2GBMA

Crystal structure of the 35-36 8 glycine insertion mutant of ubiquitin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGGGGGGGGGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gbmA00
4TKNA 4MEMA 4II2B 1G6JA 2IO0B 3HM6X 4KDIC 2DYMA 1H4RA 2DYBA 4EZLA 4IW0A 1NDDA 1TGZB 4WJPA 4ZRJA 2JZZA 4W9LA 3VQIA 4BOSC 2KFKB 4TQ0A 2KLCA 4GIVA 4NY0A 1GC6A 3A9JB 1R4MI 3PT2B 4PS3A 5IAAC 2K1FA 2MCNB 2PJHA 2D2QA 3OLMD 4NAWB 3RUIB 4ANXA 4DDID 3QK0A 3IFWB 2K8HA 3R7RA 4K7SA 5C23A 4DHZB 3UF8A 3JYUA 3VAWA 4AOFA 5J18A 2ZNVB 1V86A 1VD2A 3IVFA 4PYUA 2KKCA 2KOXA 1WY8A 4RM9A 2LJ5A 1WR6E 3M95A 2J7QB 3EC8A 3VUYA 2IBIB 4II3B 2ZPYA 1YX5B 2DAFA 4GDLB 3ZVVA 5D94A 2LXCA 3QWZB 2MQJA 4WWOA 3VTWA 4F8CB 3OJ3A 3NS8A 3EHVA 2N7DA 1K8RB 1YIWA 2XEWA 1WM3A 1WRDB 1ZKHA 2WWZA 1WE7A 3A4RA 2G45B 3MTNB 5G2NA 1Q1OA 2KFKA 3H1UA 2CR5A 3APFA 4E74A 4HWIB 2BGFA 2JVCA 1WF9A 3A9JA 3OJ4B 1T0YA 4BFRA 2GMIC 2I1KA 2L00B 2FIFA 3V62A 4ANUA 2N1VA 4NAWA 4W9CA 3D32A 1WX7A 1L7YA 4TQ1A 3EFUA 2CHWA 1AARA 4WJOA 1EF1A 4IC7B 4ANWA 3LJ3A 5E6PA 1JRUA 3L16A 4MGZE 4MH0E 3QA8A 1IP9A 2AWTA 2N7EA 4KSLC 2LASA 4GDLA 2DZKA 1WI0A 4EFOA 2MBBB 1V80A 3K9OB 3KH0A 4B6WA 3PHWB 4BBNC 2C9WB 2M4NA 2KTFA 1WGDA 2HE7A 5J2RA 1WJUA 4ICVA 2HJ8A 4TV3A 2JRHA 4JQWC 4DHJB 4ZRIA 4CYEA 3PSEB 1ISNA 4GXBA 3IBEA 2LGDA 2ZEQA 3A4SC 3DBSA 1V81A 2AEHA 2ZPNA 1XQQA 3ML9A 2LVOA 2RGFA 3P2BA 2D07B 3EECA 3WANA 2CU1A 2KN5A 2JT4B 2XK5B 1J0GA 2MBEA 3ZNZB 1Q5WB 3DVGX 4GB9A 1BT0A 2O6VB 4FADA 2R2QA 2FUHB 1V9JA 4NQLB 2NVUI 1WR1A 3AU5A 3QCAA 1E8YA 4HPMB 4KZCA 3TIXA 3VUWA 2B3AA 4WWPA 4PYZA 2K8CA 4MELA 4OVUA 4XX5A 3TJPA 2KNBA 1RLFA 5L83A 4M8MA 4KVGB 2NBVB 2LI5A 1V5TA 2J0MA 3KYDD 2KX0A 4W9GA 1NBFC 3VFKA 1WXVA 1WJ4A 4A3PA 2D3GA 4B95A 2IO3B 4IG7B 4AJYB 4G50A 2EMSA 3RYTA 3C0RB 5KHOA 3CSTA 3L08A 4J6IA 3T9LA 2JUOA 3CF6E 3QHTA 3KYCD 5LXIB 3N32A 2IO1B 5HKHA 3B08A 3RZWC 2M8SA 2XK5A 2CKHB 3M3JA 4KSKC 2UWQA 2YLMA 1WGRA 4IM2A 4B9KA 4EEWA 2O6VA 4AJWA 3PZDA 3L13A 3RT3B 2MLBA 2PEAA 4FBJB 4WJQA 4EZKA 4JIOU 4G11A 3ZNGC 2M0XA 1E8XA 1WFYA 4LDTB 3JW0X 5JH5C 4EOYA 4ZDVA 4M8NA 2K6DB 3WALA 1GUAB 1WZ0A 3JSVB 3DOWA 3WAPA 4KZ0A 4F7ZA 1V5OA 5E6OA 4FHKA 2KXJA 4FJYA 4LJOB 1GG3A 3RZFA 4HXDA 2L0TA 4MGYE 4K1RB 1YJ1A 3CSFA 4BBNF 3ZKJC 1UBIA 3A33B 4MM3A 4W9KA 2MP2B 1GC7A 3H7PB 1WX8A 2QHOA 1WE6A 2CHXA 4W9IA 2ZCBA 2NBUA 5JHAA 1Q0WB 4BKSD 1WGGA 3SDLC 5EDSA 4GSWA 1R4NI 1E8WA 4FJVB 2NBWB 1WJ6A 4P7IA 2KK8A 5L95C 2L0FA 4E3CA 2D10A 2M1MA 3GZNI 5LLIA 4DDGD 1H8CA 3HIZA 5DCNA 2W9NA 2HD5B 3JSVA 1LXDA 3V60A 3ZDMC 2MA9B 4LJPB 2BYVE 1E7VA 1J8CA 3L10B 4BOZB 3DDCB 4RM8A 1V2YA 3DBHI 4AP4C 3ECIA 2D11A 1SIFA 4MGKE 1FXTB 2JPHA 4ASWC 1WMHB 1UGMA 3Q3JA 4CHKA 1X1MA 3QARA 2MP2A 4FLHA 1TZ1A 2IY0B 1RRBA 3H7PA 3I3TB 3QQ8B 3U7DA 3VH4B 3WAOA 1IPGA 2KQSA 2V4LA 4RMAA 3APCA 3W1SC 4DWFA 2DHZA 2C60A 4I6LB 3M63B 2LRWA 4NPNA 3VUXA 1UBQA 2KVRA 2NCNA 1WXAA 5DPTA 4A20A 4NQKE 4URKA 4GDKB 5JZEB 2AL3A 3HM3A 2K25A 1Y8RC 2KJ6A 1QZEA 5D2MB 5JHBA 2BYEA 2KD0A 3UGBB 2N9EB 4JLCA 4NNJB 2KZRA 1E5WA 4MSQB 2VRRB 4ANVA 2RSUA 5AZGA 2RPQA 4KV2A 3UQAA 1UH6A 3UINB 4XC2A 3S2AA 1KOTA 3H6NA 3V6CB 1LFDA 1SE9A 2MBQA 2BF8B 4IUMB 4IM0A 3U30A 4AUQC 2WX1A 2L8JA 3PRZA 4IM3A 2Y5BB 2L3ZA 2MSED 4BKTA 1I42A 3BINA 1WMHA 2G4SA 2KDEB 2V3SA 3AI5A 1TBEA 2KWCA 2Z0DB 3X23A 1I35A 2KWUB 2WX0A 3ZUNA 4E71A 2G4DB 3B0AA 2JXXA 3QIJA 4W9DA 2N9XA 2LZ6A 4K7UA 3ZW3A 3A1QB 4XZ4A 3ZO5B 2WDTB 3DVGY 5CHWA 5BO4B 3V61A 3VH3B 2LXAA 4GDKA 2DX5B 3LDZE 3QX1A 2KC1A 4DXAB 5TR5A 4FHJA 3VXWA 2DENB 3ZNHB 2MWSB 2IO2B 3L54A 2GBRA 2KDIA 2BKRB 3PHXB 2LWPA 5CTRC 2K8BA 4I6PA 2K6QA 2LD9A 4X57B 1OTRB 3L17A 1KJTA 3VDZA 2IY1B 1OEYJ 1P9DU 3AXCA 5C1ZA 3N3KB 4W9JA 3KUZA 2KDFB 1KM7A 2XBBC 4M0WB 4PS8A 2R2OA 2IYDB 2KC2A 2JF5A 2GBNA 2MRPA 4KDLB 1C1YB 3QC8B 4HVBA 1XT9B 1WXMA 2O2VB 5AZFA 1PQSA 2EKEC 2BPSA 4FJZA 3WIMA 4EUTA 4TUUA 2KTRB 1P3QU 4YL8A 1WJNA 2CS4A 1Z5SB 3PV1A 4GOCA 3A1QA 4KIKB 3TBLD 2KHWB 3IG3A 2KMAA 3MJWA 2N4FA 3ZTCA 4ZYNA 3ZRFA 4PS7A 4K7WA 2A5UA 4MJSB 3VTVA 2LVPA 3PRPB 3TCAA 2DZMA 4MSMB 4BKGA 3MHSD 1GNUA 4G0NB 4G3XB 2GBMA 3GOEA 3VHTC 3AU4A 2RR9A 1HE8A 1M94A 5GMVA 5D7GA 2YVCA 4HLEA 1P1AA 3KVFB 2FIDA 4N9F4 2REXA 3DBLI 4HK2A 3B1LX 1UELA 3BY4B 3PGEA 1V6EA 1SGHA 4HDOA 1Z2MA 1LM8B 4NJ7A 2NPTB 3PPAA 1E7UA 2AL6A 4W9HA 4GN1A 2K39A 3H9DA 2BKFA 5CX3A 2FCNA 3V6EB 4MDKE 3W1YA 4BVUC 3DCGA 3M62B 4I6NB 4ICUA 1MG8A 2GOWA 2O2VA 2PPHA 1WGHA 2C5LC 3R7QA 3W1SA 4EKUA 2Z59B 4JL9A 5KHQA 2KTRA 1WYWB 4HPLB 2LUEA 4KIKA 1YQBA 2AYOB 4IWQA 5G55A 3RD2A 1GJZA 1ZGUB 3DQVA 3PRMB 2Z0EB 4HCPB 4MJSA 3TMPB 2FCQA 5D6JB 3RCZA 5LXHA 2FAZA 3PS6A 3ZNID 2MBHA 1VCBA 3K9PB 3Q3FA 1P0RA 4GMVA 5E6NA 5IA7A 1YD8U 3ZRCA 5DPSA 2KANA 3PLUA 1U4AA 4JGHB 2DZJA 2C7MB 2V1YA 2KDBA 1OQYA 1WX9A 3H7SA 2FNJB 2JRIB 2PE6B 3PVLA 1WZ3A 2JZ3B 3VTUA 2NPTA 3R3MA 4AWJA 3WA0A 2ZZPB 3ZDTA 2LGXA 1P98A 5J17A 3JVZX 2J0JA 1EF5A 2ZVNA 1WGYA 3UIPB 4DHJD 2I1JA 4WWNA 1WM2A 3KUDB 2ZVOA 3HK0A 2KWVB 4WJNA 1XD3B 3X0WA 2L7RA 2BYFA 2ZCCA 3PLVA 3KUCB 2M17A 4FA6A 2HTHA 2LGYA 1E8ZA 2N9PC 1C3TA 3NOBA 4DBGA 1IYFA 2LVQA 4CO7A 2KJHB 4BKSA 1OGWA 1RFAA 2IZVB 1UZXB 2ASQA 5DPWA 3SHQA 4IWPA 2DYOA 2KX3A 3NHEB 4W9EA 4ZRKA 3ZTDA 3OAWA 1S3SG 3PTFC 4DK5A 2RD0A 2O6VD 3ZLZA 1CMXB 3SU8X 2C7NB 4IWOA 2A4ZA 5CHVC 2G3QB 2WYQA 3APDA 3ONSA 3ML8A 2KQ7A 1EUVB 3O65B 3ALBA 2ZNVC 3DVNU 4WAAA 2ZJDA 2JY6A 1V49A 2N1WA 2MBOA 4HJKA 2KLGA 2MW5A 3DBRI 3A9KB 2L05A 3QJZA 2OOBB 4GGQA 4LCDE 3KW5B 1WH3A 3TL5A 2DZIA 4GU2A 1TTNA 3AULA 1ZW7A 2BWFA 2L76A 2FCSA 3RULA 2JWZA 3ZIMA 1F9JA 3DPDA 1YX6B 1J19A 3R66C 3T8MA 4W9FA 2CHZA 3HHMA 1D3ZA 3DVNV 5CHFA 2C7HA 1NI2A 3IHPC 1UD7A 4F1SA 2KJRA 5AEKB 1EO6A 4MGIE 1RAXA 3WAMA 4K81A 5FR6A 1LQBA 3U8ZA 1A5RA 2EMTA 2FCMA 2BWES 1WIAA 3N30A 3PREA 4HCNB 2UYZB 2KMCA 4DHZE 2LRUA 3NZUA 4FULA 2GBKA 4HDQA 3UIOB 4LDTD 3CMMB 3SD5A 5AZHA 2OJRA 3ENEA 4FN2A 3NZSA 4NJ6A 4EZJA 2MX2A 3NY5A 5DPRA 3QAQA 1L2NA 1OEYA 1KLVA 2NS5A 3VVWB 4WQOB 2PE9A 2NR2A 3A9KA 2J0KA 2KO3A 1E90A 2GBJA 3UQBA 2KFJA 3L0WB 4OVVA 1S1QB 1WXSA 2DAJA 4A3OA
chains in the Genus database with same CATH superfamily
3IXSA 4REZA 4EZLA 4TMAB 4ZRJA 4BOSC 3RNGC 2KFKB 1NEKB 1GC6A 2QILA 5IAAC 2FUG1 4YXDB 2MEKA 2VZKD 4MACA 4DDID 3QK0A 1SEBD 3UF8A 5J18A 2ZNVB 2KKCA 3KQ4A 2YEPB 1AW7A 2J7QB 3EC8A 2JZPA 1VLBA 1FIQA 1PGXA 2DAFA 4AS1A 2PTLA 1T5XD 3E9SA 2L32A 2YEPF 1YIWA 2V9HA 3BYYB 3AEFB 1VZ6A 1Q1OA 2KFKA 1VJKA 2MH7A 2CR5A 3GB1A 4MT5A 4E74A 2VH1A 1I4RA 4US9A 2K0PA 2I1KA 2L00B 1JROA 2QJLA 2CHWA 3LXFA 2FBWB 4HKQA 4MGZE 4MH0E 4BZAA 3ZJUA 2AWTA 1TS3A 1D6EC 1TKGA 2HTME 2DZKA 2RMMA 4EFOA 4B6WA 3PHWB 2M4NA 5C2TB 3Q3NC 4LNIA 2KTFA 4DHJB 1JRPA 1IUEA 1ISNA 3IBEA 2LGDA 4IKGA 1T0QC 1J7BA 1J7AA 2RGFA 3P2BA 2D07B 3EECA 1ZPSA 2D3CA 1V9JA 1D5XC 4HPMB 3QCAA 1QILA 4WWPA 4MELA 4OVUA 1FNVA 2WXMA 1KLUD 4KVGB 4M8MA 2NBVB 1V5TA 3DHIC 1QF6A 2J0MA 1NBFC 3VFKA 4A3PA 2D3GA 4B95A 1WWTA 4IG7B 4AJYB 2SAKA 3C0RB 3L08A 4J6IA 2QEJC 3T9LA 3CF6E 3KYCD 1L0VB 3N32A 1WYGA 4KSKC 2YLMA 1WGRA 2PIAA 4EEWA 1I7HA 4AJWA 4WJQA 4B0EA 3BIID 4G11A 1BMLC 3WALA 1UGJA 3DOWA 3ZYYX 3RNAC 1JQ4A 1STEA 5E6OA 3RZFA 2Z8LA 5D3IB 2IPKD 1GB4A 4BBNF 2WLBA 2QHOA 1WE6A 2JXTA 2ZCBA 5JHAA 2M56B 3RNBC 3SDLC 4GSWA 4A6QA 2Y5PA 1F0ZA 1R4NI 5L95C 4DDGD 2M1MA 3GZNI 4C7YA 2W9NA 4P1CC 2HD5B 1FXAA 3MFGA 2CJOA 1QOGA 1E7VA 3ZQ4A 4BOZB 3DDCB 1V2YA 3EFCA 3DBHI 1F2RI 4AP4C 2D11A 1SIFA 1FXTB 2JPHA 2LJIA 2WXIA 2B76B 1YJIA 3QARA 3L4PA 3WAOA 2IGGA 3EA6A 3QQ8B 1WRIA 2E6XA 3APCA 3W1SC 2DHZA 2QCZA 4I6LB 2J42A 1UBQA 1UWXA 1WXAA 3RFZB 5JZEB 2V4IB 3W5VB 1V1OA 5JHBA 2K22A 2BYEA 2N9EB 1Y56A 4ANVA 1ZDVA 1MFWA 2RSUA 5AZGA 2JX5A 2INPE 2TSSA 3UINB 4LNOA 3S2AA 2MBQA 2BF8B 4IM0A 4AUQC 2OHFA 2L8JA 2Y5BB 1I4QA 2KDEB 2KWCA 2Z0DB 1RWSA 3OG5A 2WX0A 4E71A 2N9XA 5BO4B 2LXAA 3AEAB 2DX5B 3MHZA 5HG2A 3QX1A 2KC1A 4S17A 3BVZA 3VXWA 4ZHPA 1NENB 2GBRA 2KDIA 4I6PA 4X57B 4N58A 3L17A 3RMKC 3VDZA 2IY1B 5C1ZA 3AXCA 1VRAB 4W9JA 2KDFB 2R2OA 3MP9A 2BTEA 1RYJA 4KDLB 1IGCA 1WXMA 1PQSA 4GOCA 2CU3A 1Z5SB 3PV1A 2AQ2B 3IG3A 1PGBA 2KMAA 3ZRFA 4PS7A 4K7WA 1UNSA 2WDQB 4MSMB 4BKGA 1SB3C 1GNUA 3MHSD 3SFDB 2LFIA 2GBMA 3GOEA 1ROEA 1WSPA 1JWBD 4RF0A 2YVCA 4HLEA 3KVFB 4N9F4 1SGHA 1LM8B 1AYFA 3PPAA 1DOYA 2K39A 1ZUD2 3W1YA 2X38A 5EE3A 2KWDA 4ZHOA 3M62B 2GOWA 2Z59B 3VRBB 1YQBA 2AYOB 4IWQA 1LGRA 3RD2A 1GJZA 1B9RA 3PRMB 2KAJA 3NS1A 5D6JB 3BWUD 3K9PB 5IA7A 3NVVA 3AE1B 3PZ8A 2C7MB 3SR6A 3PVLA 2JRIB 1N60A 2NTTA 1TS2A 3WA0A 3ZDTA 1I4PA 1YN5A 4QAYA 3JVZX 3TUOA 1VZ7A 1WGYA 4DHJD 4A8XC 1PGAA 3HK0A 1A70A 2ONQA 4M01A 2PLPA 1C3TA 1OQRA 3NOBA 2LVQA 1UZXB 4IWPA 2MJ3A 2WS3B 3NHEB 2RDBC 4W9EA 3OAWA 2RDHA 2RD0A 5IP4D 1SE3A 2G3QB 1EUVB 4KKJA 2ZNVC 3SFEB 3GE8C 2N1WA 4HJKA 4ARIA 3DBRI 3A9KB 4GGQA 2DZIA 4GU2A 3AULA 1QKZA 2BWFA 1TKYA 4YSZB 1YMHE 3T8MA 2CHZA 1D3ZA 5CHFA 1YOVB 5LNK1 1E7PB 5E6JA 5AEKB 1EO6A 1PFDA 1A5RA 3IAM1 1MG4A 3AE8B 2KQ4X 4DHZE 4HDQA 3BVGA 2JU6X 3ENEA 3H8HA 4NJ6A 2MX2A 2JQRB 4C80A 1OEYA 3VVWB 2PE9A 3A9KA 2LHDA 1S1QB 1WXSA 4C7ZA 1XCQL 4II2B 4KDIC 2DYMA 1C77A 2HJ1A 2JZZA 4MH8A 3A9JB 4PS3A 2WXGA 2D2QA 3OLMD 3R2TA 3IFWB 2K8HA 3R7RA 4K7SA 5FR3A 3JYUA 3VAWA 4AOFA 1VD2A 4M02A 4ACFA 2KOXA 4XDDA 3VUYA 2IBIB 4II3B 2ZPYA 3QWZB 2N7JA 1T6BX 4WWOA 3Q8BA 1SIJA 3EHVA 2N7DA 3EGRA 1V97A 2R61A 2XEWA 1CJEA 2KYWA 2WWZA 3H1UA 1ENFA 3APFA 4HWIB 2BGFA 4TSSA 4OZCA 3A9JA 1FCCC 1T0YA 2GMIC 2FIFA 3V62A 4DXGA 3ZXVA 1XLNA 1IGDA 4OZAA 5E6PA 2HDEA 3L16A 3J9CA 3QA8A 2LASA 4L23A 5FKAC 4OHJA 1NVID 2N9KA 4BBNC 2C9WB 1WGDA 1WJUA 4TV3A 2JRHA 4JQWC 4LLGM 4CYEA 2M19A 3PSEB 3I57A 2ZEQA 1VDVA 1HTQA 4R3DA 1UWMA 1YNTE 2J52A 3NVYA 5AUIA 3ETRA 3BK1A 2CU1A 1J0GA 2MBEA 3ZNZB 4GB9A 2O6VB 3RI7C 2R2QA 2NVUI 3AU5A 1E8YA 3HRDD 3TIXA 1DYQA 2JWUA 3VUWA 3N1ZC 3TJPA 4XWWA 1SBBB 1HZ5A 1MHHE 1WXVA 2IO3B 2EMSA 3RYTA 5KHOA 1EWYC 4LNKA 5AUKA 5LXIB 2IO1B 3R8BA 2CKHB 1YN4A 3FC4A 4IM2A 2O6VA 3U4EG 3RT3B 2MLBA 2AQ1B 2QIEB 1KH0A 2OJWA 3ZNGC 4LNFA 1E8XA 4HJGE 4OW0A 4LDTB 4M8NA 1SXTA 3WAPA 4LJOB 1JWAD 3TEZA 3C8YA 3WCQA 3AB5A 2WU5B 2BBCA 3CSFA 4C56C 3P1MA 4ZYSA 4DQOC 1UBIA 2XNAC 4W9KA 2LMCA 2IGHA 5JXVA 1GC7A 3H7PB 1WX8A 1L4ZB 2D5GA 2NBUA 1Q0WB 1WGGA 4XE0A 3AEDB 2MHJA 1AWDA 4E3CA 5LLIA 1H8CA 3HIZA 2E3TA 2W55A 5DCNA 1HZ6A 1LXDA 3ZDMC 1J8CA 3MC0B 4RM8A 5EE0A 4MGKE 2PMVA 2KMMA 3T3OA 1WMHB 3Q3JA 1X1MA 3H7PA 3U7DA 1QLBB 1IPGA 2KQSA 2V4LA 4RMAA 3M63B 2LRWA 2KVRA 4J3OD 5DPTA 1N63A 4NQKE 1T0SC 1Y8RC 5D2MB 4H2AA 4MSQB 2JYTA 2RPQA 1C76A 3UQAA 1UH6A 1KOTA 4XC2A 3H6NA 1LFDA 1SE9A 2WX1A 1L0YB 2L3ZA 3NZ3A 3CIRB 1WMHA 2G4SA 3IT6B 1KF6B 1GOZA 4JX1C 1I35A 1GPXA 3FAHA 3P42A 2G4DB 3QIJA 4W9DA 2LZ6A 3I9V1 3AE4B 3ZW3A 3A1QB 4XZ4A 3DVGY 5CHWA 2PVOD 3V3XA 3VH3B 3AE2B 4HEA1 3O13A 3P4SB 4FHJA 2DENB 3C19A 2IO2B 2BKRB 1FFUA 3Q8AA 2K8BA 2K6QA 1ACCA 2W3RA 1KJTA 3DWMA 1UF0A 3GE3C 1KM7A 1ZDXA 2KC2A 2IDYA 2GBNA 4ZRQA 1XT9B 4USAA 2IJ0A 2WXNA 3RPFC 3FKYA 2Y3AA 4TUUA 2KTRB 2CS4A 4KIKB 3TBLD 3A1QA 1XCTL 2D3AA 3ZTCA 2N4FA 3AE9B 4ZYNA 5MPOA 1FM0D 3PRPB 3TCAA 1NYQA 4G0NB 3VHTC 2RR9A 5D7GA 1P1AA 2REXA 3DBLI 1UUPA 4US8A 4PK1A 3TEWA 1UELA 3PGEA 4NJ7A 2BS4B 2IGDA 2QSDA 2BKFA 2FCNA 4MDKE 3Q69A 3I63C 4I6NB 4JL9A 4XDCA 2KTRA 2BS3B 2LUEA 4KIKA 3DQVA 4HCPB 2L1AA 2FAZA 3ZNID 3Q3FA 1FRDA 3ZRCA 2KANA 4EE2A 1U4AA 4Q2JA 5IN7A 2N9LA 2PE6B 3VTUA 4L1BA 2WDRB 5J17A 1DOXA 1HQRD 4WQMA 2AQ3B 2M0AA 1WM2A 1FXIA 2ZVOA 1XD3B 3X0WA 2M17A 4FA6A 2HTHA 2LGYA 1PDXA 1IYFA 4BKSA 4CQNA 2DYOA 2WXLA 4ZRKA 3ZTDA 3W5UB 4RGOS 4DK5A 2WXPA 2O6VD 3IT4B 1YJJA 2A4ZA 1N5WA 2WYQA 2KQ7A 3O65B 1L6VA 1EM7A 2ZJDA 2WXHA 4RH6A 2MBOA 2KLGA 2MW5A 4LTUA 2WXRA 3GP7A 4LCDE 2GB1A 2PKOA 2L76A 1F9JA 1J19A 1VR9A 3HHMA 3DVNV 1IBXB 2C7HA 1NI2A 3IHPC 3ZGZA 4F1SA 2QC8A 2WDVB 5FR6A 1P7EA 2FCMA 4NJCA 2WP9B 1D5ZC 2KMCA 4FULA 3UIOB 4LDTD 3MJ5A 1KLVA 2NS5A 4WQOB 1RFKA 2NR2A 4A9AA 3Q14C 2QMTA 3L0WB 4L2YA 4OVVA 5TSSA 3AI5A 4A3OA 1R7SA 2IO0B 4XWTA 4WIPA 2EELA 1IBXA 4W9LA 3VQIA 2KLCA 4GIVA 1D5MC 1R4MI 1T0RC 2K1FA 2MCNB 2PJHA 3ZXRA 2WXOA 3RUIB 2N0SB 5C23A 4DHZB 3NJTA 4LNNA 1L4DB 2NMQA 3NVZA 3AE5B 1ET6A 4RM9A 4WH4A 2LJ5A 1WR6E 1DOIA 3DHHC 3ZVVA 2LXCA 2MQJA 4F8CB 2K5PA 3OJ3A 4IDIA 5G5GA 1K8RB 3P4PB 1WRDB 1ZKHA 1V8CA 3A4RA 1CK1A 2G45B 3MTNB 1TKEA 5G2NA 2MJEA 3VR9B 2JVCA 4BFRA 4W9CA 3D32A 1L7YA 4TQ1A 1AARA 1M4VA 4WJOA 1SF0A 1FRRA 1C4AA 1YQ3B 1IP9A 4YTNB 4KSLC 1WI0A 1V80A 3KH0A 1C79A 5HI1A 1SE4A 5J2RA 2HJ8A 4RGTA 3EUB2 3VRAB 5G5HA 1ZXHA 2AEHA 1MJDA 2ZPNA 1XQQA 3ML9A 3LYYA 1N5XA 2KN5A 2JT4B 2XK5B 3TEXA 2J53A 4O1NA 1HTOA 1BT0A 4FADA 3B9JA 1YN3A 3RNFC 4JWSC 1WR1A 4KZCA 2B3AA 4XX5A 2KNBA 3IAS1 1JWUD 1RLFA 5L83A 2LI5A 1FFVA 1R4NB 2KX0A 3NG0A 4RF1A 3MC8A 3GZNB 3CSTA 4OZBA 2EKIA 3QHTA 2W54A 1EU4A 3B08A 3RZWC 2XK5A 4FXCA 4C00A 3M3JA 3DBHB 1F77A 1EWCA 3PZDA 2PEAA 4EZKA 1WFYA 4B0MA 4EOYA 1ZXIA 2K6DB 1DGJA 1WZ0A 3JSVB 1T3QA 4KZ0A 1TZOA 2KVZA 3KWVA 2L0TA 1YJ1A 4WWMA 1K50A 1XF5L 2MP2B 2KACA 1CQVA 4BKSD 4K3BA 1JWMD 1YQ4B 2INCC 2NBWB 1WJ6A 4P7IA 2L0FA 4ARCA 1HXYD 2ZW1A 4ZOHC 4AQ7A 1E10A 1E0ZA 3JSVA 3V60A 2MA9B 4ITKA 4LJPB 2WU2B 3NVWA 3AMZA 3W9CB 4N59A 3ABVB 3OWEB 1UGMA 4CHKA 1NI3A 2MP2A 1FNUA 2IY0B 3PZ7A 3HVDA 4NPNA 1I4XA 4A20A 1I4GA 1PYWD 1GB1A 3HM3A 2K25A 2KJ6A 2I2YA 1E6EB 2KD0A 2KZRA 1E5WA 4IUMB 2V3NA 3U30A 2Y5CA 3PRZA 4IM3A 2MSED 3BINA 2GRIA 1TBEA 1SJHD 2KWUB 3B2FA 1N62A 1J7CA 2BB6A 3KLSX 2W3SA 2L83A 3ZO5B 2WDTB 3V61A 4A90A 5TR5A 3R2IA 2MWSB 4JE3B 1K51A 2BB5A 2LD9A 4DXFA 1OTRB 1OEYJ 2JYEA 3N3KB 3KUZA 5BYQA 4PS8A 2IYDB 1XEEA 3BYTB 1C1YB 4HVBA 1GAQB 5AZFA 1VZ8A 4FJZA 4EUTA 1P3QU 4YL8A 1KLGD 3V05A 2KHWB 1V1PA 3MJWA 2A5UA 1E9MA 2H88B 4G3XB 2XN9C 1MHXA 3AU4A 1HE8A 5GMVA 1QOAA 4KKIA 2FIDA 1WXQA 2PW9A 3BY4B 5BYRA 1V6EA 5IOIA 3N9YC 2NPTB 1E7UA 4GN1A 3H9DA 4BVUC 3DCGA 3UI3A 4ICUA 2C5LC 5KHQA 1WYWB 4HPLB 3LB8C 5G55A 3DBRB 1KTKA 2JSVX 1P7FA 2FCQA 3RCZA 5LXHA 3PS6A 4GMVA 2MBHA 1TS4A 1YD8U 4JGHB 2LHEA 2KDBA 1OQYA 3H7SA 2FNJB 1C4PA 2JZ3B 2NPTA 3AV8A 3ZJTA 2LGXA 2WNMA 2J0JA 3AEEB 2ZVNA 4WWNA 2D3BA 1B1ZA 4WJNA 2KT7A 1L6UA 2L7RA 2ZCCA 3PLVA 3KUCB 3AM9A 5EE1A 4DBGA 4K3CA 2KJHB 1RFAA 2WXJA 5DPWA 1N6ZA 2KX3A 5GXGB 2BS2B 3Q2AC 1S3SG 3PTFC 3ZLZA 4YTMB 3SU8X 2C7NB 4IWOA 5CHVC 1TS5A 3ALBA 4KGRA 1FPYA 3DVNU 3HVZA 2WGSA 3MC9A 2L05A 2OOBB 3KW5B 1OQQA 2FCSA 2JWZA 3N1XC 3ZIMA 3DPDA 1YX6B 3BVMA 3DWGC 3R66C 4W9FA 1XLPA 2CJNA 2KJRA 3U8ZA 4UDUC 3ZJVA 1WIAA 2WHIA 4NAMA 3PREA 4HCNB 3NZUA 2ON8A 4WAFA 4BAXA 5EE9A 3CMMB 5T8IA 5AZHA 2OJRA 4FN2A 2DNFA 3SEBA 4P1BC 2J0KA 5I4DA 2KO3A 1E90A 4KX6B 4HROA 4TKNA 4MEMA 1G6JA 1QQRA 3HM6X 1H4RA 1SE2A 2DYBA 4IW0A 1NDDA 1QOBA 1TGZB 4WJPA 4TQ0A 4NY0A 3PT2B 1AN8A 4NAWB 4ANXA 2PVGC 3N20C 3Q8EA 1V86A 3IVFA 4PYUA 2QDFA 5C3JB 1WY8A 3M95A 1MPEA 1YX5B 4GDLB 5D94A 1ZOYB 4HKZE 3VTWA 3AH7A 3NS8A 4JWUC 3RNEC 2K9XA 1WM3A 1WE7A 4YWGG 5FK9C 1WF9A 3NUHB 3OJ4B 1C9FA 4ANUA 2N1VA 4NAWA 1WX7A 3E56A 3EFUA 4GLSC 1EF1A 2RDGA 4IC7B 4ANWA 1F2RC 3LJ3A 1JRUA 4KGTA 2N7EA 4GDLA 2MBBB 3K9OB 2WXKA 2SEBD 2HE7A 3P4QB 4ICVA 4ZRIA 2H89B 4GXBA 2DBYA 3PO0A 3A4SC 3DBSA 1V81A 1QOFA 5BMGA 2BQQA 2LVOA 1C78A 1KFYB 5D3DA 3WANA 1Q5WB 3DVGX 2G9HD 3URYA 1JMLA 2FUHB 2LEKA 4NQLB 3RN9C 2VH2A 1BUIC 4JPSA 4PYZA 2K8CA 2BW2A 3P4RB 3AECB 3T3NA 1LO5D 3KYDD 4P16A 1F52A 2FE8A 4W9GA 1WJ4A 1XXGA 1FD6A 4G50A 3KWLA 1KRHA 4YT0B 2KN4A 2JUOA 4MM3B 2M8SA 2UWQA 4B9KA 3L13A 3Q3MC 2INDC 3Q8CA 5HHDG 5BMIA 4FBJB 4XGAB 1ESFA 2W82A 4JIOU 2M0XA 1D4BA 3JW0X 5JH5C 4ZDVA 1N61A 3BZDB 4OVZA 3AE3B 2LGSA 3B2GA 1GUAB 1TYGB 1JCKB 2V3PA 3N1YC 4F7ZA 5IO9A 1V5OA 4FHKA 2KXJA 4FJYA 1GG3A 4RCOA 3BK2A 4HXDA 2BYTA 4MGYE 4K1RB 3TEYA 4YTPB 3ZKJC 3A33B 3CWIA 3RNCC 2DLBA 4MM3A 1TIFA 4PT5A 2CHXA 1BXTA 1WGKA 4W9IA 2ACZB 2OEDA 2VZKB 5EDSA 2LGIA 1Q10A 1E8WA 4FJVB 2KK8A 4M00A 3AEBB 2D10A 5BYSA 1SJED 2BYVE 4KGSA 1FCLA 3L10B 3ECIA 1JW9D 4ASWC 4FLHA 5HKHA 1TZ1A 1RRBA 2L52A 3I3TB 3VH4B 3HUIA 1L5PA 1TJEA 2I38A 4DWFA 4C4VB 2C60A 3VUXA 2NCNA 1MI0A 4GDKB 2AL3A 3NRZA 2BT6A 1QZEA 3UGBB 4JLCA 4NNJB 4XYCA 3AEGB 2VRRB 4HPPA 4RGNA 4KV2A 3V6CB 4BKTA 1I42A 5IKCM 3AE6B 2V3SA 2V0GA 4N6EB 1OFFA 3X23A 2GLSA 3ZUNA 3DBLB 1FNWA 3B0AA 2JXXA 4C4VA 4K7UA 3P63A 4GDKA 3LDZE 4DXAB 3ZNHB 1ZE3D 3L54A 2DWQA 3PHXB 2LWPA 5CTRC 1L0XB 1P9DU 2XBBC 1NYRA 3Q8FA 4M0WB 4A55A 2JF5A 2MRPA 3QC8B 1MVKA 2O2VB 2WXFA 2EKEC 2BPSA 4RNAA 3WIMA 1FO4A 1WJNA 3Q3OC 2MJDA 4RFBA 4D2KA 2BVCA 3TSSA 1PUTA 2J4XA 2LVPA 4HRSA 4MJSB 3VTVA 2DZMA 3FILB 3U2SC 4ZRPA 2Q5WD 1M94A 5HFYA 1TT5B 1CZPA 4HK2A 3W2DA 3B1LX 4HDOA 1Z2MA 4M0WA 2AL6A 2K3UA 4W9HA 5CX3A 3V6EB 4RGMA 2WXQA 2UU7A 3Q6BA 1ZP0B 1F1HA 3R7QA 1MG8A 2O2VA 2PPHA 4YSYB 1WGHA 3W1SA 4EKUA 4URKA 4P6VF 1XO3A 3AN1A 1ZGUB 3VR8B 2Z0EB 4MJSA 3TMPB 1HA5A 1TY0A 3DHGC 1VCBA 3FILA 2ICIA 1P0RA 5E6NA 5DPSA 1XLQA 3PLUA 2NTSA 1C4CA 2KDMA 2DZJA 2V1YA 1WX9A 2X8XX 1WZ3A 4AWJA 3R3MA 2ZZPB 1P98A 3U52E 1EF5A 4NZLB 2WQYB 3UIPB 4YSXB 4LK0M 2I1JA 2AX5A 1QT9A 1FEHA 3KUDB 4IOIE 2KWVB 3AE7B 1JALA 2BYFA 2INNE 1E8ZA 2N9PC 1HEZE 4CO7A 1OGWA 2IZVB 2ASQA 3SHQA 3U7ZA 1CMXB 1RM6C 1K53A 2G1EA 1EU3A 3APDA 3ONSA 3ML8A 1ET9A 4WAAA 1R4MB 2JY6A 1V49A 4S0RA 1V1PB 5BMHA 3QJZA 1WH3A 3TL5A 1TTNA 1ZW7A 3RULA 1FMAD 2RPVA 1TY2A 1SSNA 5H92C 1I4HA 1UD7A 4MGIE 1RAXA 3WAMA 4K81A 1LQBA 2EMTA 3I5JC 2BWES 3N30A 2UYZB 5H8YE 2GI9A 2LRUA 4WURA 2GBKA 3SD5A 2ZW0A 1JWSD 3NZSA 3GS2A 2LUMA 4EZJA 3NY5A 1K52A 5DPRA 3QAQA 1L2NA 3UQBA 2GBJA 2KFJA 2DAJA 1XLOA
chains in the Genus database with same CATH topology
4TKNA 4MEMA 4II2B 1G6JA 2IO0B 3HM6X 4KDIC 2DYMA 1H4RA 2DYBA 4EZLA 4IW0A 1NDDA 1TGZB 4WJPA 4ZRJA 2JZZA 4W9LA 3VQIA 4BOSC 2KFKB 4TQ0A 2KLCA 4GIVA 4NY0A 1GC6A 3A9JB 1R4MI 3PT2B 4PS3A 5IAAC 2K1FA 2MCNB 2PJHA 2D2QA 3OLMD 4NAWB 3RUIB 4ANXA 4DDID 3QK0A 3IFWB 2K8HA 3R7RA 4K7SA 5C23A 4DHZB 3UF8A 3JYUA 3VAWA 4AOFA 5J18A 2ZNVB 1V86A 1VD2A 3IVFA 4PYUA 2KKCA 2KOXA 1WY8A 4RM9A 2LJ5A 1WR6E 3M95A 2J7QB 3EC8A 3VUYA 2IBIB 4II3B 2ZPYA 1YX5B 2DAFA 4GDLB 3ZVVA 5D94A 2LXCA 3QWZB 2MQJA 4WWOA 3VTWA 4F8CB 3OJ3A 3NS8A 3EHVA 2N7DA 1K8RB 1YIWA 2XEWA 1WM3A 1WRDB 1ZKHA 2WWZA 1WE7A 3A4RA 2G45B 3MTNB 5G2NA 1Q1OA 2KFKA 3H1UA 2CR5A 3APFA 4E74A 4HWIB 2BGFA 2JVCA 1WF9A 3A9JA 3OJ4B 1T0YA 4BFRA 2GMIC 2I1KA 2L00B 2FIFA 3V62A 4ANUA 2N1VA 4NAWA 4W9CA 3D32A 1WX7A 1L7YA 4TQ1A 3EFUA 2CHWA 1AARA 4WJOA 1EF1A 4IC7B 4ANWA 3LJ3A 5E6PA 1JRUA 3L16A 4MGZE 4MH0E 3QA8A 1IP9A 2AWTA 2N7EA 4KSLC 2LASA 4GDLA 2DZKA 1WI0A 4EFOA 2MBBB 1V80A 3K9OB 3KH0A 4B6WA 3PHWB 4BBNC 2C9WB 2M4NA 2KTFA 1WGDA 2HE7A 5J2RA 1WJUA 4ICVA 2HJ8A 4TV3A 2JRHA 4JQWC 4DHJB 4ZRIA 4CYEA 3PSEB 1ISNA 4GXBA 3IBEA 2LGDA 2ZEQA 3A4SC 3DBSA 1V81A 2AEHA 2ZPNA 1XQQA 3ML9A 2LVOA 2RGFA 3P2BA 2D07B 3EECA 3WANA 2CU1A 2KN5A 2JT4B 2XK5B 1J0GA 2MBEA 3ZNZB 1Q5WB 3DVGX 4GB9A 1BT0A 2O6VB 4FADA 2R2QA 2FUHB 1V9JA 4NQLB 2NVUI 1WR1A 3AU5A 3QCAA 1E8YA 4HPMB 4KZCA 3TIXA 3VUWA 2B3AA 4WWPA 4PYZA 2K8CA 4MELA 4OVUA 4XX5A 3TJPA 2KNBA 1RLFA 5L83A 4M8MA 4KVGB 2NBVB 2LI5A 1V5TA 2J0MA 3KYDD 2KX0A 4W9GA 1NBFC 3VFKA 1WXVA 1WJ4A 4A3PA 2D3GA 4B95A 2IO3B 4IG7B 4AJYB 4G50A 2EMSA 3RYTA 3C0RB 5KHOA 3CSTA 3L08A 4J6IA 3T9LA 2JUOA 3CF6E 3QHTA 3KYCD 5LXIB 3N32A 2IO1B 5HKHA 3B08A 3RZWC 2M8SA 2XK5A 2CKHB 3M3JA 4KSKC 2UWQA 2YLMA 1WGRA 4IM2A 4B9KA 4EEWA 2O6VA 4AJWA 3PZDA 3L13A 3RT3B 2MLBA 2PEAA 4FBJB 4WJQA 4EZKA 4JIOU 4G11A 3ZNGC 2M0XA 1E8XA 1WFYA 4LDTB 3JW0X 5JH5C 4EOYA 4ZDVA 4M8NA 2K6DB 3WALA 1GUAB 1WZ0A 3JSVB 3DOWA 3WAPA 4KZ0A 4F7ZA 1V5OA 5E6OA 4FHKA 2KXJA 4FJYA 4LJOB 1GG3A 3RZFA 4HXDA 2L0TA 4MGYE 4K1RB 1YJ1A 3CSFA 4BBNF 3ZKJC 1UBIA 3A33B 4MM3A 4W9KA 2MP2B 1GC7A 3H7PB 1WX8A 2QHOA 1WE6A 2CHXA 4W9IA 2ZCBA 2NBUA 5JHAA 1Q0WB 4BKSD 1WGGA 3SDLC 5EDSA 4GSWA 1R4NI 1E8WA 4FJVB 2NBWB 1WJ6A 4P7IA 2KK8A 5L95C 2L0FA 4E3CA 2D10A 2M1MA 3GZNI 5LLIA 4DDGD 1H8CA 3HIZA 5DCNA 2W9NA 2HD5B 3JSVA 1LXDA 3V60A 3ZDMC 2MA9B 4LJPB 2BYVE 1E7VA 1J8CA 3L10B 4BOZB 3DDCB 4RM8A 1V2YA 3DBHI 4AP4C 3ECIA 2D11A 1SIFA 4MGKE 1FXTB 2JPHA 4ASWC 1WMHB 1UGMA 3Q3JA 4CHKA 1X1MA 3QARA 2MP2A 4FLHA 1TZ1A 2IY0B 1RRBA 3H7PA 3I3TB 3QQ8B 3U7DA 3VH4B 3WAOA 1IPGA 2KQSA 2V4LA 4RMAA 3APCA 3W1SC 4DWFA 2DHZA 2C60A 4I6LB 3M63B 2LRWA 4NPNA 3VUXA 1UBQA 2KVRA 2NCNA 1WXAA 5DPTA 4A20A 4NQKE 4URKA 4GDKB 5JZEB 2AL3A 3HM3A 2K25A 1Y8RC 2KJ6A 1QZEA 5D2MB 5JHBA 2BYEA 2KD0A 3UGBB 2N9EB 4JLCA 4NNJB 2KZRA 1E5WA 4MSQB 2VRRB 4ANVA 2RSUA 5AZGA 2RPQA 4KV2A 3UQAA 1UH6A 3UINB 4XC2A 3S2AA 1KOTA 3H6NA 3V6CB 1LFDA 1SE9A 2MBQA 2BF8B 4IUMB 4IM0A 3U30A 4AUQC 2WX1A 2L8JA 3PRZA 4IM3A 2Y5BB 2L3ZA 2MSED 4BKTA 1I42A 3BINA 1WMHA 2G4SA 2KDEB 2V3SA 3AI5A 1TBEA 2KWCA 2Z0DB 3X23A 1I35A 2KWUB 2WX0A 3ZUNA 4E71A 2G4DB 3B0AA 2JXXA 3QIJA 4W9DA 2N9XA 2LZ6A 4K7UA 3ZW3A 3A1QB 4XZ4A 3ZO5B 2WDTB 3DVGY 5CHWA 5BO4B 3V61A 3VH3B 2LXAA 4GDKA 2DX5B 3LDZE 3QX1A 2KC1A 4DXAB 5TR5A 4FHJA 3VXWA 2DENB 3ZNHB 2MWSB 2IO2B 3L54A 2GBRA 2KDIA 2BKRB 3PHXB 2LWPA 5CTRC 2K8BA 4I6PA 2K6QA 2LD9A 4X57B 1OTRB 3L17A 1KJTA 3VDZA 2IY1B 1OEYJ 1P9DU 3AXCA 5C1ZA 3N3KB 4W9JA 3KUZA 2KDFB 1KM7A 2XBBC 4M0WB 4PS8A 2R2OA 2IYDB 2KC2A 2JF5A 2GBNA 2MRPA 4KDLB 1C1YB 3QC8B 4HVBA 1XT9B 1WXMA 2O2VB 5AZFA 1PQSA 2EKEC 2BPSA 4FJZA 3WIMA 4EUTA 4TUUA 2KTRB 1P3QU 4YL8A 1WJNA 2CS4A 1Z5SB 3PV1A 4GOCA 3A1QA 4KIKB 3TBLD 2KHWB 3IG3A 2KMAA 3MJWA 2N4FA 3ZTCA 4ZYNA 3ZRFA 4PS7A 4K7WA 2A5UA 4MJSB 3VTVA 2LVPA 3PRPB 3TCAA 2DZMA 4MSMB 4BKGA 3MHSD 1GNUA 4G0NB 4G3XB 2GBMA 3GOEA 3VHTC 3AU4A 2RR9A 1HE8A 1M94A 5GMVA 5D7GA 2YVCA 4HLEA 1P1AA 3KVFB 2FIDA 4N9F4 2REXA 3DBLI 4HK2A 3B1LX 1UELA 3BY4B 3PGEA 1V6EA 1SGHA 4HDOA 1Z2MA 1LM8B 4NJ7A 2NPTB 3PPAA 1E7UA 2AL6A 4W9HA 4GN1A 2K39A 3H9DA 2BKFA 5CX3A 2FCNA 3V6EB 4MDKE 3W1YA 4BVUC 3DCGA 3M62B 4I6NB 4ICUA 1MG8A 2GOWA 2O2VA 2PPHA 1WGHA 2C5LC 3R7QA 3W1SA 4EKUA 2Z59B 4JL9A 5KHQA 2KTRA 1WYWB 4HPLB 2LUEA 4KIKA 1YQBA 2AYOB 4IWQA 5G55A 3RD2A 1GJZA 1ZGUB 3DQVA 3PRMB 2Z0EB 4HCPB 4MJSA 3TMPB 2FCQA 5D6JB 3RCZA 5LXHA 2FAZA 3PS6A 3ZNID 2MBHA 1VCBA 3K9PB 3Q3FA 1P0RA 4GMVA 5E6NA 5IA7A 1YD8U 3ZRCA 5DPSA 2KANA 3PLUA 1U4AA 4JGHB 2DZJA 2C7MB 2V1YA 2KDBA 1OQYA 1WX9A 3H7SA 2FNJB 2JRIB 2PE6B 3PVLA 1WZ3A 2JZ3B 3VTUA 2NPTA 3R3MA 4AWJA 3WA0A 2ZZPB 3ZDTA 2LGXA 1P98A 5J17A 3JVZX 2J0JA 1EF5A 2ZVNA 1WGYA 3UIPB 4DHJD 2I1JA 4WWNA 1WM2A 3KUDB 2ZVOA 3HK0A 2KWVB 4WJNA 1XD3B 3X0WA 2L7RA 2BYFA 2ZCCA 3PLVA 3KUCB 2M17A 4FA6A 2HTHA 2LGYA 1E8ZA 2N9PC 1C3TA 3NOBA 4DBGA 1IYFA 2LVQA 4CO7A 2KJHB 4BKSA 1OGWA 1RFAA 2IZVB 1UZXB 2ASQA 5DPWA 3SHQA 4IWPA 2DYOA 2KX3A 3NHEB 4W9EA 4ZRKA 3ZTDA 3OAWA 1S3SG 3PTFC 4DK5A 2RD0A 2O6VD 3ZLZA 1CMXB 3SU8X 2C7NB 4IWOA 2A4ZA 5CHVC 2G3QB 2WYQA 3APDA 3ONSA 3ML8A 2KQ7A 1EUVB 3O65B 3ALBA 2ZNVC 3DVNU 4WAAA 2ZJDA 2JY6A 1V49A 2N1WA 2MBOA 4HJKA 2KLGA 2MW5A 3DBRI 3A9KB 2L05A 3QJZA 2OOBB 4GGQA 4LCDE 3KW5B 1WH3A 3TL5A 2DZIA 4GU2A 1TTNA 3AULA 1ZW7A 2BWFA 2L76A 2FCSA 3RULA 2JWZA 3ZIMA 1F9JA 3DPDA 1YX6B 1J19A 3R66C 3T8MA 4W9FA 2CHZA 3HHMA 1D3ZA 3DVNV 5CHFA 2C7HA 1NI2A 3IHPC 1UD7A 4F1SA 2KJRA 5AEKB 1EO6A 4MGIE 1RAXA 3WAMA 4K81A 5FR6A 1LQBA 3U8ZA 1A5RA 2EMTA 2FCMA 2BWES 1WIAA 3N30A 3PREA 4HCNB 2UYZB 2KMCA 4DHZE 2LRUA 3NZUA 4FULA 2GBKA 4HDQA 3UIOB 4LDTD 3CMMB 3SD5A 5AZHA 2OJRA 3ENEA 4FN2A 3NZSA 4NJ6A 4EZJA 2MX2A 3NY5A 5DPRA 3QAQA 1L2NA 1OEYA 1KLVA 2NS5A 3VVWB 4WQOB 2PE9A 2NR2A 3A9KA 2J0KA 2KO3A 1E90A 2GBJA 3UQBA 2KFJA 3L0WB 4OVVA 1S1QB 1WXSA 2DAJA 4A3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TKN A;  4MEM A;  4II2 B;  1G6J A;  2IO0 B;  3HM6 X;  4KDI C;  2DYM A;  1H4R A;  2DYB A;  4EZL A;  4IW0 A;  1NDD A;  1TGZ B;  4WJP A;  4ZRJ A;  2JZZ A;  4W9L A;  3VQI A;  4BOS C;  2KFK B;  4TQ0 A;  2KLC A;  4GIV A;  4NY0 A;  1GC6 A;  3A9J B;  1R4M I;  3PT2 B;  4PS3 A;  5IAA C;  2K1F A;  2MCN B;  2PJH A;  2D2Q A;  3OLM D;  4NAW B;  3RUI B;  4ANX A;  4DDI D;  3QK0 A;  3IFW B;  2K8H A;  3R7R A;  4K7S A;  5C23 A;  4DHZ B;  3UF8 A;  3JYU A;  3VAW A;  4AOF A;  5J18 A;  2ZNV B;  1V86 A;  1VD2 A;  3IVF A;  4PYU A;  2KKC A;  2KOX A;  1WY8 A;  4RM9 A;  2LJ5 A;  1WR6 E;  3M95 A;  2J7Q B;  3EC8 A;  3VUY A;  2IBI B;  4II3 B;  2ZPY A;  1YX5 B;  2DAF A;  4GDL B;  3ZVV A;  5D94 A;  2LXC A;  3QWZ B;  2MQJ A;  4WWO A;  3VTW A;  4F8C B;  3OJ3 A;  3NS8 A;  3EHV A;  2N7D A;  1K8R B;  1YIW A;  2XEW A;  1WM3 A;  1WRD B;  1ZKH A;  2WWZ A;  1WE7 A;  3A4R A;  2G45 B;  3MTN B;  5G2N A;  1Q1O A;  2KFK A;  3H1U A;  2CR5 A;  3APF A;  4E74 A;  4HWI B;  2BGF A;  2JVC A;  1WF9 A;  3A9J A;  3OJ4 B;  1T0Y A;  4BFR A;  2GMI C;  2I1K A;  2L00 B;  2FIF A;  3V62 A;  4ANU A;  2N1V A;  4NAW A;  4W9C A;  3D32 A;  1WX7 A;  1L7Y A;  4TQ1 A;  3EFU A;  2CHW A;  1AAR A;  4WJO A;  1EF1 A;  4IC7 B;  4ANW A;  3LJ3 A;  5E6P A;  1JRU A;  3L16 A;  4MGZ E;  4MH0 E;  3QA8 A;  1IP9 A;  2AWT A;  2N7E A;  4KSL C;  2LAS A;  4GDL A;  2DZK A;  1WI0 A;  4EFO A;  2MBB B;  1V80 A;  3K9O B;  3KH0 A;  4B6W A;  3PHW B;  4BBN C;  2C9W B;  2M4N A;  2KTF A;  1WGD A;  2HE7 A;  5J2R A;  1WJU A;  4ICV A;  2HJ8 A;  4TV3 A;  2JRH A;  4JQW C;  4DHJ B;  4ZRI A;  4CYE A;  3PSE B;  1ISN A;  4GXB A;  3IBE A;  2LGD A;  2ZEQ A;  3A4S C;  3DBS A;  1V81 A;  2AEH A;  2ZPN A;  1XQQ A;  3ML9 A;  2LVO A;  2RGF A;  3P2B A;  2D07 B;  3EEC A;  3WAN A;  2CU1 A;  2KN5 A;  2JT4 B;  2XK5 B;  1J0G A;  2MBE A;  3ZNZ B;  1Q5W B;  3DVG X;  4GB9 A;  1BT0 A;  2O6V B;  4FAD A;  2R2Q A;  2FUH B;  1V9J A;  4NQL B;  2NVU I;  1WR1 A;  3AU5 A;  3QCA A;  1E8Y A;  4HPM B;  4KZC A;  3TIX A;  3VUW A;  2B3A A;  4WWP A;  4PYZ A;  2K8C A;  4MEL A;  4OVU A;  4XX5 A;  3TJP A;  2KNB A;  1RLF A;  5L83 A;  4M8M A;  4KVG B;  2NBV B;  2LI5 A;  1V5T A;  2J0M A;  3KYD D;  2KX0 A;  4W9G A;  1NBF C;  3VFK A;  1WXV A;  1WJ4 A;  4A3P A;  2D3G A;  4B95 A;  2IO3 B;  4IG7 B;  4AJY B;  4G50 A;  2EMS A;  3RYT A;  3C0R B;  5KHO A;  3CST A;  3L08 A;  4J6I A;  3T9L A;  2JUO A;  3CF6 E;  3QHT A;  3KYC D;  5LXI B;  3N32 A;  2IO1 B;  5HKH A;  3B08 A;  3RZW C;  2M8S A;  2XK5 A;  2CKH B;  3M3J A;  4KSK C;  2UWQ A;  2YLM A;  1WGR A;  4IM2 A;  4B9K A;  4EEW A;  2O6V A;  4AJW A;  3PZD A;  3L13 A;  3RT3 B;  2MLB A;  2PEA A;  4FBJ B;  4WJQ A;  4EZK A;  4JIO U;  4G11 A;  3ZNG C;  2M0X A;  1E8X A;  1WFY A;  4LDT B;  3JW0 X;  5JH5 C;  4EOY A;  4ZDV A;  4M8N A;  2K6D B;  3WAL A;  1GUA B;  1WZ0 A;  3JSV B;  3DOW A;  3WAP A;  4KZ0 A;  4F7Z A;  1V5O A;  5E6O A;  4FHK A;  2KXJ A;  4FJY A;  4LJO B;  1GG3 A;  3RZF A;  4HXD A;  2L0T A;  4MGY E;  4K1R B;  1YJ1 A;  3CSF A;  4BBN F;  3ZKJ C;  1UBI A;  3A33 B;  4MM3 A;  4W9K A;  2MP2 B;  1GC7 A;  3H7P B;  1WX8 A;  2QHO A;  1WE6 A;  2CHX A;  4W9I A;  2ZCB A;  2NBU A;  5JHA A;  1Q0W B;  4BKS D;  1WGG A;  3SDL C;  5EDS A;  4GSW A;  1R4N I;  1E8W A;  4FJV B;  2NBW B;  1WJ6 A;  4P7I A;  2KK8 A;  5L95 C;  2L0F A;  4E3C A;  2D10 A;  2M1M A;  3GZN I;  5LLI A;  4DDG D;  1H8C A;  3HIZ A;  5DCN A;  2W9N A;  2HD5 B;  3JSV A;  1LXD A;  3V60 A;  3ZDM C;  2MA9 B;  4LJP B;  2BYV E;  1E7V A;  1J8C A;  3L10 B;  4BOZ B;  3DDC B;  4RM8 A;  1V2Y A;  3DBH I;  4AP4 C;  3ECI A;  2D11 A;  1SIF A;  4MGK E;  1FXT B;  2JPH A;  4ASW C;  1WMH B;  1UGM A;  3Q3J A;  4CHK A;  1X1M A;  3QAR A;  2MP2 A;  4FLH A;  1TZ1 A;  2IY0 B;  1RRB A;  3H7P A;  3I3T B;  3QQ8 B;  3U7D A;  3VH4 B;  3WAO A;  1IPG A;  2KQS A;  2V4L A;  4RMA A;  3APC A;  3W1S C;  4DWF A;  2DHZ A;  2C60 A;  4I6L B;  3M63 B;  2LRW A;  4NPN A;  3VUX A;  1UBQ A;  2KVR A;  2NCN A;  1WXA A;  5DPT A;  4A20 A;  4NQK E;  4URK A;  4GDK B;  5JZE B;  2AL3 A;  3HM3 A;  2K25 A;  1Y8R C;  2KJ6 A;  1QZE A;  5D2M B;  5JHB A;  2BYE A;  2KD0 A;  3UGB B;  2N9E B;  4JLC A;  4NNJ B;  2KZR A;  1E5W A;  4MSQ B;  2VRR B;  4ANV A;  2RSU A;  5AZG A;  2RPQ A;  4KV2 A;  3UQA A;  1UH6 A;  3UIN B;  4XC2 A;  3S2A A;  1KOT A;  3H6N A;  3V6C B;  1LFD A;  1SE9 A;  2MBQ A;  2BF8 B;  4IUM B;  4IM0 A;  3U30 A;  4AUQ C;  2WX1 A;  2L8J A;  3PRZ A;  4IM3 A;  2Y5B B;  2L3Z A;  2MSE D;  4BKT A;  1I42 A;  3BIN A;  1WMH A;  2G4S A;  2KDE B;  2V3S A;  3AI5 A;  1TBE A;  2KWC A;  2Z0D B;  3X23 A;  1I35 A;  2KWU B;  2WX0 A;  3ZUN A;  4E71 A;  2G4D B;  3B0A A;  2JXX A;  3QIJ A;  4W9D A;  2N9X A;  2LZ6 A;  4K7U A;  3ZW3 A;  3A1Q B;  4XZ4 A;  3ZO5 B;  2WDT B;  3DVG Y;  5CHW A;  5BO4 B;  3V61 A;  3VH3 B;  2LXA A;  4GDK A;  2DX5 B;  3LDZ E;  3QX1 A;  2KC1 A;  4DXA B;  5TR5 A;  4FHJ A;  3VXW A;  2DEN B;  3ZNH B;  2MWS B;  2IO2 B;  3L54 A;  2GBR A;  2KDI A;  2BKR B;  3PHX B;  2LWP A;  5CTR C;  2K8B A;  4I6P A;  2K6Q A;  2LD9 A;  4X57 B;  1OTR B;  3L17 A;  1KJT A;  3VDZ A;  2IY1 B;  1OEY J;  1P9D U;  3AXC A;  5C1Z A;  3N3K B;  4W9J A;  3KUZ A;  2KDF B;  1KM7 A;  2XBB C;  4M0W B;  4PS8 A;  2R2O A;  2IYD B;  2KC2 A;  2JF5 A;  2GBN A;  2MRP A;  4KDL B;  1C1Y B;  3QC8 B;  4HVB A;  1XT9 B;  1WXM A;  2O2V B;  5AZF A;  1PQS A;  2EKE C;  2BPS A;  4FJZ A;  3WIM A;  4EUT A;  4TUU A;  2KTR B;  1P3Q U;  4YL8 A;  1WJN A;  2CS4 A;  1Z5S B;  3PV1 A;  4GOC A;  3A1Q A;  4KIK B;  3TBL D;  2KHW B;  3IG3 A;  2KMA A;  3MJW A;  2N4F A;  3ZTC A;  4ZYN A;  3ZRF A;  4PS7 A;  4K7W A;  2A5U A;  4MJS B;  3VTV A;  2LVP A;  3PRP B;  3TCA A;  2DZM A;  4MSM B;  4BKG A;  3MHS D;  1GNU A;  4G0N B;  4G3X B;  2GBM A;  3GOE A;  3VHT C;  3AU4 A;  2RR9 A;  1HE8 A;  1M94 A;  5GMV A;  5D7G A;  2YVC A;  4HLE A;  1P1A A;  3KVF B;  2FID A;  4N9F 4;  2REX A;  3DBL I;  4HK2 A;  3B1L X;  1UEL A;  3BY4 B;  3PGE A;  1V6E A;  1SGH A;  4HDO A;  1Z2M A;  1LM8 B;  4NJ7 A;  2NPT B;  3PPA A;  1E7U A;  2AL6 A;  4W9H A;  4GN1 A;  2K39 A;  3H9D A;  2BKF A;  5CX3 A;  2FCN A;  3V6E B;  4MDK E;  3W1Y A;  4BVU C;  3DCG A;  3M62 B;  4I6N B;  4ICU A;  1MG8 A;  2GOW A;  2O2V A;  2PPH A;  1WGH A;  2C5L C;  3R7Q A;  3W1S A;  4EKU A;  2Z59 B;  4JL9 A;  5KHQ A;  2KTR A;  1WYW B;  4HPL B;  2LUE A;  4KIK A;  1YQB A;  2AYO B;  4IWQ A;  5G55 A;  3RD2 A;  1GJZ A;  1ZGU B;  3DQV A;  3PRM B;  2Z0E B;  4HCP B;  4MJS A;  3TMP B;  2FCQ A;  5D6J B;  3RCZ A;  5LXH A;  2FAZ A;  3PS6 A;  3ZNI D;  2MBH A;  1VCB A;  3K9P B;  3Q3F A;  1P0R A;  4GMV A;  5E6N A;  5IA7 A;  1YD8 U;  3ZRC A;  5DPS A;  2KAN A;  3PLU A;  1U4A A;  4JGH B;  2DZJ A;  2C7M B;  2V1Y A;  2KDB A;  1OQY A;  1WX9 A;  3H7S A;  2FNJ B;  2JRI B;  2PE6 B;  3PVL A;  1WZ3 A;  2JZ3 B;  3VTU A;  2NPT A;  3R3M A;  4AWJ A;  3WA0 A;  2ZZP B;  3ZDT A;  2LGX A;  1P98 A;  5J17 A;  3JVZ X;  2J0J A;  1EF5 A;  2ZVN A;  1WGY A;  3UIP B;  4DHJ D;  2I1J A;  4WWN A;  1WM2 A;  3KUD B;  2ZVO A;  3HK0 A;  2KWV B;  4WJN A;  1XD3 B;  3X0W A;  2L7R A;  2BYF A;  2ZCC A;  3PLV A;  3KUC B;  2M17 A;  4FA6 A;  2HTH A;  2LGY A;  1E8Z A;  2N9P C;  1C3T A;  3NOB A;  4DBG A;  1IYF A;  2LVQ A;  4CO7 A;  2KJH B;  4BKS A;  1OGW A;  1RFA A;  2IZV B;  1UZX B;  2ASQ A;  5DPW A;  3SHQ A;  4IWP A;  2DYO A;  2KX3 A;  3NHE B;  4W9E A;  4ZRK A;  3ZTD A;  3OAW A;  1S3S G;  3PTF C;  4DK5 A;  2RD0 A;  2O6V D;  3ZLZ A;  1CMX B;  3SU8 X;  2C7N B;  4IWO A;  2A4Z A;  5CHV C;  2G3Q B;  2WYQ A;  3APD A;  3ONS A;  3ML8 A;  2KQ7 A;  1EUV B;  3O65 B;  3ALB A;  2ZNV C;  3DVN U;  4WAA A;  2ZJD A;  2JY6 A;  1V49 A;  2N1W A;  2MBO A;  4HJK A;  2KLG A;  2MW5 A;  3DBR I;  3A9K B;  2L05 A;  3QJZ A;  2OOB B;  4GGQ A;  4LCD E;  3KW5 B;  1WH3 A;  3TL5 A;  2DZI A;  4GU2 A;  1TTN A;  3AUL A;  1ZW7 A;  2BWF A;  2L76 A;  2FCS A;  3RUL A;  2JWZ A;  3ZIM A;  1F9J A;  3DPD A;  1YX6 B;  1J19 A;  3R66 C;  3T8M A;  4W9F A;  2CHZ A;  3HHM A;  1D3Z A;  3DVN V;  5CHF A;  2C7H A;  1NI2 A;  3IHP C;  1UD7 A;  4F1S A;  2KJR A;  5AEK B;  1EO6 A;  4MGI E;  1RAX A;  3WAM A;  4K81 A;  5FR6 A;  1LQB A;  3U8Z A;  1A5R A;  2EMT A;  2FCM A;  2BWE S;  1WIA A;  3N30 A;  3PRE A;  4HCN B;  2UYZ B;  2KMC A;  4DHZ E;  2LRU A;  3NZU A;  4FUL A;  2GBK A;  4HDQ A;  3UIO B;  4LDT D;  3CMM B;  3SD5 A;  5AZH A;  2OJR A;  3ENE A;  4FN2 A;  3NZS A;  4NJ6 A;  4EZJ A;  2MX2 A;  3NY5 A;  5DPR A;  3QAQ A;  1L2N A;  1OEY A;  1KLV A;  2NS5 A;  3VVW B;  4WQO B;  2PE9 A;  2NR2 A;  3A9K A;  2J0K A;  2KO3 A;  1E90 A;  2GBJ A;  3UQB A;  2KFJ A;  3L0W B;  4OVV A;  1S1Q B;  1WXS A;  2DAJ A;  4A3O A; 
#chains in the Genus database with same CATH topology
 3IXS A;  4REZ A;  4EZL A;  4TMA B;  4ZRJ A;  4BOS C;  3RNG C;  2KFK B;  1NEK B;  1GC6 A;  2QIL A;  5IAA C;  2FUG 1;  4YXD B;  2MEK A;  2VZK D;  4MAC A;  4DDI D;  3QK0 A;  1SEB D;  3UF8 A;  5J18 A;  2ZNV B;  2KKC A;  3KQ4 A;  2YEP B;  1AW7 A;  2J7Q B;  3EC8 A;  2JZP A;  1VLB A;  1FIQ A;  1PGX A;  2DAF A;  4AS1 A;  2PTL A;  1T5X D;  3E9S A;  2L32 A;  2YEP F;  1YIW A;  2V9H A;  3BYY B;  3AEF B;  1VZ6 A;  1Q1O A;  2KFK A;  1VJK A;  2MH7 A;  2CR5 A;  3GB1 A;  4MT5 A;  4E74 A;  2VH1 A;  1I4R A;  4US9 A;  2K0P A;  2I1K A;  2L00 B;  1JRO A;  2QJL A;  2CHW A;  3LXF A;  2FBW B;  4HKQ A;  4MGZ E;  4MH0 E;  4BZA A;  3ZJU A;  2AWT A;  1TS3 A;  1D6E C;  1TKG A;  2HTM E;  2DZK A;  2RMM A;  4EFO A;  4B6W A;  3PHW B;  2M4N A;  5C2T B;  3Q3N C;  4LNI A;  2KTF A;  4DHJ B;  1JRP A;  1IUE A;  1ISN A;  3IBE A;  2LGD A;  4IKG A;  1T0Q C;  1J7B A;  1J7A A;  2RGF A;  3P2B A;  2D07 B;  3EEC A;  1ZPS A;  2D3C A;  1V9J A;  1D5X C;  4HPM B;  3QCA A;  1QIL A;  4WWP A;  4MEL A;  4OVU A;  1FNV A;  2WXM A;  1KLU D;  4KVG B;  4M8M A;  2NBV B;  1V5T A;  3DHI C;  1QF6 A;  2J0M A;  1NBF C;  3VFK A;  4A3P A;  2D3G A;  4B95 A;  1WWT A;  4IG7 B;  4AJY B;  2SAK A;  3C0R B;  3L08 A;  4J6I A;  2QEJ C;  3T9L A;  3CF6 E;  3KYC D;  1L0V B;  3N32 A;  1WYG A;  4KSK C;  2YLM A;  1WGR A;  2PIA A;  4EEW A;  1I7H A;  4AJW A;  4WJQ A;  4B0E A;  3BII D;  4G11 A;  1BML C;  3WAL A;  1UGJ A;  3DOW A;  3ZYY X;  3RNA C;  1JQ4 A;  1STE A;  5E6O A;  3RZF A;  2Z8L A;  5D3I B;  2IPK D;  1GB4 A;  4BBN F;  2WLB A;  2QHO A;  1WE6 A;  2JXT A;  2ZCB A;  5JHA A;  2M56 B;  3RNB C;  3SDL C;  4GSW A;  4A6Q A;  2Y5P A;  1F0Z A;  1R4N I;  5L95 C;  4DDG D;  2M1M A;  3GZN I;  4C7Y A;  2W9N A;  4P1C C;  2HD5 B;  1FXA A;  3MFG A;  2CJO A;  1QOG A;  1E7V A;  3ZQ4 A;  4BOZ B;  3DDC B;  1V2Y A;  3EFC A;  3DBH I;  1F2R I;  4AP4 C;  2D11 A;  1SIF A;  1FXT B;  2JPH A;  2LJI A;  2WXI A;  2B76 B;  1YJI A;  3QAR A;  3L4P A;  3WAO A;  2IGG A;  3EA6 A;  3QQ8 B;  1WRI A;  2E6X A;  3APC A;  3W1S C;  2DHZ A;  2QCZ A;  4I6L B;  2J42 A;  1UBQ A;  1UWX A;  1WXA A;  3RFZ B;  5JZE B;  2V4I B;  3W5V B;  1V1O A;  5JHB A;  2K22 A;  2BYE A;  2N9E B;  1Y56 A;  4ANV A;  1ZDV A;  1MFW A;  2RSU A;  5AZG A;  2JX5 A;  2INP E;  2TSS A;  3UIN B;  4LNO A;  3S2A A;  2MBQ A;  2BF8 B;  4IM0 A;  4AUQ C;  2OHF A;  2L8J A;  2Y5B B;  1I4Q A;  2KDE B;  2KWC A;  2Z0D B;  1RWS A;  3OG5 A;  2WX0 A;  4E71 A;  2N9X A;  5BO4 B;  2LXA A;  3AEA B;  2DX5 B;  3MHZ A;  5HG2 A;  3QX1 A;  2KC1 A;  4S17 A;  3BVZ A;  3VXW A;  4ZHP A;  1NEN B;  2GBR A;  2KDI A;  4I6P A;  4X57 B;  4N58 A;  3L17 A;  3RMK C;  3VDZ A;  2IY1 B;  5C1Z A;  3AXC A;  1VRA B;  4W9J A;  2KDF B;  2R2O A;  3MP9 A;  2BTE A;  1RYJ A;  4KDL B;  1IGC A;  1WXM A;  1PQS A;  4GOC A;  2CU3 A;  1Z5S B;  3PV1 A;  2AQ2 B;  3IG3 A;  1PGB A;  2KMA A;  3ZRF A;  4PS7 A;  4K7W A;  1UNS A;  2WDQ B;  4MSM B;  4BKG A;  1SB3 C;  1GNU A;  3MHS D;  3SFD B;  2LFI A;  2GBM A;  3GOE A;  1ROE A;  1WSP A;  1JWB D;  4RF0 A;  2YVC A;  4HLE A;  3KVF B;  4N9F 4;  1SGH A;  1LM8 B;  1AYF A;  3PPA A;  1DOY A;  2K39 A;  1ZUD 2;  3W1Y A;  2X38 A;  5EE3 A;  2KWD A;  4ZHO A;  3M62 B;  2GOW A;  2Z59 B;  3VRB B;  1YQB A;  2AYO B;  4IWQ A;  1LGR A;  3RD2 A;  1GJZ A;  1B9R A;  3PRM B;  2KAJ A;  3NS1 A;  5D6J B;  3BWU D;  3K9P B;  5IA7 A;  3NVV A;  3AE1 B;  3PZ8 A;  2C7M B;  3SR6 A;  3PVL A;  2JRI B;  1N60 A;  2NTT A;  1TS2 A;  3WA0 A;  3ZDT A;  1I4P A;  1YN5 A;  4QAY A;  3JVZ X;  3TUO A;  1VZ7 A;  1WGY A;  4DHJ D;  4A8X C;  1PGA A;  3HK0 A;  1A70 A;  2ONQ A;  4M01 A;  2PLP A;  1C3T A;  1OQR A;  3NOB A;  2LVQ A;  1UZX B;  4IWP A;  2MJ3 A;  2WS3 B;  3NHE B;  2RDB C;  4W9E A;  3OAW A;  2RDH A;  2RD0 A;  5IP4 D;  1SE3 A;  2G3Q B;  1EUV B;  4KKJ A;  2ZNV C;  3SFE B;  3GE8 C;  2N1W A;  4HJK A;  4ARI A;  3DBR I;  3A9K B;  4GGQ A;  2DZI A;  4GU2 A;  3AUL A;  1QKZ A;  2BWF A;  1TKY A;  4YSZ B;  1YMH E;  3T8M A;  2CHZ A;  1D3Z A;  5CHF A;  1YOV B;  5LNK 1;  1E7P B;  5E6J A;  5AEK B;  1EO6 A;  1PFD A;  1A5R A;  3IAM 1;  1MG4 A;  3AE8 B;  2KQ4 X;  4DHZ E;  4HDQ A;  3BVG A;  2JU6 X;  3ENE A;  3H8H A;  4NJ6 A;  2MX2 A;  2JQR B;  4C80 A;  1OEY A;  3VVW B;  2PE9 A;  3A9K A;  2LHD A;  1S1Q B;  1WXS A;  4C7Z A;  1XCQ L;  4II2 B;  4KDI C;  2DYM A;  1C77 A;  2HJ1 A;  2JZZ A;  4MH8 A;  3A9J B;  4PS3 A;  2WXG A;  2D2Q A;  3OLM D;  3R2T A;  3IFW B;  2K8H A;  3R7R A;  4K7S A;  5FR3 A;  3JYU A;  3VAW A;  4AOF A;  1VD2 A;  4M02 A;  4ACF A;  2KOX A;  4XDD A;  3VUY A;  2IBI B;  4II3 B;  2ZPY A;  3QWZ B;  2N7J A;  1T6B X;  4WWO A;  3Q8B A;  1SIJ A;  3EHV A;  2N7D A;  3EGR A;  1V97 A;  2R61 A;  2XEW A;  1CJE A;  2KYW A;  2WWZ A;  3H1U A;  1ENF A;  3APF A;  4HWI B;  2BGF A;  4TSS A;  4OZC A;  3A9J A;  1FCC C;  1T0Y A;  2GMI C;  2FIF A;  3V62 A;  4DXG A;  3ZXV A;  1XLN A;  1IGD A;  4OZA A;  5E6P A;  2HDE A;  3L16 A;  3J9C A;  3QA8 A;  2LAS A;  4L23 A;  5FKA C;  4OHJ A;  1NVI D;  2N9K A;  4BBN C;  2C9W B;  1WGD A;  1WJU A;  4TV3 A;  2JRH A;  4JQW C;  4LLG M;  4CYE A;  2M19 A;  3PSE B;  3I57 A;  2ZEQ A;  1VDV A;  1HTQ A;  4R3D A;  1UWM A;  1YNT E;  2J52 A;  3NVY A;  5AUI A;  3ETR A;  3BK1 A;  2CU1 A;  1J0G A;  2MBE A;  3ZNZ B;  4GB9 A;  2O6V B;  3RI7 C;  2R2Q A;  2NVU I;  3AU5 A;  1E8Y A;  3HRD D;  3TIX A;  1DYQ A;  2JWU A;  3VUW A;  3N1Z C;  3TJP A;  4XWW A;  1SBB B;  1HZ5 A;  1MHH E;  1WXV A;  2IO3 B;  2EMS A;  3RYT A;  5KHO A;  1EWY C;  4LNK A;  5AUK A;  5LXI B;  2IO1 B;  3R8B A;  2CKH B;  1YN4 A;  3FC4 A;  4IM2 A;  2O6V A;  3U4E G;  3RT3 B;  2MLB A;  2AQ1 B;  2QIE B;  1KH0 A;  2OJW A;  3ZNG C;  4LNF A;  1E8X A;  4HJG E;  4OW0 A;  4LDT B;  4M8N A;  1SXT A;  3WAP A;  4LJO B;  1JWA D;  3TEZ A;  3C8Y A;  3WCQ A;  3AB5 A;  2WU5 B;  2BBC A;  3CSF A;  4C56 C;  3P1M A;  4ZYS A;  4DQO C;  1UBI A;  2XNA C;  4W9K A;  2LMC A;  2IGH A;  5JXV A;  1GC7 A;  3H7P B;  1WX8 A;  1L4Z B;  2D5G A;  2NBU A;  1Q0W B;  1WGG A;  4XE0 A;  3AED B;  2MHJ A;  1AWD A;  4E3C A;  5LLI A;  1H8C A;  3HIZ A;  2E3T A;  2W55 A;  5DCN A;  1HZ6 A;  1LXD A;  3ZDM C;  1J8C A;  3MC0 B;  4RM8 A;  5EE0 A;  4MGK E;  2PMV A;  2KMM A;  3T3O A;  1WMH B;  3Q3J A;  1X1M A;  3H7P A;  3U7D A;  1QLB B;  1IPG A;  2KQS A;  2V4L A;  4RMA A;  3M63 B;  2LRW A;  2KVR A;  4J3O D;  5DPT A;  1N63 A;  4NQK E;  1T0S C;  1Y8R C;  5D2M B;  4H2A A;  4MSQ B;  2JYT A;  2RPQ A;  1C76 A;  3UQA A;  1UH6 A;  1KOT A;  4XC2 A;  3H6N A;  1LFD A;  1SE9 A;  2WX1 A;  1L0Y B;  2L3Z A;  3NZ3 A;  3CIR B;  1WMH A;  2G4S A;  3IT6 B;  1KF6 B;  1GOZ A;  4JX1 C;  1I35 A;  1GPX A;  3FAH A;  3P42 A;  2G4D B;  3QIJ A;  4W9D A;  2LZ6 A;  3I9V 1;  3AE4 B;  3ZW3 A;  3A1Q B;  4XZ4 A;  3DVG Y;  5CHW A;  2PVO D;  3V3X A;  3VH3 B;  3AE2 B;  4HEA 1;  3O13 A;  3P4S B;  4FHJ A;  2DEN B;  3C19 A;  2IO2 B;  2BKR B;  1FFU A;  3Q8A A;  2K8B A;  2K6Q A;  1ACC A;  2W3R A;  1KJT A;  3DWM A;  1UF0 A;  3GE3 C;  1KM7 A;  1ZDX A;  2KC2 A;  2IDY A;  2GBN A;  4ZRQ A;  1XT9 B;  4USA A;  2IJ0 A;  2WXN A;  3RPF C;  3FKY A;  2Y3A A;  4TUU A;  2KTR B;  2CS4 A;  4KIK B;  3TBL D;  3A1Q A;  1XCT L;  2D3A A;  3ZTC A;  2N4F A;  3AE9 B;  4ZYN A;  5MPO A;  1FM0 D;  3PRP B;  3TCA A;  1NYQ A;  4G0N B;  3VHT C;  2RR9 A;  5D7G A;  1P1A A;  2REX A;  3DBL I;  1UUP A;  4US8 A;  4PK1 A;  3TEW A;  1UEL A;  3PGE A;  4NJ7 A;  2BS4 B;  2IGD A;  2QSD A;  2BKF A;  2FCN A;  4MDK E;  3Q69 A;  3I63 C;  4I6N B;  4JL9 A;  4XDC A;  2KTR A;  2BS3 B;  2LUE A;  4KIK A;  3DQV A;  4HCP B;  2L1A A;  2FAZ A;  3ZNI D;  3Q3F A;  1FRD A;  3ZRC A;  2KAN A;  4EE2 A;  1U4A A;  4Q2J A;  5IN7 A;  2N9L A;  2PE6 B;  3VTU A;  4L1B A;  2WDR B;  5J17 A;  1DOX A;  1HQR D;  4WQM A;  2AQ3 B;  2M0A A;  1WM2 A;  1FXI A;  2ZVO A;  1XD3 B;  3X0W A;  2M17 A;  4FA6 A;  2HTH A;  2LGY A;  1PDX A;  1IYF A;  4BKS A;  4CQN A;  2DYO A;  2WXL A;  4ZRK A;  3ZTD A;  3W5U B;  4RGO S;  4DK5 A;  2WXP A;  2O6V D;  3IT4 B;  1YJJ A;  2A4Z A;  1N5W A;  2WYQ A;  2KQ7 A;  3O65 B;  1L6V A;  1EM7 A;  2ZJD A;  2WXH A;  4RH6 A;  2MBO A;  2KLG A;  2MW5 A;  4LTU A;  2WXR A;  3GP7 A;  4LCD E;  2GB1 A;  2PKO A;  2L76 A;  1F9J A;  1J19 A;  1VR9 A;  3HHM A;  3DVN V;  1IBX B;  2C7H A;  1NI2 A;  3IHP C;  3ZGZ A;  4F1S A;  2QC8 A;  2WDV B;  5FR6 A;  1P7E A;  2FCM A;  4NJC A;  2WP9 B;  1D5Z C;  2KMC A;  4FUL A;  3UIO B;  4LDT D;  3MJ5 A;  1KLV A;  2NS5 A;  4WQO B;  1RFK A;  2NR2 A;  4A9A A;  3Q14 C;  2QMT A;  3L0W B;  4L2Y A;  4OVV A;  5TSS A;  3AI5 A;  4A3O A;  1R7S A;  2IO0 B;  4XWT A;  4WIP A;  2EEL A;  1IBX A;  4W9L A;  3VQI A;  2KLC A;  4GIV A;  1D5M C;  1R4M I;  1T0R C;  2K1F A;  2MCN B;  2PJH A;  3ZXR A;  2WXO A;  3RUI B;  2N0S B;  5C23 A;  4DHZ B;  3NJT A;  4LNN A;  1L4D B;  2NMQ A;  3NVZ A;  3AE5 B;  1ET6 A;  4RM9 A;  4WH4 A;  2LJ5 A;  1WR6 E;  1DOI A;  3DHH C;  3ZVV A;  2LXC A;  2MQJ A;  4F8C B;  2K5P A;  3OJ3 A;  4IDI A;  5G5G A;  1K8R B;  3P4P B;  1WRD B;  1ZKH A;  1V8C A;  3A4R A;  1CK1 A;  2G45 B;  3MTN B;  1TKE A;  5G2N A;  2MJE A;  3VR9 B;  2JVC A;  4BFR A;  4W9C A;  3D32 A;  1L7Y A;  4TQ1 A;  1AAR A;  1M4V A;  4WJO A;  1SF0 A;  1FRR A;  1C4A A;  1YQ3 B;  1IP9 A;  4YTN B;  4KSL C;  1WI0 A;  1V80 A;  3KH0 A;  1C79 A;  5HI1 A;  1SE4 A;  5J2R A;  2HJ8 A;  4RGT A;  3EUB 2;  3VRA B;  5G5H A;  1ZXH A;  2AEH A;  1MJD A;  2ZPN A;  1XQQ A;  3ML9 A;  3LYY A;  1N5X A;  2KN5 A;  2JT4 B;  2XK5 B;  3TEX A;  2J53 A;  4O1N A;  1HTO A;  1BT0 A;  4FAD A;  3B9J A;  1YN3 A;  3RNF C;  4JWS C;  1WR1 A;  4KZC A;  2B3A A;  4XX5 A;  2KNB A;  3IAS 1;  1JWU D;  1RLF A;  5L83 A;  2LI5 A;  1FFV A;  1R4N B;  2KX0 A;  3NG0 A;  4RF1 A;  3MC8 A;  3GZN B;  3CST A;  4OZB A;  2EKI A;  3QHT A;  2W54 A;  1EU4 A;  3B08 A;  3RZW C;  2XK5 A;  4FXC A;  4C00 A;  3M3J A;  3DBH B;  1F77 A;  1EWC A;  3PZD A;  2PEA A;  4EZK A;  1WFY A;  4B0M A;  4EOY A;  1ZXI A;  2K6D B;  1DGJ A;  1WZ0 A;  3JSV B;  1T3Q A;  4KZ0 A;  1TZO A;  2KVZ A;  3KWV A;  2L0T A;  1YJ1 A;  4WWM A;  1K50 A;  1XF5 L;  2MP2 B;  2KAC A;  1CQV A;  4BKS D;  4K3B A;  1JWM D;  1YQ4 B;  2INC C;  2NBW B;  1WJ6 A;  4P7I A;  2L0F A;  4ARC A;  1HXY D;  2ZW1 A;  4ZOH C;  4AQ7 A;  1E10 A;  1E0Z A;  3JSV A;  3V60 A;  2MA9 B;  4ITK A;  4LJP B;  2WU2 B;  3NVW A;  3AMZ A;  3W9C B;  4N59 A;  3ABV B;  3OWE B;  1UGM A;  4CHK A;  1NI3 A;  2MP2 A;  1FNU A;  2IY0 B;  3PZ7 A;  3HVD A;  4NPN A;  1I4X A;  4A20 A;  1I4G A;  1PYW D;  1GB1 A;  3HM3 A;  2K25 A;  2KJ6 A;  2I2Y A;  1E6E B;  2KD0 A;  2KZR A;  1E5W A;  4IUM B;  2V3N A;  3U30 A;  2Y5C A;  3PRZ A;  4IM3 A;  2MSE D;  3BIN A;  2GRI A;  1TBE A;  1SJH D;  2KWU B;  3B2F A;  1N62 A;  1J7C A;  2BB6 A;  3KLS X;  2W3S A;  2L83 A;  3ZO5 B;  2WDT B;  3V61 A;  4A90 A;  5TR5 A;  3R2I A;  2MWS B;  4JE3 B;  1K51 A;  2BB5 A;  2LD9 A;  4DXF A;  1OTR B;  1OEY J;  2JYE A;  3N3K B;  3KUZ A;  5BYQ A;  4PS8 A;  2IYD B;  1XEE A;  3BYT B;  1C1Y B;  4HVB A;  1GAQ B;  5AZF A;  1VZ8 A;  4FJZ A;  4EUT A;  1P3Q U;  4YL8 A;  1KLG D;  3V05 A;  2KHW B;  1V1P A;  3MJW A;  2A5U A;  1E9M A;  2H88 B;  4G3X B;  2XN9 C;  1MHX A;  3AU4 A;  1HE8 A;  5GMV A;  1QOA A;  4KKI A;  2FID A;  1WXQ A;  2PW9 A;  3BY4 B;  5BYR A;  1V6E A;  5IOI A;  3N9Y C;  2NPT B;  1E7U A;  4GN1 A;  3H9D A;  4BVU C;  3DCG A;  3UI3 A;  4ICU A;  2C5L C;  5KHQ A;  1WYW B;  4HPL B;  3LB8 C;  5G55 A;  3DBR B;  1KTK A;  2JSV X;  1P7F A;  2FCQ A;  3RCZ A;  5LXH A;  3PS6 A;  4GMV A;  2MBH A;  1TS4 A;  1YD8 U;  4JGH B;  2LHE A;  2KDB A;  1OQY A;  3H7S A;  2FNJ B;  1C4P A;  2JZ3 B;  2NPT A;  3AV8 A;  3ZJT A;  2LGX A;  2WNM A;  2J0J A;  3AEE B;  2ZVN A;  4WWN A;  2D3B A;  1B1Z A;  4WJN A;  2KT7 A;  1L6U A;  2L7R A;  2ZCC A;  3PLV A;  3KUC B;  3AM9 A;  5EE1 A;  4DBG A;  4K3C A;  2KJH B;  1RFA A;  2WXJ A;  5DPW A;  1N6Z A;  2KX3 A;  5GXG B;  2BS2 B;  3Q2A C;  1S3S G;  3PTF C;  3ZLZ A;  4YTM B;  3SU8 X;  2C7N B;  4IWO A;  5CHV C;  1TS5 A;  3ALB A;  4KGR A;  1FPY A;  3DVN U;  3HVZ A;  2WGS A;  3MC9 A;  2L05 A;  2OOB B;  3KW5 B;  1OQQ A;  2FCS A;  2JWZ A;  3N1X C;  3ZIM A;  3DPD A;  1YX6 B;  3BVM A;  3DWG C;  3R66 C;  4W9F A;  1XLP A;  2CJN A;  2KJR A;  3U8Z A;  4UDU C;  3ZJV A;  1WIA A;  2WHI A;  4NAM A;  3PRE A;  4HCN B;  3NZU A;  2ON8 A;  4WAF A;  4BAX A;  5EE9 A;  3CMM B;  5T8I A;  5AZH A;  2OJR A;  4FN2 A;  2DNF A;  3SEB A;  4P1B C;  2J0K A;  5I4D A;  2KO3 A;  1E90 A;  4KX6 B;  4HRO A;  4TKN A;  4MEM A;  1G6J A;  1QQR A;  3HM6 X;  1H4R A;  1SE2 A;  2DYB A;  4IW0 A;  1NDD A;  1QOB A;  1TGZ B;  4WJP A;  4TQ0 A;  4NY0 A;  3PT2 B;  1AN8 A;  4NAW B;  4ANX A;  2PVG C;  3N20 C;  3Q8E A;  1V86 A;  3IVF A;  4PYU A;  2QDF A;  5C3J B;  1WY8 A;  3M95 A;  1MPE A;  1YX5 B;  4GDL B;  5D94 A;  1ZOY B;  4HKZ E;  3VTW A;  3AH7 A;  3NS8 A;  4JWU C;  3RNE C;  2K9X A;  1WM3 A;  1WE7 A;  4YWG G;  5FK9 C;  1WF9 A;  3NUH B;  3OJ4 B;  1C9F A;  4ANU A;  2N1V A;  4NAW A;  1WX7 A;  3E56 A;  3EFU A;  4GLS C;  1EF1 A;  2RDG A;  4IC7 B;  4ANW A;  1F2R C;  3LJ3 A;  1JRU A;  4KGT A;  2N7E A;  4GDL A;  2MBB B;  3K9O B;  2WXK A;  2SEB D;  2HE7 A;  3P4Q B;  4ICV A;  4ZRI A;  2H89 B;  4GXB A;  2DBY A;  3PO0 A;  3A4S C;  3DBS A;  1V81 A;  1QOF A;  5BMG A;  2BQQ A;  2LVO A;  1C78 A;  1KFY B;  5D3D A;  3WAN A;  1Q5W B;  3DVG X;  2G9H D;  3URY A;  1JML A;  2FUH B;  2LEK A;  4NQL B;  3RN9 C;  2VH2 A;  1BUI C;  4JPS A;  4PYZ A;  2K8C A;  2BW2 A;  3P4R B;  3AEC B;  3T3N A;  1LO5 D;  3KYD D;  4P16 A;  1F52 A;  2FE8 A;  4W9G A;  1WJ4 A;  1XXG A;  1FD6 A;  4G50 A;  3KWL A;  1KRH A;  4YT0 B;  2KN4 A;  2JUO A;  4MM3 B;  2M8S A;  2UWQ A;  4B9K A;  3L13 A;  3Q3M C;  2IND C;  3Q8C A;  5HHD G;  5BMI A;  4FBJ B;  4XGA B;  1ESF A;  2W82 A;  4JIO U;  2M0X A;  1D4B A;  3JW0 X;  5JH5 C;  4ZDV A;  1N61 A;  3BZD B;  4OVZ A;  3AE3 B;  2LGS A;  3B2G A;  1GUA B;  1TYG B;  1JCK B;  2V3P A;  3N1Y C;  4F7Z A;  5IO9 A;  1V5O A;  4FHK A;  2KXJ A;  4FJY A;  1GG3 A;  4RCO A;  3BK2 A;  4HXD A;  2BYT A;  4MGY E;  4K1R B;  3TEY A;  4YTP B;  3ZKJ C;  3A33 B;  3CWI A;  3RNC C;  2DLB A;  4MM3 A;  1TIF A;  4PT5 A;  2CHX A;  1BXT A;  1WGK A;  4W9I A;  2ACZ B;  2OED A;  2VZK B;  5EDS A;  2LGI A;  1Q10 A;  1E8W A;  4FJV B;  2KK8 A;  4M00 A;  3AEB B;  2D10 A;  5BYS A;  1SJE D;  2BYV E;  4KGS A;  1FCL A;  3L10 B;  3ECI A;  1JW9 D;  4ASW C;  4FLH A;  5HKH A;  1TZ1 A;  1RRB A;  2L52 A;  3I3T B;  3VH4 B;  3HUI A;  1L5P A;  1TJE A;  2I38 A;  4DWF A;  4C4V B;  2C60 A;  3VUX A;  2NCN A;  1MI0 A;  4GDK B;  2AL3 A;  3NRZ A;  2BT6 A;  1QZE A;  3UGB B;  4JLC A;  4NNJ B;  4XYC A;  3AEG B;  2VRR B;  4HPP A;  4RGN A;  4KV2 A;  3V6C B;  4BKT A;  1I42 A;  5IKC M;  3AE6 B;  2V3S A;  2V0G A;  4N6E B;  1OFF A;  3X23 A;  2GLS A;  3ZUN A;  3DBL B;  1FNW A;  3B0A A;  2JXX A;  4C4V A;  4K7U A;  3P63 A;  4GDK A;  3LDZ E;  4DXA B;  3ZNH B;  1ZE3 D;  3L54 A;  2DWQ A;  3PHX B;  2LWP A;  5CTR C;  1L0X B;  1P9D U;  2XBB C;  1NYR A;  3Q8F A;  4M0W B;  4A55 A;  2JF5 A;  2MRP A;  3QC8 B;  1MVK A;  2O2V B;  2WXF A;  2EKE C;  2BPS A;  4RNA A;  3WIM A;  1FO4 A;  1WJN A;  3Q3O C;  2MJD A;  4RFB A;  4D2K A;  2BVC A;  3TSS A;  1PUT A;  2J4X A;  2LVP A;  4HRS A;  4MJS B;  3VTV A;  2DZM A;  3FIL B;  3U2S C;  4ZRP A;  2Q5W D;  1M94 A;  5HFY A;  1TT5 B;  1CZP A;  4HK2 A;  3W2D A;  3B1L X;  4HDO A;  1Z2M A;  4M0W A;  2AL6 A;  2K3U A;  4W9H A;  5CX3 A;  3V6E B;  4RGM A;  2WXQ A;  2UU7 A;  3Q6B A;  1ZP0 B;  1F1H A;  3R7Q A;  1MG8 A;  2O2V A;  2PPH A;  4YSY B;  1WGH A;  3W1S A;  4EKU A;  4URK A;  4P6V F;  1XO3 A;  3AN1 A;  1ZGU B;  3VR8 B;  2Z0E B;  4MJS A;  3TMP B;  1HA5 A;  1TY0 A;  3DHG C;  1VCB A;  3FIL A;  2ICI A;  1P0R A;  5E6N A;  5DPS A;  1XLQ A;  3PLU A;  2NTS A;  1C4C A;  2KDM A;  2DZJ A;  2V1Y A;  1WX9 A;  2X8X X;  1WZ3 A;  4AWJ A;  3R3M A;  2ZZP B;  1P98 A;  3U52 E;  1EF5 A;  4NZL B;  2WQY B;  3UIP B;  4YSX B;  4LK0 M;  2I1J A;  2AX5 A;  1QT9 A;  1FEH A;  3KUD B;  4IOI E;  2KWV B;  3AE7 B;  1JAL A;  2BYF A;  2INN E;  1E8Z A;  2N9P C;  1HEZ E;  4CO7 A;  1OGW A;  2IZV B;  2ASQ A;  3SHQ A;  3U7Z A;  1CMX B;  1RM6 C;  1K53 A;  2G1E A;  1EU3 A;  3APD A;  3ONS A;  3ML8 A;  1ET9 A;  4WAA A;  1R4M B;  2JY6 A;  1V49 A;  4S0R A;  1V1P B;  5BMH A;  3QJZ A;  1WH3 A;  3TL5 A;  1TTN A;  1ZW7 A;  3RUL A;  1FMA D;  2RPV A;  1TY2 A;  1SSN A;  5H92 C;  1I4H A;  1UD7 A;  4MGI E;  1RAX A;  3WAM A;  4K81 A;  1LQB A;  2EMT A;  3I5J C;  2BWE S;  3N30 A;  2UYZ B;  5H8Y E;  2GI9 A;  2LRU A;  4WUR A;  2GBK A;  3SD5 A;  2ZW0 A;  1JWS D;  3NZS A;  3GS2 A;  2LUM A;  4EZJ A;  3NY5 A;  1K52 A;  5DPR A;  3QAQ A;  1L2N A;  3UQB A;  2GBJ A;  2KFJ A;  2DAJ A;  1XLO A; 
#chains in the Genus database with same CATH homology
 4TKN A;  4MEM A;  4II2 B;  1G6J A;  2IO0 B;  3HM6 X;  4KDI C;  2DYM A;  1H4R A;  2DYB A;  4EZL A;  4IW0 A;  1NDD A;  1TGZ B;  4WJP A;  4ZRJ A;  2JZZ A;  4W9L A;  3VQI A;  4BOS C;  2KFK B;  4TQ0 A;  2KLC A;  4GIV A;  4NY0 A;  1GC6 A;  3A9J B;  1R4M I;  3PT2 B;  4PS3 A;  5IAA C;  2K1F A;  2MCN B;  2PJH A;  2D2Q A;  3OLM D;  4NAW B;  3RUI B;  4ANX A;  4DDI D;  3QK0 A;  3IFW B;  2K8H A;  3R7R A;  4K7S A;  5C23 A;  4DHZ B;  3UF8 A;  3JYU A;  3VAW A;  4AOF A;  5J18 A;  2ZNV B;  1V86 A;  1VD2 A;  3IVF A;  4PYU A;  2KKC A;  2KOX A;  1WY8 A;  4RM9 A;  2LJ5 A;  1WR6 E;  3M95 A;  2J7Q B;  3EC8 A;  3VUY A;  2IBI B;  4II3 B;  2ZPY A;  1YX5 B;  2DAF A;  4GDL B;  3ZVV A;  5D94 A;  2LXC A;  3QWZ B;  2MQJ A;  4WWO A;  3VTW A;  4F8C B;  3OJ3 A;  3NS8 A;  3EHV A;  2N7D A;  1K8R B;  1YIW A;  2XEW A;  1WM3 A;  1WRD B;  1ZKH A;  2WWZ A;  1WE7 A;  3A4R A;  2G45 B;  3MTN B;  5G2N A;  1Q1O A;  2KFK A;  3H1U A;  2CR5 A;  3APF A;  4E74 A;  4HWI B;  2BGF A;  2JVC A;  1WF9 A;  3A9J A;  3OJ4 B;  1T0Y A;  4BFR A;  2GMI C;  2I1K A;  2L00 B;  2FIF A;  3V62 A;  4ANU A;  2N1V A;  4NAW A;  4W9C A;  3D32 A;  1WX7 A;  1L7Y A;  4TQ1 A;  3EFU A;  2CHW A;  1AAR A;  4WJO A;  1EF1 A;  4IC7 B;  4ANW A;  3LJ3 A;  5E6P A;  1JRU A;  3L16 A;  4MGZ E;  4MH0 E;  3QA8 A;  1IP9 A;  2AWT A;  2N7E A;  4KSL C;  2LAS A;  4GDL A;  2DZK A;  1WI0 A;  4EFO A;  2MBB B;  1V80 A;  3K9O B;  3KH0 A;  4B6W A;  3PHW B;  4BBN C;  2C9W B;  2M4N A;  2KTF A;  1WGD A;  2HE7 A;  5J2R A;  1WJU A;  4ICV A;  2HJ8 A;  4TV3 A;  2JRH A;  4JQW C;  4DHJ B;  4ZRI A;  4CYE A;  3PSE B;  1ISN A;  4GXB A;  3IBE A;  2LGD A;  2ZEQ A;  3A4S C;  3DBS A;  1V81 A;  2AEH A;  2ZPN A;  1XQQ A;  3ML9 A;  2LVO A;  2RGF A;  3P2B A;  2D07 B;  3EEC A;  3WAN A;  2CU1 A;  2KN5 A;  2JT4 B;  2XK5 B;  1J0G A;  2MBE A;  3ZNZ B;  1Q5W B;  3DVG X;  4GB9 A;  1BT0 A;  2O6V B;  4FAD A;  2R2Q A;  2FUH B;  1V9J A;  4NQL B;  2NVU I;  1WR1 A;  3AU5 A;  3QCA A;  1E8Y A;  4HPM B;  4KZC A;  3TIX A;  3VUW A;  2B3A A;  4WWP A;  4PYZ A;  2K8C A;  4MEL A;  4OVU A;  4XX5 A;  3TJP A;  2KNB A;  1RLF A;  5L83 A;  4M8M A;  4KVG B;  2NBV B;  2LI5 A;  1V5T A;  2J0M A;  3KYD D;  2KX0 A;  4W9G A;  1NBF C;  3VFK A;  1WXV A;  1WJ4 A;  4A3P A;  2D3G A;  4B95 A;  2IO3 B;  4IG7 B;  4AJY B;  4G50 A;  2EMS A;  3RYT A;  3C0R B;  5KHO A;  3CST A;  3L08 A;  4J6I A;  3T9L A;  2JUO A;  3CF6 E;  3QHT A;  3KYC D;  5LXI B;  3N32 A;  2IO1 B;  5HKH A;  3B08 A;  3RZW C;  2M8S A;  2XK5 A;  2CKH B;  3M3J A;  4KSK C;  2UWQ A;  2YLM A;  1WGR A;  4IM2 A;  4B9K A;  4EEW A;  2O6V A;  4AJW A;  3PZD A;  3L13 A;  3RT3 B;  2MLB A;  2PEA A;  4FBJ B;  4WJQ A;  4EZK A;  4JIO U;  4G11 A;  3ZNG C;  2M0X A;  1E8X A;  1WFY A;  4LDT B;  3JW0 X;  5JH5 C;  4EOY A;  4ZDV A;  4M8N A;  2K6D B;  3WAL A;  1GUA B;  1WZ0 A;  3JSV B;  3DOW A;  3WAP A;  4KZ0 A;  4F7Z A;  1V5O A;  5E6O A;  4FHK A;  2KXJ A;  4FJY A;  4LJO B;  1GG3 A;  3RZF A;  4HXD A;  2L0T A;  4MGY E;  4K1R B;  1YJ1 A;  3CSF A;  4BBN F;  3ZKJ C;  1UBI A;  3A33 B;  4MM3 A;  4W9K A;  2MP2 B;  1GC7 A;  3H7P B;  1WX8 A;  2QHO A;  1WE6 A;  2CHX A;  4W9I A;  2ZCB A;  2NBU A;  5JHA A;  1Q0W B;  4BKS D;  1WGG A;  3SDL C;  5EDS A;  4GSW A;  1R4N I;  1E8W A;  4FJV B;  2NBW B;  1WJ6 A;  4P7I A;  2KK8 A;  5L95 C;  2L0F A;  4E3C A;  2D10 A;  2M1M A;  3GZN I;  5LLI A;  4DDG D;  1H8C A;  3HIZ A;  5DCN A;  2W9N A;  2HD5 B;  3JSV A;  1LXD A;  3V60 A;  3ZDM C;  2MA9 B;  4LJP B;  2BYV E;  1E7V A;  1J8C A;  3L10 B;  4BOZ B;  3DDC B;  4RM8 A;  1V2Y A;  3DBH I;  4AP4 C;  3ECI A;  2D11 A;  1SIF A;  4MGK E;  1FXT B;  2JPH A;  4ASW C;  1WMH B;  1UGM A;  3Q3J A;  4CHK A;  1X1M A;  3QAR A;  2MP2 A;  4FLH A;  1TZ1 A;  2IY0 B;  1RRB A;  3H7P A;  3I3T B;  3QQ8 B;  3U7D A;  3VH4 B;  3WAO A;  1IPG A;  2KQS A;  2V4L A;  4RMA A;  3APC A;  3W1S C;  4DWF A;  2DHZ A;  2C60 A;  4I6L B;  3M63 B;  2LRW A;  4NPN A;  3VUX A;  1UBQ A;  2KVR A;  2NCN A;  1WXA A;  5DPT A;  4A20 A;  4NQK E;  4URK A;  4GDK B;  5JZE B;  2AL3 A;  3HM3 A;  2K25 A;  1Y8R C;  2KJ6 A;  1QZE A;  5D2M B;  5JHB A;  2BYE A;  2KD0 A;  3UGB B;  2N9E B;  4JLC A;  4NNJ B;  2KZR A;  1E5W A;  4MSQ B;  2VRR B;  4ANV A;  2RSU A;  5AZG A;  2RPQ A;  4KV2 A;  3UQA A;  1UH6 A;  3UIN B;  4XC2 A;  3S2A A;  1KOT A;  3H6N A;  3V6C B;  1LFD A;  1SE9 A;  2MBQ A;  2BF8 B;  4IUM B;  4IM0 A;  3U30 A;  4AUQ C;  2WX1 A;  2L8J A;  3PRZ A;  4IM3 A;  2Y5B B;  2L3Z A;  2MSE D;  4BKT A;  1I42 A;  3BIN A;  1WMH A;  2G4S A;  2KDE B;  2V3S A;  3AI5 A;  1TBE A;  2KWC A;  2Z0D B;  3X23 A;  1I35 A;  2KWU B;  2WX0 A;  3ZUN A;  4E71 A;  2G4D B;  3B0A A;  2JXX A;  3QIJ A;  4W9D A;  2N9X A;  2LZ6 A;  4K7U A;  3ZW3 A;  3A1Q B;  4XZ4 A;  3ZO5 B;  2WDT B;  3DVG Y;  5CHW A;  5BO4 B;  3V61 A;  3VH3 B;  2LXA A;  4GDK A;  2DX5 B;  3LDZ E;  3QX1 A;  2KC1 A;  4DXA B;  5TR5 A;  4FHJ A;  3VXW A;  2DEN B;  3ZNH B;  2MWS B;  2IO2 B;  3L54 A;  2GBR A;  2KDI A;  2BKR B;  3PHX B;  2LWP A;  5CTR C;  2K8B A;  4I6P A;  2K6Q A;  2LD9 A;  4X57 B;  1OTR B;  3L17 A;  1KJT A;  3VDZ A;  2IY1 B;  1OEY J;  1P9D U;  3AXC A;  5C1Z A;  3N3K B;  4W9J A;  3KUZ A;  2KDF B;  1KM7 A;  2XBB C;  4M0W B;  4PS8 A;  2R2O A;  2IYD B;  2KC2 A;  2JF5 A;  2GBN A;  2MRP A;  4KDL B;  1C1Y B;  3QC8 B;  4HVB A;  1XT9 B;  1WXM A;  2O2V B;  5AZF A;  1PQS A;  2EKE C;  2BPS A;  4FJZ A;  3WIM A;  4EUT A;  4TUU A;  2KTR B;  1P3Q U;  4YL8 A;  1WJN A;  2CS4 A;  1Z5S B;  3PV1 A;  4GOC A;  3A1Q A;  4KIK B;  3TBL D;  2KHW B;  3IG3 A;  2KMA A;  3MJW A;  2N4F A;  3ZTC A;  4ZYN A;  3ZRF A;  4PS7 A;  4K7W A;  2A5U A;  4MJS B;  3VTV A;  2LVP A;  3PRP B;  3TCA A;  2DZM A;  4MSM B;  4BKG A;  3MHS D;  1GNU A;  4G0N B;  4G3X B;  2GBM A;  3GOE A;  3VHT C;  3AU4 A;  2RR9 A;  1HE8 A;  1M94 A;  5GMV A;  5D7G A;  2YVC A;  4HLE A;  1P1A A;  3KVF B;  2FID A;  4N9F 4;  2REX A;  3DBL I;  4HK2 A;  3B1L X;  1UEL A;  3BY4 B;  3PGE A;  1V6E A;  1SGH A;  4HDO A;  1Z2M A;  1LM8 B;  4NJ7 A;  2NPT B;  3PPA A;  1E7U A;  2AL6 A;  4W9H A;  4GN1 A;  2K39 A;  3H9D A;  2BKF A;  5CX3 A;  2FCN A;  3V6E B;  4MDK E;  3W1Y A;  4BVU C;  3DCG A;  3M62 B;  4I6N B;  4ICU A;  1MG8 A;  2GOW A;  2O2V A;  2PPH A;  1WGH A;  2C5L C;  3R7Q A;  3W1S A;  4EKU A;  2Z59 B;  4JL9 A;  5KHQ A;  2KTR A;  1WYW B;  4HPL B;  2LUE A;  4KIK A;  1YQB A;  2AYO B;  4IWQ A;  5G55 A;  3RD2 A;  1GJZ A;  1ZGU B;  3DQV A;  3PRM B;  2Z0E B;  4HCP B;  4MJS A;  3TMP B;  2FCQ A;  5D6J B;  3RCZ A;  5LXH A;  2FAZ A;  3PS6 A;  3ZNI D;  2MBH A;  1VCB A;  3K9P B;  3Q3F A;  1P0R A;  4GMV A;  5E6N A;  5IA7 A;  1YD8 U;  3ZRC A;  5DPS A;  2KAN A;  3PLU A;  1U4A A;  4JGH B;  2DZJ A;  2C7M B;  2V1Y A;  2KDB A;  1OQY A;  1WX9 A;  3H7S A;  2FNJ B;  2JRI B;  2PE6 B;  3PVL A;  1WZ3 A;  2JZ3 B;  3VTU A;  2NPT A;  3R3M A;  4AWJ A;  3WA0 A;  2ZZP B;  3ZDT A;  2LGX A;  1P98 A;  5J17 A;  3JVZ X;  2J0J A;  1EF5 A;  2ZVN A;  1WGY A;  3UIP B;  4DHJ D;  2I1J A;  4WWN A;  1WM2 A;  3KUD B;  2ZVO A;  3HK0 A;  2KWV B;  4WJN A;  1XD3 B;  3X0W A;  2L7R A;  2BYF A;  2ZCC A;  3PLV A;  3KUC B;  2M17 A;  4FA6 A;  2HTH A;  2LGY A;  1E8Z A;  2N9P C;  1C3T A;  3NOB A;  4DBG A;  1IYF A;  2LVQ A;  4CO7 A;  2KJH B;  4BKS A;  1OGW A;  1RFA A;  2IZV B;  1UZX B;  2ASQ A;  5DPW A;  3SHQ A;  4IWP A;  2DYO A;  2KX3 A;  3NHE B;  4W9E A;  4ZRK A;  3ZTD A;  3OAW A;  1S3S G;  3PTF C;  4DK5 A;  2RD0 A;  2O6V D;  3ZLZ A;  1CMX B;  3SU8 X;  2C7N B;  4IWO A;  2A4Z A;  5CHV C;  2G3Q B;  2WYQ A;  3APD A;  3ONS A;  3ML8 A;  2KQ7 A;  1EUV B;  3O65 B;  3ALB A;  2ZNV C;  3DVN U;  4WAA A;  2ZJD A;  2JY6 A;  1V49 A;  2N1W A;  2MBO A;  4HJK A;  2KLG A;  2MW5 A;  3DBR I;  3A9K B;  2L05 A;  3QJZ A;  2OOB B;  4GGQ A;  4LCD E;  3KW5 B;  1WH3 A;  3TL5 A;  2DZI A;  4GU2 A;  1TTN A;  3AUL A;  1ZW7 A;  2BWF A;  2L76 A;  2FCS A;  3RUL A;  2JWZ A;  3ZIM A;  1F9J A;  3DPD A;  1YX6 B;  1J19 A;  3R66 C;  3T8M A;  4W9F A;  2CHZ A;  3HHM A;  1D3Z A;  3DVN V;  5CHF A;  2C7H A;  1NI2 A;  3IHP C;  1UD7 A;  4F1S A;  2KJR A;  5AEK B;  1EO6 A;  4MGI E;  1RAX A;  3WAM A;  4K81 A;  5FR6 A;  1LQB A;  3U8Z A;  1A5R A;  2EMT A;  2FCM A;  2BWE S;  1WIA A;  3N30 A;  3PRE A;  4HCN B;  2UYZ B;  2KMC A;  4DHZ E;  2LRU A;  3NZU A;  4FUL A;  2GBK A;  4HDQ A;  3UIO B;  4LDT D;  3CMM B;  3SD5 A;  5AZH A;  2OJR A;  3ENE A;  4FN2 A;  3NZS A;  4NJ6 A;  4EZJ A;  2MX2 A;  3NY5 A;  5DPR A;  3QAQ A;  1L2N A;  1OEY A;  1KLV A;  2NS5 A;  3VVW B;  4WQO B;  2PE9 A;  2NR2 A;  3A9K A;  2J0K A;  2KO3 A;  1E90 A;  2GBJ A;  3UQB A;  2KFJ A;  3L0W B;  4OVV A;  1S1Q B;  1WXS A;  2DAJ A;  4A3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...