1TIFA

Translation initiation factor 3 n-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
KDFIINEQIRAREVRLIDQNGDQLGIKSKQEALEIAARRNLDLVLVAPNAKPPVCRIMDYGKFRFEQQKKEKEARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome binding factor
molecule keywords TRANSLATION INITIATION FACTOR 3
publication title X-ray crystallography shows that translational initiation factor IF3 consists of two compact alpha/beta domains linked by an alpha-helix.
pubmed rcsb
source organism Geobacillus stearothermophilus
total genus 24
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1995-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05198 IF3_N Translation initiation factor IF-3, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.80 Alpha Beta Roll Ubiquitin-like (UB roll) Translation initiation factor 3 (IF-3), N-terminal domain 1tifA00
1TIFA
chains in the Genus database with same CATH superfamily
3ZQ4A 4DHZB 3U4EG 3SFDB 4FJVB 3LXFA 2LI5A 5GXGB 1I4HA 2QCZA 4QAYA 2N1WA 3QX1A 2XNAC 5IAAC 2BS3B 2Y5BB 4MGZE 4W9CA 3PVLA 1QOAA 1Y56A 5AUKA 1FRRA 3UIPB 3L10B 1F2RC 3TEYA 1GB1A 2HTHA 4RGNA 3N20C 4PS7A 2IBIB 4XE0A 3IAS1 5MPOA 2BYVE 1K53A 1UUPA 3W5VB 3M3JA 1WE7A 3Q6BA 4NJ6A 3VTVA 3VVWB 4G50A 2DWQA 2JVCA 2LHEA 1V49A 2C7NB 2NPTB 2RD0A 1AARA 1L5PA 3P4RB 3Q3NC 2WXRA 2JSVX 1R4MB 1NVID 1WXQA 3L0WB 4IOIE 4WJNA 2VH1A 2V4LA 1L4ZB 1RFKA 1Q5WB 3EA6A 3AV8A 3B2FA 4TMAB 3KUCB 3QCAA 4S17A 1YJIA 2KWVB 3KH0A 4ARIA 2D07B 3VFKA 3ZNZB 2LASA 1V5OA 1SE2A 1JWBD 4N9F4 1J8CA 2ACZB 4G3XB 2WDVB 2PW9A 2MJ3A 2G3QB 3L54A 5GMVA 2HE7A 2MQJA 1VZ7A 5EE1A 1PYWD 2LMCA 3AE1B 1ACCA 2LUMA 1YD8U 1FD6A 1UBQA 2X8XX 2QJLA 4FJZA 1ZE3D 2XK5A 3MTNB 1K50A 3BK2A 3DVNV 5C23A 3ZRFA 1P1AA 1AWDA 1WFYA 3GE3C 1FXAA 1E7UA 1A70A 2ZNVB 4XC2A 5JXVA 3EECA 1AW7A 3P4SB 1H8CA 1UZXB 4EZLA 3KUZA 1D4BA 3LDZE 2YEPF 1A5RA 3ZLZA 4KGSA 3NOBA 5BYSA 3BIID 2LXCA 3BZDB 2L52A 4W9HA 3VR9B 1ET6A 1WF9A 1YJ1A 1GAQB 2R61A 3I9V1 4HPLB 2KJ6A 3ZW3A 3HUIA 3U52E 1SB3C 3PO0A 2NTTA 3PT2B 4KIKB 5IO9A 3ONSA 4B9KA 4CYEA 1FFUA 2WP9B 3AN1A 2M0XA 1P0RA 2BVCA 5J17A 3IXSA 2K6QA 2Y5PA 3ML8A 4FBJB 2NCNA 1NYRA 3AEAB 1WY8A 2ON8A 1E6EB 1KM7A 2QIEB 2RPVA 3DOWA 4A90A 1TTNA 4E3CA 3DQVA 5D3DA 1FNVA 3U30A 3APFA 3BY4B 3HM6X 2B76B 4LTUA 2H88B 2VZKB 3RZWC 4WWOA 5HKHA 4PS8A 4KV2A 3AXCA 1RFAA 1D3ZA 4L1BA 3ENEA 4B95A 2PMVA 4GDKB 4JLCA 4TUUA 1J7BA 4BOSC 2L76A 2BW2A 3AU4A 4BAXA 3PLUA 3KUDB 1VRAB 1WMHB 5TSSA 1I4XA 5AZFA 1SJHD 2I1KA 2ZNVC 3NY5A 4IC7B 2KYWA 4K3CA 4MT5A 2K22A 1TS2A 1I35A 5JHAA 2JRIB 2WXKA 3B1LX 3HRDD 1V97A 3VQIA 2GBRA 3KWLA 4XYCA 2OJWA 5FR6A 2GBNA 1V1PB 3ZGZA 4FJYA 4XWTA 2FCQA 1SBBB 1JCKB 2WXLA 5DPWA 2KD0A 4PS3A 2VH2A 2Y3AA 4IUMB 3PREA 5BMIA 1BUIC 3PRPB 1ZPSA 4YXDB 1K52A 2CHWA 4BBNC 1TS4A 2JZPA 1P7FA 2K39A 2D3AA 2ZPNA 3ZNGC 3AE4B 1WZ3A 3QA8A 1JWMD 1P98A 4HKZE 3SR6A 4PK1A 2L83A 5JH5C 3SDLC 4A6QA 1DOYA 1V86A 2NR2A 3R7RA 2EMTA 4I6NB 3W9CB 4DQOC 5BMGA 4EE2A 1T6BX 3W1YA 1UBIA 4MH8A 4GSWA 4LDTD 1TZOA 3LYYA 1ISNA 3NVVA 3RI7C 1SIFA 2N9EB 3EFCA 1V80A 1UWXA 3VAWA 1L4DB 1LM8B 1WR1A 3IT4B 3N30A 5EE3A 4ZRQA 1FCLA 1T0RC 1XLOA 4LK0M 2W55A 2IO3B 3PSEB 2E3TA 3KQ4A 5IA7A 2WQYB 2JU6X 2REXA 2KLCA 3SEBA 1XLNA 3AEEB 2EELA 5EE0A 3R2IA 2KAJA 3RCZA 3VTWA 1JALA 2KN4A 5CHWA 3NHEB 4NZLB 2FCNA 2QMTA 1HXYD 4J3OD 2NBUA 4NJCA 3AEGB 2BBCA 1I7HA 3U7ZA 2DAFA 3A1QB 3ZJTA 1LQBA 4A3PA 4ZHPA 3WAMA 2A4ZA 3H7PB 1X1MA 1E7VA 1ZXHA 1MHXA 1D5ZC 4JWUC 4IM3A 2JY6A 4P7IA 4M8MA 2J52A 2CU3A 3Q8CA 2OOBB 3RYTA 4LNKA 2BKFA 2GMIC 1EM7A 1AYFA 1I4PA 4GLSC 3D32A 3ZIMA 2IGGA 2KTRA 1G6JA 1OQYA 1FNUA 1ET9A 2ZW0A 1MI0A 3AEFB 3VUXA 1TYGB 1HZ6A 1WXAA 2RPQA 4HKQA 3JSVA 4RGTA 5DPRA 4ARCA 2ZW1A 2YVCA 3JVZX 3Q3MC 2GLSA 2LGXA 2DYMA 3WAOA 3B2GA 2N4FA 2KQSA 2Z59B 4XDCA 1E8ZA 3UQAA 5AZGA 3AH7A 3Q14C 2J42A 2JUOA 3AE8B 3IVFA 1SIJA 4ANWA 3VRAB 2R2QA 1UF0A 1U4AA 3LJ3A 2L1AA 3MP9A 3PTFC 3M63B 4XX5A 4ACFA 3VR8B 3AECB 3DPDA 1KOTA 1C4CA 2D3BA 4DBGA 2FCMA 2O2VB 2MBEA 4PYZA 3TL5A 2QILA 3APDA 4FULA 3Q2AC 4OVUA 3W1SA 2RDBC 4EFOA 4BKGA 4AOFA 3VXWA 1IGCA 1ZP0B 4ZRKA 2DZMA 1FRDA 1JWSD 4HEA1 5I4DA 1UH6A 2BF8B 3U8ZA 1TS5A 2G9HD 4NQLB 4W9LA 3K9OB 4KSKC 4MDKE 1RM6C 4NAWB 3MJWA 3PRZA 4MH0E 1KFYB 5C1ZA 2LD9A 3QC8B 4KSLC 4YTNB 1HEZE 3R2TA 3DVGX 4XZ4A 3I3TB 4XWWA 2WXOA 4TQ1A 2K5PA 2K8BA 2AL3A 4F1SA 1I4QA 2LEKA 2RDHA 1HTQA 2KK8A 2MRPA 1WWTA 5L95C 2O6VD 1EWCA 3RD2A 2KX3A 3T8MA 4DXAB 3CSFA 1N61A 1GC7A 1SGHA 1CJEA 2HTME 1OTRB 4M0WB 4GB9A 5E6JA 3WANA 3SHQA 3QWZB 2KVRA 1T0QC 3BYTB 3MHZA 4USAA 3R3MA 4E74A 3ALBA 2W9NA 3AE3B 4DK5A 1E10A 1RAXA 1BMLC 2W3RA 3FKYA 3BVMA 1WGHA 1HZ5A 3DDCB 3PS6A 5HHDG 3X0WA 2FBWB 3RZFA 4BBNF 1LXDA 2EMSA 3PZ7A 5T8IA 1VD2A 2INPE 3RPFC 1TBEA 2AX5A 2Z0EB 4GOCA 2IPKD 2ZCBA 2WXJA 2L0FA 2ZZPB 1YN3A 2DZKA 1EUVB 2MX2A 3Q3OC 3DCGA 1IBXB 2QDFA 1GC6A 1E90A 1B1ZA 3P2BA 2CU1A 3WAPA 4N58A 1YIWA 3HK0A 4GMVA 3A33B 1SE9A 3OG5A 4LNOA 2DAJA 1QOFA 2PE6B 5E6PA 4G11A 4HRSA 4ZDVA 1GB4A 4IG7B 2DZJA 4IWPA 2L32A 4M8NA 1YMHE 2LGDA 2KWCA 3RNBC 3DWMA 2A5UA 4W9DA 2N9LA 2AEHA 4ZYNA 3B0AA 2IO1B 1V1OA 2RR9A 5J2RA 4RFBA 4F8CB 4I6LB 4KVGB 1EU3A 1YX5B 1KF6B 3E56A 1L6VA 2J7QB 3X23A 3BVZA 4C4VB 1ZGUB 3UF8A 1MG4A 4LJOB 3DVNU 1WX7A 1GG3A 2AQ2B 3Q8EA 1NENB 2GBJA 3ABVB 1FCCC 2BS4B 4E71A 4DHJB 1RRBA 3RMKC 4MGYE 4ITKA 1NYQA 3NVWA 4RF1A 1WXMA 1EO6A 4P1BC 3A9KA 1K8RB 1F77A 2SAKA 1F9JA 4YSZB 5G2NA 3L08A 1YN5A 3Q3JA 5AUIA 4YTMB 5FR3A 3QARA 3T9LA 1WGYA 4K1RB 3DHGC 1QT9A 3U2SC 4N59A 2HDEA 1N60A 2L7RA 3J9CA 2WXIA 4KKJA 4MGIE 2M8SA 3KYCD 2ZVNA 3AE2B 4WAAA 1FXTB 2FE8A 1PGAA 2B3AA 2G45B 4YSXB 2K0PA 4RGMA 2L8JA 1QILA 1P3QU 3TCAA 1T0SC 3GOEA 1KLGD 2O6VA 2MP2B 2VRRB 2KMCA 4M01A 4OZAA 1FFVA 2YLMA 4YSYB 2RDGA 3UIOB 3MC9A 1YOVB 1XO3A 4B0EA 2NMQA 4ICVA 2BWES 2JRHA 4A20A 4YTPB 4WQMA 1XXGA 1YQ3B 2PIAA 4KX6B 3RNAC 3R7QA 2LVQA 5KHQA 4GU2A 4WJPA 5JZEB 4DHZE 1GUAB 1L0XB 2KVZA 4ICUA 3JYUA 1C78A 3AEBB 2AYOB 4ZRIA 2KQ4X 2LVOA 3OJ3A 4GDLB 3O13A 3RNGC 3BYYB 4RF0A 2QHOA 4NNJB 3V6EB 4II3B 4ZHOA 3AE5B 1D6EC 2UU7A 4NQKE 1FNWA 3H1UA 4N6EB 2KDEB 4W9IA 3O65B 2Y5CA 2KC1A 1KH0A 1CZPA 1MHHE 1YX6B 2KFKA 1V2YA 3V05A 3H8HA 2LUEA 2V1YA 2YEPB 2M56B 2MBQA 1L0YB 3NVZA 2QSDA 1JWUD 5D3IB 2WXMA 2XN9C 2X38A 1E8WA 3KVFB 2LWPA 4L23A 2KHWB 3ZJVA 2K9XA 2L3ZA 2L0TA 4C7YA 3KYDD 4XGAB 1PDXA 5E6NA 4M00A 1T5XD 4MGKE 1C1YB 4JGHB 1NEKB 3NZSA 3E9SA 5AEKB 2ZCCA 3RUIB 1WYGA 5E6OA 2WXPA 2HJ1A 5CTRC 2WDRB 2LZ6A 2JZZA 2WLBA 3ZJUA 2DYOA 3JW0X 1E5WA 1I4RA 1Q0WB 2Q5WD 3SU8X 1BT0A 2MBBB 3H9DA 3KW5B 2C7HA 1SE3A 2D3CA 2M4NA 4OZBA 4JWSC 4MSMB 5D7GA 3QIJA 1B9RA 1DGJA 3IFWB 1STEA 2CS4A 2PLPA 2KMMA 2LRWA 3ECIA 5FK9C 2FAZA 4IKGA 3BINA 2ZJDA 3TBLD 4FHKA 4JE3B 2CR5A 3RT3B 1IP9A 1YNTE 2ZEQA 2K3UA 3GP7A 2DENB 4GN1A 1TKEA 3ZTDA 3V62A 1NDDA 5G5GA 2J4XA 3T3NA 3I5JC 4YL8A 3EHVA 1ZKHA 3ZUNA 3DHHC 5IOIA 3WA0A 1FPYA 4HJGE 5BMHA 1UD7A 3Q8FA 4K3BA 3ZRCA 3NG0A 1WRIA 1MJDA 1SEBD 3HHMA 2CJNA 1TT5B 2KC2A 2XK5B 2JXTA 4CQNA 2AWTA 2XEWA 3A9JA 3OJ4B 3EC8A 1YN4A 1HQRD 4MJSA 1Y8RC 3NUHB 4AQ7A 5BYQA 2W54A 1K51A 2WX1A 3RNFC 4BVUC 4XDDA 3VUYA 2M17A 2KDBA 3ZVVA 2PE9A 1T0YA 3QQ8B 1RYJA 2D5GA 2I2YA 4HK2A 4MELA 2QEJC 2NS5A 3DBHI 2L05A 4WQOB 3QHTA 1IGDA 1VZ8A 2WS3B 5J18A 2D11A 2MHJA 2Z8LA 4OVVA 3EUB2 3SD5A 3CWIA 4KDLB 3P4QB 2C9WB 1VZ6A 2MBOA 2BPSA 4R3DA 3FILA 2IJ0A 2JWZA 1JRUA 4HWIB 4FLHA 2ZVOA 3A9KB 3K9PB 4KIKA 1BXTA 2M19A 3TJPA 2CHXA 1WX8A 2KMAA 2INDC 1L0VB 1XEEA 4P16A 2QC8A 1DOIA 3Q8AA 4IDIA 2BWFA 4EUTA 4WWPA 2IY1B 1UNSA 4C7ZA 3PPAA 2WDQB 4WJQA 3V60A 5CX3A 3PV1A 3APCA 3WCQA 1E8XA 2KFJA 2BQQA 4BZAA 2V9HA 3RNEC 5KHOA 3VHTC 2PKOA 2BGFA 2MW5A 2O6VB 1ENFA 1OFFA 2DX5B 4FXCA 3SFEB 1SF0A 4JL9A 3MC8A 4B6WA 3P1MA 4WIPA 1UELA 2KJRA 5D6JB 4BOZB 1QZEA 3L17A 4GDKA 4EZJA 2D10A 1FEHA 1WE6A 2WNMA 2GI9A 2ZPYA 3FAHA 1R4MI 2DNFA 4K81A 4CHKA 4KZ0A 4W9EA 1GPXA 3LB8C 1D5XC 1T3QA 2V4IB 3FC4A 3AU5A 1FM0D 2KXJA 5D94A 3W5UB 4DWFA 4RNAA 3TSSA 1OGWA 3AE6B 2WXNA 1J19A 1OQRA 4PT5A 2JXXA 2WYQA 5G55A 1R4NI 2CHZA 4RGOS 4TKNA 2N9PC 4YWGG 4IWOA 3BVGA 1C4PA 2PVGC 5JHBA 1M94A 2OJRA 4W9JA 1XLPA 4D2KA 4P1CC 1HTOA 2GB1A 4LNFA 1WI0A 2V0GA 5HI1A 4GGQA 4W9GA 3W2DA 2MJDA 4HJKA 3QK0A 2DZIA 3TIXA 3DBLI 2JZ3B 4X57B 2JF5A 2RGFA 3L4PA 5IN7A 3DVGY 3N1ZC 1C76A 1WGRA 4HVBA 2IZVB 1H4RA 4HLEA 2INCC 3PHXB 2PVOD 3BK1A 1QF6A 2WDTB 1N62A 1WM2A 1TS3A 3WALA 1Q1OA 2IY0B 2J0KA 4ZOHC 3AM9A 1VR9A 4MEMA 4W9FA 1RLFA 3CF6E 4IM2A 2CJOA 4WWNA 3H7SA 2WGSA 2IYDB 4I6PA 1WJNA 4JPSA 1FXIA 3NS1A 1WGDA 1XCQL 4FA6A 4EOYA 3NZ3A 3ML9A 2N9KA 2BB6A 2DLBA 3ZNHB 2R2OA 4WURA 3ZO5B 2KLGA 1WYWB 3KLSX 3M62B 3VH4B 5IP4D 2BKRB 4REZA 3IG3A 4MM3A 2KX0A 3N9YC 2XBBC 1F1HA 2D2QA 2W82A 2BYEA 2FUG1 4ZRPA 2MH7A 2SEBD 2JWUA 1XT9B 2KANA 1V8CA 1PGBA 1J0GA 2PJHA 3L13A 2K25A 4BKSD 3NRZA 4MACA 1MG8A 1N63A 4AJYB 3M95A 3TEZA 1DOXA 3UINB 4Q2JA 4URKA 4OVZA 2GRIA 1R4NB 4P6VF 3VDZA 3T3OA 3A4SC 2PEAA 4PYUA 4IWQA 3TEWA 2L00B 3IHPC 1C3TA 1J7CA 5H92C 3P63A 4LCDE 4NAMA 4KGRA 2TSSA 1LGRA 1MVKA 3A1QA 3RN9C 3ZYYX 2LGIA 1L2NA 1WJ6A 2KTFA 2NBVB 4HDQA 3OAWA 1YJJA 3H7PA 2MBHA 4DXGA 3DBLB 1QOBA 3ZDTA 1PQSA 3A9JB 4US9A 3AB5A 3OWEB 1JW9D 4MJSB 4HXDA 2ASQA 2EKIA 4JX1C 3N32A 2KTRB 2LGSA 4WH4A 5DPSA 1WSPA 2INNE 2KZRA 3RULA 3URYA 2BB5A 2LRUA 2LVPA 5L83A 2ONQA 1CQVA 2MSED 2V3PA 2UWQA 2I38A 1SJED 3HM3A 3TEXA 1Z2MA 2WXGA 1SXTA 4KDIC 2N0SB 2WWZA 3JSVB 4C80A 2V3NA 3N1YC 3OLMD 1IPGA 4OW0A 1ZDXA 5CHVC 5C2TB 4J6IA 3V6CB 2BS2B 2J53A 1GJZA 1FMAD 4M02A 2FNJB 3ETRA 3MC0B 3IT6B 1XQQA 3HVZA 3VRBB 4US8A 2BTEA 2BYTA 1P9DU 3PZDA 1LO5D 3Q3FA 3FILB 3BWUD 4HCNB 1V9JA 1HE8A 4DDID 1V81A 2KJHB 2IDYA 4IW0A 3MFGA 1N5XA 2KNBA 1N6ZA 1S3SG 1XD3B 2MWSB 3B08A 4RM8A 3QAQA 1V5TA 4K7WA 5H8YE 5HG2A 2UYZB 4WJOA 4KKIA 3MHSD 2FIDA 1TY2A 4AWJA 2C5LC 1GOZA 2OHFA 1ROEA 1SE4A 2WXQA 2O2VA 2C7MB 3AE9B 3R66C 4A9AA 3EFUA 1XCTL 3AEDB 4C56C 1R7SA 3A4RA 1UGJA 1NI2A 1SSNA 1WJ4A 4EKUA 1QLBB 4LNNA 4EEWA 1ZDVA 1NBFC 2HJ8A 2FUHB 4W9KA 2DBYA 2KQ7A 2JPHA 2IGDA 3GB1A 2KWUB 5IKCM 1QKZA 1TGZB 5LLIA 5EDSA 3CMMB 3ZKJC 3GS2A 1TZ1A 1VLBA 2ICIA 2V3SA 4RCOA 4LDTB 4GXBA 4DHJD 1CMXB 4OHJA 1KJTA 3AE7B 3C0RB 1EWYC 3TMPB 3DWGC 2DHZA 4NAWA 2AQ3B 3C19A 4F7ZA 1F0ZA 2LJIA 2BYFA 2N7DA 4ZRJA 1EU4A 2IO0B 2KDFB 3Q69A 2CKHB 2WU2B 5FKAC 2RMMA 2KO3A 2RSUA 3AI5A 5BO4B 2FIFA 4FN2A 1WIAA 2G1EA 2PPHA 2GBMA 3IBEA 4TQ0A 1VCBA 4BKSA 2WXHA 2K8HA 2KN5A 1WXSA 3V3XA 3IAM1 5DPTA 2LFIA 2VZKD 1P7EA 4BFRA 3PLVA 4DDGD 3ZDMC 1WRDB 2AL6A 2I1JA 1QOGA 3ZXRA 2KDIA 2JX5A 1C79A 1GNUA 2JQRB 2NBWB 2BT6A 1NI3A 1ZW7A 1WGGA 4M0WA 4RMAA 2N7EA 1DYQA 2KKCA 2JT4B 2NVUI 3GZNI 2LJ5A 3I63C 3W1SC 2LHDA 3DBSA 2E6XA 5D2MB 2G4DB 1V6EA 4WAFA 4O1NA 1OQQA 3NJTA 1PFDA 1E7PB 4WWMA 4HPPA 1I42A 1VDVA 4AP4C 2NPTA 1EF1A 2GOWA 1XLQA 4CO7A 5LNK1 4MM3B 5EE9A 2EKEC 3B9JA 4NPNA 1PUTA 3CIRB 3N3KB 1WR6E 1FO4A 4H2AA 4TV3A 4HROA 3UI3A 2D3GA 1Z5SB 3S2AA 2AQ1B 1HA5A 2C60A 2G4SA 4K7UA 3RNCC 3NZUA 3N1XC 2K8CA 5G5HA 5CHFA 1LFDA 3H6NA 5C3JB 2JYEA 1ESFA 1F2RI 4MSQB 3WIMA 2WHIA 1IBXA 2W3SA 3U7DA 1UGMA 3ZNID 1ZXIA 2OEDA 2LXAA 5BYRA 5LXHA 4L2YA 4ZYSA 1S1QB 3PHWB 4FADA 4KZCA 2N1VA 2IO2B 2J0MA 1M4VA 2DYBA 1MPEA 4HDOA 2WX0A 1KTKA 4KGTA 3VUWA 2HD5B 4GIVA 1PGXA 5LXIB 1C4AA 3KWVA 4A8XC 1WXVA 4AUQC 1EF5A 1WZ0A 1E0ZA 3PRMB 2N9XA 3DHIC 4AJWA 1YQ4B 2M1MA 4JQWC 4DXFA 1TY0A 2IGHA 2MJEA 4S0RA 4NJ7A 3UGBB 4C4VA 1JMLA 2MLBA 1N5WA 2MA9B 1YQBA 2KWDA 3GZNB 2J0JA 1XF5L 2M0AA 4AS1A 1TJEA 3DBRI 4LNIA 3GE8C 4LJPB 5AZHA 4EZKA 2KT7A 1IUEA 2KDMA 1ZUD2 2JYTA 3MJ5A 3TUOA 4JIOU 3I57A 2K6DB 2MCNB 1E8YA 1OEYJ 3Q8BA 3ZTCA 1JWAD 3QJZA 1TIFA 1VJKA 1Q10A 4B0MA 1CK1A 1JROA 1TKGA 4A3OA 1WX9A 1OEYA 3P4PB 2KACA 1KRHA 2NTSA 4ANUA 4OZCA 2WU5B 2Z0DB 3HIZA 3RFZB 4ANXA 4K7SA 4ANVA 1D5MC 3AMZA 1IYFA 4YT0B 1MFWA 1KLUD 3NVYA 4II2B 3PGEA 3PZ8A 3VTUA 4IM0A 2N7JA 3L16A 4G0NB 4FHJA 2MP2A 4TSSA 3HVDA 3EGRA 3P42A 4HPMB 5DCNA 1WMHA 1I4GA 5HFYA 1WM3A 2FCSA 1WGKA 4NY0A 1C9FA 2GBKA 3CSTA 1ZOYB 1L7YA 1RWSA 3R8BA 2PTLA 4BKTA 4UDUC 1UWMA 4ASWC 4C00A 1WJUA 3ZXVA 1E9MA 2K1FA 1F52A 1AN8A 1V1PA 3DBHB 1L6UA 2MEKA 4LLGM 2H89B 2LGYA 3VH3B 4A55A 1J7AA 4GDLA 3UQBA 3AULA 1QQRA 3C8YA 3V61A 1KLVA 2WXFA 4HCPB 1JQ4A 2KOXA 4RH6A 1C77A 4RM9A 2KFKB 5TR5A 1TKYA 1WH3A 3DBRB 1FIQA 1JRPA 3NS8A
chains in the Genus database with same CATH topology
1TIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIF A; 
#chains in the Genus database with same CATH topology
 3ZQ4 A;  4DHZ B;  3U4E G;  3SFD B;  4FJV B;  3LXF A;  2LI5 A;  5GXG B;  1I4H A;  2QCZ A;  4QAY A;  2N1W A;  3QX1 A;  2XNA C;  5IAA C;  2BS3 B;  2Y5B B;  4MGZ E;  4W9C A;  3PVL A;  1QOA A;  1Y56 A;  5AUK A;  1FRR A;  3UIP B;  3L10 B;  1F2R C;  3TEY A;  1GB1 A;  2HTH A;  4RGN A;  3N20 C;  4PS7 A;  2IBI B;  4XE0 A;  3IAS 1;  5MPO A;  2BYV E;  1K53 A;  1UUP A;  3W5V B;  3M3J A;  1WE7 A;  3Q6B A;  4NJ6 A;  3VTV A;  3VVW B;  4G50 A;  2DWQ A;  2JVC A;  2LHE A;  1V49 A;  2C7N B;  2NPT B;  2RD0 A;  1AAR A;  1L5P A;  3P4R B;  3Q3N C;  2WXR A;  2JSV X;  1R4M B;  1NVI D;  1WXQ A;  3L0W B;  4IOI E;  4WJN A;  2VH1 A;  2V4L A;  1L4Z B;  1RFK A;  1Q5W B;  3EA6 A;  3AV8 A;  3B2F A;  4TMA B;  3KUC B;  3QCA A;  4S17 A;  1YJI A;  2KWV B;  3KH0 A;  4ARI A;  2D07 B;  3VFK A;  3ZNZ B;  2LAS A;  1V5O A;  1SE2 A;  1JWB D;  4N9F 4;  1J8C A;  2ACZ B;  4G3X B;  2WDV B;  2PW9 A;  2MJ3 A;  2G3Q B;  3L54 A;  5GMV A;  2HE7 A;  2MQJ A;  1VZ7 A;  5EE1 A;  1PYW D;  2LMC A;  3AE1 B;  1ACC A;  2LUM A;  1YD8 U;  1FD6 A;  1UBQ A;  2X8X X;  2QJL A;  4FJZ A;  1ZE3 D;  2XK5 A;  3MTN B;  1K50 A;  3BK2 A;  3DVN V;  5C23 A;  3ZRF A;  1P1A A;  1AWD A;  1WFY A;  3GE3 C;  1FXA A;  1E7U A;  1A70 A;  2ZNV B;  4XC2 A;  5JXV A;  3EEC A;  1AW7 A;  3P4S B;  1H8C A;  1UZX B;  4EZL A;  3KUZ A;  1D4B A;  3LDZ E;  2YEP F;  1A5R A;  3ZLZ A;  4KGS A;  3NOB A;  5BYS A;  3BII D;  2LXC A;  3BZD B;  2L52 A;  4W9H A;  3VR9 B;  1ET6 A;  1WF9 A;  1YJ1 A;  1GAQ B;  2R61 A;  3I9V 1;  4HPL B;  2KJ6 A;  3ZW3 A;  3HUI A;  3U52 E;  1SB3 C;  3PO0 A;  2NTT A;  3PT2 B;  4KIK B;  5IO9 A;  3ONS A;  4B9K A;  4CYE A;  1FFU A;  2WP9 B;  3AN1 A;  2M0X A;  1P0R A;  2BVC A;  5J17 A;  3IXS A;  2K6Q A;  2Y5P A;  3ML8 A;  4FBJ B;  2NCN A;  1NYR A;  3AEA B;  1WY8 A;  2ON8 A;  1E6E B;  1KM7 A;  2QIE B;  2RPV A;  3DOW A;  4A90 A;  1TTN A;  4E3C A;  3DQV A;  5D3D A;  1FNV A;  3U30 A;  3APF A;  3BY4 B;  3HM6 X;  2B76 B;  4LTU A;  2H88 B;  2VZK B;  3RZW C;  4WWO A;  5HKH A;  4PS8 A;  4KV2 A;  3AXC A;  1RFA A;  1D3Z A;  4L1B A;  3ENE A;  4B95 A;  2PMV A;  4GDK B;  4JLC A;  4TUU A;  1J7B A;  4BOS C;  2L76 A;  2BW2 A;  3AU4 A;  4BAX A;  3PLU A;  3KUD B;  1VRA B;  1WMH B;  5TSS A;  1I4X A;  5AZF A;  1SJH D;  2I1K A;  2ZNV C;  3NY5 A;  4IC7 B;  2KYW A;  4K3C A;  4MT5 A;  2K22 A;  1TS2 A;  1I35 A;  5JHA A;  2JRI B;  2WXK A;  3B1L X;  3HRD D;  1V97 A;  3VQI A;  2GBR A;  3KWL A;  4XYC A;  2OJW A;  5FR6 A;  2GBN A;  1V1P B;  3ZGZ A;  4FJY A;  4XWT A;  2FCQ A;  1SBB B;  1JCK B;  2WXL A;  5DPW A;  2KD0 A;  4PS3 A;  2VH2 A;  2Y3A A;  4IUM B;  3PRE A;  5BMI A;  1BUI C;  3PRP B;  1ZPS A;  4YXD B;  1K52 A;  2CHW A;  4BBN C;  1TS4 A;  2JZP A;  1P7F A;  2K39 A;  2D3A A;  2ZPN A;  3ZNG C;  3AE4 B;  1WZ3 A;  3QA8 A;  1JWM D;  1P98 A;  4HKZ E;  3SR6 A;  4PK1 A;  2L83 A;  5JH5 C;  3SDL C;  4A6Q A;  1DOY A;  1V86 A;  2NR2 A;  3R7R A;  2EMT A;  4I6N B;  3W9C B;  4DQO C;  5BMG A;  4EE2 A;  1T6B X;  3W1Y A;  1UBI A;  4MH8 A;  4GSW A;  4LDT D;  1TZO A;  3LYY A;  1ISN A;  3NVV A;  3RI7 C;  1SIF A;  2N9E B;  3EFC A;  1V80 A;  1UWX A;  3VAW A;  1L4D B;  1LM8 B;  1WR1 A;  3IT4 B;  3N30 A;  5EE3 A;  4ZRQ A;  1FCL A;  1T0R C;  1XLO A;  4LK0 M;  2W55 A;  2IO3 B;  3PSE B;  2E3T A;  3KQ4 A;  5IA7 A;  2WQY B;  2JU6 X;  2REX A;  2KLC A;  3SEB A;  1XLN A;  3AEE B;  2EEL A;  5EE0 A;  3R2I A;  2KAJ A;  3RCZ A;  3VTW A;  1JAL A;  2KN4 A;  5CHW A;  3NHE B;  4NZL B;  2FCN A;  2QMT A;  1HXY D;  4J3O D;  2NBU A;  4NJC A;  3AEG B;  2BBC A;  1I7H A;  3U7Z A;  2DAF A;  3A1Q B;  3ZJT A;  1LQB A;  4A3P A;  4ZHP A;  3WAM A;  2A4Z A;  3H7P B;  1X1M A;  1E7V A;  1ZXH A;  1MHX A;  1D5Z C;  4JWU C;  4IM3 A;  2JY6 A;  4P7I A;  4M8M A;  2J52 A;  2CU3 A;  3Q8C A;  2OOB B;  3RYT A;  4LNK A;  2BKF A;  2GMI C;  1EM7 A;  1AYF A;  1I4P A;  4GLS C;  3D32 A;  3ZIM A;  2IGG A;  2KTR A;  1G6J A;  1OQY A;  1FNU A;  1ET9 A;  2ZW0 A;  1MI0 A;  3AEF B;  3VUX A;  1TYG B;  1HZ6 A;  1WXA A;  2RPQ A;  4HKQ A;  3JSV A;  4RGT A;  5DPR A;  4ARC A;  2ZW1 A;  2YVC A;  3JVZ X;  3Q3M C;  2GLS A;  2LGX A;  2DYM A;  3WAO A;  3B2G A;  2N4F A;  2KQS A;  2Z59 B;  4XDC A;  1E8Z A;  3UQA A;  5AZG A;  3AH7 A;  3Q14 C;  2J42 A;  2JUO A;  3AE8 B;  3IVF A;  1SIJ A;  4ANW A;  3VRA B;  2R2Q A;  1UF0 A;  1U4A A;  3LJ3 A;  2L1A A;  3MP9 A;  3PTF C;  3M63 B;  4XX5 A;  4ACF A;  3VR8 B;  3AEC B;  3DPD A;  1KOT A;  1C4C A;  2D3B A;  4DBG A;  2FCM A;  2O2V B;  2MBE A;  4PYZ A;  3TL5 A;  2QIL A;  3APD A;  4FUL A;  3Q2A C;  4OVU A;  3W1S A;  2RDB C;  4EFO A;  4BKG A;  4AOF A;  3VXW A;  1IGC A;  1ZP0 B;  4ZRK A;  2DZM A;  1FRD A;  1JWS D;  4HEA 1;  5I4D A;  1UH6 A;  2BF8 B;  3U8Z A;  1TS5 A;  2G9H D;  4NQL B;  4W9L A;  3K9O B;  4KSK C;  4MDK E;  1RM6 C;  4NAW B;  3MJW A;  3PRZ A;  4MH0 E;  1KFY B;  5C1Z A;  2LD9 A;  3QC8 B;  4KSL C;  4YTN B;  1HEZ E;  3R2T A;  3DVG X;  4XZ4 A;  3I3T B;  4XWW A;  2WXO A;  4TQ1 A;  2K5P A;  2K8B A;  2AL3 A;  4F1S A;  1I4Q A;  2LEK A;  2RDH A;  1HTQ A;  2KK8 A;  2MRP A;  1WWT A;  5L95 C;  2O6V D;  1EWC A;  3RD2 A;  2KX3 A;  3T8M A;  4DXA B;  3CSF A;  1N61 A;  1GC7 A;  1SGH A;  1CJE A;  2HTM E;  1OTR B;  4M0W B;  4GB9 A;  5E6J A;  3WAN A;  3SHQ A;  3QWZ B;  2KVR A;  1T0Q C;  3BYT B;  3MHZ A;  4USA A;  3R3M A;  4E74 A;  3ALB A;  2W9N A;  3AE3 B;  4DK5 A;  1E10 A;  1RAX A;  1BML C;  2W3R A;  3FKY A;  3BVM A;  1WGH A;  1HZ5 A;  3DDC B;  3PS6 A;  5HHD G;  3X0W A;  2FBW B;  3RZF A;  4BBN F;  1LXD A;  2EMS A;  3PZ7 A;  5T8I A;  1VD2 A;  2INP E;  3RPF C;  1TBE A;  2AX5 A;  2Z0E B;  4GOC A;  2IPK D;  2ZCB A;  2WXJ A;  2L0F A;  2ZZP B;  1YN3 A;  2DZK A;  1EUV B;  2MX2 A;  3Q3O C;  3DCG A;  1IBX B;  2QDF A;  1GC6 A;  1E90 A;  1B1Z A;  3P2B A;  2CU1 A;  3WAP A;  4N58 A;  1YIW A;  3HK0 A;  4GMV A;  3A33 B;  1SE9 A;  3OG5 A;  4LNO A;  2DAJ A;  1QOF A;  2PE6 B;  5E6P A;  4G11 A;  4HRS A;  4ZDV A;  1GB4 A;  4IG7 B;  2DZJ A;  4IWP A;  2L32 A;  4M8N A;  1YMH E;  2LGD A;  2KWC A;  3RNB C;  3DWM A;  2A5U A;  4W9D A;  2N9L A;  2AEH A;  4ZYN A;  3B0A A;  2IO1 B;  1V1O A;  2RR9 A;  5J2R A;  4RFB A;  4F8C B;  4I6L B;  4KVG B;  1EU3 A;  1YX5 B;  1KF6 B;  3E56 A;  1L6V A;  2J7Q B;  3X23 A;  3BVZ A;  4C4V B;  1ZGU B;  3UF8 A;  1MG4 A;  4LJO B;  3DVN U;  1WX7 A;  1GG3 A;  2AQ2 B;  3Q8E A;  1NEN B;  2GBJ A;  3ABV B;  1FCC C;  2BS4 B;  4E71 A;  4DHJ B;  1RRB A;  3RMK C;  4MGY E;  4ITK A;  1NYQ A;  3NVW A;  4RF1 A;  1WXM A;  1EO6 A;  4P1B C;  3A9K A;  1K8R B;  1F77 A;  2SAK A;  1F9J A;  4YSZ B;  5G2N A;  3L08 A;  1YN5 A;  3Q3J A;  5AUI A;  4YTM B;  5FR3 A;  3QAR A;  3T9L A;  1WGY A;  4K1R B;  3DHG C;  1QT9 A;  3U2S C;  4N59 A;  2HDE A;  1N60 A;  2L7R A;  3J9C A;  2WXI A;  4KKJ A;  4MGI E;  2M8S A;  3KYC D;  2ZVN A;  3AE2 B;  4WAA A;  1FXT B;  2FE8 A;  1PGA A;  2B3A A;  2G45 B;  4YSX B;  2K0P A;  4RGM A;  2L8J A;  1QIL A;  1P3Q U;  3TCA A;  1T0S C;  3GOE A;  1KLG D;  2O6V A;  2MP2 B;  2VRR B;  2KMC A;  4M01 A;  4OZA A;  1FFV A;  2YLM A;  4YSY B;  2RDG A;  3UIO B;  3MC9 A;  1YOV B;  1XO3 A;  4B0E A;  2NMQ A;  4ICV A;  2BWE S;  2JRH A;  4A20 A;  4YTP B;  4WQM A;  1XXG A;  1YQ3 B;  2PIA A;  4KX6 B;  3RNA C;  3R7Q A;  2LVQ A;  5KHQ A;  4GU2 A;  4WJP A;  5JZE B;  4DHZ E;  1GUA B;  1L0X B;  2KVZ A;  4ICU A;  3JYU A;  1C78 A;  3AEB B;  2AYO B;  4ZRI A;  2KQ4 X;  2LVO A;  3OJ3 A;  4GDL B;  3O13 A;  3RNG C;  3BYY B;  4RF0 A;  2QHO A;  4NNJ B;  3V6E B;  4II3 B;  4ZHO A;  3AE5 B;  1D6E C;  2UU7 A;  4NQK E;  1FNW A;  3H1U A;  4N6E B;  2KDE B;  4W9I A;  3O65 B;  2Y5C A;  2KC1 A;  1KH0 A;  1CZP A;  1MHH E;  1YX6 B;  2KFK A;  1V2Y A;  3V05 A;  3H8H A;  2LUE A;  2V1Y A;  2YEP B;  2M56 B;  2MBQ A;  1L0Y B;  3NVZ A;  2QSD A;  1JWU D;  5D3I B;  2WXM A;  2XN9 C;  2X38 A;  1E8W A;  3KVF B;  2LWP A;  4L23 A;  2KHW B;  3ZJV A;  2K9X A;  2L3Z A;  2L0T A;  4C7Y A;  3KYD D;  4XGA B;  1PDX A;  5E6N A;  4M00 A;  1T5X D;  4MGK E;  1C1Y B;  4JGH B;  1NEK B;  3NZS A;  3E9S A;  5AEK B;  2ZCC A;  3RUI B;  1WYG A;  5E6O A;  2WXP A;  2HJ1 A;  5CTR C;  2WDR B;  2LZ6 A;  2JZZ A;  2WLB A;  3ZJU A;  2DYO A;  3JW0 X;  1E5W A;  1I4R A;  1Q0W B;  2Q5W D;  3SU8 X;  1BT0 A;  2MBB B;  3H9D A;  3KW5 B;  2C7H A;  1SE3 A;  2D3C A;  2M4N A;  4OZB A;  4JWS C;  4MSM B;  5D7G A;  3QIJ A;  1B9R A;  1DGJ A;  3IFW B;  1STE A;  2CS4 A;  2PLP A;  2KMM A;  2LRW A;  3ECI A;  5FK9 C;  2FAZ A;  4IKG A;  3BIN A;  2ZJD A;  3TBL D;  4FHK A;  4JE3 B;  2CR5 A;  3RT3 B;  1IP9 A;  1YNT E;  2ZEQ A;  2K3U A;  3GP7 A;  2DEN B;  4GN1 A;  1TKE A;  3ZTD A;  3V62 A;  1NDD A;  5G5G A;  2J4X A;  3T3N A;  3I5J C;  4YL8 A;  3EHV A;  1ZKH A;  3ZUN A;  3DHH C;  5IOI A;  3WA0 A;  1FPY A;  4HJG E;  5BMH A;  1UD7 A;  3Q8F A;  4K3B A;  3ZRC A;  3NG0 A;  1WRI A;  1MJD A;  1SEB D;  3HHM A;  2CJN A;  1TT5 B;  2KC2 A;  2XK5 B;  2JXT A;  4CQN A;  2AWT A;  2XEW A;  3A9J A;  3OJ4 B;  3EC8 A;  1YN4 A;  1HQR D;  4MJS A;  1Y8R C;  3NUH B;  4AQ7 A;  5BYQ A;  2W54 A;  1K51 A;  2WX1 A;  3RNF C;  4BVU C;  4XDD A;  3VUY A;  2M17 A;  2KDB A;  3ZVV A;  2PE9 A;  1T0Y A;  3QQ8 B;  1RYJ A;  2D5G A;  2I2Y A;  4HK2 A;  4MEL A;  2QEJ C;  2NS5 A;  3DBH I;  2L05 A;  4WQO B;  3QHT A;  1IGD A;  1VZ8 A;  2WS3 B;  5J18 A;  2D11 A;  2MHJ A;  2Z8L A;  4OVV A;  3EUB 2;  3SD5 A;  3CWI A;  4KDL B;  3P4Q B;  2C9W B;  1VZ6 A;  2MBO A;  2BPS A;  4R3D A;  3FIL A;  2IJ0 A;  2JWZ A;  1JRU A;  4HWI B;  4FLH A;  2ZVO A;  3A9K B;  3K9P B;  4KIK A;  1BXT A;  2M19 A;  3TJP A;  2CHX A;  1WX8 A;  2KMA A;  2IND C;  1L0V B;  1XEE A;  4P16 A;  2QC8 A;  1DOI A;  3Q8A A;  4IDI A;  2BWF A;  4EUT A;  4WWP A;  2IY1 B;  1UNS A;  4C7Z A;  3PPA A;  2WDQ B;  4WJQ A;  3V60 A;  5CX3 A;  3PV1 A;  3APC A;  3WCQ A;  1E8X A;  2KFJ A;  2BQQ A;  4BZA A;  2V9H A;  3RNE C;  5KHO A;  3VHT C;  2PKO A;  2BGF A;  2MW5 A;  2O6V B;  1ENF A;  1OFF A;  2DX5 B;  4FXC A;  3SFE B;  1SF0 A;  4JL9 A;  3MC8 A;  4B6W A;  3P1M A;  4WIP A;  1UEL A;  2KJR A;  5D6J B;  4BOZ B;  1QZE A;  3L17 A;  4GDK A;  4EZJ A;  2D10 A;  1FEH A;  1WE6 A;  2WNM A;  2GI9 A;  2ZPY A;  3FAH A;  1R4M I;  2DNF A;  4K81 A;  4CHK A;  4KZ0 A;  4W9E A;  1GPX A;  3LB8 C;  1D5X C;  1T3Q A;  2V4I B;  3FC4 A;  3AU5 A;  1FM0 D;  2KXJ A;  5D94 A;  3W5U B;  4DWF A;  4RNA A;  3TSS A;  1OGW A;  3AE6 B;  2WXN A;  1J19 A;  1OQR A;  4PT5 A;  2JXX A;  2WYQ A;  5G55 A;  1R4N I;  2CHZ A;  4RGO S;  4TKN A;  2N9P C;  4YWG G;  4IWO A;  3BVG A;  1C4P A;  2PVG C;  5JHB A;  1M94 A;  2OJR A;  4W9J A;  1XLP A;  4D2K A;  4P1C C;  1HTO A;  2GB1 A;  4LNF A;  1WI0 A;  2V0G A;  5HI1 A;  4GGQ A;  4W9G A;  3W2D A;  2MJD A;  4HJK A;  3QK0 A;  2DZI A;  3TIX A;  3DBL I;  2JZ3 B;  4X57 B;  2JF5 A;  2RGF A;  3L4P A;  5IN7 A;  3DVG Y;  3N1Z C;  1C76 A;  1WGR A;  4HVB A;  2IZV B;  1H4R A;  4HLE A;  2INC C;  3PHX B;  2PVO D;  3BK1 A;  1QF6 A;  2WDT B;  1N62 A;  1WM2 A;  1TS3 A;  3WAL A;  1Q1O A;  2IY0 B;  2J0K A;  4ZOH C;  3AM9 A;  1VR9 A;  4MEM A;  4W9F A;  1RLF A;  3CF6 E;  4IM2 A;  2CJO A;  4WWN A;  3H7S A;  2WGS A;  2IYD B;  4I6P A;  1WJN A;  4JPS A;  1FXI A;  3NS1 A;  1WGD A;  1XCQ L;  4FA6 A;  4EOY A;  3NZ3 A;  3ML9 A;  2N9K A;  2BB6 A;  2DLB A;  3ZNH B;  2R2O A;  4WUR A;  3ZO5 B;  2KLG A;  1WYW B;  3KLS X;  3M62 B;  3VH4 B;  5IP4 D;  2BKR B;  4REZ A;  3IG3 A;  4MM3 A;  2KX0 A;  3N9Y C;  2XBB C;  1F1H A;  2D2Q A;  2W82 A;  2BYE A;  2FUG 1;  4ZRP A;  2MH7 A;  2SEB D;  2JWU A;  1XT9 B;  2KAN A;  1V8C A;  1PGB A;  1J0G A;  2PJH A;  3L13 A;  2K25 A;  4BKS D;  3NRZ A;  4MAC A;  1MG8 A;  1N63 A;  4AJY B;  3M95 A;  3TEZ A;  1DOX A;  3UIN B;  4Q2J A;  4URK A;  4OVZ A;  2GRI A;  1R4N B;  4P6V F;  3VDZ A;  3T3O A;  3A4S C;  2PEA A;  4PYU A;  4IWQ A;  3TEW A;  2L00 B;  3IHP C;  1C3T A;  1J7C A;  5H92 C;  3P63 A;  4LCD E;  4NAM A;  4KGR A;  2TSS A;  1LGR A;  1MVK A;  3A1Q A;  3RN9 C;  3ZYY X;  2LGI A;  1L2N A;  1WJ6 A;  2KTF A;  2NBV B;  4HDQ A;  3OAW A;  1YJJ A;  3H7P A;  2MBH A;  4DXG A;  3DBL B;  1QOB A;  3ZDT A;  1PQS A;  3A9J B;  4US9 A;  3AB5 A;  3OWE B;  1JW9 D;  4MJS B;  4HXD A;  2ASQ A;  2EKI A;  4JX1 C;  3N32 A;  2KTR B;  2LGS A;  4WH4 A;  5DPS A;  1WSP A;  2INN E;  2KZR A;  3RUL A;  3URY A;  2BB5 A;  2LRU A;  2LVP A;  5L83 A;  2ONQ A;  1CQV A;  2MSE D;  2V3P A;  2UWQ A;  2I38 A;  1SJE D;  3HM3 A;  3TEX A;  1Z2M A;  2WXG A;  1SXT A;  4KDI C;  2N0S B;  2WWZ A;  3JSV B;  4C80 A;  2V3N A;  3N1Y C;  3OLM D;  1IPG A;  4OW0 A;  1ZDX A;  5CHV C;  5C2T B;  4J6I A;  3V6C B;  2BS2 B;  2J53 A;  1GJZ A;  1FMA D;  4M02 A;  2FNJ B;  3ETR A;  3MC0 B;  3IT6 B;  1XQQ A;  3HVZ A;  3VRB B;  4US8 A;  2BTE A;  2BYT A;  1P9D U;  3PZD A;  1LO5 D;  3Q3F A;  3FIL B;  3BWU D;  4HCN B;  1V9J A;  1HE8 A;  4DDI D;  1V81 A;  2KJH B;  2IDY A;  4IW0 A;  3MFG A;  1N5X A;  2KNB A;  1N6Z A;  1S3S G;  1XD3 B;  2MWS B;  3B08 A;  4RM8 A;  3QAQ A;  1V5T A;  4K7W A;  5H8Y E;  5HG2 A;  2UYZ B;  4WJO A;  4KKI A;  3MHS D;  2FID A;  1TY2 A;  4AWJ A;  2C5L C;  1GOZ A;  2OHF A;  1ROE A;  1SE4 A;  2WXQ A;  2O2V A;  2C7M B;  3AE9 B;  3R66 C;  4A9A A;  3EFU A;  1XCT L;  3AED B;  4C56 C;  1R7S A;  3A4R A;  1UGJ A;  1NI2 A;  1SSN A;  1WJ4 A;  4EKU A;  1QLB B;  4LNN A;  4EEW A;  1ZDV A;  1NBF C;  2HJ8 A;  2FUH B;  4W9K A;  2DBY A;  2KQ7 A;  2JPH A;  2IGD A;  3GB1 A;  2KWU B;  5IKC M;  1QKZ A;  1TGZ B;  5LLI A;  5EDS A;  3CMM B;  3ZKJ C;  3GS2 A;  1TZ1 A;  1VLB A;  2ICI A;  2V3S A;  4RCO A;  4LDT B;  4GXB A;  4DHJ D;  1CMX B;  4OHJ A;  1KJT A;  3AE7 B;  3C0R B;  1EWY C;  3TMP B;  3DWG C;  2DHZ A;  4NAW A;  2AQ3 B;  3C19 A;  4F7Z A;  1F0Z A;  2LJI A;  2BYF A;  2N7D A;  4ZRJ A;  1EU4 A;  2IO0 B;  2KDF B;  3Q69 A;  2CKH B;  2WU2 B;  5FKA C;  2RMM A;  2KO3 A;  2RSU A;  3AI5 A;  5BO4 B;  2FIF A;  4FN2 A;  1WIA A;  2G1E A;  2PPH A;  2GBM A;  3IBE A;  4TQ0 A;  1VCB A;  4BKS A;  2WXH A;  2K8H A;  2KN5 A;  1WXS A;  3V3X A;  3IAM 1;  5DPT A;  2LFI A;  2VZK D;  1P7E A;  4BFR A;  3PLV A;  4DDG D;  3ZDM C;  1WRD B;  2AL6 A;  2I1J A;  1QOG A;  3ZXR A;  2KDI A;  2JX5 A;  1C79 A;  1GNU A;  2JQR B;  2NBW B;  2BT6 A;  1NI3 A;  1ZW7 A;  1WGG A;  4M0W A;  4RMA A;  2N7E A;  1DYQ A;  2KKC A;  2JT4 B;  2NVU I;  3GZN I;  2LJ5 A;  3I63 C;  3W1S C;  2LHD A;  3DBS A;  2E6X A;  5D2M B;  2G4D B;  1V6E A;  4WAF A;  4O1N A;  1OQQ A;  3NJT A;  1PFD A;  1E7P B;  4WWM A;  4HPP A;  1I42 A;  1VDV A;  4AP4 C;  2NPT A;  1EF1 A;  2GOW A;  1XLQ A;  4CO7 A;  5LNK 1;  4MM3 B;  5EE9 A;  2EKE C;  3B9J A;  4NPN A;  1PUT A;  3CIR B;  3N3K B;  1WR6 E;  1FO4 A;  4H2A A;  4TV3 A;  4HRO A;  3UI3 A;  2D3G A;  1Z5S B;  3S2A A;  2AQ1 B;  1HA5 A;  2C60 A;  2G4S A;  4K7U A;  3RNC C;  3NZU A;  3N1X C;  2K8C A;  5G5H A;  5CHF A;  1LFD A;  3H6N A;  5C3J B;  2JYE A;  1ESF A;  1F2R I;  4MSQ B;  3WIM A;  2WHI A;  1IBX A;  2W3S A;  3U7D A;  1UGM A;  3ZNI D;  1ZXI A;  2OED A;  2LXA A;  5BYR A;  5LXH A;  4L2Y A;  4ZYS A;  1S1Q B;  3PHW B;  4FAD A;  4KZC A;  2N1V A;  2IO2 B;  2J0M A;  1M4V A;  2DYB A;  1MPE A;  4HDO A;  2WX0 A;  1KTK A;  4KGT A;  3VUW A;  2HD5 B;  4GIV A;  1PGX A;  5LXI B;  1C4A A;  3KWV A;  4A8X C;  1WXV A;  4AUQ C;  1EF5 A;  1WZ0 A;  1E0Z A;  3PRM B;  2N9X A;  3DHI C;  4AJW A;  1YQ4 B;  2M1M A;  4JQW C;  4DXF A;  1TY0 A;  2IGH A;  2MJE A;  4S0R A;  4NJ7 A;  3UGB B;  4C4V A;  1JML A;  2MLB A;  1N5W A;  2MA9 B;  1YQB A;  2KWD A;  3GZN B;  2J0J A;  1XF5 L;  2M0A A;  4AS1 A;  1TJE A;  3DBR I;  4LNI A;  3GE8 C;  4LJP B;  5AZH A;  4EZK A;  2KT7 A;  1IUE A;  2KDM A;  1ZUD 2;  2JYT A;  3MJ5 A;  3TUO A;  4JIO U;  3I57 A;  2K6D B;  2MCN B;  1E8Y A;  1OEY J;  3Q8B A;  3ZTC A;  1JWA D;  3QJZ A;  1TIF A;  1VJK A;  1Q10 A;  4B0M A;  1CK1 A;  1JRO A;  1TKG A;  4A3O A;  1WX9 A;  1OEY A;  3P4P B;  2KAC A;  1KRH A;  2NTS A;  4ANU A;  4OZC A;  2WU5 B;  2Z0D B;  3HIZ A;  3RFZ B;  4ANX A;  4K7S A;  4ANV A;  1D5M C;  3AMZ A;  1IYF A;  4YT0 B;  1MFW A;  1KLU D;  3NVY A;  4II2 B;  3PGE A;  3PZ8 A;  3VTU A;  4IM0 A;  2N7J A;  3L16 A;  4G0N B;  4FHJ A;  2MP2 A;  4TSS A;  3HVD A;  3EGR A;  3P42 A;  4HPM B;  5DCN A;  1WMH A;  1I4G A;  5HFY A;  1WM3 A;  2FCS A;  1WGK A;  4NY0 A;  1C9F A;  2GBK A;  3CST A;  1ZOY B;  1L7Y A;  1RWS A;  3R8B A;  2PTL A;  4BKT A;  4UDU C;  1UWM A;  4ASW C;  4C00 A;  1WJU A;  3ZXV A;  1E9M A;  2K1F A;  1F52 A;  1AN8 A;  1V1P A;  3DBH B;  1L6U A;  2MEK A;  4LLG M;  2H89 B;  2LGY A;  3VH3 B;  4A55 A;  1J7A A;  4GDL A;  3UQB A;  3AUL A;  1QQR A;  3C8Y A;  3V61 A;  1KLV A;  2WXF A;  4HCP B;  1JQ4 A;  2KOX A;  4RH6 A;  1C77 A;  4RM9 A;  2KFK B;  5TR5 A;  1TKY A;  1WH3 A;  3DBR B;  1FIQ A;  1JRP A;  3NS8 A; 
#chains in the Genus database with same CATH homology
 1TIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...