1TIFA

Translation initiation factor 3 n-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
b'KDFIINEQIRAREVRLIDQNGDQLGIKSKQEALEIAARRNLDLVLVAPNAKPPVCRIMDYGKFRFEQQKKEKEARK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION INITIATION FACTOR 3
molecule tags Ribosome binding factor
source organism Geobacillus stearothermophilus
publication title X-ray crystallography shows that translational initiation factor IF3 consists of two compact alpha/beta domains linked by an alpha-helix.
pubmed rcsb
total genus 24
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1995-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05198 IF3_N Translation initiation factor IF-3, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.80 Alpha Beta Roll Ubiquitin-like (UB roll) Translation initiation factor 3 (IF-3), N-terminal domain 1tifA00
1TIFA
chains in the Genus database with same CATH superfamily
5G5GA 4XWWA 2IZVB 3RN9C 3TSSA 2JX5A 1RLFA 3EECA 3DBLI 1YJ1A 3SFEB 1F77A 1ESFA 4AOFA 5IAAC 4FN2A 5C3JB 3AE6B 4DXAB 1GUAB 2LJIA 4W9LA 4W9EA 4ZHOA 4ZRPA 2JSVX 1N6ZA 4BKSA 4ZRQA 3RULA 1S3SG 2G45B 4FBJB 1RYJA 2LASA 3NJTA 1ZGUB 4JQWC 1WIAA 1R7SA 3BIID 2KQ7A 3E9SA 3NVVA 3WALA 1NI2A 1S1QB 3L10B 4HDQA 3GE3C 4BBNF 3I3TB 2LGDA 3LYYA 3DBHI 1I7HA 4GDKA 4WJQA 1WI0A 3ML9A 3BVGA 3T3OA 4ZYSA 4LNIA 1OQYA 4IM2A 2LD9A 5DPWA 3VHTC 1YD8U 3Q69A 3AECB 1NI3A 1E8ZA 4NAMA 1V8CA 5CHVC 1C3TA 3AMZA 4TQ1A 2AWTA 2LFIA 2MJEA 2D3AA 4XC2A 1AN8A 2G1EA 3NRZA 3VH4B 3HM3A 1OEYA 1MG4A 2MQJA 4GDKB 2G3QB 1FNVA 2PVOD 3CWIA 2PE9A 3R2IA 5IP4D 4NY0A 4E71A 2BT6A 2WXFA 3VTUA 4XX5A 1RFAA 4II2B 2Q5WD 2XEWA 2Y5PA 2WXHA 2IGHA 3N3KB 3SR6A 3AE4B 1JALA 3P4QB 2IO2B 3VUWA 1WX7A 4E3CA 2AL3A 2ZEQA 2N7EA 1L7YA 2QDFA 1WGYA 2GBMA 1L6UA 1QOBA 4LDTB 3RNAC 4K7WA 3DWGC 2M1MA 4W9DA 2XK5A 2CJOA 1VDVA 2LI5A 1VZ8A 1N60A 4USAA 1WRIA 5HI1A 4WJPA 3OG5A 2JY6A 1JRPA 2HE7A 3HUIA 1JMLA 1V6EA 5DPTA 4AUQC 2KJRA 3Q3OC 1K50A 1J7BA 3AEFB 2EKEC 3PSEB 2MLBA 2WDRB 5E6JA 3AE9B 2KDBA 3A9JB 2MH7A 3DVGX 3NUHB 4WH4A 1OGWA 3ZNHB 3FILB 2WQYB 3AV8A 5EE3A 1JQ4A 3WAOA 5E6OA 2FAZA 3IBEA 5IO9A 4OZCA 1K51A 1VLBA 3DVNV 2DLBA 1C4CA 1VCBA 1TS4A 1TTNA 4TMAB 5FKAC 3DBSA 5L83A 5CHFA 4AS1A 5AUKA 3AEAB 2CU3A 3B0AA 4BKSD 1ZXIA 2KX0A 1WMHA 2NBWB 1ET6A 3A9KB 5AZGA 2I38A 1U4AA 2PEAA 1ROEA 2D2QA 4NJ6A 4OZAA 2Z0DB 1AARA 3ZVVA 1NBFC 2LVOA 2VH1A 5BMGA 1C77A 4FJYA 1E10A 3A1QB 1XLOA 5CTRC 2JF5A 4TKNA 2ZZPB 3MJWA 1E8XA 1FMAD 1HE8A 5HG2A 2IBIB 1YN4A 4XZ4A 4GB9A 3I5JC 4P1BC 1SXTA 4RGOS 3AE2B 1KRHA 4NAWA 1E7UA 1JWMD 1JWBD 1M94A 1WGKA 1XO3A 3UINB 2INCC 2LMCA 2N0SB 1TIFA 4K81A 3EA6A 1L0YB 4I6LB 1WR1A 4MJSB 1T0QC 2NTSA 3NVYA 2QIEB 4YT0B 1GC7A 1XLNA 3CIRB 3TUOA 1UH6A 1WGDA 1V9JA 1JWAD 4GSWA 1LFDA 3V60A 2M8SA 2NPTA 4K3BA 2J42A 1C78A 1IBXB 2PPHA 1IPGA 3RNCC 2GBNA 2WXGA 3SFDB 3MHSD 2FCQA 2Z8LA 1YX5B 4ACFA 4WJNA 2PE6B 1BMLC 3TCAA 3NOBA 2QC8A 4IDIA 1J0GA 2W3SA 4PS3A 5JHBA 2V3SA 2XBBC 4HKZE 2M0XA 4BKTA 1V97A 2GLSA 2Y5CA 2A4ZA 1E90A 3C19A 2KOXA 2LXAA 2C7NB 1J19A 4ZHPA 3AU4A 2D11A 1J8CA 2V4IB 1YN3A 2MSED 1UNSA 2K0PA 3DBRI 3R7QA 3VFKA 2J0JA 2C60A 1EF1A 2OJWA 1OQRA 4QAYA 1T0SC 4EE2A 1N5WA 1DOIA 1TZ1A 3CMMB 3RYTA 1C76A 1FM0D 5EE9A 4HWIB 3B9JA 3ML8A 2AQ1B 5KHQA 2CU1A 3VH3B 1WXQA 1ZDXA 3EGRA 4ITKA 1WGHA 5AZHA 1YQ3B 3DBHB 2M19A 3APFA 2YVCA 3VUYA 4N6EB 2MWSB 2G9HD 3P1MA 4MEMA 2RGFA 2LGSA 1E8YA 4P1CC 2FNJB 1FCLA 1VRAB 2ZW0A 4EZJA 1J7AA 1I35A 1FCCC 3W9CB 2KFJA 3ZTCA 2JU6X 3IVFA 2UU7A 3W1SC 3PPAA 1FNWA 3IXSA 3AB5A 2ZJDA 2LXCA 2RDBC 2KANA 5TSSA 1PYWD 4FADA 2DENB 4LNFA 2HD5B 4FXCA 2LRUA 3MJ5A 4GLSC 2L3ZA 2L32A 2DBYA 1D5MC 4KIKA 2WHIA 3RNBC 3AULA 2BF8B 4NQLB 1XQQA 1LQBA 3T9LA 2H88B 3R2TA 1ISNA 5IKCM 3DBLB 1STEA 4WAFA 4PT5A 4IW0A 3H1UA 1IGDA 2L00B 1FRDA 1KTKA 1YX6B 4PYUA 1ZUD2 1I4PA 3RZFA 2LWPA 3SD5A 2BQQA 4IOIE 1ENFA 2DYBA 4KKJA 3M62B 3NZUA 4IWQA 2C5LC 1WSPA 5C23A 3VR9B 2PTLA 1E0ZA 1UWMA 4ASWC 2BB6A 2BB5A 1F2RI 4WAAA 2FCNA 3V62A 3DHHC 1GB4A 2LZ6A 3K9OB 3QHTA 3V3XA 4TV3A 2KKCA 2Y3AA 2JWZA 1EUVB 2W82A 4LCDE 2ON8A 1DOXA 4KX6B 2CHXA 3R3MA 2V0GA 2SEBD 1HQRD 1SIJA 2INDC 4I6NB 4S0RA 3D32A 3Q8EA 1XLQA 2BGFA 5FR3A 1V81A 3BYTB 1MHXA 5BO4B 2K39A 2PW9A 5C2TB 3L17A 4ANWA 4IM0A 1TYGB 4BFRA 1WE6A 3QCAA 4F8CB 1WWTA 4MGIE 3PRMB 1GOZA 1NVID 3NS8A 3NVWA 4JL9A 2DWQA 3U7DA 2BS3B 4YTNB 1ZE3D 3HIZA 4REZA 2L76A 4HK2A 2WXIA 3M63B 3ALBA 1CJEA 4YTPB 2WU5B 2L1AA 4MH8A 1QKZA 2MBBB 3AE5B 4KV2A 1WJ4A 4JLCA 2FCMA 2IYDB 1V49A 2V3PA 3RI7C 2IDYA 2OJRA 2OOBB 3OLMD 3DPDA 3ZW3A 2AQ2B 3AE8B 3ZRFA 3GZNB 3X0WA 3RNFC 1V1PB 4M8NA 1SJED 3OJ3A 2HJ1A 4FA6A 3A9KA 2QJLA 3H9DA 1V86A 4NNJB 1AYFA 5BMHA 3B1LX 2FIDA 4NQKE 4ARCA 3ZNGC 1WR6E 4MT5A 3ZYYX 1XCTL 2KD0A 1MVKA 1C4AA 1BUIC 3CF6E 3TMPB 3WIMA 2FBWB 2TSSA 2DZKA 1EU3A 4WQOB 5G5HA 4L2YA 3PREA 3KVFB 4MDKE 3N9YC 1GG3A 2O6VD 1Z5SB 5TR5A 4XWTA 1WFYA 4P16A 2K8HA 4TSSA 4B0MA 4I6PA 1T0RC 1V5TA 2KNBA 2INNE 4URKA 2KDFB 3VRAB 2N9LA 1L2NA 3C0RB 2L83A 2X38A 3X23A 2XK5B 1OQQA 3HRDD 3KYCD 1R4MB 4HLEA 3MC9A 2WXOA 4BBNC 1UWXA 1X1MA 3BK2A 1BXTA 1N5XA 3RZWC 1WMHB 1WGRA 4DBGA 2WXRA 2RR9A 4WWPA 2PMVA 4J3OD 4GN1A 2WXKA 1JRUA 2BPSA 1ZP0B 1QZEA 3KWLA 2JQRB 4YTMB 4GU2A 4DDID 1I42A 1R4MI 2GI9A 4LLGM 4R3DA 2D3CA 3DVGY 2ACZB 3RT3B 5BYRA 2MP2A 2GMIC 4K7UA 3Q3NC 1PQSA 3N20C 4KSLC 4RMAA 3SHQA 2KMMA 2WXNA 3KQ4A 3P42A 4ZRJA 1Q10A 4DQOC 3ZLZA 2PIAA 2MBQA 2QILA 3PHXB 4EOYA 2KHWB 3DOWA 3I57A 1TS5A 1SB3C 2GRIA 2DZJA 5DPSA 2R2OA 2C7HA 5E6PA 1SGHA 2MEKA 2HTHA 5AUIA 1TY2A 4ARIA 1F2RC 2NTTA 1I4XA 1V1OA 3R7RA 1E5WA 2WXJA 3ZJTA 2KYWA 4XDDA 2NBVB 1YN5A 1DYQA 2C7MB 2QEJC 5D3DA 3V6CB 2BWES 2N9XA 2PVGC 2KN4A 4HJKA 2LVPA 2QMTA 1WM2A 2MHJA 1EWCA 2BBCA 2I1JA 2IO0B 1HTQA 1E6EB 4NJCA 3Q3FA 1L0XB 2ZVNA 2OHFA 4AJWA 1F52A 3NS1A 1LXDA 3W1YA 3L08A 4IG7B 1KLVA 2MP2B 4PK1A 5BYQA 3KUZA 4LJPB 2D07B 2RD0A 2Z0EB 1UUPA 4MH0E 1HZ6A 2WGSA 1PGBA 2IGDA 3VRBB 1WZ0A 3K9PB 3HK0A 2DYMA 3DQVA 4EZLA 1RAXA 3FC4A 5CHWA 4MSMB 5GMVA 4JE3B 3QA8A 4M02A 2MJ3A 5BMIA 1EWYC 4LDTD 2ZCCA 3JSVB 2INPE 1QILA 5CX3A 4UDUC 3MC8A 2JT4B 5AEKB 1LO5D 5T8IA 3W2DA 1KJTA 4A20A 1XLPA 2K25A 4M01A 2QSDA 1PUTA 3VVWB 2N1WA 4ZRKA 4KDLB 3PRPB 1BT0A 3SU8X 4RM8A 3QAQA 2DZMA 5EE0A 2IGGA 2KFKA 1WXVA 3PO0A 2KTRB 2N7DA 1NENB 2M17A 1OTRB 2R2QA 5D7GA 3VQIA 1UGJA 5JZEB 2OEDA 1YOVB 5D3IB 3NG0A 2NBUA 3IAS1 1M4VA 3WANA 2KMAA 4RCOA 2CHWA 2N4FA 1TZOA 1R4NI 1TBEA 4MGKE 1OFFA 3O65B 3M95A 3O13A 4MGYE 2O6VB 2QCZA 2ZNVC 3L4PA 1RFKA 1R4NB 1N61A 2HDEA 4OVZA 2BKFA 1N63A 4MSQB 4AQ7A 3QWZB 5IN7A 4L23A 4W9KA 3BYYB 4M00A 2J4XA 4DHJB 3DVNU 2WWZA 2MRPA 3HHMA 2VZKB 4CO7A 1SBBB 4WWNA 4RF0A 3ZXVA 2KN5A 1SSNA 3NHEB 5BYSA 2D3BA 2LHDA 1MPEA 3Q3MC 4AWJA 3P4SB 5FK9C 3EHVA 4DXFA 2K8BA 2K6QA 2LGIA 3WAPA 1CK1A 4KZ0A 3N32A 3AI5A 4NZLB 3ETRA 2Z59B 1WX9A 4LK0M 1GB1A 5EDSA 2O2VA 1TJEA 2A5UA 3A9JA 4C80A 1D3ZA 2IPKD 3MP9A 3U30A 1UGMA 1J7CA 2N9KA 3V61A 1MI0A 2MW5A 3ZO5B 4HCPB 3KH0A 2KWDA 2MA9B 2KDIA 1ET9A 2GBRA 2ZNVB 1SIFA 2KWVB 2IJ0A 2MX2A 1TGZB 4YSZB 3N1XC 4HJGE 3AEDB 3DWMA 4RGMA 4B9KA 2WX1A 3CSFA 5FR6A 1K53A 2NVUI 1I4QA 4WWOA 2KTRA 2ZW1A 4XGAB 2WX0A 3NVZA 4EZKA 2DAFA 4FJVB 2WXLA 1IP9A 3OJ4B 1FD6A 2EMTA 4A6QA 2FIFA 3AM9A 1ACCA 4US9A 5DPRA 1JWSD 2V9HA 3PGEA 5AZFA 3J9CA 3PLVA 2O2VB 1E8WA 2AEHA 2KQ4X 1P7FA 4YL8A 1NEKB 3QC8B 4LNKA 2REXA 3URYA 2LEKA 2PKOA 4BZAA 2J52A 2N7JA 3N1ZC 3FAHA 1PDXA 4ANXA 1IGCA 2LGXA 2JYEA 1V1PA 1YMHE 4A8XC 2ZCBA 1UZXB 3N1YC 4K1RB 1RWSA 2NMQA 2PJHA 2DYOA 4ZOHC 2WLBA 3MTNB 2UWQA 4W9FA 3FKYA 1WJ6A 1C79A 1I4GA 4GMVA 1TKYA 1QOAA 3Q3JA 4FHJA 1VZ7A 4G11A 1FEHA 3TEXA 3RFZB 1XT9B 3EC8A 3ZKJC 2LUMA 1TY0A 2V3NA 4MACA 4W9CA 1E7PB 3HM6X 4CQNA 2DNFA 2JZPA 1WF9A 3AEGB 1YQ4B 1B9RA 1F9JA 2RSUA 5KHOA 2GOWA 2KTFA 2K9XA 2XNAC 2KT7A 4HKQA 3RD2A 4IC7B 2G4SA 2DZIA 4KZCA 3PZ8A 3R8BA 2WYQA 2YEPF 1CZPA 4M0WB 2BS2B 2MCNB 2JXXA 3H8HA 5D2MB 4MGZE 3W5UB 3JW0X 1A70A 3AU5A 1WJNA 4L1BA 1SF0A 2RPVA 4A3PA 3Q8CA 2K5PA 2JUOA 4ICVA 4KVGB 1DOYA 3GZNI 4AP4C 1Q1OA 3P2BA 1ZXHA 2BKRB 1ZPSA 5C1ZA 1HXYD 1JW9D 1V5OA 3OWEB 2IY1B 4A90A 2J0MA 4US8A 4KKIA 4F1SA 2AQ3B 1QLBB 4S17A 3ONSA 4BOZB 3BK1A 4YWGG 4A55A 1E7VA 1C4PA 2BTEA 1GJZA 4KIKB 1FRRA 1XCQL 2LHEA 1WH3A 2KO3A 4N58A 1QF6A 1UBQA 2BWFA 1WYGA 2BYTA 1EM7A 1IUEA 1VZ6A 4OHJA 2I1KA 1WY8A 1ZW7A 2D5GA 4J6IA 1L5PA 4G0NB 4C00A 3DBRB 3LXFA 1A5RA 4ANUA 1C9FA 2L8JA 4B6WA 3WAMA 2KMCA 2BS4B 5E6NA 3LJ3A 2X8XX 3A33B 4PYZA 3L16A 2M0AA 2CJNA 5H92C 2FUHB 3VR8B 5JHAA 3Q14C 4GIVA 2DAJA 4X57B 4EEWA 2E3TA 2FUG1 3FILA 4W9JA 3TEYA 3SDLC 2GBKA 3RUIB 4DWFA 2BW2A 3MHZA 4HPMB 2WDVB 3UQAA 2GBJA 3AEEB 4IWOA 5HFYA 3DCGA 5J17A 2LRWA 4HPPA 3IT6B 1WYWB 3PV1A 3BVMA 3I63C 1N62A 1SE2A 1Z2MA 2K1FA 2WNMA 1XF5L 2KWCA 2B76B 4KGSA 1PGXA 4DHJD 3HVDA 4DDGD 1WZ3A 1K52A 1QOFA 2NPTB 3QX1A 4ZDVA 1KM7A 3DDCB 4Q2JA 3U52E 3N30A 1E9MA 3UI3A 4KGTA 1H4RA 4OVUA 3B08A 4HVBA 4GOCA 4ANVA 4GGQA 2JWUA 2ZPYA 4OZBA 1D5ZC 4C4VB 1XEEA 3DHGC 1ZOYB 2WXPA 2IY0B 5HHDG 2NS5A 2SAKA 1P0RA 3E56A 2KQSA 3RNEC 3U4EG 4HCNB 3AE3B 3VTVA 4HXDA 5LLIA 4G50A 1JROA 4WURA 2ICIA 1KOTA 2BYEA 3S2AA 3ZDMC 4IWPA 4HRSA 4TQ0A 3ZUNA 1AWDA 4LNNA 2J7QB 1FXIA 2O6VA 3ZJVA 1TKEA 4HEA1 4OW0A 4RF1A 4G3XB 2ZPNA 1WGGA 5IOIA 3QK0A 4WQMA 3NY5A 5GXGB 1NYRA 3PTFC 4FULA 2GB1A 4EKUA 1G6JA 3MFGA 2WS3B 1TT5B 3R66C 2M56B 3MC0B 3Q8AA 3RNGC 1WXMA 1H8CA 3A4RA 2DHZA 3EFUA 2L05A 1LM8B 2KZRA 1CMXB 1ZDVA 4BOSC 3QARA 3IHPC 1KLUD 4FJZA 2J0KA 2EELA 1L6VA 3L0WB 4B0EA 3JVZX 4C7YA 1WE7A 3UIPB 3JSVA 3VDZA 4JWUC 1Q5WB 4JWSC 3DHIC 2HTME 2JPHA 2D10A 2KFKB 2LVQA 4GDLB 3B2FA 2RPQA 3T3NA 3H7SA 1Q0WB 1MG8A 4LTUA 3BINA 4HPLB 2N1VA 1UD7A 1GAQB 1GNUA 3V05A 4JIOU 2XN9C 3ZXRA 1VD2A 1L0VB 3GOEA 4MELA 1Y8RC 4RH6A 2KXJA 3W1SA 2YLMA 1KF6B 2V1YA 5J2RA 1WXSA 2KVRA 2K6DB 3P4PB 4C4VA 2E6XA 2L0TA 3H7PA 4TUUA 1OEYJ 4N9F4 3ZNID 2UYZB 1GC6A 1HA5A 4RGNA 2MBHA 2K8CA 1TS2A 1YNTE 3KLSX 3VAWA 3KUCB 2Y5BB 5EE1A 1B1ZA 3BY4B 3P4RB 2JZZA 2LGYA 5I4DA 4RNAA 4LJOB 4W9GA 3TEZA 5JXVA 3LDZE 4P7IA 4E74A 1T5XD 2KWUB 4DHZE 1NYQA 3QIJA 1FXTB 4ZRIA 2L52A 4DK5A 5J18A 1CQVA 2WDTB 3B2GA 3ECIA 3AE7B 1I4RA 2BVCA 1F0ZA 3BZDB 3PVLA 5G55A 2KLGA 4WWMA 3CSTA 3AN1A 4GXBA 3PZ7A 4K3CA 1HZ5A 4W9IA 4HDOA 4NJ7A 2AL6A 2JXTA 4RGTA 2AX5A 1P3QU 3AE1B 1DGJA 4P6VF 2JRIB 1JWUD 3OAWA 2KC2A 3M3JA 1VJKA 3IFWB 3IAM1 2I2YA 3L13A 2IO3B 3LB8C 2KDMA 3UF8A 1SJHD 3APDA 1ZKHA 4XYCA 2KX3A 5D94A 4AJYB 3V6EB 2KACA 2W55A 1VR9A 1PFDA 1D6EC 4HROA 2CKHB 2KJHB 4KSKC 2LJ5A 1QOGA 5HKHA 4PS8A 2G4DB 3KYDD 1MHHE 2CR5A 4JX1C 3HVZA 4YSXB 1RRBA 1HTOA 3PS6A 1PGAA 4B95A 3U2SC 4YSYB 5LXHA 3WA0A 3JYUA 1C1YB 2ASQA 2MBEA 4RM9A 4KGRA 1I4HA 4OVVA 2ONQA 1SE3A 2VH2A 4IUMB 3IT4B 1K8RB 1D4BA 3TEWA 3EUB2 2QHOA 2KK8A 1QQRA 1YQBA 3Q8BA 4II3B 1TKGA 3L54A 1FO4A 2J53A 3AXCA 1V2YA 4KDIC 3UQBA 2W3RA 1L4DB 1TS3A 2PLPA 1KH0A 4W9HA 3UIOB 4EFOA 4H2AA 3UGBB 4WJOA 3GS2A 4BAXA 4IKGA 2IO1B 2W54A 1HEZE 2KAJA 3VXWA 3KW5B 3A4SC 4LNOA 3IG3A 1FFVA 2DX5B 2R61A 3U7ZA 2RMMA 1T0YA 2C9WB 3GE8C 4BKGA 4DXGA 1P9DU 1EU4A 3APCA 1FPYA 2RDGA 1IYFA 1RM6C 3RMKC 2KVZA 3RPFC 5D6JB 5LXIB 3RCZA 3T8MA 3PZDA 3WCQA 2NR2A 4XDCA 4NPNA 4C56C 3BVZA 5LNK1 1JCKB 4F7ZA 3TBLD 1WX8A 4BVUC 3P63A 1NDDA 2K22A 1WJUA 2LUEA 2D3GA 3ZIMA 2EKIA 2CS4A 4ZYNA 2FCSA 1WM3A 1V80A 3BWUD 3Q6BA 1KFYB 2V4LA 2VRRB 2ZVOA 4MM3A 3ENEA 3ZRCA 2CHZA 4XE0A 3QQ8B 4ICUA 1FFUA 2W9NA 1IBXA 2KJ6A 2N9EB 4WIPA 5JH5C 1UBIA 1XD3B 4RFBA 1F1HA 2H89B 1UELA 3ZNZB 2EMSA 4DHZB 2JRHA 3H6NA 2L0FA 2BYFA 3H7PB 2MJDA 1LGRA 2YEPB 3ZGZA 3Q8FA 3VUXA 2N9PC 1GPXA 2WDQB 3ZJUA 2NCNA 3KUDB 3ZDTA 4N59A 4NAWB 3PT2B 4JGHB 4EUTA 5DCNA 1P98A 2AYOB 2VZKD 2L7RA 3NZ3A 2FE8A 1YIWA 3TJPA 3KWVA 3I9V1 4YXDB 1P1AA 1FIQA 5MPOA 4C7ZA 2WU2B 2JVCA 3W5VB 4CHKA 2B3AA 1D5XC 3PHWB 4M0WA 3A1QA 3AEBB 3ZQ4A 2M4NA 3ABVB 3Q2AC 4M8MA 4CYEA 1YJJA 2MBOA 1P7EA 2WXMA 5H8YE 4D2KA 1QT9A 3EFCA 2BYVE 4MM3B 1SEBD 2K3UA 1EF5A 1T3QA 1XXGA 2KLCA 1EO6A 3SEBA 2WXQA 1T6BX 1FXAA 3AH7A 3QJZA 5L95C 4MJSA 4A9AA 3PRZA 1MFWA 1MJDA 4FHKA 3ZTDA 4PS7A 2JYTA 1UF0A 1WXAA 1SE9A 5IA7A 3VTWA 3U8ZA 4JPSA 3TL5A 4K7SA 2HJ8A 3GP7A 2RDHA 2WP9B 1SE4A 4O1NA 3GB1A 3NZSA 2KC1A 4FLHA 3PLUA 1WRDB 1FNUA 4IM3A 4A3OA 3C8YA 1L4ZB 4GDLA 1Y56A 1KLGD 2KDEB 2JZ3B 3TIXA 5G2NA 1AW7A 1YJIA
chains in the Genus database with same CATH topology
1TIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIF A; 
#chains in the Genus database with same CATH topology
 5G5G A;  4XWW A;  2IZV B;  3RN9 C;  3TSS A;  2JX5 A;  1RLF A;  3EEC A;  3DBL I;  1YJ1 A;  3SFE B;  1F77 A;  1ESF A;  4AOF A;  5IAA C;  4FN2 A;  5C3J B;  3AE6 B;  4DXA B;  1GUA B;  2LJI A;  4W9L A;  4W9E A;  4ZHO A;  4ZRP A;  2JSV X;  1N6Z A;  4BKS A;  4ZRQ A;  3RUL A;  1S3S G;  2G45 B;  4FBJ B;  1RYJ A;  2LAS A;  3NJT A;  1ZGU B;  4JQW C;  1WIA A;  1R7S A;  3BII D;  2KQ7 A;  3E9S A;  3NVV A;  3WAL A;  1NI2 A;  1S1Q B;  3L10 B;  4HDQ A;  3GE3 C;  4BBN F;  3I3T B;  2LGD A;  3LYY A;  3DBH I;  1I7H A;  4GDK A;  4WJQ A;  1WI0 A;  3ML9 A;  3BVG A;  3T3O A;  4ZYS A;  4LNI A;  1OQY A;  4IM2 A;  2LD9 A;  5DPW A;  3VHT C;  1YD8 U;  3Q69 A;  3AEC B;  1NI3 A;  1E8Z A;  4NAM A;  1V8C A;  5CHV C;  1C3T A;  3AMZ A;  4TQ1 A;  2AWT A;  2LFI A;  2MJE A;  2D3A A;  4XC2 A;  1AN8 A;  2G1E A;  3NRZ A;  3VH4 B;  3HM3 A;  1OEY A;  1MG4 A;  2MQJ A;  4GDK B;  2G3Q B;  1FNV A;  2PVO D;  3CWI A;  2PE9 A;  3R2I A;  5IP4 D;  4NY0 A;  4E71 A;  2BT6 A;  2WXF A;  3VTU A;  4XX5 A;  1RFA A;  4II2 B;  2Q5W D;  2XEW A;  2Y5P A;  2WXH A;  2IGH A;  3N3K B;  3SR6 A;  3AE4 B;  1JAL A;  3P4Q B;  2IO2 B;  3VUW A;  1WX7 A;  4E3C A;  2AL3 A;  2ZEQ A;  2N7E A;  1L7Y A;  2QDF A;  1WGY A;  2GBM A;  1L6U A;  1QOB A;  4LDT B;  3RNA C;  4K7W A;  3DWG C;  2M1M A;  4W9D A;  2XK5 A;  2CJO A;  1VDV A;  2LI5 A;  1VZ8 A;  1N60 A;  4USA A;  1WRI A;  5HI1 A;  4WJP A;  3OG5 A;  2JY6 A;  1JRP A;  2HE7 A;  3HUI A;  1JML A;  1V6E A;  5DPT A;  4AUQ C;  2KJR A;  3Q3O C;  1K50 A;  1J7B A;  3AEF B;  2EKE C;  3PSE B;  2MLB A;  2WDR B;  5E6J A;  3AE9 B;  2KDB A;  3A9J B;  2MH7 A;  3DVG X;  3NUH B;  4WH4 A;  1OGW A;  3ZNH B;  3FIL B;  2WQY B;  3AV8 A;  5EE3 A;  1JQ4 A;  3WAO A;  5E6O A;  2FAZ A;  3IBE A;  5IO9 A;  4OZC A;  1K51 A;  1VLB A;  3DVN V;  2DLB A;  1C4C A;  1VCB A;  1TS4 A;  1TTN A;  4TMA B;  5FKA C;  3DBS A;  5L83 A;  5CHF A;  4AS1 A;  5AUK A;  3AEA B;  2CU3 A;  3B0A A;  4BKS D;  1ZXI A;  2KX0 A;  1WMH A;  2NBW B;  1ET6 A;  3A9K B;  5AZG A;  2I38 A;  1U4A A;  2PEA A;  1ROE A;  2D2Q A;  4NJ6 A;  4OZA A;  2Z0D B;  1AAR A;  3ZVV A;  1NBF C;  2LVO A;  2VH1 A;  5BMG A;  1C77 A;  4FJY A;  1E10 A;  3A1Q B;  1XLO A;  5CTR C;  2JF5 A;  4TKN A;  2ZZP B;  3MJW A;  1E8X A;  1FMA D;  1HE8 A;  5HG2 A;  2IBI B;  1YN4 A;  4XZ4 A;  4GB9 A;  3I5J C;  4P1B C;  1SXT A;  4RGO S;  3AE2 B;  1KRH A;  4NAW A;  1E7U A;  1JWM D;  1JWB D;  1M94 A;  1WGK A;  1XO3 A;  3UIN B;  2INC C;  2LMC A;  2N0S B;  1TIF A;  4K81 A;  3EA6 A;  1L0Y B;  4I6L B;  1WR1 A;  4MJS B;  1T0Q C;  2NTS A;  3NVY A;  2QIE B;  4YT0 B;  1GC7 A;  1XLN A;  3CIR B;  3TUO A;  1UH6 A;  1WGD A;  1V9J A;  1JWA D;  4GSW A;  1LFD A;  3V60 A;  2M8S A;  2NPT A;  4K3B A;  2J42 A;  1C78 A;  1IBX B;  2PPH A;  1IPG A;  3RNC C;  2GBN A;  2WXG A;  3SFD B;  3MHS D;  2FCQ A;  2Z8L A;  1YX5 B;  4ACF A;  4WJN A;  2PE6 B;  1BML C;  3TCA A;  3NOB A;  2QC8 A;  4IDI A;  1J0G A;  2W3S A;  4PS3 A;  5JHB A;  2V3S A;  2XBB C;  4HKZ E;  2M0X A;  4BKT A;  1V97 A;  2GLS A;  2Y5C A;  2A4Z A;  1E90 A;  3C19 A;  2KOX A;  2LXA A;  2C7N B;  1J19 A;  4ZHP A;  3AU4 A;  2D11 A;  1J8C A;  2V4I B;  1YN3 A;  2MSE D;  1UNS A;  2K0P A;  3DBR I;  3R7Q A;  3VFK A;  2J0J A;  2C60 A;  1EF1 A;  2OJW A;  1OQR A;  4QAY A;  1T0S C;  4EE2 A;  1N5W A;  1DOI A;  1TZ1 A;  3CMM B;  3RYT A;  1C76 A;  1FM0 D;  5EE9 A;  4HWI B;  3B9J A;  3ML8 A;  2AQ1 B;  5KHQ A;  2CU1 A;  3VH3 B;  1WXQ A;  1ZDX A;  3EGR A;  4ITK A;  1WGH A;  5AZH A;  1YQ3 B;  3DBH B;  2M19 A;  3APF A;  2YVC A;  3VUY A;  4N6E B;  2MWS B;  2G9H D;  3P1M A;  4MEM A;  2RGF A;  2LGS A;  1E8Y A;  4P1C C;  2FNJ B;  1FCL A;  1VRA B;  2ZW0 A;  4EZJ A;  1J7A A;  1I35 A;  1FCC C;  3W9C B;  2KFJ A;  3ZTC A;  2JU6 X;  3IVF A;  2UU7 A;  3W1S C;  3PPA A;  1FNW A;  3IXS A;  3AB5 A;  2ZJD A;  2LXC A;  2RDB C;  2KAN A;  5TSS A;  1PYW D;  4FAD A;  2DEN B;  4LNF A;  2HD5 B;  4FXC A;  2LRU A;  3MJ5 A;  4GLS C;  2L3Z A;  2L32 A;  2DBY A;  1D5M C;  4KIK A;  2WHI A;  3RNB C;  3AUL A;  2BF8 B;  4NQL B;  1XQQ A;  1LQB A;  3T9L A;  2H88 B;  3R2T A;  1ISN A;  5IKC M;  3DBL B;  1STE A;  4WAF A;  4PT5 A;  4IW0 A;  3H1U A;  1IGD A;  2L00 B;  1FRD A;  1KTK A;  1YX6 B;  4PYU A;  1ZUD 2;  1I4P A;  3RZF A;  2LWP A;  3SD5 A;  2BQQ A;  4IOI E;  1ENF A;  2DYB A;  4KKJ A;  3M62 B;  3NZU A;  4IWQ A;  2C5L C;  1WSP A;  5C23 A;  3VR9 B;  2PTL A;  1E0Z A;  1UWM A;  4ASW C;  2BB6 A;  2BB5 A;  1F2R I;  4WAA A;  2FCN A;  3V62 A;  3DHH C;  1GB4 A;  2LZ6 A;  3K9O B;  3QHT A;  3V3X A;  4TV3 A;  2KKC A;  2Y3A A;  2JWZ A;  1EUV B;  2W82 A;  4LCD E;  2ON8 A;  1DOX A;  4KX6 B;  2CHX A;  3R3M A;  2V0G A;  2SEB D;  1HQR D;  1SIJ A;  2IND C;  4I6N B;  4S0R A;  3D32 A;  3Q8E A;  1XLQ A;  2BGF A;  5FR3 A;  1V81 A;  3BYT B;  1MHX A;  5BO4 B;  2K39 A;  2PW9 A;  5C2T B;  3L17 A;  4ANW A;  4IM0 A;  1TYG B;  4BFR A;  1WE6 A;  3QCA A;  4F8C B;  1WWT A;  4MGI E;  3PRM B;  1GOZ A;  1NVI D;  3NS8 A;  3NVW A;  4JL9 A;  2DWQ A;  3U7D A;  2BS3 B;  4YTN B;  1ZE3 D;  3HIZ A;  4REZ A;  2L76 A;  4HK2 A;  2WXI A;  3M63 B;  3ALB A;  1CJE A;  4YTP B;  2WU5 B;  2L1A A;  4MH8 A;  1QKZ A;  2MBB B;  3AE5 B;  4KV2 A;  1WJ4 A;  4JLC A;  2FCM A;  2IYD B;  1V49 A;  2V3P A;  3RI7 C;  2IDY A;  2OJR A;  2OOB B;  3OLM D;  3DPD A;  3ZW3 A;  2AQ2 B;  3AE8 B;  3ZRF A;  3GZN B;  3X0W A;  3RNF C;  1V1P B;  4M8N A;  1SJE D;  3OJ3 A;  2HJ1 A;  4FA6 A;  3A9K A;  2QJL A;  3H9D A;  1V86 A;  4NNJ B;  1AYF A;  5BMH A;  3B1L X;  2FID A;  4NQK E;  4ARC A;  3ZNG C;  1WR6 E;  4MT5 A;  3ZYY X;  1XCT L;  2KD0 A;  1MVK A;  1C4A A;  1BUI C;  3CF6 E;  3TMP B;  3WIM A;  2FBW B;  2TSS A;  2DZK A;  1EU3 A;  4WQO B;  5G5H A;  4L2Y A;  3PRE A;  3KVF B;  4MDK E;  3N9Y C;  1GG3 A;  2O6V D;  1Z5S B;  5TR5 A;  4XWT A;  1WFY A;  4P16 A;  2K8H A;  4TSS A;  4B0M A;  4I6P A;  1T0R C;  1V5T A;  2KNB A;  2INN E;  4URK A;  2KDF B;  3VRA B;  2N9L A;  1L2N A;  3C0R B;  2L83 A;  2X38 A;  3X23 A;  2XK5 B;  1OQQ A;  3HRD D;  3KYC D;  1R4M B;  4HLE A;  3MC9 A;  2WXO A;  4BBN C;  1UWX A;  1X1M A;  3BK2 A;  1BXT A;  1N5X A;  3RZW C;  1WMH B;  1WGR A;  4DBG A;  2WXR A;  2RR9 A;  4WWP A;  2PMV A;  4J3O D;  4GN1 A;  2WXK A;  1JRU A;  2BPS A;  1ZP0 B;  1QZE A;  3KWL A;  2JQR B;  4YTM B;  4GU2 A;  4DDI D;  1I42 A;  1R4M I;  2GI9 A;  4LLG M;  4R3D A;  2D3C A;  3DVG Y;  2ACZ B;  3RT3 B;  5BYR A;  2MP2 A;  2GMI C;  4K7U A;  3Q3N C;  1PQS A;  3N20 C;  4KSL C;  4RMA A;  3SHQ A;  2KMM A;  2WXN A;  3KQ4 A;  3P42 A;  4ZRJ A;  1Q10 A;  4DQO C;  3ZLZ A;  2PIA A;  2MBQ A;  2QIL A;  3PHX B;  4EOY A;  2KHW B;  3DOW A;  3I57 A;  1TS5 A;  1SB3 C;  2GRI A;  2DZJ A;  5DPS A;  2R2O A;  2C7H A;  5E6P A;  1SGH A;  2MEK A;  2HTH A;  5AUI A;  1TY2 A;  4ARI A;  1F2R C;  2NTT A;  1I4X A;  1V1O A;  3R7R A;  1E5W A;  2WXJ A;  3ZJT A;  2KYW A;  4XDD A;  2NBV B;  1YN5 A;  1DYQ A;  2C7M B;  2QEJ C;  5D3D A;  3V6C B;  2BWE S;  2N9X A;  2PVG C;  2KN4 A;  4HJK A;  2LVP A;  2QMT A;  1WM2 A;  2MHJ A;  1EWC A;  2BBC A;  2I1J A;  2IO0 B;  1HTQ A;  1E6E B;  4NJC A;  3Q3F A;  1L0X B;  2ZVN A;  2OHF A;  4AJW A;  1F52 A;  3NS1 A;  1LXD A;  3W1Y A;  3L08 A;  4IG7 B;  1KLV A;  2MP2 B;  4PK1 A;  5BYQ A;  3KUZ A;  4LJP B;  2D07 B;  2RD0 A;  2Z0E B;  1UUP A;  4MH0 E;  1HZ6 A;  2WGS A;  1PGB A;  2IGD A;  3VRB B;  1WZ0 A;  3K9P B;  3HK0 A;  2DYM A;  3DQV A;  4EZL A;  1RAX A;  3FC4 A;  5CHW A;  4MSM B;  5GMV A;  4JE3 B;  3QA8 A;  4M02 A;  2MJ3 A;  5BMI A;  1EWY C;  4LDT D;  2ZCC A;  3JSV B;  2INP E;  1QIL A;  5CX3 A;  4UDU C;  3MC8 A;  2JT4 B;  5AEK B;  1LO5 D;  5T8I A;  3W2D A;  1KJT A;  4A20 A;  1XLP A;  2K25 A;  4M01 A;  2QSD A;  1PUT A;  3VVW B;  2N1W A;  4ZRK A;  4KDL B;  3PRP B;  1BT0 A;  3SU8 X;  4RM8 A;  3QAQ A;  2DZM A;  5EE0 A;  2IGG A;  2KFK A;  1WXV A;  3PO0 A;  2KTR B;  2N7D A;  1NEN B;  2M17 A;  1OTR B;  2R2Q A;  5D7G A;  3VQI A;  1UGJ A;  5JZE B;  2OED A;  1YOV B;  5D3I B;  3NG0 A;  2NBU A;  3IAS 1;  1M4V A;  3WAN A;  2KMA A;  4RCO A;  2CHW A;  2N4F A;  1TZO A;  1R4N I;  1TBE A;  4MGK E;  1OFF A;  3O65 B;  3M95 A;  3O13 A;  4MGY E;  2O6V B;  2QCZ A;  2ZNV C;  3L4P A;  1RFK A;  1R4N B;  1N61 A;  2HDE A;  4OVZ A;  2BKF A;  1N63 A;  4MSQ B;  4AQ7 A;  3QWZ B;  5IN7 A;  4L23 A;  4W9K A;  3BYY B;  4M00 A;  2J4X A;  4DHJ B;  3DVN U;  2WWZ A;  2MRP A;  3HHM A;  2VZK B;  4CO7 A;  1SBB B;  4WWN A;  4RF0 A;  3ZXV A;  2KN5 A;  1SSN A;  3NHE B;  5BYS A;  2D3B A;  2LHD A;  1MPE A;  3Q3M C;  4AWJ A;  3P4S B;  5FK9 C;  3EHV A;  4DXF A;  2K8B A;  2K6Q A;  2LGI A;  3WAP A;  1CK1 A;  4KZ0 A;  3N32 A;  3AI5 A;  4NZL B;  3ETR A;  2Z59 B;  1WX9 A;  4LK0 M;  1GB1 A;  5EDS A;  2O2V A;  1TJE A;  2A5U A;  3A9J A;  4C80 A;  1D3Z A;  2IPK D;  3MP9 A;  3U30 A;  1UGM A;  1J7C A;  2N9K A;  3V61 A;  1MI0 A;  2MW5 A;  3ZO5 B;  4HCP B;  3KH0 A;  2KWD A;  2MA9 B;  2KDI A;  1ET9 A;  2GBR A;  2ZNV B;  1SIF A;  2KWV B;  2IJ0 A;  2MX2 A;  1TGZ B;  4YSZ B;  3N1X C;  4HJG E;  3AED B;  3DWM A;  4RGM A;  4B9K A;  2WX1 A;  3CSF A;  5FR6 A;  1K53 A;  2NVU I;  1I4Q A;  4WWO A;  2KTR A;  2ZW1 A;  4XGA B;  2WX0 A;  3NVZ A;  4EZK A;  2DAF A;  4FJV B;  2WXL A;  1IP9 A;  3OJ4 B;  1FD6 A;  2EMT A;  4A6Q A;  2FIF A;  3AM9 A;  1ACC A;  4US9 A;  5DPR A;  1JWS D;  2V9H A;  3PGE A;  5AZF A;  3J9C A;  3PLV A;  2O2V B;  1E8W A;  2AEH A;  2KQ4 X;  1P7F A;  4YL8 A;  1NEK B;  3QC8 B;  4LNK A;  2REX A;  3URY A;  2LEK A;  2PKO A;  4BZA A;  2J52 A;  2N7J A;  3N1Z C;  3FAH A;  1PDX A;  4ANX A;  1IGC A;  2LGX A;  2JYE A;  1V1P A;  1YMH E;  4A8X C;  2ZCB A;  1UZX B;  3N1Y C;  4K1R B;  1RWS A;  2NMQ A;  2PJH A;  2DYO A;  4ZOH C;  2WLB A;  3MTN B;  2UWQ A;  4W9F A;  3FKY A;  1WJ6 A;  1C79 A;  1I4G A;  4GMV A;  1TKY A;  1QOA A;  3Q3J A;  4FHJ A;  1VZ7 A;  4G11 A;  1FEH A;  3TEX A;  3RFZ B;  1XT9 B;  3EC8 A;  3ZKJ C;  2LUM A;  1TY0 A;  2V3N A;  4MAC A;  4W9C A;  1E7P B;  3HM6 X;  4CQN A;  2DNF A;  2JZP A;  1WF9 A;  3AEG B;  1YQ4 B;  1B9R A;  1F9J A;  2RSU A;  5KHO A;  2GOW A;  2KTF A;  2K9X A;  2XNA C;  2KT7 A;  4HKQ A;  3RD2 A;  4IC7 B;  2G4S A;  2DZI A;  4KZC A;  3PZ8 A;  3R8B A;  2WYQ A;  2YEP F;  1CZP A;  4M0W B;  2BS2 B;  2MCN B;  2JXX A;  3H8H A;  5D2M B;  4MGZ E;  3W5U B;  3JW0 X;  1A70 A;  3AU5 A;  1WJN A;  4L1B A;  1SF0 A;  2RPV A;  4A3P A;  3Q8C A;  2K5P A;  2JUO A;  4ICV A;  4KVG B;  1DOY A;  3GZN I;  4AP4 C;  1Q1O A;  3P2B A;  1ZXH A;  2BKR B;  1ZPS A;  5C1Z A;  1HXY D;  1JW9 D;  1V5O A;  3OWE B;  2IY1 B;  4A90 A;  2J0M A;  4US8 A;  4KKI A;  4F1S A;  2AQ3 B;  1QLB B;  4S17 A;  3ONS A;  4BOZ B;  3BK1 A;  4YWG G;  4A55 A;  1E7V A;  1C4P A;  2BTE A;  1GJZ A;  4KIK B;  1FRR A;  1XCQ L;  2LHE A;  1WH3 A;  2KO3 A;  4N58 A;  1QF6 A;  1UBQ A;  2BWF A;  1WYG A;  2BYT A;  1EM7 A;  1IUE A;  1VZ6 A;  4OHJ A;  2I1K A;  1WY8 A;  1ZW7 A;  2D5G A;  4J6I A;  1L5P A;  4G0N B;  4C00 A;  3DBR B;  3LXF A;  1A5R A;  4ANU A;  1C9F A;  2L8J A;  4B6W A;  3WAM A;  2KMC A;  2BS4 B;  5E6N A;  3LJ3 A;  2X8X X;  3A33 B;  4PYZ A;  3L16 A;  2M0A A;  2CJN A;  5H92 C;  2FUH B;  3VR8 B;  5JHA A;  3Q14 C;  4GIV A;  2DAJ A;  4X57 B;  4EEW A;  2E3T A;  2FUG 1;  3FIL A;  4W9J A;  3TEY A;  3SDL C;  2GBK A;  3RUI B;  4DWF A;  2BW2 A;  3MHZ A;  4HPM B;  2WDV B;  3UQA A;  2GBJ A;  3AEE B;  4IWO A;  5HFY A;  3DCG A;  5J17 A;  2LRW A;  4HPP A;  3IT6 B;  1WYW B;  3PV1 A;  3BVM A;  3I63 C;  1N62 A;  1SE2 A;  1Z2M A;  2K1F A;  2WNM A;  1XF5 L;  2KWC A;  2B76 B;  4KGS A;  1PGX A;  4DHJ D;  3HVD A;  4DDG D;  1WZ3 A;  1K52 A;  1QOF A;  2NPT B;  3QX1 A;  4ZDV A;  1KM7 A;  3DDC B;  4Q2J A;  3U52 E;  3N30 A;  1E9M A;  3UI3 A;  4KGT A;  1H4R A;  4OVU A;  3B08 A;  4HVB A;  4GOC A;  4ANV A;  4GGQ A;  2JWU A;  2ZPY A;  4OZB A;  1D5Z C;  4C4V B;  1XEE A;  3DHG C;  1ZOY B;  2WXP A;  2IY0 B;  5HHD G;  2NS5 A;  2SAK A;  1P0R A;  3E56 A;  2KQS A;  3RNE C;  3U4E G;  4HCN B;  3AE3 B;  3VTV A;  4HXD A;  5LLI A;  4G50 A;  1JRO A;  4WUR A;  2ICI A;  1KOT A;  2BYE A;  3S2A A;  3ZDM C;  4IWP A;  4HRS A;  4TQ0 A;  3ZUN A;  1AWD A;  4LNN A;  2J7Q B;  1FXI A;  2O6V A;  3ZJV A;  1TKE A;  4HEA 1;  4OW0 A;  4RF1 A;  4G3X B;  2ZPN A;  1WGG A;  5IOI A;  3QK0 A;  4WQM A;  3NY5 A;  5GXG B;  1NYR A;  3PTF C;  4FUL A;  2GB1 A;  4EKU A;  1G6J A;  3MFG A;  2WS3 B;  1TT5 B;  3R66 C;  2M56 B;  3MC0 B;  3Q8A A;  3RNG C;  1WXM A;  1H8C A;  3A4R A;  2DHZ A;  3EFU A;  2L05 A;  1LM8 B;  2KZR A;  1CMX B;  1ZDV A;  4BOS C;  3QAR A;  3IHP C;  1KLU D;  4FJZ A;  2J0K A;  2EEL A;  1L6V A;  3L0W B;  4B0E A;  3JVZ X;  4C7Y A;  1WE7 A;  3UIP B;  3JSV A;  3VDZ A;  4JWU C;  1Q5W B;  4JWS C;  3DHI C;  2HTM E;  2JPH A;  2D10 A;  2KFK B;  2LVQ A;  4GDL B;  3B2F A;  2RPQ A;  3T3N A;  3H7S A;  1Q0W B;  1MG8 A;  4LTU A;  3BIN A;  4HPL B;  2N1V A;  1UD7 A;  1GAQ B;  1GNU A;  3V05 A;  4JIO U;  2XN9 C;  3ZXR A;  1VD2 A;  1L0V B;  3GOE A;  4MEL A;  1Y8R C;  4RH6 A;  2KXJ A;  3W1S A;  2YLM A;  1KF6 B;  2V1Y A;  5J2R A;  1WXS A;  2KVR A;  2K6D B;  3P4P B;  4C4V A;  2E6X A;  2L0T A;  3H7P A;  4TUU A;  1OEY J;  4N9F 4;  3ZNI D;  2UYZ B;  1GC6 A;  1HA5 A;  4RGN A;  2MBH A;  2K8C A;  1TS2 A;  1YNT E;  3KLS X;  3VAW A;  3KUC B;  2Y5B B;  5EE1 A;  1B1Z A;  3BY4 B;  3P4R B;  2JZZ A;  2LGY A;  5I4D A;  4RNA A;  4LJO B;  4W9G A;  3TEZ A;  5JXV A;  3LDZ E;  4P7I A;  4E74 A;  1T5X D;  2KWU B;  4DHZ E;  1NYQ A;  3QIJ A;  1FXT B;  4ZRI A;  2L52 A;  4DK5 A;  5J18 A;  1CQV A;  2WDT B;  3B2G A;  3ECI A;  3AE7 B;  1I4R A;  2BVC A;  1F0Z A;  3BZD B;  3PVL A;  5G55 A;  2KLG A;  4WWM A;  3CST A;  3AN1 A;  4GXB A;  3PZ7 A;  4K3C A;  1HZ5 A;  4W9I A;  4HDO A;  4NJ7 A;  2AL6 A;  2JXT A;  4RGT A;  2AX5 A;  1P3Q U;  3AE1 B;  1DGJ A;  4P6V F;  2JRI B;  1JWU D;  3OAW A;  2KC2 A;  3M3J A;  1VJK A;  3IFW B;  3IAM 1;  2I2Y A;  3L13 A;  2IO3 B;  3LB8 C;  2KDM A;  3UF8 A;  1SJH D;  3APD A;  1ZKH A;  4XYC A;  2KX3 A;  5D94 A;  4AJY B;  3V6E B;  2KAC A;  2W55 A;  1VR9 A;  1PFD A;  1D6E C;  4HRO A;  2CKH B;  2KJH B;  4KSK C;  2LJ5 A;  1QOG A;  5HKH A;  4PS8 A;  2G4D B;  3KYD D;  1MHH E;  2CR5 A;  4JX1 C;  3HVZ A;  4YSX B;  1RRB A;  1HTO A;  3PS6 A;  1PGA A;  4B95 A;  3U2S C;  4YSY B;  5LXH A;  3WA0 A;  3JYU A;  1C1Y B;  2ASQ A;  2MBE A;  4RM9 A;  4KGR A;  1I4H A;  4OVV A;  2ONQ A;  1SE3 A;  2VH2 A;  4IUM B;  3IT4 B;  1K8R B;  1D4B A;  3TEW A;  3EUB 2;  2QHO A;  2KK8 A;  1QQR A;  1YQB A;  3Q8B A;  4II3 B;  1TKG A;  3L54 A;  1FO4 A;  2J53 A;  3AXC A;  1V2Y A;  4KDI C;  3UQB A;  2W3R A;  1L4D B;  1TS3 A;  2PLP A;  1KH0 A;  4W9H A;  3UIO B;  4EFO A;  4H2A A;  3UGB B;  4WJO A;  3GS2 A;  4BAX A;  4IKG A;  2IO1 B;  2W54 A;  1HEZ E;  2KAJ A;  3VXW A;  3KW5 B;  3A4S C;  4LNO A;  3IG3 A;  1FFV A;  2DX5 B;  2R61 A;  3U7Z A;  2RMM A;  1T0Y A;  2C9W B;  3GE8 C;  4BKG A;  4DXG A;  1P9D U;  1EU4 A;  3APC A;  1FPY A;  2RDG A;  1IYF A;  1RM6 C;  3RMK C;  2KVZ A;  3RPF C;  5D6J B;  5LXI B;  3RCZ A;  3T8M A;  3PZD A;  3WCQ A;  2NR2 A;  4XDC A;  4NPN A;  4C56 C;  3BVZ A;  5LNK 1;  1JCK B;  4F7Z A;  3TBL D;  1WX8 A;  4BVU C;  3P63 A;  1NDD A;  2K22 A;  1WJU A;  2LUE A;  2D3G A;  3ZIM A;  2EKI A;  2CS4 A;  4ZYN A;  2FCS A;  1WM3 A;  1V80 A;  3BWU D;  3Q6B A;  1KFY B;  2V4L A;  2VRR B;  2ZVO A;  4MM3 A;  3ENE A;  3ZRC A;  2CHZ A;  4XE0 A;  3QQ8 B;  4ICU A;  1FFU A;  2W9N A;  1IBX A;  2KJ6 A;  2N9E B;  4WIP A;  5JH5 C;  1UBI A;  1XD3 B;  4RFB A;  1F1H A;  2H89 B;  1UEL A;  3ZNZ B;  2EMS A;  4DHZ B;  2JRH A;  3H6N A;  2L0F A;  2BYF A;  3H7P B;  2MJD A;  1LGR A;  2YEP B;  3ZGZ A;  3Q8F A;  3VUX A;  2N9P C;  1GPX A;  2WDQ B;  3ZJU A;  2NCN A;  3KUD B;  3ZDT A;  4N59 A;  4NAW B;  3PT2 B;  4JGH B;  4EUT A;  5DCN A;  1P98 A;  2AYO B;  2VZK D;  2L7R A;  3NZ3 A;  2FE8 A;  1YIW A;  3TJP A;  3KWV A;  3I9V 1;  4YXD B;  1P1A A;  1FIQ A;  5MPO A;  4C7Z A;  2WU2 B;  2JVC A;  3W5V B;  4CHK A;  2B3A A;  1D5X C;  3PHW B;  4M0W A;  3A1Q A;  3AEB B;  3ZQ4 A;  2M4N A;  3ABV B;  3Q2A C;  4M8M A;  4CYE A;  1YJJ A;  2MBO A;  1P7E A;  2WXM A;  5H8Y E;  4D2K A;  1QT9 A;  3EFC A;  2BYV E;  4MM3 B;  1SEB D;  2K3U A;  1EF5 A;  1T3Q A;  1XXG A;  2KLC A;  1EO6 A;  3SEB A;  2WXQ A;  1T6B X;  1FXA A;  3AH7 A;  3QJZ A;  5L95 C;  4MJS A;  4A9A A;  3PRZ A;  1MFW A;  1MJD A;  4FHK A;  3ZTD A;  4PS7 A;  2JYT A;  1UF0 A;  1WXA A;  1SE9 A;  5IA7 A;  3VTW A;  3U8Z A;  4JPS A;  3TL5 A;  4K7S A;  2HJ8 A;  3GP7 A;  2RDH A;  2WP9 B;  1SE4 A;  4O1N A;  3GB1 A;  3NZS A;  2KC1 A;  4FLH A;  3PLU A;  1WRD B;  1FNU A;  4IM3 A;  4A3O A;  3C8Y A;  1L4Z B;  4GDL A;  1Y56 A;  1KLG D;  2KDE B;  2JZ3 B;  3TIX A;  5G2N A;  1AW7 A;  1YJI A; 
#chains in the Genus database with same CATH homology
 1TIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...