4HPMB

Pcgf1 ub fold (rawul)/bcorl1 pufd complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
81
Chain Sequence
QGTREQLNLCLERLSNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Polycomb Group Protein PCGF1 in Complex with BCOR Reveals Basis for Binding Selectivity of PCGF Homologs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords BCL-6 corepressor-like protein 1
total genus 20
structure length 81
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hpmB00
2WX1A 4PYUA 4RMAA 1G6JA 2GOWA 2YLMA 1WGGA 4JLCA 2IBIB 2N9EB 1PQSA 3AXCA 5KHQA 1JRUA 3IVFA 2MBOA 4WJPA 4BOZB 3RT3B 3OJ4B 4M8MA 4PS7A 3PT2B 1IPGA 2LGYA 2O2VB 4IM0A 4ZDVA 2JZ3B 5JHAA 1C1YB 3R66C 2NPTA 2DAFA 2I1JA 2K1FA 3RZFA 1ZW7A 4BKSD 2Z0DB 2FIFA 2LRWA 4EUTA 1ZKHA 2ZJDA 2LGXA 3PGEA 3QWZB 3LJ3A 4MM3A 2K8CA 2NS5A 3TJPA 5BO4B 2N9PC 3NZSA 4I6PA 2JUOA 2C5LC 2JWZA 2HTHA 2LZ6A 2L0FA 2B3AA 1YIWA 2GBRA 1F9JA 3ZRFA 2LXCA 3V61A 4WQOB 1E7UA 1WI0A 3M95A 3EC8A 1XD3B 1UGMA 2NPTB 5CHVC 3EHVA 2D2QA 3KUZA 1QZEA 3DBSA 1KM7A 3WAPA 1I35A 4W9CA 5AEKB 3PVLA 4NQLB 4WWPA 5EDSA 1WE7A 2MBEA 1WX9A 1LM8B 2IZVB 1YX5B 2J7QB 2L00B 2LUEA 4F7ZA 2C7NB 1UBQA 1V5TA 2ZVNA 1R4MI 3U8ZA 4OVVA 5KHOA 2IY1B 3LDZE 3VH4B 3B08A 1WX7A 2A5UA 3T9LA 4NJ7A 1V49A 2R2QA 5G55A 3VH3B 3QHTA 3IG3A 2WX0A 1RAXA 5AZGA 5D7GA 3ZKJC 1V6EA 2CR5A 1WRDB 2PE6B 1P3QU 1V9JA 4IWPA 4EKUA 4KZ0A 2O6VA 2KWVB 2J0JA 3ENEA 4NPNA 2KQ7A 4B6WA 2D10A 5GMVA 4X57B 2FCSA 1WMHB 2K39A 4GMVA 4W9KA 2REXA 2Y5BB 2V4LA 4K1RB 1YD8U 2ASQA 4EEWA 5D2MB 3L13A 1GC6A 2IO0B 4HWIB 3R7RA 3A1QA 1GC7A 2A4ZA 4NY0A 4W9DA 3RYTA 1WXVA 1BT0A 2G45B 4WWNA 2N9XA 2BGFA 2YVCA 1KJTA 3JYUA 3KVFB 1NDDA 4EFOA 4EZLA 2MW5A 2MCNB 3PRMB 3PREA 3SDLC 3DVGX 1C3TA 2D11A 3OJ3A 2MP2A 1WJUA 4G0NB 4GDLA 4GSWA 2G4DB 2RR9A 3MHSD 3RCZA 2IYDB 3QIJA 4PS8A 3AI5A 2KC1A 4NJ6A 2KXJA 3AU5A 3N30A 1E8XA 1EF5A 2LASA 1WMHA 1WM2A 2PPHA 4E3CA 2PEAA 2NR2A 3ML8A 4W9LA 3KUDB 5DPSA 2LVOA 5FR6A 1EO6A 3QQ8B 3VQIA 3A4RA 3ALBA 2KDBA 2JT4B 2K8HA 4LJOB 1WR1A 3QX1A 4MGIE 2GBKA 5LXHA 1D3ZA 3DVNU 2L7RA 3PRZA 4GXBA 3IHPC 2EMSA 3M62B 2KJHB 1YJ1A 1J8CA 4FN2A 2OJRA 2NBWB 3DCGA 1KLVA 2ZCCA 1Q1OA 4MJSA 2G3QB 1LQBA 1P9DU 4IUMB 2BPSA 2AYOB 3WALA 2L3ZA 2DENB 1UD7A 3V6CB 2GBNA 2MX2A 5AZHA 4MSMB 2DYMA 4GIVA 1WF9A 4CO7A 5JZEB 4I6LB 2KLCA 3DVGY 1WH3A 2KTRA 3DBLI 2KTRB 5IA7A 2BWFA 1V80A 3N32A 1SGHA 2M17A 2LVPA 4XX5A 3QJZA 4JIOU 4OVUA 2L8JA 2WWZA 3CMMB 3S2AA 5CTRC 4ZRKA 4LJPB 2DYBA 3WAMA 3H7SA 1WXAA 4GB9A 2M8SA 4LDTD 1WIAA 3PHXB 4M0WB 2UWQA 4WWOA 1IP9A 2KC2A 2C60A 2XEWA 3QAQA 1NBFC 1X1MA 5C23A 2FIDA 2JRHA 2CS4A 2BKFA 3ZLZA 1E7VA 1U4AA 3VFKA 2ZPYA 4DBGA 1TZ1A 2CHZA 4ICVA 1V2YA 4IM3A 2KLGA 4KSLC 4FBJB 1RLFA 3HM3A 3VAWA 3ZW3A 1Z5SB 2LD9A 4K7WA 4IG7B 3ZDTA 3N3KB 1S1QB 2JPHA 2KQSA 4JGHB 4JL9A 2L76A 5AZFA 3X23A 2K8BA 2KX0A 4GDKB 5J2RA 4BKSA 3TBLD 2GMIC 4W9GA 1GUAB 1OGWA 2JXXA 1T0YA 3WAOA 4KSKC 1H4RA 3ZNID 1NI2A 1M94A 1A5RA 4TUUA 2FCMA 4NAWA 1FXTB 2DZJA 2MQJA 2ZVOA 3JVZX 4FJYA 4GDLB 4ANUA 4F8CB 3TIXA 3ECIA 2I1KA 4FHJA 2KWUB 2ZEQA 4W9FA 2J0KA 1WM3A 2KN5A 3H6NA 4BFRA 1WGHA 2L05A 1GNUA 4IW0A 3UIPB 1EF1A 1XQQA 2LJ5A 3DPDA 3U30A 4NAWB 3NOBA 1CMXB 4B9KA 4G11A 1E8WA 2MBQA 1WZ0A 3MTNB 4FJZA 1H8CA 2FUHB 1OEYJ 3VTVA 4AWJA 3M63B 2KX3A 4ZYNA 3VHTC 4KIKA 4CYEA 3KH0A 2KVRA 2KOXA 2WDTB 3HHMA 2ZNVC 4K7SA 4PYZA 4II2B 4AP4C 4BVUC 3VTUA 4BKGA 4HCNB 1WGYA 4DDID 2BWES 3JSVB 4KVGB 2HE7A 4TQ0A 2C7HA 4I6NB 4YL8A 3CF6E 1YQBA 3H7PB 2FAZA 4AOFA 4IWQA 2EKEC 1E90A 2KNBA 3BY4B 4GDKA 2MRPA 2M1MA 2ZPNA 5D94A 1WR6E 2GBJA 2BYFA 3GOEA 4NQKE 3UF8A 2N1VA 3UIOB 2L0TA 4MH0E 5JH5C 3W1YA 4BBNC 4MEMA 3R7QA 4BOSC 2JRIB 3EFUA 4FLHA 3U7DA 2IO2B 3VUXA 4B95A 3PLVA 3UGBB 3OAWA 2CHXA 2DZIA 2KDIA 2KFJA 1LXDA 3A1QB 5L95C 2C7MB 5LXIB 5CHFA 3ZTCA 4DHJB 2GBMA 1UELA 3KUCB 5D6JB 3D32A 1TGZB 2R2OA 2IO1B 3X0WA 2HJ8A 4FULA 5G2NA 2LWPA 4FHKA 4EZJA 3A33B 1VD2A 2IY0B 3HK0A 3ML9A 3O65B 1VCBA 5J18A 3PV1A 3W1SC 3ZNZB 1TBEA 3DBRI 3IBEA 4IWOA 3H1UA 3SD5A 2D3GA 3A9KA 2DZMA 2KANA 4WJOA 4ZRIA 2LRUA 4N9F4 3T8MA 1RRBA 3TCAA 5J17A 2EMTA 3B0AA 2N7EA 3I3TB 2V1YA 2ZCBA 3PZDA 1XT9B 2K6QA 4HVBA 3VXWA 4URKA 5DPWA 4MGYE 3PLUA 3QK0A 3L08A 4DDGD 3NS8A 3QCAA 2BYVE 3ZO5B 4ANWA 2KFKA 2LI5A 2RGFA 3Q3FA 4PS3A 1UH6A 1R4NI 4W9HA 4W9EA 2DZKA 2BYEA 3A9JB 2M0XA 3A9JA 1Q5WB 2ZZPB 4ICUA 4A20A 2MSED 2ZNVB 2IO3B 1ZGUB 1J0GA 4IC7B 3NY5A 4W9IA 2AL6A 4G50A 1V5OA 2D07B 4RM8A 2KKCA 2DHZA 2BKRB 3NHEB 4BKTA 2MLBA 4HXDA 4CHKA 1IYFA 4EZKA 4HPLB 2FCNA 2VRRB 1GJZA 5TR5A 3R3MA 3L16A 1EUVB 3L0WB 2HD5B 1WJNA 3L17A 2XBBC 4KV2A 2RPQA 3RD2A 1KOTA 4G3XB 2BF8B 4WJNA 2LVQA 1WFYA 4XC2A 4MDKE 2KDEB 4HK2A 5CX3A 1HE8A 3APCA 1V86A 2KWCA 2G4SA 2KK8A 4HDOA 2KZRA 4HJKA 4HDQA 3ZNHB 3V6EB 3CSFA 4WAAA 2N1WA 4J6IA 3DVNV 4WJQA 3UINB 4FA6A 4TV3A 2QHOA 3K9OB 3V60A 4ASWC 4MELA 1UZXB 4NNJB 3JW0X 1V81A 1Q0WB 2CHWA 3KW5B 4MSQB 1WYWB 3DQVA 4KZCA 1J19A 2Z59B 4P7IA 3ZIMA 3DBHI 4AJYB 2CU1A 3VUWA 2O6VD 2MA9B 3UQBA 3ZTDA 4ANVA 3QARA 2NCNA 2N4FA 2FNJB 1TTNA 3M3JA 3ZUNA 3MJWA 3WIMA 2K25A 1YX6B 4GN1A 4XZ4A 3DOWA 3WA0A 3NZUA 2PJHA 2XK5B 1L2NA 1E8ZA 2M4NA 2NVUI 3ONSA 3ZDMC 4MGZE 4W9JA 3UQAA 3PPAA 1WXSA 3B1LX 4LCDE 4DHZB 2WYQA 5E6OA 3KYCD 2KJ6A 1WGDA 3TL5A 3APDA 2CKHB 4GGQA 4KIKB 3H9DA 4M8NA 3SHQA 3V62A 4KDIC 5HKHA 4GU2A 1S3SG 4TKNA 2KD0A 1E8YA 5E6PA 1WY8A 1Y8RC 2JY6A 2DAJA 3VTWA 4DHZE 4E71A 2KHWB 4AUQC 3Q3JA 1Z2MA 2KDFB 2KJRA 3QA8A 4TQ1A 1E5WA 4DXAB 4LDTB 4EOYA 5DPTA 2RSUA 2JZZA 4GOCA 3H7PA 3BINA 4A3OA 1UBIA 1P0RA 3AU4A 2DYOA 3RULA 1MG8A 4FJVB 4MGKE 5LLIA 3ZVVA 4KDLB 2MBHA 5C1ZA 1OTRB 1WJ6A 2KFKB 1OQYA 2UYZB 1SE9A 3RUIB 4A3PA 3OLMD 2JF5A 2V3SA 1WGRA 2O6VB 1OEYA 2AL3A 3PS6A 2RD0A 4FADA 4K81A 2J0MA 3APFA 4IM2A 2K6DB 3VDZA 4DHJD 1L7YA 2FCQA 3VUYA 1P1AA 3VVWB 1AARA 3DDCB 3GZNI 4DWFA 3L54A 2NBUA 2KO3A 2Z0EB 3PRPB 4AJWA 3IFWB 4ANXA 3PHWB 3PTFC 3QC8B 4HCPB 1SIFA 1WJ4A 4E74A 3EECA 3TMPB 1WXMA 2C9WB 3W1SA 5DCNA 4RM9A 1GG3A 3L10B 3KYDD 1I42A 2N7DA 4K7UA 1LFDA 2DX5B 3HIZA 1RFAA 4JQWC 3ZNGC 1ISNA 2LGDA 3WANA 2OOBB 4BBNF 2KMAA 2MWSB 3RZWC 5L83A 4DK5A 1WZ3A 5DPRA 1WE6A 5IAAC 2W9NA 4II3B 1WX8A 3HM6X 3A9KB 3P2BA 3ZRCA 3PSEB 2JVCA 3AULA 3C0RB 2KMCA 3K9PB 4ZRJA 5JHBA 1P98A 2XK5A 2NBVB 5E6NA 2AEHA 3CSTA 4MJSB 3SU8X 4HLEA 2MBBB 3A4SC 3JSVA 2AWTA 5CHWA 4F1SA 2PE9A 2KTFA 1K8RB 4HPMB 2MP2B 2LXAA 2O2VA
chains in the Genus database with same CATH superfamily
2OEDA 2GOWA 2YLMA 4JE3B 2K3UA 5G5GA 4WJPA 4WQMA 3RT3B 3GB1A 4M8MA 2GB1A 2LGYA 5JHAA 1C1YB 3LXFA 1VZ8A 2DAFA 2I1JA 3V05A 2Z0DB 3N20C 3O13A 3BIID 5C2TB 2K8CA 1N61A 2W3RA 2OHFA 4ARCA 2L0FA 2B3AA 1PDXA 4WQOB 1FEHA 2LUMA 1UGMA 3EHVA 4N59A 2D2QA 1FRDA 1K51A 1D6EC 4W9CA 3PVLA 5EDSA 2MBEA 1F0ZA 1YX5B 4MH8A 4YT0B 1FCLA 4OVVA 5KHOA 4C7ZA 2R2QA 3VH3B 1FO4A 2IGGA 3IG3A 2WX0A 2WXJA 1D5MC 1JWUD 2PE6B 2JU6X 1B9RA 1EU4A 2QIEB 1EWYC 4B6WA 5IOIA 4W9KA 4K1RB 3OWEB 2IO0B 3BVMA 4A8XC 3PZ7A 4NY0A 1WXVA 1BT0A 3AEAB 1HEZE 2BGFA 2M0AA 2MW5A 3AE3B 3SDLC 5LNK1 3FILB 1C3TA 3OJ3A 5G5HA 1WJUA 1E6EB 1E7PB 3QIJA 1RFKA 2KC1A 3NVWA 2LJIA 5T8IA 1KRHA 2PPHA 2NR2A 3AN1A 4W9LA 3KUDB 2LVOA 4UDUC 1EO6A 1P7FA 2WXKA 2INPE 3A4RA 2EKIA 4C80A 2V9HA 3IHPC 2EMSA 2NBWB 1KLVA 2X38A 3NS1A 4IUMB 1QOAA 2BPSA 2AYOB 3WALA 1SE3A 2MJEA 1L6UA 3V6CB 2MX2A 5AZHA 1AN8A 3BK2A 3AH7A 5JZEB 2PKOA 3VR9B 1WH3A 1GOZA 4A55A 3DBLI 2BWFA 1V80A 1MI0A 3S2AA 1I4GA 4LJPB 1WXQA 4LDTD 2UWQA 4WWOA 1IP9A 2VZKD 3QAQA 1X1MA 5BMGA 2JRHA 2WS3B 3ZLZA 1E7VA 4IM3A 2KLGA 4FBJB 1FFUA 1RLFA 2JPHA 3AEBB 2QCZA 4BKSA 3TBLD 4BZAA 4W9GA 1H4RA 1IGCA 4KGRA 1NI2A 3MHZA 2FCMA 4NAWA 1FXTB 2MQJA 4F8CB 2G1EA 2J0KA 4O1NA 1GNUA 3UIPB 3N1XC 2AX5A 3ZYYX 1C76A 3DPDA 3NOBA 1CMXB 3VTVA 4C4VA 2KX3A 2Y3AA 4KIKA 3KH0A 1DYQA 4II2B 4AP4C 3AEFB 4BKGA 4DDID 3JSVB 4TQ0A 1KFYB 4YL8A 3CF6E 1DGJA 1E90A 3BY4B 2ZPNA 1WR6E 4NQKE 2N1VA 1V1PB 4M00A 4ZHOA 4MEMA 3R7QA 4B95A 3PLVA 3UGBB 5BYSA 1QQRA 2CHXA 2KFJA 3I63C 2H89B 5IN7A 1FNWA 5LXIB 3ZTCA 1SJED 5D6JB 3T3NA 3U52E 3VRAB 5G2NA 2D3CA 5J18A 3ML9A 4A6QA 3ZNZB 3IBEA 1L0XB 3A9KA 1L4DB 1FPYA 3BK1A 2V1YA 4XDDA 2ZCBA 3AM9A 1XT9B 4HVBA 1FXIA 2BS3B 4URKA 2WLBA 3NS8A 2KFKA 3Q3FA 1XCQL 2DZKA 3ZXRA 2M0XA 3A9JA 4A20A 2RDGA 1Q10A 2IO3B 5FKAC 1ZGUB 1J0GA 2KKCA 2DHZA 2L1AA 4HXDA 2FCNA 2VRRB 1HZ6A 1OQQA 3L0WB 3L17A 2QSDA 2DBYA 2WQYB 2BVCA 2KK8A 1XLNA 4HDOA 2KZRA 3ZNHB 3V6EB 2LGSA 1TY0A 4WAAA 1SIJA 2N1WA 3CSFA 2WXMA 4P1CC 3AEEB 2QHOA 3K9OB 2JWUA 3RNCC 1BMLC 2ON8A 3FILA 4QAYA 1QF6A 1JWBD 3KQ4A 1YN4A 1TJEA 2BS2B 2FNJB 3AE7B 3WIMA 1C4CA 1YX6B 2VZKB 3WA0A 4KGTA 2XK5B 2MH7A 1L2NA 1N63A 1E8ZA 2M4NA 4ITKA 3UQAA 3T3OA 4DHZB 3APDA 4KIKB 3AEDB 3H9DA 3V62A 4KDIC 3FKYA 2WXOA 1F2RI 3RNGC 2KD0A 1WY8A 1N6ZA 3AE4B 4DHZE 4E71A 3ZJVA 2ONQA 2KDFB 3BZDB 2KJRA 3MP9A 1E5WA 3OG5A 4DXAB 4EOYA 4ACFA 3BYTB 2SAKA 4YTNB 2UYZB 1SE9A 3RUIB 1L5PA 2L32A 1CK1A 1E10A 5FK9C 3PS6A 2H88B 2LEKA 3RNEC 2J0MA 4IM2A 2FCQA 4DWFA 2KDMA 2AQ1B 3IFWB 4WAFA 4ANXA 3PTFC 1QLBB 2N9KA 1WJ4A 3KLSX 5DCNA 1I4PA 1LFDA 2DX5B 3HIZA 1F77A 1XEEA 3WANA 2OOBB 4BBNF 1MHHE 5H8YE 2B76B 5L83A 1WWTA 1WZ3A 5IAAC 3HRDD 2BYTA 1F2RC 3ZRCA 1JRPA 3PSEB 2JVCA 3AULA 3C0RB 2ICIA 3AMZA 4ZRJA 3R8BA 3FC4A 2BB5A 1HXYD 1F52A 2AEHA 4MJSB 3SU8X 2MBBB 1SXTA 5CHWA 2PE9A 2KTFA 4HPMB 2LXAA 1EWCA 2O2VA 2WX1A 1QOGA 2BB6A 4JLCA 1WGGA 3AXCA 5KHQA 1JRUA 2J4XA 4BOZB 3TEZA 4PS7A 3L4PA 3PT2B 1IPGA 2O2VB 2ZW0A 1DOIA 1NVID 1FNUA 4KKJA 4K3CA 2J52A 2K1FA 1ZKHA 3LJ3A 4MM3A 4I6PA 2JUOA 2WXFA 2J42A 2E6XA 4L23A 1SB3C 1F9JA 3ZRFA 2LXCA 3EC8A 1HTOA 2N7JA 3DBSA 1I35A 5AEKB 4NQLB 1JQ4A 1LM8B 5H92C 2IZVB 2J7QB 2LUEA 2C7NB 1UBQA 1V5TA 1T5XD 2K5PA 1K52A 1PGXA 1L0YB 1ET6A 1PFDA 3T9LA 4NJ7A 4YSXB 2L83A 5AZGA 1V6EA 2CR5A 4RGMA 1TIFA 1P3QU 1NYQA 1QOBA 5C3JB 4M02A 3ENEA 2J0JA 3NVYA 4NPNA 2AQ3B 2D10A 1WMHB 1J7CA 1MFWA 2XN9C 4BAXA 1XXGA 5D2MB 4HWIB 2JXTA 4N58A 2R61A 3SFDB 4H2AA 2N9XA 4EFOA 3KVFB 3MC9A 2D11A 3RFZB 1NEKB 1TS5A 1AYFA 4AS1A 4GDLA 3MHSD 3AI5A 4NJ6A 4OZAA 2KXJA 1J7BA 1LO5D 3N30A 4IKGA 2LASA 3GE8C 4E3CA 1YN5A 5DPSA 1HA5A 3VQIA 1N5XA 1TZOA 2JT4B 1T0SC 1WR1A 5LXHA 2GBKA 3DVNU 1C77A 2WDVB 3M62B 5HHDG 4K3BA 4FN2A 2WGSA 3DCGA 3PO0A 4M0WA 1UD7A 3VRBB 3J9CA 5EE9A 2GBNA 2WHIA 4CO7A 4I6LB 2KLCA 3DVGY 3P4RB 1E0ZA 2K9XA 1ZUD2 2NTTA 5IA7A 2LVPA 3AE1B 1JALA 5CTRC 3BVGA 2DYBA 3WAMA 3LB8C 2KMMA 3KWLA 4GB9A 4M0WB 4RCOA 2WXNA 1OFFA 2C60A 4XE0A 1IBXB 2BKFA 3VFKA 2ZPYA 1TZ1A 1V2YA 3VAWA 2LD9A 2K0PA 2KQSA 4JL9A 4IDIA 5AZFA 2K8BA 2KX0A 5J2RA 2GMIC 4USAA 2KWDA 4MT5A 1OGWA 1D5ZC 1T0YA 4P1BC 2ZVOA 3TIXA 4RH6A 2I1KA 4FHJA 2KWUB 2KN5A 3H6NA 3RMKC 3U30A 1N5WA 2WDQB 1H8CA 1OEYJ 4XGAB 2KOXA 2JZPA 3HHMA 4K7SA 1FNVA 4BVUC 3ZGZA 3TSSA 4I6NB 2PLPA 2QILA 2GRIA 1TY2A 4GDKA 2GBJA 3UIOB 3GOEA 3ZJUA 1DOYA 2L0TA 4MH0E 3W1YA 3EFUA 4EE2A 2DZIA 2KDIA 1MHXA 3A1QB 4AQ7A 1IBXA 2C7MB 5CHFA 5D3DA 2V4IB 3DHIC 2R2OA 2IO1B 3X0WA 2LWPA 4EZJA 3O65B 5E6JA 3W5UB 1TBEA 3IAS1 3H1UA 2D3GA 2CJNA 2LMCA 4WJOA 3TCAA 2EMTA 2N7EA 1JWMD 2K6QA 3HUIA 4HJGE 2RPVA 4MGYE 1ZE3D 3QK0A 4RGOS 2PMVA 4LNKA 4PS3A 4W9HA 4W9EA 2I2YA 2BYEA 2FE8A 2IPKD 2ZNVB 2HDEA 3GS2A 4W9IA 4ZRQA 4CHKA 3GP7A 1GJZA 1EUVB 1K50A 1SE4A 1KOTA 4G3XB 2XNAC 2LVQA 4DXGA 1WFYA 5CX3A 2G4SA 2LHDA 4HDQA 1SJHD 5I4DA 4NJCA 5EE3A 4LK0M 4FA6A 4TV3A 2SEBD 1I4HA 3I57A 4MSQB 1WYWB 3DQVA 3ZIMA 3ZQ4A 4OZBA 3URYA 4AJYB 2WU2B 3VUWA 2O6VD 2MA9B 1ZDVA 3UQBA 2D5GA 4ANVA 3NVZA 3CWIA 2K25A 4GN1A 1MVKA 2PJHA 2NVUI 1HZ5A 2BTEA 4MGZE 4W9JA 4HROA 3KYCD 2KJ6A 3TL5A 2CKHB 3Q6BA 5HKHA 4GU2A 2OJWA 4TKNA 5E6PA 1RM6C 1CQVA 2X8XX 1Z2MA 4TQ1A 4GOCA 3H7PA 5IKCM 4A3OA 1XCTL 2KT7A 1M4VA 2W55A 4L1BA 3ZVVA 1TS3A 3DBHB 4MACA 4J3OD 2KFKB 3DWMA 3C8YA 2QJLA 2V3SA 4YTPB 1N60A 4K81A 3NG0A 4DHJD 3EA6A 1L0VB 2GLSA 3VUYA 1P1AA 3VVWB 1AARA 1FRRA 2MJ3A 3L54A 4WWMA 1BXTA 2KO3A 2Z0EB 3PRPB 3NUHB 3PHWB 1SIFA 1WXMA 4RM9A 2NMQA 3L10B 3KYDD 2N7DA 4K7UA 1KTKA 4JQWC 3ZNGC 1ISNA 2LGIA 5HG2A 2CU3A 4DK5A 1CJEA 2V0GA 2LHEA 3E56A 5E6NA 3CSTA 3JSVA 3A4SC 4A9AA 2AWTA 2MHJA 1K8RB 1YJJA 1SF0A 2IBIB 1PQSA 2V3PA 3IVFA 3OJ4B 3SR6A 2Y5CA 2L52A 3R2IA 2BT6A 3R66C 2NPTA 2PVOD 1L4ZB 4FXCA 2FIFA 2LRWA 2JYTA 3MC8A 2LGXA 5BYQA 2NS5A 4HKQA 5BO4B 3NZSA 2HTHA 2GBRA 3FAHA 4LNFA 1WI0A 1XD3B 5CHVC 3EFCA 3KUZA 1KM7A 4WWPA 1ZXIA 4F7ZA 2ZVNA 3IAM1 1KLGD 3U8ZA 3LDZE 2IDYA 2A5UA 2WXQA 1V49A 4ARIA 4XYCA 1ZP0B 4ZRPA 3QHTA 1XLPA 4YSZB 1RYJA 1STEA 1HQRD 4C56C 2KQ7A 4X57B 2FCSA 1ET9A 2REXA 3TEYA 2Y5BB 2V4LA 1YD8U 2ASQA 3L13A 1GC6A 4US8A 2MEKA 3MJ5A 3P4SB 4LNNA 3R7RA 3A1QA 4W9DA 2G45B 1LGRA 4EZLA 1NDDA 1SSNA 1T6BX 2MCNB 3PREA 2DNFA 2MP2A 3RCZA 2IYDB 3DBLB 4PS8A 3Q14C 2W54A 1E8XA 1OQRA 2KYWA 4GLSC 2KVZA 3W9CB 1WMHA 1I4RA 3Q3MC 3QQ8B 3Q8FA 3KWVA 3ETRA 3ALBA 2RDHA 3PRZA 4GXBA 4OW0A 5BMIA 1YJ1A 1KF6B 2OJRA 2WNMA 1Q1OA 4MJSA 2G3QB 1LQBA 1P9DU 1C4PA 1YJIA 2L3ZA 3BYYB 4MSMB 2DYMA 1F1HA 1WF9A 2KTRA 2KTRB 1P7EA 2YEPB 1I4XA 2M17A 3QJZA 4OVUA 4ZOHC 2L8JA 2WWZA 3CMMB 3U7ZA 1FCCC 5HI1A 3H7SA 1WXAA 1WIAA 3PHXB 1NI3A 1YMHE 3R2TA 2XEWA 3SEBA 5C23A 4ZYSA 3EGRA 1U4AA 2WU5B 4OHJA 4ICVA 1NENB 3ZW3A 1JMLA 4K7WA 1VZ6A 3ZDTA 1XF5L 2N0SB 3N3KB 4JGHB 4LTUA 2L76A 3X23A 1TT5B 2WXIA 1GUAB 1VR9A 1SE2A 3ZNID 4PK1A 1A5RA 3JVZX 4FJYA 4ANUA 1A70A 3ECIA 4W9FA 3NRZA 4BFRA 2L05A 2QMTA 3U2SC 3ABVB 2LJ5A 2WXRA 4G11A 2MBQA 3MTNB 2RMMA 4FJZA 2FUHB 1ZXHA 3P42A 4AWJA 1UNSA 3RI7C 4CYEA 2WDTB 2INNE 4JWUC 1TS2A 2BW2A 1YQ4B 3VTUA 4HCNB 1CZPA 1FMAD 2HE7A 2C7HA 4HRSA 1AWDA 2JSVX 4NAMA 3H7PB 4IWQA 2KNBA 2M1MA 2BYFA 4BBNC 3AE9B 2ACZB 4FLHA 2IO2B 3VUXA 3OAWA 1UUPA 2PIAA 1LXDA 5L95C 2JYEA 2GBMA 1UELA 3MFGA 1XLOA 1TGZB 1TKEA 4FULA 3A33B 2IY0B 4JPSA 1VCBA 1V8CA 3PV1A 3DBRI 1N62A 3Q8BA 3SD5A 2K22A 4ZRIA 3T8MA 1C9FA 5J17A 1T0RC 3B0AA 4C00A 3CIRB 4LNIA 3VXWA 3H8HA 3L08A 4DDGD 1EU3A 1SBBB 2M19A 2FBWB 1VJKA 3QCAA 3ZO5B 5IP4D 2LI5A 1UH6A 3A9JB 1Q5WB 1ROEA 2Q5WD 4ICUA 4RF1A 1QKZA 5HFYA 5FR3A 1V5OA 4RM8A 4BKTA 2BKRB 3NHEB 2BBCA 2MLBA 4EZKA 3IXSA 4B0EA 3L16A 2RDBC 2HD5B 3RD2A 4KV2A 4WIPA 2RPQA 5MPOA 5EE0A 4WH4A 2W82A 4MDKE 4HK2A 3APCA 1V86A 3AE2B 4DXFA 1VRAB 1PUTA 3WCQA 2KACA 2KAJA 5AUIA 3DVNV 3V60A 4ASWC 4MELA 4NNJB 4DQOC 1WGKA 3JW0X 1V81A 4L2YA 2CHWA 3KW5B 1J19A 1FIQA 3DBHI 2CU1A 4S17A 5GXGB 3RNBC 3U4EG 4YTMB 1TTNA 3M3JA 3RNFC 4XZ4A 1WRIA 3DOWA 2CJOA 3AECB 3ZDMC 2I38A 1WXSA 4LCDE 3W5VB 4S0RA 1WGDA 1TS4A 2V3NA 4GGQA 4M8NA 1FM0D 3E9SA 3Q2AC 3RNAC 1E8YA 2LFIA 4AUQC 3Q3JA 4Q2JA 5DPTA 1AW7A 2RSUA 3BINA 1UBIA 3DWGC 3RULA 1MG8A 4MGKE 4KDLB 2FUG1 5C1ZA 1OTRB 1WJ6A 3I9V1 1OQYA 1MJDA 4A3PA 3AV8A 3OLMD 2JF5A 2O6VB 1JW9D 1OEYA 4FADA 3VDZA 1L7YA 3IT4B 3AE8B 3QC8B 4HCPB 2JQRB 1C4AA 4LLGM 4E74A 3TMPB 3W1SA 2C9WB 3NVVA 3ZXVA 4KGSA 1UF0A 1GG3A 2LGDA 1JWSD 4B0MA 2MWSB 3RZWC 5JXVA 1WE6A 2W9NA 4II3B 1WX8A 2ZW1A 3A9KB 3P2BA 3N1YC 1P98A 2XK5A 4PT5A 4F1SA 4C7YA 1PGAA 1C78A 3AB5A 4PYUA 2PTLA 4RMAA 1G6JA 3GE3C 3V3XA 2N9EB 2MBOA 4N6EB 1K53A 3RN9C 1NYRA 4IM0A 1Y56A 4ZDVA 2JZ3B 3SFEB 2EELA 3RZFA 1ZW7A 4BKSD 4EUTA 3PGEA 2ZJDA 3QWZB 4OVZA 3LYYA 3TJPA 2N9PC 2C5LC 2JWZA 3AE6B 2LZ6A 1YIWA 3C19A 3V61A 1E7UA 3M95A 2J53A 4XDCA 2NPTB 1I4QA 1QZEA 2WXHA 3WAPA 4RF0A 1WE7A 1WX9A 3P1MA 2L00B 1DOXA 4LNOA 1R4MI 2IGHA 4RNAA 3VH4B 1QILA 2IY1B 3B08A 1J7AA 1WX7A 4RGNA 5G55A 5D3IB 1RAXA 5D7GA 3ZKJC 1WRDB 1V9JA 4IWPA 4EKUA 4KZ0A 2O6VA 1MPEA 1IGDA 2KWVB 4XWWA 3UI3A 5GMVA 2INCC 2K39A 4GMVA 4ZHPA 1GPXA 4EEWA 1GC7A 2A4ZA 3RYTA 2N9LA 1E9MA 2GI9A 1TKYA 4WWNA 1VDVA 2YEPF 3JYUA 1KJTA 2YVCA 3DHHC 1WSPA 3PRMB 3DVGX 4JWSC 3N1ZC 2BS4B 2NTSA 4WURA 4G0NB 4GSWA 2G4DB 2RR9A 1WYGA 3AU5A 1I7HA 1EF5A 5TSSA 1WM2A 2PEAA 3ML8A 5FR6A 2KDBA 2K8HA 4LJOB 4MGIE 3QX1A 4C4VB 1D3ZA 5BYRA 2L7RA 3HVZA 3RPFC 2E3TA 2KJHB 1J8CA 3Q3NC 2ZCCA 1R7SA 1YNTE 1TKGA 2DENB 1TYGB 1R4MB 1KLUD 2W3SA 2UU7A 4GIVA 4TMAB 3TEXA 2IJ0A 1ZPSA 1JWAD 1B1ZA 3N32A 1SGHA 4XX5A 4JIOU 4ZRKA 1HTQA 2M8SA 2KC2A 3N9YC 1NBFC 2FIDA 4US9A 2CS4A 5BMHA 2WDRB 4DBGA 2CHZA 4KSLC 3HM3A 1Z5SB 4IG7B 4A90A 1S1QB 3BVZA 4GDKB 4CQNA 3BWUD 2JXXA 3WAOA 4JX1C 4KSKC 1M94A 2VH1A 4YXDB 4TUUA 2DZJA 4GDLB 2AQ2B 3Q8EA 2ZEQA 1WM3A 1C79A 1WGHA 4IW0A 1EF1A 1JROA 1XQQA 4NAWB 4B9KA 4OZCA 1E8WA 1UGJA 3EUB2 1WZ0A 1L6VA 4P6VF 4M01A 3M63B 2DWQA 2PW9A 4ZYNA 3VHTC 2KVRA 2D3BA 2ZNVC 4XWTA 4PYZA 3AEGB 4YWGG 1WGYA 1JCKB 4KVGB 2BWES 2JX5A 4KKIA 1MG4A 1YQBA 2FAZA 2QDFA 4AOFA 2EKEC 1YN3A 2MRPA 4DHJB 5D94A 3UF8A 5JH5C 3NJTA 3Q8AA 4BOSC 2JRIB 3U7DA 1UWMA 3B2FA 2QEJC 3Q8CA 1PGBA 3KUCB 3D32A 2HJ8A 1VLBA 4FHKA 1VD2A 3HK0A 3W1SC 3NZ3A 2INDC 2KN4A 4IWOA 2DZMA 2KANA 2LRUA 4N9F4 1RRBA 1GB4A 3PZ8A 3I3TB 3TEWA 3PZDA 1SEBD 5DPWA 3PLUA 4HKZE 2M56B 4P16A 2BYVE 4ANWA 2RGFA 1R4NI 2ZZPB 2MSED 1YQ3B 1GB1A 3MC0B 4NZLB 4IC7B 3NY5A 1ZOYB 2AL6A 4G50A 2D07B 1V97A 1IYFA 1QT9A 2VH2A 4HPLB 2D3AA 1T3QA 2DLBA 3Q69A 5TR5A 3R3MA 1WJNA 2XBBC 4HEA1 3ZJTA 3GZNB 1XO3A 2BF8B 4WJNA 5EE1A 4XC2A 2KDEB 1HE8A 2KWCA 1QOFA 2WXPA 3B9JA 1FD6A 4D2KA 4R3DA 4HJKA 1IUEA 1FFVA 3P4PB 4J6IA 4IOIE 3VR8B 4WJQA 3UINB 3P4QB 2MJDA 1UZXB 2HTME 1Q0WB 1ESFA 4KZCA 2Z59B 4P7IA 4HPPA 2WP9B 2HJ1A 3AE5B 3ZTDA 1RWSA 3QARA 2NCNA 1KH0A 3P63A 2N4FA 3ZUNA 3MJWA 1EM7A 1D5XC 3NZUA 1FXAA 4REZA 3ONSA 3PPAA 3B1LX 2WYQA 5E6OA 1ENFA 2IGDA 5IO9A 2PVGC 4TSSA 3SHQA 1T0QC 2BQQA 1S3SG 1V1PA 1Y8RC 4KX6B 2JY6A 4YSYB 2DAJA 3VTWA 2KHWB 3QA8A 4LDTB 3W2DA 3I5JC 2JZZA 2TSSA 1UWXA 1D4BA 1R4NB 1P0RA 3AU4A 2DYOA 4FJVB 1GAQB 5LLIA 1XLQA 2MBHA 1VZ7A 1WGRA 4RFBA 2AL3A 2RD0A 1ACCA 3APFA 2K6DB 2WXLA 3DDCB 3GZNI 2QC8A 2NBUA 2Y5PA 3B2GA 4AJWA 3DBRB 2WXGA 3HVDA 2G9HD 4MM3B 1V1OA 1YOVB 3EECA 1BUIC 3Q3OC 1I42A 1RFAA 2Z8LA 3IT6B 5AUKA 2KMAA 3TUOA 5DPRA 3HM6X 2KMCA 3K9PB 1ZDXA 3DHGC 5JHBA 2KQ4X 2NBVB 4HLEA 1PYWD 2MP2B 4RGTA
chains in the Genus database with same CATH topology
2WX1A 4PYUA 4RMAA 1G6JA 2GOWA 2YLMA 1WGGA 4JLCA 2IBIB 2N9EB 1PQSA 3AXCA 5KHQA 1JRUA 3IVFA 2MBOA 4WJPA 4BOZB 3RT3B 3OJ4B 4M8MA 4PS7A 3PT2B 1IPGA 2LGYA 2O2VB 4IM0A 4ZDVA 2JZ3B 5JHAA 1C1YB 3R66C 2NPTA 2DAFA 2I1JA 2K1FA 3RZFA 1ZW7A 4BKSD 2Z0DB 2FIFA 2LRWA 4EUTA 1ZKHA 2ZJDA 2LGXA 3PGEA 3QWZB 3LJ3A 4MM3A 2K8CA 2NS5A 3TJPA 5BO4B 2N9PC 3NZSA 4I6PA 2JUOA 2C5LC 2JWZA 2HTHA 2LZ6A 2L0FA 2B3AA 1YIWA 2GBRA 1F9JA 3ZRFA 2LXCA 3V61A 4WQOB 1E7UA 1WI0A 3M95A 3EC8A 1XD3B 1UGMA 2NPTB 5CHVC 3EHVA 2D2QA 3KUZA 1QZEA 3DBSA 1KM7A 3WAPA 1I35A 4W9CA 5AEKB 3PVLA 4NQLB 4WWPA 5EDSA 1WE7A 2MBEA 1WX9A 1LM8B 2IZVB 1YX5B 2J7QB 2L00B 2LUEA 4F7ZA 2C7NB 1UBQA 1V5TA 2ZVNA 1R4MI 3U8ZA 4OVVA 5KHOA 2IY1B 3LDZE 3VH4B 3B08A 1WX7A 2A5UA 3T9LA 4NJ7A 1V49A 2R2QA 5G55A 3VH3B 3QHTA 3IG3A 2WX0A 1RAXA 5AZGA 5D7GA 3ZKJC 1V6EA 2CR5A 1WRDB 2PE6B 1P3QU 1V9JA 4IWPA 4EKUA 4KZ0A 2O6VA 2KWVB 2J0JA 3ENEA 4NPNA 2KQ7A 4B6WA 2D10A 5GMVA 4X57B 2FCSA 1WMHB 2K39A 4GMVA 4W9KA 2REXA 2Y5BB 2V4LA 4K1RB 1YD8U 2ASQA 4EEWA 5D2MB 3L13A 1GC6A 2IO0B 4HWIB 3R7RA 3A1QA 1GC7A 2A4ZA 4NY0A 4W9DA 3RYTA 1WXVA 1BT0A 2G45B 4WWNA 2N9XA 2BGFA 2YVCA 1KJTA 3JYUA 3KVFB 1NDDA 4EFOA 4EZLA 2MW5A 2MCNB 3PRMB 3PREA 3SDLC 3DVGX 1C3TA 2D11A 3OJ3A 2MP2A 1WJUA 4G0NB 4GDLA 4GSWA 2G4DB 2RR9A 3MHSD 3RCZA 2IYDB 3QIJA 4PS8A 3AI5A 2KC1A 4NJ6A 2KXJA 3AU5A 3N30A 1E8XA 1EF5A 2LASA 1WMHA 1WM2A 2PPHA 4E3CA 2PEAA 2NR2A 3ML8A 4W9LA 3KUDB 5DPSA 2LVOA 5FR6A 1EO6A 3QQ8B 3VQIA 3A4RA 3ALBA 2KDBA 2JT4B 2K8HA 4LJOB 1WR1A 3QX1A 4MGIE 2GBKA 5LXHA 1D3ZA 3DVNU 2L7RA 3PRZA 4GXBA 3IHPC 2EMSA 3M62B 2KJHB 1YJ1A 1J8CA 4FN2A 2OJRA 2NBWB 3DCGA 1KLVA 2ZCCA 1Q1OA 4MJSA 2G3QB 1LQBA 1P9DU 4IUMB 2BPSA 2AYOB 3WALA 2L3ZA 2DENB 1UD7A 3V6CB 2GBNA 2MX2A 5AZHA 4MSMB 2DYMA 4GIVA 1WF9A 4CO7A 5JZEB 4I6LB 2KLCA 3DVGY 1WH3A 2KTRA 3DBLI 2KTRB 5IA7A 2BWFA 1V80A 3N32A 1SGHA 2M17A 2LVPA 4XX5A 3QJZA 4JIOU 4OVUA 2L8JA 2WWZA 3CMMB 3S2AA 5CTRC 4ZRKA 4LJPB 2DYBA 3WAMA 3H7SA 1WXAA 4GB9A 2M8SA 4LDTD 1WIAA 3PHXB 4M0WB 2UWQA 4WWOA 1IP9A 2KC2A 2C60A 2XEWA 3QAQA 1NBFC 1X1MA 5C23A 2FIDA 2JRHA 2CS4A 2BKFA 3ZLZA 1E7VA 1U4AA 3VFKA 2ZPYA 4DBGA 1TZ1A 2CHZA 4ICVA 1V2YA 4IM3A 2KLGA 4KSLC 4FBJB 1RLFA 3HM3A 3VAWA 3ZW3A 1Z5SB 2LD9A 4K7WA 4IG7B 3ZDTA 3N3KB 1S1QB 2JPHA 2KQSA 4JGHB 4JL9A 2L76A 5AZFA 3X23A 2K8BA 2KX0A 4GDKB 5J2RA 4BKSA 3TBLD 2GMIC 4W9GA 1GUAB 1OGWA 2JXXA 1T0YA 3WAOA 4KSKC 1H4RA 3ZNID 1NI2A 1M94A 1A5RA 4TUUA 2FCMA 4NAWA 1FXTB 2DZJA 2MQJA 2ZVOA 3JVZX 4FJYA 4GDLB 4ANUA 4F8CB 3TIXA 3ECIA 2I1KA 4FHJA 2KWUB 2ZEQA 4W9FA 2J0KA 1WM3A 2KN5A 3H6NA 4BFRA 1WGHA 2L05A 1GNUA 4IW0A 3UIPB 1EF1A 1XQQA 2LJ5A 3DPDA 3U30A 4NAWB 3NOBA 1CMXB 4B9KA 4G11A 1E8WA 2MBQA 1WZ0A 3MTNB 4FJZA 1H8CA 2FUHB 1OEYJ 3VTVA 4AWJA 3M63B 2KX3A 4ZYNA 3VHTC 4KIKA 4CYEA 3KH0A 2KVRA 2KOXA 2WDTB 3HHMA 2ZNVC 4K7SA 4PYZA 4II2B 4AP4C 4BVUC 3VTUA 4BKGA 4HCNB 1WGYA 4DDID 2BWES 3JSVB 4KVGB 2HE7A 4TQ0A 2C7HA 4I6NB 4YL8A 3CF6E 1YQBA 3H7PB 2FAZA 4AOFA 4IWQA 2EKEC 1E90A 2KNBA 3BY4B 4GDKA 2MRPA 2M1MA 2ZPNA 5D94A 1WR6E 2GBJA 2BYFA 3GOEA 4NQKE 3UF8A 2N1VA 3UIOB 2L0TA 4MH0E 5JH5C 3W1YA 4BBNC 4MEMA 3R7QA 4BOSC 2JRIB 3EFUA 4FLHA 3U7DA 2IO2B 3VUXA 4B95A 3PLVA 3UGBB 3OAWA 2CHXA 2DZIA 2KDIA 2KFJA 1LXDA 3A1QB 5L95C 2C7MB 5LXIB 5CHFA 3ZTCA 4DHJB 2GBMA 1UELA 3KUCB 5D6JB 3D32A 1TGZB 2R2OA 2IO1B 3X0WA 2HJ8A 4FULA 5G2NA 2LWPA 4FHKA 4EZJA 3A33B 1VD2A 2IY0B 3HK0A 3ML9A 3O65B 1VCBA 5J18A 3PV1A 3W1SC 3ZNZB 1TBEA 3DBRI 3IBEA 4IWOA 3H1UA 3SD5A 2D3GA 3A9KA 2DZMA 2KANA 4WJOA 4ZRIA 2LRUA 4N9F4 3T8MA 1RRBA 3TCAA 5J17A 2EMTA 3B0AA 2N7EA 3I3TB 2V1YA 2ZCBA 3PZDA 1XT9B 2K6QA 4HVBA 3VXWA 4URKA 5DPWA 4MGYE 3PLUA 3QK0A 3L08A 4DDGD 3NS8A 3QCAA 2BYVE 3ZO5B 4ANWA 2KFKA 2LI5A 2RGFA 3Q3FA 4PS3A 1UH6A 1R4NI 4W9HA 4W9EA 2DZKA 2BYEA 3A9JB 2M0XA 3A9JA 1Q5WB 2ZZPB 4ICUA 4A20A 2MSED 2ZNVB 2IO3B 1ZGUB 1J0GA 4IC7B 3NY5A 4W9IA 2AL6A 4G50A 1V5OA 2D07B 4RM8A 2KKCA 2DHZA 2BKRB 3NHEB 4BKTA 2MLBA 4HXDA 4CHKA 1IYFA 4EZKA 4HPLB 2FCNA 2VRRB 1GJZA 5TR5A 3R3MA 3L16A 1EUVB 3L0WB 2HD5B 1WJNA 3L17A 2XBBC 4KV2A 2RPQA 3RD2A 1KOTA 4G3XB 2BF8B 4WJNA 2LVQA 1WFYA 4XC2A 4MDKE 2KDEB 4HK2A 5CX3A 1HE8A 3APCA 1V86A 2KWCA 2G4SA 2KK8A 4HDOA 2KZRA 4HJKA 4HDQA 3ZNHB 3V6EB 3CSFA 4WAAA 2N1WA 4J6IA 3DVNV 4WJQA 3UINB 4FA6A 4TV3A 2QHOA 3K9OB 3V60A 4ASWC 4MELA 1UZXB 4NNJB 3JW0X 1V81A 1Q0WB 2CHWA 3KW5B 4MSQB 1WYWB 3DQVA 4KZCA 1J19A 2Z59B 4P7IA 3ZIMA 3DBHI 4AJYB 2CU1A 3VUWA 2O6VD 2MA9B 3UQBA 3ZTDA 4ANVA 3QARA 2NCNA 2N4FA 2FNJB 1TTNA 3M3JA 3ZUNA 3MJWA 3WIMA 2K25A 1YX6B 4GN1A 4XZ4A 3DOWA 3WA0A 3NZUA 2PJHA 2XK5B 1L2NA 1E8ZA 2M4NA 2NVUI 3ONSA 3ZDMC 4MGZE 4W9JA 3UQAA 3PPAA 1WXSA 3B1LX 4LCDE 4DHZB 2WYQA 5E6OA 3KYCD 2KJ6A 1WGDA 3TL5A 3APDA 2CKHB 4GGQA 4KIKB 3H9DA 4M8NA 3SHQA 3V62A 4KDIC 5HKHA 4GU2A 1S3SG 4TKNA 2KD0A 1E8YA 5E6PA 1WY8A 1Y8RC 2JY6A 2DAJA 3VTWA 4DHZE 4E71A 2KHWB 4AUQC 3Q3JA 1Z2MA 2KDFB 2KJRA 3QA8A 4TQ1A 1E5WA 4DXAB 4LDTB 4EOYA 5DPTA 2RSUA 2JZZA 4GOCA 3H7PA 3BINA 4A3OA 1UBIA 1P0RA 3AU4A 2DYOA 3RULA 1MG8A 4FJVB 4MGKE 5LLIA 3ZVVA 4KDLB 2MBHA 5C1ZA 1OTRB 1WJ6A 2KFKB 1OQYA 2UYZB 1SE9A 3RUIB 4A3PA 3OLMD 2JF5A 2V3SA 1WGRA 2O6VB 1OEYA 2AL3A 3PS6A 2RD0A 4FADA 4K81A 2J0MA 3APFA 4IM2A 2K6DB 3VDZA 4DHJD 1L7YA 2FCQA 3VUYA 1P1AA 3VVWB 1AARA 3DDCB 3GZNI 4DWFA 3L54A 2NBUA 2KO3A 2Z0EB 3PRPB 4AJWA 3IFWB 4ANXA 3PHWB 3PTFC 3QC8B 4HCPB 1SIFA 1WJ4A 4E74A 3EECA 3TMPB 1WXMA 2C9WB 3W1SA 5DCNA 4RM9A 1GG3A 3L10B 3KYDD 1I42A 2N7DA 4K7UA 1LFDA 2DX5B 3HIZA 1RFAA 4JQWC 3ZNGC 1ISNA 2LGDA 3WANA 2OOBB 4BBNF 2KMAA 2MWSB 3RZWC 5L83A 4DK5A 1WZ3A 5DPRA 1WE6A 5IAAC 2W9NA 4II3B 1WX8A 3HM6X 3A9KB 3P2BA 3ZRCA 3PSEB 2JVCA 3AULA 3C0RB 2KMCA 3K9PB 4ZRJA 5JHBA 1P98A 2XK5A 2NBVB 5E6NA 2AEHA 3CSTA 4MJSB 3SU8X 4HLEA 2MBBB 3A4SC 3JSVA 2AWTA 5CHWA 4F1SA 2PE9A 2KTFA 1K8RB 4HPMB 2MP2B 2LXAA 2O2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WX1 A;  4PYU A;  4RMA A;  1G6J A;  2GOW A;  2YLM A;  1WGG A;  4JLC A;  2IBI B;  2N9E B;  1PQS A;  3AXC A;  5KHQ A;  1JRU A;  3IVF A;  2MBO A;  4WJP A;  4BOZ B;  3RT3 B;  3OJ4 B;  4M8M A;  4PS7 A;  3PT2 B;  1IPG A;  2LGY A;  2O2V B;  4IM0 A;  4ZDV A;  2JZ3 B;  5JHA A;  1C1Y B;  3R66 C;  2NPT A;  2DAF A;  2I1J A;  2K1F A;  3RZF A;  1ZW7 A;  4BKS D;  2Z0D B;  2FIF A;  2LRW A;  4EUT A;  1ZKH A;  2ZJD A;  2LGX A;  3PGE A;  3QWZ B;  3LJ3 A;  4MM3 A;  2K8C A;  2NS5 A;  3TJP A;  5BO4 B;  2N9P C;  3NZS A;  4I6P A;  2JUO A;  2C5L C;  2JWZ A;  2HTH A;  2LZ6 A;  2L0F A;  2B3A A;  1YIW A;  2GBR A;  1F9J A;  3ZRF A;  2LXC A;  3V61 A;  4WQO B;  1E7U A;  1WI0 A;  3M95 A;  3EC8 A;  1XD3 B;  1UGM A;  2NPT B;  5CHV C;  3EHV A;  2D2Q A;  3KUZ A;  1QZE A;  3DBS A;  1KM7 A;  3WAP A;  1I35 A;  4W9C A;  5AEK B;  3PVL A;  4NQL B;  4WWP A;  5EDS A;  1WE7 A;  2MBE A;  1WX9 A;  1LM8 B;  2IZV B;  1YX5 B;  2J7Q B;  2L00 B;  2LUE A;  4F7Z A;  2C7N B;  1UBQ A;  1V5T A;  2ZVN A;  1R4M I;  3U8Z A;  4OVV A;  5KHO A;  2IY1 B;  3LDZ E;  3VH4 B;  3B08 A;  1WX7 A;  2A5U A;  3T9L A;  4NJ7 A;  1V49 A;  2R2Q A;  5G55 A;  3VH3 B;  3QHT A;  3IG3 A;  2WX0 A;  1RAX A;  5AZG A;  5D7G A;  3ZKJ C;  1V6E A;  2CR5 A;  1WRD B;  2PE6 B;  1P3Q U;  1V9J A;  4IWP A;  4EKU A;  4KZ0 A;  2O6V A;  2KWV B;  2J0J A;  3ENE A;  4NPN A;  2KQ7 A;  4B6W A;  2D10 A;  5GMV A;  4X57 B;  2FCS A;  1WMH B;  2K39 A;  4GMV A;  4W9K A;  2REX A;  2Y5B B;  2V4L A;  4K1R B;  1YD8 U;  2ASQ A;  4EEW A;  5D2M B;  3L13 A;  1GC6 A;  2IO0 B;  4HWI B;  3R7R A;  3A1Q A;  1GC7 A;  2A4Z A;  4NY0 A;  4W9D A;  3RYT A;  1WXV A;  1BT0 A;  2G45 B;  4WWN A;  2N9X A;  2BGF A;  2YVC A;  1KJT A;  3JYU A;  3KVF B;  1NDD A;  4EFO A;  4EZL A;  2MW5 A;  2MCN B;  3PRM B;  3PRE A;  3SDL C;  3DVG X;  1C3T A;  2D11 A;  3OJ3 A;  2MP2 A;  1WJU A;  4G0N B;  4GDL A;  4GSW A;  2G4D B;  2RR9 A;  3MHS D;  3RCZ A;  2IYD B;  3QIJ A;  4PS8 A;  3AI5 A;  2KC1 A;  4NJ6 A;  2KXJ A;  3AU5 A;  3N30 A;  1E8X A;  1EF5 A;  2LAS A;  1WMH A;  1WM2 A;  2PPH A;  4E3C A;  2PEA A;  2NR2 A;  3ML8 A;  4W9L A;  3KUD B;  5DPS A;  2LVO A;  5FR6 A;  1EO6 A;  3QQ8 B;  3VQI A;  3A4R A;  3ALB A;  2KDB A;  2JT4 B;  2K8H A;  4LJO B;  1WR1 A;  3QX1 A;  4MGI E;  2GBK A;  5LXH A;  1D3Z A;  3DVN U;  2L7R A;  3PRZ A;  4GXB A;  3IHP C;  2EMS A;  3M62 B;  2KJH B;  1YJ1 A;  1J8C A;  4FN2 A;  2OJR A;  2NBW B;  3DCG A;  1KLV A;  2ZCC A;  1Q1O A;  4MJS A;  2G3Q B;  1LQB A;  1P9D U;  4IUM B;  2BPS A;  2AYO B;  3WAL A;  2L3Z A;  2DEN B;  1UD7 A;  3V6C B;  2GBN A;  2MX2 A;  5AZH A;  4MSM B;  2DYM A;  4GIV A;  1WF9 A;  4CO7 A;  5JZE B;  4I6L B;  2KLC A;  3DVG Y;  1WH3 A;  2KTR A;  3DBL I;  2KTR B;  5IA7 A;  2BWF A;  1V80 A;  3N32 A;  1SGH A;  2M17 A;  2LVP A;  4XX5 A;  3QJZ A;  4JIO U;  4OVU A;  2L8J A;  2WWZ A;  3CMM B;  3S2A A;  5CTR C;  4ZRK A;  4LJP B;  2DYB A;  3WAM A;  3H7S A;  1WXA A;  4GB9 A;  2M8S A;  4LDT D;  1WIA A;  3PHX B;  4M0W B;  2UWQ A;  4WWO A;  1IP9 A;  2KC2 A;  2C60 A;  2XEW A;  3QAQ A;  1NBF C;  1X1M A;  5C23 A;  2FID A;  2JRH A;  2CS4 A;  2BKF A;  3ZLZ A;  1E7V A;  1U4A A;  3VFK A;  2ZPY A;  4DBG A;  1TZ1 A;  2CHZ A;  4ICV A;  1V2Y A;  4IM3 A;  2KLG A;  4KSL C;  4FBJ B;  1RLF A;  3HM3 A;  3VAW A;  3ZW3 A;  1Z5S B;  2LD9 A;  4K7W A;  4IG7 B;  3ZDT A;  3N3K B;  1S1Q B;  2JPH A;  2KQS A;  4JGH B;  4JL9 A;  2L76 A;  5AZF A;  3X23 A;  2K8B A;  2KX0 A;  4GDK B;  5J2R A;  4BKS A;  3TBL D;  2GMI C;  4W9G A;  1GUA B;  1OGW A;  2JXX A;  1T0Y A;  3WAO A;  4KSK C;  1H4R A;  3ZNI D;  1NI2 A;  1M94 A;  1A5R A;  4TUU A;  2FCM A;  4NAW A;  1FXT B;  2DZJ A;  2MQJ A;  2ZVO A;  3JVZ X;  4FJY A;  4GDL B;  4ANU A;  4F8C B;  3TIX A;  3ECI A;  2I1K A;  4FHJ A;  2KWU B;  2ZEQ A;  4W9F A;  2J0K A;  1WM3 A;  2KN5 A;  3H6N A;  4BFR A;  1WGH A;  2L05 A;  1GNU A;  4IW0 A;  3UIP B;  1EF1 A;  1XQQ A;  2LJ5 A;  3DPD A;  3U30 A;  4NAW B;  3NOB A;  1CMX B;  4B9K A;  4G11 A;  1E8W A;  2MBQ A;  1WZ0 A;  3MTN B;  4FJZ A;  1H8C A;  2FUH B;  1OEY J;  3VTV A;  4AWJ A;  3M63 B;  2KX3 A;  4ZYN A;  3VHT C;  4KIK A;  4CYE A;  3KH0 A;  2KVR A;  2KOX A;  2WDT B;  3HHM A;  2ZNV C;  4K7S A;  4PYZ A;  4II2 B;  4AP4 C;  4BVU C;  3VTU A;  4BKG A;  4HCN B;  1WGY A;  4DDI D;  2BWE S;  3JSV B;  4KVG B;  2HE7 A;  4TQ0 A;  2C7H A;  4I6N B;  4YL8 A;  3CF6 E;  1YQB A;  3H7P B;  2FAZ A;  4AOF A;  4IWQ A;  2EKE C;  1E90 A;  2KNB A;  3BY4 B;  4GDK A;  2MRP A;  2M1M A;  2ZPN A;  5D94 A;  1WR6 E;  2GBJ A;  2BYF A;  3GOE A;  4NQK E;  3UF8 A;  2N1V A;  3UIO B;  2L0T A;  4MH0 E;  5JH5 C;  3W1Y A;  4BBN C;  4MEM A;  3R7Q A;  4BOS C;  2JRI B;  3EFU A;  4FLH A;  3U7D A;  2IO2 B;  3VUX A;  4B95 A;  3PLV A;  3UGB B;  3OAW A;  2CHX A;  2DZI A;  2KDI A;  2KFJ A;  1LXD A;  3A1Q B;  5L95 C;  2C7M B;  5LXI B;  5CHF A;  3ZTC A;  4DHJ B;  2GBM A;  1UEL A;  3KUC B;  5D6J B;  3D32 A;  1TGZ B;  2R2O A;  2IO1 B;  3X0W A;  2HJ8 A;  4FUL A;  5G2N A;  2LWP A;  4FHK A;  4EZJ A;  3A33 B;  1VD2 A;  2IY0 B;  3HK0 A;  3ML9 A;  3O65 B;  1VCB A;  5J18 A;  3PV1 A;  3W1S C;  3ZNZ B;  1TBE A;  3DBR I;  3IBE A;  4IWO A;  3H1U A;  3SD5 A;  2D3G A;  3A9K A;  2DZM A;  2KAN A;  4WJO A;  4ZRI A;  2LRU A;  4N9F 4;  3T8M A;  1RRB A;  3TCA A;  5J17 A;  2EMT A;  3B0A A;  2N7E A;  3I3T B;  2V1Y A;  2ZCB A;  3PZD A;  1XT9 B;  2K6Q A;  4HVB A;  3VXW A;  4URK A;  5DPW A;  4MGY E;  3PLU A;  3QK0 A;  3L08 A;  4DDG D;  3NS8 A;  3QCA A;  2BYV E;  3ZO5 B;  4ANW A;  2KFK A;  2LI5 A;  2RGF A;  3Q3F A;  4PS3 A;  1UH6 A;  1R4N I;  4W9H A;  4W9E A;  2DZK A;  2BYE A;  3A9J B;  2M0X A;  3A9J A;  1Q5W B;  2ZZP B;  4ICU A;  4A20 A;  2MSE D;  2ZNV B;  2IO3 B;  1ZGU B;  1J0G A;  4IC7 B;  3NY5 A;  4W9I A;  2AL6 A;  4G50 A;  1V5O A;  2D07 B;  4RM8 A;  2KKC A;  2DHZ A;  2BKR B;  3NHE B;  4BKT A;  2MLB A;  4HXD A;  4CHK A;  1IYF A;  4EZK A;  4HPL B;  2FCN A;  2VRR B;  1GJZ A;  5TR5 A;  3R3M A;  3L16 A;  1EUV B;  3L0W B;  2HD5 B;  1WJN A;  3L17 A;  2XBB C;  4KV2 A;  2RPQ A;  3RD2 A;  1KOT A;  4G3X B;  2BF8 B;  4WJN A;  2LVQ A;  1WFY A;  4XC2 A;  4MDK E;  2KDE B;  4HK2 A;  5CX3 A;  1HE8 A;  3APC A;  1V86 A;  2KWC A;  2G4S A;  2KK8 A;  4HDO A;  2KZR A;  4HJK A;  4HDQ A;  3ZNH B;  3V6E B;  3CSF A;  4WAA A;  2N1W A;  4J6I A;  3DVN V;  4WJQ A;  3UIN B;  4FA6 A;  4TV3 A;  2QHO A;  3K9O B;  3V60 A;  4ASW C;  4MEL A;  1UZX B;  4NNJ B;  3JW0 X;  1V81 A;  1Q0W B;  2CHW A;  3KW5 B;  4MSQ B;  1WYW B;  3DQV A;  4KZC A;  1J19 A;  2Z59 B;  4P7I A;  3ZIM A;  3DBH I;  4AJY B;  2CU1 A;  3VUW A;  2O6V D;  2MA9 B;  3UQB A;  3ZTD A;  4ANV A;  3QAR A;  2NCN A;  2N4F A;  2FNJ B;  1TTN A;  3M3J A;  3ZUN A;  3MJW A;  3WIM A;  2K25 A;  1YX6 B;  4GN1 A;  4XZ4 A;  3DOW A;  3WA0 A;  3NZU A;  2PJH A;  2XK5 B;  1L2N A;  1E8Z A;  2M4N A;  2NVU I;  3ONS A;  3ZDM C;  4MGZ E;  4W9J A;  3UQA A;  3PPA A;  1WXS A;  3B1L X;  4LCD E;  4DHZ B;  2WYQ A;  5E6O A;  3KYC D;  2KJ6 A;  1WGD A;  3TL5 A;  3APD A;  2CKH B;  4GGQ A;  4KIK B;  3H9D A;  4M8N A;  3SHQ A;  3V62 A;  4KDI C;  5HKH A;  4GU2 A;  1S3S G;  4TKN A;  2KD0 A;  1E8Y A;  5E6P A;  1WY8 A;  1Y8R C;  2JY6 A;  2DAJ A;  3VTW A;  4DHZ E;  4E71 A;  2KHW B;  4AUQ C;  3Q3J A;  1Z2M A;  2KDF B;  2KJR A;  3QA8 A;  4TQ1 A;  1E5W A;  4DXA B;  4LDT B;  4EOY A;  5DPT A;  2RSU A;  2JZZ A;  4GOC A;  3H7P A;  3BIN A;  4A3O A;  1UBI A;  1P0R A;  3AU4 A;  2DYO A;  3RUL A;  1MG8 A;  4FJV B;  4MGK E;  5LLI A;  3ZVV A;  4KDL B;  2MBH A;  5C1Z A;  1OTR B;  1WJ6 A;  2KFK B;  1OQY A;  2UYZ B;  1SE9 A;  3RUI B;  4A3P A;  3OLM D;  2JF5 A;  2V3S A;  1WGR A;  2O6V B;  1OEY A;  2AL3 A;  3PS6 A;  2RD0 A;  4FAD A;  4K81 A;  2J0M A;  3APF A;  4IM2 A;  2K6D B;  3VDZ A;  4DHJ D;  1L7Y A;  2FCQ A;  3VUY A;  1P1A A;  3VVW B;  1AAR A;  3DDC B;  3GZN I;  4DWF A;  3L54 A;  2NBU A;  2KO3 A;  2Z0E B;  3PRP B;  4AJW A;  3IFW B;  4ANX A;  3PHW B;  3PTF C;  3QC8 B;  4HCP B;  1SIF A;  1WJ4 A;  4E74 A;  3EEC A;  3TMP B;  1WXM A;  2C9W B;  3W1S A;  5DCN A;  4RM9 A;  1GG3 A;  3L10 B;  3KYD D;  1I42 A;  2N7D A;  4K7U A;  1LFD A;  2DX5 B;  3HIZ A;  1RFA A;  4JQW C;  3ZNG C;  1ISN A;  2LGD A;  3WAN A;  2OOB B;  4BBN F;  2KMA A;  2MWS B;  3RZW C;  5L83 A;  4DK5 A;  1WZ3 A;  5DPR A;  1WE6 A;  5IAA C;  2W9N A;  4II3 B;  1WX8 A;  3HM6 X;  3A9K B;  3P2B A;  3ZRC A;  3PSE B;  2JVC A;  3AUL A;  3C0R B;  2KMC A;  3K9P B;  4ZRJ A;  5JHB A;  1P98 A;  2XK5 A;  2NBV B;  5E6N A;  2AEH A;  3CST A;  4MJS B;  3SU8 X;  4HLE A;  2MBB B;  3A4S C;  3JSV A;  2AWT A;  5CHW A;  4F1S A;  2PE9 A;  2KTF A;  1K8R B;  4HPM B;  2MP2 B;  2LXA A;  2O2V A; 
#chains in the Genus database with same CATH topology
 2OED A;  2GOW A;  2YLM A;  4JE3 B;  2K3U A;  5G5G A;  4WJP A;  4WQM A;  3RT3 B;  3GB1 A;  4M8M A;  2GB1 A;  2LGY A;  5JHA A;  1C1Y B;  3LXF A;  1VZ8 A;  2DAF A;  2I1J A;  3V05 A;  2Z0D B;  3N20 C;  3O13 A;  3BII D;  5C2T B;  2K8C A;  1N61 A;  2W3R A;  2OHF A;  4ARC A;  2L0F A;  2B3A A;  1PDX A;  4WQO B;  1FEH A;  2LUM A;  1UGM A;  3EHV A;  4N59 A;  2D2Q A;  1FRD A;  1K51 A;  1D6E C;  4W9C A;  3PVL A;  5EDS A;  2MBE A;  1F0Z A;  1YX5 B;  4MH8 A;  4YT0 B;  1FCL A;  4OVV A;  5KHO A;  4C7Z A;  2R2Q A;  3VH3 B;  1FO4 A;  2IGG A;  3IG3 A;  2WX0 A;  2WXJ A;  1D5M C;  1JWU D;  2PE6 B;  2JU6 X;  1B9R A;  1EU4 A;  2QIE B;  1EWY C;  4B6W A;  5IOI A;  4W9K A;  4K1R B;  3OWE B;  2IO0 B;  3BVM A;  4A8X C;  3PZ7 A;  4NY0 A;  1WXV A;  1BT0 A;  3AEA B;  1HEZ E;  2BGF A;  2M0A A;  2MW5 A;  3AE3 B;  3SDL C;  5LNK 1;  3FIL B;  1C3T A;  3OJ3 A;  5G5H A;  1WJU A;  1E6E B;  1E7P B;  3QIJ A;  1RFK A;  2KC1 A;  3NVW A;  2LJI A;  5T8I A;  1KRH A;  2PPH A;  2NR2 A;  3AN1 A;  4W9L A;  3KUD B;  2LVO A;  4UDU C;  1EO6 A;  1P7F A;  2WXK A;  2INP E;  3A4R A;  2EKI A;  4C80 A;  2V9H A;  3IHP C;  2EMS A;  2NBW B;  1KLV A;  2X38 A;  3NS1 A;  4IUM B;  1QOA A;  2BPS A;  2AYO B;  3WAL A;  1SE3 A;  2MJE A;  1L6U A;  3V6C B;  2MX2 A;  5AZH A;  1AN8 A;  3BK2 A;  3AH7 A;  5JZE B;  2PKO A;  3VR9 B;  1WH3 A;  1GOZ A;  4A55 A;  3DBL I;  2BWF A;  1V80 A;  1MI0 A;  3S2A A;  1I4G A;  4LJP B;  1WXQ A;  4LDT D;  2UWQ A;  4WWO A;  1IP9 A;  2VZK D;  3QAQ A;  1X1M A;  5BMG A;  2JRH A;  2WS3 B;  3ZLZ A;  1E7V A;  4IM3 A;  2KLG A;  4FBJ B;  1FFU A;  1RLF A;  2JPH A;  3AEB B;  2QCZ A;  4BKS A;  3TBL D;  4BZA A;  4W9G A;  1H4R A;  1IGC A;  4KGR A;  1NI2 A;  3MHZ A;  2FCM A;  4NAW A;  1FXT B;  2MQJ A;  4F8C B;  2G1E A;  2J0K A;  4O1N A;  1GNU A;  3UIP B;  3N1X C;  2AX5 A;  3ZYY X;  1C76 A;  3DPD A;  3NOB A;  1CMX B;  3VTV A;  4C4V A;  2KX3 A;  2Y3A A;  4KIK A;  3KH0 A;  1DYQ A;  4II2 B;  4AP4 C;  3AEF B;  4BKG A;  4DDI D;  3JSV B;  4TQ0 A;  1KFY B;  4YL8 A;  3CF6 E;  1DGJ A;  1E90 A;  3BY4 B;  2ZPN A;  1WR6 E;  4NQK E;  2N1V A;  1V1P B;  4M00 A;  4ZHO A;  4MEM A;  3R7Q A;  4B95 A;  3PLV A;  3UGB B;  5BYS A;  1QQR A;  2CHX A;  2KFJ A;  3I63 C;  2H89 B;  5IN7 A;  1FNW A;  5LXI B;  3ZTC A;  1SJE D;  5D6J B;  3T3N A;  3U52 E;  3VRA B;  5G2N A;  2D3C A;  5J18 A;  3ML9 A;  4A6Q A;  3ZNZ B;  3IBE A;  1L0X B;  3A9K A;  1L4D B;  1FPY A;  3BK1 A;  2V1Y A;  4XDD A;  2ZCB A;  3AM9 A;  1XT9 B;  4HVB A;  1FXI A;  2BS3 B;  4URK A;  2WLB A;  3NS8 A;  2KFK A;  3Q3F A;  1XCQ L;  2DZK A;  3ZXR A;  2M0X A;  3A9J A;  4A20 A;  2RDG A;  1Q10 A;  2IO3 B;  5FKA C;  1ZGU B;  1J0G A;  2KKC A;  2DHZ A;  2L1A A;  4HXD A;  2FCN A;  2VRR B;  1HZ6 A;  1OQQ A;  3L0W B;  3L17 A;  2QSD A;  2DBY A;  2WQY B;  2BVC A;  2KK8 A;  1XLN A;  4HDO A;  2KZR A;  3ZNH B;  3V6E B;  2LGS A;  1TY0 A;  4WAA A;  1SIJ A;  2N1W A;  3CSF A;  2WXM A;  4P1C C;  3AEE B;  2QHO A;  3K9O B;  2JWU A;  3RNC C;  1BML C;  2ON8 A;  3FIL A;  4QAY A;  1QF6 A;  1JWB D;  3KQ4 A;  1YN4 A;  1TJE A;  2BS2 B;  2FNJ B;  3AE7 B;  3WIM A;  1C4C A;  1YX6 B;  2VZK B;  3WA0 A;  4KGT A;  2XK5 B;  2MH7 A;  1L2N A;  1N63 A;  1E8Z A;  2M4N A;  4ITK A;  3UQA A;  3T3O A;  4DHZ B;  3APD A;  4KIK B;  3AED B;  3H9D A;  3V62 A;  4KDI C;  3FKY A;  2WXO A;  1F2R I;  3RNG C;  2KD0 A;  1WY8 A;  1N6Z A;  3AE4 B;  4DHZ E;  4E71 A;  3ZJV A;  2ONQ A;  2KDF B;  3BZD B;  2KJR A;  3MP9 A;  1E5W A;  3OG5 A;  4DXA B;  4EOY A;  4ACF A;  3BYT B;  2SAK A;  4YTN B;  2UYZ B;  1SE9 A;  3RUI B;  1L5P A;  2L32 A;  1CK1 A;  1E10 A;  5FK9 C;  3PS6 A;  2H88 B;  2LEK A;  3RNE C;  2J0M A;  4IM2 A;  2FCQ A;  4DWF A;  2KDM A;  2AQ1 B;  3IFW B;  4WAF A;  4ANX A;  3PTF C;  1QLB B;  2N9K A;  1WJ4 A;  3KLS X;  5DCN A;  1I4P A;  1LFD A;  2DX5 B;  3HIZ A;  1F77 A;  1XEE A;  3WAN A;  2OOB B;  4BBN F;  1MHH E;  5H8Y E;  2B76 B;  5L83 A;  1WWT A;  1WZ3 A;  5IAA C;  3HRD D;  2BYT A;  1F2R C;  3ZRC A;  1JRP A;  3PSE B;  2JVC A;  3AUL A;  3C0R B;  2ICI A;  3AMZ A;  4ZRJ A;  3R8B A;  3FC4 A;  2BB5 A;  1HXY D;  1F52 A;  2AEH A;  4MJS B;  3SU8 X;  2MBB B;  1SXT A;  5CHW A;  2PE9 A;  2KTF A;  4HPM B;  2LXA A;  1EWC A;  2O2V A;  2WX1 A;  1QOG A;  2BB6 A;  4JLC A;  1WGG A;  3AXC A;  5KHQ A;  1JRU A;  2J4X A;  4BOZ B;  3TEZ A;  4PS7 A;  3L4P A;  3PT2 B;  1IPG A;  2O2V B;  2ZW0 A;  1DOI A;  1NVI D;  1FNU A;  4KKJ A;  4K3C A;  2J52 A;  2K1F A;  1ZKH A;  3LJ3 A;  4MM3 A;  4I6P A;  2JUO A;  2WXF A;  2J42 A;  2E6X A;  4L23 A;  1SB3 C;  1F9J A;  3ZRF A;  2LXC A;  3EC8 A;  1HTO A;  2N7J A;  3DBS A;  1I35 A;  5AEK B;  4NQL B;  1JQ4 A;  1LM8 B;  5H92 C;  2IZV B;  2J7Q B;  2LUE A;  2C7N B;  1UBQ A;  1V5T A;  1T5X D;  2K5P A;  1K52 A;  1PGX A;  1L0Y B;  1ET6 A;  1PFD A;  3T9L A;  4NJ7 A;  4YSX B;  2L83 A;  5AZG A;  1V6E A;  2CR5 A;  4RGM A;  1TIF A;  1P3Q U;  1NYQ A;  1QOB A;  5C3J B;  4M02 A;  3ENE A;  2J0J A;  3NVY A;  4NPN A;  2AQ3 B;  2D10 A;  1WMH B;  1J7C A;  1MFW A;  2XN9 C;  4BAX A;  1XXG A;  5D2M B;  4HWI B;  2JXT A;  4N58 A;  2R61 A;  3SFD B;  4H2A A;  2N9X A;  4EFO A;  3KVF B;  3MC9 A;  2D11 A;  3RFZ B;  1NEK B;  1TS5 A;  1AYF A;  4AS1 A;  4GDL A;  3MHS D;  3AI5 A;  4NJ6 A;  4OZA A;  2KXJ A;  1J7B A;  1LO5 D;  3N30 A;  4IKG A;  2LAS A;  3GE8 C;  4E3C A;  1YN5 A;  5DPS A;  1HA5 A;  3VQI A;  1N5X A;  1TZO A;  2JT4 B;  1T0S C;  1WR1 A;  5LXH A;  2GBK A;  3DVN U;  1C77 A;  2WDV B;  3M62 B;  5HHD G;  4K3B A;  4FN2 A;  2WGS A;  3DCG A;  3PO0 A;  4M0W A;  1UD7 A;  3VRB B;  3J9C A;  5EE9 A;  2GBN A;  2WHI A;  4CO7 A;  4I6L B;  2KLC A;  3DVG Y;  3P4R B;  1E0Z A;  2K9X A;  1ZUD 2;  2NTT A;  5IA7 A;  2LVP A;  3AE1 B;  1JAL A;  5CTR C;  3BVG A;  2DYB A;  3WAM A;  3LB8 C;  2KMM A;  3KWL A;  4GB9 A;  4M0W B;  4RCO A;  2WXN A;  1OFF A;  2C60 A;  4XE0 A;  1IBX B;  2BKF A;  3VFK A;  2ZPY A;  1TZ1 A;  1V2Y A;  3VAW A;  2LD9 A;  2K0P A;  2KQS A;  4JL9 A;  4IDI A;  5AZF A;  2K8B A;  2KX0 A;  5J2R A;  2GMI C;  4USA A;  2KWD A;  4MT5 A;  1OGW A;  1D5Z C;  1T0Y A;  4P1B C;  2ZVO A;  3TIX A;  4RH6 A;  2I1K A;  4FHJ A;  2KWU B;  2KN5 A;  3H6N A;  3RMK C;  3U30 A;  1N5W A;  2WDQ B;  1H8C A;  1OEY J;  4XGA B;  2KOX A;  2JZP A;  3HHM A;  4K7S A;  1FNV A;  4BVU C;  3ZGZ A;  3TSS A;  4I6N B;  2PLP A;  2QIL A;  2GRI A;  1TY2 A;  4GDK A;  2GBJ A;  3UIO B;  3GOE A;  3ZJU A;  1DOY A;  2L0T A;  4MH0 E;  3W1Y A;  3EFU A;  4EE2 A;  2DZI A;  2KDI A;  1MHX A;  3A1Q B;  4AQ7 A;  1IBX A;  2C7M B;  5CHF A;  5D3D A;  2V4I B;  3DHI C;  2R2O A;  2IO1 B;  3X0W A;  2LWP A;  4EZJ A;  3O65 B;  5E6J A;  3W5U B;  1TBE A;  3IAS 1;  3H1U A;  2D3G A;  2CJN A;  2LMC A;  4WJO A;  3TCA A;  2EMT A;  2N7E A;  1JWM D;  2K6Q A;  3HUI A;  4HJG E;  2RPV A;  4MGY E;  1ZE3 D;  3QK0 A;  4RGO S;  2PMV A;  4LNK A;  4PS3 A;  4W9H A;  4W9E A;  2I2Y A;  2BYE A;  2FE8 A;  2IPK D;  2ZNV B;  2HDE A;  3GS2 A;  4W9I A;  4ZRQ A;  4CHK A;  3GP7 A;  1GJZ A;  1EUV B;  1K50 A;  1SE4 A;  1KOT A;  4G3X B;  2XNA C;  2LVQ A;  4DXG A;  1WFY A;  5CX3 A;  2G4S A;  2LHD A;  4HDQ A;  1SJH D;  5I4D A;  4NJC A;  5EE3 A;  4LK0 M;  4FA6 A;  4TV3 A;  2SEB D;  1I4H A;  3I57 A;  4MSQ B;  1WYW B;  3DQV A;  3ZIM A;  3ZQ4 A;  4OZB A;  3URY A;  4AJY B;  2WU2 B;  3VUW A;  2O6V D;  2MA9 B;  1ZDV A;  3UQB A;  2D5G A;  4ANV A;  3NVZ A;  3CWI A;  2K25 A;  4GN1 A;  1MVK A;  2PJH A;  2NVU I;  1HZ5 A;  2BTE A;  4MGZ E;  4W9J A;  4HRO A;  3KYC D;  2KJ6 A;  3TL5 A;  2CKH B;  3Q6B A;  5HKH A;  4GU2 A;  2OJW A;  4TKN A;  5E6P A;  1RM6 C;  1CQV A;  2X8X X;  1Z2M A;  4TQ1 A;  4GOC A;  3H7P A;  5IKC M;  4A3O A;  1XCT L;  2KT7 A;  1M4V A;  2W55 A;  4L1B A;  3ZVV A;  1TS3 A;  3DBH B;  4MAC A;  4J3O D;  2KFK B;  3DWM A;  3C8Y A;  2QJL A;  2V3S A;  4YTP B;  1N60 A;  4K81 A;  3NG0 A;  4DHJ D;  3EA6 A;  1L0V B;  2GLS A;  3VUY A;  1P1A A;  3VVW B;  1AAR A;  1FRR A;  2MJ3 A;  3L54 A;  4WWM A;  1BXT A;  2KO3 A;  2Z0E B;  3PRP B;  3NUH B;  3PHW B;  1SIF A;  1WXM A;  4RM9 A;  2NMQ A;  3L10 B;  3KYD D;  2N7D A;  4K7U A;  1KTK A;  4JQW C;  3ZNG C;  1ISN A;  2LGI A;  5HG2 A;  2CU3 A;  4DK5 A;  1CJE A;  2V0G A;  2LHE A;  3E56 A;  5E6N A;  3CST A;  3JSV A;  3A4S C;  4A9A A;  2AWT A;  2MHJ A;  1K8R B;  1YJJ A;  1SF0 A;  2IBI B;  1PQS A;  2V3P A;  3IVF A;  3OJ4 B;  3SR6 A;  2Y5C A;  2L52 A;  3R2I A;  2BT6 A;  3R66 C;  2NPT A;  2PVO D;  1L4Z B;  4FXC A;  2FIF A;  2LRW A;  2JYT A;  3MC8 A;  2LGX A;  5BYQ A;  2NS5 A;  4HKQ A;  5BO4 B;  3NZS A;  2HTH A;  2GBR A;  3FAH A;  4LNF A;  1WI0 A;  1XD3 B;  5CHV C;  3EFC A;  3KUZ A;  1KM7 A;  4WWP A;  1ZXI A;  4F7Z A;  2ZVN A;  3IAM 1;  1KLG D;  3U8Z A;  3LDZ E;  2IDY A;  2A5U A;  2WXQ A;  1V49 A;  4ARI A;  4XYC A;  1ZP0 B;  4ZRP A;  3QHT A;  1XLP A;  4YSZ B;  1RYJ A;  1STE A;  1HQR D;  4C56 C;  2KQ7 A;  4X57 B;  2FCS A;  1ET9 A;  2REX A;  3TEY A;  2Y5B B;  2V4L A;  1YD8 U;  2ASQ A;  3L13 A;  1GC6 A;  4US8 A;  2MEK A;  3MJ5 A;  3P4S B;  4LNN A;  3R7R A;  3A1Q A;  4W9D A;  2G45 B;  1LGR A;  4EZL A;  1NDD A;  1SSN A;  1T6B X;  2MCN B;  3PRE A;  2DNF A;  2MP2 A;  3RCZ A;  2IYD B;  3DBL B;  4PS8 A;  3Q14 C;  2W54 A;  1E8X A;  1OQR A;  2KYW A;  4GLS C;  2KVZ A;  3W9C B;  1WMH A;  1I4R A;  3Q3M C;  3QQ8 B;  3Q8F A;  3KWV A;  3ETR A;  3ALB A;  2RDH A;  3PRZ A;  4GXB A;  4OW0 A;  5BMI A;  1YJ1 A;  1KF6 B;  2OJR A;  2WNM A;  1Q1O A;  4MJS A;  2G3Q B;  1LQB A;  1P9D U;  1C4P A;  1YJI A;  2L3Z A;  3BYY B;  4MSM B;  2DYM A;  1F1H A;  1WF9 A;  2KTR A;  2KTR B;  1P7E A;  2YEP B;  1I4X A;  2M17 A;  3QJZ A;  4OVU A;  4ZOH C;  2L8J A;  2WWZ A;  3CMM B;  3U7Z A;  1FCC C;  5HI1 A;  3H7S A;  1WXA A;  1WIA A;  3PHX B;  1NI3 A;  1YMH E;  3R2T A;  2XEW A;  3SEB A;  5C23 A;  4ZYS A;  3EGR A;  1U4A A;  2WU5 B;  4OHJ A;  4ICV A;  1NEN B;  3ZW3 A;  1JML A;  4K7W A;  1VZ6 A;  3ZDT A;  1XF5 L;  2N0S B;  3N3K B;  4JGH B;  4LTU A;  2L76 A;  3X23 A;  1TT5 B;  2WXI A;  1GUA B;  1VR9 A;  1SE2 A;  3ZNI D;  4PK1 A;  1A5R A;  3JVZ X;  4FJY A;  4ANU A;  1A70 A;  3ECI A;  4W9F A;  3NRZ A;  4BFR A;  2L05 A;  2QMT A;  3U2S C;  3ABV B;  2LJ5 A;  2WXR A;  4G11 A;  2MBQ A;  3MTN B;  2RMM A;  4FJZ A;  2FUH B;  1ZXH A;  3P42 A;  4AWJ A;  1UNS A;  3RI7 C;  4CYE A;  2WDT B;  2INN E;  4JWU C;  1TS2 A;  2BW2 A;  1YQ4 B;  3VTU A;  4HCN B;  1CZP A;  1FMA D;  2HE7 A;  2C7H A;  4HRS A;  1AWD A;  2JSV X;  4NAM A;  3H7P B;  4IWQ A;  2KNB A;  2M1M A;  2BYF A;  4BBN C;  3AE9 B;  2ACZ B;  4FLH A;  2IO2 B;  3VUX A;  3OAW A;  1UUP A;  2PIA A;  1LXD A;  5L95 C;  2JYE A;  2GBM A;  1UEL A;  3MFG A;  1XLO A;  1TGZ B;  1TKE A;  4FUL A;  3A33 B;  2IY0 B;  4JPS A;  1VCB A;  1V8C A;  3PV1 A;  3DBR I;  1N62 A;  3Q8B A;  3SD5 A;  2K22 A;  4ZRI A;  3T8M A;  1C9F A;  5J17 A;  1T0R C;  3B0A A;  4C00 A;  3CIR B;  4LNI A;  3VXW A;  3H8H A;  3L08 A;  4DDG D;  1EU3 A;  1SBB B;  2M19 A;  2FBW B;  1VJK A;  3QCA A;  3ZO5 B;  5IP4 D;  2LI5 A;  1UH6 A;  3A9J B;  1Q5W B;  1ROE A;  2Q5W D;  4ICU A;  4RF1 A;  1QKZ A;  5HFY A;  5FR3 A;  1V5O A;  4RM8 A;  4BKT A;  2BKR B;  3NHE B;  2BBC A;  2MLB A;  4EZK A;  3IXS A;  4B0E A;  3L16 A;  2RDB C;  2HD5 B;  3RD2 A;  4KV2 A;  4WIP A;  2RPQ A;  5MPO A;  5EE0 A;  4WH4 A;  2W82 A;  4MDK E;  4HK2 A;  3APC A;  1V86 A;  3AE2 B;  4DXF A;  1VRA B;  1PUT A;  3WCQ A;  2KAC A;  2KAJ A;  5AUI A;  3DVN V;  3V60 A;  4ASW C;  4MEL A;  4NNJ B;  4DQO C;  1WGK A;  3JW0 X;  1V81 A;  4L2Y A;  2CHW A;  3KW5 B;  1J19 A;  1FIQ A;  3DBH I;  2CU1 A;  4S17 A;  5GXG B;  3RNB C;  3U4E G;  4YTM B;  1TTN A;  3M3J A;  3RNF C;  4XZ4 A;  1WRI A;  3DOW A;  2CJO A;  3AEC B;  3ZDM C;  2I38 A;  1WXS A;  4LCD E;  3W5V B;  4S0R A;  1WGD A;  1TS4 A;  2V3N A;  4GGQ A;  4M8N A;  1FM0 D;  3E9S A;  3Q2A C;  3RNA C;  1E8Y A;  2LFI A;  4AUQ C;  3Q3J A;  4Q2J A;  5DPT A;  1AW7 A;  2RSU A;  3BIN A;  1UBI A;  3DWG C;  3RUL A;  1MG8 A;  4MGK E;  4KDL B;  2FUG 1;  5C1Z A;  1OTR B;  1WJ6 A;  3I9V 1;  1OQY A;  1MJD A;  4A3P A;  3AV8 A;  3OLM D;  2JF5 A;  2O6V B;  1JW9 D;  1OEY A;  4FAD A;  3VDZ A;  1L7Y A;  3IT4 B;  3AE8 B;  3QC8 B;  4HCP B;  2JQR B;  1C4A A;  4LLG M;  4E74 A;  3TMP B;  3W1S A;  2C9W B;  3NVV A;  3ZXV A;  4KGS A;  1UF0 A;  1GG3 A;  2LGD A;  1JWS D;  4B0M A;  2MWS B;  3RZW C;  5JXV A;  1WE6 A;  2W9N A;  4II3 B;  1WX8 A;  2ZW1 A;  3A9K B;  3P2B A;  3N1Y C;  1P98 A;  2XK5 A;  4PT5 A;  4F1S A;  4C7Y A;  1PGA A;  1C78 A;  3AB5 A;  4PYU A;  2PTL A;  4RMA A;  1G6J A;  3GE3 C;  3V3X A;  2N9E B;  2MBO A;  4N6E B;  1K53 A;  3RN9 C;  1NYR A;  4IM0 A;  1Y56 A;  4ZDV A;  2JZ3 B;  3SFE B;  2EEL A;  3RZF A;  1ZW7 A;  4BKS D;  4EUT A;  3PGE A;  2ZJD A;  3QWZ B;  4OVZ A;  3LYY A;  3TJP A;  2N9P C;  2C5L C;  2JWZ A;  3AE6 B;  2LZ6 A;  1YIW A;  3C19 A;  3V61 A;  1E7U A;  3M95 A;  2J53 A;  4XDC A;  2NPT B;  1I4Q A;  1QZE A;  2WXH A;  3WAP A;  4RF0 A;  1WE7 A;  1WX9 A;  3P1M A;  2L00 B;  1DOX A;  4LNO A;  1R4M I;  2IGH A;  4RNA A;  3VH4 B;  1QIL A;  2IY1 B;  3B08 A;  1J7A A;  1WX7 A;  4RGN A;  5G55 A;  5D3I B;  1RAX A;  5D7G A;  3ZKJ C;  1WRD B;  1V9J A;  4IWP A;  4EKU A;  4KZ0 A;  2O6V A;  1MPE A;  1IGD A;  2KWV B;  4XWW A;  3UI3 A;  5GMV A;  2INC C;  2K39 A;  4GMV A;  4ZHP A;  1GPX A;  4EEW A;  1GC7 A;  2A4Z A;  3RYT A;  2N9L A;  1E9M A;  2GI9 A;  1TKY A;  4WWN A;  1VDV A;  2YEP F;  3JYU A;  1KJT A;  2YVC A;  3DHH C;  1WSP A;  3PRM B;  3DVG X;  4JWS C;  3N1Z C;  2BS4 B;  2NTS A;  4WUR A;  4G0N B;  4GSW A;  2G4D B;  2RR9 A;  1WYG A;  3AU5 A;  1I7H A;  1EF5 A;  5TSS A;  1WM2 A;  2PEA A;  3ML8 A;  5FR6 A;  2KDB A;  2K8H A;  4LJO B;  4MGI E;  3QX1 A;  4C4V B;  1D3Z A;  5BYR A;  2L7R A;  3HVZ A;  3RPF C;  2E3T A;  2KJH B;  1J8C A;  3Q3N C;  2ZCC A;  1R7S A;  1YNT E;  1TKG A;  2DEN B;  1TYG B;  1R4M B;  1KLU D;  2W3S A;  2UU7 A;  4GIV A;  4TMA B;  3TEX A;  2IJ0 A;  1ZPS A;  1JWA D;  1B1Z A;  3N32 A;  1SGH A;  4XX5 A;  4JIO U;  4ZRK A;  1HTQ A;  2M8S A;  2KC2 A;  3N9Y C;  1NBF C;  2FID A;  4US9 A;  2CS4 A;  5BMH A;  2WDR B;  4DBG A;  2CHZ A;  4KSL C;  3HM3 A;  1Z5S B;  4IG7 B;  4A90 A;  1S1Q B;  3BVZ A;  4GDK B;  4CQN A;  3BWU D;  2JXX A;  3WAO A;  4JX1 C;  4KSK C;  1M94 A;  2VH1 A;  4YXD B;  4TUU A;  2DZJ A;  4GDL B;  2AQ2 B;  3Q8E A;  2ZEQ A;  1WM3 A;  1C79 A;  1WGH A;  4IW0 A;  1EF1 A;  1JRO A;  1XQQ A;  4NAW B;  4B9K A;  4OZC A;  1E8W A;  1UGJ A;  3EUB 2;  1WZ0 A;  1L6V A;  4P6V F;  4M01 A;  3M63 B;  2DWQ A;  2PW9 A;  4ZYN A;  3VHT C;  2KVR A;  2D3B A;  2ZNV C;  4XWT A;  4PYZ A;  3AEG B;  4YWG G;  1WGY A;  1JCK B;  4KVG B;  2BWE S;  2JX5 A;  4KKI A;  1MG4 A;  1YQB A;  2FAZ A;  2QDF A;  4AOF A;  2EKE C;  1YN3 A;  2MRP A;  4DHJ B;  5D94 A;  3UF8 A;  5JH5 C;  3NJT A;  3Q8A A;  4BOS C;  2JRI B;  3U7D A;  1UWM A;  3B2F A;  2QEJ C;  3Q8C A;  1PGB A;  3KUC B;  3D32 A;  2HJ8 A;  1VLB A;  4FHK A;  1VD2 A;  3HK0 A;  3W1S C;  3NZ3 A;  2IND C;  2KN4 A;  4IWO A;  2DZM A;  2KAN A;  2LRU A;  4N9F 4;  1RRB A;  1GB4 A;  3PZ8 A;  3I3T B;  3TEW A;  3PZD A;  1SEB D;  5DPW A;  3PLU A;  4HKZ E;  2M56 B;  4P16 A;  2BYV E;  4ANW A;  2RGF A;  1R4N I;  2ZZP B;  2MSE D;  1YQ3 B;  1GB1 A;  3MC0 B;  4NZL B;  4IC7 B;  3NY5 A;  1ZOY B;  2AL6 A;  4G50 A;  2D07 B;  1V97 A;  1IYF A;  1QT9 A;  2VH2 A;  4HPL B;  2D3A A;  1T3Q A;  2DLB A;  3Q69 A;  5TR5 A;  3R3M A;  1WJN A;  2XBB C;  4HEA 1;  3ZJT A;  3GZN B;  1XO3 A;  2BF8 B;  4WJN A;  5EE1 A;  4XC2 A;  2KDE B;  1HE8 A;  2KWC A;  1QOF A;  2WXP A;  3B9J A;  1FD6 A;  4D2K A;  4R3D A;  4HJK A;  1IUE A;  1FFV A;  3P4P B;  4J6I A;  4IOI E;  3VR8 B;  4WJQ A;  3UIN B;  3P4Q B;  2MJD A;  1UZX B;  2HTM E;  1Q0W B;  1ESF A;  4KZC A;  2Z59 B;  4P7I A;  4HPP A;  2WP9 B;  2HJ1 A;  3AE5 B;  3ZTD A;  1RWS A;  3QAR A;  2NCN A;  1KH0 A;  3P63 A;  2N4F A;  3ZUN A;  3MJW A;  1EM7 A;  1D5X C;  3NZU A;  1FXA A;  4REZ A;  3ONS A;  3PPA A;  3B1L X;  2WYQ A;  5E6O A;  1ENF A;  2IGD A;  5IO9 A;  2PVG C;  4TSS A;  3SHQ A;  1T0Q C;  2BQQ A;  1S3S G;  1V1P A;  1Y8R C;  4KX6 B;  2JY6 A;  4YSY B;  2DAJ A;  3VTW A;  2KHW B;  3QA8 A;  4LDT B;  3W2D A;  3I5J C;  2JZZ A;  2TSS A;  1UWX A;  1D4B A;  1R4N B;  1P0R A;  3AU4 A;  2DYO A;  4FJV B;  1GAQ B;  5LLI A;  1XLQ A;  2MBH A;  1VZ7 A;  1WGR A;  4RFB A;  2AL3 A;  2RD0 A;  1ACC A;  3APF A;  2K6D B;  2WXL A;  3DDC B;  3GZN I;  2QC8 A;  2NBU A;  2Y5P A;  3B2G A;  4AJW A;  3DBR B;  2WXG A;  3HVD A;  2G9H D;  4MM3 B;  1V1O A;  1YOV B;  3EEC A;  1BUI C;  3Q3O C;  1I42 A;  1RFA A;  2Z8L A;  3IT6 B;  5AUK A;  2KMA A;  3TUO A;  5DPR A;  3HM6 X;  2KMC A;  3K9P B;  1ZDX A;  3DHG C;  5JHB A;  2KQ4 X;  2NBV B;  4HLE A;  1PYW D;  2MP2 B;  4RGT A; 
#chains in the Genus database with same CATH homology
 2WX1 A;  4PYU A;  4RMA A;  1G6J A;  2GOW A;  2YLM A;  1WGG A;  4JLC A;  2IBI B;  2N9E B;  1PQS A;  3AXC A;  5KHQ A;  1JRU A;  3IVF A;  2MBO A;  4WJP A;  4BOZ B;  3RT3 B;  3OJ4 B;  4M8M A;  4PS7 A;  3PT2 B;  1IPG A;  2LGY A;  2O2V B;  4IM0 A;  4ZDV A;  2JZ3 B;  5JHA A;  1C1Y B;  3R66 C;  2NPT A;  2DAF A;  2I1J A;  2K1F A;  3RZF A;  1ZW7 A;  4BKS D;  2Z0D B;  2FIF A;  2LRW A;  4EUT A;  1ZKH A;  2ZJD A;  2LGX A;  3PGE A;  3QWZ B;  3LJ3 A;  4MM3 A;  2K8C A;  2NS5 A;  3TJP A;  5BO4 B;  2N9P C;  3NZS A;  4I6P A;  2JUO A;  2C5L C;  2JWZ A;  2HTH A;  2LZ6 A;  2L0F A;  2B3A A;  1YIW A;  2GBR A;  1F9J A;  3ZRF A;  2LXC A;  3V61 A;  4WQO B;  1E7U A;  1WI0 A;  3M95 A;  3EC8 A;  1XD3 B;  1UGM A;  2NPT B;  5CHV C;  3EHV A;  2D2Q A;  3KUZ A;  1QZE A;  3DBS A;  1KM7 A;  3WAP A;  1I35 A;  4W9C A;  5AEK B;  3PVL A;  4NQL B;  4WWP A;  5EDS A;  1WE7 A;  2MBE A;  1WX9 A;  1LM8 B;  2IZV B;  1YX5 B;  2J7Q B;  2L00 B;  2LUE A;  4F7Z A;  2C7N B;  1UBQ A;  1V5T A;  2ZVN A;  1R4M I;  3U8Z A;  4OVV A;  5KHO A;  2IY1 B;  3LDZ E;  3VH4 B;  3B08 A;  1WX7 A;  2A5U A;  3T9L A;  4NJ7 A;  1V49 A;  2R2Q A;  5G55 A;  3VH3 B;  3QHT A;  3IG3 A;  2WX0 A;  1RAX A;  5AZG A;  5D7G A;  3ZKJ C;  1V6E A;  2CR5 A;  1WRD B;  2PE6 B;  1P3Q U;  1V9J A;  4IWP A;  4EKU A;  4KZ0 A;  2O6V A;  2KWV B;  2J0J A;  3ENE A;  4NPN A;  2KQ7 A;  4B6W A;  2D10 A;  5GMV A;  4X57 B;  2FCS A;  1WMH B;  2K39 A;  4GMV A;  4W9K A;  2REX A;  2Y5B B;  2V4L A;  4K1R B;  1YD8 U;  2ASQ A;  4EEW A;  5D2M B;  3L13 A;  1GC6 A;  2IO0 B;  4HWI B;  3R7R A;  3A1Q A;  1GC7 A;  2A4Z A;  4NY0 A;  4W9D A;  3RYT A;  1WXV A;  1BT0 A;  2G45 B;  4WWN A;  2N9X A;  2BGF A;  2YVC A;  1KJT A;  3JYU A;  3KVF B;  1NDD A;  4EFO A;  4EZL A;  2MW5 A;  2MCN B;  3PRM B;  3PRE A;  3SDL C;  3DVG X;  1C3T A;  2D11 A;  3OJ3 A;  2MP2 A;  1WJU A;  4G0N B;  4GDL A;  4GSW A;  2G4D B;  2RR9 A;  3MHS D;  3RCZ A;  2IYD B;  3QIJ A;  4PS8 A;  3AI5 A;  2KC1 A;  4NJ6 A;  2KXJ A;  3AU5 A;  3N30 A;  1E8X A;  1EF5 A;  2LAS A;  1WMH A;  1WM2 A;  2PPH A;  4E3C A;  2PEA A;  2NR2 A;  3ML8 A;  4W9L A;  3KUD B;  5DPS A;  2LVO A;  5FR6 A;  1EO6 A;  3QQ8 B;  3VQI A;  3A4R A;  3ALB A;  2KDB A;  2JT4 B;  2K8H A;  4LJO B;  1WR1 A;  3QX1 A;  4MGI E;  2GBK A;  5LXH A;  1D3Z A;  3DVN U;  2L7R A;  3PRZ A;  4GXB A;  3IHP C;  2EMS A;  3M62 B;  2KJH B;  1YJ1 A;  1J8C A;  4FN2 A;  2OJR A;  2NBW B;  3DCG A;  1KLV A;  2ZCC A;  1Q1O A;  4MJS A;  2G3Q B;  1LQB A;  1P9D U;  4IUM B;  2BPS A;  2AYO B;  3WAL A;  2L3Z A;  2DEN B;  1UD7 A;  3V6C B;  2GBN A;  2MX2 A;  5AZH A;  4MSM B;  2DYM A;  4GIV A;  1WF9 A;  4CO7 A;  5JZE B;  4I6L B;  2KLC A;  3DVG Y;  1WH3 A;  2KTR A;  3DBL I;  2KTR B;  5IA7 A;  2BWF A;  1V80 A;  3N32 A;  1SGH A;  2M17 A;  2LVP A;  4XX5 A;  3QJZ A;  4JIO U;  4OVU A;  2L8J A;  2WWZ A;  3CMM B;  3S2A A;  5CTR C;  4ZRK A;  4LJP B;  2DYB A;  3WAM A;  3H7S A;  1WXA A;  4GB9 A;  2M8S A;  4LDT D;  1WIA A;  3PHX B;  4M0W B;  2UWQ A;  4WWO A;  1IP9 A;  2KC2 A;  2C60 A;  2XEW A;  3QAQ A;  1NBF C;  1X1M A;  5C23 A;  2FID A;  2JRH A;  2CS4 A;  2BKF A;  3ZLZ A;  1E7V A;  1U4A A;  3VFK A;  2ZPY A;  4DBG A;  1TZ1 A;  2CHZ A;  4ICV A;  1V2Y A;  4IM3 A;  2KLG A;  4KSL C;  4FBJ B;  1RLF A;  3HM3 A;  3VAW A;  3ZW3 A;  1Z5S B;  2LD9 A;  4K7W A;  4IG7 B;  3ZDT A;  3N3K B;  1S1Q B;  2JPH A;  2KQS A;  4JGH B;  4JL9 A;  2L76 A;  5AZF A;  3X23 A;  2K8B A;  2KX0 A;  4GDK B;  5J2R A;  4BKS A;  3TBL D;  2GMI C;  4W9G A;  1GUA B;  1OGW A;  2JXX A;  1T0Y A;  3WAO A;  4KSK C;  1H4R A;  3ZNI D;  1NI2 A;  1M94 A;  1A5R A;  4TUU A;  2FCM A;  4NAW A;  1FXT B;  2DZJ A;  2MQJ A;  2ZVO A;  3JVZ X;  4FJY A;  4GDL B;  4ANU A;  4F8C B;  3TIX A;  3ECI A;  2I1K A;  4FHJ A;  2KWU B;  2ZEQ A;  4W9F A;  2J0K A;  1WM3 A;  2KN5 A;  3H6N A;  4BFR A;  1WGH A;  2L05 A;  1GNU A;  4IW0 A;  3UIP B;  1EF1 A;  1XQQ A;  2LJ5 A;  3DPD A;  3U30 A;  4NAW B;  3NOB A;  1CMX B;  4B9K A;  4G11 A;  1E8W A;  2MBQ A;  1WZ0 A;  3MTN B;  4FJZ A;  1H8C A;  2FUH B;  1OEY J;  3VTV A;  4AWJ A;  3M63 B;  2KX3 A;  4ZYN A;  3VHT C;  4KIK A;  4CYE A;  3KH0 A;  2KVR A;  2KOX A;  2WDT B;  3HHM A;  2ZNV C;  4K7S A;  4PYZ A;  4II2 B;  4AP4 C;  4BVU C;  3VTU A;  4BKG A;  4HCN B;  1WGY A;  4DDI D;  2BWE S;  3JSV B;  4KVG B;  2HE7 A;  4TQ0 A;  2C7H A;  4I6N B;  4YL8 A;  3CF6 E;  1YQB A;  3H7P B;  2FAZ A;  4AOF A;  4IWQ A;  2EKE C;  1E90 A;  2KNB A;  3BY4 B;  4GDK A;  2MRP A;  2M1M A;  2ZPN A;  5D94 A;  1WR6 E;  2GBJ A;  2BYF A;  3GOE A;  4NQK E;  3UF8 A;  2N1V A;  3UIO B;  2L0T A;  4MH0 E;  5JH5 C;  3W1Y A;  4BBN C;  4MEM A;  3R7Q A;  4BOS C;  2JRI B;  3EFU A;  4FLH A;  3U7D A;  2IO2 B;  3VUX A;  4B95 A;  3PLV A;  3UGB B;  3OAW A;  2CHX A;  2DZI A;  2KDI A;  2KFJ A;  1LXD A;  3A1Q B;  5L95 C;  2C7M B;  5LXI B;  5CHF A;  3ZTC A;  4DHJ B;  2GBM A;  1UEL A;  3KUC B;  5D6J B;  3D32 A;  1TGZ B;  2R2O A;  2IO1 B;  3X0W A;  2HJ8 A;  4FUL A;  5G2N A;  2LWP A;  4FHK A;  4EZJ A;  3A33 B;  1VD2 A;  2IY0 B;  3HK0 A;  3ML9 A;  3O65 B;  1VCB A;  5J18 A;  3PV1 A;  3W1S C;  3ZNZ B;  1TBE A;  3DBR I;  3IBE A;  4IWO A;  3H1U A;  3SD5 A;  2D3G A;  3A9K A;  2DZM A;  2KAN A;  4WJO A;  4ZRI A;  2LRU A;  4N9F 4;  3T8M A;  1RRB A;  3TCA A;  5J17 A;  2EMT A;  3B0A A;  2N7E A;  3I3T B;  2V1Y A;  2ZCB A;  3PZD A;  1XT9 B;  2K6Q A;  4HVB A;  3VXW A;  4URK A;  5DPW A;  4MGY E;  3PLU A;  3QK0 A;  3L08 A;  4DDG D;  3NS8 A;  3QCA A;  2BYV E;  3ZO5 B;  4ANW A;  2KFK A;  2LI5 A;  2RGF A;  3Q3F A;  4PS3 A;  1UH6 A;  1R4N I;  4W9H A;  4W9E A;  2DZK A;  2BYE A;  3A9J B;  2M0X A;  3A9J A;  1Q5W B;  2ZZP B;  4ICU A;  4A20 A;  2MSE D;  2ZNV B;  2IO3 B;  1ZGU B;  1J0G A;  4IC7 B;  3NY5 A;  4W9I A;  2AL6 A;  4G50 A;  1V5O A;  2D07 B;  4RM8 A;  2KKC A;  2DHZ A;  2BKR B;  3NHE B;  4BKT A;  2MLB A;  4HXD A;  4CHK A;  1IYF A;  4EZK A;  4HPL B;  2FCN A;  2VRR B;  1GJZ A;  5TR5 A;  3R3M A;  3L16 A;  1EUV B;  3L0W B;  2HD5 B;  1WJN A;  3L17 A;  2XBB C;  4KV2 A;  2RPQ A;  3RD2 A;  1KOT A;  4G3X B;  2BF8 B;  4WJN A;  2LVQ A;  1WFY A;  4XC2 A;  4MDK E;  2KDE B;  4HK2 A;  5CX3 A;  1HE8 A;  3APC A;  1V86 A;  2KWC A;  2G4S A;  2KK8 A;  4HDO A;  2KZR A;  4HJK A;  4HDQ A;  3ZNH B;  3V6E B;  3CSF A;  4WAA A;  2N1W A;  4J6I A;  3DVN V;  4WJQ A;  3UIN B;  4FA6 A;  4TV3 A;  2QHO A;  3K9O B;  3V60 A;  4ASW C;  4MEL A;  1UZX B;  4NNJ B;  3JW0 X;  1V81 A;  1Q0W B;  2CHW A;  3KW5 B;  4MSQ B;  1WYW B;  3DQV A;  4KZC A;  1J19 A;  2Z59 B;  4P7I A;  3ZIM A;  3DBH I;  4AJY B;  2CU1 A;  3VUW A;  2O6V D;  2MA9 B;  3UQB A;  3ZTD A;  4ANV A;  3QAR A;  2NCN A;  2N4F A;  2FNJ B;  1TTN A;  3M3J A;  3ZUN A;  3MJW A;  3WIM A;  2K25 A;  1YX6 B;  4GN1 A;  4XZ4 A;  3DOW A;  3WA0 A;  3NZU A;  2PJH A;  2XK5 B;  1L2N A;  1E8Z A;  2M4N A;  2NVU I;  3ONS A;  3ZDM C;  4MGZ E;  4W9J A;  3UQA A;  3PPA A;  1WXS A;  3B1L X;  4LCD E;  4DHZ B;  2WYQ A;  5E6O A;  3KYC D;  2KJ6 A;  1WGD A;  3TL5 A;  3APD A;  2CKH B;  4GGQ A;  4KIK B;  3H9D A;  4M8N A;  3SHQ A;  3V62 A;  4KDI C;  5HKH A;  4GU2 A;  1S3S G;  4TKN A;  2KD0 A;  1E8Y A;  5E6P A;  1WY8 A;  1Y8R C;  2JY6 A;  2DAJ A;  3VTW A;  4DHZ E;  4E71 A;  2KHW B;  4AUQ C;  3Q3J A;  1Z2M A;  2KDF B;  2KJR A;  3QA8 A;  4TQ1 A;  1E5W A;  4DXA B;  4LDT B;  4EOY A;  5DPT A;  2RSU A;  2JZZ A;  4GOC A;  3H7P A;  3BIN A;  4A3O A;  1UBI A;  1P0R A;  3AU4 A;  2DYO A;  3RUL A;  1MG8 A;  4FJV B;  4MGK E;  5LLI A;  3ZVV A;  4KDL B;  2MBH A;  5C1Z A;  1OTR B;  1WJ6 A;  2KFK B;  1OQY A;  2UYZ B;  1SE9 A;  3RUI B;  4A3P A;  3OLM D;  2JF5 A;  2V3S A;  1WGR A;  2O6V B;  1OEY A;  2AL3 A;  3PS6 A;  2RD0 A;  4FAD A;  4K81 A;  2J0M A;  3APF A;  4IM2 A;  2K6D B;  3VDZ A;  4DHJ D;  1L7Y A;  2FCQ A;  3VUY A;  1P1A A;  3VVW B;  1AAR A;  3DDC B;  3GZN I;  4DWF A;  3L54 A;  2NBU A;  2KO3 A;  2Z0E B;  3PRP B;  4AJW A;  3IFW B;  4ANX A;  3PHW B;  3PTF C;  3QC8 B;  4HCP B;  1SIF A;  1WJ4 A;  4E74 A;  3EEC A;  3TMP B;  1WXM A;  2C9W B;  3W1S A;  5DCN A;  4RM9 A;  1GG3 A;  3L10 B;  3KYD D;  1I42 A;  2N7D A;  4K7U A;  1LFD A;  2DX5 B;  3HIZ A;  1RFA A;  4JQW C;  3ZNG C;  1ISN A;  2LGD A;  3WAN A;  2OOB B;  4BBN F;  2KMA A;  2MWS B;  3RZW C;  5L83 A;  4DK5 A;  1WZ3 A;  5DPR A;  1WE6 A;  5IAA C;  2W9N A;  4II3 B;  1WX8 A;  3HM6 X;  3A9K B;  3P2B A;  3ZRC A;  3PSE B;  2JVC A;  3AUL A;  3C0R B;  2KMC A;  3K9P B;  4ZRJ A;  5JHB A;  1P98 A;  2XK5 A;  2NBV B;  5E6N A;  2AEH A;  3CST A;  4MJS B;  3SU8 X;  4HLE A;  2MBB B;  3A4S C;  3JSV A;  2AWT A;  5CHW A;  4F1S A;  2PE9 A;  2KTF A;  1K8R B;  4HPM B;  2MP2 B;  2LXA A;  2O2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...