1IPGA

Solution structure of the pb1 domain of bem1p
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
GAMGSSTSGLKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BEM1 PROTEIN
publication title Structure and ligand recognition of the PB1 domain: a novel protein module binding to the PC motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ipgA00
4I6NB 4M8NA 4NAWA 5D6JB 3PS6A 1D3ZA 2LWPA 4W9GA 1WRDB 2J0MA 3Q3JA 1G6JA 4GN1A 3DBRI 2D07B 5IA7A 1QZEA 2FIDA 4GXBA 1YJ1A 2CS4A 1WXSA 2K8HA 3PZDA 2OOBB 3PSEB 3U30A 1M94A 2B3AA 4KSLC 4WAAA 2CHZA 4KIKA 3L10B 3W1SC 3VUXA 3QK0A 4B9KA 3DBSA 3PGEA 4IWQA 2LXCA 3A1QA 4KZCA 2KDIA 4JQWC 1UGMA 1GJZA 4JGHB 4DDID 2DENB 2IY0B 1R4NI 3JSVB 1GC6A 3L16A 5KHOA 2YLMA 3KUCB 1X1MA 4IWOA 4W9FA 3ZUNA 4FN2A 3ZO5B 4W9IA 3WANA 1RFAA 1I42A 5JHBA 2PE6B 2WWZA 3NZSA 4ZRIA 2ZVOA 1WF9A 3K9OB 3KYDD 2IZVB 5E6NA 5LLIA 2FCMA 1MG8A 2RPQA 4MELA 4LCDE 4W9KA 5CHWA 2R2QA 2IYDB 3C0RB 1EF1A 3A9KB 2W9NA 1TTNA 3OAWA 2FIFA 3A9JB 3EC8A 1FXTB 1P0RA 2KLCA 3PV1A 4LDTB 3ZNZB 2GBNA 2CR5A 1J19A 5HKHA 1KLVA 4NNJB 2BYVE 2K8BA 2PJHA 3PRMB 2DZIA 2N7EA 3RZWC 1IP9A 3DVNU 3ZTDA 5DPTA 4TUUA 2KZRA 4A3OA 1YD8U 3UGBB 1KJTA 2M17A 1V86A 2JRHA 5DPRA 4AUQC 2DZKA 1ISNA 3M63B 2O2VB 3EHVA 3HM3A 3TBLD 3UIOB 2KWUB 1WM3A 3AU4A 3CSFA 2OJRA 3IHPC 4BKSA 3CMMB 2PE9A 2HTHA 2JZZA 1U4AA 2KDEB 2CHWA 3U8ZA 3N30A 3QHTA 1XT9B 4BBNF 1WX8A 3NS8A 4AJYB 2QHOA 2J7QB 4CYEA 2KQ7A 4KVGB 3A9JA 2RR9A 1WE7A 2UWQA 2A4ZA 2XBBC 1ZW7A 3UIPB 1YIWA 4ASWC 1TZ1A 2KDFB 1GC7A 3DDCB 3EECA 3HM6X 1WJ4A 1KOTA 1YQBA 3ONSA 2MCNB 3A4RA 3DCGA 5JH5C 2N4FA 1EUVB 2K8CA 1WFYA 5LXIB 3IFWB 2O2VA 1HE8A 3QWZB 1P9DU 2JWZA 3LJ3A 1AARA 1A5RA 5AZGA 1ZKHA 1K8RB 2LRWA 4ZYNA 3DBLI 2G4SA 1NBFC 1V9JA 2DZMA 3DBHI 1E7VA 1WGGA 2O6VA 4W9EA 1SGHA 2L7RA 2IY1B 2I1JA 4BOSC 1IYFA 4KV2A 1WY8A 2DAFA 2D2QA 4CO7A 4IW0A 2JUOA 2LGDA 4TKNA 5CHVC 4EUTA 4GDKB 4KDIC 1GNUA 2RGFA 4HCNB 4IWPA 2L3ZA 4FJZA 5AEKB 2MW5A 4WWOA 3DVNV 1GUAB 1LM8B 2C60A 2KFJA 3KUDB 3Q3FA 2ZJDA 3VTVA 1LXDA 3ZNID 4ZRJA 3ZRFA 3A33B 1OTRB 3JW0X 3RULA 2AL3A 1OEYA 4GU2A 4HDQA 1UBIA 4E74A 1WR6E 2IBIB 3A1QB 4W9HA 4WQOB 4A20A 2J0KA 3L13A 4RM9A 4DHZE 4ZRKA 4OVUA 3WAOA 3IG3A 3M62B 3HIZA 4KDLB 3ZLZA 1V2YA 2ZPYA 2G3QB 3RZFA 3MTNB 4KZ0A 3WIMA 2UYZB 3D32A 2ZCBA 3PPAA 4GIVA 3AULA 5E6OA 3TL5A 2A5UA 1Q1OA 4MGIE 1YX5B 1VD2A 3ALBA 4MH0E 2L0FA 4GDKA 1E8XA 1NDDA 3VDZA 1WR1A 2KQSA 3SD5A 1E7UA 2C7HA 2IO0B 1WXVA 4G11A 3ZNHB 3VXWA 5DPWA 4MGYE 3ECIA 5GMVA 1ZGUB 3UQBA 2LRUA 4GGQA 1E8WA 3PHXB 3L54A 4TQ1A 1E90A 1P98A 3ZDTA 2AWTA 2C7MB 5CX3A 2M4NA 2DYMA 2FUHB 4TQ0A 1Z2MA 3OJ4B 4FJYA 2V1YA 4W9JA 3T8MA 5J17A 4JLCA 2K6QA 3NZUA 1J0GA 4FHKA 4BKSD 3ZRCA 2DYBA 3DQVA 4URKA 4IM3A 5G2NA 2RSUA 3WALA 3T9LA 3CF6E 5DPSA 4EZLA 1E8ZA 3B0AA 2BKRB 4E71A 4LDTD 2FNJB 4K7SA 1T0YA 4FJVB 2V4LA 3TCAA 2L8JA 1EO6A 4DXAB 3PVLA 1UZXB 4W9DA 4RM8A 3VAWA 4HK2A 5FR6A 2FCQA 3V6EB 1WX9A 2LVOA 1OEYJ 3QC8B 4NQLB 3DVGX 3IBEA 3IVFA 4XC2A 2LVQA 2K25A 4AWJA 4EKUA 2AEHA 2MA9B 5CTRC 2FCNA 2EMSA 4NJ7A 2NBVB 2G4DB 3KYCD 3WAPA 3TMPB 1WZ0A 1WGRA 2KOXA 4GMVA 2PPHA 5BO4B 2LUEA 2C9WB 3W1SA 1LFDA 2MX2A 3PRPB 2MSED 2NCNA 3SHQA 3L08A 1F9JA 1H4RA 2KTRA 3HK0A 3WA0A 3GZNI 4WJQA 1RLFA 2XK5B 4MSQB 2ASQA 4FBJB 2L0TA 1TGZB 5LXHA 2N1VA 1I35A 2MLBA 4II2B 2O6VB 3QCAA 1PQSA 4DK5A 2ZVNA 2LGXA 1V81A 5CHFA 4X57B 2NR2A 3BY4B 3QAQA 3DPDA 2CKHB 2MRPA 3RCZA 3TIXA 2M8SA 2WX1A 4EFOA 4ZDVA 3ZTCA 4F8CB 4K7WA 4ANVA 1S1QB 3NY5A 4M0WB 3PREA 4HLEA 3QIJA 3UF8A 4G50A 4WJNA 4IUMB 1J8CA 3S2AA 2BGFA 2KNBA 2KD0A 3ML9A 3L17A 4IM2A 2BF8B 2HE7A 2XK5A 3L0WB 2JY6A 2MP2A 3JYUA 2N9EB 4PYUA 3VVWB 4HWIB 1IPGA 4MEMA 3OJ3A 2J0JA 2NBWB 2KX3A 4HDOA 2MQJA 4PS8A 3MJWA 2KMAA 4AP4C 3RD2A 2FCSA 3H1UA 1LQBA 3VUWA 4NQKE 5JHAA 3VFKA 5J2RA 1WGDA 2MBOA 2XEWA 3ML8A 1EF5A 4II3B 2D11A 4FADA 2WDTB 2KJ6A 2Z0DB 3P2BA 4ICVA 2D3GA 3VTUA 4I6LB 4YL8A 4GB9A 4HJKA 1UD7A 2GBRA 1GG3A 2KKCA 3H7SA 3M95A 3OLMD 4LJOB 4DHJB 3W1YA 2IO1B 3K9PB 2LZ6A 3AXCA 4K81A 3VH4B 2KC1A 2KXJA 4JIOU 3ZNGC 1WE6A 2KHWB 4FHJA 1WIAA 4DDGD 5L95C 1S3SG 3RYTA 5J18A 4WJPA 4BFRA 4BVUC 4FA6A 3KVFB 2LGYA 1E8YA 1Y8RC 2NS5A 2LD9A 2L00B 2DAJA 1WMHB 3BINA 2Y5BB 4AJWA 3VHTC 2RD0A 4XX5A 2MBHA 2CU1A 1V49A 3B08A 4IC7B 3PLVA 3ZW3A 1RRBA 4FLHA 1JRUA 2DZJA 1V80A 4ANWA 4NPNA 2JVCA 2I1KA 3DVGY 3O65B 2KMCA 4BOZB 3MHSD 2KX0A 3V61A 1WJUA 5C23A 2KFKB 3R7QA 4PS3A 5D94A 3NHEB 2WX0A 1WJNA 2Z0EB 2KTRB 2M0XA 2IO3B 3KH0A 2FAZA 2DX5B 1V5OA 1WH3A 2KANA 1WGHA 1WXAA 4B95A 1WGYA 3KUZA 1WX7A 1L7YA 1VCBA 1WMHA 4W9CA 4FULA 4HPMB 4F1SA 3CSTA 5IAAC 4NJ6A 4BKTA 2NPTB 3VQIA 4E3CA 3UQAA 4M8MA 1Q5WB 2GMIC 1OGWA 2KN5A 3N32A 1UH6A 4A3PA 2ZEQA 3H6NA 5C1ZA 3X0WA 4BBNC 4HPLB 5AZHA 2NBUA 4HVBA 2BWFA 3R3MA 4AOFA 3H7PB 4OVVA 1OQYA 3M3JA 3NOBA 3B1LX 4F7ZA 3ZKJC 3ZIMA 3WAMA 2N9PC 2PEAA 2M1MA 5TR5A 2KFKA 2G45B 3DOWA 2BPSA 3QA8A 2BYFA 2KTFA 3QX1A 3AI5A 4CHKA 3HHMA 1SE9A 4LJPB 4DHZB 2MP2B 4MGZE 2O6VD 5D7GA 2JT4B 1KM7A 2KDBA 1TBEA 1UBQA 2LI5A 4ANXA 4IM0A 3V60A 3SU8X 2NPTA 4EEWA 3U7DA 1SIFA 3VH3B 4MDKE 3UINB 4DBGA 4N9F4 3PTFC 4K7UA 2KLGA 2ZNVC 2LJ5A 2VRRB 4HCPB 4I6PA 4DWFA 2NVUI 3JSVA 4G3XB 5E6PA 3AU5A 3EFUA 4TV3A 1Q0WB 3H7PA 2DYOA 2KWVB 2MBQA 4PYZA 4EZJA 2LVPA 2JRIB 3APFA 1V6EA 4MSMB 2L05A 2LXAA 2ZNVB 2MWSB 4RMAA 2MBBB 1WYWB 4MJSB 4K1RB 2KWCA 2KK8A 5DCNA 2K6DB 4ANUA 1V5TA 2GOWA 2MBEA 2N7DA 2ZPNA 3QJZA 3A9KA 3QARA 4KSKC 3ZVVA 1XQQA 2KJHB 3PT2B 4P7IA 1C3TA 1WXMA 5AZFA 3QQ8B 2GBMA 4JL9A 4MGKE 1WJ6A 2C7NB 2AL6A 2D10A 2K1FA 2BWES 5L83A 3APDA 3ENEA 3H9DA 3N3KB 3R66C 2ZCCA 2IO2B 2BKFA 2JZ3B 4IG7B 1XD3B 3LDZE 2CHXA 3V6CB 4ICUA 4G0NB 1P1AA 3APCA 4PS7A 3V62A 4BKGA 4EZKA 1RAXA 3TJPA 3I3TB 4EOYA 4GOCA 3SDLC 5EDSA 4HXDA 2GBJA 3VUYA 2GBKA 2C5LC 4GSWA 2AYOB 1Z5SB 2JPHA 2ZZPB 2DHZA 2HJ8A 5KHQA 4GDLB 1YX6B 3PLUA 4WWPA 1CMXB 4MJSA 5D2MB 4DHJD 2WYQA 1WM2A 2EKEC 2K39A 1L2NA 1E5WA 2HD5B 2KJRA 4NAWB 1P3QU 1C1YB 1WI0A 2KO3A 3ZDMC 2EMTA 2YVCA 3VTWA 4J6IA 3PHWB 4WWNA 2Z59B 2JXXA 5G55A 3A4SC 2KVRA 1NI2A 2LASA 1WZ3A 2N9XA 4XZ4A 2N1WA 4NY0A 3R7RA 3PRZA 2V3SA 1R4MI 3GOEA 4KIKB 2BYEA 2L76A 4B6WA 3KW5B 4WJOA 5JZEB 3JVZX 2KC2A 1BT0A 2JF5A 3RT3B 3RUIB 1H8CA 1UELA 4GDLA 4MM3A 2REXA 4W9LA 2R2OA 3X23A
chains in the Genus database with same CATH superfamily
2KVZA 2WXFA 2J0MA 2BS4B 2Q5WD 3Q3MC 1C76A 3DBRI 2MJDA 4MT5A 4GXBA 1JWMD 2CS4A 4RF0A 1I4HA 2K3UA 1F2RC 3U4EG 2CHZA 4KIKA 5G5GA 1FMAD 1PGXA 3DBSA 2LXCA 4KZCA 1L4DB 1GJZA 1C9FA 1JRPA 1GC6A 3L16A 5KHOA 3KUCB 4W9FA 3ZUNA 4W9IA 2NTTA 1T6BX 2LMCA 1C4CA 4DQOC 4H2AA 4ZRIA 5E6NA 2WXOA 1MG8A 4LCDE 1WYGA 2FIFA 3A9JB 2GRIA 1AW7A 1ZUD2 3AE6B 1FEHA 1IGDA 1OQRA 3PRMB 3DVNU 5AUIA 2G1EA 2MHJA 4RGMA 1XCTL 2LEKA 4R3DA 2CJNA 3HM3A 3TBLD 1ROEA 2KWUB 5FK9C 4RNAA 3IHPC 1C77A 4BKSA 3CMMB 2JX5A 1N61A 2WXHA 3N30A 2WS3B 1WX8A 2J7QB 3AE7B 3HRDD 1YJIA 4LTUA 1SE3A 3EECA 3HM6X 1UGJA 1WJ4A 1KOTA 2MCNB 2V3PA 2N4FA 1EUVB 1T0QC 2K8CA 1D5ZC 2PIAA 5BMIA 4IKGA 1K8RB 2J4XA 1I4PA 2LRWA 1NBFC 4P16A 2DZMA 2JU6X 1WGGA 1HZ6A 2V4IB 2I1JA 2DAFA 2LGDA 5CHVC 1GNUA 1Q10A 2INPE 2JYTA 1R7SA 1TZOA 3DVNV 1GUAB 2C60A 2KFJA 3KUDB 3VTVA 2ZJDA 3C8YA 1J7AA 1BUIC 3A33B 1OTRB 2AL3A 4US9A 1OQQA 4ARIA 3A1QB 1YOVB 2J0KA 1R4NB 4ZRKA 3WAOA 1KF6B 3HIZA 1V2YA 2HJ1A 2G3QB 3RZFA 3WIMA 5E6OA 1T0SC 1Q1OA 1YX5B 1VD2A 4GDKA 3BK1A 5HFYA 2L1AA 2IO0B 1PUTA 4G11A 3VXWA 3UQBA 4NZLB 5G5HA 4GGQA 1E8WA 3AECB 3PHXB 4TQ1A 2AWTA 2C7MB 2I38A 4QAYA 3TEXA 1ZP0B 1V1OA 4BKSD 2GI9A 3ZRCA 5G2NA 3AMZA 3GZNB 3CF6E 5DPSA 4EZLA 1E8ZA 3Q3OC 3AN1A 4K3BA 1TY2A 4OZCA 4DXAB 1EO6A 2RDGA 4OHJA 4W9DA 2FCQA 3V6EB 1WX9A 2LVOA 3QC8B 4NQLB 3DVGX 2LVQA 4AWJA 3TEWA 1XO3A 3BVMA 2WU5B 3GP7A 3TMPB 1WZ0A 2C9WB 4JX1C 2K5PA 1WSPA 3HK0A 3DWGC 3DBLB 4WJQA 1RLFA 1DOXA 4MSQB 2ASQA 4FBJB 1T5XD 1TGZB 2N1VA 5HHDG 1I35A 1AWDA 4II2B 2O6VB 3URYA 3QCAA 1PQSA 4KKIA 2IDYA 1YN4A 5CHFA 4X57B 4HPPA 4A9AA 3QAQA 1KRHA 3TIXA 4ZDVA 3Q8EA 1MHHE 3PREA 4HLEA 2W3RA 3UF8A 4G50A 2XNAC 4IUMB 1K50A 2BGFA 4PK1A 2KD0A 1FFVA 3ML9A 2XK5A 3JYUA 2N9EB 1IPGA 4OW0A 4MEMA 2KX3A 1XLOA 3MJWA 4AP4C 1LQBA 5EE0A 3AV8A 2INDC 5J2RA 1YQ4B 3NG0A 1EF5A 1JWBD 2VZKD 2WDTB 2KJ6A 4AQ7A 3RN9C 3AE3B 4YSZB 4M0WA 1N63A 4HJKA 1GG3A 4DHJB 1PYWD 3OLMD 4RGOS 2X38A 3K9PB 3V05A 3AXCA 3AM9A 2KC1A 1IBXB 3ZNGC 1WE6A 2KHWB 1QOBA 5L95C 3FAHA 1V8CA 4WJPA 4BVUC 4FA6A 2LGYA 3ZJTA 1Y8RC 2RPVA 2DAJA 2QDFA 4AJWA 1N5XA 3NRZA 2RD0A 3AE1B 2QC8A 3P4SB 1PGAA 1L0XB 1JRUA 5H92C 2DZJA 4NPNA 2I1KA 2KMCA 4BOZB 3MHSD 2KX0A 1CJEA 3R7QA 1WJNA 2Z0EB 2KTRB 2M0XA 1WH3A 1V97A 4MACA 4HPMB 2LGIA 4LNOA 3CSTA 5IAAC 3T3NA 3ETRA 2ZW1A 1Q5WB 3MP9A 3N32A 2KN5A 4A3PA 3H6NA 1TS4A 2LJIA 2NBUA 2BWFA 4ZHOA 3EGRA 2W3SA 1XXGA 3M3JA 1MHXA 2JXTA 1XLPA 1EU4A 2PEAA 5TR5A 1MI0A 4C80A 3AI5A 3HHMA 2MP2B 2JT4B 1KM7A 4ANXA 4IM0A 2WXLA 3V60A 1SF0A 4HEA1 1EWCA 4YTNB 3U7DA 1SIFA 2KDMA 1BXTA 4I6PA 1VR9A 4G3XB 1HA5A 2UU7A 3P1MA 2LUMA 3P4RB 4S0RA 1JALA 2LVPA 4RMAA 1WYWB 5DCNA 2KWCA 5D3DA 4URKA 3ZXVA 3QARA 3ZVVA 2KJHB 4P7IA 1C3TA 4LNNA 2WDQB 2ZCCA 3ZQ4A 2IO2B 2BKFA 2JZ3B 1TY0A 3V6CB 4N59A 4ICUA 1I4GA 4PS7A 1RAXA 4GOCA 3RFZB 3VUYA 4GSWA 2AYOB 4D2KA 3NJTA 3RPFC 3Q69A 4MM3B 4WWPA 4C4VA 4WWMA 1CQVA 4LNFA 3HVZA 3ZXRA 4YTMB 2KO3A 3VTWA 2AQ2B 3PHWB 2Z59B 3A4SC 1F52A 3AEBB 2N9XA 1DOYA 5TSSA 3R7RA 4KIKB 2L76A 4WJOA 4JE3B 2KC2A 1BT0A 5FR3A 3RUIB 3FKYA 1K53A 1CZPA 3LB8C 4P6VF 3R2IA 2OEDA 1D3ZA 2WXJA 4W9GA 2D07B 2FIDA 1WXSA 1M4VA 3PSEB 3U30A 1TKEA 2W54A 3W1SC 4B9KA 3PGEA 2KDIA 2IY0B 3B2GA 1SE4A 2YLMA 3AE5B 4IWOA 1TYGB 5E6JA 4FN2A 3ZO5B 3I5JC 3K9OB 3KYDD 5C3JB 1VLBA 4W9KA 5CHWA 2R2QA 1NYRA 2V0GA 3OAWA 3PV1A 2KLCA 1J19A 1IGCA 2BYVE 2K8BA 5HG2A 1F0ZA 3ZTDA 2J52A 4XWTA 1V86A 2INNE 1F2RI 3M63B 1STEA 3P42A 3CSFA 4LK0M 3OWEB 1UWXA 4L2YA 2PE9A 2HTHA 2JZZA 1U4AA 3W9CB 2CHWA 3U8ZA 3QHTA 1JMLA 1XT9B 4BZAA 3NVYA 2M56B 1RFKA 5BYQA 4CYEA 5IKCM 2KQ7A 2MEKA 2V9HA 1FXAA 2RMMA 1ZW7A 3UIPB 1SB3C 3DDCB 2D5GA 1YQBA 1TIFA 5JH5C 3KLSX 4DXGA 3V3XA 2WGSA 5LXIB 1E0ZA 1P9DU 1F77A 1L0YB 1I4RA 1ZKHA 4ZYNA 5BMHA 2G4SA 2KT7A 2ZW0A 4REZA 1IUEA 1E7VA 3BVZA 2L7RA 2WP9B 1IYFA 4KV2A 1WY8A 2JUOA 4EUTA 2I2YA 4GDKB 4KDIC 1F1HA 4IWPA 4FJZA 5AEKB 2WQYB 4WIPA 2N9KA 1LXDA 3TEZA 3LYYA 3HVDA 3JW0X 5AUKA 1D5XC 4E74A 4GU2A 4HDQA 2IBIB 2YEPB 4HKQA 1E9MA 4RM9A 4KDLB 1SE2A 2ZPYA 4KZ0A 2UYZB 4GIVA 3D32A 3AULA 3E56A 3TL5A 4MH0E 3ZGZA 4YTPB 3VDZA 2KQSA 5HI1A 4L1BA 1WXVA 3ZNHB 5DPWA 3L54A 3RNCC 1P98A 2YEPF 3ZDTA 2DYMA 1QKZA 1Z2MA 4FJYA 2V1YA 1J0GA 2K6QA 1FCLA 3VRAB 4IM3A 2RSUA 3WALA 3T9LA 2W82A 4E71A 3AEFB 2ICIA 2L8JA 3DHGC 4HK2A 1ZDVA 1JQ4A 5LNK1 2AEHA 2MA9B 5CTRC 2BTEA 3WAPA 1FO4A 4OZBA 2MSED 3L08A 1H4RA 3AEEB 2XK5B 5IOIA 3DBHB 2MLBA 1N60A 2ZVNA 2CJOA 3DPDA 2MRPA 2WX1A 2KYWA 1YN3A 4F8CB 4K7WA 4RH6A 1HEZE 1S1QB 2MJ3A 4M0WB 3QIJA 1RYJA 3T3OA 4PYUA 4HWIB 2FBWB 1D4BA 3OJ3A 4HDOA 4RFBA 4M02A 2KMAA 1FRRA 1MPEA 3VUWA 2MBOA 4XWWA 4FADA 2WXPA 3LXFA 3VR9B 4GB9A 2GBRA 3M95A 2IO1B 3AH7A 4JIOU 4XDDA 2PKOA 4DXFA 4O1NA 3ZJVA 1S3SG 2W55A 4AS1A 3KVFB 1E8YA 1QT9A 2NS5A 2LD9A 3GS2A 4WQMA 3VHTC 3OG5A 3NUHB 2CU1A 1B9RA 2JQRB 5JXVA 1T3QA 4FLHA 3N20C 4ANWA 4YWGG 1L4ZB 3EUB2 4J3OD 2WXKA 4B95A 1VCBA 1WMHA 3FILA 3L4PA 2PMVA 4NJ6A 4E3CA 3UQAA 3SR6A 1OGWA 4HJGE 2INCC 3IT6B 3GE8C 5AZHA 4HVBA 4AOFA 4OVVA 3NOBA 3N1ZC 3ZKJC 2WNMA 3WAMA 2M1MA 2KFKA 2J53A 2BPSA 1QOFA 2BYFA 2KTFA 4RGTA 4LJPB 2JYEA 5D7GA 1ET6A 1UUPA 2KDBA 1N5WA 2LI5A 3SU8X 2NPTA 3VH3B 1V1PA 4MDKE 3AEAB 3UINB 2KLGA 1K52A 1ENFA 2ZNVC 3EFUA 1L0VB 2D3AA 4JPSA 4PYZA 4C7ZA 4N6EB 2L05A 1HXYD 2MBBB 2K6DB 5EE9A 1VZ6A 2GOWA 2MBEA 4KSKC 1XQQA 1FNVA 2GBMA 4MGKE 2C7NB 5L83A 3APDA 3N3KB 1YNTE 1QOGA 4KGTA 4CQNA 2CHXA 2L83A 1FIQA 4G0NB 1P1AA 4EZKA 3I3TB 3SDLC 3Q8CA 4HXDA 3Q3NC 2C5LC 4ACFA 3DHHC 3PLUA 2WYQA 1WM2A 2K39A 1DGJA 2KACA 2KJRA 1P3QU 3ZDMC 2EMTA 2DWQA 2YVCA 4J6IA 1C4PA 2LGSA 5G55A 1NI2A 1E10A 2AQ1B 2IGGA 4JWUC 2KN4A 4B6WA 5JZEB 3HUIA 2JF5A 1H8CA 2PLPA 4GDLA 3Q14C 3NVVA 2Y5PA 4M8NA 4NAWA 5D6JB 3FC4A 1C4AA 3PS6A 4KGRA 1WRDB 3Q3JA 1SJED 1KFYB 4GN1A 1FM0D 1QZEA 2K8HA 4P1BC 2AX5A 1M94A 4KSLC 3C19A 3VUXA 3QK0A 3SEBA 3A1QA 2GB1A 4JQWC 2KAJA 2WXRA 1C78A 1R4NI 1ZDXA 3JSVB 4IDIA 3WANA 1PFDA 5JHBA 3GE3C 5LLIA 1WF9A 2IZVB 3O13A 2OHFA 2FCMA 2RPQA 2G9HD 3C0RB 3A9KB 2W9NA 1SJHD 1FXTB 1P0RA 3ZNZB 2D3CA 4NNJB 3RZWC 1IP9A 1HQRD 5DPTA 4A6QA 1ZOYB 2LFIA 1KJTA 5DPRA 4AUQC 2DZKA 4TSSA 1ISNA 1QQRA 3EHVA 3P63A 3TEYA 3UIOB 1J7BA 2OJRA 4ZRPA 2KDEB 2PW9A 4KVGB 2RR9A 2A4ZA 3KWLA 1HTQA 4XYCA 4ASWC 2KDFB 4TMAB 1ESFA 1CK1A 1R4MB 1QILA 5I4DA 1WFYA 3IFWB 2O2VA 1HE8A 1AARA 1A5RA 4FXCA 3DBLI 2BS3B 3ABVB 1D5MC 1ZXIA 2DLBA 2O6VA 4ZRQA 4BOSC 3DBRB 2D2QA 4TKNA 2RGFA 1NYQA 2D3BA 2MW5A 2J42A 2H88B 3Q3FA 2DBYA 3N9YC 1YN5A 4XDCA 4W9HA 4WQOB 2L52A 4A20A 2WU2B 3L13A 4DHZE 4OVUA 3IG3A 3M62B 1P7FA 3PPAA 1TJEA 2A5UA 4MGIE 3ALBA 1WR1A 3RNAC 2QIEB 4GLSC 1FD6A 1UNSA 3MC9A 3NS1A 2VH2A 2M4NA 2FUHB 1FXIA 5BMGA 4TQ0A 3T8MA 4FHKA 2DYBA 2WXGA 4S17A 2BQQA 3RNBC 2BKRB 4LDTD 2FNJB 3TCAA 4B0MA 3PVLA 1QF6A 3R2TA 5FR6A 3PZ7A 4ZOHC 2B76B 4YSXB 3IVFA 4XC2A 2EMSA 4NJ7A 2NBVB 2G4DB 2BW2A 2BB6A 4UDUC 2LUEA 5H8YE 2FUG1 1LFDA 1YJJA 2NCNA 2K0PA 3SHQA 3RI7C 2R61A 2KTRA 3WA0A 5LXHA 1TKGA 2K9XA 2H89B 2LGXA 3Q8BA 1FCCC 2JZPA 4WURA 3TSSA 2M8SA 5C2TB 3ZTCA 2N0SB 1SEBD 4ANVA 3NY5A 3MJ5A 2GLSA 2KNBA 3L17A 1MFWA 2MP2A 2BYTA 3AEGB 1VJKA 2NBWB 3KQ4A 2E3TA 2MQJA 1FNWA 4PS8A 4RGNA 3RD2A 3J9CA 2WDRB 5JHAA 1WGDA 1XLQA 2XEWA 3ML8A 1ZE3D 4II3B 2D11A 2Z0DB 3P2BA 1NI3A 1UD7A 4LJOB 3VH4B 4MH8A 2JSVX 1MJDA 4K3CA 1XCQL 4ARCA 2MH7A 2QILA 1MVKA 1E6EB 1WIAA 4FHJA 1YQ3B 1EU3A 3RYTA 1NENB 4BFRA 2IGHA 1WMHB 2Y5BB 3FILB 2MBHA 3I57A 5IN7A 3GB1A 4IC7B 1V80A 3PO0A 1KTKA 3IT4B 3AB5A 3MFGA 3V61A 4YXDB 1WJUA 2KFKB 1GOZA 2IO3B 1SIJA 2FAZA 3TUOA 1NVID 2DX5B 1V5OA 2KANA 3VR8B 1WGHA 2HDEA 1ACCA 3RNGC 3KUZA 1WX7A 1L7YA 3PZ8A 4W9CA 4F1SA 4BKTA 2NPTB 2IGDA 1V1PB 1UH6A 4OZAA 1SSNA 3R3MA 1GB4A 1P7EA 4YSYB 1GPXA 1OQYA 3AE2B 3B1LX 4F7ZA 3Q6BA 3ZIMA 1TT5B 2G45B 3DOWA 3QA8A 1SE9A 4DHZB 4MGZE 1WWTA 2EELA 1TBEA 3I63C 4EEWA 2Z8LA 4US8A 4XGAB 4K7UA 1JWSD 2VRRB 4DWFA 2NVUI 3AU5A 4TV3A 1FPYA 1EWYC 1Q0WB 3H7PA 2MBQA 3APFA 2LXAA 2MWSB 2N7DA 2ZPNA 5AZFA 2RDHA 3QQ8B 4Q2JA 2K1FA 2WLBA 2BWES 3H9DA 3ENEA 3R66C 3LDZE 3VRBB 4BKGA 3APCA 3V62A 4EOYA 1NEKB 2JPHA 2ZZPB 1RWSA 1JWAD 1A70A 3SFEB 4GDLB 1GB1A 1DOIA 1YX6B 5D2MB 1CMXB 4MJSA 1YMHE 2HD5B 1TKYA 4NAWB 5BYRA 2WHIA 1SXTA 2TSSA 1MG4A 2WXNA 4WWNA 2BS2B 2JXXA 2KVRA 3BK2A 3SFDB 1WZ3A 4XZ4A 2N1WA 4NY0A 2PTLA 3MHZA 3DHIC 2V3SA 3GOEA 1FNUA 3KW5B 1UELA 2X8XX 4M01A 1XLNA 4W9LA 2R2OA 3X23A 4USAA 4I6NB 4EE2A 4KGSA 2LWPA 1XEEA 1G6JA 1JWUD 5IA7A 2BB5A 4ZYSA 3AEDB 5MPOA 1YJ1A 3PZDA 2OOBB 2B3AA 4WAAA 1D6EC 1I4QA 3L10B 1PGBA 4HRSA 4IWQA 2NTSA 4ITKA 2IPKD 1UGMA 4JGHB 3WCQA 4DDID 2DENB 2N7JA 1X1MA 4A8XC 1RFAA 1Y56A 2QCZA 1I42A 2PE6B 2WWZA 3NZSA 2ZVOA 1T0RC 1BMLC 4MELA 2IYDB 1EF1A 3Q8AA 1TTNA 3MC0B 3EC8A 4LDTB 3ZJUA 2GBNA 2CR5A 5HKHA 1N6ZA 1I4XA 1RM6C 2PJHA 2PVOD 1KLVA 4RCOA 2DZIA 2N7EA 2L32A 1C79A 3NVWA 4PT5A 2BT6A 4TUUA 2KZRA 4A3OA 1YD8U 3UGBB 2M17A 2JRHA 2SEBD 1HTOA 4L23A 2O2VB 3I9V1 3AU4A 1WM3A 2XN9C 1TS5A 4YT0B 2AQ3B 2BVCA 4JWSC 1GAQB 4C4VB 4BBNF 3NS8A 3P4QB 3EFCA 2QHOA 4AJYB 3A9JA 1DYQA 5GXGB 3W2DA 1WE7A 2UWQA 1WXQA 3KWVA 2VH1A 2XBBC 1YIWA 5IO9A 1TZ1A 1GC7A 2RDBC 5EE3A 3ONSA 3A4RA 3DCGA 2N9LA 3P4PB 1QLBB 3QWZB 2JWZA 3LJ3A 5AZGA 3AE9B 1V9JA 3DBHI 4W9EA 1SGHA 2IY1B 2WXMA 5BYSA 2DNFA 3DWMA 4CO7A 4IW0A 4LLGM 3BZDB 3RNFC 4HCNB 2L3ZA 1VDVA 4WWOA 1LM8B 1LO5D 5T8IA 3ZNID 4ZRJA 3ZRFA 3RULA 1I7HA 1OEYA 1UBIA 1WR6E 4C56C 3ZLZA 2LHDA 3MC8A 3MTNB 1J7CA 2ZCBA 2CU3A 2WDVB 1KLUD 2L0FA 1E8XA 1NDDA 1L6VA 4NAMA 3SD5A 4A55A 1E7UA 2C7HA 4A90A 4MGYE 3ECIA 5GMVA 1ZGUB 2LRUA 1E90A 5CX3A 3OJ4B 4W9JA 5J17A 4JLCA 3NZUA 4N58A 3DQVA 2QMTA 3B0AA 2PVGC 4K7SA 1T0YA 4FJVB 3U52E 2V4LA 2OJWA 1UZXB 4RM8A 3VAWA 1OEYJ 1JCKB 1VZ7A 3IBEA 2E6XA 3B9JA 2K25A 4EKUA 2M0AA 2FCNA 3NVZA 3KYCD 4KX6B 1LGRA 1WGRA 2KOXA 1K51A 4GMVA 2PPHA 4WAFA 2KMMA 5BO4B 3W1SA 2MX2A 3PRPB 1AN8A 1F9JA 3NZ3A 5IP4D 3GZNI 1B1ZA 2L0TA 4DK5A 4ZHPA 1V81A 1L6UA 1JROA 2NR2A 3BY4B 1QOAA 1PDXA 2CKHB 3RCZA 4EFOA 1HZ5A 3U7ZA 1VZ8A 3BVGA 4WJNA 1J8CA 3S2AA 4KKJA 4IM2A 2BF8B 2HE7A 3L0WB 2JY6A 1XF5L 3VVWB 3BYYB 2J0JA 3Q8FA 2FCSA 3H1UA 4NQKE 3VFKA 2KQ4X 3U2SC 1UWMA 2QEJC 4ICVA 2D3GA 3VTUA 4I6LB 4YL8A 2M19A 2KKCA 2K22A 3H7SA 3W5UB 3W1YA 2ONQA 2LZ6A 4K81A 2KXJA 5FKAC 1FRDA 1OFFA 2WXQA 4RF1A 1TS3A 4DDGD 2EKIA 3H8HA 5J18A 2L00B 3BINA 4NJCA 1KH0A 4XX5A 3CIRB 1V49A 2V3NA 3B08A 3ZW3A 3PLVA 1RRBA 2NMQA 2JVCA 3DVGY 3O65B 1E7PB 5EE1A 2ACZB 1IBXA 2KWDA 5C23A 1FFUA 1TS2A 3BWUD 3EA6A 4PS3A 5D94A 3NHEB 2WX0A 3KH0A 2MJEA 2WXIA 1L5PA 1WXAA 1WGYA 4HKZE 3N1YC 3RNEC 4FULA 3VQIA 1L2NA 4M8MA 2GMIC 2ZEQA 5C1ZA 5D3IB 3X0WA 4BBNC 4HPLB 3UI3A 4LNKA 3ZYYX 1WRIA 3H7PB 4B0EA 4XE0A 2LHEA 4C7YA 1KLGD 4M00A 2N9PC 4BAXA 1SBBB 2QSDA 3QX1A 4CHKA 3R8BA 2O6VD 1EM7A 1UBQA 4DBGA 4N9F4 3PTFC 2HTME 2LJ5A 4HCPB 3JSVA 5E6PA 4OVZA 2DYOA 2KWVB 4EZJA 2JRIB 1V6EA 4MSMB 2ZNVB 4MJSB 4LNIA 2JWUA 4K1RB 4ANUA 2KK8A 1V5TA 4WH4A 3QJZA 3A9KA 3PT2B 1WXMA 4JL9A 1WJ6A 2AL6A 2D10A 1JW9D 3AE4B 3W5VB 4IG7B 1XD3B 1ZPSA 2ON8A 3TJPA 3AE8B 1VRAB 5EDSA 2GBJA 2GBKA 2BBCA 1Z5SB 3B2FA 3IAM1 3CWIA 2DHZA 2Y5CA 2HJ8A 5KHQA 4DHJD 2FE8A 2EKEC 1E5WA 3BIID 1AYFA 3RMKC 2IJ0A 4P1CC 3BYTB 1C1YB 3E9SA 1WI0A 2Y3AA 2LASA 3IXSA 4C00A 1UF0A 1ET9A 2VZKB 3PRZA 4IOIE 1R4MI 2QJLA 2BYEA 1ZXHA 3N1XC 2SAKA 1WGKA 3JVZX 3RT3B 4HROA 4MM3A 3Q2AC 2REXA 3IAS1 1N62A
chains in the Genus database with same CATH topology
4I6NB 4M8NA 4NAWA 5D6JB 3PS6A 1D3ZA 2LWPA 4W9GA 1WRDB 2J0MA 3Q3JA 1G6JA 4GN1A 3DBRI 2D07B 5IA7A 1QZEA 2FIDA 4GXBA 1YJ1A 2CS4A 1WXSA 2K8HA 3PZDA 2OOBB 3PSEB 3U30A 1M94A 2B3AA 4KSLC 4WAAA 2CHZA 4KIKA 3L10B 3W1SC 3VUXA 3QK0A 4B9KA 3DBSA 3PGEA 4IWQA 2LXCA 3A1QA 4KZCA 2KDIA 4JQWC 1UGMA 1GJZA 4JGHB 4DDID 2DENB 2IY0B 1R4NI 3JSVB 1GC6A 3L16A 5KHOA 2YLMA 3KUCB 1X1MA 4IWOA 4W9FA 3ZUNA 4FN2A 3ZO5B 4W9IA 3WANA 1RFAA 1I42A 5JHBA 2PE6B 2WWZA 3NZSA 4ZRIA 2ZVOA 1WF9A 3K9OB 3KYDD 2IZVB 5E6NA 5LLIA 2FCMA 1MG8A 2RPQA 4MELA 4LCDE 4W9KA 5CHWA 2R2QA 2IYDB 3C0RB 1EF1A 3A9KB 2W9NA 1TTNA 3OAWA 2FIFA 3A9JB 3EC8A 1FXTB 1P0RA 2KLCA 3PV1A 4LDTB 3ZNZB 2GBNA 2CR5A 1J19A 5HKHA 1KLVA 4NNJB 2BYVE 2K8BA 2PJHA 3PRMB 2DZIA 2N7EA 3RZWC 1IP9A 3DVNU 3ZTDA 5DPTA 4TUUA 2KZRA 4A3OA 1YD8U 3UGBB 1KJTA 2M17A 1V86A 2JRHA 5DPRA 4AUQC 2DZKA 1ISNA 3M63B 2O2VB 3EHVA 3HM3A 3TBLD 3UIOB 2KWUB 1WM3A 3AU4A 3CSFA 2OJRA 3IHPC 4BKSA 3CMMB 2PE9A 2HTHA 2JZZA 1U4AA 2KDEB 2CHWA 3U8ZA 3N30A 3QHTA 1XT9B 4BBNF 1WX8A 3NS8A 4AJYB 2QHOA 2J7QB 4CYEA 2KQ7A 4KVGB 3A9JA 2RR9A 1WE7A 2UWQA 2A4ZA 2XBBC 1ZW7A 3UIPB 1YIWA 4ASWC 1TZ1A 2KDFB 1GC7A 3DDCB 3EECA 3HM6X 1WJ4A 1KOTA 1YQBA 3ONSA 2MCNB 3A4RA 3DCGA 5JH5C 2N4FA 1EUVB 2K8CA 1WFYA 5LXIB 3IFWB 2O2VA 1HE8A 3QWZB 1P9DU 2JWZA 3LJ3A 1AARA 1A5RA 5AZGA 1ZKHA 1K8RB 2LRWA 4ZYNA 3DBLI 2G4SA 1NBFC 1V9JA 2DZMA 3DBHI 1E7VA 1WGGA 2O6VA 4W9EA 1SGHA 2L7RA 2IY1B 2I1JA 4BOSC 1IYFA 4KV2A 1WY8A 2DAFA 2D2QA 4CO7A 4IW0A 2JUOA 2LGDA 4TKNA 5CHVC 4EUTA 4GDKB 4KDIC 1GNUA 2RGFA 4HCNB 4IWPA 2L3ZA 4FJZA 5AEKB 2MW5A 4WWOA 3DVNV 1GUAB 1LM8B 2C60A 2KFJA 3KUDB 3Q3FA 2ZJDA 3VTVA 1LXDA 3ZNID 4ZRJA 3ZRFA 3A33B 1OTRB 3JW0X 3RULA 2AL3A 1OEYA 4GU2A 4HDQA 1UBIA 4E74A 1WR6E 2IBIB 3A1QB 4W9HA 4WQOB 4A20A 2J0KA 3L13A 4RM9A 4DHZE 4ZRKA 4OVUA 3WAOA 3IG3A 3M62B 3HIZA 4KDLB 3ZLZA 1V2YA 2ZPYA 2G3QB 3RZFA 3MTNB 4KZ0A 3WIMA 2UYZB 3D32A 2ZCBA 3PPAA 4GIVA 3AULA 5E6OA 3TL5A 2A5UA 1Q1OA 4MGIE 1YX5B 1VD2A 3ALBA 4MH0E 2L0FA 4GDKA 1E8XA 1NDDA 3VDZA 1WR1A 2KQSA 3SD5A 1E7UA 2C7HA 2IO0B 1WXVA 4G11A 3ZNHB 3VXWA 5DPWA 4MGYE 3ECIA 5GMVA 1ZGUB 3UQBA 2LRUA 4GGQA 1E8WA 3PHXB 3L54A 4TQ1A 1E90A 1P98A 3ZDTA 2AWTA 2C7MB 5CX3A 2M4NA 2DYMA 2FUHB 4TQ0A 1Z2MA 3OJ4B 4FJYA 2V1YA 4W9JA 3T8MA 5J17A 4JLCA 2K6QA 3NZUA 1J0GA 4FHKA 4BKSD 3ZRCA 2DYBA 3DQVA 4URKA 4IM3A 5G2NA 2RSUA 3WALA 3T9LA 3CF6E 5DPSA 4EZLA 1E8ZA 3B0AA 2BKRB 4E71A 4LDTD 2FNJB 4K7SA 1T0YA 4FJVB 2V4LA 3TCAA 2L8JA 1EO6A 4DXAB 3PVLA 1UZXB 4W9DA 4RM8A 3VAWA 4HK2A 5FR6A 2FCQA 3V6EB 1WX9A 2LVOA 1OEYJ 3QC8B 4NQLB 3DVGX 3IBEA 3IVFA 4XC2A 2LVQA 2K25A 4AWJA 4EKUA 2AEHA 2MA9B 5CTRC 2FCNA 2EMSA 4NJ7A 2NBVB 2G4DB 3KYCD 3WAPA 3TMPB 1WZ0A 1WGRA 2KOXA 4GMVA 2PPHA 5BO4B 2LUEA 2C9WB 3W1SA 1LFDA 2MX2A 3PRPB 2MSED 2NCNA 3SHQA 3L08A 1F9JA 1H4RA 2KTRA 3HK0A 3WA0A 3GZNI 4WJQA 1RLFA 2XK5B 4MSQB 2ASQA 4FBJB 2L0TA 1TGZB 5LXHA 2N1VA 1I35A 2MLBA 4II2B 2O6VB 3QCAA 1PQSA 4DK5A 2ZVNA 2LGXA 1V81A 5CHFA 4X57B 2NR2A 3BY4B 3QAQA 3DPDA 2CKHB 2MRPA 3RCZA 3TIXA 2M8SA 2WX1A 4EFOA 4ZDVA 3ZTCA 4F8CB 4K7WA 4ANVA 1S1QB 3NY5A 4M0WB 3PREA 4HLEA 3QIJA 3UF8A 4G50A 4WJNA 4IUMB 1J8CA 3S2AA 2BGFA 2KNBA 2KD0A 3ML9A 3L17A 4IM2A 2BF8B 2HE7A 2XK5A 3L0WB 2JY6A 2MP2A 3JYUA 2N9EB 4PYUA 3VVWB 4HWIB 1IPGA 4MEMA 3OJ3A 2J0JA 2NBWB 2KX3A 4HDOA 2MQJA 4PS8A 3MJWA 2KMAA 4AP4C 3RD2A 2FCSA 3H1UA 1LQBA 3VUWA 4NQKE 5JHAA 3VFKA 5J2RA 1WGDA 2MBOA 2XEWA 3ML8A 1EF5A 4II3B 2D11A 4FADA 2WDTB 2KJ6A 2Z0DB 3P2BA 4ICVA 2D3GA 3VTUA 4I6LB 4YL8A 4GB9A 4HJKA 1UD7A 2GBRA 1GG3A 2KKCA 3H7SA 3M95A 3OLMD 4LJOB 4DHJB 3W1YA 2IO1B 3K9PB 2LZ6A 3AXCA 4K81A 3VH4B 2KC1A 2KXJA 4JIOU 3ZNGC 1WE6A 2KHWB 4FHJA 1WIAA 4DDGD 5L95C 1S3SG 3RYTA 5J18A 4WJPA 4BFRA 4BVUC 4FA6A 3KVFB 2LGYA 1E8YA 1Y8RC 2NS5A 2LD9A 2L00B 2DAJA 1WMHB 3BINA 2Y5BB 4AJWA 3VHTC 2RD0A 4XX5A 2MBHA 2CU1A 1V49A 3B08A 4IC7B 3PLVA 3ZW3A 1RRBA 4FLHA 1JRUA 2DZJA 1V80A 4ANWA 4NPNA 2JVCA 2I1KA 3DVGY 3O65B 2KMCA 4BOZB 3MHSD 2KX0A 3V61A 1WJUA 5C23A 2KFKB 3R7QA 4PS3A 5D94A 3NHEB 2WX0A 1WJNA 2Z0EB 2KTRB 2M0XA 2IO3B 3KH0A 2FAZA 2DX5B 1V5OA 1WH3A 2KANA 1WGHA 1WXAA 4B95A 1WGYA 3KUZA 1WX7A 1L7YA 1VCBA 1WMHA 4W9CA 4FULA 4HPMB 4F1SA 3CSTA 5IAAC 4NJ6A 4BKTA 2NPTB 3VQIA 4E3CA 3UQAA 4M8MA 1Q5WB 2GMIC 1OGWA 2KN5A 3N32A 1UH6A 4A3PA 2ZEQA 3H6NA 5C1ZA 3X0WA 4BBNC 4HPLB 5AZHA 2NBUA 4HVBA 2BWFA 3R3MA 4AOFA 3H7PB 4OVVA 1OQYA 3M3JA 3NOBA 3B1LX 4F7ZA 3ZKJC 3ZIMA 3WAMA 2N9PC 2PEAA 2M1MA 5TR5A 2KFKA 2G45B 3DOWA 2BPSA 3QA8A 2BYFA 2KTFA 3QX1A 3AI5A 4CHKA 3HHMA 1SE9A 4LJPB 4DHZB 2MP2B 4MGZE 2O6VD 5D7GA 2JT4B 1KM7A 2KDBA 1TBEA 1UBQA 2LI5A 4ANXA 4IM0A 3V60A 3SU8X 2NPTA 4EEWA 3U7DA 1SIFA 3VH3B 4MDKE 3UINB 4DBGA 4N9F4 3PTFC 4K7UA 2KLGA 2ZNVC 2LJ5A 2VRRB 4HCPB 4I6PA 4DWFA 2NVUI 3JSVA 4G3XB 5E6PA 3AU5A 3EFUA 4TV3A 1Q0WB 3H7PA 2DYOA 2KWVB 2MBQA 4PYZA 4EZJA 2LVPA 2JRIB 3APFA 1V6EA 4MSMB 2L05A 2LXAA 2ZNVB 2MWSB 4RMAA 2MBBB 1WYWB 4MJSB 4K1RB 2KWCA 2KK8A 5DCNA 2K6DB 4ANUA 1V5TA 2GOWA 2MBEA 2N7DA 2ZPNA 3QJZA 3A9KA 3QARA 4KSKC 3ZVVA 1XQQA 2KJHB 3PT2B 4P7IA 1C3TA 1WXMA 5AZFA 3QQ8B 2GBMA 4JL9A 4MGKE 1WJ6A 2C7NB 2AL6A 2D10A 2K1FA 2BWES 5L83A 3APDA 3ENEA 3H9DA 3N3KB 3R66C 2ZCCA 2IO2B 2BKFA 2JZ3B 4IG7B 1XD3B 3LDZE 2CHXA 3V6CB 4ICUA 4G0NB 1P1AA 3APCA 4PS7A 3V62A 4BKGA 4EZKA 1RAXA 3TJPA 3I3TB 4EOYA 4GOCA 3SDLC 5EDSA 4HXDA 2GBJA 3VUYA 2GBKA 2C5LC 4GSWA 2AYOB 1Z5SB 2JPHA 2ZZPB 2DHZA 2HJ8A 5KHQA 4GDLB 1YX6B 3PLUA 4WWPA 1CMXB 4MJSA 5D2MB 4DHJD 2WYQA 1WM2A 2EKEC 2K39A 1L2NA 1E5WA 2HD5B 2KJRA 4NAWB 1P3QU 1C1YB 1WI0A 2KO3A 3ZDMC 2EMTA 2YVCA 3VTWA 4J6IA 3PHWB 4WWNA 2Z59B 2JXXA 5G55A 3A4SC 2KVRA 1NI2A 2LASA 1WZ3A 2N9XA 4XZ4A 2N1WA 4NY0A 3R7RA 3PRZA 2V3SA 1R4MI 3GOEA 4KIKB 2BYEA 2L76A 4B6WA 3KW5B 4WJOA 5JZEB 3JVZX 2KC2A 1BT0A 2JF5A 3RT3B 3RUIB 1H8CA 1UELA 4GDLA 4MM3A 2REXA 4W9LA 2R2OA 3X23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6N B;  4M8N A;  4NAW A;  5D6J B;  3PS6 A;  1D3Z A;  2LWP A;  4W9G A;  1WRD B;  2J0M A;  3Q3J A;  1G6J A;  4GN1 A;  3DBR I;  2D07 B;  5IA7 A;  1QZE A;  2FID A;  4GXB A;  1YJ1 A;  2CS4 A;  1WXS A;  2K8H A;  3PZD A;  2OOB B;  3PSE B;  3U30 A;  1M94 A;  2B3A A;  4KSL C;  4WAA A;  2CHZ A;  4KIK A;  3L10 B;  3W1S C;  3VUX A;  3QK0 A;  4B9K A;  3DBS A;  3PGE A;  4IWQ A;  2LXC A;  3A1Q A;  4KZC A;  2KDI A;  4JQW C;  1UGM A;  1GJZ A;  4JGH B;  4DDI D;  2DEN B;  2IY0 B;  1R4N I;  3JSV B;  1GC6 A;  3L16 A;  5KHO A;  2YLM A;  3KUC B;  1X1M A;  4IWO A;  4W9F A;  3ZUN A;  4FN2 A;  3ZO5 B;  4W9I A;  3WAN A;  1RFA A;  1I42 A;  5JHB A;  2PE6 B;  2WWZ A;  3NZS A;  4ZRI A;  2ZVO A;  1WF9 A;  3K9O B;  3KYD D;  2IZV B;  5E6N A;  5LLI A;  2FCM A;  1MG8 A;  2RPQ A;  4MEL A;  4LCD E;  4W9K A;  5CHW A;  2R2Q A;  2IYD B;  3C0R B;  1EF1 A;  3A9K B;  2W9N A;  1TTN A;  3OAW A;  2FIF A;  3A9J B;  3EC8 A;  1FXT B;  1P0R A;  2KLC A;  3PV1 A;  4LDT B;  3ZNZ B;  2GBN A;  2CR5 A;  1J19 A;  5HKH A;  1KLV A;  4NNJ B;  2BYV E;  2K8B A;  2PJH A;  3PRM B;  2DZI A;  2N7E A;  3RZW C;  1IP9 A;  3DVN U;  3ZTD A;  5DPT A;  4TUU A;  2KZR A;  4A3O A;  1YD8 U;  3UGB B;  1KJT A;  2M17 A;  1V86 A;  2JRH A;  5DPR A;  4AUQ C;  2DZK A;  1ISN A;  3M63 B;  2O2V B;  3EHV A;  3HM3 A;  3TBL D;  3UIO B;  2KWU B;  1WM3 A;  3AU4 A;  3CSF A;  2OJR A;  3IHP C;  4BKS A;  3CMM B;  2PE9 A;  2HTH A;  2JZZ A;  1U4A A;  2KDE B;  2CHW A;  3U8Z A;  3N30 A;  3QHT A;  1XT9 B;  4BBN F;  1WX8 A;  3NS8 A;  4AJY B;  2QHO A;  2J7Q B;  4CYE A;  2KQ7 A;  4KVG B;  3A9J A;  2RR9 A;  1WE7 A;  2UWQ A;  2A4Z A;  2XBB C;  1ZW7 A;  3UIP B;  1YIW A;  4ASW C;  1TZ1 A;  2KDF B;  1GC7 A;  3DDC B;  3EEC A;  3HM6 X;  1WJ4 A;  1KOT A;  1YQB A;  3ONS A;  2MCN B;  3A4R A;  3DCG A;  5JH5 C;  2N4F A;  1EUV B;  2K8C A;  1WFY A;  5LXI B;  3IFW B;  2O2V A;  1HE8 A;  3QWZ B;  1P9D U;  2JWZ A;  3LJ3 A;  1AAR A;  1A5R A;  5AZG A;  1ZKH A;  1K8R B;  2LRW A;  4ZYN A;  3DBL I;  2G4S A;  1NBF C;  1V9J A;  2DZM A;  3DBH I;  1E7V A;  1WGG A;  2O6V A;  4W9E A;  1SGH A;  2L7R A;  2IY1 B;  2I1J A;  4BOS C;  1IYF A;  4KV2 A;  1WY8 A;  2DAF A;  2D2Q A;  4CO7 A;  4IW0 A;  2JUO A;  2LGD A;  4TKN A;  5CHV C;  4EUT A;  4GDK B;  4KDI C;  1GNU A;  2RGF A;  4HCN B;  4IWP A;  2L3Z A;  4FJZ A;  5AEK B;  2MW5 A;  4WWO A;  3DVN V;  1GUA B;  1LM8 B;  2C60 A;  2KFJ A;  3KUD B;  3Q3F A;  2ZJD A;  3VTV A;  1LXD A;  3ZNI D;  4ZRJ A;  3ZRF A;  3A33 B;  1OTR B;  3JW0 X;  3RUL A;  2AL3 A;  1OEY A;  4GU2 A;  4HDQ A;  1UBI A;  4E74 A;  1WR6 E;  2IBI B;  3A1Q B;  4W9H A;  4WQO B;  4A20 A;  2J0K A;  3L13 A;  4RM9 A;  4DHZ E;  4ZRK A;  4OVU A;  3WAO A;  3IG3 A;  3M62 B;  3HIZ A;  4KDL B;  3ZLZ A;  1V2Y A;  2ZPY A;  2G3Q B;  3RZF A;  3MTN B;  4KZ0 A;  3WIM A;  2UYZ B;  3D32 A;  2ZCB A;  3PPA A;  4GIV A;  3AUL A;  5E6O A;  3TL5 A;  2A5U A;  1Q1O A;  4MGI E;  1YX5 B;  1VD2 A;  3ALB A;  4MH0 E;  2L0F A;  4GDK A;  1E8X A;  1NDD A;  3VDZ A;  1WR1 A;  2KQS A;  3SD5 A;  1E7U A;  2C7H A;  2IO0 B;  1WXV A;  4G11 A;  3ZNH B;  3VXW A;  5DPW A;  4MGY E;  3ECI A;  5GMV A;  1ZGU B;  3UQB A;  2LRU A;  4GGQ A;  1E8W A;  3PHX B;  3L54 A;  4TQ1 A;  1E90 A;  1P98 A;  3ZDT A;  2AWT A;  2C7M B;  5CX3 A;  2M4N A;  2DYM A;  2FUH B;  4TQ0 A;  1Z2M A;  3OJ4 B;  4FJY A;  2V1Y A;  4W9J A;  3T8M A;  5J17 A;  4JLC A;  2K6Q A;  3NZU A;  1J0G A;  4FHK A;  4BKS D;  3ZRC A;  2DYB A;  3DQV A;  4URK A;  4IM3 A;  5G2N A;  2RSU A;  3WAL A;  3T9L A;  3CF6 E;  5DPS A;  4EZL A;  1E8Z A;  3B0A A;  2BKR B;  4E71 A;  4LDT D;  2FNJ B;  4K7S A;  1T0Y A;  4FJV B;  2V4L A;  3TCA A;  2L8J A;  1EO6 A;  4DXA B;  3PVL A;  1UZX B;  4W9D A;  4RM8 A;  3VAW A;  4HK2 A;  5FR6 A;  2FCQ A;  3V6E B;  1WX9 A;  2LVO A;  1OEY J;  3QC8 B;  4NQL B;  3DVG X;  3IBE A;  3IVF A;  4XC2 A;  2LVQ A;  2K25 A;  4AWJ A;  4EKU A;  2AEH A;  2MA9 B;  5CTR C;  2FCN A;  2EMS A;  4NJ7 A;  2NBV B;  2G4D B;  3KYC D;  3WAP A;  3TMP B;  1WZ0 A;  1WGR A;  2KOX A;  4GMV A;  2PPH A;  5BO4 B;  2LUE A;  2C9W B;  3W1S A;  1LFD A;  2MX2 A;  3PRP B;  2MSE D;  2NCN A;  3SHQ A;  3L08 A;  1F9J A;  1H4R A;  2KTR A;  3HK0 A;  3WA0 A;  3GZN I;  4WJQ A;  1RLF A;  2XK5 B;  4MSQ B;  2ASQ A;  4FBJ B;  2L0T A;  1TGZ B;  5LXH A;  2N1V A;  1I35 A;  2MLB A;  4II2 B;  2O6V B;  3QCA A;  1PQS A;  4DK5 A;  2ZVN A;  2LGX A;  1V81 A;  5CHF A;  4X57 B;  2NR2 A;  3BY4 B;  3QAQ A;  3DPD A;  2CKH B;  2MRP A;  3RCZ A;  3TIX A;  2M8S A;  2WX1 A;  4EFO A;  4ZDV A;  3ZTC A;  4F8C B;  4K7W A;  4ANV A;  1S1Q B;  3NY5 A;  4M0W B;  3PRE A;  4HLE A;  3QIJ A;  3UF8 A;  4G50 A;  4WJN A;  4IUM B;  1J8C A;  3S2A A;  2BGF A;  2KNB A;  2KD0 A;  3ML9 A;  3L17 A;  4IM2 A;  2BF8 B;  2HE7 A;  2XK5 A;  3L0W B;  2JY6 A;  2MP2 A;  3JYU A;  2N9E B;  4PYU A;  3VVW B;  4HWI B;  1IPG A;  4MEM A;  3OJ3 A;  2J0J A;  2NBW B;  2KX3 A;  4HDO A;  2MQJ A;  4PS8 A;  3MJW A;  2KMA A;  4AP4 C;  3RD2 A;  2FCS A;  3H1U A;  1LQB A;  3VUW A;  4NQK E;  5JHA A;  3VFK A;  5J2R A;  1WGD A;  2MBO A;  2XEW A;  3ML8 A;  1EF5 A;  4II3 B;  2D11 A;  4FAD A;  2WDT B;  2KJ6 A;  2Z0D B;  3P2B A;  4ICV A;  2D3G A;  3VTU A;  4I6L B;  4YL8 A;  4GB9 A;  4HJK A;  1UD7 A;  2GBR A;  1GG3 A;  2KKC A;  3H7S A;  3M95 A;  3OLM D;  4LJO B;  4DHJ B;  3W1Y A;  2IO1 B;  3K9P B;  2LZ6 A;  3AXC A;  4K81 A;  3VH4 B;  2KC1 A;  2KXJ A;  4JIO U;  3ZNG C;  1WE6 A;  2KHW B;  4FHJ A;  1WIA A;  4DDG D;  5L95 C;  1S3S G;  3RYT A;  5J18 A;  4WJP A;  4BFR A;  4BVU C;  4FA6 A;  3KVF B;  2LGY A;  1E8Y A;  1Y8R C;  2NS5 A;  2LD9 A;  2L00 B;  2DAJ A;  1WMH B;  3BIN A;  2Y5B B;  4AJW A;  3VHT C;  2RD0 A;  4XX5 A;  2MBH A;  2CU1 A;  1V49 A;  3B08 A;  4IC7 B;  3PLV A;  3ZW3 A;  1RRB A;  4FLH A;  1JRU A;  2DZJ A;  1V80 A;  4ANW A;  4NPN A;  2JVC A;  2I1K A;  3DVG Y;  3O65 B;  2KMC A;  4BOZ B;  3MHS D;  2KX0 A;  3V61 A;  1WJU A;  5C23 A;  2KFK B;  3R7Q A;  4PS3 A;  5D94 A;  3NHE B;  2WX0 A;  1WJN A;  2Z0E B;  2KTR B;  2M0X A;  2IO3 B;  3KH0 A;  2FAZ A;  2DX5 B;  1V5O A;  1WH3 A;  2KAN A;  1WGH A;  1WXA A;  4B95 A;  1WGY A;  3KUZ A;  1WX7 A;  1L7Y A;  1VCB A;  1WMH A;  4W9C A;  4FUL A;  4HPM B;  4F1S A;  3CST A;  5IAA C;  4NJ6 A;  4BKT A;  2NPT B;  3VQI A;  4E3C A;  3UQA A;  4M8M A;  1Q5W B;  2GMI C;  1OGW A;  2KN5 A;  3N32 A;  1UH6 A;  4A3P A;  2ZEQ A;  3H6N A;  5C1Z A;  3X0W A;  4BBN C;  4HPL B;  5AZH A;  2NBU A;  4HVB A;  2BWF A;  3R3M A;  4AOF A;  3H7P B;  4OVV A;  1OQY A;  3M3J A;  3NOB A;  3B1L X;  4F7Z A;  3ZKJ C;  3ZIM A;  3WAM A;  2N9P C;  2PEA A;  2M1M A;  5TR5 A;  2KFK A;  2G45 B;  3DOW A;  2BPS A;  3QA8 A;  2BYF A;  2KTF A;  3QX1 A;  3AI5 A;  4CHK A;  3HHM A;  1SE9 A;  4LJP B;  4DHZ B;  2MP2 B;  4MGZ E;  2O6V D;  5D7G A;  2JT4 B;  1KM7 A;  2KDB A;  1TBE A;  1UBQ A;  2LI5 A;  4ANX A;  4IM0 A;  3V60 A;  3SU8 X;  2NPT A;  4EEW A;  3U7D A;  1SIF A;  3VH3 B;  4MDK E;  3UIN B;  4DBG A;  4N9F 4;  3PTF C;  4K7U A;  2KLG A;  2ZNV C;  2LJ5 A;  2VRR B;  4HCP B;  4I6P A;  4DWF A;  2NVU I;  3JSV A;  4G3X B;  5E6P A;  3AU5 A;  3EFU A;  4TV3 A;  1Q0W B;  3H7P A;  2DYO A;  2KWV B;  2MBQ A;  4PYZ A;  4EZJ A;  2LVP A;  2JRI B;  3APF A;  1V6E A;  4MSM B;  2L05 A;  2LXA A;  2ZNV B;  2MWS B;  4RMA A;  2MBB B;  1WYW B;  4MJS B;  4K1R B;  2KWC A;  2KK8 A;  5DCN A;  2K6D B;  4ANU A;  1V5T A;  2GOW A;  2MBE A;  2N7D A;  2ZPN A;  3QJZ A;  3A9K A;  3QAR A;  4KSK C;  3ZVV A;  1XQQ A;  2KJH B;  3PT2 B;  4P7I A;  1C3T A;  1WXM A;  5AZF A;  3QQ8 B;  2GBM A;  4JL9 A;  4MGK E;  1WJ6 A;  2C7N B;  2AL6 A;  2D10 A;  2K1F A;  2BWE S;  5L83 A;  3APD A;  3ENE A;  3H9D A;  3N3K B;  3R66 C;  2ZCC A;  2IO2 B;  2BKF A;  2JZ3 B;  4IG7 B;  1XD3 B;  3LDZ E;  2CHX A;  3V6C B;  4ICU A;  4G0N B;  1P1A A;  3APC A;  4PS7 A;  3V62 A;  4BKG A;  4EZK A;  1RAX A;  3TJP A;  3I3T B;  4EOY A;  4GOC A;  3SDL C;  5EDS A;  4HXD A;  2GBJ A;  3VUY A;  2GBK A;  2C5L C;  4GSW A;  2AYO B;  1Z5S B;  2JPH A;  2ZZP B;  2DHZ A;  2HJ8 A;  5KHQ A;  4GDL B;  1YX6 B;  3PLU A;  4WWP A;  1CMX B;  4MJS A;  5D2M B;  4DHJ D;  2WYQ A;  1WM2 A;  2EKE C;  2K39 A;  1L2N A;  1E5W A;  2HD5 B;  2KJR A;  4NAW B;  1P3Q U;  1C1Y B;  1WI0 A;  2KO3 A;  3ZDM C;  2EMT A;  2YVC A;  3VTW A;  4J6I A;  3PHW B;  4WWN A;  2Z59 B;  2JXX A;  5G55 A;  3A4S C;  2KVR A;  1NI2 A;  2LAS A;  1WZ3 A;  2N9X A;  4XZ4 A;  2N1W A;  4NY0 A;  3R7R A;  3PRZ A;  2V3S A;  1R4M I;  3GOE A;  4KIK B;  2BYE A;  2L76 A;  4B6W A;  3KW5 B;  4WJO A;  5JZE B;  3JVZ X;  2KC2 A;  1BT0 A;  2JF5 A;  3RT3 B;  3RUI B;  1H8C A;  1UEL A;  4GDL A;  4MM3 A;  2REX A;  4W9L A;  2R2O A;  3X23 A; 
#chains in the Genus database with same CATH topology
 2KVZ A;  2WXF A;  2J0M A;  2BS4 B;  2Q5W D;  3Q3M C;  1C76 A;  3DBR I;  2MJD A;  4MT5 A;  4GXB A;  1JWM D;  2CS4 A;  4RF0 A;  1I4H A;  2K3U A;  1F2R C;  3U4E G;  2CHZ A;  4KIK A;  5G5G A;  1FMA D;  1PGX A;  3DBS A;  2LXC A;  4KZC A;  1L4D B;  1GJZ A;  1C9F A;  1JRP A;  1GC6 A;  3L16 A;  5KHO A;  3KUC B;  4W9F A;  3ZUN A;  4W9I A;  2NTT A;  1T6B X;  2LMC A;  1C4C A;  4DQO C;  4H2A A;  4ZRI A;  5E6N A;  2WXO A;  1MG8 A;  4LCD E;  1WYG A;  2FIF A;  3A9J B;  2GRI A;  1AW7 A;  1ZUD 2;  3AE6 B;  1FEH A;  1IGD A;  1OQR A;  3PRM B;  3DVN U;  5AUI A;  2G1E A;  2MHJ A;  4RGM A;  1XCT L;  2LEK A;  4R3D A;  2CJN A;  3HM3 A;  3TBL D;  1ROE A;  2KWU B;  5FK9 C;  4RNA A;  3IHP C;  1C77 A;  4BKS A;  3CMM B;  2JX5 A;  1N61 A;  2WXH A;  3N30 A;  2WS3 B;  1WX8 A;  2J7Q B;  3AE7 B;  3HRD D;  1YJI A;  4LTU A;  1SE3 A;  3EEC A;  3HM6 X;  1UGJ A;  1WJ4 A;  1KOT A;  2MCN B;  2V3P A;  2N4F A;  1EUV B;  1T0Q C;  2K8C A;  1D5Z C;  2PIA A;  5BMI A;  4IKG A;  1K8R B;  2J4X A;  1I4P A;  2LRW A;  1NBF C;  4P16 A;  2DZM A;  2JU6 X;  1WGG A;  1HZ6 A;  2V4I B;  2I1J A;  2DAF A;  2LGD A;  5CHV C;  1GNU A;  1Q10 A;  2INP E;  2JYT A;  1R7S A;  1TZO A;  3DVN V;  1GUA B;  2C60 A;  2KFJ A;  3KUD B;  3VTV A;  2ZJD A;  3C8Y A;  1J7A A;  1BUI C;  3A33 B;  1OTR B;  2AL3 A;  4US9 A;  1OQQ A;  4ARI A;  3A1Q B;  1YOV B;  2J0K A;  1R4N B;  4ZRK A;  3WAO A;  1KF6 B;  3HIZ A;  1V2Y A;  2HJ1 A;  2G3Q B;  3RZF A;  3WIM A;  5E6O A;  1T0S C;  1Q1O A;  1YX5 B;  1VD2 A;  4GDK A;  3BK1 A;  5HFY A;  2L1A A;  2IO0 B;  1PUT A;  4G11 A;  3VXW A;  3UQB A;  4NZL B;  5G5H A;  4GGQ A;  1E8W A;  3AEC B;  3PHX B;  4TQ1 A;  2AWT A;  2C7M B;  2I38 A;  4QAY A;  3TEX A;  1ZP0 B;  1V1O A;  4BKS D;  2GI9 A;  3ZRC A;  5G2N A;  3AMZ A;  3GZN B;  3CF6 E;  5DPS A;  4EZL A;  1E8Z A;  3Q3O C;  3AN1 A;  4K3B A;  1TY2 A;  4OZC A;  4DXA B;  1EO6 A;  2RDG A;  4OHJ A;  4W9D A;  2FCQ A;  3V6E B;  1WX9 A;  2LVO A;  3QC8 B;  4NQL B;  3DVG X;  2LVQ A;  4AWJ A;  3TEW A;  1XO3 A;  3BVM A;  2WU5 B;  3GP7 A;  3TMP B;  1WZ0 A;  2C9W B;  4JX1 C;  2K5P A;  1WSP A;  3HK0 A;  3DWG C;  3DBL B;  4WJQ A;  1RLF A;  1DOX A;  4MSQ B;  2ASQ A;  4FBJ B;  1T5X D;  1TGZ B;  2N1V A;  5HHD G;  1I35 A;  1AWD A;  4II2 B;  2O6V B;  3URY A;  3QCA A;  1PQS A;  4KKI A;  2IDY A;  1YN4 A;  5CHF A;  4X57 B;  4HPP A;  4A9A A;  3QAQ A;  1KRH A;  3TIX A;  4ZDV A;  3Q8E A;  1MHH E;  3PRE A;  4HLE A;  2W3R A;  3UF8 A;  4G50 A;  2XNA C;  4IUM B;  1K50 A;  2BGF A;  4PK1 A;  2KD0 A;  1FFV A;  3ML9 A;  2XK5 A;  3JYU A;  2N9E B;  1IPG A;  4OW0 A;  4MEM A;  2KX3 A;  1XLO A;  3MJW A;  4AP4 C;  1LQB A;  5EE0 A;  3AV8 A;  2IND C;  5J2R A;  1YQ4 B;  3NG0 A;  1EF5 A;  1JWB D;  2VZK D;  2WDT B;  2KJ6 A;  4AQ7 A;  3RN9 C;  3AE3 B;  4YSZ B;  4M0W A;  1N63 A;  4HJK A;  1GG3 A;  4DHJ B;  1PYW D;  3OLM D;  4RGO S;  2X38 A;  3K9P B;  3V05 A;  3AXC A;  3AM9 A;  2KC1 A;  1IBX B;  3ZNG C;  1WE6 A;  2KHW B;  1QOB A;  5L95 C;  3FAH A;  1V8C A;  4WJP A;  4BVU C;  4FA6 A;  2LGY A;  3ZJT A;  1Y8R C;  2RPV A;  2DAJ A;  2QDF A;  4AJW A;  1N5X A;  3NRZ A;  2RD0 A;  3AE1 B;  2QC8 A;  3P4S B;  1PGA A;  1L0X B;  1JRU A;  5H92 C;  2DZJ A;  4NPN A;  2I1K A;  2KMC A;  4BOZ B;  3MHS D;  2KX0 A;  1CJE A;  3R7Q A;  1WJN A;  2Z0E B;  2KTR B;  2M0X A;  1WH3 A;  1V97 A;  4MAC A;  4HPM B;  2LGI A;  4LNO A;  3CST A;  5IAA C;  3T3N A;  3ETR A;  2ZW1 A;  1Q5W B;  3MP9 A;  3N32 A;  2KN5 A;  4A3P A;  3H6N A;  1TS4 A;  2LJI A;  2NBU A;  2BWF A;  4ZHO A;  3EGR A;  2W3S A;  1XXG A;  3M3J A;  1MHX A;  2JXT A;  1XLP A;  1EU4 A;  2PEA A;  5TR5 A;  1MI0 A;  4C80 A;  3AI5 A;  3HHM A;  2MP2 B;  2JT4 B;  1KM7 A;  4ANX A;  4IM0 A;  2WXL A;  3V60 A;  1SF0 A;  4HEA 1;  1EWC A;  4YTN B;  3U7D A;  1SIF A;  2KDM A;  1BXT A;  4I6P A;  1VR9 A;  4G3X B;  1HA5 A;  2UU7 A;  3P1M A;  2LUM A;  3P4R B;  4S0R A;  1JAL A;  2LVP A;  4RMA A;  1WYW B;  5DCN A;  2KWC A;  5D3D A;  4URK A;  3ZXV A;  3QAR A;  3ZVV A;  2KJH B;  4P7I A;  1C3T A;  4LNN A;  2WDQ B;  2ZCC A;  3ZQ4 A;  2IO2 B;  2BKF A;  2JZ3 B;  1TY0 A;  3V6C B;  4N59 A;  4ICU A;  1I4G A;  4PS7 A;  1RAX A;  4GOC A;  3RFZ B;  3VUY A;  4GSW A;  2AYO B;  4D2K A;  3NJT A;  3RPF C;  3Q69 A;  4MM3 B;  4WWP A;  4C4V A;  4WWM A;  1CQV A;  4LNF A;  3HVZ A;  3ZXR A;  4YTM B;  2KO3 A;  3VTW A;  2AQ2 B;  3PHW B;  2Z59 B;  3A4S C;  1F52 A;  3AEB B;  2N9X A;  1DOY A;  5TSS A;  3R7R A;  4KIK B;  2L76 A;  4WJO A;  4JE3 B;  2KC2 A;  1BT0 A;  5FR3 A;  3RUI B;  3FKY A;  1K53 A;  1CZP A;  3LB8 C;  4P6V F;  3R2I A;  2OED A;  1D3Z A;  2WXJ A;  4W9G A;  2D07 B;  2FID A;  1WXS A;  1M4V A;  3PSE B;  3U30 A;  1TKE A;  2W54 A;  3W1S C;  4B9K A;  3PGE A;  2KDI A;  2IY0 B;  3B2G A;  1SE4 A;  2YLM A;  3AE5 B;  4IWO A;  1TYG B;  5E6J A;  4FN2 A;  3ZO5 B;  3I5J C;  3K9O B;  3KYD D;  5C3J B;  1VLB A;  4W9K A;  5CHW A;  2R2Q A;  1NYR A;  2V0G A;  3OAW A;  3PV1 A;  2KLC A;  1J19 A;  1IGC A;  2BYV E;  2K8B A;  5HG2 A;  1F0Z A;  3ZTD A;  2J52 A;  4XWT A;  1V86 A;  2INN E;  1F2R I;  3M63 B;  1STE A;  3P42 A;  3CSF A;  4LK0 M;  3OWE B;  1UWX A;  4L2Y A;  2PE9 A;  2HTH A;  2JZZ A;  1U4A A;  3W9C B;  2CHW A;  3U8Z A;  3QHT A;  1JML A;  1XT9 B;  4BZA A;  3NVY A;  2M56 B;  1RFK A;  5BYQ A;  4CYE A;  5IKC M;  2KQ7 A;  2MEK A;  2V9H A;  1FXA A;  2RMM A;  1ZW7 A;  3UIP B;  1SB3 C;  3DDC B;  2D5G A;  1YQB A;  1TIF A;  5JH5 C;  3KLS X;  4DXG A;  3V3X A;  2WGS A;  5LXI B;  1E0Z A;  1P9D U;  1F77 A;  1L0Y B;  1I4R A;  1ZKH A;  4ZYN A;  5BMH A;  2G4S A;  2KT7 A;  2ZW0 A;  4REZ A;  1IUE A;  1E7V A;  3BVZ A;  2L7R A;  2WP9 B;  1IYF A;  4KV2 A;  1WY8 A;  2JUO A;  4EUT A;  2I2Y A;  4GDK B;  4KDI C;  1F1H A;  4IWP A;  4FJZ A;  5AEK B;  2WQY B;  4WIP A;  2N9K A;  1LXD A;  3TEZ A;  3LYY A;  3HVD A;  3JW0 X;  5AUK A;  1D5X C;  4E74 A;  4GU2 A;  4HDQ A;  2IBI B;  2YEP B;  4HKQ A;  1E9M A;  4RM9 A;  4KDL B;  1SE2 A;  2ZPY A;  4KZ0 A;  2UYZ B;  4GIV A;  3D32 A;  3AUL A;  3E56 A;  3TL5 A;  4MH0 E;  3ZGZ A;  4YTP B;  3VDZ A;  2KQS A;  5HI1 A;  4L1B A;  1WXV A;  3ZNH B;  5DPW A;  3L54 A;  3RNC C;  1P98 A;  2YEP F;  3ZDT A;  2DYM A;  1QKZ A;  1Z2M A;  4FJY A;  2V1Y A;  1J0G A;  2K6Q A;  1FCL A;  3VRA B;  4IM3 A;  2RSU A;  3WAL A;  3T9L A;  2W82 A;  4E71 A;  3AEF B;  2ICI A;  2L8J A;  3DHG C;  4HK2 A;  1ZDV A;  1JQ4 A;  5LNK 1;  2AEH A;  2MA9 B;  5CTR C;  2BTE A;  3WAP A;  1FO4 A;  4OZB A;  2MSE D;  3L08 A;  1H4R A;  3AEE B;  2XK5 B;  5IOI A;  3DBH B;  2MLB A;  1N60 A;  2ZVN A;  2CJO A;  3DPD A;  2MRP A;  2WX1 A;  2KYW A;  1YN3 A;  4F8C B;  4K7W A;  4RH6 A;  1HEZ E;  1S1Q B;  2MJ3 A;  4M0W B;  3QIJ A;  1RYJ A;  3T3O A;  4PYU A;  4HWI B;  2FBW B;  1D4B A;  3OJ3 A;  4HDO A;  4RFB A;  4M02 A;  2KMA A;  1FRR A;  1MPE A;  3VUW A;  2MBO A;  4XWW A;  4FAD A;  2WXP A;  3LXF A;  3VR9 B;  4GB9 A;  2GBR A;  3M95 A;  2IO1 B;  3AH7 A;  4JIO U;  4XDD A;  2PKO A;  4DXF A;  4O1N A;  3ZJV A;  1S3S G;  2W55 A;  4AS1 A;  3KVF B;  1E8Y A;  1QT9 A;  2NS5 A;  2LD9 A;  3GS2 A;  4WQM A;  3VHT C;  3OG5 A;  3NUH B;  2CU1 A;  1B9R A;  2JQR B;  5JXV A;  1T3Q A;  4FLH A;  3N20 C;  4ANW A;  4YWG G;  1L4Z B;  3EUB 2;  4J3O D;  2WXK A;  4B95 A;  1VCB A;  1WMH A;  3FIL A;  3L4P A;  2PMV A;  4NJ6 A;  4E3C A;  3UQA A;  3SR6 A;  1OGW A;  4HJG E;  2INC C;  3IT6 B;  3GE8 C;  5AZH A;  4HVB A;  4AOF A;  4OVV A;  3NOB A;  3N1Z C;  3ZKJ C;  2WNM A;  3WAM A;  2M1M A;  2KFK A;  2J53 A;  2BPS A;  1QOF A;  2BYF A;  2KTF A;  4RGT A;  4LJP B;  2JYE A;  5D7G A;  1ET6 A;  1UUP A;  2KDB A;  1N5W A;  2LI5 A;  3SU8 X;  2NPT A;  3VH3 B;  1V1P A;  4MDK E;  3AEA B;  3UIN B;  2KLG A;  1K52 A;  1ENF A;  2ZNV C;  3EFU A;  1L0V B;  2D3A A;  4JPS A;  4PYZ A;  4C7Z A;  4N6E B;  2L05 A;  1HXY D;  2MBB B;  2K6D B;  5EE9 A;  1VZ6 A;  2GOW A;  2MBE A;  4KSK C;  1XQQ A;  1FNV A;  2GBM A;  4MGK E;  2C7N B;  5L83 A;  3APD A;  3N3K B;  1YNT E;  1QOG A;  4KGT A;  4CQN A;  2CHX A;  2L83 A;  1FIQ A;  4G0N B;  1P1A A;  4EZK A;  3I3T B;  3SDL C;  3Q8C A;  4HXD A;  3Q3N C;  2C5L C;  4ACF A;  3DHH C;  3PLU A;  2WYQ A;  1WM2 A;  2K39 A;  1DGJ A;  2KAC A;  2KJR A;  1P3Q U;  3ZDM C;  2EMT A;  2DWQ A;  2YVC A;  4J6I A;  1C4P A;  2LGS A;  5G55 A;  1NI2 A;  1E10 A;  2AQ1 B;  2IGG A;  4JWU C;  2KN4 A;  4B6W A;  5JZE B;  3HUI A;  2JF5 A;  1H8C A;  2PLP A;  4GDL A;  3Q14 C;  3NVV A;  2Y5P A;  4M8N A;  4NAW A;  5D6J B;  3FC4 A;  1C4A A;  3PS6 A;  4KGR A;  1WRD B;  3Q3J A;  1SJE D;  1KFY B;  4GN1 A;  1FM0 D;  1QZE A;  2K8H A;  4P1B C;  2AX5 A;  1M94 A;  4KSL C;  3C19 A;  3VUX A;  3QK0 A;  3SEB A;  3A1Q A;  2GB1 A;  4JQW C;  2KAJ A;  2WXR A;  1C78 A;  1R4N I;  1ZDX A;  3JSV B;  4IDI A;  3WAN A;  1PFD A;  5JHB A;  3GE3 C;  5LLI A;  1WF9 A;  2IZV B;  3O13 A;  2OHF A;  2FCM A;  2RPQ A;  2G9H D;  3C0R B;  3A9K B;  2W9N A;  1SJH D;  1FXT B;  1P0R A;  3ZNZ B;  2D3C A;  4NNJ B;  3RZW C;  1IP9 A;  1HQR D;  5DPT A;  4A6Q A;  1ZOY B;  2LFI A;  1KJT A;  5DPR A;  4AUQ C;  2DZK A;  4TSS A;  1ISN A;  1QQR A;  3EHV A;  3P63 A;  3TEY A;  3UIO B;  1J7B A;  2OJR A;  4ZRP A;  2KDE B;  2PW9 A;  4KVG B;  2RR9 A;  2A4Z A;  3KWL A;  1HTQ A;  4XYC A;  4ASW C;  2KDF B;  4TMA B;  1ESF A;  1CK1 A;  1R4M B;  1QIL A;  5I4D A;  1WFY A;  3IFW B;  2O2V A;  1HE8 A;  1AAR A;  1A5R A;  4FXC A;  3DBL I;  2BS3 B;  3ABV B;  1D5M C;  1ZXI A;  2DLB A;  2O6V A;  4ZRQ A;  4BOS C;  3DBR B;  2D2Q A;  4TKN A;  2RGF A;  1NYQ A;  2D3B A;  2MW5 A;  2J42 A;  2H88 B;  3Q3F A;  2DBY A;  3N9Y C;  1YN5 A;  4XDC A;  4W9H A;  4WQO B;  2L52 A;  4A20 A;  2WU2 B;  3L13 A;  4DHZ E;  4OVU A;  3IG3 A;  3M62 B;  1P7F A;  3PPA A;  1TJE A;  2A5U A;  4MGI E;  3ALB A;  1WR1 A;  3RNA C;  2QIE B;  4GLS C;  1FD6 A;  1UNS A;  3MC9 A;  3NS1 A;  2VH2 A;  2M4N A;  2FUH B;  1FXI A;  5BMG A;  4TQ0 A;  3T8M A;  4FHK A;  2DYB A;  2WXG A;  4S17 A;  2BQQ A;  3RNB C;  2BKR B;  4LDT D;  2FNJ B;  3TCA A;  4B0M A;  3PVL A;  1QF6 A;  3R2T A;  5FR6 A;  3PZ7 A;  4ZOH C;  2B76 B;  4YSX B;  3IVF A;  4XC2 A;  2EMS A;  4NJ7 A;  2NBV B;  2G4D B;  2BW2 A;  2BB6 A;  4UDU C;  2LUE A;  5H8Y E;  2FUG 1;  1LFD A;  1YJJ A;  2NCN A;  2K0P A;  3SHQ A;  3RI7 C;  2R61 A;  2KTR A;  3WA0 A;  5LXH A;  1TKG A;  2K9X A;  2H89 B;  2LGX A;  3Q8B A;  1FCC C;  2JZP A;  4WUR A;  3TSS A;  2M8S A;  5C2T B;  3ZTC A;  2N0S B;  1SEB D;  4ANV A;  3NY5 A;  3MJ5 A;  2GLS A;  2KNB A;  3L17 A;  1MFW A;  2MP2 A;  2BYT A;  3AEG B;  1VJK A;  2NBW B;  3KQ4 A;  2E3T A;  2MQJ A;  1FNW A;  4PS8 A;  4RGN A;  3RD2 A;  3J9C A;  2WDR B;  5JHA A;  1WGD A;  1XLQ A;  2XEW A;  3ML8 A;  1ZE3 D;  4II3 B;  2D11 A;  2Z0D B;  3P2B A;  1NI3 A;  1UD7 A;  4LJO B;  3VH4 B;  4MH8 A;  2JSV X;  1MJD A;  4K3C A;  1XCQ L;  4ARC A;  2MH7 A;  2QIL A;  1MVK A;  1E6E B;  1WIA A;  4FHJ A;  1YQ3 B;  1EU3 A;  3RYT A;  1NEN B;  4BFR A;  2IGH A;  1WMH B;  2Y5B B;  3FIL B;  2MBH A;  3I57 A;  5IN7 A;  3GB1 A;  4IC7 B;  1V80 A;  3PO0 A;  1KTK A;  3IT4 B;  3AB5 A;  3MFG A;  3V61 A;  4YXD B;  1WJU A;  2KFK B;  1GOZ A;  2IO3 B;  1SIJ A;  2FAZ A;  3TUO A;  1NVI D;  2DX5 B;  1V5O A;  2KAN A;  3VR8 B;  1WGH A;  2HDE A;  1ACC A;  3RNG C;  3KUZ A;  1WX7 A;  1L7Y A;  3PZ8 A;  4W9C A;  4F1S A;  4BKT A;  2NPT B;  2IGD A;  1V1P B;  1UH6 A;  4OZA A;  1SSN A;  3R3M A;  1GB4 A;  1P7E A;  4YSY B;  1GPX A;  1OQY A;  3AE2 B;  3B1L X;  4F7Z A;  3Q6B A;  3ZIM A;  1TT5 B;  2G45 B;  3DOW A;  3QA8 A;  1SE9 A;  4DHZ B;  4MGZ E;  1WWT A;  2EEL A;  1TBE A;  3I63 C;  4EEW A;  2Z8L A;  4US8 A;  4XGA B;  4K7U A;  1JWS D;  2VRR B;  4DWF A;  2NVU I;  3AU5 A;  4TV3 A;  1FPY A;  1EWY C;  1Q0W B;  3H7P A;  2MBQ A;  3APF A;  2LXA A;  2MWS B;  2N7D A;  2ZPN A;  5AZF A;  2RDH A;  3QQ8 B;  4Q2J A;  2K1F A;  2WLB A;  2BWE S;  3H9D A;  3ENE A;  3R66 C;  3LDZ E;  3VRB B;  4BKG A;  3APC A;  3V62 A;  4EOY A;  1NEK B;  2JPH A;  2ZZP B;  1RWS A;  1JWA D;  1A70 A;  3SFE B;  4GDL B;  1GB1 A;  1DOI A;  1YX6 B;  5D2M B;  1CMX B;  4MJS A;  1YMH E;  2HD5 B;  1TKY A;  4NAW B;  5BYR A;  2WHI A;  1SXT A;  2TSS A;  1MG4 A;  2WXN A;  4WWN A;  2BS2 B;  2JXX A;  2KVR A;  3BK2 A;  3SFD B;  1WZ3 A;  4XZ4 A;  2N1W A;  4NY0 A;  2PTL A;  3MHZ A;  3DHI C;  2V3S A;  3GOE A;  1FNU A;  3KW5 B;  1UEL A;  2X8X X;  4M01 A;  1XLN A;  4W9L A;  2R2O A;  3X23 A;  4USA A;  4I6N B;  4EE2 A;  4KGS A;  2LWP A;  1XEE A;  1G6J A;  1JWU D;  5IA7 A;  2BB5 A;  4ZYS A;  3AED B;  5MPO A;  1YJ1 A;  3PZD A;  2OOB B;  2B3A A;  4WAA A;  1D6E C;  1I4Q A;  3L10 B;  1PGB A;  4HRS A;  4IWQ A;  2NTS A;  4ITK A;  2IPK D;  1UGM A;  4JGH B;  3WCQ A;  4DDI D;  2DEN B;  2N7J A;  1X1M A;  4A8X C;  1RFA A;  1Y56 A;  2QCZ A;  1I42 A;  2PE6 B;  2WWZ A;  3NZS A;  2ZVO A;  1T0R C;  1BML C;  4MEL A;  2IYD B;  1EF1 A;  3Q8A A;  1TTN A;  3MC0 B;  3EC8 A;  4LDT B;  3ZJU A;  2GBN A;  2CR5 A;  5HKH A;  1N6Z A;  1I4X A;  1RM6 C;  2PJH A;  2PVO D;  1KLV A;  4RCO A;  2DZI A;  2N7E A;  2L32 A;  1C79 A;  3NVW A;  4PT5 A;  2BT6 A;  4TUU A;  2KZR A;  4A3O A;  1YD8 U;  3UGB B;  2M17 A;  2JRH A;  2SEB D;  1HTO A;  4L23 A;  2O2V B;  3I9V 1;  3AU4 A;  1WM3 A;  2XN9 C;  1TS5 A;  4YT0 B;  2AQ3 B;  2BVC A;  4JWS C;  1GAQ B;  4C4V B;  4BBN F;  3NS8 A;  3P4Q B;  3EFC A;  2QHO A;  4AJY B;  3A9J A;  1DYQ A;  5GXG B;  3W2D A;  1WE7 A;  2UWQ A;  1WXQ A;  3KWV A;  2VH1 A;  2XBB C;  1YIW A;  5IO9 A;  1TZ1 A;  1GC7 A;  2RDB C;  5EE3 A;  3ONS A;  3A4R A;  3DCG A;  2N9L A;  3P4P B;  1QLB B;  3QWZ B;  2JWZ A;  3LJ3 A;  5AZG A;  3AE9 B;  1V9J A;  3DBH I;  4W9E A;  1SGH A;  2IY1 B;  2WXM A;  5BYS A;  2DNF A;  3DWM A;  4CO7 A;  4IW0 A;  4LLG M;  3BZD B;  3RNF C;  4HCN B;  2L3Z A;  1VDV A;  4WWO A;  1LM8 B;  1LO5 D;  5T8I A;  3ZNI D;  4ZRJ A;  3ZRF A;  3RUL A;  1I7H A;  1OEY A;  1UBI A;  1WR6 E;  4C56 C;  3ZLZ A;  2LHD A;  3MC8 A;  3MTN B;  1J7C A;  2ZCB A;  2CU3 A;  2WDV B;  1KLU D;  2L0F A;  1E8X A;  1NDD A;  1L6V A;  4NAM A;  3SD5 A;  4A55 A;  1E7U A;  2C7H A;  4A90 A;  4MGY E;  3ECI A;  5GMV A;  1ZGU B;  2LRU A;  1E90 A;  5CX3 A;  3OJ4 B;  4W9J A;  5J17 A;  4JLC A;  3NZU A;  4N58 A;  3DQV A;  2QMT A;  3B0A A;  2PVG C;  4K7S A;  1T0Y A;  4FJV B;  3U52 E;  2V4L A;  2OJW A;  1UZX B;  4RM8 A;  3VAW A;  1OEY J;  1JCK B;  1VZ7 A;  3IBE A;  2E6X A;  3B9J A;  2K25 A;  4EKU A;  2M0A A;  2FCN A;  3NVZ A;  3KYC D;  4KX6 B;  1LGR A;  1WGR A;  2KOX A;  1K51 A;  4GMV A;  2PPH A;  4WAF A;  2KMM A;  5BO4 B;  3W1S A;  2MX2 A;  3PRP B;  1AN8 A;  1F9J A;  3NZ3 A;  5IP4 D;  3GZN I;  1B1Z A;  2L0T A;  4DK5 A;  4ZHP A;  1V81 A;  1L6U A;  1JRO A;  2NR2 A;  3BY4 B;  1QOA A;  1PDX A;  2CKH B;  3RCZ A;  4EFO A;  1HZ5 A;  3U7Z A;  1VZ8 A;  3BVG A;  4WJN A;  1J8C A;  3S2A A;  4KKJ A;  4IM2 A;  2BF8 B;  2HE7 A;  3L0W B;  2JY6 A;  1XF5 L;  3VVW B;  3BYY B;  2J0J A;  3Q8F A;  2FCS A;  3H1U A;  4NQK E;  3VFK A;  2KQ4 X;  3U2S C;  1UWM A;  2QEJ C;  4ICV A;  2D3G A;  3VTU A;  4I6L B;  4YL8 A;  2M19 A;  2KKC A;  2K22 A;  3H7S A;  3W5U B;  3W1Y A;  2ONQ A;  2LZ6 A;  4K81 A;  2KXJ A;  5FKA C;  1FRD A;  1OFF A;  2WXQ A;  4RF1 A;  1TS3 A;  4DDG D;  2EKI A;  3H8H A;  5J18 A;  2L00 B;  3BIN A;  4NJC A;  1KH0 A;  4XX5 A;  3CIR B;  1V49 A;  2V3N A;  3B08 A;  3ZW3 A;  3PLV A;  1RRB A;  2NMQ A;  2JVC A;  3DVG Y;  3O65 B;  1E7P B;  5EE1 A;  2ACZ B;  1IBX A;  2KWD A;  5C23 A;  1FFU A;  1TS2 A;  3BWU D;  3EA6 A;  4PS3 A;  5D94 A;  3NHE B;  2WX0 A;  3KH0 A;  2MJE A;  2WXI A;  1L5P A;  1WXA A;  1WGY A;  4HKZ E;  3N1Y C;  3RNE C;  4FUL A;  3VQI A;  1L2N A;  4M8M A;  2GMI C;  2ZEQ A;  5C1Z A;  5D3I B;  3X0W A;  4BBN C;  4HPL B;  3UI3 A;  4LNK A;  3ZYY X;  1WRI A;  3H7P B;  4B0E A;  4XE0 A;  2LHE A;  4C7Y A;  1KLG D;  4M00 A;  2N9P C;  4BAX A;  1SBB B;  2QSD A;  3QX1 A;  4CHK A;  3R8B A;  2O6V D;  1EM7 A;  1UBQ A;  4DBG A;  4N9F 4;  3PTF C;  2HTM E;  2LJ5 A;  4HCP B;  3JSV A;  5E6P A;  4OVZ A;  2DYO A;  2KWV B;  4EZJ A;  2JRI B;  1V6E A;  4MSM B;  2ZNV B;  4MJS B;  4LNI A;  2JWU A;  4K1R B;  4ANU A;  2KK8 A;  1V5T A;  4WH4 A;  3QJZ A;  3A9K A;  3PT2 B;  1WXM A;  4JL9 A;  1WJ6 A;  2AL6 A;  2D10 A;  1JW9 D;  3AE4 B;  3W5V B;  4IG7 B;  1XD3 B;  1ZPS A;  2ON8 A;  3TJP A;  3AE8 B;  1VRA B;  5EDS A;  2GBJ A;  2GBK A;  2BBC A;  1Z5S B;  3B2F A;  3IAM 1;  3CWI A;  2DHZ A;  2Y5C A;  2HJ8 A;  5KHQ A;  4DHJ D;  2FE8 A;  2EKE C;  1E5W A;  3BII D;  1AYF A;  3RMK C;  2IJ0 A;  4P1C C;  3BYT B;  1C1Y B;  3E9S A;  1WI0 A;  2Y3A A;  2LAS A;  3IXS A;  4C00 A;  1UF0 A;  1ET9 A;  2VZK B;  3PRZ A;  4IOI E;  1R4M I;  2QJL A;  2BYE A;  1ZXH A;  3N1X C;  2SAK A;  1WGK A;  3JVZ X;  3RT3 B;  4HRO A;  4MM3 A;  3Q2A C;  2REX A;  3IAS 1;  1N62 A; 
#chains in the Genus database with same CATH homology
 4I6N B;  4M8N A;  4NAW A;  5D6J B;  3PS6 A;  1D3Z A;  2LWP A;  4W9G A;  1WRD B;  2J0M A;  3Q3J A;  1G6J A;  4GN1 A;  3DBR I;  2D07 B;  5IA7 A;  1QZE A;  2FID A;  4GXB A;  1YJ1 A;  2CS4 A;  1WXS A;  2K8H A;  3PZD A;  2OOB B;  3PSE B;  3U30 A;  1M94 A;  2B3A A;  4KSL C;  4WAA A;  2CHZ A;  4KIK A;  3L10 B;  3W1S C;  3VUX A;  3QK0 A;  4B9K A;  3DBS A;  3PGE A;  4IWQ A;  2LXC A;  3A1Q A;  4KZC A;  2KDI A;  4JQW C;  1UGM A;  1GJZ A;  4JGH B;  4DDI D;  2DEN B;  2IY0 B;  1R4N I;  3JSV B;  1GC6 A;  3L16 A;  5KHO A;  2YLM A;  3KUC B;  1X1M A;  4IWO A;  4W9F A;  3ZUN A;  4FN2 A;  3ZO5 B;  4W9I A;  3WAN A;  1RFA A;  1I42 A;  5JHB A;  2PE6 B;  2WWZ A;  3NZS A;  4ZRI A;  2ZVO A;  1WF9 A;  3K9O B;  3KYD D;  2IZV B;  5E6N A;  5LLI A;  2FCM A;  1MG8 A;  2RPQ A;  4MEL A;  4LCD E;  4W9K A;  5CHW A;  2R2Q A;  2IYD B;  3C0R B;  1EF1 A;  3A9K B;  2W9N A;  1TTN A;  3OAW A;  2FIF A;  3A9J B;  3EC8 A;  1FXT B;  1P0R A;  2KLC A;  3PV1 A;  4LDT B;  3ZNZ B;  2GBN A;  2CR5 A;  1J19 A;  5HKH A;  1KLV A;  4NNJ B;  2BYV E;  2K8B A;  2PJH A;  3PRM B;  2DZI A;  2N7E A;  3RZW C;  1IP9 A;  3DVN U;  3ZTD A;  5DPT A;  4TUU A;  2KZR A;  4A3O A;  1YD8 U;  3UGB B;  1KJT A;  2M17 A;  1V86 A;  2JRH A;  5DPR A;  4AUQ C;  2DZK A;  1ISN A;  3M63 B;  2O2V B;  3EHV A;  3HM3 A;  3TBL D;  3UIO B;  2KWU B;  1WM3 A;  3AU4 A;  3CSF A;  2OJR A;  3IHP C;  4BKS A;  3CMM B;  2PE9 A;  2HTH A;  2JZZ A;  1U4A A;  2KDE B;  2CHW A;  3U8Z A;  3N30 A;  3QHT A;  1XT9 B;  4BBN F;  1WX8 A;  3NS8 A;  4AJY B;  2QHO A;  2J7Q B;  4CYE A;  2KQ7 A;  4KVG B;  3A9J A;  2RR9 A;  1WE7 A;  2UWQ A;  2A4Z A;  2XBB C;  1ZW7 A;  3UIP B;  1YIW A;  4ASW C;  1TZ1 A;  2KDF B;  1GC7 A;  3DDC B;  3EEC A;  3HM6 X;  1WJ4 A;  1KOT A;  1YQB A;  3ONS A;  2MCN B;  3A4R A;  3DCG A;  5JH5 C;  2N4F A;  1EUV B;  2K8C A;  1WFY A;  5LXI B;  3IFW B;  2O2V A;  1HE8 A;  3QWZ B;  1P9D U;  2JWZ A;  3LJ3 A;  1AAR A;  1A5R A;  5AZG A;  1ZKH A;  1K8R B;  2LRW A;  4ZYN A;  3DBL I;  2G4S A;  1NBF C;  1V9J A;  2DZM A;  3DBH I;  1E7V A;  1WGG A;  2O6V A;  4W9E A;  1SGH A;  2L7R A;  2IY1 B;  2I1J A;  4BOS C;  1IYF A;  4KV2 A;  1WY8 A;  2DAF A;  2D2Q A;  4CO7 A;  4IW0 A;  2JUO A;  2LGD A;  4TKN A;  5CHV C;  4EUT A;  4GDK B;  4KDI C;  1GNU A;  2RGF A;  4HCN B;  4IWP A;  2L3Z A;  4FJZ A;  5AEK B;  2MW5 A;  4WWO A;  3DVN V;  1GUA B;  1LM8 B;  2C60 A;  2KFJ A;  3KUD B;  3Q3F A;  2ZJD A;  3VTV A;  1LXD A;  3ZNI D;  4ZRJ A;  3ZRF A;  3A33 B;  1OTR B;  3JW0 X;  3RUL A;  2AL3 A;  1OEY A;  4GU2 A;  4HDQ A;  1UBI A;  4E74 A;  1WR6 E;  2IBI B;  3A1Q B;  4W9H A;  4WQO B;  4A20 A;  2J0K A;  3L13 A;  4RM9 A;  4DHZ E;  4ZRK A;  4OVU A;  3WAO A;  3IG3 A;  3M62 B;  3HIZ A;  4KDL B;  3ZLZ A;  1V2Y A;  2ZPY A;  2G3Q B;  3RZF A;  3MTN B;  4KZ0 A;  3WIM A;  2UYZ B;  3D32 A;  2ZCB A;  3PPA A;  4GIV A;  3AUL A;  5E6O A;  3TL5 A;  2A5U A;  1Q1O A;  4MGI E;  1YX5 B;  1VD2 A;  3ALB A;  4MH0 E;  2L0F A;  4GDK A;  1E8X A;  1NDD A;  3VDZ A;  1WR1 A;  2KQS A;  3SD5 A;  1E7U A;  2C7H A;  2IO0 B;  1WXV A;  4G11 A;  3ZNH B;  3VXW A;  5DPW A;  4MGY E;  3ECI A;  5GMV A;  1ZGU B;  3UQB A;  2LRU A;  4GGQ A;  1E8W A;  3PHX B;  3L54 A;  4TQ1 A;  1E90 A;  1P98 A;  3ZDT A;  2AWT A;  2C7M B;  5CX3 A;  2M4N A;  2DYM A;  2FUH B;  4TQ0 A;  1Z2M A;  3OJ4 B;  4FJY A;  2V1Y A;  4W9J A;  3T8M A;  5J17 A;  4JLC A;  2K6Q A;  3NZU A;  1J0G A;  4FHK A;  4BKS D;  3ZRC A;  2DYB A;  3DQV A;  4URK A;  4IM3 A;  5G2N A;  2RSU A;  3WAL A;  3T9L A;  3CF6 E;  5DPS A;  4EZL A;  1E8Z A;  3B0A A;  2BKR B;  4E71 A;  4LDT D;  2FNJ B;  4K7S A;  1T0Y A;  4FJV B;  2V4L A;  3TCA A;  2L8J A;  1EO6 A;  4DXA B;  3PVL A;  1UZX B;  4W9D A;  4RM8 A;  3VAW A;  4HK2 A;  5FR6 A;  2FCQ A;  3V6E B;  1WX9 A;  2LVO A;  1OEY J;  3QC8 B;  4NQL B;  3DVG X;  3IBE A;  3IVF A;  4XC2 A;  2LVQ A;  2K25 A;  4AWJ A;  4EKU A;  2AEH A;  2MA9 B;  5CTR C;  2FCN A;  2EMS A;  4NJ7 A;  2NBV B;  2G4D B;  3KYC D;  3WAP A;  3TMP B;  1WZ0 A;  1WGR A;  2KOX A;  4GMV A;  2PPH A;  5BO4 B;  2LUE A;  2C9W B;  3W1S A;  1LFD A;  2MX2 A;  3PRP B;  2MSE D;  2NCN A;  3SHQ A;  3L08 A;  1F9J A;  1H4R A;  2KTR A;  3HK0 A;  3WA0 A;  3GZN I;  4WJQ A;  1RLF A;  2XK5 B;  4MSQ B;  2ASQ A;  4FBJ B;  2L0T A;  1TGZ B;  5LXH A;  2N1V A;  1I35 A;  2MLB A;  4II2 B;  2O6V B;  3QCA A;  1PQS A;  4DK5 A;  2ZVN A;  2LGX A;  1V81 A;  5CHF A;  4X57 B;  2NR2 A;  3BY4 B;  3QAQ A;  3DPD A;  2CKH B;  2MRP A;  3RCZ A;  3TIX A;  2M8S A;  2WX1 A;  4EFO A;  4ZDV A;  3ZTC A;  4F8C B;  4K7W A;  4ANV A;  1S1Q B;  3NY5 A;  4M0W B;  3PRE A;  4HLE A;  3QIJ A;  3UF8 A;  4G50 A;  4WJN A;  4IUM B;  1J8C A;  3S2A A;  2BGF A;  2KNB A;  2KD0 A;  3ML9 A;  3L17 A;  4IM2 A;  2BF8 B;  2HE7 A;  2XK5 A;  3L0W B;  2JY6 A;  2MP2 A;  3JYU A;  2N9E B;  4PYU A;  3VVW B;  4HWI B;  1IPG A;  4MEM A;  3OJ3 A;  2J0J A;  2NBW B;  2KX3 A;  4HDO A;  2MQJ A;  4PS8 A;  3MJW A;  2KMA A;  4AP4 C;  3RD2 A;  2FCS A;  3H1U A;  1LQB A;  3VUW A;  4NQK E;  5JHA A;  3VFK A;  5J2R A;  1WGD A;  2MBO A;  2XEW A;  3ML8 A;  1EF5 A;  4II3 B;  2D11 A;  4FAD A;  2WDT B;  2KJ6 A;  2Z0D B;  3P2B A;  4ICV A;  2D3G A;  3VTU A;  4I6L B;  4YL8 A;  4GB9 A;  4HJK A;  1UD7 A;  2GBR A;  1GG3 A;  2KKC A;  3H7S A;  3M95 A;  3OLM D;  4LJO B;  4DHJ B;  3W1Y A;  2IO1 B;  3K9P B;  2LZ6 A;  3AXC A;  4K81 A;  3VH4 B;  2KC1 A;  2KXJ A;  4JIO U;  3ZNG C;  1WE6 A;  2KHW B;  4FHJ A;  1WIA A;  4DDG D;  5L95 C;  1S3S G;  3RYT A;  5J18 A;  4WJP A;  4BFR A;  4BVU C;  4FA6 A;  3KVF B;  2LGY A;  1E8Y A;  1Y8R C;  2NS5 A;  2LD9 A;  2L00 B;  2DAJ A;  1WMH B;  3BIN A;  2Y5B B;  4AJW A;  3VHT C;  2RD0 A;  4XX5 A;  2MBH A;  2CU1 A;  1V49 A;  3B08 A;  4IC7 B;  3PLV A;  3ZW3 A;  1RRB A;  4FLH A;  1JRU A;  2DZJ A;  1V80 A;  4ANW A;  4NPN A;  2JVC A;  2I1K A;  3DVG Y;  3O65 B;  2KMC A;  4BOZ B;  3MHS D;  2KX0 A;  3V61 A;  1WJU A;  5C23 A;  2KFK B;  3R7Q A;  4PS3 A;  5D94 A;  3NHE B;  2WX0 A;  1WJN A;  2Z0E B;  2KTR B;  2M0X A;  2IO3 B;  3KH0 A;  2FAZ A;  2DX5 B;  1V5O A;  1WH3 A;  2KAN A;  1WGH A;  1WXA A;  4B95 A;  1WGY A;  3KUZ A;  1WX7 A;  1L7Y A;  1VCB A;  1WMH A;  4W9C A;  4FUL A;  4HPM B;  4F1S A;  3CST A;  5IAA C;  4NJ6 A;  4BKT A;  2NPT B;  3VQI A;  4E3C A;  3UQA A;  4M8M A;  1Q5W B;  2GMI C;  1OGW A;  2KN5 A;  3N32 A;  1UH6 A;  4A3P A;  2ZEQ A;  3H6N A;  5C1Z A;  3X0W A;  4BBN C;  4HPL B;  5AZH A;  2NBU A;  4HVB A;  2BWF A;  3R3M A;  4AOF A;  3H7P B;  4OVV A;  1OQY A;  3M3J A;  3NOB A;  3B1L X;  4F7Z A;  3ZKJ C;  3ZIM A;  3WAM A;  2N9P C;  2PEA A;  2M1M A;  5TR5 A;  2KFK A;  2G45 B;  3DOW A;  2BPS A;  3QA8 A;  2BYF A;  2KTF A;  3QX1 A;  3AI5 A;  4CHK A;  3HHM A;  1SE9 A;  4LJP B;  4DHZ B;  2MP2 B;  4MGZ E;  2O6V D;  5D7G A;  2JT4 B;  1KM7 A;  2KDB A;  1TBE A;  1UBQ A;  2LI5 A;  4ANX A;  4IM0 A;  3V60 A;  3SU8 X;  2NPT A;  4EEW A;  3U7D A;  1SIF A;  3VH3 B;  4MDK E;  3UIN B;  4DBG A;  4N9F 4;  3PTF C;  4K7U A;  2KLG A;  2ZNV C;  2LJ5 A;  2VRR B;  4HCP B;  4I6P A;  4DWF A;  2NVU I;  3JSV A;  4G3X B;  5E6P A;  3AU5 A;  3EFU A;  4TV3 A;  1Q0W B;  3H7P A;  2DYO A;  2KWV B;  2MBQ A;  4PYZ A;  4EZJ A;  2LVP A;  2JRI B;  3APF A;  1V6E A;  4MSM B;  2L05 A;  2LXA A;  2ZNV B;  2MWS B;  4RMA A;  2MBB B;  1WYW B;  4MJS B;  4K1R B;  2KWC A;  2KK8 A;  5DCN A;  2K6D B;  4ANU A;  1V5T A;  2GOW A;  2MBE A;  2N7D A;  2ZPN A;  3QJZ A;  3A9K A;  3QAR A;  4KSK C;  3ZVV A;  1XQQ A;  2KJH B;  3PT2 B;  4P7I A;  1C3T A;  1WXM A;  5AZF A;  3QQ8 B;  2GBM A;  4JL9 A;  4MGK E;  1WJ6 A;  2C7N B;  2AL6 A;  2D10 A;  2K1F A;  2BWE S;  5L83 A;  3APD A;  3ENE A;  3H9D A;  3N3K B;  3R66 C;  2ZCC A;  2IO2 B;  2BKF A;  2JZ3 B;  4IG7 B;  1XD3 B;  3LDZ E;  2CHX A;  3V6C B;  4ICU A;  4G0N B;  1P1A A;  3APC A;  4PS7 A;  3V62 A;  4BKG A;  4EZK A;  1RAX A;  3TJP A;  3I3T B;  4EOY A;  4GOC A;  3SDL C;  5EDS A;  4HXD A;  2GBJ A;  3VUY A;  2GBK A;  2C5L C;  4GSW A;  2AYO B;  1Z5S B;  2JPH A;  2ZZP B;  2DHZ A;  2HJ8 A;  5KHQ A;  4GDL B;  1YX6 B;  3PLU A;  4WWP A;  1CMX B;  4MJS A;  5D2M B;  4DHJ D;  2WYQ A;  1WM2 A;  2EKE C;  2K39 A;  1L2N A;  1E5W A;  2HD5 B;  2KJR A;  4NAW B;  1P3Q U;  1C1Y B;  1WI0 A;  2KO3 A;  3ZDM C;  2EMT A;  2YVC A;  3VTW A;  4J6I A;  3PHW B;  4WWN A;  2Z59 B;  2JXX A;  5G55 A;  3A4S C;  2KVR A;  1NI2 A;  2LAS A;  1WZ3 A;  2N9X A;  4XZ4 A;  2N1W A;  4NY0 A;  3R7R A;  3PRZ A;  2V3S A;  1R4M I;  3GOE A;  4KIK B;  2BYE A;  2L76 A;  4B6W A;  3KW5 B;  4WJO A;  5JZE B;  3JVZ X;  2KC2 A;  1BT0 A;  2JF5 A;  3RT3 B;  3RUI B;  1H8C A;  1UEL A;  4GDL A;  4MM3 A;  2REX A;  4W9L A;  2R2O A;  3X23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...