3EFCA

Crystal structure of yaet periplasmic domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
327
structure length
327
Chain Sequence
GFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane protein assembly factor yaeT
publication title Crystal structure of YaeT: conformational flexibility and substrate recognition.
pubmed doi rcsb
source organism Escherichia coli
total genus 72
structure length 327
sequence length 327
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA04
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA03
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3efcA01
4C00A 4K3CA 4QAYA 3OG5A 2V9HA 3MC8A 4BZAA 3NJTA 2VH2A 2VH1A 4C4VA 2MHJA 4K3BA 4PK1A 3MC9A 4C4VB 3Q6BA 4XGAB 2X8XX 2QCZA 3EFCA 2QDFA
chains in the Genus database with same CATH superfamily
2FAZA 5H8YE 1SB3C 2BGFA 4I6PA 2LGYA 3A4SC 1OQYA 4QAYA 1UBIA 5BMHA 3APFA 2VZKD 2WX0A 5E6NA 3ZVVA 2DAJA 2DLBA 4MM3B 3PPAA 5FKAC 2KFKA 2WXKA 3P4PB 2ZNVC 4KDIC 2QHOA 4OZBA 1MG4A 3AN1A 3ZXVA 3AU4A 4B9KA 2LUMA 3QARA 3N1XC 1TYGB 4LNNA 4XWWA 2B3AA 5BYRA 5D7GA 3JYUA 1GG3A 3VH4B 4DHZE 1V5TA 1RFKA 2QCZA 3AEGB 2D3AA 1V8CA 2PPHA 4GU2A 4C56C 4B6WA 5AZHA 4WJNA 3WANA 3ZDMC 5EDSA 3BYTB 2KXJA 2JY6A 3I57A 1I4GA 3HIZA 5G5HA 2DHZA 3BYYB 3ZW3A 1WGHA 2ZEQA 2KWUB 3EHVA 2DZJA 1HQRD 2Z8LA 2BS2B 3T9LA 3Q3JA 1YOVB 1EWCA 1SE3A 1NVID 3AE2B 2RD0A 4IWQA 4REZA 3RZFA 1UH6A 4BVUC 3RCZA 2N9XA 1ENFA 1R4NB 1YJ1A 3GE3C 3UF8A 2K3UA 4P1CC 2CS4A 4E74A 4JPSA 5TSSA 2C7NB 4GDKA 4EZJA 1FXAA 2A5UA 1SIFA 2B76B 3NS1A 4KZ0A 1S1QB 2ZPNA 1YQ4B 3X23A 4LTUA 1XLQA 1C76A 4MH8A 1P7FA 1JWBD 3NVYA 3FKYA 4K3CA 1VLBA 5HKHA 4B95A 1M94A 4MM3A 3AE1B 1SJED 3AEEB 2CHZA 3R2TA 2KDFB 5J17A 2XK5B 4XGAB 1T0SC 2RSUA 2N7EA 5L95C 4OZAA 4A55A 2V0GA 1NI3A 1PGXA 4WJPA 4YSZB 2LI5A 2PVGC 1SBBB 2G4SA 3ZNZB 3P1MA 3IFWB 2KWVB 1UELA 1N5WA 1JW9D 3TJPA 1KLGD 1TY2A 1E8XA 1I7HA 3Q3MC 3H9DA 1WF9A 1YNTE 3JSVA 3TCAA 3IXSA 3BY4B 3T3OA 1FNWA 2K8BA 1FFVA 4IM3A 4YXDB 2BB5A 1N6ZA 3RYTA 1V1PB 1TS5A 2BS3B 4FADA 5GMVA 5EE9A 5AZGA 4XC2A 3R7RA 3W9CB 3DBHI 4OHJA 3E9SA 2BF8B 5C2TB 2ZCCA 3JW0X 3WAMA 2KX0A 3ENEA 3N20C 1VCBA 1K52A 2LHEA 3IBEA 3T8MA 2OJRA 2LFIA 2PIAA 3LJ3A 1PUTA 2KJRA 2LGIA 2FCQA 2V3SA 5IN7A 1C9FA 4KZCA 2KN5A 4E3CA 4YTMB 4OVUA 4A90A 4FXCA 2BPSA 1YQBA 5FK9C 2Y5PA 4HDQA 3U7ZA 3L13A 1FRRA 2MCNB 2EMSA 2SAKA 5IKCM 4A8XC 2G4DB 3UINB 1C4PA 3Q2AC 1KJTA 2MWSB 2GBNA 3HVZA 2M0XA 3RNCC 4YSXB 4XZ4A 2K9XA 1GUAB 1WJNA 1CQVA 2QMTA 1QOAA 5JH5C 2XK5A 3L17A 1YX5B 2MP2A 2WNMA 3QK0A 1TJEA 2L32A 2N7JA 1U4AA 4EZKA 3A4RA 5LXIB 1V81A 2HTHA 3RNFC 4K7WA 2XNAC 4YTPB 2LXCA 2KO3A 3R2IA 3RN9C 2IY0B 1YQ3B 3UQBA 1ZUD2 4LDTD 4W9LA 5AUKA 2V3NA 1TKGA 4NQLB 1FCLA 2K6QA 2INPE 3W5UB 4NJ6A 2KD0A 2L0FA 3CF6E 1GOZA 3TEZA 2KC2A 2K25A 1FPYA 4C00A 1LXDA 3PHXB 2KWCA 3AECB 2CR5A 1D6EC 4NAWB 4ANWA 3C8YA 3QCAA 2JZZA 2K6DB 4M01A 5IO9A 3RD2A 1EU3A 1D5ZC 1WXAA 4DHJB 2JUOA 4MGIE 3Q6BA 3VH3B 1AARA 1HTQA 2XEWA 2PMVA 3H6NA 4HDOA 1AWDA 3SFDB 3DVNU 3DVGY 4DQOC 1UZXB 3VUWA 4FJVB 2UYZB 1E90A 1OEYA 4DXFA 1WE7A 4RGNA 2ZNVB 4KIKB 4HROA 1L5PA 2GBJA 1HE8A 2QDFA 1C3TA 3H7SA 3RZWC 1V80A 2L00B 2MRPA 4N9F4 1E7VA 3ALBA 4NPNA 2O2VB 4MELA 4A9AA 5LNK1 1ROEA 4MT5A 4W9GA 5MPOA 3VUXA 2M19A 4ZRPA 4LCDE 2Y3AA 2WDTB 1I42A 1B1ZA 1VZ6A 2L3ZA 3ZRCA 1UNSA 3RNAC 2JXXA 1HTOA 3PLVA 3B9JA 2LGXA 3Q3NC 2IBIB 5EE3A 4GDLB 4DK5A 2BQQA 3VTVA 1ZP0B 2XN9C 4JIOU 3DWGC 1I4XA 2V4IB 3P4RB 2INNE 1WE6A 1ZPSA 1V6EA 2KQ4X 4RFBA 3DWMA 3WCQA 3FILB 3PRMB 1V86A 2RMMA 2W9NA 3DBRI 2N7DA 2PW9A 3M95A 1DYQA 1SXTA 3I3TB 2KVRA 2XBBC 1WMHB 3S2AA 5IAAC 5LXHA 4XDCA 4NAWA 1RWSA 2LVOA 3AE7B 3KYDD 4AOFA 2BB6A 4JX1C 1XD3B 3AE3B 4C7ZA 3H7PB 1IUEA 1YIWA 4WH4A 1PYWD 3IT6B 4OVVA 2KQ7A 4TV3A 1WXMA 3AEFB 1ZDXA 4II3B 4IM0A 2BKFA 2LZ6A 2X8XX 2R2QA 2KHWB 4IKGA 2NTTA 1TIFA 1TBEA 2NPTB 2JSVX 1UBQA 3AEDB 1H8CA 2KMCA 4UDUC 3TMPB 1JWAD 2VH1A 2DYMA 4KIKA 3P42A 5JZEB 3Q8BA 1YD8U 1GC6A 1KTKA 4IC7B 1XQQA 3B2GA 2MJDA 2NMQA 4R3DA 4BBNC 2WYQA 2L8JA 2J0MA 2WXFA 1FRDA 3ECIA 2D3CA 3A9JB 3DOWA 3PVLA 4TKNA 2GLSA 1RLFA 2DYBA 2KDBA 3Q8CA 1QOGA 4P16A 4HKQA 2E3TA 2G45B 2N4FA 1V1OA 2PE6B 4GDLA 3TL5A 1WY8A 2E6XA 1NDDA 5C23A 3WAPA 4HCNB 2HTME 3NG0A 4FA6A 2GBRA 4EE2A 2JVCA 2LWPA 4FN2A 1NBFC 3FILA 3O65B 5IP4D 2UWQA 4YWGG 3P4QB 3IHPC 5G2NA 3P4SB 1OFFA 1WFYA 2BWFA 1MI0A 4E71A 1EU4A 1EO6A 4ITKA 3VRAB 1Z2MA 3HRDD 1YMHE 4RM8A 1P7EA 1EF1A 2KACA 3KVFB 2EKIA 4A6QA 3OJ3A 3N1ZC 4N58A 2BYVE 1L2NA 1RYJA 3I63C 5I4DA 2R2OA 3HVDA 3W5VB 3H7PA 1QOFA 1JQ4A 5IA7A 2FCSA 1F9JA 1HZ6A 1M4VA 3OLMD 3B0AA 3ZNID 2K8HA 3L4PA 4GOCA 3BZDB 2KTFA 2Z59B 2NPTA 4ZRKA 3Q14C 4MEMA 2J42A 2KWDA 4MSQB 4IDIA 2O6VA 4RF0A 2ONQA 3SR6A 4KVGB 2GOWA 2BYTA 3HM6X 4EZLA 2KMMA 1WWTA 3ZLZA 3PSEB 2Q5WD 4KV2A 2N9EB 4K1RB 4NZLB 3DBLB 2D2QA 2LRUA 3NVWA 3IVFA 4HPLB 2IO0B 1VD2A 2KLGA 1WM3A 3IAS1 4KDLB 3PZDA 4RF1A 2JT4B 4BKSD 2W3SA 5D6JB 3L0WB 2H89B 3NVVA 1Y8RC 2WXGA 4EUTA 1HA5A 4CO7A 1KOTA 4DWFA 3RUIB 1TT5B 1I4HA 1TKYA 3ZGZA 2MBHA 4GB9A 4A3PA 4G11A 2K1FA 1WXSA 1ET6A 1LQBA 3U4EG 4AWJA 5JHAA 2JX5A 2GBKA 3PO0A 2I2YA 4ACFA 4K81A 1J7AA 4YTNB 1SSNA 1ISNA 3W1YA 2RDHA 2ZZPB 1WX8A 4LNFA 2CHWA 2WS3B 4AUQC 2PEAA 3V05A 2W55A 1N63A 1G6JA 4ZYSA 3RFZB 3AEAB 2CU3A 2WXRA 3DPDA 5AZFA 3WAOA 5JXVA 4ZRQA 1E8ZA 1IPGA 1JCKB 4W9HA 4MDKE 2G3QB 2MBOA 2AEHA 2VZKB 1DOIA 3EFUA 2CJOA 2WDQB 3V6EB 4H2AA 3M62B 4C7YA 1L7YA 2MBQA 1MJDA 3MFGA 2M17A 5BMIA 4HKZE 4W9JA 3Q8AA 4BZAA 2C5LC 2MLBA 5KHOA 2EELA 3U2SC 1IYFA 3VAWA 3W1SA 2KZRA 4KGSA 3RULA 4XYCA 2C60A 4JWSC 3U8ZA 2EMTA 1R7SA 2GB1A 4AP4C 4PS8A 1F2RI 5T8IA 2WXPA 4WQOB 3O13A 4AS1A 4HXDA 4OZCA 2FUHB 3TEWA 1ZDVA 5DCNA 3GZNB 4FHKA 1JROA 4ARIA 1IBXB 2INDC 2AQ3B 3BK2A 3V6CB 3NZ3A 4TQ1A 1WJ6A 2MEKA 3PLUA 2C7MB 4MGYE 3W2DA 1HEZE 4ZHPA 3J9CA 2I1JA 5CHWA 5AEKB 4B0EA 2IYDB 1ZE3D 2LGDA 1FM0D 3ML8A 4MGKE 5J2RA 4PYZA 5FR3A 3L10B 3PS6A 1R4MI 2WXQA 3DDCB 1UGMA 1PDXA 3R8BA 2WXIA 2LEKA 1OTRB 1QT9A 1SE2A 2KLCA 2JRIB 2AL3A 4WWNA 5IOIA 1KM7A 4M00A 4KKIA 1F0ZA 2BYEA 4A3OA 3UI3A 4IW0A 1H4RA 2WXMA 2L7RA 5D3DA 1F52A 4DDID 5HG2A 3QHTA 4I6LB 4BOSC 1T5XD 4IG7B 1AYFA 3AB5A 4PK1A 3Q8FA 1P3QU 3MHZA 4JL9A 2MBEA 3AH7A 4ICUA 3D32A 4MACA 2RPVA 3OWEB 3NS8A 1A5RA 3QJZA 2DBYA 3RNBC 2C7HA 1J19A 4ZOHC 3DVNV 4ZYNA 3Q69A 4EFOA 5C1ZA 4HPMB 1BT0A 4BKTA 1UD7A 4RGTA 1WI0A 1SE9A 1UWXA 2MJ3A 4NY0A 1SGHA 4JE3B 3VRBB 3AE6B 1V1PA 4JGHB 4DHZB 3QC8B 4L1BA 2D5GA 2JZPA 4OVZA 1I4RA 1F1HA 3ETRA 4URKA 3M3JA 5E6PA 2KC1A 1GPXA 2PJHA 3HHMA 2ZVNA 2J52A 4NNJB 4LNKA 1E7UA 1GJZA 1GB1A 1WM2A 3AE8B 2BW2A 1WR6E 1V49A 2WQYB 3CSFA 4F8CB 3WALA 3NRZA 4TSSA 1DGJA 4BAXA 3AE9B 2QILA 3N1YC 3MJ5A 1L6UA 1XLOA 1GNUA 2J0KA 1NYQA 2TSSA 1E7PB 4II2B 1UWMA 4S17A 4F1SA 4TQ0A 2O6VD 1RRBA 3BIID 5KHQA 3VHTC 3GS2A 2KDEB 3ZXRA 3GB1A 4YT0B 5EE0A 5HHDG 2CU1A 2JQRB 2L1AA 2KFJA 5FR6A 2IGDA 1MFWA 3QIJA 2JRHA 3TIXA 2NBVB 4EOYA 2X38A 1E8WA 4W9DA 3DHHC 1QZEA 2DAFA 4DBGA 4N59A 2Z0EB 3SDLC 1E8YA 1WX9A 1WXQA 2J0JA 3AEBB 3TEYA 2IGGA 1L4ZB 1C79A 5CTRC 1JWUD 4MH0E 2K39A 2KVZA 1YX6B 1B9RA 2FBWB 1FEHA 2NS5A 4C4VB 2OOBB 2IO2B 5DPRA 3ZJUA 2H88B 1J8CA 2N0SB 5HFYA 2M0AA 3AU5A 1MHHE 1T6BX 2LRWA 2NTSA 1WZ3A 2L05A 4NJCA 1MHXA 2HJ1A 1C4CA 3BVZA 5BYQA 2WWZA 2D3BA 3EUB2 4BOZB 1WRDB 3JVZX 1K50A 1P0RA 2ASQA 4LDTB 3N30A 1T0QC 3AV8A 1QLBB 1FD6A 3K9OB 2IO3B 3ZRFA 1L0YB 1GAQB 1T0YA 2D11A 2PLPA 1E5WA 4GSWA 3RPFC 3N3KB 3AM9A 3LXFA 3GOEA 4LNIA 4FJZA 3VDZA 2HJ8A 1FO4A 1X1MA 1WGGA 3NZSA 2INCC 3AE4B 3KUZA 3ONSA 1XT9B 3VXWA 1PQSA 1WX7A 1ZOYB 2IDYA 3SHQA 1JALA 4WQMA 1FXTB 3PT2B 2WDVB 2JU6X 2L76A 3C19A 4M8NA 3MP9A 2O2VA 3SEBA 3H8HA 1XCQL 2QJLA 1WR1A 4P1BC 2YEPB 1XF5L 4Q2JA 3H1UA 3PRPB 4PYUA 4HCPB 3Q3OC 3PV1A 2MHJA 3VVWB 3UQAA 1TKEA 1C4AA 3VUYA 4LLGM 1JWMD 4PT5A 1L0VB 2DWQA 4HJKA 3BWUD 4N6EB 2KOXA 2BVCA 1CMXB 3A1QB 1V9JA 1EM7A 3KUDB 3R7QA 4C4VA 4KSLC 3AMZA 1C77A 3C0RB 3GE8C 5E6JA 4MSMB 4TMAB 4MJSB 4XDDA 3PZ8A 1XO3A 2DYOA 3PREA 1UF0A 1WYWB 3B08A 4LJPB 1UUPA 1Q0WB 4LNOA 3NJTA 2DZMA 4RNAA 2K5PA 3V60A 1WMHA 1E10A 5D94A 2R61A 3DBSA 4BKGA 1VZ8A 1SF0A 4K7SA 2NBWB 2HE7A 1CJEA 5CHVC 3FC4A 1UGJA 2KN4A 1QF6A 2D07B 1A70A 1WRIA 2Y5BB 1TZOA 1FFUA 4ARCA 3QAQA 2YVCA 2FNJB 2GBMA 2PTLA 3K9PB 1C1YB 4P7IA 1AW7A 1WGKA 5CX3A 2ZCBA 3APCA 3VTUA 1NI2A 3UIPB 5C3JB 2N9LA 1RAXA 3WIMA 1WGRA 2G9HD 2WXHA 4WAAA 5DPTA 3B2FA 2OHFA 4IUMB 5H92C 3RNGC 3URYA 3RMKC 2KTRB 4CQNA 2WXOA 4DXAB 1J0GA 2MBBB 2KT7A 3MHSD 2JZ3B 3RT3B 3EA6A 1WYGA 3DBLI 1TS3A 1EF5A 4USAA 4BBNF 3VTWA 4ZRJA 3CIRB 1EUVB 2SEBD 3CMMB 3A9JA 2K8CA 2KKCA 3OJ4B 1ZGUB 2QIEB 3JSVB 5BO4B 4F7ZA 1FIQA 4PS3A 3ZQ4A 5BYSA 1CK1A 3N9YC 4RMAA 1VDVA 2N1VA 3A1QA 4NJ7A 4WURA 1R4NI 2BT6A 3KLSX 4C80A 4HRSA 2L83A 3ZYYX 4KSKC 2FIFA 4MJSA 2NR2A 5EE1A 4XE0A 4S0RA 1RM6C 1JMLA 2KDIA 4B0MA 3R3MA 5JHBA 2DNFA 4GLSC 2L52A 4RM9A 4HWIB 3UIOB 4NAMA 4FULA 2KX3A 2AQ1B 4HEA1 2K22A 1L4DB 1D5MC 4K3BA 2AYOB 1KLUD 1P9DU 2CHXA 3MJWA 1STEA 3P2BA 4WIPA 2IPKD 2RDGA 4IM2A 2GRIA 3U30A 2JPHA 4RH6A 2J53A 3BINA 3NY5A 3ZJVA 4XWTA 2WP9B 1JRUA 1ET9A 2DZIA 4XX5A 4BFRA 3KUCB 2CJNA 1FMAD 2MJEA 5E6OA 1BMLC 2LVQA 1N62A 4AJYB 2MP2B 3DCGA 2MW5A 4L23A 4P6VF 2KYWA 2KTRA 4WWPA 3ZNHB 1TS2A 1V5OA 2N1WA 3NOBA 2BTEA 3Q8EA 4HLEA 2AL6A 1KRHA 2NBUA 1K51A 3ZDTA 2MX2A 2LXAA 2LVPA 1J7CA 4IWPA 1TGZB 4IWOA 4YSYB 4HJGE 4FJYA 3U52E 1N60A 1JRPA 3AXCA 1KH0A 3FAHA 4FLHA 1PGAA 2KAJA 5G55A 1KFYB 2CKHB 3NHEB 2WU5B 1LGRA 4G50A 4WAFA 3ZTCA 4GMVA 3WA0A 3PZ7A 3GZNI 3TBLD 4GGQA 4D2KA 4DHJD 3CSTA 4ICVA 1N5XA 4HVBA 3DBHB 2C9WB 1E9MA 2DENB 4M02A 1Q5WB 3HM3A 2MA9B 4AJWA 1WJUA 1QOBA 5DPSA 3SU8X 1CZPA 2KQSA 2NVUI 2KNBA 1IP9A 4ANVA 2V4LA 1P98A 4CHKA 1BXTA 1PGBA 1XLNA 3ML9A 1KF6B 2AX5A 1D5XC 1AN8A 2JWUA 1TS4A 2LD9A 2DZKA 1R4MB 4J6IA 1VR9A 2PVOD 3PTFC 3I9V1 3ZO5B 2D10A 3NZUA 1WGYA 5LLIA 3U7DA 4W9FA 2WXLA 1SJHD 2NCNA 2PE9A 4J3OD 3RNEC 2DX5B 5TR5A 4FBJB 2VRRB 4RGMA 3IG3A 4KGTA 4ANXA 1QILA 1YN4A 3CWIA 1GC7A 5CHFA 3TUOA 3RI7C 4KKJA 4JLCA 1FNUA 2MSED 3AI5A 1YJJA 1ZKHA 3OG5A 3PHWB 3BVMA 4M0WB 1V2YA 1L6VA 1WGDA 3ZKJC 2LJ5A 1RFAA 2BKRB 4JQWC 1F77A 3W1SC 1T0RC 2OJWA 2YEPF 2QSDA 2JXTA 3KWLA 1T3QA 4K7UA 4LJOB 3V3XA 3V62A 1OEYJ 1YN3A 3QX1A 1VZ7A 2WX1A 1PFDA 2V1YA 4A20A 2V3PA 1BUIC 3TSSA 1KLVA 1C78A 2KK8A 1TY0A 2N9KA 4DDGD 2OEDA 1IBXA 2MQJA 4KGRA 3ABVB 4BKSA 3MTNB 3UGBB 3PGEA 4WWOA 1WXVA 2WHIA 2Z0DB 1Z5SB 3VR8B 1XCTL 3BVGA 1DOYA 4AQ7A 4L2YA 1WH3A 3SFEB 2V9HA 1GB4A 2M1MA 3QA8A 1HZ5A 1OGWA 2KANA 3VQIA 2JWZA 1WJ4A 1S3SG 4CYEA 4X57B 4ZRIA 1YN5A 2G1EA 2KJHB 3L08A 3DHIC 3KW5B 2W3RA 2JYTA 2I38A 1TTNA 4WWMA 3L16A 2KDMA 3ZJTA 2IY1B 4NQKE 3AE5B 1E0ZA 2LUEA 3KWVA 3Q3FA 5D3IB 3EC8A 2D3GA 1LFDA 1EWYC 2ICIA 4GN1A 4FHJA 2ZVOA 2BWES 3ZUNA 1K8RB 3NUHB 3A9KB 1MPEA 1XLPA 3IT4B 5GXGB 3QQ8B 1HXYD 1MVKA 2ZW1A 2ON8A 3V61A 1P1AA 2RR9A 2LASA 5AUIA 3SD5A 2UU7A 4ASWC 3KH0A 2AWTA 5DPWA 2LJIA 3HK0A 1YJIA 2WXJA 2QEJC 3B1LX 1ZW7A 4M0WA 4DXGA 2N9PC 4W9KA 2BYFA 1ZXHA 1ACCA 4US8A 4OW0A 2I1KA 1ZXIA 1Y56A 3HUIA 3MC8A 4WJOA 2FCNA 2WDRB 1XEEA 1F2RC 2ZPYA 3R66C 4O1NA 2MH7A 2REXA 2J7QB 1FNVA 3VFKA 2IZVB 2M8SA 3IAM1 4RCOA 4W9IA 3TEXA 2M4NA 3LYYA 1ESFA 3DBRB 4MGZE 1NENB 1K53A 1MG8A 2FIDA 2KMAA 4YL8A 2ZW0A 5G5GA 1LM8B 1I4PA 1FXIA 2WLBA 2GI9A 2FCMA 1JWSD 3APDA 4JWUC 1E6EB 1D4BA 1DOXA 2JF5A 2K0PA 1VRAB 3EFCA 2GMIC 2Y5CA 3L54A 3ZTDA 5L83A 2WGSA 4HPPA 5BMGA 2HD5B 2LGSA 2EKEC 1QKZA 1QQRA 2AQ2B 3KYCD 4W9EA 2KFKB 2W54A 3OAWA 2IJ0A 2FUG1 2PKOA 3LDZE 1XXGA 5D2MB 4HK2A 1OQRA 2BS4B 3N32A 3MC9A 4IOIE 1Q10A 4M8MA 4G0NB 4I6NB 1OQQA 2IGHA 5J18A 3T3NA 2FE8A 4RGOS 2A4ZA 2O6VB 4GIVA 2HDEA 1I4QA 1L0XB 2IO1B 3PRZA 1Q1OA 4WJQA 3MC0B 3A9KA 1WZ0A 1SE4A 3I5JC 4ZHOA 1SIJA 1SEBD 1FCCC 2ACZB 2RGFA 4LK0M 3DVGX 2LMCA 3DHGC 2W82A 3P63A 4PS7A 3EGRA 4W9CA 2WXNA 2VH2A 1LO5D 2LHDA 3KQ4A 2M56B 3DQVA 4KX6B 2L0TA 5HI1A 1I35A 1TZ1A 4EKUA 3NVZA 3GP7A 1NYRA 3BK1A 3EECA 3QWZB 1J7BA 2WU2B 1WSPA 2RDBC 4EEWA 2ZJDA 3A33B 3AULA 4GXBA 1D3ZA 1VJKA 2JYEA 3ZNGC 3X0WA 4G3XB 4GDKB 3M63B 1IGCA 4ZDVA 2J4XA 3LB8C 1WIAA 2RPQA 4TUUA 2BBCA 2YLMA 3ZIMA 4ANUA 1IGDA 4US9A 1N61A 1V97A 3VR9B 2QC8A 1NEKB 3E56A 2KJ6A
chains in the Genus database with same CATH topology
4C00A 4K3CA 4QAYA 3OG5A 2V9HA 3MC8A 4BZAA 3NJTA 2VH2A 2VH1A 4C4VA 2MHJA 4K3BA 4PK1A 3MC9A 4C4VB 3Q6BA 4XGAB 2X8XX 2QCZA 3EFCA 2QDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C00 A;  4K3C A;  4QAY A;  3OG5 A;  2V9H A;  3MC8 A;  4BZA A;  3NJT A;  2VH2 A;  2VH1 A;  4C4V A;  2MHJ A;  4K3B A;  4PK1 A;  3MC9 A;  4C4V B;  3Q6B A;  4XGA B;  2X8X X;  2QCZ A;  3EFC A;  2QDF A; 
#chains in the Genus database with same CATH topology
 2FAZ A;  5H8Y E;  1SB3 C;  2BGF A;  4I6P A;  2LGY A;  3A4S C;  1OQY A;  4QAY A;  1UBI A;  5BMH A;  3APF A;  2VZK D;  2WX0 A;  5E6N A;  3ZVV A;  2DAJ A;  2DLB A;  4MM3 B;  3PPA A;  5FKA C;  2KFK A;  2WXK A;  3P4P B;  2ZNV C;  4KDI C;  2QHO A;  4OZB A;  1MG4 A;  3AN1 A;  3ZXV A;  3AU4 A;  4B9K A;  2LUM A;  3QAR A;  3N1X C;  1TYG B;  4LNN A;  4XWW A;  2B3A A;  5BYR A;  5D7G A;  3JYU A;  1GG3 A;  3VH4 B;  4DHZ E;  1V5T A;  1RFK A;  2QCZ A;  3AEG B;  2D3A A;  1V8C A;  2PPH A;  4GU2 A;  4C56 C;  4B6W A;  5AZH A;  4WJN A;  3WAN A;  3ZDM C;  5EDS A;  3BYT B;  2KXJ A;  2JY6 A;  3I57 A;  1I4G A;  3HIZ A;  5G5H A;  2DHZ A;  3BYY B;  3ZW3 A;  1WGH A;  2ZEQ A;  2KWU B;  3EHV A;  2DZJ A;  1HQR D;  2Z8L A;  2BS2 B;  3T9L A;  3Q3J A;  1YOV B;  1EWC A;  1SE3 A;  1NVI D;  3AE2 B;  2RD0 A;  4IWQ A;  4REZ A;  3RZF A;  1UH6 A;  4BVU C;  3RCZ A;  2N9X A;  1ENF A;  1R4N B;  1YJ1 A;  3GE3 C;  3UF8 A;  2K3U A;  4P1C C;  2CS4 A;  4E74 A;  4JPS A;  5TSS A;  2C7N B;  4GDK A;  4EZJ A;  1FXA A;  2A5U A;  1SIF A;  2B76 B;  3NS1 A;  4KZ0 A;  1S1Q B;  2ZPN A;  1YQ4 B;  3X23 A;  4LTU A;  1XLQ A;  1C76 A;  4MH8 A;  1P7F A;  1JWB D;  3NVY A;  3FKY A;  4K3C A;  1VLB A;  5HKH A;  4B95 A;  1M94 A;  4MM3 A;  3AE1 B;  1SJE D;  3AEE B;  2CHZ A;  3R2T A;  2KDF B;  5J17 A;  2XK5 B;  4XGA B;  1T0S C;  2RSU A;  2N7E A;  5L95 C;  4OZA A;  4A55 A;  2V0G A;  1NI3 A;  1PGX A;  4WJP A;  4YSZ B;  2LI5 A;  2PVG C;  1SBB B;  2G4S A;  3ZNZ B;  3P1M A;  3IFW B;  2KWV B;  1UEL A;  1N5W A;  1JW9 D;  3TJP A;  1KLG D;  1TY2 A;  1E8X A;  1I7H A;  3Q3M C;  3H9D A;  1WF9 A;  1YNT E;  3JSV A;  3TCA A;  3IXS A;  3BY4 B;  3T3O A;  1FNW A;  2K8B A;  1FFV A;  4IM3 A;  4YXD B;  2BB5 A;  1N6Z A;  3RYT A;  1V1P B;  1TS5 A;  2BS3 B;  4FAD A;  5GMV A;  5EE9 A;  5AZG A;  4XC2 A;  3R7R A;  3W9C B;  3DBH I;  4OHJ A;  3E9S A;  2BF8 B;  5C2T B;  2ZCC A;  3JW0 X;  3WAM A;  2KX0 A;  3ENE A;  3N20 C;  1VCB A;  1K52 A;  2LHE A;  3IBE A;  3T8M A;  2OJR A;  2LFI A;  2PIA A;  3LJ3 A;  1PUT A;  2KJR A;  2LGI A;  2FCQ A;  2V3S A;  5IN7 A;  1C9F A;  4KZC A;  2KN5 A;  4E3C A;  4YTM B;  4OVU A;  4A90 A;  4FXC A;  2BPS A;  1YQB A;  5FK9 C;  2Y5P A;  4HDQ A;  3U7Z A;  3L13 A;  1FRR A;  2MCN B;  2EMS A;  2SAK A;  5IKC M;  4A8X C;  2G4D B;  3UIN B;  1C4P A;  3Q2A C;  1KJT A;  2MWS B;  2GBN A;  3HVZ A;  2M0X A;  3RNC C;  4YSX B;  4XZ4 A;  2K9X A;  1GUA B;  1WJN A;  1CQV A;  2QMT A;  1QOA A;  5JH5 C;  2XK5 A;  3L17 A;  1YX5 B;  2MP2 A;  2WNM A;  3QK0 A;  1TJE A;  2L32 A;  2N7J A;  1U4A A;  4EZK A;  3A4R A;  5LXI B;  1V81 A;  2HTH A;  3RNF C;  4K7W A;  2XNA C;  4YTP B;  2LXC A;  2KO3 A;  3R2I A;  3RN9 C;  2IY0 B;  1YQ3 B;  3UQB A;  1ZUD 2;  4LDT D;  4W9L A;  5AUK A;  2V3N A;  1TKG A;  4NQL B;  1FCL A;  2K6Q A;  2INP E;  3W5U B;  4NJ6 A;  2KD0 A;  2L0F A;  3CF6 E;  1GOZ A;  3TEZ A;  2KC2 A;  2K25 A;  1FPY A;  4C00 A;  1LXD A;  3PHX B;  2KWC A;  3AEC B;  2CR5 A;  1D6E C;  4NAW B;  4ANW A;  3C8Y A;  3QCA A;  2JZZ A;  2K6D B;  4M01 A;  5IO9 A;  3RD2 A;  1EU3 A;  1D5Z C;  1WXA A;  4DHJ B;  2JUO A;  4MGI E;  3Q6B A;  3VH3 B;  1AAR A;  1HTQ A;  2XEW A;  2PMV A;  3H6N A;  4HDO A;  1AWD A;  3SFD B;  3DVN U;  3DVG Y;  4DQO C;  1UZX B;  3VUW A;  4FJV B;  2UYZ B;  1E90 A;  1OEY A;  4DXF A;  1WE7 A;  4RGN A;  2ZNV B;  4KIK B;  4HRO A;  1L5P A;  2GBJ A;  1HE8 A;  2QDF A;  1C3T A;  3H7S A;  3RZW C;  1V80 A;  2L00 B;  2MRP A;  4N9F 4;  1E7V A;  3ALB A;  4NPN A;  2O2V B;  4MEL A;  4A9A A;  5LNK 1;  1ROE A;  4MT5 A;  4W9G A;  5MPO A;  3VUX A;  2M19 A;  4ZRP A;  4LCD E;  2Y3A A;  2WDT B;  1I42 A;  1B1Z A;  1VZ6 A;  2L3Z A;  3ZRC A;  1UNS A;  3RNA C;  2JXX A;  1HTO A;  3PLV A;  3B9J A;  2LGX A;  3Q3N C;  2IBI B;  5EE3 A;  4GDL B;  4DK5 A;  2BQQ A;  3VTV A;  1ZP0 B;  2XN9 C;  4JIO U;  3DWG C;  1I4X A;  2V4I B;  3P4R B;  2INN E;  1WE6 A;  1ZPS A;  1V6E A;  2KQ4 X;  4RFB A;  3DWM A;  3WCQ A;  3FIL B;  3PRM B;  1V86 A;  2RMM A;  2W9N A;  3DBR I;  2N7D A;  2PW9 A;  3M95 A;  1DYQ A;  1SXT A;  3I3T B;  2KVR A;  2XBB C;  1WMH B;  3S2A A;  5IAA C;  5LXH A;  4XDC A;  4NAW A;  1RWS A;  2LVO A;  3AE7 B;  3KYD D;  4AOF A;  2BB6 A;  4JX1 C;  1XD3 B;  3AE3 B;  4C7Z A;  3H7P B;  1IUE A;  1YIW A;  4WH4 A;  1PYW D;  3IT6 B;  4OVV A;  2KQ7 A;  4TV3 A;  1WXM A;  3AEF B;  1ZDX A;  4II3 B;  4IM0 A;  2BKF A;  2LZ6 A;  2X8X X;  2R2Q A;  2KHW B;  4IKG A;  2NTT A;  1TIF A;  1TBE A;  2NPT B;  2JSV X;  1UBQ A;  3AED B;  1H8C A;  2KMC A;  4UDU C;  3TMP B;  1JWA D;  2VH1 A;  2DYM A;  4KIK A;  3P42 A;  5JZE B;  3Q8B A;  1YD8 U;  1GC6 A;  1KTK A;  4IC7 B;  1XQQ A;  3B2G A;  2MJD A;  2NMQ A;  4R3D A;  4BBN C;  2WYQ A;  2L8J A;  2J0M A;  2WXF A;  1FRD A;  3ECI A;  2D3C A;  3A9J B;  3DOW A;  3PVL A;  4TKN A;  2GLS A;  1RLF A;  2DYB A;  2KDB A;  3Q8C A;  1QOG A;  4P16 A;  4HKQ A;  2E3T A;  2G45 B;  2N4F A;  1V1O A;  2PE6 B;  4GDL A;  3TL5 A;  1WY8 A;  2E6X A;  1NDD A;  5C23 A;  3WAP A;  4HCN B;  2HTM E;  3NG0 A;  4FA6 A;  2GBR A;  4EE2 A;  2JVC A;  2LWP A;  4FN2 A;  1NBF C;  3FIL A;  3O65 B;  5IP4 D;  2UWQ A;  4YWG G;  3P4Q B;  3IHP C;  5G2N A;  3P4S B;  1OFF A;  1WFY A;  2BWF A;  1MI0 A;  4E71 A;  1EU4 A;  1EO6 A;  4ITK A;  3VRA B;  1Z2M A;  3HRD D;  1YMH E;  4RM8 A;  1P7E A;  1EF1 A;  2KAC A;  3KVF B;  2EKI A;  4A6Q A;  3OJ3 A;  3N1Z C;  4N58 A;  2BYV E;  1L2N A;  1RYJ A;  3I63 C;  5I4D A;  2R2O A;  3HVD A;  3W5V B;  3H7P A;  1QOF A;  1JQ4 A;  5IA7 A;  2FCS A;  1F9J A;  1HZ6 A;  1M4V A;  3OLM D;  3B0A A;  3ZNI D;  2K8H A;  3L4P A;  4GOC A;  3BZD B;  2KTF A;  2Z59 B;  2NPT A;  4ZRK A;  3Q14 C;  4MEM A;  2J42 A;  2KWD A;  4MSQ B;  4IDI A;  2O6V A;  4RF0 A;  2ONQ A;  3SR6 A;  4KVG B;  2GOW A;  2BYT A;  3HM6 X;  4EZL A;  2KMM A;  1WWT A;  3ZLZ A;  3PSE B;  2Q5W D;  4KV2 A;  2N9E B;  4K1R B;  4NZL B;  3DBL B;  2D2Q A;  2LRU A;  3NVW A;  3IVF A;  4HPL B;  2IO0 B;  1VD2 A;  2KLG A;  1WM3 A;  3IAS 1;  4KDL B;  3PZD A;  4RF1 A;  2JT4 B;  4BKS D;  2W3S A;  5D6J B;  3L0W B;  2H89 B;  3NVV A;  1Y8R C;  2WXG A;  4EUT A;  1HA5 A;  4CO7 A;  1KOT A;  4DWF A;  3RUI B;  1TT5 B;  1I4H A;  1TKY A;  3ZGZ A;  2MBH A;  4GB9 A;  4A3P A;  4G11 A;  2K1F A;  1WXS A;  1ET6 A;  1LQB A;  3U4E G;  4AWJ A;  5JHA A;  2JX5 A;  2GBK A;  3PO0 A;  2I2Y A;  4ACF A;  4K81 A;  1J7A A;  4YTN B;  1SSN A;  1ISN A;  3W1Y A;  2RDH A;  2ZZP B;  1WX8 A;  4LNF A;  2CHW A;  2WS3 B;  4AUQ C;  2PEA A;  3V05 A;  2W55 A;  1N63 A;  1G6J A;  4ZYS A;  3RFZ B;  3AEA B;  2CU3 A;  2WXR A;  3DPD A;  5AZF A;  3WAO A;  5JXV A;  4ZRQ A;  1E8Z A;  1IPG A;  1JCK B;  4W9H A;  4MDK E;  2G3Q B;  2MBO A;  2AEH A;  2VZK B;  1DOI A;  3EFU A;  2CJO A;  2WDQ B;  3V6E B;  4H2A A;  3M62 B;  4C7Y A;  1L7Y A;  2MBQ A;  1MJD A;  3MFG A;  2M17 A;  5BMI A;  4HKZ E;  4W9J A;  3Q8A A;  4BZA A;  2C5L C;  2MLB A;  5KHO A;  2EEL A;  3U2S C;  1IYF A;  3VAW A;  3W1S A;  2KZR A;  4KGS A;  3RUL A;  4XYC A;  2C60 A;  4JWS C;  3U8Z A;  2EMT A;  1R7S A;  2GB1 A;  4AP4 C;  4PS8 A;  1F2R I;  5T8I A;  2WXP A;  4WQO B;  3O13 A;  4AS1 A;  4HXD A;  4OZC A;  2FUH B;  3TEW A;  1ZDV A;  5DCN A;  3GZN B;  4FHK A;  1JRO A;  4ARI A;  1IBX B;  2IND C;  2AQ3 B;  3BK2 A;  3V6C B;  3NZ3 A;  4TQ1 A;  1WJ6 A;  2MEK A;  3PLU A;  2C7M B;  4MGY E;  3W2D A;  1HEZ E;  4ZHP A;  3J9C A;  2I1J A;  5CHW A;  5AEK B;  4B0E A;  2IYD B;  1ZE3 D;  2LGD A;  1FM0 D;  3ML8 A;  4MGK E;  5J2R A;  4PYZ A;  5FR3 A;  3L10 B;  3PS6 A;  1R4M I;  2WXQ A;  3DDC B;  1UGM A;  1PDX A;  3R8B A;  2WXI A;  2LEK A;  1OTR B;  1QT9 A;  1SE2 A;  2KLC A;  2JRI B;  2AL3 A;  4WWN A;  5IOI A;  1KM7 A;  4M00 A;  4KKI A;  1F0Z A;  2BYE A;  4A3O A;  3UI3 A;  4IW0 A;  1H4R A;  2WXM A;  2L7R A;  5D3D A;  1F52 A;  4DDI D;  5HG2 A;  3QHT A;  4I6L B;  4BOS C;  1T5X D;  4IG7 B;  1AYF A;  3AB5 A;  4PK1 A;  3Q8F A;  1P3Q U;  3MHZ A;  4JL9 A;  2MBE A;  3AH7 A;  4ICU A;  3D32 A;  4MAC A;  2RPV A;  3OWE B;  3NS8 A;  1A5R A;  3QJZ A;  2DBY A;  3RNB C;  2C7H A;  1J19 A;  4ZOH C;  3DVN V;  4ZYN A;  3Q69 A;  4EFO A;  5C1Z A;  4HPM B;  1BT0 A;  4BKT A;  1UD7 A;  4RGT A;  1WI0 A;  1SE9 A;  1UWX A;  2MJ3 A;  4NY0 A;  1SGH A;  4JE3 B;  3VRB B;  3AE6 B;  1V1P A;  4JGH B;  4DHZ B;  3QC8 B;  4L1B A;  2D5G A;  2JZP A;  4OVZ A;  1I4R A;  1F1H A;  3ETR A;  4URK A;  3M3J A;  5E6P A;  2KC1 A;  1GPX A;  2PJH A;  3HHM A;  2ZVN A;  2J52 A;  4NNJ B;  4LNK A;  1E7U A;  1GJZ A;  1GB1 A;  1WM2 A;  3AE8 B;  2BW2 A;  1WR6 E;  1V49 A;  2WQY B;  3CSF A;  4F8C B;  3WAL A;  3NRZ A;  4TSS A;  1DGJ A;  4BAX A;  3AE9 B;  2QIL A;  3N1Y C;  3MJ5 A;  1L6U A;  1XLO A;  1GNU A;  2J0K A;  1NYQ A;  2TSS A;  1E7P B;  4II2 B;  1UWM A;  4S17 A;  4F1S A;  4TQ0 A;  2O6V D;  1RRB A;  3BII D;  5KHQ A;  3VHT C;  3GS2 A;  2KDE B;  3ZXR A;  3GB1 A;  4YT0 B;  5EE0 A;  5HHD G;  2CU1 A;  2JQR B;  2L1A A;  2KFJ A;  5FR6 A;  2IGD A;  1MFW A;  3QIJ A;  2JRH A;  3TIX A;  2NBV B;  4EOY A;  2X38 A;  1E8W A;  4W9D A;  3DHH C;  1QZE A;  2DAF A;  4DBG A;  4N59 A;  2Z0E B;  3SDL C;  1E8Y A;  1WX9 A;  1WXQ A;  2J0J A;  3AEB B;  3TEY A;  2IGG A;  1L4Z B;  1C79 A;  5CTR C;  1JWU D;  4MH0 E;  2K39 A;  2KVZ A;  1YX6 B;  1B9R A;  2FBW B;  1FEH A;  2NS5 A;  4C4V B;  2OOB B;  2IO2 B;  5DPR A;  3ZJU A;  2H88 B;  1J8C A;  2N0S B;  5HFY A;  2M0A A;  3AU5 A;  1MHH E;  1T6B X;  2LRW A;  2NTS A;  1WZ3 A;  2L05 A;  4NJC A;  1MHX A;  2HJ1 A;  1C4C A;  3BVZ A;  5BYQ A;  2WWZ A;  2D3B A;  3EUB 2;  4BOZ B;  1WRD B;  3JVZ X;  1K50 A;  1P0R A;  2ASQ A;  4LDT B;  3N30 A;  1T0Q C;  3AV8 A;  1QLB B;  1FD6 A;  3K9O B;  2IO3 B;  3ZRF A;  1L0Y B;  1GAQ B;  1T0Y A;  2D11 A;  2PLP A;  1E5W A;  4GSW A;  3RPF C;  3N3K B;  3AM9 A;  3LXF A;  3GOE A;  4LNI A;  4FJZ A;  3VDZ A;  2HJ8 A;  1FO4 A;  1X1M A;  1WGG A;  3NZS A;  2INC C;  3AE4 B;  3KUZ A;  3ONS A;  1XT9 B;  3VXW A;  1PQS A;  1WX7 A;  1ZOY B;  2IDY A;  3SHQ A;  1JAL A;  4WQM A;  1FXT B;  3PT2 B;  2WDV B;  2JU6 X;  2L76 A;  3C19 A;  4M8N A;  3MP9 A;  2O2V A;  3SEB A;  3H8H A;  1XCQ L;  2QJL A;  1WR1 A;  4P1B C;  2YEP B;  1XF5 L;  4Q2J A;  3H1U A;  3PRP B;  4PYU A;  4HCP B;  3Q3O C;  3PV1 A;  2MHJ A;  3VVW B;  3UQA A;  1TKE A;  1C4A A;  3VUY A;  4LLG M;  1JWM D;  4PT5 A;  1L0V B;  2DWQ A;  4HJK A;  3BWU D;  4N6E B;  2KOX A;  2BVC A;  1CMX B;  3A1Q B;  1V9J A;  1EM7 A;  3KUD B;  3R7Q A;  4C4V A;  4KSL C;  3AMZ A;  1C77 A;  3C0R B;  3GE8 C;  5E6J A;  4MSM B;  4TMA B;  4MJS B;  4XDD A;  3PZ8 A;  1XO3 A;  2DYO A;  3PRE A;  1UF0 A;  1WYW B;  3B08 A;  4LJP B;  1UUP A;  1Q0W B;  4LNO A;  3NJT A;  2DZM A;  4RNA A;  2K5P A;  3V60 A;  1WMH A;  1E10 A;  5D94 A;  2R61 A;  3DBS A;  4BKG A;  1VZ8 A;  1SF0 A;  4K7S A;  2NBW B;  2HE7 A;  1CJE A;  5CHV C;  3FC4 A;  1UGJ A;  2KN4 A;  1QF6 A;  2D07 B;  1A70 A;  1WRI A;  2Y5B B;  1TZO A;  1FFU A;  4ARC A;  3QAQ A;  2YVC A;  2FNJ B;  2GBM A;  2PTL A;  3K9P B;  1C1Y B;  4P7I A;  1AW7 A;  1WGK A;  5CX3 A;  2ZCB A;  3APC A;  3VTU A;  1NI2 A;  3UIP B;  5C3J B;  2N9L A;  1RAX A;  3WIM A;  1WGR A;  2G9H D;  2WXH A;  4WAA A;  5DPT A;  3B2F A;  2OHF A;  4IUM B;  5H92 C;  3RNG C;  3URY A;  3RMK C;  2KTR B;  4CQN A;  2WXO A;  4DXA B;  1J0G A;  2MBB B;  2KT7 A;  3MHS D;  2JZ3 B;  3RT3 B;  3EA6 A;  1WYG A;  3DBL I;  1TS3 A;  1EF5 A;  4USA A;  4BBN F;  3VTW A;  4ZRJ A;  3CIR B;  1EUV B;  2SEB D;  3CMM B;  3A9J A;  2K8C A;  2KKC A;  3OJ4 B;  1ZGU B;  2QIE B;  3JSV B;  5BO4 B;  4F7Z A;  1FIQ A;  4PS3 A;  3ZQ4 A;  5BYS A;  1CK1 A;  3N9Y C;  4RMA A;  1VDV A;  2N1V A;  3A1Q A;  4NJ7 A;  4WUR A;  1R4N I;  2BT6 A;  3KLS X;  4C80 A;  4HRS A;  2L83 A;  3ZYY X;  4KSK C;  2FIF A;  4MJS A;  2NR2 A;  5EE1 A;  4XE0 A;  4S0R A;  1RM6 C;  1JML A;  2KDI A;  4B0M A;  3R3M A;  5JHB A;  2DNF A;  4GLS C;  2L52 A;  4RM9 A;  4HWI B;  3UIO B;  4NAM A;  4FUL A;  2KX3 A;  2AQ1 B;  4HEA 1;  2K22 A;  1L4D B;  1D5M C;  4K3B A;  2AYO B;  1KLU D;  1P9D U;  2CHX A;  3MJW A;  1STE A;  3P2B A;  4WIP A;  2IPK D;  2RDG A;  4IM2 A;  2GRI A;  3U30 A;  2JPH A;  4RH6 A;  2J53 A;  3BIN A;  3NY5 A;  3ZJV A;  4XWT A;  2WP9 B;  1JRU A;  1ET9 A;  2DZI A;  4XX5 A;  4BFR A;  3KUC B;  2CJN A;  1FMA D;  2MJE A;  5E6O A;  1BML C;  2LVQ A;  1N62 A;  4AJY B;  2MP2 B;  3DCG A;  2MW5 A;  4L23 A;  4P6V F;  2KYW A;  2KTR A;  4WWP A;  3ZNH B;  1TS2 A;  1V5O A;  2N1W A;  3NOB A;  2BTE A;  3Q8E A;  4HLE A;  2AL6 A;  1KRH A;  2NBU A;  1K51 A;  3ZDT A;  2MX2 A;  2LXA A;  2LVP A;  1J7C A;  4IWP A;  1TGZ B;  4IWO A;  4YSY B;  4HJG E;  4FJY A;  3U52 E;  1N60 A;  1JRP A;  3AXC A;  1KH0 A;  3FAH A;  4FLH A;  1PGA A;  2KAJ A;  5G55 A;  1KFY B;  2CKH B;  3NHE B;  2WU5 B;  1LGR A;  4G50 A;  4WAF A;  3ZTC A;  4GMV A;  3WA0 A;  3PZ7 A;  3GZN I;  3TBL D;  4GGQ A;  4D2K A;  4DHJ D;  3CST A;  4ICV A;  1N5X A;  4HVB A;  3DBH B;  2C9W B;  1E9M A;  2DEN B;  4M02 A;  1Q5W B;  3HM3 A;  2MA9 B;  4AJW A;  1WJU A;  1QOB A;  5DPS A;  3SU8 X;  1CZP A;  2KQS A;  2NVU I;  2KNB A;  1IP9 A;  4ANV A;  2V4L A;  1P98 A;  4CHK A;  1BXT A;  1PGB A;  1XLN A;  3ML9 A;  1KF6 B;  2AX5 A;  1D5X C;  1AN8 A;  2JWU A;  1TS4 A;  2LD9 A;  2DZK A;  1R4M B;  4J6I A;  1VR9 A;  2PVO D;  3PTF C;  3I9V 1;  3ZO5 B;  2D10 A;  3NZU A;  1WGY A;  5LLI A;  3U7D A;  4W9F A;  2WXL A;  1SJH D;  2NCN A;  2PE9 A;  4J3O D;  3RNE C;  2DX5 B;  5TR5 A;  4FBJ B;  2VRR B;  4RGM A;  3IG3 A;  4KGT A;  4ANX A;  1QIL A;  1YN4 A;  3CWI A;  1GC7 A;  5CHF A;  3TUO A;  3RI7 C;  4KKJ A;  4JLC A;  1FNU A;  2MSE D;  3AI5 A;  1YJJ A;  1ZKH A;  3OG5 A;  3PHW B;  3BVM A;  4M0W B;  1V2Y A;  1L6V A;  1WGD A;  3ZKJ C;  2LJ5 A;  1RFA A;  2BKR B;  4JQW C;  1F77 A;  3W1S C;  1T0R C;  2OJW A;  2YEP F;  2QSD A;  2JXT A;  3KWL A;  1T3Q A;  4K7U A;  4LJO B;  3V3X A;  3V62 A;  1OEY J;  1YN3 A;  3QX1 A;  1VZ7 A;  2WX1 A;  1PFD A;  2V1Y A;  4A20 A;  2V3P A;  1BUI C;  3TSS A;  1KLV A;  1C78 A;  2KK8 A;  1TY0 A;  2N9K A;  4DDG D;  2OED A;  1IBX A;  2MQJ A;  4KGR A;  3ABV B;  4BKS A;  3MTN B;  3UGB B;  3PGE A;  4WWO A;  1WXV A;  2WHI A;  2Z0D B;  1Z5S B;  3VR8 B;  1XCT L;  3BVG A;  1DOY A;  4AQ7 A;  4L2Y A;  1WH3 A;  3SFE B;  2V9H A;  1GB4 A;  2M1M A;  3QA8 A;  1HZ5 A;  1OGW A;  2KAN A;  3VQI A;  2JWZ A;  1WJ4 A;  1S3S G;  4CYE A;  4X57 B;  4ZRI A;  1YN5 A;  2G1E A;  2KJH B;  3L08 A;  3DHI C;  3KW5 B;  2W3R A;  2JYT A;  2I38 A;  1TTN A;  4WWM A;  3L16 A;  2KDM A;  3ZJT A;  2IY1 B;  4NQK E;  3AE5 B;  1E0Z A;  2LUE A;  3KWV A;  3Q3F A;  5D3I B;  3EC8 A;  2D3G A;  1LFD A;  1EWY C;  2ICI A;  4GN1 A;  4FHJ A;  2ZVO A;  2BWE S;  3ZUN A;  1K8R B;  3NUH B;  3A9K B;  1MPE A;  1XLP A;  3IT4 B;  5GXG B;  3QQ8 B;  1HXY D;  1MVK A;  2ZW1 A;  2ON8 A;  3V61 A;  1P1A A;  2RR9 A;  2LAS A;  5AUI A;  3SD5 A;  2UU7 A;  4ASW C;  3KH0 A;  2AWT A;  5DPW A;  2LJI A;  3HK0 A;  1YJI A;  2WXJ A;  2QEJ C;  3B1L X;  1ZW7 A;  4M0W A;  4DXG A;  2N9P C;  4W9K A;  2BYF A;  1ZXH A;  1ACC A;  4US8 A;  4OW0 A;  2I1K A;  1ZXI A;  1Y56 A;  3HUI A;  3MC8 A;  4WJO A;  2FCN A;  2WDR B;  1XEE A;  1F2R C;  2ZPY A;  3R66 C;  4O1N A;  2MH7 A;  2REX A;  2J7Q B;  1FNV A;  3VFK A;  2IZV B;  2M8S A;  3IAM 1;  4RCO A;  4W9I A;  3TEX A;  2M4N A;  3LYY A;  1ESF A;  3DBR B;  4MGZ E;  1NEN B;  1K53 A;  1MG8 A;  2FID A;  2KMA A;  4YL8 A;  2ZW0 A;  5G5G A;  1LM8 B;  1I4P A;  1FXI A;  2WLB A;  2GI9 A;  2FCM A;  1JWS D;  3APD A;  4JWU C;  1E6E B;  1D4B A;  1DOX A;  2JF5 A;  2K0P A;  1VRA B;  3EFC A;  2GMI C;  2Y5C A;  3L54 A;  3ZTD A;  5L83 A;  2WGS A;  4HPP A;  5BMG A;  2HD5 B;  2LGS A;  2EKE C;  1QKZ A;  1QQR A;  2AQ2 B;  3KYC D;  4W9E A;  2KFK B;  2W54 A;  3OAW A;  2IJ0 A;  2FUG 1;  2PKO A;  3LDZ E;  1XXG A;  5D2M B;  4HK2 A;  1OQR A;  2BS4 B;  3N32 A;  3MC9 A;  4IOI E;  1Q10 A;  4M8M A;  4G0N B;  4I6N B;  1OQQ A;  2IGH A;  5J18 A;  3T3N A;  2FE8 A;  4RGO S;  2A4Z A;  2O6V B;  4GIV A;  2HDE A;  1I4Q A;  1L0X B;  2IO1 B;  3PRZ A;  1Q1O A;  4WJQ A;  3MC0 B;  3A9K A;  1WZ0 A;  1SE4 A;  3I5J C;  4ZHO A;  1SIJ A;  1SEB D;  1FCC C;  2ACZ B;  2RGF A;  4LK0 M;  3DVG X;  2LMC A;  3DHG C;  2W82 A;  3P63 A;  4PS7 A;  3EGR A;  4W9C A;  2WXN A;  2VH2 A;  1LO5 D;  2LHD A;  3KQ4 A;  2M56 B;  3DQV A;  4KX6 B;  2L0T A;  5HI1 A;  1I35 A;  1TZ1 A;  4EKU A;  3NVZ A;  3GP7 A;  1NYR A;  3BK1 A;  3EEC A;  3QWZ B;  1J7B A;  2WU2 B;  1WSP A;  2RDB C;  4EEW A;  2ZJD A;  3A33 B;  3AUL A;  4GXB A;  1D3Z A;  1VJK A;  2JYE A;  3ZNG C;  3X0W A;  4G3X B;  4GDK B;  3M63 B;  1IGC A;  4ZDV A;  2J4X A;  3LB8 C;  1WIA A;  2RPQ A;  4TUU A;  2BBC A;  2YLM A;  3ZIM A;  4ANU A;  1IGD A;  4US9 A;  1N61 A;  1V97 A;  3VR9 B;  2QC8 A;  1NEK B;  3E56 A;  2KJ6 A; 
#chains in the Genus database with same CATH homology
 4C00 A;  4K3C A;  4QAY A;  3OG5 A;  2V9H A;  3MC8 A;  4BZA A;  3NJT A;  2VH2 A;  2VH1 A;  4C4V A;  2MHJ A;  4K3B A;  4PK1 A;  3MC9 A;  4C4V B;  3Q6B A;  4XGA B;  2X8X X;  2QCZ A;  3EFC A;  2QDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...