1P9DU

High-resolution structure of the complex of hhr23a ubiquitin-like domain and the c-terminal ubiquitin-interacting motif of proteasome subunit s5a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords 26S proteasome non-ATPase regulatory subunit 4
publication title Structural determinants for the binding of ubiquitin-like domains to the proteasome.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p9dU00
2DX5B 2K25A 4W9DA 3ZW3A 4IM2A 2KTRB 2GBRA 2LVQA 1KJTA 2N7EA 1IPGA 5C23A 2ZPNA 1ZGUB 2DZJA 3OJ3A 4WWOA 2G4SA 5J2RA 2ZCCA 2ASQA 3GOEA 3M3JA 2KX3A 4KV2A 3TMPB 1C3TA 3ZO5B 1V9JA 3R7QA 1X1MA 1J0GA 3H7PB 2FIFA 3KH0A 1TTNA 3EHVA 4GMVA 4AP4C 1WMHB 2JRIB 3QHTA 2C60A 3C0RB 4HLEA 1V80A 2CKHB 2QHOA 2IO1B 1WGYA 4MH0E 3ZNHB 3QCAA 4DBGA 1M94A 2CS4A 3IHPC 4DWFA 3L17A 1J19A 2KC2A 3HIZA 4LJPB 1WXSA 3UIOB 3NY5A 2PPHA 2Z59B 3PVLA 4K7SA 1A5RA 1E90A 2IBIB 2LD9A 1WRDB 2MP2B 1E8WA 2MBQA 4EUTA 2I1JA 4ANXA 3PS6A 3RYTA 1WGDA 2JT4B 3ZRFA 2KDBA 2M8SA 2KNBA 3NHEB 4G0NB 2XBBC 2KOXA 1WY8A 2N1WA 3PRPB 4I6PA 4BKTA 4AWJA 4MJSA 5LXIB 2FIDA 1E5WA 1CMXB 4WWNA 2RPQA 1WFYA 4MSQB 1P98A 2KTRA 4XC2A 3Q3FA 4GDLB 1R4NI 3JSVB 2IYDB 1WGGA 2FNJB 2Z0DB 3DBRI 4DDID 3N3KB 2AYOB 2MSED 2LRWA 4MGIE 1E7UA 1EUVB 3H6NA 3KW5B 2K1FA 1C1YB 2AEHA 1WYWB 2NBUA 3KVFB 2UYZB 2AL3A 1GC7A 1GG3A 3NZUA 2PE6B 2RD0A 1YJ1A 3H7PA 2G3QB 2FCNA 1Q5WB 1F9JA 2V1YA 3X23A 3H7SA 5DPWA 1QZEA 4GN1A 2ZCBA 2J0KA 4M8NA 1WJNA 2NVUI 1WX9A 3QAQA 2AL6A 3PZDA 4NJ6A 3A4SC 4XZ4A 2HJ8A 3B0AA 1P3QU 1WH3A 4JGHB 4E71A 2C7HA 2AWTA 1SGHA 2Z0EB 2MLBA 2KFKB 2KKCA 3PT2B 4FLHA 3KYCD 3RZFA 3WAOA 4CO7A 4EZKA 2ZNVB 4KVGB 4TQ1A 3U8ZA 3NS8A 2WX1A 1WM3A 4W9HA 2LGXA 3PV1A 4DXAB 2KWCA 3UQBA 4GSWA 2MW5A 2L05A 3PSEB 1LXDA 3RUIB 2JY6A 3ZDMC 2KHWB 4BBNC 4JLCA 5C1ZA 3SU8X 4HPLB 3U30A 3ZTCA 2BYVE 2JWZA 4KSLC 2MWSB 3VQIA 2ZVNA 4NPNA 4F1SA 5JHAA 1GC6A 4FBJB 1KLVA 4DK5A 2L00B 1V6EA 4FN2A 1GNUA 2CHXA 1XQQA 5L83A 1V81A 2K39A 5DCNA 3ZNGC 3CF6E 4GDLA 4ZRIA 3JSVA 2KK8A 3IBEA 3TCAA 1OTRB 2D2QA 3NZSA 3QJZA 1FXTB 4BFRA 2PE9A 5E6PA 3V61A 3VDZA 3L13A 2LGDA 3EC8A 3A1QB 4MJSB 4TKNA 4KIKB 2BKFA 4ZRJA 3DVGY 4AJYB 1L2NA 1T0YA 3H1UA 4K7WA 2C7MB 2FCSA 5AZHA 2N1VA 2KJRA 1WE7A 3QIJA 3SHQA 4ASWC 3LJ3A 4KZ0A 2C5LC 3V6EB 3QA8A 2R2QA 4EOYA 4DHJB 1R4MI 2LZ6A 1I42A 4KDLB 5D6JB 2MX2A 1SIFA 3K9OB 1YX5B 3A33B 1MG8A 1UZXB 5CHFA 1G6JA 2KFKA 2BYEA 1XT9B 4PS3A 4WJPA 4DHJD 4I6LB 4MM3A 1EO6A 4JQWC 2LI5A 4LJOB 2KLCA 4IG7B 5LXHA 4LCDE 4FJVB 2IO3B 2GBJA 2D11A 1WX7A 3DBSA 2IO0B 2K8CA 2K6DB 4PS7A 4WQOB 4P7IA 1P9DU 1WGHA 4GGQA 1I35A 2GBMA 1Z5SB 2D10A 3QWZB 4WWPA 3NOBA 3DVNU 2NBWB 2EKEC 1WR1A 3A9JB 1NBFC 2ZZPB 3EFUA 3AXCA 3APDA 4KSKC 5CHWA 3ZNZB 4A3PA 3EECA 1TGZB 4NAWA 2IY1B 3BINA 2IO2B 3L16A 3VUWA 4TV3A 1AARA 1E8XA 2KDEB 2N9XA 3VTVA 3UQAA 4FHJA 4IM0A 1D3ZA 3KYDD 1WX8A 2CU1A 2KQSA 4NQKE 3A1QA 4RM8A 4KIKA 2G4DB 2DYOA 3CMMB 3QK0A 3APFA 4ICUA 3B1LX 4AUQC 4F8CB 3W1SC 4EZLA 3MHSD 3R3MA 1XD3B 4EKUA 2C9WB 2N9EB 5D94A 2FCMA 2LXAA 2O6VA 2KVRA 2FAZA 1WF9A 2KTFA 3PRZA 4FJYA 4X57B 4ZYNA 3RT3B 4BVUC 3L10B 4PYUA 4CHKA 1VD2A 1WJUA 1J8CA 1WM2A 4IC7B 2B3AA 2LGYA 2N7DA 1WE6A 4HDOA 2W9NA 1EF1A 2LWPA 2L3ZA 1UGMA 3IFWB 2MA9B 4FADA 2MBHA 3KUZA 3Q3JA 1UD7A 4HCNB 4IWPA 3VXWA 1KOTA 1YX6B 1WI0A 2M0XA 4JIOU 5JZEB 3L0WB 3QX1A 4EFOA 2KWVB 2L0TA 2NPTA 5KHOA 3R7RA 4FA6A 2R2OA 2BWES 2JRHA 3ZLZA 1GUAB 3ZKJC 5KHQA 3JW0X 1TZ1A 2PJHA 2LVPA 2KX0A 3A9JA 3WA0A 4G11A 1TBEA 3N30A 2CHWA 1UH6A 1U4AA 4MGZE 4II3B 2JZ3B 5CTRC 1Y8RC 3ML9A 3ALBA 2BKRB 4BKGA 2K6QA 1E7VA 3VUXA 3H9DA 2YVCA 3S2AA 2LASA 2MBOA 3RULA 2UWQA 1S1QB 3ZIMA 1S3SG 2DZKA 2G45B 4LDTB 4URKA 2HTHA 4M8MA 4ICVA 3UGBB 2MRPA 3M95A 2IZVB 2BF8B 4NAWB 2EMSA 3RZWC 3T8MA 3HM6X 3VH3B 4F7ZA 4HJKA 4MGKE 3ZRCA 3VFKA 4LDTD 2KJ6A 2M17A 3CSFA 3WALA 2GMIC 3MTNB 2VRRB 5D7GA 4AJWA 1KM7A 1RLFA 4II2B 3D32A 1Q1OA 2WDTB 5G2NA 2YLMA 3ZDTA 5IA7A 3AU4A 1OQYA 4DHZE 3HK0A 4G3XB 4B6WA 5DPTA 2HD5B 3APCA 3PRMB 2JXXA 4W9KA 3TBLD 2KFJA 1H8CA 5GMVA 2A5UA 2WYQA 3N32A 4NQLB 2KDIA 2K8BA 1WXMA 4JL9A 3UF8A 4A3OA 3P2BA 2BGFA 2O6VB 2KLGA 2PEAA 3M62B 5DPRA 1GJZA 3DVGX 5IAAC 4AOFA 4K7UA 2NCNA 2KN5A 1ZKHA 3ZVVA 3QQ8B 2O6VD 3QARA 3PHWB 3VTUA 5J18A 5HKHA 2HE7A 3RCZA 2GBNA 1Z2MA 2KMAA 3V6CB 5CHVC 3BY4B 4HPMB 2WX0A 4XX5A 3X0WA 4ZRKA 5CX3A 4WJNA 2DAJA 2KJHB 5JHBA 1V49A 4HWIB 2ZPYA 3JVZX 5E6NA 5L95C 1PQSA 5J17A 3A9KB 2REXA 1VCBA 5FR6A 4ANWA 2J0MA 4RMAA 2KDFB 2RSUA 2LRUA 4PS8A 4EZJA 2DZIA 2JF5A 3AULA 4BKSA 2KO3A 2NPTB 4ZDVA 2N4FA 1YD8U 5DPSA 4MEMA 1V86A 2JUOA 3GZNI 4BOZB 4DDGD 2LVOA 3L54A 3DOWA 2D3GA 4B95A 3ECIA 4GU2A 1OGWA 2O2VB 1WXVA 3ZNID 5AZFA 3DCGA 3JYUA 5D2MB 4OVUA 4E3CA 2LXCA 4NY0A 4YL8A 2XEWA 3UINB 3VH4B 4NJ7A 4WJQA 3ZUNA 1V5TA 1WZ3A 4W9IA 2KQ7A 3A4RA 1E8ZA 4FHKA 2KC1A 4G50A 2RR9A 4IW0A 4HVBA 2XK5B 4KZCA 1V5OA 4GDKB 4TQ0A 1WXAA 3OLMD 4J6IA 3CSTA 2DENB 2M1MA 3M63B 1P1AA 2JZZA 4A20A 2L7RA 2CHZA 3HHMA 2BWFA 3VTWA 1SE9A 5LLIA 2DZMA 4CYEA 4E74A 4W9JA 1LFDA 2KMCA 3ONSA 4N9F4 1RRBA 2MCNB 4PYZA 3UIPB 3W1YA 2A4ZA 4IWQA 4MELA 2FUHB 2NR2A 2LUEA 1HE8A 2GOWA 4GB9A 4W9FA 1IP9A 1WGRA 2N9PC 3I3TB 3VHTC 2KWUB 2ZVOA 2WWZA 3DBLI 1L7YA 2V3SA 3TIXA 2BYFA 3L08A 3VUYA 3VVWB 4IWOA 4KDIC 2CR5A 2JPHA 4ANUA 3U7DA 2ZJDA 3PREA 3LDZE 5BO4B 3A9KA 2ZNVC 1V2YA 5AEKB 2J7QB 5TR5A 4BOSC 4EEWA 1WJ4A 3ENEA 4WJOA 4HK2A 2DHZA 1NDDA 3AU5A 3R66C 2MBEA 3DQVA 5E6OA 3T9LA 2O2VA 3KUDB 2OOBB 3AI5A 3PLUA 1WJ6A 4W9EA 2L76A 1P0RA 3DVNV 4W9GA 3SDLC 1RFAA 4FULA 1WMHA 3QC8B 2LJ5A 4GIVA 4IM3A 1UBIA 1OEYA 3OJ4B 2I1KA 1ISNA 3PPAA 1YIWA 3K9PB 2L8JA 4MSMB 3KUCB 4GXBA 2C7NB 4HXDA 4ANVA 2J0JA 4HCPB 3TJPA 4RM9A 4BKSD 3DPDA 2XK5A 1WIAA 4K81A 2EMTA 4GDKA 1BT0A 1JRUA 1WR6E 2ZEQA 1K8RB 3V60A 4WAAA 2RGFA 2MP2A 1EF5A 2Y5BB 4M0WB 1YQBA 4NNJB 5JH5C 3IVFA 1UELA 1IYFA 4W9LA 1OEYJ 3DBHI 4HDQA 1H4RA 4K1RB 2JVCA 5AZGA 3HM3A 3WANA 4I6NB 3SD5A 3WAPA 2MBBB 2L0FA 4W9CA 1Q0WB 3OAWA 2MQJA 3B08A 2KD0A 2FCQA 2NBVB 2M4NA 2OJRA 3ZTDA 2KANA 1WZ0A 2DYBA 4FJZA 5G55A 2K8HA 3WAMA 2V4LA 4DHZB 2DAFA 1E8YA 3PGEA 3ML8A 3DDCB 4MDKE 4OVVA 3WIMA 3RD2A 1UBQA 3MJWA 3V62A 4B9KA 2DYMA 3TL5A 4MGYE 1LM8B 1RAXA 4TUUA 2GBKA 2NS5A 2KXJA 3VAWA 3O65B 2D07B 5EDSA 2BPSA 1ZW7A 3W1SA 2IY0B 4GOCA 3PTFC 3PHXB 3PLVA 4BBNF 4IUMB 2KZRA 3IG3A 1LQBA 1NI2A
chains in the Genus database with same CATH superfamily
2K25A 3ZW3A 4FXCA 2LMCA 2L32A 1SJED 4WWOA 2G4SA 2ZCCA 2YEPB 1FIQA 2ASQA 1XXGA 3GOEA 3M3JA 2KX3A 4YSYB 2W54A 1V9JA 3R7QA 3EA6A 4BAXA 3Q6BA 4KKJA 3KH0A 1RFKA 1WMHB 2I38A 1I4GA 2JYEA 2YEPF 2G1EA 4LNFA 1M94A 2CS4A 2KAJA 4S17A 4DWFA 3BVGA 1B9RA 1J19A 2DNFA 1WXSA 1FCCC 3NY5A 1ET6A 1E90A 1JALA 1PYWD 2LD9A 2N7JA 2MP2B 2MBQA 2I1JA 1WGDA 3NHEB 4G0NB 1L0XB 2WXRA 2N1WA 3PRPB 1IBXB 5LXIB 5EE1A 1MJDA 1F77A 3Q3MC 3AEAB 4GDLB 4ZYSA 2Z0DB 3DBRI 3N3KB 2KT7A 1EUVB 3P4PB 2WXGA 1C1YB 2XNAC 1MI0A 2WXQA 3TSSA 3NVYA 3NZUA 3GE3C 1F9JA 2BB5A 5DPWA 4M8NA 4L1BA 4C4VB 2INNE 2QJLA 4E71A 2C7HA 4D2KA 2AWTA 4C00A 3KYCD 1V1PB 2L1AA 2LHDA 4KVGB 3U8ZA 1K52A 4W9HA 4DXAB 2JYTA 4HPLB 5C2TB 2BYVE 2JWZA 4QAYA 3BZDB 3Q8CA 5JHAA 1K51A 1IBXA 4P1BC 2L00B 2QDFA 4FN2A 1GNUA 2CHXA 3RFZB 1QQRA 5DCNA 4GDLA 4ZRIA 3TCAA 2D2QA 2RMMA 4LTUA 3C19A 3VR8B 3VDZA 3EC8A 5TSSA 1LO5D 4MJSB 3DVGY 3L4PA 3H1UA 2C7MB 2N1VA 2WU5B 3N1ZC 3LJ3A 3NVZA 4KZ0A 1C4AA 5BYRA 3V6EB 4C4VA 2R2QA 4DHJB 3ZJVA 2BBCA 2GI9A 2K0PA 1YX5B 5CHFA 1UZXB 2BYEA 4PS3A 4H2AA 4DHJD 1V1PA 4MM3A 1EO6A 1L6VA 1GB1A 1P9DU 4YTPB 1I35A 2D10A 3QWZB 3NOBA 1UF0A 1NBFC 5IO9A 3APDA 1RM6C 2GLSA 3ETRA 1N6ZA 1AARA 2WXIA 1RYJA 5JXVA 4LNIA 4NQKE 2JU6X 2G4DB 3W1SC 3EFCA 1UUPA 4UDUC 2FCMA 1ZOYB 2J4XA 2LXAA 2I2YA 2FAZA 2KTFA 1TS3A 4PYUA 4CHKA 1J8CA 1WM2A 2B3AA 5BMHA 1EF1A 2LWPA 2D3CA 1ZE3D 3ZXRA 3VXWA 1YX6B 3RNCC 4YSZB 3L0WB 3AM9A 3R7RA 4FA6A 1PDXA 3ZKJC 1L6UA 3BIID 2KX0A 3WA0A 3N30A 2CHWA 5I4DA 1ZXHA 2BKRB 3AH7A 1TKEA 1E7VA 2YVCA 1TZOA 3RULA 5LNK1 1S1QB 2J53A 3ZIMA 5T8IA 4A90A 1P7EA 2Y5PA 4URKA 4M8MA 3UGBB 1EU4A 3M95A 2BF8B 3VH3B 4F7ZA 3CSFA 3U4EG 1KLGD 1L0VB 1OQYA 4P1CC 4G3XB 3WCQA 2KFJA 3N32A 1E10A 2KLGA 2PEAA 2QCZA 3M62B 3O13A 4AOFA 5HG2A 4YXDB 2NCNA 2W3SA 3ZXVA 3QARA 3PHWB 2HE7A 2GBNA 2SAKA 3ZGZA 1VLBA 1YJIA 4WJNA 2ZPYA 3J9CA 2RPVA 3A9KB 1VCBA 1VZ7A 2RSUA 1DGJA 1N61A 2JF5A 3AULA 4BKSA 4ACFA 2NPTB 3MJ5A 2MHJA 2V3PA 3U2SC 2JUOA 3BYTB 2H89B 1UGJA 1SEBD 2WXOA 4B95A 1T6BX 3ZJUA 2O2VB 5AZFA 2L52A 1XF5L 4E3CA 4M0WA 3P4RB 2XEWA 3VH4B 2DLBA 3NG0A 4FHKA 4KGRA 4KZCA 4ZHOA 4GDKB 5H92C 1FEHA 1P1AA 2JZZA 2OHFA 4MT5A 2BWFA 1ET9A 2JX5A 2A4ZA 1WSPA 2E3TA 3AE7B 4RGTA 1NYQA 1IP9A 1WGRA 3RMKC 2WWZA 3DBLI 2V3SA 3TIXA 5G5HA 2ZW1A 2ZJDA 3A9KA 5TR5A 4HK2A 2O2VA 1L4ZB 1WJ6A 1FCLA 2AQ3B 3DVNV 4FULA 3OJ4B 3PPAA 4ANVA 2L8JA 3KUCB 1C4CA 2C7NB 3AE8B 1CZPA 4TMAB 4K81A 1ROEA 4GDKA 1BT0A 1WR6E 2Y5BB 1WRIA 1YQBA 1L5PA 3IVFA 1IYFA 1FPYA 4HDQA 2AQ2B 2K22A 1D6EC 4I6NB 3SD5A 2MBBB 3B08A 2KD0A 3ZTDA 2OJRA 1PFDA 2DYBA 3LXFA 2K8HA 3BK1A 4US8A 4MDKE 4RGOS 2EELA 1ZUD2 3RNAC 3WIMA 1Y56A 4MGYE 1RAXA 2GBKA 2D07B 4K3BA 2BPSA 5HI1A 3PHXB 1R4NB 1ZXIA 4IUMB 3IG3A 2NTTA 1NI2A 1HTOA 2BYTA 2X8XX 4IM2A 2KTRB 5C3JB 5C23A 2OEDA 5J2RA 1ZGUB 2DZJA 2PVOD 3HVZA 3ZO5B 1X1MA 1TY0A 4AS1A 1MFWA 4GMVA 3QHTA 4XE0A 4HLEA 2CKHB 4MH0E 4ZRQA 2M56B 3ABVB 4LJPB 3UIOB 4O1NA 2PPHA 2Z59B 3PVLA 4K7SA 3DBHB 2QSDA 5AUIA 1WY8A 4I6PA 4BKTA 3TEWA 1TJEA 2FIDA 1I4QA 1E5WA 4WWNA 4XC2A 2KTRA 3Q3FA 2J52A 1WGGA 1F2RC 1TT5B 3UI3A 2BS2B 4MGIE 1E7UA 2K5PA 3H6NA 3KW5B 4RCOA 1WYWB 1SBBB 3KVFB 5HHDG 4K3CA 1GC7A 1GG3A 5FKAC 3EUB2 1Q5WB 1QF6A 3H7SA 2ZCBA 2J0KA 2AL6A 3LYYA 4XZ4A 2HJ8A 1P3QU 1WH3A 2MLBA 4FLHA 4CO7A 2Z8LA 1ZPSA 3AEGB 3AE2B 3NS8A 2WX1A 1WM3A 2KWCA 3UQBA 2MW5A 4M00A 1FXAA 4BBNC 1TYGB 5C1ZA 3SU8X 1YMHE 2Y5CA 3U30A 4KSLC 2MWSB 2ZVNA 4WIPA 4FBJB 1KLVA 1KRHA 1YQ3B 3ZNGC 2KK8A 2INDC 2PTLA 3NZSA 1FXTB 2PE9A 5E6PA 3L13A 3PZ8A 3A1QB 4TKNA 4KIKB 4ZRJA 3RN9C 3RNFC 4HROA 3BWUD 4AJYB 4K7WA 1CK1A 1JWUD 2KJRA 3QIJA 4ASWC 2LGIA 4P16A 3OG5A 3QA8A 3P1MA 4EOYA 2N9KA 2BW2A 1I42A 4KDLB 1SIFA 1G6JA 1XT9B 4WJPA 2GB1A 2WLBA 2WGSA 5LXHA 2IO3B 1JWSD 2D11A 2MJEA 1WX7A 2IO0B 5BYSA 4WQOB 2WXLA 2GBMA 4N58A 2EKIA 1Z5SB 2KVZA 3BK2A 2TSSA 1WR1A 5CHWA 3ZNZB 4KSKC 3VRAB 4NAWA 4WH4A 2IY1B 1FXIA 4TV3A 1E8XA 2HDEA 2KDEB 2N9XA 2BS4B 3UQAA 4FHJA 3KQ4A 3A1QA 3MC8A 4NZLB 4RM8A 4KIKA 3CMMB 2DYOA 4F8CB 1OQQA 1VRAB 3MHSD 3R3MA 1XD3B 2C9WB 2N9EB 2O6VA 2D3BA 4FJYA 4ZYNA 2WDRB 4IC7B 3R2IA 2LGYA 4ZOHC 1WE6A 3W2DA 2DBYA 1R4MB 2L3ZA 3VRBB 2MA9B 4FADA 4IWPA 1UD7A 1WI0A 1KF6B 2M0XA 5JZEB 1I7HA 1MHXA 2L0TA 5KHOA 2R2OA 1TZ1A 2QIEB 4MM3B 4G11A 4HKZE 1UH6A 1U4AA 4II3B 3GZNB 2JZ3B 5CTRC 1Y8RC 3ML9A 3ALBA 3VUXA 4P6VF 3FILA 3S2AA 2LASA 4RNAA 1IUEA 2H88B 2MRPA 2EMSA 3HM6X 3ZRCA 5E6JA 4EE2A 1KM7A 1XEEA 3AU4A 2M0AA 2VZKB 1DOYA 1VR9A 4DHZE 3HK0A 4B6WA 5DPTA 3PRMB 3TBLD 1H8CA 2PMVA 2XN9C 5GMVA 2KDIA 2K8BA 2B76B 2K3UA 2W3RA 4JL9A 4A3OA 4OZCA 2WDQB 2WXMA 3AE6B 5IAAC 1ZKHA 3VTUA 3Q8FA 3AV8A 2KMAA 2LUMA 3V6CB 2WX0A 3X0WA 5CX3A 2DAJA 2KJHB 3ZJTA 1N5WA 5FR6A 2REXA 4ANWA 2KDFB 4PS8A 3MP9A 4OHJA 4B0EA 4PK1A 4C56C 4DDGD 2IGDA 2LVOA 3DOWA 2D3GA 3ECIA 1OGWA 3AE4B 2IJ0A 1WXVA 4KX6B 3ZNID 1EU3A 3Q8BA 3JYUA 1L4DB 3IT6B 4NJ7A 4WJQA 1V5TA 2RDHA 3SFEB 1PUTA 1E8ZA 2KC1A 3Q8EA 1GB4A 2KMMA 1WXAA 3OLMD 3CSTA 1QOGA 3BYYB 2CHZA 3HHMA 2K9XA 5LLIA 2DZMA 1AWDA 3W1YA 2KMCA 3ONSA 2MCNB 1RRBA 3UIPB 4IWQA 2WNMA 3N1XC 4MH8A 2LUEA 1HE8A 3NZ3A 2FUG1 3IXSA 3VHTC 2QEJC 4JX1C 3L08A 5EE0A 3VVWB 2CR5A 2JPHA 4ANUA 3U7DA 3U7ZA 3I57A 2ZNVC 1UNSA 2J7QB 5IN7A 4EEWA 3Q2AC 4ZHPA 4Q2JA 1TKGA 3AU5A 1QILA 1YOVB 5E6OA 3T9LA 2OOBB 2V9HA 2L76A 3ZYYX 3SDLC 1RFAA 3I5JC 4GIVA 4IM3A 1UBIA 1OEYA 2I1KA 1ISNA 3K9PB 4XDCA 2J0JA 4HCPB 4RM9A 4BKSD 3DPDA 1WIAA 3GP7A 2ZEQA 1K8RB 3P63A 1TS2A 2RGFA 4M0WB 4WURA 1FFVA 3HRDD 5EE9A 3TEZA 1UELA 2N0SB 4GLSC 4K1RB 1OEYJ 3DBHI 1H4RA 1TIFA 5AZGA 3WANA 1J7CA 3OAWA 1SSNA 2NBVB 2WHIA 2M19A 3WAMA 4FJZA 5G55A 1STEA 2DAFA 1TS4A 3PGEA 1LM8B 2KXJA 3P4SB 1WXQA 3O65B 5EDSA 3W1SA 3R2TA 4GOCA 4S0RA 1MG4A 2KZRA 2ONQA 3KWLA 1FMAD 1E6EB 2LVQA 2D5GA 1KJTA 2N7EA 1IPGA 1TY2A 1SJHD 1HZ6A 1C3TA 4RFBA 3H7PB 1WYGA 4AP4C 4HPPA 2JRIB 2C60A 1F1HA 2IO1B 3ZNHB 1BMLC 3QCAA 4LLGM 4DBGA 3IHPC 2LFIA 3L17A 2VH1A 3TEYA 4YTMB 2IGGA 1A5RA 1I4XA 1WRDB 1VDVA 1JWMD 2LGSA 3MC0B 3RYTA 3ZRFA 2M8SA 3NVWA 3Q69A 3E9SA 2NTSA 1E7PB 1JWAD 1CMXB 1K50A 1LGRA 4MSQB 3JSVB 1OFFA 1FNVA 1FM0D 4DDID 2AYOB 2E6XA 1VZ8A 1PGXA 2LRWA 5BMGA 2K1FA 2AEHA 2AL3A 2PE6B 2RD0A 3H7PA 4LNOA 2FCNA 3RNEC 3B2GA 2UU7A 2WXKA 4ARIA 1WJNA 1QOFA 3QAQA 4NJ6A 2AX5A 1FNWA 2PKOA 3A4SC 1BUIC 3B0AA 4JGHB 4LK0M 1EWYC 1SGHA 2Z0EB 2KKCA 1V97A 3PT2B 4EZKA 3KLSX 1UWXA 4TQ1A 3PV1A 2AQ1B 2L05A 3RUIB 3ZTCA 4TSSA 4NPNA 4ZRPA 4F1SA 2KWDA 4DK5A 4XDDA 1OQRA 4IDIA 1XQQA 5L83A 1V81A 2K39A 3CIRB 3CF6E 3JSVA 1OTRB 1D5MC 4NJCA 3V61A 2QILA 2BQQA 2BKFA 1L0YB 3DHHC 1L2NA 1T0YA 1KFYB 1JW9D 5AZHA 1R7SA 2WXNA 1R4MI 4WAFA 5D6JB 1C78A 1NVID 1MG8A 4US9A 4I6LB 1ZDVA 4JQWC 4LJOB 2KLCA 1N62A 2GBJA 3DBSA 1SIJA 2KDMA 2K6DB 4PS7A 5MPOA 3AB5A 1B1ZA 1WGHA 4GGQA 2JXTA 3DVNU 2NBWB 3RI7C 3Q14C 4KKIA 3A9JB 2WP9B 2ZZPB 4REZA 3EECA 1IGCA 3VUWA 2LJIA 4M02A 4IM0A 1D3ZA 3KYDD 1WX8A 4OW0A 2PLPA 3Q3NC 4ICUA 3B1LX 4AUQC 5EE3A 4N59A 5D94A 3BVMA 2KVRA 2R61A 2OJWA 3MC9A 1WF9A 3RT3B 4BVUC 2QC8A 3L10B 2PVGC 1WJUA 1HQRD 1C76A 4XGAB 4HDOA 2W9NA 1D4BA 1JROA 1HZ5A 2V4IB 3KUZA 1KOTA 4JE3B 3QX1A 4A9AA 2BWES 2JRHA 1GUAB 2W55A 5KHQA 2PJHA 3A9JA 4JPSA 2V3NA 1M4VA 2Y3AA 4M01A 5BMIA 5IP4D 4BKGA 3H9DA 3NRZA 3U52E 2G45B 4LDTB 2HTHA 2MEKA 4HJGE 1F0ZA 2IZVB 1DOXA 2JZPA 4NAWB 3RZWC 4HJKA 3VFKA 4LDTD 3WALA 1HA5A 2GMIC 3MTNB 5D7GA 4AJWA 3AEFB 3ZDTA 2YLMA 1KLUD 3DWGC 4CQNA 2HD5B 2BS3B 2JXXA 2A5UA 3B9JA 4NQLB 1GAQB 1WXMA 2GRIA 3UF8A 3P2BA 1PGBA 2D3AA 2O6VB 4JWUC 3HUIA 3ZVVA 2O6VD 5J18A 1Z2MA 2ON8A 3BY4B 4HPMB 4XX5A 1CQVA 4HKQA 5JHBA 1V49A 4ITKA 3JVZX 5L95C 1HTQA 2J0MA 4EZJA 2LRUA 3DWMA 2DZIA 2KO3A 4ZDVA 3L54A 4GU2A 1YQ4B 1MPEA 4RGMA 2WQYB 4OVUA 4NY0A 4YL8A 3FILB 4KGSA 1I4RA 2MJ3A 3ZUNA 1D5ZC 1WZ3A 1C4PA 3LB8C 1MVKA 4W9IA 2KQ7A 4PT5A 3A4RA 2ACZB 4G50A 4HVBA 1V1OA 2XK5B 4TQ0A 2BTEA 2DENB 2M1MA 1C77A 2L7RA 4A20A 4IOIE 3VTWA 1SE9A 4CYEA 4A55A 1J7BA 1LFDA 4N9F4 4PYZA 4ARCA 2FUHB 2NR2A 1VJKA 3SEBA 4GB9A 2GOWA 4W9FA 1FO4A 5G5GA 2KWUB 2ZVOA 1DYQA 2BYFA 3VUYA 3PREA 3LDZE 5AEKB 4BOSC 3T3NA 3R8BA 3BVZA 4WJOA 1NDDA 1ZDXA 3DQVA 3PLUA 3KUDB 3AI5A 4W9EA 3I63C 2JSVX 1ZP0B 1P0RA 1KTKA 1QT9A 4W9GA 1WMHA 3W5UB 3QC8B 2LJ5A 3GE8C 1PGAA 4MSMB 4GXBA 4HXDA 1ESFA 2XK5A 1YJJA 2EMTA 1JRUA 3N1YC 3Q3OC 4C80A 2MP2A 1T0RC 2G9HD 4NNJB 5JH5C 4W9LA 4AQ7A 1BXTA 3HM3A 2INCC 3WAPA 1ACCA 2L0FA 2FCQA 2M4NA 1WZ0A 2VZKD 3N9YC 4DHZB 2V0GA 2KN4A 3AE1B 1XLOA 3RD2A 1UBQA 3MJWA 3V62A 4B9KA 4HEA1 2DYMA 4TUUA 2NS5A 3VAWA 1N63A 1NI3A 2IY0B 3SFDB 3PTFC 4OVZA 3FAHA 2CJOA 3FC4A 2DX5B 4RF1A 4W9DA 2GBRA 2ZPNA 3OJ3A 1YNTE 3RNBC 1DOIA 4KV2A 3TMPB 3TUOA 1J0GA 3URYA 2FIFA 3V05A 1TTNA 3EHVA 3PZ7A 2BT6A 3C0RB 4LNKA 1V80A 2QHOA 1ENFA 2IDYA 4XWWA 1WGYA 4XYCA 2KC2A 3HIZA 1YN5A 2NMQA 2FBWB 2IBIB 1NEKB 1XLPA 1QOAA 1RWSA 1E8WA 2LHEA 2IPKD 4EUTA 1GOZA 4ANXA 3PS6A 2VH2A 2JT4B 2KDBA 3NUHB 2KNBA 2XBBC 3VR9B 2KOXA 2WS3B 1SF0A 1EWCA 4AWJA 4MJSA 2PIAA 1NENB 1XO3A 2INPE 2RPQA 5IOIA 1WFYA 1P98A 1JCKB 1R4NI 2IYDB 1N60A 2FNJB 3IAM1 2HTME 2MSED 3N20C 1FFUA 2NBUA 2UYZB 5BYQA 1YJ1A 5D3DA 3AEEB 2G3QB 4IKGA 2V1YA 3X23A 1QZEA 4GN1A 3DHGC 4OZAA 3OWEB 2NVUI 1WX9A 3PZDA 3H8HA 5H8YE 3W9CB 3C8YA 2N9LA 2SEBD 3WAOA 2KFKB 3RZFA 1YN3A 2ZNVB 3AE3B 3NJTA 2LGXA 4GSWA 2DWQA 3PSEB 1LXDA 2JY6A 3ZDMC 2KHWB 4JLCA 4OZBA 1T3QA 3VQIA 1GC6A 1V6EA 4YWGG 3IBEA 4DQOC 3QJZA 4BFRA 5GXGB 2LGDA 1F52A 1SXTA 1WGKA 3DBRB 1T5XD 1SE2A 4B0MA 1XCQL 5D3IB 2FCSA 2KYWA 1WE7A 3SHQA 4YTNB 2WXFA 2C5LC 3HVDA 4JWSC 5FR3A 2LZ6A 2MX2A 1Q10A 1N5XA 3K9OB 3A33B 1T0SC 2KFKA 1TS5A 2LI5A 2BB6A 4IG7B 4LCDE 4FJVB 3I9V1 2PW9A 4DXFA 1VZ6A 2K8CA 1F2RI 4P7IA 3FKYA 1D5XC 1AN8A 2ZW0A 3MFGA 4C7YA 2HJ1A 4WWPA 2EKEC 1SB3C 3EFUA 3AXCA 2WXPA 4A3PA 1TGZB 3BINA 3L16A 2IO2B 2Q5WD 3VTVA 5FK9C 2CU1A 2KQSA 3NVVA 3QK0A 1K53A 3KWVA 3APFA 2W82A 4EZLA 3B2FA 4EKUA 3AEDB 4A6QA 1QKZA 2LEKA 4X57B 3PRZA 1VD2A 3IAS1 2N7DA 4DXGA 1JWBD 1UGMA 1FRRA 3IFWB 1C79A 2X38A 2MBHA 3Q3JA 4HCNB 1JRPA 4JIOU 4EFOA 2KWVB 1HEZE 2NPTA 3ZLZA 3JW0X 2LVPA 1TBEA 1QLBB 4MGZE 3V3XA 2K6QA 3MHZA 2MBOA 2UWQA 1MHHE 1S3SG 2DZKA 4LNNA 2JWUA 2MJDA 3Q8AA 4ICVA 2WXJA 3T8MA 1FRDA 4MGKE 3EGRA 2KJ6A 1TKYA 2M17A 3GS2A 4MACA 2VRRB 2WDVB 2QMTA 1RLFA 4II2B 3D32A 1Q1OA 2WDTB 5G2NA 3E56A 5IA7A 1QOBA 1SE4A 1SE3A 1AYFA 3APCA 4W9KA 4R3DA 2WYQA 2WXHA 2BGFA 4A8XC 1I4PA 1GJZA 5DPRA 3DVGX 4K7UA 3AECB 2L83A 3IT4B 2KN5A 4WWMA 3QQ8B 3PO0A 5HKHA 3RCZA 4N6EB 1YN4A 1GPXA 2BVCA 5CHVC 4ZRKA 1FD6A 4XWTA 4HWIB 5E6NA 1PQSA 5J17A 4YSXB 4RMAA 2RDGA 4YT0B 2N4FA 1YD8U 5DPSA 4MEMA 1V86A 3GZNI 4BOZB 2CJNA 2KQ4X 5HFYA 4RF0A 3GB1A 1JQ4A 3DCGA 5D2MB 2LXCA 1IGDA 3UINB 4HRSA 3AN1A 1HXYD 4IW0A 1XLNA 2RR9A 2FE8A 3ZQ4A 1V5OA 2JQRB 4L2YA 4J6IA 4NAMA 4J3OD 3M63B 4E74A 2KACA 4W9JA 3T3OA 5IKCM 2ICIA 4MELA 1UWMA 1JMLA 1T0QC 2N9PC 3I3TB 1L7YA 3W5VB 4BZAA 3DHIC 1I4HA 5AUKA 4IWOA 1CJEA 4KDIC 3NS1A 5BO4B 1J7AA 3AE5B 1V2YA 2IGHA 1WJ4A 3ENEA 2MH7A 3RNGC 1AW7A 3P42A 2DHZA 4RGNA 3R66C 2MBEA 3P4QB 1P7FA 3CWIA 1NYRA 3TEXA 1KH0A 3SR6A 4WQMA 1YIWA 3TJPA 3V60A 4WAAA 3AE9B 1E0ZA 1EF5A 4USAA 1V8CA 4RH6A 2JVCA 4C7ZA 4W9CA 1Q0WB 2MQJA 1XLQA 2KANA 3AEBB 1FNUA 2V4LA 3AMZA 1E8YA 3ML8A 4L23A 3DDCB 4OVVA 2WU2B 1WWTA 4KGTA 1EM7A 3TL5A 1A70A 3DBLB 3RPFC 2CU3A 1ZW7A 1E9MA 3PLVA 1XCTL 2J42A 1C9FA 4BBNF 1LQBA 2RDBC
chains in the Genus database with same CATH topology
2DX5B 2K25A 4W9DA 3ZW3A 4IM2A 2KTRB 2GBRA 2LVQA 1KJTA 2N7EA 1IPGA 5C23A 2ZPNA 1ZGUB 2DZJA 3OJ3A 4WWOA 2G4SA 5J2RA 2ZCCA 2ASQA 3GOEA 3M3JA 2KX3A 4KV2A 3TMPB 1C3TA 3ZO5B 1V9JA 3R7QA 1X1MA 1J0GA 3H7PB 2FIFA 3KH0A 1TTNA 3EHVA 4GMVA 4AP4C 1WMHB 2JRIB 3QHTA 2C60A 3C0RB 4HLEA 1V80A 2CKHB 2QHOA 2IO1B 1WGYA 4MH0E 3ZNHB 3QCAA 4DBGA 1M94A 2CS4A 3IHPC 4DWFA 3L17A 1J19A 2KC2A 3HIZA 4LJPB 1WXSA 3UIOB 3NY5A 2PPHA 2Z59B 3PVLA 4K7SA 1A5RA 1E90A 2IBIB 2LD9A 1WRDB 2MP2B 1E8WA 2MBQA 4EUTA 2I1JA 4ANXA 3PS6A 3RYTA 1WGDA 2JT4B 3ZRFA 2KDBA 2M8SA 2KNBA 3NHEB 4G0NB 2XBBC 2KOXA 1WY8A 2N1WA 3PRPB 4I6PA 4BKTA 4AWJA 4MJSA 5LXIB 2FIDA 1E5WA 1CMXB 4WWNA 2RPQA 1WFYA 4MSQB 1P98A 2KTRA 4XC2A 3Q3FA 4GDLB 1R4NI 3JSVB 2IYDB 1WGGA 2FNJB 2Z0DB 3DBRI 4DDID 3N3KB 2AYOB 2MSED 2LRWA 4MGIE 1E7UA 1EUVB 3H6NA 3KW5B 2K1FA 1C1YB 2AEHA 1WYWB 2NBUA 3KVFB 2UYZB 2AL3A 1GC7A 1GG3A 3NZUA 2PE6B 2RD0A 1YJ1A 3H7PA 2G3QB 2FCNA 1Q5WB 1F9JA 2V1YA 3X23A 3H7SA 5DPWA 1QZEA 4GN1A 2ZCBA 2J0KA 4M8NA 1WJNA 2NVUI 1WX9A 3QAQA 2AL6A 3PZDA 4NJ6A 3A4SC 4XZ4A 2HJ8A 3B0AA 1P3QU 1WH3A 4JGHB 4E71A 2C7HA 2AWTA 1SGHA 2Z0EB 2MLBA 2KFKB 2KKCA 3PT2B 4FLHA 3KYCD 3RZFA 3WAOA 4CO7A 4EZKA 2ZNVB 4KVGB 4TQ1A 3U8ZA 3NS8A 2WX1A 1WM3A 4W9HA 2LGXA 3PV1A 4DXAB 2KWCA 3UQBA 4GSWA 2MW5A 2L05A 3PSEB 1LXDA 3RUIB 2JY6A 3ZDMC 2KHWB 4BBNC 4JLCA 5C1ZA 3SU8X 4HPLB 3U30A 3ZTCA 2BYVE 2JWZA 4KSLC 2MWSB 3VQIA 2ZVNA 4NPNA 4F1SA 5JHAA 1GC6A 4FBJB 1KLVA 4DK5A 2L00B 1V6EA 4FN2A 1GNUA 2CHXA 1XQQA 5L83A 1V81A 2K39A 5DCNA 3ZNGC 3CF6E 4GDLA 4ZRIA 3JSVA 2KK8A 3IBEA 3TCAA 1OTRB 2D2QA 3NZSA 3QJZA 1FXTB 4BFRA 2PE9A 5E6PA 3V61A 3VDZA 3L13A 2LGDA 3EC8A 3A1QB 4MJSB 4TKNA 4KIKB 2BKFA 4ZRJA 3DVGY 4AJYB 1L2NA 1T0YA 3H1UA 4K7WA 2C7MB 2FCSA 5AZHA 2N1VA 2KJRA 1WE7A 3QIJA 3SHQA 4ASWC 3LJ3A 4KZ0A 2C5LC 3V6EB 3QA8A 2R2QA 4EOYA 4DHJB 1R4MI 2LZ6A 1I42A 4KDLB 5D6JB 2MX2A 1SIFA 3K9OB 1YX5B 3A33B 1MG8A 1UZXB 5CHFA 1G6JA 2KFKA 2BYEA 1XT9B 4PS3A 4WJPA 4DHJD 4I6LB 4MM3A 1EO6A 4JQWC 2LI5A 4LJOB 2KLCA 4IG7B 5LXHA 4LCDE 4FJVB 2IO3B 2GBJA 2D11A 1WX7A 3DBSA 2IO0B 2K8CA 2K6DB 4PS7A 4WQOB 4P7IA 1P9DU 1WGHA 4GGQA 1I35A 2GBMA 1Z5SB 2D10A 3QWZB 4WWPA 3NOBA 3DVNU 2NBWB 2EKEC 1WR1A 3A9JB 1NBFC 2ZZPB 3EFUA 3AXCA 3APDA 4KSKC 5CHWA 3ZNZB 4A3PA 3EECA 1TGZB 4NAWA 2IY1B 3BINA 2IO2B 3L16A 3VUWA 4TV3A 1AARA 1E8XA 2KDEB 2N9XA 3VTVA 3UQAA 4FHJA 4IM0A 1D3ZA 3KYDD 1WX8A 2CU1A 2KQSA 4NQKE 3A1QA 4RM8A 4KIKA 2G4DB 2DYOA 3CMMB 3QK0A 3APFA 4ICUA 3B1LX 4AUQC 4F8CB 3W1SC 4EZLA 3MHSD 3R3MA 1XD3B 4EKUA 2C9WB 2N9EB 5D94A 2FCMA 2LXAA 2O6VA 2KVRA 2FAZA 1WF9A 2KTFA 3PRZA 4FJYA 4X57B 4ZYNA 3RT3B 4BVUC 3L10B 4PYUA 4CHKA 1VD2A 1WJUA 1J8CA 1WM2A 4IC7B 2B3AA 2LGYA 2N7DA 1WE6A 4HDOA 2W9NA 1EF1A 2LWPA 2L3ZA 1UGMA 3IFWB 2MA9B 4FADA 2MBHA 3KUZA 3Q3JA 1UD7A 4HCNB 4IWPA 3VXWA 1KOTA 1YX6B 1WI0A 2M0XA 4JIOU 5JZEB 3L0WB 3QX1A 4EFOA 2KWVB 2L0TA 2NPTA 5KHOA 3R7RA 4FA6A 2R2OA 2BWES 2JRHA 3ZLZA 1GUAB 3ZKJC 5KHQA 3JW0X 1TZ1A 2PJHA 2LVPA 2KX0A 3A9JA 3WA0A 4G11A 1TBEA 3N30A 2CHWA 1UH6A 1U4AA 4MGZE 4II3B 2JZ3B 5CTRC 1Y8RC 3ML9A 3ALBA 2BKRB 4BKGA 2K6QA 1E7VA 3VUXA 3H9DA 2YVCA 3S2AA 2LASA 2MBOA 3RULA 2UWQA 1S1QB 3ZIMA 1S3SG 2DZKA 2G45B 4LDTB 4URKA 2HTHA 4M8MA 4ICVA 3UGBB 2MRPA 3M95A 2IZVB 2BF8B 4NAWB 2EMSA 3RZWC 3T8MA 3HM6X 3VH3B 4F7ZA 4HJKA 4MGKE 3ZRCA 3VFKA 4LDTD 2KJ6A 2M17A 3CSFA 3WALA 2GMIC 3MTNB 2VRRB 5D7GA 4AJWA 1KM7A 1RLFA 4II2B 3D32A 1Q1OA 2WDTB 5G2NA 2YLMA 3ZDTA 5IA7A 3AU4A 1OQYA 4DHZE 3HK0A 4G3XB 4B6WA 5DPTA 2HD5B 3APCA 3PRMB 2JXXA 4W9KA 3TBLD 2KFJA 1H8CA 5GMVA 2A5UA 2WYQA 3N32A 4NQLB 2KDIA 2K8BA 1WXMA 4JL9A 3UF8A 4A3OA 3P2BA 2BGFA 2O6VB 2KLGA 2PEAA 3M62B 5DPRA 1GJZA 3DVGX 5IAAC 4AOFA 4K7UA 2NCNA 2KN5A 1ZKHA 3ZVVA 3QQ8B 2O6VD 3QARA 3PHWB 3VTUA 5J18A 5HKHA 2HE7A 3RCZA 2GBNA 1Z2MA 2KMAA 3V6CB 5CHVC 3BY4B 4HPMB 2WX0A 4XX5A 3X0WA 4ZRKA 5CX3A 4WJNA 2DAJA 2KJHB 5JHBA 1V49A 4HWIB 2ZPYA 3JVZX 5E6NA 5L95C 1PQSA 5J17A 3A9KB 2REXA 1VCBA 5FR6A 4ANWA 2J0MA 4RMAA 2KDFB 2RSUA 2LRUA 4PS8A 4EZJA 2DZIA 2JF5A 3AULA 4BKSA 2KO3A 2NPTB 4ZDVA 2N4FA 1YD8U 5DPSA 4MEMA 1V86A 2JUOA 3GZNI 4BOZB 4DDGD 2LVOA 3L54A 3DOWA 2D3GA 4B95A 3ECIA 4GU2A 1OGWA 2O2VB 1WXVA 3ZNID 5AZFA 3DCGA 3JYUA 5D2MB 4OVUA 4E3CA 2LXCA 4NY0A 4YL8A 2XEWA 3UINB 3VH4B 4NJ7A 4WJQA 3ZUNA 1V5TA 1WZ3A 4W9IA 2KQ7A 3A4RA 1E8ZA 4FHKA 2KC1A 4G50A 2RR9A 4IW0A 4HVBA 2XK5B 4KZCA 1V5OA 4GDKB 4TQ0A 1WXAA 3OLMD 4J6IA 3CSTA 2DENB 2M1MA 3M63B 1P1AA 2JZZA 4A20A 2L7RA 2CHZA 3HHMA 2BWFA 3VTWA 1SE9A 5LLIA 2DZMA 4CYEA 4E74A 4W9JA 1LFDA 2KMCA 3ONSA 4N9F4 1RRBA 2MCNB 4PYZA 3UIPB 3W1YA 2A4ZA 4IWQA 4MELA 2FUHB 2NR2A 2LUEA 1HE8A 2GOWA 4GB9A 4W9FA 1IP9A 1WGRA 2N9PC 3I3TB 3VHTC 2KWUB 2ZVOA 2WWZA 3DBLI 1L7YA 2V3SA 3TIXA 2BYFA 3L08A 3VUYA 3VVWB 4IWOA 4KDIC 2CR5A 2JPHA 4ANUA 3U7DA 2ZJDA 3PREA 3LDZE 5BO4B 3A9KA 2ZNVC 1V2YA 5AEKB 2J7QB 5TR5A 4BOSC 4EEWA 1WJ4A 3ENEA 4WJOA 4HK2A 2DHZA 1NDDA 3AU5A 3R66C 2MBEA 3DQVA 5E6OA 3T9LA 2O2VA 3KUDB 2OOBB 3AI5A 3PLUA 1WJ6A 4W9EA 2L76A 1P0RA 3DVNV 4W9GA 3SDLC 1RFAA 4FULA 1WMHA 3QC8B 2LJ5A 4GIVA 4IM3A 1UBIA 1OEYA 3OJ4B 2I1KA 1ISNA 3PPAA 1YIWA 3K9PB 2L8JA 4MSMB 3KUCB 4GXBA 2C7NB 4HXDA 4ANVA 2J0JA 4HCPB 3TJPA 4RM9A 4BKSD 3DPDA 2XK5A 1WIAA 4K81A 2EMTA 4GDKA 1BT0A 1JRUA 1WR6E 2ZEQA 1K8RB 3V60A 4WAAA 2RGFA 2MP2A 1EF5A 2Y5BB 4M0WB 1YQBA 4NNJB 5JH5C 3IVFA 1UELA 1IYFA 4W9LA 1OEYJ 3DBHI 4HDQA 1H4RA 4K1RB 2JVCA 5AZGA 3HM3A 3WANA 4I6NB 3SD5A 3WAPA 2MBBB 2L0FA 4W9CA 1Q0WB 3OAWA 2MQJA 3B08A 2KD0A 2FCQA 2NBVB 2M4NA 2OJRA 3ZTDA 2KANA 1WZ0A 2DYBA 4FJZA 5G55A 2K8HA 3WAMA 2V4LA 4DHZB 2DAFA 1E8YA 3PGEA 3ML8A 3DDCB 4MDKE 4OVVA 3WIMA 3RD2A 1UBQA 3MJWA 3V62A 4B9KA 2DYMA 3TL5A 4MGYE 1LM8B 1RAXA 4TUUA 2GBKA 2NS5A 2KXJA 3VAWA 3O65B 2D07B 5EDSA 2BPSA 1ZW7A 3W1SA 2IY0B 4GOCA 3PTFC 3PHXB 3PLVA 4BBNF 4IUMB 2KZRA 3IG3A 1LQBA 1NI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX5 B;  2K25 A;  4W9D A;  3ZW3 A;  4IM2 A;  2KTR B;  2GBR A;  2LVQ A;  1KJT A;  2N7E A;  1IPG A;  5C23 A;  2ZPN A;  1ZGU B;  2DZJ A;  3OJ3 A;  4WWO A;  2G4S A;  5J2R A;  2ZCC A;  2ASQ A;  3GOE A;  3M3J A;  2KX3 A;  4KV2 A;  3TMP B;  1C3T A;  3ZO5 B;  1V9J A;  3R7Q A;  1X1M A;  1J0G A;  3H7P B;  2FIF A;  3KH0 A;  1TTN A;  3EHV A;  4GMV A;  4AP4 C;  1WMH B;  2JRI B;  3QHT A;  2C60 A;  3C0R B;  4HLE A;  1V80 A;  2CKH B;  2QHO A;  2IO1 B;  1WGY A;  4MH0 E;  3ZNH B;  3QCA A;  4DBG A;  1M94 A;  2CS4 A;  3IHP C;  4DWF A;  3L17 A;  1J19 A;  2KC2 A;  3HIZ A;  4LJP B;  1WXS A;  3UIO B;  3NY5 A;  2PPH A;  2Z59 B;  3PVL A;  4K7S A;  1A5R A;  1E90 A;  2IBI B;  2LD9 A;  1WRD B;  2MP2 B;  1E8W A;  2MBQ A;  4EUT A;  2I1J A;  4ANX A;  3PS6 A;  3RYT A;  1WGD A;  2JT4 B;  3ZRF A;  2KDB A;  2M8S A;  2KNB A;  3NHE B;  4G0N B;  2XBB C;  2KOX A;  1WY8 A;  2N1W A;  3PRP B;  4I6P A;  4BKT A;  4AWJ A;  4MJS A;  5LXI B;  2FID A;  1E5W A;  1CMX B;  4WWN A;  2RPQ A;  1WFY A;  4MSQ B;  1P98 A;  2KTR A;  4XC2 A;  3Q3F A;  4GDL B;  1R4N I;  3JSV B;  2IYD B;  1WGG A;  2FNJ B;  2Z0D B;  3DBR I;  4DDI D;  3N3K B;  2AYO B;  2MSE D;  2LRW A;  4MGI E;  1E7U A;  1EUV B;  3H6N A;  3KW5 B;  2K1F A;  1C1Y B;  2AEH A;  1WYW B;  2NBU A;  3KVF B;  2UYZ B;  2AL3 A;  1GC7 A;  1GG3 A;  3NZU A;  2PE6 B;  2RD0 A;  1YJ1 A;  3H7P A;  2G3Q B;  2FCN A;  1Q5W B;  1F9J A;  2V1Y A;  3X23 A;  3H7S A;  5DPW A;  1QZE A;  4GN1 A;  2ZCB A;  2J0K A;  4M8N A;  1WJN A;  2NVU I;  1WX9 A;  3QAQ A;  2AL6 A;  3PZD A;  4NJ6 A;  3A4S C;  4XZ4 A;  2HJ8 A;  3B0A A;  1P3Q U;  1WH3 A;  4JGH B;  4E71 A;  2C7H A;  2AWT A;  1SGH A;  2Z0E B;  2MLB A;  2KFK B;  2KKC A;  3PT2 B;  4FLH A;  3KYC D;  3RZF A;  3WAO A;  4CO7 A;  4EZK A;  2ZNV B;  4KVG B;  4TQ1 A;  3U8Z A;  3NS8 A;  2WX1 A;  1WM3 A;  4W9H A;  2LGX A;  3PV1 A;  4DXA B;  2KWC A;  3UQB A;  4GSW A;  2MW5 A;  2L05 A;  3PSE B;  1LXD A;  3RUI B;  2JY6 A;  3ZDM C;  2KHW B;  4BBN C;  4JLC A;  5C1Z A;  3SU8 X;  4HPL B;  3U30 A;  3ZTC A;  2BYV E;  2JWZ A;  4KSL C;  2MWS B;  3VQI A;  2ZVN A;  4NPN A;  4F1S A;  5JHA A;  1GC6 A;  4FBJ B;  1KLV A;  4DK5 A;  2L00 B;  1V6E A;  4FN2 A;  1GNU A;  2CHX A;  1XQQ A;  5L83 A;  1V81 A;  2K39 A;  5DCN A;  3ZNG C;  3CF6 E;  4GDL A;  4ZRI A;  3JSV A;  2KK8 A;  3IBE A;  3TCA A;  1OTR B;  2D2Q A;  3NZS A;  3QJZ A;  1FXT B;  4BFR A;  2PE9 A;  5E6P A;  3V61 A;  3VDZ A;  3L13 A;  2LGD A;  3EC8 A;  3A1Q B;  4MJS B;  4TKN A;  4KIK B;  2BKF A;  4ZRJ A;  3DVG Y;  4AJY B;  1L2N A;  1T0Y A;  3H1U A;  4K7W A;  2C7M B;  2FCS A;  5AZH A;  2N1V A;  2KJR A;  1WE7 A;  3QIJ A;  3SHQ A;  4ASW C;  3LJ3 A;  4KZ0 A;  2C5L C;  3V6E B;  3QA8 A;  2R2Q A;  4EOY A;  4DHJ B;  1R4M I;  2LZ6 A;  1I42 A;  4KDL B;  5D6J B;  2MX2 A;  1SIF A;  3K9O B;  1YX5 B;  3A33 B;  1MG8 A;  1UZX B;  5CHF A;  1G6J A;  2KFK A;  2BYE A;  1XT9 B;  4PS3 A;  4WJP A;  4DHJ D;  4I6L B;  4MM3 A;  1EO6 A;  4JQW C;  2LI5 A;  4LJO B;  2KLC A;  4IG7 B;  5LXH A;  4LCD E;  4FJV B;  2IO3 B;  2GBJ A;  2D11 A;  1WX7 A;  3DBS A;  2IO0 B;  2K8C A;  2K6D B;  4PS7 A;  4WQO B;  4P7I A;  1P9D U;  1WGH A;  4GGQ A;  1I35 A;  2GBM A;  1Z5S B;  2D10 A;  3QWZ B;  4WWP A;  3NOB A;  3DVN U;  2NBW B;  2EKE C;  1WR1 A;  3A9J B;  1NBF C;  2ZZP B;  3EFU A;  3AXC A;  3APD A;  4KSK C;  5CHW A;  3ZNZ B;  4A3P A;  3EEC A;  1TGZ B;  4NAW A;  2IY1 B;  3BIN A;  2IO2 B;  3L16 A;  3VUW A;  4TV3 A;  1AAR A;  1E8X A;  2KDE B;  2N9X A;  3VTV A;  3UQA A;  4FHJ A;  4IM0 A;  1D3Z A;  3KYD D;  1WX8 A;  2CU1 A;  2KQS A;  4NQK E;  3A1Q A;  4RM8 A;  4KIK A;  2G4D B;  2DYO A;  3CMM B;  3QK0 A;  3APF A;  4ICU A;  3B1L X;  4AUQ C;  4F8C B;  3W1S C;  4EZL A;  3MHS D;  3R3M A;  1XD3 B;  4EKU A;  2C9W B;  2N9E B;  5D94 A;  2FCM A;  2LXA A;  2O6V A;  2KVR A;  2FAZ A;  1WF9 A;  2KTF A;  3PRZ A;  4FJY A;  4X57 B;  4ZYN A;  3RT3 B;  4BVU C;  3L10 B;  4PYU A;  4CHK A;  1VD2 A;  1WJU A;  1J8C A;  1WM2 A;  4IC7 B;  2B3A A;  2LGY A;  2N7D A;  1WE6 A;  4HDO A;  2W9N A;  1EF1 A;  2LWP A;  2L3Z A;  1UGM A;  3IFW B;  2MA9 B;  4FAD A;  2MBH A;  3KUZ A;  3Q3J A;  1UD7 A;  4HCN B;  4IWP A;  3VXW A;  1KOT A;  1YX6 B;  1WI0 A;  2M0X A;  4JIO U;  5JZE B;  3L0W B;  3QX1 A;  4EFO A;  2KWV B;  2L0T A;  2NPT A;  5KHO A;  3R7R A;  4FA6 A;  2R2O A;  2BWE S;  2JRH A;  3ZLZ A;  1GUA B;  3ZKJ C;  5KHQ A;  3JW0 X;  1TZ1 A;  2PJH A;  2LVP A;  2KX0 A;  3A9J A;  3WA0 A;  4G11 A;  1TBE A;  3N30 A;  2CHW A;  1UH6 A;  1U4A A;  4MGZ E;  4II3 B;  2JZ3 B;  5CTR C;  1Y8R C;  3ML9 A;  3ALB A;  2BKR B;  4BKG A;  2K6Q A;  1E7V A;  3VUX A;  3H9D A;  2YVC A;  3S2A A;  2LAS A;  2MBO A;  3RUL A;  2UWQ A;  1S1Q B;  3ZIM A;  1S3S G;  2DZK A;  2G45 B;  4LDT B;  4URK A;  2HTH A;  4M8M A;  4ICV A;  3UGB B;  2MRP A;  3M95 A;  2IZV B;  2BF8 B;  4NAW B;  2EMS A;  3RZW C;  3T8M A;  3HM6 X;  3VH3 B;  4F7Z A;  4HJK A;  4MGK E;  3ZRC A;  3VFK A;  4LDT D;  2KJ6 A;  2M17 A;  3CSF A;  3WAL A;  2GMI C;  3MTN B;  2VRR B;  5D7G A;  4AJW A;  1KM7 A;  1RLF A;  4II2 B;  3D32 A;  1Q1O A;  2WDT B;  5G2N A;  2YLM A;  3ZDT A;  5IA7 A;  3AU4 A;  1OQY A;  4DHZ E;  3HK0 A;  4G3X B;  4B6W A;  5DPT A;  2HD5 B;  3APC A;  3PRM B;  2JXX A;  4W9K A;  3TBL D;  2KFJ A;  1H8C A;  5GMV A;  2A5U A;  2WYQ A;  3N32 A;  4NQL B;  2KDI A;  2K8B A;  1WXM A;  4JL9 A;  3UF8 A;  4A3O A;  3P2B A;  2BGF A;  2O6V B;  2KLG A;  2PEA A;  3M62 B;  5DPR A;  1GJZ A;  3DVG X;  5IAA C;  4AOF A;  4K7U A;  2NCN A;  2KN5 A;  1ZKH A;  3ZVV A;  3QQ8 B;  2O6V D;  3QAR A;  3PHW B;  3VTU A;  5J18 A;  5HKH A;  2HE7 A;  3RCZ A;  2GBN A;  1Z2M A;  2KMA A;  3V6C B;  5CHV C;  3BY4 B;  4HPM B;  2WX0 A;  4XX5 A;  3X0W A;  4ZRK A;  5CX3 A;  4WJN A;  2DAJ A;  2KJH B;  5JHB A;  1V49 A;  4HWI B;  2ZPY A;  3JVZ X;  5E6N A;  5L95 C;  1PQS A;  5J17 A;  3A9K B;  2REX A;  1VCB A;  5FR6 A;  4ANW A;  2J0M A;  4RMA A;  2KDF B;  2RSU A;  2LRU A;  4PS8 A;  4EZJ A;  2DZI A;  2JF5 A;  3AUL A;  4BKS A;  2KO3 A;  2NPT B;  4ZDV A;  2N4F A;  1YD8 U;  5DPS A;  4MEM A;  1V86 A;  2JUO A;  3GZN I;  4BOZ B;  4DDG D;  2LVO A;  3L54 A;  3DOW A;  2D3G A;  4B95 A;  3ECI A;  4GU2 A;  1OGW A;  2O2V B;  1WXV A;  3ZNI D;  5AZF A;  3DCG A;  3JYU A;  5D2M B;  4OVU A;  4E3C A;  2LXC A;  4NY0 A;  4YL8 A;  2XEW A;  3UIN B;  3VH4 B;  4NJ7 A;  4WJQ A;  3ZUN A;  1V5T A;  1WZ3 A;  4W9I A;  2KQ7 A;  3A4R A;  1E8Z A;  4FHK A;  2KC1 A;  4G50 A;  2RR9 A;  4IW0 A;  4HVB A;  2XK5 B;  4KZC A;  1V5O A;  4GDK B;  4TQ0 A;  1WXA A;  3OLM D;  4J6I A;  3CST A;  2DEN B;  2M1M A;  3M63 B;  1P1A A;  2JZZ A;  4A20 A;  2L7R A;  2CHZ A;  3HHM A;  2BWF A;  3VTW A;  1SE9 A;  5LLI A;  2DZM A;  4CYE A;  4E74 A;  4W9J A;  1LFD A;  2KMC A;  3ONS A;  4N9F 4;  1RRB A;  2MCN B;  4PYZ A;  3UIP B;  3W1Y A;  2A4Z A;  4IWQ A;  4MEL A;  2FUH B;  2NR2 A;  2LUE A;  1HE8 A;  2GOW A;  4GB9 A;  4W9F A;  1IP9 A;  1WGR A;  2N9P C;  3I3T B;  3VHT C;  2KWU B;  2ZVO A;  2WWZ A;  3DBL I;  1L7Y A;  2V3S A;  3TIX A;  2BYF A;  3L08 A;  3VUY A;  3VVW B;  4IWO A;  4KDI C;  2CR5 A;  2JPH A;  4ANU A;  3U7D A;  2ZJD A;  3PRE A;  3LDZ E;  5BO4 B;  3A9K A;  2ZNV C;  1V2Y A;  5AEK B;  2J7Q B;  5TR5 A;  4BOS C;  4EEW A;  1WJ4 A;  3ENE A;  4WJO A;  4HK2 A;  2DHZ A;  1NDD A;  3AU5 A;  3R66 C;  2MBE A;  3DQV A;  5E6O A;  3T9L A;  2O2V A;  3KUD B;  2OOB B;  3AI5 A;  3PLU A;  1WJ6 A;  4W9E A;  2L76 A;  1P0R A;  3DVN V;  4W9G A;  3SDL C;  1RFA A;  4FUL A;  1WMH A;  3QC8 B;  2LJ5 A;  4GIV A;  4IM3 A;  1UBI A;  1OEY A;  3OJ4 B;  2I1K A;  1ISN A;  3PPA A;  1YIW A;  3K9P B;  2L8J A;  4MSM B;  3KUC B;  4GXB A;  2C7N B;  4HXD A;  4ANV A;  2J0J A;  4HCP B;  3TJP A;  4RM9 A;  4BKS D;  3DPD A;  2XK5 A;  1WIA A;  4K81 A;  2EMT A;  4GDK A;  1BT0 A;  1JRU A;  1WR6 E;  2ZEQ A;  1K8R B;  3V60 A;  4WAA A;  2RGF A;  2MP2 A;  1EF5 A;  2Y5B B;  4M0W B;  1YQB A;  4NNJ B;  5JH5 C;  3IVF A;  1UEL A;  1IYF A;  4W9L A;  1OEY J;  3DBH I;  4HDQ A;  1H4R A;  4K1R B;  2JVC A;  5AZG A;  3HM3 A;  3WAN A;  4I6N B;  3SD5 A;  3WAP A;  2MBB B;  2L0F A;  4W9C A;  1Q0W B;  3OAW A;  2MQJ A;  3B08 A;  2KD0 A;  2FCQ A;  2NBV B;  2M4N A;  2OJR A;  3ZTD A;  2KAN A;  1WZ0 A;  2DYB A;  4FJZ A;  5G55 A;  2K8H A;  3WAM A;  2V4L A;  4DHZ B;  2DAF A;  1E8Y A;  3PGE A;  3ML8 A;  3DDC B;  4MDK E;  4OVV A;  3WIM A;  3RD2 A;  1UBQ A;  3MJW A;  3V62 A;  4B9K A;  2DYM A;  3TL5 A;  4MGY E;  1LM8 B;  1RAX A;  4TUU A;  2GBK A;  2NS5 A;  2KXJ A;  3VAW A;  3O65 B;  2D07 B;  5EDS A;  2BPS A;  1ZW7 A;  3W1S A;  2IY0 B;  4GOC A;  3PTF C;  3PHX B;  3PLV A;  4BBN F;  4IUM B;  2KZR A;  3IG3 A;  1LQB A;  1NI2 A; 
#chains in the Genus database with same CATH topology
 2K25 A;  3ZW3 A;  4FXC A;  2LMC A;  2L32 A;  1SJE D;  4WWO A;  2G4S A;  2ZCC A;  2YEP B;  1FIQ A;  2ASQ A;  1XXG A;  3GOE A;  3M3J A;  2KX3 A;  4YSY B;  2W54 A;  1V9J A;  3R7Q A;  3EA6 A;  4BAX A;  3Q6B A;  4KKJ A;  3KH0 A;  1RFK A;  1WMH B;  2I38 A;  1I4G A;  2JYE A;  2YEP F;  2G1E A;  4LNF A;  1M94 A;  2CS4 A;  2KAJ A;  4S17 A;  4DWF A;  3BVG A;  1B9R A;  1J19 A;  2DNF A;  1WXS A;  1FCC C;  3NY5 A;  1ET6 A;  1E90 A;  1JAL A;  1PYW D;  2LD9 A;  2N7J A;  2MP2 B;  2MBQ A;  2I1J A;  1WGD A;  3NHE B;  4G0N B;  1L0X B;  2WXR A;  2N1W A;  3PRP B;  1IBX B;  5LXI B;  5EE1 A;  1MJD A;  1F77 A;  3Q3M C;  3AEA B;  4GDL B;  4ZYS A;  2Z0D B;  3DBR I;  3N3K B;  2KT7 A;  1EUV B;  3P4P B;  2WXG A;  1C1Y B;  2XNA C;  1MI0 A;  2WXQ A;  3TSS A;  3NVY A;  3NZU A;  3GE3 C;  1F9J A;  2BB5 A;  5DPW A;  4M8N A;  4L1B A;  4C4V B;  2INN E;  2QJL A;  4E71 A;  2C7H A;  4D2K A;  2AWT A;  4C00 A;  3KYC D;  1V1P B;  2L1A A;  2LHD A;  4KVG B;  3U8Z A;  1K52 A;  4W9H A;  4DXA B;  2JYT A;  4HPL B;  5C2T B;  2BYV E;  2JWZ A;  4QAY A;  3BZD B;  3Q8C A;  5JHA A;  1K51 A;  1IBX A;  4P1B C;  2L00 B;  2QDF A;  4FN2 A;  1GNU A;  2CHX A;  3RFZ B;  1QQR A;  5DCN A;  4GDL A;  4ZRI A;  3TCA A;  2D2Q A;  2RMM A;  4LTU A;  3C19 A;  3VR8 B;  3VDZ A;  3EC8 A;  5TSS A;  1LO5 D;  4MJS B;  3DVG Y;  3L4P A;  3H1U A;  2C7M B;  2N1V A;  2WU5 B;  3N1Z C;  3LJ3 A;  3NVZ A;  4KZ0 A;  1C4A A;  5BYR A;  3V6E B;  4C4V A;  2R2Q A;  4DHJ B;  3ZJV A;  2BBC A;  2GI9 A;  2K0P A;  1YX5 B;  5CHF A;  1UZX B;  2BYE A;  4PS3 A;  4H2A A;  4DHJ D;  1V1P A;  4MM3 A;  1EO6 A;  1L6V A;  1GB1 A;  1P9D U;  4YTP B;  1I35 A;  2D10 A;  3QWZ B;  3NOB A;  1UF0 A;  1NBF C;  5IO9 A;  3APD A;  1RM6 C;  2GLS A;  3ETR A;  1N6Z A;  1AAR A;  2WXI A;  1RYJ A;  5JXV A;  4LNI A;  4NQK E;  2JU6 X;  2G4D B;  3W1S C;  3EFC A;  1UUP A;  4UDU C;  2FCM A;  1ZOY B;  2J4X A;  2LXA A;  2I2Y A;  2FAZ A;  2KTF A;  1TS3 A;  4PYU A;  4CHK A;  1J8C A;  1WM2 A;  2B3A A;  5BMH A;  1EF1 A;  2LWP A;  2D3C A;  1ZE3 D;  3ZXR A;  3VXW A;  1YX6 B;  3RNC C;  4YSZ B;  3L0W B;  3AM9 A;  3R7R A;  4FA6 A;  1PDX A;  3ZKJ C;  1L6U A;  3BII D;  2KX0 A;  3WA0 A;  3N30 A;  2CHW A;  5I4D A;  1ZXH A;  2BKR B;  3AH7 A;  1TKE A;  1E7V A;  2YVC A;  1TZO A;  3RUL A;  5LNK 1;  1S1Q B;  2J53 A;  3ZIM A;  5T8I A;  4A90 A;  1P7E A;  2Y5P A;  4URK A;  4M8M A;  3UGB B;  1EU4 A;  3M95 A;  2BF8 B;  3VH3 B;  4F7Z A;  3CSF A;  3U4E G;  1KLG D;  1L0V B;  1OQY A;  4P1C C;  4G3X B;  3WCQ A;  2KFJ A;  3N32 A;  1E10 A;  2KLG A;  2PEA A;  2QCZ A;  3M62 B;  3O13 A;  4AOF A;  5HG2 A;  4YXD B;  2NCN A;  2W3S A;  3ZXV A;  3QAR A;  3PHW B;  2HE7 A;  2GBN A;  2SAK A;  3ZGZ A;  1VLB A;  1YJI A;  4WJN A;  2ZPY A;  3J9C A;  2RPV A;  3A9K B;  1VCB A;  1VZ7 A;  2RSU A;  1DGJ A;  1N61 A;  2JF5 A;  3AUL A;  4BKS A;  4ACF A;  2NPT B;  3MJ5 A;  2MHJ A;  2V3P A;  3U2S C;  2JUO A;  3BYT B;  2H89 B;  1UGJ A;  1SEB D;  2WXO A;  4B95 A;  1T6B X;  3ZJU A;  2O2V B;  5AZF A;  2L52 A;  1XF5 L;  4E3C A;  4M0W A;  3P4R B;  2XEW A;  3VH4 B;  2DLB A;  3NG0 A;  4FHK A;  4KGR A;  4KZC A;  4ZHO A;  4GDK B;  5H92 C;  1FEH A;  1P1A A;  2JZZ A;  2OHF A;  4MT5 A;  2BWF A;  1ET9 A;  2JX5 A;  2A4Z A;  1WSP A;  2E3T A;  3AE7 B;  4RGT A;  1NYQ A;  1IP9 A;  1WGR A;  3RMK C;  2WWZ A;  3DBL I;  2V3S A;  3TIX A;  5G5H A;  2ZW1 A;  2ZJD A;  3A9K A;  5TR5 A;  4HK2 A;  2O2V A;  1L4Z B;  1WJ6 A;  1FCL A;  2AQ3 B;  3DVN V;  4FUL A;  3OJ4 B;  3PPA A;  4ANV A;  2L8J A;  3KUC B;  1C4C A;  2C7N B;  3AE8 B;  1CZP A;  4TMA B;  4K81 A;  1ROE A;  4GDK A;  1BT0 A;  1WR6 E;  2Y5B B;  1WRI A;  1YQB A;  1L5P A;  3IVF A;  1IYF A;  1FPY A;  4HDQ A;  2AQ2 B;  2K22 A;  1D6E C;  4I6N B;  3SD5 A;  2MBB B;  3B08 A;  2KD0 A;  3ZTD A;  2OJR A;  1PFD A;  2DYB A;  3LXF A;  2K8H A;  3BK1 A;  4US8 A;  4MDK E;  4RGO S;  2EEL A;  1ZUD 2;  3RNA C;  3WIM A;  1Y56 A;  4MGY E;  1RAX A;  2GBK A;  2D07 B;  4K3B A;  2BPS A;  5HI1 A;  3PHX B;  1R4N B;  1ZXI A;  4IUM B;  3IG3 A;  2NTT A;  1NI2 A;  1HTO A;  2BYT A;  2X8X X;  4IM2 A;  2KTR B;  5C3J B;  5C23 A;  2OED A;  5J2R A;  1ZGU B;  2DZJ A;  2PVO D;  3HVZ A;  3ZO5 B;  1X1M A;  1TY0 A;  4AS1 A;  1MFW A;  4GMV A;  3QHT A;  4XE0 A;  4HLE A;  2CKH B;  4MH0 E;  4ZRQ A;  2M56 B;  3ABV B;  4LJP B;  3UIO B;  4O1N A;  2PPH A;  2Z59 B;  3PVL A;  4K7S A;  3DBH B;  2QSD A;  5AUI A;  1WY8 A;  4I6P A;  4BKT A;  3TEW A;  1TJE A;  2FID A;  1I4Q A;  1E5W A;  4WWN A;  4XC2 A;  2KTR A;  3Q3F A;  2J52 A;  1WGG A;  1F2R C;  1TT5 B;  3UI3 A;  2BS2 B;  4MGI E;  1E7U A;  2K5P A;  3H6N A;  3KW5 B;  4RCO A;  1WYW B;  1SBB B;  3KVF B;  5HHD G;  4K3C A;  1GC7 A;  1GG3 A;  5FKA C;  3EUB 2;  1Q5W B;  1QF6 A;  3H7S A;  2ZCB A;  2J0K A;  2AL6 A;  3LYY A;  4XZ4 A;  2HJ8 A;  1P3Q U;  1WH3 A;  2MLB A;  4FLH A;  4CO7 A;  2Z8L A;  1ZPS A;  3AEG B;  3AE2 B;  3NS8 A;  2WX1 A;  1WM3 A;  2KWC A;  3UQB A;  2MW5 A;  4M00 A;  1FXA A;  4BBN C;  1TYG B;  5C1Z A;  3SU8 X;  1YMH E;  2Y5C A;  3U30 A;  4KSL C;  2MWS B;  2ZVN A;  4WIP A;  4FBJ B;  1KLV A;  1KRH A;  1YQ3 B;  3ZNG C;  2KK8 A;  2IND C;  2PTL A;  3NZS A;  1FXT B;  2PE9 A;  5E6P A;  3L13 A;  3PZ8 A;  3A1Q B;  4TKN A;  4KIK B;  4ZRJ A;  3RN9 C;  3RNF C;  4HRO A;  3BWU D;  4AJY B;  4K7W A;  1CK1 A;  1JWU D;  2KJR A;  3QIJ A;  4ASW C;  2LGI A;  4P16 A;  3OG5 A;  3QA8 A;  3P1M A;  4EOY A;  2N9K A;  2BW2 A;  1I42 A;  4KDL B;  1SIF A;  1G6J A;  1XT9 B;  4WJP A;  2GB1 A;  2WLB A;  2WGS A;  5LXH A;  2IO3 B;  1JWS D;  2D11 A;  2MJE A;  1WX7 A;  2IO0 B;  5BYS A;  4WQO B;  2WXL A;  2GBM A;  4N58 A;  2EKI A;  1Z5S B;  2KVZ A;  3BK2 A;  2TSS A;  1WR1 A;  5CHW A;  3ZNZ B;  4KSK C;  3VRA B;  4NAW A;  4WH4 A;  2IY1 B;  1FXI A;  4TV3 A;  1E8X A;  2HDE A;  2KDE B;  2N9X A;  2BS4 B;  3UQA A;  4FHJ A;  3KQ4 A;  3A1Q A;  3MC8 A;  4NZL B;  4RM8 A;  4KIK A;  3CMM B;  2DYO A;  4F8C B;  1OQQ A;  1VRA B;  3MHS D;  3R3M A;  1XD3 B;  2C9W B;  2N9E B;  2O6V A;  2D3B A;  4FJY A;  4ZYN A;  2WDR B;  4IC7 B;  3R2I A;  2LGY A;  4ZOH C;  1WE6 A;  3W2D A;  2DBY A;  1R4M B;  2L3Z A;  3VRB B;  2MA9 B;  4FAD A;  4IWP A;  1UD7 A;  1WI0 A;  1KF6 B;  2M0X A;  5JZE B;  1I7H A;  1MHX A;  2L0T A;  5KHO A;  2R2O A;  1TZ1 A;  2QIE B;  4MM3 B;  4G11 A;  4HKZ E;  1UH6 A;  1U4A A;  4II3 B;  3GZN B;  2JZ3 B;  5CTR C;  1Y8R C;  3ML9 A;  3ALB A;  3VUX A;  4P6V F;  3FIL A;  3S2A A;  2LAS A;  4RNA A;  1IUE A;  2H88 B;  2MRP A;  2EMS A;  3HM6 X;  3ZRC A;  5E6J A;  4EE2 A;  1KM7 A;  1XEE A;  3AU4 A;  2M0A A;  2VZK B;  1DOY A;  1VR9 A;  4DHZ E;  3HK0 A;  4B6W A;  5DPT A;  3PRM B;  3TBL D;  1H8C A;  2PMV A;  2XN9 C;  5GMV A;  2KDI A;  2K8B A;  2B76 B;  2K3U A;  2W3R A;  4JL9 A;  4A3O A;  4OZC A;  2WDQ B;  2WXM A;  3AE6 B;  5IAA C;  1ZKH A;  3VTU A;  3Q8F A;  3AV8 A;  2KMA A;  2LUM A;  3V6C B;  2WX0 A;  3X0W A;  5CX3 A;  2DAJ A;  2KJH B;  3ZJT A;  1N5W A;  5FR6 A;  2REX A;  4ANW A;  2KDF B;  4PS8 A;  3MP9 A;  4OHJ A;  4B0E A;  4PK1 A;  4C56 C;  4DDG D;  2IGD A;  2LVO A;  3DOW A;  2D3G A;  3ECI A;  1OGW A;  3AE4 B;  2IJ0 A;  1WXV A;  4KX6 B;  3ZNI D;  1EU3 A;  3Q8B A;  3JYU A;  1L4D B;  3IT6 B;  4NJ7 A;  4WJQ A;  1V5T A;  2RDH A;  3SFE B;  1PUT A;  1E8Z A;  2KC1 A;  3Q8E A;  1GB4 A;  2KMM A;  1WXA A;  3OLM D;  3CST A;  1QOG A;  3BYY B;  2CHZ A;  3HHM A;  2K9X A;  5LLI A;  2DZM A;  1AWD A;  3W1Y A;  2KMC A;  3ONS A;  2MCN B;  1RRB A;  3UIP B;  4IWQ A;  2WNM A;  3N1X C;  4MH8 A;  2LUE A;  1HE8 A;  3NZ3 A;  2FUG 1;  3IXS A;  3VHT C;  2QEJ C;  4JX1 C;  3L08 A;  5EE0 A;  3VVW B;  2CR5 A;  2JPH A;  4ANU A;  3U7D A;  3U7Z A;  3I57 A;  2ZNV C;  1UNS A;  2J7Q B;  5IN7 A;  4EEW A;  3Q2A C;  4ZHP A;  4Q2J A;  1TKG A;  3AU5 A;  1QIL A;  1YOV B;  5E6O A;  3T9L A;  2OOB B;  2V9H A;  2L76 A;  3ZYY X;  3SDL C;  1RFA A;  3I5J C;  4GIV A;  4IM3 A;  1UBI A;  1OEY A;  2I1K A;  1ISN A;  3K9P B;  4XDC A;  2J0J A;  4HCP B;  4RM9 A;  4BKS D;  3DPD A;  1WIA A;  3GP7 A;  2ZEQ A;  1K8R B;  3P63 A;  1TS2 A;  2RGF A;  4M0W B;  4WUR A;  1FFV A;  3HRD D;  5EE9 A;  3TEZ A;  1UEL A;  2N0S B;  4GLS C;  4K1R B;  1OEY J;  3DBH I;  1H4R A;  1TIF A;  5AZG A;  3WAN A;  1J7C A;  3OAW A;  1SSN A;  2NBV B;  2WHI A;  2M19 A;  3WAM A;  4FJZ A;  5G55 A;  1STE A;  2DAF A;  1TS4 A;  3PGE A;  1LM8 B;  2KXJ A;  3P4S B;  1WXQ A;  3O65 B;  5EDS A;  3W1S A;  3R2T A;  4GOC A;  4S0R A;  1MG4 A;  2KZR A;  2ONQ A;  3KWL A;  1FMA D;  1E6E B;  2LVQ A;  2D5G A;  1KJT A;  2N7E A;  1IPG A;  1TY2 A;  1SJH D;  1HZ6 A;  1C3T A;  4RFB A;  3H7P B;  1WYG A;  4AP4 C;  4HPP A;  2JRI B;  2C60 A;  1F1H A;  2IO1 B;  3ZNH B;  1BML C;  3QCA A;  4LLG M;  4DBG A;  3IHP C;  2LFI A;  3L17 A;  2VH1 A;  3TEY A;  4YTM B;  2IGG A;  1A5R A;  1I4X A;  1WRD B;  1VDV A;  1JWM D;  2LGS A;  3MC0 B;  3RYT A;  3ZRF A;  2M8S A;  3NVW A;  3Q69 A;  3E9S A;  2NTS A;  1E7P B;  1JWA D;  1CMX B;  1K50 A;  1LGR A;  4MSQ B;  3JSV B;  1OFF A;  1FNV A;  1FM0 D;  4DDI D;  2AYO B;  2E6X A;  1VZ8 A;  1PGX A;  2LRW A;  5BMG A;  2K1F A;  2AEH A;  2AL3 A;  2PE6 B;  2RD0 A;  3H7P A;  4LNO A;  2FCN A;  3RNE C;  3B2G A;  2UU7 A;  2WXK A;  4ARI A;  1WJN A;  1QOF A;  3QAQ A;  4NJ6 A;  2AX5 A;  1FNW A;  2PKO A;  3A4S C;  1BUI C;  3B0A A;  4JGH B;  4LK0 M;  1EWY C;  1SGH A;  2Z0E B;  2KKC A;  1V97 A;  3PT2 B;  4EZK A;  3KLS X;  1UWX A;  4TQ1 A;  3PV1 A;  2AQ1 B;  2L05 A;  3RUI B;  3ZTC A;  4TSS A;  4NPN A;  4ZRP A;  4F1S A;  2KWD A;  4DK5 A;  4XDD A;  1OQR A;  4IDI A;  1XQQ A;  5L83 A;  1V81 A;  2K39 A;  3CIR B;  3CF6 E;  3JSV A;  1OTR B;  1D5M C;  4NJC A;  3V61 A;  2QIL A;  2BQQ A;  2BKF A;  1L0Y B;  3DHH C;  1L2N A;  1T0Y A;  1KFY B;  1JW9 D;  5AZH A;  1R7S A;  2WXN A;  1R4M I;  4WAF A;  5D6J B;  1C78 A;  1NVI D;  1MG8 A;  4US9 A;  4I6L B;  1ZDV A;  4JQW C;  4LJO B;  2KLC A;  1N62 A;  2GBJ A;  3DBS A;  1SIJ A;  2KDM A;  2K6D B;  4PS7 A;  5MPO A;  3AB5 A;  1B1Z A;  1WGH A;  4GGQ A;  2JXT A;  3DVN U;  2NBW B;  3RI7 C;  3Q14 C;  4KKI A;  3A9J B;  2WP9 B;  2ZZP B;  4REZ A;  3EEC A;  1IGC A;  3VUW A;  2LJI A;  4M02 A;  4IM0 A;  1D3Z A;  3KYD D;  1WX8 A;  4OW0 A;  2PLP A;  3Q3N C;  4ICU A;  3B1L X;  4AUQ C;  5EE3 A;  4N59 A;  5D94 A;  3BVM A;  2KVR A;  2R61 A;  2OJW A;  3MC9 A;  1WF9 A;  3RT3 B;  4BVU C;  2QC8 A;  3L10 B;  2PVG C;  1WJU A;  1HQR D;  1C76 A;  4XGA B;  4HDO A;  2W9N A;  1D4B A;  1JRO A;  1HZ5 A;  2V4I B;  3KUZ A;  1KOT A;  4JE3 B;  3QX1 A;  4A9A A;  2BWE S;  2JRH A;  1GUA B;  2W55 A;  5KHQ A;  2PJH A;  3A9J A;  4JPS A;  2V3N A;  1M4V A;  2Y3A A;  4M01 A;  5BMI A;  5IP4 D;  4BKG A;  3H9D A;  3NRZ A;  3U52 E;  2G45 B;  4LDT B;  2HTH A;  2MEK A;  4HJG E;  1F0Z A;  2IZV B;  1DOX A;  2JZP A;  4NAW B;  3RZW C;  4HJK A;  3VFK A;  4LDT D;  3WAL A;  1HA5 A;  2GMI C;  3MTN B;  5D7G A;  4AJW A;  3AEF B;  3ZDT A;  2YLM A;  1KLU D;  3DWG C;  4CQN A;  2HD5 B;  2BS3 B;  2JXX A;  2A5U A;  3B9J A;  4NQL B;  1GAQ B;  1WXM A;  2GRI A;  3UF8 A;  3P2B A;  1PGB A;  2D3A A;  2O6V B;  4JWU C;  3HUI A;  3ZVV A;  2O6V D;  5J18 A;  1Z2M A;  2ON8 A;  3BY4 B;  4HPM B;  4XX5 A;  1CQV A;  4HKQ A;  5JHB A;  1V49 A;  4ITK A;  3JVZ X;  5L95 C;  1HTQ A;  2J0M A;  4EZJ A;  2LRU A;  3DWM A;  2DZI A;  2KO3 A;  4ZDV A;  3L54 A;  4GU2 A;  1YQ4 B;  1MPE A;  4RGM A;  2WQY B;  4OVU A;  4NY0 A;  4YL8 A;  3FIL B;  4KGS A;  1I4R A;  2MJ3 A;  3ZUN A;  1D5Z C;  1WZ3 A;  1C4P A;  3LB8 C;  1MVK A;  4W9I A;  2KQ7 A;  4PT5 A;  3A4R A;  2ACZ B;  4G50 A;  4HVB A;  1V1O A;  2XK5 B;  4TQ0 A;  2BTE A;  2DEN B;  2M1M A;  1C77 A;  2L7R A;  4A20 A;  4IOI E;  3VTW A;  1SE9 A;  4CYE A;  4A55 A;  1J7B A;  1LFD A;  4N9F 4;  4PYZ A;  4ARC A;  2FUH B;  2NR2 A;  1VJK A;  3SEB A;  4GB9 A;  2GOW A;  4W9F A;  1FO4 A;  5G5G A;  2KWU B;  2ZVO A;  1DYQ A;  2BYF A;  3VUY A;  3PRE A;  3LDZ E;  5AEK B;  4BOS C;  3T3N A;  3R8B A;  3BVZ A;  4WJO A;  1NDD A;  1ZDX A;  3DQV A;  3PLU A;  3KUD B;  3AI5 A;  4W9E A;  3I63 C;  2JSV X;  1ZP0 B;  1P0R A;  1KTK A;  1QT9 A;  4W9G A;  1WMH A;  3W5U B;  3QC8 B;  2LJ5 A;  3GE8 C;  1PGA A;  4MSM B;  4GXB A;  4HXD A;  1ESF A;  2XK5 A;  1YJJ A;  2EMT A;  1JRU A;  3N1Y C;  3Q3O C;  4C80 A;  2MP2 A;  1T0R C;  2G9H D;  4NNJ B;  5JH5 C;  4W9L A;  4AQ7 A;  1BXT A;  3HM3 A;  2INC C;  3WAP A;  1ACC A;  2L0F A;  2FCQ A;  2M4N A;  1WZ0 A;  2VZK D;  3N9Y C;  4DHZ B;  2V0G A;  2KN4 A;  3AE1 B;  1XLO A;  3RD2 A;  1UBQ A;  3MJW A;  3V62 A;  4B9K A;  4HEA 1;  2DYM A;  4TUU A;  2NS5 A;  3VAW A;  1N63 A;  1NI3 A;  2IY0 B;  3SFD B;  3PTF C;  4OVZ A;  3FAH A;  2CJO A;  3FC4 A;  2DX5 B;  4RF1 A;  4W9D A;  2GBR A;  2ZPN A;  3OJ3 A;  1YNT E;  3RNB C;  1DOI A;  4KV2 A;  3TMP B;  3TUO A;  1J0G A;  3URY A;  2FIF A;  3V05 A;  1TTN A;  3EHV A;  3PZ7 A;  2BT6 A;  3C0R B;  4LNK A;  1V80 A;  2QHO A;  1ENF A;  2IDY A;  4XWW A;  1WGY A;  4XYC A;  2KC2 A;  3HIZ A;  1YN5 A;  2NMQ A;  2FBW B;  2IBI B;  1NEK B;  1XLP A;  1QOA A;  1RWS A;  1E8W A;  2LHE A;  2IPK D;  4EUT A;  1GOZ A;  4ANX A;  3PS6 A;  2VH2 A;  2JT4 B;  2KDB A;  3NUH B;  2KNB A;  2XBB C;  3VR9 B;  2KOX A;  2WS3 B;  1SF0 A;  1EWC A;  4AWJ A;  4MJS A;  2PIA A;  1NEN B;  1XO3 A;  2INP E;  2RPQ A;  5IOI A;  1WFY A;  1P98 A;  1JCK B;  1R4N I;  2IYD B;  1N60 A;  2FNJ B;  3IAM 1;  2HTM E;  2MSE D;  3N20 C;  1FFU A;  2NBU A;  2UYZ B;  5BYQ A;  1YJ1 A;  5D3D A;  3AEE B;  2G3Q B;  4IKG A;  2V1Y A;  3X23 A;  1QZE A;  4GN1 A;  3DHG C;  4OZA A;  3OWE B;  2NVU I;  1WX9 A;  3PZD A;  3H8H A;  5H8Y E;  3W9C B;  3C8Y A;  2N9L A;  2SEB D;  3WAO A;  2KFK B;  3RZF A;  1YN3 A;  2ZNV B;  3AE3 B;  3NJT A;  2LGX A;  4GSW A;  2DWQ A;  3PSE B;  1LXD A;  2JY6 A;  3ZDM C;  2KHW B;  4JLC A;  4OZB A;  1T3Q A;  3VQI A;  1GC6 A;  1V6E A;  4YWG G;  3IBE A;  4DQO C;  3QJZ A;  4BFR A;  5GXG B;  2LGD A;  1F52 A;  1SXT A;  1WGK A;  3DBR B;  1T5X D;  1SE2 A;  4B0M A;  1XCQ L;  5D3I B;  2FCS A;  2KYW A;  1WE7 A;  3SHQ A;  4YTN B;  2WXF A;  2C5L C;  3HVD A;  4JWS C;  5FR3 A;  2LZ6 A;  2MX2 A;  1Q10 A;  1N5X A;  3K9O B;  3A33 B;  1T0S C;  2KFK A;  1TS5 A;  2LI5 A;  2BB6 A;  4IG7 B;  4LCD E;  4FJV B;  3I9V 1;  2PW9 A;  4DXF A;  1VZ6 A;  2K8C A;  1F2R I;  4P7I A;  3FKY A;  1D5X C;  1AN8 A;  2ZW0 A;  3MFG A;  4C7Y A;  2HJ1 A;  4WWP A;  2EKE C;  1SB3 C;  3EFU A;  3AXC A;  2WXP A;  4A3P A;  1TGZ B;  3BIN A;  3L16 A;  2IO2 B;  2Q5W D;  3VTV A;  5FK9 C;  2CU1 A;  2KQS A;  3NVV A;  3QK0 A;  1K53 A;  3KWV A;  3APF A;  2W82 A;  4EZL A;  3B2F A;  4EKU A;  3AED B;  4A6Q A;  1QKZ A;  2LEK A;  4X57 B;  3PRZ A;  1VD2 A;  3IAS 1;  2N7D A;  4DXG A;  1JWB D;  1UGM A;  1FRR A;  3IFW B;  1C79 A;  2X38 A;  2MBH A;  3Q3J A;  4HCN B;  1JRP A;  4JIO U;  4EFO A;  2KWV B;  1HEZ E;  2NPT A;  3ZLZ A;  3JW0 X;  2LVP A;  1TBE A;  1QLB B;  4MGZ E;  3V3X A;  2K6Q A;  3MHZ A;  2MBO A;  2UWQ A;  1MHH E;  1S3S G;  2DZK A;  4LNN A;  2JWU A;  2MJD A;  3Q8A A;  4ICV A;  2WXJ A;  3T8M A;  1FRD A;  4MGK E;  3EGR A;  2KJ6 A;  1TKY A;  2M17 A;  3GS2 A;  4MAC A;  2VRR B;  2WDV B;  2QMT A;  1RLF A;  4II2 B;  3D32 A;  1Q1O A;  2WDT B;  5G2N A;  3E56 A;  5IA7 A;  1QOB A;  1SE4 A;  1SE3 A;  1AYF A;  3APC A;  4W9K A;  4R3D A;  2WYQ A;  2WXH A;  2BGF A;  4A8X C;  1I4P A;  1GJZ A;  5DPR A;  3DVG X;  4K7U A;  3AEC B;  2L83 A;  3IT4 B;  2KN5 A;  4WWM A;  3QQ8 B;  3PO0 A;  5HKH A;  3RCZ A;  4N6E B;  1YN4 A;  1GPX A;  2BVC A;  5CHV C;  4ZRK A;  1FD6 A;  4XWT A;  4HWI B;  5E6N A;  1PQS A;  5J17 A;  4YSX B;  4RMA A;  2RDG A;  4YT0 B;  2N4F A;  1YD8 U;  5DPS A;  4MEM A;  1V86 A;  3GZN I;  4BOZ B;  2CJN A;  2KQ4 X;  5HFY A;  4RF0 A;  3GB1 A;  1JQ4 A;  3DCG A;  5D2M B;  2LXC A;  1IGD A;  3UIN B;  4HRS A;  3AN1 A;  1HXY D;  4IW0 A;  1XLN A;  2RR9 A;  2FE8 A;  3ZQ4 A;  1V5O A;  2JQR B;  4L2Y A;  4J6I A;  4NAM A;  4J3O D;  3M63 B;  4E74 A;  2KAC A;  4W9J A;  3T3O A;  5IKC M;  2ICI A;  4MEL A;  1UWM A;  1JML A;  1T0Q C;  2N9P C;  3I3T B;  1L7Y A;  3W5V B;  4BZA A;  3DHI C;  1I4H A;  5AUK A;  4IWO A;  1CJE A;  4KDI C;  3NS1 A;  5BO4 B;  1J7A A;  3AE5 B;  1V2Y A;  2IGH A;  1WJ4 A;  3ENE A;  2MH7 A;  3RNG C;  1AW7 A;  3P42 A;  2DHZ A;  4RGN A;  3R66 C;  2MBE A;  3P4Q B;  1P7F A;  3CWI A;  1NYR A;  3TEX A;  1KH0 A;  3SR6 A;  4WQM A;  1YIW A;  3TJP A;  3V60 A;  4WAA A;  3AE9 B;  1E0Z A;  1EF5 A;  4USA A;  1V8C A;  4RH6 A;  2JVC A;  4C7Z A;  4W9C A;  1Q0W B;  2MQJ A;  1XLQ A;  2KAN A;  3AEB B;  1FNU A;  2V4L A;  3AMZ A;  1E8Y A;  3ML8 A;  4L23 A;  3DDC B;  4OVV A;  2WU2 B;  1WWT A;  4KGT A;  1EM7 A;  3TL5 A;  1A70 A;  3DBL B;  3RPF C;  2CU3 A;  1ZW7 A;  1E9M A;  3PLV A;  1XCT L;  2J42 A;  1C9F A;  4BBN F;  1LQB A;  2RDB C; 
#chains in the Genus database with same CATH homology
 2DX5 B;  2K25 A;  4W9D A;  3ZW3 A;  4IM2 A;  2KTR B;  2GBR A;  2LVQ A;  1KJT A;  2N7E A;  1IPG A;  5C23 A;  2ZPN A;  1ZGU B;  2DZJ A;  3OJ3 A;  4WWO A;  2G4S A;  5J2R A;  2ZCC A;  2ASQ A;  3GOE A;  3M3J A;  2KX3 A;  4KV2 A;  3TMP B;  1C3T A;  3ZO5 B;  1V9J A;  3R7Q A;  1X1M A;  1J0G A;  3H7P B;  2FIF A;  3KH0 A;  1TTN A;  3EHV A;  4GMV A;  4AP4 C;  1WMH B;  2JRI B;  3QHT A;  2C60 A;  3C0R B;  4HLE A;  1V80 A;  2CKH B;  2QHO A;  2IO1 B;  1WGY A;  4MH0 E;  3ZNH B;  3QCA A;  4DBG A;  1M94 A;  2CS4 A;  3IHP C;  4DWF A;  3L17 A;  1J19 A;  2KC2 A;  3HIZ A;  4LJP B;  1WXS A;  3UIO B;  3NY5 A;  2PPH A;  2Z59 B;  3PVL A;  4K7S A;  1A5R A;  1E90 A;  2IBI B;  2LD9 A;  1WRD B;  2MP2 B;  1E8W A;  2MBQ A;  4EUT A;  2I1J A;  4ANX A;  3PS6 A;  3RYT A;  1WGD A;  2JT4 B;  3ZRF A;  2KDB A;  2M8S A;  2KNB A;  3NHE B;  4G0N B;  2XBB C;  2KOX A;  1WY8 A;  2N1W A;  3PRP B;  4I6P A;  4BKT A;  4AWJ A;  4MJS A;  5LXI B;  2FID A;  1E5W A;  1CMX B;  4WWN A;  2RPQ A;  1WFY A;  4MSQ B;  1P98 A;  2KTR A;  4XC2 A;  3Q3F A;  4GDL B;  1R4N I;  3JSV B;  2IYD B;  1WGG A;  2FNJ B;  2Z0D B;  3DBR I;  4DDI D;  3N3K B;  2AYO B;  2MSE D;  2LRW A;  4MGI E;  1E7U A;  1EUV B;  3H6N A;  3KW5 B;  2K1F A;  1C1Y B;  2AEH A;  1WYW B;  2NBU A;  3KVF B;  2UYZ B;  2AL3 A;  1GC7 A;  1GG3 A;  3NZU A;  2PE6 B;  2RD0 A;  1YJ1 A;  3H7P A;  2G3Q B;  2FCN A;  1Q5W B;  1F9J A;  2V1Y A;  3X23 A;  3H7S A;  5DPW A;  1QZE A;  4GN1 A;  2ZCB A;  2J0K A;  4M8N A;  1WJN A;  2NVU I;  1WX9 A;  3QAQ A;  2AL6 A;  3PZD A;  4NJ6 A;  3A4S C;  4XZ4 A;  2HJ8 A;  3B0A A;  1P3Q U;  1WH3 A;  4JGH B;  4E71 A;  2C7H A;  2AWT A;  1SGH A;  2Z0E B;  2MLB A;  2KFK B;  2KKC A;  3PT2 B;  4FLH A;  3KYC D;  3RZF A;  3WAO A;  4CO7 A;  4EZK A;  2ZNV B;  4KVG B;  4TQ1 A;  3U8Z A;  3NS8 A;  2WX1 A;  1WM3 A;  4W9H A;  2LGX A;  3PV1 A;  4DXA B;  2KWC A;  3UQB A;  4GSW A;  2MW5 A;  2L05 A;  3PSE B;  1LXD A;  3RUI B;  2JY6 A;  3ZDM C;  2KHW B;  4BBN C;  4JLC A;  5C1Z A;  3SU8 X;  4HPL B;  3U30 A;  3ZTC A;  2BYV E;  2JWZ A;  4KSL C;  2MWS B;  3VQI A;  2ZVN A;  4NPN A;  4F1S A;  5JHA A;  1GC6 A;  4FBJ B;  1KLV A;  4DK5 A;  2L00 B;  1V6E A;  4FN2 A;  1GNU A;  2CHX A;  1XQQ A;  5L83 A;  1V81 A;  2K39 A;  5DCN A;  3ZNG C;  3CF6 E;  4GDL A;  4ZRI A;  3JSV A;  2KK8 A;  3IBE A;  3TCA A;  1OTR B;  2D2Q A;  3NZS A;  3QJZ A;  1FXT B;  4BFR A;  2PE9 A;  5E6P A;  3V61 A;  3VDZ A;  3L13 A;  2LGD A;  3EC8 A;  3A1Q B;  4MJS B;  4TKN A;  4KIK B;  2BKF A;  4ZRJ A;  3DVG Y;  4AJY B;  1L2N A;  1T0Y A;  3H1U A;  4K7W A;  2C7M B;  2FCS A;  5AZH A;  2N1V A;  2KJR A;  1WE7 A;  3QIJ A;  3SHQ A;  4ASW C;  3LJ3 A;  4KZ0 A;  2C5L C;  3V6E B;  3QA8 A;  2R2Q A;  4EOY A;  4DHJ B;  1R4M I;  2LZ6 A;  1I42 A;  4KDL B;  5D6J B;  2MX2 A;  1SIF A;  3K9O B;  1YX5 B;  3A33 B;  1MG8 A;  1UZX B;  5CHF A;  1G6J A;  2KFK A;  2BYE A;  1XT9 B;  4PS3 A;  4WJP A;  4DHJ D;  4I6L B;  4MM3 A;  1EO6 A;  4JQW C;  2LI5 A;  4LJO B;  2KLC A;  4IG7 B;  5LXH A;  4LCD E;  4FJV B;  2IO3 B;  2GBJ A;  2D11 A;  1WX7 A;  3DBS A;  2IO0 B;  2K8C A;  2K6D B;  4PS7 A;  4WQO B;  4P7I A;  1P9D U;  1WGH A;  4GGQ A;  1I35 A;  2GBM A;  1Z5S B;  2D10 A;  3QWZ B;  4WWP A;  3NOB A;  3DVN U;  2NBW B;  2EKE C;  1WR1 A;  3A9J B;  1NBF C;  2ZZP B;  3EFU A;  3AXC A;  3APD A;  4KSK C;  5CHW A;  3ZNZ B;  4A3P A;  3EEC A;  1TGZ B;  4NAW A;  2IY1 B;  3BIN A;  2IO2 B;  3L16 A;  3VUW A;  4TV3 A;  1AAR A;  1E8X A;  2KDE B;  2N9X A;  3VTV A;  3UQA A;  4FHJ A;  4IM0 A;  1D3Z A;  3KYD D;  1WX8 A;  2CU1 A;  2KQS A;  4NQK E;  3A1Q A;  4RM8 A;  4KIK A;  2G4D B;  2DYO A;  3CMM B;  3QK0 A;  3APF A;  4ICU A;  3B1L X;  4AUQ C;  4F8C B;  3W1S C;  4EZL A;  3MHS D;  3R3M A;  1XD3 B;  4EKU A;  2C9W B;  2N9E B;  5D94 A;  2FCM A;  2LXA A;  2O6V A;  2KVR A;  2FAZ A;  1WF9 A;  2KTF A;  3PRZ A;  4FJY A;  4X57 B;  4ZYN A;  3RT3 B;  4BVU C;  3L10 B;  4PYU A;  4CHK A;  1VD2 A;  1WJU A;  1J8C A;  1WM2 A;  4IC7 B;  2B3A A;  2LGY A;  2N7D A;  1WE6 A;  4HDO A;  2W9N A;  1EF1 A;  2LWP A;  2L3Z A;  1UGM A;  3IFW B;  2MA9 B;  4FAD A;  2MBH A;  3KUZ A;  3Q3J A;  1UD7 A;  4HCN B;  4IWP A;  3VXW A;  1KOT A;  1YX6 B;  1WI0 A;  2M0X A;  4JIO U;  5JZE B;  3L0W B;  3QX1 A;  4EFO A;  2KWV B;  2L0T A;  2NPT A;  5KHO A;  3R7R A;  4FA6 A;  2R2O A;  2BWE S;  2JRH A;  3ZLZ A;  1GUA B;  3ZKJ C;  5KHQ A;  3JW0 X;  1TZ1 A;  2PJH A;  2LVP A;  2KX0 A;  3A9J A;  3WA0 A;  4G11 A;  1TBE A;  3N30 A;  2CHW A;  1UH6 A;  1U4A A;  4MGZ E;  4II3 B;  2JZ3 B;  5CTR C;  1Y8R C;  3ML9 A;  3ALB A;  2BKR B;  4BKG A;  2K6Q A;  1E7V A;  3VUX A;  3H9D A;  2YVC A;  3S2A A;  2LAS A;  2MBO A;  3RUL A;  2UWQ A;  1S1Q B;  3ZIM A;  1S3S G;  2DZK A;  2G45 B;  4LDT B;  4URK A;  2HTH A;  4M8M A;  4ICV A;  3UGB B;  2MRP A;  3M95 A;  2IZV B;  2BF8 B;  4NAW B;  2EMS A;  3RZW C;  3T8M A;  3HM6 X;  3VH3 B;  4F7Z A;  4HJK A;  4MGK E;  3ZRC A;  3VFK A;  4LDT D;  2KJ6 A;  2M17 A;  3CSF A;  3WAL A;  2GMI C;  3MTN B;  2VRR B;  5D7G A;  4AJW A;  1KM7 A;  1RLF A;  4II2 B;  3D32 A;  1Q1O A;  2WDT B;  5G2N A;  2YLM A;  3ZDT A;  5IA7 A;  3AU4 A;  1OQY A;  4DHZ E;  3HK0 A;  4G3X B;  4B6W A;  5DPT A;  2HD5 B;  3APC A;  3PRM B;  2JXX A;  4W9K A;  3TBL D;  2KFJ A;  1H8C A;  5GMV A;  2A5U A;  2WYQ A;  3N32 A;  4NQL B;  2KDI A;  2K8B A;  1WXM A;  4JL9 A;  3UF8 A;  4A3O A;  3P2B A;  2BGF A;  2O6V B;  2KLG A;  2PEA A;  3M62 B;  5DPR A;  1GJZ A;  3DVG X;  5IAA C;  4AOF A;  4K7U A;  2NCN A;  2KN5 A;  1ZKH A;  3ZVV A;  3QQ8 B;  2O6V D;  3QAR A;  3PHW B;  3VTU A;  5J18 A;  5HKH A;  2HE7 A;  3RCZ A;  2GBN A;  1Z2M A;  2KMA A;  3V6C B;  5CHV C;  3BY4 B;  4HPM B;  2WX0 A;  4XX5 A;  3X0W A;  4ZRK A;  5CX3 A;  4WJN A;  2DAJ A;  2KJH B;  5JHB A;  1V49 A;  4HWI B;  2ZPY A;  3JVZ X;  5E6N A;  5L95 C;  1PQS A;  5J17 A;  3A9K B;  2REX A;  1VCB A;  5FR6 A;  4ANW A;  2J0M A;  4RMA A;  2KDF B;  2RSU A;  2LRU A;  4PS8 A;  4EZJ A;  2DZI A;  2JF5 A;  3AUL A;  4BKS A;  2KO3 A;  2NPT B;  4ZDV A;  2N4F A;  1YD8 U;  5DPS A;  4MEM A;  1V86 A;  2JUO A;  3GZN I;  4BOZ B;  4DDG D;  2LVO A;  3L54 A;  3DOW A;  2D3G A;  4B95 A;  3ECI A;  4GU2 A;  1OGW A;  2O2V B;  1WXV A;  3ZNI D;  5AZF A;  3DCG A;  3JYU A;  5D2M B;  4OVU A;  4E3C A;  2LXC A;  4NY0 A;  4YL8 A;  2XEW A;  3UIN B;  3VH4 B;  4NJ7 A;  4WJQ A;  3ZUN A;  1V5T A;  1WZ3 A;  4W9I A;  2KQ7 A;  3A4R A;  1E8Z A;  4FHK A;  2KC1 A;  4G50 A;  2RR9 A;  4IW0 A;  4HVB A;  2XK5 B;  4KZC A;  1V5O A;  4GDK B;  4TQ0 A;  1WXA A;  3OLM D;  4J6I A;  3CST A;  2DEN B;  2M1M A;  3M63 B;  1P1A A;  2JZZ A;  4A20 A;  2L7R A;  2CHZ A;  3HHM A;  2BWF A;  3VTW A;  1SE9 A;  5LLI A;  2DZM A;  4CYE A;  4E74 A;  4W9J A;  1LFD A;  2KMC A;  3ONS A;  4N9F 4;  1RRB A;  2MCN B;  4PYZ A;  3UIP B;  3W1Y A;  2A4Z A;  4IWQ A;  4MEL A;  2FUH B;  2NR2 A;  2LUE A;  1HE8 A;  2GOW A;  4GB9 A;  4W9F A;  1IP9 A;  1WGR A;  2N9P C;  3I3T B;  3VHT C;  2KWU B;  2ZVO A;  2WWZ A;  3DBL I;  1L7Y A;  2V3S A;  3TIX A;  2BYF A;  3L08 A;  3VUY A;  3VVW B;  4IWO A;  4KDI C;  2CR5 A;  2JPH A;  4ANU A;  3U7D A;  2ZJD A;  3PRE A;  3LDZ E;  5BO4 B;  3A9K A;  2ZNV C;  1V2Y A;  5AEK B;  2J7Q B;  5TR5 A;  4BOS C;  4EEW A;  1WJ4 A;  3ENE A;  4WJO A;  4HK2 A;  2DHZ A;  1NDD A;  3AU5 A;  3R66 C;  2MBE A;  3DQV A;  5E6O A;  3T9L A;  2O2V A;  3KUD B;  2OOB B;  3AI5 A;  3PLU A;  1WJ6 A;  4W9E A;  2L76 A;  1P0R A;  3DVN V;  4W9G A;  3SDL C;  1RFA A;  4FUL A;  1WMH A;  3QC8 B;  2LJ5 A;  4GIV A;  4IM3 A;  1UBI A;  1OEY A;  3OJ4 B;  2I1K A;  1ISN A;  3PPA A;  1YIW A;  3K9P B;  2L8J A;  4MSM B;  3KUC B;  4GXB A;  2C7N B;  4HXD A;  4ANV A;  2J0J A;  4HCP B;  3TJP A;  4RM9 A;  4BKS D;  3DPD A;  2XK5 A;  1WIA A;  4K81 A;  2EMT A;  4GDK A;  1BT0 A;  1JRU A;  1WR6 E;  2ZEQ A;  1K8R B;  3V60 A;  4WAA A;  2RGF A;  2MP2 A;  1EF5 A;  2Y5B B;  4M0W B;  1YQB A;  4NNJ B;  5JH5 C;  3IVF A;  1UEL A;  1IYF A;  4W9L A;  1OEY J;  3DBH I;  4HDQ A;  1H4R A;  4K1R B;  2JVC A;  5AZG A;  3HM3 A;  3WAN A;  4I6N B;  3SD5 A;  3WAP A;  2MBB B;  2L0F A;  4W9C A;  1Q0W B;  3OAW A;  2MQJ A;  3B08 A;  2KD0 A;  2FCQ A;  2NBV B;  2M4N A;  2OJR A;  3ZTD A;  2KAN A;  1WZ0 A;  2DYB A;  4FJZ A;  5G55 A;  2K8H A;  3WAM A;  2V4L A;  4DHZ B;  2DAF A;  1E8Y A;  3PGE A;  3ML8 A;  3DDC B;  4MDK E;  4OVV A;  3WIM A;  3RD2 A;  1UBQ A;  3MJW A;  3V62 A;  4B9K A;  2DYM A;  3TL5 A;  4MGY E;  1LM8 B;  1RAX A;  4TUU A;  2GBK A;  2NS5 A;  2KXJ A;  3VAW A;  3O65 B;  2D07 B;  5EDS A;  2BPS A;  1ZW7 A;  3W1S A;  2IY0 B;  4GOC A;  3PTF C;  3PHX B;  3PLV A;  4BBN F;  4IUM B;  2KZR A;  3IG3 A;  1LQB A;  1NI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...