2RPVA

Solution structure of gb1 with lbt probe
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
CYVDTNNDGAYEGDELSGTMEYKLILNGKTLKGETTTCAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two-point anchoring of a lanthanide-binding peptide to a target protein enhances the paramagnetic anisotropic effect
pubmed doi rcsb
source organism Streptococcus sp. group g
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rpvA00
2KN4A 1PGAA 1EM7A 5HG2A 1PGBA 1IGCA 1P7EA 2OEDA 2EELA 5BMHA 1K51A 5BMGA 2PW9A 2IGHA 5JXVA 4WH4A 1YMHE 1FD6A 4GLSC 4OZAA 2I2YA 2IGDA 2KDMA 2LHEA 1P7FA 1ZXHA 1HEZE 3FILB 1K50A 4IOIE 1FCCC 2ON8A 3UI3A 4HKZE 2JU6X 4D2KA 2JZPA 1K53A 5HHDG 1Q10A 1MHXA 1MPEA 2J53A 2ZW0A 2ONQA 5HI1A 2JSVX 2KACA 4IKGA 2N9LA 2N7JA 1F2RI 1MHHE 1UWXA 4KGSA 2JWUA 2N9KA 2RPVA 1K52A 2ZW1A 1IGDA 2KQ4X 4MACA 4HJGE 1PGXA 3FILA 1D4BA 2LHDA 2GI9A 1HZ6A 2RMMA 2GB1A 2KWDA 1XF5L 1MVKA 4OZCA 1IBXA 1IBXB 1MI0A 1GB1A 2PTLA 2I38A 3MP9A 2PLPA 1C9FA 4KGTA 2QSDA 2IGGA 1GB4A 1XCTL 2J52A 2QMTA 2LUMA 5HFYA 1F2RC 4KGRA 2NMQA 1JMLA 2JXTA 1HZ5A 1YNTE 2LGIA 5BMIA 2K0PA 3GB1A 4OZBA 3V3XA 1QKZA 1XCQL 1FCLA 1KH0A
chains in the Genus database with same CATH superfamily
2KN4A 2J0MA 2M4NA 1PGBA 1B9RA 3A9KA 1RRBA 2WXMA 1IUEA 1E7UA 2WU5B 4MM3B 4BFRA 2MJ3A 4R3DA 2LGDA 1E5WA 3MTNB 2CHZA 5TSSA 1TS2A 3DVGY 2KT7A 1K8RB 3IAM1 1FFUA 2KDFB 4KV2A 3PO0A 4C7YA 3MFGA 2WXFA 4KKIA 2H88B 3ZIMA 4W9FA 2KMCA 4EOYA 1J0GA 1WXMA 4TUUA 2JZ3B 1IYFA 3LXFA 3JSVA 3JYUA 1JROA 1S1QB 3VH3B 2C60A 3NHEB 4REZA 3EFUA 1OEYA 2GI9A 3OG5A 1J7CA 3UIOB 3Q6BA 1R4NI 2M56B 1XD3B 3SD5A 4FULA 4LNOA 2KMAA 4KGTA 1UZXB 2WDTB 2CS4A 5IKCM 4NZLB 3P4PB 3KWLA 3SDLC 1V1OA 1IP9A 2C7HA 3BINA 4EFOA 1WGRA 2FNJB 5CHFA 3KUDB 4AP4C 4YSXB 2YLMA 3Q3FA 1STEA 1WR6E 5D6JB 1FCLA 1ZP0B 4USAA 3A1QA 3MJWA 2OEDA 4IWOA 2BWES 3QA8A 3W1YA 4KIKB 3N3KB 3R7QA 3DVGX 5L83A 3L17A 2CR5A 2RDHA 1T3QA 3N1XC 2LJIA 3L08A 1WGDA 3DPDA 4PS3A 4MGKE 5C23A 2DWQA 4IOIE 4EZKA 3VHTC 3TCAA 2JRIB 3C19A 4K3BA 3DDCB 1V81A 2IBIB 4HLEA 1JQ4A 1MHXA 4F7ZA 4HKQA 1L4DB 5KHOA 1WMHA 1ZDXA 1MG4A 2GBMA 2J53A 2Q5WD 3A9JA 2VRRB 3VTWA 2CJOA 1WM3A 2NVUI 2Y5CA 1DOIA 3WALA 2BS2B 4HPPA 3RUIB 4HPLB 3JSVB 4KVGB 2KQ4X 3R7RA 3QK0A 2GOWA 3BZDB 1T0YA 3DBSA 3VUYA 3KUZA 2EMSA 3URYA 1HZ6A 2VZKB 3EC8A 2AWTA 3QJZA 1WJ6A 3TJPA 1Q1OA 1YJJA 3NY5A 1ZUD2 2QSDA 1TZ1A 1TS3A 1V6EA 4MSQB 1TYGB 2J0KA 2YVCA 4WWNA 3ENEA 2BYEA 1FEHA 3ZRFA 2B76B 3PZ8A 4JL9A 4LTUA 2AX5A 4LCDE 1SXTA 3AE3B 4FXCA 2HE7A 4IDIA 2INDC 4LNKA 3I5JC 4WJPA 3U7DA 1ACCA 1N6ZA 2R2OA 1UD7A 4G0NB 5J18A 1ESFA 3L10B 4DHZE 2KC1A 2BYTA 1HXYD 1L0VB 1FIQA 4GLSC 1KRHA 4QAYA 3MJ5A 2JUOA 2PIAA 3AE9B 2WXHA 2MQJA 3TIXA 1SB3C 1GJZA 3W5VB 1QF6A 4TSSA 2KAJA 1TZOA 4A55A 4TQ0A 1KFYB 3BK2A 2BW2A 4N6EB 2WXRA 2WXQA 3C0RB 3BYYB 4JIOU 3PLVA 2ONQA 2Z0DB 4NY0A 1NVID 1I4GA 3P2BA 2FUHB 2KZRA 1RLFA 3WIMA 3AXCA 5CHWA 4YSYB 4ARIA 2BKFA 4NAWB 2ZPYA 2GBKA 1ET6A 5D94A 3OLMD 4C00A 1WI0A 1BUIC 1WRDB 3HVDA 3VH4B 4M01A 3DBLI 2KJRA 4I6NB 4URKA 4CHKA 2LASA 1YQ3B 4OW0A 3R2TA 3TMPB 2JRHA 4AJYB 1C4PA 4FJVB 3RT3B 2QDFA 3H7PA 2M19A 2MLBA 2N1WA 4B9KA 2LUMA 2WXOA 3TEZA 3BWUD 4W9JA 4KGRA 3ZYYX 2FAZA 3TUOA 1GUAB 4M8NA 3H7SA 3ZNZB 4RH6A 3N1YC 2DZIA 2X8XX 1CZPA 2GRIA 1T6BX 1P1AA 3WA0A 3ML8A 3NZSA 2J4XA 1WGGA 3O13A 2EKIA 2IO2B 3DVNU 1JWSD 2KFJA 3MC0B 2KWVB 4G3XB 5IAAC 1F1HA 3DQVA 4ICUA 1QZEA 4B0EA 1QQRA 3AB5A 1T0RC 4TV3A 1QILA 4NQKE 2MBOA 2ZEQA 1M94A 3V6EB 4AUQC 1E10A 3TBLD 2KK8A 2L0TA 1NYRA 3ZTDA 1X1MA 1YQ4B 1OQYA 1KM7A 5HKHA 3ZRCA 3JW0X 5LLIA 1B1ZA 2HTME 1KLVA 2AQ2B 4W9GA 2K22A 3ZDTA 1N5XA 2ZJDA 3DHGC 2WDVB 2KWDA 3ETRA 5IN7A 2KOXA 1FPYA 4MGYE 1GB1A 3NS1A 2BYVE 1WIAA 4PYZA 2DZJA 3EFCA 1ZPSA 5HFYA 1OGWA 3BK1A 1GC7A 2KX3A 1GOZA 3NJTA 3DCGA 3NVWA 2D07B 4X57B 5GMVA 4XWWA 4WWOA 2OJRA 5FKAC 2O6VA 4LNNA 2FCMA 3APFA 1PFDA 2WXIA 2KQSA 4DHZB 3NZUA 2WDQB 3X23A 4EE2A 1AN8A 3KWVA 2GMIC 1P7EA 2IPKD 3H7PB 1KOTA 3GS2A 2KVRA 3ZJVA 1SF0A 1H8CA 3AE2B 4C7ZA 2KVZA 1WH3A 2M0XA 4GDLB 2RDBC 4W9DA 3L4PA 4CQNA 2JT4B 2L8JA 4HJKA 3S2AA 1P9DU 3VTVA 3NZ3A 2KTRA 5CHVC 1VR9A 1K53A 4LJOB 1ROEA 2KXJA 3UQAA 4E71A 3QC8B 3Q8EA 2MBBB 3UIPB 1D6EC 1V49A 1T0QC 2BF8B 2V1YA 3ZXRA 3AECB 1I4QA 1PYWD 3R8BA 1T0SC 4EKUA 3QCAA 3AE7B 4IWPA 3AEEB 5AZFA 5LXIB 3TEWA 1MJDA 1D5ZC 5EE0A 2YEPB 1PGXA 3FILA 2WXPA 2XK5B 4MH8A 5EDSA 2NCNA 4RM9A 5G5HA 1WYGA 4XYCA 1SEBD 3U8ZA 2ZCCA 3HVZA 2KLGA 4EUTA 2N4FA 4DK5A 4IM3A 3ZVVA 2IGGA 1DYQA 2LUEA 2QILA 3Q3OC 2LFIA 4I6PA 2L52A 1V86A 1E8XA 1WY8A 1VRAB 1XO3A 2J42A 2Y5PA 3IT4B 1HQRD 2L0FA 2OHFA 3AH7A 3ZJTA 2WYQA 3LJ3A 2LGYA 1C77A 3V3XA 1UBIA 4BAXA 4RMAA 1D5MC 1EM7A 5IP4D 1BXTA 2AL6A 3BIID 3CMMB 2PKOA 4RGTA 3PVLA 3VR9B 3BY4B 1FRRA 3TSSA 1WMHB 5G55A 3UINB 4PK1A 3PS6A 5BYRA 2KDMA 1ZXHA 3HIZA 3UI3A 2V3SA 3AEBB 2LGXA 1J7BA 2ZVNA 1QOBA 4HDOA 1T5XD 4US9A 3OJ4B 1JWBD 5D3IB 5EE9A 3AE6B 2N9LA 3A1QB 3VDZA 2BBCA 4ACFA 2D3GA 3ML9A 2HTHA 3U7ZA 1EU3A 3AU5A 1ZW7A 1V1PB 3Q8BA 2ZVOA 5C3JB 3D32A 4EZLA 1WJNA 2AEHA 1L0YB 3B9JA 2E6XA 1GPXA 1C4CA 2FIFA 2KNBA 2PE6B 3LB8C 2N7EA 4BOZB 3A4SC 2M17A 3E9SA 4ZDVA 4KDIC 1YX6B 1C79A 5LXHA 1XLQA 4B0MA 4GGQA 4HXDA 4LNFA 2KTFA 3U30A 1MVKA 4FBJB 1IBXB 1F0ZA 1R7SA 1I4PA 3PRZA 3KYDD 5AZHA 4ANXA 3HM3A 5BO4B 5C2TB 1E9MA 3WANA 3P4QB 1C76A 2R61A 1J8CA 4FA6A 2TSSA 2K0PA 4KKJA 2FUG1 1OQQA 2DHZA 3UF8A 2I1JA 4BKGA 2ZNVC 4MJSA 4XE0A 4O1NA 2DBYA 4HK2A 2VH1A 2INPE 3N32A 4PYUA 3R2IA 2UU7A 5BMGA 4BOSC 2V3NA 5CX3A 1E8ZA 4P1BC 2PW9A 3V05A 4JPSA 4YTMB 1F52A 1XXGA 2AQ1B 3Q3NC 3VTUA 4EEWA 4ANVA 3AEAB 5H8YE 2LMCA 5DPWA 3Q8CA 2WLBA 2NTSA 1Q10A 1GC6A 3RCZA 1HA5A 3U4EG 3ZO5B 2MBHA 3HK0A 3VUWA 2HD5B 5JHBA 2C7MB 4NQLB 1OQRA 2KQ7A 2N7DA 3WCQA 5AUIA 2C9WB 4HCNB 2ZCBA 3L13A 3PPAA 4AWJA 1PQSA 2N9XA 3PTFC 4DWFA 2XK5A 1GG3A 2INCC 1LXDA 1E8WA 2DZMA 3P63A 2WXLA 2BQQA 4FJZA 1TJEA 2LHDA 1WE6A 2NS5A 5CTRC 2WXNA 3BVZA 1L0XB 1XF5L 3P1MA 4OZCA 1MI0A 3GE8C 2FIDA 3H1UA 2JWZA 3CWIA 1J7AA 3PT2B 1DOYA 1VCBA 5I4DA 1ENFA 1L5PA 2JYEA 3ZLZA 3ZXVA 2KWCA 2W3SA 1HTQA 1WFYA 2KDBA 2BS4B 3AULA 3ZDMC 4OHJA 3B2GA 1SE2A 4K1RB 4MH0E 1OTRB 4S17A 4NJ7A 4RF0A 2ZZPB 1NBFC 2DZKA 5DCNA 4KZCA 2KO3A 1M4VA 4A6QA 1WX8A 3BYTB 3M3JA 3CIRB 5MPOA 3RYTA 3GP7A 3I3TB 2LHEA 1P7FA 1HEZE 3K9OB 3L0WB 1FCCC 1G6JA 2HJ1A 1WGHA 1NYQA 5HHDG 3IXSA 1V5OA 4W9LA 3ZQ4A 3HRDD 2ZW0A 5AUKA 1JWMD 2WP9B 2IY0B 3E56A 2CJNA 4DDID 2B3AA 1F2RI 4S0RA 3BVGA 2G4DB 3Q3JA 3A9JB 3DVNV 3PSEB 2UWQA 3TL5A 3DHIC 3QIJA 3HUIA 4II2B 2RD0A 3DBLB 1TKEA 2IZVB 2J0JA 2K9XA 3NG0A 4NAWA 4NPNA 2KJHB 4W9CA 5JH5C 3C8YA 4ASWC 2N0SB 4HCPB 2VH2A 1ZXIA 2RMMA 1L6VA 2GB1A 4DQOC 5AEKB 4AJWA 4ZHPA 4TMAB 4IW0A 1F77A 2BGFA 3ZGZA 1CQVA 2CHWA 3VRBB 4XZ4A 1UELA 3EA6A 4J6IA 3DWMA 2FCSA 2WXKA 1FXAA 4PT5A 1YX5B 2WQYB 3I57A 2JXTA 4XDDA 1YNTE 1UNSA 4B6WA 1I4RA 5E6PA 2KFKA 1NEKB 3ABVB 1VZ7A 3PZDA 3NUHB 2QC8A 5HG2A 5EE1A 4JX1C 4WQMA 5FK9C 2W54A 2SEBD 2WNMA 1V97A 2G3QB 4JWUC 5JXVA 2WDRB 2Z8LA 2BWFA 1YD8U 2A5UA 2BS3B 3ZNGC 4EZJA 3V60A 2M0AA 3W2DA 4NNJB 2ON8A 1YIWA 2V0GA 2INNE 2LEKA 2MP2A 3T3NA 1I4XA 4PS8A 2BB6A 3MC9A 5L95C 3DBRI 1MG8A 3PREA 2IYDB 4GB9A 1UWXA 1Q0WB 1S3SG 2KX0A 2N9KA 1BMLC 2RPVA 3N1ZC 3WAPA 4HVBA 4P1CC 1WGKA 3LYYA 1SE3A 2OJWA 1XQQA 5BYSA 3PV1A 2KDIA 1FNWA 4M00A 3PHXB 1XLNA 2BT6A 5IOIA 1BT0A 4M02A 1AW7A 2WXGA 2LVOA 4MM3A 4FN2A 4LDTD 3ALBA 4MGZE 4ZRIA 3RULA 3WAOA 1WX7A 1R4MI 4JE3B 4FHJA 4IM2A 3GZNI 1ZE3D 2NBVB 4J3OD 2NMQA 1MFWA 1TS5A 3M62B 3FC4A 3RI7C 2XBBC 2AYOB 1EO6A 4GOCA 4NJ6A 1H4RA 5BMIA 4LDTB 3GB1A 2KDEB 4OZBA 2N9EB 1KH0A 1WSPA 1PGAA 4GU2A 4PS7A 1E90A 1Q5WB 3OWEB 2O2VA 3SFDB 1DOXA 1IGCA 2WX1A 2EELA 1UUPA 3RNGC 5BMHA 1EWYC 3W1SC 3PHWB 4HPMB 1A5RA 2W55A 1LM8B 2WU2B 4YTPB 1P3QU 1WZ3A 2QCZA 1JWUD 1XLOA 5DPRA 4A90A 1KF6B 1VZ6A 4C4VB 3J9CA 1FXTB 5BYQA 1FO4A 4BVUC 2ACZB 2BVCA 1SGHA 3NRZA 2MRPA 5HI1A 3RNAC 4IKGA 2MHJA 2NPTB 4II3B 1EU4A 4KSKC 3RZFA 2BKRB 1WF9A 2MBQA 4OVZA 2G9HD 3N9YC 4IM0A 3I9V1 3A4RA 3B1LX 2V9HA 4YL8A 4MACA 3U2SC 3H9DA 2REXA 5JHAA 4L2YA 1YJ1A 1KJTA 3R3MA 1RYJA 3UGBB 3RNEC 1WJUA 2J7QB 3RFZB 1TY2A 2IO1B 3DBHB 3AEFB 2UYZB 3CF6E 2DAFA 3EHVA 3L54A 2J52A 1TBEA 2QMTA 3X0WA 2LRUA 3QHTA 1TGZB 4ANWA 5J2RA 1TT5B 4N9F4 2KWUB 2KN5A 4GIVA 1FRDA 2W9NA 5H92C 2IO3B 4CYEA 1JWAD 3NVZA 1PDXA 2MW5A 5KHQA 2R2QA 3FAHA 2V3PA 1WRIA 4RCOA 4ZRQA 1UF0A 1WGYA 3Q69A 3M95A 2MWSB 2Z0EB 4KIKA 2KFKB 3NVYA 2NBWB 1FD6A 1PUTA 4KSLC 4K3CA 2NTTA 4ZRPA 2VZKD 3FILB 2CU3A 1WJ4A 2MBEA 1SSNA 3Q8FA 4GDLA 2LVQA 4E74A 5D2MB 1AARA 1R4MB 4XDCA 1WWTA 1MPEA 3WAMA 2JYTA 4K81A 4XX5A 2AQ3B 2QEJC 1V80A 3HHMA 3NOBA 1XT9B 4HRSA 2XN9C 4WWMA 2LI5A 2ASQA 4A8XC 3GOEA 4N59A 1LO5D 2RGFA 3APCA 5T8IA 3IHPC 4MDKE 3B2FA 1AYFA 1LQBA 2C5LC 3HM6X 2D2QA 3B0AA 4OVUA 2PTLA 2I1KA 4ZRKA 2D3BA 2JZZA 3AM9A 4WJOA 1E0ZA 2H89B 3AMZA 5G5GA 2LZ6A 1FM0D 4BBNF 2O6VD 2RR9A 3SHQA 3OAWA 2LGIA 2O6VB 2MH7A 4RNAA 1YN5A 1ET9A 4FJYA 2D3CA 1QKZA 2ZPNA 1LGRA 3PZ7A 4OVVA 4BZAA 4W9HA 3RD2A 3NS8A 1SBBB 5LNK1 1V2YA 3GE3C 2IGHA 3AEDB 2RDGA 3QAQA 1YJIA 1WXSA 2XNAC 5IO9A 5IA7A 4KX6B 1C1YB 1K50A 1NI3A 2JU6X 2MSED 4US8A 2PJHA 2HDEA 3GZNB 1NDDA 2K3UA 3PRPB 1XEEA 4WAAA 4BBNC 3Q8AA 5DPTA 1RM6C 3V62A 1N61A 1KLUD 2EKEC 2V4IB 1TKGA 4DXFA 3Q14C 2WXJA 2JX5A 1WXVA 2PVGC 2WHIA 1CK1A 2WWZA 2FCNA 3L16A 1DGJA 2SAKA 3DBRB 2D5GA 3H6NA 4P7IA 1Y56A 2LJ5A 4HDQA 1JRUA 4IC7B 2K8HA 1V5TA 2IO0B 1KLGD 3EGRA 4HJGE 2JQRB 4MSMB 1E7PB 4AS1A 1QLBB 1YOVB 3VR8B 2K8CA 1D5XC 2CHXA 2DAJA 3ZJUA 3P42A 4LNIA 3MHSD 2L7RA 1C9FA 2N9PC 4GMVA 3AE5B 5G2NA 3AI5A 1GAQB 1Z2MA 1QOFA 5D3DA 2MX2A 1JMLA 2FCQA 1SE4A 4LK0M 1SIJA 3ZKJC 2DYOA 3Q2AC 3FKYA 1I7HA 1JALA 3T9LA 4LLGM 3KVFB 1XCQL 1N63A 3A33B 1QOAA 2M1MA 3DWGC 1N62A 1FFVA 3RNBC 1QT9A 3AN1A 2C7NB 3QX1A 2KANA 2D11A 1JW9D 1C3TA 3JVZX 1N5WA 5JZEB 1YMHE 2MA9B 1UH6A 1AWDA 1ZDVA 4E3CA 4MGIE 2K6QA 3U52E 3PLUA 3P4RB 5E6JA 4D2KA 3CSFA 1QOGA 2GLSA 3QQ8B 2K39A 2IDYA 1A70A 2KMMA 4RF1A 4W9IA 1VD2A 2G45B 4XC2A 3MHZA 4ZHOA 1RFKA 1Z5SB 1MHHE 2QIEB 3SU8X 3AE8B 4KGSA 2JWUA 3QARA 3W9CB 1FNVA 2JVCA 3T3OA 4HEA1 2GBRA 1WXQA 2LXCA 3V6CB 2BYFA 2GBNA 2L05A 4YTNB 4YWGG 3AU4A 4MEMA 2GBJA 1Y8RC 2MEKA 3Q3MC 3NVVA 4RFBA 1C78A 3IBEA 1WXAA 4B95A 1UBQA 4JLCA 4A3OA 4FADA 2I38A 3MP9A 3AEGB 2PLPA 2WGSA 2Y5BB 1YQBA 1SIFA 3IFWB 4K7WA 1ZGUB 3RPFC 2AL3A 4DDGD 2YEPF 4GSWA 1JRPA 3N30A 2A4ZA 1FXIA 2RSUA 3EECA 2OOBB 4A20A 2L83A 3BVMA 3ZNID 5FR3A 4LJPB 4Q2JA 4GDKA 1I35A 2MJEA 3DOWA 4A3PA 4ARCA 2LD9A 2D3AA 3AE4B 3T8MA 4JWSC 3SR6A 4IG7B 1EF5A 1P98A 3A9KB 2JPHA 4OZAA 4TQ1A 2QHOA 4C4VA 3VXWA 4G50A 3ZW3A 4XGAB 3ZTCA 4F1SA 1R4NB 3TEYA 4IUMB 3O65B 3PGEA 2DENB 3APDA 4N58A 2K25A 2KACA 1VJKA 2LWPA 1I42A 3N20C 4GXBA 3ONSA 2EMTA 2KKCA 1CJEA 3RNFC 2N1VA 3SFEB 1C4AA 4JQWC 4DBGA 5GXGB 4BKSD 1E7VA 4M0WB 4BKSA 1FMAD 1HE8A 1F9JA 2QJLA 4ZOHC 2WX0A 1EF1A 2KYWA 1VZ8A 2JF5A 3I63C 1V1PA 1V8CA 2FBWB 2KD0A 4W9KA 4A9AA 2PPHA 4DXGA 1L6UA 2K5PA 4HROA 2KC2A 4FHKA 1XCTL 2NBUA 4DHJD 1GB4A 4F8CB 3OJ3A 3MC8A 1F2RC 1ISNA 2NR2A 5TR5A 4WJNA 1HZ5A 1KTKA 3QWZB 4XWTA 1P0RA 4WWPA 4WURA 4RM8A 2JY6A 1EWCA 2BB5A 2HJ8A 1WM2A 3VQIA 3ZUNA 4AOFA 1OFFA 1WZ0A 1TS4A 4DXAB 5D7GA 4AQ7A 3W5UB 2ICIA 4GDKB 3TEXA 2I2YA 1N60A 1RFAA 1CMXB 2V4LA 4HKZE 4MELA 3IVFA 3B08A 2CKHB 2WS3B 2LVPA 3RMKC 3K9PB 3KYCD 4YSZB 2G1EA 2G4SA 3ECIA 2PVOD 5DPSA 3AE1B 4RGNA 1UGMA 2JSVX 4P6VF 2DX5B 2L32A 2W82A 4WAFA 5E6NA 4JGHB 4MJSB 2MJDA 2KLCA 1TKYA 3EUB2 1EUVB 4M8MA 1WR1A 1YN4A 1K52A 4WIPA 1E6EB 2ZW1A 2PE9A 3DHHC 1IGDA 3UQBA 3KQ4A 2K6DB 3VVWB 2PMVA 2NPTA 4KDLB 2IJ0A 1TIFA 1SJHD 1ZOYB 4W9EA 2XEWA 1RAXA 1IPGA 3KW5B 4CO7A 1IBXA 3H8HA 1TTNA 1L2NA 4YT0B 2PEAA 4ANUA 3P4SB 4I6LB 4L23A 4C80A 2LRWA 3IG3A 1HTOA 2FE8A 3RNCC 2Z59B 2BTEA 4K7UA 4RGMA 4G11A 1D3ZA 2L00B 2LGSA 2KTRB 2D10A 2L3ZA 1NENB 2L1AA 1WYWB 1SJED 1VDVA 2MCNB 4ZYSA 2K8BA 3VUXA 2O2VB 4DHJB 1K51A 3KLSX 1VLBA 4HWIB 1LFDA 4P16A 5J17A 1U4AA 4KZ0A 1WE7A 4IWQA 3PRMB 2E3TA 4WH4A 3W1SA 2KJ6A 3ZNHB 1UWMA 4ZYNA 5C1ZA 2M8SA 4WJQA 2IGDA 2W3RA 3AV8A 3LDZE 2JZPA 1V9JA 3SEBA 1NI2A 4H2AA 4GN1A 5FR6A 1TY0A 4RGOS 5AZGA 4FLHA 2LXAA 2DYBA 5E6OA 3IAS1 3DBHI 3RN9C 1E8YA 3IT6B 1L7YA 2N7JA 4C56C 3RZWC 3VFKA 1GNUA 2CU1A 4YXDB 1FNUA 1WX9A 3CSTA 2DYMA 4K7SA 2IY1B 1YN3A 1UGJA 4L1BA 2KHWB 3M63B 1D4BA 4M0WA 2JXXA 4NAMA 2X38A 2K1FA 1JCKB 3KH0A 4ITKA 1J19A 4TKNA 3V61A 3VAWA 3R66C 2Y3AA 2DNFA 1SE9A 2ZNVB 1RWSA 2L76A 2MP2B 1I4HA 4BKTA 5EE3A 1L4ZB 1ZKHA 3KUCB 4UDUC 2RPQA 2DLBA 4WQOB 2BPSA 4ICVA 1XLPA 4NJCA 3VRAB 4ZRJA 4MT5A 1OEYJ
chains in the Genus database with same CATH topology
2KN4A 1QOAA 4EE2A 1AN8A 5HG2A 3KWVA 1PGBA 5EE1A 3DWGC 1N62A 1B9RA 1P7EA 1FFVA 2IPKD 1QT9A 3AN1A 4JX1C 4WQMA 5FK9C 3GS2A 2WXMA 1IUEA 3ZJVA 1SF0A 2W54A 1JW9D 3AE2B 2SEBD 2WNMA 4C7ZA 1V97A 2WU5B 4JWUC 5JXVA 1N5WA 1YMHE 4MM3B 2WDRB 2Z8LA 4GDLB 2MJ3A 4R3DA 3L4PA 2BS3B 4CQNA 5TSSA 1TS2A 1AWDA 1ZDVA 3NZ3A 2M0AA 3W2DA 3U52E 2ON8A 2V0GA 2INNE 2LEKA 3P4RB 5E6JA 4D2KA 3T3NA 1QOGA 1VR9A 1K53A 3IAM1 1I4XA 2BB6A 1ROEA 1FFUA 2IDYA 1A70A 2KMMA 4RF1A 3Q8EA 3PO0A 4C7YA 3MFGA 1D6EC 2WXFA 4KKIA 2H88B 3MHZA 4ZHOA 1RFKA 1MHHE 1UWXA 2QIEB 3AE8B 3AECB 1I4QA 1PYWD 4KGSA 2JWUA 3R8BA 2N9KA 1BMLC 2RPVA 3W9CB 1FNVA 3T3OA 4HEA1 3AE7B 1WGKA 3LYYA 1SE3A 3AEEB 1WXQA 3LXFA 4YTNB 3TEWA 4YWGG 5BYSA 1D5ZC 5EE0A 1JROA 2YEPB 1PGXA 1FNWA 3FILA 2MEKA 2WXPA 1XLNA 2BT6A 4REZA 2GI9A 4MH8A 1J7CA 1AW7A 3NVVA 5G5HA 2WXGA 4RFBA 1WYGA 1C78A 1SEBD 2M56B 3HVZA 2I38A 3MP9A 3AEGB 2PLPA 4KGTA 2IGGA 1DYQA 2QILA 2LFIA 4JE3B 2L52A 1N63A 3P4PB 3KWLA 4NZLB 3RPFC 1V1OA 1ZE3D 2YEPF 1JRPA 4J3OD 1FXIA 1VRAB 2NMQA 1TS5A 1XO3A 2J42A 2Y5PA 3FC4A 3IT4B 1HQRD 2OHFA 3AH7A 3ZJTA 4YSXB 5BMIA 1C77A 3GB1A 4OZBA 3V3XA 1STEA 2L83A 3BVMA 5FR3A 1FCLA 1KH0A 1ZP0B 1WSPA 1PGAA 1D5MC 1EM7A 4USAA 1BXTA 3OWEB 3BIID 4Q2JA 3SFDB 1DOXA 1IGCA 2OEDA 2PKOA 4RGTA 2EELA 1UUPA 1FD6A 3VR9B 5BMHA 2MJEA 4ARCA 1EWYC 1FRRA 3TSSA 3AE4B 4JWSC 3SR6A 2W55A 2WU2B 2RDHA 4YTPB 1T3QA 4OZAA 4TQ1A 5BYRA 2LJIA 1JWUD 2KDMA 1XLOA 1ZXHA 4A90A 1KF6B 1VZ6A 2DWQA 4IOIE 3J9CA 3UI3A 3AEBB 5BYQA 1FO4A 1J7BA 1QOBA 1JQ4A 1MHXA 2ACZB 3TEYA 4HKQA 1L4DB 1ZDXA 2J53A 1T5XD 2Q5WD 3NRZA 4N58A 4US9A 2CJOA 5HI1A 2Y5CA 2KACA 1VJKA 4IKGA 1JWBD 5D3IB 5EE9A 1DOIA 3AE6B 2N9LA 1EU4A 2BBCA 2BS2B 1CJEA 3U7ZA 1EU3A 4OVZA 3SFEB 2G9HD 3N9YC 1V1PB 1C4AA 3Q8BA 5C3JB 3I9V1 1GPXA 1L0YB 3B9JA 2E6XA 1C4CA 5GXGB 2KQ4X 3LB8C 4MACA 3BZDB 1FMAD 3E9SA 3U2SC 2QJLA 4ZOHC 1C79A 1XLQA 1VZ8A 4L2YA 3URYA 1HZ6A 2VZKB 4B0MA 1V1PA 1V8CA 2FBWB 4A9AA 1RYJA 1MVKA 1IBXB 1F0ZA 1R7SA 4DXGA 1YJJA 1I4PA 3RFZB 1L6UA 1TY2A 1ZUD2 2K5PA 4HROA 3AEFB 2QSDA 1TS3A 1GB4A 1XCTL 2J52A 2QMTA 5C2TB 1E9MA 1TYGB 1F2RC 3P4QB 1FEHA 2B76B 1C76A 1HZ5A 3PZ8A 1KTKA 2R61A 4LTUA 1FRDA 2AX5A 5H92C 2TSSA 4XWTA 2K0PA 1SXTA 3AE3B 4FXCA 4KKJA 2FUG1 1OQQA 4WURA 4IDIA 1JWAD 3NVZA 1PDXA 1EWCA 3FAHA 4XE0A 2BB5A 2V3PA 4O1NA 2DBYA 1WRIA 4RCOA 4ZRQA 1ACCA 3VQIA 2INPE 3Q69A 3R2IA 5BMGA 2V3NA 1ESFA 1OFFA 1TS4A 2PW9A 3NVYA 3V05A 5D7GA 4JPSA 4YTMB 4AQ7A 1HXYD 1L0VB 1PUTA 2BYTA 1XXGA 2AQ1B 3ABVB 1FIQA 3W5UB 2ICIA 4GDKB 4GLSC 2NTTA 4ZRPA 1KRHA 3TEXA 3MJ5A 2I2YA 2PIAA 1N60A 3AE9B 2WXHA 2VZKD 3FILB 3AEAB 1SB3C 5H8YE 2CU3A 3W5VB 1QF6A 4HKZE 4TSSA 1SSNA 2LMCA 3Q8CA 3Q8FA 2WS3B 2KAJA 1TZOA 4A55A 4TQ0A 2WLBA 2NTSA 1Q10A 1KFYB 3BK2A 2BW2A 4YSZB 4XDCA 4N6EB 1WWTA 2G1EA 1MPEA 2WXRA 1HA5A 2WXQA 3BYYB 2PVOD 3U4EG 2JYTA 2ONQA 3AE1B 4RGNA 2JSVX 4P6VF 1NVID 1I4GA 2AQ3B 2L32A 2W82A 2QEJC 4WAFA 1OQRA 2MJDA 3WCQA 5AUIA 1TKYA 3EUB2 4YSYB 4ARIA 4NAWB 4HRSA 1YN4A 1ET6A 1K52A 2XN9C 4WIPA 4WWMA 1E6EB 2ZW1A 1BUIC 1IGDA 3HVDA 4A8XC 4N59A 1LO5D 3KQ4A 3P63A 2WXLA 1TJEA 2PMVA 2LHDA 2IJ0A 5T8IA 2WXNA 3B2FA 1AYFA 3BVZA 1L0XB 1SJHD 1ZOYB 1XF5L 1YQ3B 3P1MA 4OZCA 1IBXA 3H8HA 4OW0A 1MI0A 2PTLA 3R2TA 1C4PA 4YT0B 3AM9A 1E0ZA 3P4SB 2M19A 2H89B 3CWIA 3AMZA 5G5GA 1J7AA 2LUMA 4L23A 4C80A 2WXOA 1FM0D 3TEZA 1DOYA 5I4DA 1ENFA 3BWUD 1L5PA 2JYEA 4KGRA 2FE8A 3ZYYX 3TUOA 2BTEA 2W3SA 4RGMA 2LGIA 2MH7A 4RNAA 1YN5A 1ET9A 2BS4B 4OHJA 4RH6A 3B2GA 1QKZA 1NENB 1SE2A 3PZ7A 1CZPA 2GRIA 1T6BX 2L1AA 4RF0A 1SJED 1VDVA 4ZYSA 1SBBB 5LNK1 1K51A 3KLSX 1VLBA 4P16A 1M4VA 4A6QA 2J4XA 2IGHA 3O13A 3AEDB 2RDGA 2EKIA 2E3TA 4WH4A 3W1SA 1YJIA 1UWMA 3BYTB 2XNAC 1JWSD 3CIRB 3MC0B 5MPOA 3GP7A 2IGDA 2LHEA 1P7FA 1HEZE 2W3RA 3AV8A 3NUHB 4KX6B 1K50A 1FCCC 4B0EA 1QQRA 1NI3A 2JU6X 3AB5A 4US8A 2JZPA 1NYQA 2HDEA 1QILA 5HHDG 3SEBA 3IXSA 4H2AA 2K3UA 1TY0A 3ZQ4A 1XEEA 3HRDD 2ZW0A 4RGOS 3Q8AA 5AUKA 1E10A 1JWMD 3IAS1 1RM6C 2WP9B 1N61A 1KLUD 3E56A 3IT6B 2CJNA 2V4IB 1TKGA 4DXFA 2N7JA 1F2RI 4C56C 1NYRA 3BVGA 1YQ4B 2WXJA 4YXDB 1FNUA 2JX5A 2PVGC 1CK1A 1DGJA 2DYMA 1B1ZA 2D5GA 2HTME 2SAKA 1YN3A 1UGJA 1Y56A 3HUIA 1TKEA 2K9XA 4L1BA 2AQ2B 2K22A 1KLGD 3EGRA 4HJGE 2JQRB 3C8YA 1D4BA 2N0SB 4M0WA 1N5XA 4NAMA 2X38A 1ZXIA 1E7PB 2RMMA 1L6VA 2GB1A 2WDVB 4DQOC 1JCKB 4AS1A 2KWDA 3ETRA 1QLBB 4ZHPA 4TMAB 3VR8B 4ITKA 1F77A 3ZGZA 1GB1A 1CQVA 3NS1A 1D5XC 3VRBB 3ZJUA 2Y3AA 3P42A 1C9FA 3EA6A 3AE5B 1RWSA 1GAQB 1QOFA 3DWMA 1I4HA 1ZPSA 5HFYA 2WXKA 1FXAA 3BK1A 5EE3A 5D3DA 1L4ZB 1GOZA 3NVWA 1JMLA 4PT5A 2WQYB 3I57A 4UDUC 4XWWA 2JXTA 2DLBA 1SE4A 4LK0M 4XDDA 1XLPA 1SIJA 1UNSA 1YNTE 5FKAC 4NJCA 3VRAB 2DYOA 1I4RA 1I7HA 1JALA 1PFDA 1NEKB 4LLGM 2WXIA 1VZ7A 4MT5A 1XCQL 2WDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KN4 A;  1PGA A;  1EM7 A;  5HG2 A;  1PGB A;  1IGC A;  1P7E A;  2OED A;  2EEL A;  5BMH A;  1K51 A;  5BMG A;  2PW9 A;  2IGH A;  5JXV A;  4WH4 A;  1YMH E;  1FD6 A;  4GLS C;  4OZA A;  2I2Y A;  2IGD A;  2KDM A;  2LHE A;  1P7F A;  1ZXH A;  1HEZ E;  3FIL B;  1K50 A;  4IOI E;  1FCC C;  2ON8 A;  3UI3 A;  4HKZ E;  2JU6 X;  4D2K A;  2JZP A;  1K53 A;  5HHD G;  1Q10 A;  1MHX A;  1MPE A;  2J53 A;  2ZW0 A;  2ONQ A;  5HI1 A;  2JSV X;  2KAC A;  4IKG A;  2N9L A;  2N7J A;  1F2R I;  1MHH E;  1UWX A;  4KGS A;  2JWU A;  2N9K A;  2RPV A;  1K52 A;  2ZW1 A;  1IGD A;  2KQ4 X;  4MAC A;  4HJG E;  1PGX A;  3FIL A;  1D4B A;  2LHD A;  2GI9 A;  1HZ6 A;  2RMM A;  2GB1 A;  2KWD A;  1XF5 L;  1MVK A;  4OZC A;  1IBX A;  1IBX B;  1MI0 A;  1GB1 A;  2PTL A;  2I38 A;  3MP9 A;  2PLP A;  1C9F A;  4KGT A;  2QSD A;  2IGG A;  1GB4 A;  1XCT L;  2J52 A;  2QMT A;  2LUM A;  5HFY A;  1F2R C;  4KGR A;  2NMQ A;  1JML A;  2JXT A;  1HZ5 A;  1YNT E;  2LGI A;  5BMI A;  2K0P A;  3GB1 A;  4OZB A;  3V3X A;  1QKZ A;  1XCQ L;  1FCL A;  1KH0 A; 
#chains in the Genus database with same CATH topology
 2KN4 A;  2J0M A;  2M4N A;  1PGB A;  1B9R A;  3A9K A;  1RRB A;  2WXM A;  1IUE A;  1E7U A;  2WU5 B;  4MM3 B;  4BFR A;  2MJ3 A;  4R3D A;  2LGD A;  1E5W A;  3MTN B;  2CHZ A;  5TSS A;  1TS2 A;  3DVG Y;  2KT7 A;  1K8R B;  3IAM 1;  1FFU A;  2KDF B;  4KV2 A;  3PO0 A;  4C7Y A;  3MFG A;  2WXF A;  4KKI A;  2H88 B;  3ZIM A;  4W9F A;  2KMC A;  4EOY A;  1J0G A;  1WXM A;  4TUU A;  2JZ3 B;  1IYF A;  3LXF A;  3JSV A;  3JYU A;  1JRO A;  1S1Q B;  3VH3 B;  2C60 A;  3NHE B;  4REZ A;  3EFU A;  1OEY A;  2GI9 A;  3OG5 A;  1J7C A;  3UIO B;  3Q6B A;  1R4N I;  2M56 B;  1XD3 B;  3SD5 A;  4FUL A;  4LNO A;  2KMA A;  4KGT A;  1UZX B;  2WDT B;  2CS4 A;  5IKC M;  4NZL B;  3P4P B;  3KWL A;  3SDL C;  1V1O A;  1IP9 A;  2C7H A;  3BIN A;  4EFO A;  1WGR A;  2FNJ B;  5CHF A;  3KUD B;  4AP4 C;  4YSX B;  2YLM A;  3Q3F A;  1STE A;  1WR6 E;  5D6J B;  1FCL A;  1ZP0 B;  4USA A;  3A1Q A;  3MJW A;  2OED A;  4IWO A;  2BWE S;  3QA8 A;  3W1Y A;  4KIK B;  3N3K B;  3R7Q A;  3DVG X;  5L83 A;  3L17 A;  2CR5 A;  2RDH A;  1T3Q A;  3N1X C;  2LJI A;  3L08 A;  1WGD A;  3DPD A;  4PS3 A;  4MGK E;  5C23 A;  2DWQ A;  4IOI E;  4EZK A;  3VHT C;  3TCA A;  2JRI B;  3C19 A;  4K3B A;  3DDC B;  1V81 A;  2IBI B;  4HLE A;  1JQ4 A;  1MHX A;  4F7Z A;  4HKQ A;  1L4D B;  5KHO A;  1WMH A;  1ZDX A;  1MG4 A;  2GBM A;  2J53 A;  2Q5W D;  3A9J A;  2VRR B;  3VTW A;  2CJO A;  1WM3 A;  2NVU I;  2Y5C A;  1DOI A;  3WAL A;  2BS2 B;  4HPP A;  3RUI B;  4HPL B;  3JSV B;  4KVG B;  2KQ4 X;  3R7R A;  3QK0 A;  2GOW A;  3BZD B;  1T0Y A;  3DBS A;  3VUY A;  3KUZ A;  2EMS A;  3URY A;  1HZ6 A;  2VZK B;  3EC8 A;  2AWT A;  3QJZ A;  1WJ6 A;  3TJP A;  1Q1O A;  1YJJ A;  3NY5 A;  1ZUD 2;  2QSD A;  1TZ1 A;  1TS3 A;  1V6E A;  4MSQ B;  1TYG B;  2J0K A;  2YVC A;  4WWN A;  3ENE A;  2BYE A;  1FEH A;  3ZRF A;  2B76 B;  3PZ8 A;  4JL9 A;  4LTU A;  2AX5 A;  4LCD E;  1SXT A;  3AE3 B;  4FXC A;  2HE7 A;  4IDI A;  2IND C;  4LNK A;  3I5J C;  4WJP A;  3U7D A;  1ACC A;  1N6Z A;  2R2O A;  1UD7 A;  4G0N B;  5J18 A;  1ESF A;  3L10 B;  4DHZ E;  2KC1 A;  2BYT A;  1HXY D;  1L0V B;  1FIQ A;  4GLS C;  1KRH A;  4QAY A;  3MJ5 A;  2JUO A;  2PIA A;  3AE9 B;  2WXH A;  2MQJ A;  3TIX A;  1SB3 C;  1GJZ A;  3W5V B;  1QF6 A;  4TSS A;  2KAJ A;  1TZO A;  4A55 A;  4TQ0 A;  1KFY B;  3BK2 A;  2BW2 A;  4N6E B;  2WXR A;  2WXQ A;  3C0R B;  3BYY B;  4JIO U;  3PLV A;  2ONQ A;  2Z0D B;  4NY0 A;  1NVI D;  1I4G A;  3P2B A;  2FUH B;  2KZR A;  1RLF A;  3WIM A;  3AXC A;  5CHW A;  4YSY B;  4ARI A;  2BKF A;  4NAW B;  2ZPY A;  2GBK A;  1ET6 A;  5D94 A;  3OLM D;  4C00 A;  1WI0 A;  1BUI C;  1WRD B;  3HVD A;  3VH4 B;  4M01 A;  3DBL I;  2KJR A;  4I6N B;  4URK A;  4CHK A;  2LAS A;  1YQ3 B;  4OW0 A;  3R2T A;  3TMP B;  2JRH A;  4AJY B;  1C4P A;  4FJV B;  3RT3 B;  2QDF A;  3H7P A;  2M19 A;  2MLB A;  2N1W A;  4B9K A;  2LUM A;  2WXO A;  3TEZ A;  3BWU D;  4W9J A;  4KGR A;  3ZYY X;  2FAZ A;  3TUO A;  1GUA B;  4M8N A;  3H7S A;  3ZNZ B;  4RH6 A;  3N1Y C;  2DZI A;  2X8X X;  1CZP A;  2GRI A;  1T6B X;  1P1A A;  3WA0 A;  3ML8 A;  3NZS A;  2J4X A;  1WGG A;  3O13 A;  2EKI A;  2IO2 B;  3DVN U;  1JWS D;  2KFJ A;  3MC0 B;  2KWV B;  4G3X B;  5IAA C;  1F1H A;  3DQV A;  4ICU A;  1QZE A;  4B0E A;  1QQR A;  3AB5 A;  1T0R C;  4TV3 A;  1QIL A;  4NQK E;  2MBO A;  2ZEQ A;  1M94 A;  3V6E B;  4AUQ C;  1E10 A;  3TBL D;  2KK8 A;  2L0T A;  1NYR A;  3ZTD A;  1X1M A;  1YQ4 B;  1OQY A;  1KM7 A;  5HKH A;  3ZRC A;  3JW0 X;  5LLI A;  1B1Z A;  2HTM E;  1KLV A;  2AQ2 B;  4W9G A;  2K22 A;  3ZDT A;  1N5X A;  2ZJD A;  3DHG C;  2WDV B;  2KWD A;  3ETR A;  5IN7 A;  2KOX A;  1FPY A;  4MGY E;  1GB1 A;  3NS1 A;  2BYV E;  1WIA A;  4PYZ A;  2DZJ A;  3EFC A;  1ZPS A;  5HFY A;  1OGW A;  3BK1 A;  1GC7 A;  2KX3 A;  1GOZ A;  3NJT A;  3DCG A;  3NVW A;  2D07 B;  4X57 B;  5GMV A;  4XWW A;  4WWO A;  2OJR A;  5FKA C;  2O6V A;  4LNN A;  2FCM A;  3APF A;  1PFD A;  2WXI A;  2KQS A;  4DHZ B;  3NZU A;  2WDQ B;  3X23 A;  4EE2 A;  1AN8 A;  3KWV A;  2GMI C;  1P7E A;  2IPK D;  3H7P B;  1KOT A;  3GS2 A;  2KVR A;  3ZJV A;  1SF0 A;  1H8C A;  3AE2 B;  4C7Z A;  2KVZ A;  1WH3 A;  2M0X A;  4GDL B;  2RDB C;  4W9D A;  3L4P A;  4CQN A;  2JT4 B;  2L8J A;  4HJK A;  3S2A A;  1P9D U;  3VTV A;  3NZ3 A;  2KTR A;  5CHV C;  1VR9 A;  1K53 A;  4LJO B;  1ROE A;  2KXJ A;  3UQA A;  4E71 A;  3QC8 B;  3Q8E A;  2MBB B;  3UIP B;  1D6E C;  1V49 A;  1T0Q C;  2BF8 B;  2V1Y A;  3ZXR A;  3AEC B;  1I4Q A;  1PYW D;  3R8B A;  1T0S C;  4EKU A;  3QCA A;  3AE7 B;  4IWP A;  3AEE B;  5AZF A;  5LXI B;  3TEW A;  1MJD A;  1D5Z C;  5EE0 A;  2YEP B;  1PGX A;  3FIL A;  2WXP A;  2XK5 B;  4MH8 A;  5EDS A;  2NCN A;  4RM9 A;  5G5H A;  1WYG A;  4XYC A;  1SEB D;  3U8Z A;  2ZCC A;  3HVZ A;  2KLG A;  4EUT A;  2N4F A;  4DK5 A;  4IM3 A;  3ZVV A;  2IGG A;  1DYQ A;  2LUE A;  2QIL A;  3Q3O C;  2LFI A;  4I6P A;  2L52 A;  1V86 A;  1E8X A;  1WY8 A;  1VRA B;  1XO3 A;  2J42 A;  2Y5P A;  3IT4 B;  1HQR D;  2L0F A;  2OHF A;  3AH7 A;  3ZJT A;  2WYQ A;  3LJ3 A;  2LGY A;  1C77 A;  3V3X A;  1UBI A;  4BAX A;  4RMA A;  1D5M C;  1EM7 A;  5IP4 D;  1BXT A;  2AL6 A;  3BII D;  3CMM B;  2PKO A;  4RGT A;  3PVL A;  3VR9 B;  3BY4 B;  1FRR A;  3TSS A;  1WMH B;  5G55 A;  3UIN B;  4PK1 A;  3PS6 A;  5BYR A;  2KDM A;  1ZXH A;  3HIZ A;  3UI3 A;  2V3S A;  3AEB B;  2LGX A;  1J7B A;  2ZVN A;  1QOB A;  4HDO A;  1T5X D;  4US9 A;  3OJ4 B;  1JWB D;  5D3I B;  5EE9 A;  3AE6 B;  2N9L A;  3A1Q B;  3VDZ A;  2BBC A;  4ACF A;  2D3G A;  3ML9 A;  2HTH A;  3U7Z A;  1EU3 A;  3AU5 A;  1ZW7 A;  1V1P B;  3Q8B A;  2ZVO A;  5C3J B;  3D32 A;  4EZL A;  1WJN A;  2AEH A;  1L0Y B;  3B9J A;  2E6X A;  1GPX A;  1C4C A;  2FIF A;  2KNB A;  2PE6 B;  3LB8 C;  2N7E A;  4BOZ B;  3A4S C;  2M17 A;  3E9S A;  4ZDV A;  4KDI C;  1YX6 B;  1C79 A;  5LXH A;  1XLQ A;  4B0M A;  4GGQ A;  4HXD A;  4LNF A;  2KTF A;  3U30 A;  1MVK A;  4FBJ B;  1IBX B;  1F0Z A;  1R7S A;  1I4P A;  3PRZ A;  3KYD D;  5AZH A;  4ANX A;  3HM3 A;  5BO4 B;  5C2T B;  1E9M A;  3WAN A;  3P4Q B;  1C76 A;  2R61 A;  1J8C A;  4FA6 A;  2TSS A;  2K0P A;  4KKJ A;  2FUG 1;  1OQQ A;  2DHZ A;  3UF8 A;  2I1J A;  4BKG A;  2ZNV C;  4MJS A;  4XE0 A;  4O1N A;  2DBY A;  4HK2 A;  2VH1 A;  2INP E;  3N32 A;  4PYU A;  3R2I A;  2UU7 A;  5BMG A;  4BOS C;  2V3N A;  5CX3 A;  1E8Z A;  4P1B C;  2PW9 A;  3V05 A;  4JPS A;  4YTM B;  1F52 A;  1XXG A;  2AQ1 B;  3Q3N C;  3VTU A;  4EEW A;  4ANV A;  3AEA B;  5H8Y E;  2LMC A;  5DPW A;  3Q8C A;  2WLB A;  2NTS A;  1Q10 A;  1GC6 A;  3RCZ A;  1HA5 A;  3U4E G;  3ZO5 B;  2MBH A;  3HK0 A;  3VUW A;  2HD5 B;  5JHB A;  2C7M B;  4NQL B;  1OQR A;  2KQ7 A;  2N7D A;  3WCQ A;  5AUI A;  2C9W B;  4HCN B;  2ZCB A;  3L13 A;  3PPA A;  4AWJ A;  1PQS A;  2N9X A;  3PTF C;  4DWF A;  2XK5 A;  1GG3 A;  2INC C;  1LXD A;  1E8W A;  2DZM A;  3P63 A;  2WXL A;  2BQQ A;  4FJZ A;  1TJE A;  2LHD A;  1WE6 A;  2NS5 A;  5CTR C;  2WXN A;  3BVZ A;  1L0X B;  1XF5 L;  3P1M A;  4OZC A;  1MI0 A;  3GE8 C;  2FID A;  3H1U A;  2JWZ A;  3CWI A;  1J7A A;  3PT2 B;  1DOY A;  1VCB A;  5I4D A;  1ENF A;  1L5P A;  2JYE A;  3ZLZ A;  3ZXV A;  2KWC A;  2W3S A;  1HTQ A;  1WFY A;  2KDB A;  2BS4 B;  3AUL A;  3ZDM C;  4OHJ A;  3B2G A;  1SE2 A;  4K1R B;  4MH0 E;  1OTR B;  4S17 A;  4NJ7 A;  4RF0 A;  2ZZP B;  1NBF C;  2DZK A;  5DCN A;  4KZC A;  2KO3 A;  1M4V A;  4A6Q A;  1WX8 A;  3BYT B;  3M3J A;  3CIR B;  5MPO A;  3RYT A;  3GP7 A;  3I3T B;  2LHE A;  1P7F A;  1HEZ E;  3K9O B;  3L0W B;  1FCC C;  1G6J A;  2HJ1 A;  1WGH A;  1NYQ A;  5HHD G;  3IXS A;  1V5O A;  4W9L A;  3ZQ4 A;  3HRD D;  2ZW0 A;  5AUK A;  1JWM D;  2WP9 B;  2IY0 B;  3E56 A;  2CJN A;  4DDI D;  2B3A A;  1F2R I;  4S0R A;  3BVG A;  2G4D B;  3Q3J A;  3A9J B;  3DVN V;  3PSE B;  2UWQ A;  3TL5 A;  3DHI C;  3QIJ A;  3HUI A;  4II2 B;  2RD0 A;  3DBL B;  1TKE A;  2IZV B;  2J0J A;  2K9X A;  3NG0 A;  4NAW A;  4NPN A;  2KJH B;  4W9C A;  5JH5 C;  3C8Y A;  4ASW C;  2N0S B;  4HCP B;  2VH2 A;  1ZXI A;  2RMM A;  1L6V A;  2GB1 A;  4DQO C;  5AEK B;  4AJW A;  4ZHP A;  4TMA B;  4IW0 A;  1F77 A;  2BGF A;  3ZGZ A;  1CQV A;  2CHW A;  3VRB B;  4XZ4 A;  1UEL A;  3EA6 A;  4J6I A;  3DWM A;  2FCS A;  2WXK A;  1FXA A;  4PT5 A;  1YX5 B;  2WQY B;  3I57 A;  2JXT A;  4XDD A;  1YNT E;  1UNS A;  4B6W A;  1I4R A;  5E6P A;  2KFK A;  1NEK B;  3ABV B;  1VZ7 A;  3PZD A;  3NUH B;  2QC8 A;  5HG2 A;  5EE1 A;  4JX1 C;  4WQM A;  5FK9 C;  2W54 A;  2SEB D;  2WNM A;  1V97 A;  2G3Q B;  4JWU C;  5JXV A;  2WDR B;  2Z8L A;  2BWF A;  1YD8 U;  2A5U A;  2BS3 B;  3ZNG C;  4EZJ A;  3V60 A;  2M0A A;  3W2D A;  4NNJ B;  2ON8 A;  1YIW A;  2V0G A;  2INN E;  2LEK A;  2MP2 A;  3T3N A;  1I4X A;  4PS8 A;  2BB6 A;  3MC9 A;  5L95 C;  3DBR I;  1MG8 A;  3PRE A;  2IYD B;  4GB9 A;  1UWX A;  1Q0W B;  1S3S G;  2KX0 A;  2N9K A;  1BML C;  2RPV A;  3N1Z C;  3WAP A;  4HVB A;  4P1C C;  1WGK A;  3LYY A;  1SE3 A;  2OJW A;  1XQQ A;  5BYS A;  3PV1 A;  2KDI A;  1FNW A;  4M00 A;  3PHX B;  1XLN A;  2BT6 A;  5IOI A;  1BT0 A;  4M02 A;  1AW7 A;  2WXG A;  2LVO A;  4MM3 A;  4FN2 A;  4LDT D;  3ALB A;  4MGZ E;  4ZRI A;  3RUL A;  3WAO A;  1WX7 A;  1R4M I;  4JE3 B;  4FHJ A;  4IM2 A;  3GZN I;  1ZE3 D;  2NBV B;  4J3O D;  2NMQ A;  1MFW A;  1TS5 A;  3M62 B;  3FC4 A;  3RI7 C;  2XBB C;  2AYO B;  1EO6 A;  4GOC A;  4NJ6 A;  1H4R A;  5BMI A;  4LDT B;  3GB1 A;  2KDE B;  4OZB A;  2N9E B;  1KH0 A;  1WSP A;  1PGA A;  4GU2 A;  4PS7 A;  1E90 A;  1Q5W B;  3OWE B;  2O2V A;  3SFD B;  1DOX A;  1IGC A;  2WX1 A;  2EEL A;  1UUP A;  3RNG C;  5BMH A;  1EWY C;  3W1S C;  3PHW B;  4HPM B;  1A5R A;  2W55 A;  1LM8 B;  2WU2 B;  4YTP B;  1P3Q U;  1WZ3 A;  2QCZ A;  1JWU D;  1XLO A;  5DPR A;  4A90 A;  1KF6 B;  1VZ6 A;  4C4V B;  3J9C A;  1FXT B;  5BYQ A;  1FO4 A;  4BVU C;  2ACZ B;  2BVC A;  1SGH A;  3NRZ A;  2MRP A;  5HI1 A;  3RNA C;  4IKG A;  2MHJ A;  2NPT B;  4II3 B;  1EU4 A;  4KSK C;  3RZF A;  2BKR B;  1WF9 A;  2MBQ A;  4OVZ A;  2G9H D;  3N9Y C;  4IM0 A;  3I9V 1;  3A4R A;  3B1L X;  2V9H A;  4YL8 A;  4MAC A;  3U2S C;  3H9D A;  2REX A;  5JHA A;  4L2Y A;  1YJ1 A;  1KJT A;  3R3M A;  1RYJ A;  3UGB B;  3RNE C;  1WJU A;  2J7Q B;  3RFZ B;  1TY2 A;  2IO1 B;  3DBH B;  3AEF B;  2UYZ B;  3CF6 E;  2DAF A;  3EHV A;  3L54 A;  2J52 A;  1TBE A;  2QMT A;  3X0W A;  2LRU A;  3QHT A;  1TGZ B;  4ANW A;  5J2R A;  1TT5 B;  4N9F 4;  2KWU B;  2KN5 A;  4GIV A;  1FRD A;  2W9N A;  5H92 C;  2IO3 B;  4CYE A;  1JWA D;  3NVZ A;  1PDX A;  2MW5 A;  5KHQ A;  2R2Q A;  3FAH A;  2V3P A;  1WRI A;  4RCO A;  4ZRQ A;  1UF0 A;  1WGY A;  3Q69 A;  3M95 A;  2MWS B;  2Z0E B;  4KIK A;  2KFK B;  3NVY A;  2NBW B;  1FD6 A;  1PUT A;  4KSL C;  4K3C A;  2NTT A;  4ZRP A;  2VZK D;  3FIL B;  2CU3 A;  1WJ4 A;  2MBE A;  1SSN A;  3Q8F A;  4GDL A;  2LVQ A;  4E74 A;  5D2M B;  1AAR A;  1R4M B;  4XDC A;  1WWT A;  1MPE A;  3WAM A;  2JYT A;  4K81 A;  4XX5 A;  2AQ3 B;  2QEJ C;  1V80 A;  3HHM A;  3NOB A;  1XT9 B;  4HRS A;  2XN9 C;  4WWM A;  2LI5 A;  2ASQ A;  4A8X C;  3GOE A;  4N59 A;  1LO5 D;  2RGF A;  3APC A;  5T8I A;  3IHP C;  4MDK E;  3B2F A;  1AYF A;  1LQB A;  2C5L C;  3HM6 X;  2D2Q A;  3B0A A;  4OVU A;  2PTL A;  2I1K A;  4ZRK A;  2D3B A;  2JZZ A;  3AM9 A;  4WJO A;  1E0Z A;  2H89 B;  3AMZ A;  5G5G A;  2LZ6 A;  1FM0 D;  4BBN F;  2O6V D;  2RR9 A;  3SHQ A;  3OAW A;  2LGI A;  2O6V B;  2MH7 A;  4RNA A;  1YN5 A;  1ET9 A;  4FJY A;  2D3C A;  1QKZ A;  2ZPN A;  1LGR A;  3PZ7 A;  4OVV A;  4BZA A;  4W9H A;  3RD2 A;  3NS8 A;  1SBB B;  5LNK 1;  1V2Y A;  3GE3 C;  2IGH A;  3AED B;  2RDG A;  3QAQ A;  1YJI A;  1WXS A;  2XNA C;  5IO9 A;  5IA7 A;  4KX6 B;  1C1Y B;  1K50 A;  1NI3 A;  2JU6 X;  2MSE D;  4US8 A;  2PJH A;  2HDE A;  3GZN B;  1NDD A;  2K3U A;  3PRP B;  1XEE A;  4WAA A;  4BBN C;  3Q8A A;  5DPT A;  1RM6 C;  3V62 A;  1N61 A;  1KLU D;  2EKE C;  2V4I B;  1TKG A;  4DXF A;  3Q14 C;  2WXJ A;  2JX5 A;  1WXV A;  2PVG C;  2WHI A;  1CK1 A;  2WWZ A;  2FCN A;  3L16 A;  1DGJ A;  2SAK A;  3DBR B;  2D5G A;  3H6N A;  4P7I A;  1Y56 A;  2LJ5 A;  4HDQ A;  1JRU A;  4IC7 B;  2K8H A;  1V5T A;  2IO0 B;  1KLG D;  3EGR A;  4HJG E;  2JQR B;  4MSM B;  1E7P B;  4AS1 A;  1QLB B;  1YOV B;  3VR8 B;  2K8C A;  1D5X C;  2CHX A;  2DAJ A;  3ZJU A;  3P42 A;  4LNI A;  3MHS D;  2L7R A;  1C9F A;  2N9P C;  4GMV A;  3AE5 B;  5G2N A;  3AI5 A;  1GAQ B;  1Z2M A;  1QOF A;  5D3D A;  2MX2 A;  1JML A;  2FCQ A;  1SE4 A;  4LK0 M;  1SIJ A;  3ZKJ C;  2DYO A;  3Q2A C;  3FKY A;  1I7H A;  1JAL A;  3T9L A;  4LLG M;  3KVF B;  1XCQ L;  1N63 A;  3A33 B;  1QOA A;  2M1M A;  3DWG C;  1N62 A;  1FFV A;  3RNB C;  1QT9 A;  3AN1 A;  2C7N B;  3QX1 A;  2KAN A;  2D11 A;  1JW9 D;  1C3T A;  3JVZ X;  1N5W A;  5JZE B;  1YMH E;  2MA9 B;  1UH6 A;  1AWD A;  1ZDV A;  4E3C A;  4MGI E;  2K6Q A;  3U52 E;  3PLU A;  3P4R B;  5E6J A;  4D2K A;  3CSF A;  1QOG A;  2GLS A;  3QQ8 B;  2K39 A;  2IDY A;  1A70 A;  2KMM A;  4RF1 A;  4W9I A;  1VD2 A;  2G45 B;  4XC2 A;  3MHZ A;  4ZHO A;  1RFK A;  1Z5S B;  1MHH E;  2QIE B;  3SU8 X;  3AE8 B;  4KGS A;  2JWU A;  3QAR A;  3W9C B;  1FNV A;  2JVC A;  3T3O A;  4HEA 1;  2GBR A;  1WXQ A;  2LXC A;  3V6C B;  2BYF A;  2GBN A;  2L05 A;  4YTN B;  4YWG G;  3AU4 A;  4MEM A;  2GBJ A;  1Y8R C;  2MEK A;  3Q3M C;  3NVV A;  4RFB A;  1C78 A;  3IBE A;  1WXA A;  4B95 A;  1UBQ A;  4JLC A;  4A3O A;  4FAD A;  2I38 A;  3MP9 A;  3AEG B;  2PLP A;  2WGS A;  2Y5B B;  1YQB A;  1SIF A;  3IFW B;  4K7W A;  1ZGU B;  3RPF C;  2AL3 A;  4DDG D;  2YEP F;  4GSW A;  1JRP A;  3N30 A;  2A4Z A;  1FXI A;  2RSU A;  3EEC A;  2OOB B;  4A20 A;  2L83 A;  3BVM A;  3ZNI D;  5FR3 A;  4LJP B;  4Q2J A;  4GDK A;  1I35 A;  2MJE A;  3DOW A;  4A3P A;  4ARC A;  2LD9 A;  2D3A A;  3AE4 B;  3T8M A;  4JWS C;  3SR6 A;  4IG7 B;  1EF5 A;  1P98 A;  3A9K B;  2JPH A;  4OZA A;  4TQ1 A;  2QHO A;  4C4V A;  3VXW A;  4G50 A;  3ZW3 A;  4XGA B;  3ZTC A;  4F1S A;  1R4N B;  3TEY A;  4IUM B;  3O65 B;  3PGE A;  2DEN B;  3APD A;  4N58 A;  2K25 A;  2KAC A;  1VJK A;  2LWP A;  1I42 A;  3N20 C;  4GXB A;  3ONS A;  2EMT A;  2KKC A;  1CJE A;  3RNF C;  2N1V A;  3SFE B;  1C4A A;  4JQW C;  4DBG A;  5GXG B;  4BKS D;  1E7V A;  4M0W B;  4BKS A;  1FMA D;  1HE8 A;  1F9J A;  2QJL A;  4ZOH C;  2WX0 A;  1EF1 A;  2KYW A;  1VZ8 A;  2JF5 A;  3I63 C;  1V1P A;  1V8C A;  2FBW B;  2KD0 A;  4W9K A;  4A9A A;  2PPH A;  4DXG A;  1L6U A;  2K5P A;  4HRO A;  2KC2 A;  4FHK A;  1XCT L;  2NBU A;  4DHJ D;  1GB4 A;  4F8C B;  3OJ3 A;  3MC8 A;  1F2R C;  1ISN A;  2NR2 A;  5TR5 A;  4WJN A;  1HZ5 A;  1KTK A;  3QWZ B;  4XWT A;  1P0R A;  4WWP A;  4WUR A;  4RM8 A;  2JY6 A;  1EWC A;  2BB5 A;  2HJ8 A;  1WM2 A;  3VQI A;  3ZUN A;  4AOF A;  1OFF A;  1WZ0 A;  1TS4 A;  4DXA B;  5D7G A;  4AQ7 A;  3W5U B;  2ICI A;  4GDK B;  3TEX A;  2I2Y A;  1N60 A;  1RFA A;  1CMX B;  2V4L A;  4HKZ E;  4MEL A;  3IVF A;  3B08 A;  2CKH B;  2WS3 B;  2LVP A;  3RMK C;  3K9P B;  3KYC D;  4YSZ B;  2G1E A;  2G4S A;  3ECI A;  2PVO D;  5DPS A;  3AE1 B;  4RGN A;  1UGM A;  2JSV X;  4P6V F;  2DX5 B;  2L32 A;  2W82 A;  4WAF A;  5E6N A;  4JGH B;  4MJS B;  2MJD A;  2KLC A;  1TKY A;  3EUB 2;  1EUV B;  4M8M A;  1WR1 A;  1YN4 A;  1K52 A;  4WIP A;  1E6E B;  2ZW1 A;  2PE9 A;  3DHH C;  1IGD A;  3UQB A;  3KQ4 A;  2K6D B;  3VVW B;  2PMV A;  2NPT A;  4KDL B;  2IJ0 A;  1TIF A;  1SJH D;  1ZOY B;  4W9E A;  2XEW A;  1RAX A;  1IPG A;  3KW5 B;  4CO7 A;  1IBX A;  3H8H A;  1TTN A;  1L2N A;  4YT0 B;  2PEA A;  4ANU A;  3P4S B;  4I6L B;  4L23 A;  4C80 A;  2LRW A;  3IG3 A;  1HTO A;  2FE8 A;  3RNC C;  2Z59 B;  2BTE A;  4K7U A;  4RGM A;  4G11 A;  1D3Z A;  2L00 B;  2LGS A;  2KTR B;  2D10 A;  2L3Z A;  1NEN B;  2L1A A;  1WYW B;  1SJE D;  1VDV A;  2MCN B;  4ZYS A;  2K8B A;  3VUX A;  2O2V B;  4DHJ B;  1K51 A;  3KLS X;  1VLB A;  4HWI B;  1LFD A;  4P16 A;  5J17 A;  1U4A A;  4KZ0 A;  1WE7 A;  4IWQ A;  3PRM B;  2E3T A;  4WH4 A;  3W1S A;  2KJ6 A;  3ZNH B;  1UWM A;  4ZYN A;  5C1Z A;  2M8S A;  4WJQ A;  2IGD A;  2W3R A;  3AV8 A;  3LDZ E;  2JZP A;  1V9J A;  3SEB A;  1NI2 A;  4H2A A;  4GN1 A;  5FR6 A;  1TY0 A;  4RGO S;  5AZG A;  4FLH A;  2LXA A;  2DYB A;  5E6O A;  3IAS 1;  3DBH I;  3RN9 C;  1E8Y A;  3IT6 B;  1L7Y A;  2N7J A;  4C56 C;  3RZW C;  3VFK A;  1GNU A;  2CU1 A;  4YXD B;  1FNU A;  1WX9 A;  3CST A;  2DYM A;  4K7S A;  2IY1 B;  1YN3 A;  1UGJ A;  4L1B A;  2KHW B;  3M63 B;  1D4B A;  4M0W A;  2JXX A;  4NAM A;  2X38 A;  2K1F A;  1JCK B;  3KH0 A;  4ITK A;  1J19 A;  4TKN A;  3V61 A;  3VAW A;  3R66 C;  2Y3A A;  2DNF A;  1SE9 A;  2ZNV B;  1RWS A;  2L76 A;  2MP2 B;  1I4H A;  4BKT A;  5EE3 A;  1L4Z B;  1ZKH A;  3KUC B;  4UDU C;  2RPQ A;  2DLB A;  4WQO B;  2BPS A;  4ICV A;  1XLP A;  4NJC A;  3VRA B;  4ZRJ A;  4MT5 A;  1OEY J; 
#chains in the Genus database with same CATH homology
 2KN4 A;  1QOA A;  4EE2 A;  1AN8 A;  5HG2 A;  3KWV A;  1PGB A;  5EE1 A;  3DWG C;  1N62 A;  1B9R A;  1P7E A;  1FFV A;  2IPK D;  1QT9 A;  3AN1 A;  4JX1 C;  4WQM A;  5FK9 C;  3GS2 A;  2WXM A;  1IUE A;  3ZJV A;  1SF0 A;  2W54 A;  1JW9 D;  3AE2 B;  2SEB D;  2WNM A;  4C7Z A;  1V97 A;  2WU5 B;  4JWU C;  5JXV A;  1N5W A;  1YMH E;  4MM3 B;  2WDR B;  2Z8L A;  4GDL B;  2MJ3 A;  4R3D A;  3L4P A;  2BS3 B;  4CQN A;  5TSS A;  1TS2 A;  1AWD A;  1ZDV A;  3NZ3 A;  2M0A A;  3W2D A;  3U52 E;  2ON8 A;  2V0G A;  2INN E;  2LEK A;  3P4R B;  5E6J A;  4D2K A;  3T3N A;  1QOG A;  1VR9 A;  1K53 A;  3IAM 1;  1I4X A;  2BB6 A;  1ROE A;  1FFU A;  2IDY A;  1A70 A;  2KMM A;  4RF1 A;  3Q8E A;  3PO0 A;  4C7Y A;  3MFG A;  1D6E C;  2WXF A;  4KKI A;  2H88 B;  3MHZ A;  4ZHO A;  1RFK A;  1MHH E;  1UWX A;  2QIE B;  3AE8 B;  3AEC B;  1I4Q A;  1PYW D;  4KGS A;  2JWU A;  3R8B A;  2N9K A;  1BML C;  2RPV A;  3W9C B;  1FNV A;  3T3O A;  4HEA 1;  3AE7 B;  1WGK A;  3LYY A;  1SE3 A;  3AEE B;  1WXQ A;  3LXF A;  4YTN B;  3TEW A;  4YWG G;  5BYS A;  1D5Z C;  5EE0 A;  1JRO A;  2YEP B;  1PGX A;  1FNW A;  3FIL A;  2MEK A;  2WXP A;  1XLN A;  2BT6 A;  4REZ A;  2GI9 A;  4MH8 A;  1J7C A;  1AW7 A;  3NVV A;  5G5H A;  2WXG A;  4RFB A;  1WYG A;  1C78 A;  1SEB D;  2M56 B;  3HVZ A;  2I38 A;  3MP9 A;  3AEG B;  2PLP A;  4KGT A;  2IGG A;  1DYQ A;  2QIL A;  2LFI A;  4JE3 B;  2L52 A;  1N63 A;  3P4P B;  3KWL A;  4NZL B;  3RPF C;  1V1O A;  1ZE3 D;  2YEP F;  1JRP A;  4J3O D;  1FXI A;  1VRA B;  2NMQ A;  1TS5 A;  1XO3 A;  2J42 A;  2Y5P A;  3FC4 A;  3IT4 B;  1HQR D;  2OHF A;  3AH7 A;  3ZJT A;  4YSX B;  5BMI A;  1C77 A;  3GB1 A;  4OZB A;  3V3X A;  1STE A;  2L83 A;  3BVM A;  5FR3 A;  1FCL A;  1KH0 A;  1ZP0 B;  1WSP A;  1PGA A;  1D5M C;  1EM7 A;  4USA A;  1BXT A;  3OWE B;  3BII D;  4Q2J A;  3SFD B;  1DOX A;  1IGC A;  2OED A;  2PKO A;  4RGT A;  2EEL A;  1UUP A;  1FD6 A;  3VR9 B;  5BMH A;  2MJE A;  4ARC A;  1EWY C;  1FRR A;  3TSS A;  3AE4 B;  4JWS C;  3SR6 A;  2W55 A;  2WU2 B;  2RDH A;  4YTP B;  1T3Q A;  4OZA A;  4TQ1 A;  5BYR A;  2LJI A;  1JWU D;  2KDM A;  1XLO A;  1ZXH A;  4A90 A;  1KF6 B;  1VZ6 A;  2DWQ A;  4IOI E;  3J9C A;  3UI3 A;  3AEB B;  5BYQ A;  1FO4 A;  1J7B A;  1QOB A;  1JQ4 A;  1MHX A;  2ACZ B;  3TEY A;  4HKQ A;  1L4D B;  1ZDX A;  2J53 A;  1T5X D;  2Q5W D;  3NRZ A;  4N58 A;  4US9 A;  2CJO A;  5HI1 A;  2Y5C A;  2KAC A;  1VJK A;  4IKG A;  1JWB D;  5D3I B;  5EE9 A;  1DOI A;  3AE6 B;  2N9L A;  1EU4 A;  2BBC A;  2BS2 B;  1CJE A;  3U7Z A;  1EU3 A;  4OVZ A;  3SFE B;  2G9H D;  3N9Y C;  1V1P B;  1C4A A;  3Q8B A;  5C3J B;  3I9V 1;  1GPX A;  1L0Y B;  3B9J A;  2E6X A;  1C4C A;  5GXG B;  2KQ4 X;  3LB8 C;  4MAC A;  3BZD B;  1FMA D;  3E9S A;  3U2S C;  2QJL A;  4ZOH C;  1C79 A;  1XLQ A;  1VZ8 A;  4L2Y A;  3URY A;  1HZ6 A;  2VZK B;  4B0M A;  1V1P A;  1V8C A;  2FBW B;  4A9A A;  1RYJ A;  1MVK A;  1IBX B;  1F0Z A;  1R7S A;  4DXG A;  1YJJ A;  1I4P A;  3RFZ B;  1L6U A;  1TY2 A;  1ZUD 2;  2K5P A;  4HRO A;  3AEF B;  2QSD A;  1TS3 A;  1GB4 A;  1XCT L;  2J52 A;  2QMT A;  5C2T B;  1E9M A;  1TYG B;  1F2R C;  3P4Q B;  1FEH A;  2B76 B;  1C76 A;  1HZ5 A;  3PZ8 A;  1KTK A;  2R61 A;  4LTU A;  1FRD A;  2AX5 A;  5H92 C;  2TSS A;  4XWT A;  2K0P A;  1SXT A;  3AE3 B;  4FXC A;  4KKJ A;  2FUG 1;  1OQQ A;  4WUR A;  4IDI A;  1JWA D;  3NVZ A;  1PDX A;  1EWC A;  3FAH A;  4XE0 A;  2BB5 A;  2V3P A;  4O1N A;  2DBY A;  1WRI A;  4RCO A;  4ZRQ A;  1ACC A;  3VQI A;  2INP E;  3Q69 A;  3R2I A;  5BMG A;  2V3N A;  1ESF A;  1OFF A;  1TS4 A;  2PW9 A;  3NVY A;  3V05 A;  5D7G A;  4JPS A;  4YTM B;  4AQ7 A;  1HXY D;  1L0V B;  1PUT A;  2BYT A;  1XXG A;  2AQ1 B;  3ABV B;  1FIQ A;  3W5U B;  2ICI A;  4GDK B;  4GLS C;  2NTT A;  4ZRP A;  1KRH A;  3TEX A;  3MJ5 A;  2I2Y A;  2PIA A;  1N60 A;  3AE9 B;  2WXH A;  2VZK D;  3FIL B;  3AEA B;  1SB3 C;  5H8Y E;  2CU3 A;  3W5V B;  1QF6 A;  4HKZ E;  4TSS A;  1SSN A;  2LMC A;  3Q8C A;  3Q8F A;  2WS3 B;  2KAJ A;  1TZO A;  4A55 A;  4TQ0 A;  2WLB A;  2NTS A;  1Q10 A;  1KFY B;  3BK2 A;  2BW2 A;  4YSZ B;  4XDC A;  4N6E B;  1WWT A;  2G1E A;  1MPE A;  2WXR A;  1HA5 A;  2WXQ A;  3BYY B;  2PVO D;  3U4E G;  2JYT A;  2ONQ A;  3AE1 B;  4RGN A;  2JSV X;  4P6V F;  1NVI D;  1I4G A;  2AQ3 B;  2L32 A;  2W82 A;  2QEJ C;  4WAF A;  1OQR A;  2MJD A;  3WCQ A;  5AUI A;  1TKY A;  3EUB 2;  4YSY B;  4ARI A;  4NAW B;  4HRS A;  1YN4 A;  1ET6 A;  1K52 A;  2XN9 C;  4WIP A;  4WWM A;  1E6E B;  2ZW1 A;  1BUI C;  1IGD A;  3HVD A;  4A8X C;  4N59 A;  1LO5 D;  3KQ4 A;  3P63 A;  2WXL A;  1TJE A;  2PMV A;  2LHD A;  2IJ0 A;  5T8I A;  2WXN A;  3B2F A;  1AYF A;  3BVZ A;  1L0X B;  1SJH D;  1ZOY B;  1XF5 L;  1YQ3 B;  3P1M A;  4OZC A;  1IBX A;  3H8H A;  4OW0 A;  1MI0 A;  2PTL A;  3R2T A;  1C4P A;  4YT0 B;  3AM9 A;  1E0Z A;  3P4S B;  2M19 A;  2H89 B;  3CWI A;  3AMZ A;  5G5G A;  1J7A A;  2LUM A;  4L23 A;  4C80 A;  2WXO A;  1FM0 D;  3TEZ A;  1DOY A;  5I4D A;  1ENF A;  3BWU D;  1L5P A;  2JYE A;  4KGR A;  2FE8 A;  3ZYY X;  3TUO A;  2BTE A;  2W3S A;  4RGM A;  2LGI A;  2MH7 A;  4RNA A;  1YN5 A;  1ET9 A;  2BS4 B;  4OHJ A;  4RH6 A;  3B2G A;  1QKZ A;  1NEN B;  1SE2 A;  3PZ7 A;  1CZP A;  2GRI A;  1T6B X;  2L1A A;  4RF0 A;  1SJE D;  1VDV A;  4ZYS A;  1SBB B;  5LNK 1;  1K51 A;  3KLS X;  1VLB A;  4P16 A;  1M4V A;  4A6Q A;  2J4X A;  2IGH A;  3O13 A;  3AED B;  2RDG A;  2EKI A;  2E3T A;  4WH4 A;  3W1S A;  1YJI A;  1UWM A;  3BYT B;  2XNA C;  1JWS D;  3CIR B;  3MC0 B;  5MPO A;  3GP7 A;  2IGD A;  2LHE A;  1P7F A;  1HEZ E;  2W3R A;  3AV8 A;  3NUH B;  4KX6 B;  1K50 A;  1FCC C;  4B0E A;  1QQR A;  1NI3 A;  2JU6 X;  3AB5 A;  4US8 A;  2JZP A;  1NYQ A;  2HDE A;  1QIL A;  5HHD G;  3SEB A;  3IXS A;  4H2A A;  2K3U A;  1TY0 A;  3ZQ4 A;  1XEE A;  3HRD D;  2ZW0 A;  4RGO S;  3Q8A A;  5AUK A;  1E10 A;  1JWM D;  3IAS 1;  1RM6 C;  2WP9 B;  1N61 A;  1KLU D;  3E56 A;  3IT6 B;  2CJN A;  2V4I B;  1TKG A;  4DXF A;  2N7J A;  1F2R I;  4C56 C;  1NYR A;  3BVG A;  1YQ4 B;  2WXJ A;  4YXD B;  1FNU A;  2JX5 A;  2PVG C;  1CK1 A;  1DGJ A;  2DYM A;  1B1Z A;  2D5G A;  2HTM E;  2SAK A;  1YN3 A;  1UGJ A;  1Y56 A;  3HUI A;  1TKE A;  2K9X A;  4L1B A;  2AQ2 B;  2K22 A;  1KLG D;  3EGR A;  4HJG E;  2JQR B;  3C8Y A;  1D4B A;  2N0S B;  4M0W A;  1N5X A;  4NAM A;  2X38 A;  1ZXI A;  1E7P B;  2RMM A;  1L6V A;  2GB1 A;  2WDV B;  4DQO C;  1JCK B;  4AS1 A;  2KWD A;  3ETR A;  1QLB B;  4ZHP A;  4TMA B;  3VR8 B;  4ITK A;  1F77 A;  3ZGZ A;  1GB1 A;  1CQV A;  3NS1 A;  1D5X C;  3VRB B;  3ZJU A;  2Y3A A;  3P42 A;  1C9F A;  3EA6 A;  3AE5 B;  1RWS A;  1GAQ B;  1QOF A;  3DWM A;  1I4H A;  1ZPS A;  5HFY A;  2WXK A;  1FXA A;  3BK1 A;  5EE3 A;  5D3D A;  1L4Z B;  1GOZ A;  3NVW A;  1JML A;  4PT5 A;  2WQY B;  3I57 A;  4UDU C;  4XWW A;  2JXT A;  2DLB A;  1SE4 A;  4LK0 M;  4XDD A;  1XLP A;  1SIJ A;  1UNS A;  1YNT E;  5FKA C;  4NJC A;  3VRA B;  2DYO A;  1I4R A;  1I7H A;  1JAL A;  1PFD A;  1NEK B;  4LLG M;  2WXI A;  1VZ7 A;  4MT5 A;  1XCQ L;  2WDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...