1L0VB

Quinol-fumarate reductase with menaquinol molecules
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 69
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2002-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1l0vB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l0vB01
1GTHA 1E0ZA 3P4SB 1GAQB 1NENB 2WP9B 3B2GA 1N5XA 2CU3A 4JWUC 3AEDB 2QIEB 4C7YA 3AEAB 3P4QB 2PKOA 5C3JB 3AN1A 2MJ3A 3WCQA 3AE8B 2W3RA 2Y5CA 2PVGC 1DOYA 4YT0B 1AWDA 3KWLA 3NVZA 4WWMA 3SFEB 2ACZB 4YXDB 2OHFA 4N58A 1GPXA 4WQMA 2WU5B 1IUEA 4KX6B 1PFDA 1TKYA 2K5PA 3FAHA 4US8A 3AEEB 1L5PA 3LB8C 4N59A 1SB3C 3ABVB 5G5HA 5H92C 1T3QA 2WDVB 1YQ4B 1CJEA 1PDXA 1WXQA 2MJEA 2B76B 2L83A 3VRBB 1YJJA 3P1MA 1XO3A 4C7ZA 1ZOYB 1JWBD 3AV8A 3DWGC 3LXFA 1XLOA 3VR9B 1QLBB 2HTME 3NS1A 1OFFA 3W5UB 1NEKB 1J7BA 1RWSA 3PO0A 3SFDB 3AE4B 1DOIA 1L6VA 3ETRA 2H89B 1N5WA 1FFUA 1H7XA 1JALA 2QJLA 4US9A 1I7HA 1V8CA 1E9MA 2MH7A 3RPFC 3HRDD 1TKGA 5MPOA 3AM9A 3NVWA 3AE7B 3VRAB 1JQ4A 1ZXIA 1FRRA 1JW9D 3AE3B 1FRDA 3P63A 2JX5A 1VDVA 2MJDA 3AEGB 2N0SB 2JQRB 3NVVA 4HROA 4ZHOA 2WDRB 2PIAA 2WDQB 1KF6B 3VR8B 1ROEA 3CIRB 1GTEA 2W55A 2WU2B 4IDIA 1JWAD 2BS2B 1OQRA 1QOGA 1DOXA 1F0ZA 2M19A 5C2TB 2DWQA 4P6VF 1XLQA 1R7SA 3AH7A 2WQYB 3HVZA 5EE0A 1CZPA 1KRHA 2K9XA 4ZHPA 5G5GA 1N61A 3AE2B 3NRZA 5EE3A 1EWYC 3BIID 1FXIA 4YTMB 3B9JA 3L4PA 1E7PB 2BS3B 3P4PB 1A70A 3B2FA 1QF6A 3AE6B 1VJKA 3AE5B 2AX5A 1FFVA 2Q5WD 1YJIA 1E6EB 2KMMA 3CWIA 2DBYA 1FIQA 1AYFA 1SF0A 4JX1C 1QOFA 2PVOD 3ZYYX 3AE1B 2W3SA 2CJOA 5GXGB 1VLBA 3CF4A 3HUIA 1QT9A 1N63A 1QOBA 4FXCA 1H7WA 2K22A 2CJNA 1L6UA 1OQQA 2G1EA 4YSZB 3W5VB 4ZOHC 4LTUA 2BS4B 1SIJA 5EE9A 1WWTA 1WYGA 4A9AA 4YTPB 1N62A 3AMZA 4JWSC 1ZUD2 5H8YE 3AEFB 5AUIA 1B9RA 3AB5A 2EKIA 3W9CB 1N60A 1QOAA 1NYRA 2FBWB 2E3TA 4HRSA 2WLBA 1E10A 1J7CA 1WRIA 1TJEA 1WGKA 1KFYB 1FMAD 1RYJA 1NVID 1YQ3B 2KAJA 1NI3A 1RM6C 1RFKA 3DWMA 1FXAA 2BT6A 1TKEA 2W54A 3FC4A 4YSXB 1FM0D 1JRPA 1L0VB 1PUTA 2WS3B 3AECB 4N6EB 1XLNA 1V97A 4C80A 4YTNB 1TYGB 1DGJA 2L52A 5AUKA 2LEKA 4YSYB 2M56B 3NVYA 3SR6A 1UWMA 4USAA 1ZP0B 4ITKA 3AE9B 3AEBB 2H88B 5EE1A 1FO4A 1XLPA 1GT8A 1J7AA 3P4RB 3EUB2 1NYQA 1JROA
chains in the Genus database with same CATH superfamily
2G9HD 2CU3A 2QILA 3R66C 2WXPA 2N7JA 3WALA 2PKOA 4C4VB 2UU7A 1SE4A 1WGHA 1I4GA 5FR6A 1L5PA 4LNFA 5H92C 1B1ZA 4RCOA 2WXFA 1YQ4B 3VHTC 1CMXB 3P1MA 2IY0B 2PE9A 3DBRB 1NEKB 2ASQA 1HEZE 1SE2A 1YN3A 2NVUI 5IP4D 3QWZB 1WIAA 2PPHA 5HI1A 1MPEA 4AS1A 3O65B 3K9OB 4B0MA 2HJ1A 1WR6E 1SGHA 4OZAA 3VXWA 3UINB 2DYOA 4HLEA 1I42A 3KUCB 4WWNA 3L17A 2K6DB 3IG3A 5G5GA 2ZEQA 4RM9A 2FUHB 4ZRPA 3NZ3A 1AYFA 4ARCA 4C56C 1QOFA 3NUHB 4NJ6A 3M95A 2GOWA 4DBGA 2FCNA 2J7QB 4RNAA 3VTVA 1UF0A 3ONSA 1N62A 3AMZA 4GGQA 4LDTB 3AEFB 2LXCA 3VQIA 2LGDA 4NAWB 4KGTA 2KJHB 3TBLD 1NVID 2D3AA 1ET6A 2LJ5A 2K8BA 4K3CA 3TSSA 2YEPF 2MWSB 2C7HA 3P42A 1E7UA 4ITKA 5CHVC 4AP4C 2Z0EB 4JE3B 1GNUA 1SXTA 2XK5B 3ZLZA 3WCQA 4II2B 2ZCCA 1FCLA 1GPXA 3SFEB 3NHEB 4OZCA 1PDXA 3PTFC 5BMIA 3NS8A 3L16A 2RPQA 1MHXA 4LDTD 4M8NA 3KUDB 3DDCB 1E5WA 3W5UB 1WE6A 3O13A 3V60A 2L3ZA 2RSUA 3GZNB 1TY0A 1MI0A 4DWFA 3ZJTA 1FNVA 2BQQA 2UWQA 3NVVA 3DVNU 1KF6B 2KDMA 4HK2A 2DWQA 1YQBA 4MT5A 1LGRA 1YJIA 3X23A 4MDKE 4F7ZA 2BYEA 3QQ8B 2WXQA 2L76A 4ARIA 1UBQA 4IKGA 2KOXA 3GE3C 3RUIB 3MFGA 3U7ZA 1H4RA 4P1CC 3QA8A 1WYGA 1WXMA 1I4XA 1MG4A 2IZVB 4REZA 2AL6A 2PW9A 2DZKA 2G4SA 2IO3B 3DOWA 5AZHA 1J7CA 3KWVA 4KZ0A 3N30A 1Z5SB 3Q3JA 5AEKB 2INPE 3PZDA 3Q8BA 2HE7A 3RN9C 1VZ7A 3L08A 3AECB 2GB1A 4I6NB 2BGFA 1TYGB 2N9KA 4WJQA 2V1YA 3SR6A 1U4AA 1LQBA 1UD7A 1WZ3A 1EF5A 1TS4A 3VTUA 2WDTB 3Q8EA 3ENEA 3KYCD 3DBHB 2JUOA 2WP9B 3TIXA 1WYWB 2J4XA 4PS7A 2ACZB 4L1BA 1ZGUB 1XF5L 2J0MA 5G5HA 2C7NB 2WXJA 1TTNA 1YN4A 1E8ZA 1JWBD 2V0GA 4XDCA 3RNEC 3ZTDA 4LNIA 2LVOA 3R8BA 3IHPC 1N5WA 4JL9A 3CSFA 1I7HA 1CK1A 1R4MI 4IWOA 2MH7A 4MGIE 5MPOA 2AEHA 4UDUC 5L95C 3ECIA 5T8IA 2XBBC 1VDVA 3TUOA 5L83A 5AZFA 4TSSA 2SEBD 4LCDE 4GIVA 1GOZA 1TT5B 2DHZA 2N1VA 5D2MB 4L23A 3D32A 2K9XA 1C1YB 1MHHE 2B3AA 3L4PA 2KTRA 1L2NA 1VJKA 4TKNA 4GMVA 4C00A 2OJRA 5HKHA 5BMGA 3A33B 2PVOD 1WM3A 2L32A 2V3PA 1AN8A 2J0KA 2JT4B 1L6UA 2HJ8A 4KVGB 4O1NA 4N9F4 5FK9C 3L10B 4JWSC 1NDDA 1PGXA 3DPDA 3VAWA 3PZ7A 2EMTA 3M62B 2E3TA 2WLBA 2DENB 4MSQB 2ZW0A 4EZKA 4GU2A 4EZLA 1YIWA 3V62A 3H7SA 1F77A 4P1BC 3Q3MC 4W9JA 4N6EB 3H1UA 2KFKA 4K7WA 2RPVA 4KSLC 4AJYB 2LXAA 4IW0A 2O6VA 4IWPA 4W9CA 1XLPA 2GLSA 4I6PA 3TEWA 3E56A 2G45B 2OHFA 2KX0A 2SAKA 4HPMB 4BBNF 3KLSX 5IO9A 3EC8A 4XZ4A 1STEA 3RCZA 1SE3A 2Z8LA 2MBBB 2KQ7A 3Q8FA 1L6VA 3ETRA 2H89B 2PE6B 1V8CA 3ZNHB 5G55A 1CQVA 1OTRB 2G4DB 5CX3A 3VR8B 3OJ4B 2BPSA 3IFWB 1F0ZA 3QIJA 1WXVA 1HZ6A 2JZZA 2W82A 4KGRA 5FR3A 3NRZA 4YTMB 3I63C 3P4PB 1QF6A 2L7RA 3B2FA 3N9YC 5E6PA 2AX5A 4WJPA 1J8CA 3V6EB 2LGIA 4M01A 1WF9A 3TEYA 4LNKA 1E8WA 5I4DA 4RGNA 4ZOHC 5J2RA 1TS2A 3W2DA 2KN5A 1TZOA 1F9JA 1D3ZA 1FXTB 1N60A 4OVZA 3DHIC 3RNAC 2NBWB 1BMLC 3A4RA 4J6IA 5E6OA 4BVUC 2KXJA 2LGXA 2ZVOA 4LJPB 4USAA 4BOSC 3VUXA 3GOEA 4E71A 2V3SA 2WXKA 3QAQA 4FLHA 4XE0A 1WM2A 3GZNI 2DX5B 2YEPB 4NAWA 4HJKA 4R3DA 4DHJB 4DDID 1ZW7A 5BMHA 3AEEB 1KLUD 5E6NA 2JSVX 2BB6A 3GP7A 3UI3A 2KNBA 2ZPYA 1XXGA 4KDLB 5TR5A 3SHQA 2WXRA 1YX6B 1L0YB 2O2VB 4BOZB 2KACA 1WMHB 3PV1A 3OWEB 3VRAB 2XK5A 2CU1A 3U52E 2N0SB 4CHKA 2PIAA 3L0WB 2CKHB 4AUQC 2PTLA 2V4IB 4P6VF 1R7SA 3HVZA 2WQYB 2FCQA 3RT3B 1A70A 3EECA 4RGTA 1YD8U 1T6BX 2JYEA 1WZ0A 4DHJD 2NR2A 3RD2A 1HE8A 4BZAA 3T8MA 3Q8CA 2RR9A 2OJWA 1TBEA 2NBUA 2KWDA 3ZJVA 4TUUA 2JF5A 2YVCA 4NJCA 2BS4B 4PS3A 4ASWC 3W1SC 1P7FA 3PRMB 1T0RC 2N9PC 3BVGA 1RYJA 1D5ZC 4M02A 1MFWA 1R4MB 1I4RA 3RMKC 2KD0A 2DZMA 4YL8A 2N1WA 1UWMA 1E90A 1WGGA 2IO1B 4XWTA 1XCQL 3SU8X 1KM7A 2HTHA 4FN2A 1NENB 3URYA 4MSMB 2IY1B 3KQ4A 5IKCM 2M4NA 2R2OA 3U30A 2K0PA 4QAYA 1UH6A 2INDC 1UBIA 2KDFB 1XO3A 4C7ZA 3V3XA 3EGRA 4PK1A 3PLUA 2LZ6A 5JH5C 1WRDB 3N1YC 4AJWA 4EE2A 4YWGG 4US9A 1RAXA 1I4HA 3DQVA 4HWIB 1TZ1A 3AM9A 3NVWA 1JQ4A 1V9JA 3AEGB 3R7RA 2IBIB 1ROEA 2MLBA 2O6VD 3B0AA 4FULA 2IGDA 4ACFA 4HDQA 1OEYJ 4XX5A 3AE2B 3W1YA 1WFYA 3BIID 3I5JC 1E7PB 1HTOA 2XNAC 4KDIC 2ZPNA 2LHDA 1UELA 1RLFA 3ZYYX 3ZXVA 3CF4A 4A90A 1YX5B 4ICVA 4PS8A 5C1ZA 3H8HA 1WR1A 2KDIA 4MGYE 2ZCBA 1F2RC 1SJED 1V86A 2EKIA 1HQRD 1NYRA 5AZGA 2LRUA 1WRIA 3MC9A 4PYUA 2BF8B 3PZ8A 2PEAA 1P98A 3QK0A 4J3OD 3ZNID 2WS3B 4HCNB 1V6EA 5AUKA 1V49A 3R2TA 2H88B 1L4DB 1RFAA 3B2GA 3NZSA 2QIEB 1GG3A 2LWPA 2MJ3A 2VZKB 4W9EA 5LNK1 1IYFA 1F2RI 2INCC 4FADA 1Q1OA 4HEA1 3MHZA 3MJWA 1TKYA 3FAHA 4US8A 4KV2A 1T5XD 2KMAA 2X38A 4S0RA 1E8XA 4HDOA 3JYUA 2C60A 1GJZA 2KVRA 3Q6BA 4IC7B 1MVKA 3AV8A 4GDLB 1PYWD 3DWGC 2LASA 1GB4A 4KSKC 3NJTA 4XDDA 4KKIA 3MTNB 2IGGA 2DZJA 1MJDA 1C77A 4RF0A 1P3QU 4RF1A 4WURA 4HROA 3EFCA 2BBCA 3N1ZC 2IO0B 3DBLI 2BW2A 3DCGA 2BYVE 2KYWA 2LUMA 5D94A 2LGSA 3AH7A 1UZXB 4A8XC 4HKQA 4OZBA 1CZPA 2JY6A 1IBXB 1SBBB 3HK0A 2VZKD 2CS4A 4HJGE 1VLBA 4MH0E 2IYDB 3SD5A 1QOBA 1WJ4A 4I6LB 4GLSC 1SEBD 1Y8RC 3ML9A 4BKTA 2KJRA 3Q14C 2GMIC 1YJ1A 2KMCA 3EHVA 2QHOA 5DPSA 1VZ6A 3KYDD 4DXFA 2KT7A 4NJ7A 4IM3A 4FA6A 2FE8A 1L0XB 1RM6C 4HCPB 3AULA 1FXAA 4KKJA 3PT2B 1JRPA 3PPAA 1PUTA 1GUAB 3LDZE 1V5OA 4NQLB 3DHGC 3PVLA 4W9LA 1FO4A 3EUB2 1NYQA 2N7DA 1I4PA 3OLMD 2DNFA 2DYBA 3P4SB 2WXGA 2FIFA 3M63B 5FKAC 2WXOA 4JWUC 3PRPB 3AN1A 1TS3A 3QC8B 2QMTA 2LRWA 2ONQA 3OG5A 1DOYA 3NVZA 3KWLA 3APCA 1WI0A 5KHQA 2Y5BB 5IA7A 1C79A 2WXHA 2FAZA 2PJHA 4ZRQA 3WAPA 1J19A 4B9KA 3H6NA 1IPGA 2KTFA 4EZJA 4ANXA 2D3GA 3VTWA 4ZDVA 3AE7B 4CYEA 1FRDA 4L2YA 2K39A 2GBMA 4HPLB 1Q5WB 1P0RA 2W55A 3AXCA 2L0TA 3Q3NC 3H7PA 2I2YA 4GSWA 5J17A 4XYCA 1L7YA 1XLQA 4K3BA 1IGDA 4KIKB 3A9KB 3EA6A 1FEHA 2JXXA 2OOBB 2MCNB 4XC2A 3CWIA 2DBYA 1TGZB 3IT6B 2O2VA 1AARA 1WMHA 2D5GA 4FXCA 1DYQA 4HXDA 1Q0WB 3RNCC 2G1EA 2WXNA 5EE9A 5LXIB 4CQNA 3N32A 4ZYSA 4IG7B 4EFOA 1WGRA 5AUIA 3HIZA 4DXAB 4B95A 4G0NB 1SJHD 1J0GA 1XD3B 2FBWB 1IGCA 3AI5A 2HD5B 3BYTB 2JWUA 2M56B 5CHFA 2NPTA 3RNGC 3LYYA 2NMQA 5D3IB 1E0ZA 1GAQB 3ML8A 1JRUA 1D5XC 2KANA 2LVQA 2M17A 3NZUA 2BWFA 4A55A 2Y5PA 3V6CB 3QCAA 1F1HA 1ESFA 3NG0A 2DYMA 4AOFA 1AWDA 1ZDVA 3UGBB 3ZQ4A 3ZXRA 2E6XA 1EUVB 5JHAA 5G2NA 4N59A 5JZEB 3MJ5A 1RRBA 1S1QB 2D3CA 3VR9B 4ZRIA 4ICUA 4TQ1A 3ZGZA 1H7XA 2PMVA 1WJUA 3DVGY 1TKGA 3P2BA 3GB1A 4FJVB 3RI7C 1R4NI 2KO3A 2NTTA 4FHKA 1ZE3D 1T0YA 2M19A 3BK2A 4B6WA 4HVBA 3MP9A 1VD2A 4ZHPA 1SIFA 3BWUD 3ZNGC 2BWES 4WJNA 2QEJC 5HG2A 2EELA 2LD9A 5BO4B 3BYYB 2AWTA 3PSEB 2Q5WD 1E6EB 2A4ZA 3KH0A 4JX1C 4DHZE 4II3B 4ZRKA 2BVCA 4K7UA 1QKZA 1H7WA 2WX0A 5BYQA 2EKEC 1AW7A 4FBJB 2JZ3B 4G50A 2WGSA 2MSED 2KC2A 3J9CA 5H8YE 1XEEA 1YMHE 1GC7A 3W9CB 3VFKA 3HM6X 1KFYB 1C76A 2BT6A 1TKEA 3A9JA 3KVFB 5BYSA 3S2AA 2D11A 3CSTA 2AQ2B 3DBLB 2KDBA 4AWJA 3APFA 3ZNZB 3H9DA 1ZUD2 3TL5A 4RH6A 1JWSD 1N5XA 3QX1A 2Z59B 4MACA 3AEAB 3P4QB 1C4CA 2L00B 3HHMA 4W9DA 4GB9A 1P1AA 3ZRFA 2MX2A 2CHZA 4MM3A 4WAFA 1L4ZB 1LM8B 1OFFA 4E74A 3L13A 1IP9A 2BKFA 1RWSA 3DHHC 2N4FA 3RNFC 4NQKE 3HRDD 1FRRA 2KVZA 3UQBA 2LJIA 3H7PB 4NPNA 4A3OA 1PQSA 2FIDA 1C4AA 3PHXB 1C78A 2L0FA 3UIOB 4DHZB 4GDLA 3ZRCA 2KFJA 2JPHA 3AE6B 2MEKA 2Z0DB 3T3NA 2AYOB 3AE1B 1WJNA 1Z2MA 2M1MA 4A20A 4ANWA 1QZEA 1V81A 2K6QA 1OQQA 4WWOA 4YSZB 3W5VB 4K7SA 1QILA 2GBJA 1KH0A 2JU6X 2N9XA 1B9RA 2WNMA 1FMAD 2J42A 3HM3A 1NI3A 1IBXA 3ZO5B 2WXIA 2W54A 3KUZA 3SDLC 3PS6A 4MELA 1EF1A 1D5MC 2L52A 2NPTB 1I4QA 4NY0A 4WQOB 4E3CA 2CR5A 3V61A 2JXTA 4WH4A 1FNUA 2KZRA 5C3JB 2W3RA 1WGYA 4WWMA 4WQMA 1PFDA 2V4LA 2K1FA 3N1XC 3QHTA 4P7IA 4OVVA 1OGWA 4URKA 4F1SA 1G6JA 4NNJB 2PLPA 3SFDB 3AE4B 1DOIA 1WXSA 5D3DA 1YNTE 2IDYA 4F8CB 2C9WB 1V1PB 3Q3OC 1EU4A 2D10A 3RPFC 3NY5A 4GXBA 1V80A 3MC0B 2JX5A 2NBVB 3U7DA 2JQRB 2WDRB 2QDFA 1GTEA 2D2QA 2BS2B 1C3TA 1GC6A 2D07B 1HXYD 1KRHA 4MJSA 4ZRJA 5EE3A 3U2SC 2MHJA 3RNBC 1OQYA 4M00A 1K51A 3AE5B 1JWMD 2L1AA 3WA0A 1D4BA 1QT9A 2ZW1A 4X57B 3TEZA 1K52A 5E6JA 3IAS1 2ZZPB 3OJ3A 1I35A 4G3XB 4A9AA 4JGHB 2MW5A 5KHOA 4DQOC 2GRIA 4DDGD 1SE9A 1T0SC 3UIPB 4D2KA 4KIKA 2GI9A 1WGKA 2MRPA 3A9KA 2YLMA 3A9JB 4DXGA 4NZLB 1YN5A 1N6ZA 2MP2A 2KWVB 3PRZA 4EUTA 1L0VB 4RFBA 4A6QA 2FCSA 1KOTA 1R4NB 3W1SA 2C7MB 4JPSA 2WX1A 3VUYA 4NAMA 2FCMA 3DVGX 3QARA 1P7EA 4IUMB 2RDBC 2LGYA 4HPPA 4BFRA 4G11A 2KHWB 1IUEA 4KX6B 3GS2A 1FNWA 4MM3B 2M0AA 1PGAA 2DLBA 5JHBA 4LK0M 2KQSA 3VRBB 1LXDA 1QLBB 3JVZX 4FJYA 5IOIA 2KWCA 3WAOA 2ON8A 1FFUA 3BINA 1WE7A 1E9MA 1ZXIA 3P63A 4AQ7A 1KJTA 1Y56A 1E7VA 2QCZA 3ZVVA 1LFDA 1QOGA 1DOXA 4M8MA 2K8HA 3PLVA 4RMAA 3IVFA 2JRHA 4MEMA 4MH8A 2I38A 3BK1A 1N63A 1FPYA 1HZ5A 1UGJA 3UQAA 2CJNA 4M0WA 1SIJA 5TSSA 2JRIB 3VUWA 4EKUA 1P9DU 4K1RB 3RYTA 4TMAB 1QOAA 4HRSA 1E10A 3GE8C 2KAJA 3V05A 2VH2A 4YSXB 2MA9B 1FD6A 2L05A 1E8YA 4YTNB 3HVDA 1KLVA 2MBEA 1J7AA 5CTRC 1GTHA 2BTEA 2ZNVC 3WIMA 2LVPA 3IAM1 2KLGA 3Q2AC 1ZKHA 2NS5A 2Y5CA 2JZPA 5CHWA 3ZW3A 3I9V1 1JWUD 1SB3C 4Q2JA 4ANUA 3PHWB 5IN7A 3A1QB 1WXQA 2B76B 2QC8A 1HTQA 1ZOYB 5DPWA 2ZVNA 1XQQA 2FNJB 1XCTL 2ICIA 1J7BA 4MGKE 1WSPA 3AU5A 3ALBA 2LHEA 2Y3AA 2I1JA 3C19A 1UUPA 3K9PB 4WWPA 1V1OA 1FCCC 1JWAD 5JXVA 3EFUA 4MJSB 1VRAB 3FILB 2M0XA 4OW0A 4RGMA 1UGMA 3JSVB 4RGOS 1K53A 3M3JA 5GXGB 3SEBA 3BY4B 4BKSA 1KLGD 2K22A 5HFYA 2EMSA 4TQ0A 3N3KB 3APDA 4FJZA 1M94A 2N7EA 2KWUB 1SSNA 4GDKA 2MP2B 2REXA 4PT5A 1HA5A 3TMPB 1ACCA 2KN4A 1WX8A 3Q8AA 1ZP0B 3Q69A 1K8RB 3A4SC 1GT8A 3P4RB 3Q3FA 1EU3A 3DVNV 4DK5A 3C0RB 3AEDB 4C7YA 2JWZA 3MC8A 4LLGM 2DZIA 3AE8B 1BXTA 2PVGC 4YXDB 4S17A 2K5PA 2WXLA 5LLIA 3N20C 2J0JA 3L54A 1WXAA 2IPKD 3OAWA 2RMMA 4EOYA 2L83A 2DAFA 3IBEA 3C8YA 2GBNA 4KZCA 1WGDA 2QJLA 4WIPA 3B08A 1D6EC 4JLCA 3AE3B 4WJOA 3RZWC 2LMCA 2WDQB 1WX9A 4OVUA 4CO7A 4XWWA 2VH1A 2DAJA 2N9EB 5EE0A 2KK8A 1X1MA 3PGEA 2RD0A 2AQ1B 2LFIA 2BYFA 4WAAA 2BYTA 2WYQA 1JCKB 2D3BA 1FIQA 1SF0A 5D6JB 4GN1A 3I3TB 3U8ZA 2CJOA 2WHIA 3HUIA 4BAXA 4PYZA 2R2QA 1V1PA 2HDEA 4M0WB 1ZDXA 2J52A 2VRRB 1QQRA 2XN9C 4LTUA 3ZDTA 3DBRI 4W9IA 2G3QB 3AB5A 3TEXA 1LO5D 1YOVB 1TJEA 2J53A 3WANA 1TIFA 4BKGA 2JVCA 2NTSA 4JIOU 1UWXA 2MBQA 1NI2A 3FKYA 1XLNA 4C80A 4LNOA 4YSYB 4MGZE 4OHJA 2OEDA 5EE1A 1ENFA 3R2IA 2X8XX 2BB5A 2IO2B 4IOIE 2INNE 2CHXA 3RULA 5DPRA 3RZFA 4C4VA 4YT0B 4W9HA 2KQ4X 4N58A 3ABVB 4BBNC 4HKZE 1CJEA 4W9FA 2L8JA 1YJJA 3BVZA 1EWCA 5EDSA 1ZPSA 3NS1A 3TCAA 1NBFC 3PO0A 2AL3A 3BVMA 1V5TA 1PGBA 3B1LX 2V3NA 1JW9D 2K3UA 3QJZA 3NOBA 2K8CA 3E9SA 2WU2B 1OQRA 1WJ6A 2N9LA 2KLCA 2K25A 4IM0A 3UF8A 1ZXHA 1EWYC 2BS3B 1FFVA 2NCNA 1Q10A 1EO6A 3X0WA 3KW5B 3ZIMA 3TJPA 1ET9A 1T0QC 1WY8A 1UNSA 3WAMA 2R61A 3JW0X 1A5RA 2W9NA 1VZ8A 2I1KA 2KKCA 2QSDA 3I57A 4GDKB 3U4EG 1TY2A 1V2YA 2LI5A 1XT9B 4LJOB 1K50A 2WXMA 4EEWA 2KDEB 1EM7A 1RFKA 3CMMB 3DWMA 5J18A 4RM8A 4ANVA 1JMLA 1KTKA 1V97A 2ZNVB 1C4PA 2LEKA 2AQ3B 2KX3A 1BUIC 3AEBB 2RDHA 1F52A 5C23A 5BYRA 1JROA 3VH4B 1M4VA 4A3PA 2GBRA 1WX7A 5HHDG 1WH3A 3R3MA 3T9LA 4BKSD 3VDZA 5GMVA 2V9HA 4FHJA 2GBKA 2WU5B 2BKRB 3LB8C 3VVWB 2IJ0A 2FUG1 1T3QA 2WDVB 2KC1A 2MJEA 1OEYA 4TV3A 2A5UA 3LXFA 1XLOA 2KTRB 2HTME 2XEWA 3T3OA 1TS5A 2MQJA 3LJ3A 4ZYNA 5IAAC 1JALA 2IGHA 2RDGA 3ZTCA 3PREA 3ZJUA 4B0EA 2LUEA 3DBSA 2MJDA 2WWZA 4W9GA 4IM2A 4P16A 1C9FA 4ZHOA 3CIRB 1VR9A 1ISNA 5C2TB 2C5LC 3ZKJC 3A1QA 3DBHI 4K81A 4LNNA 1N61A 2RGFA 1FXIA 3B9JA 4XGAB 3CF6E 4W9KA 3ZDMC 1VCBA 2TSSA 2KMMA 5DCNA 3AU4A 2CHWA 5LXHA 2W3SA 5D7GA 4KGSA 1H8CA 2KFKB 3MHSD 2MBHA 2O6VB 1WWTA 3VH3B 4YTPB 3BZDB 2KJ6A 3RFZB 4GOCA 1BT0A 5DPTA 3FILA 4IWQA 1YQ3B 3IT4B 2JYTA 4H2AA 1MG8A 3FC4A 3JSVA 2MBOA 1FM0D 1GB1A 3R7QA 2UYZB 1DGJA 2M8SA 3IXSA 3NVYA 4JQWC 3ZUNA 3AE9B 1S3SG 2ZJDA 4IDIA
chains in the Genus database with same CATH topology
2WXKA 5D3IB 1GTHA 1E0ZA 1GAQB 2BTEA 1D5XC 4XE0A 2G9HD 2CU3A 2QILA 3IAM1 2WXPA 2N7JA 4A55A 2PKOA 2Y5PA 2YEPB 1SE4A 1ESFA 2Y5CA 2DYMA 1AWDA 4R3DA 1ZDVA 2JZPA 3ZQ4A 2E6XA 5BMHA 1I4GA 3AEEB 1L5PA 3I9V1 1KLUD 1JWUD 1SB3C 2JSVX 1B1ZA 4N59A 2BB6A 4Q2JA 4RCOA 2WXFA 3GP7A 1YQ4B 3MJ5A 3UI3A 1WXQA 2B76B 3P1MA 1XXGA 1ZOYB 3VR9B 1XCTL 4TQ1A 2ICIA 1NEKB 1J7BA 1HEZE 1WSPA 1SE2A 2WXRA 1YN3A 1L0YB 3ZGZA 1H7XA 5HI1A 2KACA 1MPEA 4AS1A 2LHEA 2PMVA 2Y3AA 3OWEB 1TKGA 3VRAB 3U52E 1UUPA 4B0MA 2N0SB 3GB1A 4OZAA 2PIAA 1V1OA 1FCCC 2NTTA 2DYOA 1JWAD 2PTLA 5JXVA 1ZE3D 2V4IB 2M19A 3BK2A 4P6VF 1R7SA 3HVZA 2WQYB 3MP9A 4ZHPA 5G5GA 1VRAB 3BWUD 2QEJC 5HG2A 2EELA 3FILB 4ZRPA 1A70A 3BYYB 3NZ3A 4OW0A 4RGMA 2Q5WD 1E6EB 4RGOS 4RGTA 1T6BX 1AYFA 1K53A 4JX1C 4C56C 1QOFA 4ARCA 2JYEA 3NUHB 5GXGB 3SEBA 1QKZA 1H7WA 3Q8CA 1KLGD 2K22A 5BYQA 1AW7A 4RNAA 2KWDA 5HFYA 3ZJVA 4TQ0A 4NJCA 2BS4B 1N62A 3AMZA 1SSNA 3J9CA 5H8YE 3AEFB 1XEEA 3VQIA 1YMHE 3W9CB 1P7FA 4NAWB 4KGTA 3BVGA 1KFYB 1RYJA 1NVID 4PT5A 1D5ZC 1ET6A 1HA5A 1C76A 2BT6A 1I4RA 1ACCA 1TKEA 5BYSA 2KN4A 3Q8AA 2YEPF 3TSSA 3P42A 2AQ2B 1UWMA 1ZP0B 3Q69A 4ITKA 1GT8A 4XWTA 4JE3B 3P4RB 1XCQL 1ZUD2 1EU3A 4RH6A 1NENB 3URYA 1JWSD 1N5XA 1SXTA 3AEDB 4MACA 4C7YA 3AEAB 3P4QB 1C4CA 3KQ4A 4LLGM 3WCQA 3AE8B 1BXTA 2PVGC 1FCLA 1GPXA 3SFEB 4YXDB 2K5PA 2WXLA 2K0PA 4OZCA 1PDXA 2IPKD 2RMMA 4WAFA 5BMIA 2L83A 1XO3A 4C7ZA 3V3XA 1MHXA 1L4ZB 3EGRA 1OFFA 3C8YA 3W5UB 3O13A 1RWSA 4EE2A 4YWGG 4US9A 2QJLA 4WIPA 1TY0A 1I4HA 1MI0A 3HRDD 1D6EC 3AM9A 3NVWA 1JQ4A 3ZJTA 1FRRA 3AE3B 1FNVA 3AEGB 2LJIA 3NVVA 2LMCA 2WDQB 1KF6B 1ROEA 2KDMA 4XWWA 1C4AA 2DWQA 2IGDA 5EE0A 1C78A 4MT5A 3AE2B 3BIID 2AQ1B 1E7PB 2LFIA 3AE6B 2XNAC 2BYTA 1YJIA 1JCKB 2MEKA 2LHDA 1FIQA 1SF0A 3T3NA 3ZYYX 3AE1B 2CJOA 3CF4A 3HUIA 2WXQA 1V1PA 4A90A 4ARIA 4IKGA 2HDEA 1ZDXA 3MFGA 2J52A 1OQQA 4YSZB 1QQRA 3W5VB 3U7ZA 3H8HA 1QILA 2XN9C 4LTUA 1WYGA 1I4XA 4REZA 1KH0A 2JU6X 1F2RC 1SJED 1B9RA 2PW9A 3AB5A 3TEXA 2EKIA 1HQRD 1NYRA 1LO5D 1J7CA 3KWVA 1WRIA 2WNMA 1TJEA 2J53A 1FMAD 2J42A 1NI3A 1IBXA 2INPE 3PZ8A 3Q8BA 2NTSA 2WXIA 2W54A 1UWXA 1VZ7A 4J3OD 2WS3B 3AECB 2GB1A 1XLNA 1D5MC 4C80A 1TYGB 5AUKA 2L52A 2N9KA 4YSYB 3SR6A 1I4QA 3R2TA 4OHJA 2H88B 1L4DB 1TS4A 2OEDA 5EE1A 1ENFA 3Q8EA 2JXTA 3R2IA 2BB5A 2WP9B 4IOIE 3B2GA 4WH4A 2INNE 2QIEB 1FNUA 5C3JB 2MJ3A 5LNK1 2VZKB 2J4XA 1F2RI 2W3RA 4YT0B 4WWMA 2ACZB 4HEA1 2KQ4X 3MHZA 4N58A 4WQMA 1PFDA 4L1BA 1TKYA 3FAHA 4US8A 1XF5L 1T5XD 2X38A 3ABVB 5G5HA 4HKZE 2WXJA 1CJEA 1YN4A 1YJJA 3BVZA 1EWCA 1MVKA 1JWBD 1ZPSA 1PYWD 3AV8A 3DWGC 4GDLB 4XDCA 2V0GA 3NS1A 1GB4A 2PLPA 3R8BA 3PO0A 3SFDB 3AE4B 1DOIA 3BVMA 5D3DA 1N5WA 1PGBA 4XDDA 4KKIA 1I7HA 1YNTE 1CK1A 2IDYA 2IGGA 2V3NA 1V1PB 2MH7A 1C77A 1EU4A 4RF0A 3RPFC 5MPOA 4UDUC 4RF1A 1JW9D 5T8IA 2K3UA 4HROA 3MC0B 2JX5A 1VDVA 4WURA 3TUOA 2BBCA 2JQRB 2WDRB 3E9SA 2BW2A 4TSSA 2SEBD 1GTEA 2WU2B 1OQRA 2BS2B 2LUMA 1GOZA 1HXYD 3AH7A 4A8XC 2N9LA 4HKQA 4L23A 4OZBA 1CZPA 1KRHA 2K9XA 1MHHE 5EE3A 1ZXHA 1EWYC 3L4PA 3U2SC 2BS3B 1IBXB 1VJKA 1K51A 3AE5B 1FFVA 1SBBB 5BMGA 2VZKD 1JWMD 4HJGE 2PVOD 1Q10A 2L1AA 1D4BA 1VLBA 1QT9A 2ZW1A 1QOBA 3TEZA 1ET9A 1K52A 2L32A 2V3PA 1AN8A 1SEBD 4GLSC 5E6JA 1L6UA 1UNSA 3IAS1 4O1NA 5FK9C 2R61A 4A9AA 4JWSC 4DQOC 1PGXA 2GRIA 1VZ8A 2QSDA 3I57A 4GDKB 3U4EG 1TY2A 1VZ6A 3PZ7A 4D2KA 2E3TA 2WLBA 4DXFA 2GI9A 1WGKA 1K50A 2WXMA 4DXGA 1EM7A 5H92C 2ZW0A 1YN5A 2FE8A 1L0XB 1RM6C 4NZLB 1RFKA 3DWMA 1FXAA 4KKJA 1F77A 1JRPA 1L0VB 4RFBA 4A6QA 1JMLA 1KTKA 1PUTA 4N6EB 1V97A 1C4PA 2LEKA 2AQ3B 2RPVA 3W1SA 1BUIC 3AEBB 2RDHA 4JPSA 1FO4A 1XLPA 3EUB2 1NYQA 4NAMA 1JROA 5BYRA 1I4PA 1M4VA 3P4SB 2WXGA 1P7EA 5FKAC 2WXOA 4JWUC 3TEWA 3AN1A 1TS3A 5HHDG 2QMTA 2ONQA 3E56A 1DOYA 3NVZA 3KWLA 2OHFA 2SAKA 2WU5B 1IUEA 4KX6B 3GS2A 1FNWA 4MM3B 3KLSX 3LB8C 2M0AA 1PGAA 2IJ0A 2FUG1 1T3QA 2WDVB 2DLBA 1STEA 2MJEA 4LK0M 3VRBB 1SE3A 2Z8LA 3LXFA 1C79A 2WXHA 1XLOA 4ZRQA 1QLBB 2HTME 3T3OA 3Q8FA 1TS5A 1L6VA 3ETRA 2H89B 2ON8A 1FFUA 1JALA 1V8CA 2IGHA 2RDGA 3ZJUA 1E9MA 4B0EA 3AE7B 1CQVA 1ZXIA 3P63A 1FRDA 4L2YA 2MJDA 4AQ7A 1C9FA 4P16A 4ZHOA 1Y56A 3VR8B 2W55A 3CIRB 1QOGA 2I2YA 1DOXA 1F0ZA 1VR9A 5C2TB 1HZ6A 2W82A 4KGRA 1XLQA 5FR3A 1IGDA 1N61A 3NRZA 1FXIA 4YTMB 3B9JA 3EA6A 3P4PB 1QF6A 1FEHA 3B2FA 3N9YC 4MH8A 2AX5A 2TSSA 2KMMA 3CWIA 2DBYA 3IT6B 2W3SA 2I38A 4KGSA 3BK1A 5D7GA 1N63A 2D5GA 1HZ5A 1UGJA 1DYQA 2LGIA 4FXCA 2CJNA 3TEYA 2G1EA 4M0WA 2WXNA 5I4DA 4RGNA 4ZOHC 1TS2A 5EE9A 1SIJA 3W2DA 1WWTA 5TSSA 4CQNA 4YTPB 1TZOA 4ZYSA 3BZDB 5AUIA 3RFZB 1SJHD 4TMAB 1N60A 1QOAA 2FBWB 4HRSA 4OVZA 1E10A 1IGCA 3FILA 1BMLC 1YQ3B 2KAJA 2JYTA 3IT4B 4H2AA 3V05A 3BYTB 3FC4A 4YSXB 1FM0D 1FD6A 2JWUA 1GB1A 4YTNB 1DGJA 3HVDA 2M56B 3IXSA 3NVYA 4USAA 3AE9B 1J7AA 4IDIA 3LYYA 2NMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTH A;  1E0Z A;  3P4S B;  1GAQ B;  1NEN B;  2WP9 B;  3B2G A;  1N5X A;  2CU3 A;  4JWU C;  3AED B;  2QIE B;  4C7Y A;  3AEA B;  3P4Q B;  2PKO A;  5C3J B;  3AN1 A;  2MJ3 A;  3WCQ A;  3AE8 B;  2W3R A;  2Y5C A;  2PVG C;  1DOY A;  4YT0 B;  1AWD A;  3KWL A;  3NVZ A;  4WWM A;  3SFE B;  2ACZ B;  4YXD B;  2OHF A;  4N58 A;  1GPX A;  4WQM A;  2WU5 B;  1IUE A;  4KX6 B;  1PFD A;  1TKY A;  2K5P A;  3FAH A;  4US8 A;  3AEE B;  1L5P A;  3LB8 C;  4N59 A;  1SB3 C;  3ABV B;  5G5H A;  5H92 C;  1T3Q A;  2WDV B;  1YQ4 B;  1CJE A;  1PDX A;  1WXQ A;  2MJE A;  2B76 B;  2L83 A;  3VRB B;  1YJJ A;  3P1M A;  1XO3 A;  4C7Z A;  1ZOY B;  1JWB D;  3AV8 A;  3DWG C;  3LXF A;  1XLO A;  3VR9 B;  1QLB B;  2HTM E;  3NS1 A;  1OFF A;  3W5U B;  1NEK B;  1J7B A;  1RWS A;  3PO0 A;  3SFD B;  3AE4 B;  1DOI A;  1L6V A;  3ETR A;  2H89 B;  1N5W A;  1FFU A;  1H7X A;  1JAL A;  2QJL A;  4US9 A;  1I7H A;  1V8C A;  1E9M A;  2MH7 A;  3RPF C;  3HRD D;  1TKG A;  5MPO A;  3AM9 A;  3NVW A;  3AE7 B;  3VRA B;  1JQ4 A;  1ZXI A;  1FRR A;  1JW9 D;  3AE3 B;  1FRD A;  3P63 A;  2JX5 A;  1VDV A;  2MJD A;  3AEG B;  2N0S B;  2JQR B;  3NVV A;  4HRO A;  4ZHO A;  2WDR B;  2PIA A;  2WDQ B;  1KF6 B;  3VR8 B;  1ROE A;  3CIR B;  1GTE A;  2W55 A;  2WU2 B;  4IDI A;  1JWA D;  2BS2 B;  1OQR A;  1QOG A;  1DOX A;  1F0Z A;  2M19 A;  5C2T B;  2DWQ A;  4P6V F;  1XLQ A;  1R7S A;  3AH7 A;  2WQY B;  3HVZ A;  5EE0 A;  1CZP A;  1KRH A;  2K9X A;  4ZHP A;  5G5G A;  1N61 A;  3AE2 B;  3NRZ A;  5EE3 A;  1EWY C;  3BII D;  1FXI A;  4YTM B;  3B9J A;  3L4P A;  1E7P B;  2BS3 B;  3P4P B;  1A70 A;  3B2F A;  1QF6 A;  3AE6 B;  1VJK A;  3AE5 B;  2AX5 A;  1FFV A;  2Q5W D;  1YJI A;  1E6E B;  2KMM A;  3CWI A;  2DBY A;  1FIQ A;  1AYF A;  1SF0 A;  4JX1 C;  1QOF A;  2PVO D;  3ZYY X;  3AE1 B;  2W3S A;  2CJO A;  5GXG B;  1VLB A;  3CF4 A;  3HUI A;  1QT9 A;  1N63 A;  1QOB A;  4FXC A;  1H7W A;  2K22 A;  2CJN A;  1L6U A;  1OQQ A;  2G1E A;  4YSZ B;  3W5V B;  4ZOH C;  4LTU A;  2BS4 B;  1SIJ A;  5EE9 A;  1WWT A;  1WYG A;  4A9A A;  4YTP B;  1N62 A;  3AMZ A;  4JWS C;  1ZUD 2;  5H8Y E;  3AEF B;  5AUI A;  1B9R A;  3AB5 A;  2EKI A;  3W9C B;  1N60 A;  1QOA A;  1NYR A;  2FBW B;  2E3T A;  4HRS A;  2WLB A;  1E10 A;  1J7C A;  1WRI A;  1TJE A;  1WGK A;  1KFY B;  1FMA D;  1RYJ A;  1NVI D;  1YQ3 B;  2KAJ A;  1NI3 A;  1RM6 C;  1RFK A;  3DWM A;  1FXA A;  2BT6 A;  1TKE A;  2W54 A;  3FC4 A;  4YSX B;  1FM0 D;  1JRP A;  1L0V B;  1PUT A;  2WS3 B;  3AEC B;  4N6E B;  1XLN A;  1V97 A;  4C80 A;  4YTN B;  1TYG B;  1DGJ A;  2L52 A;  5AUK A;  2LEK A;  4YSY B;  2M56 B;  3NVY A;  3SR6 A;  1UWM A;  4USA A;  1ZP0 B;  4ITK A;  3AE9 B;  3AEB B;  2H88 B;  5EE1 A;  1FO4 A;  1XLP A;  1GT8 A;  1J7A A;  3P4R B;  3EUB 2;  1NYQ A;  1JRO A; 
#chains in the Genus database with same CATH topology
 2G9H D;  2CU3 A;  2QIL A;  3R66 C;  2WXP A;  2N7J A;  3WAL A;  2PKO A;  4C4V B;  2UU7 A;  1SE4 A;  1WGH A;  1I4G A;  5FR6 A;  1L5P A;  4LNF A;  5H92 C;  1B1Z A;  4RCO A;  2WXF A;  1YQ4 B;  3VHT C;  1CMX B;  3P1M A;  2IY0 B;  2PE9 A;  3DBR B;  1NEK B;  2ASQ A;  1HEZ E;  1SE2 A;  1YN3 A;  2NVU I;  5IP4 D;  3QWZ B;  1WIA A;  2PPH A;  5HI1 A;  1MPE A;  4AS1 A;  3O65 B;  3K9O B;  4B0M A;  2HJ1 A;  1WR6 E;  1SGH A;  4OZA A;  3VXW A;  3UIN B;  2DYO A;  4HLE A;  1I42 A;  3KUC B;  4WWN A;  3L17 A;  2K6D B;  3IG3 A;  5G5G A;  2ZEQ A;  4RM9 A;  2FUH B;  4ZRP A;  3NZ3 A;  1AYF A;  4ARC A;  4C56 C;  1QOF A;  3NUH B;  4NJ6 A;  3M95 A;  2GOW A;  4DBG A;  2FCN A;  2J7Q B;  4RNA A;  3VTV A;  1UF0 A;  3ONS A;  1N62 A;  3AMZ A;  4GGQ A;  4LDT B;  3AEF B;  2LXC A;  3VQI A;  2LGD A;  4NAW B;  4KGT A;  2KJH B;  3TBL D;  1NVI D;  2D3A A;  1ET6 A;  2LJ5 A;  2K8B A;  4K3C A;  3TSS A;  2YEP F;  2MWS B;  2C7H A;  3P42 A;  1E7U A;  4ITK A;  5CHV C;  4AP4 C;  2Z0E B;  4JE3 B;  1GNU A;  1SXT A;  2XK5 B;  3ZLZ A;  3WCQ A;  4II2 B;  2ZCC A;  1FCL A;  1GPX A;  3SFE B;  3NHE B;  4OZC A;  1PDX A;  3PTF C;  5BMI A;  3NS8 A;  3L16 A;  2RPQ A;  1MHX A;  4LDT D;  4M8N A;  3KUD B;  3DDC B;  1E5W A;  3W5U B;  1WE6 A;  3O13 A;  3V60 A;  2L3Z A;  2RSU A;  3GZN B;  1TY0 A;  1MI0 A;  4DWF A;  3ZJT A;  1FNV A;  2BQQ A;  2UWQ A;  3NVV A;  3DVN U;  1KF6 B;  2KDM A;  4HK2 A;  2DWQ A;  1YQB A;  4MT5 A;  1LGR A;  1YJI A;  3X23 A;  4MDK E;  4F7Z A;  2BYE A;  3QQ8 B;  2WXQ A;  2L76 A;  4ARI A;  1UBQ A;  4IKG A;  2KOX A;  3GE3 C;  3RUI B;  3MFG A;  3U7Z A;  1H4R A;  4P1C C;  3QA8 A;  1WYG A;  1WXM A;  1I4X A;  1MG4 A;  2IZV B;  4REZ A;  2AL6 A;  2PW9 A;  2DZK A;  2G4S A;  2IO3 B;  3DOW A;  5AZH A;  1J7C A;  3KWV A;  4KZ0 A;  3N30 A;  1Z5S B;  3Q3J A;  5AEK B;  2INP E;  3PZD A;  3Q8B A;  2HE7 A;  3RN9 C;  1VZ7 A;  3L08 A;  3AEC B;  2GB1 A;  4I6N B;  2BGF A;  1TYG B;  2N9K A;  4WJQ A;  2V1Y A;  3SR6 A;  1U4A A;  1LQB A;  1UD7 A;  1WZ3 A;  1EF5 A;  1TS4 A;  3VTU A;  2WDT B;  3Q8E A;  3ENE A;  3KYC D;  3DBH B;  2JUO A;  2WP9 B;  3TIX A;  1WYW B;  2J4X A;  4PS7 A;  2ACZ B;  4L1B A;  1ZGU B;  1XF5 L;  2J0M A;  5G5H A;  2C7N B;  2WXJ A;  1TTN A;  1YN4 A;  1E8Z A;  1JWB D;  2V0G A;  4XDC A;  3RNE C;  3ZTD A;  4LNI A;  2LVO A;  3R8B A;  3IHP C;  1N5W A;  4JL9 A;  3CSF A;  1I7H A;  1CK1 A;  1R4M I;  4IWO A;  2MH7 A;  4MGI E;  5MPO A;  2AEH A;  4UDU C;  5L95 C;  3ECI A;  5T8I A;  2XBB C;  1VDV A;  3TUO A;  5L83 A;  5AZF A;  4TSS A;  2SEB D;  4LCD E;  4GIV A;  1GOZ A;  1TT5 B;  2DHZ A;  2N1V A;  5D2M B;  4L23 A;  3D32 A;  2K9X A;  1C1Y B;  1MHH E;  2B3A A;  3L4P A;  2KTR A;  1L2N A;  1VJK A;  4TKN A;  4GMV A;  4C00 A;  2OJR A;  5HKH A;  5BMG A;  3A33 B;  2PVO D;  1WM3 A;  2L32 A;  2V3P A;  1AN8 A;  2J0K A;  2JT4 B;  1L6U A;  2HJ8 A;  4KVG B;  4O1N A;  4N9F 4;  5FK9 C;  3L10 B;  4JWS C;  1NDD A;  1PGX A;  3DPD A;  3VAW A;  3PZ7 A;  2EMT A;  3M62 B;  2E3T A;  2WLB A;  2DEN B;  4MSQ B;  2ZW0 A;  4EZK A;  4GU2 A;  4EZL A;  1YIW A;  3V62 A;  3H7S A;  1F77 A;  4P1B C;  3Q3M C;  4W9J A;  4N6E B;  3H1U A;  2KFK A;  4K7W A;  2RPV A;  4KSL C;  4AJY B;  2LXA A;  4IW0 A;  2O6V A;  4IWP A;  4W9C A;  1XLP A;  2GLS A;  4I6P A;  3TEW A;  3E56 A;  2G45 B;  2OHF A;  2KX0 A;  2SAK A;  4HPM B;  4BBN F;  3KLS X;  5IO9 A;  3EC8 A;  4XZ4 A;  1STE A;  3RCZ A;  1SE3 A;  2Z8L A;  2MBB B;  2KQ7 A;  3Q8F A;  1L6V A;  3ETR A;  2H89 B;  2PE6 B;  1V8C A;  3ZNH B;  5G55 A;  1CQV A;  1OTR B;  2G4D B;  5CX3 A;  3VR8 B;  3OJ4 B;  2BPS A;  3IFW B;  1F0Z A;  3QIJ A;  1WXV A;  1HZ6 A;  2JZZ A;  2W82 A;  4KGR A;  5FR3 A;  3NRZ A;  4YTM B;  3I63 C;  3P4P B;  1QF6 A;  2L7R A;  3B2F A;  3N9Y C;  5E6P A;  2AX5 A;  4WJP A;  1J8C A;  3V6E B;  2LGI A;  4M01 A;  1WF9 A;  3TEY A;  4LNK A;  1E8W A;  5I4D A;  4RGN A;  4ZOH C;  5J2R A;  1TS2 A;  3W2D A;  2KN5 A;  1TZO A;  1F9J A;  1D3Z A;  1FXT B;  1N60 A;  4OVZ A;  3DHI C;  3RNA C;  2NBW B;  1BML C;  3A4R A;  4J6I A;  5E6O A;  4BVU C;  2KXJ A;  2LGX A;  2ZVO A;  4LJP B;  4USA A;  4BOS C;  3VUX A;  3GOE A;  4E71 A;  2V3S A;  2WXK A;  3QAQ A;  4FLH A;  4XE0 A;  1WM2 A;  3GZN I;  2DX5 B;  2YEP B;  4NAW A;  4HJK A;  4R3D A;  4DHJ B;  4DDI D;  1ZW7 A;  5BMH A;  3AEE B;  1KLU D;  5E6N A;  2JSV X;  2BB6 A;  3GP7 A;  3UI3 A;  2KNB A;  2ZPY A;  1XXG A;  4KDL B;  5TR5 A;  3SHQ A;  2WXR A;  1YX6 B;  1L0Y B;  2O2V B;  4BOZ B;  2KAC A;  1WMH B;  3PV1 A;  3OWE B;  3VRA B;  2XK5 A;  2CU1 A;  3U52 E;  2N0S B;  4CHK A;  2PIA A;  3L0W B;  2CKH B;  4AUQ C;  2PTL A;  2V4I B;  4P6V F;  1R7S A;  3HVZ A;  2WQY B;  2FCQ A;  3RT3 B;  1A70 A;  3EEC A;  4RGT A;  1YD8 U;  1T6B X;  2JYE A;  1WZ0 A;  4DHJ D;  2NR2 A;  3RD2 A;  1HE8 A;  4BZA A;  3T8M A;  3Q8C A;  2RR9 A;  2OJW A;  1TBE A;  2NBU A;  2KWD A;  3ZJV A;  4TUU A;  2JF5 A;  2YVC A;  4NJC A;  2BS4 B;  4PS3 A;  4ASW C;  3W1S C;  1P7F A;  3PRM B;  1T0R C;  2N9P C;  3BVG A;  1RYJ A;  1D5Z C;  4M02 A;  1MFW A;  1R4M B;  1I4R A;  3RMK C;  2KD0 A;  2DZM A;  4YL8 A;  2N1W A;  1UWM A;  1E90 A;  1WGG A;  2IO1 B;  4XWT A;  1XCQ L;  3SU8 X;  1KM7 A;  2HTH A;  4FN2 A;  1NEN B;  3URY A;  4MSM B;  2IY1 B;  3KQ4 A;  5IKC M;  2M4N A;  2R2O A;  3U30 A;  2K0P A;  4QAY A;  1UH6 A;  2IND C;  1UBI A;  2KDF B;  1XO3 A;  4C7Z A;  3V3X A;  3EGR A;  4PK1 A;  3PLU A;  2LZ6 A;  5JH5 C;  1WRD B;  3N1Y C;  4AJW A;  4EE2 A;  4YWG G;  4US9 A;  1RAX A;  1I4H A;  3DQV A;  4HWI B;  1TZ1 A;  3AM9 A;  3NVW A;  1JQ4 A;  1V9J A;  3AEG B;  3R7R A;  2IBI B;  1ROE A;  2MLB A;  2O6V D;  3B0A A;  4FUL A;  2IGD A;  4ACF A;  4HDQ A;  1OEY J;  4XX5 A;  3AE2 B;  3W1Y A;  1WFY A;  3BII D;  3I5J C;  1E7P B;  1HTO A;  2XNA C;  4KDI C;  2ZPN A;  2LHD A;  1UEL A;  1RLF A;  3ZYY X;  3ZXV A;  3CF4 A;  4A90 A;  1YX5 B;  4ICV A;  4PS8 A;  5C1Z A;  3H8H A;  1WR1 A;  2KDI A;  4MGY E;  2ZCB A;  1F2R C;  1SJE D;  1V86 A;  2EKI A;  1HQR D;  1NYR A;  5AZG A;  2LRU A;  1WRI A;  3MC9 A;  4PYU A;  2BF8 B;  3PZ8 A;  2PEA A;  1P98 A;  3QK0 A;  4J3O D;  3ZNI D;  2WS3 B;  4HCN B;  1V6E A;  5AUK A;  1V49 A;  3R2T A;  2H88 B;  1L4D B;  1RFA A;  3B2G A;  3NZS A;  2QIE B;  1GG3 A;  2LWP A;  2MJ3 A;  2VZK B;  4W9E A;  5LNK 1;  1IYF A;  1F2R I;  2INC C;  4FAD A;  1Q1O A;  4HEA 1;  3MHZ A;  3MJW A;  1TKY A;  3FAH A;  4US8 A;  4KV2 A;  1T5X D;  2KMA A;  2X38 A;  4S0R A;  1E8X A;  4HDO A;  3JYU A;  2C60 A;  1GJZ A;  2KVR A;  3Q6B A;  4IC7 B;  1MVK A;  3AV8 A;  4GDL B;  1PYW D;  3DWG C;  2LAS A;  1GB4 A;  4KSK C;  3NJT A;  4XDD A;  4KKI A;  3MTN B;  2IGG A;  2DZJ A;  1MJD A;  1C77 A;  4RF0 A;  1P3Q U;  4RF1 A;  4WUR A;  4HRO A;  3EFC A;  2BBC A;  3N1Z C;  2IO0 B;  3DBL I;  2BW2 A;  3DCG A;  2BYV E;  2KYW A;  2LUM A;  5D94 A;  2LGS A;  3AH7 A;  1UZX B;  4A8X C;  4HKQ A;  4OZB A;  1CZP A;  2JY6 A;  1IBX B;  1SBB B;  3HK0 A;  2VZK D;  2CS4 A;  4HJG E;  1VLB A;  4MH0 E;  2IYD B;  3SD5 A;  1QOB A;  1WJ4 A;  4I6L B;  4GLS C;  1SEB D;  1Y8R C;  3ML9 A;  4BKT A;  2KJR A;  3Q14 C;  2GMI C;  1YJ1 A;  2KMC A;  3EHV A;  2QHO A;  5DPS A;  1VZ6 A;  3KYD D;  4DXF A;  2KT7 A;  4NJ7 A;  4IM3 A;  4FA6 A;  2FE8 A;  1L0X B;  1RM6 C;  4HCP B;  3AUL A;  1FXA A;  4KKJ A;  3PT2 B;  1JRP A;  3PPA A;  1PUT A;  1GUA B;  3LDZ E;  1V5O A;  4NQL B;  3DHG C;  3PVL A;  4W9L A;  1FO4 A;  3EUB 2;  1NYQ A;  2N7D A;  1I4P A;  3OLM D;  2DNF A;  2DYB A;  3P4S B;  2WXG A;  2FIF A;  3M63 B;  5FKA C;  2WXO A;  4JWU C;  3PRP B;  3AN1 A;  1TS3 A;  3QC8 B;  2QMT A;  2LRW A;  2ONQ A;  3OG5 A;  1DOY A;  3NVZ A;  3KWL A;  3APC A;  1WI0 A;  5KHQ A;  2Y5B B;  5IA7 A;  1C79 A;  2WXH A;  2FAZ A;  2PJH A;  4ZRQ A;  3WAP A;  1J19 A;  4B9K A;  3H6N A;  1IPG A;  2KTF A;  4EZJ A;  4ANX A;  2D3G A;  3VTW A;  4ZDV A;  3AE7 B;  4CYE A;  1FRD A;  4L2Y A;  2K39 A;  2GBM A;  4HPL B;  1Q5W B;  1P0R A;  2W55 A;  3AXC A;  2L0T A;  3Q3N C;  3H7P A;  2I2Y A;  4GSW A;  5J17 A;  4XYC A;  1L7Y A;  1XLQ A;  4K3B A;  1IGD A;  4KIK B;  3A9K B;  3EA6 A;  1FEH A;  2JXX A;  2OOB B;  2MCN B;  4XC2 A;  3CWI A;  2DBY A;  1TGZ B;  3IT6 B;  2O2V A;  1AAR A;  1WMH A;  2D5G A;  4FXC A;  1DYQ A;  4HXD A;  1Q0W B;  3RNC C;  2G1E A;  2WXN A;  5EE9 A;  5LXI B;  4CQN A;  3N32 A;  4ZYS A;  4IG7 B;  4EFO A;  1WGR A;  5AUI A;  3HIZ A;  4DXA B;  4B95 A;  4G0N B;  1SJH D;  1J0G A;  1XD3 B;  2FBW B;  1IGC A;  3AI5 A;  2HD5 B;  3BYT B;  2JWU A;  2M56 B;  5CHF A;  2NPT A;  3RNG C;  3LYY A;  2NMQ A;  5D3I B;  1E0Z A;  1GAQ B;  3ML8 A;  1JRU A;  1D5X C;  2KAN A;  2LVQ A;  2M17 A;  3NZU A;  2BWF A;  4A55 A;  2Y5P A;  3V6C B;  3QCA A;  1F1H A;  1ESF A;  3NG0 A;  2DYM A;  4AOF A;  1AWD A;  1ZDV A;  3UGB B;  3ZQ4 A;  3ZXR A;  2E6X A;  1EUV B;  5JHA A;  5G2N A;  4N59 A;  5JZE B;  3MJ5 A;  1RRB A;  1S1Q B;  2D3C A;  3VR9 B;  4ZRI A;  4ICU A;  4TQ1 A;  3ZGZ A;  1H7X A;  2PMV A;  1WJU A;  3DVG Y;  1TKG A;  3P2B A;  3GB1 A;  4FJV B;  3RI7 C;  1R4N I;  2KO3 A;  2NTT A;  4FHK A;  1ZE3 D;  1T0Y A;  2M19 A;  3BK2 A;  4B6W A;  4HVB A;  3MP9 A;  1VD2 A;  4ZHP A;  1SIF A;  3BWU D;  3ZNG C;  2BWE S;  4WJN A;  2QEJ C;  5HG2 A;  2EEL A;  2LD9 A;  5BO4 B;  3BYY B;  2AWT A;  3PSE B;  2Q5W D;  1E6E B;  2A4Z A;  3KH0 A;  4JX1 C;  4DHZ E;  4II3 B;  4ZRK A;  2BVC A;  4K7U A;  1QKZ A;  1H7W A;  2WX0 A;  5BYQ A;  2EKE C;  1AW7 A;  4FBJ B;  2JZ3 B;  4G50 A;  2WGS A;  2MSE D;  2KC2 A;  3J9C A;  5H8Y E;  1XEE A;  1YMH E;  1GC7 A;  3W9C B;  3VFK A;  3HM6 X;  1KFY B;  1C76 A;  2BT6 A;  1TKE A;  3A9J A;  3KVF B;  5BYS A;  3S2A A;  2D11 A;  3CST A;  2AQ2 B;  3DBL B;  2KDB A;  4AWJ A;  3APF A;  3ZNZ B;  3H9D A;  1ZUD 2;  3TL5 A;  4RH6 A;  1JWS D;  1N5X A;  3QX1 A;  2Z59 B;  4MAC A;  3AEA B;  3P4Q B;  1C4C A;  2L00 B;  3HHM A;  4W9D A;  4GB9 A;  1P1A A;  3ZRF A;  2MX2 A;  2CHZ A;  4MM3 A;  4WAF A;  1L4Z B;  1LM8 B;  1OFF A;  4E74 A;  3L13 A;  1IP9 A;  2BKF A;  1RWS A;  3DHH C;  2N4F A;  3RNF C;  4NQK E;  3HRD D;  1FRR A;  2KVZ A;  3UQB A;  2LJI A;  3H7P B;  4NPN A;  4A3O A;  1PQS A;  2FID A;  1C4A A;  3PHX B;  1C78 A;  2L0F A;  3UIO B;  4DHZ B;  4GDL A;  3ZRC A;  2KFJ A;  2JPH A;  3AE6 B;  2MEK A;  2Z0D B;  3T3N A;  2AYO B;  3AE1 B;  1WJN A;  1Z2M A;  2M1M A;  4A20 A;  4ANW A;  1QZE A;  1V81 A;  2K6Q A;  1OQQ A;  4WWO A;  4YSZ B;  3W5V B;  4K7S A;  1QIL A;  2GBJ A;  1KH0 A;  2JU6 X;  2N9X A;  1B9R A;  2WNM A;  1FMA D;  2J42 A;  3HM3 A;  1NI3 A;  1IBX A;  3ZO5 B;  2WXI A;  2W54 A;  3KUZ A;  3SDL C;  3PS6 A;  4MEL A;  1EF1 A;  1D5M C;  2L52 A;  2NPT B;  1I4Q A;  4NY0 A;  4WQO B;  4E3C A;  2CR5 A;  3V61 A;  2JXT A;  4WH4 A;  1FNU A;  2KZR A;  5C3J B;  2W3R A;  1WGY A;  4WWM A;  4WQM A;  1PFD A;  2V4L A;  2K1F A;  3N1X C;  3QHT A;  4P7I A;  4OVV A;  1OGW A;  4URK A;  4F1S A;  1G6J A;  4NNJ B;  2PLP A;  3SFD B;  3AE4 B;  1DOI A;  1WXS A;  5D3D A;  1YNT E;  2IDY A;  4F8C B;  2C9W B;  1V1P B;  3Q3O C;  1EU4 A;  2D10 A;  3RPF C;  3NY5 A;  4GXB A;  1V80 A;  3MC0 B;  2JX5 A;  2NBV B;  3U7D A;  2JQR B;  2WDR B;  2QDF A;  1GTE A;  2D2Q A;  2BS2 B;  1C3T A;  1GC6 A;  2D07 B;  1HXY D;  1KRH A;  4MJS A;  4ZRJ A;  5EE3 A;  3U2S C;  2MHJ A;  3RNB C;  1OQY A;  4M00 A;  1K51 A;  3AE5 B;  1JWM D;  2L1A A;  3WA0 A;  1D4B A;  1QT9 A;  2ZW1 A;  4X57 B;  3TEZ A;  1K52 A;  5E6J A;  3IAS 1;  2ZZP B;  3OJ3 A;  1I35 A;  4G3X B;  4A9A A;  4JGH B;  2MW5 A;  5KHO A;  4DQO C;  2GRI A;  4DDG D;  1SE9 A;  1T0S C;  3UIP B;  4D2K A;  4KIK A;  2GI9 A;  1WGK A;  2MRP A;  3A9K A;  2YLM A;  3A9J B;  4DXG A;  4NZL B;  1YN5 A;  1N6Z A;  2MP2 A;  2KWV B;  3PRZ A;  4EUT A;  1L0V B;  4RFB A;  4A6Q A;  2FCS A;  1KOT A;  1R4N B;  3W1S A;  2C7M B;  4JPS A;  2WX1 A;  3VUY A;  4NAM A;  2FCM A;  3DVG X;  3QAR A;  1P7E A;  4IUM B;  2RDB C;  2LGY A;  4HPP A;  4BFR A;  4G11 A;  2KHW B;  1IUE A;  4KX6 B;  3GS2 A;  1FNW A;  4MM3 B;  2M0A A;  1PGA A;  2DLB A;  5JHB A;  4LK0 M;  2KQS A;  3VRB B;  1LXD A;  1QLB B;  3JVZ X;  4FJY A;  5IOI A;  2KWC A;  3WAO A;  2ON8 A;  1FFU A;  3BIN A;  1WE7 A;  1E9M A;  1ZXI A;  3P63 A;  4AQ7 A;  1KJT A;  1Y56 A;  1E7V A;  2QCZ A;  3ZVV A;  1LFD A;  1QOG A;  1DOX A;  4M8M A;  2K8H A;  3PLV A;  4RMA A;  3IVF A;  2JRH A;  4MEM A;  4MH8 A;  2I38 A;  3BK1 A;  1N63 A;  1FPY A;  1HZ5 A;  1UGJ A;  3UQA A;  2CJN A;  4M0W A;  1SIJ A;  5TSS A;  2JRI B;  3VUW A;  4EKU A;  1P9D U;  4K1R B;  3RYT A;  4TMA B;  1QOA A;  4HRS A;  1E10 A;  3GE8 C;  2KAJ A;  3V05 A;  2VH2 A;  4YSX B;  2MA9 B;  1FD6 A;  2L05 A;  1E8Y A;  4YTN B;  3HVD A;  1KLV A;  2MBE A;  1J7A A;  5CTR C;  1GTH A;  2BTE A;  2ZNV C;  3WIM A;  2LVP A;  3IAM 1;  2KLG A;  3Q2A C;  1ZKH A;  2NS5 A;  2Y5C A;  2JZP A;  5CHW A;  3ZW3 A;  3I9V 1;  1JWU D;  1SB3 C;  4Q2J A;  4ANU A;  3PHW B;  5IN7 A;  3A1Q B;  1WXQ A;  2B76 B;  2QC8 A;  1HTQ A;  1ZOY B;  5DPW A;  2ZVN A;  1XQQ A;  2FNJ B;  1XCT L;  2ICI A;  1J7B A;  4MGK E;  1WSP A;  3AU5 A;  3ALB A;  2LHE A;  2Y3A A;  2I1J A;  3C19 A;  1UUP A;  3K9P B;  4WWP A;  1V1O A;  1FCC C;  1JWA D;  5JXV A;  3EFU A;  4MJS B;  1VRA B;  3FIL B;  2M0X A;  4OW0 A;  4RGM A;  1UGM A;  3JSV B;  4RGO S;  1K53 A;  3M3J A;  5GXG B;  3SEB A;  3BY4 B;  4BKS A;  1KLG D;  2K22 A;  5HFY A;  2EMS A;  4TQ0 A;  3N3K B;  3APD A;  4FJZ A;  1M94 A;  2N7E A;  2KWU B;  1SSN A;  4GDK A;  2MP2 B;  2REX A;  4PT5 A;  1HA5 A;  3TMP B;  1ACC A;  2KN4 A;  1WX8 A;  3Q8A A;  1ZP0 B;  3Q69 A;  1K8R B;  3A4S C;  1GT8 A;  3P4R B;  3Q3F A;  1EU3 A;  3DVN V;  4DK5 A;  3C0R B;  3AED B;  4C7Y A;  2JWZ A;  3MC8 A;  4LLG M;  2DZI A;  3AE8 B;  1BXT A;  2PVG C;  4YXD B;  4S17 A;  2K5P A;  2WXL A;  5LLI A;  3N20 C;  2J0J A;  3L54 A;  1WXA A;  2IPK D;  3OAW A;  2RMM A;  4EOY A;  2L83 A;  2DAF A;  3IBE A;  3C8Y A;  2GBN A;  4KZC A;  1WGD A;  2QJL A;  4WIP A;  3B08 A;  1D6E C;  4JLC A;  3AE3 B;  4WJO A;  3RZW C;  2LMC A;  2WDQ B;  1WX9 A;  4OVU A;  4CO7 A;  4XWW A;  2VH1 A;  2DAJ A;  2N9E B;  5EE0 A;  2KK8 A;  1X1M A;  3PGE A;  2RD0 A;  2AQ1 B;  2LFI A;  2BYF A;  4WAA A;  2BYT A;  2WYQ A;  1JCK B;  2D3B A;  1FIQ A;  1SF0 A;  5D6J B;  4GN1 A;  3I3T B;  3U8Z A;  2CJO A;  2WHI A;  3HUI A;  4BAX A;  4PYZ A;  2R2Q A;  1V1P A;  2HDE A;  4M0W B;  1ZDX A;  2J52 A;  2VRR B;  1QQR A;  2XN9 C;  4LTU A;  3ZDT A;  3DBR I;  4W9I A;  2G3Q B;  3AB5 A;  3TEX A;  1LO5 D;  1YOV B;  1TJE A;  2J53 A;  3WAN A;  1TIF A;  4BKG A;  2JVC A;  2NTS A;  4JIO U;  1UWX A;  2MBQ A;  1NI2 A;  3FKY A;  1XLN A;  4C80 A;  4LNO A;  4YSY B;  4MGZ E;  4OHJ A;  2OED A;  5EE1 A;  1ENF A;  3R2I A;  2X8X X;  2BB5 A;  2IO2 B;  4IOI E;  2INN E;  2CHX A;  3RUL A;  5DPR A;  3RZF A;  4C4V A;  4YT0 B;  4W9H A;  2KQ4 X;  4N58 A;  3ABV B;  4BBN C;  4HKZ E;  1CJE A;  4W9F A;  2L8J A;  1YJJ A;  3BVZ A;  1EWC A;  5EDS A;  1ZPS A;  3NS1 A;  3TCA A;  1NBF C;  3PO0 A;  2AL3 A;  3BVM A;  1V5T A;  1PGB A;  3B1L X;  2V3N A;  1JW9 D;  2K3U A;  3QJZ A;  3NOB A;  2K8C A;  3E9S A;  2WU2 B;  1OQR A;  1WJ6 A;  2N9L A;  2KLC A;  2K25 A;  4IM0 A;  3UF8 A;  1ZXH A;  1EWY C;  2BS3 B;  1FFV A;  2NCN A;  1Q10 A;  1EO6 A;  3X0W A;  3KW5 B;  3ZIM A;  3TJP A;  1ET9 A;  1T0Q C;  1WY8 A;  1UNS A;  3WAM A;  2R61 A;  3JW0 X;  1A5R A;  2W9N A;  1VZ8 A;  2I1K A;  2KKC A;  2QSD A;  3I57 A;  4GDK B;  3U4E G;  1TY2 A;  1V2Y A;  2LI5 A;  1XT9 B;  4LJO B;  1K50 A;  2WXM A;  4EEW A;  2KDE B;  1EM7 A;  1RFK A;  3CMM B;  3DWM A;  5J18 A;  4RM8 A;  4ANV A;  1JML A;  1KTK A;  1V97 A;  2ZNV B;  1C4P A;  2LEK A;  2AQ3 B;  2KX3 A;  1BUI C;  3AEB B;  2RDH A;  1F52 A;  5C23 A;  5BYR A;  1JRO A;  3VH4 B;  1M4V A;  4A3P A;  2GBR A;  1WX7 A;  5HHD G;  1WH3 A;  3R3M A;  3T9L A;  4BKS D;  3VDZ A;  5GMV A;  2V9H A;  4FHJ A;  2GBK A;  2WU5 B;  2BKR B;  3LB8 C;  3VVW B;  2IJ0 A;  2FUG 1;  1T3Q A;  2WDV B;  2KC1 A;  2MJE A;  1OEY A;  4TV3 A;  2A5U A;  3LXF A;  1XLO A;  2KTR B;  2HTM E;  2XEW A;  3T3O A;  1TS5 A;  2MQJ A;  3LJ3 A;  4ZYN A;  5IAA C;  1JAL A;  2IGH A;  2RDG A;  3ZTC A;  3PRE A;  3ZJU A;  4B0E A;  2LUE A;  3DBS A;  2MJD A;  2WWZ A;  4W9G A;  4IM2 A;  4P16 A;  1C9F A;  4ZHO A;  3CIR B;  1VR9 A;  1ISN A;  5C2T B;  2C5L C;  3ZKJ C;  3A1Q A;  3DBH I;  4K81 A;  4LNN A;  1N61 A;  2RGF A;  1FXI A;  3B9J A;  4XGA B;  3CF6 E;  4W9K A;  3ZDM C;  1VCB A;  2TSS A;  2KMM A;  5DCN A;  3AU4 A;  2CHW A;  5LXH A;  2W3S A;  5D7G A;  4KGS A;  1H8C A;  2KFK B;  3MHS D;  2MBH A;  2O6V B;  1WWT A;  3VH3 B;  4YTP B;  3BZD B;  2KJ6 A;  3RFZ B;  4GOC A;  1BT0 A;  5DPT A;  3FIL A;  4IWQ A;  1YQ3 B;  3IT4 B;  2JYT A;  4H2A A;  1MG8 A;  3FC4 A;  3JSV A;  2MBO A;  1FM0 D;  1GB1 A;  3R7Q A;  2UYZ B;  1DGJ A;  2M8S A;  3IXS A;  3NVY A;  4JQW C;  3ZUN A;  3AE9 B;  1S3S G;  2ZJD A;  4IDI A; 
#chains in the Genus database with same CATH homology
 2WXK A;  5D3I B;  1GTH A;  1E0Z A;  1GAQ B;  2BTE A;  1D5X C;  4XE0 A;  2G9H D;  2CU3 A;  2QIL A;  3IAM 1;  2WXP A;  2N7J A;  4A55 A;  2PKO A;  2Y5P A;  2YEP B;  1SE4 A;  1ESF A;  2Y5C A;  2DYM A;  1AWD A;  4R3D A;  1ZDV A;  2JZP A;  3ZQ4 A;  2E6X A;  5BMH A;  1I4G A;  3AEE B;  1L5P A;  3I9V 1;  1KLU D;  1JWU D;  1SB3 C;  2JSV X;  1B1Z A;  4N59 A;  2BB6 A;  4Q2J A;  4RCO A;  2WXF A;  3GP7 A;  1YQ4 B;  3MJ5 A;  3UI3 A;  1WXQ A;  2B76 B;  3P1M A;  1XXG A;  1ZOY B;  3VR9 B;  1XCT L;  4TQ1 A;  2ICI A;  1NEK B;  1J7B A;  1HEZ E;  1WSP A;  1SE2 A;  2WXR A;  1YN3 A;  1L0Y B;  3ZGZ A;  1H7X A;  5HI1 A;  2KAC A;  1MPE A;  4AS1 A;  2LHE A;  2PMV A;  2Y3A A;  3OWE B;  1TKG A;  3VRA B;  3U52 E;  1UUP A;  4B0M A;  2N0S B;  3GB1 A;  4OZA A;  2PIA A;  1V1O A;  1FCC C;  2NTT A;  2DYO A;  1JWA D;  2PTL A;  5JXV A;  1ZE3 D;  2V4I B;  2M19 A;  3BK2 A;  4P6V F;  1R7S A;  3HVZ A;  2WQY B;  3MP9 A;  4ZHP A;  5G5G A;  1VRA B;  3BWU D;  2QEJ C;  5HG2 A;  2EEL A;  3FIL B;  4ZRP A;  1A70 A;  3BYY B;  3NZ3 A;  4OW0 A;  4RGM A;  2Q5W D;  1E6E B;  4RGO S;  4RGT A;  1T6B X;  1AYF A;  1K53 A;  4JX1 C;  4C56 C;  1QOF A;  4ARC A;  2JYE A;  3NUH B;  5GXG B;  3SEB A;  1QKZ A;  1H7W A;  3Q8C A;  1KLG D;  2K22 A;  5BYQ A;  1AW7 A;  4RNA A;  2KWD A;  5HFY A;  3ZJV A;  4TQ0 A;  4NJC A;  2BS4 B;  1N62 A;  3AMZ A;  1SSN A;  3J9C A;  5H8Y E;  3AEF B;  1XEE A;  3VQI A;  1YMH E;  3W9C B;  1P7F A;  4NAW B;  4KGT A;  3BVG A;  1KFY B;  1RYJ A;  1NVI D;  4PT5 A;  1D5Z C;  1ET6 A;  1HA5 A;  1C76 A;  2BT6 A;  1I4R A;  1ACC A;  1TKE A;  5BYS A;  2KN4 A;  3Q8A A;  2YEP F;  3TSS A;  3P42 A;  2AQ2 B;  1UWM A;  1ZP0 B;  3Q69 A;  4ITK A;  1GT8 A;  4XWT A;  4JE3 B;  3P4R B;  1XCQ L;  1ZUD 2;  1EU3 A;  4RH6 A;  1NEN B;  3URY A;  1JWS D;  1N5X A;  1SXT A;  3AED B;  4MAC A;  4C7Y A;  3AEA B;  3P4Q B;  1C4C A;  3KQ4 A;  4LLG M;  3WCQ A;  3AE8 B;  1BXT A;  2PVG C;  1FCL A;  1GPX A;  3SFE B;  4YXD B;  2K5P A;  2WXL A;  2K0P A;  4OZC A;  1PDX A;  2IPK D;  2RMM A;  4WAF A;  5BMI A;  2L83 A;  1XO3 A;  4C7Z A;  3V3X A;  1MHX A;  1L4Z B;  3EGR A;  1OFF A;  3C8Y A;  3W5U B;  3O13 A;  1RWS A;  4EE2 A;  4YWG G;  4US9 A;  2QJL A;  4WIP A;  1TY0 A;  1I4H A;  1MI0 A;  3HRD D;  1D6E C;  3AM9 A;  3NVW A;  1JQ4 A;  3ZJT A;  1FRR A;  3AE3 B;  1FNV A;  3AEG B;  2LJI A;  3NVV A;  2LMC A;  2WDQ B;  1KF6 B;  1ROE A;  2KDM A;  4XWW A;  1C4A A;  2DWQ A;  2IGD A;  5EE0 A;  1C78 A;  4MT5 A;  3AE2 B;  3BII D;  2AQ1 B;  1E7P B;  2LFI A;  3AE6 B;  2XNA C;  2BYT A;  1YJI A;  1JCK B;  2MEK A;  2LHD A;  1FIQ A;  1SF0 A;  3T3N A;  3ZYY X;  3AE1 B;  2CJO A;  3CF4 A;  3HUI A;  2WXQ A;  1V1P A;  4A90 A;  4ARI A;  4IKG A;  2HDE A;  1ZDX A;  3MFG A;  2J52 A;  1OQQ A;  4YSZ B;  1QQR A;  3W5V B;  3U7Z A;  3H8H A;  1QIL A;  2XN9 C;  4LTU A;  1WYG A;  1I4X A;  4REZ A;  1KH0 A;  2JU6 X;  1F2R C;  1SJE D;  1B9R A;  2PW9 A;  3AB5 A;  3TEX A;  2EKI A;  1HQR D;  1NYR A;  1LO5 D;  1J7C A;  3KWV A;  1WRI A;  2WNM A;  1TJE A;  2J53 A;  1FMA D;  2J42 A;  1NI3 A;  1IBX A;  2INP E;  3PZ8 A;  3Q8B A;  2NTS A;  2WXI A;  2W54 A;  1UWX A;  1VZ7 A;  4J3O D;  2WS3 B;  3AEC B;  2GB1 A;  1XLN A;  1D5M C;  4C80 A;  1TYG B;  5AUK A;  2L52 A;  2N9K A;  4YSY B;  3SR6 A;  1I4Q A;  3R2T A;  4OHJ A;  2H88 B;  1L4D B;  1TS4 A;  2OED A;  5EE1 A;  1ENF A;  3Q8E A;  2JXT A;  3R2I A;  2BB5 A;  2WP9 B;  4IOI E;  3B2G A;  4WH4 A;  2INN E;  2QIE B;  1FNU A;  5C3J B;  2MJ3 A;  5LNK 1;  2VZK B;  2J4X A;  1F2R I;  2W3R A;  4YT0 B;  4WWM A;  2ACZ B;  4HEA 1;  2KQ4 X;  3MHZ A;  4N58 A;  4WQM A;  1PFD A;  4L1B A;  1TKY A;  3FAH A;  4US8 A;  1XF5 L;  1T5X D;  2X38 A;  3ABV B;  5G5H A;  4HKZ E;  2WXJ A;  1CJE A;  1YN4 A;  1YJJ A;  3BVZ A;  1EWC A;  1MVK A;  1JWB D;  1ZPS A;  1PYW D;  3AV8 A;  3DWG C;  4GDL B;  4XDC A;  2V0G A;  3NS1 A;  1GB4 A;  2PLP A;  3R8B A;  3PO0 A;  3SFD B;  3AE4 B;  1DOI A;  3BVM A;  5D3D A;  1N5W A;  1PGB A;  4XDD A;  4KKI A;  1I7H A;  1YNT E;  1CK1 A;  2IDY A;  2IGG A;  2V3N A;  1V1P B;  2MH7 A;  1C77 A;  1EU4 A;  4RF0 A;  3RPF C;  5MPO A;  4UDU C;  4RF1 A;  1JW9 D;  5T8I A;  2K3U A;  4HRO A;  3MC0 B;  2JX5 A;  1VDV A;  4WUR A;  3TUO A;  2BBC A;  2JQR B;  2WDR B;  3E9S A;  2BW2 A;  4TSS A;  2SEB D;  1GTE A;  2WU2 B;  1OQR A;  2BS2 B;  2LUM A;  1GOZ A;  1HXY D;  3AH7 A;  4A8X C;  2N9L A;  4HKQ A;  4L23 A;  4OZB A;  1CZP A;  1KRH A;  2K9X A;  1MHH E;  5EE3 A;  1ZXH A;  1EWY C;  3L4P A;  3U2S C;  2BS3 B;  1IBX B;  1VJK A;  1K51 A;  3AE5 B;  1FFV A;  1SBB B;  5BMG A;  2VZK D;  1JWM D;  4HJG E;  2PVO D;  1Q10 A;  2L1A A;  1D4B A;  1VLB A;  1QT9 A;  2ZW1 A;  1QOB A;  3TEZ A;  1ET9 A;  1K52 A;  2L32 A;  2V3P A;  1AN8 A;  1SEB D;  4GLS C;  5E6J A;  1L6U A;  1UNS A;  3IAS 1;  4O1N A;  5FK9 C;  2R61 A;  4A9A A;  4JWS C;  4DQO C;  1PGX A;  2GRI A;  1VZ8 A;  2QSD A;  3I57 A;  4GDK B;  3U4E G;  1TY2 A;  1VZ6 A;  3PZ7 A;  4D2K A;  2E3T A;  2WLB A;  4DXF A;  2GI9 A;  1WGK A;  1K50 A;  2WXM A;  4DXG A;  1EM7 A;  5H92 C;  2ZW0 A;  1YN5 A;  2FE8 A;  1L0X B;  1RM6 C;  4NZL B;  1RFK A;  3DWM A;  1FXA A;  4KKJ A;  1F77 A;  1JRP A;  1L0V B;  4RFB A;  4A6Q A;  1JML A;  1KTK A;  1PUT A;  4N6E B;  1V97 A;  1C4P A;  2LEK A;  2AQ3 B;  2RPV A;  3W1S A;  1BUI C;  3AEB B;  2RDH A;  4JPS A;  1FO4 A;  1XLP A;  3EUB 2;  1NYQ A;  4NAM A;  1JRO A;  5BYR A;  1I4P A;  1M4V A;  3P4S B;  2WXG A;  1P7E A;  5FKA C;  2WXO A;  4JWU C;  3TEW A;  3AN1 A;  1TS3 A;  5HHD G;  2QMT A;  2ONQ A;  3E56 A;  1DOY A;  3NVZ A;  3KWL A;  2OHF A;  2SAK A;  2WU5 B;  1IUE A;  4KX6 B;  3GS2 A;  1FNW A;  4MM3 B;  3KLS X;  3LB8 C;  2M0A A;  1PGA A;  2IJ0 A;  2FUG 1;  1T3Q A;  2WDV B;  2DLB A;  1STE A;  2MJE A;  4LK0 M;  3VRB B;  1SE3 A;  2Z8L A;  3LXF A;  1C79 A;  2WXH A;  1XLO A;  4ZRQ A;  1QLB B;  2HTM E;  3T3O A;  3Q8F A;  1TS5 A;  1L6V A;  3ETR A;  2H89 B;  2ON8 A;  1FFU A;  1JAL A;  1V8C A;  2IGH A;  2RDG A;  3ZJU A;  1E9M A;  4B0E A;  3AE7 B;  1CQV A;  1ZXI A;  3P63 A;  1FRD A;  4L2Y A;  2MJD A;  4AQ7 A;  1C9F A;  4P16 A;  4ZHO A;  1Y56 A;  3VR8 B;  2W55 A;  3CIR B;  1QOG A;  2I2Y A;  1DOX A;  1F0Z A;  1VR9 A;  5C2T B;  1HZ6 A;  2W82 A;  4KGR A;  1XLQ A;  5FR3 A;  1IGD A;  1N61 A;  3NRZ A;  1FXI A;  4YTM B;  3B9J A;  3EA6 A;  3P4P B;  1QF6 A;  1FEH A;  3B2F A;  3N9Y C;  4MH8 A;  2AX5 A;  2TSS A;  2KMM A;  3CWI A;  2DBY A;  3IT6 B;  2W3S A;  2I38 A;  4KGS A;  3BK1 A;  5D7G A;  1N63 A;  2D5G A;  1HZ5 A;  1UGJ A;  1DYQ A;  2LGI A;  4FXC A;  2CJN A;  3TEY A;  2G1E A;  4M0W A;  2WXN A;  5I4D A;  4RGN A;  4ZOH C;  1TS2 A;  5EE9 A;  1SIJ A;  3W2D A;  1WWT A;  5TSS A;  4CQN A;  4YTP B;  1TZO A;  4ZYS A;  3BZD B;  5AUI A;  3RFZ B;  1SJH D;  4TMA B;  1N60 A;  1QOA A;  2FBW B;  4HRS A;  4OVZ A;  1E10 A;  1IGC A;  3FIL A;  1BML C;  1YQ3 B;  2KAJ A;  2JYT A;  3IT4 B;  4H2A A;  3V05 A;  3BYT B;  3FC4 A;  4YSX B;  1FM0 D;  1FD6 A;  2JWU A;  1GB1 A;  4YTN B;  1DGJ A;  3HVD A;  2M56 B;  3IXS A;  3NVY A;  4USA A;  3AE9 B;  1J7A A;  4IDI A;  3LYY A;  2NMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...