1L0VB

Quinol-fumarate reductase with menaquinol molecules
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
b'AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
total genus 69
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2002-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1l0vB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l0vB01
1SIJA 3DWMA 4US8A 3AE9B 4JX1C 3SFDB 4YTMB 1XLOA 2W55A 5H8YE 4KX6B 1V8CA 3AEFB 4JWUC 1GT8A 1JRPA 1JWAD 2H88B 1XO3A 3AE3B 1WWTA 1V97A 3P63A 1OQRA 1TKGA 2KAJA 3AE1B 1XLPA 3DWGC 3AE2B 4FXCA 3P4SB 3VRBB 1A70A 1QOBA 1RYJA 2AX5A 3CWIA 5G5HA 2ACZB 1XLQA 4YTNB 1J7BA 2WU5B 1DOYA 3B2FA 4US9A 3P4QB 3AV8A 3FAHA 3WCQA 4USAA 1WXQA 5G5GA 1L5PA 3AH7A 1PDXA 1WGKA 1L0VB 1EWYC 5H92C 3NRZA 2WU2B 3PO0A 3AE8B 1FO4A 1DGJA 1QOAA 1YJIA 1FFUA 2G1EA 3ETRA 2MJDA 1TYGB 3NVYA 2Q5WD 4WQMA 1NEKB 3NVZA 1PFDA 1SB3C 2B76B 3AEGB 2DBYA 1H7WA 2HTME 1I7HA 3P4PB 1PUTA 1VJKA 2MH7A 4N59A 2BS4B 3ZYYX 1DOXA 1E10A 1XLNA 1VLBA 1E0ZA 3P4RB 1N60A 1AWDA 2K22A 1GTHA 1RWSA 2W3RA 2M19A 2WS3B 1JROA 1TKEA 2MJEA 3AE4B 2Y5CA 3HUIA 4LTUA 1JALA 5C3JB 2DWQA 3B9JA 5EE9A 3FC4A 1GPXA 1N61A 4ZHOA 3BIID 2EKIA 2JQRB 4IDIA 2QJLA 3VRAB 3B2GA 4HROA 1CJEA 2OHFA 4P6VF 2L52A 3RPFC 1OFFA 1QT9A 2E3TA 2PVGC 2BS2B 2LEKA 3KWLA 2CJOA 3L4PA 1T3QA 1YQ3B 3SR6A 3W5UB 1UWMA 1J7AA 3AEEB 1NVID 2PIAA 3EUB2 3NVVA 1WYGA 1R7SA 3AE7B 3P1MA 1N63A 3AB5A 1DOIA 1B9RA 1JQ4A 1CZPA 4HRSA 2KMMA 3NVWA 3W5VB 1OQQA 3LB8C 3AEAB 2PKOA 1GTEA 3AEBB 1FM0D 4YSYB 1JW9D 3AM9A 2K5PA 3AECB 5MPOA 3HRDD 4YSXB 4ITKA 1NYRA 4WWMA 1QOGA 1E9MA 3NS1A 2N0SB 4YTPB 4A9AA 1TKYA 2WDVB 2PVOD 5AUKA 3AE6B 1KFYB 3CIRB 4C80A 1QOFA 5EE3A 2WQYB 2JX5A 1NI3A 4ZHPA 1H7XA 1E7PB 1IUEA 1ZUD2 1JWBD 2WDRB 4JWSC 1FIQA 2WLBA 1E6EB 5C2TB 4N6EB 4YSZB 2WP9B 2W54A 3LXFA 2CJNA 1YQ4B 1RFKA 3AMZA 4C7ZA 3VR8B 3CF4A 4YT0B 2WDQB 4ZOHC 1N5WA 1NYQA 2K9XA 2FBWB 1AYFA 1ZOYB 1WRIA 3ABVB 1FRRA 5AUIA 1VDVA 1TJEA 1L6VA 1RM6C 3SFEB 1QLBB 2BT6A 2MJ3A 4C7YA 1KF6B 1F0ZA 5EE1A 2L83A 3VR9B 1FXAA 2CU3A 1FFVA 3HVZA 5GXGB 2M56B 1FXIA 2QIEB 1J7CA 1NENB 1GAQB 1SF0A 2BS3B 2H89B 4YXDB 3AE5B 1KRHA 1L6UA 1ZXIA 3W9CB 1QF6A 1N62A 4N58A 1ZP0B 1N5XA 2W3SA 1FMAD 1FRDA 1ROEA 1YJJA 5EE0A 3AEDB 3AN1A
chains in the Genus database with same CATH superfamily
2BB6A 2MBBB 2FUHB 3SFDB 3K9OB 1WM2A 3S2AA 5BYRA 3OJ3A 4AWJA 2DYMA 2BYEA 4RGTA 1I42A 1T6BX 2BTEA 2ACZB 4M02A 2DZMA 3I3TB 4P1BC 5DPSA 2BYVE 1FO4A 3APDA 4OVVA 2KACA 1FFUA 3GS2A 2VH1A 4ZDVA 2NMQA 1PFDA 3AEGB 4YL8A 1I7HA 3IBEA 1VLBA 1HEZE 2LGYA 2ZNVC 3A1QB 1AWDA 2HJ1A 2PTLA 4HEA1 3TEWA 2Y5CA 3GZNI 4TSSA 3WIMA 1F9JA 1P1AA 4HLEA 1TS2A 4MGYE 4A3PA 2CS4A 1R4MI 1XF5L 1EWCA 1CJEA 3ZRCA 4KGTA 4X57B 2AL6A 2UU7A 3L16A 2WXMA 4KGSA 2NTTA 4E74A 1DOIA 4FADA 4HRSA 4N9F4 4K3CA 1FM0D 1JW9D 5HFYA 3CSTA 1I4PA 4ZRKA 4ASWC 3L10B 1MHXA 4HKZE 1GC6A 2O2VA 3X23A 4W9GA 4LJPB 1WRDB 4C4VA 2MP2A 4ICVA 1MPEA 2K9XA 5AUIA 2DZIA 3RNEC 3VDZA 4OVUA 2VH2A 4P16A 2KO3A 1YX5B 2JXXA 4GN1A 1MJDA 4MSMB 1WX9A 1J0GA 4PS3A 1D5MC 1VZ8A 3ZUNA 4QAYA 3TUOA 1ZPSA 2M8SA 2G45B 3AEFB 1Y56A 2ZZPB 2OJRA 1HZ5A 1OTRB 3RNFC 1YOVB 4P1CC 2WWZA 4MM3B 2EELA 2WU5B 4IM0A 4KV2A 1WGKA 1EU4A 3ZQ4A 4EZKA 4DK5A 2G1EA 3URYA 4ANWA 4GIVA 2LZ6A 3DBSA 1PUTA 3L54A 2IGDA 4HVBA 3M63B 3ZXRA 3KUZA 3N30A 3BIID 2IBIB 3T8MA 1EF1A 2V0GA 4HWIB 3L4PA 3SDLC 4JL9A 2AQ1B 3NVVA 3Q8FA 3AEAB 1IGDA 1R4MB 2PKOA 3AM9A 3Q3NC 4YSXB 2D2QA 4EFOA 2XBBC 2N4FA 2JX5A 4M0WB 5FR6A 4OVZA 4M0WA 3KH0A 1ENFA 2XK5B 2WP9B 2RGFA 3V61A 3PTFC 1HXYD 3ML8A 3QQ8B 5D2MB 2KWUB 1V9JA 4G3XB 2Z0DB 3AU4A 3H7SA 4NQKE 1WGDA 3QWZB 1KF6B 3ZRFA 2PMVA 2RD0A 4L2YA 4GSWA 3U7ZA 2J0MA 3JSVA 2JXTA 1FXIA 4M01A 2E6XA 5JHAA 1N62A 3VQIA 3AXCA 4TQ1A 3T3OA 3IT6B 4AS1A 3U8ZA 2JWUA 2H88B 1R4NI 3NHEB 1P98A 1V97A 2KAJA 3Q2AC 2JU6X 1Q1OA 4W9HA 1E8YA 1I4GA 1EO6A 3UQBA 3CWIA 1RYJA 2KX0A 2OJWA 1C76A 4US9A 2JWZA 3BZDB 5G5GA 1OGWA 3CMMB 5E6OA 2C7NB 2AWTA 2RPQA 3P2BA 1GTHA 3QK0A 2KANA 2A5UA 3HHMA 1KLUD 1EUVB 1LM8B 2ONQA 2RDBC 1TTNA 1WMHA 2PPHA 4LK0M 2WX1A 2J52A 4LJOB 4BAXA 2WXFA 3L0WB 3OG5A 1WY8A 1WMHB 2HJ8A 1K52A 2M0AA 4FJVB 4F7ZA 5BYSA 4WJQA 2GBJA 2WXKA 4WAFA 4C80A 2PVOD 2O2VB 3GZNB 4RGMA 5C2TB 2V9HA 3LXFA 4M8NA 2ON8A 1P0RA 1LO5D 4YT0B 2WDQB 1V49A 3IG3A 1FRRA 1WXSA 2KQSA 1BMLC 2WXGA 2UWQA 1UELA 2AQ2B 3B08A 2VZKB 4KDLB 3R8BA 4GMVA 3Q8CA 1SE3A 1KRHA 1UZXB 3PPAA 1WJUA 4GXBA 1T0QC 3L17A 5DPRA 5BMGA 1XD3B 2MBOA 1V5TA 4RCOA 4REZA 2NVUI 5LXIB 4GOCA 2IGHA 2CU1A 2K25A 2HD5B 1RAXA 4K81A 3RUIB 2KMAA 4LNFA 4E71A 1GNUA 3AH7A 1HTQA 1HA5A 2K6QA 2L8JA 5HG2A 1QOAA 2L00B 1L4DB 2W82A 3CF6E 5LNK1 2DBYA 3JYUA 1YD8U 3H8HA 4IUMB 2INDC 5FR3A 3AE4B 1D5ZC 2KVZA 2N9XA 4HROA 1V1PA 2O6VB 4RMAA 4EZJA 2E3TA 2LEKA 2AEHA 3RULA 1RLFA 1NVID 3E56A 1P7FA 4AOFA 1E8WA 4LNKA 5MPOA 1STEA 2WDVB 3NOBA 5AUKA 2G3QB 4RF1A 2KQ7A 2PE6B 2KJRA 3MJWA 3APCA 5T8IA 5AZHA 2FAZA 1V2YA 3RNBC 2NS5A 3DBHI 3CSFA 1Z5SB 2Z8LA 1NI2A 1EM7A 1WE7A 2KC2A 2MX2A 4IWQA 4RH6A 4MH8A 3AE5B 1QF6A 1WR1A 2JRIB 2MEKA 3PZ8A 3FILB 5C1ZA 5G55A 1XLOA 5D3DA 5H8YE 4KX6B 1V8CA 4RFBA 3EHVA 1TKGA 2INNE 1I4XA 3DWGC 1D4BA 1JWMD 3TSSA 1J7BA 2K1FA 3B2FA 3FAHA 3PLUA 1C78A 4JE3B 1WXQA 2R2OA 1OEYJ 3H1UA 1MFWA 2LUMA 1JWSD 2IYDB 1KLVA 2CHZA 4BOZB 2WXOA 4FA6A 2RDHA 2I1KA 3NVZA 2HTME 2QSDA 3M3JA 3EC8A 3ZYYX 4KGRA 1N60A 4KSKC 4OHJA 2YVCA 1L7YA 2JZZA 2DENB 2ZPNA 1N61A 2JQRB 2ZCBA 3SHQA 1V5OA 1XQQA 4AQ7A 1IYFA 2IPKD 4WWNA 4KKJA 4GGQA 1T0SC 3ZKJC 5E6NA 1RFAA 5HHDG 2LHDA 2X8XX 2PIAA 2W9NA 4B95A 1UUPA 3H9DA 1CZPA 1FNVA 1WIAA 1NYRA 4PYZA 4JQWC 2PEAA 1SE9A 4W9FA 3NZUA 3PSEB 1IUEA 4ANUA 2KWVB 2K3UA 1JCKB 3SEBA 2LUEA 3NJTA 1RFKA 2KNBA 3VR8B 4A6QA 2KWCA 2IGGA 1E7UA 2FBWB 1AYFA 1ZOYB 2R2QA 2J42A 4XGAB 1FCLA 5LXHA 1G6JA 3UIPB 2WGSA 4ZRJA 5JH5C 2KC1A 4XC2A 1L6UA 1WR6E 2V4IB 2N9LA 3L08A 3QHTA 4US8A 1PGXA 3NS8A 4C56C 1XLPA 2BWES 1GUAB 1AN8A 4HDQA 3DQVA 5D7GA 1VCBA 2IY1B 4II2B 4D2KA 2B3AA 4LNNA 2KQ4X 4HKQA 2EMTA 2INPE 1V80A 3P4PB 1MG4A 4EKUA 4A90A 3BWUD 3IHPC 3KLSX 1RWSA 4ICUA 4LLGM 4HXDA 3HUIA 3DBLI 3Q6BA 2OEDA 3U30A 1PGAA 3NZSA 2LRUA 4EZLA 1XCTL 5KHOA 3TEZA 4P6VF 3A9JB 3PLVA 1WXAA 1KM7A 2ZW1A 3JSVB 2QMTA 4I6NB 4EUTA 1AW7A 4HPLB 1D5XC 1R7SA 1YX6B 2KMMA 4TQ0A 3BVZA 4RM9A 3FILA 1SE2A 3NS1A 4GB9A 3L13A 3N3KB 2L0TA 2KDIA 5D94A 1C79A 2D07B 3LDZE 2KXJA 2DAFA 3DCGA 2LRWA 4JWSC 5JXVA 5E6PA 1VZ7A 1I4HA 1Y8RC 4TKNA 4NNJB 2SEBD 5LLIA 1MVKA 3TEXA 3NY5A 4J3OD 2WXHA 5IP4D 4B0MA 1RM6C 2KOXA 3GP7A 3TIXA 3I63C 4NJCA 4IWPA 1V86A 1NENB 2KTRA 3V62A 4YXDB 1YJ1A 4KZCA 2DHZA 1BUIC 1ROEA 3QJZA 3DWMA 4NPNA 1A5RA 1VD2A 3H7PB 2JPHA 1GJZA 3NZ3A 3B0AA 4XE0A 1SJED 2VZKD 4B6WA 2BB5A 1T5XD 2CKHB 2WNMA 1JRUA 2ASQA 3UGBB 1VZ6A 1H8CA 4OZCA 2OOBB 3AV8A 4K3BA 1PDXA 2M4NA 2R61A 4DXGA 3MC0B 3OAWA 2BYFA 1IPGA 1YJIA 2J53A 4BFRA 3A4RA 3ENEA 1UBIA 3PT2B 4FULA 3BK1A 4MELA 1MG8A 1HZ6A 2KX3A 1JALA 3B9JA 3U2SC 3R3MA 2ZPYA 2DYOA 3M95A 4CHKA 1X1MA 1WJ6A 1E90A 3WAPA 1YN3A 2DAJA 1QT9A 3R2TA 2MBEA 1T3QA 1YQ3B 4HCNB 1E7VA 5L83A 4C00A 2WYQA 4NAWA 3LYYA 2NPTB 2CHWA 3TBLD 2Z0EB 1SXTA 4KDIC 3VH3B 2C7HA 1WXVA 4Q2JA 2KDEB 3VTVA 4FN2A 1V1PB 4R3DA 2WLBA 3DVGY 3PVLA 3K9PB 2C9WB 1ESFA 3RCZA 3Q8AA 2XEWA 3CF4A 1NYQA 1K53A 1NDDA 1L6VA 3SFEB 2LVOA 3AU5A 2LGXA 4XWWA 4LDTD 3HVZA 5IOIA 1F77A 2L76A 3PREA 4AJYB 1CQVA 4WJPA 1LGRA 1GAQB 1SEBD 5G2NA 1ZXIA 3W9CB 3TEYA 4HPMB 4MJSA 1GB4A 5DPTA 2RMMA 4MJSB 3U4EG 3ZJVA 1WE6A 2XK5A 5L95C 5IKCM 2ZW0A 3BY4B 1P7EA 5JZEB 1OQRA 1LFDA 1ISNA 3AE2B 1MHHE 1QOBA 2JY6A 3D32A 5G5HA 4DXFA 3OLMD 1OQYA 1L0VB 2G4DB 3OJ4B 1E8XA 1TY2A 4CO7A 1EU3A 3ZJUA 1E10A 3P42A 4XYCA 3ZJTA 2JVCA 2K22A 1UGJA 3PGEA 4LTUA 3C8YA 1FNWA 2DWQA 5IAAC 1PGBA 2MQJA 5C23A 1K50A 4XZ4A 3AI5A 2DX5B 4W9JA 3ZNGC 2KJ6A 1SGHA 2JYTA 4S17A 2KKCA 3B1LX 1TIFA 1WI0A 4TV3A 2D5GA 5E6JA 3AB5A 1HTOA 2VRRB 2DZJA 2GOWA 2Y5PA 3JVZX 2PJHA 1QOGA 1E9MA 1ZKHA 3ZNHB 4WIPA 3HK0A 2LGIA 4HK2A 1UH6A 4ARIA 2WXLA 1JWBD 1PQSA 1FIQA 2D3CA 4LDTB 2CJNA 2WXQA 4W9IA 2IZVB 4DDID 1TT5B 2FCSA 1F0ZA 3HVDA 3QA8A 1Z2MA 4MGIE 2LXAA 2LGDA 1QILA 4K1RB 4G50A 1LXDA 2KTFA 2KT7A 2DYBA 2IO0B 1ZE3D 2K8BA 2HDEA 1JRPA 1JWAD 3DBRI 3AE1B 4FLHA 4MGKE 2BWFA 2N7EA 1V1OA 4HJGE 3P4QB 3ZDTA 2XNAC 1L5PA 5J17A 2M17A 4GDKA 2EKEC 3DHHC 1YMHE 1FPYA 4WQMA 2I1JA 1B1ZA 2B76B 2KTRB 2DLBA 2JRHA 1L0XB 3ZDMC 2FUG1 2LGSA 4KZ0A 2WX0A 1FXTB 1WYWB 2KZRA 3I57A 4XX5A 2QJLA 4KIKB 4MSQB 1U4AA 3X0WA 4W9LA 3W5UB 3VUYA 3H6NA 4A20A 1C9FA 1L2NA 5D3IB 3NVWA 4G0NB 4IC7B 3AECB 1VR9A 2K8CA 4G11A 4I6PA 4IWOA 1TKYA 1WGHA 3CIRB 2PLPA 2LVQA 1E7PB 3Q69A 4A55A 3N1ZC 1AARA 4K7UA 5GMVA 2KN4A 4FBJB 4C7ZA 5CHFA 4PK1A 2MSED 1BT0A 2MP2B 3GOEA 2YLMA 1S1QB 3SU8X 4RM8A 1FEHA 2L83A 2KDMA 3MC8A 4A8XC 4NZLB 2KDFB 2QIEB 2BBCA 1SF0A 1UNSA 2LI5A 2C60A 3AN1A 2YEPB 4MM3A 4YTMB 3QARA 2D11A 4BBNF 4EE2A 1V81A 2Y5BB 1WWTA 3Q14C 2MCNB 3KVFB 3EGRA 1A70A 4BZAA 2I38A 2L32A 3VHTC 3ZGZA 3AE8B 2N9EB 5IN7A 1BXTA 1TYGB 2Q5WD 2A4ZA 1WXMA 3WA0A 1SB3C 4XDCA 2M0XA 3NG0A 1XEEA 3ZTCA 1DOXA 2V3SA 3UINB 4AJWA 2D3AA 2KMCA 3KQ4A 2UYZB 1GB1A 2M19A 2KJHB 1JROA 1S3SG 2BW2A 5C3JB 4DHJD 5EE9A 3MTNB 4W9CA 5J2RA 3A9KB 1WH3A 3TMPB 3QAQA 1SIFA 3ZNZB 2NBUA 4NQLB 4NY0A 3NUHB 4GDLA 1P9DU 3W5VB 1OQQA 1GTEA 4PS7A 4WWMA 2LMCA 3PV1A 4XWTA 3WAMA 3VFKA 4IOIE 2DZKA 4I6LB 2BYTA 3OWEB 3R66C 1TS4A 2W54A 5CX3A 2MRPA 2FE8A 4ZOHC 2IY0B 2J0JA 3R7RA 5CHVC 4NAWB 1WGRA 1KOTA 3VR9B 1UGMA 3IAS1 2V1YA 1ACCA 4DHJB 2RR9A 2LFIA 3E9SA 4KKIA 4ARCA 3J9CA 3RD2A 4DHZE 1ZP0B 1XCQL 3UQAA 2QEJC 3Q8EA 5EE0A 4ZRQA 2AQ3B 2J7QB 4HCPB 4DHZB 5FK9C 3DVGX 4M8MA 3P63A 4FJYA 1SE4A 2X38A 3PHXB 4JPSA 3I9V1 2N9KA 3W1SC 4L23A 3W2DA 1EWYC 1TS5A 3NRZA 2N7JA 4WH4A 1DGJA 4BKTA 4ANXA 4B9KA 2KLGA 2MJDA 1VJKA 3N1XC 2V4LA 1XLNA 3PS6A 3APFA 2HTHA 3A9JA 4URKA 1TKEA 2IO3B 1WGYA 3N32A 3W1SA 2V3PA 2WXPA 3MJ5A 2GMIC 4IDIA 3HM6X 3B2GA 1SSNA 2EMSA 2KVRA 2L7RA 4BKSD 3EECA 3KWLA 2AYOB 2K39A 1KH0A 2IO2B 4RNAA 2QC8A 1IBXA 1QKZA 2WQYB 1WX7A 3A9KA 4RGOS 4FHJA 1TS3A 4B0EA 3V60A 2WDRB 2GBMA 5AZGA 2ZVOA 1CMXB 4YWGG 3VH4B 1I35A 1R4NB 4TUUA 2RPVA 3KWVA 3A1QA 3BYTB 3IXSA 2BGFA 1FXAA 4DWFA 2GBRA 3M62B 1DYQA 1I4RA 1N5XA 3VTUA 1YJJA 1WF9A 3AULA 2CR5A 4DQOC 1J8CA 2LJ5A 3ECIA 3N1YC 2W55A 3ONSA 4HJKA 1GT8A 2GRIA 2YEPF 3RNAC 3P4SB 4RGNA 2D10A 3VUXA 1T0YA 2FCMA 1WJ4A 1KTKA 2ZCCA 4K7WA 1KLGD 3TCAA 4S0RA 3RFZB 3NVYA 3BINA 4IG7B 1NEKB 5JHBA 1VRAB 1H7WA 2ZNVB 4WJOA 4MGZE 5I4DA 1J19A 2KN5A 2KHWB 3KW5B 4GLSC 4BOSC 4K7SA 2W3RA 3IT4B 2MJEA 1WSPA 2Y3AA 5IA7A 2PE9A 2K8HA 1T0RC 3R7QA 1YN5A 4LCDE 2PVGC 2BS2B 1FNUA 2CJOA 2GI9A 5CHWA 2MBQA 3DOWA 1N63A 5CTRC 3PHWB 3RN9C 2K5PA 5BO4B 3HRDD 4EEWA 2N0SB 4YTPB 2L3ZA 5HI1A 1NI3A 1H7XA 2LVPA 4KIKA 1UBQA 4M00A 4AP4C 4N6EB 4KSLC 1C1YB 1C4AA 2L1AA 1JWUD 3ZXVA 3EFCA 2MHJA 1ZDXA 2Z59B 1V6EA 2MBHA 2O6VD 1CK1A 1ET6A 5FKAC 2BKFA 5EE1A 1KJTA 4F8CB 3ZVVA 4NAMA 4GDLB 2BKRB 1FMAD 3RT3B 1E0ZA 2L05A 3N20C 5TR5A 4JX1C 4O1NA 2WXNA 3AE3B 3DBLB 2CHXA 1F2RI 4J6IA 3QCAA 4FXCA 3VRBB 2KFKA 1ET9A 1LQBA 3QIJA 2BQQA 3ZIMA 2GB1A 3Q3OC 4OZBA 1DOYA 3WAOA 4USAA 1WFYA 3VUWA 5H92C 2MA9B 4DBGA 4ZYSA 1F52A 1F2RC 1UD7A 3DVNU 1L4ZB 2IDYA 3V3XA 1WX8A 3DVNV 4N59A 3EA6A 1EF5A 5KHQA 1WJNA 3JW0X 1C4PA 3VVWB 4ZHOA 1GC7A 4HPPA 4WQOB 3VRAB 2HE7A 1NBFC 3VTWA 1Q5WB 5AZFA 3RNCC 1UWMA 5J18A 3C0RB 3RYTA 3AE7B 2J0KA 1FCCC 2C7MB 3DBHB 1KFYB 1QOFA 3R2IA 1Q0WB 2K6DB 2WXRA 1OEYA 3A4SC 1YIWA 4A3OA 3BVGA 1SBBB 3AMZA 3I5JC 4JIOU 2N1VA 3O13A 5TSSA 4ZRIA 2DNFA 3GE8C 3ZW3A 5DPWA 3ALBA 4W9DA 5GXGB 3MHZA 2BS3B 2H89B 2WXIA 4N58A 3MC9A 1YNTE 2D3GA 2PW9A 1M94A 5D6JB 4L1BA 2IO1B 2LWPA 2I2YA 2ZEQA 1ZGUB 5BMIA 2V3NA 1XLQA 3U7DA 1P3QU 3PRPB 4IW0A 2FCNA 3SD5A 1SJHD 1H4RA 3KYCD 3Q3FA 1WZ3A 2JUOA 3VXWA 2WHIA 2BS4B 2INCC 2C5LC 2KDBA 4GDKB 2FIDA 3TL5A 1QZEA 3BYYB 3PRMB 2WS3B 4DXAB 1M4VA 4PT5A 2LJIA 2EKIA 4FJZA 1RRBA 3V6EB 2OHFA 4AUQC 2IJ0A 4ZRPA 3SR6A 3LJ3A 1TZ1A 2N7DA 3EUB2 1C77A 1WGGA 3FKYA 1JQ4A 1HQRD 4WAAA 3GE3C 2D3BA 4KVGB 3N9YC 4ITKA 4HDOA 5EDSA 1D3ZA 4BBNC 4ZYNA 2BVCA 4H2AA 4ZHPA 1IGCA 1ZUD2 3IFWB 1E6EB 2J4XA 2QDFA 4OZAA 2NR2A 4WURA 4DDGD 2XN9C 3A33B 1WRIA 5AEKB 2KLCA 1TJEA 2MJ3A 1WZ0A 4MDKE 1Q10A 2JSVX 2N1WA 2BF8B 2M56B 2AL3A 4XDDA 1N6ZA 2QCZA 4F1SA 2KFJA 3HIZA 2LXCA 4BKSA 4CYEA 3RI7C 4C4VB 1SIJA 3DPDA 1K51A 4LNOA 3AE9B 2KD0A 3PZ7A 4WJNA 1YQBA 2K0PA 4ACFA 4MEMA 4GU2A 2FIFA 2SAKA 1HE8A 2M1MA 3WCQA 3Q3JA 3EFUA 4LNIA 4NJ7A 4E3CA 2BPSA 2NTSA 2WU2B 2JZPA 4TMAB 3UF8A 3KUCB 3ETRA 5IO9A 2MH7A 4ANVA 3P4RB 4W9KA 3GB1A 1UWXA 4II3B 3FC4A 1GPXA 3ZNID 3PZDA 2NPTA 1L0YB 3RPFC 2L52A 2MW5A 5BMHA 2GBKA 3DHGC 2ZJDA 3BVMA 1J7AA 3AEEB 4MH0E 3O65B 3P1MA 1C4CA 3IVFA 2MWSB 1MI0A 5BYQA 3LB8C 3DHIC 3QX1A 1XXGA 4A9AA 3ML9A 1I4QA 4PS8A 5EE3A 3WALA 2L0FA 2G4SA 1YN4A 4BVUC 1YQ4B 3ZLZA 3ZTDA 4WWPA 1D6EC 3Q8BA 3Q3MC 3DBRB 1N5WA 2NCNA 2JT4B 3RZFA 1VDVA 2ICIA 3WANA 2BT6A 1QLBB 2GLSA 2RSUA 4NJ6A 2CU3A 1ZDVA 1FFVA 3U52E 4BKGA 2FNJB 1TBEA 1TGZB 1J7CA 4MACA 2W3SA 4P7IA 4IM2A 1FRDA 1IP9A 2TSSA 4UDUC 1IBXB 3T3NA 2JZ3B 4JWUC 1ZXHA 2G9HD 1XO3A 3W1YA 3VAWA 2KWDA 2FCQA 2KYWA 2O6VA 1QQRA 3MHSD 2AX5A 2WXJA 3V05A 3HM3A 4YTNB 4MT5A 3ZO5B 3RZWC 2WDTB 4FHKA 2NBWB 4IKGA 3PO0A 1WM3A 3UI3A 1ZW7A 2JYEA 4OW0A 1GOZA 1E8ZA 4PYUA 4CQNA 4RF0A 2LHEA 4IM3A 3RMKC 3IAM1 3DDCB 2GBNA 3V6CB 3T9LA 5HKHA 1OFFA 3H7PA 3MFGA 2QHOA 1WYGA 3KYDD 1B9RA 3RNGC 1E5WA 3AEBB 4YSYB 2MLBA 2KFKB 3AE6B 1TZOA 2NBVB 5DCNA 3UIOB 1C3TA 2KK8A 3PRZA 3C19A 4JGHB 4WWOA 4YSZB 3MP9A 1F1HA 1UF0A 1XT9B 3QC8B 2RDGA 3ABVB 2REXA 3BK2A 2LD9A 1FD6A 2JF5A 1GG3A 4C7YA 2ZVNA 4EOYA 1TY0A 4JLCA 1PYWD 4W9EA 2QILA 3KUDB 1K8RB 3TJPA 2LASA 2N9PC 1JMLA 3AEDB
chains in the Genus database with same CATH topology
3FILB 2BB6A 1ZE3D 3SFDB 1XLOA 4JX1C 4O1NA 5D3DA 2WXNA 5H8YE 5BYRA 4KX6B 1V8CA 2HDEA 4RFBA 1JRPA 1JWAD 3AE3B 1TKGA 2DYMA 2INNE 3AE1B 1I4XA 1F2RI 3DWGC 4FXCA 4RGTA 3VRBB 1ET9A 1D4BA 1JWMD 3TSSA 1T6BX 2BTEA 2ACZB 2GB1A 1V1OA 1J7BA 4HJGE 4OZBA 3B2FA 1DOYA 3P4QB 3FAHA 4JE3B 1C78A 4USAA 1WXQA 2XNAC 1L5PA 2LUMA 5H92C 1JWSD 1FO4A 4ZYSA 2KACA 2WXOA 1F2RC 1FFUA 3GS2A 2RDHA 1YMHE 4WQMA 1L4ZB 2NMQA 1B1ZA 1PFDA 3NVZA 2B76B 3AEGB 2HTME 1I7HA 2IDYA 2QSDA 3V3XA 4N59A 3ZYYX 2DLBA 4KGRA 3EA6A 1VLBA 1HEZE 1L0XB 1N60A 1AWDA 2FUG1 4OHJA 2PTLA 4HEA1 3TEWA 2Y5CA 4TSSA 1C4PA 1TS2A 1N61A 4ZHOA 3I57A 2JQRB 2QJLA 3VRAB 1EWCA 1XF5L 1CJEA 4AQ7A 2IPKD 4KKJA 4KGTA 2WXMA 5HHDG 3W5UB 1UWMA 4KGSA 2NTTA 2LHDA 2PIAA 1C9FA 3AE7B 1DOIA 1UUPA 1CZPA 4HRSA 5D3IB 3NVWA 1FM0D 1FCCC 1FNVA 1JW9D 5HFYA 1I4PA 3AECB 1VR9A 1NYRA 1TKYA 1MHXA 3CIRB 1KFYB 2PLPA 1QOFA 4HKZE 3R2IA 1E7PB 1IUEA 3Q69A 4A55A 2K3UA 2WXRA 1JCKB 3SEBA 1RFKA 2KN4A 3BVGA 1SBBB 3AMZA 4C7ZA 3VR8B 1MPEA 3O13A 4A6QA 2IGGA 2K9XA 2FBWB 1AYFA 1ZOYB 5TSSA 2J42A 1FCLA 5AUIA 1FEHA 2L83A 2KDMA 4P16A 5GXGB 3MHZA 4A8XC 4NZLB 2QIEB 2BBCA 1SF0A 2BS3B 2H89B 1UNSA 1L6UA 2WXIA 2V4IB 4N58A 2N9LA 1D5MC 1VZ8A 1YNTE 3AN1A 3TUOA 2YEPB 4US8A 1ZPSA 1PGXA 2PW9A 4YTMB 4L1BA 3AEFB 1Y56A 4C56C 4EE2A 2I2YA 1HZ5A 1WWTA 1XLPA 5BMIA 3EGRA 1AN8A 1A70A 2V3NA 1XLQA 4MM3B 2EELA 2WU5B 5D7GA 2I38A 2L32A 1WGKA 3ZGZA 4D2KA 1EU4A 1SJHD 3ZQ4A 3AE8B 2G1EA 1BXTA 1TYGB 3URYA 2KQ4X 2Q5WD 4HKQA 2INPE 1SB3C 4XDCA 3P4PB 1PUTA 2BS4B 1XEEA 2IGDA 4A90A 1DOXA 3BWUD 3KLSX 1E0ZA 4GDKB 1RWSA 3BYYB 3KQ4A 4LLGM 1GB1A 2M19A 2WS3B 1JROA 1M4VA 3HUIA 4PT5A 2BW2A 5C3JB 2OEDA 5EE9A 1PGAA 2LJIA 3BIID 2EKIA 1XCTL 3TEZA 2OHFA 4P6VF 2IJ0A 4ZRPA 2V0GA 3L4PA 2ZW1A 3SR6A 2QMTA 1AW7A 2AQ1B 3EUB2 3NVVA 3Q8FA 3NUHB 1D5XC 1R7SA 1C77A 1JQ4A 2KMMA 3W5VB 1HQRD 1OQQA 4TQ0A 3AEAB 1IGDA 1GTEA 2PKOA 3BVZA 3AM9A 3FILA 1SE2A 3N9YC 4YSXB 4ITKA 4WWMA 2LMCA 3NS1A 4XWTA 2JX5A 1C79A 4H2AA 4ZHPA 4IOIE 2BYTA 4OVZA 1IGCA 4M0WA 1ZUD2 3OWEB 4JWSC 1ENFA 5JXVA 1E6EB 1TS4A 1VZ7A 1I4HA 2WP9B 2W54A 2J4XA 1HXYD 4OZAA 2SEBD 4WURA 2FE8A 2XN9C 4ZOHC 1MVKA 1WRIA 3TEXA 4J3OD 4NAWB 1TJEA 2WXHA 4B0MA 1RM6C 2MJ3A 3GP7A 1KF6B 2PMVA 3VR9B 4L2YA 1Q10A 3U7ZA 2JSVX 3IAS1 4NJCA 2M56B 4XDDA 2JXTA 1ACCA 1FXIA 2LFIA 1NENB 4YXDB 3E9SA 4KKIA 4ARCA 3J9CA 2E6XA 1N62A 3VQIA 1ZP0B 1XCQL 1BUIC 4TQ1A 1ROEA 2QEJC 3Q8EA 5EE0A 4ZRQA 1SIJA 2AQ3B 3DWMA 1K51A 3IT6B 3T3OA 4AS1A 3AE9B 2JWUA 3NZ3A 5FK9C 4XE0A 2H88B 1SJED 2VZKD 3PZ7A 2BB5A 1V97A 3P63A 1T5XD 2KAJA 2JU6X 2WNMA 1SE4A 2X38A 1I4GA 2K0PA 3CWIA 1RYJA 4JPSA 3I9V1 1VZ6A 2SAKA 1C76A 4US9A 2N9KA 3BZDB 4OZCA 3AV8A 3WCQA 5G5GA 1PDXA 2R61A 4L23A 3W2DA 1EWYC 3MC0B 2NTSA 4DXGA 1TS5A 2WU2B 3NRZA 2N7JA 2JZPA 1DGJA 4WH4A 1YJIA 2J53A 4TMAB 3ETRA 2MJDA 2MH7A 1VJKA 1XLNA 3P4RB 1GTHA 1TKEA 3BK1A 1HZ6A 3GB1A 1UWXA 1JALA 1KLUD 3W1SA 2ONQA 2V3PA 3B9JA 2WXPA 3FC4A 3U2SC 1GPXA 3MJ5A 4IDIA 3B2GA 4LK0M 2DYOA 1SSNA 1L0YB 2J52A 3RPFC 2L52A 1YN3A 5BMHA 2WXFA 1QT9A 3R2TA 3KWLA 1T3QA 3BVMA 1YQ3B 1J7AA 3AEEB 1KH0A 3P1MA 1C4CA 3LYYA 1MI0A 1K52A 5BYQA 2M0AA 3LB8C 4RNAA 5BYSA 1XXGA 1IBXA 1SXTA 1QKZA 4A9AA 4WAFA 2WXKA 4C80A 2PVOD 1I4QA 5EE3A 2WQYB 4Q2JA 4RGOS 1TS3A 4B0EA 2WDRB 1YN4A 1V1PB 4R3DA 4RGMA 2WLBA 5C2TB 4YWGG 3LXFA 1YQ4B 2ON8A 1ESFA 1LO5D 3Q8AA 1D6EC 3CF4A 2RPVA 4YT0B 2WDQB 3Q8BA 1N5WA 1NYQA 1FRRA 1K53A 1VDVA 1L6VA 2ICIA 3SFEB 1QLBB 2BT6A 3KWVA 3BYTB 3IXSA 1FXAA 4XWWA 1BMLC 2CU3A 1ZDVA 1FFVA 2WXGA 3HVZA 3U52E 2AQ2B 1F77A 2VZKB 1CQVA 3R8BA 3Q8CA 1SE3A 1J7CA 1GAQB 1SEBD 3W9CB 1DYQA 1ZXIA 1KRHA 3TEYA 1GB4A 1I4RA 4MACA 2RMMA 1N5XA 2W3SA 3U4EG 1FRDA 3ZJVA 1YJJA 2TSSA 5BMGA 4UDUC 4RCOA 4REZA 1IBXB 3T3NA 4DQOC 2ZW0A 1P7EA 2W55A 4JWUC 1GT8A 1ZXHA 2G9HD 2IGHA 1XO3A 2GRIA 2KWDA 1OQRA 2YEPF 1QQRA 3AE2B 3P4SB 1MHHE 1QOBA 2AX5A 4RGNA 5G5HA 2WXJA 3V05A 4DXFA 4YTNB 4MT5A 1KTKA 3AH7A 4IKGA 1HA5A 1L0VB 1KLGD 1TY2A 3PO0A 5HG2A 1QOAA 3UI3A 2JYEA 3RFZB 3NVYA 4OW0A 1L4DB 1NEKB 2W82A 1VRAB 5LNK1 2DBYA 1EU3A 1H7WA 3ZJUA 1E10A 1GOZA 3P42A 5I4DA 3H8HA 3ZJTA 4CQNA 4GLSC 2K22A 5FR3A 2W3RA 2LHEA 3IT4B 4RF0A 1UGJA 2MJEA 4LTUA 1WSPA 3AE4B 3C8YA 2Y3AA 1FNWA 2DWQA 1PGBA 1D5ZC 1K50A 3IAM1 4HROA 1V1PA 1OFFA 1YN5A 2E3TA 2PVGC 2BS2B 1FNUA 2LEKA 2CJOA 2GI9A 2JYTA 3MFGA 1NVID 1WYGA 2D5GA 5E6JA 1N63A 3AB5A 3E56A 1B9RA 1P7FA 3AEBB 4YSYB 2K5PA 2Y5PA 5MPOA 3HRDD 1QOGA 1E9MA 1STEA 4YTPB 2N0SB 2WDVB 4WIPA 5AUKA 3AE6B 1TZOA 5HI1A 2LGIA 1NI3A 4ARIA 4RF1A 2WXLA 1H7XA 1JWBD 1FIQA 5T8IA 4N6EB 4YSZB 3MP9A 2CJNA 2WXQA 1C4AA 2L1AA 1JWUD 1ZDXA 2RDGA 3ABVB 3BK2A 1CK1A 1ET6A 2Z8LA 5FKAC 1FD6A 4C7YA 1F0ZA 5EE1A 1TY0A 3HVDA 1EM7A 1PYWD 2QILA 4RH6A 4MH8A 1QILA 3AE5B 4NAMA 1QF6A 1JMLA 4GDLB 2MEKA 1FMAD 3PZ8A 3AEDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SIJ A;  3DWM A;  4US8 A;  3AE9 B;  4JX1 C;  3SFD B;  4YTM B;  1XLO A;  2W55 A;  5H8Y E;  4KX6 B;  1V8C A;  3AEF B;  4JWU C;  1GT8 A;  1JRP A;  1JWA D;  2H88 B;  1XO3 A;  3AE3 B;  1WWT A;  1V97 A;  3P63 A;  1OQR A;  1TKG A;  2KAJ A;  3AE1 B;  1XLP A;  3DWG C;  3AE2 B;  4FXC A;  3P4S B;  3VRB B;  1A70 A;  1QOB A;  1RYJ A;  2AX5 A;  3CWI A;  5G5H A;  2ACZ B;  1XLQ A;  4YTN B;  1J7B A;  2WU5 B;  1DOY A;  3B2F A;  4US9 A;  3P4Q B;  3AV8 A;  3FAH A;  3WCQ A;  4USA A;  1WXQ A;  5G5G A;  1L5P A;  3AH7 A;  1PDX A;  1WGK A;  1L0V B;  1EWY C;  5H92 C;  3NRZ A;  2WU2 B;  3PO0 A;  3AE8 B;  1FO4 A;  1DGJ A;  1QOA A;  1YJI A;  1FFU A;  2G1E A;  3ETR A;  2MJD A;  1TYG B;  3NVY A;  2Q5W D;  4WQM A;  1NEK B;  3NVZ A;  1PFD A;  1SB3 C;  2B76 B;  3AEG B;  2DBY A;  1H7W A;  2HTM E;  1I7H A;  3P4P B;  1PUT A;  1VJK A;  2MH7 A;  4N59 A;  2BS4 B;  3ZYY X;  1DOX A;  1E10 A;  1XLN A;  1VLB A;  1E0Z A;  3P4R B;  1N60 A;  1AWD A;  2K22 A;  1GTH A;  1RWS A;  2W3R A;  2M19 A;  2WS3 B;  1JRO A;  1TKE A;  2MJE A;  3AE4 B;  2Y5C A;  3HUI A;  4LTU A;  1JAL A;  5C3J B;  2DWQ A;  3B9J A;  5EE9 A;  3FC4 A;  1GPX A;  1N61 A;  4ZHO A;  3BII D;  2EKI A;  2JQR B;  4IDI A;  2QJL A;  3VRA B;  3B2G A;  4HRO A;  1CJE A;  2OHF A;  4P6V F;  2L52 A;  3RPF C;  1OFF A;  1QT9 A;  2E3T A;  2PVG C;  2BS2 B;  2LEK A;  3KWL A;  2CJO A;  3L4P A;  1T3Q A;  1YQ3 B;  3SR6 A;  3W5U B;  1UWM A;  1J7A A;  3AEE B;  1NVI D;  2PIA A;  3EUB 2;  3NVV A;  1WYG A;  1R7S A;  3AE7 B;  3P1M A;  1N63 A;  3AB5 A;  1DOI A;  1B9R A;  1JQ4 A;  1CZP A;  4HRS A;  2KMM A;  3NVW A;  3W5V B;  1OQQ A;  3LB8 C;  3AEA B;  2PKO A;  1GTE A;  3AEB B;  1FM0 D;  4YSY B;  1JW9 D;  3AM9 A;  2K5P A;  3AEC B;  5MPO A;  3HRD D;  4YSX B;  4ITK A;  1NYR A;  4WWM A;  1QOG A;  1E9M A;  3NS1 A;  2N0S B;  4YTP B;  4A9A A;  1TKY A;  2WDV B;  2PVO D;  5AUK A;  3AE6 B;  1KFY B;  3CIR B;  4C80 A;  1QOF A;  5EE3 A;  2WQY B;  2JX5 A;  1NI3 A;  4ZHP A;  1H7X A;  1E7P B;  1IUE A;  1ZUD 2;  1JWB D;  2WDR B;  4JWS C;  1FIQ A;  2WLB A;  1E6E B;  5C2T B;  4N6E B;  4YSZ B;  2WP9 B;  2W54 A;  3LXF A;  2CJN A;  1YQ4 B;  1RFK A;  3AMZ A;  4C7Z A;  3VR8 B;  3CF4 A;  4YT0 B;  2WDQ B;  4ZOH C;  1N5W A;  1NYQ A;  2K9X A;  2FBW B;  1AYF A;  1ZOY B;  1WRI A;  3ABV B;  1FRR A;  5AUI A;  1VDV A;  1TJE A;  1L6V A;  1RM6 C;  3SFE B;  1QLB B;  2BT6 A;  2MJ3 A;  4C7Y A;  1KF6 B;  1F0Z A;  5EE1 A;  2L83 A;  3VR9 B;  1FXA A;  2CU3 A;  1FFV A;  3HVZ A;  5GXG B;  2M56 B;  1FXI A;  2QIE B;  1J7C A;  1NEN B;  1GAQ B;  1SF0 A;  2BS3 B;  2H89 B;  4YXD B;  3AE5 B;  1KRH A;  1L6U A;  1ZXI A;  3W9C B;  1QF6 A;  1N62 A;  4N58 A;  1ZP0 B;  1N5X A;  2W3S A;  1FMA D;  1FRD A;  1ROE A;  1YJJ A;  5EE0 A;  3AED B;  3AN1 A; 
#chains in the Genus database with same CATH topology
 2BB6 A;  2MBB B;  2FUH B;  3SFD B;  3K9O B;  1WM2 A;  3S2A A;  5BYR A;  3OJ3 A;  4AWJ A;  2DYM A;  2BYE A;  4RGT A;  1I42 A;  1T6B X;  2BTE A;  2ACZ B;  4M02 A;  2DZM A;  3I3T B;  4P1B C;  5DPS A;  2BYV E;  1FO4 A;  3APD A;  4OVV A;  2KAC A;  1FFU A;  3GS2 A;  2VH1 A;  4ZDV A;  2NMQ A;  1PFD A;  3AEG B;  4YL8 A;  1I7H A;  3IBE A;  1VLB A;  1HEZ E;  2LGY A;  2ZNV C;  3A1Q B;  1AWD A;  2HJ1 A;  2PTL A;  4HEA 1;  3TEW A;  2Y5C A;  3GZN I;  4TSS A;  3WIM A;  1F9J A;  1P1A A;  4HLE A;  1TS2 A;  4MGY E;  4A3P A;  2CS4 A;  1R4M I;  1XF5 L;  1EWC A;  1CJE A;  3ZRC A;  4KGT A;  4X57 B;  2AL6 A;  2UU7 A;  3L16 A;  2WXM A;  4KGS A;  2NTT A;  4E74 A;  1DOI A;  4FAD A;  4HRS A;  4N9F 4;  4K3C A;  1FM0 D;  1JW9 D;  5HFY A;  3CST A;  1I4P A;  4ZRK A;  4ASW C;  3L10 B;  1MHX A;  4HKZ E;  1GC6 A;  2O2V A;  3X23 A;  4W9G A;  4LJP B;  1WRD B;  4C4V A;  2MP2 A;  4ICV A;  1MPE A;  2K9X A;  5AUI A;  2DZI A;  3RNE C;  3VDZ A;  4OVU A;  2VH2 A;  4P16 A;  2KO3 A;  1YX5 B;  2JXX A;  4GN1 A;  1MJD A;  4MSM B;  1WX9 A;  1J0G A;  4PS3 A;  1D5M C;  1VZ8 A;  3ZUN A;  4QAY A;  3TUO A;  1ZPS A;  2M8S A;  2G45 B;  3AEF B;  1Y56 A;  2ZZP B;  2OJR A;  1HZ5 A;  1OTR B;  3RNF C;  1YOV B;  4P1C C;  2WWZ A;  4MM3 B;  2EEL A;  2WU5 B;  4IM0 A;  4KV2 A;  1WGK A;  1EU4 A;  3ZQ4 A;  4EZK A;  4DK5 A;  2G1E A;  3URY A;  4ANW A;  4GIV A;  2LZ6 A;  3DBS A;  1PUT A;  3L54 A;  2IGD A;  4HVB A;  3M63 B;  3ZXR A;  3KUZ A;  3N30 A;  3BII D;  2IBI B;  3T8M A;  1EF1 A;  2V0G A;  4HWI B;  3L4P A;  3SDL C;  4JL9 A;  2AQ1 B;  3NVV A;  3Q8F A;  3AEA B;  1IGD A;  1R4M B;  2PKO A;  3AM9 A;  3Q3N C;  4YSX B;  2D2Q A;  4EFO A;  2XBB C;  2N4F A;  2JX5 A;  4M0W B;  5FR6 A;  4OVZ A;  4M0W A;  3KH0 A;  1ENF A;  2XK5 B;  2WP9 B;  2RGF A;  3V61 A;  3PTF C;  1HXY D;  3ML8 A;  3QQ8 B;  5D2M B;  2KWU B;  1V9J A;  4G3X B;  2Z0D B;  3AU4 A;  3H7S A;  4NQK E;  1WGD A;  3QWZ B;  1KF6 B;  3ZRF A;  2PMV A;  2RD0 A;  4L2Y A;  4GSW A;  3U7Z A;  2J0M A;  3JSV A;  2JXT A;  1FXI A;  4M01 A;  2E6X A;  5JHA A;  1N62 A;  3VQI A;  3AXC A;  4TQ1 A;  3T3O A;  3IT6 B;  4AS1 A;  3U8Z A;  2JWU A;  2H88 B;  1R4N I;  3NHE B;  1P98 A;  1V97 A;  2KAJ A;  3Q2A C;  2JU6 X;  1Q1O A;  4W9H A;  1E8Y A;  1I4G A;  1EO6 A;  3UQB A;  3CWI A;  1RYJ A;  2KX0 A;  2OJW A;  1C76 A;  4US9 A;  2JWZ A;  3BZD B;  5G5G A;  1OGW A;  3CMM B;  5E6O A;  2C7N B;  2AWT A;  2RPQ A;  3P2B A;  1GTH A;  3QK0 A;  2KAN A;  2A5U A;  3HHM A;  1KLU D;  1EUV B;  1LM8 B;  2ONQ A;  2RDB C;  1TTN A;  1WMH A;  2PPH A;  4LK0 M;  2WX1 A;  2J52 A;  4LJO B;  4BAX A;  2WXF A;  3L0W B;  3OG5 A;  1WY8 A;  1WMH B;  2HJ8 A;  1K52 A;  2M0A A;  4FJV B;  4F7Z A;  5BYS A;  4WJQ A;  2GBJ A;  2WXK A;  4WAF A;  4C80 A;  2PVO D;  2O2V B;  3GZN B;  4RGM A;  5C2T B;  2V9H A;  3LXF A;  4M8N A;  2ON8 A;  1P0R A;  1LO5 D;  4YT0 B;  2WDQ B;  1V49 A;  3IG3 A;  1FRR A;  1WXS A;  2KQS A;  1BML C;  2WXG A;  2UWQ A;  1UEL A;  2AQ2 B;  3B08 A;  2VZK B;  4KDL B;  3R8B A;  4GMV A;  3Q8C A;  1SE3 A;  1KRH A;  1UZX B;  3PPA A;  1WJU A;  4GXB A;  1T0Q C;  3L17 A;  5DPR A;  5BMG A;  1XD3 B;  2MBO A;  1V5T A;  4RCO A;  4REZ A;  2NVU I;  5LXI B;  4GOC A;  2IGH A;  2CU1 A;  2K25 A;  2HD5 B;  1RAX A;  4K81 A;  3RUI B;  2KMA A;  4LNF A;  4E71 A;  1GNU A;  3AH7 A;  1HTQ A;  1HA5 A;  2K6Q A;  2L8J A;  5HG2 A;  1QOA A;  2L00 B;  1L4D B;  2W82 A;  3CF6 E;  5LNK 1;  2DBY A;  3JYU A;  1YD8 U;  3H8H A;  4IUM B;  2IND C;  5FR3 A;  3AE4 B;  1D5Z C;  2KVZ A;  2N9X A;  4HRO A;  1V1P A;  2O6V B;  4RMA A;  4EZJ A;  2E3T A;  2LEK A;  2AEH A;  3RUL A;  1RLF A;  1NVI D;  3E56 A;  1P7F A;  4AOF A;  1E8W A;  4LNK A;  5MPO A;  1STE A;  2WDV B;  3NOB A;  5AUK A;  2G3Q B;  4RF1 A;  2KQ7 A;  2PE6 B;  2KJR A;  3MJW A;  3APC A;  5T8I A;  5AZH A;  2FAZ A;  1V2Y A;  3RNB C;  2NS5 A;  3DBH I;  3CSF A;  1Z5S B;  2Z8L A;  1NI2 A;  1EM7 A;  1WE7 A;  2KC2 A;  2MX2 A;  4IWQ A;  4RH6 A;  4MH8 A;  3AE5 B;  1QF6 A;  1WR1 A;  2JRI B;  2MEK A;  3PZ8 A;  3FIL B;  5C1Z A;  5G55 A;  1XLO A;  5D3D A;  5H8Y E;  4KX6 B;  1V8C A;  4RFB A;  3EHV A;  1TKG A;  2INN E;  1I4X A;  3DWG C;  1D4B A;  1JWM D;  3TSS A;  1J7B A;  2K1F A;  3B2F A;  3FAH A;  3PLU A;  1C78 A;  4JE3 B;  1WXQ A;  2R2O A;  1OEY J;  3H1U A;  1MFW A;  2LUM A;  1JWS D;  2IYD B;  1KLV A;  2CHZ A;  4BOZ B;  2WXO A;  4FA6 A;  2RDH A;  2I1K A;  3NVZ A;  2HTM E;  2QSD A;  3M3J A;  3EC8 A;  3ZYY X;  4KGR A;  1N60 A;  4KSK C;  4OHJ A;  2YVC A;  1L7Y A;  2JZZ A;  2DEN B;  2ZPN A;  1N61 A;  2JQR B;  2ZCB A;  3SHQ A;  1V5O A;  1XQQ A;  4AQ7 A;  1IYF A;  2IPK D;  4WWN A;  4KKJ A;  4GGQ A;  1T0S C;  3ZKJ C;  5E6N A;  1RFA A;  5HHD G;  2LHD A;  2X8X X;  2PIA A;  2W9N A;  4B95 A;  1UUP A;  3H9D A;  1CZP A;  1FNV A;  1WIA A;  1NYR A;  4PYZ A;  4JQW C;  2PEA A;  1SE9 A;  4W9F A;  3NZU A;  3PSE B;  1IUE A;  4ANU A;  2KWV B;  2K3U A;  1JCK B;  3SEB A;  2LUE A;  3NJT A;  1RFK A;  2KNB A;  3VR8 B;  4A6Q A;  2KWC A;  2IGG A;  1E7U A;  2FBW B;  1AYF A;  1ZOY B;  2R2Q A;  2J42 A;  4XGA B;  1FCL A;  5LXH A;  1G6J A;  3UIP B;  2WGS A;  4ZRJ A;  5JH5 C;  2KC1 A;  4XC2 A;  1L6U A;  1WR6 E;  2V4I B;  2N9L A;  3L08 A;  3QHT A;  4US8 A;  1PGX A;  3NS8 A;  4C56 C;  1XLP A;  2BWE S;  1GUA B;  1AN8 A;  4HDQ A;  3DQV A;  5D7G A;  1VCB A;  2IY1 B;  4II2 B;  4D2K A;  2B3A A;  4LNN A;  2KQ4 X;  4HKQ A;  2EMT A;  2INP E;  1V80 A;  3P4P B;  1MG4 A;  4EKU A;  4A90 A;  3BWU D;  3IHP C;  3KLS X;  1RWS A;  4ICU A;  4LLG M;  4HXD A;  3HUI A;  3DBL I;  3Q6B A;  2OED A;  3U30 A;  1PGA A;  3NZS A;  2LRU A;  4EZL A;  1XCT L;  5KHO A;  3TEZ A;  4P6V F;  3A9J B;  3PLV A;  1WXA A;  1KM7 A;  2ZW1 A;  3JSV B;  2QMT A;  4I6N B;  4EUT A;  1AW7 A;  4HPL B;  1D5X C;  1R7S A;  1YX6 B;  2KMM A;  4TQ0 A;  3BVZ A;  4RM9 A;  3FIL A;  1SE2 A;  3NS1 A;  4GB9 A;  3L13 A;  3N3K B;  2L0T A;  2KDI A;  5D94 A;  1C79 A;  2D07 B;  3LDZ E;  2KXJ A;  2DAF A;  3DCG A;  2LRW A;  4JWS C;  5JXV A;  5E6P A;  1VZ7 A;  1I4H A;  1Y8R C;  4TKN A;  4NNJ B;  2SEB D;  5LLI A;  1MVK A;  3TEX A;  3NY5 A;  4J3O D;  2WXH A;  5IP4 D;  4B0M A;  1RM6 C;  2KOX A;  3GP7 A;  3TIX A;  3I63 C;  4NJC A;  4IWP A;  1V86 A;  1NEN B;  2KTR A;  3V62 A;  4YXD B;  1YJ1 A;  4KZC A;  2DHZ A;  1BUI C;  1ROE A;  3QJZ A;  3DWM A;  4NPN A;  1A5R A;  1VD2 A;  3H7P B;  2JPH A;  1GJZ A;  3NZ3 A;  3B0A A;  4XE0 A;  1SJE D;  2VZK D;  4B6W A;  2BB5 A;  1T5X D;  2CKH B;  2WNM A;  1JRU A;  2ASQ A;  3UGB B;  1VZ6 A;  1H8C A;  4OZC A;  2OOB B;  3AV8 A;  4K3B A;  1PDX A;  2M4N A;  2R61 A;  4DXG A;  3MC0 B;  3OAW A;  2BYF A;  1IPG A;  1YJI A;  2J53 A;  4BFR A;  3A4R A;  3ENE A;  1UBI A;  3PT2 B;  4FUL A;  3BK1 A;  4MEL A;  1MG8 A;  1HZ6 A;  2KX3 A;  1JAL A;  3B9J A;  3U2S C;  3R3M A;  2ZPY A;  2DYO A;  3M95 A;  4CHK A;  1X1M A;  1WJ6 A;  1E90 A;  3WAP A;  1YN3 A;  2DAJ A;  1QT9 A;  3R2T A;  2MBE A;  1T3Q A;  1YQ3 B;  4HCN B;  1E7V A;  5L83 A;  4C00 A;  2WYQ A;  4NAW A;  3LYY A;  2NPT B;  2CHW A;  3TBL D;  2Z0E B;  1SXT A;  4KDI C;  3VH3 B;  2C7H A;  1WXV A;  4Q2J A;  2KDE B;  3VTV A;  4FN2 A;  1V1P B;  4R3D A;  2WLB A;  3DVG Y;  3PVL A;  3K9P B;  2C9W B;  1ESF A;  3RCZ A;  3Q8A A;  2XEW A;  3CF4 A;  1NYQ A;  1K53 A;  1NDD A;  1L6V A;  3SFE B;  2LVO A;  3AU5 A;  2LGX A;  4XWW A;  4LDT D;  3HVZ A;  5IOI A;  1F77 A;  2L76 A;  3PRE A;  4AJY B;  1CQV A;  4WJP A;  1LGR A;  1GAQ B;  1SEB D;  5G2N A;  1ZXI A;  3W9C B;  3TEY A;  4HPM B;  4MJS A;  1GB4 A;  5DPT A;  2RMM A;  4MJS B;  3U4E G;  3ZJV A;  1WE6 A;  2XK5 A;  5L95 C;  5IKC M;  2ZW0 A;  3BY4 B;  1P7E A;  5JZE B;  1OQR A;  1LFD A;  1ISN A;  3AE2 B;  1MHH E;  1QOB A;  2JY6 A;  3D32 A;  5G5H A;  4DXF A;  3OLM D;  1OQY A;  1L0V B;  2G4D B;  3OJ4 B;  1E8X A;  1TY2 A;  4CO7 A;  1EU3 A;  3ZJU A;  1E10 A;  3P42 A;  4XYC A;  3ZJT A;  2JVC A;  2K22 A;  1UGJ A;  3PGE A;  4LTU A;  3C8Y A;  1FNW A;  2DWQ A;  5IAA C;  1PGB A;  2MQJ A;  5C23 A;  1K50 A;  4XZ4 A;  3AI5 A;  2DX5 B;  4W9J A;  3ZNG C;  2KJ6 A;  1SGH A;  2JYT A;  4S17 A;  2KKC A;  3B1L X;  1TIF A;  1WI0 A;  4TV3 A;  2D5G A;  5E6J A;  3AB5 A;  1HTO A;  2VRR B;  2DZJ A;  2GOW A;  2Y5P A;  3JVZ X;  2PJH A;  1QOG A;  1E9M A;  1ZKH A;  3ZNH B;  4WIP A;  3HK0 A;  2LGI A;  4HK2 A;  1UH6 A;  4ARI A;  2WXL A;  1JWB D;  1PQS A;  1FIQ A;  2D3C A;  4LDT B;  2CJN A;  2WXQ A;  4W9I A;  2IZV B;  4DDI D;  1TT5 B;  2FCS A;  1F0Z A;  3HVD A;  3QA8 A;  1Z2M A;  4MGI E;  2LXA A;  2LGD A;  1QIL A;  4K1R B;  4G50 A;  1LXD A;  2KTF A;  2KT7 A;  2DYB A;  2IO0 B;  1ZE3 D;  2K8B A;  2HDE A;  1JRP A;  1JWA D;  3DBR I;  3AE1 B;  4FLH A;  4MGK E;  2BWF A;  2N7E A;  1V1O A;  4HJG E;  3P4Q B;  3ZDT A;  2XNA C;  1L5P A;  5J17 A;  2M17 A;  4GDK A;  2EKE C;  3DHH C;  1YMH E;  1FPY A;  4WQM A;  2I1J A;  1B1Z A;  2B76 B;  2KTR B;  2DLB A;  2JRH A;  1L0X B;  3ZDM C;  2FUG 1;  2LGS A;  4KZ0 A;  2WX0 A;  1FXT B;  1WYW B;  2KZR A;  3I57 A;  4XX5 A;  2QJL A;  4KIK B;  4MSQ B;  1U4A A;  3X0W A;  4W9L A;  3W5U B;  3VUY A;  3H6N A;  4A20 A;  1C9F A;  1L2N A;  5D3I B;  3NVW A;  4G0N B;  4IC7 B;  3AEC B;  1VR9 A;  2K8C A;  4G11 A;  4I6P A;  4IWO A;  1TKY A;  1WGH A;  3CIR B;  2PLP A;  2LVQ A;  1E7P B;  3Q69 A;  4A55 A;  3N1Z C;  1AAR A;  4K7U A;  5GMV A;  2KN4 A;  4FBJ B;  4C7Z A;  5CHF A;  4PK1 A;  2MSE D;  1BT0 A;  2MP2 B;  3GOE A;  2YLM A;  1S1Q B;  3SU8 X;  4RM8 A;  1FEH A;  2L83 A;  2KDM A;  3MC8 A;  4A8X C;  4NZL B;  2KDF B;  2QIE B;  2BBC A;  1SF0 A;  1UNS A;  2LI5 A;  2C60 A;  3AN1 A;  2YEP B;  4MM3 A;  4YTM B;  3QAR A;  2D11 A;  4BBN F;  4EE2 A;  1V81 A;  2Y5B B;  1WWT A;  3Q14 C;  2MCN B;  3KVF B;  3EGR A;  1A70 A;  4BZA A;  2I38 A;  2L32 A;  3VHT C;  3ZGZ A;  3AE8 B;  2N9E B;  5IN7 A;  1BXT A;  1TYG B;  2Q5W D;  2A4Z A;  1WXM A;  3WA0 A;  1SB3 C;  4XDC A;  2M0X A;  3NG0 A;  1XEE A;  3ZTC A;  1DOX A;  2V3S A;  3UIN B;  4AJW A;  2D3A A;  2KMC A;  3KQ4 A;  2UYZ B;  1GB1 A;  2M19 A;  2KJH B;  1JRO A;  1S3S G;  2BW2 A;  5C3J B;  4DHJ D;  5EE9 A;  3MTN B;  4W9C A;  5J2R A;  3A9K B;  1WH3 A;  3TMP B;  3QAQ A;  1SIF A;  3ZNZ B;  2NBU A;  4NQL B;  4NY0 A;  3NUH B;  4GDL A;  1P9D U;  3W5V B;  1OQQ A;  1GTE A;  4PS7 A;  4WWM A;  2LMC A;  3PV1 A;  4XWT A;  3WAM A;  3VFK A;  4IOI E;  2DZK A;  4I6L B;  2BYT A;  3OWE B;  3R66 C;  1TS4 A;  2W54 A;  5CX3 A;  2MRP A;  2FE8 A;  4ZOH C;  2IY0 B;  2J0J A;  3R7R A;  5CHV C;  4NAW B;  1WGR A;  1KOT A;  3VR9 B;  1UGM A;  3IAS 1;  2V1Y A;  1ACC A;  4DHJ B;  2RR9 A;  2LFI A;  3E9S A;  4KKI A;  4ARC A;  3J9C A;  3RD2 A;  4DHZ E;  1ZP0 B;  1XCQ L;  3UQA A;  2QEJ C;  3Q8E A;  5EE0 A;  4ZRQ A;  2AQ3 B;  2J7Q B;  4HCP B;  4DHZ B;  5FK9 C;  3DVG X;  4M8M A;  3P63 A;  4FJY A;  1SE4 A;  2X38 A;  3PHX B;  4JPS A;  3I9V 1;  2N9K A;  3W1S C;  4L23 A;  3W2D A;  1EWY C;  1TS5 A;  3NRZ A;  2N7J A;  4WH4 A;  1DGJ A;  4BKT A;  4ANX A;  4B9K A;  2KLG A;  2MJD A;  1VJK A;  3N1X C;  2V4L A;  1XLN A;  3PS6 A;  3APF A;  2HTH A;  3A9J A;  4URK A;  1TKE A;  2IO3 B;  1WGY A;  3N32 A;  3W1S A;  2V3P A;  2WXP A;  3MJ5 A;  2GMI C;  4IDI A;  3HM6 X;  3B2G A;  1SSN A;  2EMS A;  2KVR A;  2L7R A;  4BKS D;  3EEC A;  3KWL A;  2AYO B;  2K39 A;  1KH0 A;  2IO2 B;  4RNA A;  2QC8 A;  1IBX A;  1QKZ A;  2WQY B;  1WX7 A;  3A9K A;  4RGO S;  4FHJ A;  1TS3 A;  4B0E A;  3V60 A;  2WDR B;  2GBM A;  5AZG A;  2ZVO A;  1CMX B;  4YWG G;  3VH4 B;  1I35 A;  1R4N B;  4TUU A;  2RPV A;  3KWV A;  3A1Q A;  3BYT B;  3IXS A;  2BGF A;  1FXA A;  4DWF A;  2GBR A;  3M62 B;  1DYQ A;  1I4R A;  1N5X A;  3VTU A;  1YJJ A;  1WF9 A;  3AUL A;  2CR5 A;  4DQO C;  1J8C A;  2LJ5 A;  3ECI A;  3N1Y C;  2W55 A;  3ONS A;  4HJK A;  1GT8 A;  2GRI A;  2YEP F;  3RNA C;  3P4S B;  4RGN A;  2D10 A;  3VUX A;  1T0Y A;  2FCM A;  1WJ4 A;  1KTK A;  2ZCC A;  4K7W A;  1KLG D;  3TCA A;  4S0R A;  3RFZ B;  3NVY A;  3BIN A;  4IG7 B;  1NEK B;  5JHB A;  1VRA B;  1H7W A;  2ZNV B;  4WJO A;  4MGZ E;  5I4D A;  1J19 A;  2KN5 A;  2KHW B;  3KW5 B;  4GLS C;  4BOS C;  4K7S A;  2W3R A;  3IT4 B;  2MJE A;  1WSP A;  2Y3A A;  5IA7 A;  2PE9 A;  2K8H A;  1T0R C;  3R7Q A;  1YN5 A;  4LCD E;  2PVG C;  2BS2 B;  1FNU A;  2CJO A;  2GI9 A;  5CHW A;  2MBQ A;  3DOW A;  1N63 A;  5CTR C;  3PHW B;  3RN9 C;  2K5P A;  5BO4 B;  3HRD D;  4EEW A;  2N0S B;  4YTP B;  2L3Z A;  5HI1 A;  1NI3 A;  1H7X A;  2LVP A;  4KIK A;  1UBQ A;  4M00 A;  4AP4 C;  4N6E B;  4KSL C;  1C1Y B;  1C4A A;  2L1A A;  1JWU D;  3ZXV A;  3EFC A;  2MHJ A;  1ZDX A;  2Z59 B;  1V6E A;  2MBH A;  2O6V D;  1CK1 A;  1ET6 A;  5FKA C;  2BKF A;  5EE1 A;  1KJT A;  4F8C B;  3ZVV A;  4NAM A;  4GDL B;  2BKR B;  1FMA D;  3RT3 B;  1E0Z A;  2L05 A;  3N20 C;  5TR5 A;  4JX1 C;  4O1N A;  2WXN A;  3AE3 B;  3DBL B;  2CHX A;  1F2R I;  4J6I A;  3QCA A;  4FXC A;  3VRB B;  2KFK A;  1ET9 A;  1LQB A;  3QIJ A;  2BQQ A;  3ZIM A;  2GB1 A;  3Q3O C;  4OZB A;  1DOY A;  3WAO A;  4USA A;  1WFY A;  3VUW A;  5H92 C;  2MA9 B;  4DBG A;  4ZYS A;  1F52 A;  1F2R C;  1UD7 A;  3DVN U;  1L4Z B;  2IDY A;  3V3X A;  1WX8 A;  3DVN V;  4N59 A;  3EA6 A;  1EF5 A;  5KHQ A;  1WJN A;  3JW0 X;  1C4P A;  3VVW B;  4ZHO A;  1GC7 A;  4HPP A;  4WQO B;  3VRA B;  2HE7 A;  1NBF C;  3VTW A;  1Q5W B;  5AZF A;  3RNC C;  1UWM A;  5J18 A;  3C0R B;  3RYT A;  3AE7 B;  2J0K A;  1FCC C;  2C7M B;  3DBH B;  1KFY B;  1QOF A;  3R2I A;  1Q0W B;  2K6D B;  2WXR A;  1OEY A;  3A4S C;  1YIW A;  4A3O A;  3BVG A;  1SBB B;  3AMZ A;  3I5J C;  4JIO U;  2N1V A;  3O13 A;  5TSS A;  4ZRI A;  2DNF A;  3GE8 C;  3ZW3 A;  5DPW A;  3ALB A;  4W9D A;  5GXG B;  3MHZ A;  2BS3 B;  2H89 B;  2WXI A;  4N58 A;  3MC9 A;  1YNT E;  2D3G A;  2PW9 A;  1M94 A;  5D6J B;  4L1B A;  2IO1 B;  2LWP A;  2I2Y A;  2ZEQ A;  1ZGU B;  5BMI A;  2V3N A;  1XLQ A;  3U7D A;  1P3Q U;  3PRP B;  4IW0 A;  2FCN A;  3SD5 A;  1SJH D;  1H4R A;  3KYC D;  3Q3F A;  1WZ3 A;  2JUO A;  3VXW A;  2WHI A;  2BS4 B;  2INC C;  2C5L C;  2KDB A;  4GDK B;  2FID A;  3TL5 A;  1QZE A;  3BYY B;  3PRM B;  2WS3 B;  4DXA B;  1M4V A;  4PT5 A;  2LJI A;  2EKI A;  4FJZ A;  1RRB A;  3V6E B;  2OHF A;  4AUQ C;  2IJ0 A;  4ZRP A;  3SR6 A;  3LJ3 A;  1TZ1 A;  2N7D A;  3EUB 2;  1C77 A;  1WGG A;  3FKY A;  1JQ4 A;  1HQR D;  4WAA A;  3GE3 C;  2D3B A;  4KVG B;  3N9Y C;  4ITK A;  4HDO A;  5EDS A;  1D3Z A;  4BBN C;  4ZYN A;  2BVC A;  4H2A A;  4ZHP A;  1IGC A;  1ZUD 2;  3IFW B;  1E6E B;  2J4X A;  2QDF A;  4OZA A;  2NR2 A;  4WUR A;  4DDG D;  2XN9 C;  3A33 B;  1WRI A;  5AEK B;  2KLC A;  1TJE A;  2MJ3 A;  1WZ0 A;  4MDK E;  1Q10 A;  2JSV X;  2N1W A;  2BF8 B;  2M56 B;  2AL3 A;  4XDD A;  1N6Z A;  2QCZ A;  4F1S A;  2KFJ A;  3HIZ A;  2LXC A;  4BKS A;  4CYE A;  3RI7 C;  4C4V B;  1SIJ A;  3DPD A;  1K51 A;  4LNO A;  3AE9 B;  2KD0 A;  3PZ7 A;  4WJN A;  1YQB A;  2K0P A;  4ACF A;  4MEM A;  4GU2 A;  2FIF A;  2SAK A;  1HE8 A;  2M1M A;  3WCQ A;  3Q3J A;  3EFU A;  4LNI A;  4NJ7 A;  4E3C A;  2BPS A;  2NTS A;  2WU2 B;  2JZP A;  4TMA B;  3UF8 A;  3KUC B;  3ETR A;  5IO9 A;  2MH7 A;  4ANV A;  3P4R B;  4W9K A;  3GB1 A;  1UWX A;  4II3 B;  3FC4 A;  1GPX A;  3ZNI D;  3PZD A;  2NPT A;  1L0Y B;  3RPF C;  2L52 A;  2MW5 A;  5BMH A;  2GBK A;  3DHG C;  2ZJD A;  3BVM A;  1J7A A;  3AEE B;  4MH0 E;  3O65 B;  3P1M A;  1C4C A;  3IVF A;  2MWS B;  1MI0 A;  5BYQ A;  3LB8 C;  3DHI C;  3QX1 A;  1XXG A;  4A9A A;  3ML9 A;  1I4Q A;  4PS8 A;  5EE3 A;  3WAL A;  2L0F A;  2G4S A;  1YN4 A;  4BVU C;  1YQ4 B;  3ZLZ A;  3ZTD A;  4WWP A;  1D6E C;  3Q8B A;  3Q3M C;  3DBR B;  1N5W A;  2NCN A;  2JT4 B;  3RZF A;  1VDV A;  2ICI A;  3WAN A;  2BT6 A;  1QLB B;  2GLS A;  2RSU A;  4NJ6 A;  2CU3 A;  1ZDV A;  1FFV A;  3U52 E;  4BKG A;  2FNJ B;  1TBE A;  1TGZ B;  1J7C A;  4MAC A;  2W3S A;  4P7I A;  4IM2 A;  1FRD A;  1IP9 A;  2TSS A;  4UDU C;  1IBX B;  3T3N A;  2JZ3 B;  4JWU C;  1ZXH A;  2G9H D;  1XO3 A;  3W1Y A;  3VAW A;  2KWD A;  2FCQ A;  2KYW A;  2O6V A;  1QQR A;  3MHS D;  2AX5 A;  2WXJ A;  3V05 A;  3HM3 A;  4YTN B;  4MT5 A;  3ZO5 B;  3RZW C;  2WDT B;  4FHK A;  2NBW B;  4IKG A;  3PO0 A;  1WM3 A;  3UI3 A;  1ZW7 A;  2JYE A;  4OW0 A;  1GOZ A;  1E8Z A;  4PYU A;  4CQN A;  4RF0 A;  2LHE A;  4IM3 A;  3RMK C;  3IAM 1;  3DDC B;  2GBN A;  3V6C B;  3T9L A;  5HKH A;  1OFF A;  3H7P A;  3MFG A;  2QHO A;  1WYG A;  3KYD D;  1B9R A;  3RNG C;  1E5W A;  3AEB B;  4YSY B;  2MLB A;  2KFK B;  3AE6 B;  1TZO A;  2NBV B;  5DCN A;  3UIO B;  1C3T A;  2KK8 A;  3PRZ A;  3C19 A;  4JGH B;  4WWO A;  4YSZ B;  3MP9 A;  1F1H A;  1UF0 A;  1XT9 B;  3QC8 B;  2RDG A;  3ABV B;  2REX A;  3BK2 A;  2LD9 A;  1FD6 A;  2JF5 A;  1GG3 A;  4C7Y A;  2ZVN A;  4EOY A;  1TY0 A;  4JLC A;  1PYW D;  4W9E A;  2QIL A;  3KUD B;  1K8R B;  3TJP A;  2LAS A;  2N9P C;  1JML A;  3AED B; 
#chains in the Genus database with same CATH homology
 3FIL B;  2BB6 A;  1ZE3 D;  3SFD B;  1XLO A;  4JX1 C;  4O1N A;  5D3D A;  2WXN A;  5H8Y E;  5BYR A;  4KX6 B;  1V8C A;  2HDE A;  4RFB A;  1JRP A;  1JWA D;  3AE3 B;  1TKG A;  2DYM A;  2INN E;  3AE1 B;  1I4X A;  1F2R I;  3DWG C;  4FXC A;  4RGT A;  3VRB B;  1ET9 A;  1D4B A;  1JWM D;  3TSS A;  1T6B X;  2BTE A;  2ACZ B;  2GB1 A;  1V1O A;  1J7B A;  4HJG E;  4OZB A;  3B2F A;  1DOY A;  3P4Q B;  3FAH A;  4JE3 B;  1C78 A;  4USA A;  1WXQ A;  2XNA C;  1L5P A;  2LUM A;  5H92 C;  1JWS D;  1FO4 A;  4ZYS A;  2KAC A;  2WXO A;  1F2R C;  1FFU A;  3GS2 A;  2RDH A;  1YMH E;  4WQM A;  1L4Z B;  2NMQ A;  1B1Z A;  1PFD A;  3NVZ A;  2B76 B;  3AEG B;  2HTM E;  1I7H A;  2IDY A;  2QSD A;  3V3X A;  4N59 A;  3ZYY X;  2DLB A;  4KGR A;  3EA6 A;  1VLB A;  1HEZ E;  1L0X B;  1N60 A;  1AWD A;  2FUG 1;  4OHJ A;  2PTL A;  4HEA 1;  3TEW A;  2Y5C A;  4TSS A;  1C4P A;  1TS2 A;  1N61 A;  4ZHO A;  3I57 A;  2JQR B;  2QJL A;  3VRA B;  1EWC A;  1XF5 L;  1CJE A;  4AQ7 A;  2IPK D;  4KKJ A;  4KGT A;  2WXM A;  5HHD G;  3W5U B;  1UWM A;  4KGS A;  2NTT A;  2LHD A;  2PIA A;  1C9F A;  3AE7 B;  1DOI A;  1UUP A;  1CZP A;  4HRS A;  5D3I B;  3NVW A;  1FM0 D;  1FCC C;  1FNV A;  1JW9 D;  5HFY A;  1I4P A;  3AEC B;  1VR9 A;  1NYR A;  1TKY A;  1MHX A;  3CIR B;  1KFY B;  2PLP A;  1QOF A;  4HKZ E;  3R2I A;  1E7P B;  1IUE A;  3Q69 A;  4A55 A;  2K3U A;  2WXR A;  1JCK B;  3SEB A;  1RFK A;  2KN4 A;  3BVG A;  1SBB B;  3AMZ A;  4C7Z A;  3VR8 B;  1MPE A;  3O13 A;  4A6Q A;  2IGG A;  2K9X A;  2FBW B;  1AYF A;  1ZOY B;  5TSS A;  2J42 A;  1FCL A;  5AUI A;  1FEH A;  2L83 A;  2KDM A;  4P16 A;  5GXG B;  3MHZ A;  4A8X C;  4NZL B;  2QIE B;  2BBC A;  1SF0 A;  2BS3 B;  2H89 B;  1UNS A;  1L6U A;  2WXI A;  2V4I B;  4N58 A;  2N9L A;  1D5M C;  1VZ8 A;  1YNT E;  3AN1 A;  3TUO A;  2YEP B;  4US8 A;  1ZPS A;  1PGX A;  2PW9 A;  4YTM B;  4L1B A;  3AEF B;  1Y56 A;  4C56 C;  4EE2 A;  2I2Y A;  1HZ5 A;  1WWT A;  1XLP A;  5BMI A;  3EGR A;  1AN8 A;  1A70 A;  2V3N A;  1XLQ A;  4MM3 B;  2EEL A;  2WU5 B;  5D7G A;  2I38 A;  2L32 A;  1WGK A;  3ZGZ A;  4D2K A;  1EU4 A;  1SJH D;  3ZQ4 A;  3AE8 B;  2G1E A;  1BXT A;  1TYG B;  3URY A;  2KQ4 X;  2Q5W D;  4HKQ A;  2INP E;  1SB3 C;  4XDC A;  3P4P B;  1PUT A;  2BS4 B;  1XEE A;  2IGD A;  4A90 A;  1DOX A;  3BWU D;  3KLS X;  1E0Z A;  4GDK B;  1RWS A;  3BYY B;  3KQ4 A;  4LLG M;  1GB1 A;  2M19 A;  2WS3 B;  1JRO A;  1M4V A;  3HUI A;  4PT5 A;  2BW2 A;  5C3J B;  2OED A;  5EE9 A;  1PGA A;  2LJI A;  3BII D;  2EKI A;  1XCT L;  3TEZ A;  2OHF A;  4P6V F;  2IJ0 A;  4ZRP A;  2V0G A;  3L4P A;  2ZW1 A;  3SR6 A;  2QMT A;  1AW7 A;  2AQ1 B;  3EUB 2;  3NVV A;  3Q8F A;  3NUH B;  1D5X C;  1R7S A;  1C77 A;  1JQ4 A;  2KMM A;  3W5V B;  1HQR D;  1OQQ A;  4TQ0 A;  3AEA B;  1IGD A;  1GTE A;  2PKO A;  3BVZ A;  3AM9 A;  3FIL A;  1SE2 A;  3N9Y C;  4YSX B;  4ITK A;  4WWM A;  2LMC A;  3NS1 A;  4XWT A;  2JX5 A;  1C79 A;  4H2A A;  4ZHP A;  4IOI E;  2BYT A;  4OVZ A;  1IGC A;  4M0W A;  1ZUD 2;  3OWE B;  4JWS C;  1ENF A;  5JXV A;  1E6E B;  1TS4 A;  1VZ7 A;  1I4H A;  2WP9 B;  2W54 A;  2J4X A;  1HXY D;  4OZA A;  2SEB D;  4WUR A;  2FE8 A;  2XN9 C;  4ZOH C;  1MVK A;  1WRI A;  3TEX A;  4J3O D;  4NAW B;  1TJE A;  2WXH A;  4B0M A;  1RM6 C;  2MJ3 A;  3GP7 A;  1KF6 B;  2PMV A;  3VR9 B;  4L2Y A;  1Q10 A;  3U7Z A;  2JSV X;  3IAS 1;  4NJC A;  2M56 B;  4XDD A;  2JXT A;  1ACC A;  1FXI A;  2LFI A;  1NEN B;  4YXD B;  3E9S A;  4KKI A;  4ARC A;  3J9C A;  2E6X A;  1N62 A;  3VQI A;  1ZP0 B;  1XCQ L;  1BUI C;  4TQ1 A;  1ROE A;  2QEJ C;  3Q8E A;  5EE0 A;  4ZRQ A;  1SIJ A;  2AQ3 B;  3DWM A;  1K51 A;  3IT6 B;  3T3O A;  4AS1 A;  3AE9 B;  2JWU A;  3NZ3 A;  5FK9 C;  4XE0 A;  2H88 B;  1SJE D;  2VZK D;  3PZ7 A;  2BB5 A;  1V97 A;  3P63 A;  1T5X D;  2KAJ A;  2JU6 X;  2WNM A;  1SE4 A;  2X38 A;  1I4G A;  2K0P A;  3CWI A;  1RYJ A;  4JPS A;  3I9V 1;  1VZ6 A;  2SAK A;  1C76 A;  4US9 A;  2N9K A;  3BZD B;  4OZC A;  3AV8 A;  3WCQ A;  5G5G A;  1PDX A;  2R61 A;  4L23 A;  3W2D A;  1EWY C;  3MC0 B;  2NTS A;  4DXG A;  1TS5 A;  2WU2 B;  3NRZ A;  2N7J A;  2JZP A;  1DGJ A;  4WH4 A;  1YJI A;  2J53 A;  4TMA B;  3ETR A;  2MJD A;  2MH7 A;  1VJK A;  1XLN A;  3P4R B;  1GTH A;  1TKE A;  3BK1 A;  1HZ6 A;  3GB1 A;  1UWX A;  1JAL A;  1KLU D;  3W1S A;  2ONQ A;  2V3P A;  3B9J A;  2WXP A;  3FC4 A;  3U2S C;  1GPX A;  3MJ5 A;  4IDI A;  3B2G A;  4LK0 M;  2DYO A;  1SSN A;  1L0Y B;  2J52 A;  3RPF C;  2L52 A;  1YN3 A;  5BMH A;  2WXF A;  1QT9 A;  3R2T A;  3KWL A;  1T3Q A;  3BVM A;  1YQ3 B;  1J7A A;  3AEE B;  1KH0 A;  3P1M A;  1C4C A;  3LYY A;  1MI0 A;  1K52 A;  5BYQ A;  2M0A A;  3LB8 C;  4RNA A;  5BYS A;  1XXG A;  1IBX A;  1SXT A;  1QKZ A;  4A9A A;  4WAF A;  2WXK A;  4C80 A;  2PVO D;  1I4Q A;  5EE3 A;  2WQY B;  4Q2J A;  4RGO S;  1TS3 A;  4B0E A;  2WDR B;  1YN4 A;  1V1P B;  4R3D A;  4RGM A;  2WLB A;  5C2T B;  4YWG G;  3LXF A;  1YQ4 B;  2ON8 A;  1ESF A;  1LO5 D;  3Q8A A;  1D6E C;  3CF4 A;  2RPV A;  4YT0 B;  2WDQ B;  3Q8B A;  1N5W A;  1NYQ A;  1FRR A;  1K53 A;  1VDV A;  1L6V A;  2ICI A;  3SFE B;  1QLB B;  2BT6 A;  3KWV A;  3BYT B;  3IXS A;  1FXA A;  4XWW A;  1BML C;  2CU3 A;  1ZDV A;  1FFV A;  2WXG A;  3HVZ A;  3U52 E;  2AQ2 B;  1F77 A;  2VZK B;  1CQV A;  3R8B A;  3Q8C A;  1SE3 A;  1J7C A;  1GAQ B;  1SEB D;  3W9C B;  1DYQ A;  1ZXI A;  1KRH A;  3TEY A;  1GB4 A;  1I4R A;  4MAC A;  2RMM A;  1N5X A;  2W3S A;  3U4E G;  1FRD A;  3ZJV A;  1YJJ A;  2TSS A;  5BMG A;  4UDU C;  4RCO A;  4REZ A;  1IBX B;  3T3N A;  4DQO C;  2ZW0 A;  1P7E A;  2W55 A;  4JWU C;  1GT8 A;  1ZXH A;  2G9H D;  2IGH A;  1XO3 A;  2GRI A;  2KWD A;  1OQR A;  2YEP F;  1QQR A;  3AE2 B;  3P4S B;  1MHH E;  1QOB A;  2AX5 A;  4RGN A;  5G5H A;  2WXJ A;  3V05 A;  4DXF A;  4YTN B;  4MT5 A;  1KTK A;  3AH7 A;  4IKG A;  1HA5 A;  1L0V B;  1KLG D;  1TY2 A;  3PO0 A;  5HG2 A;  1QOA A;  3UI3 A;  2JYE A;  3RFZ B;  3NVY A;  4OW0 A;  1L4D B;  1NEK B;  2W82 A;  1VRA B;  5LNK 1;  2DBY A;  1EU3 A;  1H7W A;  3ZJU A;  1E10 A;  1GOZ A;  3P42 A;  5I4D A;  3H8H A;  3ZJT A;  4CQN A;  4GLS C;  2K22 A;  5FR3 A;  2W3R A;  2LHE A;  3IT4 B;  4RF0 A;  1UGJ A;  2MJE A;  4LTU A;  1WSP A;  3AE4 B;  3C8Y A;  2Y3A A;  1FNW A;  2DWQ A;  1PGB A;  1D5Z C;  1K50 A;  3IAM 1;  4HRO A;  1V1P A;  1OFF A;  1YN5 A;  2E3T A;  2PVG C;  2BS2 B;  1FNU A;  2LEK A;  2CJO A;  2GI9 A;  2JYT A;  3MFG A;  1NVI D;  1WYG A;  2D5G A;  5E6J A;  1N63 A;  3AB5 A;  3E56 A;  1B9R A;  1P7F A;  3AEB B;  4YSY B;  2K5P A;  2Y5P A;  5MPO A;  3HRD D;  1QOG A;  1E9M A;  1STE A;  4YTP B;  2N0S B;  2WDV B;  4WIP A;  5AUK A;  3AE6 B;  1TZO A;  5HI1 A;  2LGI A;  1NI3 A;  4ARI A;  4RF1 A;  2WXL A;  1H7X A;  1JWB D;  1FIQ A;  5T8I A;  4N6E B;  4YSZ B;  3MP9 A;  2CJN A;  2WXQ A;  1C4A A;  2L1A A;  1JWU D;  1ZDX A;  2RDG A;  3ABV B;  3BK2 A;  1CK1 A;  1ET6 A;  2Z8L A;  5FKA C;  1FD6 A;  4C7Y A;  1F0Z A;  5EE1 A;  1TY0 A;  3HVD A;  1EM7 A;  1PYW D;  2QIL A;  4RH6 A;  4MH8 A;  1QIL A;  3AE5 B;  4NAM A;  1QF6 A;  1JML A;  4GDL B;  2MEK A;  1FMA D;  3PZ8 A;  3AED B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...