1WMHA

Crystal structure of a pb1 domain complex of protein kinase c iota and par6 alpha
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
83
structure length
83
Chain Sequence
QVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle
molecule keywords Protein kinase C, iota type
publication title Structure of a Cell Polarity Regulator, a Complex between Atypical PKC and Par6 PB1 Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 83
sequence length 83
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wmhA00
1Z5SB 1UBQA 4EUTA 1VCBA 1OEYJ 2IO1B 3OJ3A 2ZJDA 3QJZA 4FJVB 2WX1A 1WM2A 2K8HA 4GIVA 3TL5A 3UQBA 2LGYA 1ZKHA 5IAAC 3I3TB 4EZLA 5CHFA 1VD2A 2DYBA 1GUAB 5GMVA 1V81A 2KOXA 4NJ7A 2ZVOA 4IM3A 2DZJA 5CTRC 2JPHA 2ZPNA 2BF8B 1SIFA 1UD7A 3RULA 2JRHA 2XBBC 3GOEA 5TR5A 1P3QU 2FCQA 3TBLD 3KYCD 3L13A 4WAAA 1ISNA 1D3ZA 3D32A 4RM8A 2N4FA 3RD2A 3AU5A 1GG3A 2AYOB 2L8JA 1TGZB 4HVBA 4WWNA 2KDEB 1JRUA 4BKTA 2BGFA 2ZCCA 1V5TA 2D3GA 1X1MA 1E8XA 1P0RA 2D11A 4W9DA 4FN2A 2FCNA 2NPTB 4OVUA 2K39A 1S1QB 4LJPB 3H6NA 1FXTB 2NPTA 2W9NA 3L08A 2KWCA 3QHTA 4KZCA 3SHQA 3VH4B 3VQIA 4CO7A 1WX9A 2R2OA 3ML8A 3CSFA 2LGXA 5L95C 2DHZA 4DBGA 2YLMA 2LZ6A 1WYWB 3Q3FA 4KSLC 2IO2B 4KV2A 5CHVC 4HPMB 4ZRKA 4GXBA 2N9XA 4NJ6A 3VAWA 3ZTCA 4WJOA 1WXAA 2V1YA 3H7PA 2KJRA 3W1SC 1WR6E 5J18A 2R2QA 3WIMA 4EOYA 3ZUNA 4IG7B 4NQKE 2GBRA 3HK0A 4NNJB 4NY0A 4B9KA 2MBHA 2BPSA 3DVGX 3L0WB 2C7HA 3V61A 2BYVE 4XC2A 1WMHB 2LD9A 5LLIA 1WZ0A 4W9JA 1WMHA 3DPDA 5CX3A 4MH0E 1J0GA 3EECA 2DAJA 4ICVA 3V60A 3GZNI 2GOWA 2IY0B 3SD5A 3N3KB 4LDTB 3AXCA 3NZSA 4EKUA 3KYDD 3U30A 2L00B 2L3ZA 3V6CB 5D7GA 2KLCA 4MJSB 2MBBB 2KD0A 4MDKE 2C7NB 4MEMA 1TTNA 3DBLI 3NHEB 4KVGB 3VFKA 3EFUA 4MJSA 4FA6A 1V5OA 2L76A 3ALBA 1A5RA 3QC8B 4FADA 4AP4C 2AEHA 4B95A 4A3PA 2MA9B 3DVGY 2JWZA 3ENEA 2ZEQA 3ZO5B 1GNUA 2N1VA 3ZIMA 1WFYA 2LUEA 2Z0DB 3IBEA 1KOTA 4GDKB 3LJ3A 1WXMA 2I1KA 3RT3B 3OLMD 3HHMA 3R66C 4G11A 4GDKA 4JL9A 2MLBA 3VUXA 1WE7A 3O65B 5L83A 5DPWA 4BBNF 2G45B 3DOWA 4RM9A 2QHOA 2PE9A 3UQAA 1P9DU 4MGKE 4JGHB 4FLHA 2YVCA 3CMMB 2K6DB 2IO3B 2LXAA 2KMCA 1EF1A 3UGBB 2JVCA 1WR1A 1UGMA 3A1QB 4DHJD 4OVVA 3TJPA 1UBIA 2MWSB 3DVNV 2A4ZA 4HCNB 1WJ4A 3A1QA 3RZFA 3VVWB 2O2VB 2OJRA 2ZPYA 2FIFA 2KN5A 4GOCA 4BKGA 3Q3JA 2JY6A 1I35A 2O2VA 2WDTB 1OQYA 4HPLB 2XEWA 2LWPA 1H8CA 2RD0A 2WWZA 4BVUC 1P98A 4KDIC 2NBVB 2HD5B 2C7MB 1WH3A 3KUZA 3BINA 3HM3A 4RMAA 3V62A 1NBFC 2FAZA 2BYEA 2RR9A 3BY4B 1E8WA 3PRZA 3PREA 2FNJB 5DCNA 3APCA 2KQ7A 4DK5A 5JHBA 3W1SA 3A9KB 3R7RA 3ZNGC 3PRMB 2L0TA 2MRPA 3A9KA 3MTNB 4HDOA 4FHKA 3QARA 4HDQA 3PVLA 4GGQA 4DHJB 4M8NA 1E8ZA 3ML9A 4GDLB 3A4RA 3PHXB 3KVFB 1YIWA 2NCNA 4GDLA 5AZHA 2KJ6A 3WAOA 3TCAA 4G0NB 4DDID 2N7DA 4MSMB 2AL6A 3SDLC 3RCZA 5D6JB 5LXHA 1R4NI 3M62B 3ZRCA 1MG8A 5J2RA 2DYOA 4GSWA 2MBQA 4K7SA 4TUUA 1WGGA 1LFDA 3A33B 2K6QA 1KLVA 1IP9A 2C60A 4DHZB 4AOFA 2K1FA 3CF6E 2V3SA 3QAQA 3HM6X 3UIOB 1T0YA 2KZRA 3M3JA 4URKA 3DQVA 2LRWA 3KH0A 1WJ6A 4LCDE 4W9LA 3H7SA 4WWOA 5IA7A 3NY5A 1WGYA 2MP2B 4W9CA 4MSQB 4LDTD 3ZNHB 2MP2A 2LRUA 2KC2A 2ZZPB 3OAWA 1RRBA 3QWZB 4LJOB 2JF5A 4IUMB 3VDZA 4F1SA 5E6OA 2JRIB 2KMAA 2ZCBA 2AL3A 1ZW7A 2XK5B 3C0RB 5E6NA 1TBEA 5JZEB 1WM3A 2L05A 4F7ZA 1UZXB 2DX5B 2XK5A 2CHWA 3QCAA 4W9IA 5DPRA 4IW0A 3U8ZA 4NAWB 2KWUB 2PJHA 2B3AA 4NAWA 3L16A 2Z59B 4IM0A 2C9WB 3T8MA 1WJUA 3ZRFA 4E71A 5DPTA 4ASWC 1E90A 2ASQA 1IPGA 2LXCA 3K9OB 4IWOA 4KSKC 2IBIB 4TQ1A 1GJZA 2KNBA 4EZKA 4A20A 2G4SA 3ZVVA 1WGHA 3AULA 1Q1OA 2CR5A 5D94A 1YD8U 2RPQA 3QA8A 3PS6A 3A9JB 4K7UA 2IY1B 3DCGA 1WGRA 3A9JA 4NQLB 2LASA 3IVFA 2JT4B 3MHSD 4K81A 4WJNA 5KHQA 3NS8A 3M63B 1YJ1A 3AU4A 4AJWA 3EHVA 2D10A 2KXJA 2MBEA 1E7UA 1QZEA 4FHJA 4XZ4A 2UWQA 5FR6A 4GN1A 4ICUA 1WX8A 2WYQA 2A5UA 3ZKJC 5KHOA 1V49A 2IO0B 1YX5B 4W9HA 3RUIB 1WGDA 3PLUA 3L10B 2GBNA 1E5WA 3QX1A 3X23A 5HKHA 3DVNU 2CKHB 1SE9A 1V80A 4K7WA 2DENB 3B1LX 3HIZA 3X0WA 3VTVA 2JXXA 2BKRB 2MCNB 5LXIB 4TV3A 4E74A 4ZDVA 3DBRI 1L7YA 4BOSC 2D07B 2J7QB 2KQSA 4MELA 3KUDB 2KJHB 4NPNA 3PT2B 2NBWB 5G55A 1WI0A 2CHZA 2L7RA 2KVRA 1I42A 2RGFA 4JLCA 4WWPA 4BOZB 1J8CA 2EMTA 2M17A 3ZLZA 1LXDA 1NI2A 4KIKB 3ZW3A 4DDGD 3N32A 4GB9A 1OGWA 3PPAA 4TKNA 1V6EA 4KIKA 4CYEA 2Y5BB 4MM3A 1KM7A 2KLGA 2KTFA 4GU2A 4ZYNA 1WIAA 2JUOA 3PZDA 3KUCB 2DZIA 2KWVB 3KW5B 1GC6A 1H4RA 1TZ1A 2LI5A 2DZMA 4W9EA 2REXA 3NOBA 4CHKA 2MQJA 1V86A 1WXVA 1Y8RC 1EF5A 2OOBB 3S2AA 4DHZE 2VRRB 3ZDTA 2N9EB 1XT9B 3QK0A 1LQBA 1YQBA 4KZ0A 4MGZE 3R7QA 2N9PC 4G50A 2NR2A 2I1JA 3APDA 4EZJA 2D2QA 2GBMA 2IZVB 5G2NA 1WE6A 1WRDB 2CS4A 1RLFA 2FCMA 4FULA 3W1YA 3WAPA 2KK8A 5C1ZA 2N1WA 2WX0A 5DPSA 3VXWA 2MW5A 2KC1A 3PLVA 2FCSA 1G6JA 2KX0A 4E3CA 1AARA 4J6IA 1OTRB 5D2MB 1PQSA 4AUQC 3LDZE 4MGIE 3WAMA 4W9GA 1IYFA 3VUWA 1WZ3A 1Q5WB 4ANXA 4JIOU 3JW0X 3K9PB 2FIDA 3R3MA 2KHWB 4WJPA 1OEYA 4HJKA 4BFRA 1SGHA 5AEKB 3ECIA 2L0FA 1Z2MA 2BWES 3N30A 2PPHA 1WXSA 1EUVB 3PSEB 5JH5C 3VTUA 1E7VA 4G3XB 2AWTA 4M0WB 1K8RB 2G4DB 1UELA 2K8CA 1C3TA 2Z0EB 3MJWA 4W9KA 4ZRIA 5C23A 2KKCA 2ZVNA 3ZTDA 3RYTA 3CSTA 4AJYB 1YX6B 4I6LB 3OJ4B 4FJZA 4BKSD 4PS3A 1HE8A 1KJTA 2ZNVC 1WY8A 3IHPC 4BBNC 2BYFA 2CU1A 4GMVA 3SU8X 2NBUA 4EFOA 1BT0A 3H7PB 2MBOA 4P7IA 3B08A 4DWFA 2V4LA 4WJQA 1R4MI 2BKFA 2KDBA 3L54A 4FJYA 3PV1A 3WA0A 4IM2A 2DAFA 2KFKB 3EC8A 4I6PA 4II2B 4PS8A 4IWQA 2KX3A 3APFA 2KFKA 3ZNZB 2FUHB 2M1MA 2M4NA 2J0JA 2KDIA 3QQ8B 4YL8A 1EO6A 2GMIC 4II3B 3DBSA 1V2YA 2BWFA 3T9LA 2J0MA 1WX7A 3P2BA 2DYMA 4IC7B 2C5LC 2J0KA 3UF8A 3WANA 1RFAA 4BKSA 1U4AA 3AI5A 1WF9A 2PEAA 3IFWB 5E6PA 1M94A 3JYUA 4KDLB 4M8MA 4B6WA 2EMSA 5JHAA 4HLEA 2GBKA 3DBHI 1E8YA 1XQQA 1NDDA 1XD3B 4EEWA 3PHWB 4ZRJA 2NS5A 5EDSA 4HXDA 2LGDA 3B0AA 2JZZA 3ZNID 4TQ0A 3PTFC 1WJNA 4ANVA 2KFJA 1F9JA 1GC7A 3A4SC 1UH6A 2M8SA 1S3SG 1P1AA 4K1RB 4I6NB 4AWJA 3JSVB 4HWIB 3VTWA 5J17A 4FBJB 2K25A 4ANWA 4F8CB 2K8BA 3H9DA 3V6EB 3WALA 3JSVA 3QIJA 2PE6B 4HCPB 3L17A 4JQWC 3VUYA 2O6VD 2UYZB 2KTRB 2G3QB 2LJ5A 2HE7A 2LVQA 3IG3A 1CMXB 3ONSA 5AZGA 2KO3A 3TMPB 3UINB 4ANUA 2HJ8A 2KTRA 4MGYE 3TIXA 4DXAB 3RZWC 4X57B 1RAXA 1ZGUB 4PYZA 3ZDMC 2RSUA 1L2NA 1C1YB 2KANA 3UIPB 2HTHA 2MX2A 2N7EA 3PGEA 3VHTC 5BO4B 1LM8B 2KDFB 3VH3B 1Q0WB 3NZUA 4N9F4 2CHXA 2ZNVB 3DDCB 5CHWA 4W9FA 2LVOA 2EKEC 3H1UA 3JVZX 4A3OA 4HK2A 2DZKA 2MSED 2LVPA 4WQOB 1J19A 3PRPB 4IWPA 2M0XA 4PYUA 5AZFA 3U7DA 4PS7A 3M95A 2NVUI 2O6VB 4XX5A 2JZ3B 2GBJA 2IYDB 2O6VA 1V9JA
chains in the Genus database with same CATH superfamily
1Z5SB 4EUTA 3QJZA 2WX1A 1WM2A 2K8HA 5EE0A 2LGYA 5IAAC 1AN8A 2ZVOA 2VH1A 4IM3A 2BF8B 1SIFA 1UD7A 2JRHA 3IXSA 2D5GA 2N4FA 3AE4B 3AU5A 3RNCC 2LEKA 1JRUA 4PK1A 1YQ4B 2ZCCA 1V5TA 2D3GA 1P0RA 2NPTB 2K39A 1S1QB 4LJPB 2QJLA 2QDFA 2R2OA 3ML8A 1SXTA 5BMHA 2J4XA 3RFZB 4DBGA 2LZ6A 4KV2A 4ZRKA 1ESFA 1UWMA 1WXAA 3H7PA 4WJOA 1C78A 1WR6E 4L2YA 1JCKB 2QILA 2DLBA 2UU7A 4IG7B 3HVZA 3L0WB 2C7HA 4XC2A 2K5PA 4W9JA 3EECA 4ICVA 2V0GA 2MJ3A 1CJEA 2BBCA 3KYDD 3U7ZA 3V6CB 3GE8C 2V3PA 2MBBB 2C7NB 4MEMA 3VFKA 3RPFC 3DBHB 2MA9B 2WXJA 2JWZA 1JMLA 2LUEA 3IBEA 1KOTA 1TY0A 1WXMA 3RT3B 3PZ7A 3VUXA 1M4VA 4XE0A 2IPKD 4A55A 2J42A 1TS2A 2WXGA 3MFGA 1WR1A 3A1QB 4PT5A 4DHJD 5FK9C 1UBIA 1EU4A 2A4ZA 4HCNB 3RZFA 2OJRA 2J53A 4GOCA 2O2VA 5G5HA 4BVUC 2RDGA 2HD5B 1WH3A 3KUZA 1MPEA 4RMAA 2BS4B 3ZJVA 4K3CA 3APCA 2KQ7A 5D3IB 4DK5A 3W1SA 3ZNGC 2WDVB 4TMAB 2MRPA 3BYYB 1K53A 1E8ZA 3PHXB 3KQ4A 5AZHA 3DHGC 3TCAA 1ZDXA 3RNAC 3RCZA 2M19A 5LXHA 2DYOA 4K7SA 2LJIA 3ZGZA 4KGRA 1I4GA 2C60A 1ROEA 3HM6X 1T0YA 2L1AA 2RPVA 4URKA 2LMCA 3EGRA 3CIRB 4WWOA 2H89B 3NY5A 1FNUA 4LDTD 3Q2AC 3ZNHB 2LRUA 2KC2A 1JWAD 3QWZB 3GP7A 4OVZA 4F1SA 2KMAA 5E6NA 3ZYYX 1TBEA 5JZEB 1WM3A 4F7ZA 2XK5A 1IUEA 2YEPB 1DOIA 2KMMA 2D3CA 3U8ZA 4NAWA 4IM0A 5DPTA 1MHHE 1PUTA 1IPGA 4IWOA 4KSKC 1GPXA 3TEZA 1DYQA 1WGHA 5D94A 1YD8U 4RF0A 2RPQA 1F77A 3LYYA 2JU6X 4HPPA 2IY1B 2OEDA 1FRDA 3A9JA 1JWMD 4NQLB 1V1OA 1EM7A 4AJWA 4RNAA 1QZEA 3TEWA 5FR6A 1FO4A 4XDDA 4ICUA 4GLSC 3ZKJC 2EELA 1T0SC 1OQQA 1HTQA 4WIPA 3ZJTA 2GBNA 1J7BA 5TSSA 3X23A 4FXCA 1SE9A 5EE3A 1V80A 4K7WA 2WDRB 3HIZA 3X0WA 3AE2B 1FXAA 2D07B 2WLBA 3R8BA 2H88B 2EMTA 3ZLZA 1LXDA 2GRIA 3PPAA 1STEA 4S0RA 1V6EA 4CYEA 2KTFA 2W55A 4US9A 1WIAA 1XCQL 2JUOA 3PZDA 4RGOS 2DZIA 4OZBA 1PDXA 1T0RC 2DZMA 4W9EA 2REXA 1JWUD 2SEBD 4DHZE 1I4XA 3TSSA 2N9EB 3B2GA 1N60A 4G50A 3BVZA 2I1JA 2D2QA 2GI9A 1WRDB 2AQ1B 4FULA 2KK8A 5C1ZA 5IOIA 5HHDG 2FCSA 3Q8EA 1R4NB 4MACA 3FKYA 2KT7A 2KVZA 4Q2JA 3LDZE 3SR6A 3DHHC 1AWDA 2V4IB 3MJ5A 4ANXA 2BS3B 1XLQA 3R3MA 2PLPA 2L0FA 2BWES 1WXSA 5JH5C 1E7VA 1K8RB 3DWGC 1CQVA 4ZRIA 5C23A 3ZTDA 3V05A 3RNGC 3OJ4B 3EFCA 4PS3A 1SJED 4GMVA 1N6ZA 4A8XC 1BT0A 3VR9B 3AEDB 2V4LA 3AEFB 4FJYA 3PV1A 3WA0A 4USAA 2KX3A 3APFA 1C4PA 3EUB2 1EO6A 4II3B 4S17A 3RI7C 4YSZB 1HTOA 2MJEA 4IC7B 2C5LC 1RFAA 1U4AA 3AI5A 1WF9A 1GAQB 4WH4A 4M8MA 2EMSA 1E9MA 2CJNA 2JYTA 3HRDD 4ZRJA 2HJ1A 2LGDA 1YQ3B 3B0AA 4TQ0A 1I4RA 1F9JA 3A4SC 1S3SG 4K1RB 5J17A 3GB1A 1QOAA 3WALA 4RGTA 1FCCC 4LNIA 2KTRB 4ANVA 5AZGA 1CMXB 2IJ0A 4DXAB 4X57B 3ZDMC 2RSUA 4B0EA 2KANA 2HTHA 4OZCA 3ABVB 1LM8B 3MHZA 1Q0WB 3JVZX 5IP4D 3U7DA 1C9FA 3AE3B 2O6VB 4M00A 4XX5A 2JZ3B 1MG4A 1QLBB 1VCBA 1OEYJ 1GB1A 2ZJDA 3AEEB 3TL5A 3UQBA 4UDUC 1JWSD 2WS3B 1V81A 2J52A 1HEZE 3I5JC 1P7EA 2JPHA 2ONQA 2ZPNA 2XBBC 3GOEA 1P3QU 3TBLD 3KYCD 4ITKA 1ISNA 2INCC 1ZOYB 4WWNA 4IKGA 2MJDA 4W9DA 3W5VB 4FN2A 2FCNA 3H6NA 1AW7A 3QHTA 4XDCA 3SHQA 4KZCA 4CO7A 3VH4B 1WX9A 5EE9A 2KDMA 2LGXA 3AE1B 1WYWB 3Q3FA 3VAWA 2IO2B 5CHVC 3ZTCA 4GXBA 5J18A 2PIAA 3WIMA 3ZXRA 4EOYA 3ZUNA 4NQKE 4NY0A 4B9KA 2HDEA 2BYVE 2LD9A 5LLIA 1HZ6A 3BVMA 1T3QA 5CX3A 1J0GA 3GS2A 1NI3A 2GOWA 1GOZA 5IO9A 3SD5A 4LDTB 1N63A 3NZSA 4EKUA 5BMIA 2L00B 2MH7A 4ZRPA 3DBLI 4KVGB 5HFYA 3EFUA 4MJSA 1A5RA 4EE2A 3EA6A 2N1VA 3ZIMA 2Z0DB 2I1KA 3OLMD 4RFBA 4JL9A 4GDKA 2MLBA 1TKEA 5GXGB 2W82A 2PE9A 2K6DB 3UGBB 5FKAC 1UGMA 3TJPA 2MWSB 3DVNV 1R7SA 2O2VB 3FC4A 4BAXA 1Q10A 2WDTB 1OQYA 1VDVA 3TEXA 4HPLB 2XEWA 2LWPA 2RD0A 2KAJA 2N0SB 2L32A 2NBVB 1FNVA 3V3XA 3HM3A 4RH6A 1NBFC 1EU3A 3BY4B 1E8WA 1TY2A 4KX6B 4AS1A 3PRMB 2JXTA 1ACCA 4HEA1 1PFDA 4HDQA 1DGJA 1TT5B 2PVGC 1YIWA 1UUPA 3N20C 2LFIA 1ZUD2 2N7DA 5D6JB 1CK1A 5E6JA 2N9LA 2MBQA 3AECB 4TUUA 1WGGA 2BB5A 3MP9A 2WXKA 4XWTA 3KWVA 2K1FA 3QAQA 2V3SA 3UIOB 3DQVA 3Q8AA 3U2SC 3KH0A 4N6EB 2E3TA 4W9LA 2AQ3B 3VRBB 5IA7A 4MSQB 4YT0B 2ZZPB 1RRBA 1LGRA 4IUMB 3VDZA 5E6OA 1OFFA 2XK5B 2L05A 3KLSX 2IGDA 4NAWB 2KWUB 1XLOA 1CZPA 1SEBD 3L16A 2BTEA 1P7FA 1WJUA 1EWCA 4B0MA 2ASQA 3K9OB 3ZXVA 2QEJC 2KN4A 2KNBA 3B2FA 4REZA 2B76B 3BK2A 3AULA 3NZ3A 3SFEB 3GZNB 3A9JB 4K7UA 1OQRA 3DCGA 4A6QA 4A9AA 2ZW0A 4WJNA 2BB6A 1IGDA 4YTPB 1YJ1A 3AU4A 4O1NA 2MBEA 4FHJA 2WYQA 1V49A 4W9HA 2FUG1 2M56B 3DVNU 2CKHB 2N7JA 3VTVA 2JXXA 3I57A 1MJDA 2BKRB 4E74A 1L7YA 1TS3A 4BOSC 2J7QB 1T6BX 2KJHB 4NPNA 3PZ8A 2NBWB 2CHZA 2KVRA 4KKJA 4JLCA 4C4VA 2I2YA 1J8CA 2K0PA 2M17A 1F1HA 1XLNA 1NI2A 3ZW3A 4N59A 3T3NA 4GB9A 1OGWA 1KFYB 2W3RA 4TKNA 2Y5BB 4MM3A 1KM7A 4GU2A 4M02A 2KWVB 2JSVX 2W3SA 4CHKA 2EKIA 1JRPA 3S2AA 3AMZA 1TS5A 1LQBA 3R7QA 2NR2A 3APDA 1L6VA 3SEBA 3W1YA 1D5MC 4MT5A 3WAPA 1DOXA 4ZRQA 2WX0A 3PLVA 4RGMA 2KX0A 2ON8A 1T0QC 1AARA 5D2MB 3W5UB 1PQSA 2PVOD 4W9GA 3E56A 1QT9A 3K9PB 1ZP0B 4HJKA 2Y5CA 3N9YC 3RNEC 2QSDA 3PSEB 3NJTA 2AWTA 1T5XD 1UELA 2K8CA 1C3TA 4W9KA 2VH2A 3RYTA 2K9XA 3SFDB 1KLGD 1YX6B 2BYTA 2LGIA 1I4PA 1D5XC 4DQOC 1FXIA 2WXFA 4P7IA 1UNSA 4NAMA 1TKYA 2XN9C 4PS8A 1C4CA 2WXIA 3RN9C 4YTMB 2M4NA 3QQ8B 2AQ2B 1WX7A 3P2BA 2DYMA 4HRSA 1A70A 3UF8A 1PGXA 3AEBB 5E6PA 4DXFA 2MHJA 1HXYD 4HLEA 2GBKA 3DBHI 1XQQA 1XD3B 3P4RB 1FFUA 3PHWB 2NS5A 2JZZA 3AN1A 1UH6A 3Q8FA 4AWJA 4HWIB 3VTWA 1L6UA 2K25A 4ANWA 2K8BA 4JQWC 4ZOHC 4C7ZA 4XYCA 2PKOA 1ZGUB 4PYZA 2LHDA 3UIPB 3PGEA 3OWEB 4N9F4 2ZNVB 4W9FA 2V9HA 1UGJA 2DZKA 5BYSA 1WSPA 1J19A 3PRPB 4IWPA 3AEAB 3P42A 2W54A 3M95A 2NVUI 1KTKA 1UBQA 2INPE 3AE9B 2IO1B 3OJ3A 2WU5B 4GIVA 3I3TB 4EZLA 1VD2A 2DYBA 1GUAB 2KOXA 1KH0A 4NJ7A 4CQNA 5CTRC 4LK0M 1SBBB 3L13A 4WAAA 2GB1A 1D3ZA 2JYEA 3D32A 1J7AA 4RM8A 5BYRA 3RD2A 2AYOB 4HVBA 2L8JA 1TGZB 4BKTA 1WRIA 1X1MA 4OVUA 2W9NA 3L08A 2KWCA 3VQIA 1L0YB 5L95C 2YLMA 4KSLC 4HPMB 2N9XA 2V1YA 2KJRA 4P16A 1F0ZA 2R2QA 4LTUA 4LLGM 2D3BA 2K3UA 1R4MB 2G1EA 1N62A 3V61A 4XGAB 1N5XA 4JWSC 1WZ0A 1WMHA 3TEYA 2DAJA 2IY0B 3NVVA 3AXCA 2L3ZA 5D7GA 4MJSB 2KD0A 4MDKE 3IT4B 2DNFA 1TTNA 3NHEB 2L76A 3ALBA 3QC8B 2Y5PA 4FADA 4AP4C 4A3PA 4C56C 3ENEA 2ZEQA 3ZO5B 1GNUA 3Q14C 1WFYA 4GDKB 1YJIA 3LJ3A 3HHMA 3R66C 2NTTA 4C80A 1WE7A 3O65B 5L83A 5DPWA 2G45B 3DOWA 3UQAA 4JGHB 4KGTA 2IO3B 2LXAA 2WXNA 1EF1A 2X8XX 2JVCA 2VZKD 1UF0A 4OVVA 3VR8B 3VVWB 1WJ4A 2OJWA 1AYFA 2ACZB 2ZPYA 4BKGA 2KN5A 1YJJA 2WWZA 2WXPA 4KDIC 3ETRA 1JROA 2C7MB 2WGSA 2BYEA 4LNOA 2RR9A 3C8YA 2IGGA 2FNJB 5DCNA 5JHBA 1I4HA 3R7RA 3U52E 3FILA 3A9KA 3MTNB 4HDOA 4FHKA 4DHJB 4M8NA 1NEKB 3A4RA 1SE3A 3KVFB 4GDLA 3WAOA 4ACFA 1FPYA 2AL6A 1QOGA 3SDLC 3AEGB 1R4NI 1UWXA 3ZRCA 1MG8A 4GSWA 1K52A 1TKGA 1TZOA 4YSYB 4YXDB 5G5GA 3UI3A 1KLVA 1IP9A 2TSSA 3P63A 4J3OD 4AOFA 1MHXA 4OZAA 3M3JA 1MFWA 3Q8BA 5IN7A 2WP9B 4P1CC 1RYJA 3VRAB 2MP2A 4M01A 4C00A 2JF5A 1BMLC 2JRIB 1ZW7A 3C0RB 3MC9A 4TSSA 2CHWA 3QCAA 5DPRA 4IW0A 1V1PA 3N1ZC 1YN5A 4WQMA 3ZRFA 1N61A 2LXCA 2IBIB 1MI0A 1Q1OA 2CR5A 1QF6A 3PS6A 1TJEA 2INDC 5C2TB 1WGRA 5HI1A 1BXTA 2JT4B 3MHSD 5AUKA 4K81A 5KHQA 3NS8A 3M63B 3DWMA 1IBXA 3T3OA 1V97A 2UWQA 4XZ4A 4GN1A 2KWDA 1WX8A 1YX5B 3RUIB 1WGDA 1J7CA 3B9JA 3PLUA 4ZHOA 3QX1A 2K22A 2DENB 3B1LX 4RF1A 3HVDA 2MCNB 3DBRI 2KQSA 3PT2B 4C4VB 5G55A 1WI0A 2L7RA 4WWPA 4BOZB 2BS2B 2FBWB 4YTNB 4MM3B 4KIKA 4ZYNA 2JX5A 3KUCB 3URYA 4KGSA 3KW5B 1GC6A 1TZ1A 3I63C 4P6VF 3NOBA 2MQJA 1EF5A 2OOBB 2VRRB 3RMKC 3ZDTA 1XT9B 3QK0A 1YQBA 4KZ0A 4QAYA 2RDHA 4EZJA 2GBMA 1SJHD 3HUIA 2CS4A 2FCMA 3AE5B 1L4ZB 2KC1A 2PW9A 4HJGE 2G9HD 5T8IA 4E3CA 2WNMA 4AUQC 5IKCM 1ZE3D 2INNE 3WAMA 1Q5WB 4JIOU 3JW0X 4DXGA 3LB8C 1L0XB 2FIDA 1HQRD 2WXMA 1SGHA 1SE4A 1Z2MA 2BQQA 5H8YE 1EUVB 1VRAB 3FAHA 1XEEA 3IT6B 4G3XB 1RM6C 4M0WA 4ZYSA 2KKCA 4AJYB 3CSTA 1K50A 4I6LB 4BKSD 1KJTA 3BYTB 1WY8A 2BYFA 3MC0B 1XO3A 4WAFA 3B08A 2ICIA 4WJQA 2KDBA 3L54A 4K3BA 2DAFA 3EC8A 2KFKA 1ZDVA 1WWTA 2FUHB 1FM0D 2GMIC 3W9CB 1V2YA 2BWFA 2J0KA 3WANA 2PEAA 3IFWB 1M94A 3AV8A 1ET6A 1D5ZC 1E8YA 1E0ZA 3R2IA 4JPSA 4EEWA 1NVID 1PYWD 5EDSA 4HXDA 4US8A 1VZ6A 4JX1C 1I4QA 2M8SA 1P1AA 4I6NB 4FBJB 1QOFA 3JSVA 4HCPB 2PE6B 3P4QB 3VUYA 1Y56A 2O6VD 2UYZB 2LVQA 3TMPB 3UINB 2HJ8A 3TIXA 3DHIC 3RZWC 3O13A 1L2NA 1C1YB 1DOYA 1E7PB 2MX2A 2HTME 2N7EA 2V3NA 4MH8A 2KDFB 2L52A 3VH3B 5CHWA 4HK2A 1F2RI 2MSED 2LVPA 5AZFA 2M0XA 3MC8A 1B9RA 4PS7A 2RMMA 4WWMA 2GBJA 1I7HA 4IOIE 4XWWA 1V9JA 1YOVB 4FJVB 2VZKB 1ZKHA 1FRRA 5CHFA 5GMVA 4JE3B 2QMTA 1D6EC 2DZJA 4RGNA 4ZHPA 2YEPF 3IAS1 3RNBC 3RULA 5TR5A 1VZ8A 2FCQA 2LUMA 2WQYB 1N5WA 3BVGA 1GG3A 2KDEB 3OG5A 2BGFA 1E8XA 2D11A 3NS1A 2D3AA 4C7YA 1FXTB 2NPTA 1TIFA 5LNK1 4A90A 1QILA 3CSFA 2DHZA 2LGSA 2PMVA 4NJ6A 3W1SC 2DBYA 5BMGA 1NENB 1F2RC 1VZ7A 3IAM1 3NG0A 2GBRA 3HK0A 4NNJB 1C4AA 2MBHA 2BPSA 3AE6B 5JXVA 3Q69A 1NYQA 3DVGX 4IDIA 1ET9A 3AE7B 1WMHB 2R61A 1BUIC 1FEHA 3DPDA 4MH0E 1XXGA 3V60A 1VLBA 3GZNI 1K51A 3BZDB 3N3KB 4HKZE 3PO0A 3U30A 2BVCA 2KLCA 3BWUD 2GLSA 4FA6A 2X38A 1V5OA 2I38A 4HKQA 1SB3C 2AEHA 4B95A 3DVGY 1RFKA 4N58A 4ARIA 1FCLA 2OHFA 4G11A 3NVYA 2JZPA 1VJKA 3AH7A 4BBNF 3P1MA 4RM9A 2QHOA 5I4DA 1P9DU 4MGKE 4FLHA 1PGAA 2YVCA 3CMMB 3W2DA 2L83A 2KMCA 5BYQA 3Q8CA 1D4BA 2MEKA 1SIJA 3A1QA 2FIFA 3Q3JA 2JY6A 1I35A 2RDBC 1H8CA 1P98A 1L5PA 2LHEA 2WU2B 2IGHA 3BINA 3V62A 3C19A 3BK1A 2FAZA 4WURA 3PRZA 3LXFA 3PREA 3FILB 3A9KB 3Q3OC 3Q3MC 2QIEB 2L0TA 3QARA 3PVLA 4GGQA 4GDLB 3ML9A 3R2TA 1GB4A 2NCNA 2WXQA 2KJ6A 4G0NB 4DDID 4MSMB 3M62B 4YWGG 1XLPA 5J2RA 3BIID 2M0AA 1SE2A 1VR9A 3U4EG 5HG2A 1LFDA 3A33B 1XF5L 2K6QA 4DHZB 1ENFA 1QQRA 4H2AA 3CF6E 4OHJA 2KZRA 1YN4A 4NZLB 2LRWA 1WJ6A 4LCDE 1SF0A 3H7SA 1WGYA 2MP2B 4W9CA 5EE1A 1JW9D 2WHIA 3OAWA 4LJOB 2WXHA 1FNWA 1WXQA 3H8HA 1E6EB 3P4SB 2FE8A 2ZCBA 2AL3A 1C77A 2N9KA 3WCQA 2CU3A 1UZXB 2DX5B 1V1PB 1ZXHA 4W9IA 1PGBA 1FIQA 2PJHA 2B3AA 2Z59B 4E71A 2C9WB 3T8MA 5MPOA 3CWIA 2NMQA 2WXRA 4ASWC 2KACA 1E90A 1ZXIA 4TQ1A 1GJZA 4EZKA 4A20A 2G4SA 3ZVVA 1FD6A 1KRHA 4JWUC 3KWLA 3QA8A 3ZJUA 3NVZA 2AX5A 2NTSA 4LNNA 2LASA 3IVFA 4NJCA 2WXLA 1IBXB 3DBLB 1YMHE 2QC8A 3EHVA 2D10A 3N1YC 2KXJA 2WXOA 5AUIA 1E7UA 3AE8B 2A5UA 5KHOA 2IO0B 1C76A 3L10B 1E5WA 5HKHA 1NYRA 1YN3A 5H92C 1E10A 1KF6B 3E9SA 5LXIB 4TV3A 4ZDVA 1XCTL 3I9V1 4MELA 1B1ZA 3KUDB 3P4PB 2XNAC 1I42A 2RGFA 3DBRB 4DDGD 4KIKB 2Z8LA 3N32A 4BZAA 1WYGA 2KLGA 1MVKA 2PTLA 2QCZA 3Q6BA 1H4RA 2LI5A 1V86A 1WXVA 1Y8RC 3GE3C 3N1XC 4P1BC 1TS4A 4AQ7A 4MGZE 4LNKA 2N9PC 1RWSA 1WGKA 2JWUA 2IZVB 5G2NA 1WE6A 1RLFA 2N1WA 5DPSA 3VXWA 2MW5A 1G6JA 2WDQB 4J6IA 1OTRB 5D3DA 4MGIE 1IYFA 1KLUD 3VUWA 1WZ3A 1IGCA 2KHWB 4WJPA 1JALA 1OEYA 1FFVA 4BFRA 1HA5A 5AEKB 3ECIA 3N30A 2PPHA 1F52A 1V8CA 1L0VB 3VTUA 4M0WB 2SAKA 2G4DB 2Z0EB 3MJWA 2JQRB 2ZVNA 4L1BA 1ZPSA 4FJZA 1HE8A 4HROA 2ZNVC 4YSXB 3IHPC 2E6XA 4BBNC 2CU1A 3SU8X 1QKZA 2NBUA 4EFOA 3H7PB 2MBOA 4DWFA 4LNFA 1R4MI 2BKFA 3ZQ4A 4IM2A 2KFKB 2DWQA 1JWBD 4I6PA 4II2B 3NUHB 4IWQA 1JQ4A 3ZNZB 2M1MA 4YL8A 2J0JA 2KDIA 3DBSA 4RCOA 3T9LA 2J0MA 3L4PA 3NVWA 4L23A 4BKSA 3JYUA 4KDLB 4B6WA 4ARCA 3J9CA 3Q3NC 5JHAA 1NDDA 4D2KA 2BW2A 4KKIA 1TYGB 3ZNID 1FMAD 3PTFC 1WJNA 5FR3A 2KFJA 1GC7A 2CJOA 2Y3AA 3JSVB 2IDYA 1LO5D 4F8CB 3H9DA 1EWYC 2KQ4X 3QIJA 3V6EB 3L17A 3IG3A 2G3QB 2LJ5A 2HE7A 3ONSA 1QOBA 4ANUA 2KO3A 2KTRA 4MGYE 4R3DA 3AB5A 1RAXA 1HZ5A 2ZW1A 2KYWA 3VHTC 3NRZA 1C79A 5BO4B 1L4DB 1SSNA 3NZUA 2CHXA 3DDCB 2LVOA 2EKEC 3H1UA 4OW0A 4A3OA 5C3JB 4WQOB 2BT6A 2Q5WD 4PYUA 2IYDB 2O6VA 3RNFC 1YNTE 3AM9A 3TUOA
chains in the Genus database with same CATH topology
1Z5SB 1UBQA 4EUTA 1VCBA 1OEYJ 2IO1B 3OJ3A 2ZJDA 3QJZA 4FJVB 2WX1A 1WM2A 2K8HA 4GIVA 3TL5A 3UQBA 2LGYA 1ZKHA 5IAAC 3I3TB 4EZLA 5CHFA 1VD2A 2DYBA 1GUAB 5GMVA 1V81A 2KOXA 4NJ7A 2ZVOA 4IM3A 2DZJA 5CTRC 2JPHA 2ZPNA 2BF8B 1SIFA 1UD7A 3RULA 2JRHA 2XBBC 3GOEA 5TR5A 1P3QU 2FCQA 3TBLD 3KYCD 3L13A 4WAAA 1ISNA 1D3ZA 3D32A 4RM8A 2N4FA 3RD2A 3AU5A 1GG3A 2AYOB 2L8JA 1TGZB 4HVBA 4WWNA 2KDEB 1JRUA 4BKTA 2BGFA 2ZCCA 1V5TA 2D3GA 1X1MA 1E8XA 1P0RA 2D11A 4W9DA 4FN2A 2FCNA 2NPTB 4OVUA 2K39A 1S1QB 4LJPB 3H6NA 1FXTB 2NPTA 2W9NA 3L08A 2KWCA 3QHTA 4KZCA 3SHQA 3VH4B 3VQIA 4CO7A 1WX9A 2R2OA 3ML8A 3CSFA 2LGXA 5L95C 2DHZA 4DBGA 2YLMA 2LZ6A 1WYWB 3Q3FA 4KSLC 2IO2B 4KV2A 5CHVC 4HPMB 4ZRKA 4GXBA 2N9XA 4NJ6A 3VAWA 3ZTCA 4WJOA 1WXAA 2V1YA 3H7PA 2KJRA 3W1SC 1WR6E 5J18A 2R2QA 3WIMA 4EOYA 3ZUNA 4IG7B 4NQKE 2GBRA 3HK0A 4NNJB 4NY0A 4B9KA 2MBHA 2BPSA 3DVGX 3L0WB 2C7HA 3V61A 2BYVE 4XC2A 1WMHB 2LD9A 5LLIA 1WZ0A 4W9JA 1WMHA 3DPDA 5CX3A 4MH0E 1J0GA 3EECA 2DAJA 4ICVA 3V60A 3GZNI 2GOWA 2IY0B 3SD5A 3N3KB 4LDTB 3AXCA 3NZSA 4EKUA 3KYDD 3U30A 2L00B 2L3ZA 3V6CB 5D7GA 2KLCA 4MJSB 2MBBB 2KD0A 4MDKE 2C7NB 4MEMA 1TTNA 3DBLI 3NHEB 4KVGB 3VFKA 3EFUA 4MJSA 4FA6A 1V5OA 2L76A 3ALBA 1A5RA 3QC8B 4FADA 4AP4C 2AEHA 4B95A 4A3PA 2MA9B 3DVGY 2JWZA 3ENEA 2ZEQA 3ZO5B 1GNUA 2N1VA 3ZIMA 1WFYA 2LUEA 2Z0DB 3IBEA 1KOTA 4GDKB 3LJ3A 1WXMA 2I1KA 3RT3B 3OLMD 3HHMA 3R66C 4G11A 4GDKA 4JL9A 2MLBA 3VUXA 1WE7A 3O65B 5L83A 5DPWA 4BBNF 2G45B 3DOWA 4RM9A 2QHOA 2PE9A 3UQAA 1P9DU 4MGKE 4JGHB 4FLHA 2YVCA 3CMMB 2K6DB 2IO3B 2LXAA 2KMCA 1EF1A 3UGBB 2JVCA 1WR1A 1UGMA 3A1QB 4DHJD 4OVVA 3TJPA 1UBIA 2MWSB 3DVNV 2A4ZA 4HCNB 1WJ4A 3A1QA 3RZFA 3VVWB 2O2VB 2OJRA 2ZPYA 2FIFA 2KN5A 4GOCA 4BKGA 3Q3JA 2JY6A 1I35A 2O2VA 2WDTB 1OQYA 4HPLB 2XEWA 2LWPA 1H8CA 2RD0A 2WWZA 4BVUC 1P98A 4KDIC 2NBVB 2HD5B 2C7MB 1WH3A 3KUZA 3BINA 3HM3A 4RMAA 3V62A 1NBFC 2FAZA 2BYEA 2RR9A 3BY4B 1E8WA 3PRZA 3PREA 2FNJB 5DCNA 3APCA 2KQ7A 4DK5A 5JHBA 3W1SA 3A9KB 3R7RA 3ZNGC 3PRMB 2L0TA 2MRPA 3A9KA 3MTNB 4HDOA 4FHKA 3QARA 4HDQA 3PVLA 4GGQA 4DHJB 4M8NA 1E8ZA 3ML9A 4GDLB 3A4RA 3PHXB 3KVFB 1YIWA 2NCNA 4GDLA 5AZHA 2KJ6A 3WAOA 3TCAA 4G0NB 4DDID 2N7DA 4MSMB 2AL6A 3SDLC 3RCZA 5D6JB 5LXHA 1R4NI 3M62B 3ZRCA 1MG8A 5J2RA 2DYOA 4GSWA 2MBQA 4K7SA 4TUUA 1WGGA 1LFDA 3A33B 2K6QA 1KLVA 1IP9A 2C60A 4DHZB 4AOFA 2K1FA 3CF6E 2V3SA 3QAQA 3HM6X 3UIOB 1T0YA 2KZRA 3M3JA 4URKA 3DQVA 2LRWA 3KH0A 1WJ6A 4LCDE 4W9LA 3H7SA 4WWOA 5IA7A 3NY5A 1WGYA 2MP2B 4W9CA 4MSQB 4LDTD 3ZNHB 2MP2A 2LRUA 2KC2A 2ZZPB 3OAWA 1RRBA 3QWZB 4LJOB 2JF5A 4IUMB 3VDZA 4F1SA 5E6OA 2JRIB 2KMAA 2ZCBA 2AL3A 1ZW7A 2XK5B 3C0RB 5E6NA 1TBEA 5JZEB 1WM3A 2L05A 4F7ZA 1UZXB 2DX5B 2XK5A 2CHWA 3QCAA 4W9IA 5DPRA 4IW0A 3U8ZA 4NAWB 2KWUB 2PJHA 2B3AA 4NAWA 3L16A 2Z59B 4IM0A 2C9WB 3T8MA 1WJUA 3ZRFA 4E71A 5DPTA 4ASWC 1E90A 2ASQA 1IPGA 2LXCA 3K9OB 4IWOA 4KSKC 2IBIB 4TQ1A 1GJZA 2KNBA 4EZKA 4A20A 2G4SA 3ZVVA 1WGHA 3AULA 1Q1OA 2CR5A 5D94A 1YD8U 2RPQA 3QA8A 3PS6A 3A9JB 4K7UA 2IY1B 3DCGA 1WGRA 3A9JA 4NQLB 2LASA 3IVFA 2JT4B 3MHSD 4K81A 4WJNA 5KHQA 3NS8A 3M63B 1YJ1A 3AU4A 4AJWA 3EHVA 2D10A 2KXJA 2MBEA 1E7UA 1QZEA 4FHJA 4XZ4A 2UWQA 5FR6A 4GN1A 4ICUA 1WX8A 2WYQA 2A5UA 3ZKJC 5KHOA 1V49A 2IO0B 1YX5B 4W9HA 3RUIB 1WGDA 3PLUA 3L10B 2GBNA 1E5WA 3QX1A 3X23A 5HKHA 3DVNU 2CKHB 1SE9A 1V80A 4K7WA 2DENB 3B1LX 3HIZA 3X0WA 3VTVA 2JXXA 2BKRB 2MCNB 5LXIB 4TV3A 4E74A 4ZDVA 3DBRI 1L7YA 4BOSC 2D07B 2J7QB 2KQSA 4MELA 3KUDB 2KJHB 4NPNA 3PT2B 2NBWB 5G55A 1WI0A 2CHZA 2L7RA 2KVRA 1I42A 2RGFA 4JLCA 4WWPA 4BOZB 1J8CA 2EMTA 2M17A 3ZLZA 1LXDA 1NI2A 4KIKB 3ZW3A 4DDGD 3N32A 4GB9A 1OGWA 3PPAA 4TKNA 1V6EA 4KIKA 4CYEA 2Y5BB 4MM3A 1KM7A 2KLGA 2KTFA 4GU2A 4ZYNA 1WIAA 2JUOA 3PZDA 3KUCB 2DZIA 2KWVB 3KW5B 1GC6A 1H4RA 1TZ1A 2LI5A 2DZMA 4W9EA 2REXA 3NOBA 4CHKA 2MQJA 1V86A 1WXVA 1Y8RC 1EF5A 2OOBB 3S2AA 4DHZE 2VRRB 3ZDTA 2N9EB 1XT9B 3QK0A 1LQBA 1YQBA 4KZ0A 4MGZE 3R7QA 2N9PC 4G50A 2NR2A 2I1JA 3APDA 4EZJA 2D2QA 2GBMA 2IZVB 5G2NA 1WE6A 1WRDB 2CS4A 1RLFA 2FCMA 4FULA 3W1YA 3WAPA 2KK8A 5C1ZA 2N1WA 2WX0A 5DPSA 3VXWA 2MW5A 2KC1A 3PLVA 2FCSA 1G6JA 2KX0A 4E3CA 1AARA 4J6IA 1OTRB 5D2MB 1PQSA 4AUQC 3LDZE 4MGIE 3WAMA 4W9GA 1IYFA 3VUWA 1WZ3A 1Q5WB 4ANXA 4JIOU 3JW0X 3K9PB 2FIDA 3R3MA 2KHWB 4WJPA 1OEYA 4HJKA 4BFRA 1SGHA 5AEKB 3ECIA 2L0FA 1Z2MA 2BWES 3N30A 2PPHA 1WXSA 1EUVB 3PSEB 5JH5C 3VTUA 1E7VA 4G3XB 2AWTA 4M0WB 1K8RB 2G4DB 1UELA 2K8CA 1C3TA 2Z0EB 3MJWA 4W9KA 4ZRIA 5C23A 2KKCA 2ZVNA 3ZTDA 3RYTA 3CSTA 4AJYB 1YX6B 4I6LB 3OJ4B 4FJZA 4BKSD 4PS3A 1HE8A 1KJTA 2ZNVC 1WY8A 3IHPC 4BBNC 2BYFA 2CU1A 4GMVA 3SU8X 2NBUA 4EFOA 1BT0A 3H7PB 2MBOA 4P7IA 3B08A 4DWFA 2V4LA 4WJQA 1R4MI 2BKFA 2KDBA 3L54A 4FJYA 3PV1A 3WA0A 4IM2A 2DAFA 2KFKB 3EC8A 4I6PA 4II2B 4PS8A 4IWQA 2KX3A 3APFA 2KFKA 3ZNZB 2FUHB 2M1MA 2M4NA 2J0JA 2KDIA 3QQ8B 4YL8A 1EO6A 2GMIC 4II3B 3DBSA 1V2YA 2BWFA 3T9LA 2J0MA 1WX7A 3P2BA 2DYMA 4IC7B 2C5LC 2J0KA 3UF8A 3WANA 1RFAA 4BKSA 1U4AA 3AI5A 1WF9A 2PEAA 3IFWB 5E6PA 1M94A 3JYUA 4KDLB 4M8MA 4B6WA 2EMSA 5JHAA 4HLEA 2GBKA 3DBHI 1E8YA 1XQQA 1NDDA 1XD3B 4EEWA 3PHWB 4ZRJA 2NS5A 5EDSA 4HXDA 2LGDA 3B0AA 2JZZA 3ZNID 4TQ0A 3PTFC 1WJNA 4ANVA 2KFJA 1F9JA 1GC7A 3A4SC 1UH6A 2M8SA 1S3SG 1P1AA 4K1RB 4I6NB 4AWJA 3JSVB 4HWIB 3VTWA 5J17A 4FBJB 2K25A 4ANWA 4F8CB 2K8BA 3H9DA 3V6EB 3WALA 3JSVA 3QIJA 2PE6B 4HCPB 3L17A 4JQWC 3VUYA 2O6VD 2UYZB 2KTRB 2G3QB 2LJ5A 2HE7A 2LVQA 3IG3A 1CMXB 3ONSA 5AZGA 2KO3A 3TMPB 3UINB 4ANUA 2HJ8A 2KTRA 4MGYE 3TIXA 4DXAB 3RZWC 4X57B 1RAXA 1ZGUB 4PYZA 3ZDMC 2RSUA 1L2NA 1C1YB 2KANA 3UIPB 2HTHA 2MX2A 2N7EA 3PGEA 3VHTC 5BO4B 1LM8B 2KDFB 3VH3B 1Q0WB 3NZUA 4N9F4 2CHXA 2ZNVB 3DDCB 5CHWA 4W9FA 2LVOA 2EKEC 3H1UA 3JVZX 4A3OA 4HK2A 2DZKA 2MSED 2LVPA 4WQOB 1J19A 3PRPB 4IWPA 2M0XA 4PYUA 5AZFA 3U7DA 4PS7A 3M95A 2NVUI 2O6VB 4XX5A 2JZ3B 2GBJA 2IYDB 2O6VA 1V9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5S B;  1UBQ A;  4EUT A;  1VCB A;  1OEY J;  2IO1 B;  3OJ3 A;  2ZJD A;  3QJZ A;  4FJV B;  2WX1 A;  1WM2 A;  2K8H A;  4GIV A;  3TL5 A;  3UQB A;  2LGY A;  1ZKH A;  5IAA C;  3I3T B;  4EZL A;  5CHF A;  1VD2 A;  2DYB A;  1GUA B;  5GMV A;  1V81 A;  2KOX A;  4NJ7 A;  2ZVO A;  4IM3 A;  2DZJ A;  5CTR C;  2JPH A;  2ZPN A;  2BF8 B;  1SIF A;  1UD7 A;  3RUL A;  2JRH A;  2XBB C;  3GOE A;  5TR5 A;  1P3Q U;  2FCQ A;  3TBL D;  3KYC D;  3L13 A;  4WAA A;  1ISN A;  1D3Z A;  3D32 A;  4RM8 A;  2N4F A;  3RD2 A;  3AU5 A;  1GG3 A;  2AYO B;  2L8J A;  1TGZ B;  4HVB A;  4WWN A;  2KDE B;  1JRU A;  4BKT A;  2BGF A;  2ZCC A;  1V5T A;  2D3G A;  1X1M A;  1E8X A;  1P0R A;  2D11 A;  4W9D A;  4FN2 A;  2FCN A;  2NPT B;  4OVU A;  2K39 A;  1S1Q B;  4LJP B;  3H6N A;  1FXT B;  2NPT A;  2W9N A;  3L08 A;  2KWC A;  3QHT A;  4KZC A;  3SHQ A;  3VH4 B;  3VQI A;  4CO7 A;  1WX9 A;  2R2O A;  3ML8 A;  3CSF A;  2LGX A;  5L95 C;  2DHZ A;  4DBG A;  2YLM A;  2LZ6 A;  1WYW B;  3Q3F A;  4KSL C;  2IO2 B;  4KV2 A;  5CHV C;  4HPM B;  4ZRK A;  4GXB A;  2N9X A;  4NJ6 A;  3VAW A;  3ZTC A;  4WJO A;  1WXA A;  2V1Y A;  3H7P A;  2KJR A;  3W1S C;  1WR6 E;  5J18 A;  2R2Q A;  3WIM A;  4EOY A;  3ZUN A;  4IG7 B;  4NQK E;  2GBR A;  3HK0 A;  4NNJ B;  4NY0 A;  4B9K A;  2MBH A;  2BPS A;  3DVG X;  3L0W B;  2C7H A;  3V61 A;  2BYV E;  4XC2 A;  1WMH B;  2LD9 A;  5LLI A;  1WZ0 A;  4W9J A;  1WMH A;  3DPD A;  5CX3 A;  4MH0 E;  1J0G A;  3EEC A;  2DAJ A;  4ICV A;  3V60 A;  3GZN I;  2GOW A;  2IY0 B;  3SD5 A;  3N3K B;  4LDT B;  3AXC A;  3NZS A;  4EKU A;  3KYD D;  3U30 A;  2L00 B;  2L3Z A;  3V6C B;  5D7G A;  2KLC A;  4MJS B;  2MBB B;  2KD0 A;  4MDK E;  2C7N B;  4MEM A;  1TTN A;  3DBL I;  3NHE B;  4KVG B;  3VFK A;  3EFU A;  4MJS A;  4FA6 A;  1V5O A;  2L76 A;  3ALB A;  1A5R A;  3QC8 B;  4FAD A;  4AP4 C;  2AEH A;  4B95 A;  4A3P A;  2MA9 B;  3DVG Y;  2JWZ A;  3ENE A;  2ZEQ A;  3ZO5 B;  1GNU A;  2N1V A;  3ZIM A;  1WFY A;  2LUE A;  2Z0D B;  3IBE A;  1KOT A;  4GDK B;  3LJ3 A;  1WXM A;  2I1K A;  3RT3 B;  3OLM D;  3HHM A;  3R66 C;  4G11 A;  4GDK A;  4JL9 A;  2MLB A;  3VUX A;  1WE7 A;  3O65 B;  5L83 A;  5DPW A;  4BBN F;  2G45 B;  3DOW A;  4RM9 A;  2QHO A;  2PE9 A;  3UQA A;  1P9D U;  4MGK E;  4JGH B;  4FLH A;  2YVC A;  3CMM B;  2K6D B;  2IO3 B;  2LXA A;  2KMC A;  1EF1 A;  3UGB B;  2JVC A;  1WR1 A;  1UGM A;  3A1Q B;  4DHJ D;  4OVV A;  3TJP A;  1UBI A;  2MWS B;  3DVN V;  2A4Z A;  4HCN B;  1WJ4 A;  3A1Q A;  3RZF A;  3VVW B;  2O2V B;  2OJR A;  2ZPY A;  2FIF A;  2KN5 A;  4GOC A;  4BKG A;  3Q3J A;  2JY6 A;  1I35 A;  2O2V A;  2WDT B;  1OQY A;  4HPL B;  2XEW A;  2LWP A;  1H8C A;  2RD0 A;  2WWZ A;  4BVU C;  1P98 A;  4KDI C;  2NBV B;  2HD5 B;  2C7M B;  1WH3 A;  3KUZ A;  3BIN A;  3HM3 A;  4RMA A;  3V62 A;  1NBF C;  2FAZ A;  2BYE A;  2RR9 A;  3BY4 B;  1E8W A;  3PRZ A;  3PRE A;  2FNJ B;  5DCN A;  3APC A;  2KQ7 A;  4DK5 A;  5JHB A;  3W1S A;  3A9K B;  3R7R A;  3ZNG C;  3PRM B;  2L0T A;  2MRP A;  3A9K A;  3MTN B;  4HDO A;  4FHK A;  3QAR A;  4HDQ A;  3PVL A;  4GGQ A;  4DHJ B;  4M8N A;  1E8Z A;  3ML9 A;  4GDL B;  3A4R A;  3PHX B;  3KVF B;  1YIW A;  2NCN A;  4GDL A;  5AZH A;  2KJ6 A;  3WAO A;  3TCA A;  4G0N B;  4DDI D;  2N7D A;  4MSM B;  2AL6 A;  3SDL C;  3RCZ A;  5D6J B;  5LXH A;  1R4N I;  3M62 B;  3ZRC A;  1MG8 A;  5J2R A;  2DYO A;  4GSW A;  2MBQ A;  4K7S A;  4TUU A;  1WGG A;  1LFD A;  3A33 B;  2K6Q A;  1KLV A;  1IP9 A;  2C60 A;  4DHZ B;  4AOF A;  2K1F A;  3CF6 E;  2V3S A;  3QAQ A;  3HM6 X;  3UIO B;  1T0Y A;  2KZR A;  3M3J A;  4URK A;  3DQV A;  2LRW A;  3KH0 A;  1WJ6 A;  4LCD E;  4W9L A;  3H7S A;  4WWO A;  5IA7 A;  3NY5 A;  1WGY A;  2MP2 B;  4W9C A;  4MSQ B;  4LDT D;  3ZNH B;  2MP2 A;  2LRU A;  2KC2 A;  2ZZP B;  3OAW A;  1RRB A;  3QWZ B;  4LJO B;  2JF5 A;  4IUM B;  3VDZ A;  4F1S A;  5E6O A;  2JRI B;  2KMA A;  2ZCB A;  2AL3 A;  1ZW7 A;  2XK5 B;  3C0R B;  5E6N A;  1TBE A;  5JZE B;  1WM3 A;  2L05 A;  4F7Z A;  1UZX B;  2DX5 B;  2XK5 A;  2CHW A;  3QCA A;  4W9I A;  5DPR A;  4IW0 A;  3U8Z A;  4NAW B;  2KWU B;  2PJH A;  2B3A A;  4NAW A;  3L16 A;  2Z59 B;  4IM0 A;  2C9W B;  3T8M A;  1WJU A;  3ZRF A;  4E71 A;  5DPT A;  4ASW C;  1E90 A;  2ASQ A;  1IPG A;  2LXC A;  3K9O B;  4IWO A;  4KSK C;  2IBI B;  4TQ1 A;  1GJZ A;  2KNB A;  4EZK A;  4A20 A;  2G4S A;  3ZVV A;  1WGH A;  3AUL A;  1Q1O A;  2CR5 A;  5D94 A;  1YD8 U;  2RPQ A;  3QA8 A;  3PS6 A;  3A9J B;  4K7U A;  2IY1 B;  3DCG A;  1WGR A;  3A9J A;  4NQL B;  2LAS A;  3IVF A;  2JT4 B;  3MHS D;  4K81 A;  4WJN A;  5KHQ A;  3NS8 A;  3M63 B;  1YJ1 A;  3AU4 A;  4AJW A;  3EHV A;  2D10 A;  2KXJ A;  2MBE A;  1E7U A;  1QZE A;  4FHJ A;  4XZ4 A;  2UWQ A;  5FR6 A;  4GN1 A;  4ICU A;  1WX8 A;  2WYQ A;  2A5U A;  3ZKJ C;  5KHO A;  1V49 A;  2IO0 B;  1YX5 B;  4W9H A;  3RUI B;  1WGD A;  3PLU A;  3L10 B;  2GBN A;  1E5W A;  3QX1 A;  3X23 A;  5HKH A;  3DVN U;  2CKH B;  1SE9 A;  1V80 A;  4K7W A;  2DEN B;  3B1L X;  3HIZ A;  3X0W A;  3VTV A;  2JXX A;  2BKR B;  2MCN B;  5LXI B;  4TV3 A;  4E74 A;  4ZDV A;  3DBR I;  1L7Y A;  4BOS C;  2D07 B;  2J7Q B;  2KQS A;  4MEL A;  3KUD B;  2KJH B;  4NPN A;  3PT2 B;  2NBW B;  5G55 A;  1WI0 A;  2CHZ A;  2L7R A;  2KVR A;  1I42 A;  2RGF A;  4JLC A;  4WWP A;  4BOZ B;  1J8C A;  2EMT A;  2M17 A;  3ZLZ A;  1LXD A;  1NI2 A;  4KIK B;  3ZW3 A;  4DDG D;  3N32 A;  4GB9 A;  1OGW A;  3PPA A;  4TKN A;  1V6E A;  4KIK A;  4CYE A;  2Y5B B;  4MM3 A;  1KM7 A;  2KLG A;  2KTF A;  4GU2 A;  4ZYN A;  1WIA A;  2JUO A;  3PZD A;  3KUC B;  2DZI A;  2KWV B;  3KW5 B;  1GC6 A;  1H4R A;  1TZ1 A;  2LI5 A;  2DZM A;  4W9E A;  2REX A;  3NOB A;  4CHK A;  2MQJ A;  1V86 A;  1WXV A;  1Y8R C;  1EF5 A;  2OOB B;  3S2A A;  4DHZ E;  2VRR B;  3ZDT A;  2N9E B;  1XT9 B;  3QK0 A;  1LQB A;  1YQB A;  4KZ0 A;  4MGZ E;  3R7Q A;  2N9P C;  4G50 A;  2NR2 A;  2I1J A;  3APD A;  4EZJ A;  2D2Q A;  2GBM A;  2IZV B;  5G2N A;  1WE6 A;  1WRD B;  2CS4 A;  1RLF A;  2FCM A;  4FUL A;  3W1Y A;  3WAP A;  2KK8 A;  5C1Z A;  2N1W A;  2WX0 A;  5DPS A;  3VXW A;  2MW5 A;  2KC1 A;  3PLV A;  2FCS A;  1G6J A;  2KX0 A;  4E3C A;  1AAR A;  4J6I A;  1OTR B;  5D2M B;  1PQS A;  4AUQ C;  3LDZ E;  4MGI E;  3WAM A;  4W9G A;  1IYF A;  3VUW A;  1WZ3 A;  1Q5W B;  4ANX A;  4JIO U;  3JW0 X;  3K9P B;  2FID A;  3R3M A;  2KHW B;  4WJP A;  1OEY A;  4HJK A;  4BFR A;  1SGH A;  5AEK B;  3ECI A;  2L0F A;  1Z2M A;  2BWE S;  3N30 A;  2PPH A;  1WXS A;  1EUV B;  3PSE B;  5JH5 C;  3VTU A;  1E7V A;  4G3X B;  2AWT A;  4M0W B;  1K8R B;  2G4D B;  1UEL A;  2K8C A;  1C3T A;  2Z0E B;  3MJW A;  4W9K A;  4ZRI A;  5C23 A;  2KKC A;  2ZVN A;  3ZTD A;  3RYT A;  3CST A;  4AJY B;  1YX6 B;  4I6L B;  3OJ4 B;  4FJZ A;  4BKS D;  4PS3 A;  1HE8 A;  1KJT A;  2ZNV C;  1WY8 A;  3IHP C;  4BBN C;  2BYF A;  2CU1 A;  4GMV A;  3SU8 X;  2NBU A;  4EFO A;  1BT0 A;  3H7P B;  2MBO A;  4P7I A;  3B08 A;  4DWF A;  2V4L A;  4WJQ A;  1R4M I;  2BKF A;  2KDB A;  3L54 A;  4FJY A;  3PV1 A;  3WA0 A;  4IM2 A;  2DAF A;  2KFK B;  3EC8 A;  4I6P A;  4II2 B;  4PS8 A;  4IWQ A;  2KX3 A;  3APF A;  2KFK A;  3ZNZ B;  2FUH B;  2M1M A;  2M4N A;  2J0J A;  2KDI A;  3QQ8 B;  4YL8 A;  1EO6 A;  2GMI C;  4II3 B;  3DBS A;  1V2Y A;  2BWF A;  3T9L A;  2J0M A;  1WX7 A;  3P2B A;  2DYM A;  4IC7 B;  2C5L C;  2J0K A;  3UF8 A;  3WAN A;  1RFA A;  4BKS A;  1U4A A;  3AI5 A;  1WF9 A;  2PEA A;  3IFW B;  5E6P A;  1M94 A;  3JYU A;  4KDL B;  4M8M A;  4B6W A;  2EMS A;  5JHA A;  4HLE A;  2GBK A;  3DBH I;  1E8Y A;  1XQQ A;  1NDD A;  1XD3 B;  4EEW A;  3PHW B;  4ZRJ A;  2NS5 A;  5EDS A;  4HXD A;  2LGD A;  3B0A A;  2JZZ A;  3ZNI D;  4TQ0 A;  3PTF C;  1WJN A;  4ANV A;  2KFJ A;  1F9J A;  1GC7 A;  3A4S C;  1UH6 A;  2M8S A;  1S3S G;  1P1A A;  4K1R B;  4I6N B;  4AWJ A;  3JSV B;  4HWI B;  3VTW A;  5J17 A;  4FBJ B;  2K25 A;  4ANW A;  4F8C B;  2K8B A;  3H9D A;  3V6E B;  3WAL A;  3JSV A;  3QIJ A;  2PE6 B;  4HCP B;  3L17 A;  4JQW C;  3VUY A;  2O6V D;  2UYZ B;  2KTR B;  2G3Q B;  2LJ5 A;  2HE7 A;  2LVQ A;  3IG3 A;  1CMX B;  3ONS A;  5AZG A;  2KO3 A;  3TMP B;  3UIN B;  4ANU A;  2HJ8 A;  2KTR A;  4MGY E;  3TIX A;  4DXA B;  3RZW C;  4X57 B;  1RAX A;  1ZGU B;  4PYZ A;  3ZDM C;  2RSU A;  1L2N A;  1C1Y B;  2KAN A;  3UIP B;  2HTH A;  2MX2 A;  2N7E A;  3PGE A;  3VHT C;  5BO4 B;  1LM8 B;  2KDF B;  3VH3 B;  1Q0W B;  3NZU A;  4N9F 4;  2CHX A;  2ZNV B;  3DDC B;  5CHW A;  4W9F A;  2LVO A;  2EKE C;  3H1U A;  3JVZ X;  4A3O A;  4HK2 A;  2DZK A;  2MSE D;  2LVP A;  4WQO B;  1J19 A;  3PRP B;  4IWP A;  2M0X A;  4PYU A;  5AZF A;  3U7D A;  4PS7 A;  3M95 A;  2NVU I;  2O6V B;  4XX5 A;  2JZ3 B;  2GBJ A;  2IYD B;  2O6V A;  1V9J A; 
#chains in the Genus database with same CATH topology
 1Z5S B;  4EUT A;  3QJZ A;  2WX1 A;  1WM2 A;  2K8H A;  5EE0 A;  2LGY A;  5IAA C;  1AN8 A;  2ZVO A;  2VH1 A;  4IM3 A;  2BF8 B;  1SIF A;  1UD7 A;  2JRH A;  3IXS A;  2D5G A;  2N4F A;  3AE4 B;  3AU5 A;  3RNC C;  2LEK A;  1JRU A;  4PK1 A;  1YQ4 B;  2ZCC A;  1V5T A;  2D3G A;  1P0R A;  2NPT B;  2K39 A;  1S1Q B;  4LJP B;  2QJL A;  2QDF A;  2R2O A;  3ML8 A;  1SXT A;  5BMH A;  2J4X A;  3RFZ B;  4DBG A;  2LZ6 A;  4KV2 A;  4ZRK A;  1ESF A;  1UWM A;  1WXA A;  3H7P A;  4WJO A;  1C78 A;  1WR6 E;  4L2Y A;  1JCK B;  2QIL A;  2DLB A;  2UU7 A;  4IG7 B;  3HVZ A;  3L0W B;  2C7H A;  4XC2 A;  2K5P A;  4W9J A;  3EEC A;  4ICV A;  2V0G A;  2MJ3 A;  1CJE A;  2BBC A;  3KYD D;  3U7Z A;  3V6C B;  3GE8 C;  2V3P A;  2MBB B;  2C7N B;  4MEM A;  3VFK A;  3RPF C;  3DBH B;  2MA9 B;  2WXJ A;  2JWZ A;  1JML A;  2LUE A;  3IBE A;  1KOT A;  1TY0 A;  1WXM A;  3RT3 B;  3PZ7 A;  3VUX A;  1M4V A;  4XE0 A;  2IPK D;  4A55 A;  2J42 A;  1TS2 A;  2WXG A;  3MFG A;  1WR1 A;  3A1Q B;  4PT5 A;  4DHJ D;  5FK9 C;  1UBI A;  1EU4 A;  2A4Z A;  4HCN B;  3RZF A;  2OJR A;  2J53 A;  4GOC A;  2O2V A;  5G5H A;  4BVU C;  2RDG A;  2HD5 B;  1WH3 A;  3KUZ A;  1MPE A;  4RMA A;  2BS4 B;  3ZJV A;  4K3C A;  3APC A;  2KQ7 A;  5D3I B;  4DK5 A;  3W1S A;  3ZNG C;  2WDV B;  4TMA B;  2MRP A;  3BYY B;  1K53 A;  1E8Z A;  3PHX B;  3KQ4 A;  5AZH A;  3DHG C;  3TCA A;  1ZDX A;  3RNA C;  3RCZ A;  2M19 A;  5LXH A;  2DYO A;  4K7S A;  2LJI A;  3ZGZ A;  4KGR A;  1I4G A;  2C60 A;  1ROE A;  3HM6 X;  1T0Y A;  2L1A A;  2RPV A;  4URK A;  2LMC A;  3EGR A;  3CIR B;  4WWO A;  2H89 B;  3NY5 A;  1FNU A;  4LDT D;  3Q2A C;  3ZNH B;  2LRU A;  2KC2 A;  1JWA D;  3QWZ B;  3GP7 A;  4OVZ A;  4F1S A;  2KMA A;  5E6N A;  3ZYY X;  1TBE A;  5JZE B;  1WM3 A;  4F7Z A;  2XK5 A;  1IUE A;  2YEP B;  1DOI A;  2KMM A;  2D3C A;  3U8Z A;  4NAW A;  4IM0 A;  5DPT A;  1MHH E;  1PUT A;  1IPG A;  4IWO A;  4KSK C;  1GPX A;  3TEZ A;  1DYQ A;  1WGH A;  5D94 A;  1YD8 U;  4RF0 A;  2RPQ A;  1F77 A;  3LYY A;  2JU6 X;  4HPP A;  2IY1 B;  2OED A;  1FRD A;  3A9J A;  1JWM D;  4NQL B;  1V1O A;  1EM7 A;  4AJW A;  4RNA A;  1QZE A;  3TEW A;  5FR6 A;  1FO4 A;  4XDD A;  4ICU A;  4GLS C;  3ZKJ C;  2EEL A;  1T0S C;  1OQQ A;  1HTQ A;  4WIP A;  3ZJT A;  2GBN A;  1J7B A;  5TSS A;  3X23 A;  4FXC A;  1SE9 A;  5EE3 A;  1V80 A;  4K7W A;  2WDR B;  3HIZ A;  3X0W A;  3AE2 B;  1FXA A;  2D07 B;  2WLB A;  3R8B A;  2H88 B;  2EMT A;  3ZLZ A;  1LXD A;  2GRI A;  3PPA A;  1STE A;  4S0R A;  1V6E A;  4CYE A;  2KTF A;  2W55 A;  4US9 A;  1WIA A;  1XCQ L;  2JUO A;  3PZD A;  4RGO S;  2DZI A;  4OZB A;  1PDX A;  1T0R C;  2DZM A;  4W9E A;  2REX A;  1JWU D;  2SEB D;  4DHZ E;  1I4X A;  3TSS A;  2N9E B;  3B2G A;  1N60 A;  4G50 A;  3BVZ A;  2I1J A;  2D2Q A;  2GI9 A;  1WRD B;  2AQ1 B;  4FUL A;  2KK8 A;  5C1Z A;  5IOI A;  5HHD G;  2FCS A;  3Q8E A;  1R4N B;  4MAC A;  3FKY A;  2KT7 A;  2KVZ A;  4Q2J A;  3LDZ E;  3SR6 A;  3DHH C;  1AWD A;  2V4I B;  3MJ5 A;  4ANX A;  2BS3 B;  1XLQ A;  3R3M A;  2PLP A;  2L0F A;  2BWE S;  1WXS A;  5JH5 C;  1E7V A;  1K8R B;  3DWG C;  1CQV A;  4ZRI A;  5C23 A;  3ZTD A;  3V05 A;  3RNG C;  3OJ4 B;  3EFC A;  4PS3 A;  1SJE D;  4GMV A;  1N6Z A;  4A8X C;  1BT0 A;  3VR9 B;  3AED B;  2V4L A;  3AEF B;  4FJY A;  3PV1 A;  3WA0 A;  4USA A;  2KX3 A;  3APF A;  1C4P A;  3EUB 2;  1EO6 A;  4II3 B;  4S17 A;  3RI7 C;  4YSZ B;  1HTO A;  2MJE A;  4IC7 B;  2C5L C;  1RFA A;  1U4A A;  3AI5 A;  1WF9 A;  1GAQ B;  4WH4 A;  4M8M A;  2EMS A;  1E9M A;  2CJN A;  2JYT A;  3HRD D;  4ZRJ A;  2HJ1 A;  2LGD A;  1YQ3 B;  3B0A A;  4TQ0 A;  1I4R A;  1F9J A;  3A4S C;  1S3S G;  4K1R B;  5J17 A;  3GB1 A;  1QOA A;  3WAL A;  4RGT A;  1FCC C;  4LNI A;  2KTR B;  4ANV A;  5AZG A;  1CMX B;  2IJ0 A;  4DXA B;  4X57 B;  3ZDM C;  2RSU A;  4B0E A;  2KAN A;  2HTH A;  4OZC A;  3ABV B;  1LM8 B;  3MHZ A;  1Q0W B;  3JVZ X;  5IP4 D;  3U7D A;  1C9F A;  3AE3 B;  2O6V B;  4M00 A;  4XX5 A;  2JZ3 B;  1MG4 A;  1QLB B;  1VCB A;  1OEY J;  1GB1 A;  2ZJD A;  3AEE B;  3TL5 A;  3UQB A;  4UDU C;  1JWS D;  2WS3 B;  1V81 A;  2J52 A;  1HEZ E;  3I5J C;  1P7E A;  2JPH A;  2ONQ A;  2ZPN A;  2XBB C;  3GOE A;  1P3Q U;  3TBL D;  3KYC D;  4ITK A;  1ISN A;  2INC C;  1ZOY B;  4WWN A;  4IKG A;  2MJD A;  4W9D A;  3W5V B;  4FN2 A;  2FCN A;  3H6N A;  1AW7 A;  3QHT A;  4XDC A;  3SHQ A;  4KZC A;  4CO7 A;  3VH4 B;  1WX9 A;  5EE9 A;  2KDM A;  2LGX A;  3AE1 B;  1WYW B;  3Q3F A;  3VAW A;  2IO2 B;  5CHV C;  3ZTC A;  4GXB A;  5J18 A;  2PIA A;  3WIM A;  3ZXR A;  4EOY A;  3ZUN A;  4NQK E;  4NY0 A;  4B9K A;  2HDE A;  2BYV E;  2LD9 A;  5LLI A;  1HZ6 A;  3BVM A;  1T3Q A;  5CX3 A;  1J0G A;  3GS2 A;  1NI3 A;  2GOW A;  1GOZ A;  5IO9 A;  3SD5 A;  4LDT B;  1N63 A;  3NZS A;  4EKU A;  5BMI A;  2L00 B;  2MH7 A;  4ZRP A;  3DBL I;  4KVG B;  5HFY A;  3EFU A;  4MJS A;  1A5R A;  4EE2 A;  3EA6 A;  2N1V A;  3ZIM A;  2Z0D B;  2I1K A;  3OLM D;  4RFB A;  4JL9 A;  4GDK A;  2MLB A;  1TKE A;  5GXG B;  2W82 A;  2PE9 A;  2K6D B;  3UGB B;  5FKA C;  1UGM A;  3TJP A;  2MWS B;  3DVN V;  1R7S A;  2O2V B;  3FC4 A;  4BAX A;  1Q10 A;  2WDT B;  1OQY A;  1VDV A;  3TEX A;  4HPL B;  2XEW A;  2LWP A;  2RD0 A;  2KAJ A;  2N0S B;  2L32 A;  2NBV B;  1FNV A;  3V3X A;  3HM3 A;  4RH6 A;  1NBF C;  1EU3 A;  3BY4 B;  1E8W A;  1TY2 A;  4KX6 B;  4AS1 A;  3PRM B;  2JXT A;  1ACC A;  4HEA 1;  1PFD A;  4HDQ A;  1DGJ A;  1TT5 B;  2PVG C;  1YIW A;  1UUP A;  3N20 C;  2LFI A;  1ZUD 2;  2N7D A;  5D6J B;  1CK1 A;  5E6J A;  2N9L A;  2MBQ A;  3AEC B;  4TUU A;  1WGG A;  2BB5 A;  3MP9 A;  2WXK A;  4XWT A;  3KWV A;  2K1F A;  3QAQ A;  2V3S A;  3UIO B;  3DQV A;  3Q8A A;  3U2S C;  3KH0 A;  4N6E B;  2E3T A;  4W9L A;  2AQ3 B;  3VRB B;  5IA7 A;  4MSQ B;  4YT0 B;  2ZZP B;  1RRB A;  1LGR A;  4IUM B;  3VDZ A;  5E6O A;  1OFF A;  2XK5 B;  2L05 A;  3KLS X;  2IGD A;  4NAW B;  2KWU B;  1XLO A;  1CZP A;  1SEB D;  3L16 A;  2BTE A;  1P7F A;  1WJU A;  1EWC A;  4B0M A;  2ASQ A;  3K9O B;  3ZXV A;  2QEJ C;  2KN4 A;  2KNB A;  3B2F A;  4REZ A;  2B76 B;  3BK2 A;  3AUL A;  3NZ3 A;  3SFE B;  3GZN B;  3A9J B;  4K7U A;  1OQR A;  3DCG A;  4A6Q A;  4A9A A;  2ZW0 A;  4WJN A;  2BB6 A;  1IGD A;  4YTP B;  1YJ1 A;  3AU4 A;  4O1N A;  2MBE A;  4FHJ A;  2WYQ A;  1V49 A;  4W9H A;  2FUG 1;  2M56 B;  3DVN U;  2CKH B;  2N7J A;  3VTV A;  2JXX A;  3I57 A;  1MJD A;  2BKR B;  4E74 A;  1L7Y A;  1TS3 A;  4BOS C;  2J7Q B;  1T6B X;  2KJH B;  4NPN A;  3PZ8 A;  2NBW B;  2CHZ A;  2KVR A;  4KKJ A;  4JLC A;  4C4V A;  2I2Y A;  1J8C A;  2K0P A;  2M17 A;  1F1H A;  1XLN A;  1NI2 A;  3ZW3 A;  4N59 A;  3T3N A;  4GB9 A;  1OGW A;  1KFY B;  2W3R A;  4TKN A;  2Y5B B;  4MM3 A;  1KM7 A;  4GU2 A;  4M02 A;  2KWV B;  2JSV X;  2W3S A;  4CHK A;  2EKI A;  1JRP A;  3S2A A;  3AMZ A;  1TS5 A;  1LQB A;  3R7Q A;  2NR2 A;  3APD A;  1L6V A;  3SEB A;  3W1Y A;  1D5M C;  4MT5 A;  3WAP A;  1DOX A;  4ZRQ A;  2WX0 A;  3PLV A;  4RGM A;  2KX0 A;  2ON8 A;  1T0Q C;  1AAR A;  5D2M B;  3W5U B;  1PQS A;  2PVO D;  4W9G A;  3E56 A;  1QT9 A;  3K9P B;  1ZP0 B;  4HJK A;  2Y5C A;  3N9Y C;  3RNE C;  2QSD A;  3PSE B;  3NJT A;  2AWT A;  1T5X D;  1UEL A;  2K8C A;  1C3T A;  4W9K A;  2VH2 A;  3RYT A;  2K9X A;  3SFD B;  1KLG D;  1YX6 B;  2BYT A;  2LGI A;  1I4P A;  1D5X C;  4DQO C;  1FXI A;  2WXF A;  4P7I A;  1UNS A;  4NAM A;  1TKY A;  2XN9 C;  4PS8 A;  1C4C A;  2WXI A;  3RN9 C;  4YTM B;  2M4N A;  3QQ8 B;  2AQ2 B;  1WX7 A;  3P2B A;  2DYM A;  4HRS A;  1A70 A;  3UF8 A;  1PGX A;  3AEB B;  5E6P A;  4DXF A;  2MHJ A;  1HXY D;  4HLE A;  2GBK A;  3DBH I;  1XQQ A;  1XD3 B;  3P4R B;  1FFU A;  3PHW B;  2NS5 A;  2JZZ A;  3AN1 A;  1UH6 A;  3Q8F A;  4AWJ A;  4HWI B;  3VTW A;  1L6U A;  2K25 A;  4ANW A;  2K8B A;  4JQW C;  4ZOH C;  4C7Z A;  4XYC A;  2PKO A;  1ZGU B;  4PYZ A;  2LHD A;  3UIP B;  3PGE A;  3OWE B;  4N9F 4;  2ZNV B;  4W9F A;  2V9H A;  1UGJ A;  2DZK A;  5BYS A;  1WSP A;  1J19 A;  3PRP B;  4IWP A;  3AEA B;  3P42 A;  2W54 A;  3M95 A;  2NVU I;  1KTK A;  1UBQ A;  2INP E;  3AE9 B;  2IO1 B;  3OJ3 A;  2WU5 B;  4GIV A;  3I3T B;  4EZL A;  1VD2 A;  2DYB A;  1GUA B;  2KOX A;  1KH0 A;  4NJ7 A;  4CQN A;  5CTR C;  4LK0 M;  1SBB B;  3L13 A;  4WAA A;  2GB1 A;  1D3Z A;  2JYE A;  3D32 A;  1J7A A;  4RM8 A;  5BYR A;  3RD2 A;  2AYO B;  4HVB A;  2L8J A;  1TGZ B;  4BKT A;  1WRI A;  1X1M A;  4OVU A;  2W9N A;  3L08 A;  2KWC A;  3VQI A;  1L0Y B;  5L95 C;  2YLM A;  4KSL C;  4HPM B;  2N9X A;  2V1Y A;  2KJR A;  4P16 A;  1F0Z A;  2R2Q A;  4LTU A;  4LLG M;  2D3B A;  2K3U A;  1R4M B;  2G1E A;  1N62 A;  3V61 A;  4XGA B;  1N5X A;  4JWS C;  1WZ0 A;  1WMH A;  3TEY A;  2DAJ A;  2IY0 B;  3NVV A;  3AXC A;  2L3Z A;  5D7G A;  4MJS B;  2KD0 A;  4MDK E;  3IT4 B;  2DNF A;  1TTN A;  3NHE B;  2L76 A;  3ALB A;  3QC8 B;  2Y5P A;  4FAD A;  4AP4 C;  4A3P A;  4C56 C;  3ENE A;  2ZEQ A;  3ZO5 B;  1GNU A;  3Q14 C;  1WFY A;  4GDK B;  1YJI A;  3LJ3 A;  3HHM A;  3R66 C;  2NTT A;  4C80 A;  1WE7 A;  3O65 B;  5L83 A;  5DPW A;  2G45 B;  3DOW A;  3UQA A;  4JGH B;  4KGT A;  2IO3 B;  2LXA A;  2WXN A;  1EF1 A;  2X8X X;  2JVC A;  2VZK D;  1UF0 A;  4OVV A;  3VR8 B;  3VVW B;  1WJ4 A;  2OJW A;  1AYF A;  2ACZ B;  2ZPY A;  4BKG A;  2KN5 A;  1YJJ A;  2WWZ A;  2WXP A;  4KDI C;  3ETR A;  1JRO A;  2C7M B;  2WGS A;  2BYE A;  4LNO A;  2RR9 A;  3C8Y A;  2IGG A;  2FNJ B;  5DCN A;  5JHB A;  1I4H A;  3R7R A;  3U52 E;  3FIL A;  3A9K A;  3MTN B;  4HDO A;  4FHK A;  4DHJ B;  4M8N A;  1NEK B;  3A4R A;  1SE3 A;  3KVF B;  4GDL A;  3WAO A;  4ACF A;  1FPY A;  2AL6 A;  1QOG A;  3SDL C;  3AEG B;  1R4N I;  1UWX A;  3ZRC A;  1MG8 A;  4GSW A;  1K52 A;  1TKG A;  1TZO A;  4YSY B;  4YXD B;  5G5G A;  3UI3 A;  1KLV A;  1IP9 A;  2TSS A;  3P63 A;  4J3O D;  4AOF A;  1MHX A;  4OZA A;  3M3J A;  1MFW A;  3Q8B A;  5IN7 A;  2WP9 B;  4P1C C;  1RYJ A;  3VRA B;  2MP2 A;  4M01 A;  4C00 A;  2JF5 A;  1BML C;  2JRI B;  1ZW7 A;  3C0R B;  3MC9 A;  4TSS A;  2CHW A;  3QCA A;  5DPR A;  4IW0 A;  1V1P A;  3N1Z C;  1YN5 A;  4WQM A;  3ZRF A;  1N61 A;  2LXC A;  2IBI B;  1MI0 A;  1Q1O A;  2CR5 A;  1QF6 A;  3PS6 A;  1TJE A;  2IND C;  5C2T B;  1WGR A;  5HI1 A;  1BXT A;  2JT4 B;  3MHS D;  5AUK A;  4K81 A;  5KHQ A;  3NS8 A;  3M63 B;  3DWM A;  1IBX A;  3T3O A;  1V97 A;  2UWQ A;  4XZ4 A;  4GN1 A;  2KWD A;  1WX8 A;  1YX5 B;  3RUI B;  1WGD A;  1J7C A;  3B9J A;  3PLU A;  4ZHO A;  3QX1 A;  2K22 A;  2DEN B;  3B1L X;  4RF1 A;  3HVD A;  2MCN B;  3DBR I;  2KQS A;  3PT2 B;  4C4V B;  5G55 A;  1WI0 A;  2L7R A;  4WWP A;  4BOZ B;  2BS2 B;  2FBW B;  4YTN B;  4MM3 B;  4KIK A;  4ZYN A;  2JX5 A;  3KUC B;  3URY A;  4KGS A;  3KW5 B;  1GC6 A;  1TZ1 A;  3I63 C;  4P6V F;  3NOB A;  2MQJ A;  1EF5 A;  2OOB B;  2VRR B;  3RMK C;  3ZDT A;  1XT9 B;  3QK0 A;  1YQB A;  4KZ0 A;  4QAY A;  2RDH A;  4EZJ A;  2GBM A;  1SJH D;  3HUI A;  2CS4 A;  2FCM A;  3AE5 B;  1L4Z B;  2KC1 A;  2PW9 A;  4HJG E;  2G9H D;  5T8I A;  4E3C A;  2WNM A;  4AUQ C;  5IKC M;  1ZE3 D;  2INN E;  3WAM A;  1Q5W B;  4JIO U;  3JW0 X;  4DXG A;  3LB8 C;  1L0X B;  2FID A;  1HQR D;  2WXM A;  1SGH A;  1SE4 A;  1Z2M A;  2BQQ A;  5H8Y E;  1EUV B;  1VRA B;  3FAH A;  1XEE A;  3IT6 B;  4G3X B;  1RM6 C;  4M0W A;  4ZYS A;  2KKC A;  4AJY B;  3CST A;  1K50 A;  4I6L B;  4BKS D;  1KJT A;  3BYT B;  1WY8 A;  2BYF A;  3MC0 B;  1XO3 A;  4WAF A;  3B08 A;  2ICI A;  4WJQ A;  2KDB A;  3L54 A;  4K3B A;  2DAF A;  3EC8 A;  2KFK A;  1ZDV A;  1WWT A;  2FUH B;  1FM0 D;  2GMI C;  3W9C B;  1V2Y A;  2BWF A;  2J0K A;  3WAN A;  2PEA A;  3IFW B;  1M94 A;  3AV8 A;  1ET6 A;  1D5Z C;  1E8Y A;  1E0Z A;  3R2I A;  4JPS A;  4EEW A;  1NVI D;  1PYW D;  5EDS A;  4HXD A;  4US8 A;  1VZ6 A;  4JX1 C;  1I4Q A;  2M8S A;  1P1A A;  4I6N B;  4FBJ B;  1QOF A;  3JSV A;  4HCP B;  2PE6 B;  3P4Q B;  3VUY A;  1Y56 A;  2O6V D;  2UYZ B;  2LVQ A;  3TMP B;  3UIN B;  2HJ8 A;  3TIX A;  3DHI C;  3RZW C;  3O13 A;  1L2N A;  1C1Y B;  1DOY A;  1E7P B;  2MX2 A;  2HTM E;  2N7E A;  2V3N A;  4MH8 A;  2KDF B;  2L52 A;  3VH3 B;  5CHW A;  4HK2 A;  1F2R I;  2MSE D;  2LVP A;  5AZF A;  2M0X A;  3MC8 A;  1B9R A;  4PS7 A;  2RMM A;  4WWM A;  2GBJ A;  1I7H A;  4IOI E;  4XWW A;  1V9J A;  1YOV B;  4FJV B;  2VZK B;  1ZKH A;  1FRR A;  5CHF A;  5GMV A;  4JE3 B;  2QMT A;  1D6E C;  2DZJ A;  4RGN A;  4ZHP A;  2YEP F;  3IAS 1;  3RNB C;  3RUL A;  5TR5 A;  1VZ8 A;  2FCQ A;  2LUM A;  2WQY B;  1N5W A;  3BVG A;  1GG3 A;  2KDE B;  3OG5 A;  2BGF A;  1E8X A;  2D11 A;  3NS1 A;  2D3A A;  4C7Y A;  1FXT B;  2NPT A;  1TIF A;  5LNK 1;  4A90 A;  1QIL A;  3CSF A;  2DHZ A;  2LGS A;  2PMV A;  4NJ6 A;  3W1S C;  2DBY A;  5BMG A;  1NEN B;  1F2R C;  1VZ7 A;  3IAM 1;  3NG0 A;  2GBR A;  3HK0 A;  4NNJ B;  1C4A A;  2MBH A;  2BPS A;  3AE6 B;  5JXV A;  3Q69 A;  1NYQ A;  3DVG X;  4IDI A;  1ET9 A;  3AE7 B;  1WMH B;  2R61 A;  1BUI C;  1FEH A;  3DPD A;  4MH0 E;  1XXG A;  3V60 A;  1VLB A;  3GZN I;  1K51 A;  3BZD B;  3N3K B;  4HKZ E;  3PO0 A;  3U30 A;  2BVC A;  2KLC A;  3BWU D;  2GLS A;  4FA6 A;  2X38 A;  1V5O A;  2I38 A;  4HKQ A;  1SB3 C;  2AEH A;  4B95 A;  3DVG Y;  1RFK A;  4N58 A;  4ARI A;  1FCL A;  2OHF A;  4G11 A;  3NVY A;  2JZP A;  1VJK A;  3AH7 A;  4BBN F;  3P1M A;  4RM9 A;  2QHO A;  5I4D A;  1P9D U;  4MGK E;  4FLH A;  1PGA A;  2YVC A;  3CMM B;  3W2D A;  2L83 A;  2KMC A;  5BYQ A;  3Q8C A;  1D4B A;  2MEK A;  1SIJ A;  3A1Q A;  2FIF A;  3Q3J A;  2JY6 A;  1I35 A;  2RDB C;  1H8C A;  1P98 A;  1L5P A;  2LHE A;  2WU2 B;  2IGH A;  3BIN A;  3V62 A;  3C19 A;  3BK1 A;  2FAZ A;  4WUR A;  3PRZ A;  3LXF A;  3PRE A;  3FIL B;  3A9K B;  3Q3O C;  3Q3M C;  2QIE B;  2L0T A;  3QAR A;  3PVL A;  4GGQ A;  4GDL B;  3ML9 A;  3R2T A;  1GB4 A;  2NCN A;  2WXQ A;  2KJ6 A;  4G0N B;  4DDI D;  4MSM B;  3M62 B;  4YWG G;  1XLP A;  5J2R A;  3BII D;  2M0A A;  1SE2 A;  1VR9 A;  3U4E G;  5HG2 A;  1LFD A;  3A33 B;  1XF5 L;  2K6Q A;  4DHZ B;  1ENF A;  1QQR A;  4H2A A;  3CF6 E;  4OHJ A;  2KZR A;  1YN4 A;  4NZL B;  2LRW A;  1WJ6 A;  4LCD E;  1SF0 A;  3H7S A;  1WGY A;  2MP2 B;  4W9C A;  5EE1 A;  1JW9 D;  2WHI A;  3OAW A;  4LJO B;  2WXH A;  1FNW A;  1WXQ A;  3H8H A;  1E6E B;  3P4S B;  2FE8 A;  2ZCB A;  2AL3 A;  1C77 A;  2N9K A;  3WCQ A;  2CU3 A;  1UZX B;  2DX5 B;  1V1P B;  1ZXH A;  4W9I A;  1PGB A;  1FIQ A;  2PJH A;  2B3A A;  2Z59 B;  4E71 A;  2C9W B;  3T8M A;  5MPO A;  3CWI A;  2NMQ A;  2WXR A;  4ASW C;  2KAC A;  1E90 A;  1ZXI A;  4TQ1 A;  1GJZ A;  4EZK A;  4A20 A;  2G4S A;  3ZVV A;  1FD6 A;  1KRH A;  4JWU C;  3KWL A;  3QA8 A;  3ZJU A;  3NVZ A;  2AX5 A;  2NTS A;  4LNN A;  2LAS A;  3IVF A;  4NJC A;  2WXL A;  1IBX B;  3DBL B;  1YMH E;  2QC8 A;  3EHV A;  2D10 A;  3N1Y C;  2KXJ A;  2WXO A;  5AUI A;  1E7U A;  3AE8 B;  2A5U A;  5KHO A;  2IO0 B;  1C76 A;  3L10 B;  1E5W A;  5HKH A;  1NYR A;  1YN3 A;  5H92 C;  1E10 A;  1KF6 B;  3E9S A;  5LXI B;  4TV3 A;  4ZDV A;  1XCT L;  3I9V 1;  4MEL A;  1B1Z A;  3KUD B;  3P4P B;  2XNA C;  1I42 A;  2RGF A;  3DBR B;  4DDG D;  4KIK B;  2Z8L A;  3N32 A;  4BZA A;  1WYG A;  2KLG A;  1MVK A;  2PTL A;  2QCZ A;  3Q6B A;  1H4R A;  2LI5 A;  1V86 A;  1WXV A;  1Y8R C;  3GE3 C;  3N1X C;  4P1B C;  1TS4 A;  4AQ7 A;  4MGZ E;  4LNK A;  2N9P C;  1RWS A;  1WGK A;  2JWU A;  2IZV B;  5G2N A;  1WE6 A;  1RLF A;  2N1W A;  5DPS A;  3VXW A;  2MW5 A;  1G6J A;  2WDQ B;  4J6I A;  1OTR B;  5D3D A;  4MGI E;  1IYF A;  1KLU D;  3VUW A;  1WZ3 A;  1IGC A;  2KHW B;  4WJP A;  1JAL A;  1OEY A;  1FFV A;  4BFR A;  1HA5 A;  5AEK B;  3ECI A;  3N30 A;  2PPH A;  1F52 A;  1V8C A;  1L0V B;  3VTU A;  4M0W B;  2SAK A;  2G4D B;  2Z0E B;  3MJW A;  2JQR B;  2ZVN A;  4L1B A;  1ZPS A;  4FJZ A;  1HE8 A;  4HRO A;  2ZNV C;  4YSX B;  3IHP C;  2E6X A;  4BBN C;  2CU1 A;  3SU8 X;  1QKZ A;  2NBU A;  4EFO A;  3H7P B;  2MBO A;  4DWF A;  4LNF A;  1R4M I;  2BKF A;  3ZQ4 A;  4IM2 A;  2KFK B;  2DWQ A;  1JWB D;  4I6P A;  4II2 B;  3NUH B;  4IWQ A;  1JQ4 A;  3ZNZ B;  2M1M A;  4YL8 A;  2J0J A;  2KDI A;  3DBS A;  4RCO A;  3T9L A;  2J0M A;  3L4P A;  3NVW A;  4L23 A;  4BKS A;  3JYU A;  4KDL B;  4B6W A;  4ARC A;  3J9C A;  3Q3N C;  5JHA A;  1NDD A;  4D2K A;  2BW2 A;  4KKI A;  1TYG B;  3ZNI D;  1FMA D;  3PTF C;  1WJN A;  5FR3 A;  2KFJ A;  1GC7 A;  2CJO A;  2Y3A A;  3JSV B;  2IDY A;  1LO5 D;  4F8C B;  3H9D A;  1EWY C;  2KQ4 X;  3QIJ A;  3V6E B;  3L17 A;  3IG3 A;  2G3Q B;  2LJ5 A;  2HE7 A;  3ONS A;  1QOB A;  4ANU A;  2KO3 A;  2KTR A;  4MGY E;  4R3D A;  3AB5 A;  1RAX A;  1HZ5 A;  2ZW1 A;  2KYW A;  3VHT C;  3NRZ A;  1C79 A;  5BO4 B;  1L4D B;  1SSN A;  3NZU A;  2CHX A;  3DDC B;  2LVO A;  2EKE C;  3H1U A;  4OW0 A;  4A3O A;  5C3J B;  4WQO B;  2BT6 A;  2Q5W D;  4PYU A;  2IYD B;  2O6V A;  3RNF C;  1YNT E;  3AM9 A;  3TUO A; 
#chains in the Genus database with same CATH homology
 1Z5S B;  1UBQ A;  4EUT A;  1VCB A;  1OEY J;  2IO1 B;  3OJ3 A;  2ZJD A;  3QJZ A;  4FJV B;  2WX1 A;  1WM2 A;  2K8H A;  4GIV A;  3TL5 A;  3UQB A;  2LGY A;  1ZKH A;  5IAA C;  3I3T B;  4EZL A;  5CHF A;  1VD2 A;  2DYB A;  1GUA B;  5GMV A;  1V81 A;  2KOX A;  4NJ7 A;  2ZVO A;  4IM3 A;  2DZJ A;  5CTR C;  2JPH A;  2ZPN A;  2BF8 B;  1SIF A;  1UD7 A;  3RUL A;  2JRH A;  2XBB C;  3GOE A;  5TR5 A;  1P3Q U;  2FCQ A;  3TBL D;  3KYC D;  3L13 A;  4WAA A;  1ISN A;  1D3Z A;  3D32 A;  4RM8 A;  2N4F A;  3RD2 A;  3AU5 A;  1GG3 A;  2AYO B;  2L8J A;  1TGZ B;  4HVB A;  4WWN A;  2KDE B;  1JRU A;  4BKT A;  2BGF A;  2ZCC A;  1V5T A;  2D3G A;  1X1M A;  1E8X A;  1P0R A;  2D11 A;  4W9D A;  4FN2 A;  2FCN A;  2NPT B;  4OVU A;  2K39 A;  1S1Q B;  4LJP B;  3H6N A;  1FXT B;  2NPT A;  2W9N A;  3L08 A;  2KWC A;  3QHT A;  4KZC A;  3SHQ A;  3VH4 B;  3VQI A;  4CO7 A;  1WX9 A;  2R2O A;  3ML8 A;  3CSF A;  2LGX A;  5L95 C;  2DHZ A;  4DBG A;  2YLM A;  2LZ6 A;  1WYW B;  3Q3F A;  4KSL C;  2IO2 B;  4KV2 A;  5CHV C;  4HPM B;  4ZRK A;  4GXB A;  2N9X A;  4NJ6 A;  3VAW A;  3ZTC A;  4WJO A;  1WXA A;  2V1Y A;  3H7P A;  2KJR A;  3W1S C;  1WR6 E;  5J18 A;  2R2Q A;  3WIM A;  4EOY A;  3ZUN A;  4IG7 B;  4NQK E;  2GBR A;  3HK0 A;  4NNJ B;  4NY0 A;  4B9K A;  2MBH A;  2BPS A;  3DVG X;  3L0W B;  2C7H A;  3V61 A;  2BYV E;  4XC2 A;  1WMH B;  2LD9 A;  5LLI A;  1WZ0 A;  4W9J A;  1WMH A;  3DPD A;  5CX3 A;  4MH0 E;  1J0G A;  3EEC A;  2DAJ A;  4ICV A;  3V60 A;  3GZN I;  2GOW A;  2IY0 B;  3SD5 A;  3N3K B;  4LDT B;  3AXC A;  3NZS A;  4EKU A;  3KYD D;  3U30 A;  2L00 B;  2L3Z A;  3V6C B;  5D7G A;  2KLC A;  4MJS B;  2MBB B;  2KD0 A;  4MDK E;  2C7N B;  4MEM A;  1TTN A;  3DBL I;  3NHE B;  4KVG B;  3VFK A;  3EFU A;  4MJS A;  4FA6 A;  1V5O A;  2L76 A;  3ALB A;  1A5R A;  3QC8 B;  4FAD A;  4AP4 C;  2AEH A;  4B95 A;  4A3P A;  2MA9 B;  3DVG Y;  2JWZ A;  3ENE A;  2ZEQ A;  3ZO5 B;  1GNU A;  2N1V A;  3ZIM A;  1WFY A;  2LUE A;  2Z0D B;  3IBE A;  1KOT A;  4GDK B;  3LJ3 A;  1WXM A;  2I1K A;  3RT3 B;  3OLM D;  3HHM A;  3R66 C;  4G11 A;  4GDK A;  4JL9 A;  2MLB A;  3VUX A;  1WE7 A;  3O65 B;  5L83 A;  5DPW A;  4BBN F;  2G45 B;  3DOW A;  4RM9 A;  2QHO A;  2PE9 A;  3UQA A;  1P9D U;  4MGK E;  4JGH B;  4FLH A;  2YVC A;  3CMM B;  2K6D B;  2IO3 B;  2LXA A;  2KMC A;  1EF1 A;  3UGB B;  2JVC A;  1WR1 A;  1UGM A;  3A1Q B;  4DHJ D;  4OVV A;  3TJP A;  1UBI A;  2MWS B;  3DVN V;  2A4Z A;  4HCN B;  1WJ4 A;  3A1Q A;  3RZF A;  3VVW B;  2O2V B;  2OJR A;  2ZPY A;  2FIF A;  2KN5 A;  4GOC A;  4BKG A;  3Q3J A;  2JY6 A;  1I35 A;  2O2V A;  2WDT B;  1OQY A;  4HPL B;  2XEW A;  2LWP A;  1H8C A;  2RD0 A;  2WWZ A;  4BVU C;  1P98 A;  4KDI C;  2NBV B;  2HD5 B;  2C7M B;  1WH3 A;  3KUZ A;  3BIN A;  3HM3 A;  4RMA A;  3V62 A;  1NBF C;  2FAZ A;  2BYE A;  2RR9 A;  3BY4 B;  1E8W A;  3PRZ A;  3PRE A;  2FNJ B;  5DCN A;  3APC A;  2KQ7 A;  4DK5 A;  5JHB A;  3W1S A;  3A9K B;  3R7R A;  3ZNG C;  3PRM B;  2L0T A;  2MRP A;  3A9K A;  3MTN B;  4HDO A;  4FHK A;  3QAR A;  4HDQ A;  3PVL A;  4GGQ A;  4DHJ B;  4M8N A;  1E8Z A;  3ML9 A;  4GDL B;  3A4R A;  3PHX B;  3KVF B;  1YIW A;  2NCN A;  4GDL A;  5AZH A;  2KJ6 A;  3WAO A;  3TCA A;  4G0N B;  4DDI D;  2N7D A;  4MSM B;  2AL6 A;  3SDL C;  3RCZ A;  5D6J B;  5LXH A;  1R4N I;  3M62 B;  3ZRC A;  1MG8 A;  5J2R A;  2DYO A;  4GSW A;  2MBQ A;  4K7S A;  4TUU A;  1WGG A;  1LFD A;  3A33 B;  2K6Q A;  1KLV A;  1IP9 A;  2C60 A;  4DHZ B;  4AOF A;  2K1F A;  3CF6 E;  2V3S A;  3QAQ A;  3HM6 X;  3UIO B;  1T0Y A;  2KZR A;  3M3J A;  4URK A;  3DQV A;  2LRW A;  3KH0 A;  1WJ6 A;  4LCD E;  4W9L A;  3H7S A;  4WWO A;  5IA7 A;  3NY5 A;  1WGY A;  2MP2 B;  4W9C A;  4MSQ B;  4LDT D;  3ZNH B;  2MP2 A;  2LRU A;  2KC2 A;  2ZZP B;  3OAW A;  1RRB A;  3QWZ B;  4LJO B;  2JF5 A;  4IUM B;  3VDZ A;  4F1S A;  5E6O A;  2JRI B;  2KMA A;  2ZCB A;  2AL3 A;  1ZW7 A;  2XK5 B;  3C0R B;  5E6N A;  1TBE A;  5JZE B;  1WM3 A;  2L05 A;  4F7Z A;  1UZX B;  2DX5 B;  2XK5 A;  2CHW A;  3QCA A;  4W9I A;  5DPR A;  4IW0 A;  3U8Z A;  4NAW B;  2KWU B;  2PJH A;  2B3A A;  4NAW A;  3L16 A;  2Z59 B;  4IM0 A;  2C9W B;  3T8M A;  1WJU A;  3ZRF A;  4E71 A;  5DPT A;  4ASW C;  1E90 A;  2ASQ A;  1IPG A;  2LXC A;  3K9O B;  4IWO A;  4KSK C;  2IBI B;  4TQ1 A;  1GJZ A;  2KNB A;  4EZK A;  4A20 A;  2G4S A;  3ZVV A;  1WGH A;  3AUL A;  1Q1O A;  2CR5 A;  5D94 A;  1YD8 U;  2RPQ A;  3QA8 A;  3PS6 A;  3A9J B;  4K7U A;  2IY1 B;  3DCG A;  1WGR A;  3A9J A;  4NQL B;  2LAS A;  3IVF A;  2JT4 B;  3MHS D;  4K81 A;  4WJN A;  5KHQ A;  3NS8 A;  3M63 B;  1YJ1 A;  3AU4 A;  4AJW A;  3EHV A;  2D10 A;  2KXJ A;  2MBE A;  1E7U A;  1QZE A;  4FHJ A;  4XZ4 A;  2UWQ A;  5FR6 A;  4GN1 A;  4ICU A;  1WX8 A;  2WYQ A;  2A5U A;  3ZKJ C;  5KHO A;  1V49 A;  2IO0 B;  1YX5 B;  4W9H A;  3RUI B;  1WGD A;  3PLU A;  3L10 B;  2GBN A;  1E5W A;  3QX1 A;  3X23 A;  5HKH A;  3DVN U;  2CKH B;  1SE9 A;  1V80 A;  4K7W A;  2DEN B;  3B1L X;  3HIZ A;  3X0W A;  3VTV A;  2JXX A;  2BKR B;  2MCN B;  5LXI B;  4TV3 A;  4E74 A;  4ZDV A;  3DBR I;  1L7Y A;  4BOS C;  2D07 B;  2J7Q B;  2KQS A;  4MEL A;  3KUD B;  2KJH B;  4NPN A;  3PT2 B;  2NBW B;  5G55 A;  1WI0 A;  2CHZ A;  2L7R A;  2KVR A;  1I42 A;  2RGF A;  4JLC A;  4WWP A;  4BOZ B;  1J8C A;  2EMT A;  2M17 A;  3ZLZ A;  1LXD A;  1NI2 A;  4KIK B;  3ZW3 A;  4DDG D;  3N32 A;  4GB9 A;  1OGW A;  3PPA A;  4TKN A;  1V6E A;  4KIK A;  4CYE A;  2Y5B B;  4MM3 A;  1KM7 A;  2KLG A;  2KTF A;  4GU2 A;  4ZYN A;  1WIA A;  2JUO A;  3PZD A;  3KUC B;  2DZI A;  2KWV B;  3KW5 B;  1GC6 A;  1H4R A;  1TZ1 A;  2LI5 A;  2DZM A;  4W9E A;  2REX A;  3NOB A;  4CHK A;  2MQJ A;  1V86 A;  1WXV A;  1Y8R C;  1EF5 A;  2OOB B;  3S2A A;  4DHZ E;  2VRR B;  3ZDT A;  2N9E B;  1XT9 B;  3QK0 A;  1LQB A;  1YQB A;  4KZ0 A;  4MGZ E;  3R7Q A;  2N9P C;  4G50 A;  2NR2 A;  2I1J A;  3APD A;  4EZJ A;  2D2Q A;  2GBM A;  2IZV B;  5G2N A;  1WE6 A;  1WRD B;  2CS4 A;  1RLF A;  2FCM A;  4FUL A;  3W1Y A;  3WAP A;  2KK8 A;  5C1Z A;  2N1W A;  2WX0 A;  5DPS A;  3VXW A;  2MW5 A;  2KC1 A;  3PLV A;  2FCS A;  1G6J A;  2KX0 A;  4E3C A;  1AAR A;  4J6I A;  1OTR B;  5D2M B;  1PQS A;  4AUQ C;  3LDZ E;  4MGI E;  3WAM A;  4W9G A;  1IYF A;  3VUW A;  1WZ3 A;  1Q5W B;  4ANX A;  4JIO U;  3JW0 X;  3K9P B;  2FID A;  3R3M A;  2KHW B;  4WJP A;  1OEY A;  4HJK A;  4BFR A;  1SGH A;  5AEK B;  3ECI A;  2L0F A;  1Z2M A;  2BWE S;  3N30 A;  2PPH A;  1WXS A;  1EUV B;  3PSE B;  5JH5 C;  3VTU A;  1E7V A;  4G3X B;  2AWT A;  4M0W B;  1K8R B;  2G4D B;  1UEL A;  2K8C A;  1C3T A;  2Z0E B;  3MJW A;  4W9K A;  4ZRI A;  5C23 A;  2KKC A;  2ZVN A;  3ZTD A;  3RYT A;  3CST A;  4AJY B;  1YX6 B;  4I6L B;  3OJ4 B;  4FJZ A;  4BKS D;  4PS3 A;  1HE8 A;  1KJT A;  2ZNV C;  1WY8 A;  3IHP C;  4BBN C;  2BYF A;  2CU1 A;  4GMV A;  3SU8 X;  2NBU A;  4EFO A;  1BT0 A;  3H7P B;  2MBO A;  4P7I A;  3B08 A;  4DWF A;  2V4L A;  4WJQ A;  1R4M I;  2BKF A;  2KDB A;  3L54 A;  4FJY A;  3PV1 A;  3WA0 A;  4IM2 A;  2DAF A;  2KFK B;  3EC8 A;  4I6P A;  4II2 B;  4PS8 A;  4IWQ A;  2KX3 A;  3APF A;  2KFK A;  3ZNZ B;  2FUH B;  2M1M A;  2M4N A;  2J0J A;  2KDI A;  3QQ8 B;  4YL8 A;  1EO6 A;  2GMI C;  4II3 B;  3DBS A;  1V2Y A;  2BWF A;  3T9L A;  2J0M A;  1WX7 A;  3P2B A;  2DYM A;  4IC7 B;  2C5L C;  2J0K A;  3UF8 A;  3WAN A;  1RFA A;  4BKS A;  1U4A A;  3AI5 A;  1WF9 A;  2PEA A;  3IFW B;  5E6P A;  1M94 A;  3JYU A;  4KDL B;  4M8M A;  4B6W A;  2EMS A;  5JHA A;  4HLE A;  2GBK A;  3DBH I;  1E8Y A;  1XQQ A;  1NDD A;  1XD3 B;  4EEW A;  3PHW B;  4ZRJ A;  2NS5 A;  5EDS A;  4HXD A;  2LGD A;  3B0A A;  2JZZ A;  3ZNI D;  4TQ0 A;  3PTF C;  1WJN A;  4ANV A;  2KFJ A;  1F9J A;  1GC7 A;  3A4S C;  1UH6 A;  2M8S A;  1S3S G;  1P1A A;  4K1R B;  4I6N B;  4AWJ A;  3JSV B;  4HWI B;  3VTW A;  5J17 A;  4FBJ B;  2K25 A;  4ANW A;  4F8C B;  2K8B A;  3H9D A;  3V6E B;  3WAL A;  3JSV A;  3QIJ A;  2PE6 B;  4HCP B;  3L17 A;  4JQW C;  3VUY A;  2O6V D;  2UYZ B;  2KTR B;  2G3Q B;  2LJ5 A;  2HE7 A;  2LVQ A;  3IG3 A;  1CMX B;  3ONS A;  5AZG A;  2KO3 A;  3TMP B;  3UIN B;  4ANU A;  2HJ8 A;  2KTR A;  4MGY E;  3TIX A;  4DXA B;  3RZW C;  4X57 B;  1RAX A;  1ZGU B;  4PYZ A;  3ZDM C;  2RSU A;  1L2N A;  1C1Y B;  2KAN A;  3UIP B;  2HTH A;  2MX2 A;  2N7E A;  3PGE A;  3VHT C;  5BO4 B;  1LM8 B;  2KDF B;  3VH3 B;  1Q0W B;  3NZU A;  4N9F 4;  2CHX A;  2ZNV B;  3DDC B;  5CHW A;  4W9F A;  2LVO A;  2EKE C;  3H1U A;  3JVZ X;  4A3O A;  4HK2 A;  2DZK A;  2MSE D;  2LVP A;  4WQO B;  1J19 A;  3PRP B;  4IWP A;  2M0X A;  4PYU A;  5AZF A;  3U7D A;  4PS7 A;  3M95 A;  2NVU I;  2O6V B;  4XX5 A;  2JZ3 B;  2GBJ A;  2IYD B;  2O6V A;  1V9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...