1L0VB

Quinol-fumarate reductase with menaquinol molecules
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
total genus 69
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2002-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1l0vB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l0vB01
2PKOA 1VJKA 3VR8B 1YJIA 3LB8C 3P4SB 3CIRB 1FM0D 1I7HA 3FAHA 3W9CB 2AX5A 3KWLA 1FFUA 1N61A 4FXCA 1CZPA 4ITKA 1L0VB 5GXGB 2LEKA 1RWSA 3AEEB 3SFDB 3P4QB 4KX6B 3AB5A 5G5HA 1WXQA 1GT8A 2BT6A 3ETRA 5AUKA 1L6UA 3ABVB 1FIQA 4USAA 4HRSA 1GTEA 1SF0A 1JWBD 2KMMA 1H7WA 1JWAD 2K5PA 2EKIA 1N60A 3L4PA 2M56B 1KFYB 1SIJA 3AE4B 3AEAB 2KAJA 4WQMA 1JW9D 4ZHPA 1QT9A 2WDRB 4YSXB 2W3SA 2CJOA 3AEGB 3AH7A 1WGKA 2CU3A 5EE9A 4LTUA 3P4RB 1F0ZA 1JQ4A 2QIEB 4N58A 3AMZA 1YQ3B 4C7ZA 4P6VF 4YTNB 1WYGA 2L52A 3ZYYX 3NVYA 1NVID 1RM6C 2JQRB 2W55A 2WU5B 1N63A 3PO0A 4JWUC 3P4PB 5H8YE 4YTMB 5G5GA 1E9MA 3SR6A 2PVOD 4US9A 1YQ4B 3SFEB 3P63A 4A9AA 1FMAD 2N0SB 2BS2B 1QOFA 1WRIA 3AEFB 3VRAB 3EUB2 2WDVB 3AE8B 1PUTA 1RYJA 1TKEA 1TKYA 2CJNA 1NEKB 2M19A 3NRZA 1DOXA 1RFKA 3NVVA 1DGJA 2B76B 2ACZB 1E0ZA 1UWMA 3LXFA 1VLBA 3DWGC 3FC4A 1DOYA 1GPXA 1N62A 3AEBB 2BS3B 2WU2B 1L6VA 1R7SA 2PVGC 2DWQA 5MPOA 2G1EA 1XLNA 2W54A 4C7YA 2WP9B 2L83A 1PFDA 4JWSC 1T3QA 1L5PA 1ZOYB 2FBWB 4IDIA 1E7PB 1QOGA 4HROA 3B9JA 1JROA 2MH7A 4JX1C 5EE0A 5AUIA 3AE3B 3B2FA 2WDQB 1AYFA 3AM9A 1QLBB 3CWIA 3HRDD 1TJEA 1E6EB 4ZHOA 3AN1A 1FXAA 5C3JB 1DOIA 3HVZA 3WCQA 3W5UB 1GTHA 1NYQA 2QJLA 4YXDB 4ZOHC 5EE1A 1CJEA 3NS1A 1J7CA 1NENB 1PDXA 1FXIA 4YSZB 1N5XA 2MJ3A 2MJEA 2OHFA 2BS4B 3AV8A 2HTME 1QOBA 3AEDB 4YTPB 2H88B 5H92C 1FRDA 1YJJA 1ZXIA 1XO3A 1AWDA 1E10A 3AE9B 1XLOA 1FRRA 1OQQA 3AE6B 4YT0B 2JX5A 2PIAA 4WWMA 1KRHA 2K22A 1NI3A 1JALA 1TYGB 1IUEA 1XLQA 4N6EB 2MJDA 1V8CA 1FO4A 4YSYB 2WLBA 1TKGA 2DBYA 1OQRA 3BIID 5C2TB 1FFVA 3AE2B 1N5WA 2H89B 3AE1B 1SB3C 2E3TA 2W3RA 1XLPA 1GAQB 2Y5CA 1KF6B 1J7AA 3RPFC 2WS3B 1ZUD2 3VR9B 1H7XA 3AE7B 3AECB 3VRBB 2WQYB 1QOAA 1V97A 3B2GA 3DWMA 3NVWA 2Q5WD 1NYRA 4US8A 3AE5B 1J7BA 3CF4A 5EE3A 3W5VB 1WWTA 1ROEA 1ZP0B 3P1MA 3NVZA 4C80A 2K9XA 1A70A 1JRPA 1QF6A 1OFFA 3HUIA 4N59A 1VDVA 1EWYC 1B9RA
chains in the Genus database with same CATH superfamily
2NBUA 4GIVA 2MCNB 5D6JB 4MACA 3MTNB 3LJ3A 1RWSA 3DDCB 4KX6B 1CK1A 3DBLB 1WJ4A 3Q8AA 3E9SA 4USAA 1AN8A 2GOWA 2XBBC 4KGTA 5JZEB 3AE4B 4WQMA 2MEKA 2Y5BB 2INDC 3P4RB 1JQ4A 4GU2A 2KN5A 1BUIC 4W9GA 4C7ZA 4P1CC 4DQOC 3SEBA 3VVWB 1N63A 1ZW7A 2ZZPB 3PSEB 1PGBA 2YEPF 3IXSA 2KKCA 2N0SB 4M8NA 5D7GA 3ALBA 4EZKA 1ZXHA 2ON8A 4OVUA 2PJHA 2GBMA 3ML8A 1GOZA 1I4QA 1I35A 3Q8BA 4M01A 1ISNA 2ZVOA 3PZ8A 1L0YB 4IWQA 1XLNA 2K0PA 2V3PA 2WNMA 4JGHB 4EEWA 1H4RA 2BWES 1JCKB 2JRHA 3AM9A 1Z2MA 3V3XA 4PS3A 3KUZA 4CYEA 4ZOHC 4LJPB 5MPOA 3N1YC 4EZLA 5H92C 4MGKE 5EDSA 2N1WA 2N9EB 4A3OA 5IP4D 1EF5A 1XEEA 2K22A 4WIPA 1NI3A 3UIOB 3VDZA 1XQQA 2KFKB 3BIID 3ZJUA 1WSPA 3IFWB 2C5LC 1MJDA 3KVFB 3DWMA 1H7XA 4OVZA 3VQIA 4W9EA 2WXFA 1E90A 1ENFA 4RGTA 3N1XC 3ZNGC 2L3ZA 4H2AA 2XK5A 3W9CB 4FLHA 3R3MA 2MBHA 2PTLA 4FXCA 2D5GA 3PLVA 5G5HA 2QEJC 5AUKA 5LLIA 4RMAA 3HHMA 3PZ7A 1YQBA 1SF0A 2KK8A 1TZOA 2WX1A 2QIEB 3QC8B 3MHZA 4JLCA 4A90A 4YTNB 3ZYYX 4HVBA 2JQRB 2MBOA 3BWUD 3PZDA 3BVMA 3Q8FA 3PO0A 3Q14C 2K3UA 2INNE 5IA7A 1WXMA 4M8MA 4GGQA 1E0ZA 4MJSB 1UWMA 1IP9A 2GLSA 4KIKB 2W54A 2ZNVC 3VTVA 4C7YA 3QK0A 3A1QA 3D32A 4FHJA 2LZ6A 1WXVA 2FCMA 1KOTA 1K52A 5JHBA 1YMHE 2V3SA 5TR5A 4NQKE 3H8HA 2Z8LA 3AV8A 3K9OB 1FEHA 1C77A 3SD5A 1FRRA 3KUDB 1OQQA 3AE6B 1L7YA 1GC7A 2HDEA 1V49A 2BKRB 5DPTA 5C2TB 4E74A 4EKUA 1KF6B 3AECB 4W9DA 4NQLB 4HCNB 1J7BA 4KDLB 1FCCC 2AQ3B 1TS4A 2JRIB 3NVZA 2EMTA 2ZVNA 4JQWC 2KC2A 1JRPA 4AP4C 1B9RA 4DDGD 3QAQA 3JYUA 4ANUA 4O1NA 3MJ5A 3TEYA 3PT2B 1OQYA 3LB8C 3AI5A 5CHWA 4HCPB 1FNVA 5BMGA 2UYZB 2DAFA 2V4IB 1P7EA 3RMKC 1GTEA 3TUOA 2EKIA 3IAS1 4MM3A 4HPLB 4ZHPA 5IO9A 3URYA 2W3SA 2CJOA 3BINA 2IGGA 3ZDTA 3MC9A 4KIKA 1GNUA 1WE6A 2WXPA 4YTMB 3UINB 1TZ1A 1YQ4B 2AYOB 2NMQA 3VTUA 2NTSA 4Q2JA 2SAKA 3A4RA 2M19A 3ZW3A 1I4PA 2GI9A 1WZ0A 4KZ0A 2N4FA 4DHJD 3GB1A 1PGAA 1WX9A 2LXCA 5AZHA 2KLGA 2KVRA 3EC8A 3H9DA 2WXRA 3AE3B 1GB1A 5FR3A 3T9LA 4L2YA 3TEXA 2J7QB 1VZ7A 3NJTA 2KNBA 1YJ1A 3RNEC 1BXTA 1R4NI 1D5MC 3DBSA 4WJQA 4M00A 3U30A 2BYFA 2IO3B 1QQRA 4MH8A 2I1JA 4W9LA 1YJJA 1XT9B 3V61A 4WWMA 1YX6B 2D3BA 5HFYA 3APDA 2Y5CA 3RFZB 3Q2AC 1C1YB 4EUTA 4IM2A 4PYUA 4NAWA 2Q5WD 4IUMB 1T5XD 4DWFA 2FUHB 2RD0A 4MGIE 1GB4A 3HK0A 1P9DU 2PLPA 3PLUA 1KJTA 1M4VA 2BTEA 3Q69A 1V1PA 3IT4B 1L5PA 3CSTA 1TY0A 2XEWA 4MT5A 2M1MA 1XD3B 4MM3B 1HQRD 4ZRJA 4WWOA 1ZPSA 1WI0A 5GXGB 1E5WA 5D94A 4BOZB 1C3TA 3ZQ4A 2G9HD 4K7WA 1D4BA 2INCC 3R8BA 1GUAB 2G4SA 4DHZE 2LUEA 2NPTB 5IOIA 3E56A 3ECIA 2EELA 2FCNA 1XXGA 3QX1A 2GBKA 5D2MB 4N58A 1P0RA 2JYEA 2BF8B 1NVID 2BKFA 3JSVA 3C19A 3TMPB 1PUTA 2QC8A 1RFKA 4GDLA 4G3XB 4XGAB 2ACZB 2MLBA 2KACA 1SE4A 5TSSA 2AEHA 3ZGZA 1R7SA 2PVGC 2KFJA 2HE7A 4HKZE 4OHJA 2IZVB 2UU7A 2C7HA 1PFDA 1EO6A 4JX1C 2DZMA 2MH7A 4K7UA 5AUIA 2N9PC 1R4MB 3CWIA 1D5ZC 3V62A 2XNAC 1RFAA 3VXWA 4ZRPA 3WCQA 3NUHB 1D6EC 4LNIA 4BFRA 3IAM1 2MJEA 4LNFA 2L0FA 2BS4B 2HTME 2WXIA 3BK1A 5KHOA 4TSSA 1IUEA 4LDTB 3APFA 2D3GA 2WXNA 2WS3B 2CR5A 2L32A 4REZA 3RCZA 4IW0A 4OZAA 2ZCBA 3L08A 4C4VB 2WXQA 5HKHA 3WIMA 1SIFA 1U4AA 3HM3A 2FCQA 3IG3A 4AS1A 1PQSA 2DZIA 4KSKC 1E8XA 2LWPA 1T0QC 2DYMA 4K3BA 3VUYA 2REXA 2R61A 1L4ZB 2IY0B 4LDTD 3BK2A 4BBNF 2KOXA 1JWBD 2KQ4X 3FKYA 4P1BC 4RFBA 1KLVA 3AEAB 1JW9D 2AQ1B 4BVUC 4ZDVA 3AEGB 2N9LA 1TY2A 3NY5A 1I4HA 2WU5B 2KN4A 4JWUC 1HZ5A 4BKSD 1WRIA 2CKHB 3AE8B 3NVVA 1JMLA 1IGCA 3M62B 2NCNA 3LYYA 4WQOB 1N62A 1VRAB 3BVGA 3A9JB 1YD8U 1MVKA 4G0NB 2NBVB 4YL8A 4LLGM 4IM0A 1NDDA 3MP9A 1Q0WB 4RGMA 4ZRIA 4II3B 4DHJB 2WDQB 4TV3A 3L16A 2LGDA 2BW2A 4F8CB 1NYQA 2QILA 2WXMA 4RGOS 2MJ3A 5HHDG 4DBGA 1UGMA 1KLUD 3TSSA 3AU5A 1JWMD 1PYWD 2W3RA 1SE3A 2GBNA 3W1SC 3W1SA 4KZCA 4F7ZA 4KKJA 3AE5B 3BVZA 2O2VA 3PRPB 3ZDMC 4LJOB 2BYVE 2M17A 3B1LX 3CIRB 2E6XA 2RPVA 4W9JA 1S1QB 3DBHI 1LGRA 3AEEB 4GOCA 2AL6A 4EZJA 1LM8B 2MA9B 4HWIB 4NJCA 3BY4B 2IBIB 1YNTE 4LTUA 3U52E 4MJSA 2J42A 3T3OA 3A9KA 4ZRKA 1Q10A 5G2NA 2KDBA 4US9A 3RNCC 4KGRA 1SBBB 2RDHA 2MW5A 1DGJA 2PMVA 2DYBA 3KH0A 1WE7A 2BPSA 2KO3A 2WX0A 2QMTA 4KVGB 3PVLA 4FBJB 3U8ZA 2Z0DB 1ZOYB 1WYWB 3TL5A 3DBRI 2VZKB 3J9CA 2KZRA 3OLMD 1WY8A 2G3QB 4RM8A 4DXAB 4AJWA 1IYFA 3AN1A 2BBCA 2J0JA 3TEZA 5BO4B 1GTHA 2KYWA 1WMHA 2JY6A 3Q8CA 3ZKJC 4NAMA 1WXAA 1K8RB 1WJUA 1VZ6A 2EKEC 2HD5B 4N6EB 2MJDA 4YSYB 2WLBA 1E7VA 2D11A 2D3AA 2KWVB 3KYCD 4A8XC 1ZUD2 2ZW0A 3B2GA 1KLGD 1SSNA 3ZLZA 3V6EB 3GZNB 4KSLC 5EE3A 3W5VB 2LI5A 1OFFA 3QWZB 3VH4B 2LRWA 3S2AA 3ZTCA 2KHWB 4HLEA 4EFOA 1K50A 3VR8B 1GG3A 4GSWA 1FM0D 3ZO5B 3VHTC 4ITKA 1CZPA 3DBLI 3ETRA 2LD9A 1FIQA 1T6BX 3L4PA 1FNUA 3CMMB 3O13A 2WXKA 2FUG1 1C9FA 1FPYA 1WGKA 4HPPA 2CU3A 4IKGA 1MI0A 4CQNA 2TSSA 1AARA 2WXJA 2MX2A 4P6VF 3ZIMA 1Y8RC 4EOYA 1RM6C 2W55A 3R66C 3V6CB 2PVOD 3P63A 2LHDA 5HI1A 3TCAA 2CJNA 2KWDA 1NEKB 2XK5B 3PTFC 1JWUD 1E8ZA 3ZNHB 2ZCCA 2B76B 1P98A 2V3NA 3FC4A 3TIXA 1J8CA 2DWQA 2N9KA 3R7RA 4E3CA 2MWSB 1T3QA 1TBEA 1YN3A 1ET6A 3R7QA 1K53A 2YVCA 3B2FA 5E6PA 1QLBB 2AL3A 2PEAA 1E6EB 2JYTA 1HXYD 5EE1A 1CJEA 3IHPC 4LNOA 4DXFA 1XO3A 4BKSA 3AE9B 4LNKA 1D3ZA 1MFWA 3W2DA 4YT0B 2JX5A 4LCDE 3L10B 3L54A 3RNGC 1JALA 2LVPA 4K3CA 1WX7A 2A5UA 1JRUA 2A4ZA 1FFVA 1N5WA 2KXJA 1SJED 1OGWA 2M0XA 4A6QA 1T0YA 1UD7A 2OJRA 1UGJA 1WWTA 3N20C 2PE6B 2ICIA 3JSVB 2L7RA 2K1FA 2LGIA 2OEDA 4S0RA 1F2RI 5J17A 2O2VB 3OAWA 1WM3A 1N61A 1GT8A 2ZEQA 3PGEA 4DDID 3UQBA 1H7WA 1FCLA 5IKCM 2KJRA 1IGDA 1LXDA 4YSXB 1V5OA 4ANWA 1WYGA 2VH1A 2BWFA 2HTHA 3SDLC 5H8YE 4A9AA 3SFEB 3ZRCA 2BS2B 1QOFA 2BQQA 3UGBB 3N32A 3U4EG 1RYJA 3V60A 2LGXA 3DOWA 3M63B 3H7SA 4W9FA 4I6NB 1GPXA 4BOSC 1TS2A 1RLFA 5DCNA 5LXHA 2WP9B 3WALA 1YN5A 4WH4A 5I4DA 1LFDA 1AYFA 5GMVA 4ICUA 3EHVA 3GP7A 4GB9A 1WFYA 2JUOA 1V1PB 2JXTA 3I63C 2LJIA 2K8CA 3WAPA 2WWZA 1F2RC 1J7CA 4OW0A 2N7JA 1P1AA 1ZXIA 2RR9A 1F9JA 3N3KB 2BB6A 3W1YA 1XLOA 1V2YA 2W82A 3IT6B 2K25A 4MSQB 4ASWC 2L8JA 5KHQA 1STEA 3RPFC 1TGZB 2M8SA 1WR1A 1E7UA 1NYRA 2D3CA 1SEBD 2K6QA 4BAXA 2WYQA 5FK9C 2KTRA 3OJ3A 3HM6X 3B08A 4HPMB 1WH3A 1VJKA 1WGGA 2C9WB 5L95C 2YLMA 2LJ5A 5CTRC 2KT7A 2AX5A 2UWQA 1L0VB 3RNAC 2WHIA 2MHJA 3SU8X 1YX5B 1WXQA 2W9NA 3NG0A 2J4XA 2C7NB 4N9F4 3GOEA 4GXBA 3VH3B 2C60A 3Q3OC 3QHTA 4HJKA 3MC0B 5LNK1 2LMCA 2NPTA 5BYQA 1OEYA 4A20A 3SHQA 4B0MA 4C00A 2ZPYA 4TUUA 2G1EA 2PPHA 4EE2A 2KJHB 2O6VA 2Y3AA 4DXGA 4AWJA 1JROA 4HK2A 4OVVA 4L23A 3RNBC 1TJEA 4FJYA 4ZHOA 3EFCA 5JXVA 3CF6E 1WJ6A 1IBXA 3X0WA 2CHWA 2JXXA 1EWCA 1GC6A 3UIPB 4JIOU 2PIAA 2LGSA 4G50A 1NI2A 3IBEA 1FD6A 4LK0M 1OQRA 3K9PB 2E3TA 1V9JA 2MBBB 4BKTA 2FAZA 3JVZX 3DBHB 4RCOA 2N9XA 1TIFA 3KQ4A 1WR6E 3A9KB 4S17A 4ACFA 2HJ8A 2PKOA 1E8YA 3C8YA 3H1UA 3FILB 3P4SB 1WGDA 4OZCA 3ZXVA 2L76A 4LNNA 1L6UA 1PGXA 2VZKD 1FNWA 5FR6A 2JWUA 1ZE3D 4GMVA 1L0XB 3A1QB 2M56B 5BYSA 4WWPA 1J19A 1X1MA 1T0RC 2KTFA 2DAJA 4TMAB 2L52A 1ET9A 2AWTA 3DHIC 1K51A 1V5TA 2V1YA 3M3JA 2IY1B 3VRAB 4WWNA 1TKEA 4F1SA 4CHKA 1SJHD 4YWGG 1WGRA 3DWGC 4AJYB 1L6VA 4IWOA 4XYCA 3DHGC 4R3DA 5G55A 2V4LA 1QOGA 2K6DB 3N1ZC 3PS6A 2BYEA 2RDGA 4OZBA 4P16A 4TQ1A 2C7MB 1VCBA 1DOIA 2X38A 2INPE 3DVGX 1NENB 2V0GA 1NBFC 1D5XC 4AOFA 1EM7A 4NJ6A 4PS7A 3RI7C 1E10A 3RN9C 1V8CA 2PE9A 2MBEA 1ZDVA 4W9KA 2IGDA 3RT3B 5BMHA 1J7AA 1I4XA 2LUMA 5E6OA 2JZ3B 3NVWA 4ANVA 4PT5A 3QJZA 2IYDB 4NY0A 3CF4A 4D2KA 1HZ6A 1WRDB 4MGYE 1OEYJ 2IO1B 3Q6BA 1UBIA 3PV1A 2ZNVB 2FE8A 4IG7B 2I2YA 4FN2A 1IPGA 3NOBA 4IC7B 2G45B 1A5RA 2OOBB 3FAHA 3KWLA 1FFUA 4FA6A 4AQ7A 5FKAC 3R2TA 3P2BA 3P4QB 4HJGE 3N9YC 4K81A 3RULA 3ABVB 5DPRA 2RGFA 2KMMA 2M4NA 4IOIE 1SIJA 1TS3A 1QT9A 5DPWA 3AH7A 2CHZA 4WJPA 3AMZA 1YQ3B 5C1ZA 3L13A 4IM3A 4NNJB 3PREA 4BZAA 4W9IA 5CHFA 3EUB2 3DPDA 1UF0A 4NZLB 2J0MA 3ZVVA 2WXHA 2RPQA 2D2QA 3LXFA 1VLBA 1AW7A 3GS2A 3AULA 2I38A 4FADA 2KQ7A 1ZKHA 2GB1A 2FBWB 3DVNU 5EE0A 2DZKA 3EA6A 4WURA 3T8MA 3I57A 3WAMA 4W9CA 2JWZA 4B95A 2BVCA 3UI3A 2ASQA 4ZYNA 3ZNID 1DYQA 2OHFA 3L17A 3VUXA 3ZJTA 1I42A 2KC1A 1Y56A 2DBYA 2D07B 2Y5PA 1GJZA 1H8CA 3U7DA 3QARA 3VUWA 5T8IA 3M95A 2MP2B 3Q3JA 2KWCA 3CSFA 1YIWA 2O6VD 4MSMB 1QKZA 5CHVC 4HKQA 1HA5A 1HTOA 3RZFA 3Q3NC 2NVUI 2JPHA 2J53A 2LFIA 4NAWB 4GDLB 1I7HA 1MHXA 2KVZA 2VRRB 4NJ7A 4RM9A 3NHEB 3C0RB 3T3NA 2KTRB 1YN4A 2BT6A 4B9KA 2KD0A 4GDKB 2PW9A 2WXGA 1KFYB 3H7PB 1BMLC 1L4DB 2KAJA 1I4RA 1ZDXA 4B6WA 3PRMB 1F1HA 4ICVA 4MEMA 2GMIC 4I6PA 5G5GA 3ML9A 4KV2A 1R4NB 1RRBA 1B1ZA 3N30A 2IDYA 5JH5C 3KW5B 1DOYA 3AEBB 4W9HA 2G4DB 3WA0A 2L83A 1V86A 2VH2A 1J0GA 4HROA 4FJVB 1RAXA 2Z0EB 5E6NA 4MDKE 3BYTB 3KWVA 3EGRA 3W5UB 2CU1A 3Q8EA 4J3OD 4X57B 3KLSX 3RNFC 1F52A 4YTPB 3ZJVA 4XZ4A 2DNFA 2JZZA 2AQ2B 3VAWA 3BYYB 3DBRB 2WXLA 3I9V1 2JVCA 3ZNZB 5DPSA 1QOAA 1V97A 4JPSA 3NZUA 4US8A 5J18A 1EU4A 4BKGA 4M02A 4G11A 2JT4B 1C76A 1A70A 3U2SC 1QF6A 5HG2A 4N59A 3IVFA 1KTKA 3ONSA 4FULA 1VZ8A 3RD2A 4XC2A 1JWSD 3OWEB 3DHHC 1YOVB 3HIZA 1JWAD 2K5PA 3ZRFA 3PRZA 2N7DA 2GBRA 4MELA 5EE9A 2JSVX 1F77A 4XWTA 3HVDA 4M0WB 3P4PB 2Z59B 1V1OA 1XCQL 4PK1A 3JW0X 2CS4A 3UQAA 5AZGA 2WGSA 2KDIA 2N7EA 4KKIA 2NS5A 2KDFB 2MP2A 2DZJA 1UNSA 4K7SA 3PHXB 1FXAA 3A33B 3UF8A 2ONQA 3HVZA 2IGHA 3I5JC 3NS1A 1C78A 4WAFA 4WJOA 1WF9A 1CMXB 3AXCA 2IJ0A 5L83A 1KRHA 1MPEA 3ZXRA 1XF5L 2H89B 3AE1B 2QHOA 3VR9B 3AE7B 3VRBB 2WQYB 4DHZB 3FILA 2IPKD 2KLCA 4ZYSA 3V05A 3P1MA 4C80A 4QAYA 4ANXA 3NS8A 1WIAA 1EF1A 1V6EA 2MQJA 2R2QA 4P7IA 2KDMA 3L0WB 2ZPNA 2XN9C 5AZFA 2LEKA 4TQ0A 5IN7A 1VD2A 3DVGY 1VR9A 5D3DA 3QA8A 1QZEA 2YEPB 4FJZA 4J6IA 1UWXA 2QSDA 4FHKA 2DHZA 2K8BA 3MC8A 2WDRB 1SE9A 4C56C 4RNAA 4L1BA 2ZW1A 3NVYA 5C23A 1C4AA 5BYRA 2KX0A 4HXDA 3AEFB 3LDZE 2B3AA 2WDVB 2JU6X 5JHAA 1SGHA 3WANA 4ARIA 1MG4A 2X8XX 1MHHE 4A55A 4ARCA 1WGYA 2LHEA 1ACCA 2JZPA 1QILA 2LASA 2QCZA 1N6ZA 5AEKB 4WJNA 1I4GA 2KWUB 2M0AA 3RZWC 1C4CA 1E7PB 1WM2A 3B9JA 4KDIC 3MJWA 4XX5A 1SXTA 3A9JA 4XWWA 2QJLA 3EECA 2KFKA 1EU3A 4HDQA 1WX8A 4IWPA 4XDDA 5IAAC 4E71A 1FXIA 4YSZB 5D3IB 2KDEB 4CO7A 4RF1A 3AEDB 2H88B 3PPAA 1FRDA 4KGSA 3QCAA 4GN1A 1UUPA 3OG5A 1XLQA 3KYDD 1TYGB 1FO4A 2DYOA 2J52A 2OJWA 2LVOA 4ZRQA 1SB3C 1XLPA 1GAQB 2GBJA 3OJ4B 2BB5A 1M94A 2J0KA 4PS8A 1ESFA 2FIDA 3A4SC 3BZDB 4A3PA 5LXIB 4JL9A 1P7FA 3EFUA 2MSED 2DX5B 2K8HA 1G6JA 3X23A 5J2RA 1TS5A 3PHWB 2KX3A 2WDTB 1C79A 1CQVA 2HJ1A 4NPNA 1N60A 1E8WA 2KMAA 1UH6A 2LGYA 2V9HA 2N1VA 3AU4A 2FCSA 3QIJA 2NBWB 3RUIB 3GZNI 4PYZA 3NRZA 5E6JA 1TKYA 1DOXA 4TKNA 2IO0B 1HE8A 2CHXA 2KJ6A 2WU2B 4M0WA 1UBQA 1HTQA 4XDCA 3R2IA 2BGFA 4MH0E 2L05A 4IDIA 3VTWA 2SEBD 1BT0A 1WGHA 4C4VA 4RF0A 3U7ZA 5C3JB 2KQSA 4AUQC 1L2NA 1HEZE 1FXTB 4YXDB 1UELA 2WXOA 1V81A 2O6VB 3Q3MC 3TEWA 1QOBA 3ZUNA 2JF5A 2RDBC 4BBNC 3P42A 4RH6A 1TKGA 5CX3A 4B0EA 1KM7A 3AB5A 1ZGUB 1WJNA 2EMSA 4HDOA 1Q5WB 4II2B 2MBQA 3WAOA 3DCGA 3ZTDA 2RMMA 2K9XA 1P3QU 2NTTA 3GE8C 2LVQA 2GRIA 3H7PA 1C4PA 1YJIA 2FIFA 2QDFA 2DLBA 1OTRB 2R2OA 3MFGA 3SFDB 1LQBA 1R4MI 3APCA 1TT5B 4HRSA 4GLSC 1MG8A 4RGNA 4HEA1 2KMCA 1XCTL 3MHSD 1F0ZA 3TBLD 1UZXB 5BMIA 3SR6A 2DENB 1V80A 1E9MA 2K39A 1FMAD 3Q3FA 2LXAA 2ZJDA 2BYTA 1LO5D 1KH0A 3DQVA 3RYTA 2BS3B 1TTNA 1IBXB 1WMHB 3NZ3A 1WZ3A 4JWSC 3I3TB 4DK5A 4XE0A 3DVNV 3B0AA 3NZSA 4I6LB 3HRDD 2D10A 1SE2A 2L00B 2L1AA 3TJPA 1T0SC 2RSUA 3KUCB 1Z5SB 4K1RB 4URKA 1PDXA 1N5XA 3ENEA 1Q1OA 4JE3B 4UDUC 2IO2B 3VFKA 1AWDA 1EUVB 2FNJB 3QQ8B 1WXSA 3AE2B 2KANA 4GDKA 2L0TA 2MRPA 3H6NA 3GE3C 2NR2A 1S3SG 1ROEA 1ZP0B 2LRUA 4MGZE 3O65B 3HUIA 2I1KA 1VDVA 1EWYC 4WAAA
chains in the Genus database with same CATH topology
1VJKA 1VZ8A 4AS1A 4MACA 2AX5A 2DYMA 1JWSD 3OWEB 1L0VB 1RWSA 2R61A 4KX6B 1CK1A 1L4ZB 1WXQA 3Q8AA 2J4XA 3BK2A 3E9SA 4USAA 1AN8A 1JWBD 1JWAD 2KQ4X 2K5PA 4KGTA 4RFBA 3AE4B 3AEAB 4WQMA 1JW9D 2AQ1B 2MEKA 3AEGB 2N9LA 5EE9A 1JQ4A 3P4RB 1TY2A 1BUIC 2JSVX 4C7ZA 1F77A 4XWTA 4DQOC 3SEBA 3HVDA 1I4HA 3MC0B 2WU5B 1N63A 2KN4A 4JWUC 3P4PB 5LNK1 1PGBA 2YEPF 2LMCA 3IXSA 1HZ5A 2N0SB 5BYQA 1WRIA 5D7GA 1V1OA 1ZXHA 3AE8B 1XCQL 2ON8A 3NVVA 1JMLA 1GOZA 1I4QA 1IGCA 4RNAA 4B0MA 3Q8BA 3LYYA 1N62A 1VRAB 3BVGA 3PZ8A 1L0YB 2G1EA 1XLNA 2K0PA 1MVKA 4EE2A 2V3PA 2WNMA 4LLGM 4KKIA 3MP9A 2Y3AA 4DXGA 1JCKB 1JROA 4RGMA 2WDQB 3AM9A 1UNSA 4L23A 3V3XA 1TJEA 4ZHOA 5JXVA 1FXAA 2ONQA 3HVZA 2BW2A 2IGHA 1NYQA 1IBXA 2QILA 4ZOHC 2WXMA 4RGOS 3NS1A 5MPOA 1C78A 2MJ3A 4WAFA 1EWCA 5H92C 5HHDG 2IJ0A 2PIAA 1KRHA 1XEEA 2K22A 1NI3A 4WIPA 1KLUD 1FD6A 1MPEA 4LK0M 1XF5L 3TSSA 1OQRA 1JWMD 3BIID 1PYWD 3ZJUA 1WSPA 2E3TA 2W3RA 2H89B 3AE1B 1SE3A 3W1SA 3VR9B 1H7XA 3AE7B 3DWMA 3VRBB 2WQYB 4OVZA 3VQIA 3FILA 4RCOA 4KKJA 3AE5B 2IPKD 3BVZA 2WXFA 4ZYSA 3V05A 3KQ4A 3P1MA 4C80A 1ENFA 4RGTA 2PKOA 3C8YA 2KDMA 3FILB 4H2AA 3P4SB 3CIRB 2E6XA 2RPVA 3W9CB 2PTLA 4FXCA 2XN9C 4OZCA 2D5GA 2LEKA 3AEEB 5G5HA 2QEJC 5AUKA 4TQ0A 1L6UA 1PGXA 2VZKD 1FNWA 3PZ7A 1VR9A 1SF0A 1ZE3D 2JWUA 5D3DA 1L0XB 2M56B 5BYSA 2YEPB 4NJCA 1TZOA 1UWXA 2QSDA 2WDRB 1YNTE 4LTUA 4TMAB 3U52E 2QIEB 2J42A 3MHZA 4C56C 3T3OA 4A90A 4YTNB 1Q10A 2L52A 1ET9A 2ZW1A 3NVYA 4L1BA 1K51A 2JQRB 1C4AA 3BWUD 3Q8FA 3BVMA 3PO0A 5BYRA 4US9A 3AEFB 3VRAB 2K3UA 2INNE 2WDVB 1TKEA 2JU6X 4KGRA 1SBBB 1SJHD 2RDHA 4YWGG 1DGJA 2PMVA 4ARIA 1E0ZA 1UWMA 3DWGC 1MHHE 4A55A 4ARCA 2QMTA 1L6VA 2LHEA 1ACCA 2JZPA 1QILA 2W54A 4C7YA 1I4GA 4R3DA 2M0AA 1ZOYB 1C4CA 1E7PB 1QOGA 2VZKB 3B9JA 3J9CA 2RDGA 4OZBA 4P16A 1K52A 4TQ1A 3AN1A 1YMHE 1SXTA 1DOIA 2BBCA 2X38A 3TEZA 4XWWA 1GTHA 2INPE 2QJLA 3H8HA 1EU3A 2Z8LA 3Q8CA 1NENB 4XDDA 2V0GA 1FXIA 4YSZB 3AV8A 5D3IB 4NAMA 1D5XC 3AEDB 4RF1A 2H88B 1FEHA 1C77A 1EM7A 1FRDA 1E10A 4KGSA 1FRRA 1VZ6A 1OQQA 3AE6B 1UUPA 1XLQA 2HDEA 1TYGB 4N6EB 1FO4A 2DYOA 1V8CA 2J52A 4YSYB 2MJDA 2WLBA 1ZDVA 5C2TB 4ZRQA 1SB3C 2IGDA 1XLPA 1GAQB 5BMHA 1KF6B 1J7AA 1I4XA 2LUMA 2BB5A 4A8XC 1ZUD2 2ZW0A 3NVWA 3AECB 3B2GA 1KLGD 1SSNA 4PT5A 1J7BA 3CF4A 5EE3A 1FCCC 2AQ3B 3W5VB 1TS4A 4D2KA 3NVZA 1HZ6A 1ESFA 3BZDB 1JRPA 1OFFA 1P7FA 1B9RA 2FE8A 4O1NA 2I2YA 1K50A 3MJ5A 3TEYA 3VR8B 3LB8C 1FM0D 3FAHA 3KWLA 1FFUA 4ITKA 1CZPA 1TS5A 5FKAC 4AQ7A 1FNVA 3R2TA 5BMGA 3P4QB 3ETRA 4HJGE 3N9YC 2V4IB 3ABVB 1C79A 1FIQA 1P7EA 1GTEA 1CQVA 3TUOA 1T6BX 2KMMA 3L4PA 2EKIA 1N60A 1FNUA 4IOIE 3IAS1 3O13A 2WXKA 2FUG1 1SIJA 1C9FA 1TS3A 4ZHPA 1QT9A 3URYA 2W3SA 3AH7A 2CJOA 1WGKA 2CU3A 4IKGA 1MI0A 4CQNA 2TSSA 2WXJA 2IGGA 3AMZA 1YQ3B 4P6VF 1RM6C 2W55A 2WXPA 4YTMB 2PVOD 1YQ4B 3P63A 2LHDA 2NMQA 5HI1A 2NTSA 4Q2JA 3EUB2 2SAKA 2M19A 3NRZA 1TKYA 2CJNA 2KWDA 1NEKB 4NZLB 5E6JA 1I4PA 1DOXA 2GI9A 1JWUD 2B76B 2WXHA 3LXFA 2V3NA 1VLBA 1AW7A 3FC4A 2WU2B 3GS2A 4M0WA 3GB1A 2DWQA 2N9KA 2I38A 1PGAA 3R2IA 4XDCA 1T3QA 2GB1A 1YN3A 2FBWB 1ET6A 4IDIA 3ZYYX 5EE0A 2WXRA 1K53A 2SEBD 3EA6A 3AE3B 1GB1A 3B2FA 4WURA 5FR3A 4L2YA 3TEXA 1QLBB 1VZ7A 1E6EB 4RF0A 3I57A 5C3JB 1BXTA 3U7ZA 2JYTA 1HEZE 1D5MC 4YXDB 1HXYD 5EE1A 3UI3A 1CJEA 1DYQA 2WXOA 3TEWA 1QQRA 2OHFA 4MH8A 1QOBA 3ZJTA 1YJJA 4DXFA 1XO3A 3AE9B 3W2DA 4WWMA 4YT0B 2JX5A 3P42A 4RH6A 1JALA 1Y56A 1TKGA 2DBYA 2Y5PA 5HFYA 4B0EA 1FFVA 1N5WA 3AB5A 2Y5CA 1SJED 3RFZB 5T8IA 2Q5WD 1T5XD 1GB4A 4A6QA 2PLPA 1UGJA 1WWTA 1QKZA 2RMMA 1M4VA 2BTEA 2K9XA 3Q69A 1HA5A 4HKQA 2NTTA 1V1PA 2ICIA 3IT4B 1L5PA 2J53A 1TY0A 2LFIA 4MT5A 2OEDA 2LGIA 4MM3B 1F2RI 4NAWB 2GRIA 1C4PA 1HQRD 1YJIA 4GDLB 1I7HA 1MHXA 1ZPSA 2DLBA 1N61A 3MFGA 5GXGB 3T3NA 3ZQ4A 3SFDB 1YN4A 1GT8A 2BT6A 2G9HD 1D4BA 4HRSA 3R8BA 1H7WA 4GDKB 1FCLA 2PW9A 4GLSC 2WXGA 1KFYB 1BMLC 1L4DB 3E56A 1IGDA 4HEA1 1XCTL 2KAJA 4RGNA 1I4RA 2EELA 4YSXB 1XXGA 1F0ZA 1ZDXA 4N58A 2JYEA 1WYGA 1NVID 5BMIA 3SR6A 5H8YE 5G5GA 1E9MA 4A9AA 3SFEB 1FMAD 2BS2B 1QOFA 1PUTA 1RYJA 3U4EG 1B1ZA 2BYTA 1LO5D 2IDYA 1RFKA 1KH0A 2ACZB 2KACA 1SE4A 5TSSA 1DOYA 1GPXA 3AEBB 2BS3B 3ZGZA 1R7SA 2PVGC 1TS2A 4OHJA 4HKZE 1IBXB 2WP9B 2L83A 1PFDA 3NZ3A 4JWSC 4JX1C 4HROA 1YN5A 2MH7A 5AUIA 4WH4A 5I4DA 4XE0A 1AYFA 3CWIA 3HRDD 1D5ZC 1SE2A 2L1AA 2XNAC 3BYTB 3GP7A 3KWVA 1V1PB 4ZRPA 3EGRA 2JXTA 3W5UB 3WCQA 2LJIA 3NUHB 3Q8EA 1D6EC 4J3OD 1F2RC 3KLSX 1J7CA 4OW0A 1PDXA 2N7JA 2MJEA 3IAM1 1N5XA 2BS4B 2HTME 4YTPB 4JE3B 3ZJVA 1ZXIA 2WXIA 4UDUC 3BK1A 1AWDA 2BB6A 1XLOA 2AQ2B 2W82A 3IT6B 4TSSA 3BYYB 1IUEA 2WXLA 3I9V1 3AE2B 1STEA 2WXNA 3RPFC 2WS3B 2L32A 4REZA 1QOAA 1V97A 4OZAA 1NYRA 4JPSA 4US8A 1SEBD 1EU4A 1ROEA 1ZP0B 2WXQA 5FK9C 1C76A 1A70A 3U2SC 1QF6A 5HG2A 3HUIA 4N59A 1VDVA 1EWYC 1KTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PKO A;  1VJK A;  3VR8 B;  1YJI A;  3LB8 C;  3P4S B;  3CIR B;  1FM0 D;  1I7H A;  3FAH A;  3W9C B;  2AX5 A;  3KWL A;  1FFU A;  1N61 A;  4FXC A;  1CZP A;  4ITK A;  1L0V B;  5GXG B;  2LEK A;  1RWS A;  3AEE B;  3SFD B;  3P4Q B;  4KX6 B;  3AB5 A;  5G5H A;  1WXQ A;  1GT8 A;  2BT6 A;  3ETR A;  5AUK A;  1L6U A;  3ABV B;  1FIQ A;  4USA A;  4HRS A;  1GTE A;  1SF0 A;  1JWB D;  2KMM A;  1H7W A;  1JWA D;  2K5P A;  2EKI A;  1N60 A;  3L4P A;  2M56 B;  1KFY B;  1SIJ A;  3AE4 B;  3AEA B;  2KAJ A;  4WQM A;  1JW9 D;  4ZHP A;  1QT9 A;  2WDR B;  4YSX B;  2W3S A;  2CJO A;  3AEG B;  3AH7 A;  1WGK A;  2CU3 A;  5EE9 A;  4LTU A;  3P4R B;  1F0Z A;  1JQ4 A;  2QIE B;  4N58 A;  3AMZ A;  1YQ3 B;  4C7Z A;  4P6V F;  4YTN B;  1WYG A;  2L52 A;  3ZYY X;  3NVY A;  1NVI D;  1RM6 C;  2JQR B;  2W55 A;  2WU5 B;  1N63 A;  3PO0 A;  4JWU C;  3P4P B;  5H8Y E;  4YTM B;  5G5G A;  1E9M A;  3SR6 A;  2PVO D;  4US9 A;  1YQ4 B;  3SFE B;  3P63 A;  4A9A A;  1FMA D;  2N0S B;  2BS2 B;  1QOF A;  1WRI A;  3AEF B;  3VRA B;  3EUB 2;  2WDV B;  3AE8 B;  1PUT A;  1RYJ A;  1TKE A;  1TKY A;  2CJN A;  1NEK B;  2M19 A;  3NRZ A;  1DOX A;  1RFK A;  3NVV A;  1DGJ A;  2B76 B;  2ACZ B;  1E0Z A;  1UWM A;  3LXF A;  1VLB A;  3DWG C;  3FC4 A;  1DOY A;  1GPX A;  1N62 A;  3AEB B;  2BS3 B;  2WU2 B;  1L6V A;  1R7S A;  2PVG C;  2DWQ A;  5MPO A;  2G1E A;  1XLN A;  2W54 A;  4C7Y A;  2WP9 B;  2L83 A;  1PFD A;  4JWS C;  1T3Q A;  1L5P A;  1ZOY B;  2FBW B;  4IDI A;  1E7P B;  1QOG A;  4HRO A;  3B9J A;  1JRO A;  2MH7 A;  4JX1 C;  5EE0 A;  5AUI A;  3AE3 B;  3B2F A;  2WDQ B;  1AYF A;  3AM9 A;  1QLB B;  3CWI A;  3HRD D;  1TJE A;  1E6E B;  4ZHO A;  3AN1 A;  1FXA A;  5C3J B;  1DOI A;  3HVZ A;  3WCQ A;  3W5U B;  1GTH A;  1NYQ A;  2QJL A;  4YXD B;  4ZOH C;  5EE1 A;  1CJE A;  3NS1 A;  1J7C A;  1NEN B;  1PDX A;  1FXI A;  4YSZ B;  1N5X A;  2MJ3 A;  2MJE A;  2OHF A;  2BS4 B;  3AV8 A;  2HTM E;  1QOB A;  3AED B;  4YTP B;  2H88 B;  5H92 C;  1FRD A;  1YJJ A;  1ZXI A;  1XO3 A;  1AWD A;  1E10 A;  3AE9 B;  1XLO A;  1FRR A;  1OQQ A;  3AE6 B;  4YT0 B;  2JX5 A;  2PIA A;  4WWM A;  1KRH A;  2K22 A;  1NI3 A;  1JAL A;  1TYG B;  1IUE A;  1XLQ A;  4N6E B;  2MJD A;  1V8C A;  1FO4 A;  4YSY B;  2WLB A;  1TKG A;  2DBY A;  1OQR A;  3BII D;  5C2T B;  1FFV A;  3AE2 B;  1N5W A;  2H89 B;  3AE1 B;  1SB3 C;  2E3T A;  2W3R A;  1XLP A;  1GAQ B;  2Y5C A;  1KF6 B;  1J7A A;  3RPF C;  2WS3 B;  1ZUD 2;  3VR9 B;  1H7X A;  3AE7 B;  3AEC B;  3VRB B;  2WQY B;  1QOA A;  1V97 A;  3B2G A;  3DWM A;  3NVW A;  2Q5W D;  1NYR A;  4US8 A;  3AE5 B;  1J7B A;  3CF4 A;  5EE3 A;  3W5V B;  1WWT A;  1ROE A;  1ZP0 B;  3P1M A;  3NVZ A;  4C80 A;  2K9X A;  1A70 A;  1JRP A;  1QF6 A;  1OFF A;  3HUI A;  4N59 A;  1VDV A;  1EWY C;  1B9R A; 
#chains in the Genus database with same CATH topology
 2NBU A;  4GIV A;  2MCN B;  5D6J B;  4MAC A;  3MTN B;  3LJ3 A;  1RWS A;  3DDC B;  4KX6 B;  1CK1 A;  3DBL B;  1WJ4 A;  3Q8A A;  3E9S A;  4USA A;  1AN8 A;  2GOW A;  2XBB C;  4KGT A;  5JZE B;  3AE4 B;  4WQM A;  2MEK A;  2Y5B B;  2IND C;  3P4R B;  1JQ4 A;  4GU2 A;  2KN5 A;  1BUI C;  4W9G A;  4C7Z A;  4P1C C;  4DQO C;  3SEB A;  3VVW B;  1N63 A;  1ZW7 A;  2ZZP B;  3PSE B;  1PGB A;  2YEP F;  3IXS A;  2KKC A;  2N0S B;  4M8N A;  5D7G A;  3ALB A;  4EZK A;  1ZXH A;  2ON8 A;  4OVU A;  2PJH A;  2GBM A;  3ML8 A;  1GOZ A;  1I4Q A;  1I35 A;  3Q8B A;  4M01 A;  1ISN A;  2ZVO A;  3PZ8 A;  1L0Y B;  4IWQ A;  1XLN A;  2K0P A;  2V3P A;  2WNM A;  4JGH B;  4EEW A;  1H4R A;  2BWE S;  1JCK B;  2JRH A;  3AM9 A;  1Z2M A;  3V3X A;  4PS3 A;  3KUZ A;  4CYE A;  4ZOH C;  4LJP B;  5MPO A;  3N1Y C;  4EZL A;  5H92 C;  4MGK E;  5EDS A;  2N1W A;  2N9E B;  4A3O A;  5IP4 D;  1EF5 A;  1XEE A;  2K22 A;  4WIP A;  1NI3 A;  3UIO B;  3VDZ A;  1XQQ A;  2KFK B;  3BII D;  3ZJU A;  1WSP A;  3IFW B;  2C5L C;  1MJD A;  3KVF B;  3DWM A;  1H7X A;  4OVZ A;  3VQI A;  4W9E A;  2WXF A;  1E90 A;  1ENF A;  4RGT A;  3N1X C;  3ZNG C;  2L3Z A;  4H2A A;  2XK5 A;  3W9C B;  4FLH A;  3R3M A;  2MBH A;  2PTL A;  4FXC A;  2D5G A;  3PLV A;  5G5H A;  2QEJ C;  5AUK A;  5LLI A;  4RMA A;  3HHM A;  3PZ7 A;  1YQB A;  1SF0 A;  2KK8 A;  1TZO A;  2WX1 A;  2QIE B;  3QC8 B;  3MHZ A;  4JLC A;  4A90 A;  4YTN B;  3ZYY X;  4HVB A;  2JQR B;  2MBO A;  3BWU D;  3PZD A;  3BVM A;  3Q8F A;  3PO0 A;  3Q14 C;  2K3U A;  2INN E;  5IA7 A;  1WXM A;  4M8M A;  4GGQ A;  1E0Z A;  4MJS B;  1UWM A;  1IP9 A;  2GLS A;  4KIK B;  2W54 A;  2ZNV C;  3VTV A;  4C7Y A;  3QK0 A;  3A1Q A;  3D32 A;  4FHJ A;  2LZ6 A;  1WXV A;  2FCM A;  1KOT A;  1K52 A;  5JHB A;  1YMH E;  2V3S A;  5TR5 A;  4NQK E;  3H8H A;  2Z8L A;  3AV8 A;  3K9O B;  1FEH A;  1C77 A;  3SD5 A;  1FRR A;  3KUD B;  1OQQ A;  3AE6 B;  1L7Y A;  1GC7 A;  2HDE A;  1V49 A;  2BKR B;  5DPT A;  5C2T B;  4E74 A;  4EKU A;  1KF6 B;  3AEC B;  4W9D A;  4NQL B;  4HCN B;  1J7B A;  4KDL B;  1FCC C;  2AQ3 B;  1TS4 A;  2JRI B;  3NVZ A;  2EMT A;  2ZVN A;  4JQW C;  2KC2 A;  1JRP A;  4AP4 C;  1B9R A;  4DDG D;  3QAQ A;  3JYU A;  4ANU A;  4O1N A;  3MJ5 A;  3TEY A;  3PT2 B;  1OQY A;  3LB8 C;  3AI5 A;  5CHW A;  4HCP B;  1FNV A;  5BMG A;  2UYZ B;  2DAF A;  2V4I B;  1P7E A;  3RMK C;  1GTE A;  3TUO A;  2EKI A;  3IAS 1;  4MM3 A;  4HPL B;  4ZHP A;  5IO9 A;  3URY A;  2W3S A;  2CJO A;  3BIN A;  2IGG A;  3ZDT A;  3MC9 A;  4KIK A;  1GNU A;  1WE6 A;  2WXP A;  4YTM B;  3UIN B;  1TZ1 A;  1YQ4 B;  2AYO B;  2NMQ A;  3VTU A;  2NTS A;  4Q2J A;  2SAK A;  3A4R A;  2M19 A;  3ZW3 A;  1I4P A;  2GI9 A;  1WZ0 A;  4KZ0 A;  2N4F A;  4DHJ D;  3GB1 A;  1PGA A;  1WX9 A;  2LXC A;  5AZH A;  2KLG A;  2KVR A;  3EC8 A;  3H9D A;  2WXR A;  3AE3 B;  1GB1 A;  5FR3 A;  3T9L A;  4L2Y A;  3TEX A;  2J7Q B;  1VZ7 A;  3NJT A;  2KNB A;  1YJ1 A;  3RNE C;  1BXT A;  1R4N I;  1D5M C;  3DBS A;  4WJQ A;  4M00 A;  3U30 A;  2BYF A;  2IO3 B;  1QQR A;  4MH8 A;  2I1J A;  4W9L A;  1YJJ A;  1XT9 B;  3V61 A;  4WWM A;  1YX6 B;  2D3B A;  5HFY A;  3APD A;  2Y5C A;  3RFZ B;  3Q2A C;  1C1Y B;  4EUT A;  4IM2 A;  4PYU A;  4NAW A;  2Q5W D;  4IUM B;  1T5X D;  4DWF A;  2FUH B;  2RD0 A;  4MGI E;  1GB4 A;  3HK0 A;  1P9D U;  2PLP A;  3PLU A;  1KJT A;  1M4V A;  2BTE A;  3Q69 A;  1V1P A;  3IT4 B;  1L5P A;  3CST A;  1TY0 A;  2XEW A;  4MT5 A;  2M1M A;  1XD3 B;  4MM3 B;  1HQR D;  4ZRJ A;  4WWO A;  1ZPS A;  1WI0 A;  5GXG B;  1E5W A;  5D94 A;  4BOZ B;  1C3T A;  3ZQ4 A;  2G9H D;  4K7W A;  1D4B A;  2INC C;  3R8B A;  1GUA B;  2G4S A;  4DHZ E;  2LUE A;  2NPT B;  5IOI A;  3E56 A;  3ECI A;  2EEL A;  2FCN A;  1XXG A;  3QX1 A;  2GBK A;  5D2M B;  4N58 A;  1P0R A;  2JYE A;  2BF8 B;  1NVI D;  2BKF A;  3JSV A;  3C19 A;  3TMP B;  1PUT A;  2QC8 A;  1RFK A;  4GDL A;  4G3X B;  4XGA B;  2ACZ B;  2MLB A;  2KAC A;  1SE4 A;  5TSS A;  2AEH A;  3ZGZ A;  1R7S A;  2PVG C;  2KFJ A;  2HE7 A;  4HKZ E;  4OHJ A;  2IZV B;  2UU7 A;  2C7H A;  1PFD A;  1EO6 A;  4JX1 C;  2DZM A;  2MH7 A;  4K7U A;  5AUI A;  2N9P C;  1R4M B;  3CWI A;  1D5Z C;  3V62 A;  2XNA C;  1RFA A;  3VXW A;  4ZRP A;  3WCQ A;  3NUH B;  1D6E C;  4LNI A;  4BFR A;  3IAM 1;  2MJE A;  4LNF A;  2L0F A;  2BS4 B;  2HTM E;  2WXI A;  3BK1 A;  5KHO A;  4TSS A;  1IUE A;  4LDT B;  3APF A;  2D3G A;  2WXN A;  2WS3 B;  2CR5 A;  2L32 A;  4REZ A;  3RCZ A;  4IW0 A;  4OZA A;  2ZCB A;  3L08 A;  4C4V B;  2WXQ A;  5HKH A;  3WIM A;  1SIF A;  1U4A A;  3HM3 A;  2FCQ A;  3IG3 A;  4AS1 A;  1PQS A;  2DZI A;  4KSK C;  1E8X A;  2LWP A;  1T0Q C;  2DYM A;  4K3B A;  3VUY A;  2REX A;  2R61 A;  1L4Z B;  2IY0 B;  4LDT D;  3BK2 A;  4BBN F;  2KOX A;  1JWB D;  2KQ4 X;  3FKY A;  4P1B C;  4RFB A;  1KLV A;  3AEA B;  1JW9 D;  2AQ1 B;  4BVU C;  4ZDV A;  3AEG B;  2N9L A;  1TY2 A;  3NY5 A;  1I4H A;  2WU5 B;  2KN4 A;  4JWU C;  1HZ5 A;  4BKS D;  1WRI A;  2CKH B;  3AE8 B;  3NVV A;  1JML A;  1IGC A;  3M62 B;  2NCN A;  3LYY A;  4WQO B;  1N62 A;  1VRA B;  3BVG A;  3A9J B;  1YD8 U;  1MVK A;  4G0N B;  2NBV B;  4YL8 A;  4LLG M;  4IM0 A;  1NDD A;  3MP9 A;  1Q0W B;  4RGM A;  4ZRI A;  4II3 B;  4DHJ B;  2WDQ B;  4TV3 A;  3L16 A;  2LGD A;  2BW2 A;  4F8C B;  1NYQ A;  2QIL A;  2WXM A;  4RGO S;  2MJ3 A;  5HHD G;  4DBG A;  1UGM A;  1KLU D;  3TSS A;  3AU5 A;  1JWM D;  1PYW D;  2W3R A;  1SE3 A;  2GBN A;  3W1S C;  3W1S A;  4KZC A;  4F7Z A;  4KKJ A;  3AE5 B;  3BVZ A;  2O2V A;  3PRP B;  3ZDM C;  4LJO B;  2BYV E;  2M17 A;  3B1L X;  3CIR B;  2E6X A;  2RPV A;  4W9J A;  1S1Q B;  3DBH I;  1LGR A;  3AEE B;  4GOC A;  2AL6 A;  4EZJ A;  1LM8 B;  2MA9 B;  4HWI B;  4NJC A;  3BY4 B;  2IBI B;  1YNT E;  4LTU A;  3U52 E;  4MJS A;  2J42 A;  3T3O A;  3A9K A;  4ZRK A;  1Q10 A;  5G2N A;  2KDB A;  4US9 A;  3RNC C;  4KGR A;  1SBB B;  2RDH A;  2MW5 A;  1DGJ A;  2PMV A;  2DYB A;  3KH0 A;  1WE7 A;  2BPS A;  2KO3 A;  2WX0 A;  2QMT A;  4KVG B;  3PVL A;  4FBJ B;  3U8Z A;  2Z0D B;  1ZOY B;  1WYW B;  3TL5 A;  3DBR I;  2VZK B;  3J9C A;  2KZR A;  3OLM D;  1WY8 A;  2G3Q B;  4RM8 A;  4DXA B;  4AJW A;  1IYF A;  3AN1 A;  2BBC A;  2J0J A;  3TEZ A;  5BO4 B;  1GTH A;  2KYW A;  1WMH A;  2JY6 A;  3Q8C A;  3ZKJ C;  4NAM A;  1WXA A;  1K8R B;  1WJU A;  1VZ6 A;  2EKE C;  2HD5 B;  4N6E B;  2MJD A;  4YSY B;  2WLB A;  1E7V A;  2D11 A;  2D3A A;  2KWV B;  3KYC D;  4A8X C;  1ZUD 2;  2ZW0 A;  3B2G A;  1KLG D;  1SSN A;  3ZLZ A;  3V6E B;  3GZN B;  4KSL C;  5EE3 A;  3W5V B;  2LI5 A;  1OFF A;  3QWZ B;  3VH4 B;  2LRW A;  3S2A A;  3ZTC A;  2KHW B;  4HLE A;  4EFO A;  1K50 A;  3VR8 B;  1GG3 A;  4GSW A;  1FM0 D;  3ZO5 B;  3VHT C;  4ITK A;  1CZP A;  3DBL I;  3ETR A;  2LD9 A;  1FIQ A;  1T6B X;  3L4P A;  1FNU A;  3CMM B;  3O13 A;  2WXK A;  2FUG 1;  1C9F A;  1FPY A;  1WGK A;  4HPP A;  2CU3 A;  4IKG A;  1MI0 A;  4CQN A;  2TSS A;  1AAR A;  2WXJ A;  2MX2 A;  4P6V F;  3ZIM A;  1Y8R C;  4EOY A;  1RM6 C;  2W55 A;  3R66 C;  3V6C B;  2PVO D;  3P63 A;  2LHD A;  5HI1 A;  3TCA A;  2CJN A;  2KWD A;  1NEK B;  2XK5 B;  3PTF C;  1JWU D;  1E8Z A;  3ZNH B;  2ZCC A;  2B76 B;  1P98 A;  2V3N A;  3FC4 A;  3TIX A;  1J8C A;  2DWQ A;  2N9K A;  3R7R A;  4E3C A;  2MWS B;  1T3Q A;  1TBE A;  1YN3 A;  1ET6 A;  3R7Q A;  1K53 A;  2YVC A;  3B2F A;  5E6P A;  1QLB B;  2AL3 A;  2PEA A;  1E6E B;  2JYT A;  1HXY D;  5EE1 A;  1CJE A;  3IHP C;  4LNO A;  4DXF A;  1XO3 A;  4BKS A;  3AE9 B;  4LNK A;  1D3Z A;  1MFW A;  3W2D A;  4YT0 B;  2JX5 A;  4LCD E;  3L10 B;  3L54 A;  3RNG C;  1JAL A;  2LVP A;  4K3C A;  1WX7 A;  2A5U A;  1JRU A;  2A4Z A;  1FFV A;  1N5W A;  2KXJ A;  1SJE D;  1OGW A;  2M0X A;  4A6Q A;  1T0Y A;  1UD7 A;  2OJR A;  1UGJ A;  1WWT A;  3N20 C;  2PE6 B;  2ICI A;  3JSV B;  2L7R A;  2K1F A;  2LGI A;  2OED A;  4S0R A;  1F2R I;  5J17 A;  2O2V B;  3OAW A;  1WM3 A;  1N61 A;  1GT8 A;  2ZEQ A;  3PGE A;  4DDI D;  3UQB A;  1H7W A;  1FCL A;  5IKC M;  2KJR A;  1IGD A;  1LXD A;  4YSX B;  1V5O A;  4ANW A;  1WYG A;  2VH1 A;  2BWF A;  2HTH A;  3SDL C;  5H8Y E;  4A9A A;  3SFE B;  3ZRC A;  2BS2 B;  1QOF A;  2BQQ A;  3UGB B;  3N32 A;  3U4E G;  1RYJ A;  3V60 A;  2LGX A;  3DOW A;  3M63 B;  3H7S A;  4W9F A;  4I6N B;  1GPX A;  4BOS C;  1TS2 A;  1RLF A;  5DCN A;  5LXH A;  2WP9 B;  3WAL A;  1YN5 A;  4WH4 A;  5I4D A;  1LFD A;  1AYF A;  5GMV A;  4ICU A;  3EHV A;  3GP7 A;  4GB9 A;  1WFY A;  2JUO A;  1V1P B;  2JXT A;  3I63 C;  2LJI A;  2K8C A;  3WAP A;  2WWZ A;  1F2R C;  1J7C A;  4OW0 A;  2N7J A;  1P1A A;  1ZXI A;  2RR9 A;  1F9J A;  3N3K B;  2BB6 A;  3W1Y A;  1XLO A;  1V2Y A;  2W82 A;  3IT6 B;  2K25 A;  4MSQ B;  4ASW C;  2L8J A;  5KHQ A;  1STE A;  3RPF C;  1TGZ B;  2M8S A;  1WR1 A;  1E7U A;  1NYR A;  2D3C A;  1SEB D;  2K6Q A;  4BAX A;  2WYQ A;  5FK9 C;  2KTR A;  3OJ3 A;  3HM6 X;  3B08 A;  4HPM B;  1WH3 A;  1VJK A;  1WGG A;  2C9W B;  5L95 C;  2YLM A;  2LJ5 A;  5CTR C;  2KT7 A;  2AX5 A;  2UWQ A;  1L0V B;  3RNA C;  2WHI A;  2MHJ A;  3SU8 X;  1YX5 B;  1WXQ A;  2W9N A;  3NG0 A;  2J4X A;  2C7N B;  4N9F 4;  3GOE A;  4GXB A;  3VH3 B;  2C60 A;  3Q3O C;  3QHT A;  4HJK A;  3MC0 B;  5LNK 1;  2LMC A;  2NPT A;  5BYQ A;  1OEY A;  4A20 A;  3SHQ A;  4B0M A;  4C00 A;  2ZPY A;  4TUU A;  2G1E A;  2PPH A;  4EE2 A;  2KJH B;  2O6V A;  2Y3A A;  4DXG A;  4AWJ A;  1JRO A;  4HK2 A;  4OVV A;  4L23 A;  3RNB C;  1TJE A;  4FJY A;  4ZHO A;  3EFC A;  5JXV A;  3CF6 E;  1WJ6 A;  1IBX A;  3X0W A;  2CHW A;  2JXX A;  1EWC A;  1GC6 A;  3UIP B;  4JIO U;  2PIA A;  2LGS A;  4G50 A;  1NI2 A;  3IBE A;  1FD6 A;  4LK0 M;  1OQR A;  3K9P B;  2E3T A;  1V9J A;  2MBB B;  4BKT A;  2FAZ A;  3JVZ X;  3DBH B;  4RCO A;  2N9X A;  1TIF A;  3KQ4 A;  1WR6 E;  3A9K B;  4S17 A;  4ACF A;  2HJ8 A;  2PKO A;  1E8Y A;  3C8Y A;  3H1U A;  3FIL B;  3P4S B;  1WGD A;  4OZC A;  3ZXV A;  2L76 A;  4LNN A;  1L6U A;  1PGX A;  2VZK D;  1FNW A;  5FR6 A;  2JWU A;  1ZE3 D;  4GMV A;  1L0X B;  3A1Q B;  2M56 B;  5BYS A;  4WWP A;  1J19 A;  1X1M A;  1T0R C;  2KTF A;  2DAJ A;  4TMA B;  2L52 A;  1ET9 A;  2AWT A;  3DHI C;  1K51 A;  1V5T A;  2V1Y A;  3M3J A;  2IY1 B;  3VRA B;  4WWN A;  1TKE A;  4F1S A;  4CHK A;  1SJH D;  4YWG G;  1WGR A;  3DWG C;  4AJY B;  1L6V A;  4IWO A;  4XYC A;  3DHG C;  4R3D A;  5G55 A;  2V4L A;  1QOG A;  2K6D B;  3N1Z C;  3PS6 A;  2BYE A;  2RDG A;  4OZB A;  4P16 A;  4TQ1 A;  2C7M B;  1VCB A;  1DOI A;  2X38 A;  2INP E;  3DVG X;  1NEN B;  2V0G A;  1NBF C;  1D5X C;  4AOF A;  1EM7 A;  4NJ6 A;  4PS7 A;  3RI7 C;  1E10 A;  3RN9 C;  1V8C A;  2PE9 A;  2MBE A;  1ZDV A;  4W9K A;  2IGD A;  3RT3 B;  5BMH A;  1J7A A;  1I4X A;  2LUM A;  5E6O A;  2JZ3 B;  3NVW A;  4ANV A;  4PT5 A;  3QJZ A;  2IYD B;  4NY0 A;  3CF4 A;  4D2K A;  1HZ6 A;  1WRD B;  4MGY E;  1OEY J;  2IO1 B;  3Q6B A;  1UBI A;  3PV1 A;  2ZNV B;  2FE8 A;  4IG7 B;  2I2Y A;  4FN2 A;  1IPG A;  3NOB A;  4IC7 B;  2G45 B;  1A5R A;  2OOB B;  3FAH A;  3KWL A;  1FFU A;  4FA6 A;  4AQ7 A;  5FKA C;  3R2T A;  3P2B A;  3P4Q B;  4HJG E;  3N9Y C;  4K81 A;  3RUL A;  3ABV B;  5DPR A;  2RGF A;  2KMM A;  2M4N A;  4IOI E;  1SIJ A;  1TS3 A;  1QT9 A;  5DPW A;  3AH7 A;  2CHZ A;  4WJP A;  3AMZ A;  1YQ3 B;  5C1Z A;  3L13 A;  4IM3 A;  4NNJ B;  3PRE A;  4BZA A;  4W9I A;  5CHF A;  3EUB 2;  3DPD A;  1UF0 A;  4NZL B;  2J0M A;  3ZVV A;  2WXH A;  2RPQ A;  2D2Q A;  3LXF A;  1VLB A;  1AW7 A;  3GS2 A;  3AUL A;  2I38 A;  4FAD A;  2KQ7 A;  1ZKH A;  2GB1 A;  2FBW B;  3DVN U;  5EE0 A;  2DZK A;  3EA6 A;  4WUR A;  3T8M A;  3I57 A;  3WAM A;  4W9C A;  2JWZ A;  4B95 A;  2BVC A;  3UI3 A;  2ASQ A;  4ZYN A;  3ZNI D;  1DYQ A;  2OHF A;  3L17 A;  3VUX A;  3ZJT A;  1I42 A;  2KC1 A;  1Y56 A;  2DBY A;  2D07 B;  2Y5P A;  1GJZ A;  1H8C A;  3U7D A;  3QAR A;  3VUW A;  5T8I A;  3M95 A;  2MP2 B;  3Q3J A;  2KWC A;  3CSF A;  1YIW A;  2O6V D;  4MSM B;  1QKZ A;  5CHV C;  4HKQ A;  1HA5 A;  1HTO A;  3RZF A;  3Q3N C;  2NVU I;  2JPH A;  2J53 A;  2LFI A;  4NAW B;  4GDL B;  1I7H A;  1MHX A;  2KVZ A;  2VRR B;  4NJ7 A;  4RM9 A;  3NHE B;  3C0R B;  3T3N A;  2KTR B;  1YN4 A;  2BT6 A;  4B9K A;  2KD0 A;  4GDK B;  2PW9 A;  2WXG A;  1KFY B;  3H7P B;  1BML C;  1L4D B;  2KAJ A;  1I4R A;  1ZDX A;  4B6W A;  3PRM B;  1F1H A;  4ICV A;  4MEM A;  2GMI C;  4I6P A;  5G5G A;  3ML9 A;  4KV2 A;  1R4N B;  1RRB A;  1B1Z A;  3N30 A;  2IDY A;  5JH5 C;  3KW5 B;  1DOY A;  3AEB B;  4W9H A;  2G4D B;  3WA0 A;  2L83 A;  1V86 A;  2VH2 A;  1J0G A;  4HRO A;  4FJV B;  1RAX A;  2Z0E B;  5E6N A;  4MDK E;  3BYT B;  3KWV A;  3EGR A;  3W5U B;  2CU1 A;  3Q8E A;  4J3O D;  4X57 B;  3KLS X;  3RNF C;  1F52 A;  4YTP B;  3ZJV A;  4XZ4 A;  2DNF A;  2JZZ A;  2AQ2 B;  3VAW A;  3BYY B;  3DBR B;  2WXL A;  3I9V 1;  2JVC A;  3ZNZ B;  5DPS A;  1QOA A;  1V97 A;  4JPS A;  3NZU A;  4US8 A;  5J18 A;  1EU4 A;  4BKG A;  4M02 A;  4G11 A;  2JT4 B;  1C76 A;  1A70 A;  3U2S C;  1QF6 A;  5HG2 A;  4N59 A;  3IVF A;  1KTK A;  3ONS A;  4FUL A;  1VZ8 A;  3RD2 A;  4XC2 A;  1JWS D;  3OWE B;  3DHH C;  1YOV B;  3HIZ A;  1JWA D;  2K5P A;  3ZRF A;  3PRZ A;  2N7D A;  2GBR A;  4MEL A;  5EE9 A;  2JSV X;  1F77 A;  4XWT A;  3HVD A;  4M0W B;  3P4P B;  2Z59 B;  1V1O A;  1XCQ L;  4PK1 A;  3JW0 X;  2CS4 A;  3UQA A;  5AZG A;  2WGS A;  2KDI A;  2N7E A;  4KKI A;  2NS5 A;  2KDF B;  2MP2 A;  2DZJ A;  1UNS A;  4K7S A;  3PHX B;  1FXA A;  3A33 B;  3UF8 A;  2ONQ A;  3HVZ A;  2IGH A;  3I5J C;  3NS1 A;  1C78 A;  4WAF A;  4WJO A;  1WF9 A;  1CMX B;  3AXC A;  2IJ0 A;  5L83 A;  1KRH A;  1MPE A;  3ZXR A;  1XF5 L;  2H89 B;  3AE1 B;  2QHO A;  3VR9 B;  3AE7 B;  3VRB B;  2WQY B;  4DHZ B;  3FIL A;  2IPK D;  2KLC A;  4ZYS A;  3V05 A;  3P1M A;  4C80 A;  4QAY A;  4ANX A;  3NS8 A;  1WIA A;  1EF1 A;  1V6E A;  2MQJ A;  2R2Q A;  4P7I A;  2KDM A;  3L0W B;  2ZPN A;  2XN9 C;  5AZF A;  2LEK A;  4TQ0 A;  5IN7 A;  1VD2 A;  3DVG Y;  1VR9 A;  5D3D A;  3QA8 A;  1QZE A;  2YEP B;  4FJZ A;  4J6I A;  1UWX A;  2QSD A;  4FHK A;  2DHZ A;  2K8B A;  3MC8 A;  2WDR B;  1SE9 A;  4C56 C;  4RNA A;  4L1B A;  2ZW1 A;  3NVY A;  5C23 A;  1C4A A;  5BYR A;  2KX0 A;  4HXD A;  3AEF B;  3LDZ E;  2B3A A;  2WDV B;  2JU6 X;  5JHA A;  1SGH A;  3WAN A;  4ARI A;  1MG4 A;  2X8X X;  1MHH E;  4A55 A;  4ARC A;  1WGY A;  2LHE A;  1ACC A;  2JZP A;  1QIL A;  2LAS A;  2QCZ A;  1N6Z A;  5AEK B;  4WJN A;  1I4G A;  2KWU B;  2M0A A;  3RZW C;  1C4C A;  1E7P B;  1WM2 A;  3B9J A;  4KDI C;  3MJW A;  4XX5 A;  1SXT A;  3A9J A;  4XWW A;  2QJL A;  3EEC A;  2KFK A;  1EU3 A;  4HDQ A;  1WX8 A;  4IWP A;  4XDD A;  5IAA C;  4E71 A;  1FXI A;  4YSZ B;  5D3I B;  2KDE B;  4CO7 A;  4RF1 A;  3AED B;  2H88 B;  3PPA A;  1FRD A;  4KGS A;  3QCA A;  4GN1 A;  1UUP A;  3OG5 A;  1XLQ A;  3KYD D;  1TYG B;  1FO4 A;  2DYO A;  2J52 A;  2OJW A;  2LVO A;  4ZRQ A;  1SB3 C;  1XLP A;  1GAQ B;  2GBJ A;  3OJ4 B;  2BB5 A;  1M94 A;  2J0K A;  4PS8 A;  1ESF A;  2FID A;  3A4S C;  3BZD B;  4A3P A;  5LXI B;  4JL9 A;  1P7F A;  3EFU A;  2MSE D;  2DX5 B;  2K8H A;  1G6J A;  3X23 A;  5J2R A;  1TS5 A;  3PHW B;  2KX3 A;  2WDT B;  1C79 A;  1CQV A;  2HJ1 A;  4NPN A;  1N60 A;  1E8W A;  2KMA A;  1UH6 A;  2LGY A;  2V9H A;  2N1V A;  3AU4 A;  2FCS A;  3QIJ A;  2NBW B;  3RUI B;  3GZN I;  4PYZ A;  3NRZ A;  5E6J A;  1TKY A;  1DOX A;  4TKN A;  2IO0 B;  1HE8 A;  2CHX A;  2KJ6 A;  2WU2 B;  4M0W A;  1UBQ A;  1HTQ A;  4XDC A;  3R2I A;  2BGF A;  4MH0 E;  2L05 A;  4IDI A;  3VTW A;  2SEB D;  1BT0 A;  1WGH A;  4C4V A;  4RF0 A;  3U7Z A;  5C3J B;  2KQS A;  4AUQ C;  1L2N A;  1HEZ E;  1FXT B;  4YXD B;  1UEL A;  2WXO A;  1V81 A;  2O6V B;  3Q3M C;  3TEW A;  1QOB A;  3ZUN A;  2JF5 A;  2RDB C;  4BBN C;  3P42 A;  4RH6 A;  1TKG A;  5CX3 A;  4B0E A;  1KM7 A;  3AB5 A;  1ZGU B;  1WJN A;  2EMS A;  4HDO A;  1Q5W B;  4II2 B;  2MBQ A;  3WAO A;  3DCG A;  3ZTD A;  2RMM A;  2K9X A;  1P3Q U;  2NTT A;  3GE8 C;  2LVQ A;  2GRI A;  3H7P A;  1C4P A;  1YJI A;  2FIF A;  2QDF A;  2DLB A;  1OTR B;  2R2O A;  3MFG A;  3SFD B;  1LQB A;  1R4M I;  3APC A;  1TT5 B;  4HRS A;  4GLS C;  1MG8 A;  4RGN A;  4HEA 1;  2KMC A;  1XCT L;  3MHS D;  1F0Z A;  3TBL D;  1UZX B;  5BMI A;  3SR6 A;  2DEN B;  1V80 A;  1E9M A;  2K39 A;  1FMA D;  3Q3F A;  2LXA A;  2ZJD A;  2BYT A;  1LO5 D;  1KH0 A;  3DQV A;  3RYT A;  2BS3 B;  1TTN A;  1IBX B;  1WMH B;  3NZ3 A;  1WZ3 A;  4JWS C;  3I3T B;  4DK5 A;  4XE0 A;  3DVN V;  3B0A A;  3NZS A;  4I6L B;  3HRD D;  2D10 A;  1SE2 A;  2L00 B;  2L1A A;  3TJP A;  1T0S C;  2RSU A;  3KUC B;  1Z5S B;  4K1R B;  4URK A;  1PDX A;  1N5X A;  3ENE A;  1Q1O A;  4JE3 B;  4UDU C;  2IO2 B;  3VFK A;  1AWD A;  1EUV B;  2FNJ B;  3QQ8 B;  1WXS A;  3AE2 B;  2KAN A;  4GDK A;  2L0T A;  2MRP A;  3H6N A;  3GE3 C;  2NR2 A;  1S3S G;  1ROE A;  1ZP0 B;  2LRU A;  4MGZ E;  3O65 B;  3HUI A;  2I1K A;  1VDV A;  1EWY C;  4WAA A; 
#chains in the Genus database with same CATH homology
 1VJK A;  1VZ8 A;  4AS1 A;  4MAC A;  2AX5 A;  2DYM A;  1JWS D;  3OWE B;  1L0V B;  1RWS A;  2R61 A;  4KX6 B;  1CK1 A;  1L4Z B;  1WXQ A;  3Q8A A;  2J4X A;  3BK2 A;  3E9S A;  4USA A;  1AN8 A;  1JWB D;  1JWA D;  2KQ4 X;  2K5P A;  4KGT A;  4RFB A;  3AE4 B;  3AEA B;  4WQM A;  1JW9 D;  2AQ1 B;  2MEK A;  3AEG B;  2N9L A;  5EE9 A;  1JQ4 A;  3P4R B;  1TY2 A;  1BUI C;  2JSV X;  4C7Z A;  1F77 A;  4XWT A;  4DQO C;  3SEB A;  3HVD A;  1I4H A;  3MC0 B;  2WU5 B;  1N63 A;  2KN4 A;  4JWU C;  3P4P B;  5LNK 1;  1PGB A;  2YEP F;  2LMC A;  3IXS A;  1HZ5 A;  2N0S B;  5BYQ A;  1WRI A;  5D7G A;  1V1O A;  1ZXH A;  3AE8 B;  1XCQ L;  2ON8 A;  3NVV A;  1JML A;  1GOZ A;  1I4Q A;  1IGC A;  4RNA A;  4B0M A;  3Q8B A;  3LYY A;  1N62 A;  1VRA B;  3BVG A;  3PZ8 A;  1L0Y B;  2G1E A;  1XLN A;  2K0P A;  1MVK A;  4EE2 A;  2V3P A;  2WNM A;  4LLG M;  4KKI A;  3MP9 A;  2Y3A A;  4DXG A;  1JCK B;  1JRO A;  4RGM A;  2WDQ B;  3AM9 A;  1UNS A;  4L23 A;  3V3X A;  1TJE A;  4ZHO A;  5JXV A;  1FXA A;  2ONQ A;  3HVZ A;  2BW2 A;  2IGH A;  1NYQ A;  1IBX A;  2QIL A;  4ZOH C;  2WXM A;  4RGO S;  3NS1 A;  5MPO A;  1C78 A;  2MJ3 A;  4WAF A;  1EWC A;  5H92 C;  5HHD G;  2IJ0 A;  2PIA A;  1KRH A;  1XEE A;  2K22 A;  1NI3 A;  4WIP A;  1KLU D;  1FD6 A;  1MPE A;  4LK0 M;  1XF5 L;  3TSS A;  1OQR A;  1JWM D;  3BII D;  1PYW D;  3ZJU A;  1WSP A;  2E3T A;  2W3R A;  2H89 B;  3AE1 B;  1SE3 A;  3W1S A;  3VR9 B;  1H7X A;  3AE7 B;  3DWM A;  3VRB B;  2WQY B;  4OVZ A;  3VQI A;  3FIL A;  4RCO A;  4KKJ A;  3AE5 B;  2IPK D;  3BVZ A;  2WXF A;  4ZYS A;  3V05 A;  3KQ4 A;  3P1M A;  4C80 A;  1ENF A;  4RGT A;  2PKO A;  3C8Y A;  2KDM A;  3FIL B;  4H2A A;  3P4S B;  3CIR B;  2E6X A;  2RPV A;  3W9C B;  2PTL A;  4FXC A;  2XN9 C;  4OZC A;  2D5G A;  2LEK A;  3AEE B;  5G5H A;  2QEJ C;  5AUK A;  4TQ0 A;  1L6U A;  1PGX A;  2VZK D;  1FNW A;  3PZ7 A;  1VR9 A;  1SF0 A;  1ZE3 D;  2JWU A;  5D3D A;  1L0X B;  2M56 B;  5BYS A;  2YEP B;  4NJC A;  1TZO A;  1UWX A;  2QSD A;  2WDR B;  1YNT E;  4LTU A;  4TMA B;  3U52 E;  2QIE B;  2J42 A;  3MHZ A;  4C56 C;  3T3O A;  4A90 A;  4YTN B;  1Q10 A;  2L52 A;  1ET9 A;  2ZW1 A;  3NVY A;  4L1B A;  1K51 A;  2JQR B;  1C4A A;  3BWU D;  3Q8F A;  3BVM A;  3PO0 A;  5BYR A;  4US9 A;  3AEF B;  3VRA B;  2K3U A;  2INN E;  2WDV B;  1TKE A;  2JU6 X;  4KGR A;  1SBB B;  1SJH D;  2RDH A;  4YWG G;  1DGJ A;  2PMV A;  4ARI A;  1E0Z A;  1UWM A;  3DWG C;  1MHH E;  4A55 A;  4ARC A;  2QMT A;  1L6V A;  2LHE A;  1ACC A;  2JZP A;  1QIL A;  2W54 A;  4C7Y A;  1I4G A;  4R3D A;  2M0A A;  1ZOY B;  1C4C A;  1E7P B;  1QOG A;  2VZK B;  3B9J A;  3J9C A;  2RDG A;  4OZB A;  4P16 A;  1K52 A;  4TQ1 A;  3AN1 A;  1YMH E;  1SXT A;  1DOI A;  2BBC A;  2X38 A;  3TEZ A;  4XWW A;  1GTH A;  2INP E;  2QJL A;  3H8H A;  1EU3 A;  2Z8L A;  3Q8C A;  1NEN B;  4XDD A;  2V0G A;  1FXI A;  4YSZ B;  3AV8 A;  5D3I B;  4NAM A;  1D5X C;  3AED B;  4RF1 A;  2H88 B;  1FEH A;  1C77 A;  1EM7 A;  1FRD A;  1E10 A;  4KGS A;  1FRR A;  1VZ6 A;  1OQQ A;  3AE6 B;  1UUP A;  1XLQ A;  2HDE A;  1TYG B;  4N6E B;  1FO4 A;  2DYO A;  1V8C A;  2J52 A;  4YSY B;  2MJD A;  2WLB A;  1ZDV A;  5C2T B;  4ZRQ A;  1SB3 C;  2IGD A;  1XLP A;  1GAQ B;  5BMH A;  1KF6 B;  1J7A A;  1I4X A;  2LUM A;  2BB5 A;  4A8X C;  1ZUD 2;  2ZW0 A;  3NVW A;  3AEC B;  3B2G A;  1KLG D;  1SSN A;  4PT5 A;  1J7B A;  3CF4 A;  5EE3 A;  1FCC C;  2AQ3 B;  3W5V B;  1TS4 A;  4D2K A;  3NVZ A;  1HZ6 A;  1ESF A;  3BZD B;  1JRP A;  1OFF A;  1P7F A;  1B9R A;  2FE8 A;  4O1N A;  2I2Y A;  1K50 A;  3MJ5 A;  3TEY A;  3VR8 B;  3LB8 C;  1FM0 D;  3FAH A;  3KWL A;  1FFU A;  4ITK A;  1CZP A;  1TS5 A;  5FKA C;  4AQ7 A;  1FNV A;  3R2T A;  5BMG A;  3P4Q B;  3ETR A;  4HJG E;  3N9Y C;  2V4I B;  3ABV B;  1C79 A;  1FIQ A;  1P7E A;  1GTE A;  1CQV A;  3TUO A;  1T6B X;  2KMM A;  3L4P A;  2EKI A;  1N60 A;  1FNU A;  4IOI E;  3IAS 1;  3O13 A;  2WXK A;  2FUG 1;  1SIJ A;  1C9F A;  1TS3 A;  4ZHP A;  1QT9 A;  3URY A;  2W3S A;  3AH7 A;  2CJO A;  1WGK A;  2CU3 A;  4IKG A;  1MI0 A;  4CQN A;  2TSS A;  2WXJ A;  2IGG A;  3AMZ A;  1YQ3 B;  4P6V F;  1RM6 C;  2W55 A;  2WXP A;  4YTM B;  2PVO D;  1YQ4 B;  3P63 A;  2LHD A;  2NMQ A;  5HI1 A;  2NTS A;  4Q2J A;  3EUB 2;  2SAK A;  2M19 A;  3NRZ A;  1TKY A;  2CJN A;  2KWD A;  1NEK B;  4NZL B;  5E6J A;  1I4P A;  1DOX A;  2GI9 A;  1JWU D;  2B76 B;  2WXH A;  3LXF A;  2V3N A;  1VLB A;  1AW7 A;  3FC4 A;  2WU2 B;  3GS2 A;  4M0W A;  3GB1 A;  2DWQ A;  2N9K A;  2I38 A;  1PGA A;  3R2I A;  4XDC A;  1T3Q A;  2GB1 A;  1YN3 A;  2FBW B;  1ET6 A;  4IDI A;  3ZYY X;  5EE0 A;  2WXR A;  1K53 A;  2SEB D;  3EA6 A;  3AE3 B;  1GB1 A;  3B2F A;  4WUR A;  5FR3 A;  4L2Y A;  3TEX A;  1QLB B;  1VZ7 A;  1E6E B;  4RF0 A;  3I57 A;  5C3J B;  1BXT A;  3U7Z A;  2JYT A;  1HEZ E;  1D5M C;  4YXD B;  1HXY D;  5EE1 A;  3UI3 A;  1CJE A;  1DYQ A;  2WXO A;  3TEW A;  1QQR A;  2OHF A;  4MH8 A;  1QOB A;  3ZJT A;  1YJJ A;  4DXF A;  1XO3 A;  3AE9 B;  3W2D A;  4WWM A;  4YT0 B;  2JX5 A;  3P42 A;  4RH6 A;  1JAL A;  1Y56 A;  1TKG A;  2DBY A;  2Y5P A;  5HFY A;  4B0E A;  1FFV A;  1N5W A;  3AB5 A;  2Y5C A;  1SJE D;  3RFZ B;  5T8I A;  2Q5W D;  1T5X D;  1GB4 A;  4A6Q A;  2PLP A;  1UGJ A;  1WWT A;  1QKZ A;  2RMM A;  1M4V A;  2BTE A;  2K9X A;  3Q69 A;  1HA5 A;  4HKQ A;  2NTT A;  1V1P A;  2ICI A;  3IT4 B;  1L5P A;  2J53 A;  1TY0 A;  2LFI A;  4MT5 A;  2OED A;  2LGI A;  4MM3 B;  1F2R I;  4NAW B;  2GRI A;  1C4P A;  1HQR D;  1YJI A;  4GDL B;  1I7H A;  1MHX A;  1ZPS A;  2DLB A;  1N61 A;  3MFG A;  5GXG B;  3T3N A;  3ZQ4 A;  3SFD B;  1YN4 A;  1GT8 A;  2BT6 A;  2G9H D;  1D4B A;  4HRS A;  3R8B A;  1H7W A;  4GDK B;  1FCL A;  2PW9 A;  4GLS C;  2WXG A;  1KFY B;  1BML C;  1L4D B;  3E56 A;  1IGD A;  4HEA 1;  1XCT L;  2KAJ A;  4RGN A;  1I4R A;  2EEL A;  4YSX B;  1XXG A;  1F0Z A;  1ZDX A;  4N58 A;  2JYE A;  1WYG A;  1NVI D;  5BMI A;  3SR6 A;  5H8Y E;  5G5G A;  1E9M A;  4A9A A;  3SFE B;  1FMA D;  2BS2 B;  1QOF A;  1PUT A;  1RYJ A;  3U4E G;  1B1Z A;  2BYT A;  1LO5 D;  2IDY A;  1RFK A;  1KH0 A;  2ACZ B;  2KAC A;  1SE4 A;  5TSS A;  1DOY A;  1GPX A;  3AEB B;  2BS3 B;  3ZGZ A;  1R7S A;  2PVG C;  1TS2 A;  4OHJ A;  4HKZ E;  1IBX B;  2WP9 B;  2L83 A;  1PFD A;  3NZ3 A;  4JWS C;  4JX1 C;  4HRO A;  1YN5 A;  2MH7 A;  5AUI A;  4WH4 A;  5I4D A;  4XE0 A;  1AYF A;  3CWI A;  3HRD D;  1D5Z C;  1SE2 A;  2L1A A;  2XNA C;  3BYT B;  3GP7 A;  3KWV A;  1V1P B;  4ZRP A;  3EGR A;  2JXT A;  3W5U B;  3WCQ A;  2LJI A;  3NUH B;  3Q8E A;  1D6E C;  4J3O D;  1F2R C;  3KLS X;  1J7C A;  4OW0 A;  1PDX A;  2N7J A;  2MJE A;  3IAM 1;  1N5X A;  2BS4 B;  2HTM E;  4YTP B;  4JE3 B;  3ZJV A;  1ZXI A;  2WXI A;  4UDU C;  3BK1 A;  1AWD A;  2BB6 A;  1XLO A;  2AQ2 B;  2W82 A;  3IT6 B;  4TSS A;  3BYY B;  1IUE A;  2WXL A;  3I9V 1;  3AE2 B;  1STE A;  2WXN A;  3RPF C;  2WS3 B;  2L32 A;  4REZ A;  1QOA A;  1V97 A;  4OZA A;  1NYR A;  4JPS A;  4US8 A;  1SEB D;  1EU4 A;  1ROE A;  1ZP0 B;  2WXQ A;  5FK9 C;  1C76 A;  1A70 A;  3U2S C;  1QF6 A;  5HG2 A;  3HUI A;  4N59 A;  1VDV A;  1EWY C;  1KTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...