5IKCM

X-ray structure of the n-terminal domain of human doublecortin in complex with fab
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
AAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MAb 6H10 light chain
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 89
sequence length 89
chains with identical sequence N
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5ikcM00
2BQQA 1MFWA 5IN7A 2DNFA 5IO9A 5IKCM 5IOIA 1MG4A 1UF0A 5IP4D 1MJDA
chains in the Genus database with same CATH superfamily
2QJLA 4MDKE 1F1HA 2DENB 1F52A 3VFKA 5C3JB 1Y56A 4MSMB 3P2BA 3ZRCA 3IG3A 2N7DA 2HD5B 2KAJA 3QHTA 2K5PA 4OW0A 3QCAA 1N5WA 3B08A 1YQBA 3BIID 2LGSA 1NI3A 1ZPSA 1Q0WB 2BT6A 2Z0DB 3BY4B 4A3PA 2ZVOA 4ICVA 3APCA 1UNSA 3AEDB 2VZKD 3UQBA 1WXVA 2ZW1A 2V4IB 4ZOHC 2IBIB 2M0XA 2MBEA 1HQRD 2MH7A 3ZXVA 2BS4B 4BAXA 3VAWA 1HA5A 2D3GA 3RNCC 1JROA 4OZBA 4DHZB 1MHXA 1FD6A 4HCNB 1HE8A 2WDTB 3RULA 1AW7A 4LNIA 1FXTB 4PS3A 1TZOA 2YLMA 3SR6A 1IBXB 3ZNHB 4WJNA 1I35A 4HVBA 2KDMA 2WXMA 2QSDA 3TCAA 3RNAC 2R61A 4HLEA 5FR6A 2INNE 4WH4A 5D94A 4HCPB 3N9YC 1P98A 5AUKA 3V6CB 1L6VA 1SBBB 4NJ6A 3SD5A 2N0SB 4JX1C 2WU5B 3KUZA 1SE3A 4GDKA 2Y5PA 3HVZA 3GE8C 2V3SA 1QILA 1XEEA 2Q5WD 1UBIA 1YMHE 5E6PA 4WAFA 2JWZA 5FKAC 4BKGA 2LJIA 3NG0A 2RD0A 4K1RB 5IAAC 4KKJA 2CU1A 1C78A 3BK1A 2KTRA 2KFKB 1ET6A 3M62B 3NRZA 2KQ7A 3IFWB 2M1MA 3L4PA 5IKCM 3TEWA 1KH0A 2N9EB 3WANA 1XD3B 4IWPA 1R4MB 1NVID 4ARIA 1FNVA 1UBQA 1WI0A 1WXAA 2WDVB 2G4DB 2WXIA 3GOEA 2JYTA 1K53A 4HWIB 3W5UB 3QX1A 1OEYJ 4MM3B 2K8BA 1HXYD 1KTKA 4M8MA 2V3PA 3A9JB 1UGJA 4N9F4 1P0RA 5EE1A 1FXIA 2FBWB 2X38A 2JSVX 3WAOA 1L4DB 2WDRB 5KHQA 2BKRB 3ZJTA 1EWCA 4C4VA 5CHVC 4CO7A 1QOAA 2X8XX 3R3MA 2XEWA 2AQ3B 3U4EG 3L17A 3R8BA 2RSUA 2BB5A 2L1AA 1L4ZB 3AM9A 1J7AA 3T9LA 4NY0A 4B0EA 1MI0A 5G5HA 3OJ3A 2BB6A 2KLCA 1C4CA 4USAA 1R7SA 1N62A 5AZGA 2UWQA 2J7QB 1LQBA 4R3DA 2HJ1A 2KWVB 2KMMA 3URYA 4AS1A 2I1JA 2ZCCA 2QCZA 3N32A 4W9LA 2LGIA 2ONQA 3PZ8A 4H2AA 4YSZB 1I4GA 1EWYC 1G6JA 2FAZA 1IPGA 3IAM1 2LVPA 2QILA 2Y5BB 1T0QC 3H6NA 3I3TB 3L10B 1PGXA 4A55A 3DBLB 2WXRA 1JWMD 4MELA 3C0RB 2PJHA 1WJ6A 2ACZB 4LJOB 3TBLD 1JCKB 2RMMA 1NENB 3PRZA 2LVOA 3NVVA 4PT5A 3QIJA 2KDEB 4N59A 2KMCA 1C9FA 4K7WA 3M63B 2MBOA 1P7EA 3ZUNA 3JW0X 1T6BX 2FCQA 3U52E 3U2SC 4KIKB 1E8ZA 2BS3B 1WY8A 2LI5A 3WAPA 3N1ZC 1C79A 3M95A 1XF5L 4MJSA 1GG3A 1TS4A 1GC7A 2WWZA 1GB1A 3BINA 2EELA 5LLIA 4UDUC 2MWSB 2JT4B 4GGQA 4OVUA 2FUHB 3AN1A 4F1SA 4DHJB 1IYFA 2DX5B 4BKSD 3E9SA 2KN4A 2WXKA 3ZO5B 4KV2A 3TEYA 5I4DA 1FNUA 2MX2A 3K9OB 4GOCA 2AWTA 3I57A 3K9PB 1L5PA 1VLBA 2KC2A 2M0AA 4TV3A 1VZ6A 2EKEC 2E3TA 3TUOA 2ZPNA 2CJOA 1J8CA 4FN2A 1YX5B 1CMXB 2KLGA 1LO5D 1BMLC 3AEBB 1UGMA 4W9EA 2H89B 3KYCD 3NZ3A 1IP9A 1JWSD 4RFBA 1V1PB 1XLPA 2G45B 2WHIA 4WWOA 1TIFA 3Q8EA 2A5UA 2JWUA 3Q3FA 1E7UA 3KLSX 3NZSA 3BWUD 3L0WB 4IC7B 2CU3A 2OHFA 1F2RI 5BO4B 2PIAA 3QJZA 2BTEA 2PE9A 4GIVA 4HEA1 1KJTA 1JWUD 4K7UA 2GBJA 2PKOA 4F8CB 1CK1A 2JUOA 2L3ZA 3APDA 1J7BA 2O2VB 1PYWD 1ZXIA 3SU8X 1HZ6A 4K7SA 2K6QA 4RGMA 1JRUA 4EZKA 1FM0D 3B9JA 2MBBB 2LRWA 3MP9A 3H7SA 2JPHA 3H7PB 3EA6A 3PHWB 4XDDA 5BMHA 2AQ1B 1V97A 1L0XB 2MP2B 4W9GA 2K0PA 3ALBA 4B95A 1RWSA 1EUVB 1E8WA 4DQOC 2WXGA 2W54A 1TGZB 4TMAB 2NMQA 3HK0A 1EF5A 1MG4A 5JZEB 2MA9B 2RDGA 1KF6B 1WJNA 3M3JA 1AN8A 4BBNC 4I6PA 3PT2B 4HPLB 1GC6A 2W55A 2KVRA 3C19A 3N1YC 3AE9B 1R4NB 2PTLA 3WCQA 3FILB 2GBNA 2KDBA 3KH0A 2HE7A 2KMAA 1LGRA 2GOWA 3L16A 3UQAA 4EZJA 3QQ8B 4OVVA 3CSFA 4IWQA 3AULA 5DPRA 2TSSA 3P4PB 3DPDA 1YJIA 2IO1B 1WRDB 1UWMA 4DDID 1F0ZA 4JLCA 4KSKC 4DWFA 2MHJA 4DXGA 3RN9C 1WXQA 3WIMA 2MJ3A 1ZE3D 4L1BA 2GRIA 4ZYSA 2L05A 4WQMA 2DZMA 2KD0A 1CQVA 4LK0M 4OZCA 3AEAB 1VCBA 1KM7A 2LHEA 3MTNB 2XK5A 1T0YA 4LDTB 2UYZB 3VVWB 3UI3A 4YT0B 1KOTA 3EC8A 1QZEA 3TL5A 4NJCA 1XLOA 1WF9A 3MJWA 4IUMB 3AE3B 1H4RA 3ZNGC 4NQLB 1WWTA 1I7HA 4A6QA 5E6JA 4DBGA 4NQKE 5D3IB 2DWQA 1SE4A 1WMHA 2IY0B 4L2YA 5D2MB 2M4NA 4XYCA 1D3ZA 2DAFA 4CHKA 5HKHA 4YTMB 2KWCA 1YQ3B 2GI9A 4NAWB 1SSNA 4HDOA 2MJDA 5LNK1 3AEEB 2KDIA 2O6VB 2QHOA 1ET9A 3AE5B 4DXFA 2ZJDA 3DHHC 4ZRIA 1SE2A 3U8ZA 2K22A 2J53A 4C00A 2V0GA 2N7JA 4TSSA 1AYFA 3AB5A 4NJ7A 1D5MC 2LGYA 4WWNA 4FJVB 5G2NA 1NYRA 3ZDTA 2RPQA 3CF6E 3PZDA 4M00A 2RDHA 4W9HA 3IBEA 2PVOD 2I38A 2LASA 2QEJC 2SEBD 2WX1A 2MRPA 4KZCA 2I1KA 4LLGM 1WGRA 4EKUA 4L23A 1YJJA 3GZNB 1D4BA 3MFGA 1WH3A 4DXAB 3P63A 3KUDB 2V4LA 3T3NA 1PDXA 3P1MA 3IT6B 5BYRA 2VH1A 2IO3B 2DYMA 5JXVA 1N63A 5IO9A 1FO4A 2G9HD 1DYQA 2LMCA 2Z0EB 1ISNA 1DGJA 1UH6A 2N4FA 4E74A 1S3SG 1TTNA 2K8HA 2FE8A 4DHZE 1C1YB 1ACCA 3TSSA 3VR8B 1ENFA 4CQNA 2LXCA 2MJEA 3LJ3A 1GNUA 2LFIA 2C7NB 2WXQA 1CZPA 3DHIC 3VUXA 1T0RC 2BGFA 2JU6X 2WXHA 3AE6B 3R2IA 4Q2JA 2FIDA 2RR9A 4ZRQA 3I5JC 4BFRA 3ZW3A 3KWVA 3VQIA 2J0MA 2L76A 2WQYB 2BYTA 2IGDA 3RYTA 2ZCBA 3Q69A 4P1CC 1OEYA 2DBYA 2OJWA 2NR2A 2NPTA 2YVCA 4URKA 1WXSA 1I4HA 1K50A 2KFJA 4RM8A 2NBVB 1V9JA 5HG2A 4W9FA 4A20A 2N7EA 2ON8A 1D5ZC 3A4SC 3DVNU 4PK1A 2GMIC 2DYOA 3W1SC 1IGDA 4YSXB 4B9KA 1E8XA 3BZDB 4MT5A 4TUUA 3AE1B 4ASWC 3TIXA 2JY6A 3Q3NC 2C60A 4BZAA 4XGAB 1L6UA 3ML8A 2G3QB 2INDC 3KVFB 1N6ZA 4WAAA 1OQYA 3ENEA 1LFDA 1UELA 1EU3A 4RGOS 1UZXB 3VTUA 1T0SC 4BOSC 5GMVA 5GXGB 1OGWA 5J17A 5IP4D 2G4SA 2DNFA 2FCSA 4GDKB 2MQJA 3OG5A 4BKTA 3DBHB 1STEA 3NVWA 3O65B 1WIAA 4P7IA 2IY1B 3SEBA 2INCC 4ICUA 3DVGY 2PMVA 1AWDA 3HM6X 3SFDB 5JHBA 2B3AA 2K6DB 4S17A 4II3B 1FCCC 4YXDB 3AI5A 1GUAB 4HKZE 2KTRB 4WJQA 3NUHB 1J0GA 3A9KA 4XWWA 1PQSA 4LDTD 2KQSA 1FFUA 3EFCA 1GB4A 4AP4C 1TKGA 1WX7A 2QDFA 2EMTA 4OHJA 3DWMA 2JQRB 2OEDA 1YJ1A 4NZLB 3DBRB 5D3DA 4ZDVA 4P16A 3PRMB 4KGSA 3V3XA 3DVGX 2D10A 2JRIB 1B9RA 1L0YB 4WQOB 4I6LB 1WM2A 1ZDXA 1NDDA 4RMAA 4ARCA 3SHQA 4FA6A 1C3TA 2KK8A 1WYGA 1Q10A 5G55A 2VH2A 3A1QA 1WX9A 1D6EC 5E6OA 4W9JA 2O6VD 1WXMA 2ZEQA 3N20C 4JQWC 2WX0A 4P1BC 5EDSA 2D3AA 3PHXB 3P4SB 1BXTA 3WALA 4YSYB 2JXXA 3N3KB 4US8A 3VUWA 1V6EA 1MJDA 4C4VB 4W9IA 4IM2A 3VTVA 4IM0A 4GN1A 1YNTE 2N9LA 1EF1A 1J19A 3LXFA 2KX0A 1XCTL 4XE0A 1V1PA 4EFOA 2V9HA 4C7ZA 1IUEA 1SJED 1V8CA 2N1VA 3V60A 5IOIA 1KLVA 5JH5C 3HRDD 4HXDA 1QOFA 3J9CA 2R2QA 2KKCA 4FBJB 4J3OD 3UINB 1AARA 4MGZE 2AX5A 1EO6A 4IW0A 2H88B 2R2OA 3ABVB 1R4MI 4FLHA 2AL6A 2I2YA 1F9JA 1HTOA 4KKIA 1BT0A 3TMPB 2WXOA 2W9NA 2CKHB 1E5WA 4DDGD 2EKIA 2PLPA 2RPVA 4GDLA 5TR5A 1N60A 2BKFA 1LXDA 4W9KA 2LRUA 3JYUA 3LYYA 2W3SA 4X57B 2L52A 4HDQA 2AYOB 5DCNA 1NBFC 1KFYB 1JWBD 4OZAA 3H7PA 2K3UA 2LGDA 2B76B 4JPSA 1UF0A 2CJNA 3CSTA 3IAS1 4EOYA 1A70A 1HEZE 3NZUA 3ZTDA 3KQ4A 4IWOA 2IO2B 4AJWA 1OQRA 4ANUA 1QF6A 3C8YA 4M0WA 3QC8B 2L8JA 2KXJA 1WX8A 5C2TB 1UUPA 5DPSA 3MC9A 4AOFA 4HK2A 1EU4A 4IDIA 3LB8C 3Q8CA 2K25A 4MJSB 3KYDD 3X23A 4E3CA 1WGYA 3PVLA 2V3NA 2WNMA 2GBRA 2KOXA 3TJPA 1DOIA 3PPAA 1KLGD 4FHJA 2BQQA 3X0WA 3PREA 4K81A 2C7MB 3ECIA 1P9DU 1RAXA 2MBHA 2IJ0A 1TS3A 1Q1OA 3OWEB 3P4QB 3DBLI 1SIFA 1FRRA 3WAMA 3BVMA 2VRRB 4ACFA 1WYWB 1P7FA 4M02A 4IG7B 1XT9B 3Q14C 4C80A 3DDCB 2YEPB 4ZHOA 1S1QB 2D11A 1SF0A 3I63C 3JSVA 4EZLA 5DPTA 3RNGC 2AQ2B 4MGYE 5AZHA 1JMLA 2NTSA 4REZA 5LXHA 2XN9C 1WFYA 2E6XA 4A90A 1FXAA 4ANXA 2ICIA 5L95C 1JRPA 4G3XB 2JZPA 2XNAC 2KWDA 1WRIA 1T3QA 3Q3MC 3PTFC 3ZVVA 3HM3A 2ZZPB 3VRAB 1VDVA 2WP9B 1ZGUB 4RM9A 3ZTCA 4ANWA 2JZ3B 3RZWC 2J0KA 2DZJA 5C23A 2FUG1 3V05A 2PPHA 3Q8AA 1ZDVA 1P1AA 1XO3A 3W5VB 1LM8B 4FXCA 4WWMA 5MPOA 5L83A 3PGEA 4MSQB 2WXPA 4C56C 4NAMA 4WIPA 2PE6B 2LUMA 3JVZX 3Q6BA 2CHXA 3AU5A 1V86A 3QAQA 1E10A 1FNWA 1H8CA 1C4AA 1WJ4A 3PS6A 2W82A 1XQQA 2L83A 2KJRA 5D6JB 5J18A 1MPEA 1Y8RC 1L2NA 2SAKA 4KDIC 1YIWA 2JF5A 3ZNID 3P4RB 1I4RA 4G50A 4HKQA 1TBEA 4J6IA 4TKNA 3GB1A 1WGHA 3VDZA 3PSEB 4HPPA 4QAYA 3QK0A 2J0JA 1QOBA 4KZ0A 4AJYB 1SE9A 3H9DA 1VJKA 5H8YE 1L0VB 3B1LX 3E56A 4G0NB 1XLNA 3H1UA 4JL9A 2QC8A 2J4XA 4KX6B 3R66C 1YD8U 3AE4B 4WURA 3WA0A 4AUQC 1YX6B 5T8IA 2LWPA 3MC8A 4BKSA 1V1OA 4BVUC 3CIRB 3R7QA 2JZZA 1I42A 3UIPB 1KRHA 1IBXA 3MHSD 1B1ZA 4PYUA 5IA7A 3Q2AC 3RZFA 2K9XA 1BUIC 2KDFB 1WR1A 4ZRKA 4S0RA 2KWUB 3KWLA 2RGFA 4CYEA 1SXTA 1RLFA 4K3BA 1V5OA 2BW2A 5E6NA 2WU2B 3AEFB 2C7HA 2A4ZA 2KTFA 5BYQA 3RPFC 2BVCA 2ZPYA 1JALA 3L08A 3I9V1 4K3CA 5IN7A 1L7YA 3ZNZB 1OFFA 2KANA 4M8NA 5TSSA 3T8MA 1FMAD 1ZOYB 2WXFA 2XK5B 2JVCA 3AE2B 2KFKA 2NBUA 2BWES 1R4NI 3NHEB 2FNJB 1V49A 3SDLC 3UGBB 2KHWB 1E7PB 3ZGZA 3EFUA 1RM6C 2L0FA 1E90A 2KO3A 3Q8FA 4N58A 5HHDG 4AQ7A 5KHOA 3RCZA 3HVDA 3BVZA 2OOBB 4DK5A 1WE6A 2G1EA 3EECA 4II2B 1WMHB 1WZ0A 3D32A 2D2QA 3CMMB 4RGTA 3W2DA 2KN5A 2L32A 3NJTA 4A3OA 3EHVA 2W3RA 3DWGC 4B6WA 3RT3B 1I4QA 1RYJA 4MM3A 5CHWA 3ZRFA 1M4VA 4XDCA 2ASQA 3IHPC 3A9JA 1RRBA 4LNFA 1FPYA 4C7YA 3ZJUA 3RD2A 4YTNB 2M17A 4JIOU 3AXCA 2ZNVB 4YWGG 3U30A 1XCQL 2FIFA 2KQ4X 1M94A 1UWXA 4E71A 4XWTA 1C76A 5AEKB 3MJ5A 2DAJA 2J42A 4TQ1A 2LXAA 1V2YA 5BMGA 1QOGA 1FRDA 3W1YA 4P6VF 2DZIA 2FCNA 4GXBA 3V61A 3IVFA 3VR9B 1E9MA 2CR5A 3H8HA 3V62A 1TY2A 2BYEA 2DHZA 4MH0E 4WJOA 3FAHA 1ROEA 2KYWA 4AWJA 2N9XA 3RNEC 1GJZA 4KGTA 4N6EB 4RF1A 4ZRPA 3RNBC 3L13A 1MHHE 1ZXHA 3VH3B 2ZNVC 3W9CB 4MGKE 4EEWA 2Y3AA 1YQ4B 4I6NB 3HUIA 2DYBA 4ZHPA 3ZYYX 1CJEA 3OJ4B 2AL3A 2D3CA 2NTTA 2AEHA 4F7ZA 1YOVB 4HROA 2INPE 5EE3A 2KNBA 4RF0A 3ZQ4A 1WZ3A 1QKZA 3AECB 3FC4A 3PLVA 4KIKA 4GB9A 1ZP0B 1YN3A 5EE0A 1SB3C 3ZDMC 3RFZB 2NPTB 3GZNI 4JE3B 4GMVA 5EE9A 3B2FA 2KVZA 1ZW7A 3DVNV 4MEMA 2LZ6A 5HI1A 2IGHA 1K51A 3Q8BA 1OQQA 4EUTA 4KSLC 4GLSC 2WDQB 3MHZA 2V1YA 2PVGC 1E7VA 4B0MA 5D7GA 1TZ1A 4XZ4A 2CS4A 3IXSA 2GLSA 2RDBC 3UIOB 4BBNF 1T5XD 1VR9A 2CHWA 2JYEA 3PZ7A 3OAWA 2KT7A 4LTUA 3GP7A 3PLUA 1C77A 2MSED 4FADA 5DPWA 3NS8A 2WXJA 2Z8LA 1TKYA 1SJHD 3HHMA 1WM3A 2N9PC 4LCDE 2QIEB 2D5GA 1HZ5A 3RMKC 3UF8A 2N1WA 1TJEA 4HJKA 2WGSA 2KJ6A 2YEPF 2K1FA 3NVZA 2K8CA 2LVQA 1KLUD 4YL8A 4XC2A 3NS1A 2C5LC 2J52A 2D07B 4MGIE 1FFVA 2NS5A 1U4AA 1K8RB 3SFEB 3PV1A 1ESFA 2K39A 2KC1A 2BBCA 1F2RC 2BPSA 1V5TA 2PEAA 2NCNA 3A9KB 4JWUC 2JRHA 2LJ5A 2GBKA 3AE7B 1VRAB 2WYQA 1SIJA 3TEZA 2LHDA 4LJPB 1Z5SB 3VRBB 4NNJB 2ZW0A 1N61A 2LUEA 2HTHA 4G11A 4US9A 5C1ZA 2O2VA 3LDZE 4W9CA 2FCMA 3AMZA 1VZ8A 2BF8B 1UD7A 3DHGC 4ZRJA 2QMTA 2WXLA 3RNFC 3A1QB 4HJGE 1Z2MA 3NOBA 5J2RA 3VUYA 1WE7A 1TKEA 3ETRA 3DBHI 3Q3JA 1WR6E 2MP2A 3CWIA 2DZKA 4PS7A 2HDEA 4ITKA 3HIZA 3U7ZA 1SEBD 1WGKA 1WGGA 4RCOA 3L54A 3ML9A 2UU7A 1TYGB 2PW9A 1WJUA 3NVYA 2M56B 3ZXRA 4KVGB 2ZVNA 1QT9A 2HJ8A 2VZKB 3AE8B 2L7RA 3ONSA 2M19A 3BYTB 1FIQA 3A4RA 2LEKA 3AEGB 3KUCB 1E8YA 3V6EB 3ZLZA 4A8XC 1J7CA 3EUB2 1TS2A 3BVGA 1YN4A 1IGCA 4D2KA 4HRSA 3DBRI 3FILA 1HTQA 3DBSA 3A33B 2KJHB 2GBMA 2L0TA 4LNNA 2MW5A 1V81A 1E6EB 4GDLB 4IOIE 2NVUI 2BS2B 5CX3A 1ZKHA 2Z59B 5BYSA 1EM7A 2IO0B 2MEKA 1GOZA 1N5XA 3ZIMA 2D3BA 4MACA 1D5XC 1PFDA 3VHTC 2JX5A 3OLMD 2IYDB 4W9DA 2JXTA 1JW9D 1I4PA 1PGAA 5AZFA 4M01A 1P3QU 4M0WB 4GSWA 1WGDA 4FULA 3EGRA 4LNOA 3N30A 1F77A 4RNAA 2WXNA 2C9WB 3MC0B 1JWAD 2LD9A 3BK2A 3VH4B 4A9AA 4NPNA 2KZRA 4GU2A 3ZKJC 1QQRA 4RGNA 1XXGA 1QLBB 4XX5A 3GS2A 2IDYA 1K52A 4ZYNA 2MCNB 4RH6A 2GB1A 3DCGA 4PS8A 4FHKA 4JWSC 3DQVA 5HFYA 1TS5A 3QWZB 2CHZA 2BWFA 5FK9C 3QARA 4JGHB 1A5RA 5FR3A 4KGRA 1TY0A 1Q5WB 3APFA 1ZUD2 1TT5B 5CHFA 2N9KA 3B0AA 1GPXA 1JQ4A 5JHAA 3PRPB 2WS3B 3AH7A 3RI7C 2OJRA 2NBWB 1GAQB 1PUTA 3BYYB 4NAWA 1RFKA 4FJZA 2MLBA 5CTRC 3JSVB 3Q3OC 1VZ7A 2O6VA 3VXWA 1WSPA 4EE2A 3S2AA 5AUIA 4ANVA 3GE3C 3AV8A 5G5GA 5BMIA 3R2TA 2IZVB 2M8SA 3FKYA 3DOWA 1NYQA 3O13A 3QA8A 3AU4A 2REXA 3T3OA 1V80A 1X1MA 4PYZA 2Y5CA 1MVKA 4TQ0A 2HTME 1E0ZA 1MFWA 2LGXA 4WJPA 2XBBC 2EMSA 2L00B 3N1XC 1MG8A 1VD2A 1FEHA 4BOZB 4FJYA 2MBQA 1I4XA 1NI2A 4LNKA 1SGHA 1YN5A 2KX3A 2DLBA 1DOYA 3NY5A 1FCLA 2BYFA 4IKGA 4IM3A 3RUIB 5LXIB 3R7RA 3B2GA 1XLQA 3KW5B 1DOXA 1NEKB 3ZJVA 4WWPA 3TEXA 2KACA 4O1NA 4YTPB 1C4PA 3PO0A 4OVZA 2BYVE 4KDLB 1OTRB 4MH8A 2IGGA 3W1SA 3P42A 3IT4B 4DHJD 2IPKD 4HPMB 1PGBA 3U7DA 5H92C 2WLBA 1RFAA 3VTWA
chains in the Genus database with same CATH topology
2BQQA 1MFWA 5IN7A 2DNFA 5IO9A 5IKCM 5IOIA 1MG4A 1UF0A 5IP4D 1MJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BQQ A;  1MFW A;  5IN7 A;  2DNF A;  5IO9 A;  5IKC M;  5IOI A;  1MG4 A;  1UF0 A;  5IP4 D;  1MJD A; 
#chains in the Genus database with same CATH topology
 2QJL A;  4MDK E;  1F1H A;  2DEN B;  1F52 A;  3VFK A;  5C3J B;  1Y56 A;  4MSM B;  3P2B A;  3ZRC A;  3IG3 A;  2N7D A;  2HD5 B;  2KAJ A;  3QHT A;  2K5P A;  4OW0 A;  3QCA A;  1N5W A;  3B08 A;  1YQB A;  3BII D;  2LGS A;  1NI3 A;  1ZPS A;  1Q0W B;  2BT6 A;  2Z0D B;  3BY4 B;  4A3P A;  2ZVO A;  4ICV A;  3APC A;  1UNS A;  3AED B;  2VZK D;  3UQB A;  1WXV A;  2ZW1 A;  2V4I B;  4ZOH C;  2IBI B;  2M0X A;  2MBE A;  1HQR D;  2MH7 A;  3ZXV A;  2BS4 B;  4BAX A;  3VAW A;  1HA5 A;  2D3G A;  3RNC C;  1JRO A;  4OZB A;  4DHZ B;  1MHX A;  1FD6 A;  4HCN B;  1HE8 A;  2WDT B;  3RUL A;  1AW7 A;  4LNI A;  1FXT B;  4PS3 A;  1TZO A;  2YLM A;  3SR6 A;  1IBX B;  3ZNH B;  4WJN A;  1I35 A;  4HVB A;  2KDM A;  2WXM A;  2QSD A;  3TCA A;  3RNA C;  2R61 A;  4HLE A;  5FR6 A;  2INN E;  4WH4 A;  5D94 A;  4HCP B;  3N9Y C;  1P98 A;  5AUK A;  3V6C B;  1L6V A;  1SBB B;  4NJ6 A;  3SD5 A;  2N0S B;  4JX1 C;  2WU5 B;  3KUZ A;  1SE3 A;  4GDK A;  2Y5P A;  3HVZ A;  3GE8 C;  2V3S A;  1QIL A;  1XEE A;  2Q5W D;  1UBI A;  1YMH E;  5E6P A;  4WAF A;  2JWZ A;  5FKA C;  4BKG A;  2LJI A;  3NG0 A;  2RD0 A;  4K1R B;  5IAA C;  4KKJ A;  2CU1 A;  1C78 A;  3BK1 A;  2KTR A;  2KFK B;  1ET6 A;  3M62 B;  3NRZ A;  2KQ7 A;  3IFW B;  2M1M A;  3L4P A;  5IKC M;  3TEW A;  1KH0 A;  2N9E B;  3WAN A;  1XD3 B;  4IWP A;  1R4M B;  1NVI D;  4ARI A;  1FNV A;  1UBQ A;  1WI0 A;  1WXA A;  2WDV B;  2G4D B;  2WXI A;  3GOE A;  2JYT A;  1K53 A;  4HWI B;  3W5U B;  3QX1 A;  1OEY J;  4MM3 B;  2K8B A;  1HXY D;  1KTK A;  4M8M A;  2V3P A;  3A9J B;  1UGJ A;  4N9F 4;  1P0R A;  5EE1 A;  1FXI A;  2FBW B;  2X38 A;  2JSV X;  3WAO A;  1L4D B;  2WDR B;  5KHQ A;  2BKR B;  3ZJT A;  1EWC A;  4C4V A;  5CHV C;  4CO7 A;  1QOA A;  2X8X X;  3R3M A;  2XEW A;  2AQ3 B;  3U4E G;  3L17 A;  3R8B A;  2RSU A;  2BB5 A;  2L1A A;  1L4Z B;  3AM9 A;  1J7A A;  3T9L A;  4NY0 A;  4B0E A;  1MI0 A;  5G5H A;  3OJ3 A;  2BB6 A;  2KLC A;  1C4C A;  4USA A;  1R7S A;  1N62 A;  5AZG A;  2UWQ A;  2J7Q B;  1LQB A;  4R3D A;  2HJ1 A;  2KWV B;  2KMM A;  3URY A;  4AS1 A;  2I1J A;  2ZCC A;  2QCZ A;  3N32 A;  4W9L A;  2LGI A;  2ONQ A;  3PZ8 A;  4H2A A;  4YSZ B;  1I4G A;  1EWY C;  1G6J A;  2FAZ A;  1IPG A;  3IAM 1;  2LVP A;  2QIL A;  2Y5B B;  1T0Q C;  3H6N A;  3I3T B;  3L10 B;  1PGX A;  4A55 A;  3DBL B;  2WXR A;  1JWM D;  4MEL A;  3C0R B;  2PJH A;  1WJ6 A;  2ACZ B;  4LJO B;  3TBL D;  1JCK B;  2RMM A;  1NEN B;  3PRZ A;  2LVO A;  3NVV A;  4PT5 A;  3QIJ A;  2KDE B;  4N59 A;  2KMC A;  1C9F A;  4K7W A;  3M63 B;  2MBO A;  1P7E A;  3ZUN A;  3JW0 X;  1T6B X;  2FCQ A;  3U52 E;  3U2S C;  4KIK B;  1E8Z A;  2BS3 B;  1WY8 A;  2LI5 A;  3WAP A;  3N1Z C;  1C79 A;  3M95 A;  1XF5 L;  4MJS A;  1GG3 A;  1TS4 A;  1GC7 A;  2WWZ A;  1GB1 A;  3BIN A;  2EEL A;  5LLI A;  4UDU C;  2MWS B;  2JT4 B;  4GGQ A;  4OVU A;  2FUH B;  3AN1 A;  4F1S A;  4DHJ B;  1IYF A;  2DX5 B;  4BKS D;  3E9S A;  2KN4 A;  2WXK A;  3ZO5 B;  4KV2 A;  3TEY A;  5I4D A;  1FNU A;  2MX2 A;  3K9O B;  4GOC A;  2AWT A;  3I57 A;  3K9P B;  1L5P A;  1VLB A;  2KC2 A;  2M0A A;  4TV3 A;  1VZ6 A;  2EKE C;  2E3T A;  3TUO A;  2ZPN A;  2CJO A;  1J8C A;  4FN2 A;  1YX5 B;  1CMX B;  2KLG A;  1LO5 D;  1BML C;  3AEB B;  1UGM A;  4W9E A;  2H89 B;  3KYC D;  3NZ3 A;  1IP9 A;  1JWS D;  4RFB A;  1V1P B;  1XLP A;  2G45 B;  2WHI A;  4WWO A;  1TIF A;  3Q8E A;  2A5U A;  2JWU A;  3Q3F A;  1E7U A;  3KLS X;  3NZS A;  3BWU D;  3L0W B;  4IC7 B;  2CU3 A;  2OHF A;  1F2R I;  5BO4 B;  2PIA A;  3QJZ A;  2BTE A;  2PE9 A;  4GIV A;  4HEA 1;  1KJT A;  1JWU D;  4K7U A;  2GBJ A;  2PKO A;  4F8C B;  1CK1 A;  2JUO A;  2L3Z A;  3APD A;  1J7B A;  2O2V B;  1PYW D;  1ZXI A;  3SU8 X;  1HZ6 A;  4K7S A;  2K6Q A;  4RGM A;  1JRU A;  4EZK A;  1FM0 D;  3B9J A;  2MBB B;  2LRW A;  3MP9 A;  3H7S A;  2JPH A;  3H7P B;  3EA6 A;  3PHW B;  4XDD A;  5BMH A;  2AQ1 B;  1V97 A;  1L0X B;  2MP2 B;  4W9G A;  2K0P A;  3ALB A;  4B95 A;  1RWS A;  1EUV B;  1E8W A;  4DQO C;  2WXG A;  2W54 A;  1TGZ B;  4TMA B;  2NMQ A;  3HK0 A;  1EF5 A;  1MG4 A;  5JZE B;  2MA9 B;  2RDG A;  1KF6 B;  1WJN A;  3M3J A;  1AN8 A;  4BBN C;  4I6P A;  3PT2 B;  4HPL B;  1GC6 A;  2W55 A;  2KVR A;  3C19 A;  3N1Y C;  3AE9 B;  1R4N B;  2PTL A;  3WCQ A;  3FIL B;  2GBN A;  2KDB A;  3KH0 A;  2HE7 A;  2KMA A;  1LGR A;  2GOW A;  3L16 A;  3UQA A;  4EZJ A;  3QQ8 B;  4OVV A;  3CSF A;  4IWQ A;  3AUL A;  5DPR A;  2TSS A;  3P4P B;  3DPD A;  1YJI A;  2IO1 B;  1WRD B;  1UWM A;  4DDI D;  1F0Z A;  4JLC A;  4KSK C;  4DWF A;  2MHJ A;  4DXG A;  3RN9 C;  1WXQ A;  3WIM A;  2MJ3 A;  1ZE3 D;  4L1B A;  2GRI A;  4ZYS A;  2L05 A;  4WQM A;  2DZM A;  2KD0 A;  1CQV A;  4LK0 M;  4OZC A;  3AEA B;  1VCB A;  1KM7 A;  2LHE A;  3MTN B;  2XK5 A;  1T0Y A;  4LDT B;  2UYZ B;  3VVW B;  3UI3 A;  4YT0 B;  1KOT A;  3EC8 A;  1QZE A;  3TL5 A;  4NJC A;  1XLO A;  1WF9 A;  3MJW A;  4IUM B;  3AE3 B;  1H4R A;  3ZNG C;  4NQL B;  1WWT A;  1I7H A;  4A6Q A;  5E6J A;  4DBG A;  4NQK E;  5D3I B;  2DWQ A;  1SE4 A;  1WMH A;  2IY0 B;  4L2Y A;  5D2M B;  2M4N A;  4XYC A;  1D3Z A;  2DAF A;  4CHK A;  5HKH A;  4YTM B;  2KWC A;  1YQ3 B;  2GI9 A;  4NAW B;  1SSN A;  4HDO A;  2MJD A;  5LNK 1;  3AEE B;  2KDI A;  2O6V B;  2QHO A;  1ET9 A;  3AE5 B;  4DXF A;  2ZJD A;  3DHH C;  4ZRI A;  1SE2 A;  3U8Z A;  2K22 A;  2J53 A;  4C00 A;  2V0G A;  2N7J A;  4TSS A;  1AYF A;  3AB5 A;  4NJ7 A;  1D5M C;  2LGY A;  4WWN A;  4FJV B;  5G2N A;  1NYR A;  3ZDT A;  2RPQ A;  3CF6 E;  3PZD A;  4M00 A;  2RDH A;  4W9H A;  3IBE A;  2PVO D;  2I38 A;  2LAS A;  2QEJ C;  2SEB D;  2WX1 A;  2MRP A;  4KZC A;  2I1K A;  4LLG M;  1WGR A;  4EKU A;  4L23 A;  1YJJ A;  3GZN B;  1D4B A;  3MFG A;  1WH3 A;  4DXA B;  3P63 A;  3KUD B;  2V4L A;  3T3N A;  1PDX A;  3P1M A;  3IT6 B;  5BYR A;  2VH1 A;  2IO3 B;  2DYM A;  5JXV A;  1N63 A;  5IO9 A;  1FO4 A;  2G9H D;  1DYQ A;  2LMC A;  2Z0E B;  1ISN A;  1DGJ A;  1UH6 A;  2N4F A;  4E74 A;  1S3S G;  1TTN A;  2K8H A;  2FE8 A;  4DHZ E;  1C1Y B;  1ACC A;  3TSS A;  3VR8 B;  1ENF A;  4CQN A;  2LXC A;  2MJE A;  3LJ3 A;  1GNU A;  2LFI A;  2C7N B;  2WXQ A;  1CZP A;  3DHI C;  3VUX A;  1T0R C;  2BGF A;  2JU6 X;  2WXH A;  3AE6 B;  3R2I A;  4Q2J A;  2FID A;  2RR9 A;  4ZRQ A;  3I5J C;  4BFR A;  3ZW3 A;  3KWV A;  3VQI A;  2J0M A;  2L76 A;  2WQY B;  2BYT A;  2IGD A;  3RYT A;  2ZCB A;  3Q69 A;  4P1C C;  1OEY A;  2DBY A;  2OJW A;  2NR2 A;  2NPT A;  2YVC A;  4URK A;  1WXS A;  1I4H A;  1K50 A;  2KFJ A;  4RM8 A;  2NBV B;  1V9J A;  5HG2 A;  4W9F A;  4A20 A;  2N7E A;  2ON8 A;  1D5Z C;  3A4S C;  3DVN U;  4PK1 A;  2GMI C;  2DYO A;  3W1S C;  1IGD A;  4YSX B;  4B9K A;  1E8X A;  3BZD B;  4MT5 A;  4TUU A;  3AE1 B;  4ASW C;  3TIX A;  2JY6 A;  3Q3N C;  2C60 A;  4BZA A;  4XGA B;  1L6U A;  3ML8 A;  2G3Q B;  2IND C;  3KVF B;  1N6Z A;  4WAA A;  1OQY A;  3ENE A;  1LFD A;  1UEL A;  1EU3 A;  4RGO S;  1UZX B;  3VTU A;  1T0S C;  4BOS C;  5GMV A;  5GXG B;  1OGW A;  5J17 A;  5IP4 D;  2G4S A;  2DNF A;  2FCS A;  4GDK B;  2MQJ A;  3OG5 A;  4BKT A;  3DBH B;  1STE A;  3NVW A;  3O65 B;  1WIA A;  4P7I A;  2IY1 B;  3SEB A;  2INC C;  4ICU A;  3DVG Y;  2PMV A;  1AWD A;  3HM6 X;  3SFD B;  5JHB A;  2B3A A;  2K6D B;  4S17 A;  4II3 B;  1FCC C;  4YXD B;  3AI5 A;  1GUA B;  4HKZ E;  2KTR B;  4WJQ A;  3NUH B;  1J0G A;  3A9K A;  4XWW A;  1PQS A;  4LDT D;  2KQS A;  1FFU A;  3EFC A;  1GB4 A;  4AP4 C;  1TKG A;  1WX7 A;  2QDF A;  2EMT A;  4OHJ A;  3DWM A;  2JQR B;  2OED A;  1YJ1 A;  4NZL B;  3DBR B;  5D3D A;  4ZDV A;  4P16 A;  3PRM B;  4KGS A;  3V3X A;  3DVG X;  2D10 A;  2JRI B;  1B9R A;  1L0Y B;  4WQO B;  4I6L B;  1WM2 A;  1ZDX A;  1NDD A;  4RMA A;  4ARC A;  3SHQ A;  4FA6 A;  1C3T A;  2KK8 A;  1WYG A;  1Q10 A;  5G55 A;  2VH2 A;  3A1Q A;  1WX9 A;  1D6E C;  5E6O A;  4W9J A;  2O6V D;  1WXM A;  2ZEQ A;  3N20 C;  4JQW C;  2WX0 A;  4P1B C;  5EDS A;  2D3A A;  3PHX B;  3P4S B;  1BXT A;  3WAL A;  4YSY B;  2JXX A;  3N3K B;  4US8 A;  3VUW A;  1V6E A;  1MJD A;  4C4V B;  4W9I A;  4IM2 A;  3VTV A;  4IM0 A;  4GN1 A;  1YNT E;  2N9L A;  1EF1 A;  1J19 A;  3LXF A;  2KX0 A;  1XCT L;  4XE0 A;  1V1P A;  4EFO A;  2V9H A;  4C7Z A;  1IUE A;  1SJE D;  1V8C A;  2N1V A;  3V60 A;  5IOI A;  1KLV A;  5JH5 C;  3HRD D;  4HXD A;  1QOF A;  3J9C A;  2R2Q A;  2KKC A;  4FBJ B;  4J3O D;  3UIN B;  1AAR A;  4MGZ E;  2AX5 A;  1EO6 A;  4IW0 A;  2H88 B;  2R2O A;  3ABV B;  1R4M I;  4FLH A;  2AL6 A;  2I2Y A;  1F9J A;  1HTO A;  4KKI A;  1BT0 A;  3TMP B;  2WXO A;  2W9N A;  2CKH B;  1E5W A;  4DDG D;  2EKI A;  2PLP A;  2RPV A;  4GDL A;  5TR5 A;  1N60 A;  2BKF A;  1LXD A;  4W9K A;  2LRU A;  3JYU A;  3LYY A;  2W3S A;  4X57 B;  2L52 A;  4HDQ A;  2AYO B;  5DCN A;  1NBF C;  1KFY B;  1JWB D;  4OZA A;  3H7P A;  2K3U A;  2LGD A;  2B76 B;  4JPS A;  1UF0 A;  2CJN A;  3CST A;  3IAS 1;  4EOY A;  1A70 A;  1HEZ E;  3NZU A;  3ZTD A;  3KQ4 A;  4IWO A;  2IO2 B;  4AJW A;  1OQR A;  4ANU A;  1QF6 A;  3C8Y A;  4M0W A;  3QC8 B;  2L8J A;  2KXJ A;  1WX8 A;  5C2T B;  1UUP A;  5DPS A;  3MC9 A;  4AOF A;  4HK2 A;  1EU4 A;  4IDI A;  3LB8 C;  3Q8C A;  2K25 A;  4MJS B;  3KYD D;  3X23 A;  4E3C A;  1WGY A;  3PVL A;  2V3N A;  2WNM A;  2GBR A;  2KOX A;  3TJP A;  1DOI A;  3PPA A;  1KLG D;  4FHJ A;  2BQQ A;  3X0W A;  3PRE A;  4K81 A;  2C7M B;  3ECI A;  1P9D U;  1RAX A;  2MBH A;  2IJ0 A;  1TS3 A;  1Q1O A;  3OWE B;  3P4Q B;  3DBL I;  1SIF A;  1FRR A;  3WAM A;  3BVM A;  2VRR B;  4ACF A;  1WYW B;  1P7F A;  4M02 A;  4IG7 B;  1XT9 B;  3Q14 C;  4C80 A;  3DDC B;  2YEP B;  4ZHO A;  1S1Q B;  2D11 A;  1SF0 A;  3I63 C;  3JSV A;  4EZL A;  5DPT A;  3RNG C;  2AQ2 B;  4MGY E;  5AZH A;  1JML A;  2NTS A;  4REZ A;  5LXH A;  2XN9 C;  1WFY A;  2E6X A;  4A90 A;  1FXA A;  4ANX A;  2ICI A;  5L95 C;  1JRP A;  4G3X B;  2JZP A;  2XNA C;  2KWD A;  1WRI A;  1T3Q A;  3Q3M C;  3PTF C;  3ZVV A;  3HM3 A;  2ZZP B;  3VRA B;  1VDV A;  2WP9 B;  1ZGU B;  4RM9 A;  3ZTC A;  4ANW A;  2JZ3 B;  3RZW C;  2J0K A;  2DZJ A;  5C23 A;  2FUG 1;  3V05 A;  2PPH A;  3Q8A A;  1ZDV A;  1P1A A;  1XO3 A;  3W5V B;  1LM8 B;  4FXC A;  4WWM A;  5MPO A;  5L83 A;  3PGE A;  4MSQ B;  2WXP A;  4C56 C;  4NAM A;  4WIP A;  2PE6 B;  2LUM A;  3JVZ X;  3Q6B A;  2CHX A;  3AU5 A;  1V86 A;  3QAQ A;  1E10 A;  1FNW A;  1H8C A;  1C4A A;  1WJ4 A;  3PS6 A;  2W82 A;  1XQQ A;  2L83 A;  2KJR A;  5D6J B;  5J18 A;  1MPE A;  1Y8R C;  1L2N A;  2SAK A;  4KDI C;  1YIW A;  2JF5 A;  3ZNI D;  3P4R B;  1I4R A;  4G50 A;  4HKQ A;  1TBE A;  4J6I A;  4TKN A;  3GB1 A;  1WGH A;  3VDZ A;  3PSE B;  4HPP A;  4QAY A;  3QK0 A;  2J0J A;  1QOB A;  4KZ0 A;  4AJY B;  1SE9 A;  3H9D A;  1VJK A;  5H8Y E;  1L0V B;  3B1L X;  3E56 A;  4G0N B;  1XLN A;  3H1U A;  4JL9 A;  2QC8 A;  2J4X A;  4KX6 B;  3R66 C;  1YD8 U;  3AE4 B;  4WUR A;  3WA0 A;  4AUQ C;  1YX6 B;  5T8I A;  2LWP A;  3MC8 A;  4BKS A;  1V1O A;  4BVU C;  3CIR B;  3R7Q A;  2JZZ A;  1I42 A;  3UIP B;  1KRH A;  1IBX A;  3MHS D;  1B1Z A;  4PYU A;  5IA7 A;  3Q2A C;  3RZF A;  2K9X A;  1BUI C;  2KDF B;  1WR1 A;  4ZRK A;  4S0R A;  2KWU B;  3KWL A;  2RGF A;  4CYE A;  1SXT A;  1RLF A;  4K3B A;  1V5O A;  2BW2 A;  5E6N A;  2WU2 B;  3AEF B;  2C7H A;  2A4Z A;  2KTF A;  5BYQ A;  3RPF C;  2BVC A;  2ZPY A;  1JAL A;  3L08 A;  3I9V 1;  4K3C A;  5IN7 A;  1L7Y A;  3ZNZ B;  1OFF A;  2KAN A;  4M8N A;  5TSS A;  3T8M A;  1FMA D;  1ZOY B;  2WXF A;  2XK5 B;  2JVC A;  3AE2 B;  2KFK A;  2NBU A;  2BWE S;  1R4N I;  3NHE B;  2FNJ B;  1V49 A;  3SDL C;  3UGB B;  2KHW B;  1E7P B;  3ZGZ A;  3EFU A;  1RM6 C;  2L0F A;  1E90 A;  2KO3 A;  3Q8F A;  4N58 A;  5HHD G;  4AQ7 A;  5KHO A;  3RCZ A;  3HVD A;  3BVZ A;  2OOB B;  4DK5 A;  1WE6 A;  2G1E A;  3EEC A;  4II2 B;  1WMH B;  1WZ0 A;  3D32 A;  2D2Q A;  3CMM B;  4RGT A;  3W2D A;  2KN5 A;  2L32 A;  3NJT A;  4A3O A;  3EHV A;  2W3R A;  3DWG C;  4B6W A;  3RT3 B;  1I4Q A;  1RYJ A;  4MM3 A;  5CHW A;  3ZRF A;  1M4V A;  4XDC A;  2ASQ A;  3IHP C;  3A9J A;  1RRB A;  4LNF A;  1FPY A;  4C7Y A;  3ZJU A;  3RD2 A;  4YTN B;  2M17 A;  4JIO U;  3AXC A;  2ZNV B;  4YWG G;  3U30 A;  1XCQ L;  2FIF A;  2KQ4 X;  1M94 A;  1UWX A;  4E71 A;  4XWT A;  1C76 A;  5AEK B;  3MJ5 A;  2DAJ A;  2J42 A;  4TQ1 A;  2LXA A;  1V2Y A;  5BMG A;  1QOG A;  1FRD A;  3W1Y A;  4P6V F;  2DZI A;  2FCN A;  4GXB A;  3V61 A;  3IVF A;  3VR9 B;  1E9M A;  2CR5 A;  3H8H A;  3V62 A;  1TY2 A;  2BYE A;  2DHZ A;  4MH0 E;  4WJO A;  3FAH A;  1ROE A;  2KYW A;  4AWJ A;  2N9X A;  3RNE C;  1GJZ A;  4KGT A;  4N6E B;  4RF1 A;  4ZRP A;  3RNB C;  3L13 A;  1MHH E;  1ZXH A;  3VH3 B;  2ZNV C;  3W9C B;  4MGK E;  4EEW A;  2Y3A A;  1YQ4 B;  4I6N B;  3HUI A;  2DYB A;  4ZHP A;  3ZYY X;  1CJE A;  3OJ4 B;  2AL3 A;  2D3C A;  2NTT A;  2AEH A;  4F7Z A;  1YOV B;  4HRO A;  2INP E;  5EE3 A;  2KNB A;  4RF0 A;  3ZQ4 A;  1WZ3 A;  1QKZ A;  3AEC B;  3FC4 A;  3PLV A;  4KIK A;  4GB9 A;  1ZP0 B;  1YN3 A;  5EE0 A;  1SB3 C;  3ZDM C;  3RFZ B;  2NPT B;  3GZN I;  4JE3 B;  4GMV A;  5EE9 A;  3B2F A;  2KVZ A;  1ZW7 A;  3DVN V;  4MEM A;  2LZ6 A;  5HI1 A;  2IGH A;  1K51 A;  3Q8B A;  1OQQ A;  4EUT A;  4KSL C;  4GLS C;  2WDQ B;  3MHZ A;  2V1Y A;  2PVG C;  1E7V A;  4B0M A;  5D7G A;  1TZ1 A;  4XZ4 A;  2CS4 A;  3IXS A;  2GLS A;  2RDB C;  3UIO B;  4BBN F;  1T5X D;  1VR9 A;  2CHW A;  2JYE A;  3PZ7 A;  3OAW A;  2KT7 A;  4LTU A;  3GP7 A;  3PLU A;  1C77 A;  2MSE D;  4FAD A;  5DPW A;  3NS8 A;  2WXJ A;  2Z8L A;  1TKY A;  1SJH D;  3HHM A;  1WM3 A;  2N9P C;  4LCD E;  2QIE B;  2D5G A;  1HZ5 A;  3RMK C;  3UF8 A;  2N1W A;  1TJE A;  4HJK A;  2WGS A;  2KJ6 A;  2YEP F;  2K1F A;  3NVZ A;  2K8C A;  2LVQ A;  1KLU D;  4YL8 A;  4XC2 A;  3NS1 A;  2C5L C;  2J52 A;  2D07 B;  4MGI E;  1FFV A;  2NS5 A;  1U4A A;  1K8R B;  3SFE B;  3PV1 A;  1ESF A;  2K39 A;  2KC1 A;  2BBC A;  1F2R C;  2BPS A;  1V5T A;  2PEA A;  2NCN A;  3A9K B;  4JWU C;  2JRH A;  2LJ5 A;  2GBK A;  3AE7 B;  1VRA B;  2WYQ A;  1SIJ A;  3TEZ A;  2LHD A;  4LJP B;  1Z5S B;  3VRB B;  4NNJ B;  2ZW0 A;  1N61 A;  2LUE A;  2HTH A;  4G11 A;  4US9 A;  5C1Z A;  2O2V A;  3LDZ E;  4W9C A;  2FCM A;  3AMZ A;  1VZ8 A;  2BF8 B;  1UD7 A;  3DHG C;  4ZRJ A;  2QMT A;  2WXL A;  3RNF C;  3A1Q B;  4HJG E;  1Z2M A;  3NOB A;  5J2R A;  3VUY A;  1WE7 A;  1TKE A;  3ETR A;  3DBH I;  3Q3J A;  1WR6 E;  2MP2 A;  3CWI A;  2DZK A;  4PS7 A;  2HDE A;  4ITK A;  3HIZ A;  3U7Z A;  1SEB D;  1WGK A;  1WGG A;  4RCO A;  3L54 A;  3ML9 A;  2UU7 A;  1TYG B;  2PW9 A;  1WJU A;  3NVY A;  2M56 B;  3ZXR A;  4KVG B;  2ZVN A;  1QT9 A;  2HJ8 A;  2VZK B;  3AE8 B;  2L7R A;  3ONS A;  2M19 A;  3BYT B;  1FIQ A;  3A4R A;  2LEK A;  3AEG B;  3KUC B;  1E8Y A;  3V6E B;  3ZLZ A;  4A8X C;  1J7C A;  3EUB 2;  1TS2 A;  3BVG A;  1YN4 A;  1IGC A;  4D2K A;  4HRS A;  3DBR I;  3FIL A;  1HTQ A;  3DBS A;  3A33 B;  2KJH B;  2GBM A;  2L0T A;  4LNN A;  2MW5 A;  1V81 A;  1E6E B;  4GDL B;  4IOI E;  2NVU I;  2BS2 B;  5CX3 A;  1ZKH A;  2Z59 B;  5BYS A;  1EM7 A;  2IO0 B;  2MEK A;  1GOZ A;  1N5X A;  3ZIM A;  2D3B A;  4MAC A;  1D5X C;  1PFD A;  3VHT C;  2JX5 A;  3OLM D;  2IYD B;  4W9D A;  2JXT A;  1JW9 D;  1I4P A;  1PGA A;  5AZF A;  4M01 A;  1P3Q U;  4M0W B;  4GSW A;  1WGD A;  4FUL A;  3EGR A;  4LNO A;  3N30 A;  1F77 A;  4RNA A;  2WXN A;  2C9W B;  3MC0 B;  1JWA D;  2LD9 A;  3BK2 A;  3VH4 B;  4A9A A;  4NPN A;  2KZR A;  4GU2 A;  3ZKJ C;  1QQR A;  4RGN A;  1XXG A;  1QLB B;  4XX5 A;  3GS2 A;  2IDY A;  1K52 A;  4ZYN A;  2MCN B;  4RH6 A;  2GB1 A;  3DCG A;  4PS8 A;  4FHK A;  4JWS C;  3DQV A;  5HFY A;  1TS5 A;  3QWZ B;  2CHZ A;  2BWF A;  5FK9 C;  3QAR A;  4JGH B;  1A5R A;  5FR3 A;  4KGR A;  1TY0 A;  1Q5W B;  3APF A;  1ZUD 2;  1TT5 B;  5CHF A;  2N9K A;  3B0A A;  1GPX A;  1JQ4 A;  5JHA A;  3PRP B;  2WS3 B;  3AH7 A;  3RI7 C;  2OJR A;  2NBW B;  1GAQ B;  1PUT A;  3BYY B;  4NAW A;  1RFK A;  4FJZ A;  2MLB A;  5CTR C;  3JSV B;  3Q3O C;  1VZ7 A;  2O6V A;  3VXW A;  1WSP A;  4EE2 A;  3S2A A;  5AUI A;  4ANV A;  3GE3 C;  3AV8 A;  5G5G A;  5BMI A;  3R2T A;  2IZV B;  2M8S A;  3FKY A;  3DOW A;  1NYQ A;  3O13 A;  3QA8 A;  3AU4 A;  2REX A;  3T3O A;  1V80 A;  1X1M A;  4PYZ A;  2Y5C A;  1MVK A;  4TQ0 A;  2HTM E;  1E0Z A;  1MFW A;  2LGX A;  4WJP A;  2XBB C;  2EMS A;  2L00 B;  3N1X C;  1MG8 A;  1VD2 A;  1FEH A;  4BOZ B;  4FJY A;  2MBQ A;  1I4X A;  1NI2 A;  4LNK A;  1SGH A;  1YN5 A;  2KX3 A;  2DLB A;  1DOY A;  3NY5 A;  1FCL A;  2BYF A;  4IKG A;  4IM3 A;  3RUI B;  5LXI B;  3R7R A;  3B2G A;  1XLQ A;  3KW5 B;  1DOX A;  1NEK B;  3ZJV A;  4WWP A;  3TEX A;  2KAC A;  4O1N A;  4YTP B;  1C4P A;  3PO0 A;  4OVZ A;  2BYV E;  4KDL B;  1OTR B;  4MH8 A;  2IGG A;  3W1S A;  3P42 A;  3IT4 B;  4DHJ D;  2IPK D;  4HPM B;  1PGB A;  3U7D A;  5H92 C;  2WLB A;  1RFA A;  3VTW A; 
#chains in the Genus database with same CATH homology
 2BQQ A;  1MFW A;  5IN7 A;  2DNF A;  5IO9 A;  5IKC M;  5IOI A;  1MG4 A;  1UF0 A;  5IP4 D;  1MJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...