3EFCA

Crystal structure of yaet periplasmic domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
327
structure length
327
Chain Sequence
GFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor yaeT
publication title Crystal structure of YaeT: conformational flexibility and substrate recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 72
structure length 327
sequence length 327
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA04
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA03
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA01
4QAYA 4PK1A 2VH1A 4BZAA 3NJTA 2VH2A 2X8XX 4C00A 2V9HA 2MHJA 4K3BA 4K3CA 3OG5A 3EFCA 2QDFA 4C4VA 3Q6BA 4XGAB 3MC9A 2QCZA 4C4VB 3MC8A
chains in the Genus database with same CATH superfamily
1KLVA 4MGIE 4GOCA 4MEMA 2LGYA 4CHKA 5IKCM 2CS4A 3NVVA 4TKNA 4MGKE 1DOIA 1ZXHA 2EKIA 1LQBA 2N4FA 4TQ1A 2K6QA 3L17A 2DHZA 1LO5D 2O6VD 1T3QA 3NS1A 1MPEA 3HRDD 2V4IB 1KLUD 3W2DA 1F9JA 3V60A 3N9YC 2ZCBA 5BMGA 4KX6B 3KWVA 4OW0A 5CHVC 3OWEB 2PEAA 2IY1B 1GC7A 5DPWA 5DPRA 2BPSA 4HPPA 1P0RA 2N9PC 1MHHE 3RNAC 2DAJA 3UIPB 3ZRFA 1VD2A 3IFWB 3Q8BA 1L0XB 4NY0A 2WXQA 1V9JA 2KDIA 1LM8B 3H6NA 4G50A 3EUB2 2CJOA 4EFOA 4LLGM 2KQSA 4NQLB 1GB4A 2BW2A 4HPMB 2GOWA 2YLMA 2K22A 4RF1A 3AM9A 2MA9B 1FNUA 2K6DB 3KUCB 2WXMA 2JPHA 4IM0A 2L8JA 1WE7A 1XLQA 4JL9A 3RUIB 3DQVA 1S3SG 3TEZA 2ACZB 2V0GA 3O65B 2K3UA 2WDQB 2K25A 1IUEA 3RNFC 3VQIA 4IUMB 4ANWA 3HM3A 4L1BA 4BAXA 2CU1A 4LNIA 4ZYSA 1Q0WB 2IO2B 1GOZA 4KVGB 2CHZA 2C7MB 2GRIA 4A20A 4LDTB 2LI5A 1CMXB 1QOBA 3QQ8B 1ZPSA 1T0RC 2D3BA 3V05A 4C4VB 4IKGA 4GXBA 2AQ2B 3TIXA 4P1BC 3DBSA 2W3SA 2G3QB 3RMKC 4HEA1 5EE0A 3N3KB 1V49A 4E74A 5HFYA 3ZDMC 3CSTA 3L10B 2DWQA 4WJPA 2IGGA 2LZ6A 1YX6B 1WXVA 2FCMA 3VR9B 5H92C 1SE9A 1Z5SB 5BMHA 2MBEA 5FK9C 3SR6A 1FPYA 4OHJA 2IBIB 1ZP0B 2Z0EB 3ZDTA 2NVUI 4C56C 1E8XA 2REXA 3FAHA 1P98A 4IM2A 2KLGA 2BS2B 1UZXB 2FCNA 1EO6A 1XT9B 3QAQA 4MJSA 3VH4B 3ZGZA 2MEKA 1OGWA 1KF6B 5L95C 1XCQL 1E6EB 1C76A 3ZJVA 2BVCA 1DOXA 3M95A 3L16A 1M4VA 1I4HA 2M4NA 2J4XA 4HWIB 1OFFA 1OEYJ 1I4QA 5JXVA 2KZRA 1D5XC 3TEWA 1ZOYB 1H8CA 4A8XC 4YXDB 1N62A 3BK2A 3BIID 4ZRKA 2JZPA 1J19A 2JRHA 4W9IA 2KYWA 3U30A 3TJPA 2DAFA 5AZGA 3ZRCA 1QOGA 1C4AA 3AEDB 3LDZE 1OQQA 1EWYC 5JHAA 1S1QB 1YJJA 2IGDA 1IYFA 4KZCA 2FNJB 5E6NA 1MG4A 1TS4A 3GOEA 4NAWB 3P42A 2WDRB 4D2KA 4FADA 1VZ8A 4B6WA 3DVGX 4HRSA 5C1ZA 1NVID 3A9JA 3M62B 1R4NB 5CHFA 3GZNI 3MC8A 4YWGG 2XK5A 1E9MA 1EF1A 5BO4B 1TY2A 4RMAA 1QT9A 3KYDD 3OAWA 3RD2A 2HD5B 1WX8A 2ZPYA 3A9KB 5G5GA 3DHGC 2PMVA 3RNGC 2ON8A 2N9LA 1V81A 4W9GA 1V80A 1F0ZA 1YQ3B 2NS5A 4RH6A 3PPAA 1FRRA 2D11A 4RM9A 3AXCA 1L4DB 5KHOA 4AP4C 2BF8B 4DXGA 1FMAD 1B9RA 5DPTA 3EECA 2FIFA 3VTUA 4BKSA 4JX1C 1R4MI 5HKHA 5GMVA 3RI7C 3ZJUA 4HLEA 1PGAA 3ONSA 2BB6A 2LJIA 3AE9B 3GB1A 2JQRB 2W55A 1TY0A 3JW0X 3TEXA 1Q10A 4ICVA 1RM6C 2NR2A 4G0NB 3SFDB 4XWTA 3P4PB 3MP9A 3MHSD 3UGBB 3AE3B 2Z8LA 5IAAC 5J17A 4HKQA 4I6LB 3ZTDA 2H89B 2IDYA 2L83A 4GMVA 2HTME 2AL3A 4KSLC 1FO4A 1L4ZB 1SJED 2FUG1 4DQOC 5G5HA 5HI1A 2LUMA 1J7CA 3APFA 4IG7B 5CHWA 2NMQA 1FRDA 2M56B 4DK5A 2FAZA 5KHQA 2DZKA 1QOFA 2LWPA 3X0WA 1VCBA 2PPHA 4ARIA 2R2OA 1UGJA 3J9CA 4YSXB 3IAM1 2G9HD 2CHWA 2O2VA 2WU2B 2KK8A 1WX9A 2IO3B 4CO7A 4X57B 4L23A 1XF5L 4HVBA 3ZO5B 1V1PB 4RCOA 3WAOA 3EHVA 3Q3MC 2K5PA 3AV8A 4F1SA 3N30A 1YN3A 5FR3A 2MJ3A 1C3TA 1TKGA 4FBJB 2CKHB 3AE1B 3FC4A 4C80A 4YTPB 3I57A 2BS3B 2ZEQA 4MH8A 4K7SA 4A6QA 1YIWA 4ANVA 2O6VA 4XZ4A 3S2AA 2WXIA 4M00A 5C3JB 2PTLA 2KMMA 1E8ZA 3ECIA 3IT6B 2WXRA 3ML8A 2X8XX 4RGTA 4G11A 1GPXA 4JE3B 4XYCA 1YNTE 1GJZA 3B9JA 2UWQA 1VJKA 1AN8A 2G4SA 2D07B 2LGSA 1E10A 2HDEA 2XN9C 4E3CA 1TIFA 3GE8C 2R61A 2MCNB 4MGZE 2LVQA 2HE7A 2RPQA 3H9DA 4ACFA 1NI3A 5MPOA 2BYVE 1IPGA 3RULA 1OTRB 2L76A 4KGSA 4FN2A 2C5LC 3GS2A 3WCQA 2LXCA 4MJSB 2KDMA 2KC1A 1V8CA 3ZNHB 4LNOA 2BT6A 4JGHB 3EA6A 1WYGA 4K81A 4GSWA 4C00A 3W1SA 2KOXA 4WH4A 1WX7A 3M63B 2NBVB 4IC7B 3TCAA 1EU3A 2L7RA 3R7RA 4XGAB 1CZPA 1FXTB 2QCZA 2BWES 2DBYA 1QF6A 5GXGB 1L2NA 1FCCC 2PJHA 4G3XB 2VH1A 3W1YA 2VH2A 4BBNF 5EE9A 4EOYA 2MBOA 1YMHE 2AWTA 2DYOA 4FJZA 1E90A 1N63A 3A4RA 1QILA 3APCA 4AUQC 3JSVA 3A9JB 1Q1OA 1MJDA 2SEBD 1RFAA 3AE8B 1A70A 2WX0A 3Q3NC 4LK0M 4DHJB 5AZFA 3ZNGC 2NTTA 4K3CA 3Q3JA 3PTFC 1L7YA 1D6EC 3SEBA 4GB9A 5DCNA 3V62A 3H1UA 5EE3A 1J8CA 3H8HA 3KUDB 3B2GA 3HK0A 3NVWA 4HCPB 2JWZA 2LXAA 4PS8A 4ZRPA 2BBCA 5AEKB 3NVZA 2KFKA 2KJ6A 1UUPA 4BFRA 3AU5A 3PREA 2V3SA 1F1HA 4W9DA 3OJ3A 1E7PB 2BGFA 4US8A 2KMCA 1BXTA 1BUIC 1WR6E 4S17A 3PRZA 4MH0E 4GDLA 2V3PA 4GIVA 1D5ZC 1YQ4B 3MC0B 2RR9A 4II2B 4W9CA 4WWPA 1KTKA 1PQSA 2ZVOA 4MM3A 1XLPA 3DBLB 2BWFA 3N1XC 4URKA 3NRZA 2MW5A 3H7PA 2N1VA 3CMMB 1JRPA 5G2NA 2FCSA 1TTNA 1TGZB 2BKRB 5EE1A 1KM7A 2L52A 3RYTA 1D5MC 2LFIA 2JUOA 2V4LA 3DHIC 2M1MA 3O13A 4M02A 4FJVB 1FEHA 1NYRA 1SIJA 3IVFA 4WWMA 1UF0A 3DHHC 4LDTD 4II3B 5FKAC 1DYQA 2M19A 2O2VB 1E8WA 1WMHA 1V86A 3V3XA 1P7EA 1QKZA 4BOSC 2KMAA 1RFKA 4FXCA 3V6CB 3IG3A 2MX2A 3MC9A 2E3TA 2KWDA 4UDUC 4NAMA 1K53A 2V1YA 4LNNA 3NY5A 3E9SA 4W9HA 4WWOA 3SD5A 2FBWB 2WXJA 1L6UA 2YEPF 1ZE3D 2ZCCA 1GNUA 3QARA 1WGDA 4HKZE 5D6JB 1FXAA 2DZIA 2M0AA 3BYTB 1V5OA 3A1QA 1J7BA 1IBXA 1ISNA 1PYWD 1KJTA 2WHIA 1E7VA 3FILA 2KWUB 3W5UB 1XLNA 3DPDA 2KD0A 2O6VB 4O1NA 3VVWB 1ZKHA 3UI3A 2JZZA 4ZOHC 1YN4A 2LGDA 2MBBB 5J2RA 3SU8X 2Y5CA 1ESFA 1JWAD 1WGHA 1P3QU 2LUEA 3LB8C 3Q8EA 3QHTA 2RGFA 1YOVB 4MT5A 4K1RB 2D3CA 2Q5WD 1KRHA 4KZ0A 1K8RB 2VZKB 4TV3A 1E5WA 2XBBC 1NENB 3AB5A 4JIOU 3Q2AC 4A9AA 3B2FA 2MSED 4M0WA 4ZRJA 1WXSA 1PGXA 1OQRA 1NYQA 2KLCA 3DOWA 1ET6A 4ASWC 4IOIE 3EC8A 1WYWB 2D10A 2N0SB 3KW5B 3AMZA 4LNFA 5DPSA 1IGDA 2I1JA 2ZW0A 1N6ZA 1WE6A 3L13A 1WR1A 4EZLA 2N7JA 1PUTA 2CR5A 3P2BA 1MG8A 2HJ1A 3AN1A 1T0SC 1V2YA 3N32A 1FXIA 4FA6A 3MJ5A 2K0PA 3BY4B 3K9PB 4FHKA 2J53A 1KH0A 4YSYB 4XE0A 3PHWB 1WJ4A 1D3ZA 3P1MA 4B95A 3JSVB 1ZDVA 4S0RA 1WXQA 3GP7A 2WXNA 1CK1A 3AI5A 4BKTA 1NEKB 2IPKD 1I7HA 2B76B 1WZ0A 2HTHA 4KKJA 1NBFC 2QILA 4FULA 3BYYB 2L32A 1X1MA 2MBHA 3Q8AA 4M8NA 4YT0B 1EUVB 4KSKC 1WJNA 4AQ7A 2HJ8A 4AS1A 2WS3B 1SJHD 2QHOA 3DWGC 4HXDA 2MP2A 1J7AA 4I6NB 2EMSA 4PS7A 4OVZA 3TSSA 3RFZB 2DLBA 3HHMA 4OZCA 4Q2JA 2OEDA 4IM3A 4GDLB 3NZ3A 3ETRA 1F2RC 2L3ZA 4XDDA 1H4RA 1M94A 3ZUNA 3BINA 4WJQA 1V6EA 1JWUD 3PO0A 5LLIA 4MM3B 3TUOA 4EUTA 1TS2A 2N9KA 1DOYA 3B0AA 4MDKE 2N7EA 3OLMD 5BYSA 2KDFB 3H7PB 4EKUA 3TL5A 2KDBA 4KKIA 2INDC 1HXYD 2N1WA 1Y56A 4MGYE 3CF6E 3VUWA 4IWQA 3GZNB 3QA8A 2W82A 2MJEA 4K7UA 2NCNA 1SE3A 1C77A 1ACCA 2LEKA 3B1LX 3QC8B 4WAAA 5LNK1 4HROA 1GB1A 1I35A 1I42A 2RDHA 4EZKA 2G1EA 2AQ1B 2GBNA 2WDTB 2MQJA 3AE4B 4KGRA 5BMIA 2LRWA 1MFWA 5CTRC 4RF0A 1EWCA 4TUUA 1UD7A 3ZYYX 1NI2A 4W9LA 4NJCA 3R2IA 2VRRB 2WGSA 4OVVA 3KLSX 2BTEA 3Q8CA 4A90A 2B3AA 2QEJC 2QC8A 4JWUC 3SHQA 5TR5A 4DBGA 1R4MB 4LCDE 2JY6A 3A33B 1P1AA 4WURA 4NZLB 4QAYA 2GBKA 1IBXB 1AW7A 1K52A 1WGRA 3Q69A 2PE6B 3KUZA 1UBIA 3UQBA 3FILB 4JLCA 3I63C 3CIRB 3N20C 3NG0A 3L08A 2ZW1A 1KLGD 4OZAA 1EM7A 2L05A 1XO3A 4KIKA 3RCZA 3VDZA 1TYGB 1BMLC 2JSVX 3Q8FA 2PVGC 5FR6A 1JALA 1FFUA 1SE4A 1STEA 1TZ1A 5HG2A 5JZEB 2BB5A 2PW9A 2KDEB 2RMMA 4YSZB 2GLSA 3KQ4A 2QJLA 2QDFA 2DYMA 3NZSA 1VDVA 4GLSC 3PT2B 3UINB 2QSDA 4GDKA 3A4SC 1RRBA 3ENEA 2N7DA 1V1OA 1SIFA 4M01A 2BQQA 2DZJA 3AEGB 3VAWA 1WFYA 5IA7A 4RGMA 4M0WB 2RSUA 1D4BA 2X38A 4M8MA 3QCAA 3TBLD 3DBRI 2AX5A 2K8HA 3RN9C 3PGEA 3L4PA 1V97A 2GBMA 3ZTCA 4ZRQA 4XX5A 4DHJD 3VRAB 3ZKJC 1SEBD 1YN5A 3DBHI 3IAS1 1WZ3A 4W9EA 3LXFA 2KJHB 1TZOA 2WDVB 2C9WB 3WIMA 3AEFB 3ML9A 4FHJA 2KXJA 4ZHOA 1FCLA 4AWJA 1WIAA 5IOIA 3URYA 2LGXA 1ZXIA 2WXGA 1WRIA 3FKYA 4A3OA 3U7ZA 2IO0B 1FM0D 4RFBA 2KT7A 5JH5C 2JYEA 2KQ7A 2LD9A 4BKSD 4KGTA 3EGRA 3PV1A 1TS5A 2Y5PA 2NPTA 4N9F4 1FFVA 3GE3C 2IY0B 4FLHA 3I9V1 2W3RA 1RYJA 3NVYA 2XK5B 1F52A 2JT4B 2BYFA 2D3AA 1DGJA 2FUHB 3C19A 2KX3A 4KDLB 4NAWA 2NBWB 2MP2B 3E56A 3SDLC 1EU4A 3L0WB 1WH3A 2KVZA 2UU7A 1T0YA 5D94A 4AJYB 2XNAC 1WXAA 1HZ6A 4ITKA 1OEYA 3BK1A 2SAKA 2I38A 4USAA 3VR8B 4HK2A 2D3GA 2J52A 3UQAA 5D2MB 3R3MA 2WXPA 2INNE 2J7QB 1JROA 1L0YB 2WXHA 2RD0A 2JRIB 1KOTA 4WIPA 1UH6A 4TMAB 4MSMB 1JWSD 1WY8A 1Y8RC 2GB1A 1JQ4A 2LGIA 4DHZB 1WF9A 4MELA 3DVNU 4JQWC 4A3PA 1ZGUB 3ALBA 3WANA 4JPSA 1YQBA 4J6IA 2AQ3B 4ARCA 3DDCB 4IDIA 3BVMA 2CU3A 2QMTA 3RNEC 3C8YA 2MHJA 3T3OA 3SFEB 3K9OB 1F2RI 1RAXA 1YJIA 3U2SC 2Z59B 1RWSA 3NS8A 4AJWA 3N1ZC 1C4PA 3VRBB 5J18A 4FJYA 2LHEA 1LFDA 3V61A 5G55A 2KTRA 2EMTA 3W5VB 1VZ6A 2RDGA 2YEPB 1IGCA 4W9FA 4CYEA 2JX5A 5IP4D 3ZJTA 4RGNA 4C7ZA 2ASQA 1SE2A 3PLUA 2J42A 3ZXRA 2G45B 2I1KA 4HJKA 2ONQA 2KNBA 4PK1A 2VZKD 3JYUA 1HZ5A 3BZDB 2KO3A 4PYUA 2DNFA 1C9FA 4BBNC 1YD8U 3B08A 4HDQA 4KIKB 2K8BA 1VRAB 1AARA 2BYEA 1MHXA 4JWSC 1E8YA 4KDIC 4RGOS 1ZDXA 5AUIA 2AL6A 1B1ZA 3T8MA 4CQNA 1V1PA 1XLOA 2K8CA 2AYOB 2KQ4X 1C79A 1E0ZA 5BYRA 2N9XA 2PIAA 2DX5B 1A5RA 3PZDA 1XCTL 3AEAB 3APDA 4P16A 4MACA 3VXWA 2EKEC 4GDKB 1T6BX 4W9KA 5AUKA 4P1CC 3RZFA 1I4XA 4N58A 1Q5WB 3ZNID 4IWOA 1ZW7A 5IO9A 2C7HA 1ZUD2 3VUXA 2IGHA 3ZLZA 3T9LA 3AE2B 2DYBA 1R7SA 2FCQA 2WP9B 1WJUA 1JWBD 1UNSA 2PKOA 1N60A 1TT5B 1Z2MA 3PS6A 3QK0A 3WALA 2NBUA 4P7IA 3WA0A 1WWTA 4B0MA 1WGYA 1L6VA 1GUAB 2WX1A 3AE7B 5H8YE 3KVFB 1R4NI 3U52E 2MLBA 1QQRA 3V6EB 1OQYA 4NPNA 3X23A 3RPFC 3Q3OC 2KN5A 4US9A 2KJRA 1K51A 1C78A 2MWSB 1YX5B 2C7NB 1TS3A 2BS4B 4K7WA 1JW9D 3Q6BA 5TSSA 4B0EA 2L0FA 2ZNVB 5T8IA 4OZBA 3VHTC 4ANXA 2PE9A 2NPTB 4ZDVA 1FNWA 1WSPA 3BWUD 4C7YA 1PFDA 4GN1A 3P4QB 2LVPA 5D3IB 4KV2A 3ZIMA 2CJNA 2L1AA 3NUHB 4DDID 1WGKA 2GBJA 2MJDA 2OJWA 3L54A 4WWNA 2BKFA 3CSFA 2UYZB 3MTNB 4YL8A 3ZQ4A 1XEEA 1AWDA 2WQYB 3PZ7A 3KWLA 3UF8A 3PVLA 1GG3A 3LJ3A 2JVCA 1K50A 4HJGE 2A4ZA 2KTFA 2PVOD 1I4RA 3KYCD 3U8ZA 1N5WA 5I4DA 1NDDA 4NNJB 4RNAA 2KFKB 3AE5B 1TJEA 3AECB 2KWCA 3KH0A 3LYYA 4ANUA 1ET9A 4ZHPA 2JXXA 3R2TA 1L0VB 1HTOA 3R66C 5E6PA 2DENB 1LXDA 1L5PA 2QIEB 1IP9A 2PLPA 4WQMA 2FIDA 3UIOB 1SB3C 1WM3A 4A55A 2GI9A 2KC2A 2V3NA 3P4SB 2K1FA 4EE2A 2JYTA 2OJRA 1PGBA 3JVZX 4REZA 2WXFA 3P4RB 3T3NA 2RPVA 4P6VF 3TMPB 3MJWA 2R2QA 3BVZA 4I6PA 2AEHA 4LNKA 2M0XA 5AZHA 2KACA 1WGGA 1N61A 1QLBB 2E6XA 5BYQA 2ZJDA 2TSSA 1SBBB 3M3JA 2W9NA 2J0JA 3AEEB 2Z0DB 1VLBA 4DXFA 5E6JA 4N6EB 2WXLA 1VR9A 2NTSA 3NZUA 3DVNV 3P63A 3RNCC 2IJ0A 1V5TA 2INCC 2KKCA 3ABVB 1QZEA 3VTWA 2EELA 2ZVNA 2RDBC 1JMLA 2JXTA 2KTRB 3I5JC 4DXAB 4EEWA 3HVDA 1BT0A 4PYZA 1SSNA 4EZJA 4HCNB 1WI0A 1U4AA 1WMHB 1AYFA 3H7SA 1HE8A 5C2TB 2A5UA 3OJ4B 3DVGY 1VZ7A 1UWXA 4R3DA 5JHBA 4LTUA 4AOFA 1KFYB 1C4CA 4ZRIA 2KWVB 2I2YA 2JF5A 2J0KA 1SGHA 4XC2A 3RT3B 5LXHA 3OG5A 4F8CB 2LVOA 4TQ0A 3PRMB 5D3DA 4J3OD 4N59A 4BKGA 3W1SC 1HA5A 3A1QB 2M17A 3WAMA 4ICUA 2D5GA 2WU5B 3QX1A 3ZNZB 1WRDB 3IBEA 3QWZB 2Y5BB 2DZMA 1SXTA 1HEZE 1N5XA 2KFJA 4B9KA 2WYQA 3C0RB 4MSQB 3AU4A 3VFKA 1XD3B 1CQVA 2ZNVC 3R8BA 4XDCA 3AH7A 2D2QA 2KVRA 3R7QA 3AE6B 4YTMB 3TEYA 4E71A 4BVUC 1J0GA 3HM6X 2JWUA 3RNBC 3NOBA 3MFGA 4NJ7A 3ZW3A 3N1YC 2K39A 1WJ6A 4NJ6A 3EFUA 4HPLB 2LHDA 3NHEB 2ZZPB 3U7DA 2MRPA 3HUIA 3PSEB 5C23A 3AEBB 1EF5A 4TSSA 4ZYNA 4XWWA 2OOBB 4C4VA 1T0QC 1LGRA 4DWFA 2YVCA 4GU2A 1JCKB 2L00B 3I3TB 1P9DU 2KX0A 2IZVB 2KN4A 4IWPA 2WXOA 4BZAA 1I4GA 3NJTA 3Q14C 3PHXB 4K3BA 1SF0A 1UGMA 5L83A 1UELA 5E6OA 4BOZB 2FE8A 4YTNB 3IHPC 1XQQA 3QJZA 3CWIA 2M8SA 2INPE 2L0TA 2LMCA 1P7FA 2ICIA 2OHFA 4LJOB 1ENFA 4GGQA 2V9HA 3BVGA 2BYTA 4PS3A 3MHZA 4H2AA 4WAFA 2H88B 5LXIB 3EFCA 2N9EB 4WJNA 3RZWC 2W54A 1HTQA 3DWMA 3HVZA 1RLFA 5D7GA 1TKEA 2JZ3B 2J0MA 4W9JA 1QOAA 1C1YB 1TBEA 1HQRD 3U4EG 4RM8A 4IW0A 3Q3FA 3ZVVA 2K9XA 2C60A 2WXKA 4DDGD 3AULA 1T5XD 2JU6X 1XXGA 3DBRB 4HDOA 3DCGA 4PT5A 1WXMA 3VUYA 5EDSA 2WWZA 4WQOB 1CJEA 1G6JA 5HHDG 1UWMA 1PDXA 3DBLI 3W9CB 3DBHB 4OVUA 3PLVA 2WNMA 3IT4B 3PZ8A 1MI0A 2KAJA 2ZPNA 3ZXVA 2GMIC 1F77A 1YJ1A 1TKYA 2GBRA 5IN7A 3VTVA 1FIQA 1MVKA 2LRUA 2XEWA 1GC6A 1GAQB 3IXSA 2MBQA 5CX3A 2KANA 4DHZE 1E7UA 2LJ5A 2IYDB 4L2YA 1UBQA 3D32A 1JRUA 4LJPB 4F7ZA 1FD6A 1JWMD 1FNVA 2MH7A 3VH3B 2Y3AA 3A9KA 1WM2A 3PRPB 4NQKE 3HIZA 1ROEA 2KHWB 2IO1B 2G4DB 3WAPA 2CHXA 1I4PA 2LASA 3QIJA 2WLBA 4WJOA
chains in the Genus database with same CATH topology
4QAYA 4PK1A 2VH1A 4BZAA 3NJTA 2VH2A 2X8XX 4C00A 2V9HA 2MHJA 4K3BA 4K3CA 3OG5A 3EFCA 2QDFA 4C4VA 3Q6BA 4XGAB 3MC9A 2QCZA 4C4VB 3MC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QAY A;  4PK1 A;  2VH1 A;  4BZA A;  3NJT A;  2VH2 A;  2X8X X;  4C00 A;  2V9H A;  2MHJ A;  4K3B A;  4K3C A;  3OG5 A;  3EFC A;  2QDF A;  4C4V A;  3Q6B A;  4XGA B;  3MC9 A;  2QCZ A;  4C4V B;  3MC8 A; 
#chains in the Genus database with same CATH topology
 1KLV A;  4MGI E;  4GOC A;  4MEM A;  2LGY A;  4CHK A;  5IKC M;  2CS4 A;  3NVV A;  4TKN A;  4MGK E;  1DOI A;  1ZXH A;  2EKI A;  1LQB A;  2N4F A;  4TQ1 A;  2K6Q A;  3L17 A;  2DHZ A;  1LO5 D;  2O6V D;  1T3Q A;  3NS1 A;  1MPE A;  3HRD D;  2V4I B;  1KLU D;  3W2D A;  1F9J A;  3V60 A;  3N9Y C;  2ZCB A;  5BMG A;  4KX6 B;  3KWV A;  4OW0 A;  5CHV C;  3OWE B;  2PEA A;  2IY1 B;  1GC7 A;  5DPW A;  5DPR A;  2BPS A;  4HPP A;  1P0R A;  2N9P C;  1MHH E;  3RNA C;  2DAJ A;  3UIP B;  3ZRF A;  1VD2 A;  3IFW B;  3Q8B A;  1L0X B;  4NY0 A;  2WXQ A;  1V9J A;  2KDI A;  1LM8 B;  3H6N A;  4G50 A;  3EUB 2;  2CJO A;  4EFO A;  4LLG M;  2KQS A;  4NQL B;  1GB4 A;  2BW2 A;  4HPM B;  2GOW A;  2YLM A;  2K22 A;  4RF1 A;  3AM9 A;  2MA9 B;  1FNU A;  2K6D B;  3KUC B;  2WXM A;  2JPH A;  4IM0 A;  2L8J A;  1WE7 A;  1XLQ A;  4JL9 A;  3RUI B;  3DQV A;  1S3S G;  3TEZ A;  2ACZ B;  2V0G A;  3O65 B;  2K3U A;  2WDQ B;  2K25 A;  1IUE A;  3RNF C;  3VQI A;  4IUM B;  4ANW A;  3HM3 A;  4L1B A;  4BAX A;  2CU1 A;  4LNI A;  4ZYS A;  1Q0W B;  2IO2 B;  1GOZ A;  4KVG B;  2CHZ A;  2C7M B;  2GRI A;  4A20 A;  4LDT B;  2LI5 A;  1CMX B;  1QOB A;  3QQ8 B;  1ZPS A;  1T0R C;  2D3B A;  3V05 A;  4C4V B;  4IKG A;  4GXB A;  2AQ2 B;  3TIX A;  4P1B C;  3DBS A;  2W3S A;  2G3Q B;  3RMK C;  4HEA 1;  5EE0 A;  3N3K B;  1V49 A;  4E74 A;  5HFY A;  3ZDM C;  3CST A;  3L10 B;  2DWQ A;  4WJP A;  2IGG A;  2LZ6 A;  1YX6 B;  1WXV A;  2FCM A;  3VR9 B;  5H92 C;  1SE9 A;  1Z5S B;  5BMH A;  2MBE A;  5FK9 C;  3SR6 A;  1FPY A;  4OHJ A;  2IBI B;  1ZP0 B;  2Z0E B;  3ZDT A;  2NVU I;  4C56 C;  1E8X A;  2REX A;  3FAH A;  1P98 A;  4IM2 A;  2KLG A;  2BS2 B;  1UZX B;  2FCN A;  1EO6 A;  1XT9 B;  3QAQ A;  4MJS A;  3VH4 B;  3ZGZ A;  2MEK A;  1OGW A;  1KF6 B;  5L95 C;  1XCQ L;  1E6E B;  1C76 A;  3ZJV A;  2BVC A;  1DOX A;  3M95 A;  3L16 A;  1M4V A;  1I4H A;  2M4N A;  2J4X A;  4HWI B;  1OFF A;  1OEY J;  1I4Q A;  5JXV A;  2KZR A;  1D5X C;  3TEW A;  1ZOY B;  1H8C A;  4A8X C;  4YXD B;  1N62 A;  3BK2 A;  3BII D;  4ZRK A;  2JZP A;  1J19 A;  2JRH A;  4W9I A;  2KYW A;  3U30 A;  3TJP A;  2DAF A;  5AZG A;  3ZRC A;  1QOG A;  1C4A A;  3AED B;  3LDZ E;  1OQQ A;  1EWY C;  5JHA A;  1S1Q B;  1YJJ A;  2IGD A;  1IYF A;  4KZC A;  2FNJ B;  5E6N A;  1MG4 A;  1TS4 A;  3GOE A;  4NAW B;  3P42 A;  2WDR B;  4D2K A;  4FAD A;  1VZ8 A;  4B6W A;  3DVG X;  4HRS A;  5C1Z A;  1NVI D;  3A9J A;  3M62 B;  1R4N B;  5CHF A;  3GZN I;  3MC8 A;  4YWG G;  2XK5 A;  1E9M A;  1EF1 A;  5BO4 B;  1TY2 A;  4RMA A;  1QT9 A;  3KYD D;  3OAW A;  3RD2 A;  2HD5 B;  1WX8 A;  2ZPY A;  3A9K B;  5G5G A;  3DHG C;  2PMV A;  3RNG C;  2ON8 A;  2N9L A;  1V81 A;  4W9G A;  1V80 A;  1F0Z A;  1YQ3 B;  2NS5 A;  4RH6 A;  3PPA A;  1FRR A;  2D11 A;  4RM9 A;  3AXC A;  1L4D B;  5KHO A;  4AP4 C;  2BF8 B;  4DXG A;  1FMA D;  1B9R A;  5DPT A;  3EEC A;  2FIF A;  3VTU A;  4BKS A;  4JX1 C;  1R4M I;  5HKH A;  5GMV A;  3RI7 C;  3ZJU A;  4HLE A;  1PGA A;  3ONS A;  2BB6 A;  2LJI A;  3AE9 B;  3GB1 A;  2JQR B;  2W55 A;  1TY0 A;  3JW0 X;  3TEX A;  1Q10 A;  4ICV A;  1RM6 C;  2NR2 A;  4G0N B;  3SFD B;  4XWT A;  3P4P B;  3MP9 A;  3MHS D;  3UGB B;  3AE3 B;  2Z8L A;  5IAA C;  5J17 A;  4HKQ A;  4I6L B;  3ZTD A;  2H89 B;  2IDY A;  2L83 A;  4GMV A;  2HTM E;  2AL3 A;  4KSL C;  1FO4 A;  1L4Z B;  1SJE D;  2FUG 1;  4DQO C;  5G5H A;  5HI1 A;  2LUM A;  1J7C A;  3APF A;  4IG7 B;  5CHW A;  2NMQ A;  1FRD A;  2M56 B;  4DK5 A;  2FAZ A;  5KHQ A;  2DZK A;  1QOF A;  2LWP A;  3X0W A;  1VCB A;  2PPH A;  4ARI A;  2R2O A;  1UGJ A;  3J9C A;  4YSX B;  3IAM 1;  2G9H D;  2CHW A;  2O2V A;  2WU2 B;  2KK8 A;  1WX9 A;  2IO3 B;  4CO7 A;  4X57 B;  4L23 A;  1XF5 L;  4HVB A;  3ZO5 B;  1V1P B;  4RCO A;  3WAO A;  3EHV A;  3Q3M C;  2K5P A;  3AV8 A;  4F1S A;  3N30 A;  1YN3 A;  5FR3 A;  2MJ3 A;  1C3T A;  1TKG A;  4FBJ B;  2CKH B;  3AE1 B;  3FC4 A;  4C80 A;  4YTP B;  3I57 A;  2BS3 B;  2ZEQ A;  4MH8 A;  4K7S A;  4A6Q A;  1YIW A;  4ANV A;  2O6V A;  4XZ4 A;  3S2A A;  2WXI A;  4M00 A;  5C3J B;  2PTL A;  2KMM A;  1E8Z A;  3ECI A;  3IT6 B;  2WXR A;  3ML8 A;  2X8X X;  4RGT A;  4G11 A;  1GPX A;  4JE3 B;  4XYC A;  1YNT E;  1GJZ A;  3B9J A;  2UWQ A;  1VJK A;  1AN8 A;  2G4S A;  2D07 B;  2LGS A;  1E10 A;  2HDE A;  2XN9 C;  4E3C A;  1TIF A;  3GE8 C;  2R61 A;  2MCN B;  4MGZ E;  2LVQ A;  2HE7 A;  2RPQ A;  3H9D A;  4ACF A;  1NI3 A;  5MPO A;  2BYV E;  1IPG A;  3RUL A;  1OTR B;  2L76 A;  4KGS A;  4FN2 A;  2C5L C;  3GS2 A;  3WCQ A;  2LXC A;  4MJS B;  2KDM A;  2KC1 A;  1V8C A;  3ZNH B;  4LNO A;  2BT6 A;  4JGH B;  3EA6 A;  1WYG A;  4K81 A;  4GSW A;  4C00 A;  3W1S A;  2KOX A;  4WH4 A;  1WX7 A;  3M63 B;  2NBV B;  4IC7 B;  3TCA A;  1EU3 A;  2L7R A;  3R7R A;  4XGA B;  1CZP A;  1FXT B;  2QCZ A;  2BWE S;  2DBY A;  1QF6 A;  5GXG B;  1L2N A;  1FCC C;  2PJH A;  4G3X B;  2VH1 A;  3W1Y A;  2VH2 A;  4BBN F;  5EE9 A;  4EOY A;  2MBO A;  1YMH E;  2AWT A;  2DYO A;  4FJZ A;  1E90 A;  1N63 A;  3A4R A;  1QIL A;  3APC A;  4AUQ C;  3JSV A;  3A9J B;  1Q1O A;  1MJD A;  2SEB D;  1RFA A;  3AE8 B;  1A70 A;  2WX0 A;  3Q3N C;  4LK0 M;  4DHJ B;  5AZF A;  3ZNG C;  2NTT A;  4K3C A;  3Q3J A;  3PTF C;  1L7Y A;  1D6E C;  3SEB A;  4GB9 A;  5DCN A;  3V62 A;  3H1U A;  5EE3 A;  1J8C A;  3H8H A;  3KUD B;  3B2G A;  3HK0 A;  3NVW A;  4HCP B;  2JWZ A;  2LXA A;  4PS8 A;  4ZRP A;  2BBC A;  5AEK B;  3NVZ A;  2KFK A;  2KJ6 A;  1UUP A;  4BFR A;  3AU5 A;  3PRE A;  2V3S A;  1F1H A;  4W9D A;  3OJ3 A;  1E7P B;  2BGF A;  4US8 A;  2KMC A;  1BXT A;  1BUI C;  1WR6 E;  4S17 A;  3PRZ A;  4MH0 E;  4GDL A;  2V3P A;  4GIV A;  1D5Z C;  1YQ4 B;  3MC0 B;  2RR9 A;  4II2 B;  4W9C A;  4WWP A;  1KTK A;  1PQS A;  2ZVO A;  4MM3 A;  1XLP A;  3DBL B;  2BWF A;  3N1X C;  4URK A;  3NRZ A;  2MW5 A;  3H7P A;  2N1V A;  3CMM B;  1JRP A;  5G2N A;  2FCS A;  1TTN A;  1TGZ B;  2BKR B;  5EE1 A;  1KM7 A;  2L52 A;  3RYT A;  1D5M C;  2LFI A;  2JUO A;  2V4L A;  3DHI C;  2M1M A;  3O13 A;  4M02 A;  4FJV B;  1FEH A;  1NYR A;  1SIJ A;  3IVF A;  4WWM A;  1UF0 A;  3DHH C;  4LDT D;  4II3 B;  5FKA C;  1DYQ A;  2M19 A;  2O2V B;  1E8W A;  1WMH A;  1V86 A;  3V3X A;  1P7E A;  1QKZ A;  4BOS C;  2KMA A;  1RFK A;  4FXC A;  3V6C B;  3IG3 A;  2MX2 A;  3MC9 A;  2E3T A;  2KWD A;  4UDU C;  4NAM A;  1K53 A;  2V1Y A;  4LNN A;  3NY5 A;  3E9S A;  4W9H A;  4WWO A;  3SD5 A;  2FBW B;  2WXJ A;  1L6U A;  2YEP F;  1ZE3 D;  2ZCC A;  1GNU A;  3QAR A;  1WGD A;  4HKZ E;  5D6J B;  1FXA A;  2DZI A;  2M0A A;  3BYT B;  1V5O A;  3A1Q A;  1J7B A;  1IBX A;  1ISN A;  1PYW D;  1KJT A;  2WHI A;  1E7V A;  3FIL A;  2KWU B;  3W5U B;  1XLN A;  3DPD A;  2KD0 A;  2O6V B;  4O1N A;  3VVW B;  1ZKH A;  3UI3 A;  2JZZ A;  4ZOH C;  1YN4 A;  2LGD A;  2MBB B;  5J2R A;  3SU8 X;  2Y5C A;  1ESF A;  1JWA D;  1WGH A;  1P3Q U;  2LUE A;  3LB8 C;  3Q8E A;  3QHT A;  2RGF A;  1YOV B;  4MT5 A;  4K1R B;  2D3C A;  2Q5W D;  1KRH A;  4KZ0 A;  1K8R B;  2VZK B;  4TV3 A;  1E5W A;  2XBB C;  1NEN B;  3AB5 A;  4JIO U;  3Q2A C;  4A9A A;  3B2F A;  2MSE D;  4M0W A;  4ZRJ A;  1WXS A;  1PGX A;  1OQR A;  1NYQ A;  2KLC A;  3DOW A;  1ET6 A;  4ASW C;  4IOI E;  3EC8 A;  1WYW B;  2D10 A;  2N0S B;  3KW5 B;  3AMZ A;  4LNF A;  5DPS A;  1IGD A;  2I1J A;  2ZW0 A;  1N6Z A;  1WE6 A;  3L13 A;  1WR1 A;  4EZL A;  2N7J A;  1PUT A;  2CR5 A;  3P2B A;  1MG8 A;  2HJ1 A;  3AN1 A;  1T0S C;  1V2Y A;  3N32 A;  1FXI A;  4FA6 A;  3MJ5 A;  2K0P A;  3BY4 B;  3K9P B;  4FHK A;  2J53 A;  1KH0 A;  4YSY B;  4XE0 A;  3PHW B;  1WJ4 A;  1D3Z A;  3P1M A;  4B95 A;  3JSV B;  1ZDV A;  4S0R A;  1WXQ A;  3GP7 A;  2WXN A;  1CK1 A;  3AI5 A;  4BKT A;  1NEK B;  2IPK D;  1I7H A;  2B76 B;  1WZ0 A;  2HTH A;  4KKJ A;  1NBF C;  2QIL A;  4FUL A;  3BYY B;  2L32 A;  1X1M A;  2MBH A;  3Q8A A;  4M8N A;  4YT0 B;  1EUV B;  4KSK C;  1WJN A;  4AQ7 A;  2HJ8 A;  4AS1 A;  2WS3 B;  1SJH D;  2QHO A;  3DWG C;  4HXD A;  2MP2 A;  1J7A A;  4I6N B;  2EMS A;  4PS7 A;  4OVZ A;  3TSS A;  3RFZ B;  2DLB A;  3HHM A;  4OZC A;  4Q2J A;  2OED A;  4IM3 A;  4GDL B;  3NZ3 A;  3ETR A;  1F2R C;  2L3Z A;  4XDD A;  1H4R A;  1M94 A;  3ZUN A;  3BIN A;  4WJQ A;  1V6E A;  1JWU D;  3PO0 A;  5LLI A;  4MM3 B;  3TUO A;  4EUT A;  1TS2 A;  2N9K A;  1DOY A;  3B0A A;  4MDK E;  2N7E A;  3OLM D;  5BYS A;  2KDF B;  3H7P B;  4EKU A;  3TL5 A;  2KDB A;  4KKI A;  2IND C;  1HXY D;  2N1W A;  1Y56 A;  4MGY E;  3CF6 E;  3VUW A;  4IWQ A;  3GZN B;  3QA8 A;  2W82 A;  2MJE A;  4K7U A;  2NCN A;  1SE3 A;  1C77 A;  1ACC A;  2LEK A;  3B1L X;  3QC8 B;  4WAA A;  5LNK 1;  4HRO A;  1GB1 A;  1I35 A;  1I42 A;  2RDH A;  4EZK A;  2G1E A;  2AQ1 B;  2GBN A;  2WDT B;  2MQJ A;  3AE4 B;  4KGR A;  5BMI A;  2LRW A;  1MFW A;  5CTR C;  4RF0 A;  1EWC A;  4TUU A;  1UD7 A;  3ZYY X;  1NI2 A;  4W9L A;  4NJC A;  3R2I A;  2VRR B;  2WGS A;  4OVV A;  3KLS X;  2BTE A;  3Q8C A;  4A90 A;  2B3A A;  2QEJ C;  2QC8 A;  4JWU C;  3SHQ A;  5TR5 A;  4DBG A;  1R4M B;  4LCD E;  2JY6 A;  3A33 B;  1P1A A;  4WUR A;  4NZL B;  4QAY A;  2GBK A;  1IBX B;  1AW7 A;  1K52 A;  1WGR A;  3Q69 A;  2PE6 B;  3KUZ A;  1UBI A;  3UQB A;  3FIL B;  4JLC A;  3I63 C;  3CIR B;  3N20 C;  3NG0 A;  3L08 A;  2ZW1 A;  1KLG D;  4OZA A;  1EM7 A;  2L05 A;  1XO3 A;  4KIK A;  3RCZ A;  3VDZ A;  1TYG B;  1BML C;  2JSV X;  3Q8F A;  2PVG C;  5FR6 A;  1JAL A;  1FFU A;  1SE4 A;  1STE A;  1TZ1 A;  5HG2 A;  5JZE B;  2BB5 A;  2PW9 A;  2KDE B;  2RMM A;  4YSZ B;  2GLS A;  3KQ4 A;  2QJL A;  2QDF A;  2DYM A;  3NZS A;  1VDV A;  4GLS C;  3PT2 B;  3UIN B;  2QSD A;  4GDK A;  3A4S C;  1RRB A;  3ENE A;  2N7D A;  1V1O A;  1SIF A;  4M01 A;  2BQQ A;  2DZJ A;  3AEG B;  3VAW A;  1WFY A;  5IA7 A;  4RGM A;  4M0W B;  2RSU A;  1D4B A;  2X38 A;  4M8M A;  3QCA A;  3TBL D;  3DBR I;  2AX5 A;  2K8H A;  3RN9 C;  3PGE A;  3L4P A;  1V97 A;  2GBM A;  3ZTC A;  4ZRQ A;  4XX5 A;  4DHJ D;  3VRA B;  3ZKJ C;  1SEB D;  1YN5 A;  3DBH I;  3IAS 1;  1WZ3 A;  4W9E A;  3LXF A;  2KJH B;  1TZO A;  2WDV B;  2C9W B;  3WIM A;  3AEF B;  3ML9 A;  4FHJ A;  2KXJ A;  4ZHO A;  1FCL A;  4AWJ A;  1WIA A;  5IOI A;  3URY A;  2LGX A;  1ZXI A;  2WXG A;  1WRI A;  3FKY A;  4A3O A;  3U7Z A;  2IO0 B;  1FM0 D;  4RFB A;  2KT7 A;  5JH5 C;  2JYE A;  2KQ7 A;  2LD9 A;  4BKS D;  4KGT A;  3EGR A;  3PV1 A;  1TS5 A;  2Y5P A;  2NPT A;  4N9F 4;  1FFV A;  3GE3 C;  2IY0 B;  4FLH A;  3I9V 1;  2W3R A;  1RYJ A;  3NVY A;  2XK5 B;  1F52 A;  2JT4 B;  2BYF A;  2D3A A;  1DGJ A;  2FUH B;  3C19 A;  2KX3 A;  4KDL B;  4NAW A;  2NBW B;  2MP2 B;  3E56 A;  3SDL C;  1EU4 A;  3L0W B;  1WH3 A;  2KVZ A;  2UU7 A;  1T0Y A;  5D94 A;  4AJY B;  2XNA C;  1WXA A;  1HZ6 A;  4ITK A;  1OEY A;  3BK1 A;  2SAK A;  2I38 A;  4USA A;  3VR8 B;  4HK2 A;  2D3G A;  2J52 A;  3UQA A;  5D2M B;  3R3M A;  2WXP A;  2INN E;  2J7Q B;  1JRO A;  1L0Y B;  2WXH A;  2RD0 A;  2JRI B;  1KOT A;  4WIP A;  1UH6 A;  4TMA B;  4MSM B;  1JWS D;  1WY8 A;  1Y8R C;  2GB1 A;  1JQ4 A;  2LGI A;  4DHZ B;  1WF9 A;  4MEL A;  3DVN U;  4JQW C;  4A3P A;  1ZGU B;  3ALB A;  3WAN A;  4JPS A;  1YQB A;  4J6I A;  2AQ3 B;  4ARC A;  3DDC B;  4IDI A;  3BVM A;  2CU3 A;  2QMT A;  3RNE C;  3C8Y A;  2MHJ A;  3T3O A;  3SFE B;  3K9O B;  1F2R I;  1RAX A;  1YJI A;  3U2S C;  2Z59 B;  1RWS A;  3NS8 A;  4AJW A;  3N1Z C;  1C4P A;  3VRB B;  5J18 A;  4FJY A;  2LHE A;  1LFD A;  3V61 A;  5G55 A;  2KTR A;  2EMT A;  3W5V B;  1VZ6 A;  2RDG A;  2YEP B;  1IGC A;  4W9F A;  4CYE A;  2JX5 A;  5IP4 D;  3ZJT A;  4RGN A;  4C7Z A;  2ASQ A;  1SE2 A;  3PLU A;  2J42 A;  3ZXR A;  2G45 B;  2I1K A;  4HJK A;  2ONQ A;  2KNB A;  4PK1 A;  2VZK D;  3JYU A;  1HZ5 A;  3BZD B;  2KO3 A;  4PYU A;  2DNF A;  1C9F A;  4BBN C;  1YD8 U;  3B08 A;  4HDQ A;  4KIK B;  2K8B A;  1VRA B;  1AAR A;  2BYE A;  1MHX A;  4JWS C;  1E8Y A;  4KDI C;  4RGO S;  1ZDX A;  5AUI A;  2AL6 A;  1B1Z A;  3T8M A;  4CQN A;  1V1P A;  1XLO A;  2K8C A;  2AYO B;  2KQ4 X;  1C79 A;  1E0Z A;  5BYR A;  2N9X A;  2PIA A;  2DX5 B;  1A5R A;  3PZD A;  1XCT L;  3AEA B;  3APD A;  4P16 A;  4MAC A;  3VXW A;  2EKE C;  4GDK B;  1T6B X;  4W9K A;  5AUK A;  4P1C C;  3RZF A;  1I4X A;  4N58 A;  1Q5W B;  3ZNI D;  4IWO A;  1ZW7 A;  5IO9 A;  2C7H A;  1ZUD 2;  3VUX A;  2IGH A;  3ZLZ A;  3T9L A;  3AE2 B;  2DYB A;  1R7S A;  2FCQ A;  2WP9 B;  1WJU A;  1JWB D;  1UNS A;  2PKO A;  1N60 A;  1TT5 B;  1Z2M A;  3PS6 A;  3QK0 A;  3WAL A;  2NBU A;  4P7I A;  3WA0 A;  1WWT A;  4B0M A;  1WGY A;  1L6V A;  1GUA B;  2WX1 A;  3AE7 B;  5H8Y E;  3KVF B;  1R4N I;  3U52 E;  2MLB A;  1QQR A;  3V6E B;  1OQY A;  4NPN A;  3X23 A;  3RPF C;  3Q3O C;  2KN5 A;  4US9 A;  2KJR A;  1K51 A;  1C78 A;  2MWS B;  1YX5 B;  2C7N B;  1TS3 A;  2BS4 B;  4K7W A;  1JW9 D;  3Q6B A;  5TSS A;  4B0E A;  2L0F A;  2ZNV B;  5T8I A;  4OZB A;  3VHT C;  4ANX A;  2PE9 A;  2NPT B;  4ZDV A;  1FNW A;  1WSP A;  3BWU D;  4C7Y A;  1PFD A;  4GN1 A;  3P4Q B;  2LVP A;  5D3I B;  4KV2 A;  3ZIM A;  2CJN A;  2L1A A;  3NUH B;  4DDI D;  1WGK A;  2GBJ A;  2MJD A;  2OJW A;  3L54 A;  4WWN A;  2BKF A;  3CSF A;  2UYZ B;  3MTN B;  4YL8 A;  3ZQ4 A;  1XEE A;  1AWD A;  2WQY B;  3PZ7 A;  3KWL A;  3UF8 A;  3PVL A;  1GG3 A;  3LJ3 A;  2JVC A;  1K50 A;  4HJG E;  2A4Z A;  2KTF A;  2PVO D;  1I4R A;  3KYC D;  3U8Z A;  1N5W A;  5I4D A;  1NDD A;  4NNJ B;  4RNA A;  2KFK B;  3AE5 B;  1TJE A;  3AEC B;  2KWC A;  3KH0 A;  3LYY A;  4ANU A;  1ET9 A;  4ZHP A;  2JXX A;  3R2T A;  1L0V B;  1HTO A;  3R66 C;  5E6P A;  2DEN B;  1LXD A;  1L5P A;  2QIE B;  1IP9 A;  2PLP A;  4WQM A;  2FID A;  3UIO B;  1SB3 C;  1WM3 A;  4A55 A;  2GI9 A;  2KC2 A;  2V3N A;  3P4S B;  2K1F A;  4EE2 A;  2JYT A;  2OJR A;  1PGB A;  3JVZ X;  4REZ A;  2WXF A;  3P4R B;  3T3N A;  2RPV A;  4P6V F;  3TMP B;  3MJW A;  2R2Q A;  3BVZ A;  4I6P A;  2AEH A;  4LNK A;  2M0X A;  5AZH A;  2KAC A;  1WGG A;  1N61 A;  1QLB B;  2E6X A;  5BYQ A;  2ZJD A;  2TSS A;  1SBB B;  3M3J A;  2W9N A;  2J0J A;  3AEE B;  2Z0D B;  1VLB A;  4DXF A;  5E6J A;  4N6E B;  2WXL A;  1VR9 A;  2NTS A;  3NZU A;  3DVN V;  3P63 A;  3RNC C;  2IJ0 A;  1V5T A;  2INC C;  2KKC A;  3ABV B;  1QZE A;  3VTW A;  2EEL A;  2ZVN A;  2RDB C;  1JML A;  2JXT A;  2KTR B;  3I5J C;  4DXA B;  4EEW A;  3HVD A;  1BT0 A;  4PYZ A;  1SSN A;  4EZJ A;  4HCN B;  1WI0 A;  1U4A A;  1WMH B;  1AYF A;  3H7S A;  1HE8 A;  5C2T B;  2A5U A;  3OJ4 B;  3DVG Y;  1VZ7 A;  1UWX A;  4R3D A;  5JHB A;  4LTU A;  4AOF A;  1KFY B;  1C4C A;  4ZRI A;  2KWV B;  2I2Y A;  2JF5 A;  2J0K A;  1SGH A;  4XC2 A;  3RT3 B;  5LXH A;  3OG5 A;  4F8C B;  2LVO A;  4TQ0 A;  3PRM B;  5D3D A;  4J3O D;  4N59 A;  4BKG A;  3W1S C;  1HA5 A;  3A1Q B;  2M17 A;  3WAM A;  4ICU A;  2D5G A;  2WU5 B;  3QX1 A;  3ZNZ B;  1WRD B;  3IBE A;  3QWZ B;  2Y5B B;  2DZM A;  1SXT A;  1HEZ E;  1N5X A;  2KFJ A;  4B9K A;  2WYQ A;  3C0R B;  4MSQ B;  3AU4 A;  3VFK A;  1XD3 B;  1CQV A;  2ZNV C;  3R8B A;  4XDC A;  3AH7 A;  2D2Q A;  2KVR A;  3R7Q A;  3AE6 B;  4YTM B;  3TEY A;  4E71 A;  4BVU C;  1J0G A;  3HM6 X;  2JWU A;  3RNB C;  3NOB A;  3MFG A;  4NJ7 A;  3ZW3 A;  3N1Y C;  2K39 A;  1WJ6 A;  4NJ6 A;  3EFU A;  4HPL B;  2LHD A;  3NHE B;  2ZZP B;  3U7D A;  2MRP A;  3HUI A;  3PSE B;  5C23 A;  3AEB B;  1EF5 A;  4TSS A;  4ZYN A;  4XWW A;  2OOB B;  4C4V A;  1T0Q C;  1LGR A;  4DWF A;  2YVC A;  4GU2 A;  1JCK B;  2L00 B;  3I3T B;  1P9D U;  2KX0 A;  2IZV B;  2KN4 A;  4IWP A;  2WXO A;  4BZA A;  1I4G A;  3NJT A;  3Q14 C;  3PHX B;  4K3B A;  1SF0 A;  1UGM A;  5L83 A;  1UEL A;  5E6O A;  4BOZ B;  2FE8 A;  4YTN B;  3IHP C;  1XQQ A;  3QJZ A;  3CWI A;  2M8S A;  2INP E;  2L0T A;  2LMC A;  1P7F A;  2ICI A;  2OHF A;  4LJO B;  1ENF A;  4GGQ A;  2V9H A;  3BVG A;  2BYT A;  4PS3 A;  3MHZ A;  4H2A A;  4WAF A;  2H88 B;  5LXI B;  3EFC A;  2N9E B;  4WJN A;  3RZW C;  2W54 A;  1HTQ A;  3DWM A;  3HVZ A;  1RLF A;  5D7G A;  1TKE A;  2JZ3 B;  2J0M A;  4W9J A;  1QOA A;  1C1Y B;  1TBE A;  1HQR D;  3U4E G;  4RM8 A;  4IW0 A;  3Q3F A;  3ZVV A;  2K9X A;  2C60 A;  2WXK A;  4DDG D;  3AUL A;  1T5X D;  2JU6 X;  1XXG A;  3DBR B;  4HDO A;  3DCG A;  4PT5 A;  1WXM A;  3VUY A;  5EDS A;  2WWZ A;  4WQO B;  1CJE A;  1G6J A;  5HHD G;  1UWM A;  1PDX A;  3DBL I;  3W9C B;  3DBH B;  4OVU A;  3PLV A;  2WNM A;  3IT4 B;  3PZ8 A;  1MI0 A;  2KAJ A;  2ZPN A;  3ZXV A;  2GMI C;  1F77 A;  1YJ1 A;  1TKY A;  2GBR A;  5IN7 A;  3VTV A;  1FIQ A;  1MVK A;  2LRU A;  2XEW A;  1GC6 A;  1GAQ B;  3IXS A;  2MBQ A;  5CX3 A;  2KAN A;  4DHZ E;  1E7U A;  2LJ5 A;  2IYD B;  4L2Y A;  1UBQ A;  3D32 A;  1JRU A;  4LJP B;  4F7Z A;  1FD6 A;  1JWM D;  1FNV A;  2MH7 A;  3VH3 B;  2Y3A A;  3A9K A;  1WM2 A;  3PRP B;  4NQK E;  3HIZ A;  1ROE A;  2KHW B;  2IO1 B;  2G4D B;  3WAP A;  2CHX A;  1I4P A;  2LAS A;  3QIJ A;  2WLB A;  4WJO A; 
#chains in the Genus database with same CATH homology
 4QAY A;  4PK1 A;  2VH1 A;  4BZA A;  3NJT A;  2VH2 A;  2X8X X;  4C00 A;  2V9H A;  2MHJ A;  4K3B A;  4K3C A;  3OG5 A;  3EFC A;  2QDF A;  4C4V A;  3Q6B A;  4XGA B;  3MC9 A;  2QCZ A;  4C4V B;  3MC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...