1E7PB

Quinol:fumarate reductase from wolinella succinogenes
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title A Third Crystal Form of Wolinella Succinogenes Quinol:Fumarate Reductase Reveals Domain Closure at the Site of Fumarate Reduction
pubmed doi rcsb
source organism Wolinella succinogenes
molecule tags Oxidoreductase
total genus 55
structure length 239
sequence length 239
chains with identical sequence E, H, K
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2000-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1e7pB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e7pB01
1OQQA 1NVID 3FC4A 1FRRA 1J7AA 2L83A 3B9JA 2BS2B 2WS3B 3AE8B 1H7WA 1FIQA 2EKIA 3AEEB 3AE9B 4YTPB 1I7HA 1N5WA 1TYGB 3AV8A 2L52A 3CWIA 1QT9A 3EUB2 2WDQB 3AE6B 1JALA 1KRHA 2W3RA 3FAHA 3DWMA 3BIID 3P4SB 1TKYA 2Y5CA 1FMAD 3AE1B 1WYGA 4P6VF 5GXGB 3AECB 1GTHA 3SFEB 1RM6C 3HRDD 4YSXB 1ROEA 2HTME 2QJLA 1WRIA 5C2TB 5H92C 1KFYB 1N63A 3W9CB 1VDVA 3NVWA 4FXCA 3VR9B 1FO4A 1T3QA 1E0ZA 4JWUC 2BS3B 1L6VA 1E9MA 3W5VB 3AE2B 3AE7B 2W55A 1H7XA 1TKGA 5EE3A 5AUKA 1EWYC 3ZYYX 1GAQB 2E3TA 1NENB 4YXDB 1NYQA 1V8CA 3LXFA 5EE0A 4C7ZA 3RPFC 1AYFA 3AEAB 1PUTA 1PFDA 3AE5B 1SF0A 1XLNA 4A9AA 2KMMA 4N58A 3ETRA 1L6UA 1DOYA 2WU2B 2WQYB 2W3SA 1YQ3B 1J7CA 1QOFA 3NVYA 4C80A 5AUIA 1E10A 4WQMA 3SFDB 3CF4A 2K9XA 1N5XA 3W5UB 3VRBB 4YTNB 3AE4B 1IUEA 3AMZA 3P4RB 1TKEA 4YT0B 3NRZA 1YQ4B 3CIRB 4YSYB 3KWLA 3NVZA 3AEBB 3DWGC 2WDRB 5EE1A 2JX5A 3VRAB 1SIJA 2LEKA 3SR6A 1L0VB 1OFFA 3AM9A 2MJEA 3LB8C 4HROA 3VR8B 1E7PB 3HVZA 3NVVA 4N59A 2FBWB 3PO0A 4HRSA 1RWSA 4ITKA 1JQ4A 1VLBA 1XLQA 3B2GA 1GT8A 1QOGA 1DOIA 1PDXA 4ZHOA 1QF6A 2PVOD 1FXIA 2WLBA 2WU5B 1ZUD2 1A70A 5H8YE 1GPXA 3HUIA 1E6EB 4JWSC 3L4PA 4USAA 2K5PA 1JRPA 1N60A 3P1MA 2B76B 4YSZB 1NEKB 1V97A 1DGJA 2K22A 2M19A 2M56B 3P63A 5MPOA 2PIAA 1L5PA 1XLOA 2DBYA 2AX5A 1RYJA 4C7YA 2CU3A 5G5GA 1RFKA 1ZXIA 1CZPA 1JW9D 1XLPA 2N0SB 4US8A 4ZHPA 1TJEA 1QLBB 1DOXA 1F0ZA 1FRDA 5EE9A 2KAJA 3AB5A 2MJ3A 1N61A 4ZOHC 2H88B 4KX6B 2G1EA 3AH7A 3AE3B 1UWMA 1YJIA 5G5HA 2QIEB 1OQRA 2WDVB 2OHFA 5C3JB 2JQRB 2WP9B 2W54A 3AN1A 4IDIA 1FFUA 3AEDB 3ABVB 2H89B 1NI3A 1YJJA 3B2FA 1JWAD 1FFVA 3NS1A 1N62A 1FM0D 1FXAA 4YTMB 3P4QB 1JWBD 1CJEA 1AWDA 3AEGB 1R7SA 2CJNA 4LTUA 4WWMA 4US9A 1B9RA 2BT6A 1ZP0B 1WWTA 2CJOA 1ZOYB 4N6EB 2BS4B 1XO3A 2PVGC 1QOBA 2MJDA 3P4PB 1NYRA 2PKOA 1J7BA 1SB3C 4JX1C 1QOAA 3WCQA 2Q5WD 2MH7A 1VJKA 1GTEA 1JROA 1KF6B 2ACZB 1WGKA 3AEFB 1WXQA 2DWQA
chains in the Genus database with same CATH superfamily
3CWIA 2L52A 3RD2A 2J53A 1TKYA 1V86A 2KLGA 2UU7A 3WAMA 4LK0M 3ZLZA 4FXCA 1R4MB 4NAWB 1WF9A 4MJSB 3ZXVA 1YMHE 1E9MA 3E56A 4OZCA 1NI2A 2JVCA 2QSDA 5EE3A 1RLFA 2I1JA 4F1SA 2N9LA 2KDIA 5HHDG 2N7JA 4FADA 4GDLB 5TSSA 2AQ1B 3KVFB 4FHJA 2M0AA 5LXHA 2JWUA 3H7PA 1E5WA 5J18A 3PV1A 3TJPA 3RUIB 3OAWA 1R4NB 4RCOA 4FJZA 1EF5A 2DNFA 2L76A 2L32A 4DHJD 4WWNA 4ZYNA 2GBJA 2I2YA 2K5PA 2RDBC 2KX3A 1SGHA 4W9CA 3PGEA 1SBBB 1F9JA 1K52A 2KAJA 1QQRA 2IO3B 2MJ3A 4ZRIA 1MG4A 3AH7A 3PHXB 1YNTE 2KO3A 2Y5BB 3Q8AA 1K8RB 1R7SA 4WWMA 1TS2A 4LDTD 2KDEB 1YX6B 2WXMA 4ANVA 2WWZA 2RR9A 4OHJA 5LLIA 4REZA 4AJYB 1Y56A 3L17A 2D3AA 5GMVA 3VH4B 2D3GA 2OOBB 3UI3A 5BMGA 1V1OA 1LM8B 2O2VA 3FILA 1E7VA 3GZNI 1KLVA 5JH5C 2GRIA 4QAYA 4KGTA 1FPYA 4MH8A 1H7XA 3N3KB 4W9JA 4KSLC 4P16A 4C4VA 4KV2A 3LXFA 1SIFA 3DBSA 3M62B 2J0MA 1V1PA 1KTKA 3AE5B 1QILA 3OG5A 4WAFA 3NVYA 1HZ6A 2N4FA 1IUEA 2MA9B 5DPWA 3KYCD 2IYDB 1GG3A 3NVZA 2KNBA 4M0WB 2GBMA 4M8NA 1D3ZA 4FHKA 4HJKA 1F52A 1KLGD 2UWQA 1L0YB 1QF6A 2J7QB 1GB1A 1IBXB 1TZOA 1C77A 1GPXA 4TSSA 3RCZA 3IAS1 2IY1B 3VAWA 4ZRJA 1ESFA 3U7DA 2HD5B 4RF0A 2AX5A 1S1QB 3ZQ4A 2WXHA 5G5GA 1ZXIA 4ANWA 3VTUA 2DZKA 1FRDA 5EE9A 3MTNB 1VD2A 2QMTA 4X57B 3PS6A 1AW7A 2WDVB 2JQRB 3P4QB 1CJEA 2LGDA 2O6VA 4E3CA 2K8BA 2WXJA 2BYVE 1QOAA 2D3BA 4EE2A 3T3NA 5AZFA 4PT5A 1GJZA 4ARCA 4PS3A 2BKFA 5E6NA 2K6DB 3AE6B 1V5OA 3APCA 2IO2B 2QC8A 3B08A 4ACFA 1ROEA 2HTME 5C2TB 2N9XA 2D10A 3DHIC 2XBBC 3SD5A 1Z2MA 2JRIB 2INNE 3RNGC 4TMAB 3PREA 1FNUA 4NJ7A 5AUKA 2IO0B 2RPVA 1PUTA 1SF0A 1L4ZB 2MBOA 4GU2A 4KIKA 3DBLI 1D5XC 2WYQA 1XT9B 4K7UA 1WR6E 4ZRPA 1AN8A 4DHZE 2KT7A 4UDUC 2ZW1A 3L16A 1L0VB 5HFYA 3V61A 2HJ1A 4GOCA 2RSUA 4HROA 4EZJA 1UELA 1F2RC 3PO0A 4II2B 2BB5A 1JRUA 1QOGA 2MBQA 3RZFA 3DBHB 2N9EB 4M8MA 2K22A 2WXNA 3R2TA 1VR9A 2ASQA 4MACA 1GB4A 4I6PA 3H7PB 2WHIA 1XCQL 1DOXA 2C60A 2XN9C 2XEWA 3A1QA 4KX6B 1STEA 1UWMA 2BWES 2SEBD 1IP9A 4A3PA 3N30A 4A20A 2WX1A 3ZGZA 3Q8BA 4US9A 5BMHA 1I4HA 1SB3C 3WCQA 2DX5B 3MC9A 3IG3A 1NVID 1L4DB 4EZLA 3NJTA 1JALA 1KRHA 4M02A 4PS7A 4RGMA 3P4SB 4HKQA 3QIJA 2EMTA 3M63B 4NZLB 1E0ZA 2NPTA 1L6VA 1GOZA 2KJRA 3TIXA 1TKGA 1MFWA 1LFDA 2BBCA 3N9YC 1EUVB 3IVFA 1V81A 3ZIMA 1EU4A 4G3XB 1ET9A 4J3OD 4O1NA 4WWOA 4BBNC 4BBNF 2KOXA 1TBEA 2FCMA 2TSSA 2WDRB 5FR3A 2WXFA 2O2VB 3FILB 1BUIC 2BTEA 4I6NB 3MHSD 1E7PB 3PLUA 2RD0A 4BKSD 5AEKB 1XQQA 4JE3B 1PDXA 1TY2A 3TSSA 3KQ4A 1V49A 3KUDB 1A70A 4HK2A 1SE3A 4WJOA 4C4VB 2C5LC 2RDHA 4MSQB 1V1PB 2PIAA 4W9DA 1U4AA 4TQ1A 5T8IA 3D32A 4ZRKA 3SU8X 5E6PA 2J0KA 2QCZA 5MPOA 3PVLA 2D2QA 1UH6A 2LVPA 3ZVVA 2MP2A 3AXCA 5IKCM 4LTUA 4AJWA 4HDQA 1ZOYB 1FD6A 2LXAA 3MFGA 1C78A 2MBEA 3H8HA 1E8WA 3N1YC 2MH7A 4BOSC 1P9DU 1VZ8A 1SXTA 4NY0A 1AARA 2LUEA 2WS3B 4W9KA 3U30A 2KK8A 4P1BC 3KH0A 4IM2A 2N9KA 5H92C 1RAXA 4NQLB 4S17A 2KMAA 5C23A 1FO4A 2BW2A 2NBVB 1HEZE 3MJWA 1BT0A 1YIWA 3KYDD 4P7IA 3DBLB 2O6VB 1EWYC 2MRPA 4NAMA 2QDFA 2M17A 1M94A 3W1SC 4ASWC 4PK1A 4PS8A 2KDMA 4C80A 1UGMA 2V4LA 5DCNA 3CIRB 2AL6A 2ZNVC 3PLVA 4OVUA 1C1YB 2R2OA 2KMCA 1CQVA 2I38A 1VLBA 1NBFC 2BGFA 3O13A 2KJHB 2G4SA 2KDBA 3ZRFA 1A5RA 3UIPB 3B1LX 1JRPA 4A9AA 1V5TA 2WX0A 1DGJA 3A4RA 2G45B 3OJ4B 3VUWA 4KIKB 2VH2A 4XE0A 5CHVC 4US8A 3PZDA 4ZHPA 4HPMB 1IPGA 4ZOHC 2V3PA 1WZ3A 5BO4B 1TY0A 3AN1A 2W54A 3E9SA 4XYCA 3MJ5A 1OQYA 2CKHB 2EELA 2PE6B 3NS1A 2J4XA 2KLCA 4DWFA 1WWTA 2C7HA 1RRBA 3ZNHB 1XO3A 2PVGC 2ZZPB 5LXIB 2MJDA 1NYRA 4K7SA 1J7BA 2OJWA 1SE2A 3U8ZA 3RFZB 2ACZB 3MC8A 2K25A 2DWQA 3ONSA 4K7WA 5AZHA 3UQBA 1F2RI 4A90A 1E90A 3UINB 1OEYA 3APFA 2K0PA 1WYGA 4JQWC 2KACA 3QAQA 3A1QB 2KVRA 1HXYD 3PZ7A 2V1YA 3WIMA 1HA5A 3CSTA 3AE7B 1Z5SB 3WA0A 1MHXA 2NTSA 3GB1A 2HE7A 1NYQA 5EE0A 2Y3AA 1Q5WB 3VFKA 1J19A 1I35A 2J0JA 4MELA 2J42A 1ISNA 1YQ4B 2JX5A 2LGSA 4AP4C 3AULA 2KANA 3NVVA 4IWQA 1P1AA 1C4PA 2BKRB 2NPTB 2KZRA 1JCKB 3PRPB 2MX2A 4GIVA 4B95A 2W82A 1P7FA 1PQSA 4RGTA 2BWFA 4RFBA 2ZVNA 1I4RA 4RNAA 4IG7B 2N0SB 3KLSX 1YX5B 2N1WA 2KWUB 4DK5A 1SJHD 1E8ZA 2GMIC 3ZDTA 4N9F4 1TGZB 2LVQA 3AEDB 2VZKD 3DHHC 3HIZA 2FNJB 1WXAA 3U4EG 5IN7A 3BZDB 2BS4B 3GP7A 5FKAC 3AU4A 3BYYB 3ZJUA 1KJTA 4ANXA 4E74A 3WAPA 3AV8A 2IDYA 4DHJB 3DWMA 1IGCA 4KKJA 4P6VF 5GXGB 3R3MA 3SFEB 4HEA1 5JZEB 2LUMA 3Q6BA 3EA6A 2ZPNA 3RULA 2MP2B 4PYZA 3NZUA 3H9DA 4G0NB 3RPFC 1AYFA 1YN5A 3PTFC 4L23A 1WJUA 4ANUA 3I9V1 4EKUA 3A9JA 2INDC 3W1SA 1WZ0A 3W5UB 2ZW0A 3AMZA 4KSKC 3K9OB 1XCTL 4LDTB 4ZDVA 1OFFA 3TEZA 4AUQC 4KGRA 3T9LA 3VR8B 3NHEB 1XD3B 1YN3A 1PGXA 1KH0A 2HJ8A 3BYTB 5BYRA 2JRHA 1HE8A 3VH3B 1ZGUB 2Y5PA 2B76B 4YSZB 1NEKB 3VQIA 2JXXA 2QILA 3DVNV 4XDDA 1RYJA 4C7YA 1WY8A 3JW0X 2NVUI 2K1FA 3VUYA 4BKSA 1CZPA 2IJ0A 5CHWA 4W9FA 3AE3B 1UZXB 4MGZE 4W9EA 4JIOU 1MG8A 4YTMB 3AEGB 4IW0A 2NMQA 4N6EB 3KUCB 3QJZA 2KWDA 1QOBA 1UUPA 2I1KA 4HCNB 4KGSA 1MHHE 1JROA 5IAAC 1WXQA 1HZ5A 3Q3OC 2L83A 2NR2A 1TYGB 3ML9A 3ZJTA 4URKA 2IPKD 2W3RA 3PZ8A 2IY0B 2Z0DB 2KWCA 3V60A 1P3QU 1GTHA 2QJLA 5I4DA 3QQ8B 3TEWA 3UIOB 3CMMB 1MPEA 3W5VB 2JZZA 1L7YA 1WMHA 2R2QA 3RI7C 1V8CA 3PHWB 3R2IA 2LASA 3W2DA 1Y8RC 1WGRA 3CSFA 1T6BX 3TMPB 4J6IA 1IGDA 3VRAB 3R66C 2M4NA 1MVKA 2N1VA 1PGAA 2GBNA 2X8XX 3HVZA 2PTLA 2PMVA 1EO6A 3EC8A 3N1XC 1HTOA 3DCGA 4RGOS 5IA7A 3S2AA 1ZW7A 4IM3A 4CYEA 4B0MA 2DBYA 1B1ZA 2RDGA 3ZW3A 4FN2A 1RFAA 4ZRQA 1TJEA 3EFUA 3AB5A 4G50A 2KTRA 4MGYE 1SEBD 4MT5A 4RF1A 4D2KA 2WXPA 2KDFB 2JPHA 1CMXB 3V3XA 1ZP0B 2WXKA 4WQOB 2KXJA 1SSNA 2WXOA 3IT6B 4LCDE 4C56C 1WGKA 2LI5A 2NS5A 4OZBA 1T5XD 1J7AA 1FIQA 1H7WA 1D5ZC 1I7HA 2WXQA 1UF0A 2WDQB 4DXAB 3U52E 1K53A 1FMAD 4BFRA 3AECB 1RM6C 4LLGM 3H6NA 2JSVX 1VDVA 1N6ZA 5IP4D 1I4PA 3RNEC 2ON8A 3RNAC 2BB6A 3K9PB 1QZEA 3N20C 4EOYA 3GZNB 5BMIA 1YOVB 2E6XA 5J2RA 2D07B 3ZTDA 3VRBB 4HDOA 2IBIB 3NRZA 4YSYB 4WJNA 4CQNA 4HKZE 4HVBA 2LEKA 1WM2A 4DXGA 2MJEA 1TZ1A 1C4AA 2ZJDA 4MGIE 2ICIA 3ZNZB 2EMSA 3A9KA 2WNMA 3R7QA 2WLBA 5H8YE 2J52A 1VRAB 2FCQA 1N60A 4RH6A 1EM7A 3NG0A 4DBGA 1SE4A 4DDID 1TTNA 4GN1A 4LNFA 4IC7B 2HTHA 2LXCA 1KOTA 3A9JB 1F0ZA 1LO5D 5CTRC 2N9PC 4GMVA 1TT5B 4WWPA 3SDLC 4WJQA 2QIEB 1GUAB 1DYQA 3A33B 1NI3A 2H89B 1JWAD 2MQJA 2JZPA 4CO7A 2B3AA 3TUOA 2LMCA 3DPDA 3ZKJC 2CHWA 3B0AA 4JX1C 3Q3FA 1JWSD 4II3B 1VJKA 1WR1A 1YD8U 1OQQA 1R4MI 2EKIA 2GOWA 3AE9B 2G3QB 4TUUA 4FLHA 4ICUA 4NPNA 1C76A 4E71A 3AE1B 4WH4A 2N7DA 2MLBA 2M8SA 3VR9B 3BVMA 3WALA 1WGGA 2L05A 2C7NB 1C79A 1H4RA 1OGWA 3BK2A 5CHFA 3I5JC 3Q3JA 4YXDB 3DBRI 3ENEA 4KZCA 1WH3A 3IHPC 3AEAB 1TIFA 3NS8A 1YQ3B 1J7CA 1VCBA 3KWLA 3DWGC 3LJ3A 3JSVA 3GOEA 1WE7A 5D7GA 1S3SG 3DOWA 3QWZB 2L7RA 1F1HA 1ZE3D 4XZ4A 3VVWB 1HTQA 1YN4A 5JHBA 1MJDA 2BF8B 2LZ6A 4AS1A 1YQBA 3DVGX 3PRZA 5L95C 4WJPA 2LVOA 1KM7A 5D94A 1WMHB 3PSEB 4LNIA 3APDA 3HUIA 3DVGY 4JWSC 1XXGA 1D5MC 1ACCA 3BY4B 3JYUA 5L83A 4ZYSA 2LD9A 4XWWA 2V3NA 4IM0A 2DYMA 4HWIB 4P1CC 2DAJA 2KKCA 1EF1A 4OVVA 2YEPB 3HM6X 3FKYA 1KLUD 3HM3A 3ZO5B 1JWBD 2DYOA 1B9RA 3I3TB 2MHJA 4W9HA 2MSED 1FNWA 3P4PB 3DQVA 2KQSA 1GTEA 2DZMA 5D2MB 3AEFB 3DDCB 3ZRCA 2PPHA 2FCSA 3HK0A 2PJHA 3RNBC 3L13A 3GE3C 2LGYA 2KTRB 2LRUA 3Q3NC 2MBBB 2SAKA 1WI0A 2BVCA 3V6EB 1SJED 1WM3A 4C7ZA 4B0EA 1L6UA 5DPTA 2LRWA 2VRRB 4A8XC 2MBHA 2W3SA 5FK9C 1QOFA 3CF4A 5E6OA 3U7ZA 1UWXA 2HDEA 1HQRD 2D11A 2LJ5A 2PEAA 2A4ZA 3SR6A 4XDCA 4XC2A 4K3CA 2EKEC 3DHGC 1JWMD 3B2GA 1C3TA 3O65B 5DPSA 4JL9A 1ENFA 1OTRB 3T8MA 5C1ZA 1M4VA 1WGYA 5JXVA 3RZWC 2FIFA 2PW9A 2X38A 2M56B 3URYA 4S0RA 3V6CB 1PYWD 3Q14C 2CU3A 3ALBA 1XLPA 3PPAA 4RGNA 1FFUA 3HHMA 1FFVA 2YEPF 2CJNA 1ZXHA 1T0RC 2ZVOA 4WURA 5D3IB 3ZNID 1E7UA 3A9KB 4IWOA 1BMLC 1WX9A 1T0YA 4LNKA 4KZ0A 3VDZA 2NTTA 4DHZB 3RMKC 2LFIA 3B9JA 1WJ6A 1NDDA 2NBWB 3MC0B 3IBEA 4K1RB 4AWJA 1LXDA 3W9CB 4AOFA 3DBRB 1E8XA 2MWSB 4KVGB 1GNUA 3QARA 3IFWB 4FULA 1VZ7A 2IGGA 3AI5A 3TCAA 2OEDA 1H8CA 2LGIA 2KMMA 2Z59B 3ETRA 3TEYA 1J0GA 4LJPB 2JYEA 3PRMB 2GI9A 5AUIA 2G4DB 3BVGA 2Z8LA 2VZKB 1TKEA 4L2YA 1T0QC 2WDTB 3DBHI 1X1MA 4XX5A 3ZXRA 3SHQA 2KJ6A 3ML8A 3HVDA 1WFYA 4GGQA 4AQ7A 3QCAA 2CHZA 4MGKE 2KX0A 1E6EB 2JUOA 3L4PA 5KHOA 2GBRA 4BKGA 4WQMA 3A4SC 2KHWB 2M19A 3P63A 4H2AA 2KYWA 4M01A 2LJIA 1XLOA 4FJYA 2G9HD 5IO9A 1RFKA 3C0RB 4LNOA 4GB9A 4G11A 1N61A 4HCPB 1UGJA 3M3JA 3JSVB 5AZGA 2AWTA 2KC2A 4A55A 1V6EA 3MHZA 1V80A 3WANA 3B2FA 3ZNGC 4F8CB 4OW0A 4TV3A 2FCNA 3VHTC 1ZDVA 1XEEA 3L08A 4JLCA 1FNVA 1D4BA 1ZDXA 1KF6B 4CHKA 3VTVA 2MEKA 2AEHA 2CR5A 1D6EC 3EUB2 2AQ2B 3EFCA 4EFOA 1WX8A 3BIID 1WSPA 2FUHB 3EECA 1UD7A 2Y5CA 3VUXA 4W9LA 3HRDD 3Q8FA 2KQ4X 4JGHB 4MM3A 1TS5A 1KFYB 1N63A 1UNSA 3ZJVA 1T3QA 3JVZX 4JWUC 1I4QA 1LGRA 3LDZE 4KKIA 3I63C 2E3TA 2INCC 3RT3B 2BYTA 5CX3A 2WXRA 1FCLA 4N58A 4L1BA 2LHDA 4EEWA 1E10A 3SFDB 4YTNB 1L0XB 1Q0WB 2RPQA 2ONQA 2RMMA 1VZ6A 4IOIE 2FAZA 1WGDA 1IYFA 2KQ7A 2XK5A 3C19A 1GC7A 1XLQA 2FE8A 2WGSA 3ZTCA 2WU5B 1ZUD2 1WE6A 5FR6A 4USAA 4IWPA 2WXGA 1JWUD 2A5UA 4BOZB 3R8BA 1FEHA 2K8HA 3C8YA 1WJNA 1GC6A 2JWZA 4IDIA 3LYYA 2KTFA 1WXSA 2AYOB 4OVZA 1FM0D 2YLMA 3OLMD 4Q2JA 3RNCC 3UGBB 1MI0A 2PKOA 3N32A 4TKNA 3W1YA 1WXMA 2UYZB 3ZUNA 4MSMB 5TR5A 2KWVB 2Z0EB 3NZSA 1FXAA 2KFJA 3FC4A 3P2BA 1FRRA 5BYQA 1TS3A 1P7EA 3AE8B 1TS4A 2JF5A 3AEEB 1N5WA 2CHXA 2V0GA 5KHQA 1QT9A 2DHZA 2KFKA 2IGHA 3PT2B 4OZAA 4DXFA 2N7EA 1WRIA 2XNAC 4IUMB 3L0WB 3TEXA 3J9CA 2QHOA 2KD0A 3N1ZC 2ZCBA 3VTWA 3ECIA 4ICVA 2GB1A 1FCCC 4HLEA 5HKHA 4WAAA 1GAQB 2QEJC 4BZAA 4F7ZA 4GDKA 3IT4B 3NUHB 3KUZA 4MEMA 4GLSC 2WU2B 2K9XA 3P4RB 2NCNA 4W9GA 3AEBB 1F77A 1CK1A 2DENB 2JU6X 2DZIA 1WX7A 1OEYJ 1RWSA 2L8JA 3I57A 3L54A 1GT8A 2D3CA 2ZEQA 1V9JA 5G2NA 1FXIA 2JY6A 1WYWB 1WIAA 1V2YA 1UBIA 3NZ3A 1SE9A 4HXDA 2ZCCA 4HPPA 2OJRA 3TL5A 2H88B 3IAM1 1L2NA 3AU5A 2IO1B 1K51A 5E6JA 4NAWA 4MJSA 3QK0A 5IOIA 1AWDA 3RN9C 5HG2A 2BT6A 2WXLA 3ZDMC 4GDLA 3V62A 4XWTA 4KDLB 4LJOB 2L00B 3QC8B 1JMLA 3V05A 3BINA 4XGAB 2C9WB 1C4CA 4TQ0A 3QA8A 3KW5B 1G6JA 3FAHA 2JT4B 4A3OA 2K3UA 5D6JB 3UQAA 2ZNVB 3NVWA 4RMAA 3X0WA 1WRDB 1Q10A 1I4GA 1YJ1A 4A6QA 2BS3B 3OWEB 4MDKE 1J8CA 3AE2B 4BKTA 2W55A 2INPE 4MH0E 2GLSA 1EU3A 3GE8C 2KN5A 3QX1A 2DZJA 1PFDA 1XLNA 1QKZA 3Q8CA 1WJ4A 1DOYA 2WQYB 4EZKA 2FUG1 3BVZA 1N5XA 4NNJB 2DYBA 1I4XA 1SIJA 3AM9A 4FA6A 4GXBA 3LB8C 2PE9A 2CS4A 4MM3B 4N59A 2FBWB 4HRSA 2D5GA 4I6LB 5J17A 1JQ4A 4DDGD 1R4NI 1UBQA 1DOIA 2PVOD 2BQQA 4K81A 3T3OA 4M00A 5DPRA 3RNFC 1ZKHA 4EUTA 2BYFA 2KN4A 2R61A 5D3DA 2O6VD 4FBJB 2CU1A 3IXSA 1LQBA 4IKGA 2V3SA 1T0SC 2MW5A 1QLBB 4KDIC 4NQKE 3BK1A 4JPSA 2K8CA 3H1UA 1YJIA 1OQRA 5C3JB 2AL3A 3TBLD 2BYEA 5HI1A 1N62A 3P42A 2FIDA 1PGBA 3NOBA 2YVCA 2XK5B 4B9KA 5EDSA 1EWCA 2IZVB 2LWPA 2W9NA 1I42A 3RYTA 2DAFA 3GS2A 2JYTA 1P0RA 3EGRA 3NY5A 3L10B 2IGDA 4B6WA 2BS2B 4YTPB 4NJCA 4M0WA 3Q3MC 4WIPA 3OJ3A 3CF6E 2L3ZA 4YSXB 4HPLB 3WAOA 4C00A 4YWGG 1IBXA 3ZYYX 4ARIA 1NENB 4FJVB 4GSWA 2ZPYA 3Q8EA 4NJ6A 2JZ3B 1BXTA 3VXWA 3Q69A 3X23A 3SEBA 1E8YA 2L0FA 3AE4B 4YT0B 5EE1A 2GBKA 2KFKB 2KVZA 2PLPA 5JHAA 4BAXA 5BYSA 2K39A 2L0TA 4LNNA 1XF5L 3UF8A 4ITKA 3BWUD 2V9HA 4YL8A 5G55A 2BPSA 1C9FA 1ET6A 1P98A 4ZHOA 2M0XA 2WXIA 2MCNB 3MP9A 4K3BA 2AQ3B 3P1MA 2JXTA 1V97A 1L5PA 4PYUA 4GDKB 3Q2AC 3QHTA 4HJGE 1WXVA 1JW9D 3DVNU 5LNK1 3KWVA 1WGHA 2G1EA 4W9IA 1Q1OA 3M95A 1K50A 5G5HA 2OHFA 3EHVA 4R3DA 2WP9B 2DLBA 2REXA 3ABVB 1YJJA 2LGXA 2LHEA 3H7SA 1FXTB 2KC1A 2M1MA 2RGFA 1ZPSA 2C7MB 2V4IB 2CJOA 4DQOC 2K6QA 3R7RA 3U2SC 4BVUC 2L1AA 2VH1A 4RM8A 2NBUA 2Q5WD 4RM9A
chains in the Genus database with same CATH topology
1T5XD 1J7AA 2MEKA 2WS3B 1FIQA 1H7WA 1D5ZC 3CWIA 1I7HA 2WXQA 1D6EC 3EUB2 2AQ2B 2L52A 2WDQB 2J53A 3U52E 3BIID 1WSPA 1TKYA 2Y5CA 1K53A 1FMAD 2N9KA 3AECB 1RM6C 4LLGM 3HRDD 3Q8FA 4LK0M 2KQ4X 1TS5A 1KFYB 1N63A 1UNSA 1VDVA 2JSVX 4FXCA 5H92C 1FO4A 1T3QA 4NAWB 3ZJVA 2BW2A 1HEZE 4JWUC 1I4PA 1YMHE 1I4QA 1E9MA 3E56A 4OZCA 2ON8A 2BB6A 2QSDA 5EE3A 4KKIA 1EWYC 2N9LA 4NAMA 2E3TA 5HHDG 2N7JA 4GDLB 5BMIA 2BYTA 5TSSA 2AQ1B 2WXRA 1FCLA 4N58A 2E6XA 2KDMA 2M0AA 4L1BA 2LHDA 4C80A 2JWUA 1E10A 3SFDB 3VRBB 4YTNB 1L0XB 3NRZA 3CIRB 4YSYB 2ONQA 2RMMA 4CQNA 4HKZE 2LEKA 4RCOA 1VZ6A 4IOIE 4DXGA 2MJEA 1C4AA 2ICIA 2L32A 1CQVA 2I38A 1VLBA 1XLQA 2FE8A 3O13A 2WNMA 2WLBA 2WU5B 1ZUD2 5H8YE 2J52A 1VRAB 2I2YA 4USAA 2K5PA 1JRPA 1N60A 4A9AA 1DGJA 4RH6A 1EM7A 4C56C 2WXGA 1JWUD 1SE4A 4XE0A 3R8BA 1F0ZA 4US8A 1LO5D 4ZHPA 1FEHA 1SBBB 1K52A 2KAJA 1QQRA 2MJ3A 3C8YA 4ZOHC 2V3PA 3AH7A 1TY0A 2QIEB 3AN1A 2W54A 4IDIA 1YNTE 3E9SA 3LYYA 1DYQA 3MJ5A 1NI3A 2H89B 3Q8AA 2EELA 1JWAD 3NS1A 2J4XA 1FM0D 2JZPA 1R7SA 4OVZA 4Q2JA 4WWMA 3TUOA 1TS2A 2LMCA 1WWTA 1MI0A 2WXMA 1XO3A 2PVGC 2MJDA 2PKOA 1NYRA 4OHJA 1J7BA 4JX1C 4REZA 1JWSD 1SE2A 1Y56A 1VJKA 3RFZB 2ACZB 1FXAA 2DWQA 1OQQA 3FC4A 1FRRA 5BYQA 1TS3A 1P7EA 3AE8B 1TS4A 3UI3A 2EKIA 3AEEB 3AE9B 1F2RI 1N5WA 1V1OA 5BMGA 4A90A 2V0GA 1QT9A 3FILA 2K0PA 1C76A 3AE1B 1WYGA 4WH4A 2IGHA 2KACA 4OZAA 4DXFA 1HXYD 1WRIA 2XNAC 3PZ7A 3VR9B 3BVMA 2GRIA 3TEXA 3J9CA 4KGTA 1HA5A 3AE7B 1C79A 4MH8A 1H7XA 2GB1A 1FCCC 3BK2A 1MHXA 2NTSA 3GB1A 4P16A 1GAQB 4YXDB 1NYQA 2QEJC 3LXFA 5EE0A 2Y3AA 1V1PA 3AEAB 1KTKA 3AE5B 1QILA 3IT4B 3NUHB 4GLSC 2WU2B 4WAFA 1YQ3B 1J7CA 3NVYA 1HZ6A 2K9XA 2J42A 1IUEA 3P4RB 1YQ4B 3KWLA 3NVZA 3AEBB 3DWGC 1F77A 2JX5A 1CK1A 5D7GA 2JU6X 1ZE3D 1YN4A 3NVVA 4AS1A 1C4PA 1RWSA 3I57A 1GT8A 1KLGD 1L0YB 1QF6A 1FXIA 1JCKB 1GB1A 1IBXB 1TZOA 1C77A 1GPXA 3HUIA 4JWSC 1XXGA 2W82A 1D5MC 1ACCA 1P7FA 3IAS1 4RGTA 4TSSA 1ESFA 3NZ3A 4RFBA 4ZYSA 1I4RA 4RF0A 2AX5A 4RNAA 3ZQ4A 2WXHA 5G5GA 4XWWA 1ZXIA 2V3NA 2DYMA 2N0SB 3KLSX 1FRDA 5EE9A 2H88B 2QMTA 3IAM1 1SJHD 1K51A 5E6JA 1AW7A 2WDVB 2JQRB 2YEPB 3AEDB 2VZKD 1KLUD 1JWBD 3P4QB 1CJEA 1AWDA 2DYOA 5HG2A 3U4EG 2BT6A 2WXLA 1B9RA 3BZDB 2WXJA 2BS4B 1FNWA 3P4PB 3GP7A 5FKAC 1QOAA 4XWTA 4EE2A 3T3NA 1GTEA 1JMLA 3BYYB 3V05A 3ZJUA 3AEFB 4PT5A 1C4CA 4ARCA 4TQ0A 3AV8A 2IDYA 3AE6B 3FAHA 3DWMA 1IGCA 4KKJA 4P6VF 5GXGB 4HEA1 3SFEB 1ROEA 2HTME 2K3UA 5C2TB 3NVWA 2LUMA 1Q10A 1I4GA 4A6QA 2SAKA 3EA6A 2BS3B 2INNE 3OWEB 4TMAB 3AE2B 2W55A 2INPE 1FNUA 1EU3A 5AUKA 1SJED 2RPVA 4C7ZA 3RPFC 1AYFA 1PUTA 1PFDA 1SF0A 1XLNA 1YN5A 4B0EA 1QKZA 3Q8CA 4L23A 1L6UA 1DOYA 1L4ZB 3I9V1 4A8XC 5FK9C 2W3SA 2WQYB 1QOFA 3W1SA 2FUG1 1D5XC 3CF4A 3BVZA 1N5XA 2ZW0A 3U7ZA 3W5UB 1UWXA 3AMZA 2HDEA 1HQRD 4ZRPA 1AN8A 1I4XA 4UDUC 1XCTL 1SIJA 2ZW1A 3SR6A 1L0VB 1OFFA 3AM9A 5HFYA 3TEZA 4KGRA 3LB8C 4HROA 4XDCA 3VR8B 1F2RC 1YN3A 4MM3B 1PGXA 4N59A 2FBWB 3PO0A 2D5GA 4HRSA 1JQ4A 2BB5A 1JWMD 3B2GA 1QOGA 1DOIA 2PVOD 1ENFA 1KH0A 1M4VA 3BYTB 5BYRA 5JXVA 3T3OA 2PW9A 2Y5PA 2B76B 4YSZB 1NEKB 2K22A 2WXNA 2X38A 2KN4A 2M56B 3R2TA 3URYA 3VQIA 1VR9A 1PYWD 2QILA 4MACA 4XDDA 1RYJA 2R61A 4C7YA 5D3DA 2CU3A 1GB4A 3IXSA 4IKGA 1CZPA 1XLPA 2IJ0A 1QLBB 1XCQL 1DOXA 2XN9C 3BK1A 4JPSA 4KX6B 3AE3B 1STEA 1UWMA 1YJIA 2SEBD 1OQRA 5C3JB 4RGNA 1FFUA 1FFVA 5HI1A 1N62A 3P42A 4YTMB 1PGBA 2CJNA 2YEPF 3AEGB 3ZGZA 3Q8BA 1ZXHA 4US9A 2NMQA 4N6EB 5BMHA 1EWCA 4WURA 5D3IB 1I4HA 2KWDA 1QOBA 1UUPA 1SB3C 1BMLC 4KGSA 3WCQA 1MHHE 1JROA 3GS2A 2JYTA 3EGRA 2NTTA 1WXQA 1HZ5A 1NVID 1L4DB 2IGDA 2LFIA 2L83A 3B9JA 2BS2B 4YTPB 1TYGB 3MC0B 3ZJTA 4NJCA 4M0WA 2IPKD 1JALA 1KRHA 2W3RA 3PZ8A 4RGMA 3P4SB 4WIPA 1GTHA 4HKQA 4YSXB 2QJLA 5I4DA 3W9CB 3TEWA 4NZLB 1E0ZA 1L6VA 1MPEA 1GOZA 4YWGG 1IBXA 3W5VB 1VZ7A 1TKGA 2IGGA 3ZYYX 2BBCA 1NENB 1V8CA 4ARIA 3N9YC 1EU4A 3R2IA 2OEDA 1ET9A 4J3OD 3Q8EA 2LGIA 2KMMA 4O1NA 3W2DA 3ETRA 1BXTA 3TEYA 3Q69A 2JYEA 5AUIA 2GI9A 3SEBA 3BVGA 2Z8LA 2VZKB 3AE4B 1T6BX 1TKEA 4YT0B 2TSSA 4L2YA 5EE1A 2WDRB 1IGDA 2WXFA 3FILB 5FR3A 3VRAB 2PLPA 1MVKA 1BUIC 2BTEA 1PGAA 1E7PB 3HVZA 5BYSA 1XF5L 4ITKA 3BWUD 3HVDA 2PTLA 2PMVA 1C9FA 1ET6A 4JE3B 1PDXA 1TY2A 4ZHOA 3TSSA 3KQ4A 4AQ7A 2WXIA 1A70A 1E6EB 3MP9A 3L4PA 4RGOS 1SE3A 2AQ3B 2RDHA 3P1MA 4WQMA 2JXTA 1V97A 2M19A 3P63A 4H2AA 1V1PB 2PIAA 1L5PA 2LJIA 1XLOA 4B0MA 2G9HD 4GDKB 2DBYA 1B1ZA 2RDGA 4TQ1A 4HJGE 1RFKA 5T8IA 1JW9D 4ZRQA 1TJEA 3AB5A 5LNK1 1N61A 3KWVA 1UGJA 2G1EA 1SEBD 4MT5A 4RF1A 4D2KA 1K50A 5G5HA 5MPOA 2WXPA 2OHFA 4R3DA 2WP9B 2DLBA 4A55A 3MHZA 3ABVB 1YJJA 2LHEA 3B2FA 1ZPSA 4OW0A 4LTUA 2V4IB 3V3XA 1ZP0B 2CJOA 4DQOC 1ZOYB 1FD6A 2WXKA 3U2SC 3MFGA 2L1AA 1C78A 1ZDVA 1XEEA 3H8HA 2Q5WD 1SSNA 1FNVA 2MH7A 2WXOA 1D4BA 1VZ8A 1ZDXA 3IT6B 1SXTA 1KF6B 1WGKA 4OZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQQ A;  1NVI D;  3FC4 A;  1FRR A;  1J7A A;  2L83 A;  3B9J A;  2BS2 B;  2WS3 B;  3AE8 B;  1H7W A;  1FIQ A;  2EKI A;  3AEE B;  3AE9 B;  4YTP B;  1I7H A;  1N5W A;  1TYG B;  3AV8 A;  2L52 A;  3CWI A;  1QT9 A;  3EUB 2;  2WDQ B;  3AE6 B;  1JAL A;  1KRH A;  2W3R A;  3FAH A;  3DWM A;  3BII D;  3P4S B;  1TKY A;  2Y5C A;  1FMA D;  3AE1 B;  1WYG A;  4P6V F;  5GXG B;  3AEC B;  1GTH A;  3SFE B;  1RM6 C;  3HRD D;  4YSX B;  1ROE A;  2HTM E;  2QJL A;  1WRI A;  5C2T B;  5H92 C;  1KFY B;  1N63 A;  3W9C B;  1VDV A;  3NVW A;  4FXC A;  3VR9 B;  1FO4 A;  1T3Q A;  1E0Z A;  4JWU C;  2BS3 B;  1L6V A;  1E9M A;  3W5V B;  3AE2 B;  3AE7 B;  2W55 A;  1H7X A;  1TKG A;  5EE3 A;  5AUK A;  1EWY C;  3ZYY X;  1GAQ B;  2E3T A;  1NEN B;  4YXD B;  1NYQ A;  1V8C A;  3LXF A;  5EE0 A;  4C7Z A;  3RPF C;  1AYF A;  3AEA B;  1PUT A;  1PFD A;  3AE5 B;  1SF0 A;  1XLN A;  4A9A A;  2KMM A;  4N58 A;  3ETR A;  1L6U A;  1DOY A;  2WU2 B;  2WQY B;  2W3S A;  1YQ3 B;  1J7C A;  1QOF A;  3NVY A;  4C80 A;  5AUI A;  1E10 A;  4WQM A;  3SFD B;  3CF4 A;  2K9X A;  1N5X A;  3W5U B;  3VRB B;  4YTN B;  3AE4 B;  1IUE A;  3AMZ A;  3P4R B;  1TKE A;  4YT0 B;  3NRZ A;  1YQ4 B;  3CIR B;  4YSY B;  3KWL A;  3NVZ A;  3AEB B;  3DWG C;  2WDR B;  5EE1 A;  2JX5 A;  3VRA B;  1SIJ A;  2LEK A;  3SR6 A;  1L0V B;  1OFF A;  3AM9 A;  2MJE A;  3LB8 C;  4HRO A;  3VR8 B;  1E7P B;  3HVZ A;  3NVV A;  4N59 A;  2FBW B;  3PO0 A;  4HRS A;  1RWS A;  4ITK A;  1JQ4 A;  1VLB A;  1XLQ A;  3B2G A;  1GT8 A;  1QOG A;  1DOI A;  1PDX A;  4ZHO A;  1QF6 A;  2PVO D;  1FXI A;  2WLB A;  2WU5 B;  1ZUD 2;  1A70 A;  5H8Y E;  1GPX A;  3HUI A;  1E6E B;  4JWS C;  3L4P A;  4USA A;  2K5P A;  1JRP A;  1N60 A;  3P1M A;  2B76 B;  4YSZ B;  1NEK B;  1V97 A;  1DGJ A;  2K22 A;  2M19 A;  2M56 B;  3P63 A;  5MPO A;  2PIA A;  1L5P A;  1XLO A;  2DBY A;  2AX5 A;  1RYJ A;  4C7Y A;  2CU3 A;  5G5G A;  1RFK A;  1ZXI A;  1CZP A;  1JW9 D;  1XLP A;  2N0S B;  4US8 A;  4ZHP A;  1TJE A;  1QLB B;  1DOX A;  1F0Z A;  1FRD A;  5EE9 A;  2KAJ A;  3AB5 A;  2MJ3 A;  1N61 A;  4ZOH C;  2H88 B;  4KX6 B;  2G1E A;  3AH7 A;  3AE3 B;  1UWM A;  1YJI A;  5G5H A;  2QIE B;  1OQR A;  2WDV B;  2OHF A;  5C3J B;  2JQR B;  2WP9 B;  2W54 A;  3AN1 A;  4IDI A;  1FFU A;  3AED B;  3ABV B;  2H89 B;  1NI3 A;  1YJJ A;  3B2F A;  1JWA D;  1FFV A;  3NS1 A;  1N62 A;  1FM0 D;  1FXA A;  4YTM B;  3P4Q B;  1JWB D;  1CJE A;  1AWD A;  3AEG B;  1R7S A;  2CJN A;  4LTU A;  4WWM A;  4US9 A;  1B9R A;  2BT6 A;  1ZP0 B;  1WWT A;  2CJO A;  1ZOY B;  4N6E B;  2BS4 B;  1XO3 A;  2PVG C;  1QOB A;  2MJD A;  3P4P B;  1NYR A;  2PKO A;  1J7B A;  1SB3 C;  4JX1 C;  1QOA A;  3WCQ A;  2Q5W D;  2MH7 A;  1VJK A;  1GTE A;  1JRO A;  1KF6 B;  2ACZ B;  1WGK A;  3AEF B;  1WXQ A;  2DWQ A; 
#chains in the Genus database with same CATH topology
 3CWI A;  2L52 A;  3RD2 A;  2J53 A;  1TKY A;  1V86 A;  2KLG A;  2UU7 A;  3WAM A;  4LK0 M;  3ZLZ A;  4FXC A;  1R4M B;  4NAW B;  1WF9 A;  4MJS B;  3ZXV A;  1YMH E;  1E9M A;  3E56 A;  4OZC A;  1NI2 A;  2JVC A;  2QSD A;  5EE3 A;  1RLF A;  2I1J A;  4F1S A;  2N9L A;  2KDI A;  5HHD G;  2N7J A;  4FAD A;  4GDL B;  5TSS A;  2AQ1 B;  3KVF B;  4FHJ A;  2M0A A;  5LXH A;  2JWU A;  3H7P A;  1E5W A;  5J18 A;  3PV1 A;  3TJP A;  3RUI B;  3OAW A;  1R4N B;  4RCO A;  4FJZ A;  1EF5 A;  2DNF A;  2L76 A;  2L32 A;  4DHJ D;  4WWN A;  4ZYN A;  2GBJ A;  2I2Y A;  2K5P A;  2RDB C;  2KX3 A;  1SGH A;  4W9C A;  3PGE A;  1SBB B;  1F9J A;  1K52 A;  2KAJ A;  1QQR A;  2IO3 B;  2MJ3 A;  4ZRI A;  1MG4 A;  3AH7 A;  3PHX B;  1YNT E;  2KO3 A;  2Y5B B;  3Q8A A;  1K8R B;  1R7S A;  4WWM A;  1TS2 A;  4LDT D;  2KDE B;  1YX6 B;  2WXM A;  4ANV A;  2WWZ A;  2RR9 A;  4OHJ A;  5LLI A;  4REZ A;  4AJY B;  1Y56 A;  3L17 A;  2D3A A;  5GMV A;  3VH4 B;  2D3G A;  2OOB B;  3UI3 A;  5BMG A;  1V1O A;  1LM8 B;  2O2V A;  3FIL A;  1E7V A;  3GZN I;  1KLV A;  5JH5 C;  2GRI A;  4QAY A;  4KGT A;  1FPY A;  4MH8 A;  1H7X A;  3N3K B;  4W9J A;  4KSL C;  4P16 A;  4C4V A;  4KV2 A;  3LXF A;  1SIF A;  3DBS A;  3M62 B;  2J0M A;  1V1P A;  1KTK A;  3AE5 B;  1QIL A;  3OG5 A;  4WAF A;  3NVY A;  1HZ6 A;  2N4F A;  1IUE A;  2MA9 B;  5DPW A;  3KYC D;  2IYD B;  1GG3 A;  3NVZ A;  2KNB A;  4M0W B;  2GBM A;  4M8N A;  1D3Z A;  4FHK A;  4HJK A;  1F52 A;  1KLG D;  2UWQ A;  1L0Y B;  1QF6 A;  2J7Q B;  1GB1 A;  1IBX B;  1TZO A;  1C77 A;  1GPX A;  4TSS A;  3RCZ A;  3IAS 1;  2IY1 B;  3VAW A;  4ZRJ A;  1ESF A;  3U7D A;  2HD5 B;  4RF0 A;  2AX5 A;  1S1Q B;  3ZQ4 A;  2WXH A;  5G5G A;  1ZXI A;  4ANW A;  3VTU A;  2DZK A;  1FRD A;  5EE9 A;  3MTN B;  1VD2 A;  2QMT A;  4X57 B;  3PS6 A;  1AW7 A;  2WDV B;  2JQR B;  3P4Q B;  1CJE A;  2LGD A;  2O6V A;  4E3C A;  2K8B A;  2WXJ A;  2BYV E;  1QOA A;  2D3B A;  4EE2 A;  3T3N A;  5AZF A;  4PT5 A;  1GJZ A;  4ARC A;  4PS3 A;  2BKF A;  5E6N A;  2K6D B;  3AE6 B;  1V5O A;  3APC A;  2IO2 B;  2QC8 A;  3B08 A;  4ACF A;  1ROE A;  2HTM E;  5C2T B;  2N9X A;  2D10 A;  3DHI C;  2XBB C;  3SD5 A;  1Z2M A;  2JRI B;  2INN E;  3RNG C;  4TMA B;  3PRE A;  1FNU A;  4NJ7 A;  5AUK A;  2IO0 B;  2RPV A;  1PUT A;  1SF0 A;  1L4Z B;  2MBO A;  4GU2 A;  4KIK A;  3DBL I;  1D5X C;  2WYQ A;  1XT9 B;  4K7U A;  1WR6 E;  4ZRP A;  1AN8 A;  4DHZ E;  2KT7 A;  4UDU C;  2ZW1 A;  3L16 A;  1L0V B;  5HFY A;  3V61 A;  2HJ1 A;  4GOC A;  2RSU A;  4HRO A;  4EZJ A;  1UEL A;  1F2R C;  3PO0 A;  4II2 B;  2BB5 A;  1JRU A;  1QOG A;  2MBQ A;  3RZF A;  3DBH B;  2N9E B;  4M8M A;  2K22 A;  2WXN A;  3R2T A;  1VR9 A;  2ASQ A;  4MAC A;  1GB4 A;  4I6P A;  3H7P B;  2WHI A;  1XCQ L;  1DOX A;  2C60 A;  2XN9 C;  2XEW A;  3A1Q A;  4KX6 B;  1STE A;  1UWM A;  2BWE S;  2SEB D;  1IP9 A;  4A3P A;  3N30 A;  4A20 A;  2WX1 A;  3ZGZ A;  3Q8B A;  4US9 A;  5BMH A;  1I4H A;  1SB3 C;  3WCQ A;  2DX5 B;  3MC9 A;  3IG3 A;  1NVI D;  1L4D B;  4EZL A;  3NJT A;  1JAL A;  1KRH A;  4M02 A;  4PS7 A;  4RGM A;  3P4S B;  4HKQ A;  3QIJ A;  2EMT A;  3M63 B;  4NZL B;  1E0Z A;  2NPT A;  1L6V A;  1GOZ A;  2KJR A;  3TIX A;  1TKG A;  1MFW A;  1LFD A;  2BBC A;  3N9Y C;  1EUV B;  3IVF A;  1V81 A;  3ZIM A;  1EU4 A;  4G3X B;  1ET9 A;  4J3O D;  4O1N A;  4WWO A;  4BBN C;  4BBN F;  2KOX A;  1TBE A;  2FCM A;  2TSS A;  2WDR B;  5FR3 A;  2WXF A;  2O2V B;  3FIL B;  1BUI C;  2BTE A;  4I6N B;  3MHS D;  1E7P B;  3PLU A;  2RD0 A;  4BKS D;  5AEK B;  1XQQ A;  4JE3 B;  1PDX A;  1TY2 A;  3TSS A;  3KQ4 A;  1V49 A;  3KUD B;  1A70 A;  4HK2 A;  1SE3 A;  4WJO A;  4C4V B;  2C5L C;  2RDH A;  4MSQ B;  1V1P B;  2PIA A;  4W9D A;  1U4A A;  4TQ1 A;  5T8I A;  3D32 A;  4ZRK A;  3SU8 X;  5E6P A;  2J0K A;  2QCZ A;  5MPO A;  3PVL A;  2D2Q A;  1UH6 A;  2LVP A;  3ZVV A;  2MP2 A;  3AXC A;  5IKC M;  4LTU A;  4AJW A;  4HDQ A;  1ZOY B;  1FD6 A;  2LXA A;  3MFG A;  1C78 A;  2MBE A;  3H8H A;  1E8W A;  3N1Y C;  2MH7 A;  4BOS C;  1P9D U;  1VZ8 A;  1SXT A;  4NY0 A;  1AAR A;  2LUE A;  2WS3 B;  4W9K A;  3U30 A;  2KK8 A;  4P1B C;  3KH0 A;  4IM2 A;  2N9K A;  5H92 C;  1RAX A;  4NQL B;  4S17 A;  2KMA A;  5C23 A;  1FO4 A;  2BW2 A;  2NBV B;  1HEZ E;  3MJW A;  1BT0 A;  1YIW A;  3KYD D;  4P7I A;  3DBL B;  2O6V B;  1EWY C;  2MRP A;  4NAM A;  2QDF A;  2M17 A;  1M94 A;  3W1S C;  4ASW C;  4PK1 A;  4PS8 A;  2KDM A;  4C80 A;  1UGM A;  2V4L A;  5DCN A;  3CIR B;  2AL6 A;  2ZNV C;  3PLV A;  4OVU A;  1C1Y B;  2R2O A;  2KMC A;  1CQV A;  2I38 A;  1VLB A;  1NBF C;  2BGF A;  3O13 A;  2KJH B;  2G4S A;  2KDB A;  3ZRF A;  1A5R A;  3UIP B;  3B1L X;  1JRP A;  4A9A A;  1V5T A;  2WX0 A;  1DGJ A;  3A4R A;  2G45 B;  3OJ4 B;  3VUW A;  4KIK B;  2VH2 A;  4XE0 A;  5CHV C;  4US8 A;  3PZD A;  4ZHP A;  4HPM B;  1IPG A;  4ZOH C;  2V3P A;  1WZ3 A;  5BO4 B;  1TY0 A;  3AN1 A;  2W54 A;  3E9S A;  4XYC A;  3MJ5 A;  1OQY A;  2CKH B;  2EEL A;  2PE6 B;  3NS1 A;  2J4X A;  2KLC A;  4DWF A;  1WWT A;  2C7H A;  1RRB A;  3ZNH B;  1XO3 A;  2PVG C;  2ZZP B;  5LXI B;  2MJD A;  1NYR A;  4K7S A;  1J7B A;  2OJW A;  1SE2 A;  3U8Z A;  3RFZ B;  2ACZ B;  3MC8 A;  2K25 A;  2DWQ A;  3ONS A;  4K7W A;  5AZH A;  3UQB A;  1F2R I;  4A90 A;  1E90 A;  3UIN B;  1OEY A;  3APF A;  2K0P A;  1WYG A;  4JQW C;  2KAC A;  3QAQ A;  3A1Q B;  2KVR A;  1HXY D;  3PZ7 A;  2V1Y A;  3WIM A;  1HA5 A;  3CST A;  3AE7 B;  1Z5S B;  3WA0 A;  1MHX A;  2NTS A;  3GB1 A;  2HE7 A;  1NYQ A;  5EE0 A;  2Y3A A;  1Q5W B;  3VFK A;  1J19 A;  1I35 A;  2J0J A;  4MEL A;  2J42 A;  1ISN A;  1YQ4 B;  2JX5 A;  2LGS A;  4AP4 C;  3AUL A;  2KAN A;  3NVV A;  4IWQ A;  1P1A A;  1C4P A;  2BKR B;  2NPT B;  2KZR A;  1JCK B;  3PRP B;  2MX2 A;  4GIV A;  4B95 A;  2W82 A;  1P7F A;  1PQS A;  4RGT A;  2BWF A;  4RFB A;  2ZVN A;  1I4R A;  4RNA A;  4IG7 B;  2N0S B;  3KLS X;  1YX5 B;  2N1W A;  2KWU B;  4DK5 A;  1SJH D;  1E8Z A;  2GMI C;  3ZDT A;  4N9F 4;  1TGZ B;  2LVQ A;  3AED B;  2VZK D;  3DHH C;  3HIZ A;  2FNJ B;  1WXA A;  3U4E G;  5IN7 A;  3BZD B;  2BS4 B;  3GP7 A;  5FKA C;  3AU4 A;  3BYY B;  3ZJU A;  1KJT A;  4ANX A;  4E74 A;  3WAP A;  3AV8 A;  2IDY A;  4DHJ B;  3DWM A;  1IGC A;  4KKJ A;  4P6V F;  5GXG B;  3R3M A;  3SFE B;  4HEA 1;  5JZE B;  2LUM A;  3Q6B A;  3EA6 A;  2ZPN A;  3RUL A;  2MP2 B;  4PYZ A;  3NZU A;  3H9D A;  4G0N B;  3RPF C;  1AYF A;  1YN5 A;  3PTF C;  4L23 A;  1WJU A;  4ANU A;  3I9V 1;  4EKU A;  3A9J A;  2IND C;  3W1S A;  1WZ0 A;  3W5U B;  2ZW0 A;  3AMZ A;  4KSK C;  3K9O B;  1XCT L;  4LDT B;  4ZDV A;  1OFF A;  3TEZ A;  4AUQ C;  4KGR A;  3T9L A;  3VR8 B;  3NHE B;  1XD3 B;  1YN3 A;  1PGX A;  1KH0 A;  2HJ8 A;  3BYT B;  5BYR A;  2JRH A;  1HE8 A;  3VH3 B;  1ZGU B;  2Y5P A;  2B76 B;  4YSZ B;  1NEK B;  3VQI A;  2JXX A;  2QIL A;  3DVN V;  4XDD A;  1RYJ A;  4C7Y A;  1WY8 A;  3JW0 X;  2NVU I;  2K1F A;  3VUY A;  4BKS A;  1CZP A;  2IJ0 A;  5CHW A;  4W9F A;  3AE3 B;  1UZX B;  4MGZ E;  4W9E A;  4JIO U;  1MG8 A;  4YTM B;  3AEG B;  4IW0 A;  2NMQ A;  4N6E B;  3KUC B;  3QJZ A;  2KWD A;  1QOB A;  1UUP A;  2I1K A;  4HCN B;  4KGS A;  1MHH E;  1JRO A;  5IAA C;  1WXQ A;  1HZ5 A;  3Q3O C;  2L83 A;  2NR2 A;  1TYG B;  3ML9 A;  3ZJT A;  4URK A;  2IPK D;  2W3R A;  3PZ8 A;  2IY0 B;  2Z0D B;  2KWC A;  3V60 A;  1P3Q U;  1GTH A;  2QJL A;  5I4D A;  3QQ8 B;  3TEW A;  3UIO B;  3CMM B;  1MPE A;  3W5V B;  2JZZ A;  1L7Y A;  1WMH A;  2R2Q A;  3RI7 C;  1V8C A;  3PHW B;  3R2I A;  2LAS A;  3W2D A;  1Y8R C;  1WGR A;  3CSF A;  1T6B X;  3TMP B;  4J6I A;  1IGD A;  3VRA B;  3R66 C;  2M4N A;  1MVK A;  2N1V A;  1PGA A;  2GBN A;  2X8X X;  3HVZ A;  2PTL A;  2PMV A;  1EO6 A;  3EC8 A;  3N1X C;  1HTO A;  3DCG A;  4RGO S;  5IA7 A;  3S2A A;  1ZW7 A;  4IM3 A;  4CYE A;  4B0M A;  2DBY A;  1B1Z A;  2RDG A;  3ZW3 A;  4FN2 A;  1RFA A;  4ZRQ A;  1TJE A;  3EFU A;  3AB5 A;  4G50 A;  2KTR A;  4MGY E;  1SEB D;  4MT5 A;  4RF1 A;  4D2K A;  2WXP A;  2KDF B;  2JPH A;  1CMX B;  3V3X A;  1ZP0 B;  2WXK A;  4WQO B;  2KXJ A;  1SSN A;  2WXO A;  3IT6 B;  4LCD E;  4C56 C;  1WGK A;  2LI5 A;  2NS5 A;  4OZB A;  1T5X D;  1J7A A;  1FIQ A;  1H7W A;  1D5Z C;  1I7H A;  2WXQ A;  1UF0 A;  2WDQ B;  4DXA B;  3U52 E;  1K53 A;  1FMA D;  4BFR A;  3AEC B;  1RM6 C;  4LLG M;  3H6N A;  2JSV X;  1VDV A;  1N6Z A;  5IP4 D;  1I4P A;  3RNE C;  2ON8 A;  3RNA C;  2BB6 A;  3K9P B;  1QZE A;  3N20 C;  4EOY A;  3GZN B;  5BMI A;  1YOV B;  2E6X A;  5J2R A;  2D07 B;  3ZTD A;  3VRB B;  4HDO A;  2IBI B;  3NRZ A;  4YSY B;  4WJN A;  4CQN A;  4HKZ E;  4HVB A;  2LEK A;  1WM2 A;  4DXG A;  2MJE A;  1TZ1 A;  1C4A A;  2ZJD A;  4MGI E;  2ICI A;  3ZNZ B;  2EMS A;  3A9K A;  2WNM A;  3R7Q A;  2WLB A;  5H8Y E;  2J52 A;  1VRA B;  2FCQ A;  1N60 A;  4RH6 A;  1EM7 A;  3NG0 A;  4DBG A;  1SE4 A;  4DDI D;  1TTN A;  4GN1 A;  4LNF A;  4IC7 B;  2HTH A;  2LXC A;  1KOT A;  3A9J B;  1F0Z A;  1LO5 D;  5CTR C;  2N9P C;  4GMV A;  1TT5 B;  4WWP A;  3SDL C;  4WJQ A;  2QIE B;  1GUA B;  1DYQ A;  3A33 B;  1NI3 A;  2H89 B;  1JWA D;  2MQJ A;  2JZP A;  4CO7 A;  2B3A A;  3TUO A;  2LMC A;  3DPD A;  3ZKJ C;  2CHW A;  3B0A A;  4JX1 C;  3Q3F A;  1JWS D;  4II3 B;  1VJK A;  1WR1 A;  1YD8 U;  1OQQ A;  1R4M I;  2EKI A;  2GOW A;  3AE9 B;  2G3Q B;  4TUU A;  4FLH A;  4ICU A;  4NPN A;  1C76 A;  4E71 A;  3AE1 B;  4WH4 A;  2N7D A;  2MLB A;  2M8S A;  3VR9 B;  3BVM A;  3WAL A;  1WGG A;  2L05 A;  2C7N B;  1C79 A;  1H4R A;  1OGW A;  3BK2 A;  5CHF A;  3I5J C;  3Q3J A;  4YXD B;  3DBR I;  3ENE A;  4KZC A;  1WH3 A;  3IHP C;  3AEA B;  1TIF A;  3NS8 A;  1YQ3 B;  1J7C A;  1VCB A;  3KWL A;  3DWG C;  3LJ3 A;  3JSV A;  3GOE A;  1WE7 A;  5D7G A;  1S3S G;  3DOW A;  3QWZ B;  2L7R A;  1F1H A;  1ZE3 D;  4XZ4 A;  3VVW B;  1HTQ A;  1YN4 A;  5JHB A;  1MJD A;  2BF8 B;  2LZ6 A;  4AS1 A;  1YQB A;  3DVG X;  3PRZ A;  5L95 C;  4WJP A;  2LVO A;  1KM7 A;  5D94 A;  1WMH B;  3PSE B;  4LNI A;  3APD A;  3HUI A;  3DVG Y;  4JWS C;  1XXG A;  1D5M C;  1ACC A;  3BY4 B;  3JYU A;  5L83 A;  4ZYS A;  2LD9 A;  4XWW A;  2V3N A;  4IM0 A;  2DYM A;  4HWI B;  4P1C C;  2DAJ A;  2KKC A;  1EF1 A;  4OVV A;  2YEP B;  3HM6 X;  3FKY A;  1KLU D;  3HM3 A;  3ZO5 B;  1JWB D;  2DYO A;  1B9R A;  3I3T B;  2MHJ A;  4W9H A;  2MSE D;  1FNW A;  3P4P B;  3DQV A;  2KQS A;  1GTE A;  2DZM A;  5D2M B;  3AEF B;  3DDC B;  3ZRC A;  2PPH A;  2FCS A;  3HK0 A;  2PJH A;  3RNB C;  3L13 A;  3GE3 C;  2LGY A;  2KTR B;  2LRU A;  3Q3N C;  2MBB B;  2SAK A;  1WI0 A;  2BVC A;  3V6E B;  1SJE D;  1WM3 A;  4C7Z A;  4B0E A;  1L6U A;  5DPT A;  2LRW A;  2VRR B;  4A8X C;  2MBH A;  2W3S A;  5FK9 C;  1QOF A;  3CF4 A;  5E6O A;  3U7Z A;  1UWX A;  2HDE A;  1HQR D;  2D11 A;  2LJ5 A;  2PEA A;  2A4Z A;  3SR6 A;  4XDC A;  4XC2 A;  4K3C A;  2EKE C;  3DHG C;  1JWM D;  3B2G A;  1C3T A;  3O65 B;  5DPS A;  4JL9 A;  1ENF A;  1OTR B;  3T8M A;  5C1Z A;  1M4V A;  1WGY A;  5JXV A;  3RZW C;  2FIF A;  2PW9 A;  2X38 A;  2M56 B;  3URY A;  4S0R A;  3V6C B;  1PYW D;  3Q14 C;  2CU3 A;  3ALB A;  1XLP A;  3PPA A;  4RGN A;  1FFU A;  3HHM A;  1FFV A;  2YEP F;  2CJN A;  1ZXH A;  1T0R C;  2ZVO A;  4WUR A;  5D3I B;  3ZNI D;  1E7U A;  3A9K B;  4IWO A;  1BML C;  1WX9 A;  1T0Y A;  4LNK A;  4KZ0 A;  3VDZ A;  2NTT A;  4DHZ B;  3RMK C;  2LFI A;  3B9J A;  1WJ6 A;  1NDD A;  2NBW B;  3MC0 B;  3IBE A;  4K1R B;  4AWJ A;  1LXD A;  3W9C B;  4AOF A;  3DBR B;  1E8X A;  2MWS B;  4KVG B;  1GNU A;  3QAR A;  3IFW B;  4FUL A;  1VZ7 A;  2IGG A;  3AI5 A;  3TCA A;  2OED A;  1H8C A;  2LGI A;  2KMM A;  2Z59 B;  3ETR A;  3TEY A;  1J0G A;  4LJP B;  2JYE A;  3PRM B;  2GI9 A;  5AUI A;  2G4D B;  3BVG A;  2Z8L A;  2VZK B;  1TKE A;  4L2Y A;  1T0Q C;  2WDT B;  3DBH I;  1X1M A;  4XX5 A;  3ZXR A;  3SHQ A;  2KJ6 A;  3ML8 A;  3HVD A;  1WFY A;  4GGQ A;  4AQ7 A;  3QCA A;  2CHZ A;  4MGK E;  2KX0 A;  1E6E B;  2JUO A;  3L4P A;  5KHO A;  2GBR A;  4BKG A;  4WQM A;  3A4S C;  2KHW B;  2M19 A;  3P63 A;  4H2A A;  2KYW A;  4M01 A;  2LJI A;  1XLO A;  4FJY A;  2G9H D;  5IO9 A;  1RFK A;  3C0R B;  4LNO A;  4GB9 A;  4G11 A;  1N61 A;  4HCP B;  1UGJ A;  3M3J A;  3JSV B;  5AZG A;  2AWT A;  2KC2 A;  4A55 A;  1V6E A;  3MHZ A;  1V80 A;  3WAN A;  3B2F A;  3ZNG C;  4F8C B;  4OW0 A;  4TV3 A;  2FCN A;  3VHT C;  1ZDV A;  1XEE A;  3L08 A;  4JLC A;  1FNV A;  1D4B A;  1ZDX A;  1KF6 B;  4CHK A;  3VTV A;  2MEK A;  2AEH A;  2CR5 A;  1D6E C;  3EUB 2;  2AQ2 B;  3EFC A;  4EFO A;  1WX8 A;  3BII D;  1WSP A;  2FUH B;  3EEC A;  1UD7 A;  2Y5C A;  3VUX A;  4W9L A;  3HRD D;  3Q8F A;  2KQ4 X;  4JGH B;  4MM3 A;  1TS5 A;  1KFY B;  1N63 A;  1UNS A;  3ZJV A;  1T3Q A;  3JVZ X;  4JWU C;  1I4Q A;  1LGR A;  3LDZ E;  4KKI A;  3I63 C;  2E3T A;  2INC C;  3RT3 B;  2BYT A;  5CX3 A;  2WXR A;  1FCL A;  4N58 A;  4L1B A;  2LHD A;  4EEW A;  1E10 A;  3SFD B;  4YTN B;  1L0X B;  1Q0W B;  2RPQ A;  2ONQ A;  2RMM A;  1VZ6 A;  4IOI E;  2FAZ A;  1WGD A;  1IYF A;  2KQ7 A;  2XK5 A;  3C19 A;  1GC7 A;  1XLQ A;  2FE8 A;  2WGS A;  3ZTC A;  2WU5 B;  1ZUD 2;  1WE6 A;  5FR6 A;  4USA A;  4IWP A;  2WXG A;  1JWU D;  2A5U A;  4BOZ B;  3R8B A;  1FEH A;  2K8H A;  3C8Y A;  1WJN A;  1GC6 A;  2JWZ A;  4IDI A;  3LYY A;  2KTF A;  1WXS A;  2AYO B;  4OVZ A;  1FM0 D;  2YLM A;  3OLM D;  4Q2J A;  3RNC C;  3UGB B;  1MI0 A;  2PKO A;  3N32 A;  4TKN A;  3W1Y A;  1WXM A;  2UYZ B;  3ZUN A;  4MSM B;  5TR5 A;  2KWV B;  2Z0E B;  3NZS A;  1FXA A;  2KFJ A;  3FC4 A;  3P2B A;  1FRR A;  5BYQ A;  1TS3 A;  1P7E A;  3AE8 B;  1TS4 A;  2JF5 A;  3AEE B;  1N5W A;  2CHX A;  2V0G A;  5KHQ A;  1QT9 A;  2DHZ A;  2KFK A;  2IGH A;  3PT2 B;  4OZA A;  4DXF A;  2N7E A;  1WRI A;  2XNA C;  4IUM B;  3L0W B;  3TEX A;  3J9C A;  2QHO A;  2KD0 A;  3N1Z C;  2ZCB A;  3VTW A;  3ECI A;  4ICV A;  2GB1 A;  1FCC C;  4HLE A;  5HKH A;  4WAA A;  1GAQ B;  2QEJ C;  4BZA A;  4F7Z A;  4GDK A;  3IT4 B;  3NUH B;  3KUZ A;  4MEM A;  4GLS C;  2WU2 B;  2K9X A;  3P4R B;  2NCN A;  4W9G A;  3AEB B;  1F77 A;  1CK1 A;  2DEN B;  2JU6 X;  2DZI A;  1WX7 A;  1OEY J;  1RWS A;  2L8J A;  3I57 A;  3L54 A;  1GT8 A;  2D3C A;  2ZEQ A;  1V9J A;  5G2N A;  1FXI A;  2JY6 A;  1WYW B;  1WIA A;  1V2Y A;  1UBI A;  3NZ3 A;  1SE9 A;  4HXD A;  2ZCC A;  4HPP A;  2OJR A;  3TL5 A;  2H88 B;  3IAM 1;  1L2N A;  3AU5 A;  2IO1 B;  1K51 A;  5E6J A;  4NAW A;  4MJS A;  3QK0 A;  5IOI A;  1AWD A;  3RN9 C;  5HG2 A;  2BT6 A;  2WXL A;  3ZDM C;  4GDL A;  3V62 A;  4XWT A;  4KDL B;  4LJO B;  2L00 B;  3QC8 B;  1JML A;  3V05 A;  3BIN A;  4XGA B;  2C9W B;  1C4C A;  4TQ0 A;  3QA8 A;  3KW5 B;  1G6J A;  3FAH A;  2JT4 B;  4A3O A;  2K3U A;  5D6J B;  3UQA A;  2ZNV B;  3NVW A;  4RMA A;  3X0W A;  1WRD B;  1Q10 A;  1I4G A;  1YJ1 A;  4A6Q A;  2BS3 B;  3OWE B;  4MDK E;  1J8C A;  3AE2 B;  4BKT A;  2W55 A;  2INP E;  4MH0 E;  2GLS A;  1EU3 A;  3GE8 C;  2KN5 A;  3QX1 A;  2DZJ A;  1PFD A;  1XLN A;  1QKZ A;  3Q8C A;  1WJ4 A;  1DOY A;  2WQY B;  4EZK A;  2FUG 1;  3BVZ A;  1N5X A;  4NNJ B;  2DYB A;  1I4X A;  1SIJ A;  3AM9 A;  4FA6 A;  4GXB A;  3LB8 C;  2PE9 A;  2CS4 A;  4MM3 B;  4N59 A;  2FBW B;  4HRS A;  2D5G A;  4I6L B;  5J17 A;  1JQ4 A;  4DDG D;  1R4N I;  1UBQ A;  1DOI A;  2PVO D;  2BQQ A;  4K81 A;  3T3O A;  4M00 A;  5DPR A;  3RNF C;  1ZKH A;  4EUT A;  2BYF A;  2KN4 A;  2R61 A;  5D3D A;  2O6V D;  4FBJ B;  2CU1 A;  3IXS A;  1LQB A;  4IKG A;  2V3S A;  1T0S C;  2MW5 A;  1QLB B;  4KDI C;  4NQK E;  3BK1 A;  4JPS A;  2K8C A;  3H1U A;  1YJI A;  1OQR A;  5C3J B;  2AL3 A;  3TBL D;  2BYE A;  5HI1 A;  1N62 A;  3P42 A;  2FID A;  1PGB A;  3NOB A;  2YVC A;  2XK5 B;  4B9K A;  5EDS A;  1EWC A;  2IZV B;  2LWP A;  2W9N A;  1I42 A;  3RYT A;  2DAF A;  3GS2 A;  2JYT A;  1P0R A;  3EGR A;  3NY5 A;  3L10 B;  2IGD A;  4B6W A;  2BS2 B;  4YTP B;  4NJC A;  4M0W A;  3Q3M C;  4WIP A;  3OJ3 A;  3CF6 E;  2L3Z A;  4YSX B;  4HPL B;  3WAO A;  4C00 A;  4YWG G;  1IBX A;  3ZYY X;  4ARI A;  1NEN B;  4FJV B;  4GSW A;  2ZPY A;  3Q8E A;  4NJ6 A;  2JZ3 B;  1BXT A;  3VXW A;  3Q69 A;  3X23 A;  3SEB A;  1E8Y A;  2L0F A;  3AE4 B;  4YT0 B;  5EE1 A;  2GBK A;  2KFK B;  2KVZ A;  2PLP A;  5JHA A;  4BAX A;  5BYS A;  2K39 A;  2L0T A;  4LNN A;  1XF5 L;  3UF8 A;  4ITK A;  3BWU D;  2V9H A;  4YL8 A;  5G55 A;  2BPS A;  1C9F A;  1ET6 A;  1P98 A;  4ZHO A;  2M0X A;  2WXI A;  2MCN B;  3MP9 A;  4K3B A;  2AQ3 B;  3P1M A;  2JXT A;  1V97 A;  1L5P A;  4PYU A;  4GDK B;  3Q2A C;  3QHT A;  4HJG E;  1WXV A;  1JW9 D;  3DVN U;  5LNK 1;  3KWV A;  1WGH A;  2G1E A;  4W9I A;  1Q1O A;  3M95 A;  1K50 A;  5G5H A;  2OHF A;  3EHV A;  4R3D A;  2WP9 B;  2DLB A;  2REX A;  3ABV B;  1YJJ A;  2LGX A;  2LHE A;  3H7S A;  1FXT B;  2KC1 A;  2M1M A;  2RGF A;  1ZPS A;  2C7M B;  2V4I B;  2CJO A;  4DQO C;  2K6Q A;  3R7R A;  3U2S C;  4BVU C;  2L1A A;  2VH1 A;  4RM8 A;  2NBU A;  2Q5W D;  4RM9 A; 
#chains in the Genus database with same CATH homology
 1T5X D;  1J7A A;  2MEK A;  2WS3 B;  1FIQ A;  1H7W A;  1D5Z C;  3CWI A;  1I7H A;  2WXQ A;  1D6E C;  3EUB 2;  2AQ2 B;  2L52 A;  2WDQ B;  2J53 A;  3U52 E;  3BII D;  1WSP A;  1TKY A;  2Y5C A;  1K53 A;  1FMA D;  2N9K A;  3AEC B;  1RM6 C;  4LLG M;  3HRD D;  3Q8F A;  4LK0 M;  2KQ4 X;  1TS5 A;  1KFY B;  1N63 A;  1UNS A;  1VDV A;  2JSV X;  4FXC A;  5H92 C;  1FO4 A;  1T3Q A;  4NAW B;  3ZJV A;  2BW2 A;  1HEZ E;  4JWU C;  1I4P A;  1YMH E;  1I4Q A;  1E9M A;  3E56 A;  4OZC A;  2ON8 A;  2BB6 A;  2QSD A;  5EE3 A;  4KKI A;  1EWY C;  2N9L A;  4NAM A;  2E3T A;  5HHD G;  2N7J A;  4GDL B;  5BMI A;  2BYT A;  5TSS A;  2AQ1 B;  2WXR A;  1FCL A;  4N58 A;  2E6X A;  2KDM A;  2M0A A;  4L1B A;  2LHD A;  4C80 A;  2JWU A;  1E10 A;  3SFD B;  3VRB B;  4YTN B;  1L0X B;  3NRZ A;  3CIR B;  4YSY B;  2ONQ A;  2RMM A;  4CQN A;  4HKZ E;  2LEK A;  4RCO A;  1VZ6 A;  4IOI E;  4DXG A;  2MJE A;  1C4A A;  2ICI A;  2L32 A;  1CQV A;  2I38 A;  1VLB A;  1XLQ A;  2FE8 A;  3O13 A;  2WNM A;  2WLB A;  2WU5 B;  1ZUD 2;  5H8Y E;  2J52 A;  1VRA B;  2I2Y A;  4USA A;  2K5P A;  1JRP A;  1N60 A;  4A9A A;  1DGJ A;  4RH6 A;  1EM7 A;  4C56 C;  2WXG A;  1JWU D;  1SE4 A;  4XE0 A;  3R8B A;  1F0Z A;  4US8 A;  1LO5 D;  4ZHP A;  1FEH A;  1SBB B;  1K52 A;  2KAJ A;  1QQR A;  2MJ3 A;  3C8Y A;  4ZOH C;  2V3P A;  3AH7 A;  1TY0 A;  2QIE B;  3AN1 A;  2W54 A;  4IDI A;  1YNT E;  3E9S A;  3LYY A;  1DYQ A;  3MJ5 A;  1NI3 A;  2H89 B;  3Q8A A;  2EEL A;  1JWA D;  3NS1 A;  2J4X A;  1FM0 D;  2JZP A;  1R7S A;  4OVZ A;  4Q2J A;  4WWM A;  3TUO A;  1TS2 A;  2LMC A;  1WWT A;  1MI0 A;  2WXM A;  1XO3 A;  2PVG C;  2MJD A;  2PKO A;  1NYR A;  4OHJ A;  1J7B A;  4JX1 C;  4REZ A;  1JWS D;  1SE2 A;  1Y56 A;  1VJK A;  3RFZ B;  2ACZ B;  1FXA A;  2DWQ A;  1OQQ A;  3FC4 A;  1FRR A;  5BYQ A;  1TS3 A;  1P7E A;  3AE8 B;  1TS4 A;  3UI3 A;  2EKI A;  3AEE B;  3AE9 B;  1F2R I;  1N5W A;  1V1O A;  5BMG A;  4A90 A;  2V0G A;  1QT9 A;  3FIL A;  2K0P A;  1C76 A;  3AE1 B;  1WYG A;  4WH4 A;  2IGH A;  2KAC A;  4OZA A;  4DXF A;  1HXY D;  1WRI A;  2XNA C;  3PZ7 A;  3VR9 B;  3BVM A;  2GRI A;  3TEX A;  3J9C A;  4KGT A;  1HA5 A;  3AE7 B;  1C79 A;  4MH8 A;  1H7X A;  2GB1 A;  1FCC C;  3BK2 A;  1MHX A;  2NTS A;  3GB1 A;  4P16 A;  1GAQ B;  4YXD B;  1NYQ A;  2QEJ C;  3LXF A;  5EE0 A;  2Y3A A;  1V1P A;  3AEA B;  1KTK A;  3AE5 B;  1QIL A;  3IT4 B;  3NUH B;  4GLS C;  2WU2 B;  4WAF A;  1YQ3 B;  1J7C A;  3NVY A;  1HZ6 A;  2K9X A;  2J42 A;  1IUE A;  3P4R B;  1YQ4 B;  3KWL A;  3NVZ A;  3AEB B;  3DWG C;  1F77 A;  2JX5 A;  1CK1 A;  5D7G A;  2JU6 X;  1ZE3 D;  1YN4 A;  3NVV A;  4AS1 A;  1C4P A;  1RWS A;  3I57 A;  1GT8 A;  1KLG D;  1L0Y B;  1QF6 A;  1FXI A;  1JCK B;  1GB1 A;  1IBX B;  1TZO A;  1C77 A;  1GPX A;  3HUI A;  4JWS C;  1XXG A;  2W82 A;  1D5M C;  1ACC A;  1P7F A;  3IAS 1;  4RGT A;  4TSS A;  1ESF A;  3NZ3 A;  4RFB A;  4ZYS A;  1I4R A;  4RF0 A;  2AX5 A;  4RNA A;  3ZQ4 A;  2WXH A;  5G5G A;  4XWW A;  1ZXI A;  2V3N A;  2DYM A;  2N0S B;  3KLS X;  1FRD A;  5EE9 A;  2H88 B;  2QMT A;  3IAM 1;  1SJH D;  1K51 A;  5E6J A;  1AW7 A;  2WDV B;  2JQR B;  2YEP B;  3AED B;  2VZK D;  1KLU D;  1JWB D;  3P4Q B;  1CJE A;  1AWD A;  2DYO A;  5HG2 A;  3U4E G;  2BT6 A;  2WXL A;  1B9R A;  3BZD B;  2WXJ A;  2BS4 B;  1FNW A;  3P4P B;  3GP7 A;  5FKA C;  1QOA A;  4XWT A;  4EE2 A;  3T3N A;  1GTE A;  1JML A;  3BYY B;  3V05 A;  3ZJU A;  3AEF B;  4PT5 A;  1C4C A;  4ARC A;  4TQ0 A;  3AV8 A;  2IDY A;  3AE6 B;  3FAH A;  3DWM A;  1IGC A;  4KKJ A;  4P6V F;  5GXG B;  4HEA 1;  3SFE B;  1ROE A;  2HTM E;  2K3U A;  5C2T B;  3NVW A;  2LUM A;  1Q10 A;  1I4G A;  4A6Q A;  2SAK A;  3EA6 A;  2BS3 B;  2INN E;  3OWE B;  4TMA B;  3AE2 B;  2W55 A;  2INP E;  1FNU A;  1EU3 A;  5AUK A;  1SJE D;  2RPV A;  4C7Z A;  3RPF C;  1AYF A;  1PUT A;  1PFD A;  1SF0 A;  1XLN A;  1YN5 A;  4B0E A;  1QKZ A;  3Q8C A;  4L23 A;  1L6U A;  1DOY A;  1L4Z B;  3I9V 1;  4A8X C;  5FK9 C;  2W3S A;  2WQY B;  1QOF A;  3W1S A;  2FUG 1;  1D5X C;  3CF4 A;  3BVZ A;  1N5X A;  2ZW0 A;  3U7Z A;  3W5U B;  1UWX A;  3AMZ A;  2HDE A;  1HQR D;  4ZRP A;  1AN8 A;  1I4X A;  4UDU C;  1XCT L;  1SIJ A;  2ZW1 A;  3SR6 A;  1L0V B;  1OFF A;  3AM9 A;  5HFY A;  3TEZ A;  4KGR A;  3LB8 C;  4HRO A;  4XDC A;  3VR8 B;  1F2R C;  1YN3 A;  4MM3 B;  1PGX A;  4N59 A;  2FBW B;  3PO0 A;  2D5G A;  4HRS A;  1JQ4 A;  2BB5 A;  1JWM D;  3B2G A;  1QOG A;  1DOI A;  2PVO D;  1ENF A;  1KH0 A;  1M4V A;  3BYT B;  5BYR A;  5JXV A;  3T3O A;  2PW9 A;  2Y5P A;  2B76 B;  4YSZ B;  1NEK B;  2K22 A;  2WXN A;  2X38 A;  2KN4 A;  2M56 B;  3R2T A;  3URY A;  3VQI A;  1VR9 A;  1PYW D;  2QIL A;  4MAC A;  4XDD A;  1RYJ A;  2R61 A;  4C7Y A;  5D3D A;  2CU3 A;  1GB4 A;  3IXS A;  4IKG A;  1CZP A;  1XLP A;  2IJ0 A;  1QLB B;  1XCQ L;  1DOX A;  2XN9 C;  3BK1 A;  4JPS A;  4KX6 B;  3AE3 B;  1STE A;  1UWM A;  1YJI A;  2SEB D;  1OQR A;  5C3J B;  4RGN A;  1FFU A;  1FFV A;  5HI1 A;  1N62 A;  3P42 A;  4YTM B;  1PGB A;  2CJN A;  2YEP F;  3AEG B;  3ZGZ A;  3Q8B A;  1ZXH A;  4US9 A;  2NMQ A;  4N6E B;  5BMH A;  1EWC A;  4WUR A;  5D3I B;  1I4H A;  2KWD A;  1QOB A;  1UUP A;  1SB3 C;  1BML C;  4KGS A;  3WCQ A;  1MHH E;  1JRO A;  3GS2 A;  2JYT A;  3EGR A;  2NTT A;  1WXQ A;  1HZ5 A;  1NVI D;  1L4D B;  2IGD A;  2LFI A;  2L83 A;  3B9J A;  2BS2 B;  4YTP B;  1TYG B;  3MC0 B;  3ZJT A;  4NJC A;  4M0W A;  2IPK D;  1JAL A;  1KRH A;  2W3R A;  3PZ8 A;  4RGM A;  3P4S B;  4WIP A;  1GTH A;  4HKQ A;  4YSX B;  2QJL A;  5I4D A;  3W9C B;  3TEW A;  4NZL B;  1E0Z A;  1L6V A;  1MPE A;  1GOZ A;  4YWG G;  1IBX A;  3W5V B;  1VZ7 A;  1TKG A;  2IGG A;  3ZYY X;  2BBC A;  1NEN B;  1V8C A;  4ARI A;  3N9Y C;  1EU4 A;  3R2I A;  2OED A;  1ET9 A;  4J3O D;  3Q8E A;  2LGI A;  2KMM A;  4O1N A;  3W2D A;  3ETR A;  1BXT A;  3TEY A;  3Q69 A;  2JYE A;  5AUI A;  2GI9 A;  3SEB A;  3BVG A;  2Z8L A;  2VZK B;  3AE4 B;  1T6B X;  1TKE A;  4YT0 B;  2TSS A;  4L2Y A;  5EE1 A;  2WDR B;  1IGD A;  2WXF A;  3FIL B;  5FR3 A;  3VRA B;  2PLP A;  1MVK A;  1BUI C;  2BTE A;  1PGA A;  1E7P B;  3HVZ A;  5BYS A;  1XF5 L;  4ITK A;  3BWU D;  3HVD A;  2PTL A;  2PMV A;  1C9F A;  1ET6 A;  4JE3 B;  1PDX A;  1TY2 A;  4ZHO A;  3TSS A;  3KQ4 A;  4AQ7 A;  2WXI A;  1A70 A;  1E6E B;  3MP9 A;  3L4P A;  4RGO S;  1SE3 A;  2AQ3 B;  2RDH A;  3P1M A;  4WQM A;  2JXT A;  1V97 A;  2M19 A;  3P63 A;  4H2A A;  1V1P B;  2PIA A;  1L5P A;  2LJI A;  1XLO A;  4B0M A;  2G9H D;  4GDK B;  2DBY A;  1B1Z A;  2RDG A;  4TQ1 A;  4HJG E;  1RFK A;  5T8I A;  1JW9 D;  4ZRQ A;  1TJE A;  3AB5 A;  5LNK 1;  1N61 A;  3KWV A;  1UGJ A;  2G1E A;  1SEB D;  4MT5 A;  4RF1 A;  4D2K A;  1K50 A;  5G5H A;  5MPO A;  2WXP A;  2OHF A;  4R3D A;  2WP9 B;  2DLB A;  4A55 A;  3MHZ A;  3ABV B;  1YJJ A;  2LHE A;  3B2F A;  1ZPS A;  4OW0 A;  4LTU A;  2V4I B;  3V3X A;  1ZP0 B;  2CJO A;  4DQO C;  1ZOY B;  1FD6 A;  2WXK A;  3U2S C;  3MFG A;  2L1A A;  1C78 A;  1ZDV A;  1XEE A;  3H8H A;  2Q5W D;  1SSN A;  1FNV A;  2MH7 A;  2WXO A;  1D4B A;  1VZ8 A;  1ZDX A;  3IT6 B;  1SXT A;  1KF6 B;  1WGK A;  4OZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...