3U2SC

Crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
116
structure length
90
Chain Sequence
TTFKLAACVTLACTRVKHCSFNITTDVKDRKQKVNATFYDLYRLISCQTTTTEAVDAATAAKVFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG9 heavy chain
publication title Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 16
structure length 90
sequence length 116
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.790 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3u2sC00
4DQOC 4YWGG 3U2SC 3U4EG
chains in the Genus database with same CATH superfamily
2KDMA 2EMSA 3DHIC 4UDUC 2OEDA 1EWYC 3MC0B 3I63C 4FJZA 2SEBD 1IPGA 2N7JA 4PYZA 2ZPNA 2C9WB 3GE3C 3BK1A 2NMQA 3TEZA 3EFUA 1HXYD 4ANVA 1XLNA 4KGSA 3K9OB 3TBLD 3B0AA 3OJ4B 4GDKB 3VR9B 5HHDG 1WWTA 4O1NA 3HM3A 2QDFA 2C7MB 2K5PA 2R2QA 1E6EB 1NDDA 2JU6X 2LUMA 2CJNA 2FCNA 4OHJA 3QARA 2NPTA 1HTOA 1FFVA 2IY0B 3BVZA 2BT6A 2YLMA 3GE8C 3A1QB 5FK9C 4HPMB 4BOZB 3P4PB 2LHDA 3L10B 3PGEA 3W1SA 2W55A 1TJEA 2ZEQA 3ZRCA 2LVQA 1GOZA 1WH3A 5TR5A 1TBEA 4HRSA 2K6DB 4IC7B 2PTLA 5D3DA 1MFWA 2GBMA 2INNE 1YOVB 3SDLC 1PUTA 2J53A 4GDLB 3KUCB 2L0FA 1T3QA 1FRDA 4W9KA 2L1AA 1WJ6A 2X8XX 4LJPB 1ESFA 1ENFA 3EUB2 1T5XD 2K25A 1VJKA 2BS3B 4WH4A 1HEZE 2FE8A 2Z0DB 2DWQA 5AZHA 2ASQA 1KOTA 1UBIA 1JWSD 3MJWA 3N3KB 1ISNA 3ENEA 3VRBB 1TY2A 2LXCA 1QILA 3QK0A 3DCGA 1KLUD 3NOBA 4DHZB 1Z5SB 3TSSA 1CQVA 1SEBD 4IWOA 1K51A 2BS2B 2PE6B 3APCA 1GJZA 3AI5A 4NPNA 2MA9B 1IBXA 4JQWC 3DVNU 2KD0A 3M63B 1E0ZA 4WAFA 3LDZE 2INCC 1XEEA 4R3DA 3VH3B 2DENB 5G5HA 3Q2AC 3N30A 4IWPA 3PS6A 2V1YA 1JWUD 1FXTB 1WMHA 4K3CA 4A20A 3VAWA 2JWUA 1Y8RC 1P7EA 3APDA 2MW5A 1I42A 1L7YA 4BKGA 1D5XC 3KVFB 4A3OA 4II3B 1I4GA 4DDGD 3P63A 3WIMA 1QT9A 2NPTB 1STEA 2WXMA 2K0PA 2KX0A 4C56C 3OJ3A 2GB1A 3IG3A 3N32A 3D32A 3AU4A 4AP4C 3O13A 1K52A 1DOXA 1N63A 4EUTA 1YNTE 1ZKHA 1L0VB 1F52A 4HJKA 3RNCC 4XE0A 2BWFA 4EZJA 3W1YA 1NENB 1T0YA 1N60A 2ZW0A 2KZRA 3Q8FA 1KM7A 2UYZB 2RDGA 1V5TA 2AL6A 2HJ1A 3NRZA 2KC1A 4HK2A 5TSSA 3ZTCA 2MX2A 4N9F4 5I4DA 1YMHE 2IGHA 2KACA 3PRZA 4REZA 2N1VA 1WJ4A 5JXVA 3Q3OC 1X1MA 5IAAC 2D3BA 2W54A 1I4QA 3AM9A 1YQBA 1WX7A 2KJ6A 1P1AA 3KYDD 3SR6A 2WX1A 4FLHA 4WWNA 3OG5A 2JZZA 2K1FA 3QHTA 1J7AA 1SE3A 2KDIA 1IGDA 1WF9A 1IBXB 2ZVOA 3JSVA 4RCOA 3URYA 4B9KA 4ZYNA 4BKSA 3UQAA 1UZXB 3RT3B 1XCQL 2DLBA 2MCNB 2KX3A 1ZDXA 4NAMA 4XYCA 5LLIA 1FRRA 2MBEA 3CF6E 3Q8BA 1FPYA 2DYMA 4LJOB 3ZDTA 2KQSA 3DDCB 3X0WA 1J8CA 3L4PA 2FAZA 2V4IB 2WXKA 1L2NA 2Y3AA 2MJEA 2G45B 5KHOA 3KW5B 1I4XA 1E90A 3RZFA 2J0KA 2IJ0A 4YL8A 1SE4A 3NVZA 2N9KA 1PGBA 2WXPA 3VHTC 4TQ0A 3I57A 3VTVA 2HTME 1WZ0A 4KKJA 3PZ7A 1SBBB 3TCAA 2D5GA 1E5WA 3EA6A 3AEDB 2M1MA 5AZFA 2KWDA 2WP9B 2KQ4X 2VH1A 3PTFC 1GNUA 2KAJA 3LB8C 4MACA 4YSYB 3PLVA 4URKA 1WGGA 1FFUA 3A9JA 1TKEA 2MHJA 4YSXB 2OHFA 1P0RA 1ZUD2 1FMAD 4CHKA 3GZNI 4PS8A 4XC2A 2BF8B 4DK5A 1H4RA 3VRAB 1ET6A 3RN9C 1VR9A 4A90A 3VQIA 2ZJDA 3U2SC 4A8XC 1JWAD 2OOBB 3P42A 3QIJA 4AS1A 3IT4B 3IBEA 2L7RA 4WURA 5LNK1 4CQNA 2HDEA 3N1ZC 2BQQA 1RLFA 3I5JC 1A70A 2JWZA 1KJTA 1VCBA 5J18A 1Y56A 3W5UB 2KVRA 3JSVB 4BKSD 1TS5A 3Q8AA 3UF8A 2KJHB 4W9HA 1T0SC 4X57B 3MP9A 2DAFA 1K53A 2CJOA 2FIDA 3CMMB 2I1JA 3P2BA 2AQ2B 5DCNA 3B2FA 4GGQA 4CYEA 4GSWA 4MELA 2IPKD 2ZNVB 1B9RA 2BWES 3SD5A 2CKHB 3VUWA 1V49A 1ZPSA 3ECIA 2V9HA 3Q3NC 1K50A 4AJYB 1QQRA 1FO4A 2BPSA 1LQBA 4TUUA 4C7YA 2Y5PA 4IOIE 1VLBA 3ONSA 2PPHA 5G2NA 3AMZA 3I9V1 4OZCA 2WXQA 2NS5A 3DHGC 3PZ8A 4XDDA 1C77A 5L95C 2QSDA 2QHOA 3TEYA 1ZGUB 1NEKB 1R4NI 3MHSD 3H1UA 3JVZX 4M0WA 4IWQA 2WXOA 1E7PB 2N4FA 2LD9A 1LXDA 2V4LA 1C4PA 1XCTL 1NI2A 5L83A 4MT5A 2IGDA 4ZRKA 3RFZB 5FR3A 3A9JB 2OJWA 1IP9A 4JE3B 1YN4A 2NBUA 2W82A 3M95A 4WAAA 1UGJA 2JRHA 1UWMA 3DVGY 3M3JA 4NJCA 2BYEA 2GLSA 3L0WB 2GMIC 5C23A 1EO6A 2MH7A 4WQOB 2SAKA 3AB5A 1H8CA 3DBRI 3DWGC 4IM2A 3ZJTA 2D3AA 2WXRA 3DBSA 2DAJA 2MQJA 3V6CB 4OZAA 1SXTA 2FIFA 1ZE3D 3QJZA 2LASA 4BFRA 4USAA 1OQQA 3R2IA 1FD6A 3PO0A 3QX1A 1N6ZA 4LNKA 4K1RB 4W9GA 2LGIA 2AWTA 1TT5B 3QC8B 4B0EA 3NZ3A 1FNVA 2YVCA 3KH0A 5GMVA 4E74A 1XF5L 3RPFC 3VVWB 2QMTA 2VZKD 4GU2A 1SE9A 2MSED 2YEPF 4WQMA 2G9HD 4HJGE 3AULA 1XXGA 5HKHA 1ACCA 2AL3A 3ABVB 3W5VB 2B3AA 4KSLC 3AE6B 3ZW3A 2IZVB 1C4CA 3ALBA 2PVOD 2INPE 5IOIA 4GDLA 4ZOHC 3KYCD 2G4DB 1C3TA 4PS3A 2N7DA 3ZVVA 2CR5A 2LFIA 4BVUC 3DBLB 2KDFB 2WGSA 3AE1B 1Z2MA 3T8MA 2LWPA 3C8YA 1QZEA 4M0WB 3AECB 2D2QA 2KLCA 1TS4A 4XGAB 4RF0A 1D5MC 1C1YB 2WU2B 4NJ6A 2JYEA 4NNJB 3DBHB 2NR2A 2JPHA 2LVPA 5IN7A 2IO0B 2GBNA 2N9PC 4RFBA 4KX6B 4IUMB 2K9XA 1MG8A 4L2YA 5BMGA 3BINA 2EMTA 3Q8CA 4HVBA 1BT0A 3PHWB 3Q69A 1G6JA 3KQ4A 3C0RB 3GB1A 1GAQB 2RGFA 4KSKC 2KMCA 5BYSA 4XX5A 2M8SA 2D10A 1XLQA 3L17A 2PEAA 1TZOA 3CSFA 1JW9D 2DZMA 3B2GA 4W9DA 2BS4B 1FXIA 1RYJA 2ZZPB 3LJ3A 3RNBC 2O2VA 3L54A 2G3QB 3HRDD 4IM3A 2V3PA 2KWVB 4GN1A 1FIQA 1FEHA 4C80A 2C7NB 1WX8A 2IYDB 1QLBB 2ICIA 3L16A 4IW0A 2O6VA 2BKFA 2K3UA 4ZDVA 5D94A 2GBRA 3WALA 3L08A 1HZ5A 3DHHC 2H89B 2V3NA 1D5ZC 2BYTA 4MJSA 3VTUA 1VZ8A 1UBQA 3W9CB 4W9JA 4P1BC 1VRAB 2NVUI 1I7HA 1E8WA 2ZCCA 4BOSC 1JROA 2CHXA 2HJ8A 2Z59B 4F8CB 3QAQA 3H6NA 3PRMB 2WDVB 3J9CA 3WAPA 3K9PB 3TIXA 1UWXA 3HK0A 4IG7B 2QIEB 4A3PA 2ONQA 2OJRA 2WYQA 4RF1A 1F2RC 2JZ3B 1VD2A 5BMHA 2LRWA 2ZVNA 4GMVA 1TS2A 2WXLA 2G4SA 2LGDA 4ZYSA 2RPQA 3JW0X 5DPSA 3P1MA 1V97A 4ZRIA 1WGHA 2ACZB 1F0ZA 4EZLA 2LEKA 1Q10A 3O65B 4GLSC 3QCAA 4LNIA 4JWUC 4ACFA 1XD3B 1SE2A 1F2RI 1FNWA 3DOWA 2EKIA 2EELA 2DZKA 1ZDVA 1YJ1A 2WX0A 1ET9A 2QJLA 1LO5D 3AEAB 2KN4A 3NUHB 1I4RA 4B0MA 2KO3A 2KNBA 2L83A 4QAYA 3P4RB 2O2VB 4K3BA 2L8JA 1RWSA 1ZOYB 4RGMA 2RDHA 1N5WA 1V80A 3ZO5B 1NBFC 3UQBA 2L52A 4AWJA 1YN5A 3OAWA 1HA5A 3I3TB 5DPTA 1V81A 2WQYB 1V5OA 2O6VB 2R61A 3R66C 4OVVA 4NJ7A 2A4ZA 5KHQA 1WR1A 4LTUA 3PREA 3ZXRA 1D6EC 1L0XB 3H9DA 3RZWC 1YJJA 2PLPA 4MJSB 2D3GA 3SEBA 3ZQ4A 1JALA 3IVFA 1WJUA 1YD8U 4KDLB 1NYRA 4TSSA 4BAXA 3H7PA 2NTTA 3HHMA 1TY0A 3UI3A 4M02A 2MLBA 3HVDA 2W3RA 4P1CC 3HVZA 1L5PA 5CHFA 2LGSA 3RNGC 2PJHA 5C3JB 4P7IA 1WGKA 1E8XA 4HPLB 5T8IA 1OFFA 2JXTA 2FUG1 3BVGA 4DWFA 2KT7A 4HEA1 1FXAA 1TTNA 3VTWA 1EF5A 1SIFA 3NHEB 3WA0A 3UGBB 1ZXHA 2JT4B 4WJQA 1MG4A 1WXSA 1BMLC 2K8HA 3DQVA 3W1SC 4ANXA 1QF6A 2WXJA 2JXXA 3IHPC 3T9LA 3B9JA 3Q3MC 2MRPA 3RMKC 1JWBD 1MVKA 4FXCA 1E9MA 3U52E 1VZ7A 4YT0B 2M19A 4G11A 4JX1C 2BVCA 2H88B 4HCPB 1HE8A 2AQ3B 4FJVB 2NBWB 1R4MB 4DHJD 1ROEA 4DHJB 4ARIA 2FUHB 2XN9C 4CO7A 3ML8A 2G1EA 4RNAA 3PPAA 1GB4A 1EF1A 2J7QB 3RULA 1LM8B 4YTNB 3HM6X 5AEKB 2JVCA 3E9SA 3NVYA 4TMAB 2INDC 1XO3A 3AEGB 1KFYB 2LI5A 4HKQA 1P98A 1UD7A 3AV8A 2IBIB 2I2YA 2Y5BB 1DGJA 1WZ3A 3PLUA 5GXGB 1VZ6A 3R3MA 4ANWA 1AN8A 2ZPYA 2LGYA 1F77A 3IAM1 4LLGM 3IAS1 3VUXA 1PQSA 1EU3A 2JUOA 4RM9A 3H7PB 4N6EB 2AQ1B 2RPVA 4RGTA 1WXMA 1NYQA 2JSVX 4HPPA 1XQQA 2L0TA 4WJNA 1YX6B 2D11A 2I1KA 1XLOA 5JH5C 3WAMA 5LXIB 3AEBB 4GB9A 2WDQB 4C7ZA 1Q1OA 2WDRB 3NG0A 1SSNA 5IP4D 4JL9A 3L13A 2IGGA 4MH0E 2NBVB 3R2TA 1WM2A 1UH6A 1C79A 1TKGA 1K8RB 1TYGB 4BKTA 3KWVA 4TKNA 3NS1A 2NCNA 2HTHA 4I6PA 1YJIA 3FILA 1KRHA 1KLVA 1JCKB 1TKYA 1MPEA 1QOBA 2WS3B 3Q3FA 2REXA 4D2KA 1BUIC 4L1BA 2W9NA 3U7DA 1TIFA 1L0YB 1TGZB 2RSUA 3M62B 2J42A 1KH0A 5E6OA 1EU4A 3MTNB 1E8YA 2K8CA 3TJPA 1E7VA 4JPSA 2YEPB 3H8HA 2N7EA 3AE2B 4W9LA 3HUIA 4MH8A 3PT2B 4C4VA 2XK5A 2FCQA 4HCNB 3ZLZA 1YIWA 1F9JA 4H2AA 2KTRA 3MFGA 4FN2A 3V6EB 3WAOA 3NVVA 1KTKA 2BBCA 2K22A 2DZIA 4EEWA 4A6QA 2ZCBA 1V8CA 1D4BA 2D07B 1ZXIA 1E10A 1MHHE 1R7SA 2M0XA 2KANA 1IUEA 1PDXA 4RGNA 3MJ5A 4LNFA 1PGAA 2LJ5A 2N9LA 3X23A 1RFAA 2LRUA 4DXFA 1QOGA 2RD0A 5G5GA 2KHWB 2ZNVC 1YQ4B 3FC4A 2L32A 4G50A 1WRDB 1S3SG 3BYTB 2CHZA 1LFDA 3PRPB 4YXDB 4K7SA 1NI3A 3BK2A 4F1SA 5HG2A 4HLEA 4OVUA 2QILA 3U8ZA 2M0AA 1I35A 1C78A 3H7SA 5J2RA 1A5RA 5G55A 2KLGA 1FCCC 4KZ0A 1WE7A 1P7FA 4FHKA 4TV3A 2BYVE 4NQKE 3SU8X 1VDVA 3FILB 3N9YC 1J7CA 2WXHA 2KOXA 4S0RA 3QWZB 1EWCA 2KTFA 2MBOA 2KFJA 3P4SB 2KK8A 2KMMA 4OZBA 2C60A 3EHVA 3NS8A 1RAXA 2MP2A 4ZRQA 4US8A 2E3TA 3EECA 5CTRC 3N1YC 4A55A 4RH6A 1E7UA 1XLPA 1U4AA 2LXAA 4II2B 4WJPA 4GIVA 3KUZA 3RUIB 4NQLB 3AE7B 2BTEA 1P3QU 4C4VB 3MHZA 2XK5B 4J3OD 2CS4A 3P4QB 3LYYA 1C76A 2KFKA 1WSPA 4KIKA 3R8BA 3V61A 2KTRB 4Q2JA 1WGYA 4MEMA 3WCQA 4JWSC 2K8BA 2PMVA 3VFKA 2Z0EB 1T6BX 4M00A 4HKZE 3TEXA 2WXFA 3ZTDA 2Q5WD 3UINB 2KWUB 5HFYA 3NY5A 1SJED 4NAWB 1UUPA 3ZRFA 4FHJA 4LCDE 3QA8A 2IO1B 1HZ6A 4IDIA 4LDTD 2JZPA 4LDTB 1IYFA 4PYUA 3E56A 1FNUA 5EE0A 4M8NA 4KV2A 2L05A 1WGRA 4EE2A 1I4HA 3FAHA 1T0QC 4A9AA 1WY8A 2TSSA 4HDOA 3RNEC 3TMPB 1WXQA 3EGRA 5AUKA 2BYFA 1C9FA 1UF0A 2KKCA 4ANUA 2NTSA 4LNNA 3N1XC 3B1LX 1UNSA 4YTMB 3AE8B 3Q8EA 4DDID 3Q3JA 5H8YE 3WANA 3A4SC 3ZJUA 2M4NA 1UELA 2N9XA 2XNAC 3KLSX 2ON8A 2MBBB 1EM7A 2B76B 3NZUA 4MGYE 2GBKA 3AEEB 4GOCA 4P6VF 2MP2B 2BKRB 4OW0A 3RNFC 3DBLI 3ZXVA 2WWZA 3QQ8B 1CJEA 3ZGZA 3NJTA 2K39A 1WRIA 4W9FA 4KGTA 3RYTA 3RCZA 2GBJA 1M4VA 2M17A 2KFKB 4KIKB 3ZUNA 2PKOA 1WJNA 4EKUA 3SFDB 3DBHI 5AUIA 4XWTA 1WGDA 5CX3A 2J52A 2VH2A 3NZSA 1GB1A 2R2OA 2IO2B 1OQRA 2MBHA 1L6VA 4XZ4A 3TL5A 2L3ZA 3AE3B 1JQ4A 2X38A 3MC8A 1SGHA 5EE9A 1V1PA 1OGWA 2EKEC 3VXWA 2CHWA 1E8ZA 2V0GA 2KVZA 2LZ6A 4FJYA 4RM8A 5CHVC 4MDKE 2BGFA 1UGMA 2I38A 1IGCA 2UWQA 1S1QB 3T3NA 2MBQA 4EOYA 2XEWA 3DVGX 4FULA 3U4EG 1N5XA 4ZHPA 2J4XA 4W9CA 2L76A 2AX5A 3V60A 5EE1A 4JGHB 4M01A 1P9DU 2KQ7A 4F7ZA 3ZDMC 2O6VD 1D3ZA 3ZJVA 1PFDA 2DNFA 4OVZA 4DBGA 1J19A 4ASWC 2LGXA 2JF5A 3DPDA 4MGIE 2KDBA 4G3XB 3DWMA 2MJDA 3CSTA 5D3IB 3N20C 1WIAA 3BVMA 3KWLA 5D6JB 2BB5A 4DXAB 4KKIA 4MSQB 4RMAA 1AWDA 5FKAC 1QOFA 3UIPB 2BB6A 4RGOS 2RMMA 1WE6A 4WWOA 1QKZA 2WHIA 1N62A 4WWPA 3AXCA 4ICVA 1OEYA 1PGXA 4M8MA 3SFEB 3A33B 5EDSA 3AU5A 1WI0A 3FKYA 2PIAA 3BIID 3ZIMA 2QC8A 3GZNB 1SIJA 4MGZE 1V6EA 1JMLA 1MHXA 2GRIA 3VUYA 4K7WA 2FCMA 2HE7A 4WIPA 3BZDB 1AARA 1DOYA 4ZRJA 3HIZA 3PSEB 2KDEB 1J0GA 1V1PB 2AEHA 2MJ3A 1JWMD 2UU7A 3W2DA 5E6JA 1DYQA 1BXTA 1GUAB 2DZJA 5H92C 4YSZB 4NY0A 3IFWB 1WX9A 1SB3C 2WLBA 2N9EB 5BO4B 2MEKA 1WMHB 4B6WA 4HWIB 3V62A 1XT9B 3VDZA 3ZNHB 4MGKE 1YN3A 4PS7A 5IKCM 1Q0WB 4US9A 4ZHOA 4ICUA 2GI9A 1FCLA 1JRUA 1RRBA 1KLGD 5DPWA 2K6QA 5JZEB 2CU3A 3Q14C 1GC7A 3PV1A 2D3CA 2PE9A 3ZNGC 5DPRA 1AW7A 3JYUA 3U7ZA 4E71A 4MM3A 1V9JA 1GC6A 2WNMA 1L4ZB 5FR6A 2FNJB 1V1OA 3T3OA 5HI1A 2IO3B 1GPXA 1ZW7A 1R4NB 4J6IA 1TZ1A 3ZNZB 1CMXB 2JYTA 4MSMB 3SHQA 3VR8B 1V2YA 1NVID 2E6XA 2WU5B 3V05A 4N59A 2N0SB 3RNAC 2IY1B 2WXGA 4KGRA 2HD5B 3GOEA 4WWMA 4N58A 1OEYJ 5C1ZA 4IM0A 4NZLB 1QOAA 2XBBC 1WYGA 3DBRB 4S17A 1LGRA 3IXSA 4BBNC 2FCSA 3CWIA 1C4AA 4XDCA 3DVNV 2KYWA 3A9KA 3APFA 3TUOA 2JRIB 5IO9A 5C2TB 3RD2A 2JX5A 1R4MI 2QCZA 2WXIA 1V86A 5EE3A 1L4DB 3A4RA 2CU1A 4W9IA 1CZPA 2VRRB 1SJHD 3UIOB 2DX5B 1HTQA 2Y5CA 1OQYA 2KWCA 3BYYB 3ML9A 4BBNF 4KVGB 1Q5WB 1J7BA 5LXHA 2AYOB 2M56B 4K81A 4TQ1A 1ZP0B 3BY4B 3B08A 1EUVB 3R7RA 4ZRPA 4DXGA 2Z8LA 3S2AA 4GXBA 2DHZA 4WJOA 1SF0A 2LUEA 4K7UA 1WYWB 2PW9A 3GP7A 4HDQA 3AE9B 4HXDA 4DHZE 4YWGG 4MM3B 2DYBA 2WDTB 4FBJB 2JY6A 3OLMD 2MWSB 3PHXB 4EFOA 1I4PA 4DQOC 2LJIA 2C5LC 2LVOA 4NAWA 4BZAA 1MJDA 5D2MB 2J0MA 3AEFB 2QEJC 2ZW1A 2PVGC 5JHAA 4AQ7A 1RM6C 1WXVA 1DOIA 3CIRB 3KUDB 4AJWA 4FADA 3MC9A 4HROA 1L6UA 5E6NA 2KJRA 2KMAA 1WM3A 4L23A 3OWEB 1YX5B 2C7HA 1YQ3B 4P16A 2DBYA 3AN1A 4JLCA 2KXJA 3TEWA 2KN5A 1WR6E 1MI0A 4GDKA 2KC2A 3A9KB 3ETRA 2WXNA 1AYFA 2V3SA 1KF6B 2LHEA 3BWUD 4KDIC 4FA6A 1PYWD 5BMIA 3AE5B 3RI7C 2BW2A 2DYOA 2J0JA 3A1QA 2VZKB 2RDBC 4I6LB 1F1HA 2W3SA 3IT6B 4ITKA 4LNOA 4EZKA 2FBWB 5E6PA 2IDYA 5MPOA 1T0RC 3GS2A 1GG3A 3C19A 3R7QA 2GOWA 3LXFA 4JIOU 4LK0M 3U30A 3EC8A 4AUQC 1OTRB 1B1ZA 3ZKJC 4IKGA 5J17A 5D7GA 4XWWA 1TS3A 5JHBA 4ARCA 4YTPB 3AE4B 1N61A 2RR9A 1FM0D 4PT5A 4C00A 3V3XA 3Q6BA 1HQRD 3NVWA 4G0NB 4B95A 1RFKA 5BYRA 1JRPA 2A5UA 4E3CA 4AOFA 1CK1A 4W9EA 1WFYA 2N1WA 4I6NB 1WXAA 3ZYYX 2JQRB 3ZNID 2LMCA 5IA7A 2L00B 5AZGA 3EFCA 1M94A 5CHWA 4PK1A 3PVLA 3VH4B 5BYQA 4KZCA 3PZDA 3AH7A
chains in the Genus database with same CATH topology
2KDMA 1N5XA 4ZHPA 2J4XA 1C4PA 1XCTL 4UDUC 2OEDA 2AX5A 4MT5A 2IGDA 1EWYC 3MC0B 3RFZB 3E9SA 5FR3A 2SEBD 5EE1A 3NVYA 2N7JA 4TMAB 4JE3B 1YN4A 1XO3A 3AEGB 1KFYB 2W82A 4HKQA 3AV8A 1UGJA 2NMQA 3BK1A 1UWMA 3TEZA 2I2YA 3ZJVA 1HXYD 1DGJA 1PFDA 4NJCA 4OVZA 1XLNA 4KGSA 5GXGB 1VZ6A 2MH7A 2SAKA 3AB5A 3DWGC 1AN8A 4GDKB 3VR9B 5HHDG 1F77A 1WWTA 4O1NA 3ZJTA 3IAM1 4LLGM 3IAS1 2K5PA 1EU3A 2WXRA 1E6EB 3DWMA 2MJDA 5D3IB 2JU6X 2LUMA 1SXTA 2CJNA 1ZE3D 4OZAA 4N6EB 2AQ1B 2RPVA 4OHJA 4RGTA 3BVMA 4USAA 1NYQA 3KWLA 1OQQA 3R2IA 1FD6A 1FFVA 2JSVX 2BB5A 3PO0A 3BVZA 2BT6A 4KKIA 5FK9C 1AWDA 3P4PB 2LHDA 1XLOA 1QOFA 2LGIA 5FKAC 3AEBB 2BB6A 4RGOS 2RMMA 2W55A 3W1SA 1TJEA 2WDQB 4C7ZA 4B0EA 3NZ3A 1FNVA 1QKZA 2WDRB 1SSNA 1N62A 1GOZA 4HRSA 1XF5L 3RPFC 2PTLA 2QMTA 2VZKD 1PGXA 5D3DA 3SFEB 2IGGA 2INNE 3R2TA 1C79A 1TKGA 2YEPF 1PUTA 4WQMA 2J53A 1TYGB 4GDLB 1T3QA 1FRDA 2L1AA 2G9HD 4HJGE 2PIAA 3KWVA 3BIID 1ESFA 1XXGA 1ACCA 1ENFA 3ABVB 3NS1A 3W5VB 3EUB2 1T5XD 3AE6B 1SIJA 1VJKA 1C4CA 1YJIA 3FILA 2BS3B 4WH4A 1KRHA 2PVOD 2INPE 1JMLA 1HEZE 2FE8A 4ZOHC 1MHXA 2DWQA 2GRIA 1JCKB 1TKYA 1JWSD 1MPEA 1QOBA 4WIPA 3BZDB 3VRBB 1DOYA 2WS3B 1TY2A 4D2KA 1BUIC 4L1BA 1V1PB 2MJ3A 1QILA 1L0YB 2LFIA 1JWMD 3W2DA 2J42A 5E6JA 1DYQA 1KLUD 1BXTA 1KH0A 3TSSA 5H92C 1CQVA 1EU4A 1SEBD 4YSZB 3AE1B 4JPSA 2YEPB 3H8HA 1K51A 2BS2B 3C8YA 1SB3C 3AE2B 2WLBA 3HUIA 4MH8A 3AECB 2MEKA 1IBXA 1E0ZA 4WAFA 1XEEA 4H2AA 4R3DA 1TS4A 1YN3A 5G5HA 4RF0A 1D5MC 2WU2B 2JYEA 3MFGA 4US9A 4ZHOA 2GI9A 1FCLA 1JWUD 1KLGD 2JWUA 3NVVA 1KTKA 1P7EA 4RFBA 2BBCA 2K22A 2CU3A 4KX6B 2K9XA 4L2YA 5BMGA 4A6QA 1D5XC 1V8CA 3Q8CA 1AW7A 1D4BA 1ZXIA 1I4GA 3Q69A 3P63A 1MHHE 1E10A 3U7ZA 3KQ4A 1QT9A 1R7SA 3GB1A 1GAQB 1IUEA 1PDXA 4RGNA 3MJ5A 5BYSA 2WNMA 1PGAA 1L4ZB 1STEA 1XLQA 2WXMA 1V1OA 1TZOA 2K0PA 2N9LA 4C56C 1JW9D 4DXFA 3B2GA 1QOGA 2GB1A 3T3OA 5HI1A 2BS4B 5G5GA 1FXIA 1GPXA 1RYJA 1YQ4B 3FC4A 3O13A 2L32A 1K52A 1DOXA 1N63A 1YNTE 3HRDD 3BYTB 2V3PA 1L0VB 4XE0A 2JYTA 4YXDB 1FIQA 1NI3A 1FEHA 3VR8B 4C80A 1NENB 3BK2A 5HG2A 1NVID 2E6XA 2WU5B 3V05A 4N59A 1N60A 2QILA 2M0AA 2ZW0A 2N0SB 1C78A 1QLBB 2ICIA 3Q8FA 2RDGA 2WXGA 3NRZA 1FCCC 1P7FA 4KGRA 4WWMA 4N58A 5TSSA 2K3UA 3U4EG 5I4DA 1YMHE 2IGHA 1VDVA 3FILB 1HZ5A 3N9YC 2KACA 2H89B 1J7CA 2V3NA 4REZA 2WXHA 1EWCA 5JXVA 4NZLB 1D5ZC 1QOAA 2BYTA 3P4SB 1VZ8A 1WYGA 2KMMA 4OZBA 3W9CB 3IXSA 3CWIA 1VRAB 2W54A 1I4QA 3AM9A 1C4AA 4XDCA 1I7HA 3SR6A 4ZRQA 4US8A 2E3TA 3TUOA 4A55A 1JROA 4RH6A 5C2TB 2JX5A 1XLPA 2WDVB 3J9CA 1J7AA 1SE3A 2WXIA 5EE3A 1L4DB 1UWXA 1IGDA 1CZPA 2QIEB 1SJHD 3AE7B 2BTEA 1IBXB 2ONQA 3MHZA 4RCOA 3URYA 4J3OD 2Y5CA 3P4QB 3LYYA 1C76A 3BYYB 1WSPA 3R8BA 4Q2JA 4RF1A 1F2RC 3WCQA 1XCQL 2DLBA 5BMHA 1J7BA 4JWSC 1TS2A 2PMVA 2WXLA 2M56B 4ZYSA 4TQ1A 1ZDXA 1ZP0B 3P1MA 4NAMA 1V97A 1T6BX 1FRRA 4ZRPA 2ACZB 3Q8BA 4DXGA 1F0ZA 4HKZE 3TEXA 2Z8LA 2DYMA 2LEKA 1Q10A 2WXFA 2Q5WD 1SF0A 4GLSC 3L4PA 4JWUC 5HFYA 2PW9A 3GP7A 2V4IB 3AE9B 1SJED 4NAWB 1SE2A 2WXKA 1UUPA 1F2RI 4YWGG 2Y3AA 2MJEA 4MM3B 1FNWA 1I4XA 1HZ6A 2EKIA 2EELA 4IDIA 2JZPA 2IJ0A 1ZDVA 1SE4A 3NVZA 1ET9A 2N9KA 1PGBA 2QJLA 2WXPA 1LO5D 3E56A 1FNUA 1I4PA 2KN4A 2LJIA 3AEAB 1I4RA 3NUHB 5EE0A 4DQOC 3I57A 4TQ0A 4B0MA 2L83A 2HTME 3P4RB 4KKJA 3AEFB 3PZ7A 1SBBB 1RWSA 1ZOYB 4RGMA 2QEJC 2RDHA 2D5GA 1N5WA 2ZW1A 3EA6A 2PVGC 4EE2A 3AEDB 1I4HA 4AQ7A 1RM6C 3FAHA 2KWDA 1DOIA 4A9AA 2WP9B 2TSSA 2KQ4X 3CIRB 2L52A 2KAJA 1YN5A 3LB8C 1WXQA 4MACA 4HROA 1L6UA 3EGRA 1HA5A 5AUKA 1C9FA 2WQYB 4YSYB 2R61A 2NTSA 4L23A 1FFUA 1UNSA 4YTMB 3AE8B 3OWEB 3Q8EA 1TKEA 5H8YE 4YSXB 2OHFA 1ZUD2 3ZJUA 1YQ3B 1FMAD 4LTUA 4P16A 1D6EC 1L0XB 2DBYA 3AN1A 2XNAC 1YJJA 3KLSX 2ON8A 2PLPA 1EM7A 3TEWA 2B76B 3VRAB 1ET6A 3SEBA 3ZQ4A 1JALA 1VR9A 4A90A 1MI0A 3VQIA 3AEEB 4P6VF 3U2SC 1NYRA 4OW0A 4A8XC 1JWAD 3P42A 3ETRA 4TSSA 4AS1A 2NTTA 3IT4B 4WURA 5LNK1 4CQNA 2WXNA 1AYFA 2HDEA 1KF6B 1TY0A 2LHEA 3BWUD 3UI3A 1PYWD 5BMIA 1CJEA 3AE5B 3ZGZA 1A70A 2BW2A 2DYOA 3HVDA 2W3RA 1WRIA 1Y56A 2VZKB 3W5UB 2W3SA 3IT6B 4KGTA 3HVZA 1L5PA 1TS5A 1M4VA 5C3JB 3Q8AA 4ITKA 1WGKA 2PKOA 5T8IA 2FBWB 1OFFA 2JXTA 2FUG1 3MP9A 2IDYA 3BVGA 5MPOA 1K53A 2CJOA 2AQ2B 3GS2A 4HEA1 3SFDB 5AUIA 1FXAA 3LXFA 4XWTA 3B2FA 4LK0M 2IPKD 1B1ZA 2J52A 1B9RA 1ZXHA 4IKGA 1ZPSA 5D7GA 4XWWA 1TS3A 1GB1A 1BMLC 1OQRA 4ARCA 4YTPB 1QF6A 2WXJA 1L6VA 3AE4B 1K50A 1QQRA 1FO4A 3AE3B 1N61A 3B9JA 1JQ4A 2X38A 4C7YA 1FM0D 4PT5A 2Y5PA 1JWBD 1MVKA 4FXCA 4IOIE 3V3XA 1E9MA 1VLBA 3U52E 1HQRD 1VZ7A 4YT0B 3NVWA 2M19A 5EE9A 1RFKA 4JX1C 1V1PA 3AMZA 5BYRA 2H88B 1JRPA 3I9V1 2V0GA 4OZCA 2AQ3B 2WXQA 1CK1A 3PZ8A 1ROEA 4XDDA 1C77A 3ZYYX 2JQRB 2LMCA 2QSDA 4ARIA 2I38A 3TEYA 1IGCA 2XN9C 1NEKB 2G1EA 4RNAA 3T3NA 4M0WA 2WXOA 1E7PB 1GB4A 5BYQA 4YTNB 3AH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQO C;  4YWG G;  3U2S C;  3U4E G; 
#chains in the Genus database with same CATH topology
 2KDM A;  2EMS A;  3DHI C;  4UDU C;  2OED A;  1EWY C;  3MC0 B;  3I63 C;  4FJZ A;  2SEB D;  1IPG A;  2N7J A;  4PYZ A;  2ZPN A;  2C9W B;  3GE3 C;  3BK1 A;  2NMQ A;  3TEZ A;  3EFU A;  1HXY D;  4ANV A;  1XLN A;  4KGS A;  3K9O B;  3TBL D;  3B0A A;  3OJ4 B;  4GDK B;  3VR9 B;  5HHD G;  1WWT A;  4O1N A;  3HM3 A;  2QDF A;  2C7M B;  2K5P A;  2R2Q A;  1E6E B;  1NDD A;  2JU6 X;  2LUM A;  2CJN A;  2FCN A;  4OHJ A;  3QAR A;  2NPT A;  1HTO A;  1FFV A;  2IY0 B;  3BVZ A;  2BT6 A;  2YLM A;  3GE8 C;  3A1Q B;  5FK9 C;  4HPM B;  4BOZ B;  3P4P B;  2LHD A;  3L10 B;  3PGE A;  3W1S A;  2W55 A;  1TJE A;  2ZEQ A;  3ZRC A;  2LVQ A;  1GOZ A;  1WH3 A;  5TR5 A;  1TBE A;  4HRS A;  2K6D B;  4IC7 B;  2PTL A;  5D3D A;  1MFW A;  2GBM A;  2INN E;  1YOV B;  3SDL C;  1PUT A;  2J53 A;  4GDL B;  3KUC B;  2L0F A;  1T3Q A;  1FRD A;  4W9K A;  2L1A A;  1WJ6 A;  2X8X X;  4LJP B;  1ESF A;  1ENF A;  3EUB 2;  1T5X D;  2K25 A;  1VJK A;  2BS3 B;  4WH4 A;  1HEZ E;  2FE8 A;  2Z0D B;  2DWQ A;  5AZH A;  2ASQ A;  1KOT A;  1UBI A;  1JWS D;  3MJW A;  3N3K B;  1ISN A;  3ENE A;  3VRB B;  1TY2 A;  2LXC A;  1QIL A;  3QK0 A;  3DCG A;  1KLU D;  3NOB A;  4DHZ B;  1Z5S B;  3TSS A;  1CQV A;  1SEB D;  4IWO A;  1K51 A;  2BS2 B;  2PE6 B;  3APC A;  1GJZ A;  3AI5 A;  4NPN A;  2MA9 B;  1IBX A;  4JQW C;  3DVN U;  2KD0 A;  3M63 B;  1E0Z A;  4WAF A;  3LDZ E;  2INC C;  1XEE A;  4R3D A;  3VH3 B;  2DEN B;  5G5H A;  3Q2A C;  3N30 A;  4IWP A;  3PS6 A;  2V1Y A;  1JWU D;  1FXT B;  1WMH A;  4K3C A;  4A20 A;  3VAW A;  2JWU A;  1Y8R C;  1P7E A;  3APD A;  2MW5 A;  1I42 A;  1L7Y A;  4BKG A;  1D5X C;  3KVF B;  4A3O A;  4II3 B;  1I4G A;  4DDG D;  3P63 A;  3WIM A;  1QT9 A;  2NPT B;  1STE A;  2WXM A;  2K0P A;  2KX0 A;  4C56 C;  3OJ3 A;  2GB1 A;  3IG3 A;  3N32 A;  3D32 A;  3AU4 A;  4AP4 C;  3O13 A;  1K52 A;  1DOX A;  1N63 A;  4EUT A;  1YNT E;  1ZKH A;  1L0V B;  1F52 A;  4HJK A;  3RNC C;  4XE0 A;  2BWF A;  4EZJ A;  3W1Y A;  1NEN B;  1T0Y A;  1N60 A;  2ZW0 A;  2KZR A;  3Q8F A;  1KM7 A;  2UYZ B;  2RDG A;  1V5T A;  2AL6 A;  2HJ1 A;  3NRZ A;  2KC1 A;  4HK2 A;  5TSS A;  3ZTC A;  2MX2 A;  4N9F 4;  5I4D A;  1YMH E;  2IGH A;  2KAC A;  3PRZ A;  4REZ A;  2N1V A;  1WJ4 A;  5JXV A;  3Q3O C;  1X1M A;  5IAA C;  2D3B A;  2W54 A;  1I4Q A;  3AM9 A;  1YQB A;  1WX7 A;  2KJ6 A;  1P1A A;  3KYD D;  3SR6 A;  2WX1 A;  4FLH A;  4WWN A;  3OG5 A;  2JZZ A;  2K1F A;  3QHT A;  1J7A A;  1SE3 A;  2KDI A;  1IGD A;  1WF9 A;  1IBX B;  2ZVO A;  3JSV A;  4RCO A;  3URY A;  4B9K A;  4ZYN A;  4BKS A;  3UQA A;  1UZX B;  3RT3 B;  1XCQ L;  2DLB A;  2MCN B;  2KX3 A;  1ZDX A;  4NAM A;  4XYC A;  5LLI A;  1FRR A;  2MBE A;  3CF6 E;  3Q8B A;  1FPY A;  2DYM A;  4LJO B;  3ZDT A;  2KQS A;  3DDC B;  3X0W A;  1J8C A;  3L4P A;  2FAZ A;  2V4I B;  2WXK A;  1L2N A;  2Y3A A;  2MJE A;  2G45 B;  5KHO A;  3KW5 B;  1I4X A;  1E90 A;  3RZF A;  2J0K A;  2IJ0 A;  4YL8 A;  1SE4 A;  3NVZ A;  2N9K A;  1PGB A;  2WXP A;  3VHT C;  4TQ0 A;  3I57 A;  3VTV A;  2HTM E;  1WZ0 A;  4KKJ A;  3PZ7 A;  1SBB B;  3TCA A;  2D5G A;  1E5W A;  3EA6 A;  3AED B;  2M1M A;  5AZF A;  2KWD A;  2WP9 B;  2KQ4 X;  2VH1 A;  3PTF C;  1GNU A;  2KAJ A;  3LB8 C;  4MAC A;  4YSY B;  3PLV A;  4URK A;  1WGG A;  1FFU A;  3A9J A;  1TKE A;  2MHJ A;  4YSX B;  2OHF A;  1P0R A;  1ZUD 2;  1FMA D;  4CHK A;  3GZN I;  4PS8 A;  4XC2 A;  2BF8 B;  4DK5 A;  1H4R A;  3VRA B;  1ET6 A;  3RN9 C;  1VR9 A;  4A90 A;  3VQI A;  2ZJD A;  3U2S C;  4A8X C;  1JWA D;  2OOB B;  3P42 A;  3QIJ A;  4AS1 A;  3IT4 B;  3IBE A;  2L7R A;  4WUR A;  5LNK 1;  4CQN A;  2HDE A;  3N1Z C;  2BQQ A;  1RLF A;  3I5J C;  1A70 A;  2JWZ A;  1KJT A;  1VCB A;  5J18 A;  1Y56 A;  3W5U B;  2KVR A;  3JSV B;  4BKS D;  1TS5 A;  3Q8A A;  3UF8 A;  2KJH B;  4W9H A;  1T0S C;  4X57 B;  3MP9 A;  2DAF A;  1K53 A;  2CJO A;  2FID A;  3CMM B;  2I1J A;  3P2B A;  2AQ2 B;  5DCN A;  3B2F A;  4GGQ A;  4CYE A;  4GSW A;  4MEL A;  2IPK D;  2ZNV B;  1B9R A;  2BWE S;  3SD5 A;  2CKH B;  3VUW A;  1V49 A;  1ZPS A;  3ECI A;  2V9H A;  3Q3N C;  1K50 A;  4AJY B;  1QQR A;  1FO4 A;  2BPS A;  1LQB A;  4TUU A;  4C7Y A;  2Y5P A;  4IOI E;  1VLB A;  3ONS A;  2PPH A;  5G2N A;  3AMZ A;  3I9V 1;  4OZC A;  2WXQ A;  2NS5 A;  3DHG C;  3PZ8 A;  4XDD A;  1C77 A;  5L95 C;  2QSD A;  2QHO A;  3TEY A;  1ZGU B;  1NEK B;  1R4N I;  3MHS D;  3H1U A;  3JVZ X;  4M0W A;  4IWQ A;  2WXO A;  1E7P B;  2N4F A;  2LD9 A;  1LXD A;  2V4L A;  1C4P A;  1XCT L;  1NI2 A;  5L83 A;  4MT5 A;  2IGD A;  4ZRK A;  3RFZ B;  5FR3 A;  3A9J B;  2OJW A;  1IP9 A;  4JE3 B;  1YN4 A;  2NBU A;  2W82 A;  3M95 A;  4WAA A;  1UGJ A;  2JRH A;  1UWM A;  3DVG Y;  3M3J A;  4NJC A;  2BYE A;  2GLS A;  3L0W B;  2GMI C;  5C23 A;  1EO6 A;  2MH7 A;  4WQO B;  2SAK A;  3AB5 A;  1H8C A;  3DBR I;  3DWG C;  4IM2 A;  3ZJT A;  2D3A A;  2WXR A;  3DBS A;  2DAJ A;  2MQJ A;  3V6C B;  4OZA A;  1SXT A;  2FIF A;  1ZE3 D;  3QJZ A;  2LAS A;  4BFR A;  4USA A;  1OQQ A;  3R2I A;  1FD6 A;  3PO0 A;  3QX1 A;  1N6Z A;  4LNK A;  4K1R B;  4W9G A;  2LGI A;  2AWT A;  1TT5 B;  3QC8 B;  4B0E A;  3NZ3 A;  1FNV A;  2YVC A;  3KH0 A;  5GMV A;  4E74 A;  1XF5 L;  3RPF C;  3VVW B;  2QMT A;  2VZK D;  4GU2 A;  1SE9 A;  2MSE D;  2YEP F;  4WQM A;  2G9H D;  4HJG E;  3AUL A;  1XXG A;  5HKH A;  1ACC A;  2AL3 A;  3ABV B;  3W5V B;  2B3A A;  4KSL C;  3AE6 B;  3ZW3 A;  2IZV B;  1C4C A;  3ALB A;  2PVO D;  2INP E;  5IOI A;  4GDL A;  4ZOH C;  3KYC D;  2G4D B;  1C3T A;  4PS3 A;  2N7D A;  3ZVV A;  2CR5 A;  2LFI A;  4BVU C;  3DBL B;  2KDF B;  2WGS A;  3AE1 B;  1Z2M A;  3T8M A;  2LWP A;  3C8Y A;  1QZE A;  4M0W B;  3AEC B;  2D2Q A;  2KLC A;  1TS4 A;  4XGA B;  4RF0 A;  1D5M C;  1C1Y B;  2WU2 B;  4NJ6 A;  2JYE A;  4NNJ B;  3DBH B;  2NR2 A;  2JPH A;  2LVP A;  5IN7 A;  2IO0 B;  2GBN A;  2N9P C;  4RFB A;  4KX6 B;  4IUM B;  2K9X A;  1MG8 A;  4L2Y A;  5BMG A;  3BIN A;  2EMT A;  3Q8C A;  4HVB A;  1BT0 A;  3PHW B;  3Q69 A;  1G6J A;  3KQ4 A;  3C0R B;  3GB1 A;  1GAQ B;  2RGF A;  4KSK C;  2KMC A;  5BYS A;  4XX5 A;  2M8S A;  2D10 A;  1XLQ A;  3L17 A;  2PEA A;  1TZO A;  3CSF A;  1JW9 D;  2DZM A;  3B2G A;  4W9D A;  2BS4 B;  1FXI A;  1RYJ A;  2ZZP B;  3LJ3 A;  3RNB C;  2O2V A;  3L54 A;  2G3Q B;  3HRD D;  4IM3 A;  2V3P A;  2KWV B;  4GN1 A;  1FIQ A;  1FEH A;  4C80 A;  2C7N B;  1WX8 A;  2IYD B;  1QLB B;  2ICI A;  3L16 A;  4IW0 A;  2O6V A;  2BKF A;  2K3U A;  4ZDV A;  5D94 A;  2GBR A;  3WAL A;  3L08 A;  1HZ5 A;  3DHH C;  2H89 B;  2V3N A;  1D5Z C;  2BYT A;  4MJS A;  3VTU A;  1VZ8 A;  1UBQ A;  3W9C B;  4W9J A;  4P1B C;  1VRA B;  2NVU I;  1I7H A;  1E8W A;  2ZCC A;  4BOS C;  1JRO A;  2CHX A;  2HJ8 A;  2Z59 B;  4F8C B;  3QAQ A;  3H6N A;  3PRM B;  2WDV B;  3J9C A;  3WAP A;  3K9P B;  3TIX A;  1UWX A;  3HK0 A;  4IG7 B;  2QIE B;  4A3P A;  2ONQ A;  2OJR A;  2WYQ A;  4RF1 A;  1F2R C;  2JZ3 B;  1VD2 A;  5BMH A;  2LRW A;  2ZVN A;  4GMV A;  1TS2 A;  2WXL A;  2G4S A;  2LGD A;  4ZYS A;  2RPQ A;  3JW0 X;  5DPS A;  3P1M A;  1V97 A;  4ZRI A;  1WGH A;  2ACZ B;  1F0Z A;  4EZL A;  2LEK A;  1Q10 A;  3O65 B;  4GLS C;  3QCA A;  4LNI A;  4JWU C;  4ACF A;  1XD3 B;  1SE2 A;  1F2R I;  1FNW A;  3DOW A;  2EKI A;  2EEL A;  2DZK A;  1ZDV A;  1YJ1 A;  2WX0 A;  1ET9 A;  2QJL A;  1LO5 D;  3AEA B;  2KN4 A;  3NUH B;  1I4R A;  4B0M A;  2KO3 A;  2KNB A;  2L83 A;  4QAY A;  3P4R B;  2O2V B;  4K3B A;  2L8J A;  1RWS A;  1ZOY B;  4RGM A;  2RDH A;  1N5W A;  1V80 A;  3ZO5 B;  1NBF C;  3UQB A;  2L52 A;  4AWJ A;  1YN5 A;  3OAW A;  1HA5 A;  3I3T B;  5DPT A;  1V81 A;  2WQY B;  1V5O A;  2O6V B;  2R61 A;  3R66 C;  4OVV A;  4NJ7 A;  2A4Z A;  5KHQ A;  1WR1 A;  4LTU A;  3PRE A;  3ZXR A;  1D6E C;  1L0X B;  3H9D A;  3RZW C;  1YJJ A;  2PLP A;  4MJS B;  2D3G A;  3SEB A;  3ZQ4 A;  1JAL A;  3IVF A;  1WJU A;  1YD8 U;  4KDL B;  1NYR A;  4TSS A;  4BAX A;  3H7P A;  2NTT A;  3HHM A;  1TY0 A;  3UI3 A;  4M02 A;  2MLB A;  3HVD A;  2W3R A;  4P1C C;  3HVZ A;  1L5P A;  5CHF A;  2LGS A;  3RNG C;  2PJH A;  5C3J B;  4P7I A;  1WGK A;  1E8X A;  4HPL B;  5T8I A;  1OFF A;  2JXT A;  2FUG 1;  3BVG A;  4DWF A;  2KT7 A;  4HEA 1;  1FXA A;  1TTN A;  3VTW A;  1EF5 A;  1SIF A;  3NHE B;  3WA0 A;  3UGB B;  1ZXH A;  2JT4 B;  4WJQ A;  1MG4 A;  1WXS A;  1BML C;  2K8H A;  3DQV A;  3W1S C;  4ANX A;  1QF6 A;  2WXJ A;  2JXX A;  3IHP C;  3T9L A;  3B9J A;  3Q3M C;  2MRP A;  3RMK C;  1JWB D;  1MVK A;  4FXC A;  1E9M A;  3U52 E;  1VZ7 A;  4YT0 B;  2M19 A;  4G11 A;  4JX1 C;  2BVC A;  2H88 B;  4HCP B;  1HE8 A;  2AQ3 B;  4FJV B;  2NBW B;  1R4M B;  4DHJ D;  1ROE A;  4DHJ B;  4ARI A;  2FUH B;  2XN9 C;  4CO7 A;  3ML8 A;  2G1E A;  4RNA A;  3PPA A;  1GB4 A;  1EF1 A;  2J7Q B;  3RUL A;  1LM8 B;  4YTN B;  3HM6 X;  5AEK B;  2JVC A;  3E9S A;  3NVY A;  4TMA B;  2IND C;  1XO3 A;  3AEG B;  1KFY B;  2LI5 A;  4HKQ A;  1P98 A;  1UD7 A;  3AV8 A;  2IBI B;  2I2Y A;  2Y5B B;  1DGJ A;  1WZ3 A;  3PLU A;  5GXG B;  1VZ6 A;  3R3M A;  4ANW A;  1AN8 A;  2ZPY A;  2LGY A;  1F77 A;  3IAM 1;  4LLG M;  3IAS 1;  3VUX A;  1PQS A;  1EU3 A;  2JUO A;  4RM9 A;  3H7P B;  4N6E B;  2AQ1 B;  2RPV A;  4RGT A;  1WXM A;  1NYQ A;  2JSV X;  4HPP A;  1XQQ A;  2L0T A;  4WJN A;  1YX6 B;  2D11 A;  2I1K A;  1XLO A;  5JH5 C;  3WAM A;  5LXI B;  3AEB B;  4GB9 A;  2WDQ B;  4C7Z A;  1Q1O A;  2WDR B;  3NG0 A;  1SSN A;  5IP4 D;  4JL9 A;  3L13 A;  2IGG A;  4MH0 E;  2NBV B;  3R2T A;  1WM2 A;  1UH6 A;  1C79 A;  1TKG A;  1K8R B;  1TYG B;  4BKT A;  3KWV A;  4TKN A;  3NS1 A;  2NCN A;  2HTH A;  4I6P A;  1YJI A;  3FIL A;  1KRH A;  1KLV A;  1JCK B;  1TKY A;  1MPE A;  1QOB A;  2WS3 B;  3Q3F A;  2REX A;  4D2K A;  1BUI C;  4L1B A;  2W9N A;  3U7D A;  1TIF A;  1L0Y B;  1TGZ B;  2RSU A;  3M62 B;  2J42 A;  1KH0 A;  5E6O A;  1EU4 A;  3MTN B;  1E8Y A;  2K8C A;  3TJP A;  1E7V A;  4JPS A;  2YEP B;  3H8H A;  2N7E A;  3AE2 B;  4W9L A;  3HUI A;  4MH8 A;  3PT2 B;  4C4V A;  2XK5 A;  2FCQ A;  4HCN B;  3ZLZ A;  1YIW A;  1F9J A;  4H2A A;  2KTR A;  3MFG A;  4FN2 A;  3V6E B;  3WAO A;  3NVV A;  1KTK A;  2BBC A;  2K22 A;  2DZI A;  4EEW A;  4A6Q A;  2ZCB A;  1V8C A;  1D4B A;  2D07 B;  1ZXI A;  1E10 A;  1MHH E;  1R7S A;  2M0X A;  2KAN A;  1IUE A;  1PDX A;  4RGN A;  3MJ5 A;  4LNF A;  1PGA A;  2LJ5 A;  2N9L A;  3X23 A;  1RFA A;  2LRU A;  4DXF A;  1QOG A;  2RD0 A;  5G5G A;  2KHW B;  2ZNV C;  1YQ4 B;  3FC4 A;  2L32 A;  4G50 A;  1WRD B;  1S3S G;  3BYT B;  2CHZ A;  1LFD A;  3PRP B;  4YXD B;  4K7S A;  1NI3 A;  3BK2 A;  4F1S A;  5HG2 A;  4HLE A;  4OVU A;  2QIL A;  3U8Z A;  2M0A A;  1I35 A;  1C78 A;  3H7S A;  5J2R A;  1A5R A;  5G55 A;  2KLG A;  1FCC C;  4KZ0 A;  1WE7 A;  1P7F A;  4FHK A;  4TV3 A;  2BYV E;  4NQK E;  3SU8 X;  1VDV A;  3FIL B;  3N9Y C;  1J7C A;  2WXH A;  2KOX A;  4S0R A;  3QWZ B;  1EWC A;  2KTF A;  2MBO A;  2KFJ A;  3P4S B;  2KK8 A;  2KMM A;  4OZB A;  2C60 A;  3EHV A;  3NS8 A;  1RAX A;  2MP2 A;  4ZRQ A;  4US8 A;  2E3T A;  3EEC A;  5CTR C;  3N1Y C;  4A55 A;  4RH6 A;  1E7U A;  1XLP A;  1U4A A;  2LXA A;  4II2 B;  4WJP A;  4GIV A;  3KUZ A;  3RUI B;  4NQL B;  3AE7 B;  2BTE A;  1P3Q U;  4C4V B;  3MHZ A;  2XK5 B;  4J3O D;  2CS4 A;  3P4Q B;  3LYY A;  1C76 A;  2KFK A;  1WSP A;  4KIK A;  3R8B A;  3V61 A;  2KTR B;  4Q2J A;  1WGY A;  4MEM A;  3WCQ A;  4JWS C;  2K8B A;  2PMV A;  3VFK A;  2Z0E B;  1T6B X;  4M00 A;  4HKZ E;  3TEX A;  2WXF A;  3ZTD A;  2Q5W D;  3UIN B;  2KWU B;  5HFY A;  3NY5 A;  1SJE D;  4NAW B;  1UUP A;  3ZRF A;  4FHJ A;  4LCD E;  3QA8 A;  2IO1 B;  1HZ6 A;  4IDI A;  4LDT D;  2JZP A;  4LDT B;  1IYF A;  4PYU A;  3E56 A;  1FNU A;  5EE0 A;  4M8N A;  4KV2 A;  2L05 A;  1WGR A;  4EE2 A;  1I4H A;  3FAH A;  1T0Q C;  4A9A A;  1WY8 A;  2TSS A;  4HDO A;  3RNE C;  3TMP B;  1WXQ A;  3EGR A;  5AUK A;  2BYF A;  1C9F A;  1UF0 A;  2KKC A;  4ANU A;  2NTS A;  4LNN A;  3N1X C;  3B1L X;  1UNS A;  4YTM B;  3AE8 B;  3Q8E A;  4DDI D;  3Q3J A;  5H8Y E;  3WAN A;  3A4S C;  3ZJU A;  2M4N A;  1UEL A;  2N9X A;  2XNA C;  3KLS X;  2ON8 A;  2MBB B;  1EM7 A;  2B76 B;  3NZU A;  4MGY E;  2GBK A;  3AEE B;  4GOC A;  4P6V F;  2MP2 B;  2BKR B;  4OW0 A;  3RNF C;  3DBL I;  3ZXV A;  2WWZ A;  3QQ8 B;  1CJE A;  3ZGZ A;  3NJT A;  2K39 A;  1WRI A;  4W9F A;  4KGT A;  3RYT A;  3RCZ A;  2GBJ A;  1M4V A;  2M17 A;  2KFK B;  4KIK B;  3ZUN A;  2PKO A;  1WJN A;  4EKU A;  3SFD B;  3DBH I;  5AUI A;  4XWT A;  1WGD A;  5CX3 A;  2J52 A;  2VH2 A;  3NZS A;  1GB1 A;  2R2O A;  2IO2 B;  1OQR A;  2MBH A;  1L6V A;  4XZ4 A;  3TL5 A;  2L3Z A;  3AE3 B;  1JQ4 A;  2X38 A;  3MC8 A;  1SGH A;  5EE9 A;  1V1P A;  1OGW A;  2EKE C;  3VXW A;  2CHW A;  1E8Z A;  2V0G A;  2KVZ A;  2LZ6 A;  4FJY A;  4RM8 A;  5CHV C;  4MDK E;  2BGF A;  1UGM A;  2I38 A;  1IGC A;  2UWQ A;  1S1Q B;  3T3N A;  2MBQ A;  4EOY A;  2XEW A;  3DVG X;  4FUL A;  3U4E G;  1N5X A;  4ZHP A;  2J4X A;  4W9C A;  2L76 A;  2AX5 A;  3V60 A;  5EE1 A;  4JGH B;  4M01 A;  1P9D U;  2KQ7 A;  4F7Z A;  3ZDM C;  2O6V D;  1D3Z A;  3ZJV A;  1PFD A;  2DNF A;  4OVZ A;  4DBG A;  1J19 A;  4ASW C;  2LGX A;  2JF5 A;  3DPD A;  4MGI E;  2KDB A;  4G3X B;  3DWM A;  2MJD A;  3CST A;  5D3I B;  3N20 C;  1WIA A;  3BVM A;  3KWL A;  5D6J B;  2BB5 A;  4DXA B;  4KKI A;  4MSQ B;  4RMA A;  1AWD A;  5FKA C;  1QOF A;  3UIP B;  2BB6 A;  4RGO S;  2RMM A;  1WE6 A;  4WWO A;  1QKZ A;  2WHI A;  1N62 A;  4WWP A;  3AXC A;  4ICV A;  1OEY A;  1PGX A;  4M8M A;  3SFE B;  3A33 B;  5EDS A;  3AU5 A;  1WI0 A;  3FKY A;  2PIA A;  3BII D;  3ZIM A;  2QC8 A;  3GZN B;  1SIJ A;  4MGZ E;  1V6E A;  1JML A;  1MHX A;  2GRI A;  3VUY A;  4K7W A;  2FCM A;  2HE7 A;  4WIP A;  3BZD B;  1AAR A;  1DOY A;  4ZRJ A;  3HIZ A;  3PSE B;  2KDE B;  1J0G A;  1V1P B;  2AEH A;  2MJ3 A;  1JWM D;  2UU7 A;  3W2D A;  5E6J A;  1DYQ A;  1BXT A;  1GUA B;  2DZJ A;  5H92 C;  4YSZ B;  4NY0 A;  3IFW B;  1WX9 A;  1SB3 C;  2WLB A;  2N9E B;  5BO4 B;  2MEK A;  1WMH B;  4B6W A;  4HWI B;  3V62 A;  1XT9 B;  3VDZ A;  3ZNH B;  4MGK E;  1YN3 A;  4PS7 A;  5IKC M;  1Q0W B;  4US9 A;  4ZHO A;  4ICU A;  2GI9 A;  1FCL A;  1JRU A;  1RRB A;  1KLG D;  5DPW A;  2K6Q A;  5JZE B;  2CU3 A;  3Q14 C;  1GC7 A;  3PV1 A;  2D3C A;  2PE9 A;  3ZNG C;  5DPR A;  1AW7 A;  3JYU A;  3U7Z A;  4E71 A;  4MM3 A;  1V9J A;  1GC6 A;  2WNM A;  1L4Z B;  5FR6 A;  2FNJ B;  1V1O A;  3T3O A;  5HI1 A;  2IO3 B;  1GPX A;  1ZW7 A;  1R4N B;  4J6I A;  1TZ1 A;  3ZNZ B;  1CMX B;  2JYT A;  4MSM B;  3SHQ A;  3VR8 B;  1V2Y A;  1NVI D;  2E6X A;  2WU5 B;  3V05 A;  4N59 A;  2N0S B;  3RNA C;  2IY1 B;  2WXG A;  4KGR A;  2HD5 B;  3GOE A;  4WWM A;  4N58 A;  1OEY J;  5C1Z A;  4IM0 A;  4NZL B;  1QOA A;  2XBB C;  1WYG A;  3DBR B;  4S17 A;  1LGR A;  3IXS A;  4BBN C;  2FCS A;  3CWI A;  1C4A A;  4XDC A;  3DVN V;  2KYW A;  3A9K A;  3APF A;  3TUO A;  2JRI B;  5IO9 A;  5C2T B;  3RD2 A;  2JX5 A;  1R4M I;  2QCZ A;  2WXI A;  1V86 A;  5EE3 A;  1L4D B;  3A4R A;  2CU1 A;  4W9I A;  1CZP A;  2VRR B;  1SJH D;  3UIO B;  2DX5 B;  1HTQ A;  2Y5C A;  1OQY A;  2KWC A;  3BYY B;  3ML9 A;  4BBN F;  4KVG B;  1Q5W B;  1J7B A;  5LXH A;  2AYO B;  2M56 B;  4K81 A;  4TQ1 A;  1ZP0 B;  3BY4 B;  3B08 A;  1EUV B;  3R7R A;  4ZRP A;  4DXG A;  2Z8L A;  3S2A A;  4GXB A;  2DHZ A;  4WJO A;  1SF0 A;  2LUE A;  4K7U A;  1WYW B;  2PW9 A;  3GP7 A;  4HDQ A;  3AE9 B;  4HXD A;  4DHZ E;  4YWG G;  4MM3 B;  2DYB A;  2WDT B;  4FBJ B;  2JY6 A;  3OLM D;  2MWS B;  3PHX B;  4EFO A;  1I4P A;  4DQO C;  2LJI A;  2C5L C;  2LVO A;  4NAW A;  4BZA A;  1MJD A;  5D2M B;  2J0M A;  3AEF B;  2QEJ C;  2ZW1 A;  2PVG C;  5JHA A;  4AQ7 A;  1RM6 C;  1WXV A;  1DOI A;  3CIR B;  3KUD B;  4AJW A;  4FAD A;  3MC9 A;  4HRO A;  1L6U A;  5E6N A;  2KJR A;  2KMA A;  1WM3 A;  4L23 A;  3OWE B;  1YX5 B;  2C7H A;  1YQ3 B;  4P16 A;  2DBY A;  3AN1 A;  4JLC A;  2KXJ A;  3TEW A;  2KN5 A;  1WR6 E;  1MI0 A;  4GDK A;  2KC2 A;  3A9K B;  3ETR A;  2WXN A;  1AYF A;  2V3S A;  1KF6 B;  2LHE A;  3BWU D;  4KDI C;  4FA6 A;  1PYW D;  5BMI A;  3AE5 B;  3RI7 C;  2BW2 A;  2DYO A;  2J0J A;  3A1Q A;  2VZK B;  2RDB C;  4I6L B;  1F1H A;  2W3S A;  3IT6 B;  4ITK A;  4LNO A;  4EZK A;  2FBW B;  5E6P A;  2IDY A;  5MPO A;  1T0R C;  3GS2 A;  1GG3 A;  3C19 A;  3R7Q A;  2GOW A;  3LXF A;  4JIO U;  4LK0 M;  3U30 A;  3EC8 A;  4AUQ C;  1OTR B;  1B1Z A;  3ZKJ C;  4IKG A;  5J17 A;  5D7G A;  4XWW A;  1TS3 A;  5JHB A;  4ARC A;  4YTP B;  3AE4 B;  1N61 A;  2RR9 A;  1FM0 D;  4PT5 A;  4C00 A;  3V3X A;  3Q6B A;  1HQR D;  3NVW A;  4G0N B;  4B95 A;  1RFK A;  5BYR A;  1JRP A;  2A5U A;  4E3C A;  4AOF A;  1CK1 A;  4W9E A;  1WFY A;  2N1W A;  4I6N B;  1WXA A;  3ZYY X;  2JQR B;  3ZNI D;  2LMC A;  5IA7 A;  2L00 B;  5AZG A;  3EFC A;  1M94 A;  5CHW A;  4PK1 A;  3PVL A;  3VH4 B;  5BYQ A;  4KZC A;  3PZD A;  3AH7 A; 
#chains in the Genus database with same CATH homology
 2KDM A;  1N5X A;  4ZHP A;  2J4X A;  1C4P A;  1XCT L;  4UDU C;  2OED A;  2AX5 A;  4MT5 A;  2IGD A;  1EWY C;  3MC0 B;  3RFZ B;  3E9S A;  5FR3 A;  2SEB D;  5EE1 A;  3NVY A;  2N7J A;  4TMA B;  4JE3 B;  1YN4 A;  1XO3 A;  3AEG B;  1KFY B;  2W82 A;  4HKQ A;  3AV8 A;  1UGJ A;  2NMQ A;  3BK1 A;  1UWM A;  3TEZ A;  2I2Y A;  3ZJV A;  1HXY D;  1DGJ A;  1PFD A;  4NJC A;  4OVZ A;  1XLN A;  4KGS A;  5GXG B;  1VZ6 A;  2MH7 A;  2SAK A;  3AB5 A;  3DWG C;  1AN8 A;  4GDK B;  3VR9 B;  5HHD G;  1F77 A;  1WWT A;  4O1N A;  3ZJT A;  3IAM 1;  4LLG M;  3IAS 1;  2K5P A;  1EU3 A;  2WXR A;  1E6E B;  3DWM A;  2MJD A;  5D3I B;  2JU6 X;  2LUM A;  1SXT A;  2CJN A;  1ZE3 D;  4OZA A;  4N6E B;  2AQ1 B;  2RPV A;  4OHJ A;  4RGT A;  3BVM A;  4USA A;  1NYQ A;  3KWL A;  1OQQ A;  3R2I A;  1FD6 A;  1FFV A;  2JSV X;  2BB5 A;  3PO0 A;  3BVZ A;  2BT6 A;  4KKI A;  5FK9 C;  1AWD A;  3P4P B;  2LHD A;  1XLO A;  1QOF A;  2LGI A;  5FKA C;  3AEB B;  2BB6 A;  4RGO S;  2RMM A;  2W55 A;  3W1S A;  1TJE A;  2WDQ B;  4C7Z A;  4B0E A;  3NZ3 A;  1FNV A;  1QKZ A;  2WDR B;  1SSN A;  1N62 A;  1GOZ A;  4HRS A;  1XF5 L;  3RPF C;  2PTL A;  2QMT A;  2VZK D;  1PGX A;  5D3D A;  3SFE B;  2IGG A;  2INN E;  3R2T A;  1C79 A;  1TKG A;  2YEP F;  1PUT A;  4WQM A;  2J53 A;  1TYG B;  4GDL B;  1T3Q A;  1FRD A;  2L1A A;  2G9H D;  4HJG E;  2PIA A;  3KWV A;  3BII D;  1ESF A;  1XXG A;  1ACC A;  1ENF A;  3ABV B;  3NS1 A;  3W5V B;  3EUB 2;  1T5X D;  3AE6 B;  1SIJ A;  1VJK A;  1C4C A;  1YJI A;  3FIL A;  2BS3 B;  4WH4 A;  1KRH A;  2PVO D;  2INP E;  1JML A;  1HEZ E;  2FE8 A;  4ZOH C;  1MHX A;  2DWQ A;  2GRI A;  1JCK B;  1TKY A;  1JWS D;  1MPE A;  1QOB A;  4WIP A;  3BZD B;  3VRB B;  1DOY A;  2WS3 B;  1TY2 A;  4D2K A;  1BUI C;  4L1B A;  1V1P B;  2MJ3 A;  1QIL A;  1L0Y B;  2LFI A;  1JWM D;  3W2D A;  2J42 A;  5E6J A;  1DYQ A;  1KLU D;  1BXT A;  1KH0 A;  3TSS A;  5H92 C;  1CQV A;  1EU4 A;  1SEB D;  4YSZ B;  3AE1 B;  4JPS A;  2YEP B;  3H8H A;  1K51 A;  2BS2 B;  3C8Y A;  1SB3 C;  3AE2 B;  2WLB A;  3HUI A;  4MH8 A;  3AEC B;  2MEK A;  1IBX A;  1E0Z A;  4WAF A;  1XEE A;  4H2A A;  4R3D A;  1TS4 A;  1YN3 A;  5G5H A;  4RF0 A;  1D5M C;  2WU2 B;  2JYE A;  3MFG A;  4US9 A;  4ZHO A;  2GI9 A;  1FCL A;  1JWU D;  1KLG D;  2JWU A;  3NVV A;  1KTK A;  1P7E A;  4RFB A;  2BBC A;  2K22 A;  2CU3 A;  4KX6 B;  2K9X A;  4L2Y A;  5BMG A;  4A6Q A;  1D5X C;  1V8C A;  3Q8C A;  1AW7 A;  1D4B A;  1ZXI A;  1I4G A;  3Q69 A;  3P63 A;  1MHH E;  1E10 A;  3U7Z A;  3KQ4 A;  1QT9 A;  1R7S A;  3GB1 A;  1GAQ B;  1IUE A;  1PDX A;  4RGN A;  3MJ5 A;  5BYS A;  2WNM A;  1PGA A;  1L4Z B;  1STE A;  1XLQ A;  2WXM A;  1V1O A;  1TZO A;  2K0P A;  2N9L A;  4C56 C;  1JW9 D;  4DXF A;  3B2G A;  1QOG A;  2GB1 A;  3T3O A;  5HI1 A;  2BS4 B;  5G5G A;  1FXI A;  1GPX A;  1RYJ A;  1YQ4 B;  3FC4 A;  3O13 A;  2L32 A;  1K52 A;  1DOX A;  1N63 A;  1YNT E;  3HRD D;  3BYT B;  2V3P A;  1L0V B;  4XE0 A;  2JYT A;  4YXD B;  1FIQ A;  1NI3 A;  1FEH A;  3VR8 B;  4C80 A;  1NEN B;  3BK2 A;  5HG2 A;  1NVI D;  2E6X A;  2WU5 B;  3V05 A;  4N59 A;  1N60 A;  2QIL A;  2M0A A;  2ZW0 A;  2N0S B;  1C78 A;  1QLB B;  2ICI A;  3Q8F A;  2RDG A;  2WXG A;  3NRZ A;  1FCC C;  1P7F A;  4KGR A;  4WWM A;  4N58 A;  5TSS A;  2K3U A;  3U4E G;  5I4D A;  1YMH E;  2IGH A;  1VDV A;  3FIL B;  1HZ5 A;  3N9Y C;  2KAC A;  2H89 B;  1J7C A;  2V3N A;  4REZ A;  2WXH A;  1EWC A;  5JXV A;  4NZL B;  1D5Z C;  1QOA A;  2BYT A;  3P4S B;  1VZ8 A;  1WYG A;  2KMM A;  4OZB A;  3W9C B;  3IXS A;  3CWI A;  1VRA B;  2W54 A;  1I4Q A;  3AM9 A;  1C4A A;  4XDC A;  1I7H A;  3SR6 A;  4ZRQ A;  4US8 A;  2E3T A;  3TUO A;  4A55 A;  1JRO A;  4RH6 A;  5C2T B;  2JX5 A;  1XLP A;  2WDV B;  3J9C A;  1J7A A;  1SE3 A;  2WXI A;  5EE3 A;  1L4D B;  1UWX A;  1IGD A;  1CZP A;  2QIE B;  1SJH D;  3AE7 B;  2BTE A;  1IBX B;  2ONQ A;  3MHZ A;  4RCO A;  3URY A;  4J3O D;  2Y5C A;  3P4Q B;  3LYY A;  1C76 A;  3BYY B;  1WSP A;  3R8B A;  4Q2J A;  4RF1 A;  1F2R C;  3WCQ A;  1XCQ L;  2DLB A;  5BMH A;  1J7B A;  4JWS C;  1TS2 A;  2PMV A;  2WXL A;  2M56 B;  4ZYS A;  4TQ1 A;  1ZDX A;  1ZP0 B;  3P1M A;  4NAM A;  1V97 A;  1T6B X;  1FRR A;  4ZRP A;  2ACZ B;  3Q8B A;  4DXG A;  1F0Z A;  4HKZ E;  3TEX A;  2Z8L A;  2DYM A;  2LEK A;  1Q10 A;  2WXF A;  2Q5W D;  1SF0 A;  4GLS C;  3L4P A;  4JWU C;  5HFY A;  2PW9 A;  3GP7 A;  2V4I B;  3AE9 B;  1SJE D;  4NAW B;  1SE2 A;  2WXK A;  1UUP A;  1F2R I;  4YWG G;  2Y3A A;  2MJE A;  4MM3 B;  1FNW A;  1I4X A;  1HZ6 A;  2EKI A;  2EEL A;  4IDI A;  2JZP A;  2IJ0 A;  1ZDV A;  1SE4 A;  3NVZ A;  1ET9 A;  2N9K A;  1PGB A;  2QJL A;  2WXP A;  1LO5 D;  3E56 A;  1FNU A;  1I4P A;  2KN4 A;  2LJI A;  3AEA B;  1I4R A;  3NUH B;  5EE0 A;  4DQO C;  3I57 A;  4TQ0 A;  4B0M A;  2L83 A;  2HTM E;  3P4R B;  4KKJ A;  3AEF B;  3PZ7 A;  1SBB B;  1RWS A;  1ZOY B;  4RGM A;  2QEJ C;  2RDH A;  2D5G A;  1N5W A;  2ZW1 A;  3EA6 A;  2PVG C;  4EE2 A;  3AED B;  1I4H A;  4AQ7 A;  1RM6 C;  3FAH A;  2KWD A;  1DOI A;  4A9A A;  2WP9 B;  2TSS A;  2KQ4 X;  3CIR B;  2L52 A;  2KAJ A;  1YN5 A;  3LB8 C;  1WXQ A;  4MAC A;  4HRO A;  1L6U A;  3EGR A;  1HA5 A;  5AUK A;  1C9F A;  2WQY B;  4YSY B;  2R61 A;  2NTS A;  4L23 A;  1FFU A;  1UNS A;  4YTM B;  3AE8 B;  3OWE B;  3Q8E A;  1TKE A;  5H8Y E;  4YSX B;  2OHF A;  1ZUD 2;  3ZJU A;  1YQ3 B;  1FMA D;  4LTU A;  4P16 A;  1D6E C;  1L0X B;  2DBY A;  3AN1 A;  2XNA C;  1YJJ A;  3KLS X;  2ON8 A;  2PLP A;  1EM7 A;  3TEW A;  2B76 B;  3VRA B;  1ET6 A;  3SEB A;  3ZQ4 A;  1JAL A;  1VR9 A;  4A90 A;  1MI0 A;  3VQI A;  3AEE B;  4P6V F;  3U2S C;  1NYR A;  4OW0 A;  4A8X C;  1JWA D;  3P42 A;  3ETR A;  4TSS A;  4AS1 A;  2NTT A;  3IT4 B;  4WUR A;  5LNK 1;  4CQN A;  2WXN A;  1AYF A;  2HDE A;  1KF6 B;  1TY0 A;  2LHE A;  3BWU D;  3UI3 A;  1PYW D;  5BMI A;  1CJE A;  3AE5 B;  3ZGZ A;  1A70 A;  2BW2 A;  2DYO A;  3HVD A;  2W3R A;  1WRI A;  1Y56 A;  2VZK B;  3W5U B;  2W3S A;  3IT6 B;  4KGT A;  3HVZ A;  1L5P A;  1TS5 A;  1M4V A;  5C3J B;  3Q8A A;  4ITK A;  1WGK A;  2PKO A;  5T8I A;  2FBW B;  1OFF A;  2JXT A;  2FUG 1;  3MP9 A;  2IDY A;  3BVG A;  5MPO A;  1K53 A;  2CJO A;  2AQ2 B;  3GS2 A;  4HEA 1;  3SFD B;  5AUI A;  1FXA A;  3LXF A;  4XWT A;  3B2F A;  4LK0 M;  2IPK D;  1B1Z A;  2J52 A;  1B9R A;  1ZXH A;  4IKG A;  1ZPS A;  5D7G A;  4XWW A;  1TS3 A;  1GB1 A;  1BML C;  1OQR A;  4ARC A;  4YTP B;  1QF6 A;  2WXJ A;  1L6V A;  3AE4 B;  1K50 A;  1QQR A;  1FO4 A;  3AE3 B;  1N61 A;  3B9J A;  1JQ4 A;  2X38 A;  4C7Y A;  1FM0 D;  4PT5 A;  2Y5P A;  1JWB D;  1MVK A;  4FXC A;  4IOI E;  3V3X A;  1E9M A;  1VLB A;  3U52 E;  1HQR D;  1VZ7 A;  4YT0 B;  3NVW A;  2M19 A;  5EE9 A;  1RFK A;  4JX1 C;  1V1P A;  3AMZ A;  5BYR A;  2H88 B;  1JRP A;  3I9V 1;  2V0G A;  4OZC A;  2AQ3 B;  2WXQ A;  1CK1 A;  3PZ8 A;  1ROE A;  4XDD A;  1C77 A;  3ZYY X;  2JQR B;  2LMC A;  2QSD A;  4ARI A;  2I38 A;  3TEY A;  1IGC A;  2XN9 C;  1NEK B;  2G1E A;  4RNA A;  3T3N A;  4M0W A;  2WXO A;  1E7P B;  1GB4 A;  5BYQ A;  4YTN B;  3AH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...