1P9DU

High-resolution structure of the complex of hhr23a ubiquitin-like domain and the c-terminal ubiquitin-interacting motif of proteasome subunit s5a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26S proteasome non-ATPase regulatory subunit 4
publication title Structural determinants for the binding of ubiquitin-like domains to the proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 12
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p9dU00
2KOXA 3A1QB 1EO6A 2WDTB 4DHJB 3CF6E 1V6EA 2KHWB 5DPTA 2J0JA 3VH4B 4KZ0A 4NQLB 1M94A 3ZO5B 3T9LA 4EUTA 5L83A 4I6PA 5E6NA 1YD8U 2O2VA 4LDTD 2NPTB 1WX7A 3NOBA 4RM8A 2CHZA 3A33B 1K8RB 2KDBA 3ZTDA 1D3ZA 4E74A 4FJYA 1S1QB 5DCNA 5EDSA 3ECIA 1P0RA 3ZLZA 4ICUA 4JL9A 4GSWA 1WX8A 4TV3A 2KX3A 3JW0X 3HK0A 2RSUA 2N9PC 2O6VB 1RAXA 4IWPA 4LJOB 3ZNGC 2K39A 3PPAA 4WJPA 4XZ4A 4FBJB 3C0RB 2XEWA 2ZVNA 3IFWB 2XK5B 4JIOU 1WXMA 2PJHA 1TZ1A 2BGFA 3RZWC 2CHXA 5TR5A 1C3TA 2BKRB 4DWFA 1V81A 4HDQA 2PPHA 3A9KB 2CKHB 1TGZB 1V49A 4DHZE 4MGZE 2K8BA 3U30A 5AEKB 2FUHB 2LXCA 3M3JA 5KHOA 3VXWA 1WIAA 3L16A 1WRDB 4GDLB 3DVNU 3X0WA 4TUUA 3PHWB 3SDLC 4RMAA 3TBLD 3QIJA 3T8MA 1NI2A 3N30A 4IM3A 4F8CB 4KIKB 2IO1B 4WJQA 3VUYA 4ANUA 1I42A 1V2YA 2WX1A 3KUDB 4OVUA 2NCNA 1PQSA 3PRPB 2AWTA 4DK5A 1WMHA 5J18A 2ZNVC 4K7SA 2KVRA 3RT3B 3ALBA 4DDID 2J0KA 2M17A 4GDKA 4MH0E 3H7SA 1I35A 1WGRA 4DHJD 2BYEA 3ZRCA 4EFOA 1Z2MA 3W1YA 3JSVB 3QCAA 3DBLI 1CMXB 3PTFC 1SIFA 2MQJA 5CHVC 4NJ6A 4W9KA 2KQ7A 2ZPYA 3U8ZA 4BFRA 1WGGA 3L13A 4ANXA 4CO7A 2KLCA 2KZRA 1P3QU 2D2QA 2MBQA 3VUWA 4BVUC 4XX5A 4I6NB 2KWUB 2D3GA 2MRPA 1E7VA 2BF8B 2O2VB 2KNBA 4BKGA 2KWCA 1AARA 2KANA 4WJOA 3L0WB 3ZW3A 3RULA 2N9EB 3RYTA 2O6VD 3EECA 5AZGA 1WF9A 2DAJA 2LD9A 2KDIA 3VUXA 1VCBA 2JF5A 3L08A 4KVGB 2YVCA 4BKSA 3SU8X 2B3AA 1XD3B 3IG3A 4W9DA 4HWIB 5D94A 4EZKA 4GOCA 4W9FA 3V6EB 2MX2A 1WI0A 3KVFB 1F9JA 1L7YA 5DPSA 4MM3A 2C5LC 2L0TA 2L0FA 1V9JA 2V3SA 3PGEA 3V6CB 4A3PA 2LRUA 2QHOA 2RR9A 1WXSA 3UQAA 2IO0B 5CHFA 2OJRA 3A4RA 1WXAA 5GMVA 1J8CA 1EUVB 4FHJA 3UIOB 2VRRB 1WZ3A 2K25A 3AXCA 3OJ3A 3H7PB 3X23A 2C7HA 2FIFA 3PVLA 2NBWB 2DAFA 2IO2B 3MJWA 3N32A 2N7EA 3TJPA 1WGYA 4MELA 3DBSA 2WYQA 2AEHA 2DYBA 3VDZA 1WGHA 1WE6A 2NBVB 4GXBA 4EKUA 3B0AA 1NDDA 4EEWA 3WAPA 2JVCA 2JPHA 2L7RA 3BY4B 1OEYA 1VD2A 2GMIC 3EFUA 2NR2A 1LM8B 4GDKB 1WM3A 2N7DA 4P7IA 4W9JA 2IY1B 2KK8A 4W9EA 2CS4A 2A5UA 2DYMA 5HKHA 3LJ3A 1WY8A 2J7QB 3R66C 1EF5A 3SD5A 2L05A 4URKA 4B9KA 2WWZA 1ISNA 1UBIA 3IVFA 3VQIA 3M62B 4II3B 2FCSA 4NNJB 3WANA 4JLCA 5CX3A 2EMSA 2MBOA 3PT2B 1C1YB 2ZEQA 4BOZB 4MGYE 3K9PB 2MA9B 3RCZA 2C7MB 4IWOA 2KD0A 3M63B 4KSKC 4MGKE 1NBFC 4KDLB 3PZDA 1U4AA 1KM7A 5JZEB 3KH0A 4IC7B 5CTRC 2GBNA 2JZZA 3VTWA 4E71A 4AUQC 2RD0A 4NPNA 3R7QA 2W9NA 4EOYA 3VVWB 1R4MI 5D2MB 5JHAA 2AL3A 3PHXB 3OAWA 2HTHA 2KO3A 4FULA 2KJHB 1GC7A 1OTRB 1WFYA 1EF1A 1ZW7A 4FADA 4AJWA 3DDCB 4HVBA 1E8WA 3L17A 4HJKA 3WAMA 3DPDA 2EMTA 4G0NB 4GB9A 1WX9A 1GUAB 1IPGA 2RGFA 1YIWA 1TBEA 3PV1A 3KYDD 1T0YA 2ZVOA 3W1SA 3H9DA 2KWVB 3Q3FA 4TKNA 2PE9A 1IP9A 1IYFA 2N9XA 3PREA 1RLFA 2C9WB 3QARA 5LXIB 2Y5BB 1TTNA 3RUIB 3WALA 3AU5A 5J2RA 2D11A 4WJNA 3P2BA 4MDKE 4ZRKA 4BBNC 3MHSD 3KUCB 4I6LB 3UGBB 2KXJA 1WJUA 2BWES 2D07B 4EZJA 3DBRI 4FHKA 3IHPC 2FCQA 2M0XA 4K1RB 2IYDB 3SHQA 2UWQA 5D6JB 5JHBA 3WIMA 1XQQA 4ANWA 2XBBC 4MSMB 1GJZA 1H8CA 3WA0A 2D10A 2KFJA 3A1QA 5JH5C 1E8XA 4PS7A 3RZFA 5L95C 4WAAA 2KDFB 3HM6X 2K6QA 2C7NB 3CSTA 3KW5B 1Q1OA 1KJTA 2N1WA 3ZRFA 4FA6A 2BYVE 2MSED 4FN2A 4DDGD 1LXDA 1UBQA 3QAQA 4II2B 4PS3A 4ANVA 2K1FA 4W9HA 2A4ZA 4HXDA 3L54A 2V4LA 2ASQA 1WJ4A 1WGDA 4IM2A 4BKSD 4LCDE 4BOSC 2GBKA 2JXXA 4G50A 2KX0A 2KKCA 3ML8A 4IWQA 4HCNB 3DQVA 4FJVB 3PLVA 4IUMB 2BPSA 4BBNF 2M8SA 5LLIA 3APDA 3VTUA 3H6NA 2J0MA 2JWZA 4J6IA 2LGXA 2K8CA 4FLHA 2DZKA 2KTRA 2LVPA 4ASWC 4MJSA 2REXA 2KLGA 2KFKA 3QC8B 3HHMA 4OVVA 1LFDA 3TMPB 3A9KA 3OLMD 3QJZA 4W9IA 4HLEA 4PS8A 4GMVA 1WM2A 1QZEA 1YJ1A 2DX5B 2HJ8A 4NQKE 4HCPB 2IBIB 3ML9A 1RRBA 4GDLA 2JY6A 3TCAA 3KUZA 2K8HA 4G3XB 1WXVA 3QHTA 1WMHB 2NVUI 3LDZE 2K6DB 1J19A 5LXHA 1E5WA 3L10B 2RPQA 3DOWA 5G2NA 5DPWA 1E8YA 2LGYA 3V60A 3NS8A 1WR6E 2FNJB 2LUEA 5FR6A 5E6OA 1FXTB 1E8ZA 2MP2A 1GC6A 4TQ1A 4M0WB 4FJZA 2MCNB 3GOEA 3VFKA 1KOTA 2PE6B 1MG8A 2GOWA 3TL5A 2ZPNA 2N1VA 1ZKHA 4A3OA 3WAOA 5DPRA 2LRWA 5C23A 2MW5A 2MBBB 4ZRIA 1WJ6A 1UH6A 2M1MA 3PSEB 4HK2A 1Q5WB 1RFAA 2IY0B 1SGHA 3JVZX 3D32A 2LASA 4F7ZA 1J0GA 2KN5A 2CHWA 2LJ5A 4AP4C 4HPMB 2DYOA 1WH3A 3ZUNA 3AULA 2L8JA 5CHWA 4KSLC 3ZVVA 4K81A 4DHZB 3NZSA 4WWOA 5AZHA 4KDIC 2C60A 5J17A 3KYCD 3QX1A 4ZRJA 1XT9B 3Q3JA 3O65B 2GBJA 1WR1A 1P1AA 2JRHA 3B08A 2FCMA 2MBHA 1KLVA 3HM3A 3ZNID 4AWJA 2UYZB 2ZZPB 2KJRA 1L2NA 4E3CA 4PYUA 4JGHB 4LJPB 1WJNA 2FIDA 2DZMA 2KC1A 4NAWA 4PYZA 3UF8A 4M8MA 2BYFA 2KTRB 1Y8RC 2N4FA 4EZLA 1P9DU 1S3SG 3NZUA 4MJSB 3R7RA 2KQSA 3PLUA 4BKTA 2KFKB 3JYUA 2M4NA 2L00B 4CHKA 1UD7A 2IZVB 3I3TB 3N3KB 3H7PA 4AJYB 3H1UA 4RM9A 3ZTCA 4W9GA 2I1KA 5IAAC 5AZFA 2DENB 4F1SA 1OEYJ 4N9F4 4GU2A 4HPLB 3A9JA 4JQWC 3ZKJC 5E6PA 4DBGA 5KHQA 3V62A 1H4RA 3DVNV 2MWSB 2JUOA 3S2AA 1UELA 2NS5A 1V5OA 4YL8A 3VH3B 1P98A 1X1MA 5G55A 2YLMA 2KMCA 4IG7B 2OOBB 2GBMA 3EHVA 2MP2B 3VTVA 2Z59B 3OJ4B 1WYWB 2L76A 3DCGA 3ONSA 4K7UA 5BO4B 1WE7A 2JT4B 4NY0A 3RD2A 1Q0WB 4ZDVA 3BINA 2MBEA 4HDOA 2LVOA 3QQ8B 3QK0A 3QWZB 2FAZA 2NPTA 2ZNVB 2KC2A 4A20A 4B95A 2CU1A 1HE8A 3IBEA 2DHZA 2DZIA 1BT0A 2Z0EB 4K7WA 4G11A 2JRIB 3APCA 1V5TA 2G4SA 2HD5B 2KMAA 2KTFA 2LZ6A 3NY5A 4LDTB 2LXAA 3K9OB 3M95A 4GN1A 4MSQB 4NJ7A 3U7DA 2LI5A 1WZ0A 2AL6A 2BKFA 3VAWA 3ZNZB 1V86A 2O6VA 3CMMB 1GG3A 5IA7A 2NBUA 2LGDA 1ZGUB 2V1YA 2KDEB 3HIZA 1OQYA 1YQBA 1OGWA 3GZNI 2XK5A 3ZDTA 3CSFA 4TQ0A 4CYEA 3DBHI 4GIVA 3PS6A 1LQBA 1A5RA 4MEMA 4MGIE 3ZDMC 1E7UA 4B6WA 1YX5B 3W1SC 4XC2A 3AU4A 4WQOB 3EC8A 3NHEB 3R3MA 3QA8A 2G45B 4KV2A 3PRZA 4NAWB 1YX6B 4IW0A 2HE7A 4W9CA 4ZYNA 3A4SC 3UINB 2GBRA 2AYOB 2BWFA 2PEAA 3VHTC 1Z5SB 3UIPB 3ZNHB 1UZXB 1E90A 2L3ZA 2R2OA 2G4DB 2G3QB 2Z0DB 2CR5A 3ZIMA 4KIKA 3TIXA 3UQBA 1G6JA 2IO3B 4KZCA 3V61A 2LVQA 2ZJDA 4GGQA 4WWPA 2ZCCA 2WX0A 2ZCBA 1R4NI 1V80A 2MLBA 3APFA 4W9LA 2FCNA 3PRMB 4M8NA 1JRUA 3A9JB 4IM0A 1SE9A 3ENEA 2LWPA 2JZ3B 4WWNA 2EKEC 5C1ZA 3DVGX 1UGMA 5D7GA 3DVGY 4X57B 4DXAB 2I1JA 4ICVA 2R2QA 3AI5A 3B1LX 1GNUA 3JSVA 2DZJA 3MTNB 2KJ6A 4AOFA
chains in the Genus database with same CATH superfamily
2E6XA 1EO6A 4DHJB 1FCCC 4RGOS 3RN9C 2E3TA 5DPTA 2J0JA 5HHDG 2TSSA 4NQLB 2LMCA 3ZTDA 3T3OA 1D5ZC 4ICUA 4JL9A 4C56C 2WXMA 3B2GA 1T6BX 3HK0A 2RSUA 1IBXB 2O6VB 1RAXA 2DNFA 3ZNGC 4FBJB 3C0RB 4DXGA 2BGFA 1CJEA 5BYRA 1V81A 1SB3C 3A9KB 4S17A 2CKHB 2WQYB 2K8BA 3U30A 2CJOA 3M3JA 2V4IB 3SDLC 1I4PA 4WIPA 1KH0A 4KGRA 2BS2B 4KIKB 3AMZA 4WJQA 3VUYA 1I42A 1V2YA 1ZOYB 2AWTA 1QF6A 3B2FA 1HA5A 4QAYA 1GOZA 4LNOA 4LNNA 4DHJD 1Z2MA 3W1YA 4M0WA 2WHIA 1CMXB 1SIFA 1L5PA 4W9KA 4BFRA 3L13A 3NS1A 1WXQA 3L4PA 2KZRA 1P3QU 1QOBA 1YQ3B 1E7PB 2MRPA 2BF8B 3L0WB 2N9EB 2O6VD 3EECA 2KQ4X 2KDIA 1VCBA 3L08A 4KVGB 2YVCA 2N9KA 4ZRQA 3URYA 1FFUA 4ZHPA 3KVFB 1WRIA 3V6CB 2WGSA 3EGRA 3P4QB 2IO0B 4RNAA 1L0XB 1EUVB 3UIOB 1BUIC 3OJ3A 3X23A 2J4XA 3MJWA 2WYQA 4XDCA 3VDZA 5FKAC 1WE6A 2WXIA 4EKUA 4EEWA 3WAPA 2D5GA 2JPHA 4NZLB 2X8XX 2L7RA 1EWCA 3BY4B 2BTEA 1L6UA 2NR2A 1WM3A 4K3BA 1L4DB 2IY1B 2KK8A 2A5UA 3SD5A 2GB1A 4URKA 1TY0A 1R4MB 3RI7C 1NYRA 3VQIA 3AE5B 5CX3A 2MBOA 2ZEQA 4BOZB 4MGYE 4OHJA 1L0VB 2C7MB 4JPSA 1N60A 3PZDA 1PUTA 3AE1B 4IC7B 3VTWA 4E71A 1ZDVA 3KQ4A 4NPNA 1R4MI 5D2MB 5JHAA 2AL3A 3AN1A 2HTHA 1KRHA 2KO3A 1HZ6A 1XLQA 1GC7A 3DDCB 2NTSA 4HJKA 2OJWA 1NEKB 1GUAB 1XEEA 1ZDXA 1T0YA 1JROA 3H9DA 3Q3FA 4TKNA 3NVYA 1ZPSA 2Y5BB 3RUIB 2D11A 1ZUD2 4MDKE 4ZRKA 3KUCB 4I6LB 1CK1A 4EZJA 4FHKA 3IHPC 2M0XA 4K1RB 1BMLC 5D6JB 4MSMB 4LK0M 2RDHA 3P1MA 4PS7A 3RZFA 4WAAA 1YQ4B 1PGAA 2MSED 1V97A 2Z8LA 4FN2A 4DDGD 1UBQA 4PS3A 3NG0A 2V4LA 1TS2A 1WJ4A 5MPOA 4IM2A 2PW9A 2JXXA 2KX0A 1ZP0B 2LHEA 3NVWA 2JYTA 5LLIA 1FRRA 4J6IA 3LB8C 1FEHA 2ICIA 1FNVA 3HVZA 4MJSA 3AV8A 1HXYD 1KLGD 1LFDA 3A9KA 3QJZA 4W9IA 4HLEA 4PS8A 3P4RB 2HJ8A 1QZEA 4HCPB 1STEA 3IT6B 3TCAA 3KUZA 1C78A 5D3DA 4XYCA 1SEBD 2L32A 5LXHA 1AWDA 3L10B 3DOWA 5DPWA 5FR6A 1E8ZA 1GC6A 4FJZA 2MCNB 3VFKA 2UU7A 2N1VA 2EELA 2MW5A 1UH6A 4RF1A 4B0EA 3D32A 4RFBA 2M56B 4HPMB 2LJIA 3ZUNA 2L8JA 2Y3AA 2NTTA 1K51A 2C60A 1NVID 2MJDA 1P1AA 2MBHA 2INDC 3ZNID 4AWJA 1JWUD 2R61A 1V8CA 1VZ7A 2GLSA 2KC1A 4NAWA 3UF8A 2BYFA 2KTRB 2JZPA 1P9DU 5EE1A 3PLUA 4YWGG 1MG4A 3N3KB 3N9YC 3H1UA 3ZTCA 5IAAC 3AEBB 1C76A 4WH4A 3CWIA 5BYQA 2NS5A 3ZJUA 4Q2JA 4YL8A 3FILB 5G55A 1X1MA 1N61A 1YN3A 4IG7B 2W3SA 2HTME 1DOYA 1WYWB 1YN4A 3ONSA 1I7HA 1SE4A 5BO4B 1GB4A 3ZXVA 2JT4B 4NY0A 2W82A 3AM9A 4ZDVA 3DBHB 3MJ5A 3QK0A 3QWZB 4R3DA 2CU1A 3IBEA 2Z0EB 3LXFA 4RF0A 4LDTB 2DWQA 3SHQA 1FNUA 2JX5A 2LI5A 1Q10A 2BKFA 3AE2B 3VAWA 2NBUA 1ZGUB 3N20C 3CSFA 1AN8A 1C4CA 1V1PA 3DBHI 3NZ3A 4GIVA 4MGIE 4ACFA 1TKYA 2I38A 3TEWA 3QA8A 1CQVA 3AEAB 1WWTA 4W9CA 2GBRA 4MT5A 4HPPA 1Z5SB 3UIPB 3ZNHB 2R2OA 2G4DB 2G3QB 2PVGC 2G1EA 1GPXA 4CQNA 2ZCCA 2WX0A 2ZCBA 3ABVB 1Y56A 1JRUA 3A9JB 3BVZA 2DBYA 1KLUD 3GE8C 4HRSA 2R2QA 1GNUA 4S0RA 4YXDB 2G9HD 4REZA 2WDTB 3AE4B 3VH4B 3RNAC 1I4QA 3DHGC 1M94A 4EUTA 4I6PA 1YD8U 1F52A 2O2VA 4LDTD 1WX7A 2CHZA 2KDBA 1S1QB 3ECIA 3ZLZA 2B76B 1WX8A 4TV3A 3BWUD 3PO0A 2N9PC 1I4HA 1RM6C 4XZ4A 3IFWB 4JIOU 2MJ3A 2PJHA 1TZ1A 1MFWA 4N6EB 1JWMD 4A8XC 4WAFA 2FE8A 4YSYB 4ITKA 3VXWA 3DBLB 3L16A 4GDLB 2IGHA 3DVNU 3X0WA 4N58A 3PHWB 3TBLD 3QIJA 4F8CB 4L2YA 2IO1B 4ANUA 3BYTB 3KUDB 4OVUA 1PQSA 4DK5A 5J18A 2ZNVC 2KVRA 1F0ZA 3RT3B 3ALBA 3H8HA 4DDID 3RNEC 4GDKA 3Q8FA 2BT6A 2BYEA 3ZRCA 4EFOA 3DBLI 5IKCM 3R8BA 4LLGM 3RNGC 4KGTA 4CO7A 2KLCA 4NAMA 3EUB2 4OVZA 2KYWA 2D3GA 2KWUB 2KNBA 3ZW3A 2WXKA 2INCC 4BKSA 1P7EA 4KKIA 4OZBA 3VRBB 1XD3B 3IG3A 4HWIB 3PZ7A 1L7YA 2ZW0A 1V9JA 4WWMA 2LFIA 1GAQB 4A3PA 4FHJA 2BQQA 3AXCA 2JWUA 2NBWB 2IDYA 2J53A 2W55A 2DAFA 1MVKA 3N32A 2N7EA 3I5JC 4MELA 2AEHA 1YOVB 2DYBA 1WGHA 4GXBA 1N6ZA 2LEKA 2N0SB 2PTLA 2JVCA 1F1HA 2W54A 2D3AA 4US8A 3ZQ4A 4J3OD 2HJ1A 3EFUA 2N7DA 2V9HA 2DYMA 5HFYA 2WWZA 1UBIA 3IVFA 2FCSA 4JLCA 1F77A 1C1YB 3U7ZA 3RCZA 4IWOA 3OG5A 3RNFC 3TEXA 3Q6BA 5CTRC 2GBNA 2JZZA 2JXTA 2QILA 2RD0A 1TYGB 2H89B 3VVWB 2BVCA 3PHXB 1FCLA 1ROEA 2KJHB 1OTRB 1ZW7A 2IPKD 4AJWA 4HVBA 2WXRA 3L17A 5T8IA 3WAMA 2QIEB 4C4VB 1JQ4A 1IPGA 1YIWA 1TBEA 2WXHA 4XE0A 1VR9A 3KYDD 2KWVB 2MJEA 1UWMA 2PE9A 3PREA 1RLFA 3QARA 3AU5A 4WJNA 3P2BA 3MHSD 5FK9C 5HG2A 2K0PA 2BW2A 3DBRI 4OZAA 1WYGA 2FCQA 2UWQA 1E9MA 1XQQA 1H8CA 2D10A 5JH5C 5L95C 2N9LA 3HM6X 2K6QA 3IT4B 1Q1OA 5C3JB 1TIFA 2KWDA 4ANVA 4PK1A 2M0AA 4RCOA 3AB5A 2WU2B 4BOSC 3ZYYX 3DQVA 2BPSA 2M8SA 3DHHC 3MHZA 5BMGA 3T3NA 2LGXA 2QDFA 4FLHA 4JX1C 1N5XA 1QOFA 2LVPA 2KFKA 4OVVA 3AE6B 3TMPB 3OLMD 4GMVA 1WM2A 1RYJA 4ARCA 5EE3A 4GDLA 2JY6A 4G3XB 4LNIA 1WMHB 3O13A 1B9RA 1E5WA 2RPQA 1WR6E 2LUEA 2MP2A 1M4VA 3GE3C 1T0RC 3GOEA 5FR3A 2PE6B 2CJNA 5HI1A 2GOWA 2ZPNA 3U52E 3WAOA 4ZRIA 1JALA 3PSEB 4AQ7A 4HK2A 1Q5WB 1SGHA 4F7ZA 3TSSA 2INPE 2DYOA 3AULA 2W3RA 3TEZA 4KSLC 4DHZB 3NZSA 5AZHA 5J17A 1D5XC 3QX1A 1EM7A 1XT9B 1WR1A 4P1BC 3B08A 5H8YE 3HM3A 2UYZB 2ZZPB 1L2NA 4E3CA 3AE7B 4LJPB 5LNK1 2DZMA 4PYZA 1Y8RC 1S3SG 5AUIA 3R7RA 2KQSA 4C80A 3P42A 4TSSA 3ZJVA 2L00B 1UD7A 4AJYB 4W9GA 5AZFA 2LGSA 4N9F4 3IAS1 3ZKJC 4DBGA 3MC9A 5KHQA 1TKGA 3S2AA 3VH3B 1TJEA 1FFVA 1F2RC 1FO4A 3EHVA 3W2DA 4K7UA 1XLOA 2WXLA 1C79A 1WE7A 4M00A 3RD2A 3RPFC 2MBEA 4HDOA 2LVOA 3QQ8B 1JWBD 2ZNVB 4A20A 1FXIA 4B95A 3VRAB 4C00A 5C2TB 3RNCC 1V5TA 2HD5B 4P16A 2LXAA 3M95A 1IBXA 2O6VA 3CMMB 2KDEB 1OQYA 1YQBA 1OGWA 3GZNI 4JWUC 3ZDTA 2SAKA 2BB5A 1R4NB 2FBWB 1JW9D 4YSZB 4MEMA 2V3PA 1E7UA 4WQOB 1IUEA 1E10A 3EC8A 2G45B 4KV2A 3PRZA 2GRIA 3R2TA 1ENFA 2MEKA 2LHDA 3GS2A 5BYSA 4ZYNA 1PDXA 4ZYSA 2Z0DB 2BYTA 2CR5A 4KIKA 3UQBA 1G6JA 2IO3B 2LVQA 4A9AA 3AEFB 1R4NI 2BS4B 4W9LA 1FRDA 2M19A 4USAA 2KDMA 2AQ1B 3FAHA 1TS5A 4MACA 1ZXIA 1RFKA 1SXTA 2IGGA 4YTNB 4ICVA 3B1LX 1VZ8A 1K50A 2L1AA 4AOFA 1N62A 3CF6E 2KHWB 2OEDA 4MH8A 4KZ0A 2BB6A 4YSXB 5E6NA 3J9CA 2VH2A 1LGRA 2NPTB 1K8RB 1UF0A 4E74A 4FJYA 5DCNA 5EDSA 1P0RA 5BMHA 1XLNA 4GSWA 3NUHB 3P4SB 2KX3A 3JW0X 4HKZE 5H92C 4H2AA 3KWVA 4IWPA 2K39A 3PPAA 2XEWA 2XK5B 1WXMA 1YJIA 3OWEB 1SF0A 4UDUC 2BKRB 4DWFA 2PPHA 1WGKA 3VR8B 5AEKB 2FUHB 2KVZA 5KHOA 1WIAA 1FIQA 1N63A 4TUUA 4RMAA 3T8MA 1NI2A 1L4ZB 1SJED 2X38A 4YT0B 3PRPB 1C9FA 4K3CA 1WMHA 1XF5L 1IGCA 2J0KA 2M17A 2H88B 3H7SA 2QMTA 1WGRA 2ON8A 3JSVB 1N5WA 1YMHE 2MQJA 1DYQA 4NJ6A 2KQ7A 3BVGA 3CIRB 2D2QA 3VUWA 4BVUC 4A90A 4I6NB 1E7VA 4BKGA 1C4AA 2KANA 4WJOA 5I4DA 3RULA 2OHFA 1T3QA 1WF9A 2DAJA 1E0ZA 2LD9A 2WXFA 3SU8X 2EKIA 2WXQA 4PT5A 4W9DA 5D94A 4GOCA 3V6EB 2MX2A 1WI0A 4ARIA 1F9JA 2C5LC 3AEDB 1UUPA 2PVOD 2QHOA 1GB1A 1WXSA 3UQAA 2OJRA 5GMVA 1WXAA 1J8CA 2VRRB 1WZ3A 2K25A 3H7PB 2C7HA 2FIFA 3PVLA 1VLBA 4LNFA 3TJPA 5IP4D 3U2SC 1T5XD 4KGSA 2BBCA 2NBVB 3B0AA 3ZXRA 3LYYA 1OQRA 1OEYA 1VD2A 2K3UA 4P7IA 2ZW1A 2AQ2B 3Q69A 1TS3A 2CS4A 1QKZA 3Q8AA 1R7SA 3LJ3A 2J7QB 1EF5A 3I63C 2WXPA 4II3B 2IGDA 2D3BA 5G5HA 3WANA 3PT2B 3K9PB 2MA9B 2KD0A 3M63B 4KSKC 1U4AA 5JZEB 4A55A 2WLBA 3Q8CA 1NI3A 1XCQL 4AUQC 2ONQA 4KX6B 3SEBA 2W9NA 4EOYA 1MPEA 3OAWA 1WFYA 3V05A 1EF1A 4FADA 1HQRD 1E8WA 2WXJA 5IN7A 4G0NB 4GB9A 1WX9A 3IAM1 1SE2A 3DWMA 2RGFA 1JRPA 1E6EB 3Q3OC 2ZVOA 3W1SA 3BVMA 3AH7A 1IYFA 1ESFA 5LXIB 1TTNA 3WALA 2QCZA 1XCTL 4BBNC 3UGBB 4IKGA 1WJUA 2BWES 2D07B 1LO5D 1JCKB 3Q8BA 2FUG1 2IJ0A 3WA0A 4HJGE 1BXTA 1SIJA 4IOIE 2N1WA 1KJTA 4FA6A 2BYVE 1P7FA 2N7JA 3MC0B 1LXDA 1DOXA 3QAQA 2V0GA 4P6VF 4W9HA 2A4ZA 4HXDA 5GXGB 2ASQA 2GBKA 4G50A 1KF6B 3ML8A 4IWQA 4HCNB 4AS1A 4IUMB 4BBNF 3H6NA 3P63A 1MHXA 1MJDA 3N1YC 3Q3MC 2KTRA 4XGAB 1F2RI 2AX5A 2JSVX 2KLGA 3QC8B 2WXGA 3BYYB 1PFDA 1I4RA 1YJ1A 2DX5B 2WDRB 1SSNA 2JU6X 2K8HA 3LDZE 2K6DB 1J7BA 2Y5CA 1KFYB 3Q8EA 3DWGC 2L83A 3AECB 3FILA 1E8YA 2MHJA 4L1BA 4TQ1A 2JYEA 2VH1A 1MG8A 3AEGB 2PKOA 3KLSX 1ZKHA 5DPRA 2LRWA 1C4PA 2MBBB 1WJ6A 1L0YB 1J7CA 3JVZX 4RGMA 2LASA 2KN5A 2CHWA 2LJ5A 1HZ5A 4AP4C 1MHHE 1FMAD 1WH3A 1UGJA 3ZVVA 4KDIC 3KYCD 4ZRJA 5E6JA 3O65B 2GBJA 2FCMA 1OQQA 1KLVA 4MM3B 2KJRA 1ET6A 1QQRA 4DXFA 1WJNA 5TSSA 2FIDA 2WXNA 3DBRB 1ET9A 1EU4A 4MJSB 3BIID 4BKTA 2BS3B 3KWLA 1TZOA 2XNAC 4CHKA 3I3TB 3H7PA 2D3CA 1JMLA 2I1KA 2DENB 4F1SA 1OEYJ 2WU5B 2YEPF 4GU2A 4HPLB 3A9JA 4JQWC 5E6PA 3V62A 4KKJA 3N1XC 2QEJC 3DVNV 2MWSB 2JUOA 1P98A 2YLMA 2KMCA 2OOBB 2GBMA 4LNKA 1QOAA 2VZKB 1Q0WB 1UWXA 1MI0A 3E9SA 4HEA1 2DZIA 4K7WA 5IOIA 2LZ6A 2KMAA 5G5GA 2KTFA 1V1OA 3K9OB 4MSQB 3U7DA 3ZNZB 4IDIA 1GG3A 1NENB 4TQ0A 4CYEA 1LQBA 5D3IB 3ZDMC 3Q2AC 1YX5B 4XC2A 1VRAB 1WSPA 4NAWB 5JXVA 3WCQA 3A4SC 3UINB 2AYOB 4RGTA 2DLBA 3TIXA 3V61A 4P1CC 4GGQA 4WWPA 2GI9A 2MLBA 3APFA 2FCNA 3PRMB 3ENEA 2KAJA 3R2IA 5D7GA 4DXAB 3DVGY 4X57B 2L52A 2VZKD 2DZJA 2JWZA 2KOXA 3A1QB 1PGBA 1V6EA 3ZO5B 3T9LA 5L83A 3NOBA 3C19A 4RM8A 3A33B 1D3ZA 4OZCA 3E56A 3W9CB 2QSDA 2INNE 4A6QA 4N59A 4NJCA 5AUKA 1QLBB 4LJOB 4WJPA 1D4BA 2ZVNA 3AEEB 1V1PB 3RZWC 2CHXA 5TR5A 1C3TA 4M02A 4HDQA 1TGZB 1V49A 4DHZE 3MP9A 4MGZE 2PLPA 2LXCA 1WRDB 2AQ3B 3NJTA 3N30A 3DHIC 4IM3A 2XN9C 2WX1A 2NCNA 4XDDA 3PZ8A 4D2KA 4K7SA 4HROA 3EA6A 4WURA 1RWSA 4MH0E 3GZNB 1I35A 1CZPA 4US9A 3QCAA 3PTFC 5CHVC 2ZPYA 3U8ZA 1WGGA 4ANXA 3GP7A 4EE2A 2MBQA 5EE9A 4XX5A 1QILA 2JQRB 2O2VB 2KWCA 1AARA 1QOGA 1AW7A 1AYFA 1TS4A 2NMQA 1UNSA 3RYTA 5AZGA 3GB1A 4TMAB 3VUXA 2JF5A 1FM0D 2B3AA 1B1ZA 4EZKA 4W9FA 3ETRA 3V3XA 5DPSA 4MM3A 2L0FA 2L0TA 2V3SA 3PGEA 3I9V1 1T0SC 2LRUA 2RR9A 5CHFA 1SE3A 3A4RA 1A70A 2WS3B 4C4VA 3P4PB 3BK2A 2WNMA 3Q14C 2IO2B 1FPYA 2V3NA 3EFCA 4C7ZA 1PGXA 3AE8B 1WGYA 3DBSA 2K5PA 2WP9B 4BZAA 1NDDA 1J7AA 3NVZA 2WXOA 2GMIC 1LM8B 4GDKB 1ZE3D 4W9JA 4W9EA 5HKHA 3ZJTA 1WY8A 3R66C 1FXAA 3FKYA 2L05A 4B9KA 2Q5WD 1ISNA 3M62B 3IXSA 4NNJB 3TEYA 4YTMB 2EMSA 4MGKE 1NBFC 4KDLB 1KM7A 3KH0A 1QT9A 2QJLA 4M01A 3R7QA 2CU3A 1T0QC 3SR6A 4FULA 1ACCA 2YEPB 3DPDA 2EMTA 1I4XA 1JWAD 2RDGA 1K52A 3PV1A 3AE3B 1IP9A 2N9XA 2K9XA 2LGIA 2C9WB 3VR9B 5J2RA 2KACA 3AE9B 2KXJA 4C7YA 1HTOA 2KT7A 3Q3NC 5JHBA 2IYDB 3UI3A 3WIMA 4ANWA 1GJZA 2XBBC 2KFJA 3A1QA 1E8XA 3C8YA 2KDFB 3W5UB 2C7NB 3CSTA 3KW5B 3ZRFA 1FD6A 4JWSC 4II2B 3NRZA 2K1FA 3L54A 4LTUA 1WGDA 4BKSD 4LCDE 2KKCA 4FJVB 3PLVA 1C77A 3APDA 3VTUA 2J0MA 5EE0A 2K8CA 3RFZB 5IO9A 1SJHD 2DZKA 3HRDD 4ASWC 1D6EC 1YN5A 2REXA 1XXGA 4B0MA 3HHMA 1D5MC 2ACZB 1TT5B 3MC8A 4NQKE 2IBIB 3ML9A 1RRBA 4O1NA 1DGJA 2J42A 1WXVA 3QHTA 2RPVA 2NVUI 1J19A 1PYWD 5G2NA 3V60A 2LGYA 3NS8A 2FNJB 5E6OA 1FXTB 4M0WB 1KOTA 1VJKA 4FXCA 3TL5A 3ZGZA 4A3OA 5C23A 1XLPA 2M1MA 2PMVA 1RFAA 3RMKC 2IY0B 1J0GA 3RNBC 1EU3A 5CHWA 3HUIA 1I4GA 4K81A 3SFEB 4WWOA 3Q3JA 2JRHA 4ZHOA 4PYUA 1FNWA 4JGHB 2QC8A 3BK1A 4YTPB 4OW0A 1HTQA 4M8MA 2N4FA 4EZLA 4ZRPA 3NZUA 2LUMA 2Y5PA 4BAXA 1JWSD 1K53A 2KFKB 3JYUA 4XWTA 2M4NA 3FC4A 3SFDB 2IZVB 4RM9A 1TY2A 1NYQA 4DQOC 5BMIA 2WDVB 4XWWA 3BZDB 3W5VB 1H4RA 1YNTE 2KMMA 2PIAA 1ZXHA 4RGNA 1UELA 2KN4A 1V5OA 4WQMA 3TUOA 2K22A 2MP2B 3VTVA 1HEZE 2Z59B 3OJ4B 2L76A 3DCGA 4HKQA 3BINA 2MH7A 2FAZA 2NPTA 2KC2A 2J52A 1HE8A 2DHZA 1KTKA 1BT0A 1DOIA 4ZOHC 4G11A 2JRIB 3APCA 3NY5A 2G4SA 4NJ7A 2I2YA 4GN1A 1L6VA 1WZ0A 4RH6A 2AL6A 1V86A 5IA7A 2RMMA 2LGDA 2V1YA 3HIZA 2XK5A 1VZ6A 1SBBB 1A5RA 3PS6A 4GLSC 1YJJA 3HVDA 4B6WA 3W1SC 3AU4A 3NHEB 3R3MA 1YX6B 2HDEA 4IW0A 2HE7A 3MFGA 1VDVA 2BWFA 2PEAA 3VHTC 1OFFA 1UZXB 1EWYC 1E90A 2L3ZA 2WDQB 3ZIMA 1XO3A 4KZCA 1TKEA 2ZJDA 1V80A 2SEBD 4M8NA 2RDBC 3B9JA 4JE3B 4IM0A 1SE9A 2LWPA 2JZ3B 3I57A 2EKEC 4WWNA 5C1ZA 3NVVA 3DVGX 1UGMA 2I1JA 3AI5A 4L23A 1IGDA 3JSVA 3N1ZC 3MTNB 2KJ6A 3U4EG
chains in the Genus database with same CATH topology
2KOXA 3A1QB 1EO6A 2WDTB 4DHJB 3CF6E 1V6EA 2KHWB 5DPTA 2J0JA 3VH4B 4KZ0A 4NQLB 1M94A 3ZO5B 3T9LA 4EUTA 5L83A 4I6PA 5E6NA 1YD8U 2O2VA 4LDTD 2NPTB 1WX7A 3NOBA 4RM8A 2CHZA 3A33B 1K8RB 2KDBA 3ZTDA 1D3ZA 4E74A 4FJYA 1S1QB 5DCNA 5EDSA 3ECIA 1P0RA 3ZLZA 4ICUA 4JL9A 4GSWA 1WX8A 4TV3A 2KX3A 3JW0X 3HK0A 2RSUA 2N9PC 2O6VB 1RAXA 4IWPA 4LJOB 3ZNGC 2K39A 3PPAA 4WJPA 4XZ4A 4FBJB 3C0RB 2XEWA 2ZVNA 3IFWB 2XK5B 4JIOU 1WXMA 2PJHA 1TZ1A 2BGFA 3RZWC 2CHXA 5TR5A 1C3TA 2BKRB 4DWFA 1V81A 4HDQA 2PPHA 3A9KB 2CKHB 1TGZB 1V49A 4DHZE 4MGZE 2K8BA 3U30A 5AEKB 2FUHB 2LXCA 3M3JA 5KHOA 3VXWA 1WIAA 3L16A 1WRDB 4GDLB 3DVNU 3X0WA 4TUUA 3PHWB 3SDLC 4RMAA 3TBLD 3QIJA 3T8MA 1NI2A 3N30A 4IM3A 4F8CB 4KIKB 2IO1B 4WJQA 3VUYA 4ANUA 1I42A 1V2YA 2WX1A 3KUDB 4OVUA 2NCNA 1PQSA 3PRPB 2AWTA 4DK5A 1WMHA 5J18A 2ZNVC 4K7SA 2KVRA 3RT3B 3ALBA 4DDID 2J0KA 2M17A 4GDKA 4MH0E 3H7SA 1I35A 1WGRA 4DHJD 2BYEA 3ZRCA 4EFOA 1Z2MA 3W1YA 3JSVB 3QCAA 3DBLI 1CMXB 3PTFC 1SIFA 2MQJA 5CHVC 4NJ6A 4W9KA 2KQ7A 2ZPYA 3U8ZA 4BFRA 1WGGA 3L13A 4ANXA 4CO7A 2KLCA 2KZRA 1P3QU 2D2QA 2MBQA 3VUWA 4BVUC 4XX5A 4I6NB 2KWUB 2D3GA 2MRPA 1E7VA 2BF8B 2O2VB 2KNBA 4BKGA 2KWCA 1AARA 2KANA 4WJOA 3L0WB 3ZW3A 3RULA 2N9EB 3RYTA 2O6VD 3EECA 5AZGA 1WF9A 2DAJA 2LD9A 2KDIA 3VUXA 1VCBA 2JF5A 3L08A 4KVGB 2YVCA 4BKSA 3SU8X 2B3AA 1XD3B 3IG3A 4W9DA 4HWIB 5D94A 4EZKA 4GOCA 4W9FA 3V6EB 2MX2A 1WI0A 3KVFB 1F9JA 1L7YA 5DPSA 4MM3A 2C5LC 2L0TA 2L0FA 1V9JA 2V3SA 3PGEA 3V6CB 4A3PA 2LRUA 2QHOA 2RR9A 1WXSA 3UQAA 2IO0B 5CHFA 2OJRA 3A4RA 1WXAA 5GMVA 1J8CA 1EUVB 4FHJA 3UIOB 2VRRB 1WZ3A 2K25A 3AXCA 3OJ3A 3H7PB 3X23A 2C7HA 2FIFA 3PVLA 2NBWB 2DAFA 2IO2B 3MJWA 3N32A 2N7EA 3TJPA 1WGYA 4MELA 3DBSA 2WYQA 2AEHA 2DYBA 3VDZA 1WGHA 1WE6A 2NBVB 4GXBA 4EKUA 3B0AA 1NDDA 4EEWA 3WAPA 2JVCA 2JPHA 2L7RA 3BY4B 1OEYA 1VD2A 2GMIC 3EFUA 2NR2A 1LM8B 4GDKB 1WM3A 2N7DA 4P7IA 4W9JA 2IY1B 2KK8A 4W9EA 2CS4A 2A5UA 2DYMA 5HKHA 3LJ3A 1WY8A 2J7QB 3R66C 1EF5A 3SD5A 2L05A 4URKA 4B9KA 2WWZA 1ISNA 1UBIA 3IVFA 3VQIA 3M62B 4II3B 2FCSA 4NNJB 3WANA 4JLCA 5CX3A 2EMSA 2MBOA 3PT2B 1C1YB 2ZEQA 4BOZB 4MGYE 3K9PB 2MA9B 3RCZA 2C7MB 4IWOA 2KD0A 3M63B 4KSKC 4MGKE 1NBFC 4KDLB 3PZDA 1U4AA 1KM7A 5JZEB 3KH0A 4IC7B 5CTRC 2GBNA 2JZZA 3VTWA 4E71A 4AUQC 2RD0A 4NPNA 3R7QA 2W9NA 4EOYA 3VVWB 1R4MI 5D2MB 5JHAA 2AL3A 3PHXB 3OAWA 2HTHA 2KO3A 4FULA 2KJHB 1GC7A 1OTRB 1WFYA 1EF1A 1ZW7A 4FADA 4AJWA 3DDCB 4HVBA 1E8WA 3L17A 4HJKA 3WAMA 3DPDA 2EMTA 4G0NB 4GB9A 1WX9A 1GUAB 1IPGA 2RGFA 1YIWA 1TBEA 3PV1A 3KYDD 1T0YA 2ZVOA 3W1SA 3H9DA 2KWVB 3Q3FA 4TKNA 2PE9A 1IP9A 1IYFA 2N9XA 3PREA 1RLFA 2C9WB 3QARA 5LXIB 2Y5BB 1TTNA 3RUIB 3WALA 3AU5A 5J2RA 2D11A 4WJNA 3P2BA 4MDKE 4ZRKA 4BBNC 3MHSD 3KUCB 4I6LB 3UGBB 2KXJA 1WJUA 2BWES 2D07B 4EZJA 3DBRI 4FHKA 3IHPC 2FCQA 2M0XA 4K1RB 2IYDB 3SHQA 2UWQA 5D6JB 5JHBA 3WIMA 1XQQA 4ANWA 2XBBC 4MSMB 1GJZA 1H8CA 3WA0A 2D10A 2KFJA 3A1QA 5JH5C 1E8XA 4PS7A 3RZFA 5L95C 4WAAA 2KDFB 3HM6X 2K6QA 2C7NB 3CSTA 3KW5B 1Q1OA 1KJTA 2N1WA 3ZRFA 4FA6A 2BYVE 2MSED 4FN2A 4DDGD 1LXDA 1UBQA 3QAQA 4II2B 4PS3A 4ANVA 2K1FA 4W9HA 2A4ZA 4HXDA 3L54A 2V4LA 2ASQA 1WJ4A 1WGDA 4IM2A 4BKSD 4LCDE 4BOSC 2GBKA 2JXXA 4G50A 2KX0A 2KKCA 3ML8A 4IWQA 4HCNB 3DQVA 4FJVB 3PLVA 4IUMB 2BPSA 4BBNF 2M8SA 5LLIA 3APDA 3VTUA 3H6NA 2J0MA 2JWZA 4J6IA 2LGXA 2K8CA 4FLHA 2DZKA 2KTRA 2LVPA 4ASWC 4MJSA 2REXA 2KLGA 2KFKA 3QC8B 3HHMA 4OVVA 1LFDA 3TMPB 3A9KA 3OLMD 3QJZA 4W9IA 4HLEA 4PS8A 4GMVA 1WM2A 1QZEA 1YJ1A 2DX5B 2HJ8A 4NQKE 4HCPB 2IBIB 3ML9A 1RRBA 4GDLA 2JY6A 3TCAA 3KUZA 2K8HA 4G3XB 1WXVA 3QHTA 1WMHB 2NVUI 3LDZE 2K6DB 1J19A 5LXHA 1E5WA 3L10B 2RPQA 3DOWA 5G2NA 5DPWA 1E8YA 2LGYA 3V60A 3NS8A 1WR6E 2FNJB 2LUEA 5FR6A 5E6OA 1FXTB 1E8ZA 2MP2A 1GC6A 4TQ1A 4M0WB 4FJZA 2MCNB 3GOEA 3VFKA 1KOTA 2PE6B 1MG8A 2GOWA 3TL5A 2ZPNA 2N1VA 1ZKHA 4A3OA 3WAOA 5DPRA 2LRWA 5C23A 2MW5A 2MBBB 4ZRIA 1WJ6A 1UH6A 2M1MA 3PSEB 4HK2A 1Q5WB 1RFAA 2IY0B 1SGHA 3JVZX 3D32A 2LASA 4F7ZA 1J0GA 2KN5A 2CHWA 2LJ5A 4AP4C 4HPMB 2DYOA 1WH3A 3ZUNA 3AULA 2L8JA 5CHWA 4KSLC 3ZVVA 4K81A 4DHZB 3NZSA 4WWOA 5AZHA 4KDIC 2C60A 5J17A 3KYCD 3QX1A 4ZRJA 1XT9B 3Q3JA 3O65B 2GBJA 1WR1A 1P1AA 2JRHA 3B08A 2FCMA 2MBHA 1KLVA 3HM3A 3ZNID 4AWJA 2UYZB 2ZZPB 2KJRA 1L2NA 4E3CA 4PYUA 4JGHB 4LJPB 1WJNA 2FIDA 2DZMA 2KC1A 4NAWA 4PYZA 3UF8A 4M8MA 2BYFA 2KTRB 1Y8RC 2N4FA 4EZLA 1P9DU 1S3SG 3NZUA 4MJSB 3R7RA 2KQSA 3PLUA 4BKTA 2KFKB 3JYUA 2M4NA 2L00B 4CHKA 1UD7A 2IZVB 3I3TB 3N3KB 3H7PA 4AJYB 3H1UA 4RM9A 3ZTCA 4W9GA 2I1KA 5IAAC 5AZFA 2DENB 4F1SA 1OEYJ 4N9F4 4GU2A 4HPLB 3A9JA 4JQWC 3ZKJC 5E6PA 4DBGA 5KHQA 3V62A 1H4RA 3DVNV 2MWSB 2JUOA 3S2AA 1UELA 2NS5A 1V5OA 4YL8A 3VH3B 1P98A 1X1MA 5G55A 2YLMA 2KMCA 4IG7B 2OOBB 2GBMA 3EHVA 2MP2B 3VTVA 2Z59B 3OJ4B 1WYWB 2L76A 3DCGA 3ONSA 4K7UA 5BO4B 1WE7A 2JT4B 4NY0A 3RD2A 1Q0WB 4ZDVA 3BINA 2MBEA 4HDOA 2LVOA 3QQ8B 3QK0A 3QWZB 2FAZA 2NPTA 2ZNVB 2KC2A 4A20A 4B95A 2CU1A 1HE8A 3IBEA 2DHZA 2DZIA 1BT0A 2Z0EB 4K7WA 4G11A 2JRIB 3APCA 1V5TA 2G4SA 2HD5B 2KMAA 2KTFA 2LZ6A 3NY5A 4LDTB 2LXAA 3K9OB 3M95A 4GN1A 4MSQB 4NJ7A 3U7DA 2LI5A 1WZ0A 2AL6A 2BKFA 3VAWA 3ZNZB 1V86A 2O6VA 3CMMB 1GG3A 5IA7A 2NBUA 2LGDA 1ZGUB 2V1YA 2KDEB 3HIZA 1OQYA 1YQBA 1OGWA 3GZNI 2XK5A 3ZDTA 3CSFA 4TQ0A 4CYEA 3DBHI 4GIVA 3PS6A 1LQBA 1A5RA 4MEMA 4MGIE 3ZDMC 1E7UA 4B6WA 1YX5B 3W1SC 4XC2A 3AU4A 4WQOB 3EC8A 3NHEB 3R3MA 3QA8A 2G45B 4KV2A 3PRZA 4NAWB 1YX6B 4IW0A 2HE7A 4W9CA 4ZYNA 3A4SC 3UINB 2GBRA 2AYOB 2BWFA 2PEAA 3VHTC 1Z5SB 3UIPB 3ZNHB 1UZXB 1E90A 2L3ZA 2R2OA 2G4DB 2G3QB 2Z0DB 2CR5A 3ZIMA 4KIKA 3TIXA 3UQBA 1G6JA 2IO3B 4KZCA 3V61A 2LVQA 2ZJDA 4GGQA 4WWPA 2ZCCA 2WX0A 2ZCBA 1R4NI 1V80A 2MLBA 3APFA 4W9LA 2FCNA 3PRMB 4M8NA 1JRUA 3A9JB 4IM0A 1SE9A 3ENEA 2LWPA 2JZ3B 4WWNA 2EKEC 5C1ZA 3DVGX 1UGMA 5D7GA 3DVGY 4X57B 4DXAB 2I1JA 4ICVA 2R2QA 3AI5A 3B1LX 1GNUA 3JSVA 2DZJA 3MTNB 2KJ6A 4AOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOX A;  3A1Q B;  1EO6 A;  2WDT B;  4DHJ B;  3CF6 E;  1V6E A;  2KHW B;  5DPT A;  2J0J A;  3VH4 B;  4KZ0 A;  4NQL B;  1M94 A;  3ZO5 B;  3T9L A;  4EUT A;  5L83 A;  4I6P A;  5E6N A;  1YD8 U;  2O2V A;  4LDT D;  2NPT B;  1WX7 A;  3NOB A;  4RM8 A;  2CHZ A;  3A33 B;  1K8R B;  2KDB A;  3ZTD A;  1D3Z A;  4E74 A;  4FJY A;  1S1Q B;  5DCN A;  5EDS A;  3ECI A;  1P0R A;  3ZLZ A;  4ICU A;  4JL9 A;  4GSW A;  1WX8 A;  4TV3 A;  2KX3 A;  3JW0 X;  3HK0 A;  2RSU A;  2N9P C;  2O6V B;  1RAX A;  4IWP A;  4LJO B;  3ZNG C;  2K39 A;  3PPA A;  4WJP A;  4XZ4 A;  4FBJ B;  3C0R B;  2XEW A;  2ZVN A;  3IFW B;  2XK5 B;  4JIO U;  1WXM A;  2PJH A;  1TZ1 A;  2BGF A;  3RZW C;  2CHX A;  5TR5 A;  1C3T A;  2BKR B;  4DWF A;  1V81 A;  4HDQ A;  2PPH A;  3A9K B;  2CKH B;  1TGZ B;  1V49 A;  4DHZ E;  4MGZ E;  2K8B A;  3U30 A;  5AEK B;  2FUH B;  2LXC A;  3M3J A;  5KHO A;  3VXW A;  1WIA A;  3L16 A;  1WRD B;  4GDL B;  3DVN U;  3X0W A;  4TUU A;  3PHW B;  3SDL C;  4RMA A;  3TBL D;  3QIJ A;  3T8M A;  1NI2 A;  3N30 A;  4IM3 A;  4F8C B;  4KIK B;  2IO1 B;  4WJQ A;  3VUY A;  4ANU A;  1I42 A;  1V2Y A;  2WX1 A;  3KUD B;  4OVU A;  2NCN A;  1PQS A;  3PRP B;  2AWT A;  4DK5 A;  1WMH A;  5J18 A;  2ZNV C;  4K7S A;  2KVR A;  3RT3 B;  3ALB A;  4DDI D;  2J0K A;  2M17 A;  4GDK A;  4MH0 E;  3H7S A;  1I35 A;  1WGR A;  4DHJ D;  2BYE A;  3ZRC A;  4EFO A;  1Z2M A;  3W1Y A;  3JSV B;  3QCA A;  3DBL I;  1CMX B;  3PTF C;  1SIF A;  2MQJ A;  5CHV C;  4NJ6 A;  4W9K A;  2KQ7 A;  2ZPY A;  3U8Z A;  4BFR A;  1WGG A;  3L13 A;  4ANX A;  4CO7 A;  2KLC A;  2KZR A;  1P3Q U;  2D2Q A;  2MBQ A;  3VUW A;  4BVU C;  4XX5 A;  4I6N B;  2KWU B;  2D3G A;  2MRP A;  1E7V A;  2BF8 B;  2O2V B;  2KNB A;  4BKG A;  2KWC A;  1AAR A;  2KAN A;  4WJO A;  3L0W B;  3ZW3 A;  3RUL A;  2N9E B;  3RYT A;  2O6V D;  3EEC A;  5AZG A;  1WF9 A;  2DAJ A;  2LD9 A;  2KDI A;  3VUX A;  1VCB A;  2JF5 A;  3L08 A;  4KVG B;  2YVC A;  4BKS A;  3SU8 X;  2B3A A;  1XD3 B;  3IG3 A;  4W9D A;  4HWI B;  5D94 A;  4EZK A;  4GOC A;  4W9F A;  3V6E B;  2MX2 A;  1WI0 A;  3KVF B;  1F9J A;  1L7Y A;  5DPS A;  4MM3 A;  2C5L C;  2L0T A;  2L0F A;  1V9J A;  2V3S A;  3PGE A;  3V6C B;  4A3P A;  2LRU A;  2QHO A;  2RR9 A;  1WXS A;  3UQA A;  2IO0 B;  5CHF A;  2OJR A;  3A4R A;  1WXA A;  5GMV A;  1J8C A;  1EUV B;  4FHJ A;  3UIO B;  2VRR B;  1WZ3 A;  2K25 A;  3AXC A;  3OJ3 A;  3H7P B;  3X23 A;  2C7H A;  2FIF A;  3PVL A;  2NBW B;  2DAF A;  2IO2 B;  3MJW A;  3N32 A;  2N7E A;  3TJP A;  1WGY A;  4MEL A;  3DBS A;  2WYQ A;  2AEH A;  2DYB A;  3VDZ A;  1WGH A;  1WE6 A;  2NBV B;  4GXB A;  4EKU A;  3B0A A;  1NDD A;  4EEW A;  3WAP A;  2JVC A;  2JPH A;  2L7R A;  3BY4 B;  1OEY A;  1VD2 A;  2GMI C;  3EFU A;  2NR2 A;  1LM8 B;  4GDK B;  1WM3 A;  2N7D A;  4P7I A;  4W9J A;  2IY1 B;  2KK8 A;  4W9E A;  2CS4 A;  2A5U A;  2DYM A;  5HKH A;  3LJ3 A;  1WY8 A;  2J7Q B;  3R66 C;  1EF5 A;  3SD5 A;  2L05 A;  4URK A;  4B9K A;  2WWZ A;  1ISN A;  1UBI A;  3IVF A;  3VQI A;  3M62 B;  4II3 B;  2FCS A;  4NNJ B;  3WAN A;  4JLC A;  5CX3 A;  2EMS A;  2MBO A;  3PT2 B;  1C1Y B;  2ZEQ A;  4BOZ B;  4MGY E;  3K9P B;  2MA9 B;  3RCZ A;  2C7M B;  4IWO A;  2KD0 A;  3M63 B;  4KSK C;  4MGK E;  1NBF C;  4KDL B;  3PZD A;  1U4A A;  1KM7 A;  5JZE B;  3KH0 A;  4IC7 B;  5CTR C;  2GBN A;  2JZZ A;  3VTW A;  4E71 A;  4AUQ C;  2RD0 A;  4NPN A;  3R7Q A;  2W9N A;  4EOY A;  3VVW B;  1R4M I;  5D2M B;  5JHA A;  2AL3 A;  3PHX B;  3OAW A;  2HTH A;  2KO3 A;  4FUL A;  2KJH B;  1GC7 A;  1OTR B;  1WFY A;  1EF1 A;  1ZW7 A;  4FAD A;  4AJW A;  3DDC B;  4HVB A;  1E8W A;  3L17 A;  4HJK A;  3WAM A;  3DPD A;  2EMT A;  4G0N B;  4GB9 A;  1WX9 A;  1GUA B;  1IPG A;  2RGF A;  1YIW A;  1TBE A;  3PV1 A;  3KYD D;  1T0Y A;  2ZVO A;  3W1S A;  3H9D A;  2KWV B;  3Q3F A;  4TKN A;  2PE9 A;  1IP9 A;  1IYF A;  2N9X A;  3PRE A;  1RLF A;  2C9W B;  3QAR A;  5LXI B;  2Y5B B;  1TTN A;  3RUI B;  3WAL A;  3AU5 A;  5J2R A;  2D11 A;  4WJN A;  3P2B A;  4MDK E;  4ZRK A;  4BBN C;  3MHS D;  3KUC B;  4I6L B;  3UGB B;  2KXJ A;  1WJU A;  2BWE S;  2D07 B;  4EZJ A;  3DBR I;  4FHK A;  3IHP C;  2FCQ A;  2M0X A;  4K1R B;  2IYD B;  3SHQ A;  2UWQ A;  5D6J B;  5JHB A;  3WIM A;  1XQQ A;  4ANW A;  2XBB C;  4MSM B;  1GJZ A;  1H8C A;  3WA0 A;  2D10 A;  2KFJ A;  3A1Q A;  5JH5 C;  1E8X A;  4PS7 A;  3RZF A;  5L95 C;  4WAA A;  2KDF B;  3HM6 X;  2K6Q A;  2C7N B;  3CST A;  3KW5 B;  1Q1O A;  1KJT A;  2N1W A;  3ZRF A;  4FA6 A;  2BYV E;  2MSE D;  4FN2 A;  4DDG D;  1LXD A;  1UBQ A;  3QAQ A;  4II2 B;  4PS3 A;  4ANV A;  2K1F A;  4W9H A;  2A4Z A;  4HXD A;  3L54 A;  2V4L A;  2ASQ A;  1WJ4 A;  1WGD A;  4IM2 A;  4BKS D;  4LCD E;  4BOS C;  2GBK A;  2JXX A;  4G50 A;  2KX0 A;  2KKC A;  3ML8 A;  4IWQ A;  4HCN B;  3DQV A;  4FJV B;  3PLV A;  4IUM B;  2BPS A;  4BBN F;  2M8S A;  5LLI A;  3APD A;  3VTU A;  3H6N A;  2J0M A;  2JWZ A;  4J6I A;  2LGX A;  2K8C A;  4FLH A;  2DZK A;  2KTR A;  2LVP A;  4ASW C;  4MJS A;  2REX A;  2KLG A;  2KFK A;  3QC8 B;  3HHM A;  4OVV A;  1LFD A;  3TMP B;  3A9K A;  3OLM D;  3QJZ A;  4W9I A;  4HLE A;  4PS8 A;  4GMV A;  1WM2 A;  1QZE A;  1YJ1 A;  2DX5 B;  2HJ8 A;  4NQK E;  4HCP B;  2IBI B;  3ML9 A;  1RRB A;  4GDL A;  2JY6 A;  3TCA A;  3KUZ A;  2K8H A;  4G3X B;  1WXV A;  3QHT A;  1WMH B;  2NVU I;  3LDZ E;  2K6D B;  1J19 A;  5LXH A;  1E5W A;  3L10 B;  2RPQ A;  3DOW A;  5G2N A;  5DPW A;  1E8Y A;  2LGY A;  3V60 A;  3NS8 A;  1WR6 E;  2FNJ B;  2LUE A;  5FR6 A;  5E6O A;  1FXT B;  1E8Z A;  2MP2 A;  1GC6 A;  4TQ1 A;  4M0W B;  4FJZ A;  2MCN B;  3GOE A;  3VFK A;  1KOT A;  2PE6 B;  1MG8 A;  2GOW A;  3TL5 A;  2ZPN A;  2N1V A;  1ZKH A;  4A3O A;  3WAO A;  5DPR A;  2LRW A;  5C23 A;  2MW5 A;  2MBB B;  4ZRI A;  1WJ6 A;  1UH6 A;  2M1M A;  3PSE B;  4HK2 A;  1Q5W B;  1RFA A;  2IY0 B;  1SGH A;  3JVZ X;  3D32 A;  2LAS A;  4F7Z A;  1J0G A;  2KN5 A;  2CHW A;  2LJ5 A;  4AP4 C;  4HPM B;  2DYO A;  1WH3 A;  3ZUN A;  3AUL A;  2L8J A;  5CHW A;  4KSL C;  3ZVV A;  4K81 A;  4DHZ B;  3NZS A;  4WWO A;  5AZH A;  4KDI C;  2C60 A;  5J17 A;  3KYC D;  3QX1 A;  4ZRJ A;  1XT9 B;  3Q3J A;  3O65 B;  2GBJ A;  1WR1 A;  1P1A A;  2JRH A;  3B08 A;  2FCM A;  2MBH A;  1KLV A;  3HM3 A;  3ZNI D;  4AWJ A;  2UYZ B;  2ZZP B;  2KJR A;  1L2N A;  4E3C A;  4PYU A;  4JGH B;  4LJP B;  1WJN A;  2FID A;  2DZM A;  2KC1 A;  4NAW A;  4PYZ A;  3UF8 A;  4M8M A;  2BYF A;  2KTR B;  1Y8R C;  2N4F A;  4EZL A;  1P9D U;  1S3S G;  3NZU A;  4MJS B;  3R7R A;  2KQS A;  3PLU A;  4BKT A;  2KFK B;  3JYU A;  2M4N A;  2L00 B;  4CHK A;  1UD7 A;  2IZV B;  3I3T B;  3N3K B;  3H7P A;  4AJY B;  3H1U A;  4RM9 A;  3ZTC A;  4W9G A;  2I1K A;  5IAA C;  5AZF A;  2DEN B;  4F1S A;  1OEY J;  4N9F 4;  4GU2 A;  4HPL B;  3A9J A;  4JQW C;  3ZKJ C;  5E6P A;  4DBG A;  5KHQ A;  3V62 A;  1H4R A;  3DVN V;  2MWS B;  2JUO A;  3S2A A;  1UEL A;  2NS5 A;  1V5O A;  4YL8 A;  3VH3 B;  1P98 A;  1X1M A;  5G55 A;  2YLM A;  2KMC A;  4IG7 B;  2OOB B;  2GBM A;  3EHV A;  2MP2 B;  3VTV A;  2Z59 B;  3OJ4 B;  1WYW B;  2L76 A;  3DCG A;  3ONS A;  4K7U A;  5BO4 B;  1WE7 A;  2JT4 B;  4NY0 A;  3RD2 A;  1Q0W B;  4ZDV A;  3BIN A;  2MBE A;  4HDO A;  2LVO A;  3QQ8 B;  3QK0 A;  3QWZ B;  2FAZ A;  2NPT A;  2ZNV B;  2KC2 A;  4A20 A;  4B95 A;  2CU1 A;  1HE8 A;  3IBE A;  2DHZ A;  2DZI A;  1BT0 A;  2Z0E B;  4K7W A;  4G11 A;  2JRI B;  3APC A;  1V5T A;  2G4S A;  2HD5 B;  2KMA A;  2KTF A;  2LZ6 A;  3NY5 A;  4LDT B;  2LXA A;  3K9O B;  3M95 A;  4GN1 A;  4MSQ B;  4NJ7 A;  3U7D A;  2LI5 A;  1WZ0 A;  2AL6 A;  2BKF A;  3VAW A;  3ZNZ B;  1V86 A;  2O6V A;  3CMM B;  1GG3 A;  5IA7 A;  2NBU A;  2LGD A;  1ZGU B;  2V1Y A;  2KDE B;  3HIZ A;  1OQY A;  1YQB A;  1OGW A;  3GZN I;  2XK5 A;  3ZDT A;  3CSF A;  4TQ0 A;  4CYE A;  3DBH I;  4GIV A;  3PS6 A;  1LQB A;  1A5R A;  4MEM A;  4MGI E;  3ZDM C;  1E7U A;  4B6W A;  1YX5 B;  3W1S C;  4XC2 A;  3AU4 A;  4WQO B;  3EC8 A;  3NHE B;  3R3M A;  3QA8 A;  2G45 B;  4KV2 A;  3PRZ A;  4NAW B;  1YX6 B;  4IW0 A;  2HE7 A;  4W9C A;  4ZYN A;  3A4S C;  3UIN B;  2GBR A;  2AYO B;  2BWF A;  2PEA A;  3VHT C;  1Z5S B;  3UIP B;  3ZNH B;  1UZX B;  1E90 A;  2L3Z A;  2R2O A;  2G4D B;  2G3Q B;  2Z0D B;  2CR5 A;  3ZIM A;  4KIK A;  3TIX A;  3UQB A;  1G6J A;  2IO3 B;  4KZC A;  3V61 A;  2LVQ A;  2ZJD A;  4GGQ A;  4WWP A;  2ZCC A;  2WX0 A;  2ZCB A;  1R4N I;  1V80 A;  2MLB A;  3APF A;  4W9L A;  2FCN A;  3PRM B;  4M8N A;  1JRU A;  3A9J B;  4IM0 A;  1SE9 A;  3ENE A;  2LWP A;  2JZ3 B;  4WWN A;  2EKE C;  5C1Z A;  3DVG X;  1UGM A;  5D7G A;  3DVG Y;  4X57 B;  4DXA B;  2I1J A;  4ICV A;  2R2Q A;  3AI5 A;  3B1L X;  1GNU A;  3JSV A;  2DZJ A;  3MTN B;  2KJ6 A;  4AOF A; 
#chains in the Genus database with same CATH topology
 2E6X A;  1EO6 A;  4DHJ B;  1FCC C;  4RGO S;  3RN9 C;  2E3T A;  5DPT A;  2J0J A;  5HHD G;  2TSS A;  4NQL B;  2LMC A;  3ZTD A;  3T3O A;  1D5Z C;  4ICU A;  4JL9 A;  4C56 C;  2WXM A;  3B2G A;  1T6B X;  3HK0 A;  2RSU A;  1IBX B;  2O6V B;  1RAX A;  2DNF A;  3ZNG C;  4FBJ B;  3C0R B;  4DXG A;  2BGF A;  1CJE A;  5BYR A;  1V81 A;  1SB3 C;  3A9K B;  4S17 A;  2CKH B;  2WQY B;  2K8B A;  3U30 A;  2CJO A;  3M3J A;  2V4I B;  3SDL C;  1I4P A;  4WIP A;  1KH0 A;  4KGR A;  2BS2 B;  4KIK B;  3AMZ A;  4WJQ A;  3VUY A;  1I42 A;  1V2Y A;  1ZOY B;  2AWT A;  1QF6 A;  3B2F A;  1HA5 A;  4QAY A;  1GOZ A;  4LNO A;  4LNN A;  4DHJ D;  1Z2M A;  3W1Y A;  4M0W A;  2WHI A;  1CMX B;  1SIF A;  1L5P A;  4W9K A;  4BFR A;  3L13 A;  3NS1 A;  1WXQ A;  3L4P A;  2KZR A;  1P3Q U;  1QOB A;  1YQ3 B;  1E7P B;  2MRP A;  2BF8 B;  3L0W B;  2N9E B;  2O6V D;  3EEC A;  2KQ4 X;  2KDI A;  1VCB A;  3L08 A;  4KVG B;  2YVC A;  2N9K A;  4ZRQ A;  3URY A;  1FFU A;  4ZHP A;  3KVF B;  1WRI A;  3V6C B;  2WGS A;  3EGR A;  3P4Q B;  2IO0 B;  4RNA A;  1L0X B;  1EUV B;  3UIO B;  1BUI C;  3OJ3 A;  3X23 A;  2J4X A;  3MJW A;  2WYQ A;  4XDC A;  3VDZ A;  5FKA C;  1WE6 A;  2WXI A;  4EKU A;  4EEW A;  3WAP A;  2D5G A;  2JPH A;  4NZL B;  2X8X X;  2L7R A;  1EWC A;  3BY4 B;  2BTE A;  1L6U A;  2NR2 A;  1WM3 A;  4K3B A;  1L4D B;  2IY1 B;  2KK8 A;  2A5U A;  3SD5 A;  2GB1 A;  4URK A;  1TY0 A;  1R4M B;  3RI7 C;  1NYR A;  3VQI A;  3AE5 B;  5CX3 A;  2MBO A;  2ZEQ A;  4BOZ B;  4MGY E;  4OHJ A;  1L0V B;  2C7M B;  4JPS A;  1N60 A;  3PZD A;  1PUT A;  3AE1 B;  4IC7 B;  3VTW A;  4E71 A;  1ZDV A;  3KQ4 A;  4NPN A;  1R4M I;  5D2M B;  5JHA A;  2AL3 A;  3AN1 A;  2HTH A;  1KRH A;  2KO3 A;  1HZ6 A;  1XLQ A;  1GC7 A;  3DDC B;  2NTS A;  4HJK A;  2OJW A;  1NEK B;  1GUA B;  1XEE A;  1ZDX A;  1T0Y A;  1JRO A;  3H9D A;  3Q3F A;  4TKN A;  3NVY A;  1ZPS A;  2Y5B B;  3RUI B;  2D11 A;  1ZUD 2;  4MDK E;  4ZRK A;  3KUC B;  4I6L B;  1CK1 A;  4EZJ A;  4FHK A;  3IHP C;  2M0X A;  4K1R B;  1BML C;  5D6J B;  4MSM B;  4LK0 M;  2RDH A;  3P1M A;  4PS7 A;  3RZF A;  4WAA A;  1YQ4 B;  1PGA A;  2MSE D;  1V97 A;  2Z8L A;  4FN2 A;  4DDG D;  1UBQ A;  4PS3 A;  3NG0 A;  2V4L A;  1TS2 A;  1WJ4 A;  5MPO A;  4IM2 A;  2PW9 A;  2JXX A;  2KX0 A;  1ZP0 B;  2LHE A;  3NVW A;  2JYT A;  5LLI A;  1FRR A;  4J6I A;  3LB8 C;  1FEH A;  2ICI A;  1FNV A;  3HVZ A;  4MJS A;  3AV8 A;  1HXY D;  1KLG D;  1LFD A;  3A9K A;  3QJZ A;  4W9I A;  4HLE A;  4PS8 A;  3P4R B;  2HJ8 A;  1QZE A;  4HCP B;  1STE A;  3IT6 B;  3TCA A;  3KUZ A;  1C78 A;  5D3D A;  4XYC A;  1SEB D;  2L32 A;  5LXH A;  1AWD A;  3L10 B;  3DOW A;  5DPW A;  5FR6 A;  1E8Z A;  1GC6 A;  4FJZ A;  2MCN B;  3VFK A;  2UU7 A;  2N1V A;  2EEL A;  2MW5 A;  1UH6 A;  4RF1 A;  4B0E A;  3D32 A;  4RFB A;  2M56 B;  4HPM B;  2LJI A;  3ZUN A;  2L8J A;  2Y3A A;  2NTT A;  1K51 A;  2C60 A;  1NVI D;  2MJD A;  1P1A A;  2MBH A;  2IND C;  3ZNI D;  4AWJ A;  1JWU D;  2R61 A;  1V8C A;  1VZ7 A;  2GLS A;  2KC1 A;  4NAW A;  3UF8 A;  2BYF A;  2KTR B;  2JZP A;  1P9D U;  5EE1 A;  3PLU A;  4YWG G;  1MG4 A;  3N3K B;  3N9Y C;  3H1U A;  3ZTC A;  5IAA C;  3AEB B;  1C76 A;  4WH4 A;  3CWI A;  5BYQ A;  2NS5 A;  3ZJU A;  4Q2J A;  4YL8 A;  3FIL B;  5G55 A;  1X1M A;  1N61 A;  1YN3 A;  4IG7 B;  2W3S A;  2HTM E;  1DOY A;  1WYW B;  1YN4 A;  3ONS A;  1I7H A;  1SE4 A;  5BO4 B;  1GB4 A;  3ZXV A;  2JT4 B;  4NY0 A;  2W82 A;  3AM9 A;  4ZDV A;  3DBH B;  3MJ5 A;  3QK0 A;  3QWZ B;  4R3D A;  2CU1 A;  3IBE A;  2Z0E B;  3LXF A;  4RF0 A;  4LDT B;  2DWQ A;  3SHQ A;  1FNU A;  2JX5 A;  2LI5 A;  1Q10 A;  2BKF A;  3AE2 B;  3VAW A;  2NBU A;  1ZGU B;  3N20 C;  3CSF A;  1AN8 A;  1C4C A;  1V1P A;  3DBH I;  3NZ3 A;  4GIV A;  4MGI E;  4ACF A;  1TKY A;  2I38 A;  3TEW A;  3QA8 A;  1CQV A;  3AEA B;  1WWT A;  4W9C A;  2GBR A;  4MT5 A;  4HPP A;  1Z5S B;  3UIP B;  3ZNH B;  2R2O A;  2G4D B;  2G3Q B;  2PVG C;  2G1E A;  1GPX A;  4CQN A;  2ZCC A;  2WX0 A;  2ZCB A;  3ABV B;  1Y56 A;  1JRU A;  3A9J B;  3BVZ A;  2DBY A;  1KLU D;  3GE8 C;  4HRS A;  2R2Q A;  1GNU A;  4S0R A;  4YXD B;  2G9H D;  4REZ A;  2WDT B;  3AE4 B;  3VH4 B;  3RNA C;  1I4Q A;  3DHG C;  1M94 A;  4EUT A;  4I6P A;  1YD8 U;  1F52 A;  2O2V A;  4LDT D;  1WX7 A;  2CHZ A;  2KDB A;  1S1Q B;  3ECI A;  3ZLZ A;  2B76 B;  1WX8 A;  4TV3 A;  3BWU D;  3PO0 A;  2N9P C;  1I4H A;  1RM6 C;  4XZ4 A;  3IFW B;  4JIO U;  2MJ3 A;  2PJH A;  1TZ1 A;  1MFW A;  4N6E B;  1JWM D;  4A8X C;  4WAF A;  2FE8 A;  4YSY B;  4ITK A;  3VXW A;  3DBL B;  3L16 A;  4GDL B;  2IGH A;  3DVN U;  3X0W A;  4N58 A;  3PHW B;  3TBL D;  3QIJ A;  4F8C B;  4L2Y A;  2IO1 B;  4ANU A;  3BYT B;  3KUD B;  4OVU A;  1PQS A;  4DK5 A;  5J18 A;  2ZNV C;  2KVR A;  1F0Z A;  3RT3 B;  3ALB A;  3H8H A;  4DDI D;  3RNE C;  4GDK A;  3Q8F A;  2BT6 A;  2BYE A;  3ZRC A;  4EFO A;  3DBL I;  5IKC M;  3R8B A;  4LLG M;  3RNG C;  4KGT A;  4CO7 A;  2KLC A;  4NAM A;  3EUB 2;  4OVZ A;  2KYW A;  2D3G A;  2KWU B;  2KNB A;  3ZW3 A;  2WXK A;  2INC C;  4BKS A;  1P7E A;  4KKI A;  4OZB A;  3VRB B;  1XD3 B;  3IG3 A;  4HWI B;  3PZ7 A;  1L7Y A;  2ZW0 A;  1V9J A;  4WWM A;  2LFI A;  1GAQ B;  4A3P A;  4FHJ A;  2BQQ A;  3AXC A;  2JWU A;  2NBW B;  2IDY A;  2J53 A;  2W55 A;  2DAF A;  1MVK A;  3N32 A;  2N7E A;  3I5J C;  4MEL A;  2AEH A;  1YOV B;  2DYB A;  1WGH A;  4GXB A;  1N6Z A;  2LEK A;  2N0S B;  2PTL A;  2JVC A;  1F1H A;  2W54 A;  2D3A A;  4US8 A;  3ZQ4 A;  4J3O D;  2HJ1 A;  3EFU A;  2N7D A;  2V9H A;  2DYM A;  5HFY A;  2WWZ A;  1UBI A;  3IVF A;  2FCS A;  4JLC A;  1F77 A;  1C1Y B;  3U7Z A;  3RCZ A;  4IWO A;  3OG5 A;  3RNF C;  3TEX A;  3Q6B A;  5CTR C;  2GBN A;  2JZZ A;  2JXT A;  2QIL A;  2RD0 A;  1TYG B;  2H89 B;  3VVW B;  2BVC A;  3PHX B;  1FCL A;  1ROE A;  2KJH B;  1OTR B;  1ZW7 A;  2IPK D;  4AJW A;  4HVB A;  2WXR A;  3L17 A;  5T8I A;  3WAM A;  2QIE B;  4C4V B;  1JQ4 A;  1IPG A;  1YIW A;  1TBE A;  2WXH A;  4XE0 A;  1VR9 A;  3KYD D;  2KWV B;  2MJE A;  1UWM A;  2PE9 A;  3PRE A;  1RLF A;  3QAR A;  3AU5 A;  4WJN A;  3P2B A;  3MHS D;  5FK9 C;  5HG2 A;  2K0P A;  2BW2 A;  3DBR I;  4OZA A;  1WYG A;  2FCQ A;  2UWQ A;  1E9M A;  1XQQ A;  1H8C A;  2D10 A;  5JH5 C;  5L95 C;  2N9L A;  3HM6 X;  2K6Q A;  3IT4 B;  1Q1O A;  5C3J B;  1TIF A;  2KWD A;  4ANV A;  4PK1 A;  2M0A A;  4RCO A;  3AB5 A;  2WU2 B;  4BOS C;  3ZYY X;  3DQV A;  2BPS A;  2M8S A;  3DHH C;  3MHZ A;  5BMG A;  3T3N A;  2LGX A;  2QDF A;  4FLH A;  4JX1 C;  1N5X A;  1QOF A;  2LVP A;  2KFK A;  4OVV A;  3AE6 B;  3TMP B;  3OLM D;  4GMV A;  1WM2 A;  1RYJ A;  4ARC A;  5EE3 A;  4GDL A;  2JY6 A;  4G3X B;  4LNI A;  1WMH B;  3O13 A;  1B9R A;  1E5W A;  2RPQ A;  1WR6 E;  2LUE A;  2MP2 A;  1M4V A;  3GE3 C;  1T0R C;  3GOE A;  5FR3 A;  2PE6 B;  2CJN A;  5HI1 A;  2GOW A;  2ZPN A;  3U52 E;  3WAO A;  4ZRI A;  1JAL A;  3PSE B;  4AQ7 A;  4HK2 A;  1Q5W B;  1SGH A;  4F7Z A;  3TSS A;  2INP E;  2DYO A;  3AUL A;  2W3R A;  3TEZ A;  4KSL C;  4DHZ B;  3NZS A;  5AZH A;  5J17 A;  1D5X C;  3QX1 A;  1EM7 A;  1XT9 B;  1WR1 A;  4P1B C;  3B08 A;  5H8Y E;  3HM3 A;  2UYZ B;  2ZZP B;  1L2N A;  4E3C A;  3AE7 B;  4LJP B;  5LNK 1;  2DZM A;  4PYZ A;  1Y8R C;  1S3S G;  5AUI A;  3R7R A;  2KQS A;  4C80 A;  3P42 A;  4TSS A;  3ZJV A;  2L00 B;  1UD7 A;  4AJY B;  4W9G A;  5AZF A;  2LGS A;  4N9F 4;  3IAS 1;  3ZKJ C;  4DBG A;  3MC9 A;  5KHQ A;  1TKG A;  3S2A A;  3VH3 B;  1TJE A;  1FFV A;  1F2R C;  1FO4 A;  3EHV A;  3W2D A;  4K7U A;  1XLO A;  2WXL A;  1C79 A;  1WE7 A;  4M00 A;  3RD2 A;  3RPF C;  2MBE A;  4HDO A;  2LVO A;  3QQ8 B;  1JWB D;  2ZNV B;  4A20 A;  1FXI A;  4B95 A;  3VRA B;  4C00 A;  5C2T B;  3RNC C;  1V5T A;  2HD5 B;  4P16 A;  2LXA A;  3M95 A;  1IBX A;  2O6V A;  3CMM B;  2KDE B;  1OQY A;  1YQB A;  1OGW A;  3GZN I;  4JWU C;  3ZDT A;  2SAK A;  2BB5 A;  1R4N B;  2FBW B;  1JW9 D;  4YSZ B;  4MEM A;  2V3P A;  1E7U A;  4WQO B;  1IUE A;  1E10 A;  3EC8 A;  2G45 B;  4KV2 A;  3PRZ A;  2GRI A;  3R2T A;  1ENF A;  2MEK A;  2LHD A;  3GS2 A;  5BYS A;  4ZYN A;  1PDX A;  4ZYS A;  2Z0D B;  2BYT A;  2CR5 A;  4KIK A;  3UQB A;  1G6J A;  2IO3 B;  2LVQ A;  4A9A A;  3AEF B;  1R4N I;  2BS4 B;  4W9L A;  1FRD A;  2M19 A;  4USA A;  2KDM A;  2AQ1 B;  3FAH A;  1TS5 A;  4MAC A;  1ZXI A;  1RFK A;  1SXT A;  2IGG A;  4YTN B;  4ICV A;  3B1L X;  1VZ8 A;  1K50 A;  2L1A A;  4AOF A;  1N62 A;  3CF6 E;  2KHW B;  2OED A;  4MH8 A;  4KZ0 A;  2BB6 A;  4YSX B;  5E6N A;  3J9C A;  2VH2 A;  1LGR A;  2NPT B;  1K8R B;  1UF0 A;  4E74 A;  4FJY A;  5DCN A;  5EDS A;  1P0R A;  5BMH A;  1XLN A;  4GSW A;  3NUH B;  3P4S B;  2KX3 A;  3JW0 X;  4HKZ E;  5H92 C;  4H2A A;  3KWV A;  4IWP A;  2K39 A;  3PPA A;  2XEW A;  2XK5 B;  1WXM A;  1YJI A;  3OWE B;  1SF0 A;  4UDU C;  2BKR B;  4DWF A;  2PPH A;  1WGK A;  3VR8 B;  5AEK B;  2FUH B;  2KVZ A;  5KHO A;  1WIA A;  1FIQ A;  1N63 A;  4TUU A;  4RMA A;  3T8M A;  1NI2 A;  1L4Z B;  1SJE D;  2X38 A;  4YT0 B;  3PRP B;  1C9F A;  4K3C A;  1WMH A;  1XF5 L;  1IGC A;  2J0K A;  2M17 A;  2H88 B;  3H7S A;  2QMT A;  1WGR A;  2ON8 A;  3JSV B;  1N5W A;  1YMH E;  2MQJ A;  1DYQ A;  4NJ6 A;  2KQ7 A;  3BVG A;  3CIR B;  2D2Q A;  3VUW A;  4BVU C;  4A90 A;  4I6N B;  1E7V A;  4BKG A;  1C4A A;  2KAN A;  4WJO A;  5I4D A;  3RUL A;  2OHF A;  1T3Q A;  1WF9 A;  2DAJ A;  1E0Z A;  2LD9 A;  2WXF A;  3SU8 X;  2EKI A;  2WXQ A;  4PT5 A;  4W9D A;  5D94 A;  4GOC A;  3V6E B;  2MX2 A;  1WI0 A;  4ARI A;  1F9J A;  2C5L C;  3AED B;  1UUP A;  2PVO D;  2QHO A;  1GB1 A;  1WXS A;  3UQA A;  2OJR A;  5GMV A;  1WXA A;  1J8C A;  2VRR B;  1WZ3 A;  2K25 A;  3H7P B;  2C7H A;  2FIF A;  3PVL A;  1VLB A;  4LNF A;  3TJP A;  5IP4 D;  3U2S C;  1T5X D;  4KGS A;  2BBC A;  2NBV B;  3B0A A;  3ZXR A;  3LYY A;  1OQR A;  1OEY A;  1VD2 A;  2K3U A;  4P7I A;  2ZW1 A;  2AQ2 B;  3Q69 A;  1TS3 A;  2CS4 A;  1QKZ A;  3Q8A A;  1R7S A;  3LJ3 A;  2J7Q B;  1EF5 A;  3I63 C;  2WXP A;  4II3 B;  2IGD A;  2D3B A;  5G5H A;  3WAN A;  3PT2 B;  3K9P B;  2MA9 B;  2KD0 A;  3M63 B;  4KSK C;  1U4A A;  5JZE B;  4A55 A;  2WLB A;  3Q8C A;  1NI3 A;  1XCQ L;  4AUQ C;  2ONQ A;  4KX6 B;  3SEB A;  2W9N A;  4EOY A;  1MPE A;  3OAW A;  1WFY A;  3V05 A;  1EF1 A;  4FAD A;  1HQR D;  1E8W A;  2WXJ A;  5IN7 A;  4G0N B;  4GB9 A;  1WX9 A;  3IAM 1;  1SE2 A;  3DWM A;  2RGF A;  1JRP A;  1E6E B;  3Q3O C;  2ZVO A;  3W1S A;  3BVM A;  3AH7 A;  1IYF A;  1ESF A;  5LXI B;  1TTN A;  3WAL A;  2QCZ A;  1XCT L;  4BBN C;  3UGB B;  4IKG A;  1WJU A;  2BWE S;  2D07 B;  1LO5 D;  1JCK B;  3Q8B A;  2FUG 1;  2IJ0 A;  3WA0 A;  4HJG E;  1BXT A;  1SIJ A;  4IOI E;  2N1W A;  1KJT A;  4FA6 A;  2BYV E;  1P7F A;  2N7J A;  3MC0 B;  1LXD A;  1DOX A;  3QAQ A;  2V0G A;  4P6V F;  4W9H A;  2A4Z A;  4HXD A;  5GXG B;  2ASQ A;  2GBK A;  4G50 A;  1KF6 B;  3ML8 A;  4IWQ A;  4HCN B;  4AS1 A;  4IUM B;  4BBN F;  3H6N A;  3P63 A;  1MHX A;  1MJD A;  3N1Y C;  3Q3M C;  2KTR A;  4XGA B;  1F2R I;  2AX5 A;  2JSV X;  2KLG A;  3QC8 B;  2WXG A;  3BYY B;  1PFD A;  1I4R A;  1YJ1 A;  2DX5 B;  2WDR B;  1SSN A;  2JU6 X;  2K8H A;  3LDZ E;  2K6D B;  1J7B A;  2Y5C A;  1KFY B;  3Q8E A;  3DWG C;  2L83 A;  3AEC B;  3FIL A;  1E8Y A;  2MHJ A;  4L1B A;  4TQ1 A;  2JYE A;  2VH1 A;  1MG8 A;  3AEG B;  2PKO A;  3KLS X;  1ZKH A;  5DPR A;  2LRW A;  1C4P A;  2MBB B;  1WJ6 A;  1L0Y B;  1J7C A;  3JVZ X;  4RGM A;  2LAS A;  2KN5 A;  2CHW A;  2LJ5 A;  1HZ5 A;  4AP4 C;  1MHH E;  1FMA D;  1WH3 A;  1UGJ A;  3ZVV A;  4KDI C;  3KYC D;  4ZRJ A;  5E6J A;  3O65 B;  2GBJ A;  2FCM A;  1OQQ A;  1KLV A;  4MM3 B;  2KJR A;  1ET6 A;  1QQR A;  4DXF A;  1WJN A;  5TSS A;  2FID A;  2WXN A;  3DBR B;  1ET9 A;  1EU4 A;  4MJS B;  3BII D;  4BKT A;  2BS3 B;  3KWL A;  1TZO A;  2XNA C;  4CHK A;  3I3T B;  3H7P A;  2D3C A;  1JML A;  2I1K A;  2DEN B;  4F1S A;  1OEY J;  2WU5 B;  2YEP F;  4GU2 A;  4HPL B;  3A9J A;  4JQW C;  5E6P A;  3V62 A;  4KKJ A;  3N1X C;  2QEJ C;  3DVN V;  2MWS B;  2JUO A;  1P98 A;  2YLM A;  2KMC A;  2OOB B;  2GBM A;  4LNK A;  1QOA A;  2VZK B;  1Q0W B;  1UWX A;  1MI0 A;  3E9S A;  4HEA 1;  2DZI A;  4K7W A;  5IOI A;  2LZ6 A;  2KMA A;  5G5G A;  2KTF A;  1V1O A;  3K9O B;  4MSQ B;  3U7D A;  3ZNZ B;  4IDI A;  1GG3 A;  1NEN B;  4TQ0 A;  4CYE A;  1LQB A;  5D3I B;  3ZDM C;  3Q2A C;  1YX5 B;  4XC2 A;  1VRA B;  1WSP A;  4NAW B;  5JXV A;  3WCQ A;  3A4S C;  3UIN B;  2AYO B;  4RGT A;  2DLB A;  3TIX A;  3V61 A;  4P1C C;  4GGQ A;  4WWP A;  2GI9 A;  2MLB A;  3APF A;  2FCN A;  3PRM B;  3ENE A;  2KAJ A;  3R2I A;  5D7G A;  4DXA B;  3DVG Y;  4X57 B;  2L52 A;  2VZK D;  2DZJ A;  2JWZ A;  2KOX A;  3A1Q B;  1PGB A;  1V6E A;  3ZO5 B;  3T9L A;  5L83 A;  3NOB A;  3C19 A;  4RM8 A;  3A33 B;  1D3Z A;  4OZC A;  3E56 A;  3W9C B;  2QSD A;  2INN E;  4A6Q A;  4N59 A;  4NJC A;  5AUK A;  1QLB B;  4LJO B;  4WJP A;  1D4B A;  2ZVN A;  3AEE B;  1V1P B;  3RZW C;  2CHX A;  5TR5 A;  1C3T A;  4M02 A;  4HDQ A;  1TGZ B;  1V49 A;  4DHZ E;  3MP9 A;  4MGZ E;  2PLP A;  2LXC A;  1WRD B;  2AQ3 B;  3NJT A;  3N30 A;  3DHI C;  4IM3 A;  2XN9 C;  2WX1 A;  2NCN A;  4XDD A;  3PZ8 A;  4D2K A;  4K7S A;  4HRO A;  3EA6 A;  4WUR A;  1RWS A;  4MH0 E;  3GZN B;  1I35 A;  1CZP A;  4US9 A;  3QCA A;  3PTF C;  5CHV C;  2ZPY A;  3U8Z A;  1WGG A;  4ANX A;  3GP7 A;  4EE2 A;  2MBQ A;  5EE9 A;  4XX5 A;  1QIL A;  2JQR B;  2O2V B;  2KWC A;  1AAR A;  1QOG A;  1AW7 A;  1AYF A;  1TS4 A;  2NMQ A;  1UNS A;  3RYT A;  5AZG A;  3GB1 A;  4TMA B;  3VUX A;  2JF5 A;  1FM0 D;  2B3A A;  1B1Z A;  4EZK A;  4W9F A;  3ETR A;  3V3X A;  5DPS A;  4MM3 A;  2L0F A;  2L0T A;  2V3S A;  3PGE A;  3I9V 1;  1T0S C;  2LRU A;  2RR9 A;  5CHF A;  1SE3 A;  3A4R A;  1A70 A;  2WS3 B;  4C4V A;  3P4P B;  3BK2 A;  2WNM A;  3Q14 C;  2IO2 B;  1FPY A;  2V3N A;  3EFC A;  4C7Z A;  1PGX A;  3AE8 B;  1WGY A;  3DBS A;  2K5P A;  2WP9 B;  4BZA A;  1NDD A;  1J7A A;  3NVZ A;  2WXO A;  2GMI C;  1LM8 B;  4GDK B;  1ZE3 D;  4W9J A;  4W9E A;  5HKH A;  3ZJT A;  1WY8 A;  3R66 C;  1FXA A;  3FKY A;  2L05 A;  4B9K A;  2Q5W D;  1ISN A;  3M62 B;  3IXS A;  4NNJ B;  3TEY A;  4YTM B;  2EMS A;  4MGK E;  1NBF C;  4KDL B;  1KM7 A;  3KH0 A;  1QT9 A;  2QJL A;  4M01 A;  3R7Q A;  2CU3 A;  1T0Q C;  3SR6 A;  4FUL A;  1ACC A;  2YEP B;  3DPD A;  2EMT A;  1I4X A;  1JWA D;  2RDG A;  1K52 A;  3PV1 A;  3AE3 B;  1IP9 A;  2N9X A;  2K9X A;  2LGI A;  2C9W B;  3VR9 B;  5J2R A;  2KAC A;  3AE9 B;  2KXJ A;  4C7Y A;  1HTO A;  2KT7 A;  3Q3N C;  5JHB A;  2IYD B;  3UI3 A;  3WIM A;  4ANW A;  1GJZ A;  2XBB C;  2KFJ A;  3A1Q A;  1E8X A;  3C8Y A;  2KDF B;  3W5U B;  2C7N B;  3CST A;  3KW5 B;  3ZRF A;  1FD6 A;  4JWS C;  4II2 B;  3NRZ A;  2K1F A;  3L54 A;  4LTU A;  1WGD A;  4BKS D;  4LCD E;  2KKC A;  4FJV B;  3PLV A;  1C77 A;  3APD A;  3VTU A;  2J0M A;  5EE0 A;  2K8C A;  3RFZ B;  5IO9 A;  1SJH D;  2DZK A;  3HRD D;  4ASW C;  1D6E C;  1YN5 A;  2REX A;  1XXG A;  4B0M A;  3HHM A;  1D5M C;  2ACZ B;  1TT5 B;  3MC8 A;  4NQK E;  2IBI B;  3ML9 A;  1RRB A;  4O1N A;  1DGJ A;  2J42 A;  1WXV A;  3QHT A;  2RPV A;  2NVU I;  1J19 A;  1PYW D;  5G2N A;  3V60 A;  2LGY A;  3NS8 A;  2FNJ B;  5E6O A;  1FXT B;  4M0W B;  1KOT A;  1VJK A;  4FXC A;  3TL5 A;  3ZGZ A;  4A3O A;  5C23 A;  1XLP A;  2M1M A;  2PMV A;  1RFA A;  3RMK C;  2IY0 B;  1J0G A;  3RNB C;  1EU3 A;  5CHW A;  3HUI A;  1I4G A;  4K81 A;  3SFE B;  4WWO A;  3Q3J A;  2JRH A;  4ZHO A;  4PYU A;  1FNW A;  4JGH B;  2QC8 A;  3BK1 A;  4YTP B;  4OW0 A;  1HTQ A;  4M8M A;  2N4F A;  4EZL A;  4ZRP A;  3NZU A;  2LUM A;  2Y5P A;  4BAX A;  1JWS D;  1K53 A;  2KFK B;  3JYU A;  4XWT A;  2M4N A;  3FC4 A;  3SFD B;  2IZV B;  4RM9 A;  1TY2 A;  1NYQ A;  4DQO C;  5BMI A;  2WDV B;  4XWW A;  3BZD B;  3W5V B;  1H4R A;  1YNT E;  2KMM A;  2PIA A;  1ZXH A;  4RGN A;  1UEL A;  2KN4 A;  1V5O A;  4WQM A;  3TUO A;  2K22 A;  2MP2 B;  3VTV A;  1HEZ E;  2Z59 B;  3OJ4 B;  2L76 A;  3DCG A;  4HKQ A;  3BIN A;  2MH7 A;  2FAZ A;  2NPT A;  2KC2 A;  2J52 A;  1HE8 A;  2DHZ A;  1KTK A;  1BT0 A;  1DOI A;  4ZOH C;  4G11 A;  2JRI B;  3APC A;  3NY5 A;  2G4S A;  4NJ7 A;  2I2Y A;  4GN1 A;  1L6V A;  1WZ0 A;  4RH6 A;  2AL6 A;  1V86 A;  5IA7 A;  2RMM A;  2LGD A;  2V1Y A;  3HIZ A;  2XK5 A;  1VZ6 A;  1SBB B;  1A5R A;  3PS6 A;  4GLS C;  1YJJ A;  3HVD A;  4B6W A;  3W1S C;  3AU4 A;  3NHE B;  3R3M A;  1YX6 B;  2HDE A;  4IW0 A;  2HE7 A;  3MFG A;  1VDV A;  2BWF A;  2PEA A;  3VHT C;  1OFF A;  1UZX B;  1EWY C;  1E90 A;  2L3Z A;  2WDQ B;  3ZIM A;  1XO3 A;  4KZC A;  1TKE A;  2ZJD A;  1V80 A;  2SEB D;  4M8N A;  2RDB C;  3B9J A;  4JE3 B;  4IM0 A;  1SE9 A;  2LWP A;  2JZ3 B;  3I57 A;  2EKE C;  4WWN A;  5C1Z A;  3NVV A;  3DVG X;  1UGM A;  2I1J A;  3AI5 A;  4L23 A;  1IGD A;  3JSV A;  3N1Z C;  3MTN B;  2KJ6 A;  3U4E G; 
#chains in the Genus database with same CATH homology
 2KOX A;  3A1Q B;  1EO6 A;  2WDT B;  4DHJ B;  3CF6 E;  1V6E A;  2KHW B;  5DPT A;  2J0J A;  3VH4 B;  4KZ0 A;  4NQL B;  1M94 A;  3ZO5 B;  3T9L A;  4EUT A;  5L83 A;  4I6P A;  5E6N A;  1YD8 U;  2O2V A;  4LDT D;  2NPT B;  1WX7 A;  3NOB A;  4RM8 A;  2CHZ A;  3A33 B;  1K8R B;  2KDB A;  3ZTD A;  1D3Z A;  4E74 A;  4FJY A;  1S1Q B;  5DCN A;  5EDS A;  3ECI A;  1P0R A;  3ZLZ A;  4ICU A;  4JL9 A;  4GSW A;  1WX8 A;  4TV3 A;  2KX3 A;  3JW0 X;  3HK0 A;  2RSU A;  2N9P C;  2O6V B;  1RAX A;  4IWP A;  4LJO B;  3ZNG C;  2K39 A;  3PPA A;  4WJP A;  4XZ4 A;  4FBJ B;  3C0R B;  2XEW A;  2ZVN A;  3IFW B;  2XK5 B;  4JIO U;  1WXM A;  2PJH A;  1TZ1 A;  2BGF A;  3RZW C;  2CHX A;  5TR5 A;  1C3T A;  2BKR B;  4DWF A;  1V81 A;  4HDQ A;  2PPH A;  3A9K B;  2CKH B;  1TGZ B;  1V49 A;  4DHZ E;  4MGZ E;  2K8B A;  3U30 A;  5AEK B;  2FUH B;  2LXC A;  3M3J A;  5KHO A;  3VXW A;  1WIA A;  3L16 A;  1WRD B;  4GDL B;  3DVN U;  3X0W A;  4TUU A;  3PHW B;  3SDL C;  4RMA A;  3TBL D;  3QIJ A;  3T8M A;  1NI2 A;  3N30 A;  4IM3 A;  4F8C B;  4KIK B;  2IO1 B;  4WJQ A;  3VUY A;  4ANU A;  1I42 A;  1V2Y A;  2WX1 A;  3KUD B;  4OVU A;  2NCN A;  1PQS A;  3PRP B;  2AWT A;  4DK5 A;  1WMH A;  5J18 A;  2ZNV C;  4K7S A;  2KVR A;  3RT3 B;  3ALB A;  4DDI D;  2J0K A;  2M17 A;  4GDK A;  4MH0 E;  3H7S A;  1I35 A;  1WGR A;  4DHJ D;  2BYE A;  3ZRC A;  4EFO A;  1Z2M A;  3W1Y A;  3JSV B;  3QCA A;  3DBL I;  1CMX B;  3PTF C;  1SIF A;  2MQJ A;  5CHV C;  4NJ6 A;  4W9K A;  2KQ7 A;  2ZPY A;  3U8Z A;  4BFR A;  1WGG A;  3L13 A;  4ANX A;  4CO7 A;  2KLC A;  2KZR A;  1P3Q U;  2D2Q A;  2MBQ A;  3VUW A;  4BVU C;  4XX5 A;  4I6N B;  2KWU B;  2D3G A;  2MRP A;  1E7V A;  2BF8 B;  2O2V B;  2KNB A;  4BKG A;  2KWC A;  1AAR A;  2KAN A;  4WJO A;  3L0W B;  3ZW3 A;  3RUL A;  2N9E B;  3RYT A;  2O6V D;  3EEC A;  5AZG A;  1WF9 A;  2DAJ A;  2LD9 A;  2KDI A;  3VUX A;  1VCB A;  2JF5 A;  3L08 A;  4KVG B;  2YVC A;  4BKS A;  3SU8 X;  2B3A A;  1XD3 B;  3IG3 A;  4W9D A;  4HWI B;  5D94 A;  4EZK A;  4GOC A;  4W9F A;  3V6E B;  2MX2 A;  1WI0 A;  3KVF B;  1F9J A;  1L7Y A;  5DPS A;  4MM3 A;  2C5L C;  2L0T A;  2L0F A;  1V9J A;  2V3S A;  3PGE A;  3V6C B;  4A3P A;  2LRU A;  2QHO A;  2RR9 A;  1WXS A;  3UQA A;  2IO0 B;  5CHF A;  2OJR A;  3A4R A;  1WXA A;  5GMV A;  1J8C A;  1EUV B;  4FHJ A;  3UIO B;  2VRR B;  1WZ3 A;  2K25 A;  3AXC A;  3OJ3 A;  3H7P B;  3X23 A;  2C7H A;  2FIF A;  3PVL A;  2NBW B;  2DAF A;  2IO2 B;  3MJW A;  3N32 A;  2N7E A;  3TJP A;  1WGY A;  4MEL A;  3DBS A;  2WYQ A;  2AEH A;  2DYB A;  3VDZ A;  1WGH A;  1WE6 A;  2NBV B;  4GXB A;  4EKU A;  3B0A A;  1NDD A;  4EEW A;  3WAP A;  2JVC A;  2JPH A;  2L7R A;  3BY4 B;  1OEY A;  1VD2 A;  2GMI C;  3EFU A;  2NR2 A;  1LM8 B;  4GDK B;  1WM3 A;  2N7D A;  4P7I A;  4W9J A;  2IY1 B;  2KK8 A;  4W9E A;  2CS4 A;  2A5U A;  2DYM A;  5HKH A;  3LJ3 A;  1WY8 A;  2J7Q B;  3R66 C;  1EF5 A;  3SD5 A;  2L05 A;  4URK A;  4B9K A;  2WWZ A;  1ISN A;  1UBI A;  3IVF A;  3VQI A;  3M62 B;  4II3 B;  2FCS A;  4NNJ B;  3WAN A;  4JLC A;  5CX3 A;  2EMS A;  2MBO A;  3PT2 B;  1C1Y B;  2ZEQ A;  4BOZ B;  4MGY E;  3K9P B;  2MA9 B;  3RCZ A;  2C7M B;  4IWO A;  2KD0 A;  3M63 B;  4KSK C;  4MGK E;  1NBF C;  4KDL B;  3PZD A;  1U4A A;  1KM7 A;  5JZE B;  3KH0 A;  4IC7 B;  5CTR C;  2GBN A;  2JZZ A;  3VTW A;  4E71 A;  4AUQ C;  2RD0 A;  4NPN A;  3R7Q A;  2W9N A;  4EOY A;  3VVW B;  1R4M I;  5D2M B;  5JHA A;  2AL3 A;  3PHX B;  3OAW A;  2HTH A;  2KO3 A;  4FUL A;  2KJH B;  1GC7 A;  1OTR B;  1WFY A;  1EF1 A;  1ZW7 A;  4FAD A;  4AJW A;  3DDC B;  4HVB A;  1E8W A;  3L17 A;  4HJK A;  3WAM A;  3DPD A;  2EMT A;  4G0N B;  4GB9 A;  1WX9 A;  1GUA B;  1IPG A;  2RGF A;  1YIW A;  1TBE A;  3PV1 A;  3KYD D;  1T0Y A;  2ZVO A;  3W1S A;  3H9D A;  2KWV B;  3Q3F A;  4TKN A;  2PE9 A;  1IP9 A;  1IYF A;  2N9X A;  3PRE A;  1RLF A;  2C9W B;  3QAR A;  5LXI B;  2Y5B B;  1TTN A;  3RUI B;  3WAL A;  3AU5 A;  5J2R A;  2D11 A;  4WJN A;  3P2B A;  4MDK E;  4ZRK A;  4BBN C;  3MHS D;  3KUC B;  4I6L B;  3UGB B;  2KXJ A;  1WJU A;  2BWE S;  2D07 B;  4EZJ A;  3DBR I;  4FHK A;  3IHP C;  2FCQ A;  2M0X A;  4K1R B;  2IYD B;  3SHQ A;  2UWQ A;  5D6J B;  5JHB A;  3WIM A;  1XQQ A;  4ANW A;  2XBB C;  4MSM B;  1GJZ A;  1H8C A;  3WA0 A;  2D10 A;  2KFJ A;  3A1Q A;  5JH5 C;  1E8X A;  4PS7 A;  3RZF A;  5L95 C;  4WAA A;  2KDF B;  3HM6 X;  2K6Q A;  2C7N B;  3CST A;  3KW5 B;  1Q1O A;  1KJT A;  2N1W A;  3ZRF A;  4FA6 A;  2BYV E;  2MSE D;  4FN2 A;  4DDG D;  1LXD A;  1UBQ A;  3QAQ A;  4II2 B;  4PS3 A;  4ANV A;  2K1F A;  4W9H A;  2A4Z A;  4HXD A;  3L54 A;  2V4L A;  2ASQ A;  1WJ4 A;  1WGD A;  4IM2 A;  4BKS D;  4LCD E;  4BOS C;  2GBK A;  2JXX A;  4G50 A;  2KX0 A;  2KKC A;  3ML8 A;  4IWQ A;  4HCN B;  3DQV A;  4FJV B;  3PLV A;  4IUM B;  2BPS A;  4BBN F;  2M8S A;  5LLI A;  3APD A;  3VTU A;  3H6N A;  2J0M A;  2JWZ A;  4J6I A;  2LGX A;  2K8C A;  4FLH A;  2DZK A;  2KTR A;  2LVP A;  4ASW C;  4MJS A;  2REX A;  2KLG A;  2KFK A;  3QC8 B;  3HHM A;  4OVV A;  1LFD A;  3TMP B;  3A9K A;  3OLM D;  3QJZ A;  4W9I A;  4HLE A;  4PS8 A;  4GMV A;  1WM2 A;  1QZE A;  1YJ1 A;  2DX5 B;  2HJ8 A;  4NQK E;  4HCP B;  2IBI B;  3ML9 A;  1RRB A;  4GDL A;  2JY6 A;  3TCA A;  3KUZ A;  2K8H A;  4G3X B;  1WXV A;  3QHT A;  1WMH B;  2NVU I;  3LDZ E;  2K6D B;  1J19 A;  5LXH A;  1E5W A;  3L10 B;  2RPQ A;  3DOW A;  5G2N A;  5DPW A;  1E8Y A;  2LGY A;  3V60 A;  3NS8 A;  1WR6 E;  2FNJ B;  2LUE A;  5FR6 A;  5E6O A;  1FXT B;  1E8Z A;  2MP2 A;  1GC6 A;  4TQ1 A;  4M0W B;  4FJZ A;  2MCN B;  3GOE A;  3VFK A;  1KOT A;  2PE6 B;  1MG8 A;  2GOW A;  3TL5 A;  2ZPN A;  2N1V A;  1ZKH A;  4A3O A;  3WAO A;  5DPR A;  2LRW A;  5C23 A;  2MW5 A;  2MBB B;  4ZRI A;  1WJ6 A;  1UH6 A;  2M1M A;  3PSE B;  4HK2 A;  1Q5W B;  1RFA A;  2IY0 B;  1SGH A;  3JVZ X;  3D32 A;  2LAS A;  4F7Z A;  1J0G A;  2KN5 A;  2CHW A;  2LJ5 A;  4AP4 C;  4HPM B;  2DYO A;  1WH3 A;  3ZUN A;  3AUL A;  2L8J A;  5CHW A;  4KSL C;  3ZVV A;  4K81 A;  4DHZ B;  3NZS A;  4WWO A;  5AZH A;  4KDI C;  2C60 A;  5J17 A;  3KYC D;  3QX1 A;  4ZRJ A;  1XT9 B;  3Q3J A;  3O65 B;  2GBJ A;  1WR1 A;  1P1A A;  2JRH A;  3B08 A;  2FCM A;  2MBH A;  1KLV A;  3HM3 A;  3ZNI D;  4AWJ A;  2UYZ B;  2ZZP B;  2KJR A;  1L2N A;  4E3C A;  4PYU A;  4JGH B;  4LJP B;  1WJN A;  2FID A;  2DZM A;  2KC1 A;  4NAW A;  4PYZ A;  3UF8 A;  4M8M A;  2BYF A;  2KTR B;  1Y8R C;  2N4F A;  4EZL A;  1P9D U;  1S3S G;  3NZU A;  4MJS B;  3R7R A;  2KQS A;  3PLU A;  4BKT A;  2KFK B;  3JYU A;  2M4N A;  2L00 B;  4CHK A;  1UD7 A;  2IZV B;  3I3T B;  3N3K B;  3H7P A;  4AJY B;  3H1U A;  4RM9 A;  3ZTC A;  4W9G A;  2I1K A;  5IAA C;  5AZF A;  2DEN B;  4F1S A;  1OEY J;  4N9F 4;  4GU2 A;  4HPL B;  3A9J A;  4JQW C;  3ZKJ C;  5E6P A;  4DBG A;  5KHQ A;  3V62 A;  1H4R A;  3DVN V;  2MWS B;  2JUO A;  3S2A A;  1UEL A;  2NS5 A;  1V5O A;  4YL8 A;  3VH3 B;  1P98 A;  1X1M A;  5G55 A;  2YLM A;  2KMC A;  4IG7 B;  2OOB B;  2GBM A;  3EHV A;  2MP2 B;  3VTV A;  2Z59 B;  3OJ4 B;  1WYW B;  2L76 A;  3DCG A;  3ONS A;  4K7U A;  5BO4 B;  1WE7 A;  2JT4 B;  4NY0 A;  3RD2 A;  1Q0W B;  4ZDV A;  3BIN A;  2MBE A;  4HDO A;  2LVO A;  3QQ8 B;  3QK0 A;  3QWZ B;  2FAZ A;  2NPT A;  2ZNV B;  2KC2 A;  4A20 A;  4B95 A;  2CU1 A;  1HE8 A;  3IBE A;  2DHZ A;  2DZI A;  1BT0 A;  2Z0E B;  4K7W A;  4G11 A;  2JRI B;  3APC A;  1V5T A;  2G4S A;  2HD5 B;  2KMA A;  2KTF A;  2LZ6 A;  3NY5 A;  4LDT B;  2LXA A;  3K9O B;  3M95 A;  4GN1 A;  4MSQ B;  4NJ7 A;  3U7D A;  2LI5 A;  1WZ0 A;  2AL6 A;  2BKF A;  3VAW A;  3ZNZ B;  1V86 A;  2O6V A;  3CMM B;  1GG3 A;  5IA7 A;  2NBU A;  2LGD A;  1ZGU B;  2V1Y A;  2KDE B;  3HIZ A;  1OQY A;  1YQB A;  1OGW A;  3GZN I;  2XK5 A;  3ZDT A;  3CSF A;  4TQ0 A;  4CYE A;  3DBH I;  4GIV A;  3PS6 A;  1LQB A;  1A5R A;  4MEM A;  4MGI E;  3ZDM C;  1E7U A;  4B6W A;  1YX5 B;  3W1S C;  4XC2 A;  3AU4 A;  4WQO B;  3EC8 A;  3NHE B;  3R3M A;  3QA8 A;  2G45 B;  4KV2 A;  3PRZ A;  4NAW B;  1YX6 B;  4IW0 A;  2HE7 A;  4W9C A;  4ZYN A;  3A4S C;  3UIN B;  2GBR A;  2AYO B;  2BWF A;  2PEA A;  3VHT C;  1Z5S B;  3UIP B;  3ZNH B;  1UZX B;  1E90 A;  2L3Z A;  2R2O A;  2G4D B;  2G3Q B;  2Z0D B;  2CR5 A;  3ZIM A;  4KIK A;  3TIX A;  3UQB A;  1G6J A;  2IO3 B;  4KZC A;  3V61 A;  2LVQ A;  2ZJD A;  4GGQ A;  4WWP A;  2ZCC A;  2WX0 A;  2ZCB A;  1R4N I;  1V80 A;  2MLB A;  3APF A;  4W9L A;  2FCN A;  3PRM B;  4M8N A;  1JRU A;  3A9J B;  4IM0 A;  1SE9 A;  3ENE A;  2LWP A;  2JZ3 B;  4WWN A;  2EKE C;  5C1Z A;  3DVG X;  1UGM A;  5D7G A;  3DVG Y;  4X57 B;  4DXA B;  2I1J A;  4ICV A;  2R2Q A;  3AI5 A;  3B1L X;  1GNU A;  3JSV A;  2DZJ A;  3MTN B;  2KJ6 A;  4AOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...