4W9EA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 4)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9eA00
1KM7A 2LXCA 2MBBB 5IA7A 5TR5A 4II3B 3RCZA 4ICVA 2KANA 4JIOU 3UGBB 2JRIB 1IP9A 2JZ3B 1F9JA 4M8NA 5G55A 4RM8A 3NHEB 5CHFA 2KFKB 3TL5A 2R2OA 2ZZPB 4GIVA 1WJ4A 4A3PA 1V5OA 2JRHA 4BBNF 4DK5A 1GUAB 2NPTA 3IFWB 3DVGX 5CTRC 2RPQA 5E6NA 1LXDA 4W9JA 3L16A 4PS7A 2K39A 1QZEA 1UBIA 3A4RA 4K7SA 4XX5A 3VDZA 4GMVA 4AOFA 2IO2B 1H8CA 4FADA 2MX2A 4IWPA 4B6WA 2N4FA 2D2QA 2O2VA 4IWQA 4K1RB 5J18A 3QQ8B 2NBWB 3DVGY 3ZVVA 4B95A 1D3ZA 4HPMB 2CKHB 2XK5B 2KD0A 3PRZA 1Y8RC 4ZRKA 2WWZA 2NPTB 1WGDA 4LJOB 3H9DA 4K7UA 3PLVA 3KYCD 5D2MB 4G3XB 4RMAA 5LXHA 3EECA 3CMMB 5HKHA 4LJPB 2HJ8A 4W9CA 2L05A 2MA9B 3R66C 4MJSB 4CHKA 3QAQA 3TCAA 4ZRJA 3R3MA 2W9NA 3X23A 3ZW3A 4MGKE 3VUWA 3P2BA 2BKFA 2LWPA 4MH0E 1V81A 3B0AA 5DPSA 3T9LA 1ISNA 4E71A 2GBKA 3QJZA 2MBOA 3WIMA 3APFA 3MJWA 2YVCA 1SE9A 3ECIA 4PYZA 2D10A 4IM0A 3OLMD 4MGZE 4KDIC 2YLMA 1UD7A 3JVZX 2KMAA 4PYUA 3QIJA 4LDTD 1WGGA 1WXVA 3U8ZA 1ZKHA 1WH3A 2IY1B 2UWQA 1YJ1A 4ANVA 4A20A 1S3SG 2IBIB 3OJ3A 2C5LC 2IY0B 1WX8A 2IO0B 2MBQA 2PEAA 3IVFA 2B3AA 5DCNA 3CF6E 2JT4B 3LDZE 1WM2A 2V4LA 2KJRA 2MW5A 2Z0EB 4E74A 1OEYA 3UQAA 2LJ5A 4GSWA 4ZDVA 4FJZA 4EZJA 2RGFA 3CSTA 1L7YA 5D7GA 1E8ZA 2AWTA 4P7IA 3SU8X 4GXBA 3UIOB 4IM3A 2KQ7A 2PE9A 2LVQA 4GGQA 2R2QA 2KHWB 3AXCA 4M8MA 4TV3A 1G6JA 1J0GA 3I3TB 4GOCA 4NNJB 3PVLA 2BPSA 5L83A 2MQJA 4DDGD 2RD0A 3DVNU 3ZLZA 2CHWA 3L0WB 2FUHB 3APCA 3IHPC 2L0TA 2FCQA 3QX1A 2KTFA 1Z2MA 4PS3A 5GMVA 4RM9A 1LQBA 1V2YA 4FN2A 5AZFA 2N9XA 3SD5A 4CO7A 4EEWA 2LASA 3DOWA 3V6CB 3EHVA 4MEMA 1TTNA 2K6DB 3V61A 2KWVB 2OOBB 2MBEA 1TZ1A 1WMHA 3VVWB 3V62A 1WGRA 3MTNB 4JLCA 4BKSA 3PRPB 2KDFB 2DAJA 3T8MA 2HTHA 5D6JB 4FHKA 4WJOA 4BOSC 2IYDB 4XC2A 4JL9A 3VH3B 4FA6A 2KTRB 2DAFA 2KDEB 4NAWB 1TBEA 2KFJA 2CHXA 1V86A 1WXAA 1R4NI 1WX9A 4GU2A 4HDOA 4HXDA 4NQKE 2I1KA 4GDKA 1GC6A 4AJWA 4ANUA 2FCMA 4XZ4A 3PGEA 1WFYA 3TJPA 4AWJA 2NS5A 1KJTA 3V60A 3ENEA 2MP2B 2O6VA 4G50A 3A1QA 3H6NA 4W9IA 2LVPA 1TGZB 2MRPA 2KC2A 2WX1A 2DYOA 3NS8A 1P9DU 1GG3A 3C0RB 3QARA 3N30A 3VUYA 1WZ0A 3RT3B 3L17A 2MBHA 2JXXA 1WI0A 3ZIMA 2LD9A 4BKSD 2JF5A 3M3JA 4W9HA 2Z0DB 2KK8A 4HCNB 2ZPYA 1CMXB 1XQQA 3QCAA 2D11A 2MLBA 2ZCBA 4KV2A 4M0WB 4W9DA 2AL6A 4WQOB 4FHJA 3JW0X 1VCBA 2DZKA 1I42A 3PRMB 1EF5A 2D07B 2OJRA 4KSKC 1XD3B 1PQSA 3L54A 2KLCA 3MHSD 2GBRA 3V6EB 4DWFA 2BKRB 2JUOA 3VFKA 4TUUA 3ZKJC 3WAMA 2AL3A 3PTFC 2C9WB 1WR6E 4KZCA 3TBLD 2LXAA 1V5TA 3DBRI 1XT9B 3RZWC 1E8XA 3Q3JA 1H4RA 2J7QB 4HVBA 2KDIA 2M17A 1WR1A 3D32A 2FCNA 2KJ6A 2KN5A 4DXAB 3NZSA 1A5RA 4G11A 1RLFA 5E6PA 4EFOA 5DPRA 4W9GA 3DBSA 4NJ7A 1P1AA 2DYBA 2LGYA 4MDKE 2NBUA 4TQ0A 1GNUA 1WF9A 2KMCA 5JZEB 3K9OB 2REXA 1V49A 4J6IA 1UELA 2M8SA 4K7WA 2QHOA 3GOEA 3TMPB 1E5WA 3KUZA 3WAPA 1ZGUB 3CSFA 4BOZB 1OGWA 4KDLB 2KC1A 4FULA 2G3QB 3GZNI 2KX0A 3A33B 4IM2A 1E90A 3H7PB 4X57B 4A3OA 3A1QB 2PPHA 4LCDE 4JGHB 4TQ1A 5FR6A 1EO6A 4HWIB 4F1SA 4BKGA 5JHAA 3AU5A 1OQYA 3UINB 4K81A 5AEKB 2G45B 3DQVA 2ZVOA 2N7EA 3W1YA 5C23A 1SIFA 5J2RA 3AI5A 1RRBA 4NAWA 4KIKA 3U7DA 2C7HA 2V3SA 1T0YA 2ZJDA 3APDA 3BY4B 1E7VA 5J17A 2NBVB 1WGHA 3JSVA 3SHQA 2N9PC 1LM8B 4AJYB 3ZRCA 4FJYA 2ZNVC 3HIZA 4DHZE 1L2NA 2KFKA 3N32A 2FCSA 3VXWA 3A9JB 1WE6A 3VUXA 1Z5SB 2KO3A 4WJPA 4HCPB 3VHTC 4YL8A 1YQBA 2UYZB 4MGIE 4WAAA 2BWES 5CX3A 5DPTA 3ZDMC 4GB9A 2GMIC 1OEYJ 4HDQA 5AZGA 3K9PB 1IYFA 4N9F4 2KZRA 4FJVB 4WWNA 4MSMB 2GOWA 3QC8B 4DHJD 4HLEA 1WX7A 4ICUA 4DHJB 1C3TA 4IC7B 2XBBC 2FAZA 2WYQA 2KNBA 3HM3A 2NCNA 1WE7A 1WXMA 3KUDB 3AU4A 2DX5B 2D3GA 2DZIA 4PS8A 1P0RA 2KDBA 1WYWB 2KLGA 3AULA 3ZTDA 2JZZA 4WWPA 1LFDA 3UF8A 3L08A 1WMHB 2RR9A 1WXSA 2LUEA 2WX0A 3NOBA 2DYMA 2VRRB 2BWFA 3A9KB 2IZVB 3ALBA 3KW5B 4EOYA 2LVOA 2L00B 1WZ3A 2ZEQA 4KZ0A 3IBEA 5D94A 1WIAA 1K8RB 2KX3A 4ANXA 1EUVB 1RFAA 3DPDA 3PT2B 4B9KA 4F8CB 4IWOA 3W1SA 4E3CA 3M95A 2LI5A 5CHVC 1R4MI 1NI2A 3ZO5B 2WDTB 3H7SA 2EMSA 2JY6A 3RZFA 4W9EA 3QA8A 3U30A 2K8BA 3KUCB 1V6EA 3LJ3A 3QHTA 5E6OA 1UH6A 4EZKA 3UIPB 1WRDB 3H1UA 3OAWA 2MCNB 2HE7A 3QK0A 1WY8A 2A5UA 2MWSB 3B08A 3DVNV 1E7UA 4KSLC 2IO3B 5IAAC 2N7DA 2K8HA 3H7PA 4BBNC 3HM6X 3IG3A 4MM3A 2L76A 4GN1A 2EMTA 2AYOB 4NPNA 2L0FA 2K25A 2C7NB 1V80A 2KVRA 4IW0A 1KLVA 2DHZA 3PREA 3M63B 1WJ6A 4BFRA 4MELA 4MSQB 2IO1B 4KVGB 5EDSA 2J0KA 1FXTB 2CS4A 2L7RA 3PSEB 4WJNA 3ZNID 2FIDA 4ASWC 3Q3FA 2CR5A 2JVCA 2ZNVB 2PJHA 2K1FA 3HHMA 2C7MB 1Q5WB 4EUTA 2XEWA 4NY0A 2O2VB 3SDLC 2LRUA 2M1MA 1VD2A 3OJ4B 5BO4B 3JSVB 2ZVNA 4I6PA 2M0XA 4MJSA 2N1VA 3TIXA 5LXIB 3KVFB 4HJKA 1C1YB 3PZDA 3N3KB 1J8CA 1KOTA 2G4DB 3EC8A 2LGXA 3A4SC 3RUIB 2LGDA 3PPAA 2DZMA 3PHWB 1P3QU 4FBJB 5AZHA 2MP2A 2EKEC 2CU1A 2O6VB 3VTVA 1GJZA 1YX6B 1E8YA 2PE6B 3ONSA 2Y5BB 3S2AA 3ML8A 4NQLB 2G4SA 2KJHB 4OVVA 4WWOA 4AP4C 4FLHA 3WAOA 3W1SC 1Q1OA 1YIWA 4G0NB 1UBQA 1JRUA 1MG8A 1GC7A 2GBNA 2I1JA 3VTWA 4DDID 4W9FA 2XK5A 2K6QA 5DPWA 2LRWA 3X0WA 2KWCA 3ZRFA 2BYVE 2BF8B 1HE8A 4HK2A 3R7RA 4ANWA 1NDDA 2ZPNA 2LZ6A 2MSED 3NY5A 2KWUB 3ZTCA 4F7ZA 2CHZA 2RSUA 3KYDD 2BGFA 3PV1A 3VQIA 3VTUA 1YD8U 2BYEA 3L13A 1WJUA 2KKCA 1RAXA 4CYEA 2ZCCA 3A9KA 1V9JA 3EFUA 1OTRB 2N9EB 4EZLA 2J0MA 5JH5C 1U4AA 4DHZB 4I6NB 3BINA 1I35A 4BVUC 3ZDTA 3DBLI 5C1ZA 2KXJA 2JPHA 4JQWC 5CHWA 3PLUA 3VH4B 4AUQC 2NVUI 4I6LB 2BYFA 4GDLB 3WALA 3RULA 1IPGA 4ZYNA 2L3ZA 2GBJA 2J0JA 2M4NA 1EF1A 2C60A 5L95C 3ZNZB 3B1LX 3WA0A 2N1WA 4ZRIA 1ZW7A 1NBFC 2GBMA 2A4ZA 4EKUA 3M62B 5KHOA 4LDTB 3L10B 5G2NA 1Q0WB 2JWZA 1M94A 1E8WA 2K8CA 3DDCB 3HK0A 5LLIA 3JYUA 4GDLA 3RYTA 3WANA 1YX5B 3PS6A 1WJNA 1BT0A 4TKNA 1P98A 3A9JA 1SGHA 3NZUA 2NR2A 2FIFA 3DBHI 4URKA 2HD5B 3R7QA 5KHQA 3UQBA 3ZUNA 2O6VD 4BKTA 2KOXA 2FNJB 1UGMA 4W9KA 3VAWA 2V1YA 1S1QB 1J19A 2KQSA 3O65B 3DCGA 1AARA 4IUMB 4WJQA 4GDKB 1X1MA 2Z59B 3RD2A 2ASQA 4W9LA 4KIKB 4OVUA 1WM3A 3PHXB 4II2B 2AEHA 4MGYE 2KTRA 4NJ6A 4DBGA 2L8JA 3ML9A 3KH0A 3ZNGC 2DENB 2DZJA 4HPLB 3ZNHB 1WGYA 1UZXB 5JHBA 4IG7B 3QWZB
chains in the Genus database with same CATH superfamily
5IA7A 2MBBB 5AUKA 2CJNA 3RCZA 3UGBB 1C78A 2JZ3B 1IBXB 1CZPA 2YEPB 5C2TB 4P1CC 3RNBC 2ZZPB 1WJ4A 1WYGA 1TT5B 4A3PA 1V5OA 4BBNF 4DK5A 4OHJA 1LXDA 4PS7A 3Q8FA 2LMCA 2QCZA 2N4FA 1SF0A 3QQ8B 5EE1A 2NPTB 2VZKD 5D2MB 3E56A 3N1ZC 1L0VB 2BYTA 4MT5A 5HKHA 1EU4A 4W9CA 2L05A 2MA9B 3TCAA 4ZRJA 3J9CA 3VUWA 2IGGA 3T9LA 1I4QA 2H88B 2WU5B 3QJZA 4D2KA 3IT4B 3MJWA 2L1AA 3ECIA 4WIPA 5MPOA 2M56B 2YLMA 3I5JC 1UD7A 2VZKB 1HZ6A 3QIJA 3Q69A 3AV8A 2UWQA 4ANVA 1MI0A 1TS3A 2IY0B 4KKJA 2B3AA 3RNAC 3BYTB 2Z0EB 1ZDVA 1DGJA 3LXFA 1ZOYB 4ZDVA 5D7GA 1E8ZA 2AWTA 3AH7A 1C4CA 4P7IA 5BMHA 1FMAD 4GXBA 3AEGB 3EGRA 4GGQA 2LVQA 3I3TB 4NNJB 2MQJA 3W2DA 3ZLZA 4TMAB 2QDFA 3L0WB 2ACZB 3QX1A 1E6EB 4ARIA 2KTFA 2V4IB 2K9XA 3DBHB 1JRPA 5GMVA 1LQBA 4FN2A 5AZFA 5IP4D 1D5MC 3EHVA 4ITKA 1TTNA 3V61A 2KWVB 4LK0M 1FIQA 4P16A 4RH6A 5D6JB 2IYDB 3VH3B 2DAFA 2KDEB 2KFJA 3GB1A 1ENFA 1WX9A 4GDKA 3HRDD 4AJWA 4ANUA 4XZ4A 1YJIA 1QILA 1N60A 2VH2A 3V60A 2MP2B 2J53A 3A1QA 4W9IA 2MRPA 3QARA 3RT3B 3L17A 2LD9A 1KTKA 2HJ1A 2JF5A 2M19A 3M3JA 3VR8B 1MG4A 1XQQA 2PTLA 2MLBA 2ZCBA 4WURA 2AL6A 4FHJA 1VCBA 2D07B 1L0YB 2WXQA 3FILA 3L54A 1FFUA 2GBRA 1E7PB 4HROA 4TUUA 2AL3A 1CJEA 3TBLD 1DYQA 1ZXIA 3RZWC 1XT9B 1WR1A 2KJ6A 4DXAB 1TY2A 3AE4B 5BYRA 1RLFA 3DBSA 2NBUA 2KMCA 5JZEB 1SXTA 4M01A 1OQRA 1V49A 4J6IA 3AEEB 3I63C 1F2RI 2W3SA 3HVZA 4L23A 4C00A 4FULA 2G3QB 3GZNI 4NZLB 1VZ8A 4JGHB 1EO6A 4BKGA 1R4NB 4K81A 2G45B 2INCC 3U7DA 2L52A 4C56C 1KRHA 3APDA 4WH4A 5J17A 2NBVB 1A70A 2E3TA 2Y5PA 1XCTL 3Q14C 4MH8A 3VXWA 1IBXA 3R8BA 1TIFA 2PMVA 3FKYA 2UU7A 3K9PB 5BYQA 4MSMB 1KLGD 4OZAA 3AB5A 1C3TA 4IC7B 2KNBA 2QIEB 1C76A 2NCNA 1WXMA 3BVMA 3AU4A 1K50A 2DZIA 2RDHA 3ZTDA 1KLUD 4WWPA 2AX5A 5IN7A 1WXSA 1UNSA 1MPEA 1FNWA 1JROA 2L00B 2ZEQA 3IBEA 2HTME 1ROEA 4REZA 4B9KA 3M95A 3ZO5B 3RZFA 3QA8A 3U30A 4RFBA 1TS2A 4EZKA 4JWUC 3DVNV 2IO3B 2N7DA 2QJLA 4NPNA 3ZJTA 1YN5A 2BB5A 1ET6A 3M63B 1WJ6A 3FILB 5EDSA 3ZNID 2CS4A 1RM6C 3Q3FA 2C7MB 4NY0A 2O2VB 2LRUA 2JQRB 3P63A 5BO4B 3TIXA 1C1YB 2WP9B 1KOTA 3EC8A 4J3OD 1JW9D 3PPAA 3VRAB 2XN9C 2MP2A 1VJKA 2EKEC 3NVWA 3FC4A 3Q8BA 4AP4C 1NI3A 2BW2A 1Q10A 1GC7A 4WQMA 2LRWA 3X0WA 1HE8A 2ZPNA 1J7CA 3I9V1 4DXFA 1XXGA 2LZ6A 2MSED 5HI1A 3NY5A 4QAYA 3AE2B 3ZTCA 3KYDD 2RSUA 1YD8U 2BYEA 2KMMA 1RAXA 2INPE 1D5ZC 4BVUC 2BS3B 4LNOA 2V3PA 4YSYB 1I4GA 2NVUI 4GDLB 3WALA 3RULA 2GBJA 4UDUC 4RF1A 3B1LX 3WA0A 2N1WA 2GBMA 3M62B 5KHOA 4OZBA 1Q0WB 2BB6A 3RYTA 4M02A 3DDCB 3PS6A 1WJNA 3BVZA 4TKNA 3NZUA 1SGHA 4MM3B 1JCKB 3B2GA 3O13A 5KHQA 3ZUNA 2JYTA 4C80A 1S1QB 1J19A 3RMKC 3B2FA 2L32A 4EE2A 1GB4A 1T0SC 2VH1A 1EWYC 1C4AA 1UZXB 4US8A 1KM7A 2LXCA 1XCQL 5TR5A 3IXSA 4ICVA 2JRIB 1IP9A 2PW9A 4RGNA 2BS2B 4M8NA 4IOIE 4RM8A 3NHEB 2R2OA 3L4PA 1P7EA 2BQQA 1GUAB 1AN8A 2NPTA 3IFWB 5CTRC 5TSSA 3GE8C 4OZCA 3A4RA 2SEBD 4AOFA 4GMVA 3NVZA 5H92C 1PDXA 2CJOA 5J18A 1PGBA 4B95A 4S17A 2CKHB 2AQ2B 1Y8RC 3B9JA 5BYSA 1WGDA 4K7UA 3MJ5A 4RMAA 5LXHA 3EECA 4LJPB 2HJ8A 1ZP0B 3SEBA 3QAQA 2WXJA 2W9NA 4LLGM 4MH0E 1FO4A 2GBKA 1PGAA 5C3JB 2QMTA 3JVZX 1JWAD 4LDTD 1WGGA 1WH3A 2IY1B 1T3QA 3AEBB 4A20A 2IGHA 2MJEA 2IBIB 2IO0B 5DCNA 2Z8LA 5GXGB 3LDZE 2BVCA 3AEDB 2KJRA 2MW5A 2KAJA 4E74A 1XLNA 4FJZA 2RGFA 1L7YA 4M8MA 2KQ7A 4TV3A 3GS2A 1G6JA 4XYCA 4XWWA 5L83A 3DVNU 1FNVA 4RGOS 3KQ4A 2W3RA 3EA6A 4KGSA 1N5WA 1Z2MA 2YEPF 1B1ZA 1PGXA 2N9XA 3ZQ4A 3V6CB 4B0EA 1P7FA 4BKSA 3PRPB 2KDFB 3P1MA 3IAM1 1TKYA 4WJOA 1NEKB 1AWDA 4FA6A 1TBEA 1V86A 2KDMA 1LGRA 1WFYA 3DHHC 3TJPA 1N62A 3NVYA 3ENEA 1M4VA 2HDEA 1TY0A 2WX1A 1GG3A 3C0RB 4C7YA 3VUYA 1VZ6A 2MBHA 1WI0A 2JYEA 4W9HA 2KK8A 4HCNB 4B0MA 1CMXB 3QCAA 2D11A 4M0WB 3MC9A 4W9DA 1SE2A 3JW0X 2OJRA 1NYRA 4R3DA 1XD3B 3V6EB 2WHIA 4YTNB 3ZKJC 3WAMA 2D3BA 4KZCA 1GAQB 4HVBA 2KDIA 2M17A 2KN5A 3TEWA 3NZSA 2JZPA 5E6PA 1KF6B 2QSDA 4OVZA 3MFGA 4BAXA 1P1AA 4TQ0A 1RWSA 1GNUA 1WF9A 4HKZE 1L5PA 2WXFA 2QEJC 3TMPB 1E5WA 3KUZA 4KDLB 2KC1A 4IM2A 3H7PB 1SJED 1I4PA 2JXTA 4A3OA 4A55A 4LCDE 4TQ1A 3Q3NC 1T6BX 5FR6A 1RFKA 4HWIB 4F1SA 2QILA 3AU5A 4ZHPA 3UINB 3DQVA 3VRBB 2OEDA 4AS1A 2ON8A 1SIFA 2LHEA 4NAWA 2C7HA 3AM9A 2ZJDA 1E7VA 1KH0A 4HKQA 2LFIA 5BMIA 1LM8B 2DWQA 5EE0A 3ZRCA 4FJYA 1FD6A 2WXHA 4XGAB 1STEA 3N20C 1L2NA 3N32A 1VR9A 3UI3A 2WXMA 3SFDB 3A9JB 3VUXA 2KO3A 5FK9C 1C77A 3VHTC 1T5XD 4YL8A 1V1OA 5JXVA 2BWES 5DPTA 2NTSA 4HDQA 2V3NA 1MVKA 4DHJD 1WX7A 1D5XC 2INNE 2WYQA 3AEAB 1WE7A 3ABVB 4PS8A 1HTOA 1WYWB 2KLGA 3AULA 2JZZA 1WGKA 1MJDA 2PIAA 1YNTE 2IJ0A 3A9KB 4EOYA 3KW5B 5D94A 1EUVB 1RFAA 3PT2B 1FNUA 4F8CB 4E3CA 3BK2A 1NI2A 4JE3B 2EMSA 1K52A 3OG5A 2K8BA 1V6EA 3EUB2 3I57A 1WRDB 2MCNB 3V05A 3QK0A 1WY8A 3BIID 1E7UA 4KSLC 2G9HD 2K8HA 1R4MB 3IG3A 4MM3A 1ZUD2 1JWBD 1Y56A 2GI9A 4KKIA 4HEA1 3WCQA 4MSQB 2IO1B 2J0KA 1FXTB 2FIDA 2CR5A 2JVCA 1LO5D 1SBBB 1TZOA 2EELA 2XEWA 4EUTA 2IGDA 2M1MA 3TEYA 2N1VA 3KVFB 4XDDA 3TEXA 2KYWA 3PZDA 1FRRA 3RI7C 2DZMA 2RMMA 4FBJB 5AZHA 2O6VB 1YX6B 3TEZA 4NQLB 2G4SA 1WSPA 4G0NB 1FM0D 3U2SC 4L2YA 1UBQA 1JWUD 1JRUA 2I1JA 4W9FA 3RNGC 2KWCA 4FXCA 4HK2A 4XDCA 3Q8AA 2LEKA 4F7ZA 2BGFA 3VQIA 1F52A 3HUIA 1WJUA 2ZCCA 3EFUA 1YMHE 2N9EB 2CU3A 4I6NB 3BINA 4NAMA 3ZDTA 3DBLI 2MH7A 5C1ZA 1FXIA 2WLBA 1JWSD 1IGDA 2JU6X 2GRIA 2JPHA 5CHWA 3PLUA 3VH4B 4AUQC 2WS3B 4I6LB 3TUOA 2BS4B 1L6UA 4ZYNA 2J0JA 2N9KA 2M4NA 1EF1A 2C60A 3ZNZB 1L4ZB 1ZW7A 3P42A 4EKUA 5G2NA 2JWZA 2K8CA 1E8WA 3HK0A 1MFWA 3ZGZA 1VZ7A 2FIFA 4URKA 2Y5CA 5LNK1 3DHIC 1UGMA 4W9KA 3VAWA 2KQSA 3O65B 1QKZA 4GDKB 1X1MA 1FRDA 1WM3A 4II2B 4MGYE 3ML9A 3KH0A 2I2YA 1QQRA 2DENB 2DZJA 4HPLB 3ZNHB 1ACCA 1WGYA 4IKGA 2WXNA 4II3B 4JIOU 2KANA 1HZ5A 3AE8B 2BT6A 5CHFA 2KFKB 3DWMA 4GIVA 2JRHA 3Q6BA 4C4VB 2KACA 2RPQA 1EM7A 4W9JA 3L16A 4USAA 3AE9B 4K7SA 3VDZA 1RYJA 2IO2B 1ESFA 4HPPA 2R61A 4IWQA 3DVGY 3ZVVA 4CQNA 4HPMB 2XK5B 2MJDA 2KD0A 4ZRKA 2WWZA 3U52E 3CIRB 3H9DA 1R7SA 1XLPA 2N9LA 3CMMB 2AQ1B 3R66C 4MJSB 4PT5A 3ZW3A 4MGKE 3P2BA 5G5GA 2BKFA 2LWPA 5IKCM 3IAS1 5DPSA 1ISNA 2MBOA 3WIMA 1V97A 1NENB 1XEEA 3OLMD 2ZW1A 2OHFA 4PYUA 1ZKHA 4C4VA 3LYYA 1YJ1A 1FCCC 1S3SG 2C5LC 1WX8A 2PEAA 4H2AA 2L83A 3IVFA 3C8YA 2LHDA 3CF6E 2JT4B 2G1EA 1WM2A 1D4BA 4YTMB 3UQAA 4PK1A 3AE7B 1UUPA 3SU8X 3UIOB 4IM3A 2PE9A 2KHWB 3AXCA 2RDBC 1J0GA 3VR9B 2XNAC 2CHWA 2KT7A 1IUEA 1L6VA 2FUHB 3AN1A 3APCA 2L0TA 3AMZA 3OWEB 3RNFC 4RM9A 5FR3A 4KX6B 3SD5A 2LASA 2LUMA 3DOWA 4MEMA 5HHDG 1FEHA 2K6DB 1TZ1A 1WMHA 3V62A 3MTNB 2DAJA 4BOSC 4FHKA 4YWGG 3AE5B 1F1HA 4JL9A 1JQ4A 2KTRB 4NAWB 1BUIC 2CHXA 4GU2A 4HDOA 1R4NI 4NQKE 4HXDA 2I1KA 3N9YC 4RNAA 2FCMA 3PGEA 3NS1A 4AWJA 4G50A 3H6NA 3ZXVA 2LVPA 1TGZB 3GE3C 1AW7A 2KC2A 5HFYA 1P9DU 1WRIA 1TS5A 3MP9A 2JXXA 3ZIMA 1KFYB 4C7ZA 1XF5L 2ZPYA 2WGSA 2J52A 4KV2A 4LNKA 4WWMA 2INDC 3GP7A 1CQVA 1PQSA 2KLCA 4DWFA 2BKRB 2JUOA 1GOZA 3PTFC 2C9WB 1JWMD 1WR6E 2LXAA 4AQ7A 4ZRPA 1E8XA 3Q3JA 2FCNA 4KGTA 2WXPA 2N7JA 1NYQA 5DPRA 4W9GA 3V3XA 4NJ7A 2DYBA 2LGYA 4MDKE 2WXRA 3P4SB 1IGCA 2REXA 2FUG1 1UELA 2M8SA 3GOEA 1UWMA 3WAPA 1ZGUB 4Q2JA 3IT6B 4BOZB 4JPSA 1YOVB 1E90A 4MACA 4X57B 2PPHA 2W54A 5AUIA 1OQYA 5AEKB 2WDVB 2FBWB 1VDVA 1HEZE 1RRBA 4KIKA 1J7AA 4ZOHC 1T0YA 1L4DB 3SHQA 1I7HA 4O1NA 4RF0A 2N9PC 4AJYB 2ZNVC 2KFKA 2W55A 5IOIA 1YQ3B 1Z5SB 3ZJVA 4HCPB 2KWDA 1I4XA 1YQBA 2MJ3A 3TSSA 4MGIE 1UGJA 4WAAA 5CX3A 4GB9A 2GMIC 5AZGA 4N9F4 4ACFA 2KZRA 2GOWA 4HLEA 4ICUA 2D5GA 2XBBC 3HM3A 3KUDB 4LNFA 2DX5B 2D3GA 3U7ZA 2KDBA 1WWTA 3Q3OC 3UF8A 1V1PA 3BWUD 4IDIA 2RR9A 4ARCA 3NOBA 2DYMA 2VRRB 2BWFA 1ZE3D 2IZVB 2LVOA 2KVZA 4KZ0A 1DOYA 1WIAA 1D6EC 1SE3A 1K8RB 2KX3A 3DPDA 3PZ8A 2KQ4X 2LI5A 3NG0A 1J7BA 1R4MI 2WDTB 1HA5A 1QLBB 4W9EA 1MHXA 1NVID 3LJ3A 3QHTA 5E6OA 3DBLB 3UIPB 3OAWA 2A5UA 3B08A 1TJEA 3H7PA 2L0FA 3P4PB 2C7NB 4IW0A 2DHZA 2TSSA 3PREA 4BFRA 4MELA 4KVGB 3PSEB 2ZNVB 2LJIA 2PJHA 2RDGA 1Q5WB 4GLSC 3SDLC 2PKOA 2D3AA 1VD2A 3OJ4B 3JSVB 2ZVNA 2KN4A 4HJKA 2ONQA 4XWTA 2G4DB 2LGXA 3A4SC 3RUIB 2WQYB 3PHWB 1P3QU 1SEBD 3VTVA 1GJZA 1E8YA 2PE6B 2IDYA 3ONSA 4WWOA 3WAOA 2BBCA 3VTWA 2GBNA 4DDID 3P4RB 2M0AA 5DPWA 4M0WA 2BYVE 1PYWD 2BF8B 4P1BC 1ET9A 2E6XA 3R7RA 4ANWA 4K3CA 3Q8CA 1BMLC 3RPFC 2CHZA 4ZHOA 3VTUA 3RNCC 4DXGA 3L13A 3N1XC 2KKCA 1V9JA 4EZLA 2J0MA 1V8CA 2K3UA 4BZAA 1I35A 3NRZA 2KXJA 2W82A 3RFZB 3PO0A 2DNFA 4JQWC 4WAFA 5IO9A 2WXOA 1QT9A 1IPGA 2L3ZA 3NJTA 5L95C 2K22A 4ZRIA 1NBFC 3L10B 5LLIA 1FCLA 4HRSA 4GDLA 1WXQA 1BT0A 1HXYD 1F2RC 2NR2A 2WU2B 3SR6A 2JX5A 3P4QB 4LNIA 4BKTA 1QF6A 2FNJB 2V1YA 3DCGA 1B9RA 4WJQA 2N0SB 2LGIA 4KIKB 3U4EG 2AEHA 2V0GA 2L8JA 1ZDXA 4RGMA 1YN4A 3UQBA 3QWZB 2MEKA 2WNMA 1F9JA 1BXTA 5G55A 3TL5A 2GLSA 3DVGX 4K3BA 4N6EB 5E6NA 4OW0A 2K39A 1QZEA 1UBIA 4A6QA 5I4DA 4XX5A 1H8CA 4FADA 1SE4A 2MX2A 4IWPA 4B6WA 2D2QA 2O2VA 4K1RB 1N6ZA 2NBWB 1UWXA 1D3ZA 4S0RA 3PRZA 2K5PA 4LJOB 3PLVA 3KYCD 1HQRD 4G3XB 2B76B 3KWVA 4CHKA 3CWIA 2MHJA 3R3MA 3LB8C 3X23A 3T3NA 1JMLA 1V81A 1GPXA 3AE6B 1HTQA 3B0AA 3NUHB 4E71A 3MHZA 3NZ3A 3APFA 2YVCA 1SE9A 4PYZA 2D10A 4IM0A 4MGZE 4KDIC 1XLOA 2KMAA 1WXVA 2PVGC 3U8ZA 1QOGA 3Q2AC 3OJ3A 3RN9C 1N63A 2MBQA 4US9A 1XLQA 1MHHE 2V4LA 1OEYA 2NMQA 3HVDA 1XO3A 5EE9A 2LJ5A 3ETRA 4GSWA 4EZJA 5E6JA 3CSTA 4M00A 4RCOA 3ZYYX 2R2QA 2BTEA 2H89B 4GOCA 3PVLA 2BPSA 4DDGD 2RD0A 1E10A 2J4XA 3IHPC 2FCQA 1K51A 4PS3A 1V2YA 4CO7A 4EEWA 3DBRB 2OOBB 2MBEA 3VVWB 1F0ZA 1WGRA 4JLCA 4RGTA 1YJJA 1PFDA 3T8MA 2HTHA 4XC2A 1YQ4B 5FKAC 1WXAA 4A9AA 1GC6A 2DLBA 3URYA 2NS5A 1KJTA 3Q8EA 2O6VA 4A8XC 3E9SA 2DYOA 3NS8A 3N30A 3ZXRA 1UF0A 1QOBA 1WZ0A 2V9HA 4P6VF 4BKSD 2Z0DB 4KGRA 1FFVA 4WQOB 1I42A 1FPYA 3FAHA 2DZKA 1DOXA 1N5XA 1EF5A 3PRMB 3W5VB 1E9MA 4KSKC 3MC8A 3MHSD 3DHGC 3VFKA 2X8XX 2AQ3B 4YSXB 1V5TA 3DBRI 1H4RA 2J7QB 1VLBA 3W9CB 3D32A 5H8YE 1A5RA 4G11A 4EFOA 4YTPB 2QC8A 3Q3MC 3C19A 3K9OB 1TYGB 4LNNA 4K7WA 2QHOA 1L0XB 3BK1A 3BYYB 4YSZB 1SB3C 3CSFA 1OGWA 2D3CA 3GZNB 2KX0A 3A33B 3R2TA 5D3DA 3H8HA 1SJHD 1QOFA 3A1QB 5G5HA 2J42A 5JHAA 3BZDB 2ZVOA 2N7EA 3RNEC 3W1YA 5C23A 1TKGA 5J2RA 3AI5A 2JSVX 2V3SA 3BY4B 1ZPSA 1WGHA 3JSVA 1OFFA 2EKIA 3R2IA 3HIZA 4DHZE 2FCSA 1WE6A 4WJPA 4DQOC 2WDRB 2SAKA 2UYZB 4ZRQA 3ZDMC 1OEYJ 1IYFA 3NVVA 4FJVB 4WWNA 3QC8B 4DHJB 2FAZA 1F77A 1P0RA 4HJGE 3EFCA 1LFDA 3L08A 3AE1B 1WMHB 1VRAB 2LUEA 1GB1A 2WX0A 3ALBA 3PZ7A 1WZ3A 1N61A 1PUTA 1QOAA 1T0RC 3N1YC 5T8IA 1I4RA 4ANXA 4JWSC 4YXDB 4IWOA 3W1SA 5CHVC 4A90A 2PLPA 2Q5WD 1V1PB 3H7SA 2JY6A 2WDQB 1CK1A 3KUCB 5HG2A 1UH6A 4N59A 3H1UA 2Y3AA 2HE7A 4YT0B 2MWSB 5IAAC 4BBNC 3SFEB 3HM6X 2L76A 4GN1A 3AEFB 2EMTA 2AYOB 2K25A 1JALA 4TSSA 1C79A 1V80A 2KVRA 1KLVA 5BMGA 2ZW0A 4WJNA 2L7RA 1ZXHA 4ASWC 1DOIA 2IPKD 2K1FA 3HHMA 2NTTA 4N58A 3W5UB 4I6PA 2M0XA 4MJSA 5LXIB 2X38A 3N3KB 1J8CA 2LGDA 2CU1A 2Y5BB 3S2AA 3ML8A 4OVVA 2KJHB 1E0ZA 4FLHA 3AECB 3W1SC 1Q1OA 1YIWA 4L1BA 1MG8A 1T0QC 1SIJA 2I38A 2XK5A 2K6QA 3ZRFA 2LGSA 1NDDA 2RPVA 3KWLA 2PVOD 2KWUB 3BVGA 3PV1A 4CYEA 3A9KA 1OTRB 2WXGA 2WXKA 3MC0B 4JX1C 2JWUA 5JH5C 1U4AA 1YN3A 4DHZB 1C9FA 1EWCA 4LTUA 5EE3A 1K53A 4ZYSA 2WXLA 2ICIA 2BYFA 1OQQA 2FE8A 2A4ZA 4XE0A 4LDTB 1M94A 3WANA 3T3OA 3JYUA 2OJWA 1FXAA 1YX5B 1P98A 1I4HA 3A9JA 4NJCA 3DBHI 1C4PA 2HD5B 2WXIA 3DWGC 3R7QA 2O6VD 2KOXA 1SSNA 2GB1A 5D3IB 1AYFA 1AARA 4IUMB 3AE3B 3ZJUA 2DBYA 2K0PA 2Z59B 3RD2A 2ASQA 4W9LA 1EU3A 4OVUA 3PHXB 2KTRA 4NJ6A 3KLSX 4DBGA 3ZNGC 1TS4A 5JHBA 4IG7B 1TKEA
chains in the Genus database with same CATH topology
1KM7A 2LXCA 2MBBB 5IA7A 5TR5A 4II3B 3RCZA 4ICVA 2KANA 4JIOU 3UGBB 2JRIB 1IP9A 2JZ3B 1F9JA 4M8NA 5G55A 4RM8A 3NHEB 5CHFA 2KFKB 3TL5A 2R2OA 2ZZPB 4GIVA 1WJ4A 4A3PA 1V5OA 2JRHA 4BBNF 4DK5A 1GUAB 2NPTA 3IFWB 3DVGX 5CTRC 2RPQA 5E6NA 1LXDA 4W9JA 3L16A 4PS7A 2K39A 1QZEA 1UBIA 3A4RA 4K7SA 4XX5A 3VDZA 4GMVA 4AOFA 2IO2B 1H8CA 4FADA 2MX2A 4IWPA 4B6WA 2N4FA 2D2QA 2O2VA 4IWQA 4K1RB 5J18A 3QQ8B 2NBWB 3DVGY 3ZVVA 4B95A 1D3ZA 4HPMB 2CKHB 2XK5B 2KD0A 3PRZA 1Y8RC 4ZRKA 2WWZA 2NPTB 1WGDA 4LJOB 3H9DA 4K7UA 3PLVA 3KYCD 5D2MB 4G3XB 4RMAA 5LXHA 3EECA 3CMMB 5HKHA 4LJPB 2HJ8A 4W9CA 2L05A 2MA9B 3R66C 4MJSB 4CHKA 3QAQA 3TCAA 4ZRJA 3R3MA 2W9NA 3X23A 3ZW3A 4MGKE 3VUWA 3P2BA 2BKFA 2LWPA 4MH0E 1V81A 3B0AA 5DPSA 3T9LA 1ISNA 4E71A 2GBKA 3QJZA 2MBOA 3WIMA 3APFA 3MJWA 2YVCA 1SE9A 3ECIA 4PYZA 2D10A 4IM0A 3OLMD 4MGZE 4KDIC 2YLMA 1UD7A 3JVZX 2KMAA 4PYUA 3QIJA 4LDTD 1WGGA 1WXVA 3U8ZA 1ZKHA 1WH3A 2IY1B 2UWQA 1YJ1A 4ANVA 4A20A 1S3SG 2IBIB 3OJ3A 2C5LC 2IY0B 1WX8A 2IO0B 2MBQA 2PEAA 3IVFA 2B3AA 5DCNA 3CF6E 2JT4B 3LDZE 1WM2A 2V4LA 2KJRA 2MW5A 2Z0EB 4E74A 1OEYA 3UQAA 2LJ5A 4GSWA 4ZDVA 4FJZA 4EZJA 2RGFA 3CSTA 1L7YA 5D7GA 1E8ZA 2AWTA 4P7IA 3SU8X 4GXBA 3UIOB 4IM3A 2KQ7A 2PE9A 2LVQA 4GGQA 2R2QA 2KHWB 3AXCA 4M8MA 4TV3A 1G6JA 1J0GA 3I3TB 4GOCA 4NNJB 3PVLA 2BPSA 5L83A 2MQJA 4DDGD 2RD0A 3DVNU 3ZLZA 2CHWA 3L0WB 2FUHB 3APCA 3IHPC 2L0TA 2FCQA 3QX1A 2KTFA 1Z2MA 4PS3A 5GMVA 4RM9A 1LQBA 1V2YA 4FN2A 5AZFA 2N9XA 3SD5A 4CO7A 4EEWA 2LASA 3DOWA 3V6CB 3EHVA 4MEMA 1TTNA 2K6DB 3V61A 2KWVB 2OOBB 2MBEA 1TZ1A 1WMHA 3VVWB 3V62A 1WGRA 3MTNB 4JLCA 4BKSA 3PRPB 2KDFB 2DAJA 3T8MA 2HTHA 5D6JB 4FHKA 4WJOA 4BOSC 2IYDB 4XC2A 4JL9A 3VH3B 4FA6A 2KTRB 2DAFA 2KDEB 4NAWB 1TBEA 2KFJA 2CHXA 1V86A 1WXAA 1R4NI 1WX9A 4GU2A 4HDOA 4HXDA 4NQKE 2I1KA 4GDKA 1GC6A 4AJWA 4ANUA 2FCMA 4XZ4A 3PGEA 1WFYA 3TJPA 4AWJA 2NS5A 1KJTA 3V60A 3ENEA 2MP2B 2O6VA 4G50A 3A1QA 3H6NA 4W9IA 2LVPA 1TGZB 2MRPA 2KC2A 2WX1A 2DYOA 3NS8A 1P9DU 1GG3A 3C0RB 3QARA 3N30A 3VUYA 1WZ0A 3RT3B 3L17A 2MBHA 2JXXA 1WI0A 3ZIMA 2LD9A 4BKSD 2JF5A 3M3JA 4W9HA 2Z0DB 2KK8A 4HCNB 2ZPYA 1CMXB 1XQQA 3QCAA 2D11A 2MLBA 2ZCBA 4KV2A 4M0WB 4W9DA 2AL6A 4WQOB 4FHJA 3JW0X 1VCBA 2DZKA 1I42A 3PRMB 1EF5A 2D07B 2OJRA 4KSKC 1XD3B 1PQSA 3L54A 2KLCA 3MHSD 2GBRA 3V6EB 4DWFA 2BKRB 2JUOA 3VFKA 4TUUA 3ZKJC 3WAMA 2AL3A 3PTFC 2C9WB 1WR6E 4KZCA 3TBLD 2LXAA 1V5TA 3DBRI 1XT9B 3RZWC 1E8XA 3Q3JA 1H4RA 2J7QB 4HVBA 2KDIA 2M17A 1WR1A 3D32A 2FCNA 2KJ6A 2KN5A 4DXAB 3NZSA 1A5RA 4G11A 1RLFA 5E6PA 4EFOA 5DPRA 4W9GA 3DBSA 4NJ7A 1P1AA 2DYBA 2LGYA 4MDKE 2NBUA 4TQ0A 1GNUA 1WF9A 2KMCA 5JZEB 3K9OB 2REXA 1V49A 4J6IA 1UELA 2M8SA 4K7WA 2QHOA 3GOEA 3TMPB 1E5WA 3KUZA 3WAPA 1ZGUB 3CSFA 4BOZB 1OGWA 4KDLB 2KC1A 4FULA 2G3QB 3GZNI 2KX0A 3A33B 4IM2A 1E90A 3H7PB 4X57B 4A3OA 3A1QB 2PPHA 4LCDE 4JGHB 4TQ1A 5FR6A 1EO6A 4HWIB 4F1SA 4BKGA 5JHAA 3AU5A 1OQYA 3UINB 4K81A 5AEKB 2G45B 3DQVA 2ZVOA 2N7EA 3W1YA 5C23A 1SIFA 5J2RA 3AI5A 1RRBA 4NAWA 4KIKA 3U7DA 2C7HA 2V3SA 1T0YA 2ZJDA 3APDA 3BY4B 1E7VA 5J17A 2NBVB 1WGHA 3JSVA 3SHQA 2N9PC 1LM8B 4AJYB 3ZRCA 4FJYA 2ZNVC 3HIZA 4DHZE 1L2NA 2KFKA 3N32A 2FCSA 3VXWA 3A9JB 1WE6A 3VUXA 1Z5SB 2KO3A 4WJPA 4HCPB 3VHTC 4YL8A 1YQBA 2UYZB 4MGIE 4WAAA 2BWES 5CX3A 5DPTA 3ZDMC 4GB9A 2GMIC 1OEYJ 4HDQA 5AZGA 3K9PB 1IYFA 4N9F4 2KZRA 4FJVB 4WWNA 4MSMB 2GOWA 3QC8B 4DHJD 4HLEA 1WX7A 4ICUA 4DHJB 1C3TA 4IC7B 2XBBC 2FAZA 2WYQA 2KNBA 3HM3A 2NCNA 1WE7A 1WXMA 3KUDB 3AU4A 2DX5B 2D3GA 2DZIA 4PS8A 1P0RA 2KDBA 1WYWB 2KLGA 3AULA 3ZTDA 2JZZA 4WWPA 1LFDA 3UF8A 3L08A 1WMHB 2RR9A 1WXSA 2LUEA 2WX0A 3NOBA 2DYMA 2VRRB 2BWFA 3A9KB 2IZVB 3ALBA 3KW5B 4EOYA 2LVOA 2L00B 1WZ3A 2ZEQA 4KZ0A 3IBEA 5D94A 1WIAA 1K8RB 2KX3A 4ANXA 1EUVB 1RFAA 3DPDA 3PT2B 4B9KA 4F8CB 4IWOA 3W1SA 4E3CA 3M95A 2LI5A 5CHVC 1R4MI 1NI2A 3ZO5B 2WDTB 3H7SA 2EMSA 2JY6A 3RZFA 4W9EA 3QA8A 3U30A 2K8BA 3KUCB 1V6EA 3LJ3A 3QHTA 5E6OA 1UH6A 4EZKA 3UIPB 1WRDB 3H1UA 3OAWA 2MCNB 2HE7A 3QK0A 1WY8A 2A5UA 2MWSB 3B08A 3DVNV 1E7UA 4KSLC 2IO3B 5IAAC 2N7DA 2K8HA 3H7PA 4BBNC 3HM6X 3IG3A 4MM3A 2L76A 4GN1A 2EMTA 2AYOB 4NPNA 2L0FA 2K25A 2C7NB 1V80A 2KVRA 4IW0A 1KLVA 2DHZA 3PREA 3M63B 1WJ6A 4BFRA 4MELA 4MSQB 2IO1B 4KVGB 5EDSA 2J0KA 1FXTB 2CS4A 2L7RA 3PSEB 4WJNA 3ZNID 2FIDA 4ASWC 3Q3FA 2CR5A 2JVCA 2ZNVB 2PJHA 2K1FA 3HHMA 2C7MB 1Q5WB 4EUTA 2XEWA 4NY0A 2O2VB 3SDLC 2LRUA 2M1MA 1VD2A 3OJ4B 5BO4B 3JSVB 2ZVNA 4I6PA 2M0XA 4MJSA 2N1VA 3TIXA 5LXIB 3KVFB 4HJKA 1C1YB 3PZDA 3N3KB 1J8CA 1KOTA 2G4DB 3EC8A 2LGXA 3A4SC 3RUIB 2LGDA 3PPAA 2DZMA 3PHWB 1P3QU 4FBJB 5AZHA 2MP2A 2EKEC 2CU1A 2O6VB 3VTVA 1GJZA 1YX6B 1E8YA 2PE6B 3ONSA 2Y5BB 3S2AA 3ML8A 4NQLB 2G4SA 2KJHB 4OVVA 4WWOA 4AP4C 4FLHA 3WAOA 3W1SC 1Q1OA 1YIWA 4G0NB 1UBQA 1JRUA 1MG8A 1GC7A 2GBNA 2I1JA 3VTWA 4DDID 4W9FA 2XK5A 2K6QA 5DPWA 2LRWA 3X0WA 2KWCA 3ZRFA 2BYVE 2BF8B 1HE8A 4HK2A 3R7RA 4ANWA 1NDDA 2ZPNA 2LZ6A 2MSED 3NY5A 2KWUB 3ZTCA 4F7ZA 2CHZA 2RSUA 3KYDD 2BGFA 3PV1A 3VQIA 3VTUA 1YD8U 2BYEA 3L13A 1WJUA 2KKCA 1RAXA 4CYEA 2ZCCA 3A9KA 1V9JA 3EFUA 1OTRB 2N9EB 4EZLA 2J0MA 5JH5C 1U4AA 4DHZB 4I6NB 3BINA 1I35A 4BVUC 3ZDTA 3DBLI 5C1ZA 2KXJA 2JPHA 4JQWC 5CHWA 3PLUA 3VH4B 4AUQC 2NVUI 4I6LB 2BYFA 4GDLB 3WALA 3RULA 1IPGA 4ZYNA 2L3ZA 2GBJA 2J0JA 2M4NA 1EF1A 2C60A 5L95C 3ZNZB 3B1LX 3WA0A 2N1WA 4ZRIA 1ZW7A 1NBFC 2GBMA 2A4ZA 4EKUA 3M62B 5KHOA 4LDTB 3L10B 5G2NA 1Q0WB 2JWZA 1M94A 1E8WA 2K8CA 3DDCB 3HK0A 5LLIA 3JYUA 4GDLA 3RYTA 3WANA 1YX5B 3PS6A 1WJNA 1BT0A 4TKNA 1P98A 3A9JA 1SGHA 3NZUA 2NR2A 2FIFA 3DBHI 4URKA 2HD5B 3R7QA 5KHQA 3UQBA 3ZUNA 2O6VD 4BKTA 2KOXA 2FNJB 1UGMA 4W9KA 3VAWA 2V1YA 1S1QB 1J19A 2KQSA 3O65B 3DCGA 1AARA 4IUMB 4WJQA 4GDKB 1X1MA 2Z59B 3RD2A 2ASQA 4W9LA 4KIKB 4OVUA 1WM3A 3PHXB 4II2B 2AEHA 4MGYE 2KTRA 4NJ6A 4DBGA 2L8JA 3ML9A 3KH0A 3ZNGC 2DENB 2DZJA 4HPLB 3ZNHB 1WGYA 1UZXB 5JHBA 4IG7B 3QWZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KM7 A;  2LXC A;  2MBB B;  5IA7 A;  5TR5 A;  4II3 B;  3RCZ A;  4ICV A;  2KAN A;  4JIO U;  3UGB B;  2JRI B;  1IP9 A;  2JZ3 B;  1F9J A;  4M8N A;  5G55 A;  4RM8 A;  3NHE B;  5CHF A;  2KFK B;  3TL5 A;  2R2O A;  2ZZP B;  4GIV A;  1WJ4 A;  4A3P A;  1V5O A;  2JRH A;  4BBN F;  4DK5 A;  1GUA B;  2NPT A;  3IFW B;  3DVG X;  5CTR C;  2RPQ A;  5E6N A;  1LXD A;  4W9J A;  3L16 A;  4PS7 A;  2K39 A;  1QZE A;  1UBI A;  3A4R A;  4K7S A;  4XX5 A;  3VDZ A;  4GMV A;  4AOF A;  2IO2 B;  1H8C A;  4FAD A;  2MX2 A;  4IWP A;  4B6W A;  2N4F A;  2D2Q A;  2O2V A;  4IWQ A;  4K1R B;  5J18 A;  3QQ8 B;  2NBW B;  3DVG Y;  3ZVV A;  4B95 A;  1D3Z A;  4HPM B;  2CKH B;  2XK5 B;  2KD0 A;  3PRZ A;  1Y8R C;  4ZRK A;  2WWZ A;  2NPT B;  1WGD A;  4LJO B;  3H9D A;  4K7U A;  3PLV A;  3KYC D;  5D2M B;  4G3X B;  4RMA A;  5LXH A;  3EEC A;  3CMM B;  5HKH A;  4LJP B;  2HJ8 A;  4W9C A;  2L05 A;  2MA9 B;  3R66 C;  4MJS B;  4CHK A;  3QAQ A;  3TCA A;  4ZRJ A;  3R3M A;  2W9N A;  3X23 A;  3ZW3 A;  4MGK E;  3VUW A;  3P2B A;  2BKF A;  2LWP A;  4MH0 E;  1V81 A;  3B0A A;  5DPS A;  3T9L A;  1ISN A;  4E71 A;  2GBK A;  3QJZ A;  2MBO A;  3WIM A;  3APF A;  3MJW A;  2YVC A;  1SE9 A;  3ECI A;  4PYZ A;  2D10 A;  4IM0 A;  3OLM D;  4MGZ E;  4KDI C;  2YLM A;  1UD7 A;  3JVZ X;  2KMA A;  4PYU A;  3QIJ A;  4LDT D;  1WGG A;  1WXV A;  3U8Z A;  1ZKH A;  1WH3 A;  2IY1 B;  2UWQ A;  1YJ1 A;  4ANV A;  4A20 A;  1S3S G;  2IBI B;  3OJ3 A;  2C5L C;  2IY0 B;  1WX8 A;  2IO0 B;  2MBQ A;  2PEA A;  3IVF A;  2B3A A;  5DCN A;  3CF6 E;  2JT4 B;  3LDZ E;  1WM2 A;  2V4L A;  2KJR A;  2MW5 A;  2Z0E B;  4E74 A;  1OEY A;  3UQA A;  2LJ5 A;  4GSW A;  4ZDV A;  4FJZ A;  4EZJ A;  2RGF A;  3CST A;  1L7Y A;  5D7G A;  1E8Z A;  2AWT A;  4P7I A;  3SU8 X;  4GXB A;  3UIO B;  4IM3 A;  2KQ7 A;  2PE9 A;  2LVQ A;  4GGQ A;  2R2Q A;  2KHW B;  3AXC A;  4M8M A;  4TV3 A;  1G6J A;  1J0G A;  3I3T B;  4GOC A;  4NNJ B;  3PVL A;  2BPS A;  5L83 A;  2MQJ A;  4DDG D;  2RD0 A;  3DVN U;  3ZLZ A;  2CHW A;  3L0W B;  2FUH B;  3APC A;  3IHP C;  2L0T A;  2FCQ A;  3QX1 A;  2KTF A;  1Z2M A;  4PS3 A;  5GMV A;  4RM9 A;  1LQB A;  1V2Y A;  4FN2 A;  5AZF A;  2N9X A;  3SD5 A;  4CO7 A;  4EEW A;  2LAS A;  3DOW A;  3V6C B;  3EHV A;  4MEM A;  1TTN A;  2K6D B;  3V61 A;  2KWV B;  2OOB B;  2MBE A;  1TZ1 A;  1WMH A;  3VVW B;  3V62 A;  1WGR A;  3MTN B;  4JLC A;  4BKS A;  3PRP B;  2KDF B;  2DAJ A;  3T8M A;  2HTH A;  5D6J B;  4FHK A;  4WJO A;  4BOS C;  2IYD B;  4XC2 A;  4JL9 A;  3VH3 B;  4FA6 A;  2KTR B;  2DAF A;  2KDE B;  4NAW B;  1TBE A;  2KFJ A;  2CHX A;  1V86 A;  1WXA A;  1R4N I;  1WX9 A;  4GU2 A;  4HDO A;  4HXD A;  4NQK E;  2I1K A;  4GDK A;  1GC6 A;  4AJW A;  4ANU A;  2FCM A;  4XZ4 A;  3PGE A;  1WFY A;  3TJP A;  4AWJ A;  2NS5 A;  1KJT A;  3V60 A;  3ENE A;  2MP2 B;  2O6V A;  4G50 A;  3A1Q A;  3H6N A;  4W9I A;  2LVP A;  1TGZ B;  2MRP A;  2KC2 A;  2WX1 A;  2DYO A;  3NS8 A;  1P9D U;  1GG3 A;  3C0R B;  3QAR A;  3N30 A;  3VUY A;  1WZ0 A;  3RT3 B;  3L17 A;  2MBH A;  2JXX A;  1WI0 A;  3ZIM A;  2LD9 A;  4BKS D;  2JF5 A;  3M3J A;  4W9H A;  2Z0D B;  2KK8 A;  4HCN B;  2ZPY A;  1CMX B;  1XQQ A;  3QCA A;  2D11 A;  2MLB A;  2ZCB A;  4KV2 A;  4M0W B;  4W9D A;  2AL6 A;  4WQO B;  4FHJ A;  3JW0 X;  1VCB A;  2DZK A;  1I42 A;  3PRM B;  1EF5 A;  2D07 B;  2OJR A;  4KSK C;  1XD3 B;  1PQS A;  3L54 A;  2KLC A;  3MHS D;  2GBR A;  3V6E B;  4DWF A;  2BKR B;  2JUO A;  3VFK A;  4TUU A;  3ZKJ C;  3WAM A;  2AL3 A;  3PTF C;  2C9W B;  1WR6 E;  4KZC A;  3TBL D;  2LXA A;  1V5T A;  3DBR I;  1XT9 B;  3RZW C;  1E8X A;  3Q3J A;  1H4R A;  2J7Q B;  4HVB A;  2KDI A;  2M17 A;  1WR1 A;  3D32 A;  2FCN A;  2KJ6 A;  2KN5 A;  4DXA B;  3NZS A;  1A5R A;  4G11 A;  1RLF A;  5E6P A;  4EFO A;  5DPR A;  4W9G A;  3DBS A;  4NJ7 A;  1P1A A;  2DYB A;  2LGY A;  4MDK E;  2NBU A;  4TQ0 A;  1GNU A;  1WF9 A;  2KMC A;  5JZE B;  3K9O B;  2REX A;  1V49 A;  4J6I A;  1UEL A;  2M8S A;  4K7W A;  2QHO A;  3GOE A;  3TMP B;  1E5W A;  3KUZ A;  3WAP A;  1ZGU B;  3CSF A;  4BOZ B;  1OGW A;  4KDL B;  2KC1 A;  4FUL A;  2G3Q B;  3GZN I;  2KX0 A;  3A33 B;  4IM2 A;  1E90 A;  3H7P B;  4X57 B;  4A3O A;  3A1Q B;  2PPH A;  4LCD E;  4JGH B;  4TQ1 A;  5FR6 A;  1EO6 A;  4HWI B;  4F1S A;  4BKG A;  5JHA A;  3AU5 A;  1OQY A;  3UIN B;  4K81 A;  5AEK B;  2G45 B;  3DQV A;  2ZVO A;  2N7E A;  3W1Y A;  5C23 A;  1SIF A;  5J2R A;  3AI5 A;  1RRB A;  4NAW A;  4KIK A;  3U7D A;  2C7H A;  2V3S A;  1T0Y A;  2ZJD A;  3APD A;  3BY4 B;  1E7V A;  5J17 A;  2NBV B;  1WGH A;  3JSV A;  3SHQ A;  2N9P C;  1LM8 B;  4AJY B;  3ZRC A;  4FJY A;  2ZNV C;  3HIZ A;  4DHZ E;  1L2N A;  2KFK A;  3N32 A;  2FCS A;  3VXW A;  3A9J B;  1WE6 A;  3VUX A;  1Z5S B;  2KO3 A;  4WJP A;  4HCP B;  3VHT C;  4YL8 A;  1YQB A;  2UYZ B;  4MGI E;  4WAA A;  2BWE S;  5CX3 A;  5DPT A;  3ZDM C;  4GB9 A;  2GMI C;  1OEY J;  4HDQ A;  5AZG A;  3K9P B;  1IYF A;  4N9F 4;  2KZR A;  4FJV B;  4WWN A;  4MSM B;  2GOW A;  3QC8 B;  4DHJ D;  4HLE A;  1WX7 A;  4ICU A;  4DHJ B;  1C3T A;  4IC7 B;  2XBB C;  2FAZ A;  2WYQ A;  2KNB A;  3HM3 A;  2NCN A;  1WE7 A;  1WXM A;  3KUD B;  3AU4 A;  2DX5 B;  2D3G A;  2DZI A;  4PS8 A;  1P0R A;  2KDB A;  1WYW B;  2KLG A;  3AUL A;  3ZTD A;  2JZZ A;  4WWP A;  1LFD A;  3UF8 A;  3L08 A;  1WMH B;  2RR9 A;  1WXS A;  2LUE A;  2WX0 A;  3NOB A;  2DYM A;  2VRR B;  2BWF A;  3A9K B;  2IZV B;  3ALB A;  3KW5 B;  4EOY A;  2LVO A;  2L00 B;  1WZ3 A;  2ZEQ A;  4KZ0 A;  3IBE A;  5D94 A;  1WIA A;  1K8R B;  2KX3 A;  4ANX A;  1EUV B;  1RFA A;  3DPD A;  3PT2 B;  4B9K A;  4F8C B;  4IWO A;  3W1S A;  4E3C A;  3M95 A;  2LI5 A;  5CHV C;  1R4M I;  1NI2 A;  3ZO5 B;  2WDT B;  3H7S A;  2EMS A;  2JY6 A;  3RZF A;  4W9E A;  3QA8 A;  3U30 A;  2K8B A;  3KUC B;  1V6E A;  3LJ3 A;  3QHT A;  5E6O A;  1UH6 A;  4EZK A;  3UIP B;  1WRD B;  3H1U A;  3OAW A;  2MCN B;  2HE7 A;  3QK0 A;  1WY8 A;  2A5U A;  2MWS B;  3B08 A;  3DVN V;  1E7U A;  4KSL C;  2IO3 B;  5IAA C;  2N7D A;  2K8H A;  3H7P A;  4BBN C;  3HM6 X;  3IG3 A;  4MM3 A;  2L76 A;  4GN1 A;  2EMT A;  2AYO B;  4NPN A;  2L0F A;  2K25 A;  2C7N B;  1V80 A;  2KVR A;  4IW0 A;  1KLV A;  2DHZ A;  3PRE A;  3M63 B;  1WJ6 A;  4BFR A;  4MEL A;  4MSQ B;  2IO1 B;  4KVG B;  5EDS A;  2J0K A;  1FXT B;  2CS4 A;  2L7R A;  3PSE B;  4WJN A;  3ZNI D;  2FID A;  4ASW C;  3Q3F A;  2CR5 A;  2JVC A;  2ZNV B;  2PJH A;  2K1F A;  3HHM A;  2C7M B;  1Q5W B;  4EUT A;  2XEW A;  4NY0 A;  2O2V B;  3SDL C;  2LRU A;  2M1M A;  1VD2 A;  3OJ4 B;  5BO4 B;  3JSV B;  2ZVN A;  4I6P A;  2M0X A;  4MJS A;  2N1V A;  3TIX A;  5LXI B;  3KVF B;  4HJK A;  1C1Y B;  3PZD A;  3N3K B;  1J8C A;  1KOT A;  2G4D B;  3EC8 A;  2LGX A;  3A4S C;  3RUI B;  2LGD A;  3PPA A;  2DZM A;  3PHW B;  1P3Q U;  4FBJ B;  5AZH A;  2MP2 A;  2EKE C;  2CU1 A;  2O6V B;  3VTV A;  1GJZ A;  1YX6 B;  1E8Y A;  2PE6 B;  3ONS A;  2Y5B B;  3S2A A;  3ML8 A;  4NQL B;  2G4S A;  2KJH B;  4OVV A;  4WWO A;  4AP4 C;  4FLH A;  3WAO A;  3W1S C;  1Q1O A;  1YIW A;  4G0N B;  1UBQ A;  1JRU A;  1MG8 A;  1GC7 A;  2GBN A;  2I1J A;  3VTW A;  4DDI D;  4W9F A;  2XK5 A;  2K6Q A;  5DPW A;  2LRW A;  3X0W A;  2KWC A;  3ZRF A;  2BYV E;  2BF8 B;  1HE8 A;  4HK2 A;  3R7R A;  4ANW A;  1NDD A;  2ZPN A;  2LZ6 A;  2MSE D;  3NY5 A;  2KWU B;  3ZTC A;  4F7Z A;  2CHZ A;  2RSU A;  3KYD D;  2BGF A;  3PV1 A;  3VQI A;  3VTU A;  1YD8 U;  2BYE A;  3L13 A;  1WJU A;  2KKC A;  1RAX A;  4CYE A;  2ZCC A;  3A9K A;  1V9J A;  3EFU A;  1OTR B;  2N9E B;  4EZL A;  2J0M A;  5JH5 C;  1U4A A;  4DHZ B;  4I6N B;  3BIN A;  1I35 A;  4BVU C;  3ZDT A;  3DBL I;  5C1Z A;  2KXJ A;  2JPH A;  4JQW C;  5CHW A;  3PLU A;  3VH4 B;  4AUQ C;  2NVU I;  4I6L B;  2BYF A;  4GDL B;  3WAL A;  3RUL A;  1IPG A;  4ZYN A;  2L3Z A;  2GBJ A;  2J0J A;  2M4N A;  1EF1 A;  2C60 A;  5L95 C;  3ZNZ B;  3B1L X;  3WA0 A;  2N1W A;  4ZRI A;  1ZW7 A;  1NBF C;  2GBM A;  2A4Z A;  4EKU A;  3M62 B;  5KHO A;  4LDT B;  3L10 B;  5G2N A;  1Q0W B;  2JWZ A;  1M94 A;  1E8W A;  2K8C A;  3DDC B;  3HK0 A;  5LLI A;  3JYU A;  4GDL A;  3RYT A;  3WAN A;  1YX5 B;  3PS6 A;  1WJN A;  1BT0 A;  4TKN A;  1P98 A;  3A9J A;  1SGH A;  3NZU A;  2NR2 A;  2FIF A;  3DBH I;  4URK A;  2HD5 B;  3R7Q A;  5KHQ A;  3UQB A;  3ZUN A;  2O6V D;  4BKT A;  2KOX A;  2FNJ B;  1UGM A;  4W9K A;  3VAW A;  2V1Y A;  1S1Q B;  1J19 A;  2KQS A;  3O65 B;  3DCG A;  1AAR A;  4IUM B;  4WJQ A;  4GDK B;  1X1M A;  2Z59 B;  3RD2 A;  2ASQ A;  4W9L A;  4KIK B;  4OVU A;  1WM3 A;  3PHX B;  4II2 B;  2AEH A;  4MGY E;  2KTR A;  4NJ6 A;  4DBG A;  2L8J A;  3ML9 A;  3KH0 A;  3ZNG C;  2DEN B;  2DZJ A;  4HPL B;  3ZNH B;  1WGY A;  1UZX B;  5JHB A;  4IG7 B;  3QWZ B; 
#chains in the Genus database with same CATH topology
 5IA7 A;  2MBB B;  5AUK A;  2CJN A;  3RCZ A;  3UGB B;  1C78 A;  2JZ3 B;  1IBX B;  1CZP A;  2YEP B;  5C2T B;  4P1C C;  3RNB C;  2ZZP B;  1WJ4 A;  1WYG A;  1TT5 B;  4A3P A;  1V5O A;  4BBN F;  4DK5 A;  4OHJ A;  1LXD A;  4PS7 A;  3Q8F A;  2LMC A;  2QCZ A;  2N4F A;  1SF0 A;  3QQ8 B;  5EE1 A;  2NPT B;  2VZK D;  5D2M B;  3E56 A;  3N1Z C;  1L0V B;  2BYT A;  4MT5 A;  5HKH A;  1EU4 A;  4W9C A;  2L05 A;  2MA9 B;  3TCA A;  4ZRJ A;  3J9C A;  3VUW A;  2IGG A;  3T9L A;  1I4Q A;  2H88 B;  2WU5 B;  3QJZ A;  4D2K A;  3IT4 B;  3MJW A;  2L1A A;  3ECI A;  4WIP A;  5MPO A;  2M56 B;  2YLM A;  3I5J C;  1UD7 A;  2VZK B;  1HZ6 A;  3QIJ A;  3Q69 A;  3AV8 A;  2UWQ A;  4ANV A;  1MI0 A;  1TS3 A;  2IY0 B;  4KKJ A;  2B3A A;  3RNA C;  3BYT B;  2Z0E B;  1ZDV A;  1DGJ A;  3LXF A;  1ZOY B;  4ZDV A;  5D7G A;  1E8Z A;  2AWT A;  3AH7 A;  1C4C A;  4P7I A;  5BMH A;  1FMA D;  4GXB A;  3AEG B;  3EGR A;  4GGQ A;  2LVQ A;  3I3T B;  4NNJ B;  2MQJ A;  3W2D A;  3ZLZ A;  4TMA B;  2QDF A;  3L0W B;  2ACZ B;  3QX1 A;  1E6E B;  4ARI A;  2KTF A;  2V4I B;  2K9X A;  3DBH B;  1JRP A;  5GMV A;  1LQB A;  4FN2 A;  5AZF A;  5IP4 D;  1D5M C;  3EHV A;  4ITK A;  1TTN A;  3V61 A;  2KWV B;  4LK0 M;  1FIQ A;  4P16 A;  4RH6 A;  5D6J B;  2IYD B;  3VH3 B;  2DAF A;  2KDE B;  2KFJ A;  3GB1 A;  1ENF A;  1WX9 A;  4GDK A;  3HRD D;  4AJW A;  4ANU A;  4XZ4 A;  1YJI A;  1QIL A;  1N60 A;  2VH2 A;  3V60 A;  2MP2 B;  2J53 A;  3A1Q A;  4W9I A;  2MRP A;  3QAR A;  3RT3 B;  3L17 A;  2LD9 A;  1KTK A;  2HJ1 A;  2JF5 A;  2M19 A;  3M3J A;  3VR8 B;  1MG4 A;  1XQQ A;  2PTL A;  2MLB A;  2ZCB A;  4WUR A;  2AL6 A;  4FHJ A;  1VCB A;  2D07 B;  1L0Y B;  2WXQ A;  3FIL A;  3L54 A;  1FFU A;  2GBR A;  1E7P B;  4HRO A;  4TUU A;  2AL3 A;  1CJE A;  3TBL D;  1DYQ A;  1ZXI A;  3RZW C;  1XT9 B;  1WR1 A;  2KJ6 A;  4DXA B;  1TY2 A;  3AE4 B;  5BYR A;  1RLF A;  3DBS A;  2NBU A;  2KMC A;  5JZE B;  1SXT A;  4M01 A;  1OQR A;  1V49 A;  4J6I A;  3AEE B;  3I63 C;  1F2R I;  2W3S A;  3HVZ A;  4L23 A;  4C00 A;  4FUL A;  2G3Q B;  3GZN I;  4NZL B;  1VZ8 A;  4JGH B;  1EO6 A;  4BKG A;  1R4N B;  4K81 A;  2G45 B;  2INC C;  3U7D A;  2L52 A;  4C56 C;  1KRH A;  3APD A;  4WH4 A;  5J17 A;  2NBV B;  1A70 A;  2E3T A;  2Y5P A;  1XCT L;  3Q14 C;  4MH8 A;  3VXW A;  1IBX A;  3R8B A;  1TIF A;  2PMV A;  3FKY A;  2UU7 A;  3K9P B;  5BYQ A;  4MSM B;  1KLG D;  4OZA A;  3AB5 A;  1C3T A;  4IC7 B;  2KNB A;  2QIE B;  1C76 A;  2NCN A;  1WXM A;  3BVM A;  3AU4 A;  1K50 A;  2DZI A;  2RDH A;  3ZTD A;  1KLU D;  4WWP A;  2AX5 A;  5IN7 A;  1WXS A;  1UNS A;  1MPE A;  1FNW A;  1JRO A;  2L00 B;  2ZEQ A;  3IBE A;  2HTM E;  1ROE A;  4REZ A;  4B9K A;  3M95 A;  3ZO5 B;  3RZF A;  3QA8 A;  3U30 A;  4RFB A;  1TS2 A;  4EZK A;  4JWU C;  3DVN V;  2IO3 B;  2N7D A;  2QJL A;  4NPN A;  3ZJT A;  1YN5 A;  2BB5 A;  1ET6 A;  3M63 B;  1WJ6 A;  3FIL B;  5EDS A;  3ZNI D;  2CS4 A;  1RM6 C;  3Q3F A;  2C7M B;  4NY0 A;  2O2V B;  2LRU A;  2JQR B;  3P63 A;  5BO4 B;  3TIX A;  1C1Y B;  2WP9 B;  1KOT A;  3EC8 A;  4J3O D;  1JW9 D;  3PPA A;  3VRA B;  2XN9 C;  2MP2 A;  1VJK A;  2EKE C;  3NVW A;  3FC4 A;  3Q8B A;  4AP4 C;  1NI3 A;  2BW2 A;  1Q10 A;  1GC7 A;  4WQM A;  2LRW A;  3X0W A;  1HE8 A;  2ZPN A;  1J7C A;  3I9V 1;  4DXF A;  1XXG A;  2LZ6 A;  2MSE D;  5HI1 A;  3NY5 A;  4QAY A;  3AE2 B;  3ZTC A;  3KYD D;  2RSU A;  1YD8 U;  2BYE A;  2KMM A;  1RAX A;  2INP E;  1D5Z C;  4BVU C;  2BS3 B;  4LNO A;  2V3P A;  4YSY B;  1I4G A;  2NVU I;  4GDL B;  3WAL A;  3RUL A;  2GBJ A;  4UDU C;  4RF1 A;  3B1L X;  3WA0 A;  2N1W A;  2GBM A;  3M62 B;  5KHO A;  4OZB A;  1Q0W B;  2BB6 A;  3RYT A;  4M02 A;  3DDC B;  3PS6 A;  1WJN A;  3BVZ A;  4TKN A;  3NZU A;  1SGH A;  4MM3 B;  1JCK B;  3B2G A;  3O13 A;  5KHQ A;  3ZUN A;  2JYT A;  4C80 A;  1S1Q B;  1J19 A;  3RMK C;  3B2F A;  2L32 A;  4EE2 A;  1GB4 A;  1T0S C;  2VH1 A;  1EWY C;  1C4A A;  1UZX B;  4US8 A;  1KM7 A;  2LXC A;  1XCQ L;  5TR5 A;  3IXS A;  4ICV A;  2JRI B;  1IP9 A;  2PW9 A;  4RGN A;  2BS2 B;  4M8N A;  4IOI E;  4RM8 A;  3NHE B;  2R2O A;  3L4P A;  1P7E A;  2BQQ A;  1GUA B;  1AN8 A;  2NPT A;  3IFW B;  5CTR C;  5TSS A;  3GE8 C;  4OZC A;  3A4R A;  2SEB D;  4AOF A;  4GMV A;  3NVZ A;  5H92 C;  1PDX A;  2CJO A;  5J18 A;  1PGB A;  4B95 A;  4S17 A;  2CKH B;  2AQ2 B;  1Y8R C;  3B9J A;  5BYS A;  1WGD A;  4K7U A;  3MJ5 A;  4RMA A;  5LXH A;  3EEC A;  4LJP B;  2HJ8 A;  1ZP0 B;  3SEB A;  3QAQ A;  2WXJ A;  2W9N A;  4LLG M;  4MH0 E;  1FO4 A;  2GBK A;  1PGA A;  5C3J B;  2QMT A;  3JVZ X;  1JWA D;  4LDT D;  1WGG A;  1WH3 A;  2IY1 B;  1T3Q A;  3AEB B;  4A20 A;  2IGH A;  2MJE A;  2IBI B;  2IO0 B;  5DCN A;  2Z8L A;  5GXG B;  3LDZ E;  2BVC A;  3AED B;  2KJR A;  2MW5 A;  2KAJ A;  4E74 A;  1XLN A;  4FJZ A;  2RGF A;  1L7Y A;  4M8M A;  2KQ7 A;  4TV3 A;  3GS2 A;  1G6J A;  4XYC A;  4XWW A;  5L83 A;  3DVN U;  1FNV A;  4RGO S;  3KQ4 A;  2W3R A;  3EA6 A;  4KGS A;  1N5W A;  1Z2M A;  2YEP F;  1B1Z A;  1PGX A;  2N9X A;  3ZQ4 A;  3V6C B;  4B0E A;  1P7F A;  4BKS A;  3PRP B;  2KDF B;  3P1M A;  3IAM 1;  1TKY A;  4WJO A;  1NEK B;  1AWD A;  4FA6 A;  1TBE A;  1V86 A;  2KDM A;  1LGR A;  1WFY A;  3DHH C;  3TJP A;  1N62 A;  3NVY A;  3ENE A;  1M4V A;  2HDE A;  1TY0 A;  2WX1 A;  1GG3 A;  3C0R B;  4C7Y A;  3VUY A;  1VZ6 A;  2MBH A;  1WI0 A;  2JYE A;  4W9H A;  2KK8 A;  4HCN B;  4B0M A;  1CMX B;  3QCA A;  2D11 A;  4M0W B;  3MC9 A;  4W9D A;  1SE2 A;  3JW0 X;  2OJR A;  1NYR A;  4R3D A;  1XD3 B;  3V6E B;  2WHI A;  4YTN B;  3ZKJ C;  3WAM A;  2D3B A;  4KZC A;  1GAQ B;  4HVB A;  2KDI A;  2M17 A;  2KN5 A;  3TEW A;  3NZS A;  2JZP A;  5E6P A;  1KF6 B;  2QSD A;  4OVZ A;  3MFG A;  4BAX A;  1P1A A;  4TQ0 A;  1RWS A;  1GNU A;  1WF9 A;  4HKZ E;  1L5P A;  2WXF A;  2QEJ C;  3TMP B;  1E5W A;  3KUZ A;  4KDL B;  2KC1 A;  4IM2 A;  3H7P B;  1SJE D;  1I4P A;  2JXT A;  4A3O A;  4A55 A;  4LCD E;  4TQ1 A;  3Q3N C;  1T6B X;  5FR6 A;  1RFK A;  4HWI B;  4F1S A;  2QIL A;  3AU5 A;  4ZHP A;  3UIN B;  3DQV A;  3VRB B;  2OED A;  4AS1 A;  2ON8 A;  1SIF A;  2LHE A;  4NAW A;  2C7H A;  3AM9 A;  2ZJD A;  1E7V A;  1KH0 A;  4HKQ A;  2LFI A;  5BMI A;  1LM8 B;  2DWQ A;  5EE0 A;  3ZRC A;  4FJY A;  1FD6 A;  2WXH A;  4XGA B;  1STE A;  3N20 C;  1L2N A;  3N32 A;  1VR9 A;  3UI3 A;  2WXM A;  3SFD B;  3A9J B;  3VUX A;  2KO3 A;  5FK9 C;  1C77 A;  3VHT C;  1T5X D;  4YL8 A;  1V1O A;  5JXV A;  2BWE S;  5DPT A;  2NTS A;  4HDQ A;  2V3N A;  1MVK A;  4DHJ D;  1WX7 A;  1D5X C;  2INN E;  2WYQ A;  3AEA B;  1WE7 A;  3ABV B;  4PS8 A;  1HTO A;  1WYW B;  2KLG A;  3AUL A;  2JZZ A;  1WGK A;  1MJD A;  2PIA A;  1YNT E;  2IJ0 A;  3A9K B;  4EOY A;  3KW5 B;  5D94 A;  1EUV B;  1RFA A;  3PT2 B;  1FNU A;  4F8C B;  4E3C A;  3BK2 A;  1NI2 A;  4JE3 B;  2EMS A;  1K52 A;  3OG5 A;  2K8B A;  1V6E A;  3EUB 2;  3I57 A;  1WRD B;  2MCN B;  3V05 A;  3QK0 A;  1WY8 A;  3BII D;  1E7U A;  4KSL C;  2G9H D;  2K8H A;  1R4M B;  3IG3 A;  4MM3 A;  1ZUD 2;  1JWB D;  1Y56 A;  2GI9 A;  4KKI A;  4HEA 1;  3WCQ A;  4MSQ B;  2IO1 B;  2J0K A;  1FXT B;  2FID A;  2CR5 A;  2JVC A;  1LO5 D;  1SBB B;  1TZO A;  2EEL A;  2XEW A;  4EUT A;  2IGD A;  2M1M A;  3TEY A;  2N1V A;  3KVF B;  4XDD A;  3TEX A;  2KYW A;  3PZD A;  1FRR A;  3RI7 C;  2DZM A;  2RMM A;  4FBJ B;  5AZH A;  2O6V B;  1YX6 B;  3TEZ A;  4NQL B;  2G4S A;  1WSP A;  4G0N B;  1FM0 D;  3U2S C;  4L2Y A;  1UBQ A;  1JWU D;  1JRU A;  2I1J A;  4W9F A;  3RNG C;  2KWC A;  4FXC A;  4HK2 A;  4XDC A;  3Q8A A;  2LEK A;  4F7Z A;  2BGF A;  3VQI A;  1F52 A;  3HUI A;  1WJU A;  2ZCC A;  3EFU A;  1YMH E;  2N9E B;  2CU3 A;  4I6N B;  3BIN A;  4NAM A;  3ZDT A;  3DBL I;  2MH7 A;  5C1Z A;  1FXI A;  2WLB A;  1JWS D;  1IGD A;  2JU6 X;  2GRI A;  2JPH A;  5CHW A;  3PLU A;  3VH4 B;  4AUQ C;  2WS3 B;  4I6L B;  3TUO A;  2BS4 B;  1L6U A;  4ZYN A;  2J0J A;  2N9K A;  2M4N A;  1EF1 A;  2C60 A;  3ZNZ B;  1L4Z B;  1ZW7 A;  3P42 A;  4EKU A;  5G2N A;  2JWZ A;  2K8C A;  1E8W A;  3HK0 A;  1MFW A;  3ZGZ A;  1VZ7 A;  2FIF A;  4URK A;  2Y5C A;  5LNK 1;  3DHI C;  1UGM A;  4W9K A;  3VAW A;  2KQS A;  3O65 B;  1QKZ A;  4GDK B;  1X1M A;  1FRD A;  1WM3 A;  4II2 B;  4MGY E;  3ML9 A;  3KH0 A;  2I2Y A;  1QQR A;  2DEN B;  2DZJ A;  4HPL B;  3ZNH B;  1ACC A;  1WGY A;  4IKG A;  2WXN A;  4II3 B;  4JIO U;  2KAN A;  1HZ5 A;  3AE8 B;  2BT6 A;  5CHF A;  2KFK B;  3DWM A;  4GIV A;  2JRH A;  3Q6B A;  4C4V B;  2KAC A;  2RPQ A;  1EM7 A;  4W9J A;  3L16 A;  4USA A;  3AE9 B;  4K7S A;  3VDZ A;  1RYJ A;  2IO2 B;  1ESF A;  4HPP A;  2R61 A;  4IWQ A;  3DVG Y;  3ZVV A;  4CQN A;  4HPM B;  2XK5 B;  2MJD A;  2KD0 A;  4ZRK A;  2WWZ A;  3U52 E;  3CIR B;  3H9D A;  1R7S A;  1XLP A;  2N9L A;  3CMM B;  2AQ1 B;  3R66 C;  4MJS B;  4PT5 A;  3ZW3 A;  4MGK E;  3P2B A;  5G5G A;  2BKF A;  2LWP A;  5IKC M;  3IAS 1;  5DPS A;  1ISN A;  2MBO A;  3WIM A;  1V97 A;  1NEN B;  1XEE A;  3OLM D;  2ZW1 A;  2OHF A;  4PYU A;  1ZKH A;  4C4V A;  3LYY A;  1YJ1 A;  1FCC C;  1S3S G;  2C5L C;  1WX8 A;  2PEA A;  4H2A A;  2L83 A;  3IVF A;  3C8Y A;  2LHD A;  3CF6 E;  2JT4 B;  2G1E A;  1WM2 A;  1D4B A;  4YTM B;  3UQA A;  4PK1 A;  3AE7 B;  1UUP A;  3SU8 X;  3UIO B;  4IM3 A;  2PE9 A;  2KHW B;  3AXC A;  2RDB C;  1J0G A;  3VR9 B;  2XNA C;  2CHW A;  2KT7 A;  1IUE A;  1L6V A;  2FUH B;  3AN1 A;  3APC A;  2L0T A;  3AMZ A;  3OWE B;  3RNF C;  4RM9 A;  5FR3 A;  4KX6 B;  3SD5 A;  2LAS A;  2LUM A;  3DOW A;  4MEM A;  5HHD G;  1FEH A;  2K6D B;  1TZ1 A;  1WMH A;  3V62 A;  3MTN B;  2DAJ A;  4BOS C;  4FHK A;  4YWG G;  3AE5 B;  1F1H A;  4JL9 A;  1JQ4 A;  2KTR B;  4NAW B;  1BUI C;  2CHX A;  4GU2 A;  4HDO A;  1R4N I;  4NQK E;  4HXD A;  2I1K A;  3N9Y C;  4RNA A;  2FCM A;  3PGE A;  3NS1 A;  4AWJ A;  4G50 A;  3H6N A;  3ZXV A;  2LVP A;  1TGZ B;  3GE3 C;  1AW7 A;  2KC2 A;  5HFY A;  1P9D U;  1WRI A;  1TS5 A;  3MP9 A;  2JXX A;  3ZIM A;  1KFY B;  4C7Z A;  1XF5 L;  2ZPY A;  2WGS A;  2J52 A;  4KV2 A;  4LNK A;  4WWM A;  2IND C;  3GP7 A;  1CQV A;  1PQS A;  2KLC A;  4DWF A;  2BKR B;  2JUO A;  1GOZ A;  3PTF C;  2C9W B;  1JWM D;  1WR6 E;  2LXA A;  4AQ7 A;  4ZRP A;  1E8X A;  3Q3J A;  2FCN A;  4KGT A;  2WXP A;  2N7J A;  1NYQ A;  5DPR A;  4W9G A;  3V3X A;  4NJ7 A;  2DYB A;  2LGY A;  4MDK E;  2WXR A;  3P4S B;  1IGC A;  2REX A;  2FUG 1;  1UEL A;  2M8S A;  3GOE A;  1UWM A;  3WAP A;  1ZGU B;  4Q2J A;  3IT6 B;  4BOZ B;  4JPS A;  1YOV B;  1E90 A;  4MAC A;  4X57 B;  2PPH A;  2W54 A;  5AUI A;  1OQY A;  5AEK B;  2WDV B;  2FBW B;  1VDV A;  1HEZ E;  1RRB A;  4KIK A;  1J7A A;  4ZOH C;  1T0Y A;  1L4D B;  3SHQ A;  1I7H A;  4O1N A;  4RF0 A;  2N9P C;  4AJY B;  2ZNV C;  2KFK A;  2W55 A;  5IOI A;  1YQ3 B;  1Z5S B;  3ZJV A;  4HCP B;  2KWD A;  1I4X A;  1YQB A;  2MJ3 A;  3TSS A;  4MGI E;  1UGJ A;  4WAA A;  5CX3 A;  4GB9 A;  2GMI C;  5AZG A;  4N9F 4;  4ACF A;  2KZR A;  2GOW A;  4HLE A;  4ICU A;  2D5G A;  2XBB C;  3HM3 A;  3KUD B;  4LNF A;  2DX5 B;  2D3G A;  3U7Z A;  2KDB A;  1WWT A;  3Q3O C;  3UF8 A;  1V1P A;  3BWU D;  4IDI A;  2RR9 A;  4ARC A;  3NOB A;  2DYM A;  2VRR B;  2BWF A;  1ZE3 D;  2IZV B;  2LVO A;  2KVZ A;  4KZ0 A;  1DOY A;  1WIA A;  1D6E C;  1SE3 A;  1K8R B;  2KX3 A;  3DPD A;  3PZ8 A;  2KQ4 X;  2LI5 A;  3NG0 A;  1J7B A;  1R4M I;  2WDT B;  1HA5 A;  1QLB B;  4W9E A;  1MHX A;  1NVI D;  3LJ3 A;  3QHT A;  5E6O A;  3DBL B;  3UIP B;  3OAW A;  2A5U A;  3B08 A;  1TJE A;  3H7P A;  2L0F A;  3P4P B;  2C7N B;  4IW0 A;  2DHZ A;  2TSS A;  3PRE A;  4BFR A;  4MEL A;  4KVG B;  3PSE B;  2ZNV B;  2LJI A;  2PJH A;  2RDG A;  1Q5W B;  4GLS C;  3SDL C;  2PKO A;  2D3A A;  1VD2 A;  3OJ4 B;  3JSV B;  2ZVN A;  2KN4 A;  4HJK A;  2ONQ A;  4XWT A;  2G4D B;  2LGX A;  3A4S C;  3RUI B;  2WQY B;  3PHW B;  1P3Q U;  1SEB D;  3VTV A;  1GJZ A;  1E8Y A;  2PE6 B;  2IDY A;  3ONS A;  4WWO A;  3WAO A;  2BBC A;  3VTW A;  2GBN A;  4DDI D;  3P4R B;  2M0A A;  5DPW A;  4M0W A;  2BYV E;  1PYW D;  2BF8 B;  4P1B C;  1ET9 A;  2E6X A;  3R7R A;  4ANW A;  4K3C A;  3Q8C A;  1BML C;  3RPF C;  2CHZ A;  4ZHO A;  3VTU A;  3RNC C;  4DXG A;  3L13 A;  3N1X C;  2KKC A;  1V9J A;  4EZL A;  2J0M A;  1V8C A;  2K3U A;  4BZA A;  1I35 A;  3NRZ A;  2KXJ A;  2W82 A;  3RFZ B;  3PO0 A;  2DNF A;  4JQW C;  4WAF A;  5IO9 A;  2WXO A;  1QT9 A;  1IPG A;  2L3Z A;  3NJT A;  5L95 C;  2K22 A;  4ZRI A;  1NBF C;  3L10 B;  5LLI A;  1FCL A;  4HRS A;  4GDL A;  1WXQ A;  1BT0 A;  1HXY D;  1F2R C;  2NR2 A;  2WU2 B;  3SR6 A;  2JX5 A;  3P4Q B;  4LNI A;  4BKT A;  1QF6 A;  2FNJ B;  2V1Y A;  3DCG A;  1B9R A;  4WJQ A;  2N0S B;  2LGI A;  4KIK B;  3U4E G;  2AEH A;  2V0G A;  2L8J A;  1ZDX A;  4RGM A;  1YN4 A;  3UQB A;  3QWZ B;  2MEK A;  2WNM A;  1F9J A;  1BXT A;  5G55 A;  3TL5 A;  2GLS A;  3DVG X;  4K3B A;  4N6E B;  5E6N A;  4OW0 A;  2K39 A;  1QZE A;  1UBI A;  4A6Q A;  5I4D A;  4XX5 A;  1H8C A;  4FAD A;  1SE4 A;  2MX2 A;  4IWP A;  4B6W A;  2D2Q A;  2O2V A;  4K1R B;  1N6Z A;  2NBW B;  1UWX A;  1D3Z A;  4S0R A;  3PRZ A;  2K5P A;  4LJO B;  3PLV A;  3KYC D;  1HQR D;  4G3X B;  2B76 B;  3KWV A;  4CHK A;  3CWI A;  2MHJ A;  3R3M A;  3LB8 C;  3X23 A;  3T3N A;  1JML A;  1V81 A;  1GPX A;  3AE6 B;  1HTQ A;  3B0A A;  3NUH B;  4E71 A;  3MHZ A;  3NZ3 A;  3APF A;  2YVC A;  1SE9 A;  4PYZ A;  2D10 A;  4IM0 A;  4MGZ E;  4KDI C;  1XLO A;  2KMA A;  1WXV A;  2PVG C;  3U8Z A;  1QOG A;  3Q2A C;  3OJ3 A;  3RN9 C;  1N63 A;  2MBQ A;  4US9 A;  1XLQ A;  1MHH E;  2V4L A;  1OEY A;  2NMQ A;  3HVD A;  1XO3 A;  5EE9 A;  2LJ5 A;  3ETR A;  4GSW A;  4EZJ A;  5E6J A;  3CST A;  4M00 A;  4RCO A;  3ZYY X;  2R2Q A;  2BTE A;  2H89 B;  4GOC A;  3PVL A;  2BPS A;  4DDG D;  2RD0 A;  1E10 A;  2J4X A;  3IHP C;  2FCQ A;  1K51 A;  4PS3 A;  1V2Y A;  4CO7 A;  4EEW A;  3DBR B;  2OOB B;  2MBE A;  3VVW B;  1F0Z A;  1WGR A;  4JLC A;  4RGT A;  1YJJ A;  1PFD A;  3T8M A;  2HTH A;  4XC2 A;  1YQ4 B;  5FKA C;  1WXA A;  4A9A A;  1GC6 A;  2DLB A;  3URY A;  2NS5 A;  1KJT A;  3Q8E A;  2O6V A;  4A8X C;  3E9S A;  2DYO A;  3NS8 A;  3N30 A;  3ZXR A;  1UF0 A;  1QOB A;  1WZ0 A;  2V9H A;  4P6V F;  4BKS D;  2Z0D B;  4KGR A;  1FFV A;  4WQO B;  1I42 A;  1FPY A;  3FAH A;  2DZK A;  1DOX A;  1N5X A;  1EF5 A;  3PRM B;  3W5V B;  1E9M A;  4KSK C;  3MC8 A;  3MHS D;  3DHG C;  3VFK A;  2X8X X;  2AQ3 B;  4YSX B;  1V5T A;  3DBR I;  1H4R A;  2J7Q B;  1VLB A;  3W9C B;  3D32 A;  5H8Y E;  1A5R A;  4G11 A;  4EFO A;  4YTP B;  2QC8 A;  3Q3M C;  3C19 A;  3K9O B;  1TYG B;  4LNN A;  4K7W A;  2QHO A;  1L0X B;  3BK1 A;  3BYY B;  4YSZ B;  1SB3 C;  3CSF A;  1OGW A;  2D3C A;  3GZN B;  2KX0 A;  3A33 B;  3R2T A;  5D3D A;  3H8H A;  1SJH D;  1QOF A;  3A1Q B;  5G5H A;  2J42 A;  5JHA A;  3BZD B;  2ZVO A;  2N7E A;  3RNE C;  3W1Y A;  5C23 A;  1TKG A;  5J2R A;  3AI5 A;  2JSV X;  2V3S A;  3BY4 B;  1ZPS A;  1WGH A;  3JSV A;  1OFF A;  2EKI A;  3R2I A;  3HIZ A;  4DHZ E;  2FCS A;  1WE6 A;  4WJP A;  4DQO C;  2WDR B;  2SAK A;  2UYZ B;  4ZRQ A;  3ZDM C;  1OEY J;  1IYF A;  3NVV A;  4FJV B;  4WWN A;  3QC8 B;  4DHJ B;  2FAZ A;  1F77 A;  1P0R A;  4HJG E;  3EFC A;  1LFD A;  3L08 A;  3AE1 B;  1WMH B;  1VRA B;  2LUE A;  1GB1 A;  2WX0 A;  3ALB A;  3PZ7 A;  1WZ3 A;  1N61 A;  1PUT A;  1QOA A;  1T0R C;  3N1Y C;  5T8I A;  1I4R A;  4ANX A;  4JWS C;  4YXD B;  4IWO A;  3W1S A;  5CHV C;  4A90 A;  2PLP A;  2Q5W D;  1V1P B;  3H7S A;  2JY6 A;  2WDQ B;  1CK1 A;  3KUC B;  5HG2 A;  1UH6 A;  4N59 A;  3H1U A;  2Y3A A;  2HE7 A;  4YT0 B;  2MWS B;  5IAA C;  4BBN C;  3SFE B;  3HM6 X;  2L76 A;  4GN1 A;  3AEF B;  2EMT A;  2AYO B;  2K25 A;  1JAL A;  4TSS A;  1C79 A;  1V80 A;  2KVR A;  1KLV A;  5BMG A;  2ZW0 A;  4WJN A;  2L7R A;  1ZXH A;  4ASW C;  1DOI A;  2IPK D;  2K1F A;  3HHM A;  2NTT A;  4N58 A;  3W5U B;  4I6P A;  2M0X A;  4MJS A;  5LXI B;  2X38 A;  3N3K B;  1J8C A;  2LGD A;  2CU1 A;  2Y5B B;  3S2A A;  3ML8 A;  4OVV A;  2KJH B;  1E0Z A;  4FLH A;  3AEC B;  3W1S C;  1Q1O A;  1YIW A;  4L1B A;  1MG8 A;  1T0Q C;  1SIJ A;  2I38 A;  2XK5 A;  2K6Q A;  3ZRF A;  2LGS A;  1NDD A;  2RPV A;  3KWL A;  2PVO D;  2KWU B;  3BVG A;  3PV1 A;  4CYE A;  3A9K A;  1OTR B;  2WXG A;  2WXK A;  3MC0 B;  4JX1 C;  2JWU A;  5JH5 C;  1U4A A;  1YN3 A;  4DHZ B;  1C9F A;  1EWC A;  4LTU A;  5EE3 A;  1K53 A;  4ZYS A;  2WXL A;  2ICI A;  2BYF A;  1OQQ A;  2FE8 A;  2A4Z A;  4XE0 A;  4LDT B;  1M94 A;  3WAN A;  3T3O A;  3JYU A;  2OJW A;  1FXA A;  1YX5 B;  1P98 A;  1I4H A;  3A9J A;  4NJC A;  3DBH I;  1C4P A;  2HD5 B;  2WXI A;  3DWG C;  3R7Q A;  2O6V D;  2KOX A;  1SSN A;  2GB1 A;  5D3I B;  1AYF A;  1AAR A;  4IUM B;  3AE3 B;  3ZJU A;  2DBY A;  2K0P A;  2Z59 B;  3RD2 A;  2ASQ A;  4W9L A;  1EU3 A;  4OVU A;  3PHX B;  2KTR A;  4NJ6 A;  3KLS X;  4DBG A;  3ZNG C;  1TS4 A;  5JHB A;  4IG7 B;  1TKE A; 
#chains in the Genus database with same CATH homology
 1KM7 A;  2LXC A;  2MBB B;  5IA7 A;  5TR5 A;  4II3 B;  3RCZ A;  4ICV A;  2KAN A;  4JIO U;  3UGB B;  2JRI B;  1IP9 A;  2JZ3 B;  1F9J A;  4M8N A;  5G55 A;  4RM8 A;  3NHE B;  5CHF A;  2KFK B;  3TL5 A;  2R2O A;  2ZZP B;  4GIV A;  1WJ4 A;  4A3P A;  1V5O A;  2JRH A;  4BBN F;  4DK5 A;  1GUA B;  2NPT A;  3IFW B;  3DVG X;  5CTR C;  2RPQ A;  5E6N A;  1LXD A;  4W9J A;  3L16 A;  4PS7 A;  2K39 A;  1QZE A;  1UBI A;  3A4R A;  4K7S A;  4XX5 A;  3VDZ A;  4GMV A;  4AOF A;  2IO2 B;  1H8C A;  4FAD A;  2MX2 A;  4IWP A;  4B6W A;  2N4F A;  2D2Q A;  2O2V A;  4IWQ A;  4K1R B;  5J18 A;  3QQ8 B;  2NBW B;  3DVG Y;  3ZVV A;  4B95 A;  1D3Z A;  4HPM B;  2CKH B;  2XK5 B;  2KD0 A;  3PRZ A;  1Y8R C;  4ZRK A;  2WWZ A;  2NPT B;  1WGD A;  4LJO B;  3H9D A;  4K7U A;  3PLV A;  3KYC D;  5D2M B;  4G3X B;  4RMA A;  5LXH A;  3EEC A;  3CMM B;  5HKH A;  4LJP B;  2HJ8 A;  4W9C A;  2L05 A;  2MA9 B;  3R66 C;  4MJS B;  4CHK A;  3QAQ A;  3TCA A;  4ZRJ A;  3R3M A;  2W9N A;  3X23 A;  3ZW3 A;  4MGK E;  3VUW A;  3P2B A;  2BKF A;  2LWP A;  4MH0 E;  1V81 A;  3B0A A;  5DPS A;  3T9L A;  1ISN A;  4E71 A;  2GBK A;  3QJZ A;  2MBO A;  3WIM A;  3APF A;  3MJW A;  2YVC A;  1SE9 A;  3ECI A;  4PYZ A;  2D10 A;  4IM0 A;  3OLM D;  4MGZ E;  4KDI C;  2YLM A;  1UD7 A;  3JVZ X;  2KMA A;  4PYU A;  3QIJ A;  4LDT D;  1WGG A;  1WXV A;  3U8Z A;  1ZKH A;  1WH3 A;  2IY1 B;  2UWQ A;  1YJ1 A;  4ANV A;  4A20 A;  1S3S G;  2IBI B;  3OJ3 A;  2C5L C;  2IY0 B;  1WX8 A;  2IO0 B;  2MBQ A;  2PEA A;  3IVF A;  2B3A A;  5DCN A;  3CF6 E;  2JT4 B;  3LDZ E;  1WM2 A;  2V4L A;  2KJR A;  2MW5 A;  2Z0E B;  4E74 A;  1OEY A;  3UQA A;  2LJ5 A;  4GSW A;  4ZDV A;  4FJZ A;  4EZJ A;  2RGF A;  3CST A;  1L7Y A;  5D7G A;  1E8Z A;  2AWT A;  4P7I A;  3SU8 X;  4GXB A;  3UIO B;  4IM3 A;  2KQ7 A;  2PE9 A;  2LVQ A;  4GGQ A;  2R2Q A;  2KHW B;  3AXC A;  4M8M A;  4TV3 A;  1G6J A;  1J0G A;  3I3T B;  4GOC A;  4NNJ B;  3PVL A;  2BPS A;  5L83 A;  2MQJ A;  4DDG D;  2RD0 A;  3DVN U;  3ZLZ A;  2CHW A;  3L0W B;  2FUH B;  3APC A;  3IHP C;  2L0T A;  2FCQ A;  3QX1 A;  2KTF A;  1Z2M A;  4PS3 A;  5GMV A;  4RM9 A;  1LQB A;  1V2Y A;  4FN2 A;  5AZF A;  2N9X A;  3SD5 A;  4CO7 A;  4EEW A;  2LAS A;  3DOW A;  3V6C B;  3EHV A;  4MEM A;  1TTN A;  2K6D B;  3V61 A;  2KWV B;  2OOB B;  2MBE A;  1TZ1 A;  1WMH A;  3VVW B;  3V62 A;  1WGR A;  3MTN B;  4JLC A;  4BKS A;  3PRP B;  2KDF B;  2DAJ A;  3T8M A;  2HTH A;  5D6J B;  4FHK A;  4WJO A;  4BOS C;  2IYD B;  4XC2 A;  4JL9 A;  3VH3 B;  4FA6 A;  2KTR B;  2DAF A;  2KDE B;  4NAW B;  1TBE A;  2KFJ A;  2CHX A;  1V86 A;  1WXA A;  1R4N I;  1WX9 A;  4GU2 A;  4HDO A;  4HXD A;  4NQK E;  2I1K A;  4GDK A;  1GC6 A;  4AJW A;  4ANU A;  2FCM A;  4XZ4 A;  3PGE A;  1WFY A;  3TJP A;  4AWJ A;  2NS5 A;  1KJT A;  3V60 A;  3ENE A;  2MP2 B;  2O6V A;  4G50 A;  3A1Q A;  3H6N A;  4W9I A;  2LVP A;  1TGZ B;  2MRP A;  2KC2 A;  2WX1 A;  2DYO A;  3NS8 A;  1P9D U;  1GG3 A;  3C0R B;  3QAR A;  3N30 A;  3VUY A;  1WZ0 A;  3RT3 B;  3L17 A;  2MBH A;  2JXX A;  1WI0 A;  3ZIM A;  2LD9 A;  4BKS D;  2JF5 A;  3M3J A;  4W9H A;  2Z0D B;  2KK8 A;  4HCN B;  2ZPY A;  1CMX B;  1XQQ A;  3QCA A;  2D11 A;  2MLB A;  2ZCB A;  4KV2 A;  4M0W B;  4W9D A;  2AL6 A;  4WQO B;  4FHJ A;  3JW0 X;  1VCB A;  2DZK A;  1I42 A;  3PRM B;  1EF5 A;  2D07 B;  2OJR A;  4KSK C;  1XD3 B;  1PQS A;  3L54 A;  2KLC A;  3MHS D;  2GBR A;  3V6E B;  4DWF A;  2BKR B;  2JUO A;  3VFK A;  4TUU A;  3ZKJ C;  3WAM A;  2AL3 A;  3PTF C;  2C9W B;  1WR6 E;  4KZC A;  3TBL D;  2LXA A;  1V5T A;  3DBR I;  1XT9 B;  3RZW C;  1E8X A;  3Q3J A;  1H4R A;  2J7Q B;  4HVB A;  2KDI A;  2M17 A;  1WR1 A;  3D32 A;  2FCN A;  2KJ6 A;  2KN5 A;  4DXA B;  3NZS A;  1A5R A;  4G11 A;  1RLF A;  5E6P A;  4EFO A;  5DPR A;  4W9G A;  3DBS A;  4NJ7 A;  1P1A A;  2DYB A;  2LGY A;  4MDK E;  2NBU A;  4TQ0 A;  1GNU A;  1WF9 A;  2KMC A;  5JZE B;  3K9O B;  2REX A;  1V49 A;  4J6I A;  1UEL A;  2M8S A;  4K7W A;  2QHO A;  3GOE A;  3TMP B;  1E5W A;  3KUZ A;  3WAP A;  1ZGU B;  3CSF A;  4BOZ B;  1OGW A;  4KDL B;  2KC1 A;  4FUL A;  2G3Q B;  3GZN I;  2KX0 A;  3A33 B;  4IM2 A;  1E90 A;  3H7P B;  4X57 B;  4A3O A;  3A1Q B;  2PPH A;  4LCD E;  4JGH B;  4TQ1 A;  5FR6 A;  1EO6 A;  4HWI B;  4F1S A;  4BKG A;  5JHA A;  3AU5 A;  1OQY A;  3UIN B;  4K81 A;  5AEK B;  2G45 B;  3DQV A;  2ZVO A;  2N7E A;  3W1Y A;  5C23 A;  1SIF A;  5J2R A;  3AI5 A;  1RRB A;  4NAW A;  4KIK A;  3U7D A;  2C7H A;  2V3S A;  1T0Y A;  2ZJD A;  3APD A;  3BY4 B;  1E7V A;  5J17 A;  2NBV B;  1WGH A;  3JSV A;  3SHQ A;  2N9P C;  1LM8 B;  4AJY B;  3ZRC A;  4FJY A;  2ZNV C;  3HIZ A;  4DHZ E;  1L2N A;  2KFK A;  3N32 A;  2FCS A;  3VXW A;  3A9J B;  1WE6 A;  3VUX A;  1Z5S B;  2KO3 A;  4WJP A;  4HCP B;  3VHT C;  4YL8 A;  1YQB A;  2UYZ B;  4MGI E;  4WAA A;  2BWE S;  5CX3 A;  5DPT A;  3ZDM C;  4GB9 A;  2GMI C;  1OEY J;  4HDQ A;  5AZG A;  3K9P B;  1IYF A;  4N9F 4;  2KZR A;  4FJV B;  4WWN A;  4MSM B;  2GOW A;  3QC8 B;  4DHJ D;  4HLE A;  1WX7 A;  4ICU A;  4DHJ B;  1C3T A;  4IC7 B;  2XBB C;  2FAZ A;  2WYQ A;  2KNB A;  3HM3 A;  2NCN A;  1WE7 A;  1WXM A;  3KUD B;  3AU4 A;  2DX5 B;  2D3G A;  2DZI A;  4PS8 A;  1P0R A;  2KDB A;  1WYW B;  2KLG A;  3AUL A;  3ZTD A;  2JZZ A;  4WWP A;  1LFD A;  3UF8 A;  3L08 A;  1WMH B;  2RR9 A;  1WXS A;  2LUE A;  2WX0 A;  3NOB A;  2DYM A;  2VRR B;  2BWF A;  3A9K B;  2IZV B;  3ALB A;  3KW5 B;  4EOY A;  2LVO A;  2L00 B;  1WZ3 A;  2ZEQ A;  4KZ0 A;  3IBE A;  5D94 A;  1WIA A;  1K8R B;  2KX3 A;  4ANX A;  1EUV B;  1RFA A;  3DPD A;  3PT2 B;  4B9K A;  4F8C B;  4IWO A;  3W1S A;  4E3C A;  3M95 A;  2LI5 A;  5CHV C;  1R4M I;  1NI2 A;  3ZO5 B;  2WDT B;  3H7S A;  2EMS A;  2JY6 A;  3RZF A;  4W9E A;  3QA8 A;  3U30 A;  2K8B A;  3KUC B;  1V6E A;  3LJ3 A;  3QHT A;  5E6O A;  1UH6 A;  4EZK A;  3UIP B;  1WRD B;  3H1U A;  3OAW A;  2MCN B;  2HE7 A;  3QK0 A;  1WY8 A;  2A5U A;  2MWS B;  3B08 A;  3DVN V;  1E7U A;  4KSL C;  2IO3 B;  5IAA C;  2N7D A;  2K8H A;  3H7P A;  4BBN C;  3HM6 X;  3IG3 A;  4MM3 A;  2L76 A;  4GN1 A;  2EMT A;  2AYO B;  4NPN A;  2L0F A;  2K25 A;  2C7N B;  1V80 A;  2KVR A;  4IW0 A;  1KLV A;  2DHZ A;  3PRE A;  3M63 B;  1WJ6 A;  4BFR A;  4MEL A;  4MSQ B;  2IO1 B;  4KVG B;  5EDS A;  2J0K A;  1FXT B;  2CS4 A;  2L7R A;  3PSE B;  4WJN A;  3ZNI D;  2FID A;  4ASW C;  3Q3F A;  2CR5 A;  2JVC A;  2ZNV B;  2PJH A;  2K1F A;  3HHM A;  2C7M B;  1Q5W B;  4EUT A;  2XEW A;  4NY0 A;  2O2V B;  3SDL C;  2LRU A;  2M1M A;  1VD2 A;  3OJ4 B;  5BO4 B;  3JSV B;  2ZVN A;  4I6P A;  2M0X A;  4MJS A;  2N1V A;  3TIX A;  5LXI B;  3KVF B;  4HJK A;  1C1Y B;  3PZD A;  3N3K B;  1J8C A;  1KOT A;  2G4D B;  3EC8 A;  2LGX A;  3A4S C;  3RUI B;  2LGD A;  3PPA A;  2DZM A;  3PHW B;  1P3Q U;  4FBJ B;  5AZH A;  2MP2 A;  2EKE C;  2CU1 A;  2O6V B;  3VTV A;  1GJZ A;  1YX6 B;  1E8Y A;  2PE6 B;  3ONS A;  2Y5B B;  3S2A A;  3ML8 A;  4NQL B;  2G4S A;  2KJH B;  4OVV A;  4WWO A;  4AP4 C;  4FLH A;  3WAO A;  3W1S C;  1Q1O A;  1YIW A;  4G0N B;  1UBQ A;  1JRU A;  1MG8 A;  1GC7 A;  2GBN A;  2I1J A;  3VTW A;  4DDI D;  4W9F A;  2XK5 A;  2K6Q A;  5DPW A;  2LRW A;  3X0W A;  2KWC A;  3ZRF A;  2BYV E;  2BF8 B;  1HE8 A;  4HK2 A;  3R7R A;  4ANW A;  1NDD A;  2ZPN A;  2LZ6 A;  2MSE D;  3NY5 A;  2KWU B;  3ZTC A;  4F7Z A;  2CHZ A;  2RSU A;  3KYD D;  2BGF A;  3PV1 A;  3VQI A;  3VTU A;  1YD8 U;  2BYE A;  3L13 A;  1WJU A;  2KKC A;  1RAX A;  4CYE A;  2ZCC A;  3A9K A;  1V9J A;  3EFU A;  1OTR B;  2N9E B;  4EZL A;  2J0M A;  5JH5 C;  1U4A A;  4DHZ B;  4I6N B;  3BIN A;  1I35 A;  4BVU C;  3ZDT A;  3DBL I;  5C1Z A;  2KXJ A;  2JPH A;  4JQW C;  5CHW A;  3PLU A;  3VH4 B;  4AUQ C;  2NVU I;  4I6L B;  2BYF A;  4GDL B;  3WAL A;  3RUL A;  1IPG A;  4ZYN A;  2L3Z A;  2GBJ A;  2J0J A;  2M4N A;  1EF1 A;  2C60 A;  5L95 C;  3ZNZ B;  3B1L X;  3WA0 A;  2N1W A;  4ZRI A;  1ZW7 A;  1NBF C;  2GBM A;  2A4Z A;  4EKU A;  3M62 B;  5KHO A;  4LDT B;  3L10 B;  5G2N A;  1Q0W B;  2JWZ A;  1M94 A;  1E8W A;  2K8C A;  3DDC B;  3HK0 A;  5LLI A;  3JYU A;  4GDL A;  3RYT A;  3WAN A;  1YX5 B;  3PS6 A;  1WJN A;  1BT0 A;  4TKN A;  1P98 A;  3A9J A;  1SGH A;  3NZU A;  2NR2 A;  2FIF A;  3DBH I;  4URK A;  2HD5 B;  3R7Q A;  5KHQ A;  3UQB A;  3ZUN A;  2O6V D;  4BKT A;  2KOX A;  2FNJ B;  1UGM A;  4W9K A;  3VAW A;  2V1Y A;  1S1Q B;  1J19 A;  2KQS A;  3O65 B;  3DCG A;  1AAR A;  4IUM B;  4WJQ A;  4GDK B;  1X1M A;  2Z59 B;  3RD2 A;  2ASQ A;  4W9L A;  4KIK B;  4OVU A;  1WM3 A;  3PHX B;  4II2 B;  2AEH A;  4MGY E;  2KTR A;  4NJ6 A;  4DBG A;  2L8J A;  3ML9 A;  3KH0 A;  3ZNG C;  2DEN B;  2DZJ A;  4HPL B;  3ZNH B;  1WGY A;  1UZX B;  5JHB A;  4IG7 B;  3QWZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...