1IPGA

Solution structure of the pb1 domain of bem1p
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
GAMGSSTSGLKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and ligand recognition of the PB1 domain: a novel protein module binding to the PC motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords BEM1 PROTEIN
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ipgA00
1SE9A 2JT4B 4I6PA 4M0WB 1QZEA 1WZ0A 1Y8RC 4GIVA 4TV3A 4K7WA 4B6WA 3RZWC 3A1QB 2JF5A 4FHJA 1AARA 5GMVA 3VH3B 1UELA 1YX5B 2LGYA 2N4FA 3DBRI 2M17A 2D10A 1V81A 2JZ3B 2KQSA 2DAJA 3VUYA 1TTNA 2Y5BB 2R2QA 3AXCA 3A4SC 2V4LA 1RLFA 2K6DB 2KDIA 3NHEB 3UF8A 3PRMB 1V2YA 5AZGA 2ZCBA 4MM3A 4MJSA 2L3ZA 2O6VD 3L13A 3AULA 2NPTA 2K8CA 5CX3A 2R2OA 2CHZA 2EKEC 4JLCA 4GOCA 3KVFB 1J0GA 3TL5A 3NZSA 1OEYA 2M4NA 2GBJA 1X1MA 2Z0EB 2ZJDA 3A33B 3KW5B 1LXDA 2BYEA 3DCGA 4IM3A 4URKA 2GMIC 2DX5B 1WX7A 4WWOA 1WX9A 2LI5A 3L54A 4HVBA 4AJWA 4CHKA 2J7QB 3ZNID 2ZZPB 3DBSA 4W9EA 4GDLA 2KTRB 2BF8B 3DQVA 3HHMA 2IY0B 4HCPB 4XC2A 4F1SA 4GB9A 4W9JA 2IO0B 2LRWA 3VH4B 4A20A 3TMPB 2KWCA 4LJOB 4IG7B 2KX0A 2O2VB 2OOBB 2LWPA 5DPTA 1SGHA 3APDA 2RGFA 2W9NA 4G11A 1UBIA 5BO4B 5AZHA 3V62A 2KNBA 3PHWB 4MGIE 3TJPA 3BY4B 1E8YA 2MRPA 4E3CA 1VD2A 2KLCA 4PS3A 3ZUNA 2JXXA 1KJTA 3B08A 5E6NA 2JZZA 2K1FA 1MG8A 3NY5A 3PHXB 4AP4C 4EOYA 5FR6A 3HM3A 1L2NA 2I1JA 1NI2A 4PYZA 4W9FA 4FBJB 3DVGY 3DPDA 3VTWA 1LM8B 4HDQA 1IP9A 4HXDA 4FLHA 1WE7A 2PJHA 3KYCD 3PLVA 4GMVA 1S1QB 4I6LB 3X23A 2Z59B 2C60A 1RRBA 2JWZA 2REXA 2FCQA 4K81A 4EZKA 3EHVA 1YIWA 2C9WB 4DHJD 2B3AA 3KUCB 4E71A 2K25A 4LCDE 2IO1B 2BKRB 2KDBA 4A3OA 4CYEA 2KK8A 2KTFA 4HK2A 2IO2B 1GUAB 4ANUA 2ZPYA 1XQQA 4BKSD 4GU2A 4PS7A 4FJZA 2NCNA 3MJWA 2KTRA 3CSFA 2LXAA 4NAWA 1EUVB 1Z2MA 3ZVVA 2FUHB 3QARA 4MSQB 4FHKA 3PT2B 2NR2A 2K39A 1TBEA 3M3JA 3U8ZA 2D11A 4FULA 2C7MB 2NVUI 1E7UA 4BVUC 5L95C 2NBWB 2FCMA 2M0XA 4HLEA 5EDSA 1HE8A 2NBUA 3M62B 5IA7A 3U30A 5DPSA 2GBKA 2MX2A 3CF6E 3IG3A 4NJ6A 1WF9A 4IM2A 4RM9A 4WJPA 4IM0A 5C1ZA 2ASQA 4CO7A 1C1YB 1NDDA 4GDKB 1T0YA 4W9IA 1UBQA 4TUUA 4IWQA 2ZPNA 2MCNB 1I42A 2J0MA 1E8XA 1RAXA 1V5TA 1WJ4A 2MBBB 4IC7B 3ONSA 3DBHI 2L7RA 2O6VA 2HE7A 1K8RB 4P7IA 4GXBA 2DYBA 1IPGA 4HPLB 2J0KA 4NQKE 4TQ1A 4W9KA 3C0RB 4KDLB 4E74A 4KIKB 3UQAA 1WH3A 3ZW3A 2RR9A 3KUDB 4NQLB 1GNUA 3JYUA 4W9GA 2KOXA 3WIMA 1RFAA 1H8CA 2K8BA 3ZKJC 1ZGUB 3RULA 2RPQA 3ALBA 3VTVA 2LJ5A 1GC7A 3PSEB 3DBLI 1Q5WB 3PRZA 2KWVB 2XBBC 1KOTA 4KVGB 2EMTA 5D94A 1Q1OA 4WJQA 5G2NA 5CHFA 1E8ZA 3L10B 5D7GA 1U4AA 3OAWA 5KHOA 4IWOA 3APCA 3H9DA 4KSLC 4PYUA 4AJYB 4KDIC 3H1UA 3QK0A 4HJKA 3PZDA 3H7SA 3UQBA 2IZVB 2KLGA 1IYFA 4JQWC 1V5OA 2NS5A 2K8HA 2NBVB 1V6EA 1H4RA 4FJYA 1WE6A 3Q3JA 2JY6A 2KN5A 2N7DA 2LZ6A 2DZKA 3M63B 2KC1A 3JSVA 2BWFA 3ZLZA 1NBFC 1GG3A 3HM6X 5CTRC 3SHQA 1P98A 4AOFA 5L83A 3ZIMA 3P2BA 4K7SA 1E5WA 3CMMB 3PVLA 2JRHA 4G50A 4AUQC 3ZNZB 4WJOA 5G55A 1JRUA 3R7RA 3SDLC 2O6VB 2ZNVB 3AI5A 2ZVNA 4B9KA 1WXVA 1TGZB 5JH5C 3L08A 3W1YA 1YJ1A 1OQYA 2PPHA 1KLVA 3ZO5B 2G45B 2KFKB 3Q3FA 1E90A 2ZEQA 3PLUA 3DDCB 2C7HA 2L05A 5E6OA 1KM7A 1GC6A 3H7PA 2LVPA 1XT9B 2RSUA 5C23A 2MP2A 2YLMA 3TCAA 3VXWA 3TBLD 4FA6A 1E8WA 2M1MA 2KMAA 2BGFA 4ZRKA 2XK5A 4W9DA 2JUOA 2CHXA 3GZNI 1OTRB 3IVFA 2FIDA 2N9PC 4BKGA 2BYVE 3NOBA 1UH6A 4N9F4 4EZJA 5DCNA 1ISNA 4II2B 2JVCA 2O2VA 1WM3A 1EO6A 1YX6B 3AU4A 3ZNGC 2VRRB 4JIOU 4DHZE 1FXTB 3ENEA 2BWES 4EEWA 2KVRA 2KMCA 1I35A 2DENB 3ZTDA 2ZCCA 3MHSD 4EZLA 5J2RA 2LGXA 3LDZE 2PE6B 4YL8A 3X0WA 1OGWA 4MGZE 4PS8A 1PQSA 1R4MI 2ZNVC 4MH0E 3PRPB 3PS6A 4BKSA 2WX1A 2GBMA 2BPSA 3WAOA 3TIXA 3L0WB 3PREA 2KC2A 4BOSC 3WALA 2L76A 1GJZA 5LLIA 2KJ6A 3QX1A 2MBQA 3VVWB 4NY0A 4BBNC 3NS8A 2FNJB 4DHJB 2AEHA 2G3QB 1L7YA 4NJ7A 4XX5A 3PPAA 3A9KB 2FAZA 3W1SA 3H6NA 1WGHA 1S3SG 4BFRA 3W1SC 4HPMB 1ZW7A 1TZ1A 2KXJA 3UINB 2HJ8A 3VHTC 4K7UA 4OVVA 3ZRCA 1YD8U 2AL3A 4MELA 4KZ0A 2D07B 4G0NB 5LXIB 2MQJA 2C7NB 1WYWB 2RD0A 4W9HA 2A4ZA 1LFDA 3U7DA 3V6EB 4DDGD 1A5RA 3DVGX 4KSKC 4MDKE 4TKNA 2G4SA 1V49A 4II3B 2QHOA 4ZDVA 3UIPB 4I6NB 4J6IA 3PTFC 3RZFA 4ZRIA 2AL6A 2LUEA 3QIJA 5AZFA 4EUTA 1G6JA 3V6CB 3N30A 3N32A 4GDKA 3WAMA 1J19A 4HCNB 3KH0A 3SD5A 2CR5A 3A9JB 2LASA 2MBOA 3RYTA 4JL9A 3WANA 2MSED 2LXCA 2AWTA 1EF5A 1WJNA 1WMHA 3R66C 4F7ZA 3A9KA 3ZTCA 1P0RA 1WGGA 3A4RA 1P1AA 3VTUA 1WI0A 2L00B 3ZDMC 2KJHB 2LVQA 2D3GA 1WXSA 1UZXB 2GBRA 2GOWA 2MLBA 2MW5A 2LVOA 4LDTD 4MEMA 3RT3B 4ANVA 2DHZA 1WRDB 2OJRA 2C5LC 3EC8A 3K9PB 4OVUA 5IAAC 4JGHB 5E6PA 2I1KA 1WXAA 3QA8A 5J18A 2K6QA 2ZVOA 3ML9A 4KIKA 4LDTB 2MA9B 3VUWA 1M94A 2N9EB 1WM2A 5CHVC 4FADA 2KO3A 1Z5SB 4GGQA 5JHAA 3SU8X 4X57B 5CHWA 2KHWB 4MGYE 3QQ8B 2IYDB 2N9XA 4WWPA 3AU5A 2FCSA 3EECA 3RCZA 3QAQA 3WAPA 1WX8A 2KZRA 4GDLB 2UWQA 4ICUA 4DDID 2DZJA 2L0FA 3O65B 2CU1A 3VQIA 2JRIB 2GBNA 4BBNF 3HK0A 2WWZA 1V86A 3RD2A 4WJNA 1D3ZA 2CHWA 3D32A 4AWJA 2MBEA 3DVNU 1EF1A 5DPWA 3EFUA 3T9LA 3IFWB 3APFA 4NPNA 2WDTB 2KANA 1SIFA 2KKCA 1WXMA 4RM8A 3ML8A 5D2MB 4GSWA 3ZNHB 1UD7A 2Z0DB 1WGYA 4BOZB 1E7VA 2JPHA 3DOWA 4GN1A 4NAWB 5KHQA 1BT0A 4ZRJA 2HTHA 3V61A 1P9DU 3OJ4B 2UYZB 1LQBA 2V1YA 4FN2A 4LJPB 4MJSB 2XEWA 4DK5A 5LXHA 1C3TA 2EMSA 2WYQA 4M8NA 3VDZA 1WY8A 3JSVB 3JW0X 4BKTA 1YQBA 2IBIB 2N7EA 3QHTA 4G3XB 4NNJB 3GOEA 1WIAA 4WQOB 3CSTA 2CKHB 3VUXA 4EKUA 5HKHA 2KWUB 4W9LA 4ANWA 3QWZB 3DVNV 3HIZA 2KQ7A 4WWNA 3V60A 5JHBA 2KFJA 3ECIA 3LJ3A 4W9CA 3T8MA 2KD0A 2WX0A 4DXAB 3UGBB 1UGMA 2DYOA 2DYMA 2PE9A 2DZMA 5JZEB 1P3QU 4ANXA 2KDEB 3OJ3A 4RMAA 3A1QA 3ZDTA 3I3TB 4M8MA 4B95A 3IHPC 3B0AA 3H7PB 1V9JA 2DZIA 2N1VA 3L17A 5AEKB 4TQ0A 2MP2B 1WFYA 3M95A 4MGKE 3VFKA 1R4NI 4KV2A 2L0TA 4A3PA 3OLMD 5D6JB 3MTNB 2LD9A 2D2QA 2A5UA 2KFKA 3QJZA 4F8CB 3PV1A 2FIFA 1WR6E 4DHZB 2AYOB 3KYDD 1ZKHA 2NPTB 1WJUA 2KX3A 4IW0A 3UIOB 3K9OB 3B1LX 3QCAA 2HD5B 1WJ6A 1OEYJ 4ASWC 2LGDA 3JVZX 3ZRFA 1J8CA 3RUIB 1XD3B 1Q0WB 3BINA 1WR1A 4FJVB 4DWFA 1V80A 2G4DB 2MBHA 2YVCA 1WGDA 4ZYNA 3L16A 3R3MA 4K1RB 4WAAA 4IWPA 4MSMB 2KJRA 2DAFA 4XZ4A 1F9JA 3R7QA 3IBEA 3S2AA 2MWSB 1VCBA 4DBGA 2FCNA 2BYFA 3N3KB 5DPRA 1WGRA 3KUZA 4KZCA 2IO3B 2KDFB 2LRUA 1CMXB 2M8SA 2XK5B 3WA0A 2BKFA 2IY1B 4EFOA 2PEAA 4HDOA 1WMHB 2J0JA 4IUMB 4HWIB 2CS4A 4ICVA 5TR5A 2L8JA 1WZ3A 3NZUA 3QC8B 2V3SA 2N1WA 3VAWA 5J17A 3A9JA 3PGEA
chains in the Genus database with same CATH superfamily
1QZEA 4TV3A 4K7WA 2DWQA 3A1QB 5C3JB 2JU6X 5GMVA 3VH3B 1C77A 1SF0A 5T8IA 2OJWA 1V81A 2DAJA 2V4LA 2K6DB 2KMMA 3NVWA 3Q8FA 2ZCBA 2E3TA 2L52A 2L3ZA 2O6VD 1IGCA 3L13A 3AULA 2NPTA 4TSSA 5CX3A 4JLCA 2D3AA 1F77A 1J0GA 3TL5A 1MG4A 2Z0EB 3KW5B 2W3RA 1SJHD 1KTKA 4W9EA 4HRSA 1XLPA 3DQVA 2GI9A 4GB9A 3VH4B 1XXGA 3TMPB 4LJOB 1JWAD 2O2VB 1OQRA 2INPE 3APDA 3DHHC 3V62A 1E8YA 4ZYSA 2MRPA 4E3CA 3AV8A 1F0ZA 1VD2A 2KLCA 4PS3A 1MG8A 3AEEB 5FR6A 3HM3A 1WGKA 4W9FA 1NI2A 3AEAB 1LM8B 2PJHA 4CQNA 1S1QB 4I6LB 1VZ7A 4NJCA 3X23A 3BIID 2B3AA 4E71A 2VH2A 1UGJA 2BKRB 2IO2B 4HPPA 3MJWA 2KTRA 2LXAA 4NAWA 4KKJA 1KF6B 2GRIA 4FHKA 2BS3B 3BZDB 2C7MB 4B0EA 2IGDA 5C2TB 2FCMA 2M0XA 1SEBD 1HE8A 1DOIA 3P1MA 1TS2A 3Q6BA 1WF9A 4RM9A 5C1ZA 1L6UA 1RWSA 4IWQA 2J0MA 1WJ4A 1ZDXA 1D5ZC 3DBHI 2L7RA 3SEBA 1K8RB 4P7IA 4GXBA 4HPLB 4AQ7A 4NQKE 3Q8EA 4KIKB 3UQAA 3KUDB 3JYUA 3RNGC 4S17A 4XDDA 1ZGUB 2LJ5A 1GC7A 1Q5WB 1KOTA 3UI3A 4L1BA 3L10B 2VZKB 3GZNB 3RNCC 3AMZA 1VRAB 1KLGD 1DGJA 4HJKA 3H7SA 3UQBA 2IZVB 1AYFA 1SB3C 4JQWC 5TSSA 1H4RA 4RGOS 2Y3AA 2JY6A 2LZ6A 4XYCA 1NBFC 1C78A 4RH6A 4QAYA 3GS2A 1SJED 2QIEB 2JRHA 4G50A 1JRUA 3R7RA 1TGZB 3L08A 2G45B 3HRDD 4YSYB 3PLUA 4WWMA 2WXNA 3DDCB 3PZ7A 2L05A 4H2AA 2LVPA 3AE9B 5C23A 3VXWA 2AQ1B 3TBLD 1E8WA 2M1MA 2BGFA 1K53A 2CHXA 4JE3B 1KRHA 2E6XA 3N1XC 1QT9A 2LGIA 2JVCA 1WM3A 2LMCA 3C19A 3AU4A 2VZKD 3ZNGC 2VRRB 4DHZE 3ENEA 2BWES 3VR9B 4EEWA 1JWUD 1I35A 2ZCCA 1HZ6A 4EZLA 5J2RA 3LDZE 2PE6B 2W54A 4JWSC 1PQSA 3WAOA 3EUB2 3PREA 1QF6A 1N5XA 5LLIA 4NY0A 4XX5A 3PPAA 3W1SA 3H6NA 2GLSA 1FD6A 2LJIA 1TZ1A 2KXJA 4OVVA 2AL3A 5MPOA 1TKYA 2D3BA 2RD0A 4W9HA 3V6EB 1FCCC 4A90A 3FKYA 1ESFA 4AS1A 2AL6A 1V8CA 2LUEA 3DHGC 4GDKA 1TYGB 3BK2A 2J42A 1NENB 2MBOA 3WANA 2MSED 1STEA 2AWTA 3ZTCA 1P0RA 1WGGA 2D5GA 3WCQA 1WI0A 2ON8A 1WXSA 3RT3B 2GBRA 2WXFA 2OJRA 3K9PB 4OVUA 4JGHB 5E6PA 2I1KA 2MA9B 4GGQA 5JHAA 1IBXB 4X57B 3QQ8B 2IYDB 2N9XA 2CJNA 2FCSA 3EECA 3WAPA 1WX8A 4DDID 4ICUA 3B2GA 2CU1A 3HK0A 2X8XX 1V86A 4AWJA 2MH7A 4BAXA 1ET9A 2NTTA 3T9LA 3IFWB 1YN4A 3MFGA 1WXMA 5D2MB 4GSWA 2HJ1A 1VDVA 2JPHA 4LLGM 2K3UA 3MHZA 4ZRJA 2INDC 1GPXA 2V1YA 4DK5A 5LXHA 2L83A 1WY8A 1ZPSA 1YQBA 4G3XB 4NNJB 1WIAA 4WQOB 1BXTA 2KWUB 4YTMB 3V60A 3T8MA 2WX0A 3E56A 2DYOA 2PE9A 3ZDTA 3A1QA 3I3TB 4YSZB 3H7PB 1LGRA 5GXGB 1T5XD 4KV2A 1XLOA 3MTNB 5FK9C 2WU2B 4N59A 3KYDD 3MJ5A 2KX3A 3UIOB 4ZHPA 1WJ6A 3AE5B 4P16A 3T3NA 3RUIB 1XD3B 3P4QB 1F2RC 3R3MA 1L4DB 4MACA 1SE3A 4IWPA 2KJRA 3R7QA 3S2AA 1J7BA 2BYFA 2MJDA 1TZOA 1WGRA 2MJEA 2UU7A 5I4DA 2M8SA 2MEKA 2PEAA 1VR9A 2J53A 4IUMB 2RMMA 2CS4A 3QC8B 2N1WA 3A9JA 1IGDA 2JT4B 4GIVA 2WNMA 3IAS1 2JF5A 2R61A 4FHJA 4RGNA 1AARA 2XN9C 3IAM1 2M17A 1N6ZA 2RDBC 3TEWA 4KGRA 1T0RC 3NHEB 2KDIA 3PRMB 1V2YA 3Q8AA 1XF5L 4MJSA 1RM6C 3GP7A 2PVGC 4WAFA 2CHZA 2EKEC 3Q3NC 3AH7A 4JX1C 2M4NA 2GBJA 1KH0A 1X1MA 1SSNA 3A33B 4IM3A 4URKA 3TEXA 2GMIC 2V0GA 1WX7A 1JALA 1WX9A 3L54A 4CHKA 1JRPA 2ZZPB 3DBSA 2KTRB 4RF0A 3N20C 4HCPB 3OWEB 1UWMA 4A20A 4P6VF 2OOBB 3GE3C 2YEPF 3MC9A 5DPTA 1SGHA 4ACFA 2W9NA 3R8BA 3KWLA 3TJPA 3BY4B 2B76B 2JXXA 1KJTA 5E6NA 2JZZA 2K1FA 4AP4C 3DBHB 4ZOHC 1L0YB 4FBJB 2DBYA 5G5HA 4L23A 1IP9A 4M02A 2WXRA 1RRBA 2JWZA 4K81A 3EHVA 2C9WB 2K25A 4LCDE 1AN8A 1BUIC 4A3OA 4ZRPA 4YT0B 1NVID 2KK8A 2KTFA 4P1CC 1XQQA 1EUVB 3ZVVA 3PT2B 3I5JC 2K39A 1TBEA 1MI0A 2NVUI 1E7UA 1YN3A 5L95C 2NBWB 4HLEA 2NBUA 3AE7B 5DPSA 1DYQA 4WJPA 4LTUA 4GDKB 1T0YA 4IDIA 2ZPNA 4MM3B 2MCNB 1I42A 3ONSA 1IBXA 2O6VA 1MFWA 1SE4A 2HE7A 4W9KA 2DYBA 2WXLA 1XEEA 1ACCA 4JPSA 3ZXRA 3VTVA 4GLSC 4KVGB 1Q1OA 2ICIA 2PTLA 4EE2A 3O13A 5IKCM 1F52A 4IWOA 4KSLC 4XGAB 4AJYB 1DOXA 3QK0A 3Q2AC 1M4VA 2JYEA 1IYFA 2INNE 1ENFA 2K8HA 2PKOA 1V6EA 4FJYA 1JW9D 1WE6A 3Q3JA 5BMGA 2DZKA 3M63B 1P7EA 2WXIA 3MC8A 2BS4B 2BWFA 3RNEC 3HM6X 5CTRC 1P98A 4AOFA 5L83A 2JQRB 3DWMA 3P2BA 4C80A 1E5WA 4OZBA 3PVLA 4M01A 3ZNZB 4WJOA 5G55A 2ZNVB 3AI5A 2ZVNA 4B9KA 1WXVA 1PUTA 3BVMA 1KLVA 2BBCA 3HUIA 4YTNB 2C7HA 3SR6A 1KM7A 4PK1A 3TCAA 2LHDA 2WXPA 3TUOA 2WDRB 3P4SB 4RFBA 3VRBB 2WXHA 3RNFC 4LNNA 3GZNI 2H88B 1OTRB 3IVFA 2FIDA 2BYVE 1E9MA 5HFYA 2ZW0A 5BMHA 1ZP0B 1UH6A 3VR8B 1T0QC 1ISNA 4II2B 2SAKA 1Q10A 2WDVB 1OFFA 1ROEA 2JZPA 1QOFA 2KVRA 4L2YA 2DENB 3MHSD 3X0WA 2QSDA 3PS6A 3CIRB 1FNVA 2WX1A 3AE8B 3TIXA 4BOSC 2N0SB 4BBNC 2I2YA 2V4IB 2WXGA 2FNJB 2AEHA 2G3QB 4NJ7A 1V1OA 1WGHA 1S3SG 2HJ8A 4IKGA 4KZ0A 2D07B 3E9SA 1WYWB 3U7DA 3DVGX 4KSKC 1V49A 1C4AA 3RZFA 4J6IA 3PTFC 4ZRIA 4EUTA 5AZFA 1G6JA 2ZW1A 4C4VB 5IO9A 3A9JB 2LASA 3RNBC 3AE2B 3R66C 3IT4B 4F7ZA 1I4XA 3A4RA 1IUEA 4C7ZA 1OQQA 2V3PA 4K3BA 4MEMA 2GOWA 1UZXB 2MLBA 1YN5A 1JROA 3Q8BA 2C5LC 5J18A 2ZVOA 4LDTB 1M94A 1WM2A 2LGSA 2KT7A 2PIAA 3W5UB 4MGYE 4RNAA 4D2KA 3RCZA 2KZRA 2VH1A 3TSSA 3O65B 3VQIA 2JRIB 1AWDA 2JSVX 4WJNA 3D32A 2NMQA 2PVOD 1YNTE 3N1ZC 2BT6A 1GOZA 2BVCA 3DVNU 4OZCA 3URYA 5DPWA 4NPNA 2ACZB 2WDTB 2KANA 2N7JA 2QEJC 2IGGA 2IJ0A 3ZNHB 1UD7A 5KHQA 4BOZB 4NAWB 3DOWA 2INCC 1BT0A 3V61A 3TEYA 1P9DU 3OJ4B 2UYZB 1LQBA 2EMSA 2FBWB 2WYQA 1YJJA 2RDGA 2Z8LA 1E10A 1FFUA 3VUXA 4EKUA 5HKHA 1VZ8A 2CKHB 5JHBA 1I4GA 3ECIA 3RFZB 1Y56A 4W9CA 2DZMA 2PMVA 5JZEB 4ANXA 3OJ3A 4HROA 1V9JA 3L17A 1J7CA 4TQ0A 2NTSA 3VFKA 4A6QA 2GB1A 2L0TA 3Q69A 3OLMD 5D6JB 2LD9A 1D5MC 3QJZA 4F8CB 2AYOB 1ZKHA 4RGMA 2NPTB 3AEGB 3QCAA 2HD5B 3IXSA 3JVZX 2KWDA 2QILA 1J8CA 4IOIE 4ARCA 3BINA 1WR1A 1V80A 2G4DB 2MBHA 4ZYNA 4K1RB 2LHEA 2N9LA 4XZ4A 1F9JA 1HXYD 4OVZA 1FCLA 2DNFA 3RI7C 4DBGA 2FCNA 3N3KB 5DPRA 1EWYC 5H92C 3KUZA 3DWGC 3WA0A 2BKFA 2IY1B 4HDOA 5BYQA 2J0JA 5EE3A 5HHDG 5TR5A 4ICVA 1WZ3A 4HKZE 2V3SA 1L4ZB 5J17A 4TUUA 4C56C 1SE9A 2QC8A 4M0WB 1UELA 1YX5B 2LGYA 2N4FA 4OHJA 2JZ3B 3VUYA 1CJEA 1TTNA 3A4SC 1WRIA 1RLFA 3UF8A 2BTEA 3BK1A 4MM3A 1EU3A 4LNKA 2K22A 1HA5A 2BYTA 2R2OA 3Q3MC 4GOCA 1OEYA 3C8YA 1P7FA 2ZJDA 2J52A 1QKZA 1LXDA 2BYEA 3DCGA 3ZJUA 1TJEA 5AUKA 3T3OA 3FAHA 4WWOA 4HKQA 2QCZA 4AJWA 3MP9A 3ZNID 4GDLA 2N9KA 2IY0B 2QMTA 4YXDB 3DBRB 3V3XA 2KWCA 2KX0A 4Q2JA 1UWXA 4NAMA 1FNWA 2RGFA 1UBIA 3W5VB 1FNUA 2KNBA 3PHWB 4MGIE 2WXJA 1PYWD 3ZJTA 3N9YC 4B0MA 3AB5A 3ZUNA 3B08A 3LXFA 3H8HA 3NY5A 4EOYA 3AE4B 2CJOA 1L2NA 1N5WA 3NVVA 3DVGY 3DPDA 4HDQA 4FLHA 1NYRA 4XE0A 2X38A 4A9AA 2REXA 2FCQA 1YIWA 3KLSX 2IO1B 4CYEA 1RYJA 4HK2A 1GUAB 4ANUA 3BVGA 4FJZA 2NCNA 4LNOA 3ZQ4A 2NR2A 3I9V1 4XDCA 3M3JA 4REZA 3U8ZA 2D11A 5EDSA 1N60A 1C79A 3U30A 4IM2A 1B1ZA 1FMAD 1C1YB 1NDDA 1T6BX 4PT5A 3ZYYX 3VRAB 4IC7B 1E8XA 3ETRA 1V5TA 1TY0A 2MBBB 3BYTB 1IPGA 1MJDA 5G5GA 1N62A 1I4PA 2RR9A 4W9GA 2K0PA 2EELA 2KOXA 1H8CA 2K8BA 2RPQA 4P1BC 2Y5PA 3DBLI 3PRZA 2KWVB 4LK0M 2EMTA 1JWBD 4WJQA 5G2NA 1E8ZA 1WSPA 2IDYA 1QOGA 1U4AA 2WS3B 5KHOA 4PYUA 3H1UA 3DBLB 2WU5B 1JMLA 5IOIA 1V5OA 3W9CB 2NBVB 1FRRA 2N7DA 4KGSA 5FR3A 1GAQB 4KGTA 2KC1A 1JWMD 3JSVA 2W82A 2HDEA 1UNSA 3CMMB 4AUQC 4USAA 1FIQA 2O6VB 1ZXHA 5JH5C 1FO4A 1K50A 2H89B 2LUMA 2WLBA 1R4MB 1E90A 1HTOA 5H8YE 5E6OA 3NG0A 1GC6A 3U7ZA 2RSUA 4C7YA 4FA6A 1ET6A 1MVKA 3OG5A 1E7PB 2KMAA 4ZRKA 4W9DA 4R3DA 3AECB 1ZDVA 4KX6B 3U2SC 4BKGA 1GB1A 2N9PC 1WXQA 3NOBA 4MH8A 2KVZA 3CWIA 2O2VA 3AEBB 1EO6A 1YX6B 4JIOU 1XCTL 3EFCA 2KMCA 1N63A 1YQ3B 4OZAA 2LGXA 4MGZE 4PS8A 4BKSA 2ZNVC 2G9HD 3PRPB 1VLBA 2TSSA 3L0WB 1PGAA 2L76A 2KJ6A 3VVWB 2MBQA 3NS8A 1BMLC 1L7YA 2KDMA 2FAZA 3KWVA 2WXQA 3W1SC 1I4RA 1TY2A 4J3OD 1YD8U 1B9RA 3Q14C 4G0NB 5LXIB 3P4PB 2MQJA 3EGRA 2A4ZA 1LFDA 4DDGD 1V97A 1A5RA 4MDKE 1FXAA 1YMHE 4II3B 1NI3A 3ABVB 3QIJA 2MHJA 3N32A 2I38A 5LNK1 1J19A 3N1YC 4HCNB 3SD5A 3RYTA 2LXCA 1EF5A 1WJNA 4M00A 4HJGE 5EE0A 3VTUA 1L0VB 1EWCA 3ZDMC 2LVQA 3GB1A 2LVOA 2DHZA 1RFKA 1WXAA 3QA8A 2K6QA 4KIKA 2KQ4X 2N9EB 4FADA 2KO3A 2EKIA 3SU8X 5CHWA 4WWPA 2WXOA 2GBNA 1T0SC 1D3ZA 2CHWA 1JCKB 4O1NA 3J9CA 4ITKA 3EFUA 2K5PA 1SIFA 3ZXVA 1VJKA 2M56B 4S0RA 1QILA 2Z0DB 4DXFA 1E7VA 4GN1A 1XCQL 2HTHA 4FN2A 4MJSB 1CZPA 4N6EB 3PZ8A 2WXKA 1JWSD 3VDZA 4OW0A 3JSVB 3JW0X 4C00A 4BKTA 3GOEA 4WURA 3CSTA 3HIZA 1PGBA 1WWTA 4WWNA 3LJ3A 1UUPA 2KD0A 4DXAB 3UGBB 4KKIA 2DYMA 2QJLA 4DXGA 3B0AA 1CK1A 2N1VA 1WFYA 2PW9A 4MGKE 1R4NI 5JXVA 2D2QA 1C4CA 2FIFA 1WR6E 4DHZB 1HQRD 3K9OB 2Q5WD 3ZJVA 5D3DA 4WIPA 4ASWC 1F2RI 2WGSA 3R2TA 3ZRFA 1KLUD 3AM9A 3DHIC 1Q0WB 2YVCA 3BWUD 1WGDA 3L16A 1I4QA 1TKGA 4N58A 1D5XC 1V1PB 4MSMB 2DAFA 3IBEA 2KACA 2Y5CA 4HEA1 4ZHOA 2IO3B 1KFYB 1CMXB 2LRUA 1XLQA 5BYSA 4HWIB 2L8JA 3NZUA 4A8XC 1SIJA 3VAWA 1K51A 4DQOC 4I6PA 1WZ0A 1Y8RC 4B6WA 3RZWC 1FRDA 5EE1A 4LNIA 3DBRI 2D10A 3W2DA 2OEDA 1MHXA 2KQSA 2QDFA 2OHFA 2Y5BB 2R2QA 3AXCA 5E6JA 1HTQA 5AZGA 1SBBB 2CU3A 2ONQA 1TT5B 1HZ5A 3PO0A 1YQ4B 2K8CA 5IP4D 3KVFB 3NZSA 1TS3A 3NJTA 2L1AA 2JYTA 2DX5B 2LI5A 4HVBA 2J7QB 2JXTA 2BF8B 3HHMA 4XC2A 2IPKD 2FE8A 2KYWA 3AEDB 4F1SA 4W9JA 2IO0B 2LRWA 5HI1A 5BMIA 3EA6A 4IG7B 2LWPA 3AEFB 4G11A 5BO4B 5AZHA 3P63A 1DOYA 1L6VA 4LNFA 3PHXB 2BQQA 1L5PA 2I1JA 4PYZA 3VTWA 1C4PA 2W55A 1I4HA 4HXDA 2RPVA 1SE2A 1EU4A 1WE7A 3KYCD 3PLVA 4GMVA 1YJIA 2Z59B 2C60A 1F1HA 1CQVA 4EZKA 2L32A 4DHJD 3KUCB 2AQ3B 2KDBA 2WP9B 2LEKA 1QLBB 2ZPYA 4BKSD 4GU2A 4PS7A 4K3CA 2SEBD 3CSFA 1Z2MA 4MSQB 2BS2B 2FUHB 3QARA 3BYYB 3NRZA 4FULA 4BVUC 2AQ2B 3I57A 3M62B 5IA7A 1HEZE 2GBKA 2MX2A 3CF6E 3IG3A 4NJ6A 2K9XA 5EE9A 4IM0A 2ASQA 4UDUC 4CO7A 3LYYA 4W9IA 4MT5A 1UBQA 4C4VA 1RAXA 3L4PA 2M0AA 1YOVB 3Q3OC 1FEHA 2J0KA 4TQ1A 4E74A 3C0RB 4KDLB 1R7SA 1V1PA 1WH3A 3ZW3A 4NQLB 1GNUA 3WIMA 1RFAA 3ZKJC 3RULA 3ALBA 1GB4A 3PSEB 2XBBC 3RNAC 2JX5A 5D94A 2V9HA 3RN9C 1AW7A 5CHFA 4XWWA 2KN4A 5D7GA 1UF0A 3OAWA 3APCA 3H9DA 3RMKC 4KDIC 1XLNA 1TIFA 3PZDA 2KLGA 2NS5A 3RPFC 2KN5A 1LO5D 1VZ6A 3ZLZA 1D4BA 3NS1A 1GG3A 1TS4A 3SHQA 1TS5A 3AE3B 1XO3A 3I63C 3ZIMA 4K7SA 5HG2A 3AE6B 3HVDA 4NZLB 1QOAA 3BVZA 3SDLC 5AUIA 4RF1A 3B9JA 4RCOA 1PDXA 3W1YA 1YJ1A 1OQYA 2PPHA 4JWUC 4YTPB 4A55A 3ZO5B 2KFKB 3Q3FA 2ZEQA 1ZOYB 3H7PA 1XT9B 2W3SA 2MP2A 2YLMA 2XK5A 1C76A 2JUOA 1ZUD2 3Q8CA 1FXIA 3B2FA 4N9F4 1FM0D 4EZJA 3FILA 5DCNA 1PGXA 4M0WA 3P42A 1FXTB 1A70A 3NVYA 3NUHB 3ZTDA 1QOBA 4YL8A 1OGWA 1R4MI 4MH0E 2M19A 2GBMA 4ZRQA 2BPSA 5D3IB 3MC0B 3U52E 2KC2A 3WALA 1GJZA 1E0ZA 3QX1A 4DHJB 4RGTA 3A9KB 4YSXB 4BFRA 4TMAB 4HPMB 1ZW7A 5BYRA 3UINB 3VHTC 4K7UA 3ZRCA 4FXCA 1T3QA 5FKAC 4MELA 3KQ4A 2V3NA 2C7NB 3U4EG 4TKNA 2G4SA 3V05A 2QHOA 2AX5A 3UIPB 4I6NB 3V6CB 3N30A 3WAMA 2WQYB 3SFDB 3AN1A 3KH0A 2CR5A 2JWUA 4JL9A 1WMHA 3A9KA 1P1AA 2L00B 2XNAC 3GE8C 2KJHB 2D3GA 4BZAA 2MW5A 4LDTD 4XWTA 2KAJA 1SXTA 4ZDVA 1WRDB 3EC8A 1C9FA 5IAAC 3ML9A 3VUWA 5CHVC 1Z5SB 2G1EA 1TKEA 4WQMA 2KHWB 4US9A 5IN7A 3AU5A 3QAQA 4GDLB 2UWQA 2DZJA 2L0FA 4BBNF 2WWZA 3RD2A 2BB6A 3NVZA 1PFDA 2MBEA 2LFIA 1MPEA 3LB8C 1EF1A 2DLBA 3APFA 1FFVA 2KKCA 1E6EB 3R2IA 4RM8A 3ML8A 1MHHE 3TEZA 1FPYA 1WGYA 1L0XB 4LJPB 2XEWA 1WYGA 1C3TA 4M8NA 1J7AA 2IBIB 2N7EA 3QHTA 4ANVA 1K52A 4W9LA 4ANWA 1ZE3D 3QWZB 3DVNV 2KQ7A 3FILB 2HTME 2IGHA 2KFJA 2YEPB 4US8A 4YWGG 1UGMA 4ARIA 3FC4A 1P3QU 2D3CA 1D6EC 2KDEB 4RMAA 4M8MA 3IHPC 2DZIA 5AEKB 2MP2B 3M95A 2BW2A 4A3PA 3NZ3A 2WXMA 3HVZA 2WDQB 2A5UA 2KFKA 1JQ4A 3IT6B 3PV1A 1ZXIA 2MJ3A 1EM7A 1WJUA 4IW0A 3B1LX 2PLPA 1OEYJ 1I7HA 1NYQA 2LGDA 4WH4A 3AE1B 2WHIA 4FJVB 4DWFA 4WAAA 2BB5A 1N61A 1NEKB 3SFEB 2MWSB 3ZGZA 1VCBA 3P4RB 4KZCA 1R4NB 2KDFB 2J4XA 2XK5B 4EFOA 2RDHA 1WMHB 2FUG1 1QQRA 4B95A 3PGEA
chains in the Genus database with same CATH topology
1SE9A 2JT4B 4I6PA 4M0WB 1QZEA 1WZ0A 1Y8RC 4GIVA 4TV3A 4K7WA 4B6WA 3RZWC 3A1QB 2JF5A 4FHJA 1AARA 5GMVA 3VH3B 1UELA 1YX5B 2LGYA 2N4FA 3DBRI 2M17A 2D10A 1V81A 2JZ3B 2KQSA 2DAJA 3VUYA 1TTNA 2Y5BB 2R2QA 3AXCA 3A4SC 2V4LA 1RLFA 2K6DB 2KDIA 3NHEB 3UF8A 3PRMB 1V2YA 5AZGA 2ZCBA 4MM3A 4MJSA 2L3ZA 2O6VD 3L13A 3AULA 2NPTA 2K8CA 5CX3A 2R2OA 2CHZA 2EKEC 4JLCA 4GOCA 3KVFB 1J0GA 3TL5A 3NZSA 1OEYA 2M4NA 2GBJA 1X1MA 2Z0EB 2ZJDA 3A33B 3KW5B 1LXDA 2BYEA 3DCGA 4IM3A 4URKA 2GMIC 2DX5B 1WX7A 4WWOA 1WX9A 2LI5A 3L54A 4HVBA 4AJWA 4CHKA 2J7QB 3ZNID 2ZZPB 3DBSA 4W9EA 4GDLA 2KTRB 2BF8B 3DQVA 3HHMA 2IY0B 4HCPB 4XC2A 4F1SA 4GB9A 4W9JA 2IO0B 2LRWA 3VH4B 4A20A 3TMPB 2KWCA 4LJOB 4IG7B 2KX0A 2O2VB 2OOBB 2LWPA 5DPTA 1SGHA 3APDA 2RGFA 2W9NA 4G11A 1UBIA 5BO4B 5AZHA 3V62A 2KNBA 3PHWB 4MGIE 3TJPA 3BY4B 1E8YA 2MRPA 4E3CA 1VD2A 2KLCA 4PS3A 3ZUNA 2JXXA 1KJTA 3B08A 5E6NA 2JZZA 2K1FA 1MG8A 3NY5A 3PHXB 4AP4C 4EOYA 5FR6A 3HM3A 1L2NA 2I1JA 1NI2A 4PYZA 4W9FA 4FBJB 3DVGY 3DPDA 3VTWA 1LM8B 4HDQA 1IP9A 4HXDA 4FLHA 1WE7A 2PJHA 3KYCD 3PLVA 4GMVA 1S1QB 4I6LB 3X23A 2Z59B 2C60A 1RRBA 2JWZA 2REXA 2FCQA 4K81A 4EZKA 3EHVA 1YIWA 2C9WB 4DHJD 2B3AA 3KUCB 4E71A 2K25A 4LCDE 2IO1B 2BKRB 2KDBA 4A3OA 4CYEA 2KK8A 2KTFA 4HK2A 2IO2B 1GUAB 4ANUA 2ZPYA 1XQQA 4BKSD 4GU2A 4PS7A 4FJZA 2NCNA 3MJWA 2KTRA 3CSFA 2LXAA 4NAWA 1EUVB 1Z2MA 3ZVVA 2FUHB 3QARA 4MSQB 4FHKA 3PT2B 2NR2A 2K39A 1TBEA 3M3JA 3U8ZA 2D11A 4FULA 2C7MB 2NVUI 1E7UA 4BVUC 5L95C 2NBWB 2FCMA 2M0XA 4HLEA 5EDSA 1HE8A 2NBUA 3M62B 5IA7A 3U30A 5DPSA 2GBKA 2MX2A 3CF6E 3IG3A 4NJ6A 1WF9A 4IM2A 4RM9A 4WJPA 4IM0A 5C1ZA 2ASQA 4CO7A 1C1YB 1NDDA 4GDKB 1T0YA 4W9IA 1UBQA 4TUUA 4IWQA 2ZPNA 2MCNB 1I42A 2J0MA 1E8XA 1RAXA 1V5TA 1WJ4A 2MBBB 4IC7B 3ONSA 3DBHI 2L7RA 2O6VA 2HE7A 1K8RB 4P7IA 4GXBA 2DYBA 1IPGA 4HPLB 2J0KA 4NQKE 4TQ1A 4W9KA 3C0RB 4KDLB 4E74A 4KIKB 3UQAA 1WH3A 3ZW3A 2RR9A 3KUDB 4NQLB 1GNUA 3JYUA 4W9GA 2KOXA 3WIMA 1RFAA 1H8CA 2K8BA 3ZKJC 1ZGUB 3RULA 2RPQA 3ALBA 3VTVA 2LJ5A 1GC7A 3PSEB 3DBLI 1Q5WB 3PRZA 2KWVB 2XBBC 1KOTA 4KVGB 2EMTA 5D94A 1Q1OA 4WJQA 5G2NA 5CHFA 1E8ZA 3L10B 5D7GA 1U4AA 3OAWA 5KHOA 4IWOA 3APCA 3H9DA 4KSLC 4PYUA 4AJYB 4KDIC 3H1UA 3QK0A 4HJKA 3PZDA 3H7SA 3UQBA 2IZVB 2KLGA 1IYFA 4JQWC 1V5OA 2NS5A 2K8HA 2NBVB 1V6EA 1H4RA 4FJYA 1WE6A 3Q3JA 2JY6A 2KN5A 2N7DA 2LZ6A 2DZKA 3M63B 2KC1A 3JSVA 2BWFA 3ZLZA 1NBFC 1GG3A 3HM6X 5CTRC 3SHQA 1P98A 4AOFA 5L83A 3ZIMA 3P2BA 4K7SA 1E5WA 3CMMB 3PVLA 2JRHA 4G50A 4AUQC 3ZNZB 4WJOA 5G55A 1JRUA 3R7RA 3SDLC 2O6VB 2ZNVB 3AI5A 2ZVNA 4B9KA 1WXVA 1TGZB 5JH5C 3L08A 3W1YA 1YJ1A 1OQYA 2PPHA 1KLVA 3ZO5B 2G45B 2KFKB 3Q3FA 1E90A 2ZEQA 3PLUA 3DDCB 2C7HA 2L05A 5E6OA 1KM7A 1GC6A 3H7PA 2LVPA 1XT9B 2RSUA 5C23A 2MP2A 2YLMA 3TCAA 3VXWA 3TBLD 4FA6A 1E8WA 2M1MA 2KMAA 2BGFA 4ZRKA 2XK5A 4W9DA 2JUOA 2CHXA 3GZNI 1OTRB 3IVFA 2FIDA 2N9PC 4BKGA 2BYVE 3NOBA 1UH6A 4N9F4 4EZJA 5DCNA 1ISNA 4II2B 2JVCA 2O2VA 1WM3A 1EO6A 1YX6B 3AU4A 3ZNGC 2VRRB 4JIOU 4DHZE 1FXTB 3ENEA 2BWES 4EEWA 2KVRA 2KMCA 1I35A 2DENB 3ZTDA 2ZCCA 3MHSD 4EZLA 5J2RA 2LGXA 3LDZE 2PE6B 4YL8A 3X0WA 1OGWA 4MGZE 4PS8A 1PQSA 1R4MI 2ZNVC 4MH0E 3PRPB 3PS6A 4BKSA 2WX1A 2GBMA 2BPSA 3WAOA 3TIXA 3L0WB 3PREA 2KC2A 4BOSC 3WALA 2L76A 1GJZA 5LLIA 2KJ6A 3QX1A 2MBQA 3VVWB 4NY0A 4BBNC 3NS8A 2FNJB 4DHJB 2AEHA 2G3QB 1L7YA 4NJ7A 4XX5A 3PPAA 3A9KB 2FAZA 3W1SA 3H6NA 1WGHA 1S3SG 4BFRA 3W1SC 4HPMB 1ZW7A 1TZ1A 2KXJA 3UINB 2HJ8A 3VHTC 4K7UA 4OVVA 3ZRCA 1YD8U 2AL3A 4MELA 4KZ0A 2D07B 4G0NB 5LXIB 2MQJA 2C7NB 1WYWB 2RD0A 4W9HA 2A4ZA 1LFDA 3U7DA 3V6EB 4DDGD 1A5RA 3DVGX 4KSKC 4MDKE 4TKNA 2G4SA 1V49A 4II3B 2QHOA 4ZDVA 3UIPB 4I6NB 4J6IA 3PTFC 3RZFA 4ZRIA 2AL6A 2LUEA 3QIJA 5AZFA 4EUTA 1G6JA 3V6CB 3N30A 3N32A 4GDKA 3WAMA 1J19A 4HCNB 3KH0A 3SD5A 2CR5A 3A9JB 2LASA 2MBOA 3RYTA 4JL9A 3WANA 2MSED 2LXCA 2AWTA 1EF5A 1WJNA 1WMHA 3R66C 4F7ZA 3A9KA 3ZTCA 1P0RA 1WGGA 3A4RA 1P1AA 3VTUA 1WI0A 2L00B 3ZDMC 2KJHB 2LVQA 2D3GA 1WXSA 1UZXB 2GBRA 2GOWA 2MLBA 2MW5A 2LVOA 4LDTD 4MEMA 3RT3B 4ANVA 2DHZA 1WRDB 2OJRA 2C5LC 3EC8A 3K9PB 4OVUA 5IAAC 4JGHB 5E6PA 2I1KA 1WXAA 3QA8A 5J18A 2K6QA 2ZVOA 3ML9A 4KIKA 4LDTB 2MA9B 3VUWA 1M94A 2N9EB 1WM2A 5CHVC 4FADA 2KO3A 1Z5SB 4GGQA 5JHAA 3SU8X 4X57B 5CHWA 2KHWB 4MGYE 3QQ8B 2IYDB 2N9XA 4WWPA 3AU5A 2FCSA 3EECA 3RCZA 3QAQA 3WAPA 1WX8A 2KZRA 4GDLB 2UWQA 4ICUA 4DDID 2DZJA 2L0FA 3O65B 2CU1A 3VQIA 2JRIB 2GBNA 4BBNF 3HK0A 2WWZA 1V86A 3RD2A 4WJNA 1D3ZA 2CHWA 3D32A 4AWJA 2MBEA 3DVNU 1EF1A 5DPWA 3EFUA 3T9LA 3IFWB 3APFA 4NPNA 2WDTB 2KANA 1SIFA 2KKCA 1WXMA 4RM8A 3ML8A 5D2MB 4GSWA 3ZNHB 1UD7A 2Z0DB 1WGYA 4BOZB 1E7VA 2JPHA 3DOWA 4GN1A 4NAWB 5KHQA 1BT0A 4ZRJA 2HTHA 3V61A 1P9DU 3OJ4B 2UYZB 1LQBA 2V1YA 4FN2A 4LJPB 4MJSB 2XEWA 4DK5A 5LXHA 1C3TA 2EMSA 2WYQA 4M8NA 3VDZA 1WY8A 3JSVB 3JW0X 4BKTA 1YQBA 2IBIB 2N7EA 3QHTA 4G3XB 4NNJB 3GOEA 1WIAA 4WQOB 3CSTA 2CKHB 3VUXA 4EKUA 5HKHA 2KWUB 4W9LA 4ANWA 3QWZB 3DVNV 3HIZA 2KQ7A 4WWNA 3V60A 5JHBA 2KFJA 3ECIA 3LJ3A 4W9CA 3T8MA 2KD0A 2WX0A 4DXAB 3UGBB 1UGMA 2DYOA 2DYMA 2PE9A 2DZMA 5JZEB 1P3QU 4ANXA 2KDEB 3OJ3A 4RMAA 3A1QA 3ZDTA 3I3TB 4M8MA 4B95A 3IHPC 3B0AA 3H7PB 1V9JA 2DZIA 2N1VA 3L17A 5AEKB 4TQ0A 2MP2B 1WFYA 3M95A 4MGKE 3VFKA 1R4NI 4KV2A 2L0TA 4A3PA 3OLMD 5D6JB 3MTNB 2LD9A 2D2QA 2A5UA 2KFKA 3QJZA 4F8CB 3PV1A 2FIFA 1WR6E 4DHZB 2AYOB 3KYDD 1ZKHA 2NPTB 1WJUA 2KX3A 4IW0A 3UIOB 3K9OB 3B1LX 3QCAA 2HD5B 1WJ6A 1OEYJ 4ASWC 2LGDA 3JVZX 3ZRFA 1J8CA 3RUIB 1XD3B 1Q0WB 3BINA 1WR1A 4FJVB 4DWFA 1V80A 2G4DB 2MBHA 2YVCA 1WGDA 4ZYNA 3L16A 3R3MA 4K1RB 4WAAA 4IWPA 4MSMB 2KJRA 2DAFA 4XZ4A 1F9JA 3R7QA 3IBEA 3S2AA 2MWSB 1VCBA 4DBGA 2FCNA 2BYFA 3N3KB 5DPRA 1WGRA 3KUZA 4KZCA 2IO3B 2KDFB 2LRUA 1CMXB 2M8SA 2XK5B 3WA0A 2BKFA 2IY1B 4EFOA 2PEAA 4HDOA 1WMHB 2J0JA 4IUMB 4HWIB 2CS4A 4ICVA 5TR5A 2L8JA 1WZ3A 3NZUA 3QC8B 2V3SA 2N1WA 3VAWA 5J17A 3A9JA 3PGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE9 A;  2JT4 B;  4I6P A;  4M0W B;  1QZE A;  1WZ0 A;  1Y8R C;  4GIV A;  4TV3 A;  4K7W A;  4B6W A;  3RZW C;  3A1Q B;  2JF5 A;  4FHJ A;  1AAR A;  5GMV A;  3VH3 B;  1UEL A;  1YX5 B;  2LGY A;  2N4F A;  3DBR I;  2M17 A;  2D10 A;  1V81 A;  2JZ3 B;  2KQS A;  2DAJ A;  3VUY A;  1TTN A;  2Y5B B;  2R2Q A;  3AXC A;  3A4S C;  2V4L A;  1RLF A;  2K6D B;  2KDI A;  3NHE B;  3UF8 A;  3PRM B;  1V2Y A;  5AZG A;  2ZCB A;  4MM3 A;  4MJS A;  2L3Z A;  2O6V D;  3L13 A;  3AUL A;  2NPT A;  2K8C A;  5CX3 A;  2R2O A;  2CHZ A;  2EKE C;  4JLC A;  4GOC A;  3KVF B;  1J0G A;  3TL5 A;  3NZS A;  1OEY A;  2M4N A;  2GBJ A;  1X1M A;  2Z0E B;  2ZJD A;  3A33 B;  3KW5 B;  1LXD A;  2BYE A;  3DCG A;  4IM3 A;  4URK A;  2GMI C;  2DX5 B;  1WX7 A;  4WWO A;  1WX9 A;  2LI5 A;  3L54 A;  4HVB A;  4AJW A;  4CHK A;  2J7Q B;  3ZNI D;  2ZZP B;  3DBS A;  4W9E A;  4GDL A;  2KTR B;  2BF8 B;  3DQV A;  3HHM A;  2IY0 B;  4HCP B;  4XC2 A;  4F1S A;  4GB9 A;  4W9J A;  2IO0 B;  2LRW A;  3VH4 B;  4A20 A;  3TMP B;  2KWC A;  4LJO B;  4IG7 B;  2KX0 A;  2O2V B;  2OOB B;  2LWP A;  5DPT A;  1SGH A;  3APD A;  2RGF A;  2W9N A;  4G11 A;  1UBI A;  5BO4 B;  5AZH A;  3V62 A;  2KNB A;  3PHW B;  4MGI E;  3TJP A;  3BY4 B;  1E8Y A;  2MRP A;  4E3C A;  1VD2 A;  2KLC A;  4PS3 A;  3ZUN A;  2JXX A;  1KJT A;  3B08 A;  5E6N A;  2JZZ A;  2K1F A;  1MG8 A;  3NY5 A;  3PHX B;  4AP4 C;  4EOY A;  5FR6 A;  3HM3 A;  1L2N A;  2I1J A;  1NI2 A;  4PYZ A;  4W9F A;  4FBJ B;  3DVG Y;  3DPD A;  3VTW A;  1LM8 B;  4HDQ A;  1IP9 A;  4HXD A;  4FLH A;  1WE7 A;  2PJH A;  3KYC D;  3PLV A;  4GMV A;  1S1Q B;  4I6L B;  3X23 A;  2Z59 B;  2C60 A;  1RRB A;  2JWZ A;  2REX A;  2FCQ A;  4K81 A;  4EZK A;  3EHV A;  1YIW A;  2C9W B;  4DHJ D;  2B3A A;  3KUC B;  4E71 A;  2K25 A;  4LCD E;  2IO1 B;  2BKR B;  2KDB A;  4A3O A;  4CYE A;  2KK8 A;  2KTF A;  4HK2 A;  2IO2 B;  1GUA B;  4ANU A;  2ZPY A;  1XQQ A;  4BKS D;  4GU2 A;  4PS7 A;  4FJZ A;  2NCN A;  3MJW A;  2KTR A;  3CSF A;  2LXA A;  4NAW A;  1EUV B;  1Z2M A;  3ZVV A;  2FUH B;  3QAR A;  4MSQ B;  4FHK A;  3PT2 B;  2NR2 A;  2K39 A;  1TBE A;  3M3J A;  3U8Z A;  2D11 A;  4FUL A;  2C7M B;  2NVU I;  1E7U A;  4BVU C;  5L95 C;  2NBW B;  2FCM A;  2M0X A;  4HLE A;  5EDS A;  1HE8 A;  2NBU A;  3M62 B;  5IA7 A;  3U30 A;  5DPS A;  2GBK A;  2MX2 A;  3CF6 E;  3IG3 A;  4NJ6 A;  1WF9 A;  4IM2 A;  4RM9 A;  4WJP A;  4IM0 A;  5C1Z A;  2ASQ A;  4CO7 A;  1C1Y B;  1NDD A;  4GDK B;  1T0Y A;  4W9I A;  1UBQ A;  4TUU A;  4IWQ A;  2ZPN A;  2MCN B;  1I42 A;  2J0M A;  1E8X A;  1RAX A;  1V5T A;  1WJ4 A;  2MBB B;  4IC7 B;  3ONS A;  3DBH I;  2L7R A;  2O6V A;  2HE7 A;  1K8R B;  4P7I A;  4GXB A;  2DYB A;  1IPG A;  4HPL B;  2J0K A;  4NQK E;  4TQ1 A;  4W9K A;  3C0R B;  4KDL B;  4E74 A;  4KIK B;  3UQA A;  1WH3 A;  3ZW3 A;  2RR9 A;  3KUD B;  4NQL B;  1GNU A;  3JYU A;  4W9G A;  2KOX A;  3WIM A;  1RFA A;  1H8C A;  2K8B A;  3ZKJ C;  1ZGU B;  3RUL A;  2RPQ A;  3ALB A;  3VTV A;  2LJ5 A;  1GC7 A;  3PSE B;  3DBL I;  1Q5W B;  3PRZ A;  2KWV B;  2XBB C;  1KOT A;  4KVG B;  2EMT A;  5D94 A;  1Q1O A;  4WJQ A;  5G2N A;  5CHF A;  1E8Z A;  3L10 B;  5D7G A;  1U4A A;  3OAW A;  5KHO A;  4IWO A;  3APC A;  3H9D A;  4KSL C;  4PYU A;  4AJY B;  4KDI C;  3H1U A;  3QK0 A;  4HJK A;  3PZD A;  3H7S A;  3UQB A;  2IZV B;  2KLG A;  1IYF A;  4JQW C;  1V5O A;  2NS5 A;  2K8H A;  2NBV B;  1V6E A;  1H4R A;  4FJY A;  1WE6 A;  3Q3J A;  2JY6 A;  2KN5 A;  2N7D A;  2LZ6 A;  2DZK A;  3M63 B;  2KC1 A;  3JSV A;  2BWF A;  3ZLZ A;  1NBF C;  1GG3 A;  3HM6 X;  5CTR C;  3SHQ A;  1P98 A;  4AOF A;  5L83 A;  3ZIM A;  3P2B A;  4K7S A;  1E5W A;  3CMM B;  3PVL A;  2JRH A;  4G50 A;  4AUQ C;  3ZNZ B;  4WJO A;  5G55 A;  1JRU A;  3R7R A;  3SDL C;  2O6V B;  2ZNV B;  3AI5 A;  2ZVN A;  4B9K A;  1WXV A;  1TGZ B;  5JH5 C;  3L08 A;  3W1Y A;  1YJ1 A;  1OQY A;  2PPH A;  1KLV A;  3ZO5 B;  2G45 B;  2KFK B;  3Q3F A;  1E90 A;  2ZEQ A;  3PLU A;  3DDC B;  2C7H A;  2L05 A;  5E6O A;  1KM7 A;  1GC6 A;  3H7P A;  2LVP A;  1XT9 B;  2RSU A;  5C23 A;  2MP2 A;  2YLM A;  3TCA A;  3VXW A;  3TBL D;  4FA6 A;  1E8W A;  2M1M A;  2KMA A;  2BGF A;  4ZRK A;  2XK5 A;  4W9D A;  2JUO A;  2CHX A;  3GZN I;  1OTR B;  3IVF A;  2FID A;  2N9P C;  4BKG A;  2BYV E;  3NOB A;  1UH6 A;  4N9F 4;  4EZJ A;  5DCN A;  1ISN A;  4II2 B;  2JVC A;  2O2V A;  1WM3 A;  1EO6 A;  1YX6 B;  3AU4 A;  3ZNG C;  2VRR B;  4JIO U;  4DHZ E;  1FXT B;  3ENE A;  2BWE S;  4EEW A;  2KVR A;  2KMC A;  1I35 A;  2DEN B;  3ZTD A;  2ZCC A;  3MHS D;  4EZL A;  5J2R A;  2LGX A;  3LDZ E;  2PE6 B;  4YL8 A;  3X0W A;  1OGW A;  4MGZ E;  4PS8 A;  1PQS A;  1R4M I;  2ZNV C;  4MH0 E;  3PRP B;  3PS6 A;  4BKS A;  2WX1 A;  2GBM A;  2BPS A;  3WAO A;  3TIX A;  3L0W B;  3PRE A;  2KC2 A;  4BOS C;  3WAL A;  2L76 A;  1GJZ A;  5LLI A;  2KJ6 A;  3QX1 A;  2MBQ A;  3VVW B;  4NY0 A;  4BBN C;  3NS8 A;  2FNJ B;  4DHJ B;  2AEH A;  2G3Q B;  1L7Y A;  4NJ7 A;  4XX5 A;  3PPA A;  3A9K B;  2FAZ A;  3W1S A;  3H6N A;  1WGH A;  1S3S G;  4BFR A;  3W1S C;  4HPM B;  1ZW7 A;  1TZ1 A;  2KXJ A;  3UIN B;  2HJ8 A;  3VHT C;  4K7U A;  4OVV A;  3ZRC A;  1YD8 U;  2AL3 A;  4MEL A;  4KZ0 A;  2D07 B;  4G0N B;  5LXI B;  2MQJ A;  2C7N B;  1WYW B;  2RD0 A;  4W9H A;  2A4Z A;  1LFD A;  3U7D A;  3V6E B;  4DDG D;  1A5R A;  3DVG X;  4KSK C;  4MDK E;  4TKN A;  2G4S A;  1V49 A;  4II3 B;  2QHO A;  4ZDV A;  3UIP B;  4I6N B;  4J6I A;  3PTF C;  3RZF A;  4ZRI A;  2AL6 A;  2LUE A;  3QIJ A;  5AZF A;  4EUT A;  1G6J A;  3V6C B;  3N30 A;  3N32 A;  4GDK A;  3WAM A;  1J19 A;  4HCN B;  3KH0 A;  3SD5 A;  2CR5 A;  3A9J B;  2LAS A;  2MBO A;  3RYT A;  4JL9 A;  3WAN A;  2MSE D;  2LXC A;  2AWT A;  1EF5 A;  1WJN A;  1WMH A;  3R66 C;  4F7Z A;  3A9K A;  3ZTC A;  1P0R A;  1WGG A;  3A4R A;  1P1A A;  3VTU A;  1WI0 A;  2L00 B;  3ZDM C;  2KJH B;  2LVQ A;  2D3G A;  1WXS A;  1UZX B;  2GBR A;  2GOW A;  2MLB A;  2MW5 A;  2LVO A;  4LDT D;  4MEM A;  3RT3 B;  4ANV A;  2DHZ A;  1WRD B;  2OJR A;  2C5L C;  3EC8 A;  3K9P B;  4OVU A;  5IAA C;  4JGH B;  5E6P A;  2I1K A;  1WXA A;  3QA8 A;  5J18 A;  2K6Q A;  2ZVO A;  3ML9 A;  4KIK A;  4LDT B;  2MA9 B;  3VUW A;  1M94 A;  2N9E B;  1WM2 A;  5CHV C;  4FAD A;  2KO3 A;  1Z5S B;  4GGQ A;  5JHA A;  3SU8 X;  4X57 B;  5CHW A;  2KHW B;  4MGY E;  3QQ8 B;  2IYD B;  2N9X A;  4WWP A;  3AU5 A;  2FCS A;  3EEC A;  3RCZ A;  3QAQ A;  3WAP A;  1WX8 A;  2KZR A;  4GDL B;  2UWQ A;  4ICU A;  4DDI D;  2DZJ A;  2L0F A;  3O65 B;  2CU1 A;  3VQI A;  2JRI B;  2GBN A;  4BBN F;  3HK0 A;  2WWZ A;  1V86 A;  3RD2 A;  4WJN A;  1D3Z A;  2CHW A;  3D32 A;  4AWJ A;  2MBE A;  3DVN U;  1EF1 A;  5DPW A;  3EFU A;  3T9L A;  3IFW B;  3APF A;  4NPN A;  2WDT B;  2KAN A;  1SIF A;  2KKC A;  1WXM A;  4RM8 A;  3ML8 A;  5D2M B;  4GSW A;  3ZNH B;  1UD7 A;  2Z0D B;  1WGY A;  4BOZ B;  1E7V A;  2JPH A;  3DOW A;  4GN1 A;  4NAW B;  5KHQ A;  1BT0 A;  4ZRJ A;  2HTH A;  3V61 A;  1P9D U;  3OJ4 B;  2UYZ B;  1LQB A;  2V1Y A;  4FN2 A;  4LJP B;  4MJS B;  2XEW A;  4DK5 A;  5LXH A;  1C3T A;  2EMS A;  2WYQ A;  4M8N A;  3VDZ A;  1WY8 A;  3JSV B;  3JW0 X;  4BKT A;  1YQB A;  2IBI B;  2N7E A;  3QHT A;  4G3X B;  4NNJ B;  3GOE A;  1WIA A;  4WQO B;  3CST A;  2CKH B;  3VUX A;  4EKU A;  5HKH A;  2KWU B;  4W9L A;  4ANW A;  3QWZ B;  3DVN V;  3HIZ A;  2KQ7 A;  4WWN A;  3V60 A;  5JHB A;  2KFJ A;  3ECI A;  3LJ3 A;  4W9C A;  3T8M A;  2KD0 A;  2WX0 A;  4DXA B;  3UGB B;  1UGM A;  2DYO A;  2DYM A;  2PE9 A;  2DZM A;  5JZE B;  1P3Q U;  4ANX A;  2KDE B;  3OJ3 A;  4RMA A;  3A1Q A;  3ZDT A;  3I3T B;  4M8M A;  4B95 A;  3IHP C;  3B0A A;  3H7P B;  1V9J A;  2DZI A;  2N1V A;  3L17 A;  5AEK B;  4TQ0 A;  2MP2 B;  1WFY A;  3M95 A;  4MGK E;  3VFK A;  1R4N I;  4KV2 A;  2L0T A;  4A3P A;  3OLM D;  5D6J B;  3MTN B;  2LD9 A;  2D2Q A;  2A5U A;  2KFK A;  3QJZ A;  4F8C B;  3PV1 A;  2FIF A;  1WR6 E;  4DHZ B;  2AYO B;  3KYD D;  1ZKH A;  2NPT B;  1WJU A;  2KX3 A;  4IW0 A;  3UIO B;  3K9O B;  3B1L X;  3QCA A;  2HD5 B;  1WJ6 A;  1OEY J;  4ASW C;  2LGD A;  3JVZ X;  3ZRF A;  1J8C A;  3RUI B;  1XD3 B;  1Q0W B;  3BIN A;  1WR1 A;  4FJV B;  4DWF A;  1V80 A;  2G4D B;  2MBH A;  2YVC A;  1WGD A;  4ZYN A;  3L16 A;  3R3M A;  4K1R B;  4WAA A;  4IWP A;  4MSM B;  2KJR A;  2DAF A;  4XZ4 A;  1F9J A;  3R7Q A;  3IBE A;  3S2A A;  2MWS B;  1VCB A;  4DBG A;  2FCN A;  2BYF A;  3N3K B;  5DPR A;  1WGR A;  3KUZ A;  4KZC A;  2IO3 B;  2KDF B;  2LRU A;  1CMX B;  2M8S A;  2XK5 B;  3WA0 A;  2BKF A;  2IY1 B;  4EFO A;  2PEA A;  4HDO A;  1WMH B;  2J0J A;  4IUM B;  4HWI B;  2CS4 A;  4ICV A;  5TR5 A;  2L8J A;  1WZ3 A;  3NZU A;  3QC8 B;  2V3S A;  2N1W A;  3VAW A;  5J17 A;  3A9J A;  3PGE A; 
#chains in the Genus database with same CATH topology
 1QZE A;  4TV3 A;  4K7W A;  2DWQ A;  3A1Q B;  5C3J B;  2JU6 X;  5GMV A;  3VH3 B;  1C77 A;  1SF0 A;  5T8I A;  2OJW A;  1V81 A;  2DAJ A;  2V4L A;  2K6D B;  2KMM A;  3NVW A;  3Q8F A;  2ZCB A;  2E3T A;  2L52 A;  2L3Z A;  2O6V D;  1IGC A;  3L13 A;  3AUL A;  2NPT A;  4TSS A;  5CX3 A;  4JLC A;  2D3A A;  1F77 A;  1J0G A;  3TL5 A;  1MG4 A;  2Z0E B;  3KW5 B;  2W3R A;  1SJH D;  1KTK A;  4W9E A;  4HRS A;  1XLP A;  3DQV A;  2GI9 A;  4GB9 A;  3VH4 B;  1XXG A;  3TMP B;  4LJO B;  1JWA D;  2O2V B;  1OQR A;  2INP E;  3APD A;  3DHH C;  3V62 A;  1E8Y A;  4ZYS A;  2MRP A;  4E3C A;  3AV8 A;  1F0Z A;  1VD2 A;  2KLC A;  4PS3 A;  1MG8 A;  3AEE B;  5FR6 A;  3HM3 A;  1WGK A;  4W9F A;  1NI2 A;  3AEA B;  1LM8 B;  2PJH A;  4CQN A;  1S1Q B;  4I6L B;  1VZ7 A;  4NJC A;  3X23 A;  3BII D;  2B3A A;  4E71 A;  2VH2 A;  1UGJ A;  2BKR B;  2IO2 B;  4HPP A;  3MJW A;  2KTR A;  2LXA A;  4NAW A;  4KKJ A;  1KF6 B;  2GRI A;  4FHK A;  2BS3 B;  3BZD B;  2C7M B;  4B0E A;  2IGD A;  5C2T B;  2FCM A;  2M0X A;  1SEB D;  1HE8 A;  1DOI A;  3P1M A;  1TS2 A;  3Q6B A;  1WF9 A;  4RM9 A;  5C1Z A;  1L6U A;  1RWS A;  4IWQ A;  2J0M A;  1WJ4 A;  1ZDX A;  1D5Z C;  3DBH I;  2L7R A;  3SEB A;  1K8R B;  4P7I A;  4GXB A;  4HPL B;  4AQ7 A;  4NQK E;  3Q8E A;  4KIK B;  3UQA A;  3KUD B;  3JYU A;  3RNG C;  4S17 A;  4XDD A;  1ZGU B;  2LJ5 A;  1GC7 A;  1Q5W B;  1KOT A;  3UI3 A;  4L1B A;  3L10 B;  2VZK B;  3GZN B;  3RNC C;  3AMZ A;  1VRA B;  1KLG D;  1DGJ A;  4HJK A;  3H7S A;  3UQB A;  2IZV B;  1AYF A;  1SB3 C;  4JQW C;  5TSS A;  1H4R A;  4RGO S;  2Y3A A;  2JY6 A;  2LZ6 A;  4XYC A;  1NBF C;  1C78 A;  4RH6 A;  4QAY A;  3GS2 A;  1SJE D;  2QIE B;  2JRH A;  4G50 A;  1JRU A;  3R7R A;  1TGZ B;  3L08 A;  2G45 B;  3HRD D;  4YSY B;  3PLU A;  4WWM A;  2WXN A;  3DDC B;  3PZ7 A;  2L05 A;  4H2A A;  2LVP A;  3AE9 B;  5C23 A;  3VXW A;  2AQ1 B;  3TBL D;  1E8W A;  2M1M A;  2BGF A;  1K53 A;  2CHX A;  4JE3 B;  1KRH A;  2E6X A;  3N1X C;  1QT9 A;  2LGI A;  2JVC A;  1WM3 A;  2LMC A;  3C19 A;  3AU4 A;  2VZK D;  3ZNG C;  2VRR B;  4DHZ E;  3ENE A;  2BWE S;  3VR9 B;  4EEW A;  1JWU D;  1I35 A;  2ZCC A;  1HZ6 A;  4EZL A;  5J2R A;  3LDZ E;  2PE6 B;  2W54 A;  4JWS C;  1PQS A;  3WAO A;  3EUB 2;  3PRE A;  1QF6 A;  1N5X A;  5LLI A;  4NY0 A;  4XX5 A;  3PPA A;  3W1S A;  3H6N A;  2GLS A;  1FD6 A;  2LJI A;  1TZ1 A;  2KXJ A;  4OVV A;  2AL3 A;  5MPO A;  1TKY A;  2D3B A;  2RD0 A;  4W9H A;  3V6E B;  1FCC C;  4A90 A;  3FKY A;  1ESF A;  4AS1 A;  2AL6 A;  1V8C A;  2LUE A;  3DHG C;  4GDK A;  1TYG B;  3BK2 A;  2J42 A;  1NEN B;  2MBO A;  3WAN A;  2MSE D;  1STE A;  2AWT A;  3ZTC A;  1P0R A;  1WGG A;  2D5G A;  3WCQ A;  1WI0 A;  2ON8 A;  1WXS A;  3RT3 B;  2GBR A;  2WXF A;  2OJR A;  3K9P B;  4OVU A;  4JGH B;  5E6P A;  2I1K A;  2MA9 B;  4GGQ A;  5JHA A;  1IBX B;  4X57 B;  3QQ8 B;  2IYD B;  2N9X A;  2CJN A;  2FCS A;  3EEC A;  3WAP A;  1WX8 A;  4DDI D;  4ICU A;  3B2G A;  2CU1 A;  3HK0 A;  2X8X X;  1V86 A;  4AWJ A;  2MH7 A;  4BAX A;  1ET9 A;  2NTT A;  3T9L A;  3IFW B;  1YN4 A;  3MFG A;  1WXM A;  5D2M B;  4GSW A;  2HJ1 A;  1VDV A;  2JPH A;  4LLG M;  2K3U A;  3MHZ A;  4ZRJ A;  2IND C;  1GPX A;  2V1Y A;  4DK5 A;  5LXH A;  2L83 A;  1WY8 A;  1ZPS A;  1YQB A;  4G3X B;  4NNJ B;  1WIA A;  4WQO B;  1BXT A;  2KWU B;  4YTM B;  3V60 A;  3T8M A;  2WX0 A;  3E56 A;  2DYO A;  2PE9 A;  3ZDT A;  3A1Q A;  3I3T B;  4YSZ B;  3H7P B;  1LGR A;  5GXG B;  1T5X D;  4KV2 A;  1XLO A;  3MTN B;  5FK9 C;  2WU2 B;  4N59 A;  3KYD D;  3MJ5 A;  2KX3 A;  3UIO B;  4ZHP A;  1WJ6 A;  3AE5 B;  4P16 A;  3T3N A;  3RUI B;  1XD3 B;  3P4Q B;  1F2R C;  3R3M A;  1L4D B;  4MAC A;  1SE3 A;  4IWP A;  2KJR A;  3R7Q A;  3S2A A;  1J7B A;  2BYF A;  2MJD A;  1TZO A;  1WGR A;  2MJE A;  2UU7 A;  5I4D A;  2M8S A;  2MEK A;  2PEA A;  1VR9 A;  2J53 A;  4IUM B;  2RMM A;  2CS4 A;  3QC8 B;  2N1W A;  3A9J A;  1IGD A;  2JT4 B;  4GIV A;  2WNM A;  3IAS 1;  2JF5 A;  2R61 A;  4FHJ A;  4RGN A;  1AAR A;  2XN9 C;  3IAM 1;  2M17 A;  1N6Z A;  2RDB C;  3TEW A;  4KGR A;  1T0R C;  3NHE B;  2KDI A;  3PRM B;  1V2Y A;  3Q8A A;  1XF5 L;  4MJS A;  1RM6 C;  3GP7 A;  2PVG C;  4WAF A;  2CHZ A;  2EKE C;  3Q3N C;  3AH7 A;  4JX1 C;  2M4N A;  2GBJ A;  1KH0 A;  1X1M A;  1SSN A;  3A33 B;  4IM3 A;  4URK A;  3TEX A;  2GMI C;  2V0G A;  1WX7 A;  1JAL A;  1WX9 A;  3L54 A;  4CHK A;  1JRP A;  2ZZP B;  3DBS A;  2KTR B;  4RF0 A;  3N20 C;  4HCP B;  3OWE B;  1UWM A;  4A20 A;  4P6V F;  2OOB B;  3GE3 C;  2YEP F;  3MC9 A;  5DPT A;  1SGH A;  4ACF A;  2W9N A;  3R8B A;  3KWL A;  3TJP A;  3BY4 B;  2B76 B;  2JXX A;  1KJT A;  5E6N A;  2JZZ A;  2K1F A;  4AP4 C;  3DBH B;  4ZOH C;  1L0Y B;  4FBJ B;  2DBY A;  5G5H A;  4L23 A;  1IP9 A;  4M02 A;  2WXR A;  1RRB A;  2JWZ A;  4K81 A;  3EHV A;  2C9W B;  2K25 A;  4LCD E;  1AN8 A;  1BUI C;  4A3O A;  4ZRP A;  4YT0 B;  1NVI D;  2KK8 A;  2KTF A;  4P1C C;  1XQQ A;  1EUV B;  3ZVV A;  3PT2 B;  3I5J C;  2K39 A;  1TBE A;  1MI0 A;  2NVU I;  1E7U A;  1YN3 A;  5L95 C;  2NBW B;  4HLE A;  2NBU A;  3AE7 B;  5DPS A;  1DYQ A;  4WJP A;  4LTU A;  4GDK B;  1T0Y A;  4IDI A;  2ZPN A;  4MM3 B;  2MCN B;  1I42 A;  3ONS A;  1IBX A;  2O6V A;  1MFW A;  1SE4 A;  2HE7 A;  4W9K A;  2DYB A;  2WXL A;  1XEE A;  1ACC A;  4JPS A;  3ZXR A;  3VTV A;  4GLS C;  4KVG B;  1Q1O A;  2ICI A;  2PTL A;  4EE2 A;  3O13 A;  5IKC M;  1F52 A;  4IWO A;  4KSL C;  4XGA B;  4AJY B;  1DOX A;  3QK0 A;  3Q2A C;  1M4V A;  2JYE A;  1IYF A;  2INN E;  1ENF A;  2K8H A;  2PKO A;  1V6E A;  4FJY A;  1JW9 D;  1WE6 A;  3Q3J A;  5BMG A;  2DZK A;  3M63 B;  1P7E A;  2WXI A;  3MC8 A;  2BS4 B;  2BWF A;  3RNE C;  3HM6 X;  5CTR C;  1P98 A;  4AOF A;  5L83 A;  2JQR B;  3DWM A;  3P2B A;  4C80 A;  1E5W A;  4OZB A;  3PVL A;  4M01 A;  3ZNZ B;  4WJO A;  5G55 A;  2ZNV B;  3AI5 A;  2ZVN A;  4B9K A;  1WXV A;  1PUT A;  3BVM A;  1KLV A;  2BBC A;  3HUI A;  4YTN B;  2C7H A;  3SR6 A;  1KM7 A;  4PK1 A;  3TCA A;  2LHD A;  2WXP A;  3TUO A;  2WDR B;  3P4S B;  4RFB A;  3VRB B;  2WXH A;  3RNF C;  4LNN A;  3GZN I;  2H88 B;  1OTR B;  3IVF A;  2FID A;  2BYV E;  1E9M A;  5HFY A;  2ZW0 A;  5BMH A;  1ZP0 B;  1UH6 A;  3VR8 B;  1T0Q C;  1ISN A;  4II2 B;  2SAK A;  1Q10 A;  2WDV B;  1OFF A;  1ROE A;  2JZP A;  1QOF A;  2KVR A;  4L2Y A;  2DEN B;  3MHS D;  3X0W A;  2QSD A;  3PS6 A;  3CIR B;  1FNV A;  2WX1 A;  3AE8 B;  3TIX A;  4BOS C;  2N0S B;  4BBN C;  2I2Y A;  2V4I B;  2WXG A;  2FNJ B;  2AEH A;  2G3Q B;  4NJ7 A;  1V1O A;  1WGH A;  1S3S G;  2HJ8 A;  4IKG A;  4KZ0 A;  2D07 B;  3E9S A;  1WYW B;  3U7D A;  3DVG X;  4KSK C;  1V49 A;  1C4A A;  3RZF A;  4J6I A;  3PTF C;  4ZRI A;  4EUT A;  5AZF A;  1G6J A;  2ZW1 A;  4C4V B;  5IO9 A;  3A9J B;  2LAS A;  3RNB C;  3AE2 B;  3R66 C;  3IT4 B;  4F7Z A;  1I4X A;  3A4R A;  1IUE A;  4C7Z A;  1OQQ A;  2V3P A;  4K3B A;  4MEM A;  2GOW A;  1UZX B;  2MLB A;  1YN5 A;  1JRO A;  3Q8B A;  2C5L C;  5J18 A;  2ZVO A;  4LDT B;  1M94 A;  1WM2 A;  2LGS A;  2KT7 A;  2PIA A;  3W5U B;  4MGY E;  4RNA A;  4D2K A;  3RCZ A;  2KZR A;  2VH1 A;  3TSS A;  3O65 B;  3VQI A;  2JRI B;  1AWD A;  2JSV X;  4WJN A;  3D32 A;  2NMQ A;  2PVO D;  1YNT E;  3N1Z C;  2BT6 A;  1GOZ A;  2BVC A;  3DVN U;  4OZC A;  3URY A;  5DPW A;  4NPN A;  2ACZ B;  2WDT B;  2KAN A;  2N7J A;  2QEJ C;  2IGG A;  2IJ0 A;  3ZNH B;  1UD7 A;  5KHQ A;  4BOZ B;  4NAW B;  3DOW A;  2INC C;  1BT0 A;  3V61 A;  3TEY A;  1P9D U;  3OJ4 B;  2UYZ B;  1LQB A;  2EMS A;  2FBW B;  2WYQ A;  1YJJ A;  2RDG A;  2Z8L A;  1E10 A;  1FFU A;  3VUX A;  4EKU A;  5HKH A;  1VZ8 A;  2CKH B;  5JHB A;  1I4G A;  3ECI A;  3RFZ B;  1Y56 A;  4W9C A;  2DZM A;  2PMV A;  5JZE B;  4ANX A;  3OJ3 A;  4HRO A;  1V9J A;  3L17 A;  1J7C A;  4TQ0 A;  2NTS A;  3VFK A;  4A6Q A;  2GB1 A;  2L0T A;  3Q69 A;  3OLM D;  5D6J B;  2LD9 A;  1D5M C;  3QJZ A;  4F8C B;  2AYO B;  1ZKH A;  4RGM A;  2NPT B;  3AEG B;  3QCA A;  2HD5 B;  3IXS A;  3JVZ X;  2KWD A;  2QIL A;  1J8C A;  4IOI E;  4ARC A;  3BIN A;  1WR1 A;  1V80 A;  2G4D B;  2MBH A;  4ZYN A;  4K1R B;  2LHE A;  2N9L A;  4XZ4 A;  1F9J A;  1HXY D;  4OVZ A;  1FCL A;  2DNF A;  3RI7 C;  4DBG A;  2FCN A;  3N3K B;  5DPR A;  1EWY C;  5H92 C;  3KUZ A;  3DWG C;  3WA0 A;  2BKF A;  2IY1 B;  4HDO A;  5BYQ A;  2J0J A;  5EE3 A;  5HHD G;  5TR5 A;  4ICV A;  1WZ3 A;  4HKZ E;  2V3S A;  1L4Z B;  5J17 A;  4TUU A;  4C56 C;  1SE9 A;  2QC8 A;  4M0W B;  1UEL A;  1YX5 B;  2LGY A;  2N4F A;  4OHJ A;  2JZ3 B;  3VUY A;  1CJE A;  1TTN A;  3A4S C;  1WRI A;  1RLF A;  3UF8 A;  2BTE A;  3BK1 A;  4MM3 A;  1EU3 A;  4LNK A;  2K22 A;  1HA5 A;  2BYT A;  2R2O A;  3Q3M C;  4GOC A;  1OEY A;  3C8Y A;  1P7F A;  2ZJD A;  2J52 A;  1QKZ A;  1LXD A;  2BYE A;  3DCG A;  3ZJU A;  1TJE A;  5AUK A;  3T3O A;  3FAH A;  4WWO A;  4HKQ A;  2QCZ A;  4AJW A;  3MP9 A;  3ZNI D;  4GDL A;  2N9K A;  2IY0 B;  2QMT A;  4YXD B;  3DBR B;  3V3X A;  2KWC A;  2KX0 A;  4Q2J A;  1UWX A;  4NAM A;  1FNW A;  2RGF A;  1UBI A;  3W5V B;  1FNU A;  2KNB A;  3PHW B;  4MGI E;  2WXJ A;  1PYW D;  3ZJT A;  3N9Y C;  4B0M A;  3AB5 A;  3ZUN A;  3B08 A;  3LXF A;  3H8H A;  3NY5 A;  4EOY A;  3AE4 B;  2CJO A;  1L2N A;  1N5W A;  3NVV A;  3DVG Y;  3DPD A;  4HDQ A;  4FLH A;  1NYR A;  4XE0 A;  2X38 A;  4A9A A;  2REX A;  2FCQ A;  1YIW A;  3KLS X;  2IO1 B;  4CYE A;  1RYJ A;  4HK2 A;  1GUA B;  4ANU A;  3BVG A;  4FJZ A;  2NCN A;  4LNO A;  3ZQ4 A;  2NR2 A;  3I9V 1;  4XDC A;  3M3J A;  4REZ A;  3U8Z A;  2D11 A;  5EDS A;  1N60 A;  1C79 A;  3U30 A;  4IM2 A;  1B1Z A;  1FMA D;  1C1Y B;  1NDD A;  1T6B X;  4PT5 A;  3ZYY X;  3VRA B;  4IC7 B;  1E8X A;  3ETR A;  1V5T A;  1TY0 A;  2MBB B;  3BYT B;  1IPG A;  1MJD A;  5G5G A;  1N62 A;  1I4P A;  2RR9 A;  4W9G A;  2K0P A;  2EEL A;  2KOX A;  1H8C A;  2K8B A;  2RPQ A;  4P1B C;  2Y5P A;  3DBL I;  3PRZ A;  2KWV B;  4LK0 M;  2EMT A;  1JWB D;  4WJQ A;  5G2N A;  1E8Z A;  1WSP A;  2IDY A;  1QOG A;  1U4A A;  2WS3 B;  5KHO A;  4PYU A;  3H1U A;  3DBL B;  2WU5 B;  1JML A;  5IOI A;  1V5O A;  3W9C B;  2NBV B;  1FRR A;  2N7D A;  4KGS A;  5FR3 A;  1GAQ B;  4KGT A;  2KC1 A;  1JWM D;  3JSV A;  2W82 A;  2HDE A;  1UNS A;  3CMM B;  4AUQ C;  4USA A;  1FIQ A;  2O6V B;  1ZXH A;  5JH5 C;  1FO4 A;  1K50 A;  2H89 B;  2LUM A;  2WLB A;  1R4M B;  1E90 A;  1HTO A;  5H8Y E;  5E6O A;  3NG0 A;  1GC6 A;  3U7Z A;  2RSU A;  4C7Y A;  4FA6 A;  1ET6 A;  1MVK A;  3OG5 A;  1E7P B;  2KMA A;  4ZRK A;  4W9D A;  4R3D A;  3AEC B;  1ZDV A;  4KX6 B;  3U2S C;  4BKG A;  1GB1 A;  2N9P C;  1WXQ A;  3NOB A;  4MH8 A;  2KVZ A;  3CWI A;  2O2V A;  3AEB B;  1EO6 A;  1YX6 B;  4JIO U;  1XCT L;  3EFC A;  2KMC A;  1N63 A;  1YQ3 B;  4OZA A;  2LGX A;  4MGZ E;  4PS8 A;  4BKS A;  2ZNV C;  2G9H D;  3PRP B;  1VLB A;  2TSS A;  3L0W B;  1PGA A;  2L76 A;  2KJ6 A;  3VVW B;  2MBQ A;  3NS8 A;  1BML C;  1L7Y A;  2KDM A;  2FAZ A;  3KWV A;  2WXQ A;  3W1S C;  1I4R A;  1TY2 A;  4J3O D;  1YD8 U;  1B9R A;  3Q14 C;  4G0N B;  5LXI B;  3P4P B;  2MQJ A;  3EGR A;  2A4Z A;  1LFD A;  4DDG D;  1V97 A;  1A5R A;  4MDK E;  1FXA A;  1YMH E;  4II3 B;  1NI3 A;  3ABV B;  3QIJ A;  2MHJ A;  3N32 A;  2I38 A;  5LNK 1;  1J19 A;  3N1Y C;  4HCN B;  3SD5 A;  3RYT A;  2LXC A;  1EF5 A;  1WJN A;  4M00 A;  4HJG E;  5EE0 A;  3VTU A;  1L0V B;  1EWC A;  3ZDM C;  2LVQ A;  3GB1 A;  2LVO A;  2DHZ A;  1RFK A;  1WXA A;  3QA8 A;  2K6Q A;  4KIK A;  2KQ4 X;  2N9E B;  4FAD A;  2KO3 A;  2EKI A;  3SU8 X;  5CHW A;  4WWP A;  2WXO A;  2GBN A;  1T0S C;  1D3Z A;  2CHW A;  1JCK B;  4O1N A;  3J9C A;  4ITK A;  3EFU A;  2K5P A;  1SIF A;  3ZXV A;  1VJK A;  2M56 B;  4S0R A;  1QIL A;  2Z0D B;  4DXF A;  1E7V A;  4GN1 A;  1XCQ L;  2HTH A;  4FN2 A;  4MJS B;  1CZP A;  4N6E B;  3PZ8 A;  2WXK A;  1JWS D;  3VDZ A;  4OW0 A;  3JSV B;  3JW0 X;  4C00 A;  4BKT A;  3GOE A;  4WUR A;  3CST A;  3HIZ A;  1PGB A;  1WWT A;  4WWN A;  3LJ3 A;  1UUP A;  2KD0 A;  4DXA B;  3UGB B;  4KKI A;  2DYM A;  2QJL A;  4DXG A;  3B0A A;  1CK1 A;  2N1V A;  1WFY A;  2PW9 A;  4MGK E;  1R4N I;  5JXV A;  2D2Q A;  1C4C A;  2FIF A;  1WR6 E;  4DHZ B;  1HQR D;  3K9O B;  2Q5W D;  3ZJV A;  5D3D A;  4WIP A;  4ASW C;  1F2R I;  2WGS A;  3R2T A;  3ZRF A;  1KLU D;  3AM9 A;  3DHI C;  1Q0W B;  2YVC A;  3BWU D;  1WGD A;  3L16 A;  1I4Q A;  1TKG A;  4N58 A;  1D5X C;  1V1P B;  4MSM B;  2DAF A;  3IBE A;  2KAC A;  2Y5C A;  4HEA 1;  4ZHO A;  2IO3 B;  1KFY B;  1CMX B;  2LRU A;  1XLQ A;  5BYS A;  4HWI B;  2L8J A;  3NZU A;  4A8X C;  1SIJ A;  3VAW A;  1K51 A;  4DQO C;  4I6P A;  1WZ0 A;  1Y8R C;  4B6W A;  3RZW C;  1FRD A;  5EE1 A;  4LNI A;  3DBR I;  2D10 A;  3W2D A;  2OED A;  1MHX A;  2KQS A;  2QDF A;  2OHF A;  2Y5B B;  2R2Q A;  3AXC A;  5E6J A;  1HTQ A;  5AZG A;  1SBB B;  2CU3 A;  2ONQ A;  1TT5 B;  1HZ5 A;  3PO0 A;  1YQ4 B;  2K8C A;  5IP4 D;  3KVF B;  3NZS A;  1TS3 A;  3NJT A;  2L1A A;  2JYT A;  2DX5 B;  2LI5 A;  4HVB A;  2J7Q B;  2JXT A;  2BF8 B;  3HHM A;  4XC2 A;  2IPK D;  2FE8 A;  2KYW A;  3AED B;  4F1S A;  4W9J A;  2IO0 B;  2LRW A;  5HI1 A;  5BMI A;  3EA6 A;  4IG7 B;  2LWP A;  3AEF B;  4G11 A;  5BO4 B;  5AZH A;  3P63 A;  1DOY A;  1L6V A;  4LNF A;  3PHX B;  2BQQ A;  1L5P A;  2I1J A;  4PYZ A;  3VTW A;  1C4P A;  2W55 A;  1I4H A;  4HXD A;  2RPV A;  1SE2 A;  1EU4 A;  1WE7 A;  3KYC D;  3PLV A;  4GMV A;  1YJI A;  2Z59 B;  2C60 A;  1F1H A;  1CQV A;  4EZK A;  2L32 A;  4DHJ D;  3KUC B;  2AQ3 B;  2KDB A;  2WP9 B;  2LEK A;  1QLB B;  2ZPY A;  4BKS D;  4GU2 A;  4PS7 A;  4K3C A;  2SEB D;  3CSF A;  1Z2M A;  4MSQ B;  2BS2 B;  2FUH B;  3QAR A;  3BYY B;  3NRZ A;  4FUL A;  4BVU C;  2AQ2 B;  3I57 A;  3M62 B;  5IA7 A;  1HEZ E;  2GBK A;  2MX2 A;  3CF6 E;  3IG3 A;  4NJ6 A;  2K9X A;  5EE9 A;  4IM0 A;  2ASQ A;  4UDU C;  4CO7 A;  3LYY A;  4W9I A;  4MT5 A;  1UBQ A;  4C4V A;  1RAX A;  3L4P A;  2M0A A;  1YOV B;  3Q3O C;  1FEH A;  2J0K A;  4TQ1 A;  4E74 A;  3C0R B;  4KDL B;  1R7S A;  1V1P A;  1WH3 A;  3ZW3 A;  4NQL B;  1GNU A;  3WIM A;  1RFA A;  3ZKJ C;  3RUL A;  3ALB A;  1GB4 A;  3PSE B;  2XBB C;  3RNA C;  2JX5 A;  5D94 A;  2V9H A;  3RN9 C;  1AW7 A;  5CHF A;  4XWW A;  2KN4 A;  5D7G A;  1UF0 A;  3OAW A;  3APC A;  3H9D A;  3RMK C;  4KDI C;  1XLN A;  1TIF A;  3PZD A;  2KLG A;  2NS5 A;  3RPF C;  2KN5 A;  1LO5 D;  1VZ6 A;  3ZLZ A;  1D4B A;  3NS1 A;  1GG3 A;  1TS4 A;  3SHQ A;  1TS5 A;  3AE3 B;  1XO3 A;  3I63 C;  3ZIM A;  4K7S A;  5HG2 A;  3AE6 B;  3HVD A;  4NZL B;  1QOA A;  3BVZ A;  3SDL C;  5AUI A;  4RF1 A;  3B9J A;  4RCO A;  1PDX A;  3W1Y A;  1YJ1 A;  1OQY A;  2PPH A;  4JWU C;  4YTP B;  4A55 A;  3ZO5 B;  2KFK B;  3Q3F A;  2ZEQ A;  1ZOY B;  3H7P A;  1XT9 B;  2W3S A;  2MP2 A;  2YLM A;  2XK5 A;  1C76 A;  2JUO A;  1ZUD 2;  3Q8C A;  1FXI A;  3B2F A;  4N9F 4;  1FM0 D;  4EZJ A;  3FIL A;  5DCN A;  1PGX A;  4M0W A;  3P42 A;  1FXT B;  1A70 A;  3NVY A;  3NUH B;  3ZTD A;  1QOB A;  4YL8 A;  1OGW A;  1R4M I;  4MH0 E;  2M19 A;  2GBM A;  4ZRQ A;  2BPS A;  5D3I B;  3MC0 B;  3U52 E;  2KC2 A;  3WAL A;  1GJZ A;  1E0Z A;  3QX1 A;  4DHJ B;  4RGT A;  3A9K B;  4YSX B;  4BFR A;  4TMA B;  4HPM B;  1ZW7 A;  5BYR A;  3UIN B;  3VHT C;  4K7U A;  3ZRC A;  4FXC A;  1T3Q A;  5FKA C;  4MEL A;  3KQ4 A;  2V3N A;  2C7N B;  3U4E G;  4TKN A;  2G4S A;  3V05 A;  2QHO A;  2AX5 A;  3UIP B;  4I6N B;  3V6C B;  3N30 A;  3WAM A;  2WQY B;  3SFD B;  3AN1 A;  3KH0 A;  2CR5 A;  2JWU A;  4JL9 A;  1WMH A;  3A9K A;  1P1A A;  2L00 B;  2XNA C;  3GE8 C;  2KJH B;  2D3G A;  4BZA A;  2MW5 A;  4LDT D;  4XWT A;  2KAJ A;  1SXT A;  4ZDV A;  1WRD B;  3EC8 A;  1C9F A;  5IAA C;  3ML9 A;  3VUW A;  5CHV C;  1Z5S B;  2G1E A;  1TKE A;  4WQM A;  2KHW B;  4US9 A;  5IN7 A;  3AU5 A;  3QAQ A;  4GDL B;  2UWQ A;  2DZJ A;  2L0F A;  4BBN F;  2WWZ A;  3RD2 A;  2BB6 A;  3NVZ A;  1PFD A;  2MBE A;  2LFI A;  1MPE A;  3LB8 C;  1EF1 A;  2DLB A;  3APF A;  1FFV A;  2KKC A;  1E6E B;  3R2I A;  4RM8 A;  3ML8 A;  1MHH E;  3TEZ A;  1FPY A;  1WGY A;  1L0X B;  4LJP B;  2XEW A;  1WYG A;  1C3T A;  4M8N A;  1J7A A;  2IBI B;  2N7E A;  3QHT A;  4ANV A;  1K52 A;  4W9L A;  4ANW A;  1ZE3 D;  3QWZ B;  3DVN V;  2KQ7 A;  3FIL B;  2HTM E;  2IGH A;  2KFJ A;  2YEP B;  4US8 A;  4YWG G;  1UGM A;  4ARI A;  3FC4 A;  1P3Q U;  2D3C A;  1D6E C;  2KDE B;  4RMA A;  4M8M A;  3IHP C;  2DZI A;  5AEK B;  2MP2 B;  3M95 A;  2BW2 A;  4A3P A;  3NZ3 A;  2WXM A;  3HVZ A;  2WDQ B;  2A5U A;  2KFK A;  1JQ4 A;  3IT6 B;  3PV1 A;  1ZXI A;  2MJ3 A;  1EM7 A;  1WJU A;  4IW0 A;  3B1L X;  2PLP A;  1OEY J;  1I7H A;  1NYQ A;  2LGD A;  4WH4 A;  3AE1 B;  2WHI A;  4FJV B;  4DWF A;  4WAA A;  2BB5 A;  1N61 A;  1NEK B;  3SFE B;  2MWS B;  3ZGZ A;  1VCB A;  3P4R B;  4KZC A;  1R4N B;  2KDF B;  2J4X A;  2XK5 B;  4EFO A;  2RDH A;  1WMH B;  2FUG 1;  1QQR A;  4B95 A;  3PGE A; 
#chains in the Genus database with same CATH homology
 1SE9 A;  2JT4 B;  4I6P A;  4M0W B;  1QZE A;  1WZ0 A;  1Y8R C;  4GIV A;  4TV3 A;  4K7W A;  4B6W A;  3RZW C;  3A1Q B;  2JF5 A;  4FHJ A;  1AAR A;  5GMV A;  3VH3 B;  1UEL A;  1YX5 B;  2LGY A;  2N4F A;  3DBR I;  2M17 A;  2D10 A;  1V81 A;  2JZ3 B;  2KQS A;  2DAJ A;  3VUY A;  1TTN A;  2Y5B B;  2R2Q A;  3AXC A;  3A4S C;  2V4L A;  1RLF A;  2K6D B;  2KDI A;  3NHE B;  3UF8 A;  3PRM B;  1V2Y A;  5AZG A;  2ZCB A;  4MM3 A;  4MJS A;  2L3Z A;  2O6V D;  3L13 A;  3AUL A;  2NPT A;  2K8C A;  5CX3 A;  2R2O A;  2CHZ A;  2EKE C;  4JLC A;  4GOC A;  3KVF B;  1J0G A;  3TL5 A;  3NZS A;  1OEY A;  2M4N A;  2GBJ A;  1X1M A;  2Z0E B;  2ZJD A;  3A33 B;  3KW5 B;  1LXD A;  2BYE A;  3DCG A;  4IM3 A;  4URK A;  2GMI C;  2DX5 B;  1WX7 A;  4WWO A;  1WX9 A;  2LI5 A;  3L54 A;  4HVB A;  4AJW A;  4CHK A;  2J7Q B;  3ZNI D;  2ZZP B;  3DBS A;  4W9E A;  4GDL A;  2KTR B;  2BF8 B;  3DQV A;  3HHM A;  2IY0 B;  4HCP B;  4XC2 A;  4F1S A;  4GB9 A;  4W9J A;  2IO0 B;  2LRW A;  3VH4 B;  4A20 A;  3TMP B;  2KWC A;  4LJO B;  4IG7 B;  2KX0 A;  2O2V B;  2OOB B;  2LWP A;  5DPT A;  1SGH A;  3APD A;  2RGF A;  2W9N A;  4G11 A;  1UBI A;  5BO4 B;  5AZH A;  3V62 A;  2KNB A;  3PHW B;  4MGI E;  3TJP A;  3BY4 B;  1E8Y A;  2MRP A;  4E3C A;  1VD2 A;  2KLC A;  4PS3 A;  3ZUN A;  2JXX A;  1KJT A;  3B08 A;  5E6N A;  2JZZ A;  2K1F A;  1MG8 A;  3NY5 A;  3PHX B;  4AP4 C;  4EOY A;  5FR6 A;  3HM3 A;  1L2N A;  2I1J A;  1NI2 A;  4PYZ A;  4W9F A;  4FBJ B;  3DVG Y;  3DPD A;  3VTW A;  1LM8 B;  4HDQ A;  1IP9 A;  4HXD A;  4FLH A;  1WE7 A;  2PJH A;  3KYC D;  3PLV A;  4GMV A;  1S1Q B;  4I6L B;  3X23 A;  2Z59 B;  2C60 A;  1RRB A;  2JWZ A;  2REX A;  2FCQ A;  4K81 A;  4EZK A;  3EHV A;  1YIW A;  2C9W B;  4DHJ D;  2B3A A;  3KUC B;  4E71 A;  2K25 A;  4LCD E;  2IO1 B;  2BKR B;  2KDB A;  4A3O A;  4CYE A;  2KK8 A;  2KTF A;  4HK2 A;  2IO2 B;  1GUA B;  4ANU A;  2ZPY A;  1XQQ A;  4BKS D;  4GU2 A;  4PS7 A;  4FJZ A;  2NCN A;  3MJW A;  2KTR A;  3CSF A;  2LXA A;  4NAW A;  1EUV B;  1Z2M A;  3ZVV A;  2FUH B;  3QAR A;  4MSQ B;  4FHK A;  3PT2 B;  2NR2 A;  2K39 A;  1TBE A;  3M3J A;  3U8Z A;  2D11 A;  4FUL A;  2C7M B;  2NVU I;  1E7U A;  4BVU C;  5L95 C;  2NBW B;  2FCM A;  2M0X A;  4HLE A;  5EDS A;  1HE8 A;  2NBU A;  3M62 B;  5IA7 A;  3U30 A;  5DPS A;  2GBK A;  2MX2 A;  3CF6 E;  3IG3 A;  4NJ6 A;  1WF9 A;  4IM2 A;  4RM9 A;  4WJP A;  4IM0 A;  5C1Z A;  2ASQ A;  4CO7 A;  1C1Y B;  1NDD A;  4GDK B;  1T0Y A;  4W9I A;  1UBQ A;  4TUU A;  4IWQ A;  2ZPN A;  2MCN B;  1I42 A;  2J0M A;  1E8X A;  1RAX A;  1V5T A;  1WJ4 A;  2MBB B;  4IC7 B;  3ONS A;  3DBH I;  2L7R A;  2O6V A;  2HE7 A;  1K8R B;  4P7I A;  4GXB A;  2DYB A;  1IPG A;  4HPL B;  2J0K A;  4NQK E;  4TQ1 A;  4W9K A;  3C0R B;  4KDL B;  4E74 A;  4KIK B;  3UQA A;  1WH3 A;  3ZW3 A;  2RR9 A;  3KUD B;  4NQL B;  1GNU A;  3JYU A;  4W9G A;  2KOX A;  3WIM A;  1RFA A;  1H8C A;  2K8B A;  3ZKJ C;  1ZGU B;  3RUL A;  2RPQ A;  3ALB A;  3VTV A;  2LJ5 A;  1GC7 A;  3PSE B;  3DBL I;  1Q5W B;  3PRZ A;  2KWV B;  2XBB C;  1KOT A;  4KVG B;  2EMT A;  5D94 A;  1Q1O A;  4WJQ A;  5G2N A;  5CHF A;  1E8Z A;  3L10 B;  5D7G A;  1U4A A;  3OAW A;  5KHO A;  4IWO A;  3APC A;  3H9D A;  4KSL C;  4PYU A;  4AJY B;  4KDI C;  3H1U A;  3QK0 A;  4HJK A;  3PZD A;  3H7S A;  3UQB A;  2IZV B;  2KLG A;  1IYF A;  4JQW C;  1V5O A;  2NS5 A;  2K8H A;  2NBV B;  1V6E A;  1H4R A;  4FJY A;  1WE6 A;  3Q3J A;  2JY6 A;  2KN5 A;  2N7D A;  2LZ6 A;  2DZK A;  3M63 B;  2KC1 A;  3JSV A;  2BWF A;  3ZLZ A;  1NBF C;  1GG3 A;  3HM6 X;  5CTR C;  3SHQ A;  1P98 A;  4AOF A;  5L83 A;  3ZIM A;  3P2B A;  4K7S A;  1E5W A;  3CMM B;  3PVL A;  2JRH A;  4G50 A;  4AUQ C;  3ZNZ B;  4WJO A;  5G55 A;  1JRU A;  3R7R A;  3SDL C;  2O6V B;  2ZNV B;  3AI5 A;  2ZVN A;  4B9K A;  1WXV A;  1TGZ B;  5JH5 C;  3L08 A;  3W1Y A;  1YJ1 A;  1OQY A;  2PPH A;  1KLV A;  3ZO5 B;  2G45 B;  2KFK B;  3Q3F A;  1E90 A;  2ZEQ A;  3PLU A;  3DDC B;  2C7H A;  2L05 A;  5E6O A;  1KM7 A;  1GC6 A;  3H7P A;  2LVP A;  1XT9 B;  2RSU A;  5C23 A;  2MP2 A;  2YLM A;  3TCA A;  3VXW A;  3TBL D;  4FA6 A;  1E8W A;  2M1M A;  2KMA A;  2BGF A;  4ZRK A;  2XK5 A;  4W9D A;  2JUO A;  2CHX A;  3GZN I;  1OTR B;  3IVF A;  2FID A;  2N9P C;  4BKG A;  2BYV E;  3NOB A;  1UH6 A;  4N9F 4;  4EZJ A;  5DCN A;  1ISN A;  4II2 B;  2JVC A;  2O2V A;  1WM3 A;  1EO6 A;  1YX6 B;  3AU4 A;  3ZNG C;  2VRR B;  4JIO U;  4DHZ E;  1FXT B;  3ENE A;  2BWE S;  4EEW A;  2KVR A;  2KMC A;  1I35 A;  2DEN B;  3ZTD A;  2ZCC A;  3MHS D;  4EZL A;  5J2R A;  2LGX A;  3LDZ E;  2PE6 B;  4YL8 A;  3X0W A;  1OGW A;  4MGZ E;  4PS8 A;  1PQS A;  1R4M I;  2ZNV C;  4MH0 E;  3PRP B;  3PS6 A;  4BKS A;  2WX1 A;  2GBM A;  2BPS A;  3WAO A;  3TIX A;  3L0W B;  3PRE A;  2KC2 A;  4BOS C;  3WAL A;  2L76 A;  1GJZ A;  5LLI A;  2KJ6 A;  3QX1 A;  2MBQ A;  3VVW B;  4NY0 A;  4BBN C;  3NS8 A;  2FNJ B;  4DHJ B;  2AEH A;  2G3Q B;  1L7Y A;  4NJ7 A;  4XX5 A;  3PPA A;  3A9K B;  2FAZ A;  3W1S A;  3H6N A;  1WGH A;  1S3S G;  4BFR A;  3W1S C;  4HPM B;  1ZW7 A;  1TZ1 A;  2KXJ A;  3UIN B;  2HJ8 A;  3VHT C;  4K7U A;  4OVV A;  3ZRC A;  1YD8 U;  2AL3 A;  4MEL A;  4KZ0 A;  2D07 B;  4G0N B;  5LXI B;  2MQJ A;  2C7N B;  1WYW B;  2RD0 A;  4W9H A;  2A4Z A;  1LFD A;  3U7D A;  3V6E B;  4DDG D;  1A5R A;  3DVG X;  4KSK C;  4MDK E;  4TKN A;  2G4S A;  1V49 A;  4II3 B;  2QHO A;  4ZDV A;  3UIP B;  4I6N B;  4J6I A;  3PTF C;  3RZF A;  4ZRI A;  2AL6 A;  2LUE A;  3QIJ A;  5AZF A;  4EUT A;  1G6J A;  3V6C B;  3N30 A;  3N32 A;  4GDK A;  3WAM A;  1J19 A;  4HCN B;  3KH0 A;  3SD5 A;  2CR5 A;  3A9J B;  2LAS A;  2MBO A;  3RYT A;  4JL9 A;  3WAN A;  2MSE D;  2LXC A;  2AWT A;  1EF5 A;  1WJN A;  1WMH A;  3R66 C;  4F7Z A;  3A9K A;  3ZTC A;  1P0R A;  1WGG A;  3A4R A;  1P1A A;  3VTU A;  1WI0 A;  2L00 B;  3ZDM C;  2KJH B;  2LVQ A;  2D3G A;  1WXS A;  1UZX B;  2GBR A;  2GOW A;  2MLB A;  2MW5 A;  2LVO A;  4LDT D;  4MEM A;  3RT3 B;  4ANV A;  2DHZ A;  1WRD B;  2OJR A;  2C5L C;  3EC8 A;  3K9P B;  4OVU A;  5IAA C;  4JGH B;  5E6P A;  2I1K A;  1WXA A;  3QA8 A;  5J18 A;  2K6Q A;  2ZVO A;  3ML9 A;  4KIK A;  4LDT B;  2MA9 B;  3VUW A;  1M94 A;  2N9E B;  1WM2 A;  5CHV C;  4FAD A;  2KO3 A;  1Z5S B;  4GGQ A;  5JHA A;  3SU8 X;  4X57 B;  5CHW A;  2KHW B;  4MGY E;  3QQ8 B;  2IYD B;  2N9X A;  4WWP A;  3AU5 A;  2FCS A;  3EEC A;  3RCZ A;  3QAQ A;  3WAP A;  1WX8 A;  2KZR A;  4GDL B;  2UWQ A;  4ICU A;  4DDI D;  2DZJ A;  2L0F A;  3O65 B;  2CU1 A;  3VQI A;  2JRI B;  2GBN A;  4BBN F;  3HK0 A;  2WWZ A;  1V86 A;  3RD2 A;  4WJN A;  1D3Z A;  2CHW A;  3D32 A;  4AWJ A;  2MBE A;  3DVN U;  1EF1 A;  5DPW A;  3EFU A;  3T9L A;  3IFW B;  3APF A;  4NPN A;  2WDT B;  2KAN A;  1SIF A;  2KKC A;  1WXM A;  4RM8 A;  3ML8 A;  5D2M B;  4GSW A;  3ZNH B;  1UD7 A;  2Z0D B;  1WGY A;  4BOZ B;  1E7V A;  2JPH A;  3DOW A;  4GN1 A;  4NAW B;  5KHQ A;  1BT0 A;  4ZRJ A;  2HTH A;  3V61 A;  1P9D U;  3OJ4 B;  2UYZ B;  1LQB A;  2V1Y A;  4FN2 A;  4LJP B;  4MJS B;  2XEW A;  4DK5 A;  5LXH A;  1C3T A;  2EMS A;  2WYQ A;  4M8N A;  3VDZ A;  1WY8 A;  3JSV B;  3JW0 X;  4BKT A;  1YQB A;  2IBI B;  2N7E A;  3QHT A;  4G3X B;  4NNJ B;  3GOE A;  1WIA A;  4WQO B;  3CST A;  2CKH B;  3VUX A;  4EKU A;  5HKH A;  2KWU B;  4W9L A;  4ANW A;  3QWZ B;  3DVN V;  3HIZ A;  2KQ7 A;  4WWN A;  3V60 A;  5JHB A;  2KFJ A;  3ECI A;  3LJ3 A;  4W9C A;  3T8M A;  2KD0 A;  2WX0 A;  4DXA B;  3UGB B;  1UGM A;  2DYO A;  2DYM A;  2PE9 A;  2DZM A;  5JZE B;  1P3Q U;  4ANX A;  2KDE B;  3OJ3 A;  4RMA A;  3A1Q A;  3ZDT A;  3I3T B;  4M8M A;  4B95 A;  3IHP C;  3B0A A;  3H7P B;  1V9J A;  2DZI A;  2N1V A;  3L17 A;  5AEK B;  4TQ0 A;  2MP2 B;  1WFY A;  3M95 A;  4MGK E;  3VFK A;  1R4N I;  4KV2 A;  2L0T A;  4A3P A;  3OLM D;  5D6J B;  3MTN B;  2LD9 A;  2D2Q A;  2A5U A;  2KFK A;  3QJZ A;  4F8C B;  3PV1 A;  2FIF A;  1WR6 E;  4DHZ B;  2AYO B;  3KYD D;  1ZKH A;  2NPT B;  1WJU A;  2KX3 A;  4IW0 A;  3UIO B;  3K9O B;  3B1L X;  3QCA A;  2HD5 B;  1WJ6 A;  1OEY J;  4ASW C;  2LGD A;  3JVZ X;  3ZRF A;  1J8C A;  3RUI B;  1XD3 B;  1Q0W B;  3BIN A;  1WR1 A;  4FJV B;  4DWF A;  1V80 A;  2G4D B;  2MBH A;  2YVC A;  1WGD A;  4ZYN A;  3L16 A;  3R3M A;  4K1R B;  4WAA A;  4IWP A;  4MSM B;  2KJR A;  2DAF A;  4XZ4 A;  1F9J A;  3R7Q A;  3IBE A;  3S2A A;  2MWS B;  1VCB A;  4DBG A;  2FCN A;  2BYF A;  3N3K B;  5DPR A;  1WGR A;  3KUZ A;  4KZC A;  2IO3 B;  2KDF B;  2LRU A;  1CMX B;  2M8S A;  2XK5 B;  3WA0 A;  2BKF A;  2IY1 B;  4EFO A;  2PEA A;  4HDO A;  1WMH B;  2J0J A;  4IUM B;  4HWI B;  2CS4 A;  4ICV A;  5TR5 A;  2L8J A;  1WZ3 A;  3NZU A;  3QC8 B;  2V3S A;  2N1W A;  3VAW A;  5J17 A;  3A9J A;  3PGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...