4W9EA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 4)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9eA00
1WH3A 1WX7A 2M8SA 2IY1B 2KKCA 3B08A 4K1RB 3IVFA 2NBUA 3ZNID 4I6PA 4CHKA 2LRWA 2NBVB 1M94A 5E6OA 3H1UA 3EC8A 3JSVA 4IM2A 4W9HA 1YQBA 3LDZE 4MSMB 3NZSA 4MGYE 2DENB 3RZWC 1E5WA 3VXWA 4NAWA 3EECA 1GJZA 3ML8A 3SDLC 1C1YB 5AZGA 2MA9B 3R66C 1GC6A 4B95A 1S3SG 3QQ8B 1V86A 2AL3A 4GOCA 2KX3A 5D2MB 2KNBA 2D07B 2ASQA 1WR1A 4MGKE 1TZ1A 1P3QU 4IW0A 1WM2A 3PTFC 4ANUA 5G2NA 1K8RB 3PT2B 4KZCA 1V5TA 2KJRA 1IP9A 2G4SA 2RR9A 3ZDMC 2KFKA 2JY6A 2KJ6A 3TJPA 3TBLD 5CHWA 4HCPB 4WJPA 2KZRA 1YIWA 4ZRKA 4TQ0A 2CKHB 3H7SA 4W9LA 2XK5A 1GC7A 4JLCA 1E8XA 3VDZA 1WJ4A 3Q3FA 1V5OA 3DVGX 3DVNV 3ZDTA 3PHWB 4URKA 2KMCA 4W9DA 2LGXA 3VFKA 4HCNB 4HPLB 2CS4A 5KHOA 3A4SC 1E7VA 1EUVB 2KXJA 3DVNU 3I3TB 4I6LB 2WX1A 3WAOA 2NPTA 2ZPYA 3VQIA 1EF1A 2KHWB 3A1QA 4K7WA 5J18A 1R4NI 4HPMB 2ZNVC 4ZDVA 4DHZB 1JRUA 1Q5WB 4AJYB 3ZRCA 2ZCBA 5D7GA 2L0FA 2KWVB 4XC2A 5IAAC 3R3MA 4MELA 2LVOA 3PHXB 1WI0A 4MGIE 2Z0DB 5JHAA 2KC1A 4W9GA 3P2BA 3W1SC 4HXDA 1MG8A 1E8YA 4RM9A 4FBJB 4B6WA 2ZJDA 3ZIMA 4EFOA 5L83A 2QHOA 2KDFB 1F9JA 4WJNA 4IUMB 4LJOB 3DBLI 2MBBB 2BYEA 2BGFA 3HM6X 4BOSC 1E90A 1V9JA 2RSUA 1RLFA 2R2QA 5AZFA 4ASWC 1OEYA 3IHPC 1UH6A 2LZ6A 2KTRB 3NY5A 3PRZA 2JRIB 4DXAB 4TKNA 1WX8A 2HE7A 4B9KA 3L54A 1XD3B 2KJHB 3DDCB 1P98A 3VUWA 3SU8X 4LDTD 1WXSA 4PYUA 1YX6B 2HTHA 3VVWB 4K81A 3A33B 4FULA 1E8ZA 4ZYNA 3V6EB 2JWZA 2LUEA 4J6IA 3VH3B 2L7RA 4E3CA 5LXIB 2MP2B 2MRPA 2O2VA 2MWSB 1YJ1A 4G11A 1BT0A 1Q0WB 1UBQA 2DZKA 2IO2B 2V1YA 4W9KA 4AP4C 1QZEA 4A20A 2BWES 3QCAA 3JYUA 2G4DB 2EKEC 4XX5A 2LJ5A 3D32A 2WWZA 3S2AA 3ZNGC 5CHVC 1WJ6A 2KTFA 4GDKB 4DDGD 3SHQA 1R4MI 4HWIB 5CX3A 2LASA 2RGFA 2C7NB 3AI5A 5J17A 1J0GA 2KWCA 2L3ZA 4FHJA 1WE6A 4G0NB 2KANA 3KUZA 2JPHA 1VCBA 1EF5A 4II3B 3ZNHB 1ZKHA 4AJWA 3PPAA 1WIAA 3U7DA 2KLCA 1KLVA 1V49A 2K8BA 5G55A 4W9IA 3KH0A 3KYCD 3UINB 3JVZX 2CU1A 1AARA 2FNJB 2DZJA 2UWQA 3R7RA 3PLVA 2DHZA 4EZLA 5IA7A 2LGYA 4MH0E 4F8CB 5DPTA 3B1LX 3QJZA 4BBNC 4DHJD 3M3JA 4BKSA 3VH4B 3UF8A 1E7UA 2IYDB 2DZIA 4PYZA 3BINA 2L8JA 4W9JA 2Z59B 3ZUNA 4GDLB 1YD8U 2PEAA 2WDTB 2FUHB 4NJ7A 4I6NB 3KW5B 1WFYA 1RRBA 1SE9A 4ICUA 2L05A 3AU4A 4IC7B 5DCNA 3Q3JA 4HVBA 2EMSA 4IWOA 3A4RA 4MEMA 1RAXA 4NPNA 3ZRFA 4GB9A 4ICVA 2O6VB 2CR5A 1VD2A 2AYOB 3DQVA 2M1MA 4M8NA 3RULA 2JUOA 3OJ3A 5HKHA 3ZW3A 2G45B 2IO0B 4FLHA 3O65B 4PS3A 2ZPNA 4IM0A 4KSKC 2N9EB 3N32A 4DBGA 2G3QB 1J19A 3VHTC 2J0JA 3M63B 3APFA 5BO4B 4EOYA 1OTRB 4IG7B 2ZVNA 4GN1A 5AEKB 2MP2A 4G3XB 4TQ1A 2K39A 2KDBA 3V62A 4MM3A 1UGMA 1NI2A 2KO3A 5EDSA 2D11A 4BKTA 4AOFA 2K25A 2M0XA 4LJPB 1EO6A 3PRMB 3M62B 1LFDA 2EMTA 2N1VA 3CSTA 4BKSD 3H7PB 3ZNZB 2RD0A 5FR6A 3VAWA 1C3TA 5C1ZA 2L0TA 4NY0A 4GDKA 1WX9A 2D2QA 3VTUA 1KJTA 1WMHB 2A5UA 2CHZA 2KQ7A 2NS5A 2GBMA 1WXAA 2C60A 2NCNA 3OAWA 4BBNF 2FCMA 2MQJA 1E8WA 1Q1OA 4W9EA 5DPWA 3QARA 2REXA 3QIJA 2LI5A 2I1JA 4KIKB 5AZHA 3UQAA 4JGHB 2GBJA 1WYWB 3UGBB 2UYZB 4BVUC 2MBQA 4HK2A 3UIOB 1Y8RC 2K6QA 3L16A 2FCQA 2K1FA 1WZ3A 1WRDB 3ENEA 2MBHA 5CHFA 3W1SA 2J0KA 2D3GA 2MSED 3JSVB 3U30A 2A4ZA 1KM7A 3EHVA 1I35A 2FIDA 4PS7A 2DZMA 1OGWA 2IZVB 4FHKA 1T0YA 2JF5A 1D3ZA 3PRPB 3K9OB 1P0RA 3HHMA 4WAAA 1L7YA 3WALA 2IO1B 1J8CA 2K8HA 4OVVA 2GBRA 2K6DB 3AU5A 1WGYA 4WWNA 2JT4B 2K8CA 4WWOA 3AXCA 4GDLA 1WGDA 3NOBA 4K7SA 3LJ3A 2NBWB 4M8MA 5CTRC 3IFWB 3MHSD 2KDIA 4LCDE 1UBIA 2WX0A 2XBBC 4DWFA 4DDID 4EEWA 3VUXA 2LXAA 5LLIA 2N4FA 4ZRIA 2LVPA 3KUDB 3APDA 3ML9A 4FJZA 1Z2MA 2IBIB 2Z0EB 3ZO5B 2AWTA 5D6JB 2JXXA 4TV3A 4A3PA 2KMAA 3WAPA 5D94A 1WM3A 1V6EA 1V81A 2O6VA 4FADA 2OOBB 2N7EA 1Z5SB 3DCGA 3V61A 4KVGB 3PGEA 1TGZB 1SGHA 3OLMD 3WAMA 1ISNA 4FJYA 2J0MA 2MCNB 2MBEA 3GZNI 4AWJA 3A9KB 2W9NA 3H6NA 3T9LA 3T8MA 4KDLB 4GU2A 4K7UA 2BYFA 2M4NA 2R2OA 3KUCB 3WIMA 1WXMA 3H9DA 1U4AA 4KV2A 3GOEA 3ZLZA 3PS6A 3HM3A 3CF6E 3OJ4B 1TTNA 2CHXA 3QC8B 4IWPA 4YL8A 1HE8A 1IYFA 2BWFA 2KDEB 4RMAA 2DYMA 3H7PA 5E6PA 2LXCA 4E71A 3RCZA 3A9JB 2IO3B 1WE7A 2GBKA 1WMHA 2ZVOA 4N9F4 4BFRA 2ZEQA 2ZZPB 1IPGA 1TBEA 1NBFC 1GNUA 3QA8A 3UQBA 1WGHA 3L17A 2C7MB 3RUIB 1KOTA 4XZ4A 2AEHA 5TR5A 2BKRB 3VTWA 5J2RA 2C5LC 3CSFA 1V80A 3DBSA 2GOWA 4GIVA 1I42A 2BYVE 2KTRA 2PPHA 3SD5A 2JZ3B 2PJHA 1WGGA 3RT3B 2LVQA 3BY4B 3IBEA 2O6VD 2BKFA 2O2VB 3QK0A 2MBOA 3L08A 2NR2A 2YLMA 3MJWA 3DOWA 4P7IA 3CMMB 2MX2A 2LGDA 1ZGUB 1P1AA 1LM8B 2BF8B 2XEWA 3ZKJC 3ZTCA 4JIOU 1WR6E 2L76A 2C7HA 1OEYJ 3U8ZA 3L0WB 2KWUB 3NHEB 1S1QB 3PV1A 4W9FA 4MDKE 4F1SA 1WJNA 4JQWC 2DAFA 3VTVA 4EZJA 4CYEA 4E74A 4NQLB 2B3AA 3B0AA 2GMIC 2KC2A 4WJQA 1L2NA 4IWQA 3EFUA 3N30A 1X1MA 3W1YA 2LD9A 2MLBA 2DX5B 4MJSB 3ALBA 1FXTB 3RYTA 3ZVVA 3RZFA 4OVUA 3MTNB 2N9XA 3PZDA 4FN2A 1XT9B 4EKUA 3ZTDA 4DK5A 1V2YA 2JVCA 3V60A 3DBHI 3L10B 3QHTA 4ANWA 3JW0X 4DHZE 1UELA 1UZXB 2ZCCA 4EUTA 3WA0A 1RFAA 2V4LA 5DPRA 3QX1A 4AUQC 2M17A 4A3OA 4WWPA 3C0RB 4BKGA 4F7ZA 3AULA 3NZUA 4NNJB 1OQYA 4GMVA 2DYOA 3A9KA 4GXBA 1LQBA 2BPSA 1XQQA 1H4RA 4X57B 4RM8A 1SIFA 4WJOA 2N7DA 4HDOA 3TMPB 4NAWB 2HJ8A 4HLEA 1LXDA 2KLGA 4NQKE 2GBNA 2KOXA 2VRRB 1UD7A 2YVCA 4NJ6A 1WF9A 3DPDA 2V3SA 3DVGY 3KVFB 4HJKA 3VUYA 5C23A 2DYBA 3L13A 4MGZE 2RPQA 5JHBA 4ZRJA 3A9JA 3X23A 2MW5A 4LDTB 2KFKB 1H8CA 4FJVB 3PREA 3N3KB 1CMXB 1GUAB 2XK5B 2N9PC 2KFJA 5JZEB 2LWPA 4GSWA 4M0WB 4IM3A 2JZZA 2KX0A 1ZW7A 2KN5A 2Y5BB 2KK8A 2DAJA 2KVRA 1PQSA 2C9WB 3X0WA 4MSQB 3PVLA 2CHWA 4II2B 1WGRA 3HIZA 5LXHA 2NPTB 2FCSA 3ECIA 3IG3A 3PLUA 3TIXA 3A1QB 2FIFA 3DBRI 4ANVA 4GGQA 4KSLC 4WQOB 3KYDD 4G50A 3TCAA 3QWZB 1P9DU 1GG3A 5E6NA 3PSEB 1WJUA 2OJRA 2LRUA 4JL9A 1NDDA 2KD0A 2I1KA 4KDIC 3TL5A 4EZKA 1G6JA 5GMVA 5L95C 4KZ0A 3WANA 1WY8A 2JRHA 2HD5B 3NS8A 1YX5B 4FA6A 2FAZA 3APCA 1WZ0A 2D10A 3HK0A 2PE6B 4HDQA 2ZNVB 3QAQA 3K9PB 4CO7A 4MJSA 5JH5C 4ANXA 2KQSA 4PS8A 5DPSA 2IY0B 2J7QB 2N1WA 3ONSA 4W9CA 3RD2A 1A5RA 2WYQA 1WXVA 2AL6A 2FCNA 2PE9A 2NVUI 4TUUA 3R7QA 3M95A 3UIPB 5KHQA 3V6CB 4BOZB 4KIKA 4DHJB 2L00B
chains in the Genus database with same CATH superfamily
2M8SA 3URYA 4JWUC 4K1RB 4CHKA 4ZHOA 4JWSC 2MHJA 2WXFA 3VXWA 3ML8A 2K22A 2QILA 3N1XC 1S3SG 1N63A 2KNBA 2D07B 3NVZA 1QOGA 3RNCC 2BT6A 5EE9A 3PT2B 1GB4A 2KFKA 2JY6A 2VH2A 2JQRB 2CKHB 2MH7A 3H7SA 2WXLA 2XK5A 1C4AA 4C4VA 3DVNV 3ZDTA 4URKA 4HPLB 2CS4A 3V3XA 1T0RC 3NVYA 2KXJA 3I3TB 4B0MA 2J42A 2BS2B 2KHWB 5J18A 2QIEB 2ZNVC 4P1CC 1Q5WB 2GB1A 3P63A 2ZCBA 2LVOA 5JHAA 5EE0A 1ZXHA 4RM9A 4B6WA 4MH8A 1IGDA 3DBLI 2BB6A 1L4ZB 1EU3A 4BOSC 2RSUA 3BK2A 1FIQA 5AZFA 4ASWC 1DGJA 2KTRB 3NY5A 2PLPA 3L54A 3DDCB 3SU8X 4LDTD 4RGTA 4IKGA 1I4XA 1PGXA 4G11A 4TSSA 4AP4C 1QZEA 2CJNA 4A20A 1C4CA 2NTSA 3Q8FA 2ZW0A 4XX5A 4IOIE 3R2IA 2IJ0A 4HKQA 3VRAB 2L3ZA 2I2YA 1XEEA 1EF5A 4DQOC 3FKYA 2V3NA 1CK1A 1V49A 3KH0A 4A6QA 4XYCA 2WDVB 3DHIC 2OHFA 3PLVA 2LHDA 2BW2A 1DYQA 5DPTA 4F8CB 1K51A 4BBNC 4BKSA 2W82A 1E7UA 2L8JA 3HRDD 1QT9A 1VZ6A 2K0PA 2M19A 2YEPF 3MC9A 2EKIA 4LK0M 3AU4A 4Q2JA 1FM0D 2D3AA 1VD2A 1I4QA 1QOBA 5D3DA 2GRIA 2H88B 5HKHA 2M56B 4FLHA 4C56C 4PS3A 2ZPNA 4O1NA 4MT5A 1SIJA 4ITKA 1VLBA 2WXRA 4DBGA 4EOYA 2MP2A 2TSSA 2K39A 4PK1A 4MM3A 1V1PB 4WH4A 2K25A 3DHHC 2LGSA 3BVMA 5FR6A 3AB5A 1WX9A 2NS5A 3PZ7A 2KQ7A 1ET6A 1E8WA 2MQJA 4W9EA 3UQAA 1N61A 3RNEC 4LLGM 3L16A 5BYSA 1WGKA 5CHFA 2D3GA 3JSVB 2A4ZA 2K3UA 2IZVB 2MEKA 3PRPB 1CQVA 3HHMA 1L7YA 4S17A 2JT4B 3NOBA 2NBWB 5CTRC 3IFWB 3NVWA 3MHSD 4ZRPA 4DWFA 5BMHA 2N4FA 2HJ1A 2LVPA 1TY0A 1FRRA 3ZO5B 2AWTA 4WURA 1K53A 5MPOA 3TEWA 3WAPA 1M4VA 1WM3A 2O6VA 3MC8A 2OOBB 1MJDA 3DCGA 3V61A 5FR3A 1A70A 1PYWD 2DNFA 3T3OA 3WAMA 4FJYA 4AWJA 1VJKA 1F52A 5HI1A 3KUCB 1U4AA 1TKEA 3GOEA 4MACA 1NYQA 5BYQA 3EFCA 3QC8B 4YL8A 2BWFA 2KDEB 3H7PA 5E6PA 3RCZA 3A9JB 3AE1B 2ZEQA 1NBFC 3MJ5A 4YTNB 4YTPB 3L17A 4XZ4A 2AEHA 5J2RA 2BKRB 2D5GA 3SD5A 2LVQA 3QK0A 3N9YC 3I5JC 4RCOA 1E9MA 1TIFA 3PZ8A 3DOWA 2L52A 2MX2A 2XEWA 3ZTCA 1C9FA 1OEYJ 1ACCA 3NHEB 2KWUB 3PV1A 4W9FA 4MDKE 1SBBB 4CYEA 1JRPA 4NQLB 1ZP0B 2GMIC 2KC2A 2LD9A 1ZOYB 1HTQA 3RYTA 1SF0A 1TS2A 3RZFA 4OVUA 1K50A 1XO3A 2N9XA 1B9RA 1V2YA 4RNAA 2JVCA 1SE4A 1UELA 1UZXB 2ZCCA 3L4PA 3WA0A 5DPRA 2M17A 4A3OA 3W5UB 4WWPA 5C2TB 4F7ZA 1ZE3D 4NNJB 3Q8AA 3A9KA 2BPSA 4USAA 4WJOA 1SIFA 4KKIA 2DWQA 1L0VB 2HJ8A 4ACFA 4UDUC 2KLGA 3IXSA 2KOXA 4P6VF 4NJ6A 3DVGY 3KVFB 2RDBC 5C23A 1L0XB 2DYBA 1YJJA 2JYEA 3L13A 4HPPA 1EWCA 4ZRJA 2WXHA 4FJVB 1CMXB 4RGNA 3TSSA 2KK8A 2DAJA 2KVRA 2RDGA 1PQSA 2C9WB 3RN9C 3HUIA 1HEZE 1WGRA 3DWGC 3ECIA 3DBRI 3MFGA 4WQOB 4G50A 3BWUD 1P9DU 3PSEB 3GS2A 2VH1A 5L95C 2HD5B 3NS8A 1E7PB 2FAZA 1AW7A 3APCA 1WZ0A 4HDQA 3B2FA 1GPXA 4HEA1 3K9PB 4CO7A 4MJSA 2KT7A 1RYJA 5JH5C 3DBHB 3AEFB 2IY0B 4GLSC 2WGSA 2AL6A 1ZUD2 2JZPA 3R2TA 4BOZB 3KQ4A 4DHJB 2E6XA 2LJIA 3IVFA 2NBUA 3Q8EA 3ETRA 2NBVB 3Q3NC 1NEKB 3H1UA 3EC8A 4IM2A 3J9CA 2QMTA 3LDZE 3W9CB 3RZWC 1WYGA 4NAWA 3SDLC 1FCLA 3R66C 1GC6A 3AEEB 2AL3A 5D2MB 3FILA 2L32A 2ASQA 1WR1A 4ANUA 1PFDA 1EWYC 2KJRA 1UUPA 2G4SA 3IAS1 2KJ6A 4WJPA 2KZRA 2LHEA 4W9LA 4JLCA 1E6EB 1WJ4A 5BMIA 2KMCA 3VFKA 1SE3A 1EUVB 1ZPSA 2MJDA 3AH7A 2WX1A 1KLGD 2J4XA 2IGGA 1EF1A 1KH0A 2L0FA 4MELA 4MGIE 2Z0DB 1MG8A 2ZJDA 5L83A 2QHOA 2KDFB 1F9JA 4WJNA 4IUMB 1PUTA 2MBBB 2BYEA 1FNVA 1RLFA 2LZ6A 2JRIB 4US8A 1WX8A 2KYWA 3VUWA 3ZJTA 3VVWB 4K81A 3A33B 4FULA 4BZAA 1DOIA 2LUEA 4J6IA 2L7RA 4E3CA 2MRPA 1GAQB 2M0AA 1Q0WB 2DZKA 2IO2B 4W9KA 4HJGE 2K9XA 2Q5WD 2BWES 2AQ2B 4ZRQA 1I7HA 1YMHE 3D32A 2WWZA 4J3OD 1TS5A 2V9HA 1JROA 2KTFA 3SHQA 1R4MI 5CX3A 3RNAC 3AI5A 5J17A 1J0GA 2JPHA 3AE5B 3U7DA 2K8BA 5AUKA 5G55A 3Q14C 3AE4B 4W9IA 3W2DA 2INCC 3JVZX 1SXTA 2FNJB 1F2RI 2UWQA 4OZBA 2DHZA 3NVVA 4EZLA 1C79A 2JYTA 4MH0E 3M3JA 4NAMA 2BB5A 2INDC 4LNKA 3UF8A 2RDHA 1F2RC 3ZUNA 3P42A 2PEAA 4NJ7A 2PW9A 3DWMA 3KW5B 1WFYA 1RRBA 1L5PA 2L05A 4N6EB 3Q3JA 4HVBA 1MHHE 4IWOA 2IDYA 3A4RA 4LNNA 4IDIA 4MEMA 3H8HA 3DQVA 3N20C 1L6UA 5EE3A 2JUOA 2IO0B 3O65B 2H89B 4S0RA 4KSKC 1SJED 1DOYA 3N32A 1XLQA 3M63B 3APFA 5BO4B 2ZVNA 4GN1A 2JSVX 2XN9C 1UGMA 1N60A 2D11A 2R61A 4AOFA 2QDFA 3PRMB 4BKSD 2RD0A 1C3TA 5C1ZA 2L0TA 4K3BA 1TT5B 1KJTA 1WMHB 2A5UA 4BBNF 2GBMA 3ZJUA 2FCMA 5DPWA 4KIKB 2AQ3B 3UGBB 2UYZB 2MBQA 4JE3B 4RGOS 2K6QA 2K1FA 1WRDB 3ENEA 3NJTA 2WXNA 4REZA 2J0KA 3W1SA 2WDQB 3GE3C 3U30A 2N7JA 1KM7A 1I35A 4PS7A 1OGWA 1D3ZA 4JPSA 3E56A 4P16A 3WALA 2IO1B 2K6DB 2IGDA 4WWNA 4ZOHC 1C77A 1FNWA 1QF6A 2WX0A 2XBBC 4DDID 5LLIA 1JWBD 4ZRIA 1D4BA 1IBXB 4CQNA 2Z0EB 2JXXA 2VZKB 1MPEA 1V97A 4KX6B 4JX1C 1T3QA 1KTKA 1IUEA 3V05A 2WXOA 3B9JA 3PGEA 3OLMD 4M00A 2MCNB 2B76B 4TMAB 2MBEA 4XDDA 1J7CA 4K7UA 3WIMA 1L0YB 3HM3A 3OJ4B 1TTNA 2CHXA 3VR9B 3ZXVA 1FNUA 1JW9D 1MFWA 2KQ4X 2PTLA 3TUOA 4RF1A 4BFRA 1EM7A 2G1EA 1IPGA 1TBEA 2WU2B 2ZZPB 4YSZB 3UQBA 1XCQL 2INNE 1FFUA 1WGHA 4K3CA 2C7MB 2PVGC 2LGIA 2C5LC 3CSFA 1SEBD 1V80A 3DBSA 2GOWA 1I42A 4RH6A 2JZ3B 4R3DA 3IBEA 2O6VD 2BKFA 2OEDA 2MBOA 2NR2A 2YLMA 1FEHA 1PDXA 3MJWA 4P7IA 3AE6B 5H92C 1HTOA 2BVCA 1P1AA 1LM8B 5GXGB 1QLBB 3L0WB 3P1MA 1V8CA 1S1QB 1CZPA 1AWDA 3AE3B 4WIPA 2DAFA 3B0AA 3P4PB 1P7EA 4IWQA 3ALBA 2PKOA 3PZDA 1TKYA 1XT9B 4EKUA 3ZTDA 4DK5A 4FXCA 3DBHI 3L10B 3JW0X 4DHZE 1ZXIA 2N9LA 4EUTA 1RFAA 3WCQA 4AUQC 2KN4A 3RNGC 4BKGA 4OZCA 2DYOA 3C8YA 4GXBA 1V1OA 1XQQA 1H4RA 4RM8A 2XNAC 2N7DA 4HDOA 1LXDA 5C3JB 1WF9A 4HJKA 2V3SA 4L2YA 4HRSA 2QCZA 3A9JA 3X23A 4LDTB 3ZXRA 3PREA 1GUAB 5JZEB 4GSWA 4M0WB 1N5XA 4IM3A 2Y5BB 2KX0A 2KN5A 4C80A 2WXKA 4II2B 1JWMD 5LXHA 2NPTB 4MM3B 1ZDVA 1FO4A 3A1QB 4GGQA 4KSLC 3E9SA 4JL9A 1WJUA 2KD0A 2I1KA 2HTME 4KZ0A 2LMCA 1C78A 2OJWA 4YTMB 1SB3C 3HK0A 2PE6B 2ZNVB 3BZDB 3KLSX 4ANXA 3EGRA 2KQSA 3OWEB 4H2AA 2KDMA 3MC0B 1J7BA 2FCNA 2NVUI 3UIPB 3LB8C 2L00B 4EZKA 1YNTE 1WX7A 2IY1B 2JX5A 3ZNID 4I6PA 1M94A 1FRDA 5E6OA 4W9HA 3RI7C 3DBLB 1E5WA 3EECA 1GJZA 3AE9B 2MA9B 3QQ8B 3P4RB 4ARIA 4MGKE 1TZ1A 4NJCA 4IW0A 3PTFC 5G2NA 2V4IB 2WXQA 2MJ3A 5CHWA 1GC7A 3VDZA 1E8XA 3AE8B 3Q3FA 1Y56A 3DVGX 2LGXA 5KHOA 4I6LB 3AEGB 1UF0A 2ZPYA 4K7WA 2FBWB 3BK1A 1R4NI 4ZDVA 4DHZB 4HKZE 4AJYB 5D7GA 1NENB 5IAAC 2KWVB 4XC2A 3PHXB 5HHDG 4W9GA 4HXDA 1E8YA 4FBJB 4EFOA 3CWIA 4LJOB 1TJEA 2BGFA 2SEBD 3AV8A 1AN8A 3IHPC 2HE7A 2KJHB 1QILA 1WXSA 2WU5B 3Q8CA 2HTHA 3I9V1 1JWAD 3IT4B 1ESFA 1PGBA 5IN7A 3V6EB 2JWZA 3VH3B 5LXIB 1B1ZA 2O2VA 4ZHPA 2EELA 5FK9C 5IOIA 3UI3A 1MG4A 3U52E 2EKEC 1XLNA 1WJ6A 4GDKB 4D2KA 3AECB 4HWIB 4DXFA 2RGFA 2C7NB 1RWSA 4KGSA 2KWCA 3EA6A 4FHJA 3SFEB 3KUZA 4II3B 3ZNHB 3LXFA 1ZKHA 4AJWA 3PPAA 1WIAA 1KLVA 2KVZA 4N58A 1DOXA 3TEYA 3UINB 3KYCD 5IO9A 3MP9A 1AARA 3R7RA 5IA7A 2LGYA 2HDEA 3AEAB 4L1BA 2X38A 2IYDB 2QEJC 2DZIA 4LNFA 3BINA 4ZYSA 2Z59B 4GDLB 3PO0A 1F77A 2AX5A 3DHGC 4I6NB 1SE9A 2WDRB 1OQQA 3MHZA 2EMSA 3U2SC 3ZRFA 4GB9A 4ICVA 3ZW3A 1P7FA 2KMMA 2G45B 4IM0A 1HQRD 3CIRB 3GB1A 1WSPA 3VHTC 2J0JA 2Z8LA 1OTRB 4IG7B 5AEKB 4RF0A 4G3XB 4TQ1A 4XWWA 1I4RA 2KDBA 2FE8A 1NI2A 1YJIA 4LJPB 1J7AA 1T0SC 3I63C 1D6EC 1LFDA 2EMTA 4DXGA 5EE1A 3ZNZB 5TSSA 1ZDXA 4NY0A 3W1SC 1C4PA 1NYRA 1WXAA 2C60A 2W55A 3HVDA 1Q1OA 2WXGA 3QIJA 5AZHA 4WQMA 5HFYA 4HK2A 2LEKA 1Y8RC 2FCQA 2LFIA 1WZ3A 2MBHA 3EHVA 4LTUA 2FIDA 1FXIA 1I4GA 4WAAA 1J8CA 3T3NA 4OVVA 3AU5A 1WGYA 4WWOA 3AXCA 3FAHA 1WGDA 4K7SA 3LJ3A 2KDIA 3SFDB 4C7ZA 4LCDE 3B2GA 4A8XC 3GE8C 2GLSA 3VUXA 2LXAA 1RM6C 3N1ZC 2WLBA 5D3IB 1Z2MA 5D6JB 4TV3A 2KMAA 4WAFA 1V6EA 1V81A 1QKZA 4ARCA 2N7EA 1QOAA 4KVGB 1TGZB 3GP7A 1ISNA 2J0MA 2PVOD 4GU2A 1F1HA 2M4NA 2JXTA 4KV2A 4P1BC 4IWPA 1IYFA 4RMAA 2DYMA 4HROA 1JWUD 2LXCA 4E71A 2IO3B 1WE7A 2GBKA 1WMHA 4N9F4 3U4EG 1QOFA 1GNUA 2RMMA 5TR5A 2JWUA 1HA5A 2BQQA 2BYVE 2KTRA 2PPHA 2PJHA 2X8XX 4KKJA 4XGAB 3RT3B 3BY4B 3L08A 1UNSA 3AEBB 2LGDA 1ZGUB 1VZ8A 1FD6A 2BF8B 3ZKJC 1WR6E 2L76A 3AN1A 2NMQA 4F1SA 1WJNA 3VTVA 1L2NA 4WJQA 1VR9A 3N30A 1X1MA 3W1YA 2MLBA 3W5VB 1IBXA 2WXMA 2ONQA 4FN2A 2V0GA 2L83A 3DBRB 3QHTA 1FCCC 4ANWA 4BAXA 3GZNB 4LNOA 2V4LA 3QX1A 3C0RB 1YQ3B 1VRAB 5E6JA 2D3BA 5BMGA 2W3SA 1F0ZA 3RMKC 1Q10A 4HLEA 2J53A 1T0QC 1XXGA 2GBNA 1D5ZC 1UD7A 2YVCA 3DPDA 4YT0B 1SE2A 3Q2AC 2RPQA 5JHBA 2KFKB 4EE2A 3N1YC 3N3KB 3VR8B 2XK5B 2N9PC 2KFJA 2LWPA 4C4VB 1WXQA 1ZW7A 3PVLA 2CHWA 3TEXA 3C19A 2ACZB 2FCSA 3IG3A 2FIFA 4ANVA 4XWTA 3KYDD 3TCAA 5E6NA 2IGHA 2OJRA 1LGRA 3BYTB 1WY8A 1YX5B 1V1PA 5FKAC 1TKGA 4PS8A 5DPSA 2N1WA 2J52A 3ONSA 3RD2A 2V3PA 3R7QA 3M95A 5KHQA 4YSXB 3OAWA 1WH3A 4OHJA 2KKCA 3B08A 1YQ4B 3Q6BA 1L6VA 2LRWA 2MJEA 3JSVA 1YQBA 4MSMB 3NZSA 2UU7A 2DENB 4MGYE 4C7YA 1JALA 5IKCM 2WXPA 1C1YB 5AZGA 1ROEA 4B95A 1V86A 4GOCA 2KX3A 2CJOA 2QJLA 1FMAD 1P3QU 1WM2A 1K8RB 2IPKD 4KZCA 1V5TA 1IP9A 3RNBC 2RR9A 3ZDMC 2BS4B 2WP9B 3TJPA 3TBLD 4HCPB 4TQ0A 3O13A 1YIWA 4ZRKA 1NI3A 4M0WA 1N62A 1XLOA 2BBCA 1V5OA 2QC8A 4RGMA 3PHWB 1E10A 3BVZA 4W9DA 5H8YE 4HCNB 3A4SC 1E7VA 3DVNU 1UGJA 3WAOA 2NPTA 3VQIA 3A1QA 4HPMB 1JRUA 3Q69A 3ZRCA 4US9A 4OZAA 4A55A 1R4MB 3R3MA 1WI0A 2KC1A 3P2BA 1BXTA 3ZIMA 3EUB2 3HM6X 1V9JA 1E90A 2R2QA 1OEYA 2E3TA 3NRZA 1UH6A 3PRZA 4DXAB 2PIAA 3HVZA 4TKNA 4B9KA 1XD3B 1P98A 4PYUA 1YX6B 4LNIA 5JXVA 1E8ZA 4ZYNA 1JMLA 2DBYA 1YN4A 2MP2B 2MWSB 1YJ1A 1BT0A 4C00A 1UBQA 2V1YA 4KGTA 1JQ4A 2DLBA 1MVKA 3QCAA 3JYUA 2G4DB 2LJ5A 3S2AA 3ZNGC 5CHVC 3NZ3A 4AQ7A 4DDGD 1BUIC 2LASA 1WE6A 4G0NB 3ZYYX 2KANA 1VCBA 2W3RA 4QAYA 2KLCA 1TS4A 2CU1A 1NVID 2CU3A 2DZJA 2JU6X 2WNMA 1TZOA 1QQRA 4YXDB 3B1LX 3QJZA 4DHJD 3ZQ4A 3VH4B 3R8BA 4PYZA 3ABVB 4OW0A 1IGCA 3KWLA 4W9JA 1YD8U 1STEA 2WDTB 3FC4A 2FUHB 4ICUA 1FPYA 2AQ1B 1VZ7A 1XF5L 4IC7B 5DCNA 4N59A 3I57A 3NG0A 1OFFA 2Y3AA 1RAXA 2WQYB 4NPNA 2O6VB 2CR5A 4M8NA 2AYOB 2M1MA 1TS3A 3RULA 2I38A 3OJ3A 1GB1A 3KWVA 2L1AA 1TY2A 1XLPA 1PGAA 1HZ6A 4B0EA 2N9EB 1ET9A 2G3QB 1J19A 3NUHB 2BYTA 3V62A 5EDSA 1BMLC 2KO3A 4BKTA 2M0XA 2N0SB 1EO6A 3M62B 3CSTA 2N1VA 3H7PB 3VAWA 1GOZA 3AE7B 3AMZA 5I4DA 4GDKA 1N6ZA 2D2QA 3VTUA 2CHZA 2NCNA 3ZJVA 3TEZA 3QARA 2REXA 2LI5A 2I1JA 1OQRA 4JGHB 2GBJA 2KACA 1WYWB 3OG5A 4BVUC 1VDVA 3UIOB 2RPVA 1R7SA 2SAKA 2Y5CA 2MSED 4WWMA 4OVZA 2DZMA 4FHKA 1T0YA 2JF5A 3K9OB 1C76A 1P0RA 2ICIA 5G5HA 2N9KA 1YN5A 1MHXA 2K8HA 2GBRA 1SSNA 1TYGB 2K8CA 4GDLA 1D5XC 2LUMA 4M8MA 3AEDB 5AUIA 1HZ5A 5IP4D 1JWSD 1UBIA 4EEWA 1LO5D 1I4PA 3KUDB 3APDA 3ML9A 4FJZA 2WXJA 2IBIB 2WS3B 4A3PA 3AM9A 5D94A 3SR6A 4FADA 4AS1A 3ZGZA 1Z5SB 2KAJA 4YSYB 3SEBA 1XCTL 1SGHA 3GZNI 3A9KB 2W9NA 3H6NA 3T9LA 3Q3MC 3BYYB 3T8MA 4KDLB 2BYFA 3Q3OC 2R2OA 1D5MC 1WXMA 3H9DA 3ZLZA 3PS6A 3CF6E 4YWGG 3IT6B 1UWMA 2ON8A 1T5XD 1HXYD 1HE8A 2WXIA 1L4DB 2PMVA 3VRBB 2ZVOA 3QA8A 5BYRA 3BVGA 3RUIB 1KOTA 4RFBA 3VTWA 5G5GA 4GIVA 1WGGA 1WWTA 2GI9A 4XE0A 1CJEA 2O2VB 4A90A 1I4HA 3CMMB 1FFVA 1WRIA 2YEPB 4M01A 5HG2A 2QSDA 4JIOU 2C7HA 3U8ZA 3P4SB 3RNFC 1K52A 4JQWC 3P4QB 4EZJA 4E74A 1YOVB 2B3AA 3EFUA 3BIID 2G9HD 2DX5B 4MJSB 1FXTB 3ZVVA 3MTNB 1JCKB 1SJHD 3V60A 1RFKA 3Q8BA 3AULA 1KRHA 3NZUA 4L23A 1OQYA 4GMVA 5LNK1 1LQBA 4X57B 1E0ZA 1EU4A 3TMPB 3IAM1 4NAWB 1N5WA 4NQKE 2VRRB 5T8IA 4M02A 1FXAA 3VUYA 2NTTA 3AE2B 1ENFA 3FILB 4MGZE 1KF6B 1KLUD 3LYYA 2MW5A 3RFZB 4KGRA 4A9AA 1H8CA 2ZW1A 2Y5PA 2JZZA 2D3CA 1T6BX 3X0WA 4MSQB 2VZKD 1UWXA 4NZLB 3HIZA 3PLUA 3TIXA 2W54A 3U7ZA 3RPFC 3QWZB 1MI0A 1GG3A 2INPE 2LRUA 1NDDA 3NS1A 4KDIC 3TL5A 1G6JA 5GMVA 3WANA 2FUG1 2JRHA 4FA6A 2KWDA 4XDCA 1KFYB 1YN3A 2D10A 4PT5A 2BTEA 3QAQA 2BS3B 2K5PA 2J7QB 1AYFA 4W9CA 1A5RA 2WYQA 1WXVA 2PE9A 2WHIA 4TUUA 3V6CB 1R4NB 4KIKA
chains in the Genus database with same CATH topology
1WH3A 1WX7A 2M8SA 2IY1B 2KKCA 3B08A 4K1RB 3IVFA 2NBUA 3ZNID 4I6PA 4CHKA 2LRWA 2NBVB 1M94A 5E6OA 3H1UA 3EC8A 3JSVA 4IM2A 4W9HA 1YQBA 3LDZE 4MSMB 3NZSA 4MGYE 2DENB 3RZWC 1E5WA 3VXWA 4NAWA 3EECA 1GJZA 3ML8A 3SDLC 1C1YB 5AZGA 2MA9B 3R66C 1GC6A 4B95A 1S3SG 3QQ8B 1V86A 2AL3A 4GOCA 2KX3A 5D2MB 2KNBA 2D07B 2ASQA 1WR1A 4MGKE 1TZ1A 1P3QU 4IW0A 1WM2A 3PTFC 4ANUA 5G2NA 1K8RB 3PT2B 4KZCA 1V5TA 2KJRA 1IP9A 2G4SA 2RR9A 3ZDMC 2KFKA 2JY6A 2KJ6A 3TJPA 3TBLD 5CHWA 4HCPB 4WJPA 2KZRA 1YIWA 4ZRKA 4TQ0A 2CKHB 3H7SA 4W9LA 2XK5A 1GC7A 4JLCA 1E8XA 3VDZA 1WJ4A 3Q3FA 1V5OA 3DVGX 3DVNV 3ZDTA 3PHWB 4URKA 2KMCA 4W9DA 2LGXA 3VFKA 4HCNB 4HPLB 2CS4A 5KHOA 3A4SC 1E7VA 1EUVB 2KXJA 3DVNU 3I3TB 4I6LB 2WX1A 3WAOA 2NPTA 2ZPYA 3VQIA 1EF1A 2KHWB 3A1QA 4K7WA 5J18A 1R4NI 4HPMB 2ZNVC 4ZDVA 4DHZB 1JRUA 1Q5WB 4AJYB 3ZRCA 2ZCBA 5D7GA 2L0FA 2KWVB 4XC2A 5IAAC 3R3MA 4MELA 2LVOA 3PHXB 1WI0A 4MGIE 2Z0DB 5JHAA 2KC1A 4W9GA 3P2BA 3W1SC 4HXDA 1MG8A 1E8YA 4RM9A 4FBJB 4B6WA 2ZJDA 3ZIMA 4EFOA 5L83A 2QHOA 2KDFB 1F9JA 4WJNA 4IUMB 4LJOB 3DBLI 2MBBB 2BYEA 2BGFA 3HM6X 4BOSC 1E90A 1V9JA 2RSUA 1RLFA 2R2QA 5AZFA 4ASWC 1OEYA 3IHPC 1UH6A 2LZ6A 2KTRB 3NY5A 3PRZA 2JRIB 4DXAB 4TKNA 1WX8A 2HE7A 4B9KA 3L54A 1XD3B 2KJHB 3DDCB 1P98A 3VUWA 3SU8X 4LDTD 1WXSA 4PYUA 1YX6B 2HTHA 3VVWB 4K81A 3A33B 4FULA 1E8ZA 4ZYNA 3V6EB 2JWZA 2LUEA 4J6IA 3VH3B 2L7RA 4E3CA 5LXIB 2MP2B 2MRPA 2O2VA 2MWSB 1YJ1A 4G11A 1BT0A 1Q0WB 1UBQA 2DZKA 2IO2B 2V1YA 4W9KA 4AP4C 1QZEA 4A20A 2BWES 3QCAA 3JYUA 2G4DB 2EKEC 4XX5A 2LJ5A 3D32A 2WWZA 3S2AA 3ZNGC 5CHVC 1WJ6A 2KTFA 4GDKB 4DDGD 3SHQA 1R4MI 4HWIB 5CX3A 2LASA 2RGFA 2C7NB 3AI5A 5J17A 1J0GA 2KWCA 2L3ZA 4FHJA 1WE6A 4G0NB 2KANA 3KUZA 2JPHA 1VCBA 1EF5A 4II3B 3ZNHB 1ZKHA 4AJWA 3PPAA 1WIAA 3U7DA 2KLCA 1KLVA 1V49A 2K8BA 5G55A 4W9IA 3KH0A 3KYCD 3UINB 3JVZX 2CU1A 1AARA 2FNJB 2DZJA 2UWQA 3R7RA 3PLVA 2DHZA 4EZLA 5IA7A 2LGYA 4MH0E 4F8CB 5DPTA 3B1LX 3QJZA 4BBNC 4DHJD 3M3JA 4BKSA 3VH4B 3UF8A 1E7UA 2IYDB 2DZIA 4PYZA 3BINA 2L8JA 4W9JA 2Z59B 3ZUNA 4GDLB 1YD8U 2PEAA 2WDTB 2FUHB 4NJ7A 4I6NB 3KW5B 1WFYA 1RRBA 1SE9A 4ICUA 2L05A 3AU4A 4IC7B 5DCNA 3Q3JA 4HVBA 2EMSA 4IWOA 3A4RA 4MEMA 1RAXA 4NPNA 3ZRFA 4GB9A 4ICVA 2O6VB 2CR5A 1VD2A 2AYOB 3DQVA 2M1MA 4M8NA 3RULA 2JUOA 3OJ3A 5HKHA 3ZW3A 2G45B 2IO0B 4FLHA 3O65B 4PS3A 2ZPNA 4IM0A 4KSKC 2N9EB 3N32A 4DBGA 2G3QB 1J19A 3VHTC 2J0JA 3M63B 3APFA 5BO4B 4EOYA 1OTRB 4IG7B 2ZVNA 4GN1A 5AEKB 2MP2A 4G3XB 4TQ1A 2K39A 2KDBA 3V62A 4MM3A 1UGMA 1NI2A 2KO3A 5EDSA 2D11A 4BKTA 4AOFA 2K25A 2M0XA 4LJPB 1EO6A 3PRMB 3M62B 1LFDA 2EMTA 2N1VA 3CSTA 4BKSD 3H7PB 3ZNZB 2RD0A 5FR6A 3VAWA 1C3TA 5C1ZA 2L0TA 4NY0A 4GDKA 1WX9A 2D2QA 3VTUA 1KJTA 1WMHB 2A5UA 2CHZA 2KQ7A 2NS5A 2GBMA 1WXAA 2C60A 2NCNA 3OAWA 4BBNF 2FCMA 2MQJA 1E8WA 1Q1OA 4W9EA 5DPWA 3QARA 2REXA 3QIJA 2LI5A 2I1JA 4KIKB 5AZHA 3UQAA 4JGHB 2GBJA 1WYWB 3UGBB 2UYZB 4BVUC 2MBQA 4HK2A 3UIOB 1Y8RC 2K6QA 3L16A 2FCQA 2K1FA 1WZ3A 1WRDB 3ENEA 2MBHA 5CHFA 3W1SA 2J0KA 2D3GA 2MSED 3JSVB 3U30A 2A4ZA 1KM7A 3EHVA 1I35A 2FIDA 4PS7A 2DZMA 1OGWA 2IZVB 4FHKA 1T0YA 2JF5A 1D3ZA 3PRPB 3K9OB 1P0RA 3HHMA 4WAAA 1L7YA 3WALA 2IO1B 1J8CA 2K8HA 4OVVA 2GBRA 2K6DB 3AU5A 1WGYA 4WWNA 2JT4B 2K8CA 4WWOA 3AXCA 4GDLA 1WGDA 3NOBA 4K7SA 3LJ3A 2NBWB 4M8MA 5CTRC 3IFWB 3MHSD 2KDIA 4LCDE 1UBIA 2WX0A 2XBBC 4DWFA 4DDID 4EEWA 3VUXA 2LXAA 5LLIA 2N4FA 4ZRIA 2LVPA 3KUDB 3APDA 3ML9A 4FJZA 1Z2MA 2IBIB 2Z0EB 3ZO5B 2AWTA 5D6JB 2JXXA 4TV3A 4A3PA 2KMAA 3WAPA 5D94A 1WM3A 1V6EA 1V81A 2O6VA 4FADA 2OOBB 2N7EA 1Z5SB 3DCGA 3V61A 4KVGB 3PGEA 1TGZB 1SGHA 3OLMD 3WAMA 1ISNA 4FJYA 2J0MA 2MCNB 2MBEA 3GZNI 4AWJA 3A9KB 2W9NA 3H6NA 3T9LA 3T8MA 4KDLB 4GU2A 4K7UA 2BYFA 2M4NA 2R2OA 3KUCB 3WIMA 1WXMA 3H9DA 1U4AA 4KV2A 3GOEA 3ZLZA 3PS6A 3HM3A 3CF6E 3OJ4B 1TTNA 2CHXA 3QC8B 4IWPA 4YL8A 1HE8A 1IYFA 2BWFA 2KDEB 4RMAA 2DYMA 3H7PA 5E6PA 2LXCA 4E71A 3RCZA 3A9JB 2IO3B 1WE7A 2GBKA 1WMHA 2ZVOA 4N9F4 4BFRA 2ZEQA 2ZZPB 1IPGA 1TBEA 1NBFC 1GNUA 3QA8A 3UQBA 1WGHA 3L17A 2C7MB 3RUIB 1KOTA 4XZ4A 2AEHA 5TR5A 2BKRB 3VTWA 5J2RA 2C5LC 3CSFA 1V80A 3DBSA 2GOWA 4GIVA 1I42A 2BYVE 2KTRA 2PPHA 3SD5A 2JZ3B 2PJHA 1WGGA 3RT3B 2LVQA 3BY4B 3IBEA 2O6VD 2BKFA 2O2VB 3QK0A 2MBOA 3L08A 2NR2A 2YLMA 3MJWA 3DOWA 4P7IA 3CMMB 2MX2A 2LGDA 1ZGUB 1P1AA 1LM8B 2BF8B 2XEWA 3ZKJC 3ZTCA 4JIOU 1WR6E 2L76A 2C7HA 1OEYJ 3U8ZA 3L0WB 2KWUB 3NHEB 1S1QB 3PV1A 4W9FA 4MDKE 4F1SA 1WJNA 4JQWC 2DAFA 3VTVA 4EZJA 4CYEA 4E74A 4NQLB 2B3AA 3B0AA 2GMIC 2KC2A 4WJQA 1L2NA 4IWQA 3EFUA 3N30A 1X1MA 3W1YA 2LD9A 2MLBA 2DX5B 4MJSB 3ALBA 1FXTB 3RYTA 3ZVVA 3RZFA 4OVUA 3MTNB 2N9XA 3PZDA 4FN2A 1XT9B 4EKUA 3ZTDA 4DK5A 1V2YA 2JVCA 3V60A 3DBHI 3L10B 3QHTA 4ANWA 3JW0X 4DHZE 1UELA 1UZXB 2ZCCA 4EUTA 3WA0A 1RFAA 2V4LA 5DPRA 3QX1A 4AUQC 2M17A 4A3OA 4WWPA 3C0RB 4BKGA 4F7ZA 3AULA 3NZUA 4NNJB 1OQYA 4GMVA 2DYOA 3A9KA 4GXBA 1LQBA 2BPSA 1XQQA 1H4RA 4X57B 4RM8A 1SIFA 4WJOA 2N7DA 4HDOA 3TMPB 4NAWB 2HJ8A 4HLEA 1LXDA 2KLGA 4NQKE 2GBNA 2KOXA 2VRRB 1UD7A 2YVCA 4NJ6A 1WF9A 3DPDA 2V3SA 3DVGY 3KVFB 4HJKA 3VUYA 5C23A 2DYBA 3L13A 4MGZE 2RPQA 5JHBA 4ZRJA 3A9JA 3X23A 2MW5A 4LDTB 2KFKB 1H8CA 4FJVB 3PREA 3N3KB 1CMXB 1GUAB 2XK5B 2N9PC 2KFJA 5JZEB 2LWPA 4GSWA 4M0WB 4IM3A 2JZZA 2KX0A 1ZW7A 2KN5A 2Y5BB 2KK8A 2DAJA 2KVRA 1PQSA 2C9WB 3X0WA 4MSQB 3PVLA 2CHWA 4II2B 1WGRA 3HIZA 5LXHA 2NPTB 2FCSA 3ECIA 3IG3A 3PLUA 3TIXA 3A1QB 2FIFA 3DBRI 4ANVA 4GGQA 4KSLC 4WQOB 3KYDD 4G50A 3TCAA 3QWZB 1P9DU 1GG3A 5E6NA 3PSEB 1WJUA 2OJRA 2LRUA 4JL9A 1NDDA 2KD0A 2I1KA 4KDIC 3TL5A 4EZKA 1G6JA 5GMVA 5L95C 4KZ0A 3WANA 1WY8A 2JRHA 2HD5B 3NS8A 1YX5B 4FA6A 2FAZA 3APCA 1WZ0A 2D10A 3HK0A 2PE6B 4HDQA 2ZNVB 3QAQA 3K9PB 4CO7A 4MJSA 5JH5C 4ANXA 2KQSA 4PS8A 5DPSA 2IY0B 2J7QB 2N1WA 3ONSA 4W9CA 3RD2A 1A5RA 2WYQA 1WXVA 2AL6A 2FCNA 2PE9A 2NVUI 4TUUA 3R7QA 3M95A 3UIPB 5KHQA 3V6CB 4BOZB 4KIKA 4DHJB 2L00B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH3 A;  1WX7 A;  2M8S A;  2IY1 B;  2KKC A;  3B08 A;  4K1R B;  3IVF A;  2NBU A;  3ZNI D;  4I6P A;  4CHK A;  2LRW A;  2NBV B;  1M94 A;  5E6O A;  3H1U A;  3EC8 A;  3JSV A;  4IM2 A;  4W9H A;  1YQB A;  3LDZ E;  4MSM B;  3NZS A;  4MGY E;  2DEN B;  3RZW C;  1E5W A;  3VXW A;  4NAW A;  3EEC A;  1GJZ A;  3ML8 A;  3SDL C;  1C1Y B;  5AZG A;  2MA9 B;  3R66 C;  1GC6 A;  4B95 A;  1S3S G;  3QQ8 B;  1V86 A;  2AL3 A;  4GOC A;  2KX3 A;  5D2M B;  2KNB A;  2D07 B;  2ASQ A;  1WR1 A;  4MGK E;  1TZ1 A;  1P3Q U;  4IW0 A;  1WM2 A;  3PTF C;  4ANU A;  5G2N A;  1K8R B;  3PT2 B;  4KZC A;  1V5T A;  2KJR A;  1IP9 A;  2G4S A;  2RR9 A;  3ZDM C;  2KFK A;  2JY6 A;  2KJ6 A;  3TJP A;  3TBL D;  5CHW A;  4HCP B;  4WJP A;  2KZR A;  1YIW A;  4ZRK A;  4TQ0 A;  2CKH B;  3H7S A;  4W9L A;  2XK5 A;  1GC7 A;  4JLC A;  1E8X A;  3VDZ A;  1WJ4 A;  3Q3F A;  1V5O A;  3DVG X;  3DVN V;  3ZDT A;  3PHW B;  4URK A;  2KMC A;  4W9D A;  2LGX A;  3VFK A;  4HCN B;  4HPL B;  2CS4 A;  5KHO A;  3A4S C;  1E7V A;  1EUV B;  2KXJ A;  3DVN U;  3I3T B;  4I6L B;  2WX1 A;  3WAO A;  2NPT A;  2ZPY A;  3VQI A;  1EF1 A;  2KHW B;  3A1Q A;  4K7W A;  5J18 A;  1R4N I;  4HPM B;  2ZNV C;  4ZDV A;  4DHZ B;  1JRU A;  1Q5W B;  4AJY B;  3ZRC A;  2ZCB A;  5D7G A;  2L0F A;  2KWV B;  4XC2 A;  5IAA C;  3R3M A;  4MEL A;  2LVO A;  3PHX B;  1WI0 A;  4MGI E;  2Z0D B;  5JHA A;  2KC1 A;  4W9G A;  3P2B A;  3W1S C;  4HXD A;  1MG8 A;  1E8Y A;  4RM9 A;  4FBJ B;  4B6W A;  2ZJD A;  3ZIM A;  4EFO A;  5L83 A;  2QHO A;  2KDF B;  1F9J A;  4WJN A;  4IUM B;  4LJO B;  3DBL I;  2MBB B;  2BYE A;  2BGF A;  3HM6 X;  4BOS C;  1E90 A;  1V9J A;  2RSU A;  1RLF A;  2R2Q A;  5AZF A;  4ASW C;  1OEY A;  3IHP C;  1UH6 A;  2LZ6 A;  2KTR B;  3NY5 A;  3PRZ A;  2JRI B;  4DXA B;  4TKN A;  1WX8 A;  2HE7 A;  4B9K A;  3L54 A;  1XD3 B;  2KJH B;  3DDC B;  1P98 A;  3VUW A;  3SU8 X;  4LDT D;  1WXS A;  4PYU A;  1YX6 B;  2HTH A;  3VVW B;  4K81 A;  3A33 B;  4FUL A;  1E8Z A;  4ZYN A;  3V6E B;  2JWZ A;  2LUE A;  4J6I A;  3VH3 B;  2L7R A;  4E3C A;  5LXI B;  2MP2 B;  2MRP A;  2O2V A;  2MWS B;  1YJ1 A;  4G11 A;  1BT0 A;  1Q0W B;  1UBQ A;  2DZK A;  2IO2 B;  2V1Y A;  4W9K A;  4AP4 C;  1QZE A;  4A20 A;  2BWE S;  3QCA A;  3JYU A;  2G4D B;  2EKE C;  4XX5 A;  2LJ5 A;  3D32 A;  2WWZ A;  3S2A A;  3ZNG C;  5CHV C;  1WJ6 A;  2KTF A;  4GDK B;  4DDG D;  3SHQ A;  1R4M I;  4HWI B;  5CX3 A;  2LAS A;  2RGF A;  2C7N B;  3AI5 A;  5J17 A;  1J0G A;  2KWC A;  2L3Z A;  4FHJ A;  1WE6 A;  4G0N B;  2KAN A;  3KUZ A;  2JPH A;  1VCB A;  1EF5 A;  4II3 B;  3ZNH B;  1ZKH A;  4AJW A;  3PPA A;  1WIA A;  3U7D A;  2KLC A;  1KLV A;  1V49 A;  2K8B A;  5G55 A;  4W9I A;  3KH0 A;  3KYC D;  3UIN B;  3JVZ X;  2CU1 A;  1AAR A;  2FNJ B;  2DZJ A;  2UWQ A;  3R7R A;  3PLV A;  2DHZ A;  4EZL A;  5IA7 A;  2LGY A;  4MH0 E;  4F8C B;  5DPT A;  3B1L X;  3QJZ A;  4BBN C;  4DHJ D;  3M3J A;  4BKS A;  3VH4 B;  3UF8 A;  1E7U A;  2IYD B;  2DZI A;  4PYZ A;  3BIN A;  2L8J A;  4W9J A;  2Z59 B;  3ZUN A;  4GDL B;  1YD8 U;  2PEA A;  2WDT B;  2FUH B;  4NJ7 A;  4I6N B;  3KW5 B;  1WFY A;  1RRB A;  1SE9 A;  4ICU A;  2L05 A;  3AU4 A;  4IC7 B;  5DCN A;  3Q3J A;  4HVB A;  2EMS A;  4IWO A;  3A4R A;  4MEM A;  1RAX A;  4NPN A;  3ZRF A;  4GB9 A;  4ICV A;  2O6V B;  2CR5 A;  1VD2 A;  2AYO B;  3DQV A;  2M1M A;  4M8N A;  3RUL A;  2JUO A;  3OJ3 A;  5HKH A;  3ZW3 A;  2G45 B;  2IO0 B;  4FLH A;  3O65 B;  4PS3 A;  2ZPN A;  4IM0 A;  4KSK C;  2N9E B;  3N32 A;  4DBG A;  2G3Q B;  1J19 A;  3VHT C;  2J0J A;  3M63 B;  3APF A;  5BO4 B;  4EOY A;  1OTR B;  4IG7 B;  2ZVN A;  4GN1 A;  5AEK B;  2MP2 A;  4G3X B;  4TQ1 A;  2K39 A;  2KDB A;  3V62 A;  4MM3 A;  1UGM A;  1NI2 A;  2KO3 A;  5EDS A;  2D11 A;  4BKT A;  4AOF A;  2K25 A;  2M0X A;  4LJP B;  1EO6 A;  3PRM B;  3M62 B;  1LFD A;  2EMT A;  2N1V A;  3CST A;  4BKS D;  3H7P B;  3ZNZ B;  2RD0 A;  5FR6 A;  3VAW A;  1C3T A;  5C1Z A;  2L0T A;  4NY0 A;  4GDK A;  1WX9 A;  2D2Q A;  3VTU A;  1KJT A;  1WMH B;  2A5U A;  2CHZ A;  2KQ7 A;  2NS5 A;  2GBM A;  1WXA A;  2C60 A;  2NCN A;  3OAW A;  4BBN F;  2FCM A;  2MQJ A;  1E8W A;  1Q1O A;  4W9E A;  5DPW A;  3QAR A;  2REX A;  3QIJ A;  2LI5 A;  2I1J A;  4KIK B;  5AZH A;  3UQA A;  4JGH B;  2GBJ A;  1WYW B;  3UGB B;  2UYZ B;  4BVU C;  2MBQ A;  4HK2 A;  3UIO B;  1Y8R C;  2K6Q A;  3L16 A;  2FCQ A;  2K1F A;  1WZ3 A;  1WRD B;  3ENE A;  2MBH A;  5CHF A;  3W1S A;  2J0K A;  2D3G A;  2MSE D;  3JSV B;  3U30 A;  2A4Z A;  1KM7 A;  3EHV A;  1I35 A;  2FID A;  4PS7 A;  2DZM A;  1OGW A;  2IZV B;  4FHK A;  1T0Y A;  2JF5 A;  1D3Z A;  3PRP B;  3K9O B;  1P0R A;  3HHM A;  4WAA A;  1L7Y A;  3WAL A;  2IO1 B;  1J8C A;  2K8H A;  4OVV A;  2GBR A;  2K6D B;  3AU5 A;  1WGY A;  4WWN A;  2JT4 B;  2K8C A;  4WWO A;  3AXC A;  4GDL A;  1WGD A;  3NOB A;  4K7S A;  3LJ3 A;  2NBW B;  4M8M A;  5CTR C;  3IFW B;  3MHS D;  2KDI A;  4LCD E;  1UBI A;  2WX0 A;  2XBB C;  4DWF A;  4DDI D;  4EEW A;  3VUX A;  2LXA A;  5LLI A;  2N4F A;  4ZRI A;  2LVP A;  3KUD B;  3APD A;  3ML9 A;  4FJZ A;  1Z2M A;  2IBI B;  2Z0E B;  3ZO5 B;  2AWT A;  5D6J B;  2JXX A;  4TV3 A;  4A3P A;  2KMA A;  3WAP A;  5D94 A;  1WM3 A;  1V6E A;  1V81 A;  2O6V A;  4FAD A;  2OOB B;  2N7E A;  1Z5S B;  3DCG A;  3V61 A;  4KVG B;  3PGE A;  1TGZ B;  1SGH A;  3OLM D;  3WAM A;  1ISN A;  4FJY A;  2J0M A;  2MCN B;  2MBE A;  3GZN I;  4AWJ A;  3A9K B;  2W9N A;  3H6N A;  3T9L A;  3T8M A;  4KDL B;  4GU2 A;  4K7U A;  2BYF A;  2M4N A;  2R2O A;  3KUC B;  3WIM A;  1WXM A;  3H9D A;  1U4A A;  4KV2 A;  3GOE A;  3ZLZ A;  3PS6 A;  3HM3 A;  3CF6 E;  3OJ4 B;  1TTN A;  2CHX A;  3QC8 B;  4IWP A;  4YL8 A;  1HE8 A;  1IYF A;  2BWF A;  2KDE B;  4RMA A;  2DYM A;  3H7P A;  5E6P A;  2LXC A;  4E71 A;  3RCZ A;  3A9J B;  2IO3 B;  1WE7 A;  2GBK A;  1WMH A;  2ZVO A;  4N9F 4;  4BFR A;  2ZEQ A;  2ZZP B;  1IPG A;  1TBE A;  1NBF C;  1GNU A;  3QA8 A;  3UQB A;  1WGH A;  3L17 A;  2C7M B;  3RUI B;  1KOT A;  4XZ4 A;  2AEH A;  5TR5 A;  2BKR B;  3VTW A;  5J2R A;  2C5L C;  3CSF A;  1V80 A;  3DBS A;  2GOW A;  4GIV A;  1I42 A;  2BYV E;  2KTR A;  2PPH A;  3SD5 A;  2JZ3 B;  2PJH A;  1WGG A;  3RT3 B;  2LVQ A;  3BY4 B;  3IBE A;  2O6V D;  2BKF A;  2O2V B;  3QK0 A;  2MBO A;  3L08 A;  2NR2 A;  2YLM A;  3MJW A;  3DOW A;  4P7I A;  3CMM B;  2MX2 A;  2LGD A;  1ZGU B;  1P1A A;  1LM8 B;  2BF8 B;  2XEW A;  3ZKJ C;  3ZTC A;  4JIO U;  1WR6 E;  2L76 A;  2C7H A;  1OEY J;  3U8Z A;  3L0W B;  2KWU B;  3NHE B;  1S1Q B;  3PV1 A;  4W9F A;  4MDK E;  4F1S A;  1WJN A;  4JQW C;  2DAF A;  3VTV A;  4EZJ A;  4CYE A;  4E74 A;  4NQL B;  2B3A A;  3B0A A;  2GMI C;  2KC2 A;  4WJQ A;  1L2N A;  4IWQ A;  3EFU A;  3N30 A;  1X1M A;  3W1Y A;  2LD9 A;  2MLB A;  2DX5 B;  4MJS B;  3ALB A;  1FXT B;  3RYT A;  3ZVV A;  3RZF A;  4OVU A;  3MTN B;  2N9X A;  3PZD A;  4FN2 A;  1XT9 B;  4EKU A;  3ZTD A;  4DK5 A;  1V2Y A;  2JVC A;  3V60 A;  3DBH I;  3L10 B;  3QHT A;  4ANW A;  3JW0 X;  4DHZ E;  1UEL A;  1UZX B;  2ZCC A;  4EUT A;  3WA0 A;  1RFA A;  2V4L A;  5DPR A;  3QX1 A;  4AUQ C;  2M17 A;  4A3O A;  4WWP A;  3C0R B;  4BKG A;  4F7Z A;  3AUL A;  3NZU A;  4NNJ B;  1OQY A;  4GMV A;  2DYO A;  3A9K A;  4GXB A;  1LQB A;  2BPS A;  1XQQ A;  1H4R A;  4X57 B;  4RM8 A;  1SIF A;  4WJO A;  2N7D A;  4HDO A;  3TMP B;  4NAW B;  2HJ8 A;  4HLE A;  1LXD A;  2KLG A;  4NQK E;  2GBN A;  2KOX A;  2VRR B;  1UD7 A;  2YVC A;  4NJ6 A;  1WF9 A;  3DPD A;  2V3S A;  3DVG Y;  3KVF B;  4HJK A;  3VUY A;  5C23 A;  2DYB A;  3L13 A;  4MGZ E;  2RPQ A;  5JHB A;  4ZRJ A;  3A9J A;  3X23 A;  2MW5 A;  4LDT B;  2KFK B;  1H8C A;  4FJV B;  3PRE A;  3N3K B;  1CMX B;  1GUA B;  2XK5 B;  2N9P C;  2KFJ A;  5JZE B;  2LWP A;  4GSW A;  4M0W B;  4IM3 A;  2JZZ A;  2KX0 A;  1ZW7 A;  2KN5 A;  2Y5B B;  2KK8 A;  2DAJ A;  2KVR A;  1PQS A;  2C9W B;  3X0W A;  4MSQ B;  3PVL A;  2CHW A;  4II2 B;  1WGR A;  3HIZ A;  5LXH A;  2NPT B;  2FCS A;  3ECI A;  3IG3 A;  3PLU A;  3TIX A;  3A1Q B;  2FIF A;  3DBR I;  4ANV A;  4GGQ A;  4KSL C;  4WQO B;  3KYD D;  4G50 A;  3TCA A;  3QWZ B;  1P9D U;  1GG3 A;  5E6N A;  3PSE B;  1WJU A;  2OJR A;  2LRU A;  4JL9 A;  1NDD A;  2KD0 A;  2I1K A;  4KDI C;  3TL5 A;  4EZK A;  1G6J A;  5GMV A;  5L95 C;  4KZ0 A;  3WAN A;  1WY8 A;  2JRH A;  2HD5 B;  3NS8 A;  1YX5 B;  4FA6 A;  2FAZ A;  3APC A;  1WZ0 A;  2D10 A;  3HK0 A;  2PE6 B;  4HDQ A;  2ZNV B;  3QAQ A;  3K9P B;  4CO7 A;  4MJS A;  5JH5 C;  4ANX A;  2KQS A;  4PS8 A;  5DPS A;  2IY0 B;  2J7Q B;  2N1W A;  3ONS A;  4W9C A;  3RD2 A;  1A5R A;  2WYQ A;  1WXV A;  2AL6 A;  2FCN A;  2PE9 A;  2NVU I;  4TUU A;  3R7Q A;  3M95 A;  3UIP B;  5KHQ A;  3V6C B;  4BOZ B;  4KIK A;  4DHJ B;  2L00 B; 
#chains in the Genus database with same CATH topology
 2M8S A;  3URY A;  4JWU C;  4K1R B;  4CHK A;  4ZHO A;  4JWS C;  2MHJ A;  2WXF A;  3VXW A;  3ML8 A;  2K22 A;  2QIL A;  3N1X C;  1S3S G;  1N63 A;  2KNB A;  2D07 B;  3NVZ A;  1QOG A;  3RNC C;  2BT6 A;  5EE9 A;  3PT2 B;  1GB4 A;  2KFK A;  2JY6 A;  2VH2 A;  2JQR B;  2CKH B;  2MH7 A;  3H7S A;  2WXL A;  2XK5 A;  1C4A A;  4C4V A;  3DVN V;  3ZDT A;  4URK A;  4HPL B;  2CS4 A;  3V3X A;  1T0R C;  3NVY A;  2KXJ A;  3I3T B;  4B0M A;  2J42 A;  2BS2 B;  2KHW B;  5J18 A;  2QIE B;  2ZNV C;  4P1C C;  1Q5W B;  2GB1 A;  3P63 A;  2ZCB A;  2LVO A;  5JHA A;  5EE0 A;  1ZXH A;  4RM9 A;  4B6W A;  4MH8 A;  1IGD A;  3DBL I;  2BB6 A;  1L4Z B;  1EU3 A;  4BOS C;  2RSU A;  3BK2 A;  1FIQ A;  5AZF A;  4ASW C;  1DGJ A;  2KTR B;  3NY5 A;  2PLP A;  3L54 A;  3DDC B;  3SU8 X;  4LDT D;  4RGT A;  4IKG A;  1I4X A;  1PGX A;  4G11 A;  4TSS A;  4AP4 C;  1QZE A;  2CJN A;  4A20 A;  1C4C A;  2NTS A;  3Q8F A;  2ZW0 A;  4XX5 A;  4IOI E;  3R2I A;  2IJ0 A;  4HKQ A;  3VRA B;  2L3Z A;  2I2Y A;  1XEE A;  1EF5 A;  4DQO C;  3FKY A;  2V3N A;  1CK1 A;  1V49 A;  3KH0 A;  4A6Q A;  4XYC A;  2WDV B;  3DHI C;  2OHF A;  3PLV A;  2LHD A;  2BW2 A;  1DYQ A;  5DPT A;  4F8C B;  1K51 A;  4BBN C;  4BKS A;  2W82 A;  1E7U A;  2L8J A;  3HRD D;  1QT9 A;  1VZ6 A;  2K0P A;  2M19 A;  2YEP F;  3MC9 A;  2EKI A;  4LK0 M;  3AU4 A;  4Q2J A;  1FM0 D;  2D3A A;  1VD2 A;  1I4Q A;  1QOB A;  5D3D A;  2GRI A;  2H88 B;  5HKH A;  2M56 B;  4FLH A;  4C56 C;  4PS3 A;  2ZPN A;  4O1N A;  4MT5 A;  1SIJ A;  4ITK A;  1VLB A;  2WXR A;  4DBG A;  4EOY A;  2MP2 A;  2TSS A;  2K39 A;  4PK1 A;  4MM3 A;  1V1P B;  4WH4 A;  2K25 A;  3DHH C;  2LGS A;  3BVM A;  5FR6 A;  3AB5 A;  1WX9 A;  2NS5 A;  3PZ7 A;  2KQ7 A;  1ET6 A;  1E8W A;  2MQJ A;  4W9E A;  3UQA A;  1N61 A;  3RNE C;  4LLG M;  3L16 A;  5BYS A;  1WGK A;  5CHF A;  2D3G A;  3JSV B;  2A4Z A;  2K3U A;  2IZV B;  2MEK A;  3PRP B;  1CQV A;  3HHM A;  1L7Y A;  4S17 A;  2JT4 B;  3NOB A;  2NBW B;  5CTR C;  3IFW B;  3NVW A;  3MHS D;  4ZRP A;  4DWF A;  5BMH A;  2N4F A;  2HJ1 A;  2LVP A;  1TY0 A;  1FRR A;  3ZO5 B;  2AWT A;  4WUR A;  1K53 A;  5MPO A;  3TEW A;  3WAP A;  1M4V A;  1WM3 A;  2O6V A;  3MC8 A;  2OOB B;  1MJD A;  3DCG A;  3V61 A;  5FR3 A;  1A70 A;  1PYW D;  2DNF A;  3T3O A;  3WAM A;  4FJY A;  4AWJ A;  1VJK A;  1F52 A;  5HI1 A;  3KUC B;  1U4A A;  1TKE A;  3GOE A;  4MAC A;  1NYQ A;  5BYQ A;  3EFC A;  3QC8 B;  4YL8 A;  2BWF A;  2KDE B;  3H7P A;  5E6P A;  3RCZ A;  3A9J B;  3AE1 B;  2ZEQ A;  1NBF C;  3MJ5 A;  4YTN B;  4YTP B;  3L17 A;  4XZ4 A;  2AEH A;  5J2R A;  2BKR B;  2D5G A;  3SD5 A;  2LVQ A;  3QK0 A;  3N9Y C;  3I5J C;  4RCO A;  1E9M A;  1TIF A;  3PZ8 A;  3DOW A;  2L52 A;  2MX2 A;  2XEW A;  3ZTC A;  1C9F A;  1OEY J;  1ACC A;  3NHE B;  2KWU B;  3PV1 A;  4W9F A;  4MDK E;  1SBB B;  4CYE A;  1JRP A;  4NQL B;  1ZP0 B;  2GMI C;  2KC2 A;  2LD9 A;  1ZOY B;  1HTQ A;  3RYT A;  1SF0 A;  1TS2 A;  3RZF A;  4OVU A;  1K50 A;  1XO3 A;  2N9X A;  1B9R A;  1V2Y A;  4RNA A;  2JVC A;  1SE4 A;  1UEL A;  1UZX B;  2ZCC A;  3L4P A;  3WA0 A;  5DPR A;  2M17 A;  4A3O A;  3W5U B;  4WWP A;  5C2T B;  4F7Z A;  1ZE3 D;  4NNJ B;  3Q8A A;  3A9K A;  2BPS A;  4USA A;  4WJO A;  1SIF A;  4KKI A;  2DWQ A;  1L0V B;  2HJ8 A;  4ACF A;  4UDU C;  2KLG A;  3IXS A;  2KOX A;  4P6V F;  4NJ6 A;  3DVG Y;  3KVF B;  2RDB C;  5C23 A;  1L0X B;  2DYB A;  1YJJ A;  2JYE A;  3L13 A;  4HPP A;  1EWC A;  4ZRJ A;  2WXH A;  4FJV B;  1CMX B;  4RGN A;  3TSS A;  2KK8 A;  2DAJ A;  2KVR A;  2RDG A;  1PQS A;  2C9W B;  3RN9 C;  3HUI A;  1HEZ E;  1WGR A;  3DWG C;  3ECI A;  3DBR I;  3MFG A;  4WQO B;  4G50 A;  3BWU D;  1P9D U;  3PSE B;  3GS2 A;  2VH1 A;  5L95 C;  2HD5 B;  3NS8 A;  1E7P B;  2FAZ A;  1AW7 A;  3APC A;  1WZ0 A;  4HDQ A;  3B2F A;  1GPX A;  4HEA 1;  3K9P B;  4CO7 A;  4MJS A;  2KT7 A;  1RYJ A;  5JH5 C;  3DBH B;  3AEF B;  2IY0 B;  4GLS C;  2WGS A;  2AL6 A;  1ZUD 2;  2JZP A;  3R2T A;  4BOZ B;  3KQ4 A;  4DHJ B;  2E6X A;  2LJI A;  3IVF A;  2NBU A;  3Q8E A;  3ETR A;  2NBV B;  3Q3N C;  1NEK B;  3H1U A;  3EC8 A;  4IM2 A;  3J9C A;  2QMT A;  3LDZ E;  3W9C B;  3RZW C;  1WYG A;  4NAW A;  3SDL C;  1FCL A;  3R66 C;  1GC6 A;  3AEE B;  2AL3 A;  5D2M B;  3FIL A;  2L32 A;  2ASQ A;  1WR1 A;  4ANU A;  1PFD A;  1EWY C;  2KJR A;  1UUP A;  2G4S A;  3IAS 1;  2KJ6 A;  4WJP A;  2KZR A;  2LHE A;  4W9L A;  4JLC A;  1E6E B;  1WJ4 A;  5BMI A;  2KMC A;  3VFK A;  1SE3 A;  1EUV B;  1ZPS A;  2MJD A;  3AH7 A;  2WX1 A;  1KLG D;  2J4X A;  2IGG A;  1EF1 A;  1KH0 A;  2L0F A;  4MEL A;  4MGI E;  2Z0D B;  1MG8 A;  2ZJD A;  5L83 A;  2QHO A;  2KDF B;  1F9J A;  4WJN A;  4IUM B;  1PUT A;  2MBB B;  2BYE A;  1FNV A;  1RLF A;  2LZ6 A;  2JRI B;  4US8 A;  1WX8 A;  2KYW A;  3VUW A;  3ZJT A;  3VVW B;  4K81 A;  3A33 B;  4FUL A;  4BZA A;  1DOI A;  2LUE A;  4J6I A;  2L7R A;  4E3C A;  2MRP A;  1GAQ B;  2M0A A;  1Q0W B;  2DZK A;  2IO2 B;  4W9K A;  4HJG E;  2K9X A;  2Q5W D;  2BWE S;  2AQ2 B;  4ZRQ A;  1I7H A;  1YMH E;  3D32 A;  2WWZ A;  4J3O D;  1TS5 A;  2V9H A;  1JRO A;  2KTF A;  3SHQ A;  1R4M I;  5CX3 A;  3RNA C;  3AI5 A;  5J17 A;  1J0G A;  2JPH A;  3AE5 B;  3U7D A;  2K8B A;  5AUK A;  5G55 A;  3Q14 C;  3AE4 B;  4W9I A;  3W2D A;  2INC C;  3JVZ X;  1SXT A;  2FNJ B;  1F2R I;  2UWQ A;  4OZB A;  2DHZ A;  3NVV A;  4EZL A;  1C79 A;  2JYT A;  4MH0 E;  3M3J A;  4NAM A;  2BB5 A;  2IND C;  4LNK A;  3UF8 A;  2RDH A;  1F2R C;  3ZUN A;  3P42 A;  2PEA A;  4NJ7 A;  2PW9 A;  3DWM A;  3KW5 B;  1WFY A;  1RRB A;  1L5P A;  2L05 A;  4N6E B;  3Q3J A;  4HVB A;  1MHH E;  4IWO A;  2IDY A;  3A4R A;  4LNN A;  4IDI A;  4MEM A;  3H8H A;  3DQV A;  3N20 C;  1L6U A;  5EE3 A;  2JUO A;  2IO0 B;  3O65 B;  2H89 B;  4S0R A;  4KSK C;  1SJE D;  1DOY A;  3N32 A;  1XLQ A;  3M63 B;  3APF A;  5BO4 B;  2ZVN A;  4GN1 A;  2JSV X;  2XN9 C;  1UGM A;  1N60 A;  2D11 A;  2R61 A;  4AOF A;  2QDF A;  3PRM B;  4BKS D;  2RD0 A;  1C3T A;  5C1Z A;  2L0T A;  4K3B A;  1TT5 B;  1KJT A;  1WMH B;  2A5U A;  4BBN F;  2GBM A;  3ZJU A;  2FCM A;  5DPW A;  4KIK B;  2AQ3 B;  3UGB B;  2UYZ B;  2MBQ A;  4JE3 B;  4RGO S;  2K6Q A;  2K1F A;  1WRD B;  3ENE A;  3NJT A;  2WXN A;  4REZ A;  2J0K A;  3W1S A;  2WDQ B;  3GE3 C;  3U30 A;  2N7J A;  1KM7 A;  1I35 A;  4PS7 A;  1OGW A;  1D3Z A;  4JPS A;  3E56 A;  4P16 A;  3WAL A;  2IO1 B;  2K6D B;  2IGD A;  4WWN A;  4ZOH C;  1C77 A;  1FNW A;  1QF6 A;  2WX0 A;  2XBB C;  4DDI D;  5LLI A;  1JWB D;  4ZRI A;  1D4B A;  1IBX B;  4CQN A;  2Z0E B;  2JXX A;  2VZK B;  1MPE A;  1V97 A;  4KX6 B;  4JX1 C;  1T3Q A;  1KTK A;  1IUE A;  3V05 A;  2WXO A;  3B9J A;  3PGE A;  3OLM D;  4M00 A;  2MCN B;  2B76 B;  4TMA B;  2MBE A;  4XDD A;  1J7C A;  4K7U A;  3WIM A;  1L0Y B;  3HM3 A;  3OJ4 B;  1TTN A;  2CHX A;  3VR9 B;  3ZXV A;  1FNU A;  1JW9 D;  1MFW A;  2KQ4 X;  2PTL A;  3TUO A;  4RF1 A;  4BFR A;  1EM7 A;  2G1E A;  1IPG A;  1TBE A;  2WU2 B;  2ZZP B;  4YSZ B;  3UQB A;  1XCQ L;  2INN E;  1FFU A;  1WGH A;  4K3C A;  2C7M B;  2PVG C;  2LGI A;  2C5L C;  3CSF A;  1SEB D;  1V80 A;  3DBS A;  2GOW A;  1I42 A;  4RH6 A;  2JZ3 B;  4R3D A;  3IBE A;  2O6V D;  2BKF A;  2OED A;  2MBO A;  2NR2 A;  2YLM A;  1FEH A;  1PDX A;  3MJW A;  4P7I A;  3AE6 B;  5H92 C;  1HTO A;  2BVC A;  1P1A A;  1LM8 B;  5GXG B;  1QLB B;  3L0W B;  3P1M A;  1V8C A;  1S1Q B;  1CZP A;  1AWD A;  3AE3 B;  4WIP A;  2DAF A;  3B0A A;  3P4P B;  1P7E A;  4IWQ A;  3ALB A;  2PKO A;  3PZD A;  1TKY A;  1XT9 B;  4EKU A;  3ZTD A;  4DK5 A;  4FXC A;  3DBH I;  3L10 B;  3JW0 X;  4DHZ E;  1ZXI A;  2N9L A;  4EUT A;  1RFA A;  3WCQ A;  4AUQ C;  2KN4 A;  3RNG C;  4BKG A;  4OZC A;  2DYO A;  3C8Y A;  4GXB A;  1V1O A;  1XQQ A;  1H4R A;  4RM8 A;  2XNA C;  2N7D A;  4HDO A;  1LXD A;  5C3J B;  1WF9 A;  4HJK A;  2V3S A;  4L2Y A;  4HRS A;  2QCZ A;  3A9J A;  3X23 A;  4LDT B;  3ZXR A;  3PRE A;  1GUA B;  5JZE B;  4GSW A;  4M0W B;  1N5X A;  4IM3 A;  2Y5B B;  2KX0 A;  2KN5 A;  4C80 A;  2WXK A;  4II2 B;  1JWM D;  5LXH A;  2NPT B;  4MM3 B;  1ZDV A;  1FO4 A;  3A1Q B;  4GGQ A;  4KSL C;  3E9S A;  4JL9 A;  1WJU A;  2KD0 A;  2I1K A;  2HTM E;  4KZ0 A;  2LMC A;  1C78 A;  2OJW A;  4YTM B;  1SB3 C;  3HK0 A;  2PE6 B;  2ZNV B;  3BZD B;  3KLS X;  4ANX A;  3EGR A;  2KQS A;  3OWE B;  4H2A A;  2KDM A;  3MC0 B;  1J7B A;  2FCN A;  2NVU I;  3UIP B;  3LB8 C;  2L00 B;  4EZK A;  1YNT E;  1WX7 A;  2IY1 B;  2JX5 A;  3ZNI D;  4I6P A;  1M94 A;  1FRD A;  5E6O A;  4W9H A;  3RI7 C;  3DBL B;  1E5W A;  3EEC A;  1GJZ A;  3AE9 B;  2MA9 B;  3QQ8 B;  3P4R B;  4ARI A;  4MGK E;  1TZ1 A;  4NJC A;  4IW0 A;  3PTF C;  5G2N A;  2V4I B;  2WXQ A;  2MJ3 A;  5CHW A;  1GC7 A;  3VDZ A;  1E8X A;  3AE8 B;  3Q3F A;  1Y56 A;  3DVG X;  2LGX A;  5KHO A;  4I6L B;  3AEG B;  1UF0 A;  2ZPY A;  4K7W A;  2FBW B;  3BK1 A;  1R4N I;  4ZDV A;  4DHZ B;  4HKZ E;  4AJY B;  5D7G A;  1NEN B;  5IAA C;  2KWV B;  4XC2 A;  3PHX B;  5HHD G;  4W9G A;  4HXD A;  1E8Y A;  4FBJ B;  4EFO A;  3CWI A;  4LJO B;  1TJE A;  2BGF A;  2SEB D;  3AV8 A;  1AN8 A;  3IHP C;  2HE7 A;  2KJH B;  1QIL A;  1WXS A;  2WU5 B;  3Q8C A;  2HTH A;  3I9V 1;  1JWA D;  3IT4 B;  1ESF A;  1PGB A;  5IN7 A;  3V6E B;  2JWZ A;  3VH3 B;  5LXI B;  1B1Z A;  2O2V A;  4ZHP A;  2EEL A;  5FK9 C;  5IOI A;  3UI3 A;  1MG4 A;  3U52 E;  2EKE C;  1XLN A;  1WJ6 A;  4GDK B;  4D2K A;  3AEC B;  4HWI B;  4DXF A;  2RGF A;  2C7N B;  1RWS A;  4KGS A;  2KWC A;  3EA6 A;  4FHJ A;  3SFE B;  3KUZ A;  4II3 B;  3ZNH B;  3LXF A;  1ZKH A;  4AJW A;  3PPA A;  1WIA A;  1KLV A;  2KVZ A;  4N58 A;  1DOX A;  3TEY A;  3UIN B;  3KYC D;  5IO9 A;  3MP9 A;  1AAR A;  3R7R A;  5IA7 A;  2LGY A;  2HDE A;  3AEA B;  4L1B A;  2X38 A;  2IYD B;  2QEJ C;  2DZI A;  4LNF A;  3BIN A;  4ZYS A;  2Z59 B;  4GDL B;  3PO0 A;  1F77 A;  2AX5 A;  3DHG C;  4I6N B;  1SE9 A;  2WDR B;  1OQQ A;  3MHZ A;  2EMS A;  3U2S C;  3ZRF A;  4GB9 A;  4ICV A;  3ZW3 A;  1P7F A;  2KMM A;  2G45 B;  4IM0 A;  1HQR D;  3CIR B;  3GB1 A;  1WSP A;  3VHT C;  2J0J A;  2Z8L A;  1OTR B;  4IG7 B;  5AEK B;  4RF0 A;  4G3X B;  4TQ1 A;  4XWW A;  1I4R A;  2KDB A;  2FE8 A;  1NI2 A;  1YJI A;  4LJP B;  1J7A A;  1T0S C;  3I63 C;  1D6E C;  1LFD A;  2EMT A;  4DXG A;  5EE1 A;  3ZNZ B;  5TSS A;  1ZDX A;  4NY0 A;  3W1S C;  1C4P A;  1NYR A;  1WXA A;  2C60 A;  2W55 A;  3HVD A;  1Q1O A;  2WXG A;  3QIJ A;  5AZH A;  4WQM A;  5HFY A;  4HK2 A;  2LEK A;  1Y8R C;  2FCQ A;  2LFI A;  1WZ3 A;  2MBH A;  3EHV A;  4LTU A;  2FID A;  1FXI A;  1I4G A;  4WAA A;  1J8C A;  3T3N A;  4OVV A;  3AU5 A;  1WGY A;  4WWO A;  3AXC A;  3FAH A;  1WGD A;  4K7S A;  3LJ3 A;  2KDI A;  3SFD B;  4C7Z A;  4LCD E;  3B2G A;  4A8X C;  3GE8 C;  2GLS A;  3VUX A;  2LXA A;  1RM6 C;  3N1Z C;  2WLB A;  5D3I B;  1Z2M A;  5D6J B;  4TV3 A;  2KMA A;  4WAF A;  1V6E A;  1V81 A;  1QKZ A;  4ARC A;  2N7E A;  1QOA A;  4KVG B;  1TGZ B;  3GP7 A;  1ISN A;  2J0M A;  2PVO D;  4GU2 A;  1F1H A;  2M4N A;  2JXT A;  4KV2 A;  4P1B C;  4IWP A;  1IYF A;  4RMA A;  2DYM A;  4HRO A;  1JWU D;  2LXC A;  4E71 A;  2IO3 B;  1WE7 A;  2GBK A;  1WMH A;  4N9F 4;  3U4E G;  1QOF A;  1GNU A;  2RMM A;  5TR5 A;  2JWU A;  1HA5 A;  2BQQ A;  2BYV E;  2KTR A;  2PPH A;  2PJH A;  2X8X X;  4KKJ A;  4XGA B;  3RT3 B;  3BY4 B;  3L08 A;  1UNS A;  3AEB B;  2LGD A;  1ZGU B;  1VZ8 A;  1FD6 A;  2BF8 B;  3ZKJ C;  1WR6 E;  2L76 A;  3AN1 A;  2NMQ A;  4F1S A;  1WJN A;  3VTV A;  1L2N A;  4WJQ A;  1VR9 A;  3N30 A;  1X1M A;  3W1Y A;  2MLB A;  3W5V B;  1IBX A;  2WXM A;  2ONQ A;  4FN2 A;  2V0G A;  2L83 A;  3DBR B;  3QHT A;  1FCC C;  4ANW A;  4BAX A;  3GZN B;  4LNO A;  2V4L A;  3QX1 A;  3C0R B;  1YQ3 B;  1VRA B;  5E6J A;  2D3B A;  5BMG A;  2W3S A;  1F0Z A;  3RMK C;  1Q10 A;  4HLE A;  2J53 A;  1T0Q C;  1XXG A;  2GBN A;  1D5Z C;  1UD7 A;  2YVC A;  3DPD A;  4YT0 B;  1SE2 A;  3Q2A C;  2RPQ A;  5JHB A;  2KFK B;  4EE2 A;  3N1Y C;  3N3K B;  3VR8 B;  2XK5 B;  2N9P C;  2KFJ A;  2LWP A;  4C4V B;  1WXQ A;  1ZW7 A;  3PVL A;  2CHW A;  3TEX A;  3C19 A;  2ACZ B;  2FCS A;  3IG3 A;  2FIF A;  4ANV A;  4XWT A;  3KYD D;  3TCA A;  5E6N A;  2IGH A;  2OJR A;  1LGR A;  3BYT B;  1WY8 A;  1YX5 B;  1V1P A;  5FKA C;  1TKG A;  4PS8 A;  5DPS A;  2N1W A;  2J52 A;  3ONS A;  3RD2 A;  2V3P A;  3R7Q A;  3M95 A;  5KHQ A;  4YSX B;  3OAW A;  1WH3 A;  4OHJ A;  2KKC A;  3B08 A;  1YQ4 B;  3Q6B A;  1L6V A;  2LRW A;  2MJE A;  3JSV A;  1YQB A;  4MSM B;  3NZS A;  2UU7 A;  2DEN B;  4MGY E;  4C7Y A;  1JAL A;  5IKC M;  2WXP A;  1C1Y B;  5AZG A;  1ROE A;  4B95 A;  1V86 A;  4GOC A;  2KX3 A;  2CJO A;  2QJL A;  1FMA D;  1P3Q U;  1WM2 A;  1K8R B;  2IPK D;  4KZC A;  1V5T A;  1IP9 A;  3RNB C;  2RR9 A;  3ZDM C;  2BS4 B;  2WP9 B;  3TJP A;  3TBL D;  4HCP B;  4TQ0 A;  3O13 A;  1YIW A;  4ZRK A;  1NI3 A;  4M0W A;  1N62 A;  1XLO A;  2BBC A;  1V5O A;  2QC8 A;  4RGM A;  3PHW B;  1E10 A;  3BVZ A;  4W9D A;  5H8Y E;  4HCN B;  3A4S C;  1E7V A;  3DVN U;  1UGJ A;  3WAO A;  2NPT A;  3VQI A;  3A1Q A;  4HPM B;  1JRU A;  3Q69 A;  3ZRC A;  4US9 A;  4OZA A;  4A55 A;  1R4M B;  3R3M A;  1WI0 A;  2KC1 A;  3P2B A;  1BXT A;  3ZIM A;  3EUB 2;  3HM6 X;  1V9J A;  1E90 A;  2R2Q A;  1OEY A;  2E3T A;  3NRZ A;  1UH6 A;  3PRZ A;  4DXA B;  2PIA A;  3HVZ A;  4TKN A;  4B9K A;  1XD3 B;  1P98 A;  4PYU A;  1YX6 B;  4LNI A;  5JXV A;  1E8Z A;  4ZYN A;  1JML A;  2DBY A;  1YN4 A;  2MP2 B;  2MWS B;  1YJ1 A;  1BT0 A;  4C00 A;  1UBQ A;  2V1Y A;  4KGT A;  1JQ4 A;  2DLB A;  1MVK A;  3QCA A;  3JYU A;  2G4D B;  2LJ5 A;  3S2A A;  3ZNG C;  5CHV C;  3NZ3 A;  4AQ7 A;  4DDG D;  1BUI C;  2LAS A;  1WE6 A;  4G0N B;  3ZYY X;  2KAN A;  1VCB A;  2W3R A;  4QAY A;  2KLC A;  1TS4 A;  2CU1 A;  1NVI D;  2CU3 A;  2DZJ A;  2JU6 X;  2WNM A;  1TZO A;  1QQR A;  4YXD B;  3B1L X;  3QJZ A;  4DHJ D;  3ZQ4 A;  3VH4 B;  3R8B A;  4PYZ A;  3ABV B;  4OW0 A;  1IGC A;  3KWL A;  4W9J A;  1YD8 U;  1STE A;  2WDT B;  3FC4 A;  2FUH B;  4ICU A;  1FPY A;  2AQ1 B;  1VZ7 A;  1XF5 L;  4IC7 B;  5DCN A;  4N59 A;  3I57 A;  3NG0 A;  1OFF A;  2Y3A A;  1RAX A;  2WQY B;  4NPN A;  2O6V B;  2CR5 A;  4M8N A;  2AYO B;  2M1M A;  1TS3 A;  3RUL A;  2I38 A;  3OJ3 A;  1GB1 A;  3KWV A;  2L1A A;  1TY2 A;  1XLP A;  1PGA A;  1HZ6 A;  4B0E A;  2N9E B;  1ET9 A;  2G3Q B;  1J19 A;  3NUH B;  2BYT A;  3V62 A;  5EDS A;  1BML C;  2KO3 A;  4BKT A;  2M0X A;  2N0S B;  1EO6 A;  3M62 B;  3CST A;  2N1V A;  3H7P B;  3VAW A;  1GOZ A;  3AE7 B;  3AMZ A;  5I4D A;  4GDK A;  1N6Z A;  2D2Q A;  3VTU A;  2CHZ A;  2NCN A;  3ZJV A;  3TEZ A;  3QAR A;  2REX A;  2LI5 A;  2I1J A;  1OQR A;  4JGH B;  2GBJ A;  2KAC A;  1WYW B;  3OG5 A;  4BVU C;  1VDV A;  3UIO B;  2RPV A;  1R7S A;  2SAK A;  2Y5C A;  2MSE D;  4WWM A;  4OVZ A;  2DZM A;  4FHK A;  1T0Y A;  2JF5 A;  3K9O B;  1C76 A;  1P0R A;  2ICI A;  5G5H A;  2N9K A;  1YN5 A;  1MHX A;  2K8H A;  2GBR A;  1SSN A;  1TYG B;  2K8C A;  4GDL A;  1D5X C;  2LUM A;  4M8M A;  3AED B;  5AUI A;  1HZ5 A;  5IP4 D;  1JWS D;  1UBI A;  4EEW A;  1LO5 D;  1I4P A;  3KUD B;  3APD A;  3ML9 A;  4FJZ A;  2WXJ A;  2IBI B;  2WS3 B;  4A3P A;  3AM9 A;  5D94 A;  3SR6 A;  4FAD A;  4AS1 A;  3ZGZ A;  1Z5S B;  2KAJ A;  4YSY B;  3SEB A;  1XCT L;  1SGH A;  3GZN I;  3A9K B;  2W9N A;  3H6N A;  3T9L A;  3Q3M C;  3BYY B;  3T8M A;  4KDL B;  2BYF A;  3Q3O C;  2R2O A;  1D5M C;  1WXM A;  3H9D A;  3ZLZ A;  3PS6 A;  3CF6 E;  4YWG G;  3IT6 B;  1UWM A;  2ON8 A;  1T5X D;  1HXY D;  1HE8 A;  2WXI A;  1L4D B;  2PMV A;  3VRB B;  2ZVO A;  3QA8 A;  5BYR A;  3BVG A;  3RUI B;  1KOT A;  4RFB A;  3VTW A;  5G5G A;  4GIV A;  1WGG A;  1WWT A;  2GI9 A;  4XE0 A;  1CJE A;  2O2V B;  4A90 A;  1I4H A;  3CMM B;  1FFV A;  1WRI A;  2YEP B;  4M01 A;  5HG2 A;  2QSD A;  4JIO U;  2C7H A;  3U8Z A;  3P4S B;  3RNF C;  1K52 A;  4JQW C;  3P4Q B;  4EZJ A;  4E74 A;  1YOV B;  2B3A A;  3EFU A;  3BII D;  2G9H D;  2DX5 B;  4MJS B;  1FXT B;  3ZVV A;  3MTN B;  1JCK B;  1SJH D;  3V60 A;  1RFK A;  3Q8B A;  3AUL A;  1KRH A;  3NZU A;  4L23 A;  1OQY A;  4GMV A;  5LNK 1;  1LQB A;  4X57 B;  1E0Z A;  1EU4 A;  3TMP B;  3IAM 1;  4NAW B;  1N5W A;  4NQK E;  2VRR B;  5T8I A;  4M02 A;  1FXA A;  3VUY A;  2NTT A;  3AE2 B;  1ENF A;  3FIL B;  4MGZ E;  1KF6 B;  1KLU D;  3LYY A;  2MW5 A;  3RFZ B;  4KGR A;  4A9A A;  1H8C A;  2ZW1 A;  2Y5P A;  2JZZ A;  2D3C A;  1T6B X;  3X0W A;  4MSQ B;  2VZK D;  1UWX A;  4NZL B;  3HIZ A;  3PLU A;  3TIX A;  2W54 A;  3U7Z A;  3RPF C;  3QWZ B;  1MI0 A;  1GG3 A;  2INP E;  2LRU A;  1NDD A;  3NS1 A;  4KDI C;  3TL5 A;  1G6J A;  5GMV A;  3WAN A;  2FUG 1;  2JRH A;  4FA6 A;  2KWD A;  4XDC A;  1KFY B;  1YN3 A;  2D10 A;  4PT5 A;  2BTE A;  3QAQ A;  2BS3 B;  2K5P A;  2J7Q B;  1AYF A;  4W9C A;  1A5R A;  2WYQ A;  1WXV A;  2PE9 A;  2WHI A;  4TUU A;  3V6C B;  1R4N B;  4KIK A; 
#chains in the Genus database with same CATH homology
 1WH3 A;  1WX7 A;  2M8S A;  2IY1 B;  2KKC A;  3B08 A;  4K1R B;  3IVF A;  2NBU A;  3ZNI D;  4I6P A;  4CHK A;  2LRW A;  2NBV B;  1M94 A;  5E6O A;  3H1U A;  3EC8 A;  3JSV A;  4IM2 A;  4W9H A;  1YQB A;  3LDZ E;  4MSM B;  3NZS A;  4MGY E;  2DEN B;  3RZW C;  1E5W A;  3VXW A;  4NAW A;  3EEC A;  1GJZ A;  3ML8 A;  3SDL C;  1C1Y B;  5AZG A;  2MA9 B;  3R66 C;  1GC6 A;  4B95 A;  1S3S G;  3QQ8 B;  1V86 A;  2AL3 A;  4GOC A;  2KX3 A;  5D2M B;  2KNB A;  2D07 B;  2ASQ A;  1WR1 A;  4MGK E;  1TZ1 A;  1P3Q U;  4IW0 A;  1WM2 A;  3PTF C;  4ANU A;  5G2N A;  1K8R B;  3PT2 B;  4KZC A;  1V5T A;  2KJR A;  1IP9 A;  2G4S A;  2RR9 A;  3ZDM C;  2KFK A;  2JY6 A;  2KJ6 A;  3TJP A;  3TBL D;  5CHW A;  4HCP B;  4WJP A;  2KZR A;  1YIW A;  4ZRK A;  4TQ0 A;  2CKH B;  3H7S A;  4W9L A;  2XK5 A;  1GC7 A;  4JLC A;  1E8X A;  3VDZ A;  1WJ4 A;  3Q3F A;  1V5O A;  3DVG X;  3DVN V;  3ZDT A;  3PHW B;  4URK A;  2KMC A;  4W9D A;  2LGX A;  3VFK A;  4HCN B;  4HPL B;  2CS4 A;  5KHO A;  3A4S C;  1E7V A;  1EUV B;  2KXJ A;  3DVN U;  3I3T B;  4I6L B;  2WX1 A;  3WAO A;  2NPT A;  2ZPY A;  3VQI A;  1EF1 A;  2KHW B;  3A1Q A;  4K7W A;  5J18 A;  1R4N I;  4HPM B;  2ZNV C;  4ZDV A;  4DHZ B;  1JRU A;  1Q5W B;  4AJY B;  3ZRC A;  2ZCB A;  5D7G A;  2L0F A;  2KWV B;  4XC2 A;  5IAA C;  3R3M A;  4MEL A;  2LVO A;  3PHX B;  1WI0 A;  4MGI E;  2Z0D B;  5JHA A;  2KC1 A;  4W9G A;  3P2B A;  3W1S C;  4HXD A;  1MG8 A;  1E8Y A;  4RM9 A;  4FBJ B;  4B6W A;  2ZJD A;  3ZIM A;  4EFO A;  5L83 A;  2QHO A;  2KDF B;  1F9J A;  4WJN A;  4IUM B;  4LJO B;  3DBL I;  2MBB B;  2BYE A;  2BGF A;  3HM6 X;  4BOS C;  1E90 A;  1V9J A;  2RSU A;  1RLF A;  2R2Q A;  5AZF A;  4ASW C;  1OEY A;  3IHP C;  1UH6 A;  2LZ6 A;  2KTR B;  3NY5 A;  3PRZ A;  2JRI B;  4DXA B;  4TKN A;  1WX8 A;  2HE7 A;  4B9K A;  3L54 A;  1XD3 B;  2KJH B;  3DDC B;  1P98 A;  3VUW A;  3SU8 X;  4LDT D;  1WXS A;  4PYU A;  1YX6 B;  2HTH A;  3VVW B;  4K81 A;  3A33 B;  4FUL A;  1E8Z A;  4ZYN A;  3V6E B;  2JWZ A;  2LUE A;  4J6I A;  3VH3 B;  2L7R A;  4E3C A;  5LXI B;  2MP2 B;  2MRP A;  2O2V A;  2MWS B;  1YJ1 A;  4G11 A;  1BT0 A;  1Q0W B;  1UBQ A;  2DZK A;  2IO2 B;  2V1Y A;  4W9K A;  4AP4 C;  1QZE A;  4A20 A;  2BWE S;  3QCA A;  3JYU A;  2G4D B;  2EKE C;  4XX5 A;  2LJ5 A;  3D32 A;  2WWZ A;  3S2A A;  3ZNG C;  5CHV C;  1WJ6 A;  2KTF A;  4GDK B;  4DDG D;  3SHQ A;  1R4M I;  4HWI B;  5CX3 A;  2LAS A;  2RGF A;  2C7N B;  3AI5 A;  5J17 A;  1J0G A;  2KWC A;  2L3Z A;  4FHJ A;  1WE6 A;  4G0N B;  2KAN A;  3KUZ A;  2JPH A;  1VCB A;  1EF5 A;  4II3 B;  3ZNH B;  1ZKH A;  4AJW A;  3PPA A;  1WIA A;  3U7D A;  2KLC A;  1KLV A;  1V49 A;  2K8B A;  5G55 A;  4W9I A;  3KH0 A;  3KYC D;  3UIN B;  3JVZ X;  2CU1 A;  1AAR A;  2FNJ B;  2DZJ A;  2UWQ A;  3R7R A;  3PLV A;  2DHZ A;  4EZL A;  5IA7 A;  2LGY A;  4MH0 E;  4F8C B;  5DPT A;  3B1L X;  3QJZ A;  4BBN C;  4DHJ D;  3M3J A;  4BKS A;  3VH4 B;  3UF8 A;  1E7U A;  2IYD B;  2DZI A;  4PYZ A;  3BIN A;  2L8J A;  4W9J A;  2Z59 B;  3ZUN A;  4GDL B;  1YD8 U;  2PEA A;  2WDT B;  2FUH B;  4NJ7 A;  4I6N B;  3KW5 B;  1WFY A;  1RRB A;  1SE9 A;  4ICU A;  2L05 A;  3AU4 A;  4IC7 B;  5DCN A;  3Q3J A;  4HVB A;  2EMS A;  4IWO A;  3A4R A;  4MEM A;  1RAX A;  4NPN A;  3ZRF A;  4GB9 A;  4ICV A;  2O6V B;  2CR5 A;  1VD2 A;  2AYO B;  3DQV A;  2M1M A;  4M8N A;  3RUL A;  2JUO A;  3OJ3 A;  5HKH A;  3ZW3 A;  2G45 B;  2IO0 B;  4FLH A;  3O65 B;  4PS3 A;  2ZPN A;  4IM0 A;  4KSK C;  2N9E B;  3N32 A;  4DBG A;  2G3Q B;  1J19 A;  3VHT C;  2J0J A;  3M63 B;  3APF A;  5BO4 B;  4EOY A;  1OTR B;  4IG7 B;  2ZVN A;  4GN1 A;  5AEK B;  2MP2 A;  4G3X B;  4TQ1 A;  2K39 A;  2KDB A;  3V62 A;  4MM3 A;  1UGM A;  1NI2 A;  2KO3 A;  5EDS A;  2D11 A;  4BKT A;  4AOF A;  2K25 A;  2M0X A;  4LJP B;  1EO6 A;  3PRM B;  3M62 B;  1LFD A;  2EMT A;  2N1V A;  3CST A;  4BKS D;  3H7P B;  3ZNZ B;  2RD0 A;  5FR6 A;  3VAW A;  1C3T A;  5C1Z A;  2L0T A;  4NY0 A;  4GDK A;  1WX9 A;  2D2Q A;  3VTU A;  1KJT A;  1WMH B;  2A5U A;  2CHZ A;  2KQ7 A;  2NS5 A;  2GBM A;  1WXA A;  2C60 A;  2NCN A;  3OAW A;  4BBN F;  2FCM A;  2MQJ A;  1E8W A;  1Q1O A;  4W9E A;  5DPW A;  3QAR A;  2REX A;  3QIJ A;  2LI5 A;  2I1J A;  4KIK B;  5AZH A;  3UQA A;  4JGH B;  2GBJ A;  1WYW B;  3UGB B;  2UYZ B;  4BVU C;  2MBQ A;  4HK2 A;  3UIO B;  1Y8R C;  2K6Q A;  3L16 A;  2FCQ A;  2K1F A;  1WZ3 A;  1WRD B;  3ENE A;  2MBH A;  5CHF A;  3W1S A;  2J0K A;  2D3G A;  2MSE D;  3JSV B;  3U30 A;  2A4Z A;  1KM7 A;  3EHV A;  1I35 A;  2FID A;  4PS7 A;  2DZM A;  1OGW A;  2IZV B;  4FHK A;  1T0Y A;  2JF5 A;  1D3Z A;  3PRP B;  3K9O B;  1P0R A;  3HHM A;  4WAA A;  1L7Y A;  3WAL A;  2IO1 B;  1J8C A;  2K8H A;  4OVV A;  2GBR A;  2K6D B;  3AU5 A;  1WGY A;  4WWN A;  2JT4 B;  2K8C A;  4WWO A;  3AXC A;  4GDL A;  1WGD A;  3NOB A;  4K7S A;  3LJ3 A;  2NBW B;  4M8M A;  5CTR C;  3IFW B;  3MHS D;  2KDI A;  4LCD E;  1UBI A;  2WX0 A;  2XBB C;  4DWF A;  4DDI D;  4EEW A;  3VUX A;  2LXA A;  5LLI A;  2N4F A;  4ZRI A;  2LVP A;  3KUD B;  3APD A;  3ML9 A;  4FJZ A;  1Z2M A;  2IBI B;  2Z0E B;  3ZO5 B;  2AWT A;  5D6J B;  2JXX A;  4TV3 A;  4A3P A;  2KMA A;  3WAP A;  5D94 A;  1WM3 A;  1V6E A;  1V81 A;  2O6V A;  4FAD A;  2OOB B;  2N7E A;  1Z5S B;  3DCG A;  3V61 A;  4KVG B;  3PGE A;  1TGZ B;  1SGH A;  3OLM D;  3WAM A;  1ISN A;  4FJY A;  2J0M A;  2MCN B;  2MBE A;  3GZN I;  4AWJ A;  3A9K B;  2W9N A;  3H6N A;  3T9L A;  3T8M A;  4KDL B;  4GU2 A;  4K7U A;  2BYF A;  2M4N A;  2R2O A;  3KUC B;  3WIM A;  1WXM A;  3H9D A;  1U4A A;  4KV2 A;  3GOE A;  3ZLZ A;  3PS6 A;  3HM3 A;  3CF6 E;  3OJ4 B;  1TTN A;  2CHX A;  3QC8 B;  4IWP A;  4YL8 A;  1HE8 A;  1IYF A;  2BWF A;  2KDE B;  4RMA A;  2DYM A;  3H7P A;  5E6P A;  2LXC A;  4E71 A;  3RCZ A;  3A9J B;  2IO3 B;  1WE7 A;  2GBK A;  1WMH A;  2ZVO A;  4N9F 4;  4BFR A;  2ZEQ A;  2ZZP B;  1IPG A;  1TBE A;  1NBF C;  1GNU A;  3QA8 A;  3UQB A;  1WGH A;  3L17 A;  2C7M B;  3RUI B;  1KOT A;  4XZ4 A;  2AEH A;  5TR5 A;  2BKR B;  3VTW A;  5J2R A;  2C5L C;  3CSF A;  1V80 A;  3DBS A;  2GOW A;  4GIV A;  1I42 A;  2BYV E;  2KTR A;  2PPH A;  3SD5 A;  2JZ3 B;  2PJH A;  1WGG A;  3RT3 B;  2LVQ A;  3BY4 B;  3IBE A;  2O6V D;  2BKF A;  2O2V B;  3QK0 A;  2MBO A;  3L08 A;  2NR2 A;  2YLM A;  3MJW A;  3DOW A;  4P7I A;  3CMM B;  2MX2 A;  2LGD A;  1ZGU B;  1P1A A;  1LM8 B;  2BF8 B;  2XEW A;  3ZKJ C;  3ZTC A;  4JIO U;  1WR6 E;  2L76 A;  2C7H A;  1OEY J;  3U8Z A;  3L0W B;  2KWU B;  3NHE B;  1S1Q B;  3PV1 A;  4W9F A;  4MDK E;  4F1S A;  1WJN A;  4JQW C;  2DAF A;  3VTV A;  4EZJ A;  4CYE A;  4E74 A;  4NQL B;  2B3A A;  3B0A A;  2GMI C;  2KC2 A;  4WJQ A;  1L2N A;  4IWQ A;  3EFU A;  3N30 A;  1X1M A;  3W1Y A;  2LD9 A;  2MLB A;  2DX5 B;  4MJS B;  3ALB A;  1FXT B;  3RYT A;  3ZVV A;  3RZF A;  4OVU A;  3MTN B;  2N9X A;  3PZD A;  4FN2 A;  1XT9 B;  4EKU A;  3ZTD A;  4DK5 A;  1V2Y A;  2JVC A;  3V60 A;  3DBH I;  3L10 B;  3QHT A;  4ANW A;  3JW0 X;  4DHZ E;  1UEL A;  1UZX B;  2ZCC A;  4EUT A;  3WA0 A;  1RFA A;  2V4L A;  5DPR A;  3QX1 A;  4AUQ C;  2M17 A;  4A3O A;  4WWP A;  3C0R B;  4BKG A;  4F7Z A;  3AUL A;  3NZU A;  4NNJ B;  1OQY A;  4GMV A;  2DYO A;  3A9K A;  4GXB A;  1LQB A;  2BPS A;  1XQQ A;  1H4R A;  4X57 B;  4RM8 A;  1SIF A;  4WJO A;  2N7D A;  4HDO A;  3TMP B;  4NAW B;  2HJ8 A;  4HLE A;  1LXD A;  2KLG A;  4NQK E;  2GBN A;  2KOX A;  2VRR B;  1UD7 A;  2YVC A;  4NJ6 A;  1WF9 A;  3DPD A;  2V3S A;  3DVG Y;  3KVF B;  4HJK A;  3VUY A;  5C23 A;  2DYB A;  3L13 A;  4MGZ E;  2RPQ A;  5JHB A;  4ZRJ A;  3A9J A;  3X23 A;  2MW5 A;  4LDT B;  2KFK B;  1H8C A;  4FJV B;  3PRE A;  3N3K B;  1CMX B;  1GUA B;  2XK5 B;  2N9P C;  2KFJ A;  5JZE B;  2LWP A;  4GSW A;  4M0W B;  4IM3 A;  2JZZ A;  2KX0 A;  1ZW7 A;  2KN5 A;  2Y5B B;  2KK8 A;  2DAJ A;  2KVR A;  1PQS A;  2C9W B;  3X0W A;  4MSQ B;  3PVL A;  2CHW A;  4II2 B;  1WGR A;  3HIZ A;  5LXH A;  2NPT B;  2FCS A;  3ECI A;  3IG3 A;  3PLU A;  3TIX A;  3A1Q B;  2FIF A;  3DBR I;  4ANV A;  4GGQ A;  4KSL C;  4WQO B;  3KYD D;  4G50 A;  3TCA A;  3QWZ B;  1P9D U;  1GG3 A;  5E6N A;  3PSE B;  1WJU A;  2OJR A;  2LRU A;  4JL9 A;  1NDD A;  2KD0 A;  2I1K A;  4KDI C;  3TL5 A;  4EZK A;  1G6J A;  5GMV A;  5L95 C;  4KZ0 A;  3WAN A;  1WY8 A;  2JRH A;  2HD5 B;  3NS8 A;  1YX5 B;  4FA6 A;  2FAZ A;  3APC A;  1WZ0 A;  2D10 A;  3HK0 A;  2PE6 B;  4HDQ A;  2ZNV B;  3QAQ A;  3K9P B;  4CO7 A;  4MJS A;  5JH5 C;  4ANX A;  2KQS A;  4PS8 A;  5DPS A;  2IY0 B;  2J7Q B;  2N1W A;  3ONS A;  4W9C A;  3RD2 A;  1A5R A;  2WYQ A;  1WXV A;  2AL6 A;  2FCN A;  2PE9 A;  2NVU I;  4TUU A;  3R7Q A;  3M95 A;  3UIP B;  5KHQ A;  3V6C B;  4BOZ B;  4KIK A;  4DHJ B;  2L00 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...