1GOZA

Structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
228
Chain Sequence
b'ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKDKRKSCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENTEROTOXIN TYPE B
publication title Structural and Functional Role of Threonine 112 in a Superantigen Staphylococcus Aureus Enterotoxin B.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Enterotoxin
total genus 64
structure length 228
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1gozA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gozA02
4TSSA 3R2TA 4RHRA 3TSSA 2IPKD 4RFBA 1HQRD 3GP7A 1YN4A 1HTLD 1V1OA 1B1ZA 2IJ0A 1I4RA 1TS5A 1PTOF 1ENFA 1LT3D 1LTSD 1CQVA 1JR0D 1I4GA 5ELCA 1TY2A 3OWEB 4L63B 1G8ZD 4RGMA 1JWMD 1S5ED 1LTGD 1LTRD 1SEBD 4RGTA 1YN3A 2R61A 1PTOD 2AQ1B 1DYQA 4ZYSA 2RDGA 3URYA 1TS3A 1EU4A 4RGOS 3DWPA 1UNSA 1TS2A 2WV6D 1PTOC 2SEBD 1LTID 1RD9D 3BYYB 1STEA 1JQYD 1LT5D 1S5FD 1ESFA 1T5XD 1CT1D 1EEID 1AW7A 1LO5D 1RCVD 1LTTD 2QILA 5I4DA 1SE4A 1D5XC 1FGBD 2RDHA 4RGNA 1LT4D 4Z9CB 3EA6A 1EU3A 1DJRD 1KLGD 2CHBD 1BCPB 1PYWD 1BCPD 1SJHD 1LLRD 1FD7D 1UUPA 1S5BD 2XRQD 1S5DD 2NTSA 1PRTB 2AQ2B 1PRTD 1HXYD 1S5CD 1XTCD 2G9HD 5D3DA 1QILA 1EEFD 3MFGA 3O13A 2QEJC 4DXGA 3R2IA 3BVMA 5D3IB 3BYTB 1KLUD 4O1NA 1AN8A 1SJED 1LTAD 1XXGA 3BZDB 5FKAC 4BWGB 1D5ZC 1PZJD 2O2LD 5FK9C 5ELBA 1D5MC 1BCPF 1LTBD 4RH6A 3R8BA 1BXTA 1ET6A 1LT6D 1EFID 1FNVA 5TSSA 1ET9A 1PRTF 1MD2D 1TS4A 1FNWA 3W2DA 1RF2D 1TY0A 4L6TB 1SXTA 1RDPD 3BVZA 1I4XA 1L0YB 2NTTA 4OHJA 1BCPC 2ICIA 1PZID 1F77A 2XRSD 1CK1A 1EWCA 1PRTC 1JWSD 4RHSA 1L0XB 5ELFA 2J4XA 3EFXD 4RCOA 1I4PA 1SBBB 1V1PB 2XN9C 2Z8LA 1CHPD 3V05A 5ELEA 1JCKB 1SE2A 3MC0B 3DWQA 4NZLB 1KTKA 3DWAA 3SEBA 1PTOH 1JWUD 1FNUA 3KLSX 1M4VA 1GOZA 1PTOB 1HA5A 2TSSA 3BVGA 4UDUC 5ELDA 1D6EC 3CHBD 4DXFA 2XNAC 1I4HA 1PZKD 1YN5A 4K6LA 1B44D 1SE3A 1CHQD 2AQ3B 1I4QA 1V1PA 4C56C
chains in the Genus database with same CATH superfamily
2KQ7A 3HFZB 1YNNC 1Q86C 1I42A 1BVSA 1SROA 3PV0A 3ML9A 4PZ7A 4LMQD 3FPUB 3HOUH 1E7VA 1RFKA 1UAPA 4GLVB 1B1ZA 2YYZA 4DV4Q 3K9OB 5BO4B 4DNTB 1CQVA 4OZCA 1F2RC 1OQQA 4KN4C 4OGQC 1DOYA 4ME5A 5C23A 4CGYB 3S2HH 1LTGD 1QZEA 5E6NA 1QWYA 1UD7A 2KTFA 1Q46A 3AXCA 1DYQA 1Y1VB 1ZDXA 5C3EB 3FKYA 4A3FH 2CJNA 1G6JA 3C1EA 2ONQA 4NPNA 3JAMc 4BBSG 1G2TA 4IUPA 4DK0A 2VW9A 4DQOC 2JF5A 2D5GA 4KD4A 1YZ6A 1NCVA 2MPMA 2GVAA 3NTHA 2VRRB 2MFIA 3U7ZA 1VQDA 4M0WB 3ZJYC 2MRPA 3HOUB 1B8AA 2HDLA 3VYTA 1QF6A 1Z2MA 1PFMA 1A8VA 2KQ3A 5D65A 4HJ7A 1N36L 2UU9L 1KH0A 2LHEA 2MP1A 4CJ1B 2E2IB 4KHPL 4EEWA 5IP4D 3BDLA 2KDIA 4IUQA 3S2HB 3MFGA 3RZWC 5EJWA 1EY0A 1RL2A 4IPGA 4B3SL 1N5WA 2MBQA 2WQYB 1R4PB 4P72A 1PGAA 2BS3B 4K1RB 3M9BA 4IPCA 5C3XA 3CCEA 4A3FB 5T8IA 1NEKB 3IT4B 2K6AA 2WAQG 1Z6HA 2EYOA 4KN7C 3U9SA 2EIFA 4B08A 4HIKA 3P4QB 3PREA 1V8CA 3PSIA 1TWCH 4BA2I 3MHZA 2WU2B 4W9LA 1ZYRD 1YBYA 2D9UA 1E6EB 2XBBC 1VQ8A 5TSSA 4OVUA 4WJPA 5J1ZA 4C3HG 5J39A 4IM0A 4WJOA 1N8RC 1N34L 2O2VA 5LNK1 3H7PA 1V5OA 1TY0A 2A69D 2LI5A 1WGDA 2D10A 1HNXQ 3UGBB 1TTNA 2FXQA 4LNFA 3ALBA 2K5QA 1J7BA 1JWSD 2K25A 4RHSA 1JJGA 4APVA 2V4IB 2K1BA 2YEPB 4C2MH 3AU4A 1T0QC 2CKZB 1C7YA 3T4AC 2KN5A 4IDIA 1KABA 3EECA 4JI4Q 4LF4Q 4DN4M 5ELEA 1T6BX 2EVBA 4USAA 1TWCB 2WXGA 4ICVA 2KX0A 3IAYA 4ITKA 2FFKB 4DV2Q 4DR7L 2M8SA 4TV3A 2NVQH 3DEPA 2B39A 3MTSA 3MEHA 4PK1A 4W9CA 4IUNA 3QO2A 1X9NA 3I3TB 2NBWB 3SU8X 4QMGA 4WAFA 3U9OA 4XTCS 3KUCB 2XSCA 1HZ9A 1O7IA 3ZDMC 1SE3A 3VXWA 3OW7A 2QGQA 3L13A 3ZXVA 1C4CA 1PYSB 4AWJA 1OTCA 4FULA 5T1IA 4C2MB 3CCQA 1AFPA 3A0JA 3GTMH 1NVID 3TEWA 4BKSA 1RFAA 3LDZE 2C7HA 1I4RA 3AEGB 3SK6A 4YCVA 2WXIA 3SFDB 4DAYB 4JI5L 3Q69A 1JR0D 1V1QA 4JBJA 1KAWA 3TDQA 2BBCA 2FUHB 1VS0A 3AE9B 3SDZA 2JSOA 1XMOL 1PFDA 4HWIB 2ZJDA 2NVQB 4LK0M 4HCEA 2N88A 3J81E 2W54A 5AZHA 3X23A 3ZTCA 2H5XA 4FO2A 2KACA 3IFWB 2F3VA 5D94A 2K1FA 2N9PC 2OOBB 3KQ4A 3N9YC 4EOYA 4KGSA 1J5EL 4CHKA 2IO1B 3AEEB 2OJRA 3BYYB 2F0VA 1NAPA 5IYDG 1U0LA 1L1OC 4EQPA 1ESFA 1UBIA 3U4ZA 1MHXA 2DAJA 4FVMA 5JJKA 2MA9B 3OTOQ 1UWMA 4KZCA 2KTRB 4KGTA 2IBIB 2KJRA 2EQSA 4YCWA 4OO1I 3GTMB 4OX9Q 2MUYA 1OXVA 2E76C 2Z4HA 4RCNA 1B2TA 1LLRD 1X3EA 1PQSA 4JYAL 2M17A 1DOMA 1VQOA 4B3RQ 1PRTD 1V9JA 5LMUQ 1TIID 4AYBE 1WX7A 3I4MH 3O13A 3CMAA 1M1KC 3ULJA 3STBD 2DYOA 4GB9A 4KIKB 4ZYNA 3BVMA 5D3IB 4JOIA 4TUUA 2VH2A 4XC2A 2JX5A 2K0PA 5J17A 3P2BA 3C1FA 1J7CA 3KH0A 3L4PA 3K7UC 2CH4A 4L5TA 3RMHA 3APDA 4YSYB 1WR6E 1ZKHA 1FJGL 1ET6A 1OXTA 4L2YA 3HIZA 1MG4A 3MC9A 5BYSA 3NS1A 4HIOA 5AJ3Q 4W9EA 4GSWA 1WTOA 2EELA 1SXTA 1EL0A 4LF5Q 4NQKE 3J80c 1FFUA 1E1OA 4JBKA 2R7DA 4ZLTF 1ZUD2 2YEPF 1TWAH 1Z47A 3NBHA 3HOVG 2KZRA 3MVVA 4F8CB 2A6EC 4EZLA 1BOSA 1L6VA 3L08A 4JBWA 4PV1C 3S16B 5BMGA 2V0GA 1SDFA 1O78A 3BZKA 1Q82C 2OTLA 3PRPB 3TJPA 2CHWA 2K5VA 3FKIG 1PH9A 1WE6A 1GD7A 3UINB 3I63C 2BF8B 1L4ZB 2JU6X 1L4DB 1XPOA 4C7ZA 2ZM6L 1C8CA 3PO3G 3L3OC 2A68D 1LUZA 2IDYA 3QK0A 2AL6A 3C3LA 4IJHA 5IOIA 1DZ1A 2PW5A 4YSZB 2PJHA 3DBLI 4BAXA 3AE4B 1XQQA 3H7SA 3TRZA 3DBHI 2NZ1D 3Q22A 1NENB 1B7YB 2EMTA 3H0GH 3UE0A 5IODA 2R93H 2ZXRA 2NUCA 5IT9E 3GD7A 3S14H 4PMBA 2D0OA 1TWAB 4LF8L 2LFIA 1CMXB 2B2TA 1KDAA 1XWEA 3EN2A 1N32Q 1ICWA 3U50C 2OT2A 1I94Q 4QCLA 5EKIA 1CKNB 2PQAA 5IT9L 1H95A 1WSPA 3A56A 2NVYH 1TKGA 4FF2A 4A3KH 1XF5L 3A1QA 3PRMB 2UUAQ 4GKKQ 2BE5C 2EE1A 2JY6A 3QIJA 3ZNHB 4WQOB 3DWGC 1TVXA 2AWTA 3I91A 2BS2B 4DV7Q 3MZ5A 2BS4B 5BYRA 1NUCA 2WYQA 2RD0A 1Q8IA 4IPDA 4BXXG 4KHZA 1HZ6A 1Y69U 2N9XA 3VR3A 1H9KA 3RNCC 1EY6A 3E6ZX 3O65B 3SHLA 3H0GB 2R93B 1DGSA 4QUCA 2DENB 4ZAIA 4JI1L 1PTOC 2EMSA 1KM7A 3S14B 2BTEA 1PH7A 2DZJA 1S5FD 5M5XH 4A75A 3TP7A 3ZRFA 1SB3C 1HFGA 3EFCA 5FO8B 1AE2A 4R4OA 4IOCA 4HEA1 3U4VA 3B2GA 4DHJB 2KXJA 4KK7A 4HPMB 1DJRD 3P75A 2NVYB 1PYWD 2Z1CA 3RLFA 4X65Q 3J81j 2XWBB 4A3KB 2G3QB 3PZ8A 2AKWB 1DCZA 2XRQD 3KWVA 4GOPC 2EKEC 5GAGC 2D0PA 2G9HD 3PMFA 5FLMG 3J7ZC 3PQIA 4BY1H 3OJ4B 3PIP3 3VUYA 4FADA 4DR5L 3Q2AC 2L55A 4JLCA 3K6OA 4XE0A 1AN8A 3E3XA 1JQ4A 4KJOA 3HOXG 3TN2A 1HPCA 5BMIA 5FKAC 4UP9A 5AZGA 4FXKC 2VZKB 3GZNB 4B3TL 3ZUNA 1JWBD 2J42A 5M5XB 5CR3A 3GS2A 2VY3A 2JEBI 4DPGA 3F2DA 2JA6G 2PKOA 1VQBA 3F2UA 5EAYA 2UUCL 3U52E 4K0KQ 2WXPA 4LF7Q 3BVZA 3PO2G 3V3XA 1Y14B 1TXYA 2HCIA 4HSVA 3I7FA 4A4IA 4A93H 3CCLA 2JYTA 4AIMA 1HHVA 3FRPB 1H9SB 1KF6B 5IYBG 2HQEA 1EIGA 4RWSC 1CJEA 1IYJB 4A3JH 5HI1A 2UUBL 3VHTC 4BY1B 1FGUA 1HTOA 1GHJA 1ZPSA 3W1YA 1Q10A 4U68A 2KN4A 4OX9L 1WJ4A 1C9FA 2KHWB 2RA4A 5IA7A 4X3TA 1X3FA 3P4SB 3CF5A 2WX0A 1G51A 2JJQA 2W9NA 2WINB 4J3OD 5C0XH 4O42A 1MJCA 1Q3LA 4DK3C 1EIFA 4I6PA 1E24A 2BKFA 1YHQA 1KTKA 3CSFA 3UF8A 1WF9A 3LWEA 1FIQA 1EY7A 4LFAL 4ANXA 3K5MA 4LNNA 3VQIA 4K6DA 3KWLA 4QIWB 4YTNB 2K6QA 2KCCA 1I4HA 2RHQB 4A93B 2I1JA 5H8YE 4US9A 3IAS1 3JAML 3G6EA 2XWJB 3HM6X 5I9OA 4A3JB 1XNQQ 1X3QA 2PNRC 2MEKA 3UDFA 3K57A 4JV5L 1TKEA 4NDXA 1NI3A 1PXUA 1E5WA 2DJGC 4DR4L 1XNRQ 1GHKA 3AFQA 2MP2A 3N3KB 3RD2A 3KUZA 4BBNF 2QHOA 4RM9A 4A3MH 3RNFC 1II3A 3M3JA 1I6HH 1VQ7A 1KRTA 1YN3A 5JVH3 1WMHA 2OQ0A 1NYRA 4RF1A 2V1CC 1WGYA 1SNQA 1GC6A 1YHBA 1EU4A 2I0QA 4MM3A 4BA1I 3GTKH 2INDC 2WV6D 2R7ZG 3NZSA 4JIOU 1CTMA 3TMEA 5F2DA 4M8MA 2BKRB 4ACFA 4JCVE 4J6IA 4XT3B 2F0DA 3AE7B 2BDOA 3M3YH 2EYJA 2JZ3B 1IYUA 1CZPA 3LXFA 3D6CA 1XJVA 1QUQA 3MA2B 2OWOA 2LGXA 3VA7A 1YNJC 1BCPB 2YV5A 2F0QA 1PFBA 1J19A 2VQEQ 2NS5A 5FR3A 4LWCA 1HH2P 2CJOA 1X56A 2IL8A 4CHTB 4HKZE 1EQQA 4NAMA 4O0AA 3NQTA 3T51B 3VTVA 2R92H 3CRKC 2MO1A 4A3MB 1V9PA 2O2VB 1EEFD 3H7PB 1I6HB 2ZPNA 3ZW3A 2WWZA 4DHZE 2FCMA 3LX0A 2QCPX 1KXLA 1IW7D 4II2B 4EUTA 1T3QA 3Q3FA 1UEBA 2AHOB 3CCJA 3D4WA 4QY7A 4GKKL 1WGHA 1WXAA 3GTKB 2IO0B 1XXGA 1Q1BA 1VD2A 3PLUA 3NSWA 3BZDB 3IFTA 3RUIB 2LMCA 2V3SA 3WOFA 5DPSA 4A3CG 1K9MC 1BT0A 2IHFA 3M3YB 4N9TA 4LDTD 2M0XA 2LGSA 4GZYC 4FJYA 2X6GA 2D62A 3UIOB 1JWAD 2VH1A 1J0GA 4MHEA 3T3OA 3CCUA 2KAJA 4DK5A 5JEAH 5IIFA 1QVGA 4BY7G 1U4PA 4CBVA 5I2XA 3GTOH 1SYDA 2W82A 3TBLD 2R92B 2RF4A 3RUZA 2GBRA 4FA6A 1EWCA 2K03A 3NVVA 3AEDB 1X6OA 2F0JA 2Z0SA 2ZTCA 4W9GA 1A62A 4KD3A 3WA0A 2KFJA 1X32A 4AJWA 2I5LX 3PUYA 4PMCA 2WXNA 2PZUA 3J81c 3EFXD 4KKJA 4K8JA 3Q6SA 2HIVA 1T0YA 3HOZH 3HGBA 3SR1A 1T9HA 1WCMG 4A3IH 2EY5A 2JRIB 2KA7A 3MHSD 4KI0A 1STNA 2VQFQ 3UIPB 1QVCA 4ZHOA 1STAA 1WM2A 3T8MA 1V80A 4FBJB 1HTQA 4KDLB 3FP9A 5M5YH 4R1JA 5GQOA 3H3VI 1G291 3LJ3A 2FIDA 3BU2A 1C1YB 2Y5PA 2PZTA 1SSOA 1O7YA 1N33Q 1K8RB 1WVLA 4H0LC 3ICEA 2KMCA 3DPDA 4BOZB 1NE3A 2V4DA 3OW2A 2M56B 3EHVA 1FD6A 3GTOB 3R3MA 4RA8A 4GGQA 3HHMA 2M2LA 1C4QA 3CRLC 2F4IA 4NW2A 2CKHB 2O5JC 4NKLA 4K0KL 2L00B 4KJNA 2LRWA 2N9LA 3PLVA 4IN3A 4LF7L 1WM3A 2I1KA 3NWTA 2B76B 3FAHA 2IJ0A 3S17H 4JE3B 3HOZB 1DONA 1IBLL 1WXQA 5CV8A 3H9DA 5AUIA 4CKCA 4A3IB 4P6VF 5LXHA 2H4OA 1YJ1A 3HOYG 4WJQA 1S5ED 1KOTA 4B0EA 4LF6Q 4F7XA 5M3MH 4BS9A 2Y5BB 3FILA 5KYIA 2F0LA 4DUYL 5M5YB 3PSEB 4M8NA 4RGOS 1EQTA 4MSQB 3L2PA 3OG5A 1EZ6A 4LNOA 2DNCA 2ZCCA 5NUCA 4K5WA 1WFYA 1OGWA 4TKNA 4A3OA 2RSNA 2KENA 1IL2A 1CT1D 3Q3OC 1VCBA 5G3LD 3NUCA 3U7DA 4DUZL 1D5XC 5HGTA 3P4PB 4X66L 1KAAA 2K9XA 3TS0A 1C4AA 1RRBA 1Z9FA 3W3AA 5G5GA 3VR6A 4TQ1A 1Y56A 2WXHA 1E8WA 1FCLA 3UDIA 3S17B 1UUPA 3LYYA 2QMTA 3AEVA 3J80L 2V9HA 1JOQA 4ZRIA 3Q3MC 5D3DA 2K5HA 1KJTA 2KFKB 1KFYB 5CBAE 5M3MB 3HKZE 4F7ZA 2QEJC 2M00A 4DNRB 4DV6Q 3BS1A 2J0KA 3OMCA 4NJCA 2VS1A 5IYCH 1YHAA 4DR6Q 3OIPA 1E3PA 3APCA 3NBHB 5E4WC 2NVXH 2F0OA 2BGFA 5C4JB 2GA4B 1XNRL 2Z59B 1Y8RC 5LXIB 2DGYA 5IN7A 2MJEA 2RDFA 3AE6B 2INNE 4RH6A 1BXTA 4A3PA 1F9RA 1HCZA 3CCMA 1ET9A 1NNXA 4L8JA 4L6TB 3DVGX 5C44G 4CDEC 4N58A 3A9JA 3VRAB 2UU7A 3T3NA 1HJPA 3AM9A 1O7LA 3QC8B 3WOEA 2Q2UA 1PVOA 1E7PB 1QOGA 1VLBA 3ZO5B 1YIJA 1C79A 2CQOA 1GUSA 4UPAA 1VZ6A 4II3B 1AWDA 2PVGC 3S2AA 2LSSA 1F2MA 1QZGA 3M4QA 3H15A 4PQXA 3RULA 3CCRA 4RCOA 1Y1WG 1SMYD 2NVXB 1JMCA 1IKMA 1NYQA 3QCAA 2NN6H 1CHPD 2B2UC 1D3ZA 2Z6KA 1P8LA 4X3SA 1VQNA 4K7UA 4DKAC 5IOCA 3LB8C 3TL5A 2PQAB 1PTOH 4EX5A 3C2PA 3WWVA 3A1QB 1OEYA 3A33B 4IWPA 3K81C 2LHDA 3AEBB 4NQLB 1D6EC 3TZDA 4MIUA 5AUKA 1RAXA 3NBIA 4A3GG 3HVDA 4GLSC 2IY5B 2KDBA 1FM0D 1VR9A 4C56C 3JC66 5H1SE 2EJMA 2K5DA 1E2VA 4R4QA 5HHDG 2NZHA 3IBEA 2WAQE 1LABA 4ANVA 4YY3L 4DR2Q 1N6ZA 4GDLA 2IPKD 2L83A 2PMZE 2F0IA 4A3BG 1MKHA 1STGA 2CW0C 4KY6A 3VYSA 1YQ4B 1ZXTA 3E5SA 4RAUC 4AQ7A 3G6JB 4R4TA 1I50H 4HEDA 4QQBX 5ELCA 4ARCA 3JVZX 3HRDD 4L63B 2FIFA 1YX5B 2GVBA 1VQ5A 4N59A 1N5XA 3UE1A 4L1BA 3HM3A 4Q0FA 3DHIC 2BA0A 2KT7A 1IZ6A 2IW3A 4QUFA 3OAWA 3E9HA 3HKZG 4XDCA 4R8IA 1UE5A 3K5LA 3RYTA 1HZAA 1RD9D 1I35A 1XTDA 4ODGA 5IP7G 1VQAA 2Q8IB 4A76A 1CSPA 4KV2A 2F0GA 5C5MA 2QDBA 2B8GA 2Z4IA 1WTQA 1JB7A 3GTLH 2Z9HA 1Q0WB 3J7YW 2Q8RE 5FJ8H 4B3MQ 2JYEA 1IBXB 3PUWA 2CU3A 4JVZA 1IHZA 2Q8TA 3SDLC 4DR1Q 4GOPB 1N33L 4LNKA 3VH3B 2CHBD 4B9WA 1Y8PB 5CORA 2F0HA 3MJWA 4PZ8A 4BOSC 3PIOA 2E2IH 3TUOA 1K8OA 1FD7D 4N8X1 1S5DD 1I50B 2QJLA 3ERSX 4U673 4WJNA 1ICFB 1HXYD 1S5CD 4JI2L 1NTGA 4RM8A 4ZRQA 3UDXA 2M19A 4OVVA 4IPHA 4YL8A 2JA8G 3DDCB 2HCCA 2PZWA 2B2VA 2WDVB 1PMRA 4IFDG 2V3NA 2IX1A 3F1ZA 4ZRJA 2WS3B 4BWGB 1IBML 1EIHA 5JVG3 4XYQA 4D2KA 2HQLA 4DFAA 4DV1L 5GMVA 4FHKA 4LF6L 4YT0B 4JI6Q 2D3AA 1F2YA 2F0TA 1TU2B 3GTLB 2XTIA 4BFRA 4GN1A 1TS4A 4IUTA 2RCNA 3DVNV 1WX9A 1ZYRC 3A74A 3FMCA 3ZKJC 1WY8A 4OHJA 3M4PA 2C9OA 2HHHQ 3C8YA 2MBOA 1BCPC 3A8KE 5CV9A 2K5WA 4A3LG 2RMMA 2RSUA 1QZHA 2RR9A 1XT9B 3I4LA 3Q24A 3V60A 1SN8A 3QWNA 1LFDA 3NPPA 2IO3B 2JT4B 4C4VA 5C3JB 3OMGA 4IKGA 1IGDA 3DBRI 3K8AA 1B3QA 4JI3L 5C2TB 2ZJRA 4ZCKA 2UXDQ 2KDEB 4BKGA 3D8GA 3DWQA 2M0AA 4K8IA 4DV6L 5DPWA 3G48A 3KBGA 3M95A 3WALA 5C6AA 2L9HA 3HOWG 3I8ZA 2ZNVC 4HROA 2X69A 3AU7A 4C3JG 2KVRA 4XIGS 2MP2B 3I73A 4W9FA 4FN2A 4HVBA 1X3GA 5E3FA 3Q23A 4IM2A 1GVPA 2FINB 2E3TA 2KWVB 4YWMA 3VUWA 3KVFB 1CHQD 5IE8A 2VUMH 3PTFC 1ZXIA 1E0ZA 1WMHB 2E74C 2FBWB 2BA1A 2K5PA 1MPEA 4AYBB 1STBA 2MH7A 4GN5A 2AUKA 4NJ6A 4B9KA 1N62A 1MVKA 4ZRZA 2JZPA 4RFBA 4C7YA 2E2JH 3Q8CA 1A3TA 2RKSA 3CIRB 1NMGA 1R4QB 2IX0A 1MJDA 2CU1A 2KHSA 1E0BA 1PTOF 1E8XA 1GUWA 4EQOA 2EKIA 3A8JE 1TY2A 2UXCQ 4WQMA 5J3BA 1QUQB 4W9KA 1R4NI 4RGTA 2YU9H 5LMNQ 4IZ8A 1SF0A 2N78A 1B53A 2LXJA 4ZYSA 3GTQH 1GUAB 3I4NH 1X1MA 1I6VC 5JJIA 2Z0EB 2RGFA 4A3EH 4WORA 3KOJA 1PH2A 2OTJA 1K50A 1Z5SB 2E75C 2L05A 1VQIA 1VMPA 2ZT9C 1HNZQ 3P20A 1OEYJ 2MBBB 2JP1A 4HN7A 4MSMB 4OZAA 1PUTA 1YI2A 1WE7A 1ISNA 4XWWA 3TREA 4KKSA 3CAMA 5CV7A 1EY5A 2VUMB 3KBXA 2FMMA 1FR3A 1DOIA 1VQ4A 1V43A 2L11A 2BB6A 1CI3M 3MXNA 4NXNL 2PQEA 1ACCA 5JZEB 3AE5B 2E2JB 2LXCA 3RMKC 3IRBA 1YJ9A 5IWAQ 1EOTA 2LMCB 1SIJA 5C4XH 1ZKOA 4ID6A 2K33A 5DAUA 2LGIA 2JA7G 3GOEA 1TT2A 2GRIA 1W3SA 5JOBA 2DUDA 1B3AA 1XEEA 2DAFA 4YHHQ 2YU9B 4AP4C 2BYTA 4DR2L 3U8ZA 3NVZA 5BN5A 3C0RB 1ZW7A 3GTQB 3I4NB 1C77A 2FCQA 2K22A 4A3EB 3KYDD 4REZA 3T1YL 1BDOA 1SMXA 4PT5A 1GUTA 4X62L 2LS01 3J81L 3KUPA 1C0AA 2FJ2A 1B9NA 2RQXA 5CV6A 3R8BA 1WX8A 1LT6D 2J52A 3TS2A 1F2RI 3E0EA 2KLCA 4HCPB 1QQRA 1VMCA 2WXMA 5IP9G 1RF2D 2C5LC 4TRDA 4KMUC 4JOIC 5I2YA 1JROA 4LFCQ 4M00A 4DDGD 5JJLA 1BBXC 5C0XI 3J7AV 4CKEA 4G7HC 1Q90A 4XT1B 2EY1A 1A6XA 5C4XB 4JWUC 4A3DH 5T1GA 1FPYA 2ZW1A 3CXCA 3SHQA 1F77A 3NWSA 5C3WA 2XGTA 3S16H 1T0RC 1B9RA 5FOBB 1BMLC 4FF3A 3NE5B 4DV4L 3S1NH 2ZEQA 3W1SA 3QHTA 4GN4B 4HJAA 1WD0A 2B63H 1RTNA 2L7RA 4BZAA 1EWIA 1WFQA 1P16A 4XGAB 1YEZA 1KNEA 4OZBA 1DOKA 1W6JA 4FXGC 2G4SA 5J18A 2K8HA 4OVZA 4JPBW 1FNUA 3KYHC 3MXUA 5IGDA 3JSVA 3WAMA 2TSSA 1HA5A 4GNXA 2D11A 1X65A 1YQBA 4JX1C 1A5RA 4XYOA 4R8NA 5JHBA 3FPPA 2C7NB 1M90C 3VAWA 5E4XA 4BBRH 1TQOA 4HSPA 1LV9A 4IUVA 3DMUA 4A3DB 2IO2B 4DAPA 5C4HA 3NTKA 4GDKB 4LFBQ 3D31A 5M3FH 3FILB 2KECA 4XDDA 3W1SC 3VDZA 1GJZA 3EVQA 3HRZC 4S3SA 5E1FA 2L0TA 3TEYA 3S1NB 4G4KA 1ML0D 1Q1OA 3J9CA 4RMAA 2KWCA 1JJ2A 2B63B 1SAPA 2L3ZA 1LTSD 1Y1VG 3TP6A 2RPQA 5C3EG 4N9F4 4IC7B 4HCSA 1GNUA 3OIQA 3IHPC 2B8FA 3BINA 2KEDA 2B2TC 4QJFA 5AZFA 1O80A 2DY7A 2N1VA 2RHSB 3RZDH 4B6WA 4ANWA 2WACA 1RODA 1CQFA 1B4OA 3GV3A 5JH5C 1IUEA 1YJWA 3P1MA 4JQWC 2J0MA 2P5ZX 4BBRB 1K73C 1PH1A 4Y7NH 1KL9A 3HOUG 2HE7A 2JA9A 4NPSA 1JORA 1FXIA 2NBUA 2F03A 1BO0A 2A5UA 5M3FB 4DR3Q 3NXWA 3OHXC 2DYMA 3CWIA 1LTLA 4Z9CB 1FL0A 1LT4D 1HNXL 3M4OH 1WJ6A 4NXMQ 3EA6A 1EU3A 4TVAB 2DZKA 2QKIC 1KLGD 5EE9A 1MI2A 2LVQA 2IHEA 3X3MA 4KSKC 2HT1A 4IFDI 4LTUA 3UI3A 1BBUA 1FVIA 4S17A 1TWHH 4A3FG 5D7GA 1JALA 5IO9A 1QILA 2DBYA 4MTNA 4EQNA 4YTPB 3RZDB 3A9JB 1WTRA 1S1QB 4OEMB 4ZUIA 4JI4L 2C9WB 2VB2X 1R9TH 4LF4L 2KCTA 2PEAA 1HE8A 5E6OA 5ELNA 3A8IE 4JC0A 4Y7NB 4DV2L 1VF5C 2O2LD 5AFWA 5J2RA 2UXCL 2D3CA 4A9AA 3JW0X 1EYAA 1GC7A 3DQVA 2EJFC 2UWQA 2WFWA 1SNCA 2G9DA 1WTPA 3NJTA 2SNSA 4LCDE 1EF5A 1NDDA 4WWPA 3RCZA 4MH8A 3M4OB 1PA6A 3VUXA 1N9WA 4C3IH 1WXVA 4WJWA 3PUZA 4R4CA 2NTTA 1P7EA 4DDID 4XDXA 2M9VA 2YTYA 3W9CB 2JYOA 2WB1E 1OQRA 1TWHB 1DD2A 1IPGA 1VRAB 2MQJA 4M02A 1VQJA 5JJZA 2XRSD 1E22A 3DHHC 3PO0A 3QG1A 3PUXA 3QA8A 1JT8A 2BW2A 4HRSA 3IVFA 2BE5D 1EFWA 2KBNA 1ESRA 2JA5H 1OFFA 4JPSA 3L54A 1R9TB 2CWAA 2KVZA 4I6NB 3BZCA 2OHFA 1PYBA 2CS4A 3V05A 3KF8A 3GB1A 4IFDJ 3PVLA 3SEBA 1RM6C 1GUNA 5FLXc 4YWGG 4A20A 1SFOH 3BVGA 4A6QA 1JB3A 1G2SA 4H2AA 4C3IB 1DM0B 4H02A 3CHBD 2HDEA 3AB5A 3DM3A 4RKBA 1G6PA 2XK5A 3A7AB 3TIXA 1FFVA 4K6LA 3OTOL 4H44C 3ONSA 4W9JA 2CWPA 1XYIA 1RYJA 4I6LB 3QOLA 4RMFA 5DNFA 2D2QA 3W5VB 3TSSA 2PPBC 4DHZB 2A5HA 3OOCA 1YX6B 2ASQA 1JRUA 3HZXA 2K39A 1PH3A 2K32A 2XEWA 2JA5B 2W55A 3RLNA 2IGHA 1JJCB 4WRDA 4B3RL 4ASWC 2N8NA 4QB4A 1STHA 5LMUL 5K36H 1HZ5A 2NCNA 1EY9A 1UGJA 1Q12A 3UDGA 3U58A 2TMPA 5FO9B 4N6EB 5L37A 2CCZA 2IX3A 1XMQQ 2J7QB 3T53B 3A4SC 4WJ3M 1SFOB 2HTHA 2J0JA 2IZVB 3NHHA 3V2TA 2JPHA 3IT6B 2K50A 1TS2A 2KMAA 1HFNA 1AEXA 4JW0A 3AMUA 1E8YA 1T0SC 4TQ0A 1STEA 3NTIA 5A35A 2PO4A 4OO1H 2E6XA 4LJPB 2AL3A 3V96A 3AE2B 3F8TA 5E6PA 5AJ3L 1H8CA 4MDKE 4G0NB 2Y3AA 3ZDTA 3BK1A 2EY2A 1U4MA 4LF5L 2BWFA 1R4MB 3ETRA 4NAWA 4K2KA 4WAAA 1WR1A 4YSXB 2L52A 1HZCA 1EY4A 1LACA 3AULA 3QWZB 2PMVA 2ZPYA 5CHFA 2N55A 1CUKA 5I6WA 1PH4A 5G5HA 2JXXA 1KC8C 4CKBA 2WB1G 4L5SA 3EFUA 5IGCA 5EE1A 2JRHA 4OWTB 3CC7A 2L5TA 1GAQB 4LUZA 4O1NA 3CCSA 3E9SA 2PTLA 4BVUC 4DWFA 2BH8A 4DK1A 2QC8A 2ZVNA 4HXDA 3PHXB 2BOSA 1J6QA 4P1CC 1Y8OB 2KQSA 5I6YA 1BF4A 4C4VB 4KKUA 2F0NA 4XQQA 1F9JA 1FCCC 2Q5WD 2EXZA 1JRPA 4HJGE 1QCBD 3AEAB 2N4FA 4IWOA 4AQYQ 4OL7A 3I4MG 3GE8C 1G6ZA 4WFN3 3APFA 4XWTA 1HA6A 3I90A 3C19A 1N32L 1ASZA 1XLOA 5L95C 1I94L 3EJIA 1J9OA 3QX1A 4DR3L 1ZP0B 2NMQA 2WXJA 4FF1A 1WYDA 1B70B 4IUUA 4KSLC 1VZ8A 5KHQA 2UUAL 1VF7A 2KLGA 2L8JA 3K0XA 3B0AA 5EPLA 3A5UA 2LGYA 3C46A 2SNMA 4MH0E 1GUGA 4LF9Q 4ZOHC 1I3QH 4JI8Q 3AU5A 1YMHE 4DV7L 3NVWA 2MW5A 2ZNVB 4GOCA 1N61A 1D7QA 1OTRB 2H1EA 1E2ZA 2IT1A 5LL6X 1M4VA 4XXEA 3MTNB 3P7JA 2JWZA 1L2NA 1YVCA 1IXRA 2F0WA 3ZVVA 3K58A 5C1ZA 2PYKA 1AH9A 1EWYC 1D1KA 4GS3A 1PZKD 4CYEA 2GBJA 2REXA 2AQ3B 1KDBA 3HK0A 1ENCA 4DA2A 2OXPA 1TWGH 2KD0A 5KNBA 4RF0A 1AYFA 2AWNA 1YNJD 4L5RC 4B0MA 4WWNA 3PGEA 4DAYA 3WDNA 4X65L 4BBSH 3DLLA 1GG3A 5GADC 1WWTA 4HJ8A 4DV0Q 1IBKQ 3N32A 2BQQA 5L83A 1KHIA 1V1OA 3FDTA 4JI0Q 1SRUA 4E74A 3V62A 4QIWE 3DBLB 1I3QB 1QNUA 1V8QA 2UXBQ 3DBHB 2L76A 1YQ3B 2KC2A 2SOBA 1QOBA 3H0GG 2R93G 3L0OA 2V4LA 3VFKA 3CC2A 1G8ZD 4GKJQ 3ND8A 3MXNB 1CA5A 2KYWA 1WIAA 1WGGA 3KYCD 1XLNA 2VZAA 2K8CA 2R61A 4JI7Q 4IM3A 4JG2A 4A90A 3IG3A 2RDGA 5CC4A 3URYA 1V5TA 3A4RA 3NELA 3QB3A 4LAAA 2PI2E 4N9PA 5HURA 1UNSA 2FNJB 4GU2A 1SYBA 1JMLA 2E5LQ 2LASA 4EE2A 5EKLA 1L0VB 4K7WA 3SD5A 1JQYD 1U5KA 2Y0SE 3HS0C 2R2QA 4JGHB 1QOFA 1LTTD 3ND9A 2B2YA 1TWGB 5JPNC 3T1HQ 4A3KG 1VQMA 2F0KA 3T16A 1PLFA 3DM1A 3L16A 4BBSB 4PS3A 3D0FA 3PV1A 3Q8EA 2JSVX 1WTVA 1CZWA 2L0CA 4C3HH 4KIKA 1D4BA 1F9PA 2GBNA 5TR5A 1PRTB 1HRJA 2YLMA 2GOWA 3A9KA 1B9MA 2E8GA 2KEEA 2N9KA 4DXAB 4C3JH 1UE1A 4RNAA 1EUVB 1RLFA 1ENAA 1GB4A 2J7ZA 3S1QH 4AH6A 4KDIC 5C4JH 2J53A 3LGJA 1JOKA 2A6HD 2KOLA 2CR5A 2JN4A 4Q2JA 1S4ZA 5D6JB 1UELA 2B3AA 3M62B 1D5MC 1BCPF 1SNDA 2K7VA 2RPVA 1T5EA 4OW0A 3D32A 3K5NA 3N30A 1TBEA 2WAQB 4HCNB 1XPRA 2I46A 3MJ5A 2PMZB 3ZNID 3G71A 2OEDA 4IOAA 2FHTA 4ARIA 3S1RH 1Q7YC 1E90A 2MBEA 1P1AA 4C3HB 5KNDA 5LL6S 1XNQL 3AMZA 2ENBA 3G7LA 3MC8A 1GM5A 1I7HA 3S9WA 2UU9Q 3JSVB 4GNXB 3AE8B 4KHPQ 4C3JB 1YD8U 5EDSA 1K0RA 1VQHA 5ELFA 2Q2HA 4DBGA 3S1QB 2J4XA 3BIID 1O7ZA 4KKTA 4CJ2C 4B3SQ 2PE6B 3CW2C 4OWWB 2Q2IA 1E7ZA 2ZCBA 2KHJA 1JCKB 1SE2A 1NMFA 1EZ8A 2C5CA 3NK9A 2NVTH 3DWAA 2HD3A 3J7AF 3D3RA 1JE5A 4A93G 1F0ZA 1GOZA 3DUZA 1K8MA 5COYA 4CDFC 1PHJA 4POGA 1C78A 4LJZC 4A3JG 4UP7A 1N34Q 5DLQE 4IG7B 3S1RB 3QAQA 4DXFA 4KLKA 3PZDA 1CKNA 2Z6KC 3K59A 2K52A 4NMZA 2KHIA 3BDOA 1EQVA 2JE6I 4TSSA 3BDCA 5E7NA 1W2BA 1CM9A 2VNUD 2Y0SG 4K7SA 2N49A 3F2CA 5JXVA 4AS1A 5C0XG 5IYDH 2VQEL 3CU7A 4PYUA 2K05A 4DNIA 4P16A 4I7AA 1BR9A 3A55A 2KWUB 1WZ0A 4LLGM 3OJ3A 4URKA 2RVLA 1GKHA 2EY6A 4X3UA 3PGZA 1QKZA 2IYDB 2OQKA 1NJIC 3R7QA 4HLEA 4W9DA 1VQEA 3E56A 2NPTA 2PLPA 1C9OA 2NVTB 1NI2A 3Q8AA 1LTRD 1SEBD 3DWMA 1RTOA 4K5VA 1QOAA 2AQ1B 3QARA 3VVWB 4DR7Q 3K80C 3K5OA 3RN5A 2RCFA 2K01A 3DWPA 3ZGZA 3TP8A 4ILWA 1UGMA 2SEBD 4RG1A 5I9PA 2WIIB 1C3TA 1GPXA 2ID0A 4E71A 1LT5D 3SK8A 3S2DH 3SGIA 2JXMB 2QILA 2D3GA 3NY5A 2K14A 4I65A 5HGQA 3OYYA 5HG2A 4B9XA 2L1BA 4X3KA 3SK5A 4AUQC 4IURA 3N1YC 3RNBC 3P63A 4DHJD 1P9DU 1P7FA 4A3MG 3PRZA 4HDQA 2QW7A 2EJGC 2BT6A 3FVQA 3KK7A 3SK4A 3IFDA 1ZE3D 3VTWA 3NG0A 3NENA 3ZTDA 4GMVA 3CSTA 3L7ZC 2NBFA 3CQZH 4JI5Q 2JQRB 2INCC 2KC1A 2J0TD 4E6IA 4POFA 2DN8A 2QEXA 1XMOQ 2KJ6A 3ML8A 1PFSA 1KLUD 2MO0A 1IYVA 2LY7A 2WP8J 1N60A 3HOVH 4J15A 4X64Q 2B2WA 4W9IA 3T13A 1YJNA 5FLXE 3N1XC 3W1BA 3M7GA 3LWUA 2KUMA 5FK9C 2VQFL 3CMEA 1J5EQ 5ELBA 3S2DB 1ILPA 2VZKD 1LTBD 1TYGB 2EYLA 5D2MB 2ZXPA 2PW9A 4JI7L 2EDGA 3BK2A 1MI0A 4FNFA 3FKIH 3RNUA 1YIWA 1FNWA 5BN3A 5FLXL 1SNOA 3HKSA 2R92G 1RIPA 1HUNA 1L5PA 4HTHA 3PO3H 2B2VC 4FLHA 4ME3A 3KF8B 1L0YB 4KGRA 2HTME 3WAOA 5D14A 4C1NI 4JYAQ 3T1HL 4P75A 1E9MA 2ALYB 3CQZB 3P1HA 1D2BA 1K83H 1D1IA 2YTVA 5M9OA 1G91A 2KQ4X 1L0XB 1UE6A 2HIXA 1PGBA 2CW0D 2K04A 4N8FA 1NBFC 3M7NA 1E8ZA 2XK5B 5KHOA 3ZRCA 4AJYB 5H92C 3HOVB 3I5JC 1QNKA 4PYZA 5EBDA 3I3CA 2WXFA 4F1SA 3H3VH 5EPJA 2QSDA 1DXMA 1EF1A 1FXAA 4K14A 3OWFA 1WTHA 1TGZB 4P74A 3IAM1 1Q5WB 2B3GA 3I4OA 1FRRA 5J22A 1ZOYB 2D3BA 4LJOB 5JEAG 1FJGQ 1D8LA 3FKIB 2L1AA 3HEJA 2K3UA 4FDBA 4O2DA 3PO3B 3JYUA 2A69C 1YNND 4HMJA 4Y52H 2AEHA 4BXXH 2I5MX 3MXGA 3JAMi 2PI2A 3NS8A 1A3VA 3EQLC 2WXRA 3DHGC 4ANUA 1K83B 4RHRA 4I7ZC 3HOZG 4NP5A 3M85A 2KDFB 4FJZA 5KGUA 2EZVA 4A3IG 3BY4B 4DAVA 3NHEB 2MGSA 1JOOA 1WZ3A 4KZ0A 2NBVB 3Q0AA 3V61A 3ULLA 4GIVA 3B1LX 1TS5A 1R7SA 4YWKA 3KFUA 1W6KA 2DZMA 2A1AA 3KLSA 2GLSA 3LNNA 3CC4A 2EYHA 2GN5A 2EOTA 3BWUD 2K75A 4NAWB 3TQYA 2ZM6Q 4TMAB 4DR6L 1MBYA 3IL8A 3MFYA 2CVRA 2KJHB 2WHIA 1BBWA 3V6CB 5ELOA 2ZZPB 3D4DA 5FLMH 1BUVT 2C60A 4WWOA 2NYZD 1H9RA 1S40A 2MJ8A 5IAAC 2F0PA 5ISRA 1WGKA 4LF8Q 1K52A 4MM3B 5CBEE 3HOXH 5HY6A 4K2LA 4EFOA 1UE7A 3GZNI 4HAEA 3AFPA 2X38A 1P98A 1BCPD 3AE1B 5M3MG 4P7IA 2JA6H 2D07B 2HD5B 2KJXA 3G4SA 4OIKA 1J8IA 5EE0A 2AUJD 3ONAB 2SDFA 1YJJA 4GXBA 1K8GA 1L6UA 2CHZA 2HJ8A 2JXTA 3UQAA 1JICA 5KEEA 1K3BC 3PO2H 2A73B 3AQQA 4P71A 1S3OA 1SE8A 3B6YA 3GQBA 4DXGA 1H4RA 2LVPA 3MHBA 4P2CB 1IL8A 1GO3E 5KRUA 4F88A 3BYTB 4MELA 4ICUA 4FJVB 5IYBH 5CGKA 1MG8A 2KWDA 1LTAD 4IW0A 3T56B 4MEMA 3RNGC 5BMHA 2N9EB 3KLWA 2O6VA 2G5DA 1XPUA 4JI1Q 1PZJD 4G7OC 1SIFA 1LQBA 3NOBA 4W9HA 1HTPA 1GJXA 3KLRA 2F0SA 1B50A 3A54A 3B2FA 2F1MA 4LDTB 2WXOA 3HOXB 4G50A 3TMPB 3W2DA 2O6VD 2JUOA 4H7BA 1F1HA 3RZFA 1RDPD 2INPE 4EKUA 1UEAB 4IALA 4LK1C 1WRDB 1A2UA 2JA6B 1KQSA 1SNMA 2KVMA 4M8AA 3KF6A 5IYCG 4CDDC 4WJ4A 1V97A 2DYBA 2G4DB 1HR0Q 1PRTC 4HJ5A 3PO2B 3I55A 3RI7C 2OF1A 2BH2A 3I70A 1X54A 1P3QU 1MGSA 3STBC 2H89B 1UF0A 3OPOA 2EXDA 3AYHB 4DR5Q 1XLPA 1HUMA 1PH5A 4S0RA 1EYGA 4L23A 1E10A 3MC0B 1WI5A 2ZW0A 1V6EA 1DGJA 3SVMA 5GAEC 2DNEA 1R4MI 4AOFA 4B3TQ 4BKSD 1CA6A 2E2HH 1V81A 2FUG1 2OCEA 5DEHA 2WXLA 4PS8A 3ER0A 4ABNA 4X64L 3QJYA 1WTWA 4EGVA 3W5OA 2ES2A 4QL5A 2UUCQ 3DOWA 5ELDA 3AE3B 4MJSA 3QIAA 5KIXA 2D2CC 4ZK9B 4IWQA 1WJJA 1V1PA 2LXKA 1E1TA 4B3ML 1YOVB 2GMIC 4KX6B 3EBEA 3PS6A 2NZOA 4DR1L 2NN6G 2R7ZH 2HJ1A 4FHJA 2UUBQ 4GNXC 3W5UB 1J8CA 1EUJA 1JE4A 1K3RA 2WP9B 3NP8A 1HTLD 4YWLA 4HR7B 1VQPA 1L0WA 2WLBA 1V2YA 4JK1C 4P73A 2IWHA 5CMDA 4MT5A 4OWXB 1L1OA 2A19A 2OJWA 2O4XA 4K3CA 4WURA 3CP0A 4ZKCB 1H9JA 2ZJQA 1N63A 5CV4A 4UY8C 3RR5A 2WU5B 2A68C 1WXMA 2E2HB 4PS7A 1U4LA 1TS3A 1DOLA 1Q1EA 2KCNA 2MHVA 4LFAQ 3EUB2 1QLBB 1FYCA 3VYUA 3VDYA 3A9KB 4ULLA 3VR5A 2MLBA 4JI6L 2X6LA 2WB1B 1LO5D 5JAVA 3GTJH 4CJ0B 2HDMA 1UWXA 1A0IA 2AYOB 3P4RB 3Q8FA 1V49A 2R7ZB 3AB9A 1FGBD 5CTRC 5A2QE 2JQOA 2KFKA 5LMNW 4JV5Q 2HHHL 1VQKA 4IO9A 4A3CH 3K9PB 3NUHB 5JHAA 2IY1B 4LUOA 3RD4A 3W1GA 3J80i 2L4NA 5KNCA 5LHY1 5C0XJ 1PV4A 2NTSA 3RNAC 4V190 2AQ2B 3KDFA 2BYVE 1M94A 4DR4Q 1Q8KA 5A2QL 2ZTDA 3DEOA 3WIMA 1NBWA 3I4MB 1U4RA 4OIJA 3X0WA 3K0YA 4BY7H 3WAPA 4CO7A 3SFEB 2LZ6A 4R9WA 2GBKA 3ITPA 1VJKA 4GLXA 5FJ8G 2G1EA 4HPLB 2UXDL 1K8AC 1VZ7A 1SYEA 3AECB 2F3WA 2I07B 1A3UA 1D5ZC 2F0EA 3TCAA 2A4ZA 2VL6A 2LKVA 1A70A 2R7FA 1SLJA 2E2DC 5LLIA 3ZLZA 3GTJB 4A55A 2L12A 4L5QA 4V0BA 2ON8A 1HNWQ 1MHHE 3QOJA 1TZ1A 3VR4A 3GO5A 3AI5A 1MD2D 5DPTA 1WCMH 4K3BA 1XCQL 1MIUA 1P0RA 1KLVA 1KDCA 4YTMB 5BN4A 4P1BC 1HR0W 3L17A 3TBIB 1HEZE 2A6ED 2WX1A 3B9JA 3HG9A 3S24A 1WYGA 1I5FA 2ICIA 1CKMA 1TWFH 4G3XB 1X3PA 5EKKA 4QGUA 3R7RA 1QVFA 3H6NA 1VQFA 2A8VA 4BY7B 3S15H 4NB3A 2DHZA 1Z7TA 4FF4A 1PGXA 1I4PA 2XN9C 2Z8LA 3EIVA 2QF7A 3MP9A 5IKCM 3QR8A 1AP0A 5BR8Q 5LMNL 2PVOD 1EYCA 3T9LA 4MN3A 1L2FA 4QAYA 1HZBA 2WKDA 4LNQA 1JWUD 3N6RA 4DV3Q 1STYA 1QJOA 2EYMA 1KRHA 3VH4B 1CKOA 1OXXK 3H91A 1WCMB 1HNZL 2AMCB 2DWQA 4MACA 1TIFA 5FR6A 3CKIB 4AYBG 3VTUA 4TKOB 1RWSA 3HOYH 3BJUA 2R6GA 3U4EG 4FXDA 2NPTB 1YN5A 3U30A 3R93A 3ABVB 1FO4A 2WXQA 2IGGA 3HUIA 3DBRB 1TWFB 2RBMA 3R2TA 3ZJTA 1AARA 1JC7A 3MXPA 1XD3B 5IWAL 3S15B 4WH4A 5EGTA 1CZGA 2WGSA 2VB3X 4UP8A 4PMWA 1QT9A 3OLMD 4C00A 5DPRA 3ZIMA 2YTXA 1HQMC 2MQHA 3FHWA 4GDLB 1TJEA 3X3NA 4YHHL 3OWEB 4RGMA 5DCNA 1HR0L 1JWMD 4NY0A 4ZHPA 1PTOD 3AEFB 1FMAD 2VUMG 1UBQA 1PH6A 2MJDA 1C48A 5G3LF 2LUMA 5JEAJ 3HOYB 1IBXA 2C7MB 1F9SA 1OO9B 2F0UA 4OELB 4PG3A 4IQZA 3PUVA 5K5PA 1OQYA 3RPFC 4GOPA 5G55A 3H1UA 1SGHA 3TEHB 3Q8DA 1RCVD 3RN9C 3RNEC 2EYPA 4LFCL 2RDHA 3FC4A 3M4YA 4KY7A 2PE9A 1EQRA 2R2OA 2YVCA 4HMIA 2L32A 3CPFA 2N0SB 1R4NB 1FRDA 2KOXA 3N20C 4XYCA 5CHWA 5MPOA 4MTKA 3VR9B 3I4NG 1KNAA 1FXTB 2B29A 4MGZE 3Q8BA 4A3EG 3HP3A 1IBLQ 1SYGA 3H3VC 5C44H 2LUEA 1MSGA 1K51A 1CSQA 1XLQA 2CQAA 2F4VQ 3CPWA 4X6AH 4HIDA 1PH8A 1EO6A 4M0WA 4DUYQ 1LM8B 2WXKA 4DF7A 5KYLA 4ZKBB 5C4ZA 1MHWC 4J6HA 1KRSA 3KJPA 1FNVA 1S72A 3S1MH 1SE9A 4IJLA 1Y1WH 1WRIA 2JZZA 5C4XG 3Q3JA 2D5DA 3TEXA 1NSNS 5IGBA 4DUZQ 3PCOB 3JAME 1YJIA 2DY8A 3ENEA 4X66Q 3DCGA 1XX8A 1A15A 1EOVA 2WKCA 4R3DA 4KKIA 4M1UB 4LFBL 4XZ4A 1LXDA 5E6JA 4KHVA 1LGRA 3KW5B 4EVOA 5M5WH 2KO3A 1WJNA 1CK1A 4ALPA 4QF4A 3DXJC 4OXPA 5C44B 3L0WB 1U9RA 3H09A 4A3GH 1ROEA 2KANA 4IUMB 4B95A 4YCUA 1IW7C 1K28A 2Y5CA 1SBBB 2C35B 1ONLA 2WNMA 3BG3A 1SYCA 3ZQ4A 3VR8B 2Y0SB 2BVCA 2QIEB 1KD1C 5EE3A 4A3BH 4E3CA 3I2ZA 5C5LA 3TP5A 1ZEQX 1BUIC 2KK8A 2PIAA 2PPHA 3S1MB 5EPKA 1GXDC 1Y1WB 1VDZA 1YITA 1L7YA 2NN6I 4A3DG 2LRUA 2LJIA 3UQBA 1QG7A 1K53A 4UAIA 2LFNA 4WIPA 2XVSA 5JPMC 3PPAA 4XX5A 2NR2A 1TR5A 3F2BA 4X57B 1LM0A 4G7ZC 5M5WB 4HIMA 1E7UA 5AEKB 2B63G 1Q81C 1HNWL 1WJUA 4NXML 3ERQA 4EZJA 5IP7H 4A3GB 1EWHA 2QA4A 2N3SA 2FE8A 2MBHA 2QDLA 3PF5A 4ZRPA 1TKYA 1YN4A 2WDTB 2ATWA 1F52A 2I5HA 1PFNA 2M1MA 2BYFA 1CFMA 3K7AH 5CYUA 2I38A 2K6DB 1ENFA 1MJEA 3U2SC 2ZXOA 1I4GA 3KUDB 4F8MA 3Q3NC 3OSOA 4A3BB 1C4PA 2DNFA 4PNYA 4BBRG 1AE3A 3E0JA 2N7DA 1AZQA 1MFWA 3WCQA 3A5ZB 3IXSA 4DU9A 1EIYB 1U4AA 1H9MA 2PCFB 4MGKE 2O5IC 4J1MA 5M3FG 2FMCA 3IKJA 3ULPA 4LW1A 1NR4A 2XIWA 1AZPA 1VCIA 2LD9A 1KIXA 2F3IA 5BR8L 3Q14C 2JA8H 1IGCA 3DVGY 5HFYA 4TQUS 3DHQA 2KMMA 3SXHA 3HKZB 4FP5D 1MSHA 4DV3L 3GDEA 1VQ9A 1BQQT 4IFDH 5EQ0A 2JWUA 2QDFA 2Z0DB 3HVZA 3VR2A 3VYRA 4FXCA 4PZ6A 3PIPA 3RZOH 4K81A 4YY3Q 2O6VB 4G57A 4JBMA 3K7AB 2DJFC 2V3PA 3KJOA 4HDOA 4MGYE 5EBCA 3H94A 1F2ZA 2GI9A 2N1WA 3Q6BA 1XTCD 4GLAC 2B2YC 4H13C 4K5XA 3GTPH 3P42A 2HUGA 1UZXB 2BWES 1S3SG 2DZIA 4A3LH 2KTRA 3J81i 3KF6B 4ZRKA 2EPBA 2AX5A 1ILQA 3D4RA 1OXSC 1X55A 2JVCA 2OEOA 4DV5Q 2JA8B 2ZVOA 5IGEA 3PZ7A 1NY4A 2A6HC 1EM7A 2N7JA 1EFID 1V86A 2ZTEA 4ZUJA 3RT3B 1QB5D 2VXWA 2ASBA 2MWSB 2QCZA 3L9AX 4XQNA 2NWGA 3ZJUA 4FYDA 3RZOB 1XO3A 1VQCA 2CFMA 3ZYYX 4EQ5A 4XQJA 4EZKA 1I4XA 3H6MA 4LUVA 2LXAA 3EGRA 3CD6A 4MZ9A 1SNPA 5BYQA 3HOWH 1VQGA 3D6WA 4GN3B 1UWVA 4UHVA 1PZID 4M01A 3GTGH 1A63A 5IGGA 3GE3C 4JI2Q 3UI2A 3PIO3 2JK8A 3GTPB 1RKNA 4MJSB 2L0FA 3CCVA 3AH7A 2K4KA 4CDCC 4DAMA 1V1PB 3MAQA 5HKHA 2MSED 3AN1A 1XMQL 2KKCA 4C3IG 1IBMQ 3CMMB 1YNTE 4US8A 1VQLA 2F4VL 4DV1Q 3ZNGC 1WGRA 1BKBA 4BY1G 4GDKA 4UDUC 3NZUA 3N1ZC 4LNIA 5IY0A 1WOCA 1GUOA 3QQ8B 1IYFA 1L1OB 1RJTA 2FCSA 3DVNU 4RKLA 2XNAC 1TT5B 2KX3A 2JEAI 1N36Q 1B44D 2L15A 2JA5G 3ZXRA 4YXDB 3HOWB 1F2LA 1YNXA 2LVOA 1IKLA 2H88B 3VA5A 4C80A 3GTGB 4BKTA 2NVUI 5GXGB 1XCTL 3A7LA 2K28A 3MWYW 4OONA 3J80E 3QJZA 1HQRD 5IGFA 3GP7A 2BPSA 1ASYA 2K8BA 4HPPA 1LT3D 1LYLA 4R4IA 2W3SA 4WWMA 4G11A 4JI3Q 4DGZA 1SMYC 1WYWB 2I2YA 3E9IA 3R3OA 1VQ6A 2FAZA 2KNBA 2UYZB 1QE6A 3EROA 2KDMA 2MX2A 2MJ3A 2BB5A 3NZ3A 3L10B 2K5NA 2JA7H 3H8HA 3R66C 1SR3A 4HJ9A 1F9QA 3J7A5 1PDXA 1SSNA 3KDFB 2FCNA 1LTID 2LJ5A 1ZDVA 1UH6A 4MGIE 3MEFA 4BBNC 1TZOA 1T5XD 5I4DA 1EEID 1AW7A 1EYDA 5GAHC 1JW9D 2N7EA 1SE4A 5CV5A 5GROA 5IT9c 2DLBA 4AQYL 5K36G 4RGNA 3TZUA 1OXUA 2G45B 3NRZA 1NR2A 3N52A 1SJHD 2F0FA 4Q5VA 2CHXA 2RDBC 2EYFA 1QOHA 2CH4W 3NQIA 1S5BD 1WD1A 5DM73 2X8XX 5IP9H 2BCOA 2SAKA 2LGDA 1Y8NB 1EY8A 2BYEA 2PNHA 1J7AA 2A74C 3EC8A 3R2IA 1BNZA 4OO1G 2W3RA 4LF9L 2F0MA 2ZJPA 2JA7B 4JI8L 3CF6E 4J8QA 1E2WA 1SJED 2KCMA 2RSOA 4YIJA 5G2NA 4ZDVA 5CHVC 1WH3A 3M63B 3GV6A 4JWSC 3WANA 2LEKA 1GB1A 1SYFA 2PW7A 3RFZB 4HJKA 3VRBB 2NB0A 3ECIA 2MHJA 1FEHA 3I57A 1PRTF 4NJ7A 3TEZA 4HKQA 4C1NK 2AWOA 3SE0A 2ICEC 5DM63 2MCNB 4A8XC 4KVGB 2B2WC 4NXNQ 3NEMA 2MNAA 3SR6A 2B2UA 1A2TA 4ZQ3A 1K0SA 1TKWB 1IP9A 2GB1A 3PHWB 2Z6BA 1M8AA 2M4NA 5CX3A 2R3ZA 4KY5A 4DV0L 1IBKL 4HK2A 4JI0L 3RLOA 4DK6C 3DBSA 2IY0B 1WI0A 4MNOA 3FEWX 4F87A 3AV8A 2UXBL 4JL9A 4KV6A 2WDQB 2Q2TA 3T1YQ 4GKJL 1ZGUB 2DX5B 1C76A 1WXSA 4X62Q 2V1YA 3PF4A 1VDVA 2ACZB 2IGDA 2LWPA 2GBMA 4NZLB 1PDQA 4NNJB 1RHPA 1H9SA 3I72A 3KLSX 1Y1VH 2F52A 4IOIE 1PTOB 4CQNA 5C3EH 1ZXHA 3NVYA 2E5LL 3RN2A 1DOXA 5FO7B 4KTAA 3V6EB 1WTXA 3PT2B 3ZJVA 3B08A 2BDNA 4DV5L 3I9V1 3I56A 1I4QA 3ZNZB 2WDRB
chains in the Genus database with same CATH topology
1YNNC 3PV0A 4LMQD 3FPUB 1RFKA 1UAPA 1B1ZA 2YYZA 4DNTB 1CQVA 4OZCA 1F2RC 1OQQA 4KN4C 4OGQC 1DOYA 4ME5A 4CGYB 1LTGD 1QWYA 1DYQA 1Y1VB 1ZDXA 5C3EB 2CJNA 3C1EA 2ONQA 1G2TA 4IUPA 4DK0A 4DQOC 2D5GA 4KD4A 1NCVA 2MPMA 3NTHA 3U7ZA 3HOUB 2HDLA 3VYTA 1QF6A 1PFMA 2KQ3A 5D65A 1KH0A 2LHEA 2MP1A 4CJ1B 2E2IB 3BDLA 4IUQA 3S2HB 3MFGA 5EJWA 1EY0A 1N5WA 2WQYB 1R4PB 2BS3B 1PGAA 5C3XA 4A3FB 5T8IA 1NEKB 3IT4B 2K6AA 1Z6HA 2EYOA 4KN7C 3U9SA 4B08A 3P4QB 1V8CA 4BA2I 3MHZA 2WU2B 1ZYRD 2D9UA 1E6EB 5TSSA 5J1ZA 4C3HG 5J39A 5LNK1 1TY0A 2A69D 2K5QA 1J7BA 1JWSD 4RHSA 2V4IB 2K1BA 2YEPB 3T4AC 4IDIA 1KABA 4DN4M 5ELEA 1T6BX 2EVBA 4USAA 1TWCB 2WXGA 3IAYA 4ITKA 2FFKB 3DEPA 2B39A 3MTSA 3MEHA 4IUNA 3QO2A 4QMGA 4WAFA 3U9OA 4XTCS 2XSCA 1SE3A 3OW7A 1C4CA 5T1IA 4C2MB 1AFPA 1NVID 3TEWA 1I4RA 3AEGB 3SK6A 3SFDB 2WXIA 3Q69A 1JR0D 3TDQA 2BBCA 3AE9B 3SDZA 2JSOA 1PFDA 2NVQB 4LK0M 4HCEA 2N88A 3J81E 2W54A 4FO2A 2KACA 2F3VA 3KQ4A 3N9YC 4KGSA 3AEEB 3BYYB 2F0VA 1NAPA 4EQPA 1ESFA 1MHXA 4FVMA 1UWMA 4KGTA 4OO1I 3GTMB 2MUYA 1OXVA 2E76C 2Z4HA 4RCNA 1B2TA 1LLRD 1DOMA 1PRTD 1TIID 3O13A 2DYOA 3BVMA 5D3IB 2JX5A 2K0PA 3C1FA 1J7CA 3L4PA 3RMHA 4YSYB 1ET6A 1OXTA 4L2YA 5BYSA 3NS1A 1WTOA 2EELA 1SXTA 1EL0A 1FFUA 4ZLTF 1ZUD2 2YEPF 1Z47A 3NBHA 3MVVA 2A6EC 1BOSA 1L6VA 4JBWA 4PV1C 3S16B 5BMGA 2V0GA 1SDFA 1O78A 1L4ZB 2JU6X 1L4DB 4C7ZA 1C8CA 3L3OC 2A68D 2IDYA 3C3LA 4YSZB 1DZ1A 2PW5A 3AE4B 2NZ1D 3Q22A 1NENB 5IODA 2ZXRA 2NUCA 5IT9E 3GD7A 4PMBA 1TWAB 2LFIA 2B2TA 1KDAA 1XWEA 1ICWA 4QCLA 2OT2A 5EKIA 5IT9L 1WSPA 3A56A 1TKGA 4FF2A 1XF5L 2BE5C 2EE1A 3DWGC 1TVXA 3I91A 2BS2B 2BS4B 3MZ5A 5BYRA 1NUCA 1Q8IA 4KHZA 1HZ6A 1Y69U 3VR3A 1H9KA 1EY6A 3E6ZX 3SHLA 3H0GB 2R93B 4QUCA 4ZAIA 1PTOC 3S14B 2BTEA 1S5FD 3TP7A 1SB3C 1HFGA 5FO8B 4HEA1 3B2GA 4KK7A 1DJRD 3P75A 2NVYB 1PYWD 2Z1CA 3RLFA 2XWBB 4A3KB 3PZ8A 1DCZA 2XRQD 3KWVA 2G9HD 3PMFA 3PIP3 2L55A 3K6OA 4XE0A 1AN8A 1JQ4A 4KJOA 5BMIA 3TN2A 1HPCA 5FKAC 4FXKC 2VZKB 1JWBD 2J42A 5M5XB 5CR3A 3GS2A 2JEBI 2PKOA 3F2UA 3U52E 2WXPA 3BVZA 3V3XA 4HSVA 2HCIA 2JYTA 1HHVA 3FRPB 1H9SB 1KF6B 5HI1A 2HQEA 1EIGA 4RWSC 1CJEA 4BY1B 1GHJA 1ZPSA 1Q10A 4U68A 2KN4A 1C9FA 2RA4A 4X3TA 3P4SB 2WINB 4J3OD 5C0XH 4O42A 1Q3LA 1KTKA 3LWEA 1FIQA 1EY7A 3K5MA 3VQIA 4K6DA 3KWLA 4QIWB 4YTNB 2KCCA 1I4HA 4A93B 5H8YE 4US9A 3IAS1 3JAML 2XWJB 5I9OA 4A3JB 1X3QA 2PNRC 2MEKA 3K57A 1TKEA 4NDXA 1NI3A 1PXUA 1GHKA 1II3A 1YN3A 5JVH3 1NYRA 4RF1A 1SNQA 1EU4A 4BA1I 2WV6D 1CTMA 3TMEA 5F2DA 4XT3B 2F0DA 3AE7B 2BDOA 2EYJA 1IYUA 1CZPA 3LXFA 3D6CA 3MA2B 3VA7A 1YNJC 1BCPB 2F0QA 1PFBA 5FR3A 2CJOA 2IL8A 4CHTB 4HKZE 4NAMA 3T51B 3NQTA 3CRKC 4A3MB 1EEFD 1I6HB 3LX0A 2QCPX 1IW7D 1T3QA 3D4WA 3GTKB 1XXGA 1Q1BA 3NSWA 3BZDB 3IFTA 2LMCA 3WOFA 3M3YB 4N9TA 4GZYC 2X6GA 2D62A 1JWAD 4MHEA 3T3OA 2KAJA 5JEAH 5IIFA 1U4PA 4CBVA 5I2XA 1SYDA 2W82A 2R92B 3RUZA 1EWCA 2K03A 3NVVA 3AEDB 2F0JA 4KD3A 1X32A 3PUYA 4PMCA 2WXNA 2PZUA 4KKJA 3EFXD 4K8JA 3Q6SA 3HGBA 3SR1A 2EY5A 2KA7A 4ZHOA 4KI0A 1STNA 1STAA 1G291 2Y5PA 2PZTA 1SSOA 1O7YA 1WVLA 4H0LC 2V4DA 2M56B 1FD6A 3GTOB 4RA8A 2M2LA 1C4QA 3CRLC 2F4IA 4NW2A 2O5JC 4NKLA 4KJNA 2N9LA 4IN3A 3NWTA 2B76B 3FAHA 2IJ0A 4JE3B 3HOZB 1DONA 1WXQA 5CV8A 5AUIA 4CKCA 4A3IB 4P6VF 2H4OA 1S5ED 4B0EA 4F7XA 4BS9A 3FILA 5KYIA 2F0LA 5M5YB 4RGOS 1EQTA 1EZ6A 2DNCA 5NUCA 4K5WA 2RSNA 1CT1D 5G3LD 3NUCA 1D5XC 5HGTA 3P4PB 1KAAA 2K9XA 1C4AA 3W3AA 5G5GA 3VR6A 4TQ1A 1Y56A 2WXHA 1FCLA 3S17B 1UUPA 3LYYA 2QMTA 3J80L 1JOQA 5D3DA 1KFYB 5CBAE 5M3MB 2QEJC 2M00A 4DNRB 4NJCA 3BS1A 3OMCA 3OIPA 5E4WC 2F0OA 5C4JB 2GA4B 2MJEA 2RDFA 3AE6B 2INNE 4RH6A 1BXTA 1F9RA 1HCZA 1ET9A 4L8JA 4L6TB 4N58A 3VRAB 3T3NA 3AM9A 1O7LA 3WOEA 1E7PB 1QOGA 1VLBA 1C79A 1GUSA 1VZ6A 1AWDA 2PVGC 1F2MA 4PQXA 4RCOA 1IKMA 1SMYD 2NVXB 1NYQA 4KGRA 2NN6H 1CHPD 2B2UC 4X3SA 5IOCA 3LB8C 1PTOH 3C2PA 2LHDA 3AEBB 1D6EC 3TZDA 4MIUA 5AUKA 3NBIA 3HVDA 4GLSC 1FM0D 1VR9A 4C56C 2EJMA 2K5DA 1E2VA 5HHDG 1LABA 2IPKD 2L83A 2F0IA 1STGA 2CW0C 4KY6A 3VYSA 1YQ4B 1ZXTA 3E5SA 4RAUC 4AQ7A 3G6JB 4HEDA 5ELCA 4ARCA 3HRDD 4L63B 4N59A 1N5XA 4L1BA 4Q0FA 2BA0A 2IW3A 4QUFA 4XDCA 4R8IA 3K5LA 1RD9D 4ODGA 2Q8IB 2F0GA 5C5MA 2QDBA 2B8GA 2Z4IA 1WTQA 3J7YW 2Q8RE 2JYEA 1IBXB 3PUWA 2CU3A 2Q8TA 1IHZA 2CHBD 4B9WA 1Y8PB 5CORA 2F0HA 3TUOA 1K8OA 1FD7D 1S5DD 1I50B 2QJLA 4U673 1HXYD 1S5CD 4ZRQA 2M19A 2HCCA 2PZWA 2B2VA 2WDVB 1PMRA 4IFDG 2V3NA 2IX1A 2WS3B 4BWGB 1EIHA 5JVG3 4XYQA 4D2KA 4DFAA 4YT0B 1F2YA 2F0TA 1TU2B 3GTLB 1TS4A 4IUTA 1ZYRC 3FMCA 4OHJA 2C9OA 3C8YA 1BCPC 3A8KE 5CV9A 2K5WA 2RMMA 3I4LA 3Q24A 5C3JB 3QWNA 3NPPA 3OMGA 4IKGA 1IGDA 5C2TB 3D8GA 3DWQA 2M0AA 4K8IA 3KBGA 5C6AA 2L9HA 3I8ZA 4HROA 2X69A 3AU7A 4C3JG 4XIGS 3I73A 3Q23A 5E3FA 2FINB 2E3TA 1CHQD 1E0ZA 1ZXIA 2E74C 2FBWB 2BA1A 2K5PA 1MPEA 4AYBB 1STBA 2MH7A 2AUKA 1N62A 1MVKA 4ZRZA 2JZPA 4RFBA 4C7YA 3Q8CA 1A3TA 2RKSA 3CIRB 2IX0A 1R4QB 2KHSA 1E0BA 1PTOF 1GUWA 4EQOA 2EKIA 3A8JE 1TY2A 4WQMA 4RGTA 4IZ8A 1SF0A 1B53A 4ZYSA 1I6VC 4WORA 1K50A 2E75C 1VMPA 2ZT9C 3P20A 2JP1A 4HN7A 4OZAA 1PUTA 4XWWA 4KKSA 5CV7A 2VUMB 1EY5A 3KBXA 2FMMA 1FR3A 1DOIA 1V43A 2L11A 2BB6A 1CI3M 3MXNA 1ACCA 2PQEA 3AE5B 2E2JB 1EOTA 2LMCB 1SIJA 1ZKOA 4ID6A 2K33A 5DAUA 2LGIA 1TT2A 2GRIA 5JOBA 1XEEA 1B3AA 2YU9B 2BYTA 3NVZA 5BN5A 3GTQB 3I4NB 1C77A 2K22A 4REZA 4A3EB 1BDOA 4PT5A 1GUTA 2LS01 3J81L 3KUPA 2FJ2A 1B9NA 2RQXA 5CV6A 3R8BA 2J52A 1LT6D 1F2RI 1QQRA 1VMCA 2WXMA 1RF2D 4TRDA 4KMUC 1JROA 5I2YA 1BBXC 5C0XI 3J7AV 4CKEA 4G7HC 1Q90A 4XT1B 2EY1A 1A6XA 5C4XB 4JWUC 5T1GA 2ZW1A 1F77A 3NWSA 5C3WA 1B9RA 5FOBB 1BMLC 4FF3A 3NE5B 3W1SA 1WD0A 1RTNA 4OZBA 1KNEA 1DOKA 1W6JA 4FXGC 4OVZA 1FNUA 3MXUA 5IGDA 2TSSA 1HA5A 4JX1C 4XYOA 4R8NA 3FPPA 5E4XA 1TQOA 4HSPA 1LV9A 4IUVA 3DMUA 4A3DB 4DAPA 5C4HA 3NTKA 4GDKB 3D31A 3FILB 2KECA 4XDDA 3EVQA 3HRZC 4S3SA 5E1FA 3TEYA 3S1NB 4G4KA 1ML0D 3J9CA 2B63B 1SAPA 1LTSD 3TP6A 4HCSA 3OIQA 2B8FA 2KEDA 2B2TC 1O80A 2DY7A 2WACA 1RODA 1CQFA 1B4OA 3GV3A 1IUEA 3P1MA 4BBRB 1JORA 1FXIA 2F03A 1BO0A 5M3FB 3NXWA 3OHXC 2DYMA 3CWIA 4Z9CB 1LT4D 3EA6A 1EU3A 5EE9A 2QKIC 1KLGD 1MI2A 3X3MA 3UI3A 4IFDI 4LTUA 5D7GA 1JALA 1QILA 2DBYA 4EQNA 4YTPB 3RZDB 1WTRA 4ZUIA 2VB2X 3A8IE 4Y7NB 1VF5C 2O2LD 5AFWA 4A9AA 1EYAA 2EJFC 1SNCA 2G9DA 1WTPA 2SNSA 4MH8A 3M4OB 4WJWA 3PUZA 2NTTA 1P7EA 4XDXA 2M9VA 3W9CB 2JYOA 1OQRA 1TWHB 1DD2A 1VRAB 5JJZA 2XRSD 3PO0A 3QG1A 3PUXA 2BW2A 4HRSA 2BE5D 4JPSA 1ESRA 1OFFA 1R9TB 2OHFA 3V05A 3KF8A 3GB1A 4IFDJ 3SEBA 1RM6C 1GUNA 4YWGG 3BVGA 4A6QA 1JB3A 1G2SA 4H2AA 4C3IB 1DM0B 2HDEA 3CHBD 3AB5A 4RKBA 3A7AB 1FFVA 4K6LA 4H44C 1XYIA 1RYJA 3QOLA 5DNFA 3TSSA 2PPBC 2A5HA 3OOCA 3HZXA 2K32A 2JA5B 2W55A 2IGHA 4WRDA 4QB4A 1STHA 5K36H 1HZ5A 1EY9A 1UGJA 1Q12A 2TMPA 5FO9B 4N6EB 2IX3A 3T53B 1SFOB 3NHHA 3V2TA 3IT6B 1TS2A 1HFNA 1AEXA 3AMUA 4TQ0A 1STEA 3NTIA 5A35A 2PO4A 4OO1H 2E6XA 3V96A 3AE2B 2Y3AA 3BK1A 2EY2A 1U4MA 3ETRA 4K2KA 4YSXB 2L52A 1EY4A 1LACA 2PMVA 2N55A 5G5HA 5I6WA 4CKBA 5IGCA 5EE1A 2L5TA 1GAQB 4O1NA 3E9SA 2PTLA 4DK1A 2BOSA 1Y8OB 5I6YA 1BF4A 4KKUA 2F0NA 4XQQA 2Q5WD 1FCCC 2EXZA 1JRPA 4HJGE 1QCBD 3AEAB 4OL7A 1G6ZA 4WFN3 4XWTA 1HA6A 3I90A 1XLOA 3EJIA 1J9OA 1ZP0B 2NMQA 2WXJA 4FF1A 4IUUA 1VZ8A 1VF7A 5EPLA 3C46A 2SNMA 4ZOHC 1GUGA 1YMHE 3NVWA 1N61A 2H1EA 1E2ZA 2IT1A 5LL6X 1M4VA 4XXEA 3P7JA 2F0WA 3K58A 2PYKA 1EWYC 1D1KA 1PZKD 2AQ3B 1KDBA 4RF0A 1ENCA 4DA2A 2OXPA 5KNBA 1AYFA 2AWNA 1YNJD 4B0MA 4DAYA 3WDNA 1WWTA 1V1OA 3FDTA 1I3QB 1QNUA 1V8QA 1YQ3B 2SOBA 1QOBA 1G8ZD 3ND8A 1CA5A 4P16A 4A90A 1XLNA 2R61A 2RDGA 5CC4A 3URYA 3QB3A 4LAAA 4N9PA 5HURA 1UNSA 4EE2A 1SYBA 1JMLA 5EKLA 1L0VB 1JQYD 3HS0C 1QOFA 1LTTD 3ND9A 2B2YA 1TWGB 5JPNC 2F0KA 3T16A 1PLFA 3DM1A 4BBSB 3Q8EA 2JSVX 1WTVA 1CZWA 2L0CA 1D4BA 1F9PA 1PRTB 1HRJA 1B9MA 2KEEA 2N9KA 4RNAA 1ENAA 1GB4A 2J7ZA 2J53A 1JOKA 2A6HD 2KOLA 4Q2JA 1S4ZA 1D5MC 1BCPF 1SNDA 2K7VA 2RPVA 1T5EA 4OW0A 3K5NA 2WAQB 2I46A 3MJ5A 2PMZB 2OEDA 2FHTA 4ARIA 4C3HB 5KNDA 5LL6S 3AMZA 2ENBA 3G7LA 1I7HA 3S9WA 3AE8B 4C3JB 5ELFA 3S1QB 2J4XA 3BIID 1O7ZA 4KKTA 4CJ2C 1JCKB 1SE2A 1EZ8A 2C5CA 3NK9A 3DWAA 3J7AF 3D3RA 1F0ZA 1GOZA 3DUZA 1K8MA 5COYA 1C78A 4LJZC 3S1RB 4DXFA 3K59A 4NMZA 3BDOA 1EQVA 2JE6I 4TSSA 3BDCA 2VNUD 1CM9A 5JXVA 4AS1A 5C0XG 3CU7A 2K05A 1BR9A 3A55A 4LLGM 2RVLA 2EY6A 4X3UA 1QKZA 3E56A 2PLPA 2NVTB 3Q8AA 1LTRD 1SEBD 3DWMA 1RTOA 4K5VA 1QOAA 2AQ1B 3K5OA 2K01A 3DWPA 3ZGZA 3TP8A 4ILWA 2SEBD 5I9PA 2WIIB 1GPXA 2ID0A 1LT5D 3SK8A 2JXMB 2QILA 5HG2A 4I65A 4B9XA 2L1BA 4X3KA 3SK5A 4IURA 3P63A 1P7FA 2BT6A 2EJGC 3FVQA 3KK7A 3SK4A 3IFDA 1ZE3D 3L7ZC 2NBFA 2JQRB 2J0TD 4E6IA 2DN8A 1KLUD 1IYVA 1N60A 2LY7A 2WP8J 2B2WA 3T13A 5FLXE 3M7GA 3LWUA 2KUMA 5FK9C 1ILPA 3S2DB 5ELBA 2VZKD 1LTBD 1TYGB 2EYLA 2ZXPA 2PW9A 2EDGA 3BK2A 1MI0A 4FNFA 1FNWA 5BN3A 5FLXL 1SNOA 1HUNA 1L5PA 4HTHA 2B2VC 1L0YB 2HTME 5D14A 4C1NI 1E9MA 3CQZB 3P1HA 1D2BA 5M9OA 1D1IA 1G91A 2KQ4X 1L0XB 1PGBA 2CW0D 2K04A 3M7NA 5H92C 3HOVB 1QNKA 5EBDA 3I3CA 2WXFA 5EPJA 2QSDA 1DXMA 1FXAA 4K14A 3OWFA 3IAM1 1FRRA 5J22A 1ZOYB 5JEAG 3FKIB 2L1AA 3HEJA 2K3UA 3PO3B 2A69C 1YNND 4HMJA 3MXGA 1A3VA 3EQLC 2WXRA 1K83B 4RHRA 4I7ZC 4NP5A 3M85A 5KGUA 2EZVA 4DAVA 2MGSA 1JOOA 3Q0AA 1TS5A 1R7SA 1W6KA 3KLSA 3LNNA 2EYHA 2EOTA 3BWUD 4NAWB 4TMAB 1MBYA 3IL8A 3MFYA 2CVRA 3D4DA 1BUVT 2NYZD 1H9RA 2MJ8A 2F0PA 5ISRA 1WGKA 1K52A 4MM3B 5CBEE 4K2LA 4HAEA 2X38A 1BCPD 3AE1B 2KJXA 4OIKA 1J8IA 5EE0A 2AUJD 3ONAB 2SDFA 1YJJA 1L6UA 2JXTA 1JICA 5KEEA 2A73B 4DXGA 3GQBA 2MJDA 3MHBA 4P2CB 1IL8A 5KRUA 4F88A 3BYTB 5CGKA 2KWDA 1LTAD 3T56B 5BMHA 4G7OC 1PZJD 1HTPA 1GJXA 2F0SA 3KLRA 1B50A 3A54A 3B2FA 2F1MA 2WXOA 3HOXB 3W2DA 4H7BA 1RDPD 2INPE 1UEAB 4IALA 4LK1C 1A2UA 2JA6B 1SNMA 2KVMA 4M8AA 1V97A 1PRTC 3PO2B 2OF1A 3I70A 1MGSA 2H89B 3OPOA 1XLPA 1HUMA 4L23A 1E10A 3MC0B 2ZW0A 1DGJA 3SVMA 2DNEA 1CA6A 2FUG1 5DEHA 2WXLA 4ABNA 3QJYA 1WTWA 4EGVA 5ELDA 3AE3B 3QIAA 5KIXA 2D2CC 4ZK9B 4KX6B 1V1PA 2NN6G 3W5UB 2WP9B 1JE4A 3NP8A 1HTLD 4HR7B 2WLBA 4JK1C 2IWHA 5CMDA 4MT5A 2O4XA 4WURA 4ZKCB 1H9JA 1N63A 5CV4A 2WU5B 2A68C 2E2HB 1U4LA 1TS3A 1DOLA 1Q1EA 2KCNA 2MHVA 3EUB2 1QLBB 1FYCA 3VYUA 4ULLA 3VR5A 2X6LA 2WB1B 1LO5D 5JAVA 4CJ0B 2HDMA 1UWXA 3P4RB 3Q8FA 2R7ZB 3AB9A 1FGBD 5A2QE 3NUHB 3RD4A 5KNCA 5C0XJ 2L4NA 5LHY1 2NTSA 4V190 2AQ2B 5A2QL 3DEOA 3I4MB 1U4RA 4OIJA 3K0YA 3SFEB 4R9WA 3ITPA 1VJKA 2G1EA 1VZ7A 1SYEA 3AECB 2F3WA 2I07B 1A3UA 1D5ZC 2F0EA 1A70A 2LKVA 2E2DC 4A55A 3GTJB 2L12A 2ON8A 4V0BA 1MHHE 3QOJA 3VR4A 3GO5A 1MD2D 1XCQL 1KDCA 4YTMB 5BN4A 3TBIB 1HEZE 2A6ED 3B9JA 3HG9A 1WYGA 2ICIA 1X3PA 5EKKA 4BY7B 1Z7TA 4FF4A 1PGXA 1I4PA 2XN9C 2Z8LA 2QF7A 3MP9A 1AP0A 2PVOD 1EYCA 4MN3A 2WKDA 1KRHA 1JWUD 3N6RA 1STYA 1QJOA 2EYMA 4MACA 1OXXK 3H91A 1WCMB 2DWQA 3W5VB 3CKIB 4TKOB 1RWSA 2R6GA 3U4EG 4FXDA 1YN5A 3R93A 3ABVB 1FO4A 2WXQA 2IGGA 3HUIA 1TWFB 2RBMA 3R2TA 3ZJTA 1JC7A 3MXPA 3S15B 4WH4A 5EGTA 1CZGA 2VB3X 4PMWA 1QT9A 1HQMC 4GDLB 1TJEA 3X3NA 3OWEB 4RGMA 1JWMD 4ZHPA 1PTOD 3AEFB 1FMAD 1C48A 5G3LF 2LUMA 5JEAJ 3HOYB 1IBXA 1F9SA 1OO9B 2F0UA 4IQZA 3PUVA 5K5PA 3RPFC 1RCVD 2EYPA 2RDHA 3FC4A 3M4YA 4KY7A 4HMIA 2L32A 2N0SB 1FRDA 5MPOA 3VR9B 1KNAA 3Q8BA 3HP3A 1SYGA 3H3VC 1MSGA 1K51A 1XLQA 2CQAA 4M0WA 2WXKA 4DF7A 5KYLA 4ZKBB 5C4ZA 4J6HA 1FNVA 1WRIA 2D5DA 3TEXA 1NSNS 5IGBA 1YJIA 3JAME 2DY8A 1XX8A 1A15A 2WKCA 4R3DA 4KKIA 4M1UB 5E6JA 4KHVA 4EVOA 1CK1A 4QF4A 3DXJC 5C44B 1U9RA 3H09A 1ROEA 1IW7C 2Y5CA 1SBBB 1ONLA 2WNMA 3BG3A 1SYCA 3ZQ4A 3VR8B 2Y0SB 2QIEB 5EE3A 3TP5A 5C5LA 2PIAA 1ZEQX 1BUIC 3S1MB 5EPKA 1GXDC 1Y1WB 1VDZA 2NN6I 2LJIA 1QG7A 1K53A 4UAIA 2LFNA 4WIPA 2XVSA 5JPMC 1TR5A 4G7ZC 5M5WB 3ERQA 4A3GB 1EWHA 2FE8A 4ZRPA 1TKYA 1YN4A 1PFNA 1CFMA 5CYUA 2I38A 1ENFA 3U2SC 2ZXOA 1I4GA 4F8MA 3OSOA 4A3BB 1C4PA 4PNYA 3E0JA 1AZQA 3WCQA 3IXSA 4DU9A 1H9MA 2PCFB 2O5IC 4J1MA 2FMCA 3IKJA 1NR4A 2XIWA 1AZPA 1VCIA 1IGCA 5HFYA 4TQUS 3DHQA 2KMMA 3SXHA 3HKZB 4FP5D 1MSHA 2JWUA 4IFDH 1BQQT 5EQ0A 3HVZA 3VR2A 3VYRA 4FXCA 4G57A 3K7AB 2V3PA 5EBCA 3H94A 1F2ZA 2GI9A 1XTCD 2B2YC 4H13C 4K5XA 3P42A 2HUGA 2EPBA 2AX5A 1ILQA 3D4RA 1OXSC 2OEOA 2JA8B 3PZ7A 5IGEA 2A6HC 1EM7A 2N7JA 1EFID 4ZUJA 1QB5D 2VXWA 3ZJUA 3L9AX 4XQNA 2NWGA 4FYDA 3RZOB 1XO3A 3ZYYX 4XQJA 1I4XA 3H6MA 3EGRA 1SNPA 5BYQA 3D6WA 1PZID 5IGGA 3UI2A 3PIO3 3GTPB 1RKNA 3AH7A 3MAQA 1V1PB 3AN1A 4C3IG 1YNTE 4US8A 4UDUC 1GUOA 1RJTA 4RKLA 2XNAC 2JEAI 1B44D 4YXDB 3HOWB 1F2LA 1IKLA 2H88B 3VA5A 4C80A 3GTGB 5GXGB 1XCTL 3A7LA 2K28A 3MWYW 3J80E 1HQRD 5IGFA 3GP7A 1LT3D 2W3SA 4WWMA 4DGZA 1SMYC 2I2YA 3R3OA 1QE6A 3EROA 2KDMA 2MJ3A 2BB5A 3NZ3A 3H8HA 1PDXA 1F9QA 1SSNA 1LTID 1ZDVA 1TZOA 1T5XD 5I4DA 1EEID 1AW7A 1EYDA 1JW9D 1SE4A 5CV5A 2DLBA 5K36G 4RGNA 3TZUA 1OXUA 3NRZA 1NR2A 3N52A 1SJHD 2F0FA 4Q5VA 2EYFA 1QOHA 3NQIA 1S5BD 1WD1A 5DM73 2BCOA 2SAKA 1Y8NB 1EY8A 1J7AA 2A74C 3R2IA 1BNZA 4OO1G 2W3RA 2F0MA 2JA7B 4J8QA 1E2WA 1SJED 2RSOA 4YIJA 3GV6A