3GZNI

Structure of nedd8-activating enzyme in complex with nedd8 and mln4924
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
b'HHHMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
publication title Substrate-assisted inhibition of ubiquitin-like protein-activating enzymes: the NEDD8 E1 inhibitor MLN4924 forms a NEDD8-AMP mimetic in situ.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/ligase
total genus 19
structure length 79
sequence length 79
chains with identical sequence J
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3gznI00
3ZDMC 4FA6A 1GC6A 2KO3A 3VQIA 2G4DB 1WM3A 2KTFA 5LXIB 3APFA 3ZRCA 2NVUI 2N1WA 4AUQC 5KHQA 3H7SA 4EFOA 1RFAA 4II2B 4MELA 2RR9A 4W9DA 1D3ZA 1M94A 2DYMA 1SGHA 1WGRA 1ZKHA 2AEHA 2V3SA 2ZCBA 3NZUA 4MDKE 4HVBA 2MBEA 4PYZA 2IO1B 1WH3A 4CHKA 5LLIA 1WXAA 2I1KA 2L8JA 4TQ1A 3KH0A 4E71A 4M0WB 4WJPA 3ML9A 3D32A 4A20A 3UQAA 3LJ3A 4K1RB 2NBWB 4URKA 2KXJA 2KANA 4KIKB 3JSVA 4A3PA 2OOBB 2NPTA 1WYWB 4GGQA 2KQ7A 4W9CA 3A9JB 4FJVB 1E8YA 1Z2MA 5C1ZA 5JHAA 4IUMB 3RYTA 1C1YB 4N9F4 3SU8X 3NS8A 5J2RA 3JW0X 2J0JA 2CKHB 3A4RA 1OEYJ 3CSTA 1UELA 2N1VA 3QX1A 4HJKA 1WGYA 1CMXB 2G3QB 3ZUNA 2LXCA 3DVNU 3PREA 5BO4B 1ZGUB 3SHQA 3Q3JA 2Z0EB 2KWVB 2L3ZA 3QWZB 4TKNA 3V62A 2FIFA 3QARA 3IVFA 3M62B 2HJ8A 1MG8A 4IW0A 1P9DU 3EFUA 4W9JA 3NOBA 5GMVA 2EKEC 2B3AA 2KDFB 3AU4A 1WJ6A 4CO7A 4G50A 3ZTDA 3RZWC 4B6WA 4F8CB 4FBJB 2VRRB 4JL9A 4GDKB 2CR5A 3RD2A 2K8HA 1S1QB 3ML8A 3PLUA 1UGMA 4NJ7A 1GC7A 2KMCA 1R4MI 3PVLA 3VFKA 2XK5A 4KZ0A 3WA0A 2L00B 1WM2A 2KQSA 3PS6A 1P98A 1YIWA 3A4SC 3OJ3A 4BOZB 2LASA 2NR2A 4DHZB 1TZ1A 4K81A 2ZEQA 2IYDB 4BKSA 1J19A 1V6EA 4HCPB 1E8WA 4KDLB 2FAZA 4HPLB 5DPRA 1PQSA 3A9KA 4FJYA 3UGBB 5FR6A 4GXBA 2GOWA 4W9FA 3ECIA 4EOYA 3DCGA 1V5OA 2M17A 4IC7B 5LXHA 5D6JB 1E90A 1RRBA 3PLVA 3R66C 4EZKA 1WZ3A 1UBQA 2N9EB 1KOTA 2L05A 2FCSA 2J7QB 2M4NA 1YQBA 2W9NA 4M8NA 4LCDE 1UBIA 4MGKE 1T0YA 2DAFA 5JH5C 2L0TA 2MA9B 4JLCA 3WIMA 4WWNA 3H7PA 4MM3A 1NBFC 2BF8B 2BWES 3GZNI 4IWOA 4ZYNA 3B1LX 2EMSA 1WJUA 4JGHB 3DDCB 4F1SA 2KJ6A 5KHOA 2ZNVC 1KLVA 2KK8A 1AARA 3OLMD 1P0RA 3C0RB 1Z5SB 4KV2A 2Y5BB 3V6CB 3CSFA 3VTUA 4BKSD 2M8SA 3KUCB 3H9DA 2LGDA 2KTRA 2ZCCA 4G0NB 1GUAB 5C23A 1RLFA 2O6VD 3M3JA 3K9OB 4ZDVA 1UZXB 4LDTB 3ZTCA 5DCNA 1UD7A 3LDZE 4E3CA 2ZZPB 3T9LA 3L08A 2HD5B 4B9KA 4EKUA 4KSLC 2IZVB 3M63B 2GBKA 2DHZA 3NHEB 2JPHA 3L0WB 2AYOB 2LGYA 3L17A 4ICUA 1C3TA 3UQBA 3HM6X 4MGYE 2BYFA 3RT3B 1FXTB 1NI2A 4W9IA 5AZFA 4MSQB 2DZJA 4KDIC 1Q0WB 4TUUA 3I3TB 4K7SA 3VXWA 3APCA 2D11A 1WMHB 2KFKA 4WJOA 4MJSA 1E7UA 1L7YA 2L0FA 3H6NA 3ZLZA 3A33B 4BBNF 4GOCA 4GDLA 1SE9A 4KSKC 3ZW3A 4DHJB 2JRHA 1TBEA 4ZRKA 3N32A 2NBUA 1G6JA 2J0MA 1H4RA 3B08A 2DAJA 4F7ZA 3MHSD 1Q1OA 2MWSB 4B95A 1S3SG 1LXDA 3UIPB 3VTVA 4A3OA 2KDIA 2FCQA 3R7RA 3PRMB 3L54A 1IP9A 3MTNB 2GBJA 3L10B 2K6QA 2CU1A 4GN1A 3SD5A 1YD8U 2K1FA 1F9JA 4HDQA 3V60A 2CHZA 2MSED 4NPNA 3HK0A 5HKHA 3JYUA 4NQLB 3VAWA 2ZPYA 2R2OA 3PHWB 4PS7A 3DOWA 3UF8A 2HE7A 2KKCA 4IM2A 4K7UA 2LGXA 3U8ZA 2IY0B 2D2QA 3TBLD 3VUYA 3A1QA 2UYZB 3U7DA 1V81A 3VUXA 2CHWA 1WR1A 4RM9A 2IO3B 4XC2A 5G2NA 1YX6B 4HCNB 2JZ3B 2LJ5A 2CS4A 3DBHI 4G3XB 3WAOA 1WE6A 4NAWB 4E74A 2O2VB 2MP2A 2N7EA 2KLCA 2WDTB 3Q3FA 3ZO5B 2A4ZA 1P3QU 2K39A 4FULA 3ZIMA 3M95A 2D3GA 5D7GA 2LI5A 2BYVE 1WY8A 2KNBA 2KWCA 4IG7B 3HIZA 1WFYA 1WF9A 2PJHA 2KFKB 1WJNA 2KZRA 4EEWA 3PRZA 3W1YA 3EHVA 1GJZA 2C5LC 2FCNA 2LZ6A 3W1SA 3DBSA 1IPGA 3QJZA 2MCNB 4MEMA 4WJNA 3R3MA 3ZVVA 1A5RA 2D10A 4AJYB 4HXDA 5CX3A 5D94A 2RPQA 3TCAA 2M1MA 1WGGA 3AI5A 4TV3A 4JIOU 4KVGB 2XBBC 4BBNC 4BVUC 2BPSA 1U4AA 3TMPB 2GBNA 2YLMA 4NY0A 4HLEA 3L13A 4AP4C 5DPTA 2LWPA 2C7HA 2O6VA 2ZVNA 4WWOA 3X0WA 3JSVB 4X57B 2KX0A 2ZVOA 2NPTB 3APDA 4DK5A 2AL3A 2ASQA 3OAWA 1VCBA 1Y8RC 1OTRB 3TIXA 4FN2A 3DVGY 4XX5A 4ZRIA 3PPAA 4IM3A 5E6PA 1LQBA 2G45B 2KJRA 1WGDA 4DWFA 2CHXA 4MGZE 5AZHA 3ZNHB 1WXSA 2MX2A 2WWZA 4EZJA 4NNJB 3KVFB 2GBMA 2C7MB 2M0XA 3KUDB 1UH6A 4PS3A 3EECA 4ANWA 4FADA 1VD2A 2KHWB 2HTHA 3DQVA 1V9JA 2FUHB 3KW5B 4LDTD 2G4SA 3VUWA 3ZNGC 4OVUA 2GBRA 3L16A 3S2AA 4DXAB 4RMAA 3ZDTA 3DBLI 3VTWA 2K6DB 2K8CA 1E7VA 3PHXB 4DBGA 2K25A 2JVCA 2BKFA 1X1MA 3O65B 5J17A 1E8ZA 3TJPA 2JF5A 5CHVC 2DZMA 2MBBB 1SIFA 4AWJA 1GG3A 2KWUB 1K8RB 4GU2A 3UINB 2N9PC 3TL5A 3NZSA 1YX5B 2MBQA 3AXCA 1WZ0A 5E6NA 3RUIB 2RGFA 3GOEA 4W9KA 3RZFA 3A9JA 2ZJDA 1R4NI 2REXA 4NJ6A 2DYOA 3EC8A 2KOXA 1WX7A 2XK5B 4DHJD 2WYQA 2V1YA 3W1SC 1WJ4A 3P2BA 1EF1A 3U30A 1WIAA 2IY1B 1WXMA 2ZPNA 3ONSA 1KJTA 4MSMB 1JRUA 2JXXA 4PS8A 2D07B 3VDZA 1GNUA 2KDBA 4BKGA 2JUOA 3PT2B 5L83A 1I35A 1L2NA 2PE9A 2O6VB 3A9KB 2KX3A 3PRPB 2N7DA 3BY4B 4HK2A 4W9GA 2IO0B 1YJ1A 2FNJB 1KM7A 2BKRB 2JY6A 2UWQA 1P1AA 1WRDB 1V5TA 3PV1A 3VVWB 5E6OA 4G11A 5DPWA 4TQ0A 2N9XA 3N30A 3R7QA 2JRIB 3DPDA 2DZKA 2NS5A 2DYBA 3H7PB 2KC1A 2WX1A 4HDOA 4OVVA 2AL6A 3N3KB 3UIOB 1TTNA 4GDKA 2LVQA 1IYFA 2BWFA 2FIDA 1RAXA 4KZCA 2LUEA 4M8MA 2LVOA 4WWPA 1XD3B 3CF6E 4RM8A 3PZDA 4YL8A 3IHPC 4DDID 1J8CA 2KTRB 1WX8A 1E5WA 2AWTA 2C9WB 3DVNV 2KLGA 2KVRA 4P7IA 3IG3A 2IBIB 1ISNA 2C60A 2OJRA 5DPSA 5CTRC 1OQYA 4W9HA 2MLBA 1V2YA 3WANA 5D2MB 2C7NB 2NCNA 3NY5A 1E8XA 3IBEA 4FHKA 2I1JA 3H1UA 4PYUA 4HPMB 3VH3B 5AEKB 3PTFC 1I42A 2KJHB 1LFDA 4MJSB 2A5UA 4GB9A 4ANUA 3QQ8B 2J0KA 4GSWA 2N4FA 5J18A 2IO2B 3AU5A 2PPHA 3BINA 2NBVB 5CHFA 3RCZA 4GDLB 3ZNZB 2LXAA 4ANXA 1XQQA 3HHMA 3QHTA 2EMTA 4I6NB 4CYEA 2DX5B 1HE8A 2LVPA 2QHOA 2MBOA 2JZZA 3KUZA 2DENB 3HM3A 4FLHA 4MH0E 1WGHA 2Z0DB 3V61A 3ZNID 3DBRI 5L95C 2YVCA 4LJPB 2PEAA 2KD0A 1XT9B 1WI0A 4BFRA 4ANVA 5IA7A 3ENEA 4MGIE 3QCAA 4FHJA 5IAAC 4J6IA 4JQWC 2LD9A 3PSEB 4NQKE 1OGWA 2L76A 4GIVA 2K8BA 3ZKJC 4FJZA 1WMHA 2KDEB 3B0AA 3OJ4B 2ZNVB 3KYCD 2XEWA 1ZW7A 3AULA 5G55A 4ZRJA 3A1QB 4W9LA 2LRWA 4HWIB 3V6EB 3WAPA 5EDSA 4II3B 1WR6E 2FCMA 3VHTC 2LRUA 3QIJA 4W9EA 2MW5A 1J0GA 2BGFA 2RD0A 2MP2B 4LJOB 3X23A 2KFJA 2BYEA 1V86A 2MQJA 4DHZE 4I6LB 2DZIA 4WQOB 3WAMA 4BKTA 4IWQA 1Q5WB 1EO6A 2MBHA 3ALBA 3JVZX 3PGEA 4KIKA 1H8CA 5AZGA 4AOFA 4XZ4A 3T8MA 2V4LA 4IWPA 1V80A 4WJQA 3QAQA 1OEYA 2R2QA 4ICVA 2KMAA 1V49A 1WE7A 4DDGD 5JHBA 1BT0A 2PE6B 4IM0A 4EUTA 5JZEB 4GMVA 1EF5A 2Z59B 5CHWA 3ZRFA 2GMIC 4AJWA 4WAAA 2KN5A 2RSUA 3DVGX 4EZLA 1WXVA 4I6PA 3VH4B 3KYDD 1EUVB 3MJWA 2L7RA 4NAWA 3WALA 2O2VA 1NDDA 2MRPA 3QC8B 2KC2A 3RULA 2WX0A 3QK0A 5TR5A 1QZEA 3QA8A 4BOSC 1LM8B 4ASWC 3CMMB 3K9PB 2JWZA 2JT4B 3IFWB 1WX9A 4K7WA 3SDLC 1TGZB
chains in the Genus database with same CATH superfamily
2KO3A 2KTFA 1TY0A 4XE0A 3ZQ4A 2K9XA 3CWIA 2RR9A 1K50A 1M94A 1C9FA 3P4SB 2DYMA 5JXVA 4PYZA 2IO1B 1WH3A 1WWTA 1WXAA 2DLBA 4TQ1A 3J9CA 4WJPA 4KKIA 3ML9A 1N5WA 2KANA 4A3PA 1WYWB 3A9JB 4KGRA 1Z2MA 4WURA 3RYTA 2X8XX 3P1MA 4N9F4 3SU8X 5J2RA 3JW0X 1SE3A 1WGYA 2G3QB 3DVNU 1ZGUB 2ICIA 2IGDA 2MEKA 3KWVA 4TMAB 4P1CC 3V62A 3QWZB 1TY2A 3QARA 2BYTA 1MG8A 1UF0A 2EKEC 2WP9B 3ZTDA 2LGIA 1A70A 1S1QB 2KACA 3A4SC 2NR2A 2BQQA 1I4QA 4K81A 2QSDA 4HCPB 1L4ZB 3A9KA 5FR6A 5LXHA 3DBHB 5IKCM 2VZKD 1UBQA 1KOTA 2ZW0A 2NTTA 4LCDE 1FRRA 2BS2B 2WXOA 4WWNA 3B1LX 1DGJA 2KJ6A 5KHOA 1KFYB 2Y5BB 3Q8CA 2LGDA 1GUAB 1ZXHA 4S0RA 3K9OB 3Q6BA 4LDTB 4M01A 1TIFA 1UD7A 5D3DA 3U7ZA 1XO3A 4B9KA 4EKUA 4ICUA 3OG5A 5TSSA 1FXTB 2LMCA 1I4GA 3RNEC 1Q0WB 4TUUA 2D11A 1WMHB 4MJSA 4PK1A 2LJIA 3ZLZA 4B0MA 4KSKC 4GDLA 2RDGA 3N32A 2WNMA 1F2RI 2DAJA 4JWUC 1AWDA 3W2DA 2KDIA 1C79A 3L54A 3MTNB 3L10B 2K6QA 3FILA 2CU1A 3HK0A 5HKHA 1RWSA 2BB6A 4YTMB 3PHWB 3DOWA 2KKCA 2IY0B 1J7AA 2D2QA 3U7DA 2SAKA 2CHWA 4RM9A 4HCNB 3TUOA 5C3JB 2LJ5A 4G3XB 1T5XD 1FNUA 1WE6A 3Q3FA 2A4ZA 4YTPB 1XLQA 2BYVE 2PKOA 2N9KA 2RMMA 2PJHA 2KFKB 3W1YA 3EHVA 1HXYD 1FMAD 4DXGA 3W1SA 3QJZA 4N6EB 1FEHA 4MEMA 4WJNA 1L0XB 1A5RA 2Q5WD 4HXDA 5CX3A 1HQRD 4TV3A 1UGJA 1SF0A 4BBNC 5EE0A 1ACCA 4HJGE 4OZAA 3L13A 2LWPA 2UU7A 2INNE 3X0WA 4DK5A 2AL3A 3OAWA 3TIXA 3DHIC 2G45B 4DWFA 4EZJA 3KVFB 4RF1A 2JZPA 2WXQA 5HI1A 1UH6A 3DQVA 4OVUA 4RMAA 1MJDA 1E7VA 3PHXB 3U52E 1AW7A 3ETRA 5J17A 1X1MA 1SBBB 2MBBB 4ZRQA 1GG3A 2KWUB 4GU2A 3LYYA 5E6NA 1NENB 2KWDA 5BYSA 1XF5L 2VH2A 1N6ZA 3A9JA 1R4NI 2DYOA 1SIJA 2V1YA 3W1SC 1EF1A 2IY1B 1WXMA 2V3PA 3R2IA 2JXXA 1HTQA 4ZHOA 3VDZA 1V97A 1GNUA 4BKGA 1I35A 4WIPA 2O6VB 2KX3A 2N7DA 5C2TB 2FNJB 2UWQA 1P1AA 4G11A 4TQ0A 1SJHD 2N9XA 3R7QA 1FXAA 1T0QC 2DYBA 3H7PB 4MM3B 4HDOA 2AL6A 2BWFA 2QDFA 2D3AA 1PFDA 1BMLC 2J52A 2KTRB 3N1XC 4RF0A 2KLGA 2IBIB 1ISNA 1DOIA 2HDEA 3SR6A 5D2MB 1FXIA 1E8XA 2I1JA 3H1UA 3LXFA 3VH3B 2J4XA 2KJHB 4OW0A 3Q8FA 3IAM1 3QQ8B 2N4FA 1TKEA 3VRAB 3HRDD 3L4PA 2LVPA 2QHOA 3PZ7A 4MH0E 1KRHA 3DBRI 4LJPB 1T3QA 2BVCA 2KD0A 1P7FA 2PEAA 4C56C 4ZYSA 4ANVA 5IA7A 3QCAA 4FHJA 4LTUA 4JQWC 3NZ3A 2L76A 1TYGB 3OWEB 4EE2A 1WMHA 3B0AA 5GXGB 3TEZA 3GS2A 5G55A 4XDCA 3A1QB 4W9LA 1IUEA 4II3B 2LRUA 5HG2A 2MW5A 1CQVA 2RD0A 4KX6B 4US9A 5MPOA 2QC8A 3VR9B 4IWQA 3PGEA 3JVZX 5FR3A 3BK1A 3W9CB 2R2QA 2L32A 2N0SB 4KGSA 2INPE 2IJ0A 1JWSD 3ZXRA 2NMQA 1EF5A 5CHWA 3AMZA 4WAAA 3DVGX 4I6PA 4A90A 3KYDD 1EUVB 3BVZA 1NDDA 2KC2A 3N20C 2WX0A 3QA8A 4BOSC 4IOIE 1DYQA 2BB5A 4OHJA 2QILA 4YSXB 2W3RA 2JWZA 3BIID 1TGZB 3ZDMC 3HUIA 2G4DB 3APFA 2N1WA 4A9AA 4NZLB 2INCC 4IDIA 2V3SA 1WGRA 4MDKE 2WDRB 4H2AA 1YN4A 1ROEA 4LNOA 4M0WB 3D32A 4A20A 3UQAA 4K1RB 2JU6X 4URKA 2MJEA 2BS3B 1ENFA 5G5HA 1L4DB 1CJEA 4GGQA 2KQ7A 4FJVB 3AE3B 4IUMB 2MJDA 3NS8A 3A4RA 4CQNA 1UELA 1F52A 2K22A 2LXCA 4C7YA 3BZDB 3Q3JA 2L3ZA 3NVWA 2WXLA 2HJ1A 2IPKD 1QF6A 2EELA 1JMLA 4K3BA 1WJ6A 3AEEB 4G50A 3RZWC 2JXTA 4FBJB 4JL9A 2K8HA 1UGMA 1R4MI 2G9HD 2L00B 1WM2A 3PS6A 1E9MA 1QKZA 3OJ3A 4DHZB 2LASA 1CZPA 3W5VB 1E7PB 4ARCA 4USAA 1J19A 1GAQB 1V6EA 1E8WA 2FAZA 4FJYA 4GXBA 3ECIA 3DCGA 2M17A 5AUKA 1WZ3A 1NVID 3P63A 1VRAB 3C19A 1T0YA 2L0TA 2MA9B 3WIMA 2DBYA 3H7PA 4MM3A 2BWES 3GZNI 4ZYNA 1WJUA 4JGHB 2ZNVC 4M00A 5IN7A 1VR9A 3VTUA 3V6CB 3CSFA 3KUCB 3H9DA 2KTRA 2MH7A 1SB3C 2ZCCA 3LB8C 4K3CA 3M3JA 2O6VD 1FNVA 4ZDVA 3FAHA 3R2TA 2HD5B 2V3NA 3M63B 4HRSA 3L0WB 3RT3B 4W9IA 3BK2A 5AZFA 4XWWA 4A6QA 4KDIC 1V1OA 3PO0A 3APCA 4YWGG 1PGXA 1ZUD2 4BBNF 1F0ZA 3AEAB 3ZW3A 2LGSA 2RPVA 3E56A 2WGSA 1G6JA 2WXFA 4P6VF 2B76B 3MHSD 1Q1OA 3DWMA 2ACZB 1LXDA 3UIPB 4A3OA 4LNKA 1IP9A 3AV8A 3RN9C 2WDVB 4REZA 3IT4B 5T8IA 3SD5A 3V60A 1F9JA 3Q2AC 3VAWA 2ZPYA 4BAXA 1ZOYB 4YSYB 1FRDA 3NJTA 4PS7A 2ONQA 2HE7A 3UF8A 2LHEA 2LGXA 2WXRA 3TBLD 3A1QA 2UYZB 3VUXA 5G2NA 1YX6B 2OJWA 2WXKA 2CS4A 4E74A 3WAOA 4NAWB 3ZO5B 1P3QU 3EGRA 2IGGA 2D3GA 5D7GA 3I5JC 1WY8A 2KNBA 1WF9A 3AEDB 3RPFC 1WJNA 3BWUD 3PRZA 1KTKA 1FFVA 1UWMA 2MCNB 3IXSA 1YJJA 4AJYB 5D94A 4MH8A 2RPQA 3TCAA 3AI5A 1WGGA 2XBBC 3VR8B 4BVUC 2BPSA 3AE6B 2YLMA 2YEPB 4HLEA 4AP4C 1YJIA 5DPTA 1I4XA 5BMHA 4WWOA 2PTLA 3JSVB 1F2RC 2NPTB 3APDA 2ASQA 2D3CA 1VCBA 1OTRB 4P1BC 1V1PA 4WAFA 3DVGY 1EU4A 4L2YA 4XX5A 1VZ7A 5E6PA 1ZDXA 1F1HA 1BUIC 3Q3MC 2GBMA 3KUDB 3SFEB 2KHWB 2V4IB 4ZRPA 1V9JA 3KW5B 3GE8C 3U2SC 3L16A 4DXAB 1QOGA 1FPYA 4RGMA 3DBLI 2K8CA 3O65B 4M0WA 1E8ZA 1C4CA 2JF5A 1SIFA 1EWCA 1K8RB 3UINB 3TL5A 3NZSA 1YX5B 3RUIB 5BYQA 5H8YE 1RYJA 3GOEA 1JQ4A 4LNIA 4M02A 1JWBD 1WX7A 2XK5B 1KH0A 1WJ4A 4JPSA 3U30A 4ITKA 3NG0A 4WH4A 5LNK1 2JUOA 1L2NA 3PRPB 1E6EB 3NVYA 3BY4B 1YJ1A 1P7EA 3AE4B 1WRDB 3VVWB 3PV1A 5E6OA 4RNAA 1HTOA 2I2YA 1XLOA 2KQ4X 2NS5A 1B1ZA 1Y56A 2WX1A 4OVVA 3N3KB 1TTNA 2PLPA 2LVQA 4OVZA 1IYFA 4WWPA 3AE5B 3GZNB 4RM8A 1BXTA 4YL8A 2LUMA 1J8CA 1NYRA 4NJCA 3DVNV 1TS4A 4ARIA 2C60A 2IGHA 1OQYA 3DWGC 3MP9A 3PTFC 2ON8A 2VH1A 1GB1A 2J0KA 1ZDVA 3RCZA 3AU5A 3BINA 2NBVB 5CHFA 1OQRA 2LHDA 1XQQA 4I6NB 4CYEA 2EMTA 2Y3AA 2V0GA 1L6UA 2JZZA 3HM3A 4FLHA 1D6EC 1WGHA 1GB4A 2E3TA 2YVCA 3P42A 4BFRA 4O1NA 3PSEB 3N1ZC 1JROA 3URYA 4FJZA 4L1BA 1PGBA 3N9YC 2KDEB 2ZNVB 2XEWA 2JX5A 2V9HA 2GRIA 4GLSC 1J0GA 2BGFA 1MFWA 1FCLA 4DHZE 2DZIA 1PGAA 3MC9A 1H8CA 2CJOA 5AZGA 4AOFA 1V80A 4UDUC 3QAQA 2N9LA 1OQQA 1V49A 1WE7A 2DNFA 1BT0A 2D5GA 4EUTA 5JZEB 2PMVA 2Z59B 3ZRFA 4AJWA 3NUHB 3BVGA 4NAWA 3AN1A 3WALA 2MRPA 3QC8B 1E10A 3RULA 2KMMA 1QZEA 5TR5A 3AE1B 1EU3A 1M4VA 2JT4B 2XN9C 1D5ZC 2INDC 2CU3A 2AX5A 1WX9A 3SDLC 3VQIA 1WM3A 5LXIB 3V05A 3ZRCA 2NVUI 4AUQC 3H7SA 3MJ5A 4MELA 1MHXA 1D3ZA 4W9DA 1SJED 2AQ1B 2BTEA 3AE2B 3TEXA 4HVBA 1SGHA 2AEHA 1D4BA 2MBEA 3I57A 4CHKA 5LLIA 2N7JA 2L8JA 2WXIA 3KH0A 4E71A 3ABVB 2RDHA 2NBWB 2KXJA 4KIKB 4PT5A 3JSVA 3KWLA 4JE3B 3MC0B 2NPTA 1T0SC 4XDDA 1L0VB 5AUIA 5JHAA 1C1YB 2H89B 2QCZA 2CKHB 1OEYJ 3CSTA 3QX1A 1CMXB 3ZUNA 5IP4D 5I4DA 5BO4B 4TKNA 1KLGD 2HJ8A 3AB5A 3NOBA 5GMVA 2B3AA 3AU4A 4CO7A 1WYGA 4YXDB 1GOZA 2CR5A 4NJ7A 3WA0A 1GC7A 2KMCA 3VFKA 2XK5A 4KZ0A 1JWMD 2KQSA 1YIWA 4LLGM 2JWUA 2ZEQA 2IYDB 4BKSA 4HPLB 1PYWD 5DPRA 1PQSA 3UGBB 2GOWA 4W9FA 4EOYA 2QIEB 3AEFB 2W55A 2WS3B 1E90A 3RFZB 4EZKA 2PIAA 2L05A 2FCSA 2M4NA 2WQYB 1YQBA 5EE3A 4M8NA 4RH6A 4MGKE 1AYFA 5JH5C 4JLCA 3I63C 2BF8B 4IWOA 2M19A 3DDCB 1KLVA 2KK8A 1L6VA 4C7ZA 3B2FA 4BKSD 2M8SA 4G0NB 3VRBB 4D2KA 1RLFA 1UZXB 3ZTCA 4LK0M 5DCNA 2SEBD 2ZZPB 3T9LA 3L08A 1JWUD 4KSLC 3NHEB 2JPHA 2AYOB 2LGYA 2KVZA 3UQBA 4MGYE 2BYFA 3EA6A 1IGDA 1NI2A 4MSQB 2DZJA 4Q2JA 3VXWA 4K7SA 2KFKA 4WJOA 1E7UA 3IT6B 2L0FA 2WU2B 2X38A 2Y5PA 2BW2A 1SE9A 4ZRKA 5D3IB 2IDYA 2NBUA 3TEWA 1HEZE 2J0MA 1H4RA 3MC8A 3Q8EA 1ZPSA 2LEKA 1I7HA 1S3SG 4JX1C 3VTVA 3C8YA 3R7RA 3PRMB 2EKIA 2GBJA 1YD8U 2K1FA 3Q14C 4HDQA 2CHZA 4NPNA 2R2OA 3GB1A 3SFDB 1L0YB 4C4VB 2WXMA 1J7BA 1R4NB 1V81A 1WR1A 1SE2A 2IO3B 4XC2A 2PW9A 1WGKA 4B0EA 3DBHI 1OFFA 2N7EA 2K39A 4FULA 1QILA 1TS2A 2JYTA 3M95A 3RNGC 2LI5A 4MT5A 2KWCA 4IG7B 3HIZA 1WFYA 2I38A 2KZRA 4EEWA 3AEGB 1GJZA 1K51A 2LZ6A 1IPGA 3ZJUA 3ZVVA 1AN8A 4BZAA 4YTNB 5BYRA 1MG4A 3AE8B 1YOVB 2OEDA 3BVMA 1XEEA 1U4AA 1CK1A 3FKYA 4NY0A 2C7HA 2O6VA 2PVGC 1ET9A 2ZVOA 1QOAA 4ZRIA 3PPAA 2KJRA 5FK9C 2CHXA 5AZHA 3ZNHB 1WXSA 2MX2A 4NNJB 3DHHC 2KDMA 2M0XA 4MACA 4PS3A 1VD2A 5HHDG 3NS1A 2G4SA 3VUWA 3ZNGC 3S2AA 3ZDTA 3VTWA 4AS1A 4DBGA 2JVCA 2BKFA 3TJPA 3FC4A 4AWJA 2DZMA 3Q3OC 2N9PC 3DBRB 2MBQA 3AXCA 1WZ0A 2RGFA 4TSSA 2BS4B 2REXA 2WXNA 2KOXA 4DHJD 2WYQA 4KKJA 1YNTE 4MSMB 1KJTA 1JRUA 2D07B 2GB1A 3PT2B 2PE9A 4HK2A 1D5MC 1KM7A 2BKRB 2JY6A 1Q10A 1V5TA 5DPWA 3N30A 2HTME 4RGOS 4US8A 2JRIB 2DZKA 1JRPA 3RNBC 3UIOB 1PDXA 1TT5B 2L83A 4KZCA 1RAXA 1EM7A 1PUTA 2LUEA 4M8MA 2LVOA 1XD3B 3CF6E 1SSNA 3PZDA 4DDID 1IGCA 1E5WA 2C9WB 3PZ8A 2CJNA 1XLPA 1ZP0B 1EWYC 2OJRA 3MFGA 2FBWB 2MLBA 3WANA 2D3BA 2C7NB 2NCNA 3NY5A 4FHKA 1STEA 3UI3A 2W82A 1I42A 2A5UA 4GB9A 2BT6A 2IO2B 4WWMA 2PPHA 3ZNZB 2L1AA 2LXAA 3HHMA 3Q69A 2DX5B 1RM6C 4C00A 2MBOA 3KUZA 2DENB 1NYQA 2L52A 1QLBB 2H88B 5L95C 1JALA 3AE9B 5FKAC 1YN3A 1N60A 5IAAC 4J6IA 4NQKE 1OGWA 4LNNA 3AM9A 2K8BA 4NAMA 2R61A 3OJ4B 1YQ4B 3KYCD 1ZW7A 3AULA 4HWIB 3V6EB 3WAPA 1HA5A 1WR6E 3QIJA 4A55A 4W9EA 2MP2B 4LJOB 2AQ3B 1DOXA 1XCTL 1V86A 2MQJA 4WQOB 1F77A 1Q5WB 1EO6A 5BMIA 3ZGZA 2V4LA 2WXPA 4YSZB 1C4PA 1OEYA 4ICVA 2KMAA 2PE6B 4IM0A 2GLSA 2WU5B 1C77A 1FNWA 4GMVA 4C4VA 1N61A 2RSUA 1SE4A 1R4MB 1WXVA 3H8HA 3P4QB 3QK0A 4ASWC 3T3NA 3IFWB 3U4EG 4K7WA 1RFKA 2W54A 4FA6A 1K52A 1GC6A 5IO9A 1C78A 5KHQA 4EFOA 1RFAA 4II2B 1DOYA 2M56B 3O13A 1WSPA 1ZKHA 2ZCBA 4LNFA 4HEA1 3NZUA 4WQMA 2ZW1A 1QT9A 2I1KA 2JYEA 2YEPF 3LJ3A 4P16A 2K5PA 2OOBB 3P4RB 2W3SA 4ACFA 4W9CA 2KN4A 1ESFA 1E8YA 1IBXB 1NI3A 5C1ZA 1ZE3D 2J53A 2J0JA 2JSVX 4RFBA 2N1VA 4HJKA 2Y5CA 1VJKA 3PREA 3SHQA 4HROA 4J3OD 2Z0EB 3ZXVA 3RMKC 2KWVB 3Q8AA 2FIFA 2DWQA 1QOFA 3IVFA 3M62B 4IW0A 1NEKB 1P9DU 1XXGA 3EFUA 4W9JA 3RI7C 2KDFB 2AQ2B 3EUB2 4B6WA 4F8CB 4N58A 2VRRB 4GDKB 2WLBA 3RD2A 4RCOA 1R7SA 3ML8A 3PLUA 3PVLA 2WHIA 3CIRB 1P98A 4BOZB 1TZ1A 2K3UA 4KDLB 1V5OA 4IC7B 5D6JB 1RRBA 3PLVA 3R66C 2N9EB 2J7QB 1VZ6A 2W9NA 1UBIA 1MVKA 2DAFA 3ZYYX 2OHFA 1NBFC 3B9JA 3NVZA 1YQ3B 4RGTA 2EMSA 4F1SA 1AARA 3OLMD 1P0RA 1TS5A 1Z5SB 3C0RB 4KV2A 5C23A 2E6XA 2QMTA 3BYTB 4HPPA 4S17A 1J7CA 3LDZE 4E3CA 4OZBA 3IAS1 2IZVB 2GBKA 2DHZA 1C3TA 3L17A 3HM6X 2LFIA 3I3TB 1I4HA 1L7YA 2BBCA 3RNFC 3H6NA 3A33B 3SEBA 4FXCA 4GOCA 5EE1A 1XLNA 4DHJB 4XYCA 2JRHA 1TBEA 1QOBA 4ZOHC 1VDVA 5G5GA 3Q3NC 3B08A 1ET6A 4F7ZA 2MWSB 4B95A 2J42A 1JWAD 4HKZE 5H92C 2FCQA 3DBLB 4GN1A 2MSED 1SXTA 3JYUA 3N1YC 4KGTA 4NQLB 3TEYA 3R8BA 2GI9A 4RGNA 4XWTA 4IM2A 4K7UA 3U8ZA 3VUYA 1FO4A 3ZJVA 2JZ3B 2O2VB 2MP2A 3AE7B 2WDTB 2KLCA 1JCKB 3V3XA 3ZIMA 4XGAB 3WCQA 1T6BX 3RNAC 3T3OA 5BMGA 2C5LC 2FCNA 3DBSA 1I4PA 2NTSA 3R3MA 1HZ6A 1FCCC 2D10A 2Z8LA 1XCQL 1FM0D 2M1MA 3AH7A 3ZJTA 4JIOU 4KVGB 1FFUA 3E9SA 3TMPB 2GBNA 1KLUD 1I4RA 3AECB 3NRZA 2ZVNA 3HVDA 4X57B 2KX0A 4C80A 3AEBB 1Y8RC 1TS3A 4FN2A 4IM3A 1LQBA 1WGDA 4MGZE 2WWZA 1TZOA 1T0RC 2C7MB 4JWSC 3HVZA 5HFYA 2KYWA 3EECA 3P4PB 4ANWA 4FADA 3DHGC 2HTHA 2FUHB 2QJLA 4LDTD 1VZ8A 2GBRA 2K6DB 2K25A 1MHHE 1SEBD 5CHVC 4A8XC 2VZKB 1TJEA 3MHZA 1C76A 4W9KA 3RZFA 2ZJDA 4ZHPA 1IBXA 4NJ6A 3EC8A 2WDQB 2WXJA 2FUG1 1QQRA 3P2BA 1WIAA 2ZPNA 3ONSA 4PS8A 3BYYB 2KDBA 3EFCA 5L83A 2MJ3A 3I9V1 2WXHA 3A9KB 4W9GA 2IO0B 1UWXA 1V8CA 2JQRB 1V1PB 1N63A 1TKYA 3DPDA 2XNAC 2QEJC 1K53A 2KC1A 1N5XA 3GP7A 1YMHE 4GDKA 1JW9D 2FIDA 4N59A 3Q8BA 1YN5A 3IHPC 1E0ZA 1WX8A 2AWTA 2FE8A 2KVRA 4P7IA 3IG3A 1TKGA 5DPSA 5CTRC 1UUPA 4W9HA 1V2YA 5IOIA 3IBEA 3B2GA 4PYUA 4QAYA 4HPMB 5AEKB 1LFDA 4MJSB 2WXGA 3W5UB 4ANUA 4GSWA 2KT7A 5J18A 1D5XC 1GPXA 4ANXA 4GDLB 3QHTA 1HE8A 1WRIA 2Z0DB 3V61A 3ZNID 1N62A 4IKGA 4AQ7A 4HKQA 1XT9B 1WI0A 2K0PA 3FILB 3ENEA 4MGIE 3NVVA 1L5PA 2LD9A 1LGRA 1WXQA 4GIVA 3ZKJC 3KQ4A 4DXFA 4OZCA 4ZRJA 2LRWA 5EDSA 1FD6A 1UNSA 5EE9A 2FCMA 1C4AA 4L23A 3VHTC 3X23A 2KFJA 3TSSA 2BYEA 2TSSA 4I6LB 3WAMA 1LO5D 4BKTA 2KAJA 3ALBA 2MBHA 4YT0B 4KIKA 3GE3C 4XZ4A 3T8MA 4IWPA 1MPEA 4WJQA 3KLSX 1ZXIA 4R3DA 2G1EA 4DDGD 5JHBA 4DQOC 1VLBA 2MHJA 5E6JA 2GMIC 2KN5A 1MI0A 4EZLA 2PVOD 3VH4B 1HZ5A 3MJWA 2L7RA 2O2VA 3RNCC 2M0AA 2RDBC 1KF6B 1LM8B 3CMMB 1FIQA 1B9RA 3K9PB
chains in the Genus database with same CATH topology
3ZDMC 4FA6A 1GC6A 2KO3A 3VQIA 2G4DB 1WM3A 2KTFA 5LXIB 3APFA 3ZRCA 2NVUI 2N1WA 4AUQC 5KHQA 3H7SA 4EFOA 1RFAA 4II2B 4MELA 2RR9A 4W9DA 1D3ZA 1M94A 2DYMA 1SGHA 1WGRA 1ZKHA 2AEHA 2V3SA 2ZCBA 3NZUA 4MDKE 4HVBA 2MBEA 4PYZA 2IO1B 1WH3A 4CHKA 5LLIA 1WXAA 2I1KA 2L8JA 4TQ1A 3KH0A 4E71A 4M0WB 4WJPA 3ML9A 3D32A 4A20A 3UQAA 3LJ3A 4K1RB 2NBWB 4URKA 2KXJA 2KANA 4KIKB 3JSVA 4A3PA 2OOBB 2NPTA 1WYWB 4GGQA 2KQ7A 4W9CA 3A9JB 4FJVB 1E8YA 1Z2MA 5C1ZA 5JHAA 4IUMB 3RYTA 1C1YB 4N9F4 3SU8X 3NS8A 5J2RA 3JW0X 2J0JA 2CKHB 3A4RA 1OEYJ 3CSTA 1UELA 2N1VA 3QX1A 4HJKA 1WGYA 1CMXB 2G3QB 3ZUNA 2LXCA 3DVNU 3PREA 5BO4B 1ZGUB 3SHQA 3Q3JA 2Z0EB 2KWVB 2L3ZA 3QWZB 4TKNA 3V62A 2FIFA 3QARA 3IVFA 3M62B 2HJ8A 1MG8A 4IW0A 1P9DU 3EFUA 4W9JA 3NOBA 5GMVA 2EKEC 2B3AA 2KDFB 3AU4A 1WJ6A 4CO7A 4G50A 3ZTDA 3RZWC 4B6WA 4F8CB 4FBJB 2VRRB 4JL9A 4GDKB 2CR5A 3RD2A 2K8HA 1S1QB 3ML8A 3PLUA 1UGMA 4NJ7A 1GC7A 2KMCA 1R4MI 3PVLA 3VFKA 2XK5A 4KZ0A 3WA0A 2L00B 1WM2A 2KQSA 3PS6A 1P98A 1YIWA 3A4SC 3OJ3A 4BOZB 2LASA 2NR2A 4DHZB 1TZ1A 4K81A 2ZEQA 2IYDB 4BKSA 1J19A 1V6EA 4HCPB 1E8WA 4KDLB 2FAZA 4HPLB 5DPRA 1PQSA 3A9KA 4FJYA 3UGBB 5FR6A 4GXBA 2GOWA 4W9FA 3ECIA 4EOYA 3DCGA 1V5OA 2M17A 4IC7B 5LXHA 5D6JB 1E90A 1RRBA 3PLVA 3R66C 4EZKA 1WZ3A 1UBQA 2N9EB 1KOTA 2L05A 2FCSA 2J7QB 2M4NA 1YQBA 2W9NA 4M8NA 4LCDE 1UBIA 4MGKE 1T0YA 2DAFA 5JH5C 2L0TA 2MA9B 4JLCA 3WIMA 4WWNA 3H7PA 4MM3A 1NBFC 2BF8B 2BWES 3GZNI 4IWOA 4ZYNA 3B1LX 2EMSA 1WJUA 4JGHB 3DDCB 4F1SA 2KJ6A 5KHOA 2ZNVC 1KLVA 2KK8A 1AARA 3OLMD 1P0RA 3C0RB 1Z5SB 4KV2A 2Y5BB 3V6CB 3CSFA 3VTUA 4BKSD 2M8SA 3KUCB 3H9DA 2LGDA 2KTRA 2ZCCA 4G0NB 1GUAB 5C23A 1RLFA 2O6VD 3M3JA 3K9OB 4ZDVA 1UZXB 4LDTB 3ZTCA 5DCNA 1UD7A 3LDZE 4E3CA 2ZZPB 3T9LA 3L08A 2HD5B 4B9KA 4EKUA 4KSLC 2IZVB 3M63B 2GBKA 2DHZA 3NHEB 2JPHA 3L0WB 2AYOB 2LGYA 3L17A 4ICUA 1C3TA 3UQBA 3HM6X 4MGYE 2BYFA 3RT3B 1FXTB 1NI2A 4W9IA 5AZFA 4MSQB 2DZJA 4KDIC 1Q0WB 4TUUA 3I3TB 4K7SA 3VXWA 3APCA 2D11A 1WMHB 2KFKA 4WJOA 4MJSA 1E7UA 1L7YA 2L0FA 3H6NA 3ZLZA 3A33B 4BBNF 4GOCA 4GDLA 1SE9A 4KSKC 3ZW3A 4DHJB 2JRHA 1TBEA 4ZRKA 3N32A 2NBUA 1G6JA 2J0MA 1H4RA 3B08A 2DAJA 4F7ZA 3MHSD 1Q1OA 2MWSB 4B95A 1S3SG 1LXDA 3UIPB 3VTVA 4A3OA 2KDIA 2FCQA 3R7RA 3PRMB 3L54A 1IP9A 3MTNB 2GBJA 3L10B 2K6QA 2CU1A 4GN1A 3SD5A 1YD8U 2K1FA 1F9JA 4HDQA 3V60A 2CHZA 2MSED 4NPNA 3HK0A 5HKHA 3JYUA 4NQLB 3VAWA 2ZPYA 2R2OA 3PHWB 4PS7A 3DOWA 3UF8A 2HE7A 2KKCA 4IM2A 4K7UA 2LGXA 3U8ZA 2IY0B 2D2QA 3TBLD 3VUYA 3A1QA 2UYZB 3U7DA 1V81A 3VUXA 2CHWA 1WR1A 4RM9A 2IO3B 4XC2A 5G2NA 1YX6B 4HCNB 2JZ3B 2LJ5A 2CS4A 3DBHI 4G3XB 3WAOA 1WE6A 4NAWB 4E74A 2O2VB 2MP2A 2N7EA 2KLCA 2WDTB 3Q3FA 3ZO5B 2A4ZA 1P3QU 2K39A 4FULA 3ZIMA 3M95A 2D3GA 5D7GA 2LI5A 2BYVE 1WY8A 2KNBA 2KWCA 4IG7B 3HIZA 1WFYA 1WF9A 2PJHA 2KFKB 1WJNA 2KZRA 4EEWA 3PRZA 3W1YA 3EHVA 1GJZA 2C5LC 2FCNA 2LZ6A 3W1SA 3DBSA 1IPGA 3QJZA 2MCNB 4MEMA 4WJNA 3R3MA 3ZVVA 1A5RA 2D10A 4AJYB 4HXDA 5CX3A 5D94A 2RPQA 3TCAA 2M1MA 1WGGA 3AI5A 4TV3A 4JIOU 4KVGB 2XBBC 4BBNC 4BVUC 2BPSA 1U4AA 3TMPB 2GBNA 2YLMA 4NY0A 4HLEA 3L13A 4AP4C 5DPTA 2LWPA 2C7HA 2O6VA 2ZVNA 4WWOA 3X0WA 3JSVB 4X57B 2KX0A 2ZVOA 2NPTB 3APDA 4DK5A 2AL3A 2ASQA 3OAWA 1VCBA 1Y8RC 1OTRB 3TIXA 4FN2A 3DVGY 4XX5A 4ZRIA 3PPAA 4IM3A 5E6PA 1LQBA 2G45B 2KJRA 1WGDA 4DWFA 2CHXA 4MGZE 5AZHA 3ZNHB 1WXSA 2MX2A 2WWZA 4EZJA 4NNJB 3KVFB 2GBMA 2C7MB 2M0XA 3KUDB 1UH6A 4PS3A 3EECA 4ANWA 4FADA 1VD2A 2KHWB 2HTHA 3DQVA 1V9JA 2FUHB 3KW5B 4LDTD 2G4SA 3VUWA 3ZNGC 4OVUA 2GBRA 3L16A 3S2AA 4DXAB 4RMAA 3ZDTA 3DBLI 3VTWA 2K6DB 2K8CA 1E7VA 3PHXB 4DBGA 2K25A 2JVCA 2BKFA 1X1MA 3O65B 5J17A 1E8ZA 3TJPA 2JF5A 5CHVC 2DZMA 2MBBB 1SIFA 4AWJA 1GG3A 2KWUB 1K8RB 4GU2A 3UINB 2N9PC 3TL5A 3NZSA 1YX5B 2MBQA 3AXCA 1WZ0A 5E6NA 3RUIB 2RGFA 3GOEA 4W9KA 3RZFA 3A9JA 2ZJDA 1R4NI 2REXA 4NJ6A 2DYOA 3EC8A 2KOXA 1WX7A 2XK5B 4DHJD 2WYQA 2V1YA 3W1SC 1WJ4A 3P2BA 1EF1A 3U30A 1WIAA 2IY1B 1WXMA 2ZPNA 3ONSA 1KJTA 4MSMB 1JRUA 2JXXA 4PS8A 2D07B 3VDZA 1GNUA 2KDBA 4BKGA 2JUOA 3PT2B 5L83A 1I35A 1L2NA 2PE9A 2O6VB 3A9KB 2KX3A 3PRPB 2N7DA 3BY4B 4HK2A 4W9GA 2IO0B 1YJ1A 2FNJB 1KM7A 2BKRB 2JY6A 2UWQA 1P1AA 1WRDB 1V5TA 3PV1A 3VVWB 5E6OA 4G11A 5DPWA 4TQ0A 2N9XA 3N30A 3R7QA 2JRIB 3DPDA 2DZKA 2NS5A 2DYBA 3H7PB 2KC1A 2WX1A 4HDOA 4OVVA 2AL6A 3N3KB 3UIOB 1TTNA 4GDKA 2LVQA 1IYFA 2BWFA 2FIDA 1RAXA 4KZCA 2LUEA 4M8MA 2LVOA 4WWPA 1XD3B 3CF6E 4RM8A 3PZDA 4YL8A 3IHPC 4DDID 1J8CA 2KTRB 1WX8A 1E5WA 2AWTA 2C9WB 3DVNV 2KLGA 2KVRA 4P7IA 3IG3A 2IBIB 1ISNA 2C60A 2OJRA 5DPSA 5CTRC 1OQYA 4W9HA 2MLBA 1V2YA 3WANA 5D2MB 2C7NB 2NCNA 3NY5A 1E8XA 3IBEA 4FHKA 2I1JA 3H1UA 4PYUA 4HPMB 3VH3B 5AEKB 3PTFC 1I42A 2KJHB 1LFDA 4MJSB 2A5UA 4GB9A 4ANUA 3QQ8B 2J0KA 4GSWA 2N4FA 5J18A 2IO2B 3AU5A 2PPHA 3BINA 2NBVB 5CHFA 3RCZA 4GDLB 3ZNZB 2LXAA 4ANXA 1XQQA 3HHMA 3QHTA 2EMTA 4I6NB 4CYEA 2DX5B 1HE8A 2LVPA 2QHOA 2MBOA 2JZZA 3KUZA 2DENB 3HM3A 4FLHA 4MH0E 1WGHA 2Z0DB 3V61A 3ZNID 3DBRI 5L95C 2YVCA 4LJPB 2PEAA 2KD0A 1XT9B 1WI0A 4BFRA 4ANVA 5IA7A 3ENEA 4MGIE 3QCAA 4FHJA 5IAAC 4J6IA 4JQWC 2LD9A 3PSEB 4NQKE 1OGWA 2L76A 4GIVA 2K8BA 3ZKJC 4FJZA 1WMHA 2KDEB 3B0AA 3OJ4B 2ZNVB 3KYCD 2XEWA 1ZW7A 3AULA 5G55A 4ZRJA 3A1QB 4W9LA 2LRWA 4HWIB 3V6EB 3WAPA 5EDSA 4II3B 1WR6E 2FCMA 3VHTC 2LRUA 3QIJA 4W9EA 2MW5A 1J0GA 2BGFA 2RD0A 2MP2B 4LJOB 3X23A 2KFJA 2BYEA 1V86A 2MQJA 4DHZE 4I6LB 2DZIA 4WQOB 3WAMA 4BKTA 4IWQA 1Q5WB 1EO6A 2MBHA 3ALBA 3JVZX 3PGEA 4KIKA 1H8CA 5AZGA 4AOFA 4XZ4A 3T8MA 2V4LA 4IWPA 1V80A 4WJQA 3QAQA 1OEYA 2R2QA 4ICVA 2KMAA 1V49A 1WE7A 4DDGD 5JHBA 1BT0A 2PE6B 4IM0A 4EUTA 5JZEB 4GMVA 1EF5A 2Z59B 5CHWA 3ZRFA 2GMIC 4AJWA 4WAAA 2KN5A 2RSUA 3DVGX 4EZLA 1WXVA 4I6PA 3VH4B 3KYDD 1EUVB 3MJWA 2L7RA 4NAWA 3WALA 2O2VA 1NDDA 2MRPA 3QC8B 2KC2A 3RULA 2WX0A 3QK0A 5TR5A 1QZEA 3QA8A 4BOSC 1LM8B 4ASWC 3CMMB 3K9PB 2JWZA 2JT4B 3IFWB 1WX9A 4K7WA 3SDLC 1TGZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDM C;  4FA6 A;  1GC6 A;  2KO3 A;  3VQI A;  2G4D B;  1WM3 A;  2KTF A;  5LXI B;  3APF A;  3ZRC A;  2NVU I;  2N1W A;  4AUQ C;  5KHQ A;  3H7S A;  4EFO A;  1RFA A;  4II2 B;  4MEL A;  2RR9 A;  4W9D A;  1D3Z A;  1M94 A;  2DYM A;  1SGH A;  1WGR A;  1ZKH A;  2AEH A;  2V3S A;  2ZCB A;  3NZU A;  4MDK E;  4HVB A;  2MBE A;  4PYZ A;  2IO1 B;  1WH3 A;  4CHK A;  5LLI A;  1WXA A;  2I1K A;  2L8J A;  4TQ1 A;  3KH0 A;  4E71 A;  4M0W B;  4WJP A;  3ML9 A;  3D32 A;  4A20 A;  3UQA A;  3LJ3 A;  4K1R B;  2NBW B;  4URK A;  2KXJ A;  2KAN A;  4KIK B;  3JSV A;  4A3P A;  2OOB B;  2NPT A;  1WYW B;  4GGQ A;  2KQ7 A;  4W9C A;  3A9J B;  4FJV B;  1E8Y A;  1Z2M A;  5C1Z A;  5JHA A;  4IUM B;  3RYT A;  1C1Y B;  4N9F 4;  3SU8 X;  3NS8 A;  5J2R A;  3JW0 X;  2J0J A;  2CKH B;  3A4R A;  1OEY J;  3CST A;  1UEL A;  2N1V A;  3QX1 A;  4HJK A;  1WGY A;  1CMX B;  2G3Q B;  3ZUN A;  2LXC A;  3DVN U;  3PRE A;  5BO4 B;  1ZGU B;  3SHQ A;  3Q3J A;  2Z0E B;  2KWV B;  2L3Z A;  3QWZ B;  4TKN A;  3V62 A;  2FIF A;  3QAR A;  3IVF A;  3M62 B;  2HJ8 A;  1MG8 A;  4IW0 A;  1P9D U;  3EFU A;  4W9J A;  3NOB A;  5GMV A;  2EKE C;  2B3A A;  2KDF B;  3AU4 A;  1WJ6 A;  4CO7 A;  4G50 A;  3ZTD A;  3RZW C;  4B6W A;  4F8C B;  4FBJ B;  2VRR B;  4JL9 A;  4GDK B;  2CR5 A;  3RD2 A;  2K8H A;  1S1Q B;  3ML8 A;  3PLU A;  1UGM A;  4NJ7 A;  1GC7 A;  2KMC A;  1R4M I;  3PVL A;  3VFK A;  2XK5 A;  4KZ0 A;  3WA0 A;  2L00 B;  1WM2 A;  2KQS A;  3PS6 A;  1P98 A;  1YIW A;  3A4S C;  3OJ3 A;  4BOZ B;  2LAS A;  2NR2 A;  4DHZ B;  1TZ1 A;  4K81 A;  2ZEQ A;  2IYD B;  4BKS A;  1J19 A;  1V6E A;  4HCP B;  1E8W A;  4KDL B;  2FAZ A;  4HPL B;  5DPR A;  1PQS A;  3A9K A;  4FJY A;  3UGB B;  5FR6 A;  4GXB A;  2GOW A;  4W9F A;  3ECI A;  4EOY A;  3DCG A;  1V5O A;  2M17 A;  4IC7 B;  5LXH A;  5D6J B;  1E90 A;  1RRB A;  3PLV A;  3R66 C;  4EZK A;  1WZ3 A;  1UBQ A;  2N9E B;  1KOT A;  2L05 A;  2FCS A;  2J7Q B;  2M4N A;  1YQB A;  2W9N A;  4M8N A;  4LCD E;  1UBI A;  4MGK E;  1T0Y A;  2DAF A;  5JH5 C;  2L0T A;  2MA9 B;  4JLC A;  3WIM A;  4WWN A;  3H7P A;  4MM3 A;  1NBF C;  2BF8 B;  2BWE S;  3GZN I;  4IWO A;  4ZYN A;  3B1L X;  2EMS A;  1WJU A;  4JGH B;  3DDC B;  4F1S A;  2KJ6 A;  5KHO A;  2ZNV C;  1KLV A;  2KK8 A;  1AAR A;  3OLM D;  1P0R A;  3C0R B;  1Z5S B;  4KV2 A;  2Y5B B;  3V6C B;  3CSF A;  3VTU A;  4BKS D;  2M8S A;  3KUC B;  3H9D A;  2LGD A;  2KTR A;  2ZCC A;  4G0N B;  1GUA B;  5C23 A;  1RLF A;  2O6V D;  3M3J A;  3K9O B;  4ZDV A;  1UZX B;  4LDT B;  3ZTC A;  5DCN A;  1UD7 A;  3LDZ E;  4E3C A;  2ZZP B;  3T9L A;  3L08 A;  2HD5 B;  4B9K A;  4EKU A;  4KSL C;  2IZV B;  3M63 B;  2GBK A;  2DHZ A;  3NHE B;  2JPH A;  3L0W B;  2AYO B;  2LGY A;  3L17 A;  4ICU A;  1C3T A;  3UQB A;  3HM6 X;  4MGY E;  2BYF A;  3RT3 B;  1FXT B;  1NI2 A;  4W9I A;  5AZF A;  4MSQ B;  2DZJ A;  4KDI C;  1Q0W B;  4TUU A;  3I3T B;  4K7S A;  3VXW A;  3APC A;  2D11 A;  1WMH B;  2KFK A;  4WJO A;  4MJS A;  1E7U A;  1L7Y A;  2L0F A;  3H6N A;  3ZLZ A;  3A33 B;  4BBN F;  4GOC A;  4GDL A;  1SE9 A;  4KSK C;  3ZW3 A;  4DHJ B;  2JRH A;  1TBE A;  4ZRK A;  3N32 A;  2NBU A;  1G6J A;  2J0M A;  1H4R A;  3B08 A;  2DAJ A;  4F7Z A;  3MHS D;  1Q1O A;  2MWS B;  4B95 A;  1S3S G;  1LXD A;  3UIP B;  3VTV A;  4A3O A;  2KDI A;  2FCQ A;  3R7R A;  3PRM B;  3L54 A;  1IP9 A;  3MTN B;  2GBJ A;  3L10 B;  2K6Q A;  2CU1 A;  4GN1 A;  3SD5 A;  1YD8 U;  2K1F A;  1F9J A;  4HDQ A;  3V60 A;  2CHZ A;  2MSE D;  4NPN A;  3HK0 A;  5HKH A;  3JYU A;  4NQL B;  3VAW A;  2ZPY A;  2R2O A;  3PHW B;  4PS7 A;  3DOW A;  3UF8 A;  2HE7 A;  2KKC A;  4IM2 A;  4K7U A;  2LGX A;  3U8Z A;  2IY0 B;  2D2Q A;  3TBL D;  3VUY A;  3A1Q A;  2UYZ B;  3U7D A;  1V81 A;  3VUX A;  2CHW A;  1WR1 A;  4RM9 A;  2IO3 B;  4XC2 A;  5G2N A;  1YX6 B;  4HCN B;  2JZ3 B;  2LJ5 A;  2CS4 A;  3DBH I;  4G3X B;  3WAO A;  1WE6 A;  4NAW B;  4E74 A;  2O2V B;  2MP2 A;  2N7E A;  2KLC A;  2WDT B;  3Q3F A;  3ZO5 B;  2A4Z A;  1P3Q U;  2K39 A;  4FUL A;  3ZIM A;  3M95 A;  2D3G A;  5D7G A;  2LI5 A;  2BYV E;  1WY8 A;  2KNB A;  2KWC A;  4IG7 B;  3HIZ A;  1WFY A;  1WF9 A;  2PJH A;  2KFK B;  1WJN A;  2KZR A;  4EEW A;  3PRZ A;  3W1Y A;  3EHV A;  1GJZ A;  2C5L C;  2FCN A;  2LZ6 A;  3W1S A;  3DBS A;  1IPG A;  3QJZ A;  2MCN B;  4MEM A;  4WJN A;  3R3M A;  3ZVV A;  1A5R A;  2D10 A;  4AJY B;  4HXD A;  5CX3 A;  5D94 A;  2RPQ A;  3TCA A;  2M1M A;  1WGG A;  3AI5 A;  4TV3 A;  4JIO U;  4KVG B;  2XBB C;  4BBN C;  4BVU C;  2BPS A;  1U4A A;  3TMP B;  2GBN A;  2YLM A;  4NY0 A;  4HLE A;  3L13 A;  4AP4 C;  5DPT A;  2LWP A;  2C7H A;  2O6V A;  2ZVN A;  4WWO A;  3X0W A;  3JSV B;  4X57 B;  2KX0 A;  2ZVO A;  2NPT B;  3APD A;  4DK5 A;  2AL3 A;  2ASQ A;  3OAW A;  1VCB A;  1Y8R C;  1OTR B;  3TIX A;  4FN2 A;  3DVG Y;  4XX5 A;  4ZRI A;  3PPA A;  4IM3 A;  5E6P A;  1LQB A;  2G45 B;  2KJR A;  1WGD A;  4DWF A;  2CHX A;  4MGZ E;  5AZH A;  3ZNH B;  1WXS A;  2MX2 A;  2WWZ A;  4EZJ A;  4NNJ B;  3KVF B;  2GBM A;  2C7M B;  2M0X A;  3KUD B;  1UH6 A;  4PS3 A;  3EEC A;  4ANW A;  4FAD A;  1VD2 A;  2KHW B;  2HTH A;  3DQV A;  1V9J A;  2FUH B;  3KW5 B;  4LDT D;  2G4S A;  3VUW A;  3ZNG C;  4OVU A;  2GBR A;  3L16 A;  3S2A A;  4DXA B;  4RMA A;  3ZDT A;  3DBL I;  3VTW A;  2K6D B;  2K8C A;  1E7V A;  3PHX B;  4DBG A;  2K25 A;  2JVC A;  2BKF A;  1X1M A;  3O65 B;  5J17 A;  1E8Z A;  3TJP A;  2JF5 A;  5CHV C;  2DZM A;  2MBB B;  1SIF A;  4AWJ A;  1GG3 A;  2KWU B;  1K8R B;  4GU2 A;  3UIN B;  2N9P C;  3TL5 A;  3NZS A;  1YX5 B;  2MBQ A;  3AXC A;  1WZ0 A;  5E6N A;  3RUI B;  2RGF A;  3GOE A;  4W9K A;  3RZF A;  3A9J A;  2ZJD A;  1R4N I;  2REX A;  4NJ6 A;  2DYO A;  3EC8 A;  2KOX A;  1WX7 A;  2XK5 B;  4DHJ D;  2WYQ A;  2V1Y A;  3W1S C;  1WJ4 A;  3P2B A;  1EF1 A;  3U30 A;  1WIA A;  2IY1 B;  1WXM A;  2ZPN A;  3ONS A;  1KJT A;  4MSM B;  1JRU A;  2JXX A;  4PS8 A;  2D07 B;  3VDZ A;  1GNU A;  2KDB A;  4BKG A;  2JUO A;  3PT2 B;  5L83 A;  1I35 A;  1L2N A;  2PE9 A;  2O6V B;  3A9K B;  2KX3 A;  3PRP B;  2N7D A;  3BY4 B;  4HK2 A;  4W9G A;  2IO0 B;  1YJ1 A;  2FNJ B;  1KM7 A;  2BKR B;  2JY6 A;  2UWQ A;  1P1A A;  1WRD B;  1V5T A;  3PV1 A;  3VVW B;  5E6O A;  4G11 A;  5DPW A;  4TQ0 A;  2N9X A;  3N30 A;  3R7Q A;  2JRI B;  3DPD A;  2DZK A;  2NS5 A;  2DYB A;  3H7P B;  2KC1 A;  2WX1 A;  4HDO A;  4OVV A;  2AL6 A;  3N3K B;  3UIO B;  1TTN A;  4GDK A;  2LVQ A;  1IYF A;  2BWF A;  2FID A;  1RAX A;  4KZC A;  2LUE A;  4M8M A;  2LVO A;  4WWP A;  1XD3 B;  3CF6 E;  4RM8 A;  3PZD A;  4YL8 A;  3IHP C;  4DDI D;  1J8C A;  2KTR B;  1WX8 A;  1E5W A;  2AWT A;  2C9W B;  3DVN V;  2KLG A;  2KVR A;  4P7I A;  3IG3 A;  2IBI B;  1ISN A;  2C60 A;  2OJR A;  5DPS A;  5CTR C;  1OQY A;  4W9H A;  2MLB A;  1V2Y A;  3WAN A;  5D2M B;  2C7N B;  2NCN A;  3NY5 A;  1E8X A;  3IBE A;  4FHK A;  2I1J A;  3H1U A;  4PYU A;  4HPM B;  3VH3 B;  5AEK B;  3PTF C;  1I42 A;  2KJH B;  1LFD A;  4MJS B;  2A5U A;  4GB9 A;  4ANU A;  3QQ8 B;  2J0K A;  4GSW A;  2N4F A;  5J18 A;  2IO2 B;  3AU5 A;  2PPH A;  3BIN A;  2NBV B;  5CHF A;  3RCZ A;  4GDL B;  3ZNZ B;  2LXA A;  4ANX A;  1XQQ A;  3HHM A;  3QHT A;  2EMT A;  4I6N B;  4CYE A;  2DX5 B;  1HE8 A;  2LVP A;  2QHO A;  2MBO A;  2JZZ A;  3KUZ A;  2DEN B;  3HM3 A;  4FLH A;  4MH0 E;  1WGH A;  2Z0D B;  3V61 A;  3ZNI D;  3DBR I;  5L95 C;  2YVC A;  4LJP B;  2PEA A;  2KD0 A;  1XT9 B;  1WI0 A;  4BFR A;  4ANV A;  5IA7 A;  3ENE A;  4MGI E;  3QCA A;  4FHJ A;  5IAA C;  4J6I A;  4JQW C;  2LD9 A;  3PSE B;  4NQK E;  1OGW A;  2L76 A;  4GIV A;  2K8B A;  3ZKJ C;  4FJZ A;  1WMH A;  2KDE B;  3B0A A;  3OJ4 B;  2ZNV B;  3KYC D;  2XEW A;  1ZW7 A;  3AUL A;  5G55 A;  4ZRJ A;  3A1Q B;  4W9L A;  2LRW A;  4HWI B;  3V6E B;  3WAP A;  5EDS A;  4II3 B;  1WR6 E;  2FCM A;  3VHT C;  2LRU A;  3QIJ A;  4W9E A;  2MW5 A;  1J0G A;  2BGF A;  2RD0 A;  2MP2 B;  4LJO B;  3X23 A;  2KFJ A;  2BYE A;  1V86 A;  2MQJ A;  4DHZ E;  4I6L B;  2DZI A;  4WQO B;  3WAM A;  4BKT A;  4IWQ A;  1Q5W B;  1EO6 A;  2MBH A;  3ALB A;  3JVZ X;  3PGE A;  4KIK A;  1H8C A;  5AZG A;  4AOF A;  4XZ4 A;  3T8M A;  2V4L A;  4IWP A;  1V80 A;  4WJQ A;  3QAQ A;  1OEY A;  2R2Q A;  4ICV A;  2KMA A;  1V49 A;  1WE7 A;  4DDG D;  5JHB A;  1BT0 A;  2PE6 B;  4IM0 A;  4EUT A;  5JZE B;  4GMV A;  1EF5 A;  2Z59 B;  5CHW A;  3ZRF A;  2GMI C;  4AJW A;  4WAA A;  2KN5 A;  2RSU A;  3DVG X;  4EZL A;  1WXV A;  4I6P A;  3VH4 B;  3KYD D;  1EUV B;  3MJW A;  2L7R A;  4NAW A;  3WAL A;  2O2V A;  1NDD A;  2MRP A;  3QC8 B;  2KC2 A;  3RUL A;  2WX0 A;  3QK0 A;  5TR5 A;  1QZE A;  3QA8 A;  4BOS C;  1LM8 B;  4ASW C;  3CMM B;  3K9P B;  2JWZ A;  2JT4 B;  3IFW B;  1WX9 A;  4K7W A;  3SDL C;  1TGZ B; 
#chains in the Genus database with same CATH topology
 2KO3 A;  2KTF A;  1TY0 A;  4XE0 A;  3ZQ4 A;  2K9X A;  3CWI A;  2RR9 A;  1K50 A;  1M94 A;  1C9F A;  3P4S B;  2DYM A;  5JXV A;  4PYZ A;  2IO1 B;  1WH3 A;  1WWT A;  1WXA A;  2DLB A;  4TQ1 A;  3J9C A;  4WJP A;  4KKI A;  3ML9 A;  1N5W A;  2KAN A;  4A3P A;  1WYW B;  3A9J B;  4KGR A;  1Z2M A;  4WUR A;  3RYT A;  2X8X X;  3P1M A;  4N9F 4;  3SU8 X;  5J2R A;  3JW0 X;  1SE3 A;  1WGY A;  2G3Q B;  3DVN U;  1ZGU B;  2ICI A;  2IGD A;  2MEK A;  3KWV A;  4TMA B;  4P1C C;  3V62 A;  3QWZ B;  1TY2 A;  3QAR A;  2BYT A;  1MG8 A;  1UF0 A;  2EKE C;  2WP9 B;  3ZTD A;  2LGI A;  1A70 A;  1S1Q B;  2KAC A;  3A4S C;  2NR2 A;  2BQQ A;  1I4Q A;  4K81 A;  2QSD A;  4HCP B;  1L4Z B;  3A9K A;  5FR6 A;  5LXH A;  3DBH B;  5IKC M;  2VZK D;  1UBQ A;  1KOT A;  2ZW0 A;  2NTT A;  4LCD E;  1FRR A;  2BS2 B;  2WXO A;  4WWN A;  3B1L X;  1DGJ A;  2KJ6 A;  5KHO A;  1KFY B;  2Y5B B;  3Q8C A;  2LGD A;  1GUA B;  1ZXH A;  4S0R A;  3K9O B;  3Q6B A;  4LDT B;  4M01 A;  1TIF A;  1UD7 A;  5D3D A;  3U7Z A;  1XO3 A;  4B9K A;  4EKU A;  4ICU A;  3OG5 A;  5TSS A;  1FXT B;  2LMC A;  1I4G A;  3RNE C;  1Q0W B;  4TUU A;  2D11 A;  1WMH B;  4MJS A;  4PK1 A;  2LJI A;  3ZLZ A;  4B0M A;  4KSK C;  4GDL A;  2RDG A;  3N32 A;  2WNM A;  1F2R I;  2DAJ A;  4JWU C;  1AWD A;  3W2D A;  2KDI A;  1C79 A;  3L54 A;  3MTN B;  3L10 B;  2K6Q A;  3FIL A;  2CU1 A;  3HK0 A;  5HKH A;  1RWS A;  2BB6 A;  4YTM B;  3PHW B;  3DOW A;  2KKC A;  2IY0 B;  1J7A A;  2D2Q A;  3U7D A;  2SAK A;  2CHW A;  4RM9 A;  4HCN B;  3TUO A;  5C3J B;  2LJ5 A;  4G3X B;  1T5X D;  1FNU A;  1WE6 A;  3Q3F A;  2A4Z A;  4YTP B;  1XLQ A;  2BYV E;  2PKO A;  2N9K A;  2RMM A;  2PJH A;  2KFK B;  3W1Y A;  3EHV A;  1HXY D;  1FMA D;  4DXG A;  3W1S A;  3QJZ A;  4N6E B;  1FEH A;  4MEM A;  4WJN A;  1L0X B;  1A5R A;  2Q5W D;  4HXD A;  5CX3 A;  1HQR D;  4TV3 A;  1UGJ A;  1SF0 A;  4BBN C;  5EE0 A;  1ACC A;  4HJG E;  4OZA A;  3L13 A;  2LWP A;  2UU7 A;  2INN E;  3X0W A;  4DK5 A;  2AL3 A;  3OAW A;  3TIX A;  3DHI C;  2G45 B;  4DWF A;  4EZJ A;  3KVF B;  4RF1 A;  2JZP A;  2WXQ A;  5HI1 A;  1UH6 A;  3DQV A;  4OVU A;  4RMA A;  1MJD A;  1E7V A;  3PHX B;  3U52 E;  1AW7 A;  3ETR A;  5J17 A;  1X1M A;  1SBB B;  2MBB B;  4ZRQ A;  1GG3 A;  2KWU B;  4GU2 A;  3LYY A;  5E6N A;  1NEN B;  2KWD A;  5BYS A;  1XF5 L;  2VH2 A;  1N6Z A;  3A9J A;  1R4N I;  2DYO A;  1SIJ A;  2V1Y A;  3W1S C;  1EF1 A;  2IY1 B;  1WXM A;  2V3P A;  3R2I A;  2JXX A;  1HTQ A;  4ZHO A;  3VDZ A;  1V97 A;  1GNU A;  4BKG A;  1I35 A;  4WIP A;  2O6V B;  2KX3 A;  2N7D A;  5C2T B;  2FNJ B;  2UWQ A;  1P1A A;  4G11 A;  4TQ0 A;  1SJH D;  2N9X A;  3R7Q A;  1FXA A;  1T0Q C;  2DYB A;  3H7P B;  4MM3 B;  4HDO A;  2AL6 A;  2BWF A;  2QDF A;  2D3A A;  1PFD A;  1BML C;  2J52 A;  2KTR B;  3N1X C;  4RF0 A;  2KLG A;  2IBI B;  1ISN A;  1DOI A;  2HDE A;  3SR6 A;  5D2M B;  1FXI A;  1E8X A;  2I1J A;  3H1U A;  3LXF A;  3VH3 B;  2J4X A;  2KJH B;  4OW0 A;  3Q8F A;  3IAM 1;  3QQ8 B;  2N4F A;  1TKE A;  3VRA B;  3HRD D;  3L4P A;  2LVP A;  2QHO A;  3PZ7 A;  4MH0 E;  1KRH A;  3DBR I;  4LJP B;  1T3Q A;  2BVC A;  2KD0 A;  1P7F A;  2PEA A;  4C56 C;  4ZYS A;  4ANV A;  5IA7 A;  3QCA A;  4FHJ A;  4LTU A;  4JQW C;  3NZ3 A;  2L76 A;  1TYG B;  3OWE B;  4EE2 A;  1WMH A;  3B0A A;  5GXG B;  3TEZ A;  3GS2 A;  5G55 A;  4XDC A;  3A1Q B;  4W9L A;  1IUE A;  4II3 B;  2LRU A;  5HG2 A;  2MW5 A;  1CQV A;  2RD0 A;  4KX6 B;  4US9 A;  5MPO A;  2QC8 A;  3VR9 B;  4IWQ A;  3PGE A;  3JVZ X;  5FR3 A;  3BK1 A;  3W9C B;  2R2Q A;  2L32 A;  2N0S B;  4KGS A;  2INP E;  2IJ0 A;  1JWS D;  3ZXR A;  2NMQ A;  1EF5 A;  5CHW A;  3AMZ A;  4WAA A;  3DVG X;  4I6P A;  4A90 A;  3KYD D;  1EUV B;  3BVZ A;  1NDD A;  2KC2 A;  3N20 C;  2WX0 A;  3QA8 A;  4BOS C;  4IOI E;  1DYQ A;  2BB5 A;  4OHJ A;  2QIL A;  4YSX B;  2W3R A;  2JWZ A;  3BII D;  1TGZ B;  3ZDM C;  3HUI A;  2G4D B;  3APF A;  2N1W A;  4A9A A;  4NZL B;  2INC C;  4IDI A;  2V3S A;  1WGR A;  4MDK E;  2WDR B;  4H2A A;  1YN4 A;  1ROE A;  4LNO A;  4M0W B;  3D32 A;  4A20 A;  3UQA A;  4K1R B;  2JU6 X;  4URK A;  2MJE A;  2BS3 B;  1ENF A;  5G5H A;  1L4D B;  1CJE A;  4GGQ A;  2KQ7 A;  4FJV B;  3AE3 B;  4IUM B;  2MJD A;  3NS8 A;  3A4R A;  4CQN A;  1UEL A;  1F52 A;  2K22 A;  2LXC A;  4C7Y A;  3BZD B;  3Q3J A;  2L3Z A;  3NVW A;  2WXL A;  2HJ1 A;  2IPK D;  1QF6 A;  2EEL A;  1JML A;  4K3B A;  1WJ6 A;  3AEE B;  4G50 A;  3RZW C;  2JXT A;  4FBJ B;  4JL9 A;  2K8H A;  1UGM A;  1R4M I;  2G9H D;  2L00 B;  1WM2 A;  3PS6 A;  1E9M A;  1QKZ A;  3OJ3 A;  4DHZ B;  2LAS A;  1CZP A;  3W5V B;  1E7P B;  4ARC A;  4USA A;  1J19 A;  1GAQ B;  1V6E A;  1E8W A;  2FAZ A;  4FJY A;  4GXB A;  3ECI A;  3DCG A;  2M17 A;  5AUK A;  1WZ3 A;  1NVI D;  3P63 A;  1VRA B;  3C19 A;  1T0Y A;  2L0T A;  2MA9 B;  3WIM A;  2DBY A;  3H7P A;  4MM3 A;  2BWE S;  3GZN I;  4ZYN A;  1WJU A;  4JGH B;  2ZNV C;  4M00 A;  5IN7 A;  1VR9 A;  3VTU A;  3V6C B;  3CSF A;  3KUC B;  3H9D A;  2KTR A;  2MH7 A;  1SB3 C;  2ZCC A;  3LB8 C;  4K3C A;  3M3J A;  2O6V D;  1FNV A;  4ZDV A;  3FAH A;  3R2T A;  2HD5 B;  2V3N A;  3M63 B;  4HRS A;  3L0W B;  3RT3 B;  4W9I A;  3BK2 A;  5AZF A;  4XWW A;  4A6Q A;  4KDI C;  1V1O A;  3PO0 A;  3APC A;  4YWG G;  1PGX A;  1ZUD 2;  4BBN F;  1F0Z A;  3AEA B;  3ZW3 A;  2LGS A;  2RPV A;  3E56 A;  2WGS A;  1G6J A;  2WXF A;  4P6V F;  2B76 B;  3MHS D;  1Q1O A;  3DWM A;  2ACZ B;  1LXD A;  3UIP B;  4A3O A;  4LNK A;  1IP9 A;  3AV8 A;  3RN9 C;  2WDV B;  4REZ A;  3IT4 B;  5T8I A;  3SD5 A;  3V60 A;  1F9J A;  3Q2A C;  3VAW A;  2ZPY A;  4BAX A;  1ZOY B;  4YSY B;  1FRD A;  3NJT A;  4PS7 A;  2ONQ A;  2HE7 A;  3UF8 A;  2LHE A;  2LGX A;  2WXR A;  3TBL D;  3A1Q A;  2UYZ B;  3VUX A;  5G2N A;  1YX6 B;  2OJW A;  2WXK A;  2CS4 A;  4E74 A;  3WAO A;  4NAW B;  3ZO5 B;  1P3Q U;  3EGR A;  2IGG A;  2D3G A;  5D7G A;  3I5J C;  1WY8 A;  2KNB A;  1WF9 A;  3AED B;  3RPF C;  1WJN A;  3BWU D;  3PRZ A;  1KTK A;  1FFV A;  1UWM A;  2MCN B;  3IXS A;  1YJJ A;  4AJY B;  5D94 A;  4MH8 A;  2RPQ A;  3TCA A;  3AI5 A;  1WGG A;  2XBB C;  3VR8 B;  4BVU C;  2BPS A;  3AE6 B;  2YLM A;  2YEP B;  4HLE A;  4AP4 C;  1YJI A;  5DPT A;  1I4X A;  5BMH A;  4WWO A;  2PTL A;  3JSV B;  1F2R C;  2NPT B;  3APD A;  2ASQ A;  2D3C A;  1VCB A;  1OTR B;  4P1B C;  1V1P A;  4WAF A;  3DVG Y;  1EU4 A;  4L2Y A;  4XX5 A;  1VZ7 A;  5E6P A;  1ZDX A;  1F1H A;  1BUI C;  3Q3M C;  2GBM A;  3KUD B;  3SFE B;  2KHW B;  2V4I B;  4ZRP A;  1V9J A;  3KW5 B;  3GE8 C;  3U2S C;  3L16 A;  4DXA B;  1QOG A;  1FPY A;  4RGM A;  3DBL I;  2K8C A;  3O65 B;  4M0W A;  1E8Z A;  1C4C A;  2JF5 A;  1SIF A;  1EWC A;  1K8R B;  3UIN B;  3TL5 A;  3NZS A;  1YX5 B;  3RUI B;  5BYQ A;  5H8Y E;  1RYJ A;  3GOE A;  1JQ4 A;  4LNI A;  4M02 A;  1JWB D;  1WX7 A;  2XK5 B;  1KH0 A;  1WJ4 A;  4JPS A;  3U30 A;  4ITK A;  3NG0 A;  4WH4 A;  5LNK 1;  2JUO A;  1L2N A;  3PRP B;  1E6E B;  3NVY A;  3BY4 B;  1YJ1 A;  1P7E A;  3AE4 B;  1WRD B;  3VVW B;  3PV1 A;  5E6O A;  4RNA A;  1HTO A;  2I2Y A;  1XLO A;  2KQ4 X;  2NS5 A;  1B1Z A;  1Y56 A;  2WX1 A;  4OVV A;  3N3K B;  1TTN A;  2PLP A;  2LVQ A;  4OVZ A;  1IYF A;  4WWP A;  3AE5 B;  3GZN B;  4RM8 A;  1BXT A;  4YL8 A;  2LUM A;  1J8C A;  1NYR A;  4NJC A;  3DVN V;  1TS4 A;  4ARI A;  2C60 A;  2IGH A;  1OQY A;  3DWG C;  3MP9 A;  3PTF C;  2ON8 A;  2VH1 A;  1GB1 A;  2J0K A;  1ZDV A;  3RCZ A;  3AU5 A;  3BIN A;  2NBV B;  5CHF A;  1OQR A;  2LHD A;  1XQQ A;  4I6N B;  4CYE A;  2EMT A;  2Y3A A;  2V0G A;  1L6U A;  2JZZ A;  3HM3 A;  4FLH A;  1D6E C;  1WGH A;  1GB4 A;  2E3T A;  2YVC A;  3P42 A;  4BFR A;  4O1N A;  3PSE B;  3N1Z C;  1JRO A;  3URY A;  4FJZ A;  4L1B A;  1PGB A;  3N9Y C;  2KDE B;  2ZNV B;  2XEW A;  2JX5 A;  2V9H A;  2GRI A;  4GLS C;  1J0G A;  2BGF A;  1MFW A;  1FCL A;  4DHZ E;  2DZI A;  1PGA A;  3MC9 A;  1H8C A;  2CJO A;  5AZG A;  4AOF A;  1V80 A;  4UDU C;  3QAQ A;  2N9L A;  1OQQ A;  1V49 A;  1WE7 A;  2DNF A;  1BT0 A;  2D5G A;  4EUT A;  5JZE B;  2PMV A;  2Z59 B;  3ZRF A;  4AJW A;  3NUH B;  3BVG A;  4NAW A;  3AN1 A;  3WAL A;  2MRP A;  3QC8 B;  1E10 A;  3RUL A;  2KMM A;  1QZE A;  5TR5 A;  3AE1 B;  1EU3 A;  1M4V A;  2JT4 B;  2XN9 C;  1D5Z C;  2IND C;  2CU3 A;  2AX5 A;  1WX9 A;  3SDL C;  3VQI A;  1WM3 A;  5LXI B;  3V05 A;  3ZRC A;  2NVU I;  4AUQ C;  3H7S A;  3MJ5 A;  4MEL A;  1MHX A;  1D3Z A;  4W9D A;  1SJE D;  2AQ1 B;  2BTE A;  3AE2 B;  3TEX A;  4HVB A;  1SGH A;  2AEH A;  1D4B A;  2MBE A;  3I57 A;  4CHK A;  5LLI A;  2N7J A;  2L8J A;  2WXI A;  3KH0 A;  4E71 A;  3ABV B;  2RDH A;  2NBW B;  2KXJ A;  4KIK B;  4PT5 A;  3JSV A;  3KWL A;  4JE3 B;  3MC0 B;  2NPT A;  1T0S C;  4XDD A;  1L0V B;  5AUI A;  5JHA A;  1C1Y B;  2H89 B;  2QCZ A;  2CKH B;  1OEY J;  3CST A;  3QX1 A;  1CMX B;  3ZUN A;  5IP4 D;  5I4D A;  5BO4 B;  4TKN A;  1KLG D;  2HJ8 A;  3AB5 A;  3NOB A;  5GMV A;  2B3A A;  3AU4 A;  4CO7 A;  1WYG A;  4YXD B;  1GOZ A;  2CR5 A;  4NJ7 A;  3WA0 A;  1GC7 A;  2KMC A;  3VFK A;  2XK5 A;  4KZ0 A;  1JWM D;  2KQS A;  1YIW A;  4LLG M;  2JWU A;  2ZEQ A;  2IYD B;  4BKS A;  4HPL B;  1PYW D;  5DPR A;  1PQS A;  3UGB B;  2GOW A;  4W9F A;  4EOY A;  2QIE B;  3AEF B;  2W55 A;  2WS3 B;  1E90 A;  3RFZ B;  4EZK A;  2PIA A;  2L05 A;  2FCS A;  2M4N A;  2WQY B;  1YQB A;  5EE3 A;  4M8N A;  4RH6 A;  4MGK E;  1AYF A;  5JH5 C;  4JLC A;  3I63 C;  2BF8 B;  4IWO A;  2M19 A;  3DDC B;  1KLV A;  2KK8 A;  1L6V A;  4C7Z A;  3B2F A;  4BKS D;  2M8S A;  4G0N B;  3VRB B;  4D2K A;  1RLF A;  1UZX B;  3ZTC A;  4LK0 M;  5DCN A;  2SEB D;  2ZZP B;  3T9L A;  3L08 A;  1JWU D;  4KSL C;  3NHE B;  2JPH A;  2AYO B;  2LGY A;  2KVZ A;  3UQB A;  4MGY E;  2BYF A;  3EA6 A;  1IGD A;  1NI2 A;  4MSQ B;  2DZJ A;  4Q2J A;  3VXW A;  4K7S A;  2KFK A;  4WJO A;  1E7U A;  3IT6 B;  2L0F A;  2WU2 B;  2X38 A;  2Y5P A;  2BW2 A;  1SE9 A;  4ZRK A;  5D3I B;  2IDY A;  2NBU A;  3TEW A;  1HEZ E;  2J0M A;  1H4R A;  3MC8 A;  3Q8E A;  1ZPS A;  2LEK A;  1I7H A;  1S3S G;  4JX1 C;  3VTV A;  3C8Y A;  3R7R A;  3PRM B;  2EKI A;  2GBJ A;  1YD8 U;  2K1F A;  3Q14 C;  4HDQ A;  2CHZ A;  4NPN A;  2R2O A;  3GB1 A;  3SFD B;  1L0Y B;  4C4V B;  2WXM A;  1J7B A;  1R4N B;  1V81 A;  1WR1 A;  1SE2 A;  2IO3 B;  4XC2 A;  2PW9 A;  1WGK A;  4B0E A;  3DBH I;  1OFF A;  2N7E A;  2K39 A;  4FUL A;  1QIL A;  1TS2 A;  2JYT A;  3M95 A;  3RNG C;  2LI5 A;  4MT5 A;  2KWC A;  4IG7 B;  3HIZ A;  1WFY A;  2I38 A;  2KZR A;  4EEW A;  3AEG B;  1GJZ A;  1K51 A;  2LZ6 A;  1IPG A;  3ZJU A;  3ZVV A;  1AN8 A;  4BZA A;  4YTN B;  5BYR A;  1MG4 A;  3AE8 B;  1YOV B;  2OED A;  3BVM A;  1XEE A;  1U4A A;  1CK1 A;  3FKY A;  4NY0 A;  2C7H A;  2O6V A;  2PVG C;  1ET9 A;  2ZVO A;  1QOA A;  4ZRI A;  3PPA A;  2KJR A;  5FK9 C;  2CHX A;  5AZH A;  3ZNH B;  1WXS A;  2MX2 A;  4NNJ B;  3DHH C;  2KDM A;  2M0X A;  4MAC A;  4PS3 A;  1VD2 A;  5HHD G;  3NS1 A;  2G4S A;  3VUW A;  3ZNG C;  3S2A A;  3ZDT A;  3VTW A;  4AS1 A;  4DBG A;  2JVC A;  2BKF A;  3TJP A;  3FC4 A;  4AWJ A;  2DZM A;  3Q3O C;  2N9P C;  3DBR B;  2MBQ A;  3AXC A;  1WZ0 A;  2RGF A;  4TSS A;  2BS4 B;  2REX A;  2WXN A;  2KOX A;  4DHJ D;  2WYQ A;  4KKJ A;  1YNT E;  4MSM B;  1KJT A;  1JRU A;  2D07 B;  2GB1 A;  3PT2 B;  2PE9 A;  4HK2 A;  1D5M C;  1KM7 A;  2BKR B;  2JY6 A;  1Q10 A;  1V5T A;  5DPW A;  3N30 A;  2HTM E;  4RGO S;  4US8 A;  2JRI B;  2DZK A;  1JRP A;  3RNB C;  3UIO B;  1PDX A;  1TT5 B;  2L83 A;  4KZC A;  1RAX A;  1EM7 A;  1PUT A;  2LUE A;  4M8M A;  2LVO A;  1XD3 B;  3CF6 E;  1SSN A;  3PZD A;  4DDI D;  1IGC A;  1E5W A;  2C9W B;  3PZ8 A;  2CJN A;  1XLP A;  1ZP0 B;  1EWY C;  2OJR A;  3MFG A;  2FBW B;  2MLB A;  3WAN A;  2D3B A;  2C7N B;  2NCN A;  3NY5 A;  4FHK A;  1STE A;  3UI3 A;  2W82 A;  1I42 A;  2A5U A;  4GB9 A;  2BT6 A;  2IO2 B;  4WWM A;  2PPH A;  3ZNZ B;  2L1A A;  2LXA A;  3HHM A;  3Q69 A;  2DX5 B;  1RM6 C;  4C00 A;  2MBO A;  3KUZ A;  2DEN B;  1NYQ A;  2L52 A;  1QLB B;  2H88 B;  5L95 C;  1JAL A;  3AE9 B;  5FKA C;  1YN3 A;  1N60 A;  5IAA C;  4J6I A;  4NQK E;  1OGW A;  4LNN A;  3AM9 A;  2K8B A;  4NAM A;  2R61 A;  3OJ4 B;  1YQ4 B;  3KYC D;  1ZW7 A;  3AUL A;  4HWI B;  3V6E B;  3WAP A;  1HA5 A;  1WR6 E;  3QIJ A;  4A55 A;  4W9E A;  2MP2 B;  4LJO B;  2AQ3 B;  1DOX A;  1XCT L;  1V86 A;  2MQJ A;  4WQO B;  1F77 A;  1Q5W B;  1EO6 A;  5BMI A;  3ZGZ A;  2V4L A;  2WXP A;  4YSZ B;  1C4P A;  1OEY A;  4ICV A;  2KMA A;  2PE6 B;  4IM0 A;  2GLS A;  2WU5 B;  1C77 A;  1FNW A;  4GMV A;  4C4V A;  1N61 A;  2RSU A;  1SE4 A;  1R4M B;  1WXV A;  3H8H A;  3P4Q B;  3QK0 A;  4ASW C;  3T3N A;  3IFW B;  3U4E G;  4K7W A;  1RFK A;  2W54 A;  4FA6 A;  1K52 A;  1GC6 A;  5IO9 A;  1C78 A;  5KHQ A;  4EFO A;  1RFA A;  4II2 B;  1DOY A;  2M56 B;  3O13 A;  1WSP A;  1ZKH A;  2ZCB A;  4LNF A;  4HEA 1;  3NZU A;  4WQM A;  2ZW1 A;  1QT9 A;  2I1K A;  2JYE A;  2YEP F;  3LJ3 A;  4P16 A;  2K5P A;  2OOB B;  3P4R B;  2W3S A;  4ACF A;  4W9C A;  2KN4 A;  1ESF A;  1E8Y A;  1IBX B;  1NI3 A;  5C1Z A;  1ZE3 D;  2J53 A;  2J0J A;  2JSV X;  4RFB A;  2N1V A;  4HJK A;  2Y5C A;  1VJK A;  3PRE A;  3SHQ A;  4HRO A;  4J3O D;  2Z0E B;  3ZXV A;  3RMK C;  2KWV B;  3Q8A A;  2FIF A;  2DWQ A;  1QOF A;  3IVF A;  3M62 B;  4IW0 A;  1NEK B;  1P9D U;  1XXG A;  3EFU A;  4W9J A;  3RI7 C;  2KDF B;  2AQ2 B;  3EUB 2;  4B6W A;  4F8C B;  4N58 A;  2VRR B;  4GDK B;  2WLB A;  3RD2 A;  4RCO A;  1R7S A;  3ML8 A;  3PLU A;  3PVL A;  2WHI A;  3CIR B;  1P98 A;  4BOZ B;  1TZ1 A;  2K3U A;  4KDL B;  1V5O A;  4IC7 B;  5D6J B;  1RRB A;  3PLV A;  3R66 C;  2N9E B;  2J7Q B;  1VZ6 A;  2W9N A;  1UBI A;  1MVK A;  2DAF A;  3ZYY X;  2OHF A;  1NBF C;  3B9J A;  3NVZ A;  1YQ3 B;  4RGT A;  2EMS A;  4F1S A;  1AAR A;  3OLM D;  1P0R A;  1TS5 A;  1Z5S B;  3C0R B;  4KV2 A;  5C23 A;  2E6X A;  2QMT A;  3BYT B;  4HPP A;  4S17 A;  1J7C A;  3LDZ E;  4E3C A;  4OZB A;  3IAS 1;  2IZV B;  2GBK A;  2DHZ A;  1C3T A;  3L17 A;  3HM6 X;  2LFI A;  3I3T B;  1I4H A;  1L7Y A;  2BBC A;  3RNF C;  3H6N A;  3A33 B;  3SEB A;  4FXC A;  4GOC A;  5EE1 A;  1XLN A;  4DHJ B;  4XYC A;  2JRH A;  1TBE A;  1QOB A;  4ZOH C;  1VDV A;  5G5G A;  3Q3N C;  3B08 A;  1ET6 A;  4F7Z A;  2MWS B;  4B95 A;  2J42 A;  1JWA D;  4HKZ E;  5H92 C;  2FCQ A;  3DBL B;  4GN1 A;  2MSE D;  1SXT A;  3JYU A;  3N1Y C;  4KGT A;  4NQL B;  3TEY A;  3R8B A;  2GI9 A;  4RGN A;  4XWT A;  4IM2 A;  4K7U A;  3U8Z A;  3VUY A;  1FO4 A;  3ZJV A;  2JZ3 B;  2O2V B;  2MP2 A;  3AE7 B;  2WDT B;  2KLC A;  1JCK B;  3V3X A;  3ZIM A;  4XGA B;  3WCQ A;  1T6B X;  3RNA C;  3T3O A;  5BMG A;  2C5L C;  2FCN A;  3DBS A;  1I4P A;  2NTS A;  3R3M A;  1HZ6 A;  1FCC C;  2D10 A;  2Z8L A;  1XCQ L;  1FM0 D;  2M1M A;  3AH7 A;  3ZJT A;  4JIO U;  4KVG B;  1FFU A;  3E9S A;  3TMP B;  2GBN A;  1KLU D;  1I4R A;  3AEC B;  3NRZ A;  2ZVN A;  3HVD A;  4X57 B;  2KX0 A;  4C80 A;  3AEB B;  1Y8R C;  1TS3 A;  4FN2 A;  4IM3 A;  1LQB A;  1WGD A;  4MGZ E;  2WWZ A;  1TZO A;  1T0R C;  2C7M B;  4JWS C;  3HVZ A;  5HFY A;  2KYW A;  3EEC A;  3P4P B;  4ANW A;  4FAD A;  3DHG C;  2HTH A;  2FUH B;  2QJL A;  4LDT D;  1VZ8 A;  2GBR A;  2K6D B;  2K25 A;  1MHH E;  1SEB D;  5CHV C;  4A8X C;  2VZK B;  1TJE A;  3MHZ A;  1C76 A;  4W9K A;  3RZF A;  2ZJD A;  4ZHP A;  1IBX A;  4NJ6 A;  3EC8 A;  2WDQ B;  2WXJ A;  2FUG 1;  1QQR A;  3P2B A;  1WIA A;  2ZPN A;  3ONS A;  4PS8 A;  3BYY B;  2KDB A;  3EFC A;  5L83 A;  2MJ3 A;  3I9V 1;  2WXH A;  3A9K B;  4W9G A;  2IO0 B;  1UWX A;  1V8C A;  2JQR B;  1V1P B;  1N63 A;  1TKY A;  3DPD A;  2XNA C;  2QEJ C;  1K53 A;  2KC1 A;  1N5X A;  3GP7 A;  1YMH E;  4GDK A;  1JW9 D;  2FID A;  4N59 A;  3Q8B A;  1YN5 A;  3IHP C;  1E0Z A;  1WX8 A;  2AWT A;  2FE8 A;  2KVR A;  4P7I A;  3IG3 A;  1TKG A;  5DPS A;  5CTR C;  1UUP A;  4W9H A;  1V2Y A;  5IOI A;  3IBE A;  3B2G A;  4PYU A;  4QAY A;  4HPM B;  5AEK B;  1LFD A;  4MJS B;  2WXG A;  3W5U B;  4ANU A;  4GSW A;  2KT7 A;  5J18 A;  1D5X C;  1GPX A;  4ANX A;  4GDL B;  3QHT A;  1HE8 A;  1WRI A;  2Z0D B;  3V61 A;  3ZNI D;  1N62 A;  4IKG A;  4AQ7 A;  4HKQ A;  1XT9 B;  1WI0 A;  2K0P A;  3FIL B;  3ENE A;  4MGI E;  3NVV A;  1L5P A;  2LD9 A;  1LGR A;  1WXQ A;  4GIV A;  3ZKJ C;  3KQ4 A;  4DXF A;  4OZC A;  4ZRJ A;  2LRW A;  5EDS A;  1FD6 A;  1UNS A;  5EE9 A;  2FCM A;  1C4A A;  4L23 A;  3VHT C;  3X23 A;  2KFJ A;  3TSS A;  2BYE A;  2TSS A;  4I6L B;  3WAM A;  1LO5 D;  4BKT A;  2KAJ A;  3ALB A;  2MBH A;  4YT0 B;  4KIK A;  3GE3 C;  4XZ4 A;  3T8M A;  4IWP A;  1MPE A;  4WJQ A;  3KLS X;  1ZXI A;  4R3D A;  2G1E A;  4DDG D;  5JHB A;  4DQO C;  1VLB A;  2MHJ A;  5E6J A;  2GMI C;  2KN5 A;  1MI0 A;  4EZL A;  2PVO D;  3VH4 B;  1HZ5 A;  3MJW A;  2L7R A;  2O2V A;  3RNC C;  2M0A A;  2RDB C;  1KF6 B;  1LM8 B;  3CMM B;  1FIQ A;  1B9R A;  3K9P B; 
#chains in the Genus database with same CATH homology
 3ZDM C;  4FA6 A;  1GC6 A;  2KO3 A;  3VQI A;  2G4D B;  1WM3 A;  2KTF A;  5LXI B;  3APF A;  3ZRC A;  2NVU I;  2N1W A;  4AUQ C;  5KHQ A;  3H7S A;  4EFO A;  1RFA A;  4II2 B;  4MEL A;  2RR9 A;  4W9D A;  1D3Z A;  1M94 A;  2DYM A;  1SGH A;  1WGR A;  1ZKH A;  2AEH A;  2V3S A;  2ZCB A;  3NZU A;  4MDK E;  4HVB A;  2MBE A;  4PYZ A;  2IO1 B;  1WH3 A;  4CHK A;  5LLI A;  1WXA A;  2I1K A;  2L8J A;  4TQ1 A;  3KH0 A;  4E71 A;  4M0W B;  4WJP A;  3ML9 A;  3D32 A;  4A20 A;  3UQA A;  3LJ3 A;  4K1R B;  2NBW B;  4URK A;  2KXJ A;  2KAN A;  4KIK B;  3JSV A;  4A3P A;  2OOB B;  2NPT A;  1WYW B;  4GGQ A;  2KQ7 A;  4W9C A;  3A9J B;  4FJV B;  1E8Y A;  1Z2M A;  5C1Z A;  5JHA A;  4IUM B;  3RYT A;  1C1Y B;  4N9F 4;  3SU8 X;  3NS8 A;  5J2R A;  3JW0 X;  2J0J A;  2CKH B;  3A4R A;  1OEY J;  3CST A;  1UEL A;  2N1V A;  3QX1 A;  4HJK A;  1WGY A;  1CMX B;  2G3Q B;  3ZUN A;  2LXC A;  3DVN U;  3PRE A;  5BO4 B;  1ZGU B;  3SHQ A;  3Q3J A;  2Z0E B;  2KWV B;  2L3Z A;  3QWZ B;  4TKN A;  3V62 A;  2FIF A;  3QAR A;  3IVF A;  3M62 B;  2HJ8 A;  1MG8 A;  4IW0 A;  1P9D U;  3EFU A;  4W9J A;  3NOB A;  5GMV A;  2EKE C;  2B3A A;  2KDF B;  3AU4 A;  1WJ6 A;  4CO7 A;  4G50 A;  3ZTD A;  3RZW C;  4B6W A;  4F8C B;  4FBJ B;  2VRR B;  4JL9 A;  4GDK B;  2CR5 A;  3RD2 A;  2K8H A;  1S1Q B;  3ML8 A;  3PLU A;  1UGM A;  4NJ7 A;  1GC7 A;  2KMC A;  1R4M I;  3PVL A;  3VFK A;  2XK5 A;  4KZ0 A;  3WA0 A;  2L00 B;  1WM2 A;  2KQS A;  3PS6 A;  1P98 A;  1YIW A;  3A4S C;  3OJ3 A;  4BOZ B;  2LAS A;  2NR2 A;  4DHZ B;  1TZ1 A;  4K81 A;  2ZEQ A;  2IYD B;  4BKS A;  1J19 A;  1V6E A;  4HCP B;  1E8W A;  4KDL B;  2FAZ A;  4HPL B;  5DPR A;  1PQS A;  3A9K A;  4FJY A;  3UGB B;  5FR6 A;  4GXB A;  2GOW A;  4W9F A;  3ECI A;  4EOY A;  3DCG A;  1V5O A;  2M17 A;  4IC7 B;  5LXH A;  5D6J B;  1E90 A;  1RRB A;  3PLV A;  3R66 C;  4EZK A;  1WZ3 A;  1UBQ A;  2N9E B;  1KOT A;  2L05 A;  2FCS A;  2J7Q B;  2M4N A;  1YQB A;  2W9N A;  4M8N A;  4LCD E;  1UBI A;  4MGK E;  1T0Y A;  2DAF A;  5JH5 C;  2L0T A;  2MA9 B;  4JLC A;  3WIM A;  4WWN A;  3H7P A;  4MM3 A;  1NBF C;  2BF8 B;  2BWE S;  3GZN I;  4IWO A;  4ZYN A;  3B1L X;  2EMS A;  1WJU A;  4JGH B;  3DDC B;  4F1S A;  2KJ6 A;  5KHO A;  2ZNV C;  1KLV A;  2KK8 A;  1AAR A;  3OLM D;  1P0R A;  3C0R B;  1Z5S B;  4KV2 A;  2Y5B B;  3V6C B;  3CSF A;  3VTU A;  4BKS D;  2M8S A;  3KUC B;  3H9D A;  2LGD A;  2KTR A;  2ZCC A;  4G0N B;  1GUA B;  5C23 A;  1RLF A;  2O6V D;  3M3J A;  3K9O B;  4ZDV A;  1UZX B;  4LDT B;  3ZTC A;  5DCN A;  1UD7 A;  3LDZ E;  4E3C A;  2ZZP B;  3T9L A;  3L08 A;  2HD5 B;  4B9K A;  4EKU A;  4KSL C;  2IZV B;  3M63 B;  2GBK A;  2DHZ A;  3NHE B;  2JPH A;  3L0W B;  2AYO B;  2LGY A;  3L17 A;  4ICU A;  1C3T A;  3UQB A;  3HM6 X;  4MGY E;  2BYF A;  3RT3 B;  1FXT B;  1NI2 A;  4W9I A;  5AZF A;  4MSQ B;  2DZJ A;  4KDI C;  1Q0W B;  4TUU A;  3I3T B;  4K7S A;  3VXW A;  3APC A;  2D11 A;  1WMH B;  2KFK A;  4WJO A;  4MJS A;  1E7U A;  1L7Y A;  2L0F A;  3H6N A;  3ZLZ A;  3A33 B;  4BBN F;  4GOC A;  4GDL A;  1SE9 A;  4KSK C;  3ZW3 A;  4DHJ B;  2JRH A;  1TBE A;  4ZRK A;  3N32 A;  2NBU A;  1G6J A;  2J0M A;  1H4R A;  3B08 A;  2DAJ A;  4F7Z A;  3MHS D;  1Q1O A;  2MWS B;  4B95 A;  1S3S G;  1LXD A;  3UIP B;  3VTV A;  4A3O A;  2KDI A;  2FCQ A;  3R7R A;  3PRM B;  3L54 A;  1IP9 A;  3MTN B;  2GBJ A;  3L10 B;  2K6Q A;  2CU1 A;  4GN1 A;  3SD5 A;  1YD8 U;  2K1F A;  1F9J A;  4HDQ A;  3V60 A;  2CHZ A;  2MSE D;  4NPN A;  3HK0 A;  5HKH A;  3JYU A;  4NQL B;  3VAW A;  2ZPY A;  2R2O A;  3PHW B;  4PS7 A;  3DOW A;  3UF8 A;  2HE7 A;  2KKC A;  4IM2 A;  4K7U A;  2LGX A;  3U8Z A;  2IY0 B;  2D2Q A;  3TBL D;  3VUY A;  3A1Q A;  2UYZ B;  3U7D A;  1V81 A;  3VUX A;  2CHW A;  1WR1 A;  4RM9 A;  2IO3 B;  4XC2 A;  5G2N A;  1YX6 B;  4HCN B;  2JZ3 B;  2LJ5 A;  2CS4 A;  3DBH I;  4G3X B;  3WAO A;  1WE6 A;  4NAW B;  4E74 A;  2O2V B;  2MP2 A;  2N7E A;  2KLC A;  2WDT B;  3Q3F A;  3ZO5 B;  2A4Z A;  1P3Q U;  2K39 A;  4FUL A;  3ZIM A;  3M95 A;  2D3G A;  5D7G A;  2LI5 A;  2BYV E;  1WY8 A;  2KNB A;  2KWC A;  4IG7 B;  3HIZ A;  1WFY A;  1WF9 A;  2PJH A;  2KFK B;  1WJN A;  2KZR A;  4EEW A;  3PRZ A;  3W1Y A;  3EHV A;  1GJZ A;  2C5L C;  2FCN A;  2LZ6 A;  3W1S A;  3DBS A;  1IPG A;  3QJZ A;  2MCN B;  4MEM A;  4WJN A;  3R3M A;  3ZVV A;  1A5R A;  2D10 A;  4AJY B;  4HXD A;  5CX3 A;  5D94 A;  2RPQ A;  3TCA A;  2M1M A;  1WGG A;  3AI5 A;  4TV3 A;  4JIO U;  4KVG B;  2XBB C;  4BBN C;  4BVU C;  2BPS A;  1U4A A;  3TMP B;  2GBN A;  2YLM A;  4NY0 A;  4HLE A;  3L13 A;  4AP4 C;  5DPT A;  2LWP A;  2C7H A;  2O6V A;  2ZVN A;  4WWO A;  3X0W A;  3JSV B;  4X57 B;  2KX0 A;  2ZVO A;  2NPT B;  3APD A;  4DK5 A;  2AL3 A;  2ASQ A;  3OAW A;  1VCB A;  1Y8R C;  1OTR B;  3TIX A;  4FN2 A;  3DVG Y;  4XX5 A;  4ZRI A;  3PPA A;  4IM3 A;  5E6P A;  1LQB A;  2G45 B;  2KJR A;  1WGD A;  4DWF A;  2CHX A;  4MGZ E;  5AZH A;  3ZNH B;  1WXS A;  2MX2 A;  2WWZ A;  4EZJ A;  4NNJ B;  3KVF B;  2GBM A;  2C7M B;  2M0X A;  3KUD B;  1UH6 A;  4PS3 A;  3EEC A;  4ANW A;  4FAD A;  1VD2 A;  2KHW B;  2HTH A;  3DQV A;  1V9J A;  2FUH B;  3KW5 B;  4LDT D;  2G4S A;  3VUW A;  3ZNG C;  4OVU A;  2GBR A;  3L16 A;  3S2A A;  4DXA B;  4RMA A;  3ZDT A;  3DBL I;  3VTW A;  2K6D B;  2K8C A;  1E7V A;  3PHX B;  4DBG A;  2K25 A;  2JVC A;  2BKF A;  1X1M A;  3O65 B;  5J17 A;  1E8Z A;  3TJP A;  2JF5 A;  5CHV C;  2DZM A;  2MBB B;  1SIF A;  4AWJ A;  1GG3 A;  2KWU B;  1K8R B;  4GU2 A;  3UIN B;  2N9P C;  3TL5 A;  3NZS A;  1YX5 B;  2MBQ A;  3AXC A;  1WZ0 A;  5E6N A;  3RUI B;  2RGF A;  3GOE A;  4W9K A;  3RZF A;  3A9J A;  2ZJD A;  1R4N I;  2REX A;  4NJ6 A;  2DYO A;  3EC8 A;  2KOX A;  1WX7 A;  2XK5 B;  4DHJ D;  2WYQ A;  2V1Y A;  3W1S C;  1WJ4 A;  3P2B A;  1EF1 A;  3U30 A;  1WIA A;  2IY1 B;  1WXM A;  2ZPN A;  3ONS A;  1KJT A;  4MSM B;  1JRU A;  2JXX A;  4PS8 A;  2D07 B;  3VDZ A;  1GNU A;  2KDB A;  4BKG A;  2JUO A;  3PT2 B;  5L83 A;  1I35 A;  1L2N A;  2PE9 A;  2O6V B;  3A9K B;  2KX3 A;  3PRP B;  2N7D A;  3BY4 B;  4HK2 A;  4W9G A;  2IO0 B;  1YJ1 A;  2FNJ B;  1KM7 A;  2BKR B;  2JY6 A;  2UWQ A;  1P1A A;  1WRD B;  1V5T A;  3PV1 A;  3VVW B;  5E6O A;  4G11 A;  5DPW A;  4TQ0 A;  2N9X A;  3N30 A;  3R7Q A;  2JRI B;  3DPD A;  2DZK A;  2NS5 A;  2DYB A;  3H7P B;  2KC1 A;  2WX1 A;  4HDO A;  4OVV A;  2AL6 A;  3N3K B;  3UIO B;  1TTN A;  4GDK A;  2LVQ A;  1IYF A;  2BWF A;  2FID A;  1RAX A;  4KZC A;  2LUE A;  4M8M A;  2LVO A;  4WWP A;  1XD3 B;  3CF6 E;  4RM8 A;  3PZD A;  4YL8 A;  3IHP C;  4DDI D;  1J8C A;  2KTR B;  1WX8 A;  1E5W A;  2AWT A;  2C9W B;  3DVN V;  2KLG A;  2KVR A;  4P7I A;  3IG3 A;  2IBI B;  1ISN A;  2C60 A;  2OJR A;  5DPS A;  5CTR C;  1OQY A;  4W9H A;  2MLB A;  1V2Y A;  3WAN A;  5D2M B;  2C7N B;  2NCN A;  3NY5 A;  1E8X A;  3IBE A;  4FHK A;  2I1J A;  3H1U A;  4PYU A;  4HPM B;  3VH3 B;  5AEK B;  3PTF C;  1I42 A;  2KJH B;  1LFD A;  4MJS B;  2A5U A;  4GB9 A;  4ANU A;  3QQ8 B;  2J0K A;  4GSW A;  2N4F A;  5J18 A;  2IO2 B;  3AU5 A;  2PPH A;  3BIN A;  2NBV B;  5CHF A;  3RCZ A;  4GDL B;  3ZNZ B;  2LXA A;  4ANX A;  1XQQ A;  3HHM A;  3QHT A;  2EMT A;  4I6N B;  4CYE A;  2DX5 B;  1HE8 A;  2LVP A;  2QHO A;  2MBO A;  2JZZ A;  3KUZ A;  2DEN B;  3HM3 A;  4FLH A;  4MH0 E;  1WGH A;  2Z0D B;  3V61 A;  3ZNI D;  3DBR I;  5L95 C;  2YVC A;  4LJP B;  2PEA A;  2KD0 A;  1XT9 B;  1WI0 A;  4BFR A;  4ANV A;  5IA7 A;  3ENE A;  4MGI E;  3QCA A;  4FHJ A;  5IAA C;  4J6I A;  4JQW C;  2LD9 A;  3PSE B;  4NQK E;  1OGW A;  2L76 A;  4GIV A;  2K8B A;  3ZKJ C;  4FJZ A;  1WMH A;  2KDE B;  3B0A A;  3OJ4 B;  2ZNV B;  3KYC D;  2XEW A;  1ZW7 A;  3AUL A;  5G55 A;  4ZRJ A;  3A1Q B;  4W9L A;  2LRW A;  4HWI B;  3V6E B;  3WAP A;  5EDS A;  4II3 B;  1WR6 E;  2FCM A;  3VHT C;  2LRU A;  3QIJ A;  4W9E A;  2MW5 A;  1J0G A;  2BGF A;  2RD0 A;  2MP2 B;  4LJO B;  3X23 A;  2KFJ A;  2BYE A;  1V86 A;  2MQJ A;  4DHZ E;  4I6L B;  2DZI A;  4WQO B;  3WAM A;  4BKT A;  4IWQ A;  1Q5W B;  1EO6 A;  2MBH A;  3ALB A;  3JVZ X;  3PGE A;  4KIK A;  1H8C A;  5AZG A;  4AOF A;  4XZ4 A;  3T8M A;  2V4L A;  4IWP A;  1V80 A;  4WJQ A;  3QAQ A;  1OEY A;  2R2Q A;  4ICV A;  2KMA A;  1V49 A;  1WE7 A;  4DDG D;  5JHB A;  1BT0 A;  2PE6 B;  4IM0 A;  4EUT A;  5JZE B;  4GMV A;  1EF5 A;  2Z59 B;  5CHW A;  3ZRF A;  2GMI C;  4AJW A;  4WAA A;  2KN5 A;  2RSU A;  3DVG X;  4EZL A;  1WXV A;  4I6P A;  3VH4 B;  3KYD D;  1EUV B;  3MJW A;  2L7R A;  4NAW A;  3WAL A;  2O2V A;  1NDD A;  2MRP A;  3QC8 B;  2KC2 A;  3RUL A;  2WX0 A;  3QK0 A;  5TR5 A;  1QZE A;  3QA8 A;  4BOS C;  1LM8 B;  4ASW C;  3CMM B;  3K9P B;  2JWZ A;  2JT4 B;  3IFW B;  1WX9 A;  4K7W A;  3SDL C;  1TGZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...