3GZNI

Structure of nedd8-activating enzyme in complex with nedd8 and mln4924
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
HHHMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
publication title Substrate-assisted inhibition of ubiquitin-like protein-activating enzymes: the NEDD8 E1 inhibitor MLN4924 forms a NEDD8-AMP mimetic in situ.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/ligase
total genus 19
structure length 79
sequence length 79
chains with identical sequence J
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3gznI00
3L0WB 4FJVB 1V49A 3ZVVA 2KJRA 3QARA 3QX1A 1K8RB 3APCA 2EKEC 2XK5B 2GBRA 4EZLA 4LJOB 2MA9B 3HHMA 2EMTA 1R4NI 2O6VA 1OEYJ 2ZZPB 3QK0A 4KVGB 5DCNA 4KSKC 3A1QA 1WX7A 2KWUB 4NAWA 2ZPNA 3PRPB 2CKHB 4JQWC 3VUXA 2KXJA 4B6WA 4F1SA 4HDQA 3KVFB 3OJ3A 4BVUC 4DK5A 2DYOA 4F8CB 2MW5A 4HDOA 3ZNZB 3WALA 1WGHA 2L00B 3QIJA 4URKA 1HE8A 2GOWA 4M0WB 3EC8A 1D3ZA 4ICUA 2LVPA 5L95C 2M0XA 3VHTC 1E5WA 1EF5A 2IO2B 2FIDA 4RM9A 4WQOB 2GBJA 4W9EA 4HPMB 1RFAA 4NNJB 5E6NA 4NJ7A 2ZJDA 4MH0E 1WZ0A 2C7HA 2IO1B 3U30A 3X23A 4GN1A 4HLEA 5E6OA 4IM0A 4RMAA 2AL6A 4KSLC 1V9JA 2DZIA 4GGQA 1WX9A 3WAOA 2ZNVB 4XC2A 3DBRI 2WX1A 3KUCB 5LLIA 1YX5B 2KVRA 2DZJA 2G3QB 3HK0A 4ZRIA 3JSVB 4IUMB 4P7IA 3ZDMC 5C1ZA 2HJ8A 3X0WA 1WRDB 3DCGA 3PSEB 1C1YB 3OJ4B 3ZNHB 1TTNA 4AUQC 5EDSA 1NI2A 3C0RB 1V2YA 4W9JA 1KOTA 4K81A 4I6NB 2A5UA 4GOCA 1WF9A 2LGXA 2M4NA 1WGRA 3L08A 2JZZA 2KDEB 4KDIC 2KD0A 4FN2A 2YLMA 2KFJA 4K7SA 2KQSA 5JHBA 3PREA 5DPSA 2JXXA 2K8BA 2CHXA 4IWPA 4DWFA 4E74A 2ZVNA 4FHKA 3HM3A 4BKSD 1P9DU 4HWIB 2V4LA 2RD0A 4ASWC 4EEWA 2FCNA 5J2RA 4G0NB 2LD9A 2FCSA 2FCQA 4RM8A 5AZHA 3RZWC 2AL3A 2KDBA 3B08A 4I6LB 2PE9A 3QWZB 3R7QA 3I3TB 4IW0A 2O2VB 1EUVB 2JT4B 4MGIE 4A20A 1P0RA 3JW0X 2MCNB 2LWPA 3TJPA 1WR1A 1Q0WB 4MJSA 2KN5A 5AZFA 4MSQB 4AWJA 3CSTA 3Q3FA 1E90A 4MGYE 1J0GA 3PHWB 3ALBA 3LDZE 2KJHB 5C23A 3DBSA 3L16A 5J17A 1UH6A 2W9NA 4IM2A 4BKSA 4KDLB 3K9PB 1E7UA 3ZTCA 1RLFA 2D07B 3IBEA 2V3SA 2G45B 3AXCA 2NCNA 2GMIC 3B1LX 4W9FA 4TQ1A 3M95A 4W9DA 3V6CB 2L76A 2M1MA 1VD2A 4LJPB 4DDID 2D10A 4HVBA 2RGFA 4GDKB 2M17A 2MBHA 3PLVA 4HPLB 4ANVA 2JWZA 2PPHA 4E3CA 2BGFA 2BYEA 2QHOA 2RPQA 2MQJA 3IG3A 4FHJA 2N4FA 2J0MA 3M62B 1OEYA 3LJ3A 3RCZA 5TR5A 2JRIB 5JHAA 2KTRA 3ONSA 1V80A 1WM2A 3RD2A 1LQBA 3CMMB 3SDLC 4NQLB 4CO7A 2AEHA 2MRPA 3O65B 1E8ZA 4DXAB 5DPTA 3QHTA 2JPHA 1E8YA 3ZLZA 2JY6A 1ZKHA 4AJYB 3ZW3A 4AP4C 1UELA 1GG3A 3L54A 3PV1A 2KDFB 2L05A 3UIOB 5CHWA 4KV2A 2FAZA 4KIKB 4PYZA 3RUIB 2DAJA 4LDTB 2CHZA 4WWPA 1WYWB 3DVGY 2L3ZA 1U4AA 2K6QA 2NS5A 4FJZA 4HCPB 2DZKA 2LASA 4GIVA 3VH3B 4EOYA 3A4SC 4EFOA 1OQYA 1UZXB 3IFWB 1M94A 3VTVA 3ZKJC 2WYQA 4DHZB 3KYDD 1RAXA 2C7NB 4MDKE 3NS8A 2L8JA 1H8CA 1YX6B 4N9F4 1UBIA 1XT9B 2JVCA 5CX3A 3EECA 1F9JA 2IO3B 4MSMB 4A3PA 2G4DB 1E8WA 3PZDA 2O2VA 4IM3A 4TQ0A 3ZRCA 4A3OA 3TIXA 4FBJB 4BKGA 1YQBA 3TMPB 3VAWA 3OAWA 3HM6X 3VDZA 3CF6E 3P2BA 3A9JB 3KW5B 3PTFC 1WM3A 3U7DA 3WAPA 2LRUA 3NOBA 2KQ7A 2N9EB 2FIFA 3PVLA 3N3KB 2MP2A 2KFKB 4IC7B 1WJUA 4BBNF 4W9CA 2C9WB 3DPDA 3H7PA 2AYOB 3APDA 3L17A 2BF8B 2N1WA 4JIOU 5KHQA 2KZRA 1AARA 2ZEQA 3KYCD 2KLGA 4W9GA 2LUEA 4W9IA 4WJNA 2NPTA 4ZRKA 3JYUA 2D11A 3V62A 2DYBA 4M8NA 1OGWA 4GDLA 3DBHI 3BINA 2JF5A 4LDTD 4XZ4A 2C5LC 3RZFA 2WWZA 1A5RA 5GMVA 4ZYNA 2N7EA 1RRBA 3MHSD 4WJPA 2KX3A 2LJ5A 3VTUA 3GZNI 1YD8U 4DDGD 3DVNV 3H6NA 4NQKE 3T8MA 1IYFA 1VCBA 4W9KA 1MG8A 4ZRJA 2J7QB 1EF1A 2LVOA 2KMAA 2N9XA 2YVCA 1V5OA 3A1QB 3H1UA 3Q3JA 4HJKA 1E8XA 5KHOA 2NBUA 5IA7A 2CU1A 2D3GA 2DENB 2ZCCA 2XK5A 1KLVA 1Q5WB 2RR9A 4GXBA 2LXAA 3RULA 3ZNGC 3UQBA 4IWQA 2IBIB 4MM3A 2IZVB 3DVGX 1P3QU 2N1VA 2A4ZA 5DPRA 2IY0B 1GJZA 2KTFA 4EKUA 5JH5C 2MSED 2AWTA 1WGYA 1WMHB 4PS7A 5D94A 1I35A 1V5TA 3ML9A 2DYMA 3L13A 2DZMA 3AULA 1TGZB 4K7UA 1FXTB 1GC7A 4II3B 4FA6A 1Q1OA 2G4SA 5AZGA 1SE9A 3VTWA 2MX2A 3SHQA 4FULA 3ZRFA 3VH4B 4EZJA 1LM8B 1WJ4A 1X1MA 4MELA 3U8ZA 5CTRC 3UGBB 1WJ6A 1WXMA 2KWVB 1C3TA 4JL9A 1Y8RC 1GNUA 3PLUA 3RT3B 3QJZA 1UD7A 4W9LA 2PEAA 3OLMD 5D2MB 2WDTB 2HD5B 3UIPB 3QCAA 2HTHA 3ECIA 4J6IA 2N9PC 4BFRA 2DX5B 2MBQA 3JSVA 2Y5BB 4GSWA 4I6PA 3MTNB 3JVZX 2XBBC 2KFKA 2LGDA 1J8CA 1T0YA 3VUWA 3MJWA 2KLCA 1ZW7A 4KZCA 4K7WA 2GBKA 3QAQA 3W1SC 1GUAB 1NDDA 1WGDA 2DHZA 4II2B 4AOFA 4B9KA 1IP9A 3QQ8B 2JRHA 2LI5A 4M8MA 1BT0A 2REXA 2BPSA 2MBEA 2JZ3B 3TBLD 4DHJB 2BWFA 1SIFA 2MBOA 2BWES 3DDCB 3NHEB 4NY0A 2L0FA 2LRWA 3PS6A 1P1AA 1WY8A 2I1KA 5J18A 3ZUNA 2OOBB 2GBNA 5FR6A 1S3SG 4OVUA 4X57B 3UQAA 4GU2A 3DOWA 1XD3B 4G50A 3M63B 5HKHA 2K25A 1UBQA 5CHFA 4EZKA 2NR2A 4EUTA 2K39A 1GC6A 1H4RA 4MJSB 2ZVOA 2MWSB 3RYTA 4DHZE 2V1YA 2BYVE 3PPAA 4W9HA 4ZDVA 4HXDA 3A33B 3V60A 3WA0A 4TKNA 1WJNA 4GMVA 5CHVC 5G2NA 4MEMA 3W1SA 5JZEB 2M8SA 2KK8A 3CSFA 4PS3A 3A9KB 1ZGUB 2WX0A 2KC1A 3VQIA 3A4RA 2KKCA 3UINB 1IPGA 2UYZB 2KJ6A 4LCDE 2CHWA 3VVWB 3AI5A 1WMHA 2CS4A 2R2OA 1WE6A 3ZDTA 3R66C 3PGEA 3NZUA 3H7SA 2C7MB 4K1RB 1J19A 1WIAA 1Z2MA 2BKRB 2EMSA 2NBWB 3D32A 4KZ0A 2KO3A 3K9OB 3EFUA 3EHVA 3ENEA 3WANA 2KX0A 3NY5A 4IWOA 2FNJB 5D6JB 4AJWA 5DPWA 2ZPYA 1V6EA 2Z59B 4WJQA 5G55A 4TUUA 2IO0B 5LXIB 1V81A 1NBFC 2KHWB 3WAMA 4BKTA 3H9DA 2FCMA 1I42A 2KTRB 1QZEA 1TZ1A 2GBMA 4ANWA 4DHJD 4GDKA 3PT2B 3B0AA 4FLHA 4MGKE 3VFKA 4E71A 1YJ1A 2KOXA 3ZNID 3ZO5B 4XX5A 2FUHB 2KDIA 5AEKB 1OTRB 2IY1B 1V86A 2NVUI 1WH3A 3M3JA 1WR6E 2LVQA 2O6VB 2PE6B 3PHXB 1WFYA 2ZNVC 3R3MA 3AU4A 3T9LA 3W1YA 5L83A 3IVFA 4NAWB 3QA8A 1JRUA 3N32A 4G11A 1LFDA 1EO6A 1CMXB 2KANA 2KWCA 4WAAA 4CHKA 1YIWA 4ANXA 4CYEA 2BKFA 3SD5A 2ZCBA 3TL5A 4FJYA 4OVVA 3PRZA 2K8HA 1Z5SB 1KJTA 3KH0A 4WJOA 1L2NA 2R2QA 3BY4B 3QC8B 4KIKA 4NJ6A 1WX8A 4JLCA 4WWOA 1WZ3A 4IG7B 2ASQA 3S2AA 3V6EB 4PYUA 2CR5A 2J0KA 1LXDA 3NZSA 3VUYA 4ANUA 1XQQA 2DAFA 3AU5A 4NPNA 2HE7A 3VXWA 3L10B 1WXVA 4ICVA 4TV3A 2OJRA 2K1FA 4MGZE 3ZTDA 2VRRB 4BOSC 1WE7A 2BYFA 4F7ZA 3SU8X 1L7YA 3GOEA 2N7DA 2XEWA 2PJHA 3R7RA 2K8CA 2JUOA 2MBBB 2Z0EB 3HIZA 3WIMA 2D2QA 2NBVB 4YL8A 2L0TA 4DBGA 5BO4B 1P98A 3ML8A 3DQVA 4JGHB 3N30A 4HCNB 3DVNU 2MP2B 2LGYA 4G3XB 2MLBA 5E6PA 3UF8A 4B95A 1S1QB 3A9JA 2UWQA 1WGGA 3A9KA 3H7PB 4BOZB 1G6JA 4FADA 3PRMB 3KUZA 3TCAA 1R4MI 4BBNC 1E7VA 2KMCA 2B3AA 2LXCA 2KNBA 3V61A 1UGMA 2NPTB 2RSUA 3DBLI 2O6VD 1SGHA 2LZ6A 3IHPC 5IAAC 4GDLB 1PQSA 2C60A 5LXHA 1WI0A 1KM7A 4WWNA 2I1JA 2IYDB 1WXSA 1TBEA 3APFA 3ZIMA 2J0JA 3KUDB 4PS8A 4GB9A 1WXAA 2L7RA 2Z0DB 2K6DB 4HK2A 5D7GA 1ISNA 2KC2A
chains in the Genus database with same CATH superfamily
3L0WB 3QX1A 2EKEC 2ZW1A 2XK5B 4L2YA 2MA9B 3QK0A 4KVGB 2ZW0A 2ZZPB 1J7BA 1WX7A 2KWUB 4WIPA 3PRPB 4B6WA 5FKAC 3KVFB 4BVUC 4F8CB 1MG4A 2MW5A 3WALA 4URKA 2GOWA 4ICUA 2LVPA 3VHTC 1ZE3D 4HEA1 1E5WA 4RM9A 3Q6BA 4US8A 3BZDB 1D5ZC 1WZ0A 2W3RA 4ARIA 1FFVA 3IT6B 3DHHC 2M56B 3GE8C 2DZIA 3AECB 3WAOA 4OW0A 2ZNVB 3Q3OC 4RF1A 3KUCB 2DZJA 1C1YB 2BYTA 2H89B 2A5UA 4GOCA 2LGXA 3AMZA 1N6ZA 1M4VA 4NZLB 1K52A 1JWSD 4RFBA 1L5PA 3EA6A 3FILB 2JXXA 4HROA 1V1OA 3J9CA 2CHXA 4ITKA 4LNKA 3HM3A 2RD0A 4REZA 2FCNA 5J2RA 3RNEC 2IDYA 4P6VF 4RM8A 3RZWC 4JE3B 3T3NA 4RGNA 3B08A 2L32A 2PE9A 3QWZB 4KKJA 2O2VB 1EUVB 2JT4B 4KGRA 1I4PA 2MCNB 3TJPA 2XNAC 4MSQB 3Q3FA 1HXYD 3AEFB 5FK9C 4MGYE 3PHWB 3ALBA 3LDZE 2G1EA 3DBSA 4IM2A 3ABVB 1RLFA 1MHXA 2V3SA 2G45B 3AXCA 2GMIC 1N5XA 4W9FA 4TQ1A 2EKIA 1F1HA 1KLGD 3V6CB 2L76A 1J7CA 1GPXA 4GDKB 2INNE 2MBHA 4ANVA 3I63C 1ZDXA 1UNSA 2BGFA 4FHJA 2N7JA 2N4FA 3I5JC 4O1NA 2JRIB 3ONSA 1FCCC 3RD2A 3CMMB 5EE0A 1YN3A 4YXDB 3R2IA 2AEHA 2MRPA 5DPTA 3ZLZA 3Q8BA 1ZKHA 3ZW3A 1TKYA 1ENFA 3EUB2 3BYTB 2KDFB 3UIOB 4YTNB 5CHWA 1TY0A 4BZAA 2FAZA 4KIKB 2KQ4X 4LDTB 1QLBB 1DGJA 2K6QA 4HCPB 4GIVA 4ACFA 3HUIA 4EOYA 1OQYA 1ZDVA 5HG2A 3KYDD 2C7NB 4MDKE 2L8JA 2GLSA 4A3PA 1C77A 2G4DB 1XF5L 4IM3A 4FBJB 3B2FA 3VAWA 3OAWA 3CF6E 1WM3A 3BVMA 1LO5D 3U7DA 2LRUA 3NOBA 1FMAD 1CK1A 3RN9C 3TSSA 3N3KB 2MP2A 3OG5A 1WJUA 1YQ4B 4BBNF 1EU3A 2QC8A 2MJDA 3APDA 1OQRA 3BK2A 4W9GA 4W9IA 1F77A 2WXRA 3JYUA 2D11A 4M8NA 1RWSA 4AS1A 5GMVA 2K3UA 1RM6C 2KX3A 3VTUA 1JWMD 4DDGD 3DVNV 3H6NA 1MI0A 4NQKE 5G5GA 2IJ0A 1MG8A 4ZRJA 3Q3JA 3A1QB 4HJKA 1ROEA 2D3GA 2XK5A 4GXBA 2LXAA 1GB4A 3RULA 5IN7A 1XEEA 3AM9A 3WCQA 1FD6A 1Q10A 1FNVA 5DPRA 2IY0B 2MSED 1WMHB 2LGIA 1FNUA 3P4SB 1SE2A 1TGZB 1FXTB 4II3B 3V05A 1Q1OA 2VZKB 1JQ4A 2MX2A 3SHQA 3AE7B 3VH4B 4R3DA 5CTRC 3UGBB 1WJ6A 1WXMA 1Y8RC 1GNUA 1TS4A 1UF0A 3QJZA 4N59A 5H8YE 1E6EB 4W9LA 2PEAA 2EELA 5D2MB 3AEEB 3QCAA 1AWDA 1EWCA 4I6PA 3MTNB 2XBBC 2LGDA 5BMHA 1L4DB 1J8CA 3VUWA 2GBKA 3QAQA 1WGDA 1K50A 2UU7A 1D6EC 3VR9B 1IP9A 3QQ8B 2LGSA 3ZXRA 1VR9A 2MBOA 3NHEB 2WXIA 1WY8A 2KACA 2LHDA 3L4PA 4OVUA 1SJED 1XD3B 3RMKC 3M63B 4YTMB 2W55A 1UBQA 4EZKA 2WXMA 2NR2A 2K39A 4MJSB 1VDVA 3DBLB 2V1YA 2BYVE 1EU4A 3V60A 1VLBA 4MEMA 1CZPA 1NI3A 3W1SA 1XLPA 4PS3A 4M01A 1ZGUB 2KC1A 2KKCA 2UYZB 3HRDD 3AI5A 2R2OA 5D3IB 1J19A 4KZ0A 3ENEA 3NY5A 2BVCA 3IT4B 5LXIB 1OFFA 1I42A 4ANWA 4GDKA 3FAHA 3VFKA 2KOXA 3ZNID 3AEGB 2DWQA 4LNFA 1OQQA 1WH3A 2RDHA 2PE6B 1N62A 2FBWB 3AE4B 3AU4A 2JQRB 3IVFA 4OZAA 1LFDA 1EO6A 4WAAA 4ANXA 3AEBB 2ZCBA 3TEZA 1L2NA 3BY4B 3QC8B 4KIKA 1XCQL 2QIEB 1WRIA 2ASQA 3S2AA 3AE6B 4PYUA 2CR5A 2J0KA 3VXWA 2HE7A 1QOGA 3L10B 1C4PA 4TV3A 2OJRA 2LUMA 4MGZE 2BYFA 2E6XA 1XCTL 4JPSA 2QILA 2N7DA 3HIZA 4YL8A 2L0TA 3ML8A 1HTQA 4G3XB 5E6PA 4B95A 1S1QB 1WGGA 3H7PB 4BOZB 4FADA 3PRMB 3KUZA 1R4MI 4BBNC 3P63A 3RNGC 2O6VD 4P1CC 4J3OD 1V1PB 2JX5A 2V3PA 1BMLC 3APFA 1TBEA 5BYRA 2J0JA 2WXKA 3KUDB 2L7RA 3NVYA 3TEXA 1K8RB 3APCA 4YSZB 2GBRA 2WXPA 3AE1B 4LJOB 1OEYJ 3A1QA 5BMGA 4NAWA 5C2TB 4USAA 1DOIA 4DK5A 2DYOA 4A9AA 1WGHA 3BVGA 2KDMA 1D3ZA 5L95C 3MJ5A 2BQQA 4OVZA 2D5GA 2GBJA 4W9EA 4HPMB 1RFAA 4NNJB 5E6NA 2C7HA 1ZOYB 2GB1A 3X23A 2LFIA 4RMAA 1V9JA 3O13A 3DBRI 3NJTA 4DXGA 4RGMA 2Y5PA 5EDSA 1PDXA 4W9JA 1PFDA 1TIFA 1HZ5A 2WGSA 2KD0A 4K7SA 2KQSA 5JHBA 1PGXA 5DPSA 1E0ZA 4E74A 1C4CA 1HTOA 4BKSD 1P9DU 4EEWA 2LD9A 5AZHA 1IGCA 3GS2A 1ZPSA 2AL3A 2J52A 2LHEA 2PIAA 3GE3C 2BB6A 2HDEA 1P0RA 1T0SC 3JW0X 4MJSA 1J0GA 5C23A 3NVVA 3R2TA 5J17A 1UH6A 1KRHA 2KVZA 3LXFA 1FXAA 1WXQA 3K9PB 4RGOS 5HI1A 2NCNA 4W9DA 4LJPB 4DDID 2X38A 5H92C 2M17A 4E3CA 1WGKA 2RPQA 2K9XA 5E6JA 1F0ZA 2MQJA 1OEYA 4K3CA 3RCZA 5TR5A 5JHAA 1WM2A 1LQBA 4KGSA 4NQLB 4DXAB 1E8ZA 3Q8CA 4A8XC 2L83A 2JY6A 2KYWA 1GG3A 4RNAA 3PV1A 2L05A 2Y5CA 4IKGA 1WYGA 1U4AA 1E10A 4FJZA 4A90A 1JWAD 1UZXB 1RAXA 3NS8A 2MJ3A 4N9F4 1UBIA 1XT9B 5CX3A 1FO4A 2IO3B 1E8WA 3ZYYX 4TQ0A 1DYQA 2JZPA 4A3OA 2W54A 3P4PB 3TMPB 3P2BA 3A9JB 1JRPA 3WAPA 3W5VB 5IOIA 2N9EB 1HA5A 1I4QA 2INPE 3P4RB 2N9LA 3H7PA 2IGGA 3ETRA 2BS4B 2N1WA 2KZRA 1AARA 2YEPF 2ZEQA 2KLGA 3KYCD 4KX6B 3U4EG 4ZRKA 1OGWA 1V1PA 3VR8B 3BINA 4LDTD 2WWZA 1TY2A 4WJPA 1YD8U 2INDC 3T8MA 1FIQA 4W9KA 3MHZA 2J7QB 1C76A 2N9XA 2YVCA 3VQIA 3H1UA 1V5OA 2CU1A 1YN4A 1Q5WB 2CU3A 1STEA 5BYQA 2IZVB 5IO9A 2WLBA 2A4ZA 1GJZA 2W3SA 2AWTA 4XGAB 1ZXIA 4MT5A 1MFWA 1JWUD 1I35A 3ML9A 3PZ8A 2DZMA 3AULA 1GC7A 4FA6A 5AZGA 1SE9A 5HFYA 4HKQA 1LM8B 1X1MA 3U8ZA 2KWVB 2WXGA 1C3TA 4JL9A 3PLUA 1UD7A 1VZ8A 1FXIA 3OLMD 3UIPB 3R8BA 3KWLA 4J6IA 2MBQA 2Y5BB 4DXFA 3JVZX 2KFKA 1ZW7A 1SBBB 2QDFA 4UDUC 4AOFA 4B9KA 3W9CB 2MH7A 2MBEA 4DHJB 1SJHD 2BWFA 3NRZA 3DDCB 2BWES 2L0FA 3Q3MC 3SEBA 2LRWA 1P1AA 5J18A 4ZHOA 2K25A 2N0SB 1SE4A 1R4MB 2VZKD 1GC6A 2AX5A 4DHZE 1L6UA 4JWUC 3Q69A 3A33B 3BK1A 3CWIA 1WJNA 1CQVA 2J4XA 1SF0A 3NUHB 2WX0A 4MACA 1HEZE 3UINB 2CHWA 1PYWD 2CS4A 4C00A 3AE8B 3H7SA 2C7MB 4K1RB 2EMSA 3D32A 3N1YC 1HZ6A 2FE8A 2H88B 2FNJB 5D6JB 2ZPYA 2Z59B 3PO0A 4WJQA 2KT7A 4LLGM 1V81A 1NBFC 4BKTA 3H9DA 1ESFA 2FCMA 2ICIA 3B0AA 4FLHA 4MGKE 4XX5A 3P42A 1GB1A 2IY1B 1WR6E 3ZQ4A 4TSSA 2LVQA 4Q2JA 3PHXB 1WFYA 2E3TA 5L83A 3T9LA 4NAWB 1A70A 1C78A 4CHKA 1GAQB 3DBRB 4FJYA 4OVVA 2BS3B 2K8HA 2R2QA 3BVZA 4ZYSA 3SR6A 2G9HD 5EE1A 4IG7B 1NENB 3V6EB 4YWGG 4WWMA 4ANUA 1XQQA 3AU5A 3T3OA 1QOBA 4ICVA 5BYSA 1QILA 3NS1A 2BW2A 2JUOA 1MPEA 3Q14C 4DBGA 3B9JA 4HCNB 3UF8A 2XN9C 3A9JA 2UWQA 3A9KA 3GZNB 1VZ7A 1VJKA 2BB5A 1ET6A 2AQ3B 3KWVA 2KMCA 5AUKA 4FXCA 1UGMA 2RSUA 1SGHA 2LZ6A 2Z8LA 3IHPC 5IAAC 4GDLB 1WI0A 2I1JA 2I2YA 1SXTA 4K3BA 2WU5B 3ZIMA 1FPYA 4XDCA 2K6DB 4L1BA 4HK2A 2KC2A 4FJVB 1V49A 3ZVVA 3QARA 4HKZE 4TMAB 3AB5A 4EZLA 2EMTA 5DCNA 4KSKC 4MM3B 2JSVX 1WSPA 4JQWC 1T5XD 2B76B 3OJ3A 2PLPA 4HDOA 2JU6X 2L00B 3QIJA 4M0WB 2GI9A 2Y3AA 2M0XA 3RNBC 4C56C 1EF5A 2IO2B 2FIDA 4WQOB 2IO1B 4KGTA 3I9V1 4GN1A 1SIJA 4IM0A 2WX1A 2KVRA 3HK0A 3FC4A 3X0WA 1WRDB 4OHJA 3OJ4B 3ZNHB 1TTNA 4AUQC 3C0RB 1V2YA 1KOTA 4I6NB 1DOXA 1WF9A 2D3CA 2J53A 2RDGA 3AEAB 2M4NA 2VH1A 1WGRA 3L08A 2L1AA 1QOAA 3DHGC 4FN2A 2M19A 4L23A 4ZOHC 2K8BA 4IWPA 2M0AA 2ZVNA 4FHKA 4RGTA 1NYRA 4HWIB 2V4LA 4ASWC 2V0GA 1T6BX 2NTSA 4OZCA 2FCQA 2KDBA 4XE0A 2K0PA 3I3TB 4A20A 4MGIE 2LWPA 1WR1A 4ZRPA 2YEPB 3CSTA 1J7AA 1JWBD 2KJHB 4HJGE 3L16A 1V97A 2W9NA 2IPKD 4GLSC 3ZTCA 2D07B 1RFKA 3B1LX 3PLVA 2JWZA 2PPHA 2BYEA 2JWUA 1JCKB 3LJ3A 1V80A 2RPVA 4AP4C 1UELA 2X8XX 1AYFA 3L54A 4RF0A 1MJDA 4KV2A 3URYA 3RUIB 2CHZA 4WWPA 1WYWB 2PVOD 2PMVA 2NS5A 2LASA 3ZJVA 2KWDA 1M94A 3VTVA 3ZXVA 4DHZB 1IBXB 1H8CA 1FFUA 4ZRQA 4HRSA 2BS2B 1F9JA 2RMMA 4MSMB 3PZDA 1FNWA 2JYTA 3ZRCA 3TIXA 1XO3A 2D3AA 1NEKB 3HM6X 3V3XA 3VDZA 4AQ7A 3PTFC 2WXFA 2QMTA 2MHJA 2NTTA 3PVLA 2KFKB 2OHFA 4M02A 3DPDA 1C9FA 2BF8B 4IDIA 4YTPB 3AE9B 2LUEA 4WJNA 2LJIA 4N58A 2DYBA 4GDLA 3DBHI 5BMIA 3GB1A 3KQ4A 1C79A 4XZ4A 3RZFA 2N7EA 3GZNI 4XYCA 1IYFA 1VCBA 1EF1A 2LVOA 1E8XA 5KHOA 5IA7A 3AN1A 3AV8A 2RR9A 1KLVA 2KMMA 3UQBA 4IWQA 3P4QB 2IBIB 4M00A 4MM3A 3AEDB 2N1VA 2LMCA 1DOYA 1FCLA 1WGYA 3N9YC 4PS7A 5D94A 1V5TA 3BWUD 3L13A 4EE2A 4K7UA 4M0WA 2DBYA 3VTWA 1AN8A 3ZRFA 1WJ4A 2SAKA 4MELA 1FEHA 4YSYB 1XXGA 3RPFC 1BUIC 2HTHA 1ZUD2 2CJOA 4BFRA 1TKGA 4GSWA 1KTKA 4NAMA 3Q8FA 2PTLA 1I4GA 1T0YA 3NG0A 1TJEA 2KLCA 3MJWA 4LNNA 4KZCA 4K7WA 3W1SC 1V8CA 1GUAB 1EM7A 1NDDA 1T0RC 4II2B 2JRHA 1L6VA 2JXTA 2LI5A 4M8MA 3BIID 3RNFC 2REXA 1SIFA 2HJ1A 2PVGC 3IAM1 2OOBB 5FR6A 3UQAA 1FM0D 4X57B 3DOWA 3ZGZA 5HKHA 2PKOA 4C7ZA 5G5HA 1ZXHA 1H4RA 2MWSB 3RYTA 4ZDVA 3PPAA 3C8YA 2QJLA 4QAYA 3MP9A 3WA0A 5CHVC 1D4BA 5G2NA 1D5XC 5JZEB 3CSFA 3A9KB 2DNFA 4C4VA 3ZJUA 1IPGA 3RNAC 1E7PB 2AQ1B 1CJEA 3ZDTA 3R66C 3PGEA 2W82A 1WIAA 1D5MC 2BKRB 3N20C 3K9OB 1TT5B 3EHVA 3WANA 2KX0A 4IWOA 4KKIA 1QOFA 5G55A 1V6EA 2IO0B 3WAMA 2KTRB 1QZEA 1TZ1A 2GBMA 4DHJD 2WHIA 3PT2B 4E71A 1YJ1A 1F2RC 1UGJA 2FUHB 5JXVA 4ZHPA 5LNK1 1KLUD 2KDIA 5AEKB 2NVUI 1B1ZA 4WURA 2L52A 3R3MA 4XWWA 3N1XC 1JRUA 4RH6A 1UUPA 4G11A 3RNCC 1CMXB 2KANA 1YMHE 1YN5A 2KWCA 1YIWA 3SD5A 3W5UB 1BXTA 1ACCA 1Z5SB 1KJTA 3KH0A 2WP9B 3TUOA 4JLCA 1YOVB 4WQMA 5T8IA 2DAFA 4NPNA 2ACZB 1WXVA 4IOIE 1IBXA 2K1FA 3ZTDA 2VRRB 1WE7A 4F7ZA 3SU8X 1L7YA 1MVKA 3H8HA 3GOEA 3R7RA 2Z0EB 3C19A 3WIMA 5BO4B 1P98A 3DQVA 3DVNU 1XLOA 2WXNA 4US9A 3Q8AA 4B0EA 1G6JA 3UI3A 2GRIA 1QKZA 2N9KA 1TS2A 1E7VA 3NZ3A 2LXCA 3AE2B 2KNBA 3V61A 4H2AA 2NPTB 1ET9A 1PQSA 2C60A 5LXHA 2D3BA 4XWTA 2IYDB 1WXSA 4CQNA 3RFZB 5D3DA 3AE5B 4GB9A 2IGHA 1PGAA 4A6QA 1ISNA 1SE3A 3MC0B 5EE3A 2OEDA 1PGBA 2KJRA 1RYJA 2PW9A 3HHMA 2IGDA 1R4NI 2O6VA 4C7YA 2ZPNA 3VUXA 2CKHB 2KXJA 5C3JB 2FUG1 2ONQA 4F1SA 3TEWA 1FRRA 2TSSA 4HDQA 2BTEA 1SSNA 3ZNZB 2ON8A 1UWMA 4P1BC 1HE8A 3EC8A 5HHDG 2J42A 3VRAB 4NJ7A 2ZJDA 4MH0E 3U30A 4WAFA 4HLEA 5E6OA 2LEKA 2AL6A 4KSLC 4GGQA 1WX9A 2WDRB 3AE3B 4XC2A 1P7EA 3OWEB 5LLIA 1YX5B 2BT6A 2G3QB 4ZRIA 3B2GA 3JSVB 4IUMB 4P7IA 3ZDMC 5C1ZA 2HJ8A 3DCGA 3PSEB 1NI2A 2Q5WD 2I38A 4K81A 1AW7A 4LNIA 2SEBD 1KFYB 2JZZA 2KDEB 1WWTA 4KDIC 2YLMA 2KFJA 3PREA 1Y56A 1LGRA 1QQRA 1YQ3B 3Q2AC 4DWFA 2V9HA 4P16A 2JYEA 4G0NB 4XDDA 2FCSA 4I6LB 3R7QA 3TEYA 5TSSA 4IW0A 1UWXA 1IGDA 1QF6A 1Q0WB 2KN5A 1N63A 5AZFA 4AWJA 1E90A 4PT5A 3DBHB 2KN4A 4BKSA 4KDLB 1E7UA 2WU2B 1L0YB 4D2KA 3IBEA 1YJIA 1YNTE 2QSDA 3M95A 2WXQA 5I4DA 1NVID 2M1MA 1VD2A 5IKCM 2D10A 1L0XB 2RGFA 4HVBA 4HPLB 2QHOA 3IG3A 2J0MA 3M62B 2KTRA 1TS5A 2WXOA 3SDLC 4CO7A 3O65B 3QHTA 2JPHA 1E8YA 4AJYB 5GXGB 2MJEA 2BBCA 2WNMA 4PYZA 4LNOA 1VZ6A 2DAJA 3FILA 3SFDB 3DVGY 2L3ZA 2AQ2B 2DZKA 3VH3B 2INCC 2R61A 2WQYB 3A4SC 3E56A 4WH4A 1R7SA 4EFOA 3IFWB 3ZKJC 2WYQA 1YX6B 1QT9A 2WS3B 2JVCA 3EECA 3EFCA 1L4ZB 3P1MA 2O2VA 4BKGA 4YSXB 1YQBA 5MPOA 4RCOA 3KW5B 3GP7A 1TS3A 2HTME 3HVDA 2KQ7A 2FIFA 1HQRD 4IC7B 1N60A 1SB3C 4W9CA 2C9WB 1SEBD 2AYOB 3L17A 4JIOU 1XLNA 5KHQA 1IUEA 1JALA 3E9SA 3NVWA 4JWSC 2NPTA 1TZOA 3V62A 4A55A 2VH2A 3LYYA 4ARCA 2JF5A 1A5RA 2C5LC 1JROA 4ZYNA 1RRBA 3MHSD 2LJ5A 3IAS1 1ZP0B 2WXHA 1JW9D 2KMAA 1I4XA 2NBUA 3Q3NC 1KH0A 2DENB 2ZCCA 4LTUA 3DHIC 1T3QA 2WDQB 3ZNGC 4B0MA 4DQOC 3DVGX 1P3QU 3FKYA 3LB8C 4C4VB 1P7FA 2KTFA 4EKUA 5JH5C 1TKEA 2DYMA 3SFEB 1XLQA 1YJJA 1TYGB 2G4SA 5FR3A 4FULA 3MFGA 4EZJA 4MH8A 4JX1C 2OJWA 2WXLA 3RT3B 1VRAB 1K53A 2WDTB 2HD5B 4PK1A 3Q8EA 3ECIA 2N9PC 2DX5B 3JSVA 1KF6B 1F2RI 4S17A 1I4RA 2QEJC 4LK0M 4BAXA 2K5PA 4OZBA 2DHZA 1E9MA 1BT0A 3I57A 2BPSA 3TBLD 2JZ3B 4NY0A 3PS6A 3RI7C 2DLBA 2I1KA 3ZUNA 2GBNA 1S3SG 4GU2A 1I7HA 4G50A 3MC9A 5CHFA 1I4HA 2MEKA 4EUTA 2ZVOA 3N1ZC 2CJNA 4W9HA 1GOZA 4HXDA 3DWGC 2QCZA 4TKNA 4GMVA 2WDVB 2M8SA 2KK8A 1F52A 3A4RA 2KJ6A 2WXJA 4LCDE 3VVWB 1WMHA 3HVZA 1WE6A 3DWMA 1C4AA 3NZUA 4N6EB 4S0RA 3VRBB 1EWYC 1Z2MA 2NBWB 2KO3A 3EFUA 4AJWA 1R4NB 5IP4D 2NMQA 5DPWA 4TUUA 2KHWB 1N5WA 3ZO5B 1N61A 2KAJA 1OTRB 1V86A 3IXSA 3M3JA 1L0VB 2O6VB 3BYYB 4C80A 3ZJTA 2ZNVC 3W1YA 3QA8A 3N32A 3U2SC 4CYEA 2BKFA 3TL5A 3CIRB 3PRZA 4WJOA 2RDBC 4NJCA 3EGRA 4NJ6A 1WX8A 3W2DA 1MHHE 4WWOA 1WZ3A 1FRDA 1LXDA 3NZSA 3VUYA 1NYQA 4YT0B 3KLSX 2V3NA 4BOSC 1B9RA 2XEWA 2PJHA 2K8CA 2MBBB 3U52E 2D2QA 2NBVB 1JMLA 3MC8A 4JGHB 3N30A 3NVZA 2MP2B 2LGYA 2MLBA 5AUIA 1T0QC 1K51A 3TCAA 2B3AA 1PUTA 3DBLI 4HPPA 1KM7A 2K22A 4WWNA 5EE9A 3U7ZA 2V4IB 3AH7A 4PS8A 1WXAA 3PZ7A 2Z0DB 5D7GA
chains in the Genus database with same CATH topology
3L0WB 4FJVB 1V49A 3ZVVA 2KJRA 3QARA 3QX1A 1K8RB 3APCA 2EKEC 2XK5B 2GBRA 4EZLA 4LJOB 2MA9B 3HHMA 2EMTA 1R4NI 2O6VA 1OEYJ 2ZZPB 3QK0A 4KVGB 5DCNA 4KSKC 3A1QA 1WX7A 2KWUB 4NAWA 2ZPNA 3PRPB 2CKHB 4JQWC 3VUXA 2KXJA 4B6WA 4F1SA 4HDQA 3KVFB 3OJ3A 4BVUC 4DK5A 2DYOA 4F8CB 2MW5A 4HDOA 3ZNZB 3WALA 1WGHA 2L00B 3QIJA 4URKA 1HE8A 2GOWA 4M0WB 3EC8A 1D3ZA 4ICUA 2LVPA 5L95C 2M0XA 3VHTC 1E5WA 1EF5A 2IO2B 2FIDA 4RM9A 4WQOB 2GBJA 4W9EA 4HPMB 1RFAA 4NNJB 5E6NA 4NJ7A 2ZJDA 4MH0E 1WZ0A 2C7HA 2IO1B 3U30A 3X23A 4GN1A 4HLEA 5E6OA 4IM0A 4RMAA 2AL6A 4KSLC 1V9JA 2DZIA 4GGQA 1WX9A 3WAOA 2ZNVB 4XC2A 3DBRI 2WX1A 3KUCB 5LLIA 1YX5B 2KVRA 2DZJA 2G3QB 3HK0A 4ZRIA 3JSVB 4IUMB 4P7IA 3ZDMC 5C1ZA 2HJ8A 3X0WA 1WRDB 3DCGA 3PSEB 1C1YB 3OJ4B 3ZNHB 1TTNA 4AUQC 5EDSA 1NI2A 3C0RB 1V2YA 4W9JA 1KOTA 4K81A 4I6NB 2A5UA 4GOCA 1WF9A 2LGXA 2M4NA 1WGRA 3L08A 2JZZA 2KDEB 4KDIC 2KD0A 4FN2A 2YLMA 2KFJA 4K7SA 2KQSA 5JHBA 3PREA 5DPSA 2JXXA 2K8BA 2CHXA 4IWPA 4DWFA 4E74A 2ZVNA 4FHKA 3HM3A 4BKSD 1P9DU 4HWIB 2V4LA 2RD0A 4ASWC 4EEWA 2FCNA 5J2RA 4G0NB 2LD9A 2FCSA 2FCQA 4RM8A 5AZHA 3RZWC 2AL3A 2KDBA 3B08A 4I6LB 2PE9A 3QWZB 3R7QA 3I3TB 4IW0A 2O2VB 1EUVB 2JT4B 4MGIE 4A20A 1P0RA 3JW0X 2MCNB 2LWPA 3TJPA 1WR1A 1Q0WB 4MJSA 2KN5A 5AZFA 4MSQB 4AWJA 3CSTA 3Q3FA 1E90A 4MGYE 1J0GA 3PHWB 3ALBA 3LDZE 2KJHB 5C23A 3DBSA 3L16A 5J17A 1UH6A 2W9NA 4IM2A 4BKSA 4KDLB 3K9PB 1E7UA 3ZTCA 1RLFA 2D07B 3IBEA 2V3SA 2G45B 3AXCA 2NCNA 2GMIC 3B1LX 4W9FA 4TQ1A 3M95A 4W9DA 3V6CB 2L76A 2M1MA 1VD2A 4LJPB 4DDID 2D10A 4HVBA 2RGFA 4GDKB 2M17A 2MBHA 3PLVA 4HPLB 4ANVA 2JWZA 2PPHA 4E3CA 2BGFA 2BYEA 2QHOA 2RPQA 2MQJA 3IG3A 4FHJA 2N4FA 2J0MA 3M62B 1OEYA 3LJ3A 3RCZA 5TR5A 2JRIB 5JHAA 2KTRA 3ONSA 1V80A 1WM2A 3RD2A 1LQBA 3CMMB 3SDLC 4NQLB 4CO7A 2AEHA 2MRPA 3O65B 1E8ZA 4DXAB 5DPTA 3QHTA 2JPHA 1E8YA 3ZLZA 2JY6A 1ZKHA 4AJYB 3ZW3A 4AP4C 1UELA 1GG3A 3L54A 3PV1A 2KDFB 2L05A 3UIOB 5CHWA 4KV2A 2FAZA 4KIKB 4PYZA 3RUIB 2DAJA 4LDTB 2CHZA 4WWPA 1WYWB 3DVGY 2L3ZA 1U4AA 2K6QA 2NS5A 4FJZA 4HCPB 2DZKA 2LASA 4GIVA 3VH3B 4EOYA 3A4SC 4EFOA 1OQYA 1UZXB 3IFWB 1M94A 3VTVA 3ZKJC 2WYQA 4DHZB 3KYDD 1RAXA 2C7NB 4MDKE 3NS8A 2L8JA 1H8CA 1YX6B 4N9F4 1UBIA 1XT9B 2JVCA 5CX3A 3EECA 1F9JA 2IO3B 4MSMB 4A3PA 2G4DB 1E8WA 3PZDA 2O2VA 4IM3A 4TQ0A 3ZRCA 4A3OA 3TIXA 4FBJB 4BKGA 1YQBA 3TMPB 3VAWA 3OAWA 3HM6X 3VDZA 3CF6E 3P2BA 3A9JB 3KW5B 3PTFC 1WM3A 3U7DA 3WAPA 2LRUA 3NOBA 2KQ7A 2N9EB 2FIFA 3PVLA 3N3KB 2MP2A 2KFKB 4IC7B 1WJUA 4BBNF 4W9CA 2C9WB 3DPDA 3H7PA 2AYOB 3APDA 3L17A 2BF8B 2N1WA 4JIOU 5KHQA 2KZRA 1AARA 2ZEQA 3KYCD 2KLGA 4W9GA 2LUEA 4W9IA 4WJNA 2NPTA 4ZRKA 3JYUA 2D11A 3V62A 2DYBA 4M8NA 1OGWA 4GDLA 3DBHI 3BINA 2JF5A 4LDTD 4XZ4A 2C5LC 3RZFA 2WWZA 1A5RA 5GMVA 4ZYNA 2N7EA 1RRBA 3MHSD 4WJPA 2KX3A 2LJ5A 3VTUA 3GZNI 1YD8U 4DDGD 3DVNV 3H6NA 4NQKE 3T8MA 1IYFA 1VCBA 4W9KA 1MG8A 4ZRJA 2J7QB 1EF1A 2LVOA 2KMAA 2N9XA 2YVCA 1V5OA 3A1QB 3H1UA 3Q3JA 4HJKA 1E8XA 5KHOA 2NBUA 5IA7A 2CU1A 2D3GA 2DENB 2ZCCA 2XK5A 1KLVA 1Q5WB 2RR9A 4GXBA 2LXAA 3RULA 3ZNGC 3UQBA 4IWQA 2IBIB 4MM3A 2IZVB 3DVGX 1P3QU 2N1VA 2A4ZA 5DPRA 2IY0B 1GJZA 2KTFA 4EKUA 5JH5C 2MSED 2AWTA 1WGYA 1WMHB 4PS7A 5D94A 1I35A 1V5TA 3ML9A 2DYMA 3L13A 2DZMA 3AULA 1TGZB 4K7UA 1FXTB 1GC7A 4II3B 4FA6A 1Q1OA 2G4SA 5AZGA 1SE9A 3VTWA 2MX2A 3SHQA 4FULA 3ZRFA 3VH4B 4EZJA 1LM8B 1WJ4A 1X1MA 4MELA 3U8ZA 5CTRC 3UGBB 1WJ6A 1WXMA 2KWVB 1C3TA 4JL9A 1Y8RC 1GNUA 3PLUA 3RT3B 3QJZA 1UD7A 4W9LA 2PEAA 3OLMD 5D2MB 2WDTB 2HD5B 3UIPB 3QCAA 2HTHA 3ECIA 4J6IA 2N9PC 4BFRA 2DX5B 2MBQA 3JSVA 2Y5BB 4GSWA 4I6PA 3MTNB 3JVZX 2XBBC 2KFKA 2LGDA 1J8CA 1T0YA 3VUWA 3MJWA 2KLCA 1ZW7A 4KZCA 4K7WA 2GBKA 3QAQA 3W1SC 1GUAB 1NDDA 1WGDA 2DHZA 4II2B 4AOFA 4B9KA 1IP9A 3QQ8B 2JRHA 2LI5A 4M8MA 1BT0A 2REXA 2BPSA 2MBEA 2JZ3B 3TBLD 4DHJB 2BWFA 1SIFA 2MBOA 2BWES 3DDCB 3NHEB 4NY0A 2L0FA 2LRWA 3PS6A 1P1AA 1WY8A 2I1KA 5J18A 3ZUNA 2OOBB 2GBNA 5FR6A 1S3SG 4OVUA 4X57B 3UQAA 4GU2A 3DOWA 1XD3B 4G50A 3M63B 5HKHA 2K25A 1UBQA 5CHFA 4EZKA 2NR2A 4EUTA 2K39A 1GC6A 1H4RA 4MJSB 2ZVOA 2MWSB 3RYTA 4DHZE 2V1YA 2BYVE 3PPAA 4W9HA 4ZDVA 4HXDA 3A33B 3V60A 3WA0A 4TKNA 1WJNA 4GMVA 5CHVC 5G2NA 4MEMA 3W1SA 5JZEB 2M8SA 2KK8A 3CSFA 4PS3A 3A9KB 1ZGUB 2WX0A 2KC1A 3VQIA 3A4RA 2KKCA 3UINB 1IPGA 2UYZB 2KJ6A 4LCDE 2CHWA 3VVWB 3AI5A 1WMHA 2CS4A 2R2OA 1WE6A 3ZDTA 3R66C 3PGEA 3NZUA 3H7SA 2C7MB 4K1RB 1J19A 1WIAA 1Z2MA 2BKRB 2EMSA 2NBWB 3D32A 4KZ0A 2KO3A 3K9OB 3EFUA 3EHVA 3ENEA 3WANA 2KX0A 3NY5A 4IWOA 2FNJB 5D6JB 4AJWA 5DPWA 2ZPYA 1V6EA 2Z59B 4WJQA 5G55A 4TUUA 2IO0B 5LXIB 1V81A 1NBFC 2KHWB 3WAMA 4BKTA 3H9DA 2FCMA 1I42A 2KTRB 1QZEA 1TZ1A 2GBMA 4ANWA 4DHJD 4GDKA 3PT2B 3B0AA 4FLHA 4MGKE 3VFKA 4E71A 1YJ1A 2KOXA 3ZNID 3ZO5B 4XX5A 2FUHB 2KDIA 5AEKB 1OTRB 2IY1B 1V86A 2NVUI 1WH3A 3M3JA 1WR6E 2LVQA 2O6VB 2PE6B 3PHXB 1WFYA 2ZNVC 3R3MA 3AU4A 3T9LA 3W1YA 5L83A 3IVFA 4NAWB 3QA8A 1JRUA 3N32A 4G11A 1LFDA 1EO6A 1CMXB 2KANA 2KWCA 4WAAA 4CHKA 1YIWA 4ANXA 4CYEA 2BKFA 3SD5A 2ZCBA 3TL5A 4FJYA 4OVVA 3PRZA 2K8HA 1Z5SB 1KJTA 3KH0A 4WJOA 1L2NA 2R2QA 3BY4B 3QC8B 4KIKA 4NJ6A 1WX8A 4JLCA 4WWOA 1WZ3A 4IG7B 2ASQA 3S2AA 3V6EB 4PYUA 2CR5A 2J0KA 1LXDA 3NZSA 3VUYA 4ANUA 1XQQA 2DAFA 3AU5A 4NPNA 2HE7A 3VXWA 3L10B 1WXVA 4ICVA 4TV3A 2OJRA 2K1FA 4MGZE 3ZTDA 2VRRB 4BOSC 1WE7A 2BYFA 4F7ZA 3SU8X 1L7YA 3GOEA 2N7DA 2XEWA 2PJHA 3R7RA 2K8CA 2JUOA 2MBBB 2Z0EB 3HIZA 3WIMA 2D2QA 2NBVB 4YL8A 2L0TA 4DBGA 5BO4B 1P98A 3ML8A 3DQVA 4JGHB 3N30A 4HCNB 3DVNU 2MP2B 2LGYA 4G3XB 2MLBA 5E6PA 3UF8A 4B95A 1S1QB 3A9JA 2UWQA 1WGGA 3A9KA 3H7PB 4BOZB 1G6JA 4FADA 3PRMB 3KUZA 3TCAA 1R4MI 4BBNC 1E7VA 2KMCA 2B3AA 2LXCA 2KNBA 3V61A 1UGMA 2NPTB 2RSUA 3DBLI 2O6VD 1SGHA 2LZ6A 3IHPC 5IAAC 4GDLB 1PQSA 2C60A 5LXHA 1WI0A 1KM7A 4WWNA 2I1JA 2IYDB 1WXSA 1TBEA 3APFA 3ZIMA 2J0JA 3KUDB 4PS8A 4GB9A 1WXAA 2L7RA 2Z0DB 2K6DB 4HK2A 5D7GA 1ISNA 2KC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0W B;  4FJV B;  1V49 A;  3ZVV A;  2KJR A;  3QAR A;  3QX1 A;  1K8R B;  3APC A;  2EKE C;  2XK5 B;  2GBR A;  4EZL A;  4LJO B;  2MA9 B;  3HHM A;  2EMT A;  1R4N I;  2O6V A;  1OEY J;  2ZZP B;  3QK0 A;  4KVG B;  5DCN A;  4KSK C;  3A1Q A;  1WX7 A;  2KWU B;  4NAW A;  2ZPN A;  3PRP B;  2CKH B;  4JQW C;  3VUX A;  2KXJ A;  4B6W A;  4F1S A;  4HDQ A;  3KVF B;  3OJ3 A;  4BVU C;  4DK5 A;  2DYO A;  4F8C B;  2MW5 A;  4HDO A;  3ZNZ B;  3WAL A;  1WGH A;  2L00 B;  3QIJ A;  4URK A;  1HE8 A;  2GOW A;  4M0W B;  3EC8 A;  1D3Z A;  4ICU A;  2LVP A;  5L95 C;  2M0X A;  3VHT C;  1E5W A;  1EF5 A;  2IO2 B;  2FID A;  4RM9 A;  4WQO B;  2GBJ A;  4W9E A;  4HPM B;  1RFA A;  4NNJ B;  5E6N A;  4NJ7 A;  2ZJD A;  4MH0 E;  1WZ0 A;  2C7H A;  2IO1 B;  3U30 A;  3X23 A;  4GN1 A;  4HLE A;  5E6O A;  4IM0 A;  4RMA A;  2AL6 A;  4KSL C;  1V9J A;  2DZI A;  4GGQ A;  1WX9 A;  3WAO A;  2ZNV B;  4XC2 A;  3DBR I;  2WX1 A;  3KUC B;  5LLI A;  1YX5 B;  2KVR A;  2DZJ A;  2G3Q B;  3HK0 A;  4ZRI A;  3JSV B;  4IUM B;  4P7I A;  3ZDM C;  5C1Z A;  2HJ8 A;  3X0W A;  1WRD B;  3DCG A;  3PSE B;  1C1Y B;  3OJ4 B;  3ZNH B;  1TTN A;  4AUQ C;  5EDS A;  1NI2 A;  3C0R B;  1V2Y A;  4W9J A;  1KOT A;  4K81 A;  4I6N B;  2A5U A;  4GOC A;  1WF9 A;  2LGX A;  2M4N A;  1WGR A;  3L08 A;  2JZZ A;  2KDE B;  4KDI C;  2KD0 A;  4FN2 A;  2YLM A;  2KFJ A;  4K7S A;  2KQS A;  5JHB A;  3PRE A;  5DPS A;  2JXX A;  2K8B A;  2CHX A;  4IWP A;  4DWF A;  4E74 A;  2ZVN A;  4FHK A;  3HM3 A;  4BKS D;  1P9D U;  4HWI B;  2V4L A;  2RD0 A;  4ASW C;  4EEW A;  2FCN A;  5J2R A;  4G0N B;  2LD9 A;  2FCS A;  2FCQ A;  4RM8 A;  5AZH A;  3RZW C;  2AL3 A;  2KDB A;  3B08 A;  4I6L B;  2PE9 A;  3QWZ B;  3R7Q A;  3I3T B;  4IW0 A;  2O2V B;  1EUV B;  2JT4 B;  4MGI E;  4A20 A;  1P0R A;  3JW0 X;  2MCN B;  2LWP A;  3TJP A;  1WR1 A;  1Q0W B;  4MJS A;  2KN5 A;  5AZF A;  4MSQ B;  4AWJ A;  3CST A;  3Q3F A;  1E90 A;  4MGY E;  1J0G A;  3PHW B;  3ALB A;  3LDZ E;  2KJH B;  5C23 A;  3DBS A;  3L16 A;  5J17 A;  1UH6 A;  2W9N A;  4IM2 A;  4BKS A;  4KDL B;  3K9P B;  1E7U A;  3ZTC A;  1RLF A;  2D07 B;  3IBE A;  2V3S A;  2G45 B;  3AXC A;  2NCN A;  2GMI C;  3B1L X;  4W9F A;  4TQ1 A;  3M95 A;  4W9D A;  3V6C B;  2L76 A;  2M1M A;  1VD2 A;  4LJP B;  4DDI D;  2D10 A;  4HVB A;  2RGF A;  4GDK B;  2M17 A;  2MBH A;  3PLV A;  4HPL B;  4ANV A;  2JWZ A;  2PPH A;  4E3C A;  2BGF A;  2BYE A;  2QHO A;  2RPQ A;  2MQJ A;  3IG3 A;  4FHJ A;  2N4F A;  2J0M A;  3M62 B;  1OEY A;  3LJ3 A;  3RCZ A;  5TR5 A;  2JRI B;  5JHA A;  2KTR A;  3ONS A;  1V80 A;  1WM2 A;  3RD2 A;  1LQB A;  3CMM B;  3SDL C;  4NQL B;  4CO7 A;  2AEH A;  2MRP A;  3O65 B;  1E8Z A;  4DXA B;  5DPT A;  3QHT A;  2JPH A;  1E8Y A;  3ZLZ A;  2JY6 A;  1ZKH A;  4AJY B;  3ZW3 A;  4AP4 C;  1UEL A;  1GG3 A;  3L54 A;  3PV1 A;  2KDF B;  2L05 A;  3UIO B;  5CHW A;  4KV2 A;  2FAZ A;  4KIK B;  4PYZ A;  3RUI B;  2DAJ A;  4LDT B;  2CHZ A;  4WWP A;  1WYW B;  3DVG Y;  2L3Z A;  1U4A A;  2K6Q A;  2NS5 A;  4FJZ A;  4HCP B;  2DZK A;  2LAS A;  4GIV A;  3VH3 B;  4EOY A;  3A4S C;  4EFO A;  1OQY A;  1UZX B;  3IFW B;  1M94 A;  3VTV A;  3ZKJ C;  2WYQ A;  4DHZ B;  3KYD D;  1RAX A;  2C7N B;  4MDK E;  3NS8 A;  2L8J A;  1H8C A;  1YX6 B;  4N9F 4;  1UBI A;  1XT9 B;  2JVC A;  5CX3 A;  3EEC A;  1F9J A;  2IO3 B;  4MSM B;  4A3P A;  2G4D B;  1E8W A;  3PZD A;  2O2V A;  4IM3 A;  4TQ0 A;  3ZRC A;  4A3O A;  3TIX A;  4FBJ B;  4BKG A;  1YQB A;  3TMP B;  3VAW A;  3OAW A;  3HM6 X;  3VDZ A;  3CF6 E;  3P2B A;  3A9J B;  3KW5 B;  3PTF C;  1WM3 A;  3U7D A;  3WAP A;  2LRU A;  3NOB A;  2KQ7 A;  2N9E B;  2FIF A;  3PVL A;  3N3K B;  2MP2 A;  2KFK B;  4IC7 B;  1WJU A;  4BBN F;  4W9C A;  2C9W B;  3DPD A;  3H7P A;  2AYO B;  3APD A;  3L17 A;  2BF8 B;  2N1W A;  4JIO U;  5KHQ A;  2KZR A;  1AAR A;  2ZEQ A;  3KYC D;  2KLG A;  4W9G A;  2LUE A;  4W9I A;  4WJN A;  2NPT A;  4ZRK A;  3JYU A;  2D11 A;  3V62 A;  2DYB A;  4M8N A;  1OGW A;  4GDL A;  3DBH I;  3BIN A;  2JF5 A;  4LDT D;  4XZ4 A;  2C5L C;  3RZF A;  2WWZ A;  1A5R A;  5GMV A;  4ZYN A;  2N7E A;  1RRB A;  3MHS D;  4WJP A;  2KX3 A;  2LJ5 A;  3VTU A;  3GZN I;  1YD8 U;  4DDG D;  3DVN V;  3H6N A;  4NQK E;  3T8M A;  1IYF A;  1VCB A;  4W9K A;  1MG8 A;  4ZRJ A;  2J7Q B;  1EF1 A;  2LVO A;  2KMA A;  2N9X A;  2YVC A;  1V5O A;  3A1Q B;  3H1U A;  3Q3J A;  4HJK A;  1E8X A;  5KHO A;  2NBU A;  5IA7 A;  2CU1 A;  2D3G A;  2DEN B;  2ZCC A;  2XK5 A;  1KLV A;  1Q5W B;  2RR9 A;  4GXB A;  2LXA A;  3RUL A;  3ZNG C;  3UQB A;  4IWQ A;  2IBI B;  4MM3 A;  2IZV B;  3DVG X;  1P3Q U;  2N1V A;  2A4Z A;  5DPR A;  2IY0 B;  1GJZ A;  2KTF A;  4EKU A;  5JH5 C;  2MSE D;  2AWT A;  1WGY A;  1WMH B;  4PS7 A;  5D94 A;  1I35 A;  1V5T A;  3ML9 A;  2DYM A;  3L13 A;  2DZM A;  3AUL A;  1TGZ B;  4K7U A;  1FXT B;  1GC7 A;  4II3 B;  4FA6 A;  1Q1O A;  2G4S A;  5AZG A;  1SE9 A;  3VTW A;  2MX2 A;  3SHQ A;  4FUL A;  3ZRF A;  3VH4 B;  4EZJ A;  1LM8 B;  1WJ4 A;  1X1M A;  4MEL A;  3U8Z A;  5CTR C;  3UGB B;  1WJ6 A;  1WXM A;  2KWV B;  1C3T A;  4JL9 A;  1Y8R C;  1GNU A;  3PLU A;  3RT3 B;  3QJZ A;  1UD7 A;  4W9L A;  2PEA A;  3OLM D;  5D2M B;  2WDT B;  2HD5 B;  3UIP B;  3QCA A;  2HTH A;  3ECI A;  4J6I A;  2N9P C;  4BFR A;  2DX5 B;  2MBQ A;  3JSV A;  2Y5B B;  4GSW A;  4I6P A;  3MTN B;  3JVZ X;  2XBB C;  2KFK A;  2LGD A;  1J8C A;  1T0Y A;  3VUW A;  3MJW A;  2KLC A;  1ZW7 A;  4KZC A;  4K7W A;  2GBK A;  3QAQ A;  3W1S C;  1GUA B;  1NDD A;  1WGD A;  2DHZ A;  4II2 B;  4AOF A;  4B9K A;  1IP9 A;  3QQ8 B;  2JRH A;  2LI5 A;  4M8M A;  1BT0 A;  2REX A;  2BPS A;  2MBE A;  2JZ3 B;  3TBL D;  4DHJ B;  2BWF A;  1SIF A;  2MBO A;  2BWE S;  3DDC B;  3NHE B;  4NY0 A;  2L0F A;  2LRW A;  3PS6 A;  1P1A A;  1WY8 A;  2I1K A;  5J18 A;  3ZUN A;  2OOB B;  2GBN A;  5FR6 A;  1S3S G;  4OVU A;  4X57 B;  3UQA A;  4GU2 A;  3DOW A;  1XD3 B;  4G50 A;  3M63 B;  5HKH A;  2K25 A;  1UBQ A;  5CHF A;  4EZK A;  2NR2 A;  4EUT A;  2K39 A;  1GC6 A;  1H4R A;  4MJS B;  2ZVO A;  2MWS B;  3RYT A;  4DHZ E;  2V1Y A;  2BYV E;  3PPA A;  4W9H A;  4ZDV A;  4HXD A;  3A33 B;  3V60 A;  3WA0 A;  4TKN A;  1WJN A;  4GMV A;  5CHV C;  5G2N A;  4MEM A;  3W1S A;  5JZE B;  2M8S A;  2KK8 A;  3CSF A;  4PS3 A;  3A9K B;  1ZGU B;  2WX0 A;  2KC1 A;  3VQI A;  3A4R A;  2KKC A;  3UIN B;  1IPG A;  2UYZ B;  2KJ6 A;  4LCD E;  2CHW A;  3VVW B;  3AI5 A;  1WMH A;  2CS4 A;  2R2O A;  1WE6 A;  3ZDT A;  3R66 C;  3PGE A;  3NZU A;  3H7S A;  2C7M B;  4K1R B;  1J19 A;  1WIA A;  1Z2M A;  2BKR B;  2EMS A;  2NBW B;  3D32 A;  4KZ0 A;  2KO3 A;  3K9O B;  3EFU A;  3EHV A;  3ENE A;  3WAN A;  2KX0 A;  3NY5 A;  4IWO A;  2FNJ B;  5D6J B;  4AJW A;  5DPW A;  2ZPY A;  1V6E A;  2Z59 B;  4WJQ A;  5G55 A;  4TUU A;  2IO0 B;  5LXI B;  1V81 A;  1NBF C;  2KHW B;  3WAM A;  4BKT A;  3H9D A;  2FCM A;  1I42 A;  2KTR B;  1QZE A;  1TZ1 A;  2GBM A;  4ANW A;  4DHJ D;  4GDK A;  3PT2 B;  3B0A A;  4FLH A;  4MGK E;  3VFK A;  4E71 A;  1YJ1 A;  2KOX A;  3ZNI D;  3ZO5 B;  4XX5 A;  2FUH B;  2KDI A;  5AEK B;  1OTR B;  2IY1 B;  1V86 A;  2NVU I;  1WH3 A;  3M3J A;  1WR6 E;  2LVQ A;  2O6V B;  2PE6 B;  3PHX B;  1WFY A;  2ZNV C;  3R3M A;  3AU4 A;  3T9L A;  3W1Y A;  5L83 A;  3IVF A;  4NAW B;  3QA8 A;  1JRU A;  3N32 A;  4G11 A;  1LFD A;  1EO6 A;  1CMX B;  2KAN A;  2KWC A;  4WAA A;  4CHK A;  1YIW A;  4ANX A;  4CYE A;  2BKF A;  3SD5 A;  2ZCB A;  3TL5 A;  4FJY A;  4OVV A;  3PRZ A;  2K8H A;  1Z5S B;  1KJT A;  3KH0 A;  4WJO A;  1L2N A;  2R2Q A;  3BY4 B;  3QC8 B;  4KIK A;  4NJ6 A;  1WX8 A;  4JLC A;  4WWO A;  1WZ3 A;  4IG7 B;  2ASQ A;  3S2A A;  3V6E B;  4PYU A;  2CR5 A;  2J0K A;  1LXD A;  3NZS A;  3VUY A;  4ANU A;  1XQQ A;  2DAF A;  3AU5 A;  4NPN A;  2HE7 A;  3VXW A;  3L10 B;  1WXV A;  4ICV A;  4TV3 A;  2OJR A;  2K1F A;  4MGZ E;  3ZTD A;  2VRR B;  4BOS C;  1WE7 A;  2BYF A;  4F7Z A;  3SU8 X;  1L7Y A;  3GOE A;  2N7D A;  2XEW A;  2PJH A;  3R7R A;  2K8C A;  2JUO A;  2MBB B;  2Z0E B;  3HIZ A;  3WIM A;  2D2Q A;  2NBV B;  4YL8 A;  2L0T A;  4DBG A;  5BO4 B;  1P98 A;  3ML8 A;  3DQV A;  4JGH B;  3N30 A;  4HCN B;  3DVN U;  2MP2 B;  2LGY A;  4G3X B;  2MLB A;  5E6P A;  3UF8 A;  4B95 A;  1S1Q B;  3A9J A;  2UWQ A;  1WGG A;  3A9K A;  3H7P B;  4BOZ B;  1G6J A;  4FAD A;  3PRM B;  3KUZ A;  3TCA A;  1R4M I;  4BBN C;  1E7V A;  2KMC A;  2B3A A;  2LXC A;  2KNB A;  3V61 A;  1UGM A;  2NPT B;  2RSU A;  3DBL I;  2O6V D;  1SGH A;  2LZ6 A;  3IHP C;  5IAA C;  4GDL B;  1PQS A;  2C60 A;  5LXH A;  1WI0 A;  1KM7 A;  4WWN A;  2I1J A;  2IYD B;  1WXS A;  1TBE A;  3APF A;  3ZIM A;  2J0J A;  3KUD B;  4PS8 A;  4GB9 A;  1WXA A;  2L7R A;  2Z0D B;  2K6D B;  4HK2 A;  5D7G A;  1ISN A;  2KC2 A; 
#chains in the Genus database with same CATH topology
 3L0W B;  3QX1 A;  2EKE C;  2ZW1 A;  2XK5 B;  4L2Y A;  2MA9 B;  3QK0 A;  4KVG B;  2ZW0 A;  2ZZP B;  1J7B A;  1WX7 A;  2KWU B;  4WIP A;  3PRP B;  4B6W A;  5FKA C;  3KVF B;  4BVU C;  4F8C B;  1MG4 A;  2MW5 A;  3WAL A;  4URK A;  2GOW A;  4ICU A;  2LVP A;  3VHT C;  1ZE3 D;  4HEA 1;  1E5W A;  4RM9 A;  3Q6B A;  4US8 A;  3BZD B;  1D5Z C;  1WZ0 A;  2W3R A;  4ARI A;  1FFV A;  3IT6 B;  3DHH C;  2M56 B;  3GE8 C;  2DZI A;  3AEC B;  3WAO A;  4OW0 A;  2ZNV B;  3Q3O C;  4RF1 A;  3KUC B;  2DZJ A;  1C1Y B;  2BYT A;  2H89 B;  2A5U A;  4GOC A;  2LGX A;  3AMZ A;  1N6Z A;  1M4V A;  4NZL B;  1K52 A;  1JWS D;  4RFB A;  1L5P A;  3EA6 A;  3FIL B;  2JXX A;  4HRO A;  1V1O A;  3J9C A;  2CHX A;  4ITK A;  4LNK A;  3HM3 A;  2RD0 A;  4REZ A;  2FCN A;  5J2R A;  3RNE C;  2IDY A;  4P6V F;  4RM8 A;  3RZW C;  4JE3 B;  3T3N A;  4RGN A;  3B08 A;  2L32 A;  2PE9 A;  3QWZ B;  4KKJ A;  2O2V B;  1EUV B;  2JT4 B;  4KGR A;  1I4P A;  2MCN B;  3TJP A;  2XNA C;  4MSQ B;  3Q3F A;  1HXY D;  3AEF B;  5FK9 C;  4MGY E;  3PHW B;  3ALB A;  3LDZ E;  2G1E A;  3DBS A;  4IM2 A;  3ABV B;  1RLF A;  1MHX A;  2V3S A;  2G45 B;  3AXC A;  2GMI C;  1N5X A;  4W9F A;  4TQ1 A;  2EKI A;  1F1H A;  1KLG D;  3V6C B;  2L76 A;  1J7C A;  1GPX A;  4GDK B;  2INN E;  2MBH A;  4ANV A;  3I63 C;  1ZDX A;  1UNS A;  2BGF A;  4FHJ A;  2N7J A;  2N4F A;  3I5J C;  4O1N A;  2JRI B;  3ONS A;  1FCC C;  3RD2 A;  3CMM B;  5EE0 A;  1YN3 A;  4YXD B;  3R2I A;  2AEH A;  2MRP A;  5DPT A;  3ZLZ A;  3Q8B A;  1ZKH A;  3ZW3 A;  1TKY A;  1ENF A;  3EUB 2;  3BYT B;  2KDF B;  3UIO B;  4YTN B;  5CHW A;  1TY0 A;  4BZA A;  2FAZ A;  4KIK B;  2KQ4 X;  4LDT B;  1QLB B;  1DGJ A;  2K6Q A;  4HCP B;  4GIV A;  4ACF A;  3HUI A;  4EOY A;  1OQY A;  1ZDV A;  5HG2 A;  3KYD D;  2C7N B;  4MDK E;  2L8J A;  2GLS A;  4A3P A;  1C77 A;  2G4D B;  1XF5 L;  4IM3 A;  4FBJ B;  3B2F A;  3VAW A;  3OAW A;  3CF6 E;  1WM3 A;  3BVM A;  1LO5 D;  3U7D A;  2LRU A;  3NOB A;  1FMA D;  1CK1 A;  3RN9 C;  3TSS A;  3N3K B;  2MP2 A;  3OG5 A;  1WJU A;  1YQ4 B;  4BBN F;  1EU3 A;  2QC8 A;  2MJD A;  3APD A;  1OQR A;  3BK2 A;  4W9G A;  4W9I A;  1F77 A;  2WXR A;  3JYU A;  2D11 A;  4M8N A;  1RWS A;  4AS1 A;  5GMV A;  2K3U A;  1RM6 C;  2KX3 A;  3VTU A;  1JWM D;  4DDG D;  3DVN V;  3H6N A;  1MI0 A;  4NQK E;  5G5G A;  2IJ0 A;  1MG8 A;  4ZRJ A;  3Q3J A;  3A1Q B;  4HJK A;  1ROE A;  2D3G A;  2XK5 A;  4GXB A;  2LXA A;  1GB4 A;  3RUL A;  5IN7 A;  1XEE A;  3AM9 A;  3WCQ A;  1FD6 A;  1Q10 A;  1FNV A;  5DPR A;  2IY0 B;  2MSE D;  1WMH B;  2LGI A;  1FNU A;  3P4S B;  1SE2 A;  1TGZ B;  1FXT B;  4II3 B;  3V05 A;  1Q1O A;  2VZK B;  1JQ4 A;  2MX2 A;  3SHQ A;  3AE7 B;  3VH4 B;  4R3D A;  5CTR C;  3UGB B;  1WJ6 A;  1WXM A;  1Y8R C;  1GNU A;  1TS4 A;  1UF0 A;  3QJZ A;  4N59 A;  5H8Y E;  1E6E B;  4W9L A;  2PEA A;  2EEL A;  5D2M B;  3AEE B;  3QCA A;  1AWD A;  1EWC A;  4I6P A;  3MTN B;  2XBB C;  2LGD A;  5BMH A;  1L4D B;  1J8C A;  3VUW A;  2GBK A;  3QAQ A;  1WGD A;  1K50 A;  2UU7 A;  1D6E C;  3VR9 B;  1IP9 A;  3QQ8 B;  2LGS A;  3ZXR A;  1VR9 A;  2MBO A;  3NHE B;  2WXI A;  1WY8 A;  2KAC A;  2LHD A;  3L4P A;  4OVU A;  1SJE D;  1XD3 B;  3RMK C;  3M63 B;  4YTM B;  2W55 A;  1UBQ A;  4EZK A;  2WXM A;  2NR2 A;  2K39 A;  4MJS B;  1VDV A;  3DBL B;  2V1Y A;  2BYV E;  1EU4 A;  3V60 A;  1VLB A;  4MEM A;  1CZP A;  1NI3 A;  3W1S A;  1XLP A;  4PS3 A;  4M01 A;  1ZGU B;  2KC1 A;  2KKC A;  2UYZ B;  3HRD D;  3AI5 A;  2R2O A;  5D3I B;  1J19 A;  4KZ0 A;  3ENE A;  3NY5 A;  2BVC A;  3IT4 B;  5LXI B;  1OFF A;  1I42 A;  4ANW A;  4GDK A;  3FAH A;  3VFK A;  2KOX A;  3ZNI D;  3AEG B;  2DWQ A;  4LNF A;  1OQQ A;  1WH3 A;  2RDH A;  2PE6 B;  1N62 A;  2FBW B;  3AE4 B;  3AU4 A;  2JQR B;  3IVF A;  4OZA A;  1LFD A;  1EO6 A;  4WAA A;  4ANX A;  3AEB B;  2ZCB A;  3TEZ A;  1L2N A;  3BY4 B;  3QC8 B;  4KIK A;  1XCQ L;  2QIE B;  1WRI A;  2ASQ A;  3S2A A;  3AE6 B;  4PYU A;  2CR5 A;  2J0K A;  3VXW A;  2HE7 A;  1QOG A;  3L10 B;  1C4P A;  4TV3 A;  2OJR A;  2LUM A;  4MGZ E;  2BYF A;  2E6X A;  1XCT L;  4JPS A;  2QIL A;  2N7D A;  3HIZ A;  4YL8 A;  2L0T A;  3ML8 A;  1HTQ A;  4G3X B;  5E6P A;  4B95 A;  1S1Q B;  1WGG A;  3H7P B;  4BOZ B;  4FAD A;  3PRM B;  3KUZ A;  1R4M I;  4BBN C;  3P63 A;  3RNG C;  2O6V D;  4P1C C;  4J3O D;  1V1P B;  2JX5 A;  2V3P A;  1BML C;  3APF A;  1TBE A;  5BYR A;  2J0J A;  2WXK A;  3KUD B;  2L7R A;  3NVY A;  3TEX A;  1K8R B;  3APC A;  4YSZ B;  2GBR A;  2WXP A;  3AE1 B;  4LJO B;  1OEY J;  3A1Q A;  5BMG A;  4NAW A;  5C2T B;  4USA A;  1DOI A;  4DK5 A;  2DYO A;  4A9A A;  1WGH A;  3BVG A;  2KDM A;  1D3Z A;  5L95 C;  3MJ5 A;  2BQQ A;  4OVZ A;  2D5G A;  2GBJ A;  4W9E A;  4HPM B;  1RFA A;  4NNJ B;  5E6N A;  2C7H A;  1ZOY B;  2GB1 A;  3X23 A;  2LFI A;  4RMA A;  1V9J A;  3O13 A;  3DBR I;  3NJT A;  4DXG A;  4RGM A;  2Y5P A;  5EDS A;  1PDX A;  4W9J A;  1PFD A;  1TIF A;  1HZ5 A;  2WGS A;  2KD0 A;  4K7S A;  2KQS A;  5JHB A;  1PGX A;  5DPS A;  1E0Z A;  4E74 A;  1C4C A;  1HTO A;  4BKS D;  1P9D U;  4EEW A;  2LD9 A;  5AZH A;  1IGC A;  3GS2 A;  1ZPS A;  2AL3 A;  2J52 A;  2LHE A;  2PIA A;  3GE3 C;  2BB6 A;  2HDE A;  1P0R A;  1T0S C;  3JW0 X;  4MJS A;  1J0G A;  5C23 A;  3NVV A;  3R2T A;  5J17 A;  1UH6 A;  1KRH A;  2KVZ A;  3LXF A;  1FXA A;  1WXQ A;  3K9P B;  4RGO S;  5HI1 A;  2NCN A;  4W9D A;  4LJP B;  4DDI D;  2X38 A;  5H92 C;  2M17 A;  4E3C A;  1WGK A;  2RPQ A;  2K9X A;  5E6J A;  1F0Z A;  2MQJ A;  1OEY A;  4K3C A;  3RCZ A;  5TR5 A;  5JHA A;  1WM2 A;  1LQB A;  4KGS A;  4NQL B;  4DXA B;  1E8Z A;  3Q8C A;  4A8X C;  2L83 A;  2JY6 A;  2KYW A;  1GG3 A;  4RNA A;  3PV1 A;  2L05 A;  2Y5C A;  4IKG A;  1WYG A;  1U4A A;  1E10 A;  4FJZ A;  4A90 A;  1JWA D;  1UZX B;  1RAX A;  3NS8 A;  2MJ3 A;  4N9F 4;  1UBI A;  1XT9 B;  5CX3 A;  1FO4 A;  2IO3 B;  1E8W A;  3ZYY X;  4TQ0 A;  1DYQ A;  2JZP A;  4A3O A;  2W54 A;  3P4P B;  3TMP B;  3P2B A;  3A9J B;  1JRP A;  3WAP A;  3W5V B;  5IOI A;  2N9E B;  1HA5 A;  1I4Q A;  2INP E;  3P4R B;  2N9L A;  3H7P A;  2IGG A;  3ETR A;  2BS4 B;  2N1W A;  2KZR A;  1AAR A;  2YEP F;  2ZEQ A;  2KLG A;  3KYC D;  4KX6 B;  3U4E G;  4ZRK A;  1OGW A;  1V1P A;  3VR8 B;  3BIN A;  4LDT D;  2WWZ A;  1TY2 A;  4WJP A;  1YD8 U;  2IND C;  3T8M A;  1FIQ A;  4W9K A;  3MHZ A;  2J7Q B;  1C76 A;  2N9X A;  2YVC A;  3VQI A;  3H1U A;  1V5O A;  2CU1 A;  1YN4 A;  1Q5W B;  2CU3 A;  1STE A;  5BYQ A;  2IZV B;  5IO9 A;  2WLB A;  2A4Z A;  1GJZ A;  2W3S A;  2AWT A;  4XGA B;  1ZXI A;  4MT5 A;  1MFW A;  1JWU D;  1I35 A;  3ML9 A;  3PZ8 A;  2DZM A;  3AUL A;  1GC7 A;  4FA6 A;  5AZG A;  1SE9 A;  5HFY A;  4HKQ A;  1LM8 B;  1X1M A;  3U8Z A;  2KWV B;  2WXG A;  1C3T A;  4JL9 A;  3PLU A;  1UD7 A;  1VZ8 A;  1FXI A;  3OLM D;  3UIP B;  3R8B A;  3KWL A;  4J6I A;  2MBQ A;  2Y5B B;  4DXF A;  3JVZ X;  2KFK A;  1ZW7 A;  1SBB B;  2QDF A;  4UDU C;  4AOF A;  4B9K A;  3W9C B;  2MH7 A;  2MBE A;  4DHJ B;  1SJH D;  2BWF A;  3NRZ A;  3DDC B;  2BWE S;  2L0F A;  3Q3M C;  3SEB A;  2LRW A;  1P1A A;  5J18 A;  4ZHO A;  2K25 A;  2N0S B;  1SE4 A;  1R4M B;  2VZK D;  1GC6 A;  2AX5 A;  4DHZ E;  1L6U A;  4JWU C;  3Q69 A;  3A33 B;  3BK1 A;  3CWI A;  1WJN A;  1CQV A;  2J4X A;  1SF0 A;  3NUH B;  2WX0 A;  4MAC A;  1HEZ E;  3UIN B;  2CHW A;  1PYW D;  2CS4 A;  4C00 A;  3AE8 B;  3H7S A;  2C7M B;  4K1R B;  2EMS A;  3D32 A;  3N1Y C;  1HZ6 A;  2FE8 A;  2H88 B;  2FNJ B;  5D6J B;  2ZPY A;  2Z59 B;  3PO0 A;  4WJQ A;  2KT7 A;  4LLG M;  1V81 A;  1NBF C;  4BKT A;  3H9D A;  1ESF A;  2FCM A;  2ICI A;  3B0A A;  4FLH A;  4MGK E;  4XX5 A;  3P42 A;  1GB1 A;  2IY1 B;  1WR6 E;  3ZQ4 A;  4TSS A;  2LVQ A;  4Q2J A;  3PHX B;  1WFY A;  2E3T A;  5L83 A;  3T9L A;  4NAW B;  1A70 A;  1C78 A;  4CHK A;  1GAQ B;  3DBR B;  4FJY A;  4OVV A;  2BS3 B;  2K8H A;  2R2Q A;  3BVZ A;  4ZYS A;  3SR6 A;  2G9H D;  5EE1 A;  4IG7 B;  1NEN B;  3V6E B;  4YWG G;  4WWM A;  4ANU A;  1XQQ A;  3AU5 A;  3T3O A;  1QOB A;  4ICV A;  5BYS A;  1QIL A;  3NS1 A;  2BW2 A;  2JUO A;  1MPE A;  3Q14 C;  4DBG A;  3B9J A;  4HCN B;  3UF8 A;  2XN9 C;  3A9J A;  2UWQ A;  3A9K A;  3GZN B;  1VZ7 A;  1VJK A;  2BB5 A;  1ET6 A;  2AQ3 B;  3KWV A;  2KMC A;  5AUK A;  4FXC A;  1UGM A;  2RSU A;  1SGH A;  2LZ6 A;  2Z8L A;  3IHP C;  5IAA C;  4GDL B;  1WI0 A;  2I1J A;  2I2Y A;  1SXT A;  4K3B A;  2WU5 B;  3ZIM A;  1FPY A;  4XDC A;  2K6D B;  4L1B A;  4HK2 A;  2KC2 A;  4FJV B;  1V49 A;  3ZVV A;  3QAR A;  4HKZ E;  4TMA B;  3AB5 A;  4EZL A;  2EMT A;  5DCN A;  4KSK C;  4MM3 B;  2JSV X;  1WSP A;  4JQW C;  1T5X D;  2B76 B;  3OJ3 A;  2PLP A;  4HDO A;  2JU6 X;  2L00 B;  3QIJ A;  4M0W B;  2GI9 A;  2Y3A A;  2M0X A;  3RNB C;  4C56 C;  1EF5 A;  2IO2 B;  2FID A;  4WQO B;  2IO1 B;  4KGT A;  3I9V 1;  4GN1 A;  1SIJ A;  4IM0 A;  2WX1 A;  2KVR A;  3HK0 A;  3FC4 A;  3X0W A;  1WRD B;  4OHJ A;  3OJ4 B;  3ZNH B;  1TTN A;  4AUQ C;  3C0R B;  1V2Y A;  1KOT A;  4I6N B;  1DOX A;  1WF9 A;  2D3C A;  2J53 A;  2RDG A;  3AEA B;  2M4N A;  2VH1 A;  1WGR A;  3L08 A;  2L1A A;  1QOA A;  3DHG C;  4FN2 A;  2M19 A;  4L23 A;  4ZOH C;  2K8B A;  4IWP A;  2M0A A;  2ZVN A;  4FHK A;  4RGT A;  1NYR A;  4HWI B;  2V4L A;  4ASW C;  2V0G A;  1T6B X;  2NTS A;  4OZC A;  2FCQ A;  2KDB A;  4XE0 A;  2K0P A;  3I3T B;  4A20 A;  4MGI E;  2LWP A;  1WR1 A;  4ZRP A;  2YEP B;  3CST A;  1J7A A;  1JWB D;  2KJH B;  4HJG E;  3L16 A;  1V97 A;  2W9N A;  2IPK D;  4GLS C;  3ZTC A;  2D07 B;  1RFK A;  3B1L X;  3PLV A;  2JWZ A;  2PPH A;  2BYE A;  2JWU A;  1JCK B;  3LJ3 A;  1V80 A;  2RPV A;  4AP4 C;  1UEL A;  2X8X X;  1AYF A;  3L54 A;  4RF0 A;  1MJD A;  4KV2 A;  3URY A;  3RUI B;  2CHZ A;  4WWP A;  1WYW B;  2PVO D;  2PMV A;  2NS5 A;  2LAS A;  3ZJV A;  2KWD A;  1M94 A;  3VTV A;  3ZXV A;  4DHZ B;  1IBX B;  1H8C A;  1FFU A;  4ZRQ A;  4HRS A;  2BS2 B;  1F9J A;  2RMM A;  4MSM B;  3PZD A;  1FNW A;  2JYT A;  3ZRC A;  3TIX A;  1XO3 A;  2D3A A;  1NEK B;  3HM6 X;  3V3X A;  3VDZ A;  4AQ7 A;  3PTF C;  2WXF A;  2QMT A;  2MHJ A;  2NTT A;  3PVL A;  2KFK B;  2OHF A;  4M02 A;  3DPD A;  1C9F A;  2BF8 B;  4IDI A;  4YTP B;  3AE9 B;  2LUE A;  4WJN A;  2LJI A;  4N58 A;  2DYB A;  4GDL A;  3DBH I;  5BMI A;  3GB1 A;  3KQ4 A;  1C79 A;  4XZ4 A;  3RZF A;  2N7E A;  3GZN I;  4XYC A;  1IYF A;  1VCB A;  1EF1 A;  2LVO A;  1E8X A;  5KHO A;  5IA7 A;  3AN1 A;  3AV8 A;  2RR9 A;  1KLV A;  2KMM A;  3UQB A;  4IWQ A;  3P4Q B;  2IBI B;  4M00 A;  4MM3 A;  3AED B;  2N1V A;  2LMC A;  1DOY A;  1FCL A;  1WGY A;  3N9Y C;  4PS7 A;  5D94 A;  1V5T A;  3BWU D;  3L13 A;  4EE2 A;  4K7U A;  4M0W A;  2DBY A;  3VTW A;  1AN8 A;  3ZRF A;  1WJ4 A;  2SAK A;  4MEL A;  1FEH A;  4YSY B;  1XXG A;  3RPF C;  1BUI C;  2HTH A;  1ZUD 2;  2CJO A;  4BFR A;  1TKG A;  4GSW A;  1KTK A;  4NAM A;  3Q8F A;  2PTL A;  1I4G A;  1T0Y A;  3NG0 A;  1TJE A;  2KLC A;  3MJW A;  4LNN A;  4KZC A;  4K7W A;  3W1S C;  1V8C A;  1GUA B;  1EM7 A;  1NDD A;  1T0R C;  4II2 B;  2JRH A;  1L6V A;  2JXT A;  2LI5 A;  4M8M A;  3BII D;  3RNF C;  2REX A;  1SIF A;  2HJ1 A;  2PVG C;  3IAM 1;  2OOB B;  5FR6 A;  3UQA A;  1FM0 D;  4X57 B;  3DOW A;  3ZGZ A;  5HKH A;  2PKO A;  4C7Z A;  5G5H A;  1ZXH A;  1H4R A;  2MWS B;  3RYT A;  4ZDV A;  3PPA A;  3C8Y A;  2QJL A;  4QAY A;  3MP9 A;  3WA0 A;  5CHV C;  1D4B A;  5G2N A;  1D5X C;  5JZE B;  3CSF A;  3A9K B;  2DNF A;  4C4V A;  3ZJU A;  1IPG A;  3RNA C;  1E7P B;  2AQ1 B;  1CJE A;  3ZDT A;  3R66 C;  3PGE A;  2W82 A;  1WIA A;  1D5M C;  2BKR B;  3N20 C;  3K9O B;  1TT5 B;  3EHV A;  3WAN A;  2KX0 A;  4IWO A;  4KKI A;  1QOF A;  5G55 A;  1V6E A;  2IO0 B;  3WAM A;  2KTR B;  1QZE A;  1TZ1 A;  2GBM A;  4DHJ D;  2WHI A;  3PT2 B;  4E71 A;  1YJ1 A;  1F2R C;  1UGJ A;  2FUH B;  5JXV A;  4ZHP A;  5LNK 1;  1KLU D;  2KDI A;  5AEK B;  2NVU I;  1B1Z A;  4WUR A;  2L52 A;  3R3M A;  4XWW A;  3N1X C;  1JRU A;  4RH6 A;  1UUP A;  4G11 A;  3RNC C;  1CMX B;  2KAN A;  1YMH E;  1YN5 A;  2KWC A;  1YIW A;  3SD5 A;  3W5U B;  1BXT A;  1ACC A;  1Z5S B;  1KJT A;  3KH0 A;  2WP9 B;  3TUO A;  4JLC A;  1YOV B;  4WQM A;  5T8I A;  2DAF A;  4NPN A;  2ACZ B;  1WXV A;  4IOI E;  1IBX A;  2K1F A;  3ZTD A;  2VRR B;  1WE7 A;  4F7Z A;  3SU8 X;  1L7Y A;  1MVK A;  3H8H A;  3GOE A;  3R7R A;  2Z0E B;  3C19 A;  3WIM A;  5BO4 B;  1P98 A;  3DQV A;  3DVN U;  1XLO A;  2WXN A;  4US9 A;  3Q8A A;  4B0E A;  1G6J A;  3UI3 A;  2GRI A;  1QKZ A;  2N9K A;  1TS2 A;  1E7V A;  3NZ3 A;  2LXC A;  3AE2 B;  2KNB A;  3V61 A;  4H2A A;  2NPT B;  1ET9 A;  1PQS A;  2C60 A;  5LXH A;  2D3B A;  4XWT A;  2IYD B;  1WXS A;  4CQN A;  3RFZ B;  5D3D A;  3AE5 B;  4GB9 A;  2IGH A;  1PGA A;  4A6Q A;  1ISN A;  1SE3 A;  3MC0 B;  5EE3 A;  2OED A;  1PGB A;  2KJR A;  1RYJ A;  2PW9 A;  3HHM A;  2IGD A;  1R4N I;  2O6V A;  4C7Y A;  2ZPN A;  3VUX A;  2CKH B;  2KXJ A;  5C3J B;  2FUG 1;  2ONQ A;  4F1S A;  3TEW A;  1FRR A;  2TSS A;  4HDQ A;  2BTE A;  1SSN A;  3ZNZ B;  2ON8 A;  1UWM A;  4P1B C;  1HE8 A;  3EC8 A;  5HHD G;  2J42 A;  3VRA B;  4NJ7 A;  2ZJD A;  4MH0 E;  3U30 A;  4WAF A;  4HLE A;  5E6O A;  2LEK A;  2AL6 A;  4KSL C;  4GGQ A;  1WX9 A;  2WDR B;  3AE3 B;  4XC2 A;  1P7E A;  3OWE B;  5LLI A;  1YX5 B;  2BT6 A;  2G3Q B;  4ZRI A;  3B2G A;  3JSV B;  4IUM B;  4P7I A;  3ZDM C;  5C1Z A;  2HJ8 A;  3DCG A;  3PSE B;  1NI2 A;  2Q5W D;  2I38 A;  4K81 A;  1AW7 A;  4LNI A;  2SEB D;  1KFY B;  2JZZ A;  2KDE B;  1WWT A;  4KDI C;  2YLM A;  2KFJ A;  3PRE A;  1Y56 A;  1LGR A;  1QQR A;  1YQ3 B;  3Q2A C;  4DWF A;  2V9H A;  4P16 A;  2JYE A;  4G0N B;  4XDD A;  2FCS A;  4I6L B;  3R7Q A;  3TEY A;  5TSS A;  4IW0 A;  1UWX A;  1IGD A;  1QF6 A;  1Q0W B;  2KN5 A;  1N63 A;  5AZF A;  4AWJ A;  1E90 A;  4PT5 A;  3DBH B;  2KN4 A;  4BKS A;  4KDL B;  1E7U A;  2WU2 B;  1L0Y B;  4D2K A;  3IBE A;  1YJI A;  1YNT E;  2QSD A;  3M95 A;  2WXQ A;  5I4D A;  1NVI D;  2M1M A;  1VD2 A;  5IKC M;  2D10 A;  1L0X B;  2RGF A;  4HVB A;  4HPL B;  2QHO A;  3IG3 A;  2J0M A;  3M62 B;  2KTR A;  1TS5 A;  2WXO A;  3SDL C;  4CO7 A;  3O65 B;  3QHT A;  2JPH A;  1E8Y A;  4AJY B;  5GXG B;  2MJE A;  2BBC A;  2WNM A;  4PYZ A;  4LNO A;  1VZ6 A;  2DAJ A;  3FIL A;  3SFD B;  3DVG Y;  2L3Z A;  2AQ2 B;  2DZK A;  3VH3 B;  2INC C;  2R61 A;  2WQY B;  3A4S C;  3E56 A;  4WH4 A;  1R7S A;  4EFO A;  3IFW B;  3ZKJ C;  2WYQ A;  1YX6 B;  1QT9 A;  2WS3 B;  2JVC A;  3EEC A;  3EFC A;  1L4Z B;  3P1M A;  2O2V A;  4BKG A;  4YSX B;  1YQB A;  5MPO A;  4RCO A;  3KW5 B;  3GP7 A;  1TS3 A;  2HTM E;  3HVD A;  2KQ7 A;  2FIF A;  1HQR D;  4IC7 B;  1N60 A;  1SB3 C;  4W9C A;  2C9W B;  1SEB D;  2AYO B;  3L17 A;  4JIO U;  1XLN A;  5KHQ A;  1IUE A;  1JAL A;  3E9S A;  3NVW A;  4JWS C;  2NPT A;  1TZO A;  3V62 A;  4A55 A;  2VH2 A;  3LYY A;  4ARC A;  2JF5 A;  1A5R A;  2C5L C;  1JRO A;  4ZYN A;  1RRB A;  3MHS D;  2LJ5 A;  3IAS 1;  1ZP0 B;  2WXH A;  1JW9 D;  2KMA A;  1I4X A;  2NBU A;  3Q3N C;  1KH0 A;  2DEN B;  2ZCC A;  4LTU A;  3DHI C;  1T3Q A;  2WDQ B;  3ZNG C;  4B0M A;  4DQO C;  3DVG X;  1P3Q U;  3FKY A;  3LB8 C;  4C4V B;  1P7F A;  2KTF A;  4EKU A;  5JH5 C;  1TKE A;  2DYM A;  3SFE B;  1XLQ A;  1YJJ A;  1TYG B;  2G4S A;  5FR3 A;  4FUL A;  3MFG A;  4EZJ A;  4MH8 A;  4JX1 C;  2OJW A;  2WXL A;  3RT3 B;  1VRA B;  1K53 A;  2WDT B;  2HD5 B;  4PK1 A;  3Q8E A;  3ECI A;  2N9P C;  2DX5 B;  3JSV A;  1KF6 B;  1F2R I;  4S17 A;  1I4R A;  2QEJ C;  4LK0 M;  4BAX A;  2K5P A;  4OZB A;  2DHZ A;  1E9M A;  1BT0 A;  3I57 A;  2BPS A;  3TBL D;  2JZ3 B;  4NY0 A;  3PS6 A;  3RI7 C;  2DLB A;  2I1K A;  3ZUN A;  2GBN A;  1S3S G;  4GU2 A;  1I7H A;  4G50 A;  3MC9 A;  5CHF A;  1I4H A;  2MEK A;  4EUT A;  2ZVO A;  3N1Z C;  2CJN A;  4W9H A;  1GOZ A;  4HXD A;  3DWG C;  2QCZ A;  4TKN A;  4GMV A;  2WDV B;  2M8S A;  2KK8 A;  1F52 A;  3A4R A;  2KJ6 A;  2WXJ A;  4LCD E;  3VVW B;  1WMH A;  3HVZ A;  1WE6 A;  3DWM A;  1C4A A;  3NZU A;  4N6E B;  4S0R A;  3VRB B;  1EWY C;  1Z2M A;  2NBW B;  2KO3 A;  3EFU A;  4AJW A;  1R4N B;  5IP4 D;  2NMQ A;  5DPW A;  4TUU A;  2KHW B;  1N5W A;  3ZO5 B;  1N61 A;  2KAJ A;  1OTR B;  1V86 A;  3IXS A;  3M3J A;  1L0V B;  2O6V B;  3BYY B;  4C80 A;  3ZJT A;  2ZNV C;  3W1Y A;  3QA8 A;  3N32 A;  3U2S C;  4CYE A;  2BKF A;  3TL5 A;  3CIR B;  3PRZ A;  4WJO A;  2RDB C;  4NJC A;  3EGR A;  4NJ6 A;  1WX8 A;  3W2D A;  1MHH E;  4WWO A;  1WZ3 A;  1FRD A;  1LXD A;  3NZS A;  3VUY A;  1NYQ A;  4YT0 B;  3KLS X;  2V3N A;  4BOS C;  1B9R A;  2XEW A;  2PJH A;  2K8C A;  2MBB B;  3U52 E;  2D2Q A;  2NBV B;  1JML A;  3MC8 A;  4JGH B;  3N30 A;  3NVZ A;  2MP2 B;  2LGY A;  2MLB A;  5AUI A;  1T0Q C;  1K51 A;  3TCA A;  2B3A A;  1PUT A;  3DBL I;  4HPP A;  1KM7 A;  2K22 A;  4WWN A;  5EE9 A;  3U7Z A;  2V4I B;  3AH7 A;  4PS8 A;  1WXA A;  3PZ7 A;  2Z0D B;  5D7G A; 
#chains in the Genus database with same CATH homology
 3L0W B;  4FJV B;  1V49 A;  3ZVV A;  2KJR A;  3QAR A;  3QX1 A;  1K8R B;  3APC A;  2EKE C;  2XK5 B;  2GBR A;  4EZL A;  4LJO B;  2MA9 B;  3HHM A;  2EMT A;  1R4N I;  2O6V A;  1OEY J;  2ZZP B;  3QK0 A;  4KVG B;  5DCN A;  4KSK C;  3A1Q A;  1WX7 A;  2KWU B;  4NAW A;  2ZPN A;  3PRP B;  2CKH B;  4JQW C;  3VUX A;  2KXJ A;  4B6W A;  4F1S A;  4HDQ A;  3KVF B;  3OJ3 A;  4BVU C;  4DK5 A;  2DYO A;  4F8C B;  2MW5 A;  4HDO A;  3ZNZ B;  3WAL A;  1WGH A;  2L00 B;  3QIJ A;  4URK A;  1HE8 A;  2GOW A;  4M0W B;  3EC8 A;  1D3Z A;  4ICU A;  2LVP A;  5L95 C;  2M0X A;  3VHT C;  1E5W A;  1EF5 A;  2IO2 B;  2FID A;  4RM9 A;  4WQO B;  2GBJ A;  4W9E A;  4HPM B;  1RFA A;  4NNJ B;  5E6N A;  4NJ7 A;  2ZJD A;  4MH0 E;  1WZ0 A;  2C7H A;  2IO1 B;  3U30 A;  3X23 A;  4GN1 A;  4HLE A;  5E6O A;  4IM0 A;  4RMA A;  2AL6 A;  4KSL C;  1V9J A;  2DZI A;  4GGQ A;  1WX9 A;  3WAO A;  2ZNV B;  4XC2 A;  3DBR I;  2WX1 A;  3KUC B;  5LLI A;  1YX5 B;  2KVR A;  2DZJ A;  2G3Q B;  3HK0 A;  4ZRI A;  3JSV B;  4IUM B;  4P7I A;  3ZDM C;  5C1Z A;  2HJ8 A;  3X0W A;  1WRD B;  3DCG A;  3PSE B;  1C1Y B;  3OJ4 B;  3ZNH B;  1TTN A;  4AUQ C;  5EDS A;  1NI2 A;  3C0R B;  1V2Y A;  4W9J A;  1KOT A;  4K81 A;  4I6N B;  2A5U A;  4GOC A;  1WF9 A;  2LGX A;  2M4N A;  1WGR A;  3L08 A;  2JZZ A;  2KDE B;  4KDI C;  2KD0 A;  4FN2 A;  2YLM A;  2KFJ A;  4K7S A;  2KQS A;  5JHB A;  3PRE A;  5DPS A;  2JXX A;  2K8B A;  2CHX A;  4IWP A;  4DWF A;  4E74 A;  2ZVN A;  4FHK A;  3HM3 A;  4BKS D;  1P9D U;  4HWI B;  2V4L A;  2RD0 A;  4ASW C;  4EEW A;  2FCN A;  5J2R A;  4G0N B;  2LD9 A;  2FCS A;  2FCQ A;  4RM8 A;  5AZH A;  3RZW C;  2AL3 A;  2KDB A;  3B08 A;  4I6L B;  2PE9 A;  3QWZ B;  3R7Q A;  3I3T B;  4IW0 A;  2O2V B;  1EUV B;  2JT4 B;  4MGI E;  4A20 A;  1P0R A;  3JW0 X;  2MCN B;  2LWP A;  3TJP A;  1WR1 A;  1Q0W B;  4MJS A;  2KN5 A;  5AZF A;  4MSQ B;  4AWJ A;  3CST A;  3Q3F A;  1E90 A;  4MGY E;  1J0G A;  3PHW B;  3ALB A;  3LDZ E;  2KJH B;  5C23 A;  3DBS A;  3L16 A;  5J17 A;  1UH6 A;  2W9N A;  4IM2 A;  4BKS A;  4KDL B;  3K9P B;  1E7U A;  3ZTC A;  1RLF A;  2D07 B;  3IBE A;  2V3S A;  2G45 B;  3AXC A;  2NCN A;  2GMI C;  3B1L X;  4W9F A;  4TQ1 A;  3M95 A;  4W9D A;  3V6C B;  2L76 A;  2M1M A;  1VD2 A;  4LJP B;  4DDI D;  2D10 A;  4HVB A;  2RGF A;  4GDK B;  2M17 A;  2MBH A;  3PLV A;  4HPL B;  4ANV A;  2JWZ A;  2PPH A;  4E3C A;  2BGF A;  2BYE A;  2QHO A;  2RPQ A;  2MQJ A;  3IG3 A;  4FHJ A;  2N4F A;  2J0M A;  3M62 B;  1OEY A;  3LJ3 A;  3RCZ A;  5TR5 A;  2JRI B;  5JHA A;  2KTR A;  3ONS A;  1V80 A;  1WM2 A;  3RD2 A;  1LQB A;  3CMM B;  3SDL C;  4NQL B;  4CO7 A;  2AEH A;  2MRP A;  3O65 B;  1E8Z A;  4DXA B;  5DPT A;  3QHT A;  2JPH A;  1E8Y A;  3ZLZ A;  2JY6 A;  1ZKH A;  4AJY B;  3ZW3 A;  4AP4 C;  1UEL A;  1GG3 A;  3L54 A;  3PV1 A;  2KDF B;  2L05 A;  3UIO B;  5CHW A;  4KV2 A;  2FAZ A;  4KIK B;  4PYZ A;  3RUI B;  2DAJ A;  4LDT B;  2CHZ A;  4WWP A;  1WYW B;  3DVG Y;  2L3Z A;  1U4A A;  2K6Q A;  2NS5 A;  4FJZ A;  4HCP B;  2DZK A;  2LAS A;  4GIV A;  3VH3 B;  4EOY A;  3A4S C;  4EFO A;  1OQY A;  1UZX B;  3IFW B;  1M94 A;  3VTV A;  3ZKJ C;  2WYQ A;  4DHZ B;  3KYD D;  1RAX A;  2C7N B;  4MDK E;  3NS8 A;  2L8J A;  1H8C A;  1YX6 B;  4N9F 4;  1UBI A;  1XT9 B;  2JVC A;  5CX3 A;  3EEC A;  1F9J A;  2IO3 B;  4MSM B;  4A3P A;  2G4D B;  1E8W A;  3PZD A;  2O2V A;  4IM3 A;  4TQ0 A;  3ZRC A;  4A3O A;  3TIX A;  4FBJ B;  4BKG A;  1YQB A;  3TMP B;  3VAW A;  3OAW A;  3HM6 X;  3VDZ A;  3CF6 E;  3P2B A;  3A9J B;  3KW5 B;  3PTF C;  1WM3 A;  3U7D A;  3WAP A;  2LRU A;  3NOB A;  2KQ7 A;  2N9E B;  2FIF A;  3PVL A;  3N3K B;  2MP2 A;  2KFK B;  4IC7 B;  1WJU A;  4BBN F;  4W9C A;  2C9W B;  3DPD A;  3H7P A;  2AYO B;  3APD A;  3L17 A;  2BF8 B;  2N1W A;  4JIO U;  5KHQ A;  2KZR A;  1AAR A;  2ZEQ A;  3KYC D;  2KLG A;  4W9G A;  2LUE A;  4W9I A;  4WJN A;  2NPT A;  4ZRK A;  3JYU A;  2D11 A;  3V62 A;  2DYB A;  4M8N A;  1OGW A;  4GDL A;  3DBH I;  3BIN A;  2JF5 A;  4LDT D;  4XZ4 A;  2C5L C;  3RZF A;  2WWZ A;  1A5R A;  5GMV A;  4ZYN A;  2N7E A;  1RRB A;  3MHS D;  4WJP A;  2KX3 A;  2LJ5 A;  3VTU A;  3GZN I;  1YD8 U;  4DDG D;  3DVN V;  3H6N A;  4NQK E;  3T8M A;  1IYF A;  1VCB A;  4W9K A;  1MG8 A;  4ZRJ A;  2J7Q B;  1EF1 A;  2LVO A;  2KMA A;  2N9X A;  2YVC A;  1V5O A;  3A1Q B;  3H1U A;  3Q3J A;  4HJK A;  1E8X A;  5KHO A;  2NBU A;  5IA7 A;  2CU1 A;  2D3G A;  2DEN B;  2ZCC A;  2XK5 A;  1KLV A;  1Q5W B;  2RR9 A;  4GXB A;  2LXA A;  3RUL A;  3ZNG C;  3UQB A;  4IWQ A;  2IBI B;  4MM3 A;  2IZV B;  3DVG X;  1P3Q U;  2N1V A;  2A4Z A;  5DPR A;  2IY0 B;  1GJZ A;  2KTF A;  4EKU A;  5JH5 C;  2MSE D;  2AWT A;  1WGY A;  1WMH B;  4PS7 A;  5D94 A;  1I35 A;  1V5T A;  3ML9 A;  2DYM A;  3L13 A;  2DZM A;  3AUL A;  1TGZ B;  4K7U A;  1FXT B;  1GC7 A;  4II3 B;  4FA6 A;  1Q1O A;  2G4S A;  5AZG A;  1SE9 A;  3VTW A;  2MX2 A;  3SHQ A;  4FUL A;  3ZRF A;  3VH4 B;  4EZJ A;  1LM8 B;  1WJ4 A;  1X1M A;  4MEL A;  3U8Z A;  5CTR C;  3UGB B;  1WJ6 A;  1WXM A;  2KWV B;  1C3T A;  4JL9 A;  1Y8R C;  1GNU A;  3PLU A;  3RT3 B;  3QJZ A;  1UD7 A;  4W9L A;  2PEA A;  3OLM D;  5D2M B;  2WDT B;  2HD5 B;  3UIP B;  3QCA A;  2HTH A;  3ECI A;  4J6I A;  2N9P C;  4BFR A;  2DX5 B;  2MBQ A;  3JSV A;  2Y5B B;  4GSW A;  4I6P A;  3MTN B;  3JVZ X;  2XBB C;  2KFK A;  2LGD A;  1J8C A;  1T0Y A;  3VUW A;  3MJW A;  2KLC A;  1ZW7 A;  4KZC A;  4K7W A;  2GBK A;  3QAQ A;  3W1S C;  1GUA B;  1NDD A;  1WGD A;  2DHZ A;  4II2 B;  4AOF A;  4B9K A;  1IP9 A;  3QQ8 B;  2JRH A;  2LI5 A;  4M8M A;  1BT0 A;  2REX A;  2BPS A;  2MBE A;  2JZ3 B;  3TBL D;  4DHJ B;  2BWF A;  1SIF A;  2MBO A;  2BWE S;  3DDC B;  3NHE B;  4NY0 A;  2L0F A;  2LRW A;  3PS6 A;  1P1A A;  1WY8 A;  2I1K A;  5J18 A;  3ZUN A;  2OOB B;  2GBN A;  5FR6 A;  1S3S G;  4OVU A;  4X57 B;  3UQA A;  4GU2 A;  3DOW A;  1XD3 B;  4G50 A;  3M63 B;  5HKH A;  2K25 A;  1UBQ A;  5CHF A;  4EZK A;  2NR2 A;  4EUT A;  2K39 A;  1GC6 A;  1H4R A;  4MJS B;  2ZVO A;  2MWS B;  3RYT A;  4DHZ E;  2V1Y A;  2BYV E;  3PPA A;  4W9H A;  4ZDV A;  4HXD A;  3A33 B;  3V60 A;  3WA0 A;  4TKN A;  1WJN A;  4GMV A;  5CHV C;  5G2N A;  4MEM A;  3W1S A;  5JZE B;  2M8S A;  2KK8 A;  3CSF A;  4PS3 A;  3A9K B;  1ZGU B;  2WX0 A;  2KC1 A;  3VQI A;  3A4R A;  2KKC A;  3UIN B;  1IPG A;  2UYZ B;  2KJ6 A;  4LCD E;  2CHW A;  3VVW B;  3AI5 A;  1WMH A;  2CS4 A;  2R2O A;  1WE6 A;  3ZDT A;  3R66 C;  3PGE A;  3NZU A;  3H7S A;  2C7M B;  4K1R B;  1J19 A;  1WIA A;  1Z2M A;  2BKR B;  2EMS A;  2NBW B;  3D32 A;  4KZ0 A;  2KO3 A;  3K9O B;  3EFU A;  3EHV A;  3ENE A;  3WAN A;  2KX0 A;  3NY5 A;  4IWO A;  2FNJ B;  5D6J B;  4AJW A;  5DPW A;  2ZPY A;  1V6E A;  2Z59 B;  4WJQ A;  5G55 A;  4TUU A;  2IO0 B;  5LXI B;  1V81 A;  1NBF C;  2KHW B;  3WAM A;  4BKT A;  3H9D A;  2FCM A;  1I42 A;  2KTR B;  1QZE A;  1TZ1 A;  2GBM A;  4ANW A;  4DHJ D;  4GDK A;  3PT2 B;  3B0A A;  4FLH A;  4MGK E;  3VFK A;  4E71 A;  1YJ1 A;  2KOX A;  3ZNI D;  3ZO5 B;  4XX5 A;  2FUH B;  2KDI A;  5AEK B;  1OTR B;  2IY1 B;  1V86 A;  2NVU I;  1WH3 A;  3M3J A;  1WR6 E;  2LVQ A;  2O6V B;  2PE6 B;  3PHX B;  1WFY A;  2ZNV C;  3R3M A;  3AU4 A;  3T9L A;  3W1Y A;  5L83 A;  3IVF A;  4NAW B;  3QA8 A;  1JRU A;  3N32 A;  4G11 A;  1LFD A;  1EO6 A;  1CMX B;  2KAN A;  2KWC A;  4WAA A;  4CHK A;  1YIW A;  4ANX A;  4CYE A;  2BKF A;  3SD5 A;  2ZCB A;  3TL5 A;  4FJY A;  4OVV A;  3PRZ A;  2K8H A;  1Z5S B;  1KJT A;  3KH0 A;  4WJO A;  1L2N A;  2R2Q A;  3BY4 B;  3QC8 B;  4KIK A;  4NJ6 A;  1WX8 A;  4JLC A;  4WWO A;  1WZ3 A;  4IG7 B;  2ASQ A;  3S2A A;  3V6E B;  4PYU A;  2CR5 A;  2J0K A;  1LXD A;  3NZS A;  3VUY A;  4ANU A;  1XQQ A;  2DAF A;  3AU5 A;  4NPN A;  2HE7 A;  3VXW A;  3L10 B;  1WXV A;  4ICV A;  4TV3 A;  2OJR A;  2K1F A;  4MGZ E;  3ZTD A;  2VRR B;  4BOS C;  1WE7 A;  2BYF A;  4F7Z A;  3SU8 X;  1L7Y A;  3GOE A;  2N7D A;  2XEW A;  2PJH A;  3R7R A;  2K8C A;  2JUO A;  2MBB B;  2Z0E B;  3HIZ A;  3WIM A;  2D2Q A;  2NBV B;  4YL8 A;  2L0T A;  4DBG A;  5BO4 B;  1P98 A;  3ML8 A;  3DQV A;  4JGH B;  3N30 A;  4HCN B;  3DVN U;  2MP2 B;  2LGY A;  4G3X B;  2MLB A;  5E6P A;  3UF8 A;  4B95 A;  1S1Q B;  3A9J A;  2UWQ A;  1WGG A;  3A9K A;  3H7P B;  4BOZ B;  1G6J A;  4FAD A;  3PRM B;  3KUZ A;  3TCA A;  1R4M I;  4BBN C;  1E7V A;  2KMC A;  2B3A A;  2LXC A;  2KNB A;  3V61 A;  1UGM A;  2NPT B;  2RSU A;  3DBL I;  2O6V D;  1SGH A;  2LZ6 A;  3IHP C;  5IAA C;  4GDL B;  1PQS A;  2C60 A;  5LXH A;  1WI0 A;  1KM7 A;  4WWN A;  2I1J A;  2IYD B;  1WXS A;  1TBE A;  3APF A;  3ZIM A;  2J0J A;  3KUD B;  4PS8 A;  4GB9 A;  1WXA A;  2L7R A;  2Z0D B;  2K6D B;  4HK2 A;  5D7G A;  1ISN A;  2KC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...