5IKCM

X-ray structure of the n-terminal domain of human doublecortin in complex with fab
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
AAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAb 6H10 light chain
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 24
structure length 89
sequence length 89
chains with identical sequence N
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5ikcM00
5IO9A 2DNFA 5IOIA 1UF0A 5IN7A 5IP4D 2BQQA 1MJDA 1MFWA 5IKCM 1MG4A
chains in the Genus database with same CATH superfamily
3OLMD 1I7HA 2PKOA 1WM3A 1N60A 2JUOA 1TJEA 2W54A 1A5RA 2FE8A 5C3JB 3DDCB 3VTVA 3HVDA 3ZTDA 3AH7A 5GXGB 4L23A 4K7WA 5BYSA 2KKCA 2MH7A 1TZOA 4EE2A 4RFBA 4TQ1A 3ZUNA 2NBVB 4DXFA 2KQSA 1QLBB 2SEBD 4BAXA 1L5PA 2MQJA 1V5OA 3Q3MC 2AEHA 4DDGD 4I6LB 3AEGB 1UWXA 3ZW3A 1I35A 5I4DA 2KNBA 3VR9B 2LZ6A 1SXTA 3LJ3A 2C7HA 1RM6C 1S1QB 1UUPA 3BK1A 2M17A 4GU2A 2QHOA 4HCNB 3PO0A 2YLMA 1EM7A 2WXRA 2X8XX 2ZW0A 4B6WA 3B2FA 2L52A 3EFCA 1SBBB 1YIWA 3MJWA 3N32A 3VUWA 2MP2B 1EWCA 4G3XB 1TY2A 1BT0A 4YSZB 3NVVA 3A1QA 3H7PB 1N5XA 4NZLB 1J7BA 3AMZA 2XK5B 4HCPB 4JIOU 4B0MA 5DPWA 1JWAD 1V97A 2J52A 3EC8A 2LRUA 4LNIA 1TS3A 3T3NA 1L7YA 1JW9D 2KWUB 1AARA 4ZHPA 2Z8LA 1IP9A 1XXGA 1GAQB 1WR6E 2KHWB 2JX5A 3IVFA 1FMAD 4XX5A 1CJEA 3BK2A 2QC8A 3AEDB 1FCCC 2KDBA 2LUEA 3NZUA 4HVBA 3RD2A 1WGGA 2FCNA 4ACFA 3HVZA 1WYWB 3VQIA 3AB5A 1HXYD 2GOWA 2ZEQA 3B1LX 3Q3JA 3PZ8A 4LTUA 3V61A 4JX1C 4FXCA 4RM8A 4DBGA 1E8XA 2J42A 3U52E 4US9A 3Q3FA 1JROA 4W9EA 2WYQA 2DLBA 4E74A 2KXJA 2V1YA 3EGRA 2ZW1A 2L00B 2WXKA 4HJKA 2LWPA 4KKJA 2DNFA 1VLBA 3WA0A 2IYDB 2WX1A 1WE6A 2V4LA 1PYWD 3O65B 1WRDB 1E8ZA 3AE5B 3SU8X 3ZGZA 4DHZB 1IBXB 4WJPA 1K53A 1IPGA 3ZDTA 5BMGA 2FIDA 3VXWA 2W55A 4ICVA 2IBIB 4WWOA 3RUIB 1DOYA 1ZXHA 1R4MB 1Q0WB 2LXAA 3VAWA 1N6ZA 4CYEA 4NJ7A 1NBFC 3QQ8B 4K3CA 1DOIA 3BWUD 4A20A 2N0SB 3P42A 1UZXB 3L17A 2JVCA 1DOXA 1KOTA 4GOCA 3DHHC 2UWQA 2DYMA 2L7RA 3ONSA 2VH1A 4O1NA 2Z0DB 3OJ4B 2N1WA 3SFDB 2JF5A 1LM8B 2H89B 1SE2A 2K3UA 2BS3B 4M01A 1P9DU 4GLSC 2OEDA 4B9KA 4OZAA 3H1UA 1SB3C 3KYDD 2QIEB 4RH6A 2KT7A 2WU5B 2WX0A 2AYOB 3RMKC 2KDMA 1TKYA 1MG4A 2W3SA 2A5UA 1GB1A 4BVUC 3Q8BA 1SE4A 5JZEB 3DBRI 1H8CA 2KJ6A 2LHEA 1FIQA 1R7SA 2BW2A 3TEZA 3TEYA 5G55A 2K5PA 3E9SA 1PUTA 2HDEA 4NQKE 4JWSC 2FCQA 4WWNA 3EA6A 1JALA 2KAJA 2ZNVB 4XWTA 4ASWC 2JRHA 2VRRB 4B0EA 1KFYB 4MH0E 4C56C 1FM0D 2WP9B 4USAA 3IAS1 4YTNB 4OVUA 1A70A 4MEMA 3L0WB 1TY0A 1GC7A 3FILA 1FO4A 1WJ6A 3BINA 1MG8A 1CMXB 2UU7A 2LASA 4RMAA 2INNE 3DWMA 3A33B 1RFAA 4IM3A 1T3QA 4TSSA 3ZJTA 5BMIA 3PZDA 3VUXA 3FAHA 1D3ZA 5LNK1 1L0VB 4FBJB 1TTNA 5EDSA 1YN5A 3PVLA 2DWQA 3KVFB 3KWLA 3UF8A 3A9KB 1TS5A 1RRBA 1UH6A 2WXOA 1LFDA 3N9YC 3L4PA 1JRUA 2WXPA 3EECA 2IO2B 4EFOA 3P4PB 3OWEB 4M0WA 1YQBA 4PT5A 3WAOA 3UQAA 1NI3A 3TCAA 1SJED 4Q2JA 5HG2A 4YTMB 1D5XC 2JU6X 2WLBA 3RI7C 2NR2A 1XT9B 2CKHB 4XYCA 2KX0A 3I63C 2LRWA 3P2BA 4HPPA 2HTME 2PVOD 3KUZA 1FRDA 4JE3B 1R4NB 1XD3B 2N4FA 1OEYA 2WS3B 2DENB 1XO3A 1UGJA 1KH0A 2WDQB 4HPLB 1K50A 4FN2A 4W9JA 2K8BA 3SHQA 4IM2A 2UYZB 3GS2A 1E5WA 2LGXA 1D5MC 5EE9A 2IZVB 2W3RA 2MLBA 4FHJA 1PQSA 1WXQA 3NS1A 1C1YB 3MHSD 3MHZA 2JWUA 3APFA 3CSFA 3Q8EA 2PPHA 4H2AA 4GDLA 3NZ3A 3NVZA 4W9DA 2L83A 5G5GA 3ENEA 2E3TA 1WGHA 1UELA 3PHWB 2OOBB 1JWBD 4IW0A 3P4SB 2IDYA 2WXJA 2KJRA 5CHFA 2B76B 4IWPA 3HUIA 5D2MB 2WXQA 3SR6A 2KFKA 4RCOA 4L1BA 1FNVA 3TIXA 3W5UB 4K81A 4KDLB 3R66C 3ZLZA 3DBHI 1WI0A 1ZDXA 2LGYA 3NUHB 1UNSA 2LUMA 4MELA 1RYJA 2ACZB 2M0XA 2Q5WD 2YEPF 1SSNA 4ARCA 2BPSA 3NOBA 4GIVA 2KTFA 4C7YA 1IUEA 4BBNF 4J6IA 2KVZA 3N1XC 3JSVA 1WR1A 3BZDB 3NVWA 4PYZA 4IUMB 1EWYC 2D5GA 3AECB 4HPMB 4AQ7A 4LLGM 3ZTCA 2PTLA 3AE3B 2NCNA 3JVZX 1WJ4A 5H8YE 1QOGA 2N7JA 1DGJA 3QWZB 2WDVB 1E7VA 4LNNA 2V3SA 4NNJB 5IKCM 1I4GA 4ICUA 1G6JA 3R3MA 4N9F4 3PS6A 2FBWB 2DX5B 1N63A 3KH0A 2REXA 3DHIC 1XLNA 5TSSA 5JH5C 4LDTD 5D94A 5FK9C 2H88B 4WQMA 2K22A 2RMMA 1LO5D 2ZCBA 3AU5A 3FKYA 1P7EA 5D7GA 4ZYSA 1BUIC 1V86A 5CHWA 1F9JA 2CU1A 2G1EA 2ZZPB 3CF6E 3AEFB 3PREA 4WWPA 4EKUA 1RWSA 4ANUA 4UDUC 2VZKD 4C4VA 1FFVA 1I4QA 2BYFA 3L16A 1OQRA 2CHXA 4CHKA 3PT2B 1J19A 2NS5A 1FCLA 2MBHA 1OEYJ 3VDZA 1JMLA 3LXFA 4JPSA 1TIFA 2YEPB 2K25A 2O6VA 2CR5A 2RD0A 4XGAB 5J18A 1L0XB 2KMAA 3W2DA 1FXTB 4A3PA 3ML8A 3PRMB 4HXDA 3MC9A 1TKEA 2M56B 2FNJB 4W9FA 1KRHA 1KLUD 1KF6B 4I6NB 2LGIA 2KK8A 3DQVA 1ZP0B 1V6EA 4MGIE 2KDFB 3QX1A 1T6BX 3BVZA 3ZNHB 1OQQA 3W5VB 2FCSA 4XE0A 3HM3A 1RLFA 1E0ZA 1WJUA 3AULA 3VTWA 3W1SC 1FRRA 4C80A 2PMVA 2NBUA 2JYEA 3AE2B 4KKIA 2PJHA 4PK1A 3RNFC 3IT4B 3I5JC 2NTSA 2KJHB 4DXGA 4MGKE 5FR3A 2GBJA 2PIAA 3AXCA 3HM6X 4RNAA 4YXDB 4KGSA 2XBBC 4XZ4A 2KWCA 4AS1A 4NAMA 3WANA 3UGBB 3K9PB 2BYVE 3AEAB 3KWVA 1QOAA 2WGSA 4BKGA 4IWOA 1YQ3B 4II2B 1WXMA 1P98A 2BT6A 2D3CA 4RGNA 4WQOB 4YT0B 2WXGA 1P3QU 4LDTB 3Q8FA 1QKZA 2LGDA 2GLSA 1MVKA 2Z59B 4HLEA 4K7SA 4F1SA 4NQLB 2DYBA 3DOWA 3NS8A 3RNGC 1YD8U 4KDIC 2N7DA 3RFZB 3QJZA 3U4EG 3AE6B 1ZDVA 3W1SA 1C4CA 1JWSD 2D10A 1I4PA 3R8BA 2VZKB 1V8CA 2Y5BB 3Q3OC 2RPVA 4GDKA 3VR8B 2LJIA 4WWMA 4M0WB 2JQRB 3KQ4A 3S2AA 1L4DB 1V1PA 2L1AA 4WURA 5HI1A 4F7ZA 5LXHA 3DVGY 1ZXIA 2ON8A 3GP7A 2BQQA 2AL3A 4BBNC 2I1KA 1HTQA 4KZ0A 2QSDA 1HZ5A 2V3NA 4YWGG 5T8IA 3X23A 1ACCA 1RFKA 4RM9A 4DHJD 4M00A 3CMMB 3ECIA 1MJDA 2INCC 4C00A 4DQOC 3WALA 2BBCA 2KQ7A 2BTEA 1E10A 2KN4A 4ZRJA 4PS8A 5BO4B 3PLVA 1NYRA 1SIFA 2ZVNA 4W9LA 2N9PC 2BWES 4AP4C 1TS4A 4RF0A 2JZ3B 3Q6BA 1V49A 4HRSA 1GPXA 2EMTA 2O6VD 1YJIA 1R4MI 4II3B 3UIOB 3IFWB 1ZPSA 4GDLB 4W9KA 3OG5A 2EKIA 4FHKA 2BVCA 4ANXA 1ZUD2 2CJOA 3R7RA 3NY5A 3OJ3A 1F2RI 1NVID 3RN9C 1YMHE 3MC8A 2ONQA 4E71A 4LCDE 4P16A 2KACA 3PGEA 1PGBA 2MBQA 1I4RA 2KFKB 2N9XA 1KTKA 1HTOA 4W9HA 2CHZA 3ABVB 4ARIA 3RULA 2K6QA 3W1YA 2AQ2B 3KW5B 4AJWA 2CU3A 2DZKA 1K52A 2LEKA 3P4QB 2KZRA 2V0GA 3TL5A 2L8JA 4BKSA 2KQ4X 3Q14C 2LVOA 2L05A 5E6PA 5TR5A 5L95C 4JGHB 5C23A 3PZ7A 1L4ZB 4K7UA 3JSVB 2DYOA 4IWQA 4TUUA 3RZWC 1ZE3D 4BZAA 3Q2AC 1XLOA 1WFYA 1CQVA 5J17A 3VTUA 3H6NA 3ZJVA 2JT4B 4M8NA 4OVVA 3B0AA 3LDZE 1EU4A 2IO0B 2M1MA 2K1FA 2D07B 4RGMA 5DPTA 4KV2A 1RAXA 4A55A 3V6EB 3NHEB 1FFUA 3KUDB 3N30A 4YSXB 1D6EC 2BB5A 1TZ1A 4MT5A 5AUKA 4F8CB 2HD5B 1VJKA 2OJWA 3RPFC 2NBWB 4DHJB 1XCQL 3NJTA 2HE7A 1HZ6A 4KIKA 1F1HA 1VDVA 4LNFA 4ZHOA 4AUQC 4J3OD 2QMTA 2NPTA 3UQBA 3H7PA 2IY0B 4M8MA 4IKGA 1WJNA 4NJ6A 3NZSA 3WCQA 5C2TB 3GOEA 1HE8A 1D4BA 2WXFA 1LQBA 2QJLA 1PFDA 1E7PB 1R4NI 3VRBB 1FPYA 2O6VB 1E7UA 3VFKA 3P4RB 4WH4A 1Z2MA 2LI5A 4S17A 2N7EA 1C4PA 4YTPB 3IXSA 1HQRD 1FXAA 1SGHA 1LXDA 4JQWC 4FADA 2PE6B 4CQNA 2WXIA 3IBEA 2L3ZA 4IC7B 3APDA 4W9CA 3ZXRA 2MW5A 1C4AA 4G0NB 1Q10A 5E6OA 3ZDMC 3Q8AA 3CIRB 2C7MB 1F2RC 1CK1A 3DBSA 3T9LA 1Z5SB 3LYYA 2WDRB 3PPAA 4N58A 2IO1B 5D3DA 3DVNV 2DZMA 2VH2A 4AWJA 4W9IA 1LGRA 2R2QA 3X0WA 1SE9A 1UD7A 4MH8A 2WU2B 3DBLI 2FUHB 2BS2B 2DHZA 2KC1A 3EFUA 2LHDA 3U7ZA 3HIZA 1QT9A 1WXVA 4L2YA 2ZNVC 3IT6B 2G4DB 3DVGX 1OFFA 1JWUD 1E9MA 3DBLB 2ICIA 3M63B 1C76A 1TGZB 3U30A 1GUAB 4OW0A 3GE3C 1SEBD 3WAMA 1MPEA 2DBYA 2IY1B 4EZJA 4XDCA 4ZDVA 3L10B 3OAWA 2Y3AA 1H4RA 2L76A 4MM3A 4MDKE 2J0MA 3RNEC 2BWFA 4R3DA 2I38A 5EE1A 2Z0EB 4MJSA 1S3SG 1WMHA 2KYWA 2OJRA 3A1QB 3AN1A 1XCTL 2K8CA 4BKSD 4US8A 3PLUA 3ZYYX 3I3TB 3VH4B 2C7NB 2MJDA 3EUB2 1NDDA 1C3TA 4G50A 1F52A 2J4XA 2L32A 2MBOA 4C7ZA 1Y8RC 4JL9A 4N59A 3H9DA 2KLGA 4EZKA 3ZNZB 4FA6A 4QAYA 1E6EB 4ZRQA 1VD2A 3N1ZC 3RZFA 1V1PB 3IG3A 4K3BA 3R7QA 2J0KA 1VZ6A 3AE1B 2L0FA 1EF1A 4KSKC 1V2YA 2DAFA 2JY6A 1PGAA 2IGDA 4LJPB 4DDID 3BYYB 3AM9A 2MRPA 3Q3NC 4P1BC 2MBEA 2DAJA 2PLPA 2R61A 3BVGA 2EMSA 1T0SC 2IPKD 3ZRCA 4ZYNA 2MBBB 3LB8C 2LJ5A 5MPOA 1QOBA 3V62A 1ZW7A 1FXIA 3O13A 1VZ8A 2EKEC 5C1ZA 5HHDG 3WAPA 5IA7A 1STEA 3N1YC 1AWDA 2WWZA 1YN4A 1JWMD 3V3XA 2CJNA 5D6JB 1SIJA 2GI9A 1ZGUB 2ZJDA 5IOIA 3A9KA 4A90A 2FIFA 5AZHA 4DK5A 3AEEB 2KO3A 3QIJA 3B9JA 1WSPA 3ZRFA 1T0RC 1TBEA 1YOVB 5FKAC 1UF0A 3ZNID 2PW9A 3CWIA 1OTRB 3ZQ4A 4AJYB 1WYGA 3QHTA 3ALBA 3E56A 2N1VA 1YJ1A 2JZZA 2M19A 4PS3A 4IG7B 2W9NA 3AE7B 4KSLC 3PSEB 2LVQA 1B9RA 2C60A 4HKQA 3R2IA 1QOFA 2O2VA 3NVYA 5BYRA 3RNCC 1E90A 5DPSA 3NG0A 3Q8CA 4A3OA 3MFGA 4WJNA 1KJTA 1UGMA 4YL8A 3RNAC 3BIID 5BYQA 1I42A 1K51A 1WIAA 1I4XA 1PDXA 1DYQA 1XLQA 2XNAC 1EF5A 1NEKB 1J0GA 1TKGA 2JXXA 4MSQB 1JCKB 4P1CC 4KZCA 5L83A 2EELA 1C78A 4XC2A 1FNUA 4X57B 1WF9A 3AI5A 1VRAB 3J9CA 5HFYA 2X38A 1WGDA 1MHXA 2KOXA 3SFEB 4KGTA 3TMPB 5JHAA 1V80A 2GMIC 2R2OA 2JSVX 4RGOS 2WQYB 2PVGC 1J7AA 2CS4A 4YSYB 1WZ3A 4N6EB 2C5LC 1V9JA 1SE3A 4EEWA 3C8YA 3N3KB 1V1OA 2LMCA 3HHMA 3L08A 3FILB 4XWWA 2AQ3B 5JHBA 1WM2A 3DHGC 2ZCCA 3A9JA 3L54A 3DVNU 4MGZE 3JW0X 2D2QA 1T0YA 5J2RA 3N20C 1IYFA 3BY4B 1ZKHA 2KVRA 2W82A 3RYTA 4MSMB 5AEKB 4WJQA 4KIKB 3B2GA 3JYUA 1NI2A 3U8ZA 3UIPB 5KHQA 1GJZA 2JZPA 4HEA1 3AE8B 2V9HA 2NPTB 4NAWA 3K9OB 1SJHD 1C9FA 1J7CA 1JRPA 4BKTA 3KUCB 1OGWA 2OHFA 1Q1OA 2HJ1A 3UI3A 5H92C 1WZ0A 3C19A 2KN5A 2LD9A 1N5WA 3TSSA 1ISNA 2CHWA 2AQ1B 2PE9A 2HTHA 3KYCD 2BF8B 5BMHA 4MACA 4ITKA 2BS4B 2D3GA 2WHIA 2RDHA 3SDLC 3L13A 1WXAA 1EO6A 2IJ0A 2XEWA 1TYGB 1AYFA 3MJ5A 5AZGA 1VZ7A 4OHJA 3PRPB 1UWMA 1ET9A 4WAAA 3AE4B 2KD0A 1F77A 3ZIMA 4ZRIA 1TS2A 3Q69A 2G4SA 1KLVA 3RNBC 4FJYA 2RR9A 1XEEA 3GE8C 3WIMA 3APCA 4EUTA 1Q5WB 2KTRA 2WXLA 5EE0A 2D3AA 2ZVOA 1GC6A 3ZKJC 1U4AA 4FJVB 1J8CA 3MTNB 1T5XD 2MCNB 4EZLA 1WY8A 2QCZA 5LLIA 3VVWB 5E6JA 4A6QA 2FCMA 2WXHA 2I2YA 2GB1A 1EUVB 4S0RA 4HDOA 4WAFA 4BOSC 4MGYE 2INDC 2ZPYA 2WNMA 3DWGC 3I9V1 4IOIE 2TSSA 4TV3A 3QCAA 4LJOB 3DPDA 3VUYA 5IO9A 2DZJA 5CTRC 1PGXA 2QEJC 2AL6A 3AV8A 4MM3B 4LNOA 3MP9A 4TQ0A 3QARA 2N9KA 5DPRA 2RDBC 3B08A 4MJSB 3TUOA 2LFIA 1WMHB 2NVUI 5JXVA 4GXBA 3V60A 1YN3A 2K0PA 1MFWA 3TBLD 3M62B 4GMVA 1HA5A 2WDTB 1SF0A 4RF1A 3BVMA 3EHVA 1YQ4B 2KWVB 4REZA 1TT5B 3AU4A 2MX2A 2QILA 5CX3A 2LVPA 1UBIA 5D3IB 2FAZA 2GBRA 2QDFA 4GGQA 2JPHA 3TEWA 1GB4A 2GBKA 4DHZE 3AEBB 3C0RB 2JRIB 1YX5B 2BB6A 4HWIB 4FULA 3PHXB 4TKNA 3DBRB 1WGKA 4G11A 1N62A 1WX7A 1T0QC 1HEZE 1MI0A 4KX6B 1ENFA 4OZCA 4CO7A 1VR9A 1M4VA 1C77A 3IAM1 3A4RA 4P7IA 1FNWA 1L6VA 1AW7A 1C79A 1QILA 3V05A 3CSTA 4JWUC 3T3OA 1GG3A 2MJEA 2E6XA 4IDIA 2AX5A 2MP2A 3IHPC 2JYTA 2BGFA 3T8MA 4HKZE 3I57A 2GBNA 4GN1A 2RSUA 1ET6A 1N61A 4LNKA 5G2NA 4C4VB 2XK5A 4HJGE 4LK0M 2ASQA 2GRIA 4M02A 2KFJA 4BFRA 1YNTE 1UBQA 2NTTA 2DZIA 2J7QB 5AUIA 4EOYA 4XDDA 3TJPA 4BOZB 1BMLC 3FC4A 2IO3B 2XN9C 3AE9B 1L2NA 2HJ8A 2SAKA 3V6CB 3U2SC 2FUG1 2C9WB 1QF6A 4DWFA 2M0AA 2BKFA 3ZXVA 3A4SC 1ESFA 2RPQA 1IGCA 3ML9A 5IAAC 1WGYA 5E6NA 2JXTA 2O2VB 3RT3B 4JLCA 1P0RA 1MHHE 3GB1A 1IGDA 4P6VF 4URKA 3KLSX 2D3BA 1YX6B 4ZRKA 1V5TA 1ZOYB 3PRZA 4NJCA 4AOFA 1QZEA 1OQYA 1M94A 5FR6A 1D5ZC 4ANWA 2KMCA 1XF5L 4W9GA 2GBMA 1WRIA 4HK2A 2V4IB 3BYTB 2INPE 1NENB 4DXAB 4NY0A 3M3JA 1JQ4A 4FJZA 4OZBA 1P7FA 3SD5A 1IBXA 3ZJUA 4A8XC 4GB9A 2PEAA 1EU3A 4E3CA 4A9AA 3D32A 3HRDD 1Y56A 1GNUA 3MC0B 2M8SA 1P1AA 1QQRA 2K9XA 4KGRA 1E8YA 2G45B 3P63A 1WX8A 1L0YB 2LXCA 5G5HA 3ZVVA 1F0ZA 2KANA 1VCBA 2N9LA 3TEXA 2KDIA 3H7SA 4WIPA 1NYQA 3A9JB 2KWDA 2K6DB 3PTFC 4TMAB 4RGTA 3PV1A 3QC8B 2IGHA 2L0TA 1FD6A 1WH3A 3SEBA 2I1JA 1GOZA 2MJ3A 3QAQA 3H8HA 4I6PA 1XLPA 2KMMA 4NAWB 2BYEA 3DBHB 3DCGA 4PYUA 4GDKB 3RCZA 1AN8A 4D2KA 2V3PA 3VHTC 3M95A 1I4HA 2G3QB 2RDGA 2KLCA 3GZNI 5GMVA 2J53A 2RGFA 1L6UA 3ZO5B 2YVCA 2MSED 4PS7A 1V81A 2K39A 5IN7A 3QA8A 2Y5PA 1ROEA 3GZNB 2BKRB 2MHJA 1KLGD 1KM7A 1WXSA 5AZFA 4OVZA 1CZPA 2N9EB 4KVGB 2J0JA 2LGSA 2B3AA 4NPNA 2WXMA 1WWTA 2AWTA 4HROA 4FLHA 1B1ZA 5LXIB 3ZNGC 3UINB 1FEHA 2MEKA 1WE7A 4ZOHC 5HKHA 2Y5CA 4WJOA 3VH3B 2MA9B 2ZPNA 5KHOA 2G9HD 5IP4D 2K8HA 5CHVC 4ZRPA 1BXTA 4HDQA 3QK0A 2IGGA 4GSWA 2KTRB 3W9CB 4ANVA 4IM0A 1K8RB 3URYA 3HK0A 1YJJA 2BYTA 1WGRA 2WXNA 3NRZA 1X1MA 3U7DA 2NMQA 4B95A 3R2TA 5DCNA 3VRAB 2JWZA 2KC2A 2A4ZA 1WX9A 2KX3A 3ETRA 3P1MA 5EE3A 2D11A 1E8WA 2KDEB 2M4NA 2MWSB 1XQQA 4K1RB
chains in the Genus database with same CATH topology
5IO9A 2DNFA 5IOIA 1UF0A 5IN7A 5IP4D 2BQQA 1MJDA 1MFWA 5IKCM 1MG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IO9 A;  2DNF A;  5IOI A;  1UF0 A;  5IN7 A;  5IP4 D;  2BQQ A;  1MJD A;  1MFW A;  5IKC M;  1MG4 A; 
#chains in the Genus database with same CATH topology
 3OLM D;  1I7H A;  2PKO A;  1WM3 A;  1N60 A;  2JUO A;  1TJE A;  2W54 A;  1A5R A;  2FE8 A;  5C3J B;  3DDC B;  3VTV A;  3HVD A;  3ZTD A;  3AH7 A;  5GXG B;  4L23 A;  4K7W A;  5BYS A;  2KKC A;  2MH7 A;  1TZO A;  4EE2 A;  4RFB A;  4TQ1 A;  3ZUN A;  2NBV B;  4DXF A;  2KQS A;  1QLB B;  2SEB D;  4BAX A;  1L5P A;  2MQJ A;  1V5O A;  3Q3M C;  2AEH A;  4DDG D;  4I6L B;  3AEG B;  1UWX A;  3ZW3 A;  1I35 A;  5I4D A;  2KNB A;  3VR9 B;  2LZ6 A;  1SXT A;  3LJ3 A;  2C7H A;  1RM6 C;  1S1Q B;  1UUP A;  3BK1 A;  2M17 A;  4GU2 A;  2QHO A;  4HCN B;  3PO0 A;  2YLM A;  1EM7 A;  2WXR A;  2X8X X;  2ZW0 A;  4B6W A;  3B2F A;  2L52 A;  3EFC A;  1SBB B;  1YIW A;  3MJW A;  3N32 A;  3VUW A;  2MP2 B;  1EWC A;  4G3X B;  1TY2 A;  1BT0 A;  4YSZ B;  3NVV A;  3A1Q A;  3H7P B;  1N5X A;  4NZL B;  1J7B A;  3AMZ A;  2XK5 B;  4HCP B;  4JIO U;  4B0M A;  5DPW A;  1JWA D;  1V97 A;  2J52 A;  3EC8 A;  2LRU A;  4LNI A;  1TS3 A;  3T3N A;  1L7Y A;  1JW9 D;  2KWU B;  1AAR A;  4ZHP A;  2Z8L A;  1IP9 A;  1XXG A;  1GAQ B;  1WR6 E;  2KHW B;  2JX5 A;  3IVF A;  1FMA D;  4XX5 A;  1CJE A;  3BK2 A;  2QC8 A;  3AED B;  1FCC C;  2KDB A;  2LUE A;  3NZU A;  4HVB A;  3RD2 A;  1WGG A;  2FCN A;  4ACF A;  3HVZ A;  1WYW B;  3VQI A;  3AB5 A;  1HXY D;  2GOW A;  2ZEQ A;  3B1L X;  3Q3J A;  3PZ8 A;  4LTU A;  3V61 A;  4JX1 C;  4FXC A;  4RM8 A;  4DBG A;  1E8X A;  2J42 A;  3U52 E;  4US9 A;  3Q3F A;  1JRO A;  4W9E A;  2WYQ A;  2DLB A;  4E74 A;  2KXJ A;  2V1Y A;  3EGR A;  2ZW1 A;  2L00 B;  2WXK A;  4HJK A;  2LWP A;  4KKJ A;  2DNF A;  1VLB A;  3WA0 A;  2IYD B;  2WX1 A;  1WE6 A;  2V4L A;  1PYW D;  3O65 B;  1WRD B;  1E8Z A;  3AE5 B;  3SU8 X;  3ZGZ A;  4DHZ B;  1IBX B;  4WJP A;  1K53 A;  1IPG A;  3ZDT A;  5BMG A;  2FID A;  3VXW A;  2W55 A;  4ICV A;  2IBI B;  4WWO A;  3RUI B;  1DOY A;  1ZXH A;  1R4M B;  1Q0W B;  2LXA A;  3VAW A;  1N6Z A;  4CYE A;  4NJ7 A;  1NBF C;  3QQ8 B;  4K3C A;  1DOI A;  3BWU D;  4A20 A;  2N0S B;  3P42 A;  1UZX B;  3L17 A;  2JVC A;  1DOX A;  1KOT A;  4GOC A;  3DHH C;  2UWQ A;  2DYM A;  2L7R A;  3ONS A;  2VH1 A;  4O1N A;  2Z0D B;  3OJ4 B;  2N1W A;  3SFD B;  2JF5 A;  1LM8 B;  2H89 B;  1SE2 A;  2K3U A;  2BS3 B;  4M01 A;  1P9D U;  4GLS C;  2OED A;  4B9K A;  4OZA A;  3H1U A;  1SB3 C;  3KYD D;  2QIE B;  4RH6 A;  2KT7 A;  2WU5 B;  2WX0 A;  2AYO B;  3RMK C;  2KDM A;  1TKY A;  1MG4 A;  2W3S A;  2A5U A;  1GB1 A;  4BVU C;  3Q8B A;  1SE4 A;  5JZE B;  3DBR I;  1H8C A;  2KJ6 A;  2LHE A;  1FIQ A;  1R7S A;  2BW2 A;  3TEZ A;  3TEY A;  5G55 A;  2K5P A;  3E9S A;  1PUT A;  2HDE A;  4NQK E;  4JWS C;  2FCQ A;  4WWN A;  3EA6 A;  1JAL A;  2KAJ A;  2ZNV B;  4XWT A;  4ASW C;  2JRH A;  2VRR B;  4B0E A;  1KFY B;  4MH0 E;  4C56 C;  1FM0 D;  2WP9 B;  4USA A;  3IAS 1;  4YTN B;  4OVU A;  1A70 A;  4MEM A;  3L0W B;  1TY0 A;  1GC7 A;  3FIL A;  1FO4 A;  1WJ6 A;  3BIN A;  1MG8 A;  1CMX B;  2UU7 A;  2LAS A;  4RMA A;  2INN E;  3DWM A;  3A33 B;  1RFA A;  4IM3 A;  1T3Q A;  4TSS A;  3ZJT A;  5BMI A;  3PZD A;  3VUX A;  3FAH A;  1D3Z A;  5LNK 1;  1L0V B;  4FBJ B;  1TTN A;  5EDS A;  1YN5 A;  3PVL A;  2DWQ A;  3KVF B;  3KWL A;  3UF8 A;  3A9K B;  1TS5 A;  1RRB A;  1UH6 A;  2WXO A;  1LFD A;  3N9Y C;  3L4P A;  1JRU A;  2WXP A;  3EEC A;  2IO2 B;  4EFO A;  3P4P B;  3OWE B;  4M0W A;  1YQB A;  4PT5 A;  3WAO A;  3UQA A;  1NI3 A;  3TCA A;  1SJE D;  4Q2J A;  5HG2 A;  4YTM B;  1D5X C;  2JU6 X;  2WLB A;  3RI7 C;  2NR2 A;  1XT9 B;  2CKH B;  4XYC A;  2KX0 A;  3I63 C;  2LRW A;  3P2B A;  4HPP A;  2HTM E;  2PVO D;  3KUZ A;  1FRD A;  4JE3 B;  1R4N B;  1XD3 B;  2N4F A;  1OEY A;  2WS3 B;  2DEN B;  1XO3 A;  1UGJ A;  1KH0 A;  2WDQ B;  4HPL B;  1K50 A;  4FN2 A;  4W9J A;  2K8B A;  3SHQ A;  4IM2 A;  2UYZ B;  3GS2 A;  1E5W A;  2LGX A;  1D5M C;  5EE9 A;  2IZV B;  2W3R A;  2MLB A;  4FHJ A;  1PQS A;  1WXQ A;  3NS1 A;  1C1Y B;  3MHS D;  3MHZ A;  2JWU A;  3APF A;  3CSF A;  3Q8E A;  2PPH A;  4H2A A;  4GDL A;  3NZ3 A;  3NVZ A;  4W9D A;  2L83 A;  5G5G A;  3ENE A;  2E3T A;  1WGH A;  1UEL A;  3PHW B;  2OOB B;  1JWB D;  4IW0 A;  3P4S B;  2IDY A;  2WXJ A;  2KJR A;  5CHF A;  2B76 B;  4IWP A;  3HUI A;  5D2M B;  2WXQ A;  3SR6 A;  2KFK A;  4RCO A;  4L1B A;  1FNV A;  3TIX A;  3W5U B;  4K81 A;  4KDL B;  3R66 C;  3ZLZ A;  3DBH I;  1WI0 A;  1ZDX A;  2LGY A;  3NUH B;  1UNS A;  2LUM A;  4MEL A;  1RYJ A;  2ACZ B;  2M0X A;  2Q5W D;  2YEP F;  1SSN A;  4ARC A;  2BPS A;  3NOB A;  4GIV A;  2KTF A;  4C7Y A;  1IUE A;  4BBN F;  4J6I A;  2KVZ A;  3N1X C;  3JSV A;  1WR1 A;  3BZD B;  3NVW A;  4PYZ A;  4IUM B;  1EWY C;  2D5G A;  3AEC B;  4HPM B;  4AQ7 A;  4LLG M;  3ZTC A;  2PTL A;  3AE3 B;  2NCN A;  3JVZ X;  1WJ4 A;  5H8Y E;  1QOG A;  2N7J A;  1DGJ A;  3QWZ B;  2WDV B;  1E7V A;  4LNN A;  2V3S A;  4NNJ B;  5IKC M;  1I4G A;  4ICU A;  1G6J A;  3R3M A;  4N9F 4;  3PS6 A;  2FBW B;  2DX5 B;  1N63 A;  3KH0 A;  2REX A;  3DHI C;  1XLN A;  5TSS A;  5JH5 C;  4LDT D;  5D94 A;  5FK9 C;  2H88 B;  4WQM A;  2K22 A;  2RMM A;  1LO5 D;  2ZCB A;  3AU5 A;  3FKY A;  1P7E A;  5D7G A;  4ZYS A;  1BUI C;  1V86 A;  5CHW A;  1F9J A;  2CU1 A;  2G1E A;  2ZZP B;  3CF6 E;  3AEF B;  3PRE A;  4WWP A;  4EKU A;  1RWS A;  4ANU A;  4UDU C;  2VZK D;  4C4V A;  1FFV A;  1I4Q A;  2BYF A;  3L16 A;  1OQR A;  2CHX A;  4CHK A;  3PT2 B;  1J19 A;  2NS5 A;  1FCL A;  2MBH A;  1OEY J;  3VDZ A;  1JML A;  3LXF A;  4JPS A;  1TIF A;  2YEP B;  2K25 A;  2O6V A;  2CR5 A;  2RD0 A;  4XGA B;  5J18 A;  1L0X B;  2KMA A;  3W2D A;  1FXT B;  4A3P A;  3ML8 A;  3PRM B;  4HXD A;  3MC9 A;  1TKE A;  2M56 B;  2FNJ B;  4W9F A;  1KRH A;  1KLU D;  1KF6 B;  4I6N B;  2LGI A;  2KK8 A;  3DQV A;  1ZP0 B;  1V6E A;  4MGI E;  2KDF B;  3QX1 A;  1T6B X;  3BVZ A;  3ZNH B;  1OQQ A;  3W5V B;  2FCS A;  4XE0 A;  3HM3 A;  1RLF A;  1E0Z A;  1WJU A;  3AUL A;  3VTW A;  3W1S C;  1FRR A;  4C80 A;  2PMV A;  2NBU A;  2JYE A;  3AE2 B;  4KKI A;  2PJH A;  4PK1 A;  3RNF C;  3IT4 B;  3I5J C;  2NTS A;  2KJH B;  4DXG A;  4MGK E;  5FR3 A;  2GBJ A;  2PIA A;  3AXC A;  3HM6 X;  4RNA A;  4YXD B;  4KGS A;  2XBB C;  4XZ4 A;  2KWC A;  4AS1 A;  4NAM A;  3WAN A;  3UGB B;  3K9P B;  2BYV E;  3AEA B;  3KWV A;  1QOA A;  2WGS A;  4BKG A;  4IWO A;  1YQ3 B;  4II2 B;  1WXM A;  1P98 A;  2BT6 A;  2D3C A;  4RGN A;  4WQO B;  4YT0 B;  2WXG A;  1P3Q U;  4LDT B;  3Q8F A;  1QKZ A;  2LGD A;  2GLS A;  1MVK A;  2Z59 B;  4HLE A;  4K7S A;  4F1S A;  4NQL B;  2DYB A;  3DOW A;  3NS8 A;  3RNG C;  1YD8 U;  4KDI C;  2N7D A;  3RFZ B;  3QJZ A;  3U4E G;  3AE6 B;  1ZDV A;  3W1S A;  1C4C A;  1JWS D;  2D10 A;  1I4P A;  3R8B A;  2VZK B;  1V8C A;  2Y5B B;  3Q3O C;  2RPV A;  4GDK A;  3VR8 B;  2LJI A;  4WWM A;  4M0W B;  2JQR B;  3KQ4 A;  3S2A A;  1L4D B;  1V1P A;  2L1A A;  4WUR A;  5HI1 A;  4F7Z A;  5LXH A;  3DVG Y;  1ZXI A;  2ON8 A;  3GP7 A;  2BQQ A;  2AL3 A;  4BBN C;  2I1K A;  1HTQ A;  4KZ0 A;  2QSD A;  1HZ5 A;  2V3N A;  4YWG G;  5T8I A;  3X23 A;  1ACC A;  1RFK A;  4RM9 A;  4DHJ D;  4M00 A;  3CMM B;  3ECI A;  1MJD A;  2INC C;  4C00 A;  4DQO C;  3WAL A;  2BBC A;  2KQ7 A;  2BTE A;  1E10 A;  2KN4 A;  4ZRJ A;  4PS8 A;  5BO4 B;  3PLV A;  1NYR A;  1SIF A;  2ZVN A;  4W9L A;  2N9P C;  2BWE S;  4AP4 C;  1TS4 A;  4RF0 A;  2JZ3 B;  3Q6B A;  1V49 A;  4HRS A;  1GPX A;  2EMT A;  2O6V D;  1YJI A;  1R4M I;  4II3 B;  3UIO B;  3IFW B;  1ZPS A;  4GDL B;  4W9K A;  3OG5 A;  2EKI A;  4FHK A;  2BVC A;  4ANX A;  1ZUD 2;  2CJO A;  3R7R A;  3NY5 A;  3OJ3 A;  1F2R I;  1NVI D;  3RN9 C;  1YMH E;  3MC8 A;  2ONQ A;  4E71 A;  4LCD E;  4P16 A;  2KAC A;  3PGE A;  1PGB A;  2MBQ A;  1I4R A;  2KFK B;  2N9X A;  1KTK A;  1HTO A;  4W9H A;  2CHZ A;  3ABV B;  4ARI A;  3RUL A;  2K6Q A;  3W1Y A;  2AQ2 B;  3KW5 B;  4AJW A;  2CU3 A;  2DZK A;  1K52 A;  2LEK A;  3P4Q B;  2KZR A;  2V0G A;  3TL5 A;  2L8J A;  4BKS A;  2KQ4 X;  3Q14 C;  2LVO A;  2L05 A;  5E6P A;  5TR5 A;  5L95 C;  4JGH B;  5C23 A;  3PZ7 A;  1L4Z B;  4K7U A;  3JSV B;  2DYO A;  4IWQ A;  4TUU A;  3RZW C;  1ZE3 D;  4BZA A;  3Q2A C;  1XLO A;  1WFY A;  1CQV A;  5J17 A;  3VTU A;  3H6N A;  3ZJV A;  2JT4 B;  4M8N A;  4OVV A;  3B0A A;  3LDZ E;  1EU4 A;  2IO0 B;  2M1M A;  2K1F A;  2D07 B;  4RGM A;  5DPT A;  4KV2 A;  1RAX A;  4A55 A;  3V6E B;  3NHE B;  1FFU A;  3KUD B;  3N30 A;  4YSX B;  1D6E C;  2BB5 A;  1TZ1 A;  4MT5 A;  5AUK A;  4F8C B;  2HD5 B;  1VJK A;  2OJW A;  3RPF C;  2NBW B;  4DHJ B;  1XCQ L;  3NJT A;  2HE7 A;  1HZ6 A;  4KIK A;  1F1H A;  1VDV A;  4LNF A;  4ZHO A;  4AUQ C;  4J3O D;  2QMT A;  2NPT A;  3UQB A;  3H7P A;  2IY0 B;  4M8M A;  4IKG A;  1WJN A;  4NJ6 A;  3NZS A;  3WCQ A;  5C2T B;  3GOE A;  1HE8 A;  1D4B A;  2WXF A;  1LQB A;  2QJL A;  1PFD A;  1E7P B;  1R4N I;  3VRB B;  1FPY A;  2O6V B;  1E7U A;  3VFK A;  3P4R B;  4WH4 A;  1Z2M A;  2LI5 A;  4S17 A;  2N7E A;  1C4P A;  4YTP B;  3IXS A;  1HQR D;  1FXA A;  1SGH A;  1LXD A;  4JQW C;  4FAD A;  2PE6 B;  4CQN A;  2WXI A;  3IBE A;  2L3Z A;  4IC7 B;  3APD A;  4W9C A;  3ZXR A;  2MW5 A;  1C4A A;  4G0N B;  1Q10 A;  5E6O A;  3ZDM C;  3Q8A A;  3CIR B;  2C7M B;  1F2R C;  1CK1 A;  3DBS A;  3T9L A;  1Z5S B;  3LYY A;  2WDR B;  3PPA A;  4N58 A;  2IO1 B;  5D3D A;  3DVN V;  2DZM A;  2VH2 A;  4AWJ A;  4W9I A;  1LGR A;  2R2Q A;  3X0W A;  1SE9 A;  1UD7 A;  4MH8 A;  2WU2 B;  3DBL I;  2FUH B;  2BS2 B;  2DHZ A;  2KC1 A;  3EFU A;  2LHD A;  3U7Z A;  3HIZ A;  1QT9 A;  1WXV A;  4L2Y A;  2ZNV C;  3IT6 B;  2G4D B;  3DVG X;  1OFF A;  1JWU D;  1E9M A;  3DBL B;  2ICI A;  3M63 B;  1C76 A;  1TGZ B;  3U30 A;  1GUA B;  4OW0 A;  3GE3 C;  1SEB D;  3WAM A;  1MPE A;  2DBY A;  2IY1 B;  4EZJ A;  4XDC A;  4ZDV A;  3L10 B;  3OAW A;  2Y3A A;  1H4R A;  2L76 A;  4MM3 A;  4MDK E;  2J0M A;  3RNE C;  2BWF A;  4R3D A;  2I38 A;  5EE1 A;  2Z0E B;  4MJS A;  1S3S G;  1WMH A;  2KYW A;  2OJR A;  3A1Q B;  3AN1 A;  1XCT L;  2K8C A;  4BKS D;  4US8 A;  3PLU A;  3ZYY X;  3I3T B;  3VH4 B;  2C7N B;  2MJD A;  3EUB 2;  1NDD A;  1C3T A;  4G50 A;  1F52 A;  2J4X A;  2L32 A;  2MBO A;  4C7Z A;  1Y8R C;  4JL9 A;  4N59 A;  3H9D A;  2KLG A;  4EZK A;  3ZNZ B;  4FA6 A;  4QAY A;  1E6E B;  4ZRQ A;  1VD2 A;  3N1Z C;  3RZF A;  1V1P B;  3IG3 A;  4K3B A;  3R7Q A;  2J0K A;  1VZ6 A;  3AE1 B;  2L0F A;  1EF1 A;  4KSK C;  1V2Y A;  2DAF A;  2JY6 A;  1PGA A;  2IGD A;  4LJP B;  4DDI D;  3BYY B;  3AM9 A;  2MRP A;  3Q3N C;  4P1B C;  2MBE A;  2DAJ A;  2PLP A;  2R61 A;  3BVG A;  2EMS A;  1T0S C;  2IPK D;  3ZRC A;  4ZYN A;  2MBB B;  3LB8 C;  2LJ5 A;  5MPO A;  1QOB A;  3V62 A;  1ZW7 A;  1FXI A;  3O13 A;  1VZ8 A;  2EKE C;  5C1Z A;  5HHD G;  3WAP A;  5IA7 A;  1STE A;  3N1Y C;  1AWD A;  2WWZ A;  1YN4 A;  1JWM D;  3V3X A;  2CJN A;  5D6J B;  1SIJ A;  2GI9 A;  1ZGU B;  2ZJD A;  5IOI A;  3A9K A;  4A90 A;  2FIF A;  5AZH A;  4DK5 A;  3AEE B;  2KO3 A;  3QIJ A;  3B9J A;  1WSP A;  3ZRF A;  1T0R C;  1TBE A;  1YOV B;  5FKA C;  1UF0 A;  3ZNI D;  2PW9 A;  3CWI A;  1OTR B;  3ZQ4 A;  4AJY B;  1WYG A;  3QHT A;  3ALB A;  3E56 A;  2N1V A;  1YJ1 A;  2JZZ A;  2M19 A;  4PS3 A;  4IG7 B;  2W9N A;  3AE7 B;  4KSL C;  3PSE B;  2LVQ A;  1B9R A;  2C60 A;  4HKQ A;  3R2I A;  1QOF A;  2O2V A;  3NVY A;  5BYR A;  3RNC C;  1E90 A;  5DPS A;  3NG0 A;  3Q8C A;  4A3O A;  3MFG A;  4WJN A;  1KJT A;  1UGM A;  4YL8 A;  3RNA C;  3BII D;  5BYQ A;  1I42 A;  1K51 A;  1WIA A;  1I4X A;  1PDX A;  1DYQ A;  1XLQ A;  2XNA C;  1EF5 A;  1NEK B;  1J0G A;  1TKG A;  2JXX A;  4MSQ B;  1JCK B;  4P1C C;  4KZC A;  5L83 A;  2EEL A;  1C78 A;  4XC2 A;  1FNU A;  4X57 B;  1WF9 A;  3AI5 A;  1VRA B;  3J9C A;  5HFY A;  2X38 A;  1WGD A;  1MHX A;  2KOX A;  3SFE B;  4KGT A;  3TMP B;  5JHA A;  1V80 A;  2GMI C;  2R2O A;  2JSV X;  4RGO S;  2WQY B;  2PVG C;  1J7A A;  2CS4 A;  4YSY B;  1WZ3 A;  4N6E B;  2C5L C;  1V9J A;  1SE3 A;  4EEW A;  3C8Y A;  3N3K B;  1V1O A;  2LMC A;  3HHM A;  3L08 A;  3FIL B;  4XWW A;  2AQ3 B;  5JHB A;  1WM2 A;  3DHG C;  2ZCC A;  3A9J A;  3L54 A;  3DVN U;  4MGZ E;  3JW0 X;  2D2Q A;  1T0Y A;  5J2R A;  3N20 C;  1IYF A;  3BY4 B;  1ZKH A;  2KVR A;  2W82 A;  3RYT A;  4MSM B;  5AEK B;  4WJQ A;  4KIK B;  3B2G A;  3JYU A;  1NI2 A;  3U8Z A;  3UIP B;  5KHQ A;  1GJZ A;  2JZP A;  4HEA 1;  3AE8 B;  2V9H A;  2NPT B;  4NAW A;  3K9O B;  1SJH D;  1C9F A;  1J7C A;  1JRP A;  4BKT A;  3KUC B;  1OGW A;  2OHF A;  1Q1O A;  2HJ1 A;  3UI3 A;  5H92 C;  1WZ0 A;  3C19 A;  2KN5 A;  2LD9 A;  1N5W A;  3TSS A;  1ISN A;  2CHW A;  2AQ1 B;  2PE9 A;  2HTH A;  3KYC D;  2BF8 B;  5BMH A;  4MAC A;  4ITK A;  2BS4 B;  2D3G A;  2WHI A;  2RDH A;  3SDL C;  3L13 A;  1WXA A;  1EO6 A;  2IJ0 A;  2XEW A;  1TYG B;  1AYF A;  3MJ5 A;  5AZG A;  1VZ7 A;  4OHJ A;  3PRP B;  1UWM A;  1ET9 A;  4WAA A;  3AE4 B;  2KD0 A;  1F77 A;  3ZIM A;  4ZRI A;  1TS2 A;  3Q69 A;  2G4S A;  1KLV A;  3RNB C;  4FJY A;  2RR9 A;  1XEE A;  3GE8 C;  3WIM A;  3APC A;  4EUT A;  1Q5W B;  2KTR A;  2WXL A;  5EE0 A;  2D3A A;  2ZVO A;  1GC6 A;  3ZKJ C;  1U4A A;  4FJV B;  1J8C A;  3MTN B;  1T5X D;  2MCN B;  4EZL A;  1WY8 A;  2QCZ A;  5LLI A;  3VVW B;  5E6J A;  4A6Q A;  2FCM A;  2WXH A;  2I2Y A;  2GB1 A;  1EUV B;  4S0R A;  4HDO A;  4WAF A;  4BOS C;  4MGY E;  2IND C;  2ZPY A;  2WNM A;  3DWG C;  3I9V 1;  4IOI E;  2TSS A;  4TV3 A;  3QCA A;  4LJO B;  3DPD A;  3VUY A;  5IO9 A;  2DZJ A;  5CTR C;  1PGX A;  2QEJ C;  2AL6 A;  3AV8 A;  4MM3 B;  4LNO A;  3MP9 A;  4TQ0 A;  3QAR A;  2N9K A;  5DPR A;  2RDB C;  3B08 A;  4MJS B;  3TUO A;  2LFI A;  1WMH B;  2NVU I;  5JXV A;  4GXB A;  3V60 A;  1YN3 A;  2K0P A;  1MFW A;  3TBL D;  3M62 B;  4GMV A;  1HA5 A;  2WDT B;  1SF0 A;  4RF1 A;  3BVM A;  3EHV A;  1YQ4 B;  2KWV B;  4REZ A;  1TT5 B;  3AU4 A;  2MX2 A;  2QIL A;  5CX3 A;  2LVP A;  1UBI A;  5D3I B;  2FAZ A;  2GBR A;  2QDF A;  4GGQ A;  2JPH A;  3TEW A;  1GB4 A;  2GBK A;  4DHZ E;  3AEB B;  3C0R B;  2JRI B;  1YX5 B;  2BB6 A;  4HWI B;  4FUL A;  3PHX B;  4TKN A;  3DBR B;  1WGK A;  4G11 A;  1N62 A;  1WX7 A;  1T0Q C;  1HEZ E;  1MI0 A;  4KX6 B;  1ENF A;  4OZC A;  4CO7 A;  1VR9 A;  1M4V A;  1C77 A;  3IAM 1;  3A4R A;  4P7I A;  1FNW A;  1L6V A;  1AW7 A;  1C79 A;  1QIL A;  3V05 A;  3CST A;  4JWU C;  3T3O A;  1GG3 A;  2MJE A;  2E6X A;  4IDI A;  2AX5 A;  2MP2 A;  3IHP C;  2JYT A;  2BGF A;  3T8M A;  4HKZ E;  3I57 A;  2GBN A;  4GN1 A;  2RSU A;  1ET6 A;  1N61 A;  4LNK A;  5G2N A;  4C4V B;  2XK5 A;  4HJG E;  4LK0 M;  2ASQ A;  2GRI A;  4M02 A;  2KFJ A;  4BFR A;  1YNT E;  1UBQ A;  2NTT A;  2DZI A;  2J7Q B;  5AUI A;  4EOY A;  4XDD A;  3TJP A;  4BOZ B;  1BML C;  3FC4 A;  2IO3 B;  2XN9 C;  3AE9 B;  1L2N A;  2HJ8 A;  2SAK A;  3V6C B;  3U2S C;  2FUG 1;  2C9W B;  1QF6 A;  4DWF A;  2M0A A;  2BKF A;  3ZXV A;  3A4S C;  1ESF A;  2RPQ A;  1IGC A;  3ML9 A;  5IAA C;  1WGY A;  5E6N A;  2JXT A;  2O2V B;  3RT3 B;  4JLC A;  1P0R A;  1MHH E;  3GB1 A;  1IGD A;  4P6V F;  4URK A;  3KLS X;  2D3B A;  1YX6 B;  4ZRK A;  1V5T A;  1ZOY B;  3PRZ A;  4NJC A;  4AOF A;  1QZE A;  1OQY A;  1M94 A;  5FR6 A;  1D5Z C;  4ANW A;  2KMC A;  1XF5 L;  4W9G A;  2GBM A;  1WRI A;  4HK2 A;  2V4I B;  3BYT B;  2INP E;  1NEN B;  4DXA B;  4NY0 A;  3M3J A;  1JQ4 A;  4FJZ A;  4OZB A;  1P7F A;  3SD5 A;  1IBX A;  3ZJU A;  4A8X C;  4GB9 A;  2PEA A;  1EU3 A;  4E3C A;  4A9A A;  3D32 A;  3HRD D;  1Y56 A;  1GNU A;  3MC0 B;  2M8S A;  1P1A A;  1QQR A;  2K9X A;  4KGR A;  1E8Y A;  2G45 B;  3P63 A;  1WX8 A;  1L0Y B;  2LXC A;  5G5H A;  3ZVV A;  1F0Z A;  2KAN A;  1VCB A;  2N9L A;  3TEX A;  2KDI A;  3H7S A;  4WIP A;  1NYQ A;  3A9J B;  2KWD A;  2K6D B;  3PTF C;  4TMA B;  4RGT A;  3PV1 A;  3QC8 B;  2IGH A;  2L0T A;  1FD6 A;  1WH3 A;  3SEB A;  2I1J A;  1GOZ A;  2MJ3 A;  3QAQ A;  3H8H A;  4I6P A;  1XLP A;  2KMM A;  4NAW B;  2BYE A;  3DBH B;  3DCG A;  4PYU A;  4GDK B;  3RCZ A;  1AN8 A;  4D2K A;  2V3P A;  3VHT C;  3M95 A;  1I4H A;  2G3Q B;  2RDG A;  2KLC A;  3GZN I;  5GMV A;  2J53 A;  2RGF A;  1L6U A;  3ZO5 B;  2YVC A;  2MSE D;  4PS7 A;  1V81 A;  2K39 A;  5IN7 A;  3QA8 A;  2Y5P A;  1ROE A;  3GZN B;  2BKR B;  2MHJ A;  1KLG D;  1KM7 A;  1WXS A;  5AZF A;  4OVZ A;  1CZP A;  2N9E B;  4KVG B;  2J0J A;  2LGS A;  2B3A A;  4NPN A;  2WXM A;  1WWT A;  2AWT A;  4HRO A;  4FLH A;  1B1Z A;  5LXI B;  3ZNG C;  3UIN B;  1FEH A;  2MEK A;  1WE7 A;  4ZOH C;  5HKH A;  2Y5C A;  4WJO A;  3VH3 B;  2MA9 B;  2ZPN A;  5KHO A;  2G9H D;  5IP4 D;  2K8H A;  5CHV C;  4ZRP A;  1BXT A;  4HDQ A;  3QK0 A;  2IGG A;  4GSW A;  2KTR B;  3W9C B;  4ANV A;  4IM0 A;  1K8R B;  3URY A;  3HK0 A;  1YJJ A;  2BYT A;  1WGR A;  2WXN A;  3NRZ A;  1X1M A;  3U7D A;  2NMQ A;  4B95 A;  3R2T A;  5DCN A;  3VRA B;  2JWZ A;  2KC2 A;  2A4Z A;  1WX9 A;  2KX3 A;  3ETR A;  3P1M A;  5EE3 A;  2D11 A;  1E8W A;  2KDE B;  2M4N A;  2MWS B;  1XQQ A;  4K1R B; 
#chains in the Genus database with same CATH homology
 5IO9 A;  2DNF A;  5IOI A;  1UF0 A;  5IN7 A;  5IP4 D;  2BQQ A;  1MJD A;  1MFW A;  5IKC M;  1MG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...