1L0VB

Quinol-fumarate reductase with menaquinol molecules
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
source organism Escherichia coli
total genus 69
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2002-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1l0vB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l0vB01
2OHFA 1E9MA 1ROEA 1SF0A 2HTME 2CJOA 5EE0A 2WP9B 2W54A 4JWSC 1NYQA 4ITKA 1RWSA 1VLBA 2MJ3A 3NS1A 3B2FA 1N5WA 1QF6A 3BIID 4LTUA 1H7XA 1UWMA 1E7PB 2WQYB 5G5GA 2MH7A 1NENB 3AE3B 1VJKA 1OQQA 5EE3A 5AUKA 1E0ZA 4YXDB 2KMMA 1JWBD 1QOBA 2G1EA 1N61A 1ZP0B 1L6UA 1N60A 1KFYB 4KX6B 3AE8B 1DGJA 1N5XA 1ZXIA 3AMZA 3WCQA 3AEDB 3VRBB 3NVWA 1RM6C 1DOXA 3NVVA 1CZPA 4A9AA 2PIAA 1FXIA 1V97A 2L52A 5GXGB 1DOYA 2BS2B 3KWLA 3AE5B 1NEKB 2K5PA 1FFUA 2W3SA 3AV8A 2DBYA 4IDIA 3VRAB 3HRDD 4N59A 1YJIA 1GAQB 4US8A 1PDXA 1CJEA 2WLBA 4N58A 3AE2B 1TKYA 3PO0A 2FBWB 4YTMB 1H7WA 3CIRB 1FIQA 4JX1C 4P6VF 4USAA 1N62A 3NVZA 1KRHA 1I7HA 3B2GA 5G5HA 1TKEA 2JQRB 2WU5B 3AEBB 3AEGB 3HUIA 1FRRA 3EUB2 1FFVA 3P4QB 1E10A 2WDQB 2K9XA 3AEFB 1JW9D 5EE1A 4ZHPA 2WDRB 1XLQA 1L6VA 1N63A 3AEEB 1PUTA 1QT9A 2BT6A 4YSYB 2WDVB 1FRDA 1QOAA 4HROA 3ZYYX 1QLBB 3AE6B 1AYFA 1V8CA 3DWGC 4ZOHC 1NVID 1XLNA 1SB3C 1QOGA 3AEAB 4C7ZA 2WS3B 2EKIA 1YQ4B 3LB8C 1JWAD 1A70A 3SR6A 1TJEA 3P4PB 1E6EB 4N6EB 3AE9B 3ABVB 1J7CA 1SIJA 1JALA 2PKOA 1FM0D 1WGKA 3P1MA 1RFKA 1WXQA 4YSXB 2K22A 4WQMA 5AUIA 3W9CB 4C80A 2MJEA 1AWDA 1R7SA 3NVYA 1ZUD2 2W55A 4WWMA 3CWIA 4HRSA 2Y5CA 3L4PA 3ETRA 5H92C 5C3JB 1B9RA 1WWTA 2B76B 2LEKA 2M19A 2CU3A 1L5PA 2BS4B 3VR8B 1YQ3B 1J7AA 2Q5WD 3HVZA 1GPXA 1QOFA 2M56B 2E3TA 2KAJA 1EWYC 1ZOYB 3AH7A 3FC4A 3LXFA 1GTHA 1F0ZA 3DWMA 1NI3A 2BS3B 1IUEA 2L83A 1T3QA 4YTPB 2ACZB 1PFDA 1XO3A 1KF6B 3P4RB 1OQRA 1NYRA 3FAHA 1JRPA 5C2TB 1XLOA 3AN1A 1J7BA 3AE4B 5H8YE 1FO4A 3AM9A 2PVOD 3AB5A 4YT0B 3AECB 1L0VB 2AX5A 3RPFC 2PVGC 1DOIA 3P4SB 3AE1B 4C7YA 1GT8A 5MPOA 4YSZB 1TYGB 2WU2B 1FXAA 1JROA 1YJJA 2H89B 3CF4A 1WRIA 4YTNB 1FMAD 3VR9B 2N0SB 5EE9A 2CJNA 1XLPA 1GTEA 4FXCA 2W3RA 3NRZA 3AE7B 4US9A 2MJDA 4JWUC 2QJLA 1WYGA 2QIEB 2H88B 1VDVA 3W5VB 1RYJA 3SFEB 2DWQA 1JQ4A 3SFDB 3W5UB 4ZHOA 2JX5A 1TKGA 3B9JA 1OFFA 3P63A
chains in the Genus database with same CATH superfamily
2IO2B 3KWVA 4WAFA 2HTME 4DHZB 5J2RA 2W54A 4JWSC 1JWSD 3R7RA 2WXPA 3NZ3A 3VTUA 3MFGA 3MHZA 3BINA 1VJKA 2ZW1A 1E0ZA 3NVVA 2IGDA 2KYWA 1ZXIA 3B1LX 1N5XA 1DOXA 3S2AA 3NG0A 1MI0A 4DHZE 2RD0A 4JIOU 1DOYA 4M8NA 4RGMA 4LNFA 2DBYA 4GLSC 2WXOA 1TKYA 4FBJB 1MHXA 3OJ3A 4XDDA 3AULA 4W9DA 2RDHA 3EUB2 2WYQA 3APFA 4F8CB 2SEBD 3I5JC 2CHWA 1L4DB 4RGTA 1XLQA 2QCZA 4A55A 4BAXA 2BB5A 2PLPA 3H6NA 3NJTA 1ENFA 2GBRA 2WXIA 3PREA 4PS8A 3R3MA 2CR5A 2N7JA 4AJWA 4REZA 3DDCB 4N6EB 1GJZA 1SIJA 4BVUC 1UNSA 3BYYB 1R4NI 1WGHA 4C56C 4M00A 3H8HA 1AW7A 3L4PA 3NUHB 4TMAB 1TS4A 3DOWA 3ZJTA 2ZVNA 2M19A 3EHVA 5AZHA 1YQ3B 1GPXA 2O6VD 1ZOYB 1ZKHA 3N32A 1JMLA 3Q3MC 4JGHB 2KJRA 4FJYA 1P0RA 4GDKB 5C2TB 3AN1A 4L2YA 5JHAA 3RD2A 1WGGA 3IVFA 1PQSA 4FA6A 2K1FA 3J9CA 2HDEA 2EMTA 1GNUA 4FULA 2JVCA 2C7MB 4L23A 3UQBA 1A5RA 2DZIA 1I35A 5BYRA 3SFDB 4WAAA 4LNKA 2KOXA 1OFFA 3TUOA 1FXTB 1WX7A 4BKGA 5IAAC 2X8XX 3QHTA 5CHWA 1T0SC 4EZKA 3PRPB 4KIKB 2J52A 1M4VA 3ZNGC 3PZ7A 4AWJA 1VZ8A 2PTLA 2D3CA 1EU3A 1QOBA 2MCNB 4B0EA 4AS1A 1WE7A 3V60A 2L0TA 4TUUA 4ACFA 3IT4B 3T3NA 4M0WB 4N59A 3U4EG 2JRHA 2IYDB 4YTMB 1WJUA 1ZGUB 1WI0A 3EFUA 3HUIA 4K7UA 3FKYA 1C4CA 1WX8A 4G50A 1WYWB 4DDGD 3RCZA 2L00B 2MBEA 3DWGC 2MP2A 1SB3C 4WWNA 2CU1A 4PT5A 2LVOA 3L17A 1A70A 1KLGD 3WANA 4WQOB 3R2IA 1KTKA 2PKOA 4MM3A 5AUIA 2N7DA 2WXGA 4HRSA 3JYUA 2L0FA 5BYSA 2EKEC 3ZTDA 2ZEQA 2B76B 4HWIB 3HVZA 2KVRA 4NQKE 4ZRIA 1EWYC 4XGAB 3ONSA 3NY5A 2AQ2B 1T6BX 2L83A 1T0QC 2N9KA 2JZ3B 4YT0B 1EF1A 4JPSA 1XXGA 1WGDA 2BF8B 3C8YA 3CF4A 1IP9A 2GBKA 3B08A 2ZW0A 4JL9A 2Z8LA 2R61A 3W5VB 1WMHA 3DHIC 2DWQA 1XD3B 3K9PB 3KW5B 3OAWA 4MSQB 1WJ4A 3MJWA 2CHZA 2V3SA 3DBRB 1IBXA 4TV3A 2LHDA 2K6DB 1MVKA 2R2OA 4NAMA 2HJ1A 3BVMA 5HHDG 3AEDB 3DBLB 2LXCA 3MTNB 3VAWA 4AJYB 4F1SA 1C1YB 3H7SA 2KZRA 3QARA 3AV8A 5AZFA 1LQBA 1WZ0A 3VUYA 3QX1A 3W5UB 2FCMA 4KSKC 1KJTA 1Z2MA 1FRRA 2JWZA 3P4QB 4P1BC 4WURA 5DCNA 4TQ0A 2LASA 5D7GA 1V81A 1PUTA 4AQ7A 4D2KA 1UGJA 1F52A 4GDLB 2KMCA 3LB8C 3IFWB 3N1ZC 2FAZA 2J0MA 4WQMA 1G6JA 1TBEA 1PGAA 3ETRA 2O6VA 5DPSA 2Q5WD 4IWOA 1YN4A 3UI3A 4GU2A 2OOBB 1EWCA 1I4HA 3Q8AA 3Q3NC 3H7PB 2KACA 1DOIA 3HM6X 1GB4A 1TYGB 1OQYA 3PRMB 2GBJA 3UINB 1XCQL 4W9LA 3PGEA 2KD0A 2INPE 3SFEB 4AP4C 4IM0A 5J18A 4C4VA 1AARA 1WGRA 4LDTB 2OEDA 3NS1A 4J3OD 3Q6BA 2LMCA 5IA7A 1N5WA 1ZE3D 1MPEA 1WX9A 5G2NA 3K9OB 2CS4A 1IGCA 1FXIA 2K5PA 2KTRA 4HDOA 1K50A 1HA5A 1YJIA 3GE3C 4WIPA 2Y5PA 3AE2B 4MM3B 3NHEB 3W1YA 2IO1B 2BWFA 4RCOA 5BYQA 1KH0A 3E56A 3VTWA 2BB6A 1N63A 2WXMA 3ZYYX 1KM7A 3DCGA 2EKIA 1ZW7A 1C4AA 1FPYA 3LDZE 4IKGA 2NBWB 3WAOA 1J7CA 2D07B 2YVCA 1JALA 1FM0D 2DLBA 2V3NA 3PLUA 2MSED 4I6PA 3AI5A 4FJZA 2J53A 3VFKA 4TQ1A 4JLCA 2VZKD 1TS5A 2CU3A 2BS4B 4P1CC 4W9JA 2M56B 2DZKA 3QA8A 2WWZA 1WMHB 2BQQA 4OZBA 1T3QA 4W9HA 3IXSA 3JVZX 4A8XC 2V0GA 2RR9A 3AB5A 1SGHA 2LVPA 3P4SB 5MPOA 4DXGA 4PK1A 1V80A 5BMHA 1WM2A 2W3RA 4M01A 3DVNV 4WJOA 2ZPYA 1V5OA 4ANXA 5L83A 4BFRA 4MACA 1BXTA 1K51A 2XEWA 2KX0A 2IDYA 2MBQA 4IC7B 3WALA 2CJOA 2NPTB 3HVDA 2K6QA 3LYYA 3BYTB 1RWSA 2Z0DB 2R2QA 1E7VA 4II3B 2KDMA 1I4PA 2IY1B 1OQQA 1C4PA 1L7YA 2VH1A 5FR6A 1L6UA 2NVUI 1TIFA 3NVWA 1H8CA 2BTEA 3GOEA 4IOIE 1FFUA 3SU8X 1C78A 4DHJD 1QKZA 1F1HA 3M63B 4GDKA 5G5HA 5IO9A 4WWOA 4NNJB 4H2AA 3PV1A 4HLEA 3ZW3A 5GMVA 4KZ0A 1QT9A 4G0NB 1MHHE 3V6CB 4HPMB 2N9EB 1UBIA 1QLBB 2RPQA 1OGWA 1YQ4B 1TJEA 1JWUD 1E7UA 4YSXB 2MJEA 4IM3A 1F2RI 4KIKA 3L13A 5C3JB 5KHOA 4G11A 2LEKA 4IUMB 2INCC 3KQ4A 3SEBA 2I1KA 3ZGZA 4M0WA 2YLMA 3GZNB 2DAJA 5H8YE 2XN9C 3Q8CA 4AUQC 1TZOA 4WH4A 3V3XA 1Z5SB 2K39A 3GS2A 3O65B 3L16A 3PT2B 1N6ZA 3NRZA 1E5WA 4ZYSA 2LD9A 2MJDA 3NZSA 3TBLD 4MJSB 4ARIA 4KVGB 3RI7C 1SE9A 4IG7B 5L95C 3JSVB 3Q8EA 5FK9C 2J4XA 2KK8A 2IPKD 2LRWA 3QIJA 3R7QA 2M4NA 1JWBD 1N61A 4A90A 2JXXA 4HK2A 4F7ZA 1GOZA 1V97A 3DVNU 4KGRA 3BWUD 2JZPA 1C79A 1NEKB 1TGZB 1SSNA 3UQAA 2EMSA 2NCNA 3ZKJC 1GAQB 4EEWA 3WA0A 1ISNA 1GC6A 2WXHA 3PO0A 1WF9A 4EUTA 4WJNA 1HQRD 4ANWA 4XWTA 1L2NA 3W1SC 1V1OA 3EECA 3V6EB 3ZIMA 2WDRB 4DQOC 3AE6B 1V8CA 1C3TA 4BKSA 1WSPA 3D32A 1E6EB 2KX3A 3W9CB 3Q3FA 3PTFC 4WWMA 1RLFA 2LHEA 2Y5CA 3U2SC 2RPVA 1MJDA 2E6XA 3DHGC 3SDLC 5CHVC 4C00A 2BGFA 4GXBA 2KAJA 4MT5A 1JWMD 5DPWA 1Q1OA 3MJ5A 1ZDXA 4K7WA 3A9KB 2KFJA 1NYRA 3R2TA 4HPPA 2KMAA 2WXRA 4EKUA 3PLVA 1TS2A 2JPHA 1WH3A 1WGYA 1YD8U 5D94A 4P16A 1EUVB 3IG3A 3QQ8B 4MEMA 2KQ7A 5LNK1 3APDA 4GDLA 2EELA 1D5XC 2OHFA 2L1AA 3M3JA 1UWXA 4RNAA 3ZNID 3VH4B 1NENB 2J42A 2LUMA 3EA6A 4FHJA 4W9IA 4ANUA 2PE9A 2DZMA 5E6PA 5FKAC 4ZYNA 2LJIA 2MLBA 1V9JA 2L8JA 2MRPA 2WDTB 3UGBB 2ICIA 4USAA 4JX1C 4UDUC 2FE8A 4B95A 3H7PA 1DYQA 4RM9A 3ZRFA 2ONQA 1S3SG 5EE1A 4BZAA 2D3GA 3AU5A 2DX5B 2WXKA 3V05A 2KQSA 2JSVX 2AWTA 3ALBA 3URYA 4CQNA 4A3PA 4ZRKA 4C80A 2K22A 4RF1A 4RGOS 3VQIA 1SEBD 1P7FA 4O1NA 2RDBC 2KWVB 1B9RA 1Q5WB 4WWPA 2ZVOA 2WHIA 4DWFA 1I4GA 2JU6X 1UUPA 1K52A 4AOFA 1E8WA 1HTQA 3DBRI 2B3AA 1ET9A 2D11A 2PVGC 3VUWA 1FEHA 2XK5B 3DBLI 3I63C 4XDCA 1TTNA 3HM3A 3RZWC 3QAQA 4OW0A 3VVWB 1L0YB 2KN4A 3MP9A 2HTHA 2WX0A 4MGKE 1NYQA 3B2FA 1V5TA 4PYUA 1QF6A 2KC1A 3ZTCA 3KUCB 1XCTL 2Y3AA 4YXDB 2KMMA 3NOBA 1ZP0B 1N60A 3TEXA 5TR5A 1H4RA 3APCA 2QHOA 2ON8A 2QC8A 2GMIC 1WY8A 3HRDD 1PDXA 3A9JB 4FLHA 1EM7A 1H7WA 1FIQA 2QEJC 1N62A 1K8RB 3QK0A 3DBHB 3HHMA 2AL3A 1YN5A 3PZDA 2VZKB 1E10A 2JF5A 3DBSA 2IJ0A 4MDKE 4DXFA 3AEEB 4XYCA 2AQ3B 4PS7A 3W2DA 2JZZA 4I6LB 3OJ4B 2XNAC 2X38A 1KLUD 4LCDE 1XEEA 5CHFA 4NY0A 2NPTA 2TSSA 1I4RA 1RFKA 1R7SA 5JXVA 3X23A 2MHJA 5HFYA 4ASWC 1WWTA 5IKCM 3AH7A 1GTHA 5E6NA 4K7SA 4B0MA 1IUEA 2NS5A 2WXLA 3BVZA 1KF6B 1Y8RC 1GC7A 5LLIA 3H1UA 1HE8A 2KN5A 2D3BA 3AE1B 2LGSA 1PGBA 2WU2B 1WRIA 3UIPB 3VR9B 2GB1A 1OTRB 1D6EC 3TJPA 2FIFA 5I4DA 1EF5A 2KDIA 4DHJB 5JH5C 4ZHOA 1ROEA 1SF0A 4BBNF 2LRUA 2KLCA 1IGDA 2N9PC 1UWMA 1E7PB 5CX3A 2Z0EB 2KWCA 1LGRA 1WXMA 1VR9A 3AE8B 4K3CA 2WXQA 2PIAA 2L52A 4TSSA 3QC8B 2N9LA 1UELA 2WGSA 4MH8A 3RYTA 1IYFA 4EOYA 2ZPNA 2INDC 3RZFA 4RH6A 2MWSB 1RRBA 4RMAA 3MC0B 4GMVA 4MELA 1JW9D 1ZDVA 2V4LA 2L05A 1EO6A 1PYWD 4PS3A 2AEHA 2BYVE 4HEA1 3T8MA 4MJSA 4IM2A 4II2B 2MX2A 2MEKA 4NZLB 4BOZB 3P4PB 3ABVB 3JSVA 3B0AA 4NQLB 4HCNB 2V3PA 1WM3A 3HK0A 2WXFA 4KZCA 1TY2A 5E6JA 1ESFA 3KYDD 4MGZE 3TIXA 2ZNVC 5KHQA 5J17A 2VH2A 3N30A 2E3TA 3HIZA 3BK2A 3CSFA 4OZCA 2ACZB 1JRUA 3I3TB 2RDGA 1J7BA 4OVVA 2C7HA 2PVOD 2INNE 3ENEA 3U7DA 4DDID 1QILA 2JWUA 1FXAA 1YJJA 3PRZA 1YX6B 2OJRA 2J7QB 1J8CA 3O13A 4G3XB 4JWUC 1VD2A 2QJLA 2MBHA 2IGGA 2QIEB 1RYJA 2BYTA 4K3BA 3P63A 1E9MA 1HXYD 5EE0A 2ASQA 5BMGA 1GB1A 4BOSC 2LGIA 3QWZB 1J19A 2KC2A 5AUKA 4URKA 2N1WA 1F2RC 4RF0A 2IGHA 3R66C 1ZXHA 3N20C 3AMZA 3IAS1 3GE8C 3VH3B 1S1QB 2JYEA 3FILB 3IT6B 5GXGB 1YN3A 1SE4A 2QMTA 5BO4B 5IP4D 1UD7A 3VRAB 4JQWC 2BKFA 3GP7A 3TCAA 3A9KA 4ICVA 3UIOB 3AEGB 2RMMA 2K9XA 4LNOA 3PS6A 4ZHPA 1FRDA 4NAWB 3R8BA 3QCAA 3BZDB 1HEZE 2KANA 3PSEB 2IO0B 3E9SA 5D3DA 3GZNI 3JW0X 4J6IA 3A33B 3AE9B 3ZJUA 1BMLC 3TEZA 1ZUD2 2W55A 3CWIA 3OWEB 1VRAB 1LFDA 4HKZE 1KLVA 1CQVA 2PMVA 3M62B 2NMQA 1QOFA 2LVQA 3LXFA 2JRIB 3A4RA 1XO3A 1WXAA 1OQRA 3PHXB 4KKJA 4OVZA 4XWWA 2K0PA 2DYBA 2M1MA 1GT8A 3T9LA 3RNFC 3RMKC 1JROA 2MBBB 5G55A 4YTNB 3U7ZA 1FCLA 4K1RB 1BT0A 2KDFB 1WYGA 2H88B 4M02A 1JQ4A 2BW2A 2BVCA 1D3ZA 4HJGE 4GSWA 2WP9B 1KOTA 1YIWA 4YL8A 4DXAB 2WQYB 2Z59B 4W9KA 2BYEA 1WXSA 2C60A 4KX6B 1DGJA 3KLSX 1J0GA 1RM6C 3Q3OC 2GOWA 2FCQA 1ET6A 1WJNA 3ZUNA 4FN2A 3A4SC 1HTOA 2LGXA 4EFOA 3AEBB 1ZPSA 5D6JB 2D5GA 3ZVVA 2DYMA 3MC9A 2LGYA 3ZJVA 2XK5A 1L6VA 3C0RB 3IHPC 2KT7A 2RSUA 1NVID 1XLNA 3IAM1 2DNFA 1QQRA 2DYOA 3AEAB 4C7ZA 4A3OA 2MQJA 4FADA 4HXDA 5HI1A 1AWDA 2N9XA 1K53A 2FIDA 5IN7A 2KLGA 3T3OA 3ML9A 4HDQA 1L5PA 4LJOB 1J7AA 2L76A 2VRRB 4WJPA 4E71A 2BS3B 3OG5A 2QSDA 3AU4A 3KH0A 2Y5BB 3A1QB 3A9JA 3M95A 2AX5A 2UWQA 1P1AA 1SXTA 1HZ6A 3H9DA 3IBEA 1F77A 4FXCA 4KSLC 5BMIA 4KV2A 1NDDA 1L0XB 3RNGC 1E90A 3ZXVA 1YJ1A 2J0JA 2BPSA 2G9HD 3ZDMC 2JYTA 5TSSA 2MJ3A 2ZZPB 3DHHC 1H7XA 3Q8FA 3N1XC 2KDEB 2HE7A 3TEWA 2A4ZA 3DQVA 2KJHB 3WAMA 1WR1A 4HJKA 4X57B 3EC8A 2JUOA 2D10A 3WIMA 5LXIB 4JE3B 2KWUB 4RFBA 4N58A 1FCCC 1XQQA 3VDZA 1T0YA 1LXDA 3GB1A 4YWGG 1I4QA 5C23A 5E6OA 3UF8A 2LXAA 4LJPB 3AEFB 1VCBA 3PPAA 1RAXA 1TZ1A 2BKRB 4NJ7A 2FUG1 1QOGA 2V9HA 1L4ZB 1SJED 2LUEA 2MBOA 4MGYE 2L7RA 4XE0A 4RM8A 2DAFA 3Q2AC 2FUHB 1XF5L 2O2VB 3P42A 3VR8B 2GRIA 1STEA 4W9GA 1F0ZA 4LK0M 4KDIC 4KDLB 4ZRQA 2V4IB 1JRPA 1FO4A 3RUIB 3KYCD 1L0VB 3RPFC 1VZ6A 1SIFA 3PVLA 1R4NB 2K8CA 4B6WA 1R4MI 2KQ4X 2K8BA 1ACCA 4NJCA 2I2YA 3CSTA 2KFKB 4EE2A 2AYOB 1T5XD 3L08A 2JX5A 4N9F4 4W9CA 2G4DB 1D4BA 1PGXA 3Q69A 1VLBA 3DBHI 5HG2A 4XZ4A 3KUZA 1UF0A 4LTUA 2XBBC 5CTRC 1UGMA 3AE3B 4DBGA 3NVYA 3N3KB 5D3IB 5IOIA 1OEYJ 3VRBB 2KVZA 4PYZA 1YX5B 2KHWB 3U30A 1AN8A 2LI5A 5EDSA 2IZVB 5HKHA 2NTSA 4P6VF 2KKCA 1QZEA 2KXJA 1TT5B 2KJ6A 3B2GA 2UYZB 1TKEA 2WU5B 4LNNA 4LLGM 4IWPA 2W82A 2L32A 1SE2A 3SD5A 2N4FA 3L10B 3RNEC 4GIVA 1R4MB 1WIAA 3I9V1 2ZCBA 2G4SA 2WNMA 2GBMA 3P1MA 1UZXB 4ICUA 5H92C 4KKIA 3V62A 2JT4B 5AEKB 2AL6A 3FILA 4ARCA 1MG4A 1PFDA 3Q8BA 2IY0B 1P3QU 1C76A 3Q3JA 5JHBA 2GLSA 2N0SB 2H89B 4EZJA 2NR2A 1VDVA 4HPLB 2DZJA 4NAWA 4RGNA 1FD6A 3ZNZB 2BWES 4W9EA 4BBNC 4ITKA 4HKQA 3VHTC 5T8IA 1Q0WB 4S0RA 2MA9B 3ML8A 2MH7A 3PHWB 2G1EA 4CYEA 1WZ3A 3RN9C 1I4XA 4HVBA 2JXTA 1CZPA 1E8ZA 3EGRA 1P7EA 2BS2B 4I6NB 1V86A 1WR6E 1MG8A 3ZXRA 5JZEB 2FBWB 1CMXB 1KRHA 4E3CA 3DVGX 2PEAA 1X1MA 4ANVA 2WDQB 2REXA 2K3UA 4B9KA 1SE3A 4EZLA 1GUAB 2WDVB 3L54A 4XX5A 3ZQ4A 2D3AA 5D2MB 1JWAD 2M8SA 2PE6B 1WFYA 4IW0A 1YMHE 4CHKA 3I57A 3ZRCA 1WXQA 2WXNA 1EU4A 4KGSA 1WRDB 2MW5A 3PZ8A 1D5ZC 3EFCA 1HZ5A 1NI3A 4FHKA 3Q14C 2C9WB 4YTPB 2BBCA 2ZJDA 4K81A 4BKTA 1YQBA 1XLOA 4ZRPA 3V61A 4A6QA 2DHZA 2IBIB 3U52E 2K8HA 4WJQA 2I38A 4C7YA 3BK1A 1YNTE 4KGTA 1M94A 1FMAD 4ZRJA 5EE9A 2CJNA 1OEYA 4US9A 5AZGA 3X0WA 2MP2B 2G45B 3ZNHB 2KO3A 2ZCCA 2HJ8A 4M8MA 4W9FA 1U4AA 3P2BA 2V1YA 1V1PA 3RT3B 5G5GA 3RNAC 3VXWA 5EE3A 3U8ZA 2UU7A 4NPNA 3MC8A 3TL5A 4DK5A 1KFYB 3WCQA 4R3DA 3ECIA 2JY6A 3QJZA 2M17A 2QDFA 4OVUA 4OHJA 2KFKA 4QAYA 2N7EA 4US8A 1CJEA 2WLBA 2LZ6A 4BKSD 4GN1A 1F9JA 3A1QA 1CK1A 3NVZA 2KDBA 4MH0E 1I7HA 2GBNA 2JQRB 4HCPB 3VTVA 1FFVA 1P98A 1D5MC 3BY4B 4TKNA 1P9DU 4E74A 5C1ZA 4LNIA 4YSYB 1QOAA 1RFAA 2PJHA 2IO3B 2AQ1B 1NI2A 2LFIA 1C9FA 2WS3B 3SR6A 1VZ7A 1V6EA 1WGKA 2LJ5A 2FCSA 1BUIC 1IBXB 1NBFC 2G3QB 2C7NB 2CHXA 2J0KA 3RNCC 2RGFA 4ZOHC 2WX1A 2BYFA 3OLMD 3DWMA 2FNJB 4Q2JA 1E8YA 3FAHA 2KWDA 4S17A 1WJ6A 1E8XA 2YEPF 2SAKA 3AECB 2KNBA 3CMMB 3NZUA 4YSZB 2LWPA 3AE7B 1B1ZA 1FNWA 2C5LC 5DPTA 1T0RC 1I42A 2I1JA 1FNVA 3RFZB 4GOCA 1TY0A 1FNUA 1WXVA 1SJHD 1MFWA 2PW9A 1SBBB 2L3ZA 3AXCA 3BIID 3L0WB 3MHSD 5DPRA 1LO5D 2O6VB 3TMPB 3TSSA 4A9AA 1UBQA 3KVFB 3N1YC 2O2VA 3KWLA 2LGDA 3AE5B 1UH6A 3ZLZA 4L1BA 4GGQA 2W3SA 1V49A 3DVGY 4IDIA 4XC2A 3KUDB 2D2QA 4MGIE 4NJ6A 3CIRB 3RNBC 3ZDTA 3C19A 5LXHA 2DENB 1IPGA 2HD5B 3DPDA 4IWQA 4LDTD 2ZNVB 2GI9A 3TEYA 2BT6A 2WXJA 1XT9B 2OJWA 4HROA 1AYFA 1Y56A 2FCNA 3SHQA 4C4VB 4P7IA 4CO7A 1LM8B 3NS8A 2N1VA 4A20A 2NBVB 2CKHB 1JCKB 5FR3A 3W1SA 4OZAA 3CF6E 2M0AA 2KTRB 3FC4A 1Q10A 2W9NA 3P4RB 1GG3A 1V2YA 2YEPB 3BVGA 3AE4B 3AM9A 1V1PB 4MSMB 1YOVB 4GB9A 1C77A 4FJVB 2NBUA 1WE6A 3LJ3A 3VUXA 3WAPA 3N9YC 1TS3A 2A5UA 1XLPA 1GTEA 2K25A 2KTFA 3ZO5B 4ZDVA 2PPHA 2QILA 3RULA 2M0XA 1TKGA 3B9JA 2NTTA
chains in the Genus database with same CATH topology
3KWVA 4WAFA 2HTME 1ROEA 1SF0A 2CJOA 2W54A 1D4BA 3HVDA 1PGXA 3LYYA 3BYTB 1JWSD 3Q69A 1RWSA 1VLBA 4JWSC 5HG2A 2WXPA 2KDMA 3NZ3A 4LTUA 1IGDA 1UWMA 1E7PB 1I4PA 3MFGA 3MHZA 3AE3B 1VJKA 1OQQA 1C4PA 2ZW1A 1E0ZA 3NVVA 2IGDA 1L6UA 3NVYA 5D3IB 1VR9A 1ZXIA 3AE8B 1DOXA 1N5XA 3VRBB 3NVWA 2WXQA 2PIAA 1MI0A 2BTEA 2L52A 4TSSA 1DOYA 2N9LA 4RGMA 1AN8A 4IOIE 1FFUA 4MH8A 2DBYA 1C78A 4GLSC 1QKZA 2WXOA 2NTSA 1TKYA 4P6VF 1MHXA 4RH6A 3B2GA 5G5HA 1TKEA 4XDDA 2WU5B 4H2AA 2RDHA 4LLGM 3EUB2 3MC0B 2W82A 2L32A 1SE2A 2SEBD 1JW9D 1L4DB 1ZDVA 4RGTA 1XLQA 1QT9A 1MHHE 3I9V1 4A55A 1PYWD 2BB5A 2PLPA 1QLBB 1ENFA 4HEA1 2WXIA 2N7JA 2WNMA 1YQ4B 2MEKA 4NZLB 4REZA 1TJEA 3P4PB 4N6EB 3ABVB 1SIJA 1JWUD 3P1MA 1UNSA 4YSXB 2V3PA 2MJEA 3BYYB 1F2RI 2WXFA 4C56C 1TY2A 3H8HA 1AW7A 3L4PA 5E6JA 1ESFA 3NUHB 5H92C 4TMAB 5C3JB 2LEKA 4KKIA 1TS4A 3ZJTA 2M19A 3KQ4A 1YQ3B 1GPXA 3FILA 4ARCA 2E3TA 3SEBA 1ZOYB 4OZCA 3BK2A 3ZGZA 1JMLA 4M0WA 2ACZB 1PFDA 3Q8BA 4GDKB 5C2TB 1C76A 2RDGA 1J7BA 3AN1A 5H8YE 2XN9C 3Q8CA 4L2YA 2PVOD 2INNE 1TZOA 4WH4A 1QILA 2JWUA 3V3XA 1FXAA 1YJJA 2N0SB 2H89B 3GS2A 3J9CA 3NRZA 3O13A 4ZYSA 2HDEA 2MJDA 4JWUC 2QJLA 2IGGA 2QIEB 1VDVA 4L23A 4RGNA 1RYJA 5BYRA 4ARIA 3SFDB 2BYTA 1OFFA 3P63A 3TUOA 1E9MA 1HXYD 3Q8EA 5EE0A 1FD6A 5FK9C 2J4XA 4ITKA 4HKQA 2IPKD 5T8IA 5BMGA 2J52A 1GB1A 1M4VA 2LGIA 3PZ7A 2MH7A 5AUKA 1VZ8A 2PTLA 1F2RC 4RF0A 1EU3A 1JWBD 1QOBA 1N61A 2G1EA 2IGHA 1ZXHA 3AMZA 3IAS1 1I4XA 4A90A 4B0EA 4AS1A 1GOZA 2JXTA 2JYEA 1CZPA 3FILB 1V97A 3EGRA 1P7EA 3IT6B 4KGRA 3BWUD 5GXGB 2BS2B 1YN3A 1SE4A 2JZPA 1C79A 2QMTA 3IT4B 3T3NA 1NEKB 1SSNA 4N59A 3VRAB 3U4EG 1GAQB 3GP7A 2WXHA 3PO0A 2FBWB 4YTMB 1KRHA 1HQRD 4XWTA 3AEGB 3HUIA 2RMMA 2WDQB 2K9XA 2K3UA 1V1OA 1C4CA 4ZHPA 2WDRB 1SE3A 4DQOC 1FRDA 2WDVB 4NAWB 3R8BA 3DWGC 3AE6B 1V8CA 3BZDB 1HEZE 3ZQ4A 1SB3C 3E9SA 5D3DA 4PT5A 1JWAD 1WSPA 1A70A 1KLGD 1E6EB 3AE9B 1YMHE 1KTKA 3R2IA 1BMLC 2PKOA 3I57A 3TEZA 3ZJUA 1WXQA 3W9CB 2WXNA 5AUIA 1ZUD2 2WXGA 2W55A 1EU4A 4WWMA 2LHEA 3CWIA 4HRSA 3OWEB 2Y5CA 3U2SC 5BYSA 1VRAB 4KGSA 2RPVA 4HKZE 2E6XA 1CQVA 2PMVA 2B76B 3PZ8A 2NMQA 3HVZA 1D5ZC 1QOFA 2KAJA 1EWYC 3LXFA 1HZ5A 4MT5A 2AQ2B 1NI3A 1T6BX 1JWMD 2L83A 3MJ5A 4YTPB 1XO3A 1ZDXA 2BBCA 1OQRA 1NYRA 3R2TA 4KKJA 4OVZA 2N9KA 1XLOA 4ZRPA 2WXRA 4A6QA 4XWWA 2K0PA 3U52E 4YT0B 1TS2A 2I38A 4C7YA 1GT8A 3BK1A 1YNTE 4JPSA 1XXGA 1JROA 3C8YA 3CF4A 4KGTA 4YTNB 1FMAD 5EE9A 4P16A 3U7ZA 2CJNA 1FCLA 4US9A 2ZW0A 1WYGA 2Z8LA 2H88B 2R61A 5LNK1 3W5VB 2DWQA 1JQ4A 2EELA 1D5XC 2BW2A 2OHFA 2L1AA 4HJGE 2WP9B 1UWXA 4RNAA 1V1PA 1IBXA 5G5GA 2WQYB 2LHDA 1MVKA 1NENB 4NAMA 5EE3A 5HHDG 3BVMA 1KFYB 4KX6B 1DGJA 3WCQA 4R3DA 2J42A 3AEDB 3KLSX 1RM6C 2LUMA 3EA6A 4OHJA 1ET6A 5FKAC 2LJIA 3AV8A 4US8A 1CJEA 2WLBA 2ICIA 3W5UB 2JX5A 4USAA 4JX1C 4UDUC 2FE8A 1CK1A 3NVZA 1I7HA 2JQRB 3AEBB 1ZPSA 1FRRA 1DYQA 1FFVA 3P4QB 2D5GA 2ONQA 1D5MC 2DYMA 5EE1A 4WURA 3ZJVA 4TQ0A 5D7GA 1L6VA 1PUTA 4YSYB 1QOAA 2WXKA 4AQ7A 4D2KA 2AQ1B 1UGJA 3V05A 4GDLB 2LFIA 1NVID 1XLNA 3IAM1 1C9FA 2DYOA 1QQRA 2JSVX 3AEAB 3URYA 2WS3B 4C7ZA 4CQNA 3LB8C 3SR6A 1VZ7A 1WGKA 4C80A 2K22A 4WQMA 5HI1A 1AWDA 1BUIC 1K53A 4RF1A 4RGOS 1IBXB 3VQIA 1SEBD 1P7FA 1PGAA 3ETRA 4O1NA 1B9RA 1I4GA 3T3OA 1L5PA 2Q5WD 1J7AA 2JU6X 4ZOHC 1YN4A 3UI3A 3DWMA 2BS3B 4Q2JA 1UUPA 1K52A 2QSDA 1EWCA 1I4HA 3FAHA 2KWDA 3Q8AA 2YEPF 2SAKA 3AECB 2AX5A 1ET9A 2KACA 1SXTA 1HZ6A 1DOIA 2PVGC 1FEHA 1GB4A 4YSZB 1TYGB 1F77A 4FXCA 5BMIA 3AE7B 1B1ZA 1FNWA 4XDCA 1XCQL 1L0XB 1FNVA 3RFZB 2INPE 3SFEB 1TY0A 1FNUA 4OW0A 1SJHD 1L0YB 2KN4A 3MP9A 2G9HD 2OEDA 1NYQA 2JYTA 2PW9A 2MJ3A 1SBBB 3NS1A 4J3OD 3B2FA 5TSSA 2LMCA 1N5WA 1QF6A 1ZE3D 3BIID 1H7XA 3Q8FA 1MPEA 1XCTL 2Y3AA 4YXDB 2KMMA 1LO5D 1ZP0B 1N60A 3TEXA 3TEWA 1IGCA 3TSSA 4A9AA 1FXIA 3KWLA 2ON8A 3AE5B 2K5PA 4L1BA 2W3SA 4JE3B 1K50A 4IDIA 1HA5A 3HRDD 1YJIA 1PDXA 4RFBA 4WIPA 4N58A 1FCCC 2Y5PA 3AE2B 1EM7A 1H7WA 3CIRB 1FIQA 2QEJC 1N62A 4MM3B 3GB1A 4YWGG 1I4QA 1YN5A 1E10A 2VZKB 2GI9A 3AEFB 4RCOA 5BYQA 2IJ0A 1KH0A 3E56A 3TEYA 2BB6A 1N63A 3AEEB 2BT6A 2WXJA 2WXMA 4DXFA 2AQ3B 2FUG1 4HROA 3ZYYX 1AYFA 3W2DA 1QOGA 1Y56A 2XNAC 2EKIA 2X38A 1C4AA 1KLUD 4IKGA 1XEEA 1J7CA 1JALA 2TSSA 1FM0D 1I4RA 1L4ZB 1RFKA 2DLBA 2V3NA 1R7SA 1SJED 1JCKB 5FR3A 4XE0A 3W1SA 5JXVA 2J53A 4OZAA 5HFYA 4TQ1A 1WWTA 2VZKD 1TS5A 1XF5L 3P42A 2CU3A 2BS4B 3VR8B 2GRIA 1STEA 2M56B 2M0AA 3AH7A 3FC4A 1GTHA 1F0ZA 4LK0M 4B0MA 1Q10A 1IUEA 2WXLA 4OZBA 1T3QA 4ZRQA 3BVZA 1KF6B 3P4RB 2V4IB 3IXSA 1JRPA 4A8XC 2YEPB 2V0GA 3BVGA 3AE4B 1FO4A 3AM9A 3AB5A 1V1PB 1L0VB 3RPFC 1C77A 1VZ6A 3P4SB 3AE1B 5MPOA 1PGBA 2WU2B 4DXGA 1WRIA 3VR9B 1TS3A 3N9YC 2KQ4X 1XLPA 1GTEA 2GB1A 5BMHA 2W3RA 1D6EC 5I4DA 1ACCA 4MACA 1BXTA 4NJCA 2I2YA 1K51A 2QILA 4EE2A 1T5XD 4ZHOA 2IDYA 1TKGA 3B9JA 2NTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OHF A;  1E9M A;  1ROE A;  1SF0 A;  2HTM E;  2CJO A;  5EE0 A;  2WP9 B;  2W54 A;  4JWS C;  1NYQ A;  4ITK A;  1RWS A;  1VLB A;  2MJ3 A;  3NS1 A;  3B2F A;  1N5W A;  1QF6 A;  3BII D;  4LTU A;  1H7X A;  1UWM A;  1E7P B;  2WQY B;  5G5G A;  2MH7 A;  1NEN B;  3AE3 B;  1VJK A;  1OQQ A;  5EE3 A;  5AUK A;  1E0Z A;  4YXD B;  2KMM A;  1JWB D;  1QOB A;  2G1E A;  1N61 A;  1ZP0 B;  1L6U A;  1N60 A;  1KFY B;  4KX6 B;  3AE8 B;  1DGJ A;  1N5X A;  1ZXI A;  3AMZ A;  3WCQ A;  3AED B;  3VRB B;  3NVW A;  1RM6 C;  1DOX A;  3NVV A;  1CZP A;  4A9A A;  2PIA A;  1FXI A;  1V97 A;  2L52 A;  5GXG B;  1DOY A;  2BS2 B;  3KWL A;  3AE5 B;  1NEK B;  2K5P A;  1FFU A;  2W3S A;  3AV8 A;  2DBY A;  4IDI A;  3VRA B;  3HRD D;  4N59 A;  1YJI A;  1GAQ B;  4US8 A;  1PDX A;  1CJE A;  2WLB A;  4N58 A;  3AE2 B;  1TKY A;  3PO0 A;  2FBW B;  4YTM B;  1H7W A;  3CIR B;  1FIQ A;  4JX1 C;  4P6V F;  4USA A;  1N62 A;  3NVZ A;  1KRH A;  1I7H A;  3B2G A;  5G5H A;  1TKE A;  2JQR B;  2WU5 B;  3AEB B;  3AEG B;  3HUI A;  1FRR A;  3EUB 2;  1FFV A;  3P4Q B;  1E10 A;  2WDQ B;  2K9X A;  3AEF B;  1JW9 D;  5EE1 A;  4ZHP A;  2WDR B;  1XLQ A;  1L6V A;  1N63 A;  3AEE B;  1PUT A;  1QT9 A;  2BT6 A;  4YSY B;  2WDV B;  1FRD A;  1QOA A;  4HRO A;  3ZYY X;  1QLB B;  3AE6 B;  1AYF A;  1V8C A;  3DWG C;  4ZOH C;  1NVI D;  1XLN A;  1SB3 C;  1QOG A;  3AEA B;  4C7Z A;  2WS3 B;  2EKI A;  1YQ4 B;  3LB8 C;  1JWA D;  1A70 A;  3SR6 A;  1TJE A;  3P4P B;  1E6E B;  4N6E B;  3AE9 B;  3ABV B;  1J7C A;  1SIJ A;  1JAL A;  2PKO A;  1FM0 D;  1WGK A;  3P1M A;  1RFK A;  1WXQ A;  4YSX B;  2K22 A;  4WQM A;  5AUI A;  3W9C B;  4C80 A;  2MJE A;  1AWD A;  1R7S A;  3NVY A;  1ZUD 2;  2W55 A;  4WWM A;  3CWI A;  4HRS A;  2Y5C A;  3L4P A;  3ETR A;  5H92 C;  5C3J B;  1B9R A;  1WWT A;  2B76 B;  2LEK A;  2M19 A;  2CU3 A;  1L5P A;  2BS4 B;  3VR8 B;  1YQ3 B;  1J7A A;  2Q5W D;  3HVZ A;  1GPX A;  1QOF A;  2M56 B;  2E3T A;  2KAJ A;  1EWY C;  1ZOY B;  3AH7 A;  3FC4 A;  3LXF A;  1GTH A;  1F0Z A;  3DWM A;  1NI3 A;  2BS3 B;  1IUE A;  2L83 A;  1T3Q A;  4YTP B;  2ACZ B;  1PFD A;  1XO3 A;  1KF6 B;  3P4R B;  1OQR A;  1NYR A;  3FAH A;  1JRP A;  5C2T B;  1XLO A;  3AN1 A;  1J7B A;  3AE4 B;  5H8Y E;  1FO4 A;  3AM9 A;  2PVO D;  3AB5 A;  4YT0 B;  3AEC B;  1L0V B;  2AX5 A;  3RPF C;  2PVG C;  1DOI A;  3P4S B;  3AE1 B;  4C7Y A;  1GT8 A;  5MPO A;  4YSZ B;  1TYG B;  2WU2 B;  1FXA A;  1JRO A;  1YJJ A;  2H89 B;  3CF4 A;  1WRI A;  4YTN B;  1FMA D;  3VR9 B;  2N0S B;  5EE9 A;  2CJN A;  1XLP A;  1GTE A;  4FXC A;  2W3R A;  3NRZ A;  3AE7 B;  4US9 A;  2MJD A;  4JWU C;  2QJL A;  1WYG A;  2QIE B;  2H88 B;  1VDV A;  3W5V B;  1RYJ A;  3SFE B;  2DWQ A;  1JQ4 A;  3SFD B;  3W5U B;  4ZHO A;  2JX5 A;  1TKG A;  3B9J A;  1OFF A;  3P63 A; 
#chains in the Genus database with same CATH topology
 2IO2 B;  3KWV A;  4WAF A;  2HTM E;  4DHZ B;  5J2R A;  2W54 A;  4JWS C;  1JWS D;  3R7R A;  2WXP A;  3NZ3 A;  3VTU A;  3MFG A;  3MHZ A;  3BIN A;  1VJK A;  2ZW1 A;  1E0Z A;  3NVV A;  2IGD A;  2KYW A;  1ZXI A;  3B1L X;  1N5X A;  1DOX A;  3S2A A;  3NG0 A;  1MI0 A;  4DHZ E;  2RD0 A;  4JIO U;  1DOY A;  4M8N A;  4RGM A;  4LNF A;  2DBY A;  4GLS C;  2WXO A;  1TKY A;  4FBJ B;  1MHX A;  3OJ3 A;  4XDD A;  3AUL A;  4W9D A;  2RDH A;  3EUB 2;  2WYQ A;  3APF A;  4F8C B;  2SEB D;  3I5J C;  2CHW A;  1L4D B;  4RGT A;  1XLQ A;  2QCZ A;  4A55 A;  4BAX A;  2BB5 A;  2PLP A;  3H6N A;  3NJT A;  1ENF A;  2GBR A;  2WXI A;  3PRE A;  4PS8 A;  3R3M A;  2CR5 A;  2N7J A;  4AJW A;  4REZ A;  3DDC B;  4N6E B;  1GJZ A;  1SIJ A;  4BVU C;  1UNS A;  3BYY B;  1R4N I;  1WGH A;  4C56 C;  4M00 A;  3H8H A;  1AW7 A;  3L4P A;  3NUH B;  4TMA B;  1TS4 A;  3DOW A;  3ZJT A;  2ZVN A;  2M19 A;  3EHV A;  5AZH A;  1YQ3 B;  1GPX A;  2O6V D;  1ZOY B;  1ZKH A;  3N32 A;  1JML A;  3Q3M C;  4JGH B;  2KJR A;  4FJY A;  1P0R A;  4GDK B;  5C2T B;  3AN1 A;  4L2Y A;  5JHA A;  3RD2 A;  1WGG A;  3IVF A;  1PQS A;  4FA6 A;  2K1F A;  3J9C A;  2HDE A;  2EMT A;  1GNU A;  4FUL A;  2JVC A;  2C7M B;  4L23 A;  3UQB A;  1A5R A;  2DZI A;  1I35 A;  5BYR A;  3SFD B;  4WAA A;  4LNK A;  2KOX A;  1OFF A;  3TUO A;  1FXT B;  1WX7 A;  4BKG A;  5IAA C;  2X8X X;  3QHT A;  5CHW A;  1T0S C;  4EZK A;  3PRP B;  4KIK B;  2J52 A;  1M4V A;  3ZNG C;  3PZ7 A;  4AWJ A;  1VZ8 A;  2PTL A;  2D3C A;  1EU3 A;  1QOB A;  2MCN B;  4B0E A;  4AS1 A;  1WE7 A;  3V60 A;  2L0T A;  4TUU A;  4ACF A;  3IT4 B;  3T3N A;  4M0W B;  4N59 A;  3U4E G;  2JRH A;  2IYD B;  4YTM B;  1WJU A;  1ZGU B;  1WI0 A;  3EFU A;  3HUI A;  4K7U A;  3FKY A;  1C4C A;  1WX8 A;  4G50 A;  1WYW B;  4DDG D;  3RCZ A;  2L00 B;  2MBE A;  3DWG C;  2MP2 A;  1SB3 C;  4WWN A;  2CU1 A;  4PT5 A;  2LVO A;  3L17 A;  1A70 A;  1KLG D;  3WAN A;  4WQO B;  3R2I A;  1KTK A;  2PKO A;  4MM3 A;  5AUI A;  2N7D A;  2WXG A;  4HRS A;  3JYU A;  2L0F A;  5BYS A;  2EKE C;  3ZTD A;  2ZEQ A;  2B76 B;  4HWI B;  3HVZ A;  2KVR A;  4NQK E;  4ZRI A;  1EWY C;  4XGA B;  3ONS A;  3NY5 A;  2AQ2 B;  1T6B X;  2L83 A;  1T0Q C;  2N9K A;  2JZ3 B;  4YT0 B;  1EF1 A;  4JPS A;  1XXG A;  1WGD A;  2BF8 B;  3C8Y A;  3CF4 A;  1IP9 A;  2GBK A;  3B08 A;  2ZW0 A;  4JL9 A;  2Z8L A;  2R61 A;  3W5V B;  1WMH A;  3DHI C;  2DWQ A;  1XD3 B;  3K9P B;  3KW5 B;  3OAW A;  4MSQ B;  1WJ4 A;  3MJW A;  2CHZ A;  2V3S A;  3DBR B;  1IBX A;  4TV3 A;  2LHD A;  2K6D B;  1MVK A;  2R2O A;  4NAM A;  2HJ1 A;  3BVM A;  5HHD G;  3AED B;  3DBL B;  2LXC A;  3MTN B;  3VAW A;  4AJY B;  4F1S A;  1C1Y B;  3H7S A;  2KZR A;  3QAR A;  3AV8 A;  5AZF A;  1LQB A;  1WZ0 A;  3VUY A;  3QX1 A;  3W5U B;  2FCM A;  4KSK C;  1KJT A;  1Z2M A;  1FRR A;  2JWZ A;  3P4Q B;  4P1B C;  4WUR A;  5DCN A;  4TQ0 A;  2LAS A;  5D7G A;  1V81 A;  1PUT A;  4AQ7 A;  4D2K A;  1UGJ A;  1F52 A;  4GDL B;  2KMC A;  3LB8 C;  3IFW B;  3N1Z C;  2FAZ A;  2J0M A;  4WQM A;  1G6J A;  1TBE A;  1PGA A;  3ETR A;  2O6V A;  5DPS A;  2Q5W D;  4IWO A;  1YN4 A;  3UI3 A;  4GU2 A;  2OOB B;  1EWC A;  1I4H A;  3Q8A A;  3Q3N C;  3H7P B;  2KAC A;  1DOI A;  3HM6 X;  1GB4 A;  1TYG B;  1OQY A;  3PRM B;  2GBJ A;  3UIN B;  1XCQ L;  4W9L A;  3PGE A;  2KD0 A;  2INP E;  3SFE B;  4AP4 C;  4IM0 A;  5J18 A;  4C4V A;  1AAR A;  1WGR A;  4LDT B;  2OED A;  3NS1 A;  4J3O D;  3Q6B A;  2LMC A;  5IA7 A;  1N5W A;  1ZE3 D;  1MPE A;  1WX9 A;  5G2N A;  3K9O B;  2CS4 A;  1IGC A;  1FXI A;  2K5P A;  2KTR A;  4HDO A;  1K50 A;  1HA5 A;  1YJI A;  3GE3 C;  4WIP A;  2Y5P A;  3AE2 B;  4MM3 B;  3NHE B;  3W1Y A;  2IO1 B;  2BWF A;  4RCO A;  5BYQ A;  1KH0 A;  3E56 A;  3VTW A;  2BB6 A;  1N63 A;  2WXM A;  3ZYY X;  1KM7 A;  3DCG A;  2EKI A;  1ZW7 A;  1C4A A;  1FPY A;  3LDZ E;  4IKG A;  2NBW B;  3WAO A;  1J7C A;  2D07 B;  2YVC A;  1JAL A;  1FM0 D;  2DLB A;  2V3N A;  3PLU A;  2MSE D;  4I6P A;  3AI5 A;  4FJZ A;  2J53 A;  3VFK A;  4TQ1 A;  4JLC A;  2VZK D;  1TS5 A;  2CU3 A;  2BS4 B;  4P1C C;  4W9J A;  2M56 B;  2DZK A;  3QA8 A;  2WWZ A;  1WMH B;  2BQQ A;  4OZB A;  1T3Q A;  4W9H A;  3IXS A;  3JVZ X;  4A8X C;  2V0G A;  2RR9 A;  3AB5 A;  1SGH A;  2LVP A;  3P4S B;  5MPO A;  4DXG A;  4PK1 A;  1V80 A;  5BMH A;  1WM2 A;  2W3R A;  4M01 A;  3DVN V;  4WJO A;  2ZPY A;  1V5O A;  4ANX A;  5L83 A;  4BFR A;  4MAC A;  1BXT A;  1K51 A;  2XEW A;  2KX0 A;  2IDY A;  2MBQ A;  4IC7 B;  3WAL A;  2CJO A;  2NPT B;  3HVD A;  2K6Q A;  3LYY A;  3BYT B;  1RWS A;  2Z0D B;  2R2Q A;  1E7V A;  4II3 B;  2KDM A;  1I4P A;  2IY1 B;  1OQQ A;  1C4P A;  1L7Y A;  2VH1 A;  5FR6 A;  1L6U A;  2NVU I;  1TIF A;  3NVW A;  1H8C A;  2BTE A;  3GOE A;  4IOI E;  1FFU A;  3SU8 X;  1C78 A;  4DHJ D;  1QKZ A;  1F1H A;  3M63 B;  4GDK A;  5G5H A;  5IO9 A;  4WWO A;  4NNJ B;  4H2A A;  3PV1 A;  4HLE A;  3ZW3 A;  5GMV A;  4KZ0 A;  1QT9 A;  4G0N B;  1MHH E;  3V6C B;  4HPM B;  2N9E B;  1UBI A;  1QLB B;  2RPQ A;  1OGW A;  1YQ4 B;  1TJE A;  1JWU D;  1E7U A;  4YSX B;  2MJE A;  4IM3 A;  1F2R I;  4KIK A;  3L13 A;  5C3J B;  5KHO A;  4G11 A;  2LEK A;  4IUM B;  2INC C;  3KQ4 A;  3SEB A;  2I1K A;  3ZGZ A;  4M0W A;  2YLM A;  3GZN B;  2DAJ A;  5H8Y E;  2XN9 C;  3Q8C A;  4AUQ C;  1TZO A;  4WH4 A;  3V3X A;  1Z5S B;  2K39 A;  3GS2 A;  3O65 B;  3L16 A;  3PT2 B;  1N6Z A;  3NRZ A;  1E5W A;  4ZYS A;  2LD9 A;  2MJD A;  3NZS A;  3TBL D;  4MJS B;  4ARI A;  4KVG B;  3RI7 C;  1SE9 A;  4IG7 B;  5L95 C;  3JSV B;  3Q8E A;  5FK9 C;  2J4X A;  2KK8 A;  2IPK D;  2LRW A;  3QIJ A;  3R7Q A;  2M4N A;  1JWB D;  1N61 A;  4A90 A;  2JXX A;  4HK2 A;  4F7Z A;  1GOZ A;  1V97 A;  3DVN U;  4KGR A;  3BWU D;  2JZP A;  1C79 A;  1NEK B;  1TGZ B;  1SSN A;  3UQA A;  2EMS A;  2NCN A;  3ZKJ C;  1GAQ B;  4EEW A;  3WA0 A;  1ISN A;  1GC6 A;  2WXH A;  3PO0 A;  1WF9 A;  4EUT A;  4WJN A;  1HQR D;  4ANW A;  4XWT A;  1L2N A;  3W1S C;  1V1O A;  3EEC A;  3V6E B;  3ZIM A;  2WDR B;  4DQO C;  3AE6 B;  1V8C A;  1C3T A;  4BKS A;  1WSP A;  3D32 A;  1E6E B;  2KX3 A;  3W9C B;  3Q3F A;  3PTF C;  4WWM A;  1RLF A;  2LHE A;  2Y5C A;  3U2S C;  2RPV A;  1MJD A;  2E6X A;  3DHG C;  3SDL C;  5CHV C;  4C00 A;  2BGF A;  4GXB A;  2KAJ A;  4MT5 A;  1JWM D;  5DPW A;  1Q1O A;  3MJ5 A;  1ZDX A;  4K7W A;  3A9K B;  2KFJ A;  1NYR A;  3R2T A;  4HPP A;  2KMA A;  2WXR A;  4EKU A;  3PLV A;  1TS2 A;  2JPH A;  1WH3 A;  1WGY A;  1YD8 U;  5D94 A;  4P16 A;  1EUV B;  3IG3 A;  3QQ8 B;  4MEM A;  2KQ7 A;  5LNK 1;  3APD A;  4GDL A;  2EEL A;  1D5X C;  2OHF A;  2L1A A;  3M3J A;  1UWX A;  4RNA A;  3ZNI D;  3VH4 B;  1NEN B;  2J42 A;  2LUM A;  3EA6 A;  4FHJ A;  4W9I A;  4ANU A;  2PE9 A;  2DZM A;  5E6P A;  5FKA C;  4ZYN A;  2LJI A;  2MLB A;  1V9J A;  2L8J A;  2MRP A;  2WDT B;  3UGB B;  2ICI A;  4USA A;  4JX1 C;  4UDU C;  2FE8 A;  4B95 A;  3H7P A;  1DYQ A;  4RM9 A;  3ZRF A;  2ONQ A;  1S3S G;  5EE1 A;  4BZA A;  2D3G A;  3AU5 A;  2DX5 B;  2WXK A;  3V05 A;  2KQS A;  2JSV X;  2AWT A;  3ALB A;  3URY A;  4CQN A;  4A3P A;  4ZRK A;  4C80 A;  2K22 A;  4RF1 A;  4RGO S;  3VQI A;  1SEB D;  1P7F A;  4O1N A;  2RDB C;  2KWV B;  1B9R A;  1Q5W B;  4WWP A;  2ZVO A;  2WHI A;  4DWF A;  1I4G A;  2JU6 X;  1UUP A;  1K52 A;  4AOF A;  1E8W A;  1HTQ A;  3DBR I;  2B3A A;  1ET9 A;  2D11 A;  2PVG C;  3VUW A;  1FEH A;  2XK5 B;  3DBL I;  3I63 C;  4XDC A;  1TTN A;  3HM3 A;  3RZW C;  3QAQ A;  4OW0 A;  3VVW B;  1L0Y B;  2KN4 A;  3MP9 A;  2HTH A;  2WX0 A;  4MGK E;  1NYQ A;  3B2F A;  1V5T A;  4PYU A;  1QF6 A;  2KC1 A;  3ZTC A;  3KUC B;  1XCT L;  2Y3A A;  4YXD B;  2KMM A;  3NOB A;  1ZP0 B;  1N60 A;  3TEX A;  5TR5 A;  1H4R A;  3APC A;  2QHO A;  2ON8 A;  2QC8 A;  2GMI C;  1WY8 A;  3HRD D;  1PDX A;  3A9J B;  4FLH A;  1EM7 A;  1H7W A;  1FIQ A;  2QEJ C;  1N62 A;  1K8R B;  3QK0 A;  3DBH B;  3HHM A;  2AL3 A;  1YN5 A;  3PZD A;  2VZK B;  1E10 A;  2JF5 A;  3DBS A;  2IJ0 A;  4MDK E;  4DXF A;  3AEE B;  4XYC A;  2AQ3 B;  4PS7 A;  3W2D A;  2JZZ A;  4I6L B;  3OJ4 B;  2XNA C;  2X38 A;  1KLU D;  4LCD E;  1XEE A;  5CHF A;  4NY0 A;  2NPT A;  2TSS A;  1I4R A;  1RFK A;  1R7S A;  5JXV A;  3X23 A;  2MHJ A;  5HFY A;  4ASW C;  1WWT A;  5IKC M;  3AH7 A;  1GTH A;  5E6N A;  4K7S A;  4B0M A;  1IUE A;  2NS5 A;  2WXL A;  3BVZ A;  1KF6 B;  1Y8R C;  1GC7 A;  5LLI A;  3H1U A;  1HE8 A;  2KN5 A;  2D3B A;  3AE1 B;  2LGS A;  1PGB A;  2WU2 B;  1WRI A;  3UIP B;  3VR9 B;  2GB1 A;  1OTR B;  1D6E C;  3TJP A;  2FIF A;  5I4D A;  1EF5 A;  2KDI A;  4DHJ B;  5JH5 C;  4ZHO A;  1ROE A;  1SF0 A;  4BBN F;  2LRU A;  2KLC A;  1IGD A;  2N9P C;  1UWM A;  1E7P B;  5CX3 A;  2Z0E B;  2KWC A;  1LGR A;  1WXM A;  1VR9 A;  3AE8 B;  4K3C A;  2WXQ A;  2PIA A;  2L52 A;  4TSS A;  3QC8 B;  2N9L A;  1UEL A;  2WGS A;  4MH8 A;  3RYT A;  1IYF A;  4EOY A;  2ZPN A;  2IND C;  3RZF A;  4RH6 A;  2MWS B;  1RRB A;  4RMA A;  3MC0 B;  4GMV A;  4MEL A;  1JW9 D;  1ZDV A;  2V4L A;  2L05 A;  1EO6 A;  1PYW D;  4PS3 A;  2AEH A;  2BYV E;  4HEA 1;  3T8M A;  4MJS A;  4IM2 A;  4II2 B;  2MX2 A;  2MEK A;  4NZL B;  4BOZ B;  3P4P B;  3ABV B;  3JSV A;  3B0A A;  4NQL B;  4HCN B;  2V3P A;  1WM3 A;  3HK0 A;  2WXF A;  4KZC A;  1TY2 A;  5E6J A;  1ESF A;  3KYD D;  4MGZ E;  3TIX A;  2ZNV C;  5KHQ A;  5J17 A;  2VH2 A;  3N30 A;  2E3T A;  3HIZ A;  3BK2 A;  3CSF A;  4OZC A;  2ACZ B;  1JRU A;  3I3T B;  2RDG A;  1J7B A;  4OVV A;  2C7H A;  2PVO D;  2INN E;  3ENE A;  3U7D A;  4DDI D;  1QIL A;  2JWU A;  1FXA A;  1YJJ A;  3PRZ A;  1YX6 B;  2OJR A;  2J7Q B;  1J8C A;  3O13 A;  4G3X B;  4JWU C;  1VD2 A;  2QJL A;  2MBH A;  2IGG A;  2QIE B;  1RYJ A;  2BYT A;  4K3B A;  3P63 A;  1E9M A;  1HXY D;  5EE0 A;  2ASQ A;  5BMG A;  1GB1 A;  4BOS C;  2LGI A;  3QWZ B;  1J19 A;  2KC2 A;  5AUK A;  4URK A;  2N1W A;  1F2R C;  4RF0 A;  2IGH A;  3R66 C;  1ZXH A;  3N20 C;  3AMZ A;  3IAS 1;  3GE8 C;  3VH3 B;  1S1Q B;  2JYE A;  3FIL B;  3IT6 B;  5GXG B;  1YN3 A;  1SE4 A;  2QMT A;  5BO4 B;  5IP4 D;  1UD7 A;  3VRA B;  4JQW C;  2BKF A;  3GP7 A;  3TCA A;  3A9K A;  4ICV A;  3UIO B;  3AEG B;  2RMM A;  2K9X A;  4LNO A;  3PS6 A;  4ZHP A;  1FRD A;  4NAW B;  3R8B A;  3QCA A;  3BZD B;  1HEZ E;  2KAN A;  3PSE B;  2IO0 B;  3E9S A;  5D3D A;  3GZN I;  3JW0 X;  4J6I A;  3A33 B;  3AE9 B;  3ZJU A;  1BML C;  3TEZ A;  1ZUD 2;  2W55 A;  3CWI A;  3OWE B;  1VRA B;  1LFD A;  4HKZ E;  1KLV A;  1CQV A;  2PMV A;  3M62 B;  2NMQ A;  1QOF A;  2LVQ A;  3LXF A;  2JRI B;  3A4R A;  1XO3 A;  1WXA A;  1OQR A;  3PHX B;  4KKJ A;  4OVZ A;  4XWW A;  2K0P A;  2DYB A;  2M1M A;  1GT8 A;  3T9L A;  3RNF C;  3RMK C;  1JRO A;  2MBB B;  5G55 A;  4YTN B;  3U7Z A;  1FCL A;  4K1R B;  1BT0 A;  2KDF B;  1WYG A;  2H88 B;  4M02 A;  1JQ4 A;  2BW2 A;  2BVC A;  1D3Z A;  4HJG E;  4GSW A;  2WP9 B;  1KOT A;  1YIW A;  4YL8 A;  4DXA B;  2WQY B;  2Z59 B;  4W9K A;  2BYE A;  1WXS A;  2C60 A;  4KX6 B;  1DGJ A;  3KLS X;  1J0G A;  1RM6 C;  3Q3O C;  2GOW A;  2FCQ A;  1ET6 A;  1WJN A;  3ZUN A;  4FN2 A;  3A4S C;  1HTO A;  2LGX A;  4EFO A;  3AEB B;  1ZPS A;  5D6J B;  2D5G A;  3ZVV A;  2DYM A;  3MC9 A;  2LGY A;  3ZJV A;  2XK5 A;  1L6V A;  3C0R B;  3IHP C;  2KT7 A;  2RSU A;  1NVI D;  1XLN A;  3IAM 1;  2DNF A;  1QQR A;  2DYO A;  3AEA B;  4C7Z A;  4A3O A;  2MQJ A;  4FAD A;  4HXD A;  5HI1 A;  1AWD A;  2N9X A;  1K53 A;  2FID A;  5IN7 A;  2KLG A;  3T3O A;  3ML9 A;  4HDQ A;  1L5P A;  4LJO B;  1J7A A;  2L76 A;  2VRR B;  4WJP A;  4E71 A;  2BS3 B;  3OG5 A;  2QSD A;  3AU4 A;  3KH0 A;  2Y5B B;  3A1Q B;  3A9J A;  3M95 A;  2AX5 A;  2UWQ A;  1P1A A;  1SXT A;  1HZ6 A;  3H9D A;  3IBE A;  1F77 A;  4FXC A;  4KSL C;  5BMI A;  4KV2 A;  1NDD A;  1L0X B;  3RNG C;  1E90 A;  3ZXV A;  1YJ1 A;  2J0J A;  2BPS A;  2G9H D;  3ZDM C;  2JYT A;  5TSS A;  2MJ3 A;  2ZZP B;  3DHH C;  1H7X A;  3Q8F A;  3N1X C;  2KDE B;  2HE7 A;  3TEW A;  2A4Z A;  3DQV A;  2KJH B;  3WAM A;  1WR1 A;  4HJK A;  4X57 B;  3EC8 A;  2JUO A;  2D10 A;  3WIM A;  5LXI B;  4JE3 B;  2KWU B;  4RFB A;  4N58 A;  1FCC C;  1XQQ A;  3VDZ A;  1T0Y A;  1LXD A;  3GB1 A;  4YWG G;  1I4Q A;  5C23 A;  5E6O A;  3UF8 A;  2LXA A;  4LJP B;  3AEF B;  1VCB A;  3PPA A;  1RAX A;  1TZ1 A;  2BKR B;  4NJ7 A;  2FUG 1;  1QOG A;  2V9H A;  1L4Z B;  1SJE D;  2LUE A;  2MBO A;  4MGY E;  2L7R A;  4XE0 A;  4RM8 A;  2DAF A;  3Q2A C;  2FUH B;  1XF5 L;  2O2V B;  3P42 A;  3VR8 B;  2GRI A;  1STE A;  4W9G A;  1F0Z A;  4LK0 M;  4KDI C;  4KDL B;  4ZRQ A;  2V4I B;  1JRP A;  1FO4 A;  3RUI B;  3KYC D;  1L0V B;  3RPF C;  1VZ6 A;  1SIF A;  3PVL A;  1R4N B;  2K8C A;  4B6W A;  1R4M I;  2KQ4 X;  2K8B A;  1ACC A;  4NJC A;  2I2Y A;  3CST A;  2KFK B;  4EE2 A;  2AYO B;  1T5X D;  3L08 A;  2JX5 A;  4N9F 4;  4W9C A;  2G4D B;  1D4B A;  1PGX A;  3Q69 A;  1VLB A;  3DBH I;  5HG2 A;  4XZ4 A;  3KUZ A;  1UF0 A;  4LTU A;  2XBB C;  5CTR C;  1UGM A;  3AE3 B;  4DBG A;  3NVY A;  3N3K B;  5D3I B;  5IOI A;  1OEY J;  3VRB B;  2KVZ A;  4PYZ A;  1YX5 B;  2KHW B;  3U30 A;  1AN8 A;  2LI5 A;  5EDS A;  2IZV B;  5HKH A;  2NTS A;  4P6V F;  2KKC A;  1QZE A;  2KXJ A;  1TT5 B;  2KJ6 A;  3B2G A;  2UYZ B;  1TKE A;  2WU5 B;  4LNN A;  4LLG M;  4IWP A;  2W82 A;  2L32 A;  1SE2 A;  3SD5 A;  2N4F A;  3L10 B;  3RNE C;  4GIV A;  1R4M B;  1WIA A;  3I9V 1;  2ZCB A;  2G4S A;  2WNM A;  2GBM A;  3P1M A;  1UZX B;  4ICU A;  5H92 C;  4KKI A;  3V62 A;  2JT4 B;  5AEK B;  2AL6 A;  3FIL A;  4ARC A;  1MG4 A;  1PFD A;  3Q8B A;  2IY0 B;  1P3Q U;  1C76 A;  3Q3J A;  5JHB A;  2GLS A;  2N0S B;  2H89 B;  4EZJ A;  2NR2 A;  1VDV A;  4HPL B;  2DZJ A;  4NAW A;  4RGN A;  1FD6 A;  3ZNZ B;  2BWE S;  4W9E A;  4BBN C;  4ITK A;  4HKQ A;  3VHT C;  5T8I A;  1Q0W B;  4S0R A;  2MA9 B;  3ML8 A;  2MH7 A;  3PHW B;  2G1E A;  4CYE A;  1WZ3 A;  3RN9 C;  1I4X A;  4HVB A;  2JXT A;  1CZP A;  1E8Z A;  3EGR A;  1P7E A;  2BS2 B;  4I6N B;  1V86 A;  1WR6 E;  1MG8 A;  3ZXR A;  5JZE B;  2FBW B;  1CMX B;  1KRH A;  4E3C A;  3DVG X;  2PEA A;  1X1M A;  4ANV A;  2WDQ B;  2REX A;  2K3U A;  4B9K A;  1SE3 A;  4EZL A;  1GUA B;  2WDV B;  3L54 A;  4XX5 A;  3ZQ4 A;  2D3A A;  5D2M B;  1JWA D;  2M8S A;  2PE6 B;  1WFY A;  4IW0 A;  1YMH E;  4CHK A;  3I57 A;  3ZRC A;  1WXQ A;  2WXN A;  1EU4 A;  4KGS A;  1WRD B;  2MW5 A;  3PZ8 A;  1D5Z C;  3EFC A;  1HZ5 A;  1NI3 A;  4FHK A;  3Q14 C;  2C9W B;  4YTP B;  2BBC A;  2ZJD A;  4K81 A;  4BKT A;  1YQB A;  1XLO A;  4ZRP A;  3V61 A;  4A6Q A;  2DHZ A;  2IBI B;  3U52 E;  2K8H A;  4WJQ A;  2I38 A;  4C7Y A;  3BK1 A;  1YNT E;  4KGT A;  1M94 A;  1FMA D;  4ZRJ A;  5EE9 A;  2CJN A;  1OEY A;  4US9 A;  5AZG A;  3X0W A;  2MP2 B;  2G45 B;  3ZNH B;  2KO3 A;  2ZCC A;  2HJ8 A;  4M8M A;  4W9F A;  1U4A A;  3P2B A;  2V1Y A;  1V1P A;  3RT3 B;  5G5G A;  3RNA C;  3VXW A;  5EE3 A;  3U8Z A;  2UU7 A;  4NPN A;  3MC8 A;  3TL5 A;  4DK5 A;  1KFY B;  3WCQ A;  4R3D A;  3ECI A;  2JY6 A;  3QJZ A;  2M17 A;  2QDF A;  4OVU A;  4OHJ A;  2KFK A;  4QAY A;  2N7E A;  4US8 A;  1CJE A;  2WLB A;  2LZ6 A;  4BKS D;  4GN1 A;  1F9J A;  3A1Q A;  1CK1 A;  3NVZ A;  2KDB A;  4MH0 E;  1I7H A;  2GBN A;  2JQR B;  4HCP B;  3VTV A;  1FFV A;  1P98 A;  1D5M C;  3BY4 B;  4TKN A;  1P9D U;  4E74 A;  5C1Z A;  4LNI A;  4YSY B;  1QOA A;  1RFA A;  2PJH A;  2IO3 B;  2AQ1 B;  1NI2 A;  2LFI A;  1C9F A;  2WS3 B;  3SR6 A;  1VZ7 A;  1V6E A;  1WGK A;  2LJ5 A;  2FCS A;  1BUI C;  1IBX B;  1NBF C;  2G3Q B;  2C7N B;  2CHX A;  2J0K A;  3RNC C;  2RGF A;  4ZOH C;  2WX1 A;  2BYF A;  3OLM D;  3DWM A;  2FNJ B;  4Q2J A;  1E8Y A;  3FAH A;  2KWD A;  4S17 A;  1WJ6 A;  1E8X A;  2YEP F;  2SAK A;  3AEC B;  2KNB A;  3CMM B;  3NZU A;  4YSZ B;  2LWP A;  3AE7 B;  1B1Z A;  1FNW A;  2C5L C;  5DPT A;  1T0R C;  1I42 A;  2I1J A;  1FNV A;  3RFZ B;  4GOC A;  1TY0 A;  1FNU A;  1WXV A;  1SJH D;  1MFW A;  2PW9 A;  1SBB B;  2L3Z A;  3AXC A;  3BII D;  3L0W B;  3MHS D;  5DPR A;  1LO5 D;  2O6V B;  3TMP B;  3TSS A;  4A9A A;  1UBQ A;  3KVF B;  3N1Y C;  2O2V A;  3KWL A;  2LGD A;  3AE5 B;  1UH6 A;  3ZLZ A;  4L1B A;  4GGQ A;  2W3S A;  1V49 A;  3DVG Y;  4IDI A;  4XC2 A;  3KUD B;  2D2Q A;  4MGI E;  4NJ6 A;  3CIR B;  3RNB C;  3ZDT A;  3C19 A;  5LXH A;  2DEN B;  1IPG A;  2HD5 B;  3DPD A;  4IWQ A;  4LDT D;  2ZNV B;  2GI9 A;  3TEY A;  2BT6 A;  2WXJ A;  1XT9 B;  2OJW A;  4HRO A;  1AYF A;  1Y56 A;  2FCN A;  3SHQ A;  4C4V B;  4P7I A;  4CO7 A;  1LM8 B;  3NS8 A;  2N1V A;  4A20 A;  2NBV B;  2CKH B;  1JCK B;  5FR3 A;  3W1S A;  4OZA A;  3CF6 E;  2M0A A;  2KTR B;  3FC4 A;  1Q10 A;  2W9N A;  3P4R B;  1GG3 A;  1V2Y A;  2YEP B;  3BVG A;  3AE4 B;  3AM9 A;  1V1P B;  4MSM B;  1YOV B;  4GB9 A;  1C77 A;  4FJV B;  2NBU A;  1WE6 A;  3LJ3 A;  3VUX A;  3WAP A;  3N9Y C;  1TS3 A;  2A5U A;  1XLP A;  1GTE A;  2K25 A;  2KTF A;  3ZO5 B;  4ZDV A;  2PPH A;  2QIL A;  3RUL A;  2M0X A;  1TKG A;  3B9J A;  2NTT A; 
#chains in the Genus database with same CATH homology
 3KWV A;  4WAF A;  2HTM E;  1ROE A;  1SF0 A;  2CJO A;  2W54 A;  1D4B A;  3HVD A;  1PGX A;  3LYY A;  3BYT B;  1JWS D;  3Q69 A;  1RWS A;  1VLB A;  4JWS C;  5HG2 A;  2WXP A;  2KDM A;  3NZ3 A;  4LTU A;  1IGD A;  1UWM A;  1E7P B;  1I4P A;  3MFG A;  3MHZ A;  3AE3 B;  1VJK A;  1OQQ A;  1C4P A;  2ZW1 A;  1E0Z A;  3NVV A;  2IGD A;  1L6U A;  3NVY A;  5D3I B;  1VR9 A;  1ZXI A;  3AE8 B;  1DOX A;  1N5X A;  3VRB B;  3NVW A;  2WXQ A;  2PIA A;  1MI0 A;  2BTE A;  2L52 A;  4TSS A;  1DOY A;  2N9L A;  4RGM A;  1AN8 A;  4IOI E;  1FFU A;  4MH8 A;  2DBY A;  1C78 A;  4GLS C;  1QKZ A;  2WXO A;  2NTS A;  1TKY A;  4P6V F;  1MHX A;  4RH6 A;  3B2G A;  5G5H A;  1TKE A;  4XDD A;  2WU5 B;  4H2A A;  2RDH A;  4LLG M;  3EUB 2;  3MC0 B;  2W82 A;  2L32 A;  1SE2 A;  2SEB D;  1JW9 D;  1L4D B;  1ZDV A;  4RGT A;  1XLQ A;  1QT9 A;  1MHH E;  3I9V 1;  4A55 A;  1PYW D;  2BB5 A;  2PLP A;  1QLB B;  1ENF A;  4HEA 1;  2WXI A;  2N7J A;  2WNM A;  1YQ4 B;  2MEK A;  4NZL B;  4REZ A;  1TJE A;  3P4P B;  4N6E B;  3ABV B;  1SIJ A;  1JWU D;  3P1M A;  1UNS A;  4YSX B;  2V3P A;  2MJE A;  3BYY B;  1F2R I;  2WXF A;  4C56 C;  1TY2 A;  3H8H A;  1AW7 A;  3L4P A;  5E6J A;  1ESF A;  3NUH B;  5H92 C;  4TMA B;  5C3J B;  2LEK A;  4KKI A;  1TS4 A;  3ZJT A;  2M19 A;  3KQ4 A;  1YQ3 B;  1GPX A;  3FIL A;  4ARC A;  2E3T A;  3SEB A;  1ZOY B;  4OZC A;  3BK2 A;  3ZGZ A;  1JML A;  4M0W A;  2ACZ B;  1PFD A;  3Q8B A;  4GDK B;  5C2T B;  1C76 A;  2RDG A;  1J7B A;  3AN1 A;  5H8Y E;  2XN9 C;  3Q8C A;  4L2Y A;  2PVO D;  2INN E;  1TZO A;  4WH4 A;  1QIL A;  2JWU A;  3V3X A;  1FXA A;  1YJJ A;  2N0S B;  2H89 B;  3GS2 A;  3J9C A;  3NRZ A;  3O13 A;  4ZYS A;  2HDE A;  2MJD A;  4JWU C;  2QJL A;  2IGG A;  2QIE B;  1VDV A;  4L23 A;  4RGN A;  1RYJ A;  5BYR A;  4ARI A;  3SFD B;  2BYT A;  1OFF A;  3P63 A;  3TUO A;  1E9M A;  1HXY D;  3Q8E A;  5EE0 A;  1FD6 A;  5FK9 C;  2J4X A;  4ITK A;  4HKQ A;  2IPK D;  5T8I A;  5BMG A;  2J52 A;  1GB1 A;  1M4V A;  2LGI A;  3PZ7 A;  2MH7 A;  5AUK A;  1VZ8 A;  2PTL A;  1F2R C;  4RF0 A;  1EU3 A;  1JWB D;  1QOB A;  1N61 A;  2G1E A;  2IGH A;  1ZXH A;  3AMZ A;  3IAS 1;  1I4X A;  4A90 A;  4B0E A;  4AS1 A;  1GOZ A;  2JXT A;  2JYE A;  1CZP A;  3FIL B;  1V97 A;  3EGR A;  1P7E A;  3IT6 B;  4KGR A;  3BWU D;  5GXG B;  2BS2 B;  1YN3 A;  1SE4 A;  2JZP A;  1C79 A;  2QMT A;  3IT4 B;  3T3N A;  1NEK B;  1SSN A;  4N59 A;  3VRA B;  3U4E G;  1GAQ B;  3GP7 A;  2WXH A;  3PO0 A;  2FBW B;  4YTM B;  1KRH A;  1HQR D;  4XWT A;  3AEG B;  3HUI A;  2RMM A;  2WDQ B;  2K9X A;  2K3U A;  1V1O A;  1C4C A;  4ZHP A;  2WDR B;  1SE3 A;  4DQO C;  1FRD A;  2WDV B;  4NAW B;  3R8B A;  3DWG C;  3AE6 B;  1V8C A;  3BZD B;  1HEZ E;  3ZQ4 A;  1SB3 C;  3E9S A;  5D3D A;  4PT5 A;  1JWA D;  1WSP A;  1A70 A;  1KLG D;  1E6E B;  3AE9 B;  1YMH E;  1KTK A;  3R2I A;  1BML C;  2PKO A;  3I57 A;  3TEZ A;  3ZJU A;  1WXQ A;  3W9C B;  2WXN A;  5AUI A;  1ZUD 2;  2WXG A;  2W55 A;  1EU4 A;  4WWM A;  2LHE A;  3CWI A;  4HRS A;  3OWE B;  2Y5C A;  3U2S C;  5BYS A;  1VRA B;  4KGS A;  2RPV A;  4HKZ E;  2E6X A;  1CQV A;  2PMV A;  2B76 B;  3PZ8 A;  2NMQ A;  3HVZ A;  1D5Z C;  1QOF A;  2KAJ A;  1EWY C;  3LXF A;  1HZ5 A;  4MT5 A;  2AQ2 B;  1NI3 A;  1T6B X;  1JWM D;  2L83 A;  3MJ5 A;  4YTP B;  1XO3 A;  1ZDX A;  2BBC A;  1OQR A;  1NYR A;  3R2T A;  4KKJ A;  4OVZ A;  2N9K A;  1XLO A;  4ZRP A;  2WXR A;  4A6Q A;  4XWW A;  2K0P A;  3U52 E;  4YT0 B;  1TS2 A;  2I38 A;  4C7Y A;  1GT8 A;  3BK1 A;  1YNT E;  4JPS A;  1XXG A;  1JRO A;  3C8Y A;  3CF4 A;  4KGT A;  4YTN B;  1FMA D;  5EE9 A;  4P16 A;  3U7Z A;  2CJN A;  1FCL A;  4US9 A;  2ZW0 A;  1WYG A;  2Z8L A;  2H88 B;  2R61 A;  5LNK 1;  3W5V B;  2DWQ A;  1JQ4 A;  2EEL A;  1D5X C;  2BW2 A;  2OHF A;  2L1A A;  4HJG E;  2WP9 B;  1UWX A;  4RNA A;  1V1P A;  1IBX A;  5G5G A;  2WQY B;  2LHD A;  1MVK A;  1NEN B;  4NAM A;  5EE3 A;  5HHD G;  3BVM A;  1KFY B;  4KX6 B;  1DGJ A;  3WCQ A;  4R3D A;  2J42 A;  3AED B;  3KLS X;  1RM6 C;  2LUM A;  3EA6 A;  4OHJ A;  1ET6 A;  5FKA C;  2LJI A;  3AV8 A;  4US8 A;  1CJE A;  2WLB A;  2ICI A;  3W5U B;  2JX5 A;  4USA A;  4JX1 C;  4UDU C;  2FE8 A;  1CK1 A;  3NVZ A;  1I7H A;  2JQR B;  3AEB B;  1ZPS A;  1FRR A;  1DYQ A;  1FFV A;  3P4Q B;  2D5G A;  2ONQ A;  1D5M C;  2DYM A;  5EE1 A;  4WUR A;  3ZJV A;  4TQ0 A;  5D7G A;  1L6V A;  1PUT A;  4YSY B;  1QOA A;  2WXK A;  4AQ7 A;  4D2K A;  2AQ1 B;  1UGJ A;  3V05 A;  4GDL B;  2LFI A;  1NVI D;  1XLN A;  3IAM 1;  1C9F A;  2DYO A;  1QQR A;  2JSV X;  3AEA B;  3URY A;  2WS3 B;  4C7Z A;  4CQN A;  3LB8 C;  3SR6 A;  1VZ7 A;  1WGK A;  4C80 A;  2K22 A;  4WQM A;  5HI1 A;  1AWD A;  1BUI C;  1K53 A;  4RF1 A;  4RGO S;  1IBX B;  3VQI A;  1SEB D;  1P7F A;  1PGA A;  3ETR A;  4O1N A;  1B9R A;  1I4G A;  3T3O A;  1L5P A;  2Q5W D;  1J7A A;  2JU6 X;  4ZOH C;  1YN4 A;  3UI3 A;  3DWM A;  2BS3 B;  4Q2J A;  1UUP A;  1K52 A;  2QSD A;  1EWC A;  1I4H A;  3FAH A;  2KWD A;  3Q8A A;  2YEP F;  2SAK A;  3AEC B;  2AX5 A;  1ET9 A;  2KAC A;  1SXT A;  1HZ6 A;  1DOI A;  2PVG C;  1FEH A;  1GB4 A;  4YSZ B;  1TYG B;  1F77 A;  4FXC A;  5BMI A;  3AE7 B;  1B1Z A;  1FNW A;  4XDC A;  1XCQ L;  1L0X B;  1FNV A;  3RFZ B;  2INP E;  3SFE B;  1TY0 A;  1FNU A;  4OW0 A;  1SJH D;  1L0Y B;  2KN4 A;  3MP9 A;  2G9H D;  2OED A;  1NYQ A;  2JYT A;  2PW9 A;  2MJ3 A;  1SBB B;  3NS1 A;  4J3O D;  3B2F A;  5TSS A;  2LMC A;  1N5W A;  1QF6 A;  1ZE3 D;  3BII D;  1H7X A;  3Q8F A;  1MPE A;  1XCT L;  2Y3A A;  4YXD B;  2KMM A;  1LO5 D;  1ZP0 B;  1N60 A;  3TEX A;  3TEW A;  1IGC A;  3TSS A;  4A9A A;  1FXI A;  3KWL A;  2ON8 A;  3AE5 B;  2K5P A;  4L1B A;  2W3S A;  4JE3 B;  1K50 A;  4IDI A;  1HA5 A;  3HRD D;  1YJI A;  1PDX A;  4RFB A;  4WIP A;  4N58 A;  1FCC C;  2Y5P A;  3AE2 B;  1EM7 A;  1H7W A;  3CIR B;  1FIQ A;  2QEJ C;  1N62 A;  4MM3 B;  3GB1 A;  4YWG G;  1I4Q A;  1YN5 A;  1E10 A;  2VZK B;  2GI9 A;  3AEF B;  4RCO A;  5BYQ A;  2IJ0 A;  1KH0 A;  3E56 A;  3TEY A;  2BB6 A;  1N63 A;  3AEE B;  2BT6 A;  2WXJ A;  2WXM A;  4DXF A;  2AQ3 B;  2FUG 1;  4HRO A;  3ZYY X;  1AYF A;  3W2D A;  1QOG A;  1Y56 A;  2XNA C;  2EKI A;  2X38 A;  1C4A A;  1KLU D;  4IKG A;  1XEE A;  1J7C A;  1JAL A;  2TSS A;  1FM0 D;  1I4R A;  1L4Z B;  1RFK A;  2DLB A;  2V3N A;  1R7S A;  1SJE D;  1JCK B;  5FR3 A;  4XE0 A;  3W1S A;  5JXV A;  2J53 A;  4OZA A;  5HFY A;  4TQ1 A;  1WWT A;  2VZK D;  1TS5 A;  1XF5 L;  3P42 A;  2CU3 A;  2BS4 B;  3VR8 B;  2GRI A;  1STE A;  2M56 B;  2M0A A;  3AH7 A;  3FC4 A;  1GTH A;  1F0Z A;  4LK0 M;  4B0M A;  1Q10 A;  1IUE A;  2WXL A;  4OZB A;  1T3Q A;  4ZRQ A;  3BVZ A;  1KF6 B;  3P4R B;  2V4I B;  3IXS A;  1JRP A;  4A8X C;  2YEP B;  2V0G A;  3BVG A;  3AE4 B;  1FO4 A;  3AM9 A;  3AB5 A;  1V1P B;  1L0V B;  3RPF C;  1C77 A;  1VZ6 A;  3P4S B;  3AE1 B;  5MPO A;  1PGB A;  2WU2 B;  4DXG A;  1WRI A;  3VR9 B;  1TS3 A;  3N9Y C;  2KQ4 X;  1XLP A;  1GTE A;  2GB1 A;  5BMH A;  2W3R A;  1D6E C;  5I4D A;  1ACC A;  4MAC A;  1BXT A;  4NJC A;  2I2Y A;  1K51 A;  2QIL A;  4EE2 A;  1T5X D;  4ZHO A;  2IDY A;  1TKG A;  3B9J A;  2NTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...