2GBMA

Crystal structure of the 35-36 8 glycine insertion mutant of ubiquitin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGGGGGGGGGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin
publication title Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gbmA00
4MEMA 2ZEQA 2V1YA 2GOWA 3CSFA 3PREA 2BYFA 3APCA 2HTHA 3WANA 2L00B 2NVUI 1P3QU 4LJOB 3QC8B 1SE9A 2EKEC 2PEAA 2ZPNA 2BKFA 4CHKA 5DPRA 3TMPB 1TGZB 1Z2MA 2MBOA 2KDIA 3ENEA 4FLHA 4MJSB 3P2BA 4JQWC 4ZRJA 1J8CA 3EECA 4IWQA 2Y5BB 1WXVA 4PYZA 4RM8A 3TBLD 3WALA 1TBEA 5D6JB 2KDBA 3ZRFA 5DPSA 4FULA 1EO6A 2RSUA 2LVOA 2CS4A 3QJZA 2HD5B 2IY0B 3WA0A 4AUQC 1VCBA 2HJ8A 2XK5B 1D3ZA 4NQLB 4IG7B 4LDTD 3A4SC 1T0YA 3RULA 4TV3A 4ANUA 3EHVA 2KWVB 1E8YA 3GZNI 3PLVA 4HPLB 3ZIMA 1J19A 1IPGA 3ZLZA 3UQBA 2JVCA 2O6VA 2AL3A 2RD0A 3BY4B 3KUDB 1Q0WB 4E3CA 2XBBC 3L0WB 4GSWA 2L0TA 2QHOA 3VDZA 4ANWA 1V2YA 1WFYA 2ZCBA 1K8RB 4JGHB 1RRBA 2GBMA 5D7GA 1Q5WB 2L05A 1S1QB 4EFOA 3B0AA 4TKNA 5FR6A 4IWOA 2MWSB 1GNUA 2NS5A 2BGFA 4GMVA 2D3GA 5CTRC 3C0RB 2DZMA 2DAJA 2NBVB 2BWFA 1UELA 4MM3A 4M8MA 2WDTB 4BKSA 4ZRIA 4YL8A 1E5WA 3O65B 3L13A 3KYCD 1V81A 3VTVA 3AULA 5E6PA 3JSVB 5G2NA 2JXXA 3KUZA 4DK5A 1XQQA 2K25A 4LDTB 1WF9A 3N3KB 1WIAA 3M95A 3OLMD 4FN2A 1WGRA 2GBJA 3NY5A 3SU8X 3VH4B 2I1KA 1WH3A 2KJHB 4XX5A 3L08A 4MSMB 3ZVVA 4FJYA 2O6VD 1OGWA 4MSQB 5BO4B 3DQVA 3QCAA 3A1QA 1V5OA 2LJ5A 1UH6A 3PTFC 3PLUA 4FHKA 4HJKA 4W9EA 2G4SA 3VVWB 1GJZA 1WR6E 2Z0EB 4FBJB 1V49A 2M17A 1J0GA 4W9IA 4EEWA 4J6IA 4F8CB 4BOZB 1Z5SB 5AZFA 2L8JA 4GIVA 2AEHA 1NBFC 4KVGB 5JHBA 1WMHA 4K1RB 4BKSD 4BFRA 1NI2A 3HK0A 2ZVOA 4GDKB 3OJ3A 2JWZA 1WZ3A 2WX0A 1TZ1A 2KMAA 3TL5A 2JRHA 2IYDB 3R7QA 3QAQA 4XC2A 2NR2A 1P1AA 2KNBA 4EOYA 1WGHA 2M4NA 1RFAA 1S3SG 4DBGA 4BBNC 3CF6E 3ZKJC 3WAPA 3WAOA 4WJNA 5D94A 1RAXA 3IVFA 2IY1B 2PE9A 4BVUC 4FADA 3X0WA 4AOFA 3UINB 1WM3A 2D2QA 2RR9A 4LCDE 3R3MA 1E8XA 3A9KA 2FUHB 4IW0A 2KJRA 3PHWB 2IZVB 4GXBA 2N7EA 1F9JA 3L16A 4II2B 2JZZA 2DHZA 4HCNB 2LRUA 2G45B 2ASQA 3PS6A 4MDKE 4X57B 2ZNVC 4G0NB 1GC6A 3ZNHB 2UYZB 1M94A 1TTNA 1R4NI 4NJ6A 4GOCA 2EMSA 2KFKA 3RCZA 1P98A 4FA6A 5IAAC 4DHZE 3UGBB 4K7WA 1LFDA 1GUAB 1ZW7A 3WIMA 3MHSD 2KKCA 4PS8A 1WGDA 2BF8B 3RUIB 3DVNU 2KTRA 1V80A 4KDLB 2YVCA 4KSLC 3QA8A 3PHXB 1OTRB 2K6QA 1YX6B 2C9WB 3M3JA 2JZ3B 3N30A 4G50A 2FCNA 2IO0B 4HPMB 4KSKC 4NJ7A 2N9EB 2RPQA 2N7DA 3A1QB 3ECIA 4PS7A 3EC8A 3WAMA 2KJ6A 2C7HA 4NAWA 4ZDVA 3D32A 5KHOA 4HCPB 2UWQA 2J0KA 1UGMA 3A9JA 5LXHA 5AZGA 4GGQA 2IO2B 1MG8A 3AU4A 2ZZPB 3IG3A 2BWES 4JLCA 2CHZA 3VUXA 4EKUA 2OOBB 4W9GA 1OEYJ 2V4LA 1ZGUB 1X1MA 2MP2A 4MGIE 4AJYB 1OQYA 1YX5B 3L17A 2AL6A 3HHMA 4GDLA 5L83A 1UD7A 4G3XB 3OAWA 4B95A 1UBQA 1YQBA 3BINA 2K1FA 2FCSA 2NBUA 3EFUA 2KK8A 3VUWA 4EZJA 2RGFA 3SDLC 2MQJA 4P7IA 4EZKA 3U8ZA 4A20A 1YIWA 4K7SA 2JRIB 2KLGA 2AWTA 1WE7A 1WJNA 2A4ZA 2MSED 3A4RA 2JY6A 3ZW3A 2WWZA 3A9KB 4MH0E 4WWOA 3KH0A 3RZWC 4DHJD 5JH5C 5DCNA 2LGYA 2BYVE 2J0MA 1SGHA 5D2MB 1WI0A 1XT9B 2XEWA 3UF8A 2KX3A 2LGDA 2LZ6A 2A5UA 2NPTA 4WAAA 2KMCA 3M63B 5TR5A 4URKA 3ALBA 3TJPA 2FAZA 4BBNF 4ICUA 4ZRKA 3DVGY 2O2VA 2KFKB 2BKRB 2FIFA 4MGKE 1L7YA 2LVPA 3B1LX 4MGZE 4ZYNA 2MCNB 4KIKB 3HIZA 3NZSA 1WRDB 3IBEA 1UBIA 4OVVA 5CX3A 3X23A 1WZ0A 3PSEB 4WWPA 3APFA 3VH3B 3VAWA 3VXWA 1C3TA 1BT0A 2KTRB 1WJ6A 4W9JA 2JT4B 4KDIC 4OVUA 1QZEA 4KZCA 2MBQA 3QK0A 4AJWA 5JZEB 5GMVA 1WJ4A 1XD3B 2CR5A 2N1WA 3L54A 2D10A 2M1MA 2C7NB 1E7UA 4IM2A 4I6NB 2NCNA 3MTNB 2DYMA 1A5RA 3U7DA 3M62B 2LVQA 4NY0A 3PRPB 1WXMA 2MW5A 3A9JB 3K9OB 1P0RA 2N4FA 2KN5A 5CHWA 3B08A 3U30A 1FXTB 3SHQA 3UIPB 2YLMA 2K39A 2CHWA 3AXCA 2ZCCA 3V60A 2MP2B 3UIOB 3T9LA 1SIFA 2JF5A 3IFWB 1KLVA 1VD2A 4MJSA 5JHAA 3RT3B 4IM3A 3W1SC 2KC1A 2DX5B 3NHEB 3TCAA 3H1UA 5CHVC 1WM2A 4ANXA 1WJUA 2O6VB 3MJWA 2CU1A 3ONSA 1YD8U 4TQ1A 1E90A 1Y8RC 2DENB 3L10B 2JPHA 3A33B 4DHZB 2XK5A 2L0FA 1I35A 3ZTDA 4NPNA 2JUOA 3QIJA 3AU5A 4AP4C 4I6PA 4ASWC 5J18A 1UZXB 4DDID 1IYFA 3VUYA 3JVZX 2C5LC 3R7RA 4MGYE 2DZKA 2ZVNA 4IUMB 4E74A 1WXAA 3DCGA 3PVLA 5J17A 1V9JA 5DPTA 4WJQA 3NOBA 1I42A 4FJZA 2KHWB 4W9DA 1GG3A 2LD9A 3H7PA 3JW0X 2K8BA 4W9HA 1KJTA 3ZDMC 3JYUA 3HM3A 3NZUA 3GOEA 4K7UA 3ZNGC 4GN1A 4I6LB 3PRMB 2BPSA 1KOTA 2O2VB 3AI5A 4GU2A 4B9KA 4E71A 3DBHI 4HLEA 2KWCA 3DOWA 3VFKA 1H4RA 4M0WB 2DZJA 4MELA 1WX7A 4IM0A 2G4DB 4W9FA 3RZFA 5AEKB 4LJPB 4TQ0A 2REXA 2VRRB 1RLFA 1WYWB 2CKHB 3KW5B 5J2RA 1IP9A 2N1VA 4FJVB 1KM7A 2KFJA 2KZRA 2R2QA 4W9CA 2PPHA 1G6JA 1WXSA 3H7SA 2L7RA 2ZJDA 1R4MI 2OJRA 4A3PA 1EF5A 1HE8A 2L76A 1Q1OA 1LQBA 2AYOB 2LXCA 3ML9A 2DZIA 4HXDA 3ZDTA 2KC2A 4GB9A 3KUCB 2DYOA 1WMHB 1WE6A 1YJ1A 4PS3A 1AARA 1WY8A 3ZUNA 2MX2A 2FNJB 2KTFA 1OEYA 5CHFA 4F1SA 2IBIB 2N9XA 2GMIC 2K8CA 2G3QB 2LI5A 1P9DU 3KYDD 2V3SA 4F7ZA 2KQSA 4BKTA 3VQIA 1WX9A 3Q3JA 3T8MA 4EUTA 2KO3A 4KZ0A 2D07B 1JRUA 1PQSA 2C7MB 3NS8A 3RYTA 2GBKA 3DPDA 3PPAA 3DBRI 2K6DB 2FIDA 4GDKA 4HVBA 2PE6B 3APDA 2N9PC 4RMAA 2EMTA 2BYEA 3W1YA 3ZNID 4W9LA 3V62A 2L3ZA 3H6NA 2B3AA 2KWUB 5L95C 3Q3FA 1WX8A 2WYQA 3W1SA 1NDDA 1L2NA 5IA7A 2HE7A 3CMMB 3LJ3A 2DYBA 3H7PB 4CO7A 2LXAA 3V6EB 1E7VA 1WR1A 4HWIB 4WWNA 3V6CB 3DBLI 3VTUA 5AZHA 2MBBB 2Z0DB 2CHXA 3PT2B 4AWJA 4NQKE 2KDEB 1E8ZA 2J0JA 3QX1A 4PYUA 4ANVA 2LGXA 3CSTA 3UQAA 4ICVA 4XZ4A 4BOSC 2IO1B 2KVRA 2LASA 2FCQA 2MBEA 5G55A 4KV2A 3S2AA 1EF1A 4DHJB 3K9PB 4NAWB 2NBWB 3OJ4B 3TIXA 2W9NA 4G11A 4W9KA 3ZTCA 1U4AA 1H8CA 2GBRA 4HDQA 5C1ZA 2KDFB 2KQ7A 3VHTC 1C1YB 2MLBA 2C60A 5KHQA 2MBHA 4HDOA 2R2OA 3V61A 1V5TA 4GDLB 5E6NA 4B6WA 2LRWA 2KOXA 2PJHA 3QHTA 4M8NA 3R66C 1ZKHA 4HK2A 3DDCB 3QQ8B 3QWZB 4WQOB 2DAFA 2KXJA 2WX1A 3PZDA 2KX0A 4II3B 1CMXB 5LXIB 1V6EA 4DXAB 3DBSA 2LWPA 2ZPYA 2K8HA 2J7QB 3HM6X 4WJPA 5EDSA 3DVNV 1GC7A 1WGGA 4FHJA 2MRPA 2D11A 4IWPA 2M8SA 4JL9A 3ZNZB 2MA9B 5DPWA 1ISNA 3PRZA 3H9DA 2NPTB 3DVGX 4N9F4 3SD5A 4DDGD 3KVFB 3QARA 2KLCA 3IHPC 5LLIA 3I3TB 4EZLA 2LUEA 4BKGA 4TUUA 3ZO5B 3RD2A 3PGEA 4DWFA 3VTWA 2KD0A 4NNJB 4A3OA 5C23A 4CYEA 3ML8A 1LXDA 3PV1A 2FCMA 3LDZE 3JSVA 5E6OA 2ZNVB 4K81A 2IO3B 3ZRCA 3N32A 4JIOU 4WJOA 2GBNA 2M0XA 2I1JA 2KANA 1E8WA 4IC7B 4KIKA 4RM9A 1LM8B 5HKHA 2Z59B 1WGYA 1EUVB 1V86A
chains in the Genus database with same CATH superfamily
4N58A 3PREA 2BYFA 2HTHA 3RNEC 2NVUI 1P3QU 4LJOB 2BTEA 3AV8A 4OHJA 2EKEC 3BWUD 2ZPNA 4CHKA 5DPRA 4ZRJA 2KDIA 2KN4A 2Y5BB 3P42A 1WXVA 4RM8A 3NRZA 3AMZA 1DYQA 1TBEA 4ZRPA 2KDBA 1JWMD 2RSUA 3QJZA 1XLOA 2IY0B 1JWAD 1NYRA 3WA0A 4BAXA 1VCBA 2HJ8A 2SEBD 2XK5B 1T0YA 2ONQA 2V3NA 2L32A 3GZNI 3ZLZA 3UQBA 2JVCA 4ZOHC 2AL3A 1FNUA 4E3CA 2QEJC 3Q3OC 1WFYA 2WXRA 1V1PA 5BMGA 1RRBA 2WU2B 5FR6A 1UNSA 4GMVA 2DAJA 2D5GA 2PKOA 4BKSA 4M00A 2LHDA 3O65B 5G2NA 4XDDA 2X38A 3OLMD 2AQ1B 4XX5A 3ZVVA 2Z8LA 3KWVA 4FJYA 2O6VD 1OGWA 1HTOA 3BK2A 3DQVA 3A1QA 1V5OA 1UWMA 4W9EA 1JMLA 3LYYA 3N20C 4S17A 3RNAC 3VVWB 1GJZA 4FBJB 1C4CA 3DBRB 3VRAB 1TYGB 4BOZB 4HKZE 2G1EA 1E7PB 2PTLA 3I57A 5AZFA 5JHBA 1WMHA 1RFKA 4BFRA 1NI2A 2JWZA 2MHJA 1WZ3A 4LTUA 2JRHA 3R7QA 3TEXA 3QAQA 2DLBA 1D5MC 1PUTA 4EOYA 1RFAA 3MC9A 4BVUC 4AOFA 3A9KA 4MT5A 2KJRA 3U4EG 2DHZA 4G0NB 3ZNHB 2BQQA 1WYGA 3RCZA 1QT9A 1LGRA 3NZ3A 1GUAB 1ZW7A 4PS8A 2BS4B 2YVCA 3QA8A 4IDIA 5AUKA 1QKZA 3N30A 5HG2A 4G50A 2FCNA 5IOIA 4A55A 3D32A 1DOIA 2LFIA 2UWQA 4EKUA 2BWES 4JWSC 2QDFA 1ZGUB 1X1MA 1K50A 1I4GA 2TSSA 2AL6A 3HHMA 4GDLA 1D5ZC 3N9YC 5L83A 2INNE 1UBQA 3EFUA 2WGSA 2M56B 4A6QA 2MQJA 3U8ZA 1C78A 2JRIB 1FXAA 1VJKA 3ZW3A 3OG5A 3RZWC 5JH5C 5D2MB 1TY2A 1FCLA 2A5UA 1K52A 4URKA 3U7ZA 3TJPA 1XLPA 2FAZA 2DNFA 2K9XA 4PK1A 2FIFA 4MGKE 1L7YA 4ZYNA 2MCNB 3HIZA 4FADA 3VXWA 3NG0A 1BT0A 2N0SB 1WGKA 2KTRB 3ZJVA 4W9JA 2JT4B 1QF6A 4OVUA 1SF0A 1XD3B 2CR5A 2N1WA 2D10A 5IP4D 2C7NB 1E7UA 3MTNB 1D4BA 3PZ8A 2WP9B 2LVQA 4NY0A 3PRPB 2MW5A 4CQNA 4C80A 3P1MA 3U30A 1FXTB 1HXYD 3VRBB 2WXPA 2CHWA 4NJCA 2J52A 5FKAC 3DHGC 4H2AA 1T0RC 4IM3A 2WS3B 2LMCA 2WDQB 2IGHA 3SR6A 1RYJA 1SEBD 1YD8U 4RNAA 1IUEA 1TS5A 2XK5A 1I35A 1WRIA 2JUOA 3AU5A 4I6PA 3NVVA 5AUIA 1IYFA 3R7RA 4ACFA 2ZVNA 4IUMB 1WXAA 5DPTA 4RCOA 4W9DA 3B9JA 4M01A 5IKCM 1SB3C 1ZDVA 3AI5A 3ZXVA 1VRAB 1C4PA 2INDC 2KACA 2KWCA 3NUHB 4M0WB 2Y5CA 2DZJA 4C4VB 1MJDA 4IM0A 2G4DB 3W5UB 4O1NA 2VRRB 5J2RA 1IP9A 4FJVB 2J42A 4W9CA 2PPHA 3AE4B 2QMTA 1GPXA 2ZJDA 1R4MI 4KGSA 4HRSA 2LXCA 4HXDA 1N5XA 1YJ1A 1I7HA 3Q8FA 5BMHA 4P1BC 4ZHPA 2MX2A 1SXTA 1OEYA 2GI9A 1PDXA 4BKTA 2KO3A 4KZ0A 2MJ3A 5JXVA 3IAS1 3HVZA 3NS8A 2PVOD 2V9HA 2VZKB 3DBRI 2FIDA 4HVBA 3W1YA 2L3ZA 1R4NB 5L95C 3Q3FA 1WX8A 1STEA 2M0AA 2HE7A 5EE3A 1ZXIA 2WDVB 3LJ3A 3DBHB 4BZAA 1YMHE 2LXAA 2YEPF 3P4PB 3Q6BA 1FIQA 2KAJA 2CHXA 3IXSA 2OJWA 3AEDB 3R2TA 4BOSC 2LASA 3BYTB 4KV2A 3DWGC 4DHJB 1TIFA 4NAWB 3OJ4B 2WXHA 2W9NA 4G11A 1H8CA 2LEKA 4A90A 2MBHA 4HDOA 2KOXA 4KGRA 4RGOS 4M8NA 3R66C 3Q8CA 2DAFA 3PZDA 1CMXB 3SFEB 3AE5B 4DXAB 1MFWA 4K3BA 3HM6X 4MH8A 4WJPA 1GC7A 1YN4A 2MRPA 4OZCA 1C79A 1T3QA 3DVGX 4DDGD 2KLCA 3AE1B 2LUEA 3RD2A 4A3OA 4KGTA 2NTSA 1MI0A 2ZNVB 2LHEA 2IO3B 3N32A 2GB1A 4WJOA 2MEKA 3TEYA 2I1JA 2KANA 1LM8B 5HKHA 1OFFA 1V86A 4US8A 3CSFA 4C7YA 1SE9A 4HROA 4FLHA 2MBOA 2R61A 3ENEA 3P2BA 3EECA 4IWQA 2WXLA 3TBLD 2V0GA 3WALA 3ZRFA 3L4PA 2W55A 3E9SA 5DPSA 1EO6A 2LVOA 2CS4A 4AUQC 3Q8BA 1D3ZA 1QLBB 4TV3A 3EHVA 1ZOYB 5H8YE 2BYTA 2RD0A 3L0WB 4ANWA 4JGHB 3ETRA 4EFOA 2UU7A 4IWOA 2MWSB 3B2FA 4N59A 2NBVB 2RDHA 4MM3A 1FFUA 3Q8EA 2VH2A 3KYCD 3JSVB 1XQQA 2K25A 4S0RA 3N3KB 3RN9C 3M95A 2WNMA 3SFDB 3IAM1 1SE3A 1WGRA 3NY5A 2KJHB 3P4SB 5LNK1 4MSQB 3QCAA 4FHKA 3PLUA 1WR6E 2M17A 1FNVA 1F2RC 2IPKD 4F8CB 4ZRQA 2JSVX 4GIVA 4KVGB 1BMLC 4BKSD 1KTKA 4GDKB 2QC8A 4RF1A 3NVZA 1TZ1A 4XYCA 1I4XA 2IYDB 2IJ0A 1BUIC 1P1AA 1A70A 1MPEA 3CF6E 3ZKJC 3GS2A 3WAOA 4WJNA 4ARIA 3CWIA 3UINB 2D2QA 2RR9A 2YEPB 2FUHB 4B0EA 3PHWB 4YT0B 4GXBA 2RPVA 3PS6A 2ZNVC 2UYZB 1R4NI 2J53A 2KFKA 1P98A 5IAAC 2WXNA 4K7WA 4C7ZA 2I2YA 3WIMA 2KKCA 3AEEB 2BF8B 1V80A 4KDLB 3PHXB 2K6QA 3GE3C 4WURA 3J9CA 4HPMB 2N9EB 2N7DA 4PS7A 4D2KA 4ZDVA 3WAMA 4NAWA 4HCPB 3A9JA 1UGMA 1M4VA 1YN3A 2IO2B 3AU4A 3VUXA 4JLCA 2AQ3B 2OOBB 1OEYJ 3V3XA 3C19A 4MGIE 4AJYB 1OQYA 3L17A 3NVWA 1UD7A 4NZLB 1EWYC 2K1FA 2NBUA 2INCC 3P63A 2KK8A 3KWLA 1JROA 1CJEA 4ZYSA 1Y56A 4EZKA 1MHXA 1YIWA 4K7SA 1WJNA 2MSED 2JY6A 4MH0E 4WWOA 1F2RI 3AN1A 3KH0A 5DCNA 2LGYA 2BYVE 2J0MA 1SGHA 3PZ7A 2LGDA 2K5PA 2PLPA 2BB6A 3M63B 4HPPA 5HFYA 1YN5A 1KRHA 5H92C 2BKRB 5CX3A 1D5XC 1WRDB 2BVCA 5DPWA 3AH7A 3ZGZA 1WZ0A 2WXJA 3APFA 2DWQA 4YXDB 4KDIC 1QZEA 4KZCA 2MBQA 1EM7A 4JX1C 2DYMA 1A5RA 3BK1A 1WXMA 3K9OB 2KN5A 5CHWA 1EU4A 1FM0D 3B08A 4RH6A 2K39A 1EU3A 3AXCA 2ZCCA 2MP2B 3UIOB 2NMQA 1FXIA 4B0MA 2FUG1 2KC1A 2DX5B 1IBXB 4ANXA 2JX5A 2K3UA 2L0FA 3ZTDA 1TS4A 3QIJA 4AP4C 4ASWC 3RNFC 1UZXB 3HRDD 3JVZX 2C5LC 1NEKB 1GOZA 3DCGA 5J17A 1I42A 1T0SC 1F52A 2Y3AA 1KJTA 1YJJA 3HM3A 3NZUA 3GOEA 4GN1A 4I6LB 1KOTA 2BPSA 2O2VB 4GU2A 4B9KA 3T3NA 2N9LA 3DOWA 3RMKC 1ZDXA 3ZXRA 1BXTA 1H4RA 1N5WA 4MELA 4WQMA 3RZFA 5AEKB 3AB5A 3Q14C 2K0PA 5HI1A 2REXA 1WYWB 2KZRA 2R2QA 1GB4A 1I4HA 1G6JA 2JU6X 2L7RA 2OJRA 2ON8A 3KLSX 1HE8A 1Q1OA 2AYOB 2BBCA 1WSPA 1XEEA 3KUCB 5MPOA 1TKEA 3SEBA 3EGRA 2D3BA 5BYQA 3FILB 3ZUNA 2FNJB 2KTFA 4F1SA 1XLQA 2K8CA 3Q69A 2G3QB 2LI5A 3AEFB 3KYDD 2V3SA 4FXCA 4JWUC 2KQSA 3VQIA 1B9RA 1JW9D 4OZAA 4YSYB 1N60A 2D07B 4EE2A 1VDVA 4GDKA 3DHIC 2PE6B 3APDA 4A9AA 2LGIA 2EMTA 3ZNID 1UWXA 4REZA 2B76B 1L2NA 1FO4A 2DYBA 3H7PB 4CO7A 1SJED 4HWIB 3W5VB 3V6CB 4AWJA 2J0JA 3QX1A 4PYUA 1AYFA 3S2AA 4XWTA 3K9PB 2EKIA 2NBWB 5EE1A 5KHQA 3V61A 5E6NA 2LRWA 3QHTA 1N6ZA 2Y5PA 3DDCB 3MC8A 2WX1A 4LNNA 2KX0A 4WAFA 3BIID 4PT5A 3DBSA 2CJNA 2LWPA 3EUB2 2K8HA 2J7QB 2V3PA 4MACA 2INPE 3DVNV 1WGGA 2WLBA 2QILA 2D11A 2M8SA 3Q3MC 4N9F4 3DBLB 3IHPC 5LLIA 1UF0A 2ZW1A 4BKGA 3PGEA 4DWFA 1ROEA 2PVGC 2MH7A 1E6EB 1VR9A 1I4RA 4JIOU 2ACZB 1GAQB 1ZUD2 4MEMA 2ZEQA 2V1YA 3APCA 4RFBA 2JXTA 3E56A 3NVYA 1PGAA 2WXOA 2PEAA 3AEAB 1HQRD 2BKFA 3DWMA 3TMPB 1Z2MA 1ESFA 1J8CA 1C9FA 4PYZA 5D6JB 3B2GA 3TEZA 4M02A 2HD5B 4NQLB 4IG7B 4LDTD 3A4SC 1SIJA 3PLVA 1L6UA 3ZIMA 1IBXA 5BMIA 1J19A 1IPGA 3KUDB 1B1ZA 1Q0WB 3VDZA 2QHOA 1V2YA 4DXGA 3TEWA 4YWGG 1S1QB 1GNUA 5D3IB 2BGFA 2D3GA 5CTRC 3P4QB 1RM6C 4YL8A 1E5WA 2J4XA 5E6PA 1WF9A 1SE4A 1WIAA 4FN2A 3SU8X 3VH4B 2OEDA 1FD6A 1UH6A 2LJ5A 4TSSA 4YSZB 1WWTA 2G4SA 4AQ7A 1NI3A 2Z0EB 1V49A 2XNAC 2N9KA 4EEWA 4J6IA 4P16A 3BYYB 2L8JA 3MP9A 2JQRB 2AEHA 1NBFC 3EFCA 1L0XB 3HK0A 3GZNB 2ZVOA 3FILA 3OJ3A 2L83A 3IT4B 2KVZA 2LJIA 2KMAA 2QCZA 4XC2A 4WIPA 2KNBA 1WGHA 4DBGA 2Q5WD 5D94A 5J18A 2IY1B 3BZDB 3X0WA 4P6VF 4LCDE 1RWSA 1E8XA 4IW0A 1SSNA 1L6VA 5D3DA 1F9JA 3L16A 4II2B 1D6EC 2JZZA 2IGGA 4HCNB 2BB5A 4XDCA 1R7SA 2I38A 4X57B 2RMMA 1GC6A 3VR9B 1M94A 1I4PA 2D3CA 3UGBB 1XCQL 3UI3A 1LFDA 3MHSD 1F0ZA 2KQ4X 3DVNU 2KTRA 2XN9C 4KSLC 3MC0B 4ITKA 4L1BA 5T8IA 1OTRB 4LNIA 1V97A 2RDGA 1CQVA 4RGTA 2JZ3B 1XLNA 3A1QB 3ECIA 2KJ6A 2C7HA 1JWUD 1TS2A 4KKIA 1Q10A 5KHOA 4ZHOA 4US9A 1L5PA 1QOGA 5LXHA 2LUMA 3AM9A 4GGQA 3PO0A 3N1ZC 5AZGA 2ZZPB 3IG3A 4LNKA 2CHZA 1TY0A 2KYWA 5I4DA 1YX5B 4WH4A 2VH1A 4G3XB 3OAWA 4B95A 3BINA 2FCSA 1JRPA 2WXGA 3VUWA 4EZJA 3SDLC 1WE7A 2A4ZA 3A4RA 2BS2B 2WWZA 3A9KB 4DHJD 3FKYA 3RPFC 2XEWA 5BYRA 4WAAA 1P7EA 2KMCA 1TT5B 1XO3A 3ALBA 4L23A 4BBNF 2WXKA 3MJ5A 4N6EB 4ICUA 1FMAD 3RNCC 2LVPA 3B1LX 4KIKB 3NZSA 3IBEA 1UBIA 3X23A 3I5JC 3VH3B 4M0WA 2MJDA 4C4VA 1C3TA 1WJ6A 1C4AA 4AJWA 1JCKB 1N63A 3ABVB 5GMVA 1DOYA 3L54A 4IM2A 2NCNA 2WU5B 3M62B 2AQ2B 1P0RA 3SHQA 3UIPB 2YLMA 3Q2AC 5FR3A 4KX6B 3W2DA 3V60A 3T9LA 2JF5A 5JHAA 1CZPA 2W3SA 3NHEB 4JE3B 3H1UA 5CHVC 1WM2A 2O6VB 3MJWA 1YQ3B 3ONSA 1E90A 2DENB 2M19A 4DHZB 1KF6B 4LLGM 3BVZA 2WHIA 4DDID 3VUYA 3C8YA 5E6JA 4MGYE 3NOBA 2KHWB 3AE2B 1GG3A 2LD9A 3JW0X 3ZDMC 3ZJTA 3ZNGC 3Q8AA 4E71A 3DBHI 1AWDA 1EWCA 3BVMA 4HLEA 1SJHD 1MHHE 5TSSA 4C56C 1WX7A 2WXQA 4LJPB 4TQ0A 3HUIA 1RLFA 1ZP0B 2CKHB 3KW5B 1KM7A 2HTME 1QILA 1EF5A 3ZDTA 2X8XX 3ML9A 4YTNB 2KC2A 4PS3A 1WY8A 5BYSA 5CHFA 2N9XA 1P7FA 1UUPA 2GMIC 3U2SC 3NJTA 2OHFA 1WX9A 4GLSC 2C7MB 3DPDA 3PPAA 4YSXB 1TKYA 3IT6B 1F1HA 2N9PC 1KLUD 4W9LA 1C76A 3R8BA 3H6NA 2KWUB 5IA7A 3CMMB 2FBWB 3BVGA 2HDEA 3V6EB 1E7VA 1NENB 1E9MA 1WR1A 3VTUA 3GP7A 2KDEB 3FAHA 3EA6A 4L2YA 3CSTA 3URYA 4XZ4A 1T0QC 2IO1B 2FCQA 5G55A 1K53A 1VZ8A 1R4MB 3H8HA 4HKQA 3TIXA 4W9KA 1U4AA 1YJIA 2GBRA 4HDQA 5C1ZA 2KDFB 3RNGC 1FCCC 5FK9C 1SE2A 2C60A 2PIAA 4P1CC 4B6WA 1DGJA 1ZKHA 3QQ8B 4WQOB 1NYQA 2RDBC 5EE9A 2EELA 1YOVB 3MHZA 2ZPYA 5EDSA 2CJOA 4FHJA 4RGMA 4J3OD 3ZNZB 2MA9B 1ISNA 3PRZA 3H9DA 1NVID 2NPTB 2BW2A 3KQ4A 1JWSD 3KVFB 3QARA 3TUOA 3ZO5B 2IDYA 1N61A 3FC4A 1QOBA 2KD0A 4NNJB 1KLGD 4CYEA 3PV1A 2FCMA 3JSVA 5E6OA 3ZRCA 2MJEA 2WXIA 1E8WA 4KIKA 2Z59B 2JYEA 1E0ZA 3N1XC 2GOWA 3WANA 2L00B 2KMMA 1YNTE 2HJ1A 3QC8B 3RNBC 3LXFA 4YTMB 1TGZB 4MJSB 2WQYB 4JQWC 4YTPB 5C3JB 4XE0A 3V05A 1PGXA 4FULA 1ENFA 1WXQA 4C00A 2JWUA 3RULA 3AECB 4ANUA 2KWVB 1E8YA 4HPLB 2ICIA 2O6VA 3BY4B 1T6BX 5G5HA 2XBBC 4GSWA 2L0TA 2W3RA 2FE8A 2ZCBA 1K8RB 2GBMA 5D7GA 1Q5WB 2L05A 3B0AA 4TKNA 1E10A 2NS5A 4IOIE 3C0RB 2DZMA 2BWFA 1UELA 4NAMA 4M8MA 5C2TB 2WDTB 4XWWA 4ZRIA 4K3CA 4IKGA 3L13A 3VTVA 1V81A 1J7AA 3AULA 4DK5A 2JXXA 2LGSA 2NTTA 3KUZA 4LDTB 1GB1A 5HHDG 2IGDA 2GBJA 2I1KA 1WH3A 3L08A 4MSMB 5BO4B 3PTFC 4HJKA 3U52E 1HTQA 1AN8A 1J0GA 4W9IA 1Z5SB 1YQ4B 4K1RB 2E3TA 1HZ6A 4OVZA 2WX0A 3TL5A 2NR2A 3AE6B 2KDMA 4RGNA 2M4NA 1S3SG 4BBNC 3WAPA 1RAXA 3IVFA 3NS1A 2PE9A 2JZPA 1WM3A 3R3MA 3AE7B 1IGDA 2IZVB 2L1AA 2N7EA 5IN7A 3MFGA 2LRUA 2G45B 2ASQA 4MDKE 3N1YC 4MM3B 1QOFA 1T5XD 1TTNA 1KFYB 4NJ6A 4GOCA 2EMSA 2V4IB 4FA6A 4DHZE 3WCQA 1WGDA 3RUIB 2BT6A 1FRRA 1YX6B 2C9WB 3M3JA 2IO0B 4KSKC 4NJ7A 4RF0A 2RPQA 3EC8A 2BS3B 1OQQA 2WDRB 2J0KA 4LNOA 1MG8A 4W9GA 4WWMA 2V4LA 2G9HD 2GRIA 2MP2A 2E6XA 4OZBA 1V1OA 1JWBD 4JPSA 1XF5L 2CU3A 1YQBA 3I9V1 1J7BA 2PW9A 1QOAA 2RGFA 3RFZB 4P7IA 4A20A 2KLGA 2AWTA 1HZ5A 1MG4A 3GB1A 2L52A 4R3DA 4ARCA 3T3OA 1WI0A 1XT9B 3UF8A 2KX3A 2LZ6A 2NPTA 2QSDA 5TR5A 3TSSA 1VZ6A 4ZRKA 3DVGY 2O2VA 2KFKB 1XXGA 4MGZE 4OVVA 3PSEB 4WWPA 5GXGB 3VAWA 4KKJA 2QIEB 1ET9A 4DQOC 5JZEB 3QK0A 2GLSA 1HA5A 1L0YB 1WJ4A 1FEHA 2M1MA 4I6NB 1FRDA 4QAYA 3U7DA 3A9JB 3P4RB 3GE8C 2N4FA 4LNFA 3O13A 1IGCA 5IO9A 1FPYA 1SIFA 3IFWB 1KLVA 1VD2A 4MJSA 3RT3B 1PFDA 3I63C 3W1SC 3TCAA 3ZJUA 4HJGE 1WJUA 1ET6A 4HEA1 3W9CB 2CU1A 4TQ1A 1Y8RC 3L10B 2JPHA 3AEGB 1DOXA 1V1PB 3A33B 4UDUC 1ZE3D 1CK1A 3R2IA 1SBBB 4NPNA 3ZYYX 4DXFA 4E74A 2DZKA 3PVLA 1V9JA 4WJQA 1C77A 4FJZA 3H7PA 4W9HA 2K8BA 3JYUA 4Q2JA 1FNWA 4K7UA 3PRMB 2PMVA 3RI7C 1ACCA 1JQ4A 1L0VB 1HEZE 3VFKA 3Q3NC 3DHHC 4W9FA 2VZKD 2N1VA 2KFJA 1WXSA 3H7SA 1I4QA 4A3PA 2L76A 1LQBA 2JYTA 2DZIA 4GB9A 1JALA 2DYOA 2W82A 1WMHB 1WE6A 4USAA 3HVDA 1AARA 1L4ZB 2IBIB 2W54A 1P9DU 4F7ZA 3Q3JA 3AEBB 3T8MA 4EUTA 3AE3B 1JRUA 1PQSA 1FFVA 5G5GA 3RYTA 2GBKA 3AE8B 2K6DB 1ZPSA 4RMAA 2BYEA 4XGAB 1PGBA 2WXMA 3LB8C 4AS1A 3V62A 1K51A 2B3AA 2WYQA 3W1SA 1NDDA 2ZW0A 2K22A 1LO5D 2D3AA 4WWNA 1QQRA 3DBLI 5AZHA 2MBBB 2Z0DB 3PT2B 1TJEA 4NQKE 4TMAB 1TKGA 1E8ZA 1XCTL 3AE9B 4ANVA 2LGXA 1TZOA 3UQAA 1VZ7A 4ICVA 2KVRA 2MBEA 3ZQ4A 1EF1A 1J7CA 3VR8B 3ZTCA 2AX5A 1VLBA 2QJLA 1L4DB 2KQ7A 3VHTC 1PYWD 1C1YB 2MLBA 4OW0A 4A8XC 2R2OA 1V5TA 3OWEB 4GDLB 2PJHA 1UGJA 1N62A 4HK2A 3QWZB 2H89B 2KXJA 4II3B 5LXIB 1OQRA 1V6EA 1V8CA 1F77A 5EE0A 2H88B 2DBYA 1TS3A 1KH0A 2WXFA 4IWPA 4JL9A 1MVKA 2KWDA 2SAKA 3SD5A 4LK0M 4EZLA 3I3TB 4TUUA 3VTWA 3CIRB 5C23A 1AW7A 3ML8A 1LXDA 3LDZE 1ZXHA 2N7JA 2KT7A 4K81A 2GBNA 2M0XA 4RM9A 4IC7B 1WGYA 1EUVB
chains in the Genus database with same CATH topology
4MEMA 2ZEQA 2V1YA 2GOWA 3CSFA 3PREA 2BYFA 3APCA 2HTHA 3WANA 2L00B 2NVUI 1P3QU 4LJOB 3QC8B 1SE9A 2EKEC 2PEAA 2ZPNA 2BKFA 4CHKA 5DPRA 3TMPB 1TGZB 1Z2MA 2MBOA 2KDIA 3ENEA 4FLHA 4MJSB 3P2BA 4JQWC 4ZRJA 1J8CA 3EECA 4IWQA 2Y5BB 1WXVA 4PYZA 4RM8A 3TBLD 3WALA 1TBEA 5D6JB 2KDBA 3ZRFA 5DPSA 4FULA 1EO6A 2RSUA 2LVOA 2CS4A 3QJZA 2HD5B 2IY0B 3WA0A 4AUQC 1VCBA 2HJ8A 2XK5B 1D3ZA 4NQLB 4IG7B 4LDTD 3A4SC 1T0YA 3RULA 4TV3A 4ANUA 3EHVA 2KWVB 1E8YA 3GZNI 3PLVA 4HPLB 3ZIMA 1J19A 1IPGA 3ZLZA 3UQBA 2JVCA 2O6VA 2AL3A 2RD0A 3BY4B 3KUDB 1Q0WB 4E3CA 2XBBC 3L0WB 4GSWA 2L0TA 2QHOA 3VDZA 4ANWA 1V2YA 1WFYA 2ZCBA 1K8RB 4JGHB 1RRBA 2GBMA 5D7GA 1Q5WB 2L05A 1S1QB 4EFOA 3B0AA 4TKNA 5FR6A 4IWOA 2MWSB 1GNUA 2NS5A 2BGFA 4GMVA 2D3GA 5CTRC 3C0RB 2DZMA 2DAJA 2NBVB 2BWFA 1UELA 4MM3A 4M8MA 2WDTB 4BKSA 4ZRIA 4YL8A 1E5WA 3O65B 3L13A 3KYCD 1V81A 3VTVA 3AULA 5E6PA 3JSVB 5G2NA 2JXXA 3KUZA 4DK5A 1XQQA 2K25A 4LDTB 1WF9A 3N3KB 1WIAA 3M95A 3OLMD 4FN2A 1WGRA 2GBJA 3NY5A 3SU8X 3VH4B 2I1KA 1WH3A 2KJHB 4XX5A 3L08A 4MSMB 3ZVVA 4FJYA 2O6VD 1OGWA 4MSQB 5BO4B 3DQVA 3QCAA 3A1QA 1V5OA 2LJ5A 1UH6A 3PTFC 3PLUA 4FHKA 4HJKA 4W9EA 2G4SA 3VVWB 1GJZA 1WR6E 2Z0EB 4FBJB 1V49A 2M17A 1J0GA 4W9IA 4EEWA 4J6IA 4F8CB 4BOZB 1Z5SB 5AZFA 2L8JA 4GIVA 2AEHA 1NBFC 4KVGB 5JHBA 1WMHA 4K1RB 4BKSD 4BFRA 1NI2A 3HK0A 2ZVOA 4GDKB 3OJ3A 2JWZA 1WZ3A 2WX0A 1TZ1A 2KMAA 3TL5A 2JRHA 2IYDB 3R7QA 3QAQA 4XC2A 2NR2A 1P1AA 2KNBA 4EOYA 1WGHA 2M4NA 1RFAA 1S3SG 4DBGA 4BBNC 3CF6E 3ZKJC 3WAPA 3WAOA 4WJNA 5D94A 1RAXA 3IVFA 2IY1B 2PE9A 4BVUC 4FADA 3X0WA 4AOFA 3UINB 1WM3A 2D2QA 2RR9A 4LCDE 3R3MA 1E8XA 3A9KA 2FUHB 4IW0A 2KJRA 3PHWB 2IZVB 4GXBA 2N7EA 1F9JA 3L16A 4II2B 2JZZA 2DHZA 4HCNB 2LRUA 2G45B 2ASQA 3PS6A 4MDKE 4X57B 2ZNVC 4G0NB 1GC6A 3ZNHB 2UYZB 1M94A 1TTNA 1R4NI 4NJ6A 4GOCA 2EMSA 2KFKA 3RCZA 1P98A 4FA6A 5IAAC 4DHZE 3UGBB 4K7WA 1LFDA 1GUAB 1ZW7A 3WIMA 3MHSD 2KKCA 4PS8A 1WGDA 2BF8B 3RUIB 3DVNU 2KTRA 1V80A 4KDLB 2YVCA 4KSLC 3QA8A 3PHXB 1OTRB 2K6QA 1YX6B 2C9WB 3M3JA 2JZ3B 3N30A 4G50A 2FCNA 2IO0B 4HPMB 4KSKC 4NJ7A 2N9EB 2RPQA 2N7DA 3A1QB 3ECIA 4PS7A 3EC8A 3WAMA 2KJ6A 2C7HA 4NAWA 4ZDVA 3D32A 5KHOA 4HCPB 2UWQA 2J0KA 1UGMA 3A9JA 5LXHA 5AZGA 4GGQA 2IO2B 1MG8A 3AU4A 2ZZPB 3IG3A 2BWES 4JLCA 2CHZA 3VUXA 4EKUA 2OOBB 4W9GA 1OEYJ 2V4LA 1ZGUB 1X1MA 2MP2A 4MGIE 4AJYB 1OQYA 1YX5B 3L17A 2AL6A 3HHMA 4GDLA 5L83A 1UD7A 4G3XB 3OAWA 4B95A 1UBQA 1YQBA 3BINA 2K1FA 2FCSA 2NBUA 3EFUA 2KK8A 3VUWA 4EZJA 2RGFA 3SDLC 2MQJA 4P7IA 4EZKA 3U8ZA 4A20A 1YIWA 4K7SA 2JRIB 2KLGA 2AWTA 1WE7A 1WJNA 2A4ZA 2MSED 3A4RA 2JY6A 3ZW3A 2WWZA 3A9KB 4MH0E 4WWOA 3KH0A 3RZWC 4DHJD 5JH5C 5DCNA 2LGYA 2BYVE 2J0MA 1SGHA 5D2MB 1WI0A 1XT9B 2XEWA 3UF8A 2KX3A 2LGDA 2LZ6A 2A5UA 2NPTA 4WAAA 2KMCA 3M63B 5TR5A 4URKA 3ALBA 3TJPA 2FAZA 4BBNF 4ICUA 4ZRKA 3DVGY 2O2VA 2KFKB 2BKRB 2FIFA 4MGKE 1L7YA 2LVPA 3B1LX 4MGZE 4ZYNA 2MCNB 4KIKB 3HIZA 3NZSA 1WRDB 3IBEA 1UBIA 4OVVA 5CX3A 3X23A 1WZ0A 3PSEB 4WWPA 3APFA 3VH3B 3VAWA 3VXWA 1C3TA 1BT0A 2KTRB 1WJ6A 4W9JA 2JT4B 4KDIC 4OVUA 1QZEA 4KZCA 2MBQA 3QK0A 4AJWA 5JZEB 5GMVA 1WJ4A 1XD3B 2CR5A 2N1WA 3L54A 2D10A 2M1MA 2C7NB 1E7UA 4IM2A 4I6NB 2NCNA 3MTNB 2DYMA 1A5RA 3U7DA 3M62B 2LVQA 4NY0A 3PRPB 1WXMA 2MW5A 3A9JB 3K9OB 1P0RA 2N4FA 2KN5A 5CHWA 3B08A 3U30A 1FXTB 3SHQA 3UIPB 2YLMA 2K39A 2CHWA 3AXCA 2ZCCA 3V60A 2MP2B 3UIOB 3T9LA 1SIFA 2JF5A 3IFWB 1KLVA 1VD2A 4MJSA 5JHAA 3RT3B 4IM3A 3W1SC 2KC1A 2DX5B 3NHEB 3TCAA 3H1UA 5CHVC 1WM2A 4ANXA 1WJUA 2O6VB 3MJWA 2CU1A 3ONSA 1YD8U 4TQ1A 1E90A 1Y8RC 2DENB 3L10B 2JPHA 3A33B 4DHZB 2XK5A 2L0FA 1I35A 3ZTDA 4NPNA 2JUOA 3QIJA 3AU5A 4AP4C 4I6PA 4ASWC 5J18A 1UZXB 4DDID 1IYFA 3VUYA 3JVZX 2C5LC 3R7RA 4MGYE 2DZKA 2ZVNA 4IUMB 4E74A 1WXAA 3DCGA 3PVLA 5J17A 1V9JA 5DPTA 4WJQA 3NOBA 1I42A 4FJZA 2KHWB 4W9DA 1GG3A 2LD9A 3H7PA 3JW0X 2K8BA 4W9HA 1KJTA 3ZDMC 3JYUA 3HM3A 3NZUA 3GOEA 4K7UA 3ZNGC 4GN1A 4I6LB 3PRMB 2BPSA 1KOTA 2O2VB 3AI5A 4GU2A 4B9KA 4E71A 3DBHI 4HLEA 2KWCA 3DOWA 3VFKA 1H4RA 4M0WB 2DZJA 4MELA 1WX7A 4IM0A 2G4DB 4W9FA 3RZFA 5AEKB 4LJPB 4TQ0A 2REXA 2VRRB 1RLFA 1WYWB 2CKHB 3KW5B 5J2RA 1IP9A 2N1VA 4FJVB 1KM7A 2KFJA 2KZRA 2R2QA 4W9CA 2PPHA 1G6JA 1WXSA 3H7SA 2L7RA 2ZJDA 1R4MI 2OJRA 4A3PA 1EF5A 1HE8A 2L76A 1Q1OA 1LQBA 2AYOB 2LXCA 3ML9A 2DZIA 4HXDA 3ZDTA 2KC2A 4GB9A 3KUCB 2DYOA 1WMHB 1WE6A 1YJ1A 4PS3A 1AARA 1WY8A 3ZUNA 2MX2A 2FNJB 2KTFA 1OEYA 5CHFA 4F1SA 2IBIB 2N9XA 2GMIC 2K8CA 2G3QB 2LI5A 1P9DU 3KYDD 2V3SA 4F7ZA 2KQSA 4BKTA 3VQIA 1WX9A 3Q3JA 3T8MA 4EUTA 2KO3A 4KZ0A 2D07B 1JRUA 1PQSA 2C7MB 3NS8A 3RYTA 2GBKA 3DPDA 3PPAA 3DBRI 2K6DB 2FIDA 4GDKA 4HVBA 2PE6B 3APDA 2N9PC 4RMAA 2EMTA 2BYEA 3W1YA 3ZNID 4W9LA 3V62A 2L3ZA 3H6NA 2B3AA 2KWUB 5L95C 3Q3FA 1WX8A 2WYQA 3W1SA 1NDDA 1L2NA 5IA7A 2HE7A 3CMMB 3LJ3A 2DYBA 3H7PB 4CO7A 2LXAA 3V6EB 1E7VA 1WR1A 4HWIB 4WWNA 3V6CB 3DBLI 3VTUA 5AZHA 2MBBB 2Z0DB 2CHXA 3PT2B 4AWJA 4NQKE 2KDEB 1E8ZA 2J0JA 3QX1A 4PYUA 4ANVA 2LGXA 3CSTA 3UQAA 4ICVA 4XZ4A 4BOSC 2IO1B 2KVRA 2LASA 2FCQA 2MBEA 5G55A 4KV2A 3S2AA 1EF1A 4DHJB 3K9PB 4NAWB 2NBWB 3OJ4B 3TIXA 2W9NA 4G11A 4W9KA 3ZTCA 1U4AA 1H8CA 2GBRA 4HDQA 5C1ZA 2KDFB 2KQ7A 3VHTC 1C1YB 2MLBA 2C60A 5KHQA 2MBHA 4HDOA 2R2OA 3V61A 1V5TA 4GDLB 5E6NA 4B6WA 2LRWA 2KOXA 2PJHA 3QHTA 4M8NA 3R66C 1ZKHA 4HK2A 3DDCB 3QQ8B 3QWZB 4WQOB 2DAFA 2KXJA 2WX1A 3PZDA 2KX0A 4II3B 1CMXB 5LXIB 1V6EA 4DXAB 3DBSA 2LWPA 2ZPYA 2K8HA 2J7QB 3HM6X 4WJPA 5EDSA 3DVNV 1GC7A 1WGGA 4FHJA 2MRPA 2D11A 4IWPA 2M8SA 4JL9A 3ZNZB 2MA9B 5DPWA 1ISNA 3PRZA 3H9DA 2NPTB 3DVGX 4N9F4 3SD5A 4DDGD 3KVFB 3QARA 2KLCA 3IHPC 5LLIA 3I3TB 4EZLA 2LUEA 4BKGA 4TUUA 3ZO5B 3RD2A 3PGEA 4DWFA 3VTWA 2KD0A 4NNJB 4A3OA 5C23A 4CYEA 3ML8A 1LXDA 3PV1A 2FCMA 3LDZE 3JSVA 5E6OA 2ZNVB 4K81A 2IO3B 3ZRCA 3N32A 4JIOU 4WJOA 2GBNA 2M0XA 2I1JA 2KANA 1E8WA 4IC7B 4KIKA 4RM9A 1LM8B 5HKHA 2Z59B 1WGYA 1EUVB 1V86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEM A;  2ZEQ A;  2V1Y A;  2GOW A;  3CSF A;  3PRE A;  2BYF A;  3APC A;  2HTH A;  3WAN A;  2L00 B;  2NVU I;  1P3Q U;  4LJO B;  3QC8 B;  1SE9 A;  2EKE C;  2PEA A;  2ZPN A;  2BKF A;  4CHK A;  5DPR A;  3TMP B;  1TGZ B;  1Z2M A;  2MBO A;  2KDI A;  3ENE A;  4FLH A;  4MJS B;  3P2B A;  4JQW C;  4ZRJ A;  1J8C A;  3EEC A;  4IWQ A;  2Y5B B;  1WXV A;  4PYZ A;  4RM8 A;  3TBL D;  3WAL A;  1TBE A;  5D6J B;  2KDB A;  3ZRF A;  5DPS A;  4FUL A;  1EO6 A;  2RSU A;  2LVO A;  2CS4 A;  3QJZ A;  2HD5 B;  2IY0 B;  3WA0 A;  4AUQ C;  1VCB A;  2HJ8 A;  2XK5 B;  1D3Z A;  4NQL B;  4IG7 B;  4LDT D;  3A4S C;  1T0Y A;  3RUL A;  4TV3 A;  4ANU A;  3EHV A;  2KWV B;  1E8Y A;  3GZN I;  3PLV A;  4HPL B;  3ZIM A;  1J19 A;  1IPG A;  3ZLZ A;  3UQB A;  2JVC A;  2O6V A;  2AL3 A;  2RD0 A;  3BY4 B;  3KUD B;  1Q0W B;  4E3C A;  2XBB C;  3L0W B;  4GSW A;  2L0T A;  2QHO A;  3VDZ A;  4ANW A;  1V2Y A;  1WFY A;  2ZCB A;  1K8R B;  4JGH B;  1RRB A;  2GBM A;  5D7G A;  1Q5W B;  2L05 A;  1S1Q B;  4EFO A;  3B0A A;  4TKN A;  5FR6 A;  4IWO A;  2MWS B;  1GNU A;  2NS5 A;  2BGF A;  4GMV A;  2D3G A;  5CTR C;  3C0R B;  2DZM A;  2DAJ A;  2NBV B;  2BWF A;  1UEL A;  4MM3 A;  4M8M A;  2WDT B;  4BKS A;  4ZRI A;  4YL8 A;  1E5W A;  3O65 B;  3L13 A;  3KYC D;  1V81 A;  3VTV A;  3AUL A;  5E6P A;  3JSV B;  5G2N A;  2JXX A;  3KUZ A;  4DK5 A;  1XQQ A;  2K25 A;  4LDT B;  1WF9 A;  3N3K B;  1WIA A;  3M95 A;  3OLM D;  4FN2 A;  1WGR A;  2GBJ A;  3NY5 A;  3SU8 X;  3VH4 B;  2I1K A;  1WH3 A;  2KJH B;  4XX5 A;  3L08 A;  4MSM B;  3ZVV A;  4FJY A;  2O6V D;  1OGW A;  4MSQ B;  5BO4 B;  3DQV A;  3QCA A;  3A1Q A;  1V5O A;  2LJ5 A;  1UH6 A;  3PTF C;  3PLU A;  4FHK A;  4HJK A;  4W9E A;  2G4S A;  3VVW B;  1GJZ A;  1WR6 E;  2Z0E B;  4FBJ B;  1V49 A;  2M17 A;  1J0G A;  4W9I A;  4EEW A;  4J6I A;  4F8C B;  4BOZ B;  1Z5S B;  5AZF A;  2L8J A;  4GIV A;  2AEH A;  1NBF C;  4KVG B;  5JHB A;  1WMH A;  4K1R B;  4BKS D;  4BFR A;  1NI2 A;  3HK0 A;  2ZVO A;  4GDK B;  3OJ3 A;  2JWZ A;  1WZ3 A;  2WX0 A;  1TZ1 A;  2KMA A;  3TL5 A;  2JRH A;  2IYD B;  3R7Q A;  3QAQ A;  4XC2 A;  2NR2 A;  1P1A A;  2KNB A;  4EOY A;  1WGH A;  2M4N A;  1RFA A;  1S3S G;  4DBG A;  4BBN C;  3CF6 E;  3ZKJ C;  3WAP A;  3WAO A;  4WJN A;  5D94 A;  1RAX A;  3IVF A;  2IY1 B;  2PE9 A;  4BVU C;  4FAD A;  3X0W A;  4AOF A;  3UIN B;  1WM3 A;  2D2Q A;  2RR9 A;  4LCD E;  3R3M A;  1E8X A;  3A9K A;  2FUH B;  4IW0 A;  2KJR A;  3PHW B;  2IZV B;  4GXB A;  2N7E A;  1F9J A;  3L16 A;  4II2 B;  2JZZ A;  2DHZ A;  4HCN B;  2LRU A;  2G45 B;  2ASQ A;  3PS6 A;  4MDK E;  4X57 B;  2ZNV C;  4G0N B;  1GC6 A;  3ZNH B;  2UYZ B;  1M94 A;  1TTN A;  1R4N I;  4NJ6 A;  4GOC A;  2EMS A;  2KFK A;  3RCZ A;  1P98 A;  4FA6 A;  5IAA C;  4DHZ E;  3UGB B;  4K7W A;  1LFD A;  1GUA B;  1ZW7 A;  3WIM A;  3MHS D;  2KKC A;  4PS8 A;  1WGD A;  2BF8 B;  3RUI B;  3DVN U;  2KTR A;  1V80 A;  4KDL B;  2YVC A;  4KSL C;  3QA8 A;  3PHX B;  1OTR B;  2K6Q A;  1YX6 B;  2C9W B;  3M3J A;  2JZ3 B;  3N30 A;  4G50 A;  2FCN A;  2IO0 B;  4HPM B;  4KSK C;  4NJ7 A;  2N9E B;  2RPQ A;  2N7D A;  3A1Q B;  3ECI A;  4PS7 A;  3EC8 A;  3WAM A;  2KJ6 A;  2C7H A;  4NAW A;  4ZDV A;  3D32 A;  5KHO A;  4HCP B;  2UWQ A;  2J0K A;  1UGM A;  3A9J A;  5LXH A;  5AZG A;  4GGQ A;  2IO2 B;  1MG8 A;  3AU4 A;  2ZZP B;  3IG3 A;  2BWE S;  4JLC A;  2CHZ A;  3VUX A;  4EKU A;  2OOB B;  4W9G A;  1OEY J;  2V4L A;  1ZGU B;  1X1M A;  2MP2 A;  4MGI E;  4AJY B;  1OQY A;  1YX5 B;  3L17 A;  2AL6 A;  3HHM A;  4GDL A;  5L83 A;  1UD7 A;  4G3X B;  3OAW A;  4B95 A;  1UBQ A;  1YQB A;  3BIN A;  2K1F A;  2FCS A;  2NBU A;  3EFU A;  2KK8 A;  3VUW A;  4EZJ A;  2RGF A;  3SDL C;  2MQJ A;  4P7I A;  4EZK A;  3U8Z A;  4A20 A;  1YIW A;  4K7S A;  2JRI B;  2KLG A;  2AWT A;  1WE7 A;  1WJN A;  2A4Z A;  2MSE D;  3A4R A;  2JY6 A;  3ZW3 A;  2WWZ A;  3A9K B;  4MH0 E;  4WWO A;  3KH0 A;  3RZW C;  4DHJ D;  5JH5 C;  5DCN A;  2LGY A;  2BYV E;  2J0M A;  1SGH A;  5D2M B;  1WI0 A;  1XT9 B;  2XEW A;  3UF8 A;  2KX3 A;  2LGD A;  2LZ6 A;  2A5U A;  2NPT A;  4WAA A;  2KMC A;  3M63 B;  5TR5 A;  4URK A;  3ALB A;  3TJP A;  2FAZ A;  4BBN F;  4ICU A;  4ZRK A;  3DVG Y;  2O2V A;  2KFK B;  2BKR B;  2FIF A;  4MGK E;  1L7Y A;  2LVP A;  3B1L X;  4MGZ E;  4ZYN A;  2MCN B;  4KIK B;  3HIZ A;  3NZS A;  1WRD B;  3IBE A;  1UBI A;  4OVV A;  5CX3 A;  3X23 A;  1WZ0 A;  3PSE B;  4WWP A;  3APF A;  3VH3 B;  3VAW A;  3VXW A;  1C3T A;  1BT0 A;  2KTR B;  1WJ6 A;  4W9J A;  2JT4 B;  4KDI C;  4OVU A;  1QZE A;  4KZC A;  2MBQ A;  3QK0 A;  4AJW A;  5JZE B;  5GMV A;  1WJ4 A;  1XD3 B;  2CR5 A;  2N1W A;  3L54 A;  2D10 A;  2M1M A;  2C7N B;  1E7U A;  4IM2 A;  4I6N B;  2NCN A;  3MTN B;  2DYM A;  1A5R A;  3U7D A;  3M62 B;  2LVQ A;  4NY0 A;  3PRP B;  1WXM A;  2MW5 A;  3A9J B;  3K9O B;  1P0R A;  2N4F A;  2KN5 A;  5CHW A;  3B08 A;  3U30 A;  1FXT B;  3SHQ A;  3UIP B;  2YLM A;  2K39 A;  2CHW A;  3AXC A;  2ZCC A;  3V60 A;  2MP2 B;  3UIO B;  3T9L A;  1SIF A;  2JF5 A;  3IFW B;  1KLV A;  1VD2 A;  4MJS A;  5JHA A;  3RT3 B;  4IM3 A;  3W1S C;  2KC1 A;  2DX5 B;  3NHE B;  3TCA A;  3H1U A;  5CHV C;  1WM2 A;  4ANX A;  1WJU A;  2O6V B;  3MJW A;  2CU1 A;  3ONS A;  1YD8 U;  4TQ1 A;  1E90 A;  1Y8R C;  2DEN B;  3L10 B;  2JPH A;  3A33 B;  4DHZ B;  2XK5 A;  2L0F A;  1I35 A;  3ZTD A;  4NPN A;  2JUO A;  3QIJ A;  3AU5 A;  4AP4 C;  4I6P A;  4ASW C;  5J18 A;  1UZX B;  4DDI D;  1IYF A;  3VUY A;  3JVZ X;  2C5L C;  3R7R A;  4MGY E;  2DZK A;  2ZVN A;  4IUM B;  4E74 A;  1WXA A;  3DCG A;  3PVL A;  5J17 A;  1V9J A;  5DPT A;  4WJQ A;  3NOB A;  1I42 A;  4FJZ A;  2KHW B;  4W9D A;  1GG3 A;  2LD9 A;  3H7P A;  3JW0 X;  2K8B A;  4W9H A;  1KJT A;  3ZDM C;  3JYU A;  3HM3 A;  3NZU A;  3GOE A;  4K7U A;  3ZNG C;  4GN1 A;  4I6L B;  3PRM B;  2BPS A;  1KOT A;  2O2V B;  3AI5 A;  4GU2 A;  4B9K A;  4E71 A;  3DBH I;  4HLE A;  2KWC A;  3DOW A;  3VFK A;  1H4R A;  4M0W B;  2DZJ A;  4MEL A;  1WX7 A;  4IM0 A;  2G4D B;  4W9F A;  3RZF A;  5AEK B;  4LJP B;  4TQ0 A;  2REX A;  2VRR B;  1RLF A;  1WYW B;  2CKH B;  3KW5 B;  5J2R A;  1IP9 A;  2N1V A;  4FJV B;  1KM7 A;  2KFJ A;  2KZR A;  2R2Q A;  4W9C A;  2PPH A;  1G6J A;  1WXS A;  3H7S A;  2L7R A;  2ZJD A;  1R4M I;  2OJR A;  4A3P A;  1EF5 A;  1HE8 A;  2L76 A;  1Q1O A;  1LQB A;  2AYO B;  2LXC A;  3ML9 A;  2DZI A;  4HXD A;  3ZDT A;  2KC2 A;  4GB9 A;  3KUC B;  2DYO A;  1WMH B;  1WE6 A;  1YJ1 A;  4PS3 A;  1AAR A;  1WY8 A;  3ZUN A;  2MX2 A;  2FNJ B;  2KTF A;  1OEY A;  5CHF A;  4F1S A;  2IBI B;  2N9X A;  2GMI C;  2K8C A;  2G3Q B;  2LI5 A;  1P9D U;  3KYD D;  2V3S A;  4F7Z A;  2KQS A;  4BKT A;  3VQI A;  1WX9 A;  3Q3J A;  3T8M A;  4EUT A;  2KO3 A;  4KZ0 A;  2D07 B;  1JRU A;  1PQS A;  2C7M B;  3NS8 A;  3RYT A;  2GBK A;  3DPD A;  3PPA A;  3DBR I;  2K6D B;  2FID A;  4GDK A;  4HVB A;  2PE6 B;  3APD A;  2N9P C;  4RMA A;  2EMT A;  2BYE A;  3W1Y A;  3ZNI D;  4W9L A;  3V62 A;  2L3Z A;  3H6N A;  2B3A A;  2KWU B;  5L95 C;  3Q3F A;  1WX8 A;  2WYQ A;  3W1S A;  1NDD A;  1L2N A;  5IA7 A;  2HE7 A;  3CMM B;  3LJ3 A;  2DYB A;  3H7P B;  4CO7 A;  2LXA A;  3V6E B;  1E7V A;  1WR1 A;  4HWI B;  4WWN A;  3V6C B;  3DBL I;  3VTU A;  5AZH A;  2MBB B;  2Z0D B;  2CHX A;  3PT2 B;  4AWJ A;  4NQK E;  2KDE B;  1E8Z A;  2J0J A;  3QX1 A;  4PYU A;  4ANV A;  2LGX A;  3CST A;  3UQA A;  4ICV A;  4XZ4 A;  4BOS C;  2IO1 B;  2KVR A;  2LAS A;  2FCQ A;  2MBE A;  5G55 A;  4KV2 A;  3S2A A;  1EF1 A;  4DHJ B;  3K9P B;  4NAW B;  2NBW B;  3OJ4 B;  3TIX A;  2W9N A;  4G11 A;  4W9K A;  3ZTC A;  1U4A A;  1H8C A;  2GBR A;  4HDQ A;  5C1Z A;  2KDF B;  2KQ7 A;  3VHT C;  1C1Y B;  2MLB A;  2C60 A;  5KHQ A;  2MBH A;  4HDO A;  2R2O A;  3V61 A;  1V5T A;  4GDL B;  5E6N A;  4B6W A;  2LRW A;  2KOX A;  2PJH A;  3QHT A;  4M8N A;  3R66 C;  1ZKH A;  4HK2 A;  3DDC B;  3QQ8 B;  3QWZ B;  4WQO B;  2DAF A;  2KXJ A;  2WX1 A;  3PZD A;  2KX0 A;  4II3 B;  1CMX B;  5LXI B;  1V6E A;  4DXA B;  3DBS A;  2LWP A;  2ZPY A;  2K8H A;  2J7Q B;  3HM6 X;  4WJP A;  5EDS A;  3DVN V;  1GC7 A;  1WGG A;  4FHJ A;  2MRP A;  2D11 A;  4IWP A;  2M8S A;  4JL9 A;  3ZNZ B;  2MA9 B;  5DPW A;  1ISN A;  3PRZ A;  3H9D A;  2NPT B;  3DVG X;  4N9F 4;  3SD5 A;  4DDG D;  3KVF B;  3QAR A;  2KLC A;  3IHP C;  5LLI A;  3I3T B;  4EZL A;  2LUE A;  4BKG A;  4TUU A;  3ZO5 B;  3RD2 A;  3PGE A;  4DWF A;  3VTW A;  2KD0 A;  4NNJ B;  4A3O A;  5C23 A;  4CYE A;  3ML8 A;  1LXD A;  3PV1 A;  2FCM A;  3LDZ E;  3JSV A;  5E6O A;  2ZNV B;  4K81 A;  2IO3 B;  3ZRC A;  3N32 A;  4JIO U;  4WJO A;  2GBN A;  2M0X A;  2I1J A;  2KAN A;  1E8W A;  4IC7 B;  4KIK A;  4RM9 A;  1LM8 B;  5HKH A;  2Z59 B;  1WGY A;  1EUV B;  1V86 A; 
#chains in the Genus database with same CATH topology
 4N58 A;  3PRE A;  2BYF A;  2HTH A;  3RNE C;  2NVU I;  1P3Q U;  4LJO B;  2BTE A;  3AV8 A;  4OHJ A;  2EKE C;  3BWU D;  2ZPN A;  4CHK A;  5DPR A;  4ZRJ A;  2KDI A;  2KN4 A;  2Y5B B;  3P42 A;  1WXV A;  4RM8 A;  3NRZ A;  3AMZ A;  1DYQ A;  1TBE A;  4ZRP A;  2KDB A;  1JWM D;  2RSU A;  3QJZ A;  1XLO A;  2IY0 B;  1JWA D;  1NYR A;  3WA0 A;  4BAX A;  1VCB A;  2HJ8 A;  2SEB D;  2XK5 B;  1T0Y A;  2ONQ A;  2V3N A;  2L32 A;  3GZN I;  3ZLZ A;  3UQB A;  2JVC A;  4ZOH C;  2AL3 A;  1FNU A;  4E3C A;  2QEJ C;  3Q3O C;  1WFY A;  2WXR A;  1V1P A;  5BMG A;  1RRB A;  2WU2 B;  5FR6 A;  1UNS A;  4GMV A;  2DAJ A;  2D5G A;  2PKO A;  4BKS A;  4M00 A;  2LHD A;  3O65 B;  5G2N A;  4XDD A;  2X38 A;  3OLM D;  2AQ1 B;  4XX5 A;  3ZVV A;  2Z8L A;  3KWV A;  4FJY A;  2O6V D;  1OGW A;  1HTO A;  3BK2 A;  3DQV A;  3A1Q A;  1V5O A;  1UWM A;  4W9E A;  1JML A;  3LYY A;  3N20 C;  4S17 A;  3RNA C;  3VVW B;  1GJZ A;  4FBJ B;  1C4C A;  3DBR B;  3VRA B;  1TYG B;  4BOZ B;  4HKZ E;  2G1E A;  1E7P B;  2PTL A;  3I57 A;  5AZF A;  5JHB A;  1WMH A;  1RFK A;  4BFR A;  1NI2 A;  2JWZ A;  2MHJ A;  1WZ3 A;  4LTU A;  2JRH A;  3R7Q A;  3TEX A;  3QAQ A;  2DLB A;  1D5M C;  1PUT A;  4EOY A;  1RFA A;  3MC9 A;  4BVU C;  4AOF A;  3A9K A;  4MT5 A;  2KJR A;  3U4E G;  2DHZ A;  4G0N B;  3ZNH B;  2BQQ A;  1WYG A;  3RCZ A;  1QT9 A;  1LGR A;  3NZ3 A;  1GUA B;  1ZW7 A;  4PS8 A;  2BS4 B;  2YVC A;  3QA8 A;  4IDI A;  5AUK A;  1QKZ A;  3N30 A;  5HG2 A;  4G50 A;  2FCN A;  5IOI A;  4A55 A;  3D32 A;  1DOI A;  2LFI A;  2UWQ A;  4EKU A;  2BWE S;  4JWS C;  2QDF A;  1ZGU B;  1X1M A;  1K50 A;  1I4G A;  2TSS A;  2AL6 A;  3HHM A;  4GDL A;  1D5Z C;  3N9Y C;  5L83 A;  2INN E;  1UBQ A;  3EFU A;  2WGS A;  2M56 B;  4A6Q A;  2MQJ A;  3U8Z A;  1C78 A;  2JRI B;  1FXA A;  1VJK A;  3ZW3 A;  3OG5 A;  3RZW C;  5JH5 C;  5D2M B;  1TY2 A;  1FCL A;  2A5U A;  1K52 A;  4URK A;  3U7Z A;  3TJP A;  1XLP A;  2FAZ A;  2DNF A;  2K9X A;  4PK1 A;  2FIF A;  4MGK E;  1L7Y A;  4ZYN A;  2MCN B;  3HIZ A;  4FAD A;  3VXW A;  3NG0 A;  1BT0 A;  2N0S B;  1WGK A;  2KTR B;  3ZJV A;  4W9J A;  2JT4 B;  1QF6 A;  4OVU A;  1SF0 A;  1XD3 B;  2CR5 A;  2N1W A;  2D10 A;  5IP4 D;  2C7N B;  1E7U A;  3MTN B;  1D4B A;  3PZ8 A;  2WP9 B;  2LVQ A;  4NY0 A;  3PRP B;  2MW5 A;  4CQN A;  4C80 A;  3P1M A;  3U30 A;  1FXT B;  1HXY D;  3VRB B;  2WXP A;  2CHW A;  4NJC A;  2J52 A;  5FKA C;  3DHG C;  4H2A A;  1T0R C;  4IM3 A;  2WS3 B;  2LMC A;  2WDQ B;  2IGH A;  3SR6 A;  1RYJ A;  1SEB D;  1YD8 U;  4RNA A;  1IUE A;  1TS5 A;  2XK5 A;  1I35 A;  1WRI A;  2JUO A;  3AU5 A;  4I6P A;  3NVV A;  5AUI A;  1IYF A;  3R7R A;  4ACF A;  2ZVN A;  4IUM B;  1WXA A;  5DPT A;  4RCO A;  4W9D A;  3B9J A;  4M01 A;  5IKC M;  1SB3 C;  1ZDV A;  3AI5 A;  3ZXV A;  1VRA B;  1C4P A;  2IND C;  2KAC A;  2KWC A;  3NUH B;  4M0W B;  2Y5C A;  2DZJ A;  4C4V B;  1MJD A;  4IM0 A;  2G4D B;  3W5U B;  4O1N A;  2VRR B;  5J2R A;  1IP9 A;  4FJV B;  2J42 A;  4W9C A;  2PPH A;  3AE4 B;  2QMT A;  1GPX A;  2ZJD A;  1R4M I;  4KGS A;  4HRS A;  2LXC A;  4HXD A;  1N5X A;  1YJ1 A;  1I7H A;  3Q8F A;  5BMH A;  4P1B C;  4ZHP A;  2MX2 A;  1SXT A;  1OEY A;  2GI9 A;  1PDX A;  4BKT A;  2KO3 A;  4KZ0 A;  2MJ3 A;  5JXV A;  3IAS 1;  3HVZ A;  3NS8 A;  2PVO D;  2V9H A;  2VZK B;  3DBR I;  2FID A;  4HVB A;  3W1Y A;  2L3Z A;  1R4N B;  5L95 C;  3Q3F A;  1WX8 A;  1STE A;  2M0A A;  2HE7 A;  5EE3 A;  1ZXI A;  2WDV B;  3LJ3 A;  3DBH B;  4BZA A;  1YMH E;  2LXA A;  2YEP F;  3P4P B;  3Q6B A;  1FIQ A;  2KAJ A;  2CHX A;  3IXS A;  2OJW A;  3AED B;  3R2T A;  4BOS C;  2LAS A;  3BYT B;  4KV2 A;  3DWG C;  4DHJ B;  1TIF A;  4NAW B;  3OJ4 B;  2WXH A;  2W9N A;  4G11 A;  1H8C A;  2LEK A;  4A90 A;  2MBH A;  4HDO A;  2KOX A;  4KGR A;  4RGO S;  4M8N A;  3R66 C;  3Q8C A;  2DAF A;  3PZD A;  1CMX B;  3SFE B;  3AE5 B;  4DXA B;  1MFW A;  4K3B A;  3HM6 X;  4MH8 A;  4WJP A;  1GC7 A;  1YN4 A;  2MRP A;  4OZC A;  1C79 A;  1T3Q A;  3DVG X;  4DDG D;  2KLC A;  3AE1 B;  2LUE A;  3RD2 A;  4A3O A;  4KGT A;  2NTS A;  1MI0 A;  2ZNV B;  2LHE A;  2IO3 B;  3N32 A;  2GB1 A;  4WJO A;  2MEK A;  3TEY A;  2I1J A;  2KAN A;  1LM8 B;  5HKH A;  1OFF A;  1V86 A;  4US8 A;  3CSF A;  4C7Y A;  1SE9 A;  4HRO A;  4FLH A;  2MBO A;  2R61 A;  3ENE A;  3P2B A;  3EEC A;  4IWQ A;  2WXL A;  3TBL D;  2V0G A;  3WAL A;  3ZRF A;  3L4P A;  2W55 A;  3E9S A;  5DPS A;  1EO6 A;  2LVO A;  2CS4 A;  4AUQ C;  3Q8B A;  1D3Z A;  1QLB B;  4TV3 A;  3EHV A;  1ZOY B;  5H8Y E;  2BYT A;  2RD0 A;  3L0W B;  4ANW A;  4JGH B;  3ETR A;  4EFO A;  2UU7 A;  4IWO A;  2MWS B;  3B2F A;  4N59 A;  2NBV B;  2RDH A;  4MM3 A;  1FFU A;  3Q8E A;  2VH2 A;  3KYC D;  3JSV B;  1XQQ A;  2K25 A;  4S0R A;  3N3K B;  3RN9 C;  3M95 A;  2WNM A;  3SFD B;  3IAM 1;  1SE3 A;  1WGR A;  3NY5 A;  2KJH B;  3P4S B;  5LNK 1;  4MSQ B;  3QCA A;  4FHK A;  3PLU A;  1WR6 E;  2M17 A;  1FNV A;  1F2R C;  2IPK D;  4F8C B;  4ZRQ A;  2JSV X;  4GIV A;  4KVG B;  1BML C;  4BKS D;  1KTK A;  4GDK B;  2QC8 A;  4RF1 A;  3NVZ A;  1TZ1 A;  4XYC A;  1I4X A;  2IYD B;  2IJ0 A;  1BUI C;  1P1A A;  1A70 A;  1MPE A;  3CF6 E;  3ZKJ C;  3GS2 A;  3WAO A;  4WJN A;  4ARI A;  3CWI A;  3UIN B;  2D2Q A;  2RR9 A;  2YEP B;  2FUH B;  4B0E A;  3PHW B;  4YT0 B;  4GXB A;  2RPV A;  3PS6 A;  2ZNV C;  2UYZ B;  1R4N I;  2J53 A;  2KFK A;  1P98 A;  5IAA C;  2WXN A;  4K7W A;  4C7Z A;  2I2Y A;  3WIM A;  2KKC A;  3AEE B;  2BF8 B;  1V80 A;  4KDL B;  3PHX B;  2K6Q A;  3GE3 C;  4WUR A;  3J9C A;  4HPM B;  2N9E B;  2N7D A;  4PS7 A;  4D2K A;  4ZDV A;  3WAM A;  4NAW A;  4HCP B;  3A9J A;  1UGM A;  1M4V A;  1YN3 A;  2IO2 B;  3AU4 A;  3VUX A;  4JLC A;  2AQ3 B;  2OOB B;  1OEY J;  3V3X A;  3C19 A;  4MGI E;  4AJY B;  1OQY A;  3L17 A;  3NVW A;  1UD7 A;  4NZL B;  1EWY C;  2K1F A;  2NBU A;  2INC C;  3P63 A;  2KK8 A;  3KWL A;  1JRO A;  1CJE A;  4ZYS A;  1Y56 A;  4EZK A;  1MHX A;  1YIW A;  4K7S A;  1WJN A;  2MSE D;  2JY6 A;  4MH0 E;  4WWO A;  1F2R I;  3AN1 A;  3KH0 A;  5DCN A;  2LGY A;  2BYV E;  2J0M A;  1SGH A;  3PZ7 A;  2LGD A;  2K5P A;  2PLP A;  2BB6 A;  3M63 B;  4HPP A;  5HFY A;  1YN5 A;  1KRH A;  5H92 C;  2BKR B;  5CX3 A;  1D5X C;  1WRD B;  2BVC A;  5DPW A;  3AH7 A;  3ZGZ A;  1WZ0 A;  2WXJ A;  3APF A;  2DWQ A;  4YXD B;  4KDI C;  1QZE A;  4KZC A;  2MBQ A;  1EM7 A;  4JX1 C;  2DYM A;  1A5R A;  3BK1 A;  1WXM A;  3K9O B;  2KN5 A;  5CHW A;  1EU4 A;  1FM0 D;  3B08 A;  4RH6 A;  2K39 A;  1EU3 A;  3AXC A;  2ZCC A;  2MP2 B;  3UIO B;  2NMQ A;  1FXI A;  4B0M A;  2FUG 1;  2KC1 A;  2DX5 B;  1IBX B;  4ANX A;  2JX5 A;  2K3U A;  2L0F A;  3ZTD A;  1TS4 A;  3QIJ A;  4AP4 C;  4ASW C;  3RNF C;  1UZX B;  3HRD D;  3JVZ X;  2C5L C;  1NEK B;  1GOZ A;  3DCG A;  5J17 A;  1I42 A;  1T0S C;  1F52 A;  2Y3A A;  1KJT A;  1YJJ A;  3HM3 A;  3NZU A;  3GOE A;  4GN1 A;  4I6L B;  1KOT A;  2BPS A;  2O2V B;  4GU2 A;  4B9K A;  3T3N A;  2N9L A;  3DOW A;  3RMK C;  1ZDX A;  3ZXR A;  1BXT A;  1H4R A;  1N5W A;  4MEL A;  4WQM A;  3RZF A;  5AEK B;  3AB5 A;  3Q14 C;  2K0P A;  5HI1 A;  2REX A;  1WYW B;  2KZR A;  2R2Q A;  1GB4 A;  1I4H A;  1G6J A;  2JU6 X;  2L7R A;  2OJR A;  2ON8 A;  3KLS X;  1HE8 A;  1Q1O A;  2AYO B;  2BBC A;  1WSP A;  1XEE A;  3KUC B;  5MPO A;  1TKE A;  3SEB A;  3EGR A;  2D3B A;  5BYQ A;  3FIL B;  3ZUN A;  2FNJ B;  2KTF A;  4F1S A;  1XLQ A;  2K8C A;  3Q69 A;  2G3Q B;  2LI5 A;  3AEF B;  3KYD D;  2V3S A;  4FXC A;  4JWU C;  2KQS A;  3VQI A;  1B9R A;  1JW9 D;  4OZA A;  4YSY B;  1N60 A;  2D07 B;  4EE2 A;  1VDV A;  4GDK A;  3DHI C;  2PE6 B;  3APD A;  4A9A A;  2LGI A;  2EMT A;  3ZNI D;  1UWX A;  4REZ A;  2B76 B;  1L2N A;  1FO4 A;  2DYB A;  3H7P B;  4CO7 A;  1SJE D;  4HWI B;  3W5V B;  3V6C B;  4AWJ A;  2J0J A;  3QX1 A;  4PYU A;  1AYF A;  3S2A A;  4XWT A;  3K9P B;  2EKI A;  2NBW B;  5EE1 A;  5KHQ A;  3V61 A;  5E6N A;  2LRW A;  3QHT A;  1N6Z A;  2Y5P A;  3DDC B;  3MC8 A;  2WX1 A;  4LNN A;  2KX0 A;  4WAF A;  3BII D;  4PT5 A;  3DBS A;  2CJN A;  2LWP A;  3EUB 2;  2K8H A;  2J7Q B;  2V3P A;  4MAC A;  2INP E;  3DVN V;  1WGG A;  2WLB A;  2QIL A;  2D11 A;  2M8S A;  3Q3M C;  4N9F 4;  3DBL B;  3IHP C;  5LLI A;  1UF0 A;  2ZW1 A;  4BKG A;  3PGE A;  4DWF A;  1ROE A;  2PVG C;  2MH7 A;  1E6E B;  1VR9 A;  1I4R A;  4JIO U;  2ACZ B;  1GAQ B;  1ZUD 2;  4MEM A;  2ZEQ A;  2V1Y A;  3APC A;  4RFB A;  2JXT A;  3E56 A;  3NVY A;  1PGA A;  2WXO A;  2PEA A;  3AEA B;  1HQR D;  2BKF A;  3DWM A;  3TMP B;  1Z2M A;  1ESF A;  1J8C A;  1C9F A;  4PYZ A;  5D6J B;  3B2G A;  3TEZ A;  4M02 A;  2HD5 B;  4NQL B;  4IG7 B;  4LDT D;  3A4S C;  1SIJ A;  3PLV A;  1L6U A;  3ZIM A;  1IBX A;  5BMI A;  1J19 A;  1IPG A;  3KUD B;  1B1Z A;  1Q0W B;  3VDZ A;  2QHO A;  1V2Y A;  4DXG A;  3TEW A;  4YWG G;  1S1Q B;  1GNU A;  5D3I B;  2BGF A;  2D3G A;  5CTR C;  3P4Q B;  1RM6 C;  4YL8 A;  1E5W A;  2J4X A;  5E6P A;  1WF9 A;  1SE4 A;  1WIA A;  4FN2 A;  3SU8 X;  3VH4 B;  2OED A;  1FD6 A;  1UH6 A;  2LJ5 A;  4TSS A;  4YSZ B;  1WWT A;  2G4S A;  4AQ7 A;  1NI3 A;  2Z0E B;  1V49 A;  2XNA C;  2N9K A;  4EEW A;  4J6I A;  4P16 A;  3BYY B;  2L8J A;  3MP9 A;  2JQR B;  2AEH A;  1NBF C;  3EFC A;  1L0X B;  3HK0 A;  3GZN B;  2ZVO A;  3FIL A;  3OJ3 A;  2L83 A;  3IT4 B;  2KVZ A;  2LJI A;  2KMA A;  2QCZ A;  4XC2 A;  4WIP A;  2KNB A;  1WGH A;  4DBG A;  2Q5W D;  5D94 A;  5J18 A;  2IY1 B;  3BZD B;  3X0W A;  4P6V F;  4LCD E;  1RWS A;  1E8X A;  4IW0 A;  1SSN A;  1L6V A;  5D3D A;  1F9J A;  3L16 A;  4II2 B;  1D6E C;  2JZZ A;  2IGG A;  4HCN B;  2BB5 A;  4XDC A;  1R7S A;  2I38 A;  4X57 B;  2RMM A;  1GC6 A;  3VR9 B;  1M94 A;  1I4P A;  2D3C A;  3UGB B;  1XCQ L;  3UI3 A;  1LFD A;  3MHS D;  1F0Z A;  2KQ4 X;  3DVN U;  2KTR A;  2XN9 C;  4KSL C;  3MC0 B;  4ITK A;  4L1B A;  5T8I A;  1OTR B;  4LNI A;  1V97 A;  2RDG A;  1CQV A;  4RGT A;  2JZ3 B;  1XLN A;  3A1Q B;  3ECI A;  2KJ6 A;  2C7H A;  1JWU D;  1TS2 A;  4KKI A;  1Q10 A;  5KHO A;  4ZHO A;  4US9 A;  1L5P A;  1QOG A;  5LXH A;  2LUM A;  3AM9 A;  4GGQ A;  3PO0 A;  3N1Z C;  5AZG A;  2ZZP B;  3IG3 A;  4LNK A;  2CHZ A;  1TY0 A;  2KYW A;  5I4D A;  1YX5 B;  4WH4 A;  2VH1 A;  4G3X B;  3OAW A;  4B95 A;  3BIN A;  2FCS A;  1JRP A;  2WXG A;  3VUW A;  4EZJ A;  3SDL C;  1WE7 A;  2A4Z A;  3A4R A;  2BS2 B;  2WWZ A;  3A9K B;  4DHJ D;  3FKY A;  3RPF C;  2XEW A;  5BYR A;  4WAA A;  1P7E A;  2KMC A;  1TT5 B;  1XO3 A;  3ALB A;  4L23 A;  4BBN F;  2WXK A;  3MJ5 A;  4N6E B;  4ICU A;  1FMA D;  3RNC C;  2LVP A;  3B1L X;  4KIK B;  3NZS A;  3IBE A;  1UBI A;  3X23 A;  3I5J C;  3VH3 B;  4M0W A;  2MJD A;  4C4V A;  1C3T A;  1WJ6 A;  1C4A A;  4AJW A;  1JCK B;  1N63 A;  3ABV B;  5GMV A;  1DOY A;  3L54 A;  4IM2 A;  2NCN A;  2WU5 B;  3M62 B;  2AQ2 B;  1P0R A;  3SHQ A;  3UIP B;  2YLM A;  3Q2A C;  5FR3 A;  4KX6 B;  3W2D A;  3V60 A;  3T9L A;  2JF5 A;  5JHA A;  1CZP A;  2W3S A;  3NHE B;  4JE3 B;  3H1U A;  5CHV C;  1WM2 A;  2O6V B;  3MJW A;  1YQ3 B;  3ONS A;  1E90 A;  2DEN B;  2M19 A;  4DHZ B;  1KF6 B;  4LLG M;  3BVZ A;  2WHI A;  4DDI D;  3VUY A;  3C8Y A;  5E6J A;  4MGY E;  3NOB A;  2KHW B;  3AE2 B;  1GG3 A;  2LD9 A;  3JW0 X;  3ZDM C;  3ZJT A;  3ZNG C;  3Q8A A;  4E71 A;  3DBH I;  1AWD A;  1EWC A;  3BVM A;  4HLE A;  1SJH D;  1MHH E;  5TSS A;  4C56 C;  1WX7 A;  2WXQ A;  4LJP B;  4TQ0 A;  3HUI A;  1RLF A;  1ZP0 B;  2CKH B;  3KW5 B;  1KM7 A;  2HTM E;  1QIL A;  1EF5 A;  3ZDT A;  2X8X X;  3ML9 A;  4YTN B;  2KC2 A;  4PS3 A;  1WY8 A;  5BYS A;  5CHF A;  2N9X A;  1P7F A;  1UUP A;  2GMI C;  3U2S C;  3NJT A;  2OHF A;  1WX9 A;  4GLS C;  2C7M B;  3DPD A;  3PPA A;  4YSX B;  1TKY A;  3IT6 B;  1F1H A;  2N9P C;  1KLU D;  4W9L A;  1C76 A;  3R8B A;  3H6N A;  2KWU B;  5IA7 A;  3CMM B;  2FBW B;  3BVG A;  2HDE A;  3V6E B;  1E7V A;  1NEN B;  1E9M A;  1WR1 A;  3VTU A;  3GP7 A;  2KDE B;  3FAH A;  3EA6 A;  4L2Y A;  3CST A;  3URY A;  4XZ4 A;  1T0Q C;  2IO1 B;  2FCQ A;  5G55 A;  1K53 A;  1VZ8 A;  1R4M B;  3H8H A;  4HKQ A;  3TIX A;  4W9K A;  1U4A A;  1YJI A;  2GBR A;  4HDQ A;  5C1Z A;  2KDF B;  3RNG C;  1FCC C;  5FK9 C;  1SE2 A;  2C60 A;  2PIA A;  4P1C C;  4B6W A;  1DGJ A;  1ZKH A;  3QQ8 B;  4WQO B;  1NYQ A;  2RDB C;  5EE9 A;  2EEL A;  1YOV B;  3MHZ A;  2ZPY A;  5EDS A;  2CJO A;  4FHJ A;  4RGM A;  4J3O D;  3ZNZ B;  2MA9 B;  1ISN A;  3PRZ A;  3H9D A;  1NVI D;  2NPT B;  2BW2 A;  3KQ4 A;  1JWS D;  3KVF B;  3QAR A;  3TUO A;  3ZO5 B;  2IDY A;  1N61 A;  3FC4 A;  1QOB A;  2KD0 A;  4NNJ B;  1KLG D;  4CYE A;  3PV1 A;  2FCM A;  3JSV A;  5E6O A;  3ZRC A;  2MJE A;  2WXI A;  1E8W A;  4KIK A;  2Z59 B;  2JYE A;  1E0Z A;  3N1X C;  2GOW A;  3WAN A;  2L00 B;  2KMM A;  1YNT E;  2HJ1 A;  3QC8 B;  3RNB C;  3LXF A;  4YTM B;  1TGZ B;  4MJS B;  2WQY B;  4JQW C;  4YTP B;  5C3J B;  4XE0 A;  3V05 A;  1PGX A;  4FUL A;  1ENF A;  1WXQ A;  4C00 A;  2JWU A;  3RUL A;  3AEC B;  4ANU A;  2KWV B;  1E8Y A;  4HPL B;  2ICI A;  2O6V A;  3BY4 B;  1T6B X;  5G5H A;  2XBB C;  4GSW A;  2L0T A;  2W3R A;  2FE8 A;  2ZCB A;  1K8R B;  2GBM A;  5D7G A;  1Q5W B;  2L05 A;  3B0A A;  4TKN A;  1E10 A;  2NS5 A;  4IOI E;  3C0R B;  2DZM A;  2BWF A;  1UEL A;  4NAM A;  4M8M A;  5C2T B;  2WDT B;  4XWW A;  4ZRI A;  4K3C A;  4IKG A;  3L13 A;  3VTV A;  1V81 A;  1J7A A;  3AUL A;  4DK5 A;  2JXX A;  2LGS A;  2NTT A;  3KUZ A;  4LDT B;  1GB1 A;  5HHD G;  2IGD A;  2GBJ A;  2I1K A;  1WH3 A;  3L08 A;  4MSM B;  5BO4 B;  3PTF C;  4HJK A;  3U52 E;  1HTQ A;  1AN8 A;  1J0G A;  4W9I A;  1Z5S B;  1YQ4 B;  4K1R B;  2E3T A;  1HZ6 A;  4OVZ A;  2WX0 A;  3TL5 A;  2NR2 A;  3AE6 B;  2KDM A;  4RGN A;  2M4N A;  1S3S G;  4BBN C;  3WAP A;  1RAX A;  3IVF A;  3NS1 A;  2PE9 A;  2JZP A;  1WM3 A;  3R3M A;  3AE7 B;  1IGD A;  2IZV B;  2L1A A;  2N7E A;  5IN7 A;  3MFG A;  2LRU A;  2G45 B;  2ASQ A;  4MDK E;  3N1Y C;  4MM3 B;  1QOF A;  1T5X D;  1TTN A;  1KFY B;  4NJ6 A;  4GOC A;  2EMS A;  2V4I B;  4FA6 A;  4DHZ E;  3WCQ A;  1WGD A;  3RUI B;  2BT6 A;  1FRR A;  1YX6 B;  2C9W B;  3M3J A;  2IO0 B;  4KSK C;  4NJ7 A;  4RF0 A;  2RPQ A;  3EC8 A;  2BS3 B;  1OQQ A;  2WDR B;  2J0K A;  4LNO A;  1MG8 A;  4W9G A;  4WWM A;  2V4L A;  2G9H D;  2GRI A;  2MP2 A;  2E6X A;  4OZB A;  1V1O A;  1JWB D;  4JPS A;  1XF5 L;  2CU3 A;  1YQB A;  3I9V 1;  1J7B A;  2PW9 A;  1QOA A;  2RGF A;  3RFZ B;  4P7I A;  4A20 A;  2KLG A;  2AWT A;  1HZ5 A;  1MG4 A;  3GB1 A;  2L52 A;  4R3D A;  4ARC A;  3T3O A;  1WI0 A;  1XT9 B;  3UF8 A;  2KX3 A;  2LZ6 A;  2NPT A;  2QSD A;  5TR5 A;  3TSS A;  1VZ6 A;  4ZRK A;  3DVG Y;  2O2V A;  2KFK B;  1XXG A;  4MGZ E;  4OVV A;  3PSE B;  4WWP A;  5GXG B;  3VAW A;  4KKJ A;  2QIE B;  1ET9 A;  4DQO C;  5JZE B;  3QK0 A;  2GLS A;  1HA5 A;  1L0Y B;  1WJ4 A;  1FEH A;  2M1M A;  4I6N B;  1FRD A;  4QAY A;  3U7D A;  3A9J B;  3P4R B;  3GE8 C;  2N4F A;  4LNF A;  3O13 A;  1IGC A;  5IO9 A;  1FPY A;  1SIF A;  3IFW B;  1KLV A;  1VD2 A;  4MJS A;  3RT3 B;  1PFD A;  3I63 C;  3W1S C;  3TCA A;  3ZJU A;  4HJG E;  1WJU A;  1ET6 A;  4HEA 1;  3W9C B;  2CU1 A;  4TQ1 A;  1Y8R C;  3L10 B;  2JPH A;  3AEG B;  1DOX A;  1V1P B;  3A33 B;  4UDU C;  1ZE3 D;  1CK1 A;  3R2I A;  1SBB B;  4NPN A;  3ZYY X;  4DXF A;  4E74 A;  2DZK A;  3PVL A;  1V9J A;  4WJQ A;  1C77 A;  4FJZ A;  3H7P A;  4W9H A;  2K8B A;  3JYU A;  4Q2J A;  1FNW A;  4K7U A;  3PRM B;  2PMV A;  3RI7 C;  1ACC A;  1JQ4 A;  1L0V B;  1HEZ E;  3VFK A;  3Q3N C;  3DHH C;  4W9F A;  2VZK D;  2N1V A;  2KFJ A;  1WXS A;  3H7S A;  1I4Q A;  4A3P A;  2L76 A;  1LQB A;  2JYT A;  2DZI A;  4GB9 A;  1JAL A;  2DYO A;  2W82 A;  1WMH B;  1WE6 A;  4USA A;  3HVD A;  1AAR A;  1L4Z B;  2IBI B;  2W54 A;  1P9D U;  4F7Z A;  3Q3J A;  3AEB B;  3T8M A;  4EUT A;  3AE3 B;  1JRU A;  1PQS A;  1FFV A;  5G5G A;  3RYT A;  2GBK A;  3AE8 B;  2K6D B;  1ZPS A;  4RMA A;  2BYE A;  4XGA B;  1PGB A;  2WXM A;  3LB8 C;  4AS1 A;  3V62 A;  1K51 A;  2B3A A;  2WYQ A;  3W1S A;  1NDD A;  2ZW0 A;  2K22 A;  1LO5 D;  2D3A A;  4WWN A;  1QQR A;  3DBL I;  5AZH A;  2MBB B;  2Z0D B;  3PT2 B;  1TJE A;  4NQK E;  4TMA B;  1TKG A;  1E8Z A;  1XCT L;  3AE9 B;  4ANV A;  2LGX A;  1TZO A;  3UQA A;  1VZ7 A;  4ICV A;  2KVR A;  2MBE A;  3ZQ4 A;  1EF1 A;  1J7C A;  3VR8 B;  3ZTC A;  2AX5 A;  1VLB A;  2QJL A;  1L4D B;  2KQ7 A;  3VHT C;  1PYW D;  1C1Y B;  2MLB A;  4OW0 A;  4A8X C;  2R2O A;  1V5T A;  3OWE B;  4GDL B;  2PJH A;  1UGJ A;  1N62 A;  4HK2 A;  3QWZ B;  2H89 B;  2KXJ A;  4II3 B;  5LXI B;  1OQR A;  1V6E A;  1V8C A;  1F77 A;  5EE0 A;  2H88 B;  2DBY A;  1TS3 A;  1KH0 A;  2WXF A;  4IWP A;  4JL9 A;  1MVK A;  2KWD A;  2SAK A;  3SD5 A;  4LK0 M;  4EZL A;  3I3T B;  4TUU A;  3VTW A;  3CIR B;  5C23 A;  1AW7 A;  3ML8 A;  1LXD A;  3LDZ E;  1ZXH A;  2N7J A;  2KT7 A;  4K81 A;  2GBN A;  2M0X A;  4RM9 A;  4IC7 B;  1WGY A;  1EUV B; 
#chains in the Genus database with same CATH homology
 4MEM A;  2ZEQ A;  2V1Y A;  2GOW A;  3CSF A;  3PRE A;  2BYF A;  3APC A;  2HTH A;  3WAN A;  2L00 B;  2NVU I;  1P3Q U;  4LJO B;  3QC8 B;  1SE9 A;  2EKE C;  2PEA A;  2ZPN A;  2BKF A;  4CHK A;  5DPR A;  3TMP B;  1TGZ B;  1Z2M A;  2MBO A;  2KDI A;  3ENE A;  4FLH A;  4MJS B;  3P2B A;  4JQW C;  4ZRJ A;  1J8C A;  3EEC A;  4IWQ A;  2Y5B B;  1WXV A;  4PYZ A;  4RM8 A;  3TBL D;  3WAL A;  1TBE A;  5D6J B;  2KDB A;  3ZRF A;  5DPS A;  4FUL A;  1EO6 A;  2RSU A;  2LVO A;  2CS4 A;  3QJZ A;  2HD5 B;  2IY0 B;  3WA0 A;  4AUQ C;  1VCB A;  2HJ8 A;  2XK5 B;  1D3Z A;  4NQL B;  4IG7 B;  4LDT D;  3A4S C;  1T0Y A;  3RUL A;  4TV3 A;  4ANU A;  3EHV A;  2KWV B;  1E8Y A;  3GZN I;  3PLV A;  4HPL B;  3ZIM A;  1J19 A;  1IPG A;  3ZLZ A;  3UQB A;  2JVC A;  2O6V A;  2AL3 A;  2RD0 A;  3BY4 B;  3KUD B;  1Q0W B;  4E3C A;  2XBB C;  3L0W B;  4GSW A;  2L0T A;  2QHO A;  3VDZ A;  4ANW A;  1V2Y A;  1WFY A;  2ZCB A;  1K8R B;  4JGH B;  1RRB A;  2GBM A;  5D7G A;  1Q5W B;  2L05 A;  1S1Q B;  4EFO A;  3B0A A;  4TKN A;  5FR6 A;  4IWO A;  2MWS B;  1GNU A;  2NS5 A;  2BGF A;  4GMV A;  2D3G A;  5CTR C;  3C0R B;  2DZM A;  2DAJ A;  2NBV B;  2BWF A;  1UEL A;  4MM3 A;  4M8M A;  2WDT B;  4BKS A;  4ZRI A;  4YL8 A;  1E5W A;  3O65 B;  3L13 A;  3KYC D;  1V81 A;  3VTV A;  3AUL A;  5E6P A;  3JSV B;  5G2N A;  2JXX A;  3KUZ A;  4DK5 A;  1XQQ A;  2K25 A;  4LDT B;  1WF9 A;  3N3K B;  1WIA A;  3M95 A;  3OLM D;  4FN2 A;  1WGR A;  2GBJ A;  3NY5 A;  3SU8 X;  3VH4 B;  2I1K A;  1WH3 A;  2KJH B;  4XX5 A;  3L08 A;  4MSM B;  3ZVV A;  4FJY A;  2O6V D;  1OGW A;  4MSQ B;  5BO4 B;  3DQV A;  3QCA A;  3A1Q A;  1V5O A;  2LJ5 A;  1UH6 A;  3PTF C;  3PLU A;  4FHK A;  4HJK A;  4W9E A;  2G4S A;  3VVW B;  1GJZ A;  1WR6 E;  2Z0E B;  4FBJ B;  1V49 A;  2M17 A;  1J0G A;  4W9I A;  4EEW A;  4J6I A;  4F8C B;  4BOZ B;  1Z5S B;  5AZF A;  2L8J A;  4GIV A;  2AEH A;  1NBF C;  4KVG B;  5JHB A;  1WMH A;  4K1R B;  4BKS D;  4BFR A;  1NI2 A;  3HK0 A;  2ZVO A;  4GDK B;  3OJ3 A;  2JWZ A;  1WZ3 A;  2WX0 A;  1TZ1 A;  2KMA A;  3TL5 A;  2JRH A;  2IYD B;  3R7Q A;  3QAQ A;  4XC2 A;  2NR2 A;  1P1A A;  2KNB A;  4EOY A;  1WGH A;  2M4N A;  1RFA A;  1S3S G;  4DBG A;  4BBN C;  3CF6 E;  3ZKJ C;  3WAP A;  3WAO A;  4WJN A;  5D94 A;  1RAX A;  3IVF A;  2IY1 B;  2PE9 A;  4BVU C;  4FAD A;  3X0W A;  4AOF A;  3UIN B;  1WM3 A;  2D2Q A;  2RR9 A;  4LCD E;  3R3M A;  1E8X A;  3A9K A;  2FUH B;  4IW0 A;  2KJR A;  3PHW B;  2IZV B;  4GXB A;  2N7E A;  1F9J A;  3L16 A;  4II2 B;  2JZZ A;  2DHZ A;  4HCN B;  2LRU A;  2G45 B;  2ASQ A;  3PS6 A;  4MDK E;  4X57 B;  2ZNV C;  4G0N B;  1GC6 A;  3ZNH B;  2UYZ B;  1M94 A;  1TTN A;  1R4N I;  4NJ6 A;  4GOC A;  2EMS A;  2KFK A;  3RCZ A;  1P98 A;  4FA6 A;  5IAA C;  4DHZ E;  3UGB B;  4K7W A;  1LFD A;  1GUA B;  1ZW7 A;  3WIM A;  3MHS D;  2KKC A;  4PS8 A;  1WGD A;  2BF8 B;  3RUI B;  3DVN U;  2KTR A;  1V80 A;  4KDL B;  2YVC A;  4KSL C;  3QA8 A;  3PHX B;  1OTR B;  2K6Q A;  1YX6 B;  2C9W B;  3M3J A;  2JZ3 B;  3N30 A;  4G50 A;  2FCN A;  2IO0 B;  4HPM B;  4KSK C;  4NJ7 A;  2N9E B;  2RPQ A;  2N7D A;  3A1Q B;  3ECI A;  4PS7 A;  3EC8 A;  3WAM A;  2KJ6 A;  2C7H A;  4NAW A;  4ZDV A;  3D32 A;  5KHO A;  4HCP B;  2UWQ A;  2J0K A;  1UGM A;  3A9J A;  5LXH A;  5AZG A;  4GGQ A;  2IO2 B;  1MG8 A;  3AU4 A;  2ZZP B;  3IG3 A;  2BWE S;  4JLC A;  2CHZ A;  3VUX A;  4EKU A;  2OOB B;  4W9G A;  1OEY J;  2V4L A;  1ZGU B;  1X1M A;  2MP2 A;  4MGI E;  4AJY B;  1OQY A;  1YX5 B;  3L17 A;  2AL6 A;  3HHM A;  4GDL A;  5L83 A;  1UD7 A;  4G3X B;  3OAW A;  4B95 A;  1UBQ A;  1YQB A;  3BIN A;  2K1F A;  2FCS A;  2NBU A;  3EFU A;  2KK8 A;  3VUW A;  4EZJ A;  2RGF A;  3SDL C;  2MQJ A;  4P7I A;  4EZK A;  3U8Z A;  4A20 A;  1YIW A;  4K7S A;  2JRI B;  2KLG A;  2AWT A;  1WE7 A;  1WJN A;  2A4Z A;  2MSE D;  3A4R A;  2JY6 A;  3ZW3 A;  2WWZ A;  3A9K B;  4MH0 E;  4WWO A;  3KH0 A;  3RZW C;  4DHJ D;  5JH5 C;  5DCN A;  2LGY A;  2BYV E;  2J0M A;  1SGH A;  5D2M B;  1WI0 A;  1XT9 B;  2XEW A;  3UF8 A;  2KX3 A;  2LGD A;  2LZ6 A;  2A5U A;  2NPT A;  4WAA A;  2KMC A;  3M63 B;  5TR5 A;  4URK A;  3ALB A;  3TJP A;  2FAZ A;  4BBN F;  4ICU A;  4ZRK A;  3DVG Y;  2O2V A;  2KFK B;  2BKR B;  2FIF A;  4MGK E;  1L7Y A;  2LVP A;  3B1L X;  4MGZ E;  4ZYN A;  2MCN B;  4KIK B;  3HIZ A;  3NZS A;  1WRD B;  3IBE A;  1UBI A;  4OVV A;  5CX3 A;  3X23 A;  1WZ0 A;  3PSE B;  4WWP A;  3APF A;  3VH3 B;  3VAW A;  3VXW A;  1C3T A;  1BT0 A;  2KTR B;  1WJ6 A;  4W9J A;  2JT4 B;  4KDI C;  4OVU A;  1QZE A;  4KZC A;  2MBQ A;  3QK0 A;  4AJW A;  5JZE B;  5GMV A;  1WJ4 A;  1XD3 B;  2CR5 A;  2N1W A;  3L54 A;  2D10 A;  2M1M A;  2C7N B;  1E7U A;  4IM2 A;  4I6N B;  2NCN A;  3MTN B;  2DYM A;  1A5R A;  3U7D A;  3M62 B;  2LVQ A;  4NY0 A;  3PRP B;  1WXM A;  2MW5 A;  3A9J B;  3K9O B;  1P0R A;  2N4F A;  2KN5 A;  5CHW A;  3B08 A;  3U30 A;  1FXT B;  3SHQ A;  3UIP B;  2YLM A;  2K39 A;  2CHW A;  3AXC A;  2ZCC A;  3V60 A;  2MP2 B;  3UIO B;  3T9L A;  1SIF A;  2JF5 A;  3IFW B;  1KLV A;  1VD2 A;  4MJS A;  5JHA A;  3RT3 B;  4IM3 A;  3W1S C;  2KC1 A;  2DX5 B;  3NHE B;  3TCA A;  3H1U A;  5CHV C;  1WM2 A;  4ANX A;  1WJU A;  2O6V B;  3MJW A;  2CU1 A;  3ONS A;  1YD8 U;  4TQ1 A;  1E90 A;  1Y8R C;  2DEN B;  3L10 B;  2JPH A;  3A33 B;  4DHZ B;  2XK5 A;  2L0F A;  1I35 A;  3ZTD A;  4NPN A;  2JUO A;  3QIJ A;  3AU5 A;  4AP4 C;  4I6P A;  4ASW C;  5J18 A;  1UZX B;  4DDI D;  1IYF A;  3VUY A;  3JVZ X;  2C5L C;  3R7R A;  4MGY E;  2DZK A;  2ZVN A;  4IUM B;  4E74 A;  1WXA A;  3DCG A;  3PVL A;  5J17 A;  1V9J A;  5DPT A;  4WJQ A;  3NOB A;  1I42 A;  4FJZ A;  2KHW B;  4W9D A;  1GG3 A;  2LD9 A;  3H7P A;  3JW0 X;  2K8B A;  4W9H A;  1KJT A;  3ZDM C;  3JYU A;  3HM3 A;  3NZU A;  3GOE A;  4K7U A;  3ZNG C;  4GN1 A;  4I6L B;  3PRM B;  2BPS A;  1KOT A;  2O2V B;  3AI5 A;  4GU2 A;  4B9K A;  4E71 A;  3DBH I;  4HLE A;  2KWC A;  3DOW A;  3VFK A;  1H4R A;  4M0W B;  2DZJ A;  4MEL A;  1WX7 A;  4IM0 A;  2G4D B;  4W9F A;  3RZF A;  5AEK B;  4LJP B;  4TQ0 A;  2REX A;  2VRR B;  1RLF A;  1WYW B;  2CKH B;  3KW5 B;  5J2R A;  1IP9 A;  2N1V A;  4FJV B;  1KM7 A;  2KFJ A;  2KZR A;  2R2Q A;  4W9C A;  2PPH A;  1G6J A;  1WXS A;  3H7S A;  2L7R A;  2ZJD A;  1R4M I;  2OJR A;  4A3P A;  1EF5 A;  1HE8 A;  2L76 A;  1Q1O A;  1LQB A;  2AYO B;  2LXC A;  3ML9 A;  2DZI A;  4HXD A;  3ZDT A;  2KC2 A;  4GB9 A;  3KUC B;  2DYO A;  1WMH B;  1WE6 A;  1YJ1 A;  4PS3 A;  1AAR A;  1WY8 A;  3ZUN A;  2MX2 A;  2FNJ B;  2KTF A;  1OEY A;  5CHF A;  4F1S A;  2IBI B;  2N9X A;  2GMI C;  2K8C A;  2G3Q B;  2LI5 A;  1P9D U;  3KYD D;  2V3S A;  4F7Z A;  2KQS A;  4BKT A;  3VQI A;  1WX9 A;  3Q3J A;  3T8M A;  4EUT A;  2KO3 A;  4KZ0 A;  2D07 B;  1JRU A;  1PQS A;  2C7M B;  3NS8 A;  3RYT A;  2GBK A;  3DPD A;  3PPA A;  3DBR I;  2K6D B;  2FID A;  4GDK A;  4HVB A;  2PE6 B;  3APD A;  2N9P C;  4RMA A;  2EMT A;  2BYE A;  3W1Y A;  3ZNI D;  4W9L A;  3V62 A;  2L3Z A;  3H6N A;  2B3A A;  2KWU B;  5L95 C;  3Q3F A;  1WX8 A;  2WYQ A;  3W1S A;  1NDD A;  1L2N A;  5IA7 A;  2HE7 A;  3CMM B;  3LJ3 A;  2DYB A;  3H7P B;  4CO7 A;  2LXA A;  3V6E B;  1E7V A;  1WR1 A;  4HWI B;  4WWN A;  3V6C B;  3DBL I;  3VTU A;  5AZH A;  2MBB B;  2Z0D B;  2CHX A;  3PT2 B;  4AWJ A;  4NQK E;  2KDE B;  1E8Z A;  2J0J A;  3QX1 A;  4PYU A;  4ANV A;  2LGX A;  3CST A;  3UQA A;  4ICV A;  4XZ4 A;  4BOS C;  2IO1 B;  2KVR A;  2LAS A;  2FCQ A;  2MBE A;  5G55 A;  4KV2 A;  3S2A A;  1EF1 A;  4DHJ B;  3K9P B;  4NAW B;  2NBW B;  3OJ4 B;  3TIX A;  2W9N A;  4G11 A;  4W9K A;  3ZTC A;  1U4A A;  1H8C A;  2GBR A;  4HDQ A;  5C1Z A;  2KDF B;  2KQ7 A;  3VHT C;  1C1Y B;  2MLB A;  2C60 A;  5KHQ A;  2MBH A;  4HDO A;  2R2O A;  3V61 A;  1V5T A;  4GDL B;  5E6N A;  4B6W A;  2LRW A;  2KOX A;  2PJH A;  3QHT A;  4M8N A;  3R66 C;  1ZKH A;  4HK2 A;  3DDC B;  3QQ8 B;  3QWZ B;  4WQO B;  2DAF A;  2KXJ A;  2WX1 A;  3PZD A;  2KX0 A;  4II3 B;  1CMX B;  5LXI B;  1V6E A;  4DXA B;  3DBS A;  2LWP A;  2ZPY A;  2K8H A;  2J7Q B;  3HM6 X;  4WJP A;  5EDS A;  3DVN V;  1GC7 A;  1WGG A;  4FHJ A;  2MRP A;  2D11 A;  4IWP A;  2M8S A;  4JL9 A;  3ZNZ B;  2MA9 B;  5DPW A;  1ISN A;  3PRZ A;  3H9D A;  2NPT B;  3DVG X;  4N9F 4;  3SD5 A;  4DDG D;  3KVF B;  3QAR A;  2KLC A;  3IHP C;  5LLI A;  3I3T B;  4EZL A;  2LUE A;  4BKG A;  4TUU A;  3ZO5 B;  3RD2 A;  3PGE A;  4DWF A;  3VTW A;  2KD0 A;  4NNJ B;  4A3O A;  5C23 A;  4CYE A;  3ML8 A;  1LXD A;  3PV1 A;  2FCM A;  3LDZ E;  3JSV A;  5E6O A;  2ZNV B;  4K81 A;  2IO3 B;  3ZRC A;  3N32 A;  4JIO U;  4WJO A;  2GBN A;  2M0X A;  2I1J A;  2KAN A;  1E8W A;  4IC7 B;  4KIK A;  4RM9 A;  1LM8 B;  5HKH A;  2Z59 B;  1WGY A;  1EUV B;  1V86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...