2GBMA

Crystal structure of the 35-36 8 glycine insertion mutant of ubiquitin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
b'MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGGGGGGGGGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gbmA00
1I42A 4M0WB 4EOYA 1V81A 1YIWA 3K9OB 3ZKJC 1V5OA 2KWUB 1WXMA 1H4RA 5EDSA 3ONSA 2KQSA 4JQWC 3DVGX 2N4FA 2LVOA 3WAMA 4WJNA 3PZDA 3QX1A 3A9KB 4K7SA 3VDZA 5CHVC 4AJYB 4OVUA 2KFKB 2RPQA 3MHSD 3OLMD 1JRUA 3T9LA 4MH0E 1V5TA 3VUYA 3KH0A 3PTFC 5DPTA 4AOFA 2IO1B 1E8WA 2LGDA 4ANXA 4MGYE 4E71A 4ASWC 4BKGA 2GBKA 3R3MA 3B1LX 4NJ6A 2MBOA 3TIXA 2J0KA 5FR6A 3VTVA 4BOZB 2L3ZA 2PEAA 2DYMA 4M8NA 3ZLZA 3LJ3A 2KTFA 1H8CA 1E8YA 4FJYA 4NY0A 1WM3A 1YD8U 4FBJB 5LXHA 3H7PB 4KIKA 3EHVA 2MWSB 4EFOA 2D07B 5TR5A 4F8CB 1RRBA 4IWOA 1GG3A 2KC1A 1J8CA 2WDTB 5E6OA 4MM3A 3DBLI 4A3PA 4F1SA 4B6WA 4HCNB 4KDIC 4HVBA 1C3TA 2IY0B 3CMMB 4LCDE 2N9EB 4IW0A 3V60A 2L00B 4NAWB 1EF1A 4IWQA 3NHEB 1V49A 2FCQA 2KWVB 1OEYA 1WXSA 4NJ7A 2A4ZA 3DQVA 2IO2B 4BFRA 2D11A 1WRDB 3APDA 3L16A 1YX6B 2ZCCA 4LJPB 2HE7A 2C7MB 5E6NA 1WE6A 1WMHB 3M63B 4DHZB 3VUWA 2JRIB 1WX7A 2OOBB 1E5WA 2J7QB 2JRHA 3QIJA 4BBNF 2GBNA 1SE9A 2XEWA 3W1SC 1E90A 5CHWA 4A3OA 3WIMA 2WWZA 4W9HA 2EKEC 3DVGY 4BKSD 3MTNB 4WWNA 1GJZA 3RD2A 3A4SC 3R7QA 4GN1A 2XK5B 4HXDA 5J17A 2IBIB 4W9IA 1V2YA 3W1SA 1Q5WB 2FIDA 3W1YA 4MDKE 2K6QA 1YJ1A 1KJTA 4W9KA 4MGZE 1IYFA 1NDDA 2DZIA 2JZ3B 2K25A 3KYDD 3ZDMC 1U4AA 4W9JA 1F9JA 4KSKC 4BOSC 3V6CB 2DAFA 2CU1A 4FULA 2O6VB 1LQBA 3K9PB 4GDKA 3RCZA 2RSUA 1UZXB 2DZJA 4II3B 2BYEA 4P7IA 4NQKE 1UH6A 2UYZB 3DDCB 5C23A 2HTHA 3DBSA 2GBMA 2G4DB 2ZVNA 3IBEA 3L08A 4TQ1A 1GC6A 1WXVA 2WX0A 3VXWA 1E7UA 3SU8X 1WJ6A 1BT0A 1S3SG 3U8ZA 1MG8A 3ML9A 3B0AA 3HK0A 4M8MA 2BPSA 4ZRJA 3ZNZB 3VFKA 4HDQA 5JHBA 4DWFA 4IM3A 4EZJA 3PHWB 4FHJA 3WAPA 3EECA 2IO0B 2NBVB 2R2OA 3PRPB 3HM6X 4WJPA 4DBGA 2KKCA 3M95A 4FA6A 4IUMB 5CTRC 3D32A 2FCMA 1ISNA 4B95A 1I35A 3A9JA 4HK2A 2DAJA 2UWQA 1WY8A 4K81A 3AU4A 4K1RB 1WJUA 2C60A 2G4SA 4KV2A 2DX5B 3IFWB 3PRZA 2LRWA 2MA9B 3R7RA 3JVZX 2D10A 2NPTB 4G11A 2AL3A 1IPGA 2LRUA 4JL9A 2KTRB 4E74A 4LJOB 1ZKHA 2G45B 4BBNC 2ASQA 4FLHA 2N7DA 3ZIMA 1YQBA 1XT9B 4HPMB 5DPRA 3X23A 3ZDTA 1ZW7A 3PPAA 1XQQA 4JGHB 1WGRA 4GDKB 3DBHI 4G50A 3UIPB 1VD2A 2N1VA 4NPNA 5GMVA 4JLCA 3RULA 5DPSA 3A1QA 3AULA 3R66C 2AWTA 3BINA 1WM2A 1UGMA 3SDLC 2JVCA 2BKRB 3PHXB 4W9CA 4ANWA 2WYQA 2KN5A 4K7UA 1E8ZA 1KLVA 4ICVA 1WGGA 1UBQA 3LDZE 3TL5A 2N7EA 4GOCA 4ICUA 5CX3A 4W9EA 1IP9A 2BF8B 2VRRB 3QHTA 2ZNVC 4GSWA 3TMPB 3ENEA 3NOBA 3ECIA 2MCNB 3S2AA 3VUXA 5BO4B 4EEWA 2KMAA 4OVVA 5DCNA 2NVUI 3U30A 3ZTDA 3OJ3A 2PE6B 2REXA 4MJSA 4WWPA 5D7GA 5LLIA 3PLUA 2FNJB 2BKFA 2JUOA 2EMSA 3T8MA 4GDLB 2JWZA 2LZ6A 4CHKA 4W9GA 5JHAA 2MRPA 2ZZPB 4NNJB 1RAXA 2CHXA 4I6PA 3ZNHB 3DCGA 3L54A 3BY4B 3L10B 2O6VD 3DBRI 1NI2A 2JT4B 3EC8A 1WFYA 2KD0A 3VHTC 2GBRA 4IG7B 2M4NA 2I1KA 1M94A 2DYOA 2FCSA 5D6JB 2KXJA 4BKTA 2YLMA 5IA7A 4PS8A 3N32A 1G6JA 1R4NI 4TQ0A 1TBEA 2AL6A 2KDBA 4MELA 4WJQA 3ZUNA 3ZNID 1WE7A 2JXXA 2O2VA 3PREA 4WJOA 2KWCA 1GC7A 1LM8B 1WI0A 4ZYNA 2MP2A 1WF9A 2M0XA 2I1JA 5E6PA 2KOXA 3DVNV 2B3AA 3AU5A 1GUAB 4KZ0A 4TV3A 3CF6E 3SD5A 2MLBA 5JZEB 2Z0DB 4KZCA 2LASA 1P98A 5AZHA 2JF5A 3NS8A 4DHJB 2XBBC 2NCNA 3RYTA 1WH3A 2GMIC 3VVWB 5AZGA 5KHOA 2D2QA 1J0GA 1E7VA 4DDID 1ZGUB 4DXAB 1KM7A 2CHWA 3APFA 2ZCBA 4FHKA 4CO7A 3O65B 4AP4C 3PT2B 2EMTA 4MJSB 3PV1A 4KIKB 3PRMB 3ZW3A 1GNUA 2C9WB 1X1MA 2MBEA 3ALBA 4GIVA 2KDEB 1TZ1A 2J0MA 5D94A 2KJRA 2K8BA 2KZRA 3QCAA 4IWPA 4AWJA 1EF5A 4F7ZA 4MSMB 4FJZA 4ANVA 2KDFB 4IM0A 4EUTA 4BKSA 4B9KA 1V9JA 3KYCD 2AEHA 3UQAA 4MGKE 2KNBA 5CHFA 2FAZA 3JSVA 4G0NB 4WAAA 3VH4B 3QAQA 1FXTB 2D3GA 1LFDA 2C5LC 3TJPA 2BGFA 1P1AA 2FIFA 2LVPA 3AXCA 5AEKB 2O2VB 4PYUA 2KMCA 3ZTCA 2MP2B 3WA0A 2RD0A 1SGHA 3Q3FA 3C0RB 1TTNA 1HE8A 2N9PC 1WR6E 1K8RB 2MSED 3A9KA 3KUDB 4II2B 1OQYA 1WR1A 4N9F4 4TKNA 4AUQC 2C7NB 5D2MB 2KFKA 2HJ8A 3QK0A 5AZFA 2PJHA 3TCAA 2V1YA 2Z59B 2FCNA 1A5RA 4G3XB 4GB9A 2MW5A 3ZVVA 2K39A 2AYOB 2K8HA 1C1YB 2WX1A 2NS5A 1XD3B 4NQLB 2L05A 4HCPB 1CMXB 2PPHA 3UINB 4XX5A 4J6IA 2M17A 3IHPC 3RT3B 2DENB 2MBBB 1V6EA 1Z5SB 2LWPA 2L7RA 3L0WB 2V3SA 1WXAA 4W9LA 4E3CA 4ZRIA 3DOWA 2L76A 3VAWA 1UBIA 2IZVB 2KQ7A 3APCA 3A4RA 2IO3B 2QHOA 3WAOA 4AJWA 1Q1OA 4BVUC 2KJHB 5DPWA 2KC2A 3CSFA 2MX2A 3KVFB 3MJWA 4RM9A 3V62A 1YX5B 2LI5A 2LGYA 4NAWA 5KHQA 2KLGA 1L2NA 3PGEA 3VH3B 3ZO5B 3JW0X 4PYZA 2ZEQA 4I6LB 4DHJD 2HD5B 3HIZA 2GBJA 2KANA 4FJVB 4PS7A 5J18A 4KSLC 1J19A 2N9XA 1S1QB 3KUCB 1WMHA 3OAWA 1OGWA 4TUUA 2RR9A 3UQBA 4HJKA 3SHQA 3QQ8B 4W9DA 5G2NA 3AI5A 2W9NA 3PSEB 1Q0WB 2RGFA 2Z0EB 3A9JB 3ML8A 2N1WA 4ANUA 3RUIB 4W9FA 3IG3A 1V86A 5G55A 2CKHB 3ZNGC 1R4MI 2NR2A 1RLFA 1WX9A 1WYWB 3VTUA 3M3JA 3UGBB 1KOTA 2JZZA 2CR5A 2K8CA 2KVRA 2ZPNA 3H7SA 3NZUA 2XK5A 4IM2A 1QZEA 3UF8A 2BWFA 2BYVE 4JIOU 2KLCA 4EKUA 2DHZA 3QC8B 4MSQB 1EUVB 2MBQA 3H9DA 4FADA 4LDTB 3OJ4B 4WWOA 2NBWB 3X0WA 3A1QB 1WZ3A 4ZDVA 3TBLD 2PE9A 2NBUA 2LJ5A 5J2RA 2CHZA 1WGDA 2KK8A 2LD9A 2M8SA 4CYEA 2O6VA 4X57B 2C7HA 3L17A 3VQIA 1SIFA 3GOEA 1RFAA 1WX8A 4IC7B 2A5UA 2ZJDA 2KHWB 3QA8A 2KO3A 3A33B 1TGZB 1V80A 3VTWA 4WQOB 3Q3JA 2BWES 3DPDA 3PVLA 4YL8A 3QWZB 3NZSA 4RM8A 4DHZE 4HLEA 1P3QU 2FUHB 1D3ZA 3UIOB 4HPLB 3WALA 3B08A 2Y5BB 2ZNVB 1WGYA 2L8JA 4KVGB 4PS3A 4GU2A 3QJZA 5C1ZA 3JYUA 5IAAC 2BYFA 2KJ6A 1AARA 2V4LA 2MQJA 3P2BA 2K6DB 3I3TB 4DK5A 1T0YA 3ZRFA 4DDGD 1NBFC 5HKHA 4XC2A 3RZFA 2LUEA 4ZRKA 4EZLA 2MBHA 3PLVA 2NPTA 2OJRA 4URKA 2KTRA 1UELA 4KDLB 2ZPYA 2KFJA 4XZ4A 3WANA 5L83A 1WIAA 2KX0A 3QARA 1VCBA 1P0RA 1L7YA 4MGIE 3N3KB 2KX3A 1WJNA 3H1UA 1Z2MA 2LVQA 1Y8RC 3GZNI 3KUZA 5JH5C 3EFUA 2CS4A 1WGHA 3V61A 4RMAA 4EZKA 5L95C 2LGXA 3IVFA 3KW5B 4MEMA 1OTRB 4I6NB 3PS6A 2DYBA 3N30A 2JPHA 4FN2A 2JY6A 1UD7A 4HWIB 3CSTA 1OEYJ 2LXAA 3DVNU 2GOWA 1WZ0A 2YVCA 4A20A 2IY1B 2J0JA 2L0FA 1WJ4A 3ZRCA 3RZWC 2G3QB 1P9DU 2LXCA 4HDOA 1EO6A 2DZKA 1LXDA 2ZVOA 1E8XA 2L0TA 3HHMA 2IYDB 4GXBA 3U7DA 2K1FA 3H6NA 3H7PA 3L13A 3M62B 4GGQA 3V6EB 4GMVA 3HM3A 4LDTD 2R2QA 2DZMA 2KDIA 4GDLA 4K7WA 5LXIB 1PQSA 3JSVB 3NY5A 2M1MA
chains in the Genus database with same CATH superfamily
1V81A 1YIWA 3K9OB 5EDSA 3ONSA 2RDBC 2UU7A 2LVOA 1QF6A 3RNBC 3U2SC 2QEJC 1CZPA 2RDHA 4AJYB 2RPQA 2G1EA 2E3TA 1I7HA 3R2TA 1FPYA 2BQQA 2FUG1 4L2YA 3W9CB 2D5GA 3KH0A 1JW9D 4ANXA 3I9V1 2J0KA 3VTVA 3ZXRA 2PEAA 2DYMA 4M8NA 1E8YA 5BYQA 1HZ5A 2WDQB 2MWSB 1R4MB 1PQSA 4F8CB 1RRBA 4IWOA 1J8CA 3Q69A 2RMMA 1C3TA 2IY0B 4LCDE 3P4SB 5BMHA 5HI1A 2DWQA 2FCQA 1OEYA 5BYRA 2JXTA 4ACFA 2LGIA 2K5PA 1TY2A 1WMHB 3VUWA 2JRIB 2CJNA 2J7QB 3QIJA 4BBNF 2XEWA 3W1SC 3NG0A 4RH6A 3W5UB 3RPFC 1FNWA 4A3OA 4IOIE 4WWNA 1GJZA 4O1NA 2XK5B 5H8YE 2INDC 3TEYA 1HTOA 3P4RB 3TEWA 1IYFA 2K25A 3KYDD 1RWSA 2AQ2B 2BB5A 3E9SA 4MM3B 4BOSC 4S0RA 1VRAB 3RCZA 3RNCC 2DZJA 4HJGE 3DDCB 2HTHA 3L08A 1GC6A 1Q10A 4ZRPA 1HQRD 3IAS1 3OG5A 2KVZA 2WXGA 3N1XC 3WAPA 4FA6A 1HEZE 1ISNA 1QQRA 3AEGB 4B95A 2KWDA 3C8YA 1ZDXA 3AU4A 1WJUA 1C77A 3IFWB 1C9FA 2LRWA 3I63C 2MA9B 4G11A 4JL9A 1P7FA 2LRUA 4DXGA 4LJOB 2N7DA 5DPRA 3ZDTA 2W3SA 1WGRA 4GDKB 1VD2A 2N1VA 1PGXA 3AULA 3KQ4A 1GB4A 2QMTA 3AE7B 3AEAB 3R66C 5I4DA 3AV8A 4ANWA 3SDLC 2JVCA 4W9CA 1VZ8A 1D5XC 2BS2B 3Q3OC 2QC8A 4GOCA 5CX3A 1QKZA 4W9EA 1T0SC 1RYJA 3VUXA 3HVDA 4EEWA 3S2AA 3SR6A 3ZTDA 3OJ3A 2REXA 4RGMA 5LLIA 4WWPA 5D7GA 4US9A 2BKFA 4GDLB 2JWZA 2LZ6A 5JHAA 4W9GA 3P4PB 4NNJB 4I6PA 2JU6X 3DCGA 2O6VD 3DBRI 1NI2A 2JT4B 2Q5WD 2GBRA 2FCSA 3DWMA 2KXJA 3DBLB 5GXGB 4PS8A 5D3DA 2WXPA 2E6XA 4TQ0A 4WJQA 3ZUNA 3ZNID 2KWCA 1LM8B 3NVWA 2I1JA 2KOXA 2NTSA 4TV3A 1JWBD 3SD5A 1J7AA 2LASA 1FD6A 3URYA 2N0SB 2D2QA 1J0GA 1E7VA 1D4BA 1V1OA 1KM7A 2RDGA 2WXLA 4FHKA 1QOGA 4JX1C 3ZJUA 2EMTA 3PV1A 3ZW3A 1SE2A 1N6ZA 4ARCA 1TZ1A 4C00A 2KZRA 2K8BA 4IWPA 1UGJA 2K22A 1ESFA 4BKSA 1V9JA 3KYCD 3UQAA 1JROA 3JSVA 2WDVB 4G0NB 4WAAA 4P6VF 2BGFA 2FIFA 2QJLA 3RNGC 3O13A 1SGHA 3C0RB 5FKAC 1VR9A 3TCAA 2ZW1A 2FCNA 1A5RA 4G3XB 4GB9A 2K39A 2K8HA 1XD3B 3RFZB 1A70A 4WWMA 3Q2AC 4LK0M 3UINB 2BYTA 2M17A 3IHPC 2MBBB 2LWPA 2L7RA 3GE8C 4E3CA 3DOWA 1AN8A 2Z8LA 2IO3B 4AJWA 2KJHB 3V62A 3DBHB 4NAWA 2KLGA 3LYYA 2QCZA 2ZEQA 5EE0A 2HD5B 3KUCB 4OHJA 3TUOA 3P42A 3OAWA 1OGWA 4TUUA 3SHQA 4W9DA 1V1PB 5G2NA 1FIQA 1K53A 3RUIB 1RLFA 1WX9A 3M3JA 2JZZA 2K8CA 3AE2B 2JYTA 3BVZA 4OZCA 3TEXA 4JIOU 3KLSX 4DXFA 1LO5D 4LDTB 3OJ4B 4A6QA 1E10A 2V3NA 1ENFA 1UWXA 4BAXA 3EUB2 2C7HA 1I4GA 1SIFA 1RFAA 2KO3A 1TGZB 1XF5L 3VTWA 4DHZE 2FUHB 3UIOB 1ZE3D 2Y5BB 2ZNVB 1WGYA 2J4XA 5EE9A 4H2AA 1JWSD 1GOZA 2M0AA 3JYUA 1FNUA 2MQJA 1IBXA 4DK5A 1UNSA 1C76A 1DYQA 4LNKA 2IGHA 4XC2A 4M00A 1L4ZB 1N63A 3Q3NC 1XLOA 4EZLA 2MBHA 4ZHPA 2NPTA 4URKA 2KTRA 4YTMB 1OFFA 1EM7A 1VCBA 2KACA 3GZNI 1WWTA 2CS4A 1WGHA 4EZKA 1NYRA 1KLGD 1NEKB 1UUPA 2WGSA 3CSTA 4B0MA 3DVNU 2YVCA 4A20A 1HZ6A 3ZRCA 3N1ZC 1DOIA 4KKIA 2LXCA 3RI7C 1EO6A 2DZKA 2ZVOA 2MJDA 1VJKA 2IYDB 4GXBA 3BVMA 2QIEB 3M62B 4GGQA 2V4IB 3JSVB 1ZOYB 3Q8FA 1I42A 4M0WB 4FXCA 1V5OA 1WXMA 2KQSA 4JQWC 3DVGX 4YSZB 4WJNA 3PZDA 4K7SA 3VDZA 1WYGA 1PGBA 1HA5A 1F52A 3T9LA 4MH0E 1V5TA 3PTFC 1F2RI 3RNEC 4AOFA 2IO1B 4E71A 3MC8A 2PTLA 2QDFA 2MBOA 2WHIA 1F0ZA 3LJ3A 4FJYA 3NRZA 1YD8U 1T0QC 4REZA 1GG3A 2WDTB 4MM3A 4XDDA 4B6WA 4HCNB 4IW0A 2L00B 4NAWB 4IWQA 1V49A 1BUIC 3DQVA 3BVGA 1D5ZC 3MP9A 3APDA 1YX6B 4LJPB 5E6NA 1WE6A 1WX7A 3AE4B 2JRHA 1T5XD 5CHWA 1TIFA 3WIMA 2EKEC 4S17A 3W2DA 3A4SC 1UWMA 3GP7A 5J17A 4LNIA 1V2YA 1C79A 3U7ZA 3W1YA 2K6QA 1XLNA 4WQMA 3ZDMC 1U4AA 1I4HA 3B9JA 1F9JA 2VZKD 4KSKC 3ZJVA 4MACA 4GDKA 3K9PB 3Q6BA 2PW9A 4LNOA 1UZXB 4P7IA 2UYZB 5C23A 3IBEA 4RF1A 1FMAD 4TQ1A 1QOAA 1WXVA 1S3SG 3MJ5A 1ZXIA 1MG8A 3B0AA 3HK0A 2BPSA 3ZNZB 1FXIA 1WXQA 3VFKA 4HDQA 4EZJA 3PRPB 3RN9C 2R2OA 3PZ7A 3HM6X 2KKCA 3RNAC 1IBXB 1VLBA 4IUMB 3D32A 4HK2A 1XLQA 2UWQA 4K1RB 2C60A 2DX5B 3PRZA 2NPTB 2KTRB 4RGOS 1ZKHA 2G45B 4BBNC 4EE2A 4FLHA 3X23A 2Y3AA 3ZXVA 4NPNA 1WM2A 1UGMA 2KN5A 1SB3C 1UBQA 3LDZE 4ICUA 1IP9A 1TJEA 3QHTA 2ZNVC 2OEDA 3MC0B 1LGRA 1FO4A 3NOBA 2MCNB 5DCNA 1FCCC 2NVUI 2FNJB 2WXKA 1YN5A 2CHXA 1DGJA 3L54A 1E9MA 3EC8A 1I4RA 1SJHD 5D6JB 3N32A 1KFYB 3MFGA 1R4NI 1TBEA 2AL6A 3KWVA 1WE7A 2JXXA 4WJOA 1PFDA 1YN4A 1GUAB 4KZ0A 2ZW0A 3CF6E 2JF5A 2NCNA 2IGGA 3DHHC 1XO3A 3Q14C 5AZGA 3VVWB 4M02A 1ROEA 2ZCBA 3O65B 5IN7A 4MJSB 1GNUA 3B2GA 1X1MA 2MBEA 3AB5A 2KDEB 4F7ZA 4AWJA 2AQ3B 4IM0A 2N7JA 4C80A 2AEHA 2ON8A 3AH7A 1QOBA 3LXFA 1BMLC 3AXCA 5AEKB 3WA0A 2RD0A 4II2B 1HE8A 2N9PC 3A9KA 3KUDB 2MSED 4RGNA 2KN4A 2C7NB 5D2MB 2KFKA 2HJ8A 1HTQA 2WU2B 5AZFA 2PJHA 1V1PA 2V1YA 2Z59B 2SAKA 3ZVVA 4LLGM 4RFBA 2I38A 4XX5A 4J6IA 3AEDB 1WRIA 3FKYA 2DENB 1V6EA 1Z5SB 2LHDA 2X8XX 3IT4B 3VAWA 3A4RA 2QHOA 2XNAC 3AEFB 2MX2A 3KVFB 4RM9A 3EGRA 5G5HA 3J9CA 2LGYA 3VH3B 3JW0X 4RGTA 4PYZA 4I6LB 3RMKC 4DHJD 2PLPA 1SXTA 1JQ4A 4IDIA 2RR9A 1FRRA 4HJKA 3QQ8B 1CJEA 3AI5A 2PVOD 1Q0WB 1TS4A 3IG3A 2N9LA 2CKHB 3ZNGC 1TKEA 2NR2A 4A55A 3VTUA 3UGBB 2KVRA 3NZUA 3H7SA 3P63A 2IDYA 3UF8A 2BWFA 2BYVE 3HUIA 1FEHA 2AQ1B 4MSQB 2MBQA 3DBRB 4FADA 2YEPF 4YWGG 1WZ3A 1N5WA 2ONQA 3ETRA 1C4AA 1FNVA 2PE9A 2NBUA 2O6VA 4X57B 1ZDVA 2JSVX 1XEEA 3GOEA 2WNMA 1JMLA 1WX8A 4IC7B 4HKZE 2ZJDA 1J7BA 3B2FA 1OQRA 4YL8A 2V0GA 2B76B 2RPVA 3AECB 1D3ZA 4HPLB 2EKIA 2M56B 4L1BA 3B08A 1FM0D 3EA6A 4KVGB 4PS3A 3N9YC 2VH2A 5IAAC 1AARA 2V4LA 3P2BA 3I3TB 1D5MC 3CWIA 3NVVA 1T0YA 1NBFC 2W55A 5FK9C 3RZFA 1XCQL 2LMCA 4M0WA 4KGSA 3PLVA 1MHHE 1PYWD 5L83A 1SE3A 4R3DA 2KX0A 3FAHA 1MPEA 1P0RA 2OJWA 1YJJA 1WJNA 1NENB 3H1UA 1Z2MA 1Y8RC 3EFUA 2Y5PA 1YMHE 2X38A 4PK1A 4GLSC 3PS6A 1L0YB 1YQ4B 2LXAA 2KDMA 2J0JA 5AUKA 3E56A 3RZWC 1P9DU 4HDOA 2R61A 2LUMA 3SEBA 2MJEA 2PMVA 3HVZA 2L0TA 3ZQ4A 1N61A 3Q8AA 2K1FA 2K9XA 2NTTA 2DZMA 2KYWA 1D6EC 1B1ZA 2TSSA 1C4PA 4ZRQA 3ZKJC 1DOYA 2KWUB 4NJCA 2N4FA 3WAMA 3U4EG 3A9KB 4OVUA 2KFKB 2WS3B 3MHSD 2WXMA 2WXQA 1UF0A 3OLMD 5DPTA 1ACCA 3R2IA 1TKGA 2LGDA 3FC4A 1L5PA 2WU5B 5FR6A 3ZLZA 1H8CA 1E0ZA 2DBYA 4NY0A 3V05A 1BXTA 5LXHA 4KIKA 2D07B 5TR5A 3CMMB 4OVZA 3V60A 2J52A 1EF1A 2KWVB 1WXSA 4NJ7A 4BFRA 4J3OD 2HTME 2ZCCA 2HE7A 2NMQA 2C7MB 2BTEA 2OOBB 1N5XA 3HRDD 2WWZA 3BZDB 4W9HA 3DVGY 3RD2A 4GN1A 4HXDA 4W9IA 4B0EA 3N1YC 3NZ3A 2FIDA 4W9KA 4MGZE 1NDDA 2DZIA 2JZ3B 2CU3A 1YN3A 2DAFA 2O6VB 2RSUA 4II3B 2GB1A 2D3BA 2GLSA 4YT0B 4ZYSA 1TS2A 3DBSA 1IGCA 2ZVNA 1TY0A 2WX0A 3GZNB 4D2KA 1E7UA 2BW2A 1WJ6A 1VZ7A 3I5JC 3U8ZA 3SFDB 1TT5B 4NAMA 3AE1B 5JHBA 4IM3A 3PHWB 4YTNB 4FHJA 4DBGA 3EECA 2NBVB 3M95A 1ZPSA 3AN1A 2BBCA 2FCMA 3A9JA 1WY8A 4K81A 3JVZX 4XGAB 4E74A 1SE4A 3VR8B 5EE3A 4KGRA 2ASQA 3ZIMA 1XT9B 2G9HD 4JGHB 2PVGC 1F1HA 1OQQA 1L4DB 4JLCA 5GMVA 5DPSA 2AWTA 3BINA 2BKRB 1TYGB 4MH8A 2WYQA 1XLPA 1KLVA 1J7CA 3TL5A 2N7EA 1T6BX 2BF8B 4GSWA 4NZLB 3ENEA 3IXSA 2KMAA 3R8BA 2FE8A 1I4PA 2JZPA 2K3UA 2YEPB 2PE6B 2FBWB 4MJSA 4A90A 1JALA 2EMSA 4CHKA 2ZZPB 4QAYA 3CIRB 4CQNA 1RAXA 4UDUC 3ABVB 3L10B 2QILA 2KD0A 2M4NA 1FCLA 2I1KA 1XXGA 4BKTA 2YLMA 1G6JA 4LNNA 4A8XC 4MELA 2LHEA 1GB1A 3PREA 4USAA 1WI0A 4ZYNA 1WF9A 3DHIC 3AE3B 1T0RC 5E6PA 3DVNV 2B3AA 5G5GA 3FILA 1SEBD 5FR3A 2MLBA 1C4CA 2QSDA 5JZEB 1JRPA 3NS8A 2XBBC 3SFEB 1WH3A 2GMIC 4DDID 1ZGUB 4DXAB 2KAJA 4AP4C 3AE6B 3PRMB 4KIKB 2J53A 4M01A 1YNTE 2C9WB 3ALBA 5D94A 2KJRA 4XDCA 1GAQB 1EF5A 4TMAB 2L52A 2KDFB 4EUTA 1QT9A 1Y56A 1IGDA 2KNBA 2FAZA 3DHGC 3VH4B 2DNFA 1K52A 4BZAA 1FXTB 2D3GA 3BYTB 3TJPA 1P1AA 2LVPA 2O2VB 3NS1A 4PYUA 3V3XA 3ZTCA 2MP2B 2I2YA 1QILA 3Q3FA 1K8RB 4N9F4 1OQYA 2MHJA 4AUQC 2W82A 3QK0A 4XE0A 4OW0A 1SF0A 2MW5A 2AYOB 2WX1A 4OZAA 3AE5B 3MC9A 4HCPB 4JE3B 2PPHA 1ZUD2 4HPPA 3L0WB 2WXFA 3AEBB 4W9LA 1WXAA 5JXVA 5HG2A 2K0PA 2IZVB 2KQ7A 3APCA 3W5VB 3WAOA 5DPWA 4BVUC 1EWYC 3CSFA 2GI9A 4RNAA 3OWEB 1YX5B 2W3RA 1L2NA 2KMMA 4WH4A 3ZO5B 3HIZA 2KANA 5IO9A 3PZ8A 1NYQA 1E7PB 1ET6A 2N9XA 1S1QB 1SJED 2Z0EB 2RGFA 3A9JB 1TZOA 2N1WA 1V86A 2L83A 1IUEA 5G55A 2WXNA 1R4MI 2CR5A 4IM2A 3U52E 3Q8BA 4C4VA 2KLCA 5BMIA 4L23A 4EKUA 2DHZA 3QC8B 3H9DA 3X0WA 1YQ3B 1NI3A 2V3PA 4ZDVA 1VDVA 3EFCA 2LJ5A 2CHZA 2LFIA 2LD9A 1R4NB 1SSNA 4YSYB 1HXYD 3VQIA 3AE8B 2INPE 1NVID 2KHWB 3QA8A 1AWDA 3A33B 4WQOB 3DWGC 1ET9A 3NZSA 4RM8A 3UI3A 1WSPA 3GB1A 3ZJTA 1QLBB 3WALA 1ZP0B 2L8JA 5MPOA 3ZYYX 2LEKA 2K6DB 2GRIA 4DDGD 1I4XA 5HKHA 4ZRKA 2BS4B 2OJRA 1UELA 4KDLB 3IT6B 4XZ4A 2INCC 3WANA 1L6UA 4ZOHC 1L7YA 4MGIE 2AX5A 3FILB 1T3QA 2KX3A 3BWUD 2WDRB 4RMAA 5L95C 2LGXA 3IVFA 5HFYA 4MEMA 4I6NB 3N30A 2JPHA 1TKYA 1FRDA 1F2RC 2MEKA 2L0FA 1WJ4A 4OZBA 2G3QB 5BMGA 4IKGA 4C7ZA 3NVZA 2J42A 3U7DA 3NUHB 3H6NA 3L13A 3V6EB 3HM3A 4LDTD 5E6JA 2R2QA 4LTUA 5LXIB 2VH1A 2M1MA 4EOYA 4P1BC 1H4RA 3ZGZA 4HROA 2KQ4X 3NJTA 2VZKB 3QX1A 5CHVC 3WCQA 4TSSA 3IAM1 3P1MA 1CQVA 2HJ1A 1JRUA 1STEA 3VUYA 1E8WA 4MGYE 1L0XB 3AM9A 4ASWC 4BKGA 2GBKA 3R3MA 3B1LX 4NJ6A 3TIXA 4BOZB 2L3ZA 1AYFA 2KTFA 1WM3A 2CJOA 4FBJB 2JWUA 3H7PB 3EHVA 1RM6C 4EFOA 2KC1A 5E6OA 3DBLI 4A3PA 4F1SA 4HVBA 4KDIC 4JWSC 1YJIA 2ICIA 2N9EB 1QOFA 1PGAA 3NHEB 4KGTA 2A4ZA 4LNFA 1MI0A 2IO2B 2D11A 2HDEA 1JWUD 2BS3B 1WRDB 3BK2A 4KX6B 1I4QA 4AQ7A 3L16A 4ARIA 2WXJA 5IP4D 3M63B 4DHZB 3Q8CA 1E5WA 4HRSA 1KRHA 2GBNA 1SE9A 2PKOA 1E90A 4XWTA 5D3IB 4BKSD 3MTNB 3R7QA 4K3CA 2IBIB 3W1SA 4C4VB 2EELA 1Q5WB 2IPKD 4MDKE 1YJ1A 1KJTA 4ZHOA 1SIJA 1C78A 2L1AA 4K3BA 4W9JA 1JCKB 3V6CB 1V97A 1GPXA 2CU1A 4FULA 1LQBA 2BYEA 4NQKE 1UH6A 3TSSA 2GBMA 2G4DB 3N20C 3Q3MC 3LB8C 3VXWA 4XYCA 3SU8X 1BT0A 3ML9A 4M8MA 4ZRJA 4DWFA 2IO0B 4WJPA 2DLBA 5CTRC 4YXDB 1I35A 2DAJA 2G4SA 2BVCA 4KV2A 3VR9B 4HEA1 3R7RA 5IOIA 2D10A 2AL3A 1IPGA 2BT6A 1XCTL 4C56C 3I57A 3BYYB 1YQBA 4HPMB 1ZW7A 3PO0A 1XQQA 3PPAA 3UIPB 3DBHI 4G50A 3RULA 3A1QA 1WGKA 3PHXB 5EE1A 4K7UA 1E8ZA 4ICVA 1WGGA 2LJIA 1F77A 2WXIA 2VRRB 3TMPB 3ECIA 5BO4B 1DOXA 4OVVA 3U30A 3PLUA 2JUOA 3T8MA 1EU4A 1EWCA 1JWMD 1L0VB 2MRPA 2D3AA 1KTKA 2JYEA 5LNK1 3ZNHB 3BY4B 1WFYA 3VHTC 1PUTA 4IG7B 1MHXA 1M94A 2DYOA 5TSSA 1AW7A 3RNFC 5IKCM 5IA7A 2KDBA 3BK1A 2WXHA 2XN9C 2O2VA 2BB6A 4P1CC 1GC7A 2MP2A 1K51A 3AU5A 1P7EA 2Z0DB 4KZCA 1P98A 5AZHA 4DHJB 1FFVA 3AEEB 3RYTA 5KHOA 3TEZA 1MVKA 2CHWA 3APFA 4CO7A 3PT2B 3H8HA 1ZXHA 3T3NA 4GIVA 4Q2JA 2WP9B 4C7YA 2J0MA 3QCAA 4MSMB 2MH7A 4FJZA 4ANVA 2LGSA 5HHDG 4B9KA 2L32A 4MT5A 4MGKE 5CHFA 4RF0A 3QAQA 1LFDA 5H92C 2C5LC 2KMCA 2M19A 1TTNA 1WR6E 1WR1A 4TKNA 3VRBB 2WLBA 5C2TB 1C1YB 2NS5A 4NQLB 2V9HA 2L05A 1JWAD 4A9AA 1CMXB 3RT3B 1FFUA 2V3SA 1B9RA 2IGDA 4P16A 4JPSA 4ZRIA 2L76A 1UBIA 4N59A 3VRAB 1Q1OA 2KC2A 4WURA 2MJ3A 1MJDA 3MJWA 2JQRB 2LI5A 5KHQA 4HKQA 3PGEA 4YTPB 3AE9B 1K50A 1SBBB 4WAFA 1CK1A 2GBJA 2WXOA 3C19A 4FJVB 4PS7A 5J18A 4KSLC 1J19A 2ACZB 3L4PA 1WMHA 3AMZA 3UQBA 1VZ6A 4DQOC 2W9NA 3PSEB 3ML8A 4ANUA 3P4QB 5BYSA 4W9FA 4N6EB 2H88B 1WYWB 1KOTA 5AUIA 2ZPNA 2XK5A 1QZEA 3NVYA 4US8A 1KH0A 1PDXA 2IJ0A 4ITKA 1EUVB 4WWOA 2NBWB 3A1QB 5C3JB 3KWLA 3TBLD 2WQYB 5J2RA 2Y5CA 1WGDA 2KK8A 3Q8EA 2M8SA 4CYEA 3L17A 2N9KA 1EU3A 3BIID 2A5UA 1YOVB 4N58A 2H89B 1V80A 4RCOA 1FXAA 3Q3JA 2BWES 3DPDA 3PVLA 3QWZB 1TS5A 4WIPA 4HLEA 1P3QU 4GU2A 1RFKA 2PIAA 5T8IA 3QJZA 4KKJA 5C1ZA 2BYFA 2KJ6A 2INNE 3ZRFA 2LUEA 3GE3C 2KT7A 3GS2A 2ZPYA 2KFJA 3MHZA 1R7SA 1WIAA 3QARA 3T3OA 2SEBD 3N3KB 2LVQA 3KUZA 5JH5C 2W54A 3V61A 3KW5B 1OTRB 1KLUD 2DYBA 1MG4A 4FN2A 2JY6A 1UD7A 1L6VA 4HWIB 4PT5A 1TS3A 2JX5A 1OEYJ 1MFWA 2GOWA 1WZ0A 1KF6B 2IY1B 4YSXB 4AS1A 1E6EB 1LXDA 4JWUC 2D3CA 1E8XA 1N60A 1V8CA 2OHFA 3HHMA 1M4VA 4XWWA 3H7PA 4GMVA 4GDLA 2KDIA 2WXRA 4K7WA 1N62A 2M0XA 3NY5A
chains in the Genus database with same CATH topology
1I42A 4M0WB 4EOYA 1V81A 1YIWA 3K9OB 3ZKJC 1V5OA 2KWUB 1WXMA 1H4RA 5EDSA 3ONSA 2KQSA 4JQWC 3DVGX 2N4FA 2LVOA 3WAMA 4WJNA 3PZDA 3QX1A 3A9KB 4K7SA 3VDZA 5CHVC 4AJYB 4OVUA 2KFKB 2RPQA 3MHSD 3OLMD 1JRUA 3T9LA 4MH0E 1V5TA 3VUYA 3KH0A 3PTFC 5DPTA 4AOFA 2IO1B 1E8WA 2LGDA 4ANXA 4MGYE 4E71A 4ASWC 4BKGA 2GBKA 3R3MA 3B1LX 4NJ6A 2MBOA 3TIXA 2J0KA 5FR6A 3VTVA 4BOZB 2L3ZA 2PEAA 2DYMA 4M8NA 3ZLZA 3LJ3A 2KTFA 1H8CA 1E8YA 4FJYA 4NY0A 1WM3A 1YD8U 4FBJB 5LXHA 3H7PB 4KIKA 3EHVA 2MWSB 4EFOA 2D07B 5TR5A 4F8CB 1RRBA 4IWOA 1GG3A 2KC1A 1J8CA 2WDTB 5E6OA 4MM3A 3DBLI 4A3PA 4F1SA 4B6WA 4HCNB 4KDIC 4HVBA 1C3TA 2IY0B 3CMMB 4LCDE 2N9EB 4IW0A 3V60A 2L00B 4NAWB 1EF1A 4IWQA 3NHEB 1V49A 2FCQA 2KWVB 1OEYA 1WXSA 4NJ7A 2A4ZA 3DQVA 2IO2B 4BFRA 2D11A 1WRDB 3APDA 3L16A 1YX6B 2ZCCA 4LJPB 2HE7A 2C7MB 5E6NA 1WE6A 1WMHB 3M63B 4DHZB 3VUWA 2JRIB 1WX7A 2OOBB 1E5WA 2J7QB 2JRHA 3QIJA 4BBNF 2GBNA 1SE9A 2XEWA 3W1SC 1E90A 5CHWA 4A3OA 3WIMA 2WWZA 4W9HA 2EKEC 3DVGY 4BKSD 3MTNB 4WWNA 1GJZA 3RD2A 3A4SC 3R7QA 4GN1A 2XK5B 4HXDA 5J17A 2IBIB 4W9IA 1V2YA 3W1SA 1Q5WB 2FIDA 3W1YA 4MDKE 2K6QA 1YJ1A 1KJTA 4W9KA 4MGZE 1IYFA 1NDDA 2DZIA 2JZ3B 2K25A 3KYDD 3ZDMC 1U4AA 4W9JA 1F9JA 4KSKC 4BOSC 3V6CB 2DAFA 2CU1A 4FULA 2O6VB 1LQBA 3K9PB 4GDKA 3RCZA 2RSUA 1UZXB 2DZJA 4II3B 2BYEA 4P7IA 4NQKE 1UH6A 2UYZB 3DDCB 5C23A 2HTHA 3DBSA 2GBMA 2G4DB 2ZVNA 3IBEA 3L08A 4TQ1A 1GC6A 1WXVA 2WX0A 3VXWA 1E7UA 3SU8X 1WJ6A 1BT0A 1S3SG 3U8ZA 1MG8A 3ML9A 3B0AA 3HK0A 4M8MA 2BPSA 4ZRJA 3ZNZB 3VFKA 4HDQA 5JHBA 4DWFA 4IM3A 4EZJA 3PHWB 4FHJA 3WAPA 3EECA 2IO0B 2NBVB 2R2OA 3PRPB 3HM6X 4WJPA 4DBGA 2KKCA 3M95A 4FA6A 4IUMB 5CTRC 3D32A 2FCMA 1ISNA 4B95A 1I35A 3A9JA 4HK2A 2DAJA 2UWQA 1WY8A 4K81A 3AU4A 4K1RB 1WJUA 2C60A 2G4SA 4KV2A 2DX5B 3IFWB 3PRZA 2LRWA 2MA9B 3R7RA 3JVZX 2D10A 2NPTB 4G11A 2AL3A 1IPGA 2LRUA 4JL9A 2KTRB 4E74A 4LJOB 1ZKHA 2G45B 4BBNC 2ASQA 4FLHA 2N7DA 3ZIMA 1YQBA 1XT9B 4HPMB 5DPRA 3X23A 3ZDTA 1ZW7A 3PPAA 1XQQA 4JGHB 1WGRA 4GDKB 3DBHI 4G50A 3UIPB 1VD2A 2N1VA 4NPNA 5GMVA 4JLCA 3RULA 5DPSA 3A1QA 3AULA 3R66C 2AWTA 3BINA 1WM2A 1UGMA 3SDLC 2JVCA 2BKRB 3PHXB 4W9CA 4ANWA 2WYQA 2KN5A 4K7UA 1E8ZA 1KLVA 4ICVA 1WGGA 1UBQA 3LDZE 3TL5A 2N7EA 4GOCA 4ICUA 5CX3A 4W9EA 1IP9A 2BF8B 2VRRB 3QHTA 2ZNVC 4GSWA 3TMPB 3ENEA 3NOBA 3ECIA 2MCNB 3S2AA 3VUXA 5BO4B 4EEWA 2KMAA 4OVVA 5DCNA 2NVUI 3U30A 3ZTDA 3OJ3A 2PE6B 2REXA 4MJSA 4WWPA 5D7GA 5LLIA 3PLUA 2FNJB 2BKFA 2JUOA 2EMSA 3T8MA 4GDLB 2JWZA 2LZ6A 4CHKA 4W9GA 5JHAA 2MRPA 2ZZPB 4NNJB 1RAXA 2CHXA 4I6PA 3ZNHB 3DCGA 3L54A 3BY4B 3L10B 2O6VD 3DBRI 1NI2A 2JT4B 3EC8A 1WFYA 2KD0A 3VHTC 2GBRA 4IG7B 2M4NA 2I1KA 1M94A 2DYOA 2FCSA 5D6JB 2KXJA 4BKTA 2YLMA 5IA7A 4PS8A 3N32A 1G6JA 1R4NI 4TQ0A 1TBEA 2AL6A 2KDBA 4MELA 4WJQA 3ZUNA 3ZNID 1WE7A 2JXXA 2O2VA 3PREA 4WJOA 2KWCA 1GC7A 1LM8B 1WI0A 4ZYNA 2MP2A 1WF9A 2M0XA 2I1JA 5E6PA 2KOXA 3DVNV 2B3AA 3AU5A 1GUAB 4KZ0A 4TV3A 3CF6E 3SD5A 2MLBA 5JZEB 2Z0DB 4KZCA 2LASA 1P98A 5AZHA 2JF5A 3NS8A 4DHJB 2XBBC 2NCNA 3RYTA 1WH3A 2GMIC 3VVWB 5AZGA 5KHOA 2D2QA 1J0GA 1E7VA 4DDID 1ZGUB 4DXAB 1KM7A 2CHWA 3APFA 2ZCBA 4FHKA 4CO7A 3O65B 4AP4C 3PT2B 2EMTA 4MJSB 3PV1A 4KIKB 3PRMB 3ZW3A 1GNUA 2C9WB 1X1MA 2MBEA 3ALBA 4GIVA 2KDEB 1TZ1A 2J0MA 5D94A 2KJRA 2K8BA 2KZRA 3QCAA 4IWPA 4AWJA 1EF5A 4F7ZA 4MSMB 4FJZA 4ANVA 2KDFB 4IM0A 4EUTA 4BKSA 4B9KA 1V9JA 3KYCD 2AEHA 3UQAA 4MGKE 2KNBA 5CHFA 2FAZA 3JSVA 4G0NB 4WAAA 3VH4B 3QAQA 1FXTB 2D3GA 1LFDA 2C5LC 3TJPA 2BGFA 1P1AA 2FIFA 2LVPA 3AXCA 5AEKB 2O2VB 4PYUA 2KMCA 3ZTCA 2MP2B 3WA0A 2RD0A 1SGHA 3Q3FA 3C0RB 1TTNA 1HE8A 2N9PC 1WR6E 1K8RB 2MSED 3A9KA 3KUDB 4II2B 1OQYA 1WR1A 4N9F4 4TKNA 4AUQC 2C7NB 5D2MB 2KFKA 2HJ8A 3QK0A 5AZFA 2PJHA 3TCAA 2V1YA 2Z59B 2FCNA 1A5RA 4G3XB 4GB9A 2MW5A 3ZVVA 2K39A 2AYOB 2K8HA 1C1YB 2WX1A 2NS5A 1XD3B 4NQLB 2L05A 4HCPB 1CMXB 2PPHA 3UINB 4XX5A 4J6IA 2M17A 3IHPC 3RT3B 2DENB 2MBBB 1V6EA 1Z5SB 2LWPA 2L7RA 3L0WB 2V3SA 1WXAA 4W9LA 4E3CA 4ZRIA 3DOWA 2L76A 3VAWA 1UBIA 2IZVB 2KQ7A 3APCA 3A4RA 2IO3B 2QHOA 3WAOA 4AJWA 1Q1OA 4BVUC 2KJHB 5DPWA 2KC2A 3CSFA 2MX2A 3KVFB 3MJWA 4RM9A 3V62A 1YX5B 2LI5A 2LGYA 4NAWA 5KHQA 2KLGA 1L2NA 3PGEA 3VH3B 3ZO5B 3JW0X 4PYZA 2ZEQA 4I6LB 4DHJD 2HD5B 3HIZA 2GBJA 2KANA 4FJVB 4PS7A 5J18A 4KSLC 1J19A 2N9XA 1S1QB 3KUCB 1WMHA 3OAWA 1OGWA 4TUUA 2RR9A 3UQBA 4HJKA 3SHQA 3QQ8B 4W9DA 5G2NA 3AI5A 2W9NA 3PSEB 1Q0WB 2RGFA 2Z0EB 3A9JB 3ML8A 2N1WA 4ANUA 3RUIB 4W9FA 3IG3A 1V86A 5G55A 2CKHB 3ZNGC 1R4MI 2NR2A 1RLFA 1WX9A 1WYWB 3VTUA 3M3JA 3UGBB 1KOTA 2JZZA 2CR5A 2K8CA 2KVRA 2ZPNA 3H7SA 3NZUA 2XK5A 4IM2A 1QZEA 3UF8A 2BWFA 2BYVE 4JIOU 2KLCA 4EKUA 2DHZA 3QC8B 4MSQB 1EUVB 2MBQA 3H9DA 4FADA 4LDTB 3OJ4B 4WWOA 2NBWB 3X0WA 3A1QB 1WZ3A 4ZDVA 3TBLD 2PE9A 2NBUA 2LJ5A 5J2RA 2CHZA 1WGDA 2KK8A 2LD9A 2M8SA 4CYEA 2O6VA 4X57B 2C7HA 3L17A 3VQIA 1SIFA 3GOEA 1RFAA 1WX8A 4IC7B 2A5UA 2ZJDA 2KHWB 3QA8A 2KO3A 3A33B 1TGZB 1V80A 3VTWA 4WQOB 3Q3JA 2BWES 3DPDA 3PVLA 4YL8A 3QWZB 3NZSA 4RM8A 4DHZE 4HLEA 1P3QU 2FUHB 1D3ZA 3UIOB 4HPLB 3WALA 3B08A 2Y5BB 2ZNVB 1WGYA 2L8JA 4KVGB 4PS3A 4GU2A 3QJZA 5C1ZA 3JYUA 5IAAC 2BYFA 2KJ6A 1AARA 2V4LA 2MQJA 3P2BA 2K6DB 3I3TB 4DK5A 1T0YA 3ZRFA 4DDGD 1NBFC 5HKHA 4XC2A 3RZFA 2LUEA 4ZRKA 4EZLA 2MBHA 3PLVA 2NPTA 2OJRA 4URKA 2KTRA 1UELA 4KDLB 2ZPYA 2KFJA 4XZ4A 3WANA 5L83A 1WIAA 2KX0A 3QARA 1VCBA 1P0RA 1L7YA 4MGIE 3N3KB 2KX3A 1WJNA 3H1UA 1Z2MA 2LVQA 1Y8RC 3GZNI 3KUZA 5JH5C 3EFUA 2CS4A 1WGHA 3V61A 4RMAA 4EZKA 5L95C 2LGXA 3IVFA 3KW5B 4MEMA 1OTRB 4I6NB 3PS6A 2DYBA 3N30A 2JPHA 4FN2A 2JY6A 1UD7A 4HWIB 3CSTA 1OEYJ 2LXAA 3DVNU 2GOWA 1WZ0A 2YVCA 4A20A 2IY1B 2J0JA 2L0FA 1WJ4A 3ZRCA 3RZWC 2G3QB 1P9DU 2LXCA 4HDOA 1EO6A 2DZKA 1LXDA 2ZVOA 1E8XA 2L0TA 3HHMA 2IYDB 4GXBA 3U7DA 2K1FA 3H6NA 3H7PA 3L13A 3M62B 4GGQA 3V6EB 4GMVA 3HM3A 4LDTD 2R2QA 2DZMA 2KDIA 4GDLA 4K7WA 5LXIB 1PQSA 3JSVB 3NY5A 2M1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I42 A;  4M0W B;  4EOY A;  1V81 A;  1YIW A;  3K9O B;  3ZKJ C;  1V5O A;  2KWU B;  1WXM A;  1H4R A;  5EDS A;  3ONS A;  2KQS A;  4JQW C;  3DVG X;  2N4F A;  2LVO A;  3WAM A;  4WJN A;  3PZD A;  3QX1 A;  3A9K B;  4K7S A;  3VDZ A;  5CHV C;  4AJY B;  4OVU A;  2KFK B;  2RPQ A;  3MHS D;  3OLM D;  1JRU A;  3T9L A;  4MH0 E;  1V5T A;  3VUY A;  3KH0 A;  3PTF C;  5DPT A;  4AOF A;  2IO1 B;  1E8W A;  2LGD A;  4ANX A;  4MGY E;  4E71 A;  4ASW C;  4BKG A;  2GBK A;  3R3M A;  3B1L X;  4NJ6 A;  2MBO A;  3TIX A;  2J0K A;  5FR6 A;  3VTV A;  4BOZ B;  2L3Z A;  2PEA A;  2DYM A;  4M8N A;  3ZLZ A;  3LJ3 A;  2KTF A;  1H8C A;  1E8Y A;  4FJY A;  4NY0 A;  1WM3 A;  1YD8 U;  4FBJ B;  5LXH A;  3H7P B;  4KIK A;  3EHV A;  2MWS B;  4EFO A;  2D07 B;  5TR5 A;  4F8C B;  1RRB A;  4IWO A;  1GG3 A;  2KC1 A;  1J8C A;  2WDT B;  5E6O A;  4MM3 A;  3DBL I;  4A3P A;  4F1S A;  4B6W A;  4HCN B;  4KDI C;  4HVB A;  1C3T A;  2IY0 B;  3CMM B;  4LCD E;  2N9E B;  4IW0 A;  3V60 A;  2L00 B;  4NAW B;  1EF1 A;  4IWQ A;  3NHE B;  1V49 A;  2FCQ A;  2KWV B;  1OEY A;  1WXS A;  4NJ7 A;  2A4Z A;  3DQV A;  2IO2 B;  4BFR A;  2D11 A;  1WRD B;  3APD A;  3L16 A;  1YX6 B;  2ZCC A;  4LJP B;  2HE7 A;  2C7M B;  5E6N A;  1WE6 A;  1WMH B;  3M63 B;  4DHZ B;  3VUW A;  2JRI B;  1WX7 A;  2OOB B;  1E5W A;  2J7Q B;  2JRH A;  3QIJ A;  4BBN F;  2GBN A;  1SE9 A;  2XEW A;  3W1S C;  1E90 A;  5CHW A;  4A3O A;  3WIM A;  2WWZ A;  4W9H A;  2EKE C;  3DVG Y;  4BKS D;  3MTN B;  4WWN A;  1GJZ A;  3RD2 A;  3A4S C;  3R7Q A;  4GN1 A;  2XK5 B;  4HXD A;  5J17 A;  2IBI B;  4W9I A;  1V2Y A;  3W1S A;  1Q5W B;  2FID A;  3W1Y A;  4MDK E;  2K6Q A;  1YJ1 A;  1KJT A;  4W9K A;  4MGZ E;  1IYF A;  1NDD A;  2DZI A;  2JZ3 B;  2K25 A;  3KYD D;  3ZDM C;  1U4A A;  4W9J A;  1F9J A;  4KSK C;  4BOS C;  3V6C B;  2DAF A;  2CU1 A;  4FUL A;  2O6V B;  1LQB A;  3K9P B;  4GDK A;  3RCZ A;  2RSU A;  1UZX B;  2DZJ A;  4II3 B;  2BYE A;  4P7I A;  4NQK E;  1UH6 A;  2UYZ B;  3DDC B;  5C23 A;  2HTH A;  3DBS A;  2GBM A;  2G4D B;  2ZVN A;  3IBE A;  3L08 A;  4TQ1 A;  1GC6 A;  1WXV A;  2WX0 A;  3VXW A;  1E7U A;  3SU8 X;  1WJ6 A;  1BT0 A;  1S3S G;  3U8Z A;  1MG8 A;  3ML9 A;  3B0A A;  3HK0 A;  4M8M A;  2BPS A;  4ZRJ A;  3ZNZ B;  3VFK A;  4HDQ A;  5JHB A;  4DWF A;  4IM3 A;  4EZJ A;  3PHW B;  4FHJ A;  3WAP A;  3EEC A;  2IO0 B;  2NBV B;  2R2O A;  3PRP B;  3HM6 X;  4WJP A;  4DBG A;  2KKC A;  3M95 A;  4FA6 A;  4IUM B;  5CTR C;  3D32 A;  2FCM A;  1ISN A;  4B95 A;  1I35 A;  3A9J A;  4HK2 A;  2DAJ A;  2UWQ A;  1WY8 A;  4K81 A;  3AU4 A;  4K1R B;  1WJU A;  2C60 A;  2G4S A;  4KV2 A;  2DX5 B;  3IFW B;  3PRZ A;  2LRW A;  2MA9 B;  3R7R A;  3JVZ X;  2D10 A;  2NPT B;  4G11 A;  2AL3 A;  1IPG A;  2LRU A;  4JL9 A;  2KTR B;  4E74 A;  4LJO B;  1ZKH A;  2G45 B;  4BBN C;  2ASQ A;  4FLH A;  2N7D A;  3ZIM A;  1YQB A;  1XT9 B;  4HPM B;  5DPR A;  3X23 A;  3ZDT A;  1ZW7 A;  3PPA A;  1XQQ A;  4JGH B;  1WGR A;  4GDK B;  3DBH I;  4G50 A;  3UIP B;  1VD2 A;  2N1V A;  4NPN A;  5GMV A;  4JLC A;  3RUL A;  5DPS A;  3A1Q A;  3AUL A;  3R66 C;  2AWT A;  3BIN A;  1WM2 A;  1UGM A;  3SDL C;  2JVC A;  2BKR B;  3PHX B;  4W9C A;  4ANW A;  2WYQ A;  2KN5 A;  4K7U A;  1E8Z A;  1KLV A;  4ICV A;  1WGG A;  1UBQ A;  3LDZ E;  3TL5 A;  2N7E A;  4GOC A;  4ICU A;  5CX3 A;  4W9E A;  1IP9 A;  2BF8 B;  2VRR B;  3QHT A;  2ZNV C;  4GSW A;  3TMP B;  3ENE A;  3NOB A;  3ECI A;  2MCN B;  3S2A A;  3VUX A;  5BO4 B;  4EEW A;  2KMA A;  4OVV A;  5DCN A;  2NVU I;  3U30 A;  3ZTD A;  3OJ3 A;  2PE6 B;  2REX A;  4MJS A;  4WWP A;  5D7G A;  5LLI A;  3PLU A;  2FNJ B;  2BKF A;  2JUO A;  2EMS A;  3T8M A;  4GDL B;  2JWZ A;  2LZ6 A;  4CHK A;  4W9G A;  5JHA A;  2MRP A;  2ZZP B;  4NNJ B;  1RAX A;  2CHX A;  4I6P A;  3ZNH B;  3DCG A;  3L54 A;  3BY4 B;  3L10 B;  2O6V D;  3DBR I;  1NI2 A;  2JT4 B;  3EC8 A;  1WFY A;  2KD0 A;  3VHT C;  2GBR A;  4IG7 B;  2M4N A;  2I1K A;  1M94 A;  2DYO A;  2FCS A;  5D6J B;  2KXJ A;  4BKT A;  2YLM A;  5IA7 A;  4PS8 A;  3N32 A;  1G6J A;  1R4N I;  4TQ0 A;  1TBE A;  2AL6 A;  2KDB A;  4MEL A;  4WJQ A;  3ZUN A;  3ZNI D;  1WE7 A;  2JXX A;  2O2V A;  3PRE A;  4WJO A;  2KWC A;  1GC7 A;  1LM8 B;  1WI0 A;  4ZYN A;  2MP2 A;  1WF9 A;  2M0X A;  2I1J A;  5E6P A;  2KOX A;  3DVN V;  2B3A A;  3AU5 A;  1GUA B;  4KZ0 A;  4TV3 A;  3CF6 E;  3SD5 A;  2MLB A;  5JZE B;  2Z0D B;  4KZC A;  2LAS A;  1P98 A;  5AZH A;  2JF5 A;  3NS8 A;  4DHJ B;  2XBB C;  2NCN A;  3RYT A;  1WH3 A;  2GMI C;  3VVW B;  5AZG A;  5KHO A;  2D2Q A;  1J0G A;  1E7V A;  4DDI D;  1ZGU B;  4DXA B;  1KM7 A;  2CHW A;  3APF A;  2ZCB A;  4FHK A;  4CO7 A;  3O65 B;  4AP4 C;  3PT2 B;  2EMT A;  4MJS B;  3PV1 A;  4KIK B;  3PRM B;  3ZW3 A;  1GNU A;  2C9W B;  1X1M A;  2MBE A;  3ALB A;  4GIV A;  2KDE B;  1TZ1 A;  2J0M A;  5D94 A;  2KJR A;  2K8B A;  2KZR A;  3QCA A;  4IWP A;  4AWJ A;  1EF5 A;  4F7Z A;  4MSM B;  4FJZ A;  4ANV A;  2KDF B;  4IM0 A;  4EUT A;  4BKS A;  4B9K A;  1V9J A;  3KYC D;  2AEH A;  3UQA A;  4MGK E;  2KNB A;  5CHF A;  2FAZ A;  3JSV A;  4G0N B;  4WAA A;  3VH4 B;  3QAQ A;  1FXT B;  2D3G A;  1LFD A;  2C5L C;  3TJP A;  2BGF A;  1P1A A;  2FIF A;  2LVP A;  3AXC A;  5AEK B;  2O2V B;  4PYU A;  2KMC A;  3ZTC A;  2MP2 B;  3WA0 A;  2RD0 A;  1SGH A;  3Q3F A;  3C0R B;  1TTN A;  1HE8 A;  2N9P C;  1WR6 E;  1K8R B;  2MSE D;  3A9K A;  3KUD B;  4II2 B;  1OQY A;  1WR1 A;  4N9F 4;  4TKN A;  4AUQ C;  2C7N B;  5D2M B;  2KFK A;  2HJ8 A;  3QK0 A;  5AZF A;  2PJH A;  3TCA A;  2V1Y A;  2Z59 B;  2FCN A;  1A5R A;  4G3X B;  4GB9 A;  2MW5 A;  3ZVV A;  2K39 A;  2AYO B;  2K8H A;  1C1Y B;  2WX1 A;  2NS5 A;  1XD3 B;  4NQL B;  2L05 A;  4HCP B;  1CMX B;  2PPH A;  3UIN B;  4XX5 A;  4J6I A;  2M17 A;  3IHP C;  3RT3 B;  2DEN B;  2MBB B;  1V6E A;  1Z5S B;  2LWP A;  2L7R A;  3L0W B;  2V3S A;  1WXA A;  4W9L A;  4E3C A;  4ZRI A;  3DOW A;  2L76 A;  3VAW A;  1UBI A;  2IZV B;  2KQ7 A;  3APC A;  3A4R A;  2IO3 B;  2QHO A;  3WAO A;  4AJW A;  1Q1O A;  4BVU C;  2KJH B;  5DPW A;  2KC2 A;  3CSF A;  2MX2 A;  3KVF B;  3MJW A;  4RM9 A;  3V62 A;  1YX5 B;  2LI5 A;  2LGY A;  4NAW A;  5KHQ A;  2KLG A;  1L2N A;  3PGE A;  3VH3 B;  3ZO5 B;  3JW0 X;  4PYZ A;  2ZEQ A;  4I6L B;  4DHJ D;  2HD5 B;  3HIZ A;  2GBJ A;  2KAN A;  4FJV B;  4PS7 A;  5J18 A;  4KSL C;  1J19 A;  2N9X A;  1S1Q B;  3KUC B;  1WMH A;  3OAW A;  1OGW A;  4TUU A;  2RR9 A;  3UQB A;  4HJK A;  3SHQ A;  3QQ8 B;  4W9D A;  5G2N A;  3AI5 A;  2W9N A;  3PSE B;  1Q0W B;  2RGF A;  2Z0E B;  3A9J B;  3ML8 A;  2N1W A;  4ANU A;  3RUI B;  4W9F A;  3IG3 A;  1V86 A;  5G55 A;  2CKH B;  3ZNG C;  1R4M I;  2NR2 A;  1RLF A;  1WX9 A;  1WYW B;  3VTU A;  3M3J A;  3UGB B;  1KOT A;  2JZZ A;  2CR5 A;  2K8C A;  2KVR A;  2ZPN A;  3H7S A;  3NZU A;  2XK5 A;  4IM2 A;  1QZE A;  3UF8 A;  2BWF A;  2BYV E;  4JIO U;  2KLC A;  4EKU A;  2DHZ A;  3QC8 B;  4MSQ B;  1EUV B;  2MBQ A;  3H9D A;  4FAD A;  4LDT B;  3OJ4 B;  4WWO A;  2NBW B;  3X0W A;  3A1Q B;  1WZ3 A;  4ZDV A;  3TBL D;  2PE9 A;  2NBU A;  2LJ5 A;  5J2R A;  2CHZ A;  1WGD A;  2KK8 A;  2LD9 A;  2M8S A;  4CYE A;  2O6V A;  4X57 B;  2C7H A;  3L17 A;  3VQI A;  1SIF A;  3GOE A;  1RFA A;  1WX8 A;  4IC7 B;  2A5U A;  2ZJD A;  2KHW B;  3QA8 A;  2KO3 A;  3A33 B;  1TGZ B;  1V80 A;  3VTW A;  4WQO B;  3Q3J A;  2BWE S;  3DPD A;  3PVL A;  4YL8 A;  3QWZ B;  3NZS A;  4RM8 A;  4DHZ E;  4HLE A;  1P3Q U;  2FUH B;  1D3Z A;  3UIO B;  4HPL B;  3WAL A;  3B08 A;  2Y5B B;  2ZNV B;  1WGY A;  2L8J A;  4KVG B;  4PS3 A;  4GU2 A;  3QJZ A;  5C1Z A;  3JYU A;  5IAA C;  2BYF A;  2KJ6 A;  1AAR A;  2V4L A;  2MQJ A;  3P2B A;  2K6D B;  3I3T B;  4DK5 A;  1T0Y A;  3ZRF A;  4DDG D;  1NBF C;  5HKH A;  4XC2 A;  3RZF A;  2LUE A;  4ZRK A;  4EZL A;  2MBH A;  3PLV A;  2NPT A;  2OJR A;  4URK A;  2KTR A;  1UEL A;  4KDL B;  2ZPY A;  2KFJ A;  4XZ4 A;  3WAN A;  5L83 A;  1WIA A;  2KX0 A;  3QAR A;  1VCB A;  1P0R A;  1L7Y A;  4MGI E;  3N3K B;  2KX3 A;  1WJN A;  3H1U A;  1Z2M A;  2LVQ A;  1Y8R C;  3GZN I;  3KUZ A;  5JH5 C;  3EFU A;  2CS4 A;  1WGH A;  3V61 A;  4RMA A;  4EZK A;  5L95 C;  2LGX A;  3IVF A;  3KW5 B;  4MEM A;  1OTR B;  4I6N B;  3PS6 A;  2DYB A;  3N30 A;  2JPH A;  4FN2 A;  2JY6 A;  1UD7 A;  4HWI B;  3CST A;  1OEY J;  2LXA A;  3DVN U;  2GOW A;  1WZ0 A;  2YVC A;  4A20 A;  2IY1 B;  2J0J A;  2L0F A;  1WJ4 A;  3ZRC A;  3RZW C;  2G3Q B;  1P9D U;  2LXC A;  4HDO A;  1EO6 A;  2DZK A;  1LXD A;  2ZVO A;  1E8X A;  2L0T A;  3HHM A;  2IYD B;  4GXB A;  3U7D A;  2K1F A;  3H6N A;  3H7P A;  3L13 A;  3M62 B;  4GGQ A;  3V6E B;  4GMV A;  3HM3 A;  4LDT D;  2R2Q A;  2DZM A;  2KDI A;  4GDL A;  4K7W A;  5LXI B;  1PQS A;  3JSV B;  3NY5 A;  2M1M A; 
#chains in the Genus database with same CATH topology
 1V81 A;  1YIW A;  3K9O B;  5EDS A;  3ONS A;  2RDB C;  2UU7 A;  2LVO A;  1QF6 A;  3RNB C;  3U2S C;  2QEJ C;  1CZP A;  2RDH A;  4AJY B;  2RPQ A;  2G1E A;  2E3T A;  1I7H A;  3R2T A;  1FPY A;  2BQQ A;  2FUG 1;  4L2Y A;  3W9C B;  2D5G A;  3KH0 A;  1JW9 D;  4ANX A;  3I9V 1;  2J0K A;  3VTV A;  3ZXR A;  2PEA A;  2DYM A;  4M8N A;  1E8Y A;  5BYQ A;  1HZ5 A;  2WDQ B;  2MWS B;  1R4M B;  1PQS A;  4F8C B;  1RRB A;  4IWO A;  1J8C A;  3Q69 A;  2RMM A;  1C3T A;  2IY0 B;  4LCD E;  3P4S B;  5BMH A;  5HI1 A;  2DWQ A;  2FCQ A;  1OEY A;  5BYR A;  2JXT A;  4ACF A;  2LGI A;  2K5P A;  1TY2 A;  1WMH B;  3VUW A;  2JRI B;  2CJN A;  2J7Q B;  3QIJ A;  4BBN F;  2XEW A;  3W1S C;  3NG0 A;  4RH6 A;  3W5U B;  3RPF C;  1FNW A;  4A3O A;  4IOI E;  4WWN A;  1GJZ A;  4O1N A;  2XK5 B;  5H8Y E;  2IND C;  3TEY A;  1HTO A;  3P4R B;  3TEW A;  1IYF A;  2K25 A;  3KYD D;  1RWS A;  2AQ2 B;  2BB5 A;  3E9S A;  4MM3 B;  4BOS C;  4S0R A;  1VRA B;  3RCZ A;  3RNC C;  2DZJ A;  4HJG E;  3DDC B;  2HTH A;  3L08 A;  1GC6 A;  1Q10 A;  4ZRP A;  1HQR D;  3IAS 1;  3OG5 A;  2KVZ A;  2WXG A;  3N1X C;  3WAP A;  4FA6 A;  1HEZ E;  1ISN A;  1QQR A;  3AEG B;  4B95 A;  2KWD A;  3C8Y A;  1ZDX A;  3AU4 A;  1WJU A;  1C77 A;  3IFW B;  1C9F A;  2LRW A;  3I63 C;  2MA9 B;  4G11 A;  4JL9 A;  1P7F A;  2LRU A;  4DXG A;  4LJO B;  2N7D A;  5DPR A;  3ZDT A;  2W3S A;  1WGR A;  4GDK B;  1VD2 A;  2N1V A;  1PGX A;  3AUL A;  3KQ4 A;  1GB4 A;  2QMT A;  3AE7 B;  3AEA B;  3R66 C;  5I4D A;  3AV8 A;  4ANW A;  3SDL C;  2JVC A;  4W9C A;  1VZ8 A;  1D5X C;  2BS2 B;  3Q3O C;  2QC8 A;  4GOC A;  5CX3 A;  1QKZ A;  4W9E A;  1T0S C;  1RYJ A;  3VUX A;  3HVD A;  4EEW A;  3S2A A;  3SR6 A;  3ZTD A;  3OJ3 A;  2REX A;  4RGM A;  5LLI A;  4WWP A;  5D7G A;  4US9 A;  2BKF A;  4GDL B;  2JWZ A;  2LZ6 A;  5JHA A;  4W9G A;  3P4P B;  4NNJ B;  4I6P A;  2JU6 X;  3DCG A;  2O6V D;  3DBR I;  1NI2 A;  2JT4 B;  2Q5W D;  2GBR A;  2FCS A;  3DWM A;  2KXJ A;  3DBL B;  5GXG B;  4PS8 A;  5D3D A;  2WXP A;  2E6X A;  4TQ0 A;  4WJQ A;  3ZUN A;  3ZNI D;  2KWC A;  1LM8 B;  3NVW A;  2I1J A;  2KOX A;  2NTS A;  4TV3 A;  1JWB D;  3SD5 A;  1J7A A;  2LAS A;  1FD6 A;  3URY A;  2N0S B;  2D2Q A;  1J0G A;  1E7V A;  1D4B A;  1V1O A;  1KM7 A;  2RDG A;  2WXL A;  4FHK A;  1QOG A;  4JX1 C;  3ZJU A;  2EMT A;  3PV1 A;  3ZW3 A;  1SE2 A;  1N6Z A;  4ARC A;  1TZ1 A;  4C00 A;  2KZR A;  2K8B A;  4IWP A;  1UGJ A;  2K22 A;  1ESF A;  4BKS A;  1V9J A;  3KYC D;  3UQA A;  1JRO A;  3JSV A;  2WDV B;  4G0N B;  4WAA A;  4P6V F;  2BGF A;  2FIF A;  2QJL A;  3RNG C;  3O13 A;  1SGH A;  3C0R B;  5FKA C;  1VR9 A;  3TCA A;  2ZW1 A;  2FCN A;  1A5R A;  4G3X B;  4GB9 A;  2K39 A;  2K8H A;  1XD3 B;  3RFZ B;  1A70 A;  4WWM A;  3Q2A C;  4LK0 M;  3UIN B;  2BYT A;  2M17 A;  3IHP C;  2MBB B;  2LWP A;  2L7R A;  3GE8 C;  4E3C A;  3DOW A;  1AN8 A;  2Z8L A;  2IO3 B;  4AJW A;  2KJH B;  3V62 A;  3DBH B;  4NAW A;  2KLG A;  3LYY A;  2QCZ A;  2ZEQ A;  5EE0 A;  2HD5 B;  3KUC B;  4OHJ A;  3TUO A;  3P42 A;  3OAW A;  1OGW A;  4TUU A;  3SHQ A;  4W9D A;  1V1P B;  5G2N A;  1FIQ A;  1K53 A;  3RUI B;  1RLF A;  1WX9 A;  3M3J A;  2JZZ A;  2K8C A;  3AE2 B;  2JYT A;  3BVZ A;  4OZC A;  3TEX A;  4JIO U;  3KLS X;  4DXF A;  1LO5 D;  4LDT B;  3OJ4 B;  4A6Q A;  1E10 A;  2V3N A;  1ENF A;  1UWX A;  4BAX A;  3EUB 2;  2C7H A;  1I4G A;  1SIF A;  1RFA A;  2KO3 A;  1TGZ B;  1XF5 L;  3VTW A;  4DHZ E;  2FUH B;  3UIO B;  1ZE3 D;  2Y5B B;  2ZNV B;  1WGY A;  2J4X A;  5EE9 A;  4H2A A;  1JWS D;  1GOZ A;  2M0A A;  3JYU A;  1FNU A;  2MQJ A;  1IBX A;  4DK5 A;  1UNS A;  1C76 A;  1DYQ A;  4LNK A;  2IGH A;  4XC2 A;  4M00 A;  1L4Z B;  1N63 A;  3Q3N C;  1XLO A;  4EZL A;  2MBH A;  4ZHP A;  2NPT A;  4URK A;  2KTR A;  4YTM B;  1OFF A;  1EM7 A;  1VCB A;  2KAC A;  3GZN I;  1WWT A;  2CS4 A;  1WGH A;  4EZK A;  1NYR A;  1KLG D;  1NEK B;  1UUP A;  2WGS A;  3CST A;  4B0M A;  3DVN U;  2YVC A;  4A20 A;  1HZ6 A;  3ZRC A;  3N1Z C;  1DOI A;  4KKI A;  2LXC A;  3RI7 C;  1EO6 A;  2DZK A;  2ZVO A;  2MJD A;  1VJK A;  2IYD B;  4GXB A;  3BVM A;  2QIE B;  3M62 B;  4GGQ A;  2V4I B;  3JSV B;  1ZOY B;  3Q8F A;  1I42 A;  4M0W B;  4FXC A;  1V5O A;  1WXM A;  2KQS A;  4JQW C;  3DVG X;  4YSZ B;  4WJN A;  3PZD A;  4K7S A;  3VDZ A;  1WYG A;  1PGB A;  1HA5 A;  1F52 A;  3T9L A;  4MH0 E;  1V5T A;  3PTF C;  1F2R I;  3RNE C;  4AOF A;  2IO1 B;  4E71 A;  3MC8 A;  2PTL A;  2QDF A;  2MBO A;  2WHI A;  1F0Z A;  3LJ3 A;  4FJY A;  3NRZ A;  1YD8 U;  1T0Q C;  4REZ A;  1GG3 A;  2WDT B;  4MM3 A;  4XDD A;  4B6W A;  4HCN B;  4IW0 A;  2L00 B;  4NAW B;  4IWQ A;  1V49 A;  1BUI C;  3DQV A;  3BVG A;  1D5Z C;  3MP9 A;  3APD A;  1YX6 B;  4LJP B;  5E6N A;  1WE6 A;  1WX7 A;  3AE4 B;  2JRH A;  1T5X D;  5CHW A;  1TIF A;  3WIM A;  2EKE C;  4S17 A;  3W2D A;  3A4S C;  1UWM A;  3GP7 A;  5J17 A;  4LNI A;  1V2Y A;  1C79 A;  3U7Z A;  3W1Y A;  2K6Q A;  1XLN A;  4WQM A;  3ZDM C;  1U4A A;  1I4H A;  3B9J A;  1F9J A;  2VZK D;  4KSK C;  3ZJV A;  4MAC A;  4GDK A;  3K9P B;  3Q6B A;  2PW9 A;  4LNO A;  1UZX B;  4P7I A;  2UYZ B;  5C23 A;  3IBE A;  4RF1 A;  1FMA D;  4TQ1 A;  1QOA A;  1WXV A;  1S3S G;  3MJ5 A;  1ZXI A;  1MG8 A;  3B0A A;  3HK0 A;  2BPS A;  3ZNZ B;  1FXI A;  1WXQ A;  3VFK A;  4HDQ A;  4EZJ A;  3PRP B;  3RN9 C;  2R2O A;  3PZ7 A;  3HM6 X;  2KKC A;  3RNA C;  1IBX B;  1VLB A;  4IUM B;  3D32 A;  4HK2 A;  1XLQ A;  2UWQ A;  4K1R B;  2C60 A;  2DX5 B;  3PRZ A;  2NPT B;  2KTR B;  4RGO S;  1ZKH A;  2G45 B;  4BBN C;  4EE2 A;  4FLH A;  3X23 A;  2Y3A A;  3ZXV A;  4NPN A;  1WM2 A;  1UGM A;  2KN5 A;  1SB3 C;  1UBQ A;  3LDZ E;  4ICU A;  1IP9 A;  1TJE A;  3QHT A;  2ZNV C;  2OED A;  3MC0 B;  1LGR A;  1FO4 A;  3NOB A;  2MCN B;  5DCN A;  1FCC C;  2NVU I;  2FNJ B;  2WXK A;  1YN5 A;  2CHX A;  1DGJ A;  3L54 A;  1E9M A;  3EC8 A;  1I4R A;  1SJH D;  5D6J B;  3N32 A;  1KFY B;  3MFG A;  1R4N I;  1TBE A;  2AL6 A;  3KWV A;  1WE7 A;  2JXX A;  4WJO A;  1PFD A;  1YN4 A;  1GUA B;  4KZ0 A;  2ZW0 A;  3CF6 E;  2JF5 A;  2NCN A;  2IGG A;  3DHH C;  1XO3 A;  3Q14 C;  5AZG A;  3VVW B;  4M02 A;  1ROE A;  2ZCB A;  3O65 B;  5IN7 A;  4MJS B;  1GNU A;  3B2G A;  1X1M A;  2MBE A;  3AB5 A;  2KDE B;  4F7Z A;  4AWJ A;  2AQ3 B;  4IM0 A;  2N7J A;  4C80 A;  2AEH A;  2ON8 A;  3AH7 A;  1QOB A;  3LXF A;  1BML C;  3AXC A;  5AEK B;  3WA0 A;  2RD0 A;  4II2 B;  1HE8 A;  2N9P C;  3A9K A;  3KUD B;  2MSE D;  4RGN A;  2KN4 A;  2C7N B;  5D2M B;  2KFK A;  2HJ8 A;  1HTQ A;  2WU2 B;  5AZF A;  2PJH A;  1V1P A;  2V1Y A;  2Z59 B;  2SAK A;  3ZVV A;  4LLG M;  4RFB A;  2I38 A;  4XX5 A;  4J6I A;  3AED B;  1WRI A;  3FKY A;  2DEN B;  1V6E A;  1Z5S B;  2LHD A;  2X8X X;  3IT4 B;  3VAW A;  3A4R A;  2QHO A;  2XNA C;  3AEF B;  2MX2 A;  3KVF B;  4RM9 A;  3EGR A;  5G5H A;  3J9C A;  2LGY A;  3VH3 B;  3JW0 X;  4RGT A;  4PYZ A;  4I6L B;  3RMK C;  4DHJ D;  2PLP A;  1SXT A;  1JQ4 A;  4IDI A;  2RR9 A;  1FRR A;  4HJK A;  3QQ8 B;  1CJE A;  3AI5 A;  2PVO D;  1Q0W B;  1TS4 A;  3IG3 A;  2N9L A;  2CKH B;  3ZNG C;  1TKE A;  2NR2 A;  4A55 A;  3VTU A;  3UGB B;  2KVR A;  3NZU A;  3H7S A;  3P63 A;  2IDY A;  3UF8 A;  2BWF A;  2BYV E;  3HUI A;  1FEH A;  2AQ1 B;  4MSQ B;  2MBQ A;  3DBR B;  4FAD A;  2YEP F;  4YWG G;  1WZ3 A;  1N5W A;  2ONQ A;  3ETR A;  1C4A A;  1FNV A;  2PE9 A;  2NBU A;  2O6V A;  4X57 B;  1ZDV A;  2JSV X;  1XEE A;  3GOE A;  2WNM A;  1JML A;  1WX8 A;  4IC7 B;  4HKZ E;  2ZJD A;  1J7B A;  3B2F A;  1OQR A;  4YL8 A;  2V0G A;  2B76 B;  2RPV A;  3AEC B;  1D3Z A;  4HPL B;  2EKI A;  2M56 B;  4L1B A;  3B08 A;  1FM0 D;  3EA6 A;  4KVG B;  4PS3 A;  3N9Y C;  2VH2 A;  5IAA C;  1AAR A;  2V4L A;  3P2B A;  3I3T B;  1D5M C;  3CWI A;  3NVV A;  1T0Y A;  1NBF C;  2W55 A;  5FK9 C;  3RZF A;  1XCQ L;  2LMC A;  4M0W A;  4KGS A;  3PLV A;  1MHH E;  1PYW D;  5L83 A;  1SE3 A;  4R3D A;  2KX0 A;  3FAH A;  1MPE A;  1P0R A;  2OJW A;  1YJJ A;  1WJN A;  1NEN B;  3H1U A;  1Z2M A;  1Y8R C;  3EFU A;  2Y5P A;  1YMH E;  2X38 A;  4PK1 A;  4GLS C;  3PS6 A;  1L0Y B;  1YQ4 B;  2LXA A;  2KDM A;  2J0J A;  5AUK A;  3E56 A;  3RZW C;  1P9D U;  4HDO A;  2R61 A;  2LUM A;  3SEB A;  2MJE A;  2PMV A;  3HVZ A;  2L0T A;  3ZQ4 A;  1N61 A;  3Q8A A;  2K1F A;  2K9X A;  2NTT A;  2DZM A;  2KYW A;  1D6E C;  1B1Z A;  2TSS A;  1C4P A;  4ZRQ A;  3ZKJ C;  1DOY A;  2KWU B;  4NJC A;  2N4F A;  3WAM A;  3U4E G;  3A9K B;  4OVU A;  2KFK B;  2WS3 B;  3MHS D;  2WXM A;  2WXQ A;  1UF0 A;  3OLM D;  5DPT A;  1ACC A;  3R2I A;  1TKG A;  2LGD A;  3FC4 A;  1L5P A;  2WU5 B;  5FR6 A;  3ZLZ A;  1H8C A;  1E0Z A;  2DBY A;  4NY0 A;  3V05 A;  1BXT A;  5LXH A;  4KIK A;  2D07 B;  5TR5 A;  3CMM B;  4OVZ A;  3V60 A;  2J52 A;  1EF1 A;  2KWV B;  1WXS A;  4NJ7 A;  4BFR A;  4J3O D;  2HTM E;  2ZCC A;  2HE7 A;  2NMQ A;  2C7M B;  2BTE A;  2OOB B;  1N5X A;  3HRD D;  2WWZ A;  3BZD B;  4W9H A;  3DVG Y;  3RD2 A;  4GN1 A;  4HXD A;  4W9I A;  4B0E A;  3N1Y C;  3NZ3 A;  2FID A;  4W9K A;  4MGZ E;  1NDD A;  2DZI A;  2JZ3 B;  2CU3 A;  1YN3 A;  2DAF A;  2O6V B;  2RSU A;  4II3 B;  2GB1 A;  2D3B A;  2GLS A;  4YT0 B;  4ZYS A;  1TS2 A;  3DBS A;  1IGC A;  2ZVN A;  1TY0 A;  2WX0 A;  3GZN B;  4D2K A;  1E7U A;  2BW2 A;  1WJ6 A;  1VZ7 A;  3I5J C;  3U8Z A;  3SFD B;  1TT5 B;  4NAM A;  3AE1 B;  5JHB A;  4IM3 A;  3PHW B;  4YTN B;  4FHJ A;  4DBG A;  3EEC A;  2NBV B;  3M95 A;  1ZPS A;  3AN1 A;  2BBC A;  2FCM A;  3A9J A;  1WY8 A;  4K81 A;  3JVZ X;  4XGA B;  4E74 A;  1SE4 A;  3VR8 B;  5EE3 A;  4KGR A;  2ASQ A;  3ZIM A;  1XT9 B;  2G9H D;  4JGH B;  2PVG C;  1F1H A;  1OQQ A;  1L4D B;  4JLC A;  5GMV A;  5DPS A;  2AWT A;  3BIN A;  2BKR B;  1TYG B;  4MH8 A;  2WYQ A;  1XLP A;  1KLV A;  1J7C A;  3TL5 A;  2N7E A;  1T6B X;  2BF8 B;  4GSW A;  4NZL B;  3ENE A;  3IXS A;  2KMA A;  3R8B A;  2FE8 A;  1I4P A;  2JZP A;  2K3U A;  2YEP B;  2PE6 B;  2FBW B;  4MJS A;  4A90 A;  1JAL A;  2EMS A;  4CHK A;  2ZZP B;  4QAY A;  3CIR B;  4CQN A;  1RAX A;  4UDU C;  3ABV B;  3L10 B;  2QIL A;  2KD0 A;  2M4N A;  1FCL A;  2I1K A;  1XXG A;  4BKT A;  2YLM A;  1G6J A;  4LNN A;  4A8X C;  4MEL A;  2LHE A;  1GB1 A;  3PRE A;  4USA A;  1WI0 A;  4ZYN A;  1WF9 A;  3DHI C;  3AE3 B;  1T0R C;  5E6P A;  3DVN V;  2B3A A;  5G5G A;  3FIL A;  1SEB D;  5FR3 A;  2MLB A;  1C4C A;  2QSD A;  5JZE B;  1JRP A;  3NS8 A;  2XBB C;  3SFE B;  1WH3 A;  2GMI C;  4DDI D;  1ZGU B;  4DXA B;  2KAJ A;  4AP4 C;  3AE6 B;  3PRM B;  4KIK B;  2J53 A;  4M01 A;  1YNT E;  2C9W B;  3ALB A;  5D94 A;  2KJR A;  4XDC A;  1GAQ B;  1EF5 A;  4TMA B;  2L52 A;  2KDF B;  4EUT A;  1QT9 A;  1Y56 A;  1IGD A;  2KNB A;  2FAZ A;  3DHG C;  3VH4 B;  2DNF A;  1K52 A;  4BZA A;  1FXT B;  2D3G A;  3BYT B;  3TJP A;  1P1A A;  2LVP A;  2O2V B;  3NS1 A;  4PYU A;  3V3X A;  3ZTC A;  2MP2 B;  2I2Y A;  1QIL A;  3Q3F A;  1K8R B;  4N9F 4;  1OQY A;  2MHJ A;  4AUQ C;  2W82 A;  3QK0 A;  4XE0 A;  4OW0 A;  1SF0 A;  2MW5 A;  2AYO B;  2WX1 A;  4OZA A;  3AE5 B;  3MC9 A;  4HCP B;  4JE3 B;  2PPH A;  1ZUD 2;  4HPP A;  3L0W B;  2WXF A;  3AEB B;  4W9L A;  1WXA A;  5JXV A;  5HG2 A;  2K0P A;  2IZV B;  2KQ7 A;  3APC A;  3W5V B;  3WAO A;  5DPW A;  4BVU C;  1EWY C;  3CSF A;  2GI9 A;  4RNA A;  3OWE B;  1YX5 B;  2W3R A;  1L2N A;  2KMM A;  4WH4 A;  3ZO5 B;  3HIZ A;  2KAN A;  5IO9 A;  3PZ8 A;  1NYQ A;  1E7P B;  1ET6 A;  2N9X A;  1S1Q B;  1SJE D;  2Z0E B;  2RGF A;  3A9J B;  1TZO A;  2N1W A;  1V86 A;  2L83 A;  1IUE A;  5G55 A;  2WXN A;  1R4M I;  2CR5 A;  4IM2 A;  3U52 E;  3Q8B A;  4C4V A;  2KLC A;  5BMI A;  4L23 A;  4EKU A;  2DHZ A;  3QC8 B;  3H9D A;  3X0W A;  1YQ3 B;  1NI3 A;  2V3P A;  4ZDV A;  1VDV A;  3EFC A;  2LJ5 A;  2CHZ A;  2LFI A;  2LD9 A;  1R4N B;  1SSN A;  4YSY B;  1HXY D;  3VQI A;  3AE8 B;  2INP E;  1NVI D;  2KHW B;  3QA8 A;  1AWD A;  3A33 B;  4WQO B;  3DWG C;  1ET9 A;  3NZS A;  4RM8 A;  3UI3 A;  1WSP A;  3GB1 A;  3ZJT A;  1QLB B;  3WAL A;  1ZP0 B;  2L8J A;  5MPO A;  3ZYY X;  2LEK A;  2K6D B;  2GRI A;  4DDG D;  1I4X A;  5HKH A;  4ZRK A;  2BS4 B;  2OJR A;  1UEL A;  4KDL B;  3IT6 B;  4XZ4 A;  2INC C;  3WAN A;  1L6U A;  4ZOH C;  1L7Y A;  4MGI E;  2AX5 A;  3FIL B;  1T3Q A;  2KX3 A;  3BWU D;  2WDR B;  4RMA A;  5L95 C;  2LGX A;  3IVF A;  5HFY A;  4MEM A;  4I6N B;  3N30 A;  2JPH A;  1TKY A;  1FRD A;  1F2R C;  2MEK A;  2L0F A;  1WJ4 A;  4OZB A;  2G3Q B;  5BMG A;  4IKG A;  4C7Z A;  3NVZ A;  2J42 A;  3U7D A;  3NUH B;  3H6N A;  3L13 A;  3V6E B;  3HM3 A;  4LDT D;  5E6J A;  2R2Q A;  4LTU A;  5LXI B;  2VH1 A;  2M1M A;  4EOY A;  4P1B C;  1H4R A;  3ZGZ A;  4HRO A;  2KQ4 X;  3NJT A;  2VZK B;  3QX1 A;  5CHV C;  3WCQ A;  4TSS A;  3IAM 1;  3P1M A;  1CQV A;  2HJ1 A;  1JRU A;  1STE A;  3VUY A;  1E8W A;  4MGY E;  1L0X B;  3AM9 A;  4ASW C;  4BKG A;  2GBK A;  3R3M A;  3B1L X;  4NJ6 A;  3TIX A;  4BOZ B;  2L3Z A;  1AYF A;  2KTF A;  1WM3 A;  2CJO A;  4FBJ B;  2JWU A;  3H7P B;  3EHV A;  1RM6 C;  4EFO A;  2KC1 A;  5E6O A;  3DBL I;  4A3P A;  4F1S A;  4HVB A;  4KDI C;  4JWS C;  1YJI A;  2ICI A;  2N9E B;  1QOF A;  1PGA A;  3NHE B;  4KGT A;  2A4Z A;  4LNF A;  1MI0 A;  2IO2 B;  2D11 A;  2HDE A;  1JWU D;  2BS3 B;  1WRD B;  3BK2 A;  4KX6 B;  1I4Q A;  4AQ7 A;  3L16 A;  4ARI A;  2WXJ A;  5IP4 D;  3M63 B;  4DHZ B;  3Q8C A;  1E5W A;  4HRS A;  1KRH A;  2GBN A;  1SE9 A;  2PKO A;  1E90 A;  4XWT A;  5D3I B;  4BKS D;  3MTN B;  3R7Q A;  4K3C A;  2IBI B;  3W1S A;  4C4V B;  2EEL A;  1Q5W B;  2IPK D;  4MDK E;  1YJ1 A;  1KJT A;  4ZHO A;  1SIJ A;  1C78 A;  2L1A A;  4K3B A;  4W9J A;  1JCK B;  3V6C B;  1V97 A;  1GPX A;  2CU1 A;  4FUL A;  1LQB A;  2BYE A;  4NQK E;  1UH6 A;  3TSS A;  2GBM A;  2G4D B;  3N20 C;  3Q3M C;  3LB8 C;  3VXW A;  4XYC A;  3SU8 X;  1BT0 A;  3ML9 A;  4M8M A;  4ZRJ A;  4DWF A;  2IO0 B;  4WJP A;  2DLB A;  5CTR C;  4YXD B;  1I35 A;  2DAJ A;  2G4S A;  2BVC A;  4KV2 A;  3VR9 B;  4HEA 1;  3R7R A;  5IOI A;  2D10 A;  2AL3 A;  1IPG A;  2BT6 A;  1XCT L;  4C56 C;  3I57 A;  3BYY B;  1YQB A;  4HPM B;  1ZW7 A;  3PO0 A;  1XQQ A;  3PPA A;  3UIP B;  3DBH I;  4G50 A;  3RUL A;  3A1Q A;  1WGK A;  3PHX B;  5EE1 A;  4K7U A;  1E8Z A;  4ICV A;  1WGG A;  2LJI A;  1F77 A;  2WXI A;  2VRR B;  3TMP B;  3ECI A;  5BO4 B;  1DOX A;  4OVV A;  3U30 A;  3PLU A;  2JUO A;  3T8M A;  1EU4 A;  1EWC A;  1JWM D;  1L0V B;  2MRP A;  2D3A A;  1KTK A;  2JYE A;  5LNK 1;  3ZNH B;  3BY4 B;  1WFY A;  3VHT C;  1PUT A;  4IG7 B;  1MHX A;  1M94 A;  2DYO A;  5TSS A;  1AW7 A;  3RNF C;  5IKC M;  5IA7 A;  2KDB A;  3BK1 A;  2WXH A;  2XN9 C;  2O2V A;  2BB6 A;  4P1C C;  1GC7 A;  2MP2 A;  1K51 A;  3AU5 A;  1P7E A;  2Z0D B;  4KZC A;  1P98 A;  5AZH A;  4DHJ B;  1FFV A;  3AEE B;  3RYT A;  5KHO A;  3TEZ A;  1MVK A;  2CHW A;  3APF A;  4CO7 A;  3PT2 B;  3H8H A;  1ZXH A;  3T3N A;  4GIV A;  4Q2J A;  2WP9 B;  4C7Y A;  2J0M A;  3QCA A;  4MSM B;  2MH7 A;  4FJZ A;  4ANV A;  2LGS A;  5HHD G;  4B9K A;  2L32 A;  4MT5 A;  4MGK E;  5CHF A;  4RF0 A;  3QAQ A;  1LFD A;  5H92 C;  2C5L C;  2KMC A;  2M19 A;  1TTN A;  1WR6 E;  1WR1 A;  4TKN A;  3VRB B;  2WLB A;  5C2T B;  1C1Y B;  2NS5 A;  4NQL B;  2V9H A;  2L05 A;  1JWA D;  4A9A A;  1CMX B;  3RT3 B;  1FFU A;  2V3S A;  1B9R A;  2IGD A;  4P16 A;  4JPS A;  4ZRI A;  2L76 A;  1UBI A;  4N59 A;  3VRA B;  1Q1O A;  2KC2 A;  4WUR A;  2MJ3 A;  1MJD A;  3MJW A;  2JQR B;  2LI5 A;  5KHQ A;  4HKQ A;  3PGE A;  4YTP B;  3AE9 B;  1K50 A;  1SBB B;  4WAF A;  1CK1 A;  2GBJ A;  2WXO A;  3C19 A;  4FJV B;  4PS7 A;  5J18 A;  4KSL C;  1J19 A;  2ACZ B;  3L4P A;  1WMH A;  3AMZ A;  3UQB A;  1VZ6 A;  4DQO C;  2W9N A;  3PSE B;  3ML8 A;  4ANU A;  3P4Q B;  5BYS A;  4W9F A;  4N6E B;  2H88 B;  1WYW B;  1KOT A;  5AUI A;  2ZPN A;  2XK5 A;  1QZE A;  3NVY A;  4US8 A;  1KH0 A;  1PDX A;  2IJ0 A;  4ITK A;  1EUV B;  4WWO A;  2NBW B;  3A1Q B;  5C3J B;  3KWL A;  3TBL D;  2WQY B;  5J2R A;  2Y5C A;  1WGD A;  2KK8 A;  3Q8E A;  2M8S A;  4CYE A;  3L17 A;  2N9K A;  1EU3 A;  3BII D;  2A5U A;  1YOV B;  4N58 A;  2H89 B;  1V80 A;  4RCO A;  1FXA A;  3Q3J A;  2BWE S;  3DPD A;  3PVL A;  3QWZ B;  1TS5 A;  4WIP A;  4HLE A;  1P3Q U;  4GU2 A;  1RFK A;  2PIA A;  5T8I A;  3QJZ A;  4KKJ A;  5C1Z A;  2BYF A;  2KJ6 A;  2INN E;  3ZRF A;  2LUE A;  3GE3 C;  2KT7 A;  3GS2 A;  2ZPY A;  2KFJ A;  3MHZ A;  1R7S A;  1WIA A;  3QAR A;  3T3O A;  2SEB D;  3N3K B;  2LVQ A;  3KUZ A;  5JH5 C;  2W54 A;  3V61 A;  3KW5 B;  1OTR B;  1KLU D;  2DYB A;  1MG4 A;  4FN2 A;  2JY6 A;  1UD7 A;  1L6V A;  4HWI B;  4PT5 A;  1TS3 A;  2JX5 A;  1OEY J;  1MFW A;  2GOW A;  1WZ0 A;  1KF6 B;  2IY1 B;  4YSX B;  4AS1 A;  1E6E B;  1LXD A;  4JWU C;  2D3C A;  1E8X A;  1N60 A;  1V8C A;  2OHF A;  3HHM A;  1M4V A;  4XWW A;  3H7P A;  4GMV A;  4GDL A;  2KDI A;  2WXR A;  4K7W A;  1N62 A;  2M0X A;  3NY5 A; 
#chains in the Genus database with same CATH homology
 1I42 A;  4M0W B;  4EOY A;  1V81 A;  1YIW A;  3K9O B;  3ZKJ C;  1V5O A;  2KWU B;  1WXM A;  1H4R A;  5EDS A;  3ONS A;  2KQS A;  4JQW C;  3DVG X;  2N4F A;  2LVO A;  3WAM A;  4WJN A;  3PZD A;  3QX1 A;  3A9K B;  4K7S A;  3VDZ A;  5CHV C;  4AJY B;  4OVU A;  2KFK B;  2RPQ A;  3MHS D;  3OLM D;  1JRU A;  3T9L A;  4MH0 E;  1V5T A;  3VUY A;  3KH0 A;  3PTF C;  5DPT A;  4AOF A;  2IO1 B;  1E8W A;  2LGD A;  4ANX A;  4MGY E;  4E71 A;  4ASW C;  4BKG A;  2GBK A;  3R3M A;  3B1L X;  4NJ6 A;  2MBO A;  3TIX A;  2J0K A;  5FR6 A;  3VTV A;  4BOZ B;  2L3Z A;  2PEA A;  2DYM A;  4M8N A;  3ZLZ A;  3LJ3 A;  2KTF A;  1H8C A;  1E8Y A;  4FJY A;  4NY0 A;  1WM3 A;  1YD8 U;  4FBJ B;  5LXH A;  3H7P B;  4KIK A;  3EHV A;  2MWS B;  4EFO A;  2D07 B;  5TR5 A;  4F8C B;  1RRB A;  4IWO A;  1GG3 A;  2KC1 A;  1J8C A;  2WDT B;  5E6O A;  4MM3 A;  3DBL I;  4A3P A;  4F1S A;  4B6W A;  4HCN B;  4KDI C;  4HVB A;  1C3T A;  2IY0 B;  3CMM B;  4LCD E;  2N9E B;  4IW0 A;  3V60 A;  2L00 B;  4NAW B;  1EF1 A;  4IWQ A;  3NHE B;  1V49 A;  2FCQ A;  2KWV B;  1OEY A;  1WXS A;  4NJ7 A;  2A4Z A;  3DQV A;  2IO2 B;  4BFR A;  2D11 A;  1WRD B;  3APD A;  3L16 A;  1YX6 B;  2ZCC A;  4LJP B;  2HE7 A;  2C7M B;  5E6N A;  1WE6 A;  1WMH B;  3M63 B;  4DHZ B;  3VUW A;  2JRI B;  1WX7 A;  2OOB B;  1E5W A;  2J7Q B;  2JRH A;  3QIJ A;  4BBN F;  2GBN A;  1SE9 A;  2XEW A;  3W1S C;  1E90 A;  5CHW A;  4A3O A;  3WIM A;  2WWZ A;  4W9H A;  2EKE C;  3DVG Y;  4BKS D;  3MTN B;  4WWN A;  1GJZ A;  3RD2 A;  3A4S C;  3R7Q A;  4GN1 A;  2XK5 B;  4HXD A;  5J17 A;  2IBI B;  4W9I A;  1V2Y A;  3W1S A;  1Q5W B;  2FID A;  3W1Y A;  4MDK E;  2K6Q A;  1YJ1 A;  1KJT A;  4W9K A;  4MGZ E;  1IYF A;  1NDD A;  2DZI A;  2JZ3 B;  2K25 A;  3KYD D;  3ZDM C;  1U4A A;  4W9J A;  1F9J A;  4KSK C;  4BOS C;  3V6C B;  2DAF A;  2CU1 A;  4FUL A;  2O6V B;  1LQB A;  3K9P B;  4GDK A;  3RCZ A;  2RSU A;  1UZX B;  2DZJ A;  4II3 B;  2BYE A;  4P7I A;  4NQK E;  1UH6 A;  2UYZ B;  3DDC B;  5C23 A;  2HTH A;  3DBS A;  2GBM A;  2G4D B;  2ZVN A;  3IBE A;  3L08 A;  4TQ1 A;  1GC6 A;  1WXV A;  2WX0 A;  3VXW A;  1E7U A;  3SU8 X;  1WJ6 A;  1BT0 A;  1S3S G;  3U8Z A;  1MG8 A;  3ML9 A;  3B0A A;  3HK0 A;  4M8M A;  2BPS A;  4ZRJ A;  3ZNZ B;  3VFK A;  4HDQ A;  5JHB A;  4DWF A;  4IM3 A;  4EZJ A;  3PHW B;  4FHJ A;  3WAP A;  3EEC A;  2IO0 B;  2NBV B;  2R2O A;  3PRP B;  3HM6 X;  4WJP A;  4DBG A;  2KKC A;  3M95 A;  4FA6 A;  4IUM B;  5CTR C;  3D32 A;  2FCM A;  1ISN A;  4B95 A;  1I35 A;  3A9J A;  4HK2 A;  2DAJ A;  2UWQ A;  1WY8 A;  4K81 A;  3AU4 A;  4K1R B;  1WJU A;  2C60 A;  2G4S A;  4KV2 A;  2DX5 B;  3IFW B;  3PRZ A;  2LRW A;  2MA9 B;  3R7R A;  3JVZ X;  2D10 A;  2NPT B;  4G11 A;  2AL3 A;  1IPG A;  2LRU A;  4JL9 A;  2KTR B;  4E74 A;  4LJO B;  1ZKH A;  2G45 B;  4BBN C;  2ASQ A;  4FLH A;  2N7D A;  3ZIM A;  1YQB A;  1XT9 B;  4HPM B;  5DPR A;  3X23 A;  3ZDT A;  1ZW7 A;  3PPA A;  1XQQ A;  4JGH B;  1WGR A;  4GDK B;  3DBH I;  4G50 A;  3UIP B;  1VD2 A;  2N1V A;  4NPN A;  5GMV A;  4JLC A;  3RUL A;  5DPS A;  3A1Q A;  3AUL A;  3R66 C;  2AWT A;  3BIN A;  1WM2 A;  1UGM A;  3SDL C;  2JVC A;  2BKR B;  3PHX B;  4W9C A;  4ANW A;  2WYQ A;  2KN5 A;  4K7U A;  1E8Z A;  1KLV A;  4ICV A;  1WGG A;  1UBQ A;  3LDZ E;  3TL5 A;  2N7E A;  4GOC A;  4ICU A;  5CX3 A;  4W9E A;  1IP9 A;  2BF8 B;  2VRR B;  3QHT A;  2ZNV C;  4GSW A;  3TMP B;  3ENE A;  3NOB A;  3ECI A;  2MCN B;  3S2A A;  3VUX A;  5BO4 B;  4EEW A;  2KMA A;  4OVV A;  5DCN A;  2NVU I;  3U30 A;  3ZTD A;  3OJ3 A;  2PE6 B;  2REX A;  4MJS A;  4WWP A;  5D7G A;  5LLI A;  3PLU A;  2FNJ B;  2BKF A;  2JUO A;  2EMS A;  3T8M A;  4GDL B;  2JWZ A;  2LZ6 A;  4CHK A;  4W9G A;  5JHA A;  2MRP A;  2ZZP B;  4NNJ B;  1RAX A;  2CHX A;  4I6P A;  3ZNH B;  3DCG A;  3L54 A;  3BY4 B;  3L10 B;  2O6V D;  3DBR I;  1NI2 A;  2JT4 B;  3EC8 A;  1WFY A;  2KD0 A;  3VHT C;  2GBR A;  4IG7 B;  2M4N A;  2I1K A;  1M94 A;  2DYO A;  2FCS A;  5D6J B;  2KXJ A;  4BKT A;  2YLM A;  5IA7 A;  4PS8 A;  3N32 A;  1G6J A;  1R4N I;  4TQ0 A;  1TBE A;  2AL6 A;  2KDB A;  4MEL A;  4WJQ A;  3ZUN A;  3ZNI D;  1WE7 A;  2JXX A;  2O2V A;  3PRE A;  4WJO A;  2KWC A;  1GC7 A;  1LM8 B;  1WI0 A;  4ZYN A;  2MP2 A;  1WF9 A;  2M0X A;  2I1J A;  5E6P A;  2KOX A;  3DVN V;  2B3A A;  3AU5 A;  1GUA B;  4KZ0 A;  4TV3 A;  3CF6 E;  3SD5 A;  2MLB A;  5JZE B;  2Z0D B;  4KZC A;  2LAS A;  1P98 A;  5AZH A;  2JF5 A;  3NS8 A;  4DHJ B;  2XBB C;  2NCN A;  3RYT A;  1WH3 A;  2GMI C;  3VVW B;  5AZG A;  5KHO A;  2D2Q A;  1J0G A;  1E7V A;  4DDI D;  1ZGU B;  4DXA B;  1KM7 A;  2CHW A;  3APF A;  2ZCB A;  4FHK A;  4CO7 A;  3O65 B;  4AP4 C;  3PT2 B;  2EMT A;  4MJS B;  3PV1 A;  4KIK B;  3PRM B;  3ZW3 A;  1GNU A;  2C9W B;  1X1M A;  2MBE A;  3ALB A;  4GIV A;  2KDE B;  1TZ1 A;  2J0M A;  5D94 A;  2KJR A;  2K8B A;  2KZR A;  3QCA A;  4IWP A;  4AWJ A;  1EF5 A;  4F7Z A;  4MSM B;  4FJZ A;  4ANV A;  2KDF B;  4IM0 A;  4EUT A;  4BKS A;  4B9K A;  1V9J A;  3KYC D;  2AEH A;  3UQA A;  4MGK E;  2KNB A;  5CHF A;  2FAZ A;  3JSV A;  4G0N B;  4WAA A;  3VH4 B;  3QAQ A;  1FXT B;  2D3G A;  1LFD A;  2C5L C;  3TJP A;  2BGF A;  1P1A A;  2FIF A;  2LVP A;  3AXC A;  5AEK B;  2O2V B;  4PYU A;  2KMC A;  3ZTC A;  2MP2 B;  3WA0 A;  2RD0 A;  1SGH A;  3Q3F A;  3C0R B;  1TTN A;  1HE8 A;  2N9P C;  1WR6 E;  1K8R B;  2MSE D;  3A9K A;  3KUD B;  4II2 B;  1OQY A;  1WR1 A;  4N9F 4;  4TKN A;  4AUQ C;  2C7N B;  5D2M B;  2KFK A;  2HJ8 A;  3QK0 A;  5AZF A;  2PJH A;  3TCA A;  2V1Y A;  2Z59 B;  2FCN A;  1A5R A;  4G3X B;  4GB9 A;  2MW5 A;  3ZVV A;  2K39 A;  2AYO B;  2K8H A;  1C1Y B;  2WX1 A;  2NS5 A;  1XD3 B;  4NQL B;  2L05 A;  4HCP B;  1CMX B;  2PPH A;  3UIN B;  4XX5 A;  4J6I A;  2M17 A;  3IHP C;  3RT3 B;  2DEN B;  2MBB B;  1V6E A;  1Z5S B;  2LWP A;  2L7R A;  3L0W B;  2V3S A;  1WXA A;  4W9L A;  4E3C A;  4ZRI A;  3DOW A;  2L76 A;  3VAW A;  1UBI A;  2IZV B;  2KQ7 A;  3APC A;  3A4R A;  2IO3 B;  2QHO A;  3WAO A;  4AJW A;  1Q1O A;  4BVU C;  2KJH B;  5DPW A;  2KC2 A;  3CSF A;  2MX2 A;  3KVF B;  3MJW A;  4RM9 A;  3V62 A;  1YX5 B;  2LI5 A;  2LGY A;  4NAW A;  5KHQ A;  2KLG A;  1L2N A;  3PGE A;  3VH3 B;  3ZO5 B;  3JW0 X;  4PYZ A;  2ZEQ A;  4I6L B;  4DHJ D;  2HD5 B;  3HIZ A;  2GBJ A;  2KAN A;  4FJV B;  4PS7 A;  5J18 A;  4KSL C;  1J19 A;  2N9X A;  1S1Q B;  3KUC B;  1WMH A;  3OAW A;  1OGW A;  4TUU A;  2RR9 A;  3UQB A;  4HJK A;  3SHQ A;  3QQ8 B;  4W9D A;  5G2N A;  3AI5 A;  2W9N A;  3PSE B;  1Q0W B;  2RGF A;  2Z0E B;  3A9J B;  3ML8 A;  2N1W A;  4ANU A;  3RUI B;  4W9F A;  3IG3 A;  1V86 A;  5G55 A;  2CKH B;  3ZNG C;  1R4M I;  2NR2 A;  1RLF A;  1WX9 A;  1WYW B;  3VTU A;  3M3J A;  3UGB B;  1KOT A;  2JZZ A;  2CR5 A;  2K8C A;  2KVR A;  2ZPN A;  3H7S A;  3NZU A;  2XK5 A;  4IM2 A;  1QZE A;  3UF8 A;  2BWF A;  2BYV E;  4JIO U;  2KLC A;  4EKU A;  2DHZ A;  3QC8 B;  4MSQ B;  1EUV B;  2MBQ A;  3H9D A;  4FAD A;  4LDT B;  3OJ4 B;  4WWO A;  2NBW B;  3X0W A;  3A1Q B;  1WZ3 A;  4ZDV A;  3TBL D;  2PE9 A;  2NBU A;  2LJ5 A;  5J2R A;  2CHZ A;  1WGD A;  2KK8 A;  2LD9 A;  2M8S A;  4CYE A;  2O6V A;  4X57 B;  2C7H A;  3L17 A;  3VQI A;  1SIF A;  3GOE A;  1RFA A;  1WX8 A;  4IC7 B;  2A5U A;  2ZJD A;  2KHW B;  3QA8 A;  2KO3 A;  3A33 B;  1TGZ B;  1V80 A;  3VTW A;  4WQO B;  3Q3J A;  2BWE S;  3DPD A;  3PVL A;  4YL8 A;  3QWZ B;  3NZS A;  4RM8 A;  4DHZ E;  4HLE A;  1P3Q U;  2FUH B;  1D3Z A;  3UIO B;  4HPL B;  3WAL A;  3B08 A;  2Y5B B;  2ZNV B;  1WGY A;  2L8J A;  4KVG B;  4PS3 A;  4GU2 A;  3QJZ A;  5C1Z A;  3JYU A;  5IAA C;  2BYF A;  2KJ6 A;  1AAR A;  2V4L A;  2MQJ A;  3P2B A;  2K6D B;  3I3T B;  4DK5 A;  1T0Y A;  3ZRF A;  4DDG D;  1NBF C;  5HKH A;  4XC2 A;  3RZF A;  2LUE A;  4ZRK A;  4EZL A;  2MBH A;  3PLV A;  2NPT A;  2OJR A;  4URK A;  2KTR A;  1UEL A;  4KDL B;  2ZPY A;  2KFJ A;  4XZ4 A;  3WAN A;  5L83 A;  1WIA A;  2KX0 A;  3QAR A;  1VCB A;  1P0R A;  1L7Y A;  4MGI E;  3N3K B;  2KX3 A;  1WJN A;  3H1U A;  1Z2M A;  2LVQ A;  1Y8R C;  3GZN I;  3KUZ A;  5JH5 C;  3EFU A;  2CS4 A;  1WGH A;  3V61 A;  4RMA A;  4EZK A;  5L95 C;  2LGX A;  3IVF A;  3KW5 B;  4MEM A;  1OTR B;  4I6N B;  3PS6 A;  2DYB A;  3N30 A;  2JPH A;  4FN2 A;  2JY6 A;  1UD7 A;  4HWI B;  3CST A;  1OEY J;  2LXA A;  3DVN U;  2GOW A;  1WZ0 A;  2YVC A;  4A20 A;  2IY1 B;  2J0J A;  2L0F A;  1WJ4 A;  3ZRC A;  3RZW C;  2G3Q B;  1P9D U;  2LXC A;  4HDO A;  1EO6 A;  2DZK A;  1LXD A;  2ZVO A;  1E8X A;  2L0T A;  3HHM A;  2IYD B;  4GXB A;  3U7D A;  2K1F A;  3H6N A;  3H7P A;  3L13 A;  3M62 B;  4GGQ A;  3V6E B;  4GMV A;  3HM3 A;  4LDT D;  2R2Q A;  2DZM A;  2KDI A;  4GDL A;  4K7W A;  5LXI B;  1PQS A;  3JSV B;  3NY5 A;  2M1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...