3GZNI

Structure of nedd8-activating enzyme in complex with nedd8 and mln4924
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
HHHMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/ligase
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
publication title Substrate-assisted inhibition of ubiquitin-like protein-activating enzymes: the NEDD8 E1 inhibitor MLN4924 forms a NEDD8-AMP mimetic in situ.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 79
sequence length 79
chains with identical sequence J
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3gznI00
3HK0A 1WM2A 3QJZA 5IAAC 2EMTA 1WFYA 1WXAA 1BT0A 2N9EB 3DVNU 4LDTD 4MGZE 5E6NA 1RRBA 5G2NA 4HCPB 4BFRA 4CHKA 2D2QA 1GJZA 4WQOB 3NZSA 3VFKA 4LCDE 4JQWC 2AEHA 1Q0WB 3APDA 3CMMB 2ZCCA 3TJPA 3VTWA 2IZVB 2V3SA 1R4MI 1I42A 2KX0A 2KDFB 5J17A 5L83A 2M0XA 3R3MA 1UELA 4FA6A 4FADA 3QIJA 2MP2B 4F8CB 3MTNB 2J0JA 4A20A 1E8YA 2KDIA 3EFUA 4PYZA 1C1YB 4ICUA 3UINB 4DDID 2KWUB 4MSQB 1ISNA 1SIFA 1PQSA 1RFAA 4TUUA 1L2NA 1Z2MA 2WX0A 2KJRA 3L16A 3JVZX 1EUVB 2BYVE 3RYTA 3IG3A 2DZKA 2FUHB 4W9HA 4ZDVA 4TV3A 1WGHA 2MX2A 3T8MA 3PHWB 4DDGD 3L0WB 1YX6B 4GDLA 3V6EB 1AARA 3VTUA 3W1YA 2GBNA 4EKUA 2Y5BB 2AL3A 2ZCBA 4EFOA 2NS5A 3WAMA 3K9PB 4FJVB 3A33B 1JRUA 2K1FA 4IG7B 3PRMB 4W9DA 4AP4C 3ZLZA 4IM2A 1WGDA 2Z59B 2A4ZA 4GGQA 2AWTA 2BWES 4NJ6A 3VQIA 2CS4A 2REXA 4FJZA 5DPTA 5FR6A 1E7UA 1R4NI 1H4RA 2ZNVB 2RD0A 3QAQA 2KFKB 4FHKA 2XK5B 3PLVA 2D10A 1VD2A 4XC2A 3U30A 5C1ZA 1V2YA 1HE8A 1ZGUB 2LRUA 3QHTA 3NHEB 4W9KA 2KTFA 2N1VA 4FBJB 1IPGA 1E8ZA 2MA9B 2L3ZA 3DBSA 4OVUA 3UIOB 2MP2A 2KQ7A 2FIFA 1L7YA 4JGHB 1WR1A 2KANA 2LUEA 2D3GA 2KMCA 5D7GA 2LWPA 2WWZA 4K7WA 2M1MA 2LI5A 3U7DA 4GDKB 2C7MB 4WJOA 1WXVA 3L17A 2YLMA 1ZKHA 3VHTC 4IWPA 3A1QB 3RULA 2KD0A 3SHQA 3R7QA 4NAWB 2N9XA 3EHVA 2KLCA 5L95C 2KDEB 2LGDA 4WWNA 1Q5WB 2DYMA 2BYFA 2KN5A 2KFJA 5JHAA 3V62A 3K9OB 1G6JA 2KHWB 2DYOA 4A3OA 1OEYJ 4IM3A 2MSED 4B95A 1IYFA 3MHSD 4G0NB 4YL8A 1WGYA 5D2MB 2I1JA 1CMXB 2MWSB 1WYWB 3JW0X 1E7VA 5LXHA 3H7PB 3P2BA 4K7SA 4K81A 4BKSA 4HDQA 2HTHA 2D07B 1QZEA 2MQJA 4FHJA 5HKHA 3VVWB 1V5TA 1OTRB 2PJHA 2JWZA 3SU8X 2FAZA 1UBIA 3GZNI 3JYUA 3QC8B 3DCGA 4HLEA 2UYZB 3PHXB 4MSMB 4ICVA 3N30A 2DHZA 2KFKA 5IA7A 2XK5A 3MJWA 2LJ5A 3AU5A 3PTFC 4B6WA 4F7ZA 1TGZB 2B3AA 4KSLC 4HJKA 1E8XA 2WX1A 2BYEA 2L00B 2FNJB 3DVGX 3L08A 4WWPA 4GSWA 5JHBA 2ZVNA 1P98A 2D11A 2C7NB 3I3TB 3QA8A 2J0MA 1WE6A 2DZMA 2K8CA 1WI0A 1WZ0A 2KK8A 4MGIE 2RSUA 3S2AA 5DPRA 1YQBA 3NS8A 1WX8A 4M8MA 4URKA 2KXJA 2LGYA 4GDKA 2JVCA 2MBOA 2N1WA 2PPHA 2KC2A 3A1QA 3KUCB 3PS6A 4NAWA 1WIAA 2GBRA 2BPSA 3BINA 1UGMA 1TTNA 4BKGA 3VH4B 3APCA 4E3CA 1P0RA 1P9DU 4HXDA 5C23A 3TBLD 2KC1A 1GC7A 1NDDA 1WZ3A 1WY8A 4EZLA 2KVRA 2AYOB 2LD9A 5CHVC 1E8WA 3KVFB 4MH0E 3H7PA 2JRIB 1Y8RC 1WJUA 2QHOA 4MEMA 2J7QB 5KHOA 2EMSA 3H1UA 4M0WB 1WXMA 3M62B 3KYDD 2JXXA 2KMAA 4EUTA 3EECA 2JT4B 1WJ6A 2G4SA 3VDZA 2JRHA 2I1KA 2RR9A 4MGYE 5CX3A 1GUAB 2KOXA 2KKCA 2W9NA 3W1SA 1J8CA 2KX3A 3WA0A 4TQ0A 1UZXB 2O2VB 1XT9B 1E5WA 2LRWA 2ZPYA 3M3JA 2L7RA 1U4AA 4OVVA 4ZYNA 4MM3A 3Q3FA 4ZRIA 1MG8A 3PRZA 1WM3A 4W9FA 1LM8B 1WMHB 4N9F4 1OEYA 2LVQA 3WANA 1Q1OA 3A4SC 3QWZB 2JF5A 2CHXA 3NOBA 4MDKE 1V80A 3AXCA 1V9JA 2IO1B 2JZZA 5E6OA 2DENB 2GBKA 4F1SA 4KDIC 2FCQA 3Q3JA 3CSFA 4BOZB 5DPSA 5AZFA 4AOFA 3C0RB 3VTVA 4LJPB 4JLCA 4NQKE 3PSEB 1FXTB 3RZFA 2BF8B 1YD8U 5AEKB 2ZJDA 3VUWA 4NQLB 5JZEB 2L05A 2MLBA 2DAJA 2LVOA 1SE9A 2PE6B 4JL9A 2ZVOA 4LDTB 4W9CA 3KYCD 1LFDA 3PREA 2K8HA 4ANWA 2HJ8A 3GOEA 3DDCB 3BY4B 3OAWA 5J2RA 1ZW7A 2L0FA 3ALBA 3HIZA 3HM3A 2KWCA 2M17A 3VH3B 3DBRI 3IVFA 3UGBB 2G4DB 5BO4B 2XBBC 3PLUA 5D6JB 4KZ0A 2O2VA 3ENEA 3ML9A 3A4RA 3OJ3A 4E71A 3AI5A 1WF9A 1TBEA 3A9KB 3DVGY 3H9DA 1J19A 2CKHB 4PS8A 3H6NA 4HWIB 5E6PA 2JY6A 2MBQA 3VAWA 2ASQA 3ZVVA 2BKFA 1WMHA 3L10B 4GIVA 1EF5A 3T9LA 4DWFA 4GXBA 4DHJD 4P7IA 4EZKA 1H8CA 1V49A 3ZUNA 4FULA 1TZ1A 4JIOU 1GC6A 2DX5B 1LQBA 1SGHA 2RPQA 2Z0DB 1NI2A 2ZEQA 3B1LX 1S3SG 3EC8A 2IY0B 2L76A 3QK0A 4K1RB 3RD2A 1T0YA 2LGXA 4GU2A 3V60A 3ZTDA 1WE7A 4AJWA 2JZ3B 3QARA 3CSTA 4II2B 2NPTB 2V4LA 2OJRA 3M95A 2N4FA 1WH3A 4KV2A 1V5OA 1KOTA 3ZNZB 4EZJA 2CHZA 4TKNA 5CHWA 5DPWA 1X1MA 3TL5A 3UF8A 3ZRFA 3H7SA 5AZHA 3UQAA 3HHMA 4RM9A 3RT3B 3DQVA 3KH0A 4WJQA 4CYEA 2FCSA 2DYBA 4TQ1A 1LXDA 3PRPB 3ZRCA 4IUMB 2V1YA 5EDSA 1KM7A 2M8SA 4IC7B 3V61A 3ZNGC 4DXAB 4HK2A 1WRDB 5J18A 4MGKE 3SDLC 3KUDB 2CU1A 3A9KA 2ZNVC 2A5UA 3X0WA 1UH6A 2G45B 2K6DB 4GOCA 2EKEC 4I6NB 4WJPA 4XX5A 5JH5C 2PE9A 3VUXA 3HM6X 3R66C 4ZRKA 4G11A 2K39A 2GMIC 3PPAA 3CF6E 4CO7A 4IWQA 4WJNA 2KO3A 1VCBA 4ANUA 3R7RA 2IO3B 4MJSB 1P1AA 1OGWA 2C7HA 1RLFA 3AULA 2JPHA 3WIMA 3N32A 3D32A 4LJOB 2O6VD 3N3KB 3ZIMA 2LXAA 2NPTA 2UWQA 3NY5A 4FJYA 4W9EA 4AUQC 4BOSC 4W9LA 3OJ4B 3UIPB 1RAXA 5CTRC 2NBVB 3DVNV 2R2QA 2IO2B 4I6PA 2LXCA 2N7EA 4WAAA 2PEAA 2GBMA 1WR6E 4GB9A 1I35A 2G3QB 2DAFA 1A5RA 2MW5A 2MRPA 3DBLI 5G55A 5LLIA 2C5LC 3JSVB 3KUZA 1IP9A 2N7DA 2KZRA 3X23A 2K8BA 2CR5A 3TIXA 3QQ8B 4BBNC 2HE7A 2KTRA 3DOWA 4GN1A 4NNJB 1E90A 3WAOA 2MCNB 3APFA 3DBHI 2KWVB 2IY1B 3B08A 4A3PA 4ASWC 3A9JB 2NVUI 3ECIA 4DK5A 3PZDA 2MBHA 4G3XB 3W1SC 5D94A 4DBGA 2FCMA 3ZTCA 4ANXA 4RM8A 5GMVA 4IM0A 2WDTB 1V86A 2J0KA 3PVLA 4PS7A 1M94A 2KQSA 3ZNHB 1WGRA 4PYUA 3O65B 2NCNA 3M63B 2L8JA 4MJSA 4AJYB 1K8RB 4BKTA 2K6QA 1YJ1A 4M8NA 2KNBA 2AL6A 4KIKB 2GBJA 4HPLB 2O6VB 2WYQA 3LDZE 3QCAA 2LASA 4HVBA 4ANVA 3VUYA 2CHWA 3ML8A 4FLHA 3ZNID 2NR2A 2LZ6A 3ZO5B 3L54A 4NPNA 2C60A 2HD5B 2BWFA 2ZPNA 2K25A 1WXSA 3B0AA 3ONSA 1C3TA 2L0TA 1XQQA 3JSVA 4EEWA 2N9PC 3IFWB 1GG3A 2KJ6A 3RZWC 2MBEA 3LJ3A 2YVCA 2DZIA 5KHQA 2VRRB 5TR5A 1KJTA 4I6LB 4BVUC 1YX5B 3A9JA 2GOWA 1EF1A 1WX7A 1YIWA 2BGFA 1WJ4A 1V6EA 3RCZA 4NY0A 3IBEA 2C9WB 2ZZPB 4GMVA 4KSKC 2BKRB 4BBNF 2IO0B 2KLGA 3PV1A 3VXWA 2R2OA 2IBIB 1Z5SB 3L13A 4XZ4A 5AZGA 1S1QB 3ZDMC 1GNUA 4EOYA 2JUOA 2Z0EB 1OQYA 4AWJA 3IHPC 3SD5A 3TMPB 1NBFC 3AU4A 4FN2A 4IWOA 2IYDB 4II3B 3DPDA 2FCNA 2KDBA 4KIKA 5CHFA 3UQBA 2KTRB 4B9KA 4ZRJA 2DZJA 4W9GA 3WALA 1WX9A 2KJHB 2O6VA 2MBBB 3KW5B 3PT2B 4IW0A 2LVPA 1WJNA 2NBUA 4HPMB 4RMAA 1F9JA 1D3ZA 4W9JA 3NZUA 4W9IA 4E74A 3WAPA 3PGEA 4X57B 3U8ZA 4KDLB 3ZKJC 4NJ7A 3V6CB 4MELA 1KLVA 5DCNA 2FIDA 1V81A 1UD7A 3TCAA 1P3QU 1J0GA 4HCNB 3RUIB 2NBWB 4J6IA 4GDLB 3QX1A 1XD3B 2OOBB 3OLMD 4HDOA 3ZW3A 2M4NA 4DHJB 4DHZB 2RGFA 4BKSD 1WGGA 4G50A 4WWOA 4K7UA 3ZDTA 4KVGB 4KZCA 1EO6A 4DHZE 2XEWA 5LXIB 4PS3A 1UBQA
chains in the Genus database with same CATH superfamily
1JALA 2EMTA 4IOIE 1GJZA 4HCPB 4CHKA 4WQOB 3NZSA 2ZCCA 1Y56A 2IZVB 2V3SA 3TSSA 3GZNB 2M0XA 2MP2B 5EE0A 1ISNA 3J9CA 1SIFA 2J52A 1FEHA 2BYVE 1XCQL 3IG3A 3Q69A 2QDFA 4TV3A 2MX2A 3Q6BA 3W1YA 2GBNA 5E6JA 2IGGA 2Y5BB 2ZCBA 4EFOA 1JW9D 2NS5A 3K9PB 4IG7B 2K1FA 1D4BA 2INNE 1WGDA 1C9FA 2EELA 3FC4A 1E7UA 1R4NI 2RD0A 4FHKA 2XK5B 3DHHC 1V2YA 1HE8A 3KQ4A 3NHEB 1JWAD 2N7JA 1IPGA 2LEKA 2MA9B 2VZKD 4OZAA 1WR1A 2KANA 1UGJA 5LNK1 3GE3C 2LWPA 2WWZA 2Y5CA 1CQVA 3U7DA 4GDKB 2C7MB 3L17A 2BS2B 2YLMA 3VHTC 4AQ7A 1MFWA 2WXRA 2WXPA 3AEAB 3SHQA 3IT4B 1TKGA 5L95C 2BYFA 2JX5A 5HFYA 2W3SA 2KHWB 1LO5D 2DYOA 1IYFA 4B95A 4G0NB 2INCC 4YL8A 1CMXB 3JW0X 1NENB 3BVZA 3H7PB 4A55A 1JRPA 2HTHA 4KGRA 1GPXA 1QZEA 2MQJA 3VVWB 2WXKA 2PJHA 2SEBD 1MJDA 1LGRA 4J3OD 3E9SA 2UYZB 3PHXB 2I2YA 4ICVA 3N30A 1ET9A 2KFKA 2ICIA 3PTFC 1TY0A 4HJKA 1GAQB 1E8XA 2WX1A 3B9JA 2ZVNA 2D11A 3QA8A 4LTUA 4C56C 1WE6A 2DZMA 1WZ0A 2QSDA 4WH4A 2RSUA 3ZXVA 2XNAC 1YMHE 1FMAD 2PPHA 2KC2A 3A1QA 4OZBA 1FNVA 4NAWA 2GBRA 2BPSA 1UGMA 4BKGA 3EFCA 3APCA 4HEA1 1P0RA 4HXDA 2D3BA 1WZ3A 1MPEA 1SE4A 2IJ0A 4YXDB 2KVRA 3AEDB 5EE1A 2LD9A 1DOIA 1Y8RC 4HROA 3AE6B 1F52A 2AQ3B 3M62B 2MHJA 2GRIA 2JXXA 5IP4D 2JT4B 2INDC 3VDZA 1A70A 1GUAB 4RGTA 2ACZB 1U4AA 4MM3A 4ZRIA 1TIFA 4W9FA 4YSZB 3I9V1 1DOYA 2JF5A 2QMTA 2WXFA 1ZOYB 4MDKE 2IO1B 2JZZA 3T3OA 1JWSD 2DENB 3BZDB 1AW7A 1EU4A 1HZ6A 3Q3JA 4BOZB 3C0RB 4JLCA 4NQKE 1FXTB 1XO3A 3RZFA 2BF8B 2ZJDA 4LDTB 1TKEA 2DAJA 2LVOA 3SFEB 3URYA 4US9A 3U2SC 3DDCB 4M0WA 4ZRPA 4IKGA 3UGBB 5BO4B 2LGSA 4XDCA 4K3CA 3OJ3A 3H9DA 2CKHB 2ASQA 3L10B 2KQ4X 3T9LA 1JWMD 4FULA 1L4DB 1PYWD 3PLVA 1FXIA 4PS8A 3B1LX 1WGKA 4EZKA 3QK0A 3ZTDA 1KFYB 2LGXA 4AJWA 2WNMA 2NPTB 4KV2A 2BS4B 1D5ZC 4XE0A 1E6EB 4NAMA 4EZJA 5CHWA 2BT6A 4IDIA 3UF8A 3ZRFA 3H7SA 4NJCA 3HHMA 3Q8AA 4RM9A 3DQVA 2L83A 1LXDA 2QJLA 5EDSA 3V61A 3A9KA 1TS5A 1I4RA 1UH6A 2K6DB 2EKEC 4WJPA 3W2DA 4ZRKA 3HUIA 2K39A 4P6VF 1T0RC 3CF6E 1SIJA 2IO3B 2WXJA 1XLQA 2G9HD 3MJ5A 1KTKA 2JPHA 1L0XB 2O6VD 3N1YC 2LXAA 3NY5A 4FJYA 4W9EA 5BYSA 4W9LA 1RAXA 2HDEA 3DVNV 2R2QA 1YOVB 3DHGC 4TMAB 1WR6E 3NUHB 3DBLI 2Z8LA 1L6VA 4P1BC 4BBNC 3GE8C 3DOWA 1FRRA 5FK9C 3ZGZA 4LNIA 4A3PA 1V1PA 4C00A 5BMGA 4G3XB 1ZXHA 1ESFA 3AEGB 3W1SC 5D94A 4DBGA 2WLBA 2QCZA 4M02A 3ZTCA 5GMVA 4ANXA 2WQYB 1PUTA 1M94A 2KQSA 1WGRA 2KWDA 3M63B 4MJSA 1K8RB 2DWQA 1YJ1A 2OEDA 4HPLB 2WGSA 2KDMA 3QCAA 2LASA 2PKOA 4ANVA 2CHWA 4FLHA 3GP7A 3ZNID 2LZ6A 3ZO5B 3L54A 1EWYC 2B76B 2C60A 2HD5B 2BWFA 2PVOD 2K25A 2ZPNA 3JSVA 3IFWB 2KJ6A 2MBEA 3LJ3A 2WDQB 2VRRB 4BVUC 2WXOA 1XLPA 1EF1A 4YSYB 2BGFA 4WURA 4YTNB 3AE8B 2IO0B 4R3DA 3C8YA 3PV1A 2J42A 1JMLA 1HA5A 3ZDMC 1GNUA 2Z0EB 1OQYA 2JQRB 3TEWA 1IBXB 3IHPC 4JX1C 2VH1A 3SD5A 3AU4A 4II3B 3AEFB 2FCNA 2AQ2B 4KIKA 2SAKA 1N5WA 1FM0D 4W9GA 1XCTL 5C3JB 2O6VA 2MBBB 2YEPF 1WWTA 1F9JA 4W9IA 3ZKJC 3TEXA 4ACFA 2MJEA 1BMLC 3IXSA 2KYWA 2OOBB 2MH7A 3OLMD 1SSNA 1EO6A 3VRAB 3AE1B 1WGGA 4MH8A 1FNUA 3LXFA 5FR3A 1Q10A 5LXIB 3AE7B 3DWGC 2BVCA 4B0EA 5BYRA 1WM2A 3ABVB 5IAAC 1WFYA 2N9EB 1BT0A 4LDTD 4N58A 5E6NA 1RRBA 1XLNA 1N62A 2IPKD 1P7EA 4JQWC 3CMMB 3APDA 1FXAA 2KDFB 5J17A 5L83A 4KKJA 3R3MA 3QIJA 4F8CB 2J0JA 1E8YA 2KDIA 3EFUA 4PYZA 1C1YB 1YN3A 4ICUA 1JCKB 4ARCA 1PQSA 3VRBB 4TUUA 1ZPSA 2WX0A 2KJRA 2DZKA 1D6EC 3T8MA 1YX6B 4CQNA 5H8YE 3P4PB 4OZCA 3A33B 3PRMB 3EA6A 2A4ZA 2AWTA 4NJ6A 2Y3AA 3P4QB 5TSSA 1UWMA 1WSPA 4JPSA 2ZNVB 2DBYA 3QAQA 2D10A 1VD2A 1WXQA 5C1ZA 2LRUA 4W9KA 2V3NA 1MHXA 2N1VA 4FBJB 4OVUA 3UIOB 2FIFA 1SE3A 2D3GA 5MPOA 1JROA 3DBLB 3FILB 1FIQA 2WU2B 2KD0A 3R7QA 4AS1A 1YJJA 1TT5B 3RNBC 3EHVA 1RFKA 4WWNA 1YN4A 1HQRD 1ZDVA 5JHAA 3K9OB 1G6JA 1F1HA 1IGDA 2MSED 4IM3A 1WGYA 2NTTA 2I1JA 2MWSB 5D2MB 1WYWB 1E7VA 1FCCC 5LXHA 4K7SA 4K81A 3Q3MC 4FHJA 3SU8X 3JYUA 3QC8B 3DCGA 2DHZA 5IA7A 1KH0A 3MJWA 2LJ5A 1QILA 1TGZB 4KSLC 2JYEA 2BYEA 2L00B 2FNJB 3DVGX 4GSWA 2M56B 5JHBA 2C7NB 3I3TB 2K8CA 1PDXA 1TJEA 4MGIE 3NS1A 2N1WA 2MBOA 1QOGA 3NVZA 1WIAA 4KGSA 2WS3B 1GC7A 1B1ZA 4MACA 1E8WA 2BBCA 2QHOA 3O13A 5HI1A 1SJHD 2LJIA 1NI3A 4H2AA 4EUTA 3EECA 1MG4A 2JRHA 2I1KA 2RR9A 2KOXA 2W9NA 3W1SA 1E5WA 1QT9A 1QLBB 4ZYNA 2V3PA 4P16A 1LM8B 1WMHB 1OEYA 2LVQA 1IUEA 1Q1OA 5BYQA 1DYQA 5E6OA 4HKQA 4KDIC 1IGCA 4A6QA 3PSEB 3BK1A 3RPFC 5JZEB 4W9CA 1SXTA 1TS2A 4JL9A 3KYCD 4KX6B 3FKYA 1HTQA 2K8HA 1RYJA 3BY4B 4ITKA 3ALBA 3Q8CA 3HIZA 3HM3A 2KWCA 2M17A 3DBRI 5D6JB 2O2VA 3AI5A 3DVGY 4EE2A 4OW0A 3FAHA 3H6NA 3VAWA 2JY6A 4GIVA 1I7HA 2Y5PA 4GXBA 2NTSA 4HJGE 1BXTA 2LGIA 2DX5B 3EC8A 1SGHA 2RPQA 2Z0DB 1K52A 1S3SG 2GLSA 1WRIA 2FUG1 3UI3A 4II2B 3M95A 1OQRA 2TSSA 1WH3A 1J7CA 3RI7C 2NMQA 2K5PA 5DPWA 3AE2B 1N5XA 3NVWA 3ZRCA 4IUMB 2M8SA 4IC7B 4HK2A 5IN7A 3SDLC 3N1XC 4DXGA 2RDBC 2A5UA 1XLOA 4RF1A 4GOCA 2J4XA 4I6NB 4XX5A 2PE9A 4G11A 3OWEB 2FE8A 1TYGB 2C7HA 1RLFA 3WIMA 2HJ1A 4JE3B 3R2IA 2UWQA 3OJ4B 2DNFA 3UIPB 3P42A 5CTRC 2NBVB 2IO2B 1L0VB 2LXCA 3RMKC 3P4RB 4WAAA 2D3CA 4GB9A 2G3QB 4ZHOA 2RDGA 5LLIA 3W5UB 1IP9A 2JU6X 3X23A 2KZRA 2K8BA 3TIXA 3QQ8B 2BQQA 2BYTA 1D5MC 2HE7A 3AMZA 1VRAB 4NNJB 3DBHI 2KWVB 3B08A 3A9JB 4DK5A 3PZDA 4B0MA 1OFFA 4ZHPA 2QC8A 4RM8A 3TUOA 4PS7A 3PVLA 4PYUA 3O65B 2NCNA 2L8JA 2K6QA 2GBJA 2D3AA 3LDZE 3VUYA 3BK2A 3RNCC 1TS4A 4XGAB 3N20C 1C3TA 3ONSA 1XQQA 4EEWA 1MI0A 3RZWC 1HEZE 5T8IA 2YVCA 3ZJUA 5TR5A 4I6LB 2QIEB 4MT5A 2WXNA 3IAM1 3AH7A 4NY0A 1ZXIA 4KSKC 1I4QA 4BBNF 4C4VA 4HRSA 3VXWA 2R2OA 1YJIA 4HKZE 4XZ4A 1S1QB 5AZGA 4ARIA 1R4NB 5CHFA 4KKIA 2IYDB 1T6BX 4B9KA 3WALA 1WX9A 4W9JA 3NZUA 1EU3A 4E74A 3PGEA 4WWMA 4X57B 3U8ZA 4NJ7A 2E3TA 1J0GA 3RUIB 3P63A 5JXVA 3BIID 4J6IA 4HDOA 4DHZB 2PLPA 4KZCA 4DHZE 2M1MA 4MSQB 3Q8FA 3HK0A 1WXAA 2ZW1A 3DVNU 3CIRB 4MGZE 5AUKA 2D2QA 3VFKA 4LCDE 2AEHA 3TJPA 1I42A 1QKZA 2KX0A 3W5VB 4Q2JA 1FD6A 4FA6A 4FADA 3MTNB 4A20A 3ZJVA 3UINB 1C76A 4DDID 2KWUB 1L2NA 3AEEB 3AECB 1VZ8A 3L16A 5IO9A 4ZDVA 2FUHB 1PGXA 2W3RA 3BWUD 3PHWB 2K3UA 4DDGD 4KGTA 3L0WB 4GDLA 3VTUA 1GB1A 3PZ8A 3I5JC 2AL3A 1XF5L 3NG0A 4IM2A 1YN5A 2CS4A 2REXA 4FJZA 3AEBB 1H4RA 3ZJTA 2KFKB 5HG2A 4TSSA 1V1OA 3DBSA 2MP2A 2KQ7A 2WU5B 1QOAA 4JGHB 2LUEA 2KMCA 5D3IB 1VZ6A 4K7WA 4WJOA 2Q5WD 3N9YC 3A1QB 3RULA 4NAWB 2IDYA 2L32A 2J53A 2KDEB 2LGDA 4RFBA 3OG5A 3V62A 1ZDXA 4XWTA 2AQ1B 3T3NA 3MHSD 4D2KA 4OHJA 2E6XA 3EUB2 4HDQA 3BVMA 1T0QC 2BB6A 3LB8C 1STEA 2FAZA 3GZNI 4MSMB 4NZLB 1OQQA 2XK5A 2ON8A 4F7ZA 3AE3B 4YTMB 1RM6C 2M19A 3L08A 2JYTA 4MM3B 4GLSC 2DLBA 2J0MA 1WI0A 2L52A 1UUPA 4RGMA 3ETRA 5DPRA 3NS8A 4M8MA 2KXJA 2LFIA 2LGYA 4GDKA 4LLGM 3KUCB 4RCOA 1KRHA 3PS6A 1C4AA 2W55A 4E3CA 4ZOHC 1P9DU 3TBLD 2KC1A 1NDDA 1YNTE 2WP9B 3MFGA 1N60A 4EZLA 2AYOB 5CHVC 3H7PA 2JRIB 4BAXA 2J7QB 3H1UA 4M0WB 3IT6B 3KLSX 1QQRA 3KYDD 3U7ZA 4USAA 1WJ6A 2G4SA 1J8CA 2K0PA 2KX3A 2AX5A 4TQ0A 2M0AA 1UZXB 1VLBA 2L7RA 2RDHA 4OVVA 3Q3FA 1MG8A 3PRZA 4REZA 1WM3A 2WXIA 5D3DA 2R61A 3A4SC 3QWZB 2CHXA 1K50A 1V9JA 3MC8A 4F1SA 1TY2A 3AE4B 3CSFA 1C4PA 4AOFA 5GXGB 2HTME 3VTVA 1C4CA 2KACA 2CJNA 4M01A 4NQLB 2L05A 1HTOA 1SE9A 2ZVOA 1LFDA 3PREA 1M4VA 3HRDD 3NRZA 2HJ8A 3GOEA 1MHHE 4WAFA 1ZW7A 3IVFA 1SB3C 3PLUA 4KZ0A 3A4RA 1XEEA 4E71A 1WF9A 2BS3B 3A9KB 1C77A 2LMCA 4HWIB 5E6PA 4LNFA 3ZVVA 1EF5A 4DWFA 1V49A 1YQ4B 3ZUNA 1TZ1A 1GC6A 3DHIC 1NI2A 2ZEQA 3RD2A 1ZUD2 4GU2A 1WE7A 2JZ3B 3CSTA 3ZNZB 2CHZA 1P7FA 1K53A 1DOXA 2BTEA 2X38A 5AZHA 5H92C 1NYRA 3KH0A 4WJQA 2FCSA 2DYBA 4OVZA 3PRPB 3N1ZC 2V1YA 3RNGC 3ZNGC 4DXAB 3MC0B 1FRDA 1V1PB 2CU1A 1UNSA 2ZNVC 3X0WA 4LK0M 1T5XD 5JH5C 1L4ZB 5HHDG 5IOIA 1T0SC 4CO7A 4IWQA 1VCBA 4ANUA 3R7RA 4MJSB 1OGWA 4K3BA 1F0ZA 3D32A 4LJOB 3ZIMA 2OJWA 2NPTA 1C79A 4BOSC 1CK1A 1NYQA 2V0GA 1PFDA 2N7EA 2PEAA 2IGHA 4JWUC 3PZ7A 2L1AA 2DAFA 2MW5A 5G55A 1NEKB 2C5LC 3JSVB 5C2TB 2WXQA 2N7DA 3E56A 2GB1A 5G5HA 4GN1A 3Q14C 3WAOA 1E90A 2MCNB 1D5XC 5FKAC 2QILA 2NVUI 3ECIA 1GOZA 2W82A 3GS2A 2JWUA 4RF0A 1K51A 3BVGA 1JWUD 2FCMA 4YSXB 2N9KA 1V86A 3H8HA 2J0KA 3ZNHB 2VH2A 3B2GA 2WXMA 2UU7A 4M8NA 2CJOA 2KNBA 2AL6A 4KIKB 4RGOS 2KN4A 2O6VB 3AB5A 2WYQA 3ML8A 3B0AA 4BZAA 2L0TA 1N63A 1C78A 1HZ5A 4A8XC 1AYFA 1GG3A 2ZW0A 2DZIA 5KHQA 2V4IB 2KMMA 4LNKA 3AV8A 2GOWA 1WX7A 1YIWA 2KVZA 1V6EA 3RCZA 1SEBD 2C9WB 2ZZPB 4GMVA 2WDRB 3ZQ4A 2KLGA 2PTLA 4LNOA 1Z5SB 3L13A 2JUOA 4A90A 3TMPB 1NBFC 4IWOA 3VH4B 3RFZB 3UQBA 2KDBA 2KTRB 2GI9A 4UDUC 2KJHB 4IW0A 3KW5B 1D3ZA 1WJNA 4HPMB 3WAPA 2EKIA 4KDLB 3BYYB 3V6CB 4MELA 1GB4A 1V81A 1UD7A 1P3QU 4ZRQA 3CWIA 2G1EA 1PGAA 1TKYA 3QX1A 1XD3B 2M4NA 4DHJB 2LUMA 2RGFA 4BKSD 1TZOA 1QOFA 4WIPA 4KVGB 2XEWA 1UBQA 1FPYA 3QJZA 1I4PA 2W54A 5G2NA 4BFRA 1I4GA 3SFDB 1Q0WB 3VTWA 1IBXA 4M00A 1R4MI 4RH6A 3RNEC 1UELA 2X8XX 3VR8B 1PGBA 1RFAA 1JQ4A 3RNFC 1Z2MA 1F2RC 3JVZX 1EUVB 3RYTA 4W9HA 1UF0A 1WGHA 2H88B 2WXGA 3V6EB 1AARA 4EKUA 1T3QA 3NZ3A 3V05A 5EE9A 4P1CC 3WAMA 4FJVB 4RGNA 1JRUA 4W9DA 4AP4C 3ZLZA 2Z59B 2K22A 4GGQA 2BWES 3VQIA 5DPTA 5FR6A 2N9LA 4C80A 1E10A 3ZYYX 3MC9A 2V9HA 4XC2A 4S17A 3NVYA 3U30A 4N6EB 1ZGUB 3QHTA 3V3XA 1KLUD 2KTFA 2WXHA 1E8ZA 4XDDA 2L3ZA 3B2FA 3U52E 2D5GA 1L7YA 5D7GA 3R2TA 2LI5A 1WXVA 1ZKHA 4IWPA 1N61A 4RNAA 2N9XA 2KLCA 1ZE3D 1Q5WB 2DYMA 2KN5A 3AN1A 2KFJA 2CU3A 4L23A 3IAS1 1CZPA 2LHDA 4A3OA 1OEYJ 1VZ7A 3TEYA 3P2BA 2JXTA 4BKSA 2D07B 5HKHA 1V5TA 1OTRB 2JWZA 1UBIA 4HLEA 1JWBD 2ONQA 3AU5A 3DWMA 4B6WA 2B3AA 2PIAA 1L0YB 4WWPA 1P98A 2PMVA 3DBRB 2KK8A 4S0RA 3Q3NC 3S2AA 1YQBA 1WX8A 4URKA 2IGDA 3FILA 2JVCA 3I57A 3HVZA 3BINA 1XXGA 2PVGC 1TTNA 5C23A 1WY8A 4C7ZA 5I4DA 1WYGA 3KVFB 4MH0E 4PT5A 4HPPA 3P1MA 1WJUA 4MEMA 5KHOA 2EMSA 2INPE 1ACCA 2RPVA 2MJDA 1EWCA 1WXMA 2H89B 4QAYA 2KMAA 3VR9B 3LYYA 4MGYE 5CX3A 2KKCA 3WA0A 2O2VB 1XT9B 3M3JA 2LRWA 2ZPYA 3SR6A 2KT7A 3RN9C 1SF0A 3R8BA 4N9F4 3WANA 3NOBA 1V80A 3AXCA 2GBKA 3TEZA 5G5GA 4ZYSA 3I63C 3GB1A 3MHZA 2FCQA 1L6UA 5DPSA 4LNNA 5AZFA 4LJPB 1YD8U 1VJKA 5AEKB 3U4EG 4FXCA 3VUWA 3Q8BA 2MLBA 2PE6B 2I38A 1E7PB 2RMMA 4ANWA 4PK1A 3OAWA 2L0FA 5IKCM 2XN9C 3VH3B 1ROEA 1E0ZA 2G4DB 1VDVA 2XBBC 1R4MB 3ENEA 3ML9A 2WXLA 1F77A 1TBEA 1J19A 1AWDA 1SE2A 2MBQA 3DBHB 2BKFA 1WMHA 4DHJD 4P7IA 1H8CA 1SBBB 2FBWB 4WQMA 4JIOU 1LQBA 5J2RA 1CJEA 3V60A 2IY0B 2L76A 4K1RB 4YT0B 1T0YA 3KWLA 5AUIA 1ENFA 4YWGG 3QARA 1FFVA 2V4LA 2OJRA 2N4FA 1E9MA 1V5OA 4O1NA 1KOTA 2YEPB 3Q8EA 1I4HA 1VR9A 4L1BA 4TKNA 1X1MA 3TL5A 4DXFA 1QOBA 4L2YA 3UQAA 2OHFA 3RT3B 4CYEA 4TQ1A 2VZKB 5EE3A 4JWSC 1KM7A 4PS3A 1ZP0B 5J18A 1R7SA 1WRDB 1J7BA 4MGKE 3KUDB 1TS3A 1HXYD 2G45B 3AE5B 3SEBA 3ZXRA 3VUXA 3HM6X 3R66C 3PPAA 2GMIC 3MP9A 4WJNA 2KO3A 1P1AA 1KF6B 3AULA 3N32A 3N3KB 1FNWA 1AN8A 4AUQC 4I6PA 3AE9B 3HVDA 2GBMA 1I35A 1A5RA 2MRPA 3KUZA 2BW2A 1ET6A 2CR5A 1V8CA 2KTRA 1FFUA 2BB5A 4XWWA 3APFA 3RNAC 3L4PA 2IY1B 5BMHA 3Q2AC 4ASWC 2MBHA 1YQ3B 3WCQA 2PW9A 2QEJC 1FCLA 4C4VB 4IM0A 2JSVX 2WDTB 1F2RI 4AJYB 3C19A 4BKTA 2KAJA 1I4XA 4HVBA 3AM9A 2MEKA 1RWSA 2NR2A 4NPNA 1L5PA 1WXSA 4US8A 4C7YA 3P4SB 2N9PC 1MVKA 3KWVA 4DQOC 1EM7A 3Q3OC 1KJTA 1YX5B 5BMIA 3A9JA 1WJ4A 3IBEA 1KLGD 2BKRB 3PO0A 2MJ3A 2IBIB 3BYTB 4EOYA 4AWJA 4YTPB 4FN2A 1FO4A 3DPDA 1B9RA 4ZRJA 2DZJA 3W9CB 3PT2B 4RMAA 2LVPA 2NBUA 4XYCA 2JZPA 1J7AA 1KLVA 3EGRA 5DCNA 1DGJA 2FIDA 3TCAA 1V97A 4HCNB 4A9AA 2NBWB 2LHEA 4GDLB 1QF6A 3ZW3A 1NVID 1UWXA 1N6ZA 1SJED 2N0SB 3NVVA 4G50A 4WWOA 4K7UA 4N59A 3ZDTA 3NJTA 2WHIA 1BUIC 2WDVB 2K9XA
chains in the Genus database with same CATH topology
3HK0A 1WM2A 3QJZA 5IAAC 2EMTA 1WFYA 1WXAA 1BT0A 2N9EB 3DVNU 4LDTD 4MGZE 5E6NA 1RRBA 5G2NA 4HCPB 4BFRA 4CHKA 2D2QA 1GJZA 4WQOB 3NZSA 3VFKA 4LCDE 4JQWC 2AEHA 1Q0WB 3APDA 3CMMB 2ZCCA 3TJPA 3VTWA 2IZVB 2V3SA 1R4MI 1I42A 2KX0A 2KDFB 5J17A 5L83A 2M0XA 3R3MA 1UELA 4FA6A 4FADA 3QIJA 2MP2B 4F8CB 3MTNB 2J0JA 4A20A 1E8YA 2KDIA 3EFUA 4PYZA 1C1YB 4ICUA 3UINB 4DDID 2KWUB 4MSQB 1ISNA 1SIFA 1PQSA 1RFAA 4TUUA 1L2NA 1Z2MA 2WX0A 2KJRA 3L16A 3JVZX 1EUVB 2BYVE 3RYTA 3IG3A 2DZKA 2FUHB 4W9HA 4ZDVA 4TV3A 1WGHA 2MX2A 3T8MA 3PHWB 4DDGD 3L0WB 1YX6B 4GDLA 3V6EB 1AARA 3VTUA 3W1YA 2GBNA 4EKUA 2Y5BB 2AL3A 2ZCBA 4EFOA 2NS5A 3WAMA 3K9PB 4FJVB 3A33B 1JRUA 2K1FA 4IG7B 3PRMB 4W9DA 4AP4C 3ZLZA 4IM2A 1WGDA 2Z59B 2A4ZA 4GGQA 2AWTA 2BWES 4NJ6A 3VQIA 2CS4A 2REXA 4FJZA 5DPTA 5FR6A 1E7UA 1R4NI 1H4RA 2ZNVB 2RD0A 3QAQA 2KFKB 4FHKA 2XK5B 3PLVA 2D10A 1VD2A 4XC2A 3U30A 5C1ZA 1V2YA 1HE8A 1ZGUB 2LRUA 3QHTA 3NHEB 4W9KA 2KTFA 2N1VA 4FBJB 1IPGA 1E8ZA 2MA9B 2L3ZA 3DBSA 4OVUA 3UIOB 2MP2A 2KQ7A 2FIFA 1L7YA 4JGHB 1WR1A 2KANA 2LUEA 2D3GA 2KMCA 5D7GA 2LWPA 2WWZA 4K7WA 2M1MA 2LI5A 3U7DA 4GDKB 2C7MB 4WJOA 1WXVA 3L17A 2YLMA 1ZKHA 3VHTC 4IWPA 3A1QB 3RULA 2KD0A 3SHQA 3R7QA 4NAWB 2N9XA 3EHVA 2KLCA 5L95C 2KDEB 2LGDA 4WWNA 1Q5WB 2DYMA 2BYFA 2KN5A 2KFJA 5JHAA 3V62A 3K9OB 1G6JA 2KHWB 2DYOA 4A3OA 1OEYJ 4IM3A 2MSED 4B95A 1IYFA 3MHSD 4G0NB 4YL8A 1WGYA 5D2MB 2I1JA 1CMXB 2MWSB 1WYWB 3JW0X 1E7VA 5LXHA 3H7PB 3P2BA 4K7SA 4K81A 4BKSA 4HDQA 2HTHA 2D07B 1QZEA 2MQJA 4FHJA 5HKHA 3VVWB 1V5TA 1OTRB 2PJHA 2JWZA 3SU8X 2FAZA 1UBIA 3GZNI 3JYUA 3QC8B 3DCGA 4HLEA 2UYZB 3PHXB 4MSMB 4ICVA 3N30A 2DHZA 2KFKA 5IA7A 2XK5A 3MJWA 2LJ5A 3AU5A 3PTFC 4B6WA 4F7ZA 1TGZB 2B3AA 4KSLC 4HJKA 1E8XA 2WX1A 2BYEA 2L00B 2FNJB 3DVGX 3L08A 4WWPA 4GSWA 5JHBA 2ZVNA 1P98A 2D11A 2C7NB 3I3TB 3QA8A 2J0MA 1WE6A 2DZMA 2K8CA 1WI0A 1WZ0A 2KK8A 4MGIE 2RSUA 3S2AA 5DPRA 1YQBA 3NS8A 1WX8A 4M8MA 4URKA 2KXJA 2LGYA 4GDKA 2JVCA 2MBOA 2N1WA 2PPHA 2KC2A 3A1QA 3KUCB 3PS6A 4NAWA 1WIAA 2GBRA 2BPSA 3BINA 1UGMA 1TTNA 4BKGA 3VH4B 3APCA 4E3CA 1P0RA 1P9DU 4HXDA 5C23A 3TBLD 2KC1A 1GC7A 1NDDA 1WZ3A 1WY8A 4EZLA 2KVRA 2AYOB 2LD9A 5CHVC 1E8WA 3KVFB 4MH0E 3H7PA 2JRIB 1Y8RC 1WJUA 2QHOA 4MEMA 2J7QB 5KHOA 2EMSA 3H1UA 4M0WB 1WXMA 3M62B 3KYDD 2JXXA 2KMAA 4EUTA 3EECA 2JT4B 1WJ6A 2G4SA 3VDZA 2JRHA 2I1KA 2RR9A 4MGYE 5CX3A 1GUAB 2KOXA 2KKCA 2W9NA 3W1SA 1J8CA 2KX3A 3WA0A 4TQ0A 1UZXB 2O2VB 1XT9B 1E5WA 2LRWA 2ZPYA 3M3JA 2L7RA 1U4AA 4OVVA 4ZYNA 4MM3A 3Q3FA 4ZRIA 1MG8A 3PRZA 1WM3A 4W9FA 1LM8B 1WMHB 4N9F4 1OEYA 2LVQA 3WANA 1Q1OA 3A4SC 3QWZB 2JF5A 2CHXA 3NOBA 4MDKE 1V80A 3AXCA 1V9JA 2IO1B 2JZZA 5E6OA 2DENB 2GBKA 4F1SA 4KDIC 2FCQA 3Q3JA 3CSFA 4BOZB 5DPSA 5AZFA 4AOFA 3C0RB 3VTVA 4LJPB 4JLCA 4NQKE 3PSEB 1FXTB 3RZFA 2BF8B 1YD8U 5AEKB 2ZJDA 3VUWA 4NQLB 5JZEB 2L05A 2MLBA 2DAJA 2LVOA 1SE9A 2PE6B 4JL9A 2ZVOA 4LDTB 4W9CA 3KYCD 1LFDA 3PREA 2K8HA 4ANWA 2HJ8A 3GOEA 3DDCB 3BY4B 3OAWA 5J2RA 1ZW7A 2L0FA 3ALBA 3HIZA 3HM3A 2KWCA 2M17A 3VH3B 3DBRI 3IVFA 3UGBB 2G4DB 5BO4B 2XBBC 3PLUA 5D6JB 4KZ0A 2O2VA 3ENEA 3ML9A 3A4RA 3OJ3A 4E71A 3AI5A 1WF9A 1TBEA 3A9KB 3DVGY 3H9DA 1J19A 2CKHB 4PS8A 3H6NA 4HWIB 5E6PA 2JY6A 2MBQA 3VAWA 2ASQA 3ZVVA 2BKFA 1WMHA 3L10B 4GIVA 1EF5A 3T9LA 4DWFA 4GXBA 4DHJD 4P7IA 4EZKA 1H8CA 1V49A 3ZUNA 4FULA 1TZ1A 4JIOU 1GC6A 2DX5B 1LQBA 1SGHA 2RPQA 2Z0DB 1NI2A 2ZEQA 3B1LX 1S3SG 3EC8A 2IY0B 2L76A 3QK0A 4K1RB 3RD2A 1T0YA 2LGXA 4GU2A 3V60A 3ZTDA 1WE7A 4AJWA 2JZ3B 3QARA 3CSTA 4II2B 2NPTB 2V4LA 2OJRA 3M95A 2N4FA 1WH3A 4KV2A 1V5OA 1KOTA 3ZNZB 4EZJA 2CHZA 4TKNA 5CHWA 5DPWA 1X1MA 3TL5A 3UF8A 3ZRFA 3H7SA 5AZHA 3UQAA 3HHMA 4RM9A 3RT3B 3DQVA 3KH0A 4WJQA 4CYEA 2FCSA 2DYBA 4TQ1A 1LXDA 3PRPB 3ZRCA 4IUMB 2V1YA 5EDSA 1KM7A 2M8SA 4IC7B 3V61A 3ZNGC 4DXAB 4HK2A 1WRDB 5J18A 4MGKE 3SDLC 3KUDB 2CU1A 3A9KA 2ZNVC 2A5UA 3X0WA 1UH6A 2G45B 2K6DB 4GOCA 2EKEC 4I6NB 4WJPA 4XX5A 5JH5C 2PE9A 3VUXA 3HM6X 3R66C 4ZRKA 4G11A 2K39A 2GMIC 3PPAA 3CF6E 4CO7A 4IWQA 4WJNA 2KO3A 1VCBA 4ANUA 3R7RA 2IO3B 4MJSB 1P1AA 1OGWA 2C7HA 1RLFA 3AULA 2JPHA 3WIMA 3N32A 3D32A 4LJOB 2O6VD 3N3KB 3ZIMA 2LXAA 2NPTA 2UWQA 3NY5A 4FJYA 4W9EA 4AUQC 4BOSC 4W9LA 3OJ4B 3UIPB 1RAXA 5CTRC 2NBVB 3DVNV 2R2QA 2IO2B 4I6PA 2LXCA 2N7EA 4WAAA 2PEAA 2GBMA 1WR6E 4GB9A 1I35A 2G3QB 2DAFA 1A5RA 2MW5A 2MRPA 3DBLI 5G55A 5LLIA 2C5LC 3JSVB 3KUZA 1IP9A 2N7DA 2KZRA 3X23A 2K8BA 2CR5A 3TIXA 3QQ8B 4BBNC 2HE7A 2KTRA 3DOWA 4GN1A 4NNJB 1E90A 3WAOA 2MCNB 3APFA 3DBHI 2KWVB 2IY1B 3B08A 4A3PA 4ASWC 3A9JB 2NVUI 3ECIA 4DK5A 3PZDA 2MBHA 4G3XB 3W1SC 5D94A 4DBGA 2FCMA 3ZTCA 4ANXA 4RM8A 5GMVA 4IM0A 2WDTB 1V86A 2J0KA 3PVLA 4PS7A 1M94A 2KQSA 3ZNHB 1WGRA 4PYUA 3O65B 2NCNA 3M63B 2L8JA 4MJSA 4AJYB 1K8RB 4BKTA 2K6QA 1YJ1A 4M8NA 2KNBA 2AL6A 4KIKB 2GBJA 4HPLB 2O6VB 2WYQA 3LDZE 3QCAA 2LASA 4HVBA 4ANVA 3VUYA 2CHWA 3ML8A 4FLHA 3ZNID 2NR2A 2LZ6A 3ZO5B 3L54A 4NPNA 2C60A 2HD5B 2BWFA 2ZPNA 2K25A 1WXSA 3B0AA 3ONSA 1C3TA 2L0TA 1XQQA 3JSVA 4EEWA 2N9PC 3IFWB 1GG3A 2KJ6A 3RZWC 2MBEA 3LJ3A 2YVCA 2DZIA 5KHQA 2VRRB 5TR5A 1KJTA 4I6LB 4BVUC 1YX5B 3A9JA 2GOWA 1EF1A 1WX7A 1YIWA 2BGFA 1WJ4A 1V6EA 3RCZA 4NY0A 3IBEA 2C9WB 2ZZPB 4GMVA 4KSKC 2BKRB 4BBNF 2IO0B 2KLGA 3PV1A 3VXWA 2R2OA 2IBIB 1Z5SB 3L13A 4XZ4A 5AZGA 1S1QB 3ZDMC 1GNUA 4EOYA 2JUOA 2Z0EB 1OQYA 4AWJA 3IHPC 3SD5A 3TMPB 1NBFC 3AU4A 4FN2A 4IWOA 2IYDB 4II3B 3DPDA 2FCNA 2KDBA 4KIKA 5CHFA 3UQBA 2KTRB 4B9KA 4ZRJA 2DZJA 4W9GA 3WALA 1WX9A 2KJHB 2O6VA 2MBBB 3KW5B 3PT2B 4IW0A 2LVPA 1WJNA 2NBUA 4HPMB 4RMAA 1F9JA 1D3ZA 4W9JA 3NZUA 4W9IA 4E74A 3WAPA 3PGEA 4X57B 3U8ZA 4KDLB 3ZKJC 4NJ7A 3V6CB 4MELA 1KLVA 5DCNA 2FIDA 1V81A 1UD7A 3TCAA 1P3QU 1J0GA 4HCNB 3RUIB 2NBWB 4J6IA 4GDLB 3QX1A 1XD3B 2OOBB 3OLMD 4HDOA 3ZW3A 2M4NA 4DHJB 4DHZB 2RGFA 4BKSD 1WGGA 4G50A 4WWOA 4K7UA 3ZDTA 4KVGB 4KZCA 1EO6A 4DHZE 2XEWA 5LXIB 4PS3A 1UBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HK0 A;  1WM2 A;  3QJZ A;  5IAA C;  2EMT A;  1WFY A;  1WXA A;  1BT0 A;  2N9E B;  3DVN U;  4LDT D;  4MGZ E;  5E6N A;  1RRB A;  5G2N A;  4HCP B;  4BFR A;  4CHK A;  2D2Q A;  1GJZ A;  4WQO B;  3NZS A;  3VFK A;  4LCD E;  4JQW C;  2AEH A;  1Q0W B;  3APD A;  3CMM B;  2ZCC A;  3TJP A;  3VTW A;  2IZV B;  2V3S A;  1R4M I;  1I42 A;  2KX0 A;  2KDF B;  5J17 A;  5L83 A;  2M0X A;  3R3M A;  1UEL A;  4FA6 A;  4FAD A;  3QIJ A;  2MP2 B;  4F8C B;  3MTN B;  2J0J A;  4A20 A;  1E8Y A;  2KDI A;  3EFU A;  4PYZ A;  1C1Y B;  4ICU A;  3UIN B;  4DDI D;  2KWU B;  4MSQ B;  1ISN A;  1SIF A;  1PQS A;  1RFA A;  4TUU A;  1L2N A;  1Z2M A;  2WX0 A;  2KJR A;  3L16 A;  3JVZ X;  1EUV B;  2BYV E;  3RYT A;  3IG3 A;  2DZK A;  2FUH B;  4W9H A;  4ZDV A;  4TV3 A;  1WGH A;  2MX2 A;  3T8M A;  3PHW B;  4DDG D;  3L0W B;  1YX6 B;  4GDL A;  3V6E B;  1AAR A;  3VTU A;  3W1Y A;  2GBN A;  4EKU A;  2Y5B B;  2AL3 A;  2ZCB A;  4EFO A;  2NS5 A;  3WAM A;  3K9P B;  4FJV B;  3A33 B;  1JRU A;  2K1F A;  4IG7 B;  3PRM B;  4W9D A;  4AP4 C;  3ZLZ A;  4IM2 A;  1WGD A;  2Z59 B;  2A4Z A;  4GGQ A;  2AWT A;  2BWE S;  4NJ6 A;  3VQI A;  2CS4 A;  2REX A;  4FJZ A;  5DPT A;  5FR6 A;  1E7U A;  1R4N I;  1H4R A;  2ZNV B;  2RD0 A;  3QAQ A;  2KFK B;  4FHK A;  2XK5 B;  3PLV A;  2D10 A;  1VD2 A;  4XC2 A;  3U30 A;  5C1Z A;  1V2Y A;  1HE8 A;  1ZGU B;  2LRU A;  3QHT A;  3NHE B;  4W9K A;  2KTF A;  2N1V A;  4FBJ B;  1IPG A;  1E8Z A;  2MA9 B;  2L3Z A;  3DBS A;  4OVU A;  3UIO B;  2MP2 A;  2KQ7 A;  2FIF A;  1L7Y A;  4JGH B;  1WR1 A;  2KAN A;  2LUE A;  2D3G A;  2KMC A;  5D7G A;  2LWP A;  2WWZ A;  4K7W A;  2M1M A;  2LI5 A;  3U7D A;  4GDK B;  2C7M B;  4WJO A;  1WXV A;  3L17 A;  2YLM A;  1ZKH A;  3VHT C;  4IWP A;  3A1Q B;  3RUL A;  2KD0 A;  3SHQ A;  3R7Q A;  4NAW B;  2N9X A;  3EHV A;  2KLC A;  5L95 C;  2KDE B;  2LGD A;  4WWN A;  1Q5W B;  2DYM A;  2BYF A;  2KN5 A;  2KFJ A;  5JHA A;  3V62 A;  3K9O B;  1G6J A;  2KHW B;  2DYO A;  4A3O A;  1OEY J;  4IM3 A;  2MSE D;  4B95 A;  1IYF A;  3MHS D;  4G0N B;  4YL8 A;  1WGY A;  5D2M B;  2I1J A;  1CMX B;  2MWS B;  1WYW B;  3JW0 X;  1E7V A;  5LXH A;  3H7P B;  3P2B A;  4K7S A;  4K81 A;  4BKS A;  4HDQ A;  2HTH A;  2D07 B;  1QZE A;  2MQJ A;  4FHJ A;  5HKH A;  3VVW B;  1V5T A;  1OTR B;  2PJH A;  2JWZ A;  3SU8 X;  2FAZ A;  1UBI A;  3GZN I;  3JYU A;  3QC8 B;  3DCG A;  4HLE A;  2UYZ B;  3PHX B;  4MSM B;  4ICV A;  3N30 A;  2DHZ A;  2KFK A;  5IA7 A;  2XK5 A;  3MJW A;  2LJ5 A;  3AU5 A;  3PTF C;  4B6W A;  4F7Z A;  1TGZ B;  2B3A A;  4KSL C;  4HJK A;  1E8X A;  2WX1 A;  2BYE A;  2L00 B;  2FNJ B;  3DVG X;  3L08 A;  4WWP A;  4GSW A;  5JHB A;  2ZVN A;  1P98 A;  2D11 A;  2C7N B;  3I3T B;  3QA8 A;  2J0M A;  1WE6 A;  2DZM A;  2K8C A;  1WI0 A;  1WZ0 A;  2KK8 A;  4MGI E;  2RSU A;  3S2A A;  5DPR A;  1YQB A;  3NS8 A;  1WX8 A;  4M8M A;  4URK A;  2KXJ A;  2LGY A;  4GDK A;  2JVC A;  2MBO A;  2N1W A;  2PPH A;  2KC2 A;  3A1Q A;  3KUC B;  3PS6 A;  4NAW A;  1WIA A;  2GBR A;  2BPS A;  3BIN A;  1UGM A;  1TTN A;  4BKG A;  3VH4 B;  3APC A;  4E3C A;  1P0R A;  1P9D U;  4HXD A;  5C23 A;  3TBL D;  2KC1 A;  1GC7 A;  1NDD A;  1WZ3 A;  1WY8 A;  4EZL A;  2KVR A;  2AYO B;  2LD9 A;  5CHV C;  1E8W A;  3KVF B;  4MH0 E;  3H7P A;  2JRI B;  1Y8R C;  1WJU A;  2QHO A;  4MEM A;  2J7Q B;  5KHO A;  2EMS A;  3H1U A;  4M0W B;  1WXM A;  3M62 B;  3KYD D;  2JXX A;  2KMA A;  4EUT A;  3EEC A;  2JT4 B;  1WJ6 A;  2G4S A;  3VDZ A;  2JRH A;  2I1K A;  2RR9 A;  4MGY E;  5CX3 A;  1GUA B;  2KOX A;  2KKC A;  2W9N A;  3W1S A;  1J8C A;  2KX3 A;  3WA0 A;  4TQ0 A;  1UZX B;  2O2V B;  1XT9 B;  1E5W A;  2LRW A;  2ZPY A;  3M3J A;  2L7R A;  1U4A A;  4OVV A;  4ZYN A;  4MM3 A;  3Q3F A;  4ZRI A;  1MG8 A;  3PRZ A;  1WM3 A;  4W9F A;  1LM8 B;  1WMH B;  4N9F 4;  1OEY A;  2LVQ A;  3WAN A;  1Q1O A;  3A4S C;  3QWZ B;  2JF5 A;  2CHX A;  3NOB A;  4MDK E;  1V80 A;  3AXC A;  1V9J A;  2IO1 B;  2JZZ A;  5E6O A;  2DEN B;  2GBK A;  4F1S A;  4KDI C;  2FCQ A;  3Q3J A;  3CSF A;  4BOZ B;  5DPS A;  5AZF A;  4AOF A;  3C0R B;  3VTV A;  4LJP B;  4JLC A;  4NQK E;  3PSE B;  1FXT B;  3RZF A;  2BF8 B;  1YD8 U;  5AEK B;  2ZJD A;  3VUW A;  4NQL B;  5JZE B;  2L05 A;  2MLB A;  2DAJ A;  2LVO A;  1SE9 A;  2PE6 B;  4JL9 A;  2ZVO A;  4LDT B;  4W9C A;  3KYC D;  1LFD A;  3PRE A;  2K8H A;  4ANW A;  2HJ8 A;  3GOE A;  3DDC B;  3BY4 B;  3OAW A;  5J2R A;  1ZW7 A;  2L0F A;  3ALB A;  3HIZ A;  3HM3 A;  2KWC A;  2M17 A;  3VH3 B;  3DBR I;  3IVF A;  3UGB B;  2G4D B;  5BO4 B;  2XBB C;  3PLU A;  5D6J B;  4KZ0 A;  2O2V A;  3ENE A;  3ML9 A;  3A4R A;  3OJ3 A;  4E71 A;  3AI5 A;  1WF9 A;  1TBE A;  3A9K B;  3DVG Y;  3H9D A;  1J19 A;  2CKH B;  4PS8 A;  3H6N A;  4HWI B;  5E6P A;  2JY6 A;  2MBQ A;  3VAW A;  2ASQ A;  3ZVV A;  2BKF A;  1WMH A;  3L10 B;  4GIV A;  1EF5 A;  3T9L A;  4DWF A;  4GXB A;  4DHJ D;  4P7I A;  4EZK A;  1H8C A;  1V49 A;  3ZUN A;  4FUL A;  1TZ1 A;  4JIO U;  1GC6 A;  2DX5 B;  1LQB A;  1SGH A;  2RPQ A;  2Z0D B;  1NI2 A;  2ZEQ A;  3B1L X;  1S3S G;  3EC8 A;  2IY0 B;  2L76 A;  3QK0 A;  4K1R B;  3RD2 A;  1T0Y A;  2LGX A;  4GU2 A;  3V60 A;  3ZTD A;  1WE7 A;  4AJW A;  2JZ3 B;  3QAR A;  3CST A;  4II2 B;  2NPT B;  2V4L A;  2OJR A;  3M95 A;  2N4F A;  1WH3 A;  4KV2 A;  1V5O A;  1KOT A;  3ZNZ B;  4EZJ A;  2CHZ A;  4TKN A;  5CHW A;  5DPW A;  1X1M A;  3TL5 A;  3UF8 A;  3ZRF A;  3H7S A;  5AZH A;  3UQA A;  3HHM A;  4RM9 A;  3RT3 B;  3DQV A;  3KH0 A;  4WJQ A;  4CYE A;  2FCS A;  2DYB A;  4TQ1 A;  1LXD A;  3PRP B;  3ZRC A;  4IUM B;  2V1Y A;  5EDS A;  1KM7 A;  2M8S A;  4IC7 B;  3V61 A;  3ZNG C;  4DXA B;  4HK2 A;  1WRD B;  5J18 A;  4MGK E;  3SDL C;  3KUD B;  2CU1 A;  3A9K A;  2ZNV C;  2A5U A;  3X0W A;  1UH6 A;  2G45 B;  2K6D B;  4GOC A;  2EKE C;  4I6N B;  4WJP A;  4XX5 A;  5JH5 C;  2PE9 A;  3VUX A;  3HM6 X;  3R66 C;  4ZRK A;  4G11 A;  2K39 A;  2GMI C;  3PPA A;  3CF6 E;  4CO7 A;  4IWQ A;  4WJN A;  2KO3 A;  1VCB A;  4ANU A;  3R7R A;  2IO3 B;  4MJS B;  1P1A A;  1OGW A;  2C7H A;  1RLF A;  3AUL A;  2JPH A;  3WIM A;  3N32 A;  3D32 A;  4LJO B;  2O6V D;  3N3K B;  3ZIM A;  2LXA A;  2NPT A;  2UWQ A;  3NY5 A;  4FJY A;  4W9E A;  4AUQ C;  4BOS C;  4W9L A;  3OJ4 B;  3UIP B;  1RAX A;  5CTR C;  2NBV B;  3DVN V;  2R2Q A;  2IO2 B;  4I6P A;  2LXC A;  2N7E A;  4WAA A;  2PEA A;  2GBM A;  1WR6 E;  4GB9 A;  1I35 A;  2G3Q B;  2DAF A;  1A5R A;  2MW5 A;  2MRP A;  3DBL I;  5G55 A;  5LLI A;  2C5L C;  3JSV B;  3KUZ A;  1IP9 A;  2N7D A;  2KZR A;  3X23 A;  2K8B A;  2CR5 A;  3TIX A;  3QQ8 B;  4BBN C;  2HE7 A;  2KTR A;  3DOW A;  4GN1 A;  4NNJ B;  1E90 A;  3WAO A;  2MCN B;  3APF A;  3DBH I;  2KWV B;  2IY1 B;  3B08 A;  4A3P A;  4ASW C;  3A9J B;  2NVU I;  3ECI A;  4DK5 A;  3PZD A;  2MBH A;  4G3X B;  3W1S C;  5D94 A;  4DBG A;  2FCM A;  3ZTC A;  4ANX A;  4RM8 A;  5GMV A;  4IM0 A;  2WDT B;  1V86 A;  2J0K A;  3PVL A;  4PS7 A;  1M94 A;  2KQS A;  3ZNH B;  1WGR A;  4PYU A;  3O65 B;  2NCN A;  3M63 B;  2L8J A;  4MJS A;  4AJY B;  1K8R B;  4BKT A;  2K6Q A;  1YJ1 A;  4M8N A;  2KNB A;  2AL6 A;  4KIK B;  2GBJ A;  4HPL B;  2O6V B;  2WYQ A;  3LDZ E;  3QCA A;  2LAS A;  4HVB A;  4ANV A;  3VUY A;  2CHW A;  3ML8 A;  4FLH A;  3ZNI D;  2NR2 A;  2LZ6 A;  3ZO5 B;  3L54 A;  4NPN A;  2C60 A;  2HD5 B;  2BWF A;  2ZPN A;  2K25 A;  1WXS A;  3B0A A;  3ONS A;  1C3T A;  2L0T A;  1XQQ A;  3JSV A;  4EEW A;  2N9P C;  3IFW B;  1GG3 A;  2KJ6 A;  3RZW C;  2MBE A;  3LJ3 A;  2YVC A;  2DZI A;  5KHQ A;  2VRR B;  5TR5 A;  1KJT A;  4I6L B;  4BVU C;  1YX5 B;  3A9J A;  2GOW A;  1EF1 A;  1WX7 A;  1YIW A;  2BGF A;  1WJ4 A;  1V6E A;  3RCZ A;  4NY0 A;  3IBE A;  2C9W B;  2ZZP B;  4GMV A;  4KSK C;  2BKR B;  4BBN F;  2IO0 B;  2KLG A;  3PV1 A;  3VXW A;  2R2O A;  2IBI B;  1Z5S B;  3L13 A;  4XZ4 A;  5AZG A;  1S1Q B;  3ZDM C;  1GNU A;  4EOY A;  2JUO A;  2Z0E B;  1OQY A;  4AWJ A;  3IHP C;  3SD5 A;  3TMP B;  1NBF C;  3AU4 A;  4FN2 A;  4IWO A;  2IYD B;  4II3 B;  3DPD A;  2FCN A;  2KDB A;  4KIK A;  5CHF A;  3UQB A;  2KTR B;  4B9K A;  4ZRJ A;  2DZJ A;  4W9G A;  3WAL A;  1WX9 A;  2KJH B;  2O6V A;  2MBB B;  3KW5 B;  3PT2 B;  4IW0 A;  2LVP A;  1WJN A;  2NBU A;  4HPM B;  4RMA A;  1F9J A;  1D3Z A;  4W9J A;  3NZU A;  4W9I A;  4E74 A;  3WAP A;  3PGE A;  4X57 B;  3U8Z A;  4KDL B;  3ZKJ C;  4NJ7 A;  3V6C B;  4MEL A;  1KLV A;  5DCN A;  2FID A;  1V81 A;  1UD7 A;  3TCA A;  1P3Q U;  1J0G A;  4HCN B;  3RUI B;  2NBW B;  4J6I A;  4GDL B;  3QX1 A;  1XD3 B;  2OOB B;  3OLM D;  4HDO A;  3ZW3 A;  2M4N A;  4DHJ B;  4DHZ B;  2RGF A;  4BKS D;  1WGG A;  4G50 A;  4WWO A;  4K7U A;  3ZDT A;  4KVG B;  4KZC A;  1EO6 A;  4DHZ E;  2XEW A;  5LXI B;  4PS3 A;  1UBQ A; 
#chains in the Genus database with same CATH topology
 1JAL A;  2EMT A;  4IOI E;  1GJZ A;  4HCP B;  4CHK A;  4WQO B;  3NZS A;  2ZCC A;  1Y56 A;  2IZV B;  2V3S A;  3TSS A;  3GZN B;  2M0X A;  2MP2 B;  5EE0 A;  1ISN A;  3J9C A;  1SIF A;  2J52 A;  1FEH A;  2BYV E;  1XCQ L;  3IG3 A;  3Q69 A;  2QDF A;  4TV3 A;  2MX2 A;  3Q6B A;  3W1Y A;  2GBN A;  5E6J A;  2IGG A;  2Y5B B;  2ZCB A;  4EFO A;  1JW9 D;  2NS5 A;  3K9P B;  4IG7 B;  2K1F A;  1D4B A;  2INN E;  1WGD A;  1C9F A;  2EEL A;  3FC4 A;  1E7U A;  1R4N I;  2RD0 A;  4FHK A;  2XK5 B;  3DHH C;  1V2Y A;  1HE8 A;  3KQ4 A;  3NHE B;  1JWA D;  2N7J A;  1IPG A;  2LEK A;  2MA9 B;  2VZK D;  4OZA A;  1WR1 A;  2KAN A;  1UGJ A;  5LNK 1;  3GE3 C;  2LWP A;  2WWZ A;  2Y5C A;  1CQV A;  3U7D A;  4GDK B;  2C7M B;  3L17 A;  2BS2 B;  2YLM A;  3VHT C;  4AQ7 A;  1MFW A;  2WXR A;  2WXP A;  3AEA B;  3SHQ A;  3IT4 B;  1TKG A;  5L95 C;  2BYF A;  2JX5 A;  5HFY A;  2W3S A;  2KHW B;  1LO5 D;  2DYO A;  1IYF A;  4B95 A;  4G0N B;  2INC C;  4YL8 A;  1CMX B;  3JW0 X;  1NEN B;  3BVZ A;  3H7P B;  4A55 A;  1JRP A;  2HTH A;  4KGR A;  1GPX A;  1QZE A;  2MQJ A;  3VVW B;  2WXK A;  2PJH A;  2SEB D;  1MJD A;  1LGR A;  4J3O D;  3E9S A;  2UYZ B;  3PHX B;  2I2Y A;  4ICV A;  3N30 A;  1ET9 A;  2KFK A;  2ICI A;  3PTF C;  1TY0 A;  4HJK A;  1GAQ B;  1E8X A;  2WX1 A;  3B9J A;  2ZVN A;  2D11 A;  3QA8 A;  4LTU A;  4C56 C;  1WE6 A;  2DZM A;  1WZ0 A;  2QSD A;  4WH4 A;  2RSU A;  3ZXV A;  2XNA C;  1YMH E;  1FMA D;  2PPH A;  2KC2 A;  3A1Q A;  4OZB A;  1FNV A;  4NAW A;  2GBR A;  2BPS A;  1UGM A;  4BKG A;  3EFC A;  3APC A;  4HEA 1;  1P0R A;  4HXD A;  2D3B A;  1WZ3 A;  1MPE A;  1SE4 A;  2IJ0 A;  4YXD B;  2KVR A;  3AED B;  5EE1 A;  2LD9 A;  1DOI A;  1Y8R C;  4HRO A;  3AE6 B;  1F52 A;  2AQ3 B;  3M62 B;  2MHJ A;  2GRI A;  2JXX A;  5IP4 D;  2JT4 B;  2IND C;  3VDZ A;  1A70 A;  1GUA B;  4RGT A;  2ACZ B;  1U4A A;  4MM3 A;  4ZRI A;  1TIF A;  4W9F A;  4YSZ B;  3I9V 1;  1DOY A;  2JF5 A;  2QMT A;  2WXF A;  1ZOY B;  4MDK E;  2IO1 B;  2JZZ A;  3T3O A;  1JWS D;  2DEN B;  3BZD B;  1AW7 A;  1EU4 A;  1HZ6 A;  3Q3J A;  4BOZ B;  3C0R B;  4JLC A;  4NQK E;  1FXT B;  1XO3 A;  3RZF A;  2BF8 B;  2ZJD A;  4LDT B;  1TKE A;  2DAJ A;  2LVO A;  3SFE B;  3URY A;  4US9 A;  3U2S C;  3DDC B;  4M0W A;  4ZRP A;  4IKG A;  3UGB B;  5BO4 B;  2LGS A;  4XDC A;  4K3C A;  3OJ3 A;  3H9D A;  2CKH B;  2ASQ A;  3L10 B;  2KQ4 X;  3T9L A;  1JWM D;  4FUL A;  1L4D B;  1PYW D;  3PLV A;  1FXI A;  4PS8 A;  3B1L X;  1WGK A;  4EZK A;  3QK0 A;  3ZTD A;  1KFY B;  2LGX A;  4AJW A;  2WNM A;  2NPT B;  4KV2 A;  2BS4 B;  1D5Z C;  4XE0 A;  1E6E B;  4NAM A;  4EZJ A;  5CHW A;  2BT6 A;  4IDI A;  3UF8 A;  3ZRF A;  3H7S A;  4NJC A;  3HHM A;  3Q8A A;  4RM9 A;  3DQV A;  2L83 A;  1LXD A;  2QJL A;  5EDS A;  3V61 A;  3A9K A;  1TS5 A;  1I4R A;  1UH6 A;  2K6D B;  2EKE C;  4WJP A;  3W2D A;  4ZRK A;  3HUI A;  2K39 A;  4P6V F;  1T0R C;  3CF6 E;  1SIJ A;  2IO3 B;  2WXJ A;  1XLQ A;  2G9H D;  3MJ5 A;  1KTK A;  2JPH A;  1L0X B;  2O6V D;  3N1Y C;  2LXA A;  3NY5 A;  4FJY A;  4W9E A;  5BYS A;  4W9L A;  1RAX A;  2HDE A;  3DVN V;  2R2Q A;  1YOV B;  3DHG C;  4TMA B;  1WR6 E;  3NUH B;  3DBL I;  2Z8L A;  1L6V A;  4P1B C;  4BBN C;  3GE8 C;  3DOW A;  1FRR A;  5FK9 C;  3ZGZ A;  4LNI A;  4A3P A;  1V1P A;  4C00 A;  5BMG A;  4G3X B;  1ZXH A;  1ESF A;  3AEG B;  3W1S C;  5D94 A;  4DBG A;  2WLB A;  2QCZ A;  4M02 A;  3ZTC A;  5GMV A;  4ANX A;  2WQY B;  1PUT A;  1M94 A;  2KQS A;  1WGR A;  2KWD A;  3M63 B;  4MJS A;  1K8R B;  2DWQ A;  1YJ1 A;  2OED A;  4HPL B;  2WGS A;  2KDM A;  3QCA A;  2LAS A;  2PKO A;  4ANV A;  2CHW A;  4FLH A;  3GP7 A;  3ZNI D;  2LZ6 A;  3ZO5 B;  3L54 A;  1EWY C;  2B76 B;  2C60 A;  2HD5 B;  2BWF A;  2PVO D;  2K25 A;  2ZPN A;  3JSV A;  3IFW B;  2KJ6 A;  2MBE A;  3LJ3 A;  2WDQ B;  2VRR B;  4BVU C;  2WXO A;  1XLP A;  1EF1 A;  4YSY B;  2BGF A;  4WUR A;  4YTN B;  3AE8 B;  2IO0 B;  4R3D A;  3C8Y A;  3PV1 A;  2J42 A;  1JML A;  1HA5 A;  3ZDM C;  1GNU A;  2Z0E B;  1OQY A;  2JQR B;  3TEW A;  1IBX B;  3IHP C;  4JX1 C;  2VH1 A;  3SD5 A;  3AU4 A;  4II3 B;  3AEF B;  2FCN A;  2AQ2 B;  4KIK A;  2SAK A;  1N5W A;  1FM0 D;  4W9G A;  1XCT L;  5C3J B;  2O6V A;  2MBB B;  2YEP F;  1WWT A;  1F9J A;  4W9I A;  3ZKJ C;  3TEX A;  4ACF A;  2MJE A;  1BML C;  3IXS A;  2KYW A;  2OOB B;  2MH7 A;  3OLM D;  1SSN A;  1EO6 A;  3VRA B;  3AE1 B;  1WGG A;  4MH8 A;  1FNU A;  3LXF A;  5FR3 A;  1Q10 A;  5LXI B;  3AE7 B;  3DWG C;  2BVC A;  4B0E A;  5BYR A;  1WM2 A;  3ABV B;  5IAA C;  1WFY A;  2N9E B;  1BT0 A;  4LDT D;  4N58 A;  5E6N A;  1RRB A;  1XLN A;  1N62 A;  2IPK D;  1P7E A;  4JQW C;  3CMM B;  3APD A;  1FXA A;  2KDF B;  5J17 A;  5L83 A;  4KKJ A;  3R3M A;  3QIJ A;  4F8C B;  2J0J A;  1E8Y A;  2KDI A;  3EFU A;  4PYZ A;  1C1Y B;  1YN3 A;  4ICU A;  1JCK B;  4ARC A;  1PQS A;  3VRB B;  4TUU A;  1ZPS A;  2WX0 A;  2KJR A;  2DZK A;  1D6E C;  3T8M A;  1YX6 B;  4CQN A;  5H8Y E;  3P4P B;  4OZC A;  3A33 B;  3PRM B;  3EA6 A;  2A4Z A;  2AWT A;  4NJ6 A;  2Y3A A;  3P4Q B;  5TSS A;  1UWM A;  1WSP A;  4JPS A;  2ZNV B;  2DBY A;  3QAQ A;  2D10 A;  1VD2 A;  1WXQ A;  5C1Z A;  2LRU A;  4W9K A;  2V3N A;  1MHX A;  2N1V A;  4FBJ B;  4OVU A;  3UIO B;  2FIF A;  1SE3 A;  2D3G A;  5MPO A;  1JRO A;  3DBL B;  3FIL B;  1FIQ A;  2WU2 B;  2KD0 A;  3R7Q A;  4AS1 A;  1YJJ A;  1TT5 B;  3RNB C;  3EHV A;  1RFK A;  4WWN A;  1YN4 A;  1HQR D;  1ZDV A;  5JHA A;  3K9O B;  1G6J A;  1F1H A;  1IGD A;  2MSE D;  4IM3 A;  1WGY A;  2NTT A;  2I1J A;  2MWS B;  5D2M B;  1WYW B;  1E7V A;  1FCC C;  5LXH A;  4K7S A;  4K81 A;  3Q3M C;  4FHJ A;  3SU8 X;  3JYU A;  3QC8 B;  3DCG A;  2DHZ A;  5IA7 A;  1KH0 A;  3MJW A;  2LJ5 A;  1QIL A;  1TGZ B;  4KSL C;  2JYE A;  2BYE A;  2L00 B;  2FNJ B;  3DVG X;  4GSW A;  2M56 B;  5JHB A;  2C7N B;  3I3T B;  2K8C A;  1PDX A;  1TJE A;  4MGI E;  3NS1 A;  2N1W A;  2MBO A;  1QOG A;  3NVZ A;  1WIA A;  4KGS A;  2WS3 B;  1GC7 A;  1B1Z A;  4MAC A;  1E8W A;  2BBC A;  2QHO A;  3O13 A;  5HI1 A;  1SJH D;  2LJI A;  1NI3 A;  4H2A A;  4EUT A;  3EEC A;  1MG4 A;  2JRH A;  2I1K A;  2RR9 A;  2KOX A;  2W9N A;  3W1S A;  1E5W A;  1QT9 A;  1QLB B;  4ZYN A;  2V3P A;  4P16 A;  1LM8 B;  1WMH B;  1OEY A;  2LVQ A;  1IUE A;  1Q1O A;  5BYQ A;  1DYQ A;  5E6O A;  4HKQ A;  4KDI C;  1IGC A;  4A6Q A;  3PSE B;  3BK1 A;  3RPF C;  5JZE B;  4W9C A;  1SXT A;  1TS2 A;  4JL9 A;  3KYC D;  4KX6 B;  3FKY A;  1HTQ A;  2K8H A;  1RYJ A;  3BY4 B;  4ITK A;  3ALB A;  3Q8C A;  3HIZ A;  3HM3 A;  2KWC A;  2M17 A;  3DBR I;  5D6J B;  2O2V A;  3AI5 A;  3DVG Y;  4EE2 A;  4OW0 A;  3FAH A;  3H6N A;  3VAW A;  2JY6 A;  4GIV A;  1I7H A;  2Y5P A;  4GXB A;  2NTS A;  4HJG E;  1BXT A;  2LGI A;  2DX5 B;  3EC8 A;  1SGH A;  2RPQ A;  2Z0D B;  1K52 A;  1S3S G;  2GLS A;  1WRI A;  2FUG 1;  3UI3 A;  4II2 B;  3M95 A;  1OQR A;  2TSS A;  1WH3 A;  1J7C A;  3RI7 C;  2NMQ A;  2K5P A;  5DPW A;  3AE2 B;  1N5X A;  3NVW A;  3ZRC A;  4IUM B;  2M8S A;  4IC7 B;  4HK2 A;  5IN7 A;  3SDL C;  3N1X C;  4DXG A;  2RDB C;  2A5U A;  1XLO A;  4RF1 A;  4GOC A;  2J4X A;  4I6N B;  4XX5 A;  2PE9 A;  4G11 A;  3OWE B;  2FE8 A;  1TYG B;  2C7H A;  1RLF A;  3WIM A;  2HJ1 A;  4JE3 B;  3R2I A;  2UWQ A;  3OJ4 B;  2DNF A;  3UIP B;  3P42 A;  5CTR C;  2NBV B;  2IO2 B;  1L0V B;  2LXC A;  3RMK C;  3P4R B;  4WAA A;  2D3C A;  4GB9 A;  2G3Q B;  4ZHO A;  2RDG A;  5LLI A;  3W5U B;  1IP9 A;  2JU6 X;  3X23 A;  2KZR A;  2K8B A;  3TIX A;  3QQ8 B;  2BQQ A;  2BYT A;  1D5M C;  2HE7 A;  3AMZ A;  1VRA B;  4NNJ B;  3DBH I;  2KWV B;  3B08 A;  3A9J B;  4DK5 A;  3PZD A;  4B0M A;  1OFF A;  4ZHP A;  2QC8 A;  4RM8 A;  3TUO A;  4PS7 A;  3PVL A;  4PYU A;  3O65 B;  2NCN A;  2L8J A;  2K6Q A;  2GBJ A;  2D3A A;  3LDZ E;  3VUY A;  3BK2 A;  3RNC C;  1TS4 A;  4XGA B;  3N20 C;  1C3T A;  3ONS A;  1XQQ A;  4EEW A;  1MI0 A;  3RZW C;  1HEZ E;  5T8I A;  2YVC A;  3ZJU A;  5TR5 A;  4I6L B;  2QIE B;  4MT5 A;  2WXN A;  3IAM 1;  3AH7 A;  4NY0 A;  1ZXI A;  4KSK C;  1I4Q A;  4BBN F;  4C4V A;  4HRS A;  3VXW A;  2R2O A;  1YJI A;  4HKZ E;  4XZ4 A;  1S1Q B;  5AZG A;  4ARI A;  1R4N B;  5CHF A;  4KKI A;  2IYD B;  1T6B X;  4B9K A;  3WAL A;  1WX9 A;  4W9J A;  3NZU A;  1EU3 A;  4E74 A;  3PGE A;  4WWM A;  4X57 B;  3U8Z A;  4NJ7 A;  2E3T A;  1J0G A;  3RUI B;  3P63 A;  5JXV A;  3BII D;  4J6I A;  4HDO A;  4DHZ B;  2PLP A;  4KZC A;  4DHZ E;  2M1M A;  4MSQ B;  3Q8F A;  3HK0 A;  1WXA A;  2ZW1 A;  3DVN U;  3CIR B;  4MGZ E;  5AUK A;  2D2Q A;  3VFK A;  4LCD E;  2AEH A;  3TJP A;  1I42 A;  1QKZ A;  2KX0 A;  3W5V B;  4Q2J A;  1FD6 A;  4FA6 A;  4FAD A;  3MTN B;  4A20 A;  3ZJV A;  3UIN B;  1C76 A;  4DDI D;  2KWU B;  1L2N A;  3AEE B;  3AEC B;  1VZ8 A;  3L16 A;  5IO9 A;  4ZDV A;  2FUH B;  1PGX A;  2W3R A;  3BWU D;  3PHW B;  2K3U A;  4DDG D;  4KGT A;  3L0W B;  4GDL A;  3VTU A;  1GB1 A;  3PZ8 A;  3I5J C;  2AL3 A;  1XF5 L;  3NG0 A;  4IM2 A;  1YN5 A;  2CS4 A;  2REX A;  4FJZ A;  3AEB B;  1H4R A;  3ZJT A;  2KFK B;  5HG2 A;  4TSS A;  1V1O A;  3DBS A;  2MP2 A;  2KQ7 A;  2WU5 B;  1QOA A;  4JGH B;  2LUE A;  2KMC A;  5D3I B;  1VZ6 A;  4K7W A;  4WJO A;  2Q5W D;  3N9Y C;  3A1Q B;  3RUL A;  4NAW B;  2IDY A;  2L32 A;  2J53 A;  2KDE B;  2LGD A;  4RFB A;  3OG5 A;  3V62 A;  1ZDX A;  4XWT A;  2AQ1 B;  3T3N A;  3MHS D;  4D2K A;  4OHJ A;  2E6X A;  3EUB 2;  4HDQ A;  3BVM A;  1T0Q C;  2BB6 A;  3LB8 C;  1STE A;  2FAZ A;  3GZN I;  4MSM B;  4NZL B;  1OQQ A;  2XK5 A;  2ON8 A;  4F7Z A;  3AE3 B;  4YTM B;  1RM6 C;  2M19 A;  3L08 A;  2JYT A;  4MM3 B;  4GLS C;  2DLB A;  2J0M A;  1WI0 A;  2L52 A;  1UUP A;  4RGM A;  3ETR A;  5DPR A;  3NS8 A;  4M8M A;  2KXJ A;  2LFI A;  2LGY A;  4GDK A;  4LLG M;  3KUC B;  4RCO A;  1KRH A;  3PS6 A;  1C4A A;  2W55 A;  4E3C A;  4ZOH C;  1P9D U;  3TBL D;  2KC1 A;  1NDD A;  1YNT E;  2WP9 B;  3MFG A;  1N60 A;  4EZL A;  2AYO B;  5CHV C;  3H7P A;  2JRI B;  4BAX A;  2J7Q B;  3H1U A;  4M0W B;  3IT6 B;  3KLS X;  1QQR A;  3KYD D;  3U7Z A;  4USA A;  1WJ6 A;  2G4S A;  1J8C A;  2K0P A;  2KX3 A;  2AX5 A;  4TQ0 A;  2M0A A;  1UZX B;  1VLB A;  2L7R A;  2RDH A;  4OVV A;  3Q3F A;  1MG8 A;  3PRZ A;  4REZ A;  1WM3 A;  2WXI A;  5D3D A;  2R61 A;  3A4S C;  3QWZ B;  2CHX A;  1K50 A;  1V9J A;  3MC8 A;  4F1S A;  1TY2 A;  3AE4 B;  3CSF A;  1C4P A;  4AOF A;  5GXG B;  2HTM E;  3VTV A;  1C4C A;  2KAC A;  2CJN A;  4M01 A;  4NQL B;  2L05 A;  1HTO A;  1SE9 A;  2ZVO A;  1LFD A;  3PRE A;  1M4V A;  3HRD D;  3NRZ A;  2HJ8 A;  3GOE A;  1MHH E;  4WAF A;  1ZW7 A;  3IVF A;  1SB3 C;  3PLU A;  4KZ0 A;  3A4R A;  1XEE A;  4E71 A;  1WF9 A;  2BS3 B;  3A9K B;  1C77 A;  2LMC A;  4HWI B;  5E6P A;  4LNF A;  3ZVV A;  1EF5 A;  4DWF A;  1V49 A;  1YQ4 B;  3ZUN A;  1TZ1 A;  1GC6 A;  3DHI C;  1NI2 A;  2ZEQ A;  3RD2 A;  1ZUD 2;  4GU2 A;  1WE7 A;  2JZ3 B;  3CST A;  3ZNZ B;  2CHZ A;  1P7F A;  1K53 A;  1DOX A;  2BTE A;  2X38 A;  5AZH A;  5H92 C;  1NYR A;  3KH0 A;  4WJQ A;  2FCS A;  2DYB A;  4OVZ A;  3PRP B;  3N1Z C;  2V1Y A;  3RNG C;  3ZNG C;  4DXA B;  3MC0 B;  1FRD A;  1V1P B;  2CU1 A;  1UNS A;  2ZNV C;  3X0W A;  4LK0 M;  1T5X D;  5JH5 C;  1L4Z B;  5HHD G;  5IOI A;  1T0S C;  4CO7 A;  4IWQ A;  1VCB A;  4ANU A;  3R7R A;  4MJS B;  1OGW A;  4K3B A;  1F0Z A;  3D32 A;  4LJO B;  3ZIM A;  2OJW A;  2NPT A;  1C79 A;  4BOS C;  1CK1 A;  1NYQ A;  2V0G A;  1PFD A;  2N7E A;  2PEA A;  2IGH A;  4JWU C;  3PZ7 A;  2L1A A;  2DAF A;  2MW5 A;  5G55 A;  1NEK B;  2C5L C;  3JSV B;  5C2T B;  2WXQ A;  2N7D A;  3E56 A;  2GB1 A;  5G5H A;  4GN1 A;  3Q14 C;  3WAO A;  1E90 A;  2MCN B;  1D5X C;  5FKA C;  2QIL A;  2NVU I;  3ECI A;  1GOZ A;  2W82 A;  3GS2 A;  2JWU A;  4RF0 A;  1K51 A;  3BVG A;  1JWU D;  2FCM A;  4YSX B;  2N9K A;  1V86 A;  3H8H A;  2J0K A;  3ZNH B;  2VH2 A;  3B2G A;  2WXM A;  2UU7 A;  4M8N A;  2CJO A;  2KNB A;  2AL6 A;  4KIK B;  4RGO S;  2KN4 A;  2O6V B;  3AB5 A;  2WYQ A;  3ML8 A;  3B0A A;  4BZA A;  2L0T A;  1N63 A;  1C78 A;  1HZ5 A;  4A8X C;  1AYF A;  1GG3 A;  2ZW0 A;  2DZI A;  5KHQ A;  2V4I B;  2KMM A;  4LNK A;  3AV8 A;  2GOW A;  1WX7 A;  1YIW A;  2KVZ A;  1V6E A;  3RCZ A;  1SEB D;  2C9W B;  2ZZP B;  4GMV A;  2WDR B;  3ZQ4 A;  2KLG A;  2PTL A;  4LNO A;  1Z5S B;  3L13 A;  2JUO A;  4A90 A;  3TMP B;  1NBF C;  4IWO A;  3VH4 B;  3RFZ B;  3UQB A;  2KDB A;  2KTR B;  2GI9 A;  4UDU C;  2KJH B;  4IW0 A;  3KW5 B;  1D3Z A;  1WJN A;  4HPM B;  3WAP A;  2EKI A;  4KDL B;  3BYY B;  3V6C B;  4MEL A;  1GB4 A;  1V81 A;  1UD7 A;  1P3Q U;  4ZRQ A;  3CWI A;  2G1E A;  1PGA A;  1TKY A;  3QX1 A;  1XD3 B;  2M4N A;  4DHJ B;  2LUM A;  2RGF A;  4BKS D;  1TZO A;  1QOF A;  4WIP A;  4KVG B;  2XEW A;  1UBQ A;  1FPY A;  3QJZ A;  1I4P A;  2W54 A;  5G2N A;  4BFR A;  1I4G A;  3SFD B;  1Q0W B;  3VTW A;  1IBX A;  4M00 A;  1R4M I;  4RH6 A;  3RNE C;  1UEL A;  2X8X X;  3VR8 B;  1PGB A;  1RFA A;  1JQ4 A;  3RNF C;  1Z2M A;  1F2R C;  3JVZ X;  1EUV B;  3RYT A;  4W9H A;  1UF0 A;  1WGH A;  2H88 B;  2WXG A;  3V6E B;  1AAR A;  4EKU A;  1T3Q A;  3NZ3 A;  3V05 A;  5EE9 A;  4P1C C;  3WAM A;  4FJV B;  4RGN A;  1JRU A;  4W9D A;  4AP4 C;  3ZLZ A;  2Z59 B;  2K22 A;  4GGQ A;  2BWE S;  3VQI A;  5DPT A;  5FR6 A;  2N9L A;  4C80 A;  1E10 A;  3ZYY X;  3MC9 A;  2V9H A;  4XC2 A;  4S17 A;  3NVY A;  3U30 A;  4N6E B;  1ZGU B;  3QHT A;  3V3X A;  1KLU D;  2KTF A;  2WXH A;  1E8Z A;  4XDD A;  2L3Z A;  3B2F A;  3U52 E;  2D5G A;  1L7Y A;  5D7G A;  3R2T A;  2LI5 A;  1WXV A;  1ZKH A;  4IWP A;  1N61 A;  4RNA A;  2N9X A;  2KLC A;  1ZE3 D;  1Q5W B;  2DYM A;  2KN5 A;  3AN1 A;  2KFJ A;  2CU3 A;  4L23 A;  3IAS 1;  1CZP A;  2LHD A;  4A3O A;  1OEY J;  1VZ7 A;  3TEY A;  3P2B A;  2JXT A;  4BKS A;  2D07 B;  5HKH A;  1V5T A;  1OTR B;  2JWZ A;  1UBI A;  4HLE A;  1JWB D;  2ONQ A;  3AU5 A;  3DWM A;  4B6W A;  2B3A A;  2PIA A;  1L0Y B;  4WWP A;  1P98 A;  2PMV A;  3DBR B;  2KK8 A;  4S0R A;  3Q3N C;  3S2A A;  1YQB A;  1WX8 A;  4URK A;  2IGD A;  3FIL A;  2JVC A;  3I57 A;  3HVZ A;  3BIN A;  1XXG A;  2PVG C;  1TTN A;  5C23 A;  1WY8 A;  4C7Z A;  5I4D A;  1WYG A;  3KVF B;  4MH0 E;  4PT5 A;  4HPP A;  3P1M A;  1WJU A;  4MEM A;  5KHO A;  2EMS A;  2INP E;  1ACC A;  2RPV A;  2MJD A;  1EWC A;  1WXM A;  2H89 B;  4QAY A;  2KMA A;  3VR9 B;  3LYY A;  4MGY E;  5CX3 A;  2KKC A;  3WA0 A;  2O2V B;  1XT9 B;  3M3J A;  2LRW A;  2ZPY A;  3SR6 A;  2KT7 A;  3RN9 C;  1SF0 A;  3R8B A;  4N9F 4;  3WAN A;  3NOB A;  1V80 A;  3AXC A;  2GBK A;  3TEZ A;  5G5G A;  4ZYS A;  3I63 C;  3GB1 A;  3MHZ A;  2FCQ A;  1L6U A;  5DPS A;  4LNN A;  5AZF A;  4LJP B;  1YD8 U;  1VJK A;  5AEK B;  3U4E G;  4FXC A;  3VUW A;  3Q8B A;  2MLB A;  2PE6 B;  2I38 A;  1E7P B;  2RMM A;  4ANW A;  4PK1 A;  3OAW A;  2L0F A;  5IKC M;  2XN9 C;  3VH3 B;  1ROE A;  1E0Z A;  2G4D B;  1VDV A;  2XBB C;  1R4M B;  3ENE A;  3ML9 A;  2WXL A;  1F77 A;  1TBE A;  1J19 A;  1AWD A;  1SE2 A;  2MBQ A;  3DBH B;  2BKF A;  1WMH A;  4DHJ D;  4P7I A;  1H8C A;  1SBB B;  2FBW B;  4WQM A;  4JIO U;  1LQB A;  5J2R A;  1CJE A;  3V60 A;  2IY0 B;  2L76 A;  4K1R B;  4YT0 B;  1T0Y A;  3KWL A;  5AUI A;  1ENF A;  4YWG G;  3QAR A;  1FFV A;  2V4L A;  2OJR A;  2N4F A;  1E9M A;  1V5O A;  4O1N A;  1KOT A;  2YEP B;  3Q8E A;  1I4H A;  1VR9 A;  4L1B A;  4TKN A;  1X1M A;  3TL5 A;  4DXF A;  1QOB A;  4L2Y A;  3UQA A;  2OHF A;  3RT3 B;  4CYE A;  4TQ1 A;  2VZK B;  5EE3 A;  4JWS C;  1KM7 A;  4PS3 A;  1ZP0 B;  5J18 A;  1R7S A;  1WRD B;  1J7B A;  4MGK E;  3KUD B;  1TS3 A;  1HXY D;  2G45 B;  3AE5 B;  3SEB A;  3ZXR A;  3VUX A;  3HM6 X;  3R66 C;  3PPA A;  2GMI C;  3MP9 A;  4WJN A;  2KO3 A;  1P1A A;  1KF6 B;  3AUL A;  3N32 A;  3N3K B;  1FNW A;  1AN8 A;  4AUQ C;  4I6P A;  3AE9 B;  3HVD A;  2GBM A;  1I35 A;  1A5R A;  2MRP A;  3KUZ A;  2BW2 A;  1ET6 A;  2CR5 A;  1V8C A;  2KTR A;  1FFU A;  2BB5 A;  4XWW A;  3APF A;  3RNA C;  3L4P A;  2IY1 B;  5BMH A;  3Q2A C;  4ASW C;  2MBH A;  1YQ3 B;  3WCQ A;  2PW9 A;  2QEJ C;  1FCL A;  4C4V B;  4IM0 A;  2JSV X;  2WDT B;  1F2R I;  4AJY B;  3C19 A;  4BKT A;  2KAJ A;  1I4X A;  4HVB A;  3AM9 A;  2MEK A;  1RWS A;  2NR2 A;  4NPN A;  1L5P A;  1WXS A;  4US8 A;  4C7Y A;  3P4S B;  2N9P C;  1MVK A;  3KWV A;  4DQO C;  1EM7 A;  3Q3O C;  1KJT A;  1YX5 B;  5BMI A;  3A9J A;  1WJ4 A;  3IBE A;  1KLG D;  2BKR B;  3PO0 A;  2MJ3 A;  2IBI B;  3BYT B;  4EOY A;  4AWJ A;  4YTP B;  4FN2 A;  1FO4 A;  3DPD A;  1B9R A;  4ZRJ A;  2DZJ A;  3W9C B;  3PT2 B;  4RMA A;  2LVP A;  2NBU A;  4XYC A;  2JZP A;  1J7A A;  1KLV A;  3EGR A;  5DCN A;  1DGJ A;  2FID A;  3TCA A;  1V97 A;  4HCN B;  4A9A A;  2NBW B;  2LHE A;  4GDL B;  1QF6 A;  3ZW3 A;  1NVI D;  1UWX A;  1N6Z A;  1SJE D;  2N0S B;  3NVV A;  4G50 A;  4WWO A;  4K7U A;  4N59 A;  3ZDT A;  3NJT A;  2WHI A;  1BUI C;  2WDV B;  2K9X A; 
#chains in the Genus database with same CATH homology
 3HK0 A;  1WM2 A;  3QJZ A;  5IAA C;  2EMT A;  1WFY A;  1WXA A;  1BT0 A;  2N9E B;  3DVN U;  4LDT D;  4MGZ E;  5E6N A;  1RRB A;  5G2N A;  4HCP B;  4BFR A;  4CHK A;  2D2Q A;  1GJZ A;  4WQO B;  3NZS A;  3VFK A;  4LCD E;  4JQW C;  2AEH A;  1Q0W B;  3APD A;  3CMM B;  2ZCC A;  3TJP A;  3VTW A;  2IZV B;  2V3S A;  1R4M I;  1I42 A;  2KX0 A;  2KDF B;  5J17 A;  5L83 A;  2M0X A;  3R3M A;  1UEL A;  4FA6 A;  4FAD A;  3QIJ A;  2MP2 B;  4F8C B;  3MTN B;  2J0J A;  4A20 A;  1E8Y A;  2KDI A;  3EFU A;  4PYZ A;  1C1Y B;  4ICU A;  3UIN B;  4DDI D;  2KWU B;  4MSQ B;  1ISN A;  1SIF A;  1PQS A;  1RFA A;  4TUU A;  1L2N A;  1Z2M A;  2WX0 A;  2KJR A;  3L16 A;  3JVZ X;  1EUV B;  2BYV E;  3RYT A;  3IG3 A;  2DZK A;  2FUH B;  4W9H A;  4ZDV A;  4TV3 A;  1WGH A;  2MX2 A;  3T8M A;  3PHW B;  4DDG D;  3L0W B;  1YX6 B;  4GDL A;  3V6E B;  1AAR A;  3VTU A;  3W1Y A;  2GBN A;  4EKU A;  2Y5B B;  2AL3 A;  2ZCB A;  4EFO A;  2NS5 A;  3WAM A;  3K9P B;  4FJV B;  3A33 B;  1JRU A;  2K1F A;  4IG7 B;  3PRM B;  4W9D A;  4AP4 C;  3ZLZ A;  4IM2 A;  1WGD A;  2Z59 B;  2A4Z A;  4GGQ A;  2AWT A;  2BWE S;  4NJ6 A;  3VQI A;  2CS4 A;  2REX A;  4FJZ A;  5DPT A;  5FR6 A;  1E7U A;  1R4N I;  1H4R A;  2ZNV B;  2RD0 A;  3QAQ A;  2KFK B;  4FHK A;  2XK5 B;  3PLV A;  2D10 A;  1VD2 A;  4XC2 A;  3U30 A;  5C1Z A;  1V2Y A;  1HE8 A;  1ZGU B;  2LRU A;  3QHT A;  3NHE B;  4W9K A;  2KTF A;  2N1V A;  4FBJ B;  1IPG A;  1E8Z A;  2MA9 B;  2L3Z A;  3DBS A;  4OVU A;  3UIO B;  2MP2 A;  2KQ7 A;  2FIF A;  1L7Y A;  4JGH B;  1WR1 A;  2KAN A;  2LUE A;  2D3G A;  2KMC A;  5D7G A;  2LWP A;  2WWZ A;  4K7W A;  2M1M A;  2LI5 A;  3U7D A;  4GDK B;  2C7M B;  4WJO A;  1WXV A;  3L17 A;  2YLM A;  1ZKH A;  3VHT C;  4IWP A;  3A1Q B;  3RUL A;  2KD0 A;  3SHQ A;  3R7Q A;  4NAW B;  2N9X A;  3EHV A;  2KLC A;  5L95 C;  2KDE B;  2LGD A;  4WWN A;  1Q5W B;  2DYM A;  2BYF A;  2KN5 A;  2KFJ A;  5JHA A;  3V62 A;  3K9O B;  1G6J A;  2KHW B;  2DYO A;  4A3O A;  1OEY J;  4IM3 A;  2MSE D;  4B95 A;  1IYF A;  3MHS D;  4G0N B;  4YL8 A;  1WGY A;  5D2M B;  2I1J A;  1CMX B;  2MWS B;  1WYW B;  3JW0 X;  1E7V A;  5LXH A;  3H7P B;  3P2B A;  4K7S A;  4K81 A;  4BKS A;  4HDQ A;  2HTH A;  2D07 B;  1QZE A;  2MQJ A;  4FHJ A;  5HKH A;  3VVW B;  1V5T A;  1OTR B;  2PJH A;  2JWZ A;  3SU8 X;  2FAZ A;  1UBI A;  3GZN I;  3JYU A;  3QC8 B;  3DCG A;  4HLE A;  2UYZ B;  3PHX B;  4MSM B;  4ICV A;  3N30 A;  2DHZ A;  2KFK A;  5IA7 A;  2XK5 A;  3MJW A;  2LJ5 A;  3AU5 A;  3PTF C;  4B6W A;  4F7Z A;  1TGZ B;  2B3A A;  4KSL C;  4HJK A;  1E8X A;  2WX1 A;  2BYE A;  2L00 B;  2FNJ B;  3DVG X;  3L08 A;  4WWP A;  4GSW A;  5JHB A;  2ZVN A;  1P98 A;  2D11 A;  2C7N B;  3I3T B;  3QA8 A;  2J0M A;  1WE6 A;  2DZM A;  2K8C A;  1WI0 A;  1WZ0 A;  2KK8 A;  4MGI E;  2RSU A;  3S2A A;  5DPR A;  1YQB A;  3NS8 A;  1WX8 A;  4M8M A;  4URK A;  2KXJ A;  2LGY A;  4GDK A;  2JVC A;  2MBO A;  2N1W A;  2PPH A;  2KC2 A;  3A1Q A;  3KUC B;  3PS6 A;  4NAW A;  1WIA A;  2GBR A;  2BPS A;  3BIN A;  1UGM A;  1TTN A;  4BKG A;  3VH4 B;  3APC A;  4E3C A;  1P0R A;  1P9D U;  4HXD A;  5C23 A;  3TBL D;  2KC1 A;  1GC7 A;  1NDD A;  1WZ3 A;  1WY8 A;  4EZL A;  2KVR A;  2AYO B;  2LD9 A;  5CHV C;  1E8W A;  3KVF B;  4MH0 E;  3H7P A;  2JRI B;  1Y8R C;  1WJU A;  2QHO A;  4MEM A;  2J7Q B;  5KHO A;  2EMS A;  3H1U A;  4M0W B;  1WXM A;  3M62 B;  3KYD D;  2JXX A;  2KMA A;  4EUT A;  3EEC A;  2JT4 B;  1WJ6 A;  2G4S A;  3VDZ A;  2JRH A;  2I1K A;  2RR9 A;  4MGY E;  5CX3 A;  1GUA B;  2KOX A;  2KKC A;  2W9N A;  3W1S A;  1J8C A;  2KX3 A;  3WA0 A;  4TQ0 A;  1UZX B;  2O2V B;  1XT9 B;  1E5W A;  2LRW A;  2ZPY A;  3M3J A;  2L7R A;  1U4A A;  4OVV A;  4ZYN A;  4MM3 A;  3Q3F A;  4ZRI A;  1MG8 A;  3PRZ A;  1WM3 A;  4W9F A;  1LM8 B;  1WMH B;  4N9F 4;  1OEY A;  2LVQ A;  3WAN A;  1Q1O A;  3A4S C;  3QWZ B;  2JF5 A;  2CHX A;  3NOB A;  4MDK E;  1V80 A;  3AXC A;  1V9J A;  2IO1 B;  2JZZ A;  5E6O A;  2DEN B;  2GBK A;  4F1S A;  4KDI C;  2FCQ A;  3Q3J A;  3CSF A;  4BOZ B;  5DPS A;  5AZF A;  4AOF A;  3C0R B;  3VTV A;  4LJP B;  4JLC A;  4NQK E;  3PSE B;  1FXT B;  3RZF A;  2BF8 B;  1YD8 U;  5AEK B;  2ZJD A;  3VUW A;  4NQL B;  5JZE B;  2L05 A;  2MLB A;  2DAJ A;  2LVO A;  1SE9 A;  2PE6 B;  4JL9 A;  2ZVO A;  4LDT B;  4W9C A;  3KYC D;  1LFD A;  3PRE A;  2K8H A;  4ANW A;  2HJ8 A;  3GOE A;  3DDC B;  3BY4 B;  3OAW A;  5J2R A;  1ZW7 A;  2L0F A;  3ALB A;  3HIZ A;  3HM3 A;  2KWC A;  2M17 A;  3VH3 B;  3DBR I;  3IVF A;  3UGB B;  2G4D B;  5BO4 B;  2XBB C;  3PLU A;  5D6J B;  4KZ0 A;  2O2V A;  3ENE A;  3ML9 A;  3A4R A;  3OJ3 A;  4E71 A;  3AI5 A;  1WF9 A;  1TBE A;  3A9K B;  3DVG Y;  3H9D A;  1J19 A;  2CKH B;  4PS8 A;  3H6N A;  4HWI B;  5E6P A;  2JY6 A;  2MBQ A;  3VAW A;  2ASQ A;  3ZVV A;  2BKF A;  1WMH A;  3L10 B;  4GIV A;  1EF5 A;  3T9L A;  4DWF A;  4GXB A;  4DHJ D;  4P7I A;  4EZK A;  1H8C A;  1V49 A;  3ZUN A;  4FUL A;  1TZ1 A;  4JIO U;  1GC6 A;  2DX5 B;  1LQB A;  1SGH A;  2RPQ A;  2Z0D B;  1NI2 A;  2ZEQ A;  3B1L X;  1S3S G;  3EC8 A;  2IY0 B;  2L76 A;  3QK0 A;  4K1R B;  3RD2 A;  1T0Y A;  2LGX A;  4GU2 A;  3V60 A;  3ZTD A;  1WE7 A;  4AJW A;  2JZ3 B;  3QAR A;  3CST A;  4II2 B;  2NPT B;  2V4L A;  2OJR A;  3M95 A;  2N4F A;  1WH3 A;  4KV2 A;  1V5O A;  1KOT A;  3ZNZ B;  4EZJ A;  2CHZ A;  4TKN A;  5CHW A;  5DPW A;  1X1M A;  3TL5 A;  3UF8 A;  3ZRF A;  3H7S A;  5AZH A;  3UQA A;  3HHM A;  4RM9 A;  3RT3 B;  3DQV A;  3KH0 A;  4WJQ A;  4CYE A;  2FCS A;  2DYB A;  4TQ1 A;  1LXD A;  3PRP B;  3ZRC A;  4IUM B;  2V1Y A;  5EDS A;  1KM7 A;  2M8S A;  4IC7 B;  3V61 A;  3ZNG C;  4DXA B;  4HK2 A;  1WRD B;  5J18 A;  4MGK E;  3SDL C;  3KUD B;  2CU1 A;  3A9K A;  2ZNV C;  2A5U A;  3X0W A;  1UH6 A;  2G45 B;  2K6D B;  4GOC A;  2EKE C;  4I6N B;  4WJP A;  4XX5 A;  5JH5 C;  2PE9 A;  3VUX A;  3HM6 X;  3R66 C;  4ZRK A;  4G11 A;  2K39 A;  2GMI C;  3PPA A;  3CF6 E;  4CO7 A;  4IWQ A;  4WJN A;  2KO3 A;  1VCB A;  4ANU A;  3R7R A;  2IO3 B;  4MJS B;  1P1A A;  1OGW A;  2C7H A;  1RLF A;  3AUL A;  2JPH A;  3WIM A;  3N32 A;  3D32 A;  4LJO B;  2O6V D;  3N3K B;  3ZIM A;  2LXA A;  2NPT A;  2UWQ A;  3NY5 A;  4FJY A;  4W9E A;  4AUQ C;  4BOS C;  4W9L A;  3OJ4 B;  3UIP B;  1RAX A;  5CTR C;  2NBV B;  3DVN V;  2R2Q A;  2IO2 B;  4I6P A;  2LXC A;  2N7E A;  4WAA A;  2PEA A;  2GBM A;  1WR6 E;  4GB9 A;  1I35 A;  2G3Q B;  2DAF A;  1A5R A;  2MW5 A;  2MRP A;  3DBL I;  5G55 A;  5LLI A;  2C5L C;  3JSV B;  3KUZ A;  1IP9 A;  2N7D A;  2KZR A;  3X23 A;  2K8B A;  2CR5 A;  3TIX A;  3QQ8 B;  4BBN C;  2HE7 A;  2KTR A;  3DOW A;  4GN1 A;  4NNJ B;  1E90 A;  3WAO A;  2MCN B;  3APF A;  3DBH I;  2KWV B;  2IY1 B;  3B08 A;  4A3P A;  4ASW C;  3A9J B;  2NVU I;  3ECI A;  4DK5 A;  3PZD A;  2MBH A;  4G3X B;  3W1S C;  5D94 A;  4DBG A;  2FCM A;  3ZTC A;  4ANX A;  4RM8 A;  5GMV A;  4IM0 A;  2WDT B;  1V86 A;  2J0K A;  3PVL A;  4PS7 A;  1M94 A;  2KQS A;  3ZNH B;  1WGR A;  4PYU A;  3O65 B;  2NCN A;  3M63 B;  2L8J A;  4MJS A;  4AJY B;  1K8R B;  4BKT A;  2K6Q A;  1YJ1 A;  4M8N A;  2KNB A;  2AL6 A;  4KIK B;  2GBJ A;  4HPL B;  2O6V B;  2WYQ A;  3LDZ E;  3QCA A;  2LAS A;  4HVB A;  4ANV A;  3VUY A;  2CHW A;  3ML8 A;  4FLH A;  3ZNI D;  2NR2 A;  2LZ6 A;  3ZO5 B;  3L54 A;  4NPN A;  2C60 A;  2HD5 B;  2BWF A;  2ZPN A;  2K25 A;  1WXS A;  3B0A A;  3ONS A;  1C3T A;  2L0T A;  1XQQ A;  3JSV A;  4EEW A;  2N9P C;  3IFW B;  1GG3 A;  2KJ6 A;  3RZW C;  2MBE A;  3LJ3 A;  2YVC A;  2DZI A;  5KHQ A;  2VRR B;  5TR5 A;  1KJT A;  4I6L B;  4BVU C;  1YX5 B;  3A9J A;  2GOW A;  1EF1 A;  1WX7 A;  1YIW A;  2BGF A;  1WJ4 A;  1V6E A;  3RCZ A;  4NY0 A;  3IBE A;  2C9W B;  2ZZP B;  4GMV A;  4KSK C;  2BKR B;  4BBN F;  2IO0 B;  2KLG A;  3PV1 A;  3VXW A;  2R2O A;  2IBI B;  1Z5S B;  3L13 A;  4XZ4 A;  5AZG A;  1S1Q B;  3ZDM C;  1GNU A;  4EOY A;  2JUO A;  2Z0E B;  1OQY A;  4AWJ A;  3IHP C;  3SD5 A;  3TMP B;  1NBF C;  3AU4 A;  4FN2 A;  4IWO A;  2IYD B;  4II3 B;  3DPD A;  2FCN A;  2KDB A;  4KIK A;  5CHF A;  3UQB A;  2KTR B;  4B9K A;  4ZRJ A;  2DZJ A;  4W9G A;  3WAL A;  1WX9 A;  2KJH B;  2O6V A;  2MBB B;  3KW5 B;  3PT2 B;  4IW0 A;  2LVP A;  1WJN A;  2NBU A;  4HPM B;  4RMA A;  1F9J A;  1D3Z A;  4W9J A;  3NZU A;  4W9I A;  4E74 A;  3WAP A;  3PGE A;  4X57 B;  3U8Z A;  4KDL B;  3ZKJ C;  4NJ7 A;  3V6C B;  4MEL A;  1KLV A;  5DCN A;  2FID A;  1V81 A;  1UD7 A;  3TCA A;  1P3Q U;  1J0G A;  4HCN B;  3RUI B;  2NBW B;  4J6I A;  4GDL B;  3QX1 A;  1XD3 B;  2OOB B;  3OLM D;  4HDO A;  3ZW3 A;  2M4N A;  4DHJ B;  4DHZ B;  2RGF A;  4BKS D;  1WGG A;  4G50 A;  4WWO A;  4K7U A;  3ZDT A;  4KVG B;  4KZC A;  1EO6 A;  4DHZ E;  2XEW A;  5LXI B;  4PS3 A;  1UBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...