1TIFA

Translation initiation factor 3 n-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
KDFIINEQIRAREVRLIDQNGDQLGIKSKQEALEIAARRNLDLVLVAPNAKPPVCRIMDYGKFRFEQQKKEKEARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallography shows that translational initiation factor IF3 consists of two compact alpha/beta domains linked by an alpha-helix.
pubmed rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosome binding factor
molecule keywords TRANSLATION INITIATION FACTOR 3
total genus 24
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1995-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05198 IF3_N Translation initiation factor IF-3, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.80 Alpha Beta Roll Ubiquitin-like (UB roll) Translation initiation factor 3 (IF-3), N-terminal domain 1tifA00
1TIFA
chains in the Genus database with same CATH superfamily
2CU1A 5I4DA 2D2QA 3C0RB 3WCQA 2BB6A 4M01A 1RYJA 3UQBA 4NZLB 1NYQA 1RWSA 4D2KA 5AZHA 2Z8LA 3DWMA 2M19A 2W9NA 2DYOA 2JT4B 4IKGA 2H89B 1UBQA 2CR5A 1FXIA 1Q10A 3QJZA 1Q0WB 4IG7B 3VH3B 5BMHA 4C4VA 2WXGA 3EUB2 2JSVX 2K8BA 1XLPA 1TGZB 3W1SC 2V3PA 2RDGA 1BT0A 4WJPA 2BW2A 4OVUA 1WYWB 3TIXA 4FLHA 1ZXIA 4HK2A 1YOVB 2WHIA 2KYWA 1HQRD 1SE4A 1YMHE 2PE9A 1XCTL 3ZKJC 4MM3A 4ASWC 5CX3A 1FXTB 3UINB 4DXGA 1QOBA 1ZOYB 4BVUC 4S0RA 1XT9B 1PYWD 1YQ3B 1JRPA 1IBXB 2PPHA 1GG3A 4L1BA 1ENFA 2K6QA 2DAFA 3DVNV 5GMVA 4E3CA 5IAAC 3AB5A 2L00B 2W54A 4US9A 5D94A 1XD3B 3BIID 1FCCC 2QHOA 3VVWB 3L54A 1XCQL 3GZNB 3KWLA 2BYFA 1WZ3A 2M1MA 1YIWA 1F2RC 2LI5A 4MACA 2KWCA 3SHQA 4I6NB 3RNGC 5BMIA 1IGCA 2MEKA 3JVZX 3N3KB 2A5UA 1YX5B 3EFCA 3L4PA 3W5UB 2JF5A 3A1QB 4WJNA 3WANA 2FCMA 1QLBB 3TEXA 4A20A 4ARCA 2KQ4X 4JL9A 2LJ5A 1PGBA 3U8ZA 1SE9A 4P1BC 1NYRA 3J9CA 2E3TA 4BZAA 3WAPA 5EE9A 1UZXB 1OQQA 4EE2A 2JXTA 4MGYE 2K3UA 1WE6A 4GDKB 1JROA 2M8SA 3ONSA 3AN1A 1J0GA 5L95C 5G5GA 2DZKA 3L0WB 5FR6A 3RI7C 1J7CA 1WXQA 1RRBA 4KX6B 2QILA 2L0TA 4JGHB 3WA0A 2ZNVC 2WXRA 3WAMA 3IT6B 1YJJA 1N5WA 1C4AA 4WWPA 3V05A 3L13A 3VRBB 2YEPF 3RZWC 1C9FA 1M4VA 2PKOA 4IWOA 4KVGB 1WJUA 1GPXA 3DVGX 2JWZA 3A9JB 3PZDA 1N5XA 2LGIA 4S17A 2BS3B 1WGRA 2N0SB 3Q3MC 1JQ4A 4M02A 2NTTA 3U2SC 3OJ3A 2KJ6A 2CKHB 4KZ0A 3DPDA 3RNCC 2J42A 1UGMA 2VH1A 3N20C 2EKEC 2MP2B 1YQ4B 3AM9A 3NVYA 1ZP0B 4W9FA 1UWMA 2BYEA 1HTQA 2UWQA 4GGQA 3RCZA 1DOXA 1WRIA 4HDOA 3B2FA 2MBQA 1F1HA 5J18A 1C78A 3EA6A 3HVZA 4JX1C 1Z5SB 2N7DA 1T0RC 4W9LA 1N60A 3SEBA 2C7HA 2NS5A 1BUIC 1G6JA 1WJ6A 2KN5A 2LVQA 4AS1A 2MWSB 2BYTA 4JQWC 3EFUA 3M62B 4GN1A 4EZJA 1T0YA 2V3SA 2OJWA 4LJOB 1YJ1A 2GBNA 2L7RA 4NQLB 2PVOD 2BS2B 2ZVOA 3SDLC 3P63A 4K3BA 5IA7A 1KLUD 1YN4A 2G4DB 2KWVB 3T9LA 1FD6A 4NNJB 4N59A 3HM3A 3DQVA 2W3SA 2XEWA 1WY8A 3R7QA 1HA5A 3KUDB 2KN4A 2RMMA 2D3AA 3AE5B 2HTME 1YD8U 4LLGM 4ZYSA 1XF5L 1KM7A 4TQ1A 3P42A 3O13A 3APCA 5LXIB 1TS2A 2CU3A 3MTNB 1AARA 3RULA 5G5HA 2PLPA 3PTFC 1OQRA 2JPHA 3I63C 2SEBD 1QOAA 1QQRA 4AJWA 4ANUA 3DBHB 2G45B 3KVFB 4HJKA 4NAMA 4K7UA 1RLFA 3AXCA 4M0WB 1UELA 3TSSA 2N7JA 1HZ5A 1I4PA 4WJQA 2MBHA 2N9PC 2KAJA 3PZ7A 2XNAC 4KDLB 2IO1B 1L7YA 3A9JA 2WXPA 1WSPA 1JWSD 1VJKA 3IAM1 3JSVB 4EZLA 1FEHA 2HJ1A 5KHOA 1STEA 4JLCA 4JWUC 4MJSA 5DPRA 2KMCA 2QJLA 1LGRA 4A55A 3JW0X 2D07B 1C76A 3HIZA 1V86A 4NAWB 2LXAA 2O6VA 4DXFA 2LHEA 4AWJA 4LDTB 1GJZA 1H4RA 1EF5A 3H7PA 2CHXA 3TEZA 3W1SA 1AN8A 2FUG1 5D6JB 1AWDA 1OGWA 3VH4B 4WWNA 4ZRKA 2FBWB 3LJ3A 2J0JA 1I7HA 2KTRB 5EDSA 4WAFA 1MPEA 1XQQA 1E9MA 2AWTA 4QAYA 4HCNB 4DBGA 4F7ZA 3WAOA 2JWUA 5J17A 3GZNI 3Q3JA 4ZOHC 1WJNA 1SF0A 1WJ4A 3P2BA 4FA6A 1D4BA 2DLBA 4XDDA 2Y5BB 4HLEA 3B9JA 1FRRA 4EZKA 1WXSA 4NJ6A 2KMAA 4IM2A 4RGMA 3CWIA 1T3QA 2C7NB 5LLIA 3I9V1 5FK9C 2CJNA 1MI0A 2G9HD 4KGSA 1T5XD 1IPGA 3B2GA 2WP9B 4HXDA 3AI5A 4MM3B 1ZXHA 1TZ1A 2KFJA 4Q2JA 1D5XC 1D6EC 4L23A 3MHSD 3W1YA 2JZPA 2WXKA 3NJTA 4YSZB 2LRWA 3L10B 3ETRA 4CHKA 2YLMA 2D11A 4AUQC 4LK0M 3W2DA 4LCDE 5HFYA 2O6VD 3ZO5B 4RF0A 2MH7A 3KQ4A 3TEWA 2DYMA 2KC1A 1S3SG 1IBXA 4N6EB 2QCZA 3ML9A 4M00A 5JHAA 1UH6A 2K22A 2HJ8A 2INDC 2KLCA 3PRZA 1FXAA 3VTUA 2WXNA 1QT9A 2LMCA 3P4RB 1JWAD 3EC8A 1WX9A 1WZ0A 2XK5B 4CO7A 3BVZA 3RFZB 2MBOA 4ANVA 4NAWA 1C1YB 2ZNVB 2PIAA 2AQ3B 2ZCCA 3DHGC 3ZTCA 4NQKE 2KNBA 1R4NI 2QMTA 1ACCA 1K50A 2KDBA 4MEMA 2D10A 1ESFA 3OLMD 4WIPA 4B9KA 2JYEA 2IO3B 3O65B 3BZDB 2C5LC 3GP7A 2INCC 3V6CB 2KQSA 1RFAA 2LWPA 4I6PA 4MH8A 3N32A 2DZJA 3VHTC 2MJ3A 4HPMB 3H9DA 3QWZB 1I35A 2BQQA 4MH0E 2X8XX 1WGKA 2KXJA 2VZKB 1TYGB 1P3QU 1L0YB 3AULA 4MSQB 2RDHA 2L83A 3WIMA 3QA8A 2CS4A 1NDDA 5FR3A 3VTVA 2BKRB 1PUTA 3ECIA 1L4ZB 3DBSA 2K8CA 5D3IB 4N9F4 4PS7A 4DXAB 1I4QA 4ANXA 1TY0A 3BWUD 3B1LX 1C4PA 2GBKA 1U4AA 2WU5B 4XZ4A 1E8WA 1PQSA 2MW5A 3AE4B 2ZJDA 3ZUNA 3R7RA 2C9WB 1L5PA 4YWGG 1UF0A 4ZDVA 5IKCM 3ALBA 3R8BA 4FADA 2N9EB 3A33B 5AEKB 1ZKHA 3KYCD 1FNUA 3NG0A 1J7BA 3IT4B 2EMSA 3K9PB 1WR1A 4MGKE 3AU5A 1WE7A 1D3ZA 5LXHA 2WXQA 5D2MB 3Q3FA 1ISNA 3NRZA 4ZHOA 3QX1A 3PT2B 3DHIC 3VAWA 4F1SA 2JZ3B 1Q5WB 1FM0D 4WWMA 1JW9D 5CHWA 4N58A 1J19A 1TTNA 2JUOA 3V60A 2DNFA 4K7SA 2B76B 1VR9A 2IYDB 2RR9A 4YTNB 2ZPNA 1ZUD2 1P98A 4HKZE 1QILA 3ENEA 3QAQA 2ON8A 2K8HA 4J3OD 2LVPA 4WURA 4RFBA 1WM3A 3PRMB 4ZRPA 5EE3A 3FILA 3UQAA 1RFKA 4DWFA 2LJIA 3NVWA 2DZIA 4TQ0A 1UGJA 1ZDVA 4H2AA 1L6UA 5AUKA 4W9IA 2LFIA 3D32A 2KWUB 2KTRA 1VCBA 1YQBA 1WGYA 4GXBA 3N9YC 4OZAA 3U7DA 1IP9A 2WYQA 2LXCA 4K81A 1FPYA 1UBIA 4DK5A 1GC6A 3NVVA 3NZUA 3ZJUA 1Q1OA 3P4SB 1OEYA 4GIVA 1ROEA 1E8XA 2V3NA 3Q2AC 5HI1A 3P1MA 2JX5A 2ZVNA 5BYRA 2BVCA 2VRRB 4ZRIA 2RDBC 1VLBA 2GBMA 3URYA 2KFKB 4JE3B 1KLVA 4X57B 5D3DA 4E71A 5JHBA 1SE2A 2IGGA 3S2AA 4W9GA 4OW0A 1FNWA 4LNKA 4W9KA 3CSTA 1OTRB 1TS4A 2M56B 1T0SC 2DYBA 4ZRQA 3ML8A 2IO0B 2Q5WD 4LNFA 1TY2A 3Q3OC 1V81A 3AMZA 4EFOA 1YX6B 2M0AA 5T8IA 4NJ7A 3Q3NC 1KTKA 1EF1A 2HE7A 2BYVE 1NBFC 2IDYA 2YVCA 4XDCA 4C7ZA 4RGTA 2I1JA 2VH2A 1A5RA 4J6IA 4MGZE 3N30A 2LGDA 2LGXA 3AEAB 1JRUA 3QK0A 3GOEA 2MBBB 4K3CA 3GE3C 1WXMA 4OZCA 3KLSX 2FCSA 5D7GA 4P7IA 4A3OA 4REZA 2MJDA 2WDQB 1FRDA 3QIJA 2WQYB 4GSWA 1C3TA 1VD2A 3UF8A 1HXYD 1ET9A 3SU8X 4IOIE 3ZTDA 3N1ZC 3V3XA 2FCQA 1OEYJ 2GRIA 4XC2A 2LHDA 5CHFA 2B3AA 2E6XA 2O6VB 1HZ6A 3BVGA 3DBHI 1F52A 3IVFA 1EWYC 3AECB 3ZXRA 1JWBD 4KSLC 3AEFB 3APDA 3MC9A 3I57A 4PT5A 3M63B 1TIFA 2AYOB 3Q8EA 3DVNU 2WLBA 3EGRA 4DDGD 4L2YA 1TZOA 2AL6A 3QQ8B 5EE0A 5E6JA 3I5JC 2NVUI 2BKFA 4HJGE 1P0RA 2WGSA 1DYQA 3ZQ4A 2V4IB 3Q8BA 3KUCB 5MPOA 1SB3C 2ZEQA 1N61A 1R4NB 4G11A 4HCPB 2QDFA 1WX7A 4KZCA 3VRAB 1IGDA 1GC7A 3VUWA 4XE0A 2Z0EB 4ACFA 2JRHA 3ZNZB 4WQMA 2BB5A 2KJRA 1SJED 3TCAA 2ASQA 4NY0A 5DCNA 1BMLC 4HKQA 2RPQA 4E74A 2KMMA 2BWFA 3N1YC 2MJEA 3C8YA 2L05A 1V9JA 3BY4B 3GS2A 3AEGB 4YSXB 1J7AA 5DPSA 4LNIA 4KIKA 2HD5B 4P6VF 1C4CA 3AU4A 2GBJA 3T3OA 2WXLA 1XEEA 4M8NA 2JZZA 1JCKB 3H6NA 2JQRB 2KWDA 1GUAB 5BYQA 1EO6A 2K9XA 3CMMB 2JVCA 4B6WA 4P1CC 4W9JA 4KIKB 3DDCB 4RH6A 3U4EG 3U52E 1QZEA 3Q8AA 3CIRB 1ZE3D 1FNVA 4A6QA 2EELA 2RGFA 2XK5A 3MFGA 2D5GA 4ARIA 4W9DA 3DBLB 2J53A 1V1PA 3UI3A 1SIFA 2IO2B 3RUIB 2XN9C 3LB8C 1H8CA 1AW7A 3HRDD 3PGEA 1J8CA 1F9JA 2WNMA 1UNSA 3TBLD 4KDIC 1KF6B 2RSUA 5FKAC 3PRPB 1HTOA 4C80A 4OVZA 2NBUA 1PGAA 4C56C 1E6EB 2MA9B 1SE3A 1NI3A 1LXDA 5BMGA 3C19A 2QIEB 3BYTB 2EMTA 1P9DU 3M95A 1YN5A 2N1VA 3PLVA 2PVGC 1I4HA 4RCOA 2NR2A 2PMVA 2D3GA 3SFDB 5KHQA 3B08A 3AE7B 4K7WA 1EWCA 1F2RI 1FIQA 4HWIB 1B1ZA 3NY5A 3R2TA 2Y5CA 1GB4A 1P7FA 2DHZA 3ZNGC 1R7SA 2G4SA 3HVDA 1YJIA 5C2TB 1SGHA 5L83A 2LGYA 1K51A 4KV2A 2ZPYA 4YSYB 2KK8A 2IBIB 4M0WA 1GNUA 5JH5C 3H7SA 2ZZPB 2QC8A 4II2B 3MC8A 2FAZA 2HTHA 2L0FA 1R4MB 2MSED 3V6EB 1V97A 2WX1A 3IFWB 3ZJTA 2FIFA 5JXVA 1QOFA 3VR9B 1PDXA 1WM2A 3RN9C 1VZ8A 2K39A 5AUIA 3ZRCA 3SFEB 2H88B 1UWXA 1T0QC 1FO4A 2CHZA 3AE8B 1F0ZA 3VR8B 5CHVC 2G3QB 4MGIE 2KDIA 4JWSC 4KGTA 1E5WA 1LO5D 1Y8RC 3DHHC 1FMAD 3P4QB 2KDFB 2AQ1B 2DX5B 1Z2MA 1WR6E 2JYTA 1ET6A 4FJVB 5HHDG 3AV8A 5C3JB 2TSSA 1EU4A 4C7YA 3FKYA 3IG3A 2J4XA 2GI9A 1WGGA 2N7EA 3L16A 4URKA 2V0GA 2FCNA 2IGHA 2GB1A 2JXXA 2D3BA 3LYYA 2C60A 3VTWA 3VUYA 4BBNC 3NHEB 3ZIMA 1ZDXA 3Q14C 4IDIA 4DHJD 3A4SC 4EKUA 3RZFA 5H92C 2L1AA 4JPSA 4WQOB 4R3DA 1MG4A 1L0VB 1CJEA 2INPE 5DPWA 1CQVA 1UD7A 2MCNB 1QF6A 1F77A 2KJHB 4BKTA 1I4XA 1NENB 4GU2A 2G1EA 3RYTA 3X0WA 3ZDTA 2R61A 2KZRA 4FHJA 3VFKA 1KLGD 1N63A 3E9SA 3RMKC 1V2YA 5E6OA 4IC7B 4A3PA 1SIJA 1EU3A 1WIAA 3B0AA 2BGFA 2BWES 4ANWA 4O1NA 2JU6X 3PPAA 5H8YE 2FIDA 2OHFA 1L0XB 2QSDA 4XGAB 2AX5A 4TMAB 1SXTA 2PJHA 2KT7A 2KANA 4XX5A 3PS6A 5EE1A 1GB1A 2OJRA 3MJWA 2MHJA 2ZCBA 3NS8A 2L76A 1NEKB 2WX0A 3AE3B 1E10A 4XYCA 1K52A 4TV3A 3IBEA 3RNAC 2R2QA 4MSMB 4FN2A 4US8A 3VQIA 4MDKE 5CTRC 1Y56A 3U30A 2JRIB 3VDZA 1WXVA 2PEAA 3DCGA 3RT3B 2XBBC 1VZ7A 1P7EA 4YTPB 1MHHE 3H1UA 3R3MA 4WH4A 4W9EA 3ZDMC 1E7PB 3NZ3A 4HPPA 4FJZA 3OG5A 2UU7A 1ZPSA 5AZGA 1MFWA 3LXFA 2D3CA 1T6BX 3VUXA 4HRSA 1KJTA 2K25A 4C00A 2K5PA 5TR5A 2IY1B 1UUPA 4PYUA 3MC0B 1CZPA 2WDVB 4XWTA 3NZSA 3OWEB 3KWVA 2BF8B 1PFDA 2KFKA 1KFYB 4AP4C 3ZW3A 1XO3A 1TJEA 4DDID 4BOZB 3PVLA 1V6EA 4RMAA 2M4NA 1N62A 2K0PA 2Z0DB 2LEKA 3V62A 5HKHA 1P1AA 3MHZA 1SSNA 2AL3A 4ZRJA 2KVRA 2NBWB 5J2RA 4IWQA 4P16A 1V8CA 4GOCA 4K1RB 1L4DB 4TKNA 4G3XB 1AYFA 1V5TA 5IO9A 4OHJA 4YT0B 4A9AA 2V1YA 5BYSA 3Q6BA 2RPVA 1XLQA 3I3TB 1OQYA 2LRUA 1TT5B 2KDEB 1JWUD 3A9KA 4IM0A 3AEEB 5IN7A 3A4RA 2MBEA 1V80A 4MELA 1K53A 4DHJB 1C77A 4PYZA 3NVZA 1WXAA 3GE8C 2Y5PA 1LQBA 4C4VB 4NJCA 2O2VA 3HK0A 4ZHPA 1MG8A 3NOBA 3A9KB 1L6VA 4PS3A 1I4RA 4MT5A 1V1OA 3DBLI 2ACZB 2J0MA 3HHMA 2NCNA 2N9LA 2LASA 1B9RA 3RNEC 1RM6C 4AOFA 2PW9A 2DENB 1R4MI 4W9CA 2SAKA 4IUMB 2I1KA 1EM7A 4KKJA 4BAXA 3N1XC 4NPNA 5C1ZA 2BS4B 1QOGA 1LFDA 4RGNA 2LZ6A 1DOIA 3CF6E 2LD9A 2NBVB 3PO0A 2KD0A 3SR6A 1GOZA 2FE8A 3RD2A 1MJDA 1WRDB 2X38A 4LNNA 3K9OB 1I4GA 4ZYNA 3EHVA 3JSVA 5JZEB 3LDZE 2KX0A 4B0MA 3TEYA 3KYDD 3PLUA 2KC2A 3CSFA 2NMQA 2WXHA 2EKIA 4IM3A 1WF9A 1FCLA 1IUEA 4GB9A 1FFVA 2DAJA 3AE9B 1X1MA 2ZW0A 4G50A 2I38A 1HE8A 4UDUC 1CMXB 1JALA 2WXJA 1OFFA 1SJHD 5E6PA 1L2NA 3L08A 5IOIA 1E8ZA 3A1QA 3DBRI 1TS5A 2KQ7A 3DBRB 1LM8B 4BKSD 1SEBD 2DBYA 4G0NB 2WDRB 3R66C 2KVZA 4WJOA 3AH7A 3TJPA 2MRPA 2W3RA 2J52A 1JWMD 3KW5B 3NUHB 4YXDB 3TUOA 2AEHA 1WFYA 3UIPB 4FJYA 3L17A 2DZMA 2IGDA 2NPTB 4LDTD 4BFRA 2VZKD 1NVID 2WU2B 3BINA 2KDMA 2LGSA 4ITKA 3BK2A 2W82A 3IAS1 1EUVB 5AZFA 3ZNID 2MQJA 4CQNA 2MLBA 2LUMA 2BTEA 3OAWA 2OEDA 4A90A 3RPFC 4CYEA 4RGOS 3ZVVA 1E0ZA 4DHZB 4GDLB 2WDTB 1E8YA 1WMHB 1WGHA 1WYGA 2DWQA 3PREA 3KUZA 3HM6X 2WS3B 1S1QB 4LJPB 1MHXA 4PS8A 1XXGA 1VRAB 3QARA 2QEJC 1TKGA 2N4FA 3AE1B 4XWWA 1JMLA 3V61A 3UIOB 3T3NA 2N9XA 5G55A 3DOWA 3AE6B 1BXTA 1V49A 4I6LB 3TL5A 4AQ7A 2N9KA 2V9HA 4FULA 4KGRA 4OVVA 4TUUA 3RNBC 1TKEA 3Q8CA 2V4LA 1N6ZA 4YL8A 1K8RB 4DQOC 2O2VB 2ZW1A 2A4ZA 3APFA 3FILB 1DGJA 3MP9A 3X23A 2K6DB 2L52A 1YNTE 2KTFA 1XLNA 2GOWA 2AQ2B 4FHKA 5C23A 2HDEA 1C79A 2PE6B 2J7QB 3W9CB 4RM9A 1PGXA 4F8CB 1WGDA 3U7ZA 3OJ4B 2MX2A 1TS3A 5GXGB 1E90A 3PV1A 4MJSB 3BK1A 1E7VA 3QC8B 4WWOA 3E56A 1A70A 1FFUA 2FUHB 3ZNHB 3NS1A 2GLSA 2C7MB 3H7PB 4HEA1 4HDQA 2BBCA 4HPLB 2Z59B 3IHPC 5LNK1 2WXOA 3R2IA 4HROA 4B95A 3TMPB 4EEWA 5IP4D 2Y3AA 3ZXVA 4W9HA 4BKGA 1XLOA 1D5MC 1VZ6A 1RAXA 1ZGUB 2IPKD 4TSSA 4YTMB 1I42A 3W5VB 3ZRFA 4BOSC 4IW0A 4IWPA 2KO3A 5BO4B 1ZW7A 1NI2A 4LTUA 2BPSA 4GDLA 2KLGA 4PK1A 1KH0A 3P4PB 4AJYB 4II3B 3KH0A 5HG2A 2RD0A 2M17A 3QHTA 4OZBA 3UGBB 1QKZA 4KSKC 2PTLA 4FBJB 3T8MA 1VDVA 4RM8A 2UYZB 3DWGC 2GMIC 2YEPB 1KOTA 3WALA 4BKSA 3BVMA 1SBBB 4LNOA 2KKCA 2NPTA 5DPTA 1DOYA 3HUIA 1MVKA 2WXFA 4RF1A 2CJOA 2INNE 3FC4A 4FXCA 3AEDB 3PZ8A 4RNAA 5E6NA 2MP2A 4KKIA 3IXSA 3EECA 3JYUA 3AE2B 1WWTA 1KRHA 2KACA 1WX8A 1V1PB 5TSSA 2KHWB 2M0XA 3PHXB 4BBNF 3ZGZA 4WAAA 3AEBB 1WMHA 2ICIA 1GAQB 1WH3A 2GBRA 2WXIA 3M3JA 3VXWA 1YN3A 2R2OA 3BYYB 1IYFA 2FNJB 2KOXA 2REXA 2L3ZA 4DHZE 4GDKA 3GB1A 2IJ0A 1E7UA 4A8XC 3ZLZA 4EUTA 3RNFC 2I2YA 4GMVA 4EOYA 2BT6A 3PHWB 2ONQA 2IZVB 2JY6A 2KX3A 2LVOA 2WWZA 3MJ5A 3SD5A 2J0KA 1TKYA 1HEZE 3PSEB 1WI0A 2CHWA 3FAHA 4B0EA 3QCAA 2OOBB 4ICUA 4JIOU 2L8JA 2IY0B 2K1FA 2N1WA 3DVGY 3H8HA 2LUEA 1CK1A 1M94A 3ABVB 4GLSC 3ZJVA 3Q8FA 4HVBA 5G2NA 1TBEA 1V5OA 3Q69A 4ICVA 1D5ZC 2WXMA 2L32A 3ZYYX 4M8MA 2W55A 2NTSA 4USAA
chains in the Genus database with same CATH topology
1TIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIF A; 
#chains in the Genus database with same CATH topology
 2CU1 A;  5I4D A;  2D2Q A;  3C0R B;  3WCQ A;  2BB6 A;  4M01 A;  1RYJ A;  3UQB A;  4NZL B;  1NYQ A;  1RWS A;  4D2K A;  5AZH A;  2Z8L A;  3DWM A;  2M19 A;  2W9N A;  2DYO A;  2JT4 B;  4IKG A;  2H89 B;  1UBQ A;  2CR5 A;  1FXI A;  1Q10 A;  3QJZ A;  1Q0W B;  4IG7 B;  3VH3 B;  5BMH A;  4C4V A;  2WXG A;  3EUB 2;  2JSV X;  2K8B A;  1XLP A;  1TGZ B;  3W1S C;  2V3P A;  2RDG A;  1BT0 A;  4WJP A;  2BW2 A;  4OVU A;  1WYW B;  3TIX A;  4FLH A;  1ZXI A;  4HK2 A;  1YOV B;  2WHI A;  2KYW A;  1HQR D;  1SE4 A;  1YMH E;  2PE9 A;  1XCT L;  3ZKJ C;  4MM3 A;  4ASW C;  5CX3 A;  1FXT B;  3UIN B;  4DXG A;  1QOB A;  1ZOY B;  4BVU C;  4S0R A;  1XT9 B;  1PYW D;  1YQ3 B;  1JRP A;  1IBX B;  2PPH A;  1GG3 A;  4L1B A;  1ENF A;  2K6Q A;  2DAF A;  3DVN V;  5GMV A;  4E3C A;  5IAA C;  3AB5 A;  2L00 B;  2W54 A;  4US9 A;  5D94 A;  1XD3 B;  3BII D;  1FCC C;  2QHO A;  3VVW B;  3L54 A;  1XCQ L;  3GZN B;  3KWL A;  2BYF A;  1WZ3 A;  2M1M A;  1YIW A;  1F2R C;  2LI5 A;  4MAC A;  2KWC A;  3SHQ A;  4I6N B;  3RNG C;  5BMI A;  1IGC A;  2MEK A;  3JVZ X;  3N3K B;  2A5U A;  1YX5 B;  3EFC A;  3L4P A;  3W5U B;  2JF5 A;  3A1Q B;  4WJN A;  3WAN A;  2FCM A;  1QLB B;  3TEX A;  4A20 A;  4ARC A;  2KQ4 X;  4JL9 A;  2LJ5 A;  1PGB A;  3U8Z A;  1SE9 A;  4P1B C;  1NYR A;  3J9C A;  2E3T A;  4BZA A;  3WAP A;  5EE9 A;  1UZX B;  1OQQ A;  4EE2 A;  2JXT A;  4MGY E;  2K3U A;  1WE6 A;  4GDK B;  1JRO A;  2M8S A;  3ONS A;  3AN1 A;  1J0G A;  5L95 C;  5G5G A;  2DZK A;  3L0W B;  5FR6 A;  3RI7 C;  1J7C A;  1WXQ A;  1RRB A;  4KX6 B;  2QIL A;  2L0T A;  4JGH B;  3WA0 A;  2ZNV C;  2WXR A;  3WAM A;  3IT6 B;  1YJJ A;  1N5W A;  1C4A A;  4WWP A;  3V05 A;  3L13 A;  3VRB B;  2YEP F;  3RZW C;  1C9F A;  1M4V A;  2PKO A;  4IWO A;  4KVG B;  1WJU A;  1GPX A;  3DVG X;  2JWZ A;  3A9J B;  3PZD A;  1N5X A;  2LGI A;  4S17 A;  2BS3 B;  1WGR A;  2N0S B;  3Q3M C;  1JQ4 A;  4M02 A;  2NTT A;  3U2S C;  3OJ3 A;  2KJ6 A;  2CKH B;  4KZ0 A;  3DPD A;  3RNC C;  2J42 A;  1UGM A;  2VH1 A;  3N20 C;  2EKE C;  2MP2 B;  1YQ4 B;  3AM9 A;  3NVY A;  1ZP0 B;  4W9F A;  1UWM A;  2BYE A;  1HTQ A;  2UWQ A;  4GGQ A;  3RCZ A;  1DOX A;  1WRI A;  4HDO A;  3B2F A;  2MBQ A;  1F1H A;  5J18 A;  1C78 A;  3EA6 A;  3HVZ A;  4JX1 C;  1Z5S B;  2N7D A;  1T0R C;  4W9L A;  1N60 A;  3SEB A;  2C7H A;  2NS5 A;  1BUI C;  1G6J A;  1WJ6 A;  2KN5 A;  2LVQ A;  4AS1 A;  2MWS B;  2BYT A;  4JQW C;  3EFU A;  3M62 B;  4GN1 A;  4EZJ A;  1T0Y A;  2V3S A;  2OJW A;  4LJO B;  1YJ1 A;  2GBN A;  2L7R A;  4NQL B;  2PVO D;  2BS2 B;  2ZVO A;  3SDL C;  3P63 A;  4K3B A;  5IA7 A;  1KLU D;  1YN4 A;  2G4D B;  2KWV B;  3T9L A;  1FD6 A;  4NNJ B;  4N59 A;  3HM3 A;  3DQV A;  2W3S A;  2XEW A;  1WY8 A;  3R7Q A;  1HA5 A;  3KUD B;  2KN4 A;  2RMM A;  2D3A A;  3AE5 B;  2HTM E;  1YD8 U;  4LLG M;  4ZYS A;  1XF5 L;  1KM7 A;  4TQ1 A;  3P42 A;  3O13 A;  3APC A;  5LXI B;  1TS2 A;  2CU3 A;  3MTN B;  1AAR A;  3RUL A;  5G5H A;  2PLP A;  3PTF C;  1OQR A;  2JPH A;  3I63 C;  2SEB D;  1QOA A;  1QQR A;  4AJW A;  4ANU A;  3DBH B;  2G45 B;  3KVF B;  4HJK A;  4NAM A;  4K7U A;  1RLF A;  3AXC A;  4M0W B;  1UEL A;  3TSS A;  2N7J A;  1HZ5 A;  1I4P A;  4WJQ A;  2MBH A;  2N9P C;  2KAJ A;  3PZ7 A;  2XNA C;  4KDL B;  2IO1 B;  1L7Y A;  3A9J A;  2WXP A;  1WSP A;  1JWS D;  1VJK A;  3IAM 1;  3JSV B;  4EZL A;  1FEH A;  2HJ1 A;  5KHO A;  1STE A;  4JLC A;  4JWU C;  4MJS A;  5DPR A;  2KMC A;  2QJL A;  1LGR A;  4A55 A;  3JW0 X;  2D07 B;  1C76 A;  3HIZ A;  1V86 A;  4NAW B;  2LXA A;  2O6V A;  4DXF A;  2LHE A;  4AWJ A;  4LDT B;  1GJZ A;  1H4R A;  1EF5 A;  3H7P A;  2CHX A;  3TEZ A;  3W1S A;  1AN8 A;  2FUG 1;  5D6J B;  1AWD A;  1OGW A;  3VH4 B;  4WWN A;  4ZRK A;  2FBW B;  3LJ3 A;  2J0J A;  1I7H A;  2KTR B;  5EDS A;  4WAF A;  1MPE A;  1XQQ A;  1E9M A;  2AWT A;  4QAY A;  4HCN B;  4DBG A;  4F7Z A;  3WAO A;  2JWU A;  5J17 A;  3GZN I;  3Q3J A;  4ZOH C;  1WJN A;  1SF0 A;  1WJ4 A;  3P2B A;  4FA6 A;  1D4B A;  2DLB A;  4XDD A;  2Y5B B;  4HLE A;  3B9J A;  1FRR A;  4EZK A;  1WXS A;  4NJ6 A;  2KMA A;  4IM2 A;  4RGM A;  3CWI A;  1T3Q A;  2C7N B;  5LLI A;  3I9V 1;  5FK9 C;  2CJN A;  1MI0 A;  2G9H D;  4KGS A;  1T5X D;  1IPG A;  3B2G A;  2WP9 B;  4HXD A;  3AI5 A;  4MM3 B;  1ZXH A;  1TZ1 A;  2KFJ A;  4Q2J A;  1D5X C;  1D6E C;  4L23 A;  3MHS D;  3W1Y A;  2JZP A;  2WXK A;  3NJT A;  4YSZ B;  2LRW A;  3L10 B;  3ETR A;  4CHK A;  2YLM A;  2D11 A;  4AUQ C;  4LK0 M;  3W2D A;  4LCD E;  5HFY A;  2O6V D;  3ZO5 B;  4RF0 A;  2MH7 A;  3KQ4 A;  3TEW A;  2DYM A;  2KC1 A;  1S3S G;  1IBX A;  4N6E B;  2QCZ A;  3ML9 A;  4M00 A;  5JHA A;  1UH6 A;  2K22 A;  2HJ8 A;  2IND C;  2KLC A;  3PRZ A;  1FXA A;  3VTU A;  2WXN A;  1QT9 A;  2LMC A;  3P4R B;  1JWA D;  3EC8 A;  1WX9 A;  1WZ0 A;  2XK5 B;  4CO7 A;  3BVZ A;  3RFZ B;  2MBO A;  4ANV A;  4NAW A;  1C1Y B;  2ZNV B;  2PIA A;  2AQ3 B;  2ZCC A;  3DHG C;  3ZTC A;  4NQK E;  2KNB A;  1R4N I;  2QMT A;  1ACC A;  1K50 A;  2KDB A;  4MEM A;  2D10 A;  1ESF A;  3OLM D;  4WIP A;  4B9K A;  2JYE A;  2IO3 B;  3O65 B;  3BZD B;  2C5L C;  3GP7 A;  2INC C;  3V6C B;  2KQS A;  1RFA A;  2LWP A;  4I6P A;  4MH8 A;  3N32 A;  2DZJ A;  3VHT C;  2MJ3 A;  4HPM B;  3H9D A;  3QWZ B;  1I35 A;  2BQQ A;  4MH0 E;  2X8X X;  1WGK A;  2KXJ A;  2VZK B;  1TYG B;  1P3Q U;  1L0Y B;  3AUL A;  4MSQ B;  2RDH A;  2L83 A;  3WIM A;  3QA8 A;  2CS4 A;  1NDD A;  5FR3 A;  3VTV A;  2BKR B;  1PUT A;  3ECI A;  1L4Z B;  3DBS A;  2K8C A;  5D3I B;  4N9F 4;  4PS7 A;  4DXA B;  1I4Q A;  4ANX A;  1TY0 A;  3BWU D;  3B1L X;  1C4P A;  2GBK A;  1U4A A;  2WU5 B;  4XZ4 A;  1E8W A;  1PQS A;  2MW5 A;  3AE4 B;  2ZJD A;  3ZUN A;  3R7R A;  2C9W B;  1L5P A;  4YWG G;  1UF0 A;  4ZDV A;  5IKC M;  3ALB A;  3R8B A;  4FAD A;  2N9E B;  3A33 B;  5AEK B;  1ZKH A;  3KYC D;  1FNU A;  3NG0 A;  1J7B A;  3IT4 B;  2EMS A;  3K9P B;  1WR1 A;  4MGK E;  3AU5 A;  1WE7 A;  1D3Z A;  5LXH A;  2WXQ A;  5D2M B;  3Q3F A;  1ISN A;  3NRZ A;  4ZHO A;  3QX1 A;  3PT2 B;  3DHI C;  3VAW A;  4F1S A;  2JZ3 B;  1Q5W B;  1FM0 D;  4WWM A;  1JW9 D;  5CHW A;  4N58 A;  1J19 A;  1TTN A;  2JUO A;  3V60 A;  2DNF A;  4K7S A;  2B76 B;  1VR9 A;  2IYD B;  2RR9 A;  4YTN B;  2ZPN A;  1ZUD 2;  1P98 A;  4HKZ E;  1QIL A;  3ENE A;  3QAQ A;  2ON8 A;  2K8H A;  4J3O D;  2LVP A;  4WUR A;  4RFB A;  1WM3 A;  3PRM B;  4ZRP A;  5EE3 A;  3FIL A;  3UQA A;  1RFK A;  4DWF A;  2LJI A;  3NVW A;  2DZI A;  4TQ0 A;  1UGJ A;  1ZDV A;  4H2A A;  1L6U A;  5AUK A;  4W9I A;  2LFI A;  3D32 A;  2KWU B;  2KTR A;  1VCB A;  1YQB A;  1WGY A;  4GXB A;  3N9Y C;  4OZA A;  3U7D A;  1IP9 A;  2WYQ A;  2LXC A;  4K81 A;  1FPY A;  1UBI A;  4DK5 A;  1GC6 A;  3NVV A;  3NZU A;  3ZJU A;  1Q1O A;  3P4S B;  1OEY A;  4GIV A;  1ROE A;  1E8X A;  2V3N A;  3Q2A C;  5HI1 A;  3P1M A;  2JX5 A;  2ZVN A;  5BYR A;  2BVC A;  2VRR B;  4ZRI A;  2RDB C;  1VLB A;  2GBM A;  3URY A;  2KFK B;  4JE3 B;  1KLV A;  4X57 B;  5D3D A;  4E71 A;  5JHB A;  1SE2 A;  2IGG A;  3S2A A;  4W9G A;  4OW0 A;  1FNW A;  4LNK A;  4W9K A;  3CST A;  1OTR B;  1TS4 A;  2M56 B;  1T0S C;  2DYB A;  4ZRQ A;  3ML8 A;  2IO0 B;  2Q5W D;  4LNF A;  1TY2 A;  3Q3O C;  1V81 A;  3AMZ A;  4EFO A;  1YX6 B;  2M0A A;  5T8I A;  4NJ7 A;  3Q3N C;  1KTK A;  1EF1 A;  2HE7 A;  2BYV E;  1NBF C;  2IDY A;  2YVC A;  4XDC A;  4C7Z A;  4RGT A;  2I1J A;  2VH2 A;  1A5R A;  4J6I A;  4MGZ E;  3N30 A;  2LGD A;  2LGX A;  3AEA B;  1JRU A;  3QK0 A;  3GOE A;  2MBB B;  4K3C A;  3GE3 C;  1WXM A;  4OZC A;  3KLS X;  2FCS A;  5D7G A;  4P7I A;  4A3O A;  4REZ A;  2MJD A;  2WDQ B;  1FRD A;  3QIJ A;  2WQY B;  4GSW A;  1C3T A;  1VD2 A;  3UF8 A;  1HXY D;  1ET9 A;  3SU8 X;  4IOI E;  3ZTD A;  3N1Z C;  3V3X A;  2FCQ A;  1OEY J;  2GRI A;  4XC2 A;  2LHD A;  5CHF A;  2B3A A;  2E6X A;  2O6V B;  1HZ6 A;  3BVG A;  3DBH I;  1F52 A;  3IVF A;  1EWY C;  3AEC B;  3ZXR A;  1JWB D;  4KSL C;  3AEF B;  3APD A;  3MC9 A;  3I57 A;  4PT5 A;  3M63 B;  1TIF A;  2AYO B;  3Q8E A;  3DVN U;  2WLB A;  3EGR A;  4DDG D;  4L2Y A;  1TZO A;  2AL6 A;  3QQ8 B;  5EE0 A;  5E6J A;  3I5J C;  2NVU I;  2BKF A;  4HJG E;  1P0R A;  2WGS A;  1DYQ A;  3ZQ4 A;  2V4I B;  3Q8B A;  3KUC B;  5MPO A;  1SB3 C;  2ZEQ A;  1N61 A;  1R4N B;  4G11 A;  4HCP B;  2QDF A;  1WX7 A;  4KZC A;  3VRA B;  1IGD A;  1GC7 A;  3VUW A;  4XE0 A;  2Z0E B;  4ACF A;  2JRH A;  3ZNZ B;  4WQM A;  2BB5 A;  2KJR A;  1SJE D;  3TCA A;  2ASQ A;  4NY0 A;  5DCN A;  1BML C;  4HKQ A;  2RPQ A;  4E74 A;  2KMM A;  2BWF A;  3N1Y C;  2MJE A;  3C8Y A;  2L05 A;  1V9J A;  3BY4 B;  3GS2 A;  3AEG B;  4YSX B;  1J7A A;  5DPS A;  4LNI A;  4KIK A;  2HD5 B;  4P6V F;  1C4C A;  3AU4 A;  2GBJ A;  3T3O A;  2WXL A;  1XEE A;  4M8N A;  2JZZ A;  1JCK B;  3H6N A;  2JQR B;  2KWD A;  1GUA B;  5BYQ A;  1EO6 A;  2K9X A;  3CMM B;  2JVC A;  4B6W A;  4P1C C;  4W9J A;  4KIK B;  3DDC B;  4RH6 A;  3U4E G;  3U52 E;  1QZE A;  3Q8A A;  3CIR B;  1ZE3 D;  1FNV A;  4A6Q A;  2EEL A;  2RGF A;  2XK5 A;  3MFG A;  2D5G A;  4ARI A;  4W9D A;  3DBL B;  2J53 A;  1V1P A;  3UI3 A;  1SIF A;  2IO2 B;  3RUI B;  2XN9 C;  3LB8 C;  1H8C A;  1AW7 A;  3HRD D;  3PGE A;  1J8C A;  1F9J A;  2WNM A;  1UNS A;  3TBL D;  4KDI C;  1KF6 B;  2RSU A;  5FKA C;  3PRP B;  1HTO A;  4C80 A;  4OVZ A;  2NBU A;  1PGA A;  4C56 C;  1E6E B;  2MA9 B;  1SE3 A;  1NI3 A;  1LXD A;  5BMG A;  3C19 A;  2QIE B;  3BYT B;  2EMT A;  1P9D U;  3M95 A;  1YN5 A;  2N1V A;  3PLV A;  2PVG C;  1I4H A;  4RCO A;  2NR2 A;  2PMV A;  2D3G A;  3SFD B;  5KHQ A;  3B08 A;  3AE7 B;  4K7W A;  1EWC A;  1F2R I;  1FIQ A;  4HWI B;  1B1Z A;  3NY5 A;  3R2T A;  2Y5C A;  1GB4 A;  1P7F A;  2DHZ A;  3ZNG C;  1R7S A;  2G4S A;  3HVD A;  1YJI A;  5C2T B;  1SGH A;  5L83 A;  2LGY A;  1K51 A;  4KV2 A;  2ZPY A;  4YSY B;  2KK8 A;  2IBI B;  4M0W A;  1GNU A;  5JH5 C;  3H7S A;  2ZZP B;  2QC8 A;  4II2 B;  3MC8 A;  2FAZ A;  2HTH A;  2L0F A;  1R4M B;  2MSE D;  3V6E B;  1V97 A;  2WX1 A;  3IFW B;  3ZJT A;  2FIF A;  5JXV A;  1QOF A;  3VR9 B;  1PDX A;  1WM2 A;  3RN9 C;  1VZ8 A;  2K39 A;  5AUI A;  3ZRC A;  3SFE B;  2H88 B;  1UWX A;  1T0Q C;  1FO4 A;  2CHZ A;  3AE8 B;  1F0Z A;  3VR8 B;  5CHV C;  2G3Q B;  4MGI E;  2KDI A;  4JWS C;  4KGT A;  1E5W A;  1LO5 D;  1Y8R C;  3DHH C;  1FMA D;  3P4Q B;  2KDF B;  2AQ1 B;  2DX5 B;  1Z2M A;  1WR6 E;  2JYT A;  1ET6 A;  4FJV B;  5HHD G;  3AV8 A;  5C3J B;  2TSS A;  1EU4 A;  4C7Y A;  3FKY A;  3IG3 A;  2J4X A;  2GI9 A;  1WGG A;  2N7E A;  3L16 A;  4URK A;  2V0G A;  2FCN A;  2IGH A;  2GB1 A;  2JXX A;  2D3B A;  3LYY A;  2C60 A;  3VTW A;  3VUY A;  4BBN C;  3NHE B;  3ZIM A;  1ZDX A;  3Q14 C;  4IDI A;  4DHJ D;  3A4S C;  4EKU A;  3RZF A;  5H92 C;  2L1A A;  4JPS A;  4WQO B;  4R3D A;  1MG4 A;  1L0V B;  1CJE A;  2INP E;  5DPW A;  1CQV A;  1UD7 A;  2MCN B;  1QF6 A;  1F77 A;  2KJH B;  4BKT A;  1I4X A;  1NEN B;  4GU2 A;  2G1E A;  3RYT A;  3X0W A;  3ZDT A;  2R61 A;  2KZR A;  4FHJ A;  3VFK A;  1KLG D;  1N63 A;  3E9S A;  3RMK C;  1V2Y A;  5E6O A;  4IC7 B;  4A3P A;  1SIJ A;  1EU3 A;  1WIA A;  3B0A A;  2BGF A;  2BWE S;  4ANW A;  4O1N A;  2JU6 X;  3PPA A;  5H8Y E;  2FID A;  2OHF A;  1L0X B;  2QSD A;  4XGA B;  2AX5 A;  4TMA B;  1SXT A;  2PJH A;  2KT7 A;  2KAN A;  4XX5 A;  3PS6 A;  5EE1 A;  1GB1 A;  2OJR A;  3MJW A;  2MHJ A;  2ZCB A;  3NS8 A;  2L76 A;  1NEK B;  2WX0 A;  3AE3 B;  1E10 A;  4XYC A;  1K52 A;  4TV3 A;  3IBE A;  3RNA C;  2R2Q A;  4MSM B;  4FN2 A;  4US8 A;  3VQI A;  4MDK E;  5CTR C;  1Y56 A;  3U30 A;  2JRI B;  3VDZ A;  1WXV A;  2PEA A;  3DCG A;  3RT3 B;  2XBB C;  1VZ7 A;  1P7E A;  4YTP B;  1MHH E;  3H1U A;  3R3M A;  4WH4 A;  4W9E A;  3ZDM C;  1E7P B;  3NZ3 A;  4HPP A;  4FJZ A;  3OG5 A;  2UU7 A;  1ZPS A;  5AZG A;  1MFW A;  3LXF A;  2D3C A;  1T6B X;  3VUX A;  4HRS A;  1KJT A;  2K25 A;  4C00 A;  2K5P A;  5TR5 A;  2IY1 B;  1UUP A;  4PYU A;  3MC0 B;  1CZP A;  2WDV B;  4XWT A;  3NZS A;  3OWE B;  3KWV A;  2BF8 B;  1PFD A;  2KFK A;  1KFY B;  4AP4 C;  3ZW3 A;  1XO3 A;  1TJE A;  4DDI D;  4BOZ B;  3PVL A;  1V6E A;  4RMA A;  2M4N A;  1N62 A;  2K0P A;  2Z0D B;  2LEK A;  3V62 A;  5HKH A;  1P1A A;  3MHZ A;  1SSN A;  2AL3 A;  4ZRJ A;  2KVR A;  2NBW B;  5J2R A;  4IWQ A;  4P16 A;  1V8C A;  4GOC A;  4K1R B;  1L4D B;  4TKN A;  4G3X B;  1AYF A;  1V5T A;  5IO9 A;  4OHJ A;  4YT0 B;  4A9A A;  2V1Y A;  5BYS A;  3Q6B A;  2RPV A;  1XLQ A;  3I3T B;  1OQY A;  2LRU A;  1TT5 B;  2KDE B;  1JWU D;  3A9K A;  4IM0 A;  3AEE B;  5IN7 A;  3A4R A;  2MBE A;  1V80 A;  4MEL A;  1K53 A;  4DHJ B;  1C77 A;  4PYZ A;  3NVZ A;  1WXA A;  3GE8 C;  2Y5P A;  1LQB A;  4C4V B;  4NJC A;  2O2V A;  3HK0 A;  4ZHP A;  1MG8 A;  3NOB A;  3A9K B;  1L6V A;  4PS3 A;  1I4R A;  4MT5 A;  1V1O A;  3DBL I;  2ACZ B;  2J0M A;  3HHM A;  2NCN A;  2N9L A;  2LAS A;  1B9R A;  3RNE C;  1RM6 C;  4AOF A;  2PW9 A;  2DEN B;  1R4M I;  4W9C A;  2SAK A;  4IUM B;  2I1K A;  1EM7 A;  4KKJ A;  4BAX A;  3N1X C;  4NPN A;  5C1Z A;  2BS4 B;  1QOG A;  1LFD A;  4RGN A;  2LZ6 A;  1DOI A;  3CF6 E;  2LD9 A;  2NBV B;  3PO0 A;  2KD0 A;  3SR6 A;  1GOZ A;  2FE8 A;  3RD2 A;  1MJD A;  1WRD B;  2X38 A;  4LNN A;  3K9O B;  1I4G A;  4ZYN A;  3EHV A;  3JSV A;  5JZE B;  3LDZ E;  2KX0 A;  4B0M A;  3TEY A;  3KYD D;  3PLU A;  2KC2 A;  3CSF A;  2NMQ A;  2WXH A;  2EKI A;  4IM3 A;  1WF9 A;  1FCL A;  1IUE A;  4GB9 A;  1FFV A;  2DAJ A;  3AE9 B;  1X1M A;  2ZW0 A;  4G50 A;  2I38 A;  1HE8 A;  4UDU C;  1CMX B;  1JAL A;  2WXJ A;  1OFF A;  1SJH D;  5E6P A;  1L2N A;  3L08 A;  5IOI A;  1E8Z A;  3A1Q A;  3DBR I;  1TS5 A;  2KQ7 A;  3DBR B;  1LM8 B;  4BKS D;  1SEB D;  2DBY A;  4G0N B;  2WDR B;  3R66 C;  2KVZ A;  4WJO A;  3AH7 A;  3TJP A;  2MRP A;  2W3R A;  2J52 A;  1JWM D;  3KW5 B;  3NUH B;  4YXD B;  3TUO A;  2AEH A;  1WFY A;  3UIP B;  4FJY A;  3L17 A;  2DZM A;  2IGD A;  2NPT B;  4LDT D;  4BFR A;  2VZK D;  1NVI D;  2WU2 B;  3BIN A;  2KDM A;  2LGS A;  4ITK A;  3BK2 A;  2W82 A;  3IAS 1;  1EUV B;  5AZF A;  3ZNI D;  2MQJ A;  4CQN A;  2MLB A;  2LUM A;  2BTE A;  3OAW A;  2OED A;  4A90 A;  3RPF C;  4CYE A;  4RGO S;  3ZVV A;  1E0Z A;  4DHZ B;  4GDL B;  2WDT B;  1E8Y A;  1WMH B;  1WGH A;  1WYG A;  2DWQ A;  3PRE A;  3KUZ A;  3HM6 X;  2WS3 B;  1S1Q B;  4LJP B;  1MHX A;  4PS8 A;  1XXG A;  1VRA B;  3QAR A;  2QEJ C;  1TKG A;  2N4F A;  3AE1 B;  4XWW A;  1JML A;  3V61 A;  3UIO B;  3T3N A;  2N9X A;  5G55 A;  3DOW A;  3AE6 B;  1BXT A;  1V49 A;  4I6L B;  3TL5 A;  4AQ7 A;  2N9K A;  2V9H A;  4FUL A;  4KGR A;  4OVV A;  4TUU A;  3RNB C;  1TKE A;  3Q8C A;  2V4L A;  1N6Z A;  4YL8 A;  1K8R B;  4DQO C;  2O2V B;  2ZW1 A;  2A4Z A;  3APF A;  3FIL B;  1DGJ A;  3MP9 A;  3X23 A;  2K6D B;  2L52 A;  1YNT E;  2KTF A;  1XLN A;  2GOW A;  2AQ2 B;  4FHK A;  5C23 A;  2HDE A;  1C79 A;  2PE6 B;  2J7Q B;  3W9C B;  4RM9 A;  1PGX A;  4F8C B;  1WGD A;  3U7Z A;  3OJ4 B;  2MX2 A;  1TS3 A;  5GXG B;  1E90 A;  3PV1 A;  4MJS B;  3BK1 A;  1E7V A;  3QC8 B;  4WWO A;  3E56 A;  1A70 A;  1FFU A;  2FUH B;  3ZNH B;  3NS1 A;  2GLS A;  2C7M B;  3H7P B;  4HEA 1;  4HDQ A;  2BBC A;  4HPL B;  2Z59 B;  3IHP C;  5LNK 1;  2WXO A;  3R2I A;  4HRO A;  4B95 A;  3TMP B;  4EEW A;  5IP4 D;  2Y3A A;  3ZXV A;  4W9H A;  4BKG A;  1XLO A;  1D5M C;  1VZ6 A;  1RAX A;  1ZGU B;  2IPK D;  4TSS A;  4YTM B;  1I42 A;  3W5V B;  3ZRF A;  4BOS C;  4IW0 A;  4IWP A;  2KO3 A;  5BO4 B;  1ZW7 A;  1NI2 A;  4LTU A;  2BPS A;  4GDL A;  2KLG A;  4PK1 A;  1KH0 A;  3P4P B;  4AJY B;  4II3 B;  3KH0 A;  5HG2 A;  2RD0 A;  2M17 A;  3QHT A;  4OZB A;  3UGB B;  1QKZ A;  4KSK C;  2PTL A;  4FBJ B;  3T8M A;  1VDV A;  4RM8 A;  2UYZ B;  3DWG C;  2GMI C;  2YEP B;  1KOT A;  3WAL A;  4BKS A;  3BVM A;  1SBB B;  4LNO A;  2KKC A;  2NPT A;  5DPT A;  1DOY A;  3HUI A;  1MVK A;  2WXF A;  4RF1 A;  2CJO A;  2INN E;  3FC4 A;  4FXC A;  3AED B;  3PZ8 A;  4RNA A;  5E6N A;  2MP2 A;  4KKI A;  3IXS A;  3EEC A;  3JYU A;  3AE2 B;  1WWT A;  1KRH A;  2KAC A;  1WX8 A;  1V1P B;  5TSS A;  2KHW B;  2M0X A;  3PHX B;  4BBN F;  3ZGZ A;  4WAA A;  3AEB B;  1WMH A;  2ICI A;  1GAQ B;  1WH3 A;  2GBR A;  2WXI A;  3M3J A;  3VXW A;  1YN3 A;  2R2O A;  3BYY B;  1IYF A;  2FNJ B;  2KOX A;  2REX A;  2L3Z A;  4DHZ E;  4GDK A;  3GB1 A;  2IJ0 A;  1E7U A;  4A8X C;  3ZLZ A;  4EUT A;  3RNF C;  2I2Y A;  4GMV A;  4EOY A;  2BT6 A;  3PHW B;  2ONQ A;  2IZV B;  2JY6 A;  2KX3 A;  2LVO A;  2WWZ A;  3MJ5 A;  3SD5 A;  2J0K A;  1TKY A;  1HEZ E;  3PSE B;  1WI0 A;  2CHW A;  3FAH A;  4B0E A;  3QCA A;  2OOB B;  4ICU A;  4JIO U;  2L8J A;  2IY0 B;  2K1F A;  2N1W A;  3DVG Y;  3H8H A;  2LUE A;  1CK1 A;  1M94 A;  3ABV B;  4GLS C;  3ZJV A;  3Q8F A;  4HVB A;  5G2N A;  1TBE A;  1V5O A;  3Q69 A;  4ICV A;  1D5Z C;  2WXM A;  2L32 A;  3ZYY X;  4M8M A;  2W55 A;  2NTS A;  4USA A; 
#chains in the Genus database with same CATH homology
 1TIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...