1IPGA

Solution structure of the pb1 domain of bem1p
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
GAMGSSTSGLKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BEM1 PROTEIN
publication title Structure and ligand recognition of the PB1 domain: a novel protein module binding to the PC motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ipgA00
2KMAA 4KZ0A 3ONSA 2JT4B 3CSFA 4GU2A 1EUVB 4DHJD 2HE7A 2KD0A 1GG3A 2KMCA 3WALA 2NR2A 2ZNVC 2M4NA 2MSED 1LQBA 1U4AA 1V2YA 2JF5A 3BINA 2N9EB 3T8MA 3QAQA 1V81A 2ZVOA 4FJYA 2G3QB 3IFWB 5AZHA 3H7PB 1WZ3A 1WR6E 1WXSA 2JZZA 2NVUI 2CS4A 3VUYA 1YQBA 2KJHB 4TKNA 1L7YA 2K6DB 4TQ0A 4WJNA 4ZRKA 1WXMA 4I6LB 1WE7A 1JRUA 3X0WA 4ZDVA 1WI0A 2K39A 2KANA 4FJZA 3H7SA 3DQVA 2FCNA 1V86A 3NZSA 2L76A 4MGZE 2JRIB 4NQLB 2M17A 1YJ1A 4MDKE 4JQWC 3SDLC 3AI5A 2DYMA 1A5RA 2J0MA 4PYUA 3VXWA 2J0JA 2DYOA 2JPHA 3PHXB 2MLBA 4TQ1A 2LVOA 5CHVC 4IWOA 1H8CA 1J0GA 2N9PC 4K7SA 3ENEA 5AEKB 4ANWA 2G4SA 3ZTCA 2GBKA 2N9XA 3HHMA 4DHJB 2C9WB 4BKTA 2K1FA 1TZ1A 4GGQA 4KIKB 2JUOA 4A3OA 3B0AA 4E74A 3DBSA 3HIZA 3PSEB 3VFKA 5KHQA 4KSKC 2DENB 2A5UA 2L8JA 3DVNV 4IG7B 3KVFB 2MBHA 3PHWB 1WE6A 1WM3A 1WMHA 4BOSC 2KTRA 3RCZA 3QA8A 1T0YA 2L3ZA 2R2OA 2ZPNA 3ZVVA 5CX3A 1YD8U 2FCSA 2M0XA 2KQSA 5JZEB 3DBRI 3ECIA 2CHZA 3U8ZA 3A9KA 1YIWA 3NS8A 2DAJA 4E3CA 2FIDA 3NOBA 2KJRA 3AU4A 3RD2A 4BKGA 5L95C 4W9LA 3AU5A 3U30A 2K8BA 3M3JA 5D94A 2Y5BB 4HPMB 3DVGY 1UGMA 2N1WA 2NBVB 1OEYA 5EDSA 1ZW7A 3RZFA 4ANVA 4DHZB 5JHAA 4W9CA 2ZCCA 3A4SC 3KYCD 1H4RA 5L83A 3PT2B 1I42A 2L0FA 3JYUA 2KFJA 2LZ6A 2NBWB 3ZDMC 4GIVA 2KZRA 3A9JA 4J6IA 1MG8A 1GUAB 4MEMA 1WXAA 3PGEA 3VVWB 5BO4B 2RPQA 2PJHA 3EC8A 3LJ3A 1E8WA 2DZJA 4WJOA 2IY1B 5HKHA 1HE8A 2N4FA 3ML8A 3ZKJC 3ZUNA 2YVCA 2DAFA 1V6EA 2KKCA 5IA7A 3RULA 5AZFA 1ZKHA 1R4MI 4BKSD 4A3PA 1E8YA 2HD5B 3N32A 4IWQA 2J0KA 3LDZE 2B3AA 1VCBA 2MP2A 3R3MA 3WA0A 4GMVA 3JVZX 4GN1A 1WRDB 4EKUA 4MJSA 3TJPA 2EKEC 2L05A 1EO6A 2JXXA 1SIFA 1WX7A 3ZNGC 2MX2A 3ZIMA 1GNUA 3X23A 4CYEA 4II3B 2DHZA 2DYBA 3JW0X 3NZUA 4PS3A 2GBMA 4NAWA 2UYZB 3L54A 4EZKA 5D6JB 3ZNZB 4IWPA 3VAWA 2GBNA 1X1MA 2KDIA 3RZWC 3TIXA 3PS6A 1WX9A 2KK8A 2R2QA 2AL6A 1KLVA 3APCA 1E5WA 1Z5SB 3ZRCA 5J17A 4F8CB 1P9DU 3QC8B 2KXJA 4PS7A 2REXA 4I6PA 5LLIA 3KUZA 1WMHB 2C60A 4LCDE 2KTRB 2G45B 4X57B 3A4RA 2D2QA 1WJ4A 4NQKE 2Z0DB 2N7DA 1RLFA 3Q3FA 2DZMA 4B9KA 1WGDA 1UBIA 4EEWA 4W9FA 1C3TA 1P98A 2CU1A 3A9KB 4P7IA 2GOWA 1NI2A 2OJRA 2PE6B 2LJ5A 3B1LX 2FCMA 2WX1A 1E8ZA 2ASQA 1WJNA 4W9JA 2IZVB 1UELA 3JSVA 4FBJB 1V5OA 4IW0A 2KX3A 4W9HA 4KSLC 3Q3JA 4FLHA 2IO2B 2W9NA 1M94A 2KLCA 2KC1A 3ML9A 4KV2A 4ZRIA 2LD9A 2BYVE 3BY4B 1YX6B 3A9JB 1RAXA 1C1YB 1WX8A 2MWSB 2PE9A 2Z59B 4A20A 3IG3A 3R66C 3L16A 5E6OA 3VUWA 1GJZA 1K8RB 2K8CA 4FHKA 1E7VA 3VDZA 1WGRA 4XX5A 1WGGA 3ZW3A 3VTVA 2FCQA 4F1SA 4W9IA 2K25A 3L08A 2KTFA 3N3KB 3MTNB 3QARA 4AJWA 4HWIB 2N1VA 4AUQC 4ZYNA 1WXVA 4M8NA 2KDEB 4K7UA 2ZJDA 2ZZPB 5E6NA 3ZO5B 3IHPC 1WGYA 2BKRB 4BFRA 1P1AA 5J18A 2MP2B 4B95A 1YX5B 1WJ6A 1OTRB 3AXCA 4MSQB 3W1SC 1KJTA 2KQ7A 4DHZE 4DWFA 3D32A 4KDIC 2EMSA 4MJSB 2KC2A 4FN2A 2ZCBA 2LXCA 2ZVNA 4WWOA 5JHBA 4IM2A 2XBBC 2NS5A 2LGDA 4FJVB 2M1MA 2KX0A 3V61A 4JGHB 3QIJA 1Q0WB 2JWZA 3UF8A 4NAWB 1WFYA 3A1QA 2BKFA 1XQQA 4TUUA 5CHWA 1EF5A 2K6QA 1WM2A 4NJ6A 1F9JA 4OVVA 3V60A 3PRMB 4EOYA 3PV1A 4ICVA 2CKHB 5GMVA 5AZGA 2JZ3B 3TL5A 3KYDD 3O65B 5D7GA 3IBEA 2LXAA 3VHTC 3KH0A 4GSWA 1WR1A 2AYOB 2KFKA 2MBOA 4MH0E 4AJYB 1WIAA 2ZNVB 1XD3B 1TTNA 2PPHA 1EF1A 3M95A 3V62A 2L00B 3DPDA 4MGYE 3VQIA 5DPWA 3L13A 4MSMB 1CMXB 3VTWA 3TMPB 4MGIE 3VH3B 4RM8A 2MW5A 3ALBA 4PYZA 3RT3B 4DK5A 4WWNA 4EFOA 4G0NB 2K8HA 3QK0A 1V9JA 3OLMD 3A33B 4BBNC 2CHWA 2LI5A 4M8MA 3HM3A 3DCGA 4GOCA 3JSVB 1LM8B 3ZNHB 4EZJA 4AOFA 1D3ZA 1UH6A 2MRPA 2OOBB 3DOWA 3V6EB 1PQSA 1UD7A 2FIFA 2I1JA 4LJOB 3UIPB 1UZXB 4NNJB 3PPAA 3M62B 3PRZA 4MELA 4LDTD 4F7ZA 4HVBA 1S3SG 2NPTA 4K7WA 2J7QB 1LFDA 3ZDTA 1NDDA 2BPSA 1WZ0A 2BYEA 3VTUA 2WYQA 1Y8RC 3KUCB 1SGHA 1E8XA 4HDOA 4DDGD 2IO1B 2O6VA 3PLUA 3SD5A 2IYDB 1TBEA 3TBLD 2D3GA 2C7NB 5CTRC 4FHJA 5DCNA 3CF6E 3WIMA 2YLMA 3C0RB 3PLVA 4DBGA 3OJ4B 2FUHB 1GC6A 3ZNID 2LVQA 3L17A 3VH4B 1QZEA 3PREA 4I6NB 2JVCA 4CO7A 1S1QB 3A1QB 2AL3A 4HCNB 3EECA 4K81A 5KHOA 4FADA 4IM3A 4TV3A 2CR5A 2KNBA 4PS8A 1NBFC 4EZLA 2MCNB 2RGFA 3W1YA 4ZRJA 1V49A 4KDLB 4II2B 2IBIB 2DZIA 4OVUA 2A4ZA 2JRHA 4LDTB 1J19A 2KFKB 2GBRA 2PEAA 1KOTA 3RYTA 3T9LA 2LVPA 4MM3A 2KO3A 4XZ4A 5LXIB 2NCNA 3APFA 4WWPA 1Z2MA 2O6VD 1E90A 3PVLA 5J2RA 2XEWA 3EHVA 2RR9A 1XT9B 2BWFA 4G3XB 1WGHA 1P3QU 2KVRA 3RUIB 4B6WA 4DXAB 1WY8A 2JY6A 2L0TA 1I35A 4BOZB 3CMMB 2C7HA 2HJ8A 2LRUA 4LJPB 5G55A 4M0WB 3KW5B 3B08A 4WJQA 3SHQA 4GXBA 3APDA 2FNJB 3K9OB 1Q5WB 2M8SA 3VUXA 1KM7A 2D07B 1V80A 2MBEA 4GDLA 3W1SA 3QCAA 4W9DA 4JL9A 5DPRA 2MBQA 3ZTDA 2V3SA 2GBJA 3L10B 3WAOA 2RD0A 1AARA 4KVGB 2WX0A 4CHKA 4NY0A 2KJ6A 1RFAA 3QQ8B 2NPTB 2IO0B 3SU8X 4DDID 4FULA 3OAWA 2IO3B 2WDTB 4YL8A 4ICUA 3ZLZA 1L2NA 2ZPYA 3AULA 1WYWB 4GDKA 2O2VA 2RSUA 4KZCA 3P2BA 4WJPA 4HCPB 3HM6X 2O6VB 2N7EA 4AWJA 5DPTA 4FA6A 3QJZA 2C7MB 2Z0EB 2KWCA 4IUMB 4WQOB 2KOXA 3H9DA 2KWVB 3H6NA 3PTFC 3S2AA 2KN5A 3UIOB 1RRBA 1P0RA 3PZDA 2UWQA 4GB9A 3EFUA 2WWZA 1WJUA 3PRPB 4EUTA 2C5LC 2CHXA 3H1UA 3WANA 2I1KA 1G6JA 3GOEA 2DX5B 3KUDB 3NHEB 4W9KA 2G4DB 2HTHA 2LGYA 2QHOA 4E71A 1WH3A 3MJWA 3R7QA 4HLEA 3UQBA 4XC2A 2XK5A 1UBQA 2D10A 2KLGA 1VD2A 4BKSA 2BF8B 3MHSD 1LXDA 3ZRFA 4AP4C 2BGFA 4N9F4 1R4NI 4MGKE 2MQJA 5LXHA 2LASA 5JH5C 1V5TA 1Q1OA 3HK0A 3H7PA 2GMIC 2IY0B 4IC7B 4NJ7A 2DZKA 3IVFA 4HJKA 4W9EA 3TCAA 3DVNU 3QX1A 1E7UA 1OEYJ 2FAZA 4GDLB 2EMTA 2VRRB 2BYFA 3WAMA 4K1RB 3DDCB 3QWZB 5FR6A 1OQYA 5DPSA 5C23A 4NPNA 4G11A 3V6CB 2NBUA 1TGZB 2L7RA 5CHFA 2BWES 2ZEQA 3OJ3A 2KHWB 4BBNF 2D11A 3N30A 1IP9A 1SE9A 3L0WB 3U7DA 4RM9A 4GDKB 2O2VB 1IPGA 4IM0A 3DBHI 3QHTA 4URKA 1WF9A 4WAAA 5G2NA 4ANUA 3UINB 3DBLI 4ASWC 4ANXA 1IYFA 3M63B 4KIKA 3UQAA 5TR5A 4JLCA 3WAPA 3R7RA 4HK2A 1OGWA 3I3TB 2LUEA 2MA9B 3NY5A 3DVGX 1J8CA 4RMAA 4JIOU 1ISNA 2V1YA 2LGXA 4G50A 3CSTA 5D2MB 3GZNI 2LRWA 1FXTB 1ZGUB 4HDQA 5E6PA 2KDBA 5IAAC 3K9PB 2KDFB 3UGBB 1GC7A 4W9GA 2AWTA 4HXDA 2LWPA 5C1ZA 4BVUC 4HPLB 2V4LA 2MBBB 2KWUB 2XK5B 1BT0A 2AEHA
chains in the Genus database with same CATH superfamily
3ONSA 4JPSA 3Q69A 2IGDA 1GG3A 3BVZA 3Q8AA 1LQBA 3AEDB 3BINA 2JF5A 1TS2A 3AE5B 4L1BA 1GPXA 1WXSA 1F52A 2CS4A 2KJHB 4TKNA 4ZRKA 4ZDVA 1WE7A 1WI0A 3H7SA 1V86A 4MGZE 1YJ1A 1L4ZB 2J0JA 2DYOA 2MLBA 4TQ1A 5CHVC 3PZ7A 4K7SA 4NZLB 2E6XA 2WXKA 2N9XA 1TZ1A 3DHHC 3NRZA 4C4VB 3H8HA 3Q8BA 4A3OA 2J53A 3HIZA 1F2RI 4P16A 5KHQA 3URYA 2L8JA 2WXGA 4BOSC 2KTRA 3EA6A 4HKZE 3AE4B 3ZVVA 1YD8U 3U8ZA 3ECIA 2CHZA 4E3CA 2DAJA 5C2TB 4BKGA 2K8BA 3M3JA 5D3DA 4AQ7A 1ZW7A 3PT2B 4P1CC 1L5PA 4GIVA 3A9JA 4JWUC 4N6EB 3PGEA 3RI7C 5HKHA 5EE0A 2AQ2B 1JWSD 3ML8A 3ZKJC 3RULA 1QKZA 2G1EA 2OEDA 3BYYB 4B0EA 3BIID 4EKUA 1SIFA 5T8IA 2BYTA 3X23A 1CZPA 2DHZA 3NZUA 4LNKA 1FNVA 1JWUD 1KLVA 1Z5SB 3I5JC 1GAQB 1P9DU 1YQ3B 4I6PA 5LLIA 4LCDE 1NYQA 4LTUA 1WRIA 3E56A 1UNSA 3A4RA 2N7DA 2N7JA 2UU7A 1TT5B 1P98A 4YSYB 2OJRA 5EE3A 5LNK1 1E8ZA 1WJNA 4W9JA 1V5OA 3FAHA 2KX3A 4W9HA 2HJ1A 4FLHA 1UWMA 3BY4B 2Z59B 3IG3A 3VUWA 4DXFA 1N61A 4EE2A 2WXOA 4ACFA 2LHDA 2KDEB 5E6NA 3IHPC 4C56C 1J7BA 5J18A 2K22A 2V3PA 4ZRPA 1WJ6A 1OTRB 3W1SC 3U7ZA 4DHZE 4WURA 2ACZB 5JHBA 2NS5A 4PK1A 4JGHB 3V05A 2FBWB 4JX1C 2EELA 3DBHB 1EF5A 1WM2A 1F9JA 3DBLB 3RPFC 3PV1A 5AZGA 5IO9A 3KYDD 4GSWA 2LJIA 4AJYB 1XD3B 2MHJA 4LNOA 4XE0A 3MC9A 2L00B 3DPDA 3VQIA 5G5HA 4RM8A 3Q8FA 3RT3B 4DK5A 5AUKA 1NVID 3EUB2 4NJCA 5I4DA 1LO5D 4M0WA 4BBNC 3HM3A 1ZOYB 4WH4A 2W3RA 3ETRA 1D3ZA 2OOBB 3V6EB 4LJOB 1V1OA 4MELA 4K7WA 1Q10A 1SEBD 2PIAA 2GI9A 1Y56A 1MG4A 1LFDA 3ZDTA 2D5GA 2WYQA 1Y8RC 1SGHA 1N62A 3SD5A 2J4XA 2D3GA 2C7NB 5CTRC 5BYRA 1FIQA 3NVWA 3WIMA 2WP9B 1YMHE 1J7AA 3SFDB 3HUIA 3A1QB 2MH7A 4HCNB 2M0AA 1AWDA 1XCQL 3Q3OC 4XDCA 2MCNB 2QEJC 4II2B 2A4ZA 2JRHA 2RDHA 4RF0A 1HZ6A 3RYTA 3T9LA 1GB4A 5LXIB 1T0SC 3NVVA 1Z2MA 1RM6C 2RR9A 2BWFA 1P3QU 2X8XX 2D3BA 3N20C 3DBRB 2LRUA 2BS3B 5G55A 3B08A 2FNJB 1KLUD 1Q5WB 3BVGA 4GDLA 2MBQA 1SE2A 5MPOA 4CHKA 1FNUA 2R61A 3SU8X 4L2YA 3OAWA 1N60A 2G9HD 5HG2A 4RFBA 4HROA 3ZGZA 3C8YA 1V8CA 2KDMA 2K3UA 1C4PA 2C7MB 2Z0EB 3IAS1 4WQOB 2KOXA 2UWQA 2WWZA 4EUTA 2C5LC 2CHXA 2INNE 2DX5B 3R2IA 4HLEA 4XC2A 2XK5A 1UBQA 2KLGA 1ZXIA 1D4BA 3AEFB 1XLOA 4AP4C 4LNFA 1E10A 1V5TA 3ZXRA 1E7PB 3HK0A 4N58A 1T3QA 3DVNU 5IKCM 1JW9D 2FAZA 1TKEA 4XYCA 3CIRB 3TEWA 2WXJA 5FR6A 4NPNA 2BWES 1XLQA 2ZEQA 2D11A 3N30A 1SE9A 1CK1A 4ZOHC 3L0WB 4MH8A 2O2VB 3DBHI 3DBLI 2WXQA 4XGAB 3E9SA 3UQAA 3WAPA 4A90A 2MA9B 3DVGX 4RMAA 4JIOU 2V1YA 4G50A 5D2MB 1L0VB 5IAAC 2KDFB 3BVMA 1GC7A 3GE8C 1YN4A 2MBBB 4REZA 1TZOA 3W9CB 2LMCA 4ARCA 4KZ0A 3O13A 4DHJD 3WALA 2KD0A 3IXSA 2NR2A 2M4NA 2DBYA 2MSED 1U4AA 2Q5WD 2BS4B 2ZW1A 3B9JA 1V81A 2CU3A 5AZHA 2G3QB 2VZKD 1WR6E 3KLSX 4RGMA 2JZZA 2NVUI 2DLBA 3ZYYX 1KH0A 1YQBA 3VUYA 1L7YA 4RGNA 3Q2AC 4WJNA 3X0WA 1JRUA 3BWUD 4FJZA 3NZSA 4NQLB 3SDLC 2J0MA 3VXWA 1TYGB 2V0GA 2JPHA 1I4PA 3T3NA 3W5UB 1H8CA 2N9PC 4ANWA 2G4SA 2GBKA 4DHJB 4KIKB 4E74A 3B0AA 2VZKB 4KSKC 2DENB 2GLSA 3WCQA 3PHWB 1WM3A 3MFGA 4J3OD 2ICIA 3RCZA 1T0YA 2L3ZA 2MJ3A 2R2OA 1YOVB 2ZPNA 5CX3A 1C9FA 2FCSA 2KQSA 3AM9A 3DBRI 2K5PA 3A9KA 1YIWA 1FEHA 3AU4A 1N5XA 4W9LA 2AQ3B 3U30A 2PTLA 3RZFA 4ANVA 4DHZB 4W9CA 3A4SC 3KYCD 1MHHE 2L0FA 3JYUA 2KZRA 1MG8A 3VVWB 5BMGA 4FXCA 2RPQA 3EC8A 4Q2JA 1HE8A 3P63A 2L52A 1ZKHA 3NUHB 1HEZE 4BKSD 4A3PA 4HKQA 1SBBB 3LDZE 2B3AA 3WA0A 4GMVA 3JVZX 4IOIE 1FMAD 4HPPA 1HTOA 4MJSA 1JMLA 2EKEC 1ZXHA 1EO6A 3ZNGC 3ZIMA 3EGRA 1GNUA 1MJDA 2KACA 2DYBA 1QOGA 5E6JA 4TSSA 2GBMA 3CWIA 4S0RA 4EZKA 2WGSA 3ZNZB 2WU2B 2M19A 4IWPA 3VAWA 2IJ0A 1WX9A 2KK8A 4NAMA 1DOXA 1RWSA 1E5WA 2KXJA 4PS7A 2REXA 3NG0A 1WMHB 2HDEA 2D2QA 2WDQB 2Z0DB 1F1HA 2V9HA 3Q3FA 2GRIA 1C3TA 2BW2A 4M02A 4P7IA 2PE6B 2LJ5A 2ONQA 1JRPA 2IZVB 3JSVA 1QLBB 4KSLC 2INDC 2IO2B 1QF6A 3ML9A 2JYTA 3MJ5A 1MVKA 1C1YB 1RAXA 4ZRQA 2PE9A 4A20A 3L16A 5EE9A 3RNAC 2GB1A 1GJZA 2BB6A 3VTVA 2K25A 1I4RA 3MTNB 4AJWA 4HWIB 2N1VA 3U4EG 3IAM1 1VZ7A 2IGGA 2ZZPB 3DHIC 1WGYA 1BUIC 1IBXA 1TS5A 2MP2B 4B95A 3VR9B 1DYQA 1DGJA 2KQ7A 3D32A 4KDIC 2K0PA 2ZVNA 4IM2A 2XBBC 2J42A 3V61A 1FNWA 2JWZA 4NAWB 1ZDVA 2BKFA 4TUUA 1ET6A 3DWGC 4OVVA 3V60A 1F0ZA 3PRMB 2INCC 5GMVA 4K3BA 3IBEA 3VHTC 3KH0A 1WR1A 1WIAA 2WU5B 1TTNA 1EF1A 2EKIA 4MGYE 5DPWA 3L13A 1PGAA 4MSMB 2BQQA 3GZNB 1OFFA 1HZ5A 2LHEA 3ALBA 4GLSC 4WWNA 4G0NB 2WXPA 2N0SB 1V9JA 3A33B 2CHWA 2VH1A 3DCGA 5AUIA 2WXLA 3ZNHB 5EE1A 1UD7A 5BYSA 2JZPA 3M62B 4F7ZA 1S3SG 3PZ8A 2W55A 2BPSA 3VTUA 3KUCB 2IO1B 2O6VA 3OWEB 3TBLD 3CF6E 5HFYA 1SXTA 2I2YA 3OJ4B 3ZNID 1IGCA 3VH4B 3PREA 4CO7A 1S1QB 2AL3A 4K81A 5KHOA 4IM3A 2KNBA 2WNMA 4RNAA 4EZLA 1HA5A 2RGFA 3AEBB 3ZXVA 4KDLB 4OVUA 4LK0M 2KFKB 2PEAA 4K3CA 3V3XA 4XZ4A 3L4PA 1MPEA 1FCLA 3PVLA 5J2RA 1HTQA 4BAXA 3RUIB 3EHVA 1XT9B 1FRDA 1WGHA 2WXRA 1VDVA 3CMMB 4LJPB 5BMIA 2XN9C 3KW5B 1UGJA 3SHQA 4GXBA 2M8SA 3FILA 4P6VF 3VUXA 1KM7A 2MBEA 4L23A 3QCAA 4RF1A 3RNCC 2WX0A 3QQ8B 2NPTB 4DDID 1FRRA 4OZAA 1K51A 2IO3B 2ZPYA 3ZJTA 3AULA 4GDKA 1R4MB 3P2BA 3MC0B 2PLPA 1HQRD 5DPTA 4FA6A 3QJZA 1WGKA 4N59A 2KWCA 4IUMB 4UDUC 3H9DA 2KWVB 2BVCA 3PO0A 4ZHPA 3S2AA 2IGHA 2MJDA 5HI1A 1TY0A 1UF0A 3EFUA 1WJUA 1G6JA 1N6ZA 3P4PB 1T6BX 4W9KA 1QOAA 2G4DB 2HTHA 2QHOA 2RDBC 2BTEA 3MJWA 3R7QA 1FO4A 3LB8C 3UQBA 2D10A 4BKSA 2JWUA 4MM3B 2BF8B 3MHSD 2MQJA 5LXHA 5JH5C 1WWTA 4IC7B 3NVYA 4OW0A 4B0MA 1E7UA 1OEYJ 2LUMA 3AE8B 1OQYA 4HJGE 5C23A 4US9A 3V6CB 5CHFA 3IT4B 2KHWB 1TKGA 2D3CA 1ZP0B 3TEYA 4WAAA 4ANUA 2NMQA 3UINB 2N9KA 4C4VA 2KYWA 5TR5A 1YQ4B 1IGDA 2SAKA 3RNGC 3R7RA 3I3TB 1J8CA 4LNNA 4WWMA 1SB3C 1ISNA 2LGXA 4D2KA 2Y5PA 3CSTA 1T0RC 2PKOA 3GZNI 1JALA 1ZGUB 4HDQA 3K9PB 1V1PB 3UGBB 4YTMB 4HXDA 2V3NA 1I4GA 1XLPA 1YN3A 2W82A 1C4AA 1BT0A 4TQ0A 4HVBA 3U2SC 2L32A 1L4DB 3CSFA 3NJTA 2HE7A 2ZNVC 4LNIA 1J7CA 1V2YA 2N9EB 3T8MA 4FJYA 1L0YB 1VZ8A 3H7PB 1WZ3A 1QOFA 1V97A 1SSNA 2WXMA 1WXMA 4A8XC 1TIFA 2K39A 2KANA 1TS3A 2BT6A 3AE9B 2JRIB 2M17A 4MDKE 4JQWC 3AI5A 2DYMA 1N63A 3HRDD 2IPKD 3PHXB 1K53A 2LVOA 3RN9C 1JWMD 4IWOA 1J0GA 3KWLA 4YT0B 3ZTCA 4XDDA 4BKTA 2K1FA 2E3TA 1E9MA 3VFKA 3PSEB 1ZDXA 2A5UA 3KVFB 1WE6A 3QA8A 1WXQA 2M0XA 2FIDA 2KJRA 1AW7A 3N9YC 3AU5A 5D94A 1UGMA 2N1WA 5EDSA 1JWBD 3MHZA 1H4RA 1I42A 2LZ6A 4J6IA 4MEMA 1WXAA 3ZQ4A 2KMMA 3AEGB 1FXAA 2QMTA 2W54A 3ZUNA 3DWMA 2DAFA 1V6EA 1ACCA 1R4MI 1E8YA 2HD5B 3N32A 4IWQA 3T3OA 2J0KA 2VH2A 3R3MA 3ABVB 1JCKB 2Z8LA 1WRDB 2QJLA 4ZHOA 3TJPA 1VR9A 4KKJA 1WX7A 4O1NA 2MX2A 4CYEA 1F77A 3JW0X 1YJJA 1L0XB 2UYZB 3B2GA 3RFZB 4WAFA 4MT5A 2GBNA 1ET9A 3RZWC 3TIXA 3PS6A 3NS1A 1XXGA 2AL6A 1D5MC 3ZRCA 4F8CB 2JYEA 4P1BC 2PVGC 2C60A 2KTRB 1WJ4A 4NQKE 1RLFA 1FCCC 4B9KA 1AN8A 1A70A 1D5ZC 1WGDA 4EEWA 4CQNA 2CU1A 3AE2B 4YWGG 1NI2A 3B1LX 2KWDA 2LGIA 4USAA 4FBJB 4IW0A 4C7YA 2W9NA 1M94A 4ZRIA 2KC1A 2BYVE 5JXVA 3A9JB 2MWSB 1WX8A 4FHKA 3VDZA 3KQ4A 1WGGA 2FCQA 4F1SA 4W9IA 3GB1A 3P4QB 2PMVA 4AUQC 4ZYNA 1WXVA 1FM0D 4K7UA 2K9XA 3ZO5B 2JXTA 2QC8A 1YX5B 4MSQB 1KJTA 3AE6B 2TSSA 4OZBA 2EMSA 2KC2A 2LXCA 4WWOA 3W5VB 2M1MA 2MJEA 2LFIA 3QIJA 1Q0WB 1QOBA 3A1QA 4YTNB 1KF6B 4ZYSA 4S17A 2K6QA 4NJ6A 4EOYA 3MP9A 1VLBA 2JZ3B 3TL5A 3O65B 2X38A 5D7GA 2KQ4X 2LXAA 2AYOB 4MH0E 2ZNVB 2PPHA 1QILA 3M95A 1PUTA 4HEA1 1CMXB 4MGIE 3VH3B 2MW5A 3P4RB 4PYZA 1TJEA 3QK0A 1OQRA 4WIPA 4M8MA 3J9CA 4GOCA 1DOYA 4JWSC 1BXTA 4EZJA 1CQVA 1UH6A 2MRPA 3DOWA 1PQSA 2FIFA 2OHFA 2QCZA 1LGRA 3UIPB 1UZXB 4NNJB 1M4VA 2J7QB 1FFVA 4US8A 3RMKC 1NDDA 2BS2B 1T0QC 4BZAA 4HDOA 1AYFA 3PLUA 5DCNA 3RNFC 1ZPSA 2YLMA 2YEPF 2FUHB 1BMLC 1NYRA 4I6NB 2WDRB 4TV3A 4PS8A 4RCOA 3W1YA 4ZRJA 2IBIB 2DZIA 1FPYA 2FUG1 2LVPA 2KO3A 4WWPA 1E90A 2XEWA 3R2TA 1VJKA 1RYJA 2KVRA 4B6WA 4DXAB 2WXNA 2JY6A 2L0TA 1EWYC 4BOZB 1C79A 2WHIA 4M0WB 1NI3A 3I57A 3AV8A 1V80A 1ZUD2 2HTME 3W1SA 5DPRA 3ZTDA 2V3SA 2GBJA 3L10B 3WAOA 1AARA 2KJ6A 1RFAA 4KGRA 2IO0B 4YL8A 2QDFA 3ZLZA 5FR3A 1L2NA 4DQOC 1WYWB 2O2VA 4KZCA 3SR6A 4WJPA 4M01A 1SJED 3FKYA 1VRAB 3NVZA 3EFCA 1GB1A 4C80A 2BBCA 1I7HA 3Q8EA 2KN5A 2L83A 1P7EA 5IOIA 1KFYB 1C76A 2JX5A 3PRPB 4KGSA 3H1UA 3WANA 3W2DA 2QILA 3NHEB 2LGYA 2LGSA 3AN1A 4E71A 5H8YE 1ESFA 1L6VA 3AE7B 3LXFA 3MC8A 2JSVX 2BGFA 3AE1B 4MGKE 2LASA 3HVZA 4YSZB 4NJ7A 2DZKA 3ZJUA 3IVFA 3TCAA 1PFDA 4GDLB 2EMTA 2VRRB 2BYFA 3DDCB 5DPSA 2B76B 3AB5A 1B9RA 2L7RA 2KVZA 3OJ3A 2KN4A 2CJOA 4BBNF 1QT9A 3B2FA 4RM9A 4OVZA 1IPGA 3U52E 1YNTE 3QHTA 1WF9A 5BMHA 5TSSA 3M63B 4KIKA 1E6EB 4ITKA 1C77A 3NY5A 4MACA 1GOZA 3SEBA 5E6PA 4A9AA 1ROEA 2CJNA 4XWTA 5C1ZA 2V4LA 2KWUB 2XK5B 2AEHA 2KMAA 1EU4A 4LLGM 2JT4B 2WXHA 4GU2A 1EUVB 2DNFA 1SIJA 2KMCA 1I4HA 2H88B 2BB5A 4WQMA 2KT7A 3QAQA 2ZVOA 3IFWB 1N5WA 1UWXA 1KTKA 3VRBB 2WQYB 1K50A 2K6DB 4I6LB 3N1YC 3DQVA 2FCNA 2L76A 1FD6A 1A5RA 3VR8B 3AEAB 4PYUA 3AE3B 5BYQA 1DOIA 3ENEA 5AEKB 3HHMA 2C9WB 2WXIA 2AQ1B 4GGQA 2JUOA 3DBSA 1R7SA 3DVNV 4IG7B 2RDGA 2MBHA 5GXGB 1WMHA 3N1ZC 2DWQA 1SF0A 2Y5CA 3GE3C 5JZEB 3NS8A 3NOBA 2NTTA 3RD2A 4ARIA 5L95C 1UUPA 2Y5BB 4HPMB 3DVGY 2NBVB 1OEYA 3I63C 1SE4A 5JHAA 1F2RC 1YN5A 3C19A 2ZCCA 5L83A 3KWVA 2KFJA 2NBWB 3ZDMC 4DXGA 1GUAB 5BO4B 2PJHA 3LJ3A 1E8WA 2DZJA 4WJOA 2IY1B 3GP7A 2N4FA 2YVCA 1MHXA 2KKCA 5IA7A 5AZFA 1JQ4A 1C78A 3TEXA 1VCBA 3ZJVA 2MP2A 4GN1A 2V4IB 4A55A 1OQQA 2L05A 2JXXA 4IDIA 1JROA 1MI0A 4II3B 4PS3A 4NAWA 3L54A 3P1MA 1WSPA 5D6JB 1XEEA 2I38A 1X1MA 2KDIA 1WYGA 2R2QA 3BK2A 1E0ZA 3APCA 1CJEA 5J17A 1K52A 3QC8B 1XLNA 3KUZA 3BK1A 2G45B 4X57B 4XWWA 5HHDG 1STEA 1D5XC 2DZMA 1UBIA 4W9FA 3A9KB 2GOWA 3DHGC 2FCMA 2WX1A 2ASQA 1UELA 2YEPB 1NEKB 2INPE 1PGXA 3Q3JA 4KV2A 1R4NB 2KLCA 2LD9A 2ZW0A 2NTSA 1YX6B 3R66C 5E6OA 3IT6B 1K8RB 2K8CA 1E7VA 1WGRA 4XX5A 3ZW3A 3TSSA 3I9V1 4IKGA 4AS1A 3L08A 2KTFA 3N3KB 3QARA 2LEKA 4M8NA 4OZCA 2ZJDA 2BKRB 4BFRA 3AEEB 3N1XC 1P1AA 4RGOS 3AXCA 4DWFA 4MJSB 3Q8CA 2ZCBA 4FN2A 1QQRA 2LGDA 4FJVB 2KX0A 2PW9A 4PT5A 3UF8A 2SEBD 1WFYA 1XCTL 1XQQA 5CHWA 1KRHA 1PGBA 4ICVA 2CKHB 3Q6BA 2MBOA 2KFKA 3BZDB 1VZ6A 3V62A 3HVDA 1C4CA 4R3DA 4H2AA 3VTWA 2PVOD 3TMPB 1SE3A 4EFOA 2K8HA 2WLBA 5IP4D 1KLGD 3OLMD 5C3JB 2LI5A 3TUOA 2M56B 2OJWA 3JSVB 1LM8B 3VRAB 3TEZA 2L1AA 4AOFA 3FC4A 1SJHD 2I1JA 1PDXA 1TS4A 3PPAA 3PRZA 4LDTD 3GS2A 2NPTA 2QIEB 2QSDA 1FXIA 1TKYA 2XNAC 1NENB 2BYEA 1WZ0A 4M00A 1E8XA 4DDGD 2N9LA 2IYDB 2WDVB 1TBEA 1IBXB 4FHJA 3Q3MC 3OG5A 2RPVA 3C0RB 3PLVA 4DBGA 1P7FA 1PYWD 1GC6A 3Q3NC 2LVQA 3L17A 1QZEA 2JVCA 3EECA 4FADA 2CR5A 1T5XD 1NBFC 1I4XA 1V49A 2H89B 4LDTB 1J19A 2GBRA 1KOTA 4MM3A 2NCNA 3APFA 5G5GA 2O6VD 4QAYA 5FK9C 2JQRB 4C00A 4G3XB 2W3SA 1XO3A 1WY8A 1I35A 3R8BA 3LYYA 2C7HA 2HJ8A 3BYTB 1EWCA 1MFWA 2WS3B 4WJQA 3APDA 3UI3A 3K9OB 2D07B 1L6UA 4W9DA 4JL9A 2RD0A 4KVGB 4NY0A 4FULA 2WDTB 4ICUA 2J52A 2RSUA 4HCPB 3HM6X 2O6VB 1D6EC 2N7EA 4AWJA 4RH6A 4JE3B 1XF5L 4OHJA 3H6NA 4HRSA 3PTFC 3AECB 3UIOB 1RRBA 1P0RA 3PZDA 4GB9A 4RGTA 1JWAD 4KKIA 4C7ZA 3NZ3A 1YJIA 2I1KA 1V1PA 3GOEA 3KUDB 3SFEB 4YXDB 1WH3A 3AMZA 2D3AA 3RNBC 1VD2A 1LXDA 3ZRFA 4N9F4 1R4NI 4YTPB 3RNEC 2AX5A 2RMMA 1Q1OA 3H7PA 2GMIC 5FKAC 2IY0B 3P4SB 5D3IB 2IDYA 1RFKA 4HJKA 4W9EA 3QX1A 3FILB 4TMAB 2FE8A 1IUEA 3WAMA 4K1RB 1ENFA 3QWZB 2ON8A 4KGTA 1EU3A 4G11A 2NBUA 3Q14C 1TGZB 1I4QA 3P42A 1IP9A 3U7DA 4GDKB 4A6QA 4IM0A 1EM7A 4URKA 2MEKA 5G2NA 4ANXA 4ASWC 4KX6B 1ZE3D 2WXFA 1IYFA 1B1ZA 2Y3AA 4JLCA 4HK2A 1OGWA 2LUEA 1FFUA 2LRWA 1FXTB 2KDBA 5H92C 4W9GA 2AWTA 4YSXB 2LWPA 2KAJA 1HXYD 3AH7A 4BVUC 4HPLB 2JU6X 5IN7A 1TY2A
chains in the Genus database with same CATH topology
2KMAA 4KZ0A 3ONSA 2JT4B 3CSFA 4GU2A 1EUVB 4DHJD 2HE7A 2KD0A 1GG3A 2KMCA 3WALA 2NR2A 2ZNVC 2M4NA 2MSED 1LQBA 1U4AA 1V2YA 2JF5A 3BINA 2N9EB 3T8MA 3QAQA 1V81A 2ZVOA 4FJYA 2G3QB 3IFWB 5AZHA 3H7PB 1WZ3A 1WR6E 1WXSA 2JZZA 2NVUI 2CS4A 3VUYA 1YQBA 2KJHB 4TKNA 1L7YA 2K6DB 4TQ0A 4WJNA 4ZRKA 1WXMA 4I6LB 1WE7A 1JRUA 3X0WA 4ZDVA 1WI0A 2K39A 2KANA 4FJZA 3H7SA 3DQVA 2FCNA 1V86A 3NZSA 2L76A 4MGZE 2JRIB 4NQLB 2M17A 1YJ1A 4MDKE 4JQWC 3SDLC 3AI5A 2DYMA 1A5RA 2J0MA 4PYUA 3VXWA 2J0JA 2DYOA 2JPHA 3PHXB 2MLBA 4TQ1A 2LVOA 5CHVC 4IWOA 1H8CA 1J0GA 2N9PC 4K7SA 3ENEA 5AEKB 4ANWA 2G4SA 3ZTCA 2GBKA 2N9XA 3HHMA 4DHJB 2C9WB 4BKTA 2K1FA 1TZ1A 4GGQA 4KIKB 2JUOA 4A3OA 3B0AA 4E74A 3DBSA 3HIZA 3PSEB 3VFKA 5KHQA 4KSKC 2DENB 2A5UA 2L8JA 3DVNV 4IG7B 3KVFB 2MBHA 3PHWB 1WE6A 1WM3A 1WMHA 4BOSC 2KTRA 3RCZA 3QA8A 1T0YA 2L3ZA 2R2OA 2ZPNA 3ZVVA 5CX3A 1YD8U 2FCSA 2M0XA 2KQSA 5JZEB 3DBRI 3ECIA 2CHZA 3U8ZA 3A9KA 1YIWA 3NS8A 2DAJA 4E3CA 2FIDA 3NOBA 2KJRA 3AU4A 3RD2A 4BKGA 5L95C 4W9LA 3AU5A 3U30A 2K8BA 3M3JA 5D94A 2Y5BB 4HPMB 3DVGY 1UGMA 2N1WA 2NBVB 1OEYA 5EDSA 1ZW7A 3RZFA 4ANVA 4DHZB 5JHAA 4W9CA 2ZCCA 3A4SC 3KYCD 1H4RA 5L83A 3PT2B 1I42A 2L0FA 3JYUA 2KFJA 2LZ6A 2NBWB 3ZDMC 4GIVA 2KZRA 3A9JA 4J6IA 1MG8A 1GUAB 4MEMA 1WXAA 3PGEA 3VVWB 5BO4B 2RPQA 2PJHA 3EC8A 3LJ3A 1E8WA 2DZJA 4WJOA 2IY1B 5HKHA 1HE8A 2N4FA 3ML8A 3ZKJC 3ZUNA 2YVCA 2DAFA 1V6EA 2KKCA 5IA7A 3RULA 5AZFA 1ZKHA 1R4MI 4BKSD 4A3PA 1E8YA 2HD5B 3N32A 4IWQA 2J0KA 3LDZE 2B3AA 1VCBA 2MP2A 3R3MA 3WA0A 4GMVA 3JVZX 4GN1A 1WRDB 4EKUA 4MJSA 3TJPA 2EKEC 2L05A 1EO6A 2JXXA 1SIFA 1WX7A 3ZNGC 2MX2A 3ZIMA 1GNUA 3X23A 4CYEA 4II3B 2DHZA 2DYBA 3JW0X 3NZUA 4PS3A 2GBMA 4NAWA 2UYZB 3L54A 4EZKA 5D6JB 3ZNZB 4IWPA 3VAWA 2GBNA 1X1MA 2KDIA 3RZWC 3TIXA 3PS6A 1WX9A 2KK8A 2R2QA 2AL6A 1KLVA 3APCA 1E5WA 1Z5SB 3ZRCA 5J17A 4F8CB 1P9DU 3QC8B 2KXJA 4PS7A 2REXA 4I6PA 5LLIA 3KUZA 1WMHB 2C60A 4LCDE 2KTRB 2G45B 4X57B 3A4RA 2D2QA 1WJ4A 4NQKE 2Z0DB 2N7DA 1RLFA 3Q3FA 2DZMA 4B9KA 1WGDA 1UBIA 4EEWA 4W9FA 1C3TA 1P98A 2CU1A 3A9KB 4P7IA 2GOWA 1NI2A 2OJRA 2PE6B 2LJ5A 3B1LX 2FCMA 2WX1A 1E8ZA 2ASQA 1WJNA 4W9JA 2IZVB 1UELA 3JSVA 4FBJB 1V5OA 4IW0A 2KX3A 4W9HA 4KSLC 3Q3JA 4FLHA 2IO2B 2W9NA 1M94A 2KLCA 2KC1A 3ML9A 4KV2A 4ZRIA 2LD9A 2BYVE 3BY4B 1YX6B 3A9JB 1RAXA 1C1YB 1WX8A 2MWSB 2PE9A 2Z59B 4A20A 3IG3A 3R66C 3L16A 5E6OA 3VUWA 1GJZA 1K8RB 2K8CA 4FHKA 1E7VA 3VDZA 1WGRA 4XX5A 1WGGA 3ZW3A 3VTVA 2FCQA 4F1SA 4W9IA 2K25A 3L08A 2KTFA 3N3KB 3MTNB 3QARA 4AJWA 4HWIB 2N1VA 4AUQC 4ZYNA 1WXVA 4M8NA 2KDEB 4K7UA 2ZJDA 2ZZPB 5E6NA 3ZO5B 3IHPC 1WGYA 2BKRB 4BFRA 1P1AA 5J18A 2MP2B 4B95A 1YX5B 1WJ6A 1OTRB 3AXCA 4MSQB 3W1SC 1KJTA 2KQ7A 4DHZE 4DWFA 3D32A 4KDIC 2EMSA 4MJSB 2KC2A 4FN2A 2ZCBA 2LXCA 2ZVNA 4WWOA 5JHBA 4IM2A 2XBBC 2NS5A 2LGDA 4FJVB 2M1MA 2KX0A 3V61A 4JGHB 3QIJA 1Q0WB 2JWZA 3UF8A 4NAWB 1WFYA 3A1QA 2BKFA 1XQQA 4TUUA 5CHWA 1EF5A 2K6QA 1WM2A 4NJ6A 1F9JA 4OVVA 3V60A 3PRMB 4EOYA 3PV1A 4ICVA 2CKHB 5GMVA 5AZGA 2JZ3B 3TL5A 3KYDD 3O65B 5D7GA 3IBEA 2LXAA 3VHTC 3KH0A 4GSWA 1WR1A 2AYOB 2KFKA 2MBOA 4MH0E 4AJYB 1WIAA 2ZNVB 1XD3B 1TTNA 2PPHA 1EF1A 3M95A 3V62A 2L00B 3DPDA 4MGYE 3VQIA 5DPWA 3L13A 4MSMB 1CMXB 3VTWA 3TMPB 4MGIE 3VH3B 4RM8A 2MW5A 3ALBA 4PYZA 3RT3B 4DK5A 4WWNA 4EFOA 4G0NB 2K8HA 3QK0A 1V9JA 3OLMD 3A33B 4BBNC 2CHWA 2LI5A 4M8MA 3HM3A 3DCGA 4GOCA 3JSVB 1LM8B 3ZNHB 4EZJA 4AOFA 1D3ZA 1UH6A 2MRPA 2OOBB 3DOWA 3V6EB 1PQSA 1UD7A 2FIFA 2I1JA 4LJOB 3UIPB 1UZXB 4NNJB 3PPAA 3M62B 3PRZA 4MELA 4LDTD 4F7ZA 4HVBA 1S3SG 2NPTA 4K7WA 2J7QB 1LFDA 3ZDTA 1NDDA 2BPSA 1WZ0A 2BYEA 3VTUA 2WYQA 1Y8RC 3KUCB 1SGHA 1E8XA 4HDOA 4DDGD 2IO1B 2O6VA 3PLUA 3SD5A 2IYDB 1TBEA 3TBLD 2D3GA 2C7NB 5CTRC 4FHJA 5DCNA 3CF6E 3WIMA 2YLMA 3C0RB 3PLVA 4DBGA 3OJ4B 2FUHB 1GC6A 3ZNID 2LVQA 3L17A 3VH4B 1QZEA 3PREA 4I6NB 2JVCA 4CO7A 1S1QB 3A1QB 2AL3A 4HCNB 3EECA 4K81A 5KHOA 4FADA 4IM3A 4TV3A 2CR5A 2KNBA 4PS8A 1NBFC 4EZLA 2MCNB 2RGFA 3W1YA 4ZRJA 1V49A 4KDLB 4II2B 2IBIB 2DZIA 4OVUA 2A4ZA 2JRHA 4LDTB 1J19A 2KFKB 2GBRA 2PEAA 1KOTA 3RYTA 3T9LA 2LVPA 4MM3A 2KO3A 4XZ4A 5LXIB 2NCNA 3APFA 4WWPA 1Z2MA 2O6VD 1E90A 3PVLA 5J2RA 2XEWA 3EHVA 2RR9A 1XT9B 2BWFA 4G3XB 1WGHA 1P3QU 2KVRA 3RUIB 4B6WA 4DXAB 1WY8A 2JY6A 2L0TA 1I35A 4BOZB 3CMMB 2C7HA 2HJ8A 2LRUA 4LJPB 5G55A 4M0WB 3KW5B 3B08A 4WJQA 3SHQA 4GXBA 3APDA 2FNJB 3K9OB 1Q5WB 2M8SA 3VUXA 1KM7A 2D07B 1V80A 2MBEA 4GDLA 3W1SA 3QCAA 4W9DA 4JL9A 5DPRA 2MBQA 3ZTDA 2V3SA 2GBJA 3L10B 3WAOA 2RD0A 1AARA 4KVGB 2WX0A 4CHKA 4NY0A 2KJ6A 1RFAA 3QQ8B 2NPTB 2IO0B 3SU8X 4DDID 4FULA 3OAWA 2IO3B 2WDTB 4YL8A 4ICUA 3ZLZA 1L2NA 2ZPYA 3AULA 1WYWB 4GDKA 2O2VA 2RSUA 4KZCA 3P2BA 4WJPA 4HCPB 3HM6X 2O6VB 2N7EA 4AWJA 5DPTA 4FA6A 3QJZA 2C7MB 2Z0EB 2KWCA 4IUMB 4WQOB 2KOXA 3H9DA 2KWVB 3H6NA 3PTFC 3S2AA 2KN5A 3UIOB 1RRBA 1P0RA 3PZDA 2UWQA 4GB9A 3EFUA 2WWZA 1WJUA 3PRPB 4EUTA 2C5LC 2CHXA 3H1UA 3WANA 2I1KA 1G6JA 3GOEA 2DX5B 3KUDB 3NHEB 4W9KA 2G4DB 2HTHA 2LGYA 2QHOA 4E71A 1WH3A 3MJWA 3R7QA 4HLEA 3UQBA 4XC2A 2XK5A 1UBQA 2D10A 2KLGA 1VD2A 4BKSA 2BF8B 3MHSD 1LXDA 3ZRFA 4AP4C 2BGFA 4N9F4 1R4NI 4MGKE 2MQJA 5LXHA 2LASA 5JH5C 1V5TA 1Q1OA 3HK0A 3H7PA 2GMIC 2IY0B 4IC7B 4NJ7A 2DZKA 3IVFA 4HJKA 4W9EA 3TCAA 3DVNU 3QX1A 1E7UA 1OEYJ 2FAZA 4GDLB 2EMTA 2VRRB 2BYFA 3WAMA 4K1RB 3DDCB 3QWZB 5FR6A 1OQYA 5DPSA 5C23A 4NPNA 4G11A 3V6CB 2NBUA 1TGZB 2L7RA 5CHFA 2BWES 2ZEQA 3OJ3A 2KHWB 4BBNF 2D11A 3N30A 1IP9A 1SE9A 3L0WB 3U7DA 4RM9A 4GDKB 2O2VB 1IPGA 4IM0A 3DBHI 3QHTA 4URKA 1WF9A 4WAAA 5G2NA 4ANUA 3UINB 3DBLI 4ASWC 4ANXA 1IYFA 3M63B 4KIKA 3UQAA 5TR5A 4JLCA 3WAPA 3R7RA 4HK2A 1OGWA 3I3TB 2LUEA 2MA9B 3NY5A 3DVGX 1J8CA 4RMAA 4JIOU 1ISNA 2V1YA 2LGXA 4G50A 3CSTA 5D2MB 3GZNI 2LRWA 1FXTB 1ZGUB 4HDQA 5E6PA 2KDBA 5IAAC 3K9PB 2KDFB 3UGBB 1GC7A 4W9GA 2AWTA 4HXDA 2LWPA 5C1ZA 4BVUC 4HPLB 2V4LA 2MBBB 2KWUB 2XK5B 1BT0A 2AEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMA A;  4KZ0 A;  3ONS A;  2JT4 B;  3CSF A;  4GU2 A;  1EUV B;  4DHJ D;  2HE7 A;  2KD0 A;  1GG3 A;  2KMC A;  3WAL A;  2NR2 A;  2ZNV C;  2M4N A;  2MSE D;  1LQB A;  1U4A A;  1V2Y A;  2JF5 A;  3BIN A;  2N9E B;  3T8M A;  3QAQ A;  1V81 A;  2ZVO A;  4FJY A;  2G3Q B;  3IFW B;  5AZH A;  3H7P B;  1WZ3 A;  1WR6 E;  1WXS A;  2JZZ A;  2NVU I;  2CS4 A;  3VUY A;  1YQB A;  2KJH B;  4TKN A;  1L7Y A;  2K6D B;  4TQ0 A;  4WJN A;  4ZRK A;  1WXM A;  4I6L B;  1WE7 A;  1JRU A;  3X0W A;  4ZDV A;  1WI0 A;  2K39 A;  2KAN A;  4FJZ A;  3H7S A;  3DQV A;  2FCN A;  1V86 A;  3NZS A;  2L76 A;  4MGZ E;  2JRI B;  4NQL B;  2M17 A;  1YJ1 A;  4MDK E;  4JQW C;  3SDL C;  3AI5 A;  2DYM A;  1A5R A;  2J0M A;  4PYU A;  3VXW A;  2J0J A;  2DYO A;  2JPH A;  3PHX B;  2MLB A;  4TQ1 A;  2LVO A;  5CHV C;  4IWO A;  1H8C A;  1J0G A;  2N9P C;  4K7S A;  3ENE A;  5AEK B;  4ANW A;  2G4S A;  3ZTC A;  2GBK A;  2N9X A;  3HHM A;  4DHJ B;  2C9W B;  4BKT A;  2K1F A;  1TZ1 A;  4GGQ A;  4KIK B;  2JUO A;  4A3O A;  3B0A A;  4E74 A;  3DBS A;  3HIZ A;  3PSE B;  3VFK A;  5KHQ A;  4KSK C;  2DEN B;  2A5U A;  2L8J A;  3DVN V;  4IG7 B;  3KVF B;  2MBH A;  3PHW B;  1WE6 A;  1WM3 A;  1WMH A;  4BOS C;  2KTR A;  3RCZ A;  3QA8 A;  1T0Y A;  2L3Z A;  2R2O A;  2ZPN A;  3ZVV A;  5CX3 A;  1YD8 U;  2FCS A;  2M0X A;  2KQS A;  5JZE B;  3DBR I;  3ECI A;  2CHZ A;  3U8Z A;  3A9K A;  1YIW A;  3NS8 A;  2DAJ A;  4E3C A;  2FID A;  3NOB A;  2KJR A;  3AU4 A;  3RD2 A;  4BKG A;  5L95 C;  4W9L A;  3AU5 A;  3U30 A;  2K8B A;  3M3J A;  5D94 A;  2Y5B B;  4HPM B;  3DVG Y;  1UGM A;  2N1W A;  2NBV B;  1OEY A;  5EDS A;  1ZW7 A;  3RZF A;  4ANV A;  4DHZ B;  5JHA A;  4W9C A;  2ZCC A;  3A4S C;  3KYC D;  1H4R A;  5L83 A;  3PT2 B;  1I42 A;  2L0F A;  3JYU A;  2KFJ A;  2LZ6 A;  2NBW B;  3ZDM C;  4GIV A;  2KZR A;  3A9J A;  4J6I A;  1MG8 A;  1GUA B;  4MEM A;  1WXA A;  3PGE A;  3VVW B;  5BO4 B;  2RPQ A;  2PJH A;  3EC8 A;  3LJ3 A;  1E8W A;  2DZJ A;  4WJO A;  2IY1 B;  5HKH A;  1HE8 A;  2N4F A;  3ML8 A;  3ZKJ C;  3ZUN A;  2YVC A;  2DAF A;  1V6E A;  2KKC A;  5IA7 A;  3RUL A;  5AZF A;  1ZKH A;  1R4M I;  4BKS D;  4A3P A;  1E8Y A;  2HD5 B;  3N32 A;  4IWQ A;  2J0K A;  3LDZ E;  2B3A A;  1VCB A;  2MP2 A;  3R3M A;  3WA0 A;  4GMV A;  3JVZ X;  4GN1 A;  1WRD B;  4EKU A;  4MJS A;  3TJP A;  2EKE C;  2L05 A;  1EO6 A;  2JXX A;  1SIF A;  1WX7 A;  3ZNG C;  2MX2 A;  3ZIM A;  1GNU A;  3X23 A;  4CYE A;  4II3 B;  2DHZ A;  2DYB A;  3JW0 X;  3NZU A;  4PS3 A;  2GBM A;  4NAW A;  2UYZ B;  3L54 A;  4EZK A;  5D6J B;  3ZNZ B;  4IWP A;  3VAW A;  2GBN A;  1X1M A;  2KDI A;  3RZW C;  3TIX A;  3PS6 A;  1WX9 A;  2KK8 A;  2R2Q A;  2AL6 A;  1KLV A;  3APC A;  1E5W A;  1Z5S B;  3ZRC A;  5J17 A;  4F8C B;  1P9D U;  3QC8 B;  2KXJ A;  4PS7 A;  2REX A;  4I6P A;  5LLI A;  3KUZ A;  1WMH B;  2C60 A;  4LCD E;  2KTR B;  2G45 B;  4X57 B;  3A4R A;  2D2Q A;  1WJ4 A;  4NQK E;  2Z0D B;  2N7D A;  1RLF A;  3Q3F A;  2DZM A;  4B9K A;  1WGD A;  1UBI A;  4EEW A;  4W9F A;  1C3T A;  1P98 A;  2CU1 A;  3A9K B;  4P7I A;  2GOW A;  1NI2 A;  2OJR A;  2PE6 B;  2LJ5 A;  3B1L X;  2FCM A;  2WX1 A;  1E8Z A;  2ASQ A;  1WJN A;  4W9J A;  2IZV B;  1UEL A;  3JSV A;  4FBJ B;  1V5O A;  4IW0 A;  2KX3 A;  4W9H A;  4KSL C;  3Q3J A;  4FLH A;  2IO2 B;  2W9N A;  1M94 A;  2KLC A;  2KC1 A;  3ML9 A;  4KV2 A;  4ZRI A;  2LD9 A;  2BYV E;  3BY4 B;  1YX6 B;  3A9J B;  1RAX A;  1C1Y B;  1WX8 A;  2MWS B;  2PE9 A;  2Z59 B;  4A20 A;  3IG3 A;  3R66 C;  3L16 A;  5E6O A;  3VUW A;  1GJZ A;  1K8R B;  2K8C A;  4FHK A;  1E7V A;  3VDZ A;  1WGR A;  4XX5 A;  1WGG A;  3ZW3 A;  3VTV A;  2FCQ A;  4F1S A;  4W9I A;  2K25 A;  3L08 A;  2KTF A;  3N3K B;  3MTN B;  3QAR A;  4AJW A;  4HWI B;  2N1V A;  4AUQ C;  4ZYN A;  1WXV A;  4M8N A;  2KDE B;  4K7U A;  2ZJD A;  2ZZP B;  5E6N A;  3ZO5 B;  3IHP C;  1WGY A;  2BKR B;  4BFR A;  1P1A A;  5J18 A;  2MP2 B;  4B95 A;  1YX5 B;  1WJ6 A;  1OTR B;  3AXC A;  4MSQ B;  3W1S C;  1KJT A;  2KQ7 A;  4DHZ E;  4DWF A;  3D32 A;  4KDI C;  2EMS A;  4MJS B;  2KC2 A;  4FN2 A;  2ZCB A;  2LXC A;  2ZVN A;  4WWO A;  5JHB A;  4IM2 A;  2XBB C;  2NS5 A;  2LGD A;  4FJV B;  2M1M A;  2KX0 A;  3V61 A;  4JGH B;  3QIJ A;  1Q0W B;  2JWZ A;  3UF8 A;  4NAW B;  1WFY A;  3A1Q A;  2BKF A;  1XQQ A;  4TUU A;  5CHW A;  1EF5 A;  2K6Q A;  1WM2 A;  4NJ6 A;  1F9J A;  4OVV A;  3V60 A;  3PRM B;  4EOY A;  3PV1 A;  4ICV A;  2CKH B;  5GMV A;  5AZG A;  2JZ3 B;  3TL5 A;  3KYD D;  3O65 B;  5D7G A;  3IBE A;  2LXA A;  3VHT C;  3KH0 A;  4GSW A;  1WR1 A;  2AYO B;  2KFK A;  2MBO A;  4MH0 E;  4AJY B;  1WIA A;  2ZNV B;  1XD3 B;  1TTN A;  2PPH A;  1EF1 A;  3M95 A;  3V62 A;  2L00 B;  3DPD A;  4MGY E;  3VQI A;  5DPW A;  3L13 A;  4MSM B;  1CMX B;  3VTW A;  3TMP B;  4MGI E;  3VH3 B;  4RM8 A;  2MW5 A;  3ALB A;  4PYZ A;  3RT3 B;  4DK5 A;  4WWN A;  4EFO A;  4G0N B;  2K8H A;  3QK0 A;  1V9J A;  3OLM D;  3A33 B;  4BBN C;  2CHW A;  2LI5 A;  4M8M A;  3HM3 A;  3DCG A;  4GOC A;  3JSV B;  1LM8 B;  3ZNH B;  4EZJ A;  4AOF A;  1D3Z A;  1UH6 A;  2MRP A;  2OOB B;  3DOW A;  3V6E B;  1PQS A;  1UD7 A;  2FIF A;  2I1J A;  4LJO B;  3UIP B;  1UZX B;  4NNJ B;  3PPA A;  3M62 B;  3PRZ A;  4MEL A;  4LDT D;  4F7Z A;  4HVB A;  1S3S G;  2NPT A;  4K7W A;  2J7Q B;  1LFD A;  3ZDT A;  1NDD A;  2BPS A;  1WZ0 A;  2BYE A;  3VTU A;  2WYQ A;  1Y8R C;  3KUC B;  1SGH A;  1E8X A;  4HDO A;  4DDG D;  2IO1 B;  2O6V A;  3PLU A;  3SD5 A;  2IYD B;  1TBE A;  3TBL D;  2D3G A;  2C7N B;  5CTR C;  4FHJ A;  5DCN A;  3CF6 E;  3WIM A;  2YLM A;  3C0R B;  3PLV A;  4DBG A;  3OJ4 B;  2FUH B;  1GC6 A;  3ZNI D;  2LVQ A;  3L17 A;  3VH4 B;  1QZE A;  3PRE A;  4I6N B;  2JVC A;  4CO7 A;  1S1Q B;  3A1Q B;  2AL3 A;  4HCN B;  3EEC A;  4K81 A;  5KHO A;  4FAD A;  4IM3 A;  4TV3 A;  2CR5 A;  2KNB A;  4PS8 A;  1NBF C;  4EZL A;  2MCN B;  2RGF A;  3W1Y A;  4ZRJ A;  1V49 A;  4KDL B;  4II2 B;  2IBI B;  2DZI A;  4OVU A;  2A4Z A;  2JRH A;  4LDT B;  1J19 A;  2KFK B;  2GBR A;  2PEA A;  1KOT A;  3RYT A;  3T9L A;  2LVP A;  4MM3 A;  2KO3 A;  4XZ4 A;  5LXI B;  2NCN A;  3APF A;  4WWP A;  1Z2M A;  2O6V D;  1E90 A;  3PVL A;  5J2R A;  2XEW A;  3EHV A;  2RR9 A;  1XT9 B;  2BWF A;  4G3X B;  1WGH A;  1P3Q U;  2KVR A;  3RUI B;  4B6W A;  4DXA B;  1WY8 A;  2JY6 A;  2L0T A;  1I35 A;  4BOZ B;  3CMM B;  2C7H A;  2HJ8 A;  2LRU A;  4LJP B;  5G55 A;  4M0W B;  3KW5 B;  3B08 A;  4WJQ A;  3SHQ A;  4GXB A;  3APD A;  2FNJ B;  3K9O B;  1Q5W B;  2M8S A;  3VUX A;  1KM7 A;  2D07 B;  1V80 A;  2MBE A;  4GDL A;  3W1S A;  3QCA A;  4W9D A;  4JL9 A;  5DPR A;  2MBQ A;  3ZTD A;  2V3S A;  2GBJ A;  3L10 B;  3WAO A;  2RD0 A;  1AAR A;  4KVG B;  2WX0 A;  4CHK A;  4NY0 A;  2KJ6 A;  1RFA A;  3QQ8 B;  2NPT B;  2IO0 B;  3SU8 X;  4DDI D;  4FUL A;  3OAW A;  2IO3 B;  2WDT B;  4YL8 A;  4ICU A;  3ZLZ A;  1L2N A;  2ZPY A;  3AUL A;  1WYW B;  4GDK A;  2O2V A;  2RSU A;  4KZC A;  3P2B A;  4WJP A;  4HCP B;  3HM6 X;  2O6V B;  2N7E A;  4AWJ A;  5DPT A;  4FA6 A;  3QJZ A;  2C7M B;  2Z0E B;  2KWC A;  4IUM B;  4WQO B;  2KOX A;  3H9D A;  2KWV B;  3H6N A;  3PTF C;  3S2A A;  2KN5 A;  3UIO B;  1RRB A;  1P0R A;  3PZD A;  2UWQ A;  4GB9 A;  3EFU A;  2WWZ A;  1WJU A;  3PRP B;  4EUT A;  2C5L C;  2CHX A;  3H1U A;  3WAN A;  2I1K A;  1G6J A;  3GOE A;  2DX5 B;  3KUD B;  3NHE B;  4W9K A;  2G4D B;  2HTH A;  2LGY A;  2QHO A;  4E71 A;  1WH3 A;  3MJW A;  3R7Q A;  4HLE A;  3UQB A;  4XC2 A;  2XK5 A;  1UBQ A;  2D10 A;  2KLG A;  1VD2 A;  4BKS A;  2BF8 B;  3MHS D;  1LXD A;  3ZRF A;  4AP4 C;  2BGF A;  4N9F 4;  1R4N I;  4MGK E;  2MQJ A;  5LXH A;  2LAS A;  5JH5 C;  1V5T A;  1Q1O A;  3HK0 A;  3H7P A;  2GMI C;  2IY0 B;  4IC7 B;  4NJ7 A;  2DZK A;  3IVF A;  4HJK A;  4W9E A;  3TCA A;  3DVN U;  3QX1 A;  1E7U A;  1OEY J;  2FAZ A;  4GDL B;  2EMT A;  2VRR B;  2BYF A;  3WAM A;  4K1R B;  3DDC B;  3QWZ B;  5FR6 A;  1OQY A;  5DPS A;  5C23 A;  4NPN A;  4G11 A;  3V6C B;  2NBU A;  1TGZ B;  2L7R A;  5CHF A;  2BWE S;  2ZEQ A;  3OJ3 A;  2KHW B;  4BBN F;  2D11 A;  3N30 A;  1IP9 A;  1SE9 A;  3L0W B;  3U7D A;  4RM9 A;  4GDK B;  2O2V B;  1IPG A;  4IM0 A;  3DBH I;  3QHT A;  4URK A;  1WF9 A;  4WAA A;  5G2N A;  4ANU A;  3UIN B;  3DBL I;  4ASW C;  4ANX A;  1IYF A;  3M63 B;  4KIK A;  3UQA A;  5TR5 A;  4JLC A;  3WAP A;  3R7R A;  4HK2 A;  1OGW A;  3I3T B;  2LUE A;  2MA9 B;  3NY5 A;  3DVG X;  1J8C A;  4RMA A;  4JIO U;  1ISN A;  2V1Y A;  2LGX A;  4G50 A;  3CST A;  5D2M B;  3GZN I;  2LRW A;  1FXT B;  1ZGU B;  4HDQ A;  5E6P A;  2KDB A;  5IAA C;  3K9P B;  2KDF B;  3UGB B;  1GC7 A;  4W9G A;  2AWT A;  4HXD A;  2LWP A;  5C1Z A;  4BVU C;  4HPL B;  2V4L A;  2MBB B;  2KWU B;  2XK5 B;  1BT0 A;  2AEH A; 
#chains in the Genus database with same CATH topology
 3ONS A;  4JPS A;  3Q69 A;  2IGD A;  1GG3 A;  3BVZ A;  3Q8A A;  1LQB A;  3AED B;  3BIN A;  2JF5 A;  1TS2 A;  3AE5 B;  4L1B A;  1GPX A;  1WXS A;  1F52 A;  2CS4 A;  2KJH B;  4TKN A;  4ZRK A;  4ZDV A;  1WE7 A;  1WI0 A;  3H7S A;  1V86 A;  4MGZ E;  1YJ1 A;  1L4Z B;  2J0J A;  2DYO A;  2MLB A;  4TQ1 A;  5CHV C;  3PZ7 A;  4K7S A;  4NZL B;  2E6X A;  2WXK A;  2N9X A;  1TZ1 A;  3DHH C;  3NRZ A;  4C4V B;  3H8H A;  3Q8B A;  4A3O A;  2J53 A;  3HIZ A;  1F2R I;  4P16 A;  5KHQ A;  3URY A;  2L8J A;  2WXG A;  4BOS C;  2KTR A;  3EA6 A;  4HKZ E;  3AE4 B;  3ZVV A;  1YD8 U;  3U8Z A;  3ECI A;  2CHZ A;  4E3C A;  2DAJ A;  5C2T B;  4BKG A;  2K8B A;  3M3J A;  5D3D A;  4AQ7 A;  1ZW7 A;  3PT2 B;  4P1C C;  1L5P A;  4GIV A;  3A9J A;  4JWU C;  4N6E B;  3PGE A;  3RI7 C;  5HKH A;  5EE0 A;  2AQ2 B;  1JWS D;  3ML8 A;  3ZKJ C;  3RUL A;  1QKZ A;  2G1E A;  2OED A;  3BYY B;  4B0E A;  3BII D;  4EKU A;  1SIF A;  5T8I A;  2BYT A;  3X23 A;  1CZP A;  2DHZ A;  3NZU A;  4LNK A;  1FNV A;  1JWU D;  1KLV A;  1Z5S B;  3I5J C;  1GAQ B;  1P9D U;  1YQ3 B;  4I6P A;  5LLI A;  4LCD E;  1NYQ A;  4LTU A;  1WRI A;  3E56 A;  1UNS A;  3A4R A;  2N7D A;  2N7J A;  2UU7 A;  1TT5 B;  1P98 A;  4YSY B;  2OJR A;  5EE3 A;  5LNK 1;  1E8Z A;  1WJN A;  4W9J A;  1V5O A;  3FAH A;  2KX3 A;  4W9H A;  2HJ1 A;  4FLH A;  1UWM A;  3BY4 B;  2Z59 B;  3IG3 A;  3VUW A;  4DXF A;  1N61 A;  4EE2 A;  2WXO A;  4ACF A;  2LHD A;  2KDE B;  5E6N A;  3IHP C;  4C56 C;  1J7B A;  5J18 A;  2K22 A;  2V3P A;  4ZRP A;  1WJ6 A;  1OTR B;  3W1S C;  3U7Z A;  4DHZ E;  4WUR A;  2ACZ B;  5JHB A;  2NS5 A;  4PK1 A;  4JGH B;  3V05 A;  2FBW B;  4JX1 C;  2EEL A;  3DBH B;  1EF5 A;  1WM2 A;  1F9J A;  3DBL B;  3RPF C;  3PV1 A;  5AZG A;  5IO9 A;  3KYD D;  4GSW A;  2LJI A;  4AJY B;  1XD3 B;  2MHJ A;  4LNO A;  4XE0 A;  3MC9 A;  2L00 B;  3DPD A;  3VQI A;  5G5H A;  4RM8 A;  3Q8F A;  3RT3 B;  4DK5 A;  5AUK A;  1NVI D;  3EUB 2;  4NJC A;  5I4D A;  1LO5 D;  4M0W A;  4BBN C;  3HM3 A;  1ZOY B;  4WH4 A;  2W3R A;  3ETR A;  1D3Z A;  2OOB B;  3V6E B;  4LJO B;  1V1O A;  4MEL A;  4K7W A;  1Q10 A;  1SEB D;  2PIA A;  2GI9 A;  1Y56 A;  1MG4 A;  1LFD A;  3ZDT A;  2D5G A;  2WYQ A;  1Y8R C;  1SGH A;  1N62 A;  3SD5 A;  2J4X A;  2D3G A;  2C7N B;  5CTR C;  5BYR A;  1FIQ A;  3NVW A;  3WIM A;  2WP9 B;  1YMH E;  1J7A A;  3SFD B;  3HUI A;  3A1Q B;  2MH7 A;  4HCN B;  2M0A A;  1AWD A;  1XCQ L;  3Q3O C;  4XDC A;  2MCN B;  2QEJ C;  4II2 B;  2A4Z A;  2JRH A;  2RDH A;  4RF0 A;  1HZ6 A;  3RYT A;  3T9L A;  1GB4 A;  5LXI B;  1T0S C;  3NVV A;  1Z2M A;  1RM6 C;  2RR9 A;  2BWF A;  1P3Q U;  2X8X X;  2D3B A;  3N20 C;  3DBR B;  2LRU A;  2BS3 B;  5G55 A;  3B08 A;  2FNJ B;  1KLU D;  1Q5W B;  3BVG A;  4GDL A;  2MBQ A;  1SE2 A;  5MPO A;  4CHK A;  1FNU A;  2R61 A;  3SU8 X;  4L2Y A;  3OAW A;  1N60 A;  2G9H D;  5HG2 A;  4RFB A;  4HRO A;  3ZGZ A;  3C8Y A;  1V8C A;  2KDM A;  2K3U A;  1C4P A;  2C7M B;  2Z0E B;  3IAS 1;  4WQO B;  2KOX A;  2UWQ A;  2WWZ A;  4EUT A;  2C5L C;  2CHX A;  2INN E;  2DX5 B;  3R2I A;  4HLE A;  4XC2 A;  2XK5 A;  1UBQ A;  2KLG A;  1ZXI A;  1D4B A;  3AEF B;  1XLO A;  4AP4 C;  4LNF A;  1E10 A;  1V5T A;  3ZXR A;  1E7P B;  3HK0 A;  4N58 A;  1T3Q A;  3DVN U;  5IKC M;  1JW9 D;  2FAZ A;  1TKE A;  4XYC A;  3CIR B;  3TEW A;  2WXJ A;  5FR6 A;  4NPN A;  2BWE S;  1XLQ A;  2ZEQ A;  2D11 A;  3N30 A;  1SE9 A;  1CK1 A;  4ZOH C;  3L0W B;  4MH8 A;  2O2V B;  3DBH I;  3DBL I;  2WXQ A;  4XGA B;  3E9S A;  3UQA A;  3WAP A;  4A90 A;  2MA9 B;  3DVG X;  4RMA A;  4JIO U;  2V1Y A;  4G50 A;  5D2M B;  1L0V B;  5IAA C;  2KDF B;  3BVM A;  1GC7 A;  3GE8 C;  1YN4 A;  2MBB B;  4REZ A;  1TZO A;  3W9C B;  2LMC A;  4ARC A;  4KZ0 A;  3O13 A;  4DHJ D;  3WAL A;  2KD0 A;  3IXS A;  2NR2 A;  2M4N A;  2DBY A;  2MSE D;  1U4A A;  2Q5W D;  2BS4 B;  2ZW1 A;  3B9J A;  1V81 A;  2CU3 A;  5AZH A;  2G3Q B;  2VZK D;  1WR6 E;  3KLS X;  4RGM A;  2JZZ A;  2NVU I;  2DLB A;  3ZYY X;  1KH0 A;  1YQB A;  3VUY A;  1L7Y A;  4RGN A;  3Q2A C;  4WJN A;  3X0W A;  1JRU A;  3BWU D;  4FJZ A;  3NZS A;  4NQL B;  3SDL C;  2J0M A;  3VXW A;  1TYG B;  2V0G A;  2JPH A;  1I4P A;  3T3N A;  3W5U B;  1H8C A;  2N9P C;  4ANW A;  2G4S A;  2GBK A;  4DHJ B;  4KIK B;  4E74 A;  3B0A A;  2VZK B;  4KSK C;  2DEN B;  2GLS A;  3WCQ A;  3PHW B;  1WM3 A;  3MFG A;  4J3O D;  2ICI A;  3RCZ A;  1T0Y A;  2L3Z A;  2MJ3 A;  2R2O A;  1YOV B;  2ZPN A;  5CX3 A;  1C9F A;  2FCS A;  2KQS A;  3AM9 A;  3DBR I;  2K5P A;  3A9K A;  1YIW A;  1FEH A;  3AU4 A;  1N5X A;  4W9L A;  2AQ3 B;  3U30 A;  2PTL A;  3RZF A;  4ANV A;  4DHZ B;  4W9C A;  3A4S C;  3KYC D;  1MHH E;  2L0F A;  3JYU A;  2KZR A;  1MG8 A;  3VVW B;  5BMG A;  4FXC A;  2RPQ A;  3EC8 A;  4Q2J A;  1HE8 A;  3P63 A;  2L52 A;  1ZKH A;  3NUH B;  1HEZ E;  4BKS D;  4A3P A;  4HKQ A;  1SBB B;  3LDZ E;  2B3A A;  3WA0 A;  4GMV A;  3JVZ X;  4IOI E;  1FMA D;  4HPP A;  1HTO A;  4MJS A;  1JML A;  2EKE C;  1ZXH A;  1EO6 A;  3ZNG C;  3ZIM A;  3EGR A;  1GNU A;  1MJD A;  2KAC A;  2DYB A;  1QOG A;  5E6J A;  4TSS A;  2GBM A;  3CWI A;  4S0R A;  4EZK A;  2WGS A;  3ZNZ B;  2WU2 B;  2M19 A;  4IWP A;  3VAW A;  2IJ0 A;  1WX9 A;  2KK8 A;  4NAM A;  1DOX A;  1RWS A;  1E5W A;  2KXJ A;  4PS7 A;  2REX A;  3NG0 A;  1WMH B;  2HDE A;  2D2Q A;  2WDQ B;  2Z0D B;  1F1H A;  2V9H A;  3Q3F A;  2GRI A;  1C3T A;  2BW2 A;  4M02 A;  4P7I A;  2PE6 B;  2LJ5 A;  2ONQ A;  1JRP A;  2IZV B;  3JSV A;  1QLB B;  4KSL C;  2IND C;  2IO2 B;  1QF6 A;  3ML9 A;  2JYT A;  3MJ5 A;  1MVK A;  1C1Y B;  1RAX A;  4ZRQ A;  2PE9 A;  4A20 A;  3L16 A;  5EE9 A;  3RNA C;  2GB1 A;  1GJZ A;  2BB6 A;  3VTV A;  2K25 A;  1I4R A;  3MTN B;  4AJW A;  4HWI B;  2N1V A;  3U4E G;  3IAM 1;  1VZ7 A;  2IGG A;  2ZZP B;  3DHI C;  1WGY A;  1BUI C;  1IBX A;  1TS5 A;  2MP2 B;  4B95 A;  3VR9 B;  1DYQ A;  1DGJ A;  2KQ7 A;  3D32 A;  4KDI C;  2K0P A;  2ZVN A;  4IM2 A;  2XBB C;  2J42 A;  3V61 A;  1FNW A;  2JWZ A;  4NAW B;  1ZDV A;  2BKF A;  4TUU A;  1ET6 A;  3DWG C;  4OVV A;  3V60 A;  1F0Z A;  3PRM B;  2INC C;  5GMV A;  4K3B A;  3IBE A;  3VHT C;  3KH0 A;  1WR1 A;  1WIA A;  2WU5 B;  1TTN A;  1EF1 A;  2EKI A;  4MGY E;  5DPW A;  3L13 A;  1PGA A;  4MSM B;  2BQQ A;  3GZN B;  1OFF A;  1HZ5 A;  2LHE A;  3ALB A;  4GLS C;  4WWN A;  4G0N B;  2WXP A;  2N0S B;  1V9J A;  3A33 B;  2CHW A;  2VH1 A;  3DCG A;  5AUI A;  2WXL A;  3ZNH B;  5EE1 A;  1UD7 A;  5BYS A;  2JZP A;  3M62 B;  4F7Z A;  1S3S G;  3PZ8 A;  2W55 A;  2BPS A;  3VTU A;  3KUC B;  2IO1 B;  2O6V A;  3OWE B;  3TBL D;  3CF6 E;  5HFY A;  1SXT A;  2I2Y A;  3OJ4 B;  3ZNI D;  1IGC A;  3VH4 B;  3PRE A;  4CO7 A;  1S1Q B;  2AL3 A;  4K81 A;  5KHO A;  4IM3 A;  2KNB A;  2WNM A;  4RNA A;  4EZL A;  1HA5 A;  2RGF A;  3AEB B;  3ZXV A;  4KDL B;  4OVU A;  4LK0 M;  2KFK B;  2PEA A;  4K3C A;  3V3X A;  4XZ4 A;  3L4P A;  1MPE A;  1FCL A;  3PVL A;  5J2R A;  1HTQ A;  4BAX A;  3RUI B;  3EHV A;  1XT9 B;  1FRD A;  1WGH A;  2WXR A;  1VDV A;  3CMM B;  4LJP B;  5BMI A;  2XN9 C;  3KW5 B;  1UGJ A;  3SHQ A;  4GXB A;  2M8S A;  3FIL A;  4P6V F;  3VUX A;  1KM7 A;  2MBE A;  4L23 A;  3QCA A;  4RF1 A;  3RNC C;  2WX0 A;  3QQ8 B;  2NPT B;  4DDI D;  1FRR A;  4OZA A;  1K51 A;  2IO3 B;  2ZPY A;  3ZJT A;  3AUL A;  4GDK A;  1R4M B;  3P2B A;  3MC0 B;  2PLP A;  1HQR D;  5DPT A;  4FA6 A;  3QJZ A;  1WGK A;  4N59 A;  2KWC A;  4IUM B;  4UDU C;  3H9D A;  2KWV B;  2BVC A;  3PO0 A;  4ZHP A;  3S2A A;  2IGH A;  2MJD A;  5HI1 A;  1TY0 A;  1UF0 A;  3EFU A;  1WJU A;  1G6J A;  1N6Z A;  3P4P B;  1T6B X;  4W9K A;  1QOA A;  2G4D B;  2HTH A;  2QHO A;  2RDB C;  2BTE A;  3MJW A;  3R7Q A;  1FO4 A;  3LB8 C;  3UQB A;  2D10 A;  4BKS A;  2JWU A;  4MM3 B;  2BF8 B;  3MHS D;  2MQJ A;  5LXH A;  5JH5 C;  1WWT A;  4IC7 B;  3NVY A;  4OW0 A;  4B0M A;  1E7U A;  1OEY J;  2LUM A;  3AE8 B;  1OQY A;  4HJG E;  5C23 A;  4US9 A;  3V6C B;  5CHF A;  3IT4 B;  2KHW B;  1TKG A;  2D3C A;  1ZP0 B;  3TEY A;  4WAA A;  4ANU A;  2NMQ A;  3UIN B;  2N9K A;  4C4V A;  2KYW A;  5TR5 A;  1YQ4 B;  1IGD A;  2SAK A;  3RNG C;  3R7R A;  3I3T B;  1J8C A;  4LNN A;  4WWM A;  1SB3 C;  1ISN A;  2LGX A;  4D2K A;  2Y5P A;  3CST A;  1T0R C;  2PKO A;  3GZN I;  1JAL A;  1ZGU B;  4HDQ A;  3K9P B;  1V1P B;  3UGB B;  4YTM B;  4HXD A;  2V3N A;  1I4G A;  1XLP A;  1YN3 A;  2W82 A;  1C4A A;  1BT0 A;  4TQ0 A;  4HVB A;  3U2S C;  2L32 A;  1L4D B;  3CSF A;  3NJT A;  2HE7 A;  2ZNV C;  4LNI A;  1J7C A;  1V2Y A;  2N9E B;  3T8M A;  4FJY A;  1L0Y B;  1VZ8 A;  3H7P B;  1WZ3 A;  1QOF A;  1V97 A;  1SSN A;  2WXM A;  1WXM A;  4A8X C;  1TIF A;  2K39 A;  2KAN A;  1TS3 A;  2BT6 A;  3AE9 B;  2JRI B;  2M17 A;  4MDK E;  4JQW C;  3AI5 A;  2DYM A;  1N63 A;  3HRD D;  2IPK D;  3PHX B;  1K53 A;  2LVO A;  3RN9 C;  1JWM D;  4IWO A;  1J0G A;  3KWL A;  4YT0 B;  3ZTC A;  4XDD A;  4BKT A;  2K1F A;  2E3T A;  1E9M A;  3VFK A;  3PSE B;  1ZDX A;  2A5U A;  3KVF B;  1WE6 A;  3QA8 A;  1WXQ A;  2M0X A;  2FID A;  2KJR A;  1AW7 A;  3N9Y C;  3AU5 A;  5D94 A;  1UGM A;  2N1W A;  5EDS A;  1JWB D;  3MHZ A;  1H4R A;  1I42 A;  2LZ6 A;  4J6I A;  4MEM A;  1WXA A;  3ZQ4 A;  2KMM A;  3AEG B;  1FXA A;  2QMT A;  2W54 A;  3ZUN A;  3DWM A;  2DAF A;  1V6E A;  1ACC A;  1R4M I;  1E8Y A;  2HD5 B;  3N32 A;  4IWQ A;  3T3O A;  2J0K A;  2VH2 A;  3R3M A;  3ABV B;  1JCK B;  2Z8L A;  1WRD B;  2QJL A;  4ZHO A;  3TJP A;  1VR9 A;  4KKJ A;  1WX7 A;  4O1N A;  2MX2 A;  4CYE A;  1F77 A;  3JW0 X;  1YJJ A;  1L0X B;  2UYZ B;  3B2G A;  3RFZ B;  4WAF A;  4MT5 A;  2GBN A;  1ET9 A;  3RZW C;  3TIX A;  3PS6 A;  3NS1 A;  1XXG A;  2AL6 A;  1D5M C;  3ZRC A;  4F8C B;  2JYE A;  4P1B C;  2PVG C;  2C60 A;  2KTR B;  1WJ4 A;  4NQK E;  1RLF A;  1FCC C;  4B9K A;  1AN8 A;  1A70 A;  1D5Z C;  1WGD A;  4EEW A;  4CQN A;  2CU1 A;  3AE2 B;  4YWG G;  1NI2 A;  3B1L X;  2KWD A;  2LGI A;  4USA A;  4FBJ B;  4IW0 A;  4C7Y A;  2W9N A;  1M94 A;  4ZRI A;  2KC1 A;  2BYV E;  5JXV A;  3A9J B;  2MWS B;  1WX8 A;  4FHK A;  3VDZ A;  3KQ4 A;  1WGG A;  2FCQ A;  4F1S A;  4W9I A;  3GB1 A;  3P4Q B;  2PMV A;  4AUQ C;  4ZYN A;  1WXV A;  1FM0 D;  4K7U A;  2K9X A;  3ZO5 B;  2JXT A;  2QC8 A;  1YX5 B;  4MSQ B;  1KJT A;  3AE6 B;  2TSS A;  4OZB A;  2EMS A;  2KC2 A;  2LXC A;  4WWO A;  3W5V B;  2M1M A;  2MJE A;  2LFI A;  3QIJ A;  1Q0W B;  1QOB A;  3A1Q A;  4YTN B;  1KF6 B;  4ZYS A;  4S17 A;  2K6Q A;  4NJ6 A;  4EOY A;  3MP9 A;  1VLB A;  2JZ3 B;  3TL5 A;  3O65 B;  2X38 A;  5D7G A;  2KQ4 X;  2LXA A;  2AYO B;  4MH0 E;  2ZNV B;  2PPH A;  1QIL A;  3M95 A;  1PUT A;  4HEA 1;  1CMX B;  4MGI E;  3VH3 B;  2MW5 A;  3P4R B;  4PYZ A;  1TJE A;  3QK0 A;  1OQR A;  4WIP A;  4M8M A;  3J9C A;  4GOC A;  1DOY A;  4JWS C;  1BXT A;  4EZJ A;  1CQV A;  1UH6 A;  2MRP A;  3DOW A;  1PQS A;  2FIF A;  2OHF A;  2QCZ A;  1LGR A;  3UIP B;  1UZX B;  4NNJ B;  1M4V A;  2J7Q B;  1FFV A;  4US8 A;  3RMK C;  1NDD A;  2BS2 B;  1T0Q C;  4BZA A;  4HDO A;  1AYF A;  3PLU A;  5DCN A;  3RNF C;  1ZPS A;  2YLM A;  2YEP F;  2FUH B;  1BML C;  1NYR A;  4I6N B;  2WDR B;  4TV3 A;  4PS8 A;  4RCO A;  3W1Y A;  4ZRJ A;  2IBI B;  2DZI A;  1FPY A;  2FUG 1;  2LVP A;  2KO3 A;  4WWP A;  1E90 A;  2XEW A;  3R2T A;  1VJK A;  1RYJ A;  2KVR A;  4B6W A;  4DXA B;  2WXN A;  2JY6 A;  2L0T A;  1EWY C;  4BOZ B;  1C79 A;  2WHI A;  4M0W B;  1NI3 A;  3I57 A;  3AV8 A;  1V80 A;  1ZUD 2;  2HTM E;  3W1S A;  5DPR A;  3ZTD A;  2V3S A;  2GBJ A;  3L10 B;  3WAO A;  1AAR A;  2KJ6 A;  1RFA A;  4KGR A;  2IO0 B;  4YL8 A;  2QDF A;  3ZLZ A;  5FR3 A;  1L2N A;  4DQO C;  1WYW B;  2O2V A;  4KZC A;  3SR6 A;  4WJP A;  4M01 A;  1SJE D;  3FKY A;  1VRA B;  3NVZ A;  3EFC A;  1GB1 A;  4C80 A;  2BBC A;  1I7H A;  3Q8E A;  2KN5 A;  2L83 A;  1P7E A;  5IOI A;  1KFY B;  1C76 A;  2JX5 A;  3PRP B;  4KGS A;  3H1U A;  3WAN A;  3W2D A;  2QIL A;  3NHE B;  2LGY A;  2LGS A;  3AN1 A;  4E71 A;  5H8Y E;  1ESF A;  1L6V A;  3AE7 B;  3LXF A;  3MC8 A;  2JSV X;  2BGF A;  3AE1 B;  4MGK E;  2LAS A;  3HVZ A;  4YSZ B;  4NJ7 A;  2DZK A;  3ZJU A;  3IVF A;  3TCA A;  1PFD A;  4GDL B;  2EMT A;  2VRR B;  2BYF A;  3DDC B;  5DPS A;  2B76 B;  3AB5 A;  1B9R A;  2L7R A;  2KVZ A;  3OJ3 A;  2KN4 A;  2CJO A;  4BBN F;  1QT9 A;  3B2F A;  4RM9 A;  4OVZ A;  1IPG A;  3U52 E;  1YNT E;  3QHT A;  1WF9 A;  5BMH A;  5TSS A;  3M63 B;  4KIK A;  1E6E B;  4ITK A;  1C77 A;  3NY5 A;  4MAC A;  1GOZ A;  3SEB A;  5E6P A;  4A9A A;  1ROE A;  2CJN A;  4XWT A;  5C1Z A;  2V4L A;  2KWU B;  2XK5 B;  2AEH A;  2KMA A;  1EU4 A;  4LLG M;  2JT4 B;  2WXH A;  4GU2 A;  1EUV B;  2DNF A;  1SIJ A;  2KMC A;  1I4H A;  2H88 B;  2BB5 A;  4WQM A;  2KT7 A;  3QAQ A;  2ZVO A;  3IFW B;  1N5W A;  1UWX A;  1KTK A;  3VRB B;  2WQY B;  1K50 A;  2K6D B;  4I6L B;  3N1Y C;  3DQV A;  2FCN A;  2L76 A;  1FD6 A;  1A5R A;  3VR8 B;  3AEA B;  4PYU A;  3AE3 B;  5BYQ A;  1DOI A;  3ENE A;  5AEK B;  3HHM A;  2C9W B;  2WXI A;  2AQ1 B;  4GGQ A;  2JUO A;  3DBS A;  1R7S A;  3DVN V;  4IG7 B;  2RDG A;  2MBH A;  5GXG B;  1WMH A;  3N1Z C;  2DWQ A;  1SF0 A;  2Y5C A;  3GE3 C;  5JZE B;  3NS8 A;  3NOB A;  2NTT A;  3RD2 A;  4ARI A;  5L95 C;  1UUP A;  2Y5B B;  4HPM B;  3DVG Y;  2NBV B;  1OEY A;  3I63 C;  1SE4 A;  5JHA A;  1F2R C;  1YN5 A;  3C19 A;  2ZCC A;  5L83 A;  3KWV A;  2KFJ A;  2NBW B;  3ZDM C;  4DXG A;  1GUA B;  5BO4 B;  2PJH A;  3LJ3 A;  1E8W A;  2DZJ A;  4WJO A;  2IY1 B;  3GP7 A;  2N4F A;  2YVC A;  1MHX A;  2KKC A;  5IA7 A;  5AZF A;  1JQ4 A;  1C78 A;  3TEX A;  1VCB A;  3ZJV A;  2MP2 A;  4GN1 A;  2V4I B;  4A55 A;  1OQQ A;  2L05 A;  2JXX A;  4IDI A;  1JRO A;  1MI0 A;  4II3 B;  4PS3 A;  4NAW A;  3L54 A;  3P1M A;  1WSP A;  5D6J B;  1XEE A;  2I38 A;  1X1M A;  2KDI A;  1WYG A;  2R2Q A;  3BK2 A;  1E0Z A;  3APC A;  1CJE A;  5J17 A;  1K52 A;  3QC8 B;  1XLN A;  3KUZ A;  3BK1 A;  2G45 B;  4X57 B;  4XWW A;  5HHD G;  1STE A;  1D5X C;  2DZM A;  1UBI A;  4W9F A;  3A9K B;  2GOW A;  3DHG C;  2FCM A;  2WX1 A;  2ASQ A;  1UEL A;  2YEP B;  1NEK B;  2INP E;  1PGX A;  3Q3J A;  4KV2 A;  1R4N B;  2KLC A;  2LD9 A;  2ZW0 A;  2NTS A;  1YX6 B;  3R66 C;  5E6O A;  3IT6 B;  1K8R B;  2K8C A;  1E7V A;  1WGR A;  4XX5 A;  3ZW3 A;  3TSS A;  3I9V 1;  4IKG A;  4AS1 A;  3L08 A;  2KTF A;  3N3K B;  3QAR A;  2LEK A;  4M8N A;  4OZC A;  2ZJD A;  2BKR B;  4BFR A;  3AEE B;  3N1X C;  1P1A A;  4RGO S;  3AXC A;  4DWF A;  4MJS B;  3Q8C A;  2ZCB A;  4FN2 A;  1QQR A;  2LGD A;  4FJV B;  2KX0 A;  2PW9 A;  4PT5 A;  3UF8 A;  2SEB D;  1WFY A;  1XCT L;  1XQQ A;  5CHW A;  1KRH A;  1PGB A;  4ICV A;  2CKH B;  3Q6B A;  2MBO A;  2KFK A;  3BZD B;  1VZ6 A;  3V62 A;  3HVD A;  1C4C A;  4R3D A;  4H2A A;  3VTW A;  2PVO D;  3TMP B;  1SE3 A;  4EFO A;  2K8H A;  2WLB A;  5IP4 D;  1KLG D;  3OLM D;  5C3J B;  2LI5 A;  3TUO A;  2M56 B;  2OJW A;  3JSV B;  1LM8 B;  3VRA B;  3TEZ A;  2L1A A;  4AOF A;  3FC4 A;  1SJH D;  2I1J A;  1PDX A;  1TS4 A;  3PPA A;  3PRZ A;  4LDT D;  3GS2 A;  2NPT A;  2QIE B;  2QSD A;  1FXI A;  1TKY A;  2XNA C;  1NEN B;  2BYE A;  1WZ0 A;  4M00 A;  1E8X A;  4DDG D;  2N9L A;  2IYD B;  2WDV B;  1TBE A;  1IBX B;  4FHJ A;  3Q3M C;  3OG5 A;  2RPV A;  3C0R B;  3PLV A;  4DBG A;  1P7F A;  1PYW D;  1GC6 A;  3Q3N C;  2LVQ A;  3L17 A;  1QZE A;  2JVC A;  3EEC A;  4FAD A;  2CR5 A;  1T5X D;  1NBF C;  1I4X A;  1V49 A;  2H89 B;  4LDT B;  1J19 A;  2GBR A;  1KOT A;  4MM3 A;  2NCN A;  3APF A;  5G5G A;  2O6V D;  4QAY A;  5FK9 C;  2JQR B;  4C00 A;  4G3X B;  2W3S A;  1XO3 A;  1WY8 A;  1I35 A;  3R8B A;  3LYY A;  2C7H A;  2HJ8 A;  3BYT B;  1EWC A;  1MFW A;  2WS3 B;  4WJQ A;  3APD A;  3UI3 A;  3K9O B;  2D07 B;  1L6U A;  4W9D A;  4JL9 A;  2RD0 A;  4KVG B;  4NY0 A;  4FUL A;  2WDT B;  4ICU A;  2J52 A;  2RSU A;  4HCP B;  3HM6 X;  2O6V B;  1D6E C;  2N7E A;  4AWJ A;  4RH6 A;  4JE3 B;  1XF5 L;  4OHJ A;  3H6N A;  4HRS A;  3PTF C;  3AEC B;  3UIO B;  1RRB A;  1P0R A;  3PZD A;  4GB9 A;  4RGT A;  1JWA D;  4KKI A;  4C7Z A;  3NZ3 A;  1YJI A;  2I1K A;  1V1P A;  3GOE A;  3KUD B;  3SFE B;  4YXD B;  1WH3 A;  3AMZ A;  2D3A A;  3RNB C;  1VD2 A;  1LXD A;  3ZRF A;  4N9F 4;  1R4N I;  4YTP B;  3RNE C;  2AX5 A;  2RMM A;  1Q1O A;  3H7P A;  2GMI C;  5FKA C;  2IY0 B;  3P4S B;  5D3I B;  2IDY A;  1RFK A;  4HJK A;  4W9E A;  3QX1 A;  3FIL B;  4TMA B;  2FE8 A;  1IUE A;  3WAM A;  4K1R B;  1ENF A;  3QWZ B;  2ON8 A;  4KGT A;  1EU3 A;  4G11 A;  2NBU A;  3Q14 C;  1TGZ B;  1I4Q A;  3P42 A;  1IP9 A;  3U7D A;  4GDK B;  4A6Q A;  4IM0 A;  1EM7 A;  4URK A;  2MEK A;  5G2N A;  4ANX A;  4ASW C;  4KX6 B;  1ZE3 D;  2WXF A;  1IYF A;  1B1Z A;  2Y3A A;  4JLC A;  4HK2 A;  1OGW A;  2LUE A;  1FFU A;  2LRW A;  1FXT B;  2KDB A;  5H92 C;  4W9G A;  2AWT A;  4YSX B;  2LWP A;  2KAJ A;  1HXY D;  3AH7 A;  4BVU C;  4HPL B;  2JU6 X;  5IN7 A;  1TY2 A; 
#chains in the Genus database with same CATH homology
 2KMA A;  4KZ0 A;  3ONS A;  2JT4 B;  3CSF A;  4GU2 A;  1EUV B;  4DHJ D;  2HE7 A;  2KD0 A;  1GG3 A;  2KMC A;  3WAL A;  2NR2 A;  2ZNV C;  2M4N A;  2MSE D;  1LQB A;  1U4A A;  1V2Y A;  2JF5 A;  3BIN A;  2N9E B;  3T8M A;  3QAQ A;  1V81 A;  2ZVO A;  4FJY A;  2G3Q B;  3IFW B;  5AZH A;  3H7P B;  1WZ3 A;  1WR6 E;  1WXS A;  2JZZ A;  2NVU I;  2CS4 A;  3VUY A;  1YQB A;  2KJH B;  4TKN A;  1L7Y A;  2K6D B;  4TQ0 A;  4WJN A;  4ZRK A;  1WXM A;  4I6L B;  1WE7 A;  1JRU A;  3X0W A;  4ZDV A;  1WI0 A;  2K39 A;  2KAN A;  4FJZ A;  3H7S A;  3DQV A;  2FCN A;  1V86 A;  3NZS A;  2L76 A;  4MGZ E;  2JRI B;  4NQL B;  2M17 A;  1YJ1 A;  4MDK E;  4JQW C;  3SDL C;  3AI5 A;  2DYM A;  1A5R A;  2J0M A;  4PYU A;  3VXW A;  2J0J A;  2DYO A;  2JPH A;  3PHX B;  2MLB A;  4TQ1 A;  2LVO A;  5CHV C;  4IWO A;  1H8C A;  1J0G A;  2N9P C;  4K7S A;  3ENE A;  5AEK B;  4ANW A;  2G4S A;  3ZTC A;  2GBK A;  2N9X A;  3HHM A;  4DHJ B;  2C9W B;  4BKT A;  2K1F A;  1TZ1 A;  4GGQ A;  4KIK B;  2JUO A;  4A3O A;  3B0A A;  4E74 A;  3DBS A;  3HIZ A;  3PSE B;  3VFK A;  5KHQ A;  4KSK C;  2DEN B;  2A5U A;  2L8J A;  3DVN V;  4IG7 B;  3KVF B;  2MBH A;  3PHW B;  1WE6 A;  1WM3 A;  1WMH A;  4BOS C;  2KTR A;  3RCZ A;  3QA8 A;  1T0Y A;  2L3Z A;  2R2O A;  2ZPN A;  3ZVV A;  5CX3 A;  1YD8 U;  2FCS A;  2M0X A;  2KQS A;  5JZE B;  3DBR I;  3ECI A;  2CHZ A;  3U8Z A;  3A9K A;  1YIW A;  3NS8 A;  2DAJ A;  4E3C A;  2FID A;  3NOB A;  2KJR A;  3AU4 A;  3RD2 A;  4BKG A;  5L95 C;  4W9L A;  3AU5 A;  3U30 A;  2K8B A;  3M3J A;  5D94 A;  2Y5B B;  4HPM B;  3DVG Y;  1UGM A;  2N1W A;  2NBV B;  1OEY A;  5EDS A;  1ZW7 A;  3RZF A;  4ANV A;  4DHZ B;  5JHA A;  4W9C A;  2ZCC A;  3A4S C;  3KYC D;  1H4R A;  5L83 A;  3PT2 B;  1I42 A;  2L0F A;  3JYU A;  2KFJ A;  2LZ6 A;  2NBW B;  3ZDM C;  4GIV A;  2KZR A;  3A9J A;  4J6I A;  1MG8 A;  1GUA B;  4MEM A;  1WXA A;  3PGE A;  3VVW B;  5BO4 B;  2RPQ A;  2PJH A;  3EC8 A;  3LJ3 A;  1E8W A;  2DZJ A;  4WJO A;  2IY1 B;  5HKH A;  1HE8 A;  2N4F A;  3ML8 A;  3ZKJ C;  3ZUN A;  2YVC A;  2DAF A;  1V6E A;  2KKC A;  5IA7 A;  3RUL A;  5AZF A;  1ZKH A;  1R4M I;  4BKS D;  4A3P A;  1E8Y A;  2HD5 B;  3N32 A;  4IWQ A;  2J0K A;  3LDZ E;  2B3A A;  1VCB A;  2MP2 A;  3R3M A;  3WA0 A;  4GMV A;  3JVZ X;  4GN1 A;  1WRD B;  4EKU A;  4MJS A;  3TJP A;  2EKE C;  2L05 A;  1EO6 A;  2JXX A;  1SIF A;  1WX7 A;  3ZNG C;  2MX2 A;  3ZIM A;  1GNU A;  3X23 A;  4CYE A;  4II3 B;  2DHZ A;  2DYB A;  3JW0 X;  3NZU A;  4PS3 A;  2GBM A;  4NAW A;  2UYZ B;  3L54 A;  4EZK A;  5D6J B;  3ZNZ B;  4IWP A;  3VAW A;  2GBN A;  1X1M A;  2KDI A;  3RZW C;  3TIX A;  3PS6 A;  1WX9 A;  2KK8 A;  2R2Q A;  2AL6 A;  1KLV A;  3APC A;  1E5W A;  1Z5S B;  3ZRC A;  5J17 A;  4F8C B;  1P9D U;  3QC8 B;  2KXJ A;  4PS7 A;  2REX A;  4I6P A;  5LLI A;  3KUZ A;  1WMH B;  2C60 A;  4LCD E;  2KTR B;  2G45 B;  4X57 B;  3A4R A;  2D2Q A;  1WJ4 A;  4NQK E;  2Z0D B;  2N7D A;  1RLF A;  3Q3F A;  2DZM A;  4B9K A;  1WGD A;  1UBI A;  4EEW A;  4W9F A;  1C3T A;  1P98 A;  2CU1 A;  3A9K B;  4P7I A;  2GOW A;  1NI2 A;  2OJR A;  2PE6 B;  2LJ5 A;  3B1L X;  2FCM A;  2WX1 A;  1E8Z A;  2ASQ A;  1WJN A;  4W9J A;  2IZV B;  1UEL A;  3JSV A;  4FBJ B;  1V5O A;  4IW0 A;  2KX3 A;  4W9H A;  4KSL C;  3Q3J A;  4FLH A;  2IO2 B;  2W9N A;  1M94 A;  2KLC A;  2KC1 A;  3ML9 A;  4KV2 A;  4ZRI A;  2LD9 A;  2BYV E;  3BY4 B;  1YX6 B;  3A9J B;  1RAX A;  1C1Y B;  1WX8 A;  2MWS B;  2PE9 A;  2Z59 B;  4A20 A;  3IG3 A;  3R66 C;  3L16 A;  5E6O A;  3VUW A;  1GJZ A;  1K8R B;  2K8C A;  4FHK A;  1E7V A;  3VDZ A;  1WGR A;  4XX5 A;  1WGG A;  3ZW3 A;  3VTV A;  2FCQ A;  4F1S A;  4W9I A;  2K25 A;  3L08 A;  2KTF A;  3N3K B;  3MTN B;  3QAR A;  4AJW A;  4HWI B;  2N1V A;  4AUQ C;  4ZYN A;  1WXV A;  4M8N A;  2KDE B;  4K7U A;  2ZJD A;  2ZZP B;  5E6N A;  3ZO5 B;  3IHP C;  1WGY A;  2BKR B;  4BFR A;  1P1A A;  5J18 A;  2MP2 B;  4B95 A;  1YX5 B;  1WJ6 A;  1OTR B;  3AXC A;  4MSQ B;  3W1S C;  1KJT A;  2KQ7 A;  4DHZ E;  4DWF A;  3D32 A;  4KDI C;  2EMS A;  4MJS B;  2KC2 A;  4FN2 A;  2ZCB A;  2LXC A;  2ZVN A;  4WWO A;  5JHB A;  4IM2 A;  2XBB C;  2NS5 A;  2LGD A;  4FJV B;  2M1M A;  2KX0 A;  3V61 A;  4JGH B;  3QIJ A;  1Q0W B;  2JWZ A;  3UF8 A;  4NAW B;  1WFY A;  3A1Q A;  2BKF A;  1XQQ A;  4TUU A;  5CHW A;  1EF5 A;  2K6Q A;  1WM2 A;  4NJ6 A;  1F9J A;  4OVV A;  3V60 A;  3PRM B;  4EOY A;  3PV1 A;  4ICV A;  2CKH B;  5GMV A;  5AZG A;  2JZ3 B;  3TL5 A;  3KYD D;  3O65 B;  5D7G A;  3IBE A;  2LXA A;  3VHT C;  3KH0 A;  4GSW A;  1WR1 A;  2AYO B;  2KFK A;  2MBO A;  4MH0 E;  4AJY B;  1WIA A;  2ZNV B;  1XD3 B;  1TTN A;  2PPH A;  1EF1 A;  3M95 A;  3V62 A;  2L00 B;  3DPD A;  4MGY E;  3VQI A;  5DPW A;  3L13 A;  4MSM B;  1CMX B;  3VTW A;  3TMP B;  4MGI E;  3VH3 B;  4RM8 A;  2MW5 A;  3ALB A;  4PYZ A;  3RT3 B;  4DK5 A;  4WWN A;  4EFO A;  4G0N B;  2K8H A;  3QK0 A;  1V9J A;  3OLM D;  3A33 B;  4BBN C;  2CHW A;  2LI5 A;  4M8M A;  3HM3 A;  3DCG A;  4GOC A;  3JSV B;  1LM8 B;  3ZNH B;  4EZJ A;  4AOF A;  1D3Z A;  1UH6 A;  2MRP A;  2OOB B;  3DOW A;  3V6E B;  1PQS A;  1UD7 A;  2FIF A;  2I1J A;  4LJO B;  3UIP B;  1UZX B;  4NNJ B;  3PPA A;  3M62 B;  3PRZ A;  4MEL A;  4LDT D;  4F7Z A;  4HVB A;  1S3S G;  2NPT A;  4K7W A;  2J7Q B;  1LFD A;  3ZDT A;  1NDD A;  2BPS A;  1WZ0 A;  2BYE A;  3VTU A;  2WYQ A;  1Y8R C;  3KUC B;  1SGH A;  1E8X A;  4HDO A;  4DDG D;  2IO1 B;  2O6V A;  3PLU A;  3SD5 A;  2IYD B;  1TBE A;  3TBL D;  2D3G A;  2C7N B;  5CTR C;  4FHJ A;  5DCN A;  3CF6 E;  3WIM A;  2YLM A;  3C0R B;  3PLV A;  4DBG A;  3OJ4 B;  2FUH B;  1GC6 A;  3ZNI D;  2LVQ A;  3L17 A;  3VH4 B;  1QZE A;  3PRE A;  4I6N B;  2JVC A;  4CO7 A;  1S1Q B;  3A1Q B;  2AL3 A;  4HCN B;  3EEC A;  4K81 A;  5KHO A;  4FAD A;  4IM3 A;  4TV3 A;  2CR5 A;  2KNB A;  4PS8 A;  1NBF C;  4EZL A;  2MCN B;  2RGF A;  3W1Y A;  4ZRJ A;  1V49 A;  4KDL B;  4II2 B;  2IBI B;  2DZI A;  4OVU A;  2A4Z A;  2JRH A;  4LDT B;  1J19 A;  2KFK B;  2GBR A;  2PEA A;  1KOT A;  3RYT A;  3T9L A;  2LVP A;  4MM3 A;  2KO3 A;  4XZ4 A;  5LXI B;  2NCN A;  3APF A;  4WWP A;  1Z2M A;  2O6V D;  1E90 A;  3PVL A;  5J2R A;  2XEW A;  3EHV A;  2RR9 A;  1XT9 B;  2BWF A;  4G3X B;  1WGH A;  1P3Q U;  2KVR A;  3RUI B;  4B6W A;  4DXA B;  1WY8 A;  2JY6 A;  2L0T A;  1I35 A;  4BOZ B;  3CMM B;  2C7H A;  2HJ8 A;  2LRU A;  4LJP B;  5G55 A;  4M0W B;  3KW5 B;  3B08 A;  4WJQ A;  3SHQ A;  4GXB A;  3APD A;  2FNJ B;  3K9O B;  1Q5W B;  2M8S A;  3VUX A;  1KM7 A;  2D07 B;  1V80 A;  2MBE A;  4GDL A;  3W1S A;  3QCA A;  4W9D A;  4JL9 A;  5DPR A;  2MBQ A;  3ZTD A;  2V3S A;  2GBJ A;  3L10 B;  3WAO A;  2RD0 A;  1AAR A;  4KVG B;  2WX0 A;  4CHK A;  4NY0 A;  2KJ6 A;  1RFA A;  3QQ8 B;  2NPT B;  2IO0 B;  3SU8 X;  4DDI D;  4FUL A;  3OAW A;  2IO3 B;  2WDT B;  4YL8 A;  4ICU A;  3ZLZ A;  1L2N A;  2ZPY A;  3AUL A;  1WYW B;  4GDK A;  2O2V A;  2RSU A;  4KZC A;  3P2B A;  4WJP A;  4HCP B;  3HM6 X;  2O6V B;  2N7E A;  4AWJ A;  5DPT A;  4FA6 A;  3QJZ A;  2C7M B;  2Z0E B;  2KWC A;  4IUM B;  4WQO B;  2KOX A;  3H9D A;  2KWV B;  3H6N A;  3PTF C;  3S2A A;  2KN5 A;  3UIO B;  1RRB A;  1P0R A;  3PZD A;  2UWQ A;  4GB9 A;  3EFU A;  2WWZ A;  1WJU A;  3PRP B;  4EUT A;  2C5L C;  2CHX A;  3H1U A;  3WAN A;  2I1K A;  1G6J A;  3GOE A;  2DX5 B;  3KUD B;  3NHE B;  4W9K A;  2G4D B;  2HTH A;  2LGY A;  2QHO A;  4E71 A;  1WH3 A;  3MJW A;  3R7Q A;  4HLE A;  3UQB A;  4XC2 A;  2XK5 A;  1UBQ A;  2D10 A;  2KLG A;  1VD2 A;  4BKS A;  2BF8 B;  3MHS D;  1LXD A;  3ZRF A;  4AP4 C;  2BGF A;  4N9F 4;  1R4N I;  4MGK E;  2MQJ A;  5LXH A;  2LAS A;  5JH5 C;  1V5T A;  1Q1O A;  3HK0 A;  3H7P A;  2GMI C;  2IY0 B;  4IC7 B;  4NJ7 A;  2DZK A;  3IVF A;  4HJK A;  4W9E A;  3TCA A;  3DVN U;  3QX1 A;  1E7U A;  1OEY J;  2FAZ A;  4GDL B;  2EMT A;  2VRR B;  2BYF A;  3WAM A;  4K1R B;  3DDC B;  3QWZ B;  5FR6 A;  1OQY A;  5DPS A;  5C23 A;  4NPN A;  4G11 A;  3V6C B;  2NBU A;  1TGZ B;  2L7R A;  5CHF A;  2BWE S;  2ZEQ A;  3OJ3 A;  2KHW B;  4BBN F;  2D11 A;  3N30 A;  1IP9 A;  1SE9 A;  3L0W B;  3U7D A;  4RM9 A;  4GDK B;  2O2V B;  1IPG A;  4IM0 A;  3DBH I;  3QHT A;  4URK A;  1WF9 A;  4WAA A;  5G2N A;  4ANU A;  3UIN B;  3DBL I;  4ASW C;  4ANX A;  1IYF A;  3M63 B;  4KIK A;  3UQA A;  5TR5 A;  4JLC A;  3WAP A;  3R7R A;  4HK2 A;  1OGW A;  3I3T B;  2LUE A;  2MA9 B;  3NY5 A;  3DVG X;  1J8C A;  4RMA A;  4JIO U;  1ISN A;  2V1Y A;  2LGX A;  4G50 A;  3CST A;  5D2M B;  3GZN I;  2LRW A;  1FXT B;  1ZGU B;  4HDQ A;  5E6P A;  2KDB A;  5IAA C;  3K9P B;  2KDF B;  3UGB B;  1GC7 A;  4W9G A;  2AWT A;  4HXD A;  2LWP A;  5C1Z A;  4BVU C;  4HPL B;  2V4L A;  2MBB B;  2KWU B;  2XK5 B;  1BT0 A;  2AEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...