1TIFA

Translation initiation factor 3 n-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
b'KDFIINEQIRAREVRLIDQNGDQLGIKSKQEALEIAARRNLDLVLVAPNAKPPVCRIMDYGKFRFEQQKKEKEARK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION INITIATION FACTOR 3
publication title X-ray crystallography shows that translational initiation factor IF3 consists of two compact alpha/beta domains linked by an alpha-helix.
pubmed rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosome binding factor
total genus 24
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1995-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05198 IF3_N Translation initiation factor IF-3, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.80 Alpha Beta Roll Ubiquitin-like (UB roll) Translation initiation factor 3 (IF-3), N-terminal domain 1tifA00
1TIFA
chains in the Genus database with same CATH superfamily
4MT5A 1HA5A 4IWOA 3VTVA 1TYGB 4LNKA 4REZA 1D6EC 3AH7A 3MP9A 4WWPA 1UUPA 3SFEB 4P7IA 4US8A 3PSEB 3DVGY 3KUCB 3P42A 1FNUA 5BYSA 2LVOA 1AN8A 1XT9B 3IT4B 3R2IA 5C3JB 5DPRA 2RGFA 3PT2B 1TKYA 2FAZA 2OEDA 3EFUA 3JYUA 5G2NA 1H8CA 1WRIA 1SF0A 2NCNA 2Q5WD 3VXWA 1JQ4A 4MDKE 3L16A 3QAQA 5L95C 1WYWB 2JY6A 3HIZA 2KN4A 3RT3B 2PE6B 2L0TA 3W1SA 2WXNA 3FAHA 1SSNA 2C7MB 3RZWC 1HXYD 4FXCA 4LTUA 5E6JA 1P1AA 3GE8C 4A6QA 1WIAA 3UINB 4HLEA 2KC1A 4RMAA 1E8WA 1PGBA 4HPLB 3RYTA 2NMQA 2XK5A 2FCSA 3VQIA 1WXAA 2MSED 3AE9B 1UGMA 2GB1A 2ZNVC 5E6PA 3AECB 2O6VB 2IJ0A 3FILB 4WJNA 2D11A 1GAQB 3QK0A 2LHDA 4LNNA 1FMAD 2KMCA 1E8ZA 3N3KB 2V0GA 2DZIA 4JL9A 5E6OA 3RNBC 3W5UB 1NI2A 1XCTL 2QSDA 3W5VB 4A20A 1A5RA 4FHKA 2G1EA 4GLSC 2ZCBA 2WXRA 1L2NA 4B6WA 3QC8B 3APFA 2GBNA 2D3BA 4IUMB 1QQRA 5EE0A 3Q8BA 2ICIA 2N7EA 5BYRA 1EUVB 4M8NA 2GRIA 2LVQA 3BVZA 1QKZA 4M00A 4HPPA 1SBBB 2WLBA 1C4AA 4LCDE 5FKAC 4LK0M 4LJOB 3R7RA 2KMAA 4YTPB 4RF1A 3Q14C 1E6EB 3DHHC 3OAWA 2KFJA 4KGTA 3W9CB 1XO3A 1TTNA 2INDC 2WXHA 3L08A 2UYZB 4IM2A 1TY2A 2JZ3B 1WY8A 3H1UA 3NVZA 4MEMA 1SE9A 5BMHA 5J17A 2IPKD 2ZVNA 2X38A 1I42A 1JMLA 3E9SA 2BBCA 3U7ZA 3H9DA 3ZKJC 2WS3B 4MH8A 2FCQA 1FFUA 2KDEB 4LNIA 4Q2JA 4ICVA 3U7DA 4JE3B 5H92C 1TZ1A 1MVKA 1ZPSA 4WWOA 1N61A 3W2DA 2CU1A 1E0ZA 1JALA 1E7UA 1Q10A 4GSWA 3AEGB 1GB1A 2JU6X 2L32A 1ZGUB 4PYUA 1YN4A 2LHEA 4RCOA 3QCAA 2HJ8A 3PS6A 1UBQA 1A70A 3KLSX 3AM9A 2PMVA 2QIEB 3L4PA 4E71A 3ZNHB 2K6DB 2MBHA 2LASA 2N7JA 3IAS1 3ABVB 4ZOHC 3VH4B 2KMMA 3D32A 4PT5A 4QAYA 2KJ6A 5CTRC 2KACA 2PLPA 2LMCA 4F1SA 5FK9C 4LLGM 1G6JA 2VH1A 1MPEA 2KWVB 4BKSA 3AEDB 2NBUA 1WE7A 1EF1A 1AWDA 3ECIA 3KVFB 3A9KB 5BMGA 1HQRD 1PQSA 2IO3B 2KZRA 1OGWA 2OHFA 1TS4A 4FHJA 1D5XC 3AV8A 4M01A 4NNJB 1I7HA 1UWMA 4BBNC 3EGRA 3U4EG 4BKGA 2M19A 1SEBD 1WI0A 1IBXA 4YSXB 4DHZE 3URYA 1C3TA 1D4BA 3Q8CA 3KW5B 1T0RC 4ASWC 2N9LA 3TBLD 3SD5A 5EE1A 2KD0A 3MFGA 2PJHA 4NAWA 3NVVA 1CMXB 2N1WA 4DK5A 3IHPC 1GJZA 4F8CB 4OVUA 3VUYA 1EF5A 4KZCA 1V80A 4K7UA 2INNE 1BUIC 3LB8C 2O6VD 2MQJA 3U30A 4PS8A 3ZNID 5EE3A 4II2B 4GDKA 1ESFA 4AQ7A 2ACZB 4H2AA 3CMMB 3OLMD 1FD6A 2I38A 2KXJA 4FJVB 2QHOA 1HTQA 1JWMD 1TJEA 4G0NB 5GXGB 1DOIA 3NZ3A 2MCNB 3W1SC 1JWBD 2IGDA 3OWEB 4LDTB 2K8CA 1V5TA 1RAXA 4CYEA 1KLGD 2L7RA 1B9RA 1TKEA 4ANUA 4E3CA 2EMSA 2NTTA 1NVID 1RWSA 1UBIA 3L0WB 1LXDA 5J18A 3J9CA 1SGHA 2KLCA 2QILA 1ZDVA 3PGEA 1SIJA 3TJPA 2HDEA 2RR9A 3KYCD 2Y5CA 4ZHOA 2M1MA 2ONQA 1XXGA 3X0WA 3VH3B 4ANWA 3Q8AA 2MBOA 5IAAC 2MJDA 2K39A 2M0AA 1KRHA 1NENB 2MBQA 4BBNF 1WYGA 2LGIA 4IKGA 4ANXA 2J7QB 2XEWA 5AZFA 4HCPB 1K50A 2KANA 4B95A 4MH0E 3CF6E 1ZW7A 2B3AA 1QOAA 1OTRB 3A4RA 3U52E 2JRHA 2M17A 5G5GA 3UF8A 5CX3A 2IGHA 3PZDA 4FA6A 1LO5D 5CHFA 3HVZA 2JSVX 4JQWC 5I4DA 3N1ZC 1F52A 3TSSA 4ARCA 3NVYA 2N4FA 2BYVE 3QQ8B 3TCAA 3RFZB 4WQOB 3Q8FA 1N62A 5L83A 4X57B 2I2YA 4HPMB 1F77A 1FNWA 1WGHA 2DZKA 2J4XA 5IO9A 1IBXB 1VRAB 3ZDMC 5GMVA 1UZXB 2LGXA 1JWSD 3DVNU 4FLHA 4DXGA 4KZ0A 1WWTA 2ZJDA 2LRUA 2Z0EB 3IT6B 2AX5A 2LEKA 3PPAA 2BYEA 2LRWA 3ZIMA 3AXCA 2GBKA 3B0AA 1T0YA 3DPDA 4A90A 2B76B 3TMPB 4ZRQA 5JZEB 4NJ7A 1TY0A 2WXGA 1IP9A 2K3UA 4W9CA 1L5PA 2WXLA 3Q3JA 1Q5WB 2BYTA 2GBRA 1TIFA 1YQBA 4TKNA 2NS5A 1S3SG 2N1VA 3P4QB 2DENB 2Y5BB 3R66C 3Q3NC 5LNK1 4L2YA 3FC4A 1LQBA 3V60A 1AARA 1FO4A 3VTUA 1WGYA 2BS2B 1QOGA 3BWUD 1C76A 4ZRJA 2YEPB 2V3NA 1P7FA 2WXJA 3WALA 2AQ2B 4EOYA 1FRRA 3ZJTA 3RI7C 1CJEA 2RMMA 4KIKA 2ZNVB 1DOYA 2AL6A 5J2RA 1F9JA 2DBYA 2MH7A 2V3SA 3MC0B 5TSSA 5DPTA 3V6CB 4HEA1 3ZTDA 3DBLB 3PRPB 1V1PB 2IZVB 2WDVB 3C19A 3MC8A 3MHSD 2KDIA 3ZO5B 1VCBA 1PYWD 3BVGA 4DXFA 1HZ5A 3AE4B 3MJ5A 3A4SC 3PVLA 3RNFC 2PEAA 3JSVA 2EKIA 3N32A 2BS3B 2LJ5A 2KDMA 3TIXA 1QOBA 2HTHA 4DDGD 4RH6A 1DYQA 5IN7A 3AEFB 1U4AA 4URKA 3QARA 2K22A 3NG0A 2EKEC 3NZUA 4B0EA 1P3QU 2H89B 1R4MB 3AU5A 1IPGA 3WAPA 3P4RB 4CQNA 1D3ZA 4BOZB 1RLFA 1TBEA 3WA0A 2HTME 1YJ1A 2KWCA 4ZDVA 3SFDB 3LDZE 2OJWA 4US9A 1MHXA 4S0RA 3AE6B 3BYTB 2BPSA 3BYYB 1V8CA 4XWWA 2J0MA 2DYOA 2JZZA 3V05A 4ARIA 2KO3A 5DPWA 1EWCA 2D3CA 2WDTB 3RNGC 1MI0A 3ALBA 4EKUA 3I63C 2Y3AA 3VUXA 3MTNB 4EUTA 1E9MA 3DBLI 5AZHA 3PTFC 4RNAA 4RM8A 5MPOA 2K9XA 4IM3A 1JRPA 5JH5C 2UU7A 4IOIE 1AW7A 1FXAA 4HDOA 4BKSD 2CJOA 4FBJB 4MGIE 1UELA 1WGKA 1JWAD 1KFYB 3K9OB 3UQAA 4EE2A 3ZDTA 5E6NA 5LXIB 2IGGA 1WE6A 3NZSA 2FE8A 1HEZE 4GDLA 2JYTA 4XZ4A 4PK1A 3VTWA 4OHJA 1IUEA 1RFKA 2DYBA 1KLUD 1FIQA 2MJEA 4YWGG 1R4MI 5AUIA 1YN5A 1VJKA 4HWIB 4PS3A 3A1QA 1KM7A 1ZXHA 2UWQA 1J7AA 1EU4A 4RGNA 1E7VA 1P98A 3VRBB 3NS1A 3K9PB 3PRZA 2C60A 2QC8A 4K3CA 4YSZB 3LYYA 3ML8A 2KTRB 3M63B 3SHQA 5G5HA 4DHJD 1ZUD2 3PV1A 2CS4A 2L76A 2AQ3B 2WXPA 4G11A 1I4HA 5HHDG 1HZ6A 3M3JA 3CWIA 3GE3C 2KWUB 2PKOA 2HJ1A 3NJTA 3T3NA 2DAFA 2KQSA 1L7YA 4N9F4 2N0SB 3WAMA 2PW9A 1VZ7A 2BKFA 4OVVA 2R2QA 5FR3A 5AUKA 3FKYA 2L0FA 3AE5B 2BQQA 4A55A 4A3PA 2JX5A 1P9DU 2C7NB 1S1QB 3MC9A 4OZAA 2V3PA 3ZW3A 1FM0D 3LJ3A 5IP4D 1P7EA 2GOWA 2CJNA 4TSSA 2YEPF 4WIPA 1KTKA 2DLBA 2JWZA 1FXTB 4NQKE 3ZNZB 2KTFA 3V6EB 4YXDB 2KJHB 1TS3A 1XLQA 1L6UA 5C23A 2K6QA 1UD7A 4NQLB 1OEYJ 3RCZA 2OJRA 1WZ0A 1SIFA 1HE8A 1KOTA 4C4VA 2CHXA 2KQ4X 4KKJA 3ZXVA 2CR5A 3ONSA 3T8MA 3T9LA 2IYDB 2FUG1 1YIWA 1WGRA 4OZCA 1HTOA 1ENFA 1ET9A 1C79A 1SE2A 3KH0A 5C2TB 1VDVA 3ZGZA 1K51A 1XLOA 2WXMA 4ACFA 2WDQB 2WHIA 2XK5B 3Q2AC 2MWSB 1I4QA 3TUOA 1V6EA 4KDLB 2E6XA 5JHBA 2L52A 5T8IA 4IWPA 4KSLC 3O13A 1WR6E 2LUEA 2GLSA 1L0VB 1NYQA 1V86A 3C0RB 3GB1A 3M62B 3IBEA 2GBMA 1ACCA 1WZ3A 4P1CC 2V4IB 3Q8EA 2NTSA 4G3XB 4C00A 2E3TA 4TV3A 3R7QA 2M0XA 1N5WA 2NBWB 1L0XB 4GDLB 1M94A 2D2QA 3RNEC 5CHWA 3AE7B 1J8CA 2AWTA 2K8HA 3ZTCA 4IC7B 4LJPB 2D3GA 3A1QB 4IM0A 1WM3A 2WWZA 1K8RB 2WGSA 3T3OA 4WQMA 4KV2A 2L8JA 2KK8A 4XGAB 3AEBB 4RGTA 4K3BA 1J19A 4AJYB 5D2MB 1E8XA 3P4SB 1JRUA 3ZUNA 2BW2A 1ZP0B 3PHWB 4W9JA 2LD9A 3P2BA 4RFBA 4WWNA 2M4NA 1SE3A 4GXBA 3Q69A 1WX9A 1PDXA 2L1AA 1EU3A 1K53A 4MGKE 2N9PC 2DZMA 1GOZA 4JIOU 3QA8A 1WFYA 2WYQA 4EEWA 5BMIA 3H8HA 3ZNGC 3PZ7A 4NPNA 3UI3A 1E7PB 3PRMB 2WU2B 2PE9A 3H6NA 2QMTA 4AWJA 3VDZA 1VZ8A 1XLPA 2JWUA 5LXHA 3IFWB 1GPXA 2M8SA 2SEBD 4N6EB 4DXAB 4OW0A 3HM3A 3BK1A 3A33B 1V81A 1JW9D 3OJ4B 4EZKA 3CSTA 2WP9B 2FIDA 4TMAB 3VVWB 3B08A 3EFCA 4K81A 4B9KA 2KYWA 5H8YE 4W9FA 3Q6BA 1RYJA 1STEA 2K5PA 2WX0A 1XLNA 1J7BA 4M0WA 3ZQ4A 2MEKA 3APCA 2MA9B 4HRSA 4L1BA 2ZZPB 4B0MA 4NZLB 1QF6A 1WGDA 4C4VB 1PGAA 3DQVA 2GBJA 1NEKB 1XQQA 4RF0A 3UQBA 2FUHB 1MFWA 1I4RA 4TUUA 4MACA 4AP4C 4II3B 4W9GA 1NDDA 3AEAB 2KX3A 3PHXB 2ZCCA 4HROA 3ETRA 1WGGA 5D3DA 4WAAA 3QJZA 1L0YB 3RPFC 1WRDB 4YTNB 2BYFA 4GMVA 1C78A 1MHHE 4WAFA 3TEWA 4XYCA 3EC8A 4ICUA 1F1HA 2D10A 3R3MA 4WJQA 5IOIA 2DHZA 5EDSA 4K7WA 3TEYA 4S17A 1TS2A 3KWVA 1WJ4A 2INPE 3CSFA 4GU2A 2KLGA 1WJUA 3HUIA 1KLVA 3IAM1 2JQRB 4LNFA 2AQ1B 3PLUA 3HM6X 4NAWB 2LFIA 4J6IA 1WXSA 1Q0WB 2ZVOA 4USAA 1V2YA 1TZOA 2KQ7A 1Z2MA 1WM2A 4JLCA 4JWSC 4LNOA 2IY1B 4DHJB 4OVZA 2CKHB 3I5JC 2LZ6A 2BF8B 3IVFA 4D2KA 1KH0A 2G9HD 3B2FA 1GC6A 2JVCA 3FILA 3Q3FA 1ZOYB 4R3DA 1B1ZA 4BOSC 2HE7A 3BZDB 2R2OA 3GS2A 4GDKB 2W54A 4NJ6A 3AU4A 2IDYA 4HDQA 4E74A 2RDHA 2WX1A 1ZDXA 2WDRB 1VZ6A 2RDGA 2LGDA 5JXVA 1IGDA 4CHKA 5D6JB 3ZRFA 4K7SA 3LXFA 1X1MA 4PS7A 1QLBB 2K25A 1QOFA 1UH6A 3QX1A 5KHOA 2WQYB 5JHAA 1FFVA 3MHZA 1BT0A 2N7DA 3ZJVA 1VD2A 2GMIC 2CU3A 2C9WB 4XX5A 3DDCB 3PZ8A 3DHIC 2BWES 1E10A 2DX5B 3RMKC 2L00B 4IWQA 1JWUD 2QEJC 2XBBC 2Y5PA 4XDCA 1C4CA 3N9YC 4KDIC 4BZAA 3AE3B 1YX6B 4ZHPA 4BFRA 2AEHA 1YD8U 1IYFA 2I1KA 4KGSA 4RGMA 3S2AA 4N59A 4WURA 2MBBB 2KC2A 4IG7B 1WH3A 4G50A 2GI9A 1I4XA 2PVOD 3WANA 4DDID 1VLBA 1WF9A 2EMTA 3AN1A 3PLVA 4GGQA 1XD3B 3N1YC 4DHZB 5D7GA 2LUMA 4DQOC 4MSQB 1NYRA 3ENEA 4M02A 1NI3A 2KDFB 2R61A 4WH4A 1OQQA 2DNFA 1WR1A 2W3SA 2G4DB 4HK2A 1FPYA 4HCNB 3EUB2 1H4RA 1Y8RC 2JPHA 2JT4B 1PGXA 5FR6A 2Z0DB 2A5UA 1ET6A 5LLIA 4WJOA 2IBIB 4XC2A 2PPHA 1J7CA 3DBHB 4KGRA 1I4PA 2LWPA 2BGFA 4NY0A 3A9KA 3QIJA 3V61A 2FNJB 1N63A 2MBEA 3A9JA 2KN5A 2JXTA 2JRIB 2O2VA 3O65B 4BAXA 4TQ1A 1XF5L 3P1MA 5DCNA 2D07B 2FIFA 2RPVA 2DYMA 4P6VF 2QJLA 2WXFA 4MGYE 4A3OA 5BO4B 2V1YA 1YOVB 1OQYA 4PYZA 4RM9A 3JVZX 4JX1C 4EZLA 3Q3OC 2MJ3A 4XE0A 1MJDA 4C56C 3ML9A 2KKCA 1C77A 2MW5A 4K1RB 3H7PA 1GG3A 2JXXA 1QZEA 2EELA 3PO0A 1ZKHA 4ZYNA 3RD2A 1UF0A 3DBSA 1F0ZA 3HHMA 4GOCA 4GB9A 2NVUI 3DCGA 2OOBB 2D3AA 2YVCA 4C80A 1IGCA 3ZRCA 2LXAA 2X8XX 2IY0B 4KIKB 5TR5A 2W9NA 3NOBA 2ZPNA 4ZRKA 2J53A 1L4DB 5AEKB 2RD0A 1OFFA 2MP2A 2LJIA 1YJJA 4JPSA 2LI5A 4W9KA 4HJGE 1T3QA 3DBHI 3DBRB 1RFAA 3B1LX 4A9AA 3UIOB 3VRAB 3AE1B 2LGSA 3C8YA 1TT5B 3JSVB 2BVCA 3WIMA 3L13A 1C1YB 2PTLA 5HG2A 2CHWA 4FADA 5C1ZA 1UGJA 1T0QC 4W9HA 2BTEA 4AJWA 2N9KA 4AUQC 4MM3A 1UNSA 4UDUC 1FNVA 3BIID 1PUTA 2VZKB 2KFKA 3DVGX 3ZLZA 3SDLC 1BMLC 4BVUC 2WXOA 3B9JA 1WMHA 4W9LA 1V5OA 3UGBB 3RZFA 4JWUC 3KWLA 1SE4A 4MJSA 3GZNB 3CIRB 1LGRA 2G4SA 4FN2A 3N30A 3X23A 2QDFA 2V4LA 3DVNV 1JROA 1M4VA 1EWYC 3GOEA 4W9EA 1LM8B 2N9EB 4KX6B 1YQ3B 1FCCC 1WX8A 3HRDD 2VH2A 1SJED 3VFKA 2BKRB 2KDBA 4XDDA 4KVGB 4RGOS 2BB6A 3RULA 3N20C 2D5GA 4DWFA 1EO6A 3RNAC 4A8XC 1GB4A 2VRRB 1ZE3D 4HKZE 2N9XA 2WXIA 2DWQA 4WWMA 3NHEB 3ZJUA 1DOXA 1OQRA 2G45B 2ASQA 3TEXA 4WJPA 2J42A 2W55A 2WU5B 1L4ZB 1TKGA 2KNBA 3DBRI 1RM6C 3HVDA 3ZVVA 3A9JB 2BT6A 3NRZA 1BXTA 2O2VB 3DWGC 3BY4B 2ZPYA 4ZRPA 2K0PA 1UWXA 2QCZA 3B2GA 2FCNA 4EFOA 2CHZA 2ON8A 2L05A 2FBWB 2NPTA 2Z59B 4AS1A 5D3IB 4MELA 5AZGA 3IG3A 3NS8A 4OZBA 1YJIA 5KHQA 2IO2B 1DGJA 3DHGC 3AE2B 1C4PA 3H7PB 1C9FA 3GZNI 5HI1A 1D5MC 1YQ4B 1LFDA 4ANVA 3V62A 1GC7A 2K8BA 1OEYA 1K52A 4YT0B 4CO7A 4MGZE 3NY5A 1TGZB 2J52A 1QILA 3TEZA 1WX7A 1ISNA 4O1NA 3L17A 4M8MA 3QWZB 3U8ZA 4KSKC 3EHVA 2SAKA 3WAOA 3R2TA 2BWFA 4I6PA 1QT9A 1SB3C 2WNMA 4I6NB 1WXQA 2MP2B 4I6LB 2WXQA 2ZW1A 2I1JA 2RSUA 3P4PB 3EECA 5BYQA 4GIVA 3SEBA 4JGHB 1F2RI 3Q3MC 2TSSA 1YMHE 4J3OD 1KJTA 4IW0A 4P1BC 1J0GA 2INCC 1R7SA 2XNAC 4ZYSA 1F2RC 1WJNA 3SR6A 2KT7A 3AB5A 2KOXA 4MM3B 3WCQA 2DZJA 4EZJA 4MSMB 3KUDB 3RN9C 2KFKB 4YSYB 4XWTA 3PREA 1FXIA 2AYOB 2JYEA 1V97A 1PFDA 1WMHB 1V1PA 1P0RA 3JW0X 3APDA 2KJRA 2WXKA 4MJSB 3NUHB 3VR8B 5D94A 3HK0A 4C7YA 1WXVA 3I3TB 1SJHD 1N6ZA 1T6BX 1Z5SB 4NJCA 1YN3A 1EM7A 3RUIB 4FJYA 4W9IA 1SXTA 1Y56A 4HKQA 4W9DA 2IO0B 4BKTA 2VZKD 2W3RA 3V3XA 3I57A 2RDBC 5HKHA 5G55A 3IXSA 1R4NB 3VUWA 2REXA 1CQVA 2XN9C 1Q1OA 3L54A 1TS5A 1MG4A 2KX0A 1CK1A 1RRBA 2AL3A 3E56A 1YNTE 3UIPB 2A4ZA 4KKIA 1XEEA 1N60A 2J0JA 2KVRA 4F7ZA 3L10B 2DAJA 2FCMA 2LVPA 2L3ZA 3BK2A 2RPQA 1V1OA 3OJ3A 1MG8A 2KWDA 1L6VA 3MJWA 2V9HA 2KAJA 4FJZA 3RNCC 3BVMA 2MX2A 1WSPA 2NPTB 4YL8A 2NBVB 2LXCA 2O6VA 4C7ZA 4FULA 4HVBA 4N58A 1FEHA 4ZRIA 2YLMA 2Z8LA 3P63A 1GUAB 3TL5A 2MRPA 2JF5A 3DOWA 2C7HA 2PIAA 1T0SC 2JZPA 3U2SC 1FCLA 2L83A 4AOFA 3R8BA 1NBFC 3M95A 3KQ4A 4IDIA 4ITKA 2J0KA 3NVWA 4HXDA 5EE9A 2NR2A 3ZXRA 4NAMA 3OG5A 1GNUA 2G3QB 1WXMA 1JCKB 2KHWB 2MHJA 3SU8X 1FRDA 1R4NI 3KYDD 1I4GA 3AE8B 2LGYA 5CHVC 5IKCM 2ZEQA 4GN1A 1N5XA 2PVGC 2HD5B 5HFYA 3GP7A 3BINA 1WJ6A 1ZXIA 4YTMB 1D5ZC 2KTRA 1E90A 1V49A 3QHTA 5IA7A 3ZYYX 3AI5A 3N1XC 4HJKA 2C5LC 3I9V1 3W1YA 1AYFA 3VAWA 2BB5A 4L23A 4TQ0A 3KUZA 3H7SA 1ROEA 5DPSA 1VR9A 4M0WB 1V9JA 2MLBA 3AULA 3AMZA 4DBGA 3AEEB 2W82A 4P16A 1I35A 1T5XD 2M56B 1CZPA 3EA6A 2H88B 3VHTC 2BS4B 3VR9B 2KVZA 3DWMA 1E8YA 2JUOA 2ZW0A 4LDTD 1XCQL 2IO1B 1E5WA 2K1FA 1KF6B 1YX5B
chains in the Genus database with same CATH topology
1TIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIF A; 
#chains in the Genus database with same CATH topology
 4MT5 A;  1HA5 A;  4IWO A;  3VTV A;  1TYG B;  4LNK A;  4REZ A;  1D6E C;  3AH7 A;  3MP9 A;  4WWP A;  1UUP A;  3SFE B;  4P7I A;  4US8 A;  3PSE B;  3DVG Y;  3KUC B;  3P42 A;  1FNU A;  5BYS A;  2LVO A;  1AN8 A;  1XT9 B;  3IT4 B;  3R2I A;  5C3J B;  5DPR A;  2RGF A;  3PT2 B;  1TKY A;  2FAZ A;  2OED A;  3EFU A;  3JYU A;  5G2N A;  1H8C A;  1WRI A;  1SF0 A;  2NCN A;  2Q5W D;  3VXW A;  1JQ4 A;  4MDK E;  3L16 A;  3QAQ A;  5L95 C;  1WYW B;  2JY6 A;  3HIZ A;  2KN4 A;  3RT3 B;  2PE6 B;  2L0T A;  3W1S A;  2WXN A;  3FAH A;  1SSN A;  2C7M B;  3RZW C;  1HXY D;  4FXC A;  4LTU A;  5E6J A;  1P1A A;  3GE8 C;  4A6Q A;  1WIA A;  3UIN B;  4HLE A;  2KC1 A;  4RMA A;  1E8W A;  1PGB A;  4HPL B;  3RYT A;  2NMQ A;  2XK5 A;  2FCS A;  3VQI A;  1WXA A;  2MSE D;  3AE9 B;  1UGM A;  2GB1 A;  2ZNV C;  5E6P A;  3AEC B;  2O6V B;  2IJ0 A;  3FIL B;  4WJN A;  2D11 A;  1GAQ B;  3QK0 A;  2LHD A;  4LNN A;  1FMA D;  2KMC A;  1E8Z A;  3N3K B;  2V0G A;  2DZI A;  4JL9 A;  5E6O A;  3RNB C;  3W5U B;  1NI2 A;  1XCT L;  2QSD A;  3W5V B;  4A20 A;  1A5R A;  4FHK A;  2G1E A;  4GLS C;  2ZCB A;  2WXR A;  1L2N A;  4B6W A;  3QC8 B;  3APF A;  2GBN A;  2D3B A;  4IUM B;  1QQR A;  5EE0 A;  3Q8B A;  2ICI A;  2N7E A;  5BYR A;  1EUV B;  4M8N A;  2GRI A;  2LVQ A;  3BVZ A;  1QKZ A;  4M00 A;  4HPP A;  1SBB B;  2WLB A;  1C4A A;  4LCD E;  5FKA C;  4LK0 M;  4LJO B;  3R7R A;  2KMA A;  4YTP B;  4RF1 A;  3Q14 C;  1E6E B;  3DHH C;  3OAW A;  2KFJ A;  4KGT A;  3W9C B;  1XO3 A;  1TTN A;  2IND C;  2WXH A;  3L08 A;  2UYZ B;  4IM2 A;  1TY2 A;  2JZ3 B;  1WY8 A;  3H1U A;  3NVZ A;  4MEM A;  1SE9 A;  5BMH A;  5J17 A;  2IPK D;  2ZVN A;  2X38 A;  1I42 A;  1JML A;  3E9S A;  2BBC A;  3U7Z A;  3H9D A;  3ZKJ C;  2WS3 B;  4MH8 A;  2FCQ A;  1FFU A;  2KDE B;  4LNI A;  4Q2J A;  4ICV A;  3U7D A;  4JE3 B;  5H92 C;  1TZ1 A;  1MVK A;  1ZPS A;  4WWO A;  1N61 A;  3W2D A;  2CU1 A;  1E0Z A;  1JAL A;  1E7U A;  1Q10 A;  4GSW A;  3AEG B;  1GB1 A;  2JU6 X;  2L32 A;  1ZGU B;  4PYU A;  1YN4 A;  2LHE A;  4RCO A;  3QCA A;  2HJ8 A;  3PS6 A;  1UBQ A;  1A70 A;  3KLS X;  3AM9 A;  2PMV A;  2QIE B;  3L4P A;  4E71 A;  3ZNH B;  2K6D B;  2MBH A;  2LAS A;  2N7J A;  3IAS 1;  3ABV B;  4ZOH C;  3VH4 B;  2KMM A;  3D32 A;  4PT5 A;  4QAY A;  2KJ6 A;  5CTR C;  2KAC A;  2PLP A;  2LMC A;  4F1S A;  5FK9 C;  4LLG M;  1G6J A;  2VH1 A;  1MPE A;  2KWV B;  4BKS A;  3AED B;  2NBU A;  1WE7 A;  1EF1 A;  1AWD A;  3ECI A;  3KVF B;  3A9K B;  5BMG A;  1HQR D;  1PQS A;  2IO3 B;  2KZR A;  1OGW A;  2OHF A;  1TS4 A;  4FHJ A;  1D5X C;  3AV8 A;  4M01 A;  4NNJ B;  1I7H A;  1UWM A;  4BBN C;  3EGR A;  3U4E G;  4BKG A;  2M19 A;  1SEB D;  1WI0 A;  1IBX A;  4YSX B;  4DHZ E;  3URY A;  1C3T A;  1D4B A;  3Q8C A;  3KW5 B;  1T0R C;  4ASW C;  2N9L A;  3TBL D;  3SD5 A;  5EE1 A;  2KD0 A;  3MFG A;  2PJH A;  4NAW A;  3NVV A;  1CMX B;  2N1W A;  4DK5 A;  3IHP C;  1GJZ A;  4F8C B;  4OVU A;  3VUY A;  1EF5 A;  4KZC A;  1V80 A;  4K7U A;  2INN E;  1BUI C;  3LB8 C;  2O6V D;  2MQJ A;  3U30 A;  4PS8 A;  3ZNI D;  5EE3 A;  4II2 B;  4GDK A;  1ESF A;  4AQ7 A;  2ACZ B;  4H2A A;  3CMM B;  3OLM D;  1FD6 A;  2I38 A;  2KXJ A;  4FJV B;  2QHO A;  1HTQ A;  1JWM D;  1TJE A;  4G0N B;  5GXG B;  1DOI A;  3NZ3 A;  2MCN B;  3W1S C;  1JWB D;  2IGD A;  3OWE B;  4LDT B;  2K8C A;  1V5T A;  1RAX A;  4CYE A;  1KLG D;  2L7R A;  1B9R A;  1TKE A;  4ANU A;  4E3C A;  2EMS A;  2NTT A;  1NVI D;  1RWS A;  1UBI A;  3L0W B;  1LXD A;  5J18 A;  3J9C A;  1SGH A;  2KLC A;  2QIL A;  1ZDV A;  3PGE A;  1SIJ A;  3TJP A;  2HDE A;  2RR9 A;  3KYC D;  2Y5C A;  4ZHO A;  2M1M A;  2ONQ A;  1XXG A;  3X0W A;  3VH3 B;  4ANW A;  3Q8A A;  2MBO A;  5IAA C;  2MJD A;  2K39 A;  2M0A A;  1KRH A;  1NEN B;  2MBQ A;  4BBN F;  1WYG A;  2LGI A;  4IKG A;  4ANX A;  2J7Q B;  2XEW A;  5AZF A;  4HCP B;  1K50 A;  2KAN A;  4B95 A;  4MH0 E;  3CF6 E;  1ZW7 A;  2B3A A;  1QOA A;  1OTR B;  3A4R A;  3U52 E;  2JRH A;  2M17 A;  5G5G A;  3UF8 A;  5CX3 A;  2IGH A;  3PZD A;  4FA6 A;  1LO5 D;  5CHF A;  3HVZ A;  2JSV X;  4JQW C;  5I4D A;  3N1Z C;  1F52 A;  3TSS A;  4ARC A;  3NVY A;  2N4F A;  2BYV E;  3QQ8 B;  3TCA A;  3RFZ B;  4WQO B;  3Q8F A;  1N62 A;  5L83 A;  4X57 B;  2I2Y A;  4HPM B;  1F77 A;  1FNW A;  1WGH A;  2DZK A;  2J4X A;  5IO9 A;  1IBX B;  1VRA B;  3ZDM C;  5GMV A;  1UZX B;  2LGX A;  1JWS D;  3DVN U;  4FLH A;  4DXG A;  4KZ0 A;  1WWT A;  2ZJD A;  2LRU A;  2Z0E B;  3IT6 B;  2AX5 A;  2LEK A;  3PPA A;  2BYE A;  2LRW A;  3ZIM A;  3AXC A;  2GBK A;  3B0A A;  1T0Y A;  3DPD A;  4A90 A;  2B76 B;  3TMP B;  4ZRQ A;  5JZE B;  4NJ7 A;  1TY0 A;  2WXG A;  1IP9 A;  2K3U A;  4W9C A;  1L5P A;  2WXL A;  3Q3J A;  1Q5W B;  2BYT A;  2GBR A;  1TIF A;  1YQB A;  4TKN A;  2NS5 A;  1S3S G;  2N1V A;  3P4Q B;  2DEN B;  2Y5B B;  3R66 C;  3Q3N C;  5LNK 1;  4L2Y A;  3FC4 A;  1LQB A;  3V60 A;  1AAR A;  1FO4 A;  3VTU A;  1WGY A;  2BS2 B;  1QOG A;  3BWU D;  1C76 A;  4ZRJ A;  2YEP B;  2V3N A;  1P7F A;  2WXJ A;  3WAL A;  2AQ2 B;  4EOY A;  1FRR A;  3ZJT A;  3RI7 C;  1CJE A;  2RMM A;  4KIK A;  2ZNV B;  1DOY A;  2AL6 A;  5J2R A;  1F9J A;  2DBY A;  2MH7 A;  2V3S A;  3MC0 B;  5TSS A;  5DPT A;  3V6C B;  4HEA 1;  3ZTD A;  3DBL B;  3PRP B;  1V1P B;  2IZV B;  2WDV B;  3C19 A;  3MC8 A;  3MHS D;  2KDI A;  3ZO5 B;  1VCB A;  1PYW D;  3BVG A;  4DXF A;  1HZ5 A;  3AE4 B;  3MJ5 A;  3A4S C;  3PVL A;  3RNF C;  2PEA A;  3JSV A;  2EKI A;  3N32 A;  2BS3 B;  2LJ5 A;  2KDM A;  3TIX A;  1QOB A;  2HTH A;  4DDG D;  4RH6 A;  1DYQ A;  5IN7 A;  3AEF B;  1U4A A;  4URK A;  3QAR A;  2K22 A;  3NG0 A;  2EKE C;  3NZU A;  4B0E A;  1P3Q U;  2H89 B;  1R4M B;  3AU5 A;  1IPG A;  3WAP A;  3P4R B;  4CQN A;  1D3Z A;  4BOZ B;  1RLF A;  1TBE A;  3WA0 A;  2HTM E;  1YJ1 A;  2KWC A;  4ZDV A;  3SFD B;  3LDZ E;  2OJW A;  4US9 A;  1MHX A;  4S0R A;  3AE6 B;  3BYT B;  2BPS A;  3BYY B;  1V8C A;  4XWW A;  2J0M A;  2DYO A;  2JZZ A;  3V05 A;  4ARI A;  2KO3 A;  5DPW A;  1EWC A;  2D3C A;  2WDT B;  3RNG C;  1MI0 A;  3ALB A;  4EKU A;  3I63 C;  2Y3A A;  3VUX A;  3MTN B;  4EUT A;  1E9M A;  3DBL I;  5AZH A;  3PTF C;  4RNA A;  4RM8 A;  5MPO A;  2K9X A;  4IM3 A;  1JRP A;  5JH5 C;  2UU7 A;  4IOI E;  1AW7 A;  1FXA A;  4HDO A;  4BKS D;  2CJO A;  4FBJ B;  4MGI E;  1UEL A;  1WGK A;  1JWA D;  1KFY B;  3K9O B;  3UQA A;  4EE2 A;  3ZDT A;  5E6N A;  5LXI B;  2IGG A;  1WE6 A;  3NZS A;  2FE8 A;  1HEZ E;  4GDL A;  2JYT A;  4XZ4 A;  4PK1 A;  3VTW A;  4OHJ A;  1IUE A;  1RFK A;  2DYB A;  1KLU D;  1FIQ A;  2MJE A;  4YWG G;  1R4M I;  5AUI A;  1YN5 A;  1VJK A;  4HWI B;  4PS3 A;  3A1Q A;  1KM7 A;  1ZXH A;  2UWQ A;  1J7A A;  1EU4 A;  4RGN A;  1E7V A;  1P98 A;  3VRB B;  3NS1 A;  3K9P B;  3PRZ A;  2C60 A;  2QC8 A;  4K3C A;  4YSZ B;  3LYY A;  3ML8 A;  2KTR B;  3M63 B;  3SHQ A;  5G5H A;  4DHJ D;  1ZUD 2;  3PV1 A;  2CS4 A;  2L76 A;  2AQ3 B;  2WXP A;  4G11 A;  1I4H A;  5HHD G;  1HZ6 A;  3M3J A;  3CWI A;  3GE3 C;  2KWU B;  2PKO A;  2HJ1 A;  3NJT A;  3T3N A;  2DAF A;  2KQS A;  1L7Y A;  4N9F 4;  2N0S B;  3WAM A;  2PW9 A;  1VZ7 A;  2BKF A;  4OVV A;  2R2Q A;  5FR3 A;  5AUK A;  3FKY A;  2L0F A;  3AE5 B;  2BQQ A;  4A55 A;  4A3P A;  2JX5 A;  1P9D U;  2C7N B;  1S1Q B;  3MC9 A;  4OZA A;  2V3P A;  3ZW3 A;  1FM0 D;  3LJ3 A;  5IP4 D;  1P7E A;  2GOW A;  2CJN A;  4TSS A;  2YEP F;  4WIP A;  1KTK A;  2DLB A;  2JWZ A;  1FXT B;  4NQK E;  3ZNZ B;  2KTF A;  3V6E B;  4YXD B;  2KJH B;  1TS3 A;  1XLQ A;  1L6U A;  5C23 A;  2K6Q A;  1UD7 A;  4NQL B;  1OEY J;  3RCZ A;  2OJR A;  1WZ0 A;  1SIF A;  1HE8 A;  1KOT A;  4C4V A;  2CHX A;  2KQ4 X;  4KKJ A;  3ZXV A;  2CR5 A;  3ONS A;  3T8M A;  3T9L A;  2IYD B;  2FUG 1;  1YIW A;  1WGR A;  4OZC A;  1HTO A;  1ENF A;  1ET9 A;  1C79 A;  1SE2 A;  3KH0 A;  5C2T B;  1VDV A;  3ZGZ A;  1K51 A;  1XLO A;  2WXM A;  4ACF A;  2WDQ B;  2WHI A;  2XK5 B;  3Q2A C;  2MWS B;  1I4Q A;  3TUO A;  1V6E A;  4KDL B;  2E6X A;  5JHB A;  2L52 A;  5T8I A;  4IWP A;  4KSL C;  3O13 A;  1WR6 E;  2LUE A;  2GLS A;  1L0V B;  1NYQ A;  1V86 A;  3C0R B;  3GB1 A;  3M62 B;  3IBE A;  2GBM A;  1ACC A;  1WZ3 A;  4P1C C;  2V4I B;  3Q8E A;  2NTS A;  4G3X B;  4C00 A;  2E3T A;  4TV3 A;  3R7Q A;  2M0X A;  1N5W A;  2NBW B;  1L0X B;  4GDL B;  1M94 A;  2D2Q A;  3RNE C;  5CHW A;  3AE7 B;  1J8C A;  2AWT A;  2K8H A;  3ZTC A;  4IC7 B;  4LJP B;  2D3G A;  3A1Q B;  4IM0 A;  1WM3 A;  2WWZ A;  1K8R B;  2WGS A;  3T3O A;  4WQM A;  4KV2 A;  2L8J A;  2KK8 A;  4XGA B;  3AEB B;  4RGT A;  4K3B A;  1J19 A;  4AJY B;  5D2M B;  1E8X A;  3P4S B;  1JRU A;  3ZUN A;  2BW2 A;  1ZP0 B;  3PHW B;  4W9J A;  2LD9 A;  3P2B A;  4RFB A;  4WWN A;  2M4N A;  1SE3 A;  4GXB A;  3Q69 A;  1WX9 A;  1PDX A;  2L1A A;  1EU3 A;  1K53 A;  4MGK E;  2N9P C;  2DZM A;  1GOZ A;  4JIO U;  3QA8 A;  1WFY A;  2WYQ A;  4EEW A;  5BMI A;  3H8H A;  3ZNG C;  3PZ7 A;  4NPN A;  3UI3 A;  1E7P B;  3PRM B;  2WU2 B;  2PE9 A;  3H6N A;  2QMT A;  4AWJ A;  3VDZ A;  1VZ8 A;  1XLP A;  2JWU A;  5LXH A;  3IFW B;  1GPX A;  2M8S A;  2SEB D;  4N6E B;  4DXA B;  4OW0 A;  3HM3 A;  3BK1 A;  3A33 B;  1V81 A;  1JW9 D;  3OJ4 B;  4EZK A;  3CST A;  2WP9 B;  2FID A;  4TMA B;  3VVW B;  3B08 A;  3EFC A;  4K81 A;  4B9K A;  2KYW A;  5H8Y E;  4W9F A;  3Q6B A;  1RYJ A;  1STE A;  2K5P A;  2WX0 A;  1XLN A;  1J7B A;  4M0W A;  3ZQ4 A;  2MEK A;  3APC A;  2MA9 B;  4HRS A;  4L1B A;  2ZZP B;  4B0M A;  4NZL B;  1QF6 A;  1WGD A;  4C4V B;  1PGA A;  3DQV A;  2GBJ A;  1NEK B;  1XQQ A;  4RF0 A;  3UQB A;  2FUH B;  1MFW A;  1I4R A;  4TUU A;  4MAC A;  4AP4 C;  4II3 B;  4W9G A;  1NDD A;  3AEA B;  2KX3 A;  3PHX B;  2ZCC A;  4HRO A;  3ETR A;  1WGG A;  5D3D A;  4WAA A;  3QJZ A;  1L0Y B;  3RPF C;  1WRD B;  4YTN B;  2BYF A;  4GMV A;  1C78 A;  1MHH E;  4WAF A;  3TEW A;  4XYC A;  3EC8 A;  4ICU A;  1F1H A;  2D10 A;  3R3M A;  4WJQ A;  5IOI A;  2DHZ A;  5EDS A;  4K7W A;  3TEY A;  4S17 A;  1TS2 A;  3KWV A;  1WJ4 A;  2INP E;  3CSF A;  4GU2 A;  2KLG A;  1WJU A;  3HUI A;  1KLV A;  3IAM 1;  2JQR B;  4LNF A;  2AQ1 B;  3PLU A;  3HM6 X;  4NAW B;  2LFI A;  4J6I A;  1WXS A;  1Q0W B;  2ZVO A;  4USA A;  1V2Y A;  1TZO A;  2KQ7 A;  1Z2M A;  1WM2 A;  4JLC A;  4JWS C;  4LNO A;  2IY1 B;  4DHJ B;  4OVZ A;  2CKH B;  3I5J C;  2LZ6 A;  2BF8 B;  3IVF A;  4D2K A;  1KH0 A;  2G9H D;  3B2F A;  1GC6 A;  2JVC A;  3FIL A;  3Q3F A;  1ZOY B;  4R3D A;  1B1Z A;  4BOS C;  2HE7 A;  3BZD B;  2R2O A;  3GS2 A;  4GDK B;  2W54 A;  4NJ6 A;  3AU4 A;  2IDY A;  4HDQ A;  4E74 A;  2RDH A;  2WX1 A;  1ZDX A;  2WDR B;  1VZ6 A;  2RDG A;  2LGD A;  5JXV A;  1IGD A;  4CHK A;  5D6J B;  3ZRF A;  4K7S A;  3LXF A;  1X1M A;  4PS7 A;  1QLB B;  2K25 A;  1QOF A;  1UH6 A;  3QX1 A;  5KHO A;  2WQY B;  5JHA A;  1FFV A;  3MHZ A;  1BT0 A;  2N7D A;  3ZJV A;  1VD2 A;  2GMI C;  2CU3 A;  2C9W B;  4XX5 A;  3DDC B;  3PZ8 A;  3DHI C;  2BWE S;  1E10 A;  2DX5 B;  3RMK C;  2L00 B;  4IWQ A;  1JWU D;  2QEJ C;  2XBB C;  2Y5P A;  4XDC A;  1C4C A;  3N9Y C;  4KDI C;  4BZA A;  3AE3 B;  1YX6 B;  4ZHP A;  4BFR A;  2AEH A;  1YD8 U;  1IYF A;  2I1K A;  4KGS A;  4RGM A;  3S2A A;  4N59 A;  4WUR A;  2MBB B;  2KC2 A;  4IG7 B;  1WH3 A;  4G50 A;  2GI9 A;  1I4X A;  2PVO D;  3WAN A;  4DDI D;  1VLB A;  1WF9 A;  2EMT A;  3AN1 A;  3PLV A;  4GGQ A;  1XD3 B;  3N1Y C;  4DHZ B;  5D7G A;  2LUM A;  4DQO C;  4MSQ B;  1NYR A;  3ENE A;  4M02 A;  1NI3 A;  2KDF B;  2R61 A;  4WH4 A;  1OQQ A;  2DNF A;  1WR1 A;  2W3S A;  2G4D B;  4HK2 A;  1FPY A;  4HCN B;  3EUB 2;  1H4R A;  1Y8R C;  2JPH A;  2JT4 B;  1PGX A;  5FR6 A;  2Z0D B;  2A5U A;  1ET6 A;  5LLI A;  4WJO A;  2IBI B;  4XC2 A;  2PPH A;  1J7C A;  3DBH B;  4KGR A;  1I4P A;  2LWP A;  2BGF A;  4NY0 A;  3A9K A;  3QIJ A;  3V61 A;  2FNJ B;  1N63 A;  2MBE A;  3A9J A;  2KN5 A;  2JXT A;  2JRI B;  2O2V A;  3O65 B;  4BAX A;  4TQ1 A;  1XF5 L;  3P1M A;  5DCN A;  2D07 B;  2FIF A;  2RPV A;  2DYM A;  4P6V F;  2QJL A;  2WXF A;  4MGY E;  4A3O A;  5BO4 B;  2V1Y A;  1YOV B;  1OQY A;  4PYZ A;  4RM9 A;  3JVZ X;  4JX1 C;  4EZL A;  3Q3O C;  2MJ3 A;  4XE0 A;  1MJD A;  4C56 C;  3ML9 A;  2KKC A;  1C77 A;  2MW5 A;  4K1R B;  3H7P A;  1GG3 A;  2JXX A;  1QZE A;  2EEL A;  3PO0 A;  1ZKH A;  4ZYN A;  3RD2 A;  1UF0 A;  3DBS A;  1F0Z A;  3HHM A;  4GOC A;  4GB9 A;  2NVU I;  3DCG A;  2OOB B;  2D3A A;  2YVC A;  4C80 A;  1IGC A;  3ZRC A;  2LXA A;  2X8X X;  2IY0 B;  4KIK B;  5TR5 A;  2W9N A;  3NOB A;  2ZPN A;  4ZRK A;  2J53 A;  1L4D B;  5AEK B;  2RD0 A;  1OFF A;  2MP2 A;  2LJI A;  1YJJ A;  4JPS A;  2LI5 A;  4W9K A;  4HJG E;  1T3Q A;  3DBH I;  3DBR B;  1RFA A;  3B1L X;  4A9A A;  3UIO B;  3VRA B;  3AE1 B;  2LGS A;  3C8Y A;  1TT5 B;  3JSV B;  2BVC A;  3WIM A;  3L13 A;  1C1Y B;  2PTL A;  5HG2 A;  2CHW A;  4FAD A;  5C1Z A;  1UGJ A;  1T0Q C;  4W9H A;  2BTE A;  4AJW A;  2N9K A;  4AUQ C;  4MM3 A;  1UNS A;  4UDU C;  1FNV A;  3BII D;  1PUT A;  2VZK B;  2KFK A;  3DVG X;  3ZLZ A;  3SDL C;  1BML C;  4BVU C;  2WXO A;  3B9J A;  1WMH A;  4W9L A;  1V5O A;  3UGB B;  3RZF A;  4JWU C;  3KWL A;  1SE4 A;  4MJS A;  3GZN B;  3CIR B;  1LGR A;  2G4S A;  4FN2 A;  3N30 A;  3X23 A;  2QDF A;  2V4L A;  3DVN V;  1JRO A;  1M4V A;  1EWY C;  3GOE A;  4W9E A;  1LM8 B;  2N9E B;  4KX6 B;  1YQ3 B;  1FCC C;  1WX8 A;  3HRD D;  2VH2 A;  1SJE D;  3VFK A;  2BKR B;  2KDB A;  4XDD A;  4KVG B;  4RGO S;  2BB6 A;  3RUL A;  3N20 C;  2D5G A;  4DWF A;  1EO6 A;  3RNA C;  4A8X C;  1GB4 A;  2VRR B;  1ZE3 D;  4HKZ E;  2N9X A;  2WXI A;  2DWQ A;  4WWM A;  3NHE B;  3ZJU A;  1DOX A;  1OQR A;  2G45 B;  2ASQ A;  3TEX A;  4WJP A;  2J42 A;  2W55 A;  2WU5 B;  1L4Z B;  1TKG A;  2KNB A;  3DBR I;  1RM6 C;  3HVD A;  3ZVV A;  3A9J B;  2BT6 A;  3NRZ A;  1BXT A;  2O2V B;  3DWG C;  3BY4 B;  2ZPY A;  4ZRP A;  2K0P A;  1UWX A;  2QCZ A;  3B2G A;  2FCN A;  4EFO A;  2CHZ A;  2ON8 A;  2L05 A;  2FBW B;  2NPT A;  2Z59 B;  4AS1 A;  5D3I B;  4MEL A;  5AZG A;  3IG3 A;  3NS8 A;  4OZB A;  1YJI A;  5KHQ A;  2IO2 B;  1DGJ A;  3DHG C;  3AE2 B;  1C4P A;  3H7P B;  1C9F A;  3GZN I;  5HI1 A;  1D5M C;  1YQ4 B;  1LFD A;  4ANV A;  3V62 A;  1GC7 A;  2K8B A;  1OEY A;  1K52 A;  4YT0 B;  4CO7 A;  4MGZ E;  3NY5 A;  1TGZ B;  2J52 A;  1QIL A;  3TEZ A;  1WX7 A;  1ISN A;  4O1N A;  3L17 A;  4M8M A;  3QWZ B;  3U8Z A;  4KSK C;  3EHV A;  2SAK A;  3WAO A;  3R2T A;  2BWF A;  4I6P A;  1QT9 A;  1SB3 C;  2WNM A;  4I6N B;  1WXQ A;  2MP2 B;  4I6L B;  2WXQ A;  2ZW1 A;  2I1J A;  2RSU A;  3P4P B;  3EEC A;  5BYQ A;  4GIV A;  3SEB A;  4JGH B;  1F2R I;  3Q3M C;  2TSS A;  1YMH E;  4J3O D;  1KJT A;  4IW0 A;  4P1B C;  1J0G A;  2INC C;  1R7S A;  2XNA C;  4ZYS A;  1F2R C;  1WJN A;  3SR6 A;  2KT7 A;  3AB5 A;  2KOX A;  4MM3 B;  3WCQ A;  2DZJ A;  4EZJ A;  4MSM B;  3KUD B;  3RN9 C;  2KFK B;  4YSY B;  4XWT A;  3PRE A;  1FXI A;  2AYO B;  2JYE A;  1V97 A;  1PFD A;  1WMH B;  1V1P A;  1P0R A;  3JW0 X;  3APD A;  2KJR A;  2WXK A;  4MJS B;  3NUH B;  3VR8 B;  5D94 A;  3HK0 A;  4C7Y A;  1WXV A;  3I3T B;  1SJH D;  1N6Z A;  1T6B X;  1Z5S B;  4NJC A;  1YN3 A;  1EM7 A;  3RUI B;  4FJY A;  4W9I A;  1SXT A;  1Y56 A;  4HKQ A;  4W9D A;  2IO0 B;  4BKT A;  2VZK D;  2W3R A;  3V3X A;  3I57 A;  2RDB C;  5HKH A;  5G55 A;  3IXS A;  1R4N B;  3VUW A;  2REX A;  1CQV A;  2XN9 C;  1Q1O A;  3L54 A;  1TS5 A;  1MG4 A;  2KX0 A;  1CK1 A;  1RRB A;  2AL3 A;  3E56 A;  1YNT E;  3UIP B;  2A4Z A;  4KKI A;  1XEE A;  1N60 A;  2J0J A;  2KVR A;  4F7Z A;  3L10 B;  2DAJ A;  2FCM A;  2LVP A;  2L3Z A;  3BK2 A;  2RPQ A;  1V1O A;  3OJ3 A;  1MG8 A;  2KWD A;  1L6V A;  3MJW A;  2V9H A;  2KAJ A;  4FJZ A;  3RNC C;  3BVM A;  2MX2 A;  1WSP A;  2NPT B;  4YL8 A;  2NBV B;  2LXC A;  2O6V A;  4C7Z A;  4FUL A;  4HVB A;  4N58 A;  1FEH A;  4ZRI A;  2YLM A;  2Z8L A;  3P63 A;  1GUA B;  3TL5 A;  2MRP A;  2JF5 A;  3DOW A;  2C7H A;  2PIA A;  1T0S C;  2JZP A;  3U2S C;  1FCL A;  2L83 A;  4AOF A;  3R8B A;  1NBF C;  3M95 A;  3KQ4 A;  4IDI A;  4ITK A;  2J0K A;  3NVW A;  4HXD A;  5EE9 A;  2NR2 A;  3ZXR A;  4NAM A;  3OG5 A;  1GNU A;  2G3Q B;  1WXM A;  1JCK B;  2KHW B;  2MHJ A;  3SU8 X;  1FRD A;  1R4N I;  3KYD D;  1I4G A;  3AE8 B;  2LGY A;  5CHV C;  5IKC M;  2ZEQ A;  4GN1 A;  1N5X A;  2PVG C;  2HD5 B;  5HFY A;  3GP7 A;  3BIN A;  1WJ6 A;  1ZXI A;  4YTM B;  1D5Z C;  2KTR A;  1E90 A;  1V49 A;  3QHT A;  5IA7 A;  3ZYY X;  3AI5 A;  3N1X C;  4HJK A;  2C5L C;  3I9V 1;  3W1Y A;  1AYF A;  3VAW A;  2BB5 A;  4L23 A;  4TQ0 A;  3KUZ A;  3H7S A;  1ROE A;  5DPS A;  1VR9 A;  4M0W B;  1V9J A;  2MLB A;  3AUL A;  3AMZ A;  4DBG A;  3AEE B;  2W82 A;  4P16 A;  1I35 A;  1T5X D;  2M56 B;  1CZP A;  3EA6 A;  2H88 B;  3VHT C;  2BS4 B;  3VR9 B;  2KVZ A;  3DWM A;  1E8Y A;  2JUO A;  2ZW0 A;  4LDT D;  1XCQ L;  2IO1 B;  1E5W A;  2K1F A;  1KF6 B;  1YX5 B; 
#chains in the Genus database with same CATH homology
 1TIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...