1WMHA

Crystal structure of a pb1 domain complex of protein kinase c iota and par6 alpha
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
83
structure length
83
Chain Sequence
b'QVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C, iota type
publication title Structure of a Cell Polarity Regulator, a Complex between Atypical PKC and Par6 PB1 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 19
structure length 83
sequence length 83
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wmhA00
4MJSB 2DX5B 5FR6A 1LXDA 3HIZA 1GJZA 4FN2A 3JW0X 2RGFA 3A9JB 3KH0A 4GMVA 4NY0A 1OTRB 4F1SA 2K39A 2IO3B 3NZUA 3K9PB 4GU2A 4EFOA 1WH3A 1WXVA 3H7PA 4GB9A 4HCPB 4RMAA 4NPNA 2C5LC 4BVUC 4A3OA 3BY4B 5DPWA 2KTFA 1LM8B 4HK2A 4J6IA 2XBBC 5CHWA 1KOTA 4GDKB 1VD2A 1P9DU 3QIJA 2LUEA 3HM3A 3PV1A 3ZIMA 5LXHA 2MRPA 3V6EB 1WZ0A 5LXIB 3OJ4B 3JSVB 4BKSD 4ZRKA 2WYQA 4E74A 1XD3B 5JZEB 2JRIB 5DCNA 1KM7A 1F9JA 1Q5WB 2D11A 2XK5A 3VTWA 4EEWA 3WAMA 2W9NA 2LI5A 3UQAA 2MBEA 2JRHA 3DBRI 5AZFA 2MBQA 2AYOB 2J7QB 1UD7A 4OVUA 3A1QB 3ECIA 1WR1A 3L17A 3PT2B 2FIFA 3CSTA 2LGYA 2KQSA 3DCGA 3ZDMC 2KMAA 1J8CA 2DYOA 1BT0A 4FHJA 1S1QB 4YL8A 4FLHA 2DYMA 3KUZA 2M4NA 3OJ3A 3PREA 4F7ZA 1TTNA 2JUOA 5JHAA 4FADA 1V2YA 1WJ4A 4PS3A 4CO7A 4HJKA 2G4SA 2XK5B 2LVQA 2KC2A 5IAAC 3TBLD 4TQ0A 2BF8B 2ZEQA 3K9OB 2L00B 4HDQA 3QQ8B 3CSFA 3N30A 5G55A 5AZGA 3H9DA 1WGRA 2KTRB 3ML9A 1V86A 3QJZA 5JH5C 1D3ZA 2PJHA 3ZRCA 2KO3A 4KDIC 1WRDB 4HVBA 2B3AA 4GDLA 4KV2A 4PYZA 4RM8A 1WGGA 2R2OA 3M95A 4ZRJA 4B95A 4PS8A 1MG8A 2MP2B 2LZ6A 3PRZA 3DPDA 1IP9A 4W9HA 4BOSC 3ZO5B 4AOFA 2GBKA 1H8CA 1UGMA 4EUTA 5JHBA 3DOWA 3VUWA 4JL9A 5G2NA 2BKFA 2ZJDA 1E7VA 2IYDB 2BGFA 3I3TB 1KLVA 2GBJA 4GGQA 1GUAB 1RAXA 4PS7A 3N3KB 2O6VD 5DPSA 3PGEA 3DQVA 2LGXA 3R3MA 2D07B 4ANUA 4WAAA 1WM3A 2YVCA 2NPTB 2DHZA 2KQ7A 3ONSA 4LDTD 2L76A 4TQ1A 3VH4B 4FJZA 4GN1A 2I1JA 4N9F4 4ANVA 4NAWA 3PPAA 3H1UA 1T0YA 4FULA 2KN5A 2KANA 1YD8U 3RZFA 3V60A 3WIMA 3DBHI 3KUCB 5J2RA 4ZRIA 1WMHA 3O65B 2JF5A 3DBLI 2ZNVC 2NCNA 1GG3A 1IPGA 1TZ1A 1S3SG 2K1FA 5KHOA 1V5TA 3GZNI 4DHJD 5E6PA 2N7DA 5CX3A 2O6VB 5C1ZA 2EKEC 3KVFB 4I6PA 4P7IA 3DVGY 4EZJA 4G3XB 2PEAA 2KDIA 2N9PC 3NS8A 2FCSA 2OJRA 4G11A 5C23A 1C3TA 2IO1B 2ZVOA 4AUQC 1WX8A 4URKA 2BKRB 2CKHB 2JZZA 2KJRA 4ZYNA 3MTNB 2A4ZA 2LRWA 2M17A 3LJ3A 3HM6X 4MM3A 3ZNGC 3W1SA 4GIVA 3D32A 3VHTC 1V6EA 4KVGB 3VTUA 1YIWA 1UBQA 1XQQA 2IO0B 4FA6A 3A9KB 3JYUA 3NHEB 2JVCA 4DHJB 2KZRA 4G0NB 4AJYB 5TR5A 3QWZB 1Q0WB 2G45B 2K6QA 3LDZE 3ZNHB 1K8RB 1NBFC 4EKUA 4B9KA 1WR6E 3M3JA 4JIOU 5CHVC 2KFKA 5LLIA 4HLEA 3Q3FA 2KDFB 1KJTA 2G4DB 2BYVE 1YJ1A 3EHVA 2V4LA 1E8XA 1RFAA 1EF1A 2L0TA 3PSEB 3QAQA 5J18A 3VH3B 4A3PA 3SDLC 3UIOB 3V62A 3X23A 4BOZB 3PS6A 1I35A 4W9GA 1AARA 3KYDD 2QHOA 1WXSA 4XX5A 3RCZA 3PHWB 3ZLZA 1WJUA 2FCNA 2WDTB 2PPHA 3R7QA 4AP4C 1P1AA 3BINA 2N7EA 1YQBA 1WI0A 4ICUA 2KWUB 4MSQB 1WXAA 5DPRA 4HDOA 3TJPA 2KC1A 1WJ6A 1EO6A 2HTHA 3H7PB 2KX3A 1G6JA 1ZW7A 2KLCA 4ANXA 1A5RA 2GBNA 2N1VA 2CR5A 1EF5A 4LJPB 4JLCA 2KK8A 1CMXB 4G50A 4GOCA 2WX0A 3RT3B 3TMPB 1U4AA 2XEWA 2L0FA 1I42A 3QK0A 4LCDE 2CU1A 3PZDA 2N9EB 4TUUA 2NR2A 3L0WB 4DHZE 4DXAB 3HK0A 2CS4A 3VVWB 2L8JA 2NBWB 2K25A 3KW5B 2BYFA 2NVUI 3ZW3A 2IY1B 2CHWA 3APDA 3JVZX 2KFJA 4F8CB 1E8ZA 1WGDA 2IY0B 1IYFA 2ASQA 3AULA 4IW0A 1NDDA 1Z2MA 2L05A 4JGHB 4IG7B 3EECA 3AU4A 3QX1A 1HE8A 3DVNV 3X0WA 2DZJA 4I6LB 2DZKA 4CYEA 2C7NB 1E8YA 2N4FA 3B08A 2O2VA 5L95C 4ZDVA 3UQBA 3DBSA 2KJHB 2ZCCA 3SHQA 4KSKC 2M1MA 4WJNA 4W9IA 3WA0A 4W9JA 2AL6A 1OEYJ 3PLUA 1M94A 4II2B 4RM9A 5DPTA 1E90A 2M8SA 3QCAA 4IM3A 4MGIE 1GNUA 4W9CA 4IWPA 3VFKA 3IFWB 2FIDA 3PHXB 2FCQA 2K8CA 3ZRFA 4ANWA 3PVLA 4MGKE 1YX6B 4GDLB 2KX0A 4FJYA 4M8NA 4BBNF 2FAZA 3RYTA 4E71A 2MCNB 2HD5B 2KJ6A 3OLMD 1E7UA 1LFDA 3R66C 3WAPA 1UH6A 3M63B 3CF6E 1WJNA 1Z5SB 1C1YB 1WGHA 3ALBA 3ENEA 5GMVA 5AEKB 2KMCA 3ZVVA 2YLMA 3R7RA 3A4RA 3MJWA 3CMMB 4KIKA 3GOEA 3H6NA 4PYUA 3RD2A 3TL5A 4DWFA 4EZKA 3ZTCA 2DAJA 2K8HA 1RLFA 3Q3JA 1EUVB 4M0WB 4K81A 1SIFA 3DVNU 4IM0A 2MBHA 2IBIB 2CHZA 2KKCA 3B0AA 4KSLC 2JXXA 2JWZA 5D94A 2MX2A 4HPMB 2LWPA 2DZMA 4NAWB 2V3SA 3RULA 3VUYA 2KVRA 2OOBB 4JQWC 1OEYA 2LD9A 2AWTA 1L7YA 3VDZA 1P0RA 2KDBA 2J0MA 4ICVA 1WMHB 2MW5A 4MJSA 3T8MA 4X57B 2EMSA 2ZPYA 4KIKB 2MBBB 3VQIA 5BO4B 3VAWA 3A9JA 3QC8B 4I6NB 2PE9A 2LVPA 3ZTDA 1RRBA 1WZ3A 2Z59B 4W9FA 1FXTB 4MELA 1ZKHA 1WYWB 1WX9A 3A33B 4WWNA 2RR9A 3APFA 3T9LA 4KZ0A 3HHMA 4WQOB 2MQJA 3S2AA 4K1RB 1UZXB 2BPSA 4WJQA 4GDKA 4XC2A 3P2BA 4CHKA 4IM2A 2KNBA 3APCA 3V6CB 3NZSA 4EZLA 2ZVNA 3JSVA 2MA9B 1E8WA 3U8ZA 2C7HA 1ISNA 2K8BA 2N9XA 5D6JB 3L54A 3SD5A 2D3GA 2RSUA 4A20A 4WWOA 4M8MA 4FBJB 2K6DB 2V1YA 4XZ4A 2D10A 4K7WA 4OVVA 2BWES 3ML8A 1J19A 4W9LA 2MBOA 4WJOA 2IO2B 1GC6A 4GXBA 1YX5B 4WWPA 2ZPNA 3A1QA 1WXMA 3IG3A 1E5WA 3B1LX 3EFUA 4LJOB 2KLGA 2KFKB 5AZHA 3W1SC 2MLBA 2D2QA 4BKSA 3L10B 2WX1A 2C60A 3QARA 4DHZB 4W9EA 3DDCB 3L13A 3WAOA 3H7SA 2FNJB 1P3QU 2J0JA 4K7SA 3DVGX 2VRRB 3PTFC 5D7GA 3UIPB 1R4NI 3UF8A 2LXCA 4HPLB 3PRMB 4KZCA 1JRUA 1H4RA 4IUMB 3UGBB 4GSWA 2DENB 4E3CA 4W9DA 2KTRA 3OAWA 3TIXA 2RD0A 3IHPC 3C0RB 2C9WB 2KOXA 4HXDA 3VUXA 3IVFA 1QZEA 3WANA 3VTVA 1WF9A 4BKGA 4W9KA 4MGYE 2Z0EB 3ZKJC 2AL3A 2J0KA 4TKNA 4ASWC 2MP2A 3NY5A 3PLVA 4AWJA 2M0XA 1L2NA 3AXCA 2R2QA 1TBEA 4IWQA 5D2MB 2FCMA 3PRPB 1V49A 4HCNB 1UELA 4BKTA 4NJ6A 2GBMA 4II3B 2AEHA 3KYCD 1SGHA 2I1KA 1NI2A 1X1MA 3L08A 3L16A 3QHTA 3U7DA 3ZNZB 4NQLB 1WX7A 2KD0A 1WE7A 2GOWA 2N1WA 2HJ8A 2RPQA 2JZ3B 2BYEA 2NPTA 2KHWB 3N32A 4KDLB 1OGWA 3IBEA 2JT4B 5L83A 4DBGA 3UINB 1OQYA 2L3ZA 2LVOA 5J17A 2KWCA 3V61A 2LASA 1WFYA 5E6NA 2FUHB 4AJWA 1TGZB 2LJ5A 2HE7A 2O2VB 2L7RA 3ZDTA 4TV3A 4DK5A 1V9JA 2EMTA 1LQBA 5EDSA 4IWOA 2KDEB 1V81A 1GC7A 1V5OA 1WIAA 2REXA 4K7UA 4MGZE 1ZGUB 2PE6B 3SU8X 4MDKE 1WGYA 4HWIB 4MEMA 2O6VA 1WY8A 2ZNVB 2ZCBA 2JY6A 2Y5BB 2BWFA 2KXJA 3EC8A 4FHKA 2LXAA 2GMIC 2NS5A 2WWZA 3W1YA 3MHSD 1WE6A 1R4MI 3KUDB 2NBUA 4WJPA 2MWSB 3M62B 1SE9A 5IA7A 2DAFA 2CHXA 3A4SC 5CTRC 3VXWA 5HKHA 1P98A 1V80A 1Y8RC 4FJVB 2MSED 4DDGD 5E6OA 1VCBA 2IZVB 5CHFA 3AU5A 4B6WA 2Z0DB 2UYZB 3A9KA 2G3QB 2GBRA 3TCAA 3RZWC 2UWQA 2KWVB 3NOBA 2JPHA 4NNJB 4NQKE 4NJ7A 3AI5A 2C7MB 3ZUNA 4MSMB 4LDTB 4MH0E 2ZZPB 1PQSA 4BBNC 2NBVB 2DYBA 1Q1OA 3QA8A 2LGDA 2DZIA 4DDID 1XT9B 4IC7B 3RUIB 1UBIA 3U30A 5KHQA 3WALA 2A5UA 4EOYA 2LRUA 3ZNID 4BFRA 1J0GA 1WM2A
chains in the Genus database with same CATH superfamily
2DX5B 2CU3A 3HIZA 2RGFA 3NZ3A 1E6EB 1FNUA 1KFYB 3Q8FA 3ZQ4A 2IO3B 1P7FA 2W82A 4C7ZA 1FRDA 1WXVA 3NS1A 4GB9A 4HCPB 3V05A 1VLBA 2C5LC 4A3OA 4BVUC 3AE6B 1UUPA 2XBBC 2I2YA 2KWDA 2JQRB 1MFWA 2INPE 1JALA 5LXIB 3OJ4B 3JSVB 4QAYA 5JZEB 2L52A 1YN3A 4B0EA 4EEWA 3UI3A 2BS2B 3WAMA 1UWMA 2W9NA 3I9V1 2JRHA 2Y3AA 3DBRI 3HRDD 4OVUA 3A1QB 1WR1A 5JXVA 2LGYA 2KQSA 3DCGA 2KMAA 1BT0A 5MPOA 2INDC 4FLHA 2DYMA 3KUZA 1HEZE 1EU3A 1WJ4A 3SR6A 4HJKA 2LVQA 5IAAC 3CSFA 3N30A 5AZGA 3DWMA 4LNNA 2KTRB 3QJZA 3ZRCA 4KDIC 3RMKC 1DYQA 4XYCA 1TZOA 3Q8CA 2PTLA 3AE5B 1H8CA 1B1ZA 4LLGM 2DWQA 2IYDB 1MI0A 2O6VD 2KQ7A 2KACA 3VH4B 4N9F4 3H1UA 1GPXA 4FULA 2KN5A 4AS1A 3V60A 3O65B 1IGDA 1PFDA 4UDUC 5KHOA 4DHJD 2N7DA 5C1ZA 2EKEC 4I6PA 3DVGY 3N1ZC 2PEAA 3AE7B 1T0RC 4URKA 1WX8A 4HKQA 2JZZA 3U52E 3MTNB 2A4ZA 2M17A 3N9YC 1C9FA 2QEJC 4JPSA 1UBQA 4HJGE 4FA6A 3A9KB 2ZW0A 3NHEB 4AJYB 1BMLC 2G9HD 2LJIA 2K6QA 2WXKA 1D6EC 1NBFC 1L5PA 4JIOU 5CHVC 1OFFA 2KFKA 2OHFA 3Q3FA 1KJTA 1R4MB 1SE3A 3EHVA 1E8XA 2L0TA 3QAQA 3RPFC 3VH3B 4W9GA 3KYDD 2BTEA 2QHOA 3CWIA 3RCZA 3PHWB 3R7QA 2WDTB 1P1AA 2N7EA 1WI0A 1EU4A 2KWUB 4RGOS 1EO6A 2HTHA 1KLGD 1G6JA 4AQ7A 1A5RA 1EF5A 1PGXA 3TEXA 3Q3NC 3RT3B 3TMPB 4IKGA 2CU1A 4KKJA 4DHZE 3HK0A 3VVWB 2L8JA 2BYFA 2CHWA 3JVZX 4F8CB 2WQYB 1IYFA 3EA6A 2ASQA 2AQ3B 4IW0A 1FCLA 2WNMA 2L05A 3AM9A 3AE2B 4YXDB 3QX1A 3X0WA 1EWCA 2DZKA 3OWEB 1TS2A 2PVOD 4DXFA 3UQBA 2ZCCA 4OZCA 4KSKC 3ZJTA 1OEYJ 4A90A 4II2B 5DPTA 4RH6A 2LEKA 1MPEA 4MGIE 1GNUA 1N61A 3L4PA 4ACFA 3ZRFA 4MGKE 4GDLB 2HTME 4M8NA 4BBNF 1FM0D 1YMHE 2GLSA 3P1MA 3OLMD 1LFDA 2VH2A 3WAPA 3ALBA 5AEKB 1RFKA 2YLMA 4PYUA 3H6NA 3TL5A 3FKYA 1XCTL 1RLFA 4C80A 4M0WB 2QDFA 2W55A 2MBHA 2WXOA 4KSLC 1F0ZA 1YQ3B 2MX2A 3GP7A 4HPMB 4LK0M 1KRHA 1SJED 2AWTA 2LD9A 3H8HA 1I4HA 1L4ZB 3VDZA 2J0MA 4ICVA 2DLBA 4KIKB 2MBBB 3VAWA 4BAXA 2PE9A 2XNAC 1WXQA 3ZTDA 1WZ3A 1WYWB 3AEAB 2W3SA 3W5UB 1JROA 1M4VA 4KZ0A 2SEBD 3AECB 4WQOB 3S2AA 2WXIA 3APCA 3V6CB 2WXPA 4RGMA 3JSVA 3VR8B 2MA9B 3U8ZA 1ZDVA 2K8BA 2N9XA 4LNFA 4MM3B 3SD5A 2D3GA 2K6DB 1TS4A 4WJOA 1JWUD 2IO2B 1NYQA 3A1QA 1WXMA 4LJOB 3B1LX 3EFUA 2ZW1A 5H92C 1IUEA 1PDXA 2BS3B 2MLBA 4KGTA 2Y5PA 3L10B 2K5PA 3DDCB 3L13A 3WAOA 2W3RA 2SAKA 2FNJB 2KMMA 2GI9A 2G1EA 1NVID 1VZ6A 3UIPB 4C7YA 2LXCA 4HPLB 4GSWA 2INCC 1PYWD 4E3CA 4W9DA 2KTRA 3VUXA 4MACA 3VTVA 4BKGA 3ZKJC 4ASWC 4TKNA 3NY5A 3DHIC 5H8YE 4H2AA 3AXCA 1FNVA 1TBEA 3P4SB 2N0SB 4HCNB 1UELA 5T8IA 4BKTA 2GBMA 3U7DA 3ZNZB 1MHHE 1I4GA 2RPVA 2GOWA 1WRIA 2BYEA 2KHWB 2VZKB 2JT4B 1QOBA 4DBGA 1GAQB 3UINB 1OQYA 4M01A 3P4RB 2NTTA 2LASA 1FD6A 1WFYA 2FUHB 4AJWA 2MJ3A 2O2VB 3ZDTA 2EMTA 3KWLA 1LQBA 1V81A 1V5OA 3CIRB 1F1HA 1ZGUB 2PE6B 4WWMA 1FXAA 1XLQA 1WY8A 2AX5A 2ZCBA 2Y5BB 2BWFA 3NUHB 2PIAA 4YSYB 2LXAA 2WWZA 3W1YA 1R4MI 2WU5B 2WU2B 3M62B 1SE9A 2DAFA 3AN1A 3VXWA 5HKHA 2IDYA 3AEBB 1VCBA 3A9KA 3RZWC 3NOBA 4NNJB 4NJ7A 2C7MB 3KWVA 1PQSA 1JQ4A 2DYBA 1Q1OA 1VZ7A 3B2FA 1UBIA 1QOAA 5KHQA 4JE3B 3P63A 1JRPA 1TT5B 2WXQA 3RI7C 3BZDB 5FR6A 1GJZA 3NVWA 3JW0X 3U2SC 4GU2A 3K9PB 4EFOA 2FBWB 3URYA 4RMAA 4NPNA 3BY4B 5DPWA 1LM8B 1YJIA 3BVZA 1AN8A 2D3AA 4OZAA 2JSVX 4GDKB 5FR3A 2RMMA 3PV1A 2WS3B 2MRPA 3BIID 4ZRKA 2WYQA 3T3NA 3VRBB 3RNCC 1WWTA 2LI5A 3O13A 1J7AA 3W5VB 1ZXHA 4XDDA 2L83A 2MBQA 1CK1A 2D3CA 3CSTA 4RGTA 1WYGA 1J8CA 1S1QB 1C4CA 2JX5A 1TKGA 3PREA 2MJDA 4PS3A 2LMCA 2G4SA 1D5MC 2XK5B 2KC2A 2AQ2B 2L00B 4HDQA 1J7BA 3DHGC 1DOXA 3V3XA 1ESFA 2B3AA 2H89B 4GDLA 1MJDA 4PYZA 4RM8A 3E9SA 4ZRJA 4B95A 4PS8A 2LZ6A 3PRZA 1NENB 5D3DA 1IP9A 4W9HA 5HHDG 1GB1A 4AOFA 4US8A 4EUTA 5JHBA 4ZRPA 3VUWA 4JL9A 5HFYA 1N62A 4HPPA 4M0WA 3N3KB 3PGEA 3R3MA 2YEPB 4WAAA 1NEKB 2DHZA 2GRIA 2L76A 4TQ1A 4FJZA 3BWUD 3PPAA 1T0YA 2KANA 1JW9D 2JYEA 2JF5A 3DBLI 3HUIA 4A9AA 3NVVA 1IPGA 3AMZA 1V5TA 1SF0A 1I4PA 5E6PA 2O6VB 1AWDA 1E9MA 2V4IB 1FPYA 2N9PC 1PGAA 3AEDB 5EE1A 2ZVOA 4AUQC 4MM3A 4GIVA 3D32A 3OG5A 1YIWA 4DHJB 2KZRA 2K3UA 2MH7A 4G0NB 4ZOHC 3GB1A 2IPKD 2JWUA 3ZNHB 1BUIC 3HVZA 1YJ1A 1EF1A 4A3PA 3SDLC 3X23A 4OVZA 1I35A 1AARA 2PPHA 3N1XC 1YQBA 2VH1A 4ICUA 3TJPA 1WJ6A 4ANXA 1EWYC 2GBNA 2CR5A 4XDCA 4L2YA 1TY2A 1E10A 4JLCA 1CMXB 4ZHOA 2WX0A 1U4AA 2XEWA 3MC0B 3PZDA 3BK1A 2Z8LA 4DXAB 1N60A 2NBWB 2IY1B 1Y56A 3NRZA 5BMGA 1ET6A 3AE4B 2CJOA 3EECA 3AU4A 1JWAD 3MHZA 5HI1A 4I6LB 1J7CA 4CYEA 2C7NB 3B08A 2O2VA 4A55A 2QC8A 4C00A 4YTMB 4LNKA 2M1MA 1SXTA 3WA0A 2AL6A 3PLUA 3I57A 3ZGZA 2QJLA 1E90A 3P4QB 4IM3A 4W9CA 3VFKA 3PHXB 3ZXVA 4CQNA 2X38A 3BK2A 4LTUA 1YX6B 4YTPB 1V1OA 2FAZA 4E71A 2MCNB 2HD5B 4JWSC 1E7UA 2RDHA 4DQOC 3CF6E 3FILB 1Z5SB 1C1YB 4P1BC 1FRRA 3GOEA 4DWFA 1LGRA 3EGRA 3Q3JA 1EUVB 4XE0A 4IM0A 2IBIB 2N7JA 2CHZA 3B0AA 2TSSA 1F52A 3U7ZA 2L32A 2LWPA 2DZMA 2V3SA 1LO5D 3PO0A 1SBBB 1P0RA 2KN4A 4M02A 3MP9A 3DWGC 1XCQL 3QC8B 1K52A 1ZKHA 2RR9A 3APFA 2MQJA 2PKOA 2BPSA 4GDKA 3P2BA 2KQ4X 4JX1C 4IM2A 1IBXB 4XGAB 1ISNA 1JCKB 5D6JB 4FBJB 3GZNB 4JWUC 3ML8A 3ETRA 1J19A 4W9LA 2MBOA 2LUMA 5EE0A 4GXBA 1E5WA 5AZHA 3W1SC 1VDVA 2D2QA 3EFCA 4US9A 3R2TA 1D5XC 2VRRB 1R4NI 3UGBB 1JWSD 2J53A 5IN7A 3OAWA 1N63A 3IHPC 3C0RB 3LYYA 2C9WB 3RNEC 2BT6A 1RYJA 3IVFA 4BZAA 3Q8EA 1B9RA 1WF9A 3AB5A 4W9KA 4MGYE 2V0GA 3PLVA 2M0XA 1ZUD2 4IWQA 5D2MB 1V49A 1FEHA 4YWGG 3J9CA 2IGGA 1SGHA 3QHTA 3L16A 2PW9A 3IBEA 3U4EG 2LVOA 5J17A 2RDGA 2KWCA 2LJ5A 1NI3A 3IT6B 1V9JA 5EDSA 2KDEB 1V8CA 1GC7A 2MEKA 1WIAA 5BYQA 4MDKE 1WGYA 4HWIB 2PLPA 2O6VA 1L0XB 2ZNVB 2KXJA 4L23A 4FHKA 3MC8A 4WQMA 3NVZA 3KUDB 3VR9B 2NBUA 1FIQA 1IGCA 2CHXA 3A4SC 4RNAA 1P98A 2BW2A 4FJVB 2CJNA 4B6WA 3AU5A 2G3QB 2GBRA 1HTOA 4NQKE 3AI5A 1ENFA 4MSMB 4LDTB 2MJEA 4MH0E 4WURA 2DZIA 3AE3B 2HDEA 2K0PA 3WALA 2A5UA 1N5XA 4EOYA 1FFUA 2LRUA 5E6JA 1J0GA 1GOZA 1XLPA 3BVGA 3KH0A 4RFBA 2K39A 3NZUA 5FK9C 4XWTA 1WH3A 2KTFA 4HK2A 4J6IA 5CHWA 1VD2A 1P9DU 3QIJA 3ZIMA 3HM3A 5G5HA 3V6EB 4BKSD 1XD3B 2JRIB 1TY0A 3UQAA 4MT5A 2MBEA 2DBYA 1HQRD 5BMHA 2AYOB 3Q14C 1QOGA 4REZA 3L17A 2LGSA 2DYOA 2BVCA 4FHJA 5AUIA 2M4NA 4F7ZA 1TTNA 5EE3A 5JHAA 1V2YA 4CO7A 1L4DB 3TBLD 4TQ0A 2BF8B 1UGJA 3K9OB 2M19A 3QQ8B 2YEPF 3H9DA 1WGRA 1QLBB 5JH5C 1D3ZA 2KO3A 1WRDB 4HVBA 1WGGA 2NMQA 2R2OA 1SEBD 2MP2B 3FILA 3MC9A 2WXMA 1D5ZC 2GBKA 1UGMA 2OJWA 1MG4A 1E7VA 2BGFA 1KLVA 2GBJA 2WXJA 4GGQA 1KH0A 1RAXA 3IAS1 4ANUA 1TIFA 1WM3A 3ONSA 4LDTD 1D4BA 1CZPA 4GN1A 2I1JA 4ANVA 3RZFA 1YD8U 3KUCB 5IP4D 1TKYA 5J2RA 1QQRA 4ZRQA 2ZNVC 1TZ1A 2K9XA 3GZNI 5CX3A 2KYWA 1DOIA 1FNWA 3KVFB 3P4PB 4EZJA 2KDIA 3NS8A 4G11A 5C23A 2NTSA 2BKRB 1IBXA 1GB4A 1E7PB 3HM6X 3ZNGC 1C76A 1V6EA 2IO0B 1TJEA 2JVCA 5TR5A 3QWZB 4FXCA 1Q0WB 2G45B 3WCQA 2JXTA 3LDZE 3W9CB 2R61A 4B9KA 1XLNA 5LLIA 1BXTA 2QILA 1FCCC 1RFAA 2EKIA 3PSEB 1C78A 3UIOB 3V62A 4BOZB 2E6XA 4NJCA 1WXSA 4XX5A 3ZLZA 1WJUA 1XO3A 4GLSC 3BINA 4MSQB 1WXAA 1YQ4B 4HDOA 3H7PB 1ZW7A 2KLCA 2M56B 3GE3C 4LJPB 2WXRA 3VRAB 2KK8A 5AUKA 4GOCA 4S17A 3SEBA 2JYTA 4TUUA 2NR2A 2WXLA 2CS4A 2WLBA 3ZW3A 3APDA 4TSSA 1E8ZA 1WGDA 3AULA 4YSZB 4IG7B 1SE2A 1HE8A 3DVNV 2DZJA 3AE1B 2MHJA 3P42A 5L95C 2KJHB 3SHQA 2PVGC 2LFIA 4WJNA 3KLSX 4N59A 4W9JA 2D3BA 4RM9A 3Q2AC 4HEA1 1QILA 3IFWB 2FIDA 2FCQA 2IGHA 2K8CA 2WDQB 4ANWA 3PVLA 1AW7A 4R3DA 1I4RA 1ZPSA 2KVZA 2KX0A 3BYYB 2KJ6A 3R66C 3M63B 1WJNA 4M00A 5GMVA 1JWMD 1CQVA 2KMCA 3R7RA 3A4RA 4KIKA 4EZKA 3RD2A 3ZTCA 2K8HA 1I7HA 1PGBA 2KKCA 1NYRA 2JXXA 4MH8A 5D94A 4NAWB 1R7SA 3VUYA 2N9KA 2KVRA 2OOBB 4JQWC 1L7YA 4WAFA 5BYRA 2KDBA 1I4QA 1WMHB 2MW5A 3T8MA 4X57B 1STEA 2ZPYA 5BO4B 4C4VB 2BBCA 1V1PB 4I6NB 2WXFA 2KT7A 2LVPA 2Z59B 4W9FA 1VR9A 4MELA 4L1BA 1WX9A 1XLOA 3B9JA 4RGNA 4K3BA 1UZXB 4RCOA 4CHKA 2KNBA 4EZLA 2JU6X 1Q10A 3NJTA 2ZVNA 3DBHB 2C7HA 2WXGA 3L54A 2RDBC 4ARIA 4A20A 4M8MA 2M0AA 4K7WA 4OVVA 1JMLA 2WDVB 3I5JC 4WWPA 1T5XD 1HA5A 2ZPNA 3IG3A 2QSDA 2FUG1 3IT4B 3TEYA 1L0YB 3LB8C 2HJ1A 2V3PA 2WX1A 3QARA 4W9EA 4YSXB 4KX6B 5IO9A 3H7SA 2INNE 1JWBD 2J0JA 4P1CC 2QCZA 5D7GA 1KLUD 3NG0A 3PRMB 1H4RA 1K53A 1L6UA 4A6QA 2MP2A 5BYSA 2IGDA 2R2QA 4RF0A 3PRPB 2WXHA 1HZ6A 4II3B 3KYCD 1NI2A 1X1MA 4OZBA 2LHEA 1WX7A 2KD0A 3KQ4A 1WE7A 2N1WA 2HJ8A 2K22A 4O1NA 2ACZB 2L3ZA 1SB3C 2L7RA 4IWOA 1T6BX 1L6VA 4MEMA 1DOYA 2JY6A 3EC8A 2JZPA 3ABVB 3LXFA 2NS5A 3MHSD 1WE6A 1DGJA 4KGRA 2MWSB 1HXYD 3RNGC 2BB5A 1Y8RC 2XN9C 5E6OA 2IZVB 5CHFA 2UYZB 1XEEA 3AV8A 4LNOA 2KWVB 1I4XA 2JPHA 4YT0B 3ZUNA 3AE8B 1QT9A 2Y5CA 2LGDA 4DDID 4IC7B 2E3TA 2BB6A 3U30A 5C3JB 3GE8C 3BYTB 4PK1A 3ZNID 1WM2A 5TSSA 4MJSB 1LXDA 4FN2A 3B2GA 3A9JB 2BQQA 4GMVA 4NY0A 1OTRB 4F1SA 1ZOYB 3H7PA 3TSSA 1T0QC 3GS2A 3Q69A 2IJ0A 1KOTA 3EUB2 3NVYA 2LUEA 4HRSA 5LXHA 1WZ0A 4OHJA 4ZYSA 4E74A 2QIEB 5DCNA 1KM7A 1F9JA 1Q5WB 2D11A 2XK5A 3VTWA 1VZ8A 3Q8AA 2KDMA 1UNSA 4TMAB 1MHXA 3TEZA 5AZFA 3Q6BA 2J7QB 1UD7A 3ECIA 1CJEA 3PT2B 2FIFA 4IOIE 3ZDMC 4USAA 4YL8A 3OJ3A 1TYGB 2JUOA 4FADA 2V9HA 1K50A 5LNK1 4NZLB 2ZEQA 5G55A 1T0SC 2W54A 1SIJA 3ML9A 1V86A 1OQQA 4C56C 4DXGA 2PJHA 1WSPA 2H88B 4KV2A 3M95A 2ON8A 1MG8A 3I63C 3DPDA 4BOSC 1ZDXA 3ZO5B 3DOWA 5G2NA 2BKFA 2ZJDA 1RM6C 3I3TB 4HROA 1GUAB 2GB1A 4PS7A 5DPSA 3DQVA 2LGXA 2WDRB 2D07B 4P6VF 3TEWA 2YVCA 2NPTB 4NAWA 2WGSA 3WIMA 3DBHI 3ZJVA 4ZRIA 1WMHA 2ICIA 1AYFA 2NCNA 1GG3A 3T3OA 1FMAD 4C4VA 1S3SG 1V1PA 2K1FA 1YN4A 4P7IA 1P7EA 4G3XB 3AE9B 2FCSA 2OJRA 1C3TA 2IO1B 3AEGB 3SFEB 2CKHB 2J52A 1XXGA 2KJRA 4ZYNA 2LRWA 3LJ3A 4WH4A 3W1SA 3VHTC 4KVGB 3VTUA 1XQQA 3MJ5A 1VJKA 3JYUA 2L1AA 3E56A 1N5WA 3PZ7A 1TKEA 1K8RB 4EKUA 1WR6E 3M3JA 2V3NA 4HLEA 3IAM1 2KDFB 1F2RC 2G4DB 2BYVE 2EELA 2V4LA 2FE8A 1F77A 3DBLB 5J18A 1OQRA 3DHHC 3PS6A 4N58A 2Q5WD 2FCNA 4AP4C 3R8BA 5DPRA 1ZXIA 3AEFB 2KC1A 2KX3A 1N6ZA 2KAJA 2N1VA 2BS4B 3AH7A 4G50A 2BYTA 3ZJUA 4EE2A 1KF6B 2L0FA 1I42A 3QK0A 4LCDE 2QMTA 2N9EB 3L0WB 3FC4A 2K25A 3KW5B 2NVUI 1SJHD 1QKZA 2KFJA 2IY0B 1EM7A 1NDDA 2LHDA 3FAHA 1Z2MA 4JGHB 1MVKA 2LGIA 1E8YA 2N4FA 1K51A 4B0MA 4ZDVA 3DBSA 5C2TB 5IKCM 4W9IA 4LNIA 1M94A 3DBRB 4ZHPA 4D2KA 2M8SA 3QCAA 4IWPA 4ARCA 1PUTA 3TUOA 3ZYYX 2J4XA 4FJYA 3RYTA 2DNFA 1UH6A 4XWWA 3ENEA 1WGHA 1YJJA 1F2RI 2I38A 3ZVVA 1HTQA 3MJWA 3CMMB 3Q3OC 3N1YC 3AEEB 2DAJA 3R2IA 4K81A 3RNFC 1SIFA 3DVNU 1UWXA 2UU7A 4NAMA 2PMVA 2JWZA 2B76B 3RNAC 3RULA 2OEDA 1OEYA 1ET9A 1T3QA 4MJSA 2EMSA 5G5GA 3VQIA 2J42A 4Q2JA 3W2DA 3BVMA 5HG2A 3A9JA 4N6EB 1RRBA 4HKZE 1FXTB 3A33B 4WWNA 3T9LA 3HHMA 4OW0A 4K1RB 1KTKA 4WJQA 4XC2A 3NZSA 3C8YA 4J3OD 1E8WA 2AQ1B 4P16A 3PZ8A 1C77A 4S0RA 1UF0A 1ZE3D 2RSUA 5I4DA 4WWOA 2V1YA 4XZ4A 2D10A 1FFVA 2BWES 3SFDB 3RN9C 4RF1A 1GC6A 1YX5B 5GXGB 5BMIA 2WXNA 2KLGA 2KFKB 1TS3A 1FO4A 1L0VB 5IOIA 3MFGA 2WHIA 4A8XC 4BKSA 2C60A 4DHZB 3N20C 5FKAC 1P3QU 4K7SA 3DVGX 3PTFC 1XF5L 2ONQA 3UF8A 4KZCA 1JRUA 4IUMB 4PT5A 2DENB 3Q3MC 3TIXA 5EE9A 1V97A 2RD0A 2KOXA 2X8XX 2VZKD 4HXDA 1QZEA 3WANA 2Z0EB 4AWJA 2AL3A 2J0KA 1L2NA 1VRAB 1ROEA 2FCMA 2WP9B 1RWSA 4NJ6A 2AEHA 1ACCA 1FXIA 3L08A 2I1KA 3HVDA 1SSNA 4NQLB 2RPQA 2JZ3B 2NPTA 3N32A 1YNTE 4KDLB 1OGWA 5L83A 3RFZB 1ZP0B 4KGSA 3V61A 5D3IB 5E6NA 1TGZB 2HE7A 4TV3A 3IXSA 4DK5A 1SE4A 1E0ZA 1R4NB 1C4PA 1WGKA 3Q8BA 4K7UA 2REXA 4MGZE 3SU8X 4K3CA 4WIPA 1QF6A 2D5GA 2GMIC 1QOFA 4IDIA 3ZXRA 4WJPA 5IA7A 4KKIA 5CTRC 1V80A 1HZ5A 1YN5A 2MSED 4DDGD 3C19A 2N9LA 2Z0DB 3TCAA 2UWQA 1C79A 1C4AA 1A70A 1TS5A 2ZZPB 4BBNC 2NBVB 4ITKA 3QA8A 3RNBC 4YTNB 1XT9B 3RUIB 1YOVB 4BFRA
chains in the Genus database with same CATH topology
4MJSB 2DX5B 5FR6A 1LXDA 3HIZA 1GJZA 4FN2A 3JW0X 2RGFA 3A9JB 3KH0A 4GMVA 4NY0A 1OTRB 4F1SA 2K39A 2IO3B 3NZUA 3K9PB 4GU2A 4EFOA 1WH3A 1WXVA 3H7PA 4GB9A 4HCPB 4RMAA 4NPNA 2C5LC 4BVUC 4A3OA 3BY4B 5DPWA 2KTFA 1LM8B 4HK2A 4J6IA 2XBBC 5CHWA 1KOTA 4GDKB 1VD2A 1P9DU 3QIJA 2LUEA 3HM3A 3PV1A 3ZIMA 5LXHA 2MRPA 3V6EB 1WZ0A 5LXIB 3OJ4B 3JSVB 4BKSD 4ZRKA 2WYQA 4E74A 1XD3B 5JZEB 2JRIB 5DCNA 1KM7A 1F9JA 1Q5WB 2D11A 2XK5A 3VTWA 4EEWA 3WAMA 2W9NA 2LI5A 3UQAA 2MBEA 2JRHA 3DBRI 5AZFA 2MBQA 2AYOB 2J7QB 1UD7A 4OVUA 3A1QB 3ECIA 1WR1A 3L17A 3PT2B 2FIFA 3CSTA 2LGYA 2KQSA 3DCGA 3ZDMC 2KMAA 1J8CA 2DYOA 1BT0A 4FHJA 1S1QB 4YL8A 4FLHA 2DYMA 3KUZA 2M4NA 3OJ3A 3PREA 4F7ZA 1TTNA 2JUOA 5JHAA 4FADA 1V2YA 1WJ4A 4PS3A 4CO7A 4HJKA 2G4SA 2XK5B 2LVQA 2KC2A 5IAAC 3TBLD 4TQ0A 2BF8B 2ZEQA 3K9OB 2L00B 4HDQA 3QQ8B 3CSFA 3N30A 5G55A 5AZGA 3H9DA 1WGRA 2KTRB 3ML9A 1V86A 3QJZA 5JH5C 1D3ZA 2PJHA 3ZRCA 2KO3A 4KDIC 1WRDB 4HVBA 2B3AA 4GDLA 4KV2A 4PYZA 4RM8A 1WGGA 2R2OA 3M95A 4ZRJA 4B95A 4PS8A 1MG8A 2MP2B 2LZ6A 3PRZA 3DPDA 1IP9A 4W9HA 4BOSC 3ZO5B 4AOFA 2GBKA 1H8CA 1UGMA 4EUTA 5JHBA 3DOWA 3VUWA 4JL9A 5G2NA 2BKFA 2ZJDA 1E7VA 2IYDB 2BGFA 3I3TB 1KLVA 2GBJA 4GGQA 1GUAB 1RAXA 4PS7A 3N3KB 2O6VD 5DPSA 3PGEA 3DQVA 2LGXA 3R3MA 2D07B 4ANUA 4WAAA 1WM3A 2YVCA 2NPTB 2DHZA 2KQ7A 3ONSA 4LDTD 2L76A 4TQ1A 3VH4B 4FJZA 4GN1A 2I1JA 4N9F4 4ANVA 4NAWA 3PPAA 3H1UA 1T0YA 4FULA 2KN5A 2KANA 1YD8U 3RZFA 3V60A 3WIMA 3DBHI 3KUCB 5J2RA 4ZRIA 1WMHA 3O65B 2JF5A 3DBLI 2ZNVC 2NCNA 1GG3A 1IPGA 1TZ1A 1S3SG 2K1FA 5KHOA 1V5TA 3GZNI 4DHJD 5E6PA 2N7DA 5CX3A 2O6VB 5C1ZA 2EKEC 3KVFB 4I6PA 4P7IA 3DVGY 4EZJA 4G3XB 2PEAA 2KDIA 2N9PC 3NS8A 2FCSA 2OJRA 4G11A 5C23A 1C3TA 2IO1B 2ZVOA 4AUQC 1WX8A 4URKA 2BKRB 2CKHB 2JZZA 2KJRA 4ZYNA 3MTNB 2A4ZA 2LRWA 2M17A 3LJ3A 3HM6X 4MM3A 3ZNGC 3W1SA 4GIVA 3D32A 3VHTC 1V6EA 4KVGB 3VTUA 1YIWA 1UBQA 1XQQA 2IO0B 4FA6A 3A9KB 3JYUA 3NHEB 2JVCA 4DHJB 2KZRA 4G0NB 4AJYB 5TR5A 3QWZB 1Q0WB 2G45B 2K6QA 3LDZE 3ZNHB 1K8RB 1NBFC 4EKUA 4B9KA 1WR6E 3M3JA 4JIOU 5CHVC 2KFKA 5LLIA 4HLEA 3Q3FA 2KDFB 1KJTA 2G4DB 2BYVE 1YJ1A 3EHVA 2V4LA 1E8XA 1RFAA 1EF1A 2L0TA 3PSEB 3QAQA 5J18A 3VH3B 4A3PA 3SDLC 3UIOB 3V62A 3X23A 4BOZB 3PS6A 1I35A 4W9GA 1AARA 3KYDD 2QHOA 1WXSA 4XX5A 3RCZA 3PHWB 3ZLZA 1WJUA 2FCNA 2WDTB 2PPHA 3R7QA 4AP4C 1P1AA 3BINA 2N7EA 1YQBA 1WI0A 4ICUA 2KWUB 4MSQB 1WXAA 5DPRA 4HDOA 3TJPA 2KC1A 1WJ6A 1EO6A 2HTHA 3H7PB 2KX3A 1G6JA 1ZW7A 2KLCA 4ANXA 1A5RA 2GBNA 2N1VA 2CR5A 1EF5A 4LJPB 4JLCA 2KK8A 1CMXB 4G50A 4GOCA 2WX0A 3RT3B 3TMPB 1U4AA 2XEWA 2L0FA 1I42A 3QK0A 4LCDE 2CU1A 3PZDA 2N9EB 4TUUA 2NR2A 3L0WB 4DHZE 4DXAB 3HK0A 2CS4A 3VVWB 2L8JA 2NBWB 2K25A 3KW5B 2BYFA 2NVUI 3ZW3A 2IY1B 2CHWA 3APDA 3JVZX 2KFJA 4F8CB 1E8ZA 1WGDA 2IY0B 1IYFA 2ASQA 3AULA 4IW0A 1NDDA 1Z2MA 2L05A 4JGHB 4IG7B 3EECA 3AU4A 3QX1A 1HE8A 3DVNV 3X0WA 2DZJA 4I6LB 2DZKA 4CYEA 2C7NB 1E8YA 2N4FA 3B08A 2O2VA 5L95C 4ZDVA 3UQBA 3DBSA 2KJHB 2ZCCA 3SHQA 4KSKC 2M1MA 4WJNA 4W9IA 3WA0A 4W9JA 2AL6A 1OEYJ 3PLUA 1M94A 4II2B 4RM9A 5DPTA 1E90A 2M8SA 3QCAA 4IM3A 4MGIE 1GNUA 4W9CA 4IWPA 3VFKA 3IFWB 2FIDA 3PHXB 2FCQA 2K8CA 3ZRFA 4ANWA 3PVLA 4MGKE 1YX6B 4GDLB 2KX0A 4FJYA 4M8NA 4BBNF 2FAZA 3RYTA 4E71A 2MCNB 2HD5B 2KJ6A 3OLMD 1E7UA 1LFDA 3R66C 3WAPA 1UH6A 3M63B 3CF6E 1WJNA 1Z5SB 1C1YB 1WGHA 3ALBA 3ENEA 5GMVA 5AEKB 2KMCA 3ZVVA 2YLMA 3R7RA 3A4RA 3MJWA 3CMMB 4KIKA 3GOEA 3H6NA 4PYUA 3RD2A 3TL5A 4DWFA 4EZKA 3ZTCA 2DAJA 2K8HA 1RLFA 3Q3JA 1EUVB 4M0WB 4K81A 1SIFA 3DVNU 4IM0A 2MBHA 2IBIB 2CHZA 2KKCA 3B0AA 4KSLC 2JXXA 2JWZA 5D94A 2MX2A 4HPMB 2LWPA 2DZMA 4NAWB 2V3SA 3RULA 3VUYA 2KVRA 2OOBB 4JQWC 1OEYA 2LD9A 2AWTA 1L7YA 3VDZA 1P0RA 2KDBA 2J0MA 4ICVA 1WMHB 2MW5A 4MJSA 3T8MA 4X57B 2EMSA 2ZPYA 4KIKB 2MBBB 3VQIA 5BO4B 3VAWA 3A9JA 3QC8B 4I6NB 2PE9A 2LVPA 3ZTDA 1RRBA 1WZ3A 2Z59B 4W9FA 1FXTB 4MELA 1ZKHA 1WYWB 1WX9A 3A33B 4WWNA 2RR9A 3APFA 3T9LA 4KZ0A 3HHMA 4WQOB 2MQJA 3S2AA 4K1RB 1UZXB 2BPSA 4WJQA 4GDKA 4XC2A 3P2BA 4CHKA 4IM2A 2KNBA 3APCA 3V6CB 3NZSA 4EZLA 2ZVNA 3JSVA 2MA9B 1E8WA 3U8ZA 2C7HA 1ISNA 2K8BA 2N9XA 5D6JB 3L54A 3SD5A 2D3GA 2RSUA 4A20A 4WWOA 4M8MA 4FBJB 2K6DB 2V1YA 4XZ4A 2D10A 4K7WA 4OVVA 2BWES 3ML8A 1J19A 4W9LA 2MBOA 4WJOA 2IO2B 1GC6A 4GXBA 1YX5B 4WWPA 2ZPNA 3A1QA 1WXMA 3IG3A 1E5WA 3B1LX 3EFUA 4LJOB 2KLGA 2KFKB 5AZHA 3W1SC 2MLBA 2D2QA 4BKSA 3L10B 2WX1A 2C60A 3QARA 4DHZB 4W9EA 3DDCB 3L13A 3WAOA 3H7SA 2FNJB 1P3QU 2J0JA 4K7SA 3DVGX 2VRRB 3PTFC 5D7GA 3UIPB 1R4NI 3UF8A 2LXCA 4HPLB 3PRMB 4KZCA 1JRUA 1H4RA 4IUMB 3UGBB 4GSWA 2DENB 4E3CA 4W9DA 2KTRA 3OAWA 3TIXA 2RD0A 3IHPC 3C0RB 2C9WB 2KOXA 4HXDA 3VUXA 3IVFA 1QZEA 3WANA 3VTVA 1WF9A 4BKGA 4W9KA 4MGYE 2Z0EB 3ZKJC 2AL3A 2J0KA 4TKNA 4ASWC 2MP2A 3NY5A 3PLVA 4AWJA 2M0XA 1L2NA 3AXCA 2R2QA 1TBEA 4IWQA 5D2MB 2FCMA 3PRPB 1V49A 4HCNB 1UELA 4BKTA 4NJ6A 2GBMA 4II3B 2AEHA 3KYCD 1SGHA 2I1KA 1NI2A 1X1MA 3L08A 3L16A 3QHTA 3U7DA 3ZNZB 4NQLB 1WX7A 2KD0A 1WE7A 2GOWA 2N1WA 2HJ8A 2RPQA 2JZ3B 2BYEA 2NPTA 2KHWB 3N32A 4KDLB 1OGWA 3IBEA 2JT4B 5L83A 4DBGA 3UINB 1OQYA 2L3ZA 2LVOA 5J17A 2KWCA 3V61A 2LASA 1WFYA 5E6NA 2FUHB 4AJWA 1TGZB 2LJ5A 2HE7A 2O2VB 2L7RA 3ZDTA 4TV3A 4DK5A 1V9JA 2EMTA 1LQBA 5EDSA 4IWOA 2KDEB 1V81A 1GC7A 1V5OA 1WIAA 2REXA 4K7UA 4MGZE 1ZGUB 2PE6B 3SU8X 4MDKE 1WGYA 4HWIB 4MEMA 2O6VA 1WY8A 2ZNVB 2ZCBA 2JY6A 2Y5BB 2BWFA 2KXJA 3EC8A 4FHKA 2LXAA 2GMIC 2NS5A 2WWZA 3W1YA 3MHSD 1WE6A 1R4MI 3KUDB 2NBUA 4WJPA 2MWSB 3M62B 1SE9A 5IA7A 2DAFA 2CHXA 3A4SC 5CTRC 3VXWA 5HKHA 1P98A 1V80A 1Y8RC 4FJVB 2MSED 4DDGD 5E6OA 1VCBA 2IZVB 5CHFA 3AU5A 4B6WA 2Z0DB 2UYZB 3A9KA 2G3QB 2GBRA 3TCAA 3RZWC 2UWQA 2KWVB 3NOBA 2JPHA 4NNJB 4NQKE 4NJ7A 3AI5A 2C7MB 3ZUNA 4MSMB 4LDTB 4MH0E 2ZZPB 1PQSA 4BBNC 2NBVB 2DYBA 1Q1OA 3QA8A 2LGDA 2DZIA 4DDID 1XT9B 4IC7B 3RUIB 1UBIA 3U30A 5KHQA 3WALA 2A5UA 4EOYA 2LRUA 3ZNID 4BFRA 1J0GA 1WM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJS B;  2DX5 B;  5FR6 A;  1LXD A;  3HIZ A;  1GJZ A;  4FN2 A;  3JW0 X;  2RGF A;  3A9J B;  3KH0 A;  4GMV A;  4NY0 A;  1OTR B;  4F1S A;  2K39 A;  2IO3 B;  3NZU A;  3K9P B;  4GU2 A;  4EFO A;  1WH3 A;  1WXV A;  3H7P A;  4GB9 A;  4HCP B;  4RMA A;  4NPN A;  2C5L C;  4BVU C;  4A3O A;  3BY4 B;  5DPW A;  2KTF A;  1LM8 B;  4HK2 A;  4J6I A;  2XBB C;  5CHW A;  1KOT A;  4GDK B;  1VD2 A;  1P9D U;  3QIJ A;  2LUE A;  3HM3 A;  3PV1 A;  3ZIM A;  5LXH A;  2MRP A;  3V6E B;  1WZ0 A;  5LXI B;  3OJ4 B;  3JSV B;  4BKS D;  4ZRK A;  2WYQ A;  4E74 A;  1XD3 B;  5JZE B;  2JRI B;  5DCN A;  1KM7 A;  1F9J A;  1Q5W B;  2D11 A;  2XK5 A;  3VTW A;  4EEW A;  3WAM A;  2W9N A;  2LI5 A;  3UQA A;  2MBE A;  2JRH A;  3DBR I;  5AZF A;  2MBQ A;  2AYO B;  2J7Q B;  1UD7 A;  4OVU A;  3A1Q B;  3ECI A;  1WR1 A;  3L17 A;  3PT2 B;  2FIF A;  3CST A;  2LGY A;  2KQS A;  3DCG A;  3ZDM C;  2KMA A;  1J8C A;  2DYO A;  1BT0 A;  4FHJ A;  1S1Q B;  4YL8 A;  4FLH A;  2DYM A;  3KUZ A;  2M4N A;  3OJ3 A;  3PRE A;  4F7Z A;  1TTN A;  2JUO A;  5JHA A;  4FAD A;  1V2Y A;  1WJ4 A;  4PS3 A;  4CO7 A;  4HJK A;  2G4S A;  2XK5 B;  2LVQ A;  2KC2 A;  5IAA C;  3TBL D;  4TQ0 A;  2BF8 B;  2ZEQ A;  3K9O B;  2L00 B;  4HDQ A;  3QQ8 B;  3CSF A;  3N30 A;  5G55 A;  5AZG A;  3H9D A;  1WGR A;  2KTR B;  3ML9 A;  1V86 A;  3QJZ A;  5JH5 C;  1D3Z A;  2PJH A;  3ZRC A;  2KO3 A;  4KDI C;  1WRD B;  4HVB A;  2B3A A;  4GDL A;  4KV2 A;  4PYZ A;  4RM8 A;  1WGG A;  2R2O A;  3M95 A;  4ZRJ A;  4B95 A;  4PS8 A;  1MG8 A;  2MP2 B;  2LZ6 A;  3PRZ A;  3DPD A;  1IP9 A;  4W9H A;  4BOS C;  3ZO5 B;  4AOF A;  2GBK A;  1H8C A;  1UGM A;  4EUT A;  5JHB A;  3DOW A;  3VUW A;  4JL9 A;  5G2N A;  2BKF A;  2ZJD A;  1E7V A;  2IYD B;  2BGF A;  3I3T B;  1KLV A;  2GBJ A;  4GGQ A;  1GUA B;  1RAX A;  4PS7 A;  3N3K B;  2O6V D;  5DPS A;  3PGE A;  3DQV A;  2LGX A;  3R3M A;  2D07 B;  4ANU A;  4WAA A;  1WM3 A;  2YVC A;  2NPT B;  2DHZ A;  2KQ7 A;  3ONS A;  4LDT D;  2L76 A;  4TQ1 A;  3VH4 B;  4FJZ A;  4GN1 A;  2I1J A;  4N9F 4;  4ANV A;  4NAW A;  3PPA A;  3H1U A;  1T0Y A;  4FUL A;  2KN5 A;  2KAN A;  1YD8 U;  3RZF A;  3V60 A;  3WIM A;  3DBH I;  3KUC B;  5J2R A;  4ZRI A;  1WMH A;  3O65 B;  2JF5 A;  3DBL I;  2ZNV C;  2NCN A;  1GG3 A;  1IPG A;  1TZ1 A;  1S3S G;  2K1F A;  5KHO A;  1V5T A;  3GZN I;  4DHJ D;  5E6P A;  2N7D A;  5CX3 A;  2O6V B;  5C1Z A;  2EKE C;  3KVF B;  4I6P A;  4P7I A;  3DVG Y;  4EZJ A;  4G3X B;  2PEA A;  2KDI A;  2N9P C;  3NS8 A;  2FCS A;  2OJR A;  4G11 A;  5C23 A;  1C3T A;  2IO1 B;  2ZVO A;  4AUQ C;  1WX8 A;  4URK A;  2BKR B;  2CKH B;  2JZZ A;  2KJR A;  4ZYN A;  3MTN B;  2A4Z A;  2LRW A;  2M17 A;  3LJ3 A;  3HM6 X;  4MM3 A;  3ZNG C;  3W1S A;  4GIV A;  3D32 A;  3VHT C;  1V6E A;  4KVG B;  3VTU A;  1YIW A;  1UBQ A;  1XQQ A;  2IO0 B;  4FA6 A;  3A9K B;  3JYU A;  3NHE B;  2JVC A;  4DHJ B;  2KZR A;  4G0N B;  4AJY B;  5TR5 A;  3QWZ B;  1Q0W B;  2G45 B;  2K6Q A;  3LDZ E;  3ZNH B;  1K8R B;  1NBF C;  4EKU A;  4B9K A;  1WR6 E;  3M3J A;  4JIO U;  5CHV C;  2KFK A;  5LLI A;  4HLE A;  3Q3F A;  2KDF B;  1KJT A;  2G4D B;  2BYV E;  1YJ1 A;  3EHV A;  2V4L A;  1E8X A;  1RFA A;  1EF1 A;  2L0T A;  3PSE B;  3QAQ A;  5J18 A;  3VH3 B;  4A3P A;  3SDL C;  3UIO B;  3V62 A;  3X23 A;  4BOZ B;  3PS6 A;  1I35 A;  4W9G A;  1AAR A;  3KYD D;  2QHO A;  1WXS A;  4XX5 A;  3RCZ A;  3PHW B;  3ZLZ A;  1WJU A;  2FCN A;  2WDT B;  2PPH A;  3R7Q A;  4AP4 C;  1P1A A;  3BIN A;  2N7E A;  1YQB A;  1WI0 A;  4ICU A;  2KWU B;  4MSQ B;  1WXA A;  5DPR A;  4HDO A;  3TJP A;  2KC1 A;  1WJ6 A;  1EO6 A;  2HTH A;  3H7P B;  2KX3 A;  1G6J A;  1ZW7 A;  2KLC A;  4ANX A;  1A5R A;  2GBN A;  2N1V A;  2CR5 A;  1EF5 A;  4LJP B;  4JLC A;  2KK8 A;  1CMX B;  4G50 A;  4GOC A;  2WX0 A;  3RT3 B;  3TMP B;  1U4A A;  2XEW A;  2L0F A;  1I42 A;  3QK0 A;  4LCD E;  2CU1 A;  3PZD A;  2N9E B;  4TUU A;  2NR2 A;  3L0W B;  4DHZ E;  4DXA B;  3HK0 A;  2CS4 A;  3VVW B;  2L8J A;  2NBW B;  2K25 A;  3KW5 B;  2BYF A;  2NVU I;  3ZW3 A;  2IY1 B;  2CHW A;  3APD A;  3JVZ X;  2KFJ A;  4F8C B;  1E8Z A;  1WGD A;  2IY0 B;  1IYF A;  2ASQ A;  3AUL A;  4IW0 A;  1NDD A;  1Z2M A;  2L05 A;  4JGH B;  4IG7 B;  3EEC A;  3AU4 A;  3QX1 A;  1HE8 A;  3DVN V;  3X0W A;  2DZJ A;  4I6L B;  2DZK A;  4CYE A;  2C7N B;  1E8Y A;  2N4F A;  3B08 A;  2O2V A;  5L95 C;  4ZDV A;  3UQB A;  3DBS A;  2KJH B;  2ZCC A;  3SHQ A;  4KSK C;  2M1M A;  4WJN A;  4W9I A;  3WA0 A;  4W9J A;  2AL6 A;  1OEY J;  3PLU A;  1M94 A;  4II2 B;  4RM9 A;  5DPT A;  1E90 A;  2M8S A;  3QCA A;  4IM3 A;  4MGI E;  1GNU A;  4W9C A;  4IWP A;  3VFK A;  3IFW B;  2FID A;  3PHX B;  2FCQ A;  2K8C A;  3ZRF A;  4ANW A;  3PVL A;  4MGK E;  1YX6 B;  4GDL B;  2KX0 A;  4FJY A;  4M8N A;  4BBN F;  2FAZ A;  3RYT A;  4E71 A;  2MCN B;  2HD5 B;  2KJ6 A;  3OLM D;  1E7U A;  1LFD A;  3R66 C;  3WAP A;  1UH6 A;  3M63 B;  3CF6 E;  1WJN A;  1Z5S B;  1C1Y B;  1WGH A;  3ALB A;  3ENE A;  5GMV A;  5AEK B;  2KMC A;  3ZVV A;  2YLM A;  3R7R A;  3A4R A;  3MJW A;  3CMM B;  4KIK A;  3GOE A;  3H6N A;  4PYU A;  3RD2 A;  3TL5 A;  4DWF A;  4EZK A;  3ZTC A;  2DAJ A;  2K8H A;  1RLF A;  3Q3J A;  1EUV B;  4M0W B;  4K81 A;  1SIF A;  3DVN U;  4IM0 A;  2MBH A;  2IBI B;  2CHZ A;  2KKC A;  3B0A A;  4KSL C;  2JXX A;  2JWZ A;  5D94 A;  2MX2 A;  4HPM B;  2LWP A;  2DZM A;  4NAW B;  2V3S A;  3RUL A;  3VUY A;  2KVR A;  2OOB B;  4JQW C;  1OEY A;  2LD9 A;  2AWT A;  1L7Y A;  3VDZ A;  1P0R A;  2KDB A;  2J0M A;  4ICV A;  1WMH B;  2MW5 A;  4MJS A;  3T8M A;  4X57 B;  2EMS A;  2ZPY A;  4KIK B;  2MBB B;  3VQI A;  5BO4 B;  3VAW A;  3A9J A;  3QC8 B;  4I6N B;  2PE9 A;  2LVP A;  3ZTD A;  1RRB A;  1WZ3 A;  2Z59 B;  4W9F A;  1FXT B;  4MEL A;  1ZKH A;  1WYW B;  1WX9 A;  3A33 B;  4WWN A;  2RR9 A;  3APF A;  3T9L A;  4KZ0 A;  3HHM A;  4WQO B;  2MQJ A;  3S2A A;  4K1R B;  1UZX B;  2BPS A;  4WJQ A;  4GDK A;  4XC2 A;  3P2B A;  4CHK A;  4IM2 A;  2KNB A;  3APC A;  3V6C B;  3NZS A;  4EZL A;  2ZVN A;  3JSV A;  2MA9 B;  1E8W A;  3U8Z A;  2C7H A;  1ISN A;  2K8B A;  2N9X A;  5D6J B;  3L54 A;  3SD5 A;  2D3G A;  2RSU A;  4A20 A;  4WWO A;  4M8M A;  4FBJ B;  2K6D B;  2V1Y A;  4XZ4 A;  2D10 A;  4K7W A;  4OVV A;  2BWE S;  3ML8 A;  1J19 A;  4W9L A;  2MBO A;  4WJO A;  2IO2 B;  1GC6 A;  4GXB A;  1YX5 B;  4WWP A;  2ZPN A;  3A1Q A;  1WXM A;  3IG3 A;  1E5W A;  3B1L X;  3EFU A;  4LJO B;  2KLG A;  2KFK B;  5AZH A;  3W1S C;  2MLB A;  2D2Q A;  4BKS A;  3L10 B;  2WX1 A;  2C60 A;  3QAR A;  4DHZ B;  4W9E A;  3DDC B;  3L13 A;  3WAO A;  3H7S A;  2FNJ B;  1P3Q U;  2J0J A;  4K7S A;  3DVG X;  2VRR B;  3PTF C;  5D7G A;  3UIP B;  1R4N I;  3UF8 A;  2LXC A;  4HPL B;  3PRM B;  4KZC A;  1JRU A;  1H4R A;  4IUM B;  3UGB B;  4GSW A;  2DEN B;  4E3C A;  4W9D A;  2KTR A;  3OAW A;  3TIX A;  2RD0 A;  3IHP C;  3C0R B;  2C9W B;  2KOX A;  4HXD A;  3VUX A;  3IVF A;  1QZE A;  3WAN A;  3VTV A;  1WF9 A;  4BKG A;  4W9K A;  4MGY E;  2Z0E B;  3ZKJ C;  2AL3 A;  2J0K A;  4TKN A;  4ASW C;  2MP2 A;  3NY5 A;  3PLV A;  4AWJ A;  2M0X A;  1L2N A;  3AXC A;  2R2Q A;  1TBE A;  4IWQ A;  5D2M B;  2FCM A;  3PRP B;  1V49 A;  4HCN B;  1UEL A;  4BKT A;  4NJ6 A;  2GBM A;  4II3 B;  2AEH A;  3KYC D;  1SGH A;  2I1K A;  1NI2 A;  1X1M A;  3L08 A;  3L16 A;  3QHT A;  3U7D A;  3ZNZ B;  4NQL B;  1WX7 A;  2KD0 A;  1WE7 A;  2GOW A;  2N1W A;  2HJ8 A;  2RPQ A;  2JZ3 B;  2BYE A;  2NPT A;  2KHW B;  3N32 A;  4KDL B;  1OGW A;  3IBE A;  2JT4 B;  5L83 A;  4DBG A;  3UIN B;  1OQY A;  2L3Z A;  2LVO A;  5J17 A;  2KWC A;  3V61 A;  2LAS A;  1WFY A;  5E6N A;  2FUH B;  4AJW A;  1TGZ B;  2LJ5 A;  2HE7 A;  2O2V B;  2L7R A;  3ZDT A;  4TV3 A;  4DK5 A;  1V9J A;  2EMT A;  1LQB A;  5EDS A;  4IWO A;  2KDE B;  1V81 A;  1GC7 A;  1V5O A;  1WIA A;  2REX A;  4K7U A;  4MGZ E;  1ZGU B;  2PE6 B;  3SU8 X;  4MDK E;  1WGY A;  4HWI B;  4MEM A;  2O6V A;  1WY8 A;  2ZNV B;  2ZCB A;  2JY6 A;  2Y5B B;  2BWF A;  2KXJ A;  3EC8 A;  4FHK A;  2LXA A;  2GMI C;  2NS5 A;  2WWZ A;  3W1Y A;  3MHS D;  1WE6 A;  1R4M I;  3KUD B;  2NBU A;  4WJP A;  2MWS B;  3M62 B;  1SE9 A;  5IA7 A;  2DAF A;  2CHX A;  3A4S C;  5CTR C;  3VXW A;  5HKH A;  1P98 A;  1V80 A;  1Y8R C;  4FJV B;  2MSE D;  4DDG D;  5E6O A;  1VCB A;  2IZV B;  5CHF A;  3AU5 A;  4B6W A;  2Z0D B;  2UYZ B;  3A9K A;  2G3Q B;  2GBR A;  3TCA A;  3RZW C;  2UWQ A;  2KWV B;  3NOB A;  2JPH A;  4NNJ B;  4NQK E;  4NJ7 A;  3AI5 A;  2C7M B;  3ZUN A;  4MSM B;  4LDT B;  4MH0 E;  2ZZP B;  1PQS A;  4BBN C;  2NBV B;  2DYB A;  1Q1O A;  3QA8 A;  2LGD A;  2DZI A;  4DDI D;  1XT9 B;  4IC7 B;  3RUI B;  1UBI A;  3U30 A;  5KHQ A;  3WAL A;  2A5U A;  4EOY A;  2LRU A;  3ZNI D;  4BFR A;  1J0G A;  1WM2 A; 
#chains in the Genus database with same CATH topology
 2DX5 B;  2CU3 A;  3HIZ A;  2RGF A;  3NZ3 A;  1E6E B;  1FNU A;  1KFY B;  3Q8F A;  3ZQ4 A;  2IO3 B;  1P7F A;  2W82 A;  4C7Z A;  1FRD A;  1WXV A;  3NS1 A;  4GB9 A;  4HCP B;  3V05 A;  1VLB A;  2C5L C;  4A3O A;  4BVU C;  3AE6 B;  1UUP A;  2XBB C;  2I2Y A;  2KWD A;  2JQR B;  1MFW A;  2INP E;  1JAL A;  5LXI B;  3OJ4 B;  3JSV B;  4QAY A;  5JZE B;  2L52 A;  1YN3 A;  4B0E A;  4EEW A;  3UI3 A;  2BS2 B;  3WAM A;  1UWM A;  2W9N A;  3I9V 1;  2JRH A;  2Y3A A;  3DBR I;  3HRD D;  4OVU A;  3A1Q B;  1WR1 A;  5JXV A;  2LGY A;  2KQS A;  3DCG A;  2KMA A;  1BT0 A;  5MPO A;  2IND C;  4FLH A;  2DYM A;  3KUZ A;  1HEZ E;  1EU3 A;  1WJ4 A;  3SR6 A;  4HJK A;  2LVQ A;  5IAA C;  3CSF A;  3N30 A;  5AZG A;  3DWM A;  4LNN A;  2KTR B;  3QJZ A;  3ZRC A;  4KDI C;  3RMK C;  1DYQ A;  4XYC A;  1TZO A;  3Q8C A;  2PTL A;  3AE5 B;  1H8C A;  1B1Z A;  4LLG M;  2DWQ A;  2IYD B;  1MI0 A;  2O6V D;  2KQ7 A;  2KAC A;  3VH4 B;  4N9F 4;  3H1U A;  1GPX A;  4FUL A;  2KN5 A;  4AS1 A;  3V60 A;  3O65 B;  1IGD A;  1PFD A;  4UDU C;  5KHO A;  4DHJ D;  2N7D A;  5C1Z A;  2EKE C;  4I6P A;  3DVG Y;  3N1Z C;  2PEA A;  3AE7 B;  1T0R C;  4URK A;  1WX8 A;  4HKQ A;  2JZZ A;  3U52 E;  3MTN B;  2A4Z A;  2M17 A;  3N9Y C;  1C9F A;  2QEJ C;  4JPS A;  1UBQ A;  4HJG E;  4FA6 A;  3A9K B;  2ZW0 A;  3NHE B;  4AJY B;  1BML C;  2G9H D;  2LJI A;  2K6Q A;  2WXK A;  1D6E C;  1NBF C;  1L5P A;  4JIO U;  5CHV C;  1OFF A;  2KFK A;  2OHF A;  3Q3F A;  1KJT A;  1R4M B;  1SE3 A;  3EHV A;  1E8X A;  2L0T A;  3QAQ A;  3RPF C;  3VH3 B;  4W9G A;  3KYD D;  2BTE A;  2QHO A;  3CWI A;  3RCZ A;  3PHW B;  3R7Q A;  2WDT B;  1P1A A;  2N7E A;  1WI0 A;  1EU4 A;  2KWU B;  4RGO S;  1EO6 A;  2HTH A;  1KLG D;  1G6J A;  4AQ7 A;  1A5R A;  1EF5 A;  1PGX A;  3TEX A;  3Q3N C;  3RT3 B;  3TMP B;  4IKG A;  2CU1 A;  4KKJ A;  4DHZ E;  3HK0 A;  3VVW B;  2L8J A;  2BYF A;  2CHW A;  3JVZ X;  4F8C B;  2WQY B;  1IYF A;  3EA6 A;  2ASQ A;  2AQ3 B;  4IW0 A;  1FCL A;  2WNM A;  2L05 A;  3AM9 A;  3AE2 B;  4YXD B;  3QX1 A;  3X0W A;  1EWC A;  2DZK A;  3OWE B;  1TS2 A;  2PVO D;  4DXF A;  3UQB A;  2ZCC A;  4OZC A;  4KSK C;  3ZJT A;  1OEY J;  4A90 A;  4II2 B;  5DPT A;  4RH6 A;  2LEK A;  1MPE A;  4MGI E;  1GNU A;  1N61 A;  3L4P A;  4ACF A;  3ZRF A;  4MGK E;  4GDL B;  2HTM E;  4M8N A;  4BBN F;  1FM0 D;  1YMH E;  2GLS A;  3P1M A;  3OLM D;  1LFD A;  2VH2 A;  3WAP A;  3ALB A;  5AEK B;  1RFK A;  2YLM A;  4PYU A;  3H6N A;  3TL5 A;  3FKY A;  1XCT L;  1RLF A;  4C80 A;  4M0W B;  2QDF A;  2W55 A;  2MBH A;  2WXO A;  4KSL C;  1F0Z A;  1YQ3 B;  2MX2 A;  3GP7 A;  4HPM B;  4LK0 M;  1KRH A;  1SJE D;  2AWT A;  2LD9 A;  3H8H A;  1I4H A;  1L4Z B;  3VDZ A;  2J0M A;  4ICV A;  2DLB A;  4KIK B;  2MBB B;  3VAW A;  4BAX A;  2PE9 A;  2XNA C;  1WXQ A;  3ZTD A;  1WZ3 A;  1WYW B;  3AEA B;  2W3S A;  3W5U B;  1JRO A;  1M4V A;  4KZ0 A;  2SEB D;  3AEC B;  4WQO B;  3S2A A;  2WXI A;  3APC A;  3V6C B;  2WXP A;  4RGM A;  3JSV A;  3VR8 B;  2MA9 B;  3U8Z A;  1ZDV A;  2K8B A;  2N9X A;  4LNF A;  4MM3 B;  3SD5 A;  2D3G A;  2K6D B;  1TS4 A;  4WJO A;  1JWU D;  2IO2 B;  1NYQ A;  3A1Q A;  1WXM A;  4LJO B;  3B1L X;  3EFU A;  2ZW1 A;  5H92 C;  1IUE A;  1PDX A;  2BS3 B;  2MLB A;  4KGT A;  2Y5P A;  3L10 B;  2K5P A;  3DDC B;  3L13 A;  3WAO A;  2W3R A;  2SAK A;  2FNJ B;  2KMM A;  2GI9 A;  2G1E A;  1NVI D;  1VZ6 A;  3UIP B;  4C7Y A;  2LXC A;  4HPL B;  4GSW A;  2INC C;  1PYW D;  4E3C A;  4W9D A;  2KTR A;  3VUX A;  4MAC A;  3VTV A;  4BKG A;  3ZKJ C;  4ASW C;  4TKN A;  3NY5 A;  3DHI C;  5H8Y E;  4H2A A;  3AXC A;  1FNV A;  1TBE A;  3P4S B;  2N0S B;  4HCN B;  1UEL A;  5T8I A;  4BKT A;  2GBM A;  3U7D A;  3ZNZ B;  1MHH E;  1I4G A;  2RPV A;  2GOW A;  1WRI A;  2BYE A;  2KHW B;  2VZK B;  2JT4 B;  1QOB A;  4DBG A;  1GAQ B;  3UIN B;  1OQY A;  4M01 A;  3P4R B;  2NTT A;  2LAS A;  1FD6 A;  1WFY A;  2FUH B;  4AJW A;  2MJ3 A;  2O2V B;  3ZDT A;  2EMT A;  3KWL A;  1LQB A;  1V81 A;  1V5O A;  3CIR B;  1F1H A;  1ZGU B;  2PE6 B;  4WWM A;  1FXA A;  1XLQ A;  1WY8 A;  2AX5 A;  2ZCB A;  2Y5B B;  2BWF A;  3NUH B;  2PIA A;  4YSY B;  2LXA A;  2WWZ A;  3W1Y A;  1R4M I;  2WU5 B;  2WU2 B;  3M62 B;  1SE9 A;  2DAF A;  3AN1 A;  3VXW A;  5HKH A;  2IDY A;  3AEB B;  1VCB A;  3A9K A;  3RZW C;  3NOB A;  4NNJ B;  4NJ7 A;  2C7M B;  3KWV A;  1PQS A;  1JQ4 A;  2DYB A;  1Q1O A;  1VZ7 A;  3B2F A;  1UBI A;  1QOA A;  5KHQ A;  4JE3 B;  3P63 A;  1JRP A;  1TT5 B;  2WXQ A;  3RI7 C;  3BZD B;  5FR6 A;  1GJZ A;  3NVW A;  3JW0 X;  3U2S C;  4GU2 A;  3K9P B;  4EFO A;  2FBW B;  3URY A;  4RMA A;  4NPN A;  3BY4 B;  5DPW A;  1LM8 B;  1YJI A;  3BVZ A;  1AN8 A;  2D3A A;  4OZA A;  2JSV X;  4GDK B;  5FR3 A;  2RMM A;  3PV1 A;  2WS3 B;  2MRP A;  3BII D;  4ZRK A;  2WYQ A;  3T3N A;  3VRB B;  3RNC C;  1WWT A;  2LI5 A;  3O13 A;  1J7A A;  3W5V B;  1ZXH A;  4XDD A;  2L83 A;  2MBQ A;  1CK1 A;  2D3C A;  3CST A;  4RGT A;  1WYG A;  1J8C A;  1S1Q B;  1C4C A;  2JX5 A;  1TKG A;  3PRE A;  2MJD A;  4PS3 A;  2LMC A;  2G4S A;  1D5M C;  2XK5 B;  2KC2 A;  2AQ2 B;  2L00 B;  4HDQ A;  1J7B A;  3DHG C;  1DOX A;  3V3X A;  1ESF A;  2B3A A;  2H89 B;  4GDL A;  1MJD A;  4PYZ A;  4RM8 A;  3E9S A;  4ZRJ A;  4B95 A;  4PS8 A;  2LZ6 A;  3PRZ A;  1NEN B;  5D3D A;  1IP9 A;  4W9H A;  5HHD G;  1GB1 A;  4AOF A;  4US8 A;  4EUT A;  5JHB A;  4ZRP A;  3VUW A;  4JL9 A;  5HFY A;  1N62 A;  4HPP A;  4M0W A;  3N3K B;  3PGE A;  3R3M A;  2YEP B;  4WAA A;  1NEK B;  2DHZ A;  2GRI A;  2L76 A;  4TQ1 A;  4FJZ A;  3BWU D;  3PPA A;  1T0Y A;  2KAN A;  1JW9 D;  2JYE A;  2JF5 A;  3DBL I;  3HUI A;  4A9A A;  3NVV A;  1IPG A;  3AMZ A;  1V5T A;  1SF0 A;  1I4P A;  5E6P A;  2O6V B;  1AWD A;  1E9M A;  2V4I B;  1FPY A;  2N9P C;  1PGA A;  3AED B;  5EE1 A;  2ZVO A;  4AUQ C;  4MM3 A;  4GIV A;  3D32 A;  3OG5 A;  1YIW A;  4DHJ B;  2KZR A;  2K3U A;  2MH7 A;  4G0N B;  4ZOH C;  3GB1 A;  2IPK D;  2JWU A;  3ZNH B;  1BUI C;  3HVZ A;  1YJ1 A;  1EF1 A;  4A3P A;  3SDL C;  3X23 A;  4OVZ A;  1I35 A;  1AAR A;  2PPH A;  3N1X C;  1YQB A;  2VH1 A;  4ICU A;  3TJP A;  1WJ6 A;  4ANX A;  1EWY C;  2GBN A;  2CR5 A;  4XDC A;  4L2Y A;  1TY2 A;  1E10 A;  4JLC A;  1CMX B;  4ZHO A;  2WX0 A;  1U4A A;  2XEW A;  3MC0 B;  3PZD A;  3BK1 A;  2Z8L A;  4DXA B;  1N60 A;  2NBW B;  2IY1 B;  1Y56 A;  3NRZ A;  5BMG A;  1ET6 A;  3AE4 B;  2CJO A;  3EEC A;  3AU4 A;  1JWA D;  3MHZ A;  5HI1 A;  4I6L B;  1J7C A;  4CYE A;  2C7N B;  3B08 A;  2O2V A;  4A55 A;  2QC8 A;  4C00 A;  4YTM B;  4LNK A;  2M1M A;  1SXT A;  3WA0 A;  2AL6 A;  3PLU A;  3I57 A;  3ZGZ A;  2QJL A;  1E90 A;  3P4Q B;  4IM3 A;  4W9C A;  3VFK A;  3PHX B;  3ZXV A;  4CQN A;  2X38 A;  3BK2 A;  4LTU A;  1YX6 B;  4YTP B;  1V1O A;  2FAZ A;  4E71 A;  2MCN B;  2HD5 B;  4JWS C;  1E7U A;  2RDH A;  4DQO C;  3CF6 E;  3FIL B;  1Z5S B;  1C1Y B;  4P1B C;  1FRR A;  3GOE A;  4DWF A;  1LGR A;  3EGR A;  3Q3J A;  1EUV B;  4XE0 A;  4IM0 A;  2IBI B;  2N7J A;  2CHZ A;  3B0A A;  2TSS A;  1F52 A;  3U7Z A;  2L32 A;  2LWP A;  2DZM A;  2V3S A;  1LO5 D;  3PO0 A;  1SBB B;  1P0R A;  2KN4 A;  4M02 A;  3MP9 A;  3DWG C;  1XCQ L;  3QC8 B;  1K52 A;  1ZKH A;  2RR9 A;  3APF A;  2MQJ A;  2PKO A;  2BPS A;  4GDK A;  3P2B A;  2KQ4 X;  4JX1 C;  4IM2 A;  1IBX B;  4XGA B;  1ISN A;  1JCK B;  5D6J B;  4FBJ B;  3GZN B;  4JWU C;  3ML8 A;  3ETR A;  1J19 A;  4W9L A;  2MBO A;  2LUM A;  5EE0 A;  4GXB A;  1E5W A;  5AZH A;  3W1S C;  1VDV A;  2D2Q A;  3EFC A;  4US9 A;  3R2T A;  1D5X C;  2VRR B;  1R4N I;  3UGB B;  1JWS D;  2J53 A;  5IN7 A;  3OAW A;  1N63 A;  3IHP C;  3C0R B;  3LYY A;  2C9W B;  3RNE C;  2BT6 A;  1RYJ A;  3IVF A;  4BZA A;  3Q8E A;  1B9R A;  1WF9 A;  3AB5 A;  4W9K A;  4MGY E;  2V0G A;  3PLV A;  2M0X A;  1ZUD 2;  4IWQ A;  5D2M B;  1V49 A;  1FEH A;  4YWG G;  3J9C A;  2IGG A;  1SGH A;  3QHT A;  3L16 A;  2PW9 A;  3IBE A;  3U4E G;  2LVO A;  5J17 A;  2RDG A;  2KWC A;  2LJ5 A;  1NI3 A;  3IT6 B;  1V9J A;  5EDS A;  2KDE B;  1V8C A;  1GC7 A;  2MEK A;  1WIA A;  5BYQ A;  4MDK E;  1WGY A;  4HWI B;  2PLP A;  2O6V A;  1L0X B;  2ZNV B;  2KXJ A;  4L23 A;  4FHK A;  3MC8 A;  4WQM A;  3NVZ A;  3KUD B;  3VR9 B;  2NBU A;  1FIQ A;  1IGC A;  2CHX A;  3A4S C;  4RNA A;  1P98 A;  2BW2 A;  4FJV B;  2CJN A;  4B6W A;  3AU5 A;  2G3Q B;  2GBR A;  1HTO A;  4NQK E;  3AI5 A;  1ENF A;  4MSM B;  4LDT B;  2MJE A;  4MH0 E;  4WUR A;  2DZI A;  3AE3 B;  2HDE A;  2K0P A;  3WAL A;  2A5U A;  1N5X A;  4EOY A;  1FFU A;  2LRU A;  5E6J A;  1J0G A;  1GOZ A;  1XLP A;  3BVG A;  3KH0 A;  4RFB A;  2K39 A;  3NZU A;  5FK9 C;  4XWT A;  1WH3 A;  2KTF A;  4HK2 A;  4J6I A;  5CHW A;  1VD2 A;  1P9D U;  3QIJ A;  3ZIM A;  3HM3 A;  5G5H A;  3V6E B;  4BKS D;  1XD3 B;  2JRI B;  1TY0 A;  3UQA A;  4MT5 A;  2MBE A;  2DBY A;  1HQR D;  5BMH A;  2AYO B;  3Q14 C;  1QOG A;  4REZ A;  3L17 A;  2LGS A;  2DYO A;  2BVC A;  4FHJ A;  5AUI A;  2M4N A;  4F7Z A;  1TTN A;  5EE3 A;  5JHA A;  1V2Y A;  4CO7 A;  1L4D B;  3TBL D;  4TQ0 A;  2BF8 B;  1UGJ A;  3K9O B;  2M19 A;  3QQ8 B;  2YEP F;  3H9D A;  1WGR A;  1QLB B;  5JH5 C;  1D3Z A;  2KO3 A;  1WRD B;  4HVB A;  1WGG A;  2NMQ A;  2R2O A;  1SEB D;  2MP2 B;  3FIL A;  3MC9 A;  2WXM A;  1D5Z C;  2GBK A;  1UGM A;  2OJW A;  1MG4 A;  1E7V A;  2BGF A;  1KLV A;  2GBJ A;  2WXJ A;  4GGQ A;  1KH0 A;  1RAX A;  3IAS 1;  4ANU A;  1TIF A;  1WM3 A;  3ONS A;  4LDT D;  1D4B A;  1CZP A;  4GN1 A;  2I1J A;  4ANV A;  3RZF A;  1YD8 U;  3KUC B;  5IP4 D;  1TKY A;  5J2R A;  1QQR A;  4ZRQ A;  2ZNV C;  1TZ1 A;  2K9X A;  3GZN I;  5CX3 A;  2KYW A;  1DOI A;  1FNW A;  3KVF B;  3P4P B;  4EZJ A;  2KDI A;  3NS8 A;  4G11 A;  5C23 A;  2NTS A;  2BKR B;  1IBX A;  1GB4 A;  1E7P B;  3HM6 X;  3ZNG C;  1C76 A;  1V6E A;  2IO0 B;  1TJE A;  2JVC A;  5TR5 A;  3QWZ B;  4FXC A;  1Q0W B;  2G45 B;  3WCQ A;  2JXT A;  3LDZ E;  3W9C B;  2R61 A;  4B9K A;  1XLN A;  5LLI A;  1BXT A;  2QIL A;  1FCC C;  1RFA A;  2EKI A;  3PSE B;  1C78 A;  3UIO B;  3V62 A;  4BOZ B;  2E6X A;  4NJC A;  1WXS A;  4XX5 A;  3ZLZ A;  1WJU A;  1XO3 A;  4GLS C;  3BIN A;  4MSQ B;  1WXA A;  1YQ4 B;  4HDO A;  3H7P B;  1ZW7 A;  2KLC A;  2M56 B;  3GE3 C;  4LJP B;  2WXR A;  3VRA B;  2KK8 A;  5AUK A;  4GOC A;  4S17 A;  3SEB A;  2JYT A;  4TUU A;  2NR2 A;  2WXL A;  2CS4 A;  2WLB A;  3ZW3 A;  3APD A;  4TSS A;  1E8Z A;  1WGD A;  3AUL A;  4YSZ B;  4IG7 B;  1SE2 A;  1HE8 A;  3DVN V;  2DZJ A;  3AE1 B;  2MHJ A;  3P42 A;  5L95 C;  2KJH B;  3SHQ A;  2PVG C;  2LFI A;  4WJN A;  3KLS X;  4N59 A;  4W9J A;  2D3B A;  4RM9 A;  3Q2A C;  4HEA 1;  1QIL A;  3IFW B;  2FID A;  2FCQ A;  2IGH A;  2K8C A;  2WDQ B;  4ANW A;  3PVL A;  1AW7 A;  4R3D A;  1I4R A;  1ZPS A;  2KVZ A;  2KX0 A;  3BYY B;  2KJ6 A;  3R66 C;  3M63 B;  1WJN A;  4M00 A;  5GMV A;  1JWM D;  1CQV A;  2KMC A;  3R7R A;  3A4R A;  4KIK A;  4EZK A;  3RD2 A;  3ZTC A;  2K8H A;  1I7H A;  1PGB A;  2KKC A;  1NYR A;  2JXX A;  4MH8 A;  5D94 A;  4NAW B;  1R7S A;  3VUY A;  2N9K A;  2KVR A;  2OOB B;  4JQW C;  1L7Y A;  4WAF A;  5BYR A;  2KDB A;  1I4Q A;  1WMH B;  2MW5 A;  3T8M A;  4X57 B;  1STE A;  2ZPY A;  5BO4 B;  4C4V B;  2BBC A;  1V1P B;  4I6N B;  2WXF A;  2KT7 A;  2LVP A;  2Z59 B;  4W9F A;  1VR9 A;  4MEL A;  4L1B A;  1WX9 A;  1XLO A;  3B9J A;  4RGN A;  4K3B A;  1UZX B;  4RCO A;  4CHK A;  2KNB A;  4EZL A;  2JU6 X;  1Q10 A;  3NJT A;  2ZVN A;  3DBH B;  2C7H A;  2WXG A;  3L54 A;  2RDB C;  4ARI A;  4A20 A;  4M8M A;  2M0A A;  4K7W A;  4OVV A;  1JML A;  2WDV B;  3I5J C;  4WWP A;  1T5X D;  1HA5 A;  2ZPN A;  3IG3 A;  2QSD A;  2FUG 1;  3IT4 B;  3TEY A;  1L0Y B;  3LB8 C;  2HJ1 A;  2V3P A;  2WX1 A;  3QAR A;  4W9E A;  4YSX B;  4KX6 B;  5IO9 A;  3H7S A;  2INN E;  1JWB D;  2J0J A;  4P1C C;  2QCZ A;  5D7G A;  1KLU D;  3NG0 A;  3PRM B;  1H4R A;  1K53 A;  1L6U A;  4A6Q A;  2MP2 A;  5BYS A;  2IGD A;  2R2Q A;  4RF0 A;  3PRP B;  2WXH A;  1HZ6 A;  4II3 B;  3KYC D;  1NI2 A;  1X1M A;  4OZB A;  2LHE A;  1WX7 A;  2KD0 A;  3KQ4 A;  1WE7 A;  2N1W A;  2HJ8 A;  2K22 A;  4O1N A;  2ACZ B;  2L3Z A;  1SB3 C;  2L7R A;  4IWO A;  1T6B X;  1L6V A;  4MEM A;  1DOY A;  2JY6 A;  3EC8 A;  2JZP A;  3ABV B;  3LXF A;  2NS5 A;  3MHS D;  1WE6 A;  1DGJ A;  4KGR A;  2MWS B;  1HXY D;  3RNG C;  2BB5 A;  1Y8R C;  2XN9 C;  5E6O A;  2IZV B;  5CHF A;  2UYZ B;  1XEE A;  3AV8 A;  4LNO A;  2KWV B;  1I4X A;  2JPH A;  4YT0 B;  3ZUN A;  3AE8 B;  1QT9 A;  2Y5C A;  2LGD A;  4DDI D;  4IC7 B;  2E3T A;  2BB6 A;  3U30 A;  5C3J B;  3GE8 C;  3BYT B;  4PK1 A;  3ZNI D;  1WM2 A;  5TSS A;  4MJS B;  1LXD A;  4FN2 A;  3B2G A;  3A9J B;  2BQQ A;  4GMV A;  4NY0 A;  1OTR B;  4F1S A;  1ZOY B;  3H7P A;  3TSS A;  1T0Q C;  3GS2 A;  3Q69 A;  2IJ0 A;  1KOT A;  3EUB 2;  3NVY A;  2LUE A;  4HRS A;  5LXH A;  1WZ0 A;  4OHJ A;  4ZYS A;  4E74 A;  2QIE B;  5DCN A;  1KM7 A;  1F9J A;  1Q5W B;  2D11 A;  2XK5 A;  3VTW A;  1VZ8 A;  3Q8A A;  2KDM A;  1UNS A;  4TMA B;  1MHX A;  3TEZ A;  5AZF A;  3Q6B A;  2J7Q B;  1UD7 A;  3ECI A;  1CJE A;  3PT2 B;  2FIF A;  4IOI E;  3ZDM C;  4USA A;  4YL8 A;  3OJ3 A;  1TYG B;  2JUO A;  4FAD A;  2V9H A;  1K50 A;  5LNK 1;  4NZL B;  2ZEQ A;  5G55 A;  1T0S C;  2W54 A;  1SIJ A;  3ML9 A;  1V86 A;  1OQQ A;  4C56 C;  4DXG A;  2PJH A;  1WSP A;  2H88 B;  4KV2 A;  3M95 A;  2ON8 A;  1MG8 A;  3I63 C;  3DPD A;  4BOS C;  1ZDX A;  3ZO5 B;  3DOW A;  5G2N A;  2BKF A;  2ZJD A;  1RM6 C;  3I3T B;  4HRO A;  1GUA B;  2GB1 A;  4PS7 A;  5DPS A;  3DQV A;  2LGX A;  2WDR B;  2D07 B;  4P6V F;  3TEW A;  2YVC A;  2NPT B;  4NAW A;  2WGS A;  3WIM A;  3DBH I;  3ZJV A;  4ZRI A;  1WMH A;  2ICI A;  1AYF A;  2NCN A;  1GG3 A;  3T3O A;  1FMA D;  4C4V A;  1S3S G;  1V1P A;  2K1F A;  1YN4 A;  4P7I A;  1P7E A;  4G3X B;  3AE9 B;  2FCS A;  2OJR A;  1C3T A;  2IO1 B;  3AEG B;  3SFE B;  2CKH B;  2J52 A;  1XXG A;  2KJR A;  4ZYN A;  2LRW A;  3LJ3 A;  4WH4 A;  3W1S A;  3VHT C;  4KVG B;  3VTU A;  1XQQ A;  3MJ5 A;  1VJK A;  3JYU A;  2L1A A;  3E56 A;  1N5W A;  3PZ7 A;  1TKE A;  1K8R B;  4EKU A;  1WR6 E;  3M3J A;  2V3N A;  4HLE A;  3IAM 1;  2KDF B;  1F2R C;  2G4D B;  2BYV E;  2EEL A;  2V4L A;  2FE8 A;  1F77 A;  3DBL B;  5J18 A;  1OQR A;  3DHH C;  3PS6 A;  4N58 A;  2Q5W D;  2FCN A;  4AP4 C;  3R8B A;  5DPR A;  1ZXI A;  3AEF B;  2KC1 A;  2KX3 A;  1N6Z A;  2KAJ A;  2N1V A;  2BS4 B;  3AH7 A;  4G50 A;  2BYT A;  3ZJU A;  4EE2 A;  1KF6 B;  2L0F A;  1I42 A;  3QK0 A;  4LCD E;  2QMT A;  2N9E B;  3L0W B;  3FC4 A;  2K25 A;  3KW5 B;  2NVU I;  1SJH D;  1QKZ A;  2KFJ A;  2IY0 B;  1EM7 A;  1NDD A;  2LHD A;  3FAH A;  1Z2M A;  4JGH B;  1MVK A;  2LGI A;  1E8Y A;  2N4F A;  1K51 A;  4B0M A;  4ZDV A;  3DBS A;  5C2T B;  5IKC M;  4W9I A;  4LNI A;  1M94 A;  3DBR B;  4ZHP A;  4D2K A;  2M8S A;  3QCA A;  4IWP A;  4ARC A;  1PUT A;  3TUO A;  3ZYY X;  2J4X A;  4FJY A;  3RYT A;  2DNF A;  1UH6 A;  4XWW A;  3ENE A;  1WGH A;  1YJJ A;  1F2R I;  2I38 A;  3ZVV A;  1HTQ A;  3MJW A;  3CMM B;  3Q3O C;  3N1Y C;  3AEE B;  2DAJ A;  3R2I A;  4K81 A;  3RNF C;  1SIF A;  3DVN U;  1UWX A;  2UU7 A;  4NAM A;  2PMV A;  2JWZ A;  2B76 B;  3RNA C;  3RUL A;  2OED A;  1OEY A;  1ET9 A;  1T3Q A;  4MJS A;  2EMS A;  5G5G A;  3VQI A;  2J42 A;  4Q2J A;  3W2D A;  3BVM A;  5HG2 A;  3A9J A;  4N6E B;  1RRB A;  4HKZ E;  1FXT B;  3A33 B;  4WWN A;  3T9L A;  3HHM A;  4OW0 A;  4K1R B;  1KTK A;  4WJQ A;  4XC2 A;  3NZS A;  3C8Y A;  4J3O D;  1E8W A;  2AQ1 B;  4P16 A;  3PZ8 A;  1C77 A;  4S0R A;  1UF0 A;  1ZE3 D;  2RSU A;  5I4D A;  4WWO A;  2V1Y A;  4XZ4 A;  2D10 A;  1FFV A;  2BWE S;  3SFD B;  3RN9 C;  4RF1 A;  1GC6 A;  1YX5 B;  5GXG B;  5BMI A;  2WXN A;  2KLG A;  2KFK B;  1TS3 A;  1FO4 A;  1L0V B;  5IOI A;  3MFG A;  2WHI A;  4A8X C;  4BKS A;  2C60 A;  4DHZ B;  3N20 C;  5FKA C;  1P3Q U;  4K7S A;  3DVG X;  3PTF C;  1XF5 L;  2ONQ A;  3UF8 A;  4KZC A;  1JRU A;  4IUM B;  4PT5 A;  2DEN B;  3Q3M C;  3TIX A;  5EE9 A;  1V97 A;  2RD0 A;  2KOX A;  2X8X X;  2VZK D;  4HXD A;  1QZE A;  3WAN A;  2Z0E B;  4AWJ A;  2AL3 A;  2J0K A;  1L2N A;  1VRA B;  1ROE A;  2FCM A;  2WP9 B;  1RWS A;  4NJ6 A;  2AEH A;  1ACC A;  1FXI A;  3L08 A;  2I1K A;  3HVD A;  1SSN A;  4NQL B;  2RPQ A;  2JZ3 B;  2NPT A;  3N32 A;  1YNT E;  4KDL B;  1OGW A;  5L83 A;  3RFZ B;  1ZP0 B;  4KGS A;  3V61 A;  5D3I B;  5E6N A;  1TGZ B;  2HE7 A;  4TV3 A;  3IXS A;  4DK5 A;  1SE4 A;  1E0Z A;  1R4N B;  1C4P A;  1WGK A;  3Q8B A;  4K7U A;  2REX A;  4MGZ E;  3SU8 X;  4K3C A;  4WIP A;  1QF6 A;  2D5G A;  2GMI C;  1QOF A;  4IDI A;  3ZXR A;  4WJP A;  5IA7 A;  4KKI A;  5CTR C;  1V80 A;  1HZ5 A;  1YN5 A;  2MSE D;  4DDG D;  3C19 A;  2N9L A;  2Z0D B;  3TCA A;  2UWQ A;  1C79 A;  1C4A A;  1A70 A;  1TS5 A;  2ZZP B;  4BBN C;  2NBV B;  4ITK A;  3QA8 A;  3RNB C;  4YTN B;  1XT9 B;  3RUI B;  1YOV B;  4BFR A; 
#chains in the Genus database with same CATH homology
 4MJS B;  2DX5 B;  5FR6 A;  1LXD A;  3HIZ A;  1GJZ A;  4FN2 A;  3JW0 X;  2RGF A;  3A9J B;  3KH0 A;  4GMV A;  4NY0 A;  1OTR B;  4F1S A;  2K39 A;  2IO3 B;  3NZU A;  3K9P B;  4GU2 A;  4EFO A;  1WH3 A;  1WXV A;  3H7P A;  4GB9 A;  4HCP B;  4RMA A;  4NPN A;  2C5L C;  4BVU C;  4A3O A;  3BY4 B;  5DPW A;  2KTF A;  1LM8 B;  4HK2 A;  4J6I A;  2XBB C;  5CHW A;  1KOT A;  4GDK B;  1VD2 A;  1P9D U;  3QIJ A;  2LUE A;  3HM3 A;  3PV1 A;  3ZIM A;  5LXH A;  2MRP A;  3V6E B;  1WZ0 A;  5LXI B;  3OJ4 B;  3JSV B;  4BKS D;  4ZRK A;  2WYQ A;  4E74 A;  1XD3 B;  5JZE B;  2JRI B;  5DCN A;  1KM7 A;  1F9J A;  1Q5W B;  2D11 A;  2XK5 A;  3VTW A;  4EEW A;  3WAM A;  2W9N A;  2LI5 A;  3UQA A;  2MBE A;  2JRH A;  3DBR I;  5AZF A;  2MBQ A;  2AYO B;  2J7Q B;  1UD7 A;  4OVU A;  3A1Q B;  3ECI A;  1WR1 A;  3L17 A;  3PT2 B;  2FIF A;  3CST A;  2LGY A;  2KQS A;  3DCG A;  3ZDM C;  2KMA A;  1J8C A;  2DYO A;  1BT0 A;  4FHJ A;  1S1Q B;  4YL8 A;  4FLH A;  2DYM A;  3KUZ A;  2M4N A;  3OJ3 A;  3PRE A;  4F7Z A;  1TTN A;  2JUO A;  5JHA A;  4FAD A;  1V2Y A;  1WJ4 A;  4PS3 A;  4CO7 A;  4HJK A;  2G4S A;  2XK5 B;  2LVQ A;  2KC2 A;  5IAA C;  3TBL D;  4TQ0 A;  2BF8 B;  2ZEQ A;  3K9O B;  2L00 B;  4HDQ A;  3QQ8 B;  3CSF A;  3N30 A;  5G55 A;  5AZG A;  3H9D A;  1WGR A;  2KTR B;  3ML9 A;  1V86 A;  3QJZ A;  5JH5 C;  1D3Z A;  2PJH A;  3ZRC A;  2KO3 A;  4KDI C;  1WRD B;  4HVB A;  2B3A A;  4GDL A;  4KV2 A;  4PYZ A;  4RM8 A;  1WGG A;  2R2O A;  3M95 A;  4ZRJ A;  4B95 A;  4PS8 A;  1MG8 A;  2MP2 B;  2LZ6 A;  3PRZ A;  3DPD A;  1IP9 A;  4W9H A;  4BOS C;  3ZO5 B;  4AOF A;  2GBK A;  1H8C A;  1UGM A;  4EUT A;  5JHB A;  3DOW A;  3VUW A;  4JL9 A;  5G2N A;  2BKF A;  2ZJD A;  1E7V A;  2IYD B;  2BGF A;  3I3T B;  1KLV A;  2GBJ A;  4GGQ A;  1GUA B;  1RAX A;  4PS7 A;  3N3K B;  2O6V D;  5DPS A;  3PGE A;  3DQV A;  2LGX A;  3R3M A;  2D07 B;  4ANU A;  4WAA A;  1WM3 A;  2YVC A;  2NPT B;  2DHZ A;  2KQ7 A;  3ONS A;  4LDT D;  2L76 A;  4TQ1 A;  3VH4 B;  4FJZ A;  4GN1 A;  2I1J A;  4N9F 4;  4ANV A;  4NAW A;  3PPA A;  3H1U A;  1T0Y A;  4FUL A;  2KN5 A;  2KAN A;  1YD8 U;  3RZF A;  3V60 A;  3WIM A;  3DBH I;  3KUC B;  5J2R A;  4ZRI A;  1WMH A;  3O65 B;  2JF5 A;  3DBL I;  2ZNV C;  2NCN A;  1GG3 A;  1IPG A;  1TZ1 A;  1S3S G;  2K1F A;  5KHO A;  1V5T A;  3GZN I;  4DHJ D;  5E6P A;  2N7D A;  5CX3 A;  2O6V B;  5C1Z A;  2EKE C;  3KVF B;  4I6P A;  4P7I A;  3DVG Y;  4EZJ A;  4G3X B;  2PEA A;  2KDI A;  2N9P C;  3NS8 A;  2FCS A;  2OJR A;  4G11 A;  5C23 A;  1C3T A;  2IO1 B;  2ZVO A;  4AUQ C;  1WX8 A;  4URK A;  2BKR B;  2CKH B;  2JZZ A;  2KJR A;  4ZYN A;  3MTN B;  2A4Z A;  2LRW A;  2M17 A;  3LJ3 A;  3HM6 X;  4MM3 A;  3ZNG C;  3W1S A;  4GIV A;  3D32 A;  3VHT C;  1V6E A;  4KVG B;  3VTU A;  1YIW A;  1UBQ A;  1XQQ A;  2IO0 B;  4FA6 A;  3A9K B;  3JYU A;  3NHE B;  2JVC A;  4DHJ B;  2KZR A;  4G0N B;  4AJY B;  5TR5 A;  3QWZ B;  1Q0W B;  2G45 B;  2K6Q A;  3LDZ E;  3ZNH B;  1K8R B;  1NBF C;  4EKU A;  4B9K A;  1WR6 E;  3M3J A;  4JIO U;  5CHV C;  2KFK A;  5LLI A;  4HLE A;  3Q3F A;  2KDF B;  1KJT A;  2G4D B;  2BYV E;  1YJ1 A;  3EHV A;  2V4L A;  1E8X A;  1RFA A;  1EF1 A;  2L0T A;  3PSE B;  3QAQ A;  5J18 A;  3VH3 B;  4A3P A;  3SDL C;  3UIO B;  3V62 A;  3X23 A;  4BOZ B;  3PS6 A;  1I35 A;  4W9G A;  1AAR A;  3KYD D;  2QHO A;  1WXS A;  4XX5 A;  3RCZ A;  3PHW B;  3ZLZ A;  1WJU A;  2FCN A;  2WDT B;  2PPH A;  3R7Q A;  4AP4 C;  1P1A A;  3BIN A;  2N7E A;  1YQB A;  1WI0 A;  4ICU A;  2KWU B;  4MSQ B;  1WXA A;  5DPR A;  4HDO A;  3TJP A;  2KC1 A;  1WJ6 A;  1EO6 A;  2HTH A;  3H7P B;  2KX3 A;  1G6J A;  1ZW7 A;  2KLC A;  4ANX A;  1A5R A;  2GBN A;  2N1V A;  2CR5 A;  1EF5 A;  4LJP B;  4JLC A;  2KK8 A;  1CMX B;  4G50 A;  4GOC A;  2WX0 A;  3RT3 B;  3TMP B;  1U4A A;  2XEW A;  2L0F A;  1I42 A;  3QK0 A;  4LCD E;  2CU1 A;  3PZD A;  2N9E B;  4TUU A;  2NR2 A;  3L0W B;  4DHZ E;  4DXA B;  3HK0 A;  2CS4 A;  3VVW B;  2L8J A;  2NBW B;  2K25 A;  3KW5 B;  2BYF A;  2NVU I;  3ZW3 A;  2IY1 B;  2CHW A;  3APD A;  3JVZ X;  2KFJ A;  4F8C B;  1E8Z A;  1WGD A;  2IY0 B;  1IYF A;  2ASQ A;  3AUL A;  4IW0 A;  1NDD A;  1Z2M A;  2L05 A;  4JGH B;  4IG7 B;  3EEC A;  3AU4 A;  3QX1 A;  1HE8 A;  3DVN V;  3X0W A;  2DZJ A;  4I6L B;  2DZK A;  4CYE A;  2C7N B;  1E8Y A;  2N4F A;  3B08 A;  2O2V A;  5L95 C;  4ZDV A;  3UQB A;  3DBS A;  2KJH B;  2ZCC A;  3SHQ A;  4KSK C;  2M1M A;  4WJN A;  4W9I A;  3WA0 A;  4W9J A;  2AL6 A;  1OEY J;  3PLU A;  1M94 A;  4II2 B;  4RM9 A;  5DPT A;  1E90 A;  2M8S A;  3QCA A;  4IM3 A;  4MGI E;  1GNU A;  4W9C A;  4IWP A;  3VFK A;  3IFW B;  2FID A;  3PHX B;  2FCQ A;  2K8C A;  3ZRF A;  4ANW A;  3PVL A;  4MGK E;  1YX6 B;  4GDL B;  2KX0 A;  4FJY A;  4M8N A;  4BBN F;  2FAZ A;  3RYT A;  4E71 A;  2MCN B;  2HD5 B;  2KJ6 A;  3OLM D;  1E7U A;  1LFD A;  3R66 C;  3WAP A;  1UH6 A;  3M63 B;  3CF6 E;  1WJN A;  1Z5S B;  1C1Y B;  1WGH A;  3ALB A;  3ENE A;  5GMV A;  5AEK B;  2KMC A;  3ZVV A;  2YLM A;  3R7R A;  3A4R A;  3MJW A;  3CMM B;  4KIK A;  3GOE A;  3H6N A;  4PYU A;  3RD2 A;  3TL5 A;  4DWF A;  4EZK A;  3ZTC A;  2DAJ A;  2K8H A;  1RLF A;  3Q3J A;  1EUV B;  4M0W B;  4K81 A;  1SIF A;  3DVN U;  4IM0 A;  2MBH A;  2IBI B;  2CHZ A;  2KKC A;  3B0A A;  4KSL C;  2JXX A;  2JWZ A;  5D94 A;  2MX2 A;  4HPM B;  2LWP A;  2DZM A;  4NAW B;  2V3S A;  3RUL A;  3VUY A;  2KVR A;  2OOB B;  4JQW C;  1OEY A;  2LD9 A;  2AWT A;  1L7Y A;  3VDZ A;  1P0R A;  2KDB A;  2J0M A;  4ICV A;  1WMH B;  2MW5 A;  4MJS A;  3T8M A;  4X57 B;  2EMS A;  2ZPY A;  4KIK B;  2MBB B;  3VQI A;  5BO4 B;  3VAW A;  3A9J A;  3QC8 B;  4I6N B;  2PE9 A;  2LVP A;  3ZTD A;  1RRB A;  1WZ3 A;  2Z59 B;  4W9F A;  1FXT B;  4MEL A;  1ZKH A;  1WYW B;  1WX9 A;  3A33 B;  4WWN A;  2RR9 A;  3APF A;  3T9L A;  4KZ0 A;  3HHM A;  4WQO B;  2MQJ A;  3S2A A;  4K1R B;  1UZX B;  2BPS A;  4WJQ A;  4GDK A;  4XC2 A;  3P2B A;  4CHK A;  4IM2 A;  2KNB A;  3APC A;  3V6C B;  3NZS A;  4EZL A;  2ZVN A;  3JSV A;  2MA9 B;  1E8W A;  3U8Z A;  2C7H A;  1ISN A;  2K8B A;  2N9X A;  5D6J B;  3L54 A;  3SD5 A;  2D3G A;  2RSU A;  4A20 A;  4WWO A;  4M8M A;  4FBJ B;  2K6D B;  2V1Y A;  4XZ4 A;  2D10 A;  4K7W A;  4OVV A;  2BWE S;  3ML8 A;  1J19 A;  4W9L A;  2MBO A;  4WJO A;  2IO2 B;  1GC6 A;  4GXB A;  1YX5 B;  4WWP A;  2ZPN A;  3A1Q A;  1WXM A;  3IG3 A;  1E5W A;  3B1L X;  3EFU A;  4LJO B;  2KLG A;  2KFK B;  5AZH A;  3W1S C;  2MLB A;  2D2Q A;  4BKS A;  3L10 B;  2WX1 A;  2C60 A;  3QAR A;  4DHZ B;  4W9E A;  3DDC B;  3L13 A;  3WAO A;  3H7S A;  2FNJ B;  1P3Q U;  2J0J A;  4K7S A;  3DVG X;  2VRR B;  3PTF C;  5D7G A;  3UIP B;  1R4N I;  3UF8 A;  2LXC A;  4HPL B;  3PRM B;  4KZC A;  1JRU A;  1H4R A;  4IUM B;  3UGB B;  4GSW A;  2DEN B;  4E3C A;  4W9D A;  2KTR A;  3OAW A;  3TIX A;  2RD0 A;  3IHP C;  3C0R B;  2C9W B;  2KOX A;  4HXD A;  3VUX A;  3IVF A;  1QZE A;  3WAN A;  3VTV A;  1WF9 A;  4BKG A;  4W9K A;  4MGY E;  2Z0E B;  3ZKJ C;  2AL3 A;  2J0K A;  4TKN A;  4ASW C;  2MP2 A;  3NY5 A;  3PLV A;  4AWJ A;  2M0X A;  1L2N A;  3AXC A;  2R2Q A;  1TBE A;  4IWQ A;  5D2M B;  2FCM A;  3PRP B;  1V49 A;  4HCN B;  1UEL A;  4BKT A;  4NJ6 A;  2GBM A;  4II3 B;  2AEH A;  3KYC D;  1SGH A;  2I1K A;  1NI2 A;  1X1M A;  3L08 A;  3L16 A;  3QHT A;  3U7D A;  3ZNZ B;  4NQL B;  1WX7 A;  2KD0 A;  1WE7 A;  2GOW A;  2N1W A;  2HJ8 A;  2RPQ A;  2JZ3 B;  2BYE A;  2NPT A;  2KHW B;  3N32 A;  4KDL B;  1OGW A;  3IBE A;  2JT4 B;  5L83 A;  4DBG A;  3UIN B;  1OQY A;  2L3Z A;  2LVO A;  5J17 A;  2KWC A;  3V61 A;  2LAS A;  1WFY A;  5E6N A;  2FUH B;  4AJW A;  1TGZ B;  2LJ5 A;  2HE7 A;  2O2V B;  2L7R A;  3ZDT A;  4TV3 A;  4DK5 A;  1V9J A;  2EMT A;  1LQB A;  5EDS A;  4IWO A;  2KDE B;  1V81 A;  1GC7 A;  1V5O A;  1WIA A;  2REX A;  4K7U A;  4MGZ E;  1ZGU B;  2PE6 B;  3SU8 X;  4MDK E;  1WGY A;  4HWI B;  4MEM A;  2O6V A;  1WY8 A;  2ZNV B;  2ZCB A;  2JY6 A;  2Y5B B;  2BWF A;  2KXJ A;  3EC8 A;  4FHK A;  2LXA A;  2GMI C;  2NS5 A;  2WWZ A;  3W1Y A;  3MHS D;  1WE6 A;  1R4M I;  3KUD B;  2NBU A;  4WJP A;  2MWS B;  3M62 B;  1SE9 A;  5IA7 A;  2DAF A;  2CHX A;  3A4S C;  5CTR C;  3VXW A;  5HKH A;  1P98 A;  1V80 A;  1Y8R C;  4FJV B;  2MSE D;  4DDG D;  5E6O A;  1VCB A;  2IZV B;  5CHF A;  3AU5 A;  4B6W A;  2Z0D B;  2UYZ B;  3A9K A;  2G3Q B;  2GBR A;  3TCA A;  3RZW C;  2UWQ A;  2KWV B;  3NOB A;  2JPH A;  4NNJ B;  4NQK E;  4NJ7 A;  3AI5 A;  2C7M B;  3ZUN A;  4MSM B;  4LDT B;  4MH0 E;  2ZZP B;  1PQS A;  4BBN C;  2NBV B;  2DYB A;  1Q1O A;  3QA8 A;  2LGD A;  2DZI A;  4DDI D;  1XT9 B;  4IC7 B;  3RUI B;  1UBI A;  3U30 A;  5KHQ A;  3WAL A;  2A5U A;  4EOY A;  2LRU A;  3ZNI D;  4BFR A;  1J0G A;  1WM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...