3EFCA

Crystal structure of yaet periplasmic domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
327
structure length
327
Chain Sequence
GFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YaeT: conformational flexibility and substrate recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein assembly factor yaeT
total genus 72
structure length 327
sequence length 327
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA04
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA03
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA01
2QDFA 4K3BA 3OG5A 2QCZA 3MC9A 3EFCA 2MHJA 4PK1A 4C00A 2VH1A 4XGAB 3NJTA 2V9HA 2VH2A 4C4VA 2X8XX 4QAYA 3Q6BA 4C4VB 4K3CA 3MC8A 4BZAA
chains in the Genus database with same CATH superfamily
1FRDA 2IYDB 1KFYB 1IUEA 2NVUI 1XD3B 2JYTA 2G4DB 2RPVA 1AYFA 4I6NB 1ZPSA 4PYZA 3AE4B 1WJNA 1JWUD 2HTHA 1FXIA 3WIMA 2XK5B 3E56A 1WSPA 2AX5A 3FC4A 4W9DA 4M8NA 5C23A 3APCA 4US8A 1Y56A 4GOCA 2FE8A 3A1QA 2KWVB 3RNBC 2DYOA 3NVZA 4KSLC 2MH7A 4IUMB 1J19A 3AEGB 1RM6C 1KLGD 3A9KB 3DBRI 3P4PB 3VR8B 1E8WA 4W9LA 2KFKB 1L6UA 1YNTE 1AW7A 1CJEA 4P7IA 2KWCA 2O2VB 3NZSA 3IAM1 2WXPA 5D3DA 2MBEA 3DWMA 2JSVX 3TCAA 2H89B 1N5XA 1DYQA 3U30A 1I4QA 3NG0A 1MFWA 1SF0A 3DHHC 3P42A 1HEZE 2KJRA 3VH4B 3NRZA 2M1MA 1TBEA 1L0VB 3HVDA 2IGDA 3W2DA 3P4SB 3H1UA 3I57A 3VXWA 1QOAA 3L08A 5CHFA 3VDZA 3AE9B 4A9AA 1I4XA 2C7MB 2DLBA 3AXCA 1S3SG 3KVFB 2KZRA 1HQRD 3R7RA 4FHKA 2BB6A 3C8YA 2N9LA 3IVFA 5JHAA 1WR1A 5JH5C 4W9IA 3RZWC 1YN4A 3O65B 3ZRCA 2IO2B 4FJVB 4GDKB 4MH0E 3L0WB 4D2KA 3AE3B 5H8YE 3OJ3A 3MHZA 5IP4D 5JHBA 1ZOYB 4J3OD 2N4FA 1N6ZA 3VRBB 2BYTA 2SAKA 1FO4A 5IOIA 4PS8A 2FIFA 3UGBB 4MACA 3Q8EA 2KN5A 1RRBA 4FADA 3SEBA 1TYGB 5JZEB 3L4PA 4ZHOA 1PDXA 1MPEA 2BF8B 1R7SA 4I6PA 4XWTA 4HJKA 1TY0A 5HFYA 2JRHA 4B6WA 2TSSA 2FNJB 3Q3JA 2HTME 3UINB 1OQQA 2LI5A 3I5JC 3APFA 2LRUA 4NZLB 1BXTA 4A8XC 1F2RC 1F9JA 3KUDB 3ZQ4A 1E7VA 3BK1A 3TL5A 4HXDA 4P1BC 5BYRA 2OHFA 1P1AA 1VZ8A 2KO3A 3PO0A 5HKHA 3Q3FA 4NQKE 2WQYB 3RI7C 2KVZA 3A4SC 4US9A 3GE3C 5JXVA 1RLFA 2WXGA 4RGTA 4KX6B 2J52A 4NJCA 2BPSA 1OEYA 2WU5B 3NZUA 3DVNU 1HE8A 4FXCA 3PGEA 3V62A 1LQBA 1WR6E 3N1YC 2RPQA 4XDDA 3Q14C 1GB1A 2JPHA 3Q3OC 2L0TA 4WH4A 3H9DA 2QILA 4DXAB 3U7ZA 3VQIA 3ZTDA 4Q2JA 3H6NA 2PKOA 1VRAB 4ANXA 2KJHB 1YJ1A 2KDBA 1K53A 3NJTA 4NAWA 4FHJA 1UH6A 3M95A 2PW9A 3AMZA 2KN4A 3X23A 5DPTA 2EKEC 4FJYA 4HKZE 3RNGC 2AL6A 4C80A 3ZDTA 2KQSA 1AWDA 2WXHA 1VJKA 1S1QB 4CHKA 3KH0A 4NAWB 3VFKA 4WAFA 5E6OA 1VDVA 2QHOA 4E74A 3RPFC 2LVPA 3IXSA 2FCSA 2J4XA 1KRHA 4IM0A 3RZFA 1HA5A 2BGFA 2KFJA 5IO9A 2D10A 1YX5B 4OZCA 3V6EB 2O2VA 4YL8A 4LLGM 4MJSB 4A3OA 2VH1A 3PPAA 2YEPB 4JWSC 1SIFA 1WRDB 3PTFC 3QIJA 3QCAA 1I4PA 3HHMA 3ZLZA 4JL9A 1RYJA 4JX1C 2CJOA 1P0RA 2XK5A 4L2YA 1YX6B 4W9EA 4WIPA 1TS4A 2PTLA 2LXAA 4RGOS 3ZVVA 4HLEA 1CK1A 2KHWB 2AWTA 3B08A 2J42A 3EECA 4N6EB 2IGHA 2WXOA 4OHJA 3EFCA 4JE3B 2G3QB 1IBXB 3JSVB 5AUKA 3RCZA 1WX9A 5DPRA 3QA8A 3GS2A 2V9HA 3C19A 3N3KB 5IN7A 2MBQA 2MRPA 3M3JA 1TJEA 1LO5D 1B1ZA 2K0PA 2Z0DB 2QC8A 4GN1A 3DHGC 1BT0A 1ROEA 2DZKA 3I9V1 2V3NA 1KLVA 1R4MB 1HTOA 5DPWA 4N9F4 3Q3MC 1R4NB 4IWOA 1WY8A 1IP9A 3DVGX 1C9FA 1UGMA 2VZKB 4NJ7A 1BUIC 2N7DA 2WXIA 3SDLC 2LMCA 2QJLA 2QSDA 2LGDA 1Q0WB 2X38A 1C4PA 5E6PA 4EEWA 4HPLB 1P3QU 4F1SA 2IY1B 2GMIC 3M62B 3UF8A 2PVGC 4HEA1 2CHWA 2JU6X 4BKGA 1GC6A 3TEZA 3WAOA 3PSEB 3I3TB 3V61A 4MGZE 2ZJDA 1L6VA 4XDCA 1FNVA 3ZO5B 5D94A 1E5WA 3JVZX 3PLVA 2M19A 4AUQC 2ONQA 1YN3A 2LXCA 2WXNA 4AQ7A 4OW0A 3AECB 1N61A 3ZJUA 4K81A 3JYUA 3AU5A 2OJWA 3AE1B 1QF6A 1WX8A 1JWAD 2JQRB 3AM9A 3P4QB 3ZNGC 4NAMA 2M0XA 1WGHA 4K1RB 2D5GA 2O6VD 2LUMA 2MP2A 2LUEA 3EA6A 4RGNA 2DZIA 3GE8C 1UNSA 1WM2A 3N32A 2N7JA 3DWGC 3GOEA 4GMVA 5KHOA 4RF1A 4I6LB 2LVQA 1KM7A 4IG7B 2WNMA 4BBNF 2WXJA 2JZZA 4IWPA 4W9FA 1HTQA 3QAQA 4ICUA 3OLMD 1WMHA 2JXXA 1ET6A 3DOWA 4BZAA 2MA9B 2V1YA 1ACCA 3FAHA 4WWPA 2ICIA 3ML9A 2QIEB 2ZW0A 4LNKA 1JWBD 4RNAA 5BYSA 1KH0A 2MJ3A 1LFDA 3MC0B 1FXAA 3DHIC 3AN1A 2Q5WD 1ZXIA 4C4VB 1FCCC 3DBHB 2K8CA 1IYFA 1P98A 3ONSA 2JVCA 2MWSB 1PGXA 2YVCA 4C56C 2ZCCA 3DVNV 3NUHB 2DHZA 3ZXVA 4TV3A 1IBXA 3L10B 2KWUB 3BZDB 1KOTA 5HHDG 4DHJD 3ZJVA 4JIOU 3VTVA 2HJ1A 2EELA 3ZRFA 1V81A 4KGTA 2IDYA 3WALA 2L1AA 1V9JA 3VAWA 1FCLA 3Q2AC 1V1OA 4G0NB 2G4SA 2WXFA 1QOBA 4RMAA 1TS2A 2L76A 2MLBA 3J9CA 2KTRA 5BMGA 3ZGZA 2WP9B 3WANA 2BVCA 4DDID 2QEJC 3ZUNA 4ZYSA 2IO3B 4MSQB 2DENB 3QARA 1WI0A 2KQ4X 2IPKD 2L05A 2KTFA 2NR2A 5AUIA 2L32A 4EKUA 4WJNA 4HCNB 4ACFA 3PREA 3JSVA 1K51A 2M0AA 3Q8CA 2LZ6A 4WAAA 4XWWA 3T3NA 3DBLI 2KOXA 4DK5A 2BQQA 1QZEA 2ZVNA 4MT5A 2I2YA 1MG4A 1ESFA 1WGDA 3KYDD 1WWTA 2L7RA 2INDC 3Q8BA 3HUIA 4B0EA 3P2BA 4JLCA 4KSKC 3VH3B 1SBBB 4USAA 3EC8A 3ZIMA 1E8ZA 2KDMA 1MHXA 3WAMA 1WJ4A 1JW9D 4KV2A 2VH2A 3IT4B 1UBIA 2K1FA 4PS7A 3BY4B 1IGCA 1YMHE 2L8JA 4KZ0A 3VTWA 4DHJB 1WJUA 4GSWA 4B0MA 3DQVA 4GU2A 4LDTD 5DCNA 3FKYA 1C3TA 1DOXA 4RM9A 2DZJA 4J6IA 1JROA 4ZHPA 1V49A 1L0YB 4R3DA 5DPSA 2LVOA 2E3TA 2Y5BB 1UD7A 2CR5A 1I4GA 2IBIB 2K9XA 4EZJA 4JPSA 1OEYJ 2Y5PA 3UQAA 1T0RC 2KFKA 2WXLA 2V4IB 3SD5A 2RDGA 2LHDA 3QWZB 2MJDA 2ON8A 2AQ3B 1FMAD 3D32A 1JWSD 1GUAB 5FR6A 1JMLA 2D2QA 3H7PA 3RNCC 5HG2A 2KX3A 3LYYA 1KF6B 3U52E 4YSXB 1D5ZC 1WMHB 2FCMA 2BS4B 4OVVA 2BKFA 2W3SA 1C76A 1WGRA 2LGIA 2O6VA 1SXTA 4MGKE 4M00A 2LEKA 3VUXA 4F7ZA 4REZA 1E9MA 1YD8U 3ZNID 3AV8A 2RDHA 1B9RA 3PZ8A 4YXDB 3IHPC 4PS3A 5TSSA 2E6XA 2BS3B 2B76B 5AZFA 1T3QA 5FKAC 1XT9B 4HRSA 1RFKA 5LXHA 4HDOA 3HRDD 4KGRA 5C2TB 4AP4C 3Q69A 1EU4A 2ASQA 1L7YA 1ZUD2 5EE0A 1UELA 1NDDA 4F8CB 1F2RI 1WFYA 2ZW1A 4CYEA 2J7QB 4EZKA 1SE3A 2MQJA 1XLQA 3Q3NC 5L95C 2MEKA 2KDEB 2G9HD 1F1HA 2YEPF 1L5PA 2WGSA 1PUTA 1J7BA 4JQWC 1ZXHA 5C3JB 2AL3A 2MHJA 4ZYNA 3KWVA 2HJ8A 4XC2A 4MELA 2W82A 2ACZB 4M01A 2HD5B 3KLSX 4KIKA 2RD0A 1PFDA 2KC1A 4HK2A 2ZPNA 2JYEA 3NVYA 2BYEA 1XQQA 5EE1A 4GGQA 2K22A 1NI3A 3X0WA 4DBGA 1PYWD 4ZRIA 4ZRKA 4WURA 1TGZB 3A9JB 4GB9A 1C77A 2V3SA 4P1CC 1JRUA 1AARA 2L3ZA 2W3RA 3DBLB 3PS6A 4GDLB 4LNIA 4OVUA 2R61A 4MH8A 1XLOA 5LLIA 2Y5CA 4K7SA 3RUIB 5IA7A 1TKEA 3DBHI 3TUOA 2XN9C 1TZ1A 2JXTA 3T8MA 3AE7B 4M0WA 3R7QA 3TEYA 4C7YA 3LXFA 4IDIA 2BBCA 3CMMB 4CQNA 4FA6A 1SSNA 5G5HA 3N1ZC 1J7AA 4OZBA 4G11A 3ML8A 1WJ6A 1H4RA 4JWUC 4K7UA 3L13A 4BFRA 1OGWA 3RFZB 2DAFA 2I1JA 1R4NI 1V80A 4WWOA 1XXGA 2NCNA 4LTUA 2DWQA 3NVVA 3BYTB 2CS4A 1BMLC 3MTNB 3GZNB 3E9SA 1L4ZB 1CQVA 4WWMA 1Z2MA 2N1WA 2M17A 2KD0A 2INPE 2KTRB 1QOGA 1FNWA 4MEMA 2KWDA 4LNNA 5KHQA 4WJPA 1TTNA 2CU3A 3DDCB 2LASA 4TQ0A 2NBVB 2MW5A 2CHZA 2LGYA 3BVGA 3PT2B 3V6CB 4G50A 4CO7A 4YTMB 1QILA 4ANWA 1ENFA 2Z0EB 2KMAA 1D3ZA 4S17A 3FILB 1FM0D 3I63C 2D3CA 1ZGUB 1JRPA 3W1YA 2MBBB 4MSMB 4G3XB 1P9DU 4FLHA 4HPMB 4NY0A 4II2B 1F77A 4LNOA 2WDTB 1P7EA 3KUCB 3PLUA 5HI1A 3W9CB 4KGSA 2NTTA 3ZTCA 1MHHE 1Y8RC 3V3XA 4WJQA 4LJOB 1E8XA 3R2IA 1YQ4B 3MJWA 3TSSA 1WXQA 3MJ5A 4IC7B 4KDLB 3RNEC 5J17A 3VVWB 1OQYA 1WYGA 1HZ5A 1VD2A 1SE9A 3N1XC 2EKIA 1Z5SB 1UWMA 1NENB 2WLBA 1EWCA 4WWNA 3PHXB 2GBNA 2K6QA 1WE7A 3EFUA 3MP9A 1N62A 2K8BA 3TJPA 4RCOA 4DDGD 2AQ1B 2C60A 3IT6B 4MJSA 3V05A 1V97A 3SHQA 2V3PA 3H7SA 4N59A 4BOZB 2OOBB 2ZNVB 2FIDA 2GRIA 2N7EA 1SIJA 4URKA 5TR5A 2ZPYA 5T8IA 2V0GA 5FK9C 5C1ZA 3NS8A 3ENEA 1WRIA 3B2FA 2JY6A 2LFIA 1JALA 2LJ5A 3A9JA 4ZRJA 1UWXA 1D6EC 1M4VA 4WQOB 3PVLA 4N58A 1E8YA 1HZ6A 1FPYA 2A5UA 3UIOB 2B3AA 2MSED 2JX5A 5D2MB 3BWUD 2L52A 2KK8A 1YQ3B 5H92C 4GDKA 1WX7A 4BKSA 2DX5B 3NZ3A 4AJYB 4BKTA 2N9XA 2CJNA 4MM3A 4HROA 4A90A 4A3PA 3WAPA 3NVWA 4LDTB 1FRRA 4FN2A 1K8RB 4KIKB 4IWQA 2K3UA 1C1YB 2MJEA 1XEEA 2WDRB 2WXQA 4XZ4A 1OFFA 2PEAA 2GOWA 1T0SC 2C7NB 3N9YC 1RFAA 3L16A 4DWFA 3Q8FA 4QAYA 2W9NA 3ZYYX 1XCQL 3AE2B 2FBWB 1N5WA 1QKZA 3U7DA 2MX2A 3L17A 5LXIB 4TUUA 4HJGE 3GB1A 2BYVE 4PK1A 4C7ZA 2WXMA 3KWLA 4DHZB 4EUTA 4C00A 2PVOD 1VLBA 1WF9A 2G1EA 2LWPA 3AE5B 2W54A 4W9HA 3PV1A 1SJHD 1ZKHA 1I35A 1CZPA 4II3B 2CKHB 1A70A 1WZ0A 2LD9A 2D11A 2J53A 2BYFA 2N9EB 3WCQA 3W5UB 3S2AA 1UBQA 2JRIB 5G2NA 3B2GA 4LK0M 2IY0B 4OVZA 3RMKC 4TKNA 4HPPA 2C9WB 3B1LX 1KTKA 3DCGA 3IFWB 3W5VB 1GNUA 1V6EA 3PZ7A 4YSZB 1NYRA 2LGXA 1T0QC 3DBSA 3BVMA 3P1MA 2KKCA 1JQ4A 3AB5A 2XNAC 4K3BA 1E7UA 1T5XD 2C7HA 3KUZA 2HDEA 3TEWA 1AN8A 2WDVB 4H2AA 1D5XC 2NPTA 2WXKA 3BVZA 1KLUD 1NBFC 1L2NA 3MFGA 1WXSA 4W9CA 4C4VA 2KAJA 3CWIA 1YOVB 1MVKA 5AZGA 1WGGA 2K5PA 3A9KA 2BTEA 3U8ZA 1FIQA 3HK0A 3R66C 2GBKA 2W55A 4A20A 2RSUA 1DOIA 1H8CA 3AH7A 1EUVB 2N1VA 2IZVB 5AZHA 3RNFC 5FR3A 2G45B 2JWUA 1ZDVA 2KNBA 3AE8B 2V4LA 3R2TA 3RD2A 4DQOC 1JCKB 2VZKD 3JW0X 1TT5B 4XYCA 3W1SC 2FUHB 2K39A 2KDFB 4MM3B 1WM3A 2WX1A 4MGYE 2OEDA 4BOSC 2BW2A 4ITKA 1WYWB 5CTRC 4E71A 3P4RB 1JWMD 1WZ3A 2AYOB 1TZOA 1J7CA 4RGMA 1VZ7A 4AWJA 2D3GA 3VHTC 1GPXA 3TEXA 2REXA 3UI3A 3GP7A 1D4BA 1YN5A 3EGRA 4WJOA 1UF0A 4ARIA 1TKYA 2L00B 1SEBD 1L0XB 2PMVA 3HM6X 4B9KA 3U2SC 1FFVA 1N60A 4B95A 1NYQA 1OTRB 4LNFA 3SFEB 2N9PC 4BKSD 1XCTL 3QHTA 1WGKA 4WQMA 3PRMB 3ZXRA 2BS2B 4P6VF 1FD6A 1U4AA 4KDIC 1ZW7A 2PLPA 2BT6A 1C4CA 1VCBA 4O1NA 4ARCA 3NOBA 2DYBA 4NJ6A 4HKQA 3HVZA 2RMMA 1RWSA 2KMMA 2GBMA 2OJRA 2X8XX 3HIZA 1V1PA 2EMSA 4W9GA 1FXTB 2PIAA 1M94A 4YTPB 2NPTB 4EFOA 4ASWC 2SEBD 3M63B 3WA0A 2LRWA 2IO1B 1ZDXA 1YJIA 2L83A 2J0MA 2J0KA 3AI5A 3FILA 4W9JA 5CX3A 3H8HA 1EM7A 2BKRB 2KC2A 3Q6BA 3QQ8B 4L1BA 3VTUA 1L4DB 4KKJA 2M4NA 2FAZA 3TIXA 4EE2A 3B9JA 1EU3A 2DAJA 1T6BX 2RR9A 4M02A 1WXAA 3RYTA 4ICVA 2IO0B 5E6NA 3DPDA 2JUOA 4HVBA 2KT7A 2FUG1 3URYA 3V60A 2MCNB 2BB5A 3AEAB 3T3OA 4TSSA 1E0ZA 4A55A 2PJHA 4GXBA 4MGIE 5G5GA 2GBRA 1J0GA 4DHZE 1WXMA 4ZOHC 1RAXA 2WXRA 3RNAC 1STEA 4FBJB 3T9LA 2IJ0A 2KQ7A 4YSYB 1CMXB 2PE6B 2DNFA 4FULA 1UZXB 2LHEA 3L54A 2A4ZA 3R8BA 4UDUC 4KVGB 1GG3A 2O6VB 4L23A 4E3CA 2IGGA 2N0SB 1R4MI 4AS1A 1FNUA 1TY2A 2NBUA 2KVRA 3IAS1 3N30A 5D6JB 1KJTA 1V8CA 1PGBA 3AE6B 1TS5A 1PGAA 2K25A 5CHWA 4MDKE 3KW5B 3N20C 3QJZA 1E7PB 2L0FA 2ZEQA 4K3CA 3A4RA 1I7HA 2WYQA 4AJWA 3IBEA 4KKIA 3QK0A 4ANVA 3AU4A 1I4HA 2FCNA 2M8SA 1OQRA 3H7PB 4RH6A 3BK2A 2UU7A 1EO6A 3PRPB 4K7WA 4RM8A 3PRZA 4XE0A 4YWGG 1DOYA 5CHVC 1TS3A 4A6QA 3LDZE 3K9PB 1SE4A 3BIID 4LJPB 2MBOA 3SFDB 4YT0B 2GI9A 3DVGY 2GLSA 1Q5WB 2H88B 3SU8X 3VUYA 2Z8LA 1GC7A 3ETRA 2WS3B 2AQ2B 2UWQA 5AEKB 5BYQA 1P7FA 5J18A 2JZ3B 2ZVOA 2KJ6A 4IM3A 4NQLB 2INNE 4S0RA 3MC9A 1LXDA 1LM8B 1WE6A 1D5MC 2GB1A 2WX0A 2NMQA 4HWIB 3VR9B 3UIPB 1E6EB 2D3AA 4ANUA 3LJ3A 1VZ6A 1C79A 3NY5A 4DXFA 4XX5A 1VR9A 3MC8A 2QDFA 4NNJB 2RGFA 3OJ4B 5L83A 3BINA 3BYYB 5GXGB 3PHWB 2EMTA 2N9KA 3GZNI 3ZDMC 4ZDVA 4YTNB 4IOIE 3VRAB 1C78A 1F52A 5E6JA 2KDIA 3AEEB 3ZNHB 3AEDB 2CHXA 3NHEB 2KACA 2D3BA 2Z59B 1NI2A 2NTSA 5MPOA 2MBHA 3RULA 2UYZB 1EF5A 2ZZPB 2MP2B 3OWEB 4GIVA 4DXGA 2KYWA 1V5OA 2LJIA 2AEHA 3KYCD 3CF6E 4M8MA 3AULA 1SGHA 1WIAA 1WXVA 2QCZA 4EZLA 1YQBA 2K6DB 4LCDE 4ZRPA 1ISNA 3APDA 3OAWA 5D3IB 1NVID 4IM2A 1K52A 1ZE3D 1MG8A 1K50A 2DYMA 4PT5A 3PZDA 1LGRA 1GB4A 4GDLA 5IAAC 3NS1A 1QOFA 2CU1A 2VRRB 4AOFA 3ALBA 1IPGA 1GJZA 3W1SA 2QMTA 2LGSA 1PQSA 1UGJA 3K9OB 1WH3A 5EDSA 2K8HA 1XLNA 3EHVA 1V86A 1GAQB 1YIWA 1F0ZA 1QT9A 2NBWB 1FFUA 4BBNC 3CSFA 2I38A 3TBLD 2BWES 1GOZA 3AEBB 1E90A 2JWZA 3A1QB 1FEHA 5IKCM 2WHIA 1QLBB 5G55A 3ECIA 2INCC 4P16A 1A5RA 2R2QA 4GLSC 1XF5L 4M0WB 1NEKB 5EE9A 2C5LC 3B0AA 3LB8C 4JGHB 1E10A 2DBYA 1G6JA 1ZP0B 1V2YA 1SB3C 1DGJA 2JZPA 1WGYA 2Y3AA 3UQBA 2I1KA 2D07B 1I4RA 2BWFA 1J8CA 3DBRB 5BO4B 3AEFB 3CIRB 2KX0A 1TKGA 2PPHA 4XGAB 1TIFA 4PYUA 1UUPA 1T0YA 1EF1A 4BVUC 4X57B 4NPNA 2KLCA 3KQ4A 4BAXA 4EOYA 4W9KA 1I42A 3QX1A 1ET9A 2HE7A 3MHSD 2PE9A 3CSTA 3ZW3A 2KMCA 4HCPB 3R3MA 5I4DA 3ZKJC 3EUB2 4RFBA 1HXYD 2KXJA 2ZCBA 3C0RB 3OG5A 1C4AA 5BMHA 3ZNZB 2YLMA 2R2OA 1MI0A 2JT4B 3RT3B 1XLPA 2WU2B 3A33B 4KZCA 1SJED 2WWZA 2ZNVC 4TQ1A 1EWYC 5BMIA 2DZMA 1IGDA 2XEWA 3HM3A 1YJJA 5J2RA 2GBJA 2FCQA 2NS5A 1V1PB 3O13A 2JF5A 1V5TA 1QQRA 2XBBC 3RN9C 5LNK1 3VUWA 2KLGA 5GMVA 1Q1OA 3ABVB 4IKGA 2WDQB 1X1MA 4IW0A 3Q8AA 4OZAA 3U4EG 2J0JA 5EE3A 2RDBC 1Q10A 3P63A 1XO3A 4ZRQA 3ZJTA 4TMAB 3SR6A 3QC8B 3TMPB 1N63A 3IG3A 1SE2A 5D7GA 2KANA 4FJZA 1MJDA 4HDQA 2M56B 4RF0A
chains in the Genus database with same CATH topology
2QDFA 4K3BA 3OG5A 2QCZA 3MC9A 3EFCA 2MHJA 4PK1A 4C00A 2VH1A 4XGAB 3NJTA 2V9HA 2VH2A 4C4VA 2X8XX 4QAYA 3Q6BA 4C4VB 4K3CA 3MC8A 4BZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDF A;  4K3B A;  3OG5 A;  2QCZ A;  3MC9 A;  3EFC A;  2MHJ A;  4PK1 A;  4C00 A;  2VH1 A;  4XGA B;  3NJT A;  2V9H A;  2VH2 A;  4C4V A;  2X8X X;  4QAY A;  3Q6B A;  4C4V B;  4K3C A;  3MC8 A;  4BZA A; 
#chains in the Genus database with same CATH topology
 1FRD A;  2IYD B;  1KFY B;  1IUE A;  2NVU I;  1XD3 B;  2JYT A;  2G4D B;  2RPV A;  1AYF A;  4I6N B;  1ZPS A;  4PYZ A;  3AE4 B;  1WJN A;  1JWU D;  2HTH A;  1FXI A;  3WIM A;  2XK5 B;  3E56 A;  1WSP A;  2AX5 A;  3FC4 A;  4W9D A;  4M8N A;  5C23 A;  3APC A;  4US8 A;  1Y56 A;  4GOC A;  2FE8 A;  3A1Q A;  2KWV B;  3RNB C;  2DYO A;  3NVZ A;  4KSL C;  2MH7 A;  4IUM B;  1J19 A;  3AEG B;  1RM6 C;  1KLG D;  3A9K B;  3DBR I;  3P4P B;  3VR8 B;  1E8W A;  4W9L A;  2KFK B;  1L6U A;  1YNT E;  1AW7 A;  1CJE A;  4P7I A;  2KWC A;  2O2V B;  3NZS A;  3IAM 1;  2WXP A;  5D3D A;  2MBE A;  3DWM A;  2JSV X;  3TCA A;  2H89 B;  1N5X A;  1DYQ A;  3U30 A;  1I4Q A;  3NG0 A;  1MFW A;  1SF0 A;  3DHH C;  3P42 A;  1HEZ E;  2KJR A;  3VH4 B;  3NRZ A;  2M1M A;  1TBE A;  1L0V B;  3HVD A;  2IGD A;  3W2D A;  3P4S B;  3H1U A;  3I57 A;  3VXW A;  1QOA A;  3L08 A;  5CHF A;  3VDZ A;  3AE9 B;  4A9A A;  1I4X A;  2C7M B;  2DLB A;  3AXC A;  1S3S G;  3KVF B;  2KZR A;  1HQR D;  3R7R A;  4FHK A;  2BB6 A;  3C8Y A;  2N9L A;  3IVF A;  5JHA A;  1WR1 A;  5JH5 C;  4W9I A;  3RZW C;  1YN4 A;  3O65 B;  3ZRC A;  2IO2 B;  4FJV B;  4GDK B;  4MH0 E;  3L0W B;  4D2K A;  3AE3 B;  5H8Y E;  3OJ3 A;  3MHZ A;  5IP4 D;  5JHB A;  1ZOY B;  4J3O D;  2N4F A;  1N6Z A;  3VRB B;  2BYT A;  2SAK A;  1FO4 A;  5IOI A;  4PS8 A;  2FIF A;  3UGB B;  4MAC A;  3Q8E A;  2KN5 A;  1RRB A;  4FAD A;  3SEB A;  1TYG B;  5JZE B;  3L4P A;  4ZHO A;  1PDX A;  1MPE A;  2BF8 B;  1R7S A;  4I6P A;  4XWT A;  4HJK A;  1TY0 A;  5HFY A;  2JRH A;  4B6W A;  2TSS A;  2FNJ B;  3Q3J A;  2HTM E;  3UIN B;  1OQQ A;  2LI5 A;  3I5J C;  3APF A;  2LRU A;  4NZL B;  1BXT A;  4A8X C;  1F2R C;  1F9J A;  3KUD B;  3ZQ4 A;  1E7V A;  3BK1 A;  3TL5 A;  4HXD A;  4P1B C;  5BYR A;  2OHF A;  1P1A A;  1VZ8 A;  2KO3 A;  3PO0 A;  5HKH A;  3Q3F A;  4NQK E;  2WQY B;  3RI7 C;  2KVZ A;  3A4S C;  4US9 A;  3GE3 C;  5JXV A;  1RLF A;  2WXG A;  4RGT A;  4KX6 B;  2J52 A;  4NJC A;  2BPS A;  1OEY A;  2WU5 B;  3NZU A;  3DVN U;  1HE8 A;  4FXC A;  3PGE A;  3V62 A;  1LQB A;  1WR6 E;  3N1Y C;  2RPQ A;  4XDD A;  3Q14 C;  1GB1 A;  2JPH A;  3Q3O C;  2L0T A;  4WH4 A;  3H9D A;  2QIL A;  4DXA B;  3U7Z A;  3VQI A;  3ZTD A;  4Q2J A;  3H6N A;  2PKO A;  1VRA B;  4ANX A;  2KJH B;  1YJ1 A;  2KDB A;  1K53 A;  3NJT A;  4NAW A;  4FHJ A;  1UH6 A;  3M95 A;  2PW9 A;  3AMZ A;  2KN4 A;  3X23 A;  5DPT A;  2EKE C;  4FJY A;  4HKZ E;  3RNG C;  2AL6 A;  4C80 A;  3ZDT A;  2KQS A;  1AWD A;  2WXH A;  1VJK A;  1S1Q B;  4CHK A;  3KH0 A;  4NAW B;  3VFK A;  4WAF A;  5E6O A;  1VDV A;  2QHO A;  4E74 A;  3RPF C;  2LVP A;  3IXS A;  2FCS A;  2J4X A;  1KRH A;  4IM0 A;  3RZF A;  1HA5 A;  2BGF A;  2KFJ A;  5IO9 A;  2D10 A;  1YX5 B;  4OZC A;  3V6E B;  2O2V A;  4YL8 A;  4LLG M;  4MJS B;  4A3O A;  2VH1 A;  3PPA A;  2YEP B;  4JWS C;  1SIF A;  1WRD B;  3PTF C;  3QIJ A;  3QCA A;  1I4P A;  3HHM A;  3ZLZ A;  4JL9 A;  1RYJ A;  4JX1 C;  2CJO A;  1P0R A;  2XK5 A;  4L2Y A;  1YX6 B;  4W9E A;  4WIP A;  1TS4 A;  2PTL A;  2LXA A;  4RGO S;  3ZVV A;  4HLE A;  1CK1 A;  2KHW B;  2AWT A;  3B08 A;  2J42 A;  3EEC A;  4N6E B;  2IGH A;  2WXO A;  4OHJ A;  3EFC A;  4JE3 B;  2G3Q B;  1IBX B;  3JSV B;  5AUK A;  3RCZ A;  1WX9 A;  5DPR A;  3QA8 A;  3GS2 A;  2V9H A;  3C19 A;  3N3K B;  5IN7 A;  2MBQ A;  2MRP A;  3M3J A;  1TJE A;  1LO5 D;  1B1Z A;  2K0P A;  2Z0D B;  2QC8 A;  4GN1 A;  3DHG C;  1BT0 A;  1ROE A;  2DZK A;  3I9V 1;  2V3N A;  1KLV A;  1R4M B;  1HTO A;  5DPW A;  4N9F 4;  3Q3M C;  1R4N B;  4IWO A;  1WY8 A;  1IP9 A;  3DVG X;  1C9F A;  1UGM A;  2VZK B;  4NJ7 A;  1BUI C;  2N7D A;  2WXI A;  3SDL C;  2LMC A;  2QJL A;  2QSD A;  2LGD A;  1Q0W B;  2X38 A;  1C4P A;  5E6P A;  4EEW A;  4HPL B;  1P3Q U;  4F1S A;  2IY1 B;  2GMI C;  3M62 B;  3UF8 A;  2PVG C;  4HEA 1;  2CHW A;  2JU6 X;  4BKG A;  1GC6 A;  3TEZ A;  3WAO A;  3PSE B;  3I3T B;  3V61 A;  4MGZ E;  2ZJD A;  1L6V A;  4XDC A;  1FNV A;  3ZO5 B;  5D94 A;  1E5W A;  3JVZ X;  3PLV A;  2M19 A;  4AUQ C;  2ONQ A;  1YN3 A;  2LXC A;  2WXN A;  4AQ7 A;  4OW0 A;  3AEC B;  1N61 A;  3ZJU A;  4K81 A;  3JYU A;  3AU5 A;  2OJW A;  3AE1 B;  1QF6 A;  1WX8 A;  1JWA D;  2JQR B;  3AM9 A;  3P4Q B;  3ZNG C;  4NAM A;  2M0X A;  1WGH A;  4K1R B;  2D5G A;  2O6V D;  2LUM A;  2MP2 A;  2LUE A;  3EA6 A;  4RGN A;  2DZI A;  3GE8 C;  1UNS A;  1WM2 A;  3N32 A;  2N7J A;  3DWG C;  3GOE A;  4GMV A;  5KHO A;  4RF1 A;  4I6L B;  2LVQ A;  1KM7 A;  4IG7 B;  2WNM A;  4BBN F;  2WXJ A;  2JZZ A;  4IWP A;  4W9F A;  1HTQ A;  3QAQ A;  4ICU A;  3OLM D;  1WMH A;  2JXX A;  1ET6 A;  3DOW A;  4BZA A;  2MA9 B;  2V1Y A;  1ACC A;  3FAH A;  4WWP A;  2ICI A;  3ML9 A;  2QIE B;  2ZW0 A;  4LNK A;  1JWB D;  4RNA A;  5BYS A;  1KH0 A;  2MJ3 A;  1LFD A;  3MC0 B;  1FXA A;  3DHI C;  3AN1 A;  2Q5W D;  1ZXI A;  4C4V B;  1FCC C;  3DBH B;  2K8C A;  1IYF A;  1P98 A;  3ONS A;  2JVC A;  2MWS B;  1PGX A;  2YVC A;  4C56 C;  2ZCC A;  3DVN V;  3NUH B;  2DHZ A;  3ZXV A;  4TV3 A;  1IBX A;  3L10 B;  2KWU B;  3BZD B;  1KOT A;  5HHD G;  4DHJ D;  3ZJV A;  4JIO U;  3VTV A;  2HJ1 A;  2EEL A;  3ZRF A;  1V81 A;  4KGT A;  2IDY A;  3WAL A;  2L1A A;  1V9J A;  3VAW A;  1FCL A;  3Q2A C;  1V1O A;  4G0N B;  2G4S A;  2WXF A;  1QOB A;  4RMA A;  1TS2 A;  2L76 A;  2MLB A;  3J9C A;  2KTR A;  5BMG A;  3ZGZ A;  2WP9 B;  3WAN A;  2BVC A;  4DDI D;  2QEJ C;  3ZUN A;  4ZYS A;  2IO3 B;  4MSQ B;  2DEN B;  3QAR A;  1WI0 A;  2KQ4 X;  2IPK D;  2L05 A;  2KTF A;  2NR2 A;  5AUI A;  2L32 A;  4EKU A;  4WJN A;  4HCN B;  4ACF A;  3PRE A;  3JSV A;  1K51 A;  2M0A A;  3Q8C A;  2LZ6 A;  4WAA A;  4XWW A;  3T3N A;  3DBL I;  2KOX A;  4DK5 A;  2BQQ A;  1QZE A;  2ZVN A;  4MT5 A;  2I2Y A;  1MG4 A;  1ESF A;  1WGD A;  3KYD D;  1WWT A;  2L7R A;  2IND C;  3Q8B A;  3HUI A;  4B0E A;  3P2B A;  4JLC A;  4KSK C;  3VH3 B;  1SBB B;  4USA A;  3EC8 A;  3ZIM A;  1E8Z A;  2KDM A;  1MHX A;  3WAM A;  1WJ4 A;  1JW9 D;  4KV2 A;  2VH2 A;  3IT4 B;  1UBI A;  2K1F A;  4PS7 A;  3BY4 B;  1IGC A;  1YMH E;  2L8J A;  4KZ0 A;  3VTW A;  4DHJ B;  1WJU A;  4GSW A;  4B0M A;  3DQV A;  4GU2 A;  4LDT D;  5DCN A;  3FKY A;  1C3T A;  1DOX A;  4RM9 A;  2DZJ A;  4J6I A;  1JRO A;  4ZHP A;  1V49 A;  1L0Y B;  4R3D A;  5DPS A;  2LVO A;  2E3T A;  2Y5B B;  1UD7 A;  2CR5 A;  1I4G A;  2IBI B;  2K9X A;  4EZJ A;  4JPS A;  1OEY J;  2Y5P A;  3UQA A;  1T0R C;  2KFK A;  2WXL A;  2V4I B;  3SD5 A;  2RDG A;  2LHD A;  3QWZ B;  2MJD A;  2ON8 A;  2AQ3 B;  1FMA D;  3D32 A;  1JWS D;  1GUA B;  5FR6 A;  1JML A;  2D2Q A;  3H7P A;  3RNC C;  5HG2 A;  2KX3 A;  3LYY A;  1KF6 B;  3U52 E;  4YSX B;  1D5Z C;  1WMH B;  2FCM A;  2BS4 B;  4OVV A;  2BKF A;  2W3S A;  1C76 A;  1WGR A;  2LGI A;  2O6V A;  1SXT A;  4MGK E;  4M00 A;  2LEK A;  3VUX A;  4F7Z A;  4REZ A;  1E9M A;  1YD8 U;  3ZNI D;  3AV8 A;  2RDH A;  1B9R A;  3PZ8 A;  4YXD B;  3IHP C;  4PS3 A;  5TSS A;  2E6X A;  2BS3 B;  2B76 B;  5AZF A;  1T3Q A;  5FKA C;  1XT9 B;  4HRS A;  1RFK A;  5LXH A;  4HDO A;  3HRD D;  4KGR A;  5C2T B;  4AP4 C;  3Q69 A;  1EU4 A;  2ASQ A;  1L7Y A;  1ZUD 2;  5EE0 A;  1UEL A;  1NDD A;  4F8C B;  1F2R I;  1WFY A;  2ZW1 A;  4CYE A;  2J7Q B;  4EZK A;  1SE3 A;  2MQJ A;  1XLQ A;  3Q3N C;  5L95 C;  2MEK A;  2KDE B;  2G9H D;  1F1H A;  2YEP F;  1L5P A;  2WGS A;  1PUT A;  1J7B A;  4JQW C;  1ZXH A;  5C3J B;  2AL3 A;  2MHJ A;  4ZYN A;  3KWV A;  2HJ8 A;  4XC2 A;  4MEL A;  2W82 A;  2ACZ B;  4M01 A;  2HD5 B;  3KLS X;  4KIK A;  2RD0 A;  1PFD A;  2KC1 A;  4HK2 A;  2ZPN A;  2JYE A;  3NVY A;  2BYE A;  1XQQ A;  5EE1 A;  4GGQ A;  2K22 A;  1NI3 A;  3X0W A;  4DBG A;  1PYW D;  4ZRI A;  4ZRK A;  4WUR A;  1TGZ B;  3A9J B;  4GB9 A;  1C77 A;  2V3S A;  4P1C C;  1JRU A;  1AAR A;  2L3Z A;  2W3R A;  3DBL B;  3PS6 A;  4GDL B;  4LNI A;  4OVU A;  2R61 A;  4MH8 A;  1XLO A;  5LLI A;  2Y5C A;  4K7S A;  3RUI B;  5IA7 A;  1TKE A;  3DBH I;  3TUO A;  2XN9 C;  1TZ1 A;  2JXT A;  3T8M A;  3AE7 B;  4M0W A;  3R7Q A;  3TEY A;  4C7Y A;  3LXF A;  4IDI A;  2BBC A;  3CMM B;  4CQN A;  4FA6 A;  1SSN A;  5G5H A;  3N1Z C;  1J7A A;  4OZB A;  4G11 A;  3ML8 A;  1WJ6 A;  1H4R A;  4JWU C;  4K7U A;  3L13 A;  4BFR A;  1OGW A;  3RFZ B;  2DAF A;  2I1J A;  1R4N I;  1V80 A;  4WWO A;  1XXG A;  2NCN A;  4LTU A;  2DWQ A;  3NVV A;  3BYT B;  2CS4 A;  1BML C;  3MTN B;  3GZN B;  3E9S A;  1L4Z B;  1CQV A;  4WWM A;  1Z2M A;  2N1W A;  2M17 A;  2KD0 A;  2INP E;  2KTR B;  1QOG A;  1FNW A;  4MEM A;  2KWD A;  4LNN A;  5KHQ A;  4WJP A;  1TTN A;  2CU3 A;  3DDC B;  2LAS A;  4TQ0 A;  2NBV B;  2MW5 A;  2CHZ A;  2LGY A;  3BVG A;  3PT2 B;  3V6C B;  4G50 A;  4CO7 A;  4YTM B;  1QIL A;  4ANW A;  1ENF A;  2Z0E B;  2KMA A;  1D3Z A;  4S17 A;  3FIL B;  1FM0 D;  3I63 C;  2D3C A;  1ZGU B;  1JRP A;  3W1Y A;  2MBB B;  4MSM B;  4G3X B;  1P9D U;  4FLH A;  4HPM B;  4NY0 A;  4II2 B;  1F77 A;  4LNO A;  2WDT B;  1P7E A;  3KUC B;  3PLU A;  5HI1 A;  3W9C B;  4KGS A;  2NTT A;  3ZTC A;  1MHH E;  1Y8R C;  3V3X A;  4WJQ A;  4LJO B;  1E8X A;  3R2I A;  1YQ4 B;  3MJW A;  3TSS A;  1WXQ A;  3MJ5 A;  4IC7 B;  4KDL B;  3RNE C;  5J17 A;  3VVW B;  1OQY A;  1WYG A;  1HZ5 A;  1VD2 A;  1SE9 A;  3N1X C;  2EKI A;  1Z5S B;  1UWM A;  1NEN B;  2WLB A;  1EWC A;  4WWN A;  3PHX B;  2GBN A;  2K6Q A;  1WE7 A;  3EFU A;  3MP9 A;  1N62 A;  2K8B A;  3TJP A;  4RCO A;  4DDG D;  2AQ1 B;  2C60 A;  3IT6 B;  4MJS A;  3V05 A;  1V97 A;  3SHQ A;  2V3P A;  3H7S A;  4N59 A;  4BOZ B;  2OOB B;  2ZNV B;  2FID A;  2GRI A;  2N7E A;  1SIJ A;  4URK A;  5TR5 A;  2ZPY A;  5T8I A;  2V0G A;  5FK9 C;  5C1Z A;  3NS8 A;  3ENE A;  1WRI A;  3B2F A;  2JY6 A;  2LFI A;  1JAL A;  2LJ5 A;  3A9J A;  4ZRJ A;  1UWX A;  1D6E C;  1M4V A;  4WQO B;  3PVL A;  4N58 A;  1E8Y A;  1HZ6 A;  1FPY A;  2A5U A;  3UIO B;  2B3A A;  2MSE D;  2JX5 A;  5D2M B;  3BWU D;  2L52 A;  2KK8 A;  1YQ3 B;  5H92 C;  4GDK A;  1WX7 A;  4BKS A;  2DX5 B;  3NZ3 A;  4AJY B;  4BKT A;  2N9X A;  2CJN A;  4MM3 A;  4HRO A;  4A90 A;  4A3P A;  3WAP A;  3NVW A;  4LDT B;  1FRR A;  4FN2 A;  1K8R B;  4KIK B;  4IWQ A;  2K3U A;  1C1Y B;  2MJE A;  1XEE A;  2WDR B;  2WXQ A;  4XZ4 A;  1OFF A;  2PEA A;  2GOW A;  1T0S C;  2C7N B;  3N9Y C;  1RFA A;  3L16 A;  4DWF A;  3Q8F A;  4QAY A;  2W9N A;  3ZYY X;  1XCQ L;  3AE2 B;  2FBW B;  1N5W A;  1QKZ A;  3U7D A;  2MX2 A;  3L17 A;  5LXI B;  4TUU A;  4HJG E;  3GB1 A;  2BYV E;  4PK1 A;  4C7Z A;  2WXM A;  3KWL A;  4DHZ B;  4EUT A;  4C00 A;  2PVO D;  1VLB A;  1WF9 A;  2G1E A;  2LWP A;  3AE5 B;  2W54 A;  4W9H A;  3PV1 A;  1SJH D;  1ZKH A;  1I35 A;  1CZP A;  4II3 B;  2CKH B;  1A70 A;  1WZ0 A;  2LD9 A;  2D11 A;  2J53 A;  2BYF A;  2N9E B;  3WCQ A;  3W5U B;  3S2A A;  1UBQ A;  2JRI B;  5G2N A;  3B2G A;  4LK0 M;  2IY0 B;  4OVZ A;  3RMK C;  4TKN A;  4HPP A;  2C9W B;  3B1L X;  1KTK A;  3DCG A;  3IFW B;  3W5V B;  1GNU A;  1V6E A;  3PZ7 A;  4YSZ B;  1NYR A;  2LGX A;  1T0Q C;  3DBS A;  3BVM A;  3P1M A;  2KKC A;  1JQ4 A;  3AB5 A;  2XNA C;  4K3B A;  1E7U A;  1T5X D;  2C7H A;  3KUZ A;  2HDE A;  3TEW A;  1AN8 A;  2WDV B;  4H2A A;  1D5X C;  2NPT A;  2WXK A;  3BVZ A;  1KLU D;  1NBF C;  1L2N A;  3MFG A;  1WXS A;  4W9C A;  4C4V A;  2KAJ A;  3CWI A;  1YOV B;  1MVK A;  5AZG A;  1WGG A;  2K5P A;  3A9K A;  2BTE A;  3U8Z A;  1FIQ A;  3HK0 A;  3R66 C;  2GBK A;  2W55 A;  4A20 A;  2RSU A;  1DOI A;  1H8C A;  3AH7 A;  1EUV B;  2N1V A;  2IZV B;  5AZH A;  3RNF C;  5FR3 A;  2G45 B;  2JWU A;  1ZDV A;  2KNB A;  3AE8 B;  2V4L A;  3R2T A;  3RD2 A;  4DQO C;  1JCK B;  2VZK D;  3JW0 X;  1TT5 B;  4XYC A;  3W1S C;  2FUH B;  2K39 A;  2KDF B;  4MM3 B;  1WM3 A;  2WX1 A;  4MGY E;  2OED A;  4BOS C;  2BW2 A;  4ITK A;  1WYW B;  5CTR C;  4E71 A;  3P4R B;  1JWM D;  1WZ3 A;  2AYO B;  1TZO A;  1J7C A;  4RGM A;  1VZ7 A;  4AWJ A;  2D3G A;  3VHT C;  1GPX A;  3TEX A;  2REX A;  3UI3 A;  3GP7 A;  1D4B A;  1YN5 A;  3EGR A;  4WJO A;  1UF0 A;  4ARI A;  1TKY A;  2L00 B;  1SEB D;  1L0X B;  2PMV A;  3HM6 X;  4B9K A;  3U2S C;  1FFV A;  1N60 A;  4B95 A;  1NYQ A;  1OTR B;  4LNF A;  3SFE B;  2N9P C;  4BKS D;  1XCT L;  3QHT A;  1WGK A;  4WQM A;  3PRM B;  3ZXR A;  2BS2 B;  4P6V F;  1FD6 A;  1U4A A;  4KDI C;  1ZW7 A;  2PLP A;  2BT6 A;  1C4C A;  1VCB A;  4O1N A;  4ARC A;  3NOB A;  2DYB A;  4NJ6 A;  4HKQ A;  3HVZ A;  2RMM A;  1RWS A;  2KMM A;  2GBM A;  2OJR A;  2X8X X;  3HIZ A;  1V1P A;  2EMS A;  4W9G A;  1FXT B;  2PIA A;  1M94 A;  4YTP B;  2NPT B;  4EFO A;  4ASW C;  2SEB D;  3M63 B;  3WA0 A;  2LRW A;  2IO1 B;  1ZDX A;  1YJI A;  2L83 A;  2J0M A;  2J0K A;  3AI5 A;  3FIL A;  4W9J A;  5CX3 A;  3H8H A;  1EM7 A;  2BKR B;  2KC2 A;  3Q6B A;  3QQ8 B;  4L1B A;  3VTU A;  1L4D B;  4KKJ A;  2M4N A;  2FAZ A;  3TIX A;  4EE2 A;  3B9J A;  1EU3 A;  2DAJ A;  1T6B X;  2RR9 A;  4M02 A;  1WXA A;  3RYT A;  4ICV A;  2IO0 B;  5E6N A;  3DPD A;  2JUO A;  4HVB A;  2KT7 A;  2FUG 1;  3URY A;  3V60 A;  2MCN B;  2BB5 A;  3AEA B;  3T3O A;  4TSS A;  1E0Z A;  4A55 A;  2PJH A;  4GXB A;  4MGI E;  5G5G A;  2GBR A;  1J0G A;  4DHZ E;  1WXM A;  4ZOH C;  1RAX A;  2WXR A;  3RNA C;  1STE A;  4FBJ B;  3T9L A;  2IJ0 A;  2KQ7 A;  4YSY B;  1CMX B;  2PE6 B;  2DNF A;  4FUL A;  1UZX B;  2LHE A;  3L54 A;  2A4Z A;  3R8B A;  4UDU C;  4KVG B;  1GG3 A;  2O6V B;  4L23 A;  4E3C A;  2IGG A;  2N0S B;  1R4M I;  4AS1 A;  1FNU A;  1TY2 A;  2NBU A;  2KVR A;  3IAS 1;  3N30 A;  5D6J B;  1KJT A;  1V8C A;  1PGB A;  3AE6 B;  1TS5 A;  1PGA A;  2K25 A;  5CHW A;  4MDK E;  3KW5 B;  3N20 C;  3QJZ A;  1E7P B;  2L0F A;  2ZEQ A;  4K3C A;  3A4R A;  1I7H A;  2WYQ A;  4AJW A;  3IBE A;  4KKI A;  3QK0 A;  4ANV A;  3AU4 A;  1I4H A;  2FCN A;  2M8S A;  1OQR A;  3H7P B;  4RH6 A;  3BK2 A;  2UU7 A;  1EO6 A;  3PRP B;  4K7W A;  4RM8 A;  3PRZ A;  4XE0 A;  4YWG G;  1DOY A;  5CHV C;  1TS3 A;  4A6Q A;  3LDZ E;  3K9P B;  1SE4 A;  3BII D;  4LJP B;  2MBO A;  3SFD B;  4YT0 B;  2GI9 A;  3DVG Y;  2GLS A;  1Q5W B;  2H88 B;  3SU8 X;  3VUY A;  2Z8L A;  1GC7 A;  3ETR A;  2WS3 B;  2AQ2 B;  2UWQ A;  5AEK B;  5BYQ A;  1P7F A;  5J18 A;  2JZ3 B;  2ZVO A;  2KJ6 A;  4IM3 A;  4NQL B;  2INN E;  4S0R A;  3MC9 A;  1LXD A;  1LM8 B;  1WE6 A;  1D5M C;  2GB1 A;  2WX0 A;  2NMQ A;  4HWI B;  3VR9 B;  3UIP B;  1E6E B;  2D3A A;  4ANU A;  3LJ3 A;  1VZ6 A;  1C79 A;  3NY5 A;  4DXF A;  4XX5 A;  1VR9 A;  3MC8 A;  2QDF A;  4NNJ B;  2RGF A;  3OJ4 B;  5L83 A;  3BIN A;  3BYY B;  5GXG B;  3PHW B;  2EMT A;  2N9K A;  3GZN I;  3ZDM C;  4ZDV A;  4YTN B;  4IOI E;  3VRA B;  1C78 A;  1F52 A;  5E6J A;  2KDI A;  3AEE B;  3ZNH B;  3AED B;  2CHX A;  3NHE B;  2KAC A;  2D3B A;  2Z59 B;  1NI2 A;  2NTS A;  5MPO A;  2MBH A;  3RUL A;  2UYZ B;  1EF5 A;  2ZZP B;  2MP2 B;  3OWE B;  4GIV A;  4DXG A;  2KYW A;  1V5O A;  2LJI A;  2AEH A;  3KYC D;  3CF6 E;  4M8M A;  3AUL A;  1SGH A;  1WIA A;  1WXV A;  2QCZ A;  4EZL A;  1YQB A;  2K6D B;  4LCD E;  4ZRP A;  1ISN A;  3APD A;  3OAW A;  5D3I B;  1NVI D;  4IM2 A;  1K52 A;  1ZE3 D;  1MG8 A;  1K50 A;  2DYM A;  4PT5 A;  3PZD A;  1LGR A;  1GB4 A;  4GDL A;  5IAA C;  3NS1 A;  1QOF A;  2CU1 A;  2VRR B;  4AOF A;  3ALB A;  1IPG A;  1GJZ A;  3W1S A;  2QMT A;  2LGS A;  1PQS A;  1UGJ A;  3K9O B;  1WH3 A;  5EDS A;  2K8H A;  1XLN A;  3EHV A;  1V86 A;  1GAQ B;  1YIW A;  1F0Z A;  1QT9 A;  2NBW B;  1FFU A;  4BBN C;  3CSF A;  2I38 A;  3TBL D;  2BWE S;  1GOZ A;  3AEB B;  1E90 A;  2JWZ A;  3A1Q B;  1FEH A;  5IKC M;  2WHI A;  1QLB B;  5G55 A;  3ECI A;  2INC C;  4P16 A;  1A5R A;  2R2Q A;  4GLS C;  1XF5 L;  4M0W B;  1NEK B;  5EE9 A;  2C5L C;  3B0A A;  3LB8 C;  4JGH B;  1E10 A;  2DBY A;  1G6J A;  1ZP0 B;  1V2Y A;  1SB3 C;  1DGJ A;  2JZP A;  1WGY A;  2Y3A A;  3UQB A;  2I1K A;  2D07 B;  1I4R A;  2BWF A;  1J8C A;  3DBR B;  5BO4 B;  3AEF B;  3CIR B;  2KX0 A;  1TKG A;  2PPH A;  4XGA B;  1TIF A;  4PYU A;  1UUP A;  1T0Y A;  1EF1 A;  4BVU C;  4X57 B;  4NPN A;  2KLC A;  3KQ4 A;  4BAX A;  4EOY A;  4W9K A;  1I42 A;  3QX1 A;  1ET9 A;  2HE7 A;  3MHS D;  2PE9 A;  3CST A;  3ZW3 A;  2KMC A;  4HCP B;  3R3M A;  5I4D A;  3ZKJ C;  3EUB 2;  4RFB A;  1HXY D;  2KXJ A;  2ZCB A;  3C0R B;  3OG5 A;  1C4A A;  5BMH A;  3ZNZ B;  2YLM A;  2R2O A;  1MI0 A;  2JT4 B;  3RT3 B;  1XLP A;  2WU2 B;  3A33 B;  4KZC A;  1SJE D;  2WWZ A;  2ZNV C;  4TQ1 A;  1EWY C;  5BMI A;  2DZM A;  1IGD A;  2XEW A;  3HM3 A;  1YJJ A;  5J2R A;  2GBJ A;  2FCQ A;  2NS5 A;  1V1P B;  3O13 A;  2JF5 A;  1V5T A;  1QQR A;  2XBB C;  3RN9 C;  5LNK 1;  3VUW A;  2KLG A;  5GMV A;  1Q1O A;  3ABV B;  4IKG A;  2WDQ B;  1X1M A;  4IW0 A;  3Q8A A;  4OZA A;  3U4E G;  2J0J A;  5EE3 A;  2RDB C;  1Q10 A;  3P63 A;  1XO3 A;  4ZRQ A;  3ZJT A;  4TMA B;  3SR6 A;  3QC8 B;  3TMP B;  1N63 A;  3IG3 A;  1SE2 A;  5D7G A;  2KAN A;  4FJZ A;  1MJD A;  4HDQ A;  2M56 B;  4RF0 A; 
#chains in the Genus database with same CATH homology
 2QDF A;  4K3B A;  3OG5 A;  2QCZ A;  3MC9 A;  3EFC A;  2MHJ A;  4PK1 A;  4C00 A;  2VH1 A;  4XGA B;  3NJT A;  2V9H A;  2VH2 A;  4C4V A;  2X8X X;  4QAY A;  3Q6B A;  4C4V B;  4K3C A;  3MC8 A;  4BZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...