3U2SC

Crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
116
structure length
90
Chain Sequence
TTFKLAACVTLACTRVKHCSFNITTDVKDRKQKVNATFYDLYRLISCQTTTTEAVDAATAAKVFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PG9 heavy chain
total genus 16
structure length 90
sequence length 116
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.790 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3u2sC00
3U4EG 4DQOC 4YWGG 3U2SC
chains in the Genus database with same CATH superfamily
3VXWA 2QIEB 3RZWC 5IKCM 4GOCA 5TR5A 2X38A 2FUG1 3RNEC 1LM8B 4AUQC 2XBBC 4IWQA 4ARCA 1TJEA 4MACA 2GRIA 4KIKB 5C23A 4N59A 4EUTA 4WIPA 1V9JA 1SE4A 2WGSA 4LK0M 1ROEA 2BS3B 3BWUD 1AN8A 3LXFA 3AE3B 2LFIA 3VH3B 2IPKD 3T3NA 1WYGA 1WM2A 5T8IA 3IFWB 4E74A 1KFYB 2MBOA 3RZFA 3ZJTA 3FILA 3AULA 4RFBA 2MWSB 4IM2A 2RD0A 4NZLB 3L54A 4MJSA 1YD8U 1N63A 4ACFA 2D3GA 1Q5WB 1MG4A 2BYVE 1WJ6A 2JXXA 4F8CB 2DZIA 3PO0A 1EF1A 2PLPA 1F9JA 5BYSA 1V5OA 2Y3AA 2WXRA 2L0TA 2PVOD 3JW0X 1GNUA 3P42A 4HK2A 5FK9C 5KHOA 2HTHA 4YSYB 3KUCB 3RT3B 1N5XA 2Z0DB 3DPDA 3MHZA 4GDLA 2RSUA 1WY8A 3VRBB 1FMAD 3U7ZA 2JQRB 1QOGA 1WMHB 5J2RA 2DYMA 5GXGB 3H1UA 2DAFA 3P63A 4TSSA 5H8YE 2KKCA 1VCBA 3AXCA 1E9MA 5BO4B 3NJTA 5CHFA 3O65B 2PE9A 2ZEQA 2MBEA 1TS2A 4YTPB 3A9JA 2IY0B 1GB4A 1WMHA 4JPSA 1R4NI 3EECA 4RF1A 2BKFA 4S0RA 1CZPA 3W5UB 2Z0EB 1V80A 2JWUA 2LXAA 2Q5WD 1L7YA 4MDKE 3IAM1 2XEWA 5D3DA 2KWVB 4GLSC 3R7QA 1L6VA 1CQVA 2N7JA 2J0KA 1QLBB 3EC8A 3N1ZC 2M0AA 4DBGA 4LNNA 3UIOB 3ETRA 4PS8A 1I4QA 2LXCA 2MJ3A 4K1RB 1V2YA 1C78A 1C79A 1TZOA 1U4AA 2DNFA 1RRBA 3IAS1 1YOVB 1P1AA 3UIPB 1QOAA 1E7PB 1YMHE 2K6DB 4OZBA 2KLGA 1SJHD 4RM8A 2UWQA 4HLEA 2JRHA 4B0EA 4NJ6A 5IN7A 4EOYA 3AMZA 3WAOA 2LZ6A 3EA6A 4WJPA 5C1ZA 3Q6BA 4MELA 2V4LA 3T8MA 2M19A 3VFKA 2KQ7A 3HVDA 1FCCC 2KDBA 4M0WB 1J7BA 2NTTA 1HQRD 1D3ZA 3WAMA 1JWMD 4CQNA 1C4CA 2N9EB 2KMAA 1E5WA 3BVGA 4GN1A 2ZPYA 3P4SB 1RFKA 4KKIA 4XDCA 5BMIA 2GOWA 3AI5A 1JWBD 2L7RA 3DHGC 3PT2B 2N1VA 3B0AA 3JSVA 2MJEA 1DYQA 4FA6A 4B95A 1AWDA 5BMHA 1MI0A 2K22A 4BOSC 4KGTA 3V60A 1K52A 3NG0A 1IBXB 2IO0B 1D5MC 3I63C 2KT7A 2VZKB 3RNGC 2K0PA 1YX5B 2GBKA 4YL8A 1ESFA 5HHDG 1QT9A 4JGHB 1EWYC 3OJ4B 1WGHA 1UD7A 2QSDA 2LRWA 1L0VB 1I4GA 1UGJA 1ZDXA 1HTOA 4W9IA 1VZ7A 4LJOB 2L8JA 1UZXB 4AQ7A 4ANWA 2LVPA 3R2TA 3AEDB 1TT5B 3Q8CA 2GBNA 1N62A 3L4PA 5J17A 4A55A 2HJ1A 3N32A 4HDQA 2E3TA 4A3PA 1QF6A 2WX0A 1FEHA 2KWUB 4J6IA 4KSKC 5E6OA 4HKQA 1WR1A 3DBRB 3SFDB 1S3SG 2WXKA 1FCLA 4ZDVA 4XDDA 2MW5A 1FXIA 4I6PA 3DHIC 3AECB 2E6XA 3RFZB 3N9YC 2N1WA 4W9DA 2KMMA 4M00A 3UQAA 4PS7A 2IYDB 3C19A 3Q8EA 3N1XC 1NVID 1IUEA 1SBBB 3V6EB 1HA5A 1JALA 3AU5A 3DBSA 3B2FA 4G0NB 1ISNA 3NVZA 4OVZA 4NJ7A 3UGBB 2JXTA 3V05A 1MVKA 3L0WB 1WWTA 3N30A 1WYWB 1KLUD 2WDVB 4XE0A 2KQ4X 3O13A 2KWCA 3SDLC 4AP4C 2PE6B 4GMVA 3VR9B 4Q2JA 5DPRA 1C1YB 4K3BA 2J7QB 1E8YA 1Q10A 2V0GA 3DBRI 1JWUD 4M01A 3H7PB 4MH8A 4R3DA 4WWPA 2K8CA 4I6LB 1J19A 3VHTC 3A9KA 1F1HA 4GXBA 1E8ZA 3E56A 3TMPB 1EWCA 2L0FA 1SEBD 1WX7A 2VH1A 5FKAC 2K3UA 2KAJA 1FM0D 4HPLB 1F0ZA 3VAWA 2A4ZA 3Q3FA 1SB3C 2W3SA 4G11A 4CYEA 1KOTA 2C7HA 1GG3A 2MA9B 3UF8A 4ZYNA 2PJHA 2INCC 1Y8RC 1FFVA 2JZ3B 2D07B 4BBNF 2KANA 1HEZE 3H9DA 1VZ8A 4MM3A 1JQ4A 3L17A 2FNJB 3V6CB 1XF5L 1YQBA 2MH7A 1K53A 4GDKB 2KX0A 2BS2B 5G2NA 4LJPB 3PZDA 2KYWA 3TEZA 3M95A 2YVCA 3WCQA 4IM3A 4P1CC 4X57B 1E0ZA 3TEXA 4MSMB 1K51A 1SIJA 3AH7A 2ZJDA 3KYCD 1T0SC 1VR9A 4USAA 3DVGY 5E6PA 3KQ4A 2B3AA 2WQYB 2C7NB 4PS3A 3X23A 2N4FA 2BVCA 2MQJA 1Z5SB 3EFUA 3Q69A 4JWSC 2MRPA 4HCPB 1BT0A 2WX1A 5DPTA 1PUTA 4LDTD 1D5XC 3RYTA 2EKEC 2WDRB 2KJ6A 4K3CA 4PYUA 2DLBA 4PT5A 4ANUA 3OJ3A 2BW2A 1SGHA 3RN9C 2EELA 5EDSA 3HUIA 2K5PA 2IBIB 2IO1B 4NNJB 1MFWA 2NVUI 1WX8A 2QILA 5AZGA 4KIKA 2BYTA 2V3PA 2J0JA 4WQMA 2QDFA 2KXJA 2DHZA 2V1YA 3DVNU 4N58A 5DPSA 3V3XA 3ZNGC 1E7VA 2KFKB 5CHVC 5G5GA 1OEYJ 1PYWD 5E6JA 4F7ZA 4GDLB 4BBNC 2KOXA 4IOIE 3BK2A 2WXFA 3SR6A 3U7DA 1NDDA 2YLMA 3H8HA 4FJVB 5E6NA 3DBHB 3QK0A 3OLMD 3W1SC 1IGCA 2WXQA 1JWAD 3V61A 2L52A 1I4XA 2C7MB 2FIDA 2CJOA 4KDIC 4GIVA 2AWTA 2KTRB 2LGDA 5CHWA 4K81A 4XYCA 1ZW7A 4JE3B 4KGSA 3WA0A 4LDTB 3TBLD 4ZYSA 1WJUA 4IG7B 3PSEB 4B6WA 1UBQA 2WS3B 4WAAA 3KYDD 4CHKA 1XT9B 2LASA 3PS6A 3SEBA 1KLVA 2KVZA 5C3JB 2JU6X 1T0YA 3ZGZA 2I1JA 3DQVA 2K25A 4P7IA 1N60A 1XEEA 1MG8A 1XD3B 1P7EA 2I1KA 3ZTDA 4RNAA 2W3RA 1YJIA 1S1QB 1XLQA 3QQ8B 5HKHA 5CX3A 4IW0A 3DVGX 2WXOA 4LTUA 1WX9A 3AEBB 2N9XA 1WXQA 4W9EA 1OQRA 2CHZA 3BY4B 2ON8A 3PZ8A 2DZJA 2OEDA 4ICVA 1C3TA 1G6JA 4HVBA 3IT6B 5D2MB 5HG2A 2INPE 3B9JA 4FULA 2QMTA 4NAWB 3AE7B 3EGRA 3AEFB 2W9NA 4MGKE 1YN4A 4KZ0A 3L08A 5JZEB 1V81A 1RLFA 1KJTA 1WXSA 2CHXA 2INDC 2FCMA 3M62B 4NAWA 2LJIA 1YJ1A 2R61A 2PEAA 5GMVA 2ZPNA 2AQ2B 2NS5A 4L1BA 1YNTE 4L2YA 1WJ4A 3PLUA 1Y56A 1FO4A 2IO3B 3E9SA 3W2DA 3VDZA 3GB1A 2OHFA 3R2IA 2WU2B 3CSTA 4W9JA 3M3JA 4FBJB 1ET9A 3R3MA 4O1NA 4RGNA 2ZNVC 4WWOA 1XCTL 1JROA 3GE8C 3MTNB 4JQWC 1WGDA 2AYOB 4REZA 5C2TB 4ZOHC 3WAPA 3B08A 2L3ZA 3NVVA 4RMAA 2L32A 3KUDB 1XLPA 1JCKB 3NY5A 5HI1A 3ZW3A 1DOYA 4BFRA 4US8A 4BOZB 4DXAB 4MGYE 1TZ1A 1IP9A 1UF0A 3HIZA 2FE8A 4A20A 1ZKHA 1R4NB 1MPEA 1I7HA 2KDFB 4FN2A 4AJYB 1WRDB 1YQ4B 1ZXHA 3WANA 1AARA 2OOBB 4XWTA 1GOZA 4ZRKA 4MSQB 1FRRA 2MBQA 5DCNA 3AN1A 2AQ3B 3NHEB 1RM6C 2VZKD 3Q8AA 4BKTA 4HKZE 3CIRB 2PVGC 1WI0A 2BB6A 2NBUA 2LUMA 3QAQA 4E71A 2C5LC 2JZPA 1NI2A 2LGIA 3HRDD 1SSNA 3AEEB 1MHXA 4DHZE 1ENFA 1RYJA 1JRUA 4G3XB 3JYUA 5IO9A 1FNVA 3KVFB 2FBWB 2D3AA 2WYQA 3NUHB 2LHDA 1OTRB 2A5UA 4TQ1A 3RMKC 2N7DA 3Q2AC 3SD5A 3A1QB 2MHJA 2WDQB 3QA8A 2O2VA 2V3NA 4P6VF 1YJJA 4B0MA 4MGZE 1TY2A 2FUHB 3AE9B 2GI9A 1UNSA 1L4DB 3TEWA 4C7ZA 2KK8A 2AEHA 3RULA 5L95C 4GU2A 3HM3A 2D3BA 1LGRA 4ITKA 5DPWA 3B1LX 4JIOU 1EU4A 2XN9C 3P1MA 4II2B 4W9FA 2RMMA 3MHSD 2INNE 3ML9A 3CSFA 2RGFA 2JPHA 2I38A 2QJLA 1ZOYB 1L2NA 2M1MA 2KZRA 2CJNA 2OJRA 3PRPB 2WXMA 1JMLA 1WGYA 3U30A 2KFJA 4JLCA 3H7SA 4NAMA 2WDTB 2EKIA 4ANXA 1K8RB 4FXCA 2BPSA 5D6JB 3NZUA 2MBHA 3IXSA 2DZKA 4DDID 4TMAB 3N1YC 3VVWB 1VDVA 3VUXA 1C4AA 4GGQA 5EE3A 2KO3A 1WF9A 2YEPB 1P9DU 3U52E 4MM3B 4NQLB 1P98A 1ZGUB 4KSLC 4M02A 4BVUC 3P2BA 4LNOA 4W9LA 4DHJB 3D32A 4OW0A 3RD2A 1XLNA 3ZJUA 1GC7A 2L05A 1WJNA 5G5HA 4A9AA 3PV1A 5LXIB 3NVYA 4ZRQA 1V8CA 3LJ3A 4NY0A 3DBHI 3ALBA 3QWZB 3AE2B 1GB1A 3HK0A 1HTQA 5G55A 1XLOA 5LXHA 3DHHC 1HE8A 2KD0A 2DAJA 2NPTB 1EO6A 3Q3NC 1L6UA 1M94A 1FPYA 5CTRC 2WU5B 1FNUA 1LQBA 1ZDVA 3CF6E 2O6VB 3ZVVA 2AQ1B 3HHMA 2KDEB 1R4MB 1V1PA 2NBVB 1ZXIA 1I42A 3DWMA 3ZDMC 4C4VB 3KWVA 2IJ0A 3BYTB 3FC4A 1ET6A 2JRIB 3AE5B 1WZ0A 1UBIA 1WGGA 2IDYA 1ZPSA 2QEJC 1WZ3A 2MJDA 3EFCA 1RFAA 2NBWB 4BZAA 4RF0A 1DOIA 1CJEA 2Z8LA 2V4IB 1NYQA 1IBXA 3KWLA 2TSSA 2N0SB 5TSSA 4JWUC 4C00A 2GBMA 1A5RA 4FADA 2WLBA 1GAQB 2LD9A 3ZLZA 2KTRA 1OGWA 4A6QA 5BYQA 3KLSX 1MJDA 1OQYA 3BK1A 2D11A 2KDIA 3PZ7A 1TKYA 1YN3A 5I4DA 2KN4A 3FKYA 1WXAA 4IDIA 3RCZA 3MFGA 5IA7A 1E10A 2D5GA 2LMCA 4WJQA 1WIAA 3IG3A 2BKRB 2NR2A 3BZDB 4HRSA 1J8CA 5LNK1 4DXGA 3A9KB 2LVQA 2LRUA 2LJ5A 4A90A 1WE7A 3C8YA 1ZP0B 2KWDA 4HXDA 4W9CA 1FXTB 3ZXRA 4N9F4 1YX6B 2V3SA 3PLVA 1LO5D 4ZRPA 1B9RA 2W54A 3DBLI 3PTFC 3NZ3A 1WRIA 2RDGA 4RM9A 4KZCA 3Q3MC 1EM7A 3KH0A 2BWFA 2KVRA 4PYZA 3WALA 1Z2MA 2KDMA 1IGDA 2JF5A 2Y5BB 5KHQA 3K9OB 2WXJA 1I4HA 2WXHA 5LLIA 4EZLA 1Q1OA 1BXTA 2LGYA 5EE9A 5EE0A 3UINB 1FFUA 3VTWA 3RNCC 2JYTA 2G4SA 1KH0A 1WE6A 2KJRA 3PRMB 1A70A 2IGGA 3W9CB 3L10B 1EUVB 2RPVA 3LB8C 2PMVA 4C56C 1I35A 2Y5CA 3V62A 4MJSB 4DXFA 4HJKA 4KX6B 2HDEA 1FRDA 4CO7A 1GC6A 3W1SA 2ACZB 3DOWA 4N6EB 2G1EA 2KNBA 1AW7A 1F2RC 3VH4B 1OEYA 2AX5A 4IUMB 4ASWC 4GSWA 4XZ4A 1PGXA 4ZHOA 1NYRA 4UDUC 2RDHA 2M8SA 3AEAB 1QZEA 4IWPA 3P4RB 1H4RA 2K9XA 2XNAC 1TS4A 3BYYB 1V49A 2IO2B 2WXNA 1LXDA 2LEKA 4OZCA 4I6NB 2RPQA 3DCGA 4TQ0A 2BYFA 4RCOA 1C77A 2H88B 4K7WA 3RNAC 5IP4D 3PPAA 1C9FA 3LDZE 4FJZA 1JWSD 2LVOA 2AL3A 1J7CA 2BQQA 3VUYA 3A9JB 2JT4B 2DYBA 1T6BX 4F1SA 1R4MI 2K8HA 4AJWA 1HZ6A 3GZNB 1WR6E 2R2OA 4OVUA 3SHQA 1TKEA 5BYRA 1F2RI 4YT0B 1L0YB 1D5ZC 1TKGA 3PGEA 1UUPA 1UWMA 4WJNA 4HPPA 2LGXA 1YIWA 1X1MA 3L13A 3ZJVA 5D7GA 3U2SC 4BAXA 1DGJA 1PDXA 2JYEA 2KJHB 4P1BC 2O6VD 3APDA 3JVZX 2WXPA 3DVNV 3T9LA 3APCA 4LNKA 2MX2A 3AEGB 3BVZA 1L0XB 2J53A 3BIID 2K8BA 1QKZA 2DZMA 2CU3A 4TUUA 4YTMB 4FLHA 1TTNA 3ECIA 4E3CA 1TY0A 3UI3A 4M8NA 2CHWA 3AB5A 3OAWA 1WGRA 3A4SC 4IKGA 3URYA 2L83A 3GOEA 4FJYA 2PW9A 2JX5A 2JVCA 1TGZB 4AS1A 2WNMA 1YQ3B 3GZNI 4II3B 3RPFC 3X0WA 3Q3JA 2XK5A 3BINA 4DHZB 1J0GA 2R2QA 1KRHA 2BGFA 2FIFA 3NZSA 5JHBA 3BVMA 4FHJA 2G45B 3PHWB 2MEKA 2MP2B 2JWZA 2KN5A 3VR8B 2RDBC 4EE2A 3EHVA 2GLSA 2J4XA 3ABVB 1R7SA 1C4PA 4M8MA 3ONSA 1PQSA 5JH5C 3TEYA 2PTLA 3L16A 5AZHA 4BKGA 3VTVA 1VJKA 1ZE3D 2FCSA 2LUEA 2N9LA 1XQQA 2B76B 2ZVOA 3PRZA 4P16A 1OQQA 4US9A 4LNFA 3Q8FA 3PREA 4ARIA 1XCQL 5L83A 3ZKJC 4AOFA 1VZ6A 1SF0A 3QARA 3QC8B 4DWFA 1JRPA 3IVFA 2KLCA 3NS1A 3ZRCA 4DHJD 3VRAB 4W9HA 3I9V1 4YSXB 1WXVA 1QILA 4W9GA 1V86A 2ZCBA 3QJZA 2QCZA 3P4QB 1E6EB 3GP7A 3W5VB 1FIQA 2FCNA 3TJPA 2G9HD 5MPOA 2LI5A 2DBYA 1AYFA 2K1FA 4L23A 2J52A 5BMGA 2BS4B 1D6EC 2DENB 4IC7B 3RI7C 3J9CA 5IOIA 5AUKA 2MSED 2D10A 1NI3A 2EMTA 3U4EG 3HVZA 2Y5PA 1EF5A 4M0WA 3AE1B 2BT6A 2ONQA 1OFFA 2SEBD 2M4NA 2GBRA 1NBFC 1J7AA 3TIXA 5AUIA 2NPTA 4OZAA 4MEMA 1HXYD 2PKOA 1TS3A 3JSVB 4RGMA 3ML8A 2J42A 1KF6B 3OG5A 3ZUNA 2FAZA 1T0QC 1PFDA 1N5WA 1ZUD2 1QOBA 3AU4A 2MLBA 4URKA 2G4DB 3M63B 4WURA 2ZNVB 2HTME 4DK5A 3QX1A 4K7UA 2GBJA 2N7EA 3ZNID 2D3CA 1GJZA 1WSPA 3NRZA 4C4VA 4LCDE 1GUAB 3I5JC 4EZKA 2O2VB 3MP9A 2SAKA 2CKHB 5AEKB 1WH3A 4TKNA 4HWIB 2JUOA 1TS5A 5H92C 1UH6A 4W9KA 4LLGM 3Q8BA 3TSSA 1UWXA 4XGAB 4ZHPA 2DYOA 2LWPA 2I2YA 4KDLB 4QAYA 3KW5B 4IWOA 1L4ZB 1BMLC 4IM0A 1FNWA 2RR9A 4MGIE 4KGRA 5D94A 4EFOA 1C76A 2MCNB 4B9KA 4HROA 1IPGA 1SXTA 3ENEA 3GE3C 1T5XD 1CK1A 3AE8B 2KC1A 1YN5A 3ZXVA 2GMIC 2GB1A 2J0MA 1HZ5A 2MBBB 4OVVA 3S2AA 4A8XC 3N3KB 2V9HA 3ZIMA 2PPHA 2D2QA 3DWGC 2FCQA 4NJCA 2UU7A 2M0XA 1TBEA 2IGDA 3MJWA 4BKSA 3ZNZB 1P0RA 4A3OA 2LGSA 3IHPC 1NEKB 3GS2A 2WWZA 2UYZB 3QCAA 2IY1B 2K6QA 3RUIB 2PIAA 2KMCA 4LNIA 2EMSA 2CS4A 1SE2A 2N9KA 4DDGD 2LHEA 4XX5A 1E90A 4WWNA 1N6ZA 1N61A 3A1QA 1I4RA 3NOBA 1PGBA 2L1AA 3TL5A 4HEA1 2ZCCA 3B2GA 2KTFA 1SJED 3RNFC 2WXLA 3ZO5B 1QQRA 1L5PA 3VTUA 4WAFA 3DBLB 3VQIA 3SFEB 1UELA 2WHIA 3NS8A 1RAXA 4GB9A 3T3OA 3ZQ4A 1IYFA 3VUWA 1E8WA 2M17A 4TV3A 3QHTA 3QIJA 1FD6A 2O6VA 4KKJA 3EUB2 1WGKA 2HD5B 2KX3A 2WXGA 2L00B 3LYYA 4YSZB 3MC9A 1I4PA 2JZZA 1FXAA 5JXVA 2BWES 2G3QB 4EZJA 1V5TA 2BB5A 2Z59B 4YXDB 4HJGE 5AZFA 4JX1C 3AE4B 1PGAA 3FAHA 1KLGD 3CWIA 2JY6A 1V1PB 2K39A 3SU8X 2WP9B 3AM9A 4GDKA 4KVGB 4NPNA 2NCNA 1XXGA 2NMQA 1MHHE 2W82A 1STEA 4KV2A 1F52A 4YTNB 2HE7A 2WXIA 2BF8B 2CU1A 4C7YA 1QOFA 1NENB 2VH2A 3MC8A 2KQSA 4DQOC 3DDCB 1B1ZA 4WH4A 1V1OA 3APFA 1CMXB 3CMMB 3Q14C 1F77A 4S17A 4MH0E 3W1YA 1LFDA 4YWGG 1P3QU 2DX5B 2OJWA 3IBEA 4RH6A 3IT4B 4ZRIA 1TYGB 2H89B 2M56B 2ZVNA 2KACA 4XC2A 1KM7A 3P4PB 1UGMA 3KUZA 2W55A 3OWEB 3WIMA 4HPMB 4HCNB 4FHKA 1VRAB 1DOXA 3AV8A 2IGHA 2L76A 1P7FA 4C80A 3ZDTA 4WJOA 4WQOB 2NTSA 2YEPF 3UQBA 2ZZPB 4PK1A 4K7SA 2KFKA 3N20C 1SE9A 3ZNHB 2X8XX 4NQKE 4ZRJA 2N9PC 5FR3A 2KHWB 2IZVB 3ZRFA 1JW9D 3ZTCA 3MJ5A 4AWJA 2ICIA 2AL6A 4BKSD 2QHOA 4XWWA 4J3OD 1H8CA 1RWSA 4RGOS 5D3IB 2HJ8A 3RNBC 1GPXA 1E8XA 1T3QA 2BBCA 5EE1A 1XO3A 3TUOA 3H7PA 3I57A 1E7UA 3C0RB 3NVWA 5J18A 1SE3A 1BUIC 3AE6B 4EKUA 2QC8A 1SIFA 1KTKA 2BTEA 3R8BA 1TIFA 2KC2A 3A33B 4H2AA 2CR5A 2MP2A 3ZYYX 2C60A 2VRRB 2BYEA 3MC0B 1EU3A 3K9PB 1D4BA 4HDOA 3TCAA 3A4RA 4MT5A 4RGTA 4JL9A 3PHXB 5IAAC 1WXMA 3H6NA 3U8ZA 4ANVA 3R7RA 1M4VA 2ASQA 5HFYA 4G50A 3Q3OC 4WWMA 2C9WB 1V97A 2REXA 2ZW0A 3I3TB 1ACCA 1T0RC 1VD2A 2XK5B 5FR6A 2ZW1A 1WFYA 1K50A 4EEWA 4ICUA 4D2KA 1WM3A 5JHAA 1Q0WB 3HM6X 4OHJA 2DWQA 3R66C 1V6EA 3FILB 2JSVX 3PVLA 1VLBA
chains in the Genus database with same CATH topology
2QIEB 1E6EB 1K51A 1SIJA 3AH7A 3GP7A 3W5VB 1FIQA 1VR9A 2G9HD 4USAA 5MPOA 2X38A 2FUG1 3KQ4A 2DBYA 2WQYB 4OW0A 1AYFA 4ARCA 4L23A 1XLNA 3ZJUA 1TJEA 2J52A 5BMGA 5G5HA 2BS4B 4MACA 4A9AA 2GRIA 1D6EC 4N59A 3Q69A 4WIPA 1SE4A 3J9CA 3NVYA 4ZRQA 4JWSC 1V8CA 5AUKA 4LK0M 1NI3A 1ROEA 1PUTA 2BS3B 3U4EG 3HVZA 3BWUD 1AN8A 3LXFA 2Y5PA 4M0WA 3AE3B 2LFIA 1D5XC 2IPKD 3AE1B 3T3NA 1WYGA 2BT6A 3AE2B 5T8IA 2ONQA 2WDRB 1OFFA 1KFYB 2SEBD 1GB1A 3ZJTA 1XLOA 3FILA 2DLBA 4PT5A 4RFBA 1J7AA 1L6UA 5AUIA 4OZAA 2BW2A 2WU5B 4NZLB 1FNUA 1ZDVA 1N63A 2EELA 3HUIA 1HXYD 2PKOA 1TS3A 2K5PA 2AQ1B 1V1PA 4RGMA 2QILA 2J42A 1KF6B 1ZXIA 3PO0A 2BYTA 2V3PA 2PLPA 4WQMA 3DWMA 5BYSA 1PFDA 2Y3AA 1N5WA 2PVOD 2WXRA 3P42A 5FK9C 1ZUD2 1QOBA 3KWVA 4N58A 3V3XA 2IJ0A 3BYTB 3FC4A 1ET6A 3AE5B 4YSYB 2IDYA 5G5GA 1N5XA 3MHZA 1ZPSA 1PYWD 5E6JA 2QEJC 3VRBB 4GDLB 2MJDA 4IOIE 3BK2A 2WXFA 1FMAD 4WURA 3U7ZA 2JQRB 2HTME 3SR6A 1QOGA 4RF0A 1DOIA 1CJEA 2Z8LA 2V4IB 1NYQA 1WSPA 3NRZA 2DYMA 1IBXA 3H8HA 5GXGB 3MP9A 2SAKA 3P63A 4TSSA 5H8YE 3KWLA 2TSSA 2N0SB 1E9MA 1IGCA 1TS5A 5H92C 2WXQA 1JWAD 5TSSA 4JWUC 4LLGM 3Q8BA 2L52A 3TSSA 1UWXA 1I4XA 4ZHPA 2DYOA 2I2YA 1TS2A 4YTPB 1GB4A 1L4ZB 1BMLC 2CJOA 4JPSA 1FNWA 4KGRA 2WLBA 4RF1A 1GAQB 1C76A 1CZPA 4A6QA 4JE3B 4KGSA 4HROA 5BYQA 3KLSX 3W5UB 4ZYSA 3BK1A 3PZ7A 1SXTA 1TKYA 1YN3A 2JWUA 5I4DA 2KN4A 2Q5WD 1T5XD 1CK1A 2WS3B 3AE8B 3IAM1 4IDIA 3MFGA 1YN5A 5D3DA 2GB1A 4GLSC 1HZ5A 2D5GA 4A8XC 1E10A 2LMCA 1L6VA 1CQVA 2N7JA 3SEBA 1QLBB 3BZDB 5C3JB 4HRSA 2JU6X 2M0AA 3DWGC 5LNK1 4DXGA 4NJCA 3ZGZA 4A90A 3ETRA 1N60A 2IGDA 3C8YA 1XEEA 1ZP0B 2KWDA 1I4QA 2MJ3A 1P7EA 1C78A 1C79A 1NEKB 1TZOA 3GS2A 1LO5D 4RNAA 3IAS1 4ZRPA 1B9RA 2W3RA 1YJIA 2W54A 2PIAA 1XLQA 3NZ3A 1WRIA 2RDGA 1EM7A 1QOAA 1E7PB 1YMHE 1SE2A 2N9KA 2KDMA 2LHEA 4OZBA 1IGDA 1SJHD 1N61A 4B0EA 1I4RA 2WXJA 2WXOA 4LTUA 1PGBA 3AEBB 1WXQA 1I4HA 2WXHA 1BXTA 2L1AA 1OQRA 5EE9A 5EE0A 4HEA1 3B2GA 1FFUA 1SJED 3AMZA 2WXLA 2JYTA 1KH0A 3EA6A 1QQRA 1L5PA 2ON8A 1A70A 4WAFA 2IGGA 3PZ8A 3VQIA 2OEDA 3W9CB 2M19A 3IT6B 5HG2A 2INPE 2RPVA 3SFEB 3LB8C 3HVDA 3B9JA 1FCCC 2PMVA 2QMTA 3T3OA 4C56C 4NAWB 3ZQ4A 3AE7B 2Y5CA 3EGRA 3AEFB 1J7BA 1YN4A 2NTTA 1HQRD 4DXFA 1FD6A 4KKJA 1JWMD 3EUB2 1WGKA 4KX6B 2HDEA 1FRDA 4CQNA 1C4CA 2WXGA 2ACZB 3W1SA 3LYYA 4YSZB 4N6EB 2G1EA 1I4PA 3BVGA 1AW7A 1F2RC 1FXAA 5JXVA 3P4SB 2AX5A 1RFKA 4KKIA 4XDCA 5BMIA 2BB5A 1PGXA 1JWBD 4YXDB 4HJGE 4JX1C 4ZHOA 1NYRA 2LJIA 3AE4B 2R61A 2RDHA 1PGAA 4UDUC 2AQ2B 3FAHA 1KLGD 3CWIA 1V1PB 3AEAB 4L1BA 3P4RB 2K9XA 1YNTE 2MJEA 2XNAC 4L2YA 1TS4A 3BYYB 1DYQA 1Y56A 2WP9B 1FO4A 3AM9A 3E9SA 3W2DA 1AWDA 5BMHA 1MI0A 2OHFA 2WXNA 3GB1A 2K22A 2LEKA 3R2IA 4OZCA 4KGTA 1XXGA 2NMQA 2WU2B 1MHHE 1K52A 1IBXB 4TQ0A 1D5MC 2W82A 2VZKB 1STEA 4RCOA 1ET9A 4O1NA 1C77A 2H88B 2K0PA 4RGNA 4YTNB 1XCTL 1ESFA 2WXIA 5HHDG 1JROA 1QT9A 1EWYC 4C7YA 1QOFA 1NENB 1C9FA 4REZA 5C2TB 2QSDA 1L0VB 4ZOHC 1JWSD 1I4GA 1UGJA 1ZDXA 1J7CA 4DQOC 1VZ7A 1B1ZA 4WH4A 1V1OA 3NVVA 2L32A 1XLPA 1JCKB 1T6BX 4AQ7A 1F77A 1HZ6A 3R2TA 3AEDB 5HI1A 3Q8CA 1TKEA 1DOYA 4YWGG 4US8A 5BYRA 4RH6A 1F2RI 1N62A 3IT4B 3L4PA 4YT0B 1L0YB 2FE8A 1TYGB 1D5ZC 4A55A 2H89B 2M56B 1MPEA 1TKGA 2E3TA 1QF6A 1I7HA 1FEHA 2KACA 4HKQA 3SFDB 1YQ4B 1UUPA 1ZXHA 1UWMA 3P4PB 4XWTA 2WXKA 2W55A 3OWEB 1GOZA 1FCLA 1FRRA 4XDDA 1VRAB 3AN1A 2AQ3B 1FXIA 3ZJVA 3AV8A 1RM6C 2VZKD 5D7GA 3AECB 1DOXA 2E6XA 3Q8AA 3RFZB 2IGHA 3N9YC 4HKZE 1P7FA 3CIRB 3U2SC 2KMMA 4C80A 1DGJA 1PDXA 2PVGC 2BB6A 2JYEA 3Q8EA 2NTSA 2LUMA 2JZPA 2LGIA 1NVID 2WXPA 1IUEA 1SBBB 1SSNA 2YEPF 1HA5A 3AEEB 1MHXA 3HRDD 1JALA 1ENFA 3B2FA 1RYJA 3NVZA 4OVZA 3AEGB 3BVZA 1L0XB 5FR3A 1FNVA 2J53A 2JXTA 2FBWB 3BIID 1QKZA 3V05A 1MVKA 3NUHB 1WWTA 2LHDA 2CU3A 1JW9D 4TQ1A 4YTMB 3MJ5A 2ICIA 1KLUD 2WDVB 4XWWA 2WDQB 1TY0A 4J3OD 2V3NA 3UI3A 4XE0A 1RWSA 4P6VF 3AB5A 2KQ4X 3O13A 4RGOS 1YJJA 4B0MA 5D3IB 1TY2A 3AE9B 3VR9B 4Q2JA 2GI9A 4IKGA 1UNSA 3URYA 1L4DB 2L83A 3TEWA 4C7ZA 1GPXA 2PW9A 2JX5A 1T3QA 2BBCA 5EE1A 1Q10A 1XO3A 2V0GA 3TUOA 3I57A 1JWUD 4ITKA 4AS1A 3NVWA 4MH8A 4R3DA 2WNMA 1YQ3B 1SE3A 1BUIC 1EU4A 2XN9C 3AE6B 3RPFC 3P1MA 1KTKA 2BTEA 3E56A 1EWCA 2RMMA 2INNE 1KRHA 3R8BA 1SEBD 5FKAC 3BVMA 2MEKA 4H2AA 2K3UA 2KAJA 3VR8B 1FM0D 1F0ZA 3ZYYX 4EE2A 2I38A 1SB3C 2QJLA 2W3SA 1ZOYB 2J4XA 3ABVB 3MC0B 1EU3A 1D4BA 1R7SA 1C4PA 2CJNA 4MT5A 2PTLA 2WXMA 4RGTA 3TEYA 1JMLA 1VJKA 4NAMA 2EKIA 1ZE3D 1M4VA 2N9LA 1FFVA 2B76B 5HFYA 4FXCA 1OQQA 4P16A 4US9A 4WWMA 1V97A 3Q8FA 1HEZE 2ZW0A 1ACCA 1VZ8A 3IXSA 1JQ4A 4ARIA 1XF5L 2ZW1A 2MH7A 1K53A 1XCQL 4GDKB 2BS2B 1VZ6A 1SF0A 4TMAB 1K50A 1VDVA 1JRPA 1C4AA 3NS1A 3TEZA 5EE3A 4D2KA 3VRAB 3I9V1 2YEPB 4YSXB 3U52E 3WCQA 4OHJA 2DWQA 1QILA 4MM3B 3FILB 1E0ZA 2JSVX 3TEXA 1VLBA 3P4QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U4E G;  4DQO C;  4YWG G;  3U2S C; 
#chains in the Genus database with same CATH topology
 3VXW A;  2QIE B;  3RZW C;  5IKC M;  4GOC A;  5TR5 A;  2X38 A;  2FUG 1;  3RNE C;  1LM8 B;  4AUQ C;  2XBB C;  4IWQ A;  4ARC A;  1TJE A;  4MAC A;  2GRI A;  4KIK B;  5C23 A;  4N59 A;  4EUT A;  4WIP A;  1V9J A;  1SE4 A;  2WGS A;  4LK0 M;  1ROE A;  2BS3 B;  3BWU D;  1AN8 A;  3LXF A;  3AE3 B;  2LFI A;  3VH3 B;  2IPK D;  3T3N A;  1WYG A;  1WM2 A;  5T8I A;  3IFW B;  4E74 A;  1KFY B;  2MBO A;  3RZF A;  3ZJT A;  3FIL A;  3AUL A;  4RFB A;  2MWS B;  4IM2 A;  2RD0 A;  4NZL B;  3L54 A;  4MJS A;  1YD8 U;  1N63 A;  4ACF A;  2D3G A;  1Q5W B;  1MG4 A;  2BYV E;  1WJ6 A;  2JXX A;  4F8C B;  2DZI A;  3PO0 A;  1EF1 A;  2PLP A;  1F9J A;  5BYS A;  1V5O A;  2Y3A A;  2WXR A;  2L0T A;  2PVO D;  3JW0 X;  1GNU A;  3P42 A;  4HK2 A;  5FK9 C;  5KHO A;  2HTH A;  4YSY B;  3KUC B;  3RT3 B;  1N5X A;  2Z0D B;  3DPD A;  3MHZ A;  4GDL A;  2RSU A;  1WY8 A;  3VRB B;  1FMA D;  3U7Z A;  2JQR B;  1QOG A;  1WMH B;  5J2R A;  2DYM A;  5GXG B;  3H1U A;  2DAF A;  3P63 A;  4TSS A;  5H8Y E;  2KKC A;  1VCB A;  3AXC A;  1E9M A;  5BO4 B;  3NJT A;  5CHF A;  3O65 B;  2PE9 A;  2ZEQ A;  2MBE A;  1TS2 A;  4YTP B;  3A9J A;  2IY0 B;  1GB4 A;  1WMH A;  4JPS A;  1R4N I;  3EEC A;  4RF1 A;  2BKF A;  4S0R A;  1CZP A;  3W5U B;  2Z0E B;  1V80 A;  2JWU A;  2LXA A;  2Q5W D;  1L7Y A;  4MDK E;  3IAM 1;  2XEW A;  5D3D A;  2KWV B;  4GLS C;  3R7Q A;  1L6V A;  1CQV A;  2N7J A;  2J0K A;  1QLB B;  3EC8 A;  3N1Z C;  2M0A A;  4DBG A;  4LNN A;  3UIO B;  3ETR A;  4PS8 A;  1I4Q A;  2LXC A;  2MJ3 A;  4K1R B;  1V2Y A;  1C78 A;  1C79 A;  1TZO A;  1U4A A;  2DNF A;  1RRB A;  3IAS 1;  1YOV B;  1P1A A;  3UIP B;  1QOA A;  1E7P B;  1YMH E;  2K6D B;  4OZB A;  2KLG A;  1SJH D;  4RM8 A;  2UWQ A;  4HLE A;  2JRH A;  4B0E A;  4NJ6 A;  5IN7 A;  4EOY A;  3AMZ A;  3WAO A;  2LZ6 A;  3EA6 A;  4WJP A;  5C1Z A;  3Q6B A;  4MEL A;  2V4L A;  3T8M A;  2M19 A;  3VFK A;  2KQ7 A;  3HVD A;  1FCC C;  2KDB A;  4M0W B;  1J7B A;  2NTT A;  1HQR D;  1D3Z A;  3WAM A;  1JWM D;  4CQN A;  1C4C A;  2N9E B;  2KMA A;  1E5W A;  3BVG A;  4GN1 A;  2ZPY A;  3P4S B;  1RFK A;  4KKI A;  4XDC A;  5BMI A;  2GOW A;  3AI5 A;  1JWB D;  2L7R A;  3DHG C;  3PT2 B;  2N1V A;  3B0A A;  3JSV A;  2MJE A;  1DYQ A;  4FA6 A;  4B95 A;  1AWD A;  5BMH A;  1MI0 A;  2K22 A;  4BOS C;  4KGT A;  3V60 A;  1K52 A;  3NG0 A;  1IBX B;  2IO0 B;  1D5M C;  3I63 C;  2KT7 A;  2VZK B;  3RNG C;  2K0P A;  1YX5 B;  2GBK A;  4YL8 A;  1ESF A;  5HHD G;  1QT9 A;  4JGH B;  1EWY C;  3OJ4 B;  1WGH A;  1UD7 A;  2QSD A;  2LRW A;  1L0V B;  1I4G A;  1UGJ A;  1ZDX A;  1HTO A;  4W9I A;  1VZ7 A;  4LJO B;  2L8J A;  1UZX B;  4AQ7 A;  4ANW A;  2LVP A;  3R2T A;  3AED B;  1TT5 B;  3Q8C A;  2GBN A;  1N62 A;  3L4P A;  5J17 A;  4A55 A;  2HJ1 A;  3N32 A;  4HDQ A;  2E3T A;  4A3P A;  1QF6 A;  2WX0 A;  1FEH A;  2KWU B;  4J6I A;  4KSK C;  5E6O A;  4HKQ A;  1WR1 A;  3DBR B;  3SFD B;  1S3S G;  2WXK A;  1FCL A;  4ZDV A;  4XDD A;  2MW5 A;  1FXI A;  4I6P A;  3DHI C;  3AEC B;  2E6X A;  3RFZ B;  3N9Y C;  2N1W A;  4W9D A;  2KMM A;  4M00 A;  3UQA A;  4PS7 A;  2IYD B;  3C19 A;  3Q8E A;  3N1X C;  1NVI D;  1IUE A;  1SBB B;  3V6E B;  1HA5 A;  1JAL A;  3AU5 A;  3DBS A;  3B2F A;  4G0N B;  1ISN A;  3NVZ A;  4OVZ A;  4NJ7 A;  3UGB B;  2JXT A;  3V05 A;  1MVK A;  3L0W B;  1WWT A;  3N30 A;  1WYW B;  1KLU D;  2WDV B;  4XE0 A;  2KQ4 X;  3O13 A;  2KWC A;  3SDL C;  4AP4 C;  2PE6 B;  4GMV A;  3VR9 B;  4Q2J A;  5DPR A;  1C1Y B;  4K3B A;  2J7Q B;  1E8Y A;  1Q10 A;  2V0G A;  3DBR I;  1JWU D;  4M01 A;  3H7P B;  4MH8 A;  4R3D A;  4WWP A;  2K8C A;  4I6L B;  1J19 A;  3VHT C;  3A9K A;  1F1H A;  4GXB A;  1E8Z A;  3E56 A;  3TMP B;  1EWC A;  2L0F A;  1SEB D;  1WX7 A;  2VH1 A;  5FKA C;  2K3U A;  2KAJ A;  1FM0 D;  4HPL B;  1F0Z A;  3VAW A;  2A4Z A;  3Q3F A;  1SB3 C;  2W3S A;  4G11 A;  4CYE A;  1KOT A;  2C7H A;  1GG3 A;  2MA9 B;  3UF8 A;  4ZYN A;  2PJH A;  2INC C;  1Y8R C;  1FFV A;  2JZ3 B;  2D07 B;  4BBN F;  2KAN A;  1HEZ E;  3H9D A;  1VZ8 A;  4MM3 A;  1JQ4 A;  3L17 A;  2FNJ B;  3V6C B;  1XF5 L;  1YQB A;  2MH7 A;  1K53 A;  4GDK B;  2KX0 A;  2BS2 B;  5G2N A;  4LJP B;  3PZD A;  2KYW A;  3TEZ A;  3M95 A;  2YVC A;  3WCQ A;  4IM3 A;  4P1C C;  4X57 B;  1E0Z A;  3TEX A;  4MSM B;  1K51 A;  1SIJ A;  3AH7 A;  2ZJD A;  3KYC D;  1T0S C;  1VR9 A;  4USA A;  3DVG Y;  5E6P A;  3KQ4 A;  2B3A A;  2WQY B;  2C7N B;  4PS3 A;  3X23 A;  2N4F A;  2BVC A;  2MQJ A;  1Z5S B;  3EFU A;  3Q69 A;  4JWS C;  2MRP A;  4HCP B;  1BT0 A;  2WX1 A;  5DPT A;  1PUT A;  4LDT D;  1D5X C;  3RYT A;  2EKE C;  2WDR B;  2KJ6 A;  4K3C A;  4PYU A;  2DLB A;  4PT5 A;  4ANU A;  3OJ3 A;  2BW2 A;  1SGH A;  3RN9 C;  2EEL A;  5EDS A;  3HUI A;  2K5P A;  2IBI B;  2IO1 B;  4NNJ B;  1MFW A;  2NVU I;  1WX8 A;  2QIL A;  5AZG A;  4KIK A;  2BYT A;  2V3P A;  2J0J A;  4WQM A;  2QDF A;  2KXJ A;  2DHZ A;  2V1Y A;  3DVN U;  4N58 A;  5DPS A;  3V3X A;  3ZNG C;  1E7V A;  2KFK B;  5CHV C;  5G5G A;  1OEY J;  1PYW D;  5E6J A;  4F7Z A;  4GDL B;  4BBN C;  2KOX A;  4IOI E;  3BK2 A;  2WXF A;  3SR6 A;  3U7D A;  1NDD A;  2YLM A;  3H8H A;  4FJV B;  5E6N A;  3DBH B;  3QK0 A;  3OLM D;  3W1S C;  1IGC A;  2WXQ A;  1JWA D;  3V61 A;  2L52 A;  1I4X A;  2C7M B;  2FID A;  2CJO A;  4KDI C;  4GIV A;  2AWT A;  2KTR B;  2LGD A;  5CHW A;  4K81 A;  4XYC A;  1ZW7 A;  4JE3 B;  4KGS A;  3WA0 A;  4LDT B;  3TBL D;  4ZYS A;  1WJU A;  4IG7 B;  3PSE B;  4B6W A;  1UBQ A;  2WS3 B;  4WAA A;  3KYD D;  4CHK A;  1XT9 B;  2LAS A;  3PS6 A;  3SEB A;  1KLV A;  2KVZ A;  5C3J B;  2JU6 X;  1T0Y A;  3ZGZ A;  2I1J A;  3DQV A;  2K25 A;  4P7I A;  1N60 A;  1XEE A;  1MG8 A;  1XD3 B;  1P7E A;  2I1K A;  3ZTD A;  4RNA A;  2W3R A;  1YJI A;  1S1Q B;  1XLQ A;  3QQ8 B;  5HKH A;  5CX3 A;  4IW0 A;  3DVG X;  2WXO A;  4LTU A;  1WX9 A;  3AEB B;  2N9X A;  1WXQ A;  4W9E A;  1OQR A;  2CHZ A;  3BY4 B;  2ON8 A;  3PZ8 A;  2DZJ A;  2OED A;  4ICV A;  1C3T A;  1G6J A;  4HVB A;  3IT6 B;  5D2M B;  5HG2 A;  2INP E;  3B9J A;  4FUL A;  2QMT A;  4NAW B;  3AE7 B;  3EGR A;  3AEF B;  2W9N A;  4MGK E;  1YN4 A;  4KZ0 A;  3L08 A;  5JZE B;  1V81 A;  1RLF A;  1KJT A;  1WXS A;  2CHX A;  2IND C;  2FCM A;  3M62 B;  4NAW A;  2LJI A;  1YJ1 A;  2R61 A;  2PEA A;  5GMV A;  2ZPN A;  2AQ2 B;  2NS5 A;  4L1B A;  1YNT E;  4L2Y A;  1WJ4 A;  3PLU A;  1Y56 A;  1FO4 A;  2IO3 B;  3E9S A;  3W2D A;  3VDZ A;  3GB1 A;  2OHF A;  3R2I A;  2WU2 B;  3CST A;  4W9J A;  3M3J A;  4FBJ B;  1ET9 A;  3R3M A;  4O1N A;  4RGN A;  2ZNV C;  4WWO A;  1XCT L;  1JRO A;  3GE8 C;  3MTN B;  4JQW C;  1WGD A;  2AYO B;  4REZ A;  5C2T B;  4ZOH C;  3WAP A;  3B08 A;  2L3Z A;  3NVV A;  4RMA A;  2L32 A;  3KUD B;  1XLP A;  1JCK B;  3NY5 A;  5HI1 A;  3ZW3 A;  1DOY A;  4BFR A;  4US8 A;  4BOZ B;  4DXA B;  4MGY E;  1TZ1 A;  1IP9 A;  1UF0 A;  3HIZ A;  2FE8 A;  4A20 A;  1ZKH A;  1R4N B;  1MPE A;  1I7H A;  2KDF B;  4FN2 A;  4AJY B;  1WRD B;  1YQ4 B;  1ZXH A;  3WAN A;  1AAR A;  2OOB B;  4XWT A;  1GOZ A;  4ZRK A;  4MSQ B;  1FRR A;  2MBQ A;  5DCN A;  3AN1 A;  2AQ3 B;  3NHE B;  1RM6 C;  2VZK D;  3Q8A A;  4BKT A;  4HKZ E;  3CIR B;  2PVG C;  1WI0 A;  2BB6 A;  2NBU A;  2LUM A;  3QAQ A;  4E71 A;  2C5L C;  2JZP A;  1NI2 A;  2LGI A;  3HRD D;  1SSN A;  3AEE B;  1MHX A;  4DHZ E;  1ENF A;  1RYJ A;  1JRU A;  4G3X B;  3JYU A;  5IO9 A;  1FNV A;  3KVF B;  2FBW B;  2D3A A;  2WYQ A;  3NUH B;  2LHD A;  1OTR B;  2A5U A;  4TQ1 A;  3RMK C;  2N7D A;  3Q2A C;  3SD5 A;  3A1Q B;  2MHJ A;  2WDQ B;  3QA8 A;  2O2V A;  2V3N A;  4P6V F;  1YJJ A;  4B0M A;  4MGZ E;  1TY2 A;  2FUH B;  3AE9 B;  2GI9 A;  1UNS A;  1L4D B;  3TEW A;  4C7Z A;  2KK8 A;  2AEH A;  3RUL A;  5L95 C;  4GU2 A;  3HM3 A;  2D3B A;  1LGR A;  4ITK A;  5DPW A;  3B1L X;  4JIO U;  1EU4 A;  2XN9 C;  3P1M A;  4II2 B;  4W9F A;  2RMM A;  3MHS D;  2INN E;  3ML9 A;  3CSF A;  2RGF A;  2JPH A;  2I38 A;  2QJL A;  1ZOY B;  1L2N A;  2M1M A;  2KZR A;  2CJN A;  2OJR A;  3PRP B;  2WXM A;  1JML A;  1WGY A;  3U30 A;  2KFJ A;  4JLC A;  3H7S A;  4NAM A;  2WDT B;  2EKI A;  4ANX A;  1K8R B;  4FXC A;  2BPS A;  5D6J B;  3NZU A;  2MBH A;  3IXS A;  2DZK A;  4DDI D;  4TMA B;  3N1Y C;  3VVW B;  1VDV A;  3VUX A;  1C4A A;  4GGQ A;  5EE3 A;  2KO3 A;  1WF9 A;  2YEP B;  1P9D U;  3U52 E;  4MM3 B;  4NQL B;  1P98 A;  1ZGU B;  4KSL C;  4M02 A;  4BVU C;  3P2B A;  4LNO A;  4W9L A;  4DHJ B;  3D32 A;  4OW0 A;  3RD2 A;  1XLN A;  3ZJU A;  1GC7 A;  2L05 A;  1WJN A;  5G5H A;  4A9A A;  3PV1 A;  5LXI B;  3NVY A;  4ZRQ A;  1V8C A;  3LJ3 A;  4NY0 A;  3DBH I;  3ALB A;  3QWZ B;  3AE2 B;  1GB1 A;  3HK0 A;  1HTQ A;  5G55 A;  1XLO A;  5LXH A;  3DHH C;  1HE8 A;  2KD0 A;  2DAJ A;  2NPT B;  1EO6 A;  3Q3N C;  1L6U A;  1M94 A;  1FPY A;  5CTR C;  2WU5 B;  1FNU A;  1LQB A;  1ZDV A;  3CF6 E;  2O6V B;  3ZVV A;  2AQ1 B;  3HHM A;  2KDE B;  1R4M B;  1V1P A;  2NBV B;  1ZXI A;  1I42 A;  3DWM A;  3ZDM C;  4C4V B;  3KWV A;  2IJ0 A;  3BYT B;  3FC4 A;  1ET6 A;  2JRI B;  3AE5 B;  1WZ0 A;  1UBI A;  1WGG A;  2IDY A;  1ZPS A;  2QEJ C;  1WZ3 A;  2MJD A;  3EFC A;  1RFA A;  2NBW B;  4BZA A;  4RF0 A;  1DOI A;  1CJE A;  2Z8L A;  2V4I B;  1NYQ A;  1IBX A;  3KWL A;  2TSS A;  2N0S B;  5TSS A;  4JWU C;  4C00 A;  2GBM A;  1A5R A;  4FAD A;  2WLB A;  1GAQ B;  2LD9 A;  3ZLZ A;  2KTR A;  1OGW A;  4A6Q A;  5BYQ A;  3KLS X;  1MJD A;  1OQY A;  3BK1 A;  2D11 A;  2KDI A;  3PZ7 A;  1TKY A;  1YN3 A;  5I4D A;  2KN4 A;  3FKY A;  1WXA A;  4IDI A;  3RCZ A;  3MFG A;  5IA7 A;  1E10 A;  2D5G A;  2LMC A;  4WJQ A;  1WIA A;  3IG3 A;  2BKR B;  2NR2 A;  3BZD B;  4HRS A;  1J8C A;  5LNK 1;  4DXG A;  3A9K B;  2LVQ A;  2LRU A;  2LJ5 A;  4A90 A;  1WE7 A;  3C8Y A;  1ZP0 B;  2KWD A;  4HXD A;  4W9C A;  1FXT B;  3ZXR A;  4N9F 4;  1YX6 B;  2V3S A;  3PLV A;  1LO5 D;  4ZRP A;  1B9R A;  2W54 A;  3DBL I;  3PTF C;  3NZ3 A;  1WRI A;  2RDG A;  4RM9 A;  4KZC A;  3Q3M C;  1EM7 A;  3KH0 A;  2BWF A;  2KVR A;  4PYZ A;  3WAL A;  1Z2M A;  2KDM A;  1IGD A;  2JF5 A;  2Y5B B;  5KHQ A;  3K9O B;  2WXJ A;  1I4H A;  2WXH A;  5LLI A;  4EZL A;  1Q1O A;  1BXT A;  2LGY A;  5EE9 A;  5EE0 A;  3UIN B;  1FFU A;  3VTW A;  3RNC C;  2JYT A;  2G4S A;  1KH0 A;  1WE6 A;  2KJR A;  3PRM B;  1A70 A;  2IGG A;  3W9C B;  3L10 B;  1EUV B;  2RPV A;  3LB8 C;  2PMV A;  4C56 C;  1I35 A;  2Y5C A;  3V62 A;  4MJS B;  4DXF A;  4HJK A;  4KX6 B;  2HDE A;  1FRD A;  4CO7 A;  1GC6 A;  3W1S A;  2ACZ B;  3DOW A;  4N6E B;  2G1E A;  2KNB A;  1AW7 A;  1F2R C;  3VH4 B;  1OEY A;  2AX5 A;  4IUM B;  4ASW C;  4GSW A;  4XZ4 A;  1PGX A;  4ZHO A;  1NYR A;  4UDU C;  2RDH A;  2M8S A;  3AEA B;  1QZE A;  4IWP A;  3P4R B;  1H4R A;  2K9X A;  2XNA C;  1TS4 A;  3BYY B;  1V49 A;  2IO2 B;  2WXN A;  1LXD A;  2LEK A;  4OZC A;  4I6N B;  2RPQ A;  3DCG A;  4TQ0 A;  2BYF A;  4RCO A;  1C77 A;  2H88 B;  4K7W A;  3RNA C;  5IP4 D;  3PPA A;  1C9F A;  3LDZ E;  4FJZ A;  1JWS D;  2LVO A;  2AL3 A;  1J7C A;  2BQQ A;  3VUY A;  3A9J B;  2JT4 B;  2DYB A;  1T6B X;  4F1S A;  1R4M I;  2K8H A;  4AJW A;  1HZ6 A;  3GZN B;  1WR6 E;  2R2O A;  4OVU A;  3SHQ A;  1TKE A;  5BYR A;  1F2R I;  4YT0 B;  1L0Y B;  1D5Z C;  1TKG A;  3PGE A;  1UUP A;  1UWM A;  4WJN A;  4HPP A;  2LGX A;  1YIW A;  1X1M A;  3L13 A;  3ZJV A;  5D7G A;  3U2S C;  4BAX A;  1DGJ A;  1PDX A;  2JYE A;  2KJH B;  4P1B C;  2O6V D;  3APD A;  3JVZ X;  2WXP A;  3DVN V;  3T9L A;  3APC A;  4LNK A;  2MX2 A;  3AEG B;  3BVZ A;  1L0X B;  2J53 A;  3BII D;  2K8B A;  1QKZ A;  2DZM A;  2CU3 A;  4TUU A;  4YTM B;  4FLH A;  1TTN A;  3ECI A;  4E3C A;  1TY0 A;  3UI3 A;  4M8N A;  2CHW A;  3AB5 A;  3OAW A;  1WGR A;  3A4S C;  4IKG A;  3URY A;  2L83 A;  3GOE A;  4FJY A;  2PW9 A;  2JX5 A;  2JVC A;  1TGZ B;  4AS1 A;  2WNM A;  1YQ3 B;  3GZN I;  4II3 B;  3RPF C;  3X0W A;  3Q3J A;  2XK5 A;  3BIN A;  4DHZ B;  1J0G A;  2R2Q A;  1KRH A;  2BGF A;  2FIF A;  3NZS A;  5JHB A;  3BVM A;  4FHJ A;  2G45 B;  3PHW B;  2MEK A;  2MP2 B;  2JWZ A;  2KN5 A;  3VR8 B;  2RDB C;  4EE2 A;  3EHV A;  2GLS A;  2J4X A;  3ABV B;  1R7S A;  1C4P A;  4M8M A;  3ONS A;  1PQS A;  5JH5 C;  3TEY A;  2PTL A;  3L16 A;  5AZH A;  4BKG A;  3VTV A;  1VJK A;  1ZE3 D;  2FCS A;  2LUE A;  2N9L A;  1XQQ A;  2B76 B;  2ZVO A;  3PRZ A;  4P16 A;  1OQQ A;  4US9 A;  4LNF A;  3Q8F A;  3PRE A;  4ARI A;  1XCQ L;  5L83 A;  3ZKJ C;  4AOF A;  1VZ6 A;  1SF0 A;  3QAR A;  3QC8 B;  4DWF A;  1JRP A;  3IVF A;  2KLC A;  3NS1 A;  3ZRC A;  4DHJ D;  3VRA B;  4W9H A;  3I9V 1;  4YSX B;  1WXV A;  1QIL A;  4W9G A;  1V86 A;  2ZCB A;  3QJZ A;  2QCZ A;  3P4Q B;  1E6E B;  3GP7 A;  3W5V B;  1FIQ A;  2FCN A;  3TJP A;  2G9H D;  5MPO A;  2LI5 A;  2DBY A;  1AYF A;  2K1F A;  4L23 A;  2J52 A;  5BMG A;  2BS4 B;  1D6E C;  2DEN B;  4IC7 B;  3RI7 C;  3J9C A;  5IOI A;  5AUK A;  2MSE D;  2D10 A;  1NI3 A;  2EMT A;  3U4E G;  3HVZ A;  2Y5P A;  1EF5 A;  4M0W A;  3AE1 B;  2BT6 A;  2ONQ A;  1OFF A;  2SEB D;  2M4N A;  2GBR A;  1NBF C;  1J7A A;  3TIX A;  5AUI A;  2NPT A;  4OZA A;  4MEM A;  1HXY D;  2PKO A;  1TS3 A;  3JSV B;  4RGM A;  3ML8 A;  2J42 A;  1KF6 B;  3OG5 A;  3ZUN A;  2FAZ A;  1T0Q C;  1PFD A;  1N5W A;  1ZUD 2;  1QOB A;  3AU4 A;  2MLB A;  4URK A;  2G4D B;  3M63 B;  4WUR A;  2ZNV B;  2HTM E;  4DK5 A;  3QX1 A;  4K7U A;  2GBJ A;  2N7E A;  3ZNI D;  2D3C A;  1GJZ A;  1WSP A;  3NRZ A;  4C4V A;  4LCD E;  1GUA B;  3I5J C;  4EZK A;  2O2V B;  3MP9 A;  2SAK A;  2CKH B;  5AEK B;  1WH3 A;  4TKN A;  4HWI B;  2JUO A;  1TS5 A;  5H92 C;  1UH6 A;  4W9K A;  4LLG M;  3Q8B A;  3TSS A;  1UWX A;  4XGA B;  4ZHP A;  2DYO A;  2LWP A;  2I2Y A;  4KDL B;  4QAY A;  3KW5 B;  4IWO A;  1L4Z B;  1BML C;  4IM0 A;  1FNW A;  2RR9 A;  4MGI E;  4KGR A;  5D94 A;  4EFO A;  1C76 A;  2MCN B;  4B9K A;  4HRO A;  1IPG A;  1SXT A;  3ENE A;  3GE3 C;  1T5X D;  1CK1 A;  3AE8 B;  2KC1 A;  1YN5 A;  3ZXV A;  2GMI C;  2GB1 A;  2J0M A;  1HZ5 A;  2MBB B;  4OVV A;  3S2A A;  4A8X C;  3N3K B;  2V9H A;  3ZIM A;  2PPH A;  2D2Q A;  3DWG C;  2FCQ A;  4NJC A;  2UU7 A;  2M0X A;  1TBE A;  2IGD A;  3MJW A;  4BKS A;  3ZNZ B;  1P0R A;  4A3O A;  2LGS A;  3IHP C;  1NEK B;  3GS2 A;  2WWZ A;  2UYZ B;  3QCA A;  2IY1 B;  2K6Q A;  3RUI B;  2PIA A;  2KMC A;  4LNI A;  2EMS A;  2CS4 A;  1SE2 A;  2N9K A;  4DDG D;  2LHE A;  4XX5 A;  1E90 A;  4WWN A;  1N6Z A;  1N61 A;  3A1Q A;  1I4R A;  3NOB A;  1PGB A;  2L1A A;  3TL5 A;  4HEA 1;  2ZCC A;  3B2G A;  2KTF A;  1SJE D;  3RNF C;  2WXL A;  3ZO5 B;  1QQR A;  1L5P A;  3VTU A;  4WAF A;  3DBL B;  3VQI A;  3SFE B;  1UEL A;  2WHI A;  3NS8 A;  1RAX A;  4GB9 A;  3T3O A;  3ZQ4 A;  1IYF A;  3VUW A;  1E8W A;  2M17 A;  4TV3 A;  3QHT A;  3QIJ A;  1FD6 A;  2O6V A;  4KKJ A;  3EUB 2;  1WGK A;  2HD5 B;  2KX3 A;  2WXG A;  2L00 B;  3LYY A;  4YSZ B;  3MC9 A;  1I4P A;  2JZZ A;  1FXA A;  5JXV A;  2BWE S;  2G3Q B;  4EZJ A;  1V5T A;  2BB5 A;  2Z59 B;  4YXD B;  4HJG E;  5AZF A;  4JX1 C;  3AE4 B;  1PGA A;  3FAH A;  1KLG D;  3CWI A;  2JY6 A;  1V1P B;  2K39 A;  3SU8 X;  2WP9 B;  3AM9 A;  4GDK A;  4KVG B;  4NPN A;  2NCN A;  1XXG A;  2NMQ A;  1MHH E;  2W82 A;  1STE A;  4KV2 A;  1F52 A;  4YTN B;  2HE7 A;  2WXI A;  2BF8 B;  2CU1 A;  4C7Y A;  1QOF A;  1NEN B;  2VH2 A;  3MC8 A;  2KQS A;  4DQO C;  3DDC B;  1B1Z A;  4WH4 A;  1V1O A;  3APF A;  1CMX B;  3CMM B;  3Q14 C;  1F77 A;  4S17 A;  4MH0 E;  3W1Y A;  1LFD A;  4YWG G;  1P3Q U;  2DX5 B;  2OJW A;  3IBE A;  4RH6 A;  3IT4 B;  4ZRI A;  1TYG B;  2H89 B;  2M56 B;  2ZVN A;  2KAC A;  4XC2 A;  1KM7 A;  3P4P B;  1UGM A;  3KUZ A;  2W55 A;  3OWE B;  3WIM A;  4HPM B;  4HCN B;  4FHK A;  1VRA B;  1DOX A;  3AV8 A;  2IGH A;  2L76 A;  1P7F A;  4C80 A;  3ZDT A;  4WJO A;  4WQO B;  2NTS A;  2YEP F;  3UQB A;  2ZZP B;  4PK1 A;  4K7S A;  2KFK A;  3N20 C;  1SE9 A;  3ZNH B;  2X8X X;  4NQK E;  4ZRJ A;  2N9P C;  5FR3 A;  2KHW B;  2IZV B;  3ZRF A;  1JW9 D;  3ZTC A;  3MJ5 A;  4AWJ A;  2ICI A;  2AL6 A;  4BKS D;  2QHO A;  4XWW A;  4J3O D;  1H8C A;  1RWS A;  4RGO S;  5D3I B;  2HJ8 A;  3RNB C;  1GPX A;  1E8X A;  1T3Q A;  2BBC A;  5EE1 A;  1XO3 A;  3TUO A;  3H7P A;  3I57 A;  1E7U A;  3C0R B;  3NVW A;  5J18 A;  1SE3 A;  1BUI C;  3AE6 B;  4EKU A;  2QC8 A;  1SIF A;  1KTK A;  2BTE A;  3R8B A;  1TIF A;  2KC2 A;  3A33 B;  4H2A A;  2CR5 A;  2MP2 A;  3ZYY X;  2C60 A;  2VRR B;  2BYE A;  3MC0 B;  1EU3 A;  3K9P B;  1D4B A;  4HDO A;  3TCA A;  3A4R A;  4MT5 A;  4RGT A;  4JL9 A;  3PHX B;  5IAA C;  1WXM A;  3H6N A;  3U8Z A;  4ANV A;  3R7R A;  1M4V A;  2ASQ A;  5HFY A;  4G50 A;  3Q3O C;  4WWM A;  2C9W B;  1V97 A;  2REX A;  2ZW0 A;  3I3T B;  1ACC A;  1T0R C;  1VD2 A;  2XK5 B;  5FR6 A;  2ZW1 A;  1WFY A;  1K50 A;  4EEW A;  4ICU A;  4D2K A;  1WM3 A;  5JHA A;  1Q0W B;  3HM6 X;  4OHJ A;  2DWQ A;  3R66 C;  1V6E A;  3FIL B;  2JSV X;  3PVL A;  1VLB A; 
#chains in the Genus database with same CATH homology
 2QIE B;  1E6E B;  1K51 A;  1SIJ A;  3AH7 A;  3GP7 A;  3W5V B;  1FIQ A;  1VR9 A;  2G9H D;  4USA A;  5MPO A;  2X38 A;  2FUG 1;  3KQ4 A;  2DBY A;  2WQY B;  4OW0 A;  1AYF A;  4ARC A;  4L23 A;  1XLN A;  3ZJU A;  1TJE A;  2J52 A;  5BMG A;  5G5H A;  2BS4 B;  4MAC A;  4A9A A;  2GRI A;  1D6E C;  4N59 A;  3Q69 A;  4WIP A;  1SE4 A;  3J9C A;  3NVY A;  4ZRQ A;  4JWS C;  1V8C A;  5AUK A;  4LK0 M;  1NI3 A;  1ROE A;  1PUT A;  2BS3 B;  3U4E G;  3HVZ A;  3BWU D;  1AN8 A;  3LXF A;  2Y5P A;  4M0W A;  3AE3 B;  2LFI A;  1D5X C;  2IPK D;  3AE1 B;  3T3N A;  1WYG A;  2BT6 A;  3AE2 B;  5T8I A;  2ONQ A;  2WDR B;  1OFF A;  1KFY B;  2SEB D;  1GB1 A;  3ZJT A;  1XLO A;  3FIL A;  2DLB A;  4PT5 A;  4RFB A;  1J7A A;  1L6U A;  5AUI A;  4OZA A;  2BW2 A;  2WU5 B;  4NZL B;  1FNU A;  1ZDV A;  1N63 A;  2EEL A;  3HUI A;  1HXY D;  2PKO A;  1TS3 A;  2K5P A;  2AQ1 B;  1V1P A;  4RGM A;  2QIL A;  2J42 A;  1KF6 B;  1ZXI A;  3PO0 A;  2BYT A;  2V3P A;  2PLP A;  4WQM A;  3DWM A;  5BYS A;  1PFD A;  2Y3A A;  1N5W A;  2PVO D;  2WXR A;  3P42 A;  5FK9 C;  1ZUD 2;  1QOB A;  3KWV A;  4N58 A;  3V3X A;  2IJ0 A;  3BYT B;  3FC4 A;  1ET6 A;  3AE5 B;  4YSY B;  2IDY A;  5G5G A;  1N5X A;  3MHZ A;  1ZPS A;  1PYW D;  5E6J A;  2QEJ C;  3VRB B;  4GDL B;  2MJD A;  4IOI E;  3BK2 A;  2WXF A;  1FMA D;  4WUR A;  3U7Z A;  2JQR B;  2HTM E;  3SR6 A;  1QOG A;  4RF0 A;  1DOI A;  1CJE A;  2Z8L A;  2V4I B;  1NYQ A;  1WSP A;  3NRZ A;  2DYM A;  1IBX A;  3H8H A;  5GXG B;  3MP9 A;  2SAK A;  3P63 A;  4TSS A;  5H8Y E;  3KWL A;  2TSS A;  2N0S B;  1E9M A;  1IGC A;  1TS5 A;  5H92 C;  2WXQ A;  1JWA D;  5TSS A;  4JWU C;  4LLG M;  3Q8B A;  2L52 A;  3TSS A;  1UWX A;  1I4X A;  4ZHP A;  2DYO A;  2I2Y A;  1TS2 A;  4YTP B;  1GB4 A;  1L4Z B;  1BML C;  2CJO A;  4JPS A;  1FNW A;  4KGR A;  2WLB A;  4RF1 A;  1GAQ B;  1C76 A;  1CZP A;  4A6Q A;  4JE3 B;  4KGS A;  4HRO A;  5BYQ A;  3KLS X;  3W5U B;  4ZYS A;  3BK1 A;  3PZ7 A;  1SXT A;  1TKY A;  1YN3 A;  2JWU A;  5I4D A;  2KN4 A;  2Q5W D;  1T5X D;  1CK1 A;  2WS3 B;  3AE8 B;  3IAM 1;  4IDI A;  3MFG A;  1YN5 A;  5D3D A;  2GB1 A;  4GLS C;  1HZ5 A;  2D5G A;  4A8X C;  1E10 A;  2LMC A;  1L6V A;  1CQV A;  2N7J A;  3SEB A;  1QLB B;  3BZD B;  5C3J B;  4HRS A;  2JU6 X;  2M0A A;  3DWG C;  5LNK 1;  4DXG A;  4NJC A;  3ZGZ A;  4A90 A;  3ETR A;  1N60 A;  2IGD A;  3C8Y A;  1XEE A;  1ZP0 B;  2KWD A;  1I4Q A;  2MJ3 A;  1P7E A;  1C78 A;  1C79 A;  1NEK B;  1TZO A;  3GS2 A;  1LO5 D;  4RNA A;  3IAS 1;  4ZRP A;  1B9R A;  2W3R A;  1YJI A;  2W54 A;  2PIA A;  1XLQ A;  3NZ3 A;  1WRI A;  2RDG A;  1EM7 A;  1QOA A;  1E7P B;  1YMH E;  1SE2 A;  2N9K A;  2KDM A;  2LHE A;  4OZB A;  1IGD A;  1SJH D;  1N61 A;  4B0E A;  1I4R A;  2WXJ A;  2WXO A;  4LTU A;  1PGB A;  3AEB B;  1WXQ A;  1I4H A;  2WXH A;  1BXT A;  2L1A A;  1OQR A;  5EE9 A;  5EE0 A;  4HEA 1;  3B2G A;  1FFU A;  1SJE D;  3AMZ A;  2WXL A;  2JYT A;  1KH0 A;  3EA6 A;  1QQR A;  1L5P A;  2ON8 A;  1A70 A;  4WAF A;  2IGG A;  3PZ8 A;  3VQI A;  2OED A;  3W9C B;  2M19 A;  3IT6 B;  5HG2 A;  2INP E;  2RPV A;  3SFE B;  3LB8 C;  3HVD A;  3B9J A;  1FCC C;  2PMV A;  2QMT A;  3T3O A;  4C56 C;  4NAW B;  3ZQ4 A;  3AE7 B;  2Y5C A;  3EGR A;  3AEF B;  1J7B A;  1YN4 A;  2NTT A;  1HQR D;  4DXF A;  1FD6 A;  4KKJ A;  1JWM D;  3EUB 2;  1WGK A;  4KX6 B;  2HDE A;  1FRD A;  4CQN A;  1C4C A;  2WXG A;  2ACZ B;  3W1S A;  3LYY A;  4YSZ B;  4N6E B;  2G1E A;  1I4P A;  3BVG A;  1AW7 A;  1F2R C;  1FXA A;  5JXV A;  3P4S B;  2AX5 A;  1RFK A;  4KKI A;  4XDC A;  5BMI A;  2BB5 A;  1PGX A;  1JWB D;  4YXD B;  4HJG E;  4JX1 C;  4ZHO A;  1NYR A;  2LJI A;  3AE4 B;  2R61 A;  2RDH A;  1PGA A;  4UDU C;  2AQ2 B;  3FAH A;  1KLG D;  3CWI A;  1V1P B;  3AEA B;  4L1B A;  3P4R B;  2K9X A;  1YNT E;  2MJE A;  2XNA C;  4L2Y A;  1TS4 A;  3BYY B;  1DYQ A;  1Y56 A;  2WP9 B;  1FO4 A;  3AM9 A;  3E9S A;  3W2D A;  1AWD A;  5BMH A;  1MI0 A;  2OHF A;  2WXN A;  3GB1 A;  2K22 A;  2LEK A;  3R2I A;  4OZC A;  4KGT A;  1XXG A;  2NMQ A;  2WU2 B;  1MHH E;  1K52 A;  1IBX B;  4TQ0 A;  1D5M C;  2W82 A;  2VZK B;  1STE A;  4RCO A;  1ET9 A;  4O1N A;  1C77 A;  2H88 B;  2K0P A;  4RGN A;  4YTN B;  1XCT L;  1ESF A;  2WXI A;  5HHD G;  1JRO A;  1QT9 A;  1EWY C;  4C7Y A;  1QOF A;  1NEN B;  1C9F A;  4REZ A;  5C2T B;  2QSD A;  1L0V B;  4ZOH C;  1JWS D;  1I4G A;  1UGJ A;  1ZDX A;  1J7C A;  4DQO C;  1VZ7 A;  1B1Z A;  4WH4 A;  1V1O A;  3NVV A;  2L32 A;  1XLP A;  1JCK B;  1T6B X;  4AQ7 A;  1F77 A;  1HZ6 A;  3R2T A;  3AED B;  5HI1 A;  3Q8C A;  1TKE A;  1DOY A;  4YWG G;  4US8 A;  5BYR A;  4RH6 A;  1F2R I;  1N62 A;  3IT4 B;  3L4P A;  4YT0 B;  1L0Y B;  2FE8 A;  1TYG B;  1D5Z C;  4A55 A;  2H89 B;  2M56 B;  1MPE A;  1TKG A;  2E3T A;  1QF6 A;  1I7H A;  1FEH A;  2KAC A;  4HKQ A;  3SFD B;  1YQ4 B;  1UUP A;  1ZXH A;  1UWM A;  3P4P B;  4XWT A;  2WXK A;  2W55 A;  3OWE B;  1GOZ A;  1FCL A;  1FRR A;  4XDD A;  1VRA B;  3AN1 A;  2AQ3 B;  1FXI A;  3ZJV A;  3AV8 A;  1RM6 C;  2VZK D;  5D7G A;  3AEC B;  1DOX A;  2E6X A;  3Q8A A;  3RFZ B;  2IGH A;  3N9Y C;  4HKZ E;  1P7F A;  3CIR B;  3U2S C;  2KMM A;  4C80 A;  1DGJ A;  1PDX A;  2PVG C;  2BB6 A;  2JYE A;  3Q8E A;  2NTS A;  2LUM A;  2JZP A;  2LGI A;  1NVI D;  2WXP A;  1IUE A;  1SBB B;  1SSN A;  2YEP F;  1HA5 A;  3AEE B;  1MHX A;  3HRD D;  1JAL A;  1ENF A;  3B2F A;  1RYJ A;  3NVZ A;  4OVZ A;  3AEG B;  3BVZ A;  1L0X B;  5FR3 A;  1FNV A;  2J53 A;  2JXT A;  2FBW B;  3BII D;  1QKZ A;  3V05 A;  1MVK A;  3NUH B;  1WWT A;  2LHD A;  2CU3 A;  1JW9 D;  4TQ1 A;  4YTM B;  3MJ5 A;  2ICI A;  1KLU D;  2WDV B;  4XWW A;  2WDQ B;  1TY0 A;  4J3O D;  2V3N A;  3UI3 A;  4XE0 A;  1RWS A;  4P6V F;  3AB5 A;  2KQ4 X;  3O13 A;  4RGO S;  1YJJ A;  4B0M A;  5D3I B;  1TY2 A;  3AE9 B;  3VR9 B;  4Q2J A;  2GI9 A;  4IKG A;  1UNS A;  3URY A;  1L4D B;  2L83 A;  3TEW A;  4C7Z A;  1GPX A;  2PW9 A;  2JX5 A;  1T3Q A;  2BBC A;  5EE1 A;  1Q10 A;  1XO3 A;  2V0G A;  3TUO A;  3I57 A;  1JWU D;  4ITK A;  4AS1 A;  3NVW A;  4MH8 A;  4R3D A;  2WNM A;  1YQ3 B;  1SE3 A;  1BUI C;  1EU4 A;  2XN9 C;  3AE6 B;  3RPF C;  3P1M A;  1KTK A;  2BTE A;  3E56 A;  1EWC A;  2RMM A;  2INN E;  1KRH A;  3R8B A;  1SEB D;  5FKA C;  3BVM A;  2MEK A;  4H2A A;  2K3U A;  2KAJ A;  3VR8 B;  1FM0 D;  1F0Z A;  3ZYY X;  4EE2 A;  2I38 A;  1SB3 C;  2QJL A;  2W3S A;  1ZOY B;  2J4X A;  3ABV B;  3MC0 B;  1EU3 A;  1D4B A;  1R7S A;  1C4P A;  2CJN A;  4MT5 A;  2PTL A;  2WXM A;  4RGT A;  3TEY A;  1JML A;  1VJK A;  4NAM A;  2EKI A;  1ZE3 D;  1M4V A;  2N9L A;  1FFV A;  2B76 B;  5HFY A;  4FXC A;  1OQQ A;  4P16 A;  4US9 A;  4WWM A;  1V97 A;  3Q8F A;  1HEZ E;  2ZW0 A;  1ACC A;  1VZ8 A;  3IXS A;  1JQ4 A;  4ARI A;  1XF5 L;  2ZW1 A;  2MH7 A;  1K53 A;  1XCQ L;  4GDK B;  2BS2 B;  1VZ6 A;  1SF0 A;  4TMA B;  1K50 A;  1VDV A;  1JRP A;  1C4A A;  3NS1 A;  3TEZ A;  5EE3 A;  4D2K A;  3VRA B;  3I9V 1;  2YEP B;  4YSX B;  3U52 E;  3WCQ A;  4OHJ A;  2DWQ A;  1QIL A;  4MM3 B;  3FIL B;  1E0Z A;  2JSV X;  3TEX A;  1VLB A;  3P4Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...