3EFCA

Crystal structure of yaet periplasmic domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
327
structure length
327
Chain Sequence
GFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor yaeT
publication title Crystal structure of YaeT: conformational flexibility and substrate recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 72
structure length 327
sequence length 327
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA04
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA03
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA01
2QCZA 3Q6BA 4BZAA 4PK1A 4QAYA 4K3BA 4C00A 4C4VA 4K3CA 3OG5A 4C4VB 3MC8A 2QDFA 2X8XX 2VH2A 4XGAB 3EFCA 3NJTA 2MHJA 2V9HA 2VH1A 3MC9A
chains in the Genus database with same CATH superfamily
3AEFB 4BAXA 2L05A 3FAHA 3MHSD 4C7ZA 1M94A 4BBNF 1TKGA 3BY4B 2GBKA 2NBUA 2Y5BB 4GDLA 2N7DA 3P1MA 3T3NA 1TS3A 1C76A 2L7RA 4ZRIA 4JX1C 5D94A 1RFAA 3AE4B 1GNUA 4NY0A 1YJ1A 1L4ZB 2WNMA 4M0WA 2PKOA 1FCLA 1HTQA 3UIPB 3KLSX 3MFGA 1V1OA 2KX0A 4BOSC 3U2SC 4XZ4A 4DBGA 3DBHB 4MH0E 1MJDA 1FD6A 3IHPC 3U30A 4ITKA 3WIMA 1PGBA 4S17A 1MPEA 4TKNA 4X57B 4AQ7A 3V62A 2FUG1 5C2TB 4FJZA 3ZKJC 2JRHA 3X0WA 1L0XB 3Q3NC 3ZRCA 2MEKA 4KVGB 4DXGA 1KJTA 2D07B 2ZW0A 1XF5L 1HA5A 2WXKA 1YD8U 1WM3A 1N61A 3Q3MC 4YSYB 3DBLB 2K39A 2KAJA 4RM8A 3WALA 1WIAA 3PHXB 2K5PA 1UELA 2LJIA 1P3QU 2KMAA 1UGJA 2PJHA 2JWUA 1R4NI 3SDLC 3FILA 4ZDVA 3ZQ4A 4HXDA 4YTNB 1UD7A 4PYUA 1WXMA 1MG4A 3GP7A 1D3ZA 5HFYA 1XCQL 4HKQA 3BINA 2WXNA 2ZW1A 4I6PA 3PTFC 1I4PA 1VCBA 2NVUI 1WE6A 1F2RI 2WU5B 2KC2A 3R7RA 2Z8LA 1JROA 4K1RB 4LCDE 4TUUA 2JX5A 4KDIC 4KGSA 2K6QA 4N58A 3B2FA 1V80A 3AE1B 2PTLA 4HCNB 2EMTA 3AI5A 5T8IA 4MT5A 1I4GA 2YLMA 5AZFA 3A1QB 1DOYA 2RMMA 2OJRA 2G45B 3ENEA 3OLMD 2V3SA 2K6DB 4NNJB 2JZPA 2LASA 4KIKB 2HTME 2IO0B 3OWEB 5CHWA 3U4EG 4OVVA 1HTOA 5MPOA 3RULA 1TS4A 3A4SC 5BMHA 3RYTA 3W1YA 3OG5A 5GMVA 2KJRA 3L08A 1NI2A 5EE0A 1E0ZA 3DPDA 1I42A 4P1CC 3ETRA 1TT5B 3CMMB 3KQ4A 2LI5A 4KGTA 1JMLA 3B1LX 4J3OD 2Y5CA 2I2YA 3N20C 3RNEC 1QOGA 1V81A 1OEYA 5CX3A 3Q8CA 4NAWA 5LXHA 2IYDB 3TL5A 2X38A 1V9JA 4ASWC 2BKFA 3SFEB 1CQVA 2CJOA 1ENFA 3VXWA 1D5ZC 2PE9A 1S1QB 3DVNV 1EU3A 2B76B 4M00A 3AN1A 1EU4A 3TUOA 4BVUC 2NCNA 3VH3B 1YNTE 2JXTA 5L95C 1F0ZA 1GPXA 2FBWB 1TS2A 3PRZA 2BB6A 1GAQB 1V97A 2FIFA 2BTEA 2MHJA 2WXRA 2C60A 1T0SC 2EELA 1MG8A 1SE9A 1L6UA 4IUMB 2ASQA 2PE6B 1ZE3D 1P0RA 3PT2B 5LLIA 2W3RA 3RFZB 1D6EC 4TQ1A 1KOTA 5FR6A 4ZHOA 1R4NB 3HRDD 2E3TA 3B2GA 3DDCB 2WWZA 3BYYB 2GBJA 4W9HA 1NEKB 1ZUD2 3URYA 5J18A 3IXSA 1F2RC 2Z0DB 2WDRB 4LNKA 4W9GA 4ARCA 2BB5A 4IM0A 4B95A 4FULA 1F77A 2YEPB 2QJLA 4PS7A 3JVZX 1WMHB 2JPHA 3MC0B 4BKTA 2J0MA 1DOXA 5E6JA 3C8YA 2ON8A 2N0SB 3R3MA 1V1PA 2KQSA 2KTRB 1BT0A 3EC8A 1SEBD 2QDFA 1HXYD 1L7YA 2PLPA 1S3SG 1TY0A 3N1YC 4IOIE 3NVWA 2G9HD 2N1WA 4QAYA 3EGRA 3H7PA 1SBBB 4KX6B 3HVDA 1T0YA 3VTWA 4WWPA 4ZRJA 2QEJC 2JZ3B 2PVOD 2LUMA 1XO3A 3MTNB 2QMTA 2NBVB 2Q5WD 2CJNA 3DBRI 5KHOA 3VHTC 5G55A 2KN4A 2RDHA 2BWES 1XLNA 1RWSA 1JRPA 4LJPB 2BF8B 5IA7A 3N1XC 1TZ1A 2KDMA 1P7EA 1ZXHA 2D5GA 2FCQA 3AH7A 4YTMB 2MA9B 1ZW7A 4EZJA 1XQQA 1JWMD 2LZ6A 2J42A 4MEMA 3RNGC 3DHHC 3GE8C 4DXFA 3VFKA 1F1HA 1Y8RC 1FFVA 4B0MA 1TGZB 4IW0A 1OQRA 3HHMA 1ZPSA 4US9A 4S0RA 1SJED 2KC1A 3K9PB 3CSFA 2GBMA 2ICIA 2UU7A 2INDC 4HVBA 1IPGA 3RD2A 2N1VA 1E8WA 2H88B 1P7FA 2FCMA 2KKCA 1E90A 3AEBB 3A33B 5GXGB 1LQBA 4FJVB 4P16A 2G4SA 1IBXB 4ZRPA 2GOWA 1BUIC 5BMIA 1NYRA 3ZGZA 3A4RA 3PZ8A 1SE4A 4H2AA 3ZJVA 2K0PA 3QIJA 4DXAB 2INCC 2I38A 4RGMA 1Q10A 3W2DA 2J53A 2HJ1A 4EEWA 2PVGC 2CHXA 2V4IB 1L2NA 2BYEA 4K7SA 4MJSA 2KLCA 3AEAB 4DWFA 1ZXIA 1C4AA 3N32A 2CHWA 1OFFA 2IGDA 4W9CA 3CSTA 3EA6A 1RRBA 3SHQA 3I3TB 4TSSA 4IM2A 3NZUA 1BMLC 3VQIA 2VH2A 2GBNA 4NAMA 5JXVA 1QILA 3P4QB 3V60A 1WX8A 5G2NA 3RT3B 2W9NA 3VRBB 3NVVA 1QKZA 5D3IB 4XC2A 4LNNA 1Q0WB 2MP2A 1RFKA 1PGAA 2KVRA 1OTRB 3O65B 1ESFA 1KFYB 2XK5A 1DOIA 2KN5A 3C0RB 3JW0X 5FK9C 1N6ZA 1UH6A 1STEA 3R2TA 4EKUA 3E56A 2RDGA 3RMKC 1C78A 1GOZA 2B3AA 1WGYA 1C4PA 4G0NB 1JWAD 1HEZE 1TYGB 3APDA 1HZ5A 3IT6B 5G5HA 2O6VD 3QX1A 4NJCA 3B0AA 3TSSA 2X8XX 4JLCA 1YIWA 3VUYA 3V6EB 4XE0A 3JSVA 3P4PB 5IN7A 3ZW3A 2M8SA 3DBRB 2EKIA 3C19A 4HPMB 4I6NB 4FXCA 2BS2B 2MJ3A 3GB1A 2WGSA 4UDUC 5IP4D 1DYQA 1KLGD 4YSZB 2LXCA 3PSEB 3PREA 3AULA 4TV3A 2BYTA 1F9JA 3W1SC 3ZDTA 2K1FA 3IBEA 4A90A 4ZHPA 1JCKB 3AE7B 1QF6A 5JHBA 3I57A 2WXGA 2NPTB 2PIAA 1E10A 3SEBA 4F7ZA 2DYBA 2DBYA 4BKGA 3ZNGC 2AQ2B 3R2IA 4A20A 2C5LC 2G3QB 3TEWA 2KYWA 1GB1A 5E6OA 1RM6C 4CQNA 4MSQB 2PMVA 1A5RA 5CHFA 4RH6A 4OW0A 1RYJA 2KVZA 1EF1A 2KWUB 2ZVNA 4FA6A 3ECIA 5DPSA 4PT5A 1C3TA 4D2KA 3PGEA 1NVID 4HDOA 4RGOS 2QSDA 1VZ7A 1ROEA 3KUZA 2JUOA 3RNAC 2DYMA 3CIRB 2BS3B 4W9DA 3EFCA 4IWQA 4NJ7A 2D11A 2GI9A 3LJ3A 1PYWD 4K7WA 1WYWB 1ET6A 5TR5A 4FBJB 3A9JB 4FHJA 2C7NB 4MGYE 2CU3A 1WX9A 4L2YA 5AEKB 1JW9D 2KFKB 4XWTA 3Q8BA 2BGFA 3FC4A 1FO4A 1SB3C 4P1BC 1WX7A 2SEBD 1E5WA 3BVZA 4LNFA 2CHZA 1K53A 2KDFB 2WX0A 1ZP0B 2G1EA 3AB5A 2NTTA 4WJOA 3DOWA 1G6JA 3NRZA 3AMZA 4JWUC 1WYGA 1C1YB 2KFJA 2VRRB 3W9CB 4ARIA 1HQRD 2DWQA 5HI1A 1FXIA 3HVZA 2O6VB 1MHXA 2K9XA 4MGKE 4B9KA 4GMVA 5LNK1 2OHFA 4ANXA 3ZJTA 1UNSA 2UYZB 2IBIB 3NY5A 5AUIA 3T9LA 2WXJA 1MHHE 3UINB 2JY6A 1T3QA 3VAWA 1YQ4B 5EE3A 3SFDB 3PVLA 5I4DA 2V0GA 1TKYA 3ZTCA 3V61A 2N9XA 4GXBA 3RN9C 3HM3A 1D4BA 3A1QA 2KDEB 2WXLA 5BO4B 2JSVX 3N30A 1WXAA 4KIKA 3WANA 4KZ0A 1UWMA 1SSNA 1T0QC 3JYUA 3RZFA 1E7VA 3NS1A 3KYCD 3A9KB 2JYTA 1KLUD 4LLGM 4LDTD 2H89B 3NUHB 4DHJB 2KWDA 2BYVE 4RNAA 2W82A 2L52A 4K3BA 1UBQA 1WJNA 2DAJA 3ZLZA 3NZSA 1ACCA 2WP9B 4I6LB 2BKRB 2NMQA 4OZAA 4RM9A 2MJDA 3N9YC 1XCTL 3PO0A 3WAPA 3Q14C 3Q69A 1TKEA 3KVFB 4OVUA 2M17A 2KJ6A 2SAKA 4FLHA 3TEZA 4M02A 4KKJA 2R2OA 1WH3A 1VRAB 1WE7A 1I4QA 4MACA 2ACZB 4MGIE 1LGRA 4HLEA 2W54A 2KQ4X 1PDXA 3MHZA 1N63A 1XLQA 5BYQA 4KZCA 2C9WB 3EFUA 2BVCA 4RF1A 4LNIA 5AZHA 3V3XA 4MGZE 5E6NA 4HPPA 4DHZE 1EM7A 3AE6B 2A5UA 2E6XA 4WWNA 2J7QB 1E8ZA 5JH5C 2N9KA 1WF9A 3QA8A 1M4VA 3M63B 2JWZA 1XLPA 4LK0M 2JQRB 3EECA 4W9KA 5D6JB 1F52A 4PK1A 2W55A 1EWCA 5L83A 2N7EA 4A8XC 2WXPA 1PFDA 2ZPYA 4KSLC 4M8MA 3ZRFA 3AECB 4K3CA 2LVOA 4DDGD 3DHIC 4IDIA 2N7JA 4W9EA 2RPVA 2K25A 3N1ZC 4ZRKA 2J0KA 4HWIB 5JHAA 3ZNHB 4DHZB 3EHVA 3OJ4B 3ZO5B 4TMAB 1V86A 2KQ7A 1FRDA 5E6PA 1WMHA 4O1NA 4DK5A 4Q2JA 3ZNID 2HD5B 4HCPB 2KT7A 3PLVA 2AEHA 1HZ6A 2WX1A 3TCAA 2KMMA 4YWGG 4HJGE 4CHKA 1V5OA 2L3ZA 3U52E 1NYQA 2KTRA 2J0JA 2QC8A 3GZNI 1WGRA 1TBEA 2BPSA 3UQAA 1H8CA 2D3CA 2Z59B 2ZZPB 2K8CA 1TS5A 3AEGB 4KSKC 3RNBC 2ZEQA 2YVCA 1VZ6A 2HE7A 1SIJA 2PW9A 4GDKB 1SJHD 3WAOA 1QZEA 1JALA 2LXAA 3V6CB 5BYRA 1IGCA 3Q8AA 5FKAC 5D2MB 2ZJDA 1FCCC 1R4MI 4USAA 5KHQA 2G4DB 3AE9B 4WURA 2DZIA 2FAZA 2DZKA 1N5WA 5G5GA 3ZDMC 4E71A 1GB4A 1Z2MA 1J7BA 2HTHA 3L17A 1YN5A 1KTKA 2V9HA 4HJKA 4IWOA 2M1MA 3AE5B 2KK8A 2L8JA 3UIOB 4WQMA 2GMIC 1QOFA 4GLSC 1WM2A 1E8YA 3VRAB 4C80A 2C7HA 2BQQA 2A4ZA 3T8MA 4R3DA 1WRDB 1L5PA 2DZJA 3LYYA 3U7DA 4KDLB 3IG3A 1UUPA 3RCZA 2D3AA 3P4RB 4JPSA 2LWPA 3AV8A 2MBQA 3ZXRA 3QWZB 4GOCA 2K3UA 2NTSA 4A55A 1SF0A 3ZXVA 2KXJA 2MBEA 5HG2A 3AXCA 1IBXA 4EFOA 3ZJUA 1AW7A 1RLFA 4XDCA 1X1MA 4LNOA 4ZYNA 4E74A 2LGYA 3PLUA 1VR9A 3V05A 2JRIB 3HM6X 3MC8A 1WR1A 1TZOA 1P9DU 2GB1A 2M0XA 3IFWB 2IZVB 3D32A 3R8BA 4N6EB 2QCZA 4M01A 2IO3B 2JYEA 3U7ZA 4F1SA 1ZGUB 5LXIB 1VJKA 1V6EA 2WHIA 4MM3A 2L00B 3B9JA 3NOBA 1YJIA 2WDTB 4G11A 2Y3AA 1PQSA 3BWUD 4C7YA 3ALBA 1E9MA 3BVMA 4L23A 1V5TA 1MFWA 4P7IA 2LFIA 1XXGA 3KWLA 3DHGC 5DCNA 1LO5D 2IGHA 4A9AA 2DX5B 3KW5B 3ZUNA 2V3NA 1KRHA 2N9PC 2L76A 2J52A 4MM3B 4PYZA 4KGRA 1MI0A 1WR6E 3GZNB 2WXHA 1YX6B 2V3PA 3J9CA 2RDBC 1ZKHA 4FHKA 4RFBA 3M95A 1IUEA 5CHVC 3Q6BA 1IGDA 1IP9A 1FXTB 3TIXA 3N3KB 3UGBB 2O2VB 1JWSD 1T6BX 1LM8B 2IGGA 3BVGA 2LJ5A 4WQOB 1R4MB 4AUQC 2AQ3B 1B1ZA 2RPQA 3I9V1 5EE9A 1J7AA 4XYCA 2MH7A 4EOYA 3DVGX 3NS8A 1I4XA 1I4HA 1GC7A 3U8ZA 1JWUD 1WY8A 3W5VB 2ZVOA 5IOIA 2N9EB 1ZDXA 2WLBA 2LRUA 3ZIMA 4JL9A 4XDDA 3PHWB 3VR9B 2L32A 5DPWA 3GS2A 1FPYA 4WAFA 2LRWA 2VH1A 1ZOYB 1WGHA 3KH0A 4IKGA 2NPTA 1B9RA 1PGXA 2R2QA 2KANA 4G50A 3PRPB 3TEXA 4C56C 2LGXA 2KTFA 2LVQA 1JRUA 2MWSB 4AS1A 3W1SA 3Q2AC 2LHDA 4II2B 4OZCA 1FFUA 2XN9C 1C79A 4GIVA 3R7QA 2BWFA 3CWIA 3ZTDA 2K22A 2CS4A 2MBOA 2AYOB 4B6WA 4W9JA 2FUHB 3IAM1 1FIQA 2ZCBA 3BYTB 4FJYA 2MW5A 4HKZE 2MBBB 4XGAB 1D5XC 2IJ0A 4RF0A 2KJHB 1CJEA 1J19A 3ABVB 1L4DB 4HDQA 3LB8C 4XX5A 2MLBA 1XLOA 3A9JA 3S2AA 2IPKD 2N4FA 4OHJA 4US8A 4BKSA 2DHZA 4PS3A 3WCQA 4BFRA 3W5UB 1XD3B 2KFKA 3I63C 1XT9B 2KHWB 4AJWA 2WXOA 2DNFA 2K8BA 1WGGA 3APFA 1UF0A 3QC8B 1YN4A 3VDZA 3P2BA 3L10B 3P4SB 3ZNZB 4WWOA 4AWJA 2KNBA 1DGJA 1UGMA 1WSPA 4HRSA 1P98A 4C4VB 5D3DA 2ZCCA 2C7MB 1WJ4A 2MBHA 3L4PA 2M19A 1V49A 2D10A 2XBBC 3VUWA 1K52A 4HEA1 1D5MC 2FCSA 2JXXA 1AN8A 3UI3A 2LHEA 1GUAB 2IY0B 2WQYB 3QAQA 2HDEA 3CF6E 3IT4B 3KUCB 4C00A 4CYEA 2O6VA 1L6VA 4GDLB 4EUTA 2IO2B 2RGFA 4NJ6A 4JIOU 2K8HA 1NENB 3ML8A 3ML9A 2BW2A 3NVYA 4M0WB 1YOVB 2ZNVC 1CZPA 3ZVVA 4RMAA 3TBLD 3E9SA 2L1AA 5EDSA 2INNE 2IY1B 4G3XB 4EZKA 1E6EB 3VH4B 3A9KA 4ZOHC 2N9LA 1Q5WB 2GBRA 1GG3A 3HIZA 1U4AA 1WI0A 1GJZA 2ZNVB 1OEYJ 4AJYB 1L0VB 3IVFA 1FMAD 3QHTA 5TSSA 3AE8B 5FR3A 3TMPB 4GN1A 4HROA 1YX5B 3P42A 4GSWA 2AWTA 1NBFC 1CMXB 3RNFC 3SU8X 3DWGC 5IKCM 1VLBA 2NR2A 1Y56A 2FNJB 1C9FA 2MCNB 1OQYA 3SR6A 3FILB 4YT0B 3SD5A 5D7GA 2WXQA 2DZMA 4KV2A 2RSUA 1CK1A 2I1JA 1FM0D 3NHEB 3AEEB 4TQ0A 2OOBB 4RGNA 1AYFA 3T3OA 3MJ5A 4MSMB 2M0AA 3FKYA 4YTPB 1FXAA 1FNUA 2I1KA 3M62B 2GLSA 2KACA 3AU5A 3RPFC 2QILA 3AE2B 2BYFA 1WRIA 1GC6A 1YN3A 3QJZA 2UWQA 2VZKD 3GE3C 1KF6B 1ET9A 2KO3A 2CR5A 2MQJA 3HUIA 2KLGA 1WZ0A 3K9OB 1IYFA 4AOFA 4M8NA 2BT6A 3H7SA 2BBCA 4WIPA 4MELA 3QQ8B 1K8RB 1EF5A 4CO7A 1E7PB 2ZPNA 1R7SA 2LVPA 4A3OA 1I4RA 1J8CA 2NS5A 2CKHB 2JU6X 2ONQA 4WJQA 1SIFA 2EMSA 3PZ7A 4ICVA 1NDDA 5J2RA 1A70A 3ZYYX 1XEEA 4GB9A 5C23A 1LFDA 1WXQA 3WA0A 3AM9A 2LGSA 3H6NA 2OEDA 3VUXA 1EUVB 3RZWC 3QK0A 4EE2A 4IWPA 3DVNU 5IAAC 1RAXA 1SE2A 2M4NA 1I7HA 4NAWB 2D3GA 4GDKA 4GGQA 1QLBB 1AWDA 3RI7C 4L1BA 1SE3A 4W9FA 3VVWB 2CU1A 4JWSC 4DDID 1FNVA 3L0WB 4F8CB 2QHOA 4LDTB 2KX3A 1H4RA 1J7CA 2OJWA 3NVZA 2WDVB 2WXMA 2MRPA 4II3B 4BBNC 3B08A 4WH4A 4NQLB 2L83A 2KWVB 1YMHE 1N60A 3PS6A 3QCAA 5JZEB 1PUTA 4ZYSA 4ANVA 5HKHA 2KMCA 2DLBA 1MVKA 3AE3B 5C1ZA 1L0YB 1QOAA 4MH8A 4FN2A 3P63A 1OGWA 1LXDA 3L16A 1WGDA 4NPNA 4RGTA 3LDZE 4XWWA 1SGHA 3MP9A 2VZKB 1TTNA 4ICUA 4W9LA 4NZLB 4J6IA 1TJEA 3Q3OC 1ZDVA 2V4LA 2GRIA 1E7UA 4IC7B 4B0EA 4BZAA 2QIEB 4EZLA 1N5XA 1VZ8A 1EO6A 2RR9A 1V1PB 2XNAC 3H9DA 1N62A 2EKEC 4JE3B 4P6VF 1OQQA 2DAFA 3VTVA 4LTUA 2BS4B 5BMGA 3R66C 3DCGA 3NG0A 2L0TA 3BK1A 4FADA 4WJNA 3H7PB 2WXFA 5EE1A 1KH0A 5AUKA 3WAMA 3PZDA 3VTUA 2FE8A 4GU2A 2V1YA 1WJ6A 1C77A 1I35A 1TIFA 1KM7A 3MC9A 3QARA 3PV1A 4LJOB 3KUDB 2RD0A 4AP4C 2R61A 4NQKE 4YL8A 1JWBD 5IO9A 1YQ3B 4IM3A 4KKIA 3Q8EA 1QT9A 3Q3JA 3VR8B 4ANUA 1C4CA 1T5XD 2W3SA 2WU2B 1WFYA 2J4XA 3BIID 2JZZA 1EWYC 4ANWA 3BZDB 2LD9A 1P1AA 3O13A 3Q8FA 3PRMB 3DVGY 3LXFA 2M56B 3KYDD 1Z5SB 2JT4B 1VDVA 2O2VA 3OJ3A 1NI3A 2PPHA 2LEKA 4WAAA 5CTRC 2TSSA 4N59A 4ACFA 1WGKA 4REZA 3IAS1 4JQWC 5J17A 3M3JA 3DBSA 4N9F4 2KWCA 3DBHI 4K7UA 4OVZA 3AU4A 3DQVA 3UF8A 2FIDA 1WJUA 3BK2A 2PEAA 1WXSA 2AL6A 2KOXA 2KD0A 2HJ8A 4BKSD 1JQ4A 4YXDB 1YJJA 3NJTA 2JVCA 3L13A 3OAWA 1QQRA 4BOZB 4PS8A 3HK0A 3Q3FA 4HK2A 4MJSB 1J0GA 1K50A 3TJPA 4RCOA 2DENB 1VD2A 2WDQB 3ONSA 3RUIB 4DQOC 1YQBA 1HE8A 2LMCA 1V2YA 1WZ3A 2D2QA 5DPRA 3MJWA 3DBLI 2AX5A 4A3PA 4HPLB 4K81A 2LGIA 2INPE 4A6QA 2REXA 3I5JC 5AZGA 1UZXB 5C3JB 4URKA 2KZRA 1UWXA 4WJPA 2FCNA 1FRRA 5H8YE 1QOBA 3UQBA 1FNWA 2MSED 3X23A 1V8CA 2LGDA 2MP2B 3APCA 4OZBA 2AL3A 2JF5A 2Y5PA 2XK5B 2DYOA 2WXIA 4W9IA 1WWTA 1Q1OA 2WYQA 3DWMA 3H8HA 4MDKE 5DPTA 3EUB2 5BYSA 2IO1B 3GOEA 2Z0EB 3PPAA 1WXVA 1UBIA 2KDIA 1E8XA 3NZ3A 4YSXB 4IG7B 2LUEA 4ZRQA 2MJEA 2IDYA 1K51A 1T0RC 2L0FA 5HHDG 1BXTA 1TY2A 1ISNA 3JSVB 3KWVA 4DHJD 2AQ1B 2MX2A 2WS3B 3L54A 1AARA 4WWMA 3TEYA 4C4VA 2D3BA 5H92C 2KDBA 3H1UA 4E3CA 1SXTA 2XEWA 1FEHA 1KLVA 2YEPF 3AEDB 2NBWB 4JGHB 3RNCC
chains in the Genus database with same CATH topology
2QCZA 3Q6BA 4BZAA 4PK1A 4QAYA 4K3BA 4C00A 4C4VA 4K3CA 3OG5A 4C4VB 3MC8A 2QDFA 2X8XX 2VH2A 4XGAB 3EFCA 3NJTA 2MHJA 2V9HA 2VH1A 3MC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QCZ A;  3Q6B A;  4BZA A;  4PK1 A;  4QAY A;  4K3B A;  4C00 A;  4C4V A;  4K3C A;  3OG5 A;  4C4V B;  3MC8 A;  2QDF A;  2X8X X;  2VH2 A;  4XGA B;  3EFC A;  3NJT A;  2MHJ A;  2V9H A;  2VH1 A;  3MC9 A; 
#chains in the Genus database with same CATH topology
 3AEF B;  4BAX A;  2L05 A;  3FAH A;  3MHS D;  4C7Z A;  1M94 A;  4BBN F;  1TKG A;  3BY4 B;  2GBK A;  2NBU A;  2Y5B B;  4GDL A;  2N7D A;  3P1M A;  3T3N A;  1TS3 A;  1C76 A;  2L7R A;  4ZRI A;  4JX1 C;  5D94 A;  1RFA A;  3AE4 B;  1GNU A;  4NY0 A;  1YJ1 A;  1L4Z B;  2WNM A;  4M0W A;  2PKO A;  1FCL A;  1HTQ A;  3UIP B;  3KLS X;  3MFG A;  1V1O A;  2KX0 A;  4BOS C;  3U2S C;  4XZ4 A;  4DBG A;  3DBH B;  4MH0 E;  1MJD A;  1FD6 A;  3IHP C;  3U30 A;  4ITK A;  3WIM A;  1PGB A;  4S17 A;  1MPE A;  4TKN A;  4X57 B;  4AQ7 A;  3V62 A;  2FUG 1;  5C2T B;  4FJZ A;  3ZKJ C;  2JRH A;  3X0W A;  1L0X B;  3Q3N C;  3ZRC A;  2MEK A;  4KVG B;  4DXG A;  1KJT A;  2D07 B;  2ZW0 A;  1XF5 L;  1HA5 A;  2WXK A;  1YD8 U;  1WM3 A;  1N61 A;  3Q3M C;  4YSY B;  3DBL B;  2K39 A;  2KAJ A;  4RM8 A;  3WAL A;  1WIA A;  3PHX B;  2K5P A;  1UEL A;  2LJI A;  1P3Q U;  2KMA A;  1UGJ A;  2PJH A;  2JWU A;  1R4N I;  3SDL C;  3FIL A;  4ZDV A;  3ZQ4 A;  4HXD A;  4YTN B;  1UD7 A;  4PYU A;  1WXM A;  1MG4 A;  3GP7 A;  1D3Z A;  5HFY A;  1XCQ L;  4HKQ A;  3BIN A;  2WXN A;  2ZW1 A;  4I6P A;  3PTF C;  1I4P A;  1VCB A;  2NVU I;  1WE6 A;  1F2R I;  2WU5 B;  2KC2 A;  3R7R A;  2Z8L A;  1JRO A;  4K1R B;  4LCD E;  4TUU A;  2JX5 A;  4KDI C;  4KGS A;  2K6Q A;  4N58 A;  3B2F A;  1V80 A;  3AE1 B;  2PTL A;  4HCN B;  2EMT A;  3AI5 A;  5T8I A;  4MT5 A;  1I4G A;  2YLM A;  5AZF A;  3A1Q B;  1DOY A;  2RMM A;  2OJR A;  2G45 B;  3ENE A;  3OLM D;  2V3S A;  2K6D B;  4NNJ B;  2JZP A;  2LAS A;  4KIK B;  2HTM E;  2IO0 B;  3OWE B;  5CHW A;  3U4E G;  4OVV A;  1HTO A;  5MPO A;  3RUL A;  1TS4 A;  3A4S C;  5BMH A;  3RYT A;  3W1Y A;  3OG5 A;  5GMV A;  2KJR A;  3L08 A;  1NI2 A;  5EE0 A;  1E0Z A;  3DPD A;  1I42 A;  4P1C C;  3ETR A;  1TT5 B;  3CMM B;  3KQ4 A;  2LI5 A;  4KGT A;  1JML A;  3B1L X;  4J3O D;  2Y5C A;  2I2Y A;  3N20 C;  3RNE C;  1QOG A;  1V81 A;  1OEY A;  5CX3 A;  3Q8C A;  4NAW A;  5LXH A;  2IYD B;  3TL5 A;  2X38 A;  1V9J A;  4ASW C;  2BKF A;  3SFE B;  1CQV A;  2CJO A;  1ENF A;  3VXW A;  1D5Z C;  2PE9 A;  1S1Q B;  3DVN V;  1EU3 A;  2B76 B;  4M00 A;  3AN1 A;  1EU4 A;  3TUO A;  4BVU C;  2NCN A;  3VH3 B;  1YNT E;  2JXT A;  5L95 C;  1F0Z A;  1GPX A;  2FBW B;  1TS2 A;  3PRZ A;  2BB6 A;  1GAQ B;  1V97 A;  2FIF A;  2BTE A;  2MHJ A;  2WXR A;  2C60 A;  1T0S C;  2EEL A;  1MG8 A;  1SE9 A;  1L6U A;  4IUM B;  2ASQ A;  2PE6 B;  1ZE3 D;  1P0R A;  3PT2 B;  5LLI A;  2W3R A;  3RFZ B;  1D6E C;  4TQ1 A;  1KOT A;  5FR6 A;  4ZHO A;  1R4N B;  3HRD D;  2E3T A;  3B2G A;  3DDC B;  2WWZ A;  3BYY B;  2GBJ A;  4W9H A;  1NEK B;  1ZUD 2;  3URY A;  5J18 A;  3IXS A;  1F2R C;  2Z0D B;  2WDR B;  4LNK A;  4W9G A;  4ARC A;  2BB5 A;  4IM0 A;  4B95 A;  4FUL A;  1F77 A;  2YEP B;  2QJL A;  4PS7 A;  3JVZ X;  1WMH B;  2JPH A;  3MC0 B;  4BKT A;  2J0M A;  1DOX A;  5E6J A;  3C8Y A;  2ON8 A;  2N0S B;  3R3M A;  1V1P A;  2KQS A;  2KTR B;  1BT0 A;  3EC8 A;  1SEB D;  2QDF A;  1HXY D;  1L7Y A;  2PLP A;  1S3S G;  1TY0 A;  3N1Y C;  4IOI E;  3NVW A;  2G9H D;  2N1W A;  4QAY A;  3EGR A;  3H7P A;  1SBB B;  4KX6 B;  3HVD A;  1T0Y A;  3VTW A;  4WWP A;  4ZRJ A;  2QEJ C;  2JZ3 B;  2PVO D;  2LUM A;  1XO3 A;  3MTN B;  2QMT A;  2NBV B;  2Q5W D;  2CJN A;  3DBR I;  5KHO A;  3VHT C;  5G55 A;  2KN4 A;  2RDH A;  2BWE S;  1XLN A;  1RWS A;  1JRP A;  4LJP B;  2BF8 B;  5IA7 A;  3N1X C;  1TZ1 A;  2KDM A;  1P7E A;  1ZXH A;  2D5G A;  2FCQ A;  3AH7 A;  4YTM B;  2MA9 B;  1ZW7 A;  4EZJ A;  1XQQ A;  1JWM D;  2LZ6 A;  2J42 A;  4MEM A;  3RNG C;  3DHH C;  3GE8 C;  4DXF A;  3VFK A;  1F1H A;  1Y8R C;  1FFV A;  4B0M A;  1TGZ B;  4IW0 A;  1OQR A;  3HHM A;  1ZPS A;  4US9 A;  4S0R A;  1SJE D;  2KC1 A;  3K9P B;  3CSF A;  2GBM A;  2ICI A;  2UU7 A;  2IND C;  4HVB A;  1IPG A;  3RD2 A;  2N1V A;  1E8W A;  2H88 B;  1P7F A;  2FCM A;  2KKC A;  1E90 A;  3AEB B;  3A33 B;  5GXG B;  1LQB A;  4FJV B;  4P16 A;  2G4S A;  1IBX B;  4ZRP A;  2GOW A;  1BUI C;  5BMI A;  1NYR A;  3ZGZ A;  3A4R A;  3PZ8 A;  1SE4 A;  4H2A A;  3ZJV A;  2K0P A;  3QIJ A;  4DXA B;  2INC C;  2I38 A;  4RGM A;  1Q10 A;  3W2D A;  2J53 A;  2HJ1 A;  4EEW A;  2PVG C;  2CHX A;  2V4I B;  1L2N A;  2BYE A;  4K7S A;  4MJS A;  2KLC A;  3AEA B;  4DWF A;  1ZXI A;  1C4A A;  3N32 A;  2CHW A;  1OFF A;  2IGD A;  4W9C A;  3CST A;  3EA6 A;  1RRB A;  3SHQ A;  3I3T B;  4TSS A;  4IM2 A;  3NZU A;  1BML C;  3VQI A;  2VH2 A;  2GBN A;  4NAM A;  5JXV A;  1QIL A;  3P4Q B;  3V60 A;  1WX8 A;  5G2N A;  3RT3 B;  2W9N A;  3VRB B;  3NVV A;  1QKZ A;  5D3I B;  4XC2 A;  4LNN A;  1Q0W B;  2MP2 A;  1RFK A;  1PGA A;  2KVR A;  1OTR B;  3O65 B;  1ESF A;  1KFY B;  2XK5 A;  1DOI A;  2KN5 A;  3C0R B;  3JW0 X;  5FK9 C;  1N6Z A;  1UH6 A;  1STE A;  3R2T A;  4EKU A;  3E56 A;  2RDG A;  3RMK C;  1C78 A;  1GOZ A;  2B3A A;  1WGY A;  1C4P A;  4G0N B;  1JWA D;  1HEZ E;  1TYG B;  3APD A;  1HZ5 A;  3IT6 B;  5G5H A;  2O6V D;  3QX1 A;  4NJC A;  3B0A A;  3TSS A;  2X8X X;  4JLC A;  1YIW A;  3VUY A;  3V6E B;  4XE0 A;  3JSV A;  3P4P B;  5IN7 A;  3ZW3 A;  2M8S A;  3DBR B;  2EKI A;  3C19 A;  4HPM B;  4I6N B;  4FXC A;  2BS2 B;  2MJ3 A;  3GB1 A;  2WGS A;  4UDU C;  5IP4 D;  1DYQ A;  1KLG D;  4YSZ B;  2LXC A;  3PSE B;  3PRE A;  3AUL A;  4TV3 A;  2BYT A;  1F9J A;  3W1S C;  3ZDT A;  2K1F A;  3IBE A;  4A90 A;  4ZHP A;  1JCK B;  3AE7 B;  1QF6 A;  5JHB A;  3I57 A;  2WXG A;  2NPT B;  2PIA A;  1E10 A;  3SEB A;  4F7Z A;  2DYB A;  2DBY A;  4BKG A;  3ZNG C;  2AQ2 B;  3R2I A;  4A20 A;  2C5L C;  2G3Q B;  3TEW A;  2KYW A;  1GB1 A;  5E6O A;  1RM6 C;  4CQN A;  4MSQ B;  2PMV A;  1A5R A;  5CHF A;  4RH6 A;  4OW0 A;  1RYJ A;  2KVZ A;  1EF1 A;  2KWU B;  2ZVN A;  4FA6 A;  3ECI A;  5DPS A;  4PT5 A;  1C3T A;  4D2K A;  3PGE A;  1NVI D;  4HDO A;  4RGO S;  2QSD A;  1VZ7 A;  1ROE A;  3KUZ A;  2JUO A;  3RNA C;  2DYM A;  3CIR B;  2BS3 B;  4W9D A;  3EFC A;  4IWQ A;  4NJ7 A;  2D11 A;  2GI9 A;  3LJ3 A;  1PYW D;  4K7W A;  1WYW B;  1ET6 A;  5TR5 A;  4FBJ B;  3A9J B;  4FHJ A;  2C7N B;  4MGY E;  2CU3 A;  1WX9 A;  4L2Y A;  5AEK B;  1JW9 D;  2KFK B;  4XWT A;  3Q8B A;  2BGF A;  3FC4 A;  1FO4 A;  1SB3 C;  4P1B C;  1WX7 A;  2SEB D;  1E5W A;  3BVZ A;  4LNF A;  2CHZ A;  1K53 A;  2KDF B;  2WX0 A;  1ZP0 B;  2G1E A;  3AB5 A;  2NTT A;  4WJO A;  3DOW A;  1G6J A;  3NRZ A;  3AMZ A;  4JWU C;  1WYG A;  1C1Y B;  2KFJ A;  2VRR B;  3W9C B;  4ARI A;  1HQR D;  2DWQ A;  5HI1 A;  1FXI A;  3HVZ A;  2O6V B;  1MHX A;  2K9X A;  4MGK E;  4B9K A;  4GMV A;  5LNK 1;  2OHF A;  4ANX A;  3ZJT A;  1UNS A;  2UYZ B;  2IBI B;  3NY5 A;  5AUI A;  3T9L A;  2WXJ A;  1MHH E;  3UIN B;  2JY6 A;  1T3Q A;  3VAW A;  1YQ4 B;  5EE3 A;  3SFD B;  3PVL A;  5I4D A;  2V0G A;  1TKY A;  3ZTC A;  3V61 A;  2N9X A;  4GXB A;  3RN9 C;  3HM3 A;  1D4B A;  3A1Q A;  2KDE B;  2WXL A;  5BO4 B;  2JSV X;  3N30 A;  1WXA A;  4KIK A;  3WAN A;  4KZ0 A;  1UWM A;  1SSN A;  1T0Q C;  3JYU A;  3RZF A;  1E7V A;  3NS1 A;  3KYC D;  3A9K B;  2JYT A;  1KLU D;  4LLG M;  4LDT D;  2H89 B;  3NUH B;  4DHJ B;  2KWD A;  2BYV E;  4RNA A;  2W82 A;  2L52 A;  4K3B A;  1UBQ A;  1WJN A;  2DAJ A;  3ZLZ A;  3NZS A;  1ACC A;  2WP9 B;  4I6L B;  2BKR B;  2NMQ A;  4OZA A;  4RM9 A;  2MJD A;  3N9Y C;  1XCT L;  3PO0 A;  3WAP A;  3Q14 C;  3Q69 A;  1TKE A;  3KVF B;  4OVU A;  2M17 A;  2KJ6 A;  2SAK A;  4FLH A;  3TEZ A;  4M02 A;  4KKJ A;  2R2O A;  1WH3 A;  1VRA B;  1WE7 A;  1I4Q A;  4MAC A;  2ACZ B;  4MGI E;  1LGR A;  4HLE A;  2W54 A;  2KQ4 X;  1PDX A;  3MHZ A;  1N63 A;  1XLQ A;  5BYQ A;  4KZC A;  2C9W B;  3EFU A;  2BVC A;  4RF1 A;  4LNI A;  5AZH A;  3V3X A;  4MGZ E;  5E6N A;  4HPP A;  4DHZ E;  1EM7 A;  3AE6 B;  2A5U A;  2E6X A;  4WWN A;  2J7Q B;  1E8Z A;  5JH5 C;  2N9K A;  1WF9 A;  3QA8 A;  1M4V A;  3M63 B;  2JWZ A;  1XLP A;  4LK0 M;  2JQR B;  3EEC A;  4W9K A;  5D6J B;  1F52 A;  4PK1 A;  2W55 A;  1EWC A;  5L83 A;  2N7E A;  4A8X C;  2WXP A;  1PFD A;  2ZPY A;  4KSL C;  4M8M A;  3ZRF A;  3AEC B;  4K3C A;  2LVO A;  4DDG D;  3DHI C;  4IDI A;  2N7J A;  4W9E A;  2RPV A;  2K25 A;  3N1Z C;  4ZRK A;  2J0K A;  4HWI B;  5JHA A;  3ZNH B;  4DHZ B;  3EHV A;  3OJ4 B;  3ZO5 B;  4TMA B;  1V86 A;  2KQ7 A;  1FRD A;  5E6P A;  1WMH A;  4O1N A;  4DK5 A;  4Q2J A;  3ZNI D;  2HD5 B;  4HCP B;  2KT7 A;  3PLV A;  2AEH A;  1HZ6 A;  2WX1 A;  3TCA A;  2KMM A;  4YWG G;  4HJG E;  4CHK A;  1V5O A;  2L3Z A;  3U52 E;  1NYQ A;  2KTR A;  2J0J A;  2QC8 A;  3GZN I;  1WGR A;  1TBE A;  2BPS A;  3UQA A;  1H8C A;  2D3C A;  2Z59 B;  2ZZP B;  2K8C A;  1TS5 A;  3AEG B;  4KSK C;  3RNB C;  2ZEQ A;  2YVC A;  1VZ6 A;  2HE7 A;  1SIJ A;  2PW9 A;  4GDK B;  1SJH D;  3WAO A;  1QZE A;  1JAL A;  2LXA A;  3V6C B;  5BYR A;  1IGC A;  3Q8A A;  5FKA C;  5D2M B;  2ZJD A;  1FCC C;  1R4M I;  4USA A;  5KHQ A;  2G4D B;  3AE9 B;  4WUR A;  2DZI A;  2FAZ A;  2DZK A;  1N5W A;  5G5G A;  3ZDM C;  4E71 A;  1GB4 A;  1Z2M A;  1J7B A;  2HTH A;  3L17 A;  1YN5 A;  1KTK A;  2V9H A;  4HJK A;  4IWO A;  2M1M A;  3AE5 B;  2KK8 A;  2L8J A;  3UIO B;  4WQM A;  2GMI C;  1QOF A;  4GLS C;  1WM2 A;  1E8Y A;  3VRA B;  4C80 A;  2C7H A;  2BQQ A;  2A4Z A;  3T8M A;  4R3D A;  1WRD B;  1L5P A;  2DZJ A;  3LYY A;  3U7D A;  4KDL B;  3IG3 A;  1UUP A;  3RCZ A;  2D3A A;  3P4R B;  4JPS A;  2LWP A;  3AV8 A;  2MBQ A;  3ZXR A;  3QWZ B;  4GOC A;  2K3U A;  2NTS A;  4A55 A;  1SF0 A;  3ZXV A;  2KXJ A;  2MBE A;  5HG2 A;  3AXC A;  1IBX A;  4EFO A;  3ZJU A;  1AW7 A;  1RLF A;  4XDC A;  1X1M A;  4LNO A;  4ZYN A;  4E74 A;  2LGY A;  3PLU A;  1VR9 A;  3V05 A;  2JRI B;  3HM6 X;  3MC8 A;  1WR1 A;  1TZO A;  1P9D U;  2GB1 A;  2M0X A;  3IFW B;  2IZV B;  3D32 A;  3R8B A;  4N6E B;  2QCZ A;  4M01 A;  2IO3 B;  2JYE A;  3U7Z A;  4F1S A;  1ZGU B;  5LXI B;  1VJK A;  1V6E A;  2WHI A;  4MM3 A;  2L00 B;  3B9J A;  3NOB A;  1YJI A;  2WDT B;  4G11 A;  2Y3A A;  1PQS A;  3BWU D;  4C7Y A;  3ALB A;  1E9M A;  3BVM A;  4L23 A;  1V5T A;  1MFW A;  4P7I A;  2LFI A;  1XXG A;  3KWL A;  3DHG C;  5DCN A;  1LO5 D;  2IGH A;  4A9A A;  2DX5 B;  3KW5 B;  3ZUN A;  2V3N A;  1KRH A;  2N9P C;  2L76 A;  2J52 A;  4MM3 B;  4PYZ A;  4KGR A;  1MI0 A;  1WR6 E;  3GZN B;  2WXH A;  1YX6 B;  2V3P A;  3J9C A;  2RDB C;  1ZKH A;  4FHK A;  4RFB A;  3M95 A;  1IUE A;  5CHV C;  3Q6B A;  1IGD A;  1IP9 A;  1FXT B;  3TIX A;  3N3K B;  3UGB B;  2O2V B;  1JWS D;  1T6B X;  1LM8 B;  2IGG A;  3BVG A;  2LJ5 A;  4WQO B;  1R4M B;  4AUQ C;  2AQ3 B;  1B1Z A;  2RPQ A;  3I9V 1;  5EE9 A;  1J7A A;  4XYC A;  2MH7 A;  4EOY A;  3DVG X;  3NS8 A;  1I4X A;  1I4H A;  1GC7 A;  3U8Z A;  1JWU D;  1WY8 A;  3W5V B;  2ZVO A;  5IOI A;  2N9E B;  1ZDX A;  2WLB A;  2LRU A;  3ZIM A;  4JL9 A;  4XDD A;  3PHW B;  3VR9 B;  2L32 A;  5DPW A;  3GS2 A;  1FPY A;  4WAF A;  2LRW A;  2VH1 A;  1ZOY B;  1WGH A;  3KH0 A;  4IKG A;  2NPT A;  1B9R A;  1PGX A;  2R2Q A;  2KAN A;  4G50 A;  3PRP B;  3TEX A;  4C56 C;  2LGX A;  2KTF A;  2LVQ A;  1JRU A;  2MWS B;  4AS1 A;  3W1S A;  3Q2A C;  2LHD A;  4II2 B;  4OZC A;  1FFU A;  2XN9 C;  1C79 A;  4GIV A;  3R7Q A;  2BWF A;  3CWI A;  3ZTD A;  2K22 A;  2CS4 A;  2MBO A;  2AYO B;  4B6W A;  4W9J A;  2FUH B;  3IAM 1;  1FIQ A;  2ZCB A;  3BYT B;  4FJY A;  2MW5 A;  4HKZ E;  2MBB B;  4XGA B;  1D5X C;  2IJ0 A;  4RF0 A;  2KJH B;  1CJE A;  1J19 A;  3ABV B;  1L4D B;  4HDQ A;  3LB8 C;  4XX5 A;  2MLB A;  1XLO A;  3A9J A;  3S2A A;  2IPK D;  2N4F A;  4OHJ A;  4US8 A;  4BKS A;  2DHZ A;  4PS3 A;  3WCQ A;  4BFR A;  3W5U B;  1XD3 B;  2KFK A;  3I63 C;  1XT9 B;  2KHW B;  4AJW A;  2WXO A;  2DNF A;  2K8B A;  1WGG A;  3APF A;  1UF0 A;  3QC8 B;  1YN4 A;  3VDZ A;  3P2B A;  3L10 B;  3P4S B;  3ZNZ B;  4WWO A;  4AWJ A;  2KNB A;  1DGJ A;  1UGM A;  1WSP A;  4HRS A;  1P98 A;  4C4V B;  5D3D A;  2ZCC A;  2C7M B;  1WJ4 A;  2MBH A;  3L4P A;  2M19 A;  1V49 A;  2D10 A;  2XBB C;  3VUW A;  1K52 A;  4HEA 1;  1D5M C;  2FCS A;  2JXX A;  1AN8 A;  3UI3 A;  2LHE A;  1GUA B;  2IY0 B;  2WQY B;  3QAQ A;  2HDE A;  3CF6 E;  3IT4 B;  3KUC B;  4C00 A;  4CYE A;  2O6V A;  1L6V A;  4GDL B;  4EUT A;  2IO2 B;  2RGF A;  4NJ6 A;  4JIO U;  2K8H A;  1NEN B;  3ML8 A;  3ML9 A;  2BW2 A;  3NVY A;  4M0W B;  1YOV B;  2ZNV C;  1CZP A;  3ZVV A;  4RMA A;  3TBL D;  3E9S A;  2L1A A;  5EDS A;  2INN E;  2IY1 B;  4G3X B;  4EZK A;  1E6E B;  3VH4 B;  3A9K A;  4ZOH C;  2N9L A;  1Q5W B;  2GBR A;  1GG3 A;  3HIZ A;  1U4A A;  1WI0 A;  1GJZ A;  2ZNV B;  1OEY J;  4AJY B;  1L0V B;  3IVF A;  1FMA D;  3QHT A;  5TSS A;  3AE8 B;  5FR3 A;  3TMP B;  4GN1 A;  4HRO A;  1YX5 B;  3P42 A;  4GSW A;  2AWT A;  1NBF C;  1CMX B;  3RNF C;  3SU8 X;  3DWG C;  5IKC M;  1VLB A;  2NR2 A;  1Y56 A;  2FNJ B;  1C9F A;  2MCN B;  1OQY A;  3SR6 A;  3FIL B;  4YT0 B;  3SD5 A;  5D7G A;  2WXQ A;  2DZM A;  4KV2 A;  2RSU A;  1CK1 A;  2I1J A;  1FM0 D;  3NHE B;  3AEE B;  4TQ0 A;  2OOB B;  4RGN A;  1AYF A;  3T3O A;  3MJ5 A;  4MSM B;  2M0A A;  3FKY A;  4YTP B;  1FXA A;  1FNU A;  2I1K A;  3M62 B;  2GLS A;  2KAC A;  3AU5 A;  3RPF C;  2QIL A;  3AE2 B;  2BYF A;  1WRI A;  1GC6 A;  1YN3 A;  3QJZ A;  2UWQ A;  2VZK D;  3GE3 C;  1KF6 B;  1ET9 A;  2KO3 A;  2CR5 A;  2MQJ A;  3HUI A;  2KLG A;  1WZ0 A;  3K9O B;  1IYF A;  4AOF A;  4M8N A;  2BT6 A;  3H7S A;  2BBC A;  4WIP A;  4MEL A;  3QQ8 B;  1K8R B;  1EF5 A;  4CO7 A;  1E7P B;  2ZPN A;  1R7S A;  2LVP A;  4A3O A;  1I4R A;  1J8C A;  2NS5 A;  2CKH B;  2JU6 X;  2ONQ A;  4WJQ A;  1SIF A;  2EMS A;  3PZ7 A;  4ICV A;  1NDD A;  5J2R A;  1A70 A;  3ZYY X;  1XEE A;  4GB9 A;  5C23 A;  1LFD A;  1WXQ A;  3WA0 A;  3AM9 A;  2LGS A;  3H6N A;  2OED A;  3VUX A;  1EUV B;  3RZW C;  3QK0 A;  4EE2 A;  4IWP A;  3DVN U;  5IAA C;  1RAX A;  1SE2 A;  2M4N A;  1I7H A;  4NAW B;  2D3G A;  4GDK A;  4GGQ A;  1QLB B;  1AWD A;  3RI7 C;  4L1B A;  1SE3 A;  4W9F A;  3VVW B;  2CU1 A;  4JWS C;  4DDI D;  1FNV A;  3L0W B;  4F8C B;  2QHO A;  4LDT B;  2KX3 A;  1H4R A;  1J7C A;  2OJW A;  3NVZ A;  2WDV B;  2WXM A;  2MRP A;  4II3 B;  4BBN C;  3B08 A;  4WH4 A;  4NQL B;  2L83 A;  2KWV B;  1YMH E;  1N60 A;  3PS6 A;  3QCA A;  5JZE B;  1PUT A;  4ZYS A;  4ANV A;  5HKH A;  2KMC A;  2DLB A;  1MVK A;  3AE3 B;  5C1Z A;  1L0Y B;  1QOA A;  4MH8 A;  4FN2 A;  3P63 A;  1OGW A;  1LXD A;  3L16 A;  1WGD A;  4NPN A;  4RGT A;  3LDZ E;  4XWW A;  1SGH A;  3MP9 A;  2VZK B;  1TTN A;  4ICU A;  4W9L A;  4NZL B;  4J6I A;  1TJE A;  3Q3O C;  1ZDV A;  2V4L A;  2GRI A;  1E7U A;  4IC7 B;  4B0E A;  4BZA A;  2QIE B;  4EZL A;  1N5X A;  1VZ8 A;  1EO6 A;  2RR9 A;  1V1P B;  2XNA C;  3H9D A;  1N62 A;  2EKE C;  4JE3 B;  4P6V F;  1OQQ A;  2DAF A;  3VTV A;  4LTU A;  2BS4 B;  5BMG A;  3R66 C;  3DCG A;  3NG0 A;  2L0T A;  3BK1 A;  4FAD A;  4WJN A;  3H7P B;  2WXF A;  5EE1 A;  1KH0 A;  5AUK A;  3WAM A;  3PZD A;  3VTU A;  2FE8 A;  4GU2 A;  2V1Y A;  1WJ6 A;  1C77 A;  1I35 A;  1TIF A;  1KM7 A;  3MC9 A;  3QAR A;  3PV1 A;  4LJO B;  3KUD B;  2RD0 A;  4AP4 C;  2R61 A;  4NQK E;  4YL8 A;  1JWB D;  5IO9 A;  1YQ3 B;  4IM3 A;  4KKI A;  3Q8E A;  1QT9 A;  3Q3J A;  3VR8 B;  4ANU A;  1C4C A;  1T5X D;  2W3S A;  2WU2 B;  1WFY A;  2J4X A;  3BII D;  2JZZ A;  1EWY C;  4ANW A;  3BZD B;  2LD9 A;  1P1A A;  3O13 A;  3Q8F A;  3PRM B;  3DVG Y;  3LXF A;  2M56 B;  3KYD D;  1Z5S B;  2JT4 B;  1VDV A;  2O2V A;  3OJ3 A;  1NI3 A;  2PPH A;  2LEK A;  4WAA A;  5CTR C;  2TSS A;  4N59 A;  4ACF A;  1WGK A;  4REZ A;  3IAS 1;  4JQW C;  5J17 A;  3M3J A;  3DBS A;  4N9F 4;  2KWC A;  3DBH I;  4K7U A;  4OVZ A;  3AU4 A;  3DQV A;  3UF8 A;  2FID A;  1WJU A;  3BK2 A;  2PEA A;  1WXS A;  2AL6 A;  2KOX A;  2KD0 A;  2HJ8 A;  4BKS D;  1JQ4 A;  4YXD B;  1YJJ A;  3NJT A;  2JVC A;  3L13 A;  3OAW A;  1QQR A;  4BOZ B;  4PS8 A;  3HK0 A;  3Q3F A;  4HK2 A;  4MJS B;  1J0G A;  1K50 A;  3TJP A;  4RCO A;  2DEN B;  1VD2 A;  2WDQ B;  3ONS A;  3RUI B;  4DQO C;  1YQB A;  1HE8 A;  2LMC A;  1V2Y A;  1WZ3 A;  2D2Q A;  5DPR A;  3MJW A;  3DBL I;  2AX5 A;  4A3P A;  4HPL B;  4K81 A;  2LGI A;  2INP E;  4A6Q A;  2REX A;  3I5J C;  5AZG A;  1UZX B;  5C3J B;  4URK A;  2KZR A;  1UWX A;  4WJP A;  2FCN A;  1FRR A;  5H8Y E;  1QOB A;  3UQB A;  1FNW A;  2MSE D;  3X23 A;  1V8C A;  2LGD A;  2MP2 B;  3APC A;  4OZB A;  2AL3 A;  2JF5 A;  2Y5P A;  2XK5 B;  2DYO A;  2WXI A;  4W9I A;  1WWT A;  1Q1O A;  2WYQ A;  3DWM A;  3H8H A;  4MDK E;  5DPT A;  3EUB 2;  5BYS A;  2IO1 B;  3GOE A;  2Z0E B;  3PPA A;  1WXV A;  1UBI A;  2KDI A;  1E8X A;  3NZ3 A;  4YSX B;  4IG7 B;  2LUE A;  4ZRQ A;  2MJE A;  2IDY A;  1K51 A;  1T0R C;  2L0F A;  5HHD G;  1BXT A;  1TY2 A;  1ISN A;  3JSV B;  3KWV A;  4DHJ D;  2AQ1 B;  2MX2 A;  2WS3 B;  3L54 A;  1AAR A;  4WWM A;  3TEY A;  4C4V A;  2D3B A;  5H92 C;  2KDB A;  3H1U A;  4E3C A;  1SXT A;  2XEW A;  1FEH A;  1KLV A;  2YEP F;  3AED B;  2NBW B;  4JGH B;  3RNC C; 
#chains in the Genus database with same CATH homology
 2QCZ A;  3Q6B A;  4BZA A;  4PK1 A;  4QAY A;  4K3B A;  4C00 A;  4C4V A;  4K3C A;  3OG5 A;  4C4V B;  3MC8 A;  2QDF A;  2X8X X;  2VH2 A;  4XGA B;  3EFC A;  3NJT A;  2MHJ A;  2V9H A;  2VH1 A;  3MC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...