4HPMB

Pcgf1 ub fold (rawul)/bcorl1 pufd complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
81
Chain Sequence
QGTREQLNLCLERLSNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords BCL-6 corepressor-like protein 1
publication title Structure of the Polycomb Group Protein PCGF1 in Complex with BCOR Reveals Basis for Binding Selectivity of PCGF Homologs.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 81
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hpmB00
3W1YA 2LVOA 4WJNA 3ZNHB 3DCGA 3H6NA 2KKCA 2O2VA 3SU8X 1UH6A 2LI5A 4G11A 4MGIE 2KMAA 4I6PA 5E6NA 2L8JA 4CO7A 4I6NB 4AWJA 2G45B 5CX3A 1WZ3A 3MHSD 4DBGA 1P98A 3DBSA 1IYFA 2BYVE 1WY8A 3UF8A 1EUVB 4NAWA 4NJ7A 2AL6A 3Q3FA 2C7NB 3AU5A 1E8WA 2LVPA 4F7ZA 2QHOA 3ZRCA 4MEMA 2KFJA 3PLUA 3UQAA 1ZGUB 3VFKA 2DZJA 2EKEC 4GSWA 4HJKA 3M62B 1JRUA 1XQQA 2DX5B 1WMHA 1RFAA 4HPMB 4II2B 4KDLB 4OVUA 4HDQA 4PYUA 4GIVA 1TTNA 2WWZA 1WRDB 4F1SA 2C9WB 2PEAA 2REXA 4KZ0A 4ZYNA 2ZCBA 1TGZB 2KMCA 3P2BA 3ZDMC 2O6VB 1G6JA 2KXJA 2OJRA 2XK5A 1S3SG 2FIDA 2PE6B 2LASA 3H7PA 3LDZE 3OJ4B 5CHVC 1EF1A 1TZ1A 3DVNV 4HDOA 1CMXB 3QQ8B 4N9F4 4TKNA 3RT3B 1WGYA 2ZCCA 5JZEB 1WX7A 2Y5BB 4WWNA 2KC2A 1GJZA 3DBRI 3QARA 4K7SA 1RAXA 2BF8B 3QA8A 2A5UA 3L16A 4ZRIA 3OAWA 2DZKA 1BT0A 1WM2A 2LD9A 2KLGA 3L10B 3PHXB 2V1YA 4XC2A 4IW0A 3JSVA 4BBNF 3APCA 1WGDA 4F8CB 2ZVNA 4JQWC 1RRBA 4JLCA 3T9LA 5G2NA 2KTRA 1Q1OA 2IY0B 3DQVA 3NS8A 2JRHA 4ICVA 4ANXA 4RM8A 2NPTA 5C23A 2JF5A 2D10A 3X0WA 3PSEB 3UQBA 2ASQA 3PGEA 4YL8A 2IO3B 2M8SA 2FCMA 2DZMA 3V6CB 2R2QA 1H8CA 1M94A 3ZUNA 2ZNVB 2IZVB 3PPAA 4JIOU 4GN1A 4FBJB 1Q5WB 1V80A 5DPSA 3QAQA 3IBEA 4NY0A 4RMAA 4WAAA 2AYOB 2DYBA 1HE8A 2NS5A 2XBBC 2ZNVC 4A3OA 5AZHA 4HPLB 2L00B 3GOEA 4DHZE 1E7UA 3PLVA 3ZO5B 3CF6E 2LXCA 1ZKHA 4M0WB 5GMVA 5D2MB 3RULA 1KLVA 4WQOB 3RZWC 3O65B 2KTRB 1WE7A 3VH3B 5J17A 2KDEB 2KTFA 4W9IA 4DDID 2LWPA 2HJ8A 4ANUA 2RGFA 2BKRB 3QC8B 2JZZA 3CSFA 3B08A 3KVFB 2KDFB 3KW5B 1F9JA 1UBQA 1E7VA 3JW0X 1LXDA 4KZCA 1Q0WB 5D94A 1X1MA 2MBOA 3UINB 3CSTA 1XD3B 3A4SC 4EZKA 3U30A 3JYUA 4EEWA 1UGMA 1WGGA 2JPHA 1IPGA 5BO4B 2LJ5A 5CHFA 1V86A 4HCNB 4AJWA 4J6IA 1WXSA 4MJSB 4G3XB 2KZRA 3H7SA 2LRWA 2ZZPB 3HM3A 3PS6A 5IA7A 4DWFA 2Z0DB 2CU1A 4FJVB 2BYFA 1TBEA 3MTNB 4TQ0A 5L95C 3IHPC 4TUUA 3UIPB 3TCAA 1Z5SB 3A1QA 4A3PA 4ZRJA 2L0FA 3I3TB 3M95A 1IP9A 2K25A 4MSQB 4EZLA 2CR5A 5CHWA 4LDTD 3RYTA 4PS7A 1WX9A 1YJ1A 2KANA 3ALBA 2IO2B 3W1SC 2ZPNA 3VVWB 5IAAC 1V49A 4KIKA 4FJZA 2CHXA 1AARA 2KX3A 3VAWA 3VUYA 3ZLZA 2EMSA 3U8ZA 3ONSA 2D3GA 4KDIC 4G0NB 4AP4C 1QZEA 1V9JA 1WH3A 2GBNA 3QHTA 1YQBA 3A33B 4IWQA 2RD0A 1Y8RC 2G3QB 4K81A 4W9CA 3DDCB 3QX1A 3R66C 4GDKA 5CTRC 3V6EB 3SDLC 3OLMD 2UYZB 3SD5A 2Z59B 1S1QB 3IFWB 4BVUC 4GDLA 3H1UA 4NPNA 1V6EA 3NY5A 1ISNA 1R4NI 1P1AA 2KJHB 3V61A 2IYDB 5D7GA 2KK8A 2KD0A 2BWES 1H4RA 5D6JB 2KWUB 2RPQA 4ICUA 2FUHB 3B0AA 1SGHA 3ZDTA 1YIWA 2O2VB 4IUMB 1A5RA 2CS4A 3DVGX 2LRUA 1GC6A 3A9KA 3ZIMA 1SIFA 1SE9A 4FADA 1KOTA 1T0YA 1WZ0A 2CHWA 2MW5A 3NZSA 4IM0A 4PS3A 1WM3A 1Z2MA 4IM2A 1WJNA 3ML9A 3QJZA 3N30A 3PHWB 2JY6A 4W9FA 4IM3A 3PRZA 3PT2B 4WWPA 2M0XA 4XX5A 2IO1B 3ZVVA 2MBBB 3GZNI 2NVUI 4BOSC 3V62A 1NI2A 4MDKE 2KHWB 4NAWB 3QIJA 3A4RA 3RCZA 1WGHA 3WALA 4MGYE 1OEYA 3L08A 4HK2A 2J7QB 3WAMA 4ANVA 4WWOA 1WXMA 2KDIA 2L0TA 1WR6E 4IC7B 5JHBA 2PE9A 4IWPA 3V60A 1KJTA 3APFA 3KUCB 4ZRKA 1WMHB 4ZDVA 2D2QA 2GBRA 1K8RB 3JVZX 2KWCA 2I1JA 2BGFA 4JL9A 3BY4B 1ZW7A 5AEKB 2N4FA 2KJRA 3RZFA 3VHTC 2XK5B 2Z0EB 4FHKA 3ZTCA 1UBIA 2JXXA 2DENB 4BBNC 2BKFA 3Q3JA 5E6PA 3H7PB 4EZJA 1YD8U 2RSUA 4MH0E 2KFKA 2MP2A 1L2NA 2NBUA 3CMMB 4K7WA 4BFRA 2M4NA 2L76A 1L7YA 1PQSA 2FNJB 2KNBA 4K7UA 3X23A 1P9DU 2K1FA 1LQBA 5AZFA 1E8XA 4NQKE 4EFOA 4GU2A 4DDGD 4LDTB 4OVVA 4KV2A 3HIZA 3N32A 3D32A 3M63B 4B95A 2J0MA 3PVLA 1WR1A 4DHZB 3JSVB 3PREA 2GBKA 3ENEA 4HCPB 3KUZA 1LFDA 2AEHA 3OJ3A 2GMIC 2NPTB 3EHVA 3KUDB 4GGQA 4M8MA 2J0KA 2KX0A 2IO0B 2WDTB 3L13A 1WE6A 4NJ6A 4IG7B 4X57B 2JVCA 1UELA 2KJ6A 4MGZE 3ZRFA 1WJUA 5AZGA 2JWZA 2O6VD 2GBMA 2C7HA 2ZEQA 5G55A 3HK0A 1E8YA 3ZW3A 2MP2B 4URKA 2K6QA 4AOFA 3NOBA 2BWFA 3IVFA 3B1LX 2KQ7A 2N7DA 4PYZA 3N3KB 4NQLB 2KC1A 2V4LA 2KQSA 5DPWA 2D07B 2N1WA 2HD5B 3ECIA 3T8MA 1WXVA 3WA0A 2PJHA 4BKSD 4KSKC 3PZDA 1U4AA 2MBQA 4FJYA 1WYWB 2PPHA 3RUIB 2N9EB 3PTFC 2JUOA 3WAPA 4FULA 4DHJD 2LGDA 1NBFC 2WX0A 3TBLD 2BYEA 2FAZA 2L7RA 4LJOB 3AXCA 3VH4B 4TV3A 1OEYJ 4A20A 3C0RB 4K1RB 2DHZA 2C60A 2CHZA 4E71A 4B9KA 2J0JA 1WJ6A 4KSLC 3HHMA 3EC8A 2K39A 2HE7A 2G4SA 5TR5A 3KH0A 1V5OA 3A9JA 4P7IA 3VUXA 2CKHB 2JT4B 5DCNA 3VTWA 2MCNB 2ZJDA 3PV1A 5DPRA 2VRRB 1RLFA 4W9HA 3TMPB 2K8CA 2KLCA 1OGWA 1J19A 4G50A 1C1YB 3WIMA 2N9XA 3A1QB 2MRPA 2MX2A 3DOWA 3DPDA 4AJYB 3QWZB 2YLMA 5LLIA 3VTVA 5E6OA 3K9OB 5JHAA 4PS8A 3S2AA 2LUEA 4W9JA 4EUTA 3AI5A 2MLBA 1MG8A 2O6VA 3APDA 4WJPA 2FCNA 4KIKB 1OTRB 3DBLI 4RM9A 3EFUA 1E5WA 3SHQA 4HXDA 2KWVB 3AULA 2MQJA 3ZTDA 4I6LB 3A9JB 4B6WA 3DVNU 4DXAB 1E90A 2K6DB 3VXWA 3L54A 2JRIB 1V81A 4GDKB 4BKSA 5L83A 5JH5C 1GUAB 2ZVOA 4GMVA 1I35A 3QCAA 2W9NA 3M3JA 3ZNZB 2YVCA 4GDLB 1UZXB 1WJ4A 1YX6B 3WANA 1WXAA 3ML8A 3TJPA 3WAOA 3LJ3A 2UWQA 1R4MI 5EDSA 2KOXA 3ZNGC 3DVGY 1J0GA 3ZKJC 4MM3A 2NR2A 1GC7A 1WI0A 1P3QU 2DAJA 4W9DA 2R2OA 4KVGB 3A9KB 3K9PB 4HWIB 1GNUA 5KHOA 4LCDE 2NCNA 4XZ4A 1VCBA 4WJQA 4CHKA 2FCSA 3NHEB 3VDZA 3RD2A 4BKGA 2OOBB 4HVBA 1VD2A 3UGBB 2KN5A 2RR9A 1J8CA 2M17A 3TL5A 2K8BA 4DHJB 3L17A 1V5TA 2M1MA 4EKUA 5J2RA 4BKTA 4HLEA 1YX5B 3UIOB 2C7MB 2XEWA 1WIAA 4FLHA 2IBIB 2G4DB 2N1VA 1I42A 3QK0A 4FN2A 1V2YA 2AWTA 4LJPB 2BPSA 4ASWC 2KVRA 2GBJA 2MBHA 4II3B 3EECA 5DPTA 2A4ZA 2LVQA 1EO6A 4W9LA 2B3AA 4WJOA 4JGHB 2V3SA 4MELA 3TIXA 4FA6A 2K8HA 3R3MA 2DYMA 4W9GA 4E74A 4DK5A 3VUWA 5HKHA 2GOWA 3U7DA 3ZNID 2AL3A 4AUQC 2N9PC 2LGYA 5KHQA 1KM7A 2I1KA 1P0RA 3R7QA 2L3ZA 1C3TA 3R7RA 1OQYA 4IWOA 4MJSA 1GG3A 4BOZB 2WYQA 2LZ6A 4ANWA 2KFKB 3MJWA 5J18A 2L05A 4W9EA 3W1SA 2JZ3B 4M8NA 2KO3A 2WX1A 1NDDA 3PRPB 4GXBA 5C1ZA 2FIFA 2MSED 4CYEA 2D11A 1WGRA 4TQ1A 2IY1B 3AU4A 5FR6A 3VTUA 4EOYA 1E8ZA 3PRMB 2DZIA 2MA9B 2ZPYA 1XT9B 3BINA 4GB9A 3HM6X 1WFYA 2NBVB 3DBHI 4MGKE 4E3CA 3L0WB 1FXTB 2MBEA 4NNJB 2N7EA 4W9KA 2LGXA 2EMTA 2HTHA 1WX8A 5LXIB 1WF9A 1D3ZA 3NZUA 1UD7A 3H9DA 2C5LC 1LM8B 3KYCD 4FHJA 4MSMB 2DYOA 1EF5A 5LXHA 3VQIA 4GOCA 2LXAA 2DAFA 2MWSB 2FCQA 3IG3A 2KDBA 3KYDD 2NBWB
chains in the Genus database with same CATH superfamily
3W1YA 1QOGA 2O2VA 2KMAA 2QIEB 5E6NA 2RDBC 2YEPF 3HVDA 5CX3A 1MI0A 1P98A 3DBLB 2GB1A 4NJ7A 3Q3FA 3AU5A 1E8WA 3UQAA 2KFJA 2DZJA 2EKEC 2PLPA 1JRUA 4O1NA 1P7FA 4HPMB 1FRDA 4II2B 4PYUA 2WWZA 4F1SA 3MHZA 3Q3NC 3I5JC 1ZXIA 1TGZB 1QOBA 4N58A 1JWAD 3ZDMC 1PDXA 2KXJA 2XK5A 2LASA 3OJ4B 1C4CA 1TZ1A 4HDOA 1TZOA 4Q2JA 5EE3A 3U4EG 1CJEA 2Y5BB 1SE2A 2KC2A 4WWNA 4K7SA 2BF8B 3L16A 1JWMD 2DZKA 2E3TA 2G9HD 2WXLA 3TSSA 3PHXB 4BBNF 4F8CB 3APCA 1FCCC 3KWLA 4JLCA 2KTRA 3HUIA 2HTME 2JRHA 4ICVA 5C23A 3PSEB 3PGEA 1A70A 4N6EB 2DZMA 1HZ6A 2R2QA 1M94A 3ZUNA 3PPAA 2IZVB 1FNUA 4GN1A 1Q5WB 5DPSA 3IBEA 4RMAA 1FXAA 1MVKA 2M0AA 2JU6X 3GOEA 4DHZE 4IKGA 4M0WB 2LXCA 2LUMA 1DYQA 3GE3C 4XGAB 1YNTE 3AE9B 2LWPA 2KN4A 3EFCA 4ANUA 2RGFA 3N9YC 4C56C 1E7VA 3JW0X 1LXDA 2K5PA 5D94A 2DNFA 1X1MA 1FRRA 4EZKA 3JYUA 1UGMA 1WGGA 2JPHA 1IPGA 5BO4B 2WDVB 4AJWA 3Q8AA 4G3XB 1L4DB 2IGHA 1WGKA 1Z5SB 4YTMB 3M95A 1IP9A 4EZLA 2CR5A 3I9V1 3ALBA 1EU3A 1V49A 1GB1A 2CHXA 1PGAA 1AARA 2EMSA 3NUHB 4G0NB 1QZEA 3QHTA 1YQBA 3BYYB 3A33B 2NMQA 3DDCB 3R66C 2PW9A 2H89B 3OLMD 1FIQA 2WU2B 2KJHB 5D7GA 2KD0A 5D6JB 2KWUB 4ICUA 3B0AA 2JYEA 1LGRA 1SGHA 3ZDTA 2INCC 3N1ZC 4IUMB 3AH7A 2LHEA 2J42A 1GC6A 4LNFA 1KOTA 2CHWA 3ML9A 3N30A 3PHWB 2M0XA 1R4MB 4XDDA 3ZVVA 4BOSC 3IAS1 4PT5A 2LGSA 4NAWB 2G1EA 3RCZA 4BAXA 1UWMA 4MGYE 1RWSA 2D3AA 4WWOA 1C4AA 1WXMA 2KDIA 2L0TA 1JWBD 3V60A 3APFA 3KUCB 4ZRKA 2D2QA 2GBRA 1TS4A 2QDFA 4JL9A 1TKGA 1SIJA 5G5GA 5AEKB 2KJRA 3RZFA 1HXYD 5H8YE 3VHTC 1UBIA 3Q3JA 2RSUA 2KFKA 2NBUA 3CMMB 4D2KA 4BFRA 1PQSA 2FNJB 1I4XA 2V3PA 5BMHA 5AZFA 4WQMA 4GU2A 4DDGD 1WXQA 2ZW1A 4KV2A 3HIZA 3M63B 3PVLA 1WR1A 4DHZB 3JSVB 1GAQB 3OJ3A 4RF1A 4M8MA 2J0KA 2WDTB 2RMMA 4KX6B 4MGZE 4ACFA 2O6VD 1ZPSA 2C7HA 1RM6C 3AB5A 3B1LX 3N3KB 3VR9B 3RNEC 2IDYA 3TEWA 3WA0A 4BKSD 4KSKC 1U4AA 2D3CA 3PTFC 4DHJD 4FULA 1I4RA 1NBFC 2FAZA 2V3NA 2FBWB 3VH4B 3OWEB 5BYSA 4A20A 4HROA 2DHZA 2QC8A 4E71A 2J0JA 4KSLC 3EC8A 2VH2A 2K39A 4P1BC 2G4SA 3R2IA 3A9JA 3RNCC 2L1AA 2CKHB 5BYQA 4AQ7A 5DCNA 3AE3B 4TSSA 2L32A 3TMPB 1OGWA 1C1YB 3WIMA 2N9XA 3A1QB 3QWZB 1JROA 3K9OB 2LUEA 4W9JA 5HG2A 1NI3A 3RN9C 2LMCA 5HFYA 3FKYA 2MJDA 1HTOA 4I6LB 4NAMA 2K6DB 1F2RI 5JH5C 2ZVOA 4GMVA 2K0PA 3QCAA 1L6UA 2E6XA 2INPE 4HKQA 3ML8A 3L4PA 2UWQA 5EDSA 3DHIC 3DVGY 1AYFA 1PUTA 4WH4A 5H92C 5D3DA 1TS2A 4W9DA 5G5HA 4LCDE 1VCBA 1ZDXA 3SFDB 3VDZA 3RD2A 2OOBB 5BMGA 2PKOA 3O13A 1C79A 2K8BA 1NENB 2XEWA 1I42A 2G4DB 3QK0A 3MJ5A 1KRHA 2D5GA 3TEXA 4II3B 3EECA 3FC4A 2Z8LA 2LVQA 4W9LA 1IGDA 4JGHB 4DK5A 2BB6A 3U7DA 3V3XA 2BT6A 3FILA 1C3TA 2N7JA 4MJSA 2LZ6A 2FUG1 1NDDA 4GXBA 4HPPA 1D5XC 2MSED 1AN8A 4MT5A 3VTUA 2GLSA 5T8IA 3PRMB 1EU4A 2MA9B 3KLSX 4IDIA 2ACZB 4MH8A 1FPYA 2NBVB 4E3CA 3L0WB 1FXTB 1T0QC 2N7EA 1WX8A 2JYTA 2K22A 1HEZE 4OZBA 4MSMB 4GOCA 1I4GA 3IG3A 1C77A 2VZKD 1KH0A 1VZ8A 3SU8X 1JWSD 1UF0A 2LEKA 4MGIE 2PMVA 4CO7A 2M56B 2KMMA 2SAKA 3MHSD 3DBSA 1ENFA 4C4VA 4FXCA 2BYVE 1VLBA 3UF8A 1TS5A 2AL6A 2WS3B 2LVPA 1ZGUB 1OQQA 3VFKA 4GSWA 2V0GA 3M62B 3GZNB 1XQQA 1WMHA 1RFAA 4K3CA 4GIVA 1M4VA 2PEAA 2REXA 3GE8C 1B9RA 3GB1A 2KMCA 2O6VB 2OJRA 3H7PA 3LDZE 5CHVC 1CMXB 4TKNA 3RT3B 1WGYA 2MH7A 1XLNA 5JZEB 2J52A 1RAXA 2A5UA 5FKAC 4XC2A 2V1YA 1JW9D 2ZVNA 4JQWC 3T9LA 5G2NA 1C4PA 2WXMA 2BYTA 2KACA 2XNAC 3DQVA 3NS8A 2D10A 3NVZA 3X0WA 3AEAB 2IO3B 2M8SA 2FCMA 1CQVA 2D3BA 1H8CA 2V9HA 1R7SA 4NY0A 4WAAA 2K3UA 2AYOB 3ZO5B 1ZKHA 5GMVA 5IP4D 4WQOB 4HRSA 3RZWC 2KTRB 1WE7A 1N61A 1VRAB 3C19A 1ROEA 2BKRB 3QC8B 2JZZA 3CSFA 3KVFB 3KW5B 1F9JA 3UINB 3CSTA 1XD3B 5IOIA 5I4DA 1JCKB 1E7PB 1WXSA 4LTUA 3MC8A 1FEHA 2KZRA 3HM3A 1BUIC 3W5VB 1VJKA 2Z0DB 4UDUC 4FJVB 2BYFA 4TQ0A 3IHPC 1ET6A 1DGJA 3PZ7A 1MHHE 5CHWA 3RYTA 2KVZA 2ZPNA 3VVWB 2N9KA 5IAAC 1AWDA 4FJZA 3MFGA 1ACCA 1V9JA 2GBNA 4IWQA 1IBXA 1F0ZA 1SJED 1Y8RC 2G3QB 2BW2A 3V6EB 3SDLC 4BVUC 2PVGC 1I7HA 3NY5A 3RNAC 5C2TB 1A5RA 2CS4A 2NTSA 3A9KA 1ZUD2 4FADA 1SE9A 4P16A 1GPXA 3E56A 5FK9C 4IM2A 5EE1A 1WJNA 4IOIE 4XX5A 4IM3A 3PT2B 1NYQA 2IO1B 2MBBB 2NVUI 3VRAB 1NI2A 1STEA 3QIJA 4M00A 2JX5A 1K53A 3L08A 3BZDB 4ANVA 1WR6E 1T0SC 3IT4B 4IWPA 4B0EA 4S0RA 4DXGA 1K8RB 3JVZX 3BY4B 1ZW7A 4XYCA 2Z0EB 3ZTCA 4BBNC 2ZW0A 2QSDA 2MP2A 1N5WA 2M4NA 1NEKB 1P9DU 2CU3A 4EFOA 4NQKE 4LK0M 2VZKB 2IJ0A 3N32A 1V1OA 2J0MA 3LXFA 5BMIA 2GRIA 3KWVA 4HCPB 1C9FA 1N60A 1V1PA 3KUDB 2NPTB 3EHVA 4GGQA 2J4XA 4NJ6A 4IG7B 4X57B 1UELA 3IT6B 2ZEQA 3HK0A 4AOFA 3AE8B 4HKZE 4NQLB 3N1XC 2KC1A 2KQSA 1N62A 3ECIA 5HHDG 2GI9A 3RUIB 2PPHA 2JUOA 2OEDA 2L7RA 4LLGM 2KT7A 3TEYA 2DLBA 1E6EB 4K1RB 4ZRQA 4B9KA 3HHMA 1KLGD 1OQRA 2WNMA 1L5PA 1MFWA 3RFZB 1JWUD 3KH0A 1JQ4A 1D4BA 1MHXA 4ZOHC 2YEPB 2JT4B 2WXKA 2ZJDA 3MP9A 3LB8C 1RLFA 1YN5A 1TY0A 2KLCA 2MJ3A 2KWDA 3DOWA 4AJYB 5E6OA 3S2AA 4EUTA 1MG8A 3Q14C 4KIKB 3E9SA 3AULA 3ZTDA 3A9JB 4B6WA 2LGIA 3DVNU 4DXAB 2JRIB 4GDKB 1GUAB 3H8HA 1WWTA 4KGSA 3AM9A 3M3JA 4RGOS 2YVCA 4GDLB 1UZXB 1WJ4A 2WDRB 1FFVA 1WXAA 1FCLA 1QT9A 5TSSA 2XN9C 3LJ3A 1TJEA 3AEFB 2NR2A 2WXJA 1P3QU 2DAJA 2WQYB 1EM7A 3K9PB 5D3IB 3ZQ4A 2M19A 2SEBD 1RYJA 4WJQA 3NHEB 4BKGA 2R61A 2LJIA 2KN5A 3UGBB 4M0WA 3TL5A 1ZE3D 1YX5B 1TIFA 3UIOB 2C7MB 4FLHA 1WIAA 4NZLB 4FN2A 4ZYSA 4ASWC 3RPFC 4C00A 2MBHA 1EO6A 4MELA 3TIXA 3Q8BA 4FA6A 3R3MA 2BQQA 2GOWA 3ZNID 1J7BA 1T6BX 3DWGC 1SE3A 2I1KA 3BK2A 2L3ZA 3R7RA 4ANWA 3MJWA 2JQRB 4YSXB 4M8NA 5IKCM 2FIFA 4YT0B 4CYEA 4EE2A 1KFYB 5FR6A 3EGRA 1L0YB 1E8ZA 3Q8CA 2ZPYA 4GB9A 4USAA 3RNGC 3DBHI 4MGKE 1F77A 1T3QA 2MBEA 3NJTA 4ZHPA 2EMTA 2HTHA 2WXGA 2LHDA 3NZUA 2C5LC 3KYCD 1QF6A 2WXOA 2BTEA 2LXAA 2DAFA 2MWSB 1SF0A 2NBWB 2HDEA 4L2YA 2LVOA 3DCGA 3H6NA 4XWWA 1NVID 1UH6A 2QEJC 4CQNA 4I6PA 2L8JA 4US9A 4AS1A 4AWJA 2G45B 3ABVB 1I4QA 5AUKA 3B9JA 1WZ3A 4DBGA 1IYFA 3RNFC 2PIAA 2WXRA 1V8CA 4OZCA 1EUVB 4NAWA 2QJLA 3RMKC 1UUPA 1XCTL 2CJNA 2NTTA 2WXQA 4OW0A 4P1CC 1DOYA 1EWYC 3BVZA 1T5XD 4HJKA 2DX5B 3ZXVA 1FM0D 4HDQA 1TTNA 1WRDB 3NVWA 2ZCBA 1Y56A 1G6JA 1HZ5A 1S3SG 1N63A 2CJOA 2FIDA 2PE6B 3AEDB 3DVNV 4N9F4 2Y5PA 4C4VB 1C76A 1GJZA 3QARA 3QA8A 2EKIA 1YJJA 3OAWA 1BT0A 1WM2A 3P42A 4MACA 3L10B 4IW0A 3JSVA 1WGDA 3GP7A 2IY0B 4ANXA 2PVOD 2JF5A 2IGDA 4YSYB 4YL8A 1Q10A 1VR9A 2ZNVB 4JIOU 1XCQL 2V4IB 4FBJB 1HE8A 2XBBC 4RCOA 2JWUA 4L23A 3CF6E 3HVZA 3O65B 3VH3B 5J17A 2KDEB 2KTFA 2WXPA 5IN7A 4DDID 3Q3OC 2HJ8A 1ZXHA 4JE3B 3B08A 2WXNA 4RGTA 1UBQA 3AE1B 4KZCA 2BBCA 1I4PA 3B2GA 2MBOA 1WSPA 2HJ1A 4EEWA 5CHFA 1V86A 1YMHE 1ZDVA 2LRWA 2ZZPB 3PS6A 4DWFA 2I2YA 3NS1A 3BK1A 3AECB 3UIPB 3TCAA 3A1QA 4A3PA 2L0FA 3I3TB 2K25A 3W9CB 3W1SC 2IO2B 4HJGE 2KX3A 1FMAD 2D3GA 4AP4C 3N20C 2RD0A 1D3ZA 5CTRC 3QX1A 4XE0A 1CK1A 3SD5A 2Z59B 1S1QB 3IFWB 2UU7A 3H1UA 1V6EA 1ISNA 3V61A 2IYDB 2KK8A 2BWES 1FO4A 2RPQA 3AEBB 2FUHB 3R2TA 2O2VB 3DVGX 3CWIA 2LRUA 1SIFA 3ZJUA 1T0YA 4IM0A 4PS3A 1Z2MA 2BS3B 3QJZA 4W9FA 3PRZA 4WWPA 3NZ3A 4C80A 4RF0A 1DOIA 1YQ4B 3RI7C 2J53A 4LNKA 3AV8A 2WXFA 3A4RA 1QILA 3WALA 1TY2A 2J7QB 3WAMA 5JHBA 4IC7B 1C78A 3VRBB 2PE9A 3V05A 1KJTA 2KWCA 2Y3AA 2I1JA 4YSZB 1PYWD 1WRIA 2BGFA 3BVGA 1K51A 4YTNB 4OVZA 4YWGG 2XK5B 1IUEA 2JXXA 2BKFA 5E6PA 1YD8U 4MH0E 1L2NA 2AQ1B 3P4QB 4WIPA 2L76A 1SJHD 2KNBA 4OZAA 3X23A 2IPKD 1SXTA 3NRZA 4LDTB 4US8A 1JRPA 3AEGB 4B95A 1P7EA 3PREA 3EUB2 1YN4A 3ENEA 3KUZA 1LFDA 3EA6A 2N0SB 2GMIC 4C7YA 2BS2B 2KX0A 5BYRA 3L13A 1WE6A 2JVCA 1VDVA 2KJ6A 1WJUA 5AZGA 2JWZA 5G55A 3ZW3A 1E8YA 2Q5WD 2MP2B 2KQ7A 1EWCA 1MJDA 5DPWA 3ZJVA 2D07B 1D5ZC 2N1WA 3T8MA 2PJHA 3PZDA 4WWMA 2MBQA 4FJYA 1WYWB 2IGGA 2N9EB 3WAPA 2LGDA 2WX0A 4JPSA 1KTKA 3N1YC 3AXCA 3MC9A 1IGCA 1UWXA 4TV3A 3ETRA 1MPEA 1GB4A 2MHJA 2CHZA 1WJ6A 2RDHA 2K9XA 4S17A 5TR5A 4PK1A 2MCNB 4TMAB 4RFBA 2K8CA 1J19A 3C8YA 4G50A 4A6QA 2MX2A 3DPDA 1L0XB 2X8XX 2YLMA 2W82A 4PS8A 1QKZA 2BS4B 4DXFA 2MLBA 2O6VA 2WGSA 3APDA 2FCNA 1OTRB 4RM9A 4LNOA 3BIID 3SFEB 1E90A 3VXWA 3L54A 4BKSA 1V81A 2W9NA 1BMLC 3WANA 3WAOA 3Q3MC 1E9MA 1R4MI 2KYWA 2KOXA 1TYGB 3U7ZA 1UGJA 4MM3A 1WI0A 1XXGA 1XEEA 2R2OA 4KVGB 1TS3A 2NCNA 4XZ4A 2FCSA 1VD2A 1J8CA 1V5TA 2M1MA 4EKUA 3TEZA 5J2RA 4KKIA 4P6VF 4HLEA 2KQ4X 2IBIB 2N1VA 2WXHA 4LJPB 3P4PB 2BPSA 2KVRA 4GLSC 1HA5A 2A4ZA 2B3AA 2PTLA 4W9GA 2DYMA 3Q2AC 5HKHA 2OJWA 4XDCA 2AL3A 4AUQC 2N9PC 2LGYA 3R7QA 4HEA1 1P0RA 4IWOA 2WHIA 1GG3A 1CZPA 3T3NA 2KFKB 5J18A 3Q6BA 5JXVA 3W1SA 2KO3A 2WX1A 3R8BA 2INNE 2D11A 1WGRA 4TQ1A 2IY1B 3AE7B 3AU4A 1FXIA 3BINA 4N59A 2AX5A 1QOAA 3GS2A 1JALA 1QLBB 3BYTB 5LXIB 3AN1A 1WF9A 1UD7A 3H9DA 1YN3A 3VQIA 2L83A 1SB3C 2FCQA 3KYDD 1E10A 4KGTA 4WJNA 3ZNHB 2KKCA 4NJCA 2LI5A 4G11A 4I6NB 2AQ2B 3UI3A 1AW7A 5IO9A 3Q69A 1WY8A 2C7NB 2BVCA 1YQ3B 2QHOA 3ZRCA 4MEMA 4F7ZA 3PLUA 1J7CA 3LYYA 3FAHA 4YTPB 2WP9B 3AE5B 4KDLB 4OVUA 1L4ZB 1D5MC 2C9WB 4KZ0A 1N5XA 3VR8B 3P4RB 4ZYNA 3P2BA 4RNAA 5LNK1 1EF1A 3CIRB 3V6CB 2QCZA 3IAM1 3QQ8B 4LNNA 2ZCCA 2JXTA 3AE2B 1WX7A 2RPVA 3DBRI 4M01A 2FE8A 3I63C 4ZRIA 1YJIA 4L1BA 2LD9A 2KLGA 4R3DA 4QAYA 1ZOYB 3T3OA 1RRBA 1Q1OA 1UNSA 4RM8A 2NPTA 2RDGA 2Y5CA 3UQBA 2ASQA 3W2DA 2LFIA 2ON8A 2W54A 1V80A 5EE9A 3QAQA 4A55A 2DYBA 2NS5A 1MG4A 2ZNVC 4A3OA 5AZHA 4HPLB 2L00B 3U52E 1E7UA 3PLVA 5D2MB 3RULA 1KLVA 2WXIA 2KDMA 4W9IA 5C3JB 1LO5D 4ITKA 2KDFB 2VH1A 4ARIA 1E0ZA 1DOXA 2TSSA 1Q0WB 3TUOA 3B2FA 3A4SC 5HI1A 4A8XC 3U30A 3MC0B 2LJ5A 4WAFA 4HCNB 3DWMA 3FILB 4J6IA 5FR3A 4C7ZA 2ICIA 4MJSB 5EE0A 3H7SA 5IA7A 2CU1A 3AEEB 1TBEA 3MTNB 5L95C 4TUUA 2N9LA 3U2SC 4ZRJA 4MSQB 2W3SA 4LDTD 4PS7A 1WX9A 1XO3A 1YJ1A 2KANA 2BB5A 1YOVB 4KIKA 4OHJA 1PGXA 4K3BA 3VAWA 3VUYA 3ZLZA 3W5UB 3U8ZA 3ONSA 1SSNA 4KDIC 3SR6A 1WH3A 4K81A 4W9CA 4GDKA 4RGNA 1D6EC 1K50A 2UYZB 5GXGB 4GDLA 4NPNA 1F1HA 1R4NI 1P1AA 3AE4B 2ONQA 1H4RA 3Q8FA 1HQRD 1KLUD 1YIWA 4KGRA 3ZIMA 1WZ0A 2MW5A 3NZSA 1F2RC 1WM3A 3AMZA 2DWQA 2JY6A 4KKJA 1QOFA 4YXDB 3GZNI 3V62A 4MDKE 2KHWB 4JX1C 3I57A 4H2AA 1WGHA 2JZPA 1NYRA 1OEYA 4HK2A 4WURA 3DBRB 4JWUC 4B0MA 1XF5L 1WMHB 4ZDVA 4REZA 2WU5B 2N4FA 2JSVX 1TKYA 4FHKA 2DENB 4EZJA 3H7PB 2W55A 2WLBA 4K7WA 1TT5B 1L7YA 3IXSA 4K7UA 1FD6A 2K1FA 1LQBA 1E8XA 4OVVA 2QILA 1I4HA 2KAJA 3D32A 1SE4A 3NVVA 3BWUD 2GBKA 4ZRPA 3WCQA 2AEHA 2H88B 1K52A 2AQ3B 2IO0B 5MPOA 3NVYA 3ZRFA 1QQRA 2GBMA 4URKA 2K6QA 3NOBA 1XLQA 2BWFA 3IVFA 1ZP0B 2N7DA 2WDQB 4PYZA 3DBHB 4M02A 3J9CA 2X38A 2V4LA 3ZJTA 2HD5B 2MEKA 1WXVA 3ZGZA 3TBLD 2BYEA 3DHGC 4LJOB 4A90A 2B76B 1PGBA 1OEYJ 3C0RB 2EELA 2C60A 2DBYA 3SEBA 1OFFA 1BXTA 1L6VA 3HRDD 2HE7A 1KF6B 1SBBB 3P4SB 1V5OA 1F52A 4P7IA 2W3RA 3VUXA 1ET9A 3VTWA 4ZHOA 3PV1A 5DPRA 3RNBC 2QMTA 2VRRB 4A9AA 4W9HA 3AE6B 2MRPA 5LLIA 3VTVA 5JHAA 3Q8EA 1R4NB 3AI5A 4WJPA 1FFUA 3DBLI 1HTQA 3PO0A 3EFUA 3KQ4A 1E5WA 4J3OD 3SHQA 4HXDA 1FNVA 2KWVB 2MQJA 1FNWA 1VZ7A 1TKEA 1IBXB 4RH6A 5L83A 1XLPA 1I35A 1WYGA 2I38A 3ZNZB 1YX6B 3TJPA 4BZAA 2INDC 4JWSC 3ZNGC 1J0GA 3ZKJC 1GC7A 1VZ6A 4ARCA 2L52A 4RGMA 3A9KB 4XWTA 4HWIB 1GNUA 5KHOA 1V97A 4CHKA 5E6JA 4HVBA 2RR9A 2M17A 3P63A 4DHJB 3L17A 1GOZA 1JMLA 4BKTA 4LNIA 1XLOA 1V2YA 2AWTA 1RFKA 2GBJA 4DQOC 4MM3B 5DPTA 4WJOA 2V3SA 2K8HA 1PFDA 4E74A 1L0VB 2MJEA 3VUWA 1B1ZA 5KHQA 1KM7A 1OQYA 3PZ8A 1T0RC 2WYQA 4BOZB 2L05A 4W9EA 2JZ3B 3PRPB 5C1ZA 4EOYA 2DZIA 3DHHC 3NG0A 1XT9B 3ZYYX 3HM6X 1WFYA 1V1PB 1ESFA 4NNJB 4W9KA 2LGXA 3URYA 2OHFA 3ZXRA 5AUIA 3P1MA 1N6ZA 1LM8B 4FHJA 2DYOA 1EF5A 5LXHA 1J7AA 2KDBA 1SEBD 3OG5A 3BVMA
chains in the Genus database with same CATH topology
3W1YA 2LVOA 4WJNA 3ZNHB 3DCGA 3H6NA 2KKCA 2O2VA 3SU8X 1UH6A 2LI5A 4G11A 4MGIE 2KMAA 4I6PA 5E6NA 2L8JA 4CO7A 4I6NB 4AWJA 2G45B 5CX3A 1WZ3A 3MHSD 4DBGA 1P98A 3DBSA 1IYFA 2BYVE 1WY8A 3UF8A 1EUVB 4NAWA 4NJ7A 2AL6A 3Q3FA 2C7NB 3AU5A 1E8WA 2LVPA 4F7ZA 2QHOA 3ZRCA 4MEMA 2KFJA 3PLUA 3UQAA 1ZGUB 3VFKA 2DZJA 2EKEC 4GSWA 4HJKA 3M62B 1JRUA 1XQQA 2DX5B 1WMHA 1RFAA 4HPMB 4II2B 4KDLB 4OVUA 4HDQA 4PYUA 4GIVA 1TTNA 2WWZA 1WRDB 4F1SA 2C9WB 2PEAA 2REXA 4KZ0A 4ZYNA 2ZCBA 1TGZB 2KMCA 3P2BA 3ZDMC 2O6VB 1G6JA 2KXJA 2OJRA 2XK5A 1S3SG 2FIDA 2PE6B 2LASA 3H7PA 3LDZE 3OJ4B 5CHVC 1EF1A 1TZ1A 3DVNV 4HDOA 1CMXB 3QQ8B 4N9F4 4TKNA 3RT3B 1WGYA 2ZCCA 5JZEB 1WX7A 2Y5BB 4WWNA 2KC2A 1GJZA 3DBRI 3QARA 4K7SA 1RAXA 2BF8B 3QA8A 2A5UA 3L16A 4ZRIA 3OAWA 2DZKA 1BT0A 1WM2A 2LD9A 2KLGA 3L10B 3PHXB 2V1YA 4XC2A 4IW0A 3JSVA 4BBNF 3APCA 1WGDA 4F8CB 2ZVNA 4JQWC 1RRBA 4JLCA 3T9LA 5G2NA 2KTRA 1Q1OA 2IY0B 3DQVA 3NS8A 2JRHA 4ICVA 4ANXA 4RM8A 2NPTA 5C23A 2JF5A 2D10A 3X0WA 3PSEB 3UQBA 2ASQA 3PGEA 4YL8A 2IO3B 2M8SA 2FCMA 2DZMA 3V6CB 2R2QA 1H8CA 1M94A 3ZUNA 2ZNVB 2IZVB 3PPAA 4JIOU 4GN1A 4FBJB 1Q5WB 1V80A 5DPSA 3QAQA 3IBEA 4NY0A 4RMAA 4WAAA 2AYOB 2DYBA 1HE8A 2NS5A 2XBBC 2ZNVC 4A3OA 5AZHA 4HPLB 2L00B 3GOEA 4DHZE 1E7UA 3PLVA 3ZO5B 3CF6E 2LXCA 1ZKHA 4M0WB 5GMVA 5D2MB 3RULA 1KLVA 4WQOB 3RZWC 3O65B 2KTRB 1WE7A 3VH3B 5J17A 2KDEB 2KTFA 4W9IA 4DDID 2LWPA 2HJ8A 4ANUA 2RGFA 2BKRB 3QC8B 2JZZA 3CSFA 3B08A 3KVFB 2KDFB 3KW5B 1F9JA 1UBQA 1E7VA 3JW0X 1LXDA 4KZCA 1Q0WB 5D94A 1X1MA 2MBOA 3UINB 3CSTA 1XD3B 3A4SC 4EZKA 3U30A 3JYUA 4EEWA 1UGMA 1WGGA 2JPHA 1IPGA 5BO4B 2LJ5A 5CHFA 1V86A 4HCNB 4AJWA 4J6IA 1WXSA 4MJSB 4G3XB 2KZRA 3H7SA 2LRWA 2ZZPB 3HM3A 3PS6A 5IA7A 4DWFA 2Z0DB 2CU1A 4FJVB 2BYFA 1TBEA 3MTNB 4TQ0A 5L95C 3IHPC 4TUUA 3UIPB 3TCAA 1Z5SB 3A1QA 4A3PA 4ZRJA 2L0FA 3I3TB 3M95A 1IP9A 2K25A 4MSQB 4EZLA 2CR5A 5CHWA 4LDTD 3RYTA 4PS7A 1WX9A 1YJ1A 2KANA 3ALBA 2IO2B 3W1SC 2ZPNA 3VVWB 5IAAC 1V49A 4KIKA 4FJZA 2CHXA 1AARA 2KX3A 3VAWA 3VUYA 3ZLZA 2EMSA 3U8ZA 3ONSA 2D3GA 4KDIC 4G0NB 4AP4C 1QZEA 1V9JA 1WH3A 2GBNA 3QHTA 1YQBA 3A33B 4IWQA 2RD0A 1Y8RC 2G3QB 4K81A 4W9CA 3DDCB 3QX1A 3R66C 4GDKA 5CTRC 3V6EB 3SDLC 3OLMD 2UYZB 3SD5A 2Z59B 1S1QB 3IFWB 4BVUC 4GDLA 3H1UA 4NPNA 1V6EA 3NY5A 1ISNA 1R4NI 1P1AA 2KJHB 3V61A 2IYDB 5D7GA 2KK8A 2KD0A 2BWES 1H4RA 5D6JB 2KWUB 2RPQA 4ICUA 2FUHB 3B0AA 1SGHA 3ZDTA 1YIWA 2O2VB 4IUMB 1A5RA 2CS4A 3DVGX 2LRUA 1GC6A 3A9KA 3ZIMA 1SIFA 1SE9A 4FADA 1KOTA 1T0YA 1WZ0A 2CHWA 2MW5A 3NZSA 4IM0A 4PS3A 1WM3A 1Z2MA 4IM2A 1WJNA 3ML9A 3QJZA 3N30A 3PHWB 2JY6A 4W9FA 4IM3A 3PRZA 3PT2B 4WWPA 2M0XA 4XX5A 2IO1B 3ZVVA 2MBBB 3GZNI 2NVUI 4BOSC 3V62A 1NI2A 4MDKE 2KHWB 4NAWB 3QIJA 3A4RA 3RCZA 1WGHA 3WALA 4MGYE 1OEYA 3L08A 4HK2A 2J7QB 3WAMA 4ANVA 4WWOA 1WXMA 2KDIA 2L0TA 1WR6E 4IC7B 5JHBA 2PE9A 4IWPA 3V60A 1KJTA 3APFA 3KUCB 4ZRKA 1WMHB 4ZDVA 2D2QA 2GBRA 1K8RB 3JVZX 2KWCA 2I1JA 2BGFA 4JL9A 3BY4B 1ZW7A 5AEKB 2N4FA 2KJRA 3RZFA 3VHTC 2XK5B 2Z0EB 4FHKA 3ZTCA 1UBIA 2JXXA 2DENB 4BBNC 2BKFA 3Q3JA 5E6PA 3H7PB 4EZJA 1YD8U 2RSUA 4MH0E 2KFKA 2MP2A 1L2NA 2NBUA 3CMMB 4K7WA 4BFRA 2M4NA 2L76A 1L7YA 1PQSA 2FNJB 2KNBA 4K7UA 3X23A 1P9DU 2K1FA 1LQBA 5AZFA 1E8XA 4NQKE 4EFOA 4GU2A 4DDGD 4LDTB 4OVVA 4KV2A 3HIZA 3N32A 3D32A 3M63B 4B95A 2J0MA 3PVLA 1WR1A 4DHZB 3JSVB 3PREA 2GBKA 3ENEA 4HCPB 3KUZA 1LFDA 2AEHA 3OJ3A 2GMIC 2NPTB 3EHVA 3KUDB 4GGQA 4M8MA 2J0KA 2KX0A 2IO0B 2WDTB 3L13A 1WE6A 4NJ6A 4IG7B 4X57B 2JVCA 1UELA 2KJ6A 4MGZE 3ZRFA 1WJUA 5AZGA 2JWZA 2O6VD 2GBMA 2C7HA 2ZEQA 5G55A 3HK0A 1E8YA 3ZW3A 2MP2B 4URKA 2K6QA 4AOFA 3NOBA 2BWFA 3IVFA 3B1LX 2KQ7A 2N7DA 4PYZA 3N3KB 4NQLB 2KC1A 2V4LA 2KQSA 5DPWA 2D07B 2N1WA 2HD5B 3ECIA 3T8MA 1WXVA 3WA0A 2PJHA 4BKSD 4KSKC 3PZDA 1U4AA 2MBQA 4FJYA 1WYWB 2PPHA 3RUIB 2N9EB 3PTFC 2JUOA 3WAPA 4FULA 4DHJD 2LGDA 1NBFC 2WX0A 3TBLD 2BYEA 2FAZA 2L7RA 4LJOB 3AXCA 3VH4B 4TV3A 1OEYJ 4A20A 3C0RB 4K1RB 2DHZA 2C60A 2CHZA 4E71A 4B9KA 2J0JA 1WJ6A 4KSLC 3HHMA 3EC8A 2K39A 2HE7A 2G4SA 5TR5A 3KH0A 1V5OA 3A9JA 4P7IA 3VUXA 2CKHB 2JT4B 5DCNA 3VTWA 2MCNB 2ZJDA 3PV1A 5DPRA 2VRRB 1RLFA 4W9HA 3TMPB 2K8CA 2KLCA 1OGWA 1J19A 4G50A 1C1YB 3WIMA 2N9XA 3A1QB 2MRPA 2MX2A 3DOWA 3DPDA 4AJYB 3QWZB 2YLMA 5LLIA 3VTVA 5E6OA 3K9OB 5JHAA 4PS8A 3S2AA 2LUEA 4W9JA 4EUTA 3AI5A 2MLBA 1MG8A 2O6VA 3APDA 4WJPA 2FCNA 4KIKB 1OTRB 3DBLI 4RM9A 3EFUA 1E5WA 3SHQA 4HXDA 2KWVB 3AULA 2MQJA 3ZTDA 4I6LB 3A9JB 4B6WA 3DVNU 4DXAB 1E90A 2K6DB 3VXWA 3L54A 2JRIB 1V81A 4GDKB 4BKSA 5L83A 5JH5C 1GUAB 2ZVOA 4GMVA 1I35A 3QCAA 2W9NA 3M3JA 3ZNZB 2YVCA 4GDLB 1UZXB 1WJ4A 1YX6B 3WANA 1WXAA 3ML8A 3TJPA 3WAOA 3LJ3A 2UWQA 1R4MI 5EDSA 2KOXA 3ZNGC 3DVGY 1J0GA 3ZKJC 4MM3A 2NR2A 1GC7A 1WI0A 1P3QU 2DAJA 4W9DA 2R2OA 4KVGB 3A9KB 3K9PB 4HWIB 1GNUA 5KHOA 4LCDE 2NCNA 4XZ4A 1VCBA 4WJQA 4CHKA 2FCSA 3NHEB 3VDZA 3RD2A 4BKGA 2OOBB 4HVBA 1VD2A 3UGBB 2KN5A 2RR9A 1J8CA 2M17A 3TL5A 2K8BA 4DHJB 3L17A 1V5TA 2M1MA 4EKUA 5J2RA 4BKTA 4HLEA 1YX5B 3UIOB 2C7MB 2XEWA 1WIAA 4FLHA 2IBIB 2G4DB 2N1VA 1I42A 3QK0A 4FN2A 1V2YA 2AWTA 4LJPB 2BPSA 4ASWC 2KVRA 2GBJA 2MBHA 4II3B 3EECA 5DPTA 2A4ZA 2LVQA 1EO6A 4W9LA 2B3AA 4WJOA 4JGHB 2V3SA 4MELA 3TIXA 4FA6A 2K8HA 3R3MA 2DYMA 4W9GA 4E74A 4DK5A 3VUWA 5HKHA 2GOWA 3U7DA 3ZNID 2AL3A 4AUQC 2N9PC 2LGYA 5KHQA 1KM7A 2I1KA 1P0RA 3R7QA 2L3ZA 1C3TA 3R7RA 1OQYA 4IWOA 4MJSA 1GG3A 4BOZB 2WYQA 2LZ6A 4ANWA 2KFKB 3MJWA 5J18A 2L05A 4W9EA 3W1SA 2JZ3B 4M8NA 2KO3A 2WX1A 1NDDA 3PRPB 4GXBA 5C1ZA 2FIFA 2MSED 4CYEA 2D11A 1WGRA 4TQ1A 2IY1B 3AU4A 5FR6A 3VTUA 4EOYA 1E8ZA 3PRMB 2DZIA 2MA9B 2ZPYA 1XT9B 3BINA 4GB9A 3HM6X 1WFYA 2NBVB 3DBHI 4MGKE 4E3CA 3L0WB 1FXTB 2MBEA 4NNJB 2N7EA 4W9KA 2LGXA 2EMTA 2HTHA 1WX8A 5LXIB 1WF9A 1D3ZA 3NZUA 1UD7A 3H9DA 2C5LC 1LM8B 3KYCD 4FHJA 4MSMB 2DYOA 1EF5A 5LXHA 3VQIA 4GOCA 2LXAA 2DAFA 2MWSB 2FCQA 3IG3A 2KDBA 3KYDD 2NBWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1Y A;  2LVO A;  4WJN A;  3ZNH B;  3DCG A;  3H6N A;  2KKC A;  2O2V A;  3SU8 X;  1UH6 A;  2LI5 A;  4G11 A;  4MGI E;  2KMA A;  4I6P A;  5E6N A;  2L8J A;  4CO7 A;  4I6N B;  4AWJ A;  2G45 B;  5CX3 A;  1WZ3 A;  3MHS D;  4DBG A;  1P98 A;  3DBS A;  1IYF A;  2BYV E;  1WY8 A;  3UF8 A;  1EUV B;  4NAW A;  4NJ7 A;  2AL6 A;  3Q3F A;  2C7N B;  3AU5 A;  1E8W A;  2LVP A;  4F7Z A;  2QHO A;  3ZRC A;  4MEM A;  2KFJ A;  3PLU A;  3UQA A;  1ZGU B;  3VFK A;  2DZJ A;  2EKE C;  4GSW A;  4HJK A;  3M62 B;  1JRU A;  1XQQ A;  2DX5 B;  1WMH A;  1RFA A;  4HPM B;  4II2 B;  4KDL B;  4OVU A;  4HDQ A;  4PYU A;  4GIV A;  1TTN A;  2WWZ A;  1WRD B;  4F1S A;  2C9W B;  2PEA A;  2REX A;  4KZ0 A;  4ZYN A;  2ZCB A;  1TGZ B;  2KMC A;  3P2B A;  3ZDM C;  2O6V B;  1G6J A;  2KXJ A;  2OJR A;  2XK5 A;  1S3S G;  2FID A;  2PE6 B;  2LAS A;  3H7P A;  3LDZ E;  3OJ4 B;  5CHV C;  1EF1 A;  1TZ1 A;  3DVN V;  4HDO A;  1CMX B;  3QQ8 B;  4N9F 4;  4TKN A;  3RT3 B;  1WGY A;  2ZCC A;  5JZE B;  1WX7 A;  2Y5B B;  4WWN A;  2KC2 A;  1GJZ A;  3DBR I;  3QAR A;  4K7S A;  1RAX A;  2BF8 B;  3QA8 A;  2A5U A;  3L16 A;  4ZRI A;  3OAW A;  2DZK A;  1BT0 A;  1WM2 A;  2LD9 A;  2KLG A;  3L10 B;  3PHX B;  2V1Y A;  4XC2 A;  4IW0 A;  3JSV A;  4BBN F;  3APC A;  1WGD A;  4F8C B;  2ZVN A;  4JQW C;  1RRB A;  4JLC A;  3T9L A;  5G2N A;  2KTR A;  1Q1O A;  2IY0 B;  3DQV A;  3NS8 A;  2JRH A;  4ICV A;  4ANX A;  4RM8 A;  2NPT A;  5C23 A;  2JF5 A;  2D10 A;  3X0W A;  3PSE B;  3UQB A;  2ASQ A;  3PGE A;  4YL8 A;  2IO3 B;  2M8S A;  2FCM A;  2DZM A;  3V6C B;  2R2Q A;  1H8C A;  1M94 A;  3ZUN A;  2ZNV B;  2IZV B;  3PPA A;  4JIO U;  4GN1 A;  4FBJ B;  1Q5W B;  1V80 A;  5DPS A;  3QAQ A;  3IBE A;  4NY0 A;  4RMA A;  4WAA A;  2AYO B;  2DYB A;  1HE8 A;  2NS5 A;  2XBB C;  2ZNV C;  4A3O A;  5AZH A;  4HPL B;  2L00 B;  3GOE A;  4DHZ E;  1E7U A;  3PLV A;  3ZO5 B;  3CF6 E;  2LXC A;  1ZKH A;  4M0W B;  5GMV A;  5D2M B;  3RUL A;  1KLV A;  4WQO B;  3RZW C;  3O65 B;  2KTR B;  1WE7 A;  3VH3 B;  5J17 A;  2KDE B;  2KTF A;  4W9I A;  4DDI D;  2LWP A;  2HJ8 A;  4ANU A;  2RGF A;  2BKR B;  3QC8 B;  2JZZ A;  3CSF A;  3B08 A;  3KVF B;  2KDF B;  3KW5 B;  1F9J A;  1UBQ A;  1E7V A;  3JW0 X;  1LXD A;  4KZC A;  1Q0W B;  5D94 A;  1X1M A;  2MBO A;  3UIN B;  3CST A;  1XD3 B;  3A4S C;  4EZK A;  3U30 A;  3JYU A;  4EEW A;  1UGM A;  1WGG A;  2JPH A;  1IPG A;  5BO4 B;  2LJ5 A;  5CHF A;  1V86 A;  4HCN B;  4AJW A;  4J6I A;  1WXS A;  4MJS B;  4G3X B;  2KZR A;  3H7S A;  2LRW A;  2ZZP B;  3HM3 A;  3PS6 A;  5IA7 A;  4DWF A;  2Z0D B;  2CU1 A;  4FJV B;  2BYF A;  1TBE A;  3MTN B;  4TQ0 A;  5L95 C;  3IHP C;  4TUU A;  3UIP B;  3TCA A;  1Z5S B;  3A1Q A;  4A3P A;  4ZRJ A;  2L0F A;  3I3T B;  3M95 A;  1IP9 A;  2K25 A;  4MSQ B;  4EZL A;  2CR5 A;  5CHW A;  4LDT D;  3RYT A;  4PS7 A;  1WX9 A;  1YJ1 A;  2KAN A;  3ALB A;  2IO2 B;  3W1S C;  2ZPN A;  3VVW B;  5IAA C;  1V49 A;  4KIK A;  4FJZ A;  2CHX A;  1AAR A;  2KX3 A;  3VAW A;  3VUY A;  3ZLZ A;  2EMS A;  3U8Z A;  3ONS A;  2D3G A;  4KDI C;  4G0N B;  4AP4 C;  1QZE A;  1V9J A;  1WH3 A;  2GBN A;  3QHT A;  1YQB A;  3A33 B;  4IWQ A;  2RD0 A;  1Y8R C;  2G3Q B;  4K81 A;  4W9C A;  3DDC B;  3QX1 A;  3R66 C;  4GDK A;  5CTR C;  3V6E B;  3SDL C;  3OLM D;  2UYZ B;  3SD5 A;  2Z59 B;  1S1Q B;  3IFW B;  4BVU C;  4GDL A;  3H1U A;  4NPN A;  1V6E A;  3NY5 A;  1ISN A;  1R4N I;  1P1A A;  2KJH B;  3V61 A;  2IYD B;  5D7G A;  2KK8 A;  2KD0 A;  2BWE S;  1H4R A;  5D6J B;  2KWU B;  2RPQ A;  4ICU A;  2FUH B;  3B0A A;  1SGH A;  3ZDT A;  1YIW A;  2O2V B;  4IUM B;  1A5R A;  2CS4 A;  3DVG X;  2LRU A;  1GC6 A;  3A9K A;  3ZIM A;  1SIF A;  1SE9 A;  4FAD A;  1KOT A;  1T0Y A;  1WZ0 A;  2CHW A;  2MW5 A;  3NZS A;  4IM0 A;  4PS3 A;  1WM3 A;  1Z2M A;  4IM2 A;  1WJN A;  3ML9 A;  3QJZ A;  3N30 A;  3PHW B;  2JY6 A;  4W9F A;  4IM3 A;  3PRZ A;  3PT2 B;  4WWP A;  2M0X A;  4XX5 A;  2IO1 B;  3ZVV A;  2MBB B;  3GZN I;  2NVU I;  4BOS C;  3V62 A;  1NI2 A;  4MDK E;  2KHW B;  4NAW B;  3QIJ A;  3A4R A;  3RCZ A;  1WGH A;  3WAL A;  4MGY E;  1OEY A;  3L08 A;  4HK2 A;  2J7Q B;  3WAM A;  4ANV A;  4WWO A;  1WXM A;  2KDI A;  2L0T A;  1WR6 E;  4IC7 B;  5JHB A;  2PE9 A;  4IWP A;  3V60 A;  1KJT A;  3APF A;  3KUC B;  4ZRK A;  1WMH B;  4ZDV A;  2D2Q A;  2GBR A;  1K8R B;  3JVZ X;  2KWC A;  2I1J A;  2BGF A;  4JL9 A;  3BY4 B;  1ZW7 A;  5AEK B;  2N4F A;  2KJR A;  3RZF A;  3VHT C;  2XK5 B;  2Z0E B;  4FHK A;  3ZTC A;  1UBI A;  2JXX A;  2DEN B;  4BBN C;  2BKF A;  3Q3J A;  5E6P A;  3H7P B;  4EZJ A;  1YD8 U;  2RSU A;  4MH0 E;  2KFK A;  2MP2 A;  1L2N A;  2NBU A;  3CMM B;  4K7W A;  4BFR A;  2M4N A;  2L76 A;  1L7Y A;  1PQS A;  2FNJ B;  2KNB A;  4K7U A;  3X23 A;  1P9D U;  2K1F A;  1LQB A;  5AZF A;  1E8X A;  4NQK E;  4EFO A;  4GU2 A;  4DDG D;  4LDT B;  4OVV A;  4KV2 A;  3HIZ A;  3N32 A;  3D32 A;  3M63 B;  4B95 A;  2J0M A;  3PVL A;  1WR1 A;  4DHZ B;  3JSV B;  3PRE A;  2GBK A;  3ENE A;  4HCP B;  3KUZ A;  1LFD A;  2AEH A;  3OJ3 A;  2GMI C;  2NPT B;  3EHV A;  3KUD B;  4GGQ A;  4M8M A;  2J0K A;  2KX0 A;  2IO0 B;  2WDT B;  3L13 A;  1WE6 A;  4NJ6 A;  4IG7 B;  4X57 B;  2JVC A;  1UEL A;  2KJ6 A;  4MGZ E;  3ZRF A;  1WJU A;  5AZG A;  2JWZ A;  2O6V D;  2GBM A;  2C7H A;  2ZEQ A;  5G55 A;  3HK0 A;  1E8Y A;  3ZW3 A;  2MP2 B;  4URK A;  2K6Q A;  4AOF A;  3NOB A;  2BWF A;  3IVF A;  3B1L X;  2KQ7 A;  2N7D A;  4PYZ A;  3N3K B;  4NQL B;  2KC1 A;  2V4L A;  2KQS A;  5DPW A;  2D07 B;  2N1W A;  2HD5 B;  3ECI A;  3T8M A;  1WXV A;  3WA0 A;  2PJH A;  4BKS D;  4KSK C;  3PZD A;  1U4A A;  2MBQ A;  4FJY A;  1WYW B;  2PPH A;  3RUI B;  2N9E B;  3PTF C;  2JUO A;  3WAP A;  4FUL A;  4DHJ D;  2LGD A;  1NBF C;  2WX0 A;  3TBL D;  2BYE A;  2FAZ A;  2L7R A;  4LJO B;  3AXC A;  3VH4 B;  4TV3 A;  1OEY J;  4A20 A;  3C0R B;  4K1R B;  2DHZ A;  2C60 A;  2CHZ A;  4E71 A;  4B9K A;  2J0J A;  1WJ6 A;  4KSL C;  3HHM A;  3EC8 A;  2K39 A;  2HE7 A;  2G4S A;  5TR5 A;  3KH0 A;  1V5O A;  3A9J A;  4P7I A;  3VUX A;  2CKH B;  2JT4 B;  5DCN A;  3VTW A;  2MCN B;  2ZJD A;  3PV1 A;  5DPR A;  2VRR B;  1RLF A;  4W9H A;  3TMP B;  2K8C A;  2KLC A;  1OGW A;  1J19 A;  4G50 A;  1C1Y B;  3WIM A;  2N9X A;  3A1Q B;  2MRP A;  2MX2 A;  3DOW A;  3DPD A;  4AJY B;  3QWZ B;  2YLM A;  5LLI A;  3VTV A;  5E6O A;  3K9O B;  5JHA A;  4PS8 A;  3S2A A;  2LUE A;  4W9J A;  4EUT A;  3AI5 A;  2MLB A;  1MG8 A;  2O6V A;  3APD A;  4WJP A;  2FCN A;  4KIK B;  1OTR B;  3DBL I;  4RM9 A;  3EFU A;  1E5W A;  3SHQ A;  4HXD A;  2KWV B;  3AUL A;  2MQJ A;  3ZTD A;  4I6L B;  3A9J B;  4B6W A;  3DVN U;  4DXA B;  1E90 A;  2K6D B;  3VXW A;  3L54 A;  2JRI B;  1V81 A;  4GDK B;  4BKS A;  5L83 A;  5JH5 C;  1GUA B;  2ZVO A;  4GMV A;  1I35 A;  3QCA A;  2W9N A;  3M3J A;  3ZNZ B;  2YVC A;  4GDL B;  1UZX B;  1WJ4 A;  1YX6 B;  3WAN A;  1WXA A;  3ML8 A;  3TJP A;  3WAO A;  3LJ3 A;  2UWQ A;  1R4M I;  5EDS A;  2KOX A;  3ZNG C;  3DVG Y;  1J0G A;  3ZKJ C;  4MM3 A;  2NR2 A;  1GC7 A;  1WI0 A;  1P3Q U;  2DAJ A;  4W9D A;  2R2O A;  4KVG B;  3A9K B;  3K9P B;  4HWI B;  1GNU A;  5KHO A;  4LCD E;  2NCN A;  4XZ4 A;  1VCB A;  4WJQ A;  4CHK A;  2FCS A;  3NHE B;  3VDZ A;  3RD2 A;  4BKG A;  2OOB B;  4HVB A;  1VD2 A;  3UGB B;  2KN5 A;  2RR9 A;  1J8C A;  2M17 A;  3TL5 A;  2K8B A;  4DHJ B;  3L17 A;  1V5T A;  2M1M A;  4EKU A;  5J2R A;  4BKT A;  4HLE A;  1YX5 B;  3UIO B;  2C7M B;  2XEW A;  1WIA A;  4FLH A;  2IBI B;  2G4D B;  2N1V A;  1I42 A;  3QK0 A;  4FN2 A;  1V2Y A;  2AWT A;  4LJP B;  2BPS A;  4ASW C;  2KVR A;  2GBJ A;  2MBH A;  4II3 B;  3EEC A;  5DPT A;  2A4Z A;  2LVQ A;  1EO6 A;  4W9L A;  2B3A A;  4WJO A;  4JGH B;  2V3S A;  4MEL A;  3TIX A;  4FA6 A;  2K8H A;  3R3M A;  2DYM A;  4W9G A;  4E74 A;  4DK5 A;  3VUW A;  5HKH A;  2GOW A;  3U7D A;  3ZNI D;  2AL3 A;  4AUQ C;  2N9P C;  2LGY A;  5KHQ A;  1KM7 A;  2I1K A;  1P0R A;  3R7Q A;  2L3Z A;  1C3T A;  3R7R A;  1OQY A;  4IWO A;  4MJS A;  1GG3 A;  4BOZ B;  2WYQ A;  2LZ6 A;  4ANW A;  2KFK B;  3MJW A;  5J18 A;  2L05 A;  4W9E A;  3W1S A;  2JZ3 B;  4M8N A;  2KO3 A;  2WX1 A;  1NDD A;  3PRP B;  4GXB A;  5C1Z A;  2FIF A;  2MSE D;  4CYE A;  2D11 A;  1WGR A;  4TQ1 A;  2IY1 B;  3AU4 A;  5FR6 A;  3VTU A;  4EOY A;  1E8Z A;  3PRM B;  2DZI A;  2MA9 B;  2ZPY A;  1XT9 B;  3BIN A;  4GB9 A;  3HM6 X;  1WFY A;  2NBV B;  3DBH I;  4MGK E;  4E3C A;  3L0W B;  1FXT B;  2MBE A;  4NNJ B;  2N7E A;  4W9K A;  2LGX A;  2EMT A;  2HTH A;  1WX8 A;  5LXI B;  1WF9 A;  1D3Z A;  3NZU A;  1UD7 A;  3H9D A;  2C5L C;  1LM8 B;  3KYC D;  4FHJ A;  4MSM B;  2DYO A;  1EF5 A;  5LXH A;  3VQI A;  4GOC A;  2LXA A;  2DAF A;  2MWS B;  2FCQ A;  3IG3 A;  2KDB A;  3KYD D;  2NBW B; 
#chains in the Genus database with same CATH topology
 3W1Y A;  1QOG A;  2O2V A;  2KMA A;  2QIE B;  5E6N A;  2RDB C;  2YEP F;  3HVD A;  5CX3 A;  1MI0 A;  1P98 A;  3DBL B;  2GB1 A;  4NJ7 A;  3Q3F A;  3AU5 A;  1E8W A;  3UQA A;  2KFJ A;  2DZJ A;  2EKE C;  2PLP A;  1JRU A;  4O1N A;  1P7F A;  4HPM B;  1FRD A;  4II2 B;  4PYU A;  2WWZ A;  4F1S A;  3MHZ A;  3Q3N C;  3I5J C;  1ZXI A;  1TGZ B;  1QOB A;  4N58 A;  1JWA D;  3ZDM C;  1PDX A;  2KXJ A;  2XK5 A;  2LAS A;  3OJ4 B;  1C4C A;  1TZ1 A;  4HDO A;  1TZO A;  4Q2J A;  5EE3 A;  3U4E G;  1CJE A;  2Y5B B;  1SE2 A;  2KC2 A;  4WWN A;  4K7S A;  2BF8 B;  3L16 A;  1JWM D;  2DZK A;  2E3T A;  2G9H D;  2WXL A;  3TSS A;  3PHX B;  4BBN F;  4F8C B;  3APC A;  1FCC C;  3KWL A;  4JLC A;  2KTR A;  3HUI A;  2HTM E;  2JRH A;  4ICV A;  5C23 A;  3PSE B;  3PGE A;  1A70 A;  4N6E B;  2DZM A;  1HZ6 A;  2R2Q A;  1M94 A;  3ZUN A;  3PPA A;  2IZV B;  1FNU A;  4GN1 A;  1Q5W B;  5DPS A;  3IBE A;  4RMA A;  1FXA A;  1MVK A;  2M0A A;  2JU6 X;  3GOE A;  4DHZ E;  4IKG A;  4M0W B;  2LXC A;  2LUM A;  1DYQ A;  3GE3 C;  4XGA B;  1YNT E;  3AE9 B;  2LWP A;  2KN4 A;  3EFC A;  4ANU A;  2RGF A;  3N9Y C;  4C56 C;  1E7V A;  3JW0 X;  1LXD A;  2K5P A;  5D94 A;  2DNF A;  1X1M A;  1FRR A;  4EZK A;  3JYU A;  1UGM A;  1WGG A;  2JPH A;  1IPG A;  5BO4 B;  2WDV B;  4AJW A;  3Q8A A;  4G3X B;  1L4D B;  2IGH A;  1WGK A;  1Z5S B;  4YTM B;  3M95 A;  1IP9 A;  4EZL A;  2CR5 A;  3I9V 1;  3ALB A;  1EU3 A;  1V49 A;  1GB1 A;  2CHX A;  1PGA A;  1AAR A;  2EMS A;  3NUH B;  4G0N B;  1QZE A;  3QHT A;  1YQB A;  3BYY B;  3A33 B;  2NMQ A;  3DDC B;  3R66 C;  2PW9 A;  2H89 B;  3OLM D;  1FIQ A;  2WU2 B;  2KJH B;  5D7G A;  2KD0 A;  5D6J B;  2KWU B;  4ICU A;  3B0A A;  2JYE A;  1LGR A;  1SGH A;  3ZDT A;  2INC C;  3N1Z C;  4IUM B;  3AH7 A;  2LHE A;  2J42 A;  1GC6 A;  4LNF A;  1KOT A;  2CHW A;  3ML9 A;  3N30 A;  3PHW B;  2M0X A;  1R4M B;  4XDD A;  3ZVV A;  4BOS C;  3IAS 1;  4PT5 A;  2LGS A;  4NAW B;  2G1E A;  3RCZ A;  4BAX A;  1UWM A;  4MGY E;  1RWS A;  2D3A A;  4WWO A;  1C4A A;  1WXM A;  2KDI A;  2L0T A;  1JWB D;  3V60 A;  3APF A;  3KUC B;  4ZRK A;  2D2Q A;  2GBR A;  1TS4 A;  2QDF A;  4JL9 A;  1TKG A;  1SIJ A;  5G5G A;  5AEK B;  2KJR A;  3RZF A;  1HXY D;  5H8Y E;  3VHT C;  1UBI A;  3Q3J A;  2RSU A;  2KFK A;  2NBU A;  3CMM B;  4D2K A;  4BFR A;  1PQS A;  2FNJ B;  1I4X A;  2V3P A;  5BMH A;  5AZF A;  4WQM A;  4GU2 A;  4DDG D;  1WXQ A;  2ZW1 A;  4KV2 A;  3HIZ A;  3M63 B;  3PVL A;  1WR1 A;  4DHZ B;  3JSV B;  1GAQ B;  3OJ3 A;  4RF1 A;  4M8M A;  2J0K A;  2WDT B;  2RMM A;  4KX6 B;  4MGZ E;  4ACF A;  2O6V D;  1ZPS A;  2C7H A;  1RM6 C;  3AB5 A;  3B1L X;  3N3K B;  3VR9 B;  3RNE C;  2IDY A;  3TEW A;  3WA0 A;  4BKS D;  4KSK C;  1U4A A;  2D3C A;  3PTF C;  4DHJ D;  4FUL A;  1I4R A;  1NBF C;  2FAZ A;  2V3N A;  2FBW B;  3VH4 B;  3OWE B;  5BYS A;  4A20 A;  4HRO A;  2DHZ A;  2QC8 A;  4E71 A;  2J0J A;  4KSL C;  3EC8 A;  2VH2 A;  2K39 A;  4P1B C;  2G4S A;  3R2I A;  3A9J A;  3RNC C;  2L1A A;  2CKH B;  5BYQ A;  4AQ7 A;  5DCN A;  3AE3 B;  4TSS A;  2L32 A;  3TMP B;  1OGW A;  1C1Y B;  3WIM A;  2N9X A;  3A1Q B;  3QWZ B;  1JRO A;  3K9O B;  2LUE A;  4W9J A;  5HG2 A;  1NI3 A;  3RN9 C;  2LMC A;  5HFY A;  3FKY A;  2MJD A;  1HTO A;  4I6L B;  4NAM A;  2K6D B;  1F2R I;  5JH5 C;  2ZVO A;  4GMV A;  2K0P A;  3QCA A;  1L6U A;  2E6X A;  2INP E;  4HKQ A;  3ML8 A;  3L4P A;  2UWQ A;  5EDS A;  3DHI C;  3DVG Y;  1AYF A;  1PUT A;  4WH4 A;  5H92 C;  5D3D A;  1TS2 A;  4W9D A;  5G5H A;  4LCD E;  1VCB A;  1ZDX A;  3SFD B;  3VDZ A;  3RD2 A;  2OOB B;  5BMG A;  2PKO A;  3O13 A;  1C79 A;  2K8B A;  1NEN B;  2XEW A;  1I42 A;  2G4D B;  3QK0 A;  3MJ5 A;  1KRH A;  2D5G A;  3TEX A;  4II3 B;  3EEC A;  3FC4 A;  2Z8L A;  2LVQ A;  4W9L A;  1IGD A;  4JGH B;  4DK5 A;  2BB6 A;  3U7D A;  3V3X A;  2BT6 A;  3FIL A;  1C3T A;  2N7J A;  4MJS A;  2LZ6 A;  2FUG 1;  1NDD A;  4GXB A;  4HPP A;  1D5X C;  2MSE D;  1AN8 A;  4MT5 A;  3VTU A;  2GLS A;  5T8I A;  3PRM B;  1EU4 A;  2MA9 B;  3KLS X;  4IDI A;  2ACZ B;  4MH8 A;  1FPY A;  2NBV B;  4E3C A;  3L0W B;  1FXT B;  1T0Q C;  2N7E A;  1WX8 A;  2JYT A;  2K22 A;  1HEZ E;  4OZB A;  4MSM B;  4GOC A;  1I4G A;  3IG3 A;  1C77 A;  2VZK D;  1KH0 A;  1VZ8 A;  3SU8 X;  1JWS D;  1UF0 A;  2LEK A;  4MGI E;  2PMV A;  4CO7 A;  2M56 B;  2KMM A;  2SAK A;  3MHS D;  3DBS A;  1ENF A;  4C4V A;  4FXC A;  2BYV E;  1VLB A;  3UF8 A;  1TS5 A;  2AL6 A;  2WS3 B;  2LVP A;  1ZGU B;  1OQQ A;  3VFK A;  4GSW A;  2V0G A;  3M62 B;  3GZN B;  1XQQ A;  1WMH A;  1RFA A;  4K3C A;  4GIV A;  1M4V A;  2PEA A;  2REX A;  3GE8 C;  1B9R A;  3GB1 A;  2KMC A;  2O6V B;  2OJR A;  3H7P A;  3LDZ E;  5CHV C;  1CMX B;  4TKN A;  3RT3 B;  1WGY A;  2MH7 A;  1XLN A;  5JZE B;  2J52 A;  1RAX A;  2A5U A;  5FKA C;  4XC2 A;  2V1Y A;  1JW9 D;  2ZVN A;  4JQW C;  3T9L A;  5G2N A;  1C4P A;  2WXM A;  2BYT A;  2KAC A;  2XNA C;  3DQV A;  3NS8 A;  2D10 A;  3NVZ A;  3X0W A;  3AEA B;  2IO3 B;  2M8S A;  2FCM A;  1CQV A;  2D3B A;  1H8C A;  2V9H A;  1R7S A;  4NY0 A;  4WAA A;  2K3U A;  2AYO B;  3ZO5 B;  1ZKH A;  5GMV A;  5IP4 D;  4WQO B;  4HRS A;  3RZW C;  2KTR B;  1WE7 A;  1N61 A;  1VRA B;  3C19 A;  1ROE A;  2BKR B;  3QC8 B;  2JZZ A;  3CSF A;  3KVF B;  3KW5 B;  1F9J A;  3UIN B;  3CST A;  1XD3 B;  5IOI A;  5I4D A;  1JCK B;  1E7P B;  1WXS A;  4LTU A;  3MC8 A;  1FEH A;  2KZR A;  3HM3 A;  1BUI C;  3W5V B;  1VJK A;  2Z0D B;  4UDU C;  4FJV B;  2BYF A;  4TQ0 A;  3IHP C;  1ET6 A;  1DGJ A;  3PZ7 A;  1MHH E;  5CHW A;  3RYT A;  2KVZ A;  2ZPN A;  3VVW B;  2N9K A;  5IAA C;  1AWD A;  4FJZ A;  3MFG A;  1ACC A;  1V9J A;  2GBN A;  4IWQ A;  1IBX A;  1F0Z A;  1SJE D;  1Y8R C;  2G3Q B;  2BW2 A;  3V6E B;  3SDL C;  4BVU C;  2PVG C;  1I7H A;  3NY5 A;  3RNA C;  5C2T B;  1A5R A;  2CS4 A;  2NTS A;  3A9K A;  1ZUD 2;  4FAD A;  1SE9 A;  4P16 A;  1GPX A;  3E56 A;  5FK9 C;  4IM2 A;  5EE1 A;  1WJN A;  4IOI E;  4XX5 A;  4IM3 A;  3PT2 B;  1NYQ A;  2IO1 B;  2MBB B;  2NVU I;  3VRA B;  1NI2 A;  1STE A;  3QIJ A;  4M00 A;  2JX5 A;  1K53 A;  3L08 A;  3BZD B;  4ANV A;  1WR6 E;  1T0S C;  3IT4 B;  4IWP A;  4B0E A;  4S0R A;  4DXG A;  1K8R B;  3JVZ X;  3BY4 B;  1ZW7 A;  4XYC A;  2Z0E B;  3ZTC A;  4BBN C;  2ZW0 A;  2QSD A;  2MP2 A;  1N5W A;  2M4N A;  1NEK B;  1P9D U;  2CU3 A;  4EFO A;  4NQK E;  4LK0 M;  2VZK B;  2IJ0 A;  3N32 A;  1V1O A;  2J0M A;  3LXF A;  5BMI A;  2GRI A;  3KWV A;  4HCP B;  1C9F A;  1N60 A;  1V1P A;  3KUD B;  2NPT B;  3EHV A;  4GGQ A;  2J4X A;  4NJ6 A;  4IG7 B;  4X57 B;  1UEL A;  3IT6 B;  2ZEQ A;  3HK0 A;  4AOF A;  3AE8 B;  4HKZ E;  4NQL B;  3N1X C;  2KC1 A;  2KQS A;  1N62 A;  3ECI A;  5HHD G;  2GI9 A;  3RUI B;  2PPH A;  2JUO A;  2OED A;  2L7R A;  4LLG M;  2KT7 A;  3TEY A;  2DLB A;  1E6E B;  4K1R B;  4ZRQ A;  4B9K A;  3HHM A;  1KLG D;  1OQR A;  2WNM A;  1L5P A;  1MFW A;  3RFZ B;  1JWU D;  3KH0 A;  1JQ4 A;  1D4B A;  1MHX A;  4ZOH C;  2YEP B;  2JT4 B;  2WXK A;  2ZJD A;  3MP9 A;  3LB8 C;  1RLF A;  1YN5 A;  1TY0 A;  2KLC A;  2MJ3 A;  2KWD A;  3DOW A;  4AJY B;  5E6O A;  3S2A A;  4EUT A;  1MG8 A;  3Q14 C;  4KIK B;  3E9S A;  3AUL A;  3ZTD A;  3A9J B;  4B6W A;  2LGI A;  3DVN U;  4DXA B;  2JRI B;  4GDK B;  1GUA B;  3H8H A;  1WWT A;  4KGS A;  3AM9 A;  3M3J A;  4RGO S;  2YVC A;  4GDL B;  1UZX B;  1WJ4 A;  2WDR B;  1FFV A;  1WXA A;  1FCL A;  1QT9 A;  5TSS A;  2XN9 C;  3LJ3 A;  1TJE A;  3AEF B;  2NR2 A;  2WXJ A;  1P3Q U;  2DAJ A;  2WQY B;  1EM7 A;  3K9P B;  5D3I B;  3ZQ4 A;  2M19 A;  2SEB D;  1RYJ A;  4WJQ A;  3NHE B;  4BKG A;  2R61 A;  2LJI A;  2KN5 A;  3UGB B;  4M0W A;  3TL5 A;  1ZE3 D;  1YX5 B;  1TIF A;  3UIO B;  2C7M B;  4FLH A;  1WIA A;  4NZL B;  4FN2 A;  4ZYS A;  4ASW C;  3RPF C;  4C00 A;  2MBH A;  1EO6 A;  4MEL A;  3TIX A;  3Q8B A;  4FA6 A;  3R3M A;  2BQQ A;  2GOW A;  3ZNI D;  1J7B A;  1T6B X;  3DWG C;  1SE3 A;  2I1K A;  3BK2 A;  2L3Z A;  3R7R A;  4ANW A;  3MJW A;  2JQR B;  4YSX B;  4M8N A;  5IKC M;  2FIF A;  4YT0 B;  4CYE A;  4EE2 A;  1KFY B;  5FR6 A;  3EGR A;  1L0Y B;  1E8Z A;  3Q8C A;  2ZPY A;  4GB9 A;  4USA A;  3RNG C;  3DBH I;  4MGK E;  1F77 A;  1T3Q A;  2MBE A;  3NJT A;  4ZHP A;  2EMT A;  2HTH A;  2WXG A;  2LHD A;  3NZU A;  2C5L C;  3KYC D;  1QF6 A;  2WXO A;  2BTE A;  2LXA A;  2DAF A;  2MWS B;  1SF0 A;  2NBW B;  2HDE A;  4L2Y A;  2LVO A;  3DCG A;  3H6N A;  4XWW A;  1NVI D;  1UH6 A;  2QEJ C;  4CQN A;  4I6P A;  2L8J A;  4US9 A;  4AS1 A;  4AWJ A;  2G45 B;  3ABV B;  1I4Q A;  5AUK A;  3B9J A;  1WZ3 A;  4DBG A;  1IYF A;  3RNF C;  2PIA A;  2WXR A;  1V8C A;  4OZC A;  1EUV B;  4NAW A;  2QJL A;  3RMK C;  1UUP A;  1XCT L;  2CJN A;  2NTT A;  2WXQ A;  4OW0 A;  4P1C C;  1DOY A;  1EWY C;  3BVZ A;  1T5X D;  4HJK A;  2DX5 B;  3ZXV A;  1FM0 D;  4HDQ A;  1TTN A;  1WRD B;  3NVW A;  2ZCB A;  1Y56 A;  1G6J A;  1HZ5 A;  1S3S G;  1N63 A;  2CJO A;  2FID A;  2PE6 B;  3AED B;  3DVN V;  4N9F 4;  2Y5P A;  4C4V B;  1C76 A;  1GJZ A;  3QAR A;  3QA8 A;  2EKI A;  1YJJ A;  3OAW A;  1BT0 A;  1WM2 A;  3P42 A;  4MAC A;  3L10 B;  4IW0 A;  3JSV A;  1WGD A;  3GP7 A;  2IY0 B;  4ANX A;  2PVO D;  2JF5 A;  2IGD A;  4YSY B;  4YL8 A;  1Q10 A;  1VR9 A;  2ZNV B;  4JIO U;  1XCQ L;  2V4I B;  4FBJ B;  1HE8 A;  2XBB C;  4RCO A;  2JWU A;  4L23 A;  3CF6 E;  3HVZ A;  3O65 B;  3VH3 B;  5J17 A;  2KDE B;  2KTF A;  2WXP A;  5IN7 A;  4DDI D;  3Q3O C;  2HJ8 A;  1ZXH A;  4JE3 B;  3B08 A;  2WXN A;  4RGT A;  1UBQ A;  3AE1 B;  4KZC A;  2BBC A;  1I4P A;  3B2G A;  2MBO A;  1WSP A;  2HJ1 A;  4EEW A;  5CHF A;  1V86 A;  1YMH E;  1ZDV A;  2LRW A;  2ZZP B;  3PS6 A;  4DWF A;  2I2Y A;  3NS1 A;  3BK1 A;  3AEC B;  3UIP B;  3TCA A;  3A1Q A;  4A3P A;  2L0F A;  3I3T B;  2K25 A;  3W9C B;  3W1S C;  2IO2 B;  4HJG E;  2KX3 A;  1FMA D;  2D3G A;  4AP4 C;  3N20 C;  2RD0 A;  1D3Z A;  5CTR C;  3QX1 A;  4XE0 A;  1CK1 A;  3SD5 A;  2Z59 B;  1S1Q B;  3IFW B;  2UU7 A;  3H1U A;  1V6E A;  1ISN A;  3V61 A;  2IYD B;  2KK8 A;  2BWE S;  1FO4 A;  2RPQ A;  3AEB B;  2FUH B;  3R2T A;  2O2V B;  3DVG X;  3CWI A;  2LRU A;  1SIF A;  3ZJU A;  1T0Y A;  4IM0 A;  4PS3 A;  1Z2M A;  2BS3 B;  3QJZ A;  4W9F A;  3PRZ A;  4WWP A;  3NZ3 A;  4C80 A;  4RF0 A;  1DOI A;  1YQ4 B;  3RI7 C;  2J53 A;  4LNK A;  3AV8 A;  2WXF A;  3A4R A;  1QIL A;  3WAL A;  1TY2 A;  2J7Q B;  3WAM A;  5JHB A;  4IC7 B;  1C78 A;  3VRB B;  2PE9 A;  3V05 A;  1KJT A;  2KWC A;  2Y3A A;  2I1J A;  4YSZ B;  1PYW D;  1WRI A;  2BGF A;  3BVG A;  1K51 A;  4YTN B;  4OVZ A;  4YWG G;  2XK5 B;  1IUE A;  2JXX A;  2BKF A;  5E6P A;  1YD8 U;  4MH0 E;  1L2N A;  2AQ1 B;  3P4Q B;  4WIP A;  2L76 A;  1SJH D;  2KNB A;  4OZA A;  3X23 A;  2IPK D;  1SXT A;  3NRZ A;  4LDT B;  4US8 A;  1JRP A;  3AEG B;  4B95 A;  1P7E A;  3PRE A;  3EUB 2;  1YN4 A;  3ENE A;  3KUZ A;  1LFD A;  3EA6 A;  2N0S B;  2GMI C;  4C7Y A;  2BS2 B;  2KX0 A;  5BYR A;  3L13 A;  1WE6 A;  2JVC A;  1VDV A;  2KJ6 A;  1WJU A;  5AZG A;  2JWZ A;  5G55 A;  3ZW3 A;  1E8Y A;  2Q5W D;  2MP2 B;  2KQ7 A;  1EWC A;  1MJD A;  5DPW A;  3ZJV A;  2D07 B;  1D5Z C;  2N1W A;  3T8M A;  2PJH A;  3PZD A;  4WWM A;  2MBQ A;  4FJY A;  1WYW B;  2IGG A;  2N9E B;  3WAP A;  2LGD A;  2WX0 A;  4JPS A;  1KTK A;  3N1Y C;  3AXC A;  3MC9 A;  1IGC A;  1UWX A;  4TV3 A;  3ETR A;  1MPE A;  1GB4 A;  2MHJ A;  2CHZ A;  1WJ6 A;  2RDH A;  2K9X A;  4S17 A;  5TR5 A;  4PK1 A;  2MCN B;  4TMA B;  4RFB A;  2K8C A;  1J19 A;  3C8Y A;  4G50 A;  4A6Q A;  2MX2 A;  3DPD A;  1L0X B;  2X8X X;  2YLM A;  2W82 A;  4PS8 A;  1QKZ A;  2BS4 B;  4DXF A;  2MLB A;  2O6V A;  2WGS A;  3APD A;  2FCN A;  1OTR B;  4RM9 A;  4LNO A;  3BII D;  3SFE B;  1E90 A;  3VXW A;  3L54 A;  4BKS A;  1V81 A;  2W9N A;  1BML C;  3WAN A;  3WAO A;  3Q3M C;  1E9M A;  1R4M I;  2KYW A;  2KOX A;  1TYG B;  3U7Z A;  1UGJ A;  4MM3 A;  1WI0 A;  1XXG A;  1XEE A;  2R2O A;  4KVG B;  1TS3 A;  2NCN A;  4XZ4 A;  2FCS A;  1VD2 A;  1J8C A;  1V5T A;  2M1M A;  4EKU A;  3TEZ A;  5J2R A;  4KKI A;  4P6V F;  4HLE A;  2KQ4 X;  2IBI B;  2N1V A;  2WXH A;  4LJP B;  3P4P B;  2BPS A;  2KVR A;  4GLS C;  1HA5 A;  2A4Z A;  2B3A A;  2PTL A;  4W9G A;  2DYM A;  3Q2A C;  5HKH A;  2OJW A;  4XDC A;  2AL3 A;  4AUQ C;  2N9P C;  2LGY A;  3R7Q A;  4HEA 1;  1P0R A;  4IWO A;  2WHI A;  1GG3 A;  1CZP A;  3T3N A;  2KFK B;  5J18 A;  3Q6B A;  5JXV A;  3W1S A;  2KO3 A;  2WX1 A;  3R8B A;  2INN E;  2D11 A;  1WGR A;  4TQ1 A;  2IY1 B;  3AE7 B;  3AU4 A;  1FXI A;  3BIN A;  4N59 A;  2AX5 A;  1QOA A;  3GS2 A;  1JAL A;  1QLB B;  3BYT B;  5LXI B;  3AN1 A;  1WF9 A;  1UD7 A;  3H9D A;  1YN3 A;  3VQI A;  2L83 A;  1SB3 C;  2FCQ A;  3KYD D;  1E10 A;  4KGT A;  4WJN A;  3ZNH B;  2KKC A;  4NJC A;  2LI5 A;  4G11 A;  4I6N B;  2AQ2 B;  3UI3 A;  1AW7 A;  5IO9 A;  3Q69 A;  1WY8 A;  2C7N B;  2BVC A;  1YQ3 B;  2QHO A;  3ZRC A;  4MEM A;  4F7Z A;  3PLU A;  1J7C A;  3LYY A;  3FAH A;  4YTP B;  2WP9 B;  3AE5 B;  4KDL B;  4OVU A;  1L4Z B;  1D5M C;  2C9W B;  4KZ0 A;  1N5X A;  3VR8 B;  3P4R B;  4ZYN A;  3P2B A;  4RNA A;  5LNK 1;  1EF1 A;  3CIR B;  3V6C B;  2QCZ A;  3IAM 1;  3QQ8 B;  4LNN A;  2ZCC A;  2JXT A;  3AE2 B;  1WX7 A;  2RPV A;  3DBR I;  4M01 A;  2FE8 A;  3I63 C;  4ZRI A;  1YJI A;  4L1B A;  2LD9 A;  2KLG A;  4R3D A;  4QAY A;  1ZOY B;  3T3O A;  1RRB A;  1Q1O A;  1UNS A;  4RM8 A;  2NPT A;  2RDG A;  2Y5C A;  3UQB A;  2ASQ A;  3W2D A;  2LFI A;  2ON8 A;  2W54 A;  1V80 A;  5EE9 A;  3QAQ A;  4A55 A;  2DYB A;  2NS5 A;  1MG4 A;  2ZNV C;  4A3O A;  5AZH A;  4HPL B;  2L00 B;  3U52 E;  1E7U A;  3PLV A;  5D2M B;  3RUL A;  1KLV A;  2WXI A;  2KDM A;  4W9I A;  5C3J B;  1LO5 D;  4ITK A;  2KDF B;  2VH1 A;  4ARI A;  1E0Z A;  1DOX A;  2TSS A;  1Q0W B;  3TUO A;  3B2F A;  3A4S C;  5HI1 A;  4A8X C;  3U30 A;  3MC0 B;  2LJ5 A;  4WAF A;  4HCN B;  3DWM A;  3FIL B;  4J6I A;  5FR3 A;  4C7Z A;  2ICI A;  4MJS B;  5EE0 A;  3H7S A;  5IA7 A;  2CU1 A;  3AEE B;  1TBE A;  3MTN B;  5L95 C;  4TUU A;  2N9L A;  3U2S C;  4ZRJ A;  4MSQ B;  2W3S A;  4LDT D;  4PS7 A;  1WX9 A;  1XO3 A;  1YJ1 A;  2KAN A;  2BB5 A;  1YOV B;  4KIK A;  4OHJ A;  1PGX A;  4K3B A;  3VAW A;  3VUY A;  3ZLZ A;  3W5U B;  3U8Z A;  3ONS A;  1SSN A;  4KDI C;  3SR6 A;  1WH3 A;  4K81 A;  4W9C A;  4GDK A;  4RGN A;  1D6E C;  1K50 A;  2UYZ B;  5GXG B;  4GDL A;  4NPN A;  1F1H A;  1R4N I;  1P1A A;  3AE4 B;  2ONQ A;  1H4R A;  3Q8F A;  1HQR D;  1KLU D;  1YIW A;  4KGR A;  3ZIM A;  1WZ0 A;  2MW5 A;  3NZS A;  1F2R C;  1WM3 A;  3AMZ A;  2DWQ A;  2JY6 A;  4KKJ A;  1QOF A;  4YXD B;  3GZN I;  3V62 A;  4MDK E;  2KHW B;  4JX1 C;  3I57 A;  4H2A A;  1WGH A;  2JZP A;  1NYR A;  1OEY A;  4HK2 A;  4WUR A;  3DBR B;  4JWU C;  4B0M A;  1XF5 L;  1WMH B;  4ZDV A;  4REZ A;  2WU5 B;  2N4F A;  2JSV X;  1TKY A;  4FHK A;  2DEN B;  4EZJ A;  3H7P B;  2W55 A;  2WLB A;  4K7W A;  1TT5 B;  1L7Y A;  3IXS A;  4K7U A;  1FD6 A;  2K1F A;  1LQB A;  1E8X A;  4OVV A;  2QIL A;  1I4H A;  2KAJ A;  3D32 A;  1SE4 A;  3NVV A;  3BWU D;  2GBK A;  4ZRP A;  3WCQ A;  2AEH A;  2H88 B;  1K52 A;  2AQ3 B;  2IO0 B;  5MPO A;  3NVY A;  3ZRF A;  1QQR A;  2GBM A;  4URK A;  2K6Q A;  3NOB A;  1XLQ A;  2BWF A;  3IVF A;  1ZP0 B;  2N7D A;  2WDQ B;  4PYZ A;  3DBH B;  4M02 A;  3J9C A;  2X38 A;  2V4L A;  3ZJT A;  2HD5 B;  2MEK A;  1WXV A;  3ZGZ A;  3TBL D;  2BYE A;  3DHG C;  4LJO B;  4A90 A;  2B76 B;  1PGB A;  1OEY J;  3C0R B;  2EEL A;  2C60 A;  2DBY A;  3SEB A;  1OFF A;  1BXT A;  1L6V A;  3HRD D;  2HE7 A;  1KF6 B;  1SBB B;  3P4S B;  1V5O A;  1F52 A;  4P7I A;  2W3R A;  3VUX A;  1ET9 A;  3VTW A;  4ZHO A;  3PV1 A;  5DPR A;  3RNB C;  2QMT A;  2VRR B;  4A9A A;  4W9H A;  3AE6 B;  2MRP A;  5LLI A;  3VTV A;  5JHA A;  3Q8E A;  1R4N B;  3AI5 A;  4WJP A;  1FFU A;  3DBL I;  1HTQ A;  3PO0 A;  3EFU A;  3KQ4 A;  1E5W A;  4J3O D;  3SHQ A;  4HXD A;  1FNV A;  2KWV B;  2MQJ A;  1FNW A;  1VZ7 A;  1TKE A;  1IBX B;  4RH6 A;  5L83 A;  1XLP A;  1I35 A;  1WYG A;  2I38 A;  3ZNZ B;  1YX6 B;  3TJP A;  4BZA A;  2IND C;  4JWS C;  3ZNG C;  1J0G A;  3ZKJ C;  1GC7 A;  1VZ6 A;  4ARC A;  2L52 A;  4RGM A;  3A9K B;  4XWT A;  4HWI B;  1GNU A;  5KHO A;  1V97 A;  4CHK A;  5E6J A;  4HVB A;  2RR9 A;  2M17 A;  3P63 A;  4DHJ B;  3L17 A;  1GOZ A;  1JML A;  4BKT A;  4LNI A;  1XLO A;  1V2Y A;  2AWT A;  1RFK A;  2GBJ A;  4DQO C;  4MM3 B;  5DPT A;  4WJO A;  2V3S A;  2K8H A;  1PFD A;  4E74 A;  1L0V B;  2MJE A;  3VUW A;  1B1Z A;  5KHQ A;  1KM7 A;  1OQY A;  3PZ8 A;  1T0R C;  2WYQ A;  4BOZ B;  2L05 A;  4W9E A;  2JZ3 B;  3PRP B;  5C1Z A;  4EOY A;  2DZI A;  3DHH C;  3NG0 A;  1XT9 B;  3ZYY X;  3HM6 X;  1WFY A;  1V1P B;  1ESF A;  4NNJ B;  4W9K A;  2LGX A;  3URY A;  2OHF A;  3ZXR A;  5AUI A;  3P1M A;  1N6Z A;  1LM8 B;  4FHJ A;  2DYO A;  1EF5 A;  5LXH A;  1J7A A;  2KDB A;  1SEB D;  3OG5 A;  3BVM A; 
#chains in the Genus database with same CATH homology
 3W1Y A;  2LVO A;  4WJN A;  3ZNH B;  3DCG A;  3H6N A;  2KKC A;  2O2V A;  3SU8 X;  1UH6 A;  2LI5 A;  4G11 A;  4MGI E;  2KMA A;  4I6P A;  5E6N A;  2L8J A;  4CO7 A;  4I6N B;  4AWJ A;  2G45 B;  5CX3 A;  1WZ3 A;  3MHS D;  4DBG A;  1P98 A;  3DBS A;  1IYF A;  2BYV E;  1WY8 A;  3UF8 A;  1EUV B;  4NAW A;  4NJ7 A;  2AL6 A;  3Q3F A;  2C7N B;  3AU5 A;  1E8W A;  2LVP A;  4F7Z A;  2QHO A;  3ZRC A;  4MEM A;  2KFJ A;  3PLU A;  3UQA A;  1ZGU B;  3VFK A;  2DZJ A;  2EKE C;  4GSW A;  4HJK A;  3M62 B;  1JRU A;  1XQQ A;  2DX5 B;  1WMH A;  1RFA A;  4HPM B;  4II2 B;  4KDL B;  4OVU A;  4HDQ A;  4PYU A;  4GIV A;  1TTN A;  2WWZ A;  1WRD B;  4F1S A;  2C9W B;  2PEA A;  2REX A;  4KZ0 A;  4ZYN A;  2ZCB A;  1TGZ B;  2KMC A;  3P2B A;  3ZDM C;  2O6V B;  1G6J A;  2KXJ A;  2OJR A;  2XK5 A;  1S3S G;  2FID A;  2PE6 B;  2LAS A;  3H7P A;  3LDZ E;  3OJ4 B;  5CHV C;  1EF1 A;  1TZ1 A;  3DVN V;  4HDO A;  1CMX B;  3QQ8 B;  4N9F 4;  4TKN A;  3RT3 B;  1WGY A;  2ZCC A;  5JZE B;  1WX7 A;  2Y5B B;  4WWN A;  2KC2 A;  1GJZ A;  3DBR I;  3QAR A;  4K7S A;  1RAX A;  2BF8 B;  3QA8 A;  2A5U A;  3L16 A;  4ZRI A;  3OAW A;  2DZK A;  1BT0 A;  1WM2 A;  2LD9 A;  2KLG A;  3L10 B;  3PHX B;  2V1Y A;  4XC2 A;  4IW0 A;  3JSV A;  4BBN F;  3APC A;  1WGD A;  4F8C B;  2ZVN A;  4JQW C;  1RRB A;  4JLC A;  3T9L A;  5G2N A;  2KTR A;  1Q1O A;  2IY0 B;  3DQV A;  3NS8 A;  2JRH A;  4ICV A;  4ANX A;  4RM8 A;  2NPT A;  5C23 A;  2JF5 A;  2D10 A;  3X0W A;  3PSE B;  3UQB A;  2ASQ A;  3PGE A;  4YL8 A;  2IO3 B;  2M8S A;  2FCM A;  2DZM A;  3V6C B;  2R2Q A;  1H8C A;  1M94 A;  3ZUN A;  2ZNV B;  2IZV B;  3PPA A;  4JIO U;  4GN1 A;  4FBJ B;  1Q5W B;  1V80 A;  5DPS A;  3QAQ A;  3IBE A;  4NY0 A;  4RMA A;  4WAA A;  2AYO B;  2DYB A;  1HE8 A;  2NS5 A;  2XBB C;  2ZNV C;  4A3O A;  5AZH A;  4HPL B;  2L00 B;  3GOE A;  4DHZ E;  1E7U A;  3PLV A;  3ZO5 B;  3CF6 E;  2LXC A;  1ZKH A;  4M0W B;  5GMV A;  5D2M B;  3RUL A;  1KLV A;  4WQO B;  3RZW C;  3O65 B;  2KTR B;  1WE7 A;  3VH3 B;  5J17 A;  2KDE B;  2KTF A;  4W9I A;  4DDI D;  2LWP A;  2HJ8 A;  4ANU A;  2RGF A;  2BKR B;  3QC8 B;  2JZZ A;  3CSF A;  3B08 A;  3KVF B;  2KDF B;  3KW5 B;  1F9J A;  1UBQ A;  1E7V A;  3JW0 X;  1LXD A;  4KZC A;  1Q0W B;  5D94 A;  1X1M A;  2MBO A;  3UIN B;  3CST A;  1XD3 B;  3A4S C;  4EZK A;  3U30 A;  3JYU A;  4EEW A;  1UGM A;  1WGG A;  2JPH A;  1IPG A;  5BO4 B;  2LJ5 A;  5CHF A;  1V86 A;  4HCN B;  4AJW A;  4J6I A;  1WXS A;  4MJS B;  4G3X B;  2KZR A;  3H7S A;  2LRW A;  2ZZP B;  3HM3 A;  3PS6 A;  5IA7 A;  4DWF A;  2Z0D B;  2CU1 A;  4FJV B;  2BYF A;  1TBE A;  3MTN B;  4TQ0 A;  5L95 C;  3IHP C;  4TUU A;  3UIP B;  3TCA A;  1Z5S B;  3A1Q A;  4A3P A;  4ZRJ A;  2L0F A;  3I3T B;  3M95 A;  1IP9 A;  2K25 A;  4MSQ B;  4EZL A;  2CR5 A;  5CHW A;  4LDT D;  3RYT A;  4PS7 A;  1WX9 A;  1YJ1 A;  2KAN A;  3ALB A;  2IO2 B;  3W1S C;  2ZPN A;  3VVW B;  5IAA C;  1V49 A;  4KIK A;  4FJZ A;  2CHX A;  1AAR A;  2KX3 A;  3VAW A;  3VUY A;  3ZLZ A;  2EMS A;  3U8Z A;  3ONS A;  2D3G A;  4KDI C;  4G0N B;  4AP4 C;  1QZE A;  1V9J A;  1WH3 A;  2GBN A;  3QHT A;  1YQB A;  3A33 B;  4IWQ A;  2RD0 A;  1Y8R C;  2G3Q B;  4K81 A;  4W9C A;  3DDC B;  3QX1 A;  3R66 C;  4GDK A;  5CTR C;  3V6E B;  3SDL C;  3OLM D;  2UYZ B;  3SD5 A;  2Z59 B;  1S1Q B;  3IFW B;  4BVU C;  4GDL A;  3H1U A;  4NPN A;  1V6E A;  3NY5 A;  1ISN A;  1R4N I;  1P1A A;  2KJH B;  3V61 A;  2IYD B;  5D7G A;  2KK8 A;  2KD0 A;  2BWE S;  1H4R A;  5D6J B;  2KWU B;  2RPQ A;  4ICU A;  2FUH B;  3B0A A;  1SGH A;  3ZDT A;  1YIW A;  2O2V B;  4IUM B;  1A5R A;  2CS4 A;  3DVG X;  2LRU A;  1GC6 A;  3A9K A;  3ZIM A;  1SIF A;  1SE9 A;  4FAD A;  1KOT A;  1T0Y A;  1WZ0 A;  2CHW A;  2MW5 A;  3NZS A;  4IM0 A;  4PS3 A;  1WM3 A;  1Z2M A;  4IM2 A;  1WJN A;  3ML9 A;  3QJZ A;  3N30 A;  3PHW B;  2JY6 A;  4W9F A;  4IM3 A;  3PRZ A;  3PT2 B;  4WWP A;  2M0X A;  4XX5 A;  2IO1 B;  3ZVV A;  2MBB B;  3GZN I;  2NVU I;  4BOS C;  3V62 A;  1NI2 A;  4MDK E;  2KHW B;  4NAW B;  3QIJ A;  3A4R A;  3RCZ A;  1WGH A;  3WAL A;  4MGY E;  1OEY A;  3L08 A;  4HK2 A;  2J7Q B;  3WAM A;  4ANV A;  4WWO A;  1WXM A;  2KDI A;  2L0T A;  1WR6 E;  4IC7 B;  5JHB A;  2PE9 A;  4IWP A;  3V60 A;  1KJT A;  3APF A;  3KUC B;  4ZRK A;  1WMH B;  4ZDV A;  2D2Q A;  2GBR A;  1K8R B;  3JVZ X;  2KWC A;  2I1J A;  2BGF A;  4JL9 A;  3BY4 B;  1ZW7 A;  5AEK B;  2N4F A;  2KJR A;  3RZF A;  3VHT C;  2XK5 B;  2Z0E B;  4FHK A;  3ZTC A;  1UBI A;  2JXX A;  2DEN B;  4BBN C;  2BKF A;  3Q3J A;  5E6P A;  3H7P B;  4EZJ A;  1YD8 U;  2RSU A;  4MH0 E;  2KFK A;  2MP2 A;  1L2N A;  2NBU A;  3CMM B;  4K7W A;  4BFR A;  2M4N A;  2L76 A;  1L7Y A;  1PQS A;  2FNJ B;  2KNB A;  4K7U A;  3X23 A;  1P9D U;  2K1F A;  1LQB A;  5AZF A;  1E8X A;  4NQK E;  4EFO A;  4GU2 A;  4DDG D;  4LDT B;  4OVV A;  4KV2 A;  3HIZ A;  3N32 A;  3D32 A;  3M63 B;  4B95 A;  2J0M A;  3PVL A;  1WR1 A;  4DHZ B;  3JSV B;  3PRE A;  2GBK A;  3ENE A;  4HCP B;  3KUZ A;  1LFD A;  2AEH A;  3OJ3 A;  2GMI C;  2NPT B;  3EHV A;  3KUD B;  4GGQ A;  4M8M A;  2J0K A;  2KX0 A;  2IO0 B;  2WDT B;  3L13 A;  1WE6 A;  4NJ6 A;  4IG7 B;  4X57 B;  2JVC A;  1UEL A;  2KJ6 A;  4MGZ E;  3ZRF A;  1WJU A;  5AZG A;  2JWZ A;  2O6V D;  2GBM A;  2C7H A;  2ZEQ A;  5G55 A;  3HK0 A;  1E8Y A;  3ZW3 A;  2MP2 B;  4URK A;  2K6Q A;  4AOF A;  3NOB A;  2BWF A;  3IVF A;  3B1L X;  2KQ7 A;  2N7D A;  4PYZ A;  3N3K B;  4NQL B;  2KC1 A;  2V4L A;  2KQS A;  5DPW A;  2D07 B;  2N1W A;  2HD5 B;  3ECI A;  3T8M A;  1WXV A;  3WA0 A;  2PJH A;  4BKS D;  4KSK C;  3PZD A;  1U4A A;  2MBQ A;  4FJY A;  1WYW B;  2PPH A;  3RUI B;  2N9E B;  3PTF C;  2JUO A;  3WAP A;  4FUL A;  4DHJ D;  2LGD A;  1NBF C;  2WX0 A;  3TBL D;  2BYE A;  2FAZ A;  2L7R A;  4LJO B;  3AXC A;  3VH4 B;  4TV3 A;  1OEY J;  4A20 A;  3C0R B;  4K1R B;  2DHZ A;  2C60 A;  2CHZ A;  4E71 A;  4B9K A;  2J0J A;  1WJ6 A;  4KSL C;  3HHM A;  3EC8 A;  2K39 A;  2HE7 A;  2G4S A;  5TR5 A;  3KH0 A;  1V5O A;  3A9J A;  4P7I A;  3VUX A;  2CKH B;  2JT4 B;  5DCN A;  3VTW A;  2MCN B;  2ZJD A;  3PV1 A;  5DPR A;  2VRR B;  1RLF A;  4W9H A;  3TMP B;  2K8C A;  2KLC A;  1OGW A;  1J19 A;  4G50 A;  1C1Y B;  3WIM A;  2N9X A;  3A1Q B;  2MRP A;  2MX2 A;  3DOW A;  3DPD A;  4AJY B;  3QWZ B;  2YLM A;  5LLI A;  3VTV A;  5E6O A;  3K9O B;  5JHA A;  4PS8 A;  3S2A A;  2LUE A;  4W9J A;  4EUT A;  3AI5 A;  2MLB A;  1MG8 A;  2O6V A;  3APD A;  4WJP A;  2FCN A;  4KIK B;  1OTR B;  3DBL I;  4RM9 A;  3EFU A;  1E5W A;  3SHQ A;  4HXD A;  2KWV B;  3AUL A;  2MQJ A;  3ZTD A;  4I6L B;  3A9J B;  4B6W A;  3DVN U;  4DXA B;  1E90 A;  2K6D B;  3VXW A;  3L54 A;  2JRI B;  1V81 A;  4GDK B;  4BKS A;  5L83 A;  5JH5 C;  1GUA B;  2ZVO A;  4GMV A;  1I35 A;  3QCA A;  2W9N A;  3M3J A;  3ZNZ B;  2YVC A;  4GDL B;  1UZX B;  1WJ4 A;  1YX6 B;  3WAN A;  1WXA A;  3ML8 A;  3TJP A;  3WAO A;  3LJ3 A;  2UWQ A;  1R4M I;  5EDS A;  2KOX A;  3ZNG C;  3DVG Y;  1J0G A;  3ZKJ C;  4MM3 A;  2NR2 A;  1GC7 A;  1WI0 A;  1P3Q U;  2DAJ A;  4W9D A;  2R2O A;  4KVG B;  3A9K B;  3K9P B;  4HWI B;  1GNU A;  5KHO A;  4LCD E;  2NCN A;  4XZ4 A;  1VCB A;  4WJQ A;  4CHK A;  2FCS A;  3NHE B;  3VDZ A;  3RD2 A;  4BKG A;  2OOB B;  4HVB A;  1VD2 A;  3UGB B;  2KN5 A;  2RR9 A;  1J8C A;  2M17 A;  3TL5 A;  2K8B A;  4DHJ B;  3L17 A;  1V5T A;  2M1M A;  4EKU A;  5J2R A;  4BKT A;  4HLE A;  1YX5 B;  3UIO B;  2C7M B;  2XEW A;  1WIA A;  4FLH A;  2IBI B;  2G4D B;  2N1V A;  1I42 A;  3QK0 A;  4FN2 A;  1V2Y A;  2AWT A;  4LJP B;  2BPS A;  4ASW C;  2KVR A;  2GBJ A;  2MBH A;  4II3 B;  3EEC A;  5DPT A;  2A4Z A;  2LVQ A;  1EO6 A;  4W9L A;  2B3A A;  4WJO A;  4JGH B;  2V3S A;  4MEL A;  3TIX A;  4FA6 A;  2K8H A;  3R3M A;  2DYM A;  4W9G A;  4E74 A;  4DK5 A;  3VUW A;  5HKH A;  2GOW A;  3U7D A;  3ZNI D;  2AL3 A;  4AUQ C;  2N9P C;  2LGY A;  5KHQ A;  1KM7 A;  2I1K A;  1P0R A;  3R7Q A;  2L3Z A;  1C3T A;  3R7R A;  1OQY A;  4IWO A;  4MJS A;  1GG3 A;  4BOZ B;  2WYQ A;  2LZ6 A;  4ANW A;  2KFK B;  3MJW A;  5J18 A;  2L05 A;  4W9E A;  3W1S A;  2JZ3 B;  4M8N A;  2KO3 A;  2WX1 A;  1NDD A;  3PRP B;  4GXB A;  5C1Z A;  2FIF A;  2MSE D;  4CYE A;  2D11 A;  1WGR A;  4TQ1 A;  2IY1 B;  3AU4 A;  5FR6 A;  3VTU A;  4EOY A;  1E8Z A;  3PRM B;  2DZI A;  2MA9 B;  2ZPY A;  1XT9 B;  3BIN A;  4GB9 A;  3HM6 X;  1WFY A;  2NBV B;  3DBH I;  4MGK E;  4E3C A;  3L0W B;  1FXT B;  2MBE A;  4NNJ B;  2N7E A;  4W9K A;  2LGX A;  2EMT A;  2HTH A;  1WX8 A;  5LXI B;  1WF9 A;  1D3Z A;  3NZU A;  1UD7 A;  3H9D A;  2C5L C;  1LM8 B;  3KYC D;  4FHJ A;  4MSM B;  2DYO A;  1EF5 A;  5LXH A;  3VQI A;  4GOC A;  2LXA A;  2DAF A;  2MWS B;  2FCQ A;  3IG3 A;  2KDB A;  3KYD D;  2NBW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...