2RPVA

Solution structure of gb1 with lbt probe
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
CYVDTNNDGAYEGDELSGTMEYKLILNGKTLKGETTTCAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
publication title Two-point anchoring of a lanthanide-binding peptide to a target protein enhances the paramagnetic anisotropic effect
pubmed doi rcsb
source organism Streptococcus sp. group g
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rpvA00
2LUMA 1XCQL 2ONQA 1FCLA 1HZ5A 1YMHE 1MHHE 2LHEA 1PGXA 5JXVA 3GB1A 1Q10A 4HKZE 1K52A 2KDMA 1GB1A 2PW9A 1QKZA 2EELA 2QSDA 1FCCC 1HEZE 2GB1A 2JU6X 2IGHA 2J53A 5BMGA 1PGAA 4WH4A 4IKGA 1IGDA 1JMLA 1HZ6A 2I38A 1FD6A 5BMIA 4HJGE 2ZW0A 5BMHA 2J52A 1K51A 2RPVA 5HHDG 1PGBA 2PTLA 1C9FA 2LHDA 2QMTA 1P7FA 3FILB 1K53A 4D2KA 5HFYA 1D4BA 1K50A 2IGDA 2KWDA 2JXTA 2RMMA 1XF5L 4OZCA 1F2RC 2PLPA 2JWUA 1IBXB 1XCTL 2ON8A 3UI3A 3V3XA 2KN4A 1F2RI 2I2YA 2JSVX 2JZPA 2KACA 4KGTA 4OZBA 4GLSC 1UWXA 2N9KA 2K0PA 1IBXA 1MHXA 1ZXHA 4MACA 5HG2A 4IOIE 1GB4A 2OEDA 4KGSA 3FILA 2N9LA 2NMQA 2IGGA 1EM7A 1MI0A 1MVKA 4KGRA 1IGCA 2ZW1A 1P7EA 1YNTE 1KH0A 1MPEA 2GI9A 4OZAA 3MP9A 5HI1A 2N7JA 2KQ4X 2LGIA
chains in the Genus database with same CATH superfamily
3OLMD 3ZNZB 2NR2A 1EU3A 1UNSA 2D2QA 4BKSD 1ZE3D 4WWOA 4MJSA 1WE6A 1OGWA 1A70A 2L1AA 2LI5A 3AE4B 5EE1A 3HIZA 1P0RA 4ZHOA 2QILA 3UINB 2GLSA 1F1HA 3RI7C 3KQ4A 1T3QA 2EMSA 1IP9A 2M19A 2J52A 2D07B 2KANA 4A3OA 4BVUC 5C3JB 2K8CA 1UBQA 1VZ7A 1V1PA 5AZGA 3N20C 2BKRB 2JWUA 1TZ1A 3U52E 4FHJA 3PTFC 4FJZA 1IPGA 3DBLB 3DBRI 1V80A 2KX0A 3LYYA 4RF1A 2BB6A 3Q8BA 1L4ZB 2L76A 2M4NA 2ZZPB 2K0PA 2DAJA 2N4FA 1DYQA 2N0SB 1RYJA 3M95A 4DWFA 2Z8LA 2DYOA 3AN1A 1WRIA 1WXQA 2MBBB 3HM6X 1FXIA 4KGSA 1ISNA 3RNCC 4IM0A 3CF6E 4M8NA 3AULA 3WA0A 3B08A 4A20A 2AYOB 2ZW1A 1I4XA 2ZEQA 5CHFA 1BMLC 3ZIMA 2PE6B 3FC4A 2IO1B 3DPDA 3M63B 2ZVOA 1ZDVA 3I5JC 1J0GA 2WWZA 1QQRA 1E90A 2MRPA 3ONSA 4LNKA 1UGMA 3IAM1 4JGHB 3GB1A 3CMMB 3EHVA 3A9KA 1QOBA 1J7AA 3R2TA 3VVWB 2Z59B 4II3B 3AE6B 2ZVNA 1DOXA 2WHIA 3TEZA 4RM9A 1JALA 1B1ZA 3DHHC 1ZXIA 3SFDB 1S1QB 5HKHA 5H92C 4AP4C 1SIJA 1YJJA 1V1PB 4CO7A 2BVCA 4DDGD 2O2VA 3I57A 1WX9A 4M02A 5HFYA 4C7ZA 3VRAB 4I6NB 2KWDA 2MX2A 1N63A 5J2RA 3SEBA 2LGSA 2JZZA 2UWQA 1WXMA 1YX5B 2WYQA 2ZJDA 2REXA 2LGDA 2NS5A 2K6DB 4DK5A 2C5LC 4KDIC 1KF6B 3BK1A 1IBXA 2KHWB 2DAFA 4WJOA 3VUXA 3DBHI 2KVZA 2X38A 5AUIA 1XO3A 1N5WA 1GB4A 2WP9B 1XLQA 2MBQA 3QCAA 2MBEA 2H88B 3ZXVA 4GIVA 1QOAA 1J7BA 2R61A 4AOFA 4BOZB 2G4SA 2DZIA 3QARA 3UQAA 2INCC 1XCQL 1F0ZA 1WIAA 3I3TB 3CSTA 4K3BA 1MHHE 2KK8A 3RT3B 4PK1A 3Q8AA 4GDLA 2WX1A 4TQ0A 4ZDVA 4XGAB 4TUUA 2G45B 3LDZE 1I4HA 3IAS1 3NZ3A 1XLNA 3H8HA 1SJHD 3DHIC 3WIMA 4RGMA 1R4MB 2JYTA 3BWUD 4DXFA 5DPWA 1V97A 1FO4A 2MSED 2JU6X 3L10B 2J7QB 1U4AA 4LDTD 1KRHA 3Q14C 3RPFC 4DHZB 3U8ZA 2KWCA 3WAOA 3NHEB 3TEXA 2MBOA 4USAA 2XNAC 3GZNB 2MEKA 2LHDA 2RDHA 1GG3A 1RAXA 4HRSA 2KFJA 3U7ZA 1UELA 2BBCA 1FNUA 2JQRB 4NAWA 3BIID 1XF5L 4P1CC 2PJHA 4RF0A 1QZEA 3Q8EA 4AUQC 1IBXB 4XDCA 1F9JA 2LGYA 4KDLB 5FR3A 1WYWB 2KTFA 2D5GA 2I2YA 2JSVX 2W3SA 5TR5A 4YXDB 4KGTA 3WALA 4MH8A 4PYUA 4ZRPA 1WJ4A 2OOBB 2KT7A 3SR6A 3R7RA 3H7SA 3AE1B 4NJ7A 4N6EB 4W9HA 2D3CA 3BYTB 2VH2A 3V61A 1WWTA 2N9LA 1ZGUB 1LO5D 3PZ7A 3ZDTA 1P1AA 2B76B 3D32A 2KWUB 1GPXA 2YEPB 1KOTA 1IUEA 3X23A 1LXDA 2WXOA 2BKFA 2KQSA 1KLUD 1Q5WB 3NJTA 2J42A 2KOXA 2RGFA 3L08A 4ARIA 2QJLA 3CWIA 2XK5B 4W9JA 2KDFB 2VH1A 4DBGA 3Q8FA 3WAPA 1GC7A 1M94A 2L0TA 5AUKA 1A5RA 4FA6A 3HHMA 3RNBC 2TSSA 2KJHB 2A5UA 3AM9A 1JMLA 1UWMA 3MC0B 3WCQA 3R2IA 2MLBA 3GE8C 1XEEA 2RDGA 2G4DB 4KVGB 3NUHB 1XXGA 1VZ6A 1K53A 2KO3A 3W1SC 2M1MA 4WJNA 4S17A 2KZRA 2BYTA 2MA9B 1KFYB 4HVBA 3C8YA 3EUB2 2Z0EB 3BK2A 3DWGC 1MHXA 2AQ3B 3PS6A 1J19A 1WI0A 1Z5SB 3ECIA 3QAQA 3JSVB 4J6IA 2K8BA 5EDSA 2Y3AA 4EUTA 4XDDA 2MH7A 4GMVA 2OEDA 1SB3C 4C00A 1QT9A 2LFIA 2IGGA 1C3TA 2KWVB 4BOSC 3RD2A 2RR9A 1R4NB 1YNTE 3AU5A 1K8RB 1E8ZA 2HD5B 2W9NA 3AI5A 2PE9A 3PRMB 3LB8C 2C7NB 3ZGZA 1YD8U 1L5PA 3KVFB 4B6WA 3MFGA 1WXAA 2KFKA 1I4RA 4BFRA 1HEZE 1I4QA 1UZXB 2HTME 2BYVE 2MP2B 3AEAB 3PRZA 2INDC 2MJ3A 2K22A 2LXCA 3PPAA 4ACFA 1JCKB 3PLUA 3APDA 1YQ3B 4DQOC 1ET9A 3VRBB 3DDCB 1TS3A 2KMAA 3VTUA 3RNFC 1TTNA 2JRHA 1P7FA 3CIRB 1VJKA 1FXTB 1I7HA 2IGDA 2K1FA 4NY0A 4LLGM 2JF5A 4NQLB 3APCA 5IO9A 1F52A 5T8IA 2RPQA 1X1MA 4LK0M 4MELA 3T9LA 3NS8A 4BBNC 1VZ8A 2O6VA 3GP7A 1UD7A 1FM0D 1WGGA 1SXTA 1YJIA 2FUG1 1C4AA 2PMVA 2IYDB 1L2NA 4RGTA 4X57B 3ZUNA 2GBJA 4II2B 2N1WA 3ZXRA 1SE9A 2LVOA 2KKCA 5JHAA 3P1MA 1WJUA 3RNAC 3MJ5A 2FE8A 2ZPYA 3NVZA 1RFAA 3PSEB 1TKEA 2E6XA 4MSMB 4C56C 2KTRB 3KWLA 1H8CA 2L8JA 2KNBA 2RSUA 2ONQA 1EU4A 3VXWA 3EC8A 1HA5A 1YMHE 1NYRA 1UGJA 2R2OA 4UDUC 1PUTA 1FEHA 2BTEA 2KDMA 2DBYA 3E9SA 2EKIA 4RMAA 4BZAA 4EEWA 1SEBD 3RYTA 1JRUA 5L83A 2LWPA 5JH5C 1ZOYB 2NBWB 2CR5A 4JE3B 1YJ1A 4P7IA 1YQBA 4MGKE 1E7VA 1HE8A 2ZW0A 4A55A 4AJYB 5G2NA 2RPVA 2K8HA 2IZVB 5HHDG 2CU3A 1STEA 3N9YC 4NNJB 3AXCA 4GOCA 3DVGY 4P1BC 3R66C 2QIEB 1DGJA 3VR8B 3A1QB 2R2QA 4PYZA 2O6VB 4M01A 3I9V1 1WYGA 1WFYA 4IUMB 2V0GA 5BYQA 3P42A 3DBRB 2SAKA 1MG4A 1L0VB 3MHZA 1HQRD 2GBMA 2FCNA 3FAHA 4OZBA 5DPTA 1CJEA 1OQQA 3RNEC 2GRIA 5CHVC 1L6UA 1PFDA 4TSSA 1N6ZA 2HJ8A 3ENEA 2KX3A 1C4CA 3U2SC 1Z2MA 4RM8A 3V05A 1L6VA 3AEGB 2GMIC 4GXBA 4KSLC 3PHXB 3AB5A 1T6BX 1WZ0A 3H9DA 2WXNA 1D3ZA 2WX0A 2HE7A 4MSQB 4FULA 1NBFC 5LXHA 4HEA1 3E56A 3W2DA 2WDVB 4ZRQA 1WJNA 2WXPA 1J8CA 4KIKB 1WRDB 1WSPA 1QKZA 1C1YB 3B1LX 4C80A 3T3OA 3Q3MC 2RD0A 1BT0A 1BXTA 2KAJA 2Y5CA 3B2GA 1FFVA 4HCPB 4LNFA 1S3SG 2GB1A 2KJ6A 5BMGA 5G5GA 1XLOA 3ZQ4A 2C7HA 2NPTB 4IKGA 4HK2A 2WXJA 2I38A 4NAMA 2V3PA 5BMIA 4KZ0A 1GJZA 2WXHA 3DBLI 2H89B 2PTLA 1ACCA 1JWAD 1T5XD 4MDKE 1ZKHA 2DWQA 2RMMA 3N1ZC 3V60A 4CHKA 3RCZA 3NS1A 1XCTL 4KKIA 3OJ4B 4YTNB 2LRUA 3VTWA 4F1SA 3OAWA 2YEPF 3VH4B 2WU5B 4LCDE 4GLSC 1DOIA 1JWSD 3N32A 2IO3B 2J0MA 3C19A 4MACA 2LVPA 4CQNA 2J0KA 3KWVA 4ZOHC 2QC8A 4AQ7A 1V8CA 2VZKD 4ANWA 4BKSA 3ZJUA 1QF6A 2MBHA 1P7EA 4GN1A 3PRPB 4A6QA 5HI1A 3NVVA 3NG0A 3NZSA 1WX7A 3HRDD 2JXXA 2WQYB 1FNVA 4S0RA 2LJ5A 1WY8A 1V81A 4P16A 1NYQA 4EZLA 2YVCA 2CJOA 4L2YA 2INPE 1VCBA 2QSDA 1FCCC 3H7PA 4MM3B 1N5XA 4G0NB 3SHQA 4K7UA 3VR9B 1E7UA 3W9CB 4G3XB 2CS4A 4OVUA 4FXCA 3Q8CA 1IYFA 5BYSA 4YTPB 3IVFA 2ZCBA 4MEMA 2LASA 4ASWC 1J7CA 1NEKB 4ZHPA 1XLPA 1EF1A 2LJIA 3A4RA 1WE7A 4RFBA 2NCNA 3HVDA 3Q3FA 2XK5A 4AJWA 2WGSA 2L83A 5I4DA 2BF8B 2LXAA 4JLCA 4NZLB 3A4SC 2ACZB 1SE4A 1YN3A 2LMCA 3EGRA 4DHJB 4YSZB 2UU7A 4GSWA 1OQYA 2SEBD 4PT5A 3ZVVA 2IDYA 1TGZB 1SBBB 1TT5B 2DNFA 2K39A 4K1RB 3P4SB 4GDKA 5MPOA 1NENB 2FAZA 2KC2A 2IJ0A 2B3AA 3EFUA 4OVVA 4EOYA 1GAQB 4W9KA 3KYCD 3AEBB 3NVYA 1Q0WB 1RLFA 2BYFA 3B2FA 3P2BA 1R4MI 4P6VF 2L00B 4ANUA 4B0EA 2WU2B 4WWPA 1NVID 3PREA 1MFWA 4WIPA 1P98A 2BT6A 3APFA 4RGOS 3RFZB 5JXVA 3H7PB 1WMHB 2AX5A 1Q10A 2MW5A 4DXAB 5E6OA 2DZMA 2PW9A 3A33B 1RRBA 4JPSA 3JSVA 2EELA 2KYWA 3RUIB 3OWEB 2PKOA 5C23A 3O65B 2UYZB 1OQRA 3GZNI 4US9A 4IC7B 1MJDA 2AEHA 1E8YA 3UIPB 2IBIB 2G1EA 2IGHA 1I35A 4HROA 4GGQA 3TMPB 2M0XA 2KLCA 4ZRJA 2L0FA 3P4QB 3RZWC 3CSFA 2N7DA 2NBVB 4KZCA 2KN5A 1GC6A 1RFKA 4KSKC 1C9FA 3K9OB 1TZOA 1I4GA 1OFFA 1SE3A 5D94A 2JXTA 1C79A 1HTOA 4URKA 2LRWA 4MT5A 1WR6E 4R3DA 2MP2A 4BKGA 2D3AA 1T0SC 1D5ZC 2FIFA 1V1OA 1ZP0B 2WS3B 4GDKB 4A8XC 3P63A 1E10A 2N9XA 4WURA 3MJWA 4LTUA 3V62A 1TKYA 2FBWB 1AWDA 1T0YA 3UGBB 1ESFA 4IM2A 1TY0A 1TS4A 4EZKA 1WXVA 2G9HD 3DHGC 3ZTDA 4M8MA 1IGCA 3TEWA 2YLMA 4WQMA 3ZLZA 3W1SA 1MPEA 1WX8A 2KVRA 4ANXA 1AN8A 4M0WB 3ML8A 2IPKD 1EWCA 2AL3A 3ZW3A 3SDLC 3PO0A 5DPRA 2OHFA 3TSSA 1OEYJ 1MG8A 2J4XA 4W9GA 2BW2A 2IO2B 3MC9A 3TBLD 1EWYC 2KXJA 2DZJA 3H6NA 3UF8A 1YN4A 2GOWA 4IDIA 3LXFA 3JYUA 1YIWA 4E3CA 1QLBB 3T3NA 3DOWA 4FJVB 1ZDXA 2DZKA 3GOEA 5KHOA 4REZA 5JZEB 3DVNU 3Q3OC 2QDFA 3NVWA 4WH4A 5L95C 2FIDA 4C4VA 3HM3A 1IGDA 4DXGA 3V6EB 2DHZA 2KTRA 4BBNF 2L7RA 4IW0A 4YSXB 1ZW7A 4E74A 1PGBA 2HJ1A 4D2KA 1TYGB 1EUVB 5FKAC 4F7ZA 3UQBA 1WGDA 5AEKB 3W1YA 2CHXA 2WNMA 2DYMA 4OZCA 2AQ1B 1YX6B 3IT4B 4EE2A 2WXKA 1FXAA 2LZ6A 3QWZB 3QC8B 1GOZA 2M0AA 3UI3A 4LNNA 2ICIA 3PVLA 1F2RI 2NVUI 3U4EG 1Y56A 3AEFB 4ZYNA 1UWXA 3NZUA 1WH3A 5G5HA 4NJ6A 3J9CA 2KDEB 1E6EB 4IOIE 2D10A 2L05A 3IBEA 3QQ8B 2KQ7A 2KLGA 4XC2A 2KMMA 3A1QA 5AZHA 2L32A 5BO4B 1V5TA 5CHWA 1R7SA 1E0ZA 5C2TB 5E6JA 1RWSA 2GI9A 3MTNB 2JVCA 3MP9A 3Q69A 4A3PA 1TBEA 5J17A 4MH0E 4LDTB 5IKCM 3TEYA 1HZ5A 1UF0A 2LHEA 4RGNA 1CMXB 1WGRA 1XT9B 2N7EA 1K52A 4HJKA 3QA8A 2AWTA 2JUOA 2C60A 2XN9C 2WXFA 4MGYE 4HDOA 4WAAA 4PS7A 1PDXA 4C4VB 3VDZA 1Y8RC 2D3BA 4NJCA 3N1XC 3BVGA 1I4PA 4OVZA 3KUDB 2NTSA 1GUAB 2V9HA 4K81A 2PEAA 3URYA 4K3CA 2I1JA 1OEYA 3OG5A 3VH3B 2BPSA 4ANVA 1Q1OA 3PV1A 2BS3B 2BWFA 1WGYA 4KIKA 3P4RB 2XEWA 2KJRA 4RNAA 3PLVA 5IP4D 4DDID 2Z0DB 1T0QC 1PYWD 4PS8A 4BAXA 3AEEB 2LEKA 2PPHA 3KUZA 3GE3C 2N9KA 2C7MB 1JQ4A 1CZPA 4JX1C 2NPTA 1TS2A 4LJOB 4XZ4A 3QK0A 3S2AA 5DPSA 2WXGA 3SFEB 2L3ZA 3U30A 5AZFA 2MHJA 4TQ1A 2HTHA 2IY0B 3W5UB 3QJZA 3SD5A 1H4RA 2V1YA 4FLHA 5IN7A 4KGRA 2JT4B 2AQ2B 1AARA 3TCAA 3ZNID 1LFDA 2K25A 4NPNA 4ZRKA 2KQ4X 2LUMA 3VTVA 2JZ3B 1BUIC 4B95A 3LJ3A 3L0WB 2INNE 1SSNA 3TJPA 5D3IB 3TL5A 1P3QU 2MJEA 3TIXA 2V4LA 3AECB 3X0WA 2NBUA 1N60A 1SE2A 4YTMB 1WXSA 3QIJA 3DBSA 4K7WA 4PS3A 4LNIA 2J53A 3PT2B 4W9IA 5IA7A 1PGAA 1JRPA 5LLIA 4ITKA 1TJEA 1SGHA 2CHZA 4XWWA 2WXMA 4HPLB 1WJ6A 5EE9A 3FILB 3ZYYX 4IWQA 4W9LA 1D6EC 1KLGD 1LQBA 3K9PB 3M62B 1E7PB 3NY5A 2ZPNA 3C0RB 1JROA 3IT6B 3NRZA 2C9WB 2IY1B 3V3XA 4TV3A 1JWUD 1C76A 3SU8X 1FIQA 4W9CA 2V4IB 4MM3A 4OHJA 2ZNVC 1SJED 4MJSB 1C78A 5LXIB 1QILA 2BB5A 5HG2A 3TUOA 1FNWA 4LJPB 1I42A 5D2MB 3ZRCA 1C4PA 3QHTA 2A4ZA 4O1NA 1L4DB 4I6LB 3ZNHB 1T0RC 1OTRB 3VUWA 2V3SA 2E3TA 1FRRA 1TY2A 1XD3B 1NI3A 2WXQA 1VR9A 2LGIA 2K9XA 3DBHB 4OW0A 4MGIE 4HXDA 3DQVA 1CQVA 1JW9D 1PGXA 3HUIA 3PZ8A 3KUCB 4QAYA 1JWMD 1GB1A 4N9F4 5FK9C 1E8WA 2G3QB 4IWPA 4FN2A 2KDBA 4ARCA 3BZDB 3IXSA 1YN5A 4RH6A 4B0MA 1ROEA 4HKQA 4XX5A 3AE9B 1FD6A 3N3KB 5BMHA 4H2AA 4FADA 2JWZA 1D5XC 3RN9C 2XBBC 2RDBC 4WQOB 1V5OA 1K50A 4HLEA 1WMHA 4XE0A 1UBIA 2N9EB 2QEJC 4F8CB 1C77A 2KN4A 4Q2JA 1PQSA 5EE3A 4FHKA 2JRIB 2KACA 5GMVA 2V3NA 5D6JB 5BYRA 2FNJB 4YT0B 3RZFA 3PGEA 3HK0A 1AW7A 1KTKA 2WXLA 3A9KB 2ZNVB 1E8XA 3B0AA 1WGKA 3T8MA 4CYEA 1WM3A 4W9DA 2JY6A 3DWMA 2NMQA 3A9JA 1EM7A 2W54A 4GB9A 4US8A 2BWES 3JVZX 3GS2A 1VDVA 1KJTA 2FCMA 2N7JA 2N1VA 3MHSD 2O2VB 2MQJA 3PZDA 3JW0X 5TSSA 2QHOA 3V6CB 4IM3A 1L0YB 1N61A 4K7SA 2EMTA 3KYDD 4HPPA 3BVZA 2I1KA 2MCNB 2J0JA 1YOVB 4W9EA 3R3MA 3ZJTA 4L23A 5CTRC 2AL6A 4EZJA 4A90A 4JL9A 3ZJVA 4I6PA 4HDQA 1K51A 4M0WA 5DCNA 2QMTA 3L54A 2WXRA 3ZDMC 5J18A 1D4BA 3UIOB 1NI2A 1TIFA 2D11A 5KHQA 2PIAA 3VHTC 1F2RC 4WWNA 2Y5BB 3VUYA 4DHZE 2D3GA 1TS5A 2Y5PA 2WLBA 2ASQA 2CHWA 1V86A 4G50A 2W3RA 1VRAB 4GDLB 3A9JB 1FMAD 4HCNB 2PVOD 3R8BA 2FUHB 3RULA 1ZUD2 1WR1A 3VFKA 1QOGA 5IAAC 2O6VD 2JX5A 1UH6A 1E9MA 3L13A 2K3UA 4JWUC 4WAFA 2DLBA 5H8YE 3FKYA 3ZTCA 1RM6C 1HXYD 1M4VA 4HPMB 1V9JA 4OZAA 3N1YC 3Q3JA 3R7QA 4YWGG 2KDIA 3NOBA 1EO6A 1FFUA 4W9FA 4WJQA 3EA6A 2ZCCA 1N62A 2BQQA 1SIFA 4E71A 3L16A 3HVZA 1LM8B 5G55A 1QOFA 4NAWB 1UUPA 1KM7A 3RNGC 2CJNA 1ET6A 2JPHA 1DOYA 5CX3A 2FCSA 2LUEA 3ML9A 3BYYB 3ZKJC 3AH7A 4J3OD 1FRDA 5C1ZA 1SF0A 3AMZA 2GBKA 2W82A 4HWIB 3BY4B 1ENFA 3EECA 4RCOA 4HJGE 3L4PA 4WJPA 3Q2AC 1EF5A 4ICUA 3B9JA 5LNK1 1P9DU 2BGFA 4AS1A 4YSYB 2OJRA 2VZKB 2X8XX 2DENB 2N9PC 4XWTA 2GBNA 1L0XB 2PLPA 3KW5B 3Q3NC 1V49A 1WGHA 2M56B 5E6NA 3IHPC 3KH0A 1V6EA 2WDTB 4A9AA 4FBJB 2MJDA 5E6PA 1TKGA 2LGXA 1ZPSA 3I63C 3VAWA 3DVNV 1YQ4B 1ZXHA 4MGZE 1FPYA 2CU1A 3KLSX 1NDDA 4IWOA 3WANA 4KV2A 3VQIA 3H1UA 4EKUA 3DVGX 1MVKA 2Q5WD 2QCZA 1D5MC 5GXGB 2BS4B 3AE7B 2WDQB 1KH0A 1R4NI 2DX5B 1GNUA 4ZRIA 4TMAB 3PHWB 2GBRA 5JHBA 1JWBD 2K5PA 3AE3B 1WF9A 1FCLA 4XYCA 3WAMA 1G6JA 1WM2A 4AWJA 3ETRA 2W55A 3AE5B 3L17A 4HKZE 4N59A 4NQKE 4G11A 1XQQA 3ALBA 3OJ3A 1LGRA 4ZYSA 4N58A 3QX1A 3AU4A 4ICVA 2NTTA 4LNOA 5FR6A 2CKHB 3ZO5B 2DYBA 2IO0B 1F77A 2KMCA 1VD2A 4L1BA 1HZ6A 2M17A 3AE2B 4BKTA 3IFWB 2LD9A 3ZNGC 4YL8A 2L52A 1B9RA 4KX6B 4B9KA 3ABVB 3Q6BA 2MWSB 4C7YA 2KC1A 1KLVA 2EKEC 3AV8A 3AEDB 2ON8A 1AYFA 2HDEA 2WDRB 2OJWA 1E5WA 1VLBA 5D3DA 1L7YA 3W5VB 4KKJA 2M8SA 3BVMA 3EFCA 2JZPA 1CK1A 2KD0A 2VRRB 3O13A 1WZ3A 4GU2A 2BYEA 4IG7B 3P4PB 4JIOU 2KFKB 4JQWC 4EFOA 5IOIA 3U7DA 2K6QA 3IG3A 1HTQA 1V2YA 2LVQA 3FILA 3BINA 4WWMA 3RMKC 3ZRFA 5D7GA 1MI0A 4JWSC 3N30A 2FCQA 3M3JA 5EE0A 4TKNA 2WXIA 3DCGA 2BS2B 4FJYA 2JYEA 4DHJD 4M00A 2PVGC 3AE8B 3MC8A
chains in the Genus database with same CATH topology
2K9XA 2WU2B 4OW0A 1NVID 1EU3A 1UNSA 1CQVA 1JW9D 4WIPA 2BT6A 4RGOS 3LB8C 3ZGZA 1PGXA 3HUIA 3PZ8A 3RFZB 5JXVA 1L5PA 1ZE3D 2AX5A 1Q10A 1A70A 1JWMD 2L1AA 3AE4B 1GB1A 3MFGA 2PW9A 5EE1A 5FK9C 4JPSA 1I4RA 2EELA 3OWEB 2PKOA 1HEZE 1OQRA 1I4QA 2HTME 4ZHOA 4US9A 3AEAB 2QILA 4ARCA 3BZDB 3IXSA 1YN5A 4RH6A 2MJ3A 2G1EA 2K22A 2IGHA 4B0MA 1ROEA 4HROA 3KQ4A 4HKQA 1JCKB 1T3QA 3AE9B 1YQ3B 3P4QB 4DQOC 1ET9A 2M19A 3VRBB 1FD6A 1TS3A 2J52A 4H2AA 5BMHA 1D5XC 1RFKA 1C9FA 5C3JB 1P7FA 3CIRB 1VJKA 1TZOA 1I4GA 1I7HA 1OFFA 1K50A 1SE3A 1VZ7A 2IGDA 4XE0A 2JXTA 2QEJC 4LLGM 1C77A 1C79A 1V1PA 2JWUA 3U52E 5T8IA 4MT5A 4R3DA 4LK0M 2KN4A 4Q2JA 1D5ZC 5EE3A 1V1OA 1VZ8A 1ZP0B 2WS3B 3GP7A 4GDKB 4A8XC 3P63A 2KACA 1E10A 1FM0D 2FUG1 1SXTA 1YJIA 2BB6A 1C4AA 1L4ZB 2PMVA 2V3NA 3LYYA 3Q8BA 4WURA 5BYRA 4RGTA 4LTUA 1TKYA 2K0PA 4YT0B 2FBWB 1AWDA 1AW7A 1ESFA 1KTKA 2WXLA 1DYQA 2N0SB 1TY0A 1RYJA 1TS4A 1WGKA 2Z8LA 3P1MA 2DYOA 3AN1A 1WRIA 2G9HD 1WXQA 3MJ5A 4KGSA 1FXIA 2FE8A 3DWMA 3NVZA 2NMQA 1EM7A 2W54A 4US8A 1IGCA 2ZW1A 1I4XA 3TEWA 1TKEA 4WQMA 3W1SA 3GS2A 2E6XA 1BMLC 4C56C 1VDVA 1MPEA 3FC4A 2N7JA 3KWLA 1ZDVA 1AN8A 2ONQA 1EU4A 2IPKD 1EWCA 1QQRA 1HA5A 1YMHE 1NYRA 1UGJA 4UDUC 3IAM1 3PO0A 3GB1A 2OHFA 5TSSA 3TSSA 2J4XA 1PUTA 1FEHA 2BTEA 2KDMA 2BW2A 1QOBA 2DBYA 1J7AA 1EWYC 1L0YB 1N61A 3R2TA 3E9SA 1YN4A 2EKIA 3AE6B 3BVZA 4IDIA 3LXFA 1SEBD 1DOXA 1QLBB 3T3NA 1ZDXA 3TEZA 4REZA 1ZOYB 3ZJTA 4JE3B 3NVWA 4L23A 4WH4A 1JALA 1B1ZA 1ZXIA 3SFDB 1IGDA 4DXGA 4A90A 3ZJVA 2ZW0A 5H92C 4A55A 1K51A 1SIJA 4M0WA 4YSXB 1YJJA 1V1PB 2RPVA 5HHDG 2CU3A 1STEA 3N9YC 1PGBA 2QMTA 3I57A 4D2KA 5HFYA 1TYGB 4C7ZA 2WXRA 2QIEB 1D4BA 1DGJA 5FKAC 3VR8B 3VRAB 2KWDA 1N63A 2PIAA 3SEBA 3I9V1 1WYGA 2WNMA 2DYMA 4OZCA 2AQ1B 4EE2A 3IT4B 2WXKA 1F2RC 1FXAA 1GOZA 2M0AA 3UI3A 2V0GA 1TS5A 5BYQA 2Y5PA 3P42A 2WLBA 2ICIA 2SAKA 1F2RI 3U4EG 1L0VB 3MHZA 1HQRD 3FAHA 4OZBA 1Y56A 3AEFB 1UWXA 2W3RA 1VRAB 1CJEA 1KF6B 3BK1A 4GDLB 1IBXA 5G5HA 1OQQA 1FMAD 3J9CA 2PVOD 3R8BA 2GRIA 1L6UA 1PFDA 1E6EB 1ZUD2 4TSSA 4IOIE 2X38A 5AUIA 1C4CA 1XO3A 3U2SC 1N5WA 1QOGA 1GB4A 2JX5A 2WP9B 1XLQA 4RF1A 1E9MA 3V05A 2K3UA 4JWUC 1L6VA 4WAFA 2DLBA 5H8YE 3AEGB 2KMMA 1RM6C 2L32A 1HXYD 1M4VA 3AB5A 1T6BX 2H88B 1R7SA 1E0ZA 1QOAA 5C2TB 5E6JA 1J7BA 1RWSA 2GI9A 2R61A 3MP9A 4OZAA 2WXNA 3Q69A 4YWGG 1XCQL 1F0ZA 3TEYA 1HZ5A 4HEA1 3E56A 3W2DA 1FFUA 2WDVB 1MHHE 3EA6A 2LHEA 1N62A 4RGNA 4ZRQA 2WXPA 3HVZA 3Q8AA 4TQ0A 1QOFA 4NAWB 1K52A 1UUPA 2CJNA 1ET6A 1WSPA 1DOYA 1I4HA 2XN9C 3IAS1 1QKZA 2WXFA 3NZ3A 4C80A 1XLNA 3H8HA 1SJHD 3T3OA 1PDXA 4RGMA 3BYYB 1BXTA 2JYTA 3BWUD 2KAJA 2Y5CA 3B2GA 4DXFA 3AH7A 1V97A 4J3OD 1FRDA 1FO4A 1FFVA 1SF0A 2GB1A 2JU6X 3AMZA 2W82A 4NJCA 5BMGA 1ENFA 5G5GA 1XLOA 3BVGA 3ZQ4A 1I4PA 4OVZA 1KRHA 3RPFC 4IKGA 4RCOA 2WXJA 2I38A 2NTSA 4NAMA 2V3PA 5BMIA 4HJGE 2WXHA 3L4PA 3URYA 2H89B 3TEXA 4USAA 2XNAC 2PTLA 2MEKA 2LHDA 2RDHA 3B9JA 1ACCA 5LNK1 1JWAD 1T5XD 4HRSA 4AS1A 3U7ZA 2BS3B 4YSYB 2VZKB 2BBCA 1FNUA 2JQRB 2DWQA 2RMMA 3BIID 1XF5L 3P4RB 4XWTA 4RF0A 1L0XB 2PLPA 3Q8EA 4RNAA 3NS1A 1IBXB 1XCTL 2M56B 4XDCA 4KKIA 5FR3A 4YTNB 2D5GA 1PYWD 4A9AA 2I2YA 2JSVX 2W3SA 4YXDB 2YEPF 3AEEB 4KGTA 2MJDA 2WU5B 4GLSC 1TKGA 2LEKA 1DOIA 1ZPSA 2N9KA 4MH8A 4ZRPA 1JQ4A 1CZPA 1JWSD 1YQ4B 4JX1C 1ZXHA 3SR6A 1TS2A 4MACA 4CQNA 3AE1B 4N6EB 3KLSX 3KWVA 4ZOHC 2WXGA 3SFEB 4AQ7A 1V8CA 3BYTB 2VZKD 4TQ1A 3W5UB 1WWTA 3VQIA 2N9LA 1LO5D 3PZ7A 1MVKA 2Q5WD 2B76B 1D5MC 4KGRA 3ZJUA 5GXGB 1QF6A 1GPXA 2AQ2B 2BS4B 3AE7B 1P7EA 2WDQB 1KH0A 4A6QA 2YEPB 5HI1A 4TMAB 3NVVA 2KQ4X 1IUEA 2LUMA 1BUIC 1JWBD 2K5PA 3AE3B 1FCLA 3HRDD 2WQYB 2WXOA 2INNE 1SSNA 1FNVA 3ETRA 1KLUD 2W55A 3AE5B 5D3IB 2MJEA 2J42A 4P16A 1NYQA 4HKZE 3AECB 4N59A 2CJOA 4ARIA 2QJLA 3CWIA 4L2YA 2INPE 1N60A 2QSDA 1FCCC 4ZYSA 4N58A 1SE2A 3Q8FA 4YTMB 2NTTA 4MM3B 1N5XA 5AUKA 2TSSA 3VR9B 3W9CB 2J53A 1PGAA 1JRPA 3AM9A 1F77A 4FXCA 4ITKA 1JMLA 1HZ6A 1UWMA 1TJEA 4L1BA 3MC0B 3WCQA 3Q8CA 3R2IA 5BYSA 3AE2B 4YTPB 4XWWA 2WXMA 1XEEA 2RDGA 2L52A 3NUHB 1J7CA 1NEKB 4KX6B 5EE9A 4ZHPA 1XLPA 1XXGA 1K53A 1VZ6A 3FILB 3ABVB 3ZYYX 1D6EC 2LJIA 4C7YA 1KLGD 4RFBA 3HVDA 1E7PB 2BYTA 2L83A 1JROA 3IT6B 5I4DA 3AV8A 4NZLB 3AEDB 3NRZA 2ON8A 1AYFA 2HDEA 2WDRB 1KFYB 3V3XA 1JWUD 1C76A 1SE4A 1VLBA 1YN3A 2ACZB 3C8YA 2LMCA 1FIQA 3EGRA 3EUB2 5D3DA 3W5VB 2V4IB 4KKJA 4OHJA 3BVMA 2JZPA 4YSZB 1CK1A 3O13A 2SEBD 3BK2A 1B9RA 3DWGC 4PT5A 2IDYA 1SJED 3P4PB 1MHXA 2AQ3B 1C78A 1SBBB 1QILA 2BB5A 5HG2A 3TUOA 1FNWA 3P4SB 5MPOA 2Y3AA 1NENB 1C4PA 4XDDA 2MH7A 2IJ0A 2OEDA 1SB3C 1QT9A 3FILA 2LFIA 4O1NA 2IGGA 4WWMA 5D7GA 1MI0A 1L4DB 1GAQB 4JWSC 5EE0A 3AEBB 3NVYA 2WXIA 1YNTE 2BS2B 2JYEA 3B2FA 2E3TA 1FRRA 1TY2A 4P6VF 2PVGC 3AE8B 1NI3A 2WXQA 4B0EA 1VR9A 2LGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUM A;  1XCQ L;  2ONQ A;  1FCL A;  1HZ5 A;  1YMH E;  1MHH E;  2LHE A;  1PGX A;  5JXV A;  3GB1 A;  1Q10 A;  4HKZ E;  1K52 A;  2KDM A;  1GB1 A;  2PW9 A;  1QKZ A;  2EEL A;  2QSD A;  1FCC C;  1HEZ E;  2GB1 A;  2JU6 X;  2IGH A;  2J53 A;  5BMG A;  1PGA A;  4WH4 A;  4IKG A;  1IGD A;  1JML A;  1HZ6 A;  2I38 A;  1FD6 A;  5BMI A;  4HJG E;  2ZW0 A;  5BMH A;  2J52 A;  1K51 A;  2RPV A;  5HHD G;  1PGB A;  2PTL A;  1C9F A;  2LHD A;  2QMT A;  1P7F A;  3FIL B;  1K53 A;  4D2K A;  5HFY A;  1D4B A;  1K50 A;  2IGD A;  2KWD A;  2JXT A;  2RMM A;  1XF5 L;  4OZC A;  1F2R C;  2PLP A;  2JWU A;  1IBX B;  1XCT L;  2ON8 A;  3UI3 A;  3V3X A;  2KN4 A;  1F2R I;  2I2Y A;  2JSV X;  2JZP A;  2KAC A;  4KGT A;  4OZB A;  4GLS C;  1UWX A;  2N9K A;  2K0P A;  1IBX A;  1MHX A;  1ZXH A;  4MAC A;  5HG2 A;  4IOI E;  1GB4 A;  2OED A;  4KGS A;  3FIL A;  2N9L A;  2NMQ A;  2IGG A;  1EM7 A;  1MI0 A;  1MVK A;  4KGR A;  1IGC A;  2ZW1 A;  1P7E A;  1YNT E;  1KH0 A;  1MPE A;  2GI9 A;  4OZA A;  3MP9 A;  5HI1 A;  2N7J A;  2KQ4 X;  2LGI A; 
#chains in the Genus database with same CATH topology
 3OLM D;  3ZNZ B;  2NR2 A;  1EU3 A;  1UNS A;  2D2Q A;  4BKS D;  1ZE3 D;  4WWO A;  4MJS A;  1WE6 A;  1OGW A;  1A70 A;  2L1A A;  2LI5 A;  3AE4 B;  5EE1 A;  3HIZ A;  1P0R A;  4ZHO A;  2QIL A;  3UIN B;  2GLS A;  1F1H A;  3RI7 C;  3KQ4 A;  1T3Q A;  2EMS A;  1IP9 A;  2M19 A;  2J52 A;  2D07 B;  2KAN A;  4A3O A;  4BVU C;  5C3J B;  2K8C A;  1UBQ A;  1VZ7 A;  1V1P A;  5AZG A;  3N20 C;  2BKR B;  2JWU A;  1TZ1 A;  3U52 E;  4FHJ A;  3PTF C;  4FJZ A;  1IPG A;  3DBL B;  3DBR I;  1V80 A;  2KX0 A;  3LYY A;  4RF1 A;  2BB6 A;  3Q8B A;  1L4Z B;  2L76 A;  2M4N A;  2ZZP B;  2K0P A;  2DAJ A;  2N4F A;  1DYQ A;  2N0S B;  1RYJ A;  3M95 A;  4DWF A;  2Z8L A;  2DYO A;  3AN1 A;  1WRI A;  1WXQ A;  2MBB B;  3HM6 X;  1FXI A;  4KGS A;  1ISN A;  3RNC C;  4IM0 A;  3CF6 E;  4M8N A;  3AUL A;  3WA0 A;  3B08 A;  4A20 A;  2AYO B;  2ZW1 A;  1I4X A;  2ZEQ A;  5CHF A;  1BML C;  3ZIM A;  2PE6 B;  3FC4 A;  2IO1 B;  3DPD A;  3M63 B;  2ZVO A;  1ZDV A;  3I5J C;  1J0G A;  2WWZ A;  1QQR A;  1E90 A;  2MRP A;  3ONS A;  4LNK A;  1UGM A;  3IAM 1;  4JGH B;  3GB1 A;  3CMM B;  3EHV A;  3A9K A;  1QOB A;  1J7A A;  3R2T A;  3VVW B;  2Z59 B;  4II3 B;  3AE6 B;  2ZVN A;  1DOX A;  2WHI A;  3TEZ A;  4RM9 A;  1JAL A;  1B1Z A;  3DHH C;  1ZXI A;  3SFD B;  1S1Q B;  5HKH A;  5H92 C;  4AP4 C;  1SIJ A;  1YJJ A;  1V1P B;  4CO7 A;  2BVC A;  4DDG D;  2O2V A;  3I57 A;  1WX9 A;  4M02 A;  5HFY A;  4C7Z A;  3VRA B;  4I6N B;  2KWD A;  2MX2 A;  1N63 A;  5J2R A;  3SEB A;  2LGS A;  2JZZ A;  2UWQ A;  1WXM A;  1YX5 B;  2WYQ A;  2ZJD A;  2REX A;  2LGD A;  2NS5 A;  2K6D B;  4DK5 A;  2C5L C;  4KDI C;  1KF6 B;  3BK1 A;  1IBX A;  2KHW B;  2DAF A;  4WJO A;  3VUX A;  3DBH I;  2KVZ A;  2X38 A;  5AUI A;  1XO3 A;  1N5W A;  1GB4 A;  2WP9 B;  1XLQ A;  2MBQ A;  3QCA A;  2MBE A;  2H88 B;  3ZXV A;  4GIV A;  1QOA A;  1J7B A;  2R61 A;  4AOF A;  4BOZ B;  2G4S A;  2DZI A;  3QAR A;  3UQA A;  2INC C;  1XCQ L;  1F0Z A;  1WIA A;  3I3T B;  3CST A;  4K3B A;  1MHH E;  2KK8 A;  3RT3 B;  4PK1 A;  3Q8A A;  4GDL A;  2WX1 A;  4TQ0 A;  4ZDV A;  4XGA B;  4TUU A;  2G45 B;  3LDZ E;  1I4H A;  3IAS 1;  3NZ3 A;  1XLN A;  3H8H A;  1SJH D;  3DHI C;  3WIM A;  4RGM A;  1R4M B;  2JYT A;  3BWU D;  4DXF A;  5DPW A;  1V97 A;  1FO4 A;  2MSE D;  2JU6 X;  3L10 B;  2J7Q B;  1U4A A;  4LDT D;  1KRH A;  3Q14 C;  3RPF C;  4DHZ B;  3U8Z A;  2KWC A;  3WAO A;  3NHE B;  3TEX A;  2MBO A;  4USA A;  2XNA C;  3GZN B;  2MEK A;  2LHD A;  2RDH A;  1GG3 A;  1RAX A;  4HRS A;  2KFJ A;  3U7Z A;  1UEL A;  2BBC A;  1FNU A;  2JQR B;  4NAW A;  3BII D;  1XF5 L;  4P1C C;  2PJH A;  4RF0 A;  1QZE A;  3Q8E A;  4AUQ C;  1IBX B;  4XDC A;  1F9J A;  2LGY A;  4KDL B;  5FR3 A;  1WYW B;  2KTF A;  2D5G A;  2I2Y A;  2JSV X;  2W3S A;  5TR5 A;  4YXD B;  4KGT A;  3WAL A;  4MH8 A;  4PYU A;  4ZRP A;  1WJ4 A;  2OOB B;  2KT7 A;  3SR6 A;  3R7R A;  3H7S A;  3AE1 B;  4NJ7 A;  4N6E B;  4W9H A;  2D3C A;  3BYT B;  2VH2 A;  3V61 A;  1WWT A;  2N9L A;  1ZGU B;  1LO5 D;  3PZ7 A;  3ZDT A;  1P1A A;  2B76 B;  3D32 A;  2KWU B;  1GPX A;  2YEP B;  1KOT A;  1IUE A;  3X23 A;  1LXD A;  2WXO A;  2BKF A;  2KQS A;  1KLU D;  1Q5W B;  3NJT A;  2J42 A;  2KOX A;  2RGF A;  3L08 A;  4ARI A;  2QJL A;  3CWI A;  2XK5 B;  4W9J A;  2KDF B;  2VH1 A;  4DBG A;  3Q8F A;  3WAP A;  1GC7 A;  1M94 A;  2L0T A;  5AUK A;  1A5R A;  4FA6 A;  3HHM A;  3RNB C;  2TSS A;  2KJH B;  2A5U A;  3AM9 A;  1JML A;  1UWM A;  3MC0 B;  3WCQ A;  3R2I A;  2MLB A;  3GE8 C;  1XEE A;  2RDG A;  2G4D B;  4KVG B;  3NUH B;  1XXG A;  1VZ6 A;  1K53 A;  2KO3 A;  3W1S C;  2M1M A;  4WJN A;  4S17 A;  2KZR A;  2BYT A;  2MA9 B;  1KFY B;  4HVB A;  3C8Y A;  3EUB 2;  2Z0E B;  3BK2 A;  3DWG C;  1MHX A;  2AQ3 B;  3PS6 A;  1J19 A;  1WI0 A;  1Z5S B;  3ECI A;  3QAQ A;  3JSV B;  4J6I A;  2K8B A;  5EDS A;  2Y3A A;  4EUT A;  4XDD A;  2MH7 A;  4GMV A;  2OED A;  1SB3 C;  4C00 A;  1QT9 A;  2LFI A;  2IGG A;  1C3T A;  2KWV B;  4BOS C;  3RD2 A;  2RR9 A;  1R4N B;  1YNT E;  3AU5 A;  1K8R B;  1E8Z A;  2HD5 B;  2W9N A;  3AI5 A;  2PE9 A;  3PRM B;  3LB8 C;  2C7N B;  3ZGZ A;  1YD8 U;  1L5P A;  3KVF B;  4B6W A;  3MFG A;  1WXA A;  2KFK A;  1I4R A;  4BFR A;  1HEZ E;  1I4Q A;  1UZX B;  2HTM E;  2BYV E;  2MP2 B;  3AEA B;  3PRZ A;  2IND C;  2MJ3 A;  2K22 A;  2LXC A;  3PPA A;  4ACF A;  1JCK B;  3PLU A;  3APD A;  1YQ3 B;  4DQO C;  1ET9 A;  3VRB B;  3DDC B;  1TS3 A;  2KMA A;  3VTU A;  3RNF C;  1TTN A;  2JRH A;  1P7F A;  3CIR B;  1VJK A;  1FXT B;  1I7H A;  2IGD A;  2K1F A;  4NY0 A;  4LLG M;  2JF5 A;  4NQL B;  3APC A;  5IO9 A;  1F52 A;  5T8I A;  2RPQ A;  1X1M A;  4LK0 M;  4MEL A;  3T9L A;  3NS8 A;  4BBN C;  1VZ8 A;  2O6V A;  3GP7 A;  1UD7 A;  1FM0 D;  1WGG A;  1SXT A;  1YJI A;  2FUG 1;  1C4A A;  2PMV A;  2IYD B;  1L2N A;  4RGT A;  4X57 B;  3ZUN A;  2GBJ A;  4II2 B;  2N1W A;  3ZXR A;  1SE9 A;  2LVO A;  2KKC A;  5JHA A;  3P1M A;  1WJU A;  3RNA C;  3MJ5 A;  2FE8 A;  2ZPY A;  3NVZ A;  1RFA A;  3PSE B;  1TKE A;  2E6X A;  4MSM B;  4C56 C;  2KTR B;  3KWL A;  1H8C A;  2L8J A;  2KNB A;  2RSU A;  2ONQ A;  1EU4 A;  3VXW A;  3EC8 A;  1HA5 A;  1YMH E;  1NYR A;  1UGJ A;  2R2O A;  4UDU C;  1PUT A;  1FEH A;  2BTE A;  2KDM A;  2DBY A;  3E9S A;  2EKI A;  4RMA A;  4BZA A;  4EEW A;  1SEB D;  3RYT A;  1JRU A;  5L83 A;  2LWP A;  5JH5 C;  1ZOY B;  2NBW B;  2CR5 A;  4JE3 B;  1YJ1 A;  4P7I A;  1YQB A;  4MGK E;  1E7V A;  1HE8 A;  2ZW0 A;  4A55 A;  4AJY B;  5G2N A;  2RPV A;  2K8H A;  2IZV B;  5HHD G;  2CU3 A;  1STE A;  3N9Y C;  4NNJ B;  3AXC A;  4GOC A;  3DVG Y;  4P1B C;  3R66 C;  2QIE B;  1DGJ A;  3VR8 B;  3A1Q B;  2R2Q A;  4PYZ A;  2O6V B;  4M01 A;  3I9V 1;  1WYG A;  1WFY A;  4IUM B;  2V0G A;  5BYQ A;  3P42 A;  3DBR B;  2SAK A;  1MG4 A;  1L0V B;  3MHZ A;  1HQR D;  2GBM A;  2FCN A;  3FAH A;  4OZB A;  5DPT A;  1CJE A;  1OQQ A;  3RNE C;  2GRI A;  5CHV C;  1L6U A;  1PFD A;  4TSS A;  1N6Z A;  2HJ8 A;  3ENE A;  2KX3 A;  1C4C A;  3U2S C;  1Z2M A;  4RM8 A;  3V05 A;  1L6V A;  3AEG B;  2GMI C;  4GXB A;  4KSL C;  3PHX B;  3AB5 A;  1T6B X;  1WZ0 A;  3H9D A;  2WXN A;  1D3Z A;  2WX0 A;  2HE7 A;  4MSQ B;  4FUL A;  1NBF C;  5LXH A;  4HEA 1;  3E56 A;  3W2D A;  2WDV B;  4ZRQ A;  1WJN A;  2WXP A;  1J8C A;  4KIK B;  1WRD B;  1WSP A;  1QKZ A;  1C1Y B;  3B1L X;  4C80 A;  3T3O A;  3Q3M C;  2RD0 A;  1BT0 A;  1BXT A;  2KAJ A;  2Y5C A;  3B2G A;  1FFV A;  4HCP B;  4LNF A;  1S3S G;  2GB1 A;  2KJ6 A;  5BMG A;  5G5G A;  1XLO A;  3ZQ4 A;  2C7H A;  2NPT B;  4IKG A;  4HK2 A;  2WXJ A;  2I38 A;  4NAM A;  2V3P A;  5BMI A;  4KZ0 A;  1GJZ A;  2WXH A;  3DBL I;  2H89 B;  2PTL A;  1ACC A;  1JWA D;  1T5X D;  4MDK E;  1ZKH A;  2DWQ A;  2RMM A;  3N1Z C;  3V60 A;  4CHK A;  3RCZ A;  3NS1 A;  1XCT L;  4KKI A;  3OJ4 B;  4YTN B;  2LRU A;  3VTW A;  4F1S A;  3OAW A;  2YEP F;  3VH4 B;  2WU5 B;  4LCD E;  4GLS C;  1DOI A;  1JWS D;  3N32 A;  2IO3 B;  2J0M A;  3C19 A;  4MAC A;  2LVP A;  4CQN A;  2J0K A;  3KWV A;  4ZOH C;  2QC8 A;  4AQ7 A;  1V8C A;  2VZK D;  4ANW A;  4BKS A;  3ZJU A;  1QF6 A;  2MBH A;  1P7E A;  4GN1 A;  3PRP B;  4A6Q A;  5HI1 A;  3NVV A;  3NG0 A;  3NZS A;  1WX7 A;  3HRD D;  2JXX A;  2WQY B;  1FNV A;  4S0R A;  2LJ5 A;  1WY8 A;  1V81 A;  4P16 A;  1NYQ A;  4EZL A;  2YVC A;  2CJO A;  4L2Y A;  2INP E;  1VCB A;  2QSD A;  1FCC C;  3H7P A;  4MM3 B;  1N5X A;  4G0N B;  3SHQ A;  4K7U A;  3VR9 B;  1E7U A;  3W9C B;  4G3X B;  2CS4 A;  4OVU A;  4FXC A;  3Q8C A;  1IYF A;  5BYS A;  4YTP B;  3IVF A;  2ZCB A;  4MEM A;  2LAS A;  4ASW C;  1J7C A;  1NEK B;  4ZHP A;  1XLP A;  1EF1 A;  2LJI A;  3A4R A;  1WE7 A;  4RFB A;  2NCN A;  3HVD A;  3Q3F A;  2XK5 A;  4AJW A;  2WGS A;  2L83 A;  5I4D A;  2BF8 B;  2LXA A;  4JLC A;  4NZL B;  3A4S C;  2ACZ B;  1SE4 A;  1YN3 A;  2LMC A;  3EGR A;  4DHJ B;  4YSZ B;  2UU7 A;  4GSW A;  1OQY A;  2SEB D;  4PT5 A;  3ZVV A;  2IDY A;  1TGZ B;  1SBB B;  1TT5 B;  2DNF A;  2K39 A;  4K1R B;  3P4S B;  4GDK A;  5MPO A;  1NEN B;  2FAZ A;  2KC2 A;  2IJ0 A;  2B3A A;  3EFU A;  4OVV A;  4EOY A;  1GAQ B;  4W9K A;  3KYC D;  3AEB B;  3NVY A;  1Q0W B;  1RLF A;  2BYF A;  3B2F A;  3P2B A;  1R4M I;  4P6V F;  2L00 B;  4ANU A;  4B0E A;  2WU2 B;  4WWP A;  1NVI D;  3PRE A;  1MFW A;  4WIP A;  1P98 A;  2BT6 A;  3APF A;  4RGO S;  3RFZ B;  5JXV A;  3H7P B;  1WMH B;  2AX5 A;  1Q10 A;  2MW5 A;  4DXA B;  5E6O A;  2DZM A;  2PW9 A;  3A33 B;  1RRB A;  4JPS A;  3JSV A;  2EEL A;  2KYW A;  3RUI B;  3OWE B;  2PKO A;  5C23 A;  3O65 B;  2UYZ B;  1OQR A;  3GZN I;  4US9 A;  4IC7 B;  1MJD A;  2AEH A;  1E8Y A;  3UIP B;  2IBI B;  2G1E A;  2IGH A;  1I35 A;  4HRO A;  4GGQ A;  3TMP B;  2M0X A;  2KLC A;  4ZRJ A;  2L0F A;  3P4Q B;  3RZW C;  3CSF A;  2N7D A;  2NBV B;  4KZC A;  2KN5 A;  1GC6 A;  1RFK A;  4KSK C;  1C9F A;  3K9O B;  1TZO A;  1I4G A;  1OFF A;  1SE3 A;  5D94 A;  2JXT A;  1C79 A;  1HTO A;  4URK A;  2LRW A;  4MT5 A;  1WR6 E;  4R3D A;  2MP2 A;  4BKG A;  2D3A A;  1T0S C;  1D5Z C;  2FIF A;  1V1O A;  1ZP0 B;  2WS3 B;  4GDK B;  4A8X C;  3P63 A;  1E10 A;  2N9X A;  4WUR A;  3MJW A;  4LTU A;  3V62 A;  1TKY A;  2FBW B;  1AWD A;  1T0Y A;  3UGB B;  1ESF A;  4IM2 A;  1TY0 A;  1TS4 A;  4EZK A;  1WXV A;  2G9H D;  3DHG C;  3ZTD A;  4M8M A;  1IGC A;  3TEW A;  2YLM A;  4WQM A;  3ZLZ A;  3W1S A;  1MPE A;  1WX8 A;  2KVR A;  4ANX A;  1AN8 A;  4M0W B;  3ML8 A;  2IPK D;  1EWC A;  2AL3 A;  3ZW3 A;  3SDL C;  3PO0 A;  5DPR A;  2OHF A;  3TSS A;  1OEY J;  1MG8 A;  2J4X A;  4W9G A;  2BW2 A;  2IO2 B;  3MC9 A;  3TBL D;  1EWY C;  2KXJ A;  2DZJ A;  3H6N A;  3UF8 A;  1YN4 A;  2GOW A;  4IDI A;  3LXF A;  3JYU A;  1YIW A;  4E3C A;  1QLB B;  3T3N A;  3DOW A;  4FJV B;  1ZDX A;  2DZK A;  3GOE A;  5KHO A;  4REZ A;  5JZE B;  3DVN U;  3Q3O C;  2QDF A;  3NVW A;  4WH4 A;  5L95 C;  2FID A;  4C4V A;  3HM3 A;  1IGD A;  4DXG A;  3V6E B;  2DHZ A;  2KTR A;  4BBN F;  2L7R A;  4IW0 A;  4YSX B;  1ZW7 A;  4E74 A;  1PGB A;  2HJ1 A;  4D2K A;  1TYG B;  1EUV B;  5FKA C;  4F7Z A;  3UQB A;  1WGD A;  5AEK B;  3W1Y A;  2CHX A;  2WNM A;  2DYM A;  4OZC A;  2AQ1 B;  1YX6 B;  3IT4 B;  4EE2 A;  2WXK A;  1FXA A;  2LZ6 A;  3QWZ B;  3QC8 B;  1GOZ A;  2M0A A;  3UI3 A;  4LNN A;  2ICI A;  3PVL A;  1F2R I;  2NVU I;  3U4E G;  1Y56 A;  3AEF B;  4ZYN A;  1UWX A;  3NZU A;  1WH3 A;  5G5H A;  4NJ6 A;  3J9C A;  2KDE B;  1E6E B;  4IOI E;  2D10 A;  2L05 A;  3IBE A;  3QQ8 B;  2KQ7 A;  2KLG A;  4XC2 A;  2KMM A;  3A1Q A;  5AZH A;  2L32 A;  5BO4 B;  1V5T A;  5CHW A;  1R7S A;  1E0Z A;  5C2T B;  5E6J A;  1RWS A;  2GI9 A;  3MTN B;  2JVC A;  3MP9 A;  3Q69 A;  4A3P A;  1TBE A;  5J17 A;  4MH0 E;  4LDT B;  5IKC M;  3TEY A;  1HZ5 A;  1UF0 A;  2LHE A;  4RGN A;  1CMX B;  1WGR A;  1XT9 B;  2N7E A;  1K52 A;  4HJK A;  3QA8 A;  2AWT A;  2JUO A;  2C60 A;  2XN9 C;  2WXF A;  4MGY E;  4HDO A;  4WAA A;  4PS7 A;  1PDX A;  4C4V B;  3VDZ A;  1Y8R C;  2D3B A;  4NJC A;  3N1X C;  3BVG A;  1I4P A;  4OVZ A;  3KUD B;  2NTS A;  1GUA B;  2V9H A;  4K81 A;  2PEA A;  3URY A;  4K3C A;  2I1J A;  1OEY A;  3OG5 A;  3VH3 B;  2BPS A;  4ANV A;  1Q1O A;  3PV1 A;  2BS3 B;  2BWF A;  1WGY A;  4KIK A;  3P4R B;  2XEW A;  2KJR A;  4RNA A;  3PLV A;  5IP4 D;  4DDI D;  2Z0D B;  1T0Q C;  1PYW D;  4PS8 A;  4BAX A;  3AEE B;  2LEK A;  2PPH A;  3KUZ A;  3GE3 C;  2N9K A;  2C7M B;  1JQ4 A;  1CZP A;  4JX1 C;  2NPT A;  1TS2 A;  4LJO B;  4XZ4 A;  3QK0 A;  3S2A A;  5DPS A;  2WXG A;  3SFE B;  2L3Z A;  3U30 A;  5AZF A;  2MHJ A;  4TQ1 A;  2HTH A;  2IY0 B;  3W5U B;  3QJZ A;  3SD5 A;  1H4R A;  2V1Y A;  4FLH A;  5IN7 A;  4KGR A;  2JT4 B;  2AQ2 B;  1AAR A;  3TCA A;  3ZNI D;  1LFD A;  2K25 A;  4NPN A;  4ZRK A;  2KQ4 X;  2LUM A;  3VTV A;  2JZ3 B;  1BUI C;  4B95 A;  3LJ3 A;  3L0W B;  2INN E;  1SSN A;  3TJP A;  5D3I B;  3TL5 A;  1P3Q U;  2MJE A;  3TIX A;  2V4L A;  3AEC B;  3X0W A;  2NBU A;  1N60 A;  1SE2 A;  4YTM B;  1WXS A;  3QIJ A;  3DBS A;  4K7W A;  4PS3 A;  4LNI A;  2J53 A;  3PT2 B;  4W9I A;  5IA7 A;  1PGA A;  1JRP A;  5LLI A;  4ITK A;  1TJE A;  1SGH A;  2CHZ A;  4XWW A;  2WXM A;  4HPL B;  1WJ6 A;  5EE9 A;  3FIL B;  3ZYY X;  4IWQ A;  4W9L A;  1D6E C;  1KLG D;  1LQB A;  3K9P B;  3M62 B;  1E7P B;  3NY5 A;  2ZPN A;  3C0R B;  1JRO A;  3IT6 B;  3NRZ A;  2C9W B;  2IY1 B;  3V3X A;  4TV3 A;  1JWU D;  1C76 A;  3SU8 X;  1FIQ A;  4W9C A;  2V4I B;  4MM3 A;  4OHJ A;  2ZNV C;  1SJE D;  4MJS B;  1C78 A;  5LXI B;  1QIL A;  2BB5 A;  5HG2 A;  3TUO A;  1FNW A;  4LJP B;  1I42 A;  5D2M B;  3ZRC A;  1C4P A;  3QHT A;  2A4Z A;  4O1N A;  1L4D B;  4I6L B;  3ZNH B;  1T0R C;  1OTR B;  3VUW A;  2V3S A;  2E3T A;  1FRR A;  1TY2 A;  1XD3 B;  1NI3 A;  2WXQ A;  1VR9 A;  2LGI A;  2K9X A;  3DBH B;  4OW0 A;  4MGI E;  4HXD A;  3DQV A;  1CQV A;  1JW9 D;  1PGX A;  3HUI A;  3PZ8 A;  3KUC B;  4QAY A;  1JWM D;  1GB1 A;  4N9F 4;  5FK9 C;  1E8W A;  2G3Q B;  4IWP A;  4FN2 A;  2KDB A;  4ARC A;  3BZD B;  3IXS A;  1YN5 A;  4RH6 A;  4B0M A;  1ROE A;  4HKQ A;  4XX5 A;  3AE9 B;  1FD6 A;  3N3K B;  5BMH A;  4H2A A;  4FAD A;  2JWZ A;  1D5X C;  3RN9 C;  2XBB C;  2RDB C;  4WQO B;  1V5O A;  1K50 A;  4HLE A;  1WMH A;  4XE0 A;  1UBI A;  2N9E B;  2QEJ C;  4F8C B;  1C77 A;  2KN4 A;  4Q2J A;  1PQS A;  5EE3 A;  4FHK A;  2JRI B;  2KAC A;  5GMV A;  2V3N A;  5D6J B;  5BYR A;  2FNJ B;  4YT0 B;  3RZF A;  3PGE A;  3HK0 A;  1AW7 A;  1KTK A;  2WXL A;  3A9K B;  2ZNV B;  1E8X A;  3B0A A;  1WGK A;  3T8M A;  4CYE A;  1WM3 A;  4W9D A;  2JY6 A;  3DWM A;  2NMQ A;  3A9J A;  1EM7 A;  2W54 A;  4GB9 A;  4US8 A;  2BWE S;  3JVZ X;  3GS2 A;  1VDV A;  1KJT A;  2FCM A;  2N7J A;  2N1V A;  3MHS D;  2O2V B;  2MQJ A;  3PZD A;  3JW0 X;  5TSS A;  2QHO A;  3V6C B;  4IM3 A;  1L0Y B;  1N61 A;  4K7S A;  2EMT A;  3KYD D;  4HPP A;  3BVZ A;  2I1K A;  2MCN B;  2J0J A;  1YOV B;  4W9E A;  3R3M A;  3ZJT A;  4L23 A;  5CTR C;  2AL6 A;  4EZJ A;  4A90 A;  4JL9 A;  3ZJV A;  4I6P A;  4HDQ A;  1K51 A;  4M0W A;  5DCN A;  2QMT A;  3L54 A;  2WXR A;  3ZDM C;  5J18 A;  1D4B A;  3UIO B;  1NI2 A;  1TIF A;  2D11 A;  5KHQ A;  2PIA A;  3VHT C;  1F2R C;  4WWN A;  2Y5B B;  3VUY A;  4DHZ E;  2D3G A;  1TS5 A;  2Y5P A;  2WLB A;  2ASQ A;  2CHW A;  1V86 A;  4G50 A;  2W3R A;  1VRA B;  4GDL B;  3A9J B;  1FMA D;  4HCN B;  2PVO D;  3R8B A;  2FUH B;  3RUL A;  1ZUD 2;  1WR1 A;  3VFK A;  1QOG A;  5IAA C;  2O6V D;  2JX5 A;  1UH6 A;  1E9M A;  3L13 A;  2K3U A;  4JWU C;  4WAF A;  2DLB A;  5H8Y E;  3FKY A;  3ZTC A;  1RM6 C;  1HXY D;  1M4V A;  4HPM B;  1V9J A;  4OZA A;  3N1Y C;  3Q3J A;  3R7Q A;  4YWG G;  2KDI A;  3NOB A;  1EO6 A;  1FFU A;  4W9F A;  4WJQ A;  3EA6 A;  2ZCC A;  1N62 A;  2BQQ A;  1SIF A;  4E71 A;  3L16 A;  3HVZ A;  1LM8 B;  5G55 A;  1QOF A;  4NAW B;  1UUP A;  1KM7 A;  3RNG C;  2CJN A;  1ET6 A;  2JPH A;  1DOY A;  5CX3 A;  2FCS A;  2LUE A;  3ML9 A;  3BYY B;  3ZKJ C;  3AH7 A;  4J3O D;  1FRD A;  5C1Z A;  1SF0 A;  3AMZ A;  2GBK A;  2W82 A;  4HWI B;  3BY4 B;  1ENF A;  3EEC A;  4RCO A;  4HJG E;  3L4P A;  4WJP A;  3Q2A C;  1EF5 A;  4ICU A;  3B9J A;  5LNK 1;  1P9D U;  2BGF A;  4AS1 A;  4YSY B;  2OJR A;  2VZK B;  2X8X X;  2DEN B;  2N9P C;  4XWT A;  2GBN A;  1L0X B;  2PLP A;  3KW5 B;  3Q3N C;  1V49 A;  1WGH A;  2M56 B;  5E6N A;  3IHP C;  3KH0 A;  1V6E A;  2WDT B;  4A9A A;  4FBJ B;  2MJD A;  5E6P A;  1TKG A;  2LGX A;  1ZPS A;  3I63 C;  3VAW A;  3DVN V;  1YQ4 B;  1ZXH A;  4MGZ E;  1FPY A;  2CU1 A;  3KLS X;  1NDD A;  4IWO A;  3WAN A;  4KV2 A;  3VQI A;  3H1U A;  4EKU A;  3DVG X;  1MVK A;  2Q5W D;  2QCZ A;  1D5M C;  5GXG B;  2BS4 B;  3AE7 B;  2WDQ B;  1KH0 A;  1R4N I;  2DX5 B;  1GNU A;  4ZRI A;  4TMA B;  3PHW B;  2GBR A;  5JHB A;  1JWB D;  2K5P A;  3AE3 B;  1WF9 A;  1FCL A;  4XYC A;  3WAM A;  1G6J A;  1WM2 A;  4AWJ A;  3ETR A;  2W55 A;  3AE5 B;  3L17 A;  4HKZ E;  4N59 A;  4NQK E;  4G11 A;  1XQQ A;  3ALB A;  3OJ3 A;  1LGR A;  4ZYS A;  4N58 A;  3QX1 A;  3AU4 A;  4ICV A;  2NTT A;  4LNO A;  5FR6 A;  2CKH B;  3ZO5 B;  2DYB A;  2IO0 B;  1F77 A;  2KMC A;  1VD2 A;  4L1B A;  1HZ6 A;  2M17 A;  3AE2 B;  4BKT A;  3IFW B;  2LD9 A;  3ZNG C;  4YL8 A;  2L52 A;  1B9R A;  4KX6 B;  4B9K A;  3ABV B;  3Q6B A;  2MWS B;  4C7Y A;  2KC1 A;  1KLV A;  2EKE C;  3AV8 A;  3AED B;  2ON8 A;  1AYF A;  2HDE A;  2WDR B;  2OJW A;  1E5W A;  1VLB A;  5D3D A;  1L7Y A;  3W5V B;  4KKJ A;  2M8S A;  3BVM A;  3EFC A;  2JZP A;  1CK1 A;  2KD0 A;  2VRR B;  3O13 A;  1WZ3 A;  4GU2 A;  2BYE A;  4IG7 B;  3P4P B;  4JIO U;  2KFK B;  4JQW C;  4EFO A;  5IOI A;  3U7D A;  2K6Q A;  3IG3 A;  1HTQ A;  1V2Y A;  2LVQ A;  3FIL A;  3BIN A;  4WWM A;  3RMK C;  3ZRF A;  5D7G A;  1MI0 A;  4JWS C;  3N30 A;  2FCQ A;  3M3J A;  5EE0 A;  4TKN A;  2WXI A;  3DCG A;  2BS2 B;  4FJY A;  2JYE A;  4DHJ D;  4M00 A;  2PVG C;  3AE8 B;  3MC8 A; 
#chains in the Genus database with same CATH homology
 2K9X A;  2WU2 B;  4OW0 A;  1NVI D;  1EU3 A;  1UNS A;  1CQV A;  1JW9 D;  4WIP A;  2BT6 A;  4RGO S;  3LB8 C;  3ZGZ A;  1PGX A;  3HUI A;  3PZ8 A;  3RFZ B;  5JXV A;  1L5P A;  1ZE3 D;  2AX5 A;  1Q10 A;  1A70 A;  1JWM D;  2L1A A;  3AE4 B;  1GB1 A;  3MFG A;  2PW9 A;  5EE1 A;  5FK9 C;  4JPS A;  1I4R A;  2EEL A;  3OWE B;  2PKO A;  1HEZ E;  1OQR A;  1I4Q A;  2HTM E;  4ZHO A;  4US9 A;  3AEA B;  2QIL A;  4ARC A;  3BZD B;  3IXS A;  1YN5 A;  4RH6 A;  2MJ3 A;  2G1E A;  2K22 A;  2IGH A;  4B0M A;  1ROE A;  4HRO A;  3KQ4 A;  4HKQ A;  1JCK B;  1T3Q A;  3AE9 B;  1YQ3 B;  3P4Q B;  4DQO C;  1ET9 A;  2M19 A;  3VRB B;  1FD6 A;  1TS3 A;  2J52 A;  4H2A A;  5BMH A;  1D5X C;  1RFK A;  1C9F A;  5C3J B;  1P7F A;  3CIR B;  1VJK A;  1TZO A;  1I4G A;  1I7H A;  1OFF A;  1K50 A;  1SE3 A;  1VZ7 A;  2IGD A;  4XE0 A;  2JXT A;  2QEJ C;  4LLG M;  1C77 A;  1C79 A;  1V1P A;  2JWU A;  3U52 E;  5T8I A;  4MT5 A;  4R3D A;  4LK0 M;  2KN4 A;  4Q2J A;  1D5Z C;  5EE3 A;  1V1O A;  1VZ8 A;  1ZP0 B;  2WS3 B;  3GP7 A;  4GDK B;  4A8X C;  3P63 A;  2KAC A;  1E10 A;  1FM0 D;  2FUG 1;  1SXT A;  1YJI A;  2BB6 A;  1C4A A;  1L4Z B;  2PMV A;  2V3N A;  3LYY A;  3Q8B A;  4WUR A;  5BYR A;  4RGT A;  4LTU A;  1TKY A;  2K0P A;  4YT0 B;  2FBW B;  1AWD A;  1AW7 A;  1ESF A;  1KTK A;  2WXL A;  1DYQ A;  2N0S B;  1TY0 A;  1RYJ A;  1TS4 A;  1WGK A;  2Z8L A;  3P1M A;  2DYO A;  3AN1 A;  1WRI A;  2G9H D;  1WXQ A;  3MJ5 A;  4KGS A;  1FXI A;  2FE8 A;  3DWM A;  3NVZ A;  2NMQ A;  1EM7 A;  2W54 A;  4US8 A;  1IGC A;  2ZW1 A;  1I4X A;  3TEW A;  1TKE A;  4WQM A;  3W1S A;  3GS2 A;  2E6X A;  1BML C;  4C56 C;  1VDV A;  1MPE A;  3FC4 A;  2N7J A;  3KWL A;  1ZDV A;  1AN8 A;  2ONQ A;  1EU4 A;  2IPK D;  1EWC A;  1QQR A;  1HA5 A;  1YMH E;  1NYR A;  1UGJ A;  4UDU C;  3IAM 1;  3PO0 A;  3GB1 A;  2OHF A;  5TSS A;  3TSS A;  2J4X A;  1PUT A;  1FEH A;  2BTE A;  2KDM A;  2BW2 A;  1QOB A;  2DBY A;  1J7A A;  1EWY C;  1L0Y B;  1N61 A;  3R2T A;  3E9S A;  1YN4 A;  2EKI A;  3AE6 B;  3BVZ A;  4IDI A;  3LXF A;  1SEB D;  1DOX A;  1QLB B;  3T3N A;  1ZDX A;  3TEZ A;  4REZ A;  1ZOY B;  3ZJT A;  4JE3 B;  3NVW A;  4L23 A;  4WH4 A;  1JAL A;  1B1Z A;  1ZXI A;  3SFD B;  1IGD A;  4DXG A;  4A90 A;  3ZJV A;  2ZW0 A;  5H92 C;  4A55 A;  1K51 A;  1SIJ A;  4M0W A;  4YSX B;  1YJJ A;  1V1P B;  2RPV A;  5HHD G;  2CU3 A;  1STE A;  3N9Y C;  1PGB A;  2QMT A;  3I57 A;  4D2K A;  5HFY A;  1TYG B;  4C7Z A;  2WXR A;  2QIE B;  1D4B A;  1DGJ A;  5FKA C;  3VR8 B;  3VRA B;  2KWD A;  1N63 A;  2PIA A;  3SEB A;  3I9V 1;  1WYG A;  2WNM A;  2DYM A;  4OZC A;  2AQ1 B;  4EE2 A;  3IT4 B;  2WXK A;  1F2R C;  1FXA A;  1GOZ A;  2M0A A;  3UI3 A;  2V0G A;  1TS5 A;  5BYQ A;  2Y5P A;  3P42 A;  2WLB A;  2ICI A;  2SAK A;  1F2R I;  3U4E G;  1L0V B;  3MHZ A;  1HQR D;  3FAH A;  4OZB A;  1Y56 A;  3AEF B;  1UWX A;  2W3R A;  1VRA B;  1CJE A;  1KF6 B;  3BK1 A;  4GDL B;  1IBX A;  5G5H A;  1OQQ A;  1FMA D;  3J9C A;  2PVO D;  3R8B A;  2GRI A;  1L6U A;  1PFD A;  1E6E B;  1ZUD 2;  4TSS A;  4IOI E;  2X38 A;  5AUI A;  1C4C A;  1XO3 A;  3U2S C;  1N5W A;  1QOG A;  1GB4 A;  2JX5 A;  2WP9 B;  1XLQ A;  4RF1 A;  1E9M A;  3V05 A;  2K3U A;  4JWU C;  1L6V A;  4WAF A;  2DLB A;  5H8Y E;  3AEG B;  2KMM A;  1RM6 C;  2L32 A;  1HXY D;  1M4V A;  3AB5 A;  1T6B X;  2H88 B;  1R7S A;  1E0Z A;  1QOA A;  5C2T B;  5E6J A;  1J7B A;  1RWS A;  2GI9 A;  2R61 A;  3MP9 A;  4OZA A;  2WXN A;  3Q69 A;  4YWG G;  1XCQ L;  1F0Z A;  3TEY A;  1HZ5 A;  4HEA 1;  3E56 A;  3W2D A;  1FFU A;  2WDV B;  1MHH E;  3EA6 A;  2LHE A;  1N62 A;  4RGN A;  4ZRQ A;  2WXP A;  3HVZ A;  3Q8A A;  4TQ0 A;  1QOF A;  4NAW B;  1K52 A;  1UUP A;  2CJN A;  1ET6 A;  1WSP A;  1DOY A;  1I4H A;  2XN9 C;  3IAS 1;  1QKZ A;  2WXF A;  3NZ3 A;  4C80 A;  1XLN A;  3H8H A;  1SJH D;  3T3O A;  1PDX A;  4RGM A;  3BYY B;  1BXT A;  2JYT A;  3BWU D;  2KAJ A;  2Y5C A;  3B2G A;  4DXF A;  3AH7 A;  1V97 A;  4J3O D;  1FRD A;  1FO4 A;  1FFV A;  1SF0 A;  2GB1 A;  2JU6 X;  3AMZ A;  2W82 A;  4NJC A;  5BMG A;  1ENF A;  5G5G A;  1XLO A;  3BVG A;  3ZQ4 A;  1I4P A;  4OVZ A;  1KRH A;  3RPF C;  4IKG A;  4RCO A;  2WXJ A;  2I38 A;  2NTS A;  4NAM A;  2V3P A;  5BMI A;  4HJG E;  2WXH A;  3L4P A;  3URY A;  2H89 B;  3TEX A;  4USA A;  2XNA C;  2PTL A;  2MEK A;  2LHD A;  2RDH A;  3B9J A;  1ACC A;  5LNK 1;  1JWA D;  1T5X D;  4HRS A;  4AS1 A;  3U7Z A;  2BS3 B;  4YSY B;  2VZK B;  2BBC A;  1FNU A;  2JQR B;  2DWQ A;  2RMM A;  3BII D;  1XF5 L;  3P4R B;  4XWT A;  4RF0 A;  1L0X B;  2PLP A;  3Q8E A;  4RNA A;  3NS1 A;  1IBX B;  1XCT L;  2M56 B;  4XDC A;  4KKI A;  5FR3 A;  4YTN B;  2D5G A;  1PYW D;  4A9A A;  2I2Y A;  2JSV X;  2W3S A;  4YXD B;  2YEP F;  3AEE B;  4KGT A;  2MJD A;  2WU5 B;  4GLS C;  1TKG A;  2LEK A;  1DOI A;  1ZPS A;  2N9K A;  4MH8 A;  4ZRP A;  1JQ4 A;  1CZP A;  1JWS D;  1YQ4 B;  4JX1 C;  1ZXH A;  3SR6 A;  1TS2 A;  4MAC A;  4CQN A;  3AE1 B;  4N6E B;  3KLS X;  3KWV A;  4ZOH C;  2WXG A;  3SFE B;  4AQ7 A;  1V8C A;  3BYT B;  2VZK D;  4TQ1 A;  3W5U B;  1WWT A;  3VQI A;  2N9L A;  1LO5 D;  3PZ7 A;  1MVK A;  2Q5W D;  2B76 B;  1D5M C;  4KGR A;  3ZJU A;  5GXG B;  1QF6 A;  1GPX A;  2AQ2 B;  2BS4 B;  3AE7 B;  1P7E A;  2WDQ B;  1KH0 A;  4A6Q A;  2YEP B;  5HI1 A;  4TMA B;  3NVV A;  2KQ4 X;  1IUE A;  2LUM A;  1BUI C;  1JWB D;  2K5P A;  3AE3 B;  1FCL A;  3HRD D;  2WQY B;  2WXO A;  2INN E;  1SSN A;  1FNV A;  3ETR A;  1KLU D;  2W55 A;  3AE5 B;  5D3I B;  2MJE A;  2J42 A;  4P16 A;  1NYQ A;  4HKZ E;  3AEC B;  4N59 A;  2CJO A;  4ARI A;  2QJL A;  3CWI A;  4L2Y A;  2INP E;  1N60 A;  2QSD A;  1FCC C;  4ZYS A;  4N58 A;  1SE2 A;  3Q8F A;  4YTM B;  2NTT A;  4MM3 B;  1N5X A;  5AUK A;  2TSS A;  3VR9 B;  3W9C B;  2J53 A;  1PGA A;  1JRP A;  3AM9 A;  1F77 A;  4FXC A;  4ITK A;  1JML A;  1HZ6 A;  1UWM A;  1TJE A;  4L1B A;  3MC0 B;  3WCQ A;  3Q8C A;  3R2I A;  5BYS A;  3AE2 B;  4YTP B;  4XWW A;  2WXM A;  1XEE A;  2RDG A;  2L52 A;  3NUH B;  1J7C A;  1NEK B;  4KX6 B;  5EE9 A;  4ZHP A;  1XLP A;  1XXG A;  1K53 A;  1VZ6 A;  3FIL B;  3ABV B;  3ZYY X;  1D6E C;  2LJI A;  4C7Y A;  1KLG D;  4RFB A;  3HVD A;  1E7P B;  2BYT A;  2L83 A;  1JRO A;  3IT6 B;  5I4D A;  3AV8 A;  4NZL B;  3AED B;  3NRZ A;  2ON8 A;  1AYF A;  2HDE A;  2WDR B;  1KFY B;  3V3X A;  1JWU D;  1C76 A;  1SE4 A;  1VLB A;  1YN3 A;  2ACZ B;  3C8Y A;  2LMC A;  1FIQ A;  3EGR A;  3EUB 2;  5D3D A;  3W5V B;  2V4I B;  4KKJ A;  4OHJ A;  3BVM A;  2JZP A;  4YSZ B;  1CK1 A;  3O13 A;  2SEB D;  3BK2 A;  1B9R A;  3DWG C;  4PT5 A;  2IDY A;  1SJE D;  3P4P B;  1MHX A;  2AQ3 B;  1C78 A;  1SBB B;  1QIL A;  2BB5 A;  5HG2 A;  3TUO A;  1FNW A;  3P4S B;  5MPO A;  2Y3A A;  1NEN B;  1C4P A;  4XDD A;  2MH7 A;  2IJ0 A;  2OED A;  1SB3 C;  1QT9 A;  3FIL A;  2LFI A;  4O1N A;  2IGG A;  4WWM A;  5D7G A;  1MI0 A;  1L4D B;  1GAQ B;  4JWS C;  5EE0 A;  3AEB B;  3NVY A;  2WXI A;  1YNT E;  2BS2 B;  2JYE A;  3B2F A;  2E3T A;  1FRR A;  1TY2 A;  4P6V F;  2PVG C;  3AE8 B;  1NI3 A;  2WXQ A;  4B0E A;  1VR9 A;  2LGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...