1E7PB

Quinol:fumarate reductase from wolinella succinogenes
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Third Crystal Form of Wolinella Succinogenes Quinol:Fumarate Reductase Reveals Domain Closure at the Site of Fumarate Reduction
pubmed doi rcsb
source organism Wolinella succinogenes
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
total genus 55
structure length 239
sequence length 239
chains with identical sequence E, H, K
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2000-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1e7pB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e7pB01
1QLBB 3AE7B 1T3QA 1YJIA 4USAA 1N5WA 2N0SB 3W5UB 2M19A 2WU2B 1E10A 3PO0A 4IDIA 3CF4A 2WU5B 1SIJA 1TKYA 2JQRB 1YQ4B 3ETRA 1JROA 5G5HA 1FM0D 2M56B 1J7CA 1E9MA 2AX5A 2JX5A 3AE8B 1B9RA 1JQ4A 3KWLA 3AMZA 1GTHA 3AE2B 2LEKA 4YT0B 1QT9A 2QIEB 2BS3B 1CZPA 1TKGA 4WQMA 1VLBA 1QOFA 2W3RA 3SFEB 5G5GA 1UWMA 2PVOD 2WDRB 1KFYB 1CJEA 2W3SA 3AEDB 1WWTA 3P63A 1N5XA 3B2FA 1SB3C 5GXGB 1YQ3B 1ZP0B 2FBWB 2K5PA 2MJEA 5C3JB 2E3TA 3WCQA 1L0VB 1TJEA 2B76B 1V8CA 2DBYA 1SF0A 3VR9B 5MPOA 3NVWA 3AE6B 1TYGB 3AB5A 1XLQA 1OQRA 4C7ZA 1KRHA 2MH7A 1RWSA 2KMMA 2PIAA 4N58A 1XLPA 1FFVA 1VJKA 3NRZA 5EE0A 1DOYA 1GAQB 3CIRB 3AEEB 1R7SA 1EWYC 3AM9A 4A9AA 1E7PB 3AEAB 1QOBA 3NVVA 1IUEA 2BS4B 1FFUA 2CJOA 2WLBA 3P4SB 3NVZA 1JW9D 2PKOA 1DOIA 1RM6C 1FRRA 4JX1C 4JWUC 1H7WA 1WYGA 1ROEA 3HRDD 3LXFA 4JWSC 1GPXA 2OHFA 2BS2B 2H88B 4YTMB 1WXQA 3AEBB 1QOGA 2DWQA 2HTME 3AE9B 3P4PB 1FXIA 1OFFA 1PFDA 1YJJA 3FC4A 1ZXIA 3AECB 3L4PA 3AE1B 3VR8B 1JRPA 1E6EB 3AE4B 1A70A 2WDVB 5EE1A 4C7YA 3AH7A 5EE9A 1GTEA 1DGJA 5AUKA 1NEKB 4ZOHC 5H92C 2G1EA 3DWMA 3FAHA 4FXCA 5AUIA 2WP9B 3HVZA 3AEGB 4YTNB 1AYFA 2Q5WD 3LB8C 3VRBB 3P4RB 1JWAD 3RPFC 1JWBD 4HRSA 4HROA 4ZHPA 3NVYA 1GT8A 4KX6B 1PUTA 1QOAA 2MJDA 1N63A 1XLOA 3AE5B 3AE3B 1RYJA 3NS1A 1TKEA 1L6UA 5C2TB 1ZOYB 1FMAD 1KF6B 3VRAB 2MJ3A 4YSXB 1N62A 2Y5CA 4P6VF 1FO4A 2K22A 1ZUD2 1WRIA 4ZHOA 2WS3B 4US9A 1V97A 1I7HA 3CWIA 1J7BA 4WWMA 1NVID 4C80A 3SFDB 1RFKA 1WGKA 4N59A 2L83A 2KAJA 4ITKA 2H89B 1VDVA 3SR6A 2CJNA 1NI3A 3W9CB 2W55A 1FXAA 4YXDB 3EUB2 4YSYB 2WDQB 1N61A 3AV8A 1JALA 3AEFB 1N60A 2BT6A 2CU3A 2W54A 1XLNA 3DWGC 1PDXA 3AN1A 1F0ZA 1J7AA 2L52A 2EKIA 1AWDA 3B2GA 4LTUA 1XO3A 3ZYYX 3W5VB 4YTPB 3B9JA 1NYQA 3HUIA 2ACZB 1L5PA 1L6VA 2K9XA 2QJLA 1NENB 4N6EB 2PVGC 3ABVB 1FIQA 3P1MA 3BIID 2WQYB 1FRDA 5EE3A 3P4QB 4YSZB 5H8YE 1QF6A 1DOXA 1E0ZA 1NYRA 1OQQA 1H7XA 4US8A
chains in the Genus database with same CATH superfamily
1QLBB 1F2RC 1N5WA 4BZAA 4RM9A 2MEKA 1L4DB 2RR9A 1FEHA 1E10A 5G5HA 3IT4B 3MC8A 3H8HA 3QCAA 2J42A 2ZCCA 1RRBA 4CQNA 1TS3A 1GTHA 1QT9A 1EF1A 1WF9A 2XN9C 1R4MB 1J0GA 1SJHD 1GOZA 3UINB 3A9JA 1K52A 1VZ8A 1UGJA 2PEAA 2RPQA 3R66C 2DX5B 2LZ6A 3N3KB 1GAQB 1Q0WB 1YMHE 3AEAB 3MHSD 3BYYB 2WLBA 4L2YA 2D10A 2FUHB 4K81A 1UBQA 1R4NI 4EE2A 1BUIC 2WXQA 1WXQA 5CHVC 4XE0A 3FC4A 2JYTA 4IM3A 4M01A 2D3AA 4C7YA 4KKIA 4RGMA 4A6QA 1WGGA 2A4ZA 1E8WA 4W9IA 3ZNID 4AJYB 2KXJA 3ECIA 4DHZB 5BMHA 1CK1A 3SFDB 4K1RB 2I2YA 1TS5A 1VDVA 5BYSA 2HE7A 1VD2A 1FXAA 4YXDB 3Q69A 1XLNA 4A3OA 1WE7A 4AP4C 2AQ2B 3PVLA 4E74A 3ML9A 4HKQA 3ZGZA 1K51A 3ZXVA 1TS2A 2D3BA 2KWUB 3NZUA 4OHJA 1E0ZA 4WIPA 2D07B 2N0SB 2DYBA 1NBFC 4XGAB 4A8XC 1TKYA 3WANA 2V0GA 3R7QA 3HM6X 1QOFA 5IAAC 2V3PA 3ZKJC 2N9PC 2BBCA 2ASQA 3HHMA 5LXHA 4ZYNA 1HTOA 5CTRC 4RCOA 1HEZE 4MELA 2INCC 4KIKA 2B3AA 4XDDA 2PIAA 2KANA 1E8ZA 3NY5A 3WALA 4EZJA 2LI5A 3P2BA 3SDLC 1FRRA 2Z59B 3HRDD 2GOWA 3L10B 3WAOA 2DLBA 3B1LX 1YJJA 2PW9A 1E90A 4GXBA 1JCKB 2KN4A 2LJIA 5EE9A 1XQQA 1CMXB 2KJRA 2M0XA 2KT7A 2DZIA 4DHZE 1TY2A 4W9EA 2OEDA 2HJ8A 4ZHPA 2BQQA 2QC8A 5JHAA 1QOAA 2FIDA 3OG5A 3DPDA 2MJ3A 5KHQA 4GOCA 4OVVA 3WIMA 2H89B 4PT5A 2OOBB 3ZLZA 1YQBA 2BT6A 2GMIC 2LFIA 2EMSA 4PK1A 1ZDXA 3UGBB 2MLBA 1Y56A 3T3OA 2K9XA 2Z0DB 3RMKC 4ZRPA 3ZQ4A 2PVGC 4WQOB 2RSUA 3B0AA 1EWCA 1I35A 2EKEC 3TMPB 2JQRB 4ANXA 2INDC 1WI0A 1FO4A 1MHHE 3DBLI 1C77A 1P1AA 2NTSA 1VR9A 2W3SA 1XT9B 1ESFA 2LUEA 4JIOU 2G3QB 2O6VB 3NVWA 2DZKA 3DBHI 3VXWA 1G6JA 1ZW7A 4OW0A 2Y5PA 2KMMA 1FFVA 5E6PA 1WXSA 2CU1A 4DXFA 4P16A 2L32A 3NVVA 2N9XA 1NDDA 1BXTA 1VRAB 4M0WA 3QQ8B 5T8IA 3PLVA 4JWSC 3BY4B 2BS2B 3DBRI 2NBWB 2KVZA 1F1HA 2J7QB 1OFFA 4II2B 2LVPA 4B95A 3M3JA 5EE1A 4DXGA 4NQKE 1K50A 2JZ3B 1WM2A 3N9YC 1HA5A 4L1BA 3VTUA 4WWNA 2QHOA 2MJDA 1FMAD 4YSXB 1N62A 4WJOA 1ACCA 4G3XB 4FADA 2GRIA 1NVID 1LGRA 3ZUNA 3L0WB 3W9CB 4GB9A 2AL6A 2OJRA 1TZOA 4AS1A 3RFZB 3TBLD 2L52A 2ON8A 2KDEB 2ACZB 1L5PA 3RCZA 2V3SA 1NENB 4LNIA 2VZKB 3ZRCA 1FRDA 1QF6A 5G2NA 2KX3A 2N7EA 2KO3A 1UGMA 4MM3B 4ASWC 4YL8A 4HDOA 4FBJB 2M1MA 4FULA 2WXOA 1J7CA 3TEXA 3AE8B 5IO9A 3H7PA 3L16A 4WQMA 2PPHA 3GE3C 2WDRB 4OVZA 1HQRD 2QMTA 1ZP0B 4XWTA 2DZMA 3WCQA 1TJEA 3PSEB 3EFUA 1V8CA 1OGWA 3HK0A 2C60A 1UELA 2FE8A 1WGDA 1D5ZC 3VH4B 3I9V1 1RAXA 2WX1A 4C7ZA 1WJUA 2MH7A 3IAS1 2ZJDA 3W1SA 2IY0B 2CJOA 2BS4B 1TT5B 3Q8FA 2GBMA 4JQWC 4ANWA 1SSNA 3DCGA 4K7WA 3PS6A 1WMHA 2KWDA 1I4PA 5H92C 4MACA 3AE4B 5AZGA 5I4DA 4CHKA 4M00A 4FXCA 3RN9C 3I5JC 3V3XA 3P4RB 4J3OD 4HRSA 4CO7A 2CHWA 4KX6B 2V9HA 2AQ3B 1PUTA 1MFWA 1XCTL 1WZ0A 2MBHA 2IBIB 5C2TB 2C7MB 1I4QA 1ZUD2 3DDCB 4RNAA 2KAJA 1M4VA 2KDIA 1BT0A 2FUG1 2KOXA 3R3MA 1JRUA 3TL5A 2L3ZA 3B9JA 1L0XB 2AWTA 3P1MA 4H2AA 2WQYB 4A20A 5H8YE 4IKGA 4UDUC 3U30A 1HZ6A 4US8A 1T3QA 3PV1A 2HJ1A 3CMMB 5JXVA 1FCCC 3APCA 2CKHB 4HWIB 3RNEC 2PJHA 1TKGA 1P9DU 1AW7A 2QDFA 3B2FA 4P7IA 1YQ3B 2E3TA 4REZA 1FPYA 3NS8A 4J6IA 2VRRB 2BYVE 4EUTA 5DPRA 3Q2AC 5D6JB 4JLCA 3IXSA 5EDSA 3PHXB 3N1ZC 5CHFA 3BZDB 3Q14C 4NZLB 2KNBA 4JWUC 1WXVA 3A9KB 4RM8A 3O13A 4IG7B 2OHFA 4W9LA 2DWQA 2N9EB 3L54A 2KX0A 4MGKE 2J52A 1JRPA 1AN8A 2LHEA 1IBXA 3AH7A 1GTEA 2OJWA 4LJPB 3KQ4A 4ZRQA 3R2IA 4BOZB 1JWAD 1JWBD 3ONSA 1WFYA 3EC8A 5BMGA 2ZPNA 1RYJA 1IBXB 1ZOYB 1WE6A 4LDTD 1WRIA 4C80A 2MP2B 2ZPYA 1RFKA 3MFGA 4JE3B 5D94A 4B0MA 2CJNA 3I57A 1ET9A 4WAFA 4HJGE 5TR5A 1JALA 1F0ZA 1LQBA 3Q8BA 1J7AA 2PE9A 2BF8B 3NJTA 4URKA 1L4ZB 1VZ7A 2IO3B 1Q5WB 3NZ3A 3EECA 1DOXA 1P3QU 3GZNI 3PRZA 4GMVA 1U4AA 2L1AA 4QAYA 2INNE 2J53A 1KTKA 2PE6B 3PO0A 1SIJA 2ZVNA 2M56B 2JX5A 4WWPA 1WIAA 3KWLA 2GI9A 4HCPB 3RNCC 3IHPC 3Q3MC 3ZJVA 2MJEA 2FCSA 2LVQA 3QWZB 3EHVA 3JSVA 4MEMA 4LJOB 1K8RB 3M62B 3FILB 1QILA 1R7SA 5LLIA 3KUZA 1DOIA 1IGCA 1T0RC 3PTFC 3GOEA 4Q2JA 2X8XX 3KWVA 1WM3A 3AE9B 3NZSA 2CHZA 2DYOA 1UD7A 2JWUA 1YX5B 2NR2A 2WDVB 3I63C 1NEKB 1TZ1A 2JU6X 3CSFA 3ZTCA 4IWOA 1FNWA 1V81A 2WDTB 4LCDE 4HJKA 5HHDG 4A3PA 2WS3B 1J7BA 3M63B 4AJWA 3PHWB 2W9NA 1C78A 2LUMA 2L8JA 2A5UA 2YVCA 2NCNA 3IVFA 1EU4A 4RGTA 2MBEA 2KACA 2WDQB 3UI3A 3AEFB 5E6NA 2DAJA 1LXDA 4RF0A 3ZJTA 1LFDA 1L0YB 1XO3A 3OAWA 3DOWA 3PZ7A 1KLVA 2AEHA 4DHJD 1R4MI 3QA8A 1S1QB 3H9DA 4AOFA 2BW2A 3BIID 3AU5A 3P4QB 3UIOB 5GMVA 4CYEA 4II3B 1T0QC 3HM3A 4XC2A 4G50A 4GDKA 4JGHB 3BYTB 1IYFA 1F52A 1E9MA 2RDBC 4PS3A 3TEZA 3W1SC 5L95C 1UWMA 2Y5BB 1MI0A 1OEYJ 5HKHA 1NI2A 1WWTA 2PTLA 1E8XA 1SXTA 3KW5B 4TSSA 4AUQC 1T0SC 1LM8B 3GP7A 2PLPA 4AQ7A 4L23A 1C4PA 5DPSA 3DHHC 1XLPA 1WMHB 1E7PB 2GLSA 4G11A 3NVZA 1FFUA 2KMCA 3P4SB 1Z2MA 4GDLA 2TSSA 1I4GA 4M0WB 4B9KA 4MDKE 2ZNVC 3DHGC 2O2VB 1DGJA 1PGXA 1ZXHA 1V80A 2G1EA 3VTVA 4BVUC 1AYFA 2Q5WD 1UH6A 2BPSA 3PLUA 3NVYA 5DCNA 4RGNA 1P7FA 1KLUD 4M8NA 2FCQA 4IOIE 2JZZA 4GDLB 2K6DB 3N20C 1P0RA 3MC9A 3AN1A 1C4CA 3PPAA 4KIKB 2KWCA 4FJVB 3PT2B 2JT4B 4HKZE 4ZRIA 3RNGC 4HXDA 3AE7B 3URYA 2DAFA 3JSVB 1YQ4B 2DYMA 3NG0A 1B9RA 2JSVX 4DK5A 1L7YA 1JWMD 2QIEB 3A9KA 2KFJA 4GDKB 3SFEB 2PVOD 3UF8A 2G45B 3BVMA 3TCAA 2KTFA 2NPTB 1F9JA 2WXHA 4RMAA 2XK5B 5IOIA 2KK8A 2HTHA 2JYEA 3Q8EA 1OQRA 1KRHA 3ZNGC 1UBIA 1WJ6A 2NTTA 4C4VB 5J17A 1QOBA 5FKAC 5J18A 3SHQA 1JW9D 5BYRA 2MP2A 4NAMA 4LLGM 2K8HA 2MCNB 2AL3A 1QQRA 1WGRA 3AEBB 4LDTB 1SGHA 5HG2A 2KDBA 2WXKA 2YEPF 4TQ1A 4ZOHC 3CSTA 1YN4A 3LYYA 3ZNZB 2K8BA 2NS5A 3LJ3A 5KHOA 4PYZA 1C1YB 4A55A 5AZFA 2GBRA 1J8CA 2ZW1A 3QARA 2JF5A 3U2SC 5AEKB 1L6UA 2WXPA 3BK2A 1K53A 2E6XA 3RNBC 1UUPA 3K9OB 3U7ZA 2K6QA 3CWIA 5LNK1 1R4NB 1YNTE 1Q1OA 4ITKA 3X0WA 1NI3A 1N60A 2W54A 3DWGC 2LXAA 3VHTC 3DBLB 3L08A 3T8MA 3RNAC 2ONQA 2R2QA 3I3TB 2NBUA 2IY1B 2RGFA 2QILA 2BGFA 1YIWA 4DDGD 5D3IB 1I4XA 1HE8A 5HFYA 3N1XC 2IO0B 3A9JB 1JROA 2RPVA 1VLBA 4S17A 1AARA 1OQYA 4IM2A 1SB3C 3A1QA 4D2KA 2IGDA 1MG8A 5HI1A 5TSSA 1TYGB 4C00A 4ARCA 2L0FA 4X57B 1GC7A 4WWOA 2BKRB 4NJ6A 2G4DB 3R7RA 2N4FA 2MA9B 3BK1A 1ISNA 4NPNA 1STEA 2IGGA 1E8YA 3AECB 3Q8CA 1HXYD 3DWMA 2M8SA 3WA0A 1C3TA 3K9PB 2IGHA 4RGOS 3AE5B 4RH6A 1KM7A 3NS1A 1JWSD 2N7DA 2MBQA 2WYQA 1I7HA 3LDZE 2C9WB 1SJED 5FR6A 2L83A 5E6JA 4G0NB 5JHBA 1JWUD 1ZPSA 1XCQL 4GN1A 3VUWA 4RFBA 1ZKHA 3S2AA 3ZTDA 2UU7A 3AV8A 2KC1A 4FN2A 3BWUD 4XZ4A 5IA7A 2KJ6A 2EKIA 3W5VB 3HUIA 1WYWB 1I4RA 3V61A 1L6VA 4W9HA 2BYEA 2VH2A 3KUDB 5IP4D 1XD3B 4ZRJA 5BYQA 4W9DA 2UYZB 4HCNB 3IT6B 1FNVA 4TKNA 4B6WA 1V86A 1WXAA 4IC7B 2W3RA 3P63A 2BKFA 2IZVB 4OZCA 2CR5A 3R2TA 4NNJB 4NAWB 1WGHA 4DBGA 3IBEA 1GG3A 2NMQA 2KKCA 1VJKA 2KVRA 1DYQA 2LJ5A 3A4SC 4F8CB 2ZNVB 1IUEA 3WAPA 1V5TA 1WX9A 1YX6B 4N9F4 2IPKD 1VCBA 2WXIA 1QOGA 2D3CA 3P4PB 1X1MA 2L76A 4ARIA 1ET6A 5FK9C 4WAAA 3E56A 1D5XC 1TY0A 3EA6A 3FAHA 3TSSA 4WJQA 3W1YA 4HPLB 3RPFC 4GGQA 2D5GA 4R3DA 1GT8A 4K7UA 1XLOA 3AE3B 3AI5A 2MBOA 2IJ0A 3MP9A 1KF6B 3RNFC 5BO4B 4ZHOA 3APDA 4WWMA 3Q3NC 2AQ1B 4M02A 1GB1A 3EFCA 3ENEA 1SE2A 2WXJA 2WWZA 3UQBA 1M94A 3SD5A 3P42A 4PS7A 4IUMB 1LO5D 5AZHA 5EE3A 3V6EB 3SU8X 2KTRA 3GB1A 1H7XA 4LNOA 2V4IB 3ML8A 3VAWA 2XEWA 2KFKA 2WXFA 1F77A 2GBNA 4NJCA 2AX5A 2M4NA 3JW0X 4BAXA 3QC8B 2K3UA 4IM0A 5E6OA 1PQSA 4KDIC 4HK2A 2V4LA 4KZCA 4GIVA 5CHWA 2SAKA 3BVGA 4I6NB 1RLFA 1SEBD 2FCNA 1L2NA 2VZKD 2EMTA 2LGXA 5D2MB 1H4RA 4ACFA 4W9FA 4P1CC 4JL9A 3SEBA 2KTRB 2JZPA 3ZJUA 4M8MA 3NRZA 2REXA 2LGDA 1DOYA 3IAM1 3AM9A 4IW0A 2LGYA 4FJZA 2BB5A 3LXFA 2JWZA 4B0EA 2R2OA 2KHWB 2H88B 2NBVB 4MT5A 4OVUA 3AE1B 1C79A 3AEGB 1GNUA 5FR3A 1T0YA 2RD0A 2DENB 3GZNB 1WGKA 3RD2A 4MSMB 2W55A 4XDCA 2N9KA 1HZ5A 4N6EB 3DBSA 4KSKC 3AULA 3B08A 3QJZA 4TV3A 1P98A 1S3SG 2C5LC 3MJ5A 1TGZB 3FILA 2VH1A 2WXRA 4LNFA 3ABVB 2LRUA 2O6VD 1YJIA 2Y3AA 4ANVA 3ZXRA 2LGIA 4XX5A 3IFWB 2NVUI 3TUOA 3CF4A 1A5RA 2KDMA 1FM0D 2G4SA 1KLGD 2WGSA 3AE2B 2LEKA 3M95A 4FLHA 2V3NA 1MJDA 2WXNA 3H6NA 1TIFA 2KWVB 3QHTA 2BTEA 2IO2B 2LHDA 4EEWA 2B76B 3VVWB 1T5XD 4O1NA 5MPOA 3AB5A 1TTNA 1C4AA 4WJNA 4ZDVA 1SIFA 1WJ4A 2IO1B 2BYTA 2KC2A 1PYWD 3QAQA 5BMIA 1RWSA 4KDLB 3R8BA 2J0KA 1EWYC 4A9AA 1WGYA 2K25A 1CQVA 1RM6C 3E9SA 3QK0A 4EOYA 1PGAA 1WH3A 3L13A 2KJHB 1GPXA 4YTMB 2RMMA 3O65B 1ZGUB 4RF1A 3L4PA 3JVZX 2FIFA 2M17A 1GB4A 1SBBB 4MSQB 4TQ0A 5L83A 2JRIB 3LB8C 2HDEA 1FD6A 2KN5A 1WR6E 4DWFA 1TBEA 2RDGA 3PRMB 4NJ7A 3NOBA 3GE8C 3VH3B 3UIPB 4MGZE 2QSDA 4PYUA 2CU3A 1WX8A 4MJSB 4HPPA 3OJ3A 4S0RA 1SE4A 2CHXA 2XBBC 4BBNC 1P7EA 1FNUA 3H7SA 4NAWA 1HTQA 4YSZB 3Q3OC 3KYDD 3W5UB 4KVGB 2M19A 1JMLA 3ZDMC 4EKUA 2MW5A 2D2QA 2N1WA 3ZW3A 2KDFB 2W82A 4YT0B 1FXTB 5DPWA 4C56C 3W2DA 1IPGA 1KFYB 2XNAC 3AEDB 1I42A 1XF5L 2K5PA 1MVKA 3RZWC 2MRPA 4DHJB 4FHJA 2K39A 2LRWA 3AE6B 4F1SA 3FKYA 1YD8U 2JVCA 4MJSA 1EM7A 1UF0A 3QX1A 5EE0A 1TS4A 1WXMA 3CIRB 1C9FA 3KUCB 2BWFA 2V1YA 4W9KA 2L7RA 3AXCA 4OZAA 1YN5A 2BB6A 1H7WA 2WNMA 3OWEB 2BWES 1Y8RC 4TMAB 1MPEA 1QZEA 5IN7A 2LXCA 4GSWA 1PFDA 1FXIA 3RI7C 2LGSA 2WXMA 3VFKA 4BKGA 1ZDVA 2K1FA 2Z8LA 4I6LB 2MX2A 1UZXB 1MG4A 3BINA 3HVZA 4YTNB 4E71A 1V1OA 2KD0A 2MHJA 5J2RA 3T3NA 4ANUA 1N6ZA 2INPE 2ZW0A 3VRAB 5C1ZA 1D6EC 2ZZPB 4N59A 3KH0A 1UWXA 3APFA 2FNJB 2LASA 4KKJA 3PZ8A 4K3BA 3PREA 1BMLC 2WHIA 4DQOC 1V49A 3A1QB 4W9JA 1Z5SB 3ZYYX 4LTUA 1MHXA 1V6EA 2G9HD 4PS8A 4BOSC 2XK5A 3VUXA 3NHEB 4WURA 4A90A 2LMCA 1OQQA 3Q3JA 2KMAA 4USAA 2J4XA 2LD9A 2WU5B 2KLCA 4BKSA 1T6BX 5G5GA 5G55A 4MGYE 1CJEA 3H1UA 1N5XA 2QEJC 3RULA 2FBWB 3PGEA 1UNSA 5C3JB 1WZ3A 1L0VB 3WAMA 4GU2A 1GUAB 2DBYA 2LVOA 2I38A 2SEBD 2CS4A 1XLQA 4HVBA 2KQSA 4HPMB 3N1YC 2C7HA 3ZRFA 4N58A 3JYUA 1J19A 3D32A 3H7PB 1E5WA 4EZLA 1D4BA 3AEEB 3TJPA 1OEYA 3MC0B 2PKOA 3ALBA 3HVDA 3C19A 4JX1C 2ZCBA 4MH8A 4EFOA 1V1PA 1VZ6A 5D3DA 4ZRKA 1WJNA 4ICUA 2R61A 2J0MA 3MHZA 3DVGY 2KZRA 3ZVVA 2JXXA 5AUIA 2WP9B 2JUOA 4YWGG 5IKCM 2FCMA 1EF5A 3V62A 2K8CA 4OZBA 2L0TA 2NPTA 2UWQA 4US9A 3C0RB 1V97A 3KYCD 4HLEA 1GJZA 2K0PA 2WXLA 2M0AA 4KGSA 3CF6E 4KGRA 3EUB2 2FAZA 1N61A 1WX7A 3GS2A 2WXGA 3OLMD 1E7UA 5DPTA 4BBNF 2RDHA 4KZ0A 1AWDA 3B2GA 2JY6A 4BKSD 4YTPB 3MJWA 1NYQA 1YN3A 2LWPA 2QJLA 1H8CA 3KLSX 1OTRB 3RZFA 3MTNB 4BKTA 3ZNHB 2Z0EB 2L05A 4XYCA 2X38A 4NQLB 4AWJA 1V9JA 4DDID 1YJ1A 1ZE3D 1V1PB 3VUYA 4WJPA 1JQ4A 3BVZA 4I6PA 5AUKA 2BS3B 2HD5B 4TUUA 3V6CB 3DBHB 1Q10A 2GBJA 1KOTA 2I1KA 1SF0A 2MBBB 4K7SA 1V2YA 4KSLC 2D3GA 1WSPA 2GBKA 2QCZA 1XEEA 2AYOB 3RUIB 1GC6A 3RT3B 2D11A 2O2VA 5LXIB 3DBRB 3Q8AA 4P1BC 2JXTA 1EUVB 4C4VA 4NY0A 3RYTA 3NUHB 1FCLA 1IGDA 2HTME 1ZXIA 3VR8B 1F2RI 3QIJA 1E6EB 4LK0M 1XXGA 4BFRA 3TEWA 5D7GA 3VRBB 3ZDTA 4HROA 3DHIC 3DQVA 2MQJA 4K3CA 2I1JA 1PGBA 2EELA 1TKEA 2N9LA 1B1ZA 5C23A 4P6VF 2K22A 4FA6A 2DZJA 4MH0E 4GLSC 1KH0A 2C7NB 3UQAA 1RFAA 2JRHA 4MM3A 4YSYB 2O6VA 3DVGX 3Q3FA 4HDQA 4IWPA 2ZEQA 1D5MC 2KFKB 2KQ7A 3AU4A 2J0JA 3U4EG 3V60A 2ZVOA 3ZO5B 4W9CA 4KV2A 3J9CA 1ENFA 4ZYSA 2WU2B 2KQ4X 4FJYA 4IDIA 3ETRA 1YOVB 1KJTA 2DHZA 3VDZA 1SE9A 3AMZA 3N30A 5CX3A 1CZPA 1WY8A 3PRPB 2BYFA 5GXGB 1I4HA 3U52E 4EZKA 3PZDA 3TEYA 3C8YA 3Q6BA 3OJ4B 3VR9B 5JH5C 2IDYA 4WH4A 2ICIA 2KYWA 2MWSB 4W9GA 2JPHA 2YEPB 4KGTA 2N7JA 2L00B 3DVNV 1D3ZA 1SE3A 3EGRA 2WX0A 1C76A 1WYGA 1ROEA 3HIZA 2GB1A 1E7VA 5JZEB 1QKZA 3KVFB 2PMVA 3U8ZA 4ICVA 2KLGA 3IG3A 4JPSA 1IP9A 2DNFA 1A70A 4FHKA 3X23A 1EU3A 4MGIE 2IYDB 4IWQA 2MSED 4LNNA 1N63A 2BVCA 2Y5CA 2YLMA 4HEA1 4E3CA 4LNKA 3SR6A 3ZIMA 3N32A 3A33B 1EO6A 1WR1A 3U7DA 1V5OA 3TIXA 1PDXA 4XWWA 1WRDB 3A4RA 3V05A 4F7ZA 2N1VA 3T9LA 3VTWA 3L17A 1FIQA 4DXAB 3DVNU 1NYRA 3VQIA
chains in the Genus database with same CATH topology
1QLBB 1T3QA 1F2RC 5D3IB 1I4XA 1N5WA 3W5UB 2M19A 1JMLA 2MEKA 1L4DB 5JXVA 1FEHA 5HFYA 1E10A 5G5HA 3IT4B 1FCCC 3H8HA 1JROA 2J42A 4CQNA 1TS3A 2RPVA 1GTHA 2W82A 4YT0B 1QT9A 1TKGA 4C56C 1VLBA 3W2DA 1KFYB 1AW7A 2XNAC 3AEDB 3B2FA 1SB3C 2XN9C 1YQ3B 1SJHD 1GOZA 1XF5L 2K5PA 1MVKA 2E3TA 4REZA 4D2KA 2IGDA 1K52A 5HI1A 5TSSA 3AE6B 1TYGB 1VZ8A 4ARCA 1UGJA 1EM7A 5EE0A 3IXSA 1TS4A 1GAQB 3CIRB 1C9FA 1YMHE 3AEAB 3BYYB 3BZDB 4NZLB 2WLBA 4L2YA 4JWUC 1YN5A 2BB6A 3BK1A 4OZAA 1H7WA 2WNMA 3OWEB 4TMAB 4EE2A 1MPEA 3O13A 1BUIC 1STEA 2OHFA 2WXQA 1WXQA 2DWQA 2IGGA 1PFDA 1FXIA 4XE0A 3FC4A 2JYTA 2WXMA 3AECB 3Q8CA 2J52A 1JRPA 1AN8A 2LHEA 1HXYD 4C7YA 1IBXA 1ZDVA 2Z8LA 1GTEA 3AH7A 3KQ4A 4KKIA 3DWMA 4RGMA 4ZRQA 3R2IA 3HVZA 4YTNB 4A6QA 1JWAD 1V1OA 1JWBD 5BMGA 2IGHA 3T3NA 4RGOS 3AE5B 4RH6A 1RYJA 3NS1A 1IBXB 2INPE 1ZOYB 2ZW0A 3VRAB 1JWSD 1WRIA 1D6EC 5BMHA 1I7HA 1CK1A 4C80A 1SJED 4JE3B 3SFDB 1RFKA 3MFGA 4N59A 2L83A 5E6JA 4B0MA 2I2YA 1TS5A 1UWXA 1VDVA 2CJNA 5BYSA 1JWUD 1ZPSA 1XCQL 3I57A 1ET9A 1FXAA 4KKJA 4YXDB 3Q69A 4RFBA 3PZ8A 4WAFA 4HJGE 1BMLC 3AV8A 1JALA 1XLNA 4DQOC 1F0ZA 3BWUD 3Q8BA 1J7AA 2EKIA 3ZYYX 4LTUA 1MHXA 2AQ2B 3W5VB 3HUIA 1L4ZB 2G9HD 1I4RA 1VZ7A 1L6VA 3NZ3A 4HKQA 3ZGZA 1K51A 1TS2A 1DOXA 5BYQA 4WURA 4OHJA 4A90A 2LMCA 1E0ZA 1OQQA 4WIPA 2L1AA 4USAA 2INNE 2J53A 2N0SB 2J4XA 4A8XC 3IT6B 1KTKA 3PO0A 1FNVA 2WU5B 1SIJA 1TKYA 2V0GA 2M56B 2JX5A 2GI9A 1T6BX 3KWLA 5G5GA 1QOFA 2W3RA 1CJEA 3P63A 2V3PA 3ZJVA 1N5XA 2QEJC 2BBCA 4OZCA 2FBWB 2MJEA 1UNSA 5C3JB 1L0VB 3R2TA 4NAWB 2DBYA 2I38A 2SEBD 2NMQA 4RCOA 1HEZE 1XLQA 4XDDA 2PIAA 4N58A 1VJKA 3FILB 1D4BA 1DYQA 1QILA 3AEEB 1R7SA 3MC0B 1IUEA 2PKOA 1DOIA 1FRRA 1IGCA 3HVDA 4JX1C 3HRDD 4Q2JA 4MH8A 1V1PA 1VZ6A 2IPKD 3KWVA 5D3DA 2WXIA 2R61A 1QOGA 3AE9B 3P4PB 2DLBA 4ARIA 1YJJA 2PW9A 1ET6A 3MHZA 5FK9C 2DYOA 2JWUA 1JCKB 3E56A 2KN4A 2WDVB 2LJIA 5EE9A 1D5XC 1NEKB 1TY0A 3EA6A 3FAHA 3TSSA 2JU6X 2WP9B 5AUIA 1TY2A 3RPFC 2OEDA 4ZHPA 2D5GA 1FNWA 4R3DA 4YWGG 1GT8A 1QOAA 1XLOA 3AE3B 2IJ0A 3MP9A 4OZBA 2MJ3A 1KF6B 5HHDG 4ZHOA 2WS3B 4US9A 1V97A 1J7BA 4WWMA 2K0PA 2AQ1B 2WXLA 1C78A 2M0AA 2LUMA 2H89B 4KGSA 4KGRA 4PT5A 1GB1A 1EU4A 4RGTA 3EUB2 1SE2A 2KACA 2WDQB 1N61A 3UI3A 3AEFB 2BT6A 2WXJA 3GS2A 2WXGA 2LFIA 4RF0A 3ZJTA 1ZDXA 2RDHA 1AWDA 3B2GA 1L0YB 1XO3A 3PZ7A 3P42A 4YTPB 1NYQA 1YN3A 1Y56A 3T3OA 2K9XA 2QJLA 4ZRPA 3KLSX 3ZQ4A 2PVGC 1LO5D 2BW2A 3BIID 5EE3A 3P4QB 1EWCA 1H7XA 3GB1A 2V4IB 2WXFA 1F77A 2X38A 2JQRB 3BYTB 4NJCA 4UDUC 1ZE3D 2AX5A 1E9MA 3TEZA 1V1PB 1JQ4A 3BVZA 5AUKA 2K3UA 2BS3B 1FO4A 1MHHE 1UWMA 1C77A 1MI0A 2NTSA 1VR9A 2W3SA 1WWTA 2PTLA 1Q10A 1ESFA 1SXTA 2SAKA 3BVGA 1SEBD 4TSSA 2VZKD 1SF0A 3GP7A 3NVWA 2PLPA 4AQ7A 4L23A 3SEBA 1WSPA 1C4PA 2JZPA 4OW0A 2Y5PA 1XEEA 2KMMA 3ZJUA 1XLPA 1FFVA 3NRZA 1DOYA 4DXFA 3IAM1 3AM9A 4P16A 2L32A 3Q8AA 1E7PB 3NVVA 2BB5A 1FFUA 2JXTA 3P4SB 1BXTA 1VRAB 3NVZA 4M0WA 5T8IA 3LXFA 4B0EA 4JWSC 2BS2B 2TSSA 2H88B 3NUHB 1I4GA 1FCLA 1IGDA 2HTME 1OFFA 1ZXIA 4MT5A 3AE1B 3VR8B 1F2RI 1E6EB 1C79A 4LK0M 5EE1A 4DXGA 1K50A 1DGJA 1XXGA 3TEWA 1PGXA 1ZXHA 2G1EA 3N9YC 3AEGB 1AYFA 2Q5WD 5D7GA 3VRBB 1HA5A 4L1BA 4HROA 5FR3A 3NVYA 2MJDA 4RGNA 1P7FA 1PGBA 2EELA 1TKEA 2N9LA 1B1ZA 1KLUD 1FMAD 4P6VF 4YSXB 1N62A 2K22A 1ACCA 4IOIE 2GRIA 1NVID 1WGKA 4GLSC 1KH0A 4GDLB 3W9CB 2W55A 4XDCA 2N9KA 4YSYB 1HZ5A 4N6EB 3AN1A 1C4CA 1TZOA 4AS1A 3RFZB 2L52A 1D5MC 2ON8A 3MJ5A 2ACZB 1L5PA 3U4EG 3FILA 1NENB 2WXRA 3ABVB 2VZKB 4HKZE 1FRDA 1QF6A 3VQIA 1YJIA 3AE7B 2Y3AA 1ENFA 3J9CA 4MM3B 2LGIA 3URYA 4ZYSA 2WU2B 2KQ4X 3TUOA 4IDIA 3CF4A 3ETRA 1YQ4B 2DYMA 2KDMA 1FM0D 2WXOA 1J7CA 3TEXA 1KLGD 3AE8B 2JSVX 1B9RA 3AMZA 3AE2B 1JWMD 2LEKA 2QIEB 1CZPA 4WQMA 3SFEB 4GDKB 2PVOD 2V3NA 2WDRB 2WXNA 4OVZA 3BVMA 1HQRD 1I4HA 2QMTA 5GXGB 3U52E 2BTEA 1ZP0B 4XWTA 3WCQA 2LHDA 2WXHA 1TJEA 3TEYA 2B76B 3C8YA 1V8CA 3VR9B 1T5XD 4O1NA 5MPOA 2FE8A 2IDYA 1D5ZC 2JYEA 3AB5A 1C4AA 3I9V1 4WH4A 2ICIA 3Q8EA 2BYTA 1OQRA 4C7ZA 1KRHA 1PYWD 2MH7A 5BMIA 1RWSA 3R8BA 2NTTA 2YEPB 4KGTA 1EWYC 3IAS1 3W1SA 4A9AA 2N7JA 1QOBA 5FKAC 2CJOA 2BS4B 1CQVA 1SE3A 3EGRA 3Q8FA 1JW9D 1RM6C 3E9SA 5BYRA 1C76A 1SSNA 1PGAA 1ROEA 1WYGA 4LLGM 4NAMA 2GB1A 1GPXA 1QKZA 1QQRA 2KWDA 4YTMB 2PMVA 3AEBB 2RMMA 1I4PA 5H92C 4RF1A 4JPSA 3L4PA 5HG2A 2WXKA 2YEPF 4MACA 3AE4B 5I4DA 1A70A 1GB4A 4TQ1A 1SBBB 4ZOHC 4TQ0A 1EU3A 4FXCA 1YN4A 3LB8C 3LYYA 3V3XA 3P4RB 4J3OD 4HRSA 2HDEA 1FD6A 4KX6B 2AQ3B 1PUTA 1XCTL 4A55A 1N63A 2ZW1A 3U2SC 1L6UA 5C2TB 2RDGA 2WXPA 3BK2A 2Y5CA 1K53A 1I4QA 2E6XA 1ZUD2 1UUPA 3U7ZA 3CWIA 5LNK1 4HEA1 2QSDA 1YNTE 4RNAA 2KAJA 4ITKA 1M4VA 3SR6A 1NI3A 2FUG1 1N60A 2CU3A 2W54A 3DWGC 4XWWA 1PDXA 3V05A 2ONQA 1SE4A 3B9JA 1L0XB 1P7EA 2QILA 1FIQA 3P1MA 4H2AA 1FNUA 2WQYB 4YSZB 5H8YE 4IKGA 1NYRA 1HZ6A 4US8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLB B;  3AE7 B;  1T3Q A;  1YJI A;  4USA A;  1N5W A;  2N0S B;  3W5U B;  2M19 A;  2WU2 B;  1E10 A;  3PO0 A;  4IDI A;  3CF4 A;  2WU5 B;  1SIJ A;  1TKY A;  2JQR B;  1YQ4 B;  3ETR A;  1JRO A;  5G5H A;  1FM0 D;  2M56 B;  1J7C A;  1E9M A;  2AX5 A;  2JX5 A;  3AE8 B;  1B9R A;  1JQ4 A;  3KWL A;  3AMZ A;  1GTH A;  3AE2 B;  2LEK A;  4YT0 B;  1QT9 A;  2QIE B;  2BS3 B;  1CZP A;  1TKG A;  4WQM A;  1VLB A;  1QOF A;  2W3R A;  3SFE B;  5G5G A;  1UWM A;  2PVO D;  2WDR B;  1KFY B;  1CJE A;  2W3S A;  3AED B;  1WWT A;  3P63 A;  1N5X A;  3B2F A;  1SB3 C;  5GXG B;  1YQ3 B;  1ZP0 B;  2FBW B;  2K5P A;  2MJE A;  5C3J B;  2E3T A;  3WCQ A;  1L0V B;  1TJE A;  2B76 B;  1V8C A;  2DBY A;  1SF0 A;  3VR9 B;  5MPO A;  3NVW A;  3AE6 B;  1TYG B;  3AB5 A;  1XLQ A;  1OQR A;  4C7Z A;  1KRH A;  2MH7 A;  1RWS A;  2KMM A;  2PIA A;  4N58 A;  1XLP A;  1FFV A;  1VJK A;  3NRZ A;  5EE0 A;  1DOY A;  1GAQ B;  3CIR B;  3AEE B;  1R7S A;  1EWY C;  3AM9 A;  4A9A A;  1E7P B;  3AEA B;  1QOB A;  3NVV A;  1IUE A;  2BS4 B;  1FFU A;  2CJO A;  2WLB A;  3P4S B;  3NVZ A;  1JW9 D;  2PKO A;  1DOI A;  1RM6 C;  1FRR A;  4JX1 C;  4JWU C;  1H7W A;  1WYG A;  1ROE A;  3HRD D;  3LXF A;  4JWS C;  1GPX A;  2OHF A;  2BS2 B;  2H88 B;  4YTM B;  1WXQ A;  3AEB B;  1QOG A;  2DWQ A;  2HTM E;  3AE9 B;  3P4P B;  1FXI A;  1OFF A;  1PFD A;  1YJJ A;  3FC4 A;  1ZXI A;  3AEC B;  3L4P A;  3AE1 B;  3VR8 B;  1JRP A;  1E6E B;  3AE4 B;  1A70 A;  2WDV B;  5EE1 A;  4C7Y A;  3AH7 A;  5EE9 A;  1GTE A;  1DGJ A;  5AUK A;  1NEK B;  4ZOH C;  5H92 C;  2G1E A;  3DWM A;  3FAH A;  4FXC A;  5AUI A;  2WP9 B;  3HVZ A;  3AEG B;  4YTN B;  1AYF A;  2Q5W D;  3LB8 C;  3VRB B;  3P4R B;  1JWA D;  3RPF C;  1JWB D;  4HRS A;  4HRO A;  4ZHP A;  3NVY A;  1GT8 A;  4KX6 B;  1PUT A;  1QOA A;  2MJD A;  1N63 A;  1XLO A;  3AE5 B;  3AE3 B;  1RYJ A;  3NS1 A;  1TKE A;  1L6U A;  5C2T B;  1ZOY B;  1FMA D;  1KF6 B;  3VRA B;  2MJ3 A;  4YSX B;  1N62 A;  2Y5C A;  4P6V F;  1FO4 A;  2K22 A;  1ZUD 2;  1WRI A;  4ZHO A;  2WS3 B;  4US9 A;  1V97 A;  1I7H A;  3CWI A;  1J7B A;  4WWM A;  1NVI D;  4C80 A;  3SFD B;  1RFK A;  1WGK A;  4N59 A;  2L83 A;  2KAJ A;  4ITK A;  2H89 B;  1VDV A;  3SR6 A;  2CJN A;  1NI3 A;  3W9C B;  2W55 A;  1FXA A;  4YXD B;  3EUB 2;  4YSY B;  2WDQ B;  1N61 A;  3AV8 A;  1JAL A;  3AEF B;  1N60 A;  2BT6 A;  2CU3 A;  2W54 A;  1XLN A;  3DWG C;  1PDX A;  3AN1 A;  1F0Z A;  1J7A A;  2L52 A;  2EKI A;  1AWD A;  3B2G A;  4LTU A;  1XO3 A;  3ZYY X;  3W5V B;  4YTP B;  3B9J A;  1NYQ A;  3HUI A;  2ACZ B;  1L5P A;  1L6V A;  2K9X A;  2QJL A;  1NEN B;  4N6E B;  2PVG C;  3ABV B;  1FIQ A;  3P1M A;  3BII D;  2WQY B;  1FRD A;  5EE3 A;  3P4Q B;  4YSZ B;  5H8Y E;  1QF6 A;  1DOX A;  1E0Z A;  1NYR A;  1OQQ A;  1H7X A;  4US8 A; 
#chains in the Genus database with same CATH topology
 1QLB B;  1F2R C;  1N5W A;  4BZA A;  4RM9 A;  2MEK A;  1L4D B;  2RR9 A;  1FEH A;  1E10 A;  5G5H A;  3IT4 B;  3MC8 A;  3H8H A;  3QCA A;  2J42 A;  2ZCC A;  1RRB A;  4CQN A;  1TS3 A;  1GTH A;  1QT9 A;  1EF1 A;  1WF9 A;  2XN9 C;  1R4M B;  1J0G A;  1SJH D;  1GOZ A;  3UIN B;  3A9J A;  1K52 A;  1VZ8 A;  1UGJ A;  2PEA A;  2RPQ A;  3R66 C;  2DX5 B;  2LZ6 A;  3N3K B;  1GAQ B;  1Q0W B;  1YMH E;  3AEA B;  3MHS D;  3BYY B;  2WLB A;  4L2Y A;  2D10 A;  2FUH B;  4K81 A;  1UBQ A;  1R4N I;  4EE2 A;  1BUI C;  2WXQ A;  1WXQ A;  5CHV C;  4XE0 A;  3FC4 A;  2JYT A;  4IM3 A;  4M01 A;  2D3A A;  4C7Y A;  4KKI A;  4RGM A;  4A6Q A;  1WGG A;  2A4Z A;  1E8W A;  4W9I A;  3ZNI D;  4AJY B;  2KXJ A;  3ECI A;  4DHZ B;  5BMH A;  1CK1 A;  3SFD B;  4K1R B;  2I2Y A;  1TS5 A;  1VDV A;  5BYS A;  2HE7 A;  1VD2 A;  1FXA A;  4YXD B;  3Q69 A;  1XLN A;  4A3O A;  1WE7 A;  4AP4 C;  2AQ2 B;  3PVL A;  4E74 A;  3ML9 A;  4HKQ A;  3ZGZ A;  1K51 A;  3ZXV A;  1TS2 A;  2D3B A;  2KWU B;  3NZU A;  4OHJ A;  1E0Z A;  4WIP A;  2D07 B;  2N0S B;  2DYB A;  1NBF C;  4XGA B;  4A8X C;  1TKY A;  3WAN A;  2V0G A;  3R7Q A;  3HM6 X;  1QOF A;  5IAA C;  2V3P A;  3ZKJ C;  2N9P C;  2BBC A;  2ASQ A;  3HHM A;  5LXH A;  4ZYN A;  1HTO A;  5CTR C;  4RCO A;  1HEZ E;  4MEL A;  2INC C;  4KIK A;  2B3A A;  4XDD A;  2PIA A;  2KAN A;  1E8Z A;  3NY5 A;  3WAL A;  4EZJ A;  2LI5 A;  3P2B A;  3SDL C;  1FRR A;  2Z59 B;  3HRD D;  2GOW A;  3L10 B;  3WAO A;  2DLB A;  3B1L X;  1YJJ A;  2PW9 A;  1E90 A;  4GXB A;  1JCK B;  2KN4 A;  2LJI A;  5EE9 A;  1XQQ A;  1CMX B;  2KJR A;  2M0X A;  2KT7 A;  2DZI A;  4DHZ E;  1TY2 A;  4W9E A;  2OED A;  2HJ8 A;  4ZHP A;  2BQQ A;  2QC8 A;  5JHA A;  1QOA A;  2FID A;  3OG5 A;  3DPD A;  2MJ3 A;  5KHQ A;  4GOC A;  4OVV A;  3WIM A;  2H89 B;  4PT5 A;  2OOB B;  3ZLZ A;  1YQB A;  2BT6 A;  2GMI C;  2LFI A;  2EMS A;  4PK1 A;  1ZDX A;  3UGB B;  2MLB A;  1Y56 A;  3T3O A;  2K9X A;  2Z0D B;  3RMK C;  4ZRP A;  3ZQ4 A;  2PVG C;  4WQO B;  2RSU A;  3B0A A;  1EWC A;  1I35 A;  2EKE C;  3TMP B;  2JQR B;  4ANX A;  2IND C;  1WI0 A;  1FO4 A;  1MHH E;  3DBL I;  1C77 A;  1P1A A;  2NTS A;  1VR9 A;  2W3S A;  1XT9 B;  1ESF A;  2LUE A;  4JIO U;  2G3Q B;  2O6V B;  3NVW A;  2DZK A;  3DBH I;  3VXW A;  1G6J A;  1ZW7 A;  4OW0 A;  2Y5P A;  2KMM A;  1FFV A;  5E6P A;  1WXS A;  2CU1 A;  4DXF A;  4P16 A;  2L32 A;  3NVV A;  2N9X A;  1NDD A;  1BXT A;  1VRA B;  4M0W A;  3QQ8 B;  5T8I A;  3PLV A;  4JWS C;  3BY4 B;  2BS2 B;  3DBR I;  2NBW B;  2KVZ A;  1F1H A;  2J7Q B;  1OFF A;  4II2 B;  2LVP A;  4B95 A;  3M3J A;  5EE1 A;  4DXG A;  4NQK E;  1K50 A;  2JZ3 B;  1WM2 A;  3N9Y C;  1HA5 A;  4L1B A;  3VTU A;  4WWN A;  2QHO A;  2MJD A;  1FMA D;  4YSX B;  1N62 A;  4WJO A;  1ACC A;  4G3X B;  4FAD A;  2GRI A;  1NVI D;  1LGR A;  3ZUN A;  3L0W B;  3W9C B;  4GB9 A;  2AL6 A;  2OJR A;  1TZO A;  4AS1 A;  3RFZ B;  3TBL D;  2L52 A;  2ON8 A;  2KDE B;  2ACZ B;  1L5P A;  3RCZ A;  2V3S A;  1NEN B;  4LNI A;  2VZK B;  3ZRC A;  1FRD A;  1QF6 A;  5G2N A;  2KX3 A;  2N7E A;  2KO3 A;  1UGM A;  4MM3 B;  4ASW C;  4YL8 A;  4HDO A;  4FBJ B;  2M1M A;  4FUL A;  2WXO A;  1J7C A;  3TEX A;  3AE8 B;  5IO9 A;  3H7P A;  3L16 A;  4WQM A;  2PPH A;  3GE3 C;  2WDR B;  4OVZ A;  1HQR D;  2QMT A;  1ZP0 B;  4XWT A;  2DZM A;  3WCQ A;  1TJE A;  3PSE B;  3EFU A;  1V8C A;  1OGW A;  3HK0 A;  2C60 A;  1UEL A;  2FE8 A;  1WGD A;  1D5Z C;  3VH4 B;  3I9V 1;  1RAX A;  2WX1 A;  4C7Z A;  1WJU A;  2MH7 A;  3IAS 1;  2ZJD A;  3W1S A;  2IY0 B;  2CJO A;  2BS4 B;  1TT5 B;  3Q8F A;  2GBM A;  4JQW C;  4ANW A;  1SSN A;  3DCG A;  4K7W A;  3PS6 A;  1WMH A;  2KWD A;  1I4P A;  5H92 C;  4MAC A;  3AE4 B;  5AZG A;  5I4D A;  4CHK A;  4M00 A;  4FXC A;  3RN9 C;  3I5J C;  3V3X A;  3P4R B;  4J3O D;  4HRS A;  4CO7 A;  2CHW A;  4KX6 B;  2V9H A;  2AQ3 B;  1PUT A;  1MFW A;  1XCT L;  1WZ0 A;  2MBH A;  2IBI B;  5C2T B;  2C7M B;  1I4Q A;  1ZUD 2;  3DDC B;  4RNA A;  2KAJ A;  1M4V A;  2KDI A;  1BT0 A;  2FUG 1;  2KOX A;  3R3M A;  1JRU A;  3TL5 A;  2L3Z A;  3B9J A;  1L0X B;  2AWT A;  3P1M A;  4H2A A;  2WQY B;  4A20 A;  5H8Y E;  4IKG A;  4UDU C;  3U30 A;  1HZ6 A;  4US8 A;  1T3Q A;  3PV1 A;  2HJ1 A;  3CMM B;  5JXV A;  1FCC C;  3APC A;  2CKH B;  4HWI B;  3RNE C;  2PJH A;  1TKG A;  1P9D U;  1AW7 A;  2QDF A;  3B2F A;  4P7I A;  1YQ3 B;  2E3T A;  4REZ A;  1FPY A;  3NS8 A;  4J6I A;  2VRR B;  2BYV E;  4EUT A;  5DPR A;  3Q2A C;  5D6J B;  4JLC A;  3IXS A;  5EDS A;  3PHX B;  3N1Z C;  5CHF A;  3BZD B;  3Q14 C;  4NZL B;  2KNB A;  4JWU C;  1WXV A;  3A9K B;  4RM8 A;  3O13 A;  4IG7 B;  2OHF A;  4W9L A;  2DWQ A;  2N9E B;  3L54 A;  2KX0 A;  4MGK E;  2J52 A;  1JRP A;  1AN8 A;  2LHE A;  1IBX A;  3AH7 A;  1GTE A;  2OJW A;  4LJP B;  3KQ4 A;  4ZRQ A;  3R2I A;  4BOZ B;  1JWA D;  1JWB D;  3ONS A;  1WFY A;  3EC8 A;  5BMG A;  2ZPN A;  1RYJ A;  1IBX B;  1ZOY B;  1WE6 A;  4LDT D;  1WRI A;  4C80 A;  2MP2 B;  2ZPY A;  1RFK A;  3MFG A;  4JE3 B;  5D94 A;  4B0M A;  2CJN A;  3I57 A;  1ET9 A;  4WAF A;  4HJG E;  5TR5 A;  1JAL A;  1F0Z A;  1LQB A;  3Q8B A;  1J7A A;  2PE9 A;  2BF8 B;  3NJT A;  4URK A;  1L4Z B;  1VZ7 A;  2IO3 B;  1Q5W B;  3NZ3 A;  3EEC A;  1DOX A;  1P3Q U;  3GZN I;  3PRZ A;  4GMV A;  1U4A A;  2L1A A;  4QAY A;  2INN E;  2J53 A;  1KTK A;  2PE6 B;  3PO0 A;  1SIJ A;  2ZVN A;  2M56 B;  2JX5 A;  4WWP A;  1WIA A;  3KWL A;  2GI9 A;  4HCP B;  3RNC C;  3IHP C;  3Q3M C;  3ZJV A;  2MJE A;  2FCS A;  2LVQ A;  3QWZ B;  3EHV A;  3JSV A;  4MEM A;  4LJO B;  1K8R B;  3M62 B;  3FIL B;  1QIL A;  1R7S A;  5LLI A;  3KUZ A;  1DOI A;  1IGC A;  1T0R C;  3PTF C;  3GOE A;  4Q2J A;  2X8X X;  3KWV A;  1WM3 A;  3AE9 B;  3NZS A;  2CHZ A;  2DYO A;  1UD7 A;  2JWU A;  1YX5 B;  2NR2 A;  2WDV B;  3I63 C;  1NEK B;  1TZ1 A;  2JU6 X;  3CSF A;  3ZTC A;  4IWO A;  1FNW A;  1V81 A;  2WDT B;  4LCD E;  4HJK A;  5HHD G;  4A3P A;  2WS3 B;  1J7B A;  3M63 B;  4AJW A;  3PHW B;  2W9N A;  1C78 A;  2LUM A;  2L8J A;  2A5U A;  2YVC A;  2NCN A;  3IVF A;  1EU4 A;  4RGT A;  2MBE A;  2KAC A;  2WDQ B;  3UI3 A;  3AEF B;  5E6N A;  2DAJ A;  1LXD A;  4RF0 A;  3ZJT A;  1LFD A;  1L0Y B;  1XO3 A;  3OAW A;  3DOW A;  3PZ7 A;  1KLV A;  2AEH A;  4DHJ D;  1R4M I;  3QA8 A;  1S1Q B;  3H9D A;  4AOF A;  2BW2 A;  3BII D;  3AU5 A;  3P4Q B;  3UIO B;  5GMV A;  4CYE A;  4II3 B;  1T0Q C;  3HM3 A;  4XC2 A;  4G50 A;  4GDK A;  4JGH B;  3BYT B;  1IYF A;  1F52 A;  1E9M A;  2RDB C;  4PS3 A;  3TEZ A;  3W1S C;  5L95 C;  1UWM A;  2Y5B B;  1MI0 A;  1OEY J;  5HKH A;  1NI2 A;  1WWT A;  2PTL A;  1E8X A;  1SXT A;  3KW5 B;  4TSS A;  4AUQ C;  1T0S C;  1LM8 B;  3GP7 A;  2PLP A;  4AQ7 A;  4L23 A;  1C4P A;  5DPS A;  3DHH C;  1XLP A;  1WMH B;  1E7P B;  2GLS A;  4G11 A;  3NVZ A;  1FFU A;  2KMC A;  3P4S B;  1Z2M A;  4GDL A;  2TSS A;  1I4G A;  4M0W B;  4B9K A;  4MDK E;  2ZNV C;  3DHG C;  2O2V B;  1DGJ A;  1PGX A;  1ZXH A;  1V80 A;  2G1E A;  3VTV A;  4BVU C;  1AYF A;  2Q5W D;  1UH6 A;  2BPS A;  3PLU A;  3NVY A;  5DCN A;  4RGN A;  1P7F A;  1KLU D;  4M8N A;  2FCQ A;  4IOI E;  2JZZ A;  4GDL B;  2K6D B;  3N20 C;  1P0R A;  3MC9 A;  3AN1 A;  1C4C A;  3PPA A;  4KIK B;  2KWC A;  4FJV B;  3PT2 B;  2JT4 B;  4HKZ E;  4ZRI A;  3RNG C;  4HXD A;  3AE7 B;  3URY A;  2DAF A;  3JSV B;  1YQ4 B;  2DYM A;  3NG0 A;  1B9R A;  2JSV X;  4DK5 A;  1L7Y A;  1JWM D;  2QIE B;  3A9K A;  2KFJ A;  4GDK B;  3SFE B;  2PVO D;  3UF8 A;  2G45 B;  3BVM A;  3TCA A;  2KTF A;  2NPT B;  1F9J A;  2WXH A;  4RMA A;  2XK5 B;  5IOI A;  2KK8 A;  2HTH A;  2JYE A;  3Q8E A;  1OQR A;  1KRH A;  3ZNG C;  1UBI A;  1WJ6 A;  2NTT A;  4C4V B;  5J17 A;  1QOB A;  5FKA C;  5J18 A;  3SHQ A;  1JW9 D;  5BYR A;  2MP2 A;  4NAM A;  4LLG M;  2K8H A;  2MCN B;  2AL3 A;  1QQR A;  1WGR A;  3AEB B;  4LDT B;  1SGH A;  5HG2 A;  2KDB A;  2WXK A;  2YEP F;  4TQ1 A;  4ZOH C;  3CST A;  1YN4 A;  3LYY A;  3ZNZ B;  2K8B A;  2NS5 A;  3LJ3 A;  5KHO A;  4PYZ A;  1C1Y B;  4A55 A;  5AZF A;  2GBR A;  1J8C A;  2ZW1 A;  3QAR A;  2JF5 A;  3U2S C;  5AEK B;  1L6U A;  2WXP A;  3BK2 A;  1K53 A;  2E6X A;  3RNB C;  1UUP A;  3K9O B;  3U7Z A;  2K6Q A;  3CWI A;  5LNK 1;  1R4N B;  1YNT E;  1Q1O A;  4ITK A;  3X0W A;  1NI3 A;  1N60 A;  2W54 A;  3DWG C;  2LXA A;  3VHT C;  3DBL B;  3L08 A;  3T8M A;  3RNA C;  2ONQ A;  2R2Q A;  3I3T B;  2NBU A;  2IY1 B;  2RGF A;  2QIL A;  2BGF A;  1YIW A;  4DDG D;  5D3I B;  1I4X A;  1HE8 A;  5HFY A;  3N1X C;  2IO0 B;  3A9J B;  1JRO A;  2RPV A;  1VLB A;  4S17 A;  1AAR A;  1OQY A;  4IM2 A;  1SB3 C;  3A1Q A;  4D2K A;  2IGD A;  1MG8 A;  5HI1 A;  5TSS A;  1TYG B;  4C00 A;  4ARC A;  2L0F A;  4X57 B;  1GC7 A;  4WWO A;  2BKR B;  4NJ6 A;  2G4D B;  3R7R A;  2N4F A;  2MA9 B;  3BK1 A;  1ISN A;  4NPN A;  1STE A;  2IGG A;  1E8Y A;  3AEC B;  3Q8C A;  1HXY D;  3DWM A;  2M8S A;  3WA0 A;  1C3T A;  3K9P B;  2IGH A;  4RGO S;  3AE5 B;  4RH6 A;  1KM7 A;  3NS1 A;  1JWS D;  2N7D A;  2MBQ A;  2WYQ A;  1I7H A;  3LDZ E;  2C9W B;  1SJE D;  5FR6 A;  2L83 A;  5E6J A;  4G0N B;  5JHB A;  1JWU D;  1ZPS A;  1XCQ L;  4GN1 A;  3VUW A;  4RFB A;  1ZKH A;  3S2A A;  3ZTD A;  2UU7 A;  3AV8 A;  2KC1 A;  4FN2 A;  3BWU D;  4XZ4 A;  5IA7 A;  2KJ6 A;  2EKI A;  3W5V B;  3HUI A;  1WYW B;  1I4R A;  3V61 A;  1L6V A;  4W9H A;  2BYE A;  2VH2 A;  3KUD B;  5IP4 D;  1XD3 B;  4ZRJ A;  5BYQ A;  4W9D A;  2UYZ B;  4HCN B;  3IT6 B;  1FNV A;  4TKN A;  4B6W A;  1V86 A;  1WXA A;  4IC7 B;  2W3R A;  3P63 A;  2BKF A;  2IZV B;  4OZC A;  2CR5 A;  3R2T A;  4NNJ B;  4NAW B;  1WGH A;  4DBG A;  3IBE A;  1GG3 A;  2NMQ A;  2KKC A;  1VJK A;  2KVR A;  1DYQ A;  2LJ5 A;  3A4S C;  4F8C B;  2ZNV B;  1IUE A;  3WAP A;  1V5T A;  1WX9 A;  1YX6 B;  4N9F 4;  2IPK D;  1VCB A;  2WXI A;  1QOG A;  2D3C A;  3P4P B;  1X1M A;  2L76 A;  4ARI A;  1ET6 A;  5FK9 C;  4WAA A;  3E56 A;  1D5X C;  1TY0 A;  3EA6 A;  3FAH A;  3TSS A;  4WJQ A;  3W1Y A;  4HPL B;  3RPF C;  4GGQ A;  2D5G A;  4R3D A;  1GT8 A;  4K7U A;  1XLO A;  3AE3 B;  3AI5 A;  2MBO A;  2IJ0 A;  3MP9 A;  1KF6 B;  3RNF C;  5BO4 B;  4ZHO A;  3APD A;  4WWM A;  3Q3N C;  2AQ1 B;  4M02 A;  1GB1 A;  3EFC A;  3ENE A;  1SE2 A;  2WXJ A;  2WWZ A;  3UQB A;  1M94 A;  3SD5 A;  3P42 A;  4PS7 A;  4IUM B;  1LO5 D;  5AZH A;  5EE3 A;  3V6E B;  3SU8 X;  2KTR A;  3GB1 A;  1H7X A;  4LNO A;  2V4I B;  3ML8 A;  3VAW A;  2XEW A;  2KFK A;  2WXF A;  1F77 A;  2GBN A;  4NJC A;  2AX5 A;  2M4N A;  3JW0 X;  4BAX A;  3QC8 B;  2K3U A;  4IM0 A;  5E6O A;  1PQS A;  4KDI C;  4HK2 A;  2V4L A;  4KZC A;  4GIV A;  5CHW A;  2SAK A;  3BVG A;  4I6N B;  1RLF A;  1SEB D;  2FCN A;  1L2N A;  2VZK D;  2EMT A;  2LGX A;  5D2M B;  1H4R A;  4ACF A;  4W9F A;  4P1C C;  4JL9 A;  3SEB A;  2KTR B;  2JZP A;  3ZJU A;  4M8M A;  3NRZ A;  2REX A;  2LGD A;  1DOY A;  3IAM 1;  3AM9 A;  4IW0 A;  2LGY A;  4FJZ A;  2BB5 A;  3LXF A;  2JWZ A;  4B0E A;  2R2O A;  2KHW B;  2H88 B;  2NBV B;  4MT5 A;  4OVU A;  3AE1 B;  1C79 A;  3AEG B;  1GNU A;  5FR3 A;  1T0Y A;  2RD0 A;  2DEN B;  3GZN B;  1WGK A;  3RD2 A;  4MSM B;  2W55 A;  4XDC A;  2N9K A;  1HZ5 A;  4N6E B;  3DBS A;  4KSK C;  3AUL A;  3B08 A;  3QJZ A;  4TV3 A;  1P98 A;  1S3S G;  2C5L C;  3MJ5 A;  1TGZ B;  3FIL A;  2VH1 A;  2WXR A;  4LNF A;  3ABV B;  2LRU A;  2O6V D;  1YJI A;  2Y3A A;  4ANV A;  3ZXR A;  2LGI A;  4XX5 A;  3IFW B;  2NVU I;  3TUO A;  3CF4 A;  1A5R A;  2KDM A;  1FM0 D;  2G4S A;  1KLG D;  2WGS A;  3AE2 B;  2LEK A;  3M95 A;  4FLH A;  2V3N A;  1MJD A;  2WXN A;  3H6N A;  1TIF A;  2KWV B;  3QHT A;  2BTE A;  2IO2 B;  2LHD A;  4EEW A;  2B76 B;  3VVW B;  1T5X D;  4O1N A;  5MPO A;  3AB5 A;  1TTN A;  1C4A A;  4WJN A;  4ZDV A;  1SIF A;  1WJ4 A;  2IO1 B;  2BYT A;  2KC2 A;  1PYW D;  3QAQ A;  5BMI A;  1RWS A;  4KDL B;  3R8B A;  2J0K A;  1EWY C;  4A9A A;  1WGY A;  2K25 A;  1CQV A;  1RM6 C;  3E9S A;  3QK0 A;  4EOY A;  1PGA A;  1WH3 A;  3L13 A;  2KJH B;  1GPX A;  4YTM B;  2RMM A;  3O65 B;  1ZGU B;  4RF1 A;  3L4P A;  3JVZ X;  2FIF A;  2M17 A;  1GB4 A;  1SBB B;  4MSQ B;  4TQ0 A;  5L83 A;  2JRI B;  3LB8 C;  2HDE A;  1FD6 A;  2KN5 A;  1WR6 E;  4DWF A;  1TBE A;  2RDG A;  3PRM B;  4NJ7 A;  3NOB A;  3GE8 C;  3VH3 B;  3UIP B;  4MGZ E;  2QSD A;  4PYU A;  2CU3 A;  1WX8 A;  4MJS B;  4HPP A;  3OJ3 A;  4S0R A;  1SE4 A;  2CHX A;  2XBB C;  4BBN C;  1P7E A;  1FNU A;  3H7S A;  4NAW A;  1HTQ A;  4YSZ B;  3Q3O C;  3KYD D;  3W5U B;  4KVG B;  2M19 A;  1JML A;  3ZDM C;  4EKU A;  2MW5 A;  2D2Q A;  2N1W A;  3ZW3 A;  2KDF B;  2W82 A;  4YT0 B;  1FXT B;  5DPW A;  4C56 C;  3W2D A;  1IPG A;  1KFY B;  2XNA C;  3AED B;  1I42 A;  1XF5 L;  2K5P A;  1MVK A;  3RZW C;  2MRP A;  4DHJ B;  4FHJ A;  2K39 A;  2LRW A;  3AE6 B;  4F1S A;  3FKY A;  1YD8 U;  2JVC A;  4MJS A;  1EM7 A;  1UF0 A;  3QX1 A;  5EE0 A;  1TS4 A;  1WXM A;  3CIR B;  1C9F A;  3KUC B;  2BWF A;  2V1Y A;  4W9K A;  2L7R A;  3AXC A;  4OZA A;  1YN5 A;  2BB6 A;  1H7W A;  2WNM A;  3OWE B;  2BWE S;  1Y8R C;  4TMA B;  1MPE A;  1QZE A;  5IN7 A;  2LXC A;  4GSW A;  1PFD A;  1FXI A;  3RI7 C;  2LGS A;  2WXM A;  3VFK A;  4BKG A;  1ZDV A;  2K1F A;  2Z8L A;  4I6L B;  2MX2 A;  1UZX B;  1MG4 A;  3BIN A;  3HVZ A;  4YTN B;  4E71 A;  1V1O A;  2KD0 A;  2MHJ A;  5J2R A;  3T3N A;  4ANU A;  1N6Z A;  2INP E;  2ZW0 A;  3VRA B;  5C1Z A;  1D6E C;  2ZZP B;  4N59 A;  3KH0 A;  1UWX A;  3APF A;  2FNJ B;  2LAS A;  4KKJ A;  3PZ8 A;  4K3B A;  3PRE A;  1BML C;  2WHI A;  4DQO C;  1V49 A;  3A1Q B;  4W9J A;  1Z5S B;  3ZYY X;  4LTU A;  1MHX A;  1V6E A;  2G9H D;  4PS8 A;  4BOS C;  2XK5 A;  3VUX A;  3NHE B;  4WUR A;  4A90 A;  2LMC A;  1OQQ A;  3Q3J A;  2KMA A;  4USA A;  2J4X A;  2LD9 A;  2WU5 B;  2KLC A;  4BKS A;  1T6B X;  5G5G A;  5G55 A;  4MGY E;  1CJE A;  3H1U A;  1N5X A;  2QEJ C;  3RUL A;  2FBW B;  3PGE A;  1UNS A;  5C3J B;  1WZ3 A;  1L0V B;  3WAM A;  4GU2 A;  1GUA B;  2DBY A;  2LVO A;  2I38 A;  2SEB D;  2CS4 A;  1XLQ A;  4HVB A;  2KQS A;  4HPM B;  3N1Y C;  2C7H A;  3ZRF A;  4N58 A;  3JYU A;  1J19 A;  3D32 A;  3H7P B;  1E5W A;  4EZL A;  1D4B A;  3AEE B;  3TJP A;  1OEY A;  3MC0 B;  2PKO A;  3ALB A;  3HVD A;  3C19 A;  4JX1 C;  2ZCB A;  4MH8 A;  4EFO A;  1V1P A;  1VZ6 A;  5D3D A;  4ZRK A;  1WJN A;  4ICU A;  2R61 A;  2J0M A;  3MHZ A;  3DVG Y;  2KZR A;  3ZVV A;  2JXX A;  5AUI A;  2WP9 B;  2JUO A;  4YWG G;  5IKC M;  2FCM A;  1EF5 A;  3V62 A;  2K8C A;  4OZB A;  2L0T A;  2NPT A;  2UWQ A;  4US9 A;  3C0R B;  1V97 A;  3KYC D;  4HLE A;  1GJZ A;  2K0P A;  2WXL A;  2M0A A;  4KGS A;  3CF6 E;  4KGR A;  3EUB 2;  2FAZ A;  1N61 A;  1WX7 A;  3GS2 A;  2WXG A;  3OLM D;  1E7U A;  5DPT A;  4BBN F;  2RDH A;  4KZ0 A;  1AWD A;  3B2G A;  2JY6 A;  4BKS D;  4YTP B;  3MJW A;  1NYQ A;  1YN3 A;  2LWP A;  2QJL A;  1H8C A;  3KLS X;  1OTR B;  3RZF A;  3MTN B;  4BKT A;  3ZNH B;  2Z0E B;  2L05 A;  4XYC A;  2X38 A;  4NQL B;  4AWJ A;  1V9J A;  4DDI D;  1YJ1 A;  1ZE3 D;  1V1P B;  3VUY A;  4WJP A;  1JQ4 A;  3BVZ A;  4I6P A;  5AUK A;  2BS3 B;  2HD5 B;  4TUU A;  3V6C B;  3DBH B;  1Q10 A;  2GBJ A;  1KOT A;  2I1K A;  1SF0 A;  2MBB B;  4K7S A;  1V2Y A;  4KSL C;  2D3G A;  1WSP A;  2GBK A;  2QCZ A;  1XEE A;  2AYO B;  3RUI B;  1GC6 A;  3RT3 B;  2D11 A;  2O2V A;  5LXI B;  3DBR B;  3Q8A A;  4P1B C;  2JXT A;  1EUV B;  4C4V A;  4NY0 A;  3RYT A;  3NUH B;  1FCL A;  1IGD A;  2HTM E;  1ZXI A;  3VR8 B;  1F2R I;  3QIJ A;  1E6E B;  4LK0 M;  1XXG A;  4BFR A;  3TEW A;  5D7G A;  3VRB B;  3ZDT A;  4HRO A;  3DHI C;  3DQV A;  2MQJ A;  4K3C A;  2I1J A;  1PGB A;  2EEL A;  1TKE A;  2N9L A;  1B1Z A;  5C23 A;  4P6V F;  2K22 A;  4FA6 A;  2DZJ A;  4MH0 E;  4GLS C;  1KH0 A;  2C7N B;  3UQA A;  1RFA A;  2JRH A;  4MM3 A;  4YSY B;  2O6V A;  3DVG X;  3Q3F A;  4HDQ A;  4IWP A;  2ZEQ A;  1D5M C;  2KFK B;  2KQ7 A;  3AU4 A;  2J0J A;  3U4E G;  3V60 A;  2ZVO A;  3ZO5 B;  4W9C A;  4KV2 A;  3J9C A;  1ENF A;  4ZYS A;  2WU2 B;  2KQ4 X;  4FJY A;  4IDI A;  3ETR A;  1YOV B;  1KJT A;  2DHZ A;  3VDZ A;  1SE9 A;  3AMZ A;  3N30 A;  5CX3 A;  1CZP A;  1WY8 A;  3PRP B;  2BYF A;  5GXG B;  1I4H A;  3U52 E;  4EZK A;  3PZD A;  3TEY A;  3C8Y A;  3Q6B A;  3OJ4 B;  3VR9 B;  5JH5 C;  2IDY A;  4WH4 A;  2ICI A;  2KYW A;  2MWS B;  4W9G A;  2JPH A;  2YEP B;  4KGT A;  2N7J A;  2L00 B;  3DVN V;  1D3Z A;  1SE3 A;  3EGR A;  2WX0 A;  1C76 A;  1WYG A;  1ROE A;  3HIZ A;  2GB1 A;  1E7V A;  5JZE B;  1QKZ A;  3KVF B;  2PMV A;  3U8Z A;  4ICV A;  2KLG A;  3IG3 A;  4JPS A;  1IP9 A;  2DNF A;  1A70 A;  4FHK A;  3X23 A;  1EU3 A;  4MGI E;  2IYD B;  4IWQ A;  2MSE D;  4LNN A;  1N63 A;  2BVC A;  2Y5C A;  2YLM A;  4HEA 1;  4E3C A;  4LNK A;  3SR6 A;  3ZIM A;  3N32 A;  3A33 B;  1EO6 A;  1WR1 A;  3U7D A;  1V5O A;  3TIX A;  1PDX A;  4XWW A;  1WRD B;  3A4R A;  3V05 A;  4F7Z A;  2N1V A;  3T9L A;  3VTW A;  3L17 A;  1FIQ A;  4DXA B;  3DVN U;  1NYR A;  3VQI A; 
#chains in the Genus database with same CATH homology
 1QLB B;  1T3Q A;  1F2R C;  5D3I B;  1I4X A;  1N5W A;  3W5U B;  2M19 A;  1JML A;  2MEK A;  1L4D B;  5JXV A;  1FEH A;  5HFY A;  1E10 A;  5G5H A;  3IT4 B;  1FCC C;  3H8H A;  1JRO A;  2J42 A;  4CQN A;  1TS3 A;  2RPV A;  1GTH A;  2W82 A;  4YT0 B;  1QT9 A;  1TKG A;  4C56 C;  1VLB A;  3W2D A;  1KFY B;  1AW7 A;  2XNA C;  3AED B;  3B2F A;  1SB3 C;  2XN9 C;  1YQ3 B;  1SJH D;  1GOZ A;  1XF5 L;  2K5P A;  1MVK A;  2E3T A;  4REZ A;  4D2K A;  2IGD A;  1K52 A;  5HI1 A;  5TSS A;  3AE6 B;  1TYG B;  1VZ8 A;  4ARC A;  1UGJ A;  1EM7 A;  5EE0 A;  3IXS A;  1TS4 A;  1GAQ B;  3CIR B;  1C9F A;  1YMH E;  3AEA B;  3BYY B;  3BZD B;  4NZL B;  2WLB A;  4L2Y A;  4JWU C;  1YN5 A;  2BB6 A;  3BK1 A;  4OZA A;  1H7W A;  2WNM A;  3OWE B;  4TMA B;  4EE2 A;  1MPE A;  3O13 A;  1BUI C;  1STE A;  2OHF A;  2WXQ A;  1WXQ A;  2DWQ A;  2IGG A;  1PFD A;  1FXI A;  4XE0 A;  3FC4 A;  2JYT A;  2WXM A;  3AEC B;  3Q8C A;  2J52 A;  1JRP A;  1AN8 A;  2LHE A;  1HXY D;  4C7Y A;  1IBX A;  1ZDV A;  2Z8L A;  1GTE A;  3AH7 A;  3KQ4 A;  4KKI A;  3DWM A;  4RGM A;  4ZRQ A;  3R2I A;  3HVZ A;  4YTN B;  4A6Q A;  1JWA D;  1V1O A;  1JWB D;  5BMG A;  2IGH A;  3T3N A;  4RGO S;  3AE5 B;  4RH6 A;  1RYJ A;  3NS1 A;  1IBX B;  2INP E;  1ZOY B;  2ZW0 A;  3VRA B;  1JWS D;  1WRI A;  1D6E C;  5BMH A;  1I7H A;  1CK1 A;  4C80 A;  1SJE D;  4JE3 B;  3SFD B;  1RFK A;  3MFG A;  4N59 A;  2L83 A;  5E6J A;  4B0M A;  2I2Y A;  1TS5 A;  1UWX A;  1VDV A;  2CJN A;  5BYS A;  1JWU D;  1ZPS A;  1XCQ L;  3I57 A;  1ET9 A;  1FXA A;  4KKJ A;  4YXD B;  3Q69 A;  4RFB A;  3PZ8 A;  4WAF A;  4HJG E;  1BML C;  3AV8 A;  1JAL A;  1XLN A;  4DQO C;  1F0Z A;  3BWU D;  3Q8B A;  1J7A A;  2EKI A;  3ZYY X;  4LTU A;  1MHX A;  2AQ2 B;  3W5V B;  3HUI A;  1L4Z B;  2G9H D;  1I4R A;  1VZ7 A;  1L6V A;  3NZ3 A;  4HKQ A;  3ZGZ A;  1K51 A;  1TS2 A;  1DOX A;  5BYQ A;  4WUR A;  4OHJ A;  4A90 A;  2LMC A;  1E0Z A;  1OQQ A;  4WIP A;  2L1A A;  4USA A;  2INN E;  2J53 A;  2N0S B;  2J4X A;  4A8X C;  3IT6 B;  1KTK A;  3PO0 A;  1FNV A;  2WU5 B;  1SIJ A;  1TKY A;  2V0G A;  2M56 B;  2JX5 A;  2GI9 A;  1T6B X;  3KWL A;  5G5G A;  1QOF A;  2W3R A;  1CJE A;  3P63 A;  2V3P A;  3ZJV A;  1N5X A;  2QEJ C;  2BBC A;  4OZC A;  2FBW B;  2MJE A;  1UNS A;  5C3J B;  1L0V B;  3R2T A;  4NAW B;  2DBY A;  2I38 A;  2SEB D;  2NMQ A;  4RCO A;  1HEZ E;  1XLQ A;  4XDD A;  2PIA A;  4N58 A;  1VJK A;  3FIL B;  1D4B A;  1DYQ A;  1QIL A;  3AEE B;  1R7S A;  3MC0 B;  1IUE A;  2PKO A;  1DOI A;  1FRR A;  1IGC A;  3HVD A;  4JX1 C;  3HRD D;  4Q2J A;  4MH8 A;  1V1P A;  1VZ6 A;  2IPK D;  3KWV A;  5D3D A;  2WXI A;  2R61 A;  1QOG A;  3AE9 B;  3P4P B;  2DLB A;  4ARI A;  1YJJ A;  2PW9 A;  1ET6 A;  3MHZ A;  5FK9 C;  2DYO A;  2JWU A;  1JCK B;  3E56 A;  2KN4 A;  2WDV B;  2LJI A;  5EE9 A;  1D5X C;  1NEK B;  1TY0 A;  3EA6 A;  3FAH A;  3TSS A;  2JU6 X;  2WP9 B;  5AUI A;  1TY2 A;  3RPF C;  2OED A;  4ZHP A;  2D5G A;  1FNW A;  4R3D A;  4YWG G;  1GT8 A;  1QOA A;  1XLO A;  3AE3 B;  2IJ0 A;  3MP9 A;  4OZB A;  2MJ3 A;  1KF6 B;  5HHD G;  4ZHO A;  2WS3 B;  4US9 A;  1V97 A;  1J7B A;  4WWM A;  2K0P A;  2AQ1 B;  2WXL A;  1C78 A;  2M0A A;  2LUM A;  2H89 B;  4KGS A;  4KGR A;  4PT5 A;  1GB1 A;  1EU4 A;  4RGT A;  3EUB 2;  1SE2 A;  2KAC A;  2WDQ B;  1N61 A;  3UI3 A;  3AEF B;  2BT6 A;  2WXJ A;  3GS2 A;  2WXG A;  2LFI A;  4RF0 A;  3ZJT A;  1ZDX A;  2RDH A;  1AWD A;  3B2G A;  1L0Y B;  1XO3 A;  3PZ7 A;  3P42 A;  4YTP B;  1NYQ A;  1YN3 A;  1Y56 A;  3T3O A;  2K9X A;  2QJL A;  4ZRP A;  3KLS X;  3ZQ4 A;  2PVG C;  1LO5 D;  2BW2 A;  3BII D;  5EE3 A;  3P4Q B;  1EWC A;  1H7X A;  3GB1 A;  2V4I B;  2WXF A;  1F77 A;  2X38 A;  2JQR B;  3BYT B;  4NJC A;  4UDU C;  1ZE3 D;  2AX5 A;  1E9M A;  3TEZ A;  1V1P B;  1JQ4 A;  3BVZ A;  5AUK A;  2K3U A;  2BS3 B;  1FO4 A;  1MHH E;  1UWM A;  1C77 A;  1MI0 A;  2NTS A;  1VR9 A;  2W3S A;  1WWT A;  2PTL A;  1Q10 A;  1ESF A;  1SXT A;  2SAK A;  3BVG A;  1SEB D;  4TSS A;  2VZK D;  1SF0 A;  3GP7 A;  3NVW A;  2PLP A;  4AQ7 A;  4L23 A;  3SEB A;  1WSP A;  1C4P A;  2JZP A;  4OW0 A;  2Y5P A;  1XEE A;  2KMM A;  3ZJU A;  1XLP A;  1FFV A;  3NRZ A;  1DOY A;  4DXF A;  3IAM 1;  3AM9 A;  4P16 A;  2L32 A;  3Q8A A;  1E7P B;  3NVV A;  2BB5 A;  1FFU A;  2JXT A;  3P4S B;  1BXT A;  1VRA B;  3NVZ A;  4M0W A;  5T8I A;  3LXF A;  4B0E A;  4JWS C;  2BS2 B;  2TSS A;  2H88 B;  3NUH B;  1I4G A;  1FCL A;  1IGD A;  2HTM E;  1OFF A;  1ZXI A;  4MT5 A;  3AE1 B;  3VR8 B;  1F2R I;  1E6E B;  1C79 A;  4LK0 M;  5EE1 A;  4DXG A;  1K50 A;  1DGJ A;  1XXG A;  3TEW A;  1PGX A;  1ZXH A;  2G1E A;  3N9Y C;  3AEG B;  1AYF A;  2Q5W D;  5D7G A;  3VRB B;  1HA5 A;  4L1B A;  4HRO A;  5FR3 A;  3NVY A;  2MJD A;  4RGN A;  1P7F A;  1PGB A;  2EEL A;  1TKE A;  2N9L A;  1B1Z A;  1KLU D;  1FMA D;  4P6V F;  4YSX B;  1N62 A;  2K22 A;  1ACC A;  4IOI E;  2GRI A;  1NVI D;  1WGK A;  4GLS C;  1KH0 A;  4GDL B;  3W9C B;  2W55 A;  4XDC A;  2N9K A;  4YSY B;  1HZ5 A;  4N6E B;  3AN1 A;  1C4C A;  1TZO A;  4AS1 A;  3RFZ B;  2L52 A;  1D5M C;  2ON8 A;  3MJ5 A;  2ACZ B;  1L5P A;  3U4E G;  3FIL A;  1NEN B;  2WXR A;  3ABV B;  2VZK B;  4HKZ E;  1FRD A;  1QF6 A;  3VQI A;  1YJI A;  3AE7 B;  2Y3A A;  1ENF A;  3J9C A;  4MM3 B;  2LGI A;  3URY A;  4ZYS A;  2WU2 B;  2KQ4 X;  3TUO A;  4IDI A;  3CF4 A;  3ETR A;  1YQ4 B;  2DYM A;  2KDM A;  1FM0 D;  2WXO A;  1J7C A;  3TEX A;  1KLG D;  3AE8 B;  2JSV X;  1B9R A;  3AMZ A;  3AE2 B;  1JWM D;  2LEK A;  2QIE B;  1CZP A;  4WQM A;  3SFE B;  4GDK B;  2PVO D;  2V3N A;  2WDR B;  2WXN A;  4OVZ A;  3BVM A;  1HQR D;  1I4H A;  2QMT A;  5GXG B;  3U52 E;  2BTE A;  1ZP0 B;  4XWT A;  3WCQ A;  2LHD A;  2WXH A;  1TJE A;  3TEY A;  2B76 B;  3C8Y A;  1V8C A;  3VR9 B;  1T5X D;  4O1N A;  5MPO A;  2FE8 A;  2IDY A;  1D5Z C;  2JYE A;  3AB5 A;  1C4A A;  3I9V 1;  4WH4 A;  2ICI A;  3Q8E A;  2BYT A;  1OQR A;  4C7Z A;  1KRH A;  1PYW D;  2MH7 A;  5BMI A;  1RWS A;  3R8B A;  2NTT A;  2YEP B;  4KGT A;  1EWY C;  3IAS 1;  3W1S A;  4A9A A;  2N7J A;  1QOB A;  5FKA C;  2CJO A;  2BS4 B;  1CQV A;  1SE3 A;  3EGR A;  3Q8F A;  1JW9 D;  1RM6 C;  3E9S A;  5BYR A;  1C76 A;  1SSN A;  1PGA A;  1ROE A;  1WYG A;  4LLG M;  4NAM A;  2GB1 A;  1GPX A;  1QKZ A;  1QQR A;  2KWD A;  4YTM B;  2PMV A;  3AEB B;  2RMM A;  1I4P A;  5H92 C;  4RF1 A;  4JPS A;  3L4P A;  5HG2 A;  2WXK A;  2YEP F;  4MAC A;  3AE4 B;  5I4D A;  1A70 A;  1GB4 A;  4TQ1 A;  1SBB B;  4ZOH C;  4TQ0 A;  1EU3 A;  4FXC A;  1YN4 A;  3LB8 C;  3LYY A;  3V3X A;  3P4R B;  4J3O D;  4HRS A;  2HDE A;  1FD6 A;  4KX6 B;  2AQ3 B;  1PUT A;  1XCT L;  4A55 A;  1N63 A;  2ZW1 A;  3U2S C;  1L6U A;  5C2T B;  2RDG A;  2WXP A;  3BK2 A;  2Y5C A;  1K53 A;  1I4Q A;  2E6X A;  1ZUD 2;  1UUP A;  3U7Z A;  3CWI A;  5LNK 1;  4HEA 1;  2QSD A;  1YNT E;  4RNA A;  2KAJ A;  4ITK A;  1M4V A;  3SR6 A;  1NI3 A;  2FUG 1;  1N60 A;  2CU3 A;  2W54 A;  3DWG C;  4XWW A;  1PDX A;  3V05 A;  2ONQ A;  1SE4 A;  3B9J A;  1L0X B;  1P7E A;  2QIL A;  1FIQ A;  3P1M A;  4H2A A;  1FNU A;  2WQY B;  4YSZ B;  5H8Y E;  4IKG A;  1NYR A;  1HZ6 A;  4US8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...