4W9EA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 4)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9eA00
2IO2B 2KD0A 3APCA 2KFJA 3A9KA 4W9JA 3KH0A 1WR1A 1OQYA 4ZRKA 3ML8A 4EZLA 2DZMA 1WMHA 2N4FA 3GOEA 1LFDA 4KSLC 2JXXA 2IYDB 3NZUA 2KN5A 4GDKB 4LDTD 2VRRB 3ZUNA 2KZRA 4HPLB 3ZW3A 3H7PB 2ZNVB 3A9KB 1OTRB 4GGQA 2KTRB 3EC8A 1UGMA 4W9HA 4DHJD 4P7IA 2IY1B 4RM9A 3NOBA 1WXAA 3JSVA 1WJNA 2V4LA 1WZ3A 2D3GA 2G4SA 1CMXB 2Z0EB 3HM3A 3VUXA 3DPDA 3DVNU 2L0FA 5DPRA 3Q3JA 3JSVB 3AU5A 5AEKB 3N3KB 4WWNA 4WJNA 3IVFA 2UYZB 4TV3A 3NZSA 4W9GA 3M63B 2L3ZA 2ZNVC 2L00B 2V1YA 3H1UA 4G11A 2LI5A 2DAJA 2N9XA 2JWZA 3HK0A 4OVVA 4PS3A 4DXAB 1WX8A 2BKRB 2C60A 2L76A 2UWQA 4HDOA 3KUCB 1NBFC 3QQ8B 2PPHA 1UD7A 4LDTB 2J0JA 4HCPB 3APFA 3QC8B 2BWFA 3CF6E 3A4RA 1WE6A 2KLGA 5IAAC 3GZNI 3RD2A 3T9LA 3V61A 3QIJA 3RYTA 4NPNA 1YQBA 1WIAA 4RM8A 4EZKA 3PHXB 2JF5A 1WI0A 4GIVA 3EHVA 4ZDVA 3N30A 3NY5A 4IWPA 5KHQA 3PPAA 3VTUA 3X23A 4A20A 2KK8A 3WAPA 3AI5A 3AU4A 2C5LC 1X1MA 4NAWA 2KWCA 3DBSA 2LVQA 4LJOB 4E71A 3WIMA 2DYBA 2WYQA 4B9KA 1R4NI 1RLFA 2FCNA 1M94A 2IO3B 2OOBB 2LGDA 2PE6B 5G2NA 3WAMA 4GDLB 4KV2A 2Z0DB 4MGYE 4ANUA 2DYOA 2KWVB 1YJ1A 2RPQA 4MSQB 4N9F4 4AJYB 4E3CA 5JZEB 4FADA 3C0RB 4BBNF 1WY8A 1P0RA 3ECIA 3CSFA 4NY0A 4AUQC 1WJUA 4WQOB 1WM2A 1S3SG 4G3XB 2KDIA 1E8XA 3VHTC 1WH3A 1LM8B 2AWTA 4AJWA 3KYDD 2KDFB 1H4RA 4G50A 4IWOA 2LD9A 2WWZA 2O2VA 5TR5A 1E8YA 3QK0A 4FN2A 3MTNB 3L54A 4G0NB 5G55A 4WJQA 3VTWA 4X57B 5DCNA 4MH0E 5AZFA 2LJ5A 1LXDA 2DHZA 3L0WB 3A33B 3PZDA 1IPGA 2GBMA 3PRZA 4KIKB 5IA7A 1WM3A 2G3QB 2JZ3B 1P1AA 3QAQA 5D2MB 3WAOA 1A5RA 3ZDMC 2KO3A 4GXBA 2DENB 4GDKA 2J7QB 1J8CA 2NBWB 4KDLB 1E7UA 3VXWA 1XT9B 2XK5A 2AYOB 1WJ4A 4AOFA 2EKEC 3PRPB 4XX5A 3ZO5B 4ANWA 3SD5A 2ZZPB 3WANA 3A4SC 3APDA 3BY4B 4BBNC 1PQSA 4MJSA 1WGDA 3RZWC 2NPTB 5JH5C 2MP2A 3KW5B 3W1SC 3W1SA 3DVGY 4HCNB 4IM3A 1UZXB 4BKSD 2NR2A 1WGHA 3UF8A 5FR6A 4MGKE 2HTHA 2JZZA 3KUZA 4K1RB 1NI2A 1VD2A 2DZKA 2IBIB 2KX3A 5C1ZA 1ISNA 4F7ZA 4II3B 2JT4B 5L83A 3RCZA 2D2QA 4HXDA 3JW0X 5EDSA 2IO0B 3U7DA 4EKUA 2NVUI 3QHTA 2KDEB 2LUEA 4RMAA 2WX0A 3NHEB 3IBEA 2I1JA 5C23A 1QZEA 4AP4C 2YLMA 3DBRI 3SHQA 1K8RB 4DHZB 2FNJB 1FXTB 4MJSB 3TBLD 3U30A 3VUWA 2FIDA 4WWOA 4ANVA 2G4DB 1ZW7A 3ONSA 2GBKA 3H7PA 4WJOA 1U4AA 2MBBB 2K6DB 2XBBC 2WX1A 3IG3A 2V3SA 3ZRCA 2KJRA 2KHWB 2LGYA 4DHJB 4I6PA 1V5OA 1XQQA 2IO1B 1TZ1A 2XK5B 4MSMB 3PGEA 3VUYA 1WYWB 4ZRIA 3RUIB 5LXIB 2PE9A 3HIZA 3ZIMA 2LWPA 2FCSA 1EUVB 1SE9A 5JHBA 2K8BA 4MGZE 1NDDA 3PS6A 2MBQA 1V80A 3R7QA 2CS4A 4BVUC 1WX9A 2BPSA 2MCNB 5J17A 1WGRA 5E6NA 3OLMD 3ZVVA 1E8WA 3VVWB 3JYUA 1WGGA 1WXMA 4W9FA 2KQSA 5CHVC 4I6LB 3U8ZA 5D7GA 3QWZB 3ZNGC 4ASWC 2GBNA 4GN1A 2LVOA 3WALA 2CKHB 2KJHB 3PVLA 3X0WA 2G45B 2DZJA 2B3AA 3PV1A 4HJKA 2MBHA 3ZRFA 1D3ZA 3M95A 3PT2B 3PLUA 4FLHA 4HLEA 2O2VB 4IM0A 2CHWA 1Q1OA 2D07B 2N7DA 3KVFB 3ML9A 3OAWA 4PS7A 2W9NA 4NJ6A 1WZ0A 4CHKA 2L05A 4BOZB 2M17A 2AL3A 3RZFA 1C1YB 4CYEA 4LJPB 1RRBA 2CU1A 5CTRC 2BYFA 2N1VA 2NBVB 3DVNV 4GMVA 2NPTA 4K81A 2GMIC 4FHKA 5DPWA 1E5WA 1Z2MA 3PLVA 3T8MA 2RGFA 4EEWA 4IC7B 4EFOA 4PYUA 3DCGA 1WR6E 1VCBA 2BF8B 4MELA 1TBEA 1T0YA 3EFUA 4WJPA 1WXSA 1OEYA 1UBQA 2KC2A 4K7SA 4HDQA 1EO6A 1ZGUB 4TKNA 2KFKA 2AL6A 2MX2A 4B95A 2CHXA 3DVGX 2LZ6A 4ICVA 2KC1A 3KYCD 4BKGA 2MQJA 4NQKE 3PHWB 1KOTA 2GBRA 4KIKA 2R2OA 2C9WB 2ZCCA 2M8SA 1V9JA 2MBEA 3OJ3A 2LXAA 1GG3A 1E90A 4ZYNA 3UIPB 4DHZE 1GC7A 2JVCA 2LASA 1KLVA 1YX5B 2KTRA 3BINA 3LDZE 2JY6A 4NQLB 4W9EA 2XEWA 3UQBA 1WX7A 4HWIB 4NAWB 3VQIA 2KANA 1KJTA 3VTVA 4HPMB 1WE7A 2KFKB 3CSTA 2FCMA 2QHOA 4FJVB 1C3TA 2GOWA 1KM7A 1J19A 3DBHI 2C7NB 4W9CA 4EUTA 3CMMB 3ZNZB 2PEAA 4GDLA 1JRUA 3TCAA 4DBGA 2C7MB 3M3JA 4XC2A 5J2RA 4A3PA 2M1MA 3D32A 2HJ8A 1I35A 4ZRJA 2J0KA 2LRWA 2MRPA 3JVZX 1Y8RC 3A9JB 4F1SA 2NS5A 3V62A 3V6EB 3R7RA 4BOSC 4PS8A 2MBOA 4TUUA 5AZHA 2JRHA 2BYEA 1P9DU 1IP9A 4GB9A 3V6CB 2AEHA 1V2YA 2KVRA 4DDGD 1WMHB 1R4MI 2D10A 2HE7A 3VH4B 3AULA 4JGHB 1TGZB 4HVBA 1WGYA 2MA9B 2YVCA 2L0TA 4IG7B 2KXJA 2RD0A 3S2AA 2ZPNA 3QARA 1ZKHA 3SDLC 1XD3B 2DYMA 2C7HA 2KLCA 3PREA 4JQWC 3ZTDA 3ALBA 2I1KA 3UINB 4EOYA 3ZNID 5D6JB 2HD5B 2M0XA 3P2BA 2J0MA 3A9JA 2MP2B 2ZVNA 3K9OB 3VAWA 4E74A 3ZDTA 2KKCA 4FJYA 2CHZA 2FUHB 2BKFA 2Z59B 2K8HA 2EMTA 3H7SA 3PSEB 1WJ6A 4JLCA 3QCAA 5CHFA 2KMCA 1F9JA 2LVPA 2N1WA 3W1YA 3DQVA 1P98A 3RT3B 2MSED 3L13A 4MGIE 2LGXA 4FHJA 2KTFA 2GBJA 2K39A 3ZTCA 4IUMB 2KNBA 4W9KA 4II2B 4BKTA 4XZ4A 2O6VA 1YX6B 3LJ3A 5JHAA 3KUDB 1Q0WB 4TQ0A 2BWES 2WDTB 3VH3B 5LXHA 1L2NA 4MM3A 2PJHA 3SU8X 4K7WA 4GOCA 2EMSA 2M4NA 2REXA 3TMPB 2L7RA 4GU2A 4A3OA 4MDKE 2IZVB 2ZVOA 3TIXA 2BGFA 4BKSA 1V81A 1H8CA 1OGWA 3PRMB 2R2QA 1WRDB 5BO4B 2FAZA 4DWFA 3VDZA 1UH6A 2IY0B 4IM2A 1S1QB 3Q3FA 2A4ZA 3L17A 1YIWA 3V60A 3K9PB 2JUOA 4LCDE 5E6PA 2N9PC 3EECA 5D94A 2ZJDA 3L08A 1IYFA 4KSKC 2BYVE 2K8CA 3QJZA 4AWJA 3TL5A 4KVGB 1RAXA 4M8NA 4OVUA 3MJWA 2NCNA 2KX0A 2LRUA 1V6EA 1WF9A 2MLBA 4KDIC 2K25A 4FULA 3WA0A 3RULA 5J18A 1WFYA 1G6JA 2O6VD 2N7EA 2RSUA 4JL9A 2NBUA 4YL8A 4FA6A 2LXCA 2RR9A 4DK5A 1RFAA 3IHPC 4FBJB 4MEMA 5KHOA 4ICUA 4CO7A 4M8MA 2OJRA 2JRIB 2Y5BB 4GSWA 1SIFA 3ZNHB 2KQ7A 3I3TB 1Q5WB 3UGBB 2FCQA 5E6OA 2ZEQA 1BT0A 5DPSA 1UBIA 1AARA 4W9IA 3DBLI 5CX3A 1E8ZA 3ZLZA 1YD8U 5L95C 1GJZA 1OEYJ 4IW0A 3A1QB 3B0AA 4JIOU 4URKA 1GUAB 2K6QA 2N9EB 4IWQA 4W9DA 1J0GA 2ZPYA 1V49A 2A5UA 2O6VB 2MWSB 1MG8A 4I6NB 3UIOB 4TQ1A 1GNUA 3M62B 4J6IA 1Z5SB 3A1QA 2DAFA 5DPTA 3MHSD 3IFWB 2JPHA 1E7VA 1V86A 1HE8A 2DX5B 4NJ7A 4B6WA 3DDCB 3ENEA 2MW5A 1V5TA 4DDID 4K7UA 2KOXA 4WWPA 3AXCA 4EZJA 2CR5A 3H9DA 5AZGA 3R66C 1L7YA 4HK2A 5GMVA 3QX1A 3B1LX 2KMAA 4KZCA 2D11A 4KZ0A 1WXVA 2KJ6A 2ZCBA 3NS8A 3R3MA 3QA8A 5HKHA 3VFKA 1GC6A 1LQBA 4ANXA 4PYZA 1UELA 5LLIA 1EF5A 5CHWA 3OJ4B 1EF1A 3DOWA 3TJPA 1P3QU 3HM6X 3L16A 3UQAA 2DZIA 3PTFC 2K1FA 4W9LA 2FIFA 3B08A 3N32A 4NNJB 3ZKJC 1I42A 3HHMA 3O65B 3L10B 4M0WB 2ASQA 2KWUB 2L8JA 4F8CB 4BFRA 4WAAA 3H6NA 1SGHA 2KDBA 4FJZA 1TTNA
chains in the Genus database with same CATH superfamily
2RDHA 3V3XA 4AS1A 3KH0A 1WR1A 3GOEA 1LFDA 2VZKB 3AE2B 3RN9C 3NZUA 4GDKB 2VRRB 1ZPSA 3ZW3A 3H7PB 3A9KB 4DHJD 1UGMA 4RM9A 3E56A 1F52A 3VUXA 3DVNU 4AQ7A 5DPRA 3ZJUA 4WJNA 2N9KA 3NZSA 4BAXA 2L3ZA 3HK0A 2LUMA 2N9XA 2JWZA 3RNAC 4DXAB 1WX8A 2BKRB 2QMTA 1NBFC 2J0JA 3APFA 2BWFA 3CF6E 1Q10A 3T9LA 1WSPA 3GZNI 3L4PA 3RD2A 4CQNA 4EZKA 3EHVA 3N30A 2WHIA 4A20A 3WAPA 4NAWA 1X1MA 3DBSA 2DBYA 2LVQA 4KX6B 4IKGA 2GB1A 1FMAD 1R4NI 2FCNA 3Q8FA 4HEA1 2LMCA 2LEKA 1YQ3B 1OFFA 4KV2A 1P7EA 2RPQA 4AJYB 2J53A 1AYFA 1WY8A 2K22A 2I38A 2PVOD 4NY0A 4WQOB 1LM8B 4AJWA 2CU3A 2I2YA 3PZDA 1IPGA 4ZRPA 4PK1A 2L83A 3CIRB 4O1NA 1V1PA 1J7CA 2RPVA 2NBWB 4ANWA 4RF1A 3SD5A 3BY4B 3Q8CA 1DYQA 2WLBA 4MJSA 3W1SC 2BQQA 1UNSA 3AEEB 1FCLA 1PDXA 1F2RI 4MGKE 5FR6A 1NI3A 4K1RB 4YXDB 4GLSC 1NI2A 1VD2A 2DZKA 2KX3A 1C76A 3TUOA 2G1EA 2D2QA 1GB4A 3QHTA 1D4BA 2Q5WD 2WX0A 2BW2A 4AP4C 4DHZB 1K8RB 2FNJB 3TBLD 4LK0M 2FIDA 1ZW7A 2GBKA 3BIID 1VZ6A 4S0RA 1U4AA 2K6DB 1KLGD 2V3SA 1I4PA 4KGRA 4S17A 1V5OA 1TZ1A 2QJLA 1XO3A 1YN4A 4ZRIA 1T6BX 1NEKB 1E0ZA 3T3OA 2MBQA 2KQ4X 2WXQA 1VJKA 2BPSA 2MHJA 4LNNA 3JYUA 4W9FA 3U8ZA 3ZXRA 4I6LB 1DOXA 2BS4B 5D7GA 3ZNGC 4ASWC 2GBNA 4XWTA 2LVOA 3PZ8A 4M00A 2KJHB 1TY2A 1M4VA 2G45B 1CK1A 1HQRD 4N59A 4HLEA 2O2VB 3KVFB 3ML9A 1BUIC 1WGKA 3I5JC 4NJ6A 1WZ0A 4BOZB 2M17A 4M0WA 1C1YB 3I63C 2HTME 2N1VA 4OZBA 4K81A 4OZCA 3IT6B 1Z2MA 4EEWA 4IC7B 4PYUA 4MELA 3EFUA 1T0YA 4YWGG 4PT5A 1UBQA 2KC2A 4K7SA 2KFKA 2CHXA 3DVGX 3R2IA 2MQJA 3PHWB 2R2OA 1JRPA 1V9JA 2BBCA 1FD6A 2RDBC 3EA6A 1J7AA 3UIPB 1BMLC 3GZNB 2JVCA 1KLVA 1YX5B 4ZHPA 2JY6A 4NQLB 2KANA 1KJTA 1C3TA 1J19A 3DBHI 4GDLA 1ZP0B 4XC2A 3JVZX 3HUIA 3MHZA 4BOSC 2J52A 4YTNB 1P9DU 2K0PA 4MACA 1WGYA 4DXGA 2MA9B 2WXKA 1PFDA 1F1HA 2KXJA 4JQWC 3ALBA 3C8YA 4EOYA 3VAWA 2ZVNA 1WYGA 2Z59B 1AW7A 1WJ6A 3DBHB 4IOIE 3W1YA 3RT3B 3L13A 4BZAA 2QDFA 2GBJA 2K39A 3ZTCA 2KNBA 1KTKA 4BKTA 1YX6B 1TS4A 2PTLA 2WDTB 3RNFC 4GOCA 2JYTA 3IXSA 2L7RA 4A3OA 4JE3B 2PMVA 5HFYA 5BO4B 1D5ZC 2FAZA 3N20C 5C2TB 2KVZA 2BB6A 4C4VB 3K9PB 5E6PA 1UGJA 1IYFA 1V8CA 4KVGB 2NCNA 2KX0A 4M02A 4KDIC 4N6EB 2WNMA 3RULA 2WXMA 1G6JA 2O6VD 3N1YC 1TYGB 1QF6A 4JL9A 5I4DA 2NBUA 4FA6A 2LXCA 4DK5A 3GE8C 1VZ7A 4MEMA 5AUIA 4GSWA 3UGBB 5E6OA 5LNK1 3MFGA 1AARA 1E8ZA 5L95C 1GJZA 4IW0A 4USAA 3A1QB 3NUHB 2KWDA 2LHDA 1GUAB 2RDGA 1F0ZA 1RWSA 1TIFA 2WXPA 2MWSB 1MG8A 2FE8A 3UIOB 1GNUA 3M62B 2PLPA 1QOGA 1SXTA 1Z5SB 3KWLA 1FNVA 1I7HA 2DAFA 3RNBC 4JX1C 1OQRA 4MT5A 4B6WA 4K7UA 3SEBA 2KOXA 4WWPA 1VRAB 4EZJA 4P1CC 2H88B 3R66C 4KZCA 1STEA 1EU3A 3GE3C 2QC8A 3ZJVA 1EF1A 1DOYA 1N62A 1L0YB 1P3QU 3L16A 1YN3A 1ENFA 4NNJB 3L10B 4M0WB 2ASQA 3HRDD 1SIJA 1UUPA 2IO2B 1Y56A 2DZMA 3LB8C 5EE9A 3VR8B 1YJJA 2Z8LA 5G5GA 1KF6B 1N60A 1PYWD 2KTRB 3EC8A 2IY1B 1FCCC 3NOBA 1WXAA 2K5PA 3JSVA 1WJNA 2V4LA 3O13A 1LO5D 4A6QA 3DPDA 2V4IB 2L0FA 2W3SA 3EUB2 3JSVB 1XLNA 3AU5A 5AEKB 4WWNA 2UYZB 4W9GA 5BMIA 4G11A 5IP4D 1MJDA 4PS3A 2C60A 3KUCB 2BB5A 1UD7A 3QC8B 2JQRB 2KLGA 5IAAC 3QIJA 2W3RA 1WIAA 1EU4A 3PHXB 4ZDVA 3NY5A 5TSSA 3PPAA 2KK8A 3AU4A 4E71A 3WIMA 4ARIA 2DYBA 2WYQA 2MH7A 3ZYYX 1M94A 2BTEA 4HKZE 3EGRA 2LGDA 1QQRA 3WAMA 2INDC 2Z0DB 1SBBB 2KWVB 4MSQB 1YJ1A 4N9F4 5JZEB 4HRSA 4FADA 3ECIA 3CSFA 5IKCM 1WJUA 2CJOA 1ESFA 1WH3A 2WXLA 3KYDD 4G50A 3NS1A 2O2VA 3QK0A 4FN2A 3MTNB 4HROA 4X57B 5DCNA 5AZFA 1LXDA 4UDUC 4HJGE 1QILA 3V05A 2G3QB 2JZ3B 1P1AA 3QAQA 3WAOA 1A5RA 3ZDMC 3VXWA 2XK5A 2WGSA 3Q8BA 3WANA 1HEZE 4BBNC 2OEDA 1WGDA 2NPTB 5T8IA 4HCNB 2NR2A 1WGHA 2JZZA 3KUZA 3N9YC 3W5UB 4KKIA 2IBIB 4F7ZA 3RCZA 2IO0B 3U7DA 4EKUA 2NVUI 2LUEA 5EE1A 3IBEA 1WWTA 1YNTE 4XYCA 2XN9C 3P4QB 4MJSB 2JZPA 3DHIC 3ONSA 3H7PA 2UU7A 4ARCA 2MBBB 4US9A 2XBBC 3IG3A 3ZRCA 2L1AA 3AEBB 2LGYA 2KHWB 4DHJB 1PUTA 4I6PA 4MM3B 2IO1B 3TEZA 4MSMB 3N1XC 3PGEA 5LXIB 3HIZA 1FXAA 2FCSA 1EUVB 5H8YE 3MP9A 4MGZE 3HVDA 5BYRA 1WX9A 1NVID 2EELA 3ZVVA 3IAS1 1D5XC 3VVWB 1WGGA 1WXMA 3AE8B 5CHVC 2G9HD 1V1OA 2QILA 4GN1A 2CKHB 3N1ZC 3BWUD 3X0WA 1E7PB 1D3ZA 2ICIA 2LJIA 3PT2B 3PLUA 3GB1A 4RGTA 2D07B 2M0AA 1MHXA 1JWAD 1SJED 1ZXIA 2X38A 1R4MB 2L05A 1TKGA 2IGGA 3RZFA 2CU1A 3EFCA 2NBVB 4GMVA 2GMIC 4FHKA 1E5WA 1I4GA 2RGFA 3DCGA 1FIQA 4WJPA 5AUKA 2MJDA 2WDQB 1YN5A 4TKNA 4B95A 2KC1A 4NQKE 1MPEA 5C3JB 2GBRA 2Y3AA 2M8SA 4A8XC 1IGCA 4LNIA 5EE3A 3RNEC 2JWUA 1UWXA 4ZYNA 1L6VA 3RNGC 1GC7A 2LASA 1JMLA 2KTRA 3BINA 2BYTA 1MHHE 4W9EA 2XEWA 2LGSA 1WX7A 2OHFA 4OW0A 3NVZA 4NAWB 3VQIA 1B1ZA 4HPMB 1WE7A 3PZ7A 3DHHC 1E6EB 1I4QA 3AV8A 3NRZA 2C7NB 2C7MB 3M3JA 2HJ8A 4B0EA 1P7FA 3ZQ4A 2MRPA 3CWIA 1Y8RC 3A9JB 4F1SA 2HDEA 1K53A 1IP9A 1JROA 3V6CB 2AEHA 1V2YA 1CQVA 1R4MI 4JGHB 2WXGA 2YVCA 3BYTB 3TEYA 1ZDXA 3MC9A 3PREA 3AEDB 4D2KA 1IBXA 2MP2B 3K9OB 4OHJA 2KKCA 4US8A 4FJYA 2CHZA 1F77A 2FUHB 2K8HA 3UI3A 3PSEB 1RM6C 3QCAA 3P42A 4LNFA 2WXOA 2N1WA 1P98A 4MGIE 4IUMB 2K9XA 4XZ4A 2V3PA 4XDDA 3KUDB 1Q0WB 2IGHA 4XDCA 1XLOA 2M4NA 3TMPB 3C19A 4MDKE 2VH2A 2IZVB 2LGIA 5BYSA 3TIXA 2GRIA 2RMMA 1WRDB 1NYRA 1UH6A 2BS3B 5BYQA 3Q3FA 1L4ZB 4LCDE 3BK2A 3EECA 2AQ1B 4C7ZA 1FFUA 2JYEA 3QJZA 1B9RA 3TL5A 4M8NA 2L32A 4FXCA 2MLBA 2K25A 4NJCA 2RR9A 3DHGC 1V1PB 3IHPC 5KHOA 4ICUA 4M8MA 2OJRA 1KRHA 3BVMA 1SIFA 2KQ7A 1L5PA 1BT0A 5DPSA 3GS2A 1UBIA 4W9IA 3DBLI 1L6UA 1YOVB 1J0GA 2N9EB 4IWQA 1IUEA 3E9SA 2WXJA 1UWMA 4J6IA 3MHSD 3AEFB 1WXQA 1E7VA 2BVCA 2DX5B 2E6XA 2MW5A 3BVGA 2WXNA 2CR5A 5AZGA 2NMQA 5GMVA 3RI7C 3QX1A 3Q8EA 3R3MA 3AN1A 2DNFA 4ANXA 4PYZA 1UELA 5D3IB 5LLIA 5CHWA 3DOWA 3HM6X 3UQAA 3AE6B 1K50A 2K1FA 2FIFA 4RGMA 4RH6A 4BFRA 3I9V1 2E3TA 3B2FA 1T0SC 3MC8A 4FJZA 1TTNA 1E9MA 2KD0A 3A9KA 4W9JA 3U2SC 1HXYD 1OQYA 3AH7A 3ML8A 4EZLA 2N4FA 3ABVB 4KSLC 3IT4B 2JXXA 2KN5A 3Q14C 4HPLB 2ZNVB 1OTRB 4W9HA 2KN4A 2D3GA 2QSDA 2G4SA 3AE5B 3HM3A 4RGOS 3AE9B 1T0RC 3IAM1 2SEBD 3Q3JA 1ZDVA 3AM9A 3B2GA 1R4NB 1EM7A 3IVFA 4TV3A 3M63B 3VRAB 2IGDA 2DAJA 2LI5A 4OVVA 2UWQA 3BYYB 3FILB 2D3AA 1MI0A 4HCPB 3A4RA 3RYTA 4NPNA 1YQBA 2W54A 4RM8A 3NJTA 2JF5A 1N5WA 1WI0A 3FILA 4IWPA 2INNE 3VTUA 4A90A 5KHQA 1T3QA 2C5LC 2KWCA 1SF0A 4LJOB 3Q2AC 4B9KA 1RLFA 2IO3B 2MJ3A 4E3CA 1RFKA 4MH8A 4BBNF 1UF0A 1XCQL 3RNCC 1S3SG 1TS5A 2VZKD 1YJIA 2KDFB 4IWOA 1SJHD 1E8YA 3L54A 5G55A 1ZUD2 1DGJA 4MH0E 2LJ5A 4C7YA 3L0WB 3A33B 3PRZA 4KIKB 1WM3A 2JSVX 1QKZA 2KO3A 2X8XX 2J7QB 4KDLB 1E7UA 4QAYA 1XT9B 2AYOB 2EKEC 4P6VF 3PRPB 4XX5A 3ZO5B 5IOIA 2ZZPB 3A4SC 1JQ4A 1ZOYB 1I4RA 1FXIA 3J9CA 1QOFA 3W1SA 4IM3A 4BKSD 3UF8A 3GP7A 4WWMA 5C1ZA 1ISNA 2JT4B 3R2TA 5EDSA 5IO9A 2LHEA 2XNAC 4N58A 4J3OD 3NHEB 3DBRB 1QZEA 2OJWA 2V9HA 2YLMA 3DBRI 3KLSX 2QIEB 3SHQA 1FXTB 3VUWA 2YEPF 4RCOA 1R7SA 4WWOA 4ANVA 2G4DB 3AB5A 2ACZB 2WX1A 1GPXA 1XEEA 2PW9A 3Q3OC 1DOIA 2KJRA 2AX5A 1XQQA 1RYJA 2XK5B 1OQQA 2LWPA 1SE9A 2KDMA 2K8BA 3PS6A 2WXFA 1V80A 2CS4A 4BVUC 4XGAB 1E8WA 1C78A 2KQSA 3VR9B 4TSSA 1JCKB 1SE3A 1QT9A 3Q69A 4NAMA 2R61A 3W9CB 2GLSA 2DZJA 4HJKA 2MBHA 3ZRFA 4RFBA 4FLHA 1I4XA 4IM0A 2BS2B 2CHWA 1Q1OA 4PS7A 4YSXB 2W9NA 4M01A 2DWQA 2AL3A 5H92C 4CYEA 1TS3A 1RRBA 4LJPB 5CTRC 3DVNV 4WAFA 2NPTA 4IDIA 4WQMA 1JWSD 3PLVA 3WCQA 4Q2JA 3T8MA 3P4SB 4EFOA 4RNAA 1WR6E 1VCBA 2BF8B 1NENB 1FM0D 4HDQA 3R8BA 1SE4A 2MX2A 1KOTA 4KIKA 2K3UA 2C9WB 2FBWB 1EWYC 3U7ZA 2LXAA 3AECB 4HPPA 1GG3A 1E90A 5IN7A 2WS3B 1SEBD 3LDZE 2WXIA 4L2YA 2ZW1A 4FJVB 2GOWA 5BMGA 2SAKA 4W9CA 5HHDG 3CMMB 2PEAA 3TCAA 1JWBD 3NZ3A 1I35A 4ZRJA 2J0KA 2LRWA 3V62A 3V6EB 3R7RA 4NZLB 2JRHA 3AEGB 2INCC 1AWDA 1NYQA 1J7BA 1TKEA 4DDGD 1WMHB 2HE7A 3TEXA 3AULA 1TGZB 2WXHA 4HVBA 3AEAB 1HTQA 3P1MA 2L0TA 4IG7B 1CZPA 3S2AA 3AE4B 2BT6A 2KLCA 1HZ6A 3ZTDA 2CJNA 3UINB 1T0QC 1ZXHA 3ZNID 5D6JB 2HD5B 2J0MA 3A9JA 4E74A 3OG5A 1JW9D 1VDVA 1C9FA 2EMTA 3H7SA 4JLCA 5EE0A 4LTUA 1I4HA 4C00A 4II2B 2O6VA 3LJ3A 2PKOA 2AQ3B 1MVKA 1L2NA 2PJHA 2EMSA 1IBXB 2V0GA 4JWSC 4GU2A 3LYYA 2W82A 2BGFA 4BKSA 1V81A 1H8CA 1OGWA 2R2QA 3AE7B 3VDZA 1HZ5A 2L52A 5JXVA 3L17A 3V60A 2FUG1 2N9PC 5D94A 3L08A 4KSKC 2K8CA 4HKQA 4LNKA 3AE1B 1K51A 2LRUA 1V6EA 1WF9A 2QCZA 2IPKD 2PIAA 3FC4A 1FNUA 3PO0A 2N7EA 4C80A 4YL8A 2Y5BB 1XF5L 3ZNHB 3BK1A 4R3DA 2FCQA 2ZEQA 4ZHOA 5CX3A 3AMZA 2N9LA 2TSSA 1YD8U 3U4EG 1OEYJ 4JIOU 4URKA 3HVZA 2K6QA 3BVZA 3URYA 1HA5A 1V49A 2O6VB 3RMKC 4I6NB 4ZYSA 1YQ4B 2J42A 1VLBA 3A1QA 5HG2A 2JPHA 1KLUD 1V86A 1HE8A 4NJ7A 1F2RC 3ENEA 1V5TA 2KACA 3AXCA 4WH4A 3TEWA 2M56B 4ZOHC 1L7YA 3DWGC 1V97A 3B1LX 2D11A 2WU2B 1WXVA 2KJ6A 2ZCBA 3NS8A 3VFKA 1GC6A 2MJEA 2WQYB 1BXTA 1E10A 3PTFC 4W9LA 1QLBB 1JALA 3B08A 4LNOA 1I42A 3HHMA 4F8CB 3SR6A 4WAAA 1T5XD 4ZRQA 3H6NA 3APCA 4B0MA 2KFJA 4DQOC 4OZAA 4ZRKA 1TKYA 1WMHA 3ZJTA 2IYDB 3NVWA 4LDTD 4YTMB 3ZUNA 2KZRA 4GGQA 4P7IA 1N5XA 1WZ3A 1CMXB 2Z0EB 4LLGM 1MFWA 3LXFA 3N3KB 1YMHE 2ZNVC 3H1UA 2L00B 2V1YA 2IDYA 2L76A 4HDOA 3QQ8B 3MC0B 1ET6A 2PPHA 1A70A 4LDTB 1FRDA 3FKYA 1WE6A 3V61A 4L1BA 1FRRA 4GIVA 3X23A 3AI5A 5BMHA 1CJEA 2ON8A 2OOBB 2MEKA 3SFEB 2PE6B 4JWUC 5G2NA 4GDLB 2KYWA 4MGYE 4ANUA 2DYOA 1PGBA 2YEPB 3P4RB 3C0RB 1P0RA 4YSZB 1C77A 4AUQC 3AE3B 1WM2A 4G3XB 2KDIA 1E8XA 1QOAA 2EKIA 3VHTC 2AWTA 1H4RA 1TZOA 2LD9A 2WWZA 1C4CA 5TR5A 4G0NB 1LGRA 3VRBB 4WJQA 3Q3NC 3VTWA 2VH1A 3W5VB 2DHZA 5IA7A 2GBMA 1D6EC 2WXRA 5D2MB 2JXTA 3Q8AA 4GXBA 2DENB 4GDKA 1J8CA 1FO4A 1WJ4A 1FFVA 4AOFA 4KGTA 4ITKA 1KFYB 3APDA 4KGSA 1HTOA 1PQSA 5FK9C 3RZWC 2INPE 1EWCA 4K3CA 5JH5C 2MP2A 3KW5B 1FEHA 3DVGY 1UZXB 2N0SB 2H89B 1PGXA 2HTHA 4RGNA 4II3B 5L83A 4HXDA 3Q6BA 1WRIA 3JW0X 3RPFC 2KDEB 4RMAA 4C56C 1GOZA 2I1JA 5C23A 3BZDB 3U30A 2KMMA 1TY0A 4WJOA 4DXFA 2DLBA 1IGDA 2JU6X 2PVGC 3VUYA 1WYWB 3RUIB 5D3DA 2PE9A 4JPSA 3ZIMA 5JHBA 2D3BA 2WDVB 1NDDA 2ZW0A 3R7QA 3FAHA 2GI9A 5J17A 1TS2A 4WIPA 2MCNB 1WGRA 5E6NA 3OLMD 3NG0A 3OWEB 3QWZB 3WALA 3PVLA 3DBLB 2B3AA 3PV1A 4YSYB 3M95A 2IJ0A 2N7DA 3OAWA 1TJEA 4OVZA 2B76B 4XE0A 1SB3C 4CHKA 2KAJA 2JX5A 4EE2A 2NTSA 2BYFA 1L4DB 2HJ1A 5DPWA 2WP9B 1VR9A 3Q3MC 1TBEA 3ETRA 1WXSA 1OEYA 3I57A 2WU5B 1EO6A 1ZGUB 2AL6A 4C4VA 2LZ6A 4ICVA 3KYCD 4BKGA 2LFIA 2ZCCA 3KWVA 2MBEA 3OJ3A 2W55A 5HI1A 3RFZB 1ET9A 1N61A 2WDRB 4DHZE 2M19A 4REZA 3UQBA 4XWWA 4HWIB 1FNWA 1L0VB 3VTVA 2KFKB 3CSTA 2FCMA 2QHOA 1KM7A 3P4PB 3P63A 4EUTA 3ZNZB 1JRUA 4DBGA 5J2RA 4A3PA 2M1MA 3D32A 1XLPA 2NS5A 3ZGZA 4PS8A 2MBOA 4TUUA 5AZHA 2BYEA 4GB9A 2KVRA 2D10A 4P1BC 3VH4B 1XXGA 1C4PA 4RF0A 2RD0A 2ZPNA 3QARA 4P16A 1ZKHA 4TMAB 3SDLC 1XD3B 2DYMA 1C4AA 2C7HA 1VZ8A 3W2DA 2I1KA 2M0XA 3P2BA 3ZDTA 4YTPB 2J4XA 2BKFA 1L0XB 5CHFA 2KMCA 1F9JA 4A55A 2LVPA 3DQVA 2MSED 2LGXA 4FHJA 2KTFA 1ZE3D 4W9KA 5JHAA 1ROEA 1FPYA 1QOBA 5MPOA 2QEJC 4TQ0A 1MG4A 2BWES 3VH3B 5LXHA 4MM3A 3SU8X 4K7WA 4H2AA 5G5HA 2REXA 2ZVOA 4K3BA 1AN8A 4WURA 3PRMB 5FKAC 4DWFA 1D5MC 3TSSA 2IY0B 3DWMA 4IM2A 1S1QB 3SFDB 2A4ZA 1YIWA 2JUOA 3H8HA 1C79A 2ZJDA 2Y5CA 1N6ZA 1GAQB 2BYVE 4AWJA 1RAXA 4OVUA 3MJWA 2D5GA 4FULA 3WA0A 2ONQA 3NVYA 5J18A 1WFYA 2RSUA 1RFAA 4FBJB 4CO7A 2JRIB 3I3TB 1Q5WB 3T3NA 2NTTA 1TT5B 1SSNA 3ZLZA 1XCTL 3B0AA 1GB1A 3NVVA 4W9DA 2ZPYA 2A5UA 4L23A 1JWUD 4TQ1A 1K52A 1N63A 1KH0A 2D3CA 5DPTA 5FR3A 4ACFA 3IFWB 3MJ5A 3ZXVA 2KT7A 1XLQA 3DDCB 1SE2A 4DDID 4KKJA 3H9DA 4HK2A 5E6JA 2KMAA 4KZ0A 3QA8A 5HKHA 3U52E 2AQ2B 1LQBA 1ACCA 1EF5A 3OJ4B 4A9AA 3TJPA 1PGAA 1JWMD 2DZIA 2N7JA 2Y5PA 2V3NA 5GXGB 3B9JA 3N32A 3ZKJC 3O65B 4YT0B 2KWUB 2L8JA 3KQ4A 1SGHA 2KDBA
chains in the Genus database with same CATH topology
2IO2B 2KD0A 3APCA 2KFJA 3A9KA 4W9JA 3KH0A 1WR1A 1OQYA 4ZRKA 3ML8A 4EZLA 2DZMA 1WMHA 2N4FA 3GOEA 1LFDA 4KSLC 2JXXA 2IYDB 3NZUA 2KN5A 4GDKB 4LDTD 2VRRB 3ZUNA 2KZRA 4HPLB 3ZW3A 3H7PB 2ZNVB 3A9KB 1OTRB 4GGQA 2KTRB 3EC8A 1UGMA 4W9HA 4DHJD 4P7IA 2IY1B 4RM9A 3NOBA 1WXAA 3JSVA 1WJNA 2V4LA 1WZ3A 2D3GA 2G4SA 1CMXB 2Z0EB 3HM3A 3VUXA 3DPDA 3DVNU 2L0FA 5DPRA 3Q3JA 3JSVB 3AU5A 5AEKB 3N3KB 4WWNA 4WJNA 3IVFA 2UYZB 4TV3A 3NZSA 4W9GA 3M63B 2L3ZA 2ZNVC 2L00B 2V1YA 3H1UA 4G11A 2LI5A 2DAJA 2N9XA 2JWZA 3HK0A 4OVVA 4PS3A 4DXAB 1WX8A 2BKRB 2C60A 2L76A 2UWQA 4HDOA 3KUCB 1NBFC 3QQ8B 2PPHA 1UD7A 4LDTB 2J0JA 4HCPB 3APFA 3QC8B 2BWFA 3CF6E 3A4RA 1WE6A 2KLGA 5IAAC 3GZNI 3RD2A 3T9LA 3V61A 3QIJA 3RYTA 4NPNA 1YQBA 1WIAA 4RM8A 4EZKA 3PHXB 2JF5A 1WI0A 4GIVA 3EHVA 4ZDVA 3N30A 3NY5A 4IWPA 5KHQA 3PPAA 3VTUA 3X23A 4A20A 2KK8A 3WAPA 3AI5A 3AU4A 2C5LC 1X1MA 4NAWA 2KWCA 3DBSA 2LVQA 4LJOB 4E71A 3WIMA 2DYBA 2WYQA 4B9KA 1R4NI 1RLFA 2FCNA 1M94A 2IO3B 2OOBB 2LGDA 2PE6B 5G2NA 3WAMA 4GDLB 4KV2A 2Z0DB 4MGYE 4ANUA 2DYOA 2KWVB 1YJ1A 2RPQA 4MSQB 4N9F4 4AJYB 4E3CA 5JZEB 4FADA 3C0RB 4BBNF 1WY8A 1P0RA 3ECIA 3CSFA 4NY0A 4AUQC 1WJUA 4WQOB 1WM2A 1S3SG 4G3XB 2KDIA 1E8XA 3VHTC 1WH3A 1LM8B 2AWTA 4AJWA 3KYDD 2KDFB 1H4RA 4G50A 4IWOA 2LD9A 2WWZA 2O2VA 5TR5A 1E8YA 3QK0A 4FN2A 3MTNB 3L54A 4G0NB 5G55A 4WJQA 3VTWA 4X57B 5DCNA 4MH0E 5AZFA 2LJ5A 1LXDA 2DHZA 3L0WB 3A33B 3PZDA 1IPGA 2GBMA 3PRZA 4KIKB 5IA7A 1WM3A 2G3QB 2JZ3B 1P1AA 3QAQA 5D2MB 3WAOA 1A5RA 3ZDMC 2KO3A 4GXBA 2DENB 4GDKA 2J7QB 1J8CA 2NBWB 4KDLB 1E7UA 3VXWA 1XT9B 2XK5A 2AYOB 1WJ4A 4AOFA 2EKEC 3PRPB 4XX5A 3ZO5B 4ANWA 3SD5A 2ZZPB 3WANA 3A4SC 3APDA 3BY4B 4BBNC 1PQSA 4MJSA 1WGDA 3RZWC 2NPTB 5JH5C 2MP2A 3KW5B 3W1SC 3W1SA 3DVGY 4HCNB 4IM3A 1UZXB 4BKSD 2NR2A 1WGHA 3UF8A 5FR6A 4MGKE 2HTHA 2JZZA 3KUZA 4K1RB 1NI2A 1VD2A 2DZKA 2IBIB 2KX3A 5C1ZA 1ISNA 4F7ZA 4II3B 2JT4B 5L83A 3RCZA 2D2QA 4HXDA 3JW0X 5EDSA 2IO0B 3U7DA 4EKUA 2NVUI 3QHTA 2KDEB 2LUEA 4RMAA 2WX0A 3NHEB 3IBEA 2I1JA 5C23A 1QZEA 4AP4C 2YLMA 3DBRI 3SHQA 1K8RB 4DHZB 2FNJB 1FXTB 4MJSB 3TBLD 3U30A 3VUWA 2FIDA 4WWOA 4ANVA 2G4DB 1ZW7A 3ONSA 2GBKA 3H7PA 4WJOA 1U4AA 2MBBB 2K6DB 2XBBC 2WX1A 3IG3A 2V3SA 3ZRCA 2KJRA 2KHWB 2LGYA 4DHJB 4I6PA 1V5OA 1XQQA 2IO1B 1TZ1A 2XK5B 4MSMB 3PGEA 3VUYA 1WYWB 4ZRIA 3RUIB 5LXIB 2PE9A 3HIZA 3ZIMA 2LWPA 2FCSA 1EUVB 1SE9A 5JHBA 2K8BA 4MGZE 1NDDA 3PS6A 2MBQA 1V80A 3R7QA 2CS4A 4BVUC 1WX9A 2BPSA 2MCNB 5J17A 1WGRA 5E6NA 3OLMD 3ZVVA 1E8WA 3VVWB 3JYUA 1WGGA 1WXMA 4W9FA 2KQSA 5CHVC 4I6LB 3U8ZA 5D7GA 3QWZB 3ZNGC 4ASWC 2GBNA 4GN1A 2LVOA 3WALA 2CKHB 2KJHB 3PVLA 3X0WA 2G45B 2DZJA 2B3AA 3PV1A 4HJKA 2MBHA 3ZRFA 1D3ZA 3M95A 3PT2B 3PLUA 4FLHA 4HLEA 2O2VB 4IM0A 2CHWA 1Q1OA 2D07B 2N7DA 3KVFB 3ML9A 3OAWA 4PS7A 2W9NA 4NJ6A 1WZ0A 4CHKA 2L05A 4BOZB 2M17A 2AL3A 3RZFA 1C1YB 4CYEA 4LJPB 1RRBA 2CU1A 5CTRC 2BYFA 2N1VA 2NBVB 3DVNV 4GMVA 2NPTA 4K81A 2GMIC 4FHKA 5DPWA 1E5WA 1Z2MA 3PLVA 3T8MA 2RGFA 4EEWA 4IC7B 4EFOA 4PYUA 3DCGA 1WR6E 1VCBA 2BF8B 4MELA 1TBEA 1T0YA 3EFUA 4WJPA 1WXSA 1OEYA 1UBQA 2KC2A 4K7SA 4HDQA 1EO6A 1ZGUB 4TKNA 2KFKA 2AL6A 2MX2A 4B95A 2CHXA 3DVGX 2LZ6A 4ICVA 2KC1A 3KYCD 4BKGA 2MQJA 4NQKE 3PHWB 1KOTA 2GBRA 4KIKA 2R2OA 2C9WB 2ZCCA 2M8SA 1V9JA 2MBEA 3OJ3A 2LXAA 1GG3A 1E90A 4ZYNA 3UIPB 4DHZE 1GC7A 2JVCA 2LASA 1KLVA 1YX5B 2KTRA 3BINA 3LDZE 2JY6A 4NQLB 4W9EA 2XEWA 3UQBA 1WX7A 4HWIB 4NAWB 3VQIA 2KANA 1KJTA 3VTVA 4HPMB 1WE7A 2KFKB 3CSTA 2FCMA 2QHOA 4FJVB 1C3TA 2GOWA 1KM7A 1J19A 3DBHI 2C7NB 4W9CA 4EUTA 3CMMB 3ZNZB 2PEAA 4GDLA 1JRUA 3TCAA 4DBGA 2C7MB 3M3JA 4XC2A 5J2RA 4A3PA 2M1MA 3D32A 2HJ8A 1I35A 4ZRJA 2J0KA 2LRWA 2MRPA 3JVZX 1Y8RC 3A9JB 4F1SA 2NS5A 3V62A 3V6EB 3R7RA 4BOSC 4PS8A 2MBOA 4TUUA 5AZHA 2JRHA 2BYEA 1P9DU 1IP9A 4GB9A 3V6CB 2AEHA 1V2YA 2KVRA 4DDGD 1WMHB 1R4MI 2D10A 2HE7A 3VH4B 3AULA 4JGHB 1TGZB 4HVBA 1WGYA 2MA9B 2YVCA 2L0TA 4IG7B 2KXJA 2RD0A 3S2AA 2ZPNA 3QARA 1ZKHA 3SDLC 1XD3B 2DYMA 2C7HA 2KLCA 3PREA 4JQWC 3ZTDA 3ALBA 2I1KA 3UINB 4EOYA 3ZNID 5D6JB 2HD5B 2M0XA 3P2BA 2J0MA 3A9JA 2MP2B 2ZVNA 3K9OB 3VAWA 4E74A 3ZDTA 2KKCA 4FJYA 2CHZA 2FUHB 2BKFA 2Z59B 2K8HA 2EMTA 3H7SA 3PSEB 1WJ6A 4JLCA 3QCAA 5CHFA 2KMCA 1F9JA 2LVPA 2N1WA 3W1YA 3DQVA 1P98A 3RT3B 2MSED 3L13A 4MGIE 2LGXA 4FHJA 2KTFA 2GBJA 2K39A 3ZTCA 4IUMB 2KNBA 4W9KA 4II2B 4BKTA 4XZ4A 2O6VA 1YX6B 3LJ3A 5JHAA 3KUDB 1Q0WB 4TQ0A 2BWES 2WDTB 3VH3B 5LXHA 1L2NA 4MM3A 2PJHA 3SU8X 4K7WA 4GOCA 2EMSA 2M4NA 2REXA 3TMPB 2L7RA 4GU2A 4A3OA 4MDKE 2IZVB 2ZVOA 3TIXA 2BGFA 4BKSA 1V81A 1H8CA 1OGWA 3PRMB 2R2QA 1WRDB 5BO4B 2FAZA 4DWFA 3VDZA 1UH6A 2IY0B 4IM2A 1S1QB 3Q3FA 2A4ZA 3L17A 1YIWA 3V60A 3K9PB 2JUOA 4LCDE 5E6PA 2N9PC 3EECA 5D94A 2ZJDA 3L08A 1IYFA 4KSKC 2BYVE 2K8CA 3QJZA 4AWJA 3TL5A 4KVGB 1RAXA 4M8NA 4OVUA 3MJWA 2NCNA 2KX0A 2LRUA 1V6EA 1WF9A 2MLBA 4KDIC 2K25A 4FULA 3WA0A 3RULA 5J18A 1WFYA 1G6JA 2O6VD 2N7EA 2RSUA 4JL9A 2NBUA 4YL8A 4FA6A 2LXCA 2RR9A 4DK5A 1RFAA 3IHPC 4FBJB 4MEMA 5KHOA 4ICUA 4CO7A 4M8MA 2OJRA 2JRIB 2Y5BB 4GSWA 1SIFA 3ZNHB 2KQ7A 3I3TB 1Q5WB 3UGBB 2FCQA 5E6OA 2ZEQA 1BT0A 5DPSA 1UBIA 1AARA 4W9IA 3DBLI 5CX3A 1E8ZA 3ZLZA 1YD8U 5L95C 1GJZA 1OEYJ 4IW0A 3A1QB 3B0AA 4JIOU 4URKA 1GUAB 2K6QA 2N9EB 4IWQA 4W9DA 1J0GA 2ZPYA 1V49A 2A5UA 2O6VB 2MWSB 1MG8A 4I6NB 3UIOB 4TQ1A 1GNUA 3M62B 4J6IA 1Z5SB 3A1QA 2DAFA 5DPTA 3MHSD 3IFWB 2JPHA 1E7VA 1V86A 1HE8A 2DX5B 4NJ7A 4B6WA 3DDCB 3ENEA 2MW5A 1V5TA 4DDID 4K7UA 2KOXA 4WWPA 3AXCA 4EZJA 2CR5A 3H9DA 5AZGA 3R66C 1L7YA 4HK2A 5GMVA 3QX1A 3B1LX 2KMAA 4KZCA 2D11A 4KZ0A 1WXVA 2KJ6A 2ZCBA 3NS8A 3R3MA 3QA8A 5HKHA 3VFKA 1GC6A 1LQBA 4ANXA 4PYZA 1UELA 5LLIA 1EF5A 5CHWA 3OJ4B 1EF1A 3DOWA 3TJPA 1P3QU 3HM6X 3L16A 3UQAA 2DZIA 3PTFC 2K1FA 4W9LA 2FIFA 3B08A 3N32A 4NNJB 3ZKJC 1I42A 3HHMA 3O65B 3L10B 4M0WB 2ASQA 2KWUB 2L8JA 4F8CB 4BFRA 4WAAA 3H6NA 1SGHA 2KDBA 4FJZA 1TTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO2 B;  2KD0 A;  3APC A;  2KFJ A;  3A9K A;  4W9J A;  3KH0 A;  1WR1 A;  1OQY A;  4ZRK A;  3ML8 A;  4EZL A;  2DZM A;  1WMH A;  2N4F A;  3GOE A;  1LFD A;  4KSL C;  2JXX A;  2IYD B;  3NZU A;  2KN5 A;  4GDK B;  4LDT D;  2VRR B;  3ZUN A;  2KZR A;  4HPL B;  3ZW3 A;  3H7P B;  2ZNV B;  3A9K B;  1OTR B;  4GGQ A;  2KTR B;  3EC8 A;  1UGM A;  4W9H A;  4DHJ D;  4P7I A;  2IY1 B;  4RM9 A;  3NOB A;  1WXA A;  3JSV A;  1WJN A;  2V4L A;  1WZ3 A;  2D3G A;  2G4S A;  1CMX B;  2Z0E B;  3HM3 A;  3VUX A;  3DPD A;  3DVN U;  2L0F A;  5DPR A;  3Q3J A;  3JSV B;  3AU5 A;  5AEK B;  3N3K B;  4WWN A;  4WJN A;  3IVF A;  2UYZ B;  4TV3 A;  3NZS A;  4W9G A;  3M63 B;  2L3Z A;  2ZNV C;  2L00 B;  2V1Y A;  3H1U A;  4G11 A;  2LI5 A;  2DAJ A;  2N9X A;  2JWZ A;  3HK0 A;  4OVV A;  4PS3 A;  4DXA B;  1WX8 A;  2BKR B;  2C60 A;  2L76 A;  2UWQ A;  4HDO A;  3KUC B;  1NBF C;  3QQ8 B;  2PPH A;  1UD7 A;  4LDT B;  2J0J A;  4HCP B;  3APF A;  3QC8 B;  2BWF A;  3CF6 E;  3A4R A;  1WE6 A;  2KLG A;  5IAA C;  3GZN I;  3RD2 A;  3T9L A;  3V61 A;  3QIJ A;  3RYT A;  4NPN A;  1YQB A;  1WIA A;  4RM8 A;  4EZK A;  3PHX B;  2JF5 A;  1WI0 A;  4GIV A;  3EHV A;  4ZDV A;  3N30 A;  3NY5 A;  4IWP A;  5KHQ A;  3PPA A;  3VTU A;  3X23 A;  4A20 A;  2KK8 A;  3WAP A;  3AI5 A;  3AU4 A;  2C5L C;  1X1M A;  4NAW A;  2KWC A;  3DBS A;  2LVQ A;  4LJO B;  4E71 A;  3WIM A;  2DYB A;  2WYQ A;  4B9K A;  1R4N I;  1RLF A;  2FCN A;  1M94 A;  2IO3 B;  2OOB B;  2LGD A;  2PE6 B;  5G2N A;  3WAM A;  4GDL B;  4KV2 A;  2Z0D B;  4MGY E;  4ANU A;  2DYO A;  2KWV B;  1YJ1 A;  2RPQ A;  4MSQ B;  4N9F 4;  4AJY B;  4E3C A;  5JZE B;  4FAD A;  3C0R B;  4BBN F;  1WY8 A;  1P0R A;  3ECI A;  3CSF A;  4NY0 A;  4AUQ C;  1WJU A;  4WQO B;  1WM2 A;  1S3S G;  4G3X B;  2KDI A;  1E8X A;  3VHT C;  1WH3 A;  1LM8 B;  2AWT A;  4AJW A;  3KYD D;  2KDF B;  1H4R A;  4G50 A;  4IWO A;  2LD9 A;  2WWZ A;  2O2V A;  5TR5 A;  1E8Y A;  3QK0 A;  4FN2 A;  3MTN B;  3L54 A;  4G0N B;  5G55 A;  4WJQ A;  3VTW A;  4X57 B;  5DCN A;  4MH0 E;  5AZF A;  2LJ5 A;  1LXD A;  2DHZ A;  3L0W B;  3A33 B;  3PZD A;  1IPG A;  2GBM A;  3PRZ A;  4KIK B;  5IA7 A;  1WM3 A;  2G3Q B;  2JZ3 B;  1P1A A;  3QAQ A;  5D2M B;  3WAO A;  1A5R A;  3ZDM C;  2KO3 A;  4GXB A;  2DEN B;  4GDK A;  2J7Q B;  1J8C A;  2NBW B;  4KDL B;  1E7U A;  3VXW A;  1XT9 B;  2XK5 A;  2AYO B;  1WJ4 A;  4AOF A;  2EKE C;  3PRP B;  4XX5 A;  3ZO5 B;  4ANW A;  3SD5 A;  2ZZP B;  3WAN A;  3A4S C;  3APD A;  3BY4 B;  4BBN C;  1PQS A;  4MJS A;  1WGD A;  3RZW C;  2NPT B;  5JH5 C;  2MP2 A;  3KW5 B;  3W1S C;  3W1S A;  3DVG Y;  4HCN B;  4IM3 A;  1UZX B;  4BKS D;  2NR2 A;  1WGH A;  3UF8 A;  5FR6 A;  4MGK E;  2HTH A;  2JZZ A;  3KUZ A;  4K1R B;  1NI2 A;  1VD2 A;  2DZK A;  2IBI B;  2KX3 A;  5C1Z A;  1ISN A;  4F7Z A;  4II3 B;  2JT4 B;  5L83 A;  3RCZ A;  2D2Q A;  4HXD A;  3JW0 X;  5EDS A;  2IO0 B;  3U7D A;  4EKU A;  2NVU I;  3QHT A;  2KDE B;  2LUE A;  4RMA A;  2WX0 A;  3NHE B;  3IBE A;  2I1J A;  5C23 A;  1QZE A;  4AP4 C;  2YLM A;  3DBR I;  3SHQ A;  1K8R B;  4DHZ B;  2FNJ B;  1FXT B;  4MJS B;  3TBL D;  3U30 A;  3VUW A;  2FID A;  4WWO A;  4ANV A;  2G4D B;  1ZW7 A;  3ONS A;  2GBK A;  3H7P A;  4WJO A;  1U4A A;  2MBB B;  2K6D B;  2XBB C;  2WX1 A;  3IG3 A;  2V3S A;  3ZRC A;  2KJR A;  2KHW B;  2LGY A;  4DHJ B;  4I6P A;  1V5O A;  1XQQ A;  2IO1 B;  1TZ1 A;  2XK5 B;  4MSM B;  3PGE A;  3VUY A;  1WYW B;  4ZRI A;  3RUI B;  5LXI B;  2PE9 A;  3HIZ A;  3ZIM A;  2LWP A;  2FCS A;  1EUV B;  1SE9 A;  5JHB A;  2K8B A;  4MGZ E;  1NDD A;  3PS6 A;  2MBQ A;  1V80 A;  3R7Q A;  2CS4 A;  4BVU C;  1WX9 A;  2BPS A;  2MCN B;  5J17 A;  1WGR A;  5E6N A;  3OLM D;  3ZVV A;  1E8W A;  3VVW B;  3JYU A;  1WGG A;  1WXM A;  4W9F A;  2KQS A;  5CHV C;  4I6L B;  3U8Z A;  5D7G A;  3QWZ B;  3ZNG C;  4ASW C;  2GBN A;  4GN1 A;  2LVO A;  3WAL A;  2CKH B;  2KJH B;  3PVL A;  3X0W A;  2G45 B;  2DZJ A;  2B3A A;  3PV1 A;  4HJK A;  2MBH A;  3ZRF A;  1D3Z A;  3M95 A;  3PT2 B;  3PLU A;  4FLH A;  4HLE A;  2O2V B;  4IM0 A;  2CHW A;  1Q1O A;  2D07 B;  2N7D A;  3KVF B;  3ML9 A;  3OAW A;  4PS7 A;  2W9N A;  4NJ6 A;  1WZ0 A;  4CHK A;  2L05 A;  4BOZ B;  2M17 A;  2AL3 A;  3RZF A;  1C1Y B;  4CYE A;  4LJP B;  1RRB A;  2CU1 A;  5CTR C;  2BYF A;  2N1V A;  2NBV B;  3DVN V;  4GMV A;  2NPT A;  4K81 A;  2GMI C;  4FHK A;  5DPW A;  1E5W A;  1Z2M A;  3PLV A;  3T8M A;  2RGF A;  4EEW A;  4IC7 B;  4EFO A;  4PYU A;  3DCG A;  1WR6 E;  1VCB A;  2BF8 B;  4MEL A;  1TBE A;  1T0Y A;  3EFU A;  4WJP A;  1WXS A;  1OEY A;  1UBQ A;  2KC2 A;  4K7S A;  4HDQ A;  1EO6 A;  1ZGU B;  4TKN A;  2KFK A;  2AL6 A;  2MX2 A;  4B95 A;  2CHX A;  3DVG X;  2LZ6 A;  4ICV A;  2KC1 A;  3KYC D;  4BKG A;  2MQJ A;  4NQK E;  3PHW B;  1KOT A;  2GBR A;  4KIK A;  2R2O A;  2C9W B;  2ZCC A;  2M8S A;  1V9J A;  2MBE A;  3OJ3 A;  2LXA A;  1GG3 A;  1E90 A;  4ZYN A;  3UIP B;  4DHZ E;  1GC7 A;  2JVC A;  2LAS A;  1KLV A;  1YX5 B;  2KTR A;  3BIN A;  3LDZ E;  2JY6 A;  4NQL B;  4W9E A;  2XEW A;  3UQB A;  1WX7 A;  4HWI B;  4NAW B;  3VQI A;  2KAN A;  1KJT A;  3VTV A;  4HPM B;  1WE7 A;  2KFK B;  3CST A;  2FCM A;  2QHO A;  4FJV B;  1C3T A;  2GOW A;  1KM7 A;  1J19 A;  3DBH I;  2C7N B;  4W9C A;  4EUT A;  3CMM B;  3ZNZ B;  2PEA A;  4GDL A;  1JRU A;  3TCA A;  4DBG A;  2C7M B;  3M3J A;  4XC2 A;  5J2R A;  4A3P A;  2M1M A;  3D32 A;  2HJ8 A;  1I35 A;  4ZRJ A;  2J0K A;  2LRW A;  2MRP A;  3JVZ X;  1Y8R C;  3A9J B;  4F1S A;  2NS5 A;  3V62 A;  3V6E B;  3R7R A;  4BOS C;  4PS8 A;  2MBO A;  4TUU A;  5AZH A;  2JRH A;  2BYE A;  1P9D U;  1IP9 A;  4GB9 A;  3V6C B;  2AEH A;  1V2Y A;  2KVR A;  4DDG D;  1WMH B;  1R4M I;  2D10 A;  2HE7 A;  3VH4 B;  3AUL A;  4JGH B;  1TGZ B;  4HVB A;  1WGY A;  2MA9 B;  2YVC A;  2L0T A;  4IG7 B;  2KXJ A;  2RD0 A;  3S2A A;  2ZPN A;  3QAR A;  1ZKH A;  3SDL C;  1XD3 B;  2DYM A;  2C7H A;  2KLC A;  3PRE A;  4JQW C;  3ZTD A;  3ALB A;  2I1K A;  3UIN B;  4EOY A;  3ZNI D;  5D6J B;  2HD5 B;  2M0X A;  3P2B A;  2J0M A;  3A9J A;  2MP2 B;  2ZVN A;  3K9O B;  3VAW A;  4E74 A;  3ZDT A;  2KKC A;  4FJY A;  2CHZ A;  2FUH B;  2BKF A;  2Z59 B;  2K8H A;  2EMT A;  3H7S A;  3PSE B;  1WJ6 A;  4JLC A;  3QCA A;  5CHF A;  2KMC A;  1F9J A;  2LVP A;  2N1W A;  3W1Y A;  3DQV A;  1P98 A;  3RT3 B;  2MSE D;  3L13 A;  4MGI E;  2LGX A;  4FHJ A;  2KTF A;  2GBJ A;  2K39 A;  3ZTC A;  4IUM B;  2KNB A;  4W9K A;  4II2 B;  4BKT A;  4XZ4 A;  2O6V A;  1YX6 B;  3LJ3 A;  5JHA A;  3KUD B;  1Q0W B;  4TQ0 A;  2BWE S;  2WDT B;  3VH3 B;  5LXH A;  1L2N A;  4MM3 A;  2PJH A;  3SU8 X;  4K7W A;  4GOC A;  2EMS A;  2M4N A;  2REX A;  3TMP B;  2L7R A;  4GU2 A;  4A3O A;  4MDK E;  2IZV B;  2ZVO A;  3TIX A;  2BGF A;  4BKS A;  1V81 A;  1H8C A;  1OGW A;  3PRM B;  2R2Q A;  1WRD B;  5BO4 B;  2FAZ A;  4DWF A;  3VDZ A;  1UH6 A;  2IY0 B;  4IM2 A;  1S1Q B;  3Q3F A;  2A4Z A;  3L17 A;  1YIW A;  3V60 A;  3K9P B;  2JUO A;  4LCD E;  5E6P A;  2N9P C;  3EEC A;  5D94 A;  2ZJD A;  3L08 A;  1IYF A;  4KSK C;  2BYV E;  2K8C A;  3QJZ A;  4AWJ A;  3TL5 A;  4KVG B;  1RAX A;  4M8N A;  4OVU A;  3MJW A;  2NCN A;  2KX0 A;  2LRU A;  1V6E A;  1WF9 A;  2MLB A;  4KDI C;  2K25 A;  4FUL A;  3WA0 A;  3RUL A;  5J18 A;  1WFY A;  1G6J A;  2O6V D;  2N7E A;  2RSU A;  4JL9 A;  2NBU A;  4YL8 A;  4FA6 A;  2LXC A;  2RR9 A;  4DK5 A;  1RFA A;  3IHP C;  4FBJ B;  4MEM A;  5KHO A;  4ICU A;  4CO7 A;  4M8M A;  2OJR A;  2JRI B;  2Y5B B;  4GSW A;  1SIF A;  3ZNH B;  2KQ7 A;  3I3T B;  1Q5W B;  3UGB B;  2FCQ A;  5E6O A;  2ZEQ A;  1BT0 A;  5DPS A;  1UBI A;  1AAR A;  4W9I A;  3DBL I;  5CX3 A;  1E8Z A;  3ZLZ A;  1YD8 U;  5L95 C;  1GJZ A;  1OEY J;  4IW0 A;  3A1Q B;  3B0A A;  4JIO U;  4URK A;  1GUA B;  2K6Q A;  2N9E B;  4IWQ A;  4W9D A;  1J0G A;  2ZPY A;  1V49 A;  2A5U A;  2O6V B;  2MWS B;  1MG8 A;  4I6N B;  3UIO B;  4TQ1 A;  1GNU A;  3M62 B;  4J6I A;  1Z5S B;  3A1Q A;  2DAF A;  5DPT A;  3MHS D;  3IFW B;  2JPH A;  1E7V A;  1V86 A;  1HE8 A;  2DX5 B;  4NJ7 A;  4B6W A;  3DDC B;  3ENE A;  2MW5 A;  1V5T A;  4DDI D;  4K7U A;  2KOX A;  4WWP A;  3AXC A;  4EZJ A;  2CR5 A;  3H9D A;  5AZG A;  3R66 C;  1L7Y A;  4HK2 A;  5GMV A;  3QX1 A;  3B1L X;  2KMA A;  4KZC A;  2D11 A;  4KZ0 A;  1WXV A;  2KJ6 A;  2ZCB A;  3NS8 A;  3R3M A;  3QA8 A;  5HKH A;  3VFK A;  1GC6 A;  1LQB A;  4ANX A;  4PYZ A;  1UEL A;  5LLI A;  1EF5 A;  5CHW A;  3OJ4 B;  1EF1 A;  3DOW A;  3TJP A;  1P3Q U;  3HM6 X;  3L16 A;  3UQA A;  2DZI A;  3PTF C;  2K1F A;  4W9L A;  2FIF A;  3B08 A;  3N32 A;  4NNJ B;  3ZKJ C;  1I42 A;  3HHM A;  3O65 B;  3L10 B;  4M0W B;  2ASQ A;  2KWU B;  2L8J A;  4F8C B;  4BFR A;  4WAA A;  3H6N A;  1SGH A;  2KDB A;  4FJZ A;  1TTN A; 
#chains in the Genus database with same CATH topology
 2RDH A;  3V3X A;  4AS1 A;  3KH0 A;  1WR1 A;  3GOE A;  1LFD A;  2VZK B;  3AE2 B;  3RN9 C;  3NZU A;  4GDK B;  2VRR B;  1ZPS A;  3ZW3 A;  3H7P B;  3A9K B;  4DHJ D;  1UGM A;  4RM9 A;  3E56 A;  1F52 A;  3VUX A;  3DVN U;  4AQ7 A;  5DPR A;  3ZJU A;  4WJN A;  2N9K A;  3NZS A;  4BAX A;  2L3Z A;  3HK0 A;  2LUM A;  2N9X A;  2JWZ A;  3RNA C;  4DXA B;  1WX8 A;  2BKR B;  2QMT A;  1NBF C;  2J0J A;  3APF A;  2BWF A;  3CF6 E;  1Q10 A;  3T9L A;  1WSP A;  3GZN I;  3L4P A;  3RD2 A;  4CQN A;  4EZK A;  3EHV A;  3N30 A;  2WHI A;  4A20 A;  3WAP A;  4NAW A;  1X1M A;  3DBS A;  2DBY A;  2LVQ A;  4KX6 B;  4IKG A;  2GB1 A;  1FMA D;  1R4N I;  2FCN A;  3Q8F A;  4HEA 1;  2LMC A;  2LEK A;  1YQ3 B;  1OFF A;  4KV2 A;  1P7E A;  2RPQ A;  4AJY B;  2J53 A;  1AYF A;  1WY8 A;  2K22 A;  2I38 A;  2PVO D;  4NY0 A;  4WQO B;  1LM8 B;  4AJW A;  2CU3 A;  2I2Y A;  3PZD A;  1IPG A;  4ZRP A;  4PK1 A;  2L83 A;  3CIR B;  4O1N A;  1V1P A;  1J7C A;  2RPV A;  2NBW B;  4ANW A;  4RF1 A;  3SD5 A;  3BY4 B;  3Q8C A;  1DYQ A;  2WLB A;  4MJS A;  3W1S C;  2BQQ A;  1UNS A;  3AEE B;  1FCL A;  1PDX A;  1F2R I;  4MGK E;  5FR6 A;  1NI3 A;  4K1R B;  4YXD B;  4GLS C;  1NI2 A;  1VD2 A;  2DZK A;  2KX3 A;  1C76 A;  3TUO A;  2G1E A;  2D2Q A;  1GB4 A;  3QHT A;  1D4B A;  2Q5W D;  2WX0 A;  2BW2 A;  4AP4 C;  4DHZ B;  1K8R B;  2FNJ B;  3TBL D;  4LK0 M;  2FID A;  1ZW7 A;  2GBK A;  3BII D;  1VZ6 A;  4S0R A;  1U4A A;  2K6D B;  1KLG D;  2V3S A;  1I4P A;  4KGR A;  4S17 A;  1V5O A;  1TZ1 A;  2QJL A;  1XO3 A;  1YN4 A;  4ZRI A;  1T6B X;  1NEK B;  1E0Z A;  3T3O A;  2MBQ A;  2KQ4 X;  2WXQ A;  1VJK A;  2BPS A;  2MHJ A;  4LNN A;  3JYU A;  4W9F A;  3U8Z A;  3ZXR A;  4I6L B;  1DOX A;  2BS4 B;  5D7G A;  3ZNG C;  4ASW C;  2GBN A;  4XWT A;  2LVO A;  3PZ8 A;  4M00 A;  2KJH B;  1TY2 A;  1M4V A;  2G45 B;  1CK1 A;  1HQR D;  4N59 A;  4HLE A;  2O2V B;  3KVF B;  3ML9 A;  1BUI C;  1WGK A;  3I5J C;  4NJ6 A;  1WZ0 A;  4BOZ B;  2M17 A;  4M0W A;  1C1Y B;  3I63 C;  2HTM E;  2N1V A;  4OZB A;  4K81 A;  4OZC A;  3IT6 B;  1Z2M A;  4EEW A;  4IC7 B;  4PYU A;  4MEL A;  3EFU A;  1T0Y A;  4YWG G;  4PT5 A;  1UBQ A;  2KC2 A;  4K7S A;  2KFK A;  2CHX A;  3DVG X;  3R2I A;  2MQJ A;  3PHW B;  2R2O A;  1JRP A;  1V9J A;  2BBC A;  1FD6 A;  2RDB C;  3EA6 A;  1J7A A;  3UIP B;  1BML C;  3GZN B;  2JVC A;  1KLV A;  1YX5 B;  4ZHP A;  2JY6 A;  4NQL B;  2KAN A;  1KJT A;  1C3T A;  1J19 A;  3DBH I;  4GDL A;  1ZP0 B;  4XC2 A;  3JVZ X;  3HUI A;  3MHZ A;  4BOS C;  2J52 A;  4YTN B;  1P9D U;  2K0P A;  4MAC A;  1WGY A;  4DXG A;  2MA9 B;  2WXK A;  1PFD A;  1F1H A;  2KXJ A;  4JQW C;  3ALB A;  3C8Y A;  4EOY A;  3VAW A;  2ZVN A;  1WYG A;  2Z59 B;  1AW7 A;  1WJ6 A;  3DBH B;  4IOI E;  3W1Y A;  3RT3 B;  3L13 A;  4BZA A;  2QDF A;  2GBJ A;  2K39 A;  3ZTC A;  2KNB A;  1KTK A;  4BKT A;  1YX6 B;  1TS4 A;  2PTL A;  2WDT B;  3RNF C;  4GOC A;  2JYT A;  3IXS A;  2L7R A;  4A3O A;  4JE3 B;  2PMV A;  5HFY A;  5BO4 B;  1D5Z C;  2FAZ A;  3N20 C;  5C2T B;  2KVZ A;  2BB6 A;  4C4V B;  3K9P B;  5E6P A;  1UGJ A;  1IYF A;  1V8C A;  4KVG B;  2NCN A;  2KX0 A;  4M02 A;  4KDI C;  4N6E B;  2WNM A;  3RUL A;  2WXM A;  1G6J A;  2O6V D;  3N1Y C;  1TYG B;  1QF6 A;  4JL9 A;  5I4D A;  2NBU A;  4FA6 A;  2LXC A;  4DK5 A;  3GE8 C;  1VZ7 A;  4MEM A;  5AUI A;  4GSW A;  3UGB B;  5E6O A;  5LNK 1;  3MFG A;  1AAR A;  1E8Z A;  5L95 C;  1GJZ A;  4IW0 A;  4USA A;  3A1Q B;  3NUH B;  2KWD A;  2LHD A;  1GUA B;  2RDG A;  1F0Z A;  1RWS A;  1TIF A;  2WXP A;  2MWS B;  1MG8 A;  2FE8 A;  3UIO B;  1GNU A;  3M62 B;  2PLP A;  1QOG A;  1SXT A;  1Z5S B;  3KWL A;  1FNV A;  1I7H A;  2DAF A;  3RNB C;  4JX1 C;  1OQR A;  4MT5 A;  4B6W A;  4K7U A;  3SEB A;  2KOX A;  4WWP A;  1VRA B;  4EZJ A;  4P1C C;  2H88 B;  3R66 C;  4KZC A;  1STE A;  1EU3 A;  3GE3 C;  2QC8 A;  3ZJV A;  1EF1 A;  1DOY A;  1N62 A;  1L0Y B;  1P3Q U;  3L16 A;  1YN3 A;  1ENF A;  4NNJ B;  3L10 B;  4M0W B;  2ASQ A;  3HRD D;  1SIJ A;  1UUP A;  2IO2 B;  1Y56 A;  2DZM A;  3LB8 C;  5EE9 A;  3VR8 B;  1YJJ A;  2Z8L A;  5G5G A;  1KF6 B;  1N60 A;  1PYW D;  2KTR B;  3EC8 A;  2IY1 B;  1FCC C;  3NOB A;  1WXA A;  2K5P A;  3JSV A;  1WJN A;  2V4L A;  3O13 A;  1LO5 D;  4A6Q A;  3DPD A;  2V4I B;  2L0F A;  2W3S A;  3EUB 2;  3JSV B;  1XLN A;  3AU5 A;  5AEK B;  4WWN A;  2UYZ B;  4W9G A;  5BMI A;  4G11 A;  5IP4 D;  1MJD A;  4PS3 A;  2C60 A;  3KUC B;  2BB5 A;  1UD7 A;  3QC8 B;  2JQR B;  2KLG A;  5IAA C;  3QIJ A;  2W3R A;  1WIA A;  1EU4 A;  3PHX B;  4ZDV A;  3NY5 A;  5TSS A;  3PPA A;  2KK8 A;  3AU4 A;  4E71 A;  3WIM A;  4ARI A;  2DYB A;  2WYQ A;  2MH7 A;  3ZYY X;  1M94 A;  2BTE A;  4HKZ E;  3EGR A;  2LGD A;  1QQR A;  3WAM A;  2IND C;  2Z0D B;  1SBB B;  2KWV B;  4MSQ B;  1YJ1 A;  4N9F 4;  5JZE B;  4HRS A;  4FAD A;  3ECI A;  3CSF A;  5IKC M;  1WJU A;  2CJO A;  1ESF A;  1WH3 A;  2WXL A;  3KYD D;  4G50 A;  3NS1 A;  2O2V A;  3QK0 A;  4FN2 A;  3MTN B;  4HRO A;  4X57 B;  5DCN A;  5AZF A;  1LXD A;  4UDU C;  4HJG E;  1QIL A;  3V05 A;  2G3Q B;  2JZ3 B;  1P1A A;  3QAQ A;  3WAO A;  1A5R A;  3ZDM C;  3VXW A;  2XK5 A;  2WGS A;  3Q8B A;  3WAN A;  1HEZ E;  4BBN C;  2OED A;  1WGD A;  2NPT B;  5T8I A;  4HCN B;  2NR2 A;  1WGH A;  2JZZ A;  3KUZ A;  3N9Y C;  3W5U B;  4KKI A;  2IBI B;  4F7Z A;  3RCZ A;  2IO0 B;  3U7D A;  4EKU A;  2NVU I;  2LUE A;  5EE1 A;  3IBE A;  1WWT A;  1YNT E;  4XYC A;  2XN9 C;  3P4Q B;  4MJS B;  2JZP A;  3DHI C;  3ONS A;  3H7P A;  2UU7 A;  4ARC A;  2MBB B;  4US9 A;  2XBB C;  3IG3 A;  3ZRC A;  2L1A A;  3AEB B;  2LGY A;  2KHW B;  4DHJ B;  1PUT A;  4I6P A;  4MM3 B;  2IO1 B;  3TEZ A;  4MSM B;  3N1X C;  3PGE A;  5LXI B;  3HIZ A;  1FXA A;  2FCS A;  1EUV B;  5H8Y E;  3MP9 A;  4MGZ E;  3HVD A;  5BYR A;  1WX9 A;  1NVI D;  2EEL A;  3ZVV A;  3IAS 1;  1D5X C;  3VVW B;  1WGG A;  1WXM A;  3AE8 B;  5CHV C;  2G9H D;  1V1O A;  2QIL A;  4GN1 A;  2CKH B;  3N1Z C;  3BWU D;  3X0W A;  1E7P B;  1D3Z A;  2ICI A;  2LJI A;  3PT2 B;  3PLU A;  3GB1 A;  4RGT A;  2D07 B;  2M0A A;  1MHX A;  1JWA D;  1SJE D;  1ZXI A;  2X38 A;  1R4M B;  2L05 A;  1TKG A;  2IGG A;  3RZF A;  2CU1 A;  3EFC A;  2NBV B;  4GMV A;  2GMI C;  4FHK A;  1E5W A;  1I4G A;  2RGF A;  3DCG A;  1FIQ A;  4WJP A;  5AUK A;  2MJD A;  2WDQ B;  1YN5 A;  4TKN A;  4B95 A;  2KC1 A;  4NQK E;  1MPE A;  5C3J B;  2GBR A;  2Y3A A;  2M8S A;  4A8X C;  1IGC A;  4LNI A;  5EE3 A;  3RNE C;  2JWU A;  1UWX A;  4ZYN A;  1L6V A;  3RNG C;  1GC7 A;  2LAS A;  1JML A;  2KTR A;  3BIN A;  2BYT A;  1MHH E;  4W9E A;  2XEW A;  2LGS A;  1WX7 A;  2OHF A;  4OW0 A;  3NVZ A;  4NAW B;  3VQI A;  1B1Z A;  4HPM B;  1WE7 A;  3PZ7 A;  3DHH C;  1E6E B;  1I4Q A;  3AV8 A;  3NRZ A;  2C7N B;  2C7M B;  3M3J A;  2HJ8 A;  4B0E A;  1P7F A;  3ZQ4 A;  2MRP A;  3CWI A;  1Y8R C;  3A9J B;  4F1S A;  2HDE A;  1K53 A;  1IP9 A;  1JRO A;  3V6C B;  2AEH A;  1V2Y A;  1CQV A;  1R4M I;  4JGH B;  2WXG A;  2YVC A;  3BYT B;  3TEY A;  1ZDX A;  3MC9 A;  3PRE A;  3AED B;  4D2K A;  1IBX A;  2MP2 B;  3K9O B;  4OHJ A;  2KKC A;  4US8 A;  4FJY A;  2CHZ A;  1F77 A;  2FUH B;  2K8H A;  3UI3 A;  3PSE B;  1RM6 C;  3QCA A;  3P42 A;  4LNF A;  2WXO A;  2N1W A;  1P98 A;  4MGI E;  4IUM B;  2K9X A;  4XZ4 A;  2V3P A;  4XDD A;  3KUD B;  1Q0W B;  2IGH A;  4XDC A;  1XLO A;  2M4N A;  3TMP B;  3C19 A;  4MDK E;  2VH2 A;  2IZV B;  2LGI A;  5BYS A;  3TIX A;  2GRI A;  2RMM A;  1WRD B;  1NYR A;  1UH6 A;  2BS3 B;  5BYQ A;  3Q3F A;  1L4Z B;  4LCD E;  3BK2 A;  3EEC A;  2AQ1 B;  4C7Z A;  1FFU A;  2JYE A;  3QJZ A;  1B9R A;  3TL5 A;  4M8N A;  2L32 A;  4FXC A;  2MLB A;  2K25 A;  4NJC A;  2RR9 A;  3DHG C;  1V1P B;  3IHP C;  5KHO A;  4ICU A;  4M8M A;  2OJR A;  1KRH A;  3BVM A;  1SIF A;  2KQ7 A;  1L5P A;  1BT0 A;  5DPS A;  3GS2 A;  1UBI A;  4W9I A;  3DBL I;  1L6U A;  1YOV B;  1J0G A;  2N9E B;  4IWQ A;  1IUE A;  3E9S A;  2WXJ A;  1UWM A;  4J6I A;  3MHS D;  3AEF B;  1WXQ A;  1E7V A;  2BVC A;  2DX5 B;  2E6X A;  2MW5 A;  3BVG A;  2WXN A;  2CR5 A;  5AZG A;  2NMQ A;  5GMV A;  3RI7 C;  3QX1 A;  3Q8E A;  3R3M A;  3AN1 A;  2DNF A;  4ANX A;  4PYZ A;  1UEL A;  5D3I B;  5LLI A;  5CHW A;  3DOW A;  3HM6 X;  3UQA A;  3AE6 B;  1K50 A;  2K1F A;  2FIF A;  4RGM A;  4RH6 A;  4BFR A;  3I9V 1;  2E3T A;  3B2F A;  1T0S C;  3MC8 A;  4FJZ A;  1TTN A;  1E9M A;  2KD0 A;  3A9K A;  4W9J A;  3U2S C;  1HXY D;  1OQY A;  3AH7 A;  3ML8 A;  4EZL A;  2N4F A;  3ABV B;  4KSL C;  3IT4 B;  2JXX A;  2KN5 A;  3Q14 C;  4HPL B;  2ZNV B;  1OTR B;  4W9H A;  2KN4 A;  2D3G A;  2QSD A;  2G4S A;  3AE5 B;  3HM3 A;  4RGO S;  3AE9 B;  1T0R C;  3IAM 1;  2SEB D;  3Q3J A;  1ZDV A;  3AM9 A;  3B2G A;  1R4N B;  1EM7 A;  3IVF A;  4TV3 A;  3M63 B;  3VRA B;  2IGD A;  2DAJ A;  2LI5 A;  4OVV A;  2UWQ A;  3BYY B;  3FIL B;  2D3A A;  1MI0 A;  4HCP B;  3A4R A;  3RYT A;  4NPN A;  1YQB A;  2W54 A;  4RM8 A;  3NJT A;  2JF5 A;  1N5W A;  1WI0 A;  3FIL A;  4IWP A;  2INN E;  3VTU A;  4A90 A;  5KHQ A;  1T3Q A;  2C5L C;  2KWC A;  1SF0 A;  4LJO B;  3Q2A C;  4B9K A;  1RLF A;  2IO3 B;  2MJ3 A;  4E3C A;  1RFK A;  4MH8 A;  4BBN F;  1UF0 A;  1XCQ L;  3RNC C;  1S3S G;  1TS5 A;  2VZK D;  1YJI A;  2KDF B;  4IWO A;  1SJH D;  1E8Y A;  3L54 A;  5G55 A;  1ZUD 2;  1DGJ A;  4MH0 E;  2LJ5 A;  4C7Y A;  3L0W B;  3A33 B;  3PRZ A;  4KIK B;  1WM3 A;  2JSV X;  1QKZ A;  2KO3 A;  2X8X X;  2J7Q B;  4KDL B;  1E7U A;  4QAY A;  1XT9 B;  2AYO B;  2EKE C;  4P6V F;  3PRP B;  4XX5 A;  3ZO5 B;  5IOI A;  2ZZP B;  3A4S C;  1JQ4 A;  1ZOY B;  1I4R A;  1FXI A;  3J9C A;  1QOF A;  3W1S A;  4IM3 A;  4BKS D;  3UF8 A;  3GP7 A;  4WWM A;  5C1Z A;  1ISN A;  2JT4 B;  3R2T A;  5EDS A;  5IO9 A;  2LHE A;  2XNA C;  4N58 A;  4J3O D;  3NHE B;  3DBR B;  1QZE A;  2OJW A;  2V9H A;  2YLM A;  3DBR I;  3KLS X;  2QIE B;  3SHQ A;  1FXT B;  3VUW A;  2YEP F;  4RCO A;  1R7S A;  4WWO A;  4ANV A;  2G4D B;  3AB5 A;  2ACZ B;  2WX1 A;  1GPX A;  1XEE A;  2PW9 A;  3Q3O C;  1DOI A;  2KJR A;  2AX5 A;  1XQQ A;  1RYJ A;  2XK5 B;  1OQQ A;  2LWP A;  1SE9 A;  2KDM A;  2K8B A;  3PS6 A;  2WXF A;  1V80 A;  2CS4 A;  4BVU C;  4XGA B;  1E8W A;  1C78 A;  2KQS A;  3VR9 B;  4TSS A;  1JCK B;  1SE3 A;  1QT9 A;  3Q69 A;  4NAM A;  2R61 A;  3W9C B;  2GLS A;  2DZJ A;  4HJK A;  2MBH A;  3ZRF A;  4RFB A;  4FLH A;  1I4X A;  4IM0 A;  2BS2 B;  2CHW A;  1Q1O A;  4PS7 A;  4YSX B;  2W9N A;  4M01 A;  2DWQ A;  2AL3 A;  5H92 C;  4CYE A;  1TS3 A;  1RRB A;  4LJP B;  5CTR C;  3DVN V;  4WAF A;  2NPT A;  4IDI A;  4WQM A;  1JWS D;  3PLV A;  3WCQ A;  4Q2J A;  3T8M A;  3P4S B;  4EFO A;  4RNA A;  1WR6 E;  1VCB A;  2BF8 B;  1NEN B;  1FM0 D;  4HDQ A;  3R8B A;  1SE4 A;  2MX2 A;  1KOT A;  4KIK A;  2K3U A;  2C9W B;  2FBW B;  1EWY C;  3U7Z A;  2LXA A;  3AEC B;  4HPP A;  1GG3 A;  1E90 A;  5IN7 A;  2WS3 B;  1SEB D;  3LDZ E;  2WXI A;  4L2Y A;  2ZW1 A;  4FJV B;  2GOW A;  5BMG A;  2SAK A;  4W9C A;  5HHD G;  3CMM B;  2PEA A;  3TCA A;  1JWB D;  3NZ3 A;  1I35 A;  4ZRJ A;  2J0K A;  2LRW A;  3V62 A;  3V6E B;  3R7R A;  4NZL B;  2JRH A;  3AEG B;  2INC C;  1AWD A;  1NYQ A;  1J7B A;  1TKE A;  4DDG D;  1WMH B;  2HE7 A;  3TEX A;  3AUL A;  1TGZ B;  2WXH A;  4HVB A;  3AEA B;  1HTQ A;  3P1M A;  2L0T A;  4IG7 B;  1CZP A;  3S2A A;  3AE4 B;  2BT6 A;  2KLC A;  1HZ6 A;  3ZTD A;  2CJN A;  3UIN B;  1T0Q C;  1ZXH A;  3ZNI D;  5D6J B;  2HD5 B;  2J0M A;  3A9J A;  4E74 A;  3OG5 A;  1JW9 D;  1VDV A;  1C9F A;  2EMT A;  3H7S A;  4JLC A;  5EE0 A;  4LTU A;  1I4H A;  4C00 A;  4II2 B;  2O6V A;  3LJ3 A;  2PKO A;  2AQ3 B;  1MVK A;  1L2N A;  2PJH A;  2EMS A;  1IBX B;  2V0G A;  4JWS C;  4GU2 A;  3LYY A;  2W82 A;  2BGF A;  4BKS A;  1V81 A;  1H8C A;  1OGW A;  2R2Q A;  3AE7 B;  3VDZ A;  1HZ5 A;  2L52 A;  5JXV A;  3L17 A;  3V60 A;  2FUG 1;  2N9P C;  5D94 A;  3L08 A;  4KSK C;  2K8C A;  4HKQ A;  4LNK A;  3AE1 B;  1K51 A;  2LRU A;  1V6E A;  1WF9 A;  2QCZ A;  2IPK D;  2PIA A;  3FC4 A;  1FNU A;  3PO0 A;  2N7E A;  4C80 A;  4YL8 A;  2Y5B B;  1XF5 L;  3ZNH B;  3BK1 A;  4R3D A;  2FCQ A;  2ZEQ A;  4ZHO A;  5CX3 A;  3AMZ A;  2N9L A;  2TSS A;  1YD8 U;  3U4E G;  1OEY J;  4JIO U;  4URK A;  3HVZ A;  2K6Q A;  3BVZ A;  3URY A;  1HA5 A;  1V49 A;  2O6V B;  3RMK C;  4I6N B;  4ZYS A;  1YQ4 B;  2J42 A;  1VLB A;  3A1Q A;  5HG2 A;  2JPH A;  1KLU D;  1V86 A;  1HE8 A;  4NJ7 A;  1F2R C;  3ENE A;  1V5T A;  2KAC A;  3AXC A;  4WH4 A;  3TEW A;  2M56 B;  4ZOH C;  1L7Y A;  3DWG C;  1V97 A;  3B1L X;  2D11 A;  2WU2 B;  1WXV A;  2KJ6 A;  2ZCB A;  3NS8 A;  3VFK A;  1GC6 A;  2MJE A;  2WQY B;  1BXT A;  1E10 A;  3PTF C;  4W9L A;  1QLB B;  1JAL A;  3B08 A;  4LNO A;  1I42 A;  3HHM A;  4F8C B;  3SR6 A;  4WAA A;  1T5X D;  4ZRQ A;  3H6N A;  3APC A;  4B0M A;  2KFJ A;  4DQO C;  4OZA A;  4ZRK A;  1TKY A;  1WMH A;  3ZJT A;  2IYD B;  3NVW A;  4LDT D;  4YTM B;  3ZUN A;  2KZR A;  4GGQ A;  4P7I A;  1N5X A;  1WZ3 A;  1CMX B;  2Z0E B;  4LLG M;  1MFW A;  3LXF A;  3N3K B;  1YMH E;  2ZNV C;  3H1U A;  2L00 B;  2V1Y A;  2IDY A;  2L76 A;  4HDO A;  3QQ8 B;  3MC0 B;  1ET6 A;  2PPH A;  1A70 A;  4LDT B;  1FRD A;  3FKY A;  1WE6 A;  3V61 A;  4L1B A;  1FRR A;  4GIV A;  3X23 A;  3AI5 A;  5BMH A;  1CJE A;  2ON8 A;  2OOB B;  2MEK A;  3SFE B;  2PE6 B;  4JWU C;  5G2N A;  4GDL B;  2KYW A;  4MGY E;  4ANU A;  2DYO A;  1PGB A;  2YEP B;  3P4R B;  3C0R B;  1P0R A;  4YSZ B;  1C77 A;  4AUQ C;  3AE3 B;  1WM2 A;  4G3X B;  2KDI A;  1E8X A;  1QOA A;  2EKI A;  3VHT C;  2AWT A;  1H4R A;  1TZO A;  2LD9 A;  2WWZ A;  1C4C A;  5TR5 A;  4G0N B;  1LGR A;  3VRB B;  4WJQ A;  3Q3N C;  3VTW A;  2VH1 A;  3W5V B;  2DHZ A;  5IA7 A;  2GBM A;  1D6E C;  2WXR A;  5D2M B;  2JXT A;  3Q8A A;  4GXB A;  2DEN B;  4GDK A;  1J8C A;  1FO4 A;  1WJ4 A;  1FFV A;  4AOF A;  4KGT A;  4ITK A;  1KFY B;  3APD A;  4KGS A;  1HTO A;  1PQS A;  5FK9 C;  3RZW C;  2INP E;  1EWC A;  4K3C A;  5JH5 C;  2MP2 A;  3KW5 B;  1FEH A;  3DVG Y;  1UZX B;  2N0S B;  2H89 B;  1PGX A;  2HTH A;  4RGN A;  4II3 B;  5L83 A;  4HXD A;  3Q6B A;  1WRI A;  3JW0 X;  3RPF C;  2KDE B;  4RMA A;  4C56 C;  1GOZ A;  2I1J A;  5C23 A;  3BZD B;  3U30 A;  2KMM A;  1TY0 A;  4WJO A;  4DXF A;  2DLB A;  1IGD A;  2JU6 X;  2PVG C;  3VUY A;  1WYW B;  3RUI B;  5D3D A;  2PE9 A;  4JPS A;  3ZIM A;  5JHB A;  2D3B A;  2WDV B;  1NDD A;  2ZW0 A;  3R7Q A;  3FAH A;  2GI9 A;  5J17 A;  1TS2 A;  4WIP A;  2MCN B;  1WGR A;  5E6N A;  3OLM D;  3NG0 A;  3OWE B;  3QWZ B;  3WAL A;  3PVL A;  3DBL B;  2B3A A;  3PV1 A;  4YSY B;  3M95 A;  2IJ0 A;  2N7D A;  3OAW A;  1TJE A;  4OVZ A;  2B76 B;  4XE0 A;  1SB3 C;  4CHK A;  2KAJ A;  2JX5 A;  4EE2 A;  2NTS A;  2BYF A;  1L4D B;  2HJ1 A;  5DPW A;  2WP9 B;  1VR9 A;  3Q3M C;  1TBE A;  3ETR A;  1WXS A;  1OEY A;  3I57 A;  2WU5 B;  1EO6 A;  1ZGU B;  2AL6 A;  4C4V A;  2LZ6 A;  4ICV A;  3KYC D;  4BKG A;  2LFI A;  2ZCC A;  3KWV A;  2MBE A;  3OJ3 A;  2W55 A;  5HI1 A;  3RFZ B;  1ET9 A;  1N61 A;  2WDR B;  4DHZ E;  2M19 A;  4REZ A;  3UQB A;  4XWW A;  4HWI B;  1FNW A;  1L0V B;  3VTV A;  2KFK B;  3CST A;  2FCM A;  2QHO A;  1KM7 A;  3P4P B;  3P63 A;  4EUT A;  3ZNZ B;  1JRU A;  4DBG A;  5J2R A;  4A3P A;  2M1M A;  3D32 A;  1XLP A;  2NS5 A;  3ZGZ A;  4PS8 A;  2MBO A;  4TUU A;  5AZH A;  2BYE A;  4GB9 A;  2KVR A;  2D10 A;  4P1B C;  3VH4 B;  1XXG A;  1C4P A;  4RF0 A;  2RD0 A;  2ZPN A;  3QAR A;  4P16 A;  1ZKH A;  4TMA B;  3SDL C;  1XD3 B;  2DYM A;  1C4A A;  2C7H A;  1VZ8 A;  3W2D A;  2I1K A;  2M0X A;  3P2B A;  3ZDT A;  4YTP B;  2J4X A;  2BKF A;  1L0X B;  5CHF A;  2KMC A;  1F9J A;  4A55 A;  2LVP A;  3DQV A;  2MSE D;  2LGX A;  4FHJ A;  2KTF A;  1ZE3 D;  4W9K A;  5JHA A;  1ROE A;  1FPY A;  1QOB A;  5MPO A;  2QEJ C;  4TQ0 A;  1MG4 A;  2BWE S;  3VH3 B;  5LXH A;  4MM3 A;  3SU8 X;  4K7W A;  4H2A A;  5G5H A;  2REX A;  2ZVO A;  4K3B A;  1AN8 A;  4WUR A;  3PRM B;  5FKA C;  4DWF A;  1D5M C;  3TSS A;  2IY0 B;  3DWM A;  4IM2 A;  1S1Q B;  3SFD B;  2A4Z A;  1YIW A;  2JUO A;  3H8H A;  1C79 A;  2ZJD A;  2Y5C A;  1N6Z A;  1GAQ B;  2BYV E;  4AWJ A;  1RAX A;  4OVU A;  3MJW A;  2D5G A;  4FUL A;  3WA0 A;  2ONQ A;  3NVY A;  5J18 A;  1WFY A;  2RSU A;  1RFA A;  4FBJ B;  4CO7 A;  2JRI B;  3I3T B;  1Q5W B;  3T3N A;  2NTT A;  1TT5 B;  1SSN A;  3ZLZ A;  1XCT L;  3B0A A;  1GB1 A;  3NVV A;  4W9D A;  2ZPY A;  2A5U A;  4L23 A;  1JWU D;  4TQ1 A;  1K52 A;  1N63 A;  1KH0 A;  2D3C A;  5DPT A;  5FR3 A;  4ACF A;  3IFW B;  3MJ5 A;  3ZXV A;  2KT7 A;  1XLQ A;  3DDC B;  1SE2 A;  4DDI D;  4KKJ A;  3H9D A;  4HK2 A;  5E6J A;  2KMA A;  4KZ0 A;  3QA8 A;  5HKH A;  3U52 E;  2AQ2 B;  1LQB A;  1ACC A;  1EF5 A;  3OJ4 B;  4A9A A;  3TJP A;  1PGA A;  1JWM D;  2DZI A;  2N7J A;  2Y5P A;  2V3N A;  5GXG B;  3B9J A;  3N32 A;  3ZKJ C;  3O65 B;  4YT0 B;  2KWU B;  2L8J A;  3KQ4 A;  1SGH A;  2KDB A; 
#chains in the Genus database with same CATH homology
 2IO2 B;  2KD0 A;  3APC A;  2KFJ A;  3A9K A;  4W9J A;  3KH0 A;  1WR1 A;  1OQY A;  4ZRK A;  3ML8 A;  4EZL A;  2DZM A;  1WMH A;  2N4F A;  3GOE A;  1LFD A;  4KSL C;  2JXX A;  2IYD B;  3NZU A;  2KN5 A;  4GDK B;  4LDT D;  2VRR B;  3ZUN A;  2KZR A;  4HPL B;  3ZW3 A;  3H7P B;  2ZNV B;  3A9K B;  1OTR B;  4GGQ A;  2KTR B;  3EC8 A;  1UGM A;  4W9H A;  4DHJ D;  4P7I A;  2IY1 B;  4RM9 A;  3NOB A;  1WXA A;  3JSV A;  1WJN A;  2V4L A;  1WZ3 A;  2D3G A;  2G4S A;  1CMX B;  2Z0E B;  3HM3 A;  3VUX A;  3DPD A;  3DVN U;  2L0F A;  5DPR A;  3Q3J A;  3JSV B;  3AU5 A;  5AEK B;  3N3K B;  4WWN A;  4WJN A;  3IVF A;  2UYZ B;  4TV3 A;  3NZS A;  4W9G A;  3M63 B;  2L3Z A;  2ZNV C;  2L00 B;  2V1Y A;  3H1U A;  4G11 A;  2LI5 A;  2DAJ A;  2N9X A;  2JWZ A;  3HK0 A;  4OVV A;  4PS3 A;  4DXA B;  1WX8 A;  2BKR B;  2C60 A;  2L76 A;  2UWQ A;  4HDO A;  3KUC B;  1NBF C;  3QQ8 B;  2PPH A;  1UD7 A;  4LDT B;  2J0J A;  4HCP B;  3APF A;  3QC8 B;  2BWF A;  3CF6 E;  3A4R A;  1WE6 A;  2KLG A;  5IAA C;  3GZN I;  3RD2 A;  3T9L A;  3V61 A;  3QIJ A;  3RYT A;  4NPN A;  1YQB A;  1WIA A;  4RM8 A;  4EZK A;  3PHX B;  2JF5 A;  1WI0 A;  4GIV A;  3EHV A;  4ZDV A;  3N30 A;  3NY5 A;  4IWP A;  5KHQ A;  3PPA A;  3VTU A;  3X23 A;  4A20 A;  2KK8 A;  3WAP A;  3AI5 A;  3AU4 A;  2C5L C;  1X1M A;  4NAW A;  2KWC A;  3DBS A;  2LVQ A;  4LJO B;  4E71 A;  3WIM A;  2DYB A;  2WYQ A;  4B9K A;  1R4N I;  1RLF A;  2FCN A;  1M94 A;  2IO3 B;  2OOB B;  2LGD A;  2PE6 B;  5G2N A;  3WAM A;  4GDL B;  4KV2 A;  2Z0D B;  4MGY E;  4ANU A;  2DYO A;  2KWV B;  1YJ1 A;  2RPQ A;  4MSQ B;  4N9F 4;  4AJY B;  4E3C A;  5JZE B;  4FAD A;  3C0R B;  4BBN F;  1WY8 A;  1P0R A;  3ECI A;  3CSF A;  4NY0 A;  4AUQ C;  1WJU A;  4WQO B;  1WM2 A;  1S3S G;  4G3X B;  2KDI A;  1E8X A;  3VHT C;  1WH3 A;  1LM8 B;  2AWT A;  4AJW A;  3KYD D;  2KDF B;  1H4R A;  4G50 A;  4IWO A;  2LD9 A;  2WWZ A;  2O2V A;  5TR5 A;  1E8Y A;  3QK0 A;  4FN2 A;  3MTN B;  3L54 A;  4G0N B;  5G55 A;  4WJQ A;  3VTW A;  4X57 B;  5DCN A;  4MH0 E;  5AZF A;  2LJ5 A;  1LXD A;  2DHZ A;  3L0W B;  3A33 B;  3PZD A;  1IPG A;  2GBM A;  3PRZ A;  4KIK B;  5IA7 A;  1WM3 A;  2G3Q B;  2JZ3 B;  1P1A A;  3QAQ A;  5D2M B;  3WAO A;  1A5R A;  3ZDM C;  2KO3 A;  4GXB A;  2DEN B;  4GDK A;  2J7Q B;  1J8C A;  2NBW B;  4KDL B;  1E7U A;  3VXW A;  1XT9 B;  2XK5 A;  2AYO B;  1WJ4 A;  4AOF A;  2EKE C;  3PRP B;  4XX5 A;  3ZO5 B;  4ANW A;  3SD5 A;  2ZZP B;  3WAN A;  3A4S C;  3APD A;  3BY4 B;  4BBN C;  1PQS A;  4MJS A;  1WGD A;  3RZW C;  2NPT B;  5JH5 C;  2MP2 A;  3KW5 B;  3W1S C;  3W1S A;  3DVG Y;  4HCN B;  4IM3 A;  1UZX B;  4BKS D;  2NR2 A;  1WGH A;  3UF8 A;  5FR6 A;  4MGK E;  2HTH A;  2JZZ A;  3KUZ A;  4K1R B;  1NI2 A;  1VD2 A;  2DZK A;  2IBI B;  2KX3 A;  5C1Z A;  1ISN A;  4F7Z A;  4II3 B;  2JT4 B;  5L83 A;  3RCZ A;  2D2Q A;  4HXD A;  3JW0 X;  5EDS A;  2IO0 B;  3U7D A;  4EKU A;  2NVU I;  3QHT A;  2KDE B;  2LUE A;  4RMA A;  2WX0 A;  3NHE B;  3IBE A;  2I1J A;  5C23 A;  1QZE A;  4AP4 C;  2YLM A;  3DBR I;  3SHQ A;  1K8R B;  4DHZ B;  2FNJ B;  1FXT B;  4MJS B;  3TBL D;  3U30 A;  3VUW A;  2FID A;  4WWO A;  4ANV A;  2G4D B;  1ZW7 A;  3ONS A;  2GBK A;  3H7P A;  4WJO A;  1U4A A;  2MBB B;  2K6D B;  2XBB C;  2WX1 A;  3IG3 A;  2V3S A;  3ZRC A;  2KJR A;  2KHW B;  2LGY A;  4DHJ B;  4I6P A;  1V5O A;  1XQQ A;  2IO1 B;  1TZ1 A;  2XK5 B;  4MSM B;  3PGE A;  3VUY A;  1WYW B;  4ZRI A;  3RUI B;  5LXI B;  2PE9 A;  3HIZ A;  3ZIM A;  2LWP A;  2FCS A;  1EUV B;  1SE9 A;  5JHB A;  2K8B A;  4MGZ E;  1NDD A;  3PS6 A;  2MBQ A;  1V80 A;  3R7Q A;  2CS4 A;  4BVU C;  1WX9 A;  2BPS A;  2MCN B;  5J17 A;  1WGR A;  5E6N A;  3OLM D;  3ZVV A;  1E8W A;  3VVW B;  3JYU A;  1WGG A;  1WXM A;  4W9F A;  2KQS A;  5CHV C;  4I6L B;  3U8Z A;  5D7G A;  3QWZ B;  3ZNG C;  4ASW C;  2GBN A;  4GN1 A;  2LVO A;  3WAL A;  2CKH B;  2KJH B;  3PVL A;  3X0W A;  2G45 B;  2DZJ A;  2B3A A;  3PV1 A;  4HJK A;  2MBH A;  3ZRF A;  1D3Z A;  3M95 A;  3PT2 B;  3PLU A;  4FLH A;  4HLE A;  2O2V B;  4IM0 A;  2CHW A;  1Q1O A;  2D07 B;  2N7D A;  3KVF B;  3ML9 A;  3OAW A;  4PS7 A;  2W9N A;  4NJ6 A;  1WZ0 A;  4CHK A;  2L05 A;  4BOZ B;  2M17 A;  2AL3 A;  3RZF A;  1C1Y B;  4CYE A;  4LJP B;  1RRB A;  2CU1 A;  5CTR C;  2BYF A;  2N1V A;  2NBV B;  3DVN V;  4GMV A;  2NPT A;  4K81 A;  2GMI C;  4FHK A;  5DPW A;  1E5W A;  1Z2M A;  3PLV A;  3T8M A;  2RGF A;  4EEW A;  4IC7 B;  4EFO A;  4PYU A;  3DCG A;  1WR6 E;  1VCB A;  2BF8 B;  4MEL A;  1TBE A;  1T0Y A;  3EFU A;  4WJP A;  1WXS A;  1OEY A;  1UBQ A;  2KC2 A;  4K7S A;  4HDQ A;  1EO6 A;  1ZGU B;  4TKN A;  2KFK A;  2AL6 A;  2MX2 A;  4B95 A;  2CHX A;  3DVG X;  2LZ6 A;  4ICV A;  2KC1 A;  3KYC D;  4BKG A;  2MQJ A;  4NQK E;  3PHW B;  1KOT A;  2GBR A;  4KIK A;  2R2O A;  2C9W B;  2ZCC A;  2M8S A;  1V9J A;  2MBE A;  3OJ3 A;  2LXA A;  1GG3 A;  1E90 A;  4ZYN A;  3UIP B;  4DHZ E;  1GC7 A;  2JVC A;  2LAS A;  1KLV A;  1YX5 B;  2KTR A;  3BIN A;  3LDZ E;  2JY6 A;  4NQL B;  4W9E A;  2XEW A;  3UQB A;  1WX7 A;  4HWI B;  4NAW B;  3VQI A;  2KAN A;  1KJT A;  3VTV A;  4HPM B;  1WE7 A;  2KFK B;  3CST A;  2FCM A;  2QHO A;  4FJV B;  1C3T A;  2GOW A;  1KM7 A;  1J19 A;  3DBH I;  2C7N B;  4W9C A;  4EUT A;  3CMM B;  3ZNZ B;  2PEA A;  4GDL A;  1JRU A;  3TCA A;  4DBG A;  2C7M B;  3M3J A;  4XC2 A;  5J2R A;  4A3P A;  2M1M A;  3D32 A;  2HJ8 A;  1I35 A;  4ZRJ A;  2J0K A;  2LRW A;  2MRP A;  3JVZ X;  1Y8R C;  3A9J B;  4F1S A;  2NS5 A;  3V62 A;  3V6E B;  3R7R A;  4BOS C;  4PS8 A;  2MBO A;  4TUU A;  5AZH A;  2JRH A;  2BYE A;  1P9D U;  1IP9 A;  4GB9 A;  3V6C B;  2AEH A;  1V2Y A;  2KVR A;  4DDG D;  1WMH B;  1R4M I;  2D10 A;  2HE7 A;  3VH4 B;  3AUL A;  4JGH B;  1TGZ B;  4HVB A;  1WGY A;  2MA9 B;  2YVC A;  2L0T A;  4IG7 B;  2KXJ A;  2RD0 A;  3S2A A;  2ZPN A;  3QAR A;  1ZKH A;  3SDL C;  1XD3 B;  2DYM A;  2C7H A;  2KLC A;  3PRE A;  4JQW C;  3ZTD A;  3ALB A;  2I1K A;  3UIN B;  4EOY A;  3ZNI D;  5D6J B;  2HD5 B;  2M0X A;  3P2B A;  2J0M A;  3A9J A;  2MP2 B;  2ZVN A;  3K9O B;  3VAW A;  4E74 A;  3ZDT A;  2KKC A;  4FJY A;  2CHZ A;  2FUH B;  2BKF A;  2Z59 B;  2K8H A;  2EMT A;  3H7S A;  3PSE B;  1WJ6 A;  4JLC A;  3QCA A;  5CHF A;  2KMC A;  1F9J A;  2LVP A;  2N1W A;  3W1Y A;  3DQV A;  1P98 A;  3RT3 B;  2MSE D;  3L13 A;  4MGI E;  2LGX A;  4FHJ A;  2KTF A;  2GBJ A;  2K39 A;  3ZTC A;  4IUM B;  2KNB A;  4W9K A;  4II2 B;  4BKT A;  4XZ4 A;  2O6V A;  1YX6 B;  3LJ3 A;  5JHA A;  3KUD B;  1Q0W B;  4TQ0 A;  2BWE S;  2WDT B;  3VH3 B;  5LXH A;  1L2N A;  4MM3 A;  2PJH A;  3SU8 X;  4K7W A;  4GOC A;  2EMS A;  2M4N A;  2REX A;  3TMP B;  2L7R A;  4GU2 A;  4A3O A;  4MDK E;  2IZV B;  2ZVO A;  3TIX A;  2BGF A;  4BKS A;  1V81 A;  1H8C A;  1OGW A;  3PRM B;  2R2Q A;  1WRD B;  5BO4 B;  2FAZ A;  4DWF A;  3VDZ A;  1UH6 A;  2IY0 B;  4IM2 A;  1S1Q B;  3Q3F A;  2A4Z A;  3L17 A;  1YIW A;  3V60 A;  3K9P B;  2JUO A;  4LCD E;  5E6P A;  2N9P C;  3EEC A;  5D94 A;  2ZJD A;  3L08 A;  1IYF A;  4KSK C;  2BYV E;  2K8C A;  3QJZ A;  4AWJ A;  3TL5 A;  4KVG B;  1RAX A;  4M8N A;  4OVU A;  3MJW A;  2NCN A;  2KX0 A;  2LRU A;  1V6E A;  1WF9 A;  2MLB A;  4KDI C;  2K25 A;  4FUL A;  3WA0 A;  3RUL A;  5J18 A;  1WFY A;  1G6J A;  2O6V D;  2N7E A;  2RSU A;  4JL9 A;  2NBU A;  4YL8 A;  4FA6 A;  2LXC A;  2RR9 A;  4DK5 A;  1RFA A;  3IHP C;  4FBJ B;  4MEM A;  5KHO A;  4ICU A;  4CO7 A;  4M8M A;  2OJR A;  2JRI B;  2Y5B B;  4GSW A;  1SIF A;  3ZNH B;  2KQ7 A;  3I3T B;  1Q5W B;  3UGB B;  2FCQ A;  5E6O A;  2ZEQ A;  1BT0 A;  5DPS A;  1UBI A;  1AAR A;  4W9I A;  3DBL I;  5CX3 A;  1E8Z A;  3ZLZ A;  1YD8 U;  5L95 C;  1GJZ A;  1OEY J;  4IW0 A;  3A1Q B;  3B0A A;  4JIO U;  4URK A;  1GUA B;  2K6Q A;  2N9E B;  4IWQ A;  4W9D A;  1J0G A;  2ZPY A;  1V49 A;  2A5U A;  2O6V B;  2MWS B;  1MG8 A;  4I6N B;  3UIO B;  4TQ1 A;  1GNU A;  3M62 B;  4J6I A;  1Z5S B;  3A1Q A;  2DAF A;  5DPT A;  3MHS D;  3IFW B;  2JPH A;  1E7V A;  1V86 A;  1HE8 A;  2DX5 B;  4NJ7 A;  4B6W A;  3DDC B;  3ENE A;  2MW5 A;  1V5T A;  4DDI D;  4K7U A;  2KOX A;  4WWP A;  3AXC A;  4EZJ A;  2CR5 A;  3H9D A;  5AZG A;  3R66 C;  1L7Y A;  4HK2 A;  5GMV A;  3QX1 A;  3B1L X;  2KMA A;  4KZC A;  2D11 A;  4KZ0 A;  1WXV A;  2KJ6 A;  2ZCB A;  3NS8 A;  3R3M A;  3QA8 A;  5HKH A;  3VFK A;  1GC6 A;  1LQB A;  4ANX A;  4PYZ A;  1UEL A;  5LLI A;  1EF5 A;  5CHW A;  3OJ4 B;  1EF1 A;  3DOW A;  3TJP A;  1P3Q U;  3HM6 X;  3L16 A;  3UQA A;  2DZI A;  3PTF C;  2K1F A;  4W9L A;  2FIF A;  3B08 A;  3N32 A;  4NNJ B;  3ZKJ C;  1I42 A;  3HHM A;  3O65 B;  3L10 B;  4M0W B;  2ASQ A;  2KWU B;  2L8J A;  4F8C B;  4BFR A;  4WAA A;  3H6N A;  1SGH A;  2KDB A;  4FJZ A;  1TTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...