5H8YE

Crystal structure of the complex between maize sulfite reductase and ferredoxin in the form-2 crystal
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Sulfite reductase [ferredoxin], chloroplastic
publication title Structural and mutational studies of an electron transfer complex of maize sulfite reductase and ferredoxin.
pubmed doi rcsb
source organism Zea mays
total genus 22
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5h8yE00
1IUEA 1PUTA 2KMMA 1SIJA 3AH7A 3HUIA 4HROA 2MJ3A 1FRDA 5H92C 3AMZA 3B2GA 2W3RA 1KFYB 2BT6A 4YTPB 3VR8B 4KX6B 3AE5B 1J7CA 2DWQA 1JWBD 2PVGC 2LEKA 2E3TA 5AUKA 3SFDB 1N5XA 1QOGA 3AE6B 1NI3A 1J7BA 1B9RA 4YXDB 1PFDA 2EKIA 2WDVB 1N61A 1E0ZA 4WWMA 1VDVA 3PO0A 3P4QB 1SB3C 5G5GA 1SF0A 4A9AA 1XLNA 3SR6A 4LTUA 1L6UA 2JX5A 1EWYC 3NS1A 1TYGB 2PIAA 4N59A 2CU3A 1E7PB 2WU5B 4YT0B 3P63A 2BS3B 1E6EB 2WDQB 4YTNB 4JWUC 4US8A 3KWLA 1KRHA 2M56B 2W54A 4C7YA 1FFVA 3LXFA 1QF6A 1NENB 1FMAD 1T3QA 2W3SA 1TKEA 3AEAB 1CZPA 1XO3A 1J7AA 2K5PA 2M19A 1VLBA 1L0VB 3AE7B 4FXCA 1FO4A 4JWSC 3SFEB 1RFKA 3AE1B 5EE9A 4P6VF 1V8CA 2BS4B 3AE9B 2K9XA 3B2FA 2L83A 3AEEB 3P1MA 1RM6C 1XLOA 1QT9A 2MJEA 1DGJA 1N62A 2ACZB 2OHFA 1NEKB 2WP9B 3EUB2 3HVZA 4C7ZA 1DOXA 1FXAA 1QOFA 1NYRA 1WXQA 1OQRA 2WQYB 5EE3A 3RPFC 5C3JB 1E10A 3DWMA 2Y5CA 1CJEA 5EE0A 1ROEA 5C2TB 1I7HA 4US9A 3WCQA 3W5UB 3VRBB 4YTMB 3P4SB 1AYFA 1FXIA 2AX5A 1TKYA 1DOIA 4USAA 3AEDB 1N5WA 3HRDD 3LB8C 4ZHPA 3BIID 1FRRA 1L6VA 1A70A 1JROA 2K22A 1ZXIA 3FC4A 2H89B 1RYJA 1GAQB 5GXGB 2KAJA 2HTME 3VR9B 1NYQA 1PDXA 1UWMA 3NVZA 2B76B 1FFUA 1RWSA 3AN1A 1DOYA 1E9MA 1OQQA 2PVOD 2H88B 2L52A 3AE4B 4ITKA 1OFFA 1F0ZA 1YJJA 3AE8B 1FIQA 1FM0D 4YSZB 1TJEA 5G5HA 1JW9D 4IDIA 1WGKA 4YSYB 5AUIA 2QJLA 3W5VB 1AWDA 3AM9A 1L5PA 3W9CB 1YQ4B 3CWIA 3AV8A 1KF6B 3P4RB 1JWAD 2N0SB 2G1EA 3NRZA 4ZOHC 1N63A 2QIEB 3AEGB 1VJKA 2WS3B 4JX1C 2W55A 1QOBA 1ZP0B 3AE2B 2MJDA 3AE3B 1JQ4A 2WDRB 1XLPA 1YJIA 3L4PA 1WWTA 1QOAA 1V97A 2JQRB 5EE1A 1QLBB 3NVYA 3NVVA 2DBYA 4C80A 3AEFB 5H8YE 2BS2B 4WQMA 3ABVB 4HRSA 4N6EB 3ZYYX 3B9JA 3DWGC 3FAHA 3P4PB 1JRPA 3NVWA 1GPXA 2Q5WD 2WU2B 1R7SA 2CJNA 4ZHOA 2PKOA 1WRIA 1YQ3B 2MH7A 1NVID 1ZUD2 4YSXB 1WYGA 2CJOA 3CIRB 5MPOA 1JALA 3VRAB 1N60A 1XLQA 2WLBA 3ETRA 4N58A 1TKGA 3AEBB 2FBWB 3AB5A 3AECB 1ZOYB
chains in the Genus database with same CATH superfamily
4M02A 1SIJA 2NBWB 3ZGZA 1KFYB 4MGKE 4TQ0A 5DPSA 3C19A 3SFDB 4LDTB 3J9CA 4DDGD 3BVGA 3GE3C 4HWIB 2C9WB 2WYQA 4K7WA 4C4VB 4WWMA 5GMVA 4A9AA 4IOIE 3RYTA 3TUOA 1YIWA 2N7DA 1JWUD 5IO9A 2NPTA 2QSDA 4OW0A 2JYEA 1WE7A 5DCNA 1I35A 1SXTA 3ZXVA 2V3PA 3EECA 2MJEA 4K3BA 3NZSA 1CJEA 2C7NB 2CU1A 3V60A 4HVBA 2JY6A 4RM8A 1EF5A 2WXRA 3LJ3A 3MJWA 2HD5B 2M8SA 1ZDVA 1FFUA 4EFOA 2L8JA 4EZLA 3RULA 1E9MA 4ZDVA 2Z59B 1K52A 4HKQA 2X8XX 4WH4A 5G5HA 3Q69A 4DHJB 4PYZA 1AWDA 1B1ZA 1E7VA 3MFGA 4TQ1A 3ZKJC 1YQ4B 1TZ1A 3NRZA 4HPPA 3KYCD 2RSUA 3QX1A 4LNFA 1VJKA 1SE9A 1LM8B 2DYMA 5CTRC 4RM9A 1ZP0B 3M62B 2RMMA 5D3IB 1YJIA 3FKYA 5AEKB 2IBIB 3RMKC 3DBRB 1OEYA 3HK0A 1QILA 3UGBB 3GE8C 3KWVA 5E6PA 3BK1A 1N60A 2KC1A 3VH4B 1RFAA 3P4SB 1L2NA 2KQ7A 3S2AA 3VUYA 1FRDA 2DLBA 4G50A 4KX6B 1WYWB 2DWQA 3PRPB 3URYA 1E7UA 3KUDB 1WI0A 4ANWA 3AU4A 1HE8A 3GP7A 3A9JB 1TZOA 2WGSA 4LTUA 2BTEA 3A9KA 1KRHA 2MLBA 1J7AA 3UI3A 4JWSC 3DBHI 5EE9A 2L83A 3AEEB 2INNE 1R4NB 2LXCA 2CS4A 2D10A 3ZQ4A 1FXAA 3BY4B 1J0GA 2YEPB 3R8BA 3TIXA 5IA7A 1P9DU 3FILA 1YQBA 2MX2A 1YNTE 1FRRA 3R66C 1A70A 2WXLA 1HEZE 4N9F4 2N9LA 1KLVA 4GGQA 3DDCB 4IDIA 1E8XA 3VH3B 2BWFA 3I9V1 3CWIA 4LNOA 4ZOHC 2W82A 4W9KA 4G0NB 2D11A 3IVFA 4KGRA 5FK9C 1C1YB 1V5OA 3L08A 3IAM1 1WR6E 3ENEA 2LASA 2PTLA 4C56C 3BVMA 1PUTA 2KACA 2FE8A 4MH8A 4LJPB 4MSMB 3RNAC 2ASQA 3JW0X 3L10B 2C7MB 4RGMA 1C77A 3DHIC 1KTKA 3W1SA 3RCZA 2DAFA 3UIOB 2EMSA 3NS1A 4EZKA 1E7PB 3ECIA 2WDQB 3V3XA 3ZNHB 4NJCA 3LXFA 4NJ7A 1UUPA 4XWTA 4BFRA 3AEAB 4KZ0A 2YLMA 2KDMA 3BYYB 2M19A 1FO4A 3SFEB 3AE1B 4BKGA 5BYRA 4DHZB 3P1MA 3EA6A 1XLOA 1WM2A 2L00B 1FCLA 1QOFA 2WQYB 2WWZA 2Y5CA 1V6EA 5J18A 4ZHPA 2NR2A 1BXTA 2EKEC 2VZKB 4TMAB 1ZXIA 2ZCCA 2LMCA 5GXGB 1HZ6A 1K51A 3TEYA 2FCMA 4MGIE 4W9CA 2PVOD 3T3OA 2KZRA 5FR3A 1V1OA 3MTNB 2JWUA 1QKZA 1VRAB 2QJLA 2KJ6A 2L0TA 1N63A 4JX1C 3AXCA 4ZRIA 3DVGX 3ZRFA 1EU4A 3QJZA 2KN5A 4AUQC 4F1SA 2KMCA 4N6EB 3PPAA 3QA8A 1WRIA 1YQ3B 1UD7A 2KYWA 1WX8A 2WXHA 2KQSA 2DHZA 4BBNC 3AMZA 3VR8B 5KHOA 4NPNA 2IY1B 4W9GA 3T3NA 1T5XD 2BVCA 3O65B 4I6PA 1V1PB 4D2KA 1HQRD 4US8A 2W54A 2D5GA 2IO0B 4MELA 1YX5B 2MHJA 1I4GA 4P16A 2BB6A 4MM3B 1LFDA 1V86A 3VAWA 2LXAA 3GZNB 3DHHC 4K7SA 4ACFA 1Q0WB 1DOXA 3I57A 2JZ3B 1A5RA 4DHZE 2KMAA 4B9KA 3KW5B 3N9YC 1ROEA 2QDFA 2KVZA 1IBXB 3UQAA 3H7PB 3U7ZA 2KJRA 1RYJA 2J42A 4LNNA 2L76A 2V4IB 5CHWA 3DBHB 4MT5A 4BOSC 4YSZB 5IKCM 2OOBB 1JMLA 1L5PA 4RF0A 2N0SB 4GDKA 2WXPA 2LGXA 3SU8X 4DXAB 2KFKA 1F2RI 4E71A 5EE1A 2MBHA 2M1MA 4A8XC 3SDLC 4IW0A 1UNSA 2MH7A 5DPWA 5IP4D 2WXOA 1ESFA 3L54A 4NAMA 1WGHA 4HROA 4B0EA 2DZJA 1OQYA 2KNBA 2IGGA 1NDDA 1J8CA 3BZDB 1YN5A 1WJ4A 1STEA 3AE6B 1NI3A 1WRDB 3AULA 3P42A 2K8CA 3UINB 1VDVA 2J7QB 1SB3C 3N20C 1EWYC 5C23A 4N59A 1YJ1A 3Q3JA 2AQ2B 2LGIA 2WNMA 2IY0B 3K9PB 4PYUA 1KOTA 1MG8A 2Y5BB 3AE7B 4TUUA 1TTNA 3ZO5B 2K3UA 3Q3MC 3VUXA 2ONQA 4MSQB 2L7RA 4OHJA 3M95A 4HDQA 1M94A 1E8YA 3VTVA 1Z5SB 4A3PA 2HJ1A 4KKIA 1TS3A 2R2QA 1C79A 2N9KA 3HVDA 2KN4A 3WA0A 2GOWA 3LYYA 4FADA 2GBRA 3L16A 3JSVB 2H88B 2HE7A 4IM0A 4B0MA 5L83A 3DBLI 1V81A 4KKJA 4REZA 3DVNU 4TKNA 4XDDA 1SJED 3B08A 3MC9A 2MSED 1V97A 1WH3A 1JCKB 2JWZA 3U2SC 3NVYA 1PGBA 2QEJC 3C0RB 3N3KB 3PSEB 2WX0A 4ZHOA 2KXJA 3M3JA 3EC8A 3DHGC 4W9LA 4X57B 4C00A 3RI7C 3HUIA 2R2OA 4EEWA 1C76A 4WJNA 5J17A 1R4MI 3ZTDA 2PVGC 4AP4C 2E3TA 4ZYSA 2FIDA 1N61A 2K0PA 3E56A 1LGRA 4WQOB 4E74A 1SE4A 1E6EB 2M4NA 3Q14C 2M56B 1FFVA 1Y56A 1FNVA 3N1XC 3ZUNA 1GUAB 3NZUA 1FPYA 5G2NA 1SE3A 1YMHE 2RPVA 4FHKA 5TR5A 5D7GA 3DCGA 2ACZB 4XDCA 3W2DA 3U30A 1LXDA 3L17A 4GSWA 1WSPA 1L0YB 4WJQA 1E10A 2EMTA 2CKHB 4NQKE 3UQBA 2AYOB 2IO3B 2DENB 3W5UB 2AX5A 4GXBA 2PE6B 5AZGA 3SEBA 1VZ7A 4XE0A 1L6VA 1CQVA 4LNIA 1L0XB 1S3SG 3JVZX 1VZ8A 1UWMA 4LNKA 3N1ZC 2BB5A 5JH5C 2BF8B 2L52A 3ZVVA 2QHOA 1FIQA 1IYFA 2KKCA 1GC7A 3QC8B 2A4ZA 3IT4B 3PTFC 3NOBA 2AEHA 3RUIB 2ICIA 3C8YA 3APFA 4WWPA 3ZDMC 2JVCA 1XLPA 2IPKD 1D5XC 1UGMA 2LGDA 2MEKA 3WAOA 4WQMA 3CMMB 1L7YA 3B9JA 3APDA 4L2YA 1FXTB 3NZ3A 4MGYE 3T9LA 2NBVB 1XT9B 3AU5A 1TKGA 3AEBB 3AB5A 4CQNA 1TS4A 2ZJDA 4B95A 3PT2B 3PZDA 1LQBA 4HEA1 2Y3AA 3M63B 1F52A 1QOGA 1GJZA 2I1KA 3VDZA 4UDUC 2XK5B 3BYTB 3MJ5A 5DPRA 4JL9A 2CU3A 2L32A 1XCQL 4YTNB 2G4DB 5CHFA 4BKTA 4RGOS 3Q3FA 1C9FA 2KANA 3ZXRA 1S1QB 1WF9A 2E6XA 2LJ5A 2M17A 2KTRB 1VZ6A 1HTQA 2ZVNA 1WMHB 5TSSA 2BKRB 3VTWA 4AOFA 2N1VA 3WIMA 1NI2A 1NEKB 1Q1OA 2LZ6A 2L0FA 1YX6B 5LXHA 2MBBB 4HKZE 3Q3NC 4USAA 3V6EB 1N5WA 4GDLA 3I5JC 2Z8LA 5BMHA 2JXTA 2BQQA 3KUZA 2BYFA 2VH2A 1MG4A 2B76B 2NCNA 4GU2A 1DOYA 1E8WA 1SE2A 2NTTA 4ANVA 4IWQA 2JZZA 1OFFA 2J53A 4YSYB 3N30A 1C78A 3AM9A 3PZ7A 2AWTA 4ARIA 4WJPA 2BBCA 1EWCA 1XEEA 5LLIA 2DNFA 1TT5B 4KZCA 1WX7A 1FNWA 1T0SC 3TCAA 3ZW3A 4HK2A 4HPMB 1GPXA 2KD0A 3APCA 4A3OA 3PRMB 4BZAA 1H8CA 4WAAA 2CJOA 2ZPYA 5MPOA 4ZRKA 1Q10A 3U52E 2UWQA 2D3BA 2KMMA 2OJRA 1WGGA 2LHDA 2W3RA 3TBLD 2MBOA 1MPEA 2INCC 4YXDB 1PFDA 2IYDB 3PV1A 4IC7B 1ACCA 3PO0A 4RGNA 3B0AA 2REXA 2KC2A 2V0GA 3QWZB 5BO4B 4C4VA 3A1QB 2PW9A 1TS5A 4JWUC 3ZIMA 4EKUA 2FIFA 4KSKC 1T3QA 2PEAA 2K5PA 1IGCA 1AARA 2N7JA 1V8CA 4ICVA 5JHAA 2O6VD 3Q8CA 2WP9B 2K1FA 2INDC 3HVZA 3ZJVA 5C3JB 3IG3A 4PS8A 4AJWA 3RZFA 3AEDB 4R3DA 3N32A 5E6OA 5FR6A 5JHBA 4A90A 1V2YA 2PE9A 3CF6E 4A55A 4ASWC 4HLEA 2IO1B 2I2YA 1WGYA 2KX0A 3B1LX 3Q8BA 4JQWC 3W5VB 2BYTA 5FKAC 2LUMA 4NNJB 1KH0A 1Q5WB 4CO7A 3PZ8A 3AE2B 2O2VB 4ZRPA 1TGZB 2ZEQA 4C80A 1V80A 2BS2B 1C3TA 3DWGC 2JYTA 2XEWA 2CJNA 3HM6X 3A4RA 3BK2A 1TIFA 4AWJA 3IBEA 4JPSA 2XNAC 2GBMA 5HKHA 3BWUD 1TS2A 2MBEA 4KIKB 1ZPSA 3K9OB 2FCSA 4RFBA 2KHWB 5IOIA 2LWPA 2WDVB 1X1MA 3QQ8B 2D3GA 5G5GA 2C7HA 1SF0A 1XLNA 3SR6A 2PIAA 1H4RA 3RD2A 3A9JA 4TSSA 3JYUA 1IP9A 1NENB 2DZKA 2R61A 1L0VB 3D32A 4IWPA 1WGRA 2D3AA 3N1YC 2MWSB 4JIOU 2LRWA 4HJGE 1VCBA 3R7RA 4HJKA 5EE3A 1ET9A 1L4DB 1WXAA 4OVZA 2CHWA 3ONSA 4J6IA 3HIZA 4FBJB 1FXIA 2J4XA 2KT7A 4ZYNA 1F9JA 5HFYA 2AQ1B 4XC2A 4BKSA 4GB9A 2GI9A 3ZJUA 3Q8AA 3ZJTA 1F2RC 2L1AA 2GMIC 5IN7A 2FUG1 1RAXA 2V3SA 4H2AA 3X23A 2K8BA 2MJDA 4XYCA 2L3ZA 3NS8A 4HPLB 3Q3OC 4NAWB 2ZPNA 4MEMA 3TEXA 3X0WA 4K81A 1BT0A 5D6JB 1ZGUB 3KVFB 3DPDA 3QHTA 5JXVA 1ZUD2 3I3TB 4KV2A 4EUTA 4K3CA 3NUHB 3AECB 3RNFC 3R7QA 4LLGM 1T6BX 4YTPB 2CHZA 3MP9A 3AE5B 2LVQA 2AQ3B 4RCOA 1JWBD 1YN3A 1NBFC 1SJHD 2JT4B 2KFJA 1J7BA 1WJUA 5DPTA 2BYEA 1D5MC 2NPTB 4M00A 3WAMA 1UF0A 2QMTA 1TYGB 1AN8A 2LVOA 2WU5B 1EO6A 1WJ6A 2MA9B 1MHXA 2X38A 2DAJA 3DBRI 2ZZPB 2UU7A 1HXYD 4IUMB 4M0WB 2LD9A 1XD3B 1MFWA 2QILA 1RM6C 2GRIA 3WALA 1DGJA 1N62A 3GS2A 2ZNVC 4WWOA 1WXQA 1NYRA 2L05A 3U4EG 3BVZA 4PT5A 2N4FA 2PMVA 2AL3A 1P98A 3HRDD 3RNGC 1WXVA 2HTME 3CSTA 1SEBD 4M8NA 1RWSA 1JRUA 2JUOA 4ICUA 1UZXB 4ITKA 1YJJA 3PVLA 1P7FA 2K39A 2PLPA 1JW9D 3PLUA 4M01A 4BBNF 4HXDA 3HM3A 2J52A 3ZRCA 2TSSA 1R4NI 2K8HA 3T8MA 1UWXA 2JZPA 2WDRB 1BMLC 4ANUA 2WHIA 1WZ3A 1SGHA 2DZMA 3FAHA 3P2BA 1R7SA 2FNJB 2N1WA 2GLSA 4KGTA 3O13A 2BGFA 4BAXA 2BWES 1T0RC 3CIRB 4HCPB 4P1CC 3EFUA 5AZHA 2FBWB 1KJTA 1ZOYB 4A20A 1GNUA 2MP2B 2WX1A 3BINA 1UBIA 2GBNA 2IJ0A 3UIPB 2MBQA 1WE6A 2KJHB 3A9KB 3RZWC 3SHQA 3P4QB 2GBKA 1IGDA 3QK0A 1V5TA 1L6UA 1Y8RC 2N7EA 2EELA 1V1PA 3UF8A 2DYOA 2J0KA 1CZPA 1UH6A 4FXCA 2JF5A 2ZCBA 1J19A 1I4RA 4P6VF 2KWUB 4GIVA 4MM3A 1QT9A 3FILB 1LO5D 1KLGD 4LDTD 2KX3A 3RPFC 4WURA 5E6JA 2K6DB 2LRUA 2ZW0A 2WXGA 1XCTL 4G11A 2DX5B 2RPQA 2DYBA 4IWOA 2HJ8A 3V05A 1GC6A 1IBXA 3H7PA 1VD2A 3VR9B 1NYQA 1P0RA 1PDXA 4HCNB 4MJSB 2J0MA 4S17A 5J2RA 1OQQA 3L0WB 2JRIB 2YEPF 3AE4B 1F0ZA 3AE8B 1HTOA 1FCCC 1WGKA 3DQVA 3V6CB 2LGSA 5D2MB 2G1EA 3AEGB 1CK1A 5JZEB 3KH0A 2V1YA 1GOZA 3MC8A 4OZCA 3AE3B 3A4SC 4IG7B 2KWCA 3L4PA 1QOAA 1WY8A 1ET6A 4PK1A 1HZ5A 4ZRQA 5H8YE 3ABVB 3W1YA 3KLSX 1FNUA 4YSXB 1WYGA 1WM3A 2KTFA 1T0QC 2WLBA 4W9IA 4N58A 4DHJD 1IUEA 3PLVA 2MJ3A 1GB1A 5H92C 4YWGG 5CHVC 4G3XB 2BT6A 2G3QB 2LEKA 5AUKA 3V61A 2G4SA 1B9RA 4W9JA 4M0WA 4DK5A 3L13A 4AQ7A 2N9XA 4MH0E 3WAPA 4S0RA 3AI5A 1PGAA 2JX5A 1OEYJ 1UGJA 1D3ZA 4FA6A 4GN1A 3P63A 2BS3B 3IAS1 4C7YA 4F8CB 4GMVA 1TKEA 4URKA 1WXSA 1WGDA 1ZDXA 2RD0A 1RFKA 4QAYA 5C1ZA 3B2FA 2RDGA 2KDBA 3QAQA 4KSLC 4Q2JA 3VXWA 1F77A 4W9HA 4MGZE 2YVCA 4II3B 1YD8U 1WFYA 4BVUC 2BKFA 4J3OD 3TMPB 2JSVX 3BIID 4BOZB 3RT3B 1MVKA 1WR1A 2K22A 4I6LB 2KO3A 1GAQB 2IO2B 3H9DA 2IZVB 3OWEB 2OEDA 1T0YA 4NQLB 3LDZE 5HI1A 3RNEC 3JSVA 1K8RB 3OG5A 2WXNA 4L23A 4ANXA 2LGYA 2NVUI 3AV8A 2WXQA 3P4RB 1GB4A 3GZNI 2RGFA 4BKSD 4HDOA 2NTSA 3MHSD 3OAWA 1WWTA 2MP2A 5BYQA 1BUIC 3AEFB 1Z2MA 2VRRB 1D5ZC 3ZNZB 3NVWA 5AZFA 2RDHA 2LJIA 2WDTB 2MW5A 3U8ZA 3HHMA 3OJ4B 1TBEA 3RNBC 2KDEB 3AH7A 1P1AA 4RMAA 3B2GA 4W9EA 2D2QA 4TV3A 1HA5A 3V62A 4E3CA 1N5XA 5L95C 2HTHA 2FUHB 2ZNVB 4AS1A 3NY5A 4EZJA 1M4VA 1SIFA 3PREA 2WXIA 1PQSA 4WWNA 3KWLA 2MRPA 1QF6A 1TY2A 2W3SA 1XO3A 2IGHA 2K25A 5HHDG 1VLBA 4II2B 1MHHE 3DBLB 4I6NB 3RFZB 3TEWA 4KDIC 3EUB2 3SD5A 4IM3A 2OHFA 3ZNGC 3OJ3A 4LK0M 1KLUD 4MJSA 2GB1A 2BW2A 2XBBC 2HDEA 3DWMA 5EE0A 1XXGA 1I7HA 3WCQA 4YTMB 4WAFA 4DBGA 1AYFA 1TKYA 2N9EB 1ISNA 1SBBB 2W9NA 2KWDA 2WXMA 2WXFA 3PS6A 3RNCC 3AN1A 2QC8A 3EHVA 4ARCA 3Q6BA 1R4MB 4KDLB 2J0JA 1OGWA 1EM7A 4GDKB 4LCDE 2KFKB 3TL5A 3W9CB 3ZLZA 3PHWB 1JWAD 2QIEB 2WS3B 2W55A 1QOBA 5HG2A 2VZKD 3EFCA 1TY0A 4FHJA 2UYZB 3VHTC 2PJHA 2KLGA 3P4PB 4DWFA 2NBUA 2PKOA 1L4ZB 3I63C 4K7UA 1EF1A 1VR9A 1JALA 3ZNID 1WX9A 1XLQA 3DVGY 1RLFA 5LNK1 1QQRA 2NMQA 4P1BC 2MCNB 2O6VB 3Q2AC 1J7CA 3U7DA 1EUVB 2G9HD 4A6QA 1ENFA 2IGDA 1ZXHA 2EKIA 1I4PA 4F7ZA 2M0XA 2KK8A 2KLCA 2V3NA 3PRZA 1QZEA 5BMIA 1OTRB 4P7IA 1FEHA 3ZTCA 3IXSA 5CX3A 4W9FA 2XK5A 4XGAB 4CHKA 4YT0B 1GG3A 3MC0B 4IM2A 1P3QU 1JWMD 3GB1A 3DOWA 2V4LA 1I4QA 1D4BA 2KTRA 2KVRA 1WMHA 2SEBD 4C7ZA 3Q8EA 1OQRA 5C2TB 3PGEA 2SAKA 1C4CA 3ALBA 1AW7A 1DOIA 1KM7A 2JPHA 3MHZA 4OZBA 4FLHA 2KDFB 1JROA 4KGSA 2VH1A 4KVGB 3RN9C 2KAJA 4GOCA 3W1SC 1CMXB 3NVZA 2V9HA 2KQ4X 1UELA 1V9JA 5EDSA 2K6QA 3R3MA 4DXFA 4O1NA 2B3AA 2KDIA 2OJWA 2WXJA 1KF6B 1U4AA 2AL6A 3NHEB 4JE3B 2CHXA 4L1BA 2D07B 1RRBA 4WJOA 1YN4A 4MACA 3NVVA 2ON8A 4FULA 3TEZA 4WIPA 4CYEA 5G55A 1C4PA 1E8ZA 1E90A 3VRAB 1I4XA 3VVWB 1D6EC 5KHQA 1XQQA 4XX5A 2A5UA 4EE2A 2ZVOA 3VUWA 3ML8A 1YOVB 1FD6A 2M0AA 1E0ZA 1C4AA 3DBSA 4JGHB 2PPHA 4FJYA 3GOEA 1I42A 2JRHA 5IAAC 1FMAD 5I4DA 3H6NA 5LXIB 3WANA 3A1QA 1MI0A 5T8IA 4AJYB 3QIJA 2KOXA 2K9XA 2N9PC 4OZAA 1JWSD 2LHEA 3DVNV 3ML9A 2KWVB 3KUCB 4US9A 3LB8C 3H7SA 2D3CA 5E6NA 4B6WA 3FC4A 4RGTA 3EGRA 2DZIA 2RR9A 4JLCA 4YL8A 4K1RB 1SSNA 2WXKA 1MJDA 4PS3A 3IT6B 4DXGA 2GBJA 4MDKE 1FM0D 3IHPC 1TJEA 1P7EA 2FAZA 2LVPA 2I1JA 2MQJA 1PYWD 1WJNA 3H8HA 4NZLB 4FJVB 1QLBB 2BYVE 2DBYA 2O6VA 2O2VA 4RF1A 4HRSA 3ZYYX 3QCAA 2Z0EB 4RH6A 1G6JA 3ETRA 3H1UA 1F1HA 2I38A 4PS7A 1K53A 2JXXA 3KYDD 5BMGA 2BPSA 4NJ6A 4KIKA 3IFWB 3KQ4A 1ZW7A 4FN2A 4FJZA 1EU3A 3Q8FA 4OVVA 5D3DA 4DQOC 1E5WA 2LI5A 3A33B 4XWWA 1WIAA 2RDBC 2G45B 4M8MA 2BS4B 3AE9B 3VTUA 1IPGA 1XF5L 2LFIA 3TJPA 1DYQA 2Z0DB 2LUEA 1K50A 1ZE3D 4XZ4A 4GDLB 3R2TA 2FCQA 4W9DA 3QARA 2NS5A 3VRBB 5D94A 4LJOB 1N6ZA 2FCNA 4IKGA 4NY0A 2H89B 1PGXA 3E9SA 4RNAA 2C60A 2C5LC 1UBQA 1I4HA 2JU6X 3PHXB 2IDYA 2Y5PA 1WZ0A 5AUIA 4DDID 3NJTA 3VQIA 4EOYA 1ZKHA 3VFKA 1V49A 2INPE 1JQ4A 4GLSC 2JQRB 2ZW1A 3R2IA 2XN9C 4OVUA 4NAWA 2CR5A 1JRPA 2Q5WD 2WU2B 3CSFA 4ZRJA 1WXMA 5BYSA 1NVID 3TSSA 3ZDTA 3OLMD 3NG0A 2QCZA
chains in the Genus database with same CATH topology
4HROA 1SIJA 3AH7A 4B0EA 3ZGZA 2IGGA 3B2GA 1KFYB 4TQ0A 1ZPSA 3SFDB 1HA5A 3BZDB 4RFBA 1N5XA 1YN5A 1STEA 3AE6B 1NI3A 3J9CA 3BVGA 3P42A 2WDVB 4WWMA 1VDVA 4AS1A 1SB3C 5G5GA 1SF0A 4A9AA 1XLNA 3SR6A 4IOIE 3BWUD 1EWYC 2PIAA 1M4VA 4N59A 3TUOA 4TSSA 1JWUD 2WXIA 2AQ2B 2LGIA 3KWLA 2WNMA 1QF6A 2QSDA 1TY2A 1NENB 2W3SA 4OW0A 1XO3A 2JYEA 2IGHA 2R61A 5HHDG 1VLBA 1L0VB 3AE7B 1MHHE 2K3UA 3RFZB 1SXTA 3TEWA 2V3PA 2MJEA 3EUB2 2OHFA 4LK0M 4HJGE 1KLUD 2GB1A 2BW2A 2ONQA 5EE3A 1ET9A 1L4DB 4OHJA 4OVZA 2HDEA 3DWMA 1CJEA 5EE0A 1XXGA 1I7HA 3WCQA 4YTMB 4WAFA 1AYFA 1FXIA 1TS3A 1TKYA 2J4XA 4KKIA 1SBBB 5HFYA 2WXRA 2AQ1B 1C79A 2N9KA 2KWDA 2WXMA 1ZDVA 3HVDA 2GI9A 2WXFA 3ZJUA 2KN4A 3Q8AA 1FFUA 3AN1A 3LYYA 1E9MA 3ZJTA 1F2RC 4ARCA 1K52A 4HKQA 2H88B 2L1AA 4WH4A 4B0MA 5G5HA 2FUG1 3Q69A 1EM7A 4GDKB 1AWDA 1B1ZA 3MFGA 4TQ1A 3W9CB 1YQ4B 4KKJA 1JWAD 3NRZA 4H2AA 2QIEB 1VJKA 2WS3B 4REZA 2DYMA 2W55A 1QOBA 1ZP0B 4XDDA 1SJED 2MJDA 5HG2A 2RMMA 4NAWB 5D3IB 1YJIA 2VZKD 3TEXA 1V97A 1JCKB 1TY0A 3U2SC 3NVYA 1PGBA 2QEJC 3P4PB 4ZHOA 2PKOA 5JXVA 1L4ZB 1ZUD2 1QILA 3KWVA 1VR9A 1JALA 3BK1A 1N60A 1XLQA 3NUHB 3AECB 3P4SB 1QQRA 5LNK1 3HUIA 1T6BX 4LLGM 2NMQA 1FRDA 2DLBA 1C76A 4YTPB 3MP9A 4KX6B 3AE5B 1J7CA 2DWQA 2AQ3B 4RCOA 1JWBD 1YN3A 2PVGC 2E3TA 1SJHD 2G9HD 3URYA 4A6QA 4ZYSA 1J7BA 1ENFA 2IGDA 1ZXHA 2EKIA 1I4PA 1N61A 1D5MC 3GP7A 2K0PA 2V3NA 3E56A 5BMIA 1TZOA 1FEHA 2QMTA 3IXSA 4LTUA 2BTEA 1TYGB 1SE4A 1AN8A 2WU5B 4YT0B 1E6EB 1KRHA 1MHXA 2M56B 3MC0B 1FFVA 2X38A 1JWMD 1Y56A 1FNVA 1J7AA 3GB1A 3UI3A 1HXYD 4JWSC 1I4QA 1SE3A 5EE9A 1YMHE 2RPVA 1D4BA 2QILA 2L83A 3AEEB 5D7GA 1RM6C 2GRIA 2INNE 1DGJA 1N62A 2ACZB 4XDCA 3GS2A 3W2DA 2SEBD 4C7ZA 3ZQ4A 1FXAA 1WSPA 1NYRA 1WXQA 1L0YB 1OQRA 2YEPB 3Q8EA 1E10A 3R8BA 3U4EG 5C2TB 3FILA 3BVZA 4PT5A 3W5UB 2PMVA 1C4CA 2SAKA 1AW7A 2AX5A 1DOIA 3HRDD 1YNTE 3MHZA 3SEBA 1VZ7A 1FRRA 4OZBA 4XE0A 1L6VA 1A70A 1CQVA 1JROA 2WXLA 4KGSA 1L0XB 2KAJA 1HEZE 2HTME 2N9LA 1VZ8A 1UWMA 3NVZA 1SEBD 1RWSA 2KQ4X 2BB5A 2L52A 4ITKA 1YJJA 1FIQA 1P7FA 4O1NA 4DXFA 2PLPA 1JW9D 4IDIA 3IT4B 3I9V1 3CWIA 2WXJA 1KF6B 4ZOHC 2ICIA 2J52A 3C8YA 2W82A 2TSSA 4JE3B 4L1BA 1UWXA 2JZPA 1XLPA 2IPKD 2WDRB 1BMLC 4KGRA 5FK9C 1D5XC 1YN4A 4MACA 3NVVA 2ON8A 2MEKA 3TEZA 4WIPA 4WQMA 3B9JA 3FAHA 3IAM1 1C4PA 4L2YA 1R7SA 4KGTA 3O13A 3NZ3A 3CIRB 2PTLA 3VRAB 1I4XA 4C56C 1TKGA 3AEBB 2FBWB 3AB5A 4CQNA 1ZOYB 3BVMA 1TS4A 1D6EC 1PUTA 2KACA 2FE8A 4MH8A 4EE2A 4HEA1 2Y3AA 4RGMA 1C77A 1QOGA 1FD6A 1KTKA 2IJ0A 4UDUC 3W1SA 2M0AA 1E0ZA 3BYTB 3MJ5A 1C4AA 3P4QB 1IGDA 1L6UA 3NS1A 2CU3A 2L32A 1E7PB 2WDQB 1XCQL 3V3XA 4YTNB 2EELA 1V1PA 4NJCA 3LXFA 2DYOA 4RGOS 1FMAD 1UUPA 4XWTA 3AEAB 5I4DA 1CZPA 2KDMA 3BYYB 1C9FA 2M19A 1MI0A 4FXCA 2E6XA 1FO4A 3SFEB 3AE1B 1VZ6A 5T8IA 1I4RA 4P6VF 5TSSA 2K9XA 5BYRA 4OZAA 3P1MA 1JWSD 3EA6A 1XLOA 1QT9A 1NEKB 3FILB 2LHEA 1LO5D 1KLGD 1FCLA 1QOFA 2WQYB 3RPFC 4WURA 2Y5CA 5E6JA 2ZW0A 2WXGA 1XCTL 4US9A 4HKZE 4USAA 3LB8C 1N5WA 4ZHPA 1BXTA 2VZKB 4TMAB 2Z8LA 3V05A 5BMHA 1ZXIA 3FC4A 4RGTA 3EGRA 2JXTA 2LMCA 5GXGB 1IBXA 3VR9B 1NYQA 1HZ6A 1PDXA 1K51A 3TEYA 2B76B 1DOYA 1OQQA 1SSNA 2PVOD 1SE2A 2NTTA 2WXKA 3T3OA 2YEPF 3AE4B 1OFFA 2J53A 3IT6B 5FR3A 3AE8B 4DXGA 1V1OA 1F0ZA 1FM0D 1FCCC 1P7EA 1TJEA 2JWUA 1WGKA 1QKZA 1VRAB 4YSYB 2QJLA 1C78A 3AM9A 3PZ7A 4ARIA 2G1EA 1N63A 1CK1A 2BBCA 1PYWD 1EWCA 3AEGB 4JX1C 1GOZA 4OZCA 3AE3B 1XEEA 1EU4A 3H8HA 4NZLB 3L4PA 1QOAA 1ET6A 1FNWA 1QLBB 1HZ5A 2DBYA 4ZRQA 5H8YE 4RF1A 3ABVB 4HRSA 4N6EB 3ZYYX 1GPXA 3KLSX 1WRIA 1YQ3B 1FNUA 4RH6A 4YSXB 1WYGA 2WXHA 2CJOA 5MPOA 1Q10A 3U52E 2WLBA 3ETRA 4N58A 1IUEA 2KMMA 2LHDA 2I38A 2MJ3A 1K53A 1GB1A 5H92C 3AMZA 4YWGG 2W3RA 2BT6A 3VR8B 5BMGA 1MPEA 2LEKA 5AUKA 1B9RA 4YXDB 1PFDA 3KQ4A 4M0WA 3T3NA 4AQ7A 1T5XD 1ACCA 3PO0A 1EU3A 3Q8FA 4RGNA 1V1PB 1PGAA 2V0GA 2JX5A 1UGJA 4D2KA 1HQRD 3P63A 2BS3B 2PW9A 3IAS1 4US8A 1TS5A 4JWUC 5D3DA 2W54A 4C7YA 4DQOC 2D5GA 1T3QA 1TKEA 4XWWA 1I4GA 2K5PA 4P16A 2BB6A 1ZDXA 4MM3B 1RFKA 1IGCA 2N7JA 1V8CA 2BS4B 3AE9B 3B2FA 1XF5L 2LFIA 2RDGA 3Q8CA 2WP9B 1DYQA 3HVZA 3ZJVA 1K50A 1DOXA 1ZE3D 3I57A 4Q2JA 5C3JB 1F77A 4GDLB 3R2TA 3N9YC 1ROEA 3VRBB 4J3OD 3AEDB 2JSVX 1IBXB 3BIID 4R3DA 3U7ZA 4IKGA 1MVKA 2K22A 2H89B 1RYJA 1GAQB 4A90A 1PGXA 3E9SA 2J42A 4RNAA 3OWEB 4A55A 2V4IB 2OEDA 1I4HA 2JU6X 2I2YA 4MT5A 4YSZB 2IDYA 2Y5PA 3Q8BA 1JMLA 5HI1A 5AUIA 3W5VB 2BYTA 2WXNA 4L23A 1L5PA 5FKAC 2LUMA 4RF0A 3AV8A 3VQIA 2WXQA 3P4RB 1KH0A 2N0SB 1GB4A 2WXPA 3PZ8A 1F2RI 3AE2B 2INPE 1JQ4A 2NTSA 4GLSC 4ZRPA 1WWTA 2JQRB 5EE1A 2ZW1A 5BYQA 1BUIC 4C80A 3AEFB 3R2IA 2BS2B 2XN9C 4A8XC 3DWGC 2JYTA 1D5ZC 1JRPA 3NVWA 2Q5WD 2WU2B 2CJNA 2RDHA 5BYSA 1UNSA 2LJIA 1NVID 2MH7A 3BK2A 2WXOA 3TSSA 1ESFA 4JPSA 2XNAC 4NAMA 1TS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IUE A;  1PUT A;  2KMM A;  1SIJ A;  3AH7 A;  3HUI A;  4HRO A;  2MJ3 A;  1FRD A;  5H92 C;  3AMZ A;  3B2G A;  2W3R A;  1KFY B;  2BT6 A;  4YTP B;  3VR8 B;  4KX6 B;  3AE5 B;  1J7C A;  2DWQ A;  1JWB D;  2PVG C;  2LEK A;  2E3T A;  5AUK A;  3SFD B;  1N5X A;  1QOG A;  3AE6 B;  1NI3 A;  1J7B A;  1B9R A;  4YXD B;  1PFD A;  2EKI A;  2WDV B;  1N61 A;  1E0Z A;  4WWM A;  1VDV A;  3PO0 A;  3P4Q B;  1SB3 C;  5G5G A;  1SF0 A;  4A9A A;  1XLN A;  3SR6 A;  4LTU A;  1L6U A;  2JX5 A;  1EWY C;  3NS1 A;  1TYG B;  2PIA A;  4N59 A;  2CU3 A;  1E7P B;  2WU5 B;  4YT0 B;  3P63 A;  2BS3 B;  1E6E B;  2WDQ B;  4YTN B;  4JWU C;  4US8 A;  3KWL A;  1KRH A;  2M56 B;  2W54 A;  4C7Y A;  1FFV A;  3LXF A;  1QF6 A;  1NEN B;  1FMA D;  1T3Q A;  2W3S A;  1TKE A;  3AEA B;  1CZP A;  1XO3 A;  1J7A A;  2K5P A;  2M19 A;  1VLB A;  1L0V B;  3AE7 B;  4FXC A;  1FO4 A;  4JWS C;  3SFE B;  1RFK A;  3AE1 B;  5EE9 A;  4P6V F;  1V8C A;  2BS4 B;  3AE9 B;  2K9X A;  3B2F A;  2L83 A;  3AEE B;  3P1M A;  1RM6 C;  1XLO A;  1QT9 A;  2MJE A;  1DGJ A;  1N62 A;  2ACZ B;  2OHF A;  1NEK B;  2WP9 B;  3EUB 2;  3HVZ A;  4C7Z A;  1DOX A;  1FXA A;  1QOF A;  1NYR A;  1WXQ A;  1OQR A;  2WQY B;  5EE3 A;  3RPF C;  5C3J B;  1E10 A;  3DWM A;  2Y5C A;  1CJE A;  5EE0 A;  1ROE A;  5C2T B;  1I7H A;  4US9 A;  3WCQ A;  3W5U B;  3VRB B;  4YTM B;  3P4S B;  1AYF A;  1FXI A;  2AX5 A;  1TKY A;  1DOI A;  4USA A;  3AED B;  1N5W A;  3HRD D;  3LB8 C;  4ZHP A;  3BII D;  1FRR A;  1L6V A;  1A70 A;  1JRO A;  2K22 A;  1ZXI A;  3FC4 A;  2H89 B;  1RYJ A;  1GAQ B;  5GXG B;  2KAJ A;  2HTM E;  3VR9 B;  1NYQ A;  1PDX A;  1UWM A;  3NVZ A;  2B76 B;  1FFU A;  1RWS A;  3AN1 A;  1DOY A;  1E9M A;  1OQQ A;  2PVO D;  2H88 B;  2L52 A;  3AE4 B;  4ITK A;  1OFF A;  1F0Z A;  1YJJ A;  3AE8 B;  1FIQ A;  1FM0 D;  4YSZ B;  1TJE A;  5G5H A;  1JW9 D;  4IDI A;  1WGK A;  4YSY B;  5AUI A;  2QJL A;  3W5V B;  1AWD A;  3AM9 A;  1L5P A;  3W9C B;  1YQ4 B;  3CWI A;  3AV8 A;  1KF6 B;  3P4R B;  1JWA D;  2N0S B;  2G1E A;  3NRZ A;  4ZOH C;  1N63 A;  2QIE B;  3AEG B;  1VJK A;  2WS3 B;  4JX1 C;  2W55 A;  1QOB A;  1ZP0 B;  3AE2 B;  2MJD A;  3AE3 B;  1JQ4 A;  2WDR B;  1XLP A;  1YJI A;  3L4P A;  1WWT A;  1QOA A;  1V97 A;  2JQR B;  5EE1 A;  1QLB B;  3NVY A;  3NVV A;  2DBY A;  4C80 A;  3AEF B;  5H8Y E;  2BS2 B;  4WQM A;  3ABV B;  4HRS A;  4N6E B;  3ZYY X;  3B9J A;  3DWG C;  3FAH A;  3P4P B;  1JRP A;  3NVW A;  1GPX A;  2Q5W D;  2WU2 B;  1R7S A;  2CJN A;  4ZHO A;  2PKO A;  1WRI A;  1YQ3 B;  2MH7 A;  1NVI D;  1ZUD 2;  4YSX B;  1WYG A;  2CJO A;  3CIR B;  5MPO A;  1JAL A;  3VRA B;  1N60 A;  1XLQ A;  2WLB A;  3ETR A;  4N58 A;  1TKG A;  3AEB B;  2FBW B;  3AB5 A;  3AEC B;  1ZOY B; 
#chains in the Genus database with same CATH topology
 4M02 A;  1SIJ A;  2NBW B;  3ZGZ A;  1KFY B;  4MGK E;  4TQ0 A;  5DPS A;  3C19 A;  3SFD B;  4LDT B;  3J9C A;  4DDG D;  3BVG A;  3GE3 C;  4HWI B;  2C9W B;  2WYQ A;  4K7W A;  4C4V B;  4WWM A;  5GMV A;  4A9A A;  4IOI E;  3RYT A;  3TUO A;  1YIW A;  2N7D A;  1JWU D;  5IO9 A;  2NPT A;  2QSD A;  4OW0 A;  2JYE A;  1WE7 A;  5DCN A;  1I35 A;  1SXT A;  3ZXV A;  2V3P A;  3EEC A;  2MJE A;  4K3B A;  3NZS A;  1CJE A;  2C7N B;  2CU1 A;  3V60 A;  4HVB A;  2JY6 A;  4RM8 A;  1EF5 A;  2WXR A;  3LJ3 A;  3MJW A;  2HD5 B;  2M8S A;  1ZDV A;  1FFU A;  4EFO A;  2L8J A;  4EZL A;  3RUL A;  1E9M A;  4ZDV A;  2Z59 B;  1K52 A;  4HKQ A;  2X8X X;  4WH4 A;  5G5H A;  3Q69 A;  4DHJ B;  4PYZ A;  1AWD A;  1B1Z A;  1E7V A;  3MFG A;  4TQ1 A;  3ZKJ C;  1YQ4 B;  1TZ1 A;  3NRZ A;  4HPP A;  3KYC D;  2RSU A;  3QX1 A;  4LNF A;  1VJK A;  1SE9 A;  1LM8 B;  2DYM A;  5CTR C;  4RM9 A;  1ZP0 B;  3M62 B;  2RMM A;  5D3I B;  1YJI A;  3FKY A;  5AEK B;  2IBI B;  3RMK C;  3DBR B;  1OEY A;  3HK0 A;  1QIL A;  3UGB B;  3GE8 C;  3KWV A;  5E6P A;  3BK1 A;  1N60 A;  2KC1 A;  3VH4 B;  1RFA A;  3P4S B;  1L2N A;  2KQ7 A;  3S2A A;  3VUY A;  1FRD A;  2DLB A;  4G50 A;  4KX6 B;  1WYW B;  2DWQ A;  3PRP B;  3URY A;  1E7U A;  3KUD B;  1WI0 A;  4ANW A;  3AU4 A;  1HE8 A;  3GP7 A;  3A9J B;  1TZO A;  2WGS A;  4LTU A;  2BTE A;  3A9K A;  1KRH A;  2MLB A;  1J7A A;  3UI3 A;  4JWS C;  3DBH I;  5EE9 A;  2L83 A;  3AEE B;  2INN E;  1R4N B;  2LXC A;  2CS4 A;  2D10 A;  3ZQ4 A;  1FXA A;  3BY4 B;  1J0G A;  2YEP B;  3R8B A;  3TIX A;  5IA7 A;  1P9D U;  3FIL A;  1YQB A;  2MX2 A;  1YNT E;  1FRR A;  3R66 C;  1A70 A;  2WXL A;  1HEZ E;  4N9F 4;  2N9L A;  1KLV A;  4GGQ A;  3DDC B;  4IDI A;  1E8X A;  3VH3 B;  2BWF A;  3I9V 1;  3CWI A;  4LNO A;  4ZOH C;  2W82 A;  4W9K A;  4G0N B;  2D11 A;  3IVF A;  4KGR A;  5FK9 C;  1C1Y B;  1V5O A;  3L08 A;  3IAM 1;  1WR6 E;  3ENE A;  2LAS A;  2PTL A;  4C56 C;  3BVM A;  1PUT A;  2KAC A;  2FE8 A;  4MH8 A;  4LJP B;  4MSM B;  3RNA C;  2ASQ A;  3JW0 X;  3L10 B;  2C7M B;  4RGM A;  1C77 A;  3DHI C;  1KTK A;  3W1S A;  3RCZ A;  2DAF A;  3UIO B;  2EMS A;  3NS1 A;  4EZK A;  1E7P B;  3ECI A;  2WDQ B;  3V3X A;  3ZNH B;  4NJC A;  3LXF A;  4NJ7 A;  1UUP A;  4XWT A;  4BFR A;  3AEA B;  4KZ0 A;  2YLM A;  2KDM A;  3BYY B;  2M19 A;  1FO4 A;  3SFE B;  3AE1 B;  4BKG A;  5BYR A;  4DHZ B;  3P1M A;  3EA6 A;  1XLO A;  1WM2 A;  2L00 B;  1FCL A;  1QOF A;  2WQY B;  2WWZ A;  2Y5C A;  1V6E A;  5J18 A;  4ZHP A;  2NR2 A;  1BXT A;  2EKE C;  2VZK B;  4TMA B;  1ZXI A;  2ZCC A;  2LMC A;  5GXG B;  1HZ6 A;  1K51 A;  3TEY A;  2FCM A;  4MGI E;  4W9C A;  2PVO D;  3T3O A;  2KZR A;  5FR3 A;  1V1O A;  3MTN B;  2JWU A;  1QKZ A;  1VRA B;  2QJL A;  2KJ6 A;  2L0T A;  1N63 A;  4JX1 C;  3AXC A;  4ZRI A;  3DVG X;  3ZRF A;  1EU4 A;  3QJZ A;  2KN5 A;  4AUQ C;  4F1S A;  2KMC A;  4N6E B;  3PPA A;  3QA8 A;  1WRI A;  1YQ3 B;  1UD7 A;  2KYW A;  1WX8 A;  2WXH A;  2KQS A;  2DHZ A;  4BBN C;  3AMZ A;  3VR8 B;  5KHO A;  4NPN A;  2IY1 B;  4W9G A;  3T3N A;  1T5X D;  2BVC A;  3O65 B;  4I6P A;  1V1P B;  4D2K A;  1HQR D;  4US8 A;  2W54 A;  2D5G A;  2IO0 B;  4MEL A;  1YX5 B;  2MHJ A;  1I4G A;  4P16 A;  2BB6 A;  4MM3 B;  1LFD A;  1V86 A;  3VAW A;  2LXA A;  3GZN B;  3DHH C;  4K7S A;  4ACF A;  1Q0W B;  1DOX A;  3I57 A;  2JZ3 B;  1A5R A;  4DHZ E;  2KMA A;  4B9K A;  3KW5 B;  3N9Y C;  1ROE A;  2QDF A;  2KVZ A;  1IBX B;  3UQA A;  3H7P B;  3U7Z A;  2KJR A;  1RYJ A;  2J42 A;  4LNN A;  2L76 A;  2V4I B;  5CHW A;  3DBH B;  4MT5 A;  4BOS C;  4YSZ B;  5IKC M;  2OOB B;  1JML A;  1L5P A;  4RF0 A;  2N0S B;  4GDK A;  2WXP A;  2LGX A;  3SU8 X;  4DXA B;  2KFK A;  1F2R I;  4E71 A;  5EE1 A;  2MBH A;  2M1M A;  4A8X C;  3SDL C;  4IW0 A;  1UNS A;  2MH7 A;  5DPW A;  5IP4 D;  2WXO A;  1ESF A;  3L54 A;  4NAM A;  1WGH A;  4HRO A;  4B0E A;  2DZJ A;  1OQY A;  2KNB A;  2IGG A;  1NDD A;  1J8C A;  3BZD B;  1YN5 A;  1WJ4 A;  1STE A;  3AE6 B;  1NI3 A;  1WRD B;  3AUL A;  3P42 A;  2K8C A;  3UIN B;  1VDV A;  2J7Q B;  1SB3 C;  3N20 C;  1EWY C;  5C23 A;  4N59 A;  1YJ1 A;  3Q3J A;  2AQ2 B;  2LGI A;  2WNM A;  2IY0 B;  3K9P B;  4PYU A;  1KOT A;  1MG8 A;  2Y5B B;  3AE7 B;  4TUU A;  1TTN A;  3ZO5 B;  2K3U A;  3Q3M C;  3VUX A;  2ONQ A;  4MSQ B;  2L7R A;  4OHJ A;  3M95 A;  4HDQ A;  1M94 A;  1E8Y A;  3VTV A;  1Z5S B;  4A3P A;  2HJ1 A;  4KKI A;  1TS3 A;  2R2Q A;  1C79 A;  2N9K A;  3HVD A;  2KN4 A;  3WA0 A;  2GOW A;  3LYY A;  4FAD A;  2GBR A;  3L16 A;  3JSV B;  2H88 B;  2HE7 A;  4IM0 A;  4B0M A;  5L83 A;  3DBL I;  1V81 A;  4KKJ A;  4REZ A;  3DVN U;  4TKN A;  4XDD A;  1SJE D;  3B08 A;  3MC9 A;  2MSE D;  1V97 A;  1WH3 A;  1JCK B;  2JWZ A;  3U2S C;  3NVY A;  1PGB A;  2QEJ C;  3C0R B;  3N3K B;  3PSE B;  2WX0 A;  4ZHO A;  2KXJ A;  3M3J A;  3EC8 A;  3DHG C;  4W9L A;  4X57 B;  4C00 A;  3RI7 C;  3HUI A;  2R2O A;  4EEW A;  1C76 A;  4WJN A;  5J17 A;  1R4M I;  3ZTD A;  2PVG C;  4AP4 C;  2E3T A;  4ZYS A;  2FID A;  1N61 A;  2K0P A;  3E56 A;  1LGR A;  4WQO B;  4E74 A;  1SE4 A;  1E6E B;  2M4N A;  3Q14 C;  2M56 B;  1FFV A;  1Y56 A;  1FNV A;  3N1X C;  3ZUN A;  1GUA B;  3NZU A;  1FPY A;  5G2N A;  1SE3 A;  1YMH E;  2RPV A;  4FHK A;  5TR5 A;  5D7G A;  3DCG A;  2ACZ B;  4XDC A;  3W2D A;  3U30 A;  1LXD A;  3L17 A;  4GSW A;  1WSP A;  1L0Y B;  4WJQ A;  1E10 A;  2EMT A;  2CKH B;  4NQK E;  3UQB A;  2AYO B;  2IO3 B;  2DEN B;  3W5U B;  2AX5 A;  4GXB A;  2PE6 B;  5AZG A;  3SEB A;  1VZ7 A;  4XE0 A;  1L6V A;  1CQV A;  4LNI A;  1L0X B;  1S3S G;  3JVZ X;  1VZ8 A;  1UWM A;  4LNK A;  3N1Z C;  2BB5 A;  5JH5 C;  2BF8 B;  2L52 A;  3ZVV A;  2QHO A;  1FIQ A;  1IYF A;  2KKC A;  1GC7 A;  3QC8 B;  2A4Z A;  3IT4 B;  3PTF C;  3NOB A;  2AEH A;  3RUI B;  2ICI A;  3C8Y A;  3APF A;  4WWP A;  3ZDM C;  2JVC A;  1XLP A;  2IPK D;  1D5X C;  1UGM A;  2LGD A;  2MEK A;  3WAO A;  4WQM A;  3CMM B;  1L7Y A;  3B9J A;  3APD A;  4L2Y A;  1FXT B;  3NZ3 A;  4MGY E;  3T9L A;  2NBV B;  1XT9 B;  3AU5 A;  1TKG A;  3AEB B;  3AB5 A;  4CQN A;  1TS4 A;  2ZJD A;  4B95 A;  3PT2 B;  3PZD A;  1LQB A;  4HEA 1;  2Y3A A;  3M63 B;  1F52 A;  1QOG A;  1GJZ A;  2I1K A;  3VDZ A;  4UDU C;  2XK5 B;  3BYT B;  3MJ5 A;  5DPR A;  4JL9 A;  2CU3 A;  2L32 A;  1XCQ L;  4YTN B;  2G4D B;  5CHF A;  4BKT A;  4RGO S;  3Q3F A;  1C9F A;  2KAN A;  3ZXR A;  1S1Q B;  1WF9 A;  2E6X A;  2LJ5 A;  2M17 A;  2KTR B;  1VZ6 A;  1HTQ A;  2ZVN A;  1WMH B;  5TSS A;  2BKR B;  3VTW A;  4AOF A;  2N1V A;  3WIM A;  1NI2 A;  1NEK B;  1Q1O A;  2LZ6 A;  2L0F A;  1YX6 B;  5LXH A;  2MBB B;  4HKZ E;  3Q3N C;  4USA A;  3V6E B;  1N5W A;  4GDL A;  3I5J C;  2Z8L A;  5BMH A;  2JXT A;  2BQQ A;  3KUZ A;  2BYF A;  2VH2 A;  1MG4 A;  2B76 B;  2NCN A;  4GU2 A;  1DOY A;  1E8W A;  1SE2 A;  2NTT A;  4ANV A;  4IWQ A;  2JZZ A;  1OFF A;  2J53 A;  4YSY B;  3N30 A;  1C78 A;  3AM9 A;  3PZ7 A;  2AWT A;  4ARI A;  4WJP A;  2BBC A;  1EWC A;  1XEE A;  5LLI A;  2DNF A;  1TT5 B;  4KZC A;  1WX7 A;  1FNW A;  1T0S C;  3TCA A;  3ZW3 A;  4HK2 A;  4HPM B;  1GPX A;  2KD0 A;  3APC A;  4A3O A;  3PRM B;  4BZA A;  1H8C A;  4WAA A;  2CJO A;  2ZPY A;  5MPO A;  4ZRK A;  1Q10 A;  3U52 E;  2UWQ A;  2D3B A;  2KMM A;  2OJR A;  1WGG A;  2LHD A;  2W3R A;  3TBL D;  2MBO A;  1MPE A;  2INC C;  4YXD B;  1PFD A;  2IYD B;  3PV1 A;  4IC7 B;  1ACC A;  3PO0 A;  4RGN A;  3B0A A;  2REX A;  2KC2 A;  2V0G A;  3QWZ B;  5BO4 B;  4C4V A;  3A1Q B;  2PW9 A;  1TS5 A;  4JWU C;  3ZIM A;  4EKU A;  2FIF A;  4KSK C;  1T3Q A;  2PEA A;  2K5P A;  1IGC A;  1AAR A;  2N7J A;  1V8C A;  4ICV A;  5JHA A;  2O6V D;  3Q8C A;  2WP9 B;  2K1F A;  2IND C;  3HVZ A;  3ZJV A;  5C3J B;  3IG3 A;  4PS8 A;  4AJW A;  3RZF A;  3AED B;  4R3D A;  3N32 A;  5E6O A;  5FR6 A;  5JHB A;  4A90 A;  1V2Y A;  2PE9 A;  3CF6 E;  4A55 A;  4ASW C;  4HLE A;  2IO1 B;  2I2Y A;  1WGY A;  2KX0 A;  3B1L X;  3Q8B A;  4JQW C;  3W5V B;  2BYT A;  5FKA C;  2LUM A;  4NNJ B;  1KH0 A;  1Q5W B;  4CO7 A;  3PZ8 A;  3AE2 B;  2O2V B;  4ZRP A;  1TGZ B;  2ZEQ A;  4C80 A;  1V80 A;  2BS2 B;  1C3T A;  3DWG C;  2JYT A;  2XEW A;  2CJN A;  3HM6 X;  3A4R A;  3BK2 A;  1TIF A;  4AWJ A;  3IBE A;  4JPS A;  2XNA C;  2GBM A;  5HKH A;  3BWU D;  1TS2 A;  2MBE A;  4KIK B;  1ZPS A;  3K9O B;  2FCS A;  4RFB A;  2KHW B;  5IOI A;  2LWP A;  2WDV B;  1X1M A;  3QQ8 B;  2D3G A;  5G5G A;  2C7H A;  1SF0 A;  1XLN A;  3SR6 A;  2PIA A;  1H4R A;  3RD2 A;  3A9J A;  4TSS A;  3JYU A;  1IP9 A;  1NEN B;  2DZK A;  2R61 A;  1L0V B;  3D32 A;  4IWP A;  1WGR A;  2D3A A;  3N1Y C;  2MWS B;  4JIO U;  2LRW A;  4HJG E;  1VCB A;  3R7R A;  4HJK A;  5EE3 A;  1ET9 A;  1L4D B;  1WXA A;  4OVZ A;  2CHW A;  3ONS A;  4J6I A;  3HIZ A;  4FBJ B;  1FXI A;  2J4X A;  2KT7 A;  4ZYN A;  1F9J A;  5HFY A;  2AQ1 B;  4XC2 A;  4BKS A;  4GB9 A;  2GI9 A;  3ZJU A;  3Q8A A;  3ZJT A;  1F2R C;  2L1A A;  2GMI C;  5IN7 A;  2FUG 1;  1RAX A;  2V3S A;  4H2A A;  3X23 A;  2K8B A;  2MJD A;  4XYC A;  2L3Z A;  3NS8 A;  4HPL B;  3Q3O C;  4NAW B;  2ZPN A;  4MEM A;  3TEX A;  3X0W A;  4K81 A;  1BT0 A;  5D6J B;  1ZGU B;  3KVF B;  3DPD A;  3QHT A;  5JXV A;  1ZUD 2;  3I3T B;  4KV2 A;  4EUT A;  4K3C A;  3NUH B;  3AEC B;  3RNF C;  3R7Q A;  4LLG M;  1T6B X;  4YTP B;  2CHZ A;  3MP9 A;  3AE5 B;  2LVQ A;  2AQ3 B;  4RCO A;  1JWB D;  1YN3 A;  1NBF C;  1SJH D;  2JT4 B;  2KFJ A;  1J7B A;  1WJU A;  5DPT A;  2BYE A;  1D5M C;  2NPT B;  4M00 A;  3WAM A;  1UF0 A;  2QMT A;  1TYG B;  1AN8 A;  2LVO A;  2WU5 B;  1EO6 A;  1WJ6 A;  2MA9 B;  1MHX A;  2X38 A;  2DAJ A;  3DBR I;  2ZZP B;  2UU7 A;  1HXY D;  4IUM B;  4M0W B;  2LD9 A;  1XD3 B;  1MFW A;  2QIL A;  1RM6 C;  2GRI A;  3WAL A;  1DGJ A;  1N62 A;  3GS2 A;  2ZNV C;  4WWO A;  1WXQ A;  1NYR A;  2L05 A;  3U4E G;  3BVZ A;  4PT5 A;  2N4F A;  2PMV A;  2AL3 A;  1P98 A;  3HRD D;  3RNG C;  1WXV A;  2HTM E;  3CST A;  1SEB D;  4M8N A;  1RWS A;  1JRU A;  2JUO A;  4ICU A;  1UZX B;  4ITK A;  1YJJ A;  3PVL A;  1P7F A;  2K39 A;  2PLP A;  1JW9 D;  3PLU A;  4M01 A;  4BBN F;  4HXD A;  3HM3 A;  2J52 A;  3ZRC A;  2TSS A;  1R4N I;  2K8H A;  3T8M A;  1UWX A;  2JZP A;  2WDR B;  1BML C;  4ANU A;  2WHI A;  1WZ3 A;  1SGH A;  2DZM A;  3FAH A;  3P2B A;  1R7S A;  2FNJ B;  2N1W A;  2GLS A;  4KGT A;  3O13 A;  2BGF A;  4BAX A;  2BWE S;  1T0R C;  3CIR B;  4HCP B;  4P1C C;  3EFU A;  5AZH A;  2FBW B;  1KJT A;  1ZOY B;  4A20 A;  1GNU A;  2MP2 B;  2WX1 A;  3BIN A;  1UBI A;  2GBN A;  2IJ0 A;  3UIP B;  2MBQ A;  1WE6 A;  2KJH B;  3A9K B;  3RZW C;  3SHQ A;  3P4Q B;  2GBK A;  1IGD A;  3QK0 A;  1V5T A;  1L6U A;  1Y8R C;  2N7E A;  2EEL A;  1V1P A;  3UF8 A;  2DYO A;  2J0K A;  1CZP A;  1UH6 A;  4FXC A;  2JF5 A;  2ZCB A;  1J19 A;  1I4R A;  4P6V F;  2KWU B;  4GIV A;  4MM3 A;  1QT9 A;  3FIL B;  1LO5 D;  1KLG D;  4LDT D;  2KX3 A;  3RPF C;  4WUR A;  5E6J A;  2K6D B;  2LRU A;  2ZW0 A;  2WXG A;  1XCT L;  4G11 A;  2DX5 B;  2RPQ A;  2DYB A;  4IWO A;  2HJ8 A;  3V05 A;  1GC6 A;  1IBX A;  3H7P A;  1VD2 A;  3VR9 B;  1NYQ A;  1P0R A;  1PDX A;  4HCN B;  4MJS B;  2J0M A;  4S17 A;  5J2R A;  1OQQ A;  3L0W B;  2JRI B;  2YEP F;  3AE4 B;  1F0Z A;  3AE8 B;  1HTO A;  1FCC C;  1WGK A;  3DQV A;  3V6C B;  2LGS A;  5D2M B;  2G1E A;  3AEG B;  1CK1 A;  5JZE B;  3KH0 A;  2V1Y A;  1GOZ A;  3MC8 A;  4OZC A;  3AE3 B;  3A4S C;  4IG7 B;  2KWC A;  3L4P A;  1QOA A;  1WY8 A;  1ET6 A;  4PK1 A;  1HZ5 A;  4ZRQ A;  5H8Y E;  3ABV B;  3W1Y A;  3KLS X;  1FNU A;  4YSX B;  1WYG A;  1WM3 A;  2KTF A;  1T0Q C;  2WLB A;  4W9I A;  4N58 A;  4DHJ D;  1IUE A;  3PLV A;  2MJ3 A;  1GB1 A;  5H92 C;  4YWG G;  5CHV C;  4G3X B;  2BT6 A;  2G3Q B;  2LEK A;  5AUK A;  3V61 A;  2G4S A;  1B9R A;  4W9J A;  4M0W A;  4DK5 A;  3L13 A;  4AQ7 A;  2N9X A;  4MH0 E;  3WAP A;  4S0R A;  3AI5 A;  1PGA A;  2JX5 A;  1OEY J;  1UGJ A;  1D3Z A;  4FA6 A;  4GN1 A;  3P63 A;  2BS3 B;  3IAS 1;  4C7Y A;  4F8C B;  4GMV A;  1TKE A;  4URK A;  1WXS A;  1WGD A;  1ZDX A;  2RD0 A;  1RFK A;  4QAY A;  5C1Z A;  3B2F A;  2RDG A;  2KDB A;  3QAQ A;  4KSL C;  4Q2J A;  3VXW A;  1F77 A;  4W9H A;  4MGZ E;  2YVC A;  4II3 B;  1YD8 U;  1WFY A;  4BVU C;  2BKF A;  4J3O D;  3TMP B;  2JSV X;  3BII D;  4BOZ B;  3RT3 B;  1MVK A;  1WR1 A;  2K22 A;  4I6L B;  2KO3 A;  1GAQ B;  2IO2 B;  3H9D A;  2IZV B;  3OWE B;  2OED A;  1T0Y A;  4NQL B;  3LDZ E;  5HI1 A;  3RNE C;  3JSV A;  1K8R B;  3OG5 A;  2WXN A;  4L23 A;  4ANX A;  2LGY A;  2NVU I;  3AV8 A;  2WXQ A;  3P4R B;  1GB4 A;  3GZN I;  2RGF A;  4BKS D;  4HDO A;  2NTS A;  3MHS D;  3OAW A;  1WWT A;  2MP2 A;  5BYQ A;  1BUI C;  3AEF B;  1Z2M A;  2VRR B;  1D5Z C;  3ZNZ B;  3NVW A;  5AZF A;  2RDH A;  2LJI A;  2WDT B;  2MW5 A;  3U8Z A;  3HHM A;  3OJ4 B;  1TBE A;  3RNB C;  2KDE B;  3AH7 A;  1P1A A;  4RMA A;  3B2G A;  4W9E A;  2D2Q A;  4TV3 A;  1HA5 A;  3V62 A;  4E3C A;  1N5X A;  5L95 C;  2HTH A;  2FUH B;  2ZNV B;  4AS1 A;  3NY5 A;  4EZJ A;  1M4V A;  1SIF A;  3PRE A;  2WXI A;  1PQS A;  4WWN A;  3KWL A;  2MRP A;  1QF6 A;  1TY2 A;  2W3S A;  1XO3 A;  2IGH A;  2K25 A;  5HHD G;  1VLB A;  4II2 B;  1MHH E;  3DBL B;  4I6N B;  3RFZ B;  3TEW A;  4KDI C;  3EUB 2;  3SD5 A;  4IM3 A;  2OHF A;  3ZNG C;  3OJ3 A;  4LK0 M;  1KLU D;  4MJS A;  2GB1 A;  2BW2 A;  2XBB C;  2HDE A;  3DWM A;  5EE0 A;  1XXG A;  1I7H A;  3WCQ A;  4YTM B;  4WAF A;  4DBG A;  1AYF A;  1TKY A;  2N9E B;  1ISN A;  1SBB B;  2W9N A;  2KWD A;  2WXM A;  2WXF A;  3PS6 A;  3RNC C;  3AN1 A;  2QC8 A;  3EHV A;  4ARC A;  3Q6B A;  1R4M B;  4KDL B;  2J0J A;  1OGW A;  1EM7 A;  4GDK B;  4LCD E;  2KFK B;  3TL5 A;  3W9C B;  3ZLZ A;  3PHW B;  1JWA D;  2QIE B;  2WS3 B;  2W55 A;  1QOB A;  5HG2 A;  2VZK D;  3EFC A;  1TY0 A;  4FHJ A;  2UYZ B;  3VHT C;  2PJH A;  2KLG A;  3P4P B;  4DWF A;  2NBU A;  2PKO A;  1L4Z B;  3I63 C;  4K7U A;  1EF1 A;  1VR9 A;  1JAL A;  3ZNI D;  1WX9 A;  1XLQ A;  3DVG Y;  1RLF A;  5LNK 1;  1QQR A;  2NMQ A;  4P1B C;  2MCN B;  2O6V B;  3Q2A C;  1J7C A;  3U7D A;  1EUV B;  2G9H D;  4A6Q A;  1ENF A;  2IGD A;  1ZXH A;  2EKI A;  1I4P A;  4F7Z A;  2M0X A;  2KK8 A;  2KLC A;  2V3N A;  3PRZ A;  1QZE A;  5BMI A;  1OTR B;  4P7I A;  1FEH A;  3ZTC A;  3IXS A;  5CX3 A;  4W9F A;  2XK5 A;  4XGA B;  4CHK A;  4YT0 B;  1GG3 A;  3MC0 B;  4IM2 A;  1P3Q U;  1JWM D;  3GB1 A;  3DOW A;  2V4L A;  1I4Q A;  1D4B A;  2KTR A;  2KVR A;  1WMH A;  2SEB D;  4C7Z A;  3Q8E A;  1OQR A;  5C2T B;  3PGE A;  2SAK A;  1C4C A;  3ALB A;  1AW7 A;  1DOI A;  1KM7 A;  2JPH A;  3MHZ A;  4OZB A;  4FLH A;  2KDF B;  1JRO A;  4KGS A;  2VH1 A;  4KVG B;  3RN9 C;  2KAJ A;  4GOC A;  3W1S C;  1CMX B;  3NVZ A;  2V9H A;  2KQ4 X;  1UEL A;  1V9J A;  5EDS A;  2K6Q A;  3R3M A;  4DXF A;  4O1N A;  2B3A A;  2KDI A;  2OJW A;  2WXJ A;  1KF6 B;  1U4A A;  2AL6 A;  3NHE B;  4JE3 B;  2CHX A;  4L1B A;  2D07 B;  1RRB A;  4WJO A;  1YN4 A;  4MAC A;  3NVV A;  2ON8 A;  4FUL A;  3TEZ A;  4WIP A;  4CYE A;  5G55 A;  1C4P A;  1E8Z A;  1E90 A;  3VRA B;  1I4X A;  3VVW B;  1D6E C;  5KHQ A;  1XQQ A;  4XX5 A;  2A5U A;  4EE2 A;  2ZVO A;  3VUW A;  3ML8 A;  1YOV B;  1FD6 A;  2M0A A;  1E0Z A;  1C4A A;  3DBS A;  4JGH B;  2PPH A;  4FJY A;  3GOE A;  1I42 A;  2JRH A;  5IAA C;  1FMA D;  5I4D A;  3H6N A;  5LXI B;  3WAN A;  3A1Q A;  1MI0 A;  5T8I A;  4AJY B;  3QIJ A;  2KOX A;  2K9X A;  2N9P C;  4OZA A;  1JWS D;  2LHE A;  3DVN V;  3ML9 A;  2KWV B;  3KUC B;  4US9 A;  3LB8 C;  3H7S A;  2D3C A;  5E6N A;  4B6W A;  3FC4 A;  4RGT A;  3EGR A;  2DZI A;  2RR9 A;  4JLC A;  4YL8 A;  4K1R B;  1SSN A;  2WXK A;  1MJD A;  4PS3 A;  3IT6 B;  4DXG A;  2GBJ A;  4MDK E;  1FM0 D;  3IHP C;  1TJE A;  1P7E A;  2FAZ A;  2LVP A;  2I1J A;  2MQJ A;  1PYW D;  1WJN A;  3H8H A;  4NZL B;  4FJV B;  1QLB B;  2BYV E;  2DBY A;  2O6V A;  2O2V A;  4RF1 A;  4HRS A;  3ZYY X;  3QCA A;  2Z0E B;  4RH6 A;  1G6J A;  3ETR A;  3H1U A;  1F1H A;  2I38 A;  4PS7 A;  1K53 A;  2JXX A;  3KYD D;  5BMG A;  2BPS A;  4NJ6 A;  4KIK A;  3IFW B;  3KQ4 A;  1ZW7 A;  4FN2 A;  4FJZ A;  1EU3 A;  3Q8F A;  4OVV A;  5D3D A;  4DQO C;  1E5W A;  2LI5 A;  3A33 B;  4XWW A;  1WIA A;  2RDB C;  2G45 B;  4M8M A;  2BS4 B;  3AE9 B;  3VTU A;  1IPG A;  1XF5 L;  2LFI A;  3TJP A;  1DYQ A;  2Z0D B;  2LUE A;  1K50 A;  1ZE3 D;  4XZ4 A;  4GDL B;  3R2T A;  2FCQ A;  4W9D A;  3QAR A;  2NS5 A;  3VRB B;  5D94 A;  4LJO B;  1N6Z A;  2FCN A;  4IKG A;  4NY0 A;  2H89 B;  1PGX A;  3E9S A;  4RNA A;  2C60 A;  2C5L C;  1UBQ A;  1I4H A;  2JU6 X;  3PHX B;  2IDY A;  2Y5P A;  1WZ0 A;  5AUI A;  4DDI D;  3NJT A;  3VQI A;  4EOY A;  1ZKH A;  3VFK A;  1V49 A;  2INP E;  1JQ4 A;  4GLS C;  2JQR B;  2ZW1 A;  3R2I A;  2XN9 C;  4OVU A;  4NAW A;  2CR5 A;  1JRP A;  2Q5W D;  2WU2 B;  3CSF A;  4ZRJ A;  1WXM A;  5BYS A;  1NVI D;  3TSS A;  3ZDT A;  3OLM D;  3NG0 A;  2QCZ A; 
#chains in the Genus database with same CATH homology
 4HRO A;  1SIJ A;  3AH7 A;  4B0E A;  3ZGZ A;  2IGG A;  3B2G A;  1KFY B;  4TQ0 A;  1ZPS A;  3SFD B;  1HA5 A;  3BZD B;  4RFB A;  1N5X A;  1YN5 A;  1STE A;  3AE6 B;  1NI3 A;  3J9C A;  3BVG A;  3P42 A;  2WDV B;  4WWM A;  1VDV A;  4AS1 A;  1SB3 C;  5G5G A;  1SF0 A;  4A9A A;  1XLN A;  3SR6 A;  4IOI E;  3BWU D;  1EWY C;  2PIA A;  1M4V A;  4N59 A;  3TUO A;  4TSS A;  1JWU D;  2WXI A;  2AQ2 B;  2LGI A;  3KWL A;  2WNM A;  1QF6 A;  2QSD A;  1TY2 A;  1NEN B;  2W3S A;  4OW0 A;  1XO3 A;  2JYE A;  2IGH A;  2R61 A;  5HHD G;  1VLB A;  1L0V B;  3AE7 B;  1MHH E;  2K3U A;  3RFZ B;  1SXT A;  3TEW A;  2V3P A;  2MJE A;  3EUB 2;  2OHF A;  4LK0 M;  4HJG E;  1KLU D;  2GB1 A;  2BW2 A;  2ONQ A;  5EE3 A;  1ET9 A;  1L4D B;  4OHJ A;  4OVZ A;  2HDE A;  3DWM A;  1CJE A;  5EE0 A;  1XXG A;  1I7H A;  3WCQ A;  4YTM B;  4WAF A;  1AYF A;  1FXI A;  1TS3 A;  1TKY A;  2J4X A;  4KKI A;  1SBB B;  5HFY A;  2WXR A;  2AQ1 B;  1C79 A;  2N9K A;  2KWD A;  2WXM A;  1ZDV A;  3HVD A;  2GI9 A;  2WXF A;  3ZJU A;  2KN4 A;  3Q8A A;  1FFU A;  3AN1 A;  3LYY A;  1E9M A;  3ZJT A;  1F2R C;  4ARC A;  1K52 A;  4HKQ A;  2H88 B;  2L1A A;  4WH4 A;  4B0M A;  5G5H A;  2FUG 1;  3Q69 A;  1EM7 A;  4GDK B;  1AWD A;  1B1Z A;  3MFG A;  4TQ1 A;  3W9C B;  1YQ4 B;  4KKJ A;  1JWA D;  3NRZ A;  4H2A A;  2QIE B;  1VJK A;  2WS3 B;  4REZ A;  2DYM A;  2W55 A;  1QOB A;  1ZP0 B;  4XDD A;  1SJE D;  2MJD A;  5HG2 A;  2RMM A;  4NAW B;  5D3I B;  1YJI A;  2VZK D;  3TEX A;  1V97 A;  1JCK B;  1TY0 A;  3U2S C;  3NVY A;  1PGB A;  2QEJ C;  3P4P B;  4ZHO A;  2PKO A;  5JXV A;  1L4Z B;  1ZUD 2;  1QIL A;  3KWV A;  1VR9 A;  1JAL A;  3BK1 A;  1N60 A;  1XLQ A;  3NUH B;  3AEC B;  3P4S B;  1QQR A;  5LNK 1;  3HUI A;  1T6B X;  4LLG M;  2NMQ A;  1FRD A;  2DLB A;  1C76 A;  4YTP B;  3MP9 A;  4KX6 B;  3AE5 B;  1J7C A;  2DWQ A;  2AQ3 B;  4RCO A;  1JWB D;  1YN3 A;  2PVG C;  2E3T A;  1SJH D;  2G9H D;  3URY A;  4A6Q A;  4ZYS A;  1J7B A;  1ENF A;  2IGD A;  1ZXH A;  2EKI A;  1I4P A;  1N61 A;  1D5M C;  3GP7 A;  2K0P A;  2V3N A;  3E56 A;  5BMI A;  1TZO A;  1FEH A;  2QMT A;  3IXS A;  4LTU A;  2BTE A;  1TYG B;  1SE4 A;  1AN8 A;  2WU5 B;  4YT0 B;  1E6E B;  1KRH A;  1MHX A;  2M56 B;  3MC0 B;  1FFV A;  2X38 A;  1JWM D;  1Y56 A;  1FNV A;  1J7A A;  3GB1 A;  3UI3 A;  1HXY D;  4JWS C;  1I4Q A;  1SE3 A;  5EE9 A;  1YMH E;  2RPV A;  1D4B A;  2QIL A;  2L83 A;  3AEE B;  5D7G A;  1RM6 C;  2GRI A;  2INN E;  1DGJ A;  1N62 A;  2ACZ B;  4XDC A;  3GS2 A;  3W2D A;  2SEB D;  4C7Z A;  3ZQ4 A;  1FXA A;  1WSP A;  1NYR A;  1WXQ A;  1L0Y B;  1OQR A;  2YEP B;  3Q8E A;  1E10 A;  3R8B A;  3U4E G;  5C2T B;  3FIL A;  3BVZ A;  4PT5 A;  3W5U B;  2PMV A;  1C4C A;  2SAK A;  1AW7 A;  2AX5 A;  1DOI A;  3HRD D;  1YNT E;  3MHZ A;  3SEB A;  1VZ7 A;  1FRR A;  4OZB A;  4XE0 A;  1L6V A;  1A70 A;  1CQV A;  1JRO A;  2WXL A;  4KGS A;  1L0X B;  2KAJ A;  1HEZ E;  2HTM E;  2N9L A;  1VZ8 A;  1UWM A;  3NVZ A;  1SEB D;  1RWS A;  2KQ4 X;  2BB5 A;  2L52 A;  4ITK A;  1YJJ A;  1FIQ A;  1P7F A;  4O1N A;  4DXF A;  2PLP A;  1JW9 D;  4IDI A;  3IT4 B;  3I9V 1;  3CWI A;  2WXJ A;  1KF6 B;  4ZOH C;  2ICI A;  2J52 A;  3C8Y A;  2W82 A;  2TSS A;  4JE3 B;  4L1B A;  1UWX A;  2JZP A;  1XLP A;  2IPK D;  2WDR B;  1BML C;  4KGR A;  5FK9 C;  1D5X C;  1YN4 A;  4MAC A;  3NVV A;  2ON8 A;  2MEK A;  3TEZ A;  4WIP A;  4WQM A;  3B9J A;  3FAH A;  3IAM 1;  1C4P A;  4L2Y A;  1R7S A;  4KGT A;  3O13 A;  3NZ3 A;  3CIR B;  2PTL A;  3VRA B;  1I4X A;  4C56 C;  1TKG A;  3AEB B;  2FBW B;  3AB5 A;  4CQN A;  1ZOY B;  3BVM A;  1TS4 A;  1D6E C;  1PUT A;  2KAC A;  2FE8 A;  4MH8 A;  4EE2 A;  4HEA 1;  2Y3A A;  4RGM A;  1C77 A;  1QOG A;  1FD6 A;  1KTK A;  2IJ0 A;  4UDU C;  3W1S A;  2M0A A;  1E0Z A;  3BYT B;  3MJ5 A;  1C4A A;  3P4Q B;  1IGD A;  1L6U A;  3NS1 A;  2CU3 A;  2L32 A;  1E7P B;  2WDQ B;  1XCQ L;  3V3X A;  4YTN B;  2EEL A;  1V1P A;  4NJC A;  3LXF A;  2DYO A;  4RGO S;  1FMA D;  1UUP A;  4XWT A;  3AEA B;  5I4D A;  1CZP A;  2KDM A;  3BYY B;  1C9F A;  2M19 A;  1MI0 A;  4FXC A;  2E6X A;  1FO4 A;  3SFE B;  3AE1 B;  1VZ6 A;  5T8I A;  1I4R A;  4P6V F;  5TSS A;  2K9X A;  5BYR A;  4OZA A;  3P1M A;  1JWS D;  3EA6 A;  1XLO A;  1QT9 A;  1NEK B;  3FIL B;  2LHE A;  1LO5 D;  1KLG D;  1FCL A;  1QOF A;  2WQY B;  3RPF C;  4WUR A;  2Y5C A;  5E6J A;  2ZW0 A;  2WXG A;  1XCT L;  4US9 A;  4HKZ E;  4USA A;  3LB8 C;  1N5W A;  4ZHP A;  1BXT A;  2VZK B;  4TMA B;  2Z8L A;  3V05 A;  5BMH A;  1ZXI A;  3FC4 A;  4RGT A;  3EGR A;  2JXT A;  2LMC A;  5GXG B;  1IBX A;  3VR9 B;  1NYQ A;  1HZ6 A;  1PDX A;  1K51 A;  3TEY A;  2B76 B;  1DOY A;  1OQQ A;  1SSN A;  2PVO D;  1SE2 A;  2NTT A;  2WXK A;  3T3O A;  2YEP F;  3AE4 B;  1OFF A;  2J53 A;  3IT6 B;  5FR3 A;  3AE8 B;  4DXG A;  1V1O A;  1F0Z A;  1FM0 D;  1FCC C;  1P7E A;  1TJE A;  2JWU A;  1WGK A;  1QKZ A;  1VRA B;  4YSY B;  2QJL A;  1C78 A;  3AM9 A;  3PZ7 A;  4ARI A;  2G1E A;  1N63 A;  1CK1 A;  2BBC A;  1PYW D;  1EWC A;  3AEG B;  4JX1 C;  1GOZ A;  4OZC A;  3AE3 B;  1XEE A;  1EU4 A;  3H8H A;  4NZL B;  3L4P A;  1QOA A;  1ET6 A;  1FNW A;  1QLB B;  1HZ5 A;  2DBY A;  4ZRQ A;  5H8Y E;  4RF1 A;  3ABV B;  4HRS A;  4N6E B;  3ZYY X;  1GPX A;  3KLS X;  1WRI A;  1YQ3 B;  1FNU A;  4RH6 A;  4YSX B;  1WYG A;  2WXH A;  2CJO A;  5MPO A;  1Q10 A;  3U52 E;  2WLB A;  3ETR A;  4N58 A;  1IUE A;  2KMM A;  2LHD A;  2I38 A;  2MJ3 A;  1K53 A;  1GB1 A;  5H92 C;  3AMZ A;  4YWG G;  2W3R A;  2BT6 A;  3VR8 B;  5BMG A;  1MPE A;  2LEK A;  5AUK A;  1B9R A;  4YXD B;  1PFD A;  3KQ4 A;  4M0W A;  3T3N A;  4AQ7 A;  1T5X D;  1ACC A;  3PO0 A;  1EU3 A;  3Q8F A;  4RGN A;  1V1P B;  1PGA A;  2V0G A;  2JX5 A;  1UGJ A;  4D2K A;  1HQR D;  3P63 A;  2BS3 B;  2PW9 A;  3IAS 1;  4US8 A;  1TS5 A;  4JWU C;  5D3D A;  2W54 A;  4C7Y A;  4DQO C;  2D5G A;  1T3Q A;  1TKE A;  4XWW A;  1I4G A;  2K5P A;  4P16 A;  2BB6 A;  1ZDX A;  4MM3 B;  1RFK A;  1IGC A;  2N7J A;  1V8C A;  2BS4 B;  3AE9 B;  3B2F A;  1XF5 L;  2LFI A;  2RDG A;  3Q8C A;  2WP9 B;  1DYQ A;  3HVZ A;  3ZJV A;  1K50 A;  1DOX A;  1ZE3 D;  3I57 A;  4Q2J A;  5C3J B;  1F77 A;  4GDL B;  3R2T A;  3N9Y C;  1ROE A;  3VRB B;  4J3O D;  3AED B;  2JSV X;  1IBX B;  3BII D;  4R3D A;  3U7Z A;  4IKG A;  1MVK A;  2K22 A;  2H89 B;  1RYJ A;  1GAQ B;  4A90 A;  1PGX A;  3E9S A;  2J42 A;  4RNA A;  3OWE B;  4A55 A;  2V4I B;  2OED A;  1I4H A;  2JU6 X;  2I2Y A;  4MT5 A;  4YSZ B;  2IDY A;  2Y5P A;  3Q8B A;  1JML A;  5HI1 A;  5AUI A;  3W5V B;  2BYT A;  2WXN A;  4L23 A;  1L5P A;  5FKA C;  2LUM A;  4RF0 A;  3AV8 A;  3VQI A;  2WXQ A;  3P4R B;  1KH0 A;  2N0S B;  1GB4 A;  2WXP A;  3PZ8 A;  1F2R I;  3AE2 B;  2INP E;  1JQ4 A;  2NTS A;  4GLS C;  4ZRP A;  1WWT A;  2JQR B;  5EE1 A;  2ZW1 A;  5BYQ A;  1BUI C;  4C80 A;  3AEF B;  3R2I A;  2BS2 B;  2XN9 C;  4A8X C;  3DWG C;  2JYT A;  1D5Z C;  1JRP A;  3NVW A;  2Q5W D;  2WU2 B;  2CJN A;  2RDH A;  5BYS A;  1UNS A;  2LJI A;  1NVI D;  2MH7 A;  3BK2 A;  2WXO A;  3TSS A;  1ESF A;  4JPS A;  2XNA C;  4NAM A;  1TS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...