2RPVA

Solution structure of gb1 with lbt probe
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
CYVDTNNDGAYEGDELSGTMEYKLILNGKTLKGETTTCAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two-point anchoring of a lanthanide-binding peptide to a target protein enhances the paramagnetic anisotropic effect
pubmed doi rcsb
source organism Streptococcus sp. group g
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rpvA00
4MACA 1K50A 4KGSA 1FCCC 1IBXB 1XCTL 2J53A 1MI0A 1JMLA 2PW9A 1F2RI 1HZ6A 2JXTA 5JXVA 4GLSC 3FILB 2I2YA 5HI1A 2OEDA 1MVKA 2ZW1A 1HEZE 2PTLA 2LHDA 2ON8A 1P7FA 4IOIE 2ZW0A 2JU6X 5BMGA 1PGXA 1K52A 1QKZA 2N9LA 2N7JA 2IGGA 2JWUA 2LGIA 2RMMA 1C9FA 4OZAA 4OZBA 3GB1A 1Q10A 2K0PA 1IGCA 2IGDA 4D2KA 1FD6A 4OZCA 2KWDA 2GB1A 2KQ4X 1UWXA 3MP9A 3UI3A 1IGDA 2KACA 1GB1A 1PGAA 1YMHE 2IGHA 1ZXHA 4WH4A 2ONQA 1HZ5A 1XCQL 4KGTA 5HFYA 1PGBA 5HG2A 2KDMA 1K51A 2NMQA 1P7EA 4HJGE 1GB4A 1KH0A 2JSVX 1EM7A 4KGRA 1MHHE 2EELA 3FILA 5BMIA 1YNTE 2PLPA 2QMTA 2J52A 2LUMA 1MPEA 2LHEA 2KN4A 2N9KA 4IKGA 1IBXA 1MHXA 2JZPA 1FCLA 1XF5L 3V3XA 1D4BA 2I38A 4HKZE 2GI9A 1K53A 5HHDG 1F2RC 2RPVA 5BMHA 2QSDA
chains in the Genus database with same CATH superfamily
4BAXA 1LQBA 1YQ3B 1FCCC 1VLBA 3ZYYX 1MI0A 1X1MA 2LD9A 2QCZA 1EUVB 2LVQA 3PPAA 2HDEA 2RDBC 1TYGB 3JSVA 4EZLA 1WMHA 4ZRQA 1L5PA 1JWSD 1M4VA 1ZDXA 2REXA 5AZHA 2CHZA 3P4QB 1MVKA 3W1SC 2DZKA 1WM3A 1PGXA 3Q14C 2YEPB 3TMPB 2KC2A 2PVGC 3MJWA 1V5OA 3PRPB 3BVZA 1FM0D 4C00A 2JWUA 1IGCA 2IGDA 4RCOA 4LJOB 4KX6B 2KMCA 2WXKA 3Q8AA 5AEKB 4WH4A 1L0VB 1EWCA 1XLOA 2AX5A 1WYWB 2KDMA 4YT0B 4M00A 3MFGA 2K39A 2CJNA 3I63C 2IO3B 5G5HA 1SJHD 1R4NI 1WGHA 2BQQA 2KWVB 2KVRA 1TGZB 2L1AA 4MGZE 4XE0A 2L52A 2BW2A 5G5GA 3KWVA 1J7AA 1SSNA 4ZYNA 4BKSA 1SGHA 3UIPB 1WZ0A 2Z8LA 3AE1B 3AM9A 1OTRB 1WMHB 4EUTA 5KHQA 4C4VA 3URYA 3L08A 4DWFA 3N1XC 2WP9B 3ENEA 4P6VF 4OVUA 2KMMA 2OHFA 3IT6B 4FULA 4EE2A 2N9XA 1A70A 1JWBD 2KQ7A 2KK8A 1UD7A 5EDSA 1ZOYB 1WRIA 4HK2A 1DGJA 2R2OA 2G1EA 3KUDB 3NRZA 3ZXRA 2OEDA 2BTEA 3PZ8A 3ML9A 3MC8A 4JE3B 4PYUA 5H8YE 1P7FA 3QHTA 2MBBB 4NAWB 5BMGA 4BKSD 1SE2A 1WI0A 2ZCCA 3PTFC 4MM3A 4WIPA 4AJYB 4C7ZA 5E6NA 2NBWB 2G3QB 1Q10A 3RT3B 1KLVA 3V6EB 3UI3A 1WJ6A 2N1VA 3N20C 5HFYA 3ONSA 2CU3A 4TUUA 4L23A 2BPSA 2OJWA 3TIXA 1YQBA 5TSSA 5IN7A 1CZPA 3VAWA 1NYRA 1WM2A 3AXCA 2KJRA 4IKGA 4B6WA 3GZNI 4S0RA 1BUIC 3DBRB 1P9DU 5E6JA 1E10A 1PQSA 2MX2A 4AP4C 1WJNA 1AARA 3VR9B 2EMSA 2N7EA 3R7RA 2VZKD 3BVMA 2LVOA 2K6DB 1F2RI 4GB9A 3V05A 3PGEA 1WY8A 4K7WA 4NJCA 4CHKA 4A9AA 2Y5BB 2BS3B 2NPTB 2R2QA 4FHJA 2BKRB 4IM0A 5C3JB 1VR9A 1QT9A 1GC6A 2X8XX 2KJHB 2ZPYA 3TCAA 2WU5B 1V86A 4P16A 2L76A 2KKCA 4MT5A 3RULA 3EGRA 4LCDE 2ZPNA 3QJZA 2K9XA 4OZAA 4YSXB 2M56B 1YN4A 3C19A 4F8CB 4MJSB 2KFKA 1GG3A 2W3RA 2NTTA 3ZJVA 5LXIB 4GDKB 1E8ZA 2N0SB 2W3SA 4FN2A 3DBHB 1K51A 1PDXA 3GOEA 1WR6E 3A9KB 1VJKA 3SFDB 2JSVX 3OG5A 3NVZA 4YSYB 1L6UA 4EZKA 2WXQA 2PLPA 2WXMA 5DPSA 2R61A 2O2VA 4ANXA 3C0RB 3CWIA 2D07B 4ZRKA 2MLBA 4MEMA 2NVUI 2MEKA 1FCLA 1WF9A 2GBRA 3S2AA 1VZ6A 3KWLA 1C4CA 2LFIA 3ZDMC 2C5LC 3HVZA 2D2QA 1UH6A 1E5WA 5DPRA 1I4XA 2J53A 4II2B 1NEKB 1HXYD 2O6VB 1L2NA 3A9KA 3ETRA 1T0SC 1FFVA 1E6EB 1VCBA 4W9JA 2RGFA 4OHJA 1UGJA 4DK5A 3EFCA 1UBIA 5D94A 5IOIA 2CHXA 3ZNHB 4HDOA 2M0XA 1QKZA 4ICUA 4YL8A 3HM6X 4GMVA 4ICVA 1N6ZA 1ZP0B 1WXSA 1E7VA 4REZA 1ET9A 4BKGA 1C4AA 2KDBA 1YN3A 3N3KB 4DQOC 1HZ5A 1BXTA 3AH7A 2WXFA 2PE9A 2BYEA 2KDFB 1B1ZA 5JH5C 4W9IA 1YD8U 1G6JA 1ACCA 3B2FA 5IA7A 2K5PA 3AULA 4DHJD 2AQ2B 3AE4B 3T8MA 2Z0EB 1LGRA 4A3OA 1L4ZB 2V4LA 2KLGA 3PV1A 2WDVB 1T0YA 3DVNU 1WX8A 3DDCB 2IDYA 2RDGA 1YJ1A 4K7SA 3HUIA 2WDQB 4XX5A 3CF6E 5DPWA 4IWQA 1I4QA 3WANA 3E56A 2BYVE 1IP9A 2AEHA 2B3AA 5C1ZA 2NTSA 2M8SA 2DYBA 3WIMA 5BMHA 3LJ3A 1AWDA 2LEKA 3RN9C 3PZ7A 1IBXB 3IBEA 2HJ1A 4HKQA 5L95C 3H6NA 3I5JC 4ASWC 1GC7A 2KDIA 2KYWA 4HCNB 3M63B 3BK1A 4BOSC 4GGQA 3IAM1 4JQWC 3OWEB 4LDTB 5IAAC 3TUOA 2D3CA 2K3UA 1E90A 1FNWA 3AEAB 3H9DA 1RYJA 3AU5A 4HPLB 1RFKA 2ZVNA 3OAWA 1JALA 1QILA 2KT7A 4MDKE 2W9NA 2DHZA 3CSFA 2LMCA 2LGXA 1FNUA 4EZJA 5E6OA 1GJZA 4RGTA 4JLCA 4OZCA 2QJLA 3W5VB 2KQ4X 4BVUC 1D5MC 2MH7A 1N63A 4LTUA 3RCZA 2GBNA 1YIWA 3SFEB 1WXVA 5BYQA 2WXRA 4ANUA 2L05A 1P3QU 4L1BA 3AEFB 2INCC 1OGWA 4N9F4 1L7YA 2WXLA 3N1ZC 2LJ5A 3P4RB 1TJEA 2NCNA 2LJIA 4ZOHC 2ZNVC 2FBWB 3EUB2 1MG4A 3VUWA 2W55A 1WGRA 4CQNA 4JWSC 3U7ZA 4W9KA 1OQQA 3P2BA 2LXAA 4OW0A 3TSSA 4JX1C 1MJDA 1F0ZA 3IFWB 3R2IA 4A6QA 1F2RC 3T3OA 3MTNB 3NVYA 2VH1A 2HTHA 3ZJTA 4KGSA 4WWOA 1WJ4A 4E71A 2I1JA 3QAQA 4IC7B 3IG3A 1JMLA 3ZXVA 1JWMD 5JXVA 1CQVA 1L6VA 2E6XA 4M8NA 1TS5A 3HRDD 3SDLC 2GOWA 3RUIB 2IO2B 4HPPA 3BZDB 4HLEA 3OJ3A 4NAMA 2BWFA 2SAKA 4ZRPA 1HEZE 4N59A 1TS4A 1HTOA 1E7PB 3ZRCA 1RWSA 3IAS1 3VDZA 4ANWA 2JX5A 5JHBA 1R4MI 1U4AA 2KVZA 3NUHB 3JVZX 1WGDA 2G45B 2LXCA 2BKFA 2WHIA 4DXAB 3TEZA 5EE9A 2JZ3B 3OLMD 1ISNA 4KDLB 3DBLB 3A4RA 4DXGA 2KACA 2D3AA 1ZE3D 1LXDA 2N7DA 1F1HA 1JRPA 2PIAA 4RM8A 4RF1A 4PT5A 2YLMA 5GMVA 5CTRC 2DZIA 1YN5A 1DYQA 1S3SG 2FUG1 1UBQA 2ZZPB 2INPE 1HTQA 4OVZA 4MELA 3V61A 3QWZB 1WH3A 2KTFA 2KHWB 3W2DA 2BS2B 1J19A 3BWUD 3NOBA 5D7GA 3VUYA 4K1RB 2JQRB 1WX9A 4PK1A 1N61A 2QHOA 1NDDA 2KNBA 3J9CA 2RPVA 1NVID 1GAQB 2QSDA 5CHFA 1HA5A 2M1MA 2FIFA 4TSSA 1WXQA 4BKTA 1V97A 2JRIB 1KLUD 1I4GA 5I4DA 2BGFA 2GMIC 2LASA 2Z0DB 3K9PB 1QOBA 4H2AA 4WWMA 1HZ6A 3DBSA 3TBLD 1DOYA 1Z2MA 3KUCB 1Q1OA 3PRMB 1E8YA 1ZW7A 1UWMA 1N5WA 2K22A 4NJ6A 3HK0A 4AJWA 3DPDA 1MFWA 2W82A 3RNGC 4Q2JA 2TSSA 2NR2A 4O1NA 4DDID 1XQQA 1UGMA 2WX0A 4JIOU 3K9OB 4KKJA 1IYFA 5D3DA 2G4SA 1WXMA 2RDHA 2DWQA 3DWGC 3WCQA 2KJ6A 3A4SC 4NPNA 2QIEB 1EWYC 2FCQA 4HRSA 5LXHA 3E9SA 2UWQA 3BIID 2WXPA 1R7SA 1ENFA 1QOFA 5IP4D 2MA9B 4YXDB 3KYDD 3M95A 1JCKB 2EKIA 3LYYA 5HG2A 2MP2A 3B0AA 2O2VB 1RLFA 1T5XD 1KJTA 4AWJA 2PEAA 2GRIA 3TL5A 1TY2A 2DZMA 2L0TA 3HM3A 2K8HA 2EELA 4WWPA 1YNTE 3R66C 4IDIA 2KN4A 3DBRI 3AECB 2XEWA 1C3TA 4HDQA 4DBGA 4RFBA 5J18A 5DCNA 3AE3B 2V0GA 2JZPA 1RFAA 2DNFA 2AL3A 3VVWB 4I6PA 4AOFA 2CHWA 5H92C 1H8CA 2V9HA 3GS2A 2JWZA 4W9FA 2JZZA 3V62A 3B08A 1NBFC 2M0AA 1XCTL 4WURA 3UINB 5LNK1 1V49A 2BBCA 4MSQB 4B95A 4BZAA 4F1SA 2JYTA 3Q8EA 3NHEB 2VH2A 4PS3A 2NS5A 4HXDA 1R4MB 2DBYA 4G0NB 3ZW3A 1V80A 3T3NA 5EE1A 4KIKB 2PTLA 5E6PA 2LHDA 1CK1A 3NZUA 2RR9A 1L0YB 1KOTA 1FMAD 1T3QA 2KX3A 3KVFB 2N1WA 2N9LA 1WYGA 3Q3MC 3AE2B 2RMMA 2XNAC 2G9HD 3PS6A 4B0MA 1D5ZC 4GOCA 3NS1A 2KTRA 1SE4A 4YWGG 2C60A 3PLUA 2IGHA 4K3CA 3PRZA 2BB5A 2WXHA 3RYTA 2NMQA 1DOIA 4XC2A 1K8RB 4M0WB 3QK0A 1EM7A 2QDFA 1NYQA 2WXJA 4HVBA 2JF5A 3A1QA 5LLIA 2BWES 2WU2B 1LFDA 1I4RA 4KIKA 2D5GA 3N9YC 5L83A 1A5RA 4CYEA 4EEWA 2VZKB 5AUIA 3PVLA 1IBXA 3DVGY 2AWTA 2KAJA 1ZDVA 3BYTB 2L0FA 1TY0A 4AQ7A 2KDEB 1KTKA 3R8BA 2GI9A 1K53A 1NENB 3RMKC 1J7CA 3NJTA 2HTME 2KTRB 1TBEA 3RZWC 1PYWD 4BBNF 2GLSA 1Y8RC 1F9JA 3TEYA 2Z59B 3RNBC 2KO3A 1XLQA 1QOGA 4URKA 4NQKE 5G55A 4GXBA 4GLSC 3DHGC 2LVPA 3ZNGC 2IO1B 3AB5A 1WX7A 4P7IA 1XT9B 1XEEA 2Y5PA 3RI7C 2L3ZA 4AS1A 4IOIE 2JU6X 1WE6A 1OEYJ 2JY6A 4BBNC 1AYFA 2MJDA 1N5XA 3DHIC 4LNFA 2FCMA 3L0WB 2JUOA 2KD0A 1QLBB 4M0WA 3L17A 4M02A 4JL9A 1TT5B 3ALBA 1VDVA 3BK2A 2B76B 1ESFA 3TEXA 1D6EC 2K1FA 4A8XC 4KGTA 3Q8BA 1JROA 1WRDB 2BT6A 3ABVB 3DVNV 1V1OA 4WJNA 3AU4A 3GZNB 3AE8B 3VXWA 2XK5A 1J8CA 1S1QB 3Q2AC 4M01A 3U52E 4BOZB 1RM6C 3DVGX 2N4FA 2KX0A 4S17A 1XXGA 3NG0A 3H1UA 3A1QB 1MG8A 4XWWA 2GBKA 4G50A 3CIRB 1SE3A 5BYSA 2WGSA 1XF5L 2JYEA 2I38A 2MBEA 1FNVA 4IM2A 1I4HA 2WYQA 2KN5A 3AN1A 4EOYA 1F77A 3ZO5B 2MWSB 3Q3OC 4GIVA 2J42A 1P0RA 4QAYA 2ZVOA 1TKEA 2WS3B 4WAFA 1V1PA 4P1BC 3FILB 5CHWA 3MC9A 4I6LB 1LO5D 1VZ7A 3ZVVA 3ZJUA 4MH0E 5EE3A 3R3MA 2BB6A 1BMLC 1OQRA 4FLHA 4NY0A 1YX5B 3N30A 3ZTCA 2DZJA 2PVOD 2D3BA 4II3B 2K8CA 3AEDB 1CMXB 2JPHA 5CHVC 1FXAA 4LNKA 3N32A 2IBIB 2GB1A 4A20A 5AUKA 2C7NB 2CS4A 4WQMA 3QX1A 4HJKA 3AE5B 3RZFA 1SBBB 4E3CA 2ONQA 2FAZA 2WXNA 3APCA 2L83A 3U8ZA 3EA6A 4MGYE 2D3GA 1SIFA 4W9DA 4AUQC 3NZ3A 3H7SA 2ZCBA 2E3TA 3VQIA 1J7BA 5BMIA 1UELA 4ITKA 1ET6A 4KSKC 4KKIA 4CO7A 4US8A 3VUXA 3IXSA 2PPHA 1BT0A 1P1AA 2LGSA 1GUAB 5D3IB 1J0GA 3ZTDA 3V3XA 3I57A 2DYMA 1VRAB 1T0QC 4HKZE 3TJPA 3PO0A 3UIOB 4MJSA 2KFKB 4ZRIA 2GBMA 1FRDA 2J52A 1TKGA 2HD5B 1K50A 2O6VA 3EC8A 1EU4A 4OVVA 3WAOA 4HROA 2PW9A 4K81A 2C7MB 1EF1A 4MM3B 4RMAA 3V6CB 2ZNVB 1N60A 2WQYB 1JW9D 2O6VD 1V81A 2KQSA 4FADA 2M19A 3ZKJC 1C77A 5FK9C 3TEWA 4IW0A 4USAA 4C80A 2V4IB 4KZCA 3PZDA 4FBJB 2ZW0A 3VFKA 2WDTB 3CMMB 2KMAA 2A5UA 2N7JA 1WZ3A 1YJJA 4YTMB 2KWDA 3O13A 2MSED 1GB1A 4XDDA 2KWUB 3KH0A 2J0JA 3P63A 3VTUA 2L8JA 1UNSA 2HE7A 3APDA 1GB4A 2CU1A 4LJPB 3BYYB 2BF8B 2NPTA 3MHZA 3ZGZA 2CKHB 3RNEC 2JRHA 2PE6B 3H8HA 2LUEA 3WAMA 1FIQA 2Y5CA 4HCPB 4JPSA 1MHXA 2XBBC 1TS2A 2EKEC 2ICIA 4NNJB 4TQ0A 1EF5A 4MGIE 2FIDA 4J3OD 3U7DA 3L13A 3ZUNA 3UQAA 5FR6A 2IYDB 3RD2A 2V3NA 2AYOB 3L10B 2K8BA 2K25A 4ACFA 5J2RA 2RSUA 2M4NA 4HPMB 5HI1A 3W1YA 1SJED 4LLGM 3P1MA 3W5UB 1PUTA 3SEBA 4IUMB 5C23A 5BO4B 4W9GA 1WJUA 1QZEA 5IO9A 2H88B 1I7HA 4FHKA 3DBHI 3KQ4A 2ACZB 2LGIA 3AEEB 3EFUA 3NZSA 4OZBA 1LM8B 3EECA 4IWPA 4JGHB 3GB1A 3MC0B 3RNAC 2FNJB 1D5XC 4D2KA 3KYCD 3GP7A 1SIJA 1P98A 1UWXA 1L4DB 3AMZA 1YMHE 4ZHOA 5CX3A 2V1YA 4WJPA 4C4VB 3AE9B 1Z5SB 4YTPB 3ZRFA 1M94A 2KXJA 3ML8A 2J4XA 1FXTB 1TIFA 3X0WA 3VR8B 1I42A 1KH0A 1HE8A 4WAAA 4HEA1 2RD0A 1SEBD 3FILA 2BS4B 4G3XB 4A90A 2WNMA 3L16A 1R4NB 4ANVA 4HWIB 1MPEA 1V9JA 3LDZE 2MHJA 3PREA 3LB8C 1STEA 3ZDTA 1WFYA 3AE7B 2N9KA 2WWZA 5HKHA 4PS7A 4GN1A 2VRRB 2KLCA 2L7RA 3C8YA 1OFFA 5HHDG 1TTNA 5D6JB 3OJ4B 2LGYA 3PLVA 2N9EB 3ZLZA 1JQ4A 3L4PA 4GU2A 1DOXA 4B9KA 3Q3NC 3W9CB 1ZGUB 4DHZE 2OOBB 5FR3A 3DHHC 1YQ4B 2MJ3A 3P4SB 4X57B 1TS3A 4JWUC 2BYTA 1KRHA 1V5TA 2DX5B 3NVWA 1RRBA 4KZ0A 5MPOA 1WSPA 1OEYA 3RPFC 4G11A 1GPXA 1T0RC 2FE8A 1ZKHA 2KC1A 4C7YA 3JSVB 3FC4A 2WLBA 1E8WA 2YVCA 2CR5A 2J7QB 1WGKA 4F7ZA 3NS8A 3A9JB 1EU3A 1NI2A 1KFYB 2AQ3B 3P4PB 3PT2B 3Q3JA 2PMVA 2KANA 1L0XB 1PGAA 2FUHB 2J0MA 2WXGA 1WIAA 4XZ4A 1IUEA 1ZUD2 1VD2A 2MW5A 3WAPA 2C9WB 1XCQL 1PGBA 3BINA 1F52A 3AEBB 4WJQA 2L00B 3Q8CA 3NY5A 1WR1A 2ASQA 4XWTA 2ZEQA 3ZNZB 4EFOA 1JWAD 2YEPF 2DAJA 4TMAB 4IM3A 2G4DB 1C76A 2PJHA 4BFRA 4ZYSA 2NBUA 4MGKE 5KHOA 3VTWA 4K7UA 3R7QA 1KLGD 1I35A 2C7HA 4W9HA 3N1YC 3AE6B 4N6EB 1N62A 4WQOB 1C78A 1D4BA 2UU7A 3AI5A 3SR6A 4UDUC 4W9LA 4TKNA 2IY0B 4RGNA 3FAHA 3PSEB 4XDCA 3UF8A 4KDIC 1H4RA 1VZ8A 2MBQA 2JXTA 4RH6A 3DCGA 3ZNID 4E74A 5TR5A 2LWPA 3VRBB 3JW0X 5JZEB 1WE7A 1WWTA 2ZW1A 3Q8FA 2KWCA 1XD3B 4RNAA 2N9PC 3ZIMA 1ROEA 3H7PA 3V60A 1XLPA 1GOZA 2IGGA 2KZRA 4GDLA 1XLNA 2V3SA 1Y56A 2V3PA 4W9EA 3HHMA 2J0KA 1TKYA 2KOXA 4N58A 4W9CA 1T6BX 3M3JA 2IY1B 1CJEA 4NAWA 5DPTA 2MP2B 1GNUA 2M17A 3IHPC 1UUPA 2ZJDA 2UYZB 1SB3C 2AL6A 4I6NB 3WA0A 5BYRA 4FXCA 4PS8A 3QA8A 4XGAB 3Q6BA 4LNIA 2I1KA 4ARIA 5T8IA 4RGOS 3SU8X 2MCNB 4C56C 2MQJA 2QMTA 3IVFA 2LHEA 1E8XA 4KSLC 3KLSX 3JYUA 2JVCA 2AQ1B 3GE3C 4B0EA 2WX1A 1C4PA 2LGDA 1FXIA 4WWNA 1SE9A 1V6EA 2HJ8A 1I4PA 1RAXA 1JWUD 4YSZB 4RGMA 3ECIA 4MACA 4ZDVA 1OQYA 2QILA 4FJVB 4IWOA 3T9LA 4M8MA 2A4ZA 2DAFA 1C1YB 1KM7A 3H7PB 2L32A 3VH4B 2LRUA 4PYZA 4DHZB 4L2YA 3B1LX 4R3DA 2JXXA 2Y3AA 3UQBA 3ZQ4A 3DBLI 1QQRA 3IT4B 1PFDA 2NBVB 4RF0A 4XYCA 3Q69A 2ON8A 2BYFA 4RM9A 4NZLB 3I9V1 3SD5A 1K52A 3W1SA 3AEGB 1FEHA 1YJIA 3LXFA 3QIJA 1FPYA 3HIZA 1C9FA 1SXTA 1D3ZA 3DOWA 1WGYA 3RFZB 4GSWA 4GDLB 1IGDA 2LRWA 4J6IA 3CSTA 1NI3A 2WXIA 1V1PB 1ZXHA 2FCSA 1C79A 4EKUA 4LNNA 2MBOA 3M62B 1P7EA 3B9JA 5GXGB 1IPGA 3P42A 4IG7B 4LNOA 1XO3A 3A9JA 3FKYA 3U2SC 4WJOA 5IKCM 4YTNB 1UF0A 1WGGA 2W54A 3O65B 3PHWB 1QOAA 2LI5A 3SHQA 2LZ6A 1WXAA 5D2MB 4DDGD 1AW7A 3WALA 1V2YA 1YOVB 3MJ5A 3X23A 2GBJA 3KUZA 2IPKD 2X38A 3VH3B 1Q0WB 4KVGB 1FRRA 4FJZA 2DENB 3UGBB 4DHJB 4ZHPA 3PHXB 3QCAA 4DXFA 1AN8A 2D10A 2SEBD 3NVVA 2KFJA 3U30A 3QQ8B 2FCNA 1E7UA 3VTVA 2Q5WD 2INNE 1HQRD 2WDRB 2I2YA 1V8CA 4FA6A 3VRAB 1E0ZA 1FFUA 3A33B 5C2TB 2IJ0A 2IO0B 2PKOA 2QEJC 3B2GA 3U4EG 4MH8A 2OJRA 1TZ1A 4P1CC 2QC8A 2MJEA 4TV3A 3DQVA 5AZGA 1B9RA 3Q3FA 1KF6B 1YX6B 2EMTA 2RPQA 3VHTC 2JT4B 5G2NA 3L54A 3RNCC 2K0PA 2K6QA 3APFA 1FD6A 2WXOA 4KV2A 3HVDA 2IZVB 3MP9A 3BVGA 5JHAA 5AZFA 2CJOA 2XK5B 2MRPA 4A3PA 5FKAC 2BVCA 4HJGE 3GE8C 2D11A 3I3TB 3R2TA 4K3BA 1EO6A 3EHVA 3MHSD 4NJ7A 1FO4A 2INDC 2XN9C 4KGRA 2H89B 3QC8B 3BY4B 2DYOA 4US9A 1MHHE 1Q5WB 3QARA 1SF0A 4LK0M 1TZOA 5EE0A 3D32A 1ZXIA 1QF6A 1UZXB 5J17A 2LUMA 3RNFC 4ARCA 3KW5B 4LDTD 3DWMA 2DLBA 3AV8A 4A55A 4ZRJA 1E9MA 2MBHA 4TQ1A 1ZPSA 4GDKA 1JRUA 4FJYA 4MSMB 4NQLB
chains in the Genus database with same CATH topology
1J7CA 1AWDA 2LEKA 2HTME 3PZ7A 1PYWD 1YQ3B 1JQ4A 1FCCC 1IBXB 4HKQA 1VLBA 3TEYA 3L4PA 1MI0A 3ZYYX 1DOXA 1XLQA 1QOGA 3BK1A 3W9CB 3IAM1 2HDEA 4GLSC 1TYGB 3OWEB 4ZRQA 3AB5A 5FR3A 1L5PA 1JWSD 1M4VA 1ZDXA 3TUOA 2K3UA 1YQ4B 2MJ3A 3P4SB 1MVKA 1TS3A 3P4QB 1FNWA 4JWUC 2BYTA 1KRHA 3AEAB 1XEEA 1RYJA 2Y5PA 3NVWA 5MPOA 4AS1A 1WSPA 3RPFC 4IOIE 1GPXA 2JU6X 1RFKA 2FE8A 1PGXA 1JALA 2YEPB 1QILA 4C7YA 1AYFA 2MJDA 1N5XA 2PVGC 3FC4A 3BVZA 2WLBA 1FM0D 2LMCA 2JWUA 1FNUA 1WGKA 1EU3A 4RGTA 1IGCA 2IGDA 1QLBB 4M0WA 4RCOA 1KFYB 2AQ3B 4OZCA 2QJLA 3P4PB 3W5VB 2KQ4X 2PMVA 4KX6B 1D5MC 1L0XB 1N63A 1PGAA 2MH7A 2WXKA 4LTUA 1VDVA 2WXGA 3BK2A 2B76B 3Q8AA 3SFEB 1ESFA 3TEXA 1IUEA 1D6EC 1ZUD2 4WH4A 5BYQA 4A8XC 1L0VB 1EWCA 2WXRA 1XCQL 1XLOA 2AX5A 3Q8BA 4KGTA 1PGBA 1JROA 2KDMA 4YT0B 2BT6A 3ABVB 3AEBB 4L1BA 3MFGA 3Q8CA 1V1OA 2CJNA 3AE8B 3AEFB 5G5HA 4XWTA 1SJHD 3U52E 1RM6C 2WXLA 3P4RB 1JWAD 1TJEA 2LJIA 2YEPF 4ZOHC 2L1AA 4TMAB 1XXGA 2FBWB 3EUB2 1C76A 4XWWA 4ZYSA 4XE0A 2W55A 1KLGD 2BW2A 2L52A 5G5GA 3KWVA 3CIRB 4CQNA 1J7AA 1SE3A 4JWSC 1SSNA 3U7ZA 5BYSA 3AE6B 1OQQA 4N6EB 1N62A 1XF5L 2Z8LA 3AE1B 2JYEA 3AM9A 4OW0A 1C78A 1D4BA 3TSSA 4JX1C 2I38A 1F0ZA 3R2IA 4A6QA 1F2RC 3T3OA 1FNVA 3SR6A 3URYA 1I4HA 4UDUC 3NVYA 3ZJTA 3AN1A 4KGSA 1F77A 2WP9B 4RGNA 3FAHA 4P6VF 2KMMA 2OHFA 3IT6B 4XDCA 4EE2A 1VZ8A 1JMLA 2J42A 1A70A 1TKEA 1JWBD 2JXTA 2WS3B 1JWMD 4WAFA 1V1PA 1ZOYB 1CQVA 1WRIA 5JXVA 1L6VA 1DGJA 2E6XA 1TS5A 3FILB 3HRDD 4RH6A 1LO5D 1VZ7A 2G1EA 3ZJUA 3BZDB 3NRZA 2OEDA 3VRBB 2BTEA 3PZ8A 4NAMA 5EE3A 2BB6A 2SAKA 4ZRPA 1WWTA 2ZW1A 1BMLC 4JE3B 1HEZE 4N59A 5H8YE 1OQRA 1TS4A 1E7PB 1P7FA 3Q8FA 4NAWB 5BMGA 2PVOD 1RWSA 3IAS1 2JX5A 4RNAA 1SE2A 1ROEA 1XLPA 1GOZA 2IGGA 3NUHB 3AEDB 4WIPA 4C7ZA 1XLNA 1Y56A 1FXAA 2V3PA 1Q10A 1TKYA 4N58A 3TEZA 5EE9A 1T6BX 2GB1A 1CJEA 4DXGA 5AUKA 3UI3A 2KACA 1ZE3D 4WQMA 1JRPA 1UUPA 3AE5B 2PIAA 1SBBB 4RF1A 1SB3C 4PT5A 2ONQA 5HFYA 5BYRA 2WXNA 2CU3A 2L83A 1YN5A 4L23A 1DYQA 4FXCA 2FUG1 3EA6A 2INPE 4OVZA 5TSSA 4ARIA 5T8IA 4RGOS 3NZ3A 1CZPA 2E3TA 3VQIA 3W2DA 1NYRA 2BS2B 1J7BA 5BMIA 3BWUD 4ITKA 4C56C 5D7GA 1ET6A 4KKIA 2QMTA 4US8A 2LHEA 2JQRB 3IXSA 3KLSX 4IKGA 2AQ1B 1N61A 5D3IB 1BUIC 4B0EA 1C4PA 3V3XA 3I57A 2DYMA 1FXIA 5E6JA 1E10A 1VRAB 4HKZE 1I4PA 3PO0A 3J9CA 1JWUD 2RPVA 1NVID 4YSZB 1GAQB 1FRDA 4RGMA 2J52A 2QSDA 4MACA 1HA5A 1TKGA 4TSSA 1K50A 1WXQA 3VR9B 1V97A 1EU4A 2QILA 2VZKD 1KLUD 1I4GA 4HROA 5I4DA 3BVMA 2PW9A 1F2RI 1QOBA 3V05A 4H2AA 4MM3B 4WWMA 1HZ6A 1DOYA 4NJCA 2L32A 4A9AA 1N60A 4L2YA 2WQYB 4R3DA 1JW9D 2BS3B 1UWMA 2Y3AA 1N5WA 2K22A 2M19A 5C3JB 3ZQ4A 1VR9A 1QQRA 1QT9A 3IT4B 1C77A 5FK9C 1PFDA 2W82A 4RF0A 3TEWA 3Q69A 2ON8A 4USAA 4C80A 2V4IB 2WU5B 2ZW0A 4P16A 4Q2JA 2TSSA 4MT5A 4NZLB 3I9V1 4O1NA 1K52A 3W1SA 3EGRA 3AEGB 1FEHA 1YJIA 2N7JA 3LXFA 4KKJA 1C9FA 2K9XA 4OZAA 1SXTA 5D3DA 4YSXB 1YJJA 2M56B 1YN4A 4YTMB 2RDHA 2DWQA 2KWDA 3DWGC 3WCQA 3O13A 3RFZB 4GDLB 2W3RA 2QIEB 1EWYC 1IGDA 1GB1A 4HRSA 1NI3A 4XDDA 2NTTA 3E9SA 2WXIA 3BIID 3ZJVA 2WXPA 1V1PB 1ZXHA 4GDKB 1R7SA 1C79A 1ENFA 2N0SB 2W3SA 1QOFA 4YXDB 3P63A 1JCKB 2EKIA 3LYYA 5HG2A 1K51A 1P7EA 1UNSA 1PDXA 1GB4A 1T5XD 3B9JA 5GXGB 3BYYB 3P42A 1VJKA 3SFDB 2GRIA 2JSVX 1TY2A 3NVZA 4YSYB 3MHZA 1L6UA 2EELA 1XO3A 3ZGZA 1YNTE 2PLPA 2WXQA 2WXMA 3H8HA 3U2SC 2R61A 4YTNB 4IDIA 1FIQA 2KN4A 3CWIA 3AECB 2W54A 1QOAA 2Y5CA 4RFBA 4JPSA 2MEKA 3AE3B 1AW7A 1MHXA 2JZPA 2V0GA 1FCLA 1TS2A 3MJ5A 2ICIA 2IPKD 4TQ0A 2X38A 1VZ6A 3KWLA 1C4CA 5H92C 2LFIA 3GS2A 3HVZA 4J3OD 1FRRA 1I4XA 2M0AA 4ZHPA 1XCTL 2J53A 4WURA 4DXFA 2V3NA 1AN8A 1NEKB 2SEBD 5LNK1 3NVVA 1HXYD 2BBCA 2JYTA 3Q8EA 2Q5WD 2INNE 1HQRD 2WDRB 3ETRA 5HI1A 2I2YA 1V8CA 1FFVA 1E6EB 3VRAB 1E0ZA 1SJED 1FFUA 4LLGM 3P1MA 5C2TB 2IJ0A 2DBYA 4OHJA 1PUTA 2PKOA 2QEJC 1UGJA 3B2GA 3SEBA 3W5UB 3T3NA 5EE1A 3U4EG 2PTLA 2LHDA 4MH8A 1CK1A 2MJEA 1L0YB 2H88B 1I7HA 1FMAD 1T3QA 1B9RA 1KF6B 1QKZA 2N9LA 3KQ4A 1WYGA 2ACZB 3AE2B 2LGIA 2RMMA 3AEEB 2XNAC 4OZBA 2G9HD 1ZP0B 3GB1A 3MC0B 2K0PA 4B0MA 1D5ZC 1D5XC 4D2KA 1FD6A 2WXOA 3GP7A 1SIJA 4REZA 3HVDA 1UWXA 3MP9A 1L4DB 3NS1A 1ET9A 1SE4A 4YWGG 3BVGA 3AMZA 1YMHE 1C4AA 4ZHOA 2IGHA 3AE9B 1YN3A 4YTPB 4DQOC 1HZ5A 2CJOA 1BXTA 2BB5A 3AH7A 2WXFA 2WXHA 5FKAC 2NMQA 2J4XA 4HJGE 1B1ZA 1DOIA 3R2TA 1ACCA 3VR8B 1FO4A 3B2FA 2XN9C 1KH0A 2K5PA 1EM7A 2H89B 4KGRA 2AQ2B 1NYQA 2WXJA 2DYOA 4US9A 3AE4B 1MHHE 1SF0A 4HEA1 1SEBD 3FILA 2BS4B 4LK0M 1L4ZB 4A90A 1TZOA 2WNMA 2WU2B 5EE0A 1ZXIA 1I4RA 1QF6A 2D5GA 2LUMA 1MPEA 2WDVB 3N9YC 4ARCA 3LB8C 1STEA 2VZKB 2IDYA 3AE7B 5AUIA 2RDGA 2N9KA 1IBXA 3HUIA 2WDQB 3DWMA 2DLBA 2KAJA 3AV8A 4A55A 1ZDVA 3BYTB 1E9MA 1I4QA 1TY0A 4AQ7A 3E56A 3C8YA 1KTKA 1OFFA 4TQ1A 3R8BA 2GI9A 1K53A 1ZPSA 2NTSA 5HHDG 1NENB 5BMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAC A;  1K50 A;  4KGS A;  1FCC C;  1IBX B;  1XCT L;  2J53 A;  1MI0 A;  1JML A;  2PW9 A;  1F2R I;  1HZ6 A;  2JXT A;  5JXV A;  4GLS C;  3FIL B;  2I2Y A;  5HI1 A;  2OED A;  1MVK A;  2ZW1 A;  1HEZ E;  2PTL A;  2LHD A;  2ON8 A;  1P7F A;  4IOI E;  2ZW0 A;  2JU6 X;  5BMG A;  1PGX A;  1K52 A;  1QKZ A;  2N9L A;  2N7J A;  2IGG A;  2JWU A;  2LGI A;  2RMM A;  1C9F A;  4OZA A;  4OZB A;  3GB1 A;  1Q10 A;  2K0P A;  1IGC A;  2IGD A;  4D2K A;  1FD6 A;  4OZC A;  2KWD A;  2GB1 A;  2KQ4 X;  1UWX A;  3MP9 A;  3UI3 A;  1IGD A;  2KAC A;  1GB1 A;  1PGA A;  1YMH E;  2IGH A;  1ZXH A;  4WH4 A;  2ONQ A;  1HZ5 A;  1XCQ L;  4KGT A;  5HFY A;  1PGB A;  5HG2 A;  2KDM A;  1K51 A;  2NMQ A;  1P7E A;  4HJG E;  1GB4 A;  1KH0 A;  2JSV X;  1EM7 A;  4KGR A;  1MHH E;  2EEL A;  3FIL A;  5BMI A;  1YNT E;  2PLP A;  2QMT A;  2J52 A;  2LUM A;  1MPE A;  2LHE A;  2KN4 A;  2N9K A;  4IKG A;  1IBX A;  1MHX A;  2JZP A;  1FCL A;  1XF5 L;  3V3X A;  1D4B A;  2I38 A;  4HKZ E;  2GI9 A;  1K53 A;  5HHD G;  1F2R C;  2RPV A;  5BMH A;  2QSD A; 
#chains in the Genus database with same CATH topology
 4BAX A;  1LQB A;  1YQ3 B;  1FCC C;  1VLB A;  3ZYY X;  1MI0 A;  1X1M A;  2LD9 A;  2QCZ A;  1EUV B;  2LVQ A;  3PPA A;  2HDE A;  2RDB C;  1TYG B;  3JSV A;  4EZL A;  1WMH A;  4ZRQ A;  1L5P A;  1JWS D;  1M4V A;  1ZDX A;  2REX A;  5AZH A;  2CHZ A;  3P4Q B;  1MVK A;  3W1S C;  2DZK A;  1WM3 A;  1PGX A;  3Q14 C;  2YEP B;  3TMP B;  2KC2 A;  2PVG C;  3MJW A;  1V5O A;  3PRP B;  3BVZ A;  1FM0 D;  4C00 A;  2JWU A;  1IGC A;  2IGD A;  4RCO A;  4LJO B;  4KX6 B;  2KMC A;  2WXK A;  3Q8A A;  5AEK B;  4WH4 A;  1L0V B;  1EWC A;  1XLO A;  2AX5 A;  1WYW B;  2KDM A;  4YT0 B;  4M00 A;  3MFG A;  2K39 A;  2CJN A;  3I63 C;  2IO3 B;  5G5H A;  1SJH D;  1R4N I;  1WGH A;  2BQQ A;  2KWV B;  2KVR A;  1TGZ B;  2L1A A;  4MGZ E;  4XE0 A;  2L52 A;  2BW2 A;  5G5G A;  3KWV A;  1J7A A;  1SSN A;  4ZYN A;  4BKS A;  1SGH A;  3UIP B;  1WZ0 A;  2Z8L A;  3AE1 B;  3AM9 A;  1OTR B;  1WMH B;  4EUT A;  5KHQ A;  4C4V A;  3URY A;  3L08 A;  4DWF A;  3N1X C;  2WP9 B;  3ENE A;  4P6V F;  4OVU A;  2KMM A;  2OHF A;  3IT6 B;  4FUL A;  4EE2 A;  2N9X A;  1A70 A;  1JWB D;  2KQ7 A;  2KK8 A;  1UD7 A;  5EDS A;  1ZOY B;  1WRI A;  4HK2 A;  1DGJ A;  2R2O A;  2G1E A;  3KUD B;  3NRZ A;  3ZXR A;  2OED A;  2BTE A;  3PZ8 A;  3ML9 A;  3MC8 A;  4JE3 B;  4PYU A;  5H8Y E;  1P7F A;  3QHT A;  2MBB B;  4NAW B;  5BMG A;  4BKS D;  1SE2 A;  1WI0 A;  2ZCC A;  3PTF C;  4MM3 A;  4WIP A;  4AJY B;  4C7Z A;  5E6N A;  2NBW B;  2G3Q B;  1Q10 A;  3RT3 B;  1KLV A;  3V6E B;  3UI3 A;  1WJ6 A;  2N1V A;  3N20 C;  5HFY A;  3ONS A;  2CU3 A;  4TUU A;  4L23 A;  2BPS A;  2OJW A;  3TIX A;  1YQB A;  5TSS A;  5IN7 A;  1CZP A;  3VAW A;  1NYR A;  1WM2 A;  3AXC A;  2KJR A;  4IKG A;  4B6W A;  3GZN I;  4S0R A;  1BUI C;  3DBR B;  1P9D U;  5E6J A;  1E10 A;  1PQS A;  2MX2 A;  4AP4 C;  1WJN A;  1AAR A;  3VR9 B;  2EMS A;  2N7E A;  3R7R A;  2VZK D;  3BVM A;  2LVO A;  2K6D B;  1F2R I;  4GB9 A;  3V05 A;  3PGE A;  1WY8 A;  4K7W A;  4NJC A;  4CHK A;  4A9A A;  2Y5B B;  2BS3 B;  2NPT B;  2R2Q A;  4FHJ A;  2BKR B;  4IM0 A;  5C3J B;  1VR9 A;  1QT9 A;  1GC6 A;  2X8X X;  2KJH B;  2ZPY A;  3TCA A;  2WU5 B;  1V86 A;  4P16 A;  2L76 A;  2KKC A;  4MT5 A;  3RUL A;  3EGR A;  4LCD E;  2ZPN A;  3QJZ A;  2K9X A;  4OZA A;  4YSX B;  2M56 B;  1YN4 A;  3C19 A;  4F8C B;  4MJS B;  2KFK A;  1GG3 A;  2W3R A;  2NTT A;  3ZJV A;  5LXI B;  4GDK B;  1E8Z A;  2N0S B;  2W3S A;  4FN2 A;  3DBH B;  1K51 A;  1PDX A;  3GOE A;  1WR6 E;  3A9K B;  1VJK A;  3SFD B;  2JSV X;  3OG5 A;  3NVZ A;  4YSY B;  1L6U A;  4EZK A;  2WXQ A;  2PLP A;  2WXM A;  5DPS A;  2R61 A;  2O2V A;  4ANX A;  3C0R B;  3CWI A;  2D07 B;  4ZRK A;  2MLB A;  4MEM A;  2NVU I;  2MEK A;  1FCL A;  1WF9 A;  2GBR A;  3S2A A;  1VZ6 A;  3KWL A;  1C4C A;  2LFI A;  3ZDM C;  2C5L C;  3HVZ A;  2D2Q A;  1UH6 A;  1E5W A;  5DPR A;  1I4X A;  2J53 A;  4II2 B;  1NEK B;  1HXY D;  2O6V B;  1L2N A;  3A9K A;  3ETR A;  1T0S C;  1FFV A;  1E6E B;  1VCB A;  4W9J A;  2RGF A;  4OHJ A;  1UGJ A;  4DK5 A;  3EFC A;  1UBI A;  5D94 A;  5IOI A;  2CHX A;  3ZNH B;  4HDO A;  2M0X A;  1QKZ A;  4ICU A;  4YL8 A;  3HM6 X;  4GMV A;  4ICV A;  1N6Z A;  1ZP0 B;  1WXS A;  1E7V A;  4REZ A;  1ET9 A;  4BKG A;  1C4A A;  2KDB A;  1YN3 A;  3N3K B;  4DQO C;  1HZ5 A;  1BXT A;  3AH7 A;  2WXF A;  2PE9 A;  2BYE A;  2KDF B;  1B1Z A;  5JH5 C;  4W9I A;  1YD8 U;  1G6J A;  1ACC A;  3B2F A;  5IA7 A;  2K5P A;  3AUL A;  4DHJ D;  2AQ2 B;  3AE4 B;  3T8M A;  2Z0E B;  1LGR A;  4A3O A;  1L4Z B;  2V4L A;  2KLG A;  3PV1 A;  2WDV B;  1T0Y A;  3DVN U;  1WX8 A;  3DDC B;  2IDY A;  2RDG A;  1YJ1 A;  4K7S A;  3HUI A;  2WDQ B;  4XX5 A;  3CF6 E;  5DPW A;  4IWQ A;  1I4Q A;  3WAN A;  3E56 A;  2BYV E;  1IP9 A;  2AEH A;  2B3A A;  5C1Z A;  2NTS A;  2M8S A;  2DYB A;  3WIM A;  5BMH A;  3LJ3 A;  1AWD A;  2LEK A;  3RN9 C;  3PZ7 A;  1IBX B;  3IBE A;  2HJ1 A;  4HKQ A;  5L95 C;  3H6N A;  3I5J C;  4ASW C;  1GC7 A;  2KDI A;  2KYW A;  4HCN B;  3M63 B;  3BK1 A;  4BOS C;  4GGQ A;  3IAM 1;  4JQW C;  3OWE B;  4LDT B;  5IAA C;  3TUO A;  2D3C A;  2K3U A;  1E90 A;  1FNW A;  3AEA B;  3H9D A;  1RYJ A;  3AU5 A;  4HPL B;  1RFK A;  2ZVN A;  3OAW A;  1JAL A;  1QIL A;  2KT7 A;  4MDK E;  2W9N A;  2DHZ A;  3CSF A;  2LMC A;  2LGX A;  1FNU A;  4EZJ A;  5E6O A;  1GJZ A;  4RGT A;  4JLC A;  4OZC A;  2QJL A;  3W5V B;  2KQ4 X;  4BVU C;  1D5M C;  2MH7 A;  1N63 A;  4LTU A;  3RCZ A;  2GBN A;  1YIW A;  3SFE B;  1WXV A;  5BYQ A;  2WXR A;  4ANU A;  2L05 A;  1P3Q U;  4L1B A;  3AEF B;  2INC C;  1OGW A;  4N9F 4;  1L7Y A;  2WXL A;  3N1Z C;  2LJ5 A;  3P4R B;  1TJE A;  2NCN A;  2LJI A;  4ZOH C;  2ZNV C;  2FBW B;  3EUB 2;  1MG4 A;  3VUW A;  2W55 A;  1WGR A;  4CQN A;  4JWS C;  3U7Z A;  4W9K A;  1OQQ A;  3P2B A;  2LXA A;  4OW0 A;  3TSS A;  4JX1 C;  1MJD A;  1F0Z A;  3IFW B;  3R2I A;  4A6Q A;  1F2R C;  3T3O A;  3MTN B;  3NVY A;  2VH1 A;  2HTH A;  3ZJT A;  4KGS A;  4WWO A;  1WJ4 A;  4E71 A;  2I1J A;  3QAQ A;  4IC7 B;  3IG3 A;  1JML A;  3ZXV A;  1JWM D;  5JXV A;  1CQV A;  1L6V A;  2E6X A;  4M8N A;  1TS5 A;  3HRD D;  3SDL C;  2GOW A;  3RUI B;  2IO2 B;  4HPP A;  3BZD B;  4HLE A;  3OJ3 A;  4NAM A;  2BWF A;  2SAK A;  4ZRP A;  1HEZ E;  4N59 A;  1TS4 A;  1HTO A;  1E7P B;  3ZRC A;  1RWS A;  3IAS 1;  3VDZ A;  4ANW A;  2JX5 A;  5JHB A;  1R4M I;  1U4A A;  2KVZ A;  3NUH B;  3JVZ X;  1WGD A;  2G45 B;  2LXC A;  2BKF A;  2WHI A;  4DXA B;  3TEZ A;  5EE9 A;  2JZ3 B;  3OLM D;  1ISN A;  4KDL B;  3DBL B;  3A4R A;  4DXG A;  2KAC A;  2D3A A;  1ZE3 D;  1LXD A;  2N7D A;  1F1H A;  1JRP A;  2PIA A;  4RM8 A;  4RF1 A;  4PT5 A;  2YLM A;  5GMV A;  5CTR C;  2DZI A;  1YN5 A;  1DYQ A;  1S3S G;  2FUG 1;  1UBQ A;  2ZZP B;  2INP E;  1HTQ A;  4OVZ A;  4MEL A;  3V61 A;  3QWZ B;  1WH3 A;  2KTF A;  2KHW B;  3W2D A;  2BS2 B;  1J19 A;  3BWU D;  3NOB A;  5D7G A;  3VUY A;  4K1R B;  2JQR B;  1WX9 A;  4PK1 A;  1N61 A;  2QHO A;  1NDD A;  2KNB A;  3J9C A;  2RPV A;  1NVI D;  1GAQ B;  2QSD A;  5CHF A;  1HA5 A;  2M1M A;  2FIF A;  4TSS A;  1WXQ A;  4BKT A;  1V97 A;  2JRI B;  1KLU D;  1I4G A;  5I4D A;  2BGF A;  2GMI C;  2LAS A;  2Z0D B;  3K9P B;  1QOB A;  4H2A A;  4WWM A;  1HZ6 A;  3DBS A;  3TBL D;  1DOY A;  1Z2M A;  3KUC B;  1Q1O A;  3PRM B;  1E8Y A;  1ZW7 A;  1UWM A;  1N5W A;  2K22 A;  4NJ6 A;  3HK0 A;  4AJW A;  3DPD A;  1MFW A;  2W82 A;  3RNG C;  4Q2J A;  2TSS A;  2NR2 A;  4O1N A;  4DDI D;  1XQQ A;  1UGM A;  2WX0 A;  4JIO U;  3K9O B;  4KKJ A;  1IYF A;  5D3D A;  2G4S A;  1WXM A;  2RDH A;  2DWQ A;  3DWG C;  3WCQ A;  2KJ6 A;  3A4S C;  4NPN A;  2QIE B;  1EWY C;  2FCQ A;  4HRS A;  5LXH A;  3E9S A;  2UWQ A;  3BII D;  2WXP A;  1R7S A;  1ENF A;  1QOF A;  5IP4 D;  2MA9 B;  4YXD B;  3KYD D;  3M95 A;  1JCK B;  2EKI A;  3LYY A;  5HG2 A;  2MP2 A;  3B0A A;  2O2V B;  1RLF A;  1T5X D;  1KJT A;  4AWJ A;  2PEA A;  2GRI A;  3TL5 A;  1TY2 A;  2DZM A;  2L0T A;  3HM3 A;  2K8H A;  2EEL A;  4WWP A;  1YNT E;  3R66 C;  4IDI A;  2KN4 A;  3DBR I;  3AEC B;  2XEW A;  1C3T A;  4HDQ A;  4DBG A;  4RFB A;  5J18 A;  5DCN A;  3AE3 B;  2V0G A;  2JZP A;  1RFA A;  2DNF A;  2AL3 A;  3VVW B;  4I6P A;  4AOF A;  2CHW A;  5H92 C;  1H8C A;  2V9H A;  3GS2 A;  2JWZ A;  4W9F A;  2JZZ A;  3V62 A;  3B08 A;  1NBF C;  2M0A A;  1XCT L;  4WUR A;  3UIN B;  5LNK 1;  1V49 A;  2BBC A;  4MSQ B;  4B95 A;  4BZA A;  4F1S A;  2JYT A;  3Q8E A;  3NHE B;  2VH2 A;  4PS3 A;  2NS5 A;  4HXD A;  1R4M B;  2DBY A;  4G0N B;  3ZW3 A;  1V80 A;  3T3N A;  5EE1 A;  4KIK B;  2PTL A;  5E6P A;  2LHD A;  1CK1 A;  3NZU A;  2RR9 A;  1L0Y B;  1KOT A;  1FMA D;  1T3Q A;  2KX3 A;  3KVF B;  2N1W A;  2N9L A;  1WYG A;  3Q3M C;  3AE2 B;  2RMM A;  2XNA C;  2G9H D;  3PS6 A;  4B0M A;  1D5Z C;  4GOC A;  3NS1 A;  2KTR A;  1SE4 A;  4YWG G;  2C60 A;  3PLU A;  2IGH A;  4K3C A;  3PRZ A;  2BB5 A;  2WXH A;  3RYT A;  2NMQ A;  1DOI A;  4XC2 A;  1K8R B;  4M0W B;  3QK0 A;  1EM7 A;  2QDF A;  1NYQ A;  2WXJ A;  4HVB A;  2JF5 A;  3A1Q A;  5LLI A;  2BWE S;  2WU2 B;  1LFD A;  1I4R A;  4KIK A;  2D5G A;  3N9Y C;  5L83 A;  1A5R A;  4CYE A;  4EEW A;  2VZK B;  5AUI A;  3PVL A;  1IBX A;  3DVG Y;  2AWT A;  2KAJ A;  1ZDV A;  3BYT B;  2L0F A;  1TY0 A;  4AQ7 A;  2KDE B;  1KTK A;  3R8B A;  2GI9 A;  1K53 A;  1NEN B;  3RMK C;  1J7C A;  3NJT A;  2HTM E;  2KTR B;  1TBE A;  3RZW C;  1PYW D;  4BBN F;  2GLS A;  1Y8R C;  1F9J A;  3TEY A;  2Z59 B;  3RNB C;  2KO3 A;  1XLQ A;  1QOG A;  4URK A;  4NQK E;  5G55 A;  4GXB A;  4GLS C;  3DHG C;  2LVP A;  3ZNG C;  2IO1 B;  3AB5 A;  1WX7 A;  4P7I A;  1XT9 B;  1XEE A;  2Y5P A;  3RI7 C;  2L3Z A;  4AS1 A;  4IOI E;  2JU6 X;  1WE6 A;  1OEY J;  2JY6 A;  4BBN C;  1AYF A;  2MJD A;  1N5X A;  3DHI C;  4LNF A;  2FCM A;  3L0W B;  2JUO A;  2KD0 A;  1QLB B;  4M0W A;  3L17 A;  4M02 A;  4JL9 A;  1TT5 B;  3ALB A;  1VDV A;  3BK2 A;  2B76 B;  1ESF A;  3TEX A;  1D6E C;  2K1F A;  4A8X C;  4KGT A;  3Q8B A;  1JRO A;  1WRD B;  2BT6 A;  3ABV B;  3DVN V;  1V1O A;  4WJN A;  3AU4 A;  3GZN B;  3AE8 B;  3VXW A;  2XK5 A;  1J8C A;  1S1Q B;  3Q2A C;  4M01 A;  3U52 E;  4BOZ B;  1RM6 C;  3DVG X;  2N4F A;  2KX0 A;  4S17 A;  1XXG A;  3NG0 A;  3H1U A;  3A1Q B;  1MG8 A;  4XWW A;  2GBK A;  4G50 A;  3CIR B;  1SE3 A;  5BYS A;  2WGS A;  1XF5 L;  2JYE A;  2I38 A;  2MBE A;  1FNV A;  4IM2 A;  1I4H A;  2WYQ A;  2KN5 A;  3AN1 A;  4EOY A;  1F77 A;  3ZO5 B;  2MWS B;  3Q3O C;  4GIV A;  2J42 A;  1P0R A;  4QAY A;  2ZVO A;  1TKE A;  2WS3 B;  4WAF A;  1V1P A;  4P1B C;  3FIL B;  5CHW A;  3MC9 A;  4I6L B;  1LO5 D;  1VZ7 A;  3ZVV A;  3ZJU A;  4MH0 E;  5EE3 A;  3R3M A;  2BB6 A;  1BML C;  1OQR A;  4FLH A;  4NY0 A;  1YX5 B;  3N30 A;  3ZTC A;  2DZJ A;  2PVO D;  2D3B A;  4II3 B;  2K8C A;  3AED B;  1CMX B;  2JPH A;  5CHV C;  1FXA A;  4LNK A;  3N32 A;  2IBI B;  2GB1 A;  4A20 A;  5AUK A;  2C7N B;  2CS4 A;  4WQM A;  3QX1 A;  4HJK A;  3AE5 B;  3RZF A;  1SBB B;  4E3C A;  2ONQ A;  2FAZ A;  2WXN A;  3APC A;  2L83 A;  3U8Z A;  3EA6 A;  4MGY E;  2D3G A;  1SIF A;  4W9D A;  4AUQ C;  3NZ3 A;  3H7S A;  2ZCB A;  2E3T A;  3VQI A;  1J7B A;  5BMI A;  1UEL A;  4ITK A;  1ET6 A;  4KSK C;  4KKI A;  4CO7 A;  4US8 A;  3VUX A;  3IXS A;  2PPH A;  1BT0 A;  1P1A A;  2LGS A;  1GUA B;  5D3I B;  1J0G A;  3ZTD A;  3V3X A;  3I57 A;  2DYM A;  1VRA B;  1T0Q C;  4HKZ E;  3TJP A;  3PO0 A;  3UIO B;  4MJS A;  2KFK B;  4ZRI A;  2GBM A;  1FRD A;  2J52 A;  1TKG A;  2HD5 B;  1K50 A;  2O6V A;  3EC8 A;  1EU4 A;  4OVV A;  3WAO A;  4HRO A;  2PW9 A;  4K81 A;  2C7M B;  1EF1 A;  4MM3 B;  4RMA A;  3V6C B;  2ZNV B;  1N60 A;  2WQY B;  1JW9 D;  2O6V D;  1V81 A;  2KQS A;  4FAD A;  2M19 A;  3ZKJ C;  1C77 A;  5FK9 C;  3TEW A;  4IW0 A;  4USA A;  4C80 A;  2V4I B;  4KZC A;  3PZD A;  4FBJ B;  2ZW0 A;  3VFK A;  2WDT B;  3CMM B;  2KMA A;  2A5U A;  2N7J A;  1WZ3 A;  1YJJ A;  4YTM B;  2KWD A;  3O13 A;  2MSE D;  1GB1 A;  4XDD A;  2KWU B;  3KH0 A;  2J0J A;  3P63 A;  3VTU A;  2L8J A;  1UNS A;  2HE7 A;  3APD A;  1GB4 A;  2CU1 A;  4LJP B;  3BYY B;  2BF8 B;  2NPT A;  3MHZ A;  3ZGZ A;  2CKH B;  3RNE C;  2JRH A;  2PE6 B;  3H8H A;  2LUE A;  3WAM A;  1FIQ A;  2Y5C A;  4HCP B;  4JPS A;  1MHX A;  2XBB C;  1TS2 A;  2EKE C;  2ICI A;  4NNJ B;  4TQ0 A;  1EF5 A;  4MGI E;  2FID A;  4J3O D;  3U7D A;  3L13 A;  3ZUN A;  3UQA A;  5FR6 A;  2IYD B;  3RD2 A;  2V3N A;  2AYO B;  3L10 B;  2K8B A;  2K25 A;  4ACF A;  5J2R A;  2RSU A;  2M4N A;  4HPM B;  5HI1 A;  3W1Y A;  1SJE D;  4LLG M;  3P1M A;  3W5U B;  1PUT A;  3SEB A;  4IUM B;  5C23 A;  5BO4 B;  4W9G A;  1WJU A;  1QZE A;  5IO9 A;  2H88 B;  1I7H A;  4FHK A;  3DBH I;  3KQ4 A;  2ACZ B;  2LGI A;  3AEE B;  3EFU A;  3NZS A;  4OZB A;  1LM8 B;  3EEC A;  4IWP A;  4JGH B;  3GB1 A;  3MC0 B;  3RNA C;  2FNJ B;  1D5X C;  4D2K A;  3KYC D;  3GP7 A;  1SIJ A;  1P98 A;  1UWX A;  1L4D B;  3AMZ A;  1YMH E;  4ZHO A;  5CX3 A;  2V1Y A;  4WJP A;  4C4V B;  3AE9 B;  1Z5S B;  4YTP B;  3ZRF A;  1M94 A;  2KXJ A;  3ML8 A;  2J4X A;  1FXT B;  1TIF A;  3X0W A;  3VR8 B;  1I42 A;  1KH0 A;  1HE8 A;  4WAA A;  4HEA 1;  2RD0 A;  1SEB D;  3FIL A;  2BS4 B;  4G3X B;  4A90 A;  2WNM A;  3L16 A;  1R4N B;  4ANV A;  4HWI B;  1MPE A;  1V9J A;  3LDZ E;  2MHJ A;  3PRE A;  3LB8 C;  1STE A;  3ZDT A;  1WFY A;  3AE7 B;  2N9K A;  2WWZ A;  5HKH A;  4PS7 A;  4GN1 A;  2VRR B;  2KLC A;  2L7R A;  3C8Y A;  1OFF A;  5HHD G;  1TTN A;  5D6J B;  3OJ4 B;  2LGY A;  3PLV A;  2N9E B;  3ZLZ A;  1JQ4 A;  3L4P A;  4GU2 A;  1DOX A;  4B9K A;  3Q3N C;  3W9C B;  1ZGU B;  4DHZ E;  2OOB B;  5FR3 A;  3DHH C;  1YQ4 B;  2MJ3 A;  3P4S B;  4X57 B;  1TS3 A;  4JWU C;  2BYT A;  1KRH A;  1V5T A;  2DX5 B;  3NVW A;  1RRB A;  4KZ0 A;  5MPO A;  1WSP A;  1OEY A;  3RPF C;  4G11 A;  1GPX A;  1T0R C;  2FE8 A;  1ZKH A;  2KC1 A;  4C7Y A;  3JSV B;  3FC4 A;  2WLB A;  1E8W A;  2YVC A;  2CR5 A;  2J7Q B;  1WGK A;  4F7Z A;  3NS8 A;  3A9J B;  1EU3 A;  1NI2 A;  1KFY B;  2AQ3 B;  3P4P B;  3PT2 B;  3Q3J A;  2PMV A;  2KAN A;  1L0X B;  1PGA A;  2FUH B;  2J0M A;  2WXG A;  1WIA A;  4XZ4 A;  1IUE A;  1ZUD 2;  1VD2 A;  2MW5 A;  3WAP A;  2C9W B;  1XCQ L;  1PGB A;  3BIN A;  1F52 A;  3AEB B;  4WJQ A;  2L00 B;  3Q8C A;  3NY5 A;  1WR1 A;  2ASQ A;  4XWT A;  2ZEQ A;  3ZNZ B;  4EFO A;  1JWA D;  2YEP F;  2DAJ A;  4TMA B;  4IM3 A;  2G4D B;  1C76 A;  2PJH A;  4BFR A;  4ZYS A;  2NBU A;  4MGK E;  5KHO A;  3VTW A;  4K7U A;  3R7Q A;  1KLG D;  1I35 A;  2C7H A;  4W9H A;  3N1Y C;  3AE6 B;  4N6E B;  1N62 A;  4WQO B;  1C78 A;  1D4B A;  2UU7 A;  3AI5 A;  3SR6 A;  4UDU C;  4W9L A;  4TKN A;  2IY0 B;  4RGN A;  3FAH A;  3PSE B;  4XDC A;  3UF8 A;  4KDI C;  1H4R A;  1VZ8 A;  2MBQ A;  2JXT A;  4RH6 A;  3DCG A;  3ZNI D;  4E74 A;  5TR5 A;  2LWP A;  3VRB B;  3JW0 X;  5JZE B;  1WE7 A;  1WWT A;  2ZW1 A;  3Q8F A;  2KWC A;  1XD3 B;  4RNA A;  2N9P C;  3ZIM A;  1ROE A;  3H7P A;  3V60 A;  1XLP A;  1GOZ A;  2IGG A;  2KZR A;  4GDL A;  1XLN A;  2V3S A;  1Y56 A;  2V3P A;  4W9E A;  3HHM A;  2J0K A;  1TKY A;  2KOX A;  4N58 A;  4W9C A;  1T6B X;  3M3J A;  2IY1 B;  1CJE A;  4NAW A;  5DPT A;  2MP2 B;  1GNU A;  2M17 A;  3IHP C;  1UUP A;  2ZJD A;  2UYZ B;  1SB3 C;  2AL6 A;  4I6N B;  3WA0 A;  5BYR A;  4FXC A;  4PS8 A;  3QA8 A;  4XGA B;  3Q6B A;  4LNI A;  2I1K A;  4ARI A;  5T8I A;  4RGO S;  3SU8 X;  2MCN B;  4C56 C;  2MQJ A;  2QMT A;  3IVF A;  2LHE A;  1E8X A;  4KSL C;  3KLS X;  3JYU A;  2JVC A;  2AQ1 B;  3GE3 C;  4B0E A;  2WX1 A;  1C4P A;  2LGD A;  1FXI A;  4WWN A;  1SE9 A;  1V6E A;  2HJ8 A;  1I4P A;  1RAX A;  1JWU D;  4YSZ B;  4RGM A;  3ECI A;  4MAC A;  4ZDV A;  1OQY A;  2QIL A;  4FJV B;  4IWO A;  3T9L A;  4M8M A;  2A4Z A;  2DAF A;  1C1Y B;  1KM7 A;  3H7P B;  2L32 A;  3VH4 B;  2LRU A;  4PYZ A;  4DHZ B;  4L2Y A;  3B1L X;  4R3D A;  2JXX A;  2Y3A A;  3UQB A;  3ZQ4 A;  3DBL I;  1QQR A;  3IT4 B;  1PFD A;  2NBV B;  4RF0 A;  4XYC A;  3Q69 A;  2ON8 A;  2BYF A;  4RM9 A;  4NZL B;  3I9V 1;  3SD5 A;  1K52 A;  3W1S A;  3AEG B;  1FEH A;  1YJI A;  3LXF A;  3QIJ A;  1FPY A;  3HIZ A;  1C9F A;  1SXT A;  1D3Z A;  3DOW A;  1WGY A;  3RFZ B;  4GSW A;  4GDL B;  1IGD A;  2LRW A;  4J6I A;  3CST A;  1NI3 A;  2WXI A;  1V1P B;  1ZXH A;  2FCS A;  1C79 A;  4EKU A;  4LNN A;  2MBO A;  3M62 B;  1P7E A;  3B9J A;  5GXG B;  1IPG A;  3P42 A;  4IG7 B;  4LNO A;  1XO3 A;  3A9J A;  3FKY A;  3U2S C;  4WJO A;  5IKC M;  4YTN B;  1UF0 A;  1WGG A;  2W54 A;  3O65 B;  3PHW B;  1QOA A;  2LI5 A;  3SHQ A;  2LZ6 A;  1WXA A;  5D2M B;  4DDG D;  1AW7 A;  3WAL A;  1V2Y A;  1YOV B;  3MJ5 A;  3X23 A;  2GBJ A;  3KUZ A;  2IPK D;  2X38 A;  3VH3 B;  1Q0W B;  4KVG B;  1FRR A;  4FJZ A;  2DEN B;  3UGB B;  4DHJ B;  4ZHP A;  3PHX B;  3QCA A;  4DXF A;  1AN8 A;  2D10 A;  2SEB D;  3NVV A;  2KFJ A;  3U30 A;  3QQ8 B;  2FCN A;  1E7U A;  3VTV A;  2Q5W D;  2INN E;  1HQR D;  2WDR B;  2I2Y A;  1V8C A;  4FA6 A;  3VRA B;  1E0Z A;  1FFU A;  3A33 B;  5C2T B;  2IJ0 A;  2IO0 B;  2PKO A;  2QEJ C;  3B2G A;  3U4E G;  4MH8 A;  2OJR A;  1TZ1 A;  4P1C C;  2QC8 A;  2MJE A;  4TV3 A;  3DQV A;  5AZG A;  1B9R A;  3Q3F A;  1KF6 B;  1YX6 B;  2EMT A;  2RPQ A;  3VHT C;  2JT4 B;  5G2N A;  3L54 A;  3RNC C;  2K0P A;  2K6Q A;  3APF A;  1FD6 A;  2WXO A;  4KV2 A;  3HVD A;  2IZV B;  3MP9 A;  3BVG A;  5JHA A;  5AZF A;  2CJO A;  2XK5 B;  2MRP A;  4A3P A;  5FKA C;  2BVC A;  4HJG E;  3GE8 C;  2D11 A;  3I3T B;  3R2T A;  4K3B A;  1EO6 A;  3EHV A;  3MHS D;  4NJ7 A;  1FO4 A;  2IND C;  2XN9 C;  4KGR A;  2H89 B;  3QC8 B;  3BY4 B;  2DYO A;  4US9 A;  1MHH E;  1Q5W B;  3QAR A;  1SF0 A;  4LK0 M;  1TZO A;  5EE0 A;  3D32 A;  1ZXI A;  1QF6 A;  1UZX B;  5J17 A;  2LUM A;  3RNF C;  4ARC A;  3KW5 B;  4LDT D;  3DWM A;  2DLB A;  3AV8 A;  4A55 A;  4ZRJ A;  1E9M A;  2MBH A;  4TQ1 A;  1ZPS A;  4GDK A;  1JRU A;  4FJY A;  4MSM B;  4NQL B; 
#chains in the Genus database with same CATH homology
 1J7C A;  1AWD A;  2LEK A;  2HTM E;  3PZ7 A;  1PYW D;  1YQ3 B;  1JQ4 A;  1FCC C;  1IBX B;  4HKQ A;  1VLB A;  3TEY A;  3L4P A;  1MI0 A;  3ZYY X;  1DOX A;  1XLQ A;  1QOG A;  3BK1 A;  3W9C B;  3IAM 1;  2HDE A;  4GLS C;  1TYG B;  3OWE B;  4ZRQ A;  3AB5 A;  5FR3 A;  1L5P A;  1JWS D;  1M4V A;  1ZDX A;  3TUO A;  2K3U A;  1YQ4 B;  2MJ3 A;  3P4S B;  1MVK A;  1TS3 A;  3P4Q B;  1FNW A;  4JWU C;  2BYT A;  1KRH A;  3AEA B;  1XEE A;  1RYJ A;  2Y5P A;  3NVW A;  5MPO A;  4AS1 A;  1WSP A;  3RPF C;  4IOI E;  1GPX A;  2JU6 X;  1RFK A;  2FE8 A;  1PGX A;  1JAL A;  2YEP B;  1QIL A;  4C7Y A;  1AYF A;  2MJD A;  1N5X A;  2PVG C;  3FC4 A;  3BVZ A;  2WLB A;  1FM0 D;  2LMC A;  2JWU A;  1FNU A;  1WGK A;  1EU3 A;  4RGT A;  1IGC A;  2IGD A;  1QLB B;  4M0W A;  4RCO A;  1KFY B;  2AQ3 B;  4OZC A;  2QJL A;  3P4P B;  3W5V B;  2KQ4 X;  2PMV A;  4KX6 B;  1D5M C;  1L0X B;  1N63 A;  1PGA A;  2MH7 A;  2WXK A;  4LTU A;  1VDV A;  2WXG A;  3BK2 A;  2B76 B;  3Q8A A;  3SFE B;  1ESF A;  3TEX A;  1IUE A;  1D6E C;  1ZUD 2;  4WH4 A;  5BYQ A;  4A8X C;  1L0V B;  1EWC A;  2WXR A;  1XCQ L;  1XLO A;  2AX5 A;  3Q8B A;  4KGT A;  1PGB A;  1JRO A;  2KDM A;  4YT0 B;  2BT6 A;  3ABV B;  3AEB B;  4L1B A;  3MFG A;  3Q8C A;  1V1O A;  2CJN A;  3AE8 B;  3AEF B;  5G5H A;  4XWT A;  1SJH D;  3U52 E;  1RM6 C;  2WXL A;  3P4R B;  1JWA D;  1TJE A;  2LJI A;  2YEP F;  4ZOH C;  2L1A A;  4TMA B;  1XXG A;  2FBW B;  3EUB 2;  1C76 A;  4XWW A;  4ZYS A;  4XE0 A;  2W55 A;  1KLG D;  2BW2 A;  2L52 A;  5G5G A;  3KWV A;  3CIR B;  4CQN A;  1J7A A;  1SE3 A;  4JWS C;  1SSN A;  3U7Z A;  5BYS A;  3AE6 B;  1OQQ A;  4N6E B;  1N62 A;  1XF5 L;  2Z8L A;  3AE1 B;  2JYE A;  3AM9 A;  4OW0 A;  1C78 A;  1D4B A;  3TSS A;  4JX1 C;  2I38 A;  1F0Z A;  3R2I A;  4A6Q A;  1F2R C;  3T3O A;  1FNV A;  3SR6 A;  3URY A;  1I4H A;  4UDU C;  3NVY A;  3ZJT A;  3AN1 A;  4KGS A;  1F77 A;  2WP9 B;  4RGN A;  3FAH A;  4P6V F;  2KMM A;  2OHF A;  3IT6 B;  4XDC A;  4EE2 A;  1VZ8 A;  1JML A;  2J42 A;  1A70 A;  1TKE A;  1JWB D;  2JXT A;  2WS3 B;  1JWM D;  4WAF A;  1V1P A;  1ZOY B;  1CQV A;  1WRI A;  5JXV A;  1L6V A;  1DGJ A;  2E6X A;  1TS5 A;  3FIL B;  3HRD D;  4RH6 A;  1LO5 D;  1VZ7 A;  2G1E A;  3ZJU A;  3BZD B;  3NRZ A;  2OED A;  3VRB B;  2BTE A;  3PZ8 A;  4NAM A;  5EE3 A;  2BB6 A;  2SAK A;  4ZRP A;  1WWT A;  2ZW1 A;  1BML C;  4JE3 B;  1HEZ E;  4N59 A;  5H8Y E;  1OQR A;  1TS4 A;  1E7P B;  1P7F A;  3Q8F A;  4NAW B;  5BMG A;  2PVO D;  1RWS A;  3IAS 1;  2JX5 A;  4RNA A;  1SE2 A;  1ROE A;  1XLP A;  1GOZ A;  2IGG A;  3NUH B;  3AED B;  4WIP A;  4C7Z A;  1XLN A;  1Y56 A;  1FXA A;  2V3P A;  1Q10 A;  1TKY A;  4N58 A;  3TEZ A;  5EE9 A;  1T6B X;  2GB1 A;  1CJE A;  4DXG A;  5AUK A;  3UI3 A;  2KAC A;  1ZE3 D;  4WQM A;  1JRP A;  1UUP A;  3AE5 B;  2PIA A;  1SBB B;  4RF1 A;  1SB3 C;  4PT5 A;  2ONQ A;  5HFY A;  5BYR A;  2WXN A;  2CU3 A;  2L83 A;  1YN5 A;  4L23 A;  1DYQ A;  4FXC A;  2FUG 1;  3EA6 A;  2INP E;  4OVZ A;  5TSS A;  4ARI A;  5T8I A;  4RGO S;  3NZ3 A;  1CZP A;  2E3T A;  3VQI A;  3W2D A;  1NYR A;  2BS2 B;  1J7B A;  5BMI A;  3BWU D;  4ITK A;  4C56 C;  5D7G A;  1ET6 A;  4KKI A;  2QMT A;  4US8 A;  2LHE A;  2JQR B;  3IXS A;  3KLS X;  4IKG A;  2AQ1 B;  1N61 A;  5D3I B;  1BUI C;  4B0E A;  1C4P A;  3V3X A;  3I57 A;  2DYM A;  1FXI A;  5E6J A;  1E10 A;  1VRA B;  4HKZ E;  1I4P A;  3PO0 A;  3J9C A;  1JWU D;  2RPV A;  1NVI D;  4YSZ B;  1GAQ B;  1FRD A;  4RGM A;  2J52 A;  2QSD A;  4MAC A;  1HA5 A;  1TKG A;  4TSS A;  1K50 A;  1WXQ A;  3VR9 B;  1V97 A;  1EU4 A;  2QIL A;  2VZK D;  1KLU D;  1I4G A;  4HRO A;  5I4D A;  3BVM A;  2PW9 A;  1F2R I;  1QOB A;  3V05 A;  4H2A A;  4MM3 B;  4WWM A;  1HZ6 A;  1DOY A;  4NJC A;  2L32 A;  4A9A A;  1N60 A;  4L2Y A;  2WQY B;  4R3D A;  1JW9 D;  2BS3 B;  1UWM A;  2Y3A A;  1N5W A;  2K22 A;  2M19 A;  5C3J B;  3ZQ4 A;  1VR9 A;  1QQR A;  1QT9 A;  3IT4 B;  1C77 A;  5FK9 C;  1PFD A;  2W82 A;  4RF0 A;  3TEW A;  3Q69 A;  2ON8 A;  4USA A;  4C80 A;  2V4I B;  2WU5 B;  2ZW0 A;  4P16 A;  4Q2J A;  2TSS A;  4MT5 A;  4NZL B;  3I9V 1;  4O1N A;  1K52 A;  3W1S A;  3EGR A;  3AEG B;  1FEH A;  1YJI A;  2N7J A;  3LXF A;  4KKJ A;  1C9F A;  2K9X A;  4OZA A;  1SXT A;  5D3D A;  4YSX B;  1YJJ A;  2M56 B;  1YN4 A;  4YTM B;  2RDH A;  2DWQ A;  2KWD A;  3DWG C;  3WCQ A;  3O13 A;  3RFZ B;  4GDL B;  2W3R A;  2QIE B;  1EWY C;  1IGD A;  1GB1 A;  4HRS A;  1NI3 A;  4XDD A;  2NTT A;  3E9S A;  2WXI A;  3BII D;  3ZJV A;  2WXP A;  1V1P B;  1ZXH A;  4GDK B;  1R7S A;  1C79 A;  1ENF A;  2N0S B;  2W3S A;  1QOF A;  4YXD B;  3P63 A;  1JCK B;  2EKI A;  3LYY A;  5HG2 A;  1K51 A;  1P7E A;  1UNS A;  1PDX A;  1GB4 A;  1T5X D;  3B9J A;  5GXG B;  3BYY B;  3P42 A;  1VJK A;  3SFD B;  2GRI A;  2JSV X;  1TY2 A;  3NVZ A;  4YSY B;  3MHZ A;  1L6U A;  2EEL A;  1XO3 A;  3ZGZ A;  1YNT E;  2PLP A;  2WXQ A;  2WXM A;  3H8H A;  3U2S C;  2R61 A;  4YTN B;  4IDI A;  1FIQ A;  2KN4 A;  3CWI A;  3AEC B;  2W54 A;  1QOA A;  2Y5C A;  4RFB A;  4JPS A;  2MEK A;  3AE3 B;  1AW7 A;  1MHX A;  2JZP A;  2V0G A;  1FCL A;  1TS2 A;  3MJ5 A;  2ICI A;  2IPK D;  4TQ0 A;  2X38 A;  1VZ6 A;  3KWL A;  1C4C A;  5H92 C;  2LFI A;  3GS2 A;  3HVZ A;  4J3O D;  1FRR A;  1I4X A;  2M0A A;  4ZHP A;  1XCT L;  2J53 A;  4WUR A;  4DXF A;  2V3N A;  1AN8 A;  1NEK B;  2SEB D;  5LNK 1;  3NVV A;  1HXY D;  2BBC A;  2JYT A;  3Q8E A;  2Q5W D;  2INN E;  1HQR D;  2WDR B;  3ETR A;  5HI1 A;  2I2Y A;  1V8C A;  1FFV A;  1E6E B;  3VRA B;  1E0Z A;  1SJE D;  1FFU A;  4LLG M;  3P1M A;  5C2T B;  2IJ0 A;  2DBY A;  4OHJ A;  1PUT A;  2PKO A;  2QEJ C;  1UGJ A;  3B2G A;  3SEB A;  3W5U B;  3T3N A;  5EE1 A;  3U4E G;  2PTL A;  2LHD A;  4MH8 A;  1CK1 A;  2MJE A;  1L0Y B;  2H88 B;  1I7H A;  1FMA D;  1T3Q A;  1B9R A;  1KF6 B;  1QKZ A;  2N9L A;  3KQ4 A;  1WYG A;  2ACZ B;  3AE2 B;  2LGI A;  2RMM A;  3AEE B;  2XNA C;  4OZB A;  2G9H D;  1ZP0 B;  3GB1 A;  3MC0 B;  2K0P A;  4B0M A;  1D5Z C;  1D5X C;  4D2K A;  1FD6 A;  2WXO A;  3GP7 A;  1SIJ A;  4REZ A;  3HVD A;  1UWX A;  3MP9 A;  1L4D B;  3NS1 A;  1ET9 A;  1SE4 A;  4YWG G;  3BVG A;  3AMZ A;  1YMH E;  1C4A A;  4ZHO A;  2IGH A;  3AE9 B;  1YN3 A;  4YTP B;  4DQO C;  1HZ5 A;  2CJO A;  1BXT A;  2BB5 A;  3AH7 A;  2WXF A;  2WXH A;  5FKA C;  2NMQ A;  2J4X A;  4HJG E;  1B1Z A;  1DOI A;  3R2T A;  1ACC A;  3VR8 B;  1FO4 A;  3B2F A;  2XN9 C;  1KH0 A;  2K5P A;  1EM7 A;  2H89 B;  4KGR A;  2AQ2 B;  1NYQ A;  2WXJ A;  2DYO A;  4US9 A;  3AE4 B;  1MHH E;  1SF0 A;  4HEA 1;  1SEB D;  3FIL A;  2BS4 B;  4LK0 M;  1L4Z B;  4A90 A;  1TZO A;  2WNM A;  2WU2 B;  5EE0 A;  1ZXI A;  1I4R A;  1QF6 A;  2D5G A;  2LUM A;  1MPE A;  2WDV B;  3N9Y C;  4ARC A;  3LB8 C;  1STE A;  2VZK B;  2IDY A;  3AE7 B;  5AUI A;  2RDG A;  2N9K A;  1IBX A;  3HUI A;  2WDQ B;  3DWM A;  2DLB A;  2KAJ A;  3AV8 A;  4A55 A;  1ZDV A;  3BYT B;  1E9M A;  1I4Q A;  1TY0 A;  4AQ7 A;  3E56 A;  3C8Y A;  1KTK A;  1OFF A;  4TQ1 A;  3R8B A;  2GI9 A;  1K53 A;  1ZPS A;  2NTS A;  5HHD G;  1NEN B;  5BMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...