1E7PB

Quinol:fumarate reductase from wolinella succinogenes
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
publication title A Third Crystal Form of Wolinella Succinogenes Quinol:Fumarate Reductase Reveals Domain Closure at the Site of Fumarate Reduction
pubmed doi rcsb
source organism Wolinella succinogenes
total genus 55
structure length 239
sequence length 239
chains with identical sequence E, H, K
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2000-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1e7pB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e7pB01
3L4PA 3P4RB 2LEKA 5MPOA 1V97A 1VDVA 2CU3A 3VRAB 1QOGA 4LTUA 1FO4A 2B76B 1KF6B 3AEFB 1JWBD 5EE1A 3HVZA 1WGKA 2BT6A 4JX1C 2BS2B 4US8A 1JRPA 3AM9A 1A70A 3AE7B 1GTHA 4HROA 2WU2B 1N63A 2DBYA 5EE0A 1TJEA 1N62A 2K5PA 5GXGB 2WU5B 3NRZA 3ABVB 1E9MA 1TKEA 1JROA 4WWMA 2M56B 1I7HA 1RYJA 3CF4A 2OHFA 1ROEA 1XLOA 2K22A 2M19A 3CIRB 2Q5WD 2PVGC 3DWMA 3NVZA 5AUIA 3AE5B 1JW9D 2W55A 4P6VF 2MJEA 1VJKA 5C2TB 1XLQA 4A9AA 4KX6B 1N60A 1AWDA 1N5XA 1GPXA 2W3SA 1JWAD 2WS3B 1XO3A 3ETRA 4N58A 1YJIA 1RFKA 1QF6A 2MJ3A 4US9A 3W5VB 4YSZB 1FRRA 1ZUD2 2WDVB 4USAA 3LB8C 3AEBB 1UWMA 1SB3C 3NVVA 5G5GA 1WXQA 2WDRB 1T3QA 4HRSA 1H7WA 5AUKA 1E7PB 3SR6A 2WLBA 3W5UB 2WP9B 2QIEB 4ITKA 1GTEA 1PFDA 3AB5A 2H89B 2KAJA 4N59A 2MH7A 3W9CB 4YT0B 3FAHA 3VRBB 2CJNA 3EUB2 1DOXA 1FXIA 3VR8B 1CJEA 1NVID 3AV8A 1YQ3B 1QOFA 1ZXIA 2G1EA 1J7BA 1WWTA 4YXDB 4IDIA 4YTPB 3CWIA 1JQ4A 1FXAA 4ZHOA 1FMAD 1SIJA 3HUIA 1E6EB 1SF0A 1H7XA 3AE6B 3SFEB 4C7YA 2MJDA 1XLPA 1OFFA 1PDXA 2QJLA 1KRHA 2KMMA 3AE2B 2E3TA 1FRDA 3P1MA 1GAQB 4ZOHC 2PIAA 1NYRA 1WYGA 1B9RA 4YTMB 1QT9A 1V8CA 2K9XA 4WQMA 1KFYB 2BS3B 5EE3A 3LXFA 1R7SA 1GT8A 3WCQA 2BS4B 3AE8B 3AEGB 1NI3A 3NVWA 1TKYA 1CZPA 2FBWB 1QLBB 1VLBA 3AMZA 4N6EB 3P4PB 2CJOA 5C3JB 4JWSC 4YSXB 4JWUC 4C7ZA 2N0SB 2WDQB 5G5HA 5H92C 1OQRA 1WRIA 2Y5CA 1DOIA 3B9JA 1L6UA 1NENB 1PUTA 3AEEB 2ACZB 2DWQA 3NS1A 3AEDB 2PKOA 1FFVA 5H8YE 4C80A 1E0ZA 1YQ4B 1EWYC 3NVYA 1TYGB 1RWSA 1AYFA 3AN1A 4FXCA 3AE3B 3P4QB 2AX5A 1OQQA 5EE9A 1IUEA 1L5PA 3AE4B 1J7CA 1L6VA 2W54A 2W3RA 2WQYB 3SFDB 1RM6C 1E10A 1DGJA 3P63A 3AH7A 3B2FA 1DOYA 4YSYB 3AE1B 3P4SB 1NEKB 3AECB 4ZHPA 1JALA 1TKGA 1XLNA 2EKIA 1FM0D 1ZP0B 1QOAA 2H88B 2L52A 3AE9B 3FC4A 1QOBA 3PO0A 3BIID 1F0ZA 2L83A 3HRDD 3KWLA 1NYQA 2JX5A 3RPFC 2PVOD 1YJJA 3VR9B 1L0VB 1FFUA 1FIQA 3ZYYX 3B2GA 1ZOYB 3DWGC 3AEAB 4YTNB 1N61A 2JQRB 1J7AA 2HTME 1N5WA
chains in the Genus database with same CATH superfamily
4OVUA 4ZYSA 3MC8A 2X8XX 2PTLA 2QC8A 2L0FA 2D3CA 2ZNVB 1A70A 4IKGA 4KZCA 2WU2B 3JW0X 4GOCA 5GXGB 3V6EB 2KNBA 4RF1A 2KFKB 5TSSA 3MTNB 2MCNB 3Q2AC 4P6VF 3GOEA 5C2TB 2N7EA 3QHTA 1WM3A 2D10A 2SEBD 2I38A 4MSMB 3Q6BA 4YSZB 2MW5A 5C23A 3GS2A 3PT2B 5DCNA 4W9HA 2MP2B 5JHBA 4R3DA 2KWUB 2O6VB 3I63C 2GBRA 2LZ6A 1WYWB 3U30A 3W1YA 1P9DU 4N59A 3W9CB 3FAHA 1JCKB 3B0AA 3JYUA 2MBHA 3CWIA 1I4RA 4LJPB 4WJQA 2FUG1 1IBXB 3QQ8B 4GB9A 4WWOA 3M95A 3HUIA 1H7XA 2JZPA 2MJDA 2QJLA 1KRHA 4EOYA 4EZLA 5FR3A 5HG2A 3MJ5A 4WQOB 2DZJA 1GT8A 1RRBA 2M0XA 3O13A 4TQ0A 1TKYA 1WFYA 2KJRA 3H7SA 2MBEA 3J9CA 3BK2A 2N0SB 2WDQB 5G5HA 3VTWA 1WRIA 1FNUA 2N9PC 4FHJA 4DK5A 4C80A 3AEDB 5H8YE 1K52A 4L23A 2BB5A 2FCQA 2NMQA 2Y5BB 5T8IA 4OHJA 2CR5A 2LMCA 2Z59B 4LDTB 3PSEB 4TV3A 2IY1B 4YSYB 2IO2B 1IGDA 1K50A 2DENB 4IWPA 3W1SC 2MHJA 1UWXA 2ZVOA 2G9HD 3GB1A 4G3XB 4GDKB 2FCNA 3RMKC 5E6PA 5BYQA 5LNK1 1NDDA 2KDBA 2L0TA 2N1VA 3AXCA 3IXSA 4FJVB 2NTTA 1VRAB 2KACA 2LGXA 3BVGA 2M19A 1V1PB 2WS3B 2JPHA 1RFKA 2PE6B 2V9HA 1FRRA 5D94A 2AQ1B 2L1AA 3UQBA 5KHQA 4DHZE 3MP9A 3T3OA 1MJDA 2IO0B 3O65B 2QIEB 3Q3OC 3N32A 2CJNA 2N9KA 2AEHA 2O2VA 5G2NA 1WWTA 3L10B 1ZGUB 3BWUD 1L4DB 1SIJA 3NZUA 2FUHB 5JXVA 3VHTC 1V8CA 4DDGD 3NVWA 5BYRA 3EFCA 4NZLB 4N6EB 4ACFA 1MVKA 1T0SC 1NENB 5BMIA 2YEPF 1EWYC 1VZ7A 2FIFA 4II2B 2WXHA 4A20A 1TT5B 3V61A 3I3TB 4DXAB 2D3AA 3V62A 4NQKE 3GE3C 1K53A 1HXYD 4GMVA 4YL8A 1L7YA 2RDGA 3Q8FA 4A8XC 2ASQA 1WF9A 5AZGA 1WM2A 2KC1A 4XZ4A 4IM2A 3NJTA 2JZZA 2K1FA 2CU3A 1HA5A 4WWPA 1JWBD 2VH2A 1M4VA 2I2YA 4AJYB 2BT6A 2LASA 4QAYA 3OJ3A 2K5PA 1MG4A 4MGYE 3LJ3A 4FJYA 1BXTA 1ZKHA 1T0QC 2JY6A 2LJ5A 3ZXVA 1ET9A 1M94A 2MQJA 3W5VB 5D6JB 4B0EA 3N1YC 3K9OB 4JIOU 3H7PA 4WH4A 4M8MA 4ICUA 1UBIA 4MEMA 1P1AA 2V3SA 3E9SA 3UIOB 2UWQA 2HD5B 1FD6A 2K39A 3A9JA 4XX5A 1EM7A 1IGCA 1SE9A 3KUZA 3TCAA 3RNBC 4FHKA 3ZKJC 2TSSA 1I35A 4LNOA 1YX5B 2K6QA 1WYGA 3QK0A 2KFKA 3HM3A 5EE3A 4FN2A 2KN4A 1HZ5A 5CHWA 3VQIA 1EU4A 3DCGA 1MFWA 4JLCA 4MGZE 1E0ZA 3AE3B 3DBHB 2LVOA 2MP2A 2FCSA 1TY0A 2ZCCA 1S1QB 1DOYA 5AZFA 4ZHPA 4C4VB 2ON8A 4DDID 5IP4D 2GB1A 3BIID 3L08A 1IBXA 4KDLB 2WXRA 1FIQA 3BVMA 3AEAB 3ZNGC 3DHIC 3GZNB 2JYEA 4IM0A 4LTUA 4BKGA 1KTKA 4GGQA 1P7FA 1OGWA 2KO3A 4DBGA 1ISNA 1V2YA 4GN1A 1XXGA 1E5WA 2LVQA 1VCBA 2FIDA 2REXA 2K25A 3RNGC 2AQ3B 2HE7A 2WGSA 3L54A 4WAFA 4AUQC 1AWDA 1E8ZA 4PYUA 3PHXB 3ZXRA 4I6LB 3IBEA 1UF0A 1BMLC 2BW2A 3MFGA 1WXMA 2MBBB 1GUAB 3SD5A 1L0XB 1FXIA 4MT5A 4B95A 3VR8B 3LDZE 4XWTA 2N1WA 3TIXA 2NCNA 4CO7A 3UINB 2KMMA 1FRDA 5D7GA 3EA6A 2UU7A 1B9RA 1BT0A 5BMHA 3MHZA 3UI3A 1KFYB 2BS3B 2N9LA 3LXFA 3EGRA 2BS4B 1CZPA 1V1PA 1V86A 2CJOA 1WXSA 2KLGA 3T3NA 1L6UA 3AEEB 3PRMB 3NVYA 1RWSA 3RZWC 1OQQA 1R4MI 4JPSA 4RGMA 2KMAA 2J52A 4C00A 3WA0A 1GNUA 2KDEB 4DQOC 2PVOD 4BBNC 4DHJD 1TTNA 1MHHE 3ZYYX 3IVFA 3VDZA 2WX1A 4NAMA 2KFJA 2RSUA 3VRAB 4RFBA 4IW0A 2NBUA 2AWTA 4K7WA 2IGGA 3AM9A 1P7EA 5D3DA 3DDCB 5FKAC 1I7HA 3CMMB 1ROEA 2Q5WD 4ZRKA 2LVPA 5IO9A 3DBLB 3I5JC 4JGHB 3RNFC 3NHEB 3NG0A 3U7ZA 4EZKA 1GPXA 3A4RA 1JWAD 1WJNA 2KK8A 3RNAC 3HM6X 2C7NB 1V5TA 2JWUA 4HXDA 1SIFA 2BGFA 3KYCD 2RD0A 2KAJA 1LXDA 3VH3B 1UELA 5D2MB 1C79A 4HJGE 1PDXA 4IWQA 1YX6B 2K0PA 3AE2B 1ZW7A 2JRIB 3VUWA 1NBFC 2AQ2B 4IM3A 4KGSA 1WJUA 4BKTA 2LXCA 1JWSD 2YEPB 1WH3A 2Y5CA 2DWQA 2PKOA 3PRZA 2DZKA 1TYGB 1NI2A 2IO3B 3WAPA 2W54A 4AOFA 1ZXHA 1DGJA 4KDIC 4JL9A 3P4SB 2QDFA 4XDDA 4HJKA 1MI0A 2JT4B 1ZP0B 3M62B 2KVRA 2RDHA 3DWGC 1U4AA 1WGDA 1EUVB 2MSED 4MDKE 2LWPA 2WXMA 4PYZA 5LLIA 2CHXA 4MSQB 1FNVA 3R8BA 5AUIA 4A90A 1VJKA 1N60A 2GBJA 2ZW1A 1JRUA 2NPTA 1XO3A 2QMTA 3KW5B 1QF6A 2QCZA 4P16A 3PGEA 2L7RA 3QC8B 2AYOB 1T3QA 2NVUI 2PE9A 4C4VA 1Q10A 4MM3B 4HPLB 3U2SC 4AQ7A 1Q0WB 3AB5A 1Q5WB 3EC8A 2KLCA 1SXTA 1NVID 1TZOA 4O1NA 2CS4A 1V1OA 4M00A 3V05A 2MLBA 4FBJB 4EUTA 3OG5A 1ESFA 5EDSA 3ZJTA 1BUIC 3MC0B 4RNAA 4ZRPA 2PW9A 2LUMA 3HK0A 2LGYA 2K9XA 5IN7A 1D5XC 4A3PA 4HPPA 3BYYB 5IKCM 1J8CA 3IAS1 2AL3A 3MC9A 1MPEA 1YN5A 4MH0E 4PS3A 5EE9A 1WXVA 1XD3B 1F1HA 3SFDB 1PGXA 2IBIB 2HJ8A 2BBCA 3AE1B 2VRRB 1IYFA 1JALA 1TKGA 3R66C 2O6VD 2INPE 2MEKA 3FC4A 2BF8B 3RPFC 1E90A 1HZ6A 3L0WB 2ZVNA 1OQYA 1SE2A 4JWUC 4W9JA 1C78A 2BYTA 1KF6B 4JX1C 4KGTA 2ZNVC 1ZPSA 1SJHD 5EE0A 1TJEA 1Z5SB 1VR9A 2WXIA 1I4GA 1GC7A 1XLOA 2KTFA 2PVGC 2J7QB 2KXJA 4W9DA 1GJZA 3D32A 2M8SA 2RMMA 2WDVB 2WXNA 1A5RA 3OJ4B 5G5GA 1WX7A 3P2BA 4DHZB 4HRSA 4MACA 2OJWA 2WP9B 1D5MC 2H89B 1R4NI 3ZJUA 4RH6A 2WHIA 3AULA 3AV8A 1YQ3B 1ZXIA 2X38A 1KOTA 1JQ4A 1CK1A 4E71A 4ZHOA 2BVCA 1OFFA 3DHHC 1L0YB 3DBSA 1E7UA 3VVWB 2SAKA 5D3IB 1WE6A 1K8RB 2IO1B 3AEGB 3APDA 5DPRA 3TBLD 1YOVB 1KLGD 2WXOA 2DAJA 3TL5A 3WAOA 1V9JA 1V6EA 3RCZA 2UYZB 3KVFB 4PS8A 3R7RA 4B9KA 1KM7A 3BZDB 2XN9C 4LNKA 2C60A 2I1KA 2H88B 5BYSA 3L13A 4BKSD 1NYQA 1CMXB 3SDLC 2M4NA 1ZOYB 1E8XA 1AN8A 1WY8A 1N61A 4K81A 4M02A 2L8JA 2K8CA 2N7DA 3L4PA 1WIAA 2IZVB 4ANVA 1FCLA 4W9FA 4US8A 1UGMA 3Q3JA 2WXLA 4KZ0A 2K8BA 3ZIMA 1GB1A 2ICIA 2L3ZA 1XLQA 4W9IA 1UGJA 2ZZPB 1TS2A 4XWWA 4S17A 3ZNHB 2M0AA 1ZDXA 2LRWA 4K1RB 3AU5A 2JYTA 4USAA 3NVVA 1K51A 2G4SA 4OZAA 1C1YB 4RCOA 2YVCA 1WI0A 1V49A 2LGIA 4ITKA 4RF0A 1EWCA 2DAFA 1WX8A 3DBRI 4MJSB 4HKQA 3ZRCA 3CF6E 4KVGB 4KIKA 1NYRA 3Q8BA 5IA7A 2MRPA 3Q8CA 2V4LA 2KT7A 3QX1A 4JWSC 4J3OD 2JRHA 3QAQA 3P42A 2FE8A 5FK9C 4ARIA 2LJIA 2WNMA 2DYBA 3KUCB 5E6OA 1Q1OA 2PMVA 1YD8U 2LD9A 3VH4B 4MM3A 1ZE3D 3FKYA 4IOIE 3APFA 2D3BA 2EMSA 4L2YA 1F0ZA 1Y8RC 2VH1A 3DVGX 5J2RA 2KOXA 1YJJA 3Q3MC 3X0WA 2WX0A 3QIJA 3TMPB 2KQ4X 4W9CA 1V97A 2PLPA 2NPTB 3TEWA 1YQBA 4AS1A 3AE7B 1H4RA 1MHXA 4HROA 4WJNA 2DBYA 1N62A 3W1SA 2WWZA 2NBVB 2K22A 3CIRB 4D2KA 1T6BX 2VZKD 3WIMA 1N6ZA 3DWMA 1WJ4A 2R2QA 3U8ZA 1G6JA 4KGRA 4WAAA 3T8MA 3T9LA 2HDEA 1UWMA 4P1CC 2ZW0A 1WXQA 3TUOA 1E7PB 2IGDA 2CHZA 3RFZB 2ZPYA 3VRBB 3EUB2 5HFYA 2KTRA 2NS5A 1EO6A 2WDTB 4HWIB 1E6EB 1SF0A 3SFEB 2LHDA 3MHSD 4AWJA 2MBOA 2XEWA 3VUXA 4GIVA 2WXKA 2FBWB 5KHOA 4LNIA 1C4CA 2IPKD 4BAXA 2G45B 2J0KA 5GMVA 5H92C 1TGZB 1DOIA 4FLHA 4MGKE 3N1ZC 2ACZB 5AZHA 1XCQL 2Z0DB 1SE3A 2RPQA 2JZ3B 2D2QA 1EF5A 1J7CA 1VD2A 1C9FA 3FILB 4OW0A 5CTRC 2J53A 3AECB 1WE7A 4AJWA 2A5UA 2EKIA 1C77A 3PO0A 4N9F4 1QOBA 5L83A 5L95C 1P0RA 2GBMA 1YJ1A 1F77A 3R2TA 3VR9B 3I57A 3N1XC 1AARA 2EKEC 4E3CA 1QOGA 3LYYA 3WAMA 3HIZA 1ACCA 4WJOA 3BINA 3NRZA 1T0YA 3Q8EA 4HPMB 3IAM1 1HTOA 4ZRQA 4DHJB 2ZJDA 2ZPNA 3PREA 2BB6A 1J0GA 3AI5A 4ANWA 1STEA 4IC7B 4MGIE 2NBWB 2BWFA 3N3KB 4BOSC 1P3QU 4IG7B 2MJ3A 4US9A 2INCC 1XT9B 3Q14C 2WDRB 1RAXA 3SR6A 2XK5B 3W5UB 1TS4A 1QILA 1GTEA 1DOXA 2INNE 1J19A 1CJEA 1QOFA 3C8YA 1Y56A 3TJPA 3UIPB 1HEZE 2KYWA 3C0RB 1P98A 2WXFA 2CU1A 4CYEA 1ZDVA 4ZRJA 4MH8A 1I42A 2PIAA 1HE8A 1F9JA 3RNCC 1SJED 1R7SA 4XE0A 1NI3A 4HCNB 1YN3A 3M63B 3P4PB 3OLMD 1FPYA 4K7UA 3KYDD 4A3OA 3RI7C 3NS1A 4P1BC 2RPVA 1WZ3A 3VXWA 1SE4A 4K3BA 3A4SC 3ZQ4A 1L5PA 3C19A 1L6VA 2W3RA 1SSNA 2YLMA 1RM6C 3V60A 4GDLA 3ML8A 2JXTA 2INDC 5DPWA 5J17A 2KJ6A 2KD0A 2DLBA 4II3B 3KWVA 1PGAA 1OEYA 4MJSA 2JXXA 1N5WA 5MPOA 2D07B 3IG3A 1WRDB 4I6NB 1FO4A 3AEFB 2N9EB 3N30A 4GLSC 2BKRB 4URKA 2W82A 2WXQA 3GP7A 2J4XA 3BK1A 1N63A 3QWZB 4TSSA 4WWMA 2V3PA 3Q3FA 2KMCA 2PJHA 4AP4C 3NVZA 1JW9D 2I1JA 2V3NA 4KX6B 1N5XA 4FADA 4RM8A 4XGAB 1KJTA 4N58A 1WSPA 1XEEA 4EE2A 4BOZB 3ECIA 3ENEA 1C4AA 3KUDB 4W9KA 4KIKB 4LNFA 2GBNA 2R2OA 5AEKB 5JHAA 1KLVA 4IDIA 3EHVA 1FXAA 4LJOB 1R4MB 4OVVA 1DYQA 1FCCC 4M01A 4L1BA 1JWMD 3K9PB 5JH5C 4KKIA 4WQMA 1SBBB 5LXHA 3V3XA 1SEBD 2GLSA 1OQRA 4ANXA 2C7MB 1I4HA 2BWES 2LGSA 1PUTA 2J42A 3L16A 1FFVA 3PLVA 2E6XA 3DOWA 2OEDA 4DXGA 4ICVA 3PZ7A 2DYMA 2V4IB 5G55A 2XNAC 4W9GA 1V5OA 1YMHE 3VTVA 4B6WA 1QOAA 2JSVX 3AE9B 4F7ZA 3PV1A 2D3GA 2WXGA 1UZXB 3NUHB 3NY5A 2Z0EB 4HKZE 3B2GA 2L32A 4UDUC 4KV2A 2LEKA 3ZDTA 3VFKA 4BBNF 5DPSA 3RT3B 1XF5L 3PVLA 3ABVB 1E9MA 1WR6E 1JROA 1WR1A 1RYJA 3CSTA 2GRIA 4P7IA 3OAWA 2K3UA 5E6NA 2W55A 4A9AA 2KQSA 2KTRB 1YJIA 2K6DB 1PQSA 1KLUD 3PTFC 3ZVVA 3FILA 3IT6B 2DNFA 2KWCA 4IUMB 1H7WA 1ENFA 1WZ0A 4I6PA 1WXAA 1I4XA 4TQ1A 2RDBC 2MWSB 1PFDA 2KKCA 3AU4A 2Y5PA 3UF8A 2D11A 2PPHA 2G1EA 4YTPB 4M0WA 3NS8A 1KH0A 1UD7A 4C7YA 1V81A 4JQWC 3ZLZA 1F2RC 2E3TA 3Q69A 4ZOHC 2LI5A 3WANA 2K8HA 3QA8A 5IAAC 4LDTD 4NAWB 3RN9C 4G50A 2CHWA 2IJ0A 3NOBA 2V1YA 1L4ZB 3KLSX 3JSVB 3H9DA 3GE8C 4RGNA 4FXCA 5HI1A 1WGGA 3H6NA 1RLFA 2WQYB 2XK5A 4OVZA 1UUPA 3AH7A 4LK0M 4GSWA 4FULA 4KSKC 3VAWA 2NTSA 4TUUA 1AW7A 5C1ZA 4C56C 2J0JA 2IDYA 2JU6X 2JX5A 2MX2A 5J18A 4OZBA 3WALA 2GI9A 2MA9B 2FNJB 2DHZA 3P4RB 1VDVA 3R3MA 2G4DB 1C3TA 3RYTA 4S0RA 2B76B 3A1QB 2LUEA 2KQ7A 1WGKA 4RGTA 2BS2B 3DBHI 4JE3B 3RZFA 2GOWA 3M3JA 3E56A 2M56B 4HLEA 4NQLB 1JMLA 3A9KB 1WMHB 2C9WB 1XCTL 3VUYA 5BMGA 1C76A 2N4FA 1TBEA 3ETRA 2BQQA 2D5GA 5FR6A 3ZTDA 4E74A 2KX3A 4LLGM 2LHEA 3GZNI 1ZUD2 3AEBB 1D4BA 1WX9A 1TS5A 5IOIA 2IYDB 1UH6A 5AUKA 1FEHA 2MH7A 4NNJB 5CHFA 4GU2A 5JZEB 4H2AA 4ZDVA 1B1ZA 3ZTCA 2LRUA 3URYA 1GAQB 1QT9A 2HTHA 4PK1A 2C7HA 4NJ7A 3R7QA 2NR2A 4GDLB 3RUIB 3L17A 2JUOA 1LQBA 3ZDMC 3TSSA 3ZNZB 3H1UA 3ONSA 1VZ8A 2OOBB 4K7SA 3AN1A 4REZA 1IUEA 3DVGY 2FAZA 4XC2A 3AE4B 2JF5A 3B2FA 3PS6A 3Q3NC 2OJRA 3PPAA 3PHWB 1EF1A 4BFRA 1QQRA 1SGHA 1TS3A 2KVZA 5I4DA 3TEZA 3KH0A 2L00B 3N9YC 1TIFA 1I4PA 3PRPB 3BVZA 3QCAA 2R61A 1WGHA 3HVZA 4LCDE 2KX0A 4J6IA 1E8YA 1GTHA 4A6QA 1D5ZC 4LNNA 4NY0A 1R4NB 2OHFA 2N9XA 3X23A 3DVNV 3W2DA 4YWGG 2L76A 1S3SG 1YNTE 2BTEA 2W3SA 2LGDA 4RM9A 4HDOA 4M8NA 3ZJVA 2EMTA 3Q8AA 1ET6A 4HCPB 3UGBB 1XQQA 2VZKB 1C4PA 2KJHB 2QEJC 4HK2A 4YXDB 3DBLI 2BYFA 4TKNA 3AE6B 1WJ6A 3P1MA 2O6VA 1X1MA 4YTMB 3ZO5B 2CKHB 1LO5D 1E8WA 1UNSA 5HKHA 2QHOA 1HQRD 3AE8B 1QLBB 3AMZA 4HDQA 5LXIB 3RNEC 4W9EA 5E6JA 3B9JA 2ONQA 4A55A 2A4ZA 4ARCA 2W9NA 1YQ4B 2KC2A 5HHDG 4EZJA 2QILA 4MELA 1H8CA 4HVBA 1Z2MA 3U52E 1WGRA 1YIWA 2BYEA 2WXJA 2FCMA 1D6EC 3DVNU 3NZSA 1FM0D 2L52A 3R2IA 4WWNA 3TEYA 2Y3AA 3IHPC 1FFUA 1FNWA 3APCA 4FJZA 4F8CB 2KANA 1J7AA 2HTME 3H8HA 5EE1A 2MBQA 1FXTB 4BVUC 1JRPA 1HTQA 2DYOA 2M17A 1T0RC 1EU3A 2WU5B 3HHMA 4ANUA 4NAWA 1L2NA 4OZCA 4GDKA 1GC6A 3AE5B 3EECA 2MJEA 1PGBA 3DBRB 3JSVA 1GOZA 3BYTB 2RGFA 1V80A 3A33B 4M0WB 4FA6A 1UBQA 2DZMA 1QZEA 1CQVA 2KHWB 4NJCA 2IY0B 2LXAA 3OWEB 2PEAA 1LGRA 2WLBA 1I4QA 5TR5A 4G0NB 4YT0B 1IP9A 2G3QB 3N20C 3ZW3A 2XBBC 4RGOS 4X57B 2KDIA 3EFUA 3A1QA 1PYWD 2BKFA 3V6CB 4XYCA 2KWVB 3IT4B 1WGYA 2GMIC 1TZ1A 2N7JA 5DPTA 1QKZA 4BKSA 2J0MA 4WURA 3CSFA 3SU8X 3A9KA 1WMHA 5CHVC 3HVDA 5C3JB 5CX3A 4YSXB 3VTUA 4C7ZA 3I9V1 1LFDA 1D3ZA 3U4EG 2LFIA 1VZ6A 1OEYJ 3P4QB 4EKUA 4IWOA 4KSLC 2EELA 2WXPA 3DPDA 3P63A 1F2RI 3U7DA 1OTRB 3ZUNA 1NEKB 1XLNA 2DZIA 4EFOA 2BYVE 2L83A 3HRDD 3KQ4A 4HEA1 3B1LX 4PT5A 2JQRB 2O2VB 3ZRFA 2KZRA 3QJZA 4BZAA 2IGHA 1JWUD 2JVCA 2B3AA 1IPGA 1TKEA 3CF4A 4ASWC 4B0MA 4CQNA 3QARA 1LM8B 2KN5A 4DWFA 4WJPA 3RULA 4KKJA 2ZCBA 4ZRIA 3MJWA 4K3CA 2BPSA 3LB8C 1SB3C 1YN4A 2JWZA 2ZEQA 4G11A 4WIPA 1RFAA 4DXFA 3NZ3A 3JVZX 3IFWB 2KDMA 2DX5B 2KWDA 2V0GA 1GG3A 2KDFB 3ZGZA 1J7BA 1F52A 3ALBA 1TY2A 4TMAB 3SHQA 4EEWA 2C5LC 1FMAD 3B08A 5BO4B 2Z8LA 1XLPA 3DQVA 4Q2JA 4GXBA 3SEBA 4NPNA 3ZNID 2QSDA 1MG8A 3WCQA 2RR9A 2M1MA 3RD2A 1T5XD 1VLBA 3UQAA 4XDCA 1E7VA 3BY4B 3PZDA 3PZ8A 4ZYNA 4F1SA 3S2AA 1AYFA 2AX5A 2GBKA 4CHKA 3PLUA 1GB4A 1E10A 3H7PB 3ML9A 4W9LA 4NJ6A 3DHGC 2WYQA 3TEXA 3A9JB 4RMAA 3KWLA 2L05A 1L0VB 2HJ1A 4YTNB 2AL6A 4PS7A
chains in the Genus database with same CATH topology
2KQ4X 3P4RB 1V97A 1VDVA 2PLPA 3VRAB 4RFBA 4ZYSA 3TEWA 2B76B 2PTLA 1WGKA 2IGGA 4RGTA 2BS2B 3AM9A 4AS1A 1A70A 3AE7B 4HROA 1MHXA 4IKGA 1P7EA 4JE3B 2WU2B 2DBYA 5D3DA 1N62A 5GXGB 3W1SA 4RF1A 3E56A 5FKAC 2M56B 1I7HA 1ROEA 2K22A 5TSSA 3CIRB 4D2KA 1T6BX 2Q5WD 2VZKD 3DWMA 1JMLA 4P6VF 1XCTL 5C2TB 4KGRA 3U7ZA 1GPXA 5BMGA 1JWAD 1C76A 2SEBD 3ETRA 2I38A 2D5GA 4YSZB 4LLGM 2LHEA 1ZUD2 2HDEA 3AEBB 1UWMA 1D4BA 2ZW0A 3GS2A 1TS5A 1WXQA 3TUOA 2JWUA 5AUKA 4R3DA 1E7PB 1FEHA 2IGDA 3RFZB 4N59A 2KAJA 2MH7A 3W9CB 3FAHA 3VRBB 1JCKB 3EUB2 5HFYA 4H2AA 3CWIA 1I4RA 2FUG1 1IBXB 1B1ZA 1C79A 4HJGE 3HUIA 1E6EB 1SF0A 1H7XA 3SFEB 2JZPA 2MJDA 2LHDA 1PDXA 2QJLA 2K0PA 1KRHA 3AE2B 3URYA 1GAQB 5FR3A 1QT9A 3MJ5A 5HG2A 1GT8A 4GDLB 3O13A 4TQ0A 1TKYA 2AQ2B 2WXKA 2FBWB 4KGSA 2YEPB 1JWSD 1C4CA 2IPKD 3J9CA 3TSSA 3BK2A 2N0SB 2WDQB 5G5HA 5H92C 1WRIA 1FNUA 1DOIA 2Y5CA 2DWQA 2ACZB 1VZ8A 4C80A 3AEDB 2PKOA 5H8YE 1K52A 1XCQL 1TYGB 4L23A 3AN1A 2BB5A 4REZA 1SE3A 2NMQA 1IUEA 5T8IA 3AE4B 1J7CA 2W54A 4OHJA 1C9FA 1ZXHA 1DGJA 2LMCA 3B2FA 3FILB 4YSYB 4OW0A 3P4SB 2J53A 3AECB 1IGDA 4XDDA 1K50A 1MI0A 2EKIA 1C77A 1QQRA 1ZP0B 3PO0A 1QOBA 5I4DA 1TS3A 3TEZA 1UWXA 1F77A 3N9YC 3R2TA 2G9HD 3GB1A 3VR9B 3I57A 1I4PA 2RDHA 3DWGC 4GDKB 3BVZA 2R61A 1QOGA 3LYYA 3HVZA 5BYQA 5LNK1 1GTHA 2WXMA 1D5ZC 3IXSA 4A6QA 1ACCA 2NTTA 1VRAB 2KACA 3NRZA 3BVGA 2OHFA 2M19A 3Q8EA 3IAM1 4ZRQA 1FNVA 3R8BA 5AUIA 3W2DA 1V1PB 2BB6A 4A90A 1VJKA 4YWGG 1N60A 1YNTE 2BTEA 1STEA 2ZW1A 2W3SA 2WS3B 1XO3A 2QMTA 1RFKA 3ZJVA 1QF6A 2MJ3A 4US9A 3Q8AA 1FRRA 2AQ1B 1ET6A 2L1AA 4P16A 2WDRB 1T3QA 1Q10A 3MP9A 4MM3B 3SR6A 3T3OA 3U2SC 2VZKB 3W5UB 1C4PA 4AQ7A 1TS4A 2QIEB 1QILA 1GTEA 3AB5A 1DOXA 1SXTA 2CJNA 2N9KA 2INNE 1CJEA 1NVID 1QOFA 2QEJC 3C8YA 1TZOA 1WWTA 4YXDB 4O1NA 1Y56A 1HEZE 1V1OA 3BWUD 1L4DB 3V05A 1SIJA 3AE6B 5JXVA 2WXFA 1ESFA 1ZDVA 4MH8A 3ZJTA 3P1MA 1BUIC 3MC0B 4RNAA 4ZRPA 2PW9A 2LUMA 2PIAA 4YTMB 1V8CA 2K9XA 1LO5D 1SJED 1D5XC 1R7SA 1UNSA 4XE0A 1HQRD 3NVWA 3AE8B 1NI3A 1YN3A 4NZLB 1QLBB 3AMZA 5BYRA 4N6EB 3P4PB 5E6JA 3B9JA 3BYYB 1MVKA 2ONQA 1NENB 3IAS1 4A55A 3NS1A 5BMIA 1MPEA 1YN5A 2YEPF 1YQ4B 2RPVA 4ARCA 1EWYC 1VZ7A 5HHDG 2WXHA 5EE9A 1SE4A 2QILA 3ZQ4A 1L5PA 1L6VA 2W3RA 1SSNA 3SFDB 1PGXA 1RM6C 3U52E 2BBCA 1K53A 1HXYD 2JXTA 3AE1B 2RDGA 2WXJA 1JALA 1TKGA 2INPE 1D6EC 2MEKA 3R2IA 1FM0D 2L52A 3FC4A 3Q8FA 4A8XC 2DLBA 3TEYA 3KWVA 1PGAA 2Y3AA 3RPFC 1FFUA 1HZ6A 1FNWA 1J7AA 2HTME 1SE2A 1N5WA 4JWUC 5MPOA 2CU3A 1C78A 1HA5A 3H8HA 1FO4A 2BYTA 3AEFB 1KF6B 1JWBD 5EE1A 1M4VA 2I2YA 4GLSC 2BT6A 4JX1C 4KGTA 1JRPA 1ZPSA 2DYOA 1SJHD 2W82A 2WXQA 3GP7A 2J4XA 3BK1A 1N63A 5EE0A 1TJEA 2K5PA 1EU3A 1VR9A 2WU5B 2WXIA 4TSSA 4WWMA 1I4GA 1XLOA 2V3PA 2PVGC 4OZCA 1BXTA 3NVZA 3AE5B 1JW9D 2MJEA 2V3NA 4KX6B 1PGBA 1N5XA 1GOZA 1ET9A 3BYTB 4N58A 1WSPA 1XEEA 2RMMA 3W5VB 4EE2A 4B0EA 1CQVA 2WDVB 2WXNA 4WH4A 4NJCA 3OWEB 5G5GA 1C4AA 4HRSA 4MACA 2WLBA 1I4QA 3E9SA 2WP9B 1FD6A 1D5MC 2H89B 4YT0B 1EM7A 1IGCA 3ZJUA 4RH6A 3AV8A 1YQ3B 1ZXIA 2X38A 1JQ4A 4IDIA 4RGOS 1CK1A 1FXAA 4ZHOA 1DYQA 1FCCC 1OFFA 1L0YB 1PYWD 2TSSA 4L1BA 1JWMD 3IT4B 2SAKA 2N7JA 4KKIA 1WYGA 1QKZA 4WQMA 5EE3A 5D3IB 4WURA 1SBBB 3AEGB 2KN4A 1SEBD 3HVDA 3V3XA 1HZ5A 5C3JB 4C7ZA 4YSXB 3VQIA 1EU4A 1KLGD 2WXOA 3I9V1 1OQRA 1I4HA 3U4EG 1PUTA 2J42A 1FFVA 2LFIA 1E0ZA 1VZ6A 3AE3B 3P4QB 2E6XA 2OEDA 4DXGA 2EELA 2WXPA 1TY0A 3P63A 2DYMA 1F2RI 2V4IB 3PZ7A 1DOYA 2XNAC 3BZDB 1NEKB 2XN9C 4ZHPA 2ON8A 1YMHE 1XLNA 2GB1A 1QOAA 2JSVX 2H88B 5BYSA 3AE9B 2WXGA 3BIID 3NUHB 2L83A 3HRDD 3KQ4A 4HEA1 1NYQA 1IBXA 2WXRA 4HKZE 1FIQA 3BVMA 4PT5A 3B2GA 1ZOYB 3AEAB 1AN8A 1N61A 2JQRB 2L32A 4UDUC 3L4PA 2JYEA 2LEKA 4LTUA 1FCLA 1KTKA 1P7FA 1XF5L 4US8A 2IGHA 1JWUD 2WXLA 3ABVB 1E9MA 1TKEA 1JROA 1XXGA 1RYJA 3CF4A 1GB1A 2GRIA 2ICIA 4B0MA 2AQ3B 4WAFA 2K3UA 2W55A 1XLQA 4A9AA 1UGJA 4CQNA 1AWDA 1TS2A 4XWWA 1YJIA 4KKJA 2M0AA 1ZDXA 1KLUD 4USAA 2JYTA 3LB8C 3FILA 3IT6B 1SB3C 3NVVA 1YN4A 1K51A 4OZAA 4RCOA 4WIPA 1H7WA 1BMLC 1ENFA 2BW2A 3MFGA 4DXFA 3NZ3A 1I4XA 4TQ1A 2LGIA 4ITKA 1PFDA 2KDMA 4RF0A 2KWDA 1L0XB 1FXIA 2Y5PA 4MT5A 3VR8B 1EWCA 2V0GA 2G1EA 4XWTA 3ZGZA 1J7BA 1TY2A 4TMAB 4YTPB 4M0WA 1KH0A 1FMAD 4HKQA 2Z8LA 4C7YA 1XLPA 4Q2JA 2KMMA 1F2RC 2E3TA 1FRDA 5D7GA 3EA6A 3Q69A 4ZOHC 1NYRA 1B9RA 3Q8BA 3SEBA 5BMHA 3MHZA 3UI3A 2QSDA 1KFYB 2BS3B 3Q8CA 2N9LA 3LXFA 3WCQA 3EGRA 2BS4B 1CZPA 1T5XD 1VLBA 1V1PA 2CJOA 4JWSC 4J3OD 4XDCA 4NAWB 3T3NA 1L6UA 3P42A 3PZ8A 2IJ0A 3AEEB 2FE8A 5FK9C 1L4ZB 4ARIA 3KLSX 2LJIA 3NVYA 1RWSA 5HI1A 1AYFA 4FXCA 4RGNA 2AX5A 1OQQA 2WNMA 4JPSA 4RGMA 2PMVA 2WQYB 1GB4A 1E10A 2J52A 1ZE3D 4OVZA 1UUPA 3AH7A 4IOIE 4LK0M 2NTSA 4L2YA 1AW7A 3TEXA 4C56C 4DQOC 1F0ZA 3KWLA 2IDYA 2JU6X 2JX5A 2PVOD 1YJJA 1L0VB 4OZBA 1MHHE 3ZYYX 2GI9A 4YTNB 4NAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4P A;  3P4R B;  2LEK A;  5MPO A;  1V97 A;  1VDV A;  2CU3 A;  3VRA B;  1QOG A;  4LTU A;  1FO4 A;  2B76 B;  1KF6 B;  3AEF B;  1JWB D;  5EE1 A;  3HVZ A;  1WGK A;  2BT6 A;  4JX1 C;  2BS2 B;  4US8 A;  1JRP A;  3AM9 A;  1A70 A;  3AE7 B;  1GTH A;  4HRO A;  2WU2 B;  1N63 A;  2DBY A;  5EE0 A;  1TJE A;  1N62 A;  2K5P A;  5GXG B;  2WU5 B;  3NRZ A;  3ABV B;  1E9M A;  1TKE A;  1JRO A;  4WWM A;  2M56 B;  1I7H A;  1RYJ A;  3CF4 A;  2OHF A;  1ROE A;  1XLO A;  2K22 A;  2M19 A;  3CIR B;  2Q5W D;  2PVG C;  3DWM A;  3NVZ A;  5AUI A;  3AE5 B;  1JW9 D;  2W55 A;  4P6V F;  2MJE A;  1VJK A;  5C2T B;  1XLQ A;  4A9A A;  4KX6 B;  1N60 A;  1AWD A;  1N5X A;  1GPX A;  2W3S A;  1JWA D;  2WS3 B;  1XO3 A;  3ETR A;  4N58 A;  1YJI A;  1RFK A;  1QF6 A;  2MJ3 A;  4US9 A;  3W5V B;  4YSZ B;  1FRR A;  1ZUD 2;  2WDV B;  4USA A;  3LB8 C;  3AEB B;  1UWM A;  1SB3 C;  3NVV A;  5G5G A;  1WXQ A;  2WDR B;  1T3Q A;  4HRS A;  1H7W A;  5AUK A;  1E7P B;  3SR6 A;  2WLB A;  3W5U B;  2WP9 B;  2QIE B;  4ITK A;  1GTE A;  1PFD A;  3AB5 A;  2H89 B;  2KAJ A;  4N59 A;  2MH7 A;  3W9C B;  4YT0 B;  3FAH A;  3VRB B;  2CJN A;  3EUB 2;  1DOX A;  1FXI A;  3VR8 B;  1CJE A;  1NVI D;  3AV8 A;  1YQ3 B;  1QOF A;  1ZXI A;  2G1E A;  1J7B A;  1WWT A;  4YXD B;  4IDI A;  4YTP B;  3CWI A;  1JQ4 A;  1FXA A;  4ZHO A;  1FMA D;  1SIJ A;  3HUI A;  1E6E B;  1SF0 A;  1H7X A;  3AE6 B;  3SFE B;  4C7Y A;  2MJD A;  1XLP A;  1OFF A;  1PDX A;  2QJL A;  1KRH A;  2KMM A;  3AE2 B;  2E3T A;  1FRD A;  3P1M A;  1GAQ B;  4ZOH C;  2PIA A;  1NYR A;  1WYG A;  1B9R A;  4YTM B;  1QT9 A;  1V8C A;  2K9X A;  4WQM A;  1KFY B;  2BS3 B;  5EE3 A;  3LXF A;  1R7S A;  1GT8 A;  3WCQ A;  2BS4 B;  3AE8 B;  3AEG B;  1NI3 A;  3NVW A;  1TKY A;  1CZP A;  2FBW B;  1QLB B;  1VLB A;  3AMZ A;  4N6E B;  3P4P B;  2CJO A;  5C3J B;  4JWS C;  4YSX B;  4JWU C;  4C7Z A;  2N0S B;  2WDQ B;  5G5H A;  5H92 C;  1OQR A;  1WRI A;  2Y5C A;  1DOI A;  3B9J A;  1L6U A;  1NEN B;  1PUT A;  3AEE B;  2ACZ B;  2DWQ A;  3NS1 A;  3AED B;  2PKO A;  1FFV A;  5H8Y E;  4C80 A;  1E0Z A;  1YQ4 B;  1EWY C;  3NVY A;  1TYG B;  1RWS A;  1AYF A;  3AN1 A;  4FXC A;  3AE3 B;  3P4Q B;  2AX5 A;  1OQQ A;  5EE9 A;  1IUE A;  1L5P A;  3AE4 B;  1J7C A;  1L6V A;  2W54 A;  2W3R A;  2WQY B;  3SFD B;  1RM6 C;  1E10 A;  1DGJ A;  3P63 A;  3AH7 A;  3B2F A;  1DOY A;  4YSY B;  3AE1 B;  3P4S B;  1NEK B;  3AEC B;  4ZHP A;  1JAL A;  1TKG A;  1XLN A;  2EKI A;  1FM0 D;  1ZP0 B;  1QOA A;  2H88 B;  2L52 A;  3AE9 B;  3FC4 A;  1QOB A;  3PO0 A;  3BII D;  1F0Z A;  2L83 A;  3HRD D;  3KWL A;  1NYQ A;  2JX5 A;  3RPF C;  2PVO D;  1YJJ A;  3VR9 B;  1L0V B;  1FFU A;  1FIQ A;  3ZYY X;  3B2G A;  1ZOY B;  3DWG C;  3AEA B;  4YTN B;  1N61 A;  2JQR B;  1J7A A;  2HTM E;  1N5W A; 
#chains in the Genus database with same CATH topology
 4OVU A;  4ZYS A;  3MC8 A;  2X8X X;  2PTL A;  2QC8 A;  2L0F A;  2D3C A;  2ZNV B;  1A70 A;  4IKG A;  4KZC A;  2WU2 B;  3JW0 X;  4GOC A;  5GXG B;  3V6E B;  2KNB A;  4RF1 A;  2KFK B;  5TSS A;  3MTN B;  2MCN B;  3Q2A C;  4P6V F;  3GOE A;  5C2T B;  2N7E A;  3QHT A;  1WM3 A;  2D10 A;  2SEB D;  2I38 A;  4MSM B;  3Q6B A;  4YSZ B;  2MW5 A;  5C23 A;  3GS2 A;  3PT2 B;  5DCN A;  4W9H A;  2MP2 B;  5JHB A;  4R3D A;  2KWU B;  2O6V B;  3I63 C;  2GBR A;  2LZ6 A;  1WYW B;  3U30 A;  3W1Y A;  1P9D U;  4N59 A;  3W9C B;  3FAH A;  1JCK B;  3B0A A;  3JYU A;  2MBH A;  3CWI A;  1I4R A;  4LJP B;  4WJQ A;  2FUG 1;  1IBX B;  3QQ8 B;  4GB9 A;  4WWO A;  3M95 A;  3HUI A;  1H7X A;  2JZP A;  2MJD A;  2QJL A;  1KRH A;  4EOY A;  4EZL A;  5FR3 A;  5HG2 A;  3MJ5 A;  4WQO B;  2DZJ A;  1GT8 A;  1RRB A;  2M0X A;  3O13 A;  4TQ0 A;  1TKY A;  1WFY A;  2KJR A;  3H7S A;  2MBE A;  3J9C A;  3BK2 A;  2N0S B;  2WDQ B;  5G5H A;  3VTW A;  1WRI A;  1FNU A;  2N9P C;  4FHJ A;  4DK5 A;  4C80 A;  3AED B;  5H8Y E;  1K52 A;  4L23 A;  2BB5 A;  2FCQ A;  2NMQ A;  2Y5B B;  5T8I A;  4OHJ A;  2CR5 A;  2LMC A;  2Z59 B;  4LDT B;  3PSE B;  4TV3 A;  2IY1 B;  4YSY B;  2IO2 B;  1IGD A;  1K50 A;  2DEN B;  4IWP A;  3W1S C;  2MHJ A;  1UWX A;  2ZVO A;  2G9H D;  3GB1 A;  4G3X B;  4GDK B;  2FCN A;  3RMK C;  5E6P A;  5BYQ A;  5LNK 1;  1NDD A;  2KDB A;  2L0T A;  2N1V A;  3AXC A;  3IXS A;  4FJV B;  2NTT A;  1VRA B;  2KAC A;  2LGX A;  3BVG A;  2M19 A;  1V1P B;  2WS3 B;  2JPH A;  1RFK A;  2PE6 B;  2V9H A;  1FRR A;  5D94 A;  2AQ1 B;  2L1A A;  3UQB A;  5KHQ A;  4DHZ E;  3MP9 A;  3T3O A;  1MJD A;  2IO0 B;  3O65 B;  2QIE B;  3Q3O C;  3N32 A;  2CJN A;  2N9K A;  2AEH A;  2O2V A;  5G2N A;  1WWT A;  3L10 B;  1ZGU B;  3BWU D;  1L4D B;  1SIJ A;  3NZU A;  2FUH B;  5JXV A;  3VHT C;  1V8C A;  4DDG D;  3NVW A;  5BYR A;  3EFC A;  4NZL B;  4N6E B;  4ACF A;  1MVK A;  1T0S C;  1NEN B;  5BMI A;  2YEP F;  1EWY C;  1VZ7 A;  2FIF A;  4II2 B;  2WXH A;  4A20 A;  1TT5 B;  3V61 A;  3I3T B;  4DXA B;  2D3A A;  3V62 A;  4NQK E;  3GE3 C;  1K53 A;  1HXY D;  4GMV A;  4YL8 A;  1L7Y A;  2RDG A;  3Q8F A;  4A8X C;  2ASQ A;  1WF9 A;  5AZG A;  1WM2 A;  2KC1 A;  4XZ4 A;  4IM2 A;  3NJT A;  2JZZ A;  2K1F A;  2CU3 A;  1HA5 A;  4WWP A;  1JWB D;  2VH2 A;  1M4V A;  2I2Y A;  4AJY B;  2BT6 A;  2LAS A;  4QAY A;  3OJ3 A;  2K5P A;  1MG4 A;  4MGY E;  3LJ3 A;  4FJY A;  1BXT A;  1ZKH A;  1T0Q C;  2JY6 A;  2LJ5 A;  3ZXV A;  1ET9 A;  1M94 A;  2MQJ A;  3W5V B;  5D6J B;  4B0E A;  3N1Y C;  3K9O B;  4JIO U;  3H7P A;  4WH4 A;  4M8M A;  4ICU A;  1UBI A;  4MEM A;  1P1A A;  2V3S A;  3E9S A;  3UIO B;  2UWQ A;  2HD5 B;  1FD6 A;  2K39 A;  3A9J A;  4XX5 A;  1EM7 A;  1IGC A;  1SE9 A;  3KUZ A;  3TCA A;  3RNB C;  4FHK A;  3ZKJ C;  2TSS A;  1I35 A;  4LNO A;  1YX5 B;  2K6Q A;  1WYG A;  3QK0 A;  2KFK A;  3HM3 A;  5EE3 A;  4FN2 A;  2KN4 A;  1HZ5 A;  5CHW A;  3VQI A;  1EU4 A;  3DCG A;  1MFW A;  4JLC A;  4MGZ E;  1E0Z A;  3AE3 B;  3DBH B;  2LVO A;  2MP2 A;  2FCS A;  1TY0 A;  2ZCC A;  1S1Q B;  1DOY A;  5AZF A;  4ZHP A;  4C4V B;  2ON8 A;  4DDI D;  5IP4 D;  2GB1 A;  3BII D;  3L08 A;  1IBX A;  4KDL B;  2WXR A;  1FIQ A;  3BVM A;  3AEA B;  3ZNG C;  3DHI C;  3GZN B;  2JYE A;  4IM0 A;  4LTU A;  4BKG A;  1KTK A;  4GGQ A;  1P7F A;  1OGW A;  2KO3 A;  4DBG A;  1ISN A;  1V2Y A;  4GN1 A;  1XXG A;  1E5W A;  2LVQ A;  1VCB A;  2FID A;  2REX A;  2K25 A;  3RNG C;  2AQ3 B;  2HE7 A;  2WGS A;  3L54 A;  4WAF A;  4AUQ C;  1AWD A;  1E8Z A;  4PYU A;  3PHX B;  3ZXR A;  4I6L B;  3IBE A;  1UF0 A;  1BML C;  2BW2 A;  3MFG A;  1WXM A;  2MBB B;  1GUA B;  3SD5 A;  1L0X B;  1FXI A;  4MT5 A;  4B95 A;  3VR8 B;  3LDZ E;  4XWT A;  2N1W A;  3TIX A;  2NCN A;  4CO7 A;  3UIN B;  2KMM A;  1FRD A;  5D7G A;  3EA6 A;  2UU7 A;  1B9R A;  1BT0 A;  5BMH A;  3MHZ A;  3UI3 A;  1KFY B;  2BS3 B;  2N9L A;  3LXF A;  3EGR A;  2BS4 B;  1CZP A;  1V1P A;  1V86 A;  2CJO A;  1WXS A;  2KLG A;  3T3N A;  1L6U A;  3AEE B;  3PRM B;  3NVY A;  1RWS A;  3RZW C;  1OQQ A;  1R4M I;  4JPS A;  4RGM A;  2KMA A;  2J52 A;  4C00 A;  3WA0 A;  1GNU A;  2KDE B;  4DQO C;  2PVO D;  4BBN C;  4DHJ D;  1TTN A;  1MHH E;  3ZYY X;  3IVF A;  3VDZ A;  2WX1 A;  4NAM A;  2KFJ A;  2RSU A;  3VRA B;  4RFB A;  4IW0 A;  2NBU A;  2AWT A;  4K7W A;  2IGG A;  3AM9 A;  1P7E A;  5D3D A;  3DDC B;  5FKA C;  1I7H A;  3CMM B;  1ROE A;  2Q5W D;  4ZRK A;  2LVP A;  5IO9 A;  3DBL B;  3I5J C;  4JGH B;  3RNF C;  3NHE B;  3NG0 A;  3U7Z A;  4EZK A;  1GPX A;  3A4R A;  1JWA D;  1WJN A;  2KK8 A;  3RNA C;  3HM6 X;  2C7N B;  1V5T A;  2JWU A;  4HXD A;  1SIF A;  2BGF A;  3KYC D;  2RD0 A;  2KAJ A;  1LXD A;  3VH3 B;  1UEL A;  5D2M B;  1C79 A;  4HJG E;  1PDX A;  4IWQ A;  1YX6 B;  2K0P A;  3AE2 B;  1ZW7 A;  2JRI B;  3VUW A;  1NBF C;  2AQ2 B;  4IM3 A;  4KGS A;  1WJU A;  4BKT A;  2LXC A;  1JWS D;  2YEP B;  1WH3 A;  2Y5C A;  2DWQ A;  2PKO A;  3PRZ A;  2DZK A;  1TYG B;  1NI2 A;  2IO3 B;  3WAP A;  2W54 A;  4AOF A;  1ZXH A;  1DGJ A;  4KDI C;  4JL9 A;  3P4S B;  2QDF A;  4XDD A;  4HJK A;  1MI0 A;  2JT4 B;  1ZP0 B;  3M62 B;  2KVR A;  2RDH A;  3DWG C;  1U4A A;  1WGD A;  1EUV B;  2MSE D;  4MDK E;  2LWP A;  2WXM A;  4PYZ A;  5LLI A;  2CHX A;  4MSQ B;  1FNV A;  3R8B A;  5AUI A;  4A90 A;  1VJK A;  1N60 A;  2GBJ A;  2ZW1 A;  1JRU A;  2NPT A;  1XO3 A;  2QMT A;  3KW5 B;  1QF6 A;  2QCZ A;  4P16 A;  3PGE A;  2L7R A;  3QC8 B;  2AYO B;  1T3Q A;  2NVU I;  2PE9 A;  4C4V A;  1Q10 A;  4MM3 B;  4HPL B;  3U2S C;  4AQ7 A;  1Q0W B;  3AB5 A;  1Q5W B;  3EC8 A;  2KLC A;  1SXT A;  1NVI D;  1TZO A;  4O1N A;  2CS4 A;  1V1O A;  4M00 A;  3V05 A;  2MLB A;  4FBJ B;  4EUT A;  3OG5 A;  1ESF A;  5EDS A;  3ZJT A;  1BUI C;  3MC0 B;  4RNA A;  4ZRP A;  2PW9 A;  2LUM A;  3HK0 A;  2LGY A;  2K9X A;  5IN7 A;  1D5X C;  4A3P A;  4HPP A;  3BYY B;  5IKC M;  1J8C A;  3IAS 1;  2AL3 A;  3MC9 A;  1MPE A;  1YN5 A;  4MH0 E;  4PS3 A;  5EE9 A;  1WXV A;  1XD3 B;  1F1H A;  3SFD B;  1PGX A;  2IBI B;  2HJ8 A;  2BBC A;  3AE1 B;  2VRR B;  1IYF A;  1JAL A;  1TKG A;  3R66 C;  2O6V D;  2INP E;  2MEK A;  3FC4 A;  2BF8 B;  3RPF C;  1E90 A;  1HZ6 A;  3L0W B;  2ZVN A;  1OQY A;  1SE2 A;  4JWU C;  4W9J A;  1C78 A;  2BYT A;  1KF6 B;  4JX1 C;  4KGT A;  2ZNV C;  1ZPS A;  1SJH D;  5EE0 A;  1TJE A;  1Z5S B;  1VR9 A;  2WXI A;  1I4G A;  1GC7 A;  1XLO A;  2KTF A;  2PVG C;  2J7Q B;  2KXJ A;  4W9D A;  1GJZ A;  3D32 A;  2M8S A;  2RMM A;  2WDV B;  2WXN A;  1A5R A;  3OJ4 B;  5G5G A;  1WX7 A;  3P2B A;  4DHZ B;  4HRS A;  4MAC A;  2OJW A;  2WP9 B;  1D5M C;  2H89 B;  1R4N I;  3ZJU A;  4RH6 A;  2WHI A;  3AUL A;  3AV8 A;  1YQ3 B;  1ZXI A;  2X38 A;  1KOT A;  1JQ4 A;  1CK1 A;  4E71 A;  4ZHO A;  2BVC A;  1OFF A;  3DHH C;  1L0Y B;  3DBS A;  1E7U A;  3VVW B;  2SAK A;  5D3I B;  1WE6 A;  1K8R B;  2IO1 B;  3AEG B;  3APD A;  5DPR A;  3TBL D;  1YOV B;  1KLG D;  2WXO A;  2DAJ A;  3TL5 A;  3WAO A;  1V9J A;  1V6E A;  3RCZ A;  2UYZ B;  3KVF B;  4PS8 A;  3R7R A;  4B9K A;  1KM7 A;  3BZD B;  2XN9 C;  4LNK A;  2C60 A;  2I1K A;  2H88 B;  5BYS A;  3L13 A;  4BKS D;  1NYQ A;  1CMX B;  3SDL C;  2M4N A;  1ZOY B;  1E8X A;  1AN8 A;  1WY8 A;  1N61 A;  4K81 A;  4M02 A;  2L8J A;  2K8C A;  2N7D A;  3L4P A;  1WIA A;  2IZV B;  4ANV A;  1FCL A;  4W9F A;  4US8 A;  1UGM A;  3Q3J A;  2WXL A;  4KZ0 A;  2K8B A;  3ZIM A;  1GB1 A;  2ICI A;  2L3Z A;  1XLQ A;  4W9I A;  1UGJ A;  2ZZP B;  1TS2 A;  4XWW A;  4S17 A;  3ZNH B;  2M0A A;  1ZDX A;  2LRW A;  4K1R B;  3AU5 A;  2JYT A;  4USA A;  3NVV A;  1K51 A;  2G4S A;  4OZA A;  1C1Y B;  4RCO A;  2YVC A;  1WI0 A;  1V49 A;  2LGI A;  4ITK A;  4RF0 A;  1EWC A;  2DAF A;  1WX8 A;  3DBR I;  4MJS B;  4HKQ A;  3ZRC A;  3CF6 E;  4KVG B;  4KIK A;  1NYR A;  3Q8B A;  5IA7 A;  2MRP A;  3Q8C A;  2V4L A;  2KT7 A;  3QX1 A;  4JWS C;  4J3O D;  2JRH A;  3QAQ A;  3P42 A;  2FE8 A;  5FK9 C;  4ARI A;  2LJI A;  2WNM A;  2DYB A;  3KUC B;  5E6O A;  1Q1O A;  2PMV A;  1YD8 U;  2LD9 A;  3VH4 B;  4MM3 A;  1ZE3 D;  3FKY A;  4IOI E;  3APF A;  2D3B A;  2EMS A;  4L2Y A;  1F0Z A;  1Y8R C;  2VH1 A;  3DVG X;  5J2R A;  2KOX A;  1YJJ A;  3Q3M C;  3X0W A;  2WX0 A;  3QIJ A;  3TMP B;  2KQ4 X;  4W9C A;  1V97 A;  2PLP A;  2NPT B;  3TEW A;  1YQB A;  4AS1 A;  3AE7 B;  1H4R A;  1MHX A;  4HRO A;  4WJN A;  2DBY A;  1N62 A;  3W1S A;  2WWZ A;  2NBV B;  2K22 A;  3CIR B;  4D2K A;  1T6B X;  2VZK D;  3WIM A;  1N6Z A;  3DWM A;  1WJ4 A;  2R2Q A;  3U8Z A;  1G6J A;  4KGR A;  4WAA A;  3T8M A;  3T9L A;  2HDE A;  1UWM A;  4P1C C;  2ZW0 A;  1WXQ A;  3TUO A;  1E7P B;  2IGD A;  2CHZ A;  3RFZ B;  2ZPY A;  3VRB B;  3EUB 2;  5HFY A;  2KTR A;  2NS5 A;  1EO6 A;  2WDT B;  4HWI B;  1E6E B;  1SF0 A;  3SFE B;  2LHD A;  3MHS D;  4AWJ A;  2MBO A;  2XEW A;  3VUX A;  4GIV A;  2WXK A;  2FBW B;  5KHO A;  4LNI A;  1C4C A;  2IPK D;  4BAX A;  2G45 B;  2J0K A;  5GMV A;  5H92 C;  1TGZ B;  1DOI A;  4FLH A;  4MGK E;  3N1Z C;  2ACZ B;  5AZH A;  1XCQ L;  2Z0D B;  1SE3 A;  2RPQ A;  2JZ3 B;  2D2Q A;  1EF5 A;  1J7C A;  1VD2 A;  1C9F A;  3FIL B;  4OW0 A;  5CTR C;  2J53 A;  3AEC B;  1WE7 A;  4AJW A;  2A5U A;  2EKI A;  1C77 A;  3PO0 A;  4N9F 4;  1QOB A;  5L83 A;  5L95 C;  1P0R A;  2GBM A;  1YJ1 A;  1F77 A;  3R2T A;  3VR9 B;  3I57 A;  3N1X C;  1AAR A;  2EKE C;  4E3C A;  1QOG A;  3LYY A;  3WAM A;  3HIZ A;  1ACC A;  4WJO A;  3BIN A;  3NRZ A;  1T0Y A;  3Q8E A;  4HPM B;  3IAM 1;  1HTO A;  4ZRQ A;  4DHJ B;  2ZJD A;  2ZPN A;  3PRE A;  2BB6 A;  1J0G A;  3AI5 A;  4ANW A;  1STE A;  4IC7 B;  4MGI E;  2NBW B;  2BWF A;  3N3K B;  4BOS C;  1P3Q U;  4IG7 B;  2MJ3 A;  4US9 A;  2INC C;  1XT9 B;  3Q14 C;  2WDR B;  1RAX A;  3SR6 A;  2XK5 B;  3W5U B;  1TS4 A;  1QIL A;  1GTE A;  1DOX A;  2INN E;  1J19 A;  1CJE A;  1QOF A;  3C8Y A;  1Y56 A;  3TJP A;  3UIP B;  1HEZ E;  2KYW A;  3C0R B;  1P98 A;  2WXF A;  2CU1 A;  4CYE A;  1ZDV A;  4ZRJ A;  4MH8 A;  1I42 A;  2PIA A;  1HE8 A;  1F9J A;  3RNC C;  1SJE D;  1R7S A;  4XE0 A;  1NI3 A;  4HCN B;  1YN3 A;  3M63 B;  3P4P B;  3OLM D;  1FPY A;  4K7U A;  3KYD D;  4A3O A;  3RI7 C;  3NS1 A;  4P1B C;  2RPV A;  1WZ3 A;  3VXW A;  1SE4 A;  4K3B A;  3A4S C;  3ZQ4 A;  1L5P A;  3C19 A;  1L6V A;  2W3R A;  1SSN A;  2YLM A;  1RM6 C;  3V60 A;  4GDL A;  3ML8 A;  2JXT A;  2IND C;  5DPW A;  5J17 A;  2KJ6 A;  2KD0 A;  2DLB A;  4II3 B;  3KWV A;  1PGA A;  1OEY A;  4MJS A;  2JXX A;  1N5W A;  5MPO A;  2D07 B;  3IG3 A;  1WRD B;  4I6N B;  1FO4 A;  3AEF B;  2N9E B;  3N30 A;  4GLS C;  2BKR B;  4URK A;  2W82 A;  2WXQ A;  3GP7 A;  2J4X A;  3BK1 A;  1N63 A;  3QWZ B;  4TSS A;  4WWM A;  2V3P A;  3Q3F A;  2KMC A;  2PJH A;  4AP4 C;  3NVZ A;  1JW9 D;  2I1J A;  2V3N A;  4KX6 B;  1N5X A;  4FAD A;  4RM8 A;  4XGA B;  1KJT A;  4N58 A;  1WSP A;  1XEE A;  4EE2 A;  4BOZ B;  3ECI A;  3ENE A;  1C4A A;  3KUD B;  4W9K A;  4KIK B;  4LNF A;  2GBN A;  2R2O A;  5AEK B;  5JHA A;  1KLV A;  4IDI A;  3EHV A;  1FXA A;  4LJO B;  1R4M B;  4OVV A;  1DYQ A;  1FCC C;  4M01 A;  4L1B A;  1JWM D;  3K9P B;  5JH5 C;  4KKI A;  4WQM A;  1SBB B;  5LXH A;  3V3X A;  1SEB D;  2GLS A;  1OQR A;  4ANX A;  2C7M B;  1I4H A;  2BWE S;  2LGS A;  1PUT A;  2J42 A;  3L16 A;  1FFV A;  3PLV A;  2E6X A;  3DOW A;  2OED A;  4DXG A;  4ICV A;  3PZ7 A;  2DYM A;  2V4I B;  5G55 A;  2XNA C;  4W9G A;  1V5O A;  1YMH E;  3VTV A;  4B6W A;  1QOA A;  2JSV X;  3AE9 B;  4F7Z A;  3PV1 A;  2D3G A;  2WXG A;  1UZX B;  3NUH B;  3NY5 A;  2Z0E B;  4HKZ E;  3B2G A;  2L32 A;  4UDU C;  4KV2 A;  2LEK A;  3ZDT A;  3VFK A;  4BBN F;  5DPS A;  3RT3 B;  1XF5 L;  3PVL A;  3ABV B;  1E9M A;  1WR6 E;  1JRO A;  1WR1 A;  1RYJ A;  3CST A;  2GRI A;  4P7I A;  3OAW A;  2K3U A;  5E6N A;  2W55 A;  4A9A A;  2KQS A;  2KTR B;  1YJI A;  2K6D B;  1PQS A;  1KLU D;  3PTF C;  3ZVV A;  3FIL A;  3IT6 B;  2DNF A;  2KWC A;  4IUM B;  1H7W A;  1ENF A;  1WZ0 A;  4I6P A;  1WXA A;  1I4X A;  4TQ1 A;  2RDB C;  2MWS B;  1PFD A;  2KKC A;  3AU4 A;  2Y5P A;  3UF8 A;  2D11 A;  2PPH A;  2G1E A;  4YTP B;  4M0W A;  3NS8 A;  1KH0 A;  1UD7 A;  4C7Y A;  1V81 A;  4JQW C;  3ZLZ A;  1F2R C;  2E3T A;  3Q69 A;  4ZOH C;  2LI5 A;  3WAN A;  2K8H A;  3QA8 A;  5IAA C;  4LDT D;  4NAW B;  3RN9 C;  4G50 A;  2CHW A;  2IJ0 A;  3NOB A;  2V1Y A;  1L4Z B;  3KLS X;  3JSV B;  3H9D A;  3GE8 C;  4RGN A;  4FXC A;  5HI1 A;  1WGG A;  3H6N A;  1RLF A;  2WQY B;  2XK5 A;  4OVZ A;  1UUP A;  3AH7 A;  4LK0 M;  4GSW A;  4FUL A;  4KSK C;  3VAW A;  2NTS A;  4TUU A;  1AW7 A;  5C1Z A;  4C56 C;  2J0J A;  2IDY A;  2JU6 X;  2JX5 A;  2MX2 A;  5J18 A;  4OZB A;  3WAL A;  2GI9 A;  2MA9 B;  2FNJ B;  2DHZ A;  3P4R B;  1VDV A;  3R3M A;  2G4D B;  1C3T A;  3RYT A;  4S0R A;  2B76 B;  3A1Q B;  2LUE A;  2KQ7 A;  1WGK A;  4RGT A;  2BS2 B;  3DBH I;  4JE3 B;  3RZF A;  2GOW A;  3M3J A;  3E56 A;  2M56 B;  4HLE A;  4NQL B;  1JML A;  3A9K B;  1WMH B;  2C9W B;  1XCT L;  3VUY A;  5BMG A;  1C76 A;  2N4F A;  1TBE A;  3ETR A;  2BQQ A;  2D5G A;  5FR6 A;  3ZTD A;  4E74 A;  2KX3 A;  4LLG M;  2LHE A;  3GZN I;  1ZUD 2;  3AEB B;  1D4B A;  1WX9 A;  1TS5 A;  5IOI A;  2IYD B;  1UH6 A;  5AUK A;  1FEH A;  2MH7 A;  4NNJ B;  5CHF A;  4GU2 A;  5JZE B;  4H2A A;  4ZDV A;  1B1Z A;  3ZTC A;  2LRU A;  3URY A;  1GAQ B;  1QT9 A;  2HTH A;  4PK1 A;  2C7H A;  4NJ7 A;  3R7Q A;  2NR2 A;  4GDL B;  3RUI B;  3L17 A;  2JUO A;  1LQB A;  3ZDM C;  3TSS A;  3ZNZ B;  3H1U A;  3ONS A;  1VZ8 A;  2OOB B;  4K7S A;  3AN1 A;  4REZ A;  1IUE A;  3DVG Y;  2FAZ A;  4XC2 A;  3AE4 B;  2JF5 A;  3B2F A;  3PS6 A;  3Q3N C;  2OJR A;  3PPA A;  3PHW B;  1EF1 A;  4BFR A;  1QQR A;  1SGH A;  1TS3 A;  2KVZ A;  5I4D A;  3TEZ A;  3KH0 A;  2L00 B;  3N9Y C;  1TIF A;  1I4P A;  3PRP B;  3BVZ A;  3QCA A;  2R61 A;  1WGH A;  3HVZ A;  4LCD E;  2KX0 A;  4J6I A;  1E8Y A;  1GTH A;  4A6Q A;  1D5Z C;  4LNN A;  4NY0 A;  1R4N B;  2OHF A;  2N9X A;  3X23 A;  3DVN V;  3W2D A;  4YWG G;  2L76 A;  1S3S G;  1YNT E;  2BTE A;  2W3S A;  2LGD A;  4RM9 A;  4HDO A;  4M8N A;  3ZJV A;  2EMT A;  3Q8A A;  1ET6 A;  4HCP B;  3UGB B;  1XQQ A;  2VZK B;  1C4P A;  2KJH B;  2QEJ C;  4HK2 A;  4YXD B;  3DBL I;  2BYF A;  4TKN A;  3AE6 B;  1WJ6 A;  3P1M A;  2O6V A;  1X1M A;  4YTM B;  3ZO5 B;  2CKH B;  1LO5 D;  1E8W A;  1UNS A;  5HKH A;  2QHO A;  1HQR D;  3AE8 B;  1QLB B;  3AMZ A;  4HDQ A;  5LXI B;  3RNE C;  4W9E A;  5E6J A;  3B9J A;  2ONQ A;  4A55 A;  2A4Z A;  4ARC A;  2W9N A;  1YQ4 B;  2KC2 A;  5HHD G;  4EZJ A;  2QIL A;  4MEL A;  1H8C A;  4HVB A;  1Z2M A;  3U52 E;  1WGR A;  1YIW A;  2BYE A;  2WXJ A;  2FCM A;  1D6E C;  3DVN U;  3NZS A;  1FM0 D;  2L52 A;  3R2I A;  4WWN A;  3TEY A;  2Y3A A;  3IHP C;  1FFU A;  1FNW A;  3APC A;  4FJZ A;  4F8C B;  2KAN A;  1J7A A;  2HTM E;  3H8H A;  5EE1 A;  2MBQ A;  1FXT B;  4BVU C;  1JRP A;  1HTQ A;  2DYO A;  2M17 A;  1T0R C;  1EU3 A;  2WU5 B;  3HHM A;  4ANU A;  4NAW A;  1L2N A;  4OZC A;  4GDK A;  1GC6 A;  3AE5 B;  3EEC A;  2MJE A;  1PGB A;  3DBR B;  3JSV A;  1GOZ A;  3BYT B;  2RGF A;  1V80 A;  3A33 B;  4M0W B;  4FA6 A;  1UBQ A;  2DZM A;  1QZE A;  1CQV A;  2KHW B;  4NJC A;  2IY0 B;  2LXA A;  3OWE B;  2PEA A;  1LGR A;  2WLB A;  1I4Q A;  5TR5 A;  4G0N B;  4YT0 B;  1IP9 A;  2G3Q B;  3N20 C;  3ZW3 A;  2XBB C;  4RGO S;  4X57 B;  2KDI A;  3EFU A;  3A1Q A;  1PYW D;  2BKF A;  3V6C B;  4XYC A;  2KWV B;  3IT4 B;  1WGY A;  2GMI C;  1TZ1 A;  2N7J A;  5DPT A;  1QKZ A;  4BKS A;  2J0M A;  4WUR A;  3CSF A;  3SU8 X;  3A9K A;  1WMH A;  5CHV C;  3HVD A;  5C3J B;  5CX3 A;  4YSX B;  3VTU A;  4C7Z A;  3I9V 1;  1LFD A;  1D3Z A;  3U4E G;  2LFI A;  1VZ6 A;  1OEY J;  3P4Q B;  4EKU A;  4IWO A;  4KSL C;  2EEL A;  2WXP A;  3DPD A;  3P63 A;  1F2R I;  3U7D A;  1OTR B;  3ZUN A;  1NEK B;  1XLN A;  2DZI A;  4EFO A;  2BYV E;  2L83 A;  3HRD D;  3KQ4 A;  4HEA 1;  3B1L X;  4PT5 A;  2JQR B;  2O2V B;  3ZRF A;  2KZR A;  3QJZ A;  4BZA A;  2IGH A;  1JWU D;  2JVC A;  2B3A A;  1IPG A;  1TKE A;  3CF4 A;  4ASW C;  4B0M A;  4CQN A;  3QAR A;  1LM8 B;  2KN5 A;  4DWF A;  4WJP A;  3RUL A;  4KKJ A;  2ZCB A;  4ZRI A;  3MJW A;  4K3C A;  2BPS A;  3LB8 C;  1SB3 C;  1YN4 A;  2JWZ A;  2ZEQ A;  4G11 A;  4WIP A;  1RFA A;  4DXF A;  3NZ3 A;  3JVZ X;  3IFW B;  2KDM A;  2DX5 B;  2KWD A;  2V0G A;  1GG3 A;  2KDF B;  3ZGZ A;  1J7B A;  1F52 A;  3ALB A;  1TY2 A;  4TMA B;  3SHQ A;  4EEW A;  2C5L C;  1FMA D;  3B08 A;  5BO4 B;  2Z8L A;  1XLP A;  3DQV A;  4Q2J A;  4GXB A;  3SEB A;  4NPN A;  3ZNI D;  2QSD A;  1MG8 A;  3WCQ A;  2RR9 A;  2M1M A;  3RD2 A;  1T5X D;  1VLB A;  3UQA A;  4XDC A;  1E7V A;  3BY4 B;  3PZD A;  3PZ8 A;  4ZYN A;  4F1S A;  3S2A A;  1AYF A;  2AX5 A;  2GBK A;  4CHK A;  3PLU A;  1GB4 A;  1E10 A;  3H7P B;  3ML9 A;  4W9L A;  4NJ6 A;  3DHG C;  2WYQ A;  3TEX A;  3A9J B;  4RMA A;  3KWL A;  2L05 A;  1L0V B;  2HJ1 A;  4YTN B;  2AL6 A;  4PS7 A; 
#chains in the Genus database with same CATH homology
 2KQ4 X;  3P4R B;  1V97 A;  1VDV A;  2PLP A;  3VRA B;  4RFB A;  4ZYS A;  3TEW A;  2B76 B;  2PTL A;  1WGK A;  2IGG A;  4RGT A;  2BS2 B;  3AM9 A;  4AS1 A;  1A70 A;  3AE7 B;  4HRO A;  1MHX A;  4IKG A;  1P7E A;  4JE3 B;  2WU2 B;  2DBY A;  5D3D A;  1N62 A;  5GXG B;  3W1S A;  4RF1 A;  3E56 A;  5FKA C;  2M56 B;  1I7H A;  1ROE A;  2K22 A;  5TSS A;  3CIR B;  4D2K A;  1T6B X;  2Q5W D;  2VZK D;  3DWM A;  1JML A;  4P6V F;  1XCT L;  5C2T B;  4KGR A;  3U7Z A;  1GPX A;  5BMG A;  1JWA D;  1C76 A;  2SEB D;  3ETR A;  2I38 A;  2D5G A;  4YSZ B;  4LLG M;  2LHE A;  1ZUD 2;  2HDE A;  3AEB B;  1UWM A;  1D4B A;  2ZW0 A;  3GS2 A;  1TS5 A;  1WXQ A;  3TUO A;  2JWU A;  5AUK A;  4R3D A;  1E7P B;  1FEH A;  2IGD A;  3RFZ B;  4N59 A;  2KAJ A;  2MH7 A;  3W9C B;  3FAH A;  3VRB B;  1JCK B;  3EUB 2;  5HFY A;  4H2A A;  3CWI A;  1I4R A;  2FUG 1;  1IBX B;  1B1Z A;  1C79 A;  4HJG E;  3HUI A;  1E6E B;  1SF0 A;  1H7X A;  3SFE B;  2JZP A;  2MJD A;  2LHD A;  1PDX A;  2QJL A;  2K0P A;  1KRH A;  3AE2 B;  3URY A;  1GAQ B;  5FR3 A;  1QT9 A;  3MJ5 A;  5HG2 A;  1GT8 A;  4GDL B;  3O13 A;  4TQ0 A;  1TKY A;  2AQ2 B;  2WXK A;  2FBW B;  4KGS A;  2YEP B;  1JWS D;  1C4C A;  2IPK D;  3J9C A;  3TSS A;  3BK2 A;  2N0S B;  2WDQ B;  5G5H A;  5H92 C;  1WRI A;  1FNU A;  1DOI A;  2Y5C A;  2DWQ A;  2ACZ B;  1VZ8 A;  4C80 A;  3AED B;  2PKO A;  5H8Y E;  1K52 A;  1XCQ L;  1TYG B;  4L23 A;  3AN1 A;  2BB5 A;  4REZ A;  1SE3 A;  2NMQ A;  1IUE A;  5T8I A;  3AE4 B;  1J7C A;  2W54 A;  4OHJ A;  1C9F A;  1ZXH A;  1DGJ A;  2LMC A;  3B2F A;  3FIL B;  4YSY B;  4OW0 A;  3P4S B;  2J53 A;  3AEC B;  1IGD A;  4XDD A;  1K50 A;  1MI0 A;  2EKI A;  1C77 A;  1QQR A;  1ZP0 B;  3PO0 A;  1QOB A;  5I4D A;  1TS3 A;  3TEZ A;  1UWX A;  1F77 A;  3N9Y C;  3R2T A;  2G9H D;  3GB1 A;  3VR9 B;  3I57 A;  1I4P A;  2RDH A;  3DWG C;  4GDK B;  3BVZ A;  2R61 A;  1QOG A;  3LYY A;  3HVZ A;  5BYQ A;  5LNK 1;  1GTH A;  2WXM A;  1D5Z C;  3IXS A;  4A6Q A;  1ACC A;  2NTT A;  1VRA B;  2KAC A;  3NRZ A;  3BVG A;  2OHF A;  2M19 A;  3Q8E A;  3IAM 1;  4ZRQ A;  1FNV A;  3R8B A;  5AUI A;  3W2D A;  1V1P B;  2BB6 A;  4A90 A;  1VJK A;  4YWG G;  1N60 A;  1YNT E;  2BTE A;  1STE A;  2ZW1 A;  2W3S A;  2WS3 B;  1XO3 A;  2QMT A;  1RFK A;  3ZJV A;  1QF6 A;  2MJ3 A;  4US9 A;  3Q8A A;  1FRR A;  2AQ1 B;  1ET6 A;  2L1A A;  4P16 A;  2WDR B;  1T3Q A;  1Q10 A;  3MP9 A;  4MM3 B;  3SR6 A;  3T3O A;  3U2S C;  2VZK B;  3W5U B;  1C4P A;  4AQ7 A;  1TS4 A;  2QIE B;  1QIL A;  1GTE A;  3AB5 A;  1DOX A;  1SXT A;  2CJN A;  2N9K A;  2INN E;  1CJE A;  1NVI D;  1QOF A;  2QEJ C;  3C8Y A;  1TZO A;  1WWT A;  4YXD B;  4O1N A;  1Y56 A;  1HEZ E;  1V1O A;  3BWU D;  1L4D B;  3V05 A;  1SIJ A;  3AE6 B;  5JXV A;  2WXF A;  1ESF A;  1ZDV A;  4MH8 A;  3ZJT A;  3P1M A;  1BUI C;  3MC0 B;  4RNA A;  4ZRP A;  2PW9 A;  2LUM A;  2PIA A;  4YTM B;  1V8C A;  2K9X A;  1LO5 D;  1SJE D;  1D5X C;  1R7S A;  1UNS A;  4XE0 A;  1HQR D;  3NVW A;  3AE8 B;  1NI3 A;  1YN3 A;  4NZL B;  1QLB B;  3AMZ A;  5BYR A;  4N6E B;  3P4P B;  5E6J A;  3B9J A;  3BYY B;  1MVK A;  2ONQ A;  1NEN B;  3IAS 1;  4A55 A;  3NS1 A;  5BMI A;  1MPE A;  1YN5 A;  2YEP F;  1YQ4 B;  2RPV A;  4ARC A;  1EWY C;  1VZ7 A;  5HHD G;  2WXH A;  5EE9 A;  1SE4 A;  2QIL A;  3ZQ4 A;  1L5P A;  1L6V A;  2W3R A;  1SSN A;  3SFD B;  1PGX A;  1RM6 C;  3U52 E;  2BBC A;  1K53 A;  1HXY D;  2JXT A;  3AE1 B;  2RDG A;  2WXJ A;  1JAL A;  1TKG A;  2INP E;  1D6E C;  2MEK A;  3R2I A;  1FM0 D;  2L52 A;  3FC4 A;  3Q8F A;  4A8X C;  2DLB A;  3TEY A;  3KWV A;  1PGA A;  2Y3A A;  3RPF C;  1FFU A;  1HZ6 A;  1FNW A;  1J7A A;  2HTM E;  1SE2 A;  1N5W A;  4JWU C;  5MPO A;  2CU3 A;  1C78 A;  1HA5 A;  3H8H A;  1FO4 A;  2BYT A;  3AEF B;  1KF6 B;  1JWB D;  5EE1 A;  1M4V A;  2I2Y A;  4GLS C;  2BT6 A;  4JX1 C;  4KGT A;  1JRP A;  1ZPS A;  2DYO A;  1SJH D;  2W82 A;  2WXQ A;  3GP7 A;  2J4X A;  3BK1 A;  1N63 A;  5EE0 A;  1TJE A;  2K5P A;  1EU3 A;  1VR9 A;  2WU5 B;  2WXI A;  4TSS A;  4WWM A;  1I4G A;  1XLO A;  2V3P A;  2PVG C;  4OZC A;  1BXT A;  3NVZ A;  3AE5 B;  1JW9 D;  2MJE A;  2V3N A;  4KX6 B;  1PGB A;  1N5X A;  1GOZ A;  1ET9 A;  3BYT B;  4N58 A;  1WSP A;  1XEE A;  2RMM A;  3W5V B;  4EE2 A;  4B0E A;  1CQV A;  2WDV B;  2WXN A;  4WH4 A;  4NJC A;  3OWE B;  5G5G A;  1C4A A;  4HRS A;  4MAC A;  2WLB A;  1I4Q A;  3E9S A;  2WP9 B;  1FD6 A;  1D5M C;  2H89 B;  4YT0 B;  1EM7 A;  1IGC A;  3ZJU A;  4RH6 A;  3AV8 A;  1YQ3 B;  1ZXI A;  2X38 A;  1JQ4 A;  4IDI A;  4RGO S;  1CK1 A;  1FXA A;  4ZHO A;  1DYQ A;  1FCC C;  1OFF A;  1L0Y B;  1PYW D;  2TSS A;  4L1B A;  1JWM D;  3IT4 B;  2SAK A;  2N7J A;  4KKI A;  1WYG A;  1QKZ A;  4WQM A;  5EE3 A;  5D3I B;  4WUR A;  1SBB B;  3AEG B;  2KN4 A;  1SEB D;  3HVD A;  3V3X A;  1HZ5 A;  5C3J B;  4C7Z A;  4YSX B;  3VQI A;  1EU4 A;  1KLG D;  2WXO A;  3I9V 1;  1OQR A;  1I4H A;  3U4E G;  1PUT A;  2J42 A;  1FFV A;  2LFI A;  1E0Z A;  1VZ6 A;  3AE3 B;  3P4Q B;  2E6X A;  2OED A;  4DXG A;  2EEL A;  2WXP A;  1TY0 A;  3P63 A;  2DYM A;  1F2R I;  2V4I B;  3PZ7 A;  1DOY A;  2XNA C;  3BZD B;  1NEK B;  2XN9 C;  4ZHP A;  2ON8 A;  1YMH E;  1XLN A;  2GB1 A;  1QOA A;  2JSV X;  2H88 B;  5BYS A;  3AE9 B;  2WXG A;  3BII D;  3NUH B;  2L83 A;  3HRD D;  3KQ4 A;  4HEA 1;  1NYQ A;  1IBX A;  2WXR A;  4HKZ E;  1FIQ A;  3BVM A;  4PT5 A;  3B2G A;  1ZOY B;  3AEA B;  1AN8 A;  1N61 A;  2JQR B;  2L32 A;  4UDU C;  3L4P A;  2JYE A;  2LEK A;  4LTU A;  1FCL A;  1KTK A;  1P7F A;  1XF5 L;  4US8 A;  2IGH A;  1JWU D;  2WXL A;  3ABV B;  1E9M A;  1TKE A;  1JRO A;  1XXG A;  1RYJ A;  3CF4 A;  1GB1 A;  2GRI A;  2ICI A;  4B0M A;  2AQ3 B;  4WAF A;  2K3U A;  2W55 A;  1XLQ A;  4A9A A;  1UGJ A;  4CQN A;  1AWD A;  1TS2 A;  4XWW A;  1YJI A;  4KKJ A;  2M0A A;  1ZDX A;  1KLU D;  4USA A;  2JYT A;  3LB8 C;  3FIL A;  3IT6 B;  1SB3 C;  3NVV A;  1YN4 A;  1K51 A;  4OZA A;  4RCO A;  4WIP A;  1H7W A;  1BML C;  1ENF A;  2BW2 A;  3MFG A;  4DXF A;  3NZ3 A;  1I4X A;  4TQ1 A;  2LGI A;  4ITK A;  1PFD A;  2KDM A;  4RF0 A;  2KWD A;  1L0X B;  1FXI A;  2Y5P A;  4MT5 A;  3VR8 B;  1EWC A;  2V0G A;  2G1E A;  4XWT A;  3ZGZ A;  1J7B A;  1TY2 A;  4TMA B;  4YTP B;  4M0W A;  1KH0 A;  1FMA D;  4HKQ A;  2Z8L A;  4C7Y A;  1XLP A;  4Q2J A;  2KMM A;  1F2R C;  2E3T A;  1FRD A;  5D7G A;  3EA6 A;  3Q69 A;  4ZOH C;  1NYR A;  1B9R A;  3Q8B A;  3SEB A;  5BMH A;  3MHZ A;  3UI3 A;  2QSD A;  1KFY B;  2BS3 B;  3Q8C A;  2N9L A;  3LXF A;  3WCQ A;  3EGR A;  2BS4 B;  1CZP A;  1T5X D;  1VLB A;  1V1P A;  2CJO A;  4JWS C;  4J3O D;  4XDC A;  4NAW B;  3T3N A;  1L6U A;  3P42 A;  3PZ8 A;  2IJ0 A;  3AEE B;  2FE8 A;  5FK9 C;  1L4Z B;  4ARI A;  3KLS X;  2LJI A;  3NVY A;  1RWS A;  5HI1 A;  1AYF A;  4FXC A;  4RGN A;  2AX5 A;  1OQQ A;  2WNM A;  4JPS A;  4RGM A;  2PMV A;  2WQY B;  1GB4 A;  1E10 A;  2J52 A;  1ZE3 D;  4OVZ A;  1UUP A;  3AH7 A;  4IOI E;  4LK0 M;  2NTS A;  4L2Y A;  1AW7 A;  3TEX A;  4C56 C;  4DQO C;  1F0Z A;  3KWL A;  2IDY A;  2JU6 X;  2JX5 A;  2PVO D;  1YJJ A;  1L0V B;  4OZB A;  1MHH E;  3ZYY X;  2GI9 A;  4YTN B;  4NAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...