5H8YE

Crystal structure of the complex between maize sulfite reductase and ferredoxin in the form-2 crystal
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite reductase [ferredoxin], chloroplastic
publication title Structural and mutational studies of an electron transfer complex of maize sulfite reductase and ferredoxin.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase/electron transport
total genus 22
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5h8yE00
4YTMB 5G5HA 2K22A 5EE0A 1YJJA 2PVOD 4YSYB 3EUB2 3SFEB 2KMMA 5MPOA 2G1EA 2WDRB 1N5WA 1QLBB 3W5UB 4N6EB 1FFUA 1TKGA 1DOIA 1JW9D 3SFDB 4IDIA 1QOGA 1XLNA 1N62A 2MJ3A 1DOXA 1JQ4A 1CZPA 1QT9A 2M56B 2W3RA 2Y5CA 3AE2B 3HVZA 3AE6B 4FXCA 4N59A 4US9A 3VR9B 1ZUD2 2H88B 3AEDB 3W9CB 4ZHOA 1NYQA 2WP9B 3KWLA 1WYGA 5G5GA 3NVVA 1V97A 3VRAB 2PKOA 1XLPA 1T3QA 4JWUC 5AUKA 1J7AA 3P4SB 1ZP0B 2JQRB 1E9MA 3ETRA 3HUIA 3P4RB 1KRHA 4JWSC 2WS3B 1FMAD 2CJNA 2MJDA 1AWDA 3P1MA 5C3JB 1GPXA 1V8CA 3AEBB 1UWMA 1ZOYB 1WRIA 2WU5B 3AE5B 3B2FA 4P6VF 2L83A 3ABVB 1SIJA 4YXDB 4C7ZA 3WCQA 2W3SA 3NS1A 1XO3A 1E7PB 3W5VB 1E0ZA 1KF6B 2OHFA 2K9XA 3FAHA 3NVWA 1XLQA 3CIRB 3AEFB 1N60A 3AEGB 2LEKA 5C2TB 1N5XA 1L0VB 1RM6C 1WWTA 1QOFA 1NI3A 2BS3B 4A9AA 4KX6B 1CJEA 2Q5WD 1A70A 3CWIA 1SF0A 1JRPA 3AEEB 5H92C 1ROEA 3B9JA 4ITKA 1J7BA 1RWSA 4WWMA 5AUIA 1QOBA 1FIQA 1WXQA 3NRZA 2BT6A 3AE7B 3AE3B 1YQ4B 2WDQB 1WGKA 4HRSA 1R7SA 2FBWB 2PIAA 2WQYB 1VJKA 3AV8A 3AE8B 1TKYA 4JX1C 4WQMA 1NVID 4YTNB 3P4QB 3ZYYX 3AM9A 4LTUA 1SB3C 1FRDA 1L6VA 3AMZA 4HROA 2B76B 2KAJA 1KFYB 3FC4A 3NVYA 3P4PB 1EWYC 3PO0A 2E3TA 1YQ3B 2HTME 3LB8C 1XLOA 2L52A 2ACZB 4C80A 4N58A 4USAA 4YSZB 1IUEA 4YT0B 3AEAB 3RPFC 1DOYA 1NYRA 2CU3A 3AE1B 1VDVA 2WU2B 1QOAA 1TJEA 2BS2B 1E10A 2BS4B 1I7HA 2DWQA 2MH7A 1RYJA 3HRDD 1L5PA 3P63A 5EE9A 3AN1A 1FXAA 4ZOHC 1NENB 1JWAD 2EKIA 1FM0D 2WLBA 3LXFA 2H89B 3VR8B 4YSXB 1YJIA 1L6UA 4US8A 4C7YA 2QJLA 2AX5A 1RFKA 1TYGB 1AYFA 3NVZA 1FFVA 1OQQA 1JWBD 1OQRA 5GXGB 1F0ZA 3DWGC 1PUTA 2W55A 3DWMA 2QIEB 4YTPB 1OFFA 3BIID 5EE1A 2PVGC 4ZHPA 2K5PA 1FXIA 3L4PA 2MJEA 1FO4A 1TKEA 3SR6A 3AB5A 2W54A 3VRBB 2WDVB 1N61A 3B2GA 1PFDA 1N63A 1E6EB 1JROA 2CJOA 2DBYA 1FRRA 1JALA 3AECB 3AE4B 1GAQB 1NEKB 1VLBA 2N0SB 1QF6A 5EE3A 3AE9B 1DGJA 5H8YE 3AH7A 1B9RA 2JX5A 1PDXA 2M19A 1ZXIA 1J7CA
chains in the Genus database with same CATH superfamily
1SJHD 2WNMA 1FXTB 3L0WB 3V6CB 3SFEB 5JHAA 5I4DA 2DZKA 4WQOB 1TKGA 1QOGA 2KQ4X 3Q8CA 4R3DA 2INDC 2BB5A 1BMLC 1ZW7A 4ZHOA 2WX1A 3NZSA 2ICIA 4BBNF 1TS2A 3P4SB 2D11A 4E71A 3HUIA 3IAM1 5E6JA 2MCNB 1TT5B 3I5JC 3UIPB 4JL9A 3QQ8B 2WXIA 1SIJA 3V3XA 2W3SA 5JZEB 1E7PB 3NZ3A 2FCNA 4CHKA 3FAHA 4ZRQA 3KUZA 1IGCA 3EFUA 4KX6B 5E6NA 1TGZB 1XEEA 1RWSA 3NRZA 3R8BA 4EOYA 2K1FA 1P3QU 4MM3A 3KW5B 4FJZA 1VJKA 3AE8B 1WSPA 2C7HA 4ANVA 3AMZA 1L6VA 4WJPA 1WGRA 1Y8RC 1ENFA 1XLOA 1C4CA 1HTQA 3V6EB 1WX7A 2LXAA 3AE1B 3EFCA 2JSVX 1SIFA 2AEHA 3RNCC 4P1BC 4TKNA 1SGHA 4M8MA 4I6NB 3H1UA 4HVBA 1JWBD 2N1WA 2W55A 2HE7A 3DHIC 1BXTA 1SXTA 2PW9A 4ANUA 2NPTA 2L76A 3PV1A 3VTUA 2ZPYA 2W54A 3HM3A 4M0WB 2RDGA 3DVNU 2BVCA 1C76A 3HM6X 3U7ZA 4MEMA 5H8YE 1FCCC 3C8YA 2KK8A 1J7CA 2G4SA 3O65B 2HJ8A 4A3PA 2WXOA 2KN4A 5HG2A 5C1ZA 1OEYA 2KHWB 3NJTA 3M95A 1I4RA 3JYUA 1LFDA 3PRPB 3W9CB 4W9LA 4IM0A 4TV3A 3KWLA 2L1AA 2LVQA 1XLPA 4CQNA 3MHSD 3RNEC 3MC9A 3L54A 2LJ5A 3PZ8A 3ZNHB 2FIDA 3P1MA 1WRDB 5C3JB 2CS4A 2KWDA 2LGSA 4EZKA 3VH3B 2Z0EB 2KTFA 3IFWB 2O6VB 3ZTDA 4YXDB 3Q8EA 1C79A 1UELA 4DHZE 2LXCA 4PS8A 5D3IB 4GDKA 4KZ0A 1WR1A 4RGTA 1F2RC 2KFKA 2DYBA 2RPVA 1I4GA 3DBSA 5JXVA 3R3MA 4YWGG 2J0MA 4IW0A 2YEPB 3I3TB 1WGKA 5AZHA 4LNIA 2PIAA 4F8CB 2IGHA 5LXHA 5DCNA 1SSNA 2XK5A 4LLGM 2R2OA 3N32A 4PYZA 1R4MI 3ENEA 1T0YA 3AEAB 5AZGA 2CU3A 2ZNVC 1BT0A 5FKAC 1FXAA 4ZOHC 1T0SC 2DENB 1L6UA 2GLSA 2QJLA 2LASA 2N4FA 1RFKA 3TL5A 1E8YA 4XGAB 2QSDA 1KLUD 1MG8A 4OW0A 4K7WA 4FADA 5L95C 1WE6A 2LFIA 1IPGA 3ZRFA 4P1CC 2K6DB 2M19A 1L4DB 1OTRB 4GXBA 1UBQA 2IGDA 4DDGD 4CYEA 1HA5A 1VCBA 2LHEA 4F1SA 5J18A 1VD2A 4GIVA 2Y5CA 1YN3A 3VR9B 1XQQA 3PREA 3VFKA 3MHZA 2H88B 2GBRA 3PLUA 3EC8A 5HHDG 5DPWA 2JWZA 4GMVA 2IYDB 2KN5A 4IUMB 2D3CA 1WJUA 3Q6BA 2OHFA 1D5MC 1FEHA 3AEFB 2CHXA 2OOBB 1NI3A 3AULA 1QKZA 3CWIA 1SF0A 1NBFC 4MGZE 2DX5B 3OJ4B 4LNNA 4FA6A 2FBWB 1YNTE 3VAWA 2LUEA 4FULA 4MJSB 1WJ6A 1KJTA 4K81A 5TR5A 1GNUA 4MSMB 3LB8C 3IVFA 3E9SA 2FIFA 4F7ZA 2BPSA 1VDVA 1E7UA 2CHZA 1E10A 3Q3MC 1RYJA 3GE3C 5EE9A 2JZZA 1NI2A 2JRHA 3H9DA 2KTRB 3VUWA 2W9NA 4BFRA 2WXJA 4JPSA 3IG3A 3BK1A 1FFVA 2DYMA 2O6VD 3PLVA 3DWMA 2KACA 1OFFA 4W9GA 4TQ0A 1ESFA 1E5WA 2VH1A 1L4ZB 1N61A 3B2GA 3B0AA 2ZCBA 2D3AA 1P9DU 1VLBA 3QK0A 1B9RA 1PDXA 4RFBA 2INCC 3OLMD 2OEDA 3APFA 1YN5A 1HXYD 4OZAA 2WDTB 2C9WB 1RFAA 1VRAB 2RDHA 3W5UB 4BAXA 2DZJA 1CK1A 2FE8A 3VXWA 2LZ6A 4FXCA 2IO3B 5D94A 2XN9C 4RGMA 3R2IA 1ET9A 3GZNI 3H6NA 1ZP0B 1TY2A 5IAAC 4KKJA 2WXFA 1IBXA 5BYRA 4GLSC 1CQVA 4MELA 3AEGB 1WWTA 3Q3OC 1M94A 4FHKA 4FBJB 3Q3JA 4P7IA 5H92C 4MDKE 2CKHB 1YQ4B 3DPDA 3Q14C 1HZ6A 3D32A 4JGHB 1C77A 4RCOA 1BUIC 1P98A 4JX1C 1F77A 4PT5A 2DNFA 4AQ7A 3NVYA 4USAA 4YSZB 3JSVB 3CMMB 1YX5B 3A9JA 2DWQA 4LNKA 3L13A 2EKIA 4BBNC 2M4NA 1WJ4A 2V1YA 2Y5BB 2QIEB 3RZFA 2KVRA 3RUIB 3QAQA 3RMKC 4GN1A 2MP2A 4OVVA 4DHJB 1E8XA 2DBYA 4LJOB 3BVGA 4AJYB 3AE9B 2NMQA 4XZ4A 1GOZA 4P16A 3R7RA 3M63B 1JCKB 1WGHA 4WJQA 1K8RB 5AEKB 3DBRB 3WA0A 1E8ZA 2G4DB 2O2VB 3P4RB 1Q10A 4KSLC 3L17A 1V8CA 4WURA 2N9LA 2GBNA 1L2NA 3Q2AC 4C7ZA 1C1YB 2DAFA 5HKHA 4MACA 1RM6C 1U4AA 1PGBA 1Z5SB 3OJ3A 3V60A 1LM8B 2HJ1A 2PLPA 2ZNVB 1JRPA 3DDCB 3N1XC 1J7BA 4N9F4 4B0EA 4DQOC 2N7DA 4K7SA 3PVLA 3N1YC 4KZCA 1KOTA 1MJDA 1VZ7A 1P7EA 2GB1A 2RSUA 1EF5A 1FRDA 2JRIB 4S0RA 4AP4C 1TIFA 2HTME 1K51A 3DVNV 3U52E 4YT0B 1MG4A 3U4EG 1GB1A 3LXFA 2ZW0A 3QX1A 4PYUA 1ZXHA 2KDFB 2AWTA 3BYYB 3BIID 4ANWA 4WIPA 4KIKA 2K5PA 4B0MA 4DXAB 4K1RB 3I9V1 3AB5A 3NY5A 2WXMA 3VRBB 4KGTA 1L7YA 2L0TA 4IM3A 1V80A 2ZVOA 4TQ1A 4G3XB 3SEBA 5LXIB 2J52A 2A4ZA 2VRRB 2KDBA 3AXCA 1VZ8A 2KC1A 2WDRB 1J19A 1J0GA 1G6JA 4HDQA 2C60A 4N6EB 3MP9A 1TS4A 2IZVB 3HK0A 1XLNA 3IT6B 1T5XD 3Q8AA 1CZPA 1GC6A 1WX8A 2C5LC 3HHMA 2WXLA 3KLSX 2GBMA 3KH0A 2MSED 1J7AA 2JYEA 2Y3AA 1KTKA 1ZGUB 4W9HA 3H7PB 4MSQB 1AWDA 3KWVA 3Q8BA 4HPPA 4C4VB 3ZVVA 3B2FA 4FJYA 4HKZE 2ON8A 1WJNA 3TSSA 4NAWB 3RI7C 1V86A 4EEWA 2EELA 2N9KA 1CJEA 2GRIA 4DHJD 2R2QA 4HK2A 3H8HA 1YX6B 2V9HA 2DZIA 3EA6A 3Q8FA 4RF1A 1FCLA 4JE3B 4IWOA 4ICVA 3PO0A 2K8HA 3N3KB 2KX0A 4HCNB 4G50A 3RPFC 1NYRA 4HCPB 4D2KA 1D6EC 2TSSA 3HRDD 5T8IA 3TCAA 1NENB 1FM0D 3Q3FA 2L0FA 3VTWA 2BYVE 3Q69A 2ZW1A 2RMMA 4IC7B 4M00A 2BTEA 1SBBB 4YTPB 5LNK1 4OZCA 4L1BA 3L4PA 1TKEA 4LCDE 4XE0A 2M17A 4IWPA 3AECB 1SE3A 3QCAA 2ZCCA 2WXKA 4KDIC 2RR9A 4KDLB 1RRBA 1DOIA 1VZ6A 4G11A 3CSTA 1C78A 3PPAA 1Z2MA 1E90A 5FR3A 4E3CA 2KNBA 5AUKA 1XF5L 2PPHA 2FAZA 2RDBC 3VH4B 2GMIC 2V4LA 1Q0WB 3N9YC 4W9CA 4MGKE 1EM7A 3A9KB 3R7QA 4DXFA 5CHFA 1GC7A 1XO3A 2BYEA 1YIWA 3SDLC 4FHJA 3B1LX 5TSSA 3Q3NC 1L0VB 2KDEB 1WMHB 2N1VA 2JZPA 3PT2B 4XWTA 3VUYA 4WWMA 1TS3A 2BWFA 2V3PA 1UF0A 4I6PA 4WQMA 1NVID 1I35A 5IP4D 3QHTA 4BZAA 2I38A 3RFZB 4TMAB 2X38A 1YD8U 4N58A 2QDFA 3A1QA 2MHJA 3BYTB 3BINA 1P0RA 4TSSA 2DLBA 4OHJA 5D6JB 4PS7A 4J6IA 2C7MB 1R4MB 3NHEB 2AX5A 3A4RA 2Z0DB 3FILB 3SHQA 1PUTA 2PMVA 4NJ7A 2WXGA 4B95A 3U2SC 4ARCA 1TY0A 1HZ5A 2WYQA 1NEKB 5KHOA 3A4SC 1MVKA 3URYA 1WIAA 3PTFC 3WANA 4RGNA 4GB9A 1YQBA 4IWQA 1ZDXA 4OZBA 5BMGA 2JF5A 3ZGZA 1N62A 1QT9A 3ZJTA 2J7QB 3AEDB 4FJVB 1UNSA 4RM8A 2HD5B 1HQRD 4A3OA 4HXDA 3DBLB 4W9KA 2M8SA 4RF0A 1F9JA 2JQRB 2QILA 1S1QB 2WXPA 2D07B 4ZRKA 1S3SG 3U30A 1KRHA 4E74A 3VUXA 1ZOYB 4HKQA 1V1PB 3WCQA 1PGAA 1FNWA 2WXHA 4Q2JA 5GMVA 1TBEA 2LEKA 2BS3B 4A9AA 2WX0A 3RYTA 1ROEA 3ZDTA 4WWNA 4W9DA 2J0KA 1TZ1A 1V5OA 1WXVA 2KZRA 1WGGA 4JLCA 1KLVA 2KVZA 2INPE 3PZ7A 1IGDA 2LGYA 4HJGE 1SB3C 2MLBA 5G55A 4DDID 5HI1A 4LNFA 5FK9C 2L52A 3A33B 3DVGX 2LGIA 4JQWC 2GBJA 4KGSA 4KV2A 1L5PA 1JWAD 2H89B 1YJIA 5C23A 3WAOA 3QA8A 2NVUI 1XD3B 3QIJA 1CMXB 3NVZA 1F0ZA 1D5XC 1H8CA 2V3NA 2KMCA 2LI5A 3W1SA 3PRZA 5D2MB 2NR2A 2V0GA 3NUHB 2KJRA 1N63A 2W82A 2N7EA 3FKYA 1JALA 1FNVA 4DBGA 3BVZA 3AH7A 3N30A 1XCQL 2PVOD 4NQKE 2LGDA 4HEA1 2VH2A 3C0RB 4WWPA 3SFDB 4IDIA 1A5RA 2M0AA 3O13A 1XXGA 1V6EA 2MRPA 2W3RA 1PYWD 4NJ6A 5LLIA 4IG7B 3NVVA 5DPSA 1KH0A 2PKOA 4UDUC 3WAPA 4URKA 3TIXA 4XX5A 5HFYA 1PGXA 2WS3B 1FMAD 1KM7A 4G0NB 4NJCA 2NBWB 1ACCA 3RNAC 3E56A 1WRIA 1AN8A 2BKRB 3AE5B 2L83A 3GZNB 4EE2A 2K39A 1LGRA 2BYFA 2G45B 2MBBB 2MA9B 3ZXVA 1N60A 4L2YA 3QJZA 1D5ZC 1WF9A 3L16A 4KSKC 4X57B 3OWEB 2ZJDA 4ITKA 1I4PA 1WZ0A 5D3DA 2A5UA 4EUTA 3DVGY 5FR6A 4S17A 1HTOA 3AU4A 3I63C 1R7SA 1P7FA 4OVUA 2L05A 3DHHC 2EMTA 3P4QB 4RMAA 2FUG1 2LVPA 4LTUA 1RLFA 3LJ3A 2B76B 3T3OA 4M0WA 2UYZB 2KDIA 3KUCB 1QOAA 2MH7A 4XYCA 3MTNB 2N9PC 2JZ3B 4YSXB 3DBHI 4A6QA 1AARA 1WM2A 4BOSC 4MM3B 3IXSA 4XC2A 3APDA 3DCGA 2L8JA 3ZJVA 4ACFA 1LXDA 3PHXB 2ZZPB 3C19A 1JROA 2CU1A 2CJOA 1FRRA 2MBOA 3RT3B 3RNFC 2RPQA 4RM9A 1GG3A 3VDZA 2JUOA 2O6VA 1V9JA 1YJJA 4M01A 4A90A 3GB1A 3RNGC 4XDDA 3TEXA 1WXSA 4N59A 4BKSD 4REZA 4AJWA 3CSFA 3T9LA 4C56C 1F52A 1T3QA 2SEBD 2JWUA 3RN9C 2AQ3B 2MBQA 1Q1OA 3KYDD 1IYFA 2D5GA 2BW2A 1VR9A 2MWSB 3NS1A 2AL6A 1XLQA 3CIRB 3ONSA 3N20C 4RGOS 4WH4A 3WAMA 2FNJB 2K6QA 1ZDVA 2KT7A 1QILA 3LYYA 2GI9A 3OAWA 2NS5A 3KYCD 2WQYB 2IY1B 2AL3A 3ZYYX 1WFYA 4RNAA 1WGYA 1YQ3B 3CF6E 1IUEA 3MC0B 4AS1A 3BZDB 5CTRC 2KFKB 3TEWA 2B3AA 1F2RI 1SE4A 3DBRI 4C7YA 3ZQ4A 2KWCA 3VVWB 4ICUA 1AYFA 3KQ4A 1OQQA 1ISNA 3M62B 2KLGA 3RZWC 1R4NB 2XK5B 2KXJA 3J9CA 1FXIA 5JHBA 4A8XC 1WGDA 3JW0X 3MJ5A 4GOCA 4NQLB 2ZEQA 4BKTA 4MH0E 3TMPB 3B08A 4GSWA 3I57A 5J2RA 2K3UA 1LQBA 4K7UA 4HPMB 1N5WA 1QLBB 1JQ4A 1JWMD 1QZEA 2JU6X 1WX9A 2M1MA 2VZKB 4M02A 5IN7A 1Q5WB 3VTVA 2BGFA 2I1KA 1GPXA 3TBLD 1UWMA 2ZVNA 5G2NA 2PE6B 1SE2A 2Y5PA 4OVZA 3JVZX 2RD0A 2RGFA 4MJSA 2QC8A 2BQQA 2L7RA 5IOIA 3WIMA 5BYQA 3TEZA 4EKUA 1OEYJ 4II3B 4MGYE 4WAAA 4HLEA 4AOFA 5AUIA 2CR5A 2KTRA 4B9KA 2WXNA 1SEBD 3AE7B 2JXXA 3L08A 2PTLA 3AM9A 1K53A 2KYWA 2WXQA 1X1MA 2E3TA 2E6XA 2ACZB 2QMTA 1XT9B 4NAMA 2WHIA 2N9XA 3P63A 3UF8A 2WLBA 4US8A 3IHPC 3IT4B 2K0PA 3K9OB 2PVGC 3TEYA 4WJNA 3SR6A 2LWPA 2I1JA 2XEWA 2FCQA 1QQRA 4L23A 2JPHA 1TS5A 1GAQB 1MHXA 3S2AA 3BK2A 1SJED 4ZRPA 5BO4B 5E6PA 3RD2A 1YJ1A 1HEZE 3HVZA 3AE6B 5E6OA 3NS8A 5G5GA 2YEPF 3VRAB 4CO7A 2I2YA 2REXA 2BB6A 4WJOA 1SE9A 4ASWC 2FCMA 2MJDA 4PK1A 2FUHB 1I4HA 4MGIE 3ABVB 2OJWA 3DOWA 1E0ZA 2LGXA 3NVWA 2QHOA 1KLGD 2PJHA 4II2B 1EU3A 5C2TB 2HTHA 3JSVA 1A70A 2AYOB 3AEEB 4GDLB 4K3CA 2Z59B 3B9JA 1V49A 1TTNA 3MFGA 1QOBA 1WI0A 2WGSA 5CHVC 3AV8A 1TKYA 3T3NA 1I4XA 1OGWA 4YTNB 2IDYA 1GB4A 1IBXB 4HDOA 2J0JA 4KGRA 2VZKD 3IBEA 1ZKHA 2BKFA 3EECA 4WWOA 2WU2B 1XCTL 2BS2B 3PHWB 3V05A 1AW7A 2V3SA 3TJPA 1UD7A 1T0RC 1GUAB 2JXTA 3V62A 2KMAA 2QEJC 2Z8LA 3PRMB 4ARIA 1JMLA 2XBBC 4LNOA 2GBKA 3LDZE 1JWUD 2JY6A 2O2VA 2WDVB 5BMIA 3ZDMC 2YLMA 1L0XB 1C9FA 1QF6A 3A9JB 4XWWA 2JX5A 4ZRIA 1C4PA 4YTMB 2K22A 4B6WA 3QARA 3MJWA 1WXMA 2L32A 1K50A 1JW9D 2WXRA 2X8XX 3AE2B 4WAFA 3ZRCA 1J8CA 2UWQA 1V97A 5CHWA 2MP2B 2K8BA 3ETRA 1E7VA 1D4BA 1HE8A 2EKEC 3QC8B 5DPRA 4J3OD 3ECIA 2WU5B 4P6VF 2IJ0A 4W9EA 4XDCA 3N1ZC 1JRUA 5BYSA 3ML8A 1WXAA 2JYTA 1T6BX 1ET6A 2EMSA 1YOVB 1WXQA 4H2AA 4QAYA 2BT6A 5L83A 2WDQB 4ZYNA 3W1YA 1T0QC 4HRSA 2NBVB 1RAXA 3PSEB 1DYQA 3PGEA 3KVFB 2ZPNA 2J4XA 3ML9A 4GU2A 3X0WA 3UIOB 2QCZA 4NNJB 4FLHA 1UGJA 2KJ6A 3GOEA 2MQJA 1IP9A 2D3BA 3AN1A 2MBEA 1V1OA 2NTSA 2IO2B 1TYGB 3DBLI 1MPEA 1OQRA 1N6ZA 3SD5A 1I4QA 3DWGC 2LD9A 4EFOA 5EDSA 3APCA 3OG5A 1UUPA 3ZO5B 3H7PA 1LO5D 3PS6A 2DZMA 1ZPSA 5EE3A 3W2DA 4IOIE 3UGBB 4C4VA 1ZXIA 1STEA 5G5HA 4HPLB 4YSYB 3EUB2 1MHHE 3RNBC 1F1HA 3ZW3A 4NAWA 1FFUA 1UZXB 1V2YA 2KWVB 3AI5A 4KIKB 1ZUD2 2DYOA 3EGRA 4DXGA 1WYGA 2MX2A 2IBIB 4DHZB 1EO6A 3V61A 2DHZA 2MW5A 3SU8X 3PZDA 4RH6A 3AEBB 4HWIB 4ZDVA 2KJHB 3UQBA 4GGQA 2IPKD 1UGMA 2HDEA 2LJIA 1WY8A 2G3QB 1N5XA 2IGGA 4NY0A 2G9HD 1B1ZA 4LDTB 2Q5WD 4BKGA 3W1SC 3QWZB 3UINB 3VQIA 1FIQA 1MFWA 4KVGB 5IKCM 2JVCA 1WZ3A 5D7GA 2AQ1B 2DAJA 2BF8B 4LJPB 3ZIMA 2LHDA 3DHGC 2KAJA 3FC4A 1EWYC 4W9FA 4JIOU 3NOBA 2KWUB 4IM2A 5KHQA 1EU4A 2BS4B 3RCZA 2NCNA 2XNAC 3ZJUA 2UU7A 2FCSA 1V81A 3BY4B 2J42A 2PE9A 1FO4A 2K8CA 3DBHB 2LRWA 4GDLA 2IO1B 2INNE 3ZUNA 3ALBA 1E6EB 4ANXA 2KQ7A 2KQSA 1DGJA 3BVMA 2SAKA 4DWFA 3A9KA 3X23A 2KMMA 2IO0B 3KUDB 2G1EA 3L10B 2LVOA 4IKGA 1DOXA 2M56B 1YMHE 4MH8A 3UI3A 4I6LB 1L0YB 1WMHA 2WP9B 4W9IA 4TUUA 3T8MA 1WH3A 4JWUC 2AQ2B 4ZRJA 3K9PB 1P1AA 2L3ZA 2CJNA 3H7SA 2LMCA 1PQSA 2KX3A 3W5VB 2L00B 1E8WA 2LRUA 3ZNGC 2NPTB 1QOFA 3ZNZB 2N7JA 2KFJA 4BVUC 3ZKJC 3GP7A 2KD0A 2MBHA 3ZLZA 3AU5A 5AZFA 3NG0A 5BMHA 3EHVA 3GE8C 3AE3B 3DQVA 4MT5A 2K25A 4A55A 3FILA 2NBUA 2KC2A 4DK5A 3M3JA 1FNUA 4HROA 2D10A 2JT4B 1KFYB 3P4PB 1H4RA 4KKIA 4W9JA 3BWUD 1D3ZA 5CX3A 1FPYA 4C80A 4HJKA 1ZE3D 2BBCA 3MC8A 1MI0A 1UH6A 1I7HA 1UWXA 2IY0B 1I42A 1WR6E 4LK0M 4FN2A 2KANA 4PS3A 1OQYA 2J53A 5GXGB 4YL8A 3IAS1 5DPTA 2KKCA 2KO3A 3P2BA 2OJRA 3P42A 5JH5C 1Y56A 4LDTD 4GDKB 4EZLA 3AE4B 3A1QB 1K52A 3ZNID 4ZYSA 4EZJA 5EE0A 3R2TA 1V1PA 5MPOA 3GS2A 5IO9A 3VHTC 1YN4A 2MJ3A 3TUOA 4A20A 2KDMA 4US9A 1UBIA 1JWSD 1NYQA 5IA7A 3U8ZA 3NZUA 2D2QA 1EWCA 1E9MA 4JWSC 4K3BA 2KOXA 2KLCA 2CHWA 4O1NA 3R66C 2ONQA 1KF6B 4BKSA 2K9XA 1V5TA 3HVDA 4M8NA 2N9EB 2D3GA 1TZOA 2R61A 5J17A 1R4NI 2WWZA 2GOWA 4AWJA 1WE7A 2M0XA 4C00A 2MEKA 2BWES 2YVCA 3HIZA 4AUQC 1EF1A 2LUMA 1NDDA 2PEAA 4NZLB 1DOYA 3WALA 1TJEA 1GJZA 1C3TA 4BOZB 3VR8B 1WYWB 1C4AA 3ZXRA 1EUVB 5EE1A 4ZHPA 2MJEA 3UQAA 2ASQA 3ZTCA 3RULA 2C7NB 1PFDA 1FD6A 2NTTA 2V4IB 3U7DA 1WM3A 4NPNA 1M4VA 2N0SB 2BYTA
chains in the Genus database with same CATH topology
4YTMB 2K22A 1SJHD 1XCQL 2WNMA 2PVOD 3SFEB 4HEA1 2L32A 5I4DA 1JCKB 1K50A 1TKGA 1JW9D 2WXRA 3SFDB 4IDIA 1QOGA 2KQ4X 2M0AA 3Q8CA 4R3DA 3AE2B 3O13A 1XXGA 2W3RA 4WAFA 2BB5A 1PYWD 1BMLC 4ZHOA 2ICIA 3NVVA 1V97A 1KH0A 2PKOA 4UDUC 1TS2A 3P4SB 3ETRA 3HUIA 3P4RB 1D4BA 1Q10A 5HFYA 1PGXA 2WS3B 1FMAD 3IAM1 5E6JA 4NJCA 1V8CA 4WURA 2N9LA 1ACCA 4J3OD 3E56A 1WRIA 1AN8A 2WU5B 3AE5B 4P6VF 2IJ0A 2L83A 2WXIA 1SIJA 4C7ZA 3V3XA 2W3SA 4EE2A 1E7PB 3NZ3A 4XDCA 3FAHA 4ZRQA 5BYSA 4MACA 1N60A 1IGCA 1RM6C 4L2YA 1PGBA 1D5ZC 3OWEB 4KX6B 2JYTA 2PLPA 1JRPA 1T6BX 1XEEA 4ITKA 1J7BA 1ET6A 1RWSA 4B0EA 1I4PA 5D3DA 4DQOC 2BYTA 1WXQA 4H2AA 3NRZA 2BT6A 3R8BA 2WDQB 4HRSA 1R7SA 1P7FA 1VJKA 3AE8B 1VZ7A 3P4QB 1DYQA 1P7EA 2GB1A 1WSPA 2FUG1 4LTUA 1FRDA 1L6VA 3AMZA 2J4XA 2B76B 1ENFA 2HTME 4M0WA 1K51A 1XLOA 3U52E 1C4CA 3T3OA 4YT0B 1UGJA 3AE1B 1QOAA 3U4EG 2MH7A 2JSVX 3AN1A 1GB1A 4YSXB 3LXFA 1V1OA 2NTSA 4A6QA 2ZW0A 1ZXHA 1TYGB 4MM3B 3IXSA 1MPEA 1JWBD 1OQRA 1I4QA 3DWGC 2W55A 3BYYB 3BIID 1BXTA 1SXTA 2PW9A 4WIPA 3ZJVA 2K5PA 4B0MA 3I9V1 3AB5A 2WXMA 2W54A 3VRBB 4KGTA 1JROA 1UUPA 2RDGA 1C76A 2CJOA 1FRRA 1LO5D 4TQ1A 3SEBA 3U7ZA 1ZPSA 5EE3A 2J52A 3W2DA 5H8YE 4IOIE 1FCCC 3C8YA 1ZXIA 1STEA 1J7CA 1VZ8A 5G5HA 1YJJA 2WXOA 2KN4A 4YSYB 3EUB2 1MHHE 5HG2A 2WDRB 4A90A 3GB1A 4N6EB 1FFUA 4XDDA 3MP9A 3TEXA 1TS4A 1I4RA 1XLNA 3IT6B 1T5XD 3Q8AA 1CZPA 4N59A 3W9CB 4REZA 1ZUD2 2WXLA 2DYOA 3EGRA 4DXGA 3KWLA 1WYGA 3KLSX 2L1AA 4C56C 1XLPA 4CQNA 1T3QA 1J7AA 2JYEA 2Y3AA 1KTKA 2SEBD 2JWUA 3PZ8A 2AQ3B 3P1MA 4RH6A 1AWDA 3KWVA 5C3JB 3Q8BA 3AEBB 2KWDA 2D5GA 2BW2A 1VR9A 3B2FA 4YXDB 3NS1A 4HKZE 2ON8A 2IPKD 3TSSA 4NAWB 3Q8EA 1XLQA 2HDEA 3CIRB 1C79A 2LJIA 4RGOS 2IGGA 1N5XA 5D3IB 2G9HD 4WH4A 2EELA 2N9KA 1B1ZA 1CJEA 2Q5WD 2GRIA 4RGTA 1ZDVA 1F2RC 3H8HA 3VQIA 2RPVA 1FIQA 1I4GA 5JXVA 4YWGG 1QILA 2YEPB 3LYYA 2GI9A 3EA6A 1WGKA 3Q8FA 4RF1A 2WQYB 2PIAA 5D7GA 2AQ1B 2IGHA 3ZYYX 1FCLA 2LHDA 1SSNA 4RNAA 4JE3B 4LLGM 2KAJA 3FC4A 1EWYC 3PO0A 1YQ3B 1IUEA 3MC0B 3AEAB 3RPFC 1NYRA 2CU3A 4D2KA 1EU4A 4AS1A 3BZDB 2BS4B 1D6EC 2TSSA 3HRDD 5FKAC 3TEWA 5T8IA 1FXAA 4ZOHC 1NENB 2XNAC 1FM0D 3ZJUA 1F2RI 1L6UA 1SE4A 4C7YA 2QJLA 3ZQ4A 3Q69A 1RFKA 1AYFA 3KQ4A 1OQQA 2ZW1A 2RMMA 2BTEA 2J42A 1SBBB 4YTPB 5LNK1 2QSDA 4OZCA 1KLUD 4L1BA 4OW0A 3J9CA 1FXIA 3L4PA 4A8XC 1FO4A 1TKEA 2LFIA 2INNE 3MJ5A 4XE0A 1E6EB 3AECB 1SE3A 1DGJA 3BVMA 2SAKA 3I57A 2M19A 2K3UA 1L4DB 2IGDA 2KMMA 2G1EA 2WXKA 1N5WA 1HA5A 1QLBB 2LHEA 1DOIA 1VZ6A 1JQ4A 1C78A 4IKGA 1JWMD 2M56B 1DOXA 1YMHE 2JU6X 2Y5CA 4MH8A 1YN3A 3UI3A 3VR9B 3MHZA 2H88B 2VZKB 1L0YB 2WP9B 5FR3A 4JWUC 2AQ2B 5AUKA 1XF5L 5HHDG 2CJNA 1GPXA 3N9YC 1UWMA 1EM7A 1SE2A 2Y5PA 4OVZA 2LMCA 4DXFA 1XO3A 3W5VB 2OHFA 1D5MC 1FEHA 3AEFB 5TSSA 1L0VB 5BYQA 3TEZA 1QOFA 1NI3A 2N7JA 1QKZA 3CWIA 1SF0A 3GP7A 2JZPA 4XWTA 4WWMA 5AUIA 1TS3A 2WXNA 1SEBD 5BMHA 2V3PA 3AE7B 3AE3B 2FBWB 4MT5A 4A55A 4WQMA 3FILA 1NVID 2PTLA 3AM9A 1K53A 1YNTE 1FNUA 2WXQA 4HROA 2I38A 1KFYB 3RFZB 3P4PB 4KKIA 2E3TA 4TMAB 2X38A 3BWUD 2E6XA 3LB8C 2ACZB 4C80A 3E9SA 4N58A 2QMTA 1ZE3D 4NAMA 2BBCA 1VDVA 1MI0A 1E10A 1I7HA 1UWXA 3BYTB 1RYJA 3P63A 5EE9A 4TSSA 2DLBA 2WLBA 4OHJA 4LK0M 4US8A 3IT4B 2AX5A 2WXJA 4JPSA 2J53A 3BK1A 1FFVA 2DYMA 5GXGB 2K0PA 3FILB 1PUTA 3DWMA 2PMVA 2KACA 1OFFA 3IAS1 2PVGC 3TEYA 4TQ0A 1ESFA 3P42A 3SR6A 2WXGA 1L4ZB 1Y56A 3U2SC 4ARCA 1N61A 3B2GA 1TY0A 4GDKB 1HZ5A 1QQRA 4L23A 1TS5A 1GAQB 1NEKB 1VLBA 3AE4B 1MHXA 1K52A 1B9RA 1MVKA 3URYA 1PDXA 4ZYSA 4RFBA 3BK2A 4RGNA 5EE0A 2OEDA 3R2TA 1V1PA 1SJED 4OZBA 1ZDXA 1YN5A 5MPOA 1HXYD 3GS2A 4OZAA 1VRAB 2RDHA 3W5UB 4ZRPA 5BMGA 3ZGZA 1CK1A 1YN4A 2FE8A 2MJ3A 1N62A 3TUOA 1QT9A 1HEZE 3HVZA 4FXCA 3AE6B 3ZJTA 2KDMA 4US9A 3AEDB 1JWSD 1NYQA 1UNSA 5G5GA 2YEPF 2XN9C 3VRAB 4RGMA 1HQRD 3R2IA 2I2YA 1ET9A 4RF0A 2BB6A 1EWCA 1ZP0B 2JQRB 2QILA 2WXPA 1E9MA 1KRHA 1TY2A 4JWSC 2MJDA 4KKJA 1ZOYB 1I4HA 4HKQA 4O1NA 3ABVB 2WXFA 1V1PB 1IBXA 5BYRA 3WCQA 4GLSC 1E0ZA 2ONQA 1KF6B 1PGAA 2K9XA 1FNWA 2WXHA 3NVWA 1CQVA 4Q2JA 1KLGD 3AEGB 1EU3A 2LEKA 3HVDA 5C2TB 1WWTA 2BS3B 4A9AA 1A70A 1TZOA 3AEEB 1ROEA 4GDLB 5H92C 3B9JA 2R61A 3MFGA 1QOBA 1YQ4B 1HZ6A 1C77A 4RCOA 3AV8A 1BUIC 2MEKA 1TKYA 4JX1C 3T3NA 1I4XA 4YTNB 2INPE 3PZ7A 1IGDA 2IDYA 1GB4A 1F77A 4PT5A 1IBXB 4HJGE 1SB3C 2LUMA 4AQ7A 4KGRA 3NVYA 4NZLB 5HI1A 2VZKD 5FK9C 2L52A 4USAA 4YSZB 1DOYA 2LGIA 2WU2B 1XCTL 1TJEA 2BS2B 2DWQA 4KGSA 1L5PA 3V05A 1AW7A 1JWAD 2EKIA 2H89B 3VR8B 1YJIA 1C4AA 2JXTA 3NVZA 1F0ZA 2QEJC 1D5XC 2Z8LA 2QIEB 2V3NA 4ARIA 1JMLA 5EE1A 4ZHPA 3W1SA 1JWUD 2MJEA 2V0GA 3NUHB 2WDVB 1PFDA 1N63A 2W82A 5BMIA 1FD6A 1L0XB 2DBYA 2NTTA 1JALA 3BVGA 1C9FA 1FNVA 2V4IB 1QF6A 3BVZA 4XWWA 3AE9B 1M4VA 2NMQA 3AH7A 1GOZA 2JX5A 2N0SB 1C4PA 4P16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTM B;  5G5H A;  2K22 A;  5EE0 A;  1YJJ A;  2PVO D;  4YSY B;  3EUB 2;  3SFE B;  2KMM A;  5MPO A;  2G1E A;  2WDR B;  1N5W A;  1QLB B;  3W5U B;  4N6E B;  1FFU A;  1TKG A;  1DOI A;  1JW9 D;  3SFD B;  4IDI A;  1QOG A;  1XLN A;  1N62 A;  2MJ3 A;  1DOX A;  1JQ4 A;  1CZP A;  1QT9 A;  2M56 B;  2W3R A;  2Y5C A;  3AE2 B;  3HVZ A;  3AE6 B;  4FXC A;  4N59 A;  4US9 A;  3VR9 B;  1ZUD 2;  2H88 B;  3AED B;  3W9C B;  4ZHO A;  1NYQ A;  2WP9 B;  3KWL A;  1WYG A;  5G5G A;  3NVV A;  1V97 A;  3VRA B;  2PKO A;  1XLP A;  1T3Q A;  4JWU C;  5AUK A;  1J7A A;  3P4S B;  1ZP0 B;  2JQR B;  1E9M A;  3ETR A;  3HUI A;  3P4R B;  1KRH A;  4JWS C;  2WS3 B;  1FMA D;  2CJN A;  2MJD A;  1AWD A;  3P1M A;  5C3J B;  1GPX A;  1V8C A;  3AEB B;  1UWM A;  1ZOY B;  1WRI A;  2WU5 B;  3AE5 B;  3B2F A;  4P6V F;  2L83 A;  3ABV B;  1SIJ A;  4YXD B;  4C7Z A;  3WCQ A;  2W3S A;  3NS1 A;  1XO3 A;  1E7P B;  3W5V B;  1E0Z A;  1KF6 B;  2OHF A;  2K9X A;  3FAH A;  3NVW A;  1XLQ A;  3CIR B;  3AEF B;  1N60 A;  3AEG B;  2LEK A;  5C2T B;  1N5X A;  1L0V B;  1RM6 C;  1WWT A;  1QOF A;  1NI3 A;  2BS3 B;  4A9A A;  4KX6 B;  1CJE A;  2Q5W D;  1A70 A;  3CWI A;  1SF0 A;  1JRP A;  3AEE B;  5H92 C;  1ROE A;  3B9J A;  4ITK A;  1J7B A;  1RWS A;  4WWM A;  5AUI A;  1QOB A;  1FIQ A;  1WXQ A;  3NRZ A;  2BT6 A;  3AE7 B;  3AE3 B;  1YQ4 B;  2WDQ B;  1WGK A;  4HRS A;  1R7S A;  2FBW B;  2PIA A;  2WQY B;  1VJK A;  3AV8 A;  3AE8 B;  1TKY A;  4JX1 C;  4WQM A;  1NVI D;  4YTN B;  3P4Q B;  3ZYY X;  3AM9 A;  4LTU A;  1SB3 C;  1FRD A;  1L6V A;  3AMZ A;  4HRO A;  2B76 B;  2KAJ A;  1KFY B;  3FC4 A;  3NVY A;  3P4P B;  1EWY C;  3PO0 A;  2E3T A;  1YQ3 B;  2HTM E;  3LB8 C;  1XLO A;  2L52 A;  2ACZ B;  4C80 A;  4N58 A;  4USA A;  4YSZ B;  1IUE A;  4YT0 B;  3AEA B;  3RPF C;  1DOY A;  1NYR A;  2CU3 A;  3AE1 B;  1VDV A;  2WU2 B;  1QOA A;  1TJE A;  2BS2 B;  1E10 A;  2BS4 B;  1I7H A;  2DWQ A;  2MH7 A;  1RYJ A;  3HRD D;  1L5P A;  3P63 A;  5EE9 A;  3AN1 A;  1FXA A;  4ZOH C;  1NEN B;  1JWA D;  2EKI A;  1FM0 D;  2WLB A;  3LXF A;  2H89 B;  3VR8 B;  4YSX B;  1YJI A;  1L6U A;  4US8 A;  4C7Y A;  2QJL A;  2AX5 A;  1RFK A;  1TYG B;  1AYF A;  3NVZ A;  1FFV A;  1OQQ A;  1JWB D;  1OQR A;  5GXG B;  1F0Z A;  3DWG C;  1PUT A;  2W55 A;  3DWM A;  2QIE B;  4YTP B;  1OFF A;  3BII D;  5EE1 A;  2PVG C;  4ZHP A;  2K5P A;  1FXI A;  3L4P A;  2MJE A;  1FO4 A;  1TKE A;  3SR6 A;  3AB5 A;  2W54 A;  3VRB B;  2WDV B;  1N61 A;  3B2G A;  1PFD A;  1N63 A;  1E6E B;  1JRO A;  2CJO A;  2DBY A;  1FRR A;  1JAL A;  3AEC B;  3AE4 B;  1GAQ B;  1NEK B;  1VLB A;  2N0S B;  1QF6 A;  5EE3 A;  3AE9 B;  1DGJ A;  5H8Y E;  3AH7 A;  1B9R A;  2JX5 A;  1PDX A;  2M19 A;  1ZXI A;  1J7C A; 
#chains in the Genus database with same CATH topology
 1SJH D;  2WNM A;  1FXT B;  3L0W B;  3V6C B;  3SFE B;  5JHA A;  5I4D A;  2DZK A;  4WQO B;  1TKG A;  1QOG A;  2KQ4 X;  3Q8C A;  4R3D A;  2IND C;  2BB5 A;  1BML C;  1ZW7 A;  4ZHO A;  2WX1 A;  3NZS A;  2ICI A;  4BBN F;  1TS2 A;  3P4S B;  2D11 A;  4E71 A;  3HUI A;  3IAM 1;  5E6J A;  2MCN B;  1TT5 B;  3I5J C;  3UIP B;  4JL9 A;  3QQ8 B;  2WXI A;  1SIJ A;  3V3X A;  2W3S A;  5JZE B;  1E7P B;  3NZ3 A;  2FCN A;  4CHK A;  3FAH A;  4ZRQ A;  3KUZ A;  1IGC A;  3EFU A;  4KX6 B;  5E6N A;  1TGZ B;  1XEE A;  1RWS A;  3NRZ A;  3R8B A;  4EOY A;  2K1F A;  1P3Q U;  4MM3 A;  3KW5 B;  4FJZ A;  1VJK A;  3AE8 B;  1WSP A;  2C7H A;  4ANV A;  3AMZ A;  1L6V A;  4WJP A;  1WGR A;  1Y8R C;  1ENF A;  1XLO A;  1C4C A;  1HTQ A;  3V6E B;  1WX7 A;  2LXA A;  3AE1 B;  3EFC A;  2JSV X;  1SIF A;  2AEH A;  3RNC C;  4P1B C;  4TKN A;  1SGH A;  4M8M A;  4I6N B;  3H1U A;  4HVB A;  1JWB D;  2N1W A;  2W55 A;  2HE7 A;  3DHI C;  1BXT A;  1SXT A;  2PW9 A;  4ANU A;  2NPT A;  2L76 A;  3PV1 A;  3VTU A;  2ZPY A;  2W54 A;  3HM3 A;  4M0W B;  2RDG A;  3DVN U;  2BVC A;  1C76 A;  3HM6 X;  3U7Z A;  4MEM A;  5H8Y E;  1FCC C;  3C8Y A;  2KK8 A;  1J7C A;  2G4S A;  3O65 B;  2HJ8 A;  4A3P A;  2WXO A;  2KN4 A;  5HG2 A;  5C1Z A;  1OEY A;  2KHW B;  3NJT A;  3M95 A;  1I4R A;  3JYU A;  1LFD A;  3PRP B;  3W9C B;  4W9L A;  4IM0 A;  4TV3 A;  3KWL A;  2L1A A;  2LVQ A;  1XLP A;  4CQN A;  3MHS D;  3RNE C;  3MC9 A;  3L54 A;  2LJ5 A;  3PZ8 A;  3ZNH B;  2FID A;  3P1M A;  1WRD B;  5C3J B;  2CS4 A;  2KWD A;  2LGS A;  4EZK A;  3VH3 B;  2Z0E B;  2KTF A;  3IFW B;  2O6V B;  3ZTD A;  4YXD B;  3Q8E A;  1C79 A;  1UEL A;  4DHZ E;  2LXC A;  4PS8 A;  5D3I B;  4GDK A;  4KZ0 A;  1WR1 A;  4RGT A;  1F2R C;  2KFK A;  2DYB A;  2RPV A;  1I4G A;  3DBS A;  5JXV A;  3R3M A;  4YWG G;  2J0M A;  4IW0 A;  2YEP B;  3I3T B;  1WGK A;  5AZH A;  4LNI A;  2PIA A;  4F8C B;  2IGH A;  5LXH A;  5DCN A;  1SSN A;  2XK5 A;  4LLG M;  2R2O A;  3N32 A;  4PYZ A;  1R4M I;  3ENE A;  1T0Y A;  3AEA B;  5AZG A;  2CU3 A;  2ZNV C;  1BT0 A;  5FKA C;  1FXA A;  4ZOH C;  1T0S C;  2DEN B;  1L6U A;  2GLS A;  2QJL A;  2LAS A;  2N4F A;  1RFK A;  3TL5 A;  1E8Y A;  4XGA B;  2QSD A;  1KLU D;  1MG8 A;  4OW0 A;  4K7W A;  4FAD A;  5L95 C;  1WE6 A;  2LFI A;  1IPG A;  3ZRF A;  4P1C C;  2K6D B;  2M19 A;  1L4D B;  1OTR B;  4GXB A;  1UBQ A;  2IGD A;  4DDG D;  4CYE A;  1HA5 A;  1VCB A;  2LHE A;  4F1S A;  5J18 A;  1VD2 A;  4GIV A;  2Y5C A;  1YN3 A;  3VR9 B;  1XQQ A;  3PRE A;  3VFK A;  3MHZ A;  2H88 B;  2GBR A;  3PLU A;  3EC8 A;  5HHD G;  5DPW A;  2JWZ A;  4GMV A;  2IYD B;  2KN5 A;  4IUM B;  2D3C A;  1WJU A;  3Q6B A;  2OHF A;  1D5M C;  1FEH A;  3AEF B;  2CHX A;  2OOB B;  1NI3 A;  3AUL A;  1QKZ A;  3CWI A;  1SF0 A;  1NBF C;  4MGZ E;  2DX5 B;  3OJ4 B;  4LNN A;  4FA6 A;  2FBW B;  1YNT E;  3VAW A;  2LUE A;  4FUL A;  4MJS B;  1WJ6 A;  1KJT A;  4K81 A;  5TR5 A;  1GNU A;  4MSM B;  3LB8 C;  3IVF A;  3E9S A;  2FIF A;  4F7Z A;  2BPS A;  1VDV A;  1E7U A;  2CHZ A;  1E10 A;  3Q3M C;  1RYJ A;  3GE3 C;  5EE9 A;  2JZZ A;  1NI2 A;  2JRH A;  3H9D A;  2KTR B;  3VUW A;  2W9N A;  4BFR A;  2WXJ A;  4JPS A;  3IG3 A;  3BK1 A;  1FFV A;  2DYM A;  2O6V D;  3PLV A;  3DWM A;  2KAC A;  1OFF A;  4W9G A;  4TQ0 A;  1ESF A;  1E5W A;  2VH1 A;  1L4Z B;  1N61 A;  3B2G A;  3B0A A;  2ZCB A;  2D3A A;  1P9D U;  1VLB A;  3QK0 A;  1B9R A;  1PDX A;  4RFB A;  2INC C;  3OLM D;  2OED A;  3APF A;  1YN5 A;  1HXY D;  4OZA A;  2WDT B;  2C9W B;  1RFA A;  1VRA B;  2RDH A;  3W5U B;  4BAX A;  2DZJ A;  1CK1 A;  2FE8 A;  3VXW A;  2LZ6 A;  4FXC A;  2IO3 B;  5D94 A;  2XN9 C;  4RGM A;  3R2I A;  1ET9 A;  3GZN I;  3H6N A;  1ZP0 B;  1TY2 A;  5IAA C;  4KKJ A;  2WXF A;  1IBX A;  5BYR A;  4GLS C;  1CQV A;  4MEL A;  3AEG B;  1WWT A;  3Q3O C;  1M94 A;  4FHK A;  4FBJ B;  3Q3J A;  4P7I A;  5H92 C;  4MDK E;  2CKH B;  1YQ4 B;  3DPD A;  3Q14 C;  1HZ6 A;  3D32 A;  4JGH B;  1C77 A;  4RCO A;  1BUI C;  1P98 A;  4JX1 C;  1F77 A;  4PT5 A;  2DNF A;  4AQ7 A;  3NVY A;  4USA A;  4YSZ B;  3JSV B;  3CMM B;  1YX5 B;  3A9J A;  2DWQ A;  4LNK A;  3L13 A;  2EKI A;  4BBN C;  2M4N A;  1WJ4 A;  2V1Y A;  2Y5B B;  2QIE B;  3RZF A;  2KVR A;  3RUI B;  3QAQ A;  3RMK C;  4GN1 A;  2MP2 A;  4OVV A;  4DHJ B;  1E8X A;  2DBY A;  4LJO B;  3BVG A;  4AJY B;  3AE9 B;  2NMQ A;  4XZ4 A;  1GOZ A;  4P16 A;  3R7R A;  3M63 B;  1JCK B;  1WGH A;  4WJQ A;  1K8R B;  5AEK B;  3DBR B;  3WA0 A;  1E8Z A;  2G4D B;  2O2V B;  3P4R B;  1Q10 A;  4KSL C;  3L17 A;  1V8C A;  4WUR A;  2N9L A;  2GBN A;  1L2N A;  3Q2A C;  4C7Z A;  1C1Y B;  2DAF A;  5HKH A;  4MAC A;  1RM6 C;  1U4A A;  1PGB A;  1Z5S B;  3OJ3 A;  3V60 A;  1LM8 B;  2HJ1 A;  2PLP A;  2ZNV B;  1JRP A;  3DDC B;  3N1X C;  1J7B A;  4N9F 4;  4B0E A;  4DQO C;  2N7D A;  4K7S A;  3PVL A;  3N1Y C;  4KZC A;  1KOT A;  1MJD A;  1VZ7 A;  1P7E A;  2GB1 A;  2RSU A;  1EF5 A;  1FRD A;  2JRI B;  4S0R A;  4AP4 C;  1TIF A;  2HTM E;  1K51 A;  3DVN V;  3U52 E;  4YT0 B;  1MG4 A;  3U4E G;  1GB1 A;  3LXF A;  2ZW0 A;  3QX1 A;  4PYU A;  1ZXH A;  2KDF B;  2AWT A;  3BYY B;  3BII D;  4ANW A;  4WIP A;  4KIK A;  2K5P A;  4B0M A;  4DXA B;  4K1R B;  3I9V 1;  3AB5 A;  3NY5 A;  2WXM A;  3VRB B;  4KGT A;  1L7Y A;  2L0T A;  4IM3 A;  1V80 A;  2ZVO A;  4TQ1 A;  4G3X B;  3SEB A;  5LXI B;  2J52 A;  2A4Z A;  2VRR B;  2KDB A;  3AXC A;  1VZ8 A;  2KC1 A;  2WDR B;  1J19 A;  1J0G A;  1G6J A;  4HDQ A;  2C60 A;  4N6E B;  3MP9 A;  1TS4 A;  2IZV B;  3HK0 A;  1XLN A;  3IT6 B;  1T5X D;  3Q8A A;  1CZP A;  1GC6 A;  1WX8 A;  2C5L C;  3HHM A;  2WXL A;  3KLS X;  2GBM A;  3KH0 A;  2MSE D;  1J7A A;  2JYE A;  2Y3A A;  1KTK A;  1ZGU B;  4W9H A;  3H7P B;  4MSQ B;  1AWD A;  3KWV A;  3Q8B A;  4HPP A;  4C4V B;  3ZVV A;  3B2F A;  4FJY A;  4HKZ E;  2ON8 A;  1WJN A;  3TSS A;  4NAW B;  3RI7 C;  1V86 A;  4EEW A;  2EEL A;  2N9K A;  1CJE A;  2GRI A;  4DHJ D;  2R2Q A;  4HK2 A;  3H8H A;  1YX6 B;  2V9H A;  2DZI A;  3EA6 A;  3Q8F A;  4RF1 A;  1FCL A;  4JE3 B;  4IWO A;  4ICV A;  3PO0 A;  2K8H A;  3N3K B;  2KX0 A;  4HCN B;  4G50 A;  3RPF C;  1NYR A;  4HCP B;  4D2K A;  1D6E C;  2TSS A;  3HRD D;  5T8I A;  3TCA A;  1NEN B;  1FM0 D;  3Q3F A;  2L0F A;  3VTW A;  2BYV E;  3Q69 A;  2ZW1 A;  2RMM A;  4IC7 B;  4M00 A;  2BTE A;  1SBB B;  4YTP B;  5LNK 1;  4OZC A;  4L1B A;  3L4P A;  1TKE A;  4LCD E;  4XE0 A;  2M17 A;  4IWP A;  3AEC B;  1SE3 A;  3QCA A;  2ZCC A;  2WXK A;  4KDI C;  2RR9 A;  4KDL B;  1RRB A;  1DOI A;  1VZ6 A;  4G11 A;  3CST A;  1C78 A;  3PPA A;  1Z2M A;  1E90 A;  5FR3 A;  4E3C A;  2KNB A;  5AUK A;  1XF5 L;  2PPH A;  2FAZ A;  2RDB C;  3VH4 B;  2GMI C;  2V4L A;  1Q0W B;  3N9Y C;  4W9C A;  4MGK E;  1EM7 A;  3A9K B;  3R7Q A;  4DXF A;  5CHF A;  1GC7 A;  1XO3 A;  2BYE A;  1YIW A;  3SDL C;  4FHJ A;  3B1L X;  5TSS A;  3Q3N C;  1L0V B;  2KDE B;  1WMH B;  2N1V A;  2JZP A;  3PT2 B;  4XWT A;  3VUY A;  4WWM A;  1TS3 A;  2BWF A;  2V3P A;  1UF0 A;  4I6P A;  4WQM A;  1NVI D;  1I35 A;  5IP4 D;  3QHT A;  4BZA A;  2I38 A;  3RFZ B;  4TMA B;  2X38 A;  1YD8 U;  4N58 A;  2QDF A;  3A1Q A;  2MHJ A;  3BYT B;  3BIN A;  1P0R A;  4TSS A;  2DLB A;  4OHJ A;  5D6J B;  4PS7 A;  4J6I A;  2C7M B;  1R4M B;  3NHE B;  2AX5 A;  3A4R A;  2Z0D B;  3FIL B;  3SHQ A;  1PUT A;  2PMV A;  4NJ7 A;  2WXG A;  4B95 A;  3U2S C;  4ARC A;  1TY0 A;  1HZ5 A;  2WYQ A;  1NEK B;  5KHO A;  3A4S C;  1MVK A;  3URY A;  1WIA A;  3PTF C;  3WAN A;  4RGN A;  4GB9 A;  1YQB A;  4IWQ A;  1ZDX A;  4OZB A;  5BMG A;  2JF5 A;  3ZGZ A;  1N62 A;  1QT9 A;  3ZJT A;  2J7Q B;  3AED B;  4FJV B;  1UNS A;  4RM8 A;  2HD5 B;  1HQR D;  4A3O A;  4HXD A;  3DBL B;  4W9K A;  2M8S A;  4RF0 A;  1F9J A;  2JQR B;  2QIL A;  1S1Q B;  2WXP A;  2D07 B;  4ZRK A;  1S3S G;  3U30 A;  1KRH A;  4E74 A;  3VUX A;  1ZOY B;  4HKQ A;  1V1P B;  3WCQ A;  1PGA A;  1FNW A;  2WXH A;  4Q2J A;  5GMV A;  1TBE A;  2LEK A;  2BS3 B;  4A9A A;  2WX0 A;  3RYT A;  1ROE A;  3ZDT A;  4WWN A;  4W9D A;  2J0K A;  1TZ1 A;  1V5O A;  1WXV A;  2KZR A;  1WGG A;  4JLC A;  1KLV A;  2KVZ A;  2INP E;  3PZ7 A;  1IGD A;  2LGY A;  4HJG E;  1SB3 C;  2MLB A;  5G55 A;  4DDI D;  5HI1 A;  4LNF A;  5FK9 C;  2L52 A;  3A33 B;  3DVG X;  2LGI A;  4JQW C;  2GBJ A;  4KGS A;  4KV2 A;  1L5P A;  1JWA D;  2H89 B;  1YJI A;  5C23 A;  3WAO A;  3QA8 A;  2NVU I;  1XD3 B;  3QIJ A;  1CMX B;  3NVZ A;  1F0Z A;  1D5X C;  1H8C A;  2V3N A;  2KMC A;  2LI5 A;  3W1S A;  3PRZ A;  5D2M B;  2NR2 A;  2V0G A;  3NUH B;  2KJR A;  1N63 A;  2W82 A;  2N7E A;  3FKY A;  1JAL A;  1FNV A;  4DBG A;  3BVZ A;  3AH7 A;  3N30 A;  1XCQ L;  2PVO D;  4NQK E;  2LGD A;  4HEA 1;  2VH2 A;  3C0R B;  4WWP A;  3SFD B;  4IDI A;  1A5R A;  2M0A A;  3O13 A;  1XXG A;  1V6E A;  2MRP A;  2W3R A;  1PYW D;  4NJ6 A;  5LLI A;  4IG7 B;  3NVV A;  5DPS A;  1KH0 A;  2PKO A;  4UDU C;  3WAP A;  4URK A;  3TIX A;  4XX5 A;  5HFY A;  1PGX A;  2WS3 B;  1FMA D;  1KM7 A;  4G0N B;  4NJC A;  2NBW B;  1ACC A;  3RNA C;  3E56 A;  1WRI A;  1AN8 A;  2BKR B;  3AE5 B;  2L83 A;  3GZN B;  4EE2 A;  2K39 A;  1LGR A;  2BYF A;  2G45 B;  2MBB B;  2MA9 B;  3ZXV A;  1N60 A;  4L2Y A;  3QJZ A;  1D5Z C;  1WF9 A;  3L16 A;  4KSK C;  4X57 B;  3OWE B;  2ZJD A;  4ITK A;  1I4P A;  1WZ0 A;  5D3D A;  2A5U A;  4EUT A;  3DVG Y;  5FR6 A;  4S17 A;  1HTO A;  3AU4 A;  3I63 C;  1R7S A;  1P7F A;  4OVU A;  2L05 A;  3DHH C;  2EMT A;  3P4Q B;  4RMA A;  2FUG 1;  2LVP A;  4LTU A;  1RLF A;  3LJ3 A;  2B76 B;  3T3O A;  4M0W A;  2UYZ B;  2KDI A;  3KUC B;  1QOA A;  2MH7 A;  4XYC A;  3MTN B;  2N9P C;  2JZ3 B;  4YSX B;  3DBH I;  4A6Q A;  1AAR A;  1WM2 A;  4BOS C;  4MM3 B;  3IXS A;  4XC2 A;  3APD A;  3DCG A;  2L8J A;  3ZJV A;  4ACF A;  1LXD A;  3PHX B;  2ZZP B;  3C19 A;  1JRO A;  2CU1 A;  2CJO A;  1FRR A;  2MBO A;  3RT3 B;  3RNF C;  2RPQ A;  4RM9 A;  1GG3 A;  3VDZ A;  2JUO A;  2O6V A;  1V9J A;  1YJJ A;  4M01 A;  4A90 A;  3GB1 A;  3RNG C;  4XDD A;  3TEX A;  1WXS A;  4N59 A;  4BKS D;  4REZ A;  4AJW A;  3CSF A;  3T9L A;  4C56 C;  1F52 A;  1T3Q A;  2SEB D;  2JWU A;  3RN9 C;  2AQ3 B;  2MBQ A;  1Q1O A;  3KYD D;  1IYF A;  2D5G A;  2BW2 A;  1VR9 A;  2MWS B;  3NS1 A;  2AL6 A;  1XLQ A;  3CIR B;  3ONS A;  3N20 C;  4RGO S;  4WH4 A;  3WAM A;  2FNJ B;  2K6Q A;  1ZDV A;  2KT7 A;  1QIL A;  3LYY A;  2GI9 A;  3OAW A;  2NS5 A;  3KYC D;  2WQY B;  2IY1 B;  2AL3 A;  3ZYY X;  1WFY A;  4RNA A;  1WGY A;  1YQ3 B;  3CF6 E;  1IUE A;  3MC0 B;  4AS1 A;  3BZD B;  5CTR C;  2KFK B;  3TEW A;  2B3A A;  1F2R I;  1SE4 A;  3DBR I;  4C7Y A;  3ZQ4 A;  2KWC A;  3VVW B;  4ICU A;  1AYF A;  3KQ4 A;  1OQQ A;  1ISN A;  3M62 B;  2KLG A;  3RZW C;  1R4N B;  2XK5 B;  2KXJ A;  3J9C A;  1FXI A;  5JHB A;  4A8X C;  1WGD A;  3JW0 X;  3MJ5 A;  4GOC A;  4NQL B;  2ZEQ A;  4BKT A;  4MH0 E;  3TMP B;  3B08 A;  4GSW A;  3I57 A;  5J2R A;  2K3U A;  1LQB A;  4K7U A;  4HPM B;  1N5W A;  1QLB B;  1JQ4 A;  1JWM D;  1QZE A;  2JU6 X;  1WX9 A;  2M1M A;  2VZK B;  4M02 A;  5IN7 A;  1Q5W B;  3VTV A;  2BGF A;  2I1K A;  1GPX A;  3TBL D;  1UWM A;  2ZVN A;  5G2N A;  2PE6 B;  1SE2 A;  2Y5P A;  4OVZ A;  3JVZ X;  2RD0 A;  2RGF A;  4MJS A;  2QC8 A;  2BQQ A;  2L7R A;  5IOI A;  3WIM A;  5BYQ A;  3TEZ A;  4EKU A;  1OEY J;  4II3 B;  4MGY E;  4WAA A;  4HLE A;  4AOF A;  5AUI A;  2CR5 A;  2KTR A;  4B9K A;  2WXN A;  1SEB D;  3AE7 B;  2JXX A;  3L08 A;  2PTL A;  3AM9 A;  1K53 A;  2KYW A;  2WXQ A;  1X1M A;  2E3T A;  2E6X A;  2ACZ B;  2QMT A;  1XT9 B;  4NAM A;  2WHI A;  2N9X A;  3P63 A;  3UF8 A;  2WLB A;  4US8 A;  3IHP C;  3IT4 B;  2K0P A;  3K9O B;  2PVG C;  3TEY A;  4WJN A;  3SR6 A;  2LWP A;  2I1J A;  2XEW A;  2FCQ A;  1QQR A;  4L23 A;  2JPH A;  1TS5 A;  1GAQ B;  1MHX A;  3S2A A;  3BK2 A;  1SJE D;  4ZRP A;  5BO4 B;  5E6P A;  3RD2 A;  1YJ1 A;  1HEZ E;  3HVZ A;  3AE6 B;  5E6O A;  3NS8 A;  5G5G A;  2YEP F;  3VRA B;  4CO7 A;  2I2Y A;  2REX A;  2BB6 A;  4WJO A;  1SE9 A;  4ASW C;  2FCM A;  2MJD A;  4PK1 A;  2FUH B;  1I4H A;  4MGI E;  3ABV B;  2OJW A;  3DOW A;  1E0Z A;  2LGX A;  3NVW A;  2QHO A;  1KLG D;  2PJH A;  4II2 B;  1EU3 A;  5C2T B;  2HTH A;  3JSV A;  1A70 A;  2AYO B;  3AEE B;  4GDL B;  4K3C A;  2Z59 B;  3B9J A;  1V49 A;  1TTN A;  3MFG A;  1QOB A;  1WI0 A;  2WGS A;  5CHV C;  3AV8 A;  1TKY A;  3T3N A;  1I4X A;  1OGW A;  4YTN B;  2IDY A;  1GB4 A;  1IBX B;  4HDO A;  2J0J A;  4KGR A;  2VZK D;  3IBE A;  1ZKH A;  2BKF A;  3EEC A;  4WWO A;  2WU2 B;  1XCT L;  2BS2 B;  3PHW B;  3V05 A;  1AW7 A;  2V3S A;  3TJP A;  1UD7 A;  1T0R C;  1GUA B;  2JXT A;  3V62 A;  2KMA A;  2QEJ C;  2Z8L A;  3PRM B;  4ARI A;  1JML A;  2XBB C;  4LNO A;  2GBK A;  3LDZ E;  1JWU D;  2JY6 A;  2O2V A;  2WDV B;  5BMI A;  3ZDM C;  2YLM A;  1L0X B;  1C9F A;  1QF6 A;  3A9J B;  4XWW A;  2JX5 A;  4ZRI A;  1C4P A;  4YTM B;  2K22 A;  4B6W A;  3QAR A;  3MJW A;  1WXM A;  2L32 A;  1K50 A;  1JW9 D;  2WXR A;  2X8X X;  3AE2 B;  4WAF A;  3ZRC A;  1J8C A;  2UWQ A;  1V97 A;  5CHW A;  2MP2 B;  2K8B A;  3ETR A;  1E7V A;  1D4B A;  1HE8 A;  2EKE C;  3QC8 B;  5DPR A;  4J3O D;  3ECI A;  2WU5 B;  4P6V F;  2IJ0 A;  4W9E A;  4XDC A;  3N1Z C;  1JRU A;  5BYS A;  3ML8 A;  1WXA A;  2JYT A;  1T6B X;  1ET6 A;  2EMS A;  1YOV B;  1WXQ A;  4H2A A;  4QAY A;  2BT6 A;  5L83 A;  2WDQ B;  4ZYN A;  3W1Y A;  1T0Q C;  4HRS A;  2NBV B;  1RAX A;  3PSE B;  1DYQ A;  3PGE A;  3KVF B;  2ZPN A;  2J4X A;  3ML9 A;  4GU2 A;  3X0W A;  3UIO B;  2QCZ A;  4NNJ B;  4FLH A;  1UGJ A;  2KJ6 A;  3GOE A;  2MQJ A;  1IP9 A;  2D3B A;  3AN1 A;  2MBE A;  1V1O A;  2NTS A;  2IO2 B;  1TYG B;  3DBL I;  1MPE A;  1OQR A;  1N6Z A;  3SD5 A;  1I4Q A;  3DWG C;  2LD9 A;  4EFO A;  5EDS A;  3APC A;  3OG5 A;  1UUP A;  3ZO5 B;  3H7P A;  1LO5 D;  3PS6 A;  2DZM A;  1ZPS A;  5EE3 A;  3W2D A;  4IOI E;  3UGB B;  4C4V A;  1ZXI A;  1STE A;  5G5H A;  4HPL B;  4YSY B;  3EUB 2;  1MHH E;  3RNB C;  1F1H A;  3ZW3 A;  4NAW A;  1FFU A;  1UZX B;  1V2Y A;  2KWV B;  3AI5 A;  4KIK B;  1ZUD 2;  2DYO A;  3EGR A;  4DXG A;  1WYG A;  2MX2 A;  2IBI B;  4DHZ B;  1EO6 A;  3V61 A;  2DHZ A;  2MW5 A;  3SU8 X;  3PZD A;  4RH6 A;  3AEB B;  4HWI B;  4ZDV A;  2KJH B;  3UQB A;  4GGQ A;  2IPK D;  1UGM A;  2HDE A;  2LJI A;  1WY8 A;  2G3Q B;  1N5X A;  2IGG A;  4NY0 A;  2G9H D;  1B1Z A;  4LDT B;  2Q5W D;  4BKG A;  3W1S C;  3QWZ B;  3UIN B;  3VQI A;  1FIQ A;  1MFW A;  4KVG B;  5IKC M;  2JVC A;  1WZ3 A;  5D7G A;  2AQ1 B;  2DAJ A;  2BF8 B;  4LJP B;  3ZIM A;  2LHD A;  3DHG C;  2KAJ A;  3FC4 A;  1EWY C;  4W9F A;  4JIO U;  3NOB A;  2KWU B;  4IM2 A;  5KHQ A;  1EU4 A;  2BS4 B;  3RCZ A;  2NCN A;  2XNA C;  3ZJU A;  2UU7 A;  2FCS A;  1V81 A;  3BY4 B;  2J42 A;  2PE9 A;  1FO4 A;  2K8C A;  3DBH B;  2LRW A;  4GDL A;  2IO1 B;  2INN E;  3ZUN A;  3ALB A;  1E6E B;  4ANX A;  2KQ7 A;  2KQS A;  1DGJ A;  3BVM A;  2SAK A;  4DWF A;  3A9K A;  3X23 A;  2KMM A;  2IO0 B;  3KUD B;  2G1E A;  3L10 B;  2LVO A;  4IKG A;  1DOX A;  2M56 B;  1YMH E;  4MH8 A;  3UI3 A;  4I6L B;  1L0Y B;  1WMH A;  2WP9 B;  4W9I A;  4TUU A;  3T8M A;  1WH3 A;  4JWU C;  2AQ2 B;  4ZRJ A;  3K9P B;  1P1A A;  2L3Z A;  2CJN A;  3H7S A;  2LMC A;  1PQS A;  2KX3 A;  3W5V B;  2L00 B;  1E8W A;  2LRU A;  3ZNG C;  2NPT B;  1QOF A;  3ZNZ B;  2N7J A;  2KFJ A;  4BVU C;  3ZKJ C;  3GP7 A;  2KD0 A;  2MBH A;  3ZLZ A;  3AU5 A;  5AZF A;  3NG0 A;  5BMH A;  3EHV A;  3GE8 C;  3AE3 B;  3DQV A;  4MT5 A;  2K25 A;  4A55 A;  3FIL A;  2NBU A;  2KC2 A;  4DK5 A;  3M3J A;  1FNU A;  4HRO A;  2D10 A;  2JT4 B;  1KFY B;  3P4P B;  1H4R A;  4KKI A;  4W9J A;  3BWU D;  1D3Z A;  5CX3 A;  1FPY A;  4C80 A;  4HJK A;  1ZE3 D;  2BBC A;  3MC8 A;  1MI0 A;  1UH6 A;  1I7H A;  1UWX A;  2IY0 B;  1I42 A;  1WR6 E;  4LK0 M;  4FN2 A;  2KAN A;  4PS3 A;  1OQY A;  2J53 A;  5GXG B;  4YL8 A;  3IAS 1;  5DPT A;  2KKC A;  2KO3 A;  3P2B A;  2OJR A;  3P42 A;  5JH5 C;  1Y56 A;  4LDT D;  4GDK B;  4EZL A;  3AE4 B;  3A1Q B;  1K52 A;  3ZNI D;  4ZYS A;  4EZJ A;  5EE0 A;  3R2T A;  1V1P A;  5MPO A;  3GS2 A;  5IO9 A;  3VHT C;  1YN4 A;  2MJ3 A;  3TUO A;  4A20 A;  2KDM A;  4US9 A;  1UBI A;  1JWS D;  1NYQ A;  5IA7 A;  3U8Z A;  3NZU A;  2D2Q A;  1EWC A;  1E9M A;  4JWS C;  4K3B A;  2KOX A;  2KLC A;  2CHW A;  4O1N A;  3R66 C;  2ONQ A;  1KF6 B;  4BKS A;  2K9X A;  1V5T A;  3HVD A;  4M8N A;  2N9E B;  2D3G A;  1TZO A;  2R61 A;  5J17 A;  1R4N I;  2WWZ A;  2GOW A;  4AWJ A;  1WE7 A;  2M0X A;  4C00 A;  2MEK A;  2BWE S;  2YVC A;  3HIZ A;  4AUQ C;  1EF1 A;  2LUM A;  1NDD A;  2PEA A;  4NZL B;  1DOY A;  3WAL A;  1TJE A;  1GJZ A;  1C3T A;  4BOZ B;  3VR8 B;  1WYW B;  1C4A A;  3ZXR A;  1EUV B;  5EE1 A;  4ZHP A;  2MJE A;  3UQA A;  2ASQ A;  3ZTC A;  3RUL A;  2C7N B;  1PFD A;  1FD6 A;  2NTT A;  2V4I B;  3U7D A;  1WM3 A;  4NPN A;  1M4V A;  2N0S B;  2BYT A; 
#chains in the Genus database with same CATH homology
 4YTM B;  2K22 A;  1SJH D;  1XCQ L;  2WNM A;  2PVO D;  3SFE B;  4HEA 1;  2L32 A;  5I4D A;  1JCK B;  1K50 A;  1TKG A;  1JW9 D;  2WXR A;  3SFD B;  4IDI A;  1QOG A;  2KQ4 X;  2M0A A;  3Q8C A;  4R3D A;  3AE2 B;  3O13 A;  1XXG A;  2W3R A;  4WAF A;  2BB5 A;  1PYW D;  1BML C;  4ZHO A;  2ICI A;  3NVV A;  1V97 A;  1KH0 A;  2PKO A;  4UDU C;  1TS2 A;  3P4S B;  3ETR A;  3HUI A;  3P4R B;  1D4B A;  1Q10 A;  5HFY A;  1PGX A;  2WS3 B;  1FMA D;  3IAM 1;  5E6J A;  4NJC A;  1V8C A;  4WUR A;  2N9L A;  1ACC A;  4J3O D;  3E56 A;  1WRI A;  1AN8 A;  2WU5 B;  3AE5 B;  4P6V F;  2IJ0 A;  2L83 A;  2WXI A;  1SIJ A;  4C7Z A;  3V3X A;  2W3S A;  4EE2 A;  1E7P B;  3NZ3 A;  4XDC A;  3FAH A;  4ZRQ A;  5BYS A;  4MAC A;  1N60 A;  1IGC A;  1RM6 C;  4L2Y A;  1PGB A;  1D5Z C;  3OWE B;  4KX6 B;  2JYT A;  2PLP A;  1JRP A;  1T6B X;  1XEE A;  4ITK A;  1J7B A;  1ET6 A;  1RWS A;  4B0E A;  1I4P A;  5D3D A;  4DQO C;  2BYT A;  1WXQ A;  4H2A A;  3NRZ A;  2BT6 A;  3R8B A;  2WDQ B;  4HRS A;  1R7S A;  1P7F A;  1VJK A;  3AE8 B;  1VZ7 A;  3P4Q B;  1DYQ A;  1P7E A;  2GB1 A;  1WSP A;  2FUG 1;  4LTU A;  1FRD A;  1L6V A;  3AMZ A;  2J4X A;  2B76 B;  1ENF A;  2HTM E;  4M0W A;  1K51 A;  1XLO A;  3U52 E;  1C4C A;  3T3O A;  4YT0 B;  1UGJ A;  3AE1 B;  1QOA A;  3U4E G;  2MH7 A;  2JSV X;  3AN1 A;  1GB1 A;  4YSX B;  3LXF A;  1V1O A;  2NTS A;  4A6Q A;  2ZW0 A;  1ZXH A;  1TYG B;  4MM3 B;  3IXS A;  1MPE A;  1JWB D;  1OQR A;  1I4Q A;  3DWG C;  2W55 A;  3BYY B;  3BII D;  1BXT A;  1SXT A;  2PW9 A;  4WIP A;  3ZJV A;  2K5P A;  4B0M A;  3I9V 1;  3AB5 A;  2WXM A;  2W54 A;  3VRB B;  4KGT A;  1JRO A;  1UUP A;  2RDG A;  1C76 A;  2CJO A;  1FRR A;  1LO5 D;  4TQ1 A;  3SEB A;  3U7Z A;  1ZPS A;  5EE3 A;  2J52 A;  3W2D A;  5H8Y E;  4IOI E;  1FCC C;  3C8Y A;  1ZXI A;  1STE A;  1J7C A;  1VZ8 A;  5G5H A;  1YJJ A;  2WXO A;  2KN4 A;  4YSY B;  3EUB 2;  1MHH E;  5HG2 A;  2WDR B;  4A90 A;  3GB1 A;  4N6E B;  1FFU A;  4XDD A;  3MP9 A;  3TEX A;  1TS4 A;  1I4R A;  1XLN A;  3IT6 B;  1T5X D;  3Q8A A;  1CZP A;  4N59 A;  3W9C B;  4REZ A;  1ZUD 2;  2WXL A;  2DYO A;  3EGR A;  4DXG A;  3KWL A;  1WYG A;  3KLS X;  2L1A A;  4C56 C;  1XLP A;  4CQN A;  1T3Q A;  1J7A A;  2JYE A;  2Y3A A;  1KTK A;  2SEB D;  2JWU A;  3PZ8 A;  2AQ3 B;  3P1M A;  4RH6 A;  1AWD A;  3KWV A;  5C3J B;  3Q8B A;  3AEB B;  2KWD A;  2D5G A;  2BW2 A;  1VR9 A;  3B2F A;  4YXD B;  3NS1 A;  4HKZ E;  2ON8 A;  2IPK D;  3TSS A;  4NAW B;  3Q8E A;  1XLQ A;  2HDE A;  3CIR B;  1C79 A;  2LJI A;  4RGO S;  2IGG A;  1N5X A;  5D3I B;  2G9H D;  4WH4 A;  2EEL A;  2N9K A;  1B1Z A;  1CJE A;  2Q5W D;  2GRI A;  4RGT A;  1ZDV A;  1F2R C;  3H8H A;  3VQI A;  2RPV A;  1FIQ A;  1I4G A;  5JXV A;  4YWG G;  1QIL A;  2YEP B;  3LYY A;  2GI9 A;  3EA6 A;  1WGK A;  3Q8F A;  4RF1 A;  2WQY B;  2PIA A;  5D7G A;  2AQ1 B;  2IGH A;  3ZYY X;  1FCL A;  2LHD A;  1SSN A;  4RNA A;  4JE3 B;  4LLG M;  2KAJ A;  3FC4 A;  1EWY C;  3PO0 A;  1YQ3 B;  1IUE A;  3MC0 B;  3AEA B;  3RPF C;  1NYR A;  2CU3 A;  4D2K A;  1EU4 A;  4AS1 A;  3BZD B;  2BS4 B;  1D6E C;  2TSS A;  3HRD D;  5FKA C;  3TEW A;  5T8I A;  1FXA A;  4ZOH C;  1NEN B;  2XNA C;  1FM0 D;  3ZJU A;  1F2R I;  1L6U A;  1SE4 A;  4C7Y A;  2QJL A;  3ZQ4 A;  3Q69 A;  1RFK A;  1AYF A;  3KQ4 A;  1OQQ A;  2ZW1 A;  2RMM A;  2BTE A;  2J42 A;  1SBB B;  4YTP B;  5LNK 1;  2QSD A;  4OZC A;  1KLU D;  4L1B A;  4OW0 A;  3J9C A;  1FXI A;  3L4P A;  4A8X C;  1FO4 A;  1TKE A;  2LFI A;  2INN E;  3MJ5 A;  4XE0 A;  1E6E B;  3AEC B;  1SE3 A;  1DGJ A;  3BVM A;  2SAK A;  3I57 A;  2M19 A;  2K3U A;  1L4D B;  2IGD A;  2KMM A;  2G1E A;  2WXK A;  1N5W A;  1HA5 A;  1QLB B;  2LHE A;  1DOI A;  1VZ6 A;  1JQ4 A;  1C78 A;  4IKG A;  1JWM D;  2M56 B;  1DOX A;  1YMH E;  2JU6 X;  2Y5C A;  4MH8 A;  1YN3 A;  3UI3 A;  3VR9 B;  3MHZ A;  2H88 B;  2VZK B;  1L0Y B;  2WP9 B;  5FR3 A;  4JWU C;  2AQ2 B;  5AUK A;  1XF5 L;  5HHD G;  2CJN A;  1GPX A;  3N9Y C;  1UWM A;  1EM7 A;  1SE2 A;  2Y5P A;  4OVZ A;  2LMC A;  4DXF A;  1XO3 A;  3W5V B;  2OHF A;  1D5M C;  1FEH A;  3AEF B;  5TSS A;  1L0V B;  5BYQ A;  3TEZ A;  1QOF A;  1NI3 A;  2N7J A;  1QKZ A;  3CWI A;  1SF0 A;  3GP7 A;  2JZP A;  4XWT A;  4WWM A;  5AUI A;  1TS3 A;  2WXN A;  1SEB D;  5BMH A;  2V3P A;  3AE7 B;  3AE3 B;  2FBW B;  4MT5 A;  4A55 A;  4WQM A;  3FIL A;  1NVI D;  2PTL A;  3AM9 A;  1K53 A;  1YNT E;  1FNU A;  2WXQ A;  4HRO A;  2I38 A;  1KFY B;  3RFZ B;  3P4P B;  4KKI A;  2E3T A;  4TMA B;  2X38 A;  3BWU D;  2E6X A;  3LB8 C;  2ACZ B;  4C80 A;  3E9S A;  4N58 A;  2QMT A;  1ZE3 D;  4NAM A;  2BBC A;  1VDV A;  1MI0 A;  1E10 A;  1I7H A;  1UWX A;  3BYT B;  1RYJ A;  3P63 A;  5EE9 A;  4TSS A;  2DLB A;  2WLB A;  4OHJ A;  4LK0 M;  4US8 A;  3IT4 B;  2AX5 A;  2WXJ A;  4JPS A;  2J53 A;  3BK1 A;  1FFV A;  2DYM A;  5GXG B;  2K0P A;  3FIL B;  1PUT A;  3DWM A;  2PMV A;  2KAC A;  1OFF A;  3IAS 1;  2PVG C;  3TEY A;  4TQ0 A;  1ESF A;  3P42 A;  3SR6 A;  2WXG A;  1L4Z B;  1Y56 A;  3U2S C;  4ARC A;  1N61 A;  3B2G A;  1TY0 A;  4GDK B;  1HZ5 A;  1QQR A;  4L23 A;  1TS5 A;  1GAQ B;  1NEK B;  1VLB A;  3AE4 B;  1MHX A;  1K52 A;  1B9R A;  1MVK A;  3URY A;  1PDX A;  4ZYS A;  4RFB A;  3BK2 A;  4RGN A;  5EE0 A;  2OED A;  3R2T A;  1V1P A;  1SJE D;  4OZB A;  1ZDX A;  1YN5 A;  5MPO A;  1HXY D;  3GS2 A;  4OZA A;  1VRA B;  2RDH A;  3W5U B;  4ZRP A;  5BMG A;  3ZGZ A;  1CK1 A;  1YN4 A;  2FE8 A;  2MJ3 A;  1N62 A;  3TUO A;  1QT9 A;  1HEZ E;  3HVZ A;  4FXC A;  3AE6 B;  3ZJT A;  2KDM A;  4US9 A;  3AED B;  1JWS D;  1NYQ A;  1UNS A;  5G5G A;  2YEP F;  2XN9 C;  3VRA B;  4RGM A;  1HQR D;  3R2I A;  2I2Y A;  1ET9 A;  4RF0 A;  2BB6 A;  1EWC A;  1ZP0 B;  2JQR B;  2QIL A;  2WXP A;  1E9M A;  1KRH A;  1TY2 A;  4JWS C;  2MJD A;  4KKJ A;  1ZOY B;  1I4H A;  4HKQ A;  4O1N A;  3ABV B;  2WXF A;  1V1P B;  1IBX A;  5BYR A;  3WCQ A;  4GLS C;  1E0Z A;  2ONQ A;  1KF6 B;  1PGA A;  2K9X A;  1FNW A;  2WXH A;  3NVW A;  1CQV A;  4Q2J A;  1KLG D;  3AEG B;  1EU3 A;  2LEK A;  3HVD A;  5C2T B;  1WWT A;  2BS3 B;  4A9A A;  1A70 A;  1TZO A;  3AEE B;  1ROE A;  4GDL B;  5H92 C;  3B9J A;  2R61 A;  3MFG A;  1QOB A;  1YQ4 B;  1HZ6 A;  1C77 A;  4RCO A;  3AV8 A;  1BUI C;  2MEK A;  1TKY A;  4JX1 C;  3T3N A;  1I4X A;  4YTN B;  2INP E;  3PZ7 A;  1IGD A;  2IDY A;  1GB4 A;  1F77 A;  4PT5 A;  1IBX B;  4HJG E;  1SB3 C;  2LUM A;  4AQ7 A;  4KGR A;  3NVY A;  4NZL B;  5HI1 A;  2VZK D;  5FK9 C;  2L52 A;  4USA A;  4YSZ B;  1DOY A;  2LGI A;  2WU2 B;  1XCT L;  1TJE A;  2BS2 B;  2DWQ A;  4KGS A;  1L5P A;  3V05 A;  1AW7 A;  1JWA D;  2EKI A;  2H89 B;  3VR8 B;  1YJI A;  1C4A A;  2JXT A;  3NVZ A;  1F0Z A;  2QEJ C;  1D5X C;  2Z8L A;  2QIE B;  2V3N A;  4ARI A;  1JML A;  5EE1 A;  4ZHP A;  3W1S A;  1JWU D;  2MJE A;  2V0G A;  3NUH B;  2WDV B;  1PFD A;  1N63 A;  2W82 A;  5BMI A;  1FD6 A;  1L0X B;  2DBY A;  2NTT A;  1JAL A;  3BVG A;  1C9F A;  1FNV A;  2V4I B;  1QF6 A;  3BVZ A;  4XWW A;  3AE9 B;  1M4V A;  2NMQ A;  3AH7 A;  1GOZ A;  2JX5 A;  2N0S B;  1C4P A;  4P16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...