5H8YE

Crystal structure of the complex between maize sulfite reductase and ferredoxin in the form-2 crystal
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational studies of an electron transfer complex of maize sulfite reductase and ferredoxin.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase/electron transport
molecule keywords Sulfite reductase [ferredoxin], chloroplastic
total genus 22
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5h8yE00
1B9RA 1SIJA 3DWMA 4N59A 1J7BA 1NI3A 2MJ3A 3RPFC 1JW9D 3AE4B 1YQ4B 1A70A 1XLQA 2LEKA 3NVYA 2ACZB 3VRAB 3AMZA 2HTME 3ZYYX 1NEKB 1R7SA 2JQRB 3AV8A 1CZPA 1PFDA 4JWUC 2CJNA 1DGJA 2M56B 3HUIA 3AE8B 3P4PB 1YJJA 5C2TB 3SFDB 1VJKA 1N5WA 2WP9B 2Y5CA 1E10A 4KX6B 2E3TA 4FXCA 5AUIA 1FM0D 3AE7B 4ZHPA 1FRRA 1RFKA 4USAA 3NRZA 4YT0B 4HRSA 1QF6A 1GAQB 1N61A 1XLOA 3AEEB 2N0SB 1AYFA 1FRDA 1WXQA 1J7CA 1VDVA 4YSYB 1N63A 2AX5A 2BT6A 1L6VA 3AE2B 1FMAD 3AECB 1QLBB 1PUTA 3FAHA 1FO4A 3AN1A 2G1EA 1FFUA 1ZXIA 1V97A 1YJIA 1KFYB 4N58A 1QOFA 5C3JB 2OHFA 2W3RA 1WGKA 2WDVB 1XLNA 5MPOA 2DBYA 4WWMA 1TKGA 3B9JA 1E0ZA 1WYGA 1OQRA 2PVOD 3AH7A 3AEAB 4YXDB 1CJEA 1JQ4A 3AEBB 3P63A 2WDQB 3AE1B 2W54A 1I7HA 1NVID 2DWQA 3DWGC 3W5UB 4JWSC 4ITKA 3NVVA 1NYQA 3SFEB 1UWMA 1ZUD2 1JROA 1QT9A 1SB3C 2BS4B 2M19A 2PVGC 3AB5A 3AEFB 3AEGB 3NS1A 2BS2B 2H88B 4WQMA 5G5HA 2MJEA 3WCQA 1J7AA 3P4SB 4P6VF 4YSXB 4US8A 2Q5WD 2CJOA 3SR6A 1RM6C 2K22A 5EE3A 1RWSA 1E6EB 2K5PA 1TKEA 2CU3A 1JWAD 4JX1C 4C7ZA 1QOAA 2FBWB 4LTUA 3CWIA 4ZHOA 1AWDA 2WU5B 5AUKA 2QJLA 5G5GA 5GXGB 1SF0A 5EE0A 1WRIA 2WS3B 3LB8C 1N60A 1TKYA 1L0VB 1E7PB 2L83A 1E9MA 3VR8B 1TJEA 3NVZA 3ABVB 3L4PA 3AE5B 3ETRA 1L5PA 3HRDD 2EKIA 2WLBA 3AE3B 1ROEA 3VRBB 2PIAA 1RYJA 3AE6B 3PO0A 5EE1A 1ZP0B 4YTPB 3EUB2 1DOXA 3B2GA 3AM9A 4IDIA 1NYRA 2WDRB 3BIID 3P1MA 4US9A 4YTMB 1WWTA 2KMMA 2QIEB 1DOYA 5EE9A 1T3QA 2BS3B 1L6UA 4A9AA 4C7YA 2B76B 2MJDA 1GPXA 2K9XA 1KF6B 3FC4A 1YQ3B 3CIRB 2MH7A 1OQQA 1JALA 1N5XA 1OFFA 5H92C 1KRHA 1F0ZA 5H8YE 3B2FA 1NENB 1EWYC 1XLPA 1TYGB 4HROA 4ZOHC 1QOGA 1V8CA 1ZOYB 1FFVA 2PKOA 3P4RB 3AE9B 3KWLA 1XO3A 1JWBD 4N6EB 2W55A 3VR9B 2WU2B 2W3SA 1FXIA 1DOIA 3LXFA 1PDXA 2WQYB 2JX5A 3NVWA 3W5VB 4C80A 1N62A 3W9CB 4YTNB 4YSZB 1QOBA 1IUEA 2L52A 3AEDB 1VLBA 2KAJA 1FXAA 3HVZA 3P4QB 1JRPA 1FIQA 2H89B
chains in the Genus database with same CATH superfamily
4IWOA 4W9LA 2JZZA 2UWQA 2Y5PA 4EFOA 2KTFA 5D2MB 4KDLB 4C4VB 2DZJA 1HZ6A 2PEAA 3NUHB 2NPTA 1D3ZA 2BYEA 1WY8A 4NPNA 1QF6A 1N61A 4JPSA 2J0JA 3RZWC 3UQAA 2KQ7A 1WGKA 3B9JA 1WYGA 2X38A 4HWIB 4FN2A 3AE1B 1PGXA 3DWGC 2D3GA 1T0YA 3TBLD 2HTHA 2R2OA 3SFEB 1I35A 2L05A 4XWTA 2L3ZA 5E6OA 1UELA 3U52E 4US8A 2UU7A 3BYTB 2RGFA 3BYYB 3Q3MC 4M02A 3P42A 2FBWB 4HDQA 3W2DA 2C7NB 2LJ5A 3U7DA 1KJTA 1L5PA 1JWMD 3VRBB 1E5WA 2LHDA 5BYQA 4WJPA 1SJHD 1GJZA 4DDGD 1L7YA 3GZNI 1EU3A 1OEYA 2C7MB 2CKHB 4ZDVA 5E6NA 2UYZB 3Q8BA 3RCZA 3TEZA 2DLBA 3HVDA 1OTRB 4EKUA 2YVCA 3P4RB 3KWLA 2N9KA 4HCPB 2KFKA 2QSDA 2LGYA 2XK5A 2D11A 4ZYSA 5L95C 2WXRA 3PLVA 2IGDA 2L52A 2K8CA 1TS2A 2C9WB 3BVGA 4N59A 3TIXA 3L08A 1CMXB 3UIPB 2RR9A 2KNBA 2JYTA 2JQRB 5KHQA 1WXSA 4DQOC 1FPYA 2NPTB 5C2TB 2KDEB 1WE6A 2PLPA 2G4SA 1GOZA 3MC9A 3A9KA 1RFKA 1UZXB 2K39A 4L23A 4NJCA 4C56C 1N63A 2INNE 3U7ZA 3QIJA 3RUIB 5JHBA 1MJDA 3PZ7A 1VD2A 1XLNA 3EGRA 4EZJA 2BB5A 2LGDA 1LQBA 3VFKA 4HKQA 3V61A 2DWQA 2KN4A 3APFA 4CYEA 3DHHC 1WF9A 1SXTA 3ZTCA 2V3SA 3Q8FA 4WJQA 4BOZB 2M1MA 2V3NA 2MP2B 3AU4A 3QHTA 3KLSX 4LTUA 4XGAB 3M63B 2AL6A 5BMHA 5AUKA 1D5MC 5EE0A 1WMHA 1MFWA 4RH6A 2W82A 1TKYA 1Q1OA 1E7PB 2ZVNA 2EMTA 4B95A 4MDKE 4LNOA 2LXCA 4MM3B 4E71A 1V2YA 1GC7A 4A3PA 2MBEA 4KIKB 3U30A 2WDRB 1LO5D 2QIEB 3H7PA 3QARA 2MJDA 3TEWA 3PHWB 3N1YC 1F52A 5G55A 4HROA 4ZOHC 3GZNB 3C8YA 1OGWA 1JCKB 1M94A 3VQIA 4BKTA 1MVKA 2WQYB 3NVWA 5CX3A 5LXIB 1T0SC 2I2YA 1L0YB 2JYEA 1FXAA 2L0FA 1GG3A 1WX9A 3O65B 2ACZB 2J53A 2N9LA 2G4DB 2KO3A 3I3TB 1HTOA 2QEJC 3VDZA 1EWCA 2CJNA 1U4AA 4ICVA 1BXTA 4KX6B 3DBHB 4ARIA 2AQ2B 3RZFA 4A3OA 3BK1A 2AX5A 3V05A 1UBIA 2N9XA 1YJIA 4N58A 4K81A 2OHFA 2WDVB 3A33B 2DBYA 3OJ4B 3Q2AC 2M4NA 3IFWB 5GMVA 1V81A 4KKJA 2OEDA 2JRIB 4P1CC 1CQVA 3AB5A 2MQJA 5IP4D 1J7AA 2Q5WD 1KLUD 4LDTB 3I63C 1E6EB 4JX1C 4MJSA 4ZHOA 2REXA 1E9MA 3ABVB 2V4LA 2ZCBA 2B3AA 2EKIA 3VUYA 1F1HA 2WXKA 2FAZA 2HE7A 4YL8A 5BMIA 4OZAA 1WWTA 1WZ0A 2D2QA 1T3QA 4JE3B 4ARCA 2NBVB 1HXYD 5H92C 5LNK1 1LM8B 1EF5A 2YEPF 4IOIE 1QOGA 4ANVA 1V8CA 4XZ4A 4M01A 3T3NA 4AS1A 2KWUB 1ZDVA 3BWUD 4WAFA 1K53A 2ZCCA 1AARA 1VLBA 4IM3A 1N6ZA 1KTKA 1UGJA 1SIJA 4I6PA 4RF1A 2MRPA 1YQ4B 4GLSC 3GP7A 3TUOA 3PGEA 4FJYA 3DPDA 5IOIA 2KC1A 1IYFA 3P4PB 4KKIA 1H8CA 3A9KB 3NJTA 5JXVA 2MWSB 1WJ4A 3AE7B 1KH0A 3MP9A 4K7SA 2R61A 3EFUA 3ZKJC 4B9KA 1FCCC 4YXDB 3P63A 1Q10A 2RMMA 2K1FA 1I7HA 3OAWA 2NVUI 4AQ7A 1TS3A 4ZRKA 3MHSD 1JWUD 2R2QA 3NY5A 2VZKB 4IM0A 1YX5B 4Q2JA 3D32A 2K5PA 2PE6B 3JSVA 2VZKD 3RNAC 4IWQA 2OOBB 1N60A 1L0VB 1QILA 2G9HD 2RDGA 2PIAA 3KYDD 3UQBA 1WM2A 1YMHE 3MHZA 4HPPA 4XE0A 2KMCA 2LGSA 2MSED 3ALBA 4DXGA 4NQLB 4RFBA 3ZXRA 2EELA 4MACA 2LGXA 3RNEC 1OQQA 4II3B 3RNFC 4ZRJA 4MH8A 1YD8U 2K8BA 1CK1A 1LXDA 1Y8RC 2NBWB 3WAPA 3LXFA 5FKAC 4EZKA 1P9DU 1IGCA 4DHJD 4OHJA 1SE4A 3RPFC 1SE9A 3Q3OC 1I42A 2D5GA 3UGBB 1WIAA 2XEWA 3R66C 2ZNVC 3TMPB 4JWUC 1DGJA 3AE8B 3QA8A 4F1SA 2Z0DB 3W1YA 3GB1A 3TL5A 4PYUA 3T8MA 1C1YB 3L17A 3SU8X 3ZJVA 3APCA 4IC7B 4S0RA 1HZ5A 2WX0A 3FAHA 1Z2MA 2W9NA 2L1AA 2W3RA 5DCNA 4A90A 4FHKA 5L83A 1CJEA 2D10A 3Q8CA 1TBEA 3ZUNA 2PTLA 3MTNB 4X57B 3DVGY 2M0XA 1TT5B 3LB8C 1WI0A 3NVZA 4GGQA 1JWSD 5C23A 3N1XC 4IDIA 4O1NA 2WXHA 2IO0B 3I5JC 4GXBA 4LLGM 2NS5A 2LD9A 4A9AA 3ML8A 1C4CA 1SEBD 2K9XA 1KF6B 4D2KA 4AWJA 2BW2A 5IAAC 4PYZA 1WX7A 4RF0A 1TS4A 3A9JB 2WX1A 3R3MA 4HPMB 1AN8A 2DYOA 3PHXB 1FFVA 4N6EB 3NZ3A 1UBQA 1N62A 2XN9C 1WGHA 3AE3B 1FNWA 3AE4B 2WNMA 3VAWA 2J42A 2RDHA 4OVZA 2IO2B 3AV8A 1XT9B 2JPHA 1N5WA 3DBSA 5CTRC 3RFZB 1UWXA 2DZMA 3TSSA 1GAQB 1XLOA 1FRDA 1WSPA 3ZO5B 5J18A 1EO6A 4ANXA 1FFUA 4BKSD 1P0RA 2N4FA 2ON8A 2ICIA 4M8NA 5BMGA 2XK5B 3ZNHB 3LDZE 3DVNU 1UUPA 4FJZA 3LJ3A 2WXFA 1D5ZC 2A5UA 1UWMA 4JQWC 5AZFA 4WQMA 3CSFA 4P6VF 3ZNZB 3EHVA 2MBHA 2N9PC 3IBEA 2WHIA 1FEHA 4REZA 1YNTE 3URYA 1SF0A 1EF1A 1WRIA 3JW0X 3VH4B 3J9CA 2LFIA 1PGAA 1P98A 1GUAB 2WXLA 2PW9A 3KWVA 3L16A 2DZIA 2J7QB 4IG7B 4C00A 3U2SC 4HVBA 5CHFA 1NENB 2LASA 1TYGB 1IPGA 3RNGC 2WXMA 1VZ6A 1JWBD 4HXDA 3VR9B 1ZKHA 3APDA 4OVUA 3WA0A 3OG5A 3ZXVA 1WX8A 1B9RA 3IHPC 1WXMA 4DK5A 1TZOA 5FR6A 4E74A 4K1RB 4LJOB 4TSSA 1PFDA 1E8ZA 3VH3B 1K8RB 4DHJB 1WJUA 2N1WA 2SAKA 3R7QA 3H6NA 2HD5B 4NNJB 1G6JA 3L13A 2JF5A 5AZGA 3Q14C 1AYFA 1SGHA 1VDVA 4XWWA 1I4PA 1QLBB 1PUTA 2G1EA 1KFYB 4IM2A 2G45B 3OJ3A 2KK8A 4II2B 4KZ0A 2W54A 1M4VA 2OJWA 2K8HA 4M0WB 4L1BA 4W9KA 3AEFB 2TSSA 1TS5A 3HM6X 3M62B 2WYQA 4W9IA 3FILA 1ISNA 2SEBD 3HHMA 1TKEA 4MGKE 1Q0WB 2KKCA 1YN4A 2WS3B 3WIMA 1F77A 2KT7A 3KW5B 5AEKB 1LFDA 1D6EC 2JZ3B 1WJNA 2LWPA 3MJ5A 4URKA 1J8CA 2V3PA 4YTPB 2MHJA 1STEA 4GMVA 3AM9A 4WJOA 3VTUA 1V49A 4BKGA 3PZ8A 4XC2A 3EA6A 1PGBA 4RCOA 1SE2A 1WE7A 2MH7A 2DNFA 1JALA 4AP4C 1B1ZA 1OFFA 1N5XA 2WXIA 2ZJDA 3B2FA 1UF0A 2FCSA 2DAFA 1F9JA 1ZOYB 3ZRCA 4JLCA 2M8SA 1IP9A 1V1OA 1UNSA 4RGMA 2W3SA 4E3CA 2LI5A 3DBLI 2K25A 2KTRB 4BKSA 1ESFA 3HVZA 4W9EA 5HKHA 2H89B 3LYYA 1WGRA 4HPLB 3RI7C 1I4QA 3W1SA 4BOSC 4ANUA 4GDKB 4K7UA 2NTTA 2BYFA 4P7IA 2HTME 3AXCA 1EM7A 3PT2B 2AYOB 2IYDB 3P2BA 3M3JA 3V60A 5DPWA 2AEHA 1FM0D 1SJED 5CHWA 1BT0A 5HFYA 2N0SB 4DBGA 5G2NA 1FMAD 4KDIC 4WIPA 2L0TA 4PS7A 3N30A 5IO9A 4A8XC 1TIFA 1FXTB 1HTQA 2E6XA 1MPEA 3VHTC 2BQQA 3O13A 1GNUA 2J52A 1NVID 3W5UB 2GBJA 2KXJA 4HLEA 1NBFC 5G5HA 4JIOU 2KWVB 1TZ1A 5D6JB 2K22A 4MJSB 3JVZX 5CHVC 4W9DA 2CU3A 1JWAD 2KC2A 3IAM1 1HA5A 1IBXA 3HM3A 2LZ6A 3ZQ4A 2MX2A 1WXAA 2N9EB 3FKYA 3L4PA 4CHKA 4DWFA 3JYUA 3ZNID 3EUB2 5J17A 2N7EA 3B2GA 2FE8A 3X23A 2BBCA 3B1LX 2L32A 4MEMA 3Q3FA 3PVLA 2BKFA 2N1VA 2IBIB 1XCTL 3CIRB 1DYQA 4LDTD 2FNJB 1J0GA 1ET6A 2KLCA 4RNAA 1XF5L 1SBBB 4ZRIA 1BMLC 4C80A 2J0MA 1QOBA 3UI3A 3AEDB 4K7WA 3WAMA 3MC0B 4ZYNA 3NVYA 1LGRA 2JWUA 3VRAB 3AMZA 2NBUA 3FILB 1NEKB 1R7SA 2EKEC 1FD6A 1E10A 3QC8B 3QX1A 3TEXA 1FRRA 4YT0B 2ZW0A 2KWCA 3T9LA 3U8ZA 3PS6A 1ENFA 5DPRA 1FO4A 3DBHI 1Q5WB 3DVGX 3CF6E 1V5TA 1UGMA 1WRDB 1OQRA 4KIKA 2M17A 3HK0A 3PPAA 4IW0A 1Y56A 3ZDMC 2Z8LA 3GE3C 1D4BA 3AEGB 2BS2B 3KYCD 3ZGZA 4G3XB 2D3AA 2C7HA 4NJ6A 3JSVB 4K3BA 3SR6A 3RMKC 1P7EA 2ZPNA 1KLGD 4ACFA 1IBXB 1KOTA 4C7ZA 2MLBA 1E90A 2WU5B 2L83A 4MM3A 1YN5A 3VR8B 2DX5B 2IY0B 3VUWA 3BIID 3ENEA 4NZLB 1DOYA 3PTFC 4TMAB 2N7JA 2BPSA 1MI0A 4G11A 2LRWA 4R3DA 2RPQA 2OJRA 3DBLB 3B0AA 4KZCA 1FNVA 2W55A 3WAOA 2GMIC 2BYTA 4BVUC 3SD5A 4K3CA 1T0QC 3P4QB 3V3XA 1XQQA 2KOXA 4FADA 1A70A 2FUHB 3BZDB 1GB1A 3KQ4A 4WQOB 1SE3A 3DHGC 4WWOA 3HUIA 2O2VA 2MBOA 4WAAA 5HI1A 2KVZA 2JUOA 2KX0A 2AWTA 4ZRQA 3VXWA 3BVMA 4RGNA 1V86A 2FUG1 2J4XA 2K0PA 1C4PA 5BYRA 1JMLA 3MFGA 2KACA 1H4RA 2GBRA 3PV1A 1V97A 2KMAA 1MHXA 5MPOA 2MEKA 3UINB 2I38A 1I4RA 3GOEA 2JT4B 1YOVB 2ONQA 4MT5A 4IKGA 1RRBA 4G0NB 2BS4B 4P1BC 2INDC 5AZHA 3DQVA 2ZVOA 1K51A 3QWZB 3P4SB 4TQ1A 2C5LC 3PRZA 2BKRB 2KJRA 1WMHB 3PRMB 2WXGA 4MELA 2DYMA 4NAWB 1WR6E 2GB1A 2BGFA 3RN9C 2KFKB 3A1QA 2KJHB 4RM8A 1WJ6A 3ETRA 1ROEA 2KLGA 4TUUA 1NYRA 1TY2A 1MHHE 4YTMB 4IUMB 1T0RC 1L6UA 4LK0M 2LHEA 3ZW3A 3EC8A 4XDDA 3VTVA 4BZAA 3KUCB 4TKNA 5H8YE 2ZNVB 4LNIA 2NMQA 3RYTA 3R2IA 3W5VB 3NZUA 4CO7A 5HHDG 1IUEA 5LLIA 4FHJA 1R4NB 4HCNB 2VH2A 5TR5A 3ZYYX 4BFRA 2YLMA 3N32A 2KYWA 2CU1A 3V6EB 4A20A 1AW7A 1C77A 1I4GA 4KSKC 4MSQB 2LRUA 1GB4A 2PJHA 2IDYA 3NS8A 4MGZE 4GU2A 2HJ8A 3A1QB 2L00B 5C3JB 1D5XC 2KDIA 3E56A 3AI5A 4PK1A 3IT6B 3AEAB 3AEBB 1E7UA 4IWPA 1I4HA 5E6JA 1ZE3D 3X0WA 3ZVVA 1QT9A 1BUIC 2M19A 3PSEB 3WALA 2BWES 3QQ8B 2MCNB 4JL9A 2KTRA 3Q8AA 3RNCC 2JY6A 1P3QU 4EZLA 2GI9A 5GXGB 3RD2A 2C60A 4PT5A 3SHQA 1K50A 1L2NA 1RYJA 2J0KA 1K52A 2JSVX 2KD0A 1MG8A 3VVWB 4US9A 2LXAA 3RT3B 4LNFA 1R4MI 2QILA 3W1SC 3A9JA 1QQRA 1V80A 3FC4A 5BO4B 4B0EA 1WYWB 4S17A 3TJPA 1EWYC 1XLPA 4RMAA 2JZPA 4M0WA 5DPSA 4GB9A 4WJNA 4A6QA 4NAMA 2BWFA 4XYCA 5IKCM 1ZPSA 2JX5A 3ML9A 3QK0A 1HQRD 2JXXA 4XDCA 1FIQA 1XEEA 1J7BA 1WXVA 1VR9A 3DCGA 1JW9D 1OQYA 1WGGA 3PREA 3N9YC 2AQ1B 4HK2A 3S2AA 2LUMA 3VUXA 3AULA 5HG2A 1R4NI 2BYVE 2D3CA 1V1PB 4MH0E 2O2VB 4HKZE 5DPTA 3L0WB 3NRZA 4HRSA 4I6NB 4GDLA 3DBRI 4EUTA 1WXQA 1J7CA 4YSYB 4RM9A 3AECB 1WGYA 2KQSA 3IAS1 2DYBA 1QOFA 2EMSA 2JRHA 2IPKD 3DHIC 1ACCA 2BVCA 1WR1A 3NVVA 4WWPA 2WXJA 2MP2A 4YSXB 3ECIA 3KUDB 2L8JA 4L2YA 1V6EA 4CQNA 2KQ4X 4BAXA 1QOAA 5I4DA 4J6IA 2MW5A 1AWDA 3ZIMA 1F2RI 1HEZE 1WM3A 2BTEA 1TJEA 3M95A 3HRDD 2Y3AA 4OW0A 1ZP0B 2DZKA 2LVOA 3UF8A 4BBNF 1YX6B 4G50A 2RSUA 3NG0A 1PYWD 1C79A 2X8XX 2B76B 1Z5SB 2LVPA 2JXTA 4TV3A 3K9OB 2K6DB 1E8XA 4B0MA 1KRHA 4GOCA 1OEYJ 1WH3A 3IT4B 1R4MB 2JVCA 4J3OD 3V62A 5D7GA 3Q69A 1GC6A 3W9CB 2M0AA 2IJ0A 3B08A 3KH0A 1JRPA 4FJVB 3SEBA 2KDMA 4TQ0A 4PS8A 2I1JA 4GN1A 4FLHA 4HJGE 2ASQA 1T6BX 2BF8B 3EECA 2AL3A 5TSSA 3BINA 3MC8A 4USAA 4FBJB 1RAXA 3AEEB 1E8WA 2RD0A 3RULA 3IG3A 1XXGA 2IY1B 4FULA 4WWMA 2WXOA 4DHZB 3Q8EA 3I9V1 1XCQL 4LCDE 2L7RA 3IVFA 1VRAB 4ITKA 2QC8A 2NCNA 1TGZB 1JROA 1ZUD2 4MSMB 1SB3C 1C9FA 3V6CB 3WCQA 1KM7A 1UD7A 1RWSA 3CMMB 4W9HA 4C4VA 1T5XD 4N9F4 4RGOS 2QJLA 4EE2A 3UIOB 2DAJA 4W9GA 4A55A 5BYSA 3PO0A 1DOXA 4MGYE 1WGDA 3C0RB 4KSLC 2FCNA 5EE9A 2BS3B 4DXAB 3H7PB 2IO1B 4AJWA 1YQ3B 3PRPB 1S3SG 1WFYA 1YJ1A 1ET9A 2WWZA 5T8IA 2MBQA 2LUEA 3SDLC 1DOIA 4KV2A 1FNUA 1EU4A 2INPE 2O6VA 2MJ3A 1PQSA 2V4IB 4NJ7A 1XLQA 2LEKA 3NOBA 4JGHB 2I1KA 3ZRFA 2D07B 2AQ3B 3QJZA 4H2AA 1CZPA 3DBRB 2CHXA 4ICUA 4QAYA 1V1PA 3IXSA 3Q6BA 2K3UA 1IGDA 1VJKA 2ZW1A 2IO3B 2WP9B 2FCQA 4EOYA 1MG4A 2N7DA 2E3TA 4FXCA 3DOWA 3QCAA 2ZPYA 2BT6A 2IGHA 1L6VA 1L4DB 3C19A 3AN1A 2KANA 2NTSA 2WXQA 4OVVA 4F8CB 2KWDA 1E0ZA 2PVOD 2HDEA 2WDQB 4OZCA 4LJPB 5D3DA 2BB6A 1NYQA 1V9JA 2L76A 1P7FA 3R7RA 3PLUA 2H88B 2MJEA 2V1YA 4I6LB 3TCAA 5IA7A 5EE3A 2VH1A 2Y5BB 3H7SA 2CHWA 3HIZA 1EUVB 3CWIA 2LGIA 5E6PA 2D3BA 2KDFB 3BY4B 4XX5A 2CR5A 3ZTDA 3AE5B 3ZJTA 4AOFA 1F2RC 3P1MA 3AU5A 1RFAA 4GDKA 3OWEB 2GBNA 3PZDA 3R2TA 2JU6X 1ZW7A 2JWZA 2VRRB 1UH6A 4YWGG 2PMVA 2HJ1A 3L54A 4WURA 4ANWA 1PDXA 2KX3A 4YSZB 2KAJA 3U4EG 2KHWB 1NI3A 3E9SA 3N20C 4GSWA 3T3OA 5JH5C 2KDBA 4WH4A 4DDID 3L10B 1L0XB 1TTNA 3A4RA 4LNNA 2M56B 1YJJA 5D3IB 3SFDB 2Y5CA 4NQKE 2WDTB 1L4ZB 2CS4A 5AUIA 4ZHPA 1YIWA 3Q3JA 2FIDA 3CSTA 4NAWA 5FK9C 2GRIA 3ZNGC 4HJKA 2WXPA 4HDOA 3NZSA 5EDSA 1V5OA 1TKGA 3K9PB 3AH7A 3GS2A 2KVRA 3KVFB 1ZDXA 1ZXHA 2LMCA 2K6QA 1X1MA 3NHEB 4JWSC 5D94A 4KGRA 4HEA1 4WWNA 2PVGC 3NS1A 2ZZPB 2A4ZA 2WGSA 2CJOA 3VTWA 1RM6C 2MBBB 5IN7A 4BBNC 2PPHA 4MGIE 4W9FA 2MA9B 3H1UA 1C4AA 1C3TA 4KGSA 3N1ZC 2PE9A 2FCMA 3QAQA 4P16A 2CHZA 2WLBA 4F7ZA 5EE1A 1QKZA 2GBMA 3H9DA 2NR2A 2G3QB 1J19A 3Q3NC 4LNKA 2KMMA 4UDUC 1HE8A 2QCZA 2Z59B 1GPXA 2KZRA 5JHAA 3R8BA 1C78A 1ZGUB 1VCBA 2XNAC 2GLSA 1VZ7A 3AE9B 4OZBA 3WANA 2DENB 1FXIA 4PS3A 2IZVB 4YTNB 4DHZE 2KFJA 5LXHA 3DWMA 4DXFA 1XD3B 3BVZA 2QDFA 1E8YA 1QZEA 2XBBC 3H8HA 1YN3A 1NI2A 2KN5A 3OLMD 3TEYA 3ZDTA 2KJ6A 2RPVA 4AUQC 1NDDA 5FR3A 3BK2A 4KGTA 2Z0EB 3N3KB 4ASWC 2O6VD 2WXNA 3AE2B 5JZEB 1SSNA 3DVNV 1ZXIA 4AJYB 2GBKA 2ZEQA 1FCLA 1YQBA 3KUZA 1JQ4A 4RGTA 2IGGA 3A4SC 3GE8C 4FA6A 1TY0A 5C1ZA 2QMTA 1C76A 3ZLZA 5J2RA 3ZJUA 2QHOA 3ONSA 5G5GA 4W9CA 2GOWA 3DDCB 4W9JA 1S1QB 2INCC 2FIFA 5KHOA 4M00A 3AE6B 1P1AA 1I4XA 1KLVA 3RNBC 4GIVA 2V0GA 1A5RA 4NY0A 4EEWA 1VZ8A 1JRUA 1RLFA 4C7YA 2LJIA 4KVGB 4B6WA 2RDBC 3MJWA 2DHZA 1F0ZA 3I57A 2PKOA 4GDLB 2V9HA 1E7VA 1XO3A 2WU2B 2YEPB 3EFCA 4M8MA 4ZRPA 2O6VB 1WZ3A 2LVQA 1SIFA
chains in the Genus database with same CATH topology
3SEBA 2KDMA 1SE4A 3RPFC 4TQ0A 3MC0B 3NVYA 2JWUA 2Y5PA 2D5GA 3VRAB 3AMZA 4HJGE 3FILB 1NEKB 1R7SA 4JWUC 1FD6A 1DGJA 1HZ6A 3AE8B 1T6BX 3GB1A 3NUHB 1E10A 3TEXA 5TSSA 1FRRA 4USAA 4YT0B 1QF6A 1N61A 2ZW0A 3AEEB 4JPSA 3ZJVA 1HZ5A 1ENFA 3FAHA 1FO4A 1XXGA 2L1AA 2W3RA 1WGKA 4A90A 4WWMA 2WXOA 3B9JA 1WYGA 1OQRA 3Q8EA 2X38A 3I9V1 1CJEA 1XCQL 3AE1B 3Q8CA 1PGXA 3DWGC 1VRAB 1Y56A 2PTLA 2Z8LA 4ITKA 3SFEB 1ZUD2 1JROA 1D4BA 1SB3C 3AEGB 1C9FA 2BS2B 4XWTA 3U52E 3WCQA 3ZGZA 4US8A 3BYTB 3SR6A 1P7EA 1KLGD 1RWSA 3BYYB 1IBXB 1T5XD 4C7ZA 3P42A 2FBWB 4RGOS 2WU5B 2QJLA 3W2DA 3LB8C 4EE2A 2L83A 1YN5A 3VR8B 3NVZA 1JWSD 1L5PA 4A55A 5BYSA 1JWMD 3VRBB 3PO0A 2LHDA 5BYQA 1DOXA 4IDIA 3BIID 4O1NA 1SJHD 2WXHA 4NZLB 1DOYA 5EE9A 4TMAB 2BS3B 4LLGM 1EU3A 4A9AA 2N7JA 1C4CA 1SEBD 1MI0A 2K9XA 1KF6B 4D2KA 4R3DA 1YQ3B 2BW2A 4RF0A 1ET9A 1TS4A 3Q8BA 3TEZA 2DLBA 1AN8A 2DYOA 3HVDA 5T8IA 1FNVA 1FFVA 3P4RB 3KWLA 2N9KA 4N6EB 2W55A 1DOIA 2QSDA 3NZ3A 2BYTA 1FNUA 1N62A 4ZYSA 3P4QB 1EU4A 2WXRA 2IGDA 2XN9C 2L52A 3V3XA 1TS2A 2INPE 3AE3B 3BVGA 4N59A 2MJ3A 1FNWA 2V4IB 3AE4B 1A70A 1XLQA 2LEKA 3BZDB 1GB1A 3KQ4A 2WNMA 2AQ3B 2JYTA 4H2AA 2J42A 2RDHA 4OVZA 2JQRB 3AV8A 1SE3A 1CZPA 4DQOC 3HUIA 1V1PA 3IXSA 5HI1A 5C2TB 2K3UA 1IGDA 1VJKA 1N5WA 2WP9B 2ZW1A 3RFZB 4ZRQA 2PLPA 2E3TA 1UWXA 4FXCA 1GOZA 3BVMA 1RFKA 4RGNA 3TSSA 1GAQB 1XLOA 2FUG1 2J4XA 2K0PA 4L23A 1FRDA 4NJCA 1C4PA 1N63A 1JMLA 3MFGA 5BYRA 4C56C 1WSPA 2BT6A 2IGHA 1L6VA 2INNE 2KACA 3U7ZA 1L4DB 3AN1A 1FFUA 1V97A 2NTSA 2WXQA 3PZ7A 1MHXA 1XLNA 2KWDA 2MEKA 3EGRA 5MPOA 2BB5A 1E0ZA 2PVOD 2I38A 2ON8A 1I4RA 2ICIA 5BMGA 2HDEA 2WDQB 4OZCA 4HKQA 2DWQA 2KN4A 2ONQA 5D3DA 4MT5A 1UUPA 2BB6A 2WXFA 1D5ZC 1NYQA 4IKGA 1P7FA 1UWMA 2BS4B 1SXTA 4WQMA 2H88B 1K51A 2MJEA 3Q8FA 3P4SB 4P6VF 4TQ1A 2V3NA 5EE3A 2WXGA 3KLSX 4LTUA 1FEHA 2DYMA 4NAWB 3CWIA 4REZA 1YNTE 2LGIA 5AUKA 2GB1A 3URYA 1D5MC 5BMHA 1SF0A 5EE0A 1WRIA 2W82A 4RH6A 1TKYA 1E7PB 3J9CA 2LFIA 1PGAA 3AE5B 3ETRA 3ZJTA 4MM3B 1ROEA 1F2RC 1NYRA 2WDRB 3P1MA 1TY2A 1LO5D 1MHHE 4YTMB 2QIEB 3OWEB 2WXLA 2PW9A 3KWVA 3R2TA 1L6UA 2JU6X 4LK0M 2LHEA 2MJDA 3TEWA 4XDDA 3U2SC 4YWGG 5H8YE 1NENB 2PMVA 1TYGB 4HROA 4ZOHC 3C8YA 4WURA 2WXMA 1VZ6A 2NMQA 1JCKB 1JWBD 3VR9B 3R2IA 3VQIA 1PDXA 1MVKA 2WQYB 3NVWA 3W5VB 4YSZB 5HHDG 1IUEA 2I2YA 1L0YB 2KAJA 2JYEA 1FXAA 3U4EG 1B9RA 1NI3A 3E9SA 1TZOA 3T3OA 2ACZB 2J53A 2N9LA 4WH4A 1L0XB 3ZYYX 4TSSA 2QEJC 1PFDA 1EWCA 2CJNA 2M56B 1YJJA 5D3IB 3SFDB 1AW7A 2SAKA 1C77A 1I4GA 2Y5CA 1BXTA 4KX6B 1L4ZB 4ARIA 5AUIA 4ZHPA 1GB4A 2AQ2B 1AYFA 2IDYA 1VDVA 5FK9C 2GRIA 3BK1A 2AX5A 2WXPA 1I4PA 4XWWA 1QLBB 1PUTA 3V05A 2G1EA 1YJIA 1KFYB 4N58A 5C3JB 2OHFA 2WDVB 1D5XC 3E56A 2DBYA 1TKGA 3AH7A 3IT6B 3AEAB 3GS2A 1ZDXA 3AEBB 1ZXHA 2W54A 1I4HA 4KKJA 1M4VA 5E6JA 2LMCA 2OEDA 4JWSC 1ZE3D 4KGRA 4HEA1 4L1BA 1CQVA 1QT9A 1BUIC 2PVGC 2M19A 3AB5A 3AEFB 3NS1A 2TSSA 1TS5A 1J7AA 2Q5WD 1KLUD 2CJOA 1RM6C 3FILA 2SEBD 1E6EB 3Q8AA 1TKEA 4JX1C 2GI9A 4ZHOA 5GXGB 1YN4A 1C4AA 2WS3B 1F77A 4KGSA 1E9MA 1D6EC 3ABVB 4PT5A 4P16A 1K50A 3MJ5A 2EKIA 2WLBA 1RYJA 5EE1A 2V3PA 1QKZA 2WXKA 1K52A 4YTPB 2JSVX 1STEA 3AM9A 5BMIA 4OZAA 4US9A 1WWTA 2KMMA 4UDUC 1T3QA 3PZ8A 2QILA 4JE3B 1GPXA 3EA6A 1PGBA 4RCOA 1QQRA 4ARCA 3R8BA 3FC4A 1SE2A 4B0EA 1JRPA 1HXYD 2MH7A 1JALA 1C78A 1B1ZA 1OFFA 1N5XA 5H92C 5LNK1 2WXIA 3B2FA 1EWYC 1XLPA 2YEPF 4IOIE 2JZPA 4M0WA 1QOGA 1V8CA 1ZOYB 2XNAC 4A6QA 1V1OA 3T3NA 1VZ7A 3AE9B 4NAMA 4OZBA 4AS1A 1UNSA 4RGMA 1ZDVA 2W3SA 1FXIA 3BWUD 4WAFA 1ZPSA 2JX5A 1K53A 1HQRD 4YTNB 4XDCA 1ESFA 1VLBA 3HVZA 1KTKA 1XEEA 1FIQA 1UGJA 2H89B 3LYYA 1SIJA 3DWMA 4DXFA 1J7BA 1VR9A 1JW9D 1I4QA 4RF1A 3BVZA 1YQ4B 4GLSC 3N9YC 2AQ1B 3W1SA 4GDKB 2LUMA 3GP7A 2NTTA 3TUOA 2HTME 3H8HA 1YN3A 1EM7A 3P4PB 4KKIA 3TEYA 5HG2A 5JXVA 1V1PB 2RPVA 4HKZE 1FM0D 1SJED 3AE7B 5FR3A 3NRZA 3BK2A 4HRSA 5HFYA 2N0SB 4KGTA 1WXQA 1J7CA 4YSYB 1KH0A 3MP9A 2WXNA 3AE2B 3AECB 1FMAD 4WIPA 3IAS1 2R61A 1SSNA 1ZXIA 1QOFA 4A8XC 1FCLA 2IPKD 1FCCC 4YXDB 2E6XA 1JQ4A 1ACCA 1MPEA 3P63A 3O13A 1Q10A 2J52A 2RMMA 4RGTA 1I7HA 1NVID 2IGGA 3W5UB 4AQ7A 1TS3A 3NVVA 1JWUD 1TY0A 2WXJA 5G5HA 2VZKB 4YSXB 2QMTA 1C76A 4Q2JA 2K22A 3ZJUA 4L2YA 4CQNA 2KQ4X 2K5PA 2CU3A 1JWAD 1QOAA 3IAM1 5I4DA 2VZKD 1HA5A 1IBXA 1AWDA 5G5GA 3ZQ4A 1F2RI 1HEZE 2BTEA 1N60A 1L0VB 1TJEA 3L4PA 1QILA 3HRDD 2G9HD 2RDGA 2PIAA 2Y3AA 3AE6B 4OW0A 1YMHE 1ZP0B 1I4XA 3EUB2 3MHZA 4XE0A 2V0GA 3B2GA 2FE8A 2BBCA 1PYWD 1VZ8A 4DXGA 1C79A 2L32A 4RFBA 2EELA 2B76B 4C7YA 4MACA 2LJIA 2JXTA 1XCTL 3CIRB 1DYQA 1OQQA 4B0MA 4MH8A 1KRHA 1F0ZA 1CK1A 3IT4B 1ET6A 3I57A 4J3OD 2PKOA 4GDLB 5D7GA 4RNAA 1XF5L 1SBBB 3Q69A 1XO3A 2WU2B 2YEPB 3LXFA 1BMLC 4C80A 5FKAC 3W9CB 1QOBA 4ZRPA 3UI3A 2M0AA 3AEDB 2IJ0A 1IGCA 4OHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9R A;  1SIJ A;  3DWM A;  4N59 A;  1J7B A;  1NI3 A;  2MJ3 A;  3RPF C;  1JW9 D;  3AE4 B;  1YQ4 B;  1A70 A;  1XLQ A;  2LEK A;  3NVY A;  2ACZ B;  3VRA B;  3AMZ A;  2HTM E;  3ZYY X;  1NEK B;  1R7S A;  2JQR B;  3AV8 A;  1CZP A;  1PFD A;  4JWU C;  2CJN A;  1DGJ A;  2M56 B;  3HUI A;  3AE8 B;  3P4P B;  1YJJ A;  5C2T B;  3SFD B;  1VJK A;  1N5W A;  2WP9 B;  2Y5C A;  1E10 A;  4KX6 B;  2E3T A;  4FXC A;  5AUI A;  1FM0 D;  3AE7 B;  4ZHP A;  1FRR A;  1RFK A;  4USA A;  3NRZ A;  4YT0 B;  4HRS A;  1QF6 A;  1GAQ B;  1N61 A;  1XLO A;  3AEE B;  2N0S B;  1AYF A;  1FRD A;  1WXQ A;  1J7C A;  1VDV A;  4YSY B;  1N63 A;  2AX5 A;  2BT6 A;  1L6V A;  3AE2 B;  1FMA D;  3AEC B;  1QLB B;  1PUT A;  3FAH A;  1FO4 A;  3AN1 A;  2G1E A;  1FFU A;  1ZXI A;  1V97 A;  1YJI A;  1KFY B;  4N58 A;  1QOF A;  5C3J B;  2OHF A;  2W3R A;  1WGK A;  2WDV B;  1XLN A;  5MPO A;  2DBY A;  4WWM A;  1TKG A;  3B9J A;  1E0Z A;  1WYG A;  1OQR A;  2PVO D;  3AH7 A;  3AEA B;  4YXD B;  1CJE A;  1JQ4 A;  3AEB B;  3P63 A;  2WDQ B;  3AE1 B;  2W54 A;  1I7H A;  1NVI D;  2DWQ A;  3DWG C;  3W5U B;  4JWS C;  4ITK A;  3NVV A;  1NYQ A;  3SFE B;  1UWM A;  1ZUD 2;  1JRO A;  1QT9 A;  1SB3 C;  2BS4 B;  2M19 A;  2PVG C;  3AB5 A;  3AEF B;  3AEG B;  3NS1 A;  2BS2 B;  2H88 B;  4WQM A;  5G5H A;  2MJE A;  3WCQ A;  1J7A A;  3P4S B;  4P6V F;  4YSX B;  4US8 A;  2Q5W D;  2CJO A;  3SR6 A;  1RM6 C;  2K22 A;  5EE3 A;  1RWS A;  1E6E B;  2K5P A;  1TKE A;  2CU3 A;  1JWA D;  4JX1 C;  4C7Z A;  1QOA A;  2FBW B;  4LTU A;  3CWI A;  4ZHO A;  1AWD A;  2WU5 B;  5AUK A;  2QJL A;  5G5G A;  5GXG B;  1SF0 A;  5EE0 A;  1WRI A;  2WS3 B;  3LB8 C;  1N60 A;  1TKY A;  1L0V B;  1E7P B;  2L83 A;  1E9M A;  3VR8 B;  1TJE A;  3NVZ A;  3ABV B;  3L4P A;  3AE5 B;  3ETR A;  1L5P A;  3HRD D;  2EKI A;  2WLB A;  3AE3 B;  1ROE A;  3VRB B;  2PIA A;  1RYJ A;  3AE6 B;  3PO0 A;  5EE1 A;  1ZP0 B;  4YTP B;  3EUB 2;  1DOX A;  3B2G A;  3AM9 A;  4IDI A;  1NYR A;  2WDR B;  3BII D;  3P1M A;  4US9 A;  4YTM B;  1WWT A;  2KMM A;  2QIE B;  1DOY A;  5EE9 A;  1T3Q A;  2BS3 B;  1L6U A;  4A9A A;  4C7Y A;  2B76 B;  2MJD A;  1GPX A;  2K9X A;  1KF6 B;  3FC4 A;  1YQ3 B;  3CIR B;  2MH7 A;  1OQQ A;  1JAL A;  1N5X A;  1OFF A;  5H92 C;  1KRH A;  1F0Z A;  5H8Y E;  3B2F A;  1NEN B;  1EWY C;  1XLP A;  1TYG B;  4HRO A;  4ZOH C;  1QOG A;  1V8C A;  1ZOY B;  1FFV A;  2PKO A;  3P4R B;  3AE9 B;  3KWL A;  1XO3 A;  1JWB D;  4N6E B;  2W55 A;  3VR9 B;  2WU2 B;  2W3S A;  1FXI A;  1DOI A;  3LXF A;  1PDX A;  2WQY B;  2JX5 A;  3NVW A;  3W5V B;  4C80 A;  1N62 A;  3W9C B;  4YTN B;  4YSZ B;  1QOB A;  1IUE A;  2L52 A;  3AED B;  1VLB A;  2KAJ A;  1FXA A;  3HVZ A;  3P4Q B;  1JRP A;  1FIQ A;  2H89 B; 
#chains in the Genus database with same CATH topology
 4IWO A;  4W9L A;  2JZZ A;  2UWQ A;  2Y5P A;  4EFO A;  2KTF A;  5D2M B;  4KDL B;  4C4V B;  2DZJ A;  1HZ6 A;  2PEA A;  3NUH B;  2NPT A;  1D3Z A;  2BYE A;  1WY8 A;  4NPN A;  1QF6 A;  1N61 A;  4JPS A;  2J0J A;  3RZW C;  3UQA A;  2KQ7 A;  1WGK A;  3B9J A;  1WYG A;  2X38 A;  4HWI B;  4FN2 A;  3AE1 B;  1PGX A;  3DWG C;  2D3G A;  1T0Y A;  3TBL D;  2HTH A;  2R2O A;  3SFE B;  1I35 A;  2L05 A;  4XWT A;  2L3Z A;  5E6O A;  1UEL A;  3U52 E;  4US8 A;  2UU7 A;  3BYT B;  2RGF A;  3BYY B;  3Q3M C;  4M02 A;  3P42 A;  2FBW B;  4HDQ A;  3W2D A;  2C7N B;  2LJ5 A;  3U7D A;  1KJT A;  1L5P A;  1JWM D;  3VRB B;  1E5W A;  2LHD A;  5BYQ A;  4WJP A;  1SJH D;  1GJZ A;  4DDG D;  1L7Y A;  3GZN I;  1EU3 A;  1OEY A;  2C7M B;  2CKH B;  4ZDV A;  5E6N A;  2UYZ B;  3Q8B A;  3RCZ A;  3TEZ A;  2DLB A;  3HVD A;  1OTR B;  4EKU A;  2YVC A;  3P4R B;  3KWL A;  2N9K A;  4HCP B;  2KFK A;  2QSD A;  2LGY A;  2XK5 A;  2D11 A;  4ZYS A;  5L95 C;  2WXR A;  3PLV A;  2IGD A;  2L52 A;  2K8C A;  1TS2 A;  2C9W B;  3BVG A;  4N59 A;  3TIX A;  3L08 A;  1CMX B;  3UIP B;  2RR9 A;  2KNB A;  2JYT A;  2JQR B;  5KHQ A;  1WXS A;  4DQO C;  1FPY A;  2NPT B;  5C2T B;  2KDE B;  1WE6 A;  2PLP A;  2G4S A;  1GOZ A;  3MC9 A;  3A9K A;  1RFK A;  1UZX B;  2K39 A;  4L23 A;  4NJC A;  4C56 C;  1N63 A;  2INN E;  3U7Z A;  3QIJ A;  3RUI B;  5JHB A;  1MJD A;  3PZ7 A;  1VD2 A;  1XLN A;  3EGR A;  4EZJ A;  2BB5 A;  2LGD A;  1LQB A;  3VFK A;  4HKQ A;  3V61 A;  2DWQ A;  2KN4 A;  3APF A;  4CYE A;  3DHH C;  1WF9 A;  1SXT A;  3ZTC A;  2V3S A;  3Q8F A;  4WJQ A;  4BOZ B;  2M1M A;  2V3N A;  2MP2 B;  3AU4 A;  3QHT A;  3KLS X;  4LTU A;  4XGA B;  3M63 B;  2AL6 A;  5BMH A;  5AUK A;  1D5M C;  5EE0 A;  1WMH A;  1MFW A;  4RH6 A;  2W82 A;  1TKY A;  1Q1O A;  1E7P B;  2ZVN A;  2EMT A;  4B95 A;  4MDK E;  4LNO A;  2LXC A;  4MM3 B;  4E71 A;  1V2Y A;  1GC7 A;  4A3P A;  2MBE A;  4KIK B;  3U30 A;  2WDR B;  1LO5 D;  2QIE B;  3H7P A;  3QAR A;  2MJD A;  3TEW A;  3PHW B;  3N1Y C;  1F52 A;  5G55 A;  4HRO A;  4ZOH C;  3GZN B;  3C8Y A;  1OGW A;  1JCK B;  1M94 A;  3VQI A;  4BKT A;  1MVK A;  2WQY B;  3NVW A;  5CX3 A;  5LXI B;  1T0S C;  2I2Y A;  1L0Y B;  2JYE A;  1FXA A;  2L0F A;  1GG3 A;  1WX9 A;  3O65 B;  2ACZ B;  2J53 A;  2N9L A;  2G4D B;  2KO3 A;  3I3T B;  1HTO A;  2QEJ C;  3VDZ A;  1EWC A;  2CJN A;  1U4A A;  4ICV A;  1BXT A;  4KX6 B;  3DBH B;  4ARI A;  2AQ2 B;  3RZF A;  4A3O A;  3BK1 A;  2AX5 A;  3V05 A;  1UBI A;  2N9X A;  1YJI A;  4N58 A;  4K81 A;  2OHF A;  2WDV B;  3A33 B;  2DBY A;  3OJ4 B;  3Q2A C;  2M4N A;  3IFW B;  5GMV A;  1V81 A;  4KKJ A;  2OED A;  2JRI B;  4P1C C;  1CQV A;  3AB5 A;  2MQJ A;  5IP4 D;  1J7A A;  2Q5W D;  1KLU D;  4LDT B;  3I63 C;  1E6E B;  4JX1 C;  4MJS A;  4ZHO A;  2REX A;  1E9M A;  3ABV B;  2V4L A;  2ZCB A;  2B3A A;  2EKI A;  3VUY A;  1F1H A;  2WXK A;  2FAZ A;  2HE7 A;  4YL8 A;  5BMI A;  4OZA A;  1WWT A;  1WZ0 A;  2D2Q A;  1T3Q A;  4JE3 B;  4ARC A;  2NBV B;  1HXY D;  5H92 C;  5LNK 1;  1LM8 B;  1EF5 A;  2YEP F;  4IOI E;  1QOG A;  4ANV A;  1V8C A;  4XZ4 A;  4M01 A;  3T3N A;  4AS1 A;  2KWU B;  1ZDV A;  3BWU D;  4WAF A;  1K53 A;  2ZCC A;  1AAR A;  1VLB A;  4IM3 A;  1N6Z A;  1KTK A;  1UGJ A;  1SIJ A;  4I6P A;  4RF1 A;  2MRP A;  1YQ4 B;  4GLS C;  3GP7 A;  3TUO A;  3PGE A;  4FJY A;  3DPD A;  5IOI A;  2KC1 A;  1IYF A;  3P4P B;  4KKI A;  1H8C A;  3A9K B;  3NJT A;  5JXV A;  2MWS B;  1WJ4 A;  3AE7 B;  1KH0 A;  3MP9 A;  4K7S A;  2R61 A;  3EFU A;  3ZKJ C;  4B9K A;  1FCC C;  4YXD B;  3P63 A;  1Q10 A;  2RMM A;  2K1F A;  1I7H A;  3OAW A;  2NVU I;  4AQ7 A;  1TS3 A;  4ZRK A;  3MHS D;  1JWU D;  2R2Q A;  3NY5 A;  2VZK B;  4IM0 A;  1YX5 B;  4Q2J A;  3D32 A;  2K5P A;  2PE6 B;  3JSV A;  2VZK D;  3RNA C;  4IWQ A;  2OOB B;  1N60 A;  1L0V B;  1QIL A;  2G9H D;  2RDG A;  2PIA A;  3KYD D;  3UQB A;  1WM2 A;  1YMH E;  3MHZ A;  4HPP A;  4XE0 A;  2KMC A;  2LGS A;  2MSE D;  3ALB A;  4DXG A;  4NQL B;  4RFB A;  3ZXR A;  2EEL A;  4MAC A;  2LGX A;  3RNE C;  1OQQ A;  4II3 B;  3RNF C;  4ZRJ A;  4MH8 A;  1YD8 U;  2K8B A;  1CK1 A;  1LXD A;  1Y8R C;  2NBW B;  3WAP A;  3LXF A;  5FKA C;  4EZK A;  1P9D U;  1IGC A;  4DHJ D;  4OHJ A;  1SE4 A;  3RPF C;  1SE9 A;  3Q3O C;  1I42 A;  2D5G A;  3UGB B;  1WIA A;  2XEW A;  3R66 C;  2ZNV C;  3TMP B;  4JWU C;  1DGJ A;  3AE8 B;  3QA8 A;  4F1S A;  2Z0D B;  3W1Y A;  3GB1 A;  3TL5 A;  4PYU A;  3T8M A;  1C1Y B;  3L17 A;  3SU8 X;  3ZJV A;  3APC A;  4IC7 B;  4S0R A;  1HZ5 A;  2WX0 A;  3FAH A;  1Z2M A;  2W9N A;  2L1A A;  2W3R A;  5DCN A;  4A90 A;  4FHK A;  5L83 A;  1CJE A;  2D10 A;  3Q8C A;  1TBE A;  3ZUN A;  2PTL A;  3MTN B;  4X57 B;  3DVG Y;  2M0X A;  1TT5 B;  3LB8 C;  1WI0 A;  3NVZ A;  4GGQ A;  1JWS D;  5C23 A;  3N1X C;  4IDI A;  4O1N A;  2WXH A;  2IO0 B;  3I5J C;  4GXB A;  4LLG M;  2NS5 A;  2LD9 A;  4A9A A;  3ML8 A;  1C4C A;  1SEB D;  2K9X A;  1KF6 B;  4D2K A;  4AWJ A;  2BW2 A;  5IAA C;  4PYZ A;  1WX7 A;  4RF0 A;  1TS4 A;  3A9J B;  2WX1 A;  3R3M A;  4HPM B;  1AN8 A;  2DYO A;  3PHX B;  1FFV A;  4N6E B;  3NZ3 A;  1UBQ A;  1N62 A;  2XN9 C;  1WGH A;  3AE3 B;  1FNW A;  3AE4 B;  2WNM A;  3VAW A;  2J42 A;  2RDH A;  4OVZ A;  2IO2 B;  3AV8 A;  1XT9 B;  2JPH A;  1N5W A;  3DBS A;  5CTR C;  3RFZ B;  1UWX A;  2DZM A;  3TSS A;  1GAQ B;  1XLO A;  1FRD A;  1WSP A;  3ZO5 B;  5J18 A;  1EO6 A;  4ANX A;  1FFU A;  4BKS D;  1P0R A;  2N4F A;  2ON8 A;  2ICI A;  4M8N A;  5BMG A;  2XK5 B;  3ZNH B;  3LDZ E;  3DVN U;  1UUP A;  4FJZ A;  3LJ3 A;  2WXF A;  1D5Z C;  2A5U A;  1UWM A;  4JQW C;  5AZF A;  4WQM A;  3CSF A;  4P6V F;  3ZNZ B;  3EHV A;  2MBH A;  2N9P C;  3IBE A;  2WHI A;  1FEH A;  4REZ A;  1YNT E;  3URY A;  1SF0 A;  1EF1 A;  1WRI A;  3JW0 X;  3VH4 B;  3J9C A;  2LFI A;  1PGA A;  1P98 A;  1GUA B;  2WXL A;  2PW9 A;  3KWV A;  3L16 A;  2DZI A;  2J7Q B;  4IG7 B;  4C00 A;  3U2S C;  4HVB A;  5CHF A;  1NEN B;  2LAS A;  1TYG B;  1IPG A;  3RNG C;  2WXM A;  1VZ6 A;  1JWB D;  4HXD A;  3VR9 B;  1ZKH A;  3APD A;  4OVU A;  3WA0 A;  3OG5 A;  3ZXV A;  1WX8 A;  1B9R A;  3IHP C;  1WXM A;  4DK5 A;  1TZO A;  5FR6 A;  4E74 A;  4K1R B;  4LJO B;  4TSS A;  1PFD A;  1E8Z A;  3VH3 B;  1K8R B;  4DHJ B;  1WJU A;  2N1W A;  2SAK A;  3R7Q A;  3H6N A;  2HD5 B;  4NNJ B;  1G6J A;  3L13 A;  2JF5 A;  5AZG A;  3Q14 C;  1AYF A;  1SGH A;  1VDV A;  4XWW A;  1I4P A;  1QLB B;  1PUT A;  2G1E A;  1KFY B;  4IM2 A;  2G45 B;  3OJ3 A;  2KK8 A;  4II2 B;  4KZ0 A;  2W54 A;  1M4V A;  2OJW A;  2K8H A;  4M0W B;  4L1B A;  4W9K A;  3AEF B;  2TSS A;  1TS5 A;  3HM6 X;  3M62 B;  2WYQ A;  4W9I A;  3FIL A;  1ISN A;  2SEB D;  3HHM A;  1TKE A;  4MGK E;  1Q0W B;  2KKC A;  1YN4 A;  2WS3 B;  3WIM A;  1F77 A;  2KT7 A;  3KW5 B;  5AEK B;  1LFD A;  1D6E C;  2JZ3 B;  1WJN A;  2LWP A;  3MJ5 A;  4URK A;  1J8C A;  2V3P A;  4YTP B;  2MHJ A;  1STE A;  4GMV A;  3AM9 A;  4WJO A;  3VTU A;  1V49 A;  4BKG A;  3PZ8 A;  4XC2 A;  3EA6 A;  1PGB A;  4RCO A;  1SE2 A;  1WE7 A;  2MH7 A;  2DNF A;  1JAL A;  4AP4 C;  1B1Z A;  1OFF A;  1N5X A;  2WXI A;  2ZJD A;  3B2F A;  1UF0 A;  2FCS A;  2DAF A;  1F9J A;  1ZOY B;  3ZRC A;  4JLC A;  2M8S A;  1IP9 A;  1V1O A;  1UNS A;  4RGM A;  2W3S A;  4E3C A;  2LI5 A;  3DBL I;  2K25 A;  2KTR B;  4BKS A;  1ESF A;  3HVZ A;  4W9E A;  5HKH A;  2H89 B;  3LYY A;  1WGR A;  4HPL B;  3RI7 C;  1I4Q A;  3W1S A;  4BOS C;  4ANU A;  4GDK B;  4K7U A;  2NTT A;  2BYF A;  4P7I A;  2HTM E;  3AXC A;  1EM7 A;  3PT2 B;  2AYO B;  2IYD B;  3P2B A;  3M3J A;  3V60 A;  5DPW A;  2AEH A;  1FM0 D;  1SJE D;  5CHW A;  1BT0 A;  5HFY A;  2N0S B;  4DBG A;  5G2N A;  1FMA D;  4KDI C;  4WIP A;  2L0T A;  4PS7 A;  3N30 A;  5IO9 A;  4A8X C;  1TIF A;  1FXT B;  1HTQ A;  2E6X A;  1MPE A;  3VHT C;  2BQQ A;  3O13 A;  1GNU A;  2J52 A;  1NVI D;  3W5U B;  2GBJ A;  2KXJ A;  4HLE A;  1NBF C;  5G5H A;  4JIO U;  2KWV B;  1TZ1 A;  5D6J B;  2K22 A;  4MJS B;  3JVZ X;  5CHV C;  4W9D A;  2CU3 A;  1JWA D;  2KC2 A;  3IAM 1;  1HA5 A;  1IBX A;  3HM3 A;  2LZ6 A;  3ZQ4 A;  2MX2 A;  1WXA A;  2N9E B;  3FKY A;  3L4P A;  4CHK A;  4DWF A;  3JYU A;  3ZNI D;  3EUB 2;  5J17 A;  2N7E A;  3B2G A;  2FE8 A;  3X23 A;  2BBC A;  3B1L X;  2L32 A;  4MEM A;  3Q3F A;  3PVL A;  2BKF A;  2N1V A;  2IBI B;  1XCT L;  3CIR B;  1DYQ A;  4LDT D;  2FNJ B;  1J0G A;  1ET6 A;  2KLC A;  4RNA A;  1XF5 L;  1SBB B;  4ZRI A;  1BML C;  4C80 A;  2J0M A;  1QOB A;  3UI3 A;  3AED B;  4K7W A;  3WAM A;  3MC0 B;  4ZYN A;  3NVY A;  1LGR A;  2JWU A;  3VRA B;  3AMZ A;  2NBU A;  3FIL B;  1NEK B;  1R7S A;  2EKE C;  1FD6 A;  1E10 A;  3QC8 B;  3QX1 A;  3TEX A;  1FRR A;  4YT0 B;  2ZW0 A;  2KWC A;  3T9L A;  3U8Z A;  3PS6 A;  1ENF A;  5DPR A;  1FO4 A;  3DBH I;  1Q5W B;  3DVG X;  3CF6 E;  1V5T A;  1UGM A;  1WRD B;  1OQR A;  4KIK A;  2M17 A;  3HK0 A;  3PPA A;  4IW0 A;  1Y56 A;  3ZDM C;  2Z8L A;  3GE3 C;  1D4B A;  3AEG B;  2BS2 B;  3KYC D;  3ZGZ A;  4G3X B;  2D3A A;  2C7H A;  4NJ6 A;  3JSV B;  4K3B A;  3SR6 A;  3RMK C;  1P7E A;  2ZPN A;  1KLG D;  4ACF A;  1IBX B;  1KOT A;  4C7Z A;  2MLB A;  1E90 A;  2WU5 B;  2L83 A;  4MM3 A;  1YN5 A;  3VR8 B;  2DX5 B;  2IY0 B;  3VUW A;  3BII D;  3ENE A;  4NZL B;  1DOY A;  3PTF C;  4TMA B;  2N7J A;  2BPS A;  1MI0 A;  4G11 A;  2LRW A;  4R3D A;  2RPQ A;  2OJR A;  3DBL B;  3B0A A;  4KZC A;  1FNV A;  2W55 A;  3WAO A;  2GMI C;  2BYT A;  4BVU C;  3SD5 A;  4K3C A;  1T0Q C;  3P4Q B;  3V3X A;  1XQQ A;  2KOX A;  4FAD A;  1A70 A;  2FUH B;  3BZD B;  1GB1 A;  3KQ4 A;  4WQO B;  1SE3 A;  3DHG C;  4WWO A;  3HUI A;  2O2V A;  2MBO A;  4WAA A;  5HI1 A;  2KVZ A;  2JUO A;  2KX0 A;  2AWT A;  4ZRQ A;  3VXW A;  3BVM A;  4RGN A;  1V86 A;  2FUG 1;  2J4X A;  2K0P A;  1C4P A;  5BYR A;  1JML A;  3MFG A;  2KAC A;  1H4R A;  2GBR A;  3PV1 A;  1V97 A;  2KMA A;  1MHX A;  5MPO A;  2MEK A;  3UIN B;  2I38 A;  1I4R A;  3GOE A;  2JT4 B;  1YOV B;  2ONQ A;  4MT5 A;  4IKG A;  1RRB A;  4G0N B;  2BS4 B;  4P1B C;  2IND C;  5AZH A;  3DQV A;  2ZVO A;  1K51 A;  3QWZ B;  3P4S B;  4TQ1 A;  2C5L C;  3PRZ A;  2BKR B;  2KJR A;  1WMH B;  3PRM B;  2WXG A;  4MEL A;  2DYM A;  4NAW B;  1WR6 E;  2GB1 A;  2BGF A;  3RN9 C;  2KFK B;  3A1Q A;  2KJH B;  4RM8 A;  1WJ6 A;  3ETR A;  1ROE A;  2KLG A;  4TUU A;  1NYR A;  1TY2 A;  1MHH E;  4YTM B;  4IUM B;  1T0R C;  1L6U A;  4LK0 M;  2LHE A;  3ZW3 A;  3EC8 A;  4XDD A;  3VTV A;  4BZA A;  3KUC B;  4TKN A;  5H8Y E;  2ZNV B;  4LNI A;  2NMQ A;  3RYT A;  3R2I A;  3W5V B;  3NZU A;  4CO7 A;  5HHD G;  1IUE A;  5LLI A;  4FHJ A;  1R4N B;  4HCN B;  2VH2 A;  5TR5 A;  3ZYY X;  4BFR A;  2YLM A;  3N32 A;  2KYW A;  2CU1 A;  3V6E B;  4A20 A;  1AW7 A;  1C77 A;  1I4G A;  4KSK C;  4MSQ B;  2LRU A;  1GB4 A;  2PJH A;  2IDY A;  3NS8 A;  4MGZ E;  4GU2 A;  2HJ8 A;  3A1Q B;  2L00 B;  5C3J B;  1D5X C;  2KDI A;  3E56 A;  3AI5 A;  4PK1 A;  3IT6 B;  3AEA B;  3AEB B;  1E7U A;  4IWP A;  1I4H A;  5E6J A;  1ZE3 D;  3X0W A;  3ZVV A;  1QT9 A;  1BUI C;  2M19 A;  3PSE B;  3WAL A;  2BWE S;  3QQ8 B;  2MCN B;  4JL9 A;  2KTR A;  3Q8A A;  3RNC C;  2JY6 A;  1P3Q U;  4EZL A;  2GI9 A;  5GXG B;  3RD2 A;  2C60 A;  4PT5 A;  3SHQ A;  1K50 A;  1L2N A;  1RYJ A;  2J0K A;  1K52 A;  2JSV X;  2KD0 A;  1MG8 A;  3VVW B;  4US9 A;  2LXA A;  3RT3 B;  4LNF A;  1R4M I;  2QIL A;  3W1S C;  3A9J A;  1QQR A;  1V80 A;  3FC4 A;  5BO4 B;  4B0E A;  1WYW B;  4S17 A;  3TJP A;  1EWY C;  1XLP A;  4RMA A;  2JZP A;  4M0W A;  5DPS A;  4GB9 A;  4WJN A;  4A6Q A;  4NAM A;  2BWF A;  4XYC A;  5IKC M;  1ZPS A;  2JX5 A;  3ML9 A;  3QK0 A;  1HQR D;  2JXX A;  4XDC A;  1FIQ A;  1XEE A;  1J7B A;  1WXV A;  1VR9 A;  3DCG A;  1JW9 D;  1OQY A;  1WGG A;  3PRE A;  3N9Y C;  2AQ1 B;  4HK2 A;  3S2A A;  2LUM A;  3VUX A;  3AUL A;  5HG2 A;  1R4N I;  2BYV E;  2D3C A;  1V1P B;  4MH0 E;  2O2V B;  4HKZ E;  5DPT A;  3L0W B;  3NRZ A;  4HRS A;  4I6N B;  4GDL A;  3DBR I;  4EUT A;  1WXQ A;  1J7C A;  4YSY B;  4RM9 A;  3AEC B;  1WGY A;  2KQS A;  3IAS 1;  2DYB A;  1QOF A;  2EMS A;  2JRH A;  2IPK D;  3DHI C;  1ACC A;  2BVC A;  1WR1 A;  3NVV A;  4WWP A;  2WXJ A;  2MP2 A;  4YSX B;  3ECI A;  3KUD B;  2L8J A;  4L2Y A;  1V6E A;  4CQN A;  2KQ4 X;  4BAX A;  1QOA A;  5I4D A;  4J6I A;  2MW5 A;  1AWD A;  3ZIM A;  1F2R I;  1HEZ E;  1WM3 A;  2BTE A;  1TJE A;  3M95 A;  3HRD D;  2Y3A A;  4OW0 A;  1ZP0 B;  2DZK A;  2LVO A;  3UF8 A;  4BBN F;  1YX6 B;  4G50 A;  2RSU A;  3NG0 A;  1PYW D;  1C79 A;  2X8X X;  2B76 B;  1Z5S B;  2LVP A;  2JXT A;  4TV3 A;  3K9O B;  2K6D B;  1E8X A;  4B0M A;  1KRH A;  4GOC A;  1OEY J;  1WH3 A;  3IT4 B;  1R4M B;  2JVC A;  4J3O D;  3V62 A;  5D7G A;  3Q69 A;  1GC6 A;  3W9C B;  2M0A A;  2IJ0 A;  3B08 A;  3KH0 A;  1JRP A;  4FJV B;  3SEB A;  2KDM A;  4TQ0 A;  4PS8 A;  2I1J A;  4GN1 A;  4FLH A;  4HJG E;  2ASQ A;  1T6B X;  2BF8 B;  3EEC A;  2AL3 A;  5TSS A;  3BIN A;  3MC8 A;  4USA A;  4FBJ B;  1RAX A;  3AEE B;  1E8W A;  2RD0 A;  3RUL A;  3IG3 A;  1XXG A;  2IY1 B;  4FUL A;  4WWM A;  2WXO A;  4DHZ B;  3Q8E A;  3I9V 1;  1XCQ L;  4LCD E;  2L7R A;  3IVF A;  1VRA B;  4ITK A;  2QC8 A;  2NCN A;  1TGZ B;  1JRO A;  1ZUD 2;  4MSM B;  1SB3 C;  1C9F A;  3V6C B;  3WCQ A;  1KM7 A;  1UD7 A;  1RWS A;  3CMM B;  4W9H A;  4C4V A;  1T5X D;  4N9F 4;  4RGO S;  2QJL A;  4EE2 A;  3UIO B;  2DAJ A;  4W9G A;  4A55 A;  5BYS A;  3PO0 A;  1DOX A;  4MGY E;  1WGD A;  3C0R B;  4KSL C;  2FCN A;  5EE9 A;  2BS3 B;  4DXA B;  3H7P B;  2IO1 B;  4AJW A;  1YQ3 B;  3PRP B;  1S3S G;  1WFY A;  1YJ1 A;  1ET9 A;  2WWZ A;  5T8I A;  2MBQ A;  2LUE A;  3SDL C;  1DOI A;  4KV2 A;  1FNU A;  1EU4 A;  2INP E;  2O6V A;  2MJ3 A;  1PQS A;  2V4I B;  4NJ7 A;  1XLQ A;  2LEK A;  3NOB A;  4JGH B;  2I1K A;  3ZRF A;  2D07 B;  2AQ3 B;  3QJZ A;  4H2A A;  1CZP A;  3DBR B;  2CHX A;  4ICU A;  4QAY A;  1V1P A;  3IXS A;  3Q6B A;  2K3U A;  1IGD A;  1VJK A;  2ZW1 A;  2IO3 B;  2WP9 B;  2FCQ A;  4EOY A;  1MG4 A;  2N7D A;  2E3T A;  4FXC A;  3DOW A;  3QCA A;  2ZPY A;  2BT6 A;  2IGH A;  1L6V A;  1L4D B;  3C19 A;  3AN1 A;  2KAN A;  2NTS A;  2WXQ A;  4OVV A;  4F8C B;  2KWD A;  1E0Z A;  2PVO D;  2HDE A;  2WDQ B;  4OZC A;  4LJP B;  5D3D A;  2BB6 A;  1NYQ A;  1V9J A;  2L76 A;  1P7F A;  3R7R A;  3PLU A;  2H88 B;  2MJE A;  2V1Y A;  4I6L B;  3TCA A;  5IA7 A;  5EE3 A;  2VH1 A;  2Y5B B;  3H7S A;  2CHW A;  3HIZ A;  1EUV B;  3CWI A;  2LGI A;  5E6P A;  2D3B A;  2KDF B;  3BY4 B;  4XX5 A;  2CR5 A;  3ZTD A;  3AE5 B;  3ZJT A;  4AOF A;  1F2R C;  3P1M A;  3AU5 A;  1RFA A;  4GDK A;  3OWE B;  2GBN A;  3PZD A;  3R2T A;  2JU6 X;  1ZW7 A;  2JWZ A;  2VRR B;  1UH6 A;  4YWG G;  2PMV A;  2HJ1 A;  3L54 A;  4WUR A;  4ANW A;  1PDX A;  2KX3 A;  4YSZ B;  2KAJ A;  3U4E G;  2KHW B;  1NI3 A;  3E9S A;  3N20 C;  4GSW A;  3T3O A;  5JH5 C;  2KDB A;  4WH4 A;  4DDI D;  3L10 B;  1L0X B;  1TTN A;  3A4R A;  4LNN A;  2M56 B;  1YJJ A;  5D3I B;  3SFD B;  2Y5C A;  4NQK E;  2WDT B;  1L4Z B;  2CS4 A;  5AUI A;  4ZHP A;  1YIW A;  3Q3J A;  2FID A;  3CST A;  4NAW A;  5FK9 C;  2GRI A;  3ZNG C;  4HJK A;  2WXP A;  4HDO A;  3NZS A;  5EDS A;  1V5O A;  1TKG A;  3K9P B;  3AH7 A;  3GS2 A;  2KVR A;  3KVF B;  1ZDX A;  1ZXH A;  2LMC A;  2K6Q A;  1X1M A;  3NHE B;  4JWS C;  5D94 A;  4KGR A;  4HEA 1;  4WWN A;  2PVG C;  3NS1 A;  2ZZP B;  2A4Z A;  2WGS A;  2CJO A;  3VTW A;  1RM6 C;  2MBB B;  5IN7 A;  4BBN C;  2PPH A;  4MGI E;  4W9F A;  2MA9 B;  3H1U A;  1C4A A;  1C3T A;  4KGS A;  3N1Z C;  2PE9 A;  2FCM A;  3QAQ A;  4P16 A;  2CHZ A;  2WLB A;  4F7Z A;  5EE1 A;  1QKZ A;  2GBM A;  3H9D A;  2NR2 A;  2G3Q B;  1J19 A;  3Q3N C;  4LNK A;  2KMM A;  4UDU C;  1HE8 A;  2QCZ A;  2Z59 B;  1GPX A;  2KZR A;  5JHA A;  3R8B A;  1C78 A;  1ZGU B;  1VCB A;  2XNA C;  2GLS A;  1VZ7 A;  3AE9 B;  4OZB A;  3WAN A;  2DEN B;  1FXI A;  4PS3 A;  2IZV B;  4YTN B;  4DHZ E;  2KFJ A;  5LXH A;  3DWM A;  4DXF A;  1XD3 B;  3BVZ A;  2QDF A;  1E8Y A;  1QZE A;  2XBB C;  3H8H A;  1YN3 A;  1NI2 A;  2KN5 A;  3OLM D;  3TEY A;  3ZDT A;  2KJ6 A;  2RPV A;  4AUQ C;  1NDD A;  5FR3 A;  3BK2 A;  4KGT A;  2Z0E B;  3N3K B;  4ASW C;  2O6V D;  2WXN A;  3AE2 B;  5JZE B;  1SSN A;  3DVN V;  1ZXI A;  4AJY B;  2GBK A;  2ZEQ A;  1FCL A;  1YQB A;  3KUZ A;  1JQ4 A;  4RGT A;  2IGG A;  3A4S C;  3GE8 C;  4FA6 A;  1TY0 A;  5C1Z A;  2QMT A;  1C76 A;  3ZLZ A;  5J2R A;  3ZJU A;  2QHO A;  3ONS A;  5G5G A;  4W9C A;  2GOW A;  3DDC B;  4W9J A;  1S1Q B;  2INC C;  2FIF A;  5KHO A;  4M00 A;  3AE6 B;  1P1A A;  1I4X A;  1KLV A;  3RNB C;  4GIV A;  2V0G A;  1A5R A;  4NY0 A;  4EEW A;  1VZ8 A;  1JRU A;  1RLF A;  4C7Y A;  2LJI A;  4KVG B;  4B6W A;  2RDB C;  3MJW A;  2DHZ A;  1F0Z A;  3I57 A;  2PKO A;  4GDL B;  2V9H A;  1E7V A;  1XO3 A;  2WU2 B;  2YEP B;  3EFC A;  4M8M A;  4ZRP A;  2O6V B;  1WZ3 A;  2LVQ A;  1SIF A; 
#chains in the Genus database with same CATH homology
 3SEB A;  2KDM A;  1SE4 A;  3RPF C;  4TQ0 A;  3MC0 B;  3NVY A;  2JWU A;  2Y5P A;  2D5G A;  3VRA B;  3AMZ A;  4HJG E;  3FIL B;  1NEK B;  1R7S A;  4JWU C;  1FD6 A;  1DGJ A;  1HZ6 A;  3AE8 B;  1T6B X;  3GB1 A;  3NUH B;  1E10 A;  3TEX A;  5TSS A;  1FRR A;  4USA A;  4YT0 B;  1QF6 A;  1N61 A;  2ZW0 A;  3AEE B;  4JPS A;  3ZJV A;  1HZ5 A;  1ENF A;  3FAH A;  1FO4 A;  1XXG A;  2L1A A;  2W3R A;  1WGK A;  4A90 A;  4WWM A;  2WXO A;  3B9J A;  1WYG A;  1OQR A;  3Q8E A;  2X38 A;  3I9V 1;  1CJE A;  1XCQ L;  3AE1 B;  3Q8C A;  1PGX A;  3DWG C;  1VRA B;  1Y56 A;  2PTL A;  2Z8L A;  4ITK A;  3SFE B;  1ZUD 2;  1JRO A;  1D4B A;  1SB3 C;  3AEG B;  1C9F A;  2BS2 B;  4XWT A;  3U52 E;  3WCQ A;  3ZGZ A;  4US8 A;  3BYT B;  3SR6 A;  1P7E A;  1KLG D;  1RWS A;  3BYY B;  1IBX B;  1T5X D;  4C7Z A;  3P42 A;  2FBW B;  4RGO S;  2WU5 B;  2QJL A;  3W2D A;  3LB8 C;  4EE2 A;  2L83 A;  1YN5 A;  3VR8 B;  3NVZ A;  1JWS D;  1L5P A;  4A55 A;  5BYS A;  1JWM D;  3VRB B;  3PO0 A;  2LHD A;  5BYQ A;  1DOX A;  4IDI A;  3BII D;  4O1N A;  1SJH D;  2WXH A;  4NZL B;  1DOY A;  5EE9 A;  4TMA B;  2BS3 B;  4LLG M;  1EU3 A;  4A9A A;  2N7J A;  1C4C A;  1SEB D;  1MI0 A;  2K9X A;  1KF6 B;  4D2K A;  4R3D A;  1YQ3 B;  2BW2 A;  4RF0 A;  1ET9 A;  1TS4 A;  3Q8B A;  3TEZ A;  2DLB A;  1AN8 A;  2DYO A;  3HVD A;  5T8I A;  1FNV A;  1FFV A;  3P4R B;  3KWL A;  2N9K A;  4N6E B;  2W55 A;  1DOI A;  2QSD A;  3NZ3 A;  2BYT A;  1FNU A;  1N62 A;  4ZYS A;  3P4Q B;  1EU4 A;  2WXR A;  2IGD A;  2XN9 C;  2L52 A;  3V3X A;  1TS2 A;  2INP E;  3AE3 B;  3BVG A;  4N59 A;  2MJ3 A;  1FNW A;  2V4I B;  3AE4 B;  1A70 A;  1XLQ A;  2LEK A;  3BZD B;  1GB1 A;  3KQ4 A;  2WNM A;  2AQ3 B;  2JYT A;  4H2A A;  2J42 A;  2RDH A;  4OVZ A;  2JQR B;  3AV8 A;  1SE3 A;  1CZP A;  4DQO C;  3HUI A;  1V1P A;  3IXS A;  5HI1 A;  5C2T B;  2K3U A;  1IGD A;  1VJK A;  1N5W A;  2WP9 B;  2ZW1 A;  3RFZ B;  4ZRQ A;  2PLP A;  2E3T A;  1UWX A;  4FXC A;  1GOZ A;  3BVM A;  1RFK A;  4RGN A;  3TSS A;  1GAQ B;  1XLO A;  2FUG 1;  2J4X A;  2K0P A;  4L23 A;  1FRD A;  4NJC A;  1C4P A;  1N63 A;  1JML A;  3MFG A;  5BYR A;  4C56 C;  1WSP A;  2BT6 A;  2IGH A;  1L6V A;  2INN E;  2KAC A;  3U7Z A;  1L4D B;  3AN1 A;  1FFU A;  1V97 A;  2NTS A;  2WXQ A;  3PZ7 A;  1MHX A;  1XLN A;  2KWD A;  2MEK A;  3EGR A;  5MPO A;  2BB5 A;  1E0Z A;  2PVO D;  2I38 A;  2ON8 A;  1I4R A;  2ICI A;  5BMG A;  2HDE A;  2WDQ B;  4OZC A;  4HKQ A;  2DWQ A;  2KN4 A;  2ONQ A;  5D3D A;  4MT5 A;  1UUP A;  2BB6 A;  2WXF A;  1D5Z C;  1NYQ A;  4IKG A;  1P7F A;  1UWM A;  2BS4 B;  1SXT A;  4WQM A;  2H88 B;  1K51 A;  2MJE A;  3Q8F A;  3P4S B;  4P6V F;  4TQ1 A;  2V3N A;  5EE3 A;  2WXG A;  3KLS X;  4LTU A;  1FEH A;  2DYM A;  4NAW B;  3CWI A;  4REZ A;  1YNT E;  2LGI A;  5AUK A;  2GB1 A;  3URY A;  1D5M C;  5BMH A;  1SF0 A;  5EE0 A;  1WRI A;  2W82 A;  4RH6 A;  1TKY A;  1E7P B;  3J9C A;  2LFI A;  1PGA A;  3AE5 B;  3ETR A;  3ZJT A;  4MM3 B;  1ROE A;  1F2R C;  1NYR A;  2WDR B;  3P1M A;  1TY2 A;  1LO5 D;  1MHH E;  4YTM B;  2QIE B;  3OWE B;  2WXL A;  2PW9 A;  3KWV A;  3R2T A;  1L6U A;  2JU6 X;  4LK0 M;  2LHE A;  2MJD A;  3TEW A;  4XDD A;  3U2S C;  4YWG G;  5H8Y E;  1NEN B;  2PMV A;  1TYG B;  4HRO A;  4ZOH C;  3C8Y A;  4WUR A;  2WXM A;  1VZ6 A;  2NMQ A;  1JCK B;  1JWB D;  3VR9 B;  3R2I A;  3VQI A;  1PDX A;  1MVK A;  2WQY B;  3NVW A;  3W5V B;  4YSZ B;  5HHD G;  1IUE A;  2I2Y A;  1L0Y B;  2KAJ A;  2JYE A;  1FXA A;  3U4E G;  1B9R A;  1NI3 A;  3E9S A;  1TZO A;  3T3O A;  2ACZ B;  2J53 A;  2N9L A;  4WH4 A;  1L0X B;  3ZYY X;  4TSS A;  2QEJ C;  1PFD A;  1EWC A;  2CJN A;  2M56 B;  1YJJ A;  5D3I B;  3SFD B;  1AW7 A;  2SAK A;  1C77 A;  1I4G A;  2Y5C A;  1BXT A;  4KX6 B;  1L4Z B;  4ARI A;  5AUI A;  4ZHP A;  1GB4 A;  2AQ2 B;  1AYF A;  2IDY A;  1VDV A;  5FK9 C;  2GRI A;  3BK1 A;  2AX5 A;  2WXP A;  1I4P A;  4XWW A;  1QLB B;  1PUT A;  3V05 A;  2G1E A;  1YJI A;  1KFY B;  4N58 A;  5C3J B;  2OHF A;  2WDV B;  1D5X C;  3E56 A;  2DBY A;  1TKG A;  3AH7 A;  3IT6 B;  3AEA B;  3GS2 A;  1ZDX A;  3AEB B;  1ZXH A;  2W54 A;  1I4H A;  4KKJ A;  1M4V A;  5E6J A;  2LMC A;  2OED A;  4JWS C;  1ZE3 D;  4KGR A;  4HEA 1;  4L1B A;  1CQV A;  1QT9 A;  1BUI C;  2PVG C;  2M19 A;  3AB5 A;  3AEF B;  3NS1 A;  2TSS A;  1TS5 A;  1J7A A;  2Q5W D;  1KLU D;  2CJO A;  1RM6 C;  3FIL A;  2SEB D;  1E6E B;  3Q8A A;  1TKE A;  4JX1 C;  2GI9 A;  4ZHO A;  5GXG B;  1YN4 A;  1C4A A;  2WS3 B;  1F77 A;  4KGS A;  1E9M A;  1D6E C;  3ABV B;  4PT5 A;  4P16 A;  1K50 A;  3MJ5 A;  2EKI A;  2WLB A;  1RYJ A;  5EE1 A;  2V3P A;  1QKZ A;  2WXK A;  1K52 A;  4YTP B;  2JSV X;  1STE A;  3AM9 A;  5BMI A;  4OZA A;  4US9 A;  1WWT A;  2KMM A;  4UDU C;  1T3Q A;  3PZ8 A;  2QIL A;  4JE3 B;  1GPX A;  3EA6 A;  1PGB A;  4RCO A;  1QQR A;  4ARC A;  3R8B A;  3FC4 A;  1SE2 A;  4B0E A;  1JRP A;  1HXY D;  2MH7 A;  1JAL A;  1C78 A;  1B1Z A;  1OFF A;  1N5X A;  5H92 C;  5LNK 1;  2WXI A;  3B2F A;  1EWY C;  1XLP A;  2YEP F;  4IOI E;  2JZP A;  4M0W A;  1QOG A;  1V8C A;  1ZOY B;  2XNA C;  4A6Q A;  1V1O A;  3T3N A;  1VZ7 A;  3AE9 B;  4NAM A;  4OZB A;  4AS1 A;  1UNS A;  4RGM A;  1ZDV A;  2W3S A;  1FXI A;  3BWU D;  4WAF A;  1ZPS A;  2JX5 A;  1K53 A;  1HQR D;  4YTN B;  4XDC A;  1ESF A;  1VLB A;  3HVZ A;  1KTK A;  1XEE A;  1FIQ A;  1UGJ A;  2H89 B;  3LYY A;  1SIJ A;  3DWM A;  4DXF A;  1J7B A;  1VR9 A;  1JW9 D;  1I4Q A;  4RF1 A;  3BVZ A;  1YQ4 B;  4GLS C;  3N9Y C;  2AQ1 B;  3W1S A;  4GDK B;  2LUM A;  3GP7 A;  2NTT A;  3TUO A;  2HTM E;  3H8H A;  1YN3 A;  1EM7 A;  3P4P B;  4KKI A;  3TEY A;  5HG2 A;  5JXV A;  1V1P B;  2RPV A;  4HKZ E;  1FM0 D;  1SJE D;  3AE7 B;  5FR3 A;  3NRZ A;  3BK2 A;  4HRS A;  5HFY A;  2N0S B;  4KGT A;  1WXQ A;  1J7C A;  4YSY B;  1KH0 A;  3MP9 A;  2WXN A;  3AE2 B;  3AEC B;  1FMA D;  4WIP A;  3IAS 1;  2R61 A;  1SSN A;  1ZXI A;  1QOF A;  4A8X C;  1FCL A;  2IPK D;  1FCC C;  4YXD B;  2E6X A;  1JQ4 A;  1ACC A;  1MPE A;  3P63 A;  3O13 A;  1Q10 A;  2J52 A;  2RMM A;  4RGT A;  1I7H A;  1NVI D;  2IGG A;  3W5U B;  4AQ7 A;  1TS3 A;  3NVV A;  1JWU D;  1TY0 A;  2WXJ A;  5G5H A;  2VZK B;  4YSX B;  2QMT A;  1C76 A;  4Q2J A;  2K22 A;  3ZJU A;  4L2Y A;  4CQN A;  2KQ4 X;  2K5P A;  2CU3 A;  1JWA D;  1QOA A;  3IAM 1;  5I4D A;  2VZK D;  1HA5 A;  1IBX A;  1AWD A;  5G5G A;  3ZQ4 A;  1F2R I;  1HEZ E;  2BTE A;  1N60 A;  1L0V B;  1TJE A;  3L4P A;  1QIL A;  3HRD D;  2G9H D;  2RDG A;  2PIA A;  2Y3A A;  3AE6 B;  4OW0 A;  1YMH E;  1ZP0 B;  1I4X A;  3EUB 2;  3MHZ A;  4XE0 A;  2V0G A;  3B2G A;  2FE8 A;  2BBC A;  1PYW D;  1VZ8 A;  4DXG A;  1C79 A;  2L32 A;  4RFB A;  2EEL A;  2B76 B;  4C7Y A;  4MAC A;  2LJI A;  2JXT A;  1XCT L;  3CIR B;  1DYQ A;  1OQQ A;  4B0M A;  4MH8 A;  1KRH A;  1F0Z A;  1CK1 A;  3IT4 B;  1ET6 A;  3I57 A;  4J3O D;  2PKO A;  4GDL B;  5D7G A;  4RNA A;  1XF5 L;  1SBB B;  3Q69 A;  1XO3 A;  2WU2 B;  2YEP B;  3LXF A;  1BML C;  4C80 A;  5FKA C;  3W9C B;  1QOB A;  4ZRP A;  3UI3 A;  2M0A A;  3AED B;  2IJ0 A;  1IGC A;  4OHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...