1IPGA

Solution structure of the pb1 domain of bem1p
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
GAMGSSTSGLKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords BEM1 PROTEIN
publication title Structure and ligand recognition of the PB1 domain: a novel protein module binding to the PC motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ipgA00
2KVRA 3B08A 4FADA 1Y8RC 2ZNVC 3CSFA 1RLFA 1WYWB 4MGYE 3GZNI 2NS5A 2DYMA 2LZ6A 2IY0B 5C1ZA 2R2QA 2KMAA 5BO4B 2ZVNA 2KFKB 3PPAA 1Z5SB 2RSUA 4N9F4 4WWNA 2RR9A 3A4SC 1EUVB 3NHEB 2G45B 4RM9A 1G6JA 3NZUA 2KC2A 1P1AA 4JGHB 1XQQA 4TKNA 3VH4B 4DDGD 2K25A 4TQ1A 2N1VA 3VTUA 4EKUA 3QJZA 3VVWB 3BY4B 4NNJB 4HCNB 4W9FA 2L8JA 3W1SC 2MBHA 4M8MA 2FCMA 4EZKA 3ALBA 2AL3A 4IW0A 1YX6B 2I1KA 3X23A 4MJSB 2JT4B 2AL6A 1WI0A 2IZVB 3QARA 4G0NB 4KSLC 2ZJDA 1TGZB 4MEMA 4DHZB 1UBIA 1WH3A 3HK0A 4PYZA 4GU2A 1OGWA 3ZVVA 3ML9A 1XT9B 1V2YA 2LXAA 2CHZA 2O2VB 3OAWA 2G4DB 2UYZB 4GSWA 1TZ1A 4JQWC 2XEWA 4DK5A 3L17A 4K7SA 4GDKA 3PT2B 4JIOU 4PS8A 4HK2A 2OOBB 4E3CA 3ECIA 4IM3A 1UZXB 4KIKA 4W9KA 2NCNA 2IY1B 2V1YA 2GBMA 2NBUA 4WJPA 2KANA 1BT0A 3NZSA 4NAWB 1LFDA 4NPNA 4BOZB 4F7ZA 5DCNA 2ASQA 2BKFA 3VHTC 4DDID 4E74A 1AARA 2NPTA 2N9XA 2IO3B 1WXMA 1TTNA 2FCSA 1NDDA 2DAFA 3S2AA 2NVUI 3ZTDA 1WX7A 1WR1A 2JF5A 4W9CA 3VQIA 1YQBA 4XC2A 3PTFC 2XK5A 3PZDA 3QHTA 1NI2A 3NS8A 2QHOA 4B95A 3V61A 3JVZX 3DVNV 4ZYNA 3DBHI 1UGMA 5TR5A 3ZDMC 4W9DA 2O6VA 2MLBA 3IBEA 3CMMB 2MBEA 3SU8X 2GBRA 3AU5A 1RAXA 2D2QA 2FNJB 1WGHA 1JRUA 1IP9A 4P7IA 2AYOB 3A9JA 3L08A 3QAQA 4K81A 2KLCA 4K7UA 4AP4C 4GOCA 2FIDA 2KDBA 3OJ3A 4MM3A 1J0GA 4TQ0A 1SGHA 2C5LC 3DBRI 2M4NA 2MWSB 3W1YA 3H1UA 1P9DU 3DQVA 4BKGA 2KX3A 4MSQB 4M8NA 4B6WA 2EKEC 3L0WB 2GOWA 2BWES 4FJZA 3ML8A 5LLIA 2BF8B 4WWOA 1WGYA 1GC7A 3QC8B 3QX1A 3UGBB 3CF6E 1MG8A 2BYFA 2WDTB 4URKA 2A4ZA 3MHSD 4KZCA 1YJ1A 2JWZA 2YVCA 3DBSA 3ZRFA 3ZRCA 4CYEA 4II3B 2MBQA 3N32A 2KTRB 1V86A 2IO0B 3ONSA 3ZNHB 4AJYB 4FN2A 2CHWA 2HD5B 1E90A 2RGFA 5D2MB 3DVNU 3TJPA 2GBJA 4NJ7A 2KO3A 5J17A 2KMCA 1C3TA 2GMIC 2J0JA 1UBQA 4G3XB 4IM0A 1L7YA 2KWCA 3QA8A 2FCQA 3I3TB 2L0TA 4AOFA 2C7HA 3AU4A 4BBNF 1IYFA 3ZTCA 4MELA 3H7PB 4MGIE 2N1WA 3IVFA 4KDIC 4KSKC 3RUIB 3SHQA 1X1MA 3RYTA 3EECA 2ZZPB 3EFUA 2MCNB 3DBLI 3M63B 2KWUB 2MP2A 3N30A 5E6NA 1LXDA 3PRMB 2JUOA 3T9LA 4DHZE 3KYCD 3IG3A 2KFJA 3X0WA 2BYEA 3VH3B 3PVLA 3H6NA 1GJZA 2LI5A 2MX2A 3R7QA 3R3MA 1ZKHA 2ZPYA 4FJYA 4MGKE 2N4FA 1YIWA 3IHPC 5AEKB 1WX9A 1GUAB 2KX0A 4WJOA 4DHJB 3PV1A 2XBBC 3PRZA 4G50A 2FCNA 2FIFA 4ICUA 1UD7A 4WWPA 3KUCB 1GC6A 4KDLB 3HIZA 4GDKB 2N9PC 3B0AA 2ZCCA 3DCGA 1WXSA 2KDIA 5E6PA 1WX8A 3WIMA 2OJRA 3L16A 4IWPA 1WZ3A 3RD2A 1J19A 3VFKA 2KFKA 2IO1B 1WZ0A 2KKCA 1EF1A 1CMXB 2KOXA 1YD8U 3W1SA 2LWPA 1WGRA 4LDTB 4IWQA 4EFOA 2LJ5A 4BOSC 3WAMA 1P0RA 5LXIB 2LRWA 2CR5A 1S1QB 1V6EA 1R4MI 3VTWA 2DHZA 1E7VA 1WJNA 2IBIB 2LGDA 1LQBA 2EMSA 4FHKA 4II2B 4B9KA 4FBJB 3A1QB 1EF5A 3JSVA 2D10A 3V60A 1RFAA 1GG3A 4LDTD 4MJSA 4AUQC 1KM7A 2CKHB 2BKRB 2XK5B 4ASWC 2DZKA 4A20A 1ZGUB 1WMHB 3QK0A 2L76A 1K8RB 5JHAA 3ZKJC 4GIVA 2LUEA 2MQJA 1Q0WB 1U4AA 2D11A 2KXJA 2R2OA 3VUYA 4IM2A 1F9JA 1R4NI 3APDA 2KDEB 3R7RA 3V62A 4LJOB 1V80A 3VUWA 1L2NA 3BINA 3K9OB 2KHWB 3A9JB 2HJ8A 3RULA 3ZIMA 5JZEB 1I35A 2UWQA 3CSTA 2KLGA 2M1MA 2AWTA 1H4RA 2YLMA 1WJ6A 3HM6X 4TV3A 2MBOA 3AI5A 3ENEA 3T8MA 4ANXA 4DWFA 3QCAA 2CU1A 5GMVA 5G55A 3ZNZB 1WJUA 3H7SA 2V4LA 1V81A 3A9KB 2K8CA 2KWVB 1QZEA 2REXA 3ZNGC 3U8ZA 3VDZA 1WXAA 3ZLZA 1S3SG 5E6OA 3ZDTA 2BYVE 2DX5B 1EO6A 3APCA 1ZW7A 2C7NB 2IO2B 2KQSA 2Z0DB 2VRRB 4X57B 5EDSA 2DZMA 3WAOA 5AZHA 5CHFA 4GN1A 3M95A 1H8CA 4W9IA 3R66C 4G11A 3D32A 1GNUA 4GGQA 1SE9A 3AXCA 2IYDB 3JW0X 3M3JA 1WF9A 1ISNA 3MJWA 1TBEA 2DENB 2Z0EB 3QQ8B 2Y5BB 4JL9A 3WA0A 2L7RA 3U30A 3B1LX 3SDLC 1WE7A 1RRBA 1Q5WB 1PQSA 2LD9A 3PSEB 1I42A 2L05A 2GBKA 4W9GA 5DPTA 3QWZB 5D6JB 2RPQA 3HM3A 2L00B 4GDLA 1FXTB 1OEYA 4NQLB 5DPRA 2LRUA 3DVGX 4ZDVA 2KZRA 5HKHA 2DZIA 2MP2B 3DDCB 3TIXA 1C1YB 1E8XA 4BKSD 3GOEA 2DYBA 1WM3A 4I6PA 5J2RA 4HDOA 2LGYA 4IC7B 1T0YA 3RZFA 4K7WA 3TMPB 5J18A 2L0FA 2KNBA 1WGGA 2M17A 2ZNVB 5CHWA 2C7MB 2WYQA 2BPSA 3DOWA 3V6EB 2LGXA 3KW5B 4HVBA 1SIFA 3EC8A 1V5OA 4IWOA 4WAAA 3PGEA 2MBBB 3N3KB 4HWIB 3OLMD 4PS3A 4CHKA 4EOYA 2AEHA 3LJ3A 3UIPB 3DVGY 2EMTA 2ZCBA 2RD0A 2KJ6A 4OVVA 4YL8A 1NBFC 3A4RA 2LASA 4BBNC 4NQKE 2M8SA 4KVGB 3K9PB 1OTRB 4I6NB 3AULA 3PLUA 4KV2A 5L95C 4ZRKA 3H7PA 4TUUA 4XZ4A 3UQBA 4FJVB 4EUTA 4FULA 3PLVA 4FHJA 4A3OA 2ZPNA 2KDFB 4KZ0A 4IG7B 4KIKB 1UH6A 2C60A 4XX5A 3VAWA 4AJWA 4F1SA 3C0RB 3NOBA 5DPSA 4JLCA 2M0XA 4DHJD 4FA6A 1E5WA 5CTRC 2MW5A 4PYUA 2JZ3B 3Q3FA 4MDKE 3JSVB 2JY6A 1HE8A 4HLEA 4K1RB 2J0MA 4NJ6A 3A33B 4HXDA 3RT3B 2WX0A 4AWJA 2NPTB 3WANA 4IUMB 2JXXA 2KN5A 4ZRJA 4RMAA 5AZFA 4ANUA 5CX3A 4OVUA 1WE6A 1WXVA 4HJKA 2LVQA 3PS6A 4A3PA 2KC1A 1WY8A 4HPLB 2JZZA 3U7DA 2Z59B 3H9DA 2PJHA 2CS4A 1WIAA 4FLHA 4I6LB 3ZNID 3UQAA 1Q1OA 2HE7A 5LXHA 2BGFA 3TBLD 2A5UA 3RCZA 4WJNA 5IAAC 4MH0E 4WJQA 4EZLA 2O2VA 3JYUA 1IPGA 3UIOB 2FUHB 5FR6A 2O6VB 5C23A 4ICVA 4WQOB 2J7QB 5AZGA 5G2NA 3TCAA 2NBVB 1YX5B 4W9HA 1WM2A 3DPDA 4E71A 5KHQA 2GBNA 2MSED 3ZO5B 3TL5A 4CO7A 4NY0A 3IFWB 2NBWB 2KJRA 2DZJA 3OJ4B 3VTVA 4NAWA 3KUDB 3A1QA 1P3QU 3KH0A 1V9JA 2DYOA 3KYDD 4GB9A 3L13A 2O6VD 2BWFA 4BKTA 3O65B 1V5TA 3SD5A 5L83A 4BFRA 2N7EA 4W9EA 4W9JA 2WWZA 2K39A 2N9EB 3MTNB 1Z2MA 1WMHA 3QIJA 4EZJA 1VCBA 1VD2A 3RZWC 4DXAB 3UINB 3VXWA 4HCPB 2K1FA 2LVOA 1KOTA 5D7GA 2C9WB 4BVUC 2JRHA 2NR2A 3LDZE 2ZEQA 3PREA 4HPMB 4DBGA 1E8WA 1OEYJ 2N7DA 5KHOA 3UF8A 3Q3JA 2JPHA 2KJHB 2B3AA 4PS7A 3ZUNA 3P2BA 2G4SA 2WX1A 2CHXA 3PHWB 4MSMB 3KVFB 5CHVC 3EHVA 3KUZA 1XD3B 3M62B 3L54A 1KLVA 4J6IA 1E8YA 2K6DB 2K6QA 1E8ZA 2HTHA 2J0KA 2G3QB 3PHXB 4F8CB 1P98A 4GDLB 1WR6E 2DAJA 2MRPA 3WAPA 2FAZA 2V3SA 5JH5C 3A9KA 3WALA 2MA9B 2L3ZA 4ZRIA 1V49A 4ANWA 4ANVA 1WJ4A 5JHBA 2KD0A 2I1JA 4RM8A 5IA7A 3L10B 1E7UA 2PPHA 2PE6B 2D07B 4MGZE 5DPWA 2KTFA 4M0WB 1WGDA 3NY5A 2ZVOA 4LCDE 2PEAA 2D3GA 2PE9A 2W9NA 1M94A 4HDQA 4GXBA 2JVCA 2K8HA 1WRDB 2KQ7A 2K8BA 3ZW3A 2KTRA 3APFA 4GMVA 1KJTA 3PRPB 3VUXA 4BKSA 1OQYA 4EEWA 4LJPB 1J8CA 3HHMA 1A5RA 1D3ZA 2LXCA 2JRIB 1WFYA 5D94A 3V6CB 4W9LA 2LVPA 1LM8B 2KK8A 1UELA
chains in the Genus database with same CATH superfamily
2KVRA 5BMGA 4HKQA 2KMMA 4LNIA 2KFKB 2W54A 4WWNA 1G6JA 1P1AA 3VTUA 2WXMA 5C2TB 3QJZA 3BY4B 1K50A 4NNJB 4M8MA 2FCMA 2I1KA 1XF5L 5EE1A 2AL6A 1JMLA 3QARA 4G0NB 1NENB 3TEXA 1TGZB 4MEMA 1WH3A 2BBCA 4GU2A 2LXAA 2O2VB 3OAWA 3ABVB 1TZ1A 4OW0A 4K7SA 4JIOU 3U4EG 1N60A 3ECIA 4IM3A 4KIKA 2BB5A 2WHIA 2NBUA 4WJPA 2KANA 3O13A 1LFDA 2DBYA 4F7ZA 3BVGA 3VHTC 4DDID 1YN3A 3SFEB 1AW7A 4A9AA 3AMZA 2N9XA 3S2AA 1ENFA 1WR1A 2E6XA 3VQIA 4XC2A 1QKZA 3PTFC 1SB3C 1AN8A 3NS8A 4B95A 3NVYA 3P4RB 2D5GA 4ZYNA 1TKGA 4HEA1 4MACA 3CMMB 3SU8X 1D4BA 1RAXA 2Y5PA 1JQ4A 3RNFC 2INCC 4K7UA 4AP4C 3SR6A 4TQ0A 4O1NA 3DBRI 2MWSB 3H1UA 1YQ4B 4BKGA 4YTNB 2KX3A 4M8NA 4HJGE 2EKEC 2GOWA 2BWES 5LLIA 1GC7A 4RNAA 2IPKD 1D5MC 2MJEA 2A4ZA 4ZYSA 2SEBD 3DBSA 1E6EB 3ZRCA 4II3B 2KTRB 1V86A 3ONSA 3ZNHB 1JRPA 3DVNU 4N59A 3BYYB 2KO3A 1FNUA 2WXJA 1C3TA 2GMIC 2INDC 2KWCA 3TEYA 3AU4A 1OQRA 3ZTCA 2N1WA 4TMAB 1X1MA 3EECA 2ZZPB 2MP2A 3N30A 3ZQ4A 1E7PB 1HTQA 4DHZE 2W3RA 1GPXA 4AS1A 1PYWD 1I4XA 1GJZA 1XLNA 1C78A 1ZKHA 2QIEB 1TS5A 4FJYA 2N4FA 2AX5A 1SE2A 4C7ZA 2FUG1 2FE8A 2XBBC 2FCNA 1UD7A 3RN9C 3KUCB 4KDLB 1I4QA 1TJEA 4IWPA 2INPE 2IO1B 1CMXB 3W1SA 1WGRA 1I4HA 4LDTB 4BOSC 3WAMA 4R3DA 1V6EA 4DXFA 2L32A 2QILA 2Y3AA 3ZJVA 3TSSA 2IBIB 2EMSA 3A1QB 2DNFA 1KLGD 3RNAC 4TSSA 4YTMB 1ROEA 1HXYD 2M19A 1FMAD 4A20A 3RI7C 4FXCA 1K8RB 2WXIA 2D11A 4IM2A 1R4NI 3APDA 2KDEB 3K9OB 3EFCA 5JZEB 3RULA 1I35A 2UWQA 3HM6X 1WJ6A 3BIID 3AI5A 3NS1A 3RNGC 1TT5B 4NAMA 1EU3A 2BS4B 2V4LA 1V81A 4LNFA 3ZYYX 2KWVB 1D6EC 1F77A 3VDZA 1S3SG 2WQYB 3N9YC 1QOBA 5E6OA 3ZDTA 2DX5B 2Z0DB 2Q5WD 4GN1A 1H8CA 1T0QC 2WXPA 4NJCA 4PT5A 1ZPSA 1GNUA 4GGQA 3AXCA 3JW0X 1LGRA 3MJWA 2WXNA 3BVZA 2Y5BB 2J4XA 2L7RA 2ICIA 2L83A 1WE7A 2LD9A 1PQSA 2WNMA 2PVOD 2L05A 5DPTA 1XCQL 2L00B 2LRUA 2DZIA 2MP2B 3DDCB 2SAKA 3RNEC 4BKSD 1WM3A 3FAHA 3HVZA 1FXIA 1V1OA 4HDOA 3NUHB 3RZFA 3AEGB 5J18A 1NYQA 2M17A 2BYTA 3V6EB 3E56A 4HVBA 4YSXB 3DHHC 4IWOA 3PGEA 2MBBB 3N3KB 4PS3A 4CHKA 3LJ3A 1KF6B 2ZCBA 2KJ6A 3A4RA 2M8SA 4I6NB 1OTRB 1N61A 4US9A 4ZRKA 4FULA 2YEPB 3BVMA 1CQVA 2ZPNA 2KDFB 4KZ0A 1YJIA 3UI3A 2C60A 3ZJTA 3C0RB 2MJDA 1PGBA 2WU5B 1E5WA 1HE8A 5C3JB 1HQRD 3VRAB 1N5WA 1EM7A 2KN5A 4RMAA 1J7BA 5CX3A 3IT6B 4OVUA 1WXVA 2KC1A 2IJ0A 1P7FA 2JU6X 4FLHA 3UQAA 1UGJA 4WJQA 5GXGB 3AEFB 1T6BX 4ICVA 5G2NA 3TCAA 1ET9A 2NBVB 1SIJA 4W9HA 1WM2A 3DPDA 5KHQA 2GBNA 3ZO5B 4CO7A 4NY0A 3IFWB 3KUDB 2DYOA 2O6VD 3O65B 4BFRA 3FC4A 2WWZA 2K39A 1JWUD 3QIJA 4EZJA 5HFYA 2K1FA 2KVZA 4HPMB 3UF8A 3U7ZA 2NTSA 4JX1C 1QT9A 1PGXA 3P2BA 2GRIA 1XD3B 4WURA 3L54A 1KLVA 1ZDVA 2DAJA 2MRPA 5JH5C 3A9KA 2MA9B 2BW2A 1IUEA 5JHBA 1HEZE 2D07B 3IAM1 3AECB 4JWSC 3B2GA 1WGDA 1WWTA 4LCDE 2D3GA 2KACA 2W9NA 3B2FA 2RDHA 2JVCA 1K53A 2K8HA 2KQ7A 3P42A 1HZ6A 3IAS1 4GMVA 3PRPB 2N9LA 1A5RA 2LXCA 2V4IB 2PTLA 3BYTB 1UELA 3CSFA 1WYWB 2DYMA 5C1ZA 2R2QA 2ZVNA 1Z5SB 2RSUA 2RR9A 1EUVB 3NHEB 4RM9A 3NZUA 2KC2A 4JGHB 5D3IB 1SXTA 1TS2A 2LHEA 4ACFA 2VZKD 4RFBA 4EZKA 2AL3A 2NTTA 4IW0A 3RFZB 4MJSB 4XE0A 1MG4A 1WI0A 3HK0A 3RNBC 3MJ5A 1V2YA 3Q8AA 4JQWC 4DK5A 2UYZB 4RGTA 3Q69A 3PT2B 2INNE 4N58A 3ETRA 4HK2A 1T3QA 4E3CA 1UZXB 3PZ7A 2NCNA 2V1YA 2M0AA 5D3DA 3Q3NC 2PW9A 4NPNA 4BOZB 5DCNA 2ASQA 2BKFA 1I4GA 2NPTA 1N5XA 2WGSA 4C00A 2LMCA 1TTNA 1WX7A 1YQBA 4LLGM 2QHOA 3V61A 1C4AA 3ZDMC 5TR5A 1JW9D 3ZJUA 2MLBA 3IBEA 2MBEA 2GBRA 2D2QA 1WGHA 1J7AA 4XYCA 3A9JA 3SEBA 4K81A 1NYRA 2BB6A 2KDBA 4MM3A 1J0GA 4L1BA 3NVVA 1P9DU 4A90A 3ML8A 3QC8B 3QX1A 1SEBD 3UGBB 2EELA 1MG8A 2WDTB 4URKA 2YVCA 4M01A 3AN1A 4KKIA 4AJYB 1UF0A 2JQRB 2RGFA 1UWXA 4NJ7A 5J17A 1KRHA 1KLUD 1UBQA 2WP9B 4IM0A 1L7YA 4EE2A 3I3TB 2L0TA 4AOFA 2J53A 2G1EA 4BBNF 1IYFA 1DGJA 1ZE3D 2WXRA 1E9MA 3I63C 3RYTA 3U52E 3EFUA 2MCNB 5E6NA 3PRMB 1XO3A 1R7SA 2ZW0A 2BYEA 3PVLA 1VJKA 2LI5A 3R7QA 1VZ8A 1YIWA 1WX9A 1TY0A 2KX0A 3NJTA 2FIFA 1YMHE 4WWPA 3VR8B 3DCGA 1WXSA 1WX8A 3WIMA 1WZ3A 3RD2A 1J19A 1WSPA 2KOXA 4EFOA 2LJ5A 3KWLA 2LRWA 5JXVA 5H92C 5MPOA 2DHZA 1WJNA 1LQBA 2BS2B 4FBJB 1EF5A 3Q3OC 3DBHB 2D10A 4AUQC 4LDTD 1UNSA 4P16A 1KM7A 4ASWC 1WMHB 1JALA 4L23A 4GIVA 1Q0WB 3V62A 3WCQA 3N1XC 1QF6A 3TUOA 3C19A 5IO9A 1V80A 3U2SC 2Z8LA 2KHWB 3A9JB 2M1MA 2AWTA 1H4RA 1XXGA 2MBOA 3ENEA 3GE3C 4C56C 3V3XA 3BK2A 5GMVA 5G55A 1TKYA 1I7HA 3H8HA 1WYGA 3DHGC 1J7CA 2CU3A 2AQ3B 2K8CA 3ZLZA 4L2YA 3AE2B 1ZW7A 3E9SA 1FCCC 2DZMA 4ARCA 1MI0A 3W5UB 2RPVA 2B76B 4G11A 3ZGZA 5E6JA 3M3JA 2GB1A 2BTEA 1V1PB 2Z0EB 4JWUC 1PDXA 3WA0A 1L4DB 3P4PB 1I4RA 1L4ZB 1RRBA 3DHIC 1EU4A 2GBKA 3GP7A 4W9GA 1TS3A 2QEJC 4GDLA 5DPRA 2KWDA 3DVGX 2KZRA 1FNWA 1QLBB 5IKCM 3GOEA 4I6PA 1FM0D 4IC7B 3MC9A 4K7WA 3AE7B 3TMPB 2ZNVB 1WGGA 1QOGA 2BPSA 1ET6A 1V5OA 2BVCA 4HWIB 3P4SB 2AEHA 2DWQA 2RD0A 4OVVA 4YL8A 2LASA 4NQKE 2V3PA 3K9PB 3AULA 1DYQA 1L5PA 1R4MB 3Q3MC 5L95C 3H7PA 4XZ4A 1T0RC 3PLVA 1FO4A 4A3OA 3W9CB 4KIKB 1UH6A 3VAWA 1XEEA 4IDIA 2PMVA 2KDMA 5DPSA 4JLCA 4FA6A 4DHJD 2I2YA 3Q3FA 4MDKE 2JY6A 4HLEA 4OZAA 2J0MA 4HXDA 3EUB2 3WANA 2MJ3A 1RYJA 1WE6A 1LO5D 3PS6A 1WY8A 1FFVA 3W2DA 2MEKA 4HPLB 2PVGC 3AB5A 4I6LB 2PKOA 3AEDB 5LXHA 1IBXA 4A8XC 5IAAC 1IPGA 3IXSA 3NVWA 1YNTE 4WQOB 5AZGA 2H88B 1HTOA 3T3NA 3TL5A 3OJ4B 2DZJA 3VTVA 4QAYA 3KLSX 4OZBA 3L13A 1L0VB 2BWFA 3SD5A 1I4PA 4ARIA 1VD2A 3RZWC 5AUKA 3UINB 3VXWA 2C9WB 2JRHA 4DBGA 1E8WA 1OEYJ 5KHOA 1SE3A 4PS7A 3NRZA 2CHXA 1FIQA 4MSMB 1Y56A 1CZPA 3KUZA 3AEBB 5G5HA 4C4VA 3MC8A 2J0KA 1TY2A 4RF0A 4GDLB 3WAPA 2FAZA 2DLBA 2V3SA 3WALA 1SBBB 4ZRIA 1V49A 2M56B 1WJ4A 2N0SB 5FK9C 2I1JA 3R8BA 3L10B 1E7UA 2PE6B 1VRAB 4JE3B 3I5JC 2VH1A 1B1ZA 1M94A 3B9JA 4GXBA 1MHHE 1OFFA 3APFA 1KTKA 4BKSA 4EEWA 1HZ5A 3ZXRA 3KWVA 1WFYA 5D94A 4W9LA 1LM8B 4ZRPA 3MC0B 1RLFA 1AWDA 2LZ6A 2KMAA 1YOVB 5BO4B 3PPAA 1C4PA 1QOFA 2K3UA 4HRSA 4DXGA 2G45B 4RGNA 3VH4B 5EE9A 2BT6A 3CWIA 3VVWB 3W1SC 2MBHA 3ALBA 2WXGA 1YX6B 2QJLA 4XDDA 1A70A 1JROA 4KSLC 2ZJDA 1UBIA 4PYZA 1L0XB 3ZVVA 1IBXB 3P63A 3ML9A 1JCKB 1XT9B 2CHZA 1BMLC 2G4DB 2XEWA 1F1HA 2N9KA 3L17A 4GDKA 3PZ8A 2EKIA 4W9KA 2AQ1B 2IY1B 3MHZA 3LYYA 2GBMA 1F2RC 1ZP0B 1AARA 1VR9A 1FD6A 2IO3B 2FCSA 1NDDA 5IOIA 3ZTDA 2JF5A 4YSZB 4XWTA 2XK5A 3PZDA 3QHTA 1GB4A 3DBHI 1UGMA 2O6VA 3AE4B 4P1BC 2FNJB 1L6UA 1IP9A 4XGAB 4P7IA 2AYOB 3QAQA 4C7YA 2KLCA 4C4VB 4GOCA 2D3BA 2FIDA 3OJ3A 1SGHA 3TEZA 3AV8A 1P7EA 4B6WA 3L0WB 4FJZA 4LNOA 2BF8B 4WWOA 4Q2JA 1GB1A 1V97A 3CF6E 2BYFA 3LB8C 4KZCA 1TS4A 1YJ1A 4MH8A 3HRDD 4CYEA 3N32A 5EE3A 4RF1A 2IO0B 3GZNB 3GS2A 4P6VF 2CHWA 2HD5B 1E90A 2D3CA 2V9HA 5D2MB 3TJPA 4CQNA 2L1AA 4WQMA 4D2KA 3VR9B 2KMCA 2J0JA 2JX5A 4G3XB 3J9CA 1FPYA 2FCQA 3MFGA 2GLSA 1IGDA 4MELA 3W5VB 4MGIE 1VZ6A 4KSKC 3SHQA 3AE1B 2JYEA 2LEKA 3N1ZC 4LNKA 1MVKA 4HROA 2KWUB 4M0WA 3KYCD 3IG3A 1GAQB 2KFJA 4A55A 3AEAB 3P4QB 5BYSA 4RH6A 3R3MA 1XLPA 2JYTA 3MP9A 4WJOA 2W3SA 3PO0A 3AE5B 3PRZA 4G50A 2WDRB 4ICUA 1GC6A 4YSYB 2ZW1A 4GDKB 2N9PC 3B0AA 2WXHA 5E6PA 3X23A 2OJRA 3L16A 2KFKA 1WZ0A 1YD8U 2LWPA 4IWQA 4RGMA 2CR5A 3VRBB 1VZ7A 1R4MI 3VTWA 5BYQA 2LGDA 4B9KA 1N63A 3CIRB 4PK1A 3JSVA 1RFAA 2CKHB 2BKRB 2XK5B 4C80A 4YWGG 2LHDA 1ZGUB 2KT7A 2MQJA 1U4AA 3L4PA 1F9JA 3R7RA 1DOYA 4RCOA 1K51A 1FEHA 2CJOA 1L2NA 1NI3A 2OEDA 4YT0B 2KLGA 1TIFA 2RDBC 2YLMA 3AE8B 2GI9A 4ANXA 4DWFA 2CU1A 3ZNZB 1D5XC 1WJUA 2QMTA 3A9KB 2R61A 1QZEA 2REXA 2X38A 1EO6A 1SF0A 3APCA 2C7NB 2IO2B 2KQSA 5AZHA 4USAA 3M95A 4W9IA 3D32A 1SE9A 2IYDB 1PUTA 3Q2AC 1TBEA 3URYA 3QQ8B 2IGDA 1WGKA 2WXKA 4JL9A 3DBLB 2KQ4X 3U30A 1MJDA 3AE6B 3B1LX 3SDLC 1Q5WB 3V05A 1PGAA 5D6JB 1FXTB 5HKHA 4MT5A 2DYBA 1JWSD 1T0YA 2KNBA 2C7MB 3EC8A 4WAAA 2JZPA 4YXDB 4EOYA 4J3OD 5I4DA 3UIPB 5HI1A 3EGRA 3DVGY 4IKGA 4XDCA 1ACCA 4KVGB 3AE3B 5IN7A 2VZKB 4KV2A 1FNVA 1JWAD 3UQBA 4FJVB 4FHJA 2QCZA 4LNNA 4F1SA 4AJWA 4KX6B 2K0PA 3NOBA 2M0XA 1STEA 2IGGA 1IGCA 1T5XD 3NZ3A 5CTRC 2WXFA 4PYUA 3JSVB 1ZXHA 4WAFA 3A33B 4AWJA 2NPTB 2JXXA 2BQQA 2NMQA 2V3NA 4ZRJA 4IOIE 4ANUA 3Q8EA 2WU2B 2TSSA 2Z59B 2CS4A 3ZNID 1Q1OA 2HE7A 2WLBA 2BGFA 2LUMA 2A5UA 3RMKC 4WJNA 3JYUA 3UIOB 1VLBA 5C23A 1YX5B 4E71A 5FR3A 2MSED 4B0MA 4ZHPA 2W55A 2KJRA 4NAWA 1F2RI 3A1QA 4MM3B 1V8CA 3SFDB 1JWBD 3KH0A 1KH0A 1V9JA 4GB9A 2E3TA 3HUIA 4W9EA 2LGSA 3BK1A 1YN5A 3R2IA 4W9JA 3Q14C 4LTUA 4OZCA 4HCPB 2LVOA 5D7GA 3LDZE 2OHFA 2ZEQA 3PREA 1L0YB 3Q3JA 2JPHA 2B3AA 3ZUNA 3NG0A 3M62B 5HHDG 1HA5A 1YQ3B 1E8ZA 1P98A 1CK1A 2J42A 4ANVA 2FBWB 4US8A 1SE4A 3RNCC 5IA7A 3Q8BA 2ONQA 4MGZE 2KTFA 1BXTA 3Q8CA 4LK0M 2PE9A 1WRDB 2WXLA 3Q8FA 1YN4A 1TKEA 2K9XA 3VUXA 1OQYA 1J8CA 3HHMA 4S0RA 2X8XX 1D3ZA 2JRIB 3RPFC 2KK8A 3B08A 4FADA 1Y8RC 2ZNVC 4MGYE 1EWYC 3GZNI 1C79A 2NS5A 3T3OA 2IY0B 4AQ7A 4N9F4 4M02A 3A4SC 1NEKB 1QILA 2IDYA 2Y5CA 1XQQA 4TKNA 1XLOA 4DDGD 2K25A 3OG5A 2HDEA 2N1VA 1ZOYB 4TQ1A 4EKUA 2HJ1A 3FKYA 2H89B 4HCNB 4W9FA 2L8JA 3DWMA 2JT4B 2IZVB 5EE0A 4KGSA 4DHZB 2XNAC 1OGWA 1N6ZA 1WRIA 4GSWA 2LFIA 1RWSA 3HVDA 4PS8A 1C77A 2OOBB 1BUIC 5HG2A 1BT0A 3NZSA 4NAWB 2LGIA 1QQRA 4E74A 1ZUD2 3I9V1 1F0ZA 1WXMA 1EWCA 2DAFA 2K5PA 2NVUI 4W9CA 4NZLB 1XCTL 2MH7A 1NI2A 1E0ZA 3JVZX 2QC8A 3DVNV 1FFUA 1FRRA 4BAXA 4W9DA 4WIPA 2QDFA 2JXTA 3AU5A 1JRUA 3IT4B 3L08A 5AUIA 1CJEA 1ZXIA 1C76A 3AEEB 2C5LC 2M4NA 3W1YA 2JWUA 3DQVA 4MSQB 4N6EB 2OJWA 1WGYA 4ZOHC 4M00A 3MHSD 2JWZA 3ZRFA 2G9HD 2MBQA 1NVID 4FN2A 1TZOA 4HKZE 2RDGA 2GBJA 5BMIA 1C9FA 1YJJA 3QA8A 1C4CA 2C7HA 2PLPA 3H7PB 4JPSA 3IVFA 4KDIC 3RUIB 2BS3B 2HTME 3DBLI 3M63B 5H8YE 4K3BA 1WXQA 1LXDA 2JUOA 3T9LA 3X0WA 1TYGB 3VH3B 3C8YA 3H6NA 2KAJA 2MX2A 2ZPYA 4MGKE 3IHPC 5AEKB 1GUAB 2W82A 4DHJB 1MHXA 3PV1A 3GE8C 4P1CC 3GB1A 1FXAA 4S17A 3HIZA 2ZCCA 2KDIA 1F52A 3VFKA 2KKCA 1EF1A 1SSNA 1RM6C 1P0RA 5LXIB 1S1QB 1K52A 1SJED 3EA6A 5T8IA 1E7VA 4II2B 1ESFA 4FHKA 3FILA 3V60A 4ZHOA 4MJSA 1GG3A 3R2TA 3AM9A 2DZKA 3QK0A 2L76A 4B0EA 5JHAA 3ZKJC 2VH2A 2LUEA 3OWEB 4XWWA 3KQ4A 2R2OA 2KXJA 3VUYA 4LJOB 1Q10A 5IP4D 1MPEA 3DBRB 1XLQA 3BINA 1DOIA 2HJ8A 3ZIMA 3CSTA 1GOZA 4TV3A 1L6VA 3T8MA 3QCAA 3H7SA 1AYFA 4WWMA 2JSVX 3DWGC 3ZNGC 3U8ZA 1WXAA 2I38A 2BYVE 5BYRA 4X57B 5EDSA 2VRRB 3WAOA 1T0SC 1JWMD 5CHFA 3R66C 2WDQB 1UWMA 3LXFA 4ZRQA 1WF9A 1ISNA 1E10A 2DENB 2WXOA 2IGHA 3P1MA 1I42A 3PSEB 3AH7A 4OVZA 3QWZB 4HPPA 4REZA 2RPQA 3HM3A 1FRDA 1OEYA 4NQLB 4ZDVA 2N7JA 3TIXA 1C1YB 1E8XA 4KKJA 3TEWA 5J2RA 2LGYA 5G5GA 4UDUC 4YTPB 2LJIA 1FCLA 1M4VA 2L0FA 5CHWA 2WYQA 3DOWA 2LGXA 3KW5B 3ZXVA 1SIFA 2PIAA 1D5ZC 3OLMD 2YEPF 4H2AA 2WS3B 2EMTA 3NVZA 4KGTA 1NBFC 4BBNC 2L52A 3PLUA 4WH4A 4TUUA 2WDVB 4EUTA 5BMHA 1QOAA 3AE9B 4IG7B 4XX5A 2CJNA 1SJHD 2AQ2B 1ZDXA 2MW5A 2JZ3B 3FILB 4K1RB 1UUPA 2ACZB 4NJ6A 3Q6BA 3RT3B 2WX0A 1R4NB 4IUMB 3N1YC 1KFYB 5AZFA 2KN4A 4HJKA 2LVQA 4A3PA 2JZZA 3U7DA 3H9DA 2PJHA 1WIAA 3I57A 3TBLD 1PFDA 3RCZA 4MH0E 4EZLA 2O2VA 2K22A 2FUHB 5FR6A 2O6VB 2J7QB 2J52A 4RGOS 4DQOC 4ITKA 2NBWB 1DOXA 1B9RA 1P3QU 3KYDD 4K3CA 3N20C 4A6QA 4BKTA 1V5TA 5L83A 2N7EA 2N9EB 3MTNB 1Z2MA 1WMHA 4OHJA 1VCBA 4DXAB 1KOTA 4KGRA 4BVUC 2NR2A 1OQQA 1N62A 3BWUD 2N7DA 2KJHB 2D3AA 2V0GA 2G4SA 2QSDA 2XN9C 2WX1A 3PHWB 3KVFB 5CHVC 3EHVA 4J6IA 1E8YA 2K6DB 2K6QA 2HTHA 4BZAA 2G3QB 3PHXB 1MFWA 2KYWA 4F8CB 1WR6E 2L3ZA 4ANWA 3BZDB 2KD0A 4RM8A 5FKAC 2PPHA 1RFKA 2WXQA 1VDVA 5DPWA 4M0WB 4GLSC 5LNK1 3NY5A 2ZVOA 2PEAA 2ON8A 5TSSA 4HDQA 2K8BA 3ZW3A 1V1PA 2KTRA 2UU7A 1KJTA 4LJPB 3V6CB 2MHJA 2LVPA 2RMMA 3VUWA
chains in the Genus database with same CATH topology
2KVRA 3B08A 4FADA 1Y8RC 2ZNVC 3CSFA 1RLFA 1WYWB 4MGYE 3GZNI 2NS5A 2DYMA 2LZ6A 2IY0B 5C1ZA 2R2QA 2KMAA 5BO4B 2ZVNA 2KFKB 3PPAA 1Z5SB 2RSUA 4N9F4 4WWNA 2RR9A 3A4SC 1EUVB 3NHEB 2G45B 4RM9A 1G6JA 3NZUA 2KC2A 1P1AA 4JGHB 1XQQA 4TKNA 3VH4B 4DDGD 2K25A 4TQ1A 2N1VA 3VTUA 4EKUA 3QJZA 3VVWB 3BY4B 4NNJB 4HCNB 4W9FA 2L8JA 3W1SC 2MBHA 4M8MA 2FCMA 4EZKA 3ALBA 2AL3A 4IW0A 1YX6B 2I1KA 3X23A 4MJSB 2JT4B 2AL6A 1WI0A 2IZVB 3QARA 4G0NB 4KSLC 2ZJDA 1TGZB 4MEMA 4DHZB 1UBIA 1WH3A 3HK0A 4PYZA 4GU2A 1OGWA 3ZVVA 3ML9A 1XT9B 1V2YA 2LXAA 2CHZA 2O2VB 3OAWA 2G4DB 2UYZB 4GSWA 1TZ1A 4JQWC 2XEWA 4DK5A 3L17A 4K7SA 4GDKA 3PT2B 4JIOU 4PS8A 4HK2A 2OOBB 4E3CA 3ECIA 4IM3A 1UZXB 4KIKA 4W9KA 2NCNA 2IY1B 2V1YA 2GBMA 2NBUA 4WJPA 2KANA 1BT0A 3NZSA 4NAWB 1LFDA 4NPNA 4BOZB 4F7ZA 5DCNA 2ASQA 2BKFA 3VHTC 4DDID 4E74A 1AARA 2NPTA 2N9XA 2IO3B 1WXMA 1TTNA 2FCSA 1NDDA 2DAFA 3S2AA 2NVUI 3ZTDA 1WX7A 1WR1A 2JF5A 4W9CA 3VQIA 1YQBA 4XC2A 3PTFC 2XK5A 3PZDA 3QHTA 1NI2A 3NS8A 2QHOA 4B95A 3V61A 3JVZX 3DVNV 4ZYNA 3DBHI 1UGMA 5TR5A 3ZDMC 4W9DA 2O6VA 2MLBA 3IBEA 3CMMB 2MBEA 3SU8X 2GBRA 3AU5A 1RAXA 2D2QA 2FNJB 1WGHA 1JRUA 1IP9A 4P7IA 2AYOB 3A9JA 3L08A 3QAQA 4K81A 2KLCA 4K7UA 4AP4C 4GOCA 2FIDA 2KDBA 3OJ3A 4MM3A 1J0GA 4TQ0A 1SGHA 2C5LC 3DBRI 2M4NA 2MWSB 3W1YA 3H1UA 1P9DU 3DQVA 4BKGA 2KX3A 4MSQB 4M8NA 4B6WA 2EKEC 3L0WB 2GOWA 2BWES 4FJZA 3ML8A 5LLIA 2BF8B 4WWOA 1WGYA 1GC7A 3QC8B 3QX1A 3UGBB 3CF6E 1MG8A 2BYFA 2WDTB 4URKA 2A4ZA 3MHSD 4KZCA 1YJ1A 2JWZA 2YVCA 3DBSA 3ZRFA 3ZRCA 4CYEA 4II3B 2MBQA 3N32A 2KTRB 1V86A 2IO0B 3ONSA 3ZNHB 4AJYB 4FN2A 2CHWA 2HD5B 1E90A 2RGFA 5D2MB 3DVNU 3TJPA 2GBJA 4NJ7A 2KO3A 5J17A 2KMCA 1C3TA 2GMIC 2J0JA 1UBQA 4G3XB 4IM0A 1L7YA 2KWCA 3QA8A 2FCQA 3I3TB 2L0TA 4AOFA 2C7HA 3AU4A 4BBNF 1IYFA 3ZTCA 4MELA 3H7PB 4MGIE 2N1WA 3IVFA 4KDIC 4KSKC 3RUIB 3SHQA 1X1MA 3RYTA 3EECA 2ZZPB 3EFUA 2MCNB 3DBLI 3M63B 2KWUB 2MP2A 3N30A 5E6NA 1LXDA 3PRMB 2JUOA 3T9LA 4DHZE 3KYCD 3IG3A 2KFJA 3X0WA 2BYEA 3VH3B 3PVLA 3H6NA 1GJZA 2LI5A 2MX2A 3R7QA 3R3MA 1ZKHA 2ZPYA 4FJYA 4MGKE 2N4FA 1YIWA 3IHPC 5AEKB 1WX9A 1GUAB 2KX0A 4WJOA 4DHJB 3PV1A 2XBBC 3PRZA 4G50A 2FCNA 2FIFA 4ICUA 1UD7A 4WWPA 3KUCB 1GC6A 4KDLB 3HIZA 4GDKB 2N9PC 3B0AA 2ZCCA 3DCGA 1WXSA 2KDIA 5E6PA 1WX8A 3WIMA 2OJRA 3L16A 4IWPA 1WZ3A 3RD2A 1J19A 3VFKA 2KFKA 2IO1B 1WZ0A 2KKCA 1EF1A 1CMXB 2KOXA 1YD8U 3W1SA 2LWPA 1WGRA 4LDTB 4IWQA 4EFOA 2LJ5A 4BOSC 3WAMA 1P0RA 5LXIB 2LRWA 2CR5A 1S1QB 1V6EA 1R4MI 3VTWA 2DHZA 1E7VA 1WJNA 2IBIB 2LGDA 1LQBA 2EMSA 4FHKA 4II2B 4B9KA 4FBJB 3A1QB 1EF5A 3JSVA 2D10A 3V60A 1RFAA 1GG3A 4LDTD 4MJSA 4AUQC 1KM7A 2CKHB 2BKRB 2XK5B 4ASWC 2DZKA 4A20A 1ZGUB 1WMHB 3QK0A 2L76A 1K8RB 5JHAA 3ZKJC 4GIVA 2LUEA 2MQJA 1Q0WB 1U4AA 2D11A 2KXJA 2R2OA 3VUYA 4IM2A 1F9JA 1R4NI 3APDA 2KDEB 3R7RA 3V62A 4LJOB 1V80A 3VUWA 1L2NA 3BINA 3K9OB 2KHWB 3A9JB 2HJ8A 3RULA 3ZIMA 5JZEB 1I35A 2UWQA 3CSTA 2KLGA 2M1MA 2AWTA 1H4RA 2YLMA 1WJ6A 3HM6X 4TV3A 2MBOA 3AI5A 3ENEA 3T8MA 4ANXA 4DWFA 3QCAA 2CU1A 5GMVA 5G55A 3ZNZB 1WJUA 3H7SA 2V4LA 1V81A 3A9KB 2K8CA 2KWVB 1QZEA 2REXA 3ZNGC 3U8ZA 3VDZA 1WXAA 3ZLZA 1S3SG 5E6OA 3ZDTA 2BYVE 2DX5B 1EO6A 3APCA 1ZW7A 2C7NB 2IO2B 2KQSA 2Z0DB 2VRRB 4X57B 5EDSA 2DZMA 3WAOA 5AZHA 5CHFA 4GN1A 3M95A 1H8CA 4W9IA 3R66C 4G11A 3D32A 1GNUA 4GGQA 1SE9A 3AXCA 2IYDB 3JW0X 3M3JA 1WF9A 1ISNA 3MJWA 1TBEA 2DENB 2Z0EB 3QQ8B 2Y5BB 4JL9A 3WA0A 2L7RA 3U30A 3B1LX 3SDLC 1WE7A 1RRBA 1Q5WB 1PQSA 2LD9A 3PSEB 1I42A 2L05A 2GBKA 4W9GA 5DPTA 3QWZB 5D6JB 2RPQA 3HM3A 2L00B 4GDLA 1FXTB 1OEYA 4NQLB 5DPRA 2LRUA 3DVGX 4ZDVA 2KZRA 5HKHA 2DZIA 2MP2B 3DDCB 3TIXA 1C1YB 1E8XA 4BKSD 3GOEA 2DYBA 1WM3A 4I6PA 5J2RA 4HDOA 2LGYA 4IC7B 1T0YA 3RZFA 4K7WA 3TMPB 5J18A 2L0FA 2KNBA 1WGGA 2M17A 2ZNVB 5CHWA 2C7MB 2WYQA 2BPSA 3DOWA 3V6EB 2LGXA 3KW5B 4HVBA 1SIFA 3EC8A 1V5OA 4IWOA 4WAAA 3PGEA 2MBBB 3N3KB 4HWIB 3OLMD 4PS3A 4CHKA 4EOYA 2AEHA 3LJ3A 3UIPB 3DVGY 2EMTA 2ZCBA 2RD0A 2KJ6A 4OVVA 4YL8A 1NBFC 3A4RA 2LASA 4BBNC 4NQKE 2M8SA 4KVGB 3K9PB 1OTRB 4I6NB 3AULA 3PLUA 4KV2A 5L95C 4ZRKA 3H7PA 4TUUA 4XZ4A 3UQBA 4FJVB 4EUTA 4FULA 3PLVA 4FHJA 4A3OA 2ZPNA 2KDFB 4KZ0A 4IG7B 4KIKB 1UH6A 2C60A 4XX5A 3VAWA 4AJWA 4F1SA 3C0RB 3NOBA 5DPSA 4JLCA 2M0XA 4DHJD 4FA6A 1E5WA 5CTRC 2MW5A 4PYUA 2JZ3B 3Q3FA 4MDKE 3JSVB 2JY6A 1HE8A 4HLEA 4K1RB 2J0MA 4NJ6A 3A33B 4HXDA 3RT3B 2WX0A 4AWJA 2NPTB 3WANA 4IUMB 2JXXA 2KN5A 4ZRJA 4RMAA 5AZFA 4ANUA 5CX3A 4OVUA 1WE6A 1WXVA 4HJKA 2LVQA 3PS6A 4A3PA 2KC1A 1WY8A 4HPLB 2JZZA 3U7DA 2Z59B 3H9DA 2PJHA 2CS4A 1WIAA 4FLHA 4I6LB 3ZNID 3UQAA 1Q1OA 2HE7A 5LXHA 2BGFA 3TBLD 2A5UA 3RCZA 4WJNA 5IAAC 4MH0E 4WJQA 4EZLA 2O2VA 3JYUA 1IPGA 3UIOB 2FUHB 5FR6A 2O6VB 5C23A 4ICVA 4WQOB 2J7QB 5AZGA 5G2NA 3TCAA 2NBVB 1YX5B 4W9HA 1WM2A 3DPDA 4E71A 5KHQA 2GBNA 2MSED 3ZO5B 3TL5A 4CO7A 4NY0A 3IFWB 2NBWB 2KJRA 2DZJA 3OJ4B 3VTVA 4NAWA 3KUDB 3A1QA 1P3QU 3KH0A 1V9JA 2DYOA 3KYDD 4GB9A 3L13A 2O6VD 2BWFA 4BKTA 3O65B 1V5TA 3SD5A 5L83A 4BFRA 2N7EA 4W9EA 4W9JA 2WWZA 2K39A 2N9EB 3MTNB 1Z2MA 1WMHA 3QIJA 4EZJA 1VCBA 1VD2A 3RZWC 4DXAB 3UINB 3VXWA 4HCPB 2K1FA 2LVOA 1KOTA 5D7GA 2C9WB 4BVUC 2JRHA 2NR2A 3LDZE 2ZEQA 3PREA 4HPMB 4DBGA 1E8WA 1OEYJ 2N7DA 5KHOA 3UF8A 3Q3JA 2JPHA 2KJHB 2B3AA 4PS7A 3ZUNA 3P2BA 2G4SA 2WX1A 2CHXA 3PHWB 4MSMB 3KVFB 5CHVC 3EHVA 3KUZA 1XD3B 3M62B 3L54A 1KLVA 4J6IA 1E8YA 2K6DB 2K6QA 1E8ZA 2HTHA 2J0KA 2G3QB 3PHXB 4F8CB 1P98A 4GDLB 1WR6E 2DAJA 2MRPA 3WAPA 2FAZA 2V3SA 5JH5C 3A9KA 3WALA 2MA9B 2L3ZA 4ZRIA 1V49A 4ANWA 4ANVA 1WJ4A 5JHBA 2KD0A 2I1JA 4RM8A 5IA7A 3L10B 1E7UA 2PPHA 2PE6B 2D07B 4MGZE 5DPWA 2KTFA 4M0WB 1WGDA 3NY5A 2ZVOA 4LCDE 2PEAA 2D3GA 2PE9A 2W9NA 1M94A 4HDQA 4GXBA 2JVCA 2K8HA 1WRDB 2KQ7A 2K8BA 3ZW3A 2KTRA 3APFA 4GMVA 1KJTA 3PRPB 3VUXA 4BKSA 1OQYA 4EEWA 4LJPB 1J8CA 3HHMA 1A5RA 1D3ZA 2LXCA 2JRIB 1WFYA 5D94A 3V6CB 4W9LA 2LVPA 1LM8B 2KK8A 1UELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVR A;  3B08 A;  4FAD A;  1Y8R C;  2ZNV C;  3CSF A;  1RLF A;  1WYW B;  4MGY E;  3GZN I;  2NS5 A;  2DYM A;  2LZ6 A;  2IY0 B;  5C1Z A;  2R2Q A;  2KMA A;  5BO4 B;  2ZVN A;  2KFK B;  3PPA A;  1Z5S B;  2RSU A;  4N9F 4;  4WWN A;  2RR9 A;  3A4S C;  1EUV B;  3NHE B;  2G45 B;  4RM9 A;  1G6J A;  3NZU A;  2KC2 A;  1P1A A;  4JGH B;  1XQQ A;  4TKN A;  3VH4 B;  4DDG D;  2K25 A;  4TQ1 A;  2N1V A;  3VTU A;  4EKU A;  3QJZ A;  3VVW B;  3BY4 B;  4NNJ B;  4HCN B;  4W9F A;  2L8J A;  3W1S C;  2MBH A;  4M8M A;  2FCM A;  4EZK A;  3ALB A;  2AL3 A;  4IW0 A;  1YX6 B;  2I1K A;  3X23 A;  4MJS B;  2JT4 B;  2AL6 A;  1WI0 A;  2IZV B;  3QAR A;  4G0N B;  4KSL C;  2ZJD A;  1TGZ B;  4MEM A;  4DHZ B;  1UBI A;  1WH3 A;  3HK0 A;  4PYZ A;  4GU2 A;  1OGW A;  3ZVV A;  3ML9 A;  1XT9 B;  1V2Y A;  2LXA A;  2CHZ A;  2O2V B;  3OAW A;  2G4D B;  2UYZ B;  4GSW A;  1TZ1 A;  4JQW C;  2XEW A;  4DK5 A;  3L17 A;  4K7S A;  4GDK A;  3PT2 B;  4JIO U;  4PS8 A;  4HK2 A;  2OOB B;  4E3C A;  3ECI A;  4IM3 A;  1UZX B;  4KIK A;  4W9K A;  2NCN A;  2IY1 B;  2V1Y A;  2GBM A;  2NBU A;  4WJP A;  2KAN A;  1BT0 A;  3NZS A;  4NAW B;  1LFD A;  4NPN A;  4BOZ B;  4F7Z A;  5DCN A;  2ASQ A;  2BKF A;  3VHT C;  4DDI D;  4E74 A;  1AAR A;  2NPT A;  2N9X A;  2IO3 B;  1WXM A;  1TTN A;  2FCS A;  1NDD A;  2DAF A;  3S2A A;  2NVU I;  3ZTD A;  1WX7 A;  1WR1 A;  2JF5 A;  4W9C A;  3VQI A;  1YQB A;  4XC2 A;  3PTF C;  2XK5 A;  3PZD A;  3QHT A;  1NI2 A;  3NS8 A;  2QHO A;  4B95 A;  3V61 A;  3JVZ X;  3DVN V;  4ZYN A;  3DBH I;  1UGM A;  5TR5 A;  3ZDM C;  4W9D A;  2O6V A;  2MLB A;  3IBE A;  3CMM B;  2MBE A;  3SU8 X;  2GBR A;  3AU5 A;  1RAX A;  2D2Q A;  2FNJ B;  1WGH A;  1JRU A;  1IP9 A;  4P7I A;  2AYO B;  3A9J A;  3L08 A;  3QAQ A;  4K81 A;  2KLC A;  4K7U A;  4AP4 C;  4GOC A;  2FID A;  2KDB A;  3OJ3 A;  4MM3 A;  1J0G A;  4TQ0 A;  1SGH A;  2C5L C;  3DBR I;  2M4N A;  2MWS B;  3W1Y A;  3H1U A;  1P9D U;  3DQV A;  4BKG A;  2KX3 A;  4MSQ B;  4M8N A;  4B6W A;  2EKE C;  3L0W B;  2GOW A;  2BWE S;  4FJZ A;  3ML8 A;  5LLI A;  2BF8 B;  4WWO A;  1WGY A;  1GC7 A;  3QC8 B;  3QX1 A;  3UGB B;  3CF6 E;  1MG8 A;  2BYF A;  2WDT B;  4URK A;  2A4Z A;  3MHS D;  4KZC A;  1YJ1 A;  2JWZ A;  2YVC A;  3DBS A;  3ZRF A;  3ZRC A;  4CYE A;  4II3 B;  2MBQ A;  3N32 A;  2KTR B;  1V86 A;  2IO0 B;  3ONS A;  3ZNH B;  4AJY B;  4FN2 A;  2CHW A;  2HD5 B;  1E90 A;  2RGF A;  5D2M B;  3DVN U;  3TJP A;  2GBJ A;  4NJ7 A;  2KO3 A;  5J17 A;  2KMC A;  1C3T A;  2GMI C;  2J0J A;  1UBQ A;  4G3X B;  4IM0 A;  1L7Y A;  2KWC A;  3QA8 A;  2FCQ A;  3I3T B;  2L0T A;  4AOF A;  2C7H A;  3AU4 A;  4BBN F;  1IYF A;  3ZTC A;  4MEL A;  3H7P B;  4MGI E;  2N1W A;  3IVF A;  4KDI C;  4KSK C;  3RUI B;  3SHQ A;  1X1M A;  3RYT A;  3EEC A;  2ZZP B;  3EFU A;  2MCN B;  3DBL I;  3M63 B;  2KWU B;  2MP2 A;  3N30 A;  5E6N A;  1LXD A;  3PRM B;  2JUO A;  3T9L A;  4DHZ E;  3KYC D;  3IG3 A;  2KFJ A;  3X0W A;  2BYE A;  3VH3 B;  3PVL A;  3H6N A;  1GJZ A;  2LI5 A;  2MX2 A;  3R7Q A;  3R3M A;  1ZKH A;  2ZPY A;  4FJY A;  4MGK E;  2N4F A;  1YIW A;  3IHP C;  5AEK B;  1WX9 A;  1GUA B;  2KX0 A;  4WJO A;  4DHJ B;  3PV1 A;  2XBB C;  3PRZ A;  4G50 A;  2FCN A;  2FIF A;  4ICU A;  1UD7 A;  4WWP A;  3KUC B;  1GC6 A;  4KDL B;  3HIZ A;  4GDK B;  2N9P C;  3B0A A;  2ZCC A;  3DCG A;  1WXS A;  2KDI A;  5E6P A;  1WX8 A;  3WIM A;  2OJR A;  3L16 A;  4IWP A;  1WZ3 A;  3RD2 A;  1J19 A;  3VFK A;  2KFK A;  2IO1 B;  1WZ0 A;  2KKC A;  1EF1 A;  1CMX B;  2KOX A;  1YD8 U;  3W1S A;  2LWP A;  1WGR A;  4LDT B;  4IWQ A;  4EFO A;  2LJ5 A;  4BOS C;  3WAM A;  1P0R A;  5LXI B;  2LRW A;  2CR5 A;  1S1Q B;  1V6E A;  1R4M I;  3VTW A;  2DHZ A;  1E7V A;  1WJN A;  2IBI B;  2LGD A;  1LQB A;  2EMS A;  4FHK A;  4II2 B;  4B9K A;  4FBJ B;  3A1Q B;  1EF5 A;  3JSV A;  2D10 A;  3V60 A;  1RFA A;  1GG3 A;  4LDT D;  4MJS A;  4AUQ C;  1KM7 A;  2CKH B;  2BKR B;  2XK5 B;  4ASW C;  2DZK A;  4A20 A;  1ZGU B;  1WMH B;  3QK0 A;  2L76 A;  1K8R B;  5JHA A;  3ZKJ C;  4GIV A;  2LUE A;  2MQJ A;  1Q0W B;  1U4A A;  2D11 A;  2KXJ A;  2R2O A;  3VUY A;  4IM2 A;  1F9J A;  1R4N I;  3APD A;  2KDE B;  3R7R A;  3V62 A;  4LJO B;  1V80 A;  3VUW A;  1L2N A;  3BIN A;  3K9O B;  2KHW B;  3A9J B;  2HJ8 A;  3RUL A;  3ZIM A;  5JZE B;  1I35 A;  2UWQ A;  3CST A;  2KLG A;  2M1M A;  2AWT A;  1H4R A;  2YLM A;  1WJ6 A;  3HM6 X;  4TV3 A;  2MBO A;  3AI5 A;  3ENE A;  3T8M A;  4ANX A;  4DWF A;  3QCA A;  2CU1 A;  5GMV A;  5G55 A;  3ZNZ B;  1WJU A;  3H7S A;  2V4L A;  1V81 A;  3A9K B;  2K8C A;  2KWV B;  1QZE A;  2REX A;  3ZNG C;  3U8Z A;  3VDZ A;  1WXA A;  3ZLZ A;  1S3S G;  5E6O A;  3ZDT A;  2BYV E;  2DX5 B;  1EO6 A;  3APC A;  1ZW7 A;  2C7N B;  2IO2 B;  2KQS A;  2Z0D B;  2VRR B;  4X57 B;  5EDS A;  2DZM A;  3WAO A;  5AZH A;  5CHF A;  4GN1 A;  3M95 A;  1H8C A;  4W9I A;  3R66 C;  4G11 A;  3D32 A;  1GNU A;  4GGQ A;  1SE9 A;  3AXC A;  2IYD B;  3JW0 X;  3M3J A;  1WF9 A;  1ISN A;  3MJW A;  1TBE A;  2DEN B;  2Z0E B;  3QQ8 B;  2Y5B B;  4JL9 A;  3WA0 A;  2L7R A;  3U30 A;  3B1L X;  3SDL C;  1WE7 A;  1RRB A;  1Q5W B;  1PQS A;  2LD9 A;  3PSE B;  1I42 A;  2L05 A;  2GBK A;  4W9G A;  5DPT A;  3QWZ B;  5D6J B;  2RPQ A;  3HM3 A;  2L00 B;  4GDL A;  1FXT B;  1OEY A;  4NQL B;  5DPR A;  2LRU A;  3DVG X;  4ZDV A;  2KZR A;  5HKH A;  2DZI A;  2MP2 B;  3DDC B;  3TIX A;  1C1Y B;  1E8X A;  4BKS D;  3GOE A;  2DYB A;  1WM3 A;  4I6P A;  5J2R A;  4HDO A;  2LGY A;  4IC7 B;  1T0Y A;  3RZF A;  4K7W A;  3TMP B;  5J18 A;  2L0F A;  2KNB A;  1WGG A;  2M17 A;  2ZNV B;  5CHW A;  2C7M B;  2WYQ A;  2BPS A;  3DOW A;  3V6E B;  2LGX A;  3KW5 B;  4HVB A;  1SIF A;  3EC8 A;  1V5O A;  4IWO A;  4WAA A;  3PGE A;  2MBB B;  3N3K B;  4HWI B;  3OLM D;  4PS3 A;  4CHK A;  4EOY A;  2AEH A;  3LJ3 A;  3UIP B;  3DVG Y;  2EMT A;  2ZCB A;  2RD0 A;  2KJ6 A;  4OVV A;  4YL8 A;  1NBF C;  3A4R A;  2LAS A;  4BBN C;  4NQK E;  2M8S A;  4KVG B;  3K9P B;  1OTR B;  4I6N B;  3AUL A;  3PLU A;  4KV2 A;  5L95 C;  4ZRK A;  3H7P A;  4TUU A;  4XZ4 A;  3UQB A;  4FJV B;  4EUT A;  4FUL A;  3PLV A;  4FHJ A;  4A3O A;  2ZPN A;  2KDF B;  4KZ0 A;  4IG7 B;  4KIK B;  1UH6 A;  2C60 A;  4XX5 A;  3VAW A;  4AJW A;  4F1S A;  3C0R B;  3NOB A;  5DPS A;  4JLC A;  2M0X A;  4DHJ D;  4FA6 A;  1E5W A;  5CTR C;  2MW5 A;  4PYU A;  2JZ3 B;  3Q3F A;  4MDK E;  3JSV B;  2JY6 A;  1HE8 A;  4HLE A;  4K1R B;  2J0M A;  4NJ6 A;  3A33 B;  4HXD A;  3RT3 B;  2WX0 A;  4AWJ A;  2NPT B;  3WAN A;  4IUM B;  2JXX A;  2KN5 A;  4ZRJ A;  4RMA A;  5AZF A;  4ANU A;  5CX3 A;  4OVU A;  1WE6 A;  1WXV A;  4HJK A;  2LVQ A;  3PS6 A;  4A3P A;  2KC1 A;  1WY8 A;  4HPL B;  2JZZ A;  3U7D A;  2Z59 B;  3H9D A;  2PJH A;  2CS4 A;  1WIA A;  4FLH A;  4I6L B;  3ZNI D;  3UQA A;  1Q1O A;  2HE7 A;  5LXH A;  2BGF A;  3TBL D;  2A5U A;  3RCZ A;  4WJN A;  5IAA C;  4MH0 E;  4WJQ A;  4EZL A;  2O2V A;  3JYU A;  1IPG A;  3UIO B;  2FUH B;  5FR6 A;  2O6V B;  5C23 A;  4ICV A;  4WQO B;  2J7Q B;  5AZG A;  5G2N A;  3TCA A;  2NBV B;  1YX5 B;  4W9H A;  1WM2 A;  3DPD A;  4E71 A;  5KHQ A;  2GBN A;  2MSE D;  3ZO5 B;  3TL5 A;  4CO7 A;  4NY0 A;  3IFW B;  2NBW B;  2KJR A;  2DZJ A;  3OJ4 B;  3VTV A;  4NAW A;  3KUD B;  3A1Q A;  1P3Q U;  3KH0 A;  1V9J A;  2DYO A;  3KYD D;  4GB9 A;  3L13 A;  2O6V D;  2BWF A;  4BKT A;  3O65 B;  1V5T A;  3SD5 A;  5L83 A;  4BFR A;  2N7E A;  4W9E A;  4W9J A;  2WWZ A;  2K39 A;  2N9E B;  3MTN B;  1Z2M A;  1WMH A;  3QIJ A;  4EZJ A;  1VCB A;  1VD2 A;  3RZW C;  4DXA B;  3UIN B;  3VXW A;  4HCP B;  2K1F A;  2LVO A;  1KOT A;  5D7G A;  2C9W B;  4BVU C;  2JRH A;  2NR2 A;  3LDZ E;  2ZEQ A;  3PRE A;  4HPM B;  4DBG A;  1E8W A;  1OEY J;  2N7D A;  5KHO A;  3UF8 A;  3Q3J A;  2JPH A;  2KJH B;  2B3A A;  4PS7 A;  3ZUN A;  3P2B A;  2G4S A;  2WX1 A;  2CHX A;  3PHW B;  4MSM B;  3KVF B;  5CHV C;  3EHV A;  3KUZ A;  1XD3 B;  3M62 B;  3L54 A;  1KLV A;  4J6I A;  1E8Y A;  2K6D B;  2K6Q A;  1E8Z A;  2HTH A;  2J0K A;  2G3Q B;  3PHX B;  4F8C B;  1P98 A;  4GDL B;  1WR6 E;  2DAJ A;  2MRP A;  3WAP A;  2FAZ A;  2V3S A;  5JH5 C;  3A9K A;  3WAL A;  2MA9 B;  2L3Z A;  4ZRI A;  1V49 A;  4ANW A;  4ANV A;  1WJ4 A;  5JHB A;  2KD0 A;  2I1J A;  4RM8 A;  5IA7 A;  3L10 B;  1E7U A;  2PPH A;  2PE6 B;  2D07 B;  4MGZ E;  5DPW A;  2KTF A;  4M0W B;  1WGD A;  3NY5 A;  2ZVO A;  4LCD E;  2PEA A;  2D3G A;  2PE9 A;  2W9N A;  1M94 A;  4HDQ A;  4GXB A;  2JVC A;  2K8H A;  1WRD B;  2KQ7 A;  2K8B A;  3ZW3 A;  2KTR A;  3APF A;  4GMV A;  1KJT A;  3PRP B;  3VUX A;  4BKS A;  1OQY A;  4EEW A;  4LJP B;  1J8C A;  3HHM A;  1A5R A;  1D3Z A;  2LXC A;  2JRI B;  1WFY A;  5D94 A;  3V6C B;  4W9L A;  2LVP A;  1LM8 B;  2KK8 A;  1UEL A; 
#chains in the Genus database with same CATH topology
 2KVR A;  5BMG A;  4HKQ A;  2KMM A;  4LNI A;  2KFK B;  2W54 A;  4WWN A;  1G6J A;  1P1A A;  3VTU A;  2WXM A;  5C2T B;  3QJZ A;  3BY4 B;  1K50 A;  4NNJ B;  4M8M A;  2FCM A;  2I1K A;  1XF5 L;  5EE1 A;  2AL6 A;  1JML A;  3QAR A;  4G0N B;  1NEN B;  3TEX A;  1TGZ B;  4MEM A;  1WH3 A;  2BBC A;  4GU2 A;  2LXA A;  2O2V B;  3OAW A;  3ABV B;  1TZ1 A;  4OW0 A;  4K7S A;  4JIO U;  3U4E G;  1N60 A;  3ECI A;  4IM3 A;  4KIK A;  2BB5 A;  2WHI A;  2NBU A;  4WJP A;  2KAN A;  3O13 A;  1LFD A;  2DBY A;  4F7Z A;  3BVG A;  3VHT C;  4DDI D;  1YN3 A;  3SFE B;  1AW7 A;  4A9A A;  3AMZ A;  2N9X A;  3S2A A;  1ENF A;  1WR1 A;  2E6X A;  3VQI A;  4XC2 A;  1QKZ A;  3PTF C;  1SB3 C;  1AN8 A;  3NS8 A;  4B95 A;  3NVY A;  3P4R B;  2D5G A;  4ZYN A;  1TKG A;  4HEA 1;  4MAC A;  3CMM B;  3SU8 X;  1D4B A;  1RAX A;  2Y5P A;  1JQ4 A;  3RNF C;  2INC C;  4K7U A;  4AP4 C;  3SR6 A;  4TQ0 A;  4O1N A;  3DBR I;  2MWS B;  3H1U A;  1YQ4 B;  4BKG A;  4YTN B;  2KX3 A;  4M8N A;  4HJG E;  2EKE C;  2GOW A;  2BWE S;  5LLI A;  1GC7 A;  4RNA A;  2IPK D;  1D5M C;  2MJE A;  2A4Z A;  4ZYS A;  2SEB D;  3DBS A;  1E6E B;  3ZRC A;  4II3 B;  2KTR B;  1V86 A;  3ONS A;  3ZNH B;  1JRP A;  3DVN U;  4N59 A;  3BYY B;  2KO3 A;  1FNU A;  2WXJ A;  1C3T A;  2GMI C;  2IND C;  2KWC A;  3TEY A;  3AU4 A;  1OQR A;  3ZTC A;  2N1W A;  4TMA B;  1X1M A;  3EEC A;  2ZZP B;  2MP2 A;  3N30 A;  3ZQ4 A;  1E7P B;  1HTQ A;  4DHZ E;  2W3R A;  1GPX A;  4AS1 A;  1PYW D;  1I4X A;  1GJZ A;  1XLN A;  1C78 A;  1ZKH A;  2QIE B;  1TS5 A;  4FJY A;  2N4F A;  2AX5 A;  1SE2 A;  4C7Z A;  2FUG 1;  2FE8 A;  2XBB C;  2FCN A;  1UD7 A;  3RN9 C;  3KUC B;  4KDL B;  1I4Q A;  1TJE A;  4IWP A;  2INP E;  2IO1 B;  1CMX B;  3W1S A;  1WGR A;  1I4H A;  4LDT B;  4BOS C;  3WAM A;  4R3D A;  1V6E A;  4DXF A;  2L32 A;  2QIL A;  2Y3A A;  3ZJV A;  3TSS A;  2IBI B;  2EMS A;  3A1Q B;  2DNF A;  1KLG D;  3RNA C;  4TSS A;  4YTM B;  1ROE A;  1HXY D;  2M19 A;  1FMA D;  4A20 A;  3RI7 C;  4FXC A;  1K8R B;  2WXI A;  2D11 A;  4IM2 A;  1R4N I;  3APD A;  2KDE B;  3K9O B;  3EFC A;  5JZE B;  3RUL A;  1I35 A;  2UWQ A;  3HM6 X;  1WJ6 A;  3BII D;  3AI5 A;  3NS1 A;  3RNG C;  1TT5 B;  4NAM A;  1EU3 A;  2BS4 B;  2V4L A;  1V81 A;  4LNF A;  3ZYY X;  2KWV B;  1D6E C;  1F77 A;  3VDZ A;  1S3S G;  2WQY B;  3N9Y C;  1QOB A;  5E6O A;  3ZDT A;  2DX5 B;  2Z0D B;  2Q5W D;  4GN1 A;  1H8C A;  1T0Q C;  2WXP A;  4NJC A;  4PT5 A;  1ZPS A;  1GNU A;  4GGQ A;  3AXC A;  3JW0 X;  1LGR A;  3MJW A;  2WXN A;  3BVZ A;  2Y5B B;  2J4X A;  2L7R A;  2ICI A;  2L83 A;  1WE7 A;  2LD9 A;  1PQS A;  2WNM A;  2PVO D;  2L05 A;  5DPT A;  1XCQ L;  2L00 B;  2LRU A;  2DZI A;  2MP2 B;  3DDC B;  2SAK A;  3RNE C;  4BKS D;  1WM3 A;  3FAH A;  3HVZ A;  1FXI A;  1V1O A;  4HDO A;  3NUH B;  3RZF A;  3AEG B;  5J18 A;  1NYQ A;  2M17 A;  2BYT A;  3V6E B;  3E56 A;  4HVB A;  4YSX B;  3DHH C;  4IWO A;  3PGE A;  2MBB B;  3N3K B;  4PS3 A;  4CHK A;  3LJ3 A;  1KF6 B;  2ZCB A;  2KJ6 A;  3A4R A;  2M8S A;  4I6N B;  1OTR B;  1N61 A;  4US9 A;  4ZRK A;  4FUL A;  2YEP B;  3BVM A;  1CQV A;  2ZPN A;  2KDF B;  4KZ0 A;  1YJI A;  3UI3 A;  2C60 A;  3ZJT A;  3C0R B;  2MJD A;  1PGB A;  2WU5 B;  1E5W A;  1HE8 A;  5C3J B;  1HQR D;  3VRA B;  1N5W A;  1EM7 A;  2KN5 A;  4RMA A;  1J7B A;  5CX3 A;  3IT6 B;  4OVU A;  1WXV A;  2KC1 A;  2IJ0 A;  1P7F A;  2JU6 X;  4FLH A;  3UQA A;  1UGJ A;  4WJQ A;  5GXG B;  3AEF B;  1T6B X;  4ICV A;  5G2N A;  3TCA A;  1ET9 A;  2NBV B;  1SIJ A;  4W9H A;  1WM2 A;  3DPD A;  5KHQ A;  2GBN A;  3ZO5 B;  4CO7 A;  4NY0 A;  3IFW B;  3KUD B;  2DYO A;  2O6V D;  3O65 B;  4BFR A;  3FC4 A;  2WWZ A;  2K39 A;  1JWU D;  3QIJ A;  4EZJ A;  5HFY A;  2K1F A;  2KVZ A;  4HPM B;  3UF8 A;  3U7Z A;  2NTS A;  4JX1 C;  1QT9 A;  1PGX A;  3P2B A;  2GRI A;  1XD3 B;  4WUR A;  3L54 A;  1KLV A;  1ZDV A;  2DAJ A;  2MRP A;  5JH5 C;  3A9K A;  2MA9 B;  2BW2 A;  1IUE A;  5JHB A;  1HEZ E;  2D07 B;  3IAM 1;  3AEC B;  4JWS C;  3B2G A;  1WGD A;  1WWT A;  4LCD E;  2D3G A;  2KAC A;  2W9N A;  3B2F A;  2RDH A;  2JVC A;  1K53 A;  2K8H A;  2KQ7 A;  3P42 A;  1HZ6 A;  3IAS 1;  4GMV A;  3PRP B;  2N9L A;  1A5R A;  2LXC A;  2V4I B;  2PTL A;  3BYT B;  1UEL A;  3CSF A;  1WYW B;  2DYM A;  5C1Z A;  2R2Q A;  2ZVN A;  1Z5S B;  2RSU A;  2RR9 A;  1EUV B;  3NHE B;  4RM9 A;  3NZU A;  2KC2 A;  4JGH B;  5D3I B;  1SXT A;  1TS2 A;  2LHE A;  4ACF A;  2VZK D;  4RFB A;  4EZK A;  2AL3 A;  2NTT A;  4IW0 A;  3RFZ B;  4MJS B;  4XE0 A;  1MG4 A;  1WI0 A;  3HK0 A;  3RNB C;  3MJ5 A;  1V2Y A;  3Q8A A;  4JQW C;  4DK5 A;  2UYZ B;  4RGT A;  3Q69 A;  3PT2 B;  2INN E;  4N58 A;  3ETR A;  4HK2 A;  1T3Q A;  4E3C A;  1UZX B;  3PZ7 A;  2NCN A;  2V1Y A;  2M0A A;  5D3D A;  3Q3N C;  2PW9 A;  4NPN A;  4BOZ B;  5DCN A;  2ASQ A;  2BKF A;  1I4G A;  2NPT A;  1N5X A;  2WGS A;  4C00 A;  2LMC A;  1TTN A;  1WX7 A;  1YQB A;  4LLG M;  2QHO A;  3V61 A;  1C4A A;  3ZDM C;  5TR5 A;  1JW9 D;  3ZJU A;  2MLB A;  3IBE A;  2MBE A;  2GBR A;  2D2Q A;  1WGH A;  1J7A A;  4XYC A;  3A9J A;  3SEB A;  4K81 A;  1NYR A;  2BB6 A;  2KDB A;  4MM3 A;  1J0G A;  4L1B A;  3NVV A;  1P9D U;  4A90 A;  3ML8 A;  3QC8 B;  3QX1 A;  1SEB D;  3UGB B;  2EEL A;  1MG8 A;  2WDT B;  4URK A;  2YVC A;  4M01 A;  3AN1 A;  4KKI A;  4AJY B;  1UF0 A;  2JQR B;  2RGF A;  1UWX A;  4NJ7 A;  5J17 A;  1KRH A;  1KLU D;  1UBQ A;  2WP9 B;  4IM0 A;  1L7Y A;  4EE2 A;  3I3T B;  2L0T A;  4AOF A;  2J53 A;  2G1E A;  4BBN F;  1IYF A;  1DGJ A;  1ZE3 D;  2WXR A;  1E9M A;  3I63 C;  3RYT A;  3U52 E;  3EFU A;  2MCN B;  5E6N A;  3PRM B;  1XO3 A;  1R7S A;  2ZW0 A;  2BYE A;  3PVL A;  1VJK A;  2LI5 A;  3R7Q A;  1VZ8 A;  1YIW A;  1WX9 A;  1TY0 A;  2KX0 A;  3NJT A;  2FIF A;  1YMH E;  4WWP A;  3VR8 B;  3DCG A;  1WXS A;  1WX8 A;  3WIM A;  1WZ3 A;  3RD2 A;  1J19 A;  1WSP A;  2KOX A;  4EFO A;  2LJ5 A;  3KWL A;  2LRW A;  5JXV A;  5H92 C;  5MPO A;  2DHZ A;  1WJN A;  1LQB A;  2BS2 B;  4FBJ B;  1EF5 A;  3Q3O C;  3DBH B;  2D10 A;  4AUQ C;  4LDT D;  1UNS A;  4P16 A;  1KM7 A;  4ASW C;  1WMH B;  1JAL A;  4L23 A;  4GIV A;  1Q0W B;  3V62 A;  3WCQ A;  3N1X C;  1QF6 A;  3TUO A;  3C19 A;  5IO9 A;  1V80 A;  3U2S C;  2Z8L A;  2KHW B;  3A9J B;  2M1M A;  2AWT A;  1H4R A;  1XXG A;  2MBO A;  3ENE A;  3GE3 C;  4C56 C;  3V3X A;  3BK2 A;  5GMV A;  5G55 A;  1TKY A;  1I7H A;  3H8H A;  1WYG A;  3DHG C;  1J7C A;  2CU3 A;  2AQ3 B;  2K8C A;  3ZLZ A;  4L2Y A;  3AE2 B;  1ZW7 A;  3E9S A;  1FCC C;  2DZM A;  4ARC A;  1MI0 A;  3W5U B;  2RPV A;  2B76 B;  4G11 A;  3ZGZ A;  5E6J A;  3M3J A;  2GB1 A;  2BTE A;  1V1P B;  2Z0E B;  4JWU C;  1PDX A;  3WA0 A;  1L4D B;  3P4P B;  1I4R A;  1L4Z B;  1RRB A;  3DHI C;  1EU4 A;  2GBK A;  3GP7 A;  4W9G A;  1TS3 A;  2QEJ C;  4GDL A;  5DPR A;  2KWD A;  3DVG X;  2KZR A;  1FNW A;  1QLB B;  5IKC M;  3GOE A;  4I6P A;  1FM0 D;  4IC7 B;  3MC9 A;  4K7W A;  3AE7 B;  3TMP B;  2ZNV B;  1WGG A;  1QOG A;  2BPS A;  1ET6 A;  1V5O A;  2BVC A;  4HWI B;  3P4S B;  2AEH A;  2DWQ A;  2RD0 A;  4OVV A;  4YL8 A;  2LAS A;  4NQK E;  2V3P A;  3K9P B;  3AUL A;  1DYQ A;  1L5P A;  1R4M B;  3Q3M C;  5L95 C;  3H7P A;  4XZ4 A;  1T0R C;  3PLV A;  1FO4 A;  4A3O A;  3W9C B;  4KIK B;  1UH6 A;  3VAW A;  1XEE A;  4IDI A;  2PMV A;  2KDM A;  5DPS A;  4JLC A;  4FA6 A;  4DHJ D;  2I2Y A;  3Q3F A;  4MDK E;  2JY6 A;  4HLE A;  4OZA A;  2J0M A;  4HXD A;  3EUB 2;  3WAN A;  2MJ3 A;  1RYJ A;  1WE6 A;  1LO5 D;  3PS6 A;  1WY8 A;  1FFV A;  3W2D A;  2MEK A;  4HPL B;  2PVG C;  3AB5 A;  4I6L B;  2PKO A;  3AED B;  5LXH A;  1IBX A;  4A8X C;  5IAA C;  1IPG A;  3IXS A;  3NVW A;  1YNT E;  4WQO B;  5AZG A;  2H88 B;  1HTO A;  3T3N A;  3TL5 A;  3OJ4 B;  2DZJ A;  3VTV A;  4QAY A;  3KLS X;  4OZB A;  3L13 A;  1L0V B;  2BWF A;  3SD5 A;  1I4P A;  4ARI A;  1VD2 A;  3RZW C;  5AUK A;  3UIN B;  3VXW A;  2C9W B;  2JRH A;  4DBG A;  1E8W A;  1OEY J;  5KHO A;  1SE3 A;  4PS7 A;  3NRZ A;  2CHX A;  1FIQ A;  4MSM B;  1Y56 A;  1CZP A;  3KUZ A;  3AEB B;  5G5H A;  4C4V A;  3MC8 A;  2J0K A;  1TY2 A;  4RF0 A;  4GDL B;  3WAP A;  2FAZ A;  2DLB A;  2V3S A;  3WAL A;  1SBB B;  4ZRI A;  1V49 A;  2M56 B;  1WJ4 A;  2N0S B;  5FK9 C;  2I1J A;  3R8B A;  3L10 B;  1E7U A;  2PE6 B;  1VRA B;  4JE3 B;  3I5J C;  2VH1 A;  1B1Z A;  1M94 A;  3B9J A;  4GXB A;  1MHH E;  1OFF A;  3APF A;  1KTK A;  4BKS A;  4EEW A;  1HZ5 A;  3ZXR A;  3KWV A;  1WFY A;  5D94 A;  4W9L A;  1LM8 B;  4ZRP A;  3MC0 B;  1RLF A;  1AWD A;  2LZ6 A;  2KMA A;  1YOV B;  5BO4 B;  3PPA A;  1C4P A;  1QOF A;  2K3U A;  4HRS A;  4DXG A;  2G45 B;  4RGN A;  3VH4 B;  5EE9 A;  2BT6 A;  3CWI A;  3VVW B;  3W1S C;  2MBH A;  3ALB A;  2WXG A;  1YX6 B;  2QJL A;  4XDD A;  1A70 A;  1JRO A;  4KSL C;  2ZJD A;  1UBI A;  4PYZ A;  1L0X B;  3ZVV A;  1IBX B;  3P63 A;  3ML9 A;  1JCK B;  1XT9 B;  2CHZ A;  1BML C;  2G4D B;  2XEW A;  1F1H A;  2N9K A;  3L17 A;  4GDK A;  3PZ8 A;  2EKI A;  4W9K A;  2AQ1 B;  2IY1 B;  3MHZ A;  3LYY A;  2GBM A;  1F2R C;  1ZP0 B;  1AAR A;  1VR9 A;  1FD6 A;  2IO3 B;  2FCS A;  1NDD A;  5IOI A;  3ZTD A;  2JF5 A;  4YSZ B;  4XWT A;  2XK5 A;  3PZD A;  3QHT A;  1GB4 A;  3DBH I;  1UGM A;  2O6V A;  3AE4 B;  4P1B C;  2FNJ B;  1L6U A;  1IP9 A;  4XGA B;  4P7I A;  2AYO B;  3QAQ A;  4C7Y A;  2KLC A;  4C4V B;  4GOC A;  2D3B A;  2FID A;  3OJ3 A;  1SGH A;  3TEZ A;  3AV8 A;  1P7E A;  4B6W A;  3L0W B;  4FJZ A;  4LNO A;  2BF8 B;  4WWO A;  4Q2J A;  1GB1 A;  1V97 A;  3CF6 E;  2BYF A;  3LB8 C;  4KZC A;  1TS4 A;  1YJ1 A;  4MH8 A;  3HRD D;  4CYE A;  3N32 A;  5EE3 A;  4RF1 A;  2IO0 B;  3GZN B;  3GS2 A;  4P6V F;  2CHW A;  2HD5 B;  1E90 A;  2D3C A;  2V9H A;  5D2M B;  3TJP A;  4CQN A;  2L1A A;  4WQM A;  4D2K A;  3VR9 B;  2KMC A;  2J0J A;  2JX5 A;  4G3X B;  3J9C A;  1FPY A;  2FCQ A;  3MFG A;  2GLS A;  1IGD A;  4MEL A;  3W5V B;  4MGI E;  1VZ6 A;  4KSK C;  3SHQ A;  3AE1 B;  2JYE A;  2LEK A;  3N1Z C;  4LNK A;  1MVK A;  4HRO A;  2KWU B;  4M0W A;  3KYC D;  3IG3 A;  1GAQ B;  2KFJ A;  4A55 A;  3AEA B;  3P4Q B;  5BYS A;  4RH6 A;  3R3M A;  1XLP A;  2JYT A;  3MP9 A;  4WJO A;  2W3S A;  3PO0 A;  3AE5 B;  3PRZ A;  4G50 A;  2WDR B;  4ICU A;  1GC6 A;  4YSY B;  2ZW1 A;  4GDK B;  2N9P C;  3B0A A;  2WXH A;  5E6P A;  3X23 A;  2OJR A;  3L16 A;  2KFK A;  1WZ0 A;  1YD8 U;  2LWP A;  4IWQ A;  4RGM A;  2CR5 A;  3VRB B;  1VZ7 A;  1R4M I;  3VTW A;  5BYQ A;  2LGD A;  4B9K A;  1N63 A;  3CIR B;  4PK1 A;  3JSV A;  1RFA A;  2CKH B;  2BKR B;  2XK5 B;  4C80 A;  4YWG G;  2LHD A;  1ZGU B;  2KT7 A;  2MQJ A;  1U4A A;  3L4P A;  1F9J A;  3R7R A;  1DOY A;  4RCO A;  1K51 A;  1FEH A;  2CJO A;  1L2N A;  1NI3 A;  2OED A;  4YT0 B;  2KLG A;  1TIF A;  2RDB C;  2YLM A;  3AE8 B;  2GI9 A;  4ANX A;  4DWF A;  2CU1 A;  3ZNZ B;  1D5X C;  1WJU A;  2QMT A;  3A9K B;  2R61 A;  1QZE A;  2REX A;  2X38 A;  1EO6 A;  1SF0 A;  3APC A;  2C7N B;  2IO2 B;  2KQS A;  5AZH A;  4USA A;  3M95 A;  4W9I A;  3D32 A;  1SE9 A;  2IYD B;  1PUT A;  3Q2A C;  1TBE A;  3URY A;  3QQ8 B;  2IGD A;  1WGK A;  2WXK A;  4JL9 A;  3DBL B;  2KQ4 X;  3U30 A;  1MJD A;  3AE6 B;  3B1L X;  3SDL C;  1Q5W B;  3V05 A;  1PGA A;  5D6J B;  1FXT B;  5HKH A;  4MT5 A;  2DYB A;  1JWS D;  1T0Y A;  2KNB A;  2C7M B;  3EC8 A;  4WAA A;  2JZP A;  4YXD B;  4EOY A;  4J3O D;  5I4D A;  3UIP B;  5HI1 A;  3EGR A;  3DVG Y;  4IKG A;  4XDC A;  1ACC A;  4KVG B;  3AE3 B;  5IN7 A;  2VZK B;  4KV2 A;  1FNV A;  1JWA D;  3UQB A;  4FJV B;  4FHJ A;  2QCZ A;  4LNN A;  4F1S A;  4AJW A;  4KX6 B;  2K0P A;  3NOB A;  2M0X A;  1STE A;  2IGG A;  1IGC A;  1T5X D;  3NZ3 A;  5CTR C;  2WXF A;  4PYU A;  3JSV B;  1ZXH A;  4WAF A;  3A33 B;  4AWJ A;  2NPT B;  2JXX A;  2BQQ A;  2NMQ A;  2V3N A;  4ZRJ A;  4IOI E;  4ANU A;  3Q8E A;  2WU2 B;  2TSS A;  2Z59 B;  2CS4 A;  3ZNI D;  1Q1O A;  2HE7 A;  2WLB A;  2BGF A;  2LUM A;  2A5U A;  3RMK C;  4WJN A;  3JYU A;  3UIO B;  1VLB A;  5C23 A;  1YX5 B;  4E71 A;  5FR3 A;  2MSE D;  4B0M A;  4ZHP A;  2W55 A;  2KJR A;  4NAW A;  1F2R I;  3A1Q A;  4MM3 B;  1V8C A;  3SFD B;  1JWB D;  3KH0 A;  1KH0 A;  1V9J A;  4GB9 A;  2E3T A;  3HUI A;  4W9E A;  2LGS A;  3BK1 A;  1YN5 A;  3R2I A;  4W9J A;  3Q14 C;  4LTU A;  4OZC A;  4HCP B;  2LVO A;  5D7G A;  3LDZ E;  2OHF A;  2ZEQ A;  3PRE A;  1L0Y B;  3Q3J A;  2JPH A;  2B3A A;  3ZUN A;  3NG0 A;  3M62 B;  5HHD G;  1HA5 A;  1YQ3 B;  1E8Z A;  1P98 A;  1CK1 A;  2J42 A;  4ANV A;  2FBW B;  4US8 A;  1SE4 A;  3RNC C;  5IA7 A;  3Q8B A;  2ONQ A;  4MGZ E;  2KTF A;  1BXT A;  3Q8C A;  4LK0 M;  2PE9 A;  1WRD B;  2WXL A;  3Q8F A;  1YN4 A;  1TKE A;  2K9X A;  3VUX A;  1OQY A;  1J8C A;  3HHM A;  4S0R A;  2X8X X;  1D3Z A;  2JRI B;  3RPF C;  2KK8 A;  3B08 A;  4FAD A;  1Y8R C;  2ZNV C;  4MGY E;  1EWY C;  3GZN I;  1C79 A;  2NS5 A;  3T3O A;  2IY0 B;  4AQ7 A;  4N9F 4;  4M02 A;  3A4S C;  1NEK B;  1QIL A;  2IDY A;  2Y5C A;  1XQQ A;  4TKN A;  1XLO A;  4DDG D;  2K25 A;  3OG5 A;  2HDE A;  2N1V A;  1ZOY B;  4TQ1 A;  4EKU A;  2HJ1 A;  3FKY A;  2H89 B;  4HCN B;  4W9F A;  2L8J A;  3DWM A;  2JT4 B;  2IZV B;  5EE0 A;  4KGS A;  4DHZ B;  2XNA C;  1OGW A;  1N6Z A;  1WRI A;  4GSW A;  2LFI A;  1RWS A;  3HVD A;  4PS8 A;  1C77 A;  2OOB B;  1BUI C;  5HG2 A;  1BT0 A;  3NZS A;  4NAW B;  2LGI A;  1QQR A;  4E74 A;  1ZUD 2;  3I9V 1;  1F0Z A;  1WXM A;  1EWC A;  2DAF A;  2K5P A;  2NVU I;  4W9C A;  4NZL B;  1XCT L;  2MH7 A;  1NI2 A;  1E0Z A;  3JVZ X;  2QC8 A;  3DVN V;  1FFU A;  1FRR A;  4BAX A;  4W9D A;  4WIP A;  2QDF A;  2JXT A;  3AU5 A;  1JRU A;  3IT4 B;  3L08 A;  5AUI A;  1CJE A;  1ZXI A;  1C76 A;  3AEE B;  2C5L C;  2M4N A;  3W1Y A;  2JWU A;  3DQV A;  4MSQ B;  4N6E B;  2OJW A;  1WGY A;  4ZOH C;  4M00 A;  3MHS D;  2JWZ A;  3ZRF A;  2G9H D;  2MBQ A;  1NVI D;  4FN2 A;  1TZO A;  4HKZ E;  2RDG A;  2GBJ A;  5BMI A;  1C9F A;  1YJJ A;  3QA8 A;  1C4C A;  2C7H A;  2PLP A;  3H7P B;  4JPS A;  3IVF A;  4KDI C;  3RUI B;  2BS3 B;  2HTM E;  3DBL I;  3M63 B;  5H8Y E;  4K3B A;  1WXQ A;  1LXD A;  2JUO A;  3T9L A;  3X0W A;  1TYG B;  3VH3 B;  3C8Y A;  3H6N A;  2KAJ A;  2MX2 A;  2ZPY A;  4MGK E;  3IHP C;  5AEK B;  1GUA B;  2W82 A;  4DHJ B;  1MHX A;  3PV1 A;  3GE8 C;  4P1C C;  3GB1 A;  1FXA A;  4S17 A;  3HIZ A;  2ZCC A;  2KDI A;  1F52 A;  3VFK A;  2KKC A;  1EF1 A;  1SSN A;  1RM6 C;  1P0R A;  5LXI B;  1S1Q B;  1K52 A;  1SJE D;  3EA6 A;  5T8I A;  1E7V A;  4II2 B;  1ESF A;  4FHK A;  3FIL A;  3V60 A;  4ZHO A;  4MJS A;  1GG3 A;  3R2T A;  3AM9 A;  2DZK A;  3QK0 A;  2L76 A;  4B0E A;  5JHA A;  3ZKJ C;  2VH2 A;  2LUE A;  3OWE B;  4XWW A;  3KQ4 A;  2R2O A;  2KXJ A;  3VUY A;  4LJO B;  1Q10 A;  5IP4 D;  1MPE A;  3DBR B;  1XLQ A;  3BIN A;  1DOI A;  2HJ8 A;  3ZIM A;  3CST A;  1GOZ A;  4TV3 A;  1L6V A;  3T8M A;  3QCA A;  3H7S A;  1AYF A;  4WWM A;  2JSV X;  3DWG C;  3ZNG C;  3U8Z A;  1WXA A;  2I38 A;  2BYV E;  5BYR A;  4X57 B;  5EDS A;  2VRR B;  3WAO A;  1T0S C;  1JWM D;  5CHF A;  3R66 C;  2WDQ B;  1UWM A;  3LXF A;  4ZRQ A;  1WF9 A;  1ISN A;  1E10 A;  2DEN B;  2WXO A;  2IGH A;  3P1M A;  1I42 A;  3PSE B;  3AH7 A;  4OVZ A;  3QWZ B;  4HPP A;  4REZ A;  2RPQ A;  3HM3 A;  1FRD A;  1OEY A;  4NQL B;  4ZDV A;  2N7J A;  3TIX A;  1C1Y B;  1E8X A;  4KKJ A;  3TEW A;  5J2R A;  2LGY A;  5G5G A;  4UDU C;  4YTP B;  2LJI A;  1FCL A;  1M4V A;  2L0F A;  5CHW A;  2WYQ A;  3DOW A;  2LGX A;  3KW5 B;  3ZXV A;  1SIF A;  2PIA A;  1D5Z C;  3OLM D;  2YEP F;  4H2A A;  2WS3 B;  2EMT A;  3NVZ A;  4KGT A;  1NBF C;  4BBN C;  2L52 A;  3PLU A;  4WH4 A;  4TUU A;  2WDV B;  4EUT A;  5BMH A;  1QOA A;  3AE9 B;  4IG7 B;  4XX5 A;  2CJN A;  1SJH D;  2AQ2 B;  1ZDX A;  2MW5 A;  2JZ3 B;  3FIL B;  4K1R B;  1UUP A;  2ACZ B;  4NJ6 A;  3Q6B A;  3RT3 B;  2WX0 A;  1R4N B;  4IUM B;  3N1Y C;  1KFY B;  5AZF A;  2KN4 A;  4HJK A;  2LVQ A;  4A3P A;  2JZZ A;  3U7D A;  3H9D A;  2PJH A;  1WIA A;  3I57 A;  3TBL D;  1PFD A;  3RCZ A;  4MH0 E;  4EZL A;  2O2V A;  2K22 A;  2FUH B;  5FR6 A;  2O6V B;  2J7Q B;  2J52 A;  4RGO S;  4DQO C;  4ITK A;  2NBW B;  1DOX A;  1B9R A;  1P3Q U;  3KYD D;  4K3C A;  3N20 C;  4A6Q A;  4BKT A;  1V5T A;  5L83 A;  2N7E A;  2N9E B;  3MTN B;  1Z2M A;  1WMH A;  4OHJ A;  1VCB A;  4DXA B;  1KOT A;  4KGR A;  4BVU C;  2NR2 A;  1OQQ A;  1N62 A;  3BWU D;  2N7D A;  2KJH B;  2D3A A;  2V0G A;  2G4S A;  2QSD A;  2XN9 C;  2WX1 A;  3PHW B;  3KVF B;  5CHV C;  3EHV A;  4J6I A;  1E8Y A;  2K6D B;  2K6Q A;  2HTH A;  4BZA A;  2G3Q B;  3PHX B;  1MFW A;  2KYW A;  4F8C B;  1WR6 E;  2L3Z A;  4ANW A;  3BZD B;  2KD0 A;  4RM8 A;  5FKA C;  2PPH A;  1RFK A;  2WXQ A;  1VDV A;  5DPW A;  4M0W B;  4GLS C;  5LNK 1;  3NY5 A;  2ZVO A;  2PEA A;  2ON8 A;  5TSS A;  4HDQ A;  2K8B A;  3ZW3 A;  1V1P A;  2KTR A;  2UU7 A;  1KJT A;  4LJP B;  3V6C B;  2MHJ A;  2LVP A;  2RMM A;  3VUW A; 
#chains in the Genus database with same CATH homology
 2KVR A;  3B08 A;  4FAD A;  1Y8R C;  2ZNV C;  3CSF A;  1RLF A;  1WYW B;  4MGY E;  3GZN I;  2NS5 A;  2DYM A;  2LZ6 A;  2IY0 B;  5C1Z A;  2R2Q A;  2KMA A;  5BO4 B;  2ZVN A;  2KFK B;  3PPA A;  1Z5S B;  2RSU A;  4N9F 4;  4WWN A;  2RR9 A;  3A4S C;  1EUV B;  3NHE B;  2G45 B;  4RM9 A;  1G6J A;  3NZU A;  2KC2 A;  1P1A A;  4JGH B;  1XQQ A;  4TKN A;  3VH4 B;  4DDG D;  2K25 A;  4TQ1 A;  2N1V A;  3VTU A;  4EKU A;  3QJZ A;  3VVW B;  3BY4 B;  4NNJ B;  4HCN B;  4W9F A;  2L8J A;  3W1S C;  2MBH A;  4M8M A;  2FCM A;  4EZK A;  3ALB A;  2AL3 A;  4IW0 A;  1YX6 B;  2I1K A;  3X23 A;  4MJS B;  2JT4 B;  2AL6 A;  1WI0 A;  2IZV B;  3QAR A;  4G0N B;  4KSL C;  2ZJD A;  1TGZ B;  4MEM A;  4DHZ B;  1UBI A;  1WH3 A;  3HK0 A;  4PYZ A;  4GU2 A;  1OGW A;  3ZVV A;  3ML9 A;  1XT9 B;  1V2Y A;  2LXA A;  2CHZ A;  2O2V B;  3OAW A;  2G4D B;  2UYZ B;  4GSW A;  1TZ1 A;  4JQW C;  2XEW A;  4DK5 A;  3L17 A;  4K7S A;  4GDK A;  3PT2 B;  4JIO U;  4PS8 A;  4HK2 A;  2OOB B;  4E3C A;  3ECI A;  4IM3 A;  1UZX B;  4KIK A;  4W9K A;  2NCN A;  2IY1 B;  2V1Y A;  2GBM A;  2NBU A;  4WJP A;  2KAN A;  1BT0 A;  3NZS A;  4NAW B;  1LFD A;  4NPN A;  4BOZ B;  4F7Z A;  5DCN A;  2ASQ A;  2BKF A;  3VHT C;  4DDI D;  4E74 A;  1AAR A;  2NPT A;  2N9X A;  2IO3 B;  1WXM A;  1TTN A;  2FCS A;  1NDD A;  2DAF A;  3S2A A;  2NVU I;  3ZTD A;  1WX7 A;  1WR1 A;  2JF5 A;  4W9C A;  3VQI A;  1YQB A;  4XC2 A;  3PTF C;  2XK5 A;  3PZD A;  3QHT A;  1NI2 A;  3NS8 A;  2QHO A;  4B95 A;  3V61 A;  3JVZ X;  3DVN V;  4ZYN A;  3DBH I;  1UGM A;  5TR5 A;  3ZDM C;  4W9D A;  2O6V A;  2MLB A;  3IBE A;  3CMM B;  2MBE A;  3SU8 X;  2GBR A;  3AU5 A;  1RAX A;  2D2Q A;  2FNJ B;  1WGH A;  1JRU A;  1IP9 A;  4P7I A;  2AYO B;  3A9J A;  3L08 A;  3QAQ A;  4K81 A;  2KLC A;  4K7U A;  4AP4 C;  4GOC A;  2FID A;  2KDB A;  3OJ3 A;  4MM3 A;  1J0G A;  4TQ0 A;  1SGH A;  2C5L C;  3DBR I;  2M4N A;  2MWS B;  3W1Y A;  3H1U A;  1P9D U;  3DQV A;  4BKG A;  2KX3 A;  4MSQ B;  4M8N A;  4B6W A;  2EKE C;  3L0W B;  2GOW A;  2BWE S;  4FJZ A;  3ML8 A;  5LLI A;  2BF8 B;  4WWO A;  1WGY A;  1GC7 A;  3QC8 B;  3QX1 A;  3UGB B;  3CF6 E;  1MG8 A;  2BYF A;  2WDT B;  4URK A;  2A4Z A;  3MHS D;  4KZC A;  1YJ1 A;  2JWZ A;  2YVC A;  3DBS A;  3ZRF A;  3ZRC A;  4CYE A;  4II3 B;  2MBQ A;  3N32 A;  2KTR B;  1V86 A;  2IO0 B;  3ONS A;  3ZNH B;  4AJY B;  4FN2 A;  2CHW A;  2HD5 B;  1E90 A;  2RGF A;  5D2M B;  3DVN U;  3TJP A;  2GBJ A;  4NJ7 A;  2KO3 A;  5J17 A;  2KMC A;  1C3T A;  2GMI C;  2J0J A;  1UBQ A;  4G3X B;  4IM0 A;  1L7Y A;  2KWC A;  3QA8 A;  2FCQ A;  3I3T B;  2L0T A;  4AOF A;  2C7H A;  3AU4 A;  4BBN F;  1IYF A;  3ZTC A;  4MEL A;  3H7P B;  4MGI E;  2N1W A;  3IVF A;  4KDI C;  4KSK C;  3RUI B;  3SHQ A;  1X1M A;  3RYT A;  3EEC A;  2ZZP B;  3EFU A;  2MCN B;  3DBL I;  3M63 B;  2KWU B;  2MP2 A;  3N30 A;  5E6N A;  1LXD A;  3PRM B;  2JUO A;  3T9L A;  4DHZ E;  3KYC D;  3IG3 A;  2KFJ A;  3X0W A;  2BYE A;  3VH3 B;  3PVL A;  3H6N A;  1GJZ A;  2LI5 A;  2MX2 A;  3R7Q A;  3R3M A;  1ZKH A;  2ZPY A;  4FJY A;  4MGK E;  2N4F A;  1YIW A;  3IHP C;  5AEK B;  1WX9 A;  1GUA B;  2KX0 A;  4WJO A;  4DHJ B;  3PV1 A;  2XBB C;  3PRZ A;  4G50 A;  2FCN A;  2FIF A;  4ICU A;  1UD7 A;  4WWP A;  3KUC B;  1GC6 A;  4KDL B;  3HIZ A;  4GDK B;  2N9P C;  3B0A A;  2ZCC A;  3DCG A;  1WXS A;  2KDI A;  5E6P A;  1WX8 A;  3WIM A;  2OJR A;  3L16 A;  4IWP A;  1WZ3 A;  3RD2 A;  1J19 A;  3VFK A;  2KFK A;  2IO1 B;  1WZ0 A;  2KKC A;  1EF1 A;  1CMX B;  2KOX A;  1YD8 U;  3W1S A;  2LWP A;  1WGR A;  4LDT B;  4IWQ A;  4EFO A;  2LJ5 A;  4BOS C;  3WAM A;  1P0R A;  5LXI B;  2LRW A;  2CR5 A;  1S1Q B;  1V6E A;  1R4M I;  3VTW A;  2DHZ A;  1E7V A;  1WJN A;  2IBI B;  2LGD A;  1LQB A;  2EMS A;  4FHK A;  4II2 B;  4B9K A;  4FBJ B;  3A1Q B;  1EF5 A;  3JSV A;  2D10 A;  3V60 A;  1RFA A;  1GG3 A;  4LDT D;  4MJS A;  4AUQ C;  1KM7 A;  2CKH B;  2BKR B;  2XK5 B;  4ASW C;  2DZK A;  4A20 A;  1ZGU B;  1WMH B;  3QK0 A;  2L76 A;  1K8R B;  5JHA A;  3ZKJ C;  4GIV A;  2LUE A;  2MQJ A;  1Q0W B;  1U4A A;  2D11 A;  2KXJ A;  2R2O A;  3VUY A;  4IM2 A;  1F9J A;  1R4N I;  3APD A;  2KDE B;  3R7R A;  3V62 A;  4LJO B;  1V80 A;  3VUW A;  1L2N A;  3BIN A;  3K9O B;  2KHW B;  3A9J B;  2HJ8 A;  3RUL A;  3ZIM A;  5JZE B;  1I35 A;  2UWQ A;  3CST A;  2KLG A;  2M1M A;  2AWT A;  1H4R A;  2YLM A;  1WJ6 A;  3HM6 X;  4TV3 A;  2MBO A;  3AI5 A;  3ENE A;  3T8M A;  4ANX A;  4DWF A;  3QCA A;  2CU1 A;  5GMV A;  5G55 A;  3ZNZ B;  1WJU A;  3H7S A;  2V4L A;  1V81 A;  3A9K B;  2K8C A;  2KWV B;  1QZE A;  2REX A;  3ZNG C;  3U8Z A;  3VDZ A;  1WXA A;  3ZLZ A;  1S3S G;  5E6O A;  3ZDT A;  2BYV E;  2DX5 B;  1EO6 A;  3APC A;  1ZW7 A;  2C7N B;  2IO2 B;  2KQS A;  2Z0D B;  2VRR B;  4X57 B;  5EDS A;  2DZM A;  3WAO A;  5AZH A;  5CHF A;  4GN1 A;  3M95 A;  1H8C A;  4W9I A;  3R66 C;  4G11 A;  3D32 A;  1GNU A;  4GGQ A;  1SE9 A;  3AXC A;  2IYD B;  3JW0 X;  3M3J A;  1WF9 A;  1ISN A;  3MJW A;  1TBE A;  2DEN B;  2Z0E B;  3QQ8 B;  2Y5B B;  4JL9 A;  3WA0 A;  2L7R A;  3U30 A;  3B1L X;  3SDL C;  1WE7 A;  1RRB A;  1Q5W B;  1PQS A;  2LD9 A;  3PSE B;  1I42 A;  2L05 A;  2GBK A;  4W9G A;  5DPT A;  3QWZ B;  5D6J B;  2RPQ A;  3HM3 A;  2L00 B;  4GDL A;  1FXT B;  1OEY A;  4NQL B;  5DPR A;  2LRU A;  3DVG X;  4ZDV A;  2KZR A;  5HKH A;  2DZI A;  2MP2 B;  3DDC B;  3TIX A;  1C1Y B;  1E8X A;  4BKS D;  3GOE A;  2DYB A;  1WM3 A;  4I6P A;  5J2R A;  4HDO A;  2LGY A;  4IC7 B;  1T0Y A;  3RZF A;  4K7W A;  3TMP B;  5J18 A;  2L0F A;  2KNB A;  1WGG A;  2M17 A;  2ZNV B;  5CHW A;  2C7M B;  2WYQ A;  2BPS A;  3DOW A;  3V6E B;  2LGX A;  3KW5 B;  4HVB A;  1SIF A;  3EC8 A;  1V5O A;  4IWO A;  4WAA A;  3PGE A;  2MBB B;  3N3K B;  4HWI B;  3OLM D;  4PS3 A;  4CHK A;  4EOY A;  2AEH A;  3LJ3 A;  3UIP B;  3DVG Y;  2EMT A;  2ZCB A;  2RD0 A;  2KJ6 A;  4OVV A;  4YL8 A;  1NBF C;  3A4R A;  2LAS A;  4BBN C;  4NQK E;  2M8S A;  4KVG B;  3K9P B;  1OTR B;  4I6N B;  3AUL A;  3PLU A;  4KV2 A;  5L95 C;  4ZRK A;  3H7P A;  4TUU A;  4XZ4 A;  3UQB A;  4FJV B;  4EUT A;  4FUL A;  3PLV A;  4FHJ A;  4A3O A;  2ZPN A;  2KDF B;  4KZ0 A;  4IG7 B;  4KIK B;  1UH6 A;  2C60 A;  4XX5 A;  3VAW A;  4AJW A;  4F1S A;  3C0R B;  3NOB A;  5DPS A;  4JLC A;  2M0X A;  4DHJ D;  4FA6 A;  1E5W A;  5CTR C;  2MW5 A;  4PYU A;  2JZ3 B;  3Q3F A;  4MDK E;  3JSV B;  2JY6 A;  1HE8 A;  4HLE A;  4K1R B;  2J0M A;  4NJ6 A;  3A33 B;  4HXD A;  3RT3 B;  2WX0 A;  4AWJ A;  2NPT B;  3WAN A;  4IUM B;  2JXX A;  2KN5 A;  4ZRJ A;  4RMA A;  5AZF A;  4ANU A;  5CX3 A;  4OVU A;  1WE6 A;  1WXV A;  4HJK A;  2LVQ A;  3PS6 A;  4A3P A;  2KC1 A;  1WY8 A;  4HPL B;  2JZZ A;  3U7D A;  2Z59 B;  3H9D A;  2PJH A;  2CS4 A;  1WIA A;  4FLH A;  4I6L B;  3ZNI D;  3UQA A;  1Q1O A;  2HE7 A;  5LXH A;  2BGF A;  3TBL D;  2A5U A;  3RCZ A;  4WJN A;  5IAA C;  4MH0 E;  4WJQ A;  4EZL A;  2O2V A;  3JYU A;  1IPG A;  3UIO B;  2FUH B;  5FR6 A;  2O6V B;  5C23 A;  4ICV A;  4WQO B;  2J7Q B;  5AZG A;  5G2N A;  3TCA A;  2NBV B;  1YX5 B;  4W9H A;  1WM2 A;  3DPD A;  4E71 A;  5KHQ A;  2GBN A;  2MSE D;  3ZO5 B;  3TL5 A;  4CO7 A;  4NY0 A;  3IFW B;  2NBW B;  2KJR A;  2DZJ A;  3OJ4 B;  3VTV A;  4NAW A;  3KUD B;  3A1Q A;  1P3Q U;  3KH0 A;  1V9J A;  2DYO A;  3KYD D;  4GB9 A;  3L13 A;  2O6V D;  2BWF A;  4BKT A;  3O65 B;  1V5T A;  3SD5 A;  5L83 A;  4BFR A;  2N7E A;  4W9E A;  4W9J A;  2WWZ A;  2K39 A;  2N9E B;  3MTN B;  1Z2M A;  1WMH A;  3QIJ A;  4EZJ A;  1VCB A;  1VD2 A;  3RZW C;  4DXA B;  3UIN B;  3VXW A;  4HCP B;  2K1F A;  2LVO A;  1KOT A;  5D7G A;  2C9W B;  4BVU C;  2JRH A;  2NR2 A;  3LDZ E;  2ZEQ A;  3PRE A;  4HPM B;  4DBG A;  1E8W A;  1OEY J;  2N7D A;  5KHO A;  3UF8 A;  3Q3J A;  2JPH A;  2KJH B;  2B3A A;  4PS7 A;  3ZUN A;  3P2B A;  2G4S A;  2WX1 A;  2CHX A;  3PHW B;  4MSM B;  3KVF B;  5CHV C;  3EHV A;  3KUZ A;  1XD3 B;  3M62 B;  3L54 A;  1KLV A;  4J6I A;  1E8Y A;  2K6D B;  2K6Q A;  1E8Z A;  2HTH A;  2J0K A;  2G3Q B;  3PHX B;  4F8C B;  1P98 A;  4GDL B;  1WR6 E;  2DAJ A;  2MRP A;  3WAP A;  2FAZ A;  2V3S A;  5JH5 C;  3A9K A;  3WAL A;  2MA9 B;  2L3Z A;  4ZRI A;  1V49 A;  4ANW A;  4ANV A;  1WJ4 A;  5JHB A;  2KD0 A;  2I1J A;  4RM8 A;  5IA7 A;  3L10 B;  1E7U A;  2PPH A;  2PE6 B;  2D07 B;  4MGZ E;  5DPW A;  2KTF A;  4M0W B;  1WGD A;  3NY5 A;  2ZVO A;  4LCD E;  2PEA A;  2D3G A;  2PE9 A;  2W9N A;  1M94 A;  4HDQ A;  4GXB A;  2JVC A;  2K8H A;  1WRD B;  2KQ7 A;  2K8B A;  3ZW3 A;  2KTR A;  3APF A;  4GMV A;  1KJT A;  3PRP B;  3VUX A;  4BKS A;  1OQY A;  4EEW A;  4LJP B;  1J8C A;  3HHM A;  1A5R A;  1D3Z A;  2LXC A;  2JRI B;  1WFY A;  5D94 A;  3V6C B;  4W9L A;  2LVP A;  1LM8 B;  2KK8 A;  1UEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...