4W9EA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 4)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9eA00
4RM9A 2IO1B 1WIAA 4GDKA 4MGYE 3R7RA 4LJOB 2GOWA 2KANA 3DBSA 1WGRA 4TV3A 3UIPB 4DDID 2RD0A 3A1QA 4JQWC 2KMAA 2KHWB 4FADA 3VXWA 2MA9B 3WAMA 2KTRA 3PHXB 2LRUA 4AWJA 2J0KA 2MW5A 4IG7B 3DBLI 1OEYJ 4GDLB 5DCNA 4M0WB 4PS8A 3VQIA 4WQOB 3SU8X 1YJ1A 4IC7B 4LDTD 3WIMA 5J18A 5CTRC 2LGYA 2V3SA 2GBNA 2JXXA 1H4RA 4JL9A 4HDQA 2GBRA 1Z2MA 2I1KA 2KQSA 2M1MA 3TMPB 3VVWB 5L83A 2I1JA 4WWNA 2ZCBA 4YL8A 4EUTA 1V86A 4MSMB 4MM3A 2XK5A 3HM6X 2GBJA 4FBJB 4DXAB 4NY0A 3ZDMC 1P0RA 2KDBA 3ZIMA 2ZVOA 2R2QA 3PLUA 2L05A 1P9DU 4GIVA 3DVGX 4KSLC 4II2B 3VUYA 1RAXA 4HDOA 4GDKB 1UELA 4G3XB 4FULA 3ZRCA 2KWVB 2KWCA 2UYZB 2N9EB 3Q3JA 3QCAA 3WALA 5L95C 3A1QB 3KUZA 2DZJA 1WJNA 3GZNI 2K8CA 2KFKA 2CHWA 3L0WB 3N32A 4BBNC 2KTRB 5LXHA 4B6WA 1K8RB 2K8HA 1WXSA 2A4ZA 4A20A 2ASQA 3K9PB 2DX5B 2HE7A 4HCPB 3VTWA 4HPLB 3IBEA 2C7NB 4FHKA 2A5UA 2LVQA 2LD9A 3CMMB 3BINA 2ZPNA 3IHPC 2LXAA 1SGHA 2KLGA 4PS7A 5JH5C 3QIJA 1IPGA 3ZTDA 4W9KA 2DZMA 3LJ3A 3V60A 3PTFC 1NI2A 2BKFA 4HPMB 3QA8A 2NPTA 2KKCA 4LCDE 3ZNGC 2JZZA 2XK5B 3L13A 1WE6A 1WH3A 3PV1A 3VAWA 3HIZA 2AEHA 2DZIA 4RM8A 3R3MA 3RCZA 4I6LB 1WGGA 2L76A 2JT4B 3I3TB 4K7SA 2V4LA 4W9IA 3ENEA 3APCA 1WX8A 2BF8B 1OGWA 2DENB 3R66C 4BKGA 1R4NI 1TBEA 1UZXB 1HE8A 2RPQA 3V6CB 1E90A 4FHJA 3B08A 3QK0A 2DYBA 2KFKB 2DAJA 2IO2B 3PRPB 4EOYA 3TL5A 1IYFA 3TJPA 3U7DA 3QAQA 4ZYNA 4IM2A 3IVFA 1P1AA 1XD3B 1WXMA 2ZPYA 3ZDTA 3T9LA 3APFA 3DBRI 3AULA 2MP2A 2DZKA 4TQ1A 2C7MB 3D32A 4ASWC 4ANUA 3L10B 3R7QA 4GDLA 2PPHA 4E3CA 4F8CB 3PHWB 5HKHA 3WAOA 1WE7A 4A3OA 2M0XA 2KJRA 3M3JA 4IWPA 1CMXB 2NPTB 2PE6B 3PREA 3K9OB 3IFWB 2G4DB 2Z59B 1S1QB 1V5OA 3ALBA 3UINB 4AJWA 2C60A 4GU2A 1RFAA 4ZDVA 2KXJA 1WJUA 4HLEA 2LGXA 3LDZE 3ZNZB 4XC2A 2MBBB 4N9F4 5J17A 2Y5BB 3X0WA 4GGQA 4IWQA 2CKHB 3VFKA 4OVVA 2GMIC 2IZVB 5FR6A 3N3KB 1QZEA 4AP4C 5LXIB 2CR5A 5E6PA 1ISNA 3SHQA 3V61A 3AI5A 3VTVA 3L16A 1G6JA 2D2QA 4K1RB 3M62B 2V1YA 1XQQA 2KOXA 1IP9A 3ZW3A 1S3SG 4WWPA 4KDIC 1UBQA 4W9JA 3A33B 3UF8A 1EF1A 2ZEQA 5DPSA 2MP2B 2WX0A 4MSQB 3PGEA 3RULA 4B9KA 1ZGUB 4URKA 2JZ3B 3APDA 4BOZB 3MHSD 4GXBA 4KDLB 4GB9A 1I35A 1FXTB 1UH6A 3Q3FA 4AJYB 2K6QA 4BOSC 4BKTA 1V2YA 3M63B 2L3ZA 3PS6A 1EF5A 3IG3A 4JIOU 4J6IA 3V62A 1WM2A 4HWIB 2PEAA 1OEYA 3VUWA 4X57B 4GSWA 2DAFA 3T8MA 4AOFA 1P98A 4JLCA 3P2BA 4IWOA 2KJHB 1GC6A 1WRDB 1E8XA 3EECA 1F9JA 3DBHI 2MCNB 1WM3A 4WJNA 3VH4B 2MBHA 2BYFA 4MH0E 1Q0WB 4HXDA 1GJZA 4ICUA 1GG3A 4PYZA 5E6NA 4BBNF 4DHZB 2HJ8A 3AU4A 4KV2A 5IAAC 3NHEB 4EZKA 4EZLA 2UWQA 2C5LC 5CHFA 5AZHA 2NVUI 1WFYA 2KWUB 2BYVE 3ML8A 4MGKE 3VUXA 4E71A 1T0YA 4EEWA 3KYCD 3H7PA 2JF5A 3GOEA 3H9DA 3A9JA 4MGZE 2K6DB 2G45B 4HVBA 5BO4B 1Q5WB 2GBKA 1UD7A 2JVCA 2LXCA 2JRIB 3EC8A 5JHAA 3DVNV 3U30A 2FCSA 2L0FA 5AZFA 2R2OA 1YD8U 4BFRA 2NBVB 2KD0A 5G2NA 4G0NB 5DPTA 2LASA 3RZWC 2N7EA 2KDIA 4NNJB 2JUOA 5CHVC 1AARA 1M94A 2AWTA 1E7VA 2NBUA 1E8ZA 2IO0B 2IY0B 1C3TA 2LZ6A 4FA6A 2BKRB 1VCBA 3OJ4B 3QHTA 1ZKHA 2KTFA 4W9GA 3U8ZA 4CYEA 2M4NA 1L7YA 2PE9A 4WJPA 2JPHA 1E8WA 4LJPB 4XX5A 2KDFB 1GNUA 2NCNA 4M8MA 5DPWA 1KLVA 1D3ZA 2KFJA 2KMCA 3B1LX 2ZVNA 3EFUA 2DHZA 2KNBA 4ICVA 4MELA 2FUHB 4DBGA 2M8SA 4FJZA 1V80A 1V9JA 3C0RB 1WX7A 2MBEA 2MRPA 2AL3A 1TTNA 3SDLC 2IY1B 4TKNA 4EZJA 3ONSA 4WWOA 2EKEC 2IO3B 2MWSB 3W1SA 4ANVA 2XBBC 2ZCCA 5C23A 2EMTA 3JVZX 3KVFB 4PYUA 1J8CA 2ZNVB 3MTNB 4IW0A 1X1MA 3H7PB 4XZ4A 2WX1A 5E6OA 3A9JB 3VTUA 3KUCB 1RRBA 4KZCA 1J0GA 2Z0EB 2XEWA 1WGDA 3H1UA 3H7SA 3DPDA 3DDCB 4P7IA 3RUIB 2D3GA 3ZNHB 3ZO5B 3TIXA 1LQBA 4W9EA 3WANA 3OAWA 2Z0DB 2L8JA 2L00B 2CHZA 1YIWA 5KHQA 2N1WA 3A4RA 2LJ5A 2CU1A 2N9XA 2KC1A 1EO6A 2AL6A 2AYOB 4AUQC 3HHMA 2MBQA 1LXDA 3NZSA 4WJQA 2BYEA 4HK2A 3QC8B 4RMAA 3ML9A 1KOTA 1E7UA 1WF9A 1WZ3A 2RR9A 4NQLB 1NDDA 4M8NA 2KDEB 3HK0A 2BGFA 2EMSA 2O2VA 4NJ6A 4B95A 4NAWA 3PRMB 3HM3A 5AEKB 1H8CA 4TUUA 4ANXA 3PLVA 3L08A 3PSEB 3ZKJC 3PT2B 2NR2A 2LGDA 3CSFA 3PVLA 1V6EA 4II3B 4I6NB 2N1VA 3A4SC 3OJ3A 5D2MB 3ZLZA 3KH0A 3O65B 4GN1A 3A9KA 2IYDB 2M17A 2BPSA 4A3PA 1Z5SB 3DVNU 3N30A 3NOBA 2L0TA 3EHVA 4KIKA 2MQJA 3VH3B 3WA0A 4EFOA 2O6VD 2C9WB 4MGIE 4PS3A 3RT3B 1WMHA 1WJ4A 2ZNVC 2KVRA 3DCGA 3L17A 4EKUA 1VD2A 2J0JA 3QQ8B 4FJVB 1WGHA 2J7QB 3QX1A 4DWFA 1EUVB 1BT0A 3RZFA 2FIFA 1RLFA 3NZUA 4DK5A 2REXA 2ZZPB 2HD5B 2FNJB 4KVGB 2YVCA 4MDKE 2HTHA 2KK8A 3H6NA 4G11A 2FCMA 1SIFA 2O2VB 3NY5A 3ZTCA 1V81A 4W9DA 5KHOA 4NAWB 3L54A 4NPNA 3UQAA 4G50A 4IUMB 4NQKE 1P3QU 2LWPA 2ZJDA 3ECIA 3MJWA 4K81A 1J19A 3AU5A 3CSTA 1R4MI 4GOCA 3ZRFA 5JHBA 2O6VA 3A9KB 2RGFA 2D07B 4E74A 5D94A 4GMVA 1WY8A 3KYDD 1LM8B 3CF6E 4DHJD 3BY4B 3QWZB 4CHKA 2KJ6A 3DVGY 1YX6B 2LVOA 4KIKB 3W1SC 4ZRKA 1KM7A 2MLBA 4W9LA 4DHZE 1WMHB 3UQBA 2WDTB 2WYQA 3PPAA 1V5TA 4F1SA 2YLMA 3DOWA 3S2AA 5GMVA 5CX3A 3VHTC 2MX2A 5J2RA 3W1YA 1ZW7A 5TR5A 1I42A 4CO7A 1LFDA 2QHOA 2KO3A 3KUDB 3TCAA 2K39A 2N9PC 3JSVA 1YX5B 2GBMA 3X23A 1WI0A 2FCNA 4K7UA 4W9CA 4JGHB 4ANWA 4K7WA 3DQVA 4HCNB 4I6PA 1C1YB 3RD2A 5JZEB 3OLMD 4TQ0A 5IA7A 3TBLD 2MBOA 2JY6A 4WAAA 4MJSA 2L7RA 1TZ1A 2PJHA 3WAPA 1UBIA 2O6VB 1SE9A 1XT9B 4KSKC 2NS5A 2C7HA 1WZ0A 2D10A 3JYUA 1WR1A 4FN2A 1GUAB 3ZUNA 1MG8A 2K25A 2LUEA 3VDZA 2CS4A 1L2NA 2B3AA 4ZRJA 2FCQA 4WJOA 4BKSD 2CHXA 1WXVA 2D11A 1GC7A 1OTRB 1WR6E 3QARA 4NJ7A 2LI5A 3UGBB 5LLIA 2BWFA 2NBWB 1JRUA 3ZVVA 4IM3A 3SD5A 3QJZA 1E8YA 4BVUC 3JW0X 2IBIB 2OJRA 2FIDA 2OOBB 4HJKA 3JSVB 1TGZB 1WXAA 3ZNID 3V6EB 2G4SA 4LDTB 5D7GA 1WGYA 2LRWA 4DDGD 5CHWA 2JWZA 1U4AA 2K8BA 3NS8A 1E5WA 2DYOA 4KZ0A 2DYMA 1WJ6A 2KN5A 2KZRA 2BWES 4FLHA 4MJSB 5DPRA 4DHJB 2KLCA 3UIOB 2MSED 3KW5B 1YQBA 4FJYA 2LVPA 4W9HA 1Q1OA 1KJTA 4BKSA 3AXCA 4OVUA 4F7ZA 2JRHA 1V49A 2W9NA 2WWZA 5D6JB 4ZRIA 1PQSA 2K1FA 1WYWB 2KC2A 2G3QB 3RYTA 5C1ZA 2N4FA 1NBFC 5AZGA 1UGMA 2J0MA 1OQYA 3PRZA 1A5RA 2N7DA 4MEMA 5G55A 2FAZA 2KX0A 2KX3A 2RSUA 5EDSA 3PZDA 1Y8RC 3B0AA 4W9FA 3M95A 2KQ7A 2VRRB 1WX9A 4IM0A
chains in the Genus database with same CATH superfamily
2J53A 4RM9A 3R8BA 3BVGA 4GDKA 4L23A 3AB5A 4O1NA 2KANA 3O13A 4JQWC 4XYCA 2KHWB 2LHDA 3VXWA 3W9CB 1D5MC 2MW5A 2WXRA 3DBLI 3DHIC 1L6VA 1I4QA 5BYRA 3VQIA 1KTKA 1DOXA 4XDCA 5E6JA 2M0AA 1KLGD 4YTNB 5L83A 2ZCBA 4EUTA 1V86A 2NMQA 2K9XA 1SJHD 2DNFA 2L83A 3IAS1 1YN3A 1P9DU 4GIVA 4KSLC 4II2B 3VUYA 4FULA 4QAYA 1SSNA 2KWCA 3QCAA 3WALA 5BMIA 3KUZA 3GZNI 2K8CA 2CHWA 3L0WB 4BBNC 5LXHA 2K8HA 3ZQ4A 1PGXA 3IHPC 2D5GA 1IPGA 2DZMA 1NI2A 3EGRA 4HPMB 3QA8A 1VRAB 1NI3A 1WH3A 3I3TB 3N1YC 4P16A 4K7SA 2X8XX 1WX8A 1OGWA 4BKGA 1UZXB 3B08A 1HEZE 4IM2A 3IVFA 1PUTA 2KQ4X 3ZDTA 4LNOA 3AULA 2QDFA 1J7AA 1FNUA 2KVZA 3W2DA 3WAOA 2M0XA 1FXIA 5D3IB 1NENB 1F1HA 2Z59B 2IGDA 4HROA 4GU2A 1RFAA 3SR6A 3LDZE 1L0VB 2PVGC 3X0WA 4TMAB 5FR6A 2V3NA 1GPXA 2D2QA 4K1RB 1IP9A 1I4PA 3A33B 3UF8A 5DPSA 4DXFA 1F2RC 3RPFC 4KX6B 4C7ZA 3DHGC 1FXTB 1UH6A 1DOYA 3VR9B 2K6QA 4BKTA 1V2YA 1C4PA 3M63B 4JIOU 4C00A 5H92C 1FCLA 2KJHB 1F9JA 3DBHI 3VH4B 3AV8A 1Q0WB 4ICUA 4YSYB 1ZE3D 1P7FA 4WQMA 3RNAC 4WAFA 5CHFA 3AE9B 4MGKE 3RNFC 2JF5A 3GOEA 1XEEA 4HVBA 2GBKA 2JVCA 4OVZA 3GP7A 2R2OA 4BFRA 4YXDB 1FM0D 4G0NB 2LASA 4NNJB 2JUOA 3P4SB 5HG2A 1VCBA 4CYEA 2LUMA 2M4NA 1L7YA 2PE9A 1C9FA 1GNUA 1QF6A 2IGHA 3AM9A 5DPWA 1D3ZA 3B1LX 4KGTA 2DHZA 4ICVA 4MELA 2FUHB 1HZ6A 5JXVA 4FJZA 4KGRA 3SDLC 4TKNA 4EZJA 2WGSA 4M02A 2IO3B 3W1SA 2ZCCA 1K50A 3JVZX 5E6OA 1X1MA 3H7PB 3A9JB 3KUCB 1RRBA 5HI1A 1C78A 2Y5PA 4HPPA 3H7SA 2D3GA 1V97A 3AE6B 3OAWA 2CHZA 2B76B 2LMCA 3HRDD 1XCTL 2MBQA 4RGOS 3ML9A 2RR9A 2JU6X 4YSXB 2EMSA 2O2VA 3Q8FA 5BMHA 2V0GA 2WDQB 1KLUD 2VZKB 4TUUA 1C4AA 4ANXA 3PLVA 4KKIA 3PVLA 1STEA 4L1BA 1XLNA 3EFCA 3NVYA 2PLPA 1ZXHA 2WXQA 2L0TA 1VZ6A 4ZRPA 3VH3B 1WMHA 1WJ4A 3L17A 2J0JA 1WGHA 5D3DA 2N9LA 2J7QB 1BT0A 3RZFA 3AN1A 2REXA 3IXSA 2FNJB 4HRSA 1V8CA 4ZHOA 1HQRD 1R7SA 3L4PA 1F2RI 4ZRQA 3TEWA 1SIFA 4W9DA 2L32A 4NAWB 4G50A 3ECIA 2LWPA 1ZP0B 2AX5A 4M00A 3CSTA 2LGSA 4DHJD 1PGAA 3DVGY 2LVOA 1T6BX 4W9LA 4US9A 2BT6A 2WU5B 3DOWA 3U4EG 1TZOA 3S2AA 5J2RA 3W1YA 3LB8C 1I42A 1JWMD 1LFDA 2EKIA 2QSDA 3KUDB 2RDBC 1SIJA 1C79A 2FCNA 3ZXVA 4K7WA 3Q3MC 1L5PA 5JZEB 1C1YB 3RD2A 1CZPA 2MBOA 2JY6A 1JWBD 2L7RA 1XLQA 3RI7C 4N59A 1MFWA 3ZUNA 1WR1A 3VDZA 4KGSA 2ZW1A 3AEBB 1XO3A 4WJOA 4NJ7A 3QARA 4R3DA 2LI5A 3P4RB 1KF6B 2BWFA 2NBWB 3ZVVA 2W3RA 3Q8BA 3QJZA 1E8YA 2INNE 2KACA 4ITKA 2OJRA 2FIDA 3JSVB 1TGZB 2RDHA 3V6EB 5D7GA 4WIPA 2LRWA 4DDGD 2K8BA 3NS8A 4KZ0A 3AH7A 1D5XC 4FLHA 3B2FA 3ZJUA 2KLCA 3UIOB 1GB1A 4W9HA 1KJTA 4M0WA 4PT5A 4ZRIA 4JPSA 2K1FA 3KWVA 5C1ZA 5AZGA 1OQYA 4RFBA 1AYFA 1MJDA 2N7DA 4MEMA 2JX5A 1IBXB 2KX0A 4JE3B 1MHXA 2QIEB 2H89B 3U7ZA 3M95A 2KQ7A 1TTNA 4IM0A 3MC0B 1I4RA 2GOWA 2WDVB 1D5ZC 1B9RA 2KTRA 2ONQA 4S0RA 2LRUA 1L4ZB 4IG7B 5DCNA 1YQ3B 3P4QB 5G5HA 2M19A 4EE2A 1EU3A 1YJ1A 3AE2B 4LDTD 3WIMA 5J18A 2GBNA 1H4RA 4HDQA 2GBRA 1Z2MA 2I1KA 2KQSA 3N1ZC 3TMPB 1WSPA 2WXPA 2I1JA 5T8IA 2YEPF 4IDIA 1ESFA 1JWSD 1MVKA 4MM3A 4PK1A 1NYRA 3DHHC 2WXIA 4FBJB 4DXAB 1YJJA 2DBYA 2R2QA 3Q3OC 1NYQA 2L05A 3DVGX 1B1ZA 2R61A 1RAXA 4GDKB 4G3XB 1TY0A 2UYZB 3Q3JA 3VR8B 2BS4B 1TS5A 1WXSA 2A4ZA 4A20A 3NVVA 2ASQA 1QQRA 2DX5B 3VTWA 4GLSC 4MT5A 1Y56A 2KT7A 2LXAA 1SGHA 3QIJA 3SFDB 3V60A 3HVZA 2BKFA 2NPTA 3ZNGC 2JZZA 3SFEB 1DYQA 4RM8A 3R3MA 3RCZA 2WXFA 1IBXA 3TEZA 2V4LA 4W9IA 3ENEA 1R4NI 1HE8A 2RPQA 3V6CB 1E90A 4FHJA 5EE9A 3QK0A 2DYBA 4EOYA 4WURA 3TL5A 3TJPA 1EM7A 3RFZB 1P1AA 1ZDVA 3DBRI 4TQ1A 5EE0A 2C7MB 3D32A 1R4MB 4E3CA 2PPHA 3KQ4A 4CQNA 3NVZA 4YSZB 1QLBB 3M3JA 2PE6B 1N62A 3K9OB 3IFWB 1S1QB 3RNEC 4AJWA 2RMMA 4ZDVA 1Q10A 2KXJA 1HTQA 1E6EB 2LGXA 3ZNZB 3PO0A 4XC2A 4N9F4 2Y5BB 2CKHB 3VFKA 2QILA 3N3KB 5LXIB 5E6PA 1ISNA 3AEAB 3V61A 3AI5A 3L16A 3N20C 1FXAA 2JYEA 2KOXA 3P4PB 2WXLA 2J52A 1S3SG 3KLSX 4W9JA 2WXHA 2ZEQA 1VZ8A 3B9JA 4MSQB 3BIID 4URKA 4KDLB 1N63A 4GB9A 1I35A 4K3CA 2CJOA 2VH1A 1QT9A 2L3ZA 3V62A 1WM2A 4HWIB 3LYYA 1OEYA 4GSWA 3P2BA 4IWOA 1TY2A 2Y3AA 2AQ2B 3EECA 2WP9B 3I63C 1WM3A 4MH8A 2LFIA 2BVCA 1BUIC 3ZJVA 2MBHA 2BYFA 4MH0E 1GJZA 2GI9A 4NJCA 4EZKA 5AZHA 3VRAB 1WFYA 2KWUB 2WDRB 2BYVE 4EEWA 1FMAD 3ZYYX 3Q8AA 1AN8A 4MGZE 2K6DB 5BO4B 1UD7A 3EC8A 2JRIB 3U30A 2FCSA 1OQQA 5AZFA 2NBVB 3DWMA 3P1MA 2KD0A 4OZAA 5DPTA 3RZWC 3NZ3A 2KDIA 5IP4D 2AWTA 1E7VA 2NBUA 2IO0B 2OHFA 4FA6A 1ZKHA 2KTFA 3OG5A 3U8ZA 4WJPA 1GOZA 4LJPB 4XX5A 4M8MA 1V1PA 2NTTA 4A90A 4YWGG 1JWUD 3C0RB 2AL3A 2EKEC 2RDGA 1ET9A 2XBBC 3IAM1 1GAQB 4XZ4A 2Q5WD 2XN9C 3NS1A 1J0GA 1YNTE 2Z0EB 3DPDA 4P7IA 1QKZA 1CQVA 3RUIB 3ZNHB 4XGAB 4OZBA 2K5PA 4W9EA 3WANA 1XF5L 2L00B 1YIWA 5EE3A 2CU1A 2AYOB 4WWMA 4HK2A 1KOTA 4IOIE 1J7BA 1BMLC 2J4XA 2KDEB 2PMVA 4M8NA 2BGFA 3BYTB 4NJ6A 4YTPB 3L08A 1N6ZA 2LGDA 3CSFA 4I6NB 2N1VA 3KH0A 3ABVB 1LO5D 1T3QA 5TSSA 1Z5SB 2YEPB 2K0PA 4Q2JA 3EHVA 4KIKA 2MQJA 2O6VD 2C9WB 3GS2A 4MGIE 4PS3A 3RT3B 4EKUA 2DWQA 2KVRA 1EUVB 3TUOA 2FIFA 1RLFA 3NZUA 2AQ3B 3E56A 2YVCA 2HTHA 4G11A 2BYTA 2O2VB 2JYTA 1EU4A 4NPNA 1T0QC 2W54A 4DXGA 4IUMB 1P3QU 3MJWA 5C2TB 4NAMA 4XWWA 3AEGB 1J7CA 1SEBD 2MJEA 2RGFA 2D07B 1WY8A 1CK1A 1LM8B 3QWZB 4CHKA 2WNMA 1YX6B 3RN9C 3AE4B 1WMHB 3UQBA 4JX1C 3PPAA 2YLMA 4MACA 2KWDA 3J9CA 3FILA 2WXGA 5GMVA 3VHTC 1ZW7A 1PFDA 1YX5B 3X23A 1UWXA 1PGBA 4LNFA 4I6PA 3FC4A 5IA7A 3TBLD 3GE8C 1TZ1A 2PJHA 3WAPA 1UBIA 1SE9A 1XT9B 3P63A 2HTME 1WZ0A 5IOIA 2WXJA 1GUAB 2LUEA 2CS4A 1L2NA 2B3AA 2N9KA 4BKSD 2D11A 1OTRB 1WR6E 5LLIA 1EWYC 3BVZA 1JRUA 2MHJA 5G5GA 1L4DB 3HUIA 2G4SA 4LDTB 1F52A 1MI0A 2KN5A 1FO4A 1TJEA 1YOVB 4C56C 3I5JC 3AXCA 4OVUA 2KDMA 4F7ZA 2JRHA 2W9NA 4N58A 3Q8CA 1WYWB 2G3QB 2PVOD 1NBFC 5EE1A 3MC8A 2E6XA 1WWTA 2FAZA 3Q2AC 2KX3A 2RSUA 2BS2B 3NG0A 1Y8RC 4FXCA 3SU8X 2I2YA 2IO1B 1FNWA 2W82A 1WIAA 2MH7A 3R7RA 4TV3A 3DBSA 3UIPB 4DDID 1HZ5A 3A1QA 4FADA 2MA9B 4REZA 3PHXB 4AWJA 2J0KA 4GDLB 4M0WB 1L6UA 1WRIA 4WQOB 2PIAA 5CTRC 1E9MA 2PTLA 2JXXA 1HTOA 4N6EB 2M1MA 3VVWB 1YJIA 4WWNA 3ZJTA 4YL8A 2LGIA 2XK5A 2GBJA 1N5WA 4NY0A 4LTUA 5C3JB 3ZIMA 1UELA 3ZRCA 2BW2A 2KWVB 5L95C 1WJNA 2KFKA 4RGMA 3N32A 2KTRB 3I57A 1K8RB 4HCPB 3IBEA 4FHKA 3BVMA 1TKGA 4XE0A 3BINA 1UGJA 4PS7A 4YT0B 3ZTDA 4W9KA 1ZDXA 3PTFC 1FRRA 1UF0A 2QEJC 3BK1A 4LCDE 4MM3B 3L13A 1K51A 3HIZA 2AEHA 2DZIA 4I6LB 2L76A 3ZGZA 2QCZA 2VH2A 4HKQA 4BZAA 2BF8B 5BYSA 2DENB 3R66C 3AE1B 2JWUA 2MJ3A 1RFKA 5HFYA 3ETRA 1E10A 2BB6A 3NVWA 1IYFA 3U7DA 3WCQA 4RH6A 2IGGA 2ZPYA 3APFA 2MP2A 2DZKA 1K52A 4ANUA 1FD6A 3L10B 3R7QA 4GDLA 5HKHA 1WE7A 4A3OA 2KJRA 4IWPA 1CMXB 2NPTB 3PREA 2G4DB 1LGRA 4D2KA 2QJLA 1V5OA 4P1CC 3UINB 4JWUC 3OWEB 1D6EC 1SE4A 2MBBB 4C7YA 1SJED 2GMIC 4ARCA 5BMGA 4AP4C 2CR5A 3SHQA 1SE3A 3M62B 2V1YA 2GRIA 4KDIC 1UBQA 1JMLA 1QOBA 2WX0A 4JWSC 3RULA 4B9KA 1ZGUB 3RMKC 3TSSA 3T3OA 2N0SB 4BOZB 1SBBB 1SXTA 4AJYB 2ON8A 3R2IA 2WXOA 1EWCA 3PS6A 3IG3A 4J6IA 2PEAA 3VUWA 3LXFA 4X57B 3T8MA 4RF1A 1P98A 1GC6A 1WRDB 2HJ1A 3HVDA 2CJNA 4WJNA 3MJ5A 2IPKD 5FKAC 4L2YA 4HXDA 4PYZA 4BBNF 4KV2A 5IAAC 1N5XA 2NVUI 3AEFB 3T3NA 1TIFA 3ML8A 3VUXA 2WLBA 1T0YA 3URYA 2VZKD 2G45B 1Q5WB 2LXCA 3Q3NC 4ARIA 5G2NA 2N7EA 3U52E 4K3BA 4W9GA 2UU7A 1E8WA 3BZDB 2KDFB 2NCNA 1P7EA 2KMCA 1FNVA 2KNBA 1UUPA 2M8SA 1V9JA 3W5UB 2MRPA 3ONSA 4WWOA 4P6VF 4ANVA 4PYUA 2ZNVB 3MTNB 4IW0A 3VTUA 2WX1A 1DGJA 3BWUD 2SEBD 4KZCA 1N60A 2XEWA 1WGDA 3DBLB 3DDCB 3TIXA 1LQBA 3MC9A 2Z0DB 2L8JA 2EELA 2WXKA 2N1WA 3ZXRA 2N9XA 1EO6A 2AL6A 4BAXA 1T5XD 4AUQC 3NZSA 1LXDA 4WJQA 2BYEA 4RMAA 1WF9A 4NQLB 3HK0A 1V1PB 4B95A 2KYWA 3HM3A 4S17A 2L1AA 5AEKB 2INPE 5AUKA 1IGCA 3PSEB 3ZKJC 3PT2B 2NR2A 1QOFA 1FIQA 3OJ3A 2H88B 1E7PB 3CWIA 4GN1A 4XWTA 3A9KA 3GZNB 4A3PA 3BK2A 1JALA 3DVNU 2KN4A 1ACCA 4DQOC 4EFOA 1SF0A 2QMTA 3DCGA 1VD2A 2FUG1 4FJVB 2KAJA 3QX1A 4DWFA 1KFYB 4HJGE 4DK5A 2IJ0A 4J3OD 2ZZPB 3AECB 4RGTA 2KK8A 2WXNA 1L0YB 2V9HA 2FCMA 3NY5A 1V81A 4OZCA 3L54A 3UQAA 4OHJA 3Q6BA 1ENFA 4K81A 3AU5A 1FFVA 1R4MI 1F77A 4GOCA 1VZ7A 2O6VA 4E74A 5D94A 3CIRB 3BY4B 4KIKB 3AE8B 3W1SC 4ZRKA 1KM7A 2MLBA 1DOIA 2WDTB 1T0RC 2WYQA 2XNAC 1KH0A 4LNIA 2AQ1B 2LEKA 5TR5A 4CO7A 3TCAA 3I9V1 2N9PC 1WI0A 5I4DA 2MJDA 4W9CA 2L52A 3AEDB 2DLBA 2K3UA 3OLMD 3NUHB 4WAAA 4MJSA 5BYQA 5MPOA 2N7JA 1I4XA 2NS5A 2BQQA 4FN2A 2I38A 1I4GA 1MG8A 3Q14C 4A55A 2CHXA 1WXVA 1TKEA 3AEEB 3FAHA 3UGBB 3IT4B 1IUEA 3FILB 1L0XB 2WU2B 1XLOA 4LLGM 4LK0M 4HJKA 2WQYB 1WGYA 2KMMA 5CHWA 2JWZA 2PW9A 1E5WA 2JQRB 4RCOA 1WJ6A 2BWES 3DBHB 3V3XA 4DHJB 1YN5A 2MSED 1GB4A 1FEHA 2K22A 3U2SC 4BKSA 3B2GA 2PKOA 1V49A 2WWZA 3RYTA 4ZYSA 2KC2A 1JROA 3H8HA 4NZLB 4H2AA 1WXQA 2J0MA 3PRZA 2G9HD 3TEXA 1JQ4A 3PZ7A 3C8YA 3PZDA 1C4CA 3MP9A 1QILA 2VRRB 1WX9A 1OFFA 4MGYE 1YMHE 4LJOB 1WGRA 2RD0A 2INCC 2KMAA 1FFUA 3WAMA 5LNK1 3W5VB 4AQ7A 1OEYJ 4PS8A 4IC7B 2LGYA 2V3SA 1XCQL 4JL9A 1BXTA 2D3BA 1ZPSA 4MSMB 1CJEA 3HM6X 3ZDMC 1P0RA 2ICIA 2KDBA 2ZVOA 3PLUA 4ZHPA 1TS3A 4A9AA 4HDOA 2N9EB 3A1QB 2DZJA 1ET6A 4B6WA 3K9PB 2HE7A 5IN7A 4HPLB 4KKJA 2C7NB 2A5UA 2LVQA 2LD9A 3CMMB 3TEYA 1WYGA 1QOGA 2ZPNA 3PZ8A 2KLGA 5JH5C 3N9YC 4C4VB 2LHEA 3LJ3A 3MHZA 1E0ZA 1XLPA 2KKCA 1VJKA 2XK5B 1WE6A 3PV1A 3VAWA 4RF0A 1WGGA 2JT4B 2GB1A 2WS3B 2BBCA 3APCA 4RGNA 1ROEA 1TBEA 2GLSA 2KFKB 2DAJA 2J42A 2IO2B 3PRPB 1F0ZA 4HEA1 3QAQA 4ZYNA 1XD3B 4LNNA 1WXMA 3T9LA 1ZUD2 1MHHE 4WH4A 4ASWC 5FR3A 4F8CB 3PHWB 4US8A 2Y5CA 3N1XC 2JZPA 4OW0A 1IGDA 4ACFA 3ALBA 2C60A 4AS1A 1WJUA 4HLEA 2OEDA 5FK9C 3VRBB 5J17A 4GGQA 4IWQA 4OVVA 1UNSA 4TSSA 2IZVB 4A8XC 1D4BA 2MEKA 1QZEA 3AMZA 1HXYD 3VTVA 1G6JA 1XQQA 3ZW3A 4WWPA 1EF1A 3C19A 1I4HA 2MP2B 3PGEA 2JZ3B 3APDA 3MHSD 4GXBA 3Q3FA 1MG4A 4BOSC 4USAA 4C4VA 1EF5A 1I7HA 4AOFA 1XXGA 2DAFA 4JLCA 1E8XA 2RPVA 2MCNB 2ZW0A 1GG3A 1VR9A 5E6NA 4DHZB 3AE5B 2HJ8A 3AU4A 3NHEB 4EZLA 1V1OA 2UWQA 2C5LC 4E71A 1OQRA 3KYCD 3H7PA 3H9DA 3A9JA 3AE3B 5JHAA 3DVNV 2L0FA 1YD8U 2Z8LA 3EA6A 3FKYA 5CHVC 1AARA 1M94A 2BTEA 1E8ZA 2IY0B 3RNGC 1C3TA 2LZ6A 2BKRB 3OJ4B 3QHTA 5AUIA 2JPHA 3BYYB 3DWGC 1KLVA 3NJTA 2KFJA 2INDC 2ZVNA 3EFUA 4DBGA 1RYJA 4A6QA 1V80A 2D3AA 1WX7A 2MBEA 1JWAD 2IY1B 2W3SA 1NEKB 2MWSB 2JSVX 5C23A 2EMTA 3KVFB 1TYGB 1JW9D 5KHQA 1J8CA 2FE8A 2X38A 1KRHA 3H1UA 1VDVA 4IKGA 1A70A 3ZO5B 4B0MA 2IDYA 3A4RA 2LJ5A 2KC1A 2CU3A 3HHMA 5IO9A 4P1BC 4LNKA 3QC8B 1E7UA 1WZ3A 3RNCC 1NDDA 1TS2A 3GE3C 4NAWA 3PRMB 2E3TA 1SE2A 1K53A 1N61A 1H8CA 5IKCM 4HKZE 1VLBA 1V6EA 4II3B 3A4SC 3ZLZA 5D2MB 1FCCC 3O65B 2IYDB 2M17A 2BPSA 2D3CA 3N30A 3NOBA 3UI3A 3E9SA 2NTSA 3WA0A 2M56B 2ZNVC 3QQ8B 3GB1A 3RNBC 2HD5B 4B0EA 2QC8A 4KVGB 1YN4A 4MDKE 3H6NA 1TT5B 3AE7B 1AW7A 3ZTCA 5KHOA 2G1EA 2SAKA 1PDXA 4NQKE 1HA5A 2ZJDA 1J19A 2V4IB 1R4NB 3ZRFA 5JHBA 4ZOHC 1JCKB 3A9KB 1YQ4B 4GMVA 3KYDD 3IT6B 3CF6E 2KJ6A 3P42A 1ZOYB 3DBRB 3Q69A 4DHZE 1V5TA 2WXMA 4F1SA 5GXGB 2JXTA 3V05A 5CX3A 2MX2A 2QHOA 2HDEA 2KO3A 2K39A 3JSVA 1FRDA 1NVID 2GBMA 4K7UA 3MFGA 4JGHB 1AWDA 4ANWA 4C80A 3DQVA 4HCNB 2FBWB 4TQ0A 2BS3B 1RWSA 2O6VB 4KSKC 2C7HA 2D10A 3JYUA 2K25A 1TS4A 1RM6C 4XDDA 2V3PA 4ZRJA 1ZXIA 3NRZA 1UWMA 2FCQA 1PYWD 1GC7A 1C76A 4M01A 1FPYA 4IM3A 3SD5A 4BVUC 3JW0X 2IBIB 1WGKA 2OOBB 2W55A 1T0SC 2TSSA 1WXAA 4UDUC 3ZNID 3Q8EA 4RNAA 3EUB2 2WHIA 1U4AA 2DYOA 2DYMA 2KZRA 4MJSB 5DPRA 2BB5A 3KW5B 1YQBA 4FJYA 2LVPA 4YTMB 1Q1OA 1C77A 1QOAA 3SEBA 1JRPA 5D6JB 1PQSA 1MPEA 2ACZB 2N4FA 1UGMA 5H8YE 1A5RA 2OJWA 1TKYA 5HHDG 5G55A 2LJIA 1M4VA 5EDSA 3R2TA 3B0AA 1SB3C 4W9FA 3KWLA
chains in the Genus database with same CATH topology
4RM9A 2IO1B 1WIAA 4GDKA 4MGYE 3R7RA 4LJOB 2GOWA 2KANA 3DBSA 1WGRA 4TV3A 3UIPB 4DDID 2RD0A 3A1QA 4JQWC 2KMAA 2KHWB 4FADA 3VXWA 2MA9B 3WAMA 2KTRA 3PHXB 2LRUA 4AWJA 2J0KA 2MW5A 4IG7B 3DBLI 1OEYJ 4GDLB 5DCNA 4M0WB 4PS8A 3VQIA 4WQOB 3SU8X 1YJ1A 4IC7B 4LDTD 3WIMA 5J18A 5CTRC 2LGYA 2V3SA 2GBNA 2JXXA 1H4RA 4JL9A 4HDQA 2GBRA 1Z2MA 2I1KA 2KQSA 2M1MA 3TMPB 3VVWB 5L83A 2I1JA 4WWNA 2ZCBA 4YL8A 4EUTA 1V86A 4MSMB 4MM3A 2XK5A 3HM6X 2GBJA 4FBJB 4DXAB 4NY0A 3ZDMC 1P0RA 2KDBA 3ZIMA 2ZVOA 2R2QA 3PLUA 2L05A 1P9DU 4GIVA 3DVGX 4KSLC 4II2B 3VUYA 1RAXA 4HDOA 4GDKB 1UELA 4G3XB 4FULA 3ZRCA 2KWVB 2KWCA 2UYZB 2N9EB 3Q3JA 3QCAA 3WALA 5L95C 3A1QB 3KUZA 2DZJA 1WJNA 3GZNI 2K8CA 2KFKA 2CHWA 3L0WB 3N32A 4BBNC 2KTRB 5LXHA 4B6WA 1K8RB 2K8HA 1WXSA 2A4ZA 4A20A 2ASQA 3K9PB 2DX5B 2HE7A 4HCPB 3VTWA 4HPLB 3IBEA 2C7NB 4FHKA 2A5UA 2LVQA 2LD9A 3CMMB 3BINA 2ZPNA 3IHPC 2LXAA 1SGHA 2KLGA 4PS7A 5JH5C 3QIJA 1IPGA 3ZTDA 4W9KA 2DZMA 3LJ3A 3V60A 3PTFC 1NI2A 2BKFA 4HPMB 3QA8A 2NPTA 2KKCA 4LCDE 3ZNGC 2JZZA 2XK5B 3L13A 1WE6A 1WH3A 3PV1A 3VAWA 3HIZA 2AEHA 2DZIA 4RM8A 3R3MA 3RCZA 4I6LB 1WGGA 2L76A 2JT4B 3I3TB 4K7SA 2V4LA 4W9IA 3ENEA 3APCA 1WX8A 2BF8B 1OGWA 2DENB 3R66C 4BKGA 1R4NI 1TBEA 1UZXB 1HE8A 2RPQA 3V6CB 1E90A 4FHJA 3B08A 3QK0A 2DYBA 2KFKB 2DAJA 2IO2B 3PRPB 4EOYA 3TL5A 1IYFA 3TJPA 3U7DA 3QAQA 4ZYNA 4IM2A 3IVFA 1P1AA 1XD3B 1WXMA 2ZPYA 3ZDTA 3T9LA 3APFA 3DBRI 3AULA 2MP2A 2DZKA 4TQ1A 2C7MB 3D32A 4ASWC 4ANUA 3L10B 3R7QA 4GDLA 2PPHA 4E3CA 4F8CB 3PHWB 5HKHA 3WAOA 1WE7A 4A3OA 2M0XA 2KJRA 3M3JA 4IWPA 1CMXB 2NPTB 2PE6B 3PREA 3K9OB 3IFWB 2G4DB 2Z59B 1S1QB 1V5OA 3ALBA 3UINB 4AJWA 2C60A 4GU2A 1RFAA 4ZDVA 2KXJA 1WJUA 4HLEA 2LGXA 3LDZE 3ZNZB 4XC2A 2MBBB 4N9F4 5J17A 2Y5BB 3X0WA 4GGQA 4IWQA 2CKHB 3VFKA 4OVVA 2GMIC 2IZVB 5FR6A 3N3KB 1QZEA 4AP4C 5LXIB 2CR5A 5E6PA 1ISNA 3SHQA 3V61A 3AI5A 3VTVA 3L16A 1G6JA 2D2QA 4K1RB 3M62B 2V1YA 1XQQA 2KOXA 1IP9A 3ZW3A 1S3SG 4WWPA 4KDIC 1UBQA 4W9JA 3A33B 3UF8A 1EF1A 2ZEQA 5DPSA 2MP2B 2WX0A 4MSQB 3PGEA 3RULA 4B9KA 1ZGUB 4URKA 2JZ3B 3APDA 4BOZB 3MHSD 4GXBA 4KDLB 4GB9A 1I35A 1FXTB 1UH6A 3Q3FA 4AJYB 2K6QA 4BOSC 4BKTA 1V2YA 3M63B 2L3ZA 3PS6A 1EF5A 3IG3A 4JIOU 4J6IA 3V62A 1WM2A 4HWIB 2PEAA 1OEYA 3VUWA 4X57B 4GSWA 2DAFA 3T8MA 4AOFA 1P98A 4JLCA 3P2BA 4IWOA 2KJHB 1GC6A 1WRDB 1E8XA 3EECA 1F9JA 3DBHI 2MCNB 1WM3A 4WJNA 3VH4B 2MBHA 2BYFA 4MH0E 1Q0WB 4HXDA 1GJZA 4ICUA 1GG3A 4PYZA 5E6NA 4BBNF 4DHZB 2HJ8A 3AU4A 4KV2A 5IAAC 3NHEB 4EZKA 4EZLA 2UWQA 2C5LC 5CHFA 5AZHA 2NVUI 1WFYA 2KWUB 2BYVE 3ML8A 4MGKE 3VUXA 4E71A 1T0YA 4EEWA 3KYCD 3H7PA 2JF5A 3GOEA 3H9DA 3A9JA 4MGZE 2K6DB 2G45B 4HVBA 5BO4B 1Q5WB 2GBKA 1UD7A 2JVCA 2LXCA 2JRIB 3EC8A 5JHAA 3DVNV 3U30A 2FCSA 2L0FA 5AZFA 2R2OA 1YD8U 4BFRA 2NBVB 2KD0A 5G2NA 4G0NB 5DPTA 2LASA 3RZWC 2N7EA 2KDIA 4NNJB 2JUOA 5CHVC 1AARA 1M94A 2AWTA 1E7VA 2NBUA 1E8ZA 2IO0B 2IY0B 1C3TA 2LZ6A 4FA6A 2BKRB 1VCBA 3OJ4B 3QHTA 1ZKHA 2KTFA 4W9GA 3U8ZA 4CYEA 2M4NA 1L7YA 2PE9A 4WJPA 2JPHA 1E8WA 4LJPB 4XX5A 2KDFB 1GNUA 2NCNA 4M8MA 5DPWA 1KLVA 1D3ZA 2KFJA 2KMCA 3B1LX 2ZVNA 3EFUA 2DHZA 2KNBA 4ICVA 4MELA 2FUHB 4DBGA 2M8SA 4FJZA 1V80A 1V9JA 3C0RB 1WX7A 2MBEA 2MRPA 2AL3A 1TTNA 3SDLC 2IY1B 4TKNA 4EZJA 3ONSA 4WWOA 2EKEC 2IO3B 2MWSB 3W1SA 4ANVA 2XBBC 2ZCCA 5C23A 2EMTA 3JVZX 3KVFB 4PYUA 1J8CA 2ZNVB 3MTNB 4IW0A 1X1MA 3H7PB 4XZ4A 2WX1A 5E6OA 3A9JB 3VTUA 3KUCB 1RRBA 4KZCA 1J0GA 2Z0EB 2XEWA 1WGDA 3H1UA 3H7SA 3DPDA 3DDCB 4P7IA 3RUIB 2D3GA 3ZNHB 3ZO5B 3TIXA 1LQBA 4W9EA 3WANA 3OAWA 2Z0DB 2L8JA 2L00B 2CHZA 1YIWA 5KHQA 2N1WA 3A4RA 2LJ5A 2CU1A 2N9XA 2KC1A 1EO6A 2AL6A 2AYOB 4AUQC 3HHMA 2MBQA 1LXDA 3NZSA 4WJQA 2BYEA 4HK2A 3QC8B 4RMAA 3ML9A 1KOTA 1E7UA 1WF9A 1WZ3A 2RR9A 4NQLB 1NDDA 4M8NA 2KDEB 3HK0A 2BGFA 2EMSA 2O2VA 4NJ6A 4B95A 4NAWA 3PRMB 3HM3A 5AEKB 1H8CA 4TUUA 4ANXA 3PLVA 3L08A 3PSEB 3ZKJC 3PT2B 2NR2A 2LGDA 3CSFA 3PVLA 1V6EA 4II3B 4I6NB 2N1VA 3A4SC 3OJ3A 5D2MB 3ZLZA 3KH0A 3O65B 4GN1A 3A9KA 2IYDB 2M17A 2BPSA 4A3PA 1Z5SB 3DVNU 3N30A 3NOBA 2L0TA 3EHVA 4KIKA 2MQJA 3VH3B 3WA0A 4EFOA 2O6VD 2C9WB 4MGIE 4PS3A 3RT3B 1WMHA 1WJ4A 2ZNVC 2KVRA 3DCGA 3L17A 4EKUA 1VD2A 2J0JA 3QQ8B 4FJVB 1WGHA 2J7QB 3QX1A 4DWFA 1EUVB 1BT0A 3RZFA 2FIFA 1RLFA 3NZUA 4DK5A 2REXA 2ZZPB 2HD5B 2FNJB 4KVGB 2YVCA 4MDKE 2HTHA 2KK8A 3H6NA 4G11A 2FCMA 1SIFA 2O2VB 3NY5A 3ZTCA 1V81A 4W9DA 5KHOA 4NAWB 3L54A 4NPNA 3UQAA 4G50A 4IUMB 4NQKE 1P3QU 2LWPA 2ZJDA 3ECIA 3MJWA 4K81A 1J19A 3AU5A 3CSTA 1R4MI 4GOCA 3ZRFA 5JHBA 2O6VA 3A9KB 2RGFA 2D07B 4E74A 5D94A 4GMVA 1WY8A 3KYDD 1LM8B 3CF6E 4DHJD 3BY4B 3QWZB 4CHKA 2KJ6A 3DVGY 1YX6B 2LVOA 4KIKB 3W1SC 4ZRKA 1KM7A 2MLBA 4W9LA 4DHZE 1WMHB 3UQBA 2WDTB 2WYQA 3PPAA 1V5TA 4F1SA 2YLMA 3DOWA 3S2AA 5GMVA 5CX3A 3VHTC 2MX2A 5J2RA 3W1YA 1ZW7A 5TR5A 1I42A 4CO7A 1LFDA 2QHOA 2KO3A 3KUDB 3TCAA 2K39A 2N9PC 3JSVA 1YX5B 2GBMA 3X23A 1WI0A 2FCNA 4K7UA 4W9CA 4JGHB 4ANWA 4K7WA 3DQVA 4HCNB 4I6PA 1C1YB 3RD2A 5JZEB 3OLMD 4TQ0A 5IA7A 3TBLD 2MBOA 2JY6A 4WAAA 4MJSA 2L7RA 1TZ1A 2PJHA 3WAPA 1UBIA 2O6VB 1SE9A 1XT9B 4KSKC 2NS5A 2C7HA 1WZ0A 2D10A 3JYUA 1WR1A 4FN2A 1GUAB 3ZUNA 1MG8A 2K25A 2LUEA 3VDZA 2CS4A 1L2NA 2B3AA 4ZRJA 2FCQA 4WJOA 4BKSD 2CHXA 1WXVA 2D11A 1GC7A 1OTRB 1WR6E 3QARA 4NJ7A 2LI5A 3UGBB 5LLIA 2BWFA 2NBWB 1JRUA 3ZVVA 4IM3A 3SD5A 3QJZA 1E8YA 4BVUC 3JW0X 2IBIB 2OJRA 2FIDA 2OOBB 4HJKA 3JSVB 1TGZB 1WXAA 3ZNID 3V6EB 2G4SA 4LDTB 5D7GA 1WGYA 2LRWA 4DDGD 5CHWA 2JWZA 1U4AA 2K8BA 3NS8A 1E5WA 2DYOA 4KZ0A 2DYMA 1WJ6A 2KN5A 2KZRA 2BWES 4FLHA 4MJSB 5DPRA 4DHJB 2KLCA 3UIOB 2MSED 3KW5B 1YQBA 4FJYA 2LVPA 4W9HA 1Q1OA 1KJTA 4BKSA 3AXCA 4OVUA 4F7ZA 2JRHA 1V49A 2W9NA 2WWZA 5D6JB 4ZRIA 1PQSA 2K1FA 1WYWB 2KC2A 2G3QB 3RYTA 5C1ZA 2N4FA 1NBFC 5AZGA 1UGMA 2J0MA 1OQYA 3PRZA 1A5RA 2N7DA 4MEMA 5G55A 2FAZA 2KX0A 2KX3A 2RSUA 5EDSA 3PZDA 1Y8RC 3B0AA 4W9FA 3M95A 2KQ7A 2VRRB 1WX9A 4IM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RM9 A;  2IO1 B;  1WIA A;  4GDK A;  4MGY E;  3R7R A;  4LJO B;  2GOW A;  2KAN A;  3DBS A;  1WGR A;  4TV3 A;  3UIP B;  4DDI D;  2RD0 A;  3A1Q A;  4JQW C;  2KMA A;  2KHW B;  4FAD A;  3VXW A;  2MA9 B;  3WAM A;  2KTR A;  3PHX B;  2LRU A;  4AWJ A;  2J0K A;  2MW5 A;  4IG7 B;  3DBL I;  1OEY J;  4GDL B;  5DCN A;  4M0W B;  4PS8 A;  3VQI A;  4WQO B;  3SU8 X;  1YJ1 A;  4IC7 B;  4LDT D;  3WIM A;  5J18 A;  5CTR C;  2LGY A;  2V3S A;  2GBN A;  2JXX A;  1H4R A;  4JL9 A;  4HDQ A;  2GBR A;  1Z2M A;  2I1K A;  2KQS A;  2M1M A;  3TMP B;  3VVW B;  5L83 A;  2I1J A;  4WWN A;  2ZCB A;  4YL8 A;  4EUT A;  1V86 A;  4MSM B;  4MM3 A;  2XK5 A;  3HM6 X;  2GBJ A;  4FBJ B;  4DXA B;  4NY0 A;  3ZDM C;  1P0R A;  2KDB A;  3ZIM A;  2ZVO A;  2R2Q A;  3PLU A;  2L05 A;  1P9D U;  4GIV A;  3DVG X;  4KSL C;  4II2 B;  3VUY A;  1RAX A;  4HDO A;  4GDK B;  1UEL A;  4G3X B;  4FUL A;  3ZRC A;  2KWV B;  2KWC A;  2UYZ B;  2N9E B;  3Q3J A;  3QCA A;  3WAL A;  5L95 C;  3A1Q B;  3KUZ A;  2DZJ A;  1WJN A;  3GZN I;  2K8C A;  2KFK A;  2CHW A;  3L0W B;  3N32 A;  4BBN C;  2KTR B;  5LXH A;  4B6W A;  1K8R B;  2K8H A;  1WXS A;  2A4Z A;  4A20 A;  2ASQ A;  3K9P B;  2DX5 B;  2HE7 A;  4HCP B;  3VTW A;  4HPL B;  3IBE A;  2C7N B;  4FHK A;  2A5U A;  2LVQ A;  2LD9 A;  3CMM B;  3BIN A;  2ZPN A;  3IHP C;  2LXA A;  1SGH A;  2KLG A;  4PS7 A;  5JH5 C;  3QIJ A;  1IPG A;  3ZTD A;  4W9K A;  2DZM A;  3LJ3 A;  3V60 A;  3PTF C;  1NI2 A;  2BKF A;  4HPM B;  3QA8 A;  2NPT A;  2KKC A;  4LCD E;  3ZNG C;  2JZZ A;  2XK5 B;  3L13 A;  1WE6 A;  1WH3 A;  3PV1 A;  3VAW A;  3HIZ A;  2AEH A;  2DZI A;  4RM8 A;  3R3M A;  3RCZ A;  4I6L B;  1WGG A;  2L76 A;  2JT4 B;  3I3T B;  4K7S A;  2V4L A;  4W9I A;  3ENE A;  3APC A;  1WX8 A;  2BF8 B;  1OGW A;  2DEN B;  3R66 C;  4BKG A;  1R4N I;  1TBE A;  1UZX B;  1HE8 A;  2RPQ A;  3V6C B;  1E90 A;  4FHJ A;  3B08 A;  3QK0 A;  2DYB A;  2KFK B;  2DAJ A;  2IO2 B;  3PRP B;  4EOY A;  3TL5 A;  1IYF A;  3TJP A;  3U7D A;  3QAQ A;  4ZYN A;  4IM2 A;  3IVF A;  1P1A A;  1XD3 B;  1WXM A;  2ZPY A;  3ZDT A;  3T9L A;  3APF A;  3DBR I;  3AUL A;  2MP2 A;  2DZK A;  4TQ1 A;  2C7M B;  3D32 A;  4ASW C;  4ANU A;  3L10 B;  3R7Q A;  4GDL A;  2PPH A;  4E3C A;  4F8C B;  3PHW B;  5HKH A;  3WAO A;  1WE7 A;  4A3O A;  2M0X A;  2KJR A;  3M3J A;  4IWP A;  1CMX B;  2NPT B;  2PE6 B;  3PRE A;  3K9O B;  3IFW B;  2G4D B;  2Z59 B;  1S1Q B;  1V5O A;  3ALB A;  3UIN B;  4AJW A;  2C60 A;  4GU2 A;  1RFA A;  4ZDV A;  2KXJ A;  1WJU A;  4HLE A;  2LGX A;  3LDZ E;  3ZNZ B;  4XC2 A;  2MBB B;  4N9F 4;  5J17 A;  2Y5B B;  3X0W A;  4GGQ A;  4IWQ A;  2CKH B;  3VFK A;  4OVV A;  2GMI C;  2IZV B;  5FR6 A;  3N3K B;  1QZE A;  4AP4 C;  5LXI B;  2CR5 A;  5E6P A;  1ISN A;  3SHQ A;  3V61 A;  3AI5 A;  3VTV A;  3L16 A;  1G6J A;  2D2Q A;  4K1R B;  3M62 B;  2V1Y A;  1XQQ A;  2KOX A;  1IP9 A;  3ZW3 A;  1S3S G;  4WWP A;  4KDI C;  1UBQ A;  4W9J A;  3A33 B;  3UF8 A;  1EF1 A;  2ZEQ A;  5DPS A;  2MP2 B;  2WX0 A;  4MSQ B;  3PGE A;  3RUL A;  4B9K A;  1ZGU B;  4URK A;  2JZ3 B;  3APD A;  4BOZ B;  3MHS D;  4GXB A;  4KDL B;  4GB9 A;  1I35 A;  1FXT B;  1UH6 A;  3Q3F A;  4AJY B;  2K6Q A;  4BOS C;  4BKT A;  1V2Y A;  3M63 B;  2L3Z A;  3PS6 A;  1EF5 A;  3IG3 A;  4JIO U;  4J6I A;  3V62 A;  1WM2 A;  4HWI B;  2PEA A;  1OEY A;  3VUW A;  4X57 B;  4GSW A;  2DAF A;  3T8M A;  4AOF A;  1P98 A;  4JLC A;  3P2B A;  4IWO A;  2KJH B;  1GC6 A;  1WRD B;  1E8X A;  3EEC A;  1F9J A;  3DBH I;  2MCN B;  1WM3 A;  4WJN A;  3VH4 B;  2MBH A;  2BYF A;  4MH0 E;  1Q0W B;  4HXD A;  1GJZ A;  4ICU A;  1GG3 A;  4PYZ A;  5E6N A;  4BBN F;  4DHZ B;  2HJ8 A;  3AU4 A;  4KV2 A;  5IAA C;  3NHE B;  4EZK A;  4EZL A;  2UWQ A;  2C5L C;  5CHF A;  5AZH A;  2NVU I;  1WFY A;  2KWU B;  2BYV E;  3ML8 A;  4MGK E;  3VUX A;  4E71 A;  1T0Y A;  4EEW A;  3KYC D;  3H7P A;  2JF5 A;  3GOE A;  3H9D A;  3A9J A;  4MGZ E;  2K6D B;  2G45 B;  4HVB A;  5BO4 B;  1Q5W B;  2GBK A;  1UD7 A;  2JVC A;  2LXC A;  2JRI B;  3EC8 A;  5JHA A;  3DVN V;  3U30 A;  2FCS A;  2L0F A;  5AZF A;  2R2O A;  1YD8 U;  4BFR A;  2NBV B;  2KD0 A;  5G2N A;  4G0N B;  5DPT A;  2LAS A;  3RZW C;  2N7E A;  2KDI A;  4NNJ B;  2JUO A;  5CHV C;  1AAR A;  1M94 A;  2AWT A;  1E7V A;  2NBU A;  1E8Z A;  2IO0 B;  2IY0 B;  1C3T A;  2LZ6 A;  4FA6 A;  2BKR B;  1VCB A;  3OJ4 B;  3QHT A;  1ZKH A;  2KTF A;  4W9G A;  3U8Z A;  4CYE A;  2M4N A;  1L7Y A;  2PE9 A;  4WJP A;  2JPH A;  1E8W A;  4LJP B;  4XX5 A;  2KDF B;  1GNU A;  2NCN A;  4M8M A;  5DPW A;  1KLV A;  1D3Z A;  2KFJ A;  2KMC A;  3B1L X;  2ZVN A;  3EFU A;  2DHZ A;  2KNB A;  4ICV A;  4MEL A;  2FUH B;  4DBG A;  2M8S A;  4FJZ A;  1V80 A;  1V9J A;  3C0R B;  1WX7 A;  2MBE A;  2MRP A;  2AL3 A;  1TTN A;  3SDL C;  2IY1 B;  4TKN A;  4EZJ A;  3ONS A;  4WWO A;  2EKE C;  2IO3 B;  2MWS B;  3W1S A;  4ANV A;  2XBB C;  2ZCC A;  5C23 A;  2EMT A;  3JVZ X;  3KVF B;  4PYU A;  1J8C A;  2ZNV B;  3MTN B;  4IW0 A;  1X1M A;  3H7P B;  4XZ4 A;  2WX1 A;  5E6O A;  3A9J B;  3VTU A;  3KUC B;  1RRB A;  4KZC A;  1J0G A;  2Z0E B;  2XEW A;  1WGD A;  3H1U A;  3H7S A;  3DPD A;  3DDC B;  4P7I A;  3RUI B;  2D3G A;  3ZNH B;  3ZO5 B;  3TIX A;  1LQB A;  4W9E A;  3WAN A;  3OAW A;  2Z0D B;  2L8J A;  2L00 B;  2CHZ A;  1YIW A;  5KHQ A;  2N1W A;  3A4R A;  2LJ5 A;  2CU1 A;  2N9X A;  2KC1 A;  1EO6 A;  2AL6 A;  2AYO B;  4AUQ C;  3HHM A;  2MBQ A;  1LXD A;  3NZS A;  4WJQ A;  2BYE A;  4HK2 A;  3QC8 B;  4RMA A;  3ML9 A;  1KOT A;  1E7U A;  1WF9 A;  1WZ3 A;  2RR9 A;  4NQL B;  1NDD A;  4M8N A;  2KDE B;  3HK0 A;  2BGF A;  2EMS A;  2O2V A;  4NJ6 A;  4B95 A;  4NAW A;  3PRM B;  3HM3 A;  5AEK B;  1H8C A;  4TUU A;  4ANX A;  3PLV A;  3L08 A;  3PSE B;  3ZKJ C;  3PT2 B;  2NR2 A;  2LGD A;  3CSF A;  3PVL A;  1V6E A;  4II3 B;  4I6N B;  2N1V A;  3A4S C;  3OJ3 A;  5D2M B;  3ZLZ A;  3KH0 A;  3O65 B;  4GN1 A;  3A9K A;  2IYD B;  2M17 A;  2BPS A;  4A3P A;  1Z5S B;  3DVN U;  3N30 A;  3NOB A;  2L0T A;  3EHV A;  4KIK A;  2MQJ A;  3VH3 B;  3WA0 A;  4EFO A;  2O6V D;  2C9W B;  4MGI E;  4PS3 A;  3RT3 B;  1WMH A;  1WJ4 A;  2ZNV C;  2KVR A;  3DCG A;  3L17 A;  4EKU A;  1VD2 A;  2J0J A;  3QQ8 B;  4FJV B;  1WGH A;  2J7Q B;  3QX1 A;  4DWF A;  1EUV B;  1BT0 A;  3RZF A;  2FIF A;  1RLF A;  3NZU A;  4DK5 A;  2REX A;  2ZZP B;  2HD5 B;  2FNJ B;  4KVG B;  2YVC A;  4MDK E;  2HTH A;  2KK8 A;  3H6N A;  4G11 A;  2FCM A;  1SIF A;  2O2V B;  3NY5 A;  3ZTC A;  1V81 A;  4W9D A;  5KHO A;  4NAW B;  3L54 A;  4NPN A;  3UQA A;  4G50 A;  4IUM B;  4NQK E;  1P3Q U;  2LWP A;  2ZJD A;  3ECI A;  3MJW A;  4K81 A;  1J19 A;  3AU5 A;  3CST A;  1R4M I;  4GOC A;  3ZRF A;  5JHB A;  2O6V A;  3A9K B;  2RGF A;  2D07 B;  4E74 A;  5D94 A;  4GMV A;  1WY8 A;  3KYD D;  1LM8 B;  3CF6 E;  4DHJ D;  3BY4 B;  3QWZ B;  4CHK A;  2KJ6 A;  3DVG Y;  1YX6 B;  2LVO A;  4KIK B;  3W1S C;  4ZRK A;  1KM7 A;  2MLB A;  4W9L A;  4DHZ E;  1WMH B;  3UQB A;  2WDT B;  2WYQ A;  3PPA A;  1V5T A;  4F1S A;  2YLM A;  3DOW A;  3S2A A;  5GMV A;  5CX3 A;  3VHT C;  2MX2 A;  5J2R A;  3W1Y A;  1ZW7 A;  5TR5 A;  1I42 A;  4CO7 A;  1LFD A;  2QHO A;  2KO3 A;  3KUD B;  3TCA A;  2K39 A;  2N9P C;  3JSV A;  1YX5 B;  2GBM A;  3X23 A;  1WI0 A;  2FCN A;  4K7U A;  4W9C A;  4JGH B;  4ANW A;  4K7W A;  3DQV A;  4HCN B;  4I6P A;  1C1Y B;  3RD2 A;  5JZE B;  3OLM D;  4TQ0 A;  5IA7 A;  3TBL D;  2MBO A;  2JY6 A;  4WAA A;  4MJS A;  2L7R A;  1TZ1 A;  2PJH A;  3WAP A;  1UBI A;  2O6V B;  1SE9 A;  1XT9 B;  4KSK C;  2NS5 A;  2C7H A;  1WZ0 A;  2D10 A;  3JYU A;  1WR1 A;  4FN2 A;  1GUA B;  3ZUN A;  1MG8 A;  2K25 A;  2LUE A;  3VDZ A;  2CS4 A;  1L2N A;  2B3A A;  4ZRJ A;  2FCQ A;  4WJO A;  4BKS D;  2CHX A;  1WXV A;  2D11 A;  1GC7 A;  1OTR B;  1WR6 E;  3QAR A;  4NJ7 A;  2LI5 A;  3UGB B;  5LLI A;  2BWF A;  2NBW B;  1JRU A;  3ZVV A;  4IM3 A;  3SD5 A;  3QJZ A;  1E8Y A;  4BVU C;  3JW0 X;  2IBI B;  2OJR A;  2FID A;  2OOB B;  4HJK A;  3JSV B;  1TGZ B;  1WXA A;  3ZNI D;  3V6E B;  2G4S A;  4LDT B;  5D7G A;  1WGY A;  2LRW A;  4DDG D;  5CHW A;  2JWZ A;  1U4A A;  2K8B A;  3NS8 A;  1E5W A;  2DYO A;  4KZ0 A;  2DYM A;  1WJ6 A;  2KN5 A;  2KZR A;  2BWE S;  4FLH A;  4MJS B;  5DPR A;  4DHJ B;  2KLC A;  3UIO B;  2MSE D;  3KW5 B;  1YQB A;  4FJY A;  2LVP A;  4W9H A;  1Q1O A;  1KJT A;  4BKS A;  3AXC A;  4OVU A;  4F7Z A;  2JRH A;  1V49 A;  2W9N A;  2WWZ A;  5D6J B;  4ZRI A;  1PQS A;  2K1F A;  1WYW B;  2KC2 A;  2G3Q B;  3RYT A;  5C1Z A;  2N4F A;  1NBF C;  5AZG A;  1UGM A;  2J0M A;  1OQY A;  3PRZ A;  1A5R A;  2N7D A;  4MEM A;  5G55 A;  2FAZ A;  2KX0 A;  2KX3 A;  2RSU A;  5EDS A;  3PZD A;  1Y8R C;  3B0A A;  4W9F A;  3M95 A;  2KQ7 A;  2VRR B;  1WX9 A;  4IM0 A; 
#chains in the Genus database with same CATH topology
 2J53 A;  4RM9 A;  3R8B A;  3BVG A;  4GDK A;  4L23 A;  3AB5 A;  4O1N A;  2KAN A;  3O13 A;  4JQW C;  4XYC A;  2KHW B;  2LHD A;  3VXW A;  3W9C B;  1D5M C;  2MW5 A;  2WXR A;  3DBL I;  3DHI C;  1L6V A;  1I4Q A;  5BYR A;  3VQI A;  1KTK A;  1DOX A;  4XDC A;  5E6J A;  2M0A A;  1KLG D;  4YTN B;  5L83 A;  2ZCB A;  4EUT A;  1V86 A;  2NMQ A;  2K9X A;  1SJH D;  2DNF A;  2L83 A;  3IAS 1;  1YN3 A;  1P9D U;  4GIV A;  4KSL C;  4II2 B;  3VUY A;  4FUL A;  4QAY A;  1SSN A;  2KWC A;  3QCA A;  3WAL A;  5BMI A;  3KUZ A;  3GZN I;  2K8C A;  2CHW A;  3L0W B;  4BBN C;  5LXH A;  2K8H A;  3ZQ4 A;  1PGX A;  3IHP C;  2D5G A;  1IPG A;  2DZM A;  1NI2 A;  3EGR A;  4HPM B;  3QA8 A;  1VRA B;  1NI3 A;  1WH3 A;  3I3T B;  3N1Y C;  4P16 A;  4K7S A;  2X8X X;  1WX8 A;  1OGW A;  4BKG A;  1UZX B;  3B08 A;  1HEZ E;  4IM2 A;  3IVF A;  1PUT A;  2KQ4 X;  3ZDT A;  4LNO A;  3AUL A;  2QDF A;  1J7A A;  1FNU A;  2KVZ A;  3W2D A;  3WAO A;  2M0X A;  1FXI A;  5D3I B;  1NEN B;  1F1H A;  2Z59 B;  2IGD A;  4HRO A;  4GU2 A;  1RFA A;  3SR6 A;  3LDZ E;  1L0V B;  2PVG C;  3X0W A;  4TMA B;  5FR6 A;  2V3N A;  1GPX A;  2D2Q A;  4K1R B;  1IP9 A;  1I4P A;  3A33 B;  3UF8 A;  5DPS A;  4DXF A;  1F2R C;  3RPF C;  4KX6 B;  4C7Z A;  3DHG C;  1FXT B;  1UH6 A;  1DOY A;  3VR9 B;  2K6Q A;  4BKT A;  1V2Y A;  1C4P A;  3M63 B;  4JIO U;  4C00 A;  5H92 C;  1FCL A;  2KJH B;  1F9J A;  3DBH I;  3VH4 B;  3AV8 A;  1Q0W B;  4ICU A;  4YSY B;  1ZE3 D;  1P7F A;  4WQM A;  3RNA C;  4WAF A;  5CHF A;  3AE9 B;  4MGK E;  3RNF C;  2JF5 A;  3GOE A;  1XEE A;  4HVB A;  2GBK A;  2JVC A;  4OVZ A;  3GP7 A;  2R2O A;  4BFR A;  4YXD B;  1FM0 D;  4G0N B;  2LAS A;  4NNJ B;  2JUO A;  3P4S B;  5HG2 A;  1VCB A;  4CYE A;  2LUM A;  2M4N A;  1L7Y A;  2PE9 A;  1C9F A;  1GNU A;  1QF6 A;  2IGH A;  3AM9 A;  5DPW A;  1D3Z A;  3B1L X;  4KGT A;  2DHZ A;  4ICV A;  4MEL A;  2FUH B;  1HZ6 A;  5JXV A;  4FJZ A;  4KGR A;  3SDL C;  4TKN A;  4EZJ A;  2WGS A;  4M02 A;  2IO3 B;  3W1S A;  2ZCC A;  1K50 A;  3JVZ X;  5E6O A;  1X1M A;  3H7P B;  3A9J B;  3KUC B;  1RRB A;  5HI1 A;  1C78 A;  2Y5P A;  4HPP A;  3H7S A;  2D3G A;  1V97 A;  3AE6 B;  3OAW A;  2CHZ A;  2B76 B;  2LMC A;  3HRD D;  1XCT L;  2MBQ A;  4RGO S;  3ML9 A;  2RR9 A;  2JU6 X;  4YSX B;  2EMS A;  2O2V A;  3Q8F A;  5BMH A;  2V0G A;  2WDQ B;  1KLU D;  2VZK B;  4TUU A;  1C4A A;  4ANX A;  3PLV A;  4KKI A;  3PVL A;  1STE A;  4L1B A;  1XLN A;  3EFC A;  3NVY A;  2PLP A;  1ZXH A;  2WXQ A;  2L0T A;  1VZ6 A;  4ZRP A;  3VH3 B;  1WMH A;  1WJ4 A;  3L17 A;  2J0J A;  1WGH A;  5D3D A;  2N9L A;  2J7Q B;  1BT0 A;  3RZF A;  3AN1 A;  2REX A;  3IXS A;  2FNJ B;  4HRS A;  1V8C A;  4ZHO A;  1HQR D;  1R7S A;  3L4P A;  1F2R I;  4ZRQ A;  3TEW A;  1SIF A;  4W9D A;  2L32 A;  4NAW B;  4G50 A;  3ECI A;  2LWP A;  1ZP0 B;  2AX5 A;  4M00 A;  3CST A;  2LGS A;  4DHJ D;  1PGA A;  3DVG Y;  2LVO A;  1T6B X;  4W9L A;  4US9 A;  2BT6 A;  2WU5 B;  3DOW A;  3U4E G;  1TZO A;  3S2A A;  5J2R A;  3W1Y A;  3LB8 C;  1I42 A;  1JWM D;  1LFD A;  2EKI A;  2QSD A;  3KUD B;  2RDB C;  1SIJ A;  1C79 A;  2FCN A;  3ZXV A;  4K7W A;  3Q3M C;  1L5P A;  5JZE B;  1C1Y B;  3RD2 A;  1CZP A;  2MBO A;  2JY6 A;  1JWB D;  2L7R A;  1XLQ A;  3RI7 C;  4N59 A;  1MFW A;  3ZUN A;  1WR1 A;  3VDZ A;  4KGS A;  2ZW1 A;  3AEB B;  1XO3 A;  4WJO A;  4NJ7 A;  3QAR A;  4R3D A;  2LI5 A;  3P4R B;  1KF6 B;  2BWF A;  2NBW B;  3ZVV A;  2W3R A;  3Q8B A;  3QJZ A;  1E8Y A;  2INN E;  2KAC A;  4ITK A;  2OJR A;  2FID A;  3JSV B;  1TGZ B;  2RDH A;  3V6E B;  5D7G A;  4WIP A;  2LRW A;  4DDG D;  2K8B A;  3NS8 A;  4KZ0 A;  3AH7 A;  1D5X C;  4FLH A;  3B2F A;  3ZJU A;  2KLC A;  3UIO B;  1GB1 A;  4W9H A;  1KJT A;  4M0W A;  4PT5 A;  4ZRI A;  4JPS A;  2K1F A;  3KWV A;  5C1Z A;  5AZG A;  1OQY A;  4RFB A;  1AYF A;  1MJD A;  2N7D A;  4MEM A;  2JX5 A;  1IBX B;  2KX0 A;  4JE3 B;  1MHX A;  2QIE B;  2H89 B;  3U7Z A;  3M95 A;  2KQ7 A;  1TTN A;  4IM0 A;  3MC0 B;  1I4R A;  2GOW A;  2WDV B;  1D5Z C;  1B9R A;  2KTR A;  2ONQ A;  4S0R A;  2LRU A;  1L4Z B;  4IG7 B;  5DCN A;  1YQ3 B;  3P4Q B;  5G5H A;  2M19 A;  4EE2 A;  1EU3 A;  1YJ1 A;  3AE2 B;  4LDT D;  3WIM A;  5J18 A;  2GBN A;  1H4R A;  4HDQ A;  2GBR A;  1Z2M A;  2I1K A;  2KQS A;  3N1Z C;  3TMP B;  1WSP A;  2WXP A;  2I1J A;  5T8I A;  2YEP F;  4IDI A;  1ESF A;  1JWS D;  1MVK A;  4MM3 A;  4PK1 A;  1NYR A;  3DHH C;  2WXI A;  4FBJ B;  4DXA B;  1YJJ A;  2DBY A;  2R2Q A;  3Q3O C;  1NYQ A;  2L05 A;  3DVG X;  1B1Z A;  2R61 A;  1RAX A;  4GDK B;  4G3X B;  1TY0 A;  2UYZ B;  3Q3J A;  3VR8 B;  2BS4 B;  1TS5 A;  1WXS A;  2A4Z A;  4A20 A;  3NVV A;  2ASQ A;  1QQR A;  2DX5 B;  3VTW A;  4GLS C;  4MT5 A;  1Y56 A;  2KT7 A;  2LXA A;  1SGH A;  3QIJ A;  3SFD B;  3V60 A;  3HVZ A;  2BKF A;  2NPT A;  3ZNG C;  2JZZ A;  3SFE B;  1DYQ A;  4RM8 A;  3R3M A;  3RCZ A;  2WXF A;  1IBX A;  3TEZ A;  2V4L A;  4W9I A;  3ENE A;  1R4N I;  1HE8 A;  2RPQ A;  3V6C B;  1E90 A;  4FHJ A;  5EE9 A;  3QK0 A;  2DYB A;  4EOY A;  4WUR A;  3TL5 A;  3TJP A;  1EM7 A;  3RFZ B;  1P1A A;  1ZDV A;  3DBR I;  4TQ1 A;  5EE0 A;  2C7M B;  3D32 A;  1R4M B;  4E3C A;  2PPH A;  3KQ4 A;  4CQN A;  3NVZ A;  4YSZ B;  1QLB B;  3M3J A;  2PE6 B;  1N62 A;  3K9O B;  3IFW B;  1S1Q B;  3RNE C;  4AJW A;  2RMM A;  4ZDV A;  1Q10 A;  2KXJ A;  1HTQ A;  1E6E B;  2LGX A;  3ZNZ B;  3PO0 A;  4XC2 A;  4N9F 4;  2Y5B B;  2CKH B;  3VFK A;  2QIL A;  3N3K B;  5LXI B;  5E6P A;  1ISN A;  3AEA B;  3V61 A;  3AI5 A;  3L16 A;  3N20 C;  1FXA A;  2JYE A;  2KOX A;  3P4P B;  2WXL A;  2J52 A;  1S3S G;  3KLS X;  4W9J A;  2WXH A;  2ZEQ A;  1VZ8 A;  3B9J A;  4MSQ B;  3BII D;  4URK A;  4KDL B;  1N63 A;  4GB9 A;  1I35 A;  4K3C A;  2CJO A;  2VH1 A;  1QT9 A;  2L3Z A;  3V62 A;  1WM2 A;  4HWI B;  3LYY A;  1OEY A;  4GSW A;  3P2B A;  4IWO A;  1TY2 A;  2Y3A A;  2AQ2 B;  3EEC A;  2WP9 B;  3I63 C;  1WM3 A;  4MH8 A;  2LFI A;  2BVC A;  1BUI C;  3ZJV A;  2MBH A;  2BYF A;  4MH0 E;  1GJZ A;  2GI9 A;  4NJC A;  4EZK A;  5AZH A;  3VRA B;  1WFY A;  2KWU B;  2WDR B;  2BYV E;  4EEW A;  1FMA D;  3ZYY X;  3Q8A A;  1AN8 A;  4MGZ E;  2K6D B;  5BO4 B;  1UD7 A;  3EC8 A;  2JRI B;  3U30 A;  2FCS A;  1OQQ A;  5AZF A;  2NBV B;  3DWM A;  3P1M A;  2KD0 A;  4OZA A;  5DPT A;  3RZW C;  3NZ3 A;  2KDI A;  5IP4 D;  2AWT A;  1E7V A;  2NBU A;  2IO0 B;  2OHF A;  4FA6 A;  1ZKH A;  2KTF A;  3OG5 A;  3U8Z A;  4WJP A;  1GOZ A;  4LJP B;  4XX5 A;  4M8M A;  1V1P A;  2NTT A;  4A90 A;  4YWG G;  1JWU D;  3C0R B;  2AL3 A;  2EKE C;  2RDG A;  1ET9 A;  2XBB C;  3IAM 1;  1GAQ B;  4XZ4 A;  2Q5W D;  2XN9 C;  3NS1 A;  1J0G A;  1YNT E;  2Z0E B;  3DPD A;  4P7I A;  1QKZ A;  1CQV A;  3RUI B;  3ZNH B;  4XGA B;  4OZB A;  2K5P A;  4W9E A;  3WAN A;  1XF5 L;  2L00 B;  1YIW A;  5EE3 A;  2CU1 A;  2AYO B;  4WWM A;  4HK2 A;  1KOT A;  4IOI E;  1J7B A;  1BML C;  2J4X A;  2KDE B;  2PMV A;  4M8N A;  2BGF A;  3BYT B;  4NJ6 A;  4YTP B;  3L08 A;  1N6Z A;  2LGD A;  3CSF A;  4I6N B;  2N1V A;  3KH0 A;  3ABV B;  1LO5 D;  1T3Q A;  5TSS A;  1Z5S B;  2YEP B;  2K0P A;  4Q2J A;  3EHV A;  4KIK A;  2MQJ A;  2O6V D;  2C9W B;  3GS2 A;  4MGI E;  4PS3 A;  3RT3 B;  4EKU A;  2DWQ A;  2KVR A;  1EUV B;  3TUO A;  2FIF A;  1RLF A;  3NZU A;  2AQ3 B;  3E56 A;  2YVC A;  2HTH A;  4G11 A;  2BYT A;  2O2V B;  2JYT A;  1EU4 A;  4NPN A;  1T0Q C;  2W54 A;  4DXG A;  4IUM B;  1P3Q U;  3MJW A;  5C2T B;  4NAM A;  4XWW A;  3AEG B;  1J7C A;  1SEB D;  2MJE A;  2RGF A;  2D07 B;  1WY8 A;  1CK1 A;  1LM8 B;  3QWZ B;  4CHK A;  2WNM A;  1YX6 B;  3RN9 C;  3AE4 B;  1WMH B;  3UQB A;  4JX1 C;  3PPA A;  2YLM A;  4MAC A;  2KWD A;  3J9C A;  3FIL A;  2WXG A;  5GMV A;  3VHT C;  1ZW7 A;  1PFD A;  1YX5 B;  3X23 A;  1UWX A;  1PGB A;  4LNF A;  4I6P A;  3FC4 A;  5IA7 A;  3TBL D;  3GE8 C;  1TZ1 A;  2PJH A;  3WAP A;  1UBI A;  1SE9 A;  1XT9 B;  3P63 A;  2HTM E;  1WZ0 A;  5IOI A;  2WXJ A;  1GUA B;  2LUE A;  2CS4 A;  1L2N A;  2B3A A;  2N9K A;  4BKS D;  2D11 A;  1OTR B;  1WR6 E;  5LLI A;  1EWY C;  3BVZ A;  1JRU A;  2MHJ A;  5G5G A;  1L4D B;  3HUI A;  2G4S A;  4LDT B;  1F52 A;  1MI0 A;  2KN5 A;  1FO4 A;  1TJE A;  1YOV B;  4C56 C;  3I5J C;  3AXC A;  4OVU A;  2KDM A;  4F7Z A;  2JRH A;  2W9N A;  4N58 A;  3Q8C A;  1WYW B;  2G3Q B;  2PVO D;  1NBF C;  5EE1 A;  3MC8 A;  2E6X A;  1WWT A;  2FAZ A;  3Q2A C;  2KX3 A;  2RSU A;  2BS2 B;  3NG0 A;  1Y8R C;  4FXC A;  3SU8 X;  2I2Y A;  2IO1 B;  1FNW A;  2W82 A;  1WIA A;  2MH7 A;  3R7R A;  4TV3 A;  3DBS A;  3UIP B;  4DDI D;  1HZ5 A;  3A1Q A;  4FAD A;  2MA9 B;  4REZ A;  3PHX B;  4AWJ A;  2J0K A;  4GDL B;  4M0W B;  1L6U A;  1WRI A;  4WQO B;  2PIA A;  5CTR C;  1E9M A;  2PTL A;  2JXX A;  1HTO A;  4N6E B;  2M1M A;  3VVW B;  1YJI A;  4WWN A;  3ZJT A;  4YL8 A;  2LGI A;  2XK5 A;  2GBJ A;  1N5W A;  4NY0 A;  4LTU A;  5C3J B;  3ZIM A;  1UEL A;  3ZRC A;  2BW2 A;  2KWV B;  5L95 C;  1WJN A;  2KFK A;  4RGM A;  3N32 A;  2KTR B;  3I57 A;  1K8R B;  4HCP B;  3IBE A;  4FHK A;  3BVM A;  1TKG A;  4XE0 A;  3BIN A;  1UGJ A;  4PS7 A;  4YT0 B;  3ZTD A;  4W9K A;  1ZDX A;  3PTF C;  1FRR A;  1UF0 A;  2QEJ C;  3BK1 A;  4LCD E;  4MM3 B;  3L13 A;  1K51 A;  3HIZ A;  2AEH A;  2DZI A;  4I6L B;  2L76 A;  3ZGZ A;  2QCZ A;  2VH2 A;  4HKQ A;  4BZA A;  2BF8 B;  5BYS A;  2DEN B;  3R66 C;  3AE1 B;  2JWU A;  2MJ3 A;  1RFK A;  5HFY A;  3ETR A;  1E10 A;  2BB6 A;  3NVW A;  1IYF A;  3U7D A;  3WCQ A;  4RH6 A;  2IGG A;  2ZPY A;  3APF A;  2MP2 A;  2DZK A;  1K52 A;  4ANU A;  1FD6 A;  3L10 B;  3R7Q A;  4GDL A;  5HKH A;  1WE7 A;  4A3O A;  2KJR A;  4IWP A;  1CMX B;  2NPT B;  3PRE A;  2G4D B;  1LGR A;  4D2K A;  2QJL A;  1V5O A;  4P1C C;  3UIN B;  4JWU C;  3OWE B;  1D6E C;  1SE4 A;  2MBB B;  4C7Y A;  1SJE D;  2GMI C;  4ARC A;  5BMG A;  4AP4 C;  2CR5 A;  3SHQ A;  1SE3 A;  3M62 B;  2V1Y A;  2GRI A;  4KDI C;  1UBQ A;  1JML A;  1QOB A;  2WX0 A;  4JWS C;  3RUL A;  4B9K A;  1ZGU B;  3RMK C;  3TSS A;  3T3O A;  2N0S B;  4BOZ B;  1SBB B;  1SXT A;  4AJY B;  2ON8 A;  3R2I A;  2WXO A;  1EWC A;  3PS6 A;  3IG3 A;  4J6I A;  2PEA A;  3VUW A;  3LXF A;  4X57 B;  3T8M A;  4RF1 A;  1P98 A;  1GC6 A;  1WRD B;  2HJ1 A;  3HVD A;  2CJN A;  4WJN A;  3MJ5 A;  2IPK D;  5FKA C;  4L2Y A;  4HXD A;  4PYZ A;  4BBN F;  4KV2 A;  5IAA C;  1N5X A;  2NVU I;  3AEF B;  3T3N A;  1TIF A;  3ML8 A;  3VUX A;  2WLB A;  1T0Y A;  3URY A;  2VZK D;  2G45 B;  1Q5W B;  2LXC A;  3Q3N C;  4ARI A;  5G2N A;  2N7E A;  3U52 E;  4K3B A;  4W9G A;  2UU7 A;  1E8W A;  3BZD B;  2KDF B;  2NCN A;  1P7E A;  2KMC A;  1FNV A;  2KNB A;  1UUP A;  2M8S A;  1V9J A;  3W5U B;  2MRP A;  3ONS A;  4WWO A;  4P6V F;  4ANV A;  4PYU A;  2ZNV B;  3MTN B;  4IW0 A;  3VTU A;  2WX1 A;  1DGJ A;  3BWU D;  2SEB D;  4KZC A;  1N60 A;  2XEW A;  1WGD A;  3DBL B;  3DDC B;  3TIX A;  1LQB A;  3MC9 A;  2Z0D B;  2L8J A;  2EEL A;  2WXK A;  2N1W A;  3ZXR A;  2N9X A;  1EO6 A;  2AL6 A;  4BAX A;  1T5X D;  4AUQ C;  3NZS A;  1LXD A;  4WJQ A;  2BYE A;  4RMA A;  1WF9 A;  4NQL B;  3HK0 A;  1V1P B;  4B95 A;  2KYW A;  3HM3 A;  4S17 A;  2L1A A;  5AEK B;  2INP E;  5AUK A;  1IGC A;  3PSE B;  3ZKJ C;  3PT2 B;  2NR2 A;  1QOF A;  1FIQ A;  3OJ3 A;  2H88 B;  1E7P B;  3CWI A;  4GN1 A;  4XWT A;  3A9K A;  3GZN B;  4A3P A;  3BK2 A;  1JAL A;  3DVN U;  2KN4 A;  1ACC A;  4DQO C;  4EFO A;  1SF0 A;  2QMT A;  3DCG A;  1VD2 A;  2FUG 1;  4FJV B;  2KAJ A;  3QX1 A;  4DWF A;  1KFY B;  4HJG E;  4DK5 A;  2IJ0 A;  4J3O D;  2ZZP B;  3AEC B;  4RGT A;  2KK8 A;  2WXN A;  1L0Y B;  2V9H A;  2FCM A;  3NY5 A;  1V81 A;  4OZC A;  3L54 A;  3UQA A;  4OHJ A;  3Q6B A;  1ENF A;  4K81 A;  3AU5 A;  1FFV A;  1R4M I;  1F77 A;  4GOC A;  1VZ7 A;  2O6V A;  4E74 A;  5D94 A;  3CIR B;  3BY4 B;  4KIK B;  3AE8 B;  3W1S C;  4ZRK A;  1KM7 A;  2MLB A;  1DOI A;  2WDT B;  1T0R C;  2WYQ A;  2XNA C;  1KH0 A;  4LNI A;  2AQ1 B;  2LEK A;  5TR5 A;  4CO7 A;  3TCA A;  3I9V 1;  2N9P C;  1WI0 A;  5I4D A;  2MJD A;  4W9C A;  2L52 A;  3AED B;  2DLB A;  2K3U A;  3OLM D;  3NUH B;  4WAA A;  4MJS A;  5BYQ A;  5MPO A;  2N7J A;  1I4X A;  2NS5 A;  2BQQ A;  4FN2 A;  2I38 A;  1I4G A;  1MG8 A;  3Q14 C;  4A55 A;  2CHX A;  1WXV A;  1TKE A;  3AEE B;  3FAH A;  3UGB B;  3IT4 B;  1IUE A;  3FIL B;  1L0X B;  2WU2 B;  1XLO A;  4LLG M;  4LK0 M;  4HJK A;  2WQY B;  1WGY A;  2KMM A;  5CHW A;  2JWZ A;  2PW9 A;  1E5W A;  2JQR B;  4RCO A;  1WJ6 A;  2BWE S;  3DBH B;  3V3X A;  4DHJ B;  1YN5 A;  2MSE D;  1GB4 A;  1FEH A;  2K22 A;  3U2S C;  4BKS A;  3B2G A;  2PKO A;  1V49 A;  2WWZ A;  3RYT A;  4ZYS A;  2KC2 A;  1JRO A;  3H8H A;  4NZL B;  4H2A A;  1WXQ A;  2J0M A;  3PRZ A;  2G9H D;  3TEX A;  1JQ4 A;  3PZ7 A;  3C8Y A;  3PZD A;  1C4C A;  3MP9 A;  1QIL A;  2VRR B;  1WX9 A;  1OFF A;  4MGY E;  1YMH E;  4LJO B;  1WGR A;  2RD0 A;  2INC C;  2KMA A;  1FFU A;  3WAM A;  5LNK 1;  3W5V B;  4AQ7 A;  1OEY J;  4PS8 A;  4IC7 B;  2LGY A;  2V3S A;  1XCQ L;  4JL9 A;  1BXT A;  2D3B A;  1ZPS A;  4MSM B;  1CJE A;  3HM6 X;  3ZDM C;  1P0R A;  2ICI A;  2KDB A;  2ZVO A;  3PLU A;  4ZHP A;  1TS3 A;  4A9A A;  4HDO A;  2N9E B;  3A1Q B;  2DZJ A;  1ET6 A;  4B6W A;  3K9P B;  2HE7 A;  5IN7 A;  4HPL B;  4KKJ A;  2C7N B;  2A5U A;  2LVQ A;  2LD9 A;  3CMM B;  3TEY A;  1WYG A;  1QOG A;  2ZPN A;  3PZ8 A;  2KLG A;  5JH5 C;  3N9Y C;  4C4V B;  2LHE A;  3LJ3 A;  3MHZ A;  1E0Z A;  1XLP A;  2KKC A;  1VJK A;  2XK5 B;  1WE6 A;  3PV1 A;  3VAW A;  4RF0 A;  1WGG A;  2JT4 B;  2GB1 A;  2WS3 B;  2BBC A;  3APC A;  4RGN A;  1ROE A;  1TBE A;  2GLS A;  2KFK B;  2DAJ A;  2J42 A;  2IO2 B;  3PRP B;  1F0Z A;  4HEA 1;  3QAQ A;  4ZYN A;  1XD3 B;  4LNN A;  1WXM A;  3T9L A;  1ZUD 2;  1MHH E;  4WH4 A;  4ASW C;  5FR3 A;  4F8C B;  3PHW B;  4US8 A;  2Y5C A;  3N1X C;  2JZP A;  4OW0 A;  1IGD A;  4ACF A;  3ALB A;  2C60 A;  4AS1 A;  1WJU A;  4HLE A;  2OED A;  5FK9 C;  3VRB B;  5J17 A;  4GGQ A;  4IWQ A;  4OVV A;  1UNS A;  4TSS A;  2IZV B;  4A8X C;  1D4B A;  2MEK A;  1QZE A;  3AMZ A;  1HXY D;  3VTV A;  1G6J A;  1XQQ A;  3ZW3 A;  4WWP A;  1EF1 A;  3C19 A;  1I4H A;  2MP2 B;  3PGE A;  2JZ3 B;  3APD A;  3MHS D;  4GXB A;  3Q3F A;  1MG4 A;  4BOS C;  4USA A;  4C4V A;  1EF5 A;  1I7H A;  4AOF A;  1XXG A;  2DAF A;  4JLC A;  1E8X A;  2RPV A;  2MCN B;  2ZW0 A;  1GG3 A;  1VR9 A;  5E6N A;  4DHZ B;  3AE5 B;  2HJ8 A;  3AU4 A;  3NHE B;  4EZL A;  1V1O A;  2UWQ A;  2C5L C;  4E71 A;  1OQR A;  3KYC D;  3H7P A;  3H9D A;  3A9J A;  3AE3 B;  5JHA A;  3DVN V;  2L0F A;  1YD8 U;  2Z8L A;  3EA6 A;  3FKY A;  5CHV C;  1AAR A;  1M94 A;  2BTE A;  1E8Z A;  2IY0 B;  3RNG C;  1C3T A;  2LZ6 A;  2BKR B;  3OJ4 B;  3QHT A;  5AUI A;  2JPH A;  3BYY B;  3DWG C;  1KLV A;  3NJT A;  2KFJ A;  2IND C;  2ZVN A;  3EFU A;  4DBG A;  1RYJ A;  4A6Q A;  1V80 A;  2D3A A;  1WX7 A;  2MBE A;  1JWA D;  2IY1 B;  2W3S A;  1NEK B;  2MWS B;  2JSV X;  5C23 A;  2EMT A;  3KVF B;  1TYG B;  1JW9 D;  5KHQ A;  1J8C A;  2FE8 A;  2X38 A;  1KRH A;  3H1U A;  1VDV A;  4IKG A;  1A70 A;  3ZO5 B;  4B0M A;  2IDY A;  3A4R A;  2LJ5 A;  2KC1 A;  2CU3 A;  3HHM A;  5IO9 A;  4P1B C;  4LNK A;  3QC8 B;  1E7U A;  1WZ3 A;  3RNC C;  1NDD A;  1TS2 A;  3GE3 C;  4NAW A;  3PRM B;  2E3T A;  1SE2 A;  1K53 A;  1N61 A;  1H8C A;  5IKC M;  4HKZ E;  1VLB A;  1V6E A;  4II3 B;  3A4S C;  3ZLZ A;  5D2M B;  1FCC C;  3O65 B;  2IYD B;  2M17 A;  2BPS A;  2D3C A;  3N30 A;  3NOB A;  3UI3 A;  3E9S A;  2NTS A;  3WA0 A;  2M56 B;  2ZNV C;  3QQ8 B;  3GB1 A;  3RNB C;  2HD5 B;  4B0E A;  2QC8 A;  4KVG B;  1YN4 A;  4MDK E;  3H6N A;  1TT5 B;  3AE7 B;  1AW7 A;  3ZTC A;  5KHO A;  2G1E A;  2SAK A;  1PDX A;  4NQK E;  1HA5 A;  2ZJD A;  1J19 A;  2V4I B;  1R4N B;  3ZRF A;  5JHB A;  4ZOH C;  1JCK B;  3A9K B;  1YQ4 B;  4GMV A;  3KYD D;  3IT6 B;  3CF6 E;  2KJ6 A;  3P42 A;  1ZOY B;  3DBR B;  3Q69 A;  4DHZ E;  1V5T A;  2WXM A;  4F1S A;  5GXG B;  2JXT A;  3V05 A;  5CX3 A;  2MX2 A;  2QHO A;  2HDE A;  2KO3 A;  2K39 A;  3JSV A;  1FRD A;  1NVI D;  2GBM A;  4K7U A;  3MFG A;  4JGH B;  1AWD A;  4ANW A;  4C80 A;  3DQV A;  4HCN B;  2FBW B;  4TQ0 A;  2BS3 B;  1RWS A;  2O6V B;  4KSK C;  2C7H A;  2D10 A;  3JYU A;  2K25 A;  1TS4 A;  1RM6 C;  4XDD A;  2V3P A;  4ZRJ A;  1ZXI A;  3NRZ A;  1UWM A;  2FCQ A;  1PYW D;  1GC7 A;  1C76 A;  4M01 A;  1FPY A;  4IM3 A;  3SD5 A;  4BVU C;  3JW0 X;  2IBI B;  1WGK A;  2OOB B;  2W55 A;  1T0S C;  2TSS A;  1WXA A;  4UDU C;  3ZNI D;  3Q8E A;  4RNA A;  3EUB 2;  2WHI A;  1U4A A;  2DYO A;  2DYM A;  2KZR A;  4MJS B;  5DPR A;  2BB5 A;  3KW5 B;  1YQB A;  4FJY A;  2LVP A;  4YTM B;  1Q1O A;  1C77 A;  1QOA A;  3SEB A;  1JRP A;  5D6J B;  1PQS A;  1MPE A;  2ACZ B;  2N4F A;  1UGM A;  5H8Y E;  1A5R A;  2OJW A;  1TKY A;  5HHD G;  5G55 A;  2LJI A;  1M4V A;  5EDS A;  3R2T A;  3B0A A;  1SB3 C;  4W9F A;  3KWL A; 
#chains in the Genus database with same CATH homology
 4RM9 A;  2IO1 B;  1WIA A;  4GDK A;  4MGY E;  3R7R A;  4LJO B;  2GOW A;  2KAN A;  3DBS A;  1WGR A;  4TV3 A;  3UIP B;  4DDI D;  2RD0 A;  3A1Q A;  4JQW C;  2KMA A;  2KHW B;  4FAD A;  3VXW A;  2MA9 B;  3WAM A;  2KTR A;  3PHX B;  2LRU A;  4AWJ A;  2J0K A;  2MW5 A;  4IG7 B;  3DBL I;  1OEY J;  4GDL B;  5DCN A;  4M0W B;  4PS8 A;  3VQI A;  4WQO B;  3SU8 X;  1YJ1 A;  4IC7 B;  4LDT D;  3WIM A;  5J18 A;  5CTR C;  2LGY A;  2V3S A;  2GBN A;  2JXX A;  1H4R A;  4JL9 A;  4HDQ A;  2GBR A;  1Z2M A;  2I1K A;  2KQS A;  2M1M A;  3TMP B;  3VVW B;  5L83 A;  2I1J A;  4WWN A;  2ZCB A;  4YL8 A;  4EUT A;  1V86 A;  4MSM B;  4MM3 A;  2XK5 A;  3HM6 X;  2GBJ A;  4FBJ B;  4DXA B;  4NY0 A;  3ZDM C;  1P0R A;  2KDB A;  3ZIM A;  2ZVO A;  2R2Q A;  3PLU A;  2L05 A;  1P9D U;  4GIV A;  3DVG X;  4KSL C;  4II2 B;  3VUY A;  1RAX A;  4HDO A;  4GDK B;  1UEL A;  4G3X B;  4FUL A;  3ZRC A;  2KWV B;  2KWC A;  2UYZ B;  2N9E B;  3Q3J A;  3QCA A;  3WAL A;  5L95 C;  3A1Q B;  3KUZ A;  2DZJ A;  1WJN A;  3GZN I;  2K8C A;  2KFK A;  2CHW A;  3L0W B;  3N32 A;  4BBN C;  2KTR B;  5LXH A;  4B6W A;  1K8R B;  2K8H A;  1WXS A;  2A4Z A;  4A20 A;  2ASQ A;  3K9P B;  2DX5 B;  2HE7 A;  4HCP B;  3VTW A;  4HPL B;  3IBE A;  2C7N B;  4FHK A;  2A5U A;  2LVQ A;  2LD9 A;  3CMM B;  3BIN A;  2ZPN A;  3IHP C;  2LXA A;  1SGH A;  2KLG A;  4PS7 A;  5JH5 C;  3QIJ A;  1IPG A;  3ZTD A;  4W9K A;  2DZM A;  3LJ3 A;  3V60 A;  3PTF C;  1NI2 A;  2BKF A;  4HPM B;  3QA8 A;  2NPT A;  2KKC A;  4LCD E;  3ZNG C;  2JZZ A;  2XK5 B;  3L13 A;  1WE6 A;  1WH3 A;  3PV1 A;  3VAW A;  3HIZ A;  2AEH A;  2DZI A;  4RM8 A;  3R3M A;  3RCZ A;  4I6L B;  1WGG A;  2L76 A;  2JT4 B;  3I3T B;  4K7S A;  2V4L A;  4W9I A;  3ENE A;  3APC A;  1WX8 A;  2BF8 B;  1OGW A;  2DEN B;  3R66 C;  4BKG A;  1R4N I;  1TBE A;  1UZX B;  1HE8 A;  2RPQ A;  3V6C B;  1E90 A;  4FHJ A;  3B08 A;  3QK0 A;  2DYB A;  2KFK B;  2DAJ A;  2IO2 B;  3PRP B;  4EOY A;  3TL5 A;  1IYF A;  3TJP A;  3U7D A;  3QAQ A;  4ZYN A;  4IM2 A;  3IVF A;  1P1A A;  1XD3 B;  1WXM A;  2ZPY A;  3ZDT A;  3T9L A;  3APF A;  3DBR I;  3AUL A;  2MP2 A;  2DZK A;  4TQ1 A;  2C7M B;  3D32 A;  4ASW C;  4ANU A;  3L10 B;  3R7Q A;  4GDL A;  2PPH A;  4E3C A;  4F8C B;  3PHW B;  5HKH A;  3WAO A;  1WE7 A;  4A3O A;  2M0X A;  2KJR A;  3M3J A;  4IWP A;  1CMX B;  2NPT B;  2PE6 B;  3PRE A;  3K9O B;  3IFW B;  2G4D B;  2Z59 B;  1S1Q B;  1V5O A;  3ALB A;  3UIN B;  4AJW A;  2C60 A;  4GU2 A;  1RFA A;  4ZDV A;  2KXJ A;  1WJU A;  4HLE A;  2LGX A;  3LDZ E;  3ZNZ B;  4XC2 A;  2MBB B;  4N9F 4;  5J17 A;  2Y5B B;  3X0W A;  4GGQ A;  4IWQ A;  2CKH B;  3VFK A;  4OVV A;  2GMI C;  2IZV B;  5FR6 A;  3N3K B;  1QZE A;  4AP4 C;  5LXI B;  2CR5 A;  5E6P A;  1ISN A;  3SHQ A;  3V61 A;  3AI5 A;  3VTV A;  3L16 A;  1G6J A;  2D2Q A;  4K1R B;  3M62 B;  2V1Y A;  1XQQ A;  2KOX A;  1IP9 A;  3ZW3 A;  1S3S G;  4WWP A;  4KDI C;  1UBQ A;  4W9J A;  3A33 B;  3UF8 A;  1EF1 A;  2ZEQ A;  5DPS A;  2MP2 B;  2WX0 A;  4MSQ B;  3PGE A;  3RUL A;  4B9K A;  1ZGU B;  4URK A;  2JZ3 B;  3APD A;  4BOZ B;  3MHS D;  4GXB A;  4KDL B;  4GB9 A;  1I35 A;  1FXT B;  1UH6 A;  3Q3F A;  4AJY B;  2K6Q A;  4BOS C;  4BKT A;  1V2Y A;  3M63 B;  2L3Z A;  3PS6 A;  1EF5 A;  3IG3 A;  4JIO U;  4J6I A;  3V62 A;  1WM2 A;  4HWI B;  2PEA A;  1OEY A;  3VUW A;  4X57 B;  4GSW A;  2DAF A;  3T8M A;  4AOF A;  1P98 A;  4JLC A;  3P2B A;  4IWO A;  2KJH B;  1GC6 A;  1WRD B;  1E8X A;  3EEC A;  1F9J A;  3DBH I;  2MCN B;  1WM3 A;  4WJN A;  3VH4 B;  2MBH A;  2BYF A;  4MH0 E;  1Q0W B;  4HXD A;  1GJZ A;  4ICU A;  1GG3 A;  4PYZ A;  5E6N A;  4BBN F;  4DHZ B;  2HJ8 A;  3AU4 A;  4KV2 A;  5IAA C;  3NHE B;  4EZK A;  4EZL A;  2UWQ A;  2C5L C;  5CHF A;  5AZH A;  2NVU I;  1WFY A;  2KWU B;  2BYV E;  3ML8 A;  4MGK E;  3VUX A;  4E71 A;  1T0Y A;  4EEW A;  3KYC D;  3H7P A;  2JF5 A;  3GOE A;  3H9D A;  3A9J A;  4MGZ E;  2K6D B;  2G45 B;  4HVB A;  5BO4 B;  1Q5W B;  2GBK A;  1UD7 A;  2JVC A;  2LXC A;  2JRI B;  3EC8 A;  5JHA A;  3DVN V;  3U30 A;  2FCS A;  2L0F A;  5AZF A;  2R2O A;  1YD8 U;  4BFR A;  2NBV B;  2KD0 A;  5G2N A;  4G0N B;  5DPT A;  2LAS A;  3RZW C;  2N7E A;  2KDI A;  4NNJ B;  2JUO A;  5CHV C;  1AAR A;  1M94 A;  2AWT A;  1E7V A;  2NBU A;  1E8Z A;  2IO0 B;  2IY0 B;  1C3T A;  2LZ6 A;  4FA6 A;  2BKR B;  1VCB A;  3OJ4 B;  3QHT A;  1ZKH A;  2KTF A;  4W9G A;  3U8Z A;  4CYE A;  2M4N A;  1L7Y A;  2PE9 A;  4WJP A;  2JPH A;  1E8W A;  4LJP B;  4XX5 A;  2KDF B;  1GNU A;  2NCN A;  4M8M A;  5DPW A;  1KLV A;  1D3Z A;  2KFJ A;  2KMC A;  3B1L X;  2ZVN A;  3EFU A;  2DHZ A;  2KNB A;  4ICV A;  4MEL A;  2FUH B;  4DBG A;  2M8S A;  4FJZ A;  1V80 A;  1V9J A;  3C0R B;  1WX7 A;  2MBE A;  2MRP A;  2AL3 A;  1TTN A;  3SDL C;  2IY1 B;  4TKN A;  4EZJ A;  3ONS A;  4WWO A;  2EKE C;  2IO3 B;  2MWS B;  3W1S A;  4ANV A;  2XBB C;  2ZCC A;  5C23 A;  2EMT A;  3JVZ X;  3KVF B;  4PYU A;  1J8C A;  2ZNV B;  3MTN B;  4IW0 A;  1X1M A;  3H7P B;  4XZ4 A;  2WX1 A;  5E6O A;  3A9J B;  3VTU A;  3KUC B;  1RRB A;  4KZC A;  1J0G A;  2Z0E B;  2XEW A;  1WGD A;  3H1U A;  3H7S A;  3DPD A;  3DDC B;  4P7I A;  3RUI B;  2D3G A;  3ZNH B;  3ZO5 B;  3TIX A;  1LQB A;  4W9E A;  3WAN A;  3OAW A;  2Z0D B;  2L8J A;  2L00 B;  2CHZ A;  1YIW A;  5KHQ A;  2N1W A;  3A4R A;  2LJ5 A;  2CU1 A;  2N9X A;  2KC1 A;  1EO6 A;  2AL6 A;  2AYO B;  4AUQ C;  3HHM A;  2MBQ A;  1LXD A;  3NZS A;  4WJQ A;  2BYE A;  4HK2 A;  3QC8 B;  4RMA A;  3ML9 A;  1KOT A;  1E7U A;  1WF9 A;  1WZ3 A;  2RR9 A;  4NQL B;  1NDD A;  4M8N A;  2KDE B;  3HK0 A;  2BGF A;  2EMS A;  2O2V A;  4NJ6 A;  4B95 A;  4NAW A;  3PRM B;  3HM3 A;  5AEK B;  1H8C A;  4TUU A;  4ANX A;  3PLV A;  3L08 A;  3PSE B;  3ZKJ C;  3PT2 B;  2NR2 A;  2LGD A;  3CSF A;  3PVL A;  1V6E A;  4II3 B;  4I6N B;  2N1V A;  3A4S C;  3OJ3 A;  5D2M B;  3ZLZ A;  3KH0 A;  3O65 B;  4GN1 A;  3A9K A;  2IYD B;  2M17 A;  2BPS A;  4A3P A;  1Z5S B;  3DVN U;  3N30 A;  3NOB A;  2L0T A;  3EHV A;  4KIK A;  2MQJ A;  3VH3 B;  3WA0 A;  4EFO A;  2O6V D;  2C9W B;  4MGI E;  4PS3 A;  3RT3 B;  1WMH A;  1WJ4 A;  2ZNV C;  2KVR A;  3DCG A;  3L17 A;  4EKU A;  1VD2 A;  2J0J A;  3QQ8 B;  4FJV B;  1WGH A;  2J7Q B;  3QX1 A;  4DWF A;  1EUV B;  1BT0 A;  3RZF A;  2FIF A;  1RLF A;  3NZU A;  4DK5 A;  2REX A;  2ZZP B;  2HD5 B;  2FNJ B;  4KVG B;  2YVC A;  4MDK E;  2HTH A;  2KK8 A;  3H6N A;  4G11 A;  2FCM A;  1SIF A;  2O2V B;  3NY5 A;  3ZTC A;  1V81 A;  4W9D A;  5KHO A;  4NAW B;  3L54 A;  4NPN A;  3UQA A;  4G50 A;  4IUM B;  4NQK E;  1P3Q U;  2LWP A;  2ZJD A;  3ECI A;  3MJW A;  4K81 A;  1J19 A;  3AU5 A;  3CST A;  1R4M I;  4GOC A;  3ZRF A;  5JHB A;  2O6V A;  3A9K B;  2RGF A;  2D07 B;  4E74 A;  5D94 A;  4GMV A;  1WY8 A;  3KYD D;  1LM8 B;  3CF6 E;  4DHJ D;  3BY4 B;  3QWZ B;  4CHK A;  2KJ6 A;  3DVG Y;  1YX6 B;  2LVO A;  4KIK B;  3W1S C;  4ZRK A;  1KM7 A;  2MLB A;  4W9L A;  4DHZ E;  1WMH B;  3UQB A;  2WDT B;  2WYQ A;  3PPA A;  1V5T A;  4F1S A;  2YLM A;  3DOW A;  3S2A A;  5GMV A;  5CX3 A;  3VHT C;  2MX2 A;  5J2R A;  3W1Y A;  1ZW7 A;  5TR5 A;  1I42 A;  4CO7 A;  1LFD A;  2QHO A;  2KO3 A;  3KUD B;  3TCA A;  2K39 A;  2N9P C;  3JSV A;  1YX5 B;  2GBM A;  3X23 A;  1WI0 A;  2FCN A;  4K7U A;  4W9C A;  4JGH B;  4ANW A;  4K7W A;  3DQV A;  4HCN B;  4I6P A;  1C1Y B;  3RD2 A;  5JZE B;  3OLM D;  4TQ0 A;  5IA7 A;  3TBL D;  2MBO A;  2JY6 A;  4WAA A;  4MJS A;  2L7R A;  1TZ1 A;  2PJH A;  3WAP A;  1UBI A;  2O6V B;  1SE9 A;  1XT9 B;  4KSK C;  2NS5 A;  2C7H A;  1WZ0 A;  2D10 A;  3JYU A;  1WR1 A;  4FN2 A;  1GUA B;  3ZUN A;  1MG8 A;  2K25 A;  2LUE A;  3VDZ A;  2CS4 A;  1L2N A;  2B3A A;  4ZRJ A;  2FCQ A;  4WJO A;  4BKS D;  2CHX A;  1WXV A;  2D11 A;  1GC7 A;  1OTR B;  1WR6 E;  3QAR A;  4NJ7 A;  2LI5 A;  3UGB B;  5LLI A;  2BWF A;  2NBW B;  1JRU A;  3ZVV A;  4IM3 A;  3SD5 A;  3QJZ A;  1E8Y A;  4BVU C;  3JW0 X;  2IBI B;  2OJR A;  2FID A;  2OOB B;  4HJK A;  3JSV B;  1TGZ B;  1WXA A;  3ZNI D;  3V6E B;  2G4S A;  4LDT B;  5D7G A;  1WGY A;  2LRW A;  4DDG D;  5CHW A;  2JWZ A;  1U4A A;  2K8B A;  3NS8 A;  1E5W A;  2DYO A;  4KZ0 A;  2DYM A;  1WJ6 A;  2KN5 A;  2KZR A;  2BWE S;  4FLH A;  4MJS B;  5DPR A;  4DHJ B;  2KLC A;  3UIO B;  2MSE D;  3KW5 B;  1YQB A;  4FJY A;  2LVP A;  4W9H A;  1Q1O A;  1KJT A;  4BKS A;  3AXC A;  4OVU A;  4F7Z A;  2JRH A;  1V49 A;  2W9N A;  2WWZ A;  5D6J B;  4ZRI A;  1PQS A;  2K1F A;  1WYW B;  2KC2 A;  2G3Q B;  3RYT A;  5C1Z A;  2N4F A;  1NBF C;  5AZG A;  1UGM A;  2J0M A;  1OQY A;  3PRZ A;  1A5R A;  2N7D A;  4MEM A;  5G55 A;  2FAZ A;  2KX0 A;  2KX3 A;  2RSU A;  5EDS A;  3PZD A;  1Y8R C;  3B0A A;  4W9F A;  3M95 A;  2KQ7 A;  2VRR B;  1WX9 A;  4IM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...