3U2SC

Crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
116
structure length
90
Chain Sequence
TTFKLAACVTLACTRVKHCSFNITTDVKDRKQKVNATFYDLYRLISCQTTTTEAVDAATAAKVFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PG9 heavy chain
publication title Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 90
sequence length 116
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.790 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3u2sC00
4YWGG 4DQOC 3U4EG 3U2SC
chains in the Genus database with same CATH superfamily
1E5WA 2GBNA 2DZKA 3CWIA 4GIVA 1XXGA 1WE7A 4C7YA 3IBEA 3HRDD 3R2IA 2WXNA 3M95A 5DPTA 1MI0A 2DX5B 2AL3A 3Q8EA 5CHWA 3IAS1 1M94A 3APDA 2M19A 1TJEA 1OTRB 2C9WB 1WX9A 2RDBC 3R3MA 2EKIA 1HTOA 3P4QB 2KTRA 1ZXIA 4HEA1 1WX8A 1ZKHA 1SGHA 2FCSA 1JWMD 3U7DA 4M01A 2N9PC 2Q5WD 1TT5B 4B95A 4WIPA 4ZRKA 1IBXB 3A4SC 1LXDA 1E6EB 2VH1A 3PGEA 1WXAA 3N3KB 2RMMA 2JVCA 1L0VB 4RFBA 1WI0A 1UUPA 1HTQA 4A3PA 2K39A 2IY1B 5C3JB 1SE2A 5D3IB 3AEEB 2KVRA 2WU5B 3IXSA 1YOVB 4KSLC 1BUIC 2ZVOA 3NVVA 3NOBA 3SHQA 3OJ4B 3ZYYX 2INNE 3AU5A 3PPAA 3VR8B 2FCQA 2DZIA 1MVKA 1UZXB 1GG3A 4NAWA 4RGTA 4HKZE 3URYA 4GXBA 1F2RI 3MFGA 2J53A 3KLSX 3ONSA 4ICVA 4X57B 4HLEA 3FAHA 2K5PA 2YEPF 1V5OA 2FNJB 4IM3A 1CQVA 1E7UA 2PJHA 4JE3B 4N59A 2RPVA 2ZJDA 4KZCA 1XCQL 3MHSD 1EF1A 2E6XA 2N9KA 4I6LB 4B0EA 3H7PB 3DHHC 2KFKA 2GRIA 3U2SC 1GNUA 2ZNVB 3SFEB 1ZW7A 3CIRB 4YTNB 3V62A 3TEZA 2L76A 1XF5L 2FUG1 1FNVA 2MLBA 3JSVB 3ZGZA 3BWUD 1C76A 1E7VA 3V05A 3A9JA 2LWPA 4JIOU 2DBYA 2W3SA 1T0QC 3ZDTA 1WXSA 3AU4A 2IBIB 2KN5A 4IG7B 3VUYA 5DCNA 5E6NA 2O2VA 3DBLI 3SR6A 3RNEC 4C4VB 2PVOD 3AEDB 4I6NB 2MBHA 3IFWB 3APFA 4P6VF 2JQRB 1KM7A 2KC1A 2NPTB 1L5PA 4KIKA 5L83A 3ZXRA 5AZGA 3AE8B 2AEHA 1Y8RC 2UWQA 1QT9A 3ZRFA 4PS7A 4NJ6A 1A70A 4HPPA 1EWYC 3Q8CA 3W1SC 4ZRQA 3PHWB 2J0JA 1E90A 3P4PB 1P3QU 1UF0A 2LVQA 4JQWC 3AI5A 3QC8B 3GS2A 2MWSB 3E9SA 1C4AA 3PVLA 5BO4B 1R4NI 2L0FA 2GMIC 2LGSA 5IOIA 2DZJA 1HEZE 4DK5A 2N7EA 1CZPA 1XLNA 4UDUC 2LHEA 3DBRI 2GI9A 3SU8X 1X1MA 2QHOA 2CJNA 4NY0A 1YJIA 1ET6A 3CF6E 1UGJA 4DDID 3VXWA 1ZDXA 1R4MI 4FADA 2IO0B 4B0MA 4WWMA 1WGYA 2MBBB 3BK1A 1FXIA 2EMTA 3VTVA 1I42A 3MC0B 4ZRPA 5LXIB 1G6JA 4W9JA 1GB1A 4Q2JA 2JSVX 4P1CC 1YJJA 2KJ6A 4EZLA 2NBVB 3HIZA 2WU2B 1WMHB 2LGDA 2DYMA 4IWOA 5AUKA 4W9HA 1WXVA 4A6QA 4WJPA 2C7HA 3MJWA 1WH3A 3KH0A 3EA6A 1PUTA 4KGTA 3QIJA 4FJYA 1WGHA 2KO3A 5GXGB 1QLBB 3FKYA 2J52A 5TSSA 3CSTA 5HG2A 1VR9A 1TZOA 2BYFA 3DOWA 1PGAA 3WAPA 2KHWB 1SXTA 2XEWA 2NBWB 3L4PA 4HKQA 4QAYA 3H1UA 3QQ8B 4OVZA 3TUOA 3A1QB 2WXMA 3L17A 3DVNU 1L6VA 3EC8A 3W1YA 2JYTA 2WXPA 1I4HA 1QOFA 1WE6A 5IAAC 4TUUA 2WXHA 3T3OA 4KKIA 2MX2A 1QKZA 3AE6B 3ZKJC 1P98A 3ZTDA 4CYEA 2KWCA 2WGSA 2BYVE 2JX5A 3KYDD 1RM6C 3V6CB 1E8YA 1AN8A 1RLFA 4HROA 2LRUA 1BMLC 1JALA 5LNK1 3B9JA 2D10A 1C78A 1B1ZA 1NEKB 1NVID 2BGFA 2K8BA 4EE2A 1YMHE 2INPE 2NS5A 5D6JB 4MJSA 2KQSA 1SJED 2KX3A 3Q3FA 4LLGM 3ZQ4A 2M0AA 3IT4B 3HK0A 1NBFC 3Q3MC 3VUXA 3ZNID 3TEWA 1C9FA 2WQYB 1WIAA 1J8CA 4MGKE 1GC7A 4ANVA 4YT0B 2CJOA 1NI3A 4IDIA 4HDQA 1XQQA 2N7DA 3I5JC 4PT5A 1V8CA 3A9KA 3L13A 1JWSD 2BS4B 1FNUA 3VTUA 2L32A 3T9LA 3PRZA 4TSSA 4DXFA 4K3CA 2CHWA 3BVMA 3OG5A 1SSNA 1ZOYB 2JZPA 2BB6A 2LHDA 1YJ1A 5J17A 4DHJD 1GPXA 1XEEA 2N9XA 1VZ6A 2WXFA 1PGXA 5BMGA 3DDCB 3NUHB 1K50A 1VCBA 3B08A 2NTTA 1WGDA 2MP2A 3GZNI 3NHEB 4LCDE 3X23A 1N5WA 2JZ3B 2BVCA 2ZZPB 2TSSA 3BY4B 4MDKE 1VRAB 3VFKA 2RGFA 2OHFA 3DVGY 4M0WB 2O6VA 3KUCB 1BXTA 1ZDVA 1V5TA 3AEAB 1YQ3B 2G4DB 1I4RA 1T0RC 2WWZA 4XYCA 3I9V1 3TEXA 2L1AA 3AE2B 1LQBA 1JRUA 1P0RA 2JY6A 3HHMA 3RFZB 5D3DA 2I1KA 1IPGA 4WJOA 1J7CA 3BYTB 1AARA 5DPRA 2LUMA 3L54A 2D3AA 2V0GA 4IUMB 2JXXA 4I6PA 3LXFA 2L0TA 2J0MA 3C8YA 2RD0A 3OWEB 5JXVA 3N1YC 4WJQA 1C77A 4FJVB 4W9IA 3RT3B 2PMVA 3L08A 1J7AA 2PIAA 2HDEA 3NY5A 4PS3A 5CX3A 1WGKA 4BBNF 2OEDA 1PFDA 1F1HA 2M4NA 3DBHI 1UELA 2CR5A 1OEYA 2DAJA 1WZ0A 2W55A 2KKCA 1TKEA 1A5RA 4JPSA 2LEKA 3LJ3A 2NBUA 3T8MA 3C19A 2KVZA 2I2YA 4ANWA 4YTMB 2V3SA 2DZMA 4NQLB 2VZKD 2KTRB 1L4ZB 2KD0A 1WXQA 4EEWA 2D07B 3IHPC 1LO5D 3NZ3A 4LNFA 4B9KA 3FILA 2MBEA 1ISNA 2UU7A 3KWLA 2JT4B 3IG3A 3AE5B 2D5GA 3BVZA 3UF8A 1FD6A 4OHJA 1NENB 2CKHB 2YVCA 1WSPA 2I1JA 3DBLB 1XO3A 2L52A 2KTFA 1LFDA 4M00A 3WA0A 2L83A 2RDHA 2NMQA 3U52E 3PLUA 2BTEA 2BYEA 5FK9C 1F9JA 1TS2A 3R7RA 1SF0A 2NCNA 1QF6A 1OQYA 2QSDA 2JYEA 1E0ZA 1TZ1A 2WXRA 2LUEA 2R2QA 3Q69A 2IY0B 4XE0A 2FBWB 1WFYA 2FAZA 5BYRA 1LGRA 1MJDA 1FCLA 1WJ4A 1V86A 3VHTC 2HE7A 1F0ZA 1WM3A 2FIDA 2BYTA 2WX0A 4W9LA 3ZRCA 2L7RA 2ZCBA 2X8XX 1TBEA 2WDTB 2FCMA 4KGSA 1MHXA 5C2TB 1TS3A 4ICUA 1F2RC 3WANA 4K7UA 2WXGA 4HVBA 3KUDB 2HJ1A 1T0SC 2SAKA 1IP9A 1J19A 1R4NB 2YLMA 1CJEA 3VAWA 4GDKA 3DBRB 3A9JB 1WJUA 3DWMA 4RM8A 4W9FA 2ICIA 3BK2A 3MHZA 1M4VA 1TYGB 2BKRB 1TTNA 3OLMD 5MPOA 3CMMB 5G5GA 5H8YE 3APCA 2QJLA 4ZYNA 1WX7A 2O2VB 4AOFA 1D3ZA 1FMAD 4F1SA 3N1XC 2LGXA 3NVWA 3QAQA 4RCOA 4KIKB 2GLSA 1B9RA 2N0SB 1SIFA 4PYZA 4XZ4A 2OJRA 4DHJB 3QK0A 3RYTA 4O1NA 2L05A 2PLPA 2HTHA 3B2GA 4HWIB 4KV2A 2CHZA 2L8JA 1D5ZC 4IKGA 2JXTA 3W1SA 3N30A 1KFYB 3HVDA 2WDQB 2LFIA 1WY8A 2DHZA 2KN4A 2PE9A 2O6VD 3R7QA 1V80A 4M8MA 1I4XA 4HPLB 2WXLA 5CTRC 3Q3OC 4HPMB 4K1RB 1GJZA 3V6EB 1JWUD 1OFFA 3PHXB 2KYWA 1SE9A 2XNAC 1T6BX 4BAXA 1VDVA 2E3TA 3PO0A 2JF5A 4G11A 1V97A 1K53A 3ZJTA 2FIFA 2JWUA 4URKA 1RAXA 3ABVB 2AQ1B 1XLOA 4TV3A 1FFUA 3VH4B 4MSMB 2AQ2B 4WWNA 2MJ3A 1BT0A 1KLGD 3GB1A 4ZDVA 1ESFA 5G55A 4MACA 2KAJA 1C4CA 4DHZE 4G50A 5CHVC 1FM0D 1ET9A 1Y56A 1T0YA 4AJYB 5JH5C 3TIXA 4FBJB 1UWMA 3J9CA 5JZEB 5TR5A 4ZYSA 5DPWA 1KJTA 1L7YA 3PSEB 4LNIA 1JWBD 2AX5A 2QEJC 3GE8C 3SFDB 2V3NA 1TKGA 3ML8A 3UGBB 2ZNVC 5HKHA 4LNOA 2NPTA 1WXMA 4FN2A 2FCNA 3L0WB 3KUZA 3WCQA 3H6NA 4L1BA 3V61A 2ZPNA 3AEGB 3GOEA 4REZA 4OVVA 1JMLA 2B76B 1C79A 2K8CA 3EGRA 1KRHA 4F7ZA 5KHQA 2UYZB 2XK5A 2KLCA 2RR9A 4ANUA 4RF0A 1V2YA 1I7HA 3PT2B 2VZKB 5EE9A 3RN9C 3M63B 2KLGA 3VRAB 3ZW3A 2BQQA 1ZE3D 2KJHB 5EE1A 2QCZA 4KZ0A 4A9AA 2D3CA 4W9KA 2H89B 1P9DU 2CHXA 3WIMA 3IAM1 4CQNA 3KQ4A 1E9MA 1WR6E 2EELA 2GB1A 1XD3B 4RGMA 1FRDA 3AN1A 4HCNB 1D4BA 2KQ7A 3DVGX 2IDYA 3RUIB 3WALA 2C7MB 3PZ8A 4IM2A 2DENB 1FXTB 3NS1A 1RFKA 1DOIA 2KK8A 1WJNA 4W9DA 1V1PA 3NZSA 4KX6B 2PEAA 4FXCA 3AXCA 4IC7B 4GGQA 4N6EB 3WAMA 3B2FA 4IWPA 3ZJUA 1K8RB 2NR2A 2C7NB 3GZNB 2B3AA 1FO4A 3KVFB 2W54A 3RMKC 1FRRA 1PGBA 3QARA 1SB3C 2DYOA 2MQJA 4B6WA 4W9GA 4MJSB 1L6UA 2A4ZA 4AWJA 4IW0A 1SE4A 5FR6A 4IWQA 1VZ8A 3IT6B 3W2DA 1E8ZA 3ALBA 5HI1A 4NPNA 5E6JA 3QX1A 3AH7A 3OAWA 5AEKB 2JRHA 4DHZB 4AQ7A 4KGRA 3ML9A 4J6IA 3A9KB 4LJOB 5G5HA 1DGJA 1FIQA 2KANA 4XX5A 3RCZA 4W9EA 4BFRA 1N62A 4KKJA 3X0WA 4PS8A 2N1VA 4WWPA 2KACA 4NJ7A 2K3UA 4BBNC 4DBGA 2CS4A 4TKNA 4XC2A 3Q8BA 3M3JA 3GP7A 4A55A 4E3CA 4OZCA 1IGDA 2WP9B 5GMVA 4FA6A 2AL6A 3DBHB 3C0RB 2CU3A 1YX6B 1HQRD 2MP2B 1E8XA 1HXYD 1VD2A 2XBBC 1YD8U 2HTME 1OQRA 2VRRB 2IO1B 4FLHA 4RMAA 1T5XD 4EZJA 4BOSC 1EM7A 1KTKA 1H4RA 2O6VB 2QMTA 3VDZA 3KWVA 1MG4A 2N9EB 1UBIA 5E6OA 1ZUD2 2V1YA 4BKTA 1Z5SB 1HA5A 4IM0A 2Y5BB 3PV1A 1V49A 3FC4A 4E74A 2DAFA 1H8CA 3R66C 4AP4C 3DPDA 3I63C 2Y3AA 3RNGC 3P63A 1WRDB 4LNNA 3AEBB 3U30A 3IVFA 5HHDG 1CK1A 3CSFA 5EE3A 2W9NA 2LJ5A 1YN5A 2KMAA 2FUHB 4S0RA 2QDFA 4AUQC 2X38A 3QCAA 5AUIA 3U7ZA 1QZEA 2QC8A 1KOTA 1XCTL 1C3TA 1P7EA 2KNBA 3H9DA 1P7FA 1U4AA 2GBRA 3MC9A 2LMCA 2GBKA 4LK0M 4IOIE 4GDLA 2ZVNA 4BZAA 1QQRA 1STEA 4A90A 1ENFA 2WS3B 2PPHA 3PZDA 1HZ6A 2K9XA 4GN1A 4MGIE 4ZRJA 1N60A 4ANXA 3V3XA 1TY0A 1AWDA 3TMPB 1OGWA 4NZLB 1ZXHA 5FKAC 2Z0DB 2V4LA 2D3BA 3RZWC 2FE8A 3OJ3A 2WYQA 4TQ0A 1WJ6A 3W9CB 1YQBA 3AECB 3AV8A 2MBOA 3EHVA 4JL9A 3VUWA 3NVZA 1XLQA 5KHOA 4JGHB 2K8HA 2WDRB 1V6EA 1J0GA 3O65B 2M56B 3AMZA 3UQBA 4P16A 2JU6X 2KQ4X 2BT6A 2G4SA 3FILB 2J4XA 4ACFA 2MBQA 2JUOA 2BW2A 1SIJA 4RH6A 4XGAB 4ZHPA 1JRPA 3PREA 3VTWA 4R3DA 2GBJA 2ZEQA 1NI2A 1WM2A 4C56C 1C4PA 4BOZB 4ZOHC 3P2BA 5IO9A 1ACCA 2L3ZA 2WLBA 2JWZA 3RNBC 4M8NA 2MCNB 1GC6A 3A4RA 2V4IB 4NAMA 2M8SA 2LGIA 4RGNA 2PTLA 2ACZB 2LXCA 2DWQA 4FHJA 3BINA 4N9F4 1GB4A 4WJNA 1AYFA 1V81A 1WRIA 3Q3NC 3ZNGC 4BKSA 2Y5PA 2KMCA 1TS4A 2WXIA 2WXJA 4HXDA 3PTFC 2RDGA 1E7PB 2MH7A 4K81A 3GE3C 3DVNV 4A8XC 4RNAA 2DLBA 4NAWB 4ITKA 4GB9A 1IYFA 2Z0EB 1L2NA 4GDKB 3TJPA 3NJTA 1TIFA 2KC2A 2WXOA 2KFJA 2BWES 3B0AA 5J2RA 1KLUD 4MM3A 1JQ4A 4OW0A 1UBQA 2IPKD 4FULA 1YN3A 2Y5CA 4ZHOA 4P1BC 3MJ5A 1KF6B 4OZBA 4A3OA 1TY2A 3AE3B 4BVUC 3I57A 3A33B 2MEKA 3QJZA 3RD2A 1EF5A 3NZUA 2KFKB 5E6PA 1YIWA 2G9HD 3BVGA 1RRBA 5BMIA 2NTSA 4ZRIA 3BYYB 4D2KA 1YN4A 5AZFA 1C1YB 3H8HA 2LZ6A 2LD9A 2PKOA 2IO2B 4LDTD 5BYSA 3AULA 2ZPYA 2KDFB 3QHTA 2N7JA 3P42A 1UH6A 4HCPB 3NG0A 1R4MB 3RULA 4NQKE 3UINB 2J0KA 2M0XA 4S17A 3I3TB 3E56A 5LXHA 1YX5B 2BB5A 2K6QA 1IBXA 4K7SA 3S2AA 1IUEA 4YXDB 4PYUA 2QILA 3VH3B 4WAFA 3ZJVA 4NNJB 3ETRA 3Q6BA 2C60A 2D3GA 4HRSA 3K9OB 3ZLZA 3P1MA 2MJDA 2IJ0A 1QOAA 2JZZA 4II3B 4EFOA 5L95C 2N1WA 2KXJA 3JW0X 3TCAA 1EWCA 4WQMA 4WH4A 2WDVB 1MPEA 1UGMA 3ENEA 2AQ3B 3RZFA 2GBMA 2XN9C 2KDIA 3ZTCA 3VVWB 4TMAB 3HUIA 2MJEA 4DWFA 3RNFC 5CHFA 3AM9A 4WQOB 2J7QB 3N20C 2JRIB 1FNWA 2J42A 3UI3A 2V9HA 2W3RA 5C23A 3B1LX 3H7PA 3Q8AA 2IZVB 3PRMB 4A20A 3Q14C 1XLPA 2KWVB 4C80A 3DCGA 3NVYA 5J18A 2L00B 1MHHE 4MGZE 3T3NA 4RF1A 3NS8A 4ARIA 3JSVA 3EUB2 1FEHA 1HE8A 3BZDB 2KX0A 3PRPB 4WWOA 1V9JA 3DBSA 4BKGA 2BPSA 2D2QA 1OQQA 2XK5B 3U8ZA 3AE1B 2AWTA 2OJWA 3AE7B 5AZHA 2KWDA 4YWGG 2K25A 2Z8LA 4JWSC 2GOWA 1OEYJ 3DQVA 5C1ZA 4C4VA 1YNTE 1HZ5A 1YQ4B 1TGZB 1N6ZA 1K51A 3W5VB 3WAOA 1L0YB 2QIEB 1TS5A 2H88B 2KJRA 1WZ3A 1WYGA 4II2B 5IN7A 4C00A 1GAQB 4JX1C 1VZ7A 1SJHD 3R2TA 4K3BA 4L2YA 3L16A 3UQAA 2KZRA 4KDIC 2ASQA 3R8BA 1I4QA 1Q1OA 1T3QA 1V1OA 4ARCA 1JCKB 1WGRA 2DNFA 4GLSC 2ZCCA 1V1PB 3P4RB 5IP4D 4J3OD 4OVUA 4YL8A 1D5XC 3O13A 3ZO5B 4HJKA 4JLCA 1JW9D 2PE6B 2LVOA 3LB8C 1IGCA 2EKEC 1Z2MA 2MSED 4BKSD 2WX1A 1I35A 1RYJA 1Q10A 1GUAB 2C5LC 3AEFB 3P4SB 4RGOS 5H92C 4MH0E 2CU1A 3DHGC 2M17A 4HDOA 4KSKC 2ZW1A 3EFUA 4P7IA 1FXAA 2VH2A 2BKFA 2MW5A 2RSUA 1NDDA 2MHJA 1QILA 3Q8FA 4MH8A 1SE3A 3N9YC 2N4FA 2INCC 2KDMA 2KMMA 2WNMA 1WMHA 2IGDA 2LXAA 2SEBD 1SBBB 1AW7A 2BS3B 1D5MC 3KW5B 1NYQA 4KDLB 3Q3JA 2IYDB 4JWUC 1TKYA 2NVUI 5D2MB 3JVZX 4EKUA 2W82A 5I4DA 3EFCA 3AE4B 5LLIA 1E8WA 2IGHA 3ZVVA 5FR3A 4LDTB 2LRWA 3DWGC 3LYYA 4XWWA 2KOXA 5IA7A 4E71A 1QOBA 4XDCA 1EU4A 4H2AA 2A5UA 3RI7C 3DHIC 2PVGC 1I4PA 4RM9A 1ROEA 4TQ1A 5JHBA 2IO3B 2OOBB 5IKCM 3TEYA 4DXGA 1FFVA 3A1QA 1Q5WB 1P1AA 4PK1A 4F8CB 3ZXVA 1UD7A 2R61A 1K52A 2LGYA 4K7WA 3ZDMC 2RPQA 2KT7A 3W5UB 3TSSA 3SDLC 2K0PA 3MTNB 4GSWA 4L23A 3PS6A 5DPSA 5BMHA 3EECA 4AS1A 4WURA 2LASA 1VJKA 2LVPA 2V3PA 1J7BA 3SD5A 4EOYA 2BS2B 2N9LA 1DYQA 1UWXA 2I38A 4XDDA 1S1QB 3K9PB 3NRZA 4MGYE 4LTUA 4XWTA 4US8A 3QWZB 4DQOC 4LJPB 3ZUNA 3ZNHB 3LDZE 2Z59B 4ASWC 1ZP0B 5EDSA 1WYWB 1F52A 4GDLB 1UNSA 4M02A 4YSYB 3ZIMA 2YEPB 4CHKA 1KH0A 1EU3A 1Q0WB 2K22A 1S3SG 4G3XB 4GOCA 1ZPSA 3V60A 3HVZA 5G2NA 2LI5A 4US9A 3AE9B 4YTPB 5D7GA 2MRPA 2HD5B 2EMSA 3KYCD 4WAAA 2DYBA 2K6DB 3ZNZB 3RNAC 4MT5A 1RWSA 1N5XA 2AYOB 4KVGB 1KLVA 1VLBA 2PW9A 3MC8A 1WF9A 3AB5A 1D6EC 2ON8A 3VRBB 3TL5A 1EUVB 3ECIA 4W9CA 2KDBA 3UIPB 4FJZA 1I4GA 2JPHA 1F77A 5T8IA 1MG8A 1JROA 1PYWD 1PQSA 1R7SA 4YSZB 2KWUB 2ONQA 1DOYA 4C7ZA 2WHIA 5HFYA 4MELA 4LNKA 1DOXA 2INDC 4HJGE 3VR9B 1N61A 4N58A 4DDGD 1EO6A 2BWFA 4USAA 3MP9A 4CO7A 3N32A 2G45B 4HK2A 3HM6X 3JYUA 3RPFC 1WGGA 3HM3A 5EE0A 1WWTA 1E10A 5JHAA 4M0WA 1L4DB 3VQIA 1FCCC 1RFAA 2MA9B 5BYQA 1ZGUB 4OZAA 1GOZA 2K1FA 3Q2AC 1L0XB 1LM8B 2BF8B 4DXAB 1CMXB 3H7SA 1N63A 4NJCA 2REXA 4G0NB 1JWAD 2IGGA 2R2OA 2D11A 4FHKA 3RNCC 3N1ZC 2HJ8A 2BBCA 3UIOB 2G3QB 3TBLD 1QOGA 3SEBA 1NYRA 1WR1A 4EZKA 1XT9B 3L10B 1FPYA 5D94A 2WXKA 2M1MA 3PLVA 1PDXA 3M62B 4GMVA 2G1EA 3BIID 2LJIA 3U4EG 2ZW0A 4YSXB 4GU2A 3D32A 4EUTA 1MFWA 2KDEB 3QA8A 4MSQB 1SEBD 2WXQA 3PZ7A 4MEMA 4MM3B 4AJWA
chains in the Genus database with same CATH topology
2LHDA 1FRDA 3AN1A 1D4BA 1MPEA 3CWIA 2IDYA 1XXGA 2AQ3B 4C7YA 2XN9C 3HRDD 3PZ8A 3R2IA 1GPXA 1XEEA 2WXNA 3NS1A 1VZ6A 1RFKA 1DOIA 4TMAB 2WXFA 3HUIA 1PGXA 1V1PA 5BMGA 2MJEA 4KX6B 3NUHB 1MI0A 3AM9A 1K50A 4FXCA 2NTTA 4N6EB 1N5WA 1FNWA 2J42A 2TSSA 3B2FA 3UI3A 3ZJUA 3Q8EA 2W3RA 1VRAB 3Q8AA 3IAS1 1FO4A 2W54A 1FRRA 1PGBA 1SB3C 2DYOA 2OHFA 1XLPA 2M19A 1TJEA 4C80A 1L6UA 3NVYA 1BXTA 1ZDVA 1SE4A 2EKIA 1MHHE 1VZ8A 3AEAB 1YQ3B 3IT6B 3W2DA 3T3NA 1I4RA 4RF1A 3P4QB 1ZXIA 4ARIA 4HEA1 3EUB2 1FEHA 3BZDB 3I9V1 3TEXA 2L1AA 3AE2B 1JWMD 5HI1A 2Q5WD 4WIPA 5E6JA 1IBXB 1OQQA 3AE1B 1E6EB 3AE7B 3AH7A 3RFZB 5D3DA 2KWDA 4YWGG 2RMMA 1L0VB 1J7CA 2Z8LA 4JWSC 4AQ7A 4KGRA 4RFBA 3BYTB 1UUPA 2LUMA 1YNTE 1HZ5A 1YQ4B 5G5HA 1DGJA 1FIQA 5C3JB 2V0GA 1SE2A 5D3IB 1K51A 3AEEB 3LXFA 3W5VB 2WU5B 1L0YB 2QIEB 3IXSA 1TS5A 1BUIC 3C8YA 3NVVA 1N62A 2H88B 3OWEB 4KKJA 5JXVA 3ZYYX 1WYGA 1C77A 2INNE 3VR8B 1MVKA 1GAQB 4JX1C 2PMVA 2KACA 1VZ7A 1J7AA 2PIAA 1SJHD 3R2TA 2HDEA 4L2YA 2K3UA 4RGTA 4HKZE 3URYA 1WGKA 2OEDA 1F2RI 3R8BA 1I4QA 3MFGA 2J53A 1T3QA 1V1OA 1PFDA 3Q8BA 4ARCA 3GP7A 4A55A 1JCKB 3KLSX 4OZCA 1IGDA 2WP9B 4GLSC 1V1PB 3P4RB 3FAHA 2K5PA 2YEPF 4J3OD 2W55A 2CU3A 1HQRD 1TKEA 1CQVA 4JPSA 1HXYD 4JE3B 4N59A 2RPVA 2LEKA 1D5XC 1XCQL 3O13A 1JW9D 2E6XA 2N9KA 2HTME 3LB8C 1OQRA 4B0EA 1T5XD 1IGCA 2I2YA 1EM7A 1KTKA 2GRIA 2QMTA 3KWVA 3U2SC 4YTMB 3SFEB 4YTNB 3CIRB 1RYJA 3TEZA 1Q10A 3AEFB 3P4SB 1ZUD2 4RGOS 1XF5L 2FUG1 2VZKD 1HA5A 1FNVA 1L4ZB 3ZGZA 3BWUD 1C76A 1WXQA 5H92C 3V05A 3FC4A 1LO5D 2ZW1A 3NZ3A 3FILA 2DBYA 1FXAA 2W3SA 2Y3AA 3KWLA 3P63A 3AE5B 3AEBB 2D5GA 3BVZA 3SR6A 1FD6A 4OHJA 2PVOD 3AEDB 1NENB 5HHDG 1CK1A 1QILA 5EE3A 4P6VF 2JQRB 1WSPA 3Q8FA 4MH8A 1XO3A 1SE3A 1YN5A 2L52A 3N9YC 1L5PA 2L83A 2RDHA 2KDMA 2NMQA 3U52E 3AE8B 2BTEA 5FK9C 2X38A 2KMMA 2WNMA 5AUIA 1QT9A 3U7ZA 1TS2A 2IGDA 1XCTL 1P7EA 1SF0A 1QF6A 1A70A 2QSDA 1P7FA 1EWYC 2JYEA 2SEBD 2WXRA 1SBBB 1AW7A 2BS3B 2LMCA 1D5MC 2FBWB 3Q69A 3Q8CA 4LK0M 4ZRQA 5BYRA 1NYQA 4IOIE 1FCLA 3P4PB 4JWUC 1QQRA 1TKYA 1STEA 4A90A 1ENFA 1F0ZA 2WS3B 2W82A 5I4DA 2BYTA 3AE4B 1HZ6A 2K9XA 3GS2A 2IGHA 5FR3A 1N60A 4KGSA 1MHXA 3DWGC 3E9SA 3LYYA 3V3XA 5C2TB 1C4AA 1TS3A 4XWWA 1TY0A 1F2RC 1AWDA 1QOBA 4XDCA 1EU4A 4NZLB 4H2AA 1ZXHA 5FKAC 2WXGA 2FE8A 2PVGC 1I4PA 2SAKA 1ROEA 4TQ0A 4TQ1A 1HEZE 3W9CB 3AECB 3AV8A 1CZPA 1XLNA 4UDUC 3TEYA 2LHEA 3NVZA 4DXGA 1XLQA 2GI9A 1FFVA 1CJEA 2CJNA 1YJIA 1ET6A 2WDRB 1UGJA 3DWMA 1ZDXA 2ICIA 2R61A 3BK2A 3MHZA 1M4VA 1TYGB 2M56B 1K52A 3AMZA 4B0MA 4P16A 2JU6X 5MPOA 4WWMA 2KQ4X 2BT6A 3FILB 5G5GA 2J4XA 3BK1A 2BW2A 1SIJA 1FXIA 5H8YE 4RH6A 3TSSA 3W5UB 2K0PA 2QJLA 4L23A 4ZHPA 1JRPA 5BMHA 4AS1A 4WURA 1FMAD 3MC0B 4ZRPA 4R3DA 1VJKA 2V3PA 3NVWA 1GB1A 1J7BA 4Q2JA 2JSVX 4RCOA 4C56C 1C4PA 1B9RA 2N0SB 1YJJA 4ZOHC 1ACCA 2BS2B 2N9LA 2WU2B 1DYQA 1UWXA 2WLBA 2I38A 4O1NA 4XDDA 2PLPA 2DYMA 3NRZA 4LTUA 4XWTA 4US8A 3B2GA 4DQOC 5AUKA 4A6QA 2V4IB 1D5ZC 1ZP0B 4NAMA 4IKGA 2JXTA 2LGIA 3W1SA 4RGNA 1KFYB 3HVDA 2WDQB 4GDLB 2PTLA 2ACZB 3EA6A 2DWQA 2LFIA 1PUTA 1UNSA 1GB4A 4YSYB 4KGTA 2KN4A 1AYFA 2YEPB 5GXGB 1QLBB 1WRIA 1KH0A 1EU3A 2K22A 1ZPSA 2Y5PA 1TS4A 1I4XA 3HVZA 2WXIA 2J52A 5TSSA 2WXJA 5HG2A 1VR9A 2WXLA 1TZOA 4US9A 3AE9B 4YTPB 5D7GA 1PGAA 1JWUD 2RDGA 1OFFA 1E7PB 1SXTA 2MH7A 3L4PA 4HKQA 4MT5A 4OVZA 2XNAC 3TUOA 1RWSA 1N5XA 1T6BX 1E0ZA 1VDVA 2E3TA 4A8XC 4RNAA 3PO0A 1VLBA 2DLBA 2PW9A 4NAWB 1V97A 4ITKA 1K53A 3ZJTA 2JWUA 2WXMA 3AB5A 1D6EC 1L6VA 2ON8A 4GDKB 3VRBB 2JYTA 3ABVB 2AQ1B 1XLOA 2WXOA 2WXPA 1I4HA 1QOFA 1KLUD 1JQ4A 4OW0A 1FFUA 2WXHA 1I4GA 2IPKD 1YN3A 4KKIA 1QKZA 3T3OA 1F77A 2Y5CA 5T8IA 1JROA 1PYWD 2AQ2B 1R7SA 2MJ3A 3AE6B 1KF6B 3MJ5A 4YSZB 4ZHOA 4OZBA 2ONQA 1KLGD 3GB1A 1TY2A 3AE3B 1DOYA 4C7ZA 1ESFA 5HFYA 3I57A 4MACA 2KAJA 1DOXA 2MEKA 1C4CA 2JX5A 1FM0D 1ET9A 1Y56A 1RM6C 4HJGE 3VR9B 1N61A 4N58A 1AN8A 4HROA 1BMLC 2G9HD 4USAA 1JALA 5LNK1 3MP9A 3BVGA 1UWMA 3J9CA 4ZYSA 2NTSA 3B9JA 5BMIA 3RPFC 1C78A 1B1ZA 1NEKB 3BYYB 1NVID 4EE2A 4D2KA 5EE0A 1WWTA 1JWBD 1YN4A 1YMHE 2AX5A 2INPE 2QEJC 1E10A 3SFDB 4M0WA 3H8HA 1L4DB 2V3NA 1TKGA 4XE0A 3VQIA 1FCCC 2PKOA 5BYQA 5BYSA 4OZAA 1GOZA 1SJED 4LLGM 3ZQ4A 2M0AA 3IT4B 3WCQA 2N7JA 3P42A 4L1BA 1L0XB 1N63A 4NJCA 3TEWA 3AEGB 1JWAD 4REZA 1C9FA 1JMLA 2IGGA 2B76B 1C79A 2WQYB 3E56A 3EGRA 1KRHA 2BB5A 2BBCA 4RGMA 1IBXA 4YT0B 2CJOA 1NI3A 1IUEA 4IDIA 4YXDB 4RF0A 2QILA 4WAFA 1I7HA 2VZKB 3ZJVA 4PT5A 3ETRA 1QOGA 5EE9A 3SEBA 1NYRA 1V8CA 3VRAB 4HRSA 5EE1A 1ZE3D 1JWSD 2BS4B 1FNUA 2WXKA 3P1MA 2MJDA 2IJ0A 1QOAA 1PDXA 4A9AA 2G1EA 3BIID 2LJIA 3U4EG 2ZW0A 4YSXB 2H89B 2L32A 4TSSA 1SEBD 3IAM1 4CQNA 4DXFA 2WXQA 1EWCA 3KQ4A 4WQMA 1E9MA 3PZ7A 3BVMA 2EELA 4WH4A 4MM3B 1SSNA 1ZOYB 2GB1A 2WDVB 2JZPA 2BB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWG G;  4DQO C;  3U4E G;  3U2S C; 
#chains in the Genus database with same CATH topology
 1E5W A;  2GBN A;  2DZK A;  3CWI A;  4GIV A;  1XXG A;  1WE7 A;  4C7Y A;  3IBE A;  3HRD D;  3R2I A;  2WXN A;  3M95 A;  5DPT A;  1MI0 A;  2DX5 B;  2AL3 A;  3Q8E A;  5CHW A;  3IAS 1;  1M94 A;  3APD A;  2M19 A;  1TJE A;  1OTR B;  2C9W B;  1WX9 A;  2RDB C;  3R3M A;  2EKI A;  1HTO A;  3P4Q B;  2KTR A;  1ZXI A;  4HEA 1;  1WX8 A;  1ZKH A;  1SGH A;  2FCS A;  1JWM D;  3U7D A;  4M01 A;  2N9P C;  2Q5W D;  1TT5 B;  4B95 A;  4WIP A;  4ZRK A;  1IBX B;  3A4S C;  1LXD A;  1E6E B;  2VH1 A;  3PGE A;  1WXA A;  3N3K B;  2RMM A;  2JVC A;  1L0V B;  4RFB A;  1WI0 A;  1UUP A;  1HTQ A;  4A3P A;  2K39 A;  2IY1 B;  5C3J B;  1SE2 A;  5D3I B;  3AEE B;  2KVR A;  2WU5 B;  3IXS A;  1YOV B;  4KSL C;  1BUI C;  2ZVO A;  3NVV A;  3NOB A;  3SHQ A;  3OJ4 B;  3ZYY X;  2INN E;  3AU5 A;  3PPA A;  3VR8 B;  2FCQ A;  2DZI A;  1MVK A;  1UZX B;  1GG3 A;  4NAW A;  4RGT A;  4HKZ E;  3URY A;  4GXB A;  1F2R I;  3MFG A;  2J53 A;  3KLS X;  3ONS A;  4ICV A;  4X57 B;  4HLE A;  3FAH A;  2K5P A;  2YEP F;  1V5O A;  2FNJ B;  4IM3 A;  1CQV A;  1E7U A;  2PJH A;  4JE3 B;  4N59 A;  2RPV A;  2ZJD A;  4KZC A;  1XCQ L;  3MHS D;  1EF1 A;  2E6X A;  2N9K A;  4I6L B;  4B0E A;  3H7P B;  3DHH C;  2KFK A;  2GRI A;  3U2S C;  1GNU A;  2ZNV B;  3SFE B;  1ZW7 A;  3CIR B;  4YTN B;  3V62 A;  3TEZ A;  2L76 A;  1XF5 L;  2FUG 1;  1FNV A;  2MLB A;  3JSV B;  3ZGZ A;  3BWU D;  1C76 A;  1E7V A;  3V05 A;  3A9J A;  2LWP A;  4JIO U;  2DBY A;  2W3S A;  1T0Q C;  3ZDT A;  1WXS A;  3AU4 A;  2IBI B;  2KN5 A;  4IG7 B;  3VUY A;  5DCN A;  5E6N A;  2O2V A;  3DBL I;  3SR6 A;  3RNE C;  4C4V B;  2PVO D;  3AED B;  4I6N B;  2MBH A;  3IFW B;  3APF A;  4P6V F;  2JQR B;  1KM7 A;  2KC1 A;  2NPT B;  1L5P A;  4KIK A;  5L83 A;  3ZXR A;  5AZG A;  3AE8 B;  2AEH A;  1Y8R C;  2UWQ A;  1QT9 A;  3ZRF A;  4PS7 A;  4NJ6 A;  1A70 A;  4HPP A;  1EWY C;  3Q8C A;  3W1S C;  4ZRQ A;  3PHW B;  2J0J A;  1E90 A;  3P4P B;  1P3Q U;  1UF0 A;  2LVQ A;  4JQW C;  3AI5 A;  3QC8 B;  3GS2 A;  2MWS B;  3E9S A;  1C4A A;  3PVL A;  5BO4 B;  1R4N I;  2L0F A;  2GMI C;  2LGS A;  5IOI A;  2DZJ A;  1HEZ E;  4DK5 A;  2N7E A;  1CZP A;  1XLN A;  4UDU C;  2LHE A;  3DBR I;  2GI9 A;  3SU8 X;  1X1M A;  2QHO A;  2CJN A;  4NY0 A;  1YJI A;  1ET6 A;  3CF6 E;  1UGJ A;  4DDI D;  3VXW A;  1ZDX A;  1R4M I;  4FAD A;  2IO0 B;  4B0M A;  4WWM A;  1WGY A;  2MBB B;  3BK1 A;  1FXI A;  2EMT A;  3VTV A;  1I42 A;  3MC0 B;  4ZRP A;  5LXI B;  1G6J A;  4W9J A;  1GB1 A;  4Q2J A;  2JSV X;  4P1C C;  1YJJ A;  2KJ6 A;  4EZL A;  2NBV B;  3HIZ A;  2WU2 B;  1WMH B;  2LGD A;  2DYM A;  4IWO A;  5AUK A;  4W9H A;  1WXV A;  4A6Q A;  4WJP A;  2C7H A;  3MJW A;  1WH3 A;  3KH0 A;  3EA6 A;  1PUT A;  4KGT A;  3QIJ A;  4FJY A;  1WGH A;  2KO3 A;  5GXG B;  1QLB B;  3FKY A;  2J52 A;  5TSS A;  3CST A;  5HG2 A;  1VR9 A;  1TZO A;  2BYF A;  3DOW A;  1PGA A;  3WAP A;  2KHW B;  1SXT A;  2XEW A;  2NBW B;  3L4P A;  4HKQ A;  4QAY A;  3H1U A;  3QQ8 B;  4OVZ A;  3TUO A;  3A1Q B;  2WXM A;  3L17 A;  3DVN U;  1L6V A;  3EC8 A;  3W1Y A;  2JYT A;  2WXP A;  1I4H A;  1QOF A;  1WE6 A;  5IAA C;  4TUU A;  2WXH A;  3T3O A;  4KKI A;  2MX2 A;  1QKZ A;  3AE6 B;  3ZKJ C;  1P98 A;  3ZTD A;  4CYE A;  2KWC A;  2WGS A;  2BYV E;  2JX5 A;  3KYD D;  1RM6 C;  3V6C B;  1E8Y A;  1AN8 A;  1RLF A;  4HRO A;  2LRU A;  1BML C;  1JAL A;  5LNK 1;  3B9J A;  2D10 A;  1C78 A;  1B1Z A;  1NEK B;  1NVI D;  2BGF A;  2K8B A;  4EE2 A;  1YMH E;  2INP E;  2NS5 A;  5D6J B;  4MJS A;  2KQS A;  1SJE D;  2KX3 A;  3Q3F A;  4LLG M;  3ZQ4 A;  2M0A A;  3IT4 B;  3HK0 A;  1NBF C;  3Q3M C;  3VUX A;  3ZNI D;  3TEW A;  1C9F A;  2WQY B;  1WIA A;  1J8C A;  4MGK E;  1GC7 A;  4ANV A;  4YT0 B;  2CJO A;  1NI3 A;  4IDI A;  4HDQ A;  1XQQ A;  2N7D A;  3I5J C;  4PT5 A;  1V8C A;  3A9K A;  3L13 A;  1JWS D;  2BS4 B;  1FNU A;  3VTU A;  2L32 A;  3T9L A;  3PRZ A;  4TSS A;  4DXF A;  4K3C A;  2CHW A;  3BVM A;  3OG5 A;  1SSN A;  1ZOY B;  2JZP A;  2BB6 A;  2LHD A;  1YJ1 A;  5J17 A;  4DHJ D;  1GPX A;  1XEE A;  2N9X A;  1VZ6 A;  2WXF A;  1PGX A;  5BMG A;  3DDC B;  3NUH B;  1K50 A;  1VCB A;  3B08 A;  2NTT A;  1WGD A;  2MP2 A;  3GZN I;  3NHE B;  4LCD E;  3X23 A;  1N5W A;  2JZ3 B;  2BVC A;  2ZZP B;  2TSS A;  3BY4 B;  4MDK E;  1VRA B;  3VFK A;  2RGF A;  2OHF A;  3DVG Y;  4M0W B;  2O6V A;  3KUC B;  1BXT A;  1ZDV A;  1V5T A;  3AEA B;  1YQ3 B;  2G4D B;  1I4R A;  1T0R C;  2WWZ A;  4XYC A;  3I9V 1;  3TEX A;  2L1A A;  3AE2 B;  1LQB A;  1JRU A;  1P0R A;  2JY6 A;  3HHM A;  3RFZ B;  5D3D A;  2I1K A;  1IPG A;  4WJO A;  1J7C A;  3BYT B;  1AAR A;  5DPR A;  2LUM A;  3L54 A;  2D3A A;  2V0G A;  4IUM B;  2JXX A;  4I6P A;  3LXF A;  2L0T A;  2J0M A;  3C8Y A;  2RD0 A;  3OWE B;  5JXV A;  3N1Y C;  4WJQ A;  1C77 A;  4FJV B;  4W9I A;  3RT3 B;  2PMV A;  3L08 A;  1J7A A;  2PIA A;  2HDE A;  3NY5 A;  4PS3 A;  5CX3 A;  1WGK A;  4BBN F;  2OED A;  1PFD A;  1F1H A;  2M4N A;  3DBH I;  1UEL A;  2CR5 A;  1OEY A;  2DAJ A;  1WZ0 A;  2W55 A;  2KKC A;  1TKE A;  1A5R A;  4JPS A;  2LEK A;  3LJ3 A;  2NBU A;  3T8M A;  3C19 A;  2KVZ A;  2I2Y A;  4ANW A;  4YTM B;  2V3S A;  2DZM A;  4NQL B;  2VZK D;  2KTR B;  1L4Z B;  2KD0 A;  1WXQ A;  4EEW A;  2D07 B;  3IHP C;  1LO5 D;  3NZ3 A;  4LNF A;  4B9K A;  3FIL A;  2MBE A;  1ISN A;  2UU7 A;  3KWL A;  2JT4 B;  3IG3 A;  3AE5 B;  2D5G A;  3BVZ A;  3UF8 A;  1FD6 A;  4OHJ A;  1NEN B;  2CKH B;  2YVC A;  1WSP A;  2I1J A;  3DBL B;  1XO3 A;  2L52 A;  2KTF A;  1LFD A;  4M00 A;  3WA0 A;  2L83 A;  2RDH A;  2NMQ A;  3U52 E;  3PLU A;  2BTE A;  2BYE A;  5FK9 C;  1F9J A;  1TS2 A;  3R7R A;  1SF0 A;  2NCN A;  1QF6 A;  1OQY A;  2QSD A;  2JYE A;  1E0Z A;  1TZ1 A;  2WXR A;  2LUE A;  2R2Q A;  3Q69 A;  2IY0 B;  4XE0 A;  2FBW B;  1WFY A;  2FAZ A;  5BYR A;  1LGR A;  1MJD A;  1FCL A;  1WJ4 A;  1V86 A;  3VHT C;  2HE7 A;  1F0Z A;  1WM3 A;  2FID A;  2BYT A;  2WX0 A;  4W9L A;  3ZRC A;  2L7R A;  2ZCB A;  2X8X X;  1TBE A;  2WDT B;  2FCM A;  4KGS A;  1MHX A;  5C2T B;  1TS3 A;  4ICU A;  1F2R C;  3WAN A;  4K7U A;  2WXG A;  4HVB A;  3KUD B;  2HJ1 A;  1T0S C;  2SAK A;  1IP9 A;  1J19 A;  1R4N B;  2YLM A;  1CJE A;  3VAW A;  4GDK A;  3DBR B;  3A9J B;  1WJU A;  3DWM A;  4RM8 A;  4W9F A;  2ICI A;  3BK2 A;  3MHZ A;  1M4V A;  1TYG B;  2BKR B;  1TTN A;  3OLM D;  5MPO A;  3CMM B;  5G5G A;  5H8Y E;  3APC A;  2QJL A;  4ZYN A;  1WX7 A;  2O2V B;  4AOF A;  1D3Z A;  1FMA D;  4F1S A;  3N1X C;  2LGX A;  3NVW A;  3QAQ A;  4RCO A;  4KIK B;  2GLS A;  1B9R A;  2N0S B;  1SIF A;  4PYZ A;  4XZ4 A;  2OJR A;  4DHJ B;  3QK0 A;  3RYT A;  4O1N A;  2L05 A;  2PLP A;  2HTH A;  3B2G A;  4HWI B;  4KV2 A;  2CHZ A;  2L8J A;  1D5Z C;  4IKG A;  2JXT A;  3W1S A;  3N30 A;  1KFY B;  3HVD A;  2WDQ B;  2LFI A;  1WY8 A;  2DHZ A;  2KN4 A;  2PE9 A;  2O6V D;  3R7Q A;  1V80 A;  4M8M A;  1I4X A;  4HPL B;  2WXL A;  5CTR C;  3Q3O C;  4HPM B;  4K1R B;  1GJZ A;  3V6E B;  1JWU D;  1OFF A;  3PHX B;  2KYW A;  1SE9 A;  2XNA C;  1T6B X;  4BAX A;  1VDV A;  2E3T A;  3PO0 A;  2JF5 A;  4G11 A;  1V97 A;  1K53 A;  3ZJT A;  2FIF A;  2JWU A;  4URK A;  1RAX A;  3ABV B;  2AQ1 B;  1XLO A;  4TV3 A;  1FFU A;  3VH4 B;  4MSM B;  2AQ2 B;  4WWN A;  2MJ3 A;  1BT0 A;  1KLG D;  3GB1 A;  4ZDV A;  1ESF A;  5G55 A;  4MAC A;  2KAJ A;  1C4C A;  4DHZ E;  4G50 A;  5CHV C;  1FM0 D;  1ET9 A;  1Y56 A;  1T0Y A;  4AJY B;  5JH5 C;  3TIX A;  4FBJ B;  1UWM A;  3J9C A;  5JZE B;  5TR5 A;  4ZYS A;  5DPW A;  1KJT A;  1L7Y A;  3PSE B;  4LNI A;  1JWB D;  2AX5 A;  2QEJ C;  3GE8 C;  3SFD B;  2V3N A;  1TKG A;  3ML8 A;  3UGB B;  2ZNV C;  5HKH A;  4LNO A;  2NPT A;  1WXM A;  4FN2 A;  2FCN A;  3L0W B;  3KUZ A;  3WCQ A;  3H6N A;  4L1B A;  3V61 A;  2ZPN A;  3AEG B;  3GOE A;  4REZ A;  4OVV A;  1JML A;  2B76 B;  1C79 A;  2K8C A;  3EGR A;  1KRH A;  4F7Z A;  5KHQ A;  2UYZ B;  2XK5 A;  2KLC A;  2RR9 A;  4ANU A;  4RF0 A;  1V2Y A;  1I7H A;  3PT2 B;  2VZK B;  5EE9 A;  3RN9 C;  3M63 B;  2KLG A;  3VRA B;  3ZW3 A;  2BQQ A;  1ZE3 D;  2KJH B;  5EE1 A;  2QCZ A;  4KZ0 A;  4A9A A;  2D3C A;  4W9K A;  2H89 B;  1P9D U;  2CHX A;  3WIM A;  3IAM 1;  4CQN A;  3KQ4 A;  1E9M A;  1WR6 E;  2EEL A;  2GB1 A;  1XD3 B;  4RGM A;  1FRD A;  3AN1 A;  4HCN B;  1D4B A;  2KQ7 A;  3DVG X;  2IDY A;  3RUI B;  3WAL A;  2C7M B;  3PZ8 A;  4IM2 A;  2DEN B;  1FXT B;  3NS1 A;  1RFK A;  1DOI A;  2KK8 A;  1WJN A;  4W9D A;  1V1P A;  3NZS A;  4KX6 B;  2PEA A;  4FXC A;  3AXC A;  4IC7 B;  4GGQ A;  4N6E B;  3WAM A;  3B2F A;  4IWP A;  3ZJU A;  1K8R B;  2NR2 A;  2C7N B;  3GZN B;  2B3A A;  1FO4 A;  3KVF B;  2W54 A;  3RMK C;  1FRR A;  1PGB A;  3QAR A;  1SB3 C;  2DYO A;  2MQJ A;  4B6W A;  4W9G A;  4MJS B;  1L6U A;  2A4Z A;  4AWJ A;  4IW0 A;  1SE4 A;  5FR6 A;  4IWQ A;  1VZ8 A;  3IT6 B;  3W2D A;  1E8Z A;  3ALB A;  5HI1 A;  4NPN A;  5E6J A;  3QX1 A;  3AH7 A;  3OAW A;  5AEK B;  2JRH A;  4DHZ B;  4AQ7 A;  4KGR A;  3ML9 A;  4J6I A;  3A9K B;  4LJO B;  5G5H A;  1DGJ A;  1FIQ A;  2KAN A;  4XX5 A;  3RCZ A;  4W9E A;  4BFR A;  1N62 A;  4KKJ A;  3X0W A;  4PS8 A;  2N1V A;  4WWP A;  2KAC A;  4NJ7 A;  2K3U A;  4BBN C;  4DBG A;  2CS4 A;  4TKN A;  4XC2 A;  3Q8B A;  3M3J A;  3GP7 A;  4A55 A;  4E3C A;  4OZC A;  1IGD A;  2WP9 B;  5GMV A;  4FA6 A;  2AL6 A;  3DBH B;  3C0R B;  2CU3 A;  1YX6 B;  1HQR D;  2MP2 B;  1E8X A;  1HXY D;  1VD2 A;  2XBB C;  1YD8 U;  2HTM E;  1OQR A;  2VRR B;  2IO1 B;  4FLH A;  4RMA A;  1T5X D;  4EZJ A;  4BOS C;  1EM7 A;  1KTK A;  1H4R A;  2O6V B;  2QMT A;  3VDZ A;  3KWV A;  1MG4 A;  2N9E B;  1UBI A;  5E6O A;  1ZUD 2;  2V1Y A;  4BKT A;  1Z5S B;  1HA5 A;  4IM0 A;  2Y5B B;  3PV1 A;  1V49 A;  3FC4 A;  4E74 A;  2DAF A;  1H8C A;  3R66 C;  4AP4 C;  3DPD A;  3I63 C;  2Y3A A;  3RNG C;  3P63 A;  1WRD B;  4LNN A;  3AEB B;  3U30 A;  3IVF A;  5HHD G;  1CK1 A;  3CSF A;  5EE3 A;  2W9N A;  2LJ5 A;  1YN5 A;  2KMA A;  2FUH B;  4S0R A;  2QDF A;  4AUQ C;  2X38 A;  3QCA A;  5AUI A;  3U7Z A;  1QZE A;  2QC8 A;  1KOT A;  1XCT L;  1C3T A;  1P7E A;  2KNB A;  3H9D A;  1P7F A;  1U4A A;  2GBR A;  3MC9 A;  2LMC A;  2GBK A;  4LK0 M;  4IOI E;  4GDL A;  2ZVN A;  4BZA A;  1QQR A;  1STE A;  4A90 A;  1ENF A;  2WS3 B;  2PPH A;  3PZD A;  1HZ6 A;  2K9X A;  4GN1 A;  4MGI E;  4ZRJ A;  1N60 A;  4ANX A;  3V3X A;  1TY0 A;  1AWD A;  3TMP B;  1OGW A;  4NZL B;  1ZXH A;  5FKA C;  2Z0D B;  2V4L A;  2D3B A;  3RZW C;  2FE8 A;  3OJ3 A;  2WYQ A;  4TQ0 A;  1WJ6 A;  3W9C B;  1YQB A;  3AEC B;  3AV8 A;  2MBO A;  3EHV A;  4JL9 A;  3VUW A;  3NVZ A;  1XLQ A;  5KHO A;  4JGH B;  2K8H A;  2WDR B;  1V6E A;  1J0G A;  3O65 B;  2M56 B;  3AMZ A;  3UQB A;  4P16 A;  2JU6 X;  2KQ4 X;  2BT6 A;  2G4S A;  3FIL B;  2J4X A;  4ACF A;  2MBQ A;  2JUO A;  2BW2 A;  1SIJ A;  4RH6 A;  4XGA B;  4ZHP A;  1JRP A;  3PRE A;  3VTW A;  4R3D A;  2GBJ A;  2ZEQ A;  1NI2 A;  1WM2 A;  4C56 C;  1C4P A;  4BOZ B;  4ZOH C;  3P2B A;  5IO9 A;  1ACC A;  2L3Z A;  2WLB A;  2JWZ A;  3RNB C;  4M8N A;  2MCN B;  1GC6 A;  3A4R A;  2V4I B;  4NAM A;  2M8S A;  2LGI A;  4RGN A;  2PTL A;  2ACZ B;  2LXC A;  2DWQ A;  4FHJ A;  3BIN A;  4N9F 4;  1GB4 A;  4WJN A;  1AYF A;  1V81 A;  1WRI A;  3Q3N C;  3ZNG C;  4BKS A;  2Y5P A;  2KMC A;  1TS4 A;  2WXI A;  2WXJ A;  4HXD A;  3PTF C;  2RDG A;  1E7P B;  2MH7 A;  4K81 A;  3GE3 C;  3DVN V;  4A8X C;  4RNA A;  2DLB A;  4NAW B;  4ITK A;  4GB9 A;  1IYF A;  2Z0E B;  1L2N A;  4GDK B;  3TJP A;  3NJT A;  1TIF A;  2KC2 A;  2WXO A;  2KFJ A;  2BWE S;  3B0A A;  5J2R A;  1KLU D;  4MM3 A;  1JQ4 A;  4OW0 A;  1UBQ A;  2IPK D;  4FUL A;  1YN3 A;  2Y5C A;  4ZHO A;  4P1B C;  3MJ5 A;  1KF6 B;  4OZB A;  4A3O A;  1TY2 A;  3AE3 B;  4BVU C;  3I57 A;  3A33 B;  2MEK A;  3QJZ A;  3RD2 A;  1EF5 A;  3NZU A;  2KFK B;  5E6P A;  1YIW A;  2G9H D;  3BVG A;  1RRB A;  5BMI A;  2NTS A;  4ZRI A;  3BYY B;  4D2K A;  1YN4 A;  5AZF A;  1C1Y B;  3H8H A;  2LZ6 A;  2LD9 A;  2PKO A;  2IO2 B;  4LDT D;  5BYS A;  3AUL A;  2ZPY A;  2KDF B;  3QHT A;  2N7J A;  3P42 A;  1UH6 A;  4HCP B;  3NG0 A;  1R4M B;  3RUL A;  4NQK E;  3UIN B;  2J0K A;  2M0X A;  4S17 A;  3I3T B;  3E56 A;  5LXH A;  1YX5 B;  2BB5 A;  2K6Q A;  1IBX A;  4K7S A;  3S2A A;  1IUE A;  4YXD B;  4PYU A;  2QIL A;  3VH3 B;  4WAF A;  3ZJV A;  4NNJ B;  3ETR A;  3Q6B A;  2C60 A;  2D3G A;  4HRS A;  3K9O B;  3ZLZ A;  3P1M A;  2MJD A;  2IJ0 A;  1QOA A;  2JZZ A;  4II3 B;  4EFO A;  5L95 C;  2N1W A;  2KXJ A;  3JW0 X;  3TCA A;  1EWC A;  4WQM A;  4WH4 A;  2WDV B;  1MPE A;  1UGM A;  3ENE A;  2AQ3 B;  3RZF A;  2GBM A;  2XN9 C;  2KDI A;  3ZTC A;  3VVW B;  4TMA B;  3HUI A;  2MJE A;  4DWF A;  3RNF C;  5CHF A;  3AM9 A;  4WQO B;  2J7Q B;  3N20 C;  2JRI B;  1FNW A;  2J42 A;  3UI3 A;  2V9H A;  2W3R A;  5C23 A;  3B1L X;  3H7P A;  3Q8A A;  2IZV B;  3PRM B;  4A20 A;  3Q14 C;  1XLP A;  2KWV B;  4C80 A;  3DCG A;  3NVY A;  5J18 A;  2L00 B;  1MHH E;  4MGZ E;  3T3N A;  4RF1 A;  3NS8 A;  4ARI A;  3JSV A;  3EUB 2;  1FEH A;  1HE8 A;  3BZD B;  2KX0 A;  3PRP B;  4WWO A;  1V9J A;  3DBS A;  4BKG A;  2BPS A;  2D2Q A;  1OQQ A;  2XK5 B;  3U8Z A;  3AE1 B;  2AWT A;  2OJW A;  3AE7 B;  5AZH A;  2KWD A;  4YWG G;  2K25 A;  2Z8L A;  4JWS C;  2GOW A;  1OEY J;  3DQV A;  5C1Z A;  4C4V A;  1YNT E;  1HZ5 A;  1YQ4 B;  1TGZ B;  1N6Z A;  1K51 A;  3W5V B;  3WAO A;  1L0Y B;  2QIE B;  1TS5 A;  2H88 B;  2KJR A;  1WZ3 A;  1WYG A;  4II2 B;  5IN7 A;  4C00 A;  1GAQ B;  4JX1 C;  1VZ7 A;  1SJH D;  3R2T A;  4K3B A;  4L2Y A;  3L16 A;  3UQA A;  2KZR A;  4KDI C;  2ASQ A;  3R8B A;  1I4Q A;  1Q1O A;  1T3Q A;  1V1O A;  4ARC A;  1JCK B;  1WGR A;  2DNF A;  4GLS C;  2ZCC A;  1V1P B;  3P4R B;  5IP4 D;  4J3O D;  4OVU A;  4YL8 A;  1D5X C;  3O13 A;  3ZO5 B;  4HJK A;  4JLC A;  1JW9 D;  2PE6 B;  2LVO A;  3LB8 C;  1IGC A;  2EKE C;  1Z2M A;  2MSE D;  4BKS D;  2WX1 A;  1I35 A;  1RYJ A;  1Q10 A;  1GUA B;  2C5L C;  3AEF B;  3P4S B;  4RGO S;  5H92 C;  4MH0 E;  2CU1 A;  3DHG C;  2M17 A;  4HDO A;  4KSK C;  2ZW1 A;  3EFU A;  4P7I A;  1FXA A;  2VH2 A;  2BKF A;  2MW5 A;  2RSU A;  1NDD A;  2MHJ A;  1QIL A;  3Q8F A;  4MH8 A;  1SE3 A;  3N9Y C;  2N4F A;  2INC C;  2KDM A;  2KMM A;  2WNM A;  1WMH A;  2IGD A;  2LXA A;  2SEB D;  1SBB B;  1AW7 A;  2BS3 B;  1D5M C;  3KW5 B;  1NYQ A;  4KDL B;  3Q3J A;  2IYD B;  4JWU C;  1TKY A;  2NVU I;  5D2M B;  3JVZ X;  4EKU A;  2W82 A;  5I4D A;  3EFC A;  3AE4 B;  5LLI A;  1E8W A;  2IGH A;  3ZVV A;  5FR3 A;  4LDT B;  2LRW A;  3DWG C;  3LYY A;  4XWW A;  2KOX A;  5IA7 A;  4E71 A;  1QOB A;  4XDC A;  1EU4 A;  4H2A A;  2A5U A;  3RI7 C;  3DHI C;  2PVG C;  1I4P A;  4RM9 A;  1ROE A;  4TQ1 A;  5JHB A;  2IO3 B;  2OOB B;  5IKC M;  3TEY A;  4DXG A;  1FFV A;  3A1Q A;  1Q5W B;  1P1A A;  4PK1 A;  4F8C B;  3ZXV A;  1UD7 A;  2R61 A;  1K52 A;  2LGY A;  4K7W A;  3ZDM C;  2RPQ A;  2KT7 A;  3W5U B;  3TSS A;  3SDL C;  2K0P A;  3MTN B;  4GSW A;  4L23 A;  3PS6 A;  5DPS A;  5BMH A;  3EEC A;  4AS1 A;  4WUR A;  2LAS A;  1VJK A;  2LVP A;  2V3P A;  1J7B A;  3SD5 A;  4EOY A;  2BS2 B;  2N9L A;  1DYQ A;  1UWX A;  2I38 A;  4XDD A;  1S1Q B;  3K9P B;  3NRZ A;  4MGY E;  4LTU A;  4XWT A;  4US8 A;  3QWZ B;  4DQO C;  4LJP B;  3ZUN A;  3ZNH B;  3LDZ E;  2Z59 B;  4ASW C;  1ZP0 B;  5EDS A;  1WYW B;  1F52 A;  4GDL B;  1UNS A;  4M02 A;  4YSY B;  3ZIM A;  2YEP B;  4CHK A;  1KH0 A;  1EU3 A;  1Q0W B;  2K22 A;  1S3S G;  4G3X B;  4GOC A;  1ZPS A;  3V60 A;  3HVZ A;  5G2N A;  2LI5 A;  4US9 A;  3AE9 B;  4YTP B;  5D7G A;  2MRP A;  2HD5 B;  2EMS A;  3KYC D;  4WAA A;  2DYB A;  2K6D B;  3ZNZ B;  3RNA C;  4MT5 A;  1RWS A;  1N5X A;  2AYO B;  4KVG B;  1KLV A;  1VLB A;  2PW9 A;  3MC8 A;  1WF9 A;  3AB5 A;  1D6E C;  2ON8 A;  3VRB B;  3TL5 A;  1EUV B;  3ECI A;  4W9C A;  2KDB A;  3UIP B;  4FJZ A;  1I4G A;  2JPH A;  1F77 A;  5T8I A;  1MG8 A;  1JRO A;  1PYW D;  1PQS A;  1R7S A;  4YSZ B;  2KWU B;  2ONQ A;  1DOY A;  4C7Z A;  2WHI A;  5HFY A;  4MEL A;  4LNK A;  1DOX A;  2IND C;  4HJG E;  3VR9 B;  1N61 A;  4N58 A;  4DDG D;  1EO6 A;  2BWF A;  4USA A;  3MP9 A;  4CO7 A;  3N32 A;  2G45 B;  4HK2 A;  3HM6 X;  3JYU A;  3RPF C;  1WGG A;  3HM3 A;  5EE0 A;  1WWT A;  1E10 A;  5JHA A;  4M0W A;  1L4D B;  3VQI A;  1FCC C;  1RFA A;  2MA9 B;  5BYQ A;  1ZGU B;  4OZA A;  1GOZ A;  2K1F A;  3Q2A C;  1L0X B;  1LM8 B;  2BF8 B;  4DXA B;  1CMX B;  3H7S A;  1N63 A;  4NJC A;  2REX A;  4G0N B;  1JWA D;  2IGG A;  2R2O A;  2D11 A;  4FHK A;  3RNC C;  3N1Z C;  2HJ8 A;  2BBC A;  3UIO B;  2G3Q B;  3TBL D;  1QOG A;  3SEB A;  1NYR A;  1WR1 A;  4EZK A;  1XT9 B;  3L10 B;  1FPY A;  5D94 A;  2WXK A;  2M1M A;  3PLV A;  1PDX A;  3M62 B;  4GMV A;  2G1E A;  3BII D;  2LJI A;  3U4E G;  2ZW0 A;  4YSX B;  4GU2 A;  3D32 A;  4EUT A;  1MFW A;  2KDE B;  3QA8 A;  4MSQ B;  1SEB D;  2WXQ A;  3PZ7 A;  4MEM A;  4MM3 B;  4AJW A; 
#chains in the Genus database with same CATH homology
 2LHD A;  1FRD A;  3AN1 A;  1D4B A;  1MPE A;  3CWI A;  2IDY A;  1XXG A;  2AQ3 B;  4C7Y A;  2XN9 C;  3HRD D;  3PZ8 A;  3R2I A;  1GPX A;  1XEE A;  2WXN A;  3NS1 A;  1VZ6 A;  1RFK A;  1DOI A;  4TMA B;  2WXF A;  3HUI A;  1PGX A;  1V1P A;  5BMG A;  2MJE A;  4KX6 B;  3NUH B;  1MI0 A;  3AM9 A;  1K50 A;  4FXC A;  2NTT A;  4N6E B;  1N5W A;  1FNW A;  2J42 A;  2TSS A;  3B2F A;  3UI3 A;  3ZJU A;  3Q8E A;  2W3R A;  1VRA B;  3Q8A A;  3IAS 1;  1FO4 A;  2W54 A;  1FRR A;  1PGB A;  1SB3 C;  2DYO A;  2OHF A;  1XLP A;  2M19 A;  1TJE A;  4C80 A;  1L6U A;  3NVY A;  1BXT A;  1ZDV A;  1SE4 A;  2EKI A;  1MHH E;  1VZ8 A;  3AEA B;  1YQ3 B;  3IT6 B;  3W2D A;  3T3N A;  1I4R A;  4RF1 A;  3P4Q B;  1ZXI A;  4ARI A;  4HEA 1;  3EUB 2;  1FEH A;  3BZD B;  3I9V 1;  3TEX A;  2L1A A;  3AE2 B;  1JWM D;  5HI1 A;  2Q5W D;  4WIP A;  5E6J A;  1IBX B;  1OQQ A;  3AE1 B;  1E6E B;  3AE7 B;  3AH7 A;  3RFZ B;  5D3D A;  2KWD A;  4YWG G;  2RMM A;  1L0V B;  1J7C A;  2Z8L A;  4JWS C;  4AQ7 A;  4KGR A;  4RFB A;  3BYT B;  1UUP A;  2LUM A;  1YNT E;  1HZ5 A;  1YQ4 B;  5G5H A;  1DGJ A;  1FIQ A;  5C3J B;  2V0G A;  1SE2 A;  5D3I B;  1K51 A;  3AEE B;  3LXF A;  3W5V B;  2WU5 B;  1L0Y B;  2QIE B;  3IXS A;  1TS5 A;  1BUI C;  3C8Y A;  3NVV A;  1N62 A;  2H88 B;  3OWE B;  4KKJ A;  5JXV A;  3ZYY X;  1WYG A;  1C77 A;  2INN E;  3VR8 B;  1MVK A;  1GAQ B;  4JX1 C;  2PMV A;  2KAC A;  1VZ7 A;  1J7A A;  2PIA A;  1SJH D;  3R2T A;  2HDE A;  4L2Y A;  2K3U A;  4RGT A;  4HKZ E;  3URY A;  1WGK A;  2OED A;  1F2R I;  3R8B A;  1I4Q A;  3MFG A;  2J53 A;  1T3Q A;  1V1O A;  1PFD A;  3Q8B A;  4ARC A;  3GP7 A;  4A55 A;  1JCK B;  3KLS X;  4OZC A;  1IGD A;  2WP9 B;  4GLS C;  1V1P B;  3P4R B;  3FAH A;  2K5P A;  2YEP F;  4J3O D;  2W55 A;  2CU3 A;  1HQR D;  1TKE A;  1CQV A;  4JPS A;  1HXY D;  4JE3 B;  4N59 A;  2RPV A;  2LEK A;  1D5X C;  1XCQ L;  3O13 A;  1JW9 D;  2E6X A;  2N9K A;  2HTM E;  3LB8 C;  1OQR A;  4B0E A;  1T5X D;  1IGC A;  2I2Y A;  1EM7 A;  1KTK A;  2GRI A;  2QMT A;  3KWV A;  3U2S C;  4YTM B;  3SFE B;  4YTN B;  3CIR B;  1RYJ A;  3TEZ A;  1Q10 A;  3AEF B;  3P4S B;  1ZUD 2;  4RGO S;  1XF5 L;  2FUG 1;  2VZK D;  1HA5 A;  1FNV A;  1L4Z B;  3ZGZ A;  3BWU D;  1C76 A;  1WXQ A;  5H92 C;  3V05 A;  3FC4 A;  1LO5 D;  2ZW1 A;  3NZ3 A;  3FIL A;  2DBY A;  1FXA A;  2W3S A;  2Y3A A;  3KWL A;  3P63 A;  3AE5 B;  3AEB B;  2D5G A;  3BVZ A;  3SR6 A;  1FD6 A;  4OHJ A;  2PVO D;  3AED B;  1NEN B;  5HHD G;  1CK1 A;  1QIL A;  5EE3 A;  4P6V F;  2JQR B;  1WSP A;  3Q8F A;  4MH8 A;  1XO3 A;  1SE3 A;  1YN5 A;  2L52 A;  3N9Y C;  1L5P A;  2L83 A;  2RDH A;  2KDM A;  2NMQ A;  3U52 E;  3AE8 B;  2BTE A;  5FK9 C;  2X38 A;  2KMM A;  2WNM A;  5AUI A;  1QT9 A;  3U7Z A;  1TS2 A;  2IGD A;  1XCT L;  1P7E A;  1SF0 A;  1QF6 A;  1A70 A;  2QSD A;  1P7F A;  1EWY C;  2JYE A;  2SEB D;  2WXR A;  1SBB B;  1AW7 A;  2BS3 B;  2LMC A;  1D5M C;  2FBW B;  3Q69 A;  3Q8C A;  4LK0 M;  4ZRQ A;  5BYR A;  1NYQ A;  4IOI E;  1FCL A;  3P4P B;  4JWU C;  1QQR A;  1TKY A;  1STE A;  4A90 A;  1ENF A;  1F0Z A;  2WS3 B;  2W82 A;  5I4D A;  2BYT A;  3AE4 B;  1HZ6 A;  2K9X A;  3GS2 A;  2IGH A;  5FR3 A;  1N60 A;  4KGS A;  1MHX A;  3DWG C;  3E9S A;  3LYY A;  3V3X A;  5C2T B;  1C4A A;  1TS3 A;  4XWW A;  1TY0 A;  1F2R C;  1AWD A;  1QOB A;  4XDC A;  1EU4 A;  4NZL B;  4H2A A;  1ZXH A;  5FKA C;  2WXG A;  2FE8 A;  2PVG C;  1I4P A;  2SAK A;  1ROE A;  4TQ0 A;  4TQ1 A;  1HEZ E;  3W9C B;  3AEC B;  3AV8 A;  1CZP A;  1XLN A;  4UDU C;  3TEY A;  2LHE A;  3NVZ A;  4DXG A;  1XLQ A;  2GI9 A;  1FFV A;  1CJE A;  2CJN A;  1YJI A;  1ET6 A;  2WDR B;  1UGJ A;  3DWM A;  1ZDX A;  2ICI A;  2R61 A;  3BK2 A;  3MHZ A;  1M4V A;  1TYG B;  2M56 B;  1K52 A;  3AMZ A;  4B0M A;  4P16 A;  2JU6 X;  5MPO A;  4WWM A;  2KQ4 X;  2BT6 A;  3FIL B;  5G5G A;  2J4X A;  3BK1 A;  2BW2 A;  1SIJ A;  1FXI A;  5H8Y E;  4RH6 A;  3TSS A;  3W5U B;  2K0P A;  2QJL A;  4L23 A;  4ZHP A;  1JRP A;  5BMH A;  4AS1 A;  4WUR A;  1FMA D;  3MC0 B;  4ZRP A;  4R3D A;  1VJK A;  2V3P A;  3NVW A;  1GB1 A;  1J7B A;  4Q2J A;  2JSV X;  4RCO A;  4C56 C;  1C4P A;  1B9R A;  2N0S B;  1YJJ A;  4ZOH C;  1ACC A;  2BS2 B;  2N9L A;  2WU2 B;  1DYQ A;  1UWX A;  2WLB A;  2I38 A;  4O1N A;  4XDD A;  2PLP A;  2DYM A;  3NRZ A;  4LTU A;  4XWT A;  4US8 A;  3B2G A;  4DQO C;  5AUK A;  4A6Q A;  2V4I B;  1D5Z C;  1ZP0 B;  4NAM A;  4IKG A;  2JXT A;  2LGI A;  3W1S A;  4RGN A;  1KFY B;  3HVD A;  2WDQ B;  4GDL B;  2PTL A;  2ACZ B;  3EA6 A;  2DWQ A;  2LFI A;  1PUT A;  1UNS A;  1GB4 A;  4YSY B;  4KGT A;  2KN4 A;  1AYF A;  2YEP B;  5GXG B;  1QLB B;  1WRI A;  1KH0 A;  1EU3 A;  2K22 A;  1ZPS A;  2Y5P A;  1TS4 A;  1I4X A;  3HVZ A;  2WXI A;  2J52 A;  5TSS A;  2WXJ A;  5HG2 A;  1VR9 A;  2WXL A;  1TZO A;  4US9 A;  3AE9 B;  4YTP B;  5D7G A;  1PGA A;  1JWU D;  2RDG A;  1OFF A;  1E7P B;  1SXT A;  2MH7 A;  3L4P A;  4HKQ A;  4MT5 A;  4OVZ A;  2XNA C;  3TUO A;  1RWS A;  1N5X A;  1T6B X;  1E0Z A;  1VDV A;  2E3T A;  4A8X C;  4RNA A;  3PO0 A;  1VLB A;  2DLB A;  2PW9 A;  4NAW B;  1V97 A;  4ITK A;  1K53 A;  3ZJT A;  2JWU A;  2WXM A;  3AB5 A;  1D6E C;  1L6V A;  2ON8 A;  4GDK B;  3VRB B;  2JYT A;  3ABV B;  2AQ1 B;  1XLO A;  2WXO A;  2WXP A;  1I4H A;  1QOF A;  1KLU D;  1JQ4 A;  4OW0 A;  1FFU A;  2WXH A;  1I4G A;  2IPK D;  1YN3 A;  4KKI A;  1QKZ A;  3T3O A;  1F77 A;  2Y5C A;  5T8I A;  1JRO A;  1PYW D;  2AQ2 B;  1R7S A;  2MJ3 A;  3AE6 B;  1KF6 B;  3MJ5 A;  4YSZ B;  4ZHO A;  4OZB A;  2ONQ A;  1KLG D;  3GB1 A;  1TY2 A;  3AE3 B;  1DOY A;  4C7Z A;  1ESF A;  5HFY A;  3I57 A;  4MAC A;  2KAJ A;  1DOX A;  2MEK A;  1C4C A;  2JX5 A;  1FM0 D;  1ET9 A;  1Y56 A;  1RM6 C;  4HJG E;  3VR9 B;  1N61 A;  4N58 A;  1AN8 A;  4HRO A;  1BML C;  2G9H D;  4USA A;  1JAL A;  5LNK 1;  3MP9 A;  3BVG A;  1UWM A;  3J9C A;  4ZYS A;  2NTS A;  3B9J A;  5BMI A;  3RPF C;  1C78 A;  1B1Z A;  1NEK B;  3BYY B;  1NVI D;  4EE2 A;  4D2K A;  5EE0 A;  1WWT A;  1JWB D;  1YN4 A;  1YMH E;  2AX5 A;  2INP E;  2QEJ C;  1E10 A;  3SFD B;  4M0W A;  3H8H A;  1L4D B;  2V3N A;  1TKG A;  4XE0 A;  3VQI A;  1FCC C;  2PKO A;  5BYQ A;  5BYS A;  4OZA A;  1GOZ A;  1SJE D;  4LLG M;  3ZQ4 A;  2M0A A;  3IT4 B;  3WCQ A;  2N7J A;  3P42 A;  4L1B A;  1L0X B;  1N63 A;  4NJC A;  3TEW A;  3AEG B;  1JWA D;  4REZ A;  1C9F A;  1JML A;  2IGG A;  2B76 B;  1C79 A;  2WQY B;  3E56 A;  3EGR A;  1KRH A;  2BB5 A;  2BBC A;  4RGM A;  1IBX A;  4YT0 B;  2CJO A;  1NI3 A;  1IUE A;  4IDI A;  4YXD B;  4RF0 A;  2QIL A;  4WAF A;  1I7H A;  2VZK B;  3ZJV A;  4PT5 A;  3ETR A;  1QOG A;  5EE9 A;  3SEB A;  1NYR A;  1V8C A;  3VRA B;  4HRS A;  5EE1 A;  1ZE3 D;  1JWS D;  2BS4 B;  1FNU A;  2WXK A;  3P1M A;  2MJD A;  2IJ0 A;  1QOA A;  1PDX A;  4A9A A;  2G1E A;  3BII D;  2LJI A;  3U4E G;  2ZW0 A;  4YSX B;  2H89 B;  2L32 A;  4TSS A;  1SEB D;  3IAM 1;  4CQN A;  4DXF A;  2WXQ A;  1EWC A;  3KQ4 A;  4WQM A;  1E9M A;  3PZ7 A;  3BVM A;  2EEL A;  4WH4 A;  4MM3 B;  1SSN A;  1ZOY B;  2GB1 A;  2WDV B;  2JZP A;  2BB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...