1IPGA

Solution structure of the pb1 domain of bem1p
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
b'GAMGSSTSGLKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BEM1 PROTEIN
publication title Structure and ligand recognition of the PB1 domain: a novel protein module binding to the PC motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ipgA00
2CKHB 1UGMA 4AJYB 3NOBA 3A9JB 1J0GA 3Q3FA 1L7YA 3H6NA 1OTRB 2C5LC 3H7PB 3M63B 5FR6A 3TMPB 2KO3A 4ICVA 4W9FA 1S1QB 4BBNC 3TCAA 1GG3A 2Z0DB 4A20A 1GC6A 1WJUA 1Z5SB 1X1MA 2KHWB 1I42A 3M95A 2GBJA 4LCDE 4J6IA 4NJ6A 4AUQC 4CYEA 1Q1OA 2LUEA 2J7QB 1WXMA 4K1RB 4WAAA 4I6LB 3VAWA 4DK5A 4TV3A 3L54A 2FIFA 2MCNB 1UH6A 1MG8A 5C23A 3NY5A 2KLCA 4WWNA 5DCNA 1WI0A 5JH5C 3A9KB 2FAZA 4W9DA 5CHVC 4DHJB 2KOXA 1WX7A 2BPSA 1E5WA 4FJYA 4IM0A 3ZW3A 2N7DA 3L13A 2KD0A 2MBBB 1XD3B 4YL8A 5TR5A 3V62A 2IYDB 2GOWA 1WM2A 2MBEA 4HCPB 3PRMB 2WYQA 3PSEB 3PLVA 3QWZB 4FBJB 3B0AA 3AULA 3H7SA 4EUTA 2CHZA 5J17A 1RFAA 1WY8A 1WGRA 2LI5A 2YLMA 2KFKA 1LQBA 2NVUI 3A1QA 4AOFA 1XQQA 1WM3A 3AU5A 2KDBA 2MBHA 2KDIA 3EFUA 3VVWB 2ZPYA 5KHQA 2IO0B 3DVGY 4ZYNA 2BYEA 3ZRCA 3APFA 4TQ1A 5CHFA 3RULA 3PTFC 3VQIA 2AL3A 1GNUA 2HE7A 3A9JA 2IO1B 1Y8RC 2PJHA 2UYZB 3QA8A 1TBEA 2K8HA 3K9OB 3QHTA 5E6PA 2JWZA 1RAXA 4DDID 1NBFC 2M1MA 2M17A 1YX5B 3HK0A 2GBRA 3KUZA 1EF5A 4PYUA 2ZVOA 4URKA 2IY0B 3PLUA 2DYBA 4F1SA 1J19A 4MJSB 4HLEA 5DPTA 2Y5BB 2CU1A 2IZVB 4HDQA 4KSLC 3R7QA 5L95C 2D11A 4P7IA 2PPHA 2D2QA 3KUDB 2K39A 5CHWA 3D32A 2ZPNA 2KANA 3JW0X 4LJPB 4HPLB 1R4NI 2J0KA 2DZKA 2NS5A 2J0JA 1WGDA 2KC2A 3L16A 2L8JA 2L76A 2A4ZA 2ZVNA 3APDA 1S3SG 5G2NA 1WR6E 1WMHB 2LXCA 1YJ1A 4BOZB 4DBGA 3V6CB 3VUXA 3V6EB 2JRIB 5E6NA 2WX1A 5DPWA 4X57B 4KVGB 2LVOA 3PZDA 2XK5B 4GMVA 3QIJA 1JRUA 1V6EA 3SD5A 2KN5A 3W1SC 2KTRB 3ZTCA 4JL9A 4M8MA 4HPMB 2LVPA 3ONSA 3B08A 3KVFB 3H9DA 3QCAA 4OVVA 4GDLB 1P0RA 2JZZA 3N3KB 4N9F4 3U7DA 3RD2A 2MWSB 2K6QA 4A3PA 1WGHA 4KZCA 2NPTB 3IG3A 1V86A 2HD5B 2Z0EB 4IG7B 4IWOA 3H1UA 2LASA 2KDFB 2C7HA 2RGFA 2PE6B 1ZKHA 2KNBA 4W9EA 3T9LA 4WJQA 2DHZA 3PT2B 4WJNA 5GMVA 2JPHA 4HDOA 3AU4A 4TKNA 5AZFA 2MX2A 4MGZE 4AWJA 4F8CB 2A5UA 2JZ3B 3R3MA 4HCNB 3UQBA 4BOSC 2BKRB 1YX6B 1WF9A 2JUOA 1C3TA 2N9XA 3APCA 2XBBC 3PGEA 3DDCB 4WJOA 3GZNI 4MSMB 1BT0A 2NBVB 3KYCD 2KQ7A 4NAWB 4FJVB 3T8MA 3JYUA 3AI5A 3VUYA 3RT3B 1EF1A 2MW5A 1RRBA 4CO7A 1UBQA 2CHXA 2IO3B 2KLGA 4BKGA 4M0WB 2DZIA 3DQVA 2D3GA 2LRUA 2DX5B 2Z59B 2FCNA 4IW0A 1EO6A 2LWPA 2K6DB 3RCZA 3DBRI 4W9CA 3IHPC 3VUWA 3W1YA 2K8CA 2GBKA 1WXSA 5HKHA 3PRPB 4E3CA 4HXDA 4HVBA 2O6VB 4K81A 3ENEA 3V60A 2K25A 4FHKA 3TL5A 4W9HA 1U4AA 4EZLA 3AXCA 2XEWA 4LJOB 1Q0WB 3X23A 1SIFA 4GDKA 5JHAA 3OJ4B 1WGYA 3RUIB 3VHTC 2G4DB 3MJWA 1YD8U 3SDLC 4XX5A 4RM9A 2PEAA 2N1VA 4IC7B 1XT9B 1E8XA 2DYOA 1F9JA 2ZNVC 4ZRIA 3DVNU 2BYVE 2EKEC 1V2YA 2BWFA 2VRRB 2FUHB 1UD7A 5DPSA 4WWOA 4FADA 2DZMA 2B3AA 2OJRA 2ASQA 4MDKE 2G4SA 4NNJB 3S2AA 1Z2MA 4W9JA 2YVCA 4ASWC 3KUCB 3QC8B 4E71A 5L83A 3TIXA 1Q5WB 2KDEB 3O65B 3H7PA 3ECIA 2C7MB 2KJRA 4ANXA 3QX1A 3X0WA 2KMCA 2MRPA 4G50A 1FXTB 1CMXB 2MP2B 3P2BA 1YQBA 4KIKB 3SHQA 4EKUA 2HJ8A 1V5OA 2DAJA 2WWZA 3WA0A 4F7ZA 1SGHA 2RR9A 2AEHA 4BKSA 2G3QB 1E7UA 2JRHA 1QZEA 3KH0A 3WANA 1TZ1A 2HTHA 2N9EB 1ISNA 4E74A 1IP9A 5JHBA 1D3ZA 3A9KA 1ZGUB 2DYMA 1LXDA 2REXA 2EMSA 1WFYA 1LFDA 4NJ7A 4IWQA 1WRDB 4GIVA 1WX8A 1RLFA 4EFOA 1WR1A 4G3XB 2FCQA 4KDIC 3L10B 3TBLD 2NBUA 2ZEQA 3UF8A 3A33B 1G6JA 3CF6E 4KV2A 4W9GA 2M4NA 2LGDA 4GU2A 1UBIA 2MQJA 3PVLA 4HJKA 1C1YB 4RMAA 4BKTA 2M0XA 4II3B 5J2RA 3VDZA 2KTFA 3QQ8B 5DPRA 1E7VA 4NPNA 3SU8X 4GOCA 3CSTA 4FHJA 4G0NB 5E6OA 3DBSA 4B6WA 5J18A 1GJZA 2ZJDA 1T0YA 2KVRA 5D7GA 3ZKJC 3B1LX 3QJZA 2C9WB 2LXAA 4JLCA 3IFWB 1OGWA 1NI2A 5CTRC 4MH0E 2K1FA 4ANWA 3JSVB 3OLMD 1H4RA 4FN2A 4NQKE 2RSUA 3R66C 4KSKC 4EZJA 3WALA 3VXWA 4KIKA 2D10A 2L0FA 3CMMB 2M8SA 3PPAA 4PS8A 2BWES 2DAFA 2QHOA 1R4MI 4MJSA 2ZNVB 3ZRFA 3VFKA 2MSED 1HE8A 3NS8A 4MEMA 4LDTD 3OAWA 5AZGA 2FCMA 5G55A 3DVNV 2OOBB 1M94A 1V80A 4M8NA 2UWQA 3ZUNA 1OEYJ 3N32A 2BKFA 2L00B 4K7UA 4WJPA 3N30A 4IM2A 3VTVA 3ZNID 1IYFA 1WMHA 1I35A 2KFJA 2L7RA 4AP4C 3C0RB 3IVFA 4B9KA 4DHJD 2PE9A 5BO4B 3A4RA 1P3QU 4WWPA 4JQWC 4JIOU 3EECA 2GBNA 2KXJA 2XK5A 1PQSA 4II2B 1OEYA 2KTRA 2N4FA 1J8CA 3ZTDA 4BVUC 1TTNA 3VH3B 1K8RB 2KWCA 2R2QA 1GC7A 4NY0A 2DENB 2KZRA 3UIPB 4GDLA 1V5TA 3BINA 2I1KA 1WJ6A 4W9LA 2FCSA 4ANVA 1UELA 3HM3A 1IPGA 1NDDA 2NPTA 3GOEA 2JVCA 2RPQA 5D6JB 3DPDA 3Q3JA 5D94A 1E90A 4EZKA 3UINB 4LDTB 2N7EA 3L0WB 2O2VB 2EMTA 1KOTA 4GN1A 2KK8A 5KHOA 2MBOA 4G11A 3DOWA 2WX0A 2KKCA 3DVGX 3JSVA 2MLBA 2NR2A 4FLHA 3EC8A 4XZ4A 2K8BA 3CSFA 1KLVA 2BYFA 1WJNA 4K7WA 5LXHA 2N9PC 2AYOB 2C60A 3PRZA 4W9KA 1VD2A 2KQSA 2ZCCA 4DHZE 3ZDMC 2CS4A 3EHVA 3HM6X 4FULA 4GSWA 2V4LA 1H8CA 2KX3A 2LD9A 4ZRJA 5D2MB 2ZZPB 4K7SA 4TUUA 1YIWA 5LLIA 4TQ0A 2IBIB 3PHWB 3ZIMA 1WZ3A 4DDGD 1V81A 4NAWA 2FNJB 2D07B 2KWUB 3ZVVA 3I3TB 2AWTA 2V3SA 3KW5B 3RYTA 4I6PA 3QARA 2JXXA 3IBEA 2NBWB 1LM8B 3RZFA 4RM8A 5AEKB 1L2NA 3U8ZA 1E8YA 2L0TA 4W9IA 3JVZX 5LXIB 3UGBB 3V61A 3DCGA 2LGXA 1EUVB 2GBMA 1V49A 3TJPA 2G45B 4BBNF 4PS7A 3ZDTA 3PS6A 2KMAA 3QK0A 1A5RA 3WAPA 3LDZE 3HHMA 3MHSD 1OQYA 3NZSA 5C1ZA 2KJ6A 4OVUA 2C7NB 2ZCBA 3M62B 2O6VA 4CHKA 1WGGA 3PHXB 4HWIB 2AL6A 2V1YA 2CHWA 3NZUA 4GB9A 3ZO5B 1WZ0A 4A3OA 5EDSA 2KWVB 2KC1A 3A4SC 2KJHB 5AZHA 4JGHB 1WE6A 4NQLB 2NCNA 2RD0A 2LJ5A 2O2VA 2IY1B 5IA7A 4KZ0A 4ANUA 2GMIC 1P1AA 2L3ZA 3W1SA 2JT4B 2JY6A 5IAAC 4ZRKA 2JF5A 2LVQA 4PS3A 2MBQA 1E8WA 1WXVA 2LZ6A 2LGYA 4FJZA 3U30A 3ZNGC 3L17A 1V9JA 3M3JA 4HK2A 3WAMA 3VTWA 4IWPA 1WX9A 2L05A 3K9PB 3ML9A 3OJ3A 3RZWC 2IO2B 4MELA 4IM3A 4MGYE 1WXAA 1WJ4A 5JZEB 1WH3A 3WIMA 2FIDA 2W9NA 3UIOB 4EEWA 4ICUA 1UZXB 3DBHI 3ZNZB 3VH4B 3BY4B 4DHZB 2WDTB 4AJWA 4WQOB 3ZLZA 4ZDVA 3WAOA 3KYDD 4MM3A 3LJ3A 2MP2A 3PV1A 1ZW7A 4FA6A 4DXAB 2BF8B 3L08A 3MTNB 1VCBA 2CR5A 3NHEB 4MGKE 1KJTA 5CX3A 3UQAA 1WYWB 3DBLI 3VTUA 1WE7A 3ML8A 1E8ZA 2N1WA 4MGIE 4BKSD 2DZJA 4GDKB 4DWFA 4BFRA 1GUAB 1SE9A 3QAQA 2BGFA 2R2OA 4GXBA 3ALBA 3PREA 1P98A 4IUMB 4I6NB 4KDLB 2O6VD 3R7RA 3HIZA 1AARA 2J0MA 4GGQA 2I1JA 2KFKB 2KX0A 4PYZA 3A1QB 3ZNHB 4EOYA 1TGZB 1WIAA 4MSQB 4XC2A 1KM7A 1P9DU 2LRWA 2MA9B 4B95A
chains in the Genus database with same CATH superfamily
3U7ZA 3Q3FA 4JE3B 2VH1A 1OTRB 2JU6X 2YEPF 4WURA 4W9FA 3IT4B 2Z0DB 1WGKA 1X1MA 2KHWB 4JWUC 3M95A 4LCDE 4AUQC 1Q1OA 3Q8CA 4WAAA 1MHHE 4I6LB 3L54A 2MCNB 2CJOA 3VRAB 2KLCA 4WWNA 1L0YB 1ZOYB 1WX7A 2NTSA 3ZW3A 2IYDB 3IXSA 3L4PA 1XF5L 3LXFA 3H7SA 3BVZA 2CHZA 5JXVA 1WGRA 1CJEA 2LI5A 4XWWA 1LQBA 1PYWD 3AU5A 5EE1A 3VRBB 2IO0B 2BYEA 2RPVA 3APFA 4RF0A 3O13A 5CHFA 3PTFC 2GB1A 3AE6B 3DWGC 2AL3A 1J7BA 2IO1B 1Y8RC 2JWZA 1RAXA 1JRPA 2IGHA 1TZOA 2DYBA 1KF6B 1J19A 2Y5BB 4KSLC 2D11A 2D2QA 3GS2A 5CHWA 3D32A 2KANA 4HPLB 1PGXA 2J0KA 2KC2A 1WGDA 1KLGD 2A4ZA 3ZXVA 1BMLC 1S3SG 3DHHC 2G1EA 5G2NA 3I5JC 1NVID 1SJED 5E6NA 5DPWA 4X57B 2LVOA 2LUMA 2KTRB 4M8MA 2LVPA 1C4CA 3TUOA 3ONSA 3B08A 5D3IB 3HVZA 1JWAD 2WXRA 4A3PA 4EE2A 1WGHA 3IG3A 1F2RI 4ZOHC 1QOBA 4IWOA 2KDFB 3NVVA 1RFKA 1YMHE 1ZKHA 1AWDA 4HROA 1MHXA 3AU4A 1JROA 1HEZE 4MGZE 4YTPB 1DGJA 1I4PA 4F8CB 2JZ3B 4HCNB 4M00A 4B0MA 1YX6B 5EE3A 2PMVA 2XBBC 1ZE3D 3AB5A 3VR8B 4ARIA 5C2TB 4RGMA 1SBBB 2MW5A 2IO3B 4BKGA 4M0WB 3DQVA 2DX5B 3ZJUA 1AW7A 1EO6A 2LWPA 3RCZA 1IBXA 1ZXHA 3IHPC 2K8CA 2K25A 3UI3A 4BZAA 4W9HA 3AXCA 2ON8A 1FNVA 1I7HA 5JHAA 1F77A 4P6VF 1WGYA 2YEPB 4P1BC 1UWMA 1F2RC 1XLNA 1F9JA 3URYA 4ZRIA 1WYGA 2BYVE 4RNAA 1TS3A 3P1MA 1UD7A 3BVMA 4MDKE 2B3AA 3S2AA 1V1PA 1Z2MA 2YVCA 3EGRA 1VZ8A 3DHGC 3KUCB 3TEZA 3O65B 2KJRA 3QX1A 1C78A 2QSDA 2MHJA 4C7ZA 1SB3C 1B9RA 1FXTB 1I4GA 4KIKB 1QT9A 3B2FA 2JRHA 1QZEA 4RGTA 3KH0A 3WANA 2BBCA 1SXTA 2BQQA 1QLBB 2N9EB 1ISNA 3A9KA 1ZGUB 1WFYA 4ARCA 1WRDB 2WQYB 4GIVA 1WR1A 1I4XA 2OHFA 4G3XB 2VZKD 4KDIC 4ITKA 2NBUA 2WXMA 3UF8A 4KKJA 1XLQA 4KV2A 2LGDA 4YXDB 1UBIA 2MQJA 2M0XA 1ENFA 3HRDD 3VDZA 2KTFA 2KAJA 4FHJA 5J18A 2V9HA 1TY2A 5I4DA 2KACA 5D7GA 3ZKJC 4K3CA 4JLCA 1QQRA 1SIJA 1NI2A 1RWSA 4A6QA 4FN2A 4NQKE 3R66C 3AEEB 4K3BA 3WALA 4KKIA 1VRAB 3PPAA 3KQ4A 3VFKA 4KX6B 2FCMA 2RDGA 2WNMA 3DVNV 2OOBB 1M94A 4WIPA 1M4VA 1C4AA 3KLSX 3ZUNA 1OEYJ 3N1YC 4K7UA 4WJPA 3ZNID 1I35A 1WMHA 2KFJA 3C0RB 1YN5A 3FKYA 1DYQA 1FXIA 3EECA 1L4ZB 2XK5A 1OEYA 3RMKC 1TTNA 3VH3B 3BIID 3BINA 1MG4A 3DWMA 4C80A 4S0RA 1NDDA 5D6JB 2KQ4X 4EZKA 4UDUC 4LDTB 2O2VB 2EMTA 1KOTA 2KK8A 4G11A 2WX0A 2KKCA 3JSVA 1KLVA 1VD2A 4NAMA 2ZCCA 2CS4A 2AQ3B 3EHVA 3AEDB 2V4LA 4ZRJA 1DOYA 2ZZPB 1FNWA 2MJEA 2JSVX 4KGRA 4TQ0A 3PHWB 3ZIMA 4YTMB 3NG0A 4NAWA 3ZVVA 2AWTA 2V3SA 3KW5B 1LM8B 4RM8A 5C3JB 3C19A 1E8YA 2L0TA 4W9IA 2CJNA 3JVZX 4FXCA 5LXIB 3UGBB 3V61A 3I9V1 3M62B 4CHKA 4NZLB 1XLOA 1KRHA 4S17A 4A3OA 5EDSA 3A4SC 5AZHA 2GRIA 1FFUA 1LGRA 3LB8C 1K51A 4IOIE 5HFYA 1L6UA 3LYYA 3W1SA 3NUHB 2JT4B 3CIRB 1VZ7A 2JF5A 2WDRB 3AEGB 2MBQA 4FJZA 3MC0B 1L4DB 1WX9A 1HXYD 3KWLA 1WJ4A 2FIDA 1SE3A 4EEWA 1UZXB 3ZNZB 5BYQA 2G9HD 4DHZB 4AJWA 3Q8EA 1E7PB 4MM3A 3PV1A 1MJDA 2WXIA 4DXAB 1DOIA 2BF8B 3L08A 1VCBA 3NHEB 5CX3A 2VZKB 3DBLI 3VTUA 4BKSD 1GUAB 1SE9A 2R2OA 2AX5A 3PREA 1P98A 2QCZA 3T3NA 1JWMD 1ZUD2 2J0MA 2KFKB 4PYZA 3A1QB 4EOYA 1TGZB 2ICIA 2Y5PA 1KM7A 2BS2B 1MPEA 3W2DA 2LRWA 1YOVB 1HQRD 1QILA 1XCQL 1V1PB 1UGMA 2CKHB 3A9JB 1UNSA 1L7YA 4L2YA 1FM0D 2WU2B 3TMPB 2KO3A 3TCAA 1GG3A 1WJUA 1I42A 4RH6A 1T6BX 2KT7A 1I4QA 4NJ6A 1QF6A 3AE4B 1WXMA 1RM6C 1D4BA 1JW9D 5DCNA 5JH5C 1FMAD 3A9KB 2FAZA 1E5WA 4IM0A 3V62A 4DXGA 3BYTB 4HCPB 3PRMB 2WYQA 2WHIA 5IOIA 1NENB 4EUTA 2IDYA 5J17A 2YLMA 3U52E 1XQQA 1WM3A 1WWTA 3RNEC 3NVWA 4ZYNA 4XDCA 2JWUA 2V0GA 4XYCA 3VQIA 3AM9A 4MT5A 2HE7A 2RDHA 1ACCA 4C00A 2UYZB 2PJHA 1T0SC 3K9OB 5E6PA 3U2SC 1NBFC 1SE2A 4XE0A 1JWUD 4IDIA 5BYSA 3KUZA 1EF5A 5DPTA 1GB4A 4USAA 2WXLA 3R7QA 4PK1A 4P7IA 3KUDB 2ZPNA 4A90A 3JW0X 4KGSA 4LJPB 3BK1A 1R4NI 3L16A 2L8JA 3APDA 2SAKA 1TT5B 1WMHB 2LXCA 4DBGA 2MJ3A 3V6EB 1F0ZA 2WX1A 3BWUD 2L83A 3PZDA 2XK5B 1V6EA 3W1SC 3N1XC 3W5UB 3QCAA 4OVVA 5HI1A 5FR3A 2BB6A 4MACA 3RD2A 4KZCA 3NZ3A 4US8A 2WXPA 3H1UA 5MPOA 2LASA 2RGFA 2Q5WD 2KNBA 1FEHA 3PT2B 4WJNA 4TKNA 4JWSC 2A5UA 3DBLB 2HDEA 4BOSC 2BKRB 2JUOA 1WF9A 4LNFA 4JPSA 2NBVB 4NAWB 4FJVB 3Q8AA 3NVZA 4YT0B 1T0RC 4Q2JA 1RRBA 4CO7A 2CHXA 2D3GA 2LRUA 2Z59B 2FCNA 3W1YA 3EFCA 3W9CB 1WRIA 2GBKA 2WXQA 1ET6A 4HXDA 4TMAB 4E3CA 4HVBA 1FPYA 3V60A 1C79A 4FHKA 4A8XC 4XDDA 1EWCA 4EZLA 4LJOB 1N5XA 1SIFA 4GDKA 2BW2A 1KLUD 2G4DB 3MJWA 2IPKD 4RM9A 4IC7B 3BVGA 1V2YA 4FADA 2WDVB 2OJRA 2ASQA 4W9JA 4E71A 1YQ3B 1PDXA 2MRPA 4EKUA 3P2BA 2WWZA 5BYRA 4N59A 3I63C 2RR9A 4YSYB 2G3QB 2IGDA 2E6XA 5T8IA 1GAQB 4ZHOA 1D3ZA 5BMHA 2EMSA 4NJ7A 2K22A 1RLFA 1ROEA 2INNE 2FCQA 3L10B 3TBLD 1D5ZC 1G6JA 1TYGB 2M56B 1ZPSA 1OQQA 4W9GA 2WXGA 1R4NB 5DPRA 4IKGA 1TJEA 4CQNA 5E6OA 4B6WA 4HPPA 2ZJDA 1L6VA 2ACZB 4DXFA 1XEEA 2LXAA 3IFWB 2LEKA 2RSUA 4KSKC 4EZJA 1HZ6A 3E9SA 2R61A 4H2AA 2M8SA 4DQOC 4MJSA 1R4MI 3ZRFA 2MSED 4MEMA 4LDTD 1V80A 4M8NA 2VH2A 3EUB2 3N20C 2BKFA 3Q6BA 3VTVA 4IM2A 1TKEA 1KFYB 4B9KA 4DHJD 5HHDG 4KGTA 4JQWC 4LK0M 4II2B 2LGSA 1J8CA 1QOGA 2KWCA 1GC7A 2DENB 2KZRA 4GDLA 2I1KA 1WJ6A 2FCSA 1F1HA 2PLPA 3GOEA 2RPQA 3Q3JA 1CK1A 1IGCA 4GN1A 3RI7C 4FLHA 2NR2A 1RYJA 3EC8A 3CSFA 2BYFA 3I57A 1WJNA 4K7WA 4DHZE 3J9CA 4GSWA 1H8CA 2KX3A 2XN9C 4M01A 5D2MB 4K7SA 4TUUA 5BMIA 1WZ3A 1XXGA 1V81A 3ZYYX 3I3TB 2QJLA 4I6PA 3QARA 3IBEA 1ZXIA 2X38A 3RZFA 3U8ZA 3CWIA 3VR9B 4HRSA 1V49A 3P4QB 3ZJVA 4BBNF 1TKYA 2K9XA 3PS6A 2KMAA 4LTUA 2DWQA 1E0ZA 1OQYA 1HTQA 3P63A 1FD6A 1ZDXA 2ZCBA 2O6VA 3PHXB 4HWIB 4C4VA 2V1YA 2GLSA 1N6ZA 3NZUA 4GB9A 3ZO5B 1ZDVA 1PGAA 2KC1A 1NYQA 1YQ4B 4JGHB 1KH0A 4NQLB 2NCNA 2RD0A 2LJ5A 2DLBA 4KZ0A 4ANUA 2JXTA 2JY6A 4RF1A 1STEA 2LGYA 2LZ6A 4N58A 3KWVA 2BYTA 1P7EA 1V8CA 3M3JA 4HK2A 3GE8C 3WAMA 3K9PB 2HJ1A 3RZWC 1FRRA 5JZEB 3UIOB 3VH4B 4ZDVA 2V3PA 2KYWA 4WQOB 3WAOA 3KYDD 3LJ3A 3AE9B 4FA6A 3B2GA 3TEWA 2CR5A 4LNOA 1WYWB 1FCLA 1WE7A 1YJIA 2N1WA 4MGIE 4GDKB 4DWFA 2BGFA 4GXBA 1B1ZA 4IUMB 4JX1C 3SEBA 5H92C 2D5GA 4KDLB 2O6VD 3R7RA 1AARA 3Q8BA 3ZNHB 1WIAA 1R4MB 3SFDB 3FC4A 2BVCA 4B95A 1PGBA 3OWEB 1J0GA 1T3QA 4ZRPA 1EU4A 3H6NA 4GLSC 1S1QB 4BBNC 1GC6A 3AE7B 3ZXRA 4J6IA 2PKOA 2EELA 2LUEA 3HUIA 2J7QB 4J3OD 4K1RB 2CU3A 3VAWA 1N62A 1MG8A 3NY5A 4REZA 4DHJB 5CHVC 2WP9B 2BPSA 4FJYA 2N7DA 3L13A 2KD0A 2MBBB 1XD3B 2GOWA 2LJIA 3PSEB 1K53A 2N7JA 3PLVA 3QWZB 3Q2AC 3B0AA 2TSSA 1RFAA 1WY8A 2NMQA 4AOFA 2KDBA 3EFUA 2KDIA 5KHQA 1JWBD 2RMMA 3DVGY 2WXHA 4TQ1A 5E6JA 1GNUA 3NVYA 3Q3OC 1L5PA 1TBEA 2K8HA 3QHTA 4DDID 2M1MA 1YX5B 3HK0A 2DBYA 4URKA 2IY0B 4F1SA 1E6EB 4MJSB 1TIFA 4HDQA 4HEA1 2PPHA 1E9MA 1EM7A 2D3BA 1JALA 2DZKA 2NS5A 2ZVNA 3Q69A 1WR6E 5H8YE 1YJ1A 3V6CB 3VUXA 3AEAB 3WCQA 2FBWB 4KVGB 4YTNB 1IBXB 3SD5A 3QIJA 1JRUA 3GE3C 3Q3MC 4HPMB 3KVFB 3H9DA 4GDLB 1P0RA 2JZZA 4N9F4 3U7DA 2MWSB 2K6QA 1TY0A 2BT6A 2HD5B 4IG7B 4C7YA 2C7HA 3BZDB 1MFWA 3RNBC 4AS1A 3T9LA 2JPHA 1P7FA 4AWJA 4OHJA 3UQBA 1C3TA 3APCA 3PGEA 2JZPA 2BS4B 3DDCB 4WJOA 3GZNI 2KQ7A 3BK2A 3AI5A 3VUYA 1EF1A 2PTLA 2Y5CA 1NEKB 1UBQA 2KLGA 1BUIC 1MVKA 4IW0A 2K6DB 4P16A 3DBRI 4W9CA 3VUWA 1FRDA 1WXSA 5HKHA 3PRPB 2PVOD 2O6VB 2OJWA 1OFFA 4C4VB 1FIQA 3RNAC 4ZHPA 2AQ1B 3AE1B 3X23A 1N5WA 3OJ4B 1VR9A 4R3DA 1EWYC 2WXKA 1VZ6A 1YD8U 2PEAA 2N1VA 3R8BA 2DYOA 2ZNVC 2BWFA 2FUHB 5DPSA 2LMCA 4NNJB 3QC8B 5L83A 3TIXA 2KDEB 4ANXA 3H7PA 1E10A 2C7MB 1Y56A 3X0WA 2KMCA 1CQVA 1CMXB 3WA0A 1SGHA 3NJTA 2HTHA 2L52A 4E74A 5JHBA 4N6EB 2DYMA 2REXA 2J52A 1L0XB 1DOXA 1N63A 4IWQA 2LGIA 4EFOA 1WX8A 5HG2A 2JYTA 2ZEQA 4RGOS 3Q3NC 2WLBA 2M4NA 4HJKA 4BKTA 4II3B 2IGGA 4A55A 3QQ8B 2M19A 3SU8X 3MC8A 3W5VB 3IAM1 1HA5A 1EU3A 1NYRA 4G0NB 2L1AA 3DBSA 1T0YA 2C9WB 3AE2B 4OZCA 1OGWA 5CTRC 1FXAA 4MH0E 2K1FA 3JSVB 4HJGE 2OEDA 4KIKA 2D10A 2KWDA 2L0FA 2V3NA 4PS8A 4RCOA 2ZNVB 2EKIA 3NS8A 1PFDA 3OAWA 2LFIA 5G55A 4YWGG 2UWQA 2DNFA 3N32A 2L00B 3TSSA 3N30A 2L7RA 3IVFA 5BO4B 2WXJA 3FAHA 1YJJA 2LHEA 4WWPA 4JIOU 2GBNA 1R7SA 3GZNB 1K8RB 2R2QA 4NY0A 3UIPB 1V5TA 2J4XA 2M0AA 1JQ4A 4ANVA 1UELA 3HM3A 1IPGA 2NPTA 2JVCA 3DBRB 2QC8A 2N7EA 3L0WB 1D6EC 2UU7A 5LNK1 2W3RA 3DOWA 4P1CC 2GI9A 4LNIA 4XZ4A 5GXGB 5LXHA 2N9PC 2AYOB 2C60A 3RN9C 4W9KA 4B0EA 2KQSA 3SR6A 3ZDMC 1C4PA 2LD9A 3H8HA 3R2IA 1WSPA 1YIWA 5LLIA 3Q14C 3NS1A 4DDGD 3N1ZC 2D07B 2KWUB 4WQMA 2NBWB 1ZP0B 4MM3B 5AEKB 1L2NA 4WAFA 3HVDA 3PZ7A 2GBMA 2G45B 4PS7A 3ZDTA 1PUTA 1A5RA 3HHMA 4LNKA 1D5XC 2KJ6A 3AV8A 1IUEA 1J7CA 4OVUA 5FKAC 4XGAB 2KWVB 4OZBA 3B9JA 1FNUA 2I38A 3AECB 2O2VA 3RFZB 4A9AA 1WXQA 3ZQ4A 4ZRKA 2QEJC 1E8WA 1WXVA 3ZNGC 3T3OA 5D3DA 4IWPA 1CZPA 1FFVA 2J42A 3OJ3A 2N9KA 4YSXB 3TEXA 2Y3AA 2W9NA 1T0QC 1TS4A 4ICUA 3DBHI 3BY4B 1ET9A 5TSSA 2WDTB 2KN4A 2MP2A 1ZW7A 4YSZB 4MGKE 2KVZA 4BAXA 1QOAA 2DZJA 3QAQA 3OG5A 1D5MC 1UUPA 2ZW1A 3N9YC 4I6NB 3C8YA 4GGQA 2KX0A 4MSQB 4L23A 1P9DU 2MA9B 5FK9C 4AJYB 3NOBA 3ZJTA 2C5LC 3H7PB 3RPFC 3M63B 1XCTL 5FR6A 4ICVA 4A20A 1UGJA 1Z5SB 2GBJA 4CYEA 4OW0A 2INCC 3GB1A 1TKGA 4WH4A 4DK5A 4TV3A 2FIFA 1UH6A 5C23A 1C9FA 1BXTA 1AYFA 2N0SB 1WI0A 2MJDA 4W9DA 2KOXA 2D3AA 3MC9A 4YL8A 5TR5A 2JX5A 2MBEA 1WM2A 4FBJB 3AULA 2E3TA 3NRZA 2KFKA 2NVUI 3A1QA 1V1OA 2MBHA 3VVWB 2ZPYA 1Q10A 2RDBC 3FILA 3ZRCA 3ZGZA 3RULA 5IP4D 2ONQA 1SJHD 3A9JA 3QA8A 4ACFA 1LO5D 1C76A 1KTKA 2I2YA 2M17A 1GOZA 2GBRA 4PYUA 2ZVOA 3AE3B 3PLUA 3MHZA 4HLEA 2CU1A 2IZVB 5L95C 2WXFA 2K39A 3MJ5A 2WS3B 4D2KA 4HKQA 1OQRA 2J0JA 2L76A 4BOZB 2MEKA 2JRIB 2K0PA 4HKZE 4GMVA 2MH7A 2KN5A 3ZTCA 4JL9A 3DHIC 2WDQB 1TS5A 3N3KB 1F52A 3P4SB 1GB1A 5IKCM 2NPTB 1V86A 2Z0EB 2JYEA 1GPXA 1QKZA 3DBHB 2PE6B 4W9EA 4WJQA 2DHZA 5GMVA 4HDOA 5AZFA 2MX2A 1JCKB 3AE5B 3R3MA 1L0VB 2J53A 2JQRB 3AH7A 3ETRA 2N9XA 4MSMB 5G5HA 1BT0A 3KYCD 3T8MA 3JYUA 3RT3B 1HTOA 4MH8A 1AN8A 3BYYB 2X8XX 1UF0A 2DZIA 2BS3B 3AE8B 2WXOA 2N9LA 1VJKA 1QOFA 1VDVA 2BB5A 2INPE 4TSSA 5AUIA 5BMGA 2KDMA 4K81A 3ENEA 1SSNA 3TL5A 3AN1A 1U4AA 4US9A 2XEWA 1Q0WB 3AMZA 3AEBB 3RUIB 3VHTC 3P4RB 3U4EG 1SF0A 3SDLC 4XX5A 2NTTA 2WU5B 1XT9B 1E8XA 3DVNU 4OZAA 1FCCC 2EKEC 2VRRB 4WWOA 2DZMA 2SEBD 2G4SA 2BTEA 4ASWC 1Q5WB 3ECIA 1HZ5A 4G50A 2MP2B 3SHQA 1A70A 1YQBA 2HJ8A 1V5OA 1NI3A 2DAJA 1XO3A 4F7ZA 2AEHA 4BKSA 4O1NA 2KMMA 1E7UA 5IO9A 1TZ1A 3P4PB 3E56A 2W55A 1IP9A 1J7AA 2XNAC 1LXDA 1LFDA 4C56C 4LLGM 3Q8FA 2IJ0A 2Z8LA 4QAYA 3A33B 3CF6E 2FUG1 4GU2A 4RMAA 3PVLA 5J2RA 1C1YB 1C77A 2W82A 4LNNA 1TS2A 2QDFA 5G5GA 1E7VA 3IT6B 2QIEB 2LHDA 4NPNA 3IAS1 3CSTA 4GOCA 2D3CA 4M02A 1GJZA 1N61A 2KVRA 3V05A 3B1LX 3QJZA 3EA6A 2WXNA 4ANWA 3OLMD 1H4RA 5AUKA 2INDC 3VXWA 2K5PA 3CMMB 4WWMA 1YN4A 2BWES 2DAFA 2QHOA 1HE8A 2HTME 5AZGA 3RNGC 1MI0A 1I4RA 4RGNA 3GP7A 2PVGC 1IYFA 4AP4C 2H89B 2PE9A 4OVZA 3A4RA 1P3QU 4ZYSA 3FILB 1UWXA 2KXJA 1PQSA 1K50A 2KTRA 2N4FA 3ZTDA 4BVUC 1K52A 1IGDA 2W3SA 2QILA 4W9LA 1T5XD 2K3UA 2FE8A 3TEYA 3DPDA 5D94A 1E90A 1V97A 3UINB 2H88B 1FO4A 5KHOA 2MBOA 3DVGX 2MLBA 1YN3A 2K8BA 2V4IB 3SFEB 3PRZA 3HM6X 4FULA 5EE0A 5EE9A 4ZRQA 2IBIB 2FNJB 3RYTA 2W54A 2JXXA 4XWTA 4M0WA 3DCGA 2LGXA 1EUVB 3TJPA 3RNFC 2B76B 3QK0A 2PW9A 1JWSD 3LDZE 3WAPA 3MHSD 5C1ZA 3NZSA 2C7NB 1YNTE 1I4HA 1WGGA 2AL6A 2QMTA 2CHWA 4AQ7A 4RFBA 5IN7A 3MP9A 1JMLA 1SE4A 1WZ0A 2KJHB 3V3XA 2ZW0A 1WE6A 2IY1B 5IA7A 2L32A 2GMIC 1ESFA 1P1AA 2L3ZA 5IAAC 4PS3A 2LVQA 1N60A 3U30A 3PZ8A 3L17A 1V9JA 3VTWA 3ML9A 2L05A 2IO2B 4MELA 4IM3A 4L1BA 1WXAA 3PO0A 4MGYE 1WH3A 3WIMA 4NJCA 2PIAA 1XLPA 3ZLZA 2AQ2B 3MTNB 1KJTA 3UQAA 1SEBD 2WGSA 3R2TA 3ML8A 1E8ZA 3RNCC 3ABVB 4BFRA 3ALBA 3P42A 3HIZA 2I1JA 3AEFB 4XC2A 3MFGA 1VLBA 4PT5A
chains in the Genus database with same CATH topology
2CKHB 1UGMA 4AJYB 3NOBA 3A9JB 1J0GA 3Q3FA 1L7YA 3H6NA 1OTRB 2C5LC 3H7PB 3M63B 5FR6A 3TMPB 2KO3A 4ICVA 4W9FA 1S1QB 4BBNC 3TCAA 1GG3A 2Z0DB 4A20A 1GC6A 1WJUA 1Z5SB 1X1MA 2KHWB 1I42A 3M95A 2GBJA 4LCDE 4J6IA 4NJ6A 4AUQC 4CYEA 1Q1OA 2LUEA 2J7QB 1WXMA 4K1RB 4WAAA 4I6LB 3VAWA 4DK5A 4TV3A 3L54A 2FIFA 2MCNB 1UH6A 1MG8A 5C23A 3NY5A 2KLCA 4WWNA 5DCNA 1WI0A 5JH5C 3A9KB 2FAZA 4W9DA 5CHVC 4DHJB 2KOXA 1WX7A 2BPSA 1E5WA 4FJYA 4IM0A 3ZW3A 2N7DA 3L13A 2KD0A 2MBBB 1XD3B 4YL8A 5TR5A 3V62A 2IYDB 2GOWA 1WM2A 2MBEA 4HCPB 3PRMB 2WYQA 3PSEB 3PLVA 3QWZB 4FBJB 3B0AA 3AULA 3H7SA 4EUTA 2CHZA 5J17A 1RFAA 1WY8A 1WGRA 2LI5A 2YLMA 2KFKA 1LQBA 2NVUI 3A1QA 4AOFA 1XQQA 1WM3A 3AU5A 2KDBA 2MBHA 2KDIA 3EFUA 3VVWB 2ZPYA 5KHQA 2IO0B 3DVGY 4ZYNA 2BYEA 3ZRCA 3APFA 4TQ1A 5CHFA 3RULA 3PTFC 3VQIA 2AL3A 1GNUA 2HE7A 3A9JA 2IO1B 1Y8RC 2PJHA 2UYZB 3QA8A 1TBEA 2K8HA 3K9OB 3QHTA 5E6PA 2JWZA 1RAXA 4DDID 1NBFC 2M1MA 2M17A 1YX5B 3HK0A 2GBRA 3KUZA 1EF5A 4PYUA 2ZVOA 4URKA 2IY0B 3PLUA 2DYBA 4F1SA 1J19A 4MJSB 4HLEA 5DPTA 2Y5BB 2CU1A 2IZVB 4HDQA 4KSLC 3R7QA 5L95C 2D11A 4P7IA 2PPHA 2D2QA 3KUDB 2K39A 5CHWA 3D32A 2ZPNA 2KANA 3JW0X 4LJPB 4HPLB 1R4NI 2J0KA 2DZKA 2NS5A 2J0JA 1WGDA 2KC2A 3L16A 2L8JA 2L76A 2A4ZA 2ZVNA 3APDA 1S3SG 5G2NA 1WR6E 1WMHB 2LXCA 1YJ1A 4BOZB 4DBGA 3V6CB 3VUXA 3V6EB 2JRIB 5E6NA 2WX1A 5DPWA 4X57B 4KVGB 2LVOA 3PZDA 2XK5B 4GMVA 3QIJA 1JRUA 1V6EA 3SD5A 2KN5A 3W1SC 2KTRB 3ZTCA 4JL9A 4M8MA 4HPMB 2LVPA 3ONSA 3B08A 3KVFB 3H9DA 3QCAA 4OVVA 4GDLB 1P0RA 2JZZA 3N3KB 4N9F4 3U7DA 3RD2A 2MWSB 2K6QA 4A3PA 1WGHA 4KZCA 2NPTB 3IG3A 1V86A 2HD5B 2Z0EB 4IG7B 4IWOA 3H1UA 2LASA 2KDFB 2C7HA 2RGFA 2PE6B 1ZKHA 2KNBA 4W9EA 3T9LA 4WJQA 2DHZA 3PT2B 4WJNA 5GMVA 2JPHA 4HDOA 3AU4A 4TKNA 5AZFA 2MX2A 4MGZE 4AWJA 4F8CB 2A5UA 2JZ3B 3R3MA 4HCNB 3UQBA 4BOSC 2BKRB 1YX6B 1WF9A 2JUOA 1C3TA 2N9XA 3APCA 2XBBC 3PGEA 3DDCB 4WJOA 3GZNI 4MSMB 1BT0A 2NBVB 3KYCD 2KQ7A 4NAWB 4FJVB 3T8MA 3JYUA 3AI5A 3VUYA 3RT3B 1EF1A 2MW5A 1RRBA 4CO7A 1UBQA 2CHXA 2IO3B 2KLGA 4BKGA 4M0WB 2DZIA 3DQVA 2D3GA 2LRUA 2DX5B 2Z59B 2FCNA 4IW0A 1EO6A 2LWPA 2K6DB 3RCZA 3DBRI 4W9CA 3IHPC 3VUWA 3W1YA 2K8CA 2GBKA 1WXSA 5HKHA 3PRPB 4E3CA 4HXDA 4HVBA 2O6VB 4K81A 3ENEA 3V60A 2K25A 4FHKA 3TL5A 4W9HA 1U4AA 4EZLA 3AXCA 2XEWA 4LJOB 1Q0WB 3X23A 1SIFA 4GDKA 5JHAA 3OJ4B 1WGYA 3RUIB 3VHTC 2G4DB 3MJWA 1YD8U 3SDLC 4XX5A 4RM9A 2PEAA 2N1VA 4IC7B 1XT9B 1E8XA 2DYOA 1F9JA 2ZNVC 4ZRIA 3DVNU 2BYVE 2EKEC 1V2YA 2BWFA 2VRRB 2FUHB 1UD7A 5DPSA 4WWOA 4FADA 2DZMA 2B3AA 2OJRA 2ASQA 4MDKE 2G4SA 4NNJB 3S2AA 1Z2MA 4W9JA 2YVCA 4ASWC 3KUCB 3QC8B 4E71A 5L83A 3TIXA 1Q5WB 2KDEB 3O65B 3H7PA 3ECIA 2C7MB 2KJRA 4ANXA 3QX1A 3X0WA 2KMCA 2MRPA 4G50A 1FXTB 1CMXB 2MP2B 3P2BA 1YQBA 4KIKB 3SHQA 4EKUA 2HJ8A 1V5OA 2DAJA 2WWZA 3WA0A 4F7ZA 1SGHA 2RR9A 2AEHA 4BKSA 2G3QB 1E7UA 2JRHA 1QZEA 3KH0A 3WANA 1TZ1A 2HTHA 2N9EB 1ISNA 4E74A 1IP9A 5JHBA 1D3ZA 3A9KA 1ZGUB 2DYMA 1LXDA 2REXA 2EMSA 1WFYA 1LFDA 4NJ7A 4IWQA 1WRDB 4GIVA 1WX8A 1RLFA 4EFOA 1WR1A 4G3XB 2FCQA 4KDIC 3L10B 3TBLD 2NBUA 2ZEQA 3UF8A 3A33B 1G6JA 3CF6E 4KV2A 4W9GA 2M4NA 2LGDA 4GU2A 1UBIA 2MQJA 3PVLA 4HJKA 1C1YB 4RMAA 4BKTA 2M0XA 4II3B 5J2RA 3VDZA 2KTFA 3QQ8B 5DPRA 1E7VA 4NPNA 3SU8X 4GOCA 3CSTA 4FHJA 4G0NB 5E6OA 3DBSA 4B6WA 5J18A 1GJZA 2ZJDA 1T0YA 2KVRA 5D7GA 3ZKJC 3B1LX 3QJZA 2C9WB 2LXAA 4JLCA 3IFWB 1OGWA 1NI2A 5CTRC 4MH0E 2K1FA 4ANWA 3JSVB 3OLMD 1H4RA 4FN2A 4NQKE 2RSUA 3R66C 4KSKC 4EZJA 3WALA 3VXWA 4KIKA 2D10A 2L0FA 3CMMB 2M8SA 3PPAA 4PS8A 2BWES 2DAFA 2QHOA 1R4MI 4MJSA 2ZNVB 3ZRFA 3VFKA 2MSED 1HE8A 3NS8A 4MEMA 4LDTD 3OAWA 5AZGA 2FCMA 5G55A 3DVNV 2OOBB 1M94A 1V80A 4M8NA 2UWQA 3ZUNA 1OEYJ 3N32A 2BKFA 2L00B 4K7UA 4WJPA 3N30A 4IM2A 3VTVA 3ZNID 1IYFA 1WMHA 1I35A 2KFJA 2L7RA 4AP4C 3C0RB 3IVFA 4B9KA 4DHJD 2PE9A 5BO4B 3A4RA 1P3QU 4WWPA 4JQWC 4JIOU 3EECA 2GBNA 2KXJA 2XK5A 1PQSA 4II2B 1OEYA 2KTRA 2N4FA 1J8CA 3ZTDA 4BVUC 1TTNA 3VH3B 1K8RB 2KWCA 2R2QA 1GC7A 4NY0A 2DENB 2KZRA 3UIPB 4GDLA 1V5TA 3BINA 2I1KA 1WJ6A 4W9LA 2FCSA 4ANVA 1UELA 3HM3A 1IPGA 1NDDA 2NPTA 3GOEA 2JVCA 2RPQA 5D6JB 3DPDA 3Q3JA 5D94A 1E90A 4EZKA 3UINB 4LDTB 2N7EA 3L0WB 2O2VB 2EMTA 1KOTA 4GN1A 2KK8A 5KHOA 2MBOA 4G11A 3DOWA 2WX0A 2KKCA 3DVGX 3JSVA 2MLBA 2NR2A 4FLHA 3EC8A 4XZ4A 2K8BA 3CSFA 1KLVA 2BYFA 1WJNA 4K7WA 5LXHA 2N9PC 2AYOB 2C60A 3PRZA 4W9KA 1VD2A 2KQSA 2ZCCA 4DHZE 3ZDMC 2CS4A 3EHVA 3HM6X 4FULA 4GSWA 2V4LA 1H8CA 2KX3A 2LD9A 4ZRJA 5D2MB 2ZZPB 4K7SA 4TUUA 1YIWA 5LLIA 4TQ0A 2IBIB 3PHWB 3ZIMA 1WZ3A 4DDGD 1V81A 4NAWA 2FNJB 2D07B 2KWUB 3ZVVA 3I3TB 2AWTA 2V3SA 3KW5B 3RYTA 4I6PA 3QARA 2JXXA 3IBEA 2NBWB 1LM8B 3RZFA 4RM8A 5AEKB 1L2NA 3U8ZA 1E8YA 2L0TA 4W9IA 3JVZX 5LXIB 3UGBB 3V61A 3DCGA 2LGXA 1EUVB 2GBMA 1V49A 3TJPA 2G45B 4BBNF 4PS7A 3ZDTA 3PS6A 2KMAA 3QK0A 1A5RA 3WAPA 3LDZE 3HHMA 3MHSD 1OQYA 3NZSA 5C1ZA 2KJ6A 4OVUA 2C7NB 2ZCBA 3M62B 2O6VA 4CHKA 1WGGA 3PHXB 4HWIB 2AL6A 2V1YA 2CHWA 3NZUA 4GB9A 3ZO5B 1WZ0A 4A3OA 5EDSA 2KWVB 2KC1A 3A4SC 2KJHB 5AZHA 4JGHB 1WE6A 4NQLB 2NCNA 2RD0A 2LJ5A 2O2VA 2IY1B 5IA7A 4KZ0A 4ANUA 2GMIC 1P1AA 2L3ZA 3W1SA 2JT4B 2JY6A 5IAAC 4ZRKA 2JF5A 2LVQA 4PS3A 2MBQA 1E8WA 1WXVA 2LZ6A 2LGYA 4FJZA 3U30A 3ZNGC 3L17A 1V9JA 3M3JA 4HK2A 3WAMA 3VTWA 4IWPA 1WX9A 2L05A 3K9PB 3ML9A 3OJ3A 3RZWC 2IO2B 4MELA 4IM3A 4MGYE 1WXAA 1WJ4A 5JZEB 1WH3A 3WIMA 2FIDA 2W9NA 3UIOB 4EEWA 4ICUA 1UZXB 3DBHI 3ZNZB 3VH4B 3BY4B 4DHZB 2WDTB 4AJWA 4WQOB 3ZLZA 4ZDVA 3WAOA 3KYDD 4MM3A 3LJ3A 2MP2A 3PV1A 1ZW7A 4FA6A 4DXAB 2BF8B 3L08A 3MTNB 1VCBA 2CR5A 3NHEB 4MGKE 1KJTA 5CX3A 3UQAA 1WYWB 3DBLI 3VTUA 1WE7A 3ML8A 1E8ZA 2N1WA 4MGIE 4BKSD 2DZJA 4GDKB 4DWFA 4BFRA 1GUAB 1SE9A 3QAQA 2BGFA 2R2OA 4GXBA 3ALBA 3PREA 1P98A 4IUMB 4I6NB 4KDLB 2O6VD 3R7RA 3HIZA 1AARA 2J0MA 4GGQA 2I1JA 2KFKB 2KX0A 4PYZA 3A1QB 3ZNHB 4EOYA 1TGZB 1WIAA 4MSQB 4XC2A 1KM7A 1P9DU 2LRWA 2MA9B 4B95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKH B;  1UGM A;  4AJY B;  3NOB A;  3A9J B;  1J0G A;  3Q3F A;  1L7Y A;  3H6N A;  1OTR B;  2C5L C;  3H7P B;  3M63 B;  5FR6 A;  3TMP B;  2KO3 A;  4ICV A;  4W9F A;  1S1Q B;  4BBN C;  3TCA A;  1GG3 A;  2Z0D B;  4A20 A;  1GC6 A;  1WJU A;  1Z5S B;  1X1M A;  2KHW B;  1I42 A;  3M95 A;  2GBJ A;  4LCD E;  4J6I A;  4NJ6 A;  4AUQ C;  4CYE A;  1Q1O A;  2LUE A;  2J7Q B;  1WXM A;  4K1R B;  4WAA A;  4I6L B;  3VAW A;  4DK5 A;  4TV3 A;  3L54 A;  2FIF A;  2MCN B;  1UH6 A;  1MG8 A;  5C23 A;  3NY5 A;  2KLC A;  4WWN A;  5DCN A;  1WI0 A;  5JH5 C;  3A9K B;  2FAZ A;  4W9D A;  5CHV C;  4DHJ B;  2KOX A;  1WX7 A;  2BPS A;  1E5W A;  4FJY A;  4IM0 A;  3ZW3 A;  2N7D A;  3L13 A;  2KD0 A;  2MBB B;  1XD3 B;  4YL8 A;  5TR5 A;  3V62 A;  2IYD B;  2GOW A;  1WM2 A;  2MBE A;  4HCP B;  3PRM B;  2WYQ A;  3PSE B;  3PLV A;  3QWZ B;  4FBJ B;  3B0A A;  3AUL A;  3H7S A;  4EUT A;  2CHZ A;  5J17 A;  1RFA A;  1WY8 A;  1WGR A;  2LI5 A;  2YLM A;  2KFK A;  1LQB A;  2NVU I;  3A1Q A;  4AOF A;  1XQQ A;  1WM3 A;  3AU5 A;  2KDB A;  2MBH A;  2KDI A;  3EFU A;  3VVW B;  2ZPY A;  5KHQ A;  2IO0 B;  3DVG Y;  4ZYN A;  2BYE A;  3ZRC A;  3APF A;  4TQ1 A;  5CHF A;  3RUL A;  3PTF C;  3VQI A;  2AL3 A;  1GNU A;  2HE7 A;  3A9J A;  2IO1 B;  1Y8R C;  2PJH A;  2UYZ B;  3QA8 A;  1TBE A;  2K8H A;  3K9O B;  3QHT A;  5E6P A;  2JWZ A;  1RAX A;  4DDI D;  1NBF C;  2M1M A;  2M17 A;  1YX5 B;  3HK0 A;  2GBR A;  3KUZ A;  1EF5 A;  4PYU A;  2ZVO A;  4URK A;  2IY0 B;  3PLU A;  2DYB A;  4F1S A;  1J19 A;  4MJS B;  4HLE A;  5DPT A;  2Y5B B;  2CU1 A;  2IZV B;  4HDQ A;  4KSL C;  3R7Q A;  5L95 C;  2D11 A;  4P7I A;  2PPH A;  2D2Q A;  3KUD B;  2K39 A;  5CHW A;  3D32 A;  2ZPN A;  2KAN A;  3JW0 X;  4LJP B;  4HPL B;  1R4N I;  2J0K A;  2DZK A;  2NS5 A;  2J0J A;  1WGD A;  2KC2 A;  3L16 A;  2L8J A;  2L76 A;  2A4Z A;  2ZVN A;  3APD A;  1S3S G;  5G2N A;  1WR6 E;  1WMH B;  2LXC A;  1YJ1 A;  4BOZ B;  4DBG A;  3V6C B;  3VUX A;  3V6E B;  2JRI B;  5E6N A;  2WX1 A;  5DPW A;  4X57 B;  4KVG B;  2LVO A;  3PZD A;  2XK5 B;  4GMV A;  3QIJ A;  1JRU A;  1V6E A;  3SD5 A;  2KN5 A;  3W1S C;  2KTR B;  3ZTC A;  4JL9 A;  4M8M A;  4HPM B;  2LVP A;  3ONS A;  3B08 A;  3KVF B;  3H9D A;  3QCA A;  4OVV A;  4GDL B;  1P0R A;  2JZZ A;  3N3K B;  4N9F 4;  3U7D A;  3RD2 A;  2MWS B;  2K6Q A;  4A3P A;  1WGH A;  4KZC A;  2NPT B;  3IG3 A;  1V86 A;  2HD5 B;  2Z0E B;  4IG7 B;  4IWO A;  3H1U A;  2LAS A;  2KDF B;  2C7H A;  2RGF A;  2PE6 B;  1ZKH A;  2KNB A;  4W9E A;  3T9L A;  4WJQ A;  2DHZ A;  3PT2 B;  4WJN A;  5GMV A;  2JPH A;  4HDO A;  3AU4 A;  4TKN A;  5AZF A;  2MX2 A;  4MGZ E;  4AWJ A;  4F8C B;  2A5U A;  2JZ3 B;  3R3M A;  4HCN B;  3UQB A;  4BOS C;  2BKR B;  1YX6 B;  1WF9 A;  2JUO A;  1C3T A;  2N9X A;  3APC A;  2XBB C;  3PGE A;  3DDC B;  4WJO A;  3GZN I;  4MSM B;  1BT0 A;  2NBV B;  3KYC D;  2KQ7 A;  4NAW B;  4FJV B;  3T8M A;  3JYU A;  3AI5 A;  3VUY A;  3RT3 B;  1EF1 A;  2MW5 A;  1RRB A;  4CO7 A;  1UBQ A;  2CHX A;  2IO3 B;  2KLG A;  4BKG A;  4M0W B;  2DZI A;  3DQV A;  2D3G A;  2LRU A;  2DX5 B;  2Z59 B;  2FCN A;  4IW0 A;  1EO6 A;  2LWP A;  2K6D B;  3RCZ A;  3DBR I;  4W9C A;  3IHP C;  3VUW A;  3W1Y A;  2K8C A;  2GBK A;  1WXS A;  5HKH A;  3PRP B;  4E3C A;  4HXD A;  4HVB A;  2O6V B;  4K81 A;  3ENE A;  3V60 A;  2K25 A;  4FHK A;  3TL5 A;  4W9H A;  1U4A A;  4EZL A;  3AXC A;  2XEW A;  4LJO B;  1Q0W B;  3X23 A;  1SIF A;  4GDK A;  5JHA A;  3OJ4 B;  1WGY A;  3RUI B;  3VHT C;  2G4D B;  3MJW A;  1YD8 U;  3SDL C;  4XX5 A;  4RM9 A;  2PEA A;  2N1V A;  4IC7 B;  1XT9 B;  1E8X A;  2DYO A;  1F9J A;  2ZNV C;  4ZRI A;  3DVN U;  2BYV E;  2EKE C;  1V2Y A;  2BWF A;  2VRR B;  2FUH B;  1UD7 A;  5DPS A;  4WWO A;  4FAD A;  2DZM A;  2B3A A;  2OJR A;  2ASQ A;  4MDK E;  2G4S A;  4NNJ B;  3S2A A;  1Z2M A;  4W9J A;  2YVC A;  4ASW C;  3KUC B;  3QC8 B;  4E71 A;  5L83 A;  3TIX A;  1Q5W B;  2KDE B;  3O65 B;  3H7P A;  3ECI A;  2C7M B;  2KJR A;  4ANX A;  3QX1 A;  3X0W A;  2KMC A;  2MRP A;  4G50 A;  1FXT B;  1CMX B;  2MP2 B;  3P2B A;  1YQB A;  4KIK B;  3SHQ A;  4EKU A;  2HJ8 A;  1V5O A;  2DAJ A;  2WWZ A;  3WA0 A;  4F7Z A;  1SGH A;  2RR9 A;  2AEH A;  4BKS A;  2G3Q B;  1E7U A;  2JRH A;  1QZE A;  3KH0 A;  3WAN A;  1TZ1 A;  2HTH A;  2N9E B;  1ISN A;  4E74 A;  1IP9 A;  5JHB A;  1D3Z A;  3A9K A;  1ZGU B;  2DYM A;  1LXD A;  2REX A;  2EMS A;  1WFY A;  1LFD A;  4NJ7 A;  4IWQ A;  1WRD B;  4GIV A;  1WX8 A;  1RLF A;  4EFO A;  1WR1 A;  4G3X B;  2FCQ A;  4KDI C;  3L10 B;  3TBL D;  2NBU A;  2ZEQ A;  3UF8 A;  3A33 B;  1G6J A;  3CF6 E;  4KV2 A;  4W9G A;  2M4N A;  2LGD A;  4GU2 A;  1UBI A;  2MQJ A;  3PVL A;  4HJK A;  1C1Y B;  4RMA A;  4BKT A;  2M0X A;  4II3 B;  5J2R A;  3VDZ A;  2KTF A;  3QQ8 B;  5DPR A;  1E7V A;  4NPN A;  3SU8 X;  4GOC A;  3CST A;  4FHJ A;  4G0N B;  5E6O A;  3DBS A;  4B6W A;  5J18 A;  1GJZ A;  2ZJD A;  1T0Y A;  2KVR A;  5D7G A;  3ZKJ C;  3B1L X;  3QJZ A;  2C9W B;  2LXA A;  4JLC A;  3IFW B;  1OGW A;  1NI2 A;  5CTR C;  4MH0 E;  2K1F A;  4ANW A;  3JSV B;  3OLM D;  1H4R A;  4FN2 A;  4NQK E;  2RSU A;  3R66 C;  4KSK C;  4EZJ A;  3WAL A;  3VXW A;  4KIK A;  2D10 A;  2L0F A;  3CMM B;  2M8S A;  3PPA A;  4PS8 A;  2BWE S;  2DAF A;  2QHO A;  1R4M I;  4MJS A;  2ZNV B;  3ZRF A;  3VFK A;  2MSE D;  1HE8 A;  3NS8 A;  4MEM A;  4LDT D;  3OAW A;  5AZG A;  2FCM A;  5G55 A;  3DVN V;  2OOB B;  1M94 A;  1V80 A;  4M8N A;  2UWQ A;  3ZUN A;  1OEY J;  3N32 A;  2BKF A;  2L00 B;  4K7U A;  4WJP A;  3N30 A;  4IM2 A;  3VTV A;  3ZNI D;  1IYF A;  1WMH A;  1I35 A;  2KFJ A;  2L7R A;  4AP4 C;  3C0R B;  3IVF A;  4B9K A;  4DHJ D;  2PE9 A;  5BO4 B;  3A4R A;  1P3Q U;  4WWP A;  4JQW C;  4JIO U;  3EEC A;  2GBN A;  2KXJ A;  2XK5 A;  1PQS A;  4II2 B;  1OEY A;  2KTR A;  2N4F A;  1J8C A;  3ZTD A;  4BVU C;  1TTN A;  3VH3 B;  1K8R B;  2KWC A;  2R2Q A;  1GC7 A;  4NY0 A;  2DEN B;  2KZR A;  3UIP B;  4GDL A;  1V5T A;  3BIN A;  2I1K A;  1WJ6 A;  4W9L A;  2FCS A;  4ANV A;  1UEL A;  3HM3 A;  1IPG A;  1NDD A;  2NPT A;  3GOE A;  2JVC A;  2RPQ A;  5D6J B;  3DPD A;  3Q3J A;  5D94 A;  1E90 A;  4EZK A;  3UIN B;  4LDT B;  2N7E A;  3L0W B;  2O2V B;  2EMT A;  1KOT A;  4GN1 A;  2KK8 A;  5KHO A;  2MBO A;  4G11 A;  3DOW A;  2WX0 A;  2KKC A;  3DVG X;  3JSV A;  2MLB A;  2NR2 A;  4FLH A;  3EC8 A;  4XZ4 A;  2K8B A;  3CSF A;  1KLV A;  2BYF A;  1WJN A;  4K7W A;  5LXH A;  2N9P C;  2AYO B;  2C60 A;  3PRZ A;  4W9K A;  1VD2 A;  2KQS A;  2ZCC A;  4DHZ E;  3ZDM C;  2CS4 A;  3EHV A;  3HM6 X;  4FUL A;  4GSW A;  2V4L A;  1H8C A;  2KX3 A;  2LD9 A;  4ZRJ A;  5D2M B;  2ZZP B;  4K7S A;  4TUU A;  1YIW A;  5LLI A;  4TQ0 A;  2IBI B;  3PHW B;  3ZIM A;  1WZ3 A;  4DDG D;  1V81 A;  4NAW A;  2FNJ B;  2D07 B;  2KWU B;  3ZVV A;  3I3T B;  2AWT A;  2V3S A;  3KW5 B;  3RYT A;  4I6P A;  3QAR A;  2JXX A;  3IBE A;  2NBW B;  1LM8 B;  3RZF A;  4RM8 A;  5AEK B;  1L2N A;  3U8Z A;  1E8Y A;  2L0T A;  4W9I A;  3JVZ X;  5LXI B;  3UGB B;  3V61 A;  3DCG A;  2LGX A;  1EUV B;  2GBM A;  1V49 A;  3TJP A;  2G45 B;  4BBN F;  4PS7 A;  3ZDT A;  3PS6 A;  2KMA A;  3QK0 A;  1A5R A;  3WAP A;  3LDZ E;  3HHM A;  3MHS D;  1OQY A;  3NZS A;  5C1Z A;  2KJ6 A;  4OVU A;  2C7N B;  2ZCB A;  3M62 B;  2O6V A;  4CHK A;  1WGG A;  3PHX B;  4HWI B;  2AL6 A;  2V1Y A;  2CHW A;  3NZU A;  4GB9 A;  3ZO5 B;  1WZ0 A;  4A3O A;  5EDS A;  2KWV B;  2KC1 A;  3A4S C;  2KJH B;  5AZH A;  4JGH B;  1WE6 A;  4NQL B;  2NCN A;  2RD0 A;  2LJ5 A;  2O2V A;  2IY1 B;  5IA7 A;  4KZ0 A;  4ANU A;  2GMI C;  1P1A A;  2L3Z A;  3W1S A;  2JT4 B;  2JY6 A;  5IAA C;  4ZRK A;  2JF5 A;  2LVQ A;  4PS3 A;  2MBQ A;  1E8W A;  1WXV A;  2LZ6 A;  2LGY A;  4FJZ A;  3U30 A;  3ZNG C;  3L17 A;  1V9J A;  3M3J A;  4HK2 A;  3WAM A;  3VTW A;  4IWP A;  1WX9 A;  2L05 A;  3K9P B;  3ML9 A;  3OJ3 A;  3RZW C;  2IO2 B;  4MEL A;  4IM3 A;  4MGY E;  1WXA A;  1WJ4 A;  5JZE B;  1WH3 A;  3WIM A;  2FID A;  2W9N A;  3UIO B;  4EEW A;  4ICU A;  1UZX B;  3DBH I;  3ZNZ B;  3VH4 B;  3BY4 B;  4DHZ B;  2WDT B;  4AJW A;  4WQO B;  3ZLZ A;  4ZDV A;  3WAO A;  3KYD D;  4MM3 A;  3LJ3 A;  2MP2 A;  3PV1 A;  1ZW7 A;  4FA6 A;  4DXA B;  2BF8 B;  3L08 A;  3MTN B;  1VCB A;  2CR5 A;  3NHE B;  4MGK E;  1KJT A;  5CX3 A;  3UQA A;  1WYW B;  3DBL I;  3VTU A;  1WE7 A;  3ML8 A;  1E8Z A;  2N1W A;  4MGI E;  4BKS D;  2DZJ A;  4GDK B;  4DWF A;  4BFR A;  1GUA B;  1SE9 A;  3QAQ A;  2BGF A;  2R2O A;  4GXB A;  3ALB A;  3PRE A;  1P98 A;  4IUM B;  4I6N B;  4KDL B;  2O6V D;  3R7R A;  3HIZ A;  1AAR A;  2J0M A;  4GGQ A;  2I1J A;  2KFK B;  2KX0 A;  4PYZ A;  3A1Q B;  3ZNH B;  4EOY A;  1TGZ B;  1WIA A;  4MSQ B;  4XC2 A;  1KM7 A;  1P9D U;  2LRW A;  2MA9 B;  4B95 A; 
#chains in the Genus database with same CATH topology
 3U7Z A;  3Q3F A;  4JE3 B;  2VH1 A;  1OTR B;  2JU6 X;  2YEP F;  4WUR A;  4W9F A;  3IT4 B;  2Z0D B;  1WGK A;  1X1M A;  2KHW B;  4JWU C;  3M95 A;  4LCD E;  4AUQ C;  1Q1O A;  3Q8C A;  4WAA A;  1MHH E;  4I6L B;  3L54 A;  2MCN B;  2CJO A;  3VRA B;  2KLC A;  4WWN A;  1L0Y B;  1ZOY B;  1WX7 A;  2NTS A;  3ZW3 A;  2IYD B;  3IXS A;  3L4P A;  1XF5 L;  3LXF A;  3H7S A;  3BVZ A;  2CHZ A;  5JXV A;  1WGR A;  1CJE A;  2LI5 A;  4XWW A;  1LQB A;  1PYW D;  3AU5 A;  5EE1 A;  3VRB B;  2IO0 B;  2BYE A;  2RPV A;  3APF A;  4RF0 A;  3O13 A;  5CHF A;  3PTF C;  2GB1 A;  3AE6 B;  3DWG C;  2AL3 A;  1J7B A;  2IO1 B;  1Y8R C;  2JWZ A;  1RAX A;  1JRP A;  2IGH A;  1TZO A;  2DYB A;  1KF6 B;  1J19 A;  2Y5B B;  4KSL C;  2D11 A;  2D2Q A;  3GS2 A;  5CHW A;  3D32 A;  2KAN A;  4HPL B;  1PGX A;  2J0K A;  2KC2 A;  1WGD A;  1KLG D;  2A4Z A;  3ZXV A;  1BML C;  1S3S G;  3DHH C;  2G1E A;  5G2N A;  3I5J C;  1NVI D;  1SJE D;  5E6N A;  5DPW A;  4X57 B;  2LVO A;  2LUM A;  2KTR B;  4M8M A;  2LVP A;  1C4C A;  3TUO A;  3ONS A;  3B08 A;  5D3I B;  3HVZ A;  1JWA D;  2WXR A;  4A3P A;  4EE2 A;  1WGH A;  3IG3 A;  1F2R I;  4ZOH C;  1QOB A;  4IWO A;  2KDF B;  3NVV A;  1RFK A;  1YMH E;  1ZKH A;  1AWD A;  4HRO A;  1MHX A;  3AU4 A;  1JRO A;  1HEZ E;  4MGZ E;  4YTP B;  1DGJ A;  1I4P A;  4F8C B;  2JZ3 B;  4HCN B;  4M00 A;  4B0M A;  1YX6 B;  5EE3 A;  2PMV A;  2XBB C;  1ZE3 D;  3AB5 A;  3VR8 B;  4ARI A;  5C2T B;  4RGM A;  1SBB B;  2MW5 A;  2IO3 B;  4BKG A;  4M0W B;  3DQV A;  2DX5 B;  3ZJU A;  1AW7 A;  1EO6 A;  2LWP A;  3RCZ A;  1IBX A;  1ZXH A;  3IHP C;  2K8C A;  2K25 A;  3UI3 A;  4BZA A;  4W9H A;  3AXC A;  2ON8 A;  1FNV A;  1I7H A;  5JHA A;  1F77 A;  4P6V F;  1WGY A;  2YEP B;  4P1B C;  1UWM A;  1F2R C;  1XLN A;  1F9J A;  3URY A;  4ZRI A;  1WYG A;  2BYV E;  4RNA A;  1TS3 A;  3P1M A;  1UD7 A;  3BVM A;  4MDK E;  2B3A A;  3S2A A;  1V1P A;  1Z2M A;  2YVC A;  3EGR A;  1VZ8 A;  3DHG C;  3KUC B;  3TEZ A;  3O65 B;  2KJR A;  3QX1 A;  1C78 A;  2QSD A;  2MHJ A;  4C7Z A;  1SB3 C;  1B9R A;  1FXT B;  1I4G A;  4KIK B;  1QT9 A;  3B2F A;  2JRH A;  1QZE A;  4RGT A;  3KH0 A;  3WAN A;  2BBC A;  1SXT A;  2BQQ A;  1QLB B;  2N9E B;  1ISN A;  3A9K A;  1ZGU B;  1WFY A;  4ARC A;  1WRD B;  2WQY B;  4GIV A;  1WR1 A;  1I4X A;  2OHF A;  4G3X B;  2VZK D;  4KDI C;  4ITK A;  2NBU A;  2WXM A;  3UF8 A;  4KKJ A;  1XLQ A;  4KV2 A;  2LGD A;  4YXD B;  1UBI A;  2MQJ A;  2M0X A;  1ENF A;  3HRD D;  3VDZ A;  2KTF A;  2KAJ A;  4FHJ A;  5J18 A;  2V9H A;  1TY2 A;  5I4D A;  2KAC A;  5D7G A;  3ZKJ C;  4K3C A;  4JLC A;  1QQR A;  1SIJ A;  1NI2 A;  1RWS A;  4A6Q A;  4FN2 A;  4NQK E;  3R66 C;  3AEE B;  4K3B A;  3WAL A;  4KKI A;  1VRA B;  3PPA A;  3KQ4 A;  3VFK A;  4KX6 B;  2FCM A;  2RDG A;  2WNM A;  3DVN V;  2OOB B;  1M94 A;  4WIP A;  1M4V A;  1C4A A;  3KLS X;  3ZUN A;  1OEY J;  3N1Y C;  4K7U A;  4WJP A;  3ZNI D;  1I35 A;  1WMH A;  2KFJ A;  3C0R B;  1YN5 A;  3FKY A;  1DYQ A;  1FXI A;  3EEC A;  1L4Z B;  2XK5 A;  1OEY A;  3RMK C;  1TTN A;  3VH3 B;  3BII D;  3BIN A;  1MG4 A;  3DWM A;  4C80 A;  4S0R A;  1NDD A;  5D6J B;  2KQ4 X;  4EZK A;  4UDU C;  4LDT B;  2O2V B;  2EMT A;  1KOT A;  2KK8 A;  4G11 A;  2WX0 A;  2KKC A;  3JSV A;  1KLV A;  1VD2 A;  4NAM A;  2ZCC A;  2CS4 A;  2AQ3 B;  3EHV A;  3AED B;  2V4L A;  4ZRJ A;  1DOY A;  2ZZP B;  1FNW A;  2MJE A;  2JSV X;  4KGR A;  4TQ0 A;  3PHW B;  3ZIM A;  4YTM B;  3NG0 A;  4NAW A;  3ZVV A;  2AWT A;  2V3S A;  3KW5 B;  1LM8 B;  4RM8 A;  5C3J B;  3C19 A;  1E8Y A;  2L0T A;  4W9I A;  2CJN A;  3JVZ X;  4FXC A;  5LXI B;  3UGB B;  3V61 A;  3I9V 1;  3M62 B;  4CHK A;  4NZL B;  1XLO A;  1KRH A;  4S17 A;  4A3O A;  5EDS A;  3A4S C;  5AZH A;  2GRI A;  1FFU A;  1LGR A;  3LB8 C;  1K51 A;  4IOI E;  5HFY A;  1L6U A;  3LYY A;  3W1S A;  3NUH B;  2JT4 B;  3CIR B;  1VZ7 A;  2JF5 A;  2WDR B;  3AEG B;  2MBQ A;  4FJZ A;  3MC0 B;  1L4D B;  1WX9 A;  1HXY D;  3KWL A;  1WJ4 A;  2FID A;  1SE3 A;  4EEW A;  1UZX B;  3ZNZ B;  5BYQ A;  2G9H D;  4DHZ B;  4AJW A;  3Q8E A;  1E7P B;  4MM3 A;  3PV1 A;  1MJD A;  2WXI A;  4DXA B;  1DOI A;  2BF8 B;  3L08 A;  1VCB A;  3NHE B;  5CX3 A;  2VZK B;  3DBL I;  3VTU A;  4BKS D;  1GUA B;  1SE9 A;  2R2O A;  2AX5 A;  3PRE A;  1P98 A;  2QCZ A;  3T3N A;  1JWM D;  1ZUD 2;  2J0M A;  2KFK B;  4PYZ A;  3A1Q B;  4EOY A;  1TGZ B;  2ICI A;  2Y5P A;  1KM7 A;  2BS2 B;  1MPE A;  3W2D A;  2LRW A;  1YOV B;  1HQR D;  1QIL A;  1XCQ L;  1V1P B;  1UGM A;  2CKH B;  3A9J B;  1UNS A;  1L7Y A;  4L2Y A;  1FM0 D;  2WU2 B;  3TMP B;  2KO3 A;  3TCA A;  1GG3 A;  1WJU A;  1I42 A;  4RH6 A;  1T6B X;  2KT7 A;  1I4Q A;  4NJ6 A;  1QF6 A;  3AE4 B;  1WXM A;  1RM6 C;  1D4B A;  1JW9 D;  5DCN A;  5JH5 C;  1FMA D;  3A9K B;  2FAZ A;  1E5W A;  4IM0 A;  3V62 A;  4DXG A;  3BYT B;  4HCP B;  3PRM B;  2WYQ A;  2WHI A;  5IOI A;  1NEN B;  4EUT A;  2IDY A;  5J17 A;  2YLM A;  3U52 E;  1XQQ A;  1WM3 A;  1WWT A;  3RNE C;  3NVW A;  4ZYN A;  4XDC A;  2JWU A;  2V0G A;  4XYC A;  3VQI A;  3AM9 A;  4MT5 A;  2HE7 A;  2RDH A;  1ACC A;  4C00 A;  2UYZ B;  2PJH A;  1T0S C;  3K9O B;  5E6P A;  3U2S C;  1NBF C;  1SE2 A;  4XE0 A;  1JWU D;  4IDI A;  5BYS A;  3KUZ A;  1EF5 A;  5DPT A;  1GB4 A;  4USA A;  2WXL A;  3R7Q A;  4PK1 A;  4P7I A;  3KUD B;  2ZPN A;  4A90 A;  3JW0 X;  4KGS A;  4LJP B;  3BK1 A;  1R4N I;  3L16 A;  2L8J A;  3APD A;  2SAK A;  1TT5 B;  1WMH B;  2LXC A;  4DBG A;  2MJ3 A;  3V6E B;  1F0Z A;  2WX1 A;  3BWU D;  2L83 A;  3PZD A;  2XK5 B;  1V6E A;  3W1S C;  3N1X C;  3W5U B;  3QCA A;  4OVV A;  5HI1 A;  5FR3 A;  2BB6 A;  4MAC A;  3RD2 A;  4KZC A;  3NZ3 A;  4US8 A;  2WXP A;  3H1U A;  5MPO A;  2LAS A;  2RGF A;  2Q5W D;  2KNB A;  1FEH A;  3PT2 B;  4WJN A;  4TKN A;  4JWS C;  2A5U A;  3DBL B;  2HDE A;  4BOS C;  2BKR B;  2JUO A;  1WF9 A;  4LNF A;  4JPS A;  2NBV B;  4NAW B;  4FJV B;  3Q8A A;  3NVZ A;  4YT0 B;  1T0R C;  4Q2J A;  1RRB A;  4CO7 A;  2CHX A;  2D3G A;  2LRU A;  2Z59 B;  2FCN A;  3W1Y A;  3EFC A;  3W9C B;  1WRI A;  2GBK A;  2WXQ A;  1ET6 A;  4HXD A;  4TMA B;  4E3C A;  4HVB A;  1FPY A;  3V60 A;  1C79 A;  4FHK A;  4A8X C;  4XDD A;  1EWC A;  4EZL A;  4LJO B;  1N5X A;  1SIF A;  4GDK A;  2BW2 A;  1KLU D;  2G4D B;  3MJW A;  2IPK D;  4RM9 A;  4IC7 B;  3BVG A;  1V2Y A;  4FAD A;  2WDV B;  2OJR A;  2ASQ A;  4W9J A;  4E71 A;  1YQ3 B;  1PDX A;  2MRP A;  4EKU A;  3P2B A;  2WWZ A;  5BYR A;  4N59 A;  3I63 C;  2RR9 A;  4YSY B;  2G3Q B;  2IGD A;  2E6X A;  5T8I A;  1GAQ B;  4ZHO A;  1D3Z A;  5BMH A;  2EMS A;  4NJ7 A;  2K22 A;  1RLF A;  1ROE A;  2INN E;  2FCQ A;  3L10 B;  3TBL D;  1D5Z C;  1G6J A;  1TYG B;  2M56 B;  1ZPS A;  1OQQ A;  4W9G A;  2WXG A;  1R4N B;  5DPR A;  4IKG A;  1TJE A;  4CQN A;  5E6O A;  4B6W A;  4HPP A;  2ZJD A;  1L6V A;  2ACZ B;  4DXF A;  1XEE A;  2LXA A;  3IFW B;  2LEK A;  2RSU A;  4KSK C;  4EZJ A;  1HZ6 A;  3E9S A;  2R61 A;  4H2A A;  2M8S A;  4DQO C;  4MJS A;  1R4M I;  3ZRF A;  2MSE D;  4MEM A;  4LDT D;  1V80 A;  4M8N A;  2VH2 A;  3EUB 2;  3N20 C;  2BKF A;  3Q6B A;  3VTV A;  4IM2 A;  1TKE A;  1KFY B;  4B9K A;  4DHJ D;  5HHD G;  4KGT A;  4JQW C;  4LK0 M;  4II2 B;  2LGS A;  1J8C A;  1QOG A;  2KWC A;  1GC7 A;  2DEN B;  2KZR A;  4GDL A;  2I1K A;  1WJ6 A;  2FCS A;  1F1H A;  2PLP A;  3GOE A;  2RPQ A;  3Q3J A;  1CK1 A;  1IGC A;  4GN1 A;  3RI7 C;  4FLH A;  2NR2 A;  1RYJ A;  3EC8 A;  3CSF A;  2BYF A;  3I57 A;  1WJN A;  4K7W A;  4DHZ E;  3J9C A;  4GSW A;  1H8C A;  2KX3 A;  2XN9 C;  4M01 A;  5D2M B;  4K7S A;  4TUU A;  5BMI A;  1WZ3 A;  1XXG A;  1V81 A;  3ZYY X;  3I3T B;  2QJL A;  4I6P A;  3QAR A;  3IBE A;  1ZXI A;  2X38 A;  3RZF A;  3U8Z A;  3CWI A;  3VR9 B;  4HRS A;  1V49 A;  3P4Q B;  3ZJV A;  4BBN F;  1TKY A;  2K9X A;  3PS6 A;  2KMA A;  4LTU A;  2DWQ A;  1E0Z A;  1OQY A;  1HTQ A;  3P63 A;  1FD6 A;  1ZDX A;  2ZCB A;  2O6V A;  3PHX B;  4HWI B;  4C4V A;  2V1Y A;  2GLS A;  1N6Z A;  3NZU A;  4GB9 A;  3ZO5 B;  1ZDV A;  1PGA A;  2KC1 A;  1NYQ A;  1YQ4 B;  4JGH B;  1KH0 A;  4NQL B;  2NCN A;  2RD0 A;  2LJ5 A;  2DLB A;  4KZ0 A;  4ANU A;  2JXT A;  2JY6 A;  4RF1 A;  1STE A;  2LGY A;  2LZ6 A;  4N58 A;  3KWV A;  2BYT A;  1P7E A;  1V8C A;  3M3J A;  4HK2 A;  3GE8 C;  3WAM A;  3K9P B;  2HJ1 A;  3RZW C;  1FRR A;  5JZE B;  3UIO B;  3VH4 B;  4ZDV A;  2V3P A;  2KYW A;  4WQO B;  3WAO A;  3KYD D;  3LJ3 A;  3AE9 B;  4FA6 A;  3B2G A;  3TEW A;  2CR5 A;  4LNO A;  1WYW B;  1FCL A;  1WE7 A;  1YJI A;  2N1W A;  4MGI E;  4GDK B;  4DWF A;  2BGF A;  4GXB A;  1B1Z A;  4IUM B;  4JX1 C;  3SEB A;  5H92 C;  2D5G A;  4KDL B;  2O6V D;  3R7R A;  1AAR A;  3Q8B A;  3ZNH B;  1WIA A;  1R4M B;  3SFD B;  3FC4 A;  2BVC A;  4B95 A;  1PGB A;  3OWE B;  1J0G A;  1T3Q A;  4ZRP A;  1EU4 A;  3H6N A;  4GLS C;  1S1Q B;  4BBN C;  1GC6 A;  3AE7 B;  3ZXR A;  4J6I A;  2PKO A;  2EEL A;  2LUE A;  3HUI A;  2J7Q B;  4J3O D;  4K1R B;  2CU3 A;  3VAW A;  1N62 A;  1MG8 A;  3NY5 A;  4REZ A;  4DHJ B;  5CHV C;  2WP9 B;  2BPS A;  4FJY A;  2N7D A;  3L13 A;  2KD0 A;  2MBB B;  1XD3 B;  2GOW A;  2LJI A;  3PSE B;  1K53 A;  2N7J A;  3PLV A;  3QWZ B;  3Q2A C;  3B0A A;  2TSS A;  1RFA A;  1WY8 A;  2NMQ A;  4AOF A;  2KDB A;  3EFU A;  2KDI A;  5KHQ A;  1JWB D;  2RMM A;  3DVG Y;  2WXH A;  4TQ1 A;  5E6J A;  1GNU A;  3NVY A;  3Q3O C;  1L5P A;  1TBE A;  2K8H A;  3QHT A;  4DDI D;  2M1M A;  1YX5 B;  3HK0 A;  2DBY A;  4URK A;  2IY0 B;  4F1S A;  1E6E B;  4MJS B;  1TIF A;  4HDQ A;  4HEA 1;  2PPH A;  1E9M A;  1EM7 A;  2D3B A;  1JAL A;  2DZK A;  2NS5 A;  2ZVN A;  3Q69 A;  1WR6 E;  5H8Y E;  1YJ1 A;  3V6C B;  3VUX A;  3AEA B;  3WCQ A;  2FBW B;  4KVG B;  4YTN B;  1IBX B;  3SD5 A;  3QIJ A;  1JRU A;  3GE3 C;  3Q3M C;  4HPM B;  3KVF B;  3H9D A;  4GDL B;  1P0R A;  2JZZ A;  4N9F 4;  3U7D A;  2MWS B;  2K6Q A;  1TY0 A;  2BT6 A;  2HD5 B;  4IG7 B;  4C7Y A;  2C7H A;  3BZD B;  1MFW A;  3RNB C;  4AS1 A;  3T9L A;  2JPH A;  1P7F A;  4AWJ A;  4OHJ A;  3UQB A;  1C3T A;  3APC A;  3PGE A;  2JZP A;  2BS4 B;  3DDC B;  4WJO A;  3GZN I;  2KQ7 A;  3BK2 A;  3AI5 A;  3VUY A;  1EF1 A;  2PTL A;  2Y5C A;  1NEK B;  1UBQ A;  2KLG A;  1BUI C;  1MVK A;  4IW0 A;  2K6D B;  4P16 A;  3DBR I;  4W9C A;  3VUW A;  1FRD A;  1WXS A;  5HKH A;  3PRP B;  2PVO D;  2O6V B;  2OJW A;  1OFF A;  4C4V B;  1FIQ A;  3RNA C;  4ZHP A;  2AQ1 B;  3AE1 B;  3X23 A;  1N5W A;  3OJ4 B;  1VR9 A;  4R3D A;  1EWY C;  2WXK A;  1VZ6 A;  1YD8 U;  2PEA A;  2N1V A;  3R8B A;  2DYO A;  2ZNV C;  2BWF A;  2FUH B;  5DPS A;  2LMC A;  4NNJ B;  3QC8 B;  5L83 A;  3TIX A;  2KDE B;  4ANX A;  3H7P A;  1E10 A;  2C7M B;  1Y56 A;  3X0W A;  2KMC A;  1CQV A;  1CMX B;  3WA0 A;  1SGH A;  3NJT A;  2HTH A;  2L52 A;  4E74 A;  5JHB A;  4N6E B;  2DYM A;  2REX A;  2J52 A;  1L0X B;  1DOX A;  1N63 A;  4IWQ A;  2LGI A;  4EFO A;  1WX8 A;  5HG2 A;  2JYT A;  2ZEQ A;  4RGO S;  3Q3N C;  2WLB A;  2M4N A;  4HJK A;  4BKT A;  4II3 B;  2IGG A;  4A55 A;  3QQ8 B;  2M19 A;  3SU8 X;  3MC8 A;  3W5V B;  3IAM 1;  1HA5 A;  1EU3 A;  1NYR A;  4G0N B;  2L1A A;  3DBS A;  1T0Y A;  2C9W B;  3AE2 B;  4OZC A;  1OGW A;  5CTR C;  1FXA A;  4MH0 E;  2K1F A;  3JSV B;  4HJG E;  2OED A;  4KIK A;  2D10 A;  2KWD A;  2L0F A;  2V3N A;  4PS8 A;  4RCO A;  2ZNV B;  2EKI A;  3NS8 A;  1PFD A;  3OAW A;  2LFI A;  5G55 A;  4YWG G;  2UWQ A;  2DNF A;  3N32 A;  2L00 B;  3TSS A;  3N30 A;  2L7R A;  3IVF A;  5BO4 B;  2WXJ A;  3FAH A;  1YJJ A;  2LHE A;  4WWP A;  4JIO U;  2GBN A;  1R7S A;  3GZN B;  1K8R B;  2R2Q A;  4NY0 A;  3UIP B;  1V5T A;  2J4X A;  2M0A A;  1JQ4 A;  4ANV A;  1UEL A;  3HM3 A;  1IPG A;  2NPT A;  2JVC A;  3DBR B;  2QC8 A;  2N7E A;  3L0W B;  1D6E C;  2UU7 A;  5LNK 1;  2W3R A;  3DOW A;  4P1C C;  2GI9 A;  4LNI A;  4XZ4 A;  5GXG B;  5LXH A;  2N9P C;  2AYO B;  2C60 A;  3RN9 C;  4W9K A;  4B0E A;  2KQS A;  3SR6 A;  3ZDM C;  1C4P A;  2LD9 A;  3H8H A;  3R2I A;  1WSP A;  1YIW A;  5LLI A;  3Q14 C;  3NS1 A;  4DDG D;  3N1Z C;  2D07 B;  2KWU B;  4WQM A;  2NBW B;  1ZP0 B;  4MM3 B;  5AEK B;  1L2N A;  4WAF A;  3HVD A;  3PZ7 A;  2GBM A;  2G45 B;  4PS7 A;  3ZDT A;  1PUT A;  1A5R A;  3HHM A;  4LNK A;  1D5X C;  2KJ6 A;  3AV8 A;  1IUE A;  1J7C A;  4OVU A;  5FKA C;  4XGA B;  2KWV B;  4OZB A;  3B9J A;  1FNU A;  2I38 A;  3AEC B;  2O2V A;  3RFZ B;  4A9A A;  1WXQ A;  3ZQ4 A;  4ZRK A;  2QEJ C;  1E8W A;  1WXV A;  3ZNG C;  3T3O A;  5D3D A;  4IWP A;  1CZP A;  1FFV A;  2J42 A;  3OJ3 A;  2N9K A;  4YSX B;  3TEX A;  2Y3A A;  2W9N A;  1T0Q C;  1TS4 A;  4ICU A;  3DBH I;  3BY4 B;  1ET9 A;  5TSS A;  2WDT B;  2KN4 A;  2MP2 A;  1ZW7 A;  4YSZ B;  4MGK E;  2KVZ A;  4BAX A;  1QOA A;  2DZJ A;  3QAQ A;  3OG5 A;  1D5M C;  1UUP A;  2ZW1 A;  3N9Y C;  4I6N B;  3C8Y A;  4GGQ A;  2KX0 A;  4MSQ B;  4L23 A;  1P9D U;  2MA9 B;  5FK9 C;  4AJY B;  3NOB A;  3ZJT A;  2C5L C;  3H7P B;  3RPF C;  3M63 B;  1XCT L;  5FR6 A;  4ICV A;  4A20 A;  1UGJ A;  1Z5S B;  2GBJ A;  4CYE A;  4OW0 A;  2INC C;  3GB1 A;  1TKG A;  4WH4 A;  4DK5 A;  4TV3 A;  2FIF A;  1UH6 A;  5C23 A;  1C9F A;  1BXT A;  1AYF A;  2N0S B;  1WI0 A;  2MJD A;  4W9D A;  2KOX A;  2D3A A;  3MC9 A;  4YL8 A;  5TR5 A;  2JX5 A;  2MBE A;  1WM2 A;  4FBJ B;  3AUL A;  2E3T A;  3NRZ A;  2KFK A;  2NVU I;  3A1Q A;  1V1O A;  2MBH A;  3VVW B;  2ZPY A;  1Q10 A;  2RDB C;  3FIL A;  3ZRC A;  3ZGZ A;  3RUL A;  5IP4 D;  2ONQ A;  1SJH D;  3A9J A;  3QA8 A;  4ACF A;  1LO5 D;  1C76 A;  1KTK A;  2I2Y A;  2M17 A;  1GOZ A;  2GBR A;  4PYU A;  2ZVO A;  3AE3 B;  3PLU A;  3MHZ A;  4HLE A;  2CU1 A;  2IZV B;  5L95 C;  2WXF A;  2K39 A;  3MJ5 A;  2WS3 B;  4D2K A;  4HKQ A;  1OQR A;  2J0J A;  2L76 A;  4BOZ B;  2MEK A;  2JRI B;  2K0P A;  4HKZ E;  4GMV A;  2MH7 A;  2KN5 A;  3ZTC A;  4JL9 A;  3DHI C;  2WDQ B;  1TS5 A;  3N3K B;  1F52 A;  3P4S B;  1GB1 A;  5IKC M;  2NPT B;  1V86 A;  2Z0E B;  2JYE A;  1GPX A;  1QKZ A;  3DBH B;  2PE6 B;  4W9E A;  4WJQ A;  2DHZ A;  5GMV A;  4HDO A;  5AZF A;  2MX2 A;  1JCK B;  3AE5 B;  3R3M A;  1L0V B;  2J53 A;  2JQR B;  3AH7 A;  3ETR A;  2N9X A;  4MSM B;  5G5H A;  1BT0 A;  3KYC D;  3T8M A;  3JYU A;  3RT3 B;  1HTO A;  4MH8 A;  1AN8 A;  3BYY B;  2X8X X;  1UF0 A;  2DZI A;  2BS3 B;  3AE8 B;  2WXO A;  2N9L A;  1VJK A;  1QOF A;  1VDV A;  2BB5 A;  2INP E;  4TSS A;  5AUI A;  5BMG A;  2KDM A;  4K81 A;  3ENE A;  1SSN A;  3TL5 A;  3AN1 A;  1U4A A;  4US9 A;  2XEW A;  1Q0W B;  3AMZ A;  3AEB B;  3RUI B;  3VHT C;  3P4R B;  3U4E G;  1SF0 A;  3SDL C;  4XX5 A;  2NTT A;  2WU5 B;  1XT9 B;  1E8X A;  3DVN U;  4OZA A;  1FCC C;  2EKE C;  2VRR B;  4WWO A;  2DZM A;  2SEB D;  2G4S A;  2BTE A;  4ASW C;  1Q5W B;  3ECI A;  1HZ5 A;  4G50 A;  2MP2 B;  3SHQ A;  1A70 A;  1YQB A;  2HJ8 A;  1V5O A;  1NI3 A;  2DAJ A;  1XO3 A;  4F7Z A;  2AEH A;  4BKS A;  4O1N A;  2KMM A;  1E7U A;  5IO9 A;  1TZ1 A;  3P4P B;  3E56 A;  2W55 A;  1IP9 A;  1J7A A;  2XNA C;  1LXD A;  1LFD A;  4C56 C;  4LLG M;  3Q8F A;  2IJ0 A;  2Z8L A;  4QAY A;  3A33 B;  3CF6 E;  2FUG 1;  4GU2 A;  4RMA A;  3PVL A;  5J2R A;  1C1Y B;  1C77 A;  2W82 A;  4LNN A;  1TS2 A;  2QDF A;  5G5G A;  1E7V A;  3IT6 B;  2QIE B;  2LHD A;  4NPN A;  3IAS 1;  3CST A;  4GOC A;  2D3C A;  4M02 A;  1GJZ A;  1N61 A;  2KVR A;  3V05 A;  3B1L X;  3QJZ A;  3EA6 A;  2WXN A;  4ANW A;  3OLM D;  1H4R A;  5AUK A;  2IND C;  3VXW A;  2K5P A;  3CMM B;  4WWM A;  1YN4 A;  2BWE S;  2DAF A;  2QHO A;  1HE8 A;  2HTM E;  5AZG A;  3RNG C;  1MI0 A;  1I4R A;  4RGN A;  3GP7 A;  2PVG C;  1IYF A;  4AP4 C;  2H89 B;  2PE9 A;  4OVZ A;  3A4R A;  1P3Q U;  4ZYS A;  3FIL B;  1UWX A;  2KXJ A;  1PQS A;  1K50 A;  2KTR A;  2N4F A;  3ZTD A;  4BVU C;  1K52 A;  1IGD A;  2W3S A;  2QIL A;  4W9L A;  1T5X D;  2K3U A;  2FE8 A;  3TEY A;  3DPD A;  5D94 A;  1E90 A;  1V97 A;  3UIN B;  2H88 B;  1FO4 A;  5KHO A;  2MBO A;  3DVG X;  2MLB A;  1YN3 A;  2K8B A;  2V4I B;  3SFE B;  3PRZ A;  3HM6 X;  4FUL A;  5EE0 A;  5EE9 A;  4ZRQ A;  2IBI B;  2FNJ B;  3RYT A;  2W54 A;  2JXX A;  4XWT A;  4M0W A;  3DCG A;  2LGX A;  1EUV B;  3TJP A;  3RNF C;  2B76 B;  3QK0 A;  2PW9 A;  1JWS D;  3LDZ E;  3WAP A;  3MHS D;  5C1Z A;  3NZS A;  2C7N B;  1YNT E;  1I4H A;  1WGG A;  2AL6 A;  2QMT A;  2CHW A;  4AQ7 A;  4RFB A;  5IN7 A;  3MP9 A;  1JML A;  1SE4 A;  1WZ0 A;  2KJH B;  3V3X A;  2ZW0 A;  1WE6 A;  2IY1 B;  5IA7 A;  2L32 A;  2GMI C;  1ESF A;  1P1A A;  2L3Z A;  5IAA C;  4PS3 A;  2LVQ A;  1N60 A;  3U30 A;  3PZ8 A;  3L17 A;  1V9J A;  3VTW A;  3ML9 A;  2L05 A;  2IO2 B;  4MEL A;  4IM3 A;  4L1B A;  1WXA A;  3PO0 A;  4MGY E;  1WH3 A;  3WIM A;  4NJC A;  2PIA A;  1XLP A;  3ZLZ A;  2AQ2 B;  3MTN B;  1KJT A;  3UQA A;  1SEB D;  2WGS A;  3R2T A;  3ML8 A;  1E8Z A;  3RNC C;  3ABV B;  4BFR A;  3ALB A;  3P42 A;  3HIZ A;  2I1J A;  3AEF B;  4XC2 A;  3MFG A;  1VLB A;  4PT5 A; 
#chains in the Genus database with same CATH homology
 2CKH B;  1UGM A;  4AJY B;  3NOB A;  3A9J B;  1J0G A;  3Q3F A;  1L7Y A;  3H6N A;  1OTR B;  2C5L C;  3H7P B;  3M63 B;  5FR6 A;  3TMP B;  2KO3 A;  4ICV A;  4W9F A;  1S1Q B;  4BBN C;  3TCA A;  1GG3 A;  2Z0D B;  4A20 A;  1GC6 A;  1WJU A;  1Z5S B;  1X1M A;  2KHW B;  1I42 A;  3M95 A;  2GBJ A;  4LCD E;  4J6I A;  4NJ6 A;  4AUQ C;  4CYE A;  1Q1O A;  2LUE A;  2J7Q B;  1WXM A;  4K1R B;  4WAA A;  4I6L B;  3VAW A;  4DK5 A;  4TV3 A;  3L54 A;  2FIF A;  2MCN B;  1UH6 A;  1MG8 A;  5C23 A;  3NY5 A;  2KLC A;  4WWN A;  5DCN A;  1WI0 A;  5JH5 C;  3A9K B;  2FAZ A;  4W9D A;  5CHV C;  4DHJ B;  2KOX A;  1WX7 A;  2BPS A;  1E5W A;  4FJY A;  4IM0 A;  3ZW3 A;  2N7D A;  3L13 A;  2KD0 A;  2MBB B;  1XD3 B;  4YL8 A;  5TR5 A;  3V62 A;  2IYD B;  2GOW A;  1WM2 A;  2MBE A;  4HCP B;  3PRM B;  2WYQ A;  3PSE B;  3PLV A;  3QWZ B;  4FBJ B;  3B0A A;  3AUL A;  3H7S A;  4EUT A;  2CHZ A;  5J17 A;  1RFA A;  1WY8 A;  1WGR A;  2LI5 A;  2YLM A;  2KFK A;  1LQB A;  2NVU I;  3A1Q A;  4AOF A;  1XQQ A;  1WM3 A;  3AU5 A;  2KDB A;  2MBH A;  2KDI A;  3EFU A;  3VVW B;  2ZPY A;  5KHQ A;  2IO0 B;  3DVG Y;  4ZYN A;  2BYE A;  3ZRC A;  3APF A;  4TQ1 A;  5CHF A;  3RUL A;  3PTF C;  3VQI A;  2AL3 A;  1GNU A;  2HE7 A;  3A9J A;  2IO1 B;  1Y8R C;  2PJH A;  2UYZ B;  3QA8 A;  1TBE A;  2K8H A;  3K9O B;  3QHT A;  5E6P A;  2JWZ A;  1RAX A;  4DDI D;  1NBF C;  2M1M A;  2M17 A;  1YX5 B;  3HK0 A;  2GBR A;  3KUZ A;  1EF5 A;  4PYU A;  2ZVO A;  4URK A;  2IY0 B;  3PLU A;  2DYB A;  4F1S A;  1J19 A;  4MJS B;  4HLE A;  5DPT A;  2Y5B B;  2CU1 A;  2IZV B;  4HDQ A;  4KSL C;  3R7Q A;  5L95 C;  2D11 A;  4P7I A;  2PPH A;  2D2Q A;  3KUD B;  2K39 A;  5CHW A;  3D32 A;  2ZPN A;  2KAN A;  3JW0 X;  4LJP B;  4HPL B;  1R4N I;  2J0K A;  2DZK A;  2NS5 A;  2J0J A;  1WGD A;  2KC2 A;  3L16 A;  2L8J A;  2L76 A;  2A4Z A;  2ZVN A;  3APD A;  1S3S G;  5G2N A;  1WR6 E;  1WMH B;  2LXC A;  1YJ1 A;  4BOZ B;  4DBG A;  3V6C B;  3VUX A;  3V6E B;  2JRI B;  5E6N A;  2WX1 A;  5DPW A;  4X57 B;  4KVG B;  2LVO A;  3PZD A;  2XK5 B;  4GMV A;  3QIJ A;  1JRU A;  1V6E A;  3SD5 A;  2KN5 A;  3W1S C;  2KTR B;  3ZTC A;  4JL9 A;  4M8M A;  4HPM B;  2LVP A;  3ONS A;  3B08 A;  3KVF B;  3H9D A;  3QCA A;  4OVV A;  4GDL B;  1P0R A;  2JZZ A;  3N3K B;  4N9F 4;  3U7D A;  3RD2 A;  2MWS B;  2K6Q A;  4A3P A;  1WGH A;  4KZC A;  2NPT B;  3IG3 A;  1V86 A;  2HD5 B;  2Z0E B;  4IG7 B;  4IWO A;  3H1U A;  2LAS A;  2KDF B;  2C7H A;  2RGF A;  2PE6 B;  1ZKH A;  2KNB A;  4W9E A;  3T9L A;  4WJQ A;  2DHZ A;  3PT2 B;  4WJN A;  5GMV A;  2JPH A;  4HDO A;  3AU4 A;  4TKN A;  5AZF A;  2MX2 A;  4MGZ E;  4AWJ A;  4F8C B;  2A5U A;  2JZ3 B;  3R3M A;  4HCN B;  3UQB A;  4BOS C;  2BKR B;  1YX6 B;  1WF9 A;  2JUO A;  1C3T A;  2N9X A;  3APC A;  2XBB C;  3PGE A;  3DDC B;  4WJO A;  3GZN I;  4MSM B;  1BT0 A;  2NBV B;  3KYC D;  2KQ7 A;  4NAW B;  4FJV B;  3T8M A;  3JYU A;  3AI5 A;  3VUY A;  3RT3 B;  1EF1 A;  2MW5 A;  1RRB A;  4CO7 A;  1UBQ A;  2CHX A;  2IO3 B;  2KLG A;  4BKG A;  4M0W B;  2DZI A;  3DQV A;  2D3G A;  2LRU A;  2DX5 B;  2Z59 B;  2FCN A;  4IW0 A;  1EO6 A;  2LWP A;  2K6D B;  3RCZ A;  3DBR I;  4W9C A;  3IHP C;  3VUW A;  3W1Y A;  2K8C A;  2GBK A;  1WXS A;  5HKH A;  3PRP B;  4E3C A;  4HXD A;  4HVB A;  2O6V B;  4K81 A;  3ENE A;  3V60 A;  2K25 A;  4FHK A;  3TL5 A;  4W9H A;  1U4A A;  4EZL A;  3AXC A;  2XEW A;  4LJO B;  1Q0W B;  3X23 A;  1SIF A;  4GDK A;  5JHA A;  3OJ4 B;  1WGY A;  3RUI B;  3VHT C;  2G4D B;  3MJW A;  1YD8 U;  3SDL C;  4XX5 A;  4RM9 A;  2PEA A;  2N1V A;  4IC7 B;  1XT9 B;  1E8X A;  2DYO A;  1F9J A;  2ZNV C;  4ZRI A;  3DVN U;  2BYV E;  2EKE C;  1V2Y A;  2BWF A;  2VRR B;  2FUH B;  1UD7 A;  5DPS A;  4WWO A;  4FAD A;  2DZM A;  2B3A A;  2OJR A;  2ASQ A;  4MDK E;  2G4S A;  4NNJ B;  3S2A A;  1Z2M A;  4W9J A;  2YVC A;  4ASW C;  3KUC B;  3QC8 B;  4E71 A;  5L83 A;  3TIX A;  1Q5W B;  2KDE B;  3O65 B;  3H7P A;  3ECI A;  2C7M B;  2KJR A;  4ANX A;  3QX1 A;  3X0W A;  2KMC A;  2MRP A;  4G50 A;  1FXT B;  1CMX B;  2MP2 B;  3P2B A;  1YQB A;  4KIK B;  3SHQ A;  4EKU A;  2HJ8 A;  1V5O A;  2DAJ A;  2WWZ A;  3WA0 A;  4F7Z A;  1SGH A;  2RR9 A;  2AEH A;  4BKS A;  2G3Q B;  1E7U A;  2JRH A;  1QZE A;  3KH0 A;  3WAN A;  1TZ1 A;  2HTH A;  2N9E B;  1ISN A;  4E74 A;  1IP9 A;  5JHB A;  1D3Z A;  3A9K A;  1ZGU B;  2DYM A;  1LXD A;  2REX A;  2EMS A;  1WFY A;  1LFD A;  4NJ7 A;  4IWQ A;  1WRD B;  4GIV A;  1WX8 A;  1RLF A;  4EFO A;  1WR1 A;  4G3X B;  2FCQ A;  4KDI C;  3L10 B;  3TBL D;  2NBU A;  2ZEQ A;  3UF8 A;  3A33 B;  1G6J A;  3CF6 E;  4KV2 A;  4W9G A;  2M4N A;  2LGD A;  4GU2 A;  1UBI A;  2MQJ A;  3PVL A;  4HJK A;  1C1Y B;  4RMA A;  4BKT A;  2M0X A;  4II3 B;  5J2R A;  3VDZ A;  2KTF A;  3QQ8 B;  5DPR A;  1E7V A;  4NPN A;  3SU8 X;  4GOC A;  3CST A;  4FHJ A;  4G0N B;  5E6O A;  3DBS A;  4B6W A;  5J18 A;  1GJZ A;  2ZJD A;  1T0Y A;  2KVR A;  5D7G A;  3ZKJ C;  3B1L X;  3QJZ A;  2C9W B;  2LXA A;  4JLC A;  3IFW B;  1OGW A;  1NI2 A;  5CTR C;  4MH0 E;  2K1F A;  4ANW A;  3JSV B;  3OLM D;  1H4R A;  4FN2 A;  4NQK E;  2RSU A;  3R66 C;  4KSK C;  4EZJ A;  3WAL A;  3VXW A;  4KIK A;  2D10 A;  2L0F A;  3CMM B;  2M8S A;  3PPA A;  4PS8 A;  2BWE S;  2DAF A;  2QHO A;  1R4M I;  4MJS A;  2ZNV B;  3ZRF A;  3VFK A;  2MSE D;  1HE8 A;  3NS8 A;  4MEM A;  4LDT D;  3OAW A;  5AZG A;  2FCM A;  5G55 A;  3DVN V;  2OOB B;  1M94 A;  1V80 A;  4M8N A;  2UWQ A;  3ZUN A;  1OEY J;  3N32 A;  2BKF A;  2L00 B;  4K7U A;  4WJP A;  3N30 A;  4IM2 A;  3VTV A;  3ZNI D;  1IYF A;  1WMH A;  1I35 A;  2KFJ A;  2L7R A;  4AP4 C;  3C0R B;  3IVF A;  4B9K A;  4DHJ D;  2PE9 A;  5BO4 B;  3A4R A;  1P3Q U;  4WWP A;  4JQW C;  4JIO U;  3EEC A;  2GBN A;  2KXJ A;  2XK5 A;  1PQS A;  4II2 B;  1OEY A;  2KTR A;  2N4F A;  1J8C A;  3ZTD A;  4BVU C;  1TTN A;  3VH3 B;  1K8R B;  2KWC A;  2R2Q A;  1GC7 A;  4NY0 A;  2DEN B;  2KZR A;  3UIP B;  4GDL A;  1V5T A;  3BIN A;  2I1K A;  1WJ6 A;  4W9L A;  2FCS A;  4ANV A;  1UEL A;  3HM3 A;  1IPG A;  1NDD A;  2NPT A;  3GOE A;  2JVC A;  2RPQ A;  5D6J B;  3DPD A;  3Q3J A;  5D94 A;  1E90 A;  4EZK A;  3UIN B;  4LDT B;  2N7E A;  3L0W B;  2O2V B;  2EMT A;  1KOT A;  4GN1 A;  2KK8 A;  5KHO A;  2MBO A;  4G11 A;  3DOW A;  2WX0 A;  2KKC A;  3DVG X;  3JSV A;  2MLB A;  2NR2 A;  4FLH A;  3EC8 A;  4XZ4 A;  2K8B A;  3CSF A;  1KLV A;  2BYF A;  1WJN A;  4K7W A;  5LXH A;  2N9P C;  2AYO B;  2C60 A;  3PRZ A;  4W9K A;  1VD2 A;  2KQS A;  2ZCC A;  4DHZ E;  3ZDM C;  2CS4 A;  3EHV A;  3HM6 X;  4FUL A;  4GSW A;  2V4L A;  1H8C A;  2KX3 A;  2LD9 A;  4ZRJ A;  5D2M B;  2ZZP B;  4K7S A;  4TUU A;  1YIW A;  5LLI A;  4TQ0 A;  2IBI B;  3PHW B;  3ZIM A;  1WZ3 A;  4DDG D;  1V81 A;  4NAW A;  2FNJ B;  2D07 B;  2KWU B;  3ZVV A;  3I3T B;  2AWT A;  2V3S A;  3KW5 B;  3RYT A;  4I6P A;  3QAR A;  2JXX A;  3IBE A;  2NBW B;  1LM8 B;  3RZF A;  4RM8 A;  5AEK B;  1L2N A;  3U8Z A;  1E8Y A;  2L0T A;  4W9I A;  3JVZ X;  5LXI B;  3UGB B;  3V61 A;  3DCG A;  2LGX A;  1EUV B;  2GBM A;  1V49 A;  3TJP A;  2G45 B;  4BBN F;  4PS7 A;  3ZDT A;  3PS6 A;  2KMA A;  3QK0 A;  1A5R A;  3WAP A;  3LDZ E;  3HHM A;  3MHS D;  1OQY A;  3NZS A;  5C1Z A;  2KJ6 A;  4OVU A;  2C7N B;  2ZCB A;  3M62 B;  2O6V A;  4CHK A;  1WGG A;  3PHX B;  4HWI B;  2AL6 A;  2V1Y A;  2CHW A;  3NZU A;  4GB9 A;  3ZO5 B;  1WZ0 A;  4A3O A;  5EDS A;  2KWV B;  2KC1 A;  3A4S C;  2KJH B;  5AZH A;  4JGH B;  1WE6 A;  4NQL B;  2NCN A;  2RD0 A;  2LJ5 A;  2O2V A;  2IY1 B;  5IA7 A;  4KZ0 A;  4ANU A;  2GMI C;  1P1A A;  2L3Z A;  3W1S A;  2JT4 B;  2JY6 A;  5IAA C;  4ZRK A;  2JF5 A;  2LVQ A;  4PS3 A;  2MBQ A;  1E8W A;  1WXV A;  2LZ6 A;  2LGY A;  4FJZ A;  3U30 A;  3ZNG C;  3L17 A;  1V9J A;  3M3J A;  4HK2 A;  3WAM A;  3VTW A;  4IWP A;  1WX9 A;  2L05 A;  3K9P B;  3ML9 A;  3OJ3 A;  3RZW C;  2IO2 B;  4MEL A;  4IM3 A;  4MGY E;  1WXA A;  1WJ4 A;  5JZE B;  1WH3 A;  3WIM A;  2FID A;  2W9N A;  3UIO B;  4EEW A;  4ICU A;  1UZX B;  3DBH I;  3ZNZ B;  3VH4 B;  3BY4 B;  4DHZ B;  2WDT B;  4AJW A;  4WQO B;  3ZLZ A;  4ZDV A;  3WAO A;  3KYD D;  4MM3 A;  3LJ3 A;  2MP2 A;  3PV1 A;  1ZW7 A;  4FA6 A;  4DXA B;  2BF8 B;  3L08 A;  3MTN B;  1VCB A;  2CR5 A;  3NHE B;  4MGK E;  1KJT A;  5CX3 A;  3UQA A;  1WYW B;  3DBL I;  3VTU A;  1WE7 A;  3ML8 A;  1E8Z A;  2N1W A;  4MGI E;  4BKS D;  2DZJ A;  4GDK B;  4DWF A;  4BFR A;  1GUA B;  1SE9 A;  3QAQ A;  2BGF A;  2R2O A;  4GXB A;  3ALB A;  3PRE A;  1P98 A;  4IUM B;  4I6N B;  4KDL B;  2O6V D;  3R7R A;  3HIZ A;  1AAR A;  2J0M A;  4GGQ A;  2I1J A;  2KFK B;  2KX0 A;  4PYZ A;  3A1Q B;  3ZNH B;  4EOY A;  1TGZ B;  1WIA A;  4MSQ B;  4XC2 A;  1KM7 A;  1P9D U;  2LRW A;  2MA9 B;  4B95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...