2GBMA

Crystal structure of the 35-36 8 glycine insertion mutant of ubiquitin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGGGGGGGGGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gbmA00
2NBVB 2RSUA 2M17A 3A9KA 2A4ZA 3DPDA 3IBEA 4FBJB 2PE6B 4FHJA 1I35A 2KWUB 1EF1A 1E8WA 1AARA 4NJ7A 2BWFA 2WDTB 1R4NI 2JUOA 1V5TA 4BVUC 2HE7A 3DVGX 3APFA 4WJNA 2CHXA 3VAWA 2UYZB 3A1QB 4TQ1A 3U7DA 2N7DA 2G45B 3DBLI 2GMIC 4YL8A 2XK5A 4WJPA 2O6VD 3QJZA 5CTRC 3ZUNA 2N7EA 1Q1OA 2KNBA 2ZNVB 4KZ0A 3RUIB 4B95A 3DCGA 3UQAA 1WE7A 1GC6A 1ZW7A 4FJYA 4DHZB 2KDFB 1L7YA 4AUQC 3ONSA 3ZTDA 4CO7A 4HVBA 2KOXA 1NDDA 3UINB 2I1JA 3QX1A 3P2BA 2FUHB 4NQKE 3T9LA 2ASQA 2KWCA 3SHQA 1WR6E 3KUDB 2L00B 3WAPA 1WXMA 3QIJA 2FIFA 4EEWA 4IM3A 3PRZA 1WZ0A 2J7QB 2KZRA 4HLEA 2DENB 1WF9A 3X23A 3WAMA 3VUYA 3A4SC 2KJRA 3H7PA 4BBNF 2G3QB 5J2RA 2NBWB 5GMVA 1XT9B 3A4RA 2JF5A 4WWOA 1YD8U 2K6QA 2DZKA 2DZIA 2XK5B 2MBQA 3HHMA 1V2YA 4AJWA 2Z0DB 3CSTA 2LGDA 2MRPA 2KX0A 1P1AA 1WXAA 3A9KB 2KD0A 3HM6X 2KWVB 1UBIA 1NBFC 3PT2B 5DPSA 3NZUA 4ANXA 1V6EA 4KSLC 2KX3A 2O2VB 2ZJDA 3KUZA 3K9PB 2AL6A 2ZNVC 5G2NA 3N30A 4KIKB 2FNJB 3AU5A 3EECA 2FCNA 3PTFC 1NI2A 1WZ3A 2O6VB 2DX5B 2LRUA 2PPHA 3TIXA 5D2MB 1WMHB 2BWES 3I3TB 4HWIB 4WJQA 3RZFA 3JVZX 4E74A 3N32A 2L76A 3QWZB 4M8NA 3B1LX 2Z0EB 1YX6B 1ISNA 1C3TA 2B3AA 4I6LB 3AU4A 4MJSA 2K8BA 2MBHA 2DYBA 4NAWA 1VD2A 4GDLB 1YX5B 2KMAA 1P98A 4PS7A 4XX5A 2V4LA 3H7SA 1WXVA 1WE6A 4HDQA 1V49A 1Z2MA 1LQBA 1T0YA 3QHTA 1RAXA 2JZZA 1WJNA 2KXJA 3JYUA 1RLFA 2KO3A 4JIOU 3SD5A 1WGGA 3MJWA 3WALA 2DAFA 2MBEA 4IUMB 4LJPB 5JHBA 4F1SA 4BKTA 5G55A 3APDA 1WFYA 4RMAA 2ZCBA 2OOBB 4NY0A 3VFKA 4GDKA 4B9KA 4E71A 4FHKA 3IG3A 1R4MI 4TV3A 4WAAA 1UGMA 4KDLB 3VTVA 2CKHB 1WGHA 4IWPA 5DPTA 2MWSB 2C7NB 3DQVA 2LD9A 3RCZA 4I6PA 1E8XA 2G4SA 1EF5A 3HIZA 2PE9A 3ZNZB 4BOSC 2ZZPB 2DHZA 3H9DA 4GGQA 1YIWA 3W1SC 3L16A 3JSVA 2HD5B 3VDZA 5CHFA 4AJYB 3L17A 5E6NA 1UD7A 2ZVNA 3BY4B 2KVRA 3NY5A 3VUXA 3S2AA 2DZMA 2XBBC 1WXSA 2KDEB 2KK8A 4JL9A 2KTFA 4N9F4 4MH0E 4DHJD 1P9DU 2REXA 4PYZA 5D7GA 4K7UA 5DPWA 2K39A 2KJ6A 3PSEB 4W9DA 4EZLA 5EDSA 1BT0A 4DK5A 3A9JB 3IVFA 2D11A 3KW5B 4HK2A 2HTHA 2IY0B 4IW0A 3DBSA 3DVNV 4W9CA 3V6CB 1S1QB 5AZGA 3ZDTA 3KH0A 4DHJB 5CHWA 4PS8A 4DHZE 3K9OB 3PVLA 5L95C 2NPTA 3ZVVA 3PPAA 3T8MA 3WIMA 2FCSA 4W9EA 5LLIA 2AEHA 5DPRA 1IYFA 5C1ZA 3ZNID 4WJOA 4TQ0A 4W9JA 2LGYA 3PLUA 4KDIC 4ANVA 1OEYA 2KQ7A 5J18A 2BPSA 2JT4B 2MA9B 1G6JA 4ICUA 3ZW3A 3OJ4B 3R7QA 1D3ZA 3OJ3A 2KKCA 2XEWA 1S3SG 3A1QA 4G50A 2KTRB 4TUUA 3GZNI 3DVGY 2JWZA 2LRWA 4HDOA 4JGHB 3ZLZA 2RD0A 1VCBA 1E5WA 2QHOA 3TCAA 2R2OA 2LVQA 4HCNB 2PJHA 3PLVA 3W1YA 2GBNA 2KQSA 4J6IA 1WX7A 2D3GA 4WWNA 4JLCA 5J17A 4HXDA 1GJZA 2KJHB 3DBHI 1QZEA 4K1RB 2BKFA 2D10A 3M3JA 2KMCA 2N1WA 4MSQB 4ZYNA 2LVOA 1UH6A 2C7HA 2BKRB 3B08A 4CYEA 3VH4B 4HCPB 3NOBA 2BYEA 2CU1A 2WX0A 1CMXB 4BBNC 4ANWA 4BKSD 3LJ3A 2MP2B 1MG8A 4MGYE 1WIAA 4BOZB 4DWFA 2NCNA 3M95A 1WYWB 2N9PC 4G11A 4ZDVA 3APCA 1GUAB 3R3MA 2LUEA 3ZTCA 4GSWA 4M8MA 4WWPA 4KV2A 2O6VA 1GG3A 3ENEA 2L0TA 2GBRA 3PHXB 2WWZA 3QAQA 5DCNA 3TJPA 4W9GA 3WANA 1WGYA 4IM2A 2D07B 3UGBB 1KJTA 2BGFA 2DYOA 2GOWA 3EHVA 5IAAC 3ZNGC 2M8SA 3W1SA 2O2VA 2OJRA 1WR1A 3O65B 5AZFA 3U30A 5BO4B 2WX1A 2FCQA 2LJ5A 2KC1A 4MELA 2FAZA 3ZRFA 2CR5A 3QCAA 3QA8A 4MGIE 1FXTB 1Q0WB 2ZPYA 4GXBA 3ZDMC 3RZWC 2M1MA 4MM3A 1WI0A 2JVCA 4GMVA 3SU8X 3VQIA 4K81A 4G3XB 3VH3B 3VXWA 2ZCCA 2L7RA 3ZRCA 4AP4C 1OQYA 1RRBA 4K7WA 1A5RA 2PEAA 3QK0A 5D6JB 1P3QU 3PREA 2L0FA 1UELA 3IHPC 1K8RB 3VVWB 1J8CA 3CSFA 5AZHA 4KSKC 5LXIB 3AI5A 3TL5A 2RGFA 1TTNA 2MCNB 4DDGD 5JZEB 2KFKA 3L13A 1WJUA 4BKGA 4LJOB 2JZ3B 1LM8B 2KC2A 2GBJA 4EUTA 4W9IA 4AOFA 1P0RA 2GBKA 3V60A 2MX2A 2JPHA 4EFOA 2ZEQA 2LWPA 4P7IA 3HK0A 4NQLB 2KDBA 1XD3B 2KLCA 3ZO5B 2MLBA 2IO1B 3V6EB 1TBEA 1LFDA 2EMSA 3JSVB 3MTNB 4FLHA 4HJKA 2IZVB 3AXCA 2V3SA 3A33B 2HJ8A 4FA6A 3EC8A 4EZJA 3CMMB 1J19A 2AYOB 4GOCA 4IG7B 4XC2A 2J0KA 4FULA 1JRUA 1C1YB 1H4RA 1Q5WB 3R66C 2MBOA 4W9LA 2FIDA 2RPQA 2N4FA 3L0WB 1F9JA 4FADA 3KUCB 1V81A 1SE9A 4IWQA 4EZKA 1Y8RC 3HM3A 3RD2A 2BF8B 2LXAA 3VHTC 2D2QA 3V62A 2IYDB 2NBUA 4XZ4A 3PRPB 2AL3A 4FJVB 2DZJA 3NHEB 3DOWA 3Q3FA 4B6WA 2BYFA 4MSMB 3TBLD 2KFKB 4MGZE 4GN1A 1GNUA 2CS4A 4RM9A 2MP2A 1YJ1A 4TKNA 2NR2A 2L3ZA 3VTWA 4E3CA 3GOEA 3H7PB 2L8JA 3DBRI 3EFUA 2V1YA 4ICVA 3L08A 1E8YA 3OAWA 2N9EB 4RM8A 4W9FA 4KIKA 5KHOA 4LDTB 4MDKE 4WQOB 1M94A 3M62B 2IO2B 2N9XA 3Q3JA 4KVGB 3CF6E 2C5LC 4MGKE 3ML9A 1GC7A 5IA7A 3M63B 4X57B 3BINA 1WX8A 4II2B 4ZRJA 1KLVA 3OLMD 1V80A 4EOYA 3VTUA 4MJSB 2Z59B 1TZ1A 3RULA 2K1FA 2JY6A 3SDLC 3ML8A 3PHWB 5FR6A 3UIPB 3PZDA 1WJ4A 3VUWA 3UQBA 5CHVC 1WGRA 2NPTB 2A5UA 4PYUA 4F7ZA 4HPMB 2L05A 1KOTA 1UZXB 2JRIB 2IO0B 4DXAB 3TMPB 2C9WB 2Y5BB 5E6PA 1I42A 2EMTA 3KVFB 2NS5A 3MHSD 3ZIMA 5AEKB 2IO3B 2ZPNA 1KM7A 5E6OA 3L54A 4ZRKA 1LXDA 5D94A 2R2QA 4W9HA 4HPLB 4DBGA 4II3B 4EKUA 3U8ZA 4JQWC 1ZGUB 5TR5A 4GB9A 3KYCD 3PV1A 1X1MA 3QARA 1YQBA 4BFRA 3ZNHB 1WM2A 3WAOA 1TGZB 4IWOA 4M0WB 4F8CB 1Z5SB 2C7MB 2BYVE 1V86A 4MEMA 4NNJB 3RYTA 4A20A 3AULA 1U4AA 5LXHA 2KFJA 3NS8A 4W9KA 5HKHA 4GDLA 4URKA 4AWJA 3PS6A 1E7VA 2KLGA 4ZRIA 4BKSA 4LDTD 3ECIA 3N3KB 3H6NA 2C60A 2KTRA 1WX9A 1WMHA 1WJ6A 1XQQA 2VRRB 4GU2A 2G4DB 1IP9A 2EKEC 2M0XA 2M4NA 5C23A 3NZSA 4A3PA 2YVCA 2K8CA 3DVNU 2LI5A 3D32A 4OVUA 3KYDD 2J0JA 4IM0A 3DDCB 2DAJA 5L83A 2J0MA 4GIVA 1J0GA 1L2NA 2GBMA 3JW0X 3QQ8B 2CHWA 3ZKJC 2KDIA 1SGHA 3WA0A 3PGEA 1E8ZA 3LDZE 1WM3A 3X0WA 4LCDE 1EO6A 3L10B 1WGDA 2CHZA 1SIFA 4I6NB 4A3OA 4ASWC 5KHQA 4FJZA 3IFWB 1PQSA 2KHWB 3H1UA 3B0AA 4ANUA 4K7SA 3A9JA 1HE8A 2W9NA 2MSED 4GDKB 1OGWA 2LXCA 2FCMA 2MW5A 2MBBB 3V61A 4CHKA 4NJ6A 2KANA 4IC7B 2AWTA 2LASA 2WYQA 2IBIB 5JH5C 2RR9A 4DDID 3R7RA 2IY1B 2K6DB 3PRMB 2JXXA 2LVPA 2UWQA 2K8HA 4FN2A 3UIOB 1IPGA 2N1VA 4KZCA 3RT3B 1ZKHA 2NVUI 2MQJA 1OTRB 1RFAA 1WH3A 2DYMA 3UF8A 1WRDB 2LGXA 5JHAA 3ALBA 4NPNA 3C0RB 1V5OA 1E7UA 1H8CA 2K25A 4G0NB 3QC8B 4PS3A 4OVVA 4NAWB 2JRHA 2KN5A 5CX3A 2LZ6A 1E90A 1EUVB 2I1KA 1OEYJ 2YLMA 1WY8A 2ZVOA 1V9JA 1UBQA
chains in the Genus database with same CATH superfamily
2RSUA 2M17A 2IJ0A 3A9KA 3DPDA 4RF0A 1FNUA 1KH0A 1JWUD 2WDTB 2WXIA 3RNBC 2CHXA 2UYZB 4TQ1A 2N7DA 3QJZA 5CTRC 3ZUNA 1F1HA 2L52A 1HZ6A 1WE7A 1ZW7A 2QILA 2KDFB 4AUQC 3ONSA 2LJIA 2W82A 2IDYA 4NQKE 3KUDB 4MM3B 1WXMA 3QIJA 1WZ0A 2KZRA 1SF0A 2DENB 3WAMA 4YTNB 3H7PA 1C4AA 2N0SB 3AH7A 2NBWB 2X38A 2XK5B 1V2YA 1UF0A 2Z0DB 2MRPA 3A9KB 3HM6X 2KWVB 1TYGB 4ANXA 2CJOA 2ZJDA 3K9PB 1GB4A 1VLBA 5HFYA 2W55A 2O6VB 3HUIA 2PPHA 3IAS1 3AE8B 4WJQA 1KTKA 3JVZX 2L76A 3QWZB 4M8NA 1YX6B 1ISNA 1J7AA 5IN7A 1VD2A 3KQ4A 2KMAA 1WE6A 3MFGA 4HDQA 1V49A 2BS3B 1Z2MA 1T0YA 1RAXA 2ZW0A 4M00A 4JIOU 3FKYA 5BYRA 2MBEA 3AM9A 2OOBB 3T3NA 1L0VB 4S0RA 1R4MI 2QJLA 1UGMA 5IP4D 3BIID 3VTVA 1FPYA 1V97A 4IWPA 2LHEA 2LD9A 4I6PA 2DHZA 3L4PA 3JSVA 3VDZA 2WXJA 5CHFA 2NTSA 3RFZB 1UD7A 3HRDD 3AE2B 2KDEB 4MH0E 4NAMA 4DHJD 2REXA 3CIRB 3IVFA 2W54A 4IW0A 1F2RC 3DBSA 1FXAA 3V6CB 4YT0B 1QOFA 1HEZE 4DHJB 5C3JB 2NPTA 3AB5A 3PPAA 3T8MA 2FCSA 1IYFA 1B1ZA 2WXGA 4KX6B 2BPSA 2JT4B 3TEWA 4ICUA 1SIJA 4JWSC 2AQ2B 2QCZA 4TUUA 3A1QA 2OHFA 3DVGY 2JWZA 3TCAA 2LVQA 4HCNB 2PJHA 2HDEA 4J6IA 1WX7A 2D3GA 3KLSX 4JLCA 2BKFA 2D10A 4DXGA 2N1WA 1UH6A 3B08A 4CYEA 4HCPB 1UWXA 4ARIA 2L83A 4ANWA 4D2KA 1C79A 1FFVA 1MG8A 3BYYB 4BOZB 1RFKA 3M95A 3NJTA 2LUEA 4M8MA 3U4EG 2WQYB 2GBRA 3PHXB 5DCNA 1WGYA 4IM2A 2D07B 1T5XD 2WNMA 1KJTA 3EHVA 5IAAC 3ZNGC 5EE1A 3U30A 1STEA 4MELA 1PGAA 2M1MA 4C7ZA 2JVCA 4GMVA 3SU8X 4K81A 2LUMA 1OQQA 3AEEB 3VH3B 4AP4C 4XYCA 1A5RA 5D6JB 3R8BA 5TSSA 1UNSA 3C19A 1A70A 3CSFA 3TL5A 1B9RA 1TTNA 2TSSA 2KFKA 4LJOB 2JZ3B 1LM8B 2GBJA 5G5HA 3N20C 4AOFA 1P0RA 3EFCA 4M0WA 2ZEQA 4NQLB 2KDBA 1XD3B 2MLBA 3V6EB 3JSVB 4HJKA 4FLHA 3FILB 2BB6A 2V3SA 3AEGB 1H4RA 1Q5WB 2H89B 3R66C 1QILA 2RPQA 2IGHA 2LGIA 4FADA 2BVCA 1SE9A 4IWQA 3U52E 3VHTC 2LXAA 2D2QA 4XZ4A 2XN9C 4M01A 4B6WA 3Q3FA 4A8XC 1C77A 2D5GA 2CS4A 4LTUA 1FIQA 2MP2A 4LLGM 2J52A 2NR2A 3DBRI 2N9EB 4RM8A 4KIKA 4RH6A 4FXCA 1M94A 2V3NA 3M62B 4WQOB 4KVGB 4S17A 1HXYD 1GB1A 4LNKA 5IA7A 4GLSC 1NEKB 1KRHA 2N9KA 2WXRA 3B9JA 1KLVA 3OLMD 1ZDVA 1TZ1A 2K1FA 3SDLC 3LYYA 3ML8A 2YEPF 2GI9A 3VUWA 3UQBA 2WXFA 1WGRA 2A5UA 4ZRPA 2IO0B 1HA5A 4DXAB 1I42A 2BQQA 2GRIA 2NS5A 2JSVX 5E6OA 1VZ6A 1VDVA 1ACCA 2R2QA 4W9HA 2K5PA 1E0ZA 4JQWC 4OW0A 3KYCD 1MFWA 3GB1A 5FK9C 3N1XC 1X1MA 1ZE3D 3QARA 1YQBA 4L2YA 3WAOA 4IWOA 4WAFA 2BYVE 4MEMA 3E9SA 4URKA 3TEXA 1N5XA 3PS6A 4IDIA 1E7VA 2KLGA 3MC0B 1RYJA 2C60A 2G4DB 4Q2JA 4A9AA 1T0RC 4LNIA 3D32A 3KYDD 2J0JA 2DAJA 2J0MA 4GIVA 1J0GA 1ET9A 3ZQ4A 1TJEA 2GBMA 4P6VF 1F2RI 3QQ8B 3ZKJC 2QEJC 4JE3B 1WGDA 4I6NB 4REZA 2ACZB 1TKYA 3IFWB 1PQSA 1F52A 4DQOC 2KHWB 3DWMA 3H1UA 2M56B 2L1AA 1OGWA 2LXCA 2FCMA 4LNFA 1XF5L 2MBBB 4IC7B 3GE3C 3BK1A 3T3OA 4YXDB 1SJED 2K6DB 2K22A 1OQRA 2N1VA 1ZKHA 2NVUI 2MQJA 2DYMA 1WRDB 2LGXA 2PW9A 1V5OA 1DGJA 3GE8C 4G0NB 4OHJA 4YSZB 2JRHA 2KN5A 1E90A 2HJ1A 2I1KA 2PLPA 4AJWA 2ZVOA 1V9JA 4LNNA 1UBQA 2NBVB 1ESFA 3IBEA 2PE6B 3RNCC 3GP7A 3AE9B 2RDGA 4IOIE 3SFEB 4NJ7A 1E9MA 2PTLA 5H8YE 1V5TA 2BTEA 4BVUC 3APFA 1QOBA 3Q2AC 3NVVA 2G45B 2XK5A 4WJPA 4JX1C 2KNBA 4PT5A 3I63C 4KZ0A 4B95A 4J3OD 4FJYA 1MJDA 2PVGC 2UU7A 4DHZB 3DHIC 1JCKB 1JMLA 3P2BA 2RDBC 4RGMA 2WHIA 4RF1A 3WAPA 2FIFA 4EEWA 3RN9C 3VUYA 3A4SC 4BBNF 1V1PB 5IKCM 1HTQA 1XT9B 3A4RA 4WWOA 2OJWA 3CSTA 1C9FA 3BVGA 1P1AA 2KD0A 3AEDB 1NBFC 2ON8A 4KSLC 3KUZA 3MHZA 2AL6A 2ZNVC 3N30A 2FNJB 3AU5A 3EECA 4TSSA 2FCNA 1WZ3A 2DX5B 2WXOA 5D2MB 1WMHB 4HWIB 4E74A 3N32A 4P16A 3AE7B 3B1LX 4TMAB 4C4VA 2MBHA 4PK1A 4GDLB 1YX5B 1P98A 4PS7A 4XX5A 1I4GA 3QHTA 2JZZA 3BVMA 4BAXA 1WJNA 4KKJA 1RLFA 4IUMB 1WFYA 4RMAA 1XO3A 4NY0A 4B9KA 2PKOA 4E71A 2WDVB 4TV3A 4WAAA 5DPTA 3DQVA 1EF5A 4BOSC 2SEBD 1YIWA 3L16A 1ROEA 3VUXA 3BY4B 2DZMA 2KK8A 4JL9A 4N9F4 5D7GA 3MJ5A 2VH1A 2KT7A 4W9DA 5EDSA 1TS4A 3A9JB 4HK2A 2D11A 3KW5B 2HTHA 1S1QB 5AZGA 3ZDTA 4L1BA 5CHWA 4PS8A 3GZNB 3PVLA 5L95C 5IOIA 2AEHA 5C1ZA 3ZNID 3AV8A 4TQ0A 3Q8BA 2BBCA 4KDIC 4ANVA 5J18A 1N63A 3V05A 2QMTA 2WXQA 1D3ZA 2XEWA 1S3SG 2LRWA 4JGHB 3ZLZA 1E5WA 2INNE 2QHOA 3PLVA 1D5MC 3W1YA 1NVID 2MHJA 2NTTA 1GJZA 2M0AA 2KJHB 3DBHI 1QZEA 1IGCA 1FXIA 4MSQB 3VH4B 2CU1A 1CMXB 2IGDA 1SB3C 4B0EA 4MGYE 1BUIC 2N9PC 1GUAB 4KV2A 1GG3A 3ENEA 3ABVB 4RGOS 4OZBA 2WWZA 1FFUA 2WDQB 4HEA1 3NZ3A 1WR1A 4RCOA 2FCQA 3B2FA 2KC1A 1FRDA 1XXGA 3ZRFA 1BMLC 3QCAA 3QA8A 4MACA 2BT6A 3P42A 1WI0A 3VQIA 4G3XB 2L7RA 3V3XA 1OQYA 3QK0A 1WRIA 1CK1A 2L0FA 1J8CA 3W9CB 2RGFA 4DDGD 3ZYYX 3P4PB 3AE5B 4L23A 4EUTA 4MT5A 2JPHA 4EFOA 3HK0A 2WXLA 2D3AA 1TT5B 3ZO5B 1TBEA 1LFDA 3MTNB 3VRAB 2B76B 1XCTL 3A33B 1D5ZC 3Q3MC 1QQRA 1YQ4B 2J0KA 4FULA 2FIDA 3L0WB 1K52A 2FBWB 4YSYB 1JROA 4AS1A 3PO0A 3V62A 1OFFA 3KWLA 3PRPB 2IGGA 3DBHB 3DOWA 2JYTA 2KFKB 1NI3A 4MGZE 1QOGA 1SE3A 1GNUA 4A55A 1VJKA 3VTWA 1WXQA 3EFUA 2V1YA 4M02A 2V9HA 2IO2B 4MGKE 4XGAB 3ML9A 1GC7A 4N59A 1V1OA 3M63B 1WX8A 3LXFA 5C2TB 3ZJVA 4MJSB 4ZYSA 5FR6A 2NPTB 1GPXA 1UZXB 3TMPB 2C9WB 2Y5BB 3P63A 1RWSA 2IO3B 3L54A 2J42A 1LXDA 3ZJTA 5D94A 4HPLB 4DBGA 4EKUA 1NYRA 4RGNA 3PV1A 1YOVB 4M0WB 2C7MB 3SEBA 5I4DA 1V86A 2JQRB 3HVZA 1TIFA 2WU5B 3AULA 3GS2A 4C4VB 3NS8A 4W9KA 1MG4A 4GDLA 4AWJA 1PDXA 1SXTA 4LDTD 3N3KB 2KN4A 4GU2A 1VZ8A 2VRRB 5C23A 2FE8A 4A3PA 1GOZA 2LI5A 4IM0A 1JW9D 5L83A 4K3BA 2CHWA 2KDIA 1SGHA 3DHGC 3C8YA 3LDZE 2MEKA 3ZXVA 4LCDE 3L10B 2CHZA 1SIFA 1PGBA 2QC8A 3A9JA 1HE8A 4GDKB 2MW5A 4NJ6A 2KANA 3BZDB 2Y5PA 2INPE 3AE3B 2JXXA 3KWVA 1GAQB 1RFAA 1SE2A 1I4RA 1AW7A 3UF8A 1XLPA 2RDHA 3C0RB 1H8CA 1SE4A 3OWEB 4OVVA 4A6QA 2V4IB 1JALA 5HG2A 1LO5D 3TUOA 2FUG1 4YSXB 1C76A 1EF1A 1AARA 3UI3A 1QKZA 2HE7A 3DVGX 5BYSA 4WJNA 3FILA 3VAWA 1K53A 3N9YC 2O6VD 2N7EA 3RUIB 3UQAA 2R61A 4LK0M 1AWDA 4NZLB 4CO7A 1I4HA 3H8HA 2KOXA 1NDDA 2I1JA 3QX1A 4HPPA 3EUB2 2FUHB 3T9LA 1E10A 2KWCA 1PFDA 2I38A 1JWBD 1L6UA 4IM3A 4HLEA 3X23A 3W5VB 5D3DA 1CQVA 2JF5A 1FNWA 1YD8U 2K6QA 2DZIA 2MBQA 4EE2A 1UBIA 3IT4B 4A90A 3PT2B 5DPSA 1V6EA 1YJJA 2KX3A 2YEPB 4KKIA 3PTFC 4C56C 3RNFC 3P1MA 5EE3A 2LRUA 2LGSA 2BWES 3I3TB 3RZFA 2Z0EB 5BMHA 1CZPA 2ONQA 4XE0A 1C3TA 2B3AA 4I6LB 3AU4A 4MJSA 2K8BA 4NAWA 3ZXRA 1R4MB 2V4LA 2WLBA 1WXVA 3H7SA 3RMKC 1N62A 3Q3NC 2VZKD 1LQBA 2KXJA 3JYUA 1WGKA 2KO3A 3EA6A 3MC9A 3MJWA 1PYWD 2RMMA 2KQ4X 4LJPB 5JHBA 4F1SA 5G55A 3APDA 2CU3A 2ZCBA 2WXHA 2ICIA 4GDKA 3P4SB 3IG3A 2X8XX 4KDLB 2ZW1A 2J53A 2Z8LA 2MWSB 2WU2B 3RCZA 1TZOA 5MPOA 3HIZA 1FO4A 1SEBD 3ZNZB 2ZZPB 1KFYB 3U2SC 2HD5B 3RI7C 4AJYB 4WWMA 3L17A 2Y5CA 2WXNA 1WXSA 2KTFA 2KACA 1Y56A 3AEFB 5DPWA 2K39A 3PSEB 4EZLA 4DK5A 1FEHA 1TS2A 3ETRA 1L5PA 3AE4B 4B0MA 3KH0A 1WYGA 4WIPA 4DHZE 3K9OB 3ZVVA 3Q69A 5LLIA 4W9JA 1UUPA 1I7HA 3PLUA 1G6JA 1OEYA 1MVKA 2MA9B 3NS1A 3R7QA 2AQ3B 4ZRIA 4G50A 1PUTA 1UGJA 2K0PA 3W2DA 2R2OA 1EWYC 2W3SA 3HVDA 3NVYA 1XLOA 2EELA 1YN3A 2JZPA 4HXDA 5H92C 4JWUC 4K1RB 3M3JA 4ZYNA 1ZXIA 2KYWA 3NOBA 2BYEA 2J4XA 1RM6C 2V3PA 4BBNC 4BKSD 3LJ3A 4OZCA 2L32A 1HTOA 1N61A 1XCQL 3Q8CA 1WIAA 1C4PA 1L6VA 2LHDA 4DWFA 1WYWB 2DLBA 4XDCA 3ZTCA 1V8CA 2O6VA 5AUKA 1IBXB 2DYOA 2M8SA 2O2VA 2QSDA 4ARCA 2FAZA 4ZHPA 3NRZA 4HROA 2CR5A 4MGIE 1Q0WB 2JX5A 2ZPYA 4MM3A 1CJEA 2KDMA 2OEDA 1I4PA 4WH4A 3ZRCA 4K7WA 5JXVA 2PEAA 3N1YC 5E6JA 3PZ8A 4RGTA 3FC4A 1E6EB 5LXIB 3AI5A 3W5UB 2MCNB 1F77A 2QDFA 4BKGA 1FCLA 3VRBB 3Q8EA 3PZ7A 4KGSA 3V60A 2LWPA 4R3DA 2KLCA 1FD6A 3N1ZC 1F0ZA 2LEKA 2IZVB 3AXCA 3OG5A 4FA6A 4EZJA 4XDDA 2AYOB 4GOCA 4IG7B 1IBXA 4C80A 2MBOA 3LB8C 4W9LA 2N4FA 1F9JA 3KUCB 1E7PB 1V81A 4P1BC 3AECB 4EZKA 1Y8RC 3RD2A 1HZ5A 3U7ZA 1JQ4A 4RFBA 5JZEB 1HQRD 2DZJA 3NHEB 2QIEB 2BYTA 2KAJA 2K9XA 4MSMB 1D5XC 1LGRA 1I4XA 4GN1A 3I57A 2N7JA 1NENB 1NYQA 4TKNA 4E3CA 1L0YB 3H7PB 5LNK1 1DYQA 3L08A 3OAWA 4MDKE 4N6EB 4YTPB 2WXPA 3BINA 4II2B 1V80A 1IGDA 4EOYA 1TY2A 2JY6A 1J7BA 2G9HD 3PZDA 3UIPB 1WJ4A 1EM7A 5CHVC 4F7ZA 1AN8A 3AE6B 2L05A 4HPMB 1KOTA 2EMTA 3KVFB 3MHSD 3ZIMA 1R7SA 1KM7A 4ZRKA 4DXFA 4II3B 3U8ZA 1ZGUB 3DBLB 5TR5A 2JYEA 1FRRA 2WP9B 2XNAC 4ZHOA 3BVZA 4QAYA 3ZNHB 5HI1A 4F8CB 4A20A 4KGTA 4US8A 1J7CA 1U4AA 4HKZE 2KFJA 1EU4A 5HKHA 1XLQA 4BKSA 3ECIA 4OVZA 3H6NA 1T0QC 1WMHA 2WGSA 2VH2A 3MC8A 2EKEC 2K8CA 3DVNU 4O1NA 3DDCB 1VRAB 1L2NA 3JW0X 3WA0A 3PGEA 1E8ZA 3X0WA 1DOYA 3IAM1 1XEEA 2W3RA 2INCC 2M19A 4ASWC 4FJZA 1JWSD 2NMQA 3B0AA 2KWDA 1TY0A 3V61A 4CHKA 2JXTA 2AWTA 2LASA 5JH5C 2IBIB 4DDID 3R7RA 3UIOB 1IPGA 4KZCA 3RT3B 3SFDB 1OTRB 1Q10A 1T0SC 5JHAA 2H88B 4NPNA 3NUHB 1E7UA 2K25A 3QC8B 5FR3A 1QF6A 4NAWB 2KMMA 1EUVB 3AN1A 1MHXA 2A4ZA 4WURA 4FBJB 2CJNA 4FHJA 1I35A 2KWUB 1E8WA 2BWFA 1R4NI 2JUOA 1TKGA 4JPSA 3A1QB 3U7DA 3DBLI 4YL8A 2GMIC 2D3CA 1Q1OA 2ZNVB 3DCGA 1GC6A 1EWCA 1L7YA 2PVOD 3ZTDA 4HVBA 3UINB 2Q5WD 1C78A 2KVZA 2ASQA 3SHQA 1WR6E 3BYTB 2L00B 3PRZA 4ZRQA 2J7QB 1WF9A 2KJRA 2G3QB 5J2RA 4MH8A 5GMVA 5BMGA 2E6XA 4US9A 2DZKA 3NG0A 3AEAB 3FAHA 3HHMA 3MP9A 2LGDA 3SR6A 2KX0A 1WXAA 3J9CA 4ITKA 4BZAA 3NZUA 2PMVA 2O2VB 1TS5A 5G2NA 4KIKB 1KLUD 1QLBB 1NI2A 3CWIA 3TIXA 2E3TA 1L4ZB 3VR9B 3I9V1 4IKGA 1I4QA 2DYBA 3P4QB 2BW2A 1ENFA 3O13A 2AX5A 5HHDG 5GXGB 2Y3AA 3SD5A 1WGGA 4RNAA 3WALA 2DAFA 4BKTA 2BS4B 3VFKA 3R2IA 4FHKA 5FKAC 2IPKD 2LMCA 3RNGC 1ZOYB 2CKHB 1WGHA 3AMZA 2C7NB 1VZ7A 1E8XA 2G4SA 2PE9A 4GGQA 4XWWA 3H9DA 3W1SC 1EU3A 5E6NA 3NY5A 2ZVNA 2KVRA 3S2AA 2XBBC 1ZDXA 1MHHE 1P9DU 1T3QA 2MJEA 4PYZA 4K7UA 2KJ6A 1BT0A 1DOIA 2IY0B 1MI0A 1BXTA 2SAKA 3DVNV 4W9CA 2WDRB 4YTMB 1P7EA 3WIMA 1TKEA 4W9EA 2I2YA 5DPRA 4C00A 4LNOA 4WJOA 2LGYA 2KQ7A 1YJIA 1MPEA 3ZW3A 5T8IA 3OJ4B 3OJ3A 2KKCA 1AYFA 2KTRB 3GZNI 5IO9A 4HDOA 3AE1B 2RD0A 1VCBA 2N9LA 5EE0A 2GBNA 2KQSA 3I5JC 4WWNA 3IT6B 5J17A 5EE9A 2V0GA 1N6ZA 4XWTA 1XLNA 3NVZA 2KMCA 1YQ3B 1FNVA 2LVOA 2C7HA 2BKRB 2WX0A 1YN5A 3ZGZA 1ET6A 2MP2B 3VR8B 1N5WA 2NCNA 1ZUD2 4G11A 4ZDVA 3APCA 3R3MA 3BK2A 4GSWA 4WWPA 3BWUD 2L0TA 1ZXHA 3TJPA 3QAQA 4W9GA 3WANA 1TS3A 3UGBB 2BGFA 2GOWA 3W1SA 2OJRA 3O65B 5AZFA 2GB1A 2WX1A 5BO4B 2GLSA 2LJ5A 1FXTB 4KGRA 3P4RB 4GXBA 2WS3B 3ZDMC 3RZWC 3IXSA 3DWGC 3VXWA 2K3UA 1YNTE 2ZCCA 4C7YA 3AEBB 1RRBA 2DNFA 1V1PA 1P3QU 3PREA 4USAA 3DBRB 4ACFA 1UELA 3IHPC 1K8RB 3ZJUA 3VVWB 2MH7A 3B2GA 2DBYA 5AZHA 4KSKC 3L13A 4HJGE 4HKQA 1WJUA 2KC2A 4W9IA 1SBBB 2GBKA 1JWMD 2MX2A 1FM0D 2HTME 4P7IA 2WXMA 3Q8FA 2IO1B 1P7FA 4N58A 2EMSA 1C4CA 2HJ8A 3EC8A 3CMMB 1J19A 4XC2A 4H2AA 2LFIA 3DHHC 2JU6X 1JRUA 1C1YB 4AQ7A 2BS2B 4UDUC 3TSSA 1D4BA 3HM3A 2BF8B 2IYDB 2NBUA 2AL3A 4FJVB 2BYFA 3TBLD 3TEYA 1WWTA 1R4NB 4RM9A 1YJ1A 1K50A 2L3ZA 3GOEA 2L8JA 1UWMA 3Q14C 4ICVA 1IUEA 1E8YA 2JWUA 4ZOHC 2BB5A 3NVWA 4W9FA 5KHOA 4LDTB 3RNAC 2N9XA 3Q3JA 3CF6E 2C5LC 4WQMA 4X57B 1SJHD 4ZRJA 3VTUA 1VR9A 2Z59B 3RULA 1L4DB 3PHWB 4NJCA 1KLGD 5G5GA 4CQNA 3EGRA 4PYUA 1K51A 3URYA 2JRIB 5E6PA 5AEKB 2ZPNA 1L0XB 5AUIA 1JWAD 1D6EC 2EKIA 4GB9A 2D3BA 4BFRA 1ZPSA 1WM2A 1TGZB 3Q6BA 1Z5SB 4NNJB 3RYTA 1DOXA 1JRPA 1WSPA 5LXHA 1SSNA 2AQ1B 3Q3OC 1FCCC 4K3CA 3RNEC 2KTRA 4P1CC 1WX9A 1WJ6A 3Q8AA 1XQQA 1IP9A 2M0XA 2M4NA 4HRSA 2YVCA 1FMAD 4OVUA 1YN4A 5D3IB 4OZAA 1YMHE 3E56A 1M4VA 1WM3A 5BMIA 2INDC 1EO6A 2G1EA 3RPFC 4A3OA 2MJDA 1N60A 1QOAA 5KHQA 2WXKA 4YWGG 1QT9A 1T6BX 4ANUA 2RPVA 3TEZA 4K7SA 2MJ3A 2PIAA 2W9NA 2MSED 2WYQA 2RR9A 2DWQA 2IY1B 3PRMB 4FN2A 2LVPA 1ZP0B 2K8HA 2UWQA 1WH3A 5BYQA 3ALBA 1PGXA 4PS3A 3WCQA 5CX3A 2LZ6A 2VZKB 3R2TA 1KF6B 1OEYJ 2YLMA 1WY8A 3NZSA
chains in the Genus database with same CATH topology
2NBVB 2RSUA 2M17A 3A9KA 2A4ZA 3DPDA 3IBEA 4FBJB 2PE6B 4FHJA 1I35A 2KWUB 1EF1A 1E8WA 1AARA 4NJ7A 2BWFA 2WDTB 1R4NI 2JUOA 1V5TA 4BVUC 2HE7A 3DVGX 3APFA 4WJNA 2CHXA 3VAWA 2UYZB 3A1QB 4TQ1A 3U7DA 2N7DA 2G45B 3DBLI 2GMIC 4YL8A 2XK5A 4WJPA 2O6VD 3QJZA 5CTRC 3ZUNA 2N7EA 1Q1OA 2KNBA 2ZNVB 4KZ0A 3RUIB 4B95A 3DCGA 3UQAA 1WE7A 1GC6A 1ZW7A 4FJYA 4DHZB 2KDFB 1L7YA 4AUQC 3ONSA 3ZTDA 4CO7A 4HVBA 2KOXA 1NDDA 3UINB 2I1JA 3QX1A 3P2BA 2FUHB 4NQKE 3T9LA 2ASQA 2KWCA 3SHQA 1WR6E 3KUDB 2L00B 3WAPA 1WXMA 3QIJA 2FIFA 4EEWA 4IM3A 3PRZA 1WZ0A 2J7QB 2KZRA 4HLEA 2DENB 1WF9A 3X23A 3WAMA 3VUYA 3A4SC 2KJRA 3H7PA 4BBNF 2G3QB 5J2RA 2NBWB 5GMVA 1XT9B 3A4RA 2JF5A 4WWOA 1YD8U 2K6QA 2DZKA 2DZIA 2XK5B 2MBQA 3HHMA 1V2YA 4AJWA 2Z0DB 3CSTA 2LGDA 2MRPA 2KX0A 1P1AA 1WXAA 3A9KB 2KD0A 3HM6X 2KWVB 1UBIA 1NBFC 3PT2B 5DPSA 3NZUA 4ANXA 1V6EA 4KSLC 2KX3A 2O2VB 2ZJDA 3KUZA 3K9PB 2AL6A 2ZNVC 5G2NA 3N30A 4KIKB 2FNJB 3AU5A 3EECA 2FCNA 3PTFC 1NI2A 1WZ3A 2O6VB 2DX5B 2LRUA 2PPHA 3TIXA 5D2MB 1WMHB 2BWES 3I3TB 4HWIB 4WJQA 3RZFA 3JVZX 4E74A 3N32A 2L76A 3QWZB 4M8NA 3B1LX 2Z0EB 1YX6B 1ISNA 1C3TA 2B3AA 4I6LB 3AU4A 4MJSA 2K8BA 2MBHA 2DYBA 4NAWA 1VD2A 4GDLB 1YX5B 2KMAA 1P98A 4PS7A 4XX5A 2V4LA 3H7SA 1WXVA 1WE6A 4HDQA 1V49A 1Z2MA 1LQBA 1T0YA 3QHTA 1RAXA 2JZZA 1WJNA 2KXJA 3JYUA 1RLFA 2KO3A 4JIOU 3SD5A 1WGGA 3MJWA 3WALA 2DAFA 2MBEA 4IUMB 4LJPB 5JHBA 4F1SA 4BKTA 5G55A 3APDA 1WFYA 4RMAA 2ZCBA 2OOBB 4NY0A 3VFKA 4GDKA 4B9KA 4E71A 4FHKA 3IG3A 1R4MI 4TV3A 4WAAA 1UGMA 4KDLB 3VTVA 2CKHB 1WGHA 4IWPA 5DPTA 2MWSB 2C7NB 3DQVA 2LD9A 3RCZA 4I6PA 1E8XA 2G4SA 1EF5A 3HIZA 2PE9A 3ZNZB 4BOSC 2ZZPB 2DHZA 3H9DA 4GGQA 1YIWA 3W1SC 3L16A 3JSVA 2HD5B 3VDZA 5CHFA 4AJYB 3L17A 5E6NA 1UD7A 2ZVNA 3BY4B 2KVRA 3NY5A 3VUXA 3S2AA 2DZMA 2XBBC 1WXSA 2KDEB 2KK8A 4JL9A 2KTFA 4N9F4 4MH0E 4DHJD 1P9DU 2REXA 4PYZA 5D7GA 4K7UA 5DPWA 2K39A 2KJ6A 3PSEB 4W9DA 4EZLA 5EDSA 1BT0A 4DK5A 3A9JB 3IVFA 2D11A 3KW5B 4HK2A 2HTHA 2IY0B 4IW0A 3DBSA 3DVNV 4W9CA 3V6CB 1S1QB 5AZGA 3ZDTA 3KH0A 4DHJB 5CHWA 4PS8A 4DHZE 3K9OB 3PVLA 5L95C 2NPTA 3ZVVA 3PPAA 3T8MA 3WIMA 2FCSA 4W9EA 5LLIA 2AEHA 5DPRA 1IYFA 5C1ZA 3ZNID 4WJOA 4TQ0A 4W9JA 2LGYA 3PLUA 4KDIC 4ANVA 1OEYA 2KQ7A 5J18A 2BPSA 2JT4B 2MA9B 1G6JA 4ICUA 3ZW3A 3OJ4B 3R7QA 1D3ZA 3OJ3A 2KKCA 2XEWA 1S3SG 3A1QA 4G50A 2KTRB 4TUUA 3GZNI 3DVGY 2JWZA 2LRWA 4HDOA 4JGHB 3ZLZA 2RD0A 1VCBA 1E5WA 2QHOA 3TCAA 2R2OA 2LVQA 4HCNB 2PJHA 3PLVA 3W1YA 2GBNA 2KQSA 4J6IA 1WX7A 2D3GA 4WWNA 4JLCA 5J17A 4HXDA 1GJZA 2KJHB 3DBHI 1QZEA 4K1RB 2BKFA 2D10A 3M3JA 2KMCA 2N1WA 4MSQB 4ZYNA 2LVOA 1UH6A 2C7HA 2BKRB 3B08A 4CYEA 3VH4B 4HCPB 3NOBA 2BYEA 2CU1A 2WX0A 1CMXB 4BBNC 4ANWA 4BKSD 3LJ3A 2MP2B 1MG8A 4MGYE 1WIAA 4BOZB 4DWFA 2NCNA 3M95A 1WYWB 2N9PC 4G11A 4ZDVA 3APCA 1GUAB 3R3MA 2LUEA 3ZTCA 4GSWA 4M8MA 4WWPA 4KV2A 2O6VA 1GG3A 3ENEA 2L0TA 2GBRA 3PHXB 2WWZA 3QAQA 5DCNA 3TJPA 4W9GA 3WANA 1WGYA 4IM2A 2D07B 3UGBB 1KJTA 2BGFA 2DYOA 2GOWA 3EHVA 5IAAC 3ZNGC 2M8SA 3W1SA 2O2VA 2OJRA 1WR1A 3O65B 5AZFA 3U30A 5BO4B 2WX1A 2FCQA 2LJ5A 2KC1A 4MELA 2FAZA 3ZRFA 2CR5A 3QCAA 3QA8A 4MGIE 1FXTB 1Q0WB 2ZPYA 4GXBA 3ZDMC 3RZWC 2M1MA 4MM3A 1WI0A 2JVCA 4GMVA 3SU8X 3VQIA 4K81A 4G3XB 3VH3B 3VXWA 2ZCCA 2L7RA 3ZRCA 4AP4C 1OQYA 1RRBA 4K7WA 1A5RA 2PEAA 3QK0A 5D6JB 1P3QU 3PREA 2L0FA 1UELA 3IHPC 1K8RB 3VVWB 1J8CA 3CSFA 5AZHA 4KSKC 5LXIB 3AI5A 3TL5A 2RGFA 1TTNA 2MCNB 4DDGD 5JZEB 2KFKA 3L13A 1WJUA 4BKGA 4LJOB 2JZ3B 1LM8B 2KC2A 2GBJA 4EUTA 4W9IA 4AOFA 1P0RA 2GBKA 3V60A 2MX2A 2JPHA 4EFOA 2ZEQA 2LWPA 4P7IA 3HK0A 4NQLB 2KDBA 1XD3B 2KLCA 3ZO5B 2MLBA 2IO1B 3V6EB 1TBEA 1LFDA 2EMSA 3JSVB 3MTNB 4FLHA 4HJKA 2IZVB 3AXCA 2V3SA 3A33B 2HJ8A 4FA6A 3EC8A 4EZJA 3CMMB 1J19A 2AYOB 4GOCA 4IG7B 4XC2A 2J0KA 4FULA 1JRUA 1C1YB 1H4RA 1Q5WB 3R66C 2MBOA 4W9LA 2FIDA 2RPQA 2N4FA 3L0WB 1F9JA 4FADA 3KUCB 1V81A 1SE9A 4IWQA 4EZKA 1Y8RC 3HM3A 3RD2A 2BF8B 2LXAA 3VHTC 2D2QA 3V62A 2IYDB 2NBUA 4XZ4A 3PRPB 2AL3A 4FJVB 2DZJA 3NHEB 3DOWA 3Q3FA 4B6WA 2BYFA 4MSMB 3TBLD 2KFKB 4MGZE 4GN1A 1GNUA 2CS4A 4RM9A 2MP2A 1YJ1A 4TKNA 2NR2A 2L3ZA 3VTWA 4E3CA 3GOEA 3H7PB 2L8JA 3DBRI 3EFUA 2V1YA 4ICVA 3L08A 1E8YA 3OAWA 2N9EB 4RM8A 4W9FA 4KIKA 5KHOA 4LDTB 4MDKE 4WQOB 1M94A 3M62B 2IO2B 2N9XA 3Q3JA 4KVGB 3CF6E 2C5LC 4MGKE 3ML9A 1GC7A 5IA7A 3M63B 4X57B 3BINA 1WX8A 4II2B 4ZRJA 1KLVA 3OLMD 1V80A 4EOYA 3VTUA 4MJSB 2Z59B 1TZ1A 3RULA 2K1FA 2JY6A 3SDLC 3ML8A 3PHWB 5FR6A 3UIPB 3PZDA 1WJ4A 3VUWA 3UQBA 5CHVC 1WGRA 2NPTB 2A5UA 4PYUA 4F7ZA 4HPMB 2L05A 1KOTA 1UZXB 2JRIB 2IO0B 4DXAB 3TMPB 2C9WB 2Y5BB 5E6PA 1I42A 2EMTA 3KVFB 2NS5A 3MHSD 3ZIMA 5AEKB 2IO3B 2ZPNA 1KM7A 5E6OA 3L54A 4ZRKA 1LXDA 5D94A 2R2QA 4W9HA 4HPLB 4DBGA 4II3B 4EKUA 3U8ZA 4JQWC 1ZGUB 5TR5A 4GB9A 3KYCD 3PV1A 1X1MA 3QARA 1YQBA 4BFRA 3ZNHB 1WM2A 3WAOA 1TGZB 4IWOA 4M0WB 4F8CB 1Z5SB 2C7MB 2BYVE 1V86A 4MEMA 4NNJB 3RYTA 4A20A 3AULA 1U4AA 5LXHA 2KFJA 3NS8A 4W9KA 5HKHA 4GDLA 4URKA 4AWJA 3PS6A 1E7VA 2KLGA 4ZRIA 4BKSA 4LDTD 3ECIA 3N3KB 3H6NA 2C60A 2KTRA 1WX9A 1WMHA 1WJ6A 1XQQA 2VRRB 4GU2A 2G4DB 1IP9A 2EKEC 2M0XA 2M4NA 5C23A 3NZSA 4A3PA 2YVCA 2K8CA 3DVNU 2LI5A 3D32A 4OVUA 3KYDD 2J0JA 4IM0A 3DDCB 2DAJA 5L83A 2J0MA 4GIVA 1J0GA 1L2NA 2GBMA 3JW0X 3QQ8B 2CHWA 3ZKJC 2KDIA 1SGHA 3WA0A 3PGEA 1E8ZA 3LDZE 1WM3A 3X0WA 4LCDE 1EO6A 3L10B 1WGDA 2CHZA 1SIFA 4I6NB 4A3OA 4ASWC 5KHQA 4FJZA 3IFWB 1PQSA 2KHWB 3H1UA 3B0AA 4ANUA 4K7SA 3A9JA 1HE8A 2W9NA 2MSED 4GDKB 1OGWA 2LXCA 2FCMA 2MW5A 2MBBB 3V61A 4CHKA 4NJ6A 2KANA 4IC7B 2AWTA 2LASA 2WYQA 2IBIB 5JH5C 2RR9A 4DDID 3R7RA 2IY1B 2K6DB 3PRMB 2JXXA 2LVPA 2UWQA 2K8HA 4FN2A 3UIOB 1IPGA 2N1VA 4KZCA 3RT3B 1ZKHA 2NVUI 2MQJA 1OTRB 1RFAA 1WH3A 2DYMA 3UF8A 1WRDB 2LGXA 5JHAA 3ALBA 4NPNA 3C0RB 1V5OA 1E7UA 1H8CA 2K25A 4G0NB 3QC8B 4PS3A 4OVVA 4NAWB 2JRHA 2KN5A 5CX3A 2LZ6A 1E90A 1EUVB 2I1KA 1OEYJ 2YLMA 1WY8A 2ZVOA 1V9JA 1UBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBV B;  2RSU A;  2M17 A;  3A9K A;  2A4Z A;  3DPD A;  3IBE A;  4FBJ B;  2PE6 B;  4FHJ A;  1I35 A;  2KWU B;  1EF1 A;  1E8W A;  1AAR A;  4NJ7 A;  2BWF A;  2WDT B;  1R4N I;  2JUO A;  1V5T A;  4BVU C;  2HE7 A;  3DVG X;  3APF A;  4WJN A;  2CHX A;  3VAW A;  2UYZ B;  3A1Q B;  4TQ1 A;  3U7D A;  2N7D A;  2G45 B;  3DBL I;  2GMI C;  4YL8 A;  2XK5 A;  4WJP A;  2O6V D;  3QJZ A;  5CTR C;  3ZUN A;  2N7E A;  1Q1O A;  2KNB A;  2ZNV B;  4KZ0 A;  3RUI B;  4B95 A;  3DCG A;  3UQA A;  1WE7 A;  1GC6 A;  1ZW7 A;  4FJY A;  4DHZ B;  2KDF B;  1L7Y A;  4AUQ C;  3ONS A;  3ZTD A;  4CO7 A;  4HVB A;  2KOX A;  1NDD A;  3UIN B;  2I1J A;  3QX1 A;  3P2B A;  2FUH B;  4NQK E;  3T9L A;  2ASQ A;  2KWC A;  3SHQ A;  1WR6 E;  3KUD B;  2L00 B;  3WAP A;  1WXM A;  3QIJ A;  2FIF A;  4EEW A;  4IM3 A;  3PRZ A;  1WZ0 A;  2J7Q B;  2KZR A;  4HLE A;  2DEN B;  1WF9 A;  3X23 A;  3WAM A;  3VUY A;  3A4S C;  2KJR A;  3H7P A;  4BBN F;  2G3Q B;  5J2R A;  2NBW B;  5GMV A;  1XT9 B;  3A4R A;  2JF5 A;  4WWO A;  1YD8 U;  2K6Q A;  2DZK A;  2DZI A;  2XK5 B;  2MBQ A;  3HHM A;  1V2Y A;  4AJW A;  2Z0D B;  3CST A;  2LGD A;  2MRP A;  2KX0 A;  1P1A A;  1WXA A;  3A9K B;  2KD0 A;  3HM6 X;  2KWV B;  1UBI A;  1NBF C;  3PT2 B;  5DPS A;  3NZU A;  4ANX A;  1V6E A;  4KSL C;  2KX3 A;  2O2V B;  2ZJD A;  3KUZ A;  3K9P B;  2AL6 A;  2ZNV C;  5G2N A;  3N30 A;  4KIK B;  2FNJ B;  3AU5 A;  3EEC A;  2FCN A;  3PTF C;  1NI2 A;  1WZ3 A;  2O6V B;  2DX5 B;  2LRU A;  2PPH A;  3TIX A;  5D2M B;  1WMH B;  2BWE S;  3I3T B;  4HWI B;  4WJQ A;  3RZF A;  3JVZ X;  4E74 A;  3N32 A;  2L76 A;  3QWZ B;  4M8N A;  3B1L X;  2Z0E B;  1YX6 B;  1ISN A;  1C3T A;  2B3A A;  4I6L B;  3AU4 A;  4MJS A;  2K8B A;  2MBH A;  2DYB A;  4NAW A;  1VD2 A;  4GDL B;  1YX5 B;  2KMA A;  1P98 A;  4PS7 A;  4XX5 A;  2V4L A;  3H7S A;  1WXV A;  1WE6 A;  4HDQ A;  1V49 A;  1Z2M A;  1LQB A;  1T0Y A;  3QHT A;  1RAX A;  2JZZ A;  1WJN A;  2KXJ A;  3JYU A;  1RLF A;  2KO3 A;  4JIO U;  3SD5 A;  1WGG A;  3MJW A;  3WAL A;  2DAF A;  2MBE A;  4IUM B;  4LJP B;  5JHB A;  4F1S A;  4BKT A;  5G55 A;  3APD A;  1WFY A;  4RMA A;  2ZCB A;  2OOB B;  4NY0 A;  3VFK A;  4GDK A;  4B9K A;  4E71 A;  4FHK A;  3IG3 A;  1R4M I;  4TV3 A;  4WAA A;  1UGM A;  4KDL B;  3VTV A;  2CKH B;  1WGH A;  4IWP A;  5DPT A;  2MWS B;  2C7N B;  3DQV A;  2LD9 A;  3RCZ A;  4I6P A;  1E8X A;  2G4S A;  1EF5 A;  3HIZ A;  2PE9 A;  3ZNZ B;  4BOS C;  2ZZP B;  2DHZ A;  3H9D A;  4GGQ A;  1YIW A;  3W1S C;  3L16 A;  3JSV A;  2HD5 B;  3VDZ A;  5CHF A;  4AJY B;  3L17 A;  5E6N A;  1UD7 A;  2ZVN A;  3BY4 B;  2KVR A;  3NY5 A;  3VUX A;  3S2A A;  2DZM A;  2XBB C;  1WXS A;  2KDE B;  2KK8 A;  4JL9 A;  2KTF A;  4N9F 4;  4MH0 E;  4DHJ D;  1P9D U;  2REX A;  4PYZ A;  5D7G A;  4K7U A;  5DPW A;  2K39 A;  2KJ6 A;  3PSE B;  4W9D A;  4EZL A;  5EDS A;  1BT0 A;  4DK5 A;  3A9J B;  3IVF A;  2D11 A;  3KW5 B;  4HK2 A;  2HTH A;  2IY0 B;  4IW0 A;  3DBS A;  3DVN V;  4W9C A;  3V6C B;  1S1Q B;  5AZG A;  3ZDT A;  3KH0 A;  4DHJ B;  5CHW A;  4PS8 A;  4DHZ E;  3K9O B;  3PVL A;  5L95 C;  2NPT A;  3ZVV A;  3PPA A;  3T8M A;  3WIM A;  2FCS A;  4W9E A;  5LLI A;  2AEH A;  5DPR A;  1IYF A;  5C1Z A;  3ZNI D;  4WJO A;  4TQ0 A;  4W9J A;  2LGY A;  3PLU A;  4KDI C;  4ANV A;  1OEY A;  2KQ7 A;  5J18 A;  2BPS A;  2JT4 B;  2MA9 B;  1G6J A;  4ICU A;  3ZW3 A;  3OJ4 B;  3R7Q A;  1D3Z A;  3OJ3 A;  2KKC A;  2XEW A;  1S3S G;  3A1Q A;  4G50 A;  2KTR B;  4TUU A;  3GZN I;  3DVG Y;  2JWZ A;  2LRW A;  4HDO A;  4JGH B;  3ZLZ A;  2RD0 A;  1VCB A;  1E5W A;  2QHO A;  3TCA A;  2R2O A;  2LVQ A;  4HCN B;  2PJH A;  3PLV A;  3W1Y A;  2GBN A;  2KQS A;  4J6I A;  1WX7 A;  2D3G A;  4WWN A;  4JLC A;  5J17 A;  4HXD A;  1GJZ A;  2KJH B;  3DBH I;  1QZE A;  4K1R B;  2BKF A;  2D10 A;  3M3J A;  2KMC A;  2N1W A;  4MSQ B;  4ZYN A;  2LVO A;  1UH6 A;  2C7H A;  2BKR B;  3B08 A;  4CYE A;  3VH4 B;  4HCP B;  3NOB A;  2BYE A;  2CU1 A;  2WX0 A;  1CMX B;  4BBN C;  4ANW A;  4BKS D;  3LJ3 A;  2MP2 B;  1MG8 A;  4MGY E;  1WIA A;  4BOZ B;  4DWF A;  2NCN A;  3M95 A;  1WYW B;  2N9P C;  4G11 A;  4ZDV A;  3APC A;  1GUA B;  3R3M A;  2LUE A;  3ZTC A;  4GSW A;  4M8M A;  4WWP A;  4KV2 A;  2O6V A;  1GG3 A;  3ENE A;  2L0T A;  2GBR A;  3PHX B;  2WWZ A;  3QAQ A;  5DCN A;  3TJP A;  4W9G A;  3WAN A;  1WGY A;  4IM2 A;  2D07 B;  3UGB B;  1KJT A;  2BGF A;  2DYO A;  2GOW A;  3EHV A;  5IAA C;  3ZNG C;  2M8S A;  3W1S A;  2O2V A;  2OJR A;  1WR1 A;  3O65 B;  5AZF A;  3U30 A;  5BO4 B;  2WX1 A;  2FCQ A;  2LJ5 A;  2KC1 A;  4MEL A;  2FAZ A;  3ZRF A;  2CR5 A;  3QCA A;  3QA8 A;  4MGI E;  1FXT B;  1Q0W B;  2ZPY A;  4GXB A;  3ZDM C;  3RZW C;  2M1M A;  4MM3 A;  1WI0 A;  2JVC A;  4GMV A;  3SU8 X;  3VQI A;  4K81 A;  4G3X B;  3VH3 B;  3VXW A;  2ZCC A;  2L7R A;  3ZRC A;  4AP4 C;  1OQY A;  1RRB A;  4K7W A;  1A5R A;  2PEA A;  3QK0 A;  5D6J B;  1P3Q U;  3PRE A;  2L0F A;  1UEL A;  3IHP C;  1K8R B;  3VVW B;  1J8C A;  3CSF A;  5AZH A;  4KSK C;  5LXI B;  3AI5 A;  3TL5 A;  2RGF A;  1TTN A;  2MCN B;  4DDG D;  5JZE B;  2KFK A;  3L13 A;  1WJU A;  4BKG A;  4LJO B;  2JZ3 B;  1LM8 B;  2KC2 A;  2GBJ A;  4EUT A;  4W9I A;  4AOF A;  1P0R A;  2GBK A;  3V60 A;  2MX2 A;  2JPH A;  4EFO A;  2ZEQ A;  2LWP A;  4P7I A;  3HK0 A;  4NQL B;  2KDB A;  1XD3 B;  2KLC A;  3ZO5 B;  2MLB A;  2IO1 B;  3V6E B;  1TBE A;  1LFD A;  2EMS A;  3JSV B;  3MTN B;  4FLH A;  4HJK A;  2IZV B;  3AXC A;  2V3S A;  3A33 B;  2HJ8 A;  4FA6 A;  3EC8 A;  4EZJ A;  3CMM B;  1J19 A;  2AYO B;  4GOC A;  4IG7 B;  4XC2 A;  2J0K A;  4FUL A;  1JRU A;  1C1Y B;  1H4R A;  1Q5W B;  3R66 C;  2MBO A;  4W9L A;  2FID A;  2RPQ A;  2N4F A;  3L0W B;  1F9J A;  4FAD A;  3KUC B;  1V81 A;  1SE9 A;  4IWQ A;  4EZK A;  1Y8R C;  3HM3 A;  3RD2 A;  2BF8 B;  2LXA A;  3VHT C;  2D2Q A;  3V62 A;  2IYD B;  2NBU A;  4XZ4 A;  3PRP B;  2AL3 A;  4FJV B;  2DZJ A;  3NHE B;  3DOW A;  3Q3F A;  4B6W A;  2BYF A;  4MSM B;  3TBL D;  2KFK B;  4MGZ E;  4GN1 A;  1GNU A;  2CS4 A;  4RM9 A;  2MP2 A;  1YJ1 A;  4TKN A;  2NR2 A;  2L3Z A;  3VTW A;  4E3C A;  3GOE A;  3H7P B;  2L8J A;  3DBR I;  3EFU A;  2V1Y A;  4ICV A;  3L08 A;  1E8Y A;  3OAW A;  2N9E B;  4RM8 A;  4W9F A;  4KIK A;  5KHO A;  4LDT B;  4MDK E;  4WQO B;  1M94 A;  3M62 B;  2IO2 B;  2N9X A;  3Q3J A;  4KVG B;  3CF6 E;  2C5L C;  4MGK E;  3ML9 A;  1GC7 A;  5IA7 A;  3M63 B;  4X57 B;  3BIN A;  1WX8 A;  4II2 B;  4ZRJ A;  1KLV A;  3OLM D;  1V80 A;  4EOY A;  3VTU A;  4MJS B;  2Z59 B;  1TZ1 A;  3RUL A;  2K1F A;  2JY6 A;  3SDL C;  3ML8 A;  3PHW B;  5FR6 A;  3UIP B;  3PZD A;  1WJ4 A;  3VUW A;  3UQB A;  5CHV C;  1WGR A;  2NPT B;  2A5U A;  4PYU A;  4F7Z A;  4HPM B;  2L05 A;  1KOT A;  1UZX B;  2JRI B;  2IO0 B;  4DXA B;  3TMP B;  2C9W B;  2Y5B B;  5E6P A;  1I42 A;  2EMT A;  3KVF B;  2NS5 A;  3MHS D;  3ZIM A;  5AEK B;  2IO3 B;  2ZPN A;  1KM7 A;  5E6O A;  3L54 A;  4ZRK A;  1LXD A;  5D94 A;  2R2Q A;  4W9H A;  4HPL B;  4DBG A;  4II3 B;  4EKU A;  3U8Z A;  4JQW C;  1ZGU B;  5TR5 A;  4GB9 A;  3KYC D;  3PV1 A;  1X1M A;  3QAR A;  1YQB A;  4BFR A;  3ZNH B;  1WM2 A;  3WAO A;  1TGZ B;  4IWO A;  4M0W B;  4F8C B;  1Z5S B;  2C7M B;  2BYV E;  1V86 A;  4MEM A;  4NNJ B;  3RYT A;  4A20 A;  3AUL A;  1U4A A;  5LXH A;  2KFJ A;  3NS8 A;  4W9K A;  5HKH A;  4GDL A;  4URK A;  4AWJ A;  3PS6 A;  1E7V A;  2KLG A;  4ZRI A;  4BKS A;  4LDT D;  3ECI A;  3N3K B;  3H6N A;  2C60 A;  2KTR A;  1WX9 A;  1WMH A;  1WJ6 A;  1XQQ A;  2VRR B;  4GU2 A;  2G4D B;  1IP9 A;  2EKE C;  2M0X A;  2M4N A;  5C23 A;  3NZS A;  4A3P A;  2YVC A;  2K8C A;  3DVN U;  2LI5 A;  3D32 A;  4OVU A;  3KYD D;  2J0J A;  4IM0 A;  3DDC B;  2DAJ A;  5L83 A;  2J0M A;  4GIV A;  1J0G A;  1L2N A;  2GBM A;  3JW0 X;  3QQ8 B;  2CHW A;  3ZKJ C;  2KDI A;  1SGH A;  3WA0 A;  3PGE A;  1E8Z A;  3LDZ E;  1WM3 A;  3X0W A;  4LCD E;  1EO6 A;  3L10 B;  1WGD A;  2CHZ A;  1SIF A;  4I6N B;  4A3O A;  4ASW C;  5KHQ A;  4FJZ A;  3IFW B;  1PQS A;  2KHW B;  3H1U A;  3B0A A;  4ANU A;  4K7S A;  3A9J A;  1HE8 A;  2W9N A;  2MSE D;  4GDK B;  1OGW A;  2LXC A;  2FCM A;  2MW5 A;  2MBB B;  3V61 A;  4CHK A;  4NJ6 A;  2KAN A;  4IC7 B;  2AWT A;  2LAS A;  2WYQ A;  2IBI B;  5JH5 C;  2RR9 A;  4DDI D;  3R7R A;  2IY1 B;  2K6D B;  3PRM B;  2JXX A;  2LVP A;  2UWQ A;  2K8H A;  4FN2 A;  3UIO B;  1IPG A;  2N1V A;  4KZC A;  3RT3 B;  1ZKH A;  2NVU I;  2MQJ A;  1OTR B;  1RFA A;  1WH3 A;  2DYM A;  3UF8 A;  1WRD B;  2LGX A;  5JHA A;  3ALB A;  4NPN A;  3C0R B;  1V5O A;  1E7U A;  1H8C A;  2K25 A;  4G0N B;  3QC8 B;  4PS3 A;  4OVV A;  4NAW B;  2JRH A;  2KN5 A;  5CX3 A;  2LZ6 A;  1E90 A;  1EUV B;  2I1K A;  1OEY J;  2YLM A;  1WY8 A;  2ZVO A;  1V9J A;  1UBQ A; 
#chains in the Genus database with same CATH topology
 2RSU A;  2M17 A;  2IJ0 A;  3A9K A;  3DPD A;  4RF0 A;  1FNU A;  1KH0 A;  1JWU D;  2WDT B;  2WXI A;  3RNB C;  2CHX A;  2UYZ B;  4TQ1 A;  2N7D A;  3QJZ A;  5CTR C;  3ZUN A;  1F1H A;  2L52 A;  1HZ6 A;  1WE7 A;  1ZW7 A;  2QIL A;  2KDF B;  4AUQ C;  3ONS A;  2LJI A;  2W82 A;  2IDY A;  4NQK E;  3KUD B;  4MM3 B;  1WXM A;  3QIJ A;  1WZ0 A;  2KZR A;  1SF0 A;  2DEN B;  3WAM A;  4YTN B;  3H7P A;  1C4A A;  2N0S B;  3AH7 A;  2NBW B;  2X38 A;  2XK5 B;  1V2Y A;  1UF0 A;  2Z0D B;  2MRP A;  3A9K B;  3HM6 X;  2KWV B;  1TYG B;  4ANX A;  2CJO A;  2ZJD A;  3K9P B;  1GB4 A;  1VLB A;  5HFY A;  2W55 A;  2O6V B;  3HUI A;  2PPH A;  3IAS 1;  3AE8 B;  4WJQ A;  1KTK A;  3JVZ X;  2L76 A;  3QWZ B;  4M8N A;  1YX6 B;  1ISN A;  1J7A A;  5IN7 A;  1VD2 A;  3KQ4 A;  2KMA A;  1WE6 A;  3MFG A;  4HDQ A;  1V49 A;  2BS3 B;  1Z2M A;  1T0Y A;  1RAX A;  2ZW0 A;  4M00 A;  4JIO U;  3FKY A;  5BYR A;  2MBE A;  3AM9 A;  2OOB B;  3T3N A;  1L0V B;  4S0R A;  1R4M I;  2QJL A;  1UGM A;  5IP4 D;  3BII D;  3VTV A;  1FPY A;  1V97 A;  4IWP A;  2LHE A;  2LD9 A;  4I6P A;  2DHZ A;  3L4P A;  3JSV A;  3VDZ A;  2WXJ A;  5CHF A;  2NTS A;  3RFZ B;  1UD7 A;  3HRD D;  3AE2 B;  2KDE B;  4MH0 E;  4NAM A;  4DHJ D;  2REX A;  3CIR B;  3IVF A;  2W54 A;  4IW0 A;  1F2R C;  3DBS A;  1FXA A;  3V6C B;  4YT0 B;  1QOF A;  1HEZ E;  4DHJ B;  5C3J B;  2NPT A;  3AB5 A;  3PPA A;  3T8M A;  2FCS A;  1IYF A;  1B1Z A;  2WXG A;  4KX6 B;  2BPS A;  2JT4 B;  3TEW A;  4ICU A;  1SIJ A;  4JWS C;  2AQ2 B;  2QCZ A;  4TUU A;  3A1Q A;  2OHF A;  3DVG Y;  2JWZ A;  3TCA A;  2LVQ A;  4HCN B;  2PJH A;  2HDE A;  4J6I A;  1WX7 A;  2D3G A;  3KLS X;  4JLC A;  2BKF A;  2D10 A;  4DXG A;  2N1W A;  1UH6 A;  3B08 A;  4CYE A;  4HCP B;  1UWX A;  4ARI A;  2L83 A;  4ANW A;  4D2K A;  1C79 A;  1FFV A;  1MG8 A;  3BYY B;  4BOZ B;  1RFK A;  3M95 A;  3NJT A;  2LUE A;  4M8M A;  3U4E G;  2WQY B;  2GBR A;  3PHX B;  5DCN A;  1WGY A;  4IM2 A;  2D07 B;  1T5X D;  2WNM A;  1KJT A;  3EHV A;  5IAA C;  3ZNG C;  5EE1 A;  3U30 A;  1STE A;  4MEL A;  1PGA A;  2M1M A;  4C7Z A;  2JVC A;  4GMV A;  3SU8 X;  4K81 A;  2LUM A;  1OQQ A;  3AEE B;  3VH3 B;  4AP4 C;  4XYC A;  1A5R A;  5D6J B;  3R8B A;  5TSS A;  1UNS A;  3C19 A;  1A70 A;  3CSF A;  3TL5 A;  1B9R A;  1TTN A;  2TSS A;  2KFK A;  4LJO B;  2JZ3 B;  1LM8 B;  2GBJ A;  5G5H A;  3N20 C;  4AOF A;  1P0R A;  3EFC A;  4M0W A;  2ZEQ A;  4NQL B;  2KDB A;  1XD3 B;  2MLB A;  3V6E B;  3JSV B;  4HJK A;  4FLH A;  3FIL B;  2BB6 A;  2V3S A;  3AEG B;  1H4R A;  1Q5W B;  2H89 B;  3R66 C;  1QIL A;  2RPQ A;  2IGH A;  2LGI A;  4FAD A;  2BVC A;  1SE9 A;  4IWQ A;  3U52 E;  3VHT C;  2LXA A;  2D2Q A;  4XZ4 A;  2XN9 C;  4M01 A;  4B6W A;  3Q3F A;  4A8X C;  1C77 A;  2D5G A;  2CS4 A;  4LTU A;  1FIQ A;  2MP2 A;  4LLG M;  2J52 A;  2NR2 A;  3DBR I;  2N9E B;  4RM8 A;  4KIK A;  4RH6 A;  4FXC A;  1M94 A;  2V3N A;  3M62 B;  4WQO B;  4KVG B;  4S17 A;  1HXY D;  1GB1 A;  4LNK A;  5IA7 A;  4GLS C;  1NEK B;  1KRH A;  2N9K A;  2WXR A;  3B9J A;  1KLV A;  3OLM D;  1ZDV A;  1TZ1 A;  2K1F A;  3SDL C;  3LYY A;  3ML8 A;  2YEP F;  2GI9 A;  3VUW A;  3UQB A;  2WXF A;  1WGR A;  2A5U A;  4ZRP A;  2IO0 B;  1HA5 A;  4DXA B;  1I42 A;  2BQQ A;  2GRI A;  2NS5 A;  2JSV X;  5E6O A;  1VZ6 A;  1VDV A;  1ACC A;  2R2Q A;  4W9H A;  2K5P A;  1E0Z A;  4JQW C;  4OW0 A;  3KYC D;  1MFW A;  3GB1 A;  5FK9 C;  3N1X C;  1X1M A;  1ZE3 D;  3QAR A;  1YQB A;  4L2Y A;  3WAO A;  4IWO A;  4WAF A;  2BYV E;  4MEM A;  3E9S A;  4URK A;  3TEX A;  1N5X A;  3PS6 A;  4IDI A;  1E7V A;  2KLG A;  3MC0 B;  1RYJ A;  2C60 A;  2G4D B;  4Q2J A;  4A9A A;  1T0R C;  4LNI A;  3D32 A;  3KYD D;  2J0J A;  2DAJ A;  2J0M A;  4GIV A;  1J0G A;  1ET9 A;  3ZQ4 A;  1TJE A;  2GBM A;  4P6V F;  1F2R I;  3QQ8 B;  3ZKJ C;  2QEJ C;  4JE3 B;  1WGD A;  4I6N B;  4REZ A;  2ACZ B;  1TKY A;  3IFW B;  1PQS A;  1F52 A;  4DQO C;  2KHW B;  3DWM A;  3H1U A;  2M56 B;  2L1A A;  1OGW A;  2LXC A;  2FCM A;  4LNF A;  1XF5 L;  2MBB B;  4IC7 B;  3GE3 C;  3BK1 A;  3T3O A;  4YXD B;  1SJE D;  2K6D B;  2K22 A;  1OQR A;  2N1V A;  1ZKH A;  2NVU I;  2MQJ A;  2DYM A;  1WRD B;  2LGX A;  2PW9 A;  1V5O A;  1DGJ A;  3GE8 C;  4G0N B;  4OHJ A;  4YSZ B;  2JRH A;  2KN5 A;  1E90 A;  2HJ1 A;  2I1K A;  2PLP A;  4AJW A;  2ZVO A;  1V9J A;  4LNN A;  1UBQ A;  2NBV B;  1ESF A;  3IBE A;  2PE6 B;  3RNC C;  3GP7 A;  3AE9 B;  2RDG A;  4IOI E;  3SFE B;  4NJ7 A;  1E9M A;  2PTL A;  5H8Y E;  1V5T A;  2BTE A;  4BVU C;  3APF A;  1QOB A;  3Q2A C;  3NVV A;  2G45 B;  2XK5 A;  4WJP A;  4JX1 C;  2KNB A;  4PT5 A;  3I63 C;  4KZ0 A;  4B95 A;  4J3O D;  4FJY A;  1MJD A;  2PVG C;  2UU7 A;  4DHZ B;  3DHI C;  1JCK B;  1JML A;  3P2B A;  2RDB C;  4RGM A;  2WHI A;  4RF1 A;  3WAP A;  2FIF A;  4EEW A;  3RN9 C;  3VUY A;  3A4S C;  4BBN F;  1V1P B;  5IKC M;  1HTQ A;  1XT9 B;  3A4R A;  4WWO A;  2OJW A;  3CST A;  1C9F A;  3BVG A;  1P1A A;  2KD0 A;  3AED B;  1NBF C;  2ON8 A;  4KSL C;  3KUZ A;  3MHZ A;  2AL6 A;  2ZNV C;  3N30 A;  2FNJ B;  3AU5 A;  3EEC A;  4TSS A;  2FCN A;  1WZ3 A;  2DX5 B;  2WXO A;  5D2M B;  1WMH B;  4HWI B;  4E74 A;  3N32 A;  4P16 A;  3AE7 B;  3B1L X;  4TMA B;  4C4V A;  2MBH A;  4PK1 A;  4GDL B;  1YX5 B;  1P98 A;  4PS7 A;  4XX5 A;  1I4G A;  3QHT A;  2JZZ A;  3BVM A;  4BAX A;  1WJN A;  4KKJ A;  1RLF A;  4IUM B;  1WFY A;  4RMA A;  1XO3 A;  4NY0 A;  4B9K A;  2PKO A;  4E71 A;  2WDV B;  4TV3 A;  4WAA A;  5DPT A;  3DQV A;  1EF5 A;  4BOS C;  2SEB D;  1YIW A;  3L16 A;  1ROE A;  3VUX A;  3BY4 B;  2DZM A;  2KK8 A;  4JL9 A;  4N9F 4;  5D7G A;  3MJ5 A;  2VH1 A;  2KT7 A;  4W9D A;  5EDS A;  1TS4 A;  3A9J B;  4HK2 A;  2D11 A;  3KW5 B;  2HTH A;  1S1Q B;  5AZG A;  3ZDT A;  4L1B A;  5CHW A;  4PS8 A;  3GZN B;  3PVL A;  5L95 C;  5IOI A;  2AEH A;  5C1Z A;  3ZNI D;  3AV8 A;  4TQ0 A;  3Q8B A;  2BBC A;  4KDI C;  4ANV A;  5J18 A;  1N63 A;  3V05 A;  2QMT A;  2WXQ A;  1D3Z A;  2XEW A;  1S3S G;  2LRW A;  4JGH B;  3ZLZ A;  1E5W A;  2INN E;  2QHO A;  3PLV A;  1D5M C;  3W1Y A;  1NVI D;  2MHJ A;  2NTT A;  1GJZ A;  2M0A A;  2KJH B;  3DBH I;  1QZE A;  1IGC A;  1FXI A;  4MSQ B;  3VH4 B;  2CU1 A;  1CMX B;  2IGD A;  1SB3 C;  4B0E A;  4MGY E;  1BUI C;  2N9P C;  1GUA B;  4KV2 A;  1GG3 A;  3ENE A;  3ABV B;  4RGO S;  4OZB A;  2WWZ A;  1FFU A;  2WDQ B;  4HEA 1;  3NZ3 A;  1WR1 A;  4RCO A;  2FCQ A;  3B2F A;  2KC1 A;  1FRD A;  1XXG A;  3ZRF A;  1BML C;  3QCA A;  3QA8 A;  4MAC A;  2BT6 A;  3P42 A;  1WI0 A;  3VQI A;  4G3X B;  2L7R A;  3V3X A;  1OQY A;  3QK0 A;  1WRI A;  1CK1 A;  2L0F A;  1J8C A;  3W9C B;  2RGF A;  4DDG D;  3ZYY X;  3P4P B;  3AE5 B;  4L23 A;  4EUT A;  4MT5 A;  2JPH A;  4EFO A;  3HK0 A;  2WXL A;  2D3A A;  1TT5 B;  3ZO5 B;  1TBE A;  1LFD A;  3MTN B;  3VRA B;  2B76 B;  1XCT L;  3A33 B;  1D5Z C;  3Q3M C;  1QQR A;  1YQ4 B;  2J0K A;  4FUL A;  2FID A;  3L0W B;  1K52 A;  2FBW B;  4YSY B;  1JRO A;  4AS1 A;  3PO0 A;  3V62 A;  1OFF A;  3KWL A;  3PRP B;  2IGG A;  3DBH B;  3DOW A;  2JYT A;  2KFK B;  1NI3 A;  4MGZ E;  1QOG A;  1SE3 A;  1GNU A;  4A55 A;  1VJK A;  3VTW A;  1WXQ A;  3EFU A;  2V1Y A;  4M02 A;  2V9H A;  2IO2 B;  4MGK E;  4XGA B;  3ML9 A;  1GC7 A;  4N59 A;  1V1O A;  3M63 B;  1WX8 A;  3LXF A;  5C2T B;  3ZJV A;  4MJS B;  4ZYS A;  5FR6 A;  2NPT B;  1GPX A;  1UZX B;  3TMP B;  2C9W B;  2Y5B B;  3P63 A;  1RWS A;  2IO3 B;  3L54 A;  2J42 A;  1LXD A;  3ZJT A;  5D94 A;  4HPL B;  4DBG A;  4EKU A;  1NYR A;  4RGN A;  3PV1 A;  1YOV B;  4M0W B;  2C7M B;  3SEB A;  5I4D A;  1V86 A;  2JQR B;  3HVZ A;  1TIF A;  2WU5 B;  3AUL A;  3GS2 A;  4C4V B;  3NS8 A;  4W9K A;  1MG4 A;  4GDL A;  4AWJ A;  1PDX A;  1SXT A;  4LDT D;  3N3K B;  2KN4 A;  4GU2 A;  1VZ8 A;  2VRR B;  5C23 A;  2FE8 A;  4A3P A;  1GOZ A;  2LI5 A;  4IM0 A;  1JW9 D;  5L83 A;  4K3B A;  2CHW A;  2KDI A;  1SGH A;  3DHG C;  3C8Y A;  3LDZ E;  2MEK A;  3ZXV A;  4LCD E;  3L10 B;  2CHZ A;  1SIF A;  1PGB A;  2QC8 A;  3A9J A;  1HE8 A;  4GDK B;  2MW5 A;  4NJ6 A;  2KAN A;  3BZD B;  2Y5P A;  2INP E;  3AE3 B;  2JXX A;  3KWV A;  1GAQ B;  1RFA A;  1SE2 A;  1I4R A;  1AW7 A;  3UF8 A;  1XLP A;  2RDH A;  3C0R B;  1H8C A;  1SE4 A;  3OWE B;  4OVV A;  4A6Q A;  2V4I B;  1JAL A;  5HG2 A;  1LO5 D;  3TUO A;  2FUG 1;  4YSX B;  1C76 A;  1EF1 A;  1AAR A;  3UI3 A;  1QKZ A;  2HE7 A;  3DVG X;  5BYS A;  4WJN A;  3FIL A;  3VAW A;  1K53 A;  3N9Y C;  2O6V D;  2N7E A;  3RUI B;  3UQA A;  2R61 A;  4LK0 M;  1AWD A;  4NZL B;  4CO7 A;  1I4H A;  3H8H A;  2KOX A;  1NDD A;  2I1J A;  3QX1 A;  4HPP A;  3EUB 2;  2FUH B;  3T9L A;  1E10 A;  2KWC A;  1PFD A;  2I38 A;  1JWB D;  1L6U A;  4IM3 A;  4HLE A;  3X23 A;  3W5V B;  5D3D A;  1CQV A;  2JF5 A;  1FNW A;  1YD8 U;  2K6Q A;  2DZI A;  2MBQ A;  4EE2 A;  1UBI A;  3IT4 B;  4A90 A;  3PT2 B;  5DPS A;  1V6E A;  1YJJ A;  2KX3 A;  2YEP B;  4KKI A;  3PTF C;  4C56 C;  3RNF C;  3P1M A;  5EE3 A;  2LRU A;  2LGS A;  2BWE S;  3I3T B;  3RZF A;  2Z0E B;  5BMH A;  1CZP A;  2ONQ A;  4XE0 A;  1C3T A;  2B3A A;  4I6L B;  3AU4 A;  4MJS A;  2K8B A;  4NAW A;  3ZXR A;  1R4M B;  2V4L A;  2WLB A;  1WXV A;  3H7S A;  3RMK C;  1N62 A;  3Q3N C;  2VZK D;  1LQB A;  2KXJ A;  3JYU A;  1WGK A;  2KO3 A;  3EA6 A;  3MC9 A;  3MJW A;  1PYW D;  2RMM A;  2KQ4 X;  4LJP B;  5JHB A;  4F1S A;  5G55 A;  3APD A;  2CU3 A;  2ZCB A;  2WXH A;  2ICI A;  4GDK A;  3P4S B;  3IG3 A;  2X8X X;  4KDL B;  2ZW1 A;  2J53 A;  2Z8L A;  2MWS B;  2WU2 B;  3RCZ A;  1TZO A;  5MPO A;  3HIZ A;  1FO4 A;  1SEB D;  3ZNZ B;  2ZZP B;  1KFY B;  3U2S C;  2HD5 B;  3RI7 C;  4AJY B;  4WWM A;  3L17 A;  2Y5C A;  2WXN A;  1WXS A;  2KTF A;  2KAC A;  1Y56 A;  3AEF B;  5DPW A;  2K39 A;  3PSE B;  4EZL A;  4DK5 A;  1FEH A;  1TS2 A;  3ETR A;  1L5P A;  3AE4 B;  4B0M A;  3KH0 A;  1WYG A;  4WIP A;  4DHZ E;  3K9O B;  3ZVV A;  3Q69 A;  5LLI A;  4W9J A;  1UUP A;  1I7H A;  3PLU A;  1G6J A;  1OEY A;  1MVK A;  2MA9 B;  3NS1 A;  3R7Q A;  2AQ3 B;  4ZRI A;  4G50 A;  1PUT A;  1UGJ A;  2K0P A;  3W2D A;  2R2O A;  1EWY C;  2W3S A;  3HVD A;  3NVY A;  1XLO A;  2EEL A;  1YN3 A;  2JZP A;  4HXD A;  5H92 C;  4JWU C;  4K1R B;  3M3J A;  4ZYN A;  1ZXI A;  2KYW A;  3NOB A;  2BYE A;  2J4X A;  1RM6 C;  2V3P A;  4BBN C;  4BKS D;  3LJ3 A;  4OZC A;  2L32 A;  1HTO A;  1N61 A;  1XCQ L;  3Q8C A;  1WIA A;  1C4P A;  1L6V A;  2LHD A;  4DWF A;  1WYW B;  2DLB A;  4XDC A;  3ZTC A;  1V8C A;  2O6V A;  5AUK A;  1IBX B;  2DYO A;  2M8S A;  2O2V A;  2QSD A;  4ARC A;  2FAZ A;  4ZHP A;  3NRZ A;  4HRO A;  2CR5 A;  4MGI E;  1Q0W B;  2JX5 A;  2ZPY A;  4MM3 A;  1CJE A;  2KDM A;  2OED A;  1I4P A;  4WH4 A;  3ZRC A;  4K7W A;  5JXV A;  2PEA A;  3N1Y C;  5E6J A;  3PZ8 A;  4RGT A;  3FC4 A;  1E6E B;  5LXI B;  3AI5 A;  3W5U B;  2MCN B;  1F77 A;  2QDF A;  4BKG A;  1FCL A;  3VRB B;  3Q8E A;  3PZ7 A;  4KGS A;  3V60 A;  2LWP A;  4R3D A;  2KLC A;  1FD6 A;  3N1Z C;  1F0Z A;  2LEK A;  2IZV B;  3AXC A;  3OG5 A;  4FA6 A;  4EZJ A;  4XDD A;  2AYO B;  4GOC A;  4IG7 B;  1IBX A;  4C80 A;  2MBO A;  3LB8 C;  4W9L A;  2N4F A;  1F9J A;  3KUC B;  1E7P B;  1V81 A;  4P1B C;  3AEC B;  4EZK A;  1Y8R C;  3RD2 A;  1HZ5 A;  3U7Z A;  1JQ4 A;  4RFB A;  5JZE B;  1HQR D;  2DZJ A;  3NHE B;  2QIE B;  2BYT A;  2KAJ A;  2K9X A;  4MSM B;  1D5X C;  1LGR A;  1I4X A;  4GN1 A;  3I57 A;  2N7J A;  1NEN B;  1NYQ A;  4TKN A;  4E3C A;  1L0Y B;  3H7P B;  5LNK 1;  1DYQ A;  3L08 A;  3OAW A;  4MDK E;  4N6E B;  4YTP B;  2WXP A;  3BIN A;  4II2 B;  1V80 A;  1IGD A;  4EOY A;  1TY2 A;  2JY6 A;  1J7B A;  2G9H D;  3PZD A;  3UIP B;  1WJ4 A;  1EM7 A;  5CHV C;  4F7Z A;  1AN8 A;  3AE6 B;  2L05 A;  4HPM B;  1KOT A;  2EMT A;  3KVF B;  3MHS D;  3ZIM A;  1R7S A;  1KM7 A;  4ZRK A;  4DXF A;  4II3 B;  3U8Z A;  1ZGU B;  3DBL B;  5TR5 A;  2JYE A;  1FRR A;  2WP9 B;  2XNA C;  4ZHO A;  3BVZ A;  4QAY A;  3ZNH B;  5HI1 A;  4F8C B;  4A20 A;  4KGT A;  4US8 A;  1J7C A;  1U4A A;  4HKZ E;  2KFJ A;  1EU4 A;  5HKH A;  1XLQ A;  4BKS A;  3ECI A;  4OVZ A;  3H6N A;  1T0Q C;  1WMH A;  2WGS A;  2VH2 A;  3MC8 A;  2EKE C;  2K8C A;  3DVN U;  4O1N A;  3DDC B;  1VRA B;  1L2N A;  3JW0 X;  3WA0 A;  3PGE A;  1E8Z A;  3X0W A;  1DOY A;  3IAM 1;  1XEE A;  2W3R A;  2INC C;  2M19 A;  4ASW C;  4FJZ A;  1JWS D;  2NMQ A;  3B0A A;  2KWD A;  1TY0 A;  3V61 A;  4CHK A;  2JXT A;  2AWT A;  2LAS A;  5JH5 C;  2IBI B;  4DDI D;  3R7R A;  3UIO B;  1IPG A;  4KZC A;  3RT3 B;  3SFD B;  1OTR B;  1Q10 A;  1T0S C;  5JHA A;  2H88 B;  4NPN A;  3NUH B;  1E7U A;  2K25 A;  3QC8 B;  5FR3 A;  1QF6 A;  4NAW B;  2KMM A;  1EUV B;  3AN1 A;  1MHX A;  2A4Z A;  4WUR A;  4FBJ B;  2CJN A;  4FHJ A;  1I35 A;  2KWU B;  1E8W A;  2BWF A;  1R4N I;  2JUO A;  1TKG A;  4JPS A;  3A1Q B;  3U7D A;  3DBL I;  4YL8 A;  2GMI C;  2D3C A;  1Q1O A;  2ZNV B;  3DCG A;  1GC6 A;  1EWC A;  1L7Y A;  2PVO D;  3ZTD A;  4HVB A;  3UIN B;  2Q5W D;  1C78 A;  2KVZ A;  2ASQ A;  3SHQ A;  1WR6 E;  3BYT B;  2L00 B;  3PRZ A;  4ZRQ A;  2J7Q B;  1WF9 A;  2KJR A;  2G3Q B;  5J2R A;  4MH8 A;  5GMV A;  5BMG A;  2E6X A;  4US9 A;  2DZK A;  3NG0 A;  3AEA B;  3FAH A;  3HHM A;  3MP9 A;  2LGD A;  3SR6 A;  2KX0 A;  1WXA A;  3J9C A;  4ITK A;  4BZA A;  3NZU A;  2PMV A;  2O2V B;  1TS5 A;  5G2N A;  4KIK B;  1KLU D;  1QLB B;  1NI2 A;  3CWI A;  3TIX A;  2E3T A;  1L4Z B;  3VR9 B;  3I9V 1;  4IKG A;  1I4Q A;  2DYB A;  3P4Q B;  2BW2 A;  1ENF A;  3O13 A;  2AX5 A;  5HHD G;  5GXG B;  2Y3A A;  3SD5 A;  1WGG A;  4RNA A;  3WAL A;  2DAF A;  4BKT A;  2BS4 B;  3VFK A;  3R2I A;  4FHK A;  5FKA C;  2IPK D;  2LMC A;  3RNG C;  1ZOY B;  2CKH B;  1WGH A;  3AMZ A;  2C7N B;  1VZ7 A;  1E8X A;  2G4S A;  2PE9 A;  4GGQ A;  4XWW A;  3H9D A;  3W1S C;  1EU3 A;  5E6N A;  3NY5 A;  2ZVN A;  2KVR A;  3S2A A;  2XBB C;  1ZDX A;  1MHH E;  1P9D U;  1T3Q A;  2MJE A;  4PYZ A;  4K7U A;  2KJ6 A;  1BT0 A;  1DOI A;  2IY0 B;  1MI0 A;  1BXT A;  2SAK A;  3DVN V;  4W9C A;  2WDR B;  4YTM B;  1P7E A;  3WIM A;  1TKE A;  4W9E A;  2I2Y A;  5DPR A;  4C00 A;  4LNO A;  4WJO A;  2LGY A;  2KQ7 A;  1YJI A;  1MPE A;  3ZW3 A;  5T8I A;  3OJ4 B;  3OJ3 A;  2KKC A;  1AYF A;  2KTR B;  3GZN I;  5IO9 A;  4HDO A;  3AE1 B;  2RD0 A;  1VCB A;  2N9L A;  5EE0 A;  2GBN A;  2KQS A;  3I5J C;  4WWN A;  3IT6 B;  5J17 A;  5EE9 A;  2V0G A;  1N6Z A;  4XWT A;  1XLN A;  3NVZ A;  2KMC A;  1YQ3 B;  1FNV A;  2LVO A;  2C7H A;  2BKR B;  2WX0 A;  1YN5 A;  3ZGZ A;  1ET6 A;  2MP2 B;  3VR8 B;  1N5W A;  2NCN A;  1ZUD 2;  4G11 A;  4ZDV A;  3APC A;  3R3M A;  3BK2 A;  4GSW A;  4WWP A;  3BWU D;  2L0T A;  1ZXH A;  3TJP A;  3QAQ A;  4W9G A;  3WAN A;  1TS3 A;  3UGB B;  2BGF A;  2GOW A;  3W1S A;  2OJR A;  3O65 B;  5AZF A;  2GB1 A;  2WX1 A;  5BO4 B;  2GLS A;  2LJ5 A;  1FXT B;  4KGR A;  3P4R B;  4GXB A;  2WS3 B;  3ZDM C;  3RZW C;  3IXS A;  3DWG C;  3VXW A;  2K3U A;  1YNT E;  2ZCC A;  4C7Y A;  3AEB B;  1RRB A;  2DNF A;  1V1P A;  1P3Q U;  3PRE A;  4USA A;  3DBR B;  4ACF A;  1UEL A;  3IHP C;  1K8R B;  3ZJU A;  3VVW B;  2MH7 A;  3B2G A;  2DBY A;  5AZH A;  4KSK C;  3L13 A;  4HJG E;  4HKQ A;  1WJU A;  2KC2 A;  4W9I A;  1SBB B;  2GBK A;  1JWM D;  2MX2 A;  1FM0 D;  2HTM E;  4P7I A;  2WXM A;  3Q8F A;  2IO1 B;  1P7F A;  4N58 A;  2EMS A;  1C4C A;  2HJ8 A;  3EC8 A;  3CMM B;  1J19 A;  4XC2 A;  4H2A A;  2LFI A;  3DHH C;  2JU6 X;  1JRU A;  1C1Y B;  4AQ7 A;  2BS2 B;  4UDU C;  3TSS A;  1D4B A;  3HM3 A;  2BF8 B;  2IYD B;  2NBU A;  2AL3 A;  4FJV B;  2BYF A;  3TBL D;  3TEY A;  1WWT A;  1R4N B;  4RM9 A;  1YJ1 A;  1K50 A;  2L3Z A;  3GOE A;  2L8J A;  1UWM A;  3Q14 C;  4ICV A;  1IUE A;  1E8Y A;  2JWU A;  4ZOH C;  2BB5 A;  3NVW A;  4W9F A;  5KHO A;  4LDT B;  3RNA C;  2N9X A;  3Q3J A;  3CF6 E;  2C5L C;  4WQM A;  4X57 B;  1SJH D;  4ZRJ A;  3VTU A;  1VR9 A;  2Z59 B;  3RUL A;  1L4D B;  3PHW B;  4NJC A;  1KLG D;  5G5G A;  4CQN A;  3EGR A;  4PYU A;  1K51 A;  3URY A;  2JRI B;  5E6P A;  5AEK B;  2ZPN A;  1L0X B;  5AUI A;  1JWA D;  1D6E C;  2EKI A;  4GB9 A;  2D3B A;  4BFR A;  1ZPS A;  1WM2 A;  1TGZ B;  3Q6B A;  1Z5S B;  4NNJ B;  3RYT A;  1DOX A;  1JRP A;  1WSP A;  5LXH A;  1SSN A;  2AQ1 B;  3Q3O C;  1FCC C;  4K3C A;  3RNE C;  2KTR A;  4P1C C;  1WX9 A;  1WJ6 A;  3Q8A A;  1XQQ A;  1IP9 A;  2M0X A;  2M4N A;  4HRS A;  2YVC A;  1FMA D;  4OVU A;  1YN4 A;  5D3I B;  4OZA A;  1YMH E;  3E56 A;  1M4V A;  1WM3 A;  5BMI A;  2IND C;  1EO6 A;  2G1E A;  3RPF C;  4A3O A;  2MJD A;  1N60 A;  1QOA A;  5KHQ A;  2WXK A;  4YWG G;  1QT9 A;  1T6B X;  4ANU A;  2RPV A;  3TEZ A;  4K7S A;  2MJ3 A;  2PIA A;  2W9N A;  2MSE D;  2WYQ A;  2RR9 A;  2DWQ A;  2IY1 B;  3PRM B;  4FN2 A;  2LVP A;  1ZP0 B;  2K8H A;  2UWQ A;  1WH3 A;  5BYQ A;  3ALB A;  1PGX A;  4PS3 A;  3WCQ A;  5CX3 A;  2LZ6 A;  2VZK B;  3R2T A;  1KF6 B;  1OEY J;  2YLM A;  1WY8 A;  3NZS A; 
#chains in the Genus database with same CATH homology
 2NBV B;  2RSU A;  2M17 A;  3A9K A;  2A4Z A;  3DPD A;  3IBE A;  4FBJ B;  2PE6 B;  4FHJ A;  1I35 A;  2KWU B;  1EF1 A;  1E8W A;  1AAR A;  4NJ7 A;  2BWF A;  2WDT B;  1R4N I;  2JUO A;  1V5T A;  4BVU C;  2HE7 A;  3DVG X;  3APF A;  4WJN A;  2CHX A;  3VAW A;  2UYZ B;  3A1Q B;  4TQ1 A;  3U7D A;  2N7D A;  2G45 B;  3DBL I;  2GMI C;  4YL8 A;  2XK5 A;  4WJP A;  2O6V D;  3QJZ A;  5CTR C;  3ZUN A;  2N7E A;  1Q1O A;  2KNB A;  2ZNV B;  4KZ0 A;  3RUI B;  4B95 A;  3DCG A;  3UQA A;  1WE7 A;  1GC6 A;  1ZW7 A;  4FJY A;  4DHZ B;  2KDF B;  1L7Y A;  4AUQ C;  3ONS A;  3ZTD A;  4CO7 A;  4HVB A;  2KOX A;  1NDD A;  3UIN B;  2I1J A;  3QX1 A;  3P2B A;  2FUH B;  4NQK E;  3T9L A;  2ASQ A;  2KWC A;  3SHQ A;  1WR6 E;  3KUD B;  2L00 B;  3WAP A;  1WXM A;  3QIJ A;  2FIF A;  4EEW A;  4IM3 A;  3PRZ A;  1WZ0 A;  2J7Q B;  2KZR A;  4HLE A;  2DEN B;  1WF9 A;  3X23 A;  3WAM A;  3VUY A;  3A4S C;  2KJR A;  3H7P A;  4BBN F;  2G3Q B;  5J2R A;  2NBW B;  5GMV A;  1XT9 B;  3A4R A;  2JF5 A;  4WWO A;  1YD8 U;  2K6Q A;  2DZK A;  2DZI A;  2XK5 B;  2MBQ A;  3HHM A;  1V2Y A;  4AJW A;  2Z0D B;  3CST A;  2LGD A;  2MRP A;  2KX0 A;  1P1A A;  1WXA A;  3A9K B;  2KD0 A;  3HM6 X;  2KWV B;  1UBI A;  1NBF C;  3PT2 B;  5DPS A;  3NZU A;  4ANX A;  1V6E A;  4KSL C;  2KX3 A;  2O2V B;  2ZJD A;  3KUZ A;  3K9P B;  2AL6 A;  2ZNV C;  5G2N A;  3N30 A;  4KIK B;  2FNJ B;  3AU5 A;  3EEC A;  2FCN A;  3PTF C;  1NI2 A;  1WZ3 A;  2O6V B;  2DX5 B;  2LRU A;  2PPH A;  3TIX A;  5D2M B;  1WMH B;  2BWE S;  3I3T B;  4HWI B;  4WJQ A;  3RZF A;  3JVZ X;  4E74 A;  3N32 A;  2L76 A;  3QWZ B;  4M8N A;  3B1L X;  2Z0E B;  1YX6 B;  1ISN A;  1C3T A;  2B3A A;  4I6L B;  3AU4 A;  4MJS A;  2K8B A;  2MBH A;  2DYB A;  4NAW A;  1VD2 A;  4GDL B;  1YX5 B;  2KMA A;  1P98 A;  4PS7 A;  4XX5 A;  2V4L A;  3H7S A;  1WXV A;  1WE6 A;  4HDQ A;  1V49 A;  1Z2M A;  1LQB A;  1T0Y A;  3QHT A;  1RAX A;  2JZZ A;  1WJN A;  2KXJ A;  3JYU A;  1RLF A;  2KO3 A;  4JIO U;  3SD5 A;  1WGG A;  3MJW A;  3WAL A;  2DAF A;  2MBE A;  4IUM B;  4LJP B;  5JHB A;  4F1S A;  4BKT A;  5G55 A;  3APD A;  1WFY A;  4RMA A;  2ZCB A;  2OOB B;  4NY0 A;  3VFK A;  4GDK A;  4B9K A;  4E71 A;  4FHK A;  3IG3 A;  1R4M I;  4TV3 A;  4WAA A;  1UGM A;  4KDL B;  3VTV A;  2CKH B;  1WGH A;  4IWP A;  5DPT A;  2MWS B;  2C7N B;  3DQV A;  2LD9 A;  3RCZ A;  4I6P A;  1E8X A;  2G4S A;  1EF5 A;  3HIZ A;  2PE9 A;  3ZNZ B;  4BOS C;  2ZZP B;  2DHZ A;  3H9D A;  4GGQ A;  1YIW A;  3W1S C;  3L16 A;  3JSV A;  2HD5 B;  3VDZ A;  5CHF A;  4AJY B;  3L17 A;  5E6N A;  1UD7 A;  2ZVN A;  3BY4 B;  2KVR A;  3NY5 A;  3VUX A;  3S2A A;  2DZM A;  2XBB C;  1WXS A;  2KDE B;  2KK8 A;  4JL9 A;  2KTF A;  4N9F 4;  4MH0 E;  4DHJ D;  1P9D U;  2REX A;  4PYZ A;  5D7G A;  4K7U A;  5DPW A;  2K39 A;  2KJ6 A;  3PSE B;  4W9D A;  4EZL A;  5EDS A;  1BT0 A;  4DK5 A;  3A9J B;  3IVF A;  2D11 A;  3KW5 B;  4HK2 A;  2HTH A;  2IY0 B;  4IW0 A;  3DBS A;  3DVN V;  4W9C A;  3V6C B;  1S1Q B;  5AZG A;  3ZDT A;  3KH0 A;  4DHJ B;  5CHW A;  4PS8 A;  4DHZ E;  3K9O B;  3PVL A;  5L95 C;  2NPT A;  3ZVV A;  3PPA A;  3T8M A;  3WIM A;  2FCS A;  4W9E A;  5LLI A;  2AEH A;  5DPR A;  1IYF A;  5C1Z A;  3ZNI D;  4WJO A;  4TQ0 A;  4W9J A;  2LGY A;  3PLU A;  4KDI C;  4ANV A;  1OEY A;  2KQ7 A;  5J18 A;  2BPS A;  2JT4 B;  2MA9 B;  1G6J A;  4ICU A;  3ZW3 A;  3OJ4 B;  3R7Q A;  1D3Z A;  3OJ3 A;  2KKC A;  2XEW A;  1S3S G;  3A1Q A;  4G50 A;  2KTR B;  4TUU A;  3GZN I;  3DVG Y;  2JWZ A;  2LRW A;  4HDO A;  4JGH B;  3ZLZ A;  2RD0 A;  1VCB A;  1E5W A;  2QHO A;  3TCA A;  2R2O A;  2LVQ A;  4HCN B;  2PJH A;  3PLV A;  3W1Y A;  2GBN A;  2KQS A;  4J6I A;  1WX7 A;  2D3G A;  4WWN A;  4JLC A;  5J17 A;  4HXD A;  1GJZ A;  2KJH B;  3DBH I;  1QZE A;  4K1R B;  2BKF A;  2D10 A;  3M3J A;  2KMC A;  2N1W A;  4MSQ B;  4ZYN A;  2LVO A;  1UH6 A;  2C7H A;  2BKR B;  3B08 A;  4CYE A;  3VH4 B;  4HCP B;  3NOB A;  2BYE A;  2CU1 A;  2WX0 A;  1CMX B;  4BBN C;  4ANW A;  4BKS D;  3LJ3 A;  2MP2 B;  1MG8 A;  4MGY E;  1WIA A;  4BOZ B;  4DWF A;  2NCN A;  3M95 A;  1WYW B;  2N9P C;  4G11 A;  4ZDV A;  3APC A;  1GUA B;  3R3M A;  2LUE A;  3ZTC A;  4GSW A;  4M8M A;  4WWP A;  4KV2 A;  2O6V A;  1GG3 A;  3ENE A;  2L0T A;  2GBR A;  3PHX B;  2WWZ A;  3QAQ A;  5DCN A;  3TJP A;  4W9G A;  3WAN A;  1WGY A;  4IM2 A;  2D07 B;  3UGB B;  1KJT A;  2BGF A;  2DYO A;  2GOW A;  3EHV A;  5IAA C;  3ZNG C;  2M8S A;  3W1S A;  2O2V A;  2OJR A;  1WR1 A;  3O65 B;  5AZF A;  3U30 A;  5BO4 B;  2WX1 A;  2FCQ A;  2LJ5 A;  2KC1 A;  4MEL A;  2FAZ A;  3ZRF A;  2CR5 A;  3QCA A;  3QA8 A;  4MGI E;  1FXT B;  1Q0W B;  2ZPY A;  4GXB A;  3ZDM C;  3RZW C;  2M1M A;  4MM3 A;  1WI0 A;  2JVC A;  4GMV A;  3SU8 X;  3VQI A;  4K81 A;  4G3X B;  3VH3 B;  3VXW A;  2ZCC A;  2L7R A;  3ZRC A;  4AP4 C;  1OQY A;  1RRB A;  4K7W A;  1A5R A;  2PEA A;  3QK0 A;  5D6J B;  1P3Q U;  3PRE A;  2L0F A;  1UEL A;  3IHP C;  1K8R B;  3VVW B;  1J8C A;  3CSF A;  5AZH A;  4KSK C;  5LXI B;  3AI5 A;  3TL5 A;  2RGF A;  1TTN A;  2MCN B;  4DDG D;  5JZE B;  2KFK A;  3L13 A;  1WJU A;  4BKG A;  4LJO B;  2JZ3 B;  1LM8 B;  2KC2 A;  2GBJ A;  4EUT A;  4W9I A;  4AOF A;  1P0R A;  2GBK A;  3V60 A;  2MX2 A;  2JPH A;  4EFO A;  2ZEQ A;  2LWP A;  4P7I A;  3HK0 A;  4NQL B;  2KDB A;  1XD3 B;  2KLC A;  3ZO5 B;  2MLB A;  2IO1 B;  3V6E B;  1TBE A;  1LFD A;  2EMS A;  3JSV B;  3MTN B;  4FLH A;  4HJK A;  2IZV B;  3AXC A;  2V3S A;  3A33 B;  2HJ8 A;  4FA6 A;  3EC8 A;  4EZJ A;  3CMM B;  1J19 A;  2AYO B;  4GOC A;  4IG7 B;  4XC2 A;  2J0K A;  4FUL A;  1JRU A;  1C1Y B;  1H4R A;  1Q5W B;  3R66 C;  2MBO A;  4W9L A;  2FID A;  2RPQ A;  2N4F A;  3L0W B;  1F9J A;  4FAD A;  3KUC B;  1V81 A;  1SE9 A;  4IWQ A;  4EZK A;  1Y8R C;  3HM3 A;  3RD2 A;  2BF8 B;  2LXA A;  3VHT C;  2D2Q A;  3V62 A;  2IYD B;  2NBU A;  4XZ4 A;  3PRP B;  2AL3 A;  4FJV B;  2DZJ A;  3NHE B;  3DOW A;  3Q3F A;  4B6W A;  2BYF A;  4MSM B;  3TBL D;  2KFK B;  4MGZ E;  4GN1 A;  1GNU A;  2CS4 A;  4RM9 A;  2MP2 A;  1YJ1 A;  4TKN A;  2NR2 A;  2L3Z A;  3VTW A;  4E3C A;  3GOE A;  3H7P B;  2L8J A;  3DBR I;  3EFU A;  2V1Y A;  4ICV A;  3L08 A;  1E8Y A;  3OAW A;  2N9E B;  4RM8 A;  4W9F A;  4KIK A;  5KHO A;  4LDT B;  4MDK E;  4WQO B;  1M94 A;  3M62 B;  2IO2 B;  2N9X A;  3Q3J A;  4KVG B;  3CF6 E;  2C5L C;  4MGK E;  3ML9 A;  1GC7 A;  5IA7 A;  3M63 B;  4X57 B;  3BIN A;  1WX8 A;  4II2 B;  4ZRJ A;  1KLV A;  3OLM D;  1V80 A;  4EOY A;  3VTU A;  4MJS B;  2Z59 B;  1TZ1 A;  3RUL A;  2K1F A;  2JY6 A;  3SDL C;  3ML8 A;  3PHW B;  5FR6 A;  3UIP B;  3PZD A;  1WJ4 A;  3VUW A;  3UQB A;  5CHV C;  1WGR A;  2NPT B;  2A5U A;  4PYU A;  4F7Z A;  4HPM B;  2L05 A;  1KOT A;  1UZX B;  2JRI B;  2IO0 B;  4DXA B;  3TMP B;  2C9W B;  2Y5B B;  5E6P A;  1I42 A;  2EMT A;  3KVF B;  2NS5 A;  3MHS D;  3ZIM A;  5AEK B;  2IO3 B;  2ZPN A;  1KM7 A;  5E6O A;  3L54 A;  4ZRK A;  1LXD A;  5D94 A;  2R2Q A;  4W9H A;  4HPL B;  4DBG A;  4II3 B;  4EKU A;  3U8Z A;  4JQW C;  1ZGU B;  5TR5 A;  4GB9 A;  3KYC D;  3PV1 A;  1X1M A;  3QAR A;  1YQB A;  4BFR A;  3ZNH B;  1WM2 A;  3WAO A;  1TGZ B;  4IWO A;  4M0W B;  4F8C B;  1Z5S B;  2C7M B;  2BYV E;  1V86 A;  4MEM A;  4NNJ B;  3RYT A;  4A20 A;  3AUL A;  1U4A A;  5LXH A;  2KFJ A;  3NS8 A;  4W9K A;  5HKH A;  4GDL A;  4URK A;  4AWJ A;  3PS6 A;  1E7V A;  2KLG A;  4ZRI A;  4BKS A;  4LDT D;  3ECI A;  3N3K B;  3H6N A;  2C60 A;  2KTR A;  1WX9 A;  1WMH A;  1WJ6 A;  1XQQ A;  2VRR B;  4GU2 A;  2G4D B;  1IP9 A;  2EKE C;  2M0X A;  2M4N A;  5C23 A;  3NZS A;  4A3P A;  2YVC A;  2K8C A;  3DVN U;  2LI5 A;  3D32 A;  4OVU A;  3KYD D;  2J0J A;  4IM0 A;  3DDC B;  2DAJ A;  5L83 A;  2J0M A;  4GIV A;  1J0G A;  1L2N A;  2GBM A;  3JW0 X;  3QQ8 B;  2CHW A;  3ZKJ C;  2KDI A;  1SGH A;  3WA0 A;  3PGE A;  1E8Z A;  3LDZ E;  1WM3 A;  3X0W A;  4LCD E;  1EO6 A;  3L10 B;  1WGD A;  2CHZ A;  1SIF A;  4I6N B;  4A3O A;  4ASW C;  5KHQ A;  4FJZ A;  3IFW B;  1PQS A;  2KHW B;  3H1U A;  3B0A A;  4ANU A;  4K7S A;  3A9J A;  1HE8 A;  2W9N A;  2MSE D;  4GDK B;  1OGW A;  2LXC A;  2FCM A;  2MW5 A;  2MBB B;  3V61 A;  4CHK A;  4NJ6 A;  2KAN A;  4IC7 B;  2AWT A;  2LAS A;  2WYQ A;  2IBI B;  5JH5 C;  2RR9 A;  4DDI D;  3R7R A;  2IY1 B;  2K6D B;  3PRM B;  2JXX A;  2LVP A;  2UWQ A;  2K8H A;  4FN2 A;  3UIO B;  1IPG A;  2N1V A;  4KZC A;  3RT3 B;  1ZKH A;  2NVU I;  2MQJ A;  1OTR B;  1RFA A;  1WH3 A;  2DYM A;  3UF8 A;  1WRD B;  2LGX A;  5JHA A;  3ALB A;  4NPN A;  3C0R B;  1V5O A;  1E7U A;  1H8C A;  2K25 A;  4G0N B;  3QC8 B;  4PS3 A;  4OVV A;  4NAW B;  2JRH A;  2KN5 A;  5CX3 A;  2LZ6 A;  1E90 A;  1EUV B;  2I1K A;  1OEY J;  2YLM A;  1WY8 A;  2ZVO A;  1V9J A;  1UBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...