1GOZA

Structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
228
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKDKRKSCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Enterotoxin
molecule keywords ENTEROTOXIN TYPE B
publication title Structural and Functional Role of Threonine 112 in a Superantigen Staphylococcus Aureus Enterotoxin B.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 64
structure length 228
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1gozA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gozA02
1V1OA 5D3DA 1HTLD 1KLGD 1PTOF 1LLRD 1L0XB 5ELEA 4RCOA 3BYYB 4DXFA 1ET6A 1FD7D 1FNUA 1PRTF 3CHBD 1AN8A 1FGBD 1RCVD 2O2LD 1LTAD 3R2IA 1UUPA 2XN9C 1QILA 5TSSA 1CT1D 1TS3A 4DXGA 3MFGA 1JR0D 1S5DD 1CK1A 1BXTA 2Z8LA 3MC0B 3OWEB 3DWAA 1CHPD 2TSSA 1CHQD 1JWMD 1SEBD 1MD2D 4L63B 1LTTD 1HA5A 2XRSD 1LO5D 3BVGA 1SE4A 4OHJA 4RFBA 4RGNA 2XNAC 1D6EC 1EU3A 2RDGA 4TSSA 4RHRA 2NTSA 1EFID 4RHSA 3R2TA 1D5XC 1KLUD 1YN3A 1TS4A 1PZKD 1M4VA 4NZLB 1LT3D 2QILA 2IJ0A 1BCPD 1TS5A 2IPKD 3V05A 1LTGD 1LT6D 1JWSD 1TS2A 2J4XA 4L6TB 1LT5D 2ICIA 1L0YB 1V1PB 1FNVA 5FK9C 1ESFA 1JQYD 2AQ1B 1PRTC 1I4XA 1YN4A 1EWCA 1JCKB 1SE2A 1EEID 4ZYSA 1HXYD 1JWUD 1S5FD 2G9HD 1ET9A 2AQ3B 1T5XD 2AQ2B 1B1ZA 1LTRD 3GP7A 4RGMA 1UNSA 1TY0A 3R8BA 1PZID 1SE3A 2QEJC 5ELDA 1XTCD 1PZJD 1S5BD 1BCPB 1DYQA 1KTKA 5D3IB 1PTOH 1LTBD 3SEBA 1D5ZC 1TY2A 2WV6D 1I4HA 4C56C 3BVZA 1BCPF 1AW7A 1LTID 1PYWD 3O13A 1F77A 2XRQD 1PTOC 1ENFA 4O1NA 3EA6A 3BVMA 3BYTB 3TSSA 1RF2D 1STEA 5I4DA 4UDUC 5ELFA 1D5MC 4BWGB 1I4GA 1SXTA 4RGOS 4RGTA 1CQVA 1EU4A 2CHBD 1YN5A 1PTOD 1GOZA 2NTTA 3EFXD 1HQRD 1S5ED 3W2DA 1SJHD 3URYA 1FNWA 3DWPA 3KLSX 1PRTD 3BZDB 1DJRD 1V1PA 5ELCA 1RDPD 2RDHA 2SEBD 4RH6A 1S5CD 4K6LA 1XXGA 4Z9CB 1G8ZD 5ELBA 1I4RA 1SBBB 2R61A 1LT4D 1EEFD 3DWQA 1I4QA 1B44D 1I4PA 1RD9D 5FKAC 1PTOB 1BCPC 1LTSD 1SJED 1PRTB
chains in the Genus database with same CATH superfamily
1TJEA 2I5LX 4R4CA 3I56A 3HS0C 2C5CA 2ZPYA 4MGIE 3W5VB 1I35A 3UQAA 2JA8H 3ZYYX 1C4QA 5FOBB 4RKBA 1QVCA 3QG1A 3KF8B 1GUOA 2E2DC 3VFKA 3M7NA 4DK1A 1U9RA 3NHEB 2EKIA 3S17B 4J1MA 3I4NB 4UHVA 4BY1G 1DGJA 2ZVNA 3S2HB 3CRLC 4DAMA 1NVID 4GXBA 3T9LA 1Q81C 2HT1A 3P4SB 3WAPA 2HJ1A 4A3CH 1EF5A 4LLGM 3HOVH 2K5NA 3A5ZB 3N1ZC 3DVNU 3RI7C 4JPSA 5H92C 3MHSD 3DBRI 4JWUC 2CWPA 2X6LA 5IOCA 2RSOA 3L2PA 1H9JA 4ZDVA 1E0BA 3AMUA 1OQYA 4OELB 4DF7A 1C4CA 4MJSA 4ANVA 3MP9A 2K75A 1SIFA 1IKMA 2LRUA 2WXGA 4TSSA 1NE3A 4JIOU 1JRPA 3UQBA 4RHSA 1R4NI 2JA5H 4NXML 1OEYA 1C4PA 4LDTD 3BY4B 1B3QA 1L4ZB 1KNEA 4KY5A 2VQFL 2EIFA 3D31A 4FDBA 5C0XH 4YHHL 3TEWA 3H15A 4HK2A 5KHOA 1EY9A 1XMQL 1O7IA 1FNVA 2K5VA 2LSSA 5FK9C 1XPUA 1SROA 1NI3A 5E6OA 3U2SC 3HOZG 2L0TA 3HK0A 2ZJDA 2JA8B 4HDQA 1S5FD 1S1QB 2L3ZA 4OVZA 2BH2A 2LFIA 2V4LA 2F0TA 4KIKA 3ER0A 2EYOA 1E5WA 3CU7A 3CQZH 2XEWA 2LGIA 3Q8FA 1TY0A 4XT3B 1WIAA 1RKNA 3T56B 4MH0E 4MTNA 4B6WA 2EMSA 3EFCA 1A6XA 4WQOB 1KAWA 5IT9c 1QZEA 4XYOA 1VRAB 1CM9A 1HZCA 1Z47A 3TP7A 2GBKA 2L32A 1A3VA 3HOVB 4PG3A 1P3QU 2J0KA 4TKOB 5L37A 2INCC 4IOAA 3H7PA 1HRJA 4NJ7A 4WJOA 1QZGA 2G4SA 1HZBA 3GV3A 4YWLA 4X3TA 3GO5A 2LUMA 4NQLB 4ZYNA 3VHTC 3NK9A 1JWBD 1KXLA 2YYZA 5J22A 2K14A 4O1NA 1NYQA 4JW0A 2WDRB 1STNA 5GAGC 2DZKA 3BYTB 1UWVA 1KJTA 1FCLA 2EMTA 4FLHA 5BYSA 2JA5B 4NJCA 1I4GA 3ZJYC 4XWWA 1G6PA 4KY6A 4Y7NH 1CQVA 3P20A 2J0TD 1E9MA 5FO9B 3FVQA 1HQRD 1WWTA 2MHJA 2D62A 5JZEB 2GOWA 5LMNQ 2OF1A 4TUUA 2WQYB 1AE2A 1C9OA 1F2MA 1V1PA 1VQEA 4A3KB 3BZCA 1QF6A 2M56B 4CBVA 4G11A 2NPTB 2Z4HA 4A75A 4R4TA 1C78A 4MJSB 1C9FA 2WINB 3R7QA 2PPHA 1WTHA 1HNZQ 1OQRA 1PH1A 2DAFA 1VQNA 1K52A 5JH5C 3CQZB 4R1JA 2PVOD 1R4MI 1SF0A 2OQ0A 2D10A 1LQBA 3AFQA 4C3JH 2IX3A 4X3UA 1XWEA 4GMVA 1YD8U 3TEXA 5C4JH 2WDTB 5I6WA 1YZ6A 5I9OA 5IT9L 1W2BA 5IT9E 2IO0B 4A93H 4IM2A 2MLBA 2INNE 2IYDB 2Y0SG 4A3LG 2KDIA 5IYDG 4OWTB 1ASYA 2B63G 1UBIA 1FD7D 5JEAH 3RN2A 3QOJA 2KXJA 1RCVD 4KIKB 1D3ZA 3QWZB 3HEJA 4GLVB 5C4XG 2B2UC 3R2IA 4C2MH 1YNJD 2HTME 4FN2A 2ZVOA 1LFDA 3QIJA 1GO3E 5J2RA 4HEDA 3H9DA 1JR0D 1VQFA 1Z9FA 4Y7NB 3EQLC 4IG7B 3HOUG 4GNXC 2Z8LA 1MI2A 3MC0B 3H7PB 3CSTA 1BBWA 4OVUA 2PIAA 3AEVA 4WORA 4W9IA 3HFZB 4YSXB 4NDXA 1W6JA 2VRRB 2FBWB 2BVCA 3BVGA 4P73A 1SE4A 1MPEA 4FHJA 3M63B 1GB1A 2NN6G 3RNCC 1K8OA 3R2TA 4A3IH 4L5QA 1M8AA 2Q2TA 2W55A 1LT3D 1QCBD 4C3JB 2K50A 4CJ2C 2GBNA 5JVH3 3UIOB 3OWFA 3UI2A 1TIFA 5C4JB 3EECA 3Q2AC 4JWSC 1CA5A 1SFOH 5M3MH 1JW9D 3JSVA 2VY3A 1A2TA 1V1PB 2MA9B 2KDFB 2PMVA 4ZHPA 1K28A 1Q8KA 1TWHH 4A93B 4L2YA 2EY5A 5I6YA 1IZ6A 4K5VA 1FVIA 4MIUA 2BYVE 3AQQA 4J6HA 3F2CA 2WDVB 3I5JC 3P4PB 2PE9A 1ET9A 1V80A 1ZOYB 2CW0C 3C3LA 4X3KA 3MFYA 1LGRA 4XQQA 4C2MB 1WXQA 4AYBB 3AE4B 1HZ9A 4WRDA 2G45B 4K5XA 1TR5A 2WNMA 4W9EA 1WFQA 4BOSC 2MCNB 3J81i 1VQPA 2A68D 1TY2A 1K53A 3I70A 3MXNA 4YT0B 3W1YA 1IBMQ 3P2BA 2IW3A 5LMNL 1R9TH 1H9KA 2K1FA 2ZXPA 4KI0A 3HRDD 4KV6A 1LV9A 1IHZA 4IQZA 4R8IA 2BW2A 1BO0A 1XNQQ 3W5UB 1ENFA 3SGIA 3EA6A 1HNZL 1HZ6A 4GB9A 2KHJA 5C0XI 3S1MH 1RF2D 4A3IB 3CWIA 1SIJA 1JJCB 2I38A 2IO2B 1EIYB 4JX1C 3I55A 1TKEA 3LWUA 3VTWA 1QOFA 1QOBA 2WU2B 3CMEA 2J42A 3K7AH 5C6AA 2ZZPB 4BOZB 1SFOB 1ICWA 5M3MB 1V8CA 2PW5A 2KWCA 2RCFA 3BZDB 4DFAA 2DBYA 1TWHB 4E6IA 1E24A 3U9SA 4TV3A 2ES2A 4W9KA 2HIVA 3M4YA 2WXPA 2ASQA 1UWXA 3QOLA 3P1HA 3O65B 2A5HA 3RD4A 1JT8A 2ZCBA 5EAYA 2BOSA 5GAHC 2K25A 4KK7A 3FDTA 2DHZA 1V2YA 3RFZB 1G51A 3JYUA 1C48A 4F8MA 5D65A 1I50H 4LJOB 2OQKA 1R9TB 4HMJA 2YLMA 1WTVA 1L0XB 4WAAA 4RCOA 3ONAB 3AE9B 1EY0A 2HQLA 3N3KB 2D2CC 4HWIB 2F3VA 1PLFA 2KTFA 5G3LD 1JORA 1IYJB 1V8QA 5E6NA 4KKSA 1EYAA 1YI2A 3S1MB 2LD9A 4HEA1 4RNAA 1K51A 2LEKA 4ZOHC 2EPBA 4JI0L 1QG7A 3A54A 2NWGA 1BXTA 3MXNB 2HIXA 1GM5A 4PYUA 2XTIA 3K7AB 4IUTA 1WTWA 1XMOQ 1JOQA 1AARA 5HHDG 4DDGD 2A68C 1I6HH 4F7XA 3Q22A 4IWOA 4PZ8A 2BYEA 4DGZA 2RPQA 3FC4A 2KWVB 1JJ2A 2K39A 3I73A 2B2WC 4XDXA 3WAMA 1G6JA 4AQYQ 1T0RC 1WI5A 2RSNA 1CZGA 1NR2A 1UELA 4LF9Q 3E9IA 4G7HC 1M4VA 1C7YA 1AZPA 2BWES 4HKZE 2IJ0A 3NVYA 5DCNA 3RNFC 2IPKD 1GC7A 2KD0A 3A8IE 3T53B 3ZVVA 3FPPA 2Z4IA 4DV7Q 3WALA 3CXCA 1I50B 3I4LA 4XIGS 1IBML 4OWXB 4HIKA 2MWSB 3OMGA 2WACA 4W9FA 3M85A 2HE7A 4LWCA 5FLXc 2B76B 2IHFA 4A3DG 3BJUA 1PGBA 2L05A 5CV7A 2EXZA 1XNQL 1YVCA 1B1ZA 5ISRA 3CF6E 3PHWB 3Q3JA 4TQ1A 3SXHA 3PIPA 3E56A 3TN2A 1FM0D 4HJGE 1OXSC 4BBRG 4KKJA 1VQCA 3LB8C 3BK1A 1PUTA 1J6QA 1WJNA 1DYQA 2AUJD 5CORA 4CDCC 2UYZB 4HJKA 5EQ0A 1TVXA 4OVVA 2CQAA 3RT3B 3DHHC 2WXKA 4IUPA 2KHWB 4K7SA 1I6HB 2RGFA 3ZJVA 1PH8A 4NAMA 2DYMA 4MSMB 2SAKA 3WCQA 3IL8A 5DPWA 3K9OB 4MGYE 1EY5A 2DYOA 1WJ4A 5G5HA 2I0QA 3TEZA 3W9CB 3PMFA 3MXGA 3SFEB 4IKGA 2J0JA 3P42A 3P7JA 1DZ1A 4IDIA 1HZAA 3TSSA 4L8JA 4NPSA 2QC8A 3CD6A 3DPDA 3N6RA 4HDOA 1Y69U 2WGSA 5KNCA 4BXXG 1Y1VG 2MQJA 4YTPB 1RODA 1YJ1A 3K57A 5IYDH 3NVWA 4QY7A 3AMZA 1WX8A 1SN8A 3PRPB 2AMCB 1H9SA 1RDPD 5C4XH 1P8LA 1GHKA 1PMRA 3MC8A 2KK8A 2BYTA 1KF6B 3LWEA 3PZDA 2QSDA 5FLXL 5DLQE 5FLXE 3HOUH 2B8GA 1ZYRD 1V86A 3M62B 2N9PC 1I4QA 1J8IA 2KX3A 4GOPC 2I1JA 1PRTB 1X3EA 2L55A 5M5XH 1HEZE 1V1OA 4A3BG 1G91A 3AEAB 1H9RA 2NCNA 4K1RB 1MSGA 3HRZC 4KJOA 3OIPA 4WFN3 2OJWA 4DXFA 4K3CA 4WWNA 4II3B 1JICA 4MGZE 4MELA 4P71A 4HCEA 3EHVA 4AQYL 1LTAD 1O7ZA 3R93A 4LF9L 3K80C 1WGRA 2KFKA 1CT1D 5DPTA 1EQRA 3T3OA 4I6NB 4BKSD 1JOOA 3SDZA 1VCIA 2Y0SB 3MWYW 2E5LQ 3R3OA 2B63B 2N55A 3SHLA 4MT5A 1PH6A 3T4AC 2N0SB 4FNFA 4G7ZC 2EYHA 3NG0A 1MD2D 5C4XB 3DBSA 4JI5Q 2XRSD 3ERSX 4DAVA 1WYGA 5CGKA 3RZDH 3I3TB 1FD6A 4XQNA 4FVMA 4XGAB 5BR8Q 5KHQA 3AU7A 2CH4A 2N4FA 4WJWA 5COYA 4PT5A 1Z6HA 2JSOA 4HAEA 3HOUB 4GOCA 2R93G 1EY7A 2KAJA 3STBC 1WXAA 3RZOH 1FJGL 5E1FA 2UU9Q 1F9SA 3ABVB 4BBNC 5E7NA 1ENCA 3KOJA 1WTOA 4LF5Q 2JQOA 4DR4Q 1WTQA 1E8ZA 3DUZA 3KK7A 1XLNA 3P4QB 5M5XB 1H9SB 3PGZA 3S15H 3VRAB 1ESFA 4LUOA 2LWPA 4LAAA 1SE2A 1J7AA 2D07B 1XLQA 2KEEA 2F0GA 2KWUB 2BWFA 3KJOA 1I42A 1ZXTA 3HKZG 4O2DA 1YMHE 1ZYRC 4L23A 4FO2A 3DBHI 4K8JA 3DHGC 2JWZA 1L2NA 3E0EA 2LMCA 1X65A 2ZPNA 1SE8A 1YQBA 1MKHA 1L7YA 3KUCB 2K5WA 4YY3Q 4NAWB 3RZDB 3TL5A 2PI2A 3T13A 4ANUA 4KY7A 3I8ZA 3C2PA 2ZT9C 1XYIA 1TKGA 3TJPA 3TS2A 3RZOB 2GMIC 4A9AA 4HPMB 4A20A 1YN5A 5IO9A 1GOZA 1T0YA 4ZLTF 2A4ZA 2DN8A 3H09A 3GZNB 1WM3A 2UWQA 1K73C 3S15B 2C9OA 2XWBB 3N32A 4LNOA 2IGGA 1QQRA 3T16A 2A5UA 4S17A 3J7YW 3P75A 5I2XA 1DOLA 2XSCA 2F52A 2PO4A 2JA5G 4X57B 1X55A 1EIFA 2F3IA 4K6LA 2E2JH 3J81c 4IUMB 4BFRA 5C0XG 2GB1A 3M7GA 1SRUA 1V97A 2D3GA 2K8HA 1IYFA 1JE4A 2DYBA 4GZYC 3PZ8A 2TMPA 4JOIA 5HI1A 2KEDA 1J19A 3CCUA 4YCWA 2Q8RE 1XNRQ 1FPYA 2JQRB 1U4PA 4ME3A 1IUEA 3A8JE 1MG8A 1B2TA 3KUZA 1K83H 4DK0A 4J15A 3BS1A 2FMMA 3X3MA 4HJ8A 4C3HH 1XQQA 5EE0A 4JI5L 1CZPA 2DZIA 1ET6A 2A74C 2IL8A 5GXGB 3T1HQ 3TDQA 1XF5L 1CMXB 5BR8L 2D11A 4YWKA 1UZXB 2O6VA 3BDOA 3VAWA 2UU9L 3PV1A 5KEEA 2IBIB 2D0PA 2LMCB 4LF5L 4DR4L 2QA4A 3BWUD 1WX9A 2EY1A 1DOMA 4ABNA 4A3DH 1D2BA 2M19A 5JJIA 2JN4A 1JWMD 1GKHA 1SEBD 2K5HA 3EBEA 3VYRA 2Z0DB 3NUHB 1JRUA 2D5DA 2R2QA 3H6NA 1E3PA 3UE0A 3A8KE 2E2JB 4CKBA 1YNTE 3H1UA 3RMKC 3AB5A 3QR8A 1IKLA 4N8FA 4OIKA 5C3EG 2WXIA 1K50A 3J81L 3I9V1 1FFVA 2LXAA 3J81E 2EVBA 2L5TA 3GTKH 4NZLB 4KGRA 4MM3A 5G3LF 4DR7Q 4AJWA 1LTGD 1F9RA 1HQMC 3EFUA 4L6TB 2F0DA 3HGBA 4N6EB 1YX6B 4NY0A 3PVLA 1J0GA 1K83B 2WB1E 3RR5A 2H88B 2IY5B 3KYCD 2DJFC 1JQYD 3IFTA 2SDFA 2F0IA 2KCMA 4C3HB 1C8CA 1IL2A 1JALA 3VR3A 2JUOA 2V3PA 2F0QA 1VQ4A 2DAJA 1EEID 3ITPA 2VZKB 3WDNA 4YY3L 3J7A5 2LGDA 1JWUD 2ZTDA 5D14A 4L1BA 4M1UB 2G4DB 1UE5A 1WGHA 2RBMA 4BXXH 3B08A 3MHZA 3OW2A 2PW9A 5IE8A 2OTLA 4LF8L 3ZIMA 3E0JA 2E2HH 3BG3A 4A93G 2J7QB 2V3SA 3TIXA 5FJ8H 5BYRA 2L76A 3A4RA 2WHIA 2K32A 4FADA 4YIJA 4A3DB 2J52A 2WXOA 3TRZA 3ULPA 3ML9A 1P7FA 2JZ3B 3U7DA 1TBEA 2EYPA 2RMMA 3HOWH 4AYBG 4M8NA 1HNWQ 2WX0A 4OW0A 2SNSA 2Z6KC 2MNAA 2E76C 4ZUJA 1J9OA 3RLFA 1PHJA 2O6VB 1BNZA 3OAWA 4MNOA 1TKWB 2V4DA 3G6JB 2Q2UA 3GZNI 3GTKB 1I94Q 2JYOA 4A3BH 2CHBD 1XT9B 3QJZA 1PTOD 1SYBA 3GTGH 1HUNA 4XX5A 3H94A 1EY8A 3IXSA 2OEDA 4DR6Q 1VQJA 4HIMA 5DEHA 4HLEA 2KDEB 3TP5A 2F0HA 4R4IA 3PO2G 3PLUA 4JBKA 4HCPB 1MJEA 4A3IG 4UP7A 3QQ8B 4DWFA 1DOXA 4BS9A 2CQOA 2WIIB 2RSUA 3T1HL 1VDZA 1K3RA 4K6DA 3ZNID 2UUCQ 4ANWA 2I2YA 3K5NA 3MAQA 5ELBA 1ZUD2 3IT4B 1I4RA 3WOEA 2E2HB 3RN9C 3I4MH 4PYZA 3ZJTA 4MM3B 3QARA 2CHXA 4Q2JA 1RD9D 1SSOA 2RQXA 4R3DA 2G9DA 4JBJA 2L1BA 3KYDD 1R4PB 1Q8IA 2HDEA 2E75C 3S2DH 1N32Q 2B2WA 4BY7G 1FXAA 5D3DA 1HTLD 4UPAA 3ZW3A 4OZBA 1CI3M 2JEBI 2LKVA 3BYYB 5J3BA 1VD2A 2JA6G 2R93H 4W9HA 3SK8A 1FGBD 2B2TA 3NEMA 2PMZE 1G291 1H9MA 2D3BA 2D5GA 1PH2A 2XN9C 3M4QA 2ACZB 2MJ3A 1TT2A 5TSSA 4EGVA 1A0IA 1F2RI 3IHPC 1TS3A 4JC0A 3T3NA 4A3BB 2KTRA 2D3CA 4HVBA 4DR7L 1CK1A 4RMFA 3GTGB 3U58A 5GQOA 1Q0WB 3MHBA 2FIDA 3JW0X 1PA6A 1WE6A 1CHPD 2L9HA 2K03A 4FP5D 3AE7B 3SK6A 4KJNA 4G3XB 2F0SA 1O7LA 1B9MA 2RHQB 5EBDA 1CSQA 4DNRB 1QOAA 1WJJA 1AWDA 3MEHA 3A9KB 1Y8NB 2MO1A 4KN7C 1HUMA 3OIQA 4A55A 1EU3A 2LXCA 4JPBW 4YTNB 3RPFC 1J7BA 4DK5A 4UP8A 5C3WA 4USAA 2MBOA 2NTSA 2MX2A 4BVUC 4KDLB 1L1OC 3QJYA 3I4MB 2ZW0A 1BR9A 1CFMA 1TS4A 3P63A 1V9JA 2KYWA 3NENA 2CHZA 3N1YC 1JWSD 2K3UA 4KMUC 1CKOA 3Q3FA 2R92H 2K6QA 5T8IA 1VF7A 3S2DB 4LFBQ 4M01A 4GU2A 4NW2A 1WD1A 2KLGA 1QZHA 2WXJA 5AEKB 4ZYSA 1E2ZA 2R93B 3M95A 1HNWL 4X65L 2IDYA 2QCPX 4MHEA 3I63C 4K5WA 3KW5B 3D6CA 3T8MA 2NPTA 1XPOA 1WCMG 4ZK9B 4C7YA 1PZJD 2N7JA 3AN1A 4R4QA 1BCPB 3Q23A 3GDEA 1I94L 2RCNA 1A2UA 4YXDB 1STYA 2KHIA 3SEBA 4AS1A 4RKLA 4JCVE 2FE8A 5J17A 4DR6L 2NUCA 1PH5A 3M4OH 2E3TA 3N1XC 4KVGB 1O7YA 1AH9A 3L54A 4EZLA 1ASZA 4LK0M 4MZ9A 3PIO3 4DU9A 3HKZB 5A2QL 3NWTA 5A2QE 4N58A 1RLFA 3WWVA 2E8GA 4HCSA 3WOFA 3KJPA 1GAQB 2KTRB 4RGOS 1YHQA 1YX5B 2LVOA 4GDKB 4WAFA 2A19A 2KNBA 3VA5A 2EOTA 4POGA 2R2OA 3EFXD 4E74A 3X3NA 1CKNB 1XX8A 5KNBA 1I7HA 2R92B 1QE6A 1N32L 4ILWA 3H3VI 2C9WB 4LNNA 3S24A 4MTKA 3AXCA 2BE5D 4CHTB 4KKIA 4II2B 4OO1H 1K3BC 2FHTA 1X56A 3NZUA 4IWQA 3F2BA 1EIHA 4QJFA 1G8ZD 5LLIA 4DNTB 5ELOA 4IWPA 1UGJA 1SNOA 1SYCA 4DV3L 1EEFD 4H2AA 4A76A 2RDBC 3ENEA 3H91A 1V49A 1LTSD 5AUKA 4JI1L 1SJED 3M4OB 4GLSC 2C35B 3APFA 1A62A 1EL0A 3L17A 3AV8A 4DUZQ 1WRDB 5EE9A 3VYTA 4YCUA 1K8GA 3ZNGC 4HKQA 3H6MA 2ZTEA 5C3EH 3I2ZA 2PI2E 4HIOA 4HTHA 1ZGUB 1T5EA 4QL5A 2O2LD 4DK6C 1CZWA 2CVRA 1PYSB 4P75A 2KQ3A 3NTKA 4HPPA 3NUCA 3PF4A 1ZW7A 2BTEA 3ND9A 2HDMA 1EZ8A 2UXBQ 1MJDA 2LXJA 1E8XA 3K0YA 2OXPA 2YTXA 2JXXA 4AIMA 4APVA 1Q7YC 3BIID 1WF9A 2A69D 4GN1A 3UE1A 4A3OA 5C3JB 3LYYA 4PK1A 1ISNA 4JGHB 4LFBL 3PO3G 5C1ZA 1VQBA 5EKLA 1E8WA 3PS6A 4US8A 2R6GA 4KHPQ 1VQLA 4WQMA 3W1SA 3CIRB 4OX9Q 1B53A 1TKYA 2FAZA 3NHHA 5L95C 1JOKA 3TMPB 2K52A 1UAPA 2VS1A 1VZ7A 2OJRA 1EFID 3PQIA 2WAQE 2BGFA 3A7AB 4QIWB 1UE1A 3OLMD 4IPCA 2GI9A 5H1SE 4MSQB 1JWAD 2JYTA 2K8CA 4ARIA 5JAVA 2DNCA 4H7BA 2PTLA 1L0YB 2QCZA 1MI0A 2WDQB 5T1IA 3OJ3A 3RZWC 1YN4A 3A7LA 4R4OA 1VQ8A 2RPVA 3RNEC 4EUTA 1C4AA 1OTCA 1ZXIA 5C3EB 2WU5B 3EGRA 1MHHE 1CTMA 2ZXRA 2AQ2B 4HSVA 1NYRA 2BT6A 2MBQA 2YEPB 1HCZA 4OZAA 1SNCA 1WMHA 3IG3A 5I9PA 2PZWA 1LM0A 4LUVA 2OHFA 3DEOA 1PDQA 2B2YA 2NBUA 3ZKJC 1GJZA 4CKEA 3B2FA 5BN4A 1N6ZA 1WJ6A 5IGEA 3PO2H 3BDLA 1PVOA 3LXFA 2ZEQA 2CKHB 1K0SA 4DBGA 3Q6SA 3HIZA 4JK1C 4KX6B 2EZVA 4FJZA 1BBXC 5NUCA 5EGTA 3NOBA 4Q0FA 2AL6A 3AI5A 2XRQD 3MA2B 4ZUIA 2AEHA 2W82A 3QAQA 1OXVA 1RIPA 5EPJA 3DVGX 1VLBA 1MSHA 3CRKC 3EROA 4RWSC 4DPGA 1I6VC 1N8RC 2KHSA 1SXTA 1WGGA 2KQSA 4BY7H 2WXNA 1IPGA 1XCTL 2FFKB 2ALYB 5IIFA 2WWZA 1PH4A 1S3SG 1ZXHA 2QHOA 5AZFA 5HKHA 1FNWA 2EJFC 4O0AA 2F0UA 1M1KC 2CCZA 2JA6H 1A5RA 1PFSA 2AWTA 2WXLA 3RLOA 4QUCA 2KN5A 3E5SA 3DXJC 4OIJA 5ELCA 4PMWA 1YNND 3DM3A 4DUZL 4M02A 3I91A 1OGWA 3AU5A 4XWTA 2C5LC 1ZPSA 4B3SQ 1XPRA 1F9PA 4Z9CB 3W1GA 1J5EQ 4RA8A 4JI6Q 3KFUA 4ACFA 2F0LA 2DY7A 2LUEA 1WY8A 4C1NI 5JJZA 3K5OA 3SK5A 2KX0A 4X6AH 3DWQA 4DHZB 4YWGG 2UXBL 3RUIB 3MVVA 3NPPA 3PO2B 4WJPA 4IPHA 2FUHB 2VH2A 1YNJC 4LW1A 4N9PA 2B3GA 2N9LA 1JJGA 4IM3A 5A35A 2OWOA 2JYEA 4BZAA 1EOVA 1UBQA 1PTOF 1R7SA 5ELEA 4KHPL 3KWLA 4C4VA 4OX9L 2NR2A 3K5MA 4DHJB 1AN8A 5LL6X 2N7EA 3HZXA 4MN3A 1WMHB 1VQAA 3H7SA 2J7ZA 4HXDA 5IGFA 1E22A 3NTHA 1M94A 2BDNA 2NVUI 5ELNA 1TGZB 4BY7B 1X3PA 4A3JG 4JI7Q 3G6EA 4JVZA 4FBJB 4KTAA 3VR2A 3K6OA 4F88A 2F0NA 1FO4A 3OWEB 2JA6B 1V5OA 1SE9A 3AFPA 3M4PA 2WP9B 1SNMA 4RCNA 2MP2A 2MUYA 4QAYA 2B2VA 1LTTD 4HJ9A 2EYFA 5C4HA 3L0OA 3PUZA 3UDGA 1WCMH 2LVPA 1ZKOA 1RM6C 1YNXA 1BUIC 2GBJA 2F0WA 1HA6A 3SK4A 3V60A 4MGKE 2N49A 4ULLA 1TXYA 5CV6A 5DAUA 4FYDA 4G7OC 1G2TA 3CAMA 1SAPA 2H4OA 1HR0Q 1NSNS 3QK0A 4CDDC 3NBIA 5D6JB 5TR5A 4M8AA 5JPMC 1N62A 2PE6B 4P1CC 2Q8IB 2JWUA 1FL0A 2IGHA 3OW7A 1WGYA 1Q12A 1WXMA 2GVAA 2KJ6A 3PCOB 5BMHA 1EOTA 1YNNC 4HIDA 1OXUA 2MFIA 3CCMA 2AHOB 3ZO5B 3Q6BA 2M17A 2L11A 1UWMA 2N7DA 3WA0A 4DN4M 1EO6A 4C3HG 2HTHA 5CX3A 4LNQA 2IO1B 4B08A 1PFBA 5KYIA 4A4IA 3ZRCA 2X38A 4UAIA 4KHZA 1RFKA 5DPRA 4KKUA 5BN3A 2PJHA 4B95A 3HP3A 4WWPA 1VQ6A 4C4VB 1PYWD 4ZHOA 1TIID 1X1MA 4K2LA 1LACA 1N9WA 4MACA 4FXKC 4TQUS 1WCMB 2BH8A 4B3SL 3BVMA 1J5EL 4JI6L 2PPBC 1GC6A 1MG4A 1QLBB 3CSFA 1HTOA 1B7YB 5ELFA 5EPKA 2DGYA 2KLCA 5CTRC 1WZ0A 2DLBA 3CW2C 1KHIA 3IFDA 4JG2A 2R7DA 2M0AA 3PUVA 1JE5A 2HHHQ 4LTUA 4ANXA 4LCDE 4QGUA 2GA4B 2MP2B 1E7VA 5D2MB 2PW7A 2VUMH 4A3PA 1KIXA 2E6XA 1WTRA 2D9UA 1Q5WB 5CBAE 1P1AA 4DK3C 3G71A 3NZSA 3L7ZC 4C1NK 2JU6X 4WWOA 3WIMA 3J7ZC 4QQBX 2Z1CA 4HCNB 3K7UC 4I7ZC 1LABA 1RFAA 2KC1A 2C7NB 1DONA 3NE5B 1GUAB 1HTQA 1B44D 3DEPA 3PO3H 4ZRPA 5LMNW 5E4WC 3ND8A 2ZJPA 4WWMA 2PVGC 1FIQA 3NSWA 4RAUC 2SNMA 2VB3X 2BF8B 1KL9A 4F87A 1GJXA 2K33A 2NBFA 4KSLC 4FJYA 4J6IA 3I4OA 4K0KQ 4ZRIA 3K5LA 3DCGA 4IO9A 1CA6A 1V43A 2KWDA 4MDKE 3SR1A 5FJ8G 2ASBA 3KBXA 1PFDA 1Y8OB 4NKLA 1V6EA 2C7HA 3VR8B 3UDFA 5JOBA 3D4DA 2PQAB 2DZJA 3B1LX 2FINB 2QKIC 5HGQA 3J7AF 3U4EG 1HR0L 3K8AA 3HOWG 3M3YH 5EE3A 3OPOA 2H89B 1X3GA 1ZKHA 2QIEB 1EF1A 2AYOB 1N33Q 4HJAA 2FCNA 3IVFA 4A3EH 2Z0SA 3CCVA 3FAHA 1Q10A 4W9LA 4FA6A 2VUMB 1E7ZA 3F2UA 2BBCA 2ZW1A 1XMOL 4JI4Q 1XJVA 2MQHA 3L4PA 1BBUA 4RFBA 2DZMA 1HJPA 1L0VB 4A90A 3DWGC 1SR3A 2RDGA 2KANA 2ICEC 1Z7TA 3PUXA 1NAPA 4FF3A 2NZHA 4ITKA 1UE6A 3FILA 5E6JA 2WFWA 5CV8A 5M3FH 2KFJA 1SGHA 1T0SC 1VZ8A 3WAOA 4NAWA 2RVLA 3PO3B 3MXPA 3SFDB 3AEEB 3Q3OC 1YQ3B 3A1QA 5J18A 1LT5D 4HR7B 1UF0A 1IBLQ 5AJ3Q 3S1RH 2NS5A 4IUNA 1S3OA 3VYUA 5IOIA 4P2CB 4HRSA 3TEYA 4IURA 3I4MG 3I7FA 4DV7L 2G9HD 3T51B 3HM3A 1FXIA 5KIXA 1LTRD 1NUCA 2ZJRA 2BKFA 5CMDA 4PS7A 4ZRJA 4GS3A 3KLSA 1LM8B 3R8BA 2QEJC 1A3UA 4CYEA 4WJ4A 1TYGB 1YEZA 5IODA 1K8RB 2KC2A 1HFNA 5CHVC 1FR3A 5AFWA 5D3IB 3W5OA 2R7FA 1EFWA 1E7UA 2HHHL 4KHVA 2BA1A 5LHY1 3NY5A 4FXDA 3VR9B 4AYBE 2M4NA 4A3EB 1MFWA 4K7UA 3EJIA 2PLPA 3EVQA 1JMCA 2EYLA 4QUFA 3RLNA 2NB0A 1D8LA 2CHWA 5M3FB 4UDUC 4PQXA 3I57A 4QB4A 4A3FG 3VH3B 2PYKA 4LNKA 4B0EA 2KUMA 2MSED 4IALA 3UGBB 3S1RB 1GUGA 4DNIA 2RDHA 3KUDB 1FEHA 5G55A 1UEBA 4L5RC 4K0KL 1JROA 1VQIA 2HCIA 3Q69A 3FILB 4A3JH 3ZXRA 3PZ7A 3ZDTA 1JC7A 5IGCA 3TCAA 1P9DU 3KUPA 2A1AA 1SBBB 2R92G 1KFYB 1TTNA 2CJNA 4DV4Q 3CCJA 1H8CA 3N30A 1HFGA 2XGTA 2QDLA 3A1QB 3BK2A 4GN3B 3PGEA 1PH7A 2R7ZG 2OT2A 3CKIB 3L16A 3GTLH 1N33L 1I3QH 2D2QA 2W3RA 4TKNA 3ZNHB 5C5LA 3U8ZA 4L5SA 3UIPB 4JI4L 3EIVA 3IKJA 4IJLA 4CKCA 1H95A 2B2UA 3L9AX 5C44G 4DR1Q 1F1HA 5IP9H 5KGUA 1QILA 5KRUA 1TZOA 5IYCH 1SNQA 5HFYA 3OJ4B 4ZRQA 4XT1B 1XLPA 4EQ5A 3JAMi 1YJIA 2MW5A 4GNXA 2F0FA 4RF1A 1WR6E 3IBEA 4IM0A 4NNJB 2BPSA 4RMAA 1IBLL 2TSSA 5AJ3L 2DUDA 5EKIA 3CC2A 3ML8A 2L4NA 4JI2Q 1EY6A 4EKUA 1SSNA 2E5LL 5GROA 1D7QA 3A74A 3G4SA 4KZ0A 4KV2A 4JYAQ 1DOIA 5CC4A 2QDFA 3ONSA 4IPGA 5JPNC 4A3JB 1VZ6A 2KJXA 5K5PA 2HJ8A 3J80i 4NB3A 1C79A 1YN3A 4X62Q 3Q0AA 4GKKQ 2CS4A 1EUJA 3T1YQ 4DV2Q 1VJKA 2QDBA 3DHQA 2AX5A 2YTYA 2O5JC 1UEAB 3HG9A 4H44C 4JBMA 3V3XA 2J4XA 1IBXB 1FRDA 1ILPA 4OO1G 4U673 3GTLB 4DXAB 1I3QB 1MHWC 2LXKA 2XK5A 2A6HD 3KH0A 1XO3A 2LZ6A 2F03A 4N9F4 2AQ3B 1T5XD 2V1CC 3NQIA 1JMLA 2K01A 4LF7Q 1QT9A 1B4OA 4DR3Q 3E9HA 1PV4A 3RMHA 1IP9A 4POFA 1PZID 3HVDA 4LDTB 5AZHA 1ZEQX 3FEWX 1F9QA 4PZ7A 1FYCA 4K3BA 2ZTCA 4AQ7A 3NBHA 3RNGC 2BB6A 4IFDJ 4KD3A 2NVQH 3C1EA 4ME5A 2BS2B 2N1VA 1JB7A 4JLCA 2MJ8A 1EYCA 1PQSA 1MBYA 5IP4D 4PMBA 1TWAH 2F3WA 1PFNA 2OTJA 3M3JA 4B3TQ 2Q8TA 4GN5A 1ZDVA 2KOXA 2LS01 1D1IA 3QA8A 3I72A 2DENB 4R9WA 1OO9B 4E71A 5LL6S 2JRHA 1D5MC 2A8VA 1A70A 2IY0B 3Q8BA 4LJPB 4PNYA 4GNXB 4GSWA 1OXTA 3RNBC 1NJIC 1EQVA 2XWJB 5CV5A 5M9OA 1IXRA 3GD7A 3M9BA 3SE0A 5HURA 2V9HA 3VR6A 2WXRA 1PRTD 1S4ZA 4IW0A 2LGXA 3A0JA 1YBYA 2FJ2A 2Z59B 3DWMA 3NZ3A 2E2IH 4S0RA 4HJ5A 1PGXA 3FKIH 1YHBA 4RH6A 3AE5B 2HD5B 3RUZA 1EIGA 3PREA 1Y1WH 2LGYA 1YOVB 5CHFA 3VYSA 4DR1L 5IAAC 5C23A 4PV1C 5J1ZA 1N5XA 2J53A 2ID0A 1WTPA 1SNPA 3J9CA 3Q8EA 2KCCA 5K36H 3R66C 4EFOA 3CCRA 3A9KA 4YTMB 5JJLA 4ARCA 2I46A 1E6EB 3OHXC 4H02A 4FF4A 3BINA 2RHSB 2NVQB 3G7LA 1C77A 2XK5B 3L0WB 2AWNA 2O2VA 4X64Q 1QKZA 1NY4A 2KECA 3S9WA 1NBWA 4CGYB 1XNRL 2A6HC 2VXWA 3BZKA 5GADC 4JI2L 2KQ4X 2M2LA 4WJQA 4S3SA 2VZAA 4AUQC 1LYLA 4OXPA 4JYAL 2KACA 2Q5WD 3C19A 4IUVA 1KABA 3OMCA 4X62L 1WTXA 4GKKL 3GTQH 2BDOA 3T1YL 4DV2L 3HOXG 3C1FA 3LJ3A 1ACCA 3NBHB 4AH6A 3V6EB 3DVNV 4XDCA 3AE6B 5IGBA 4JE3B 1F2LA 2L83A 3AECB 4W9DA 2KVMA 1CSPA 2E2IB 1CQFA 1WYWB 4KSKC 3UDIA 1L5PA 1VR9A 2WXMA 3P1MA 2QEXA 2Y0SE 3FRPB 2HUGA 2LASA 1IYUA 3CC7A 2VQFQ 3J7AV 4LF7L 3HKSA 3VDYA 4NPNA 4DR3L 3HOWB 5IGGA 1MJCA 1EM7A 3L3OC 1OQQA 3GTMH 1KLUD 1AYFA 1QUQA 2EELA 1VQDA 1KD1C 1FGUA 3CCQA 3LGJA 5FLMG 2F0JA 1Y56A 2Q2IA 1SYDA 5BMGA 2RR9A 3U30A 5D94A 3GTJH 2UUAQ 3EN2A 3V62A 4CHKA 1WXSA 4TQ0A 4IJHA 4GDKA 1PRTC 1E90A 1I4XA 1PH9A 4AOFA 1JCKB 2K5DA 2PZTA 4X66Q 4ZCKA 4I6LB 1CKNA 3PIOA 4B3TL 4A3FH 3KLRA 1WYDA 4RGMA 2VL6A 2DNEA 1UNSA 2MH7A 4JL9A 3AEGB 4A6QA 2GRIA 3UINB 3GTQB 1NCVA 4IC7B 3NVZA 1F9JA 4YL8A 1KTKA 4QF4A 5CHWA 1D5ZC 4L5TA 4W9GA 3SHQA 4H0LC 2M0XA 4C80A 2Q2HA 3NTIA 2O2VB 4P1BC 2Z9HA 3BVZA 4EE2A 4GN4B 3VH4B 2BS3B 3ERQA 4IN3A 3D32A 1LTID 2BQQA 2VB2X 1PTOC 3H0GG 3KQ4A 2D3AA 2Y5CA 1QVFA 4QCLA 2GVBA 2L12A 3CF5A 1BUVT 2M00A 4EQPA 3EUB2 5JXVA 2R7ZH 2IX0A 3GTMB 1ENAA 1HNXQ 3TP6A 1V9PA 4LNFA 3CC4A 5JVG3 1KQSA 1TZ1A 3ZTDA 1E0ZA 2BCOA 1X3FA 1G2SA 3VRBB 2YU9H 3KLSX 3GTJB 2K28A 4V0BA 4NJ6A 1XTDA 4X64L 3GOEA 1ZDXA 4PZ6A 5C44H 2WLBA 2D0OA 1S5CD 1E2WA 4EOYA 1GUTA 3KBGA 4JQWC 1WM2A 4HSPA 4A3FB 3RD2A 3OG5A 1C3TA 1QUQB 2L52A 3L10B 2K22A 5HG2A 2IX1A 2UUCL 2K9XA 4CDEC 4W9JA 3D4WA 4GOPA 2JXMB 5IYBG 3Q24A 4C3IG 5JJKA 1K9MC 4AP4C 1Q46A 2JEAI 1AZQA 4JI8Q 2KN4A 4MH8A 1DOKA 3ETRA 1STHA 3I90A 3KF6B 3U4VA 4ZAIA 1II3A 1X32A 2R7ZB 2F4VQ 1E8YA 2ZNVC 2FXQA 5EJWA 1IGCA 1HH2P 4DV1Q 3ECIA 4K7WA 3VR5A 4A3KH 4ID6A 2KOLA 2V4IB 1JB3A 1PDXA 2WB1G 2YU9B 3NS8A 3DWAA 4ICUA 3HOYG 2UUAL 4IFDG 4KGSA 2JE6I 2BA0A 4HN7A 4PS3A 1T6BX 5EKKA 2QF7A 5C44B 1VQOA 2LJ5A 1HA5A 2VZKD 2XBBC 1LO5D 1EWIA 3AEBB 2GN5A 4X66L 1L4DB 4GLAC 2WS3B 1L6UA 4RGNA 4K81A 2GLSA 2F1MA 1QJOA 3EC8A 2KVRA 2LHEA 1F52A 4TRDA 1L0WA 4GKJQ 2REXA 1D5XC 4REZA 1U5KA 1MGSA 3A5UA 1F2ZA 3R3MA 2LJIA 1DD2A 2VUMG 1GG3A 4ZKBB 1QWYA 2MP1A 5E3FA 1U0LA 4URKA 3QB3A 2JZPA 4CO7A 2ATWA 1VS0A 2KBNA 1Q1EA 4K2KA 4B9XA 1IL8A 2EXDA 1DXMA 5CV9A 3UDXA 1LXDA 2WXHA 4HPLB 3PTFC 2N9KA 3JAMc 5BO4B 1T0QC 2ZJQA 1P7EA 4F1SA 1W6KA 5DM73 2O6VD 5EBCA 2UUBQ 1XCQL 5HY6A 1V81A 5FR6A 1WFYA 1HNXL 1KDCA 2JF5A 4A3GG 4WIPA 3DDCB 4GOPB 2OCEA 1GUNA 1LTBD 1O78A 4J8QA 2CW0D 1MVKA 3NWSA 3AM9A 2IO3B 3CCLA 4LF4Q 4DR5Q 1BF4A 1F2RC 2YVCA 3J80c 1FCCC 2M9VA 1WD0A 2KZRA 2LGSA 3GV6A 2M1MA 4HROA 2RDFA 4ZQ3A 4UP9A 1BMLC 1GUSA 2N8NA 2MBHA 1Q1OA 4LF6Q 2K7VA 3NJTA 1KLVA 2N9XA 3DBLB 2DY8A 3S1QH 1BKBA 5JHBA 1GHJA 3I3CA 4BWGB 1TQOA 2BE5C 4A3EG 1EQQA 2NBVB 3B2GA 1B50A 4BBSG 4A3MH 4BKSA 1TU2B 2VW9A 1S5ED 3PF5A 3VDZA 2MEKA 2Y5BB 2PEAA 4M0WA 2L0FA 4J3OD 1N60A 4DV0Q 1U4MA 3U9OA 1EYGA 3ZNZB 4B3MQ 3HUIA 5M3FG 2SEBD 1U4LA 2JA9A 4JI8L 2N9EB 1P0RA 3OSOA 1WJUA 4YSYB 3QX1A 3HOXH 1GXDC 4K14A 1ONLA 1QOHA 4KN4C 1G6ZA 2F4VL 5DM63 2KENA 3JAML 3JAME 4DV1L 4JOIC 1M90C 2N1WA 3RN5A 3IAM1 1NEKB 3D4RA 2Y3AA 2X8XX 4I6PA 2JP1A 1L6VA 2CJOA 3L08A 3UF8A 2YV5A 2H1EA 2JA7G 4ZRZA 3Q8DA 1MIUA 2CH4W 2GBMA 4FHKA 3R7RA 3CCEA 1T3QA 2CU3A 1LUZA 1PRTF 3GTOH 1BDOA 5IP7G 4JI0Q 3QCAA 1SMYD 2A69C 2QJLA 2FNJB 3J80L 3GTPH 2INDC 5CV4A 5FLMH 3J80E 3APCA 4B9KA 1N5WA 5C2TB 3S1QB 4GKJL 3IAS1 5C4ZA 3VUXA 5LXHA 5CR3A 4FXCA 1RL2A 1S5DD 3B6YA 3CPFA 3ZXVA 1KDBA 4A3MB 2V0GA 3G48A 1EYDA 3VTUA 1Q1BA 3E3XA 3A56A 4RF0A 3CMAA 4PS8A 5AZGA 4TVAB 1ML0D 2MHVA 3BU2A 4OHJA 2XNAC 3HOXB 4Q5VA 3B0AA 1VF5C 4LFCQ 4JI3Q 1NTGA 2NZ1D 5I2YA 1SYEA 1A15A 5GAEC 3H3VC 2UUBL 1VMCA 3ULJA 5IGDA 5KYLA 1YJWA 2KMMA 3A4SC 3ZTCA 2KDMA 4FF1A 1BCPD 2KKCA 1TS2A 2FUG1 3AULA 4M0WB 1N63A 1A63A 3H0GH 4CQNA 4G4KA 2I1KA 1QNKA 4BKGA 2AQ1B 1L2FA 4LF4L 4DR5L 1TT5B 3APDA 4G0NB 4N59A 2CU1A 1GB4A 3GTOB 1CJEA 1HXYD 4OO1I 2Z0EB 3N20C 3TS0A 3FPUB 1BOSA 3P4RB 3GTPB 4PMCA 4LF6L 5IKCM 3IT6B 4C00A 3JC66 4D2KA 5FR3A 4RG1A 2R3ZA 2UXDQ 1WGKA 3Q8AA 4ALPA 4TMAB 4ICVA 5IWAQ 2AKWB 4BY1H 3LNNA 4ODGA 4C56C 3V61A 3KDFA 1AW7A 4DV0L 1AE3A 4P6VF 2L1AA 3O13A 4B3ML 1E7PB 5IP9G 3DBLI 3VVWB 5IYCG 2Z6KA 2DWQA 4EZJA 2ZCCA 1WXVA 1PFMA 1BVSA 1SMYC 4CJ0B 2F0OA 2LRWA 3X23A 3JSVB 1STEA 4N8X1 5J39A 1N36Q 5IYBH 4I7AA 4C3IH 3HKZE 2WP8J 3GE3C 2LY7A 4RGTA 4V190 3Q8CA 1AP0A 2NTTA 3ZUNA 2PNRC 3DWPA 4B9WA 3H0GB 4M00A 3ZLZA 1CUKA 1DJRD 2PQAA 2BB5A 4U68A 3PLVA 1VCBA 1R4QB 5EDSA 1WX7A 3VXWA 1J7CA 3VUYA 5G2NA 1XXGA 2A6ED 2N88A 3F8TA 5T1GA 3ULLA 1EZ6A 1P16A 1C0AA 4XZ4A 2BYFA 2W9NA 4DA2A 4JV5Q 3TEHB 3HOZH 3AE1B 1F0ZA 3PUYA 5F2DA 1FMAD 1X9NA 1N34Q 3HOYH 4IFDH 2RF4A 2OOBB 1WRIA 2EQSA 5FKAC 2IY1B 1WOCA 1GUWA 3X0WA 1BCPC 3RYTA 2N78A 4ZKCB 4BY1B 5C5MA 2MJEA 3RNAC 5C0XJ 4K8IA 3V6CB 1GPXA 4IPDA 3F2DA 2V1YA 1GVPA 4H13C 3CHBD 2EYMA 3A9JA 4XXEA 2B2TC 1RJTA 1X54A 4KGTA 3ZGZA 2WAQG 4LFCL 4JI3L 1S72A 1YQ4B 2KCNA 1UD7A 2VQEQ 3TBLD 2K05A 4C3IB 4DXGA 1VQKA 1UH6A 1X6OA 1OEYJ 4P16A 4KD4A 3KDFB 2EKEC 4RM9A 2VNUD 1WI0A 5D7GA 4JI7L 5DNFA 1RAXA 1Q90A 1KH0A 1K8AC 1B9NA 4B3RQ 4IOCA 4GIVA 1HTPA 4QMGA 1FJGQ 2J0MA 2EDGA 2JK8A 2IHEA 4A3GH 1YJJA 3HOZB 1L1OA 3D3RA 3FHWA 3QO2A 2WB1B 3PO0A 2UXDL 1A8VA 3SD5A 3PV0A 3HOYB 2HDLA 3DBHB 3Q3MC 4XYQA 5IWAL 3FKIG 2EYJA 4N9TA 4OEMB 1FFUA 3K0XA 3ZRFA 3TZUA 1W3SA 1KRTA 2AL3A 5G5GA 1Y1WG 2KA7A 2C7MB 4QIWE 1SB3C 3NQTA 3Q3NC 1V5TA 1PGAA 3W1BA 3STBD 3V2TA 3DOWA 1TWGH 3A55A 2LI5A 5K36G 1ZP0B 4LJZC 2K8BA 3LDZE 2WXQA 4DV5Q 1ZE3D 2K04A 3JVZX 2A6EC 4BBSH 3AU4A 4A3LH 4JBWA 1SE3A 3BDCA 4OGQC 1N36L 2EJGC 4BA1I 2B63H 4G57A 1GNUA 2JX5A 2IZVB 1VQHA 1PTOH 1V1QA 4YCVA 2MGSA 1RRBA 3GS2A 4EQOA 1I5FA 3IRBA 1I4HA 2N3SA 2C60A 1LTLA 2XVSA 2KQ7A 4WJ3M 4G50A 3SU8X 3ZQ4A 3W3AA 5DPSA 3C0RB 3MJWA 3A9JB 5AUIA 1EQTA 1OXXK 2JPHA 3CCSA 4BA2I 5L83A 2F4IA 5CBEE 3PHXB 1E1TA 4A3GB 5JEAJ 3PIP3 4DAYA 4JV5L 4KLKA 4DDID 2F0MA 2IWHA 1WVLA 1YHAA 1PH3A 1DM0B 4XTCS 2JA7H 3AYHB 4NXNQ 1N34L 2CKZB 2QW7A 1EU4A 3PUWA 2NN6H 2HD3A 3SVMA 4WURA 1SJHD 1TWFH 5IP7H 1Q82C 3N52A 1WZ3A 4ASWC 3OTOQ 2AUKA 4LMQD 1YIJA 1IBKQ 3M3YB 1AFPA 1JQ4A 5MPOA 2MBBB 1NI2A 1TWGB 2UXCQ 2L00B 3RULA 4DHJD 3TP8A 2DX5B 2INPE 1S40A 2DNFA 4IOIE 2JXTA 2I07B 3TBIB 5KNDA 1L1OB 2FIFA 4BBSB 2CFMA 3MTNB 2R61A 1QNUA 1RWSA 1Z5SB 2JVCA 5BN5A 2VQEL 2B8FA 4YWMA 3SDLC 2F0PA 2LVQA 1PTOB 3I4NG 3ZJUA 2NVYH 3DMUA 5EPLA 1Y8PB 2K6AA 3KWVA 1IYVA 2PMZB 4DHZE 1E1OA 2ZM6Q 1C76A 1Y14B 3TREA 4B3RL 1IBXA 3LX0A 3RNUA 3U7ZA 2AWOA 4W9CA 3OYYA 3HHMA 1Y8RC 1SMXA 4GDLA 1SYFA 3AH7A 1VQGA 2K1BA 3AB9A 5FO8B 1NBFC 1KDAA 1MHXA 3S1NH 3MEFA 2JA7B 2KT7A 2MPMA 3MFGA 3NXWA 2K5PA 3NS1A 3K9PB 4EEWA 3DLLA 1D4BA 2V3NA 2KDBA 3AE2B 1TWFB 2I5MX 5M5WH 1STAA 1NNXA 3U4ZA 4IUUA 4DUYQ 1N61A 1SNDA 4GGQA 3W1SC 4E3CA 1DOYA 3QWNA 1U4RA 1STBA 1NMFA 4IFDI 1B8AA 1D6EC 4DAYB 2X69A 4DV5L 2MJDA 1HZ5A 2YTVA 2JA8G 2I5HA 3D6WA 4DR2Q 3DHIC 3DQVA 1RYJA 3MJ5A 3K59A 4DQOC 2F0EA 3MXUA 2QILA 1GD7A 4OL7A 1LT6D 2NVYB 2WXFA 3N9YC 2GBRA 3Q14C 1K8MA 2PNHA 2ICIA 2NMQA 2K4KA 1KOTA 5IN7A 3KLWA 5LMUQ 2O5IC 2ZNVB 5H8YE 1EWCA 1RTNA 2K5QA 4A3CG 3C46A 4LF8Q 3HOVG 1YITA 2KFKB 2UU7A 3CP0A 1YIWA 1HHVA 1DCZA 1DGSA 3MC9A 4P7IA 2ENBA 1PXUA 4IUQA 2JZZA 4AWJA 1Z2MA 1HR0W 5LNK1 1BQQT 2M8SA 4OONA 2LHDA 4EX5A 1KC8C 1XTCD 3S1NB 4B0MA 2B2YC 1B70B 1S5BD 4NMZA 4NXNL 1AEXA 3TMEA 2F0VA 5IY0A 5E6PA 1FXTB 3PRMB 2BKRB 2PKOA 4O42A 2WV6D 4CDFC 4UY8C 2PZUA 1WH3A 3V96A 5M5WB 1BCPF 1X3QA 3OTOL 3HM6X 1IBKL 3L13A 1SYGA 3S14H 4HJ7A 4IZ8A 1QB5D 2UXCL 3E9SA 1CKMA 4GDLB 4F8CB 3D8GA 4A3KG 2E74C 2HQEA 2KVZA 2K6DB 1J8CA 5I4DA 4AJYB 2MBEA 3MTSA 2QMTA 3TUOA 2WYQA 3A33B 1VQ9A 3AE3B 4F7ZA 3PSIA 3QC8B 3PRZA 4R8NA 1QOGA 4M8MA 3W2DA 4OWWB 2JSVX 2WKCA 1KM7A 1RHPA 1VDVA 4BKTA 1ROEA 1SDFA 2ZM6L 3TZDA 1B9RA 3IAYA 4C7ZA 1O80A 3NELA 4KZCA 4XE0A 3ICEA 3CPWA 3FP9A 4XQJA 3AEFB 1SLJA 3F1ZA 3GE8C 5BMIA 1NDDA 2K0PA 1OFFA 2FCQA 3DM1A 3S16H 2MO0A 2B29A 5GMVA 1T9HA 1IW7D 1KRHA 1NR4A 5EE1A 3PPAA 2L0CA 4LFAQ 2RKSA 2W3SA 1D1KA 4HMIA 4DV4L 4BBRH 2JRIB 1KLGD 3S2AA 1LLRD 3S14B 3PT2B 1C1YB 1U4AA 4DUYL 3E6ZX 3OOCA 2B39A 1FNUA 1A3TA 2OEOA 2RA4A 1XEEA 4KKTA 4OZCA 4XDDA 4Y52H 4DKAC 3C8YA 4DV6Q 2NN6I 1UUPA 5M5YH 4XYCA 4DR2L 2CR5A 4EVOA 3ZDMC 5E4XA 5IA7A 2JY6A 3FKYA 2EY2A 1TWCH 1KNAA 4FJVB 4FXGC 1ESRA 1EY4A 1HPCA 3J81j 1WSPA 2IT1A 2JJQA 3FMCA 2IGDA 4C3JG 1IGDA 2L15A 5LMUL 1CHQD 3H3VH 4EQNA 1Y1VH 2WAQB 4L63B 4NQKE 2B2VC 1XLOA 1OTRB 1Q3LA 1UE7A 1Q86C 1UGMA 1H4RA 1ICFB 3DBRB 2XIWA 3VQIA 2F0KA 4A3MG 1TWAB 4RHRA 3K58A 1NENB 3IFWB 4WJNA 1QVGA 5JEAG 2NBWB 2G3QB 1RTOA 5BYQA 1PZKD 3S16B 3TQYA 1YJ9A 1EWYC 1TS5A 3V05A 2B3AA 3D0FA 4A8XC 2KCTA 4I65A 4LK1C 1WGDA 2JT4B 1R4NB 4LUZA 2SOBA 1VQMA 4BBRB 4X65Q 3NP8A 1WR1A 4P74A 1KAAA 1VQ5A 1B3AA 1ILQA 2NVTH 2MRPA 3NRZA 3RZFA 2NVXH 3KVFB 4KDIC 3GP7A 3WANA 3KF8A 2G5DA 2A73B 3FKIB 2Z6BA 4CJ1B 5M5YB 4GLXA 1P98A 5ELDA 4NXMQ 4RM8A 1Y1WB 2FMCA 3DVGY 3GQBA 2YEPF 1TWCB 2BS4B 1HE8A 4YHHQ 4P72A 3CMMB 2ON8A 3UI3A 2X6GA 5CYUA 5C3XA 1XMQQ 2L7RA 1IW7C 2CWAA 2EJMA 3MZ5A 1VQ7A 4XC2A 3RCZA 2PQEA 4WH4A 3U50C 1BT0A 4FULA 3VTVA 4FF2A 3ALBA 1Y1VB 2FCSA 2KJRA 1F77A 2VH1A 4US9A 5M3MG 1PYBA 4MEMA 1FRRA 2PCFB 1NMGA 1EUVB 3PSEB 3QIAA 4ZRKA 2P5ZX 5FO7B 1YJNA 3S17H 2WKDA 3I4NH 3HVZA 4BBNF 5JHAA 3AE8B 3S2HH 2L8JA 4X3SA 3U52E 2Y5PA 3QHTA 2NYZD 2ZXOA 2RD0A 3KF6A 4DAPA 2FCMA 4YSZB 4NP5A 2ONQA 3VA7A 3NVVA 3URYA 1KRSA 4LFAL 3H8HA 3VR4A 2QGQA 3KYHC 2G1EA 2W54A 3VUWA 2KJHB 5HGTA 3AEDB 4BAXA 4EZKA 2EY6A 1E10A 4DV3Q 2NVTB 3K81C 1E2VA 2KMAA 3GB1A 2KMCA 1EWHA 2NVXB 2O4XA 1XD3B 3B9JA 2DJGC 2NZOA 2LFNA 3SR6A 4DV6L 1K0RA 4JI1Q 2H5XA 1LT4D 1I4PA 5LXIB 1WE7A 2WX1A 4LNIA 2HCCA 2KO3A 1R4MB 1F2YA 1VMPA 2EE1A 1STGA
chains in the Genus database with same CATH topology
1TJEA 3HS0C 2C5CA 3ZYYX 1C4QA 5FOBB 4RKBA 3QG1A 1GUOA 2E2DC 3M7NA 4DK1A 1U9RA 2EKIA 3S17B 4J1MA 3I4NB 1DGJA 3S2HB 3CRLC 1NVID 3P4SB 4LLGM 4JPSA 5H92C 4JWUC 2X6LA 5IOCA 2RSOA 1H9JA 1E0BA 3AMUA 4DF7A 1C4CA 3MP9A 1IKMA 2WXGA 4TSSA 1JRPA 4RHSA 1C4PA 1L4ZB 1KNEA 4KY5A 3D31A 5C0XH 3TEWA 1EY9A 1FNVA 5FK9C 3U2SC 1NI3A 2JA8B 1S5FD 4OVZA 2LFIA 2F0TA 2EYOA 3CU7A 3Q8FA 2LGIA 1TY0A 4XT3B 1RKNA 3T56B 1A6XA 4XYOA 1VRAB 1CM9A 1Z47A 3TP7A 2L32A 1A3VA 3HOVB 4TKOB 1HRJA 3GV3A 4X3TA 3GO5A 2LUMA 3NK9A 1JWBD 2YYZA 5J22A 4O1NA 1NYQA 2WDRB 1STNA 3BYTB 1FCLA 5BYSA 2JA5B 4NJCA 1I4GA 4XWWA 4KY6A 1CQVA 3P20A 2J0TD 1E9MA 5FO9B 3FVQA 1HQRD 1WWTA 2D62A 2OF1A 2WQYB 1F2MA 1V1PA 4A3KB 1QF6A 2M56B 4CBVA 2Z4HA 1C9FA 1C78A 2WINB 1OQRA 1K52A 3CQZB 2PVOD 1SF0A 2IX3A 4X3UA 1XWEA 3TEXA 5I6WA 5I9OA 5IT9L 5IT9E 2INNE 1FD7D 5JEAH 3QOJA 1RCVD 3HEJA 2B2UC 3R2IA 2HTME 1YNJD 4HEDA 1JR0D 4Y7NB 3EQLC 2Z8LA 1MI2A 3MC0B 2PIAA 4WORA 4YSXB 4NDXA 1W6JA 2FBWB 3BVGA 1SE4A 1MPEA 1GB1A 2NN6G 1K8OA 3R2TA 1M8AA 2W55A 1LT3D 1QCBD 4C3JB 4CJ2C 5JVH3 3OWFA 3UI2A 5C4JB 4JWSC 1CA5A 1JW9D 1A2TA 1V1PB 2PMVA 4ZHPA 4A93B 4L2YA 2EY5A 5I6YA 4K5VA 4MIUA 2WDVB 4J6HA 3P4PB 1ET9A 1ZOYB 2CW0C 3C3LA 4X3KA 3MFYA 4XQQA 4C2MB 1WXQA 4AYBB 3AE4B 4WRDA 4K5XA 1TR5A 2WNMA 2A68D 1TY2A 1K53A 3I70A 3MXNA 4YT0B 2IW3A 1H9KA 2ZXPA 4KI0A 3HRDD 4KV6A 1LV9A 1IHZA 4IQZA 4R8IA 2BW2A 1BO0A 3W5UB 1ENFA 3EA6A 1HZ6A 5C0XI 1RF2D 4A3IB 3CWIA 1SIJA 2I38A 4JX1C 1TKEA 3LWUA 1QOFA 1QOBA 2WU2B 2J42A 5C6AA 1SFOB 1ICWA 5M3MB 1V8CA 2PW5A 3BZDB 4DFAA 2DBYA 1TWHB 4E6IA 3U9SA 3M4YA 2WXPA 1UWXA 3QOLA 3P1HA 2A5HA 3RD4A 2BOSA 4KK7A 3FDTA 3RFZB 1C48A 4F8MA 5D65A 1R9TB 4HMJA 1WTVA 1L0XB 4RCOA 3ONAB 3AE9B 1EY0A 2D2CC 2F3VA 1PLFA 5G3LD 1JORA 1V8QA 4KKSA 1EYAA 3S1MB 4HEA1 4ZOHC 4RNAA 1K51A 2LEKA 2EPBA 1QG7A 3A54A 2NWGA 1BXTA 3K7AB 4IUTA 1WTWA 1JOQA 5HHDG 2A68C 4F7XA 3Q22A 4DGZA 3FC4A 3I73A 2B2WC 4XDXA 2RSNA 1CZGA 1NR2A 4G7HC 1M4VA 1AZPA 4HKZE 2IJ0A 3NVYA 2IPKD 3A8IE 3T53B 3FPPA 2Z4IA 1I50B 3I4LA 4XIGS 3OMGA 2WACA 3M85A 2B76B 1PGBA 5CV7A 2EXZA 1B1ZA 5ISRA 4TQ1A 3SXHA 3E56A 3TN2A 1FM0D 4HJGE 1OXSC 4KKJA 3LB8C 3BK1A 1PUTA 1DOXA 1DYQA 2AUJD 5CORA 5EQ0A 1TVXA 2CQAA 2WXKA 4IUPA 1I6HB 3ZJVA 4NAMA 2DYMA 2SAKA 3WCQA 3IL8A 1EY5A 2DYOA 5G5HA 3TEZA 3W9CB 3PMFA 3MXGA 3SFEB 4IKGA 3P42A 3P7JA 1DZ1A 4IDIA 3TSSA 4L8JA 3N6RA 1Y69U 5KNCA 4YTPB 1RODA 3K57A 3NVWA 3AMZA 1H9SA 1RDPD 1GHKA 1PMRA 2BYTA 1KF6B 3LWEA 2QSDA 5FLXL 5FLXE 2B8GA 1ZYRD 1I4QA 1J8IA 1PRTB 2L55A 1HEZE 1V1OA 1G91A 3AEAB 1H9RA 1MSGA 3HRZC 4KJOA 3OIPA 4WFN3 4DXFA 1JICA 4HCEA 1LTAD 1O7ZA 3R93A 1CT1D 3T3OA 1JOOA 3SDZA 1VCIA 2Y0SB 3MWYW 3R3OA 2B63B 2N55A 3SHLA 4MT5A 3T4AC 2N0SB 4FNFA 4G7ZC 2EYHA 1MD2D 5C4XB 2XRSD 4DAVA 1WYGA 5CGKA 1FD6A 4XQNA 4FVMA 3AU7A 4WJWA 5COYA 4PT5A 1Z6HA 2JSOA 4HAEA 3HOUB 1EY7A 2KAJA 3ABVB 5E1FA 1F9SA 1ENCA 1WTOA 1WTQA 3DUZA 3KK7A 1XLNA 3P4QB 5M5XB 1H9SB 3VRAB 1ESFA 4LAAA 1SE2A 1J7AA 1XLQA 2KEEA 2F0GA 1ZXTA 1YMHE 1ZYRC 4L23A 4FO2A 4K8JA 2LMCA 2K5WA 4NAWB 3RZDB 3T13A 4KY7A 3I8ZA 3C2PA 2ZT9C 1XYIA 1TKGA 3RZOB 4A9AA 1YN5A 1GOZA 4ZLTF 2DN8A 3H09A 3S15B 2C9OA 2XWBB 2IGGA 1QQRA 3T16A 3J7YW 3P75A 5I2XA 1DOLA 2XSCA 2PO4A 4K6LA 5C0XG 2GB1A 3M7GA 1V97A 1JE4A 4GZYC 3PZ8A 2TMPA 5HI1A 2KEDA 2JQRB 2Q8RE 1U4PA 1IUEA 3A8JE 1B2TA 4DK0A 3BS1A 2FMMA 3X3MA 5EE0A 1CZPA 1ET6A 2A74C 2IL8A 5GXGB 3TDQA 1XF5L 3BDOA 5KEEA 2LMCB 3BWUD 2EY1A 1DOMA 4ABNA 1D2BA 2M19A 1JWMD 3VYRA 1SEBD 3NUHB 2D5DA 3A8KE 2E2JB 4CKBA 1YNTE 3AB5A 1IKLA 4OIKA 2WXIA 1K50A 3J81L 3I9V1 1FFVA 4NZLB 3J81E 2EVBA 2L5TA 4KGRA 5G3LF 1LTGD 1F9RA 1HQMC 4L6TB 2F0DA 3HGBA 4N6EB 1K83B 2H88B 1JQYD 3IFTA 2SDFA 2F0IA 4C3HB 1C8CA 1JALA 2V3PA 3VR3A 2F0QA 2VZKB 1EEID 3ITPA 3WDNA 4L1BA 1JWUD 5D14A 4M1UB 2RBMA 3MHZA 2PW9A 3E0JA 3BG3A 5BYRA 2K32A 4YIJA 4A3DB 2J52A 2WXOA 1P7FA 2EYPA 2RMMA 4OW0A 2SNSA 2E76C 4ZUJA 1J9OA 3RLFA 1BNZA 1TKWB 2V4DA 3G6JB 3GTKB 2JYOA 2CHBD 1PTOD 1SYBA 1HUNA 3H94A 1EY8A 3IXSA 2OEDA 5DEHA 3TP5A 2F0HA 4BS9A 2WIIB 1VDZA 4K6DA 2I2YA 3K5NA 3MAQA 5ELBA 1ZUD2 3IT4B 1I4RA 3WOEA 2E2HB 3ZJTA 4MM3B 4Q2JA 1RD9D 1SSOA 2RQXA 4R3DA 2G9DA 2L1BA 1R4PB 1Q8IA 2HDEA 2E75C 1FXAA 2B2WA 5D3DA 1HTLD 4OZBA 1CI3M 2JEBI 2LKVA 3BYYB 3SK8A 1FGBD 2B2TA 1G291 1H9MA 2D5GA 2ACZB 2XN9C 2MJ3A 1TT2A 5TSSA 4EGVA 1F2RI 1TS3A 3T3NA 4A3BB 1CK1A 3GTGB 3MHBA 1CHPD 2L9HA 2K03A 4FP5D 3AE7B 3SK6A 4KJNA 2F0SA 1O7LA 1B9MA 5EBDA 1QOAA 4DNRB 1AWDA 3MEHA 1Y8NB 4KN7C 1HUMA 3OIQA 4A55A 1EU3A 4YTNB 3RPFC 1J7BA 5C3WA 4USAA 2NTSA 3QJYA 3I4MB 2ZW0A 1BR9A 1CFMA 1TS4A 3P63A 1JWSD 2K3UA 4KMUC 5T8IA 1VF7A 3S2DB 4NW2A 1WD1A 2WXJA 4ZYSA 1E2ZA 2R93B 2IDYA 2QCPX 4MHEA 4K5WA 3D6CA 4ZK9B 4C7YA 1PZJD 2N7JA 3AN1A 1BCPB 3Q23A 4YXDB 1A2UA 1STYA 3SEBA 4AS1A 4RKLA 2FE8A 2NUCA 2E3TA 1O7YA 4LK0M 3PIO3 4DU9A 3HKZB 5A2QL 3NWTA 5A2QE 4N58A 4HCSA 3WOFA 1GAQB 4GDKB 4RGOS 4WAFA 3VA5A 2EOTA 3EFXD 3X3NA 1XX8A 5KNBA 1I7HA 2R92B 1QE6A 4ILWA 2BE5D 4CHTB 4KKIA 4OO1H 2FHTA 1EIHA 1G8ZD 4DNTB 1UGJA 1SNOA 1SYCA 1EEFD 4H2AA 3H91A 5AUKA 1LTSD 1SJED 3M4OB 4GLSC 1EL0A 3AV8A 5EE9A 3VYTA 4HKQA 3H6MA 4HTHA 1T5EA 2O2LD 1CZWA 2CVRA 2KQ3A 3NTKA 3NUCA 2BTEA 3ND9A 2HDMA 1EZ8A 3K0YA 2OXPA 3BIID 5C3JB 2A69D 3LYYA 5EKLA 4US8A 2R6GA 4WQMA 3W1SA 3CIRB 1B53A 1TKYA 3NHHA 1JOKA 1UAPA 1VZ7A 1EFID 3A7AB 4QIWB 2GI9A 1JWAD 2JYTA 4ARIA 5JAVA 2DNCA 4H7BA 2PTLA 1L0YB 1MI0A 2WDQB 5T1IA 1YN4A 3A7LA 2RPVA 1C4AA 1ZXIA 5C3EB 2WU5B 3EGRA 1MHHE 1CTMA 2ZXRA 2AQ2B 4HSVA 1NYRA 2BT6A 2YEPB 1HCZA 4OZAA 1SNCA 5I9PA 2PZWA 2OHFA 3DEOA 1PDQA 2B2YA 4CKEA 3B2FA 5BN4A 5IGEA 3BDLA 3LXFA 3Q6SA 4JK1C 4KX6B 2EZVA 1BBXC 5NUCA 5EGTA 4Q0FA 2XRQD 3MA2B 4ZUIA 2W82A 1OXVA 5EPJA 1VLBA 1MSHA 3CRKC 3EROA 4RWSC 1I6VC 2KHSA 1SXTA 2WXNA 1XCTL 2FFKB 5IIFA 1ZXHA 1FNWA 2EJFC 2F0UA 2WXLA 4QUCA 3E5SA 3DXJC 4OIJA 5ELCA 4PMWA 1YNND 3I91A 4XWTA 1ZPSA 1F9PA 4Z9CB 4RA8A 2F0LA 2DY7A 4C1NI 5JJZA 3K5OA 3SK5A 3DWQA 4YWGG 3MVVA 3NPPA 3PO2B 1YNJC 4N9PA 2N9LA 5A35A 2JYEA 1PTOF 1R7SA 5ELEA 3KWLA 3K5MA 1AN8A 5LL6X 3HZXA 4MN3A 2J7ZA 5IGFA 3NTHA 2BDNA 4BY7B 1X3PA 4KTAA 3VR2A 3K6OA 4F88A 2F0NA 1FO4A 3OWEB 2JA6B 2WP9B 1SNMA 4RCNA 2MUYA 2B2VA 1LTTD 2EYFA 5C4HA 3PUZA 1ZKOA 1RM6C 1BUIC 2F0WA 1HA6A 3SK4A 4ULLA 5CV6A 4FYDA 5DAUA 4G7OC 1G2TA 1SAPA 2H4OA 1NSNS 3NBIA 4M8AA 5JPMC 1N62A 2Q8IB 2JWUA 2IGHA 3OW7A 1Q12A 5BMHA 1EOTA 1YNNC 1OXUA 2L11A 1UWMA 4DN4M 4C3HG 4B08A 1PFBA 5KYIA 2X38A 4UAIA 4KHZA 1RFKA 4KKUA 5BN3A 3HP3A 1PYWD 4ZHOA 1TIID 4K2LA 1LACA 4MACA 4FXKC 4TQUS 1WCMB 3BVMA 2PPBC 1QLBB 5ELFA 5EPKA 2DLBA 2M0AA 3IFDA 3PUVA 4LTUA 2GA4B 2PW7A 2E6XA 1WTRA 2D9UA 5CBAE 3L7ZC 4C1NK 2JU6X 2Z1CA 4I7ZC 1LABA 1DONA 3NE5B 1B44D 3DEPA 4ZRPA 5E4WC 3ND8A 4WWMA 2PVGC 1FIQA 3NSWA 4RAUC 2SNMA 2VB3X 4F87A 1GJXA 2K33A 2NBFA 3K5LA 1CA6A 1V43A 2KWDA 3SR1A 1PFDA 3KBXA 1Y8OB 4NKLA 3VR8B 5JOBA 3D4DA 2FINB 2QKIC 3J7AF 3U4EG 5EE3A 3OPOA 2H89B 2QIEB 3FAHA 1Q10A 2VUMB 3F2UA 2BBCA 2ZW1A 3L4PA 4RFBA 1L0VB 4A90A 3DWGC 2RDGA 2ICEC 1Z7TA 3PUXA 1NAPA 4FF3A 4ITKA 5E6JA 3FILA 5CV8A 1VZ8A 2RVLA 3PO3B 3MXPA 3SFDB 3AEEB 1YQ3B 1LT5D 4HR7B 4IUNA 3VYUA 4P2CB 4HRSA 3TEYA 4IURA 2G9HD 3T51B 1FXIA 5KIXA 1LTRD 1NUCA 5CMDA 3KLSA 3R8BA 2QEJC 1A3UA 1TYGB 5IODA 1HFNA 4D2KA 1FR3A 5AFWA 5D3IB 4KHVA 2BA1A 5LHY1 3VR9B 4FXDA 4A3EB 3EJIA 2PLPA 3EVQA 2EYLA 4QUFA 2NB0A 5M3FB 4UDUC 4PQXA 3I57A 4QB4A 2PYKA 4B0EA 2KUMA 4IALA 3S1RB 1GUGA 2RDHA 1FEHA 1JROA 2HCIA 3Q69A 3FILB 3PZ7A 1JC7A 5IGCA 3KUPA 1SBBB 1KFYB 2CJNA 1HFGA 3BK2A 2OT2A 3CKIB 2W3RA 5C5LA 3IKJA 4CKCA 2B2UA 3L9AX 5KGUA 1QILA 5KRUA 1TZOA 1SNQA 5HFYA 4ZRQA 4XT1B 1XLPA 1YJIA 2F0FA 4RF1A 2TSSA 5EKIA 2L4NA 1EY6A 1SSNA 1DOIA 5CC4A 5JPNC 4A3JB 1VZ6A 2KJXA 5K5PA 1C79A 1YN3A 3Q0AA 1VJKA 2QDBA 3DHQA 2AX5A 2O5JC 1UEAB 3HG9A 4H44C 3V3XA 2J4XA 1IBXB 1FRDA 1ILPA 4OO1G 4U673 3GTLB 1I3QB 2A6HD 1XO3A 2F03A 2AQ3B 1T5XD 3NQIA 1JMLA 1QT9A 2K01A 1B4OA 3RMHA 1PZID 3HVDA 1ZEQX 3FEWX 1F9QA 1FYCA 4AQ7A 3NBHA 2BB6A 4IFDJ 4KD3A 3C1EA 4ME5A 2BS2B 2MJ8A 1EYCA 1MBYA 4PMBA 2F3WA 1PFNA 2Q8TA 1ZDVA 2LS01 1D1IA 3I72A 4R9WA 1OO9B 5LL6S 1D5MC 1A70A 3Q8BA 4PNYA 1OXTA 1EQVA 2XWJB 5CV5A 5M9OA 3GD7A 3SE0A 5HURA 3VR6A 2WXRA 1PRTD 1S4ZA 2FJ2A 3DWMA 3NZ3A 1PGXA 4RH6A 3AE5B 3RUZA 1EIGA 3VYSA 4PV1C 5J1ZA 1N5XA 2J53A 2ID0A 1WTPA 1SNPA 3J9CA 3Q8EA 2KCCA 5K36H 4YTMB 4ARCA 2I46A 1E6EB 3OHXC 4FF4A 2NVQB 3G7LA 1C77A 2AWNA 1QKZA 2KECA 3S9WA 4CGYB 2A6HC 2VXWA 2KQ4X 2M2LA 4S3SA 2KACA 2Q5WD 4IUVA 1KABA 3OMCA 1WTXA 2BDOA 3C1FA 1ACCA 4XDCA 3AE6B 5IGBA 4JE3B 1F2LA 2L83A 3AECB 2KVMA 2E2IB 1CQFA 2WXMA 1L5PA 1VR9A 3P1MA 3FRPB 2HUGA 1IYUA 3J7AV 3HOWB 5IGGA 1OQQA 1EM7A 3L3OC 1KLUD 1AYFA 2EELA 2F0JA 1Y56A 1SYDA 5BMGA 4TQ0A 1PRTC 1I4XA 1JCKB 2K5DA 2PZTA 3KLRA 4RGMA 2DNEA 1UNSA 2MH7A 3AEGB 4A6QA 2GRIA 3GTQB 1NCVA 3NVZA 1KTKA 4QF4A 1D5ZC 4H0LC 4C80A 3NTIA 3BVZA 4EE2A 2BS3B 3ERQA 4IN3A 1LTID 2VB2X 1PTOC 3KQ4A 2Y5CA 4QCLA 2L12A 1BUVT 2M00A 4EQPA 3EUB2 5JXVA 2IX0A 3GTMB 1ENAA 3TP6A 5JVG3 1E0ZA 2BCOA 1G2SA 3VRBB 3KLSX 3GTJB 2K28A 4V0BA 1ZDXA 2WLBA 1S5CD 1E2WA 1GUTA 3KBGA 4HSPA 4A3FB 2L52A 2K22A 5HG2A 2IX1A 2K9XA 3D4WA 2JXMB 3Q24A 4C3IG 2JEAI 1AZQA 2KN4A 4MH8A 1DOKA 3ETRA 1STHA 3I90A 4ZAIA 1II3A 1X32A 2R7ZB 5EJWA 1IGCA 3VR5A 4ID6A 2KOLA 2V4IB 1JB3A 1PDXA 2YU9B 3DWAA 4KGSA 4IFDG 2JE6I 2BA0A 4HN7A 1T6BX 5EKKA 2QF7A 5C44B 3AEBB 3W5VB 1HA5A 2VZKD 1LO5D 1L4DB 2WS3B 1L6UA 4RGNA 2F1MA 1QJOA 2LHEA 4TRDA 4REZA 1D5XC 1MGSA 1F2ZA 2LJIA 1DD2A 4ZKBB 1QWYA 2MP1A 5E3FA 3QB3A 2JZPA 4B9XA 4K2KA 1Q1EA 1IL8A 5CV9A 1DXMA 2WXHA 2N9KA 1P7EA 1W6KA 5DM73 5EBCA 1XCQL 1KDCA 4WIPA 1GUNA 1LTBD 1O78A 4J8QA 2CW0D 1MVKA 3NWSA 3AM9A 1F2RC 1BF4A 1FCCC 2M9VA 1WD0A 3GV6A 4HROA 2RDFA 4ZQ3A 1BMLC 1GUSA 2K7VA 2DY8A 1GHJA 3I3CA 4BWGB 1TQOA 2BE5C 3B2GA 1B50A 1TU2B 1S5ED 2MEKA 4M0WA 4J3OD 1N60A 1U4MA 3U9OA 3HUIA 2SEBD 1U4LA 3OSOA 4YSYB 1GXDC 4K14A 1ONLA 1QOHA 4KN4C 1G6ZA 5DM63 3JAML 3JAME 3IAM1 1NEKB 3D4RA 2Y3AA 2JP1A 1L6VA 2CJOA 2H1EA 4ZRZA 1T3QA 2CU3A 1PRTF 1BDOA 1SMYD 2A69C 2QJLA 3J80L 5CV4A 3J80E 1N5WA 5C2TB 3S1QB 3IAS1 5C4ZA 5CR3A 4FXCA 1S5DD 1KDBA 4A3MB 2V0GA 1EYDA 1Q1BA 3A56A 4RF0A 1ML0D 2MHVA 4OHJA 2XNAC 3HOXB 4Q5VA 1VF5C 2NZ1D 5I2YA 1SYEA 1A15A 3H3VC 1VMCA 5IGDA 5KYLA 2KMMA 2KDMA 4FF1A 1BCPD 1TS2A 2FUG1 1N63A 4CQNA 4G4KA 1QNKA 2AQ1B 4N59A 1GB4A 3GTOB 1CJEA 1HXYD 4OO1I 3FPUB 1BOSA 3P4RB 3GTPB 4PMCA 3IT6B 5FR3A 2R3ZA 1WGKA 3Q8AA 4TMAB 3LNNA 4ODGA 4C56C 1AW7A 4P6VF 2L1AA 3O13A 1E7PB 2DWQA 1PFMA 4CJ0B 1SMYC 2F0OA 1STEA 5J39A 2WP8J 2LY7A 4RGTA 4V190 3Q8CA 1AP0A 2NTTA 2PNRC 3DWPA 4B9WA 3H0GB 1DJRD 2BB5A 4U68A 1R4QB 1J7CA 1XXGA 2A6ED 2N88A 5T1GA 1EZ6A 4DA2A 3AE1B 1F0ZA 3PUYA 5F2DA 1FMAD 4IFDH 1WRIA 5FKAC 1GUWA 1BCPC 4ZKCB 4BY1B 5C5MA 2MJEA 5C0XJ 4K8IA 1GPXA 4H13C 3CHBD 2EYMA 4XXEA 2B2TC 1RJTA 4KGTA 3ZGZA 1YQ4B 2KCNA 2K05A 4C3IB 4DXGA 4P16A 4KD4A 2VNUD 5D7GA 5DNFA 1Q90A 1KH0A 1B9NA 1HTPA 4QMGA 2EDGA 1YJJA 3HOZB 3D3RA 3QO2A 2WB1B 3PO0A 3PV0A 3HOYB 2HDLA 4XYQA 2EYJA 4N9TA 1FFUA 3TZUA 5G5GA 2KA7A 1SB3C 3NQTA 1PGAA 3V2TA 3A55A 5K36G 1ZP0B 4LJZC 2WXQA 1ZE3D 2K04A 2A6EC 4JBWA 1SE3A 3BDCA 4OGQC 2EJGC 4BA1I 2JX5A 4G57A 1PTOH 3GS2A 2MGSA 4EQOA 1I4HA 2XVSA 3ZQ4A 3W3AA 5AUIA 1EQTA 1OXXK 4BA2I 2F4IA 5CBEE 4A3GB 5JEAJ 3PIP3 4DAYA 2F0MA 2IWHA 1WVLA 1DM0B 4XTCS 1EU4A 3PUWA 2NN6H 3SVMA 4WURA 1SJHD 3N52A 2AUKA 4LMQD 3M3YB 1AFPA 1JQ4A 5MPOA 1TWGB 3TP8A 2INPE 4IOIE 2JXTA 2I07B 3TBIB 5KNDA 4BBSB 2R61A 1QNUA 1RWSA 5BN5A 2B8FA 2F0PA 1PTOB 3ZJUA 3DMUA 5EPLA 1Y8PB 2K6AA 3KWVA 1IYVA 2PMZB 1C76A 1IBXA 3LX0A 3U7ZA 2AWOA 1SYFA 3AH7A 2K1BA 5FO8B 3AB9A 1KDAA 1MHXA 2JA7B 2MPMA 3MFGA 3NXWA 2K5PA 3NS1A 1D4BA 2V3NA 3AE2B 1TWFB 1STAA 4IUUA 1N61A 1SNDA 1DOYA 3QWNA 1U4RA 1STBA 4IFDI 1D6EC 2MJDA 2X69A 1HZ5A 3D6WA 1RYJA 3MJ5A 3K59A 4DQOC 2F0EA 3MXUA 2QILA 4OL7A 1LT6D 2NVYB 2WXFA 3N9YC 1K8MA 2NMQA 2ICIA 2O5IC 5H8YE 1EWCA 1RTNA 2K5QA 3C46A 1HHVA 1DCZA 2ENBA 1PXUA 4IUQA 5LNK1 1BQQT 2LHDA 3S1NB 4B0MA 1XTCD 2B2YC 3TMEA 1S5BD 4NMZA 1AEXA 2F0VA 2PKOA 4O42A 2WV6D 2PZUA 3V96A 5M5WB 1BCPF 1X3QA 1SYGA 4IZ8A 1QB5D 3E9SA 4GDLB 3D8GA 2E74C 2HQEA 5I4DA 3MTSA 2QMTA 3TUOA 3AE3B 4R8NA 1QOGA 3W2DA 2JSVX 2WKCA 1RHPA 1VDVA 1ROEA 1SDFA 3TZDA 1B9RA 3IAYA 4C7ZA 1O80A 4XE0A 4XQJA 3AEFB 5BMIA 2K0PA 1OFFA 3DM1A 1IW7D 1KRHA 1NR4A 5EE1A 2L0CA 2W3SA 2RKSA 1D1KA 4HMIA 1KLGD 1LLRD 3S14B 3E6ZX 3OOCA 2B39A 1FNUA 1A3TA 2OEOA 2RA4A 1XEEA 4KKTA 4OZCA 4XDDA 3C8YA 2NN6I 1UUPA 4EVOA 5E4XA 2EY2A 1KNAA 4FXGC 1ESRA 1EY4A 1HPCA 1WSPA 2IT1A 3FMCA 2IGDA 4C3JG 1IGDA 1CHQD 4EQNA 4L63B 2WAQB 2B2VC 1XLOA 1Q3LA 2XIWA 3VQIA 2F0KA 1TWAB 4RHRA 3K58A 1NENB 5JEAG 1RTOA 5BYQA 1PZKD 3S16B 1EWYC 1TS5A 3V05A 4A8XC 4I65A 4LK1C 2SOBA 4BBRB 3NP8A 1KAAA 1B3AA 1ILQA 3NRZA 3GP7A 3KF8A 2A73B 3FKIB 4CJ1B 5M5YB 5ELDA 1Y1WB 2FMCA 3GQBA 2YEPF 1TWCB