4W9EA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 4)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9eA00
1YX6B 1G6JA 2JRIB 3A4RA 4BOZB 2N7EA 2BKFA 1UZXB 4K81A 2KHWB 2KDBA 3WAOA 1V81A 1LFDA 2MBOA 5C1ZA 2FCNA 3AU5A 3PLVA 2OOBB 4MJSB 1GUAB 1WJ4A 3QIJA 4HDOA 3TIXA 2KDIA 2ZVOA 3MTNB 2C7HA 3QHTA 4HCNB 1V49A 4LDTD 2ZPYA 2KMAA 5CHFA 3V61A 4ICUA 3W1SA 4JL9A 4TV3A 3ONSA 2LD9A 2KC1A 1U4AA 2AYOB 4ZRIA 4GDLA 4MEMA 2IBIB 4GU2A 3RZFA 3CMMB 2GBRA 3C0RB 4WQOB 2KO3A 3ENEA 4BKSD 4CYEA 2AL3A 3IVFA 2KC2A 3VUYA 2KDFB 1OGWA 1ZKHA 5E6PA 4AWJA 2KZRA 2G45B 3VQIA 4FJZA 3GOEA 4RM8A 3H1UA 1WRDB 2KFKA 2L0FA 2LI5A 5G55A 4G3XB 2KN5A 3QQ8B 2DZIA 1GNUA 3TMPB 2MBHA 4BFRA 1WFYA 2KD0A 2R2OA 3HIZA 3L17A 2MP2A 4B9KA 4AOFA 1E5WA 1V9JA 2IY1B 3LJ3A 2KDEB 1OEYA 1WX9A 2JWZA 3NS8A 4NNJB 3V62A 1S1QB 1VCBA 3DBLI 2IZVB 1V2YA 2M8SA 2D2QA 5FR6A 2EKEC 3L54A 2R2QA 1WX8A 2LVOA 3A1QB 4A3PA 5G2NA 2KWUB 4BVUC 2O2VB 2MX2A 4JLCA 2BPSA 4IWOA 3BINA 2KTFA 5CHVC 3W1SC 4LDTB 2BKRB 4ANXA 5DPRA 5LXHA 1LM8B 2IO0B 2Z0DB 2DZKA 4NQKE 3VH3B 1S3SG 2Z59B 2L7RA 4KDIC 4MGZE 1WM2A 2WDTB 3ZO5B 3K9PB 2LVQA 4WWNA 2ZNVC 2JRHA 4G11A 4MM3A 3VAWA 5GMVA 4I6NB 2N1WA 4W9KA 3VDZA 1XT9B 2DHZA 4HJKA 2DX5B 2FNJB 2RR9A 1F9JA 3VTUA 4MSQB 2XEWA 3DQVA 1WGGA 1WH3A 2MQJA 4HK2A 2N7DA 4WJQA 5D6JB 5J2RA 2K25A 4GXBA 2L0TA 2WWZA 4EFOA 2NPTB 4IW0A 2NBVB 3WAPA 2BGFA 1LXDA 1WJNA 3N3KB 4W9HA 3N32A 2JT4B 3PRZA 5CHWA 3H7SA 3DCGA 4IC7B 2KQSA 1WF9A 1H4RA 3ZW3A 3HM3A 2IO3B 1WGHA 4K7UA 4LJPB 2J0JA 4K7WA 4FN2A 3DOWA 3PV1A 2KWVB 4HPMB 1EF5A 1RRBA 2WYQA 4BBNC 3AXCA 5E6NA 3EHVA 1WYWB 3APDA 2KLCA 3NOBA 3PT2B 2M4NA 3U30A 5EDSA 3OJ4B 2MA9B 2CHWA 3V60A 2Z0EB 3KVFB 2A5UA 3RYTA 2K8CA 2LGDA 2N4FA 5D94A 3RUIB 2MRPA 2FCQA 5CX3A 2RSUA 2JF5A 2KVRA 1XD3B 3PLUA 2ASQA 1ZGUB 3QARA 3VTVA 1SGHA 3A9KB 2M17A 4JGHB 4II3B 3M3JA 3QX1A 4TQ1A 3EC8A 3NZUA 1KOTA 1WMHB 2XK5A 4W9JA 3B1LX 2FAZA 1XQQA 3PHWB 4WWOA 3V6EB 1ISNA 2A4ZA 4W9FA 3KH0A 4F7ZA 2K39A 4FJYA 1E8ZA 4NAWB 5KHQA 1WR6E 1PQSA 1FXTB 3RZWC 4OVUA 2AL6A 4DK5A 2K1FA 3L10B 2C60A 4W9DA 4NJ6A 1E8YA 3B0AA 3M95A 3A1QA 4DHJD 3QAQA 2RGFA 1HE8A 3AULA 1K8RB 2O2VA 4FHJA 1SIFA 3IHPC 3KUDB 4OVVA 3CSTA 1TTNA 3ALBA 2Y5BB 3RT3B 3UGBB 2GBKA 2M1MA 2LXCA 2KLGA 2K8BA 2D11A 1LQBA 1WZ0A 2DENB 1TGZB 1T0YA 4IM0A 5C23A 2IO2B 5DPWA 3U7DA 3SHQA 4X57B 1E8XA 2GMIC 3KUCB 3VUXA 4ZDVA 4BKSA 4DBGA 2LGYA 2KJ6A 2V4LA 2XK5B 3JYUA 3SDLC 1MG8A 3O65B 5IAAC 4WWPA 1KM7A 1WXMA 3DVGX 3ZUNA 2J0KA 1UBQA 1J0GA 1P3QU 4KZ0A 3QC8B 4FJVB 4GB9A 3T8MA 4F8CB 4AUQC 2NPTA 2JZZA 2AWTA 1X1MA 3SU8X 2N9EB 3JW0X 1GC6A 2C5LC 1E90A 2KANA 2L00B 3WALA 2EMTA 3RD2A 2CKHB 4MSMB 2RPQA 1WXSA 5J17A 3ML8A 3APCA 1EUVB 1Q1OA 3ZNGC 1VD2A 1V6EA 1J19A 4AJWA 4TQ0A 2MBBB 1WIAA 3ZDTA 2ZZPB 2QHOA 3CSFA 3PSEB 4GDKB 2KX3A 4IUMB 5HKHA 2HJ8A 4PS8A 4DDID 4DXAB 1P98A 4J6IA 2J0MA 3OLMD 4K7SA 1I42A 1UGMA 2K6QA 3DVNU 3KW5B 3MJWA 3PRMB 2YLMA 3DDCB 2BYFA 4DHJB 2XBBC 3T9LA 4EKUA 1E8WA 2BF8B 2MW5A 2D10A 3DVNV 2ZNVB 3DBRI 1C1YB 5JZEB 1WE6A 2W9NA 1RFAA 3VUWA 3QJZA 3DVGY 2N9XA 4FBJB 2KFJA 2RD0A 5L83A 4PYZA 1OTRB 2OJRA 4GGQA 3VVWB 4JQWC 4I6LB 3R7QA 2KXJA 1WJ6A 3R66C 3QA8A 4ZRJA 2GBNA 1YX5B 2UYZB 3A9KA 2KMCA 2DYMA 4WAAA 2GOWA 4E74A 4HPLB 2KKCA 3HM6X 1WMHA 2I1JA 4IG7B 1V5TA 5CTRC 4FLHA 1WI0A 1OQYA 2K6DB 4W9EA 1GG3A 3JVZX 3W1YA 3JSVB 3QWZB 4EZKA 3ZKJC 1GJZA 2EMSA 4K1RB 1NI2A 3X0WA 4NAWA 3MHSD 1Q0WB 4GSWA 2DAJA 1WXAA 2V1YA 4BKGA 2O6VD 1WY8A 1Z5SB 4CHKA 1TZ1A 1YJ1A 2FUHB 4NPNA 2V3SA 4KVGB 3IG3A 3PPAA 5JHAA 4G50A 4KV2A 4E3CA 4M8MA 2G4DB 4G0NB 3D32A 3VH4B 3ZNHB 1SE9A 4A3OA 2AEHA 4PS3A 3WA0A 1WM3A 3H7PB 5AEKB 2LRUA 2NBUA 4GN1A 2JPHA 1UD7A 3PRPB 4W9IA 3H9DA 5DPSA 4WJPA 4I6PA 1WZ3A 2FCMA 1E7VA 3TCAA 2HD5B 2CHXA 2MWSB 3DBHI 3PVLA 4XC2A 3UQAA 4W9GA 1M94A 3ZNID 2CS4A 2ZJDA 5D7GA 3HHMA 3LDZE 3TL5A 3HK0A 2G3QB 4IM3A 4II2B 3Q3FA 1UH6A 5D2MB 1Y8RC 4TUUA 2MCNB 5JH5C 4BKTA 3L13A 3ZRFA 3SD5A 2BWES 4MGKE 2KTRB 2PEAA 2IYDB 1YIWA 4AP4C 3RCZA 4NJ7A 2C7MB 3ZNZB 4TKNA 3R3MA 3UIPB 4HVBA 1NBFC 3ZTDA 1E7UA 5IA7A 3ZIMA 4IM2A 1P0RA 2HE7A 1WGRA 3WAMA 2HTHA 2KWCA 3QCAA 4ZYNA 4W9CA 2MBEA 1RLFA 4KIKB 5J18A 1BT0A 3NZSA 2DYBA 4WJNA 2C9WB 4GDKA 5AZHA 3VXWA 4RMAA 4ICVA 4JIOU 4ANWA 2ZEQA 2O6VB 1V5OA 3UF8A 2DYOA 1YQBA 1L7YA 4NY0A 4XZ4A 2NR2A 2PE9A 5BO4B 4RM9A 1J8CA 2YVCA 1R4MI 1GC7A 2JXXA 3KUZA 4IWQA 2LUEA 2NBWB 2NS5A 3VFKA 4GMVA 3ZDMC 4B95A 4FHKA 1C3TA 2LASA 2D07B 1Q5WB 1KLVA 3ZLZA 4BOSC 3DBSA 3IFWB 4ZRKA 2GBJA 1EF1A 3A9JB 2LWPA 2NCNA 2KK8A 4MGYE 2IY0B 3B08A 2UWQA 3VTWA 4HCPB 4EZLA 2LJ5A 3PTFC 1UBIA 4MELA 3L16A 3KYDD 3UINB 3TJPA 4HXDA 1RAXA 3OJ3A 4FULA 4NQLB 2JUOA 2WX0A 2WX1A 4MDKE 3JSVA 2B3AA 1P1AA 3EFUA 3N30A 3NY5A 5AZFA 4EZJA 4KDLB 1WJUA 4HWIB 2ZPNA 2D3GA 2ZVNA 3PHXB 4F1SA 3P2BA 2PE6B 5DPTA 4EEWA 2VRRB 2ZCBA 2BWFA 3RULA 1UELA 4ANUA 4HLEA 4MH0E 3NHEB 3I3TB 3IBEA 1WE7A 3VHTC 2J7QB 2KQ7A 3A33B 3M62B 3ML9A 4GDLB 1ZW7A 4A20A 3H7PA 4GIVA 2KX0A 4M8NA 4DHZB 2C7NB 2L05A 3WANA 2KNBA 3X23A 5L95C 3PS6A 2G4SA 4E71A 2NVUI 1WXVA 3ZRCA 1CMXB 4KZCA 1AARA 2BYEA 4KSKC 2PPHA 2REXA 2LVPA 3A4SC 4WJOA 3H6NA 4FADA 3UIOB 1IP9A 2KFKB 1QZEA 4PS7A 2LRWA 2KJRA 2N1VA 3KYCD 1Z2MA 1TBEA 4IWPA 4CO7A 4GOCA 4N9F4 3AU4A 3R7RA 1D3ZA 3PREA 2IO1B 3V6CB 2I1KA 3PZDA 1WGDA 3DPDA 3OAWA 3CF6E 3ZTCA 5E6OA 1WX7A 2DAFA 4HDQA 3K9OB 2KTRA 2M0XA 2MP2B 4M0WB 2KJHB 4LJOB 4EOYA 2BYVE 2MBQA 4PYUA 5LXIB 3AI5A 4EUTA 2L8JA 1A5RA 4DWFA 4MJSA 4URKA 2MSED 2PJHA 4B6WA 5LLIA 2CHZA 3S2AA 4KIKA 2FIDA 4P7IA 5AZGA 1OEYJ 4KSLC 4FA6A 1WGYA 3GZNI 1JRUA 4LCDE 1L2NA 2JY6A 2KOXA 3ECIA 4XX5A 4AJYB 5JHBA 2O6VA 2GBMA 5DCNA 2DZJA 2CR5A 1V80A 2MLBA 4YL8A 1H8CA 2L76A 2FIFA 4ANVA 4W9LA 4ASWC 3TBLD 3BY4B 3L08A 1R4NI 3L0WB 5TR5A 3Q3JA 2L3ZA 2LXAA 2LZ6A 2ZCCA 3WIMA 3QK0A 2JZ3B 1IPGA 1P9DU 1NDDA 3UQBA 2DZMA 3APFA 4BBNF 4DHZE 1IYFA 2CU1A 1EO6A 2FCSA 1YD8U 1WR1A 2LGXA 3A9JA 5KHOA 2JVCA 3EECA 3ZVVA 3PGEA 2K8HA 4DDGD 3U8ZA 1I35A 2N9PC 1KJTA 1V86A 4MGIE 3M63B
chains in the Genus database with same CATH superfamily
1YX6B 2JRIB 1CK1A 3NJTA 3WAOA 2Y5CA 1LFDA 3AU5A 1GUAB 5BMGA 1HZ6A 2KDIA 1SIJA 1NI3A 2AQ2B 5CHFA 5D3DA 4JL9A 2KC1A 4YTMB 1NYRA 4ZRIA 1L4ZB 1QT9A 1ZUD2 3C0RB 4C4VB 4BKSD 2AL3A 3I5JC 3IVFA 4LK0M 1IGCA 4ARCA 4ARIA 3VUYA 2V3PA 4AWJA 2G45B 4FJZA 1DOXA 1VRAB 4RM8A 3H1UA 4XDCA 1WRDB 2L0FA 2LJIA 3SFDB 3QQ8B 2LMCA 1PGBA 3RFZB 3HIZA 1MHHE 2QSDA 2MP2A 4B9KA 1E5WA 1V9JA 3LJ3A 2WXOA 1OEYA 5D3IB 2OEDA 3BYYB 1K53A 1F52A 1V2YA 5FR6A 3U52E 3L54A 1ZPSA 1WX8A 3I57A 4HEA1 4BVUC 2PMVA 2QCZA 1MJDA 3ZXRA 4JLCA 3SEBA 4IWOA 3W1SC 2IO0B 3AE5B 3UI3A 2W82A 2Z59B 2GRIA 4I6NB 1SBBB 4MSQB 4MACA 2MQJA 1GPXA 1JWMD 2K25A 2TSSA 2WP9B 4ZHOA 3WAPA 3E9SA 4DXGA 4P6VF 3PRZA 2W3SA 1H4RA 3ZW3A 1V1OA 3T3NA 4XWWA 2KWVB 4HPMB 1RRBA 2LFIA 5E6NA 1TT5B 2M56B 4B0EA 1FRDA 2KLCA 2PKOA 3NS1A 1TKEA 2MA9B 2CHWA 2Z0EB 1YN5A 4USAA 3AE7B 5D94A 1V1PB 3QARA 4ACFA 3EC8A 3Q8BA 1WMHB 2XK5A 2G1EA 4W9JA 1C4CA 1XQQA 2A4ZA 1WR6E 1F1HA 1PGXA 2AL6A 4OHJA 2C60A 1E8YA 5LNK1 2YEPF 3QAQA 1HZ5A 4OVVA 3UGBB 2GBKA 1YQ4B 2DENB 1JMLA 3GB1A 2QIEB 3VUXA 1UF0A 3JYUA 3RNBC 3O65B 1JRPA 1WXMA 3DVGX 3ZUNA 1P3QU 4KZ0A 4FJVB 1V97A 4F8CB 1OQRA 2WXNA 1X1MA 1GC6A 2C5LC 1AN8A 3WALA 2EMTA 4CQNA 1WXSA 3ML8A 1Q1OA 4Q2JA 1VD2A 5EE1A 3ZNGC 1TY2A 2MBBB 1WIAA 2KX3A 2HJ8A 4J6IA 1UWMA 2V9HA 3R2TA 4K7SA 1I42A 4RFBA 2K6QA 4S17A 3PRMB 2YLMA 3DDCB 4DHJB 3T9LA 2D10A 3DVNV 1C1YB 1QQRA 2QDFA 5JZEB 1WE6A 1SF0A 2W9NA 3QJZA 1QOGA 4FBJB 3EUB2 2OJRA 3R7QA 3AE2B 4ZRJA 2GBNA 1YX5B 1VJKA 4XDDA 2GOWA 4HPLB 1WMHA 3E56A 4IG7B 1L5PA 3W1YA 1M4VA 3QWZB 2WU5B 1GJZA 2EMSA 1NI2A 2RPVA 1IGDA 4LNIA 2V1YA 4BKGA 1Z5SB 1FEHA 1XLNA 1C78A 4CHKA 2IGGA 1YJ1A 2KQ4X 2V3SA 4KVGB 3PPAA 4G50A 4KV2A 4M8MA 4S0RA 3R8BA 3Q3OC 3H8HA 4P1CC 5DPSA 1WZ3A 3BK1A 2L52A 3DBLB 3RNEC 1M94A 2CS4A 5D7GA 3LDZE 3W5UB 1Y8RC 2SAKA 4TUUA 2MCNB 1IUEA 2QEJC 1L6UA 4BKTA 4RF0A 2BWES 2DWQA 3WCQA 2KTRB 5BMIA 4AP4C 2SEBD 3RCZA 2WDQB 4TKNA 3V05A 1P0RA 2LUMA 1WGRA 1QOBA 3N20C 2KWCA 4ZYNA 2MBEA 4KIKB 3DWGC 1MFWA 1HTOA 4ICVA 2ZEQA 1L7YA 2CJOA 4XZ4A 2EKIA 2OJWA 4BZAA 1C3TA 1ET6A 3A9JB 2LWPA 2KK8A 4HCPB 2B76B 2GB1A 1TS3A 2LGIA 4NQLB 2JUOA 2WX0A 2WX1A 4MDKE 1K52A 1MVKA 4KDLB 2MJDA 3PHXB 4F1SA 1Y56A 5T8IA 4EEWA 1T0SC 2ZCBA 3Q8EA 3P4RB 2KQ7A 3B2GA 4GIVA 4REZA 2KX0A 1XEEA 2K22A 3TEZA 1HA5A 2K3UA 3TUOA 1DOYA 3U7ZA 3ZRCA 1JQ4A 2REXA 2JYTA 3H6NA 4WJOA 5IKCM 1QZEA 2MHJA 3KYCD 2KJRA 1I4XA 1Z2MA 1J7AA 2INNE 1E0ZA 2IO1B 3OAWA 1WGDA 3ZTCA 3AE1B 2L1AA 3AE3B 2KTRA 2M0XA 2BYVE 4PYUA 1GB1A 1SE2A 1A5RA 4DWFA 4KIKA 1V8CA 3VRAB 3GZNI 1YNTE 4XX5A 5DCNA 2DZJA 2MLBA 1T0QC 1H8CA 4QAYA 1N63A 5EE0A 2E3TA 4ASWC 3BVGA 3NRZA 3RPFC 2L3ZA 2ZCCA 4MT5A 2JZ3B 1NDDA 3IT6B 3UQBA 4BBNF 3B9JA 1YD8U 3A9JA 3ZVVA 3U8ZA 3EGRA 1G6JA 4BOZB 4K81A 2WS3B 2KDBA 1V81A 2FCNA 4MJSB 2OOBB 2JX5A 5BYSA 3DBRB 3MTNB 1N6ZA 2C7HA 2NTSA 2AX5A 4LDTD 3V61A 1FFUA 2ZW1A 2W54A 2FE8A 1U4AA 4RH6A 2AYOB 4JWUC 2IBIB 4N6EB 3Q2AC 4WQOB 3ENEA 1RFKA 4CYEA 2BS4B 5IP4D 2WXMA 4HRSA 1OGWA 1ROEA 5IOIA 5G55A 2LI5A 2ON8A 1WGKA 3NVZA 2KN5A 3TMPB 2MBHA 4BFRA 1WFYA 2R2OA 2QJLA 2IY1B 2KDEB 3TSSA 1WX9A 2JWZA 4NNJB 3V62A 3BK2A 2LGSA 2WU2B 1TJEA 2N0SB 3IAM1 5I4DA 4XE0A 2JQRB 4A3PA 2MX2A 5CHVC 1UGJA 3W5VB 1E9MA 4ANXA 5FR3A 2Z0DB 1KF6B 4HROA 3K9PB 4C56C 4WAFA 2V4IB 4W9KA 1DOIA 2FNJB 2RR9A 1F9JA 2XEWA 1WGGA 4HK2A 5TSSA 4GXBA 1XCTL 1N5XA 2L0TA 2WXQA 2NPTB 3AE8B 2NBVB 3N3KB 4W9HA 4M02A 2JT4B 1R4MB 3H7SA 1WGHA 5GXGB 2BB6A 4K7UA 4K7WA 3PO0A 1VR9A 4BBNC 4LNNA 1TZOA 3NOBA 1T3QA 3T3OA 3LYYA 3U30A 5EDSA 5FK9C 3V60A 1YJIA 4NZLB 1F0ZA 1LO5D 2N4FA 2FCQA 3DHIC 4DXFA 1EWCA 1XD3B 2Y5PA 4JGHB 3QX1A 1JALA 5HHDG 5IN7A 3NZUA 1P7EA 4TSSA 2FAZA 4WWOA 2HDEA 4F7ZA 2K39A 4NAWB 1PUTA 4OVUA 3DHGC 3L10B 3FC4A 5G5GA 4JWSC 3M95A 3ALBA 4XGAB 4RNAA 2Z8LA 4IM0A 5C23A 4XYCA 3SHQA 1B9RA 2GMIC 4RCOA 1NEKB 3KUCB 4ZDVA 4BKSA 3BVZA 2LGYA 2XK5B 1MG8A 3MFGA 1JCKB 2J0KA 2WGSA 4C7YA 4UDUC 1C9FA 2IDYA 4AUQC 2NPTA 2JZZA 4LNKA 2N9EB 1R4NB 1E90A 1KH0A 2KANA 2L00B 2MEKA 3NUHB 4ZOHC 2CKHB 2RPQA 1YMHE 1V6EA 4YSZB 4LLGM 3ZDTA 2VH2A 3FKYA 4GDKB 2L32A 3PSEB 5HKHA 2J0MA 1EU4A 1T0RC 4C00A 2BYFA 2MW5A 4KKIA 2BBCA 2PVGC 4C7ZA 3AEDB 1RFAA 2KFJA 2INDC 4GGQA 3VVWB 2KXJA 1LGRA 4LTUA 3R66C 3QA8A 2KMCA 2DYMA 4JE3B 4E74A 2KKCA 4C80A 1V5TA 5CTRC 4FLHA 1CJEA 1GG3A 4M01A 4K1RB 3X0WA 4NAWA 5AUIA 1Q0WB 4GSWA 1AW7A 1KFYB 2O6VD 1WY8A 3Q3NC 2I2YA 1TZ1A 1K51A 3IG3A 3RNAC 1SSNA 5JHAA 1L0XB 2G4DB 4G0NB 1SE9A 4A3OA 2AEHA 4KGTA 4PS3A 2CU3A 3WA0A 3H7PB 3P42A 4WJPA 2MWSB 3AMZA 3PVLA 4XC2A 4W9GA 2ZJDA 3HHMA 2JSVX 1SJED 3TL5A 2G3QB 4IM3A 2NTTA 3Q3FA 1UH6A 5D2MB 4ZRPA 5JH5C 2K5PA 4HPPA 3ETRA 2WLBA 3KQ4A 4M00A 1N5WA 1N61A 2C7MB 3LB8C 3ZTDA 3RN9C 3WAMA 1NYQA 5J18A 1BT0A 3MJ5A 3I9V1 3VXWA 4GDKA 2QILA 4NY0A 2NR2A 1NVID 4RM9A 1CQVA 4L1BA 2JXXA 4N58A 4IWQA 1ZOYB 3ZDMC 1N60A 4FHKA 3ZLZA 3DBSA 1VZ7A 3IFWB 5IO9A 2NCNA 4MGYE 2UWQA 3N1YC 3VTWA 1STEA 2KWDA 3L16A 2MH7A 4O1NA 4YSYB 1P1AA 3NY5A 5H92C 2RMMA 2PE6B 5DPTA 1QOAA 3RULA 3NHEB 3I3TB 3P1MA 2J7QB 1FPYA 3H7PA 4M8NA 4DHZB 1B1ZA 2C7NB 4OZAA 2KNBA 3X23A 3P63A 1JWUD 5L95C 2IGDA 3HRDD 3B2FA 1MHXA 1MPEA 3HVDA 3J9CA 4RF1A 4FADA 3URYA 2KN4A 2N1VA 4CO7A 3R7RA 2BYTA 3SFEB 3AEAB 1WX7A 1FRRA 3IT4B 2KJHB 4LJOB 2MBQA 1YJJA 3AI5A 4LNFA 2KACA 1P7FA 4JPSA 4ITKA 5AUKA 4URKA 2PJHA 4B6WA 5LLIA 4EE2A 4LCDE 1L2NA 1QILA 1C77A 3ECIA 2Y3AA 2GBMA 4YL8A 3MC8A 4ANVA 4PK1A 4OVZA 3L0WB 3N9YC 5TR5A 4L2YA 2DBYA 4MM3B 2K0PA 4N59A 2BVCA 3DHHC 1YOVB 2FCSA 1WR1A 1K50A 3TEXA 2LGXA 1WYGA 2KAJA 3PGEA 1FNUA 1I35A 4MGIE 3M63B 1PGAA 3A4RA 5HG2A 2BKFA 1UZXB 2MBOA 1SJHD 3PLVA 1VDVA 3QIJA 4HDOA 2ZVOA 3QHTA 2ZPYA 4ICUA 4TV3A 3ONSA 4KGSA 2GI9A 4GU2A 3RZFA 3CMMB 2KO3A 3NZ3A 2X8XX 2KDFB 1JWAD 3NVYA 3GOEA 3Q6BA 2G9HD 2DZIA 1GNUA 1ZE3D 2KD0A 2AQ3B 2WXJA 1DGJA 3L17A 5MPOA 3P4PB 4YTNB 3NG0A 1S1QB 1VCBA 3DBLI 2IJ0A 2WXPA 3DBHB 2D2QA 1WRIA 2EKEC 4RGOS 2LVOA 3A1QB 4JX1C 1E6EB 2KWUB 1KTKA 3BINA 4A9AA 4LDTB 2BKRB 1SB3C 1UNSA 5LXHA 1LM8B 4NQKE 4ZHPA 3VH3B 4MGZE 2L7RA 3NVVA 4KDIC 1WM2A 2WDTB 3ZO5B 2LVQA 4WWNA 2ZNVC 2JRHA 4G11A 4MM3A 5BMHA 3BYTB 2N1WA 1UUPA 3VDZA 2DX5B 1WH3A 5J2RA 4EFOA 2WWZA 1FCCC 2I38A 1LXDA 3EA6A 1WJNA 4AQ7A 2FBWB 4ZRQA 3DCGA 1QLBB 4AS1A 2KQSA 1WF9A 2IO3B 3ZGZA 3CIRB 4LJPB 3DOWA 3PV1A 2QC8A 1J7BA 1EF5A 3AXCA 3W9CB 1WYWB 3PT2B 3RMKC 4RGTA 4YXDB 3BZDB 2A5UA 1Q10A 3DWMA 2HJ1A 4B0MA 5CX3A 2JF5A 2ASQA 1SGHA 2M17A 1I4GA 4II3B 4TQ1A 2BT6A 4KGRA 1KOTA 3LXFA 3R2IA 3B1LX 1T5XD 3FAHA 3PHWB 3V6EB 4WIPA 1ISNA 4W9FA 4FJYA 1C4PA 1E8ZA 3MP9A 1XF5L 1BMLC 1PQSA 3RZWC 3GE8C 4DK5A 2K1FA 4W9DA 4NJ6A 3B0AA 3A1QA 2BTEA 2RGFA 1HE8A 1NENB 1FD6A 1K8RB 1FO4A 1SIFA 3KUDB 2Y5BB 3RT3B 2WDRB 2M1MA 2W55A 2D11A 1LQBA 1WZ0A 4K3BA 1TGZB 1T0YA 2RDGA 2IO2B 2PVOD 5DPWA 3U7DA 4WURA 3KLSX 2KJ6A 1WXQA 2V4LA 2ACZB 3MC9A 3SDLC 3TEWA 4KX6B 5IAAC 4WWPA 5EE9A 4R3DA 1UBQA 1J0GA 1ENFA 2V0GA 3QC8B 2JU6X 4GB9A 2OHFA 1JROA 1GB4A 1D5MC 2NMQA 5J17A 2IPKD 4BAXA 1J19A 4TQ0A 1BUIC 2QHOA 3CSFA 2D3BA 4IUMB 2WDVB 3EFCA 3BIID 1JW9D 4DXAB 1P98A 3U4EG 1IBXB 1ZDVA 4P1BC 1UGMA 3DVNU 3MJWA 1XLQA 2J4XA 2R61A 3DBRI 1ESFA 3VUWA 3Q8FA 2N9XA 5L83A 1OTRB 1GAQB 4JQWC 1WJ6A 3ZYYX 1HQRD 2UYZB 1DYQA 3HM6X 2I1JA 1WI0A 1OQYA 2K6DB 4W9EA 3JVZX 3JSVB 4EZKA 1WXAA 4H2AA 2MJEA 4NPNA 4E3CA 3D32A 1RYJA 3ZNHB 2WXKA 5BYQA 1WM3A 2WHIA 5AEKB 1ZXHA 2UU7A 2JZPA 3PRPB 3H9DA 1WWTA 1E7VA 3TCAA 3ZQ4A 5HFYA 3UQAA 1SE3A 2QMTA 3HK0A 4II2B 1AWDA 1N62A 3IAS1 4MGKE 3BWUD 2IYDB 1YIWA 3Q69A 2DLBA 2INCC 3ZNZB 2PIAA 3ZIMA 4IM2A 1L6VA 1HEZE 2HTHA 2RDHA 3QCAA 4W9CA 3Q14C 3AV8A 1RLFA 2GLSA 3NZSA 2DYBA 5AZHA 1UWXA 4RMAA 4ANWA 2O6VB 2AQ1B 3UF8A 1IBXA 1QOFA 1J8CA 3AEGB 5HI1A 2YVCA 1L0VB 1R4MI 2IGHA 1GC7A 2N9KA 3KUZA 2LUEA 2NBWB 2NS5A 3VFKA 4B95A 2N7JA 2D07B 2LASA 1Q5WB 3TEYA 2WXIA 2GBJA 4YWGG 2IY0B 3B08A 3KWVA 4EZLA 1TS5A 2LJ5A 3PTFC 1UBIA 1FIQA 3AECB 3KYDD 3UINB 3TJPA 1RAXA 4FULA 4P16A 2WQYB 4GLSC 3JSVA 2B3AA 3EFUA 3FILB 1XLPA 3OG5A 1WJUA 2VZKB 4HWIB 2ZPNA 3AM9A 3HVZA 1VLBA 2KMMA 3P2BA 1ZP0B 2BQQA 2BWFA 4D2KA 1UELA 4ANUA 4HLEA 1D6EC 4DQOC 1I4HA 3IBEA 3VHTC 1J7CA 3M62B 3A33B 4GDLB 3ML9A 1ZW7A 4A20A 1A70A 1HTQA 2ICIA 3AE6B 3AEFB 1VZ6A 2L05A 3WANA 2G4SA 4HJGE 4WWMA 1WXVA 4KZCA 1AARA 2BYEA 2CJNA 2LVPA 4A6QA 2KFKB 1FNWA 4IWPA 2E6XA 4GOCA 4HKQA 3N1XC 2BS3B 1D3ZA 3V6CB 3AEEB 2I1KA 3CF6E 2DAFA 1F2RC 3K9OB 2VH1A 4M0WB 5C3JB 3RNGC 4L23A 3Q8AA 4FXCA 5LXIB 2JYEA 2L8JA 1T6BX 2MSED 2CHZA 3AE4B 1OEYJ 4KSLC 4YSXB 1JRUA 2KOXA 3GP7A 4AJYB 4OZBA 2O6VA 2CR5A 1KRHA 2INPE 4HKZE 1E10A 4W9LA 5G5HA 2DNFA 3BY4B 1MG4A 3TBLD 1R4NI 2ONQA 2JWUA 2LXAA 1D5XC 2LZ6A 3Q3JA 3QK0A 1IPGA 4C4VA 1P9DU 3OWEB 3APFA 2VZKD 2CU1A 1EO6A 5KHOA 2JVCA 3P4SB 2K8HA 4DDGD 4WH4A 1KJTA 1V86A 2N7EA 3IXSA 3AB5A 2KHWB 5C1ZA 3FILA 1WJ4A 1JWBD 3TIXA 2JXTA 4YT0B 1F2RI 4HCNB 1V49A 2BB5A 3W1SA 2KMAA 1PFDA 2LD9A 4GDLA 4MEMA 3I63C 2GBRA 4OW0A 1SE4A 4IDIA 1FM0D 2KDMA 2KC2A 3O13A 4US8A 1ZKHA 5E6PA 2KZRA 3VQIA 2BW2A 4A90A 2KFKA 4G3XB 2J53A 1L0YB 4WQMA 4IOIE 4M0WA 4AOFA 1KLUD 3NS8A 4J3OD 1RWSA 2IZVB 2M8SA 1OFFA 2R2QA 5G2NA 5C2TB 2O2VB 2BPSA 3SR6A 2KTFA 1FNVA 5DPRA 4NAMA 2DZKA 2KVZA 5EE3A 1S3SG 4LNOA 1R7SA 3VAWA 5GMVA 5BYRA 1XT9B 2DHZA 4HJKA 1V1PA 3VTUA 1GOZA 3DQVA 1TYGB 4WJQA 2N7DA 1TKYA 5D6JB 1C76A 4IW0A 3Q8CA 2BGFA 3N32A 5CHWA 3NVWA 4IC7B 3HM3A 4KKJA 2J0JA 4FN2A 5JXVA 1ZXIA 2WYQA 4RGMA 3EHVA 2WXRA 5FKAC 3APDA 2M4NA 3OJ4B 3L4PA 2EELA 3KVFB 3RYTA 2K8CA 2LGDA 2YEPB 3RUIB 2MRPA 4OZCA 2RSUA 2KVRA 3PLUA 1ZGUB 1I7HA 3VTVA 1EM7A 3A9KB 3M3JA 1FMAD 3ZXVA 4US9A 3C19A 3ZJVA 3GS2A 3VR9B 4MH8A 3KH0A 2KT7A 5KHQA 1FXTB 1OQQA 1I4RA 3CWIA 3BVMA 3PZ7A 4DHJD 1TS4A 3AULA 2O2VA 3HUIA 4FHJA 3IHPC 3CSTA 1TTNA 1D4BA 1KLGD 2LXCA 2KLGA 2K8BA 3RNCC 2J42A 4X57B 1E8XA 3P4QB 4DBGA 2HTME 1C79A 1KM7A 3GZNB 2RDBC 3AEBB 4A55A 4NJCA 3T8MA 2AWTA 3SU8X 3JW0X 2M0AA 4TMAB 4MSMB 3RD2A 1XCQL 2H88B 3APCA 4RGNA 1EUVB 2BS2B 4AJWA 2ZZPB 1AYFA 2PTLA 4PS8A 4DDID 3VR8B 3OLMD 3W2DA 1RM6C 3KW5B 2XBBC 4EKUA 1E8WA 2BF8B 2FUG1 1WSPA 2ZNVB 1ACCA 2XNAC 2LHEA 1FFVA 3DVGY 1QF6A 2RD0A 4PYZA 1FCLA 4I6LB 1CZPA 3A9KA 4IKGA 2D5GA 2J52A 4WAAA 1TY0A 3RNFC 3ZKJC 3AN1A 3MHZA 3MHSD 2DAJA 2FUHB 3Q3MC 3AE9B 2PW9A 3RI7C 3VH4B 4A8XC 2XN9C 2LRUA 2NBUA 4GN1A 2JPHA 1UD7A 4W9IA 4I6PA 1XXGA 3ZJUA 2FCMA 2HD5B 2CHXA 3MC0B 3DBHI 1JWSD 1FXIA 3ZNID 1E7PB 2V3NA 2L83A 3L13A 3ZRFA 3SD5A 1C4AA 2PEAA 2H89B 2LHDA 4NJ7A 3R3MA 3UIPB 4K3CA 4HVBA 1NBFC 2WXGA 1E7UA 4ZYSA 5IA7A 2HE7A 1FXAA 1YN4A 2D3CA 4WJNA 1PDXA 2C9WB 1XLOA 4JIOU 2LEKA 1YN3A 1V5OA 2DYOA 1YQBA 3VRBB 2W3RA 2WXLA 1ZDXA 2PE9A 5BO4B 1ET9A 2N9LA 4GMVA 2WXHA 1F77A 1KLVA 2Q5WD 1I4PA 4BOSC 3U2SC 1BXTA 2WXFA 4ZRKA 1EF1A 2D3AA 1TKGA 4MELA 4HXDA 3OJ3A 3V3XA 3N30A 5AZFA 4EZJA 2D3GA 2ZVNA 3ABVB 2VRRB 2PLPA 3PZ8A 4MH0E 1WE7A 1EWYC 1SXTA 1MI0A 3PS6A 4E71A 2NVUI 5E6JA 1CMXB 4PT5A 2MJ3A 4KSKC 2PPHA 3KWLA 3A4SC 3UIOB 1IP9A 3AH7A 4PS7A 2LRWA 1TBEA 2K9XA 3N1ZC 4N9F4 4YTPB 3AU4A 1TIFA 3PREA 1QKZA 3DPDA 2ZW0A 3PZDA 2M19A 5E6OA 4HDQA 1L4DB 2MP2B 2WNMA 4EOYA 4EUTA 4MJSA 1EU3A 3S2AA 2FIDA 4P7IA 5AZGA 4FA6A 1WGYA 2JY6A 1SEBD 1HXYD 2X38A 5JHBA 1V80A 2L76A 2FIFA 1VZ8A 1YQ3B 3L08A 5H8YE 3WIMA 1D5ZC 1XO3A 2DZMA 4DHZE 1PYWD 1I4QA 1IYFA 3GE3C 2KYWA 1TS2A 3ZJTA 3C8YA 3EECA 4XWTA 2N9PC
chains in the Genus database with same CATH topology
1YX6B 1G6JA 2JRIB 3A4RA 4BOZB 2N7EA 2BKFA 1UZXB 4K81A 2KHWB 2KDBA 3WAOA 1V81A 1LFDA 2MBOA 5C1ZA 2FCNA 3AU5A 3PLVA 2OOBB 4MJSB 1GUAB 1WJ4A 3QIJA 4HDOA 3TIXA 2KDIA 2ZVOA 3MTNB 2C7HA 3QHTA 4HCNB 1V49A 4LDTD 2ZPYA 2KMAA 5CHFA 3V61A 4ICUA 3W1SA 4JL9A 4TV3A 3ONSA 2LD9A 2KC1A 1U4AA 2AYOB 4ZRIA 4GDLA 4MEMA 2IBIB 4GU2A 3RZFA 3CMMB 2GBRA 3C0RB 4WQOB 2KO3A 3ENEA 4BKSD 4CYEA 2AL3A 3IVFA 2KC2A 3VUYA 2KDFB 1OGWA 1ZKHA 5E6PA 4AWJA 2KZRA 2G45B 3VQIA 4FJZA 3GOEA 4RM8A 3H1UA 1WRDB 2KFKA 2L0FA 2LI5A 5G55A 4G3XB 2KN5A 3QQ8B 2DZIA 1GNUA 3TMPB 2MBHA 4BFRA 1WFYA 2KD0A 2R2OA 3HIZA 3L17A 2MP2A 4B9KA 4AOFA 1E5WA 1V9JA 2IY1B 3LJ3A 2KDEB 1OEYA 1WX9A 2JWZA 3NS8A 4NNJB 3V62A 1S1QB 1VCBA 3DBLI 2IZVB 1V2YA 2M8SA 2D2QA 5FR6A 2EKEC 3L54A 2R2QA 1WX8A 2LVOA 3A1QB 4A3PA 5G2NA 2KWUB 4BVUC 2O2VB 2MX2A 4JLCA 2BPSA 4IWOA 3BINA 2KTFA 5CHVC 3W1SC 4LDTB 2BKRB 4ANXA 5DPRA 5LXHA 1LM8B 2IO0B 2Z0DB 2DZKA 4NQKE 3VH3B 1S3SG 2Z59B 2L7RA 4KDIC 4MGZE 1WM2A 2WDTB 3ZO5B 3K9PB 2LVQA 4WWNA 2ZNVC 2JRHA 4G11A 4MM3A 3VAWA 5GMVA 4I6NB 2N1WA 4W9KA 3VDZA 1XT9B 2DHZA 4HJKA 2DX5B 2FNJB 2RR9A 1F9JA 3VTUA 4MSQB 2XEWA 3DQVA 1WGGA 1WH3A 2MQJA 4HK2A 2N7DA 4WJQA 5D6JB 5J2RA 2K25A 4GXBA 2L0TA 2WWZA 4EFOA 2NPTB 4IW0A 2NBVB 3WAPA 2BGFA 1LXDA 1WJNA 3N3KB 4W9HA 3N32A 2JT4B 3PRZA 5CHWA 3H7SA 3DCGA 4IC7B 2KQSA 1WF9A 1H4RA 3ZW3A 3HM3A 2IO3B 1WGHA 4K7UA 4LJPB 2J0JA 4K7WA 4FN2A 3DOWA 3PV1A 2KWVB 4HPMB 1EF5A 1RRBA 2WYQA 4BBNC 3AXCA 5E6NA 3EHVA 1WYWB 3APDA 2KLCA 3NOBA 3PT2B 2M4NA 3U30A 5EDSA 3OJ4B 2MA9B 2CHWA 3V60A 2Z0EB 3KVFB 2A5UA 3RYTA 2K8CA 2LGDA 2N4FA 5D94A 3RUIB 2MRPA 2FCQA 5CX3A 2RSUA 2JF5A 2KVRA 1XD3B 3PLUA 2ASQA 1ZGUB 3QARA 3VTVA 1SGHA 3A9KB 2M17A 4JGHB 4II3B 3M3JA 3QX1A 4TQ1A 3EC8A 3NZUA 1KOTA 1WMHB 2XK5A 4W9JA 3B1LX 2FAZA 1XQQA 3PHWB 4WWOA 3V6EB 1ISNA 2A4ZA 4W9FA 3KH0A 4F7ZA 2K39A 4FJYA 1E8ZA 4NAWB 5KHQA 1WR6E 1PQSA 1FXTB 3RZWC 4OVUA 2AL6A 4DK5A 2K1FA 3L10B 2C60A 4W9DA 4NJ6A 1E8YA 3B0AA 3M95A 3A1QA 4DHJD 3QAQA 2RGFA 1HE8A 3AULA 1K8RB 2O2VA 4FHJA 1SIFA 3IHPC 3KUDB 4OVVA 3CSTA 1TTNA 3ALBA 2Y5BB 3RT3B 3UGBB 2GBKA 2M1MA 2LXCA 2KLGA 2K8BA 2D11A 1LQBA 1WZ0A 2DENB 1TGZB 1T0YA 4IM0A 5C23A 2IO2B 5DPWA 3U7DA 3SHQA 4X57B 1E8XA 2GMIC 3KUCB 3VUXA 4ZDVA 4BKSA 4DBGA 2LGYA 2KJ6A 2V4LA 2XK5B 3JYUA 3SDLC 1MG8A 3O65B 5IAAC 4WWPA 1KM7A 1WXMA 3DVGX 3ZUNA 2J0KA 1UBQA 1J0GA 1P3QU 4KZ0A 3QC8B 4FJVB 4GB9A 3T8MA 4F8CB 4AUQC 2NPTA 2JZZA 2AWTA 1X1MA 3SU8X 2N9EB 3JW0X 1GC6A 2C5LC 1E90A 2KANA 2L00B 3WALA 2EMTA 3RD2A 2CKHB 4MSMB 2RPQA 1WXSA 5J17A 3ML8A 3APCA 1EUVB 1Q1OA 3ZNGC 1VD2A 1V6EA 1J19A 4AJWA 4TQ0A 2MBBB 1WIAA 3ZDTA 2ZZPB 2QHOA 3CSFA 3PSEB 4GDKB 2KX3A 4IUMB 5HKHA 2HJ8A 4PS8A 4DDID 4DXAB 1P98A 4J6IA 2J0MA 3OLMD 4K7SA 1I42A 1UGMA 2K6QA 3DVNU 3KW5B 3MJWA 3PRMB 2YLMA 3DDCB 2BYFA 4DHJB 2XBBC 3T9LA 4EKUA 1E8WA 2BF8B 2MW5A 2D10A 3DVNV 2ZNVB 3DBRI 1C1YB 5JZEB 1WE6A 2W9NA 1RFAA 3VUWA 3QJZA 3DVGY 2N9XA 4FBJB 2KFJA 2RD0A 5L83A 4PYZA 1OTRB 2OJRA 4GGQA 3VVWB 4JQWC 4I6LB 3R7QA 2KXJA 1WJ6A 3R66C 3QA8A 4ZRJA 2GBNA 1YX5B 2UYZB 3A9KA 2KMCA 2DYMA 4WAAA 2GOWA 4E74A 4HPLB 2KKCA 3HM6X 1WMHA 2I1JA 4IG7B 1V5TA 5CTRC 4FLHA 1WI0A 1OQYA 2K6DB 4W9EA 1GG3A 3JVZX 3W1YA 3JSVB 3QWZB 4EZKA 3ZKJC 1GJZA 2EMSA 4K1RB 1NI2A 3X0WA 4NAWA 3MHSD 1Q0WB 4GSWA 2DAJA 1WXAA 2V1YA 4BKGA 2O6VD 1WY8A 1Z5SB 4CHKA 1TZ1A 1YJ1A 2FUHB 4NPNA 2V3SA 4KVGB 3IG3A 3PPAA 5JHAA 4G50A 4KV2A 4E3CA 4M8MA 2G4DB 4G0NB 3D32A 3VH4B 3ZNHB 1SE9A 4A3OA 2AEHA 4PS3A 3WA0A 1WM3A 3H7PB 5AEKB 2LRUA 2NBUA 4GN1A 2JPHA 1UD7A 3PRPB 4W9IA 3H9DA 5DPSA 4WJPA 4I6PA 1WZ3A 2FCMA 1E7VA 3TCAA 2HD5B 2CHXA 2MWSB 3DBHI 3PVLA 4XC2A 3UQAA 4W9GA 1M94A 3ZNID 2CS4A 2ZJDA 5D7GA 3HHMA 3LDZE 3TL5A 3HK0A 2G3QB 4IM3A 4II2B 3Q3FA 1UH6A 5D2MB 1Y8RC 4TUUA 2MCNB 5JH5C 4BKTA 3L13A 3ZRFA 3SD5A 2BWES 4MGKE 2KTRB 2PEAA 2IYDB 1YIWA 4AP4C 3RCZA 4NJ7A 2C7MB 3ZNZB 4TKNA 3R3MA 3UIPB 4HVBA 1NBFC 3ZTDA 1E7UA 5IA7A 3ZIMA 4IM2A 1P0RA 2HE7A 1WGRA 3WAMA 2HTHA 2KWCA 3QCAA 4ZYNA 4W9CA 2MBEA 1RLFA 4KIKB 5J18A 1BT0A 3NZSA 2DYBA 4WJNA 2C9WB 4GDKA 5AZHA 3VXWA 4RMAA 4ICVA 4JIOU 4ANWA 2ZEQA 2O6VB 1V5OA 3UF8A 2DYOA 1YQBA 1L7YA 4NY0A 4XZ4A 2NR2A 2PE9A 5BO4B 4RM9A 1J8CA 2YVCA 1R4MI 1GC7A 2JXXA 3KUZA 4IWQA 2LUEA 2NBWB 2NS5A 3VFKA 4GMVA 3ZDMC 4B95A 4FHKA 1C3TA 2LASA 2D07B 1Q5WB 1KLVA 3ZLZA 4BOSC 3DBSA 3IFWB 4ZRKA 2GBJA 1EF1A 3A9JB 2LWPA 2NCNA 2KK8A 4MGYE 2IY0B 3B08A 2UWQA 3VTWA 4HCPB 4EZLA 2LJ5A 3PTFC 1UBIA 4MELA 3L16A 3KYDD 3UINB 3TJPA 4HXDA 1RAXA 3OJ3A 4FULA 4NQLB 2JUOA 2WX0A 2WX1A 4MDKE 3JSVA 2B3AA 1P1AA 3EFUA 3N30A 3NY5A 5AZFA 4EZJA 4KDLB 1WJUA 4HWIB 2ZPNA 2D3GA 2ZVNA 3PHXB 4F1SA 3P2BA 2PE6B 5DPTA 4EEWA 2VRRB 2ZCBA 2BWFA 3RULA 1UELA 4ANUA 4HLEA 4MH0E 3NHEB 3I3TB 3IBEA 1WE7A 3VHTC 2J7QB 2KQ7A 3A33B 3M62B 3ML9A 4GDLB 1ZW7A 4A20A 3H7PA 4GIVA 2KX0A 4M8NA 4DHZB 2C7NB 2L05A 3WANA 2KNBA 3X23A 5L95C 3PS6A 2G4SA 4E71A 2NVUI 1WXVA 3ZRCA 1CMXB 4KZCA 1AARA 2BYEA 4KSKC 2PPHA 2REXA 2LVPA 3A4SC 4WJOA 3H6NA 4FADA 3UIOB 1IP9A 2KFKB 1QZEA 4PS7A 2LRWA 2KJRA 2N1VA 3KYCD 1Z2MA 1TBEA 4IWPA 4CO7A 4GOCA 4N9F4 3AU4A 3R7RA 1D3ZA 3PREA 2IO1B 3V6CB 2I1KA 3PZDA 1WGDA 3DPDA 3OAWA 3CF6E 3ZTCA 5E6OA 1WX7A 2DAFA 4HDQA 3K9OB 2KTRA 2M0XA 2MP2B 4M0WB 2KJHB 4LJOB 4EOYA 2BYVE 2MBQA 4PYUA 5LXIB 3AI5A 4EUTA 2L8JA 1A5RA 4DWFA 4MJSA 4URKA 2MSED 2PJHA 4B6WA 5LLIA 2CHZA 3S2AA 4KIKA 2FIDA 4P7IA 5AZGA 1OEYJ 4KSLC 4FA6A 1WGYA 3GZNI 1JRUA 4LCDE 1L2NA 2JY6A 2KOXA 3ECIA 4XX5A 4AJYB 5JHBA 2O6VA 2GBMA 5DCNA 2DZJA 2CR5A 1V80A 2MLBA 4YL8A 1H8CA 2L76A 2FIFA 4ANVA 4W9LA 4ASWC 3TBLD 3BY4B 3L08A 1R4NI 3L0WB 5TR5A 3Q3JA 2L3ZA 2LXAA 2LZ6A 2ZCCA 3WIMA 3QK0A 2JZ3B 1IPGA 1P9DU 1NDDA 3UQBA 2DZMA 3APFA 4BBNF 4DHZE 1IYFA 2CU1A 1EO6A 2FCSA 1YD8U 1WR1A 2LGXA 3A9JA 5KHOA 2JVCA 3EECA 3ZVVA 3PGEA 2K8HA 4DDGD 3U8ZA 1I35A 2N9PC 1KJTA 1V86A 4MGIE 3M63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX6 B;  1G6J A;  2JRI B;  3A4R A;  4BOZ B;  2N7E A;  2BKF A;  1UZX B;  4K81 A;  2KHW B;  2KDB A;  3WAO A;  1V81 A;  1LFD A;  2MBO A;  5C1Z A;  2FCN A;  3AU5 A;  3PLV A;  2OOB B;  4MJS B;  1GUA B;  1WJ4 A;  3QIJ A;  4HDO A;  3TIX A;  2KDI A;  2ZVO A;  3MTN B;  2C7H A;  3QHT A;  4HCN B;  1V49 A;  4LDT D;  2ZPY A;  2KMA A;  5CHF A;  3V61 A;  4ICU A;  3W1S A;  4JL9 A;  4TV3 A;  3ONS A;  2LD9 A;  2KC1 A;  1U4A A;  2AYO B;  4ZRI A;  4GDL A;  4MEM A;  2IBI B;  4GU2 A;  3RZF A;  3CMM B;  2GBR A;  3C0R B;  4WQO B;  2KO3 A;  3ENE A;  4BKS D;  4CYE A;  2AL3 A;  3IVF A;  2KC2 A;  3VUY A;  2KDF B;  1OGW A;  1ZKH A;  5E6P A;  4AWJ A;  2KZR A;  2G45 B;  3VQI A;  4FJZ A;  3GOE A;  4RM8 A;  3H1U A;  1WRD B;  2KFK A;  2L0F A;  2LI5 A;  5G55 A;  4G3X B;  2KN5 A;  3QQ8 B;  2DZI A;  1GNU A;  3TMP B;  2MBH A;  4BFR A;  1WFY A;  2KD0 A;  2R2O A;  3HIZ A;  3L17 A;  2MP2 A;  4B9K A;  4AOF A;  1E5W A;  1V9J A;  2IY1 B;  3LJ3 A;  2KDE B;  1OEY A;  1WX9 A;  2JWZ A;  3NS8 A;  4NNJ B;  3V62 A;  1S1Q B;  1VCB A;  3DBL I;  2IZV B;  1V2Y A;  2M8S A;  2D2Q A;  5FR6 A;  2EKE C;  3L54 A;  2R2Q A;  1WX8 A;  2LVO A;  3A1Q B;  4A3P A;  5G2N A;  2KWU B;  4BVU C;  2O2V B;  2MX2 A;  4JLC A;  2BPS A;  4IWO A;  3BIN A;  2KTF A;  5CHV C;  3W1S C;  4LDT B;  2BKR B;  4ANX A;  5DPR A;  5LXH A;  1LM8 B;  2IO0 B;  2Z0D B;  2DZK A;  4NQK E;  3VH3 B;  1S3S G;  2Z59 B;  2L7R A;  4KDI C;  4MGZ E;  1WM2 A;  2WDT B;  3ZO5 B;  3K9P B;  2LVQ A;  4WWN A;  2ZNV C;  2JRH A;  4G11 A;  4MM3 A;  3VAW A;  5GMV A;  4I6N B;  2N1W A;  4W9K A;  3VDZ A;  1XT9 B;  2DHZ A;  4HJK A;  2DX5 B;  2FNJ B;  2RR9 A;  1F9J A;  3VTU A;  4MSQ B;  2XEW A;  3DQV A;  1WGG A;  1WH3 A;  2MQJ A;  4HK2 A;  2N7D A;  4WJQ A;  5D6J B;  5J2R A;  2K25 A;  4GXB A;  2L0T A;  2WWZ A;  4EFO A;  2NPT B;  4IW0 A;  2NBV B;  3WAP A;  2BGF A;  1LXD A;  1WJN A;  3N3K B;  4W9H A;  3N32 A;  2JT4 B;  3PRZ A;  5CHW A;  3H7S A;  3DCG A;  4IC7 B;  2KQS A;  1WF9 A;  1H4R A;  3ZW3 A;  3HM3 A;  2IO3 B;  1WGH A;  4K7U A;  4LJP B;  2J0J A;  4K7W A;  4FN2 A;  3DOW A;  3PV1 A;  2KWV B;  4HPM B;  1EF5 A;  1RRB A;  2WYQ A;  4BBN C;  3AXC A;  5E6N A;  3EHV A;  1WYW B;  3APD A;  2KLC A;  3NOB A;  3PT2 B;  2M4N A;  3U30 A;  5EDS A;  3OJ4 B;  2MA9 B;  2CHW A;  3V60 A;  2Z0E B;  3KVF B;  2A5U A;  3RYT A;  2K8C A;  2LGD A;  2N4F A;  5D94 A;  3RUI B;  2MRP A;  2FCQ A;  5CX3 A;  2RSU A;  2JF5 A;  2KVR A;  1XD3 B;  3PLU A;  2ASQ A;  1ZGU B;  3QAR A;  3VTV A;  1SGH A;  3A9K B;  2M17 A;  4JGH B;  4II3 B;  3M3J A;  3QX1 A;  4TQ1 A;  3EC8 A;  3NZU A;  1KOT A;  1WMH B;  2XK5 A;  4W9J A;  3B1L X;  2FAZ A;  1XQQ A;  3PHW B;  4WWO A;  3V6E B;  1ISN A;  2A4Z A;  4W9F A;  3KH0 A;  4F7Z A;  2K39 A;  4FJY A;  1E8Z A;  4NAW B;  5KHQ A;  1WR6 E;  1PQS A;  1FXT B;  3RZW C;  4OVU A;  2AL6 A;  4DK5 A;  2K1F A;  3L10 B;  2C60 A;  4W9D A;  4NJ6 A;  1E8Y A;  3B0A A;  3M95 A;  3A1Q A;  4DHJ D;  3QAQ A;  2RGF A;  1HE8 A;  3AUL A;  1K8R B;  2O2V A;  4FHJ A;  1SIF A;  3IHP C;  3KUD B;  4OVV A;  3CST A;  1TTN A;  3ALB A;  2Y5B B;  3RT3 B;  3UGB B;  2GBK A;  2M1M A;  2LXC A;  2KLG A;  2K8B A;  2D11 A;  1LQB A;  1WZ0 A;  2DEN B;  1TGZ B;  1T0Y A;  4IM0 A;  5C23 A;  2IO2 B;  5DPW A;  3U7D A;  3SHQ A;  4X57 B;  1E8X A;  2GMI C;  3KUC B;  3VUX A;  4ZDV A;  4BKS A;  4DBG A;  2LGY A;  2KJ6 A;  2V4L A;  2XK5 B;  3JYU A;  3SDL C;  1MG8 A;  3O65 B;  5IAA C;  4WWP A;  1KM7 A;  1WXM A;  3DVG X;  3ZUN A;  2J0K A;  1UBQ A;  1J0G A;  1P3Q U;  4KZ0 A;  3QC8 B;  4FJV B;  4GB9 A;  3T8M A;  4F8C B;  4AUQ C;  2NPT A;  2JZZ A;  2AWT A;  1X1M A;  3SU8 X;  2N9E B;  3JW0 X;  1GC6 A;  2C5L C;  1E90 A;  2KAN A;  2L00 B;  3WAL A;  2EMT A;  3RD2 A;  2CKH B;  4MSM B;  2RPQ A;  1WXS A;  5J17 A;  3ML8 A;  3APC A;  1EUV B;  1Q1O A;  3ZNG C;  1VD2 A;  1V6E A;  1J19 A;  4AJW A;  4TQ0 A;  2MBB B;  1WIA A;  3ZDT A;  2ZZP B;  2QHO A;  3CSF A;  3PSE B;  4GDK B;  2KX3 A;  4IUM B;  5HKH A;  2HJ8 A;  4PS8 A;  4DDI D;  4DXA B;  1P98 A;  4J6I A;  2J0M A;  3OLM D;  4K7S A;  1I42 A;  1UGM A;  2K6Q A;  3DVN U;  3KW5 B;  3MJW A;  3PRM B;  2YLM A;  3DDC B;  2BYF A;  4DHJ B;  2XBB C;  3T9L A;  4EKU A;  1E8W A;  2BF8 B;  2MW5 A;  2D10 A;  3DVN V;  2ZNV B;  3DBR I;  1C1Y B;  5JZE B;  1WE6 A;  2W9N A;  1RFA A;  3VUW A;  3QJZ A;  3DVG Y;  2N9X A;  4FBJ B;  2KFJ A;  2RD0 A;  5L83 A;  4PYZ A;  1OTR B;  2OJR A;  4GGQ A;  3VVW B;  4JQW C;  4I6L B;  3R7Q A;  2KXJ A;  1WJ6 A;  3R66 C;  3QA8 A;  4ZRJ A;  2GBN A;  1YX5 B;  2UYZ B;  3A9K A;  2KMC A;  2DYM A;  4WAA A;  2GOW A;  4E74 A;  4HPL B;  2KKC A;  3HM6 X;  1WMH A;  2I1J A;  4IG7 B;  1V5T A;  5CTR C;  4FLH A;  1WI0 A;  1OQY A;  2K6D B;  4W9E A;  1GG3 A;  3JVZ X;  3W1Y A;  3JSV B;  3QWZ B;  4EZK A;  3ZKJ C;  1GJZ A;  2EMS A;  4K1R B;  1NI2 A;  3X0W A;  4NAW A;  3MHS D;  1Q0W B;  4GSW A;  2DAJ A;  1WXA A;  2V1Y A;  4BKG A;  2O6V D;  1WY8 A;  1Z5S B;  4CHK A;  1TZ1 A;  1YJ1 A;  2FUH B;  4NPN A;  2V3S A;  4KVG B;  3IG3 A;  3PPA A;  5JHA A;  4G50 A;  4KV2 A;  4E3C A;  4M8M A;  2G4D B;  4G0N B;  3D32 A;  3VH4 B;  3ZNH B;  1SE9 A;  4A3O A;  2AEH A;  4PS3 A;  3WA0 A;  1WM3 A;  3H7P B;  5AEK B;  2LRU A;  2NBU A;  4GN1 A;  2JPH A;  1UD7 A;  3PRP B;  4W9I A;  3H9D A;  5DPS A;  4WJP A;  4I6P A;  1WZ3 A;  2FCM A;  1E7V A;  3TCA A;  2HD5 B;  2CHX A;  2MWS B;  3DBH I;  3PVL A;  4XC2 A;  3UQA A;  4W9G A;  1M94 A;  3ZNI D;  2CS4 A;  2ZJD A;  5D7G A;  3HHM A;  3LDZ E;  3TL5 A;  3HK0 A;  2G3Q B;  4IM3 A;  4II2 B;  3Q3F A;  1UH6 A;  5D2M B;  1Y8R C;  4TUU A;  2MCN B;  5JH5 C;  4BKT A;  3L13 A;  3ZRF A;  3SD5 A;  2BWE S;  4MGK E;  2KTR B;  2PEA A;  2IYD B;  1YIW A;  4AP4 C;  3RCZ A;  4NJ7 A;  2C7M B;  3ZNZ B;  4TKN A;  3R3M A;  3UIP B;  4HVB A;  1NBF C;  3ZTD A;  1E7U A;  5IA7 A;  3ZIM A;  4IM2 A;  1P0R A;  2HE7 A;  1WGR A;  3WAM A;  2HTH A;  2KWC A;  3QCA A;  4ZYN A;  4W9C A;  2MBE A;  1RLF A;  4KIK B;  5J18 A;  1BT0 A;  3NZS A;  2DYB A;  4WJN A;  2C9W B;  4GDK A;  5AZH A;  3VXW A;  4RMA A;  4ICV A;  4JIO U;  4ANW A;  2ZEQ A;  2O6V B;  1V5O A;  3UF8 A;  2DYO A;  1YQB A;  1L7Y A;  4NY0 A;  4XZ4 A;  2NR2 A;  2PE9 A;  5BO4 B;  4RM9 A;  1J8C A;  2YVC A;  1R4M I;  1GC7 A;  2JXX A;  3KUZ A;  4IWQ A;  2LUE A;  2NBW B;  2NS5 A;  3VFK A;  4GMV A;  3ZDM C;  4B95 A;  4FHK A;  1C3T A;  2LAS A;  2D07 B;  1Q5W B;  1KLV A;  3ZLZ A;  4BOS C;  3DBS A;  3IFW B;  4ZRK A;  2GBJ A;  1EF1 A;  3A9J B;  2LWP A;  2NCN A;  2KK8 A;  4MGY E;  2IY0 B;  3B08 A;  2UWQ A;  3VTW A;  4HCP B;  4EZL A;  2LJ5 A;  3PTF C;  1UBI A;  4MEL A;  3L16 A;  3KYD D;  3UIN B;  3TJP A;  4HXD A;  1RAX A;  3OJ3 A;  4FUL A;  4NQL B;  2JUO A;  2WX0 A;  2WX1 A;  4MDK E;  3JSV A;  2B3A A;  1P1A A;  3EFU A;  3N30 A;  3NY5 A;  5AZF A;  4EZJ A;  4KDL B;  1WJU A;  4HWI B;  2ZPN A;  2D3G A;  2ZVN A;  3PHX B;  4F1S A;  3P2B A;  2PE6 B;  5DPT A;  4EEW A;  2VRR B;  2ZCB A;  2BWF A;  3RUL A;  1UEL A;  4ANU A;  4HLE A;  4MH0 E;  3NHE B;  3I3T B;  3IBE A;  1WE7 A;  3VHT C;  2J7Q B;  2KQ7 A;  3A33 B;  3M62 B;  3ML9 A;  4GDL B;  1ZW7 A;  4A20 A;  3H7P A;  4GIV A;  2KX0 A;  4M8N A;  4DHZ B;  2C7N B;  2L05 A;  3WAN A;  2KNB A;  3X23 A;  5L95 C;  3PS6 A;  2G4S A;  4E71 A;  2NVU I;  1WXV A;  3ZRC A;  1CMX B;  4KZC A;  1AAR A;  2BYE A;  4KSK C;  2PPH A;  2REX A;  2LVP A;  3A4S C;  4WJO A;  3H6N A;  4FAD A;  3UIO B;  1IP9 A;  2KFK B;  1QZE A;  4PS7 A;  2LRW A;  2KJR A;  2N1V A;  3KYC D;  1Z2M A;  1TBE A;  4IWP A;  4CO7 A;  4GOC A;  4N9F 4;  3AU4 A;  3R7R A;  1D3Z A;  3PRE A;  2IO1 B;  3V6C B;  2I1K A;  3PZD A;  1WGD A;  3DPD A;  3OAW A;  3CF6 E;  3ZTC A;  5E6O A;  1WX7 A;  2DAF A;  4HDQ A;  3K9O B;  2KTR A;  2M0X A;  2MP2 B;  4M0W B;  2KJH B;  4LJO B;  4EOY A;  2BYV E;  2MBQ A;  4PYU A;  5LXI B;  3AI5 A;  4EUT A;  2L8J A;  1A5R A;  4DWF A;  4MJS A;  4URK A;  2MSE D;  2PJH A;  4B6W A;  5LLI A;  2CHZ A;  3S2A A;  4KIK A;  2FID A;  4P7I A;  5AZG A;  1OEY J;  4KSL C;  4FA6 A;  1WGY A;  3GZN I;  1JRU A;  4LCD E;  1L2N A;  2JY6 A;  2KOX A;  3ECI A;  4XX5 A;  4AJY B;  5JHB A;  2O6V A;  2GBM A;  5DCN A;  2DZJ A;  2CR5 A;  1V80 A;  2MLB A;  4YL8 A;  1H8C A;  2L76 A;  2FIF A;  4ANV A;  4W9L A;  4ASW C;  3TBL D;  3BY4 B;  3L08 A;  1R4N I;  3L0W B;  5TR5 A;  3Q3J A;  2L3Z A;  2LXA A;  2LZ6 A;  2ZCC A;  3WIM A;  3QK0 A;  2JZ3 B;  1IPG A;  1P9D U;  1NDD A;  3UQB A;  2DZM A;  3APF A;  4BBN F;  4DHZ E;  1IYF A;  2CU1 A;  1EO6 A;  2FCS A;  1YD8 U;  1WR1 A;  2LGX A;  3A9J A;  5KHO A;  2JVC A;  3EEC A;  3ZVV A;  3PGE A;  2K8H A;  4DDG D;  3U8Z A;  1I35 A;  2N9P C;  1KJT A;  1V86 A;  4MGI E;  3M63 B; 
#chains in the Genus database with same CATH topology
 1YX6 B;  2JRI B;  1CK1 A;  3NJT A;  3WAO A;  2Y5C A;  1LFD A;  3AU5 A;  1GUA B;  5BMG A;  1HZ6 A;  2KDI A;  1SIJ A;  1NI3 A;  2AQ2 B;  5CHF A;  5D3D A;  4JL9 A;  2KC1 A;  4YTM B;  1NYR A;  4ZRI A;  1L4Z B;  1QT9 A;  1ZUD 2;  3C0R B;  4C4V B;  4BKS D;  2AL3 A;  3I5J C;  3IVF A;  4LK0 M;  1IGC A;  4ARC A;  4ARI A;  3VUY A;  2V3P A;  4AWJ A;  2G45 B;  4FJZ A;  1DOX A;  1VRA B;  4RM8 A;  3H1U A;  4XDC A;  1WRD B;  2L0F A;  2LJI A;  3SFD B;  3QQ8 B;  2LMC A;  1PGB A;  3RFZ B;  3HIZ A;  1MHH E;  2QSD A;  2MP2 A;  4B9K A;  1E5W A;  1V9J A;  3LJ3 A;  2WXO A;  1OEY A;  5D3I B;  2OED A;  3BYY B;  1K53 A;  1F52 A;  1V2Y A;  5FR6 A;  3U52 E;  3L54 A;  1ZPS A;  1WX8 A;  3I57 A;  4HEA 1;  4BVU C;  2PMV A;  2QCZ A;  1MJD A;  3ZXR A;  4JLC A;  3SEB A;  4IWO A;  3W1S C;  2IO0 B;  3AE5 B;  3UI3 A;  2W82 A;  2Z59 B;  2GRI A;  4I6N B;  1SBB B;  4MSQ B;  4MAC A;  2MQJ A;  1GPX A;  1JWM D;  2K25 A;  2TSS A;  2WP9 B;  4ZHO A;  3WAP A;  3E9S A;  4DXG A;  4P6V F;  3PRZ A;  2W3S A;  1H4R A;  3ZW3 A;  1V1O A;  3T3N A;  4XWW A;  2KWV B;  4HPM B;  1RRB A;  2LFI A;  5E6N A;  1TT5 B;  2M56 B;  4B0E A;  1FRD A;  2KLC A;  2PKO A;  3NS1 A;  1TKE A;  2MA9 B;  2CHW A;  2Z0E B;  1YN5 A;  4USA A;  3AE7 B;  5D94 A;  1V1P B;  3QAR A;  4ACF A;  3EC8 A;  3Q8B A;  1WMH B;  2XK5 A;  2G1E A;  4W9J A;  1C4C A;  1XQQ A;  2A4Z A;  1WR6 E;  1F1H A;  1PGX A;  2AL6 A;  4OHJ A;  2C60 A;  1E8Y A;  5LNK 1;  2YEP F;  3QAQ A;  1HZ5 A;  4OVV A;  3UGB B;  2GBK A;  1YQ4 B;  2DEN B;  1JML A;  3GB1 A;  2QIE B;  3VUX A;  1UF0 A;  3JYU A;  3RNB C;  3O65 B;  1JRP A;  1WXM A;  3DVG X;  3ZUN A;  1P3Q U;  4KZ0 A;  4FJV B;  1V97 A;  4F8C B;  1OQR A;  2WXN A;  1X1M A;  1GC6 A;  2C5L C;  1AN8 A;  3WAL A;  2EMT A;  4CQN A;  1WXS A;  3ML8 A;  1Q1O A;  4Q2J A;  1VD2 A;  5EE1 A;  3ZNG C;  1TY2 A;  2MBB B;  1WIA A;  2KX3 A;  2HJ8 A;  4J6I A;  1UWM A;  2V9H A;  3R2T A;  4K7S A;  1I42 A;  4RFB A;  2K6Q A;  4S17 A;  3PRM B;  2YLM A;  3DDC B;  4DHJ B;  3T9L A;  2D10 A;  3DVN V;  1C1Y B;  1QQR A;  2QDF A;  5JZE B;  1WE6 A;  1SF0 A;  2W9N A;  3QJZ A;  1QOG A;  4FBJ B;  3EUB 2;  2OJR A;  3R7Q A;  3AE2 B;  4ZRJ A;  2GBN A;  1YX5 B;  1VJK A;  4XDD A;  2GOW A;  4HPL B;  1WMH A;  3E56 A;  4IG7 B;  1L5P A;  3W1Y A;  1M4V A;  3QWZ B;  2WU5 B;  1GJZ A;  2EMS A;  1NI2 A;  2RPV A;  1IGD A;  4LNI A;  2V1Y A;  4BKG A;  1Z5S B;  1FEH A;  1XLN A;  1C78 A;  4CHK A;  2IGG A;  1YJ1 A;  2KQ4 X;  2V3S A;  4KVG B;  3PPA A;  4G50 A;  4KV2 A;  4M8M A;  4S0R A;  3R8B A;  3Q3O C;  3H8H A;  4P1C C;  5DPS A;  1WZ3 A;  3BK1 A;  2L52 A;  3DBL B;  3RNE C;  1M94 A;  2CS4 A;  5D7G A;  3LDZ E;  3W5U B;  1Y8R C;  2SAK A;  4TUU A;  2MCN B;  1IUE A;  2QEJ C;  1L6U A;  4BKT A;  4RF0 A;  2BWE S;  2DWQ A;  3WCQ A;  2KTR B;  5BMI A;  4AP4 C;  2SEB D;  3RCZ A;  2WDQ B;  4TKN A;  3V05 A;  1P0R A;  2LUM A;  1WGR A;  1QOB A;  3N20 C;  2KWC A;  4ZYN A;  2MBE A;  4KIK B;  3DWG C;  1MFW A;  1HTO A;  4ICV A;  2ZEQ A;  1L7Y A;  2CJO A;  4XZ4 A;  2EKI A;  2OJW A;  4BZA A;  1C3T A;  1ET6 A;  3A9J B;  2LWP A;  2KK8 A;  4HCP B;  2B76 B;  2GB1 A;  1TS3 A;  2LGI A;  4NQL B;  2JUO A;  2WX0 A;  2WX1 A;  4MDK E;  1K52 A;  1MVK A;  4KDL B;  2MJD A;  3PHX B;  4F1S A;  1Y56 A;  5T8I A;  4EEW A;  1T0S C;  2ZCB A;  3Q8E A;  3P4R B;  2KQ7 A;  3B2G A;  4GIV A;  4REZ A;  2KX0 A;  1XEE A;  2K22 A;  3TEZ A;  1HA5 A;  2K3U A;  3TUO A;  1DOY A;  3U7Z A;  3ZRC A;  1JQ4 A;  2REX A;  2JYT A;  3H6N A;  4WJO A;  5IKC M;  1QZE A;  2MHJ A;  3KYC D;  2KJR A;  1I4X A;  1Z2M A;  1J7A A;  2INN E;  1E0Z A;  2IO1 B;  3OAW A;  1WGD A;  3ZTC A;  3AE1 B;  2L1A A;  3AE3 B;  2KTR A;  2M0X A;  2BYV E;  4PYU A;  1GB1 A;  1SE2 A;  1A5R A;  4DWF A;  4KIK A;  1V8C A;  3VRA B;  3GZN I;  1YNT E;  4XX5 A;  5DCN A;  2DZJ A;  2MLB A;  1T0Q C;  1H8C A;  4QAY A;  1N63 A;  5EE0 A;  2E3T A;  4ASW C;  3BVG A;  3NRZ A;  3RPF C;  2L3Z A;  2ZCC A;  4MT5 A;  2JZ3 B;  1NDD A;  3IT6 B;  3UQB A;  4BBN F;  3B9J A;  1YD8 U;  3A9J A;  3ZVV A;  3U8Z A;  3EGR A;  1G6J A;  4BOZ B;  4K81 A;  2WS3 B;  2KDB A;  1V81 A;  2FCN A;  4MJS B;  2OOB B;  2JX5 A;  5BYS A;  3DBR B;  3MTN B;  1N6Z A;  2C7H A;  2NTS A;  2AX5 A;  4LDT D;  3V61 A;  1FFU A;  2ZW1 A;  2W54 A;  2FE8 A;  1U4A A;  4RH6 A;  2AYO B;  4JWU C;  2IBI B;  4N6E B;  3Q2A C;  4WQO B;  3ENE A;  1RFK A;  4CYE A;  2BS4 B;  5IP4 D;  2WXM A;  4HRS A;  1OGW A;  1ROE A;  5IOI A;  5G55 A;  2LI5 A;  2ON8 A;  1WGK A;  3NVZ A;  2KN5 A;  3TMP B;  2MBH A;  4BFR A;  1WFY A;  2R2O A;  2QJL A;  2IY1 B;  2KDE B;  3TSS A;  1WX9 A;  2JWZ A;  4NNJ B;  3V62 A;  3BK2 A;  2LGS A;  2WU2 B;  1TJE A;  2N0S B;  3IAM 1;  5I4D A;  4XE0 A;  2JQR B;  4A3P A;  2MX2 A;  5CHV C;  1UGJ A;  3W5V B;  1E9M A;  4ANX A;  5FR3 A;  2Z0D B;  1KF6 B;  4HRO A;  3K9P B;  4C56 C;  4WAF A;  2V4I B;  4W9K A;  1DOI A;  2FNJ B;  2RR9 A;  1F9J A;  2XEW A;  1WGG A;  4HK2 A;  5TSS A;  4GXB A;  1XCT L;  1N5X A;  2L0T A;  2WXQ A;  2NPT B;  3AE8 B;  2NBV B;  3N3K B;  4W9H A;  4M02 A;  2JT4 B;  1R4M B;  3H7S A;  1WGH A;  5GXG B;  2BB6 A;  4K7U A;  4K7W A;  3PO0 A;  1VR9 A;  4BBN C;  4LNN A;  1TZO A;  3NOB A;  1T3Q A;  3T3O A;  3LYY A;  3U30 A;  5EDS A;  5FK9 C;  3V60 A;  1YJI A;  4NZL B;  1F0Z A;  1LO5 D;  2N4F A;  2FCQ A;  3DHI C;  4DXF A;  1EWC A;  1XD3 B;  2Y5P A;  4JGH B;  3QX1 A;  1JAL A;  5HHD G;  5IN7 A;  3NZU A;  1P7E A;  4TSS A;  2FAZ A;  4WWO A;  2HDE A;  4F7Z A;  2K39 A;  4NAW B;  1PUT A;  4OVU A;  3DHG C;  3L10 B;  3FC4 A;  5G5G A;  4JWS C;  3M95 A;  3ALB A;  4XGA B;  4RNA A;  2Z8L A;  4IM0 A;  5C23 A;  4XYC A;  3SHQ A;  1B9R A;  2GMI C;  4RCO A;  1NEK B;  3KUC B;  4ZDV A;  4BKS A;  3BVZ A;  2LGY A;  2XK5 B;  1MG8 A;  3MFG A;  1JCK B;  2J0K A;  2WGS A;  4C7Y A;  4UDU C;  1C9F A;  2IDY A;  4AUQ C;  2NPT A;  2JZZ A;  4LNK A;  2N9E B;  1R4N B;  1E90 A;  1KH0 A;  2KAN A;  2L00 B;  2MEK A;  3NUH B;  4ZOH C;  2CKH B;  2RPQ A;  1YMH E;  1V6E A;  4YSZ B;  4LLG M;  3ZDT A;  2VH2 A;  3FKY A;  4GDK B;  2L32 A;  3PSE B;  5HKH A;  2J0M A;  1EU4 A;  1T0R C;  4C00 A;  2BYF A;  2MW5 A;  4KKI A;  2BBC A;  2PVG C;  4C7Z A;  3AED B;  1RFA A;  2KFJ A;  2IND C;  4GGQ A;  3VVW B;  2KXJ A;  1LGR A;  4LTU A;  3R66 C;  3QA8 A;  2KMC A;  2DYM A;  4JE3 B;  4E74 A;  2KKC A;  4C80 A;  1V5T A;  5CTR C;  4FLH A;  1CJE A;  1GG3 A;  4M01 A;  4K1R B;  3X0W A;  4NAW A;  5AUI A;  1Q0W B;  4GSW A;  1AW7 A;  1KFY B;  2O6V D;  1WY8 A;  3Q3N C;  2I2Y A;  1TZ1 A;  1K51 A;  3IG3 A;  3RNA C;  1SSN A;  5JHA A;  1L0X B;  2G4D B;  4G0N B;  1SE9 A;  4A3O A;  2AEH A;  4KGT A;  4PS3 A;  2CU3 A;  3WA0 A;  3H7P B;  3P42 A;  4WJP A;  2MWS B;  3AMZ A;  3PVL A;  4XC2 A;  4W9G A;  2ZJD A;  3HHM A;  2JSV X;  1SJE D;  3TL5 A;  2G3Q B;  4IM3 A;  2NTT A;  3Q3F A;  1UH6 A;  5D2M B;  4ZRP A;  5JH5 C;  2K5P A;  4HPP A;  3ETR A;  2WLB A;  3KQ4 A;  4M00 A;  1N5W A;  1N61 A;  2C7M B;  3LB8 C;  3ZTD A;  3RN9 C;  3WAM A;  1NYQ A;  5J18 A;  1BT0 A;  3MJ5 A;  3I9V 1;  3VXW A;  4GDK A;  2QIL A;  4NY0 A;  2NR2 A;  1NVI D;  4RM9 A;  1CQV A;  4L1B A;  2JXX A;  4N58 A;  4IWQ A;  1ZOY B;  3ZDM C;  1N60 A;  4FHK A;  3ZLZ A;  3DBS A;  1VZ7 A;  3IFW B;  5IO9 A;  2NCN A;  4MGY E;  2UWQ A;  3N1Y C;  3VTW A;  1STE A;  2KWD A;  3L16 A;  2MH7 A;  4O1N A;  4YSY B;  1P1A A;  3NY5 A;  5H92 C;  2RMM A;  2PE6 B;  5DPT A;  1QOA A;  3RUL A;  3NHE B;  3I3T B;  3P1M A;  2J7Q B;  1FPY A;  3H7P A;  4M8N A;  4DHZ B;  1B1Z A;  2C7N B;  4OZA A;  2KNB A;  3X23 A;  3P63 A;  1JWU D;  5L95 C;  2IGD A;  3HRD D;  3B2F A;  1MHX A;  1MPE A;  3HVD A;  3J9C A;  4RF1 A;  4FAD A;  3URY A;  2KN4 A;  2N1V A;  4CO7 A;  3R7R A;  2BYT A;  3SFE B;  3AEA B;  1WX7 A;  1FRR A;  3IT4 B;  2KJH B;  4LJO B;  2MBQ A;  1YJJ A;  3AI5 A;  4LNF A;  2KAC A;  1P7F A;  4JPS A;  4ITK A;  5AUK A;  4URK A;  2PJH A;  4B6W A;  5LLI A;  4EE2 A;  4LCD E;  1L2N A;  1QIL A;  1C77 A;  3ECI A;  2Y3A A;  2GBM A;  4YL8 A;  3MC8 A;  4ANV A;  4PK1 A;  4OVZ A;  3L0W B;  3N9Y C;  5TR5 A;  4L2Y A;  2DBY A;  4MM3 B;  2K0P A;  4N59 A;  2BVC A;  3DHH C;  1YOV B;  2FCS A;  1WR1 A;  1K50 A;  3TEX A;  2LGX A;  1WYG A;  2KAJ A;  3PGE A;  1FNU A;  1I35 A;  4MGI E;  3M63 B;  1PGA A;  3A4R A;  5HG2 A;  2BKF A;  1UZX B;  2MBO A;  1SJH D;  3PLV A;  1VDV A;  3QIJ A;  4HDO A;  2ZVO A;  3QHT A;  2ZPY A;  4ICU A;  4TV3 A;  3ONS A;  4KGS A;  2GI9 A;  4GU2 A;  3RZF A;  3CMM B;  2KO3 A;  3NZ3 A;  2X8X X;  2KDF B;  1JWA D;  3NVY A;  3GOE A;  3Q6B A;  2G9H D;  2DZI A;  1GNU A;  1ZE3 D;  2KD0 A;  2AQ3 B;  2WXJ A;  1DGJ A;  3L17 A;  5MPO A;  3P4P B;  4YTN B;  3NG0 A;  1S1Q B;  1VCB A;  3DBL I;  2IJ0 A;  2WXP A;  3DBH B;  2D2Q A;  1WRI A;  2EKE C;  4RGO S;  2LVO A;  3A1Q B;  4JX1 C;  1E6E B;  2KWU B;  1KTK A;  3BIN A;  4A9A A;  4LDT B;  2BKR B;  1SB3 C;  1UNS A;  5LXH A;  1LM8 B;  4NQK E;  4ZHP A;  3VH3 B;  4MGZ E;  2L7R A;  3NVV A;  4KDI C;  1WM2 A;  2WDT B;  3ZO5 B;  2LVQ A;  4WWN A;  2ZNV C;  2JRH A;  4G11 A;  4MM3 A;  5BMH A;  3BYT B;  2N1W A;  1UUP A;  3VDZ A;  2DX5 B;  1WH3 A;  5J2R A;  4EFO A;  2WWZ A;  1FCC C;  2I38 A;  1LXD A;  3EA6 A;  1WJN A;  4AQ7 A;  2FBW B;  4ZRQ A;  3DCG A;  1QLB B;  4AS1 A;  2KQS A;  1WF9 A;  2IO3 B;  3ZGZ A;  3CIR B;  4LJP B;  3DOW A;  3PV1 A;  2QC8 A;  1J7B A;  1EF5 A;  3AXC A;  3W9C B;  1WYW B;  3PT2 B;  3RMK C;  4RGT A;  4YXD B;  3BZD B;  2A5U A;  1Q10 A;  3DWM A;  2HJ1 A;  4B0M A;  5CX3 A;  2JF5 A;  2ASQ A;  1SGH A;  2M17 A;  1I4G A;  4II3 B;  4TQ1 A;  2BT6 A;  4KGR A;  1KOT A;  3LXF A;  3R2I A;  3B1L X;  1T5X D;  3FAH A;  3PHW B;  3V6E B;  4WIP A;  1ISN A;  4W9F A;  4FJY A;  1C4P A;  1E8Z A;  3MP9 A;  1XF5 L;  1BML C;  1PQS A;  3RZW C;  3GE8 C;  4DK5 A;  2K1F A;  4W9D A;  4NJ6 A;  3B0A A;  3A1Q A;  2BTE A;  2RGF A;  1HE8 A;  1NEN B;  1FD6 A;  1K8R B;  1FO4 A;  1SIF A;  3KUD B;  2Y5B B;  3RT3 B;  2WDR B;  2M1M A;  2W55 A;  2D11 A;  1LQB A;  1WZ0 A;  4K3B A;  1TGZ B;  1T0Y A;  2RDG A;  2IO2 B;  2PVO D;  5DPW A;  3U7D A;  4WUR A;  3KLS X;  2KJ6 A;  1WXQ A;  2V4L A;  2ACZ B;  3MC9 A;  3SDL C;  3TEW A;  4KX6 B;  5IAA C;  4WWP A;  5EE9 A;  4R3D A;  1UBQ A;  1J0G A;  1ENF A;  2V0G A;  3QC8 B;  2JU6 X;  4GB9 A;  2OHF A;  1JRO A;  1GB4 A;  1D5M C;  2NMQ A;  5J17 A;  2IPK D;  4BAX A;  1J19 A;  4TQ0 A;  1BUI C;  2QHO A;  3CSF A;  2D3B A;  4IUM B;  2WDV B;  3EFC A;  3BII D;  1JW9 D;  4DXA B;  1P98 A;  3U4E G;  1IBX B;  1ZDV A;  4P1B C;  1UGM A;  3DVN U;  3MJW A;  1XLQ A;  2J4X A;  2R61 A;  3DBR I;  1ESF A;  3VUW A;  3Q8F A;  2N9X A;  5L83 A;  1OTR B;  1GAQ B;  4JQW C;  1WJ6 A;  3ZYY X;  1HQR D;  2UYZ B;  1DYQ A;  3HM6 X;  2I1J A;  1WI0 A;  1OQY A;  2K6D B;  4W9E A;  3JVZ X;  3JSV B;  4EZK A;  1WXA A;  4H2A A;  2MJE A;  4NPN A;  4E3C A;  3D32 A;  1RYJ A;  3ZNH B;  2WXK A;  5BYQ A;  1WM3 A;  2WHI A;  5AEK B;  1ZXH A;  2UU7 A;  2JZP A;  3PRP B;  3H9D A;  1WWT A;  1E7V A;  3TCA A;  3ZQ4 A;  5HFY A;  3UQA A;  1SE3 A;  2QMT A;  3HK0 A;  4II2 B;  1AWD A;  1N62 A;  3IAS 1;  4MGK E;  3BWU D;  2IYD B;  1YIW A;  3Q69 A;  2DLB A;  2INC C;  3ZNZ B;  2PIA A;  3ZIM A;  4IM2 A;  1L6V A;  1HEZ E;  2HTH A;  2RDH A;  3QCA A;  4W9C A;  3Q14 C;  3AV8 A;  1RLF A;  2GLS A;  3NZS A;  2DYB A;  5AZH A;  1UWX A;  4RMA A;  4ANW A;  2O6V B;  2AQ1 B;  3UF8 A;  1IBX A;  1QOF A;  1J8C A;  3AEG B;  5HI1 A;  2YVC A;  1L0V B;  1R4M I;  2IGH A;  1GC7 A;  2N9K A;  3KUZ A;  2LUE A;  2NBW B;  2NS5 A;  3VFK A;  4B95 A;  2N7J A;  2D07 B;  2LAS A;  1Q5W B;  3TEY A;  2WXI A;  2GBJ A;  4YWG G;  2IY0 B;  3B08 A;  3KWV A;  4EZL A;  1TS5 A;  2LJ5 A;  3PTF C;  1UBI A;  1FIQ A;  3AEC B;  3KYD D;  3UIN B;  3TJP A;  1RAX A;  4FUL A;  4P16 A;  2WQY B;  4GLS C;  3JSV A;  2B3A A;  3EFU A;  3FIL B;  1XLP A;  3OG5 A;  1WJU A;  2VZK B;  4HWI B;  2ZPN A;  3AM9 A;  3HVZ A;  1VLB A;  2KMM A;  3P2B A;  1ZP0 B;  2BQQ A;  2BWF A;  4D2K A;  1UEL A;  4ANU A;  4HLE A;  1D6E C;  4DQO C;  1I4H A;  3IBE A;  3VHT C;  1J7C A;  3M62 B;  3A33 B;  4GDL B;  3ML9 A;  1ZW7 A;  4A20 A;  1A70 A;  1HTQ A;  2ICI A;  3AE6 B;  3AEF B;  1VZ6 A;  2L05 A;  3WAN A;  2G4S A;  4HJG E;  4WWM A;  1WXV A;  4KZC A;  1AAR A;  2BYE A;  2CJN A;  2LVP A;  4A6Q A;  2KFK B;  1FNW A;  4IWP A;  2E6X A;  4GOC A;  4HKQ A;  3N1X C;  2BS3 B;  1D3Z A;  3V6C B;  3AEE B;  2I1K A;  3CF6 E;  2DAF A;  1F2R C;  3K9O B;  2VH1 A;  4M0W B;  5C3J B;  3RNG C;  4L23 A;  3Q8A A;  4FXC A;  5LXI B;  2JYE A;  2L8J A;  1T6B X;  2MSE D;  2CHZ A;  3AE4 B;  1OEY J;  4KSL C;  4YSX B;  1JRU A;  2KOX A;  3GP7 A;  4AJY B;  4OZB A;  2O6V A;  2CR5 A;  1KRH A;  2INP E;  4HKZ E;  1E10 A;  4W9L A;  5G5H A;  2DNF A;  3BY4 B;  1MG4 A;  3TBL D;  1R4N I;  2ONQ A;  2JWU A;  2LXA A;  1D5X C;  2LZ6 A;  3Q3J A;  3QK0 A;  1IPG A;  4C4V A;  1P9D U;  3OWE B;  3APF A;  2VZK D;  2CU1 A;  1EO6 A;  5KHO A;  2JVC A;  3P4S B;  2K8H A;  4DDG D;  4WH4 A;  1KJT A;  1V86 A;  2N7E A;  3IXS A;  3AB5 A;  2KHW B;  5C1Z A;  3FIL A;  1WJ4 A;  1JWB D;  3TIX A;  2JXT A;  4YT0 B;  1F2R I;  4HCN B;  1V49 A;  2BB5 A;  3W1S A;  2KMA A;  1PFD A;  2LD9 A;  4GDL A;  4MEM A;  3I63 C;  2GBR A;  4OW0 A;  1SE4 A;  4IDI A;  1FM0 D;  2KDM A;  2KC2 A;  3O13 A;  4US8 A;  1ZKH A;  5E6P A;  2KZR A;  3VQI A;  2BW2 A;  4A90 A;  2KFK A;  4G3X B;  2J53 A;  1L0Y B;  4WQM A;  4IOI E;  4M0W A;  4AOF A;  1KLU D;  3NS8 A;  4J3O D;  1RWS A;  2IZV B;  2M8S A;  1OFF A;  2R2Q A;  5G2N A;  5C2T B;  2O2V B;  2BPS A;  3SR6 A;  2KTF A;  1FNV A;  5DPR A;  4NAM A;  2DZK A;  2KVZ A;  5EE3 A;  1S3S G;  4LNO A;  1R7S A;  3VAW A;  5GMV A;  5BYR A;  1XT9 B;  2DHZ A;  4HJK A;  1V1P A;  3VTU A;  1GOZ A;  3DQV A;  1TYG B;  4WJQ A;  2N7D A;  1TKY A;  5D6J B;  1C76 A;  4IW0 A;  3Q8C A;  2BGF A;  3N32 A;  5CHW A;  3NVW A;  4IC7 B;  3HM3 A;  4KKJ A;  2J0J A;  4FN2 A;  5JXV A;  1ZXI A;  2WYQ A;  4RGM A;  3EHV A;  2WXR A;  5FKA C;  3APD A;  2M4N A;  3OJ4 B;  3L4P A;  2EEL A;  3KVF B;  3RYT A;  2K8C A;  2LGD A;  2YEP B;  3RUI B;  2MRP A;  4OZC A;  2RSU A;  2KVR A;  3PLU A;  1ZGU B;  1I7H A;  3VTV A;  1EM7 A;  3A9K B;  3M3J A;  1FMA D;  3ZXV A;  4US9 A;  3C19 A;  3ZJV A;  3GS2 A;  3VR9 B;  4MH8 A;  3KH0 A;  2KT7 A;  5KHQ A;  1FXT B;  1OQQ A;  1I4R A;  3CWI A;  3BVM A;  3PZ7 A;  4DHJ D;  1TS4 A;  3AUL A;  2O2V A;  3HUI A;  4FHJ A;  3IHP C;  3CST A;  1TTN A;  1D4B A;  1KLG D;  2LXC A;  2KLG A;  2K8B A;  3RNC C;  2J42 A;  4X57 B;  1E8X A;  3P4Q B;  4DBG A;  2HTM E;  1C79 A;  1KM7 A;  3GZN B;  2RDB C;  3AEB B;  4A55 A;  4NJC A;  3T8M A;  2AWT A;  3SU8 X;  3JW0 X;  2M0A A;  4TMA B;  4MSM B;  3RD2 A;  1XCQ L;  2H88 B;  3APC A;  4RGN A;  1EUV B;  2BS2 B;  4AJW A;  2ZZP B;  1AYF A;  2PTL A;  4PS8 A;  4DDI D;  3VR8 B;  3OLM D;  3W2D A;  1RM6 C;  3KW5 B;  2XBB C;  4EKU A;  1E8W A;  2BF8 B;  2FUG 1;  1WSP A;  2ZNV B;  1ACC A;  2XNA C;  2LHE A;  1FFV A;  3DVG Y;  1QF6 A;  2RD0 A;  4PYZ A;  1FCL A;  4I6L B;  1CZP A;  3A9K A;  4IKG A;  2D5G A;  2J52 A;  4WAA A;  1TY0 A;  3RNF C;  3ZKJ C;  3AN1 A;  3MHZ A;  3MHS D;  2DAJ A;  2FUH B;  3Q3M C;  3AE9 B;  2PW9 A;  3RI7 C;  3VH4 B;  4A8X C;  2XN9 C;  2LRU A;  2NBU A;  4GN1 A;  2JPH A;  1UD7 A;  4W9I A;  4I6P A;  1XXG A;  3ZJU A;  2FCM A;  2HD5 B;  2CHX A;  3MC0 B;  3DBH I;  1JWS D;  1FXI A;  3ZNI D;  1E7P B;  2V3N A;  2L83 A;  3L13 A;  3ZRF A;  3SD5 A;  1C4A A;  2PEA A;  2H89 B;  2LHD A;  4NJ7 A;  3R3M A;  3UIP B;  4K3C A;  4HVB A;  1NBF C;  2WXG A;  1E7U A;  4ZYS A;  5IA7 A;  2HE7 A;  1FXA A;  1YN4 A;  2D3C A;  4WJN A;  1PDX A;  2C9W B;  1XLO A;  4JIO U;  2LEK A;  1YN3 A;  1V5O A;  2DYO A;  1YQB A;  3VRB B;  2W3R A;  2WXL A;  1ZDX A;  2PE9 A;  5BO4 B;  1ET9 A;  2N9L A;  4GMV A;  2WXH A;  1F77 A;  1KLV A;  2Q5W D;  1I4P A;  4BOS C;  3U2S C;  1BXT A;  2WXF A;  4ZRK A;  1EF1 A;  2D3A A;  1TKG A;  4MEL A;  4HXD A;  3OJ3 A;  3V3X A;  3N30 A;  5AZF A;  4EZJ A;  2D3G A;  2ZVN A;  3ABV B;  2VRR B;  2PLP A;  3PZ8 A;  4MH0 E;  1WE7 A;  1EWY C;  1SXT A;  1MI0 A;  3PS6 A;  4E71 A;  2NVU I;  5E6J A;  1CMX B;  4PT5 A;  2MJ3 A;  4KSK C;  2PPH A;  3KWL A;  3A4S C;  3UIO B;  1IP9 A;  3AH7 A;  4PS7 A;  2LRW A;  1TBE A;  2K9X A;  3N1Z C;  4N9F 4;  4YTP B;  3AU4 A;  1TIF A;  3PRE A;  1QKZ A;  3DPD A;  2ZW0 A;  3PZD A;  2M19 A;  5E6O A;  4HDQ A;  1L4D B;  2MP2 B;  2WNM A;  4EOY A;  4EUT A;  4MJS A;  1EU3 A;  3S2A A;  2FID A;  4P7I A;  5AZG A;  4FA6 A;  1WGY A;  2JY6 A;  1SEB D;  1HXY D;  2X38 A;  5JHB A;  1V80 A;  2L76 A;  2FIF A;  1VZ8 A;  1YQ3 B;  3L08 A;  5H8Y E;  3WIM A;  1D5Z C;  1XO3 A;  2DZM A;  4DHZ E;  1PYW D;  1I4Q A;  1IYF A;  3GE3 C;  2KYW A;  1TS2 A;  3ZJT A;  3C8Y A;  3EEC A;  4XWT A;  2N9P C; 
#chains in the Genus database with same CATH homology
 1YX6 B;  1G6J A;  2JRI B;  3A4R A;  4BOZ B;  2N7E A;  2BKF A;  1UZX B;  4K81 A;  2KHW B;  2KDB A;  3WAO A;  1V81 A;  1LFD A;  2MBO A;  5C1Z A;  2FCN A;  3AU5 A;  3PLV A;  2OOB B;  4MJS B;  1GUA B;  1WJ4 A;  3QIJ A;  4HDO A;  3TIX A;  2KDI A;  2ZVO A;  3MTN B;  2C7H A;  3QHT A;  4HCN B;  1V49 A;  4LDT D;  2ZPY A;  2KMA A;  5CHF A;  3V61 A;  4ICU A;  3W1S A;  4JL9 A;  4TV3 A;  3ONS A;  2LD9 A;  2KC1 A;  1U4A A;  2AYO B;  4ZRI A;  4GDL A;  4MEM A;  2IBI B;  4GU2 A;  3RZF A;  3CMM B;  2GBR A;  3C0R B;  4WQO B;  2KO3 A;  3ENE A;  4BKS D;  4CYE A;  2AL3 A;  3IVF A;  2KC2 A;  3VUY A;  2KDF B;  1OGW A;  1ZKH A;  5E6P A;  4AWJ A;  2KZR A;  2G45 B;  3VQI A;  4FJZ A;  3GOE A;  4RM8 A;  3H1U A;  1WRD B;  2KFK A;  2L0F A;  2LI5 A;  5G55 A;  4G3X B;  2KN5 A;  3QQ8 B;  2DZI A;  1GNU A;  3TMP B;  2MBH A;  4BFR A;  1WFY A;  2KD0 A;  2R2O A;  3HIZ A;  3L17 A;  2MP2 A;  4B9K A;  4AOF A;  1E5W A;  1V9J A;  2IY1 B;  3LJ3 A;  2KDE B;  1OEY A;  1WX9 A;  2JWZ A;  3NS8 A;  4NNJ B;  3V62 A;  1S1Q B;  1VCB A;  3DBL I;  2IZV B;  1V2Y A;  2M8S A;  2D2Q A;  5FR6 A;  2EKE C;  3L54 A;  2R2Q A;  1WX8 A;  2LVO A;  3A1Q B;  4A3P A;  5G2N A;  2KWU B;  4BVU C;  2O2V B;  2MX2 A;  4JLC A;  2BPS A;  4IWO A;  3BIN A;  2KTF A;  5CHV C;  3W1S C;  4LDT B;  2BKR B;  4ANX A;  5DPR A;  5LXH A;  1LM8 B;  2IO0 B;  2Z0D B;  2DZK A;  4NQK E;  3VH3 B;  1S3S G;  2Z59 B;  2L7R A;  4KDI C;  4MGZ E;  1WM2 A;  2WDT B;  3ZO5 B;  3K9P B;  2LVQ A;  4WWN A;  2ZNV C;  2JRH A;  4G11 A;  4MM3 A;  3VAW A;  5GMV A;  4I6N B;  2N1W A;  4W9K A;  3VDZ A;  1XT9 B;  2DHZ A;  4HJK A;  2DX5 B;  2FNJ B;  2RR9 A;  1F9J A;  3VTU A;  4MSQ B;  2XEW A;  3DQV A;  1WGG A;  1WH3 A;  2MQJ A;  4HK2 A;  2N7D A;  4WJQ A;  5D6J B;  5J2R A;  2K25 A;  4GXB A;  2L0T A;  2WWZ A;  4EFO A;  2NPT B;  4IW0 A;  2NBV B;  3WAP A;  2BGF A;  1LXD A;  1WJN A;  3N3K B;  4W9H A;  3N32 A;  2JT4 B;  3PRZ A;  5CHW A;  3H7S A;  3DCG A;  4IC7 B;  2KQS A;  1WF9 A;  1H4R A;  3ZW3 A;  3HM3 A;  2IO3 B;  1WGH A;  4K7U A;  4LJP B;  2J0J A;  4K7W A;  4FN2 A;  3DOW A;  3PV1 A;  2KWV B;  4HPM B;  1EF5 A;  1RRB A;  2WYQ A;  4BBN C;  3AXC A;  5E6N A;  3EHV A;  1WYW B;  3APD A;  2KLC A;  3NOB A;  3PT2 B;  2M4N A;  3U30 A;  5EDS A;  3OJ4 B;  2MA9 B;  2CHW A;  3V60 A;  2Z0E B;  3KVF B;  2A5U A;  3RYT A;  2K8C A;  2LGD A;  2N4F A;  5D94 A;  3RUI B;  2MRP A;  2FCQ A;  5CX3 A;  2RSU A;  2JF5 A;  2KVR A;  1XD3 B;  3PLU A;  2ASQ A;  1ZGU B;  3QAR A;  3VTV A;  1SGH A;  3A9K B;  2M17 A;  4JGH B;  4II3 B;  3M3J A;  3QX1 A;  4TQ1 A;  3EC8 A;  3NZU A;  1KOT A;  1WMH B;  2XK5 A;  4W9J A;  3B1L X;  2FAZ A;  1XQQ A;  3PHW B;  4WWO A;  3V6E B;  1ISN A;  2A4Z A;  4W9F A;  3KH0 A;  4F7Z A;  2K39 A;  4FJY A;  1E8Z A;  4NAW B;  5KHQ A;  1WR6 E;  1PQS A;  1FXT B;  3RZW C;  4OVU A;  2AL6 A;  4DK5 A;  2K1F A;  3L10 B;  2C60 A;  4W9D A;  4NJ6 A;  1E8Y A;  3B0A A;  3M95 A;  3A1Q A;  4DHJ D;  3QAQ A;  2RGF A;  1HE8 A;  3AUL A;  1K8R B;  2O2V A;  4FHJ A;  1SIF A;  3IHP C;  3KUD B;  4OVV A;  3CST A;  1TTN A;  3ALB A;  2Y5B B;  3RT3 B;  3UGB B;  2GBK A;  2M1M A;  2LXC A;  2KLG A;  2K8B A;  2D11 A;  1LQB A;  1WZ0 A;  2DEN B;  1TGZ B;  1T0Y A;  4IM0 A;  5C23 A;  2IO2 B;  5DPW A;  3U7D A;  3SHQ A;  4X57 B;  1E8X A;  2GMI C;  3KUC B;  3VUX A;  4ZDV A;  4BKS A;  4DBG A;  2LGY A;  2KJ6 A;  2V4L A;  2XK5 B;  3JYU A;  3SDL C;  1MG8 A;  3O65 B;  5IAA C;  4WWP A;  1KM7 A;  1WXM A;  3DVG X;  3ZUN A;  2J0K A;  1UBQ A;  1J0G A;  1P3Q U;  4KZ0 A;  3QC8 B;  4FJV B;  4GB9 A;  3T8M A;  4F8C B;  4AUQ C;  2NPT A;  2JZZ A;  2AWT A;  1X1M A;  3SU8 X;  2N9E B;  3JW0 X;  1GC6 A;  2C5L C;  1E90 A;  2KAN A;  2L00 B;  3WAL A;  2EMT A;  3RD2 A;  2CKH B;  4MSM B;  2RPQ A;  1WXS A;  5J17 A;  3ML8 A;  3APC A;  1EUV B;  1Q1O A;  3ZNG C;  1VD2 A;  1V6E A;  1J19 A;  4AJW A;  4TQ0 A;  2MBB B;  1WIA A;  3ZDT A;  2ZZP B;  2QHO A;  3CSF A;  3PSE B;  4GDK B;  2KX3 A;  4IUM B;  5HKH A;  2HJ8 A;  4PS8 A;  4DDI D;  4DXA B;  1P98 A;  4J6I A;  2J0M A;  3OLM D;  4K7S A;  1I42 A;  1UGM A;  2K6Q A;  3DVN U;  3KW5 B;  3MJW A;  3PRM B;  2YLM A;  3DDC B;  2BYF A;  4DHJ B;  2XBB C;  3T9L A;  4EKU A;  1E8W A;  2BF8 B;  2MW5 A;  2D10 A;  3DVN V;  2ZNV B;  3DBR I;  1C1Y B;  5JZE B;  1WE6 A;  2W9N A;  1RFA A;  3VUW A;  3QJZ A;  3DVG Y;  2N9X A;  4FBJ B;  2KFJ A;  2RD0 A;  5L83 A;  4PYZ A;  1OTR B;  2OJR A;  4GGQ A;  3VVW B;  4JQW C;  4I6L B;  3R7Q A;  2KXJ A;  1WJ6 A;  3R66 C;  3QA8 A;  4ZRJ A;  2GBN A;  1YX5 B;  2UYZ B;  3A9K A;  2KMC A;  2DYM A;  4WAA A;  2GOW A;  4E74 A;  4HPL B;  2KKC A;  3HM6 X;  1WMH A;  2I1J A;  4IG7 B;  1V5T A;  5CTR C;  4FLH A;  1WI0 A;  1OQY A;  2K6D B;  4W9E A;  1GG3 A;  3JVZ X;  3W1Y A;  3JSV B;  3QWZ B;  4EZK A;  3ZKJ C;  1GJZ A;  2EMS A;  4K1R B;  1NI2 A;  3X0W A;  4NAW A;  3MHS D;  1Q0W B;  4GSW A;  2DAJ A;  1WXA A;  2V1Y A;  4BKG A;  2O6V D;  1WY8 A;  1Z5S B;  4CHK A;  1TZ1 A;  1YJ1 A;  2FUH B;  4NPN A;  2V3S A;  4KVG B;  3IG3 A;  3PPA A;  5JHA A;  4G50 A;  4KV2 A;  4E3C A;  4M8M A;  2G4D B;  4G0N B;  3D32 A;  3VH4 B;  3ZNH B;  1SE9 A;  4A3O A;  2AEH A;  4PS3 A;  3WA0 A;  1WM3 A;  3H7P B;  5AEK B;  2LRU A;  2NBU A;  4GN1 A;  2JPH A;  1UD7 A;  3PRP B;  4W9I A;  3H9D A;  5DPS A;  4WJP A;  4I6P A;  1WZ3 A;  2FCM A;  1E7V A;  3TCA A;  2HD5 B;  2CHX A;  2MWS B;  3DBH I;  3PVL A;  4XC2 A;  3UQA A;  4W9G A;  1M94 A;  3ZNI D;  2CS4 A;  2ZJD A;  5D7G A;  3HHM A;  3LDZ E;  3TL5 A;  3HK0 A;  2G3Q B;  4IM3 A;  4II2 B;  3Q3F A;  1UH6 A;  5D2M B;  1Y8R C;  4TUU A;  2MCN B;  5JH5 C;  4BKT A;  3L13 A;  3ZRF A;  3SD5 A;  2BWE S;  4MGK E;  2KTR B;  2PEA A;  2IYD B;  1YIW A;  4AP4 C;  3RCZ A;  4NJ7 A;  2C7M B;  3ZNZ B;  4TKN A;  3R3M A;  3UIP B;  4HVB A;  1NBF C;  3ZTD A;  1E7U A;  5IA7 A;  3ZIM A;  4IM2 A;  1P0R A;  2HE7 A;  1WGR A;  3WAM A;  2HTH A;  2KWC A;  3QCA A;  4ZYN A;  4W9C A;  2MBE A;  1RLF A;  4KIK B;  5J18 A;  1BT0 A;  3NZS A;  2DYB A;  4WJN A;  2C9W B;  4GDK A;  5AZH A;  3VXW A;  4RMA A;  4ICV A;  4JIO U;  4ANW A;  2ZEQ A;  2O6V B;  1V5O A;  3UF8 A;  2DYO A;  1YQB A;  1L7Y A;  4NY0 A;  4XZ4 A;  2NR2 A;  2PE9 A;  5BO4 B;  4RM9 A;  1J8C A;  2YVC A;  1R4M I;  1GC7 A;  2JXX A;  3KUZ A;  4IWQ A;  2LUE A;  2NBW B;  2NS5 A;  3VFK A;  4GMV A;  3ZDM C;  4B95 A;  4FHK A;  1C3T A;  2LAS A;  2D07 B;  1Q5W B;  1KLV A;  3ZLZ A;  4BOS C;  3DBS A;  3IFW B;  4ZRK A;  2GBJ A;  1EF1 A;  3A9J B;  2LWP A;  2NCN A;  2KK8 A;  4MGY E;  2IY0 B;  3B08 A;  2UWQ A;  3VTW A;  4HCP B;  4EZL A;  2LJ5 A;  3PTF C;  1UBI A;  4MEL A;  3L16 A;  3KYD D;  3UIN B;  3TJP A;  4HXD A;  1RAX A;  3OJ3 A;  4FUL A;  4NQL B;  2JUO A;  2WX0 A;  2WX1 A;  4MDK E;  3JSV A;  2B3A A;  1P1A A;  3EFU A;  3N30 A;  3NY5 A;  5AZF A;  4EZJ A;  4KDL B;  1WJU A;  4HWI B;  2ZPN A;  2D3G A;  2ZVN A;  3PHX B;  4F1S A;  3P2B A;  2PE6 B;  5DPT A;  4EEW A;  2VRR B;  2ZCB A;  2BWF A;  3RUL A;  1UEL A;  4ANU A;  4HLE A;  4MH0 E;  3NHE B;  3I3T B;  3IBE A;  1WE7 A;  3VHT C;  2J7Q B;  2KQ7 A;  3A33 B;  3M62 B;  3ML9 A;  4GDL B;  1ZW7 A;  4A20 A;  3H7P A;  4GIV A;  2KX0 A;  4M8N A;  4DHZ B;  2C7N B;  2L05 A;  3WAN A;  2KNB A;  3X23 A;  5L95 C;  3PS6 A;  2G4S A;  4E71 A;  2NVU I;  1WXV A;  3ZRC A;  1CMX B;  4KZC A;  1AAR A;  2BYE A;  4KSK C;  2PPH A;  2REX A;  2LVP A;  3A4S C;  4WJO A;  3H6N A;  4FAD A;  3UIO B;  1IP9 A;  2KFK B;  1QZE A;  4PS7 A;  2LRW A;  2KJR A;  2N1V A;  3KYC D;  1Z2M A;  1TBE A;  4IWP A;  4CO7 A;  4GOC A;  4N9F 4;  3AU4 A;  3R7R A;  1D3Z A;  3PRE A;  2IO1 B;  3V6C B;  2I1K A;  3PZD A;  1WGD A;  3DPD A;  3OAW A;  3CF6 E;  3ZTC A;  5E6O A;  1WX7 A;  2DAF A;  4HDQ A;  3K9O B;  2KTR A;  2M0X A;  2MP2 B;  4M0W B;  2KJH B;  4LJO B;  4EOY A;  2BYV E;  2MBQ A;  4PYU A;  5LXI B;  3AI5 A;  4EUT A;  2L8J A;  1A5R A;  4DWF A;  4MJS A;  4URK A;  2MSE D;  2PJH A;  4B6W A;  5LLI A;  2CHZ A;  3S2A A;  4KIK A;  2FID A;  4P7I A;  5AZG A;  1OEY J;  4KSL C;  4FA6 A;  1WGY A;  3GZN I;  1JRU A;  4LCD E;  1L2N A;  2JY6 A;  2KOX A;  3ECI A;  4XX5 A;  4AJY B;  5JHB A;  2O6V A;  2GBM A;  5DCN A;  2DZJ A;  2CR5 A;  1V80 A;  2MLB A;  4YL8 A;  1H8C A;  2L76 A;  2FIF A;  4ANV A;  4W9L A;  4ASW C;  3TBL D;  3BY4 B;  3L08 A;  1R4N I;  3L0W B;  5TR5 A;  3Q3J A;  2L3Z A;  2LXA A;  2LZ6 A;  2ZCC A;  3WIM A;  3QK0 A;  2JZ3 B;  1IPG A;  1P9D U;  1NDD A;  3UQB A;  2DZM A;  3APF A;  4BBN F;  4DHZ E;  1IYF A;  2CU1 A;  1EO6 A;  2FCS A;  1YD8 U;  1WR1 A;  2LGX A;  3A9J A;  5KHO A;  2JVC A;  3EEC A;  3ZVV A;  3PGE A;  2K8H A;  4DDG D;  3U8Z A;  1I35 A;  2N9P C;  1KJT A;  1V86 A;  4MGI E;  3M63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...