5H8YE

Crystal structure of the complex between maize sulfite reductase and ferredoxin in the form-2 crystal
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite reductase [ferredoxin], chloroplastic
publication title Structural and mutational studies of an electron transfer complex of maize sulfite reductase and ferredoxin.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase/electron transport
total genus 22
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5h8yE00
2PIAA 4ZOHC 2WU5B 1DOYA 1FIQA 3AEBB 2BS3B 1N61A 2K22A 1PUTA 4JWUC 1DOXA 2K5PA 2WDRB 5H92C 3AB5A 1N63A 1QF6A 1NYRA 2W54A 5G5HA 3AE6B 1E0ZA 3B2FA 3CWIA 3HRDD 1AYFA 1XO3A 3VRAB 1WXQA 1SB3C 1NI3A 1QLBB 1JROA 3CIRB 1B9RA 4A9AA 1N5XA 2CJOA 2DWQA 4JX1C 5G5GA 3W5VB 2W3SA 1A70A 1VJKA 3ZYYX 1E6EB 1V8CA 3NVYA 2PVOD 3AE7B 1FXAA 3AECB 1VLBA 1KRHA 1RYJA 3DWGC 4YTPB 1RM6C 1ZUD2 1QOFA 3AH7A 3HUIA 1IUEA 1QOBA 3AE4B 1RWSA 1GAQB 1TYGB 3AEDB 2FBWB 4HRSA 2BT6A 1WYGA 2K9XA 3AEGB 4YSZB 1OQQA 2CJNA 2WDQB 5C3JB 1YJJA 1DOIA 1ZXIA 2HTME 1FXIA 1XLPA 2JQRB 1SIJA 3P4SB 3SFEB 1KF6B 3SFDB 2E3TA 1UWMA 1FO4A 2BS4B 3AM9A 1FFUA 3P4PB 1JQ4A 2PKOA 3WCQA 4C7ZA 1WWTA 2MJ3A 2M56B 3AEAB 1J7AA 3LXFA 1JW9D 2BS2B 5EE1A 1EWYC 2MJDA 1YQ4B 2QIEB 1TKYA 4FXCA 3ABVB 4N6EB 2DBYA 1JWBD 4USAA 1QOGA 2QJLA 4KX6B 4JWSC 3BIID 3LB8C 2KAJA 1L6UA 1QOAA 2Q5WD 3ETRA 1L5PA 5EE0A 1CJEA 1PFDA 2CU3A 2N0SB 2WDVB 4ZHOA 2WQYB 1F0ZA 4YT0B 2W55A 1FRDA 3B9JA 1XLOA 1QT9A 3AMZA 4C7YA 3VR8B 3P4RB 2WS3B 1J7BA 3AN1A 3AEEB 1JWAD 3P63A 3NVWA 1FRRA 3AE8B 1FM0D 3P1MA 3P4QB 1FMAD 2M19A 3RPFC 1TJEA 2KMMA 1NENB 1N62A 3HVZA 3AE5B 2LEKA 2B76B 2OHFA 1XLNA 1N60A 1J7CA 2ACZB 1JRPA 5GXGB 4YXDB 2WLBA 1AWDA 4US8A 1N5WA 2G1EA 1ZP0B 3DWMA 2AX5A 4LTUA 1CZPA 4YTMB 1E10A 1NEKB 3B2GA 2H88B 3NVZA 1WRIA 1L6VA 2W3RA 3FC4A 3AEFB 3PO0A 4YTNB 3AE2B 1GPXA 2H89B 1V97A 1PDXA 1SF0A 2L83A 3NS1A 4IDIA 3VR9B 5EE3A 1VDVA 4ITKA 2Y5CA 5EE9A 3EUB2 3KWLA 3W9CB 1OQRA 3W5UB 2JX5A 2PVGC 1JALA 4N58A 2MH7A 1I7HA 3L4PA 3AE1B 2EKIA 1TKGA 1OFFA 3SR6A 1RFKA 5H8YE 1ZOYB 1E9MA 1YQ3B 4C80A 4ZHPA 1TKEA 2L52A 3AE9B 2WU2B 5C2TB 3AE3B 1T3QA 2WP9B 1XLQA 1NYQA 1FFVA 3FAHA 1YJIA 1R7SA 1ROEA 4WWMA 5AUKA 3VRBB 1DGJA 5MPOA 4N59A 4YSYB 4WQMA 1KFYB 3NRZA 5AUIA 3AV8A 4YSXB 1L0VB 2MJEA 4HROA 1E7PB 4US9A 4P6VF 1NVID 3NVVA 1WGKA
chains in the Genus database with same CATH superfamily
4IG7B 3AEBB 4P7IA 4X57B 3RMKC 1QF6A 2WXMA 2W54A 4MM3B 5E6OA 2WXKA 2INNE 1D5MC 2KMAA 1Q0WB 1R4NI 1D5XC 1N5XA 2PJHA 3WALA 3OAWA 3Q8FA 1K53A 2VZKB 1IGCA 3RZWC 4LNFA 4ZRIA 2V4IB 3V61A 5E6JA 5IA7A 5L83A 4OVVA 4RF1A 2RPVA 3T3OA 1SIJA 3DBHB 2N1WA 3QJZA 3OWEB 4RGTA 1KLUD 3L17A 2KTRA 3A1QA 4K3CA 5D7GA 1TS2A 3IBEA 1XLOA 2UU7A 3ONSA 2WNMA 4NAWA 2LRWA 4ACFA 2M19A 3KH0A 1TZOA 1ET6A 2M0AA 2LRUA 3H7SA 2JZZA 5GMVA 1I4GA 1I4HA 2G1EA 4G3XB 2WXRA 4YTMB 4PYZA 4KGRA 4PS8A 2QEJC 2QDFA 4J6IA 4CO7A 2BVCA 4FHJA 2NBVB 3E56A 2JT4B 2XNAC 1VR9A 3PVLA 2QSDA 1OQRA 4GDKA 1FD6A 2KN5A 3AE1B 1YIWA 1V2YA 2JY6A 2WDTB 4MGIE 2O6VD 3TBLD 1NYQA 4BKSD 3GP7A 4HWIB 2IJ0A 1WMHB 3MC9A 3SD5A 1DOYA 5IAAC 2KYWA 1PUTA 4W9DA 2WX1A 1FNUA 1A5RA 4WJPA 1RRBA 1V9JA 2KDEB 3VRAB 1XO3A 2BB5A 3CIRB 4IM2A 1E7UA 1V5TA 3H9DA 2CHXA 3ZJUA 1AN8A 2W82A 3NVYA 2ZJDA 5LXIB 2KWCA 4II2B 1TYGB 4HPMB 1V5OA 1SGHA 2D11A 2N7JA 4REZA 2L00B 1D3ZA 1MFWA 4B0MA 1QKZA 4WAAA 2ZVNA 3ABVB 2V1YA 2JPHA 1QOAA 2GRIA 2RD0A 1L7YA 1C77A 3VUXA 1FRDA 4C7YA 2SEBD 4KSLC 3TL5A 3WIMA 3KUCB 3RPFC 3X23A 1SBBB 4MSMB 3N32A 2M0XA 3JSVA 2GBJA 1E10A 2AX5A 2JF5A 4IWOA 2K8CA 1I4QA 2N9XA 5D3IB 4TMAB 3W5UB 2D2QA 2JZPA 4KZCA 1P7EA 1Z2MA 2ZW1A 2WXJA 5JHAA 5H8YE 3RULA 2C7HA 3PGEA 3TMPB 4FA6A 2KJHB 5L95C 3HVDA 4P16A 1BT0A 3ZXVA 3WAMA 1BXTA 2KDFB 1YX5B 3AI5A 1WJ6A 3L13A 2Z0DB 3QARA 3VQIA 5H92C 2UWQA 2N9PC 5G5HA 1F52A 4E3CA 2L05A 1YD8U 4AS1A 1JROA 2JSVX 2K1FA 2JYEA 3PRPB 4A9AA 1P7FA 1T0QC 2WXGA 4K7WA 2B3AA 2GLSA 1FEHA 3DBHI 4M8NA 5DPRA 5DPSA 3AE4B 4FLHA 4QAYA 3BINA 3ZW3A 2IGHA 4ASWC 5CHWA 2DZIA 3SFDB 2D3BA 1FO4A 3GE8C 3NHEB 2LWPA 1WR1A 2BWES 2WXNA 3EFUA 2DZKA 4G0NB 2V3PA 3OLMD 1Y8RC 2MP2A 3TJPA 1L2NA 2BKRB 4WJOA 2D3CA 4MACA 1K51A 3A33B 3H6NA 1OTRB 2BF8B 4G11A 5D94A 1J8CA 1WYWB 4IOIE 4LTUA 2MBOA 2H88B 4AP4C 3IHPC 1I42A 3O65B 3A4RA 1GPXA 3AE2B 5EE3A 3EUB2 2BGFA 1ACCA 1YQ3B 2JZ3B 4IUMB 5C2TB 4ARIA 1YNTE 3R7RA 1XLQA 2LZ6A 3DCGA 2REXA 4FBJB 1HZ6A 1HEZE 2RR9A 4YSXB 1E7PB 3RYTA 2PIAA 4WWNA 5HKHA 2R61A 1WSPA 2JVCA 1D5ZC 1P0RA 2MW5A 2LHEA 4MGKE 3U7DA 3V60A 1E8YA 2IO3B 1X1MA 4JIOU 1HTOA 2IO0B 1KM7A 4MH0E 4URKA 1JWUD 3N20C 5J17A 2IZVB 4RGNA 2JWUA 1ZUD2 2AQ3B 4DXAB 1QOBA 2LJ5A 4ZRKA 2BT6A 3AEGB 4W9EA 3TEZA 4JL9A 4OVZA 2O6VA 1KF6B 2A4ZA 4BKSA 1CMXB 1WWTA 5LNK1 2V3SA 1TKYA 3C0RB 3ZGZA 3A9JB 2QC8A 3UQBA 2M17A 5JXVA 1L6UA 2LGYA 3ZNID 4C00A 2FCSA 3PV1A 2KNBA 3P4RB 3AN1A 1V86A 3MTNB 4KZ0A 2M4NA 3RNAC 3I57A 1L4ZB 5C23A 2PTLA 1FM0D 3AXCA 2XBBC 2FIFA 5GXGB 5AZFA 5C1ZA 2HE7A 1ZPSA 3RT3B 1KLVA 1N5WA 3DPDA 2KN4A 2KQSA 3NVZA 4CQNA 2C5LC 1MJDA 3VTVA 3PTFC 2FIDA 4IDIA 4L1BA 4YL8A 3Q14C 1C1YB 1ZOYB 3P2BA 3N3KB 3SEBA 3AE9B 2A5UA 2LXAA 2DLBA 2I1KA 1HTQA 1ROEA 4NAMA 5MPOA 2X8XX 4EEWA 4YSYB 3PZDA 1HA5A 5E6PA 1TS4A 2WXLA 1VCBA 2RDBC 5HFYA 1GOZA 1UBIA 2EMTA 1BMLC 3B2FA 3IG3A 4KVGB 3PLUA 3VUWA 1SB3C 2DWQA 4C4VA 1BUIC 4KIKA 3HK0A 3EHVA 2DNFA 1SE2A 2KOXA 2J0MA 2GB1A 2ZCCA 4DXGA 3Q3NC 3Q8AA 4M0WA 3BY4B 3AEDB 3D32A 4FJZA 5C3JB 3N1ZC 2IBIB 1EU3A 2IDYA 2MRPA 1WRDB 5D3DA 2BS4B 4RFBA 2DZJA 4HCPB 1EF5A 2Z8LA 3QWZB 4A6QA 2O2VA 2KDIA 1IP9A 2QJLA 2YEPB 4XWTA 1LXDA 3LB8C 4WIPA 3A9KA 1F9JA 2VH2A 3OG5A 4FJVB 2LGIA 1TS5A 2KDBA 2W9NA 2KQ4X 1UNSA 4EZLA 1D6EC 3Q8EA 2HD5B 1T0SC 1WGRA 2KWVB 3DBLB 3Q3MC 1RAXA 2KXJA 1MI0A 1IYFA 1SF0A 3BYYB 1VD2A 3PLVA 3S2AA 2FCMA 2V9HA 2MH7A 1OFFA 1I4RA 3MFGA 3TEWA 2KVZA 2RDHA 4AJWA 1E9MA 4ZHPA 2L52A 2LGSA 1Y56A 2RGFA 3EC8A 2CU1A 4AWJA 4HROA 2WXIA 1JRUA 3ZVVA 1V6EA 2ZEQA 4M8MA 3R2IA 1PGAA 2TSSA 2WDRB 3ZLZA 3CWIA 4FHKA 4H2AA 1WXQA 2BWFA 4DHJD 3KQ4A 4B6WA 2CJOA 4JX1C 1DYQA 2EMSA 3JVZX 3RUIB 1VLBA 3K9PB 1ENFA 3ZNHB 4W9KA 1JWSD 2KQ7A 2BYVE 4W9FA 1RWSA 4DWFA 1MHXA 2CHWA 3MP9A 1DOIA 3Q69A 3J9CA 2FE8A 1JQ4A 4W9HA 4BOZB 4OZBA 3LDZE 4LNNA 1UGJA 1IPGA 2PE6B 1JMLA 4M02A 1GB1A 2KWDA 4RNAA 3URYA 4MM3A 1IBXB 4MGZE 1V1PB 1WX7A 3ALBA 3CSTA 4MH8A 2FNJB 2V0GA 3P1MA 4PS3A 1TJEA 2OJWA 4PK1A 2B76B 2ACZB 2LMCA 2X38A 2L8JA 1HQRD 5HI1A 4GLSC 2D07B 3Q3OC 3QA8A 2ONQA 3BVZA 4F7ZA 2KO3A 5EE9A 1ISNA 3KYCD 4A8XC 2KC1A 4PS7A 1OQYA 4RGOS 2LI5A 4E74A 1Q1OA 2ICIA 3PRZA 5T8IA 2MSED 2M1MA 2KD0A 4M01A 3NRZA 3MJ5A 2BTEA 4P6VF 3EFCA 3VXWA 4AUQC 3NVVA 4XGAB 3T8MA 4EZKA 4ZYNA 2LUMA 3QHTA 2HTHA 4IKGA 1NYRA 3W1YA 4GDLB 1PYWD 2MBQA 1AYFA 4GU2A 1S3SG 2PMVA 3BYTB 1TZ1A 1WGYA 4D2KA 3NZSA 2MA9B 3MC0B 3X0WA 1K52A 1FXAA 1YQBA 4CHKA 4YTPB 1UELA 3IXSA 1ESFA 3GS2A 1CK1A 4BFRA 1S1QB 1SIFA 4YSZB 1WGGA 5FKAC 3Q8BA 1FXIA 2CKHB 3AU4A 2JUOA 1ZDVA 2AWTA 3B0AA 1XF5L 4OVUA 3AEAB 1EWYC 3VTUA 1WMHA 1EM7A 3KW5B 1JWBD 1WGDA 2J0KA 2HJ8A 3ETRA 2LGDA 3U4EG 4W9LA 2WDVB 3TEXA 5I4DA 4HLEA 1MG8A 2XK5B 5J18A 1T0RC 3HM6X 4ZRQA 5BYQA 1OEYA 1FMAD 3DBLI 2KMMA 4K1RB 2IO1B 4MT5A 2VH1A 4YXDB 1AWDA 4DHZE 1GG3A 2W3RA 2XK5A 3PO0A 2AEHA 3DVNU 3IVFA 1I35A 2AL3A 2EKIA 3ZDTA 2L32A 2EKEC 1UWXA 4EUTA 2NCNA 3APCA 4RH6A 3R66C 2J4XA 3KVFB 3MJWA 5DCNA 3AV8A 2WWZA 2LXCA 4LDTB 1NVID 3GE3C 1UUPA 4B95A 2R2QA 1LGRA 2K22A 2GMIC 1YN4A 2K5PA 4LK0M 1YN5A 4I6PA 3IAM1 3V6CB 2G3QB 1HZ5A 3R2TA 1B9RA 2Y5BB 4KSKC 2OJRA 2W3SA 3EA6A 1MVKA 4EFOA 1WFYA 2MBBB 3DBSA 5IOIA 4N9F4 5EDSA 3PHWB 2IY0B 4KKIA 4XE0A 1OGWA 4HRSA 3PT2B 2N9KA 3KWVA 4Q2JA 3IT4B 4EZJA 3IFWB 2G4DB 4KDIC 4DHJB 1V1OA 3QQ8B 3KYDD 4ZDVA 2MJDA 2QIEB 4HPPA 2KJRA 5J2RA 1N6ZA 5EE0A 2LVOA 2AQ2B 1NDDA 2V4LA 1SJED 3UIOB 5CHVC 4BBNC 3V3XA 4XYCA 2KJ6A 3RI7C 4GIVA 2IGDA 1N62A 1T0YA 1V80A 2LEKA 2LGXA 2LD9A 2KWUB 3FKYA 2C7MB 3ZKJC 5BYRA 1OEYJ 2V3NA 3NY5A 1XQQA 1C76A 1Q10A 2YEPF 4ITKA 1LFDA 4GXBA 3RNCC 3U2SC 4DK5A 2MBHA 2IGGA 4P1CC 1WM3A 4P1BC 2JRIB 3V62A 3ZO5B 1FFVA 4A55A 1F2RI 1PGXA 5AUKA 1KFYB 4BOSC 4OZCA 2N7DA 2GOWA 2KC2A 4HDOA 1VZ6A 3ZRCA 3KUZA 5AZHA 2K8BA 4ZRPA 3ZQ4A 3DBRB 1WXSA 1XXGA 3PSEB 4ARCA 3ZIMA 1E8XA 1KJTA 3ZNGC 2NPTB 2QILA 3H8HA 3RN9C 4MDKE 1CQVA 3QX1A 1C4PA 3PHXB 1IUEA 2C60A 4IWQA 1WYGA 1PGBA 4MJSB 4FADA 1TBEA 4TSSA 2Y5PA 3AM9A 2DAJA 3PREA 1WM2A 3TCAA 1TIFA 1FNWA 2DBYA 1UD7A 2PLPA 2Q5WD 3BVMA 1M94A 2D3GA 5G55A 1GNUA 1F0ZA 2N9LA 3FILB 3RD2A 1TY0A 2WS3B 3UIPB 5CTRC 3RZFA 4XDCA 4G50A 3C8YA 3EGRA 1QZEA 3HM3A 5AEKB 4KGSA 2KFKB 3V05A 1N60A 1EUVB 1WX9A 4RGMA 4A90A 1EF1A 1CZPA 1NEKB 1UGMA 2N4FA 3B1LX 3ZNZB 3FC4A 3R3MA 2H89B 1KLGD 3VDZA 1RLFA 1WE6A 1E8WA 2PVGC 2LVQA 1JALA 1TKGA 4JE3B 3VUYA 3M62B 2WU2B 4L23A 3QIJA 1WZ0A 1JWMD 3A9JA 5BMIA 1WX8A 4S0RA 2OOBB 2J0JA 2WYQA 3PZ8A 2AQ1B 4ZOHC 4BKTA 2EELA 1N63A 2JYTA 3AE6B 3NJTA 1TGZB 5LLIA 4TUUA 1ZXHA 4BAXA 1WXMA 1K8RB 1YN3A 2MBEA 3PPAA 3ZYYX 5TSSA 2IY1B 2PVOD 1R4MB 3I3TB 2DAFA 2DX5B 2K39A 4JGHB 2FBWB 2WDQB 3A4SC 2DYBA 1M4VA 2NBWB 4IW0A 3P4PB 5D6JB 1JCKB 4NJCA 1AARA 5KHQA 4AOFA 3JW0X 5EE1A 2CS4A 5BYSA 3R7QA 1CJEA 2LASA 1J0GA 1K50A 3VR8B 1C4AA 3DVNV 3ML9A 3L10B 4RF0A 1WGHA 1FRRA 1SE9A 2BPSA 4MGYE 5JZEB 5HG2A 1ZDXA 4RCOA 2K6DB 4PT5A 4B9KA 2D5GA 1VRAB 4DXFA 1V97A 2L83A 4DQOC 4WAFA 2JX5A 3DHHC 2NBUA 2KMCA 3EECA 4RM8A 4L2YA 4C80A 2N9EB 2G4SA 2J42A 2ZCBA 2L76A 2INPE 2N7EA 2ZPNA 1G6JA 1J19A 1I4XA 2DYOA 2PPHA 5AUIA 3DBRI 1UBQA 4LDTD 4ANVA 2WU5B 3AU5A 1FXTB 1U4AA 3RNEC 2GBMA 4ZRJA 3Q8CA 4LNIA 3NZUA 3VH4B 5TR5A 2HJ1A 3M95A 4HVBA 2M8SA 3UQAA 1KH0A 4BBNF 2DYMA 5FR3A 1A70A 5JH5C 1ZW7A 1WIAA 3ECIA 3AE7B 1T6BX 3ENEA 3Q2AC 1KRHA 3L0WB 2Z0EB 3NG0A 4TKNA 1GJZA 2RPQA 2MJ3A 2M56B 3RNGC 3LXFA 5HHDG 4N6EB 1F77A 3K9OB 4USAA 2WXHA 2XEWA 4KX6B 4LJPB 2NMQA 2KAJA 2LUEA 2PE9A 4C56C 4GN1A 3UI3A 4LLGM 3OJ4B 3MC8A 4W9JA 1L4DB 3AULA 3I5JC 3BVGA 1ET9A 2MCNB 1EO6A 4FULA 1WZ3A 5IN7A 2MQJA 3TSSA 3RFZB 2AYOB 3M3JA 1L0YB 2MLBA 5IP4D 4GOCA 2NR2A 1JRPA 2FCQA 4NNJB 1ZP0B 3B2GA 4EOYA 2AL6A 2BYEA 5FK9C 4LNKA 4NJ6A 1SJHD 1TY2A 3DHGC 5LXHA 2L0TA 3W9CB 3KWLA 3NOBA 4FN2A 3C19A 3L4PA 3QK0A 1ZGUB 1T3QA 2YVCA 2KTRB 3A1QB 1WXAA 4US9A 2D10A 3CF6E 1IBXA 3IT6B 1V1PA 1I4PA 4GMVA 1DOXA 1IGDA 1WJUA 4XWWA 3T3NA 4NAWB 1R4MI 4IM3A 4OHJA 3RCZA 1WJNA 2L7RA 3UGBB 2Z59B 2LVPA 1GUAB 1RM6C 2VRRB 3AH7A 3B08A 2C7NB 2E6XA 3N1XC 4GSWA 2CR5A 2K9XA 4LNOA 1SXTA 3SFEB 4ANWA 2DENB 4NQLB 2K3UA 1FPYA 4GDKB 4HCNB 3ZUNA 2PKOA 1KTKA 2J7QB 3ML8A 1VZ8A 4XC2A 2KTFA 2WXOA 1WXVA 2KKCA 1XCTL 4HKZE 1ZKHA 2KLCA 4GDLA 1B1ZA 4BKGA 3E9SA 3T9LA 1QILA 2DZMA 1NENB 3AE5B 2WXQA 4KGTA 5BO4B 4BZAA 3H7PB 3DVGX 4ANUA 3IAS1 4PYUA 1UZXB 3W2DA 3CMMB 5DPWA 4ZYSA 1SSNA 2ZNVB 1L6VA 2ZPYA 2INCC 3AEFB 4YTNB 2K8HA 1PDXA 2ZZPB 3LJ3A 1VDVA 4WH4A 4AJYB 2Y5CA 3HHMA 1V49A 3P42A 2FAZA 3QC8B 3H7PA 4IM0A 4EKUA 1YOVB 3GOEA 3AE3B 4NPNA 2BYTA 1C79A 1DGJA 2G9HD 2INDC 3DDCB 4N59A 1WJ4A 1Q5WB 5KHOA 2MJEA 1F2RC 5E6NA 4WWOA 3W1SA 1H4RA 1MHHE 2BS3B 2QMTA 1PQSA 2GBKA 2MEKA 1WI0A 3JSVB 3M63B 3BK2A 1XCQL 2G45B 3APFA 1YJ1A 1OQQA 2CJNA 1SEBD 2GI9A 2HTME 3L16A 2WXPA 1XLPA 1AW7A 2JQRB 4TV3A 3KLSX 5BMGA 4KKJA 1JW9D 4ICVA 1YQ4B 5D2MB 2ZNVC 4FXCA 3N1YC 3GB1A 1WY8A 4JWSC 4HK2A 1L5PA 2NVUI 2WQYB 2RDGA 2WHIA 4YT0B 4JQWC 2W55A 3ZJTA 3AMZA 3CSFA 3W1SC 1P9DU 3AEEB 1C3TA 1JWAD 3DOWA 3ZTCA 2CHZA 3AE8B 1NI2A 1WR6E 2Y3AA 5CHFA 1J7CA 2WLBA 2NTSA 3VH3B 4US8A 4TQ0A 2JU6X 4KV2A 4YWGG 4R3DA 3VR9B 2J53A 3PRMB 2KACA 3APDA 4N58A 3SR6A 2JWZA 1YX6B 4I6NB 1WF9A 5CX3A 2WP9B 2HDEA 2UYZB 3VRBB 1P98A 4WWMA 4WQMA 2RMMA 2SAKA 3QAQA 4K7SA 2MP2B 1XEEA 1FCLA 1XT9B 1YMHE 4WURA 3U8ZA 2QHOA 1EWCA 2OEDA 1LM8B 1F1HA 3SHQA 2PEAA 3LYYA 3ZTDA 1D4BA 3W5VB 2BW2A 2QCZA 2I1JA 1VJKA 1LO5D 3ZJVA 3H1UA 4KDLB 3SDLC 1H8CA 2ZW0A 2I38A 4HKQA 1QOFA 2KLGA 2WX0A 1GAQB 1ZE3D 3NZ3A 5IKCM 2ZVOA 3GZNB 3WAPA 3Q6BA 2KK8A 2WGSA 1NBFC 2K6QA 5G2NA 4DBGA 5BMHA 2JRHA 3OJ3A 2IPKD 3PZ7A 4JLCA 4O1NA 2XN9C 2N1VA 1E8ZA 4HXDA 4J3OD 1P3QU 1T5XD 3R8BA 1MG4A 1P1AA 2LJIA 1GC6A 3HVZA 4HDQA 2NPTA 3NS8A 2JXTA 2PW9A 1UF0A 2KT7A 2KX0A 1SE4A 2KZRA 3WAOA 4CYEA 2LHDA 4K7UA 3VTWA 3NS1A 4GB9A 4MJSA 3N30A 4HJGE 3U7ZA 1RFKA 2O6VB 2IO2B 4W9IA 3RNFC 4I6LB 1KOTA 3SU8X 3MHSD 3FAHA 2VZKD 1YJIA 1R7SA 3KUDB 1E90A 1UH6A 1GB4A 1TT5B 3FILA 4A3PA 4HJKA 4HEA1 4DDID 1C9FA 1FIQA 1N61A 4M00A 2J52A 3BK1A 1GC7A 2KFKA 2K25A 1HE8A 2KX3A 1QLBB 4NZLB 5G5GA 3I63C 2BQQA 2L1AA 3DVGY 4W9CA 1E6EB 1C78A 1V8CA 3AECB 4B0EA 2FCNA 3DWGC 2MHJA 1XD3B 1R4NB 4S17A 3BZDB 1WE7A 2L0FA 1SE3A 4A3OA 2YLMA 4HPLB 1YJJA 3L08A 1ZXIA 3Q3FA 3TIXA 3P4SB 4MEMA 4FJYA 3I9V1 2E3TA 1UWMA 1FCCC 1FFUA 1C4CA 3V6EB 3WCQA 3DQVA 4K81A 1J7AA 4F1SA 1QQRA 3TEYA 1QOGA 4K3BA 3BIID 4XDDA 2IYDB 3ZXRA 1PFDA 2CU3A 2N0SB 4MSQB 2ASQA 1E5WA 1QT9A 3U52E 3U30A 3VHTC 4WQOB 4XX5A 3P63A 3NVWA 1RFAA 3P4QB 5DPTA 2BKFA 4F8CB 3DWMA 4C4VB 4KIKB 1WRIA 2KVRA 4NJ7A 2KANA 2MX2A 4W9GA 4M0WB 4EE2A 1TKEA 4II3B 1TS3A 3ZRFA 1LQBA 3UINB 2GBRA 1V81A 3QCAA 4AQ7A 2FUG1 3ZDMC 2R2OA 1L0VB 2O2VB 4TQ1A 2JXXA 3O13A 1WGKA 3WA0A 2L3ZA 3A9KB 4JWUC 3VFKA 3N9YC 3AB5A 5IO9A 4WJNA 3UF8A 1E0ZA 3HRDD 2KFJA 3WANA 4IC7B 3BWUD 1NI3A 2BYFA 2C9WB 5FR6A 3VAWA 3GZNI 4LCDE 2WXFA 1WH3A 1RYJA 2KDMA 4BVUC 1TTNA 3HUIA 2KHWB 1VZ7A 3TUOA 2K0PA 4A20A 4IWPA 3NUHB 1MPEA 4C7ZA 4WWPA 1E7VA 2NS5A 2BS2B 4ICUA 2GBNA 1EU4A 4RMAA 4ZHOA 3B9JA 4OW0A 4XZ4A 1J7BA 4DDGD 3RNBC 4NQKE 1FNVA 4DHZB 4MELA 2BB6A 2RSUA 3PS6A 4UDUC 1L0XB 4WJQA 2FUHB 3MHZA 4ANXA 2OHFA 1XLNA 4RM9A 3DHIC 3L54A 2LFIA 4GGQA 2NTTA 1Z5SB 2BBCA 4NY0A 1STEA 3Q3JA 1I7HA 3VVWB 2D3AA 4JPSA 4E71A 3HIZA 3JYUA 5JHBA 2ON8A 4LJOB 2DHZA 4OZAA 5AZGA 1HXYD 2MWSB 2I2YA
chains in the Genus database with same CATH topology
3W1SA 3AEBB 1MHHE 2BS3B 4ZRPA 1QF6A 2WXMA 5HFYA 2W54A 1GOZA 4MM3B 1BMLC 3B2FA 3ZQ4A 2QMTA 2WXKA 2INNE 1D5MC 1XXGA 1SB3C 1D5XC 1N5XA 2DWQA 4ARCA 1BUIC 3Q8FA 1K53A 2VZKB 1IGCA 1SE2A 2QILA 3H8HA 2GB1A 2MEKA 4DXGA 1CQVA 1C4PA 3BK2A 1XCQL 2V4IB 5E6JA 3Q8AA 4M0WA 1IUEA 3AEDB 1WYGA 4RF1A 5C3JB 2RPVA 1OQQA 2CJNA 1PGBA 3T3OA 1SEBD 2GI9A 2HTME 2WXPA 1XLPA 1AW7A 1SIJA 2JQRB 4TSSA 1EU3A 2IDYA 5D3DA 2Y5PA 3KLSX 2BS4B 3AM9A 4RFBA 3OWEB 5BMGA 4KKJA 4RGTA 1KLUD 1JW9D 2Z8LA 1YQ4B 4A6QA 1FNWA 4FXCA 2DBYA 3GB1A 2QJLA 2YEPB 4XWTA 4JWSC 2PLPA 2Q5WD 3BVMA 3LB8C 5D7GA 1L5PA 1TS2A 4WIPA 1F0ZA 2WQYB 2RDGA 2N9LA 4YT0B 3ZJTA 2W55A 1XLOA 3AMZA 3FILB 1TY0A 2LGIA 2WS3B 1TS5A 3AEEB 1JWAD 2WNMA 4XDCA 3AE8B 2KQ4X 1UNSA 2M19A 1TZOA 3C8YA 1D6EC 1ET6A 2M0AA 3EGRA 3Q8EA 2Y3AA 4KGSA 3V05A 1N60A 1J7CA 4RGMA 2WLBA 2NTSA 1I4GA 4A90A 1I4HA 4US8A 2G1EA 4YTMB 2WXRA 1CZPA 1NEKB 4KGRA 2QEJC 4TQ0A 3E56A 3FC4A 2JU6X 2XNAC 1VR9A 2H89B 1KLGD 1MI0A 4R3DA 4YWGG 3VR9B 1SF0A 2QSDA 3BYYB 2J53A 1OQRA 2KACA 2PVGC 1JALA 4N58A 2MH7A 1FD6A 3AE1B 1TKGA 1OFFA 1I4RA 3SR6A 3MFGA 3TEWA 4JE3B 2RDHA 1E9MA 4ZHPA 2L52A 2WU2B 4L23A 2WP9B 2HDEA 1JWMD 1Y56A 1NYQA 5BMIA 3VRBB 3GP7A 4WWMA 4WQMA 2RMMA 2SAKA 2IJ0A 4HROA 2WXIA 3PZ8A 3R2IA 1PGAA 2AQ1B 4ZOHC 1DOYA 1XEEA 1FCLA 1YMHE 2EELA 1PUTA 2TSSA 2WDRB 4WURA 1N63A 1FNUA 2JYTA 3AE6B 3CWIA 3VRAB 1XO3A 2BB5A 4H2AA 1WXQA 1EWCA 2OEDA 1ZXHA 3CIRB 3KQ4A 2CJOA 3LYYA 4JX1C 1YN3A 1D4BA 1DYQA 3W5VB 2BW2A 3ZJUA 1VJKA 3ZYYX 1AN8A 1LO5D 5TSSA 2W82A 3ZJVA 3NVYA 2PVOD 1VLBA 2ZW0A 2I38A 4HKQA 1ENFA 1QOFA 1JWSD 1RWSA 1GAQB 1TYGB 1ZE3D 3NZ3A 2FBWB 1MHXA 2WDQB 3MP9A 1DOIA 3Q69A 1M4VA 2N7JA 3J9CA 2FE8A 4REZA 3P4PB 1JQ4A 1JCKB 4NJCA 4OZBA 4B0MA 1QKZA 5EE1A 5BMHA 1UGJA 2IPKD 3ABVB 1JMLA 3PZ7A 1GB1A 2KWDA 4O1NA 5BYSA 2XN9C 1QOAA 4RNAA 2GRIA 1CJEA 3URYA 4J3OD 1C77A 1FRDA 4C7YA 1K50A 3VR8B 1C4AA 1T5XD 1IBXB 2SEBD 3R8BA 1V1PB 4MH8A 4RF0A 2V0GA 1FRRA 3P1MA 2LJIA 3RPFC 1TJEA 5HG2A 1ZDXA 3HVZA 1SBBB 2B76B 2ACZB 2LMCA 2X38A 4RCOA 2JXTA 2PW9A 1E10A 2AX5A 4PT5A 1SE4A 1HQRD 5HI1A 2D5GA 2LHDA 4GLSC 1VRAB 4DXFA 1I4QA 1V97A 2ONQA 3BVZA 3NS1A 2L83A 4DQOC 5EE9A 4HJGE 4TMAB 4WAFA 5D3IB 3W5UB 2JX5A 2JZPA 1P7EA 2ZW1A 3U7ZA 2WXJA 1RFKA 5H8YE 4A8XC 4L2YA 4C80A 4RGOS 2J42A 2INPE 2ICIA 3HVDA 3FAHA 2VZKD 4P16A 5T8IA 1YJIA 1R7SA 1I4XA 1GB4A 3NRZA 1BXTA 2DYOA 5AUIA 3MJ5A 2BTEA 3FILA 4P6VF 4HEA1 3NVVA 1C9FA 2WU5B 2LUMA 1FIQA 1N61A 3VQIA 5H92C 3Q8CA 4IKGA 2J52A 1NYRA 5G5HA 3BK1A 4GDLB 1PYWD 4AS1A 1AYFA 2PMVA 3BYTB 1QLBB 1JROA 2JSVX 4A9AA 2JYEA 4D2KA 1KH0A 4NZLB 1P7FA 5G5GA 2DYMA 5FR3A 2WXGA 2L1AA 3MC0B 1A70A 1K52A 1E6EB 1C78A 1V8CA 3AE7B 1T6BX 1FXAA 3AECB 4B0EA 1FEHA 1KRHA 3DWGC 4YTPB 3IXSA 1ESFA 3BZDB 3GS2A 1CK1A 3AE4B 4YSZB 1SE3A 1YJJA 1ZXIA 2IGHA 3Q8BA 1FXIA 5FKAC 3P4SB 1ZDVA 3I9V1 2E3TA 3SFDB 1UWMA 1FO4A 1FCCC 1FFUA 1C4CA 1XF5L 3WCQA 2MJ3A 2M56B 3AEAB 1J7AA 3LXFA 5HHDG 1EWYC 2WXNA 4N6EB 1EM7A 1F77A 1QQRA 4USAA 1JWBD 2WXHA 2V3PA 3TEYA 1QOGA 4KX6B 2NMQA 3BIID 2KAJA 3ETRA 4C56C 4XDDA 3U4EG 3UI3A 1PFDA 2CU3A 2N0SB 2WDVB 4LLGM 3TEXA 1L4DB 5I4DA 1QT9A 3BVGA 1ET9A 3U52E 3P63A 4MACA 3NVWA 1K51A 4ZRQA 5BYQA 3TSSA 3P4QB 1FMAD 3RFZB 2KMMA 1L0YB 1JRPA 4MT5A 4YXDB 1AWDA 3DWMA 4IOIE 1ZP0B 4LTUA 3B2GA 2H88B 1WRIA 2W3RA 3PO0A 5FK9C 3AE2B 1GPXA 1SJHD 1TY2A 5EE3A 3EUB2 3KWLA 3W9CB 3L4PA 2EKIA 2L32A 1ACCA 1UWXA 1YQ3B 4EE2A 1TKEA 5C2TB 4ARIA 1YNTE 1T3QA 1TS3A 1XLQA 4RH6A 2J4XA 1HZ6A 2FUG1 4AQ7A 1HEZE 4YSXB 3AV8A 1L0VB 4TQ1A 1E7PB 4US9A 1NVID 1IBXA 1UUPA 3IT6B 3O13A 1WGKA 1V1PA 2PIAA 1I4PA 2R61A 2K22A 4JWUC 1DOXA 1YN4A 2K5PA 3N9YC 4LK0M 1WSPA 1YN5A 3AB5A 1D5ZC 2LHEA 1E0ZA 1IGDA 3HRDD 3IAM1 3BWUD 4XWWA 3T3NA 4NAWB 1NI3A 1HZ5A 3R2TA 1B9RA 4OHJA 2W3SA 3EA6A 1MVKA 2WXFA 1JWUD 4RGNA 1RYJA 2JWUA 1RM6C 1ZUD2 3AH7A 2AQ3B 2KDMA 2E6XA 3HUIA 1QOBA 4KKIA 4XE0A 1VZ7A 4HRSA 2BT6A 3AEGB 2K9XA 3TUOA 3TEZA 2K0PA 2N9KA 3KWVA 4Q2JA 3IT4B 1SXTA 3SFEB 4OVZA 3NUHB 1KF6B 2K3UA 4GDKB 1MPEA 2PKOA 4C7ZA 1KTKA 1WWTA 5LNK1 1V1OA 2BS2B 1VZ8A 2MJDA 2QIEB 1TKYA 2WXOA 1EU4A 3ZGZA 5JXVA 1L6UA 5EE0A 1XCTL 4ZHOA 4HKZE 2AQ2B 3B9JA 1SJED 4OW0A 3P4RB 1J7BA 3AN1A 3V3XA 1B1ZA 1FNVA 3I57A 1L4ZB 2PTLA 2BB6A 1FM0D 3E9SA 4UDUC 1L0XB 2IGDA 1QILA 1NENB 1N62A 3AE5B 2WXQA 3MHZA 2LEKA 4KGTA 2OHFA 1XLNA 5GXGB 2LFIA 3IAS1 1ZPSA 1N5WA 3W2DA 2KN4A 2NTTA 4ZYSA 3NVZA 1SSNA 1L6VA 4CQNA 3AEFB 5BYRA 4YTNB 2V3NA 1C76A 1PDXA 1Q10A 2BBCA 2YEPF 4IDIA 1STEA 1VDVA 4ITKA 4WH4A 2Y5CA 4L1BA 3P42A 3U2SC 1I7HA 2IGGA 1ZOYB 3SEBA 4JPSA 3AE9B 3AE3B 2DLBA 1FFVA 4A55A 1F2RI 2ON8A 2BYTA 1PGXA 1ROEA 4NAMA 5AUKA 1C79A 1DGJA 2G9HD 4N59A 4OZAA 4YSYB 5MPOA 1KFYB 4OZCA 2MJEA 1HXYD 1HA5A 1F2RC 1VZ6A 1TS4A 2I2YA 2WXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PIA A;  4ZOH C;  2WU5 B;  1DOY A;  1FIQ A;  3AEB B;  2BS3 B;  1N61 A;  2K22 A;  1PUT A;  4JWU C;  1DOX A;  2K5P A;  2WDR B;  5H92 C;  3AB5 A;  1N63 A;  1QF6 A;  1NYR A;  2W54 A;  5G5H A;  3AE6 B;  1E0Z A;  3B2F A;  3CWI A;  3HRD D;  1AYF A;  1XO3 A;  3VRA B;  1WXQ A;  1SB3 C;  1NI3 A;  1QLB B;  1JRO A;  3CIR B;  1B9R A;  4A9A A;  1N5X A;  2CJO A;  2DWQ A;  4JX1 C;  5G5G A;  3W5V B;  2W3S A;  1A70 A;  1VJK A;  3ZYY X;  1E6E B;  1V8C A;  3NVY A;  2PVO D;  3AE7 B;  1FXA A;  3AEC B;  1VLB A;  1KRH A;  1RYJ A;  3DWG C;  4YTP B;  1RM6 C;  1ZUD 2;  1QOF A;  3AH7 A;  3HUI A;  1IUE A;  1QOB A;  3AE4 B;  1RWS A;  1GAQ B;  1TYG B;  3AED B;  2FBW B;  4HRS A;  2BT6 A;  1WYG A;  2K9X A;  3AEG B;  4YSZ B;  1OQQ A;  2CJN A;  2WDQ B;  5C3J B;  1YJJ A;  1DOI A;  1ZXI A;  2HTM E;  1FXI A;  1XLP A;  2JQR B;  1SIJ A;  3P4S B;  3SFE B;  1KF6 B;  3SFD B;  2E3T A;  1UWM A;  1FO4 A;  2BS4 B;  3AM9 A;  1FFU A;  3P4P B;  1JQ4 A;  2PKO A;  3WCQ A;  4C7Z A;  1WWT A;  2MJ3 A;  2M56 B;  3AEA B;  1J7A A;  3LXF A;  1JW9 D;  2BS2 B;  5EE1 A;  1EWY C;  2MJD A;  1YQ4 B;  2QIE B;  1TKY A;  4FXC A;  3ABV B;  4N6E B;  2DBY A;  1JWB D;  4USA A;  1QOG A;  2QJL A;  4KX6 B;  4JWS C;  3BII D;  3LB8 C;  2KAJ A;  1L6U A;  1QOA A;  2Q5W D;  3ETR A;  1L5P A;  5EE0 A;  1CJE A;  1PFD A;  2CU3 A;  2N0S B;  2WDV B;  4ZHO A;  2WQY B;  1F0Z A;  4YT0 B;  2W55 A;  1FRD A;  3B9J A;  1XLO A;  1QT9 A;  3AMZ A;  4C7Y A;  3VR8 B;  3P4R B;  2WS3 B;  1J7B A;  3AN1 A;  3AEE B;  1JWA D;  3P63 A;  3NVW A;  1FRR A;  3AE8 B;  1FM0 D;  3P1M A;  3P4Q B;  1FMA D;  2M19 A;  3RPF C;  1TJE A;  2KMM A;  1NEN B;  1N62 A;  3HVZ A;  3AE5 B;  2LEK A;  2B76 B;  2OHF A;  1XLN A;  1N60 A;  1J7C A;  2ACZ B;  1JRP A;  5GXG B;  4YXD B;  2WLB A;  1AWD A;  4US8 A;  1N5W A;  2G1E A;  1ZP0 B;  3DWM A;  2AX5 A;  4LTU A;  1CZP A;  4YTM B;  1E10 A;  1NEK B;  3B2G A;  2H88 B;  3NVZ A;  1WRI A;  1L6V A;  2W3R A;  3FC4 A;  3AEF B;  3PO0 A;  4YTN B;  3AE2 B;  1GPX A;  2H89 B;  1V97 A;  1PDX A;  1SF0 A;  2L83 A;  3NS1 A;  4IDI A;  3VR9 B;  5EE3 A;  1VDV A;  4ITK A;  2Y5C A;  5EE9 A;  3EUB 2;  3KWL A;  3W9C B;  1OQR A;  3W5U B;  2JX5 A;  2PVG C;  1JAL A;  4N58 A;  2MH7 A;  1I7H A;  3L4P A;  3AE1 B;  2EKI A;  1TKG A;  1OFF A;  3SR6 A;  1RFK A;  5H8Y E;  1ZOY B;  1E9M A;  1YQ3 B;  4C80 A;  4ZHP A;  1TKE A;  2L52 A;  3AE9 B;  2WU2 B;  5C2T B;  3AE3 B;  1T3Q A;  2WP9 B;  1XLQ A;  1NYQ A;  1FFV A;  3FAH A;  1YJI A;  1R7S A;  1ROE A;  4WWM A;  5AUK A;  3VRB B;  1DGJ A;  5MPO A;  4N59 A;  4YSY B;  4WQM A;  1KFY B;  3NRZ A;  5AUI A;  3AV8 A;  4YSX B;  1L0V B;  2MJE A;  4HRO A;  1E7P B;  4US9 A;  4P6V F;  1NVI D;  3NVV A;  1WGK A; 
#chains in the Genus database with same CATH topology
 4IG7 B;  3AEB B;  4P7I A;  4X57 B;  3RMK C;  1QF6 A;  2WXM A;  2W54 A;  4MM3 B;  5E6O A;  2WXK A;  2INN E;  1D5M C;  2KMA A;  1Q0W B;  1R4N I;  1D5X C;  1N5X A;  2PJH A;  3WAL A;  3OAW A;  3Q8F A;  1K53 A;  2VZK B;  1IGC A;  3RZW C;  4LNF A;  4ZRI A;  2V4I B;  3V61 A;  5E6J A;  5IA7 A;  5L83 A;  4OVV A;  4RF1 A;  2RPV A;  3T3O A;  1SIJ A;  3DBH B;  2N1W A;  3QJZ A;  3OWE B;  4RGT A;  1KLU D;  3L17 A;  2KTR A;  3A1Q A;  4K3C A;  5D7G A;  1TS2 A;  3IBE A;  1XLO A;  2UU7 A;  3ONS A;  2WNM A;  4NAW A;  2LRW A;  4ACF A;  2M19 A;  3KH0 A;  1TZO A;  1ET6 A;  2M0A A;  2LRU A;  3H7S A;  2JZZ A;  5GMV A;  1I4G A;  1I4H A;  2G1E A;  4G3X B;  2WXR A;  4YTM B;  4PYZ A;  4KGR A;  4PS8 A;  2QEJ C;  2QDF A;  4J6I A;  4CO7 A;  2BVC A;  4FHJ A;  2NBV B;  3E56 A;  2JT4 B;  2XNA C;  1VR9 A;  3PVL A;  2QSD A;  1OQR A;  4GDK A;  1FD6 A;  2KN5 A;  3AE1 B;  1YIW A;  1V2Y A;  2JY6 A;  2WDT B;  4MGI E;  2O6V D;  3TBL D;  1NYQ A;  4BKS D;  3GP7 A;  4HWI B;  2IJ0 A;  1WMH B;  3MC9 A;  3SD5 A;  1DOY A;  5IAA C;  2KYW A;  1PUT A;  4W9D A;  2WX1 A;  1FNU A;  1A5R A;  4WJP A;  1RRB A;  1V9J A;  2KDE B;  3VRA B;  1XO3 A;  2BB5 A;  3CIR B;  4IM2 A;  1E7U A;  1V5T A;  3H9D A;  2CHX A;  3ZJU A;  1AN8 A;  2W82 A;  3NVY A;  2ZJD A;  5LXI B;  2KWC A;  4II2 B;  1TYG B;  4HPM B;  1V5O A;  1SGH A;  2D11 A;  2N7J A;  4REZ A;  2L00 B;  1D3Z A;  1MFW A;  4B0M A;  1QKZ A;  4WAA A;  2ZVN A;  3ABV B;  2V1Y A;  2JPH A;  1QOA A;  2GRI A;  2RD0 A;  1L7Y A;  1C77 A;  3VUX A;  1FRD A;  4C7Y A;  2SEB D;  4KSL C;  3TL5 A;  3WIM A;  3KUC B;  3RPF C;  3X23 A;  1SBB B;  4MSM B;  3N32 A;  2M0X A;  3JSV A;  2GBJ A;  1E10 A;  2AX5 A;  2JF5 A;  4IWO A;  2K8C A;  1I4Q A;  2N9X A;  5D3I B;  4TMA B;  3W5U B;  2D2Q A;  2JZP A;  4KZC A;  1P7E A;  1Z2M A;  2ZW1 A;  2WXJ A;  5JHA A;  5H8Y E;  3RUL A;  2C7H A;  3PGE A;  3TMP B;  4FA6 A;  2KJH B;  5L95 C;  3HVD A;  4P16 A;  1BT0 A;  3ZXV A;  3WAM A;  1BXT A;  2KDF B;  1YX5 B;  3AI5 A;  1WJ6 A;  3L13 A;  2Z0D B;  3QAR A;  3VQI A;  5H92 C;  2UWQ A;  2N9P C;  5G5H A;  1F52 A;  4E3C A;  2L05 A;  1YD8 U;  4AS1 A;  1JRO A;  2JSV X;  2K1F A;  2JYE A;  3PRP B;  4A9A A;  1P7F A;  1T0Q C;  2WXG A;  4K7W A;  2B3A A;  2GLS A;  1FEH A;  3DBH I;  4M8N A;  5DPR A;  5DPS A;  3AE4 B;  4FLH A;  4QAY A;  3BIN A;  3ZW3 A;  2IGH A;  4ASW C;  5CHW A;  2DZI A;  3SFD B;  2D3B A;  1FO4 A;  3GE8 C;  3NHE B;  2LWP A;  1WR1 A;  2BWE S;  2WXN A;  3EFU A;  2DZK A;  4G0N B;  2V3P A;  3OLM D;  1Y8R C;  2MP2 A;  3TJP A;  1L2N A;  2BKR B;  4WJO A;  2D3C A;  4MAC A;  1K51 A;  3A33 B;  3H6N A;  1OTR B;  2BF8 B;  4G11 A;  5D94 A;  1J8C A;  1WYW B;  4IOI E;  4LTU A;  2MBO A;  2H88 B;  4AP4 C;  3IHP C;  1I42 A;  3O65 B;  3A4R A;  1GPX A;  3AE2 B;  5EE3 A;  3EUB 2;  2BGF A;  1ACC A;  1YQ3 B;  2JZ3 B;  4IUM B;  5C2T B;  4ARI A;  1YNT E;  3R7R A;  1XLQ A;  2LZ6 A;  3DCG A;  2REX A;  4FBJ B;  1HZ6 A;  1HEZ E;  2RR9 A;  4YSX B;  1E7P B;  3RYT A;  2PIA A;  4WWN A;  5HKH A;  2R61 A;  1WSP A;  2JVC A;  1D5Z C;  1P0R A;  2MW5 A;  2LHE A;  4MGK E;  3U7D A;  3V60 A;  1E8Y A;  2IO3 B;  1X1M A;  4JIO U;  1HTO A;  2IO0 B;  1KM7 A;  4MH0 E;  4URK A;  1JWU D;  3N20 C;  5J17 A;  2IZV B;  4RGN A;  2JWU A;  1ZUD 2;  2AQ3 B;  4DXA B;  1QOB A;  2LJ5 A;  4ZRK A;  2BT6 A;  3AEG B;  4W9E A;  3TEZ A;  4JL9 A;  4OVZ A;  2O6V A;  1KF6 B;  2A4Z A;  4BKS A;  1CMX B;  1WWT A;  5LNK 1;  2V3S A;  1TKY A;  3C0R B;  3ZGZ A;  3A9J B;  2QC8 A;  3UQB A;  2M17 A;  5JXV A;  1L6U A;  2LGY A;  3ZNI D;  4C00 A;  2FCS A;  3PV1 A;  2KNB A;  3P4R B;  3AN1 A;  1V86 A;  3MTN B;  4KZ0 A;  2M4N A;  3RNA C;  3I57 A;  1L4Z B;  5C23 A;  2PTL A;  1FM0 D;  3AXC A;  2XBB C;  2FIF A;  5GXG B;  5AZF A;  5C1Z A;  2HE7 A;  1ZPS A;  3RT3 B;  1KLV A;  1N5W A;  3DPD A;  2KN4 A;  2KQS A;  3NVZ A;  4CQN A;  2C5L C;  1MJD A;  3VTV A;  3PTF C;  2FID A;  4IDI A;  4L1B A;  4YL8 A;  3Q14 C;  1C1Y B;  1ZOY B;  3P2B A;  3N3K B;  3SEB A;  3AE9 B;  2A5U A;  2LXA A;  2DLB A;  2I1K A;  1HTQ A;  1ROE A;  4NAM A;  5MPO A;  2X8X X;  4EEW A;  4YSY B;  3PZD A;  1HA5 A;  5E6P A;  1TS4 A;  2WXL A;  1VCB A;  2RDB C;  5HFY A;  1GOZ A;  1UBI A;  2EMT A;  1BML C;  3B2F A;  3IG3 A;  4KVG B;  3PLU A;  3VUW A;  1SB3 C;  2DWQ A;  4C4V A;  1BUI C;  4KIK A;  3HK0 A;  3EHV A;  2DNF A;  1SE2 A;  2KOX A;  2J0M A;  2GB1 A;  2ZCC A;  4DXG A;  3Q3N C;  3Q8A A;  4M0W A;  3BY4 B;  3AED B;  3D32 A;  4FJZ A;  5C3J B;  3N1Z C;  2IBI B;  1EU3 A;  2IDY A;  2MRP A;  1WRD B;  5D3D A;  2BS4 B;  4RFB A;  2DZJ A;  4HCP B;  1EF5 A;  2Z8L A;  3QWZ B;  4A6Q A;  2O2V A;  2KDI A;  1IP9 A;  2QJL A;  2YEP B;  4XWT A;  1LXD A;  3LB8 C;  4WIP A;  3A9K A;  1F9J A;  2VH2 A;  3OG5 A;  4FJV B;  2LGI A;  1TS5 A;  2KDB A;  2W9N A;  2KQ4 X;  1UNS A;  4EZL A;  1D6E C;  3Q8E A;  2HD5 B;  1T0S C;  1WGR A;  2KWV B;  3DBL B;  3Q3M C;  1RAX A;  2KXJ A;  1MI0 A;  1IYF A;  1SF0 A;  3BYY B;  1VD2 A;  3PLV A;  3S2A A;  2FCM A;  2V9H A;  2MH7 A;  1OFF A;  1I4R A;  3MFG A;  3TEW A;  2KVZ A;  2RDH A;  4AJW A;  1E9M A;  4ZHP A;  2L52 A;  2LGS A;  1Y56 A;  2RGF A;  3EC8 A;  2CU1 A;  4AWJ A;  4HRO A;  2WXI A;  1JRU A;  3ZVV A;  1V6E A;  2ZEQ A;  4M8M A;  3R2I A;  1PGA A;  2TSS A;  2WDR B;  3ZLZ A;  3CWI A;  4FHK A;  4H2A A;  1WXQ A;  2BWF A;  4DHJ D;  3KQ4 A;  4B6W A;  2CJO A;  4JX1 C;  1DYQ A;  2EMS A;  3JVZ X;  3RUI B;  1VLB A;  3K9P B;  1ENF A;  3ZNH B;  4W9K A;  1JWS D;  2KQ7 A;  2BYV E;  4W9F A;  1RWS A;  4DWF A;  1MHX A;  2CHW A;  3MP9 A;  1DOI A;  3Q69 A;  3J9C A;  2FE8 A;  1JQ4 A;  4W9H A;  4BOZ B;  4OZB A;  3LDZ E;  4LNN A;  1UGJ A;  1IPG A;  2PE6 B;  1JML A;  4M02 A;  1GB1 A;  2KWD A;  4RNA A;  3URY A;  4MM3 A;  1IBX B;  4MGZ E;  1V1P B;  1WX7 A;  3ALB A;  3CST A;  4MH8 A;  2FNJ B;  2V0G A;  3P1M A;  4PS3 A;  1TJE A;  2OJW A;  4PK1 A;  2B76 B;  2ACZ B;  2LMC A;  2X38 A;  2L8J A;  1HQR D;  5HI1 A;  4GLS C;  2D07 B;  3Q3O C;  3QA8 A;  2ONQ A;  3BVZ A;  4F7Z A;  2KO3 A;  5EE9 A;  1ISN A;  3KYC D;  4A8X C;  2KC1 A;  4PS7 A;  1OQY A;  4RGO S;  2LI5 A;  4E74 A;  1Q1O A;  2ICI A;  3PRZ A;  5T8I A;  2MSE D;  2M1M A;  2KD0 A;  4M01 A;  3NRZ A;  3MJ5 A;  2BTE A;  4P6V F;  3EFC A;  3VXW A;  4AUQ C;  3NVV A;  4XGA B;  3T8M A;  4EZK A;  4ZYN A;  2LUM A;  3QHT A;  2HTH A;  4IKG A;  1NYR A;  3W1Y A;  4GDL B;  1PYW D;  2MBQ A;  1AYF A;  4GU2 A;  1S3S G;  2PMV A;  3BYT B;  1TZ1 A;  1WGY A;  4D2K A;  3NZS A;  2MA9 B;  3MC0 B;  3X0W A;  1K52 A;  1FXA A;  1YQB A;  4CHK A;  4YTP B;  1UEL A;  3IXS A;  1ESF A;  3GS2 A;  1CK1 A;  4BFR A;  1S1Q B;  1SIF A;  4YSZ B;  1WGG A;  5FKA C;  3Q8B A;  1FXI A;  2CKH B;  3AU4 A;  2JUO A;  1ZDV A;  2AWT A;  3B0A A;  1XF5 L;  4OVU A;  3AEA B;  1EWY C;  3VTU A;  1WMH A;  1EM7 A;  3KW5 B;  1JWB D;  1WGD A;  2J0K A;  2HJ8 A;  3ETR A;  2LGD A;  3U4E G;  4W9L A;  2WDV B;  3TEX A;  5I4D A;  4HLE A;  1MG8 A;  2XK5 B;  5J18 A;  1T0R C;  3HM6 X;  4ZRQ A;  5BYQ A;  1OEY A;  1FMA D;  3DBL I;  2KMM A;  4K1R B;  2IO1 B;  4MT5 A;  2VH1 A;  4YXD B;  1AWD A;  4DHZ E;  1GG3 A;  2W3R A;  2XK5 A;  3PO0 A;  2AEH A;  3DVN U;  3IVF A;  1I35 A;  2AL3 A;  2EKI A;  3ZDT A;  2L32 A;  2EKE C;  1UWX A;  4EUT A;  2NCN A;  3APC A;  4RH6 A;  3R66 C;  2J4X A;  3KVF B;  3MJW A;  5DCN A;  3AV8 A;  2WWZ A;  2LXC A;  4LDT B;  1NVI D;  3GE3 C;  1UUP A;  4B95 A;  2R2Q A;  1LGR A;  2K22 A;  2GMI C;  1YN4 A;  2K5P A;  4LK0 M;  1YN5 A;  4I6P A;  3IAM 1;  3V6C B;  2G3Q B;  1HZ5 A;  3R2T A;  1B9R A;  2Y5B B;  4KSK C;  2OJR A;  2W3S A;  3EA6 A;  1MVK A;  4EFO A;  1WFY A;  2MBB B;  3DBS A;  5IOI A;  4N9F 4;  5EDS A;  3PHW B;  2IY0 B;  4KKI A;  4XE0 A;  1OGW A;  4HRS A;  3PT2 B;  2N9K A;  3KWV A;  4Q2J A;  3IT4 B;  4EZJ A;  3IFW B;  2G4D B;  4KDI C;  4DHJ B;  1V1O A;  3QQ8 B;  3KYD D;  4ZDV A;  2MJD A;  2QIE B;  4HPP A;  2KJR A;  5J2R A;  1N6Z A;  5EE0 A;  2LVO A;  2AQ2 B;  1NDD A;  2V4L A;  1SJE D;  3UIO B;  5CHV C;  4BBN C;  3V3X A;  4XYC A;  2KJ6 A;  3RI7 C;  4GIV A;  2IGD A;  1N62 A;  1T0Y A;  1V80 A;  2LEK A;  2LGX A;  2LD9 A;  2KWU B;  3FKY A;  2C7M B;  3ZKJ C;  5BYR A;  1OEY J;  2V3N A;  3NY5 A;  1XQQ A;  1C76 A;  1Q10 A;  2YEP F;  4ITK A;  1LFD A;  4GXB A;  3RNC C;  3U2S C;  4DK5 A;  2MBH A;  2IGG A;  4P1C C;  1WM3 A;  4P1B C;  2JRI B;  3V62 A;  3ZO5 B;  1FFV A;  4A55 A;  1F2R I;  1PGX A;  5AUK A;  1KFY B;  4BOS C;  4OZC A;  2N7D A;  2GOW A;  2KC2 A;  4HDO A;  1VZ6 A;  3ZRC A;  3KUZ A;  5AZH A;  2K8B A;  4ZRP A;  3ZQ4 A;  3DBR B;  1WXS A;  1XXG A;  3PSE B;  4ARC A;  3ZIM A;  1E8X A;  1KJT A;  3ZNG C;  2NPT B;  2QIL A;  3H8H A;  3RN9 C;  4MDK E;  1CQV A;  3QX1 A;  1C4P A;  3PHX B;  1IUE A;  2C60 A;  4IWQ A;  1WYG A;  1PGB A;  4MJS B;  4FAD A;  1TBE A;  4TSS A;  2Y5P A;  3AM9 A;  2DAJ A;  3PRE A;  1WM2 A;  3TCA A;  1TIF A;  1FNW A;  2DBY A;  1UD7 A;  2PLP A;  2Q5W D;  3BVM A;  1M94 A;  2D3G A;  5G55 A;  1GNU A;  1F0Z A;  2N9L A;  3FIL B;  3RD2 A;  1TY0 A;  2WS3 B;  3UIP B;  5CTR C;  3RZF A;  4XDC A;  4G50 A;  3C8Y A;  3EGR A;  1QZE A;  3HM3 A;  5AEK B;  4KGS A;  2KFK B;  3V05 A;  1N60 A;  1EUV B;  1WX9 A;  4RGM A;  4A90 A;  1EF1 A;  1CZP A;  1NEK B;  1UGM A;  2N4F A;  3B1L X;  3ZNZ B;  3FC4 A;  3R3M A;  2H89 B;  1KLG D;  3VDZ A;  1RLF A;  1WE6 A;  1E8W A;  2PVG C;  2LVQ A;  1JAL A;  1TKG A;  4JE3 B;  3VUY A;  3M62 B;  2WU2 B;  4L23 A;  3QIJ A;  1WZ0 A;  1JWM D;  3A9J A;  5BMI A;  1WX8 A;  4S0R A;  2OOB B;  2J0J A;  2WYQ A;  3PZ8 A;  2AQ1 B;  4ZOH C;  4BKT A;  2EEL A;  1N63 A;  2JYT A;  3AE6 B;  3NJT A;  1TGZ B;  5LLI A;  4TUU A;  1ZXH A;  4BAX A;  1WXM A;  1K8R B;  1YN3 A;  2MBE A;  3PPA A;  3ZYY X;  5TSS A;  2IY1 B;  2PVO D;  1R4M B;  3I3T B;  2DAF A;  2DX5 B;  2K39 A;  4JGH B;  2FBW B;  2WDQ B;  3A4S C;  2DYB A;  1M4V A;  2NBW B;  4IW0 A;  3P4P B;  5D6J B;  1JCK B;  4NJC A;  1AAR A;  5KHQ A;  4AOF A;  3JW0 X;  5EE1 A;  2CS4 A;  5BYS A;  3R7Q A;  1CJE A;  2LAS A;  1J0G A;  1K50 A;  3VR8 B;  1C4A A;  3DVN V;  3ML9 A;  3L10 B;  4RF0 A;  1WGH A;  1FRR A;  1SE9 A;  2BPS A;  4MGY E;  5JZE B;  5HG2 A;  1ZDX A;  4RCO A;  2K6D B;  4PT5 A;  4B9K A;  2D5G A;  1VRA B;  4DXF A;  1V97 A;  2L83 A;  4DQO C;  4WAF A;  2JX5 A;  3DHH C;  2NBU A;  2KMC A;  3EEC A;  4RM8 A;  4L2Y A;  4C80 A;  2N9E B;  2G4S A;  2J42 A;  2ZCB A;  2L76 A;  2INP E;  2N7E A;  2ZPN A;  1G6J A;  1J19 A;  1I4X A;  2DYO A;  2PPH A;  5AUI A;  3DBR I;  1UBQ A;  4LDT D;  4ANV A;  2WU5 B;  3AU5 A;  1FXT B;  1U4A A;  3RNE C;  2GBM A;  4ZRJ A;  3Q8C A;  4LNI A;  3NZU A;  3VH4 B;  5TR5 A;  2HJ1 A;  3M95 A;  4HVB A;  2M8S A;  3UQA A;  1KH0 A;  4BBN F;  2DYM A;  5FR3 A;  1A70 A;  5JH5 C;  1ZW7 A;  1WIA A;  3ECI A;  3AE7 B;  1T6B X;  3ENE A;  3Q2A C;  1KRH A;  3L0W B;  2Z0E B;  3NG0 A;  4TKN A;  1GJZ A;  2RPQ A;  2MJ3 A;  2M56 B;  3RNG C;  3LXF A;  5HHD G;  4N6E B;  1F77 A;  3K9O B;  4USA A;  2WXH A;  2XEW A;  4KX6 B;  4LJP B;  2NMQ A;  2KAJ A;  2LUE A;  2PE9 A;  4C56 C;  4GN1 A;  3UI3 A;  4LLG M;  3OJ4 B;  3MC8 A;  4W9J A;  1L4D B;  3AUL A;  3I5J C;  3BVG A;  1ET9 A;  2MCN B;  1EO6 A;  4FUL A;  1WZ3 A;  5IN7 A;  2MQJ A;  3TSS A;  3RFZ B;  2AYO B;  3M3J A;  1L0Y B;  2MLB A;  5IP4 D;  4GOC A;  2NR2 A;  1JRP A;  2FCQ A;  4NNJ B;  1ZP0 B;  3B2G A;  4EOY A;  2AL6 A;  2BYE A;  5FK9 C;  4LNK A;  4NJ6 A;  1SJH D;  1TY2 A;  3DHG C;  5LXH A;  2L0T A;  3W9C B;  3KWL A;  3NOB A;  4FN2 A;  3C19 A;  3L4P A;  3QK0 A;  1ZGU B;  1T3Q A;  2YVC A;  2KTR B;  3A1Q B;  1WXA A;  4US9 A;  2D10 A;  3CF6 E;  1IBX A;  3IT6 B;  1V1P A;  1I4P A;  4GMV A;  1DOX A;  1IGD A;  1WJU A;  4XWW A;  3T3N A;  4NAW B;  1R4M I;  4IM3 A;  4OHJ A;  3RCZ A;  1WJN A;  2L7R A;  3UGB B;  2Z59 B;  2LVP A;  1GUA B;  1RM6 C;  2VRR B;  3AH7 A;  3B08 A;  2C7N B;  2E6X A;  3N1X C;  4GSW A;  2CR5 A;  2K9X A;  4LNO A;  1SXT A;  3SFE B;  4ANW A;  2DEN B;  4NQL B;  2K3U A;  1FPY A;  4GDK B;  4HCN B;  3ZUN A;  2PKO A;  1KTK A;  2J7Q B;  3ML8 A;  1VZ8 A;  4XC2 A;  2KTF A;  2WXO A;  1WXV A;  2KKC A;  1XCT L;  4HKZ E;  1ZKH A;  2KLC A;  4GDL A;  1B1Z A;  4BKG A;  3E9S A;  3T9L A;  1QIL A;  2DZM A;  1NEN B;  3AE5 B;  2WXQ A;  4KGT A;  5BO4 B;  4BZA A;  3H7P B;  3DVG X;  4ANU A;  3IAS 1;  4PYU A;  1UZX B;  3W2D A;  3CMM B;  5DPW A;  4ZYS A;  1SSN A;  2ZNV B;  1L6V A;  2ZPY A;  2INC C;  3AEF B;  4YTN B;  2K8H A;  1PDX A;  2ZZP B;  3LJ3 A;  1VDV A;  4WH4 A;  4AJY B;  2Y5C A;  3HHM A;  1V49 A;  3P42 A;  2FAZ A;  3QC8 B;  3H7P A;  4IM0 A;  4EKU A;  1YOV B;  3GOE A;  3AE3 B;  4NPN A;  2BYT A;  1C79 A;  1DGJ A;  2G9H D;  2IND C;  3DDC B;  4N59 A;  1WJ4 A;  1Q5W B;  5KHO A;  2MJE A;  1F2R C;  5E6N A;  4WWO A;  3W1S A;  1H4R A;  1MHH E;  2BS3 B;  2QMT A;  1PQS A;  2GBK A;  2MEK A;  1WI0 A;  3JSV B;  3M63 B;  3BK2 A;  1XCQ L;  2G45 B;  3APF A;  1YJ1 A;  1OQQ A;  2CJN A;  1SEB D;  2GI9 A;  2HTM E;  3L16 A;  2WXP A;  1XLP A;  1AW7 A;  2JQR B;  4TV3 A;  3KLS X;  5BMG A;  4KKJ A;  1JW9 D;  4ICV A;  1YQ4 B;  5D2M B;  2ZNV C;  4FXC A;  3N1Y C;  3GB1 A;  1WY8 A;  4JWS C;  4HK2 A;  1L5P A;  2NVU I;  2WQY B;  2RDG A;  2WHI A;  4YT0 B;  4JQW C;  2W55 A;  3ZJT A;  3AMZ A;  3CSF A;  3W1S C;  1P9D U;  3AEE B;  1C3T A;  1JWA D;  3DOW A;  3ZTC A;  2CHZ A;  3AE8 B;  1NI2 A;  1WR6 E;  2Y3A A;  5CHF A;  1J7C A;  2WLB A;  2NTS A;  3VH3 B;  4US8 A;  4TQ0 A;  2JU6 X;  4KV2 A;  4YWG G;  4R3D A;  3VR9 B;  2J53 A;  3PRM B;  2KAC A;  3APD A;  4N58 A;  3SR6 A;  2JWZ A;  1YX6 B;  4I6N B;  1WF9 A;  5CX3 A;  2WP9 B;  2HDE A;  2UYZ B;  3VRB B;  1P98 A;  4WWM A;  4WQM A;  2RMM A;  2SAK A;  3QAQ A;  4K7S A;  2MP2 B;  1XEE A;  1FCL A;  1XT9 B;  1YMH E;  4WUR A;  3U8Z A;  2QHO A;  1EWC A;  2OED A;  1LM8 B;  1F1H A;  3SHQ A;  2PEA A;  3LYY A;  3ZTD A;  1D4B A;  3W5V B;  2BW2 A;  2QCZ A;  2I1J A;  1VJK A;  1LO5 D;  3ZJV A;  3H1U A;  4KDL B;  3SDL C;  1H8C A;  2ZW0 A;  2I38 A;  4HKQ A;  1QOF A;  2KLG A;  2WX0 A;  1GAQ B;  1ZE3 D;  3NZ3 A;  5IKC M;  2ZVO A;  3GZN B;  3WAP A;  3Q6B A;  2KK8 A;  2WGS A;  1NBF C;  2K6Q A;  5G2N A;  4DBG A;  5BMH A;  2JRH A;  3OJ3 A;  2IPK D;  3PZ7 A;  4JLC A;  4O1N A;  2XN9 C;  2N1V A;  1E8Z A;  4HXD A;  4J3O D;  1P3Q U;  1T5X D;  3R8B A;  1MG4 A;  1P1A A;  2LJI A;  1GC6 A;  3HVZ A;  4HDQ A;  2NPT A;  3NS8 A;  2JXT A;  2PW9 A;  1UF0 A;  2KT7 A;  2KX0 A;  1SE4 A;  2KZR A;  3WAO A;  4CYE A;  2LHD A;  4K7U A;  3VTW A;  3NS1 A;  4GB9 A;  4MJS A;  3N30 A;  4HJG E;  3U7Z A;  1RFK A;  2O6V B;  2IO2 B;  4W9I A;  3RNF C;  4I6L B;  1KOT A;  3SU8 X;  3MHS D;  3FAH A;  2VZK D;  1YJI A;  1R7S A;  3KUD B;  1E90 A;  1UH6 A;  1GB4 A;  1TT5 B;  3FIL A;  4A3P A;  4HJK A;  4HEA 1;  4DDI D;  1C9F A;  1FIQ A;  1N61 A;  4M00 A;  2J52 A;  3BK1 A;  1GC7 A;  2KFK A;  2K25 A;  1HE8 A;  2KX3 A;  1QLB B;  4NZL B;  5G5G A;  3I63 C;  2BQQ A;  2L1A A;  3DVG Y;  4W9C A;  1E6E B;  1C78 A;  1V8C A;  3AEC B;  4B0E A;  2FCN A;  3DWG C;  2MHJ A;  1XD3 B;  1R4N B;  4S17 A;  3BZD B;  1WE7 A;  2L0F A;  1SE3 A;  4A3O A;  2YLM A;  4HPL B;  1YJJ A;  3L08 A;  1ZXI A;  3Q3F A;  3TIX A;  3P4S B;  4MEM A;  4FJY A;  3I9V 1;  2E3T A;  1UWM A;  1FCC C;  1FFU A;  1C4C A;  3V6E B;  3WCQ A;  3DQV A;  4K81 A;  1J7A A;  4F1S A;  1QQR A;  3TEY A;  1QOG A;  4K3B A;  3BII D;  4XDD A;  2IYD B;  3ZXR A;  1PFD A;  2CU3 A;  2N0S B;  4MSQ B;  2ASQ A;  1E5W A;  1QT9 A;  3U52 E;  3U30 A;  3VHT C;  4WQO B;  4XX5 A;  3P63 A;  3NVW A;  1RFA A;  3P4Q B;  5DPT A;  2BKF A;  4F8C B;  3DWM A;  4C4V B;  4KIK B;  1WRI A;  2KVR A;  4NJ7 A;  2KAN A;  2MX2 A;  4W9G A;  4M0W B;  4EE2 A;  1TKE A;  4II3 B;  1TS3 A;  3ZRF A;  1LQB A;  3UIN B;  2GBR A;  1V81 A;  3QCA A;  4AQ7 A;  2FUG 1;  3ZDM C;  2R2O A;  1L0V B;  2O2V B;  4TQ1 A;  2JXX A;  3O13 A;  1WGK A;  3WA0 A;  2L3Z A;  3A9K B;  4JWU C;  3VFK A;  3N9Y C;  3AB5 A;  5IO9 A;  4WJN A;  3UF8 A;  1E0Z A;  3HRD D;  2KFJ A;  3WAN A;  4IC7 B;  3BWU D;  1NI3 A;  2BYF A;  2C9W B;  5FR6 A;  3VAW A;  3GZN I;  4LCD E;  2WXF A;  1WH3 A;  1RYJ A;  2KDM A;  4BVU C;  1TTN A;  3HUI A;  2KHW B;  1VZ7 A;  3TUO A;  2K0P A;  4A20 A;  4IWP A;  3NUH B;  1MPE A;  4C7Z A;  4WWP A;  1E7V A;  2NS5 A;  2BS2 B;  4ICU A;  2GBN A;  1EU4 A;  4RMA A;  4ZHO A;  3B9J A;  4OW0 A;  4XZ4 A;  1J7B A;  4DDG D;  3RNB C;  4NQK E;  1FNV A;  4DHZ B;  4MEL A;  2BB6 A;  2RSU A;  3PS6 A;  4UDU C;  1L0X B;  4WJQ A;  2FUH B;  3MHZ A;  4ANX A;  2OHF A;  1XLN A;  4RM9 A;  3DHI C;  3L54 A;  2LFI A;  4GGQ A;  2NTT A;  1Z5S B;  2BBC A;  4NY0 A;  1STE A;  3Q3J A;  1I7H A;  3VVW B;  2D3A A;  4JPS A;  4E71 A;  3HIZ A;  3JYU A;  5JHB A;  2ON8 A;  4LJO B;  2DHZ A;  4OZA A;  5AZG A;  1HXY D;  2MWS B;  2I2Y A; 
#chains in the Genus database with same CATH homology
 3W1S A;  3AEB B;  1MHH E;  2BS3 B;  4ZRP A;  1QF6 A;  2WXM A;  5HFY A;  2W54 A;  1GOZ A;  4MM3 B;  1BML C;  3B2F A;  3ZQ4 A;  2QMT A;  2WXK A;  2INN E;  1D5M C;  1XXG A;  1SB3 C;  1D5X C;  1N5X A;  2DWQ A;  4ARC A;  1BUI C;  3Q8F A;  1K53 A;  2VZK B;  1IGC A;  1SE2 A;  2QIL A;  3H8H A;  2GB1 A;  2MEK A;  4DXG A;  1CQV A;  1C4P A;  3BK2 A;  1XCQ L;  2V4I B;  5E6J A;  3Q8A A;  4M0W A;  1IUE A;  3AED B;  1WYG A;  4RF1 A;  5C3J B;  2RPV A;  1OQQ A;  2CJN A;  1PGB A;  3T3O A;  1SEB D;  2GI9 A;  2HTM E;  2WXP A;  1XLP A;  1AW7 A;  1SIJ A;  2JQR B;  4TSS A;  1EU3 A;  2IDY A;  5D3D A;  2Y5P A;  3KLS X;  2BS4 B;  3AM9 A;  4RFB A;  3OWE B;  5BMG A;  4KKJ A;  4RGT A;  1KLU D;  1JW9 D;  2Z8L A;  1YQ4 B;  4A6Q A;  1FNW A;  4FXC A;  2DBY A;  3GB1 A;  2QJL A;  2YEP B;  4XWT A;  4JWS C;  2PLP A;  2Q5W D;  3BVM A;  3LB8 C;  5D7G A;  1L5P A;  1TS2 A;  4WIP A;  1F0Z A;  2WQY B;  2RDG A;  2N9L A;  4YT0 B;  3ZJT A;  2W55 A;  1XLO A;  3AMZ A;  3FIL B;  1TY0 A;  2LGI A;  2WS3 B;  1TS5 A;  3AEE B;  1JWA D;  2WNM A;  4XDC A;  3AE8 B;  2KQ4 X;  1UNS A;  2M19 A;  1TZO A;  3C8Y A;  1D6E C;  1ET6 A;  2M0A A;  3EGR A;  3Q8E A;  2Y3A A;  4KGS A;  3V05 A;  1N60 A;  1J7C A;  4RGM A;  2WLB A;  2NTS A;  1I4G A;  4A90 A;  1I4H A;  4US8 A;  2G1E A;  4YTM B;  2WXR A;  1CZP A;  1NEK B;  4KGR A;  2QEJ C;  4TQ0 A;  3E56 A;  3FC4 A;  2JU6 X;  2XNA C;  1VR9 A;  2H89 B;  1KLG D;  1MI0 A;  4R3D A;  4YWG G;  3VR9 B;  1SF0 A;  2QSD A;  3BYY B;  2J53 A;  1OQR A;  2KAC A;  2PVG C;  1JAL A;  4N58 A;  2MH7 A;  1FD6 A;  3AE1 B;  1TKG A;  1OFF A;  1I4R A;  3SR6 A;  3MFG A;  3TEW A;  4JE3 B;  2RDH A;  1E9M A;  4ZHP A;  2L52 A;  2WU2 B;  4L23 A;  2WP9 B;  2HDE A;  1JWM D;  1Y56 A;  1NYQ A;  5BMI A;  3VRB B;  3GP7 A;  4WWM A;  4WQM A;  2RMM A;  2SAK A;  2IJ0 A;  4HRO A;  2WXI A;  3PZ8 A;  3R2I A;  1PGA A;  2AQ1 B;  4ZOH C;  1DOY A;  1XEE A;  1FCL A;  1YMH E;  2EEL A;  1PUT A;  2TSS A;  2WDR B;  4WUR A;  1N63 A;  1FNU A;  2JYT A;  3AE6 B;  3CWI A;  3VRA B;  1XO3 A;  2BB5 A;  4H2A A;  1WXQ A;  1EWC A;  2OED A;  1ZXH A;  3CIR B;  3KQ4 A;  2CJO A;  3LYY A;  4JX1 C;  1YN3 A;  1D4B A;  1DYQ A;  3W5V B;  2BW2 A;  3ZJU A;  1VJK A;  3ZYY X;  1AN8 A;  1LO5 D;  5TSS A;  2W82 A;  3ZJV A;  3NVY A;  2PVO D;  1VLB A;  2ZW0 A;  2I38 A;  4HKQ A;  1ENF A;  1QOF A;  1JWS D;  1RWS A;  1GAQ B;  1TYG B;  1ZE3 D;  3NZ3 A;  2FBW B;  1MHX A;  2WDQ B;  3MP9 A;  1DOI A;  3Q69 A;  1M4V A;  2N7J A;  3J9C A;  2FE8 A;  4REZ A;  3P4P B;  1JQ4 A;  1JCK B;  4NJC A;  4OZB A;  4B0M A;  1QKZ A;  5EE1 A;  5BMH A;  1UGJ A;  2IPK D;  3ABV B;  1JML A;  3PZ7 A;  1GB1 A;  2KWD A;  4O1N A;  5BYS A;  2XN9 C;  1QOA A;  4RNA A;  2GRI A;  1CJE A;  3URY A;  4J3O D;  1C77 A;  1FRD A;  4C7Y A;  1K50 A;  3VR8 B;  1C4A A;  1T5X D;  1IBX B;  2SEB D;  3R8B A;  1V1P B;  4MH8 A;  4RF0 A;  2V0G A;  1FRR A;  3P1M A;  2LJI A;  3RPF C;  1TJE A;  5HG2 A;  1ZDX A;  3HVZ A;  1SBB B;  2B76 B;  2ACZ B;  2LMC A;  2X38 A;  4RCO A;  2JXT A;  2PW9 A;  1E10 A;  2AX5 A;  4PT5 A;  1SE4 A;  1HQR D;  5HI1 A;  2D5G A;  2LHD A;  4GLS C;  1VRA B;  4DXF A;  1I4Q A;  1V97 A;  2ONQ A;  3BVZ A;  3NS1 A;  2L83 A;  4DQO C;  5EE9 A;  4HJG E;  4TMA B;  4WAF A;  5D3I B;  3W5U B;  2JX5 A;  2JZP A;  1P7E A;  2ZW1 A;  3U7Z A;  2WXJ A;  1RFK A;  5H8Y E;  4A8X C;  4L2Y A;  4C80 A;  4RGO S;  2J42 A;  2INP E;  2ICI A;  3HVD A;  3FAH A;  2VZK D;  4P16 A;  5T8I A;  1YJI A;  1R7S A;  1I4X A;  1GB4 A;  3NRZ A;  1BXT A;  2DYO A;  5AUI A;  3MJ5 A;  2BTE A;  3FIL A;  4P6V F;  4HEA 1;  3NVV A;  1C9F A;  2WU5 B;  2LUM A;  1FIQ A;  1N61 A;  3VQI A;  5H92 C;  3Q8C A;  4IKG A;  2J52 A;  1NYR A;  5G5H A;  3BK1 A;  4GDL B;  1PYW D;  4AS1 A;  1AYF A;  2PMV A;  3BYT B;  1QLB B;  1JRO A;  2JSV X;  4A9A A;  2JYE A;  4D2K A;  1KH0 A;  4NZL B;  1P7F A;  5G5G A;  2DYM A;  5FR3 A;  2WXG A;  2L1A A;  3MC0 B;  1A70 A;  1K52 A;  1E6E B;  1C78 A;  1V8C A;  3AE7 B;  1T6B X;  1FXA A;  3AEC B;  4B0E A;  1FEH A;  1KRH A;  3DWG C;  4YTP B;  3IXS A;  1ESF A;  3BZD B;  3GS2 A;  1CK1 A;  3AE4 B;  4YSZ B;  1SE3 A;  1YJJ A;  1ZXI A;  2IGH A;  3Q8B A;  1FXI A;  5FKA C;  3P4S B;  1ZDV A;  3I9V 1;  2E3T A;  3SFD B;  1UWM A;  1FO4 A;  1FCC C;  1FFU A;  1C4C A;  1XF5 L;  3WCQ A;  2MJ3 A;  2M56 B;  3AEA B;  1J7A A;  3LXF A;  5HHD G;  1EWY C;  2WXN A;  4N6E B;  1EM7 A;  1F77 A;  1QQR A;  4USA A;  1JWB D;  2WXH A;  2V3P A;  3TEY A;  1QOG A;  4KX6 B;  2NMQ A;  3BII D;  2KAJ A;  3ETR A;  4C56 C;  4XDD A;  3U4E G;  3UI3 A;  1PFD A;  2CU3 A;  2N0S B;  2WDV B;  4LLG M;  3TEX A;  1L4D B;  5I4D A;  1QT9 A;  3BVG A;  1ET9 A;  3U52 E;  3P63 A;  4MAC A;  3NVW A;  1K51 A;  4ZRQ A;  5BYQ A;  3TSS A;  3P4Q B;  1FMA D;  3RFZ B;  2KMM A;  1L0Y B;  1JRP A;  4MT5 A;  4YXD B;  1AWD A;  3DWM A;  4IOI E;  1ZP0 B;  4LTU A;  3B2G A;  2H88 B;  1WRI A;  2W3R A;  3PO0 A;  5FK9 C;  3AE2 B;  1GPX A;  1SJH D;  1TY2 A;  5EE3 A;  3EUB 2;  3KWL A;  3W9C B;  3L4P A;  2EKI A;  2L32 A;  1ACC A;  1UWX A;  1YQ3 B;  4EE2 A;  1TKE A;  5C2T B;  4ARI A;  1YNT E;  1T3Q A;  1TS3 A;  1XLQ A;  4RH6 A;  2J4X A;  1HZ6 A;  2FUG 1;  4AQ7 A;  1HEZ E;  4YSX B;  3AV8 A;  1L0V B;  4TQ1 A;  1E7P B;  4US9 A;  1NVI D;  1IBX A;  1UUP A;  3IT6 B;  3O13 A;  1WGK A;  1V1P A;  2PIA A;  1I4P A;  2R61 A;  2K22 A;  4JWU C;  1DOX A;  1YN4 A;  2K5P A;  3N9Y C;  4LK0 M;  1WSP A;  1YN5 A;  3AB5 A;  1D5Z C;  2LHE A;  1E0Z A;  1IGD A;  3HRD D;  3IAM 1;  3BWU D;  4XWW A;  3T3N A;  4NAW B;  1NI3 A;  1HZ5 A;  3R2T A;  1B9R A;  4OHJ A;  2W3S A;  3EA6 A;  1MVK A;  2WXF A;  1JWU D;  4RGN A;  1RYJ A;  2JWU A;  1RM6 C;  1ZUD 2;  3AH7 A;  2AQ3 B;  2KDM A;  2E6X A;  3HUI A;  1QOB A;  4KKI A;  4XE0 A;  1VZ7 A;  4HRS A;  2BT6 A;  3AEG B;  2K9X A;  3TUO A;  3TEZ A;  2K0P A;  2N9K A;  3KWV A;  4Q2J A;  3IT4 B;  1SXT A;  3SFE B;  4OVZ A;  3NUH B;  1KF6 B;  2K3U A;  4GDK B;  1MPE A;  2PKO A;  4C7Z A;  1KTK A;  1WWT A;  5LNK 1;  1V1O A;  2BS2 B;  1VZ8 A;  2MJD A;  2QIE B;  1TKY A;  2WXO A;  1EU4 A;  3ZGZ A;  5JXV A;  1L6U A;  5EE0 A;  1XCT L;  4ZHO A;  4HKZ E;  2AQ2 B;  3B9J A;  1SJE D;  4OW0 A;  3P4R B;  1J7B A;  3AN1 A;  3V3X A;  1B1Z A;  1FNV A;  3I57 A;  1L4Z B;  2PTL A;  2BB6 A;  1FM0 D;  3E9S A;  4UDU C;  1L0X B;  2IGD A;  1QIL A;  1NEN B;  1N62 A;  3AE5 B;  2WXQ A;  3MHZ A;  2LEK A;  4KGT A;  2OHF A;  1XLN A;  5GXG B;  2LFI A;  3IAS 1;  1ZPS A;  1N5W A;  3W2D A;  2KN4 A;  2NTT A;  4ZYS A;  3NVZ A;  1SSN A;  1L6V A;  4CQN A;  3AEF B;  5BYR A;  4YTN B;  2V3N A;  1C76 A;  1PDX A;  1Q10 A;  2BBC A;  2YEP F;  4IDI A;  1STE A;  1VDV A;  4ITK A;  4WH4 A;  2Y5C A;  4L1B A;  3P42 A;  3U2S C;  1I7H A;  2IGG A;  1ZOY B;  3SEB A;  4JPS A;  3AE9 B;  3AE3 B;  2DLB A;  1FFV A;  4A55 A;  1F2R I;  2ON8 A;  2BYT A;  1PGX A;  1ROE A;  4NAM A;  5AUK A;  1C79 A;  1DGJ A;  2G9H D;  4N59 A;  4OZA A;  4YSY B;  5MPO A;  1KFY B;  4OZC A;  2MJE A;  1HXY D;  1HA5 A;  1F2R C;  1VZ6 A;  1TS4 A;  2I2Y A;  2WXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...