2RPVA

Solution structure of gb1 with lbt probe
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
CYVDTNNDGAYEGDELSGTMEYKLILNGKTLKGETTTCAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Two-point anchoring of a lanthanide-binding peptide to a target protein enhances the paramagnetic anisotropic effect
pubmed doi rcsb
source organism Streptococcus sp. group g
molecule tags Immune system
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rpvA00
2OEDA 4OZBA 2QMTA 5HFYA 1MHXA 1P7FA 2ON8A 1FD6A 2RMMA 1ZXHA 2PTLA 2QSDA 2N9LA 4OZCA 2KDMA 1PGAA 4MACA 4KGTA 1GB4A 2KWDA 4IOIE 4HKZE 2GB1A 2J52A 2IGDA 4HJGE 1MI0A 3V3XA 2I38A 1UWXA 2LHDA 4D2KA 4KGRA 2KACA 1MHHE 2GI9A 4KGSA 1F2RC 1QKZA 2I2YA 2ZW1A 1K51A 1FCLA 4GLSC 2LUMA 3GB1A 1Q10A 2N9KA 1MPEA 1K52A 2IGGA 1GB1A 1K50A 5HHDG 2N7JA 5HI1A 2J53A 1D4BA 1HEZE 1IGCA 2LGIA 1XCTL 2ONQA 1F2RI 1FCCC 2ZW0A 2PLPA 2RPVA 1HZ5A 5BMIA 3FILA 1IBXA 2JWUA 2JU6X 5JXVA 4IKGA 1HZ6A 1IGDA 1XCQL 1YNTE 2IGHA 2JSVX 1PGBA 1KH0A 3FILB 1XF5L 2PW9A 2NMQA 1YMHE 2LHEA 1IBXB 4OZAA 5BMGA 1JMLA 2JZPA 5HG2A 2EELA 1PGXA 1EM7A 2KN4A 3UI3A 1C9FA 5BMHA 2K0PA 4WH4A 1K53A 2KQ4X 3MP9A 2JXTA 1MVKA 1P7EA
chains in the Genus database with same CATH superfamily
2JYTA 5EE3A 4WAFA 1ET6A 2ON8A 5CX3A 1N5WA 1ZW7A 3OLMD 1QOBA 1KF6B 1YN3A 2YEPB 4PS7A 1I4HA 1EU4A 2KDMA 4J3OD 3DHHC 2NBUA 3AN1A 2KWCA 4KGTA 2W55A 4DXFA 4K1RB 4HPLB 4RNAA 1R4NB 1Q0WB 3VVWB 3Q3MC 3RCZA 2VZKB 2I1JA 4DWFA 3NG0A 3UF8A 1NVID 1JCKB 1K51A 2DZKA 4GDLB 2IBIB 1ZXIA 3EGRA 3AM9A 3ZYYX 1T6BX 4DHZB 2OJWA 2QDFA 4FJZA 1Z2MA 3KUCB 2D3CA 4K3CA 4B9KA 2W3SA 2K5PA 2DX5B 2WWZA 4NZLB 4B0EA 5CHWA 4IWPA 3GE3C 3ML9A 3PGEA 1CZPA 3ZRFA 2L32A 4K7SA 2KDIA 4NJ6A 3HUIA 3VDZA 2DHZA 2WU5B 3MJWA 1XO3A 3DBSA 1GUAB 1ZDVA 1C76A 2LHEA 1QQRA 2IY0B 1N60A 3HHMA 4IW0A 3BWUD 2N7EA 1E8WA 3TUOA 3W9CB 1QLBB 3KYCD 3IT4B 2V3NA 3A9JA 1V1PB 1Z5SB 1C4PA 3A4RA 2BS3B 3N9YC 4ARCA 1WRDB 2LI5A 2XNAC 4WJPA 2DZMA 3L10B 2V4LA 1L0YB 4NJ7A 2MRPA 3L16A 1QOGA 2GB1A 2KVRA 1WJ6A 2J0KA 3MC9A 4RGNA 4XWTA 3TEZA 1OGWA 3TEWA 2PJHA 2HJ8A 1YQ3B 3GB1A 3KQ4A 3OWEB 1Q10A 2JZ3B 2KVZA 2JX5A 2C7MB 2KMCA 3QCAA 3N1YC 3PREA 1KLVA 2FCNA 2HTME 3S2AA 1I42A 2J53A 2K6DB 3A4SC 1UBIA 3AE6B 2FAZA 1WJNA 3ZGZA 1YN5A 1TY0A 5LLIA 5LXIB 1OFFA 2DZJA 4HDQA 1NEKB 2LD9A 4M01A 1L7YA 2LGYA 1P9DU 3QC8B 2XK5B 3NOBA 4JLCA 1EU3A 3PO0A 2MX2A 1OEYA 5D3DA 1KH0A 4IUMB 3FILB 4ZRIA 3WALA 3GP7A 3U7DA 4G11A 4BOSC 4KIKB 2KT7A 3PRPB 2KX0A 2VZKD 2OEDA 1WI0A 2JT4B 2HE7A 1XXGA 3ZXVA 1SE3A 4MELA 2TSSA 3PZ7A 4WJOA 1N6ZA 2GBNA 3B0AA 1C4CA 4MJSB 2KMAA 1E6EB 1HQRD 1GOZA 2WP9B 2DNFA 3ZDTA 2DENB 2KAJA 2MJ3A 2K8HA 2EMTA 2V9HA 3WCQA 2KYWA 3MFGA 4ASWC 1FXTB 2KFKA 1D3ZA 1LFDA 1L2NA 1HE8A 2GI9A 4HRSA 3ZXRA 4HWIB 4TV3A 2KNBA 3P63A 1YJJA 2KTRB 5HKHA 2RGFA 3ZJVA 4LNOA 1UELA 2M1MA 1SJHD 2J7QB 5DCNA 3AEEB 4R3DA 3C0RB 4OVZA 3JW0X 2WNMA 2BT6A 5FKAC 4AWJA 3H7PB 2RPVA 3DOWA 2WXNA 1GC6A 3C19A 2JRHA 2CHZA 1R4MB 3AECB 2BB5A 2N9EB 3DQVA 4MSQB 2LVQA 2N1VA 1XEEA 1OQRA 3DBHB 2INDC 1JRPA 3TJPA 3H8HA 1YNTE 3AEFB 4AQ7A 1HTQA 2LJ5A 1DYQA 1UZXB 1YMHE 2INCC 3IT6B 4GSWA 4N6EB 3LXFA 4L23A 2EELA 1T0QC 1BMLC 2DZIA 3OJ4B 3Q69A 3LJ3A 4WH4A 5C2TB 1ZOYB 3RNGC 2L3ZA 4GDKA 4QAYA 5GMVA 1TY2A 2LFIA 5G2NA 3B1LX 1WFYA 1WYGA 2JUOA 1RAXA 2KKCA 2WYQA 4OHJA 2KHWB 1E9MA 4HJKA 2Z0DB 4GN1A 1WGGA 3GZNI 2YLMA 1SIJA 2DAFA 1JRUA 2M0AA 3JVZX 2WQYB 3R2IA 4A55A 2OOBB 2Q5WD 3EC8A 2FCQA 1Y8RC 4HPMB 4GLSC 2X8XX 4BKSD 3AU5A 2CU1A 4X57B 1K52A 2NBVB 3RNBC 4EOYA 2ZCCA 4C7YA 2L0FA 3NUHB 3ZQ4A 1FCCC 4N59A 1WM3A 5BYSA 1XLPA 3DBLI 1OEYJ 1L5PA 1EF5A 5BMIA 4ANWA 1NDDA 4B6WA 4IWQA 4KV2A 3QK0A 1TKGA 3CWIA 1QOAA 4GOCA 1F9JA 1E8ZA 2AX5A 2IDYA 2MJEA 5DPWA 4BFRA 4URKA 2PIAA 4ITKA 1LXDA 5EE1A 1E8YA 2HD5B 1IBXB 4NNJB 3AE9B 2GOWA 3PTFC 4HPPA 3UQBA 3TSSA 1GAQB 2W54A 2Y5PA 4EZJA 1SJED 2WXRA 1P7EA 4B0MA 2KJHB 4OZBA 3Q14C 1PQSA 3ONSA 3VRBB 1FD6A 2MJDA 5CHFA 2BBCA 1M4VA 1V6EA 4AJYB 4NQKE 1GB4A 4NAWB 2K39A 2L7RA 3KVFB 4B95A 3U4EG 2PVOD 1UGMA 1FO4A 1FNVA 2M56B 2AYOB 4FLHA 3DBRI 3I3TB 2K8CA 1I4QA 4BKSA 2XK5A 1FNWA 4ANVA 1KTKA 3AV8A 2VRRB 5CHVC 3Q2AC 1D5XC 1WE7A 2V3PA 4MGYE 2N1WA 4KIKA 2G3QB 3W1SA 3WAMA 1R7SA 1IGCA 1WX7A 4A90A 1C78A 3NRZA 4M8NA 1DOIA 1F2RI 4NJCA 5E6OA 2O6VA 2MSED 4MT5A 4FHJA 3RT3B 2RSUA 2KJ6A 3Q3JA 3DWGC 2LXCA 2WXJA 1EF1A 3R7QA 4GXBA 3A9KB 3CSFA 4F7ZA 3ZIMA 2MW5A 3AI5A 1SXTA 2L76A 2MHJA 1E7UA 3UIPB 1XQQA 1RYJA 4RH6A 3V60A 4FJVB 1SE4A 3JYUA 3APCA 2GBRA 1N62A 1C9FA 2CKHB 1RRBA 3BVGA 1T0YA 2YVCA 4OW0A 3WAPA 1JW9D 4JE3B 3B2FA 3Q3NC 1MG4A 1I4XA 3NHEB 1SF0A 4EUTA 2KTRA 1WRIA 3P4PB 3PZDA 3ZJUA 2BS2B 3A1QB 4IM2A 4WJQA 2N9LA 2O2VB 1YD8U 1I4GA 1WX8A 3DBLB 3QIJA 3X23A 3NS8A 4RGMA 1YJIA 2JYEA 5G55A 4MM3B 4LDTB 4MGIE 2GRIA 3QA8A 2KX3A 4LTUA 4DHZE 2NTTA 2MH7A 2PVGC 3KYDD 2N9PC 3QWZB 3X0WA 1TYGB 4FADA 1GC7A 2QCZA 3EFUA 1E8XA 3O13A 2EMSA 1D4BA 1V81A 4RM9A 4O1NA 4A20A 4WJNA 1KLUD 3CIRB 4FJYA 2D07B 2D11A 1T5XD 4A9AA 4TQ0A 4ZRQA 3RN9C 2BPSA 3IXSA 2M0XA 3T3NA 2WXIA 4FA6A 4DDGD 4A3PA 4HVBA 1UUPA 1DGJA 4W9HA 5JZEB 4N9F4 2HJ1A 3KH0A 2K22A 3DBRB 4WAAA 3VUXA 3ZJTA 1FNUA 3NVVA 4XX5A 2IJ0A 3TMPB 2D5GA 1F0ZA 1SE2A 4NY0A 1FFVA 2QILA 2JF5A 3V6EB 3RNCC 2L00B 3ALBA 2BTEA 4P1CC 1K53A 4TQ1A 4RGTA 1MG8A 5JHBA 1WZ3A 4YSZB 1C4AA 1L4DB 5AZFA 1J7CA 4EFOA 2HDEA 1DOXA 3PLVA 1NI3A 2UU7A 1P3QU 1AWDA 4MGZE 4ANUA 3U30A 1A70A 1RM6C 1B9RA 5D94A 3IBEA 3KWLA 3PRZA 2WDQB 5AUIA 3I9V1 3JSVA 2BB6A 2M19A 4HJGE 1L0VB 3V05A 1JWSD 3QARA 3EHVA 2D3AA 4PYZA 2KN5A 1V5TA 2KACA 2ZW1A 3PZ8A 3QX1A 1R4MI 5FR3A 2H89B 4S17A 3AE3B 2KC2A 4BAXA 3LDZE 2N9KA 2E3TA 3VUWA 3ZDMC 1WXAA 4YXDB 5E6NA 4US8A 1TS5A 1Q5WB 3DBHI 3AH7A 1K50A 5HHDG 4ZYNA 3RPFC 1SBBB 1J7BA 4P7IA 2RR9A 3M3JA 4CYEA 1XCTL 1S3SG 3Q8EA 1UNSA 1YQ4B 1JWMD 2LEKA 3V61A 2L52A 1IUEA 1TKYA 1T0RC 3K9OB 1DOYA 2G45B 2W82A 4P1BC 2JWUA 3SU8X 3SEBA 1HA5A 3MC8A 3IFWB 5JXVA 2N4FA 1KM7A 3DWMA 1UF0A 4NAWA 1VZ7A 5E6PA 2SAKA 4ANXA 4W9CA 2ZCBA 4ZRPA 1L4ZB 1N63A 2PW9A 4LLGM 1RLFA 2NMQA 2ZNVC 2KK8A 3ZNID 1AW7A 2AWTA 2KDFB 4TMAB 1ZPSA 1YJ1A 1XT9B 1FRDA 1SIFA 2ASQA 5IOIA 2NBWB 3EUB2 1MVKA 3SFDB 4BBNC 3ZVVA 3D32A 4I6NB 3E56A 1STEA 5HFYA 1I7HA 3B9JA 2RMMA 1WSPA 1VRAB 1V86A 1N61A 3L54A 5LXHA 2KWUB 4WIPA 5EE9A 2OHFA 1YN4A 2RDBC 3UIOB 1FRRA 5D7GA 2MP2B 3MJ5A 2LJIA 2DLBA 4YSYB 2PE9A 1A5RA 2K1FA 3IG3A 4YWGG 1L0XB 1WH3A 1PDXA 2CJNA 4S0RA 5JHAA 1EO6A 3FAHA 4XYCA 4C4VB 3LB8C 4F8CB 3HM6X 1NENB 1C79A 4M8MA 5AZHA 1JALA 4JWUC 3RNEC 3B2GA 1VDVA 1SSNA 4DK5A 2ZZPB 3PS6A 4YTMB 2O2VA 1E7PB 2K25A 2ZPNA 2C9WB 2LRUA 2KJRA 1XLNA 4PS3A 1M94A 3W5VB 1XD3B 4M02A 3BZDB 3ABVB 1F1HA 1C77A 1T0SC 3PSEB 2MCNB 1JROA 3BVMA 3VR9B 2LZ6A 3NS1A 1CQVA 4ICUA 1EM7A 2BQQA 3M62B 3PLUA 1ZE3D 3VHTC 1WGHA 2M8SA 3VQIA 1K8RB 5C23A 1NBFC 4JGHB 4L1BA 5E6JA 2WHIA 3W2DA 5T8IA 5IN7A 2VH1A 4LJPB 2KANA 4RGOS 1QILA 5J17A 3IAS1 4NQLB 2M4NA 4KZ0A 2KXJA 3U7ZA 1WGRA 3Q6BA 3W1SC 1TIFA 4GDLA 1IPGA 5IAAC 1ROEA 4US9A 4D2KA 2EKEC 1MFWA 1SEBD 2UWQA 3N3KB 3RMKC 3APDA 1BXTA 1WXQA 4C56C 3J9CA 4GU2A 3GS2A 4W9EA 4BVUC 1S1QB 2ZVOA 2L1AA 1MPEA 5G5HA 3WAOA 1E7VA 1TGZB 2IO0B 4KX6B 2FIFA 1GJZA 1WM2A 4FHKA 3QAQA 1NI2A 1YX6B 4L2YA 2LWPA 4C80A 4IWOA 4M00A 1I4PA 3ZTCA 3P4QB 3ZNGC 4OVVA 2AL3A 1YX5B 3PV1A 2YEPF 2XBBC 3I5JC 1VJKA 2J4XA 3DVNV 3UQAA 1D5MC 2FCMA 2WXOA 1T3QA 3IVFA 2GLSA 2CHWA 3L13A 5D3IB 1V1PA 2PE6B 1XF5L 3I63C 4OZAA 1WIAA 2WXMA 3UI3A 2CJOA 1L6UA 3MHSD 2JPHA 2BKFA 2V1YA 2WXQA 2WDRB 1B1ZA 1VZ6A 4WQOB 3GOEA 1ACCA 4EE2A 3KLSX 1MHXA 1P7FA 1P98A 3K9PB 4KKIA 4W9DA 3ZKJC 1EWYC 4G0NB 1UD7A 4NPNA 3FKYA 4A3OA 1OQYA 3E9SA 1WGKA 1QOFA 4JPSA 2MEKA 1WGYA 3DVNU 3R3MA 4DXGA 3QQ8B 5DPRA 1TZOA 3CSTA 4K7UA 2KLGA 1TKEA 2WXLA 5AUKA 3AB5A 2G1EA 2RDGA 3A33B 2JVCA 2LUEA 4USAA 2D10A 3AU4A 3HVZA 4PT5A 1VCBA 2IO2B 2BF8B 5J18A 3M63B 5TSSA 1RWSA 5LNK1 2RPQA 1E0ZA 2IGGA 4ZRKA 2C5LC 3N1XC 2WU2B 2KO3A 1WWTA 2ONQA 3L4PA 3SR6A 2L05A 2KLCA 4RMAA 2R2QA 2KDBA 1UH6A 3NZSA 4P6VF 5DPTA 3L08A 4LK0M 1CMXB 3FILA 1FFUA 3RUIB 3VH4B 1ZUD2 4FULA 5IA7A 2WLBA 4I6LB 4ZDVA 1HZ6A 4JQWC 3DPDA 1D5ZC 4KZCA 4BKTA 1LGRA 5TR5A 1TTNA 1ET9A 1C3TA 5BMHA 2K0PA 2Y5CA 4OVUA 4MJSA 3MP9A 1TS2A 2G9HD 2H88B 4C4VA 2N7DA 3H9DA 2NTSA 1WGDA 3T3OA 4AJWA 3Q3FA 2DYMA 1WMHB 4KKJA 3VRAB 4TSSA 2L8JA 4AUQC 1YIWA 2IGDA 2K8BA 1VLBA 3R2TA 2ZEQA 2IY1B 4YL8A 3V3XA 4DBGA 3NZUA 3R7RA 4ZHOA 2XN9C 3H7SA 1J0GA 1MHHE 4JL9A 4KGSA 1J19A 5IP4D 3OAWA 4FN2A 2MA9B 3GE8C 4BKGA 2RD0A 4HCNB 2GBJA 3ZUNA 1TBEA 4MDKE 4AOFA 2LVOA 2G4SA 3H7PA 3SD5A 3U8ZA 4BOZB 4PK1A 1AYFA 2LGXA 4GIVA 1LM8B 1SGHA 2B76B 1Y56A 2KFKB 1SB3C 2WDTB 4EZLA 1V2YA 2IYDB 1OQQA 4RF1A 2NCNA 4F1SA 3EA6A 3NJTA 5BYQA 2CHXA 1ZKHA 3ZW3A 2ICIA 2AL6A 2SEBD 2MBHA 4W9LA 5AZGA 3PRMB 2INNE 2FBWB 2JU6X 1TZ1A 1WXSA 2DYOA 3H1UA 4WWOA 3SHQA 4IM0A 2XEWA 2KFJA 2JSVX 2Z59B 3AE7B 1QZEA 3BVZA 4UDUC 1GNUA 4RFBA 3PPAA 3AXCA 2PPHA 5H8YE 3N1ZC 2JZPA 4EEWA 3KWVA 2MLBA 1G6JA 2ACZB 2JWZA 4LNNA 2A4ZA 4BZAA 2KQ7A 4YT0B 1RFAA 4RM8A 3IHPC 3DHGC 2QSDA 2CU3A 2QJLA 3TCAA 3ENEA 4ZRJA 4GDKB 1V8CA 2VH2A 3BY4B 3Q8FA 2QIEB 2KC1A 1OTRB 2WX1A 1AARA 2KOXA 4HLEA 4KDIC 1GG3A 1TT5B 2C7HA 1NYQA 2ZNVB 4MH0E 1JWAD 1UBQA 4DXAB 3AEDB 1FCLA 1V1OA 2LUMA 3BK1A 4HCPB 2AQ1B 1WY8A 4EZKA 3KUDB 4JWSC 4II2B 2FUHB 2DAJA 1FM0D 4HK2A 1GPXA 2IO1B 4ZHPA 1SE9A 3AE8B 3TBLD 4W9IA 1EUVB 5IKCM 2BYEA 2PKOA 1WR6E 1IBXA 2N9XA 4TKNA 4W9GA 5EDSA 5L83A 2NR2A 5GXGB 1ENFA 2ZJDA 4DDID 1D6EC 1PGBA 4XDDA 1FXAA 2W3RA 3DDCB 1PUTA 1KLGD 2QMTA 4K81A 2AQ3B 3V62A 1V97A 2D3BA 3PHWB 3ZNZB 2DYBA 3DVGX 2NVUI 2PTLA 2NS5A 4HROA 2L83A 3P4SB 2KZRA 4FXCA 1JQ4A 2GBMA 4LDTD 4MACA 2KWDA 4I6PA 4XGAB 5D2MB 4IDIA 3AE1B 1AN8A 4W9FA 4YSXB 1E5WA 4REZA 2MQJA 4ZYSA 5CTRC 1P1AA 3FC4A 4MGKE 1UWXA 1WYWB 3B08A 2V3SA 2Z0EB 1F2RC 4LJOB 1WE6A 3VUYA 3W1YA 1UGJA 1IP9A 4HEA1 4XC2A 2X38A 3APFA 5JH5C 2LGSA 3N30A 3BYYB 2IO3B 1N5XA 1HEZE 1UWMA 3A9KA 4K7WA 2GBKA 1MJDA 1KJTA 2LMCA 4MSMB 2PLPA 1P0RA 2WXKA 3HK0A 1VZ8A 4IC7B 1YOVB 1FEHA 1WMHA 1QF6A 2J0MA 3P1MA 3AEAB 4G3XB 5C3JB 3AMZA 4KSKC 3HRDD 2O6VB 3WANA 1J8CA 3RYTA 4Q2JA 4WURA 2BWES 3T8MA 1KFYB 1XLQA 3M95A 4A6QA 2K3UA 1I4RA 3BYTB 3A1QA 5J2RA 2K9XA 2AQ2B 2KTFA 3Q3OC 5BO4B 3AE2B 5H92C 1KOTA 3RZWC 4N58A 4MM3A 4M0WB 3VTVA 2UYZB 4TUUA 3U2SC 2LGDA 2FIDA 4KVGB 2BS4B 1WX9A 4OZCA 3ZRCA 2FNJB 2BW2A 2MBQA 1I35A 2JZZA 5MPOA 2WXPA 1Q1OA 1WJ4A 3CMMB 3RD2A 2CS4A 3DCGA 4XWWA 4HDOA 1VD2A 3NVZA 4KDLB 2BGFA 2REXA 5G5GA 3VAWA 2WXGA 2I2YA 2NPTB 1H8CA 2N0SB 1ZP0B 4E71A 4XZ4A 1V49A 2M17A 3HM3A 3I57A 2Y5BB 3ECIA 4MEMA 2FE8A 1FPYA 4LCDE 3KW5B 4CHKA 3N32A 4PS8A 1H4RA 4XE0A 3AE5B 4HKQA 3QHTA 2ZW0A 3WA0A 3ZNHB 2IPKD 2C60A 1X1MA 1CJEA 3VH3B 3RZFA 2FUG1 3NZ3A 2BYTA 2QC8A 2D2QA 4YTNB 1NYRA 1WF9A 3OG5A 2JQRB 3BK2A 4IKGA 2R2OA 1FIQA 1IGDA 2IGHA 3TL5A 2WX0A 1LQBA 3VR8B 2V4IB 1EWCA 1VR9A 3L17A 2WGSA 2GMIC 4GMVA 5HG2A 1BUIC 5KHQA 2DBYA 4DHJB 4ACFA 3ZTDA 3P2BA 3V6CB 4JIOU 5EE0A 4A8XC 1JWUD 2WXFA 1JMLA 2JXTA 2PMVA 4IG7B 3TEYA 3R66C 1TS3A 3NVWA 4HXDA 4GGQA 1ZXHA 2EKIA 1PFDA 2CR5A 3SDLC 3RNAC 3T9LA 2BYFA 4MH8A 1CK1A 1PGAA 1E90A 2C7NB 3ETRA 4HKZE 3W5UB 2BWFA 5BYRA 4C00A 3RFZB 2WXHA 1F52A 1MI0A 2LVPA 1WXVA 4W9KA 3L0WB 1XLOA 3ZO5B 2KDEB 2QEJC 4WWMA 3UGBB 1V80A 4KGRA 3AE4B 4JX1C 2BKRB 1WJUA 3ZLZA 1V9JA 3KUZA 1JWBD 2KMMA 3JSVB 1ZDXA 1WR1A 3A9JB 2MWSB 1HXYD 2O6VD 4J6IA 4CO7A 3URYA 4YTPB 3NY5A 3PT2B 4KSLC 5HI1A 3R8BA 2FCSA 1V5OA 2LGIA 4II3B 3DHIC 3SFEB 4ICVA 3PVLA 2V0GA 1QT9A 3OJ3A 2Z8LA 3P4RB 2MBOA 2Y3AA 1ISNA 1HZ5A 4DQOC 1FXIA 2BVCA 5C1ZA 1R4NI 1WXMA 1HTOA 3VTUA 5D6JB 2KQSA 2PEAA 2IZVB 4WWPA 1IYFA 3AEBB 3Q8BA 1YQBA 1XCQL 3Q8CA 4BBNF 4RCOA 4G50A 4LNFA 3AULA 3H6NA 4W9JA 4NAMA 2ZPYA 3EFCA 1L6VA 1TS4A 2KN4A 1F77A 5I4DA 3U52E 4AS1A 4LNIA 1E10A 4P16A 2E6XA 2LRWA 5FR6A 3HIZA 2D3GA 3TIXA 4ARIA 4LNKA 2BYVE 4AP4C 1PYWD 2OJRA 1C1YB 3MC0B 2MP2A 5AEKB 2INPE 3AEGB 3NVYA 1TJEA 1BT0A 3MTNB 4PYUA 4C7ZA 2MBBB 3DVGY 3LYYA 4IOIE 4WQMA 4XDCA 3VXWA 2J52A 1ZGUB 3Q8AA 2R61A 3VTWA 4E3CA 1J7AA 4H2AA 1WZ0A 2I38A 2JRIB 2LHDA 3MHZA 3BIID 4IM3A 2L0TA 4E74A 2G4DB 2A5UA 3WIMA 1QKZA 4EKUA 2I1KA 2WDVB 3ML8A 2AEHA 5L95C 4ZOHC 3GZNB 3HVDA 1FMAD 2K6QA 2KWVB 1GB1A 2N7JA 2ZVNA 4K3BA 4GB9A 2LXAA 4DHJD 3QJZA 4M0WA 2JXXA 2HTHA 5IO9A 2KD0A 3RI7C 2WS3B 3TEXA 2W9NA 4WWNA 5KHOA 2MBEA 3P42A 4RF0A 3EECA 4CQNA 2QHOA 5DPSA 3CF6E 1ESFA 1KRHA 3IAM1 2RDHA 3N20C 3PHXB 3UINB 2LASA 3RNFC 2B3AA 5BMGA 2JY6A 5FK9C 1PGXA 3VFKA 1LO5D 3C8YA 2NPTA 2J42A 3BINA 1U4AA 2DWQA 2J0JA 4FBJB 3O65B 1RFKA 2KQ4X 3RULA
chains in the Genus database with same CATH topology
5T8IA 2JYTA 5EE3A 4B0MA 4WAFA 4OZBA 2QMTA 1ET6A 2AQ3B 1V97A 2ON8A 4RGOS 1N5WA 1QILA 3VRBB 2MJDA 1FD6A 3IAS1 2PTLA 1QOBA 1KF6B 1YN3A 2BBCA 1M4VA 2YEPB 1I4HA 1EU4A 4HROA 2L83A 2KDMA 3P4SB 4J3OD 4FXCA 1JQ4A 3AN1A 4MACA 3U7ZA 4KGTA 1GB4A 2KWDA 4NAWB 2W55A 4DXFA 4IDIA 4RNAA 3U4EG 2PVOD 1FO4A 3AE1B 1FNVA 1AN8A 4YSXB 2M56B 4REZA 4ZYSA 1ROEA 4US9A 3FC4A 1I4QA 1UWXA 2VZKB 4D2KA 1FNWA 1SEBD 1KTKA 1F2RC 1NVID 1BXTA 1WXQA 4C56C 1JCKB 3J9CA 3AV8A 1UGJA 1K51A 3GS2A 4GDLB 4HEA1 1ZXIA 3EGRA 2L1AA 3AM9A 3ZYYX 1D5XC 1MPEA 1T6BX 5G5HA 4KX6B 2X38A 2V3PA 3BYYB 1N5XA 3W1SA 1R7SA 1HEZE 1IGCA 1UWMA 4L2YA 1C78A 3NRZA 4A90A 4C80A 2LMCA 1DOIA 1F2RI 1I4PA 4NJCA 2PLPA 3P4QB 2WXKA 4MT5A 1VZ8A 2W3SA 1FEHA 2K5PA 2YEPF 1QF6A 3P1MA 3DWGC 2WXJA 4NZLB 1VJKA 4B0EA 2J4XA 3AEAB 5C3JB 3AMZA 1D5MC 2WXOA 1SXTA 1CZPA 3HRDD 1T3QA 2L32A 3HUIA 4Q2JA 2WU5B 1RYJA 4RH6A 4WURA 5D3IB 1V1PA 1SE4A 1XO3A 1XF5L 1ZDVA 1C76A 2LHEA 1N62A 1KFYB 1XLQA 4OZAA 1QQRA 1N60A 4A6QA 3BWUD 2WXMA 2K3UA 1C9FA 3TUOA 1I4RA 3BYTB 3UI3A 3W9CB 2CJOA 1L6UA 1QLBB 3BVGA 4OW0A 2K9XA 1JW9D 4JE3B 3IT4B 3B2FA 2V3NA 2AQ2B 1I4XA 2WXQA 2WDRB 1SF0A 1V1PB 1C4PA 1B1ZA 1VZ6A 3AE2B 2BS3B 5H92C 3N9YC 1WRIA 4N58A 1ACCA 3P4PB 4EE2A 3KLSX 1MHXA 1P7FA 3U2SC 4KKIA 4ARCA 3ZJUA 2BS2B 1EWYC 2BS4B 2N9LA 4OZCA 2XNAC 2BW2A 3E9SA 1I4GA 1WGKA 1L0YB 1QOFA 4JPSA 2MEKA 4RGMA 1YJIA 5MPOA 2JYEA 2WXPA 1QOGA 2GB1A 4MM3B 4DXGA 4RGNA 4XWWA 4XWTA 2GRIA 1TZOA 3TEZA 3NVZA 4LTUA 1TKEA 5G5GA 2WXLA 3TEWA 2WXGA 5AUKA 2I2YA 3AB5A 2G1EA 2N0SB 2NTTA 2RDGA 2MH7A 4USAA 2PVGC 1ZP0B 3HVZA 1YQ3B 3GB1A 3KQ4A 3OWEB 4PT5A 1Q10A 2JX5A 1TYGB 5TSSA 1RWSA 5LNK1 2HTME 3O13A 3I57A 1E0ZA 2IGGA 2J53A 2FE8A 1D4BA 2WU2B 4O1NA 1KLUD 1WWTA 3CIRB 2ONQA 3L4PA 4XE0A 3AE5B 3SR6A 4HKQA 2ZW0A 3AE6B 3ZGZA 1T5XD 1YN5A 2IPKD 1TY0A 1CJEA 4P6VF 4A9AA 4TQ0A 4ZRQA 1OFFA 2FUG1 3IXSA 3FILA 4LK0M 1FFUA 3NZ3A 2BYTA 3T3NA 4YTNB 1NEKB 2WXIA 1ZUD2 1NYRA 1UUPA 2JQRB 3BK2A 2WLBA 4IKGA 1DGJA 1FIQA 1EU3A 1HZ6A 1IGDA 3PO0A 2IGHA 3VR8B 2V4IB 2K22A 1D5ZC 1EWCA 1VR9A 5D3DA 1KH0A 3ZJTA 3FILB 1FNUA 3NVVA 2IJ0A 3GP7A 2D5GA 1F0ZA 1SE2A 5HG2A 1BUIC 1FFVA 2QILA 2DBYA 1ET9A 5BMHA 2K0PA 2Y5CA 2BTEA 1K53A 5EE0A 4A8XC 4TQ1A 1JWUD 3MP9A 1TS2A 2WXFA 2VZKD 2JXTA 1JMLA 2G9HD 2H88B 2PMVA 4RGTA 2OEDA 3TEYA 4YSZB 1C4AA 1L4DB 1TS3A 1J7CA 1XXGA 1SE3A 2NTSA 3NVWA 3T3OA 2HDEA 1DOXA 2TSSA 2DYMA 1NI3A 1ZXHA 4KKJA 2EKIA 1PFDA 3PZ7A 1AWDA 3VRAB 4TSSA 1A70A 1RM6C 4MH8A 1CK1A 1PGAA 1B9RA 1C4CA 1E6EB 1HQRD 3KWLA 1GOZA 2WDQB 2WP9B 3ETRA 5AUIA 3I9V1 4HKZE 3W5UB 5BYRA 2IGDA 2BB6A 2M19A 3RFZB 1VLBA 2WXHA 3R2TA 2KAJA 1L0VB 1MI0A 4HJGE 2MJ3A 3V05A 3V3XA 3WCQA 1XLOA 1JWSD 3MFGA 4ZHOA 2XN9C 2QEJC 4WWMA 4KGRA 3AE4B 2KACA 4JX1C 1MHHE 2GI9A 4KGSA 2ZW1A 3PZ8A 1JWBD 2KMMA 1ZDXA 5FR3A 2H89B 3AE3B 4HRSA 2N9KA 2E3TA 1HXYD 3P63A 1YJJA 4YXDB 4US8A 1AYFA 1TS5A 3ZJVA 3URYA 2B76B 4YTPB 1Y56A 3AH7A 1K50A 1SB3C 1SJHD 5HHDG 5HI1A 3R8BA 1OQQA 1SBBB 3AEEB 4RF1A 1J7BA 2LGIA 1XCTL 3SFEB 4R3DA 4OVZA 2V0GA 1QT9A 3EA6A 1UNSA 1YQ4B 3Q8EA 5BYQA 2WNMA 1JWMD 2BT6A 2Z8LA 2LEKA 3P4RB 5FKAC 2L52A 2Y3AA 2ICIA 2RPVA 1IUEA 2WXNA 1TKYA 1HZ5A 4DQOC 2SEBD 1FXIA 1DOYA 3AECB 2BB5A 2W82A 2INNE 2JWUA 2FBWB 3SEBA 1HA5A 2JU6X 5JXVA 3RPFC 1XEEA 2DYOA 3DWMA 1OQRA 1VZ7A 3AEBB 3Q8BA 1JRPA 2SAKA 3H8HA 1XCQL 1YNTE 2JSVX 3AE7B 1L4ZB 3AEFB 3BVZA 3Q8CA 4ZRPA 4AQ7A 1N63A 4RCOA 4UDUC 1DYQA 2PW9A 4RFBA 4LLGM 2NMQA 1YMHE 3IT6B 4N6EB 4NAMA 3LXFA 5H8YE 4L23A 2JZPA 1AW7A 2EELA 1L6VA 1TS4A 2KN4A 1BMLC 1F77A 5I4DA 3U52E 4AS1A 3KWVA 4TMAB 1ZPSA 1E10A 3Q69A 4P16A 4WH4A 1FRDA 1ZOYB 5C2TB 2ACZB 2E6XA 3EUB2 4ARIA 1MVKA 3SFDB 1TY2A 2LFIA 3E56A 1STEA 1PYWD 4YT0B 5HFYA 3MC0B 1I7HA 1WYGA 3B9JA 2RMMA 2INPE 4OHJA 1WSPA 1VRAB 2QSDA 3AEGB 3NVYA 2CU3A 1N61A 2QJLA 1TJEA 1E9MA 4WIPA 4GDKB 4C7ZA 5EE9A 1V8CA 2OHFA 3LYYA 1YN4A 4IOIE 4WQMA 4XDCA 1SIJA 1FRRA 2J52A 5D7GA 2R61A 3Q8FA 2M0AA 2QIEB 3Q8AA 1J7AA 2WQYB 3MJ5A 2LJIA 2DLBA 4YSYB 3R2IA 4H2AA 4A55A 2Q5WD 2I38A 2LHDA 3MHZA 3BIID 1NYQA 1QKZA 4YWGG 1L0XB 1JWAD 1PDXA 2WDVB 3AEDB 2CJNA 1FCLA 1V1OA 4GLSC 2LUMA 3FAHA 3BK1A 4ZOHC 2AQ1B 3LB8C 1K52A 3HVDA 1NENB 1C79A 1FMAD 4JWSC 1GB1A 4C7YA 2N7JA 1JALA 4JWUC 1FM0D 3NUHB 1GPXA 3ZQ4A 1FCCC 3B2GA 4N59A 5BYSA 4ZHPA 1VDVA 4M0WA 1SSNA 3AE8B 1XLPA 2PKOA 4YTMB 1L5PA 5BMIA 1E7PB 2WS3B 3TEXA 1IBXA 1TKGA 3CWIA 1QOAA 1XLNA 3W5VB 5GXGB 2AX5A 3BZDB 1ENFA 3ABVB 2IDYA 2MJEA 3P42A 1C77A 4RF0A 4CQNA 2PIAA 4ITKA 1D6EC 1ESFA 1KRHA 3IAM1 5EE1A 1JROA 2RDHA 1PGBA 3BVMA 3VR9B 4XDDA 1FXAA 1IBXB 3NS1A 5BMGA 1CQVA 3AE9B 5FK9C 2W3RA 1PGXA 1EM7A 1PUTA 1ZE3D 1LO5D 3C8YA 3VQIA 3TSSA 1GAQB 2J42A 2DWQA 1KLGD 2W54A 4L1BA 2Y5PA 2KQ4X 1SJED 2WXRA 5E6JA 1RFKA 1P7EA 3W2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OED A;  4OZB A;  2QMT A;  5HFY A;  1MHX A;  1P7F A;  2ON8 A;  1FD6 A;  2RMM A;  1ZXH A;  2PTL A;  2QSD A;  2N9L A;  4OZC A;  2KDM A;  1PGA A;  4MAC A;  4KGT A;  1GB4 A;  2KWD A;  4IOI E;  4HKZ E;  2GB1 A;  2J52 A;  2IGD A;  4HJG E;  1MI0 A;  3V3X A;  2I38 A;  1UWX A;  2LHD A;  4D2K A;  4KGR A;  2KAC A;  1MHH E;  2GI9 A;  4KGS A;  1F2R C;  1QKZ A;  2I2Y A;  2ZW1 A;  1K51 A;  1FCL A;  4GLS C;  2LUM A;  3GB1 A;  1Q10 A;  2N9K A;  1MPE A;  1K52 A;  2IGG A;  1GB1 A;  1K50 A;  5HHD G;  2N7J A;  5HI1 A;  2J53 A;  1D4B A;  1HEZ E;  1IGC A;  2LGI A;  1XCT L;  2ONQ A;  1F2R I;  1FCC C;  2ZW0 A;  2PLP A;  2RPV A;  1HZ5 A;  5BMI A;  3FIL A;  1IBX A;  2JWU A;  2JU6 X;  5JXV A;  4IKG A;  1HZ6 A;  1IGD A;  1XCQ L;  1YNT E;  2IGH A;  2JSV X;  1PGB A;  1KH0 A;  3FIL B;  1XF5 L;  2PW9 A;  2NMQ A;  1YMH E;  2LHE A;  1IBX B;  4OZA A;  5BMG A;  1JML A;  2JZP A;  5HG2 A;  2EEL A;  1PGX A;  1EM7 A;  2KN4 A;  3UI3 A;  1C9F A;  5BMH A;  2K0P A;  4WH4 A;  1K53 A;  2KQ4 X;  3MP9 A;  2JXT A;  1MVK A;  1P7E A; 
#chains in the Genus database with same CATH topology
 2JYT A;  5EE3 A;  4WAF A;  1ET6 A;  2ON8 A;  5CX3 A;  1N5W A;  1ZW7 A;  3OLM D;  1QOB A;  1KF6 B;  1YN3 A;  2YEP B;  4PS7 A;  1I4H A;  1EU4 A;  2KDM A;  4J3O D;  3DHH C;  2NBU A;  3AN1 A;  2KWC A;  4KGT A;  2W55 A;  4DXF A;  4K1R B;  4HPL B;  4RNA A;  1R4N B;  1Q0W B;  3VVW B;  3Q3M C;  3RCZ A;  2VZK B;  2I1J A;  4DWF A;  3NG0 A;  3UF8 A;  1NVI D;  1JCK B;  1K51 A;  2DZK A;  4GDL B;  2IBI B;  1ZXI A;  3EGR A;  3AM9 A;  3ZYY X;  1T6B X;  4DHZ B;  2OJW A;  2QDF A;  4FJZ A;  1Z2M A;  3KUC B;  2D3C A;  4K3C A;  4B9K A;  2W3S A;  2K5P A;  2DX5 B;  2WWZ A;  4NZL B;  4B0E A;  5CHW A;  4IWP A;  3GE3 C;  3ML9 A;  3PGE A;  1CZP A;  3ZRF A;  2L32 A;  4K7S A;  2KDI A;  4NJ6 A;  3HUI A;  3VDZ A;  2DHZ A;  2WU5 B;  3MJW A;  1XO3 A;  3DBS A;  1GUA B;  1ZDV A;  1C76 A;  2LHE A;  1QQR A;  2IY0 B;  1N60 A;  3HHM A;  4IW0 A;  3BWU D;  2N7E A;  1E8W A;  3TUO A;  3W9C B;  1QLB B;  3KYC D;  3IT4 B;  2V3N A;  3A9J A;  1V1P B;  1Z5S B;  1C4P A;  3A4R A;  2BS3 B;  3N9Y C;  4ARC A;  1WRD B;  2LI5 A;  2XNA C;  4WJP A;  2DZM A;  3L10 B;  2V4L A;  1L0Y B;  4NJ7 A;  2MRP A;  3L16 A;  1QOG A;  2GB1 A;  2KVR A;  1WJ6 A;  2J0K A;  3MC9 A;  4RGN A;  4XWT A;  3TEZ A;  1OGW A;  3TEW A;  2PJH A;  2HJ8 A;  1YQ3 B;  3GB1 A;  3KQ4 A;  3OWE B;  1Q10 A;  2JZ3 B;  2KVZ A;  2JX5 A;  2C7M B;  2KMC A;  3QCA A;  3N1Y C;  3PRE A;  1KLV A;  2FCN A;  2HTM E;  3S2A A;  1I42 A;  2J53 A;  2K6D B;  3A4S C;  1UBI A;  3AE6 B;  2FAZ A;  1WJN A;  3ZGZ A;  1YN5 A;  1TY0 A;  5LLI A;  5LXI B;  1OFF A;  2DZJ A;  4HDQ A;  1NEK B;  2LD9 A;  4M01 A;  1L7Y A;  2LGY A;  1P9D U;  3QC8 B;  2XK5 B;  3NOB A;  4JLC A;  1EU3 A;  3PO0 A;  2MX2 A;  1OEY A;  5D3D A;  1KH0 A;  4IUM B;  3FIL B;  4ZRI A;  3WAL A;  3GP7 A;  3U7D A;  4G11 A;  4BOS C;  4KIK B;  2KT7 A;  3PRP B;  2KX0 A;  2VZK D;  2OED A;  1WI0 A;  2JT4 B;  2HE7 A;  1XXG A;  3ZXV A;  1SE3 A;  4MEL A;  2TSS A;  3PZ7 A;  4WJO A;  1N6Z A;  2GBN A;  3B0A A;  1C4C A;  4MJS B;  2KMA A;  1E6E B;  1HQR D;  1GOZ A;  2WP9 B;  2DNF A;  3ZDT A;  2DEN B;  2KAJ A;  2MJ3 A;  2K8H A;  2EMT A;  2V9H A;  3WCQ A;  2KYW A;  3MFG A;  4ASW C;  1FXT B;  2KFK A;  1D3Z A;  1LFD A;  1L2N A;  1HE8 A;  2GI9 A;  4HRS A;  3ZXR A;  4HWI B;  4TV3 A;  2KNB A;  3P63 A;  1YJJ A;  2KTR B;  5HKH A;  2RGF A;  3ZJV A;  4LNO A;  1UEL A;  2M1M A;  1SJH D;  2J7Q B;  5DCN A;  3AEE B;  4R3D A;  3C0R B;  4OVZ A;  3JW0 X;  2WNM A;  2BT6 A;  5FKA C;  4AWJ A;  3H7P B;  2RPV A;  3DOW A;  2WXN A;  1GC6 A;  3C19 A;  2JRH A;  2CHZ A;  1R4M B;  3AEC B;  2BB5 A;  2N9E B;  3DQV A;  4MSQ B;  2LVQ A;  2N1V A;  1XEE A;  1OQR A;  3DBH B;  2IND C;  1JRP A;  3TJP A;  3H8H A;  1YNT E;  3AEF B;  4AQ7 A;  1HTQ A;  2LJ5 A;  1DYQ A;  1UZX B;  1YMH E;  2INC C;  3IT6 B;  4GSW A;  4N6E B;  3LXF A;  4L23 A;  2EEL A;  1T0Q C;  1BML C;  2DZI A;  3OJ4 B;  3Q69 A;  3LJ3 A;  4WH4 A;  5C2T B;  1ZOY B;  3RNG C;  2L3Z A;  4GDK A;  4QAY A;  5GMV A;  1TY2 A;  2LFI A;  5G2N A;  3B1L X;  1WFY A;  1WYG A;  2JUO A;  1RAX A;  2KKC A;  2WYQ A;  4OHJ A;  2KHW B;  1E9M A;  4HJK A;  2Z0D B;  4GN1 A;  1WGG A;  3GZN I;  2YLM A;  1SIJ A;  2DAF A;  1JRU A;  2M0A A;  3JVZ X;  2WQY B;  3R2I A;  4A55 A;  2OOB B;  2Q5W D;  3EC8 A;  2FCQ A;  1Y8R C;  4HPM B;  4GLS C;  2X8X X;  4BKS D;  3AU5 A;  2CU1 A;  4X57 B;  1K52 A;  2NBV B;  3RNB C;  4EOY A;  2ZCC A;  4C7Y A;  2L0F A;  3NUH B;  3ZQ4 A;  1FCC C;  4N59 A;  1WM3 A;  5BYS A;  1XLP A;  3DBL I;  1OEY J;  1L5P A;  1EF5 A;  5BMI A;  4ANW A;  1NDD A;  4B6W A;  4IWQ A;  4KV2 A;  3QK0 A;  1TKG A;  3CWI A;  1QOA A;  4GOC A;  1F9J A;  1E8Z A;  2AX5 A;  2IDY A;  2MJE A;  5DPW A;  4BFR A;  4URK A;  2PIA A;  4ITK A;  1LXD A;  5EE1 A;  1E8Y A;  2HD5 B;  1IBX B;  4NNJ B;  3AE9 B;  2GOW A;  3PTF C;  4HPP A;  3UQB A;  3TSS A;  1GAQ B;  2W54 A;  2Y5P A;  4EZJ A;  1SJE D;  2WXR A;  1P7E A;  4B0M A;  2KJH B;  4OZB A;  3Q14 C;  1PQS A;  3ONS A;  3VRB B;  1FD6 A;  2MJD A;  5CHF A;  2BBC A;  1M4V A;  1V6E A;  4AJY B;  4NQK E;  1GB4 A;  4NAW B;  2K39 A;  2L7R A;  3KVF B;  4B95 A;  3U4E G;  2PVO D;  1UGM A;  1FO4 A;  1FNV A;  2M56 B;  2AYO B;  4FLH A;  3DBR I;  3I3T B;  2K8C A;  1I4Q A;  4BKS A;  2XK5 A;  1FNW A;  4ANV A;  1KTK A;  3AV8 A;  2VRR B;  5CHV C;  3Q2A C;  1D5X C;  1WE7 A;  2V3P A;  4MGY E;  2N1W A;  4KIK A;  2G3Q B;  3W1S A;  3WAM A;  1R7S A;  1IGC A;  1WX7 A;  4A90 A;  1C78 A;  3NRZ A;  4M8N A;  1DOI A;  1F2R I;  4NJC A;  5E6O A;  2O6V A;  2MSE D;  4MT5 A;  4FHJ A;  3RT3 B;  2RSU A;  2KJ6 A;  3Q3J A;  3DWG C;  2LXC A;  2WXJ A;  1EF1 A;  3R7Q A;  4GXB A;  3A9K B;  3CSF A;  4F7Z A;  3ZIM A;  2MW5 A;  3AI5 A;  1SXT A;  2L76 A;  2MHJ A;  1E7U A;  3UIP B;  1XQQ A;  1RYJ A;  4RH6 A;  3V60 A;  4FJV B;  1SE4 A;  3JYU A;  3APC A;  2GBR A;  1N62 A;  1C9F A;  2CKH B;  1RRB A;  3BVG A;  1T0Y A;  2YVC A;  4OW0 A;  3WAP A;  1JW9 D;  4JE3 B;  3B2F A;  3Q3N C;  1MG4 A;  1I4X A;  3NHE B;  1SF0 A;  4EUT A;  2KTR A;  1WRI A;  3P4P B;  3PZD A;  3ZJU A;  2BS2 B;  3A1Q B;  4IM2 A;  4WJQ A;  2N9L A;  2O2V B;  1YD8 U;  1I4G A;  1WX8 A;  3DBL B;  3QIJ A;  3X23 A;  3NS8 A;  4RGM A;  1YJI A;  2JYE A;  5G55 A;  4MM3 B;  4LDT B;  4MGI E;  2GRI A;  3QA8 A;  2KX3 A;  4LTU A;  4DHZ E;  2NTT A;  2MH7 A;  2PVG C;  3KYD D;  2N9P C;  3QWZ B;  3X0W A;  1TYG B;  4FAD A;  1GC7 A;  2QCZ A;  3EFU A;  1E8X A;  3O13 A;  2EMS A;  1D4B A;  1V81 A;  4RM9 A;  4O1N A;  4A20 A;  4WJN A;  1KLU D;  3CIR B;  4FJY A;  2D07 B;  2D11 A;  1T5X D;  4A9A A;  4TQ0 A;  4ZRQ A;  3RN9 C;  2BPS A;  3IXS A;  2M0X A;  3T3N A;  2WXI A;  4FA6 A;  4DDG D;  4A3P A;  4HVB A;  1UUP A;  1DGJ A;  4W9H A;  5JZE B;  4N9F 4;  2HJ1 A;  3KH0 A;  2K22 A;  3DBR B;  4WAA A;  3VUX A;  3ZJT A;  1FNU A;  3NVV A;  4XX5 A;  2IJ0 A;  3TMP B;  2D5G A;  1F0Z A;  1SE2 A;  4NY0 A;  1FFV A;  2QIL A;  2JF5 A;  3V6E B;  3RNC C;  2L00 B;  3ALB A;  2BTE A;  4P1C C;  1K53 A;  4TQ1 A;  4RGT A;  1MG8 A;  5JHB A;  1WZ3 A;  4YSZ B;  1C4A A;  1L4D B;  5AZF A;  1J7C A;  4EFO A;  2HDE A;  1DOX A;  3PLV A;  1NI3 A;  2UU7 A;  1P3Q U;  1AWD A;  4MGZ E;  4ANU A;  3U30 A;  1A70 A;  1RM6 C;  1B9R A;  5D94 A;  3IBE A;  3KWL A;  3PRZ A;  2WDQ B;  5AUI A;  3I9V 1;  3JSV A;  2BB6 A;  2M19 A;  4HJG E;  1L0V B;  3V05 A;  1JWS D;  3QAR A;  3EHV A;  2D3A A;  4PYZ A;  2KN5 A;  1V5T A;  2KAC A;  2ZW1 A;  3PZ8 A;  3QX1 A;  1R4M I;  5FR3 A;  2H89 B;  4S17 A;  3AE3 B;  2KC2 A;  4BAX A;  3LDZ E;  2N9K A;  2E3T A;  3VUW A;  3ZDM C;  1WXA A;  4YXD B;  5E6N A;  4US8 A;  1TS5 A;  1Q5W B;  3DBH I;  3AH7 A;  1K50 A;  5HHD G;  4ZYN A;  3RPF C;  1SBB B;  1J7B A;  4P7I A;  2RR9 A;  3M3J A;  4CYE A;  1XCT L;  1S3S G;  3Q8E A;  1UNS A;  1YQ4 B;  1JWM D;  2LEK A;  3V61 A;  2L52 A;  1IUE A;  1TKY A;  1T0R C;  3K9O B;  1DOY A;  2G45 B;  2W82 A;  4P1B C;  2JWU A;  3SU8 X;  3SEB A;  1HA5 A;  3MC8 A;  3IFW B;  5JXV A;  2N4F A;  1KM7 A;  3DWM A;  1UF0 A;  4NAW A;  1VZ7 A;  5E6P A;  2SAK A;  4ANX A;  4W9C A;  2ZCB A;  4ZRP A;  1L4Z B;  1N63 A;  2PW9 A;  4LLG M;  1RLF A;  2NMQ A;  2ZNV C;  2KK8 A;  3ZNI D;  1AW7 A;  2AWT A;  2KDF B;  4TMA B;  1ZPS A;  1YJ1 A;  1XT9 B;  1FRD A;  1SIF A;  2ASQ A;  5IOI A;  2NBW B;  3EUB 2;  1MVK A;  3SFD B;  4BBN C;  3ZVV A;  3D32 A;  4I6N B;  3E56 A;  1STE A;  5HFY A;  1I7H A;  3B9J A;  2RMM A;  1WSP A;  1VRA B;  1V86 A;  1N61 A;  3L54 A;  5LXH A;  2KWU B;  4WIP A;  5EE9 A;  2OHF A;  1YN4 A;  2RDB C;  3UIO B;  1FRR A;  5D7G A;  2MP2 B;  3MJ5 A;  2LJI A;  2DLB A;  4YSY B;  2PE9 A;  1A5R A;  2K1F A;  3IG3 A;  4YWG G;  1L0X B;  1WH3 A;  1PDX A;  2CJN A;  4S0R A;  5JHA A;  1EO6 A;  3FAH A;  4XYC A;  4C4V B;  3LB8 C;  4F8C B;  3HM6 X;  1NEN B;  1C79 A;  4M8M A;  5AZH A;  1JAL A;  4JWU C;  3RNE C;  3B2G A;  1VDV A;  1SSN A;  4DK5 A;  2ZZP B;  3PS6 A;  4YTM B;  2O2V A;  1E7P B;  2K25 A;  2ZPN A;  2C9W B;  2LRU A;  2KJR A;  1XLN A;  4PS3 A;  1M94 A;  3W5V B;  1XD3 B;  4M02 A;  3BZD B;  3ABV B;  1F1H A;  1C77 A;  1T0S C;  3PSE B;  2MCN B;  1JRO A;  3BVM A;  3VR9 B;  2LZ6 A;  3NS1 A;  1CQV A;  4ICU A;  1EM7 A;  2BQQ A;  3M62 B;  3PLU A;  1ZE3 D;  3VHT C;  1WGH A;  2M8S A;  3VQI A;  1K8R B;  5C23 A;  1NBF C;  4JGH B;  4L1B A;  5E6J A;  2WHI A;  3W2D A;  5T8I A;  5IN7 A;  2VH1 A;  4LJP B;  2KAN A;  4RGO S;  1QIL A;  5J17 A;  3IAS 1;  4NQL B;  2M4N A;  4KZ0 A;  2KXJ A;  3U7Z A;  1WGR A;  3Q6B A;  3W1S C;  1TIF A;  4GDL A;  1IPG A;  5IAA C;  1ROE A;  4US9 A;  4D2K A;  2EKE C;  1MFW A;  1SEB D;  2UWQ A;  3N3K B;  3RMK C;  3APD A;  1BXT A;  1WXQ A;  4C56 C;  3J9C A;  4GU2 A;  3GS2 A;  4W9E A;  4BVU C;  1S1Q B;  2ZVO A;  2L1A A;  1MPE A;  5G5H A;  3WAO A;  1E7V A;  1TGZ B;  2IO0 B;  4KX6 B;  2FIF A;  1GJZ A;  1WM2 A;  4FHK A;  3QAQ A;  1NI2 A;  1YX6 B;  4L2Y A;  2LWP A;  4C80 A;  4IWO A;  4M00 A;  1I4P A;  3ZTC A;  3P4Q B;  3ZNG C;  4OVV A;  2AL3 A;  1YX5 B;  3PV1 A;  2YEP F;  2XBB C;  3I5J C;  1VJK A;  2J4X A;  3DVN V;  3UQA A;  1D5M C;  2FCM A;  2WXO A;  1T3Q A;  3IVF A;  2GLS A;  2CHW A;  3L13 A;  5D3I B;  1V1P A;  2PE6 B;  1XF5 L;  3I63 C;  4OZA A;  1WIA A;  2WXM A;  3UI3 A;  2CJO A;  1L6U A;  3MHS D;  2JPH A;  2BKF A;  2V1Y A;  2WXQ A;  2WDR B;  1B1Z A;  1VZ6 A;  4WQO B;  3GOE A;  1ACC A;  4EE2 A;  3KLS X;  1MHX A;  1P7F A;  1P98 A;  3K9P B;  4KKI A;  4W9D A;  3ZKJ C;  1EWY C;  4G0N B;  1UD7 A;  4NPN A;  3FKY A;  4A3O A;  1OQY A;  3E9S A;  1WGK A;  1QOF A;  4JPS A;  2MEK A;  1WGY A;  3DVN U;  3R3M A;  4DXG A;  3QQ8 B;  5DPR A;  1TZO A;  3CST A;  4K7U A;  2KLG A;  1TKE A;  2WXL A;  5AUK A;  3AB5 A;  2G1E A;  2RDG A;  3A33 B;  2JVC A;  2LUE A;  4USA A;  2D10 A;  3AU4 A;  3HVZ A;  4PT5 A;  1VCB A;  2IO2 B;  2BF8 B;  5J18 A;  3M63 B;  5TSS A;  1RWS A;  5LNK 1;  2RPQ A;  1E0Z A;  2IGG A;  4ZRK A;  2C5L C;  3N1X C;  2WU2 B;  2KO3 A;  1WWT A;  2ONQ A;  3L4P A;  3SR6 A;  2L05 A;  2KLC A;  4RMA A;  2R2Q A;  2KDB A;  1UH6 A;  3NZS A;  4P6V F;  5DPT A;  3L08 A;  4LK0 M;  1CMX B;  3FIL A;  1FFU A;  3RUI B;  3VH4 B;  1ZUD 2;  4FUL A;  5IA7 A;  2WLB A;  4I6L B;  4ZDV A;  1HZ6 A;  4JQW C;  3DPD A;  1D5Z C;  4KZC A;  4BKT A;  1LGR A;  5TR5 A;  1TTN A;  1ET9 A;  1C3T A;  5BMH A;  2K0P A;  2Y5C A;  4OVU A;  4MJS A;  3MP9 A;  1TS2 A;  2G9H D;  2H88 B;  4C4V A;  2N7D A;  3H9D A;  2NTS A;  1WGD A;  3T3O A;  4AJW A;  3Q3F A;  2DYM A;  1WMH B;  4KKJ A;  3VRA B;  4TSS A;  2L8J A;  4AUQ C;  1YIW A;  2IGD A;  2K8B A;  1VLB A;  3R2T A;  2ZEQ A;  2IY1 B;  4YL8 A;  3V3X A;  4DBG A;  3NZU A;  3R7R A;  4ZHO A;  2XN9 C;  3H7S A;  1J0G A;  1MHH E;  4JL9 A;  4KGS A;  1J19 A;  5IP4 D;  3OAW A;  4FN2 A;  2MA9 B;  3GE8 C;  4BKG A;  2RD0 A;  4HCN B;  2GBJ A;  3ZUN A;  1TBE A;  4MDK E;  4AOF A;  2LVO A;  2G4S A;  3H7P A;  3SD5 A;  3U8Z A;  4BOZ B;  4PK1 A;  1AYF A;  2LGX A;  4GIV A;  1LM8 B;  1SGH A;  2B76 B;  1Y56 A;  2KFK B;  1SB3 C;  2WDT B;  4EZL A;  1V2Y A;  2IYD B;  1OQQ A;  4RF1 A;  2NCN A;  4F1S A;  3EA6 A;  3NJT A;  5BYQ A;  2CHX A;  1ZKH A;  3ZW3 A;  2ICI A;  2AL6 A;  2SEB D;  2MBH A;  4W9L A;  5AZG A;  3PRM B;  2INN E;  2FBW B;  2JU6 X;  1TZ1 A;  1WXS A;  2DYO A;  3H1U A;  4WWO A;  3SHQ A;  4IM0 A;  2XEW A;  2KFJ A;  2JSV X;  2Z59 B;  3AE7 B;  1QZE A;  3BVZ A;  4UDU C;  1GNU A;  4RFB A;  3PPA A;  3AXC A;  2PPH A;  5H8Y E;  3N1Z C;  2JZP A;  4EEW A;  3KWV A;  2MLB A;  1G6J A;  2ACZ B;  2JWZ A;  4LNN A;  2A4Z A;  4BZA A;  2KQ7 A;  4YT0 B;  1RFA A;  4RM8 A;  3IHP C;  3DHG C;  2QSD A;  2CU3 A;  2QJL A;  3TCA A;  3ENE A;  4ZRJ A;  4GDK B;  1V8C A;  2VH2 A;  3BY4 B;  3Q8F A;  2QIE B;  2KC1 A;  1OTR B;  2WX1 A;  1AAR A;  2KOX A;  4HLE A;  4KDI C;  1GG3 A;  1TT5 B;  2C7H A;  1NYQ A;  2ZNV B;  4MH0 E;  1JWA D;  1UBQ A;  4DXA B;  3AED B;  1FCL A;  1V1O A;  2LUM A;  3BK1 A;  4HCP B;  2AQ1 B;  1WY8 A;  4EZK A;  3KUD B;  4JWS C;  4II2 B;  2FUH B;  2DAJ A;  1FM0 D;  4HK2 A;  1GPX A;  2IO1 B;  4ZHP A;  1SE9 A;  3AE8 B;  3TBL D;  4W9I A;  1EUV B;  5IKC M;  2BYE A;  2PKO A;  1WR6 E;  1IBX A;  2N9X A;  4TKN A;  4W9G A;  5EDS A;  5L83 A;  2NR2 A;  5GXG B;  1ENF A;  2ZJD A;  4DDI D;  1D6E C;  1PGB A;  4XDD A;  1FXA A;  2W3R A;  3DDC B;  1PUT A;  1KLG D;  2QMT A;  4K81 A;  2AQ3 B;  3V62 A;  1V97 A;  2D3B A;  3PHW B;  3ZNZ B;  2DYB A;  3DVG X;  2NVU I;  2PTL A;  2NS5 A;  4HRO A;  2L83 A;  3P4S B;  2KZR A;  4FXC A;  1JQ4 A;  2GBM A;  4LDT D;  4MAC A;  2KWD A;  4I6P A;  4XGA B;  5D2M B;  4IDI A;  3AE1 B;  1AN8 A;  4W9F A;  4YSX B;  1E5W A;  4REZ A;  2MQJ A;  4ZYS A;  5CTR C;  1P1A A;  3FC4 A;  4MGK E;  1UWX A;  1WYW B;  3B08 A;  2V3S A;  2Z0E B;  1F2R C;  4LJO B;  1WE6 A;  3VUY A;  3W1Y A;  1UGJ A;  1IP9 A;  4HEA 1;  4XC2 A;  2X38 A;  3APF A;  5JH5 C;  2LGS A;  3N30 A;  3BYY B;  2IO3 B;  1N5X A;  1HEZ E;  1UWM A;  3A9K A;  4K7W A;  2GBK A;  1MJD A;  1KJT A;  2LMC A;  4MSM B;  2PLP A;  1P0R A;  2WXK A;  3HK0 A;  1VZ8 A;  4IC7 B;  1YOV B;  1FEH A;  1WMH A;  1QF6 A;  2J0M A;  3P1M A;  3AEA B;  4G3X B;  5C3J B;  3AMZ A;  4KSK C;  3HRD D;  2O6V B;  3WAN A;  1J8C A;  3RYT A;  4Q2J A;  4WUR A;  2BWE S;  3T8M A;  1KFY B;  1XLQ A;  3M95 A;  4A6Q A;  2K3U A;  1I4R A;  3BYT B;  3A1Q A;  5J2R A;  2K9X A;  2AQ2 B;  2KTF A;  3Q3O C;  5BO4 B;  3AE2 B;  5H92 C;  1KOT A;  3RZW C;  4N58 A;  4MM3 A;  4M0W B;  3VTV A;  2UYZ B;  4TUU A;  3U2S C;  2LGD A;  2FID A;  4KVG B;  2BS4 B;  1WX9 A;  4OZC A;  3ZRC A;  2FNJ B;  2BW2 A;  2MBQ A;  1I35 A;  2JZZ A;  5MPO A;  2WXP A;  1Q1O A;  1WJ4 A;  3CMM B;  3RD2 A;  2CS4 A;  3DCG A;  4XWW A;  4HDO A;  1VD2 A;  3NVZ A;  4KDL B;  2BGF A;  2REX A;  5G5G A;  3VAW A;  2WXG A;  2I2Y A;  2NPT B;  1H8C A;  2N0S B;  1ZP0 B;  4E71 A;  4XZ4 A;  1V49 A;  2M17 A;  3HM3 A;  3I57 A;  2Y5B B;  3ECI A;  4MEM A;  2FE8 A;  1FPY A;  4LCD E;  3KW5 B;  4CHK A;  3N32 A;  4PS8 A;  1H4R A;  4XE0 A;  3AE5 B;  4HKQ A;  3QHT A;  2ZW0 A;  3WA0 A;  3ZNH B;  2IPK D;  2C60 A;  1X1M A;  1CJE A;  3VH3 B;  3RZF A;  2FUG 1;  3NZ3 A;  2BYT A;  2QC8 A;  2D2Q A;  4YTN B;  1NYR A;  1WF9 A;  3OG5 A;  2JQR B;  3BK2 A;  4IKG A;  2R2O A;  1FIQ A;  1IGD A;  2IGH A;  3TL5 A;  2WX0 A;  1LQB A;  3VR8 B;  2V4I B;  1EWC A;  1VR9 A;  3L17 A;  2WGS A;  2GMI C;  4GMV A;  5HG2 A;  1BUI C;  5KHQ A;  2DBY A;  4DHJ B;  4ACF A;  3ZTD A;  3P2B A;  3V6C B;  4JIO U;  5EE0 A;  4A8X C;  1JWU D;  2WXF A;  1JML A;  2JXT A;  2PMV A;  4IG7 B;  3TEY A;  3R66 C;  1TS3 A;  3NVW A;  4HXD A;  4GGQ A;  1ZXH A;  2EKI A;  1PFD A;  2CR5 A;  3SDL C;  3RNA C;  3T9L A;  2BYF A;  4MH8 A;  1CK1 A;  1PGA A;  1E90 A;  2C7N B;  3ETR A;  4HKZ E;  3W5U B;  2BWF A;  5BYR A;  4C00 A;  3RFZ B;  2WXH A;  1F52 A;  1MI0 A;  2LVP A;  1WXV A;  4W9K A;  3L0W B;  1XLO A;  3ZO5 B;  2KDE B;  2QEJ C;  4WWM A;  3UGB B;  1V80 A;  4KGR A;  3AE4 B;  4JX1 C;  2BKR B;  1WJU A;  3ZLZ A;  1V9J A;  3KUZ A;  1JWB D;  2KMM A;  3JSV B;  1ZDX A;  1WR1 A;  3A9J B;  2MWS B;  1HXY D;  2O6V D;  4J6I A;  4CO7 A;  3URY A;  4YTP B;  3NY5 A;  3PT2 B;  4KSL C;  5HI1 A;  3R8B A;  2FCS A;  1V5O A;  2LGI A;  4II3 B;  3DHI C;  3SFE B;  4ICV A;  3PVL A;  2V0G A;  1QT9 A;  3OJ3 A;  2Z8L A;  3P4R B;  2MBO A;  2Y3A A;  1ISN A;  1HZ5 A;  4DQO C;  1FXI A;  2BVC A;  5C1Z A;  1R4N I;  1WXM A;  1HTO A;  3VTU A;  5D6J B;  2KQS A;  2PEA A;  2IZV B;  4WWP A;  1IYF A;  3AEB B;  3Q8B A;  1YQB A;  1XCQ L;  3Q8C A;  4BBN F;  4RCO A;  4G50 A;  4LNF A;  3AUL A;  3H6N A;  4W9J A;  4NAM A;  2ZPY A;  3EFC A;  1L6V A;  1TS4 A;  2KN4 A;  1F77 A;  5I4D A;  3U52 E;  4AS1 A;  4LNI A;  1E10 A;  4P16 A;  2E6X A;  2LRW A;  5FR6 A;  3HIZ A;  2D3G A;  3TIX A;  4ARI A;  4LNK A;  2BYV E;  4AP4 C;  1PYW D;  2OJR A;  1C1Y B;  3MC0 B;  2MP2 A;  5AEK B;  2INP E;  3AEG B;  3NVY A;  1TJE A;  1BT0 A;  3MTN B;  4PYU A;  4C7Z A;  2MBB B;  3DVG Y;  3LYY A;  4IOI E;  4WQM A;  4XDC A;  3VXW A;  2J52 A;  1ZGU B;  3Q8A A;  2R61 A;  3VTW A;  4E3C A;  1J7A A;  4H2A A;  1WZ0 A;  2I38 A;  2JRI B;  2LHD A;  3MHZ A;  3BII D;  4IM3 A;  2L0T A;  4E74 A;  2G4D B;  2A5U A;  3WIM A;  1QKZ A;  4EKU A;  2I1K A;  2WDV B;  3ML8 A;  2AEH A;  5L95 C;  4ZOH C;  3GZN B;  3HVD A;  1FMA D;  2K6Q A;  2KWV B;  1GB1 A;  2N7J A;  2ZVN A;  4K3B A;  4GB9 A;  2LXA A;  4DHJ D;  3QJZ A;  4M0W A;  2JXX A;  2HTH A;  5IO9 A;  2KD0 A;  3RI7 C;  2WS3 B;  3TEX A;  2W9N A;  4WWN A;  5KHO A;  2MBE A;  3P42 A;  4RF0 A;  3EEC A;  4CQN A;  2QHO A;  5DPS A;  3CF6 E;  1ESF A;  1KRH A;  3IAM 1;  2RDH A;  3N20 C;  3PHX B;  3UIN B;  2LAS A;  3RNF C;  2B3A A;  5BMG A;  2JY6 A;  5FK9 C;  1PGX A;  3VFK A;  1LO5 D;  3C8Y A;  2NPT A;  2J42 A;  3BIN A;  1U4A A;  2DWQ A;  2J0J A;  4FBJ B;  3O65 B;  1RFK A;  2KQ4 X;  3RUL A; 
#chains in the Genus database with same CATH homology
 5T8I A;  2JYT A;  5EE3 A;  4B0M A;  4WAF A;  4OZB A;  2QMT A;  1ET6 A;  2AQ3 B;  1V97 A;  2ON8 A;  4RGO S;  1N5W A;  1QIL A;  3VRB B;  2MJD A;  1FD6 A;  3IAS 1;  2PTL A;  1QOB A;  1KF6 B;  1YN3 A;  2BBC A;  1M4V A;  2YEP B;  1I4H A;  1EU4 A;  4HRO A;  2L83 A;  2KDM A;  3P4S B;  4J3O D;  4FXC A;  1JQ4 A;  3AN1 A;  4MAC A;  3U7Z A;  4KGT A;  1GB4 A;  2KWD A;  4NAW B;  2W55 A;  4DXF A;  4IDI A;  4RNA A;  3U4E G;  2PVO D;  1FO4 A;  3AE1 B;  1FNV A;  1AN8 A;  4YSX B;  2M56 B;  4REZ A;  4ZYS A;  1ROE A;  4US9 A;  3FC4 A;  1I4Q A;  1UWX A;  2VZK B;  4D2K A;  1FNW A;  1SEB D;  1KTK A;  1F2R C;  1NVI D;  1BXT A;  1WXQ A;  4C56 C;  1JCK B;  3J9C A;  3AV8 A;  1UGJ A;  1K51 A;  3GS2 A;  4GDL B;  4HEA 1;  1ZXI A;  3EGR A;  2L1A A;  3AM9 A;  3ZYY X;  1D5X C;  1MPE A;  1T6B X;  5G5H A;  4KX6 B;  2X38 A;  2V3P A;  3BYY B;  1N5X A;  3W1S A;  1R7S A;  1HEZ E;  1IGC A;  1UWM A;  4L2Y A;  1C78 A;  3NRZ A;  4A90 A;  4C80 A;  2LMC A;  1DOI A;  1F2R I;  1I4P A;  4NJC A;  2PLP A;  3P4Q B;  2WXK A;  4MT5 A;  1VZ8 A;  2W3S A;  1FEH A;  2K5P A;  2YEP F;  1QF6 A;  3P1M A;  3DWG C;  2WXJ A;  4NZL B;  1VJK A;  4B0E A;  2J4X A;  3AEA B;  5C3J B;  3AMZ A;  1D5M C;  2WXO A;  1SXT A;  1CZP A;  3HRD D;  1T3Q A;  2L32 A;  3HUI A;  4Q2J A;  2WU5 B;  1RYJ A;  4RH6 A;  4WUR A;  5D3I B;  1V1P A;  1SE4 A;  1XO3 A;  1XF5 L;  1ZDV A;  1C76 A;  2LHE A;  1N62 A;  1KFY B;  1XLQ A;  4OZA A;  1QQR A;  1N60 A;  4A6Q A;  3BWU D;  2WXM A;  2K3U A;  1C9F A;  3TUO A;  1I4R A;  3BYT B;  3UI3 A;  3W9C B;  2CJO A;  1L6U A;  1QLB B;  3BVG A;  4OW0 A;  2K9X A;  1JW9 D;  4JE3 B;  3IT4 B;  3B2F A;  2V3N A;  2AQ2 B;  1I4X A;  2WXQ A;  2WDR B;  1SF0 A;  1V1P B;  1C4P A;  1B1Z A;  1VZ6 A;  3AE2 B;  2BS3 B;  5H92 C;  3N9Y C;  1WRI A;  4N58 A;  1ACC A;  3P4P B;  4EE2 A;  3KLS X;  1MHX A;  1P7F A;  3U2S C;  4KKI A;  4ARC A;  3ZJU A;  2BS2 B;  1EWY C;  2BS4 B;  2N9L A;  4OZC A;  2XNA C;  2BW2 A;  3E9S A;  1I4G A;  1WGK A;  1L0Y B;  1QOF A;  4JPS A;  2MEK A;  4RGM A;  1YJI A;  5MPO A;  2JYE A;  2WXP A;  1QOG A;  2GB1 A;  4MM3 B;  4DXG A;  4RGN A;  4XWW A;  4XWT A;  2GRI A;  1TZO A;  3TEZ A;  3NVZ A;  4LTU A;  1TKE A;  5G5G A;  2WXL A;  3TEW A;  2WXG A;  5AUK A;  2I2Y A;  3AB5 A;  2G1E A;  2N0S B;  2NTT A;  2RDG A;  2MH7 A;  4USA A;  2PVG C;  1ZP0 B;  3HVZ A;  1YQ3 B;  3GB1 A;  3KQ4 A;  3OWE B;  4PT5 A;  1Q10 A;  2JX5 A;  1TYG B;  5TSS A;  1RWS A;  5LNK 1;  2HTM E;  3O13 A;  3I57 A;  1E0Z A;  2IGG A;  2J53 A;  2FE8 A;  1D4B A;  2WU2 B;  4O1N A;  1KLU D;  1WWT A;  3CIR B;  2ONQ A;  3L4P A;  4XE0 A;  3AE5 B;  3SR6 A;  4HKQ A;  2ZW0 A;  3AE6 B;  3ZGZ A;  1T5X D;  1YN5 A;  2IPK D;  1TY0 A;  1CJE A;  4P6V F;  4A9A A;  4TQ0 A;  4ZRQ A;  1OFF A;  2FUG 1;  3IXS A;  3FIL A;  4LK0 M;  1FFU A;  3NZ3 A;  2BYT A;  3T3N A;  4YTN B;  1NEK B;  2WXI A;  1ZUD 2;  1NYR A;  1UUP A;  2JQR B;  3BK2 A;  2WLB A;  4IKG A;  1DGJ A;  1FIQ A;  1EU3 A;  1HZ6 A;  1IGD A;  3PO0 A;  2IGH A;  3VR8 B;  2V4I B;  2K22 A;  1D5Z C;  1EWC A;  1VR9 A;  5D3D A;  1KH0 A;  3ZJT A;  3FIL B;  1FNU A;  3NVV A;  2IJ0 A;  3GP7 A;  2D5G A;  1F0Z A;  1SE2 A;  5HG2 A;  1BUI C;  1FFV A;  2QIL A;  2DBY A;  1ET9 A;  5BMH A;  2K0P A;  2Y5C A;  2BTE A;  1K53 A;  5EE0 A;  4A8X C;  4TQ1 A;  1JWU D;  3MP9 A;  1TS2 A;  2WXF A;  2VZK D;  2JXT A;  1JML A;  2G9H D;  2H88 B;  2PMV A;  4RGT A;  2OED A;  3TEY A;  4YSZ B;  1C4A A;  1L4D B;  1TS3 A;  1J7C A;  1XXG A;  1SE3 A;  2NTS A;  3NVW A;  3T3O A;  2HDE A;  1DOX A;  2TSS A;  2DYM A;  1NI3 A;  1ZXH A;  4KKJ A;  2EKI A;  1PFD A;  3PZ7 A;  1AWD A;  3VRA B;  4TSS A;  1A70 A;  1RM6 C;  4MH8 A;  1CK1 A;  1PGA A;  1B9R A;  1C4C A;  1E6E B;  1HQR D;  3KWL A;  1GOZ A;  2WDQ B;  2WP9 B;  3ETR A;  5AUI A;  3I9V 1;  4HKZ E;  3W5U B;  5BYR A;  2IGD A;  2BB6 A;  2M19 A;  3RFZ B;  1VLB A;  2WXH A;  3R2T A;  2KAJ A;  1L0V B;  1MI0 A;  4HJG E;  2MJ3 A;  3V05 A;  3V3X A;  3WCQ A;  1XLO A;  1JWS D;  3MFG A;  4ZHO A;  2XN9 C;  2QEJ C;  4WWM A;  4KGR A;  3AE4 B;  2KAC A;  4JX1 C;  1MHH E;  2GI9 A;  4KGS A;  2ZW1 A;  3PZ8 A;  1JWB D;  2KMM A;  1ZDX A;  5FR3 A;  2H89 B;  3AE3 B;  4HRS A;  2N9K A;  2E3T A;  1HXY D;  3P63 A;  1YJJ A;  4YXD B;  4US8 A;  1AYF A;  1TS5 A;  3ZJV A;  3URY A;  2B76 B;  4YTP B;  1Y56 A;  3AH7 A;  1K50 A;  1SB3 C;  1SJH D;  5HHD G;  5HI1 A;  3R8B A;  1OQQ A;  1SBB B;  3AEE B;  4RF1 A;  1J7B A;  2LGI A;  1XCT L;  3SFE B;  4R3D A;  4OVZ A;  2V0G A;  1QT9 A;  3EA6 A;  1UNS A;  1YQ4 B;  3Q8E A;  5BYQ A;  2WNM A;  1JWM D;  2BT6 A;  2Z8L A;  2LEK A;  3P4R B;  5FKA C;  2L52 A;  2Y3A A;  2ICI A;  2RPV A;  1IUE A;  2WXN A;  1TKY A;  1HZ5 A;  4DQO C;  2SEB D;  1FXI A;  1DOY A;  3AEC B;  2BB5 A;  2W82 A;  2INN E;  2JWU A;  2FBW B;  3SEB A;  1HA5 A;  2JU6 X;  5JXV A;  3RPF C;  1XEE A;  2DYO A;  3DWM A;  1OQR A;  1VZ7 A;  3AEB B;  3Q8B A;  1JRP A;  2SAK A;  3H8H A;  1XCQ L;  1YNT E;  2JSV X;  3AE7 B;  1L4Z B;  3AEF B;  3BVZ A;  3Q8C A;  4ZRP A;  4AQ7 A;  1N63 A;  4RCO A;  4UDU C;  1DYQ A;  2PW9 A;  4RFB A;  4LLG M;  2NMQ A;  1YMH E;  3IT6 B;  4N6E B;  4NAM A;  3LXF A;  5H8Y E;  4L23 A;  2JZP A;  1AW7 A;  2EEL A;  1L6V A;  1TS4 A;  2KN4 A;  1BML C;  1F77 A;  5I4D A;  3U52 E;  4AS1 A;  3KWV A;  4TMA B;  1ZPS A;  1E10 A;  3Q69 A;  4P16 A;  4WH4 A;  1FRD A;  1ZOY B;  5C2T B;  2ACZ B;  2E6X A;  3EUB 2;  4ARI A;  1MVK A;  3SFD B;  1TY2 A;  2LFI A;  3E56 A;  1STE A;  1PYW D;  4YT0 B;  5HFY A;  3MC0 B;  1I7H A;  1WYG A;  3B9J A;  2RMM A;  2INP E;  4OHJ A;  1WSP A;  1VRA B;  2QSD A;  3AEG B;  3NVY A;  2CU3 A;  1N61 A;  2QJL A;  1TJE A;  1E9M A;  4WIP A;  4GDK B;  4C7Z A;  5EE9 A;  1V8C A;  2OHF A;  3LYY A;  1YN4 A;  4IOI E;  4WQM A;  4XDC A;  1SIJ A;  1FRR A;  2J52 A;  5D7G A;  2R61 A;  3Q8F A;  2M0A A;  2QIE B;  3Q8A A;  1J7A A;  2WQY B;  3MJ5 A;  2LJI A;  2DLB A;  4YSY B;  3R2I A;  4H2A A;  4A55 A;  2Q5W D;  2I38 A;  2LHD A;  3MHZ A;  3BII D;  1NYQ A;  1QKZ A;  4YWG G;  1L0X B;  1JWA D;  1PDX A;  2WDV B;  3AED B;  2CJN A;  1FCL A;  1V1O A;  4GLS C;  2LUM A;  3FAH A;  3BK1 A;  4ZOH C;  2AQ1 B;  3LB8 C;  1K52 A;  3HVD A;  1NEN B;  1C79 A;  1FMA D;  4JWS C;  1GB1 A;  4C7Y A;  2N7J A;  1JAL A;  4JWU C;  1FM0 D;  3NUH B;  1GPX A;  3ZQ4 A;  1FCC C;  3B2G A;  4N59 A;  5BYS A;  4ZHP A;  1VDV A;  4M0W A;  1SSN A;  3AE8 B;  1XLP A;  2PKO A;  4YTM B;  1L5P A;  5BMI A;  1E7P B;  2WS3 B;  3TEX A;  1IBX A;  1TKG A;  3CWI A;  1QOA A;  1XLN A;  3W5V B;  5GXG B;  2AX5 A;  3BZD B;  1ENF A;  3ABV B;  2IDY A;  2MJE A;  3P42 A;  1C77 A;  4RF0 A;  4CQN A;  2PIA A;  4ITK A;  1D6E C;  1ESF A;  1KRH A;  3IAM 1;  5EE1 A;  1JRO A;  2RDH A;  1PGB A;  3BVM A;  3VR9 B;  4XDD A;  1FXA A;  1IBX B;  3NS1 A;  5BMG A;  1CQV A;  3AE9 B;  5FK9 C;  2W3R A;  1PGX A;  1EM7 A;  1PUT A;  1ZE3 D;  1LO5 D;  3C8Y A;  3VQI A;  3TSS A;  1GAQ B;  2J42 A;  2DWQ A;  1KLG D;  2W54 A;  4L1B A;  2Y5P A;  2KQ4 X;  1SJE D;  2WXR A;  5E6J A;  1RFK A;  1P7E A;  3W2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...