1GOZA

Structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
228
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKDKRKSCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Role of Threonine 112 in a Superantigen Staphylococcus Aureus Enterotoxin B.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Enterotoxin
molecule keywords ENTEROTOXIN TYPE B
total genus 64
structure length 228
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1gozA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gozA02
1LTSD 1FNWA 4BWGB 1L0XB 1SE3A 1PTOD 2QEJC 5FKAC 4L63B 1JCKB 1V1PA 1XTCD 4ZYSA 1PTOC 2RDHA 1AW7A 1HXYD 2AQ1B 4UDUC 1YN4A 1JQYD 1FD7D 1TS3A 4RFBA 2NTTA 3TSSA 1LTAD 1V1PB 1I4HA 3BZDB 1CK1A 2QILA 1SBBB 2G9HD 1CT1D 1EEID 4K6LA 5D3DA 2SEBD 1I4XA 3DWPA 1QILA 1D5MC 1EU4A 1V1OA 1BCPB 1PZKD 1SJED 2IJ0A 1UNSA 1L0YB 3BVMA 1BCPD 1BXTA 1MD2D 3R2TA 1LLRD 1PTOH 3V05A 2AQ2B 4DXFA 1PRTB 1RCVD 1SEBD 3DWAA 3KLSX 1ESFA 3OWEB 1B1ZA 1S5BD 1LT4D 1PTOF 3MFGA 1CHPD 1SE4A 1JWMD 2XNAC 1HA5A 1RF2D 1TY0A 1LT6D 1PRTC 1I4RA 1JR0D 2WV6D 3DWQA 4Z9CB 3EA6A 1DYQA 2ICIA 5ELDA 4NZLB 1TY2A 1TS4A 1B44D 1LT5D 2XN9C 1FGBD 1LT3D 2XRQD 1EWCA 1TS5A 4TSSA 1S5DD 1LTTD 1G8ZD 4RCOA 3W2DA 2RDGA 5ELFA 1KTKA 1LTBD 1S5ED 3GP7A 4RH6A 4RGMA 5I4DA 4O1NA 1ET9A 4RGTA 3URYA 1BCPF 1LTGD 1RD9D 1FNUA 1I4QA 3BYYB 4RGNA 1SJHD 1I4GA 1PZJD 1LTRD 1S5FD 1YN5A 1D5ZC 1ET6A 3EFXD 1STEA 1KLGD 1I4PA 1PRTD 2O2LD 2J4XA 1PYWD 1JWSD 1EU3A 1PRTF 1PTOB 1D6EC 1LO5D 1HQRD 1TS2A 2XRSD 4RHRA 5TSSA 1SE2A 4RGOS 5ELEA 1ENFA 2NTSA 2AQ3B 4L6TB 1SXTA 2IPKD 5D3IB 1EEFD 1M4VA 2R61A 1LTID 1D5XC 3MC0B 1AN8A 1KLUD 1XXGA 1F77A 1UUPA 1S5CD 1BCPC 1YN3A 3CHBD 4RHSA 1PZID 5FK9C 2CHBD 1GOZA 3O13A 3R2IA 5ELCA 4C56C 2Z8LA 3BVGA 3BYTB 3BVZA 2TSSA 5ELBA 4DXGA 1EFID 4OHJA 1T5XD 1DJRD 1CQVA 1CHQD 1HTLD 1FNVA 1JWUD 3R8BA 3SEBA 1RDPD
chains in the Genus database with same CATH superfamily
3Q22A 1LTSD 1WYDA 2KVMA 3A0JA 4E6IA 3GTGH 1E8WA 2LXAA 2PQAB 4PG3A 5HGTA 2VY3A 2WXPA 1N5WA 4KDLB 4G7OC 4X64L 4K7WA 2CFMA 2Z4HA 1GUOA 2OJWA 3VFKA 1YMHE 3APFA 1NTGA 4GNXB 3L4PA 3CF6E 4OWTB 3C8YA 4TV3A 3T4AC 4GLXA 2KMCA 1HNXL 3PS6A 1XMOL 4KHPL 2MJDA 2F0KA 1MJCA 3AH7A 3I63C 2A4ZA 4A3EB 3SE0A 1VQPA 2E74C 4R4IA 2B3AA 3TUOA 2E76C 3W5UB 1X32A 1D1IA 1WMHB 2V0GA 1G6JA 3MVVA 1MHHE 4TKNA 4L8JA 3RLFA 3T1HQ 4HJ7A 1FEHA 2BW2A 3OW7A 2UUCQ 2J0JA 4PS7A 2OOBB 3NK9A 3TRZA 4BBSB 3HVZA 1PA6A 3EJIA 4HCEA 4A93G 3P63A 5G5GA 2Z4IA 1Q0WB 4DK0A 1BCPB 1C4CA 2KJ6A 1SROA 3V3XA 4NAMA 1L0YB 3K5NA 1RAXA 5IOIA 2KFKA 4Q5VA 2BB6A 3KWLA 3DBSA 2UXBL 2E2DC 4DR4L 3PF4A 1RCVD 3DBHB 4FXCA 4U68A 2H1EA 3W1SC 3OWEB 1B1ZA 2K01A 1CSQA 3WAPA 5C4HA 3N6RA 3H1UA 4IWPA 2CQAA 3A9KB 4ANXA 3MXNB 2F0QA 2JA9A 4UHVA 1Y14B 4W9FA 3CCQA 3ZKJC 1QZEA 1WX8A 2FE8A 3N32A 4R3DA 3Q8BA 3RNCC 3OWFA 1WZ3A 3OMCA 4Z9CB 1KJTA 4A3IH 3PO3G 2AWTA 1F9QA 4FLHA 1K9MC 4IUMB 5C3WA 1W6KA 2VUMG 2UXCQ 2PMVA 2BYTA 3OW2A 3ETRA 4WWOA 1A3TA 3W3AA 2FAZA 4LF7Q 2IDYA 2L00B 4DR3Q 4FF2A 1RD9D 1GO3E 4K0KL 3L10B 4RGNA 4F87A 4HIKA 2A74C 4KX6B 1AYFA 1D5ZC 3FKIH 2IWHA 3X3NA 4PNYA 2D2CC 1JRUA 4ANVA 3VYSA 1VRAB 2QDBA 2WLBA 4JI1Q 5JOBA 1JWSD 4RM8A 2PO4A 5JJLA 1XF5L 3C3LA 5EJWA 1PQSA 2W54A 2RGFA 2XRSD 2WXIA 3J80c 2YU9B 2NZHA 2IGGA 3SVMA 2NPTB 1DOLA 2NTSA 2K1BA 2RHSB 4WJ4A 3NS8A 2QSDA 2KJXA 2DZIA 4DDID 2RR9A 1QQRA 3VYRA 3CIRB 1E0BA 3SK5A 1F77A 4CDCC 4ME3A 3KUPA 4OELB 5LMNL 1GOZA 3DEOA 1NI3A 3TL5A 2A1AA 5IWAL 3GTGB 2N7EA 1G6ZA 1U0LA 1PYSB 2WIIB 4EQNA 1MJDA 1UWMA 4HKQA 3MFYA 4BVUC 1WE7A 4B3MQ 2R7ZB 1KDCA 1VZ6A 3UGBB 1QVGA 2Z0EB 3KF6B 1BBXC 1ACCA 1WI0A 3AU5A 1RDPD 1A3VA 4HIMA 2RPQA 1YD8U 4AP4C 1L0XB 4PZ7A 4DN4M 1I5FA 4K5XA 2KC1A 1XPUA 2M2LA 1TVXA 2UU7A 1EQVA 1KHIA 4LUOA 1Z9FA 1SSOA 1EZ8A 2DGYA 2RDFA 3F2UA 4EVOA 2LRUA 4HVBA 4YTMB 3VTWA 3OG5A 2XWJB 4A93B 4AS1A 3GOEA 1QVFA 4LNOA 2OQKA 2ID0A 3RR5A 4P75A 3CRLC 4PMCA 1X3PA 1I4HA 4CYEA 1P8LA 4MHEA 2LMCA 2N9PC 1D7QA 2MBEA 1PH6A 3KK7A 2C7MB 3PZ7A 3CU7A 4A3CH 2Z9HA 3Q8DA 2XEWA 4LJOB 1A0IA 3QG1A 1GB4A 2E2HB 1BCPD 4GDLB 1K0RA 4FJVB 3QO2A 2KK8A 4CKCA 4M02A 4L5RC 5JEAH 2RSNA 4N8FA 2YTYA 4HTHA 5A35A 1S5BD 4IFDJ 1SNOA 3Q0AA 2CHWA 4JI8L 1UEAB 2WGSA 1I6VC 2Q2IA 2QCPX 1CZWA 1PTOF 5JEAG 3B1LX 1O7ZA 4YHHQ 1C0AA 2GRIA 4DK5A 1HNWL 5GQOA 5FLMH 3U52E 1PFMA 2EYFA 5FLXc 3U30A 1K3RA 1AWDA 2D3GA 1R4PB 1N34L 3Q3OC 4C3HH 1I4RA 4LFCQ 4DHZE 2INPE 1K3BC 2ZTCA 4NMZA 4IFDH 4YWMA 2FUHB 2R93H 2JA6B 1S1QB 5G2NA 4D2KA 4H13C 4OIKA 1D3ZA 2XN9C 2FMMA 5BN4A 1LT3D 4ARIA 1RFKA 4JI2Q 1EWCA 1TTNA 2CU3A 2RCNA 3PLUA 4MGYE 4YL8A 4FADA 5I4DA 1S5ED 1B70B 2X6GA 3H3VC 1H9MA 4ZDVA 1SFOB 1QJOA 1FNUA 3LWUA 1OQRA 3JVZX 3IXSA 1R4MB 1S4ZA 1HZ9A 1ET6A 4KD3A 2D3CA 3P20A 1EWHA 1PH1A 5BR8L 4N9PA 1TKEA 3NVVA 2HQLA 4KSKC 1GUWA 5GMVA 4LK1C 1NR2A 1KD1C 1A5RA 4YY3L 1ZE3D 3GV3A 4KN4C 3APDA 4RGOS 2R92H 4PZ6A 4WJWA 3PIPA 1YQ4B 3AB5A 3NXWA 4MM3B 4P1CC 2AQ3B 4NXNQ 2G5DA 3Q8AA 1GJXA 3NP8A 1HTOA 3HRZC 1PUTA 4NXML 3J9CA 3KDFB 4DV4Q 1LTID 3P4QB 4JWSC 3U7DA 2ONQA 1LXDA 3HOVG 1XXGA 1K53A 4JPSA 3VRAB 3BWUD 2V3SA 1TQOA 2R7ZH 4IZ8A 2EYMA 4QY7A 1SMYC 4XIGS 4N58A 3RNGC 3OHXC 4JK1C 1R9TH 4JGHB 4C56C 2Z8LA 3BVGA 5T1IA 1KF6B 2Q5WD 4EQOA 2RSUA 3EECA 2DZJA 3J7A5 1U5KA 1EYDA 3HOUH 4KTAA 2AX5A 4GKJQ 2PW9A 4FJYA 4LFCL 2YTXA 5C3EH 1WIAA 4GDKB 5IP4D 2Y3AA 3BINA 1PFBA 4UP9A 4ZKBB 1MHWC 1KXLA 1EZ6A 4BWGB 4DV1Q 3AEBB 2X6LA 2WU5B 4BBNC 1HZ6A 2UUAL 1X55A 3QOJA 4HAEA 1STHA 1PXUA 3I70A 4C3HB 2CJNA 2B2UA 2OEDA 3PUXA 3K7AH 2C60A 2GBNA 1BDOA 1XNQQ 3P1HA 5IYCG 3K58A 2PJHA 1ISNA 3MEHA 2MGSA 3HOWH 5I9PA 2HTME 1HH2P 5M3MG 2ZZPB 1TS3A 2OHFA 2NTTA 2MP1A 1IGCA 4GXBA 4RWSC 4KGSA 3WAMA 4YXDB 4E3CA 4KD4A 2B2WA 2QILA 3AE6B 1IBLL 4OVVA 1YNNC 3KF8A 1GKHA 2F0GA 2SNMA 5C0XI 3J7ZC 1G6PA 1MHXA 2LUMA 4PS3A 2KHSA 5E6NA 2EXZA 2WAQG 4XDXA 1EF5A 2LZ6A 3H8HA 3C2PA 3D0FA 4JI6L 4A3KH 4NJ6A 2I2YA 4LMQD 2NVYB 1AH9A 2OF1A 1GNUA 1B3AA 2HTHA 1GUNA 3Q23A 3I90A 1LT4D 2JXMB 2Y0SG 3J80L 2GB1A 1B53A 2QIEB 2LGSA 1EM7A 2JZ3B 4BKSD 4BKGA 4RAUC 4BY1H 1SNPA 4NDXA 3I73A 2B39A 1TY0A 2RCFA 5JJIA 1KM7A 3TEYA 1C4AA 1FYCA 4HJ5A 4DR1L 5FLMG 1GJZA 2F0HA 4A3DB 4PZ8A 1P3QU 4W9KA 3VDZA 1SRUA 3QB3A 4CJ0B 4B3ML 3S17B 3FKYA 4IJHA 4NZLB 1T5EA 5FR6A 3DWMA 3RZFA 1E22A 3NVZA 4AIMA 2N78A 1YZ6A 5IP9H 4BBRB 1IBXA 2PMZB 2XBBC 3JYUA 3A9JA 4ZYNA 4TQ1A 2DNFA 4ZKCB 3VUXA 2OEOA 4W9LA 1E1OA 1I4GA 4EKUA 3VRBB 3CCVA 3L0OA 1P1AA 3EFCA 4YT0B 4HEDA 2F0NA 3HM6X 3J81L 2R2QA 4MNOA 1PRTD 2O2LD 2WXMA 4KN7C 1B8AA 5EE0A 3WA0A 3U50C 3S2AA 2LXJA 2NVTH 4PS8A 2KNBA 3T53B 2G4SA 3NZUA 1L1OB 2DHZA 2NPTA 1SNDA 3TEHB 3R7RA 2JEAI 1WMHA 2RVLA 2D5GA 1Q1BA 3HKSA 3TEXA 3QR8A 4DHJB 3HKZE 3MC0B 2MRPA 2YEPF 4WORA 2KHIA 2BWFA 1UE7A 4LF7L 2F3VA 2JXXA 3C19A 4DK1A 4LJPB 1OXUA 2CW0C 3ERSX 3K0YA 1UD7A 1XLOA 1VMCA 3BS1A 4MIUA 1PH5A 1V2YA 2RDBC 4HROA 1B9NA 2K5HA 3O13A 5IGBA 4ACFA 2WAQB 2L9HA 3VTUA 2NWGA 2ZXOA 2C9OA 3NZ3A 2LGIA 2WXFA 1GG3A 2KQ3A 4ILWA 4WJOA 3KVFB 3EIVA 4B3RL 2IL8A 1ZOYB 1EOVA 2VB3X 2CKZB 1J0GA 1PTOD 1ASZA 2QEJC 4B0MA 3ZW3A 1H9SA 1EO6A 4AQYL 3LDZE 3AEAB 4XYCA 4DNTB 4KJNA 1FIQA 4MEMA 1HNZQ 4XDCA 4J1MA 5CGKA 2VZKD 1Q90A 1E3PA 3SK8A 4POFA 2ZCCA 2LJ5A 3DVNU 1LTAD 2LKVA 4PMBA 1ONLA 1RJTA 3NQIA 1E7VA 2GBRA 3OAWA 4PT5A 1YEZA 3J81E 4C7YA 2EYLA 4S0RA 3KF6A 3J7YW 4A20A 1IZ6A 3M3YH 1HA6A 2KMMA 1PH3A 3RNEC 3I4MB 1ESRA 1Q10A 2KLGA 2F0PA 4LK0M 3S2DH 4FJZA 4W9DA 4K5WA 2OT2A 3KLSA 4NY0A 4FA6A 1LACA 2AQ2B 4OO1H 2PI2A 4LW1A 4A3GB 1XMOQ 5DPWA 3DWAA 2K7VA 2ICEC 3B08A 3F2CA 1WTVA 4MJSB 3K9PB 1V5TA 1J5EL 1CKNA 3ONAB 5CV9A 4DR5Q 1TJEA 3AU4A 1EIFA 1OFFA 4HWIB 2M1MA 1LV9A 1YJJA 1O7LA 3GTKH 1RF2D 1TT5B 4APVA 4BA1I 4YSYB 2CVRA 3RN9C 1KABA 1IYJB 3A74A 2L83A 3RULA 2FCNA 3CW2C 4ODGA 4FP5D 4KGRA 1TU2B 4EEWA 3K9OB 3D4RA 3KW5B 5DPRA 4P72A 2J0TD 1MI0A 1WRDB 2MJEA 1QG7A 3RCZA 1X6OA 4OZBA 1Y1WH 2HDEA 1IL2A 3NEMA 1VQBA 1PFDA 3ZVVA 1K0SA 1SB3C 2WU2B 5JZEB 3V61A 4IURA 3T13A 5E6OA 1MI2A 2JQRB 1EIYB 1I4QA 2F1MA 3DDCB 3LJ3A 3A4SC 4HDOA 4WWMA 2JA6G 4FDBA 4M0WB 3TMPB 3SHQA 2L7RA 4ZAIA 2FHTA 4UPAA 2D3BA 5AJ3Q 2J7ZA 5IP7H 1HZ5A 2IBIB 4RF1A 1FXIA 3AE8B 2QKIC 2E2JB 2I1JA 2F0IA 1SSNA 1FJGQ 2KDIA 3BG3A 1NYRA 1WZ0A 3VQIA 3NE5B 5TSSA 2JSVX 1C1YB 2BOSA 1TWHB 1I94Q 3X23A 3JAMc 1FD6A 3H6MA 4C4VB 2CCZA 1I7HA 3VH3B 3CCUA 2GLSA 2H89B 5BO4B 4JC0A 4ANWA 4BZAA 3U4ZA 3AM9A 1K83B 5M5XB 3PUWA 2KCMA 3CKIB 3KF8B 3NTKA 4ULLA 1RM6C 2JPHA 4II2B 2BKRB 5G3LD 2KA7A 1KOTA 4R4OA 3BYTB 4V0BA 1WGHA 5G55A 3VR6A 1EFID 4WIPA 1VQ6A 4RG1A 4KK7A 3Q8FA 5LL6X 2K25A 4IUVA 3HOVB 3FPPA 3IKJA 1MG4A 1QUQB 3ZUNA 5E4XA 3NBHA 3PZDA 4DBGA 2F0MA 1JB3A 2L15A 4JYAQ 2L8JA 4KDIC 4K7SA 2K5QA 4AQYQ 4B0EA 2ON8A 2ZNVC 3G6JB 2N9EB 2JK8A 1JCKB 1AZQA 4CGYB 4A3BB 2WXOA 4WRDA 4YCUA 4JYAL 3ML8A 2WWZA 3MA2B 1TGZB 1Z47A 4B9XA 2AQ1B 5DPSA 4WJ3M 5J39A 1FD7D 3ZRCA 3GTOH 1YJ1A 5LMNW 4WWNA 4OONA 3PUZA 2O6VB 4HMJA 5D94A 1FVIA 1PGAA 4I7ZC 3QWNA 2HD3A 5CR3A 1K51A 1C3TA 1K8MA 1MFWA 3V96A 3I91A 2AEHA 4DV0Q 4US8A 4MTKA 1HR0Q 1VQNA 4CKBA 1IBML 4K2KA 1I4XA 3DWPA 5C44B 1GB1A 2JUOA 5LXHA 2LUEA 1EU4A 4KI0A 1IYFA 1JORA 1WM3A 1UGMA 2IX0A 3BK2A 2O6VA 2KDFB 1LTLA 2BH8A 1DXMA 4J6HA 1HE8A 1WY8A 2E2JH 3Q8EA 3TP6A 2I5MX 4IC7B 4WAAA 4BBNF 4ALPA 3E9IA 4F7XA 3UQBA 1U4RA 3TS2A 3RNUA 3FHWA 4ZRQA 3R66C 3M9BA 2EMTA 4AYBB 2MO0A 3GTJB 4I6PA 4DQOC 2K5WA 5E6PA 3UQAA 1GUAB 5BYSA 4GU2A 3HVDA 1JWMD 3NTIA 3MXGA 4C2MB 2IW3A 2HT1A 2ZW1A 1C9OA 3FILB 3I56A 3GS2A 2A69D 5D65A 1N6ZA 1PRTC 2BDNA 1EOTA 4C3JB 3S1MH 2WV6D 1E8YA 2ZNVB 5IT9c 3QIJA 1CM9A 1CKNB 3CP0A 3PF5A 4MJSA 3JSVA 3GE3C 3PV1A 1LT5D 3I4LA 2PEAA 1QLBB 4NB3A 1ML0D 4BBSH 2MJ3A 2V3NA 2L05A 4A3IG 4RCOA 1TXYA 1XYIA 4DR6L 2WXLA 3IHPC 1X56A 5IYBH 3CWIA 4LNQA 1STBA 3U58A 4IOIE 1ZDXA 2LY7A 3ZJUA 2JA7B 3RI7C 2KMAA 3C0RB 4HJKA 1TWFH 5CV4A 2WB1B 1J5EQ 2J0MA 3DLLA 3UDIA 3ULLA 1RLFA 3MXPA 1EU3A 5LMUQ 3DVGY 2JYOA 2JYTA 1DGSA 3QOLA 4XTCS 1T0QC 3IFWB 3N1YC 1V8QA 4QGUA 2QA4A 1VQ7A 2G4DB 2V1YA 2IO1B 1H4RA 4E74A 3IAYA 5CTRC 3VUWA 4NW2A 2KXJA 3CMMB 1EIGA 1XPRA 3PSIA 2JY6A 3NVYA 4K2LA 3WALA 3I8ZA 4OXPA 3M7NA 1C79A 2ZVNA 2C9WB 3H7PB 1TWAB 4JW0A 4IUQA 4KY6A 3C1FA 4MDKE 3U4EG 1S72A 3AEDB 3L16A 4P71A 1Q1EA 4ICVA 4PMWA 3R2IA 4GKKL 2QJLA 2L12A 1KC8C 1ICWA 4M1UB 1WM2A 4Q2JA 5BN5A 4HJ9A 2L0CA 2Q2UA 1EQTA 1SYGA 1Q86C 3Q6BA 3ZNHB 1JWAD 2J42A 1YHAA 1UBQA 3F1ZA 3F2DA 2EYHA 4JI3L 5FKAC 5G3LF 5IY0A 2KJRA 2YEPB 1RKNA 1MSGA 1L6UA 3K5MA 2O2VB 4DV1L 1QNUA 5M5WH 1IL8A 2HCIA 5C0XH 1WSPA 3DHHC 4HIDA 2UU9Q 2WDQB 5L95C 3SXHA 2XK5B 5C44G 1E8ZA 1YN4A 4CDDC 3A7LA 2D5DA 3NHEB 3TSSA 3MEFA 4A90A 3H7SA 3TQYA 1YJNA 1LGRA 3UF8A 3MTSA 2G9HD 2BH2A 3PO3H 2B76B 5EKLA 4KMUC 3T16A 1XD3B 3AE9B 3ZIMA 2SEBD 2P5ZX 4IG7B 4BFRA 2WXKA 2OCEA 1WJ4A 3RNAC 1XEEA 2L76A 3AYHB 1WVLA 3A1QA 2HHHL 2A5HA 1U4LA 4IQZA 4C2MH 4EOYA 5DM73 1WTHA 5AFWA 3ICEA 3DHGC 4BY7G 4NP5A 3T1YL 3FKIG 2MH7A 3LB8C 5BR8Q 4P16A 3VR8B 4JI5L 4JVZA 3MFGA 1DOIA 4JBMA 1G91A 4F88A 3DBRI 3AE1B 2EYJA 3ZDMC 3VR4A 2B2TA 4OVUA 4DHZB 5G5HA 4A3GG 1JOQA 5I6WA 2AWOA 1BQQT 2N7DA 3S9WA 2BS4B 3GTMB 3VHTC 5C2TB 3GD7A 1FR3A 2L1BA 5M3FH 4JOIA 1F2LA 3VUYA 2A73B 1IP9A 3TREA 2DYBA 4G7ZC 1NMFA 2G9DA 3M62B 3TMEA 2MBOA 4JIOU 1RTNA 4RH6A 2B2VC 4X6AH 2H4OA 4O1NA 3URYA 3S1RH 1UH6A 1N34Q 1WX7A 3QA8A 5MPOA 3T56B 4K1RB 1EIHA 2K75A 2KQ4X 4YWLA 4CJ1B 1N9WA 1QNKA 4JI8Q 2QEXA 1K28A 1B3QA 2D0OA 2IZVB 1L1OC 4JI6Q 2C7HA 1NAPA 3T51B 3ZYYX 1SE2A 1E90A 1ENFA 1E9MA 4JOIC 4L6TB 2ZCBA 3ABVB 1EQQA 2AL3A 1NBWA 2LI5A 3ONSA 4MACA 3K81C 2ATWA 3RZWC 2VNUD 1AFPA 1B50A 1S5CD 1DONA 2PIAA 3QC8B 4AOFA 3AECB 1SNQA 1WI5A 2WKDA 3RZDH 4GOPC 3BVZA 1VR9A 4KIKB 3EQLC 3TP8A 4A3MB 1NE3A 1SF0A 4ICUA 1ZYRD 4IM2A 1ZPSA 1SYEA 4XZ4A 3R7QA 4X62L 3WAOA 5KYLA 4L5QA 1T9HA 2NS5A 3CSFA 4G57A 4OIJA 4A75A 3A4RA 2M4NA 2MPMA 5J3BA 2VRRB 4IJLA 2W3SA 3T9LA 2AUJD 2NVUI 5FLXL 2VZAA 3KUDB 1V1PA 2PI2E 1VQHA 1Q8KA 5M5YB 1QOHA 1SIFA 2ZW0A 3FMCA 3GTMH 3TP5A 1N33L 4IW0A 1GXDC 2EZVA 3ERQA 3CMEA 1CZPA 4UDUC 1O7YA 1EWIA 5D14A 1CI3M 4WFN3 3HOWG 4X3UA 4QIWB 2DLBA 4FNFA 4HPLB 1V1PB 3E3XA 5C4ZA 5CBAE 3S14H 4BY7H 1H95A 1ZDVA 5JJZA 5EE1A 4W9EA 5JXVA 2VL6A 4RM9A 1L4ZB 4URKA 4BBRG 4A76A 1CT1D 1WFQA 4MSMB 5LHY1 3LXFA 4DNIA 2XIWA 2JA8H 2YYZA 5EPJA 4NXMQ 2V9HA 3QHTA 4L23A 2MA9B 1E5WA 4DAYB 5NUCA 4HMIA 2C5LC 2A68D 4XX5A 3I3CA 3VTVA 1WR6E 2R2OA 2LASA 5FR3A 4LDTB 1OXSC 4LNFA 1PTOH 3V05A 3DUZA 3EUB2 1C8CA 1UE6A 1GC7A 5DNFA 1ZUD2 1QUQA 5J2RA 5E1FA 4K8JA 4R9WA 1GUSA 2E75C 2FCQA 2KOXA 4DHJD 1YX6B 1Y56A 3IAM1 3NG0A 3BDLA 4XQQA 4WQMA 4A3FG 2PPBC 4JG2A 1WF9A 2L0TA 5IO9A 2RMMA 2O5IC 5C4XG 3ZJVA 2VS1A 1SIJA 1E2ZA 1JR0D 2K5NA 4XQNA 3G71A 4A3JB 2BF8B 2AYOB 2ZM6Q 4A3EG 1IBKL 3TP7A 1UE5A 2DWQA 2UXCL 1W6JA 2D0PA 1HNZL 2KDEB 2BS3B 4G11A 4TQ0A 1PYBA 3PIP3 1S5DD 1LTTD 1STGA 3M4OH 2N9KA 4MT5A 5ELFA 1KTKA 3HP3A 1YIJA 2UU9L 2X8XX 3ZXVA 3M3JA 5CV7A 3OSOA 2AMCB 3SK4A 2CR5A 1JROA 2JZZA 3KH0A 1VQGA 4MSQB 3M4YA 3JAMi 1LTRD 1HNWQ 5I2YA 4OW0A 4CDFC 4X3TA 4IUNA 3N3KB 4A3IB 4DA2A 3S2DB 3SFDB 3PZ8A 4KV6A 1Z7TA 1A15A 1A3UA 3A8IE 1J8IA 3OMGA 1V1QA 2N55A 4IFDI 3B0AA 3L54A 1H9KA 1IBKQ 3AMUA 2EELA 4BS9A 4EFOA 3S14B 4IOAA 2KCCA 2IO0B 2PNHA 3N30A 1NEKB 4V190 1F1HA 2FCMA 2GI9A 2MQJA 3ZGZA 3VDYA 5C0XG 4EE2A 4A3MG 3RZDB 3X3MA 4GOCA 3S17H 1VCIA 3E5SA 4NPSA 4JCVE 3PGEA 4GN1A 5IE8A 3NUHB 4G4KA 2OJRA 1A6XA 2LFNA 2CHBD 2M17A 1LFDA 5D7GA 2N0SB 2HD5B 1FFVA 2NR2A 4QB4A 3O65B 1DJRD 5ELOA 4LNKA 5LMUL 3KUZA 5EBDA 5DEHA 2DNCA 4EQ5A 4FF3A 4NNJB 1HPCA 3WOFA 3NHHA 4OL7A 3HOWB 1G2TA 2MSED 2KCNA 1V9PA 3AU7A 3DHIC 2PVGC 4B3TL 4US9A 3Q69A 1QZHA 2NVTB 3RT3B 1RFAA 4NQKE 4GS3A 3A54A 2XSCA 5DCNA 3PUYA 1IW7C 2F0WA 4QIWE 2JXTA 4LNNA 4ZUIA 2KANA 2BCOA 5C3JB 3NWSA 3Q3NC 3PCOB 1TYGB 3HOUG 1SYCA 2KN4A 1ZKHA 3VR5A 3ML9A 1N33Q 1J8CA 2LVPA 4DV6Q 5LMNQ 5JVG3 4MGIE 3HKZG 5GAEC 2R6GA 1CK1A 1CZGA 1PH7A 1VQJA 1SYBA 3HGBA 4IPCA 1JJ2A 2NN6I 1WJUA 1N60A 4A3KB 2F4IA 4K6LA 2NZOA 2DX5B 3N1ZC 2JA5G 3RMKC 1MGSA 4RMAA 3OJ4B 2QC8A 4LF9Q 1V6EA 4A3FB 4DXAB 2PPHA 2LXCA 3R2TA 1MD2D 1LLRD 2XTIA 3L0WB 5JJKA 1D8LA 1TBEA 5C4XB 2LWPA 2M00A 2WYQA 1QB5D 2F0TA 4JBWA 2K14A 1XNRL 3GTLH 4TUUA 4DFAA 4HEA1 3NOBA 3ALBA 2OXPA 4IUTA 1KNAA 5CHWA 1NUCA 5CHVC 4A3BH 4DV0L 1ENCA 3M4OB 1R4NB 1PFSA 3IVFA 3VVWB 2K52A 3DWQA 2KWUB 1UEBA 2B63G 3P42A 1JICA 2NBFA 1G51A 1VDVA 3AEEB 4NAWB 4TKOB 3I4MH 4TSSA 5C6AA 4WJNA 2R7ZG 2F0FA 1VLBA 3K59A 4W9GA 4IWQA 1HUMA 3AEVA 4A3DG 1BCPF 1LTGD 3E9HA 3I2ZA 4PV1C 1S40A 2WDRB 3AEGB 1KNEA 2NMQA 1PZJD 2N4FA 3MHSD 2WXHA 1DOMA 2J53A 4GKJL 4NAWA 4JI7Q 3ECIA 3GQBA 3PRMB 5T8IA 3R3OA 3TEZA 3KLRA 2LVQA 5IGEA 2UXBQ 1V49A 2ZM6L 2A5UA 3DQVA 4EX5A 3FRPB 1N8RC 3I4NB 3HOUB 3ZTDA 2EJFC 2LGDA 3HG9A 4P6VF 4Y52H 2SNSA 4LNIA 2K6DB 2C5CA 4NXNL 1YNJC 2K22A 3ND8A 5EQ0A 2KOLA 3LWEA 3T1YQ 1J7BA 5JEAJ 1MPEA 3K7AB 1NYQA 4QJFA 2EYOA 1P7EA 2UUBQ 2N7JA 4KJOA 2L5TA 5ISRA 1T0YA 2DAFA 4DDGD 1T0RC 3HZXA 1HRJA 5AZGA 5IYDH 3VYUA 2R92B 5KRUA 1FNVA 1DZ1A 1L6VA 1WFYA 1LQBA 4PYZA 3IRBA 3OJ3A 1GUTA 3W9CB 2KTRA 3W1SA 1RL2A 3TDQA 4XYQA 5AJ3L 1M90C 2ZXRA 1SE3A 3L2PA 2NVXH 4X64Q 4CHKA 4Q0FA 1K8GA 3DVGX 2KN5A 4HCNB 3OIPA 5H92C 3HKZB 4ZYSA 2HCCA 4JX1C 3WIMA 3LYYA 1KAAA 4JI2L 2DYOA 1DOYA 1DCZA 1HXYD 5GAGC 1BUIC 1X3FA 4Y7NB 1LYLA 2JA5B 1STAA 1VF5C 4HIOA 3PO2G 2OQ0A 3D6CA 4RFBA 1WX9A 2X38A 1STNA 3DM1A 4RCNA 1TWCB 4X65L 3KUCB 3MTNB 3U8ZA 3QWZB 2K0PA 1KLVA 2CHXA 3M4PA 2AHOB 2EJGC 2L55A 2CQOA 1WJ6A 5EE3A 2N9LA 5IT9L 4ABNA 1TZ1A 3RUZA 1WGKA 2L11A 5CBEE 1N61A 1HCZA 2IY0B 3PHWB 5BN3A 1IKMA 1VJKA 4IPGA 4AH6A 3H91A 3CXCA 3FILA 3V6CB 2VH1A 1PRTB 1Y8PB 2ALYB 3MHBA 2JRIB 1SEBD 3GTKB 1ESFA 1EL0A 4AYBE 3I4MG 3P4SB 1NSNS 4ZRPA 1XLPA 4XT1B 4DUZQ 5CMDA 3I4NG 4FBJB 2R7FA 3CCEA 1F52A 2PVOD 1OEYJ 3GE8C 3GTPB 1DGJA 2MEKA 3IG3A 3Q3FA 4REZA 1HHVA 2W82A 3GTOB 3BDCA 2KKCA 4HDQA 4DK3C 4KV2A 1S3SG 5H1SE 1V5OA 1VQ9A 2GVBA 1DYQA 4DWFA 2F0JA 3AB9A 4C7ZA 4W9CA 3H94A 2I1KA 1SMYD 3PRZA 1STYA 2LRWA 4HLEA 4ID6A 2R93G 4XE0A 1WYGA 5FJ8G 5K36G 4RGMA 4B9WA 4RGTA 5IGCA 1WJNA 4EZLA 2LD9A 2WX1A 1SJHD 4IN3A 5C3XA 2KAJA 3AV8A 1EY9A 4A3DH 3RNBC 2F4VL 1JMCA 2GBMA 1YNND 4WURA 1NNXA 2IHFA 3DPDA 3A1QB 4H0LC 4K14A 1VQ4A 3FVQA 2E5LQ 3AMZA 3E0JA 2I0QA 2PZTA 4O42A 1YI2A 4KSLC 1TWCH 1EYCA 3M7GA 1L5PA 3AN1A 5IKCM 4ME5A 2IY1B 4F8CB 2JQOA 2F3IA 2Y5PA 3HUIA 1E10A 1JQ4A 1FCCC 5D3IB 3S1MB 1EQRA 4ZK9B 4DV3L 4LDTD 4A3LG 2R92G 1TKWB 3NRZA 1DOKA 4UP8A 4JI5Q 2PZWA 3OPOA 4LF4Q 2ASBA 2F52A 5CHFA 2Z1CA 3NWTA 4FF4A 3ZLZA 4DV7Q 3QJZA 1VQEA 3JSVB 2BE5C 3UE0A 3K0XA 4H2AA 5ELBA 4R4QA 1HTQA 2MX2A 2ZTDA 3KJOA 1RODA 1L2FA 4RKLA 5LNK1 1CHQD 1LABA 2AKWB 1KDAA 1SR3A 3SEBA 2PTLA 4MH0E 3L08A 3ULPA 1FM0D 1JC7A 4ANUA 5IN7A 1V8CA 3KJPA 2FJ2A 3RFZB 1KRHA 1NR4A 1IBMQ 1P98A 4QQBX 1J9OA 3N1XC 1X65A 4CDEC 1PMRA 1GM5A 1FXAA 1N63A 2BYFA 2W9NA 1N32Q 1SLJA 1WTPA 3HEJA 3KYDD 1BT0A 2KYWA 2NBWB 4JI4L 4DR2L 2ZPNA 2K05A 3OTOL 4PQXA 3CMAA 1P9DU 4H02A 2BTEA 1WTXA 1V80A 3RLOA 3VR2A 2AWNA 2OTLA 4M01A 2R93B 2M0XA 1SBBB 2F4VQ 4FXGC 3DOWA 4K6DA 3A56A 4JI3Q 3P4PB 1VQLA 3ZTCA 3Q3MC 4BY1G 1ZXHA 1S3OA 1AZPA 1ZYRC 3HOYB 3DWGC 1SJED 4L5SA 5KEEA 3BVMA 4NKLA 3WDNA 2EE1A 1I42A 1EUVB 3CC4A 1D2BA 2WXGA 3AE7B 4N9TA 1Y69U 3Q8CA 2EY5A 4QUFA 3G6EA 4A3KG 4ITKA 3RNFC 4EGVA 1C9FA 2A19A 2QGQA 4C1NI 5EE9A 1Y1VG 1Y1WB 3PRPB 5JAVA 1YNTE 2D10A 3SHLA 3CC7A 1KFYB 5M3MH 5J17A 1XWEA 3NPPA 1YOVB 1V97A 3T1HL 4F7ZA 5BMHA 2MLBA 2M19A 4DUZL 1N62A 2NUCA 1F9SA 5M9OA 1EY4A 3EA6A 2VQEL 1KL9A 5ELDA 3SR6A 1V43A 1TY2A 3SDZA 1BUVT 1I50H 1WXSA 1I6HH 2IY5B 2IO2B 3ZNZB 2ZJPA 2Y0SE 3OIQA 3W2DA 4B9KA 5BMIA 2PNRC 2W55A 1YITA 4XC2A 2CWPA 4J8QA 1FL0A 1QVCA 4FHKA 4C3JG 2Y5CA 2E2HH 3NS1A 1VQ5A 4P2CB 4WQOB 4GZYC 2BS2B 4GNXC 1KDBA 3D4DA 4U673 1K83H 5M5XH 3S16B 1R7SA 2A69C 1PV4A 2WDVB 5COYA 2RA4A 4LF8L 1E8XA 1XPOA 2K1FA 2EY6A 5IP7G 1PTOB 3DMUA 4WAFA 1HQRD 5IT9E 2FIFA 4DR7Q 3PLVA 2V4IB 4JQWC 1Q82C 3VR3A 4MM3A 3ZNID 3S1QB 1WTRA 1X9NA 2Q8RE 1M4VA 3J80i 2UWQA 1RHPA 5CX3A 4H7BA 3NTHA 4QUCA 3U4VA 1KIXA 1AN8A 1FGUA 1KLUD 2ZXPA 4OWWB 2K50A 2JA6H 3GZNI 2MFIA 4ZQ3A 5KNBA 5GADC 4DR5L 1OTCA 1NDDA 2MBHA 4DV4L 5JHBA 2LJIA 2DZMA 1A70A 4IALA 1WD1A 1UZXB 2TSSA 2WDTB 1O80A 4WWPA 2GBKA 1C4PA 2Q8IB 1MVKA 3D31A 5E4WC 1YJ9A 3IAS1 3S15H 2UUBL 2MUYA 3G7LA 1UBIA 1SMXA 2DN8A 2WXJA 4OZCA 5J18A 2V4LA 3EVQA 1F2MA 1QF6A 5M3MB 2NVYH 1PLFA 2D9UA 3C46A 4CKEA 1VZ7A 1W2BA 1ZGUB 2BPSA 2D3AA 2I38A 3QK0A 5LXIB 2HDMA 2XWBB 3E6ZX 2KC2A 3ND9A 1QOAA 1H9JA 1Q81C 4DV5L 1NI2A 1XLNA 3ZNGC 2WS3B 3CAMA 4BY1B 4LJZC 1VS0A 2DNEA 1TKGA 1BBWA 3PO3B 1TWGB 5IYDG 4OO1G 1CSPA 5AZFA 4JV5L 4DK6C 2VUMB 4ZUJA 5L37A 1ROEA 4C3HG 2PW5A 5E3FA 1Y1VH 3UI2A 5I6YA 1YBYA 1J6QA 1ZKOA 2CKHB 3DBLI 1EFWA 4HKZE 3RUIB 1WXQA 1BOSA 1SE8A 4RA8A 3H15A 3D32A 3A9JB 1WRIA 1NVID 3VH4B 1F0ZA 4DAMA 1V1OA 3SR1A 3I55A 4B3RQ 1PZKD 4DAYA 2CJOA 2L32A 2LGYA 3LNNA 1BXTA 2TMPA 2NVQH 3OTOQ 4LFBL 2GBJA 4W9IA 3KDFA 3HM3A 3V2TA 1UWXA 1JE4A 3KYHC 1B9RA 5IODA 2IGDA 3UDXA 4C3IH 2MHVA 3S1QH 1BNZA 2INCC 4EUTA 1XCQL 4LFAL 2JZPA 1WGRA 2VW9A 1Z2MA 2KWCA 4BOZB 4L5TA 1H9SB 2B2UC 1QZGA 2KDMA 2K33A 2L3ZA 3IBEA 2XNAC 5M3FB 3SK6A 3GTQH 1CQFA 2N8NA 4B6WA 1WCMG 2A6ED 3D6WA 3J81c 4IPDA 4R4TA 1JW9D 1SDFA 1QOBA 1LT6D 3H6NA 2K28A 1XCTL 5L83A 2PLPA 5EAYA 1I94L 2MCNB 2G1EA 1Q8IA 2Y0SB 2HDLA 5I2XA 4IOCA 1VQMA 4HN7A 4R4CA 3S2HB 1HUNA 1FXTB 2DYMA 4I7AA 3STBD 1FJGL 4L2YA 2RQXA 5IAAC 2SOBA 2XRQD 3A9KA 3NZSA 4A9AA 2B2WC 2UXDQ 2KEEA 5DLQE 2WACA 3GTJH 4LF4L 2NYZD 2RDGA 2WXQA 1LTBD 5IIFA 1L0VB 4HSPA 1HZAA 2DJFC 4LF9L 4QMGA 2K39A 5IYBG 2KX0A 5EDSA 4HCPB 4M8AA 2EY1A 1YN5A 1IPGA 2N1VA 5LLIA 3AFPA 4G0NB 3EFXD 5I9OA 3PIOA 3OYYA 2KHJA 1PYWD 2B29A 2E6XA 4UAIA 1D6EC 4YIJA 2I07B 2E5LL 1E2VA 4HXDA 4IWOA 5BYRA 1Z5SB 1RTOA 4DR1Q 3GTLB 1SXTA 2R3ZA 3ZDTA 3QARA 4GNXA 1K8OA 4B3TQ 2RHQB 3I4OA 4HR7B 1JE5A 3J81j 2BDOA 2ZPYA 3DBRB 4A3MH 1UWVA 1TWFB 1SN8A 4OWXB 4DKAC 1AARA 2SAKA 1U4MA 1EY5A 5M5WB 4J15A 1YJWA 4CQNA 2KX3A 4QL5A 2A6EC 4LF5Q 2B8GA 2VZKB 2K4KA 1ILPA 2NB0A 1FPYA 2YU9H 1B4OA 3VA7A 1VCBA 2K03A 1C4QA 1JWUD 2BA0A 2MNAA 4P1BC 1SGHA 2DUDA 1JOKA 4JI1L 2EYPA 5C0XJ 1FNWA 2YVCA 4LWCA 2JA7G 5HI1A 2Q8TA 2KD0A 1Y8OB 4JL9A 3K57A 1TWGH 4YWKA 2KVZA 3D3RA 2FXQA 3FAHA 4K0KQ 4CO7A 1P16A 3H7PA 3QIAA 2RDHA 3I5JC 3D8GA 4M8NA 2EPBA 2K9XA 1U4PA 4MGZE 5GAHC 2LGXA 5BYQA 1JJGA 3TBIB 1V81A 2RPVA 2IGHA 3AE2B 3PT2B 1VQCA 2BT6A 5HG2A 2OTJA 4ZHPA 5HFYA 2K5VA 2NVQB 3HOXG 1FRRA 4A3EH 1KH0A 2GA4B 2DBYA 1OQQA 3AE4B 4RNAA 2Z6KC 3HFZB 1PH9A 1GHKA 4AJWA 1E0ZA 3DM3A 4LTUA 2CH4A 3W5OA 4A93H 5FJ8H 1WOCA 5K36H 5EKKA 1Q5WB 1WE6A 1ZW7A 1WCMB 2C35B 2G45B 1R4QB 1C76A 1Q7YC 4DR4Q 3RZOB 1E7UA 4HJ8A 1HR0W 4P74A 3A5UA 1YHQA 3DCGA 3KOJA 1CTMA 3SGIA 4MTNA 4B3SQ 4A3JH 2WX0A 3S2HH 2CH4W 1UGJA 2NVXB 4RMFA 5E7NA 2K32A 1HEZE 2K6AA 3PIO3 4GDKA 1IYVA 4FYDA 2UUCL 3KBGA 4GIVA 2KDBA 3Q3JA 1QCBD 2VXWA 1BO0A 1MIUA 3KBXA 4DF7A 4YY3Q 4WJQA 4IFDG 2B2YC 4OZAA 1FO4A 3RD2A 2BYEA 3WOEA 3GP7A 3V60A 3MHZA 1L2NA 2KECA 3IT4B 4BA2I 3ZJYC 2PCFB 1U9RA 1JWBD 1TZOA 2Z0SA 1XX8A 4KHVA 3Q14C 3NQTA 1HFNA 2WNMA 2JN4A 4C3IG 5IGGA 2WFWA 5IGDA 4BOSC 4ZOHC 2FINB 3MXNA 2J4XA 4HCSA 1R9TB 2QDFA 4K7UA 4N6EB 2D11A 2MP2A 4X66L 2W3RA 4TVAB 3PO2B 3FKIB 4JI7L 3RPFC 2EKEC 1JMLA 5IP9G 2BB5A 2DJGC 4LUVA 1YQBA 4OVZA 3EROA 1MBYA 1YNJD 1SFOH 3VXWA 1H8CA 2C7NB 3AE3B 1I3QH 4JI0L 2WP8J 4M00A 5IOCA 2K04A 3KLWA 2WINB 1T0SC 1F9PA 2BQQA 4RHSA 4YHHL 4EZKA 3L7ZC 1N5XA 5M5YH 1D1KA 2B2TC 5ELCA 3U9OA 4A8XC 1ZP0B 1CA5A 4ZCKA 4OHJA 1K50A 2KEDA 2E2IH 4M8MA 3W1YA 4YCVA 1YJIA 3BZCA 2JRHA 2O6VD 1MSHA 5JPNC 1F2ZA 3R8BA 3NBHB 4XT3B 2A8VA 4BY7B 1I35A 3Q2AC 1X3EA 4IKGA 4BXXG 3G4SA 5DM63 1IHZA 4HPMB 1IYUA 1YX5B 1GVPA 3RN2A 1WJJA 2IO3B 3ITPA 1J7CA 2QF7A 4TQUS 1WR1A 3TZDA 3CSTA 2IT1A 3JC66 3DBLB 3HOXB 1NBFC 4HK2A 2KHWB 2K5DA 3PVLA 2PZUA 1YHBA 1JQYD 2PQEA 3VR9B 3A5ZB 2K8CA 3C1EA 1XNQL 3EC8A 2R7DA 2KVRA 2JSOA 1Y8NB 4DAVA 2X69A 4C4VA 3K6OA 3BZDB 4A3BG 1J19A 5HURA 2DZKA 3KQ4A 4POGA 2UUAQ 2ASQA 3E9SA 2KJHB 4JPBW 2KFJA 3FEWX 4K81A 5EPKA 3RZOH 4M0WA 4DV6L 2A6HD 1P0RA 3AQQA 3HHMA 3NJTA 1DOXA 1DM0B 1VQDA 2SDFA 2CS4A 2M9VA 3UDFA 4DXFA 2FNJB 4DUYQ 1VF7A 1UAPA 5CV6A 3A7AB 1C78A 3J7AV 1NCVA 5C4JB 4LAAA 2MJ8A 2YLMA 1XLQA 2KZRA 4X3SA 1CHPD 3H3VI 1SE4A 2JA5H 2Z6KA 2KENA 1KRSA 4GB9A 3APCA 1K8AC 1UELA 2F3WA 2BA1A 1BBUA 4A4IA 3RYTA 1XMQQ 3PPAA 4GN3B 3J81i 2K3UA 2IX1A 3K80C 4C80A 1L7YA 3AEFB 2H5XA 3Q6SA 2RBMA 4YCWA 4NJ7A 2E8GA 3JAME 1FGBD 5H8YE 1YNXA 4F8MA 1PGXA 2MW5A 2HHHQ 1JALA 5M3FG 1F2YA 3UI3A 2QDLA 4IDIA 1EYGA 1VQFA 3HOZH 1HZBA 1ET9A 4KKUA 4S3SA 1OGWA 1M1KC 3HS0C 3MXUA 1XJVA 3CPWA 2B63B 1CJEA 1RYJA 2BWES 4GGQA 4HSVA 1EY0A 4GOPA 2H88B 2E3TA 1PVOA 4DPGA 4WJPA 1I4PA 2EJMA 4ZRKA 2NZ1D 1WWTA 3VA5A 4ZLTF 3GTPH 4OGQC 2IHEA 2ZTEA 3TIXA 2PMZE 4UY8C 2O4XA 3TN2A 4EZJA 2I5HA 1NY4A 2R61A 4JWUC 1VQ8A 5KNCA 1LM0A 1NMGA 3K8AA 2KTFA 1E2WA 1JT8A 3LX0A 1YN3A 1UUPA 3NSWA 3PUVA 1BCPC 2E2IB 3N9YC 1PZID 4GMVA 4NJCA 4JE3B 2RF4A 4ZRIA 2UYZB 5JPMC 4A3LH 3J80E 1ZXTA 3LGJA 2N88A 2JE6I 3DEPA 1K73C 1R4NI 2EKIA 3DBHI 1Q46A 3BY4B 4BKSA 3KYCD 1B2TA 1FFUA 1A8VA 1T5XD 2V4DA 2L52A 4FO2A 4K5VA 2QMTA 2V3PA 3PREA 5C4JH 1HTLD 4F1SA 4GKKQ 1GUGA 1XQQA 3QX1A 3CCLA 1A63A 1MJEA 4DV5Q 3H9DA 1WD0A 3I57A 4IPHA 2L4NA 2WXNA 2JJQA 3BU2A 2O5JC 1BKBA 5HHDG 1PH4A 1XTCD 2FBWB 5HGQA 3NBIA 2ZVOA 1CKMA 3K5OA 1V9JA 4KKJA 1SE9A 2PE9A 3ZO5B 4BXXH 1B7YB 1FMAD 4JBJA 2WKCA 3FPUB 1UE1A 4KKTA 3PTFC 3NVWA 1NJIC 4NPNA 4AWJA 5KGUA 3S24A 3T3OA 1SYFA 5FO9B 3ZXRA 3ULJA 1HNXQ 2HIXA 1XMQL 4W9JA 2ZT9C 1K52A 2WXRA 4MGKE 3F2BA 3HOZB 1E7ZA 5DPTA 4CJ2C 3T8MA 3VAWA 2FCSA 3V6EB 4O2DA 1O78A 2Z6BA 1Q1OA 1XO3A 3AE5B 1EEID 3L3OC 4K8IA 2NCNA 5CV8A 1VQAA 2B2VA 3U9SA 3M85A 4IM3A 1A2TA 4KKSA 1D5MC 4YTNB 5KHOA 1AE2A 3E0EA 3M63B 4G50A 5HKHA 2KWDA 1II3A 4DUYL 2JA8G 4DR6Q 2EIFA 1Y8RC 2D07B 2GOWA 3SU8X 1JOOA 4LCDE 2AUKA 4HJAA 5IWAQ 2NBVB 4MELA 1X54A 3KLSX 4R1JA 2PYKA 3IL8A 1BVSA 4LF8Q 2N49A 3GV6A 1RWSA 1R4MI 1Q3LA 3A33B 4FXDA 3FDTA 3EN2A 4FVMA 1JRPA 1PH8A 3EGRA 1VQIA 1Z6HA 5HY6A 5T1GA 2J0KA 2LMCB 2Q2TA 3R3MA 1GPXA 3TBLD 4GSWA 3GDEA 3VYTA 4A3FH 4X62Q 4L1BA 2D62A 3B6YA 2UXDL 2ICIA 1ILQA 2FFKB 2LHEA 5KHQA 3B9JA 4ZHOA 4KZ0A 4JLCA 2B63H 1TS5A 4YSZB 3D4WA 3NY5A 2VUMH 2LEKA 1CFMA 3MP9A 4G3XB 1KQSA 2WQYB 4X57B 3UINB 1SNCA 1MG8A 1SNMA 1PHJA 2DAJA 1QE6A 1HZCA 2LXKA 3A8JE 4DR3L 1GAQB 4KGTA 1OXTA 2HQEA 1S5FD 2WAQE 4B08A 3FP9A 3MAQA 2K8BA 3BZKA 2Z59B 2AL6A 5C5LA 2KBNA 2MBBB 1X3GA 4KY5A 3X0WA 1EWYC 1LO5D 2HE7A 2JWZA 2QCZA 2DENB 4II3B 5GXGB 2CWAA 3BJUA 3CCJA 2DY7A 3H0GG 4LFBQ 5AUIA 5TR5A 4X3KA 5ELEA 3HOVH 1YQ3B 4YSXB 1L0WA 4C3IB 2YV5A 3H0GH 4DV2L 4CBVA 1K8RB 2EMSA 2F03A 2JF5A 4HJGE 4QAYA 1GC6A 3KWVA 5CV5A 3K5LA 2JEBI 4FULA 4YTPB 2ACZB 4A6QA 2A6HC 3G48A 4KZCA 3I7FA 1BMLC 2QHOA 1SYDA 5FK9C 1O7IA 1F2RI 1VDZA 4FXKC 3MJ5A 1IGDA 4K3CA 1B9MA 4XGAB 4JV5Q 1OXXK 3P2BA 4OX9L 4OEMB 5IGFA 4IUPA 4GDLA 4DXGA 4Y7NH 3TZUA 3S1RB 2JA8B 4FF1A 5C3EG 1TWHH 4JI4Q 2B8FA 2MP2B 2HJ1A 4MN3A 2BBCA 1KAWA 1VD2A 2BVCA 4USAA 1TR5A 3UIOB 1N32L 2KTRB 1E6EB 3ENEA 3JAML 4J6IA 1A2UA 3CPFA 4AYBG 1ICFB 5BMGA 2OWOA 2EOTA 4L63B 1IUEA 2KACA 4P7IA 2VB2X 3QAQA 3J7AF 2IYDB 4A3PA 5IYCH 2EDGA 5J1ZA 3W5VB 3TEWA 1ZXIA 2KQ7A 1M8AA 4CHTB 1N36Q 3CQZB 2RSOA 2F0EA 4DNRB 4KHPQ 3PHXB 3M95A 3CD6A 3HRDD 1WH3A 2FMCA 1L4DB 2WHIA 2MWSB 3K7UC 3CF5A 5IA7A 3N52A 4ZRJA 1GHJA 5E6JA 3I9V1 3CCSA 5AUKA 2Y5BB 1EYAA 3M4QA 2KLCA 3AXCA 4HRSA 3MC9A 2KWVB 4RKBA 2F0OA 4GLVB 4B3SL 4JBKA 2F0VA 2VQFQ 1QILA 1IW7D 4DV3Q 1WTWA 5D2MB 2HIVA 5EPLA 3EBEA 3ZJTA 2IJ0A 2M8SA 2RD0A 4DR7L 4KIKA 1C48A 3FC4A 2ZJRA 1M94A 3M3YB 3MJWA 1TKYA 2LHDA 3SFEB 1AP0A 4A3JG 2NN6H 3H0GB 1BF4A 5GROA 4A3OA 1AE3A 4DGZA 1WYWB 3BIID 4ASWC 4KLKA 5A2QL 3A8KE 2INNE 5FO8B 4A3GH 2DY8A 4IO9A 1HA5A 2FIDA 5CC4A 1GD7A 3MZ5A 5AZHA 3DXJC 3DHQA 2I46A 5F2DA 3OOCA 4DAPA 4C1NK 1Y1VB 1KRTA 1Y1WG 1P7FA 1WGDA 2L0FA 4GLSC 1PFNA 1IXRA 1VMPA 2JWUA 3B2FA 2HUGA 5JVH3 2I5LX 1BR9A 5KYIA 1C77A 4IUUA 2JP1A 1RIPA 5FLXE 2VQEQ 1G8ZD 1WXMA 5C3EB 1OXVA 5EKIA 2F0LA 4AQ7A 1T6BX 1V86A 5K5PA 1IBXB 2F0DA 2EXDA 2QW7A 3F8TA 1PH2A 2N1WA 2ZJDA 4J3OD 2LFIA 2FUG1 2MO1A 4EQPA 2PQAA 1VZ8A 3BYYB 3W1BA 3PO0A 1CUKA 1JB7A 3S1NB 4ARCA 4C3JH 3PGZA 3KFUA 1CMXB 4NQLB 3CRKC 4RF0A 1STEA 1KLGD 1EY7A 1EY8A 4GLAC 1YVCA 1WGYA 3P4RB 4G7HC 1W3SA 1JJCB 4LF5L 3L9AX 1SAPA 1TS2A 3MWYW 3NELA 3WWVA 3B2GA 3TS0A 4RHRA 1PDXA 3HIZA 5C1ZA 2K6QA 5FO7B 4B95A 3AFQA 5FOBB 4BAXA 1EEFD 3IFDA 2XVSA 3HK0A 5JHAA 4TRDA 1CKOA 1D5XC 1QT9A 1OO9B 4FHJA 2WB1E 4K3BA 1OTRB 2J7QB 3CCMA 4KVGB 4KY7A 1G2SA 5EBCA 2M56B 2PE6B 3TJPA 3P7JA 4WH4A 1QWYA 1YIWA 3WCQA 1NENB 4GOPB 2NBUA 2RKSA 2CHZA 4X65Q 1WGGA 2KFKB 1EF1A 4DR2Q 3QJYA 2BYVE 3QCAA 3SD5A 1CQVA 2BE5D 3PMFA 1QKZA 1LM8B 4S17A 5D6JB 4KKIA 4XWWA 1L1OA 2VQFL 5C5MA 2KT7A 5DAUA 2GVAA 2ZEQA 3CQZH 2LVOA 3E56A 1HQMC 2KUMA 3A55A 2D2QA 3NENA 3RD4A 2INDC 2O2VA 2REXA 1OQYA 5AEKB 3GO5A 1PTOC 3HOYH 1AW7A 1QOFA 2MBQA 5KNDA 4LF6L 4A55A 1D4BA 1OEYA 2XK5A 1RRBA 1IKLA 2A68C 3WANA 1N36L 2ES2A 4N9F4 5JH5C 4LF6Q 3PO2H 3BK1A 3T3NA 4DV7L 1MKHA 5ELNA 4BBRH 1LUZA 1F9RA 1QOGA 1X1MA 2BKFA 2KQSA 2JU6X 3L17A 3QQ8B 1FCLA 1XT9B 1TT2A 1HR0L 1F2RC 3U2SC 1I3QB 2V1CC 4KHZA 5D3DA 3R93A 4LFAQ 1H9RA 3ZQ4A 1EY6A 1X3QA 4UP7A 2LS01 3S1NH 4IM0A 2M0AA 1ASYA 1WTOA 1CA6A 4XXEA 5KIXA 3EFUA 1UNSA 1A62A 2B2YA 5LL6S 3HOZG 3PQIA 3NUCA 2F0SA 4HPPA 2LSSA 2YTVA 3P1MA 3I72A 2JX5A 3PSEB 2PKOA 3GTQB 4OX9Q 4BBSG 1I50B 4P73A 1I6HB 1EUJA 3PV0A 1F9JA 4I65A 4MZ9A 4QCLA 1TIFA 2B3GA 2ENBA 4OO1I 5CYUA 5A2QE 1HFGA 4XDDA 4FN2A 4MH8A 2F0UA 1U4AA 1HTPA 3UDGA 3RN5A 4E71A 4I6LB 1PDQA 4H44C 3I4NH 3Q24A 4DV2Q 1G291 1ZEQX 3W1GA 3CCRA 2J52A 3S16H 3OLMD 2HJ8A 4AJYB 5CORA 1VQKA 1DD2A 1J7AA 3N20C 3SDLC 3UIPB 3HOXH 3IT6B 2Z0DB 1C7YA 2L1AA 1TS4A 1B44D 2GMIC 3H09A 4N8X1 4ZRZA 5EGTA 4A3CG 1FRDA 3GZNB 1ENAA 2WB1G 4XWTA 2CW0D 3BDOA 3GB1A 1PGBA 3STBC 1HJPA 1WTQA 3EHVA 1E7PB 1UF0A 3UE1A 4XQJA 2XGTA 1WCMH 5C4XH 2WP9B 1IBLQ 4PYUA 2NN6G 1VQOA 4BKTA 4C00A 2N9XA 2JT4B 4GN5A 2K8HA 2MQHA 3RMHA 1XNRQ 2G3QB 1PRTF 1T3QA 2JA7H 4DU9A 4W9HA 2EVBA 3P75A 4O0AA 4R8IA 2VH2A 3V62A 3CC2A 2IX3A 4XYOA 5J22A 3S15B 1XTDA 2IPKD 4AUQC 2EQSA 4LLGM 1E24A 4YWGG 3L13A 2EY2A 3H3VH 2CU1A 3U7ZA 2MHJA 4GN4B 4R8NA 3ER0A 2K5PA 4I6NB 2BGFA 1AEXA 2PW7A 3CHBD 2JYEA 2KO3A 3MC8A 4TMAB 4JI0Q 3JW0X 3AULA 3RLNA 3HOYG 3I3TB 2GN5A 5C23A 3TCAA 2KCTA 1TWAH 5C44H 3DVNV 1Q12A 1TIID 3IFTA 1WXVA 4N59A 2N3SA 4LUZA 4QF4A 4X66Q 1WXAA 3AI5A 2JVCA 4PK1A 1E1TA 2ZJQA 2Q2HA 3ZRFA
chains in the Genus database with same CATH topology
3Q22A 1LTSD 2KVMA 4E6IA 5HGTA 2WXPA 1N5WA 4G7OC 2Z4HA 1GUOA 1YMHE 3L4PA 3C8YA 3T4AC 2MJDA 2F0KA 3AH7A 4A3EB 3SE0A 2E74C 3TUOA 2E76C 3W5UB 1X32A 1D1IA 2V0GA 3MVVA 1MHHE 4L8JA 3RLFA 1FEHA 2BW2A 3OW7A 3NK9A 4BBSB 3HVZA 3P63A 3EJIA 4HCEA 5G5GA 2Z4IA 4DK0A 1BCPB 1C4CA 3V3XA 4NAMA 1L0YB 3K5NA 4Q5VA 2BB6A 3KWLA 2E2DC 4FXCA 1RCVD 4U68A 2H1EA 3OWEB 1B1ZA 2K01A 5C4HA 3N6RA 2CQAA 2F0QA 4R3DA 2FE8A 3Q8BA 3OWFA 3OMCA 4Z9CB 1F9QA 5C3WA 1W6KA 2PMVA 2BYTA 3ETRA 1A3TA 3W3AA 2IDYA 4FF2A 1RD9D 4RGNA 4F87A 2A74C 4KX6B 1AYFA 1D5ZC 2IWHA 3X3NA 4PNYA 2D2CC 3VYSA 1VRAB 2QDBA 2WLBA 5JOBA 1JWSD 2PO4A 1XF5L 3C3LA 5EJWA 2W54A 2XRSD 2WXIA 2YU9B 2IGGA 3SVMA 1DOLA 2NTSA 2K1BA 2QSDA 2KJXA 1QQRA 3VYRA 3CIRB 1E0BA 3SK5A 1F77A 3KUPA 1GOZA 3DEOA 1NI3A 3GTGB 1G6ZA 2WIIB 4EQNA 1UWMA 4HKQA 3MFYA 2R7ZB 1KDCA 1VZ6A 1BBXC 1ACCA 1RDPD 1A3VA 1L0XB 4DN4M 4K5XA 2M2LA 1TVXA 1EQVA 3F2UA 1SSOA 1EZ8A 2RDFA 4EVOA 2XWJB 4A93B 4AS1A 2ID0A 3CRLC 4PMCA 1X3PA 1I4HA 4MHEA 2LMCA 3KK7A 3PZ7A 3CU7A 3QG1A 1GB4A 2E2HB 1BCPD 4GDLB 3QO2A 4CKCA 5JEAH 2RSNA 4IFDJ 4HTHA 5A35A 1S5BD 1SNOA 3Q0AA 1UEAB 1I6VC 5JEAG 2QCPX 1CZWA 1PTOF 1O7ZA 2GRIA 3U52E 1PFMA 2EYFA 1AWDA 1R4PB 1I4RA 2INPE 4NMZA 4IFDH 4D2KA 2JA6B 4H13C 4OIKA 2XN9C 2FMMA 5BN4A 1LT3D 4ARIA 1RFKA 2CU3A 1EWCA 5I4DA 1S5ED 2X6GA 3H3VC 1H9MA 1SFOB 1QJOA 1FNUA 3LWUA 1OQRA 3IXSA 1S4ZA 1ET6A 4KD3A 3P20A 1EWHA 4N9PA 1TKEA 3NVVA 1GUWA 4LK1C 1NR2A 1ZE3D 3GV3A 4KN4C 4RGOS 4WJWA 3AB5A 4MM3B 1YQ4B 3NXWA 2AQ3B 3Q8AA 1GJXA 3NP8A 3J9CA 3HRZC 1PUTA 4JWSC 4YTMB 1LTID 3P4QB 2ONQA 1XXGA 1K53A 4JPSA 3VRAB 3BWUD 1TQOA 4IZ8A 2EYMA 4XIGS 1SMYC 4N58A 3OHXC 4JK1C 4C56C 2Z8LA 3BVGA 5T1IA 1KF6B 2Q5WD 4EQOA 1EYDA 4KTAA 2AX5A 2PW9A 4GDKB 2Y3AA 1PFBA 4ZKBB 1EZ6A 4BWGB 3AEBB 2X6LA 2WU5B 1HZ6A 3QOJA 4HAEA 1STHA 1PXUA 3I70A 4C3HB 2CJNA 2B2UA 2OEDA 3PUXA 1BDOA 3P1HA 3K58A 3MEHA 2MGSA 5I9PA 2HTME 1TS3A 2OHFA 2NTTA 2MP1A 1IGCA 4KGSA 4RWSC 4YXDB 4KD4A 2B2WA 2QILA 3AE6B 1YNNC 3KF8A 2SNMA 2F0GA 5C0XI 2LUMA 1MHXA 2KHSA 2EXZA 4XDXA 3H8HA 3C2PA 2I2YA 4LMQD 2NVYB 2OF1A 1B3AA 1GUNA 3Q23A 3I90A 1LT4D 2JXMB 3J80L 2GB1A 1B53A 2QIEB 1EM7A 4RAUC 1SNPA 4NDXA 3I73A 2B39A 1TY0A 3TEYA 1C4AA 1FYCA 2F0HA 4A3DB 3QB3A 4CJ0B 3S17B 4NZLB 1T5EA 3DWMA 3NVZA 4BBRB 1IBXA 2PMZB 4TQ1A 4ZKCB 1JQ4A 2OEOA 1I4GA 3VRBB 4YT0B 4HEDA 2F0NA 3J81L 1PRTD 2O2LD 2WXMA 4KN7C 5EE0A 3T53B 1SNDA 2JEAI 2RVLA 2D5GA 1Q1BA 3TEXA 3MC0B 2YEPF 4WORA 2F3VA 4DK1A 1OXUA 2CW0C 3K0YA 1XLOA 1VMCA 3BS1A 4MIUA 4HROA 1B9NA 3O13A 5IGBA 2WAQB 2L9HA 2NWGA 2ZXOA 2C9OA 3NZ3A 2LGIA 2WXFA 2KQ3A 4ILWA 2IL8A 1ZOYB 2VB3X 1PTOD 2QEJC 4B0MA 1H9SA 3AEAB 4DNTB 4KJNA 1FIQA 4XDCA 4J1MA 5CGKA 2VZKD 1Q90A 3SK8A 1LTAD 2LKVA 4PMBA 1ONLA 1RJTA 3NQIA 4PT5A 3J81E 4C7YA 2EYLA 3J7YW 1HA6A 2KMMA 3I4MB 1ESRA 1Q10A 2F0PA 4LK0M 4K5WA 2OT2A 3KLSA 1LACA 2AQ2B 4OO1H 4A3GB 3DWAA 2K7VA 2ICEC 1WTVA 3ONAB 5CV9A 1TJEA 1OFFA 1LV9A 1YJJA 1O7LA 1RF2D 4BA1I 4YSYB 2CVRA 1KABA 2L83A 4ODGA 4FP5D 4KGRA 1TU2B 3D4RA 2J0TD 1MI0A 2MJEA 1QG7A 4OZBA 2HDEA 1PFDA 1SB3C 2WU2B 4IURA 3T13A 1MI2A 2JQRB 1I4QA 2F1MA 4WWMA 4ZAIA 2FHTA 2J7ZA 1HZ5A 4RF1A 1FXIA 3AE8B 2QKIC 2E2JB 2F0IA 1SSNA 3BG3A 1NYRA 3VQIA 3NE5B 5TSSA 2JSVX 2BOSA 1TWHB 1FD6A 3H6MA 1I7HA 2H89B 3AM9A 1K83B 5M5XB 3CKIB 3PUWA 3NTKA 4ULLA 1RM6C 5G3LD 2KA7A 3BYTB 4V0BA 3VR6A 1EFID 4WIPA 4KK7A 3Q8FA 5LL6X 4IUVA 3HOVB 3FPPA 3IKJA 5E4XA 3NBHA 2F0MA 1JB3A 2K5QA 4B0EA 2ON8A 3G6JB 1JCKB 1AZQA 4CGYB 4A3BB 2WXOA 4WRDA 3MA2B 1Z47A 4B9XA 2AQ1B 5J39A 1FD7D 3PUZA 4HMJA 1PGAA 4I7ZC 3QWNA 5CR3A 1K51A 1K8MA 3V96A 3I91A 4US8A 4CKBA 1GB1A 4K2KA 1I4XA 3DWPA 5C44B 1EU4A 4KI0A 1JORA 2IX0A 3BK2A 1DXMA 4J6HA 3Q8EA 3TP6A 4F7XA 1U4RA 4ZRQA 4AYBB 3GTJB 2K5WA 5BYSA 3HVDA 1JWMD 3NTIA 3MXGA 4C2MB 2IW3A 2ZW1A 3FILB 3GS2A 2A69D 5D65A 1PRTC 2BDNA 1EOTA 4C3JB 2WV6D 1CM9A 1LT5D 3I4LA 1QLBB 1ML0D 2V3NA 2MJ3A 4RCOA 1XYIA 2WXLA 3CWIA 1STBA 4IOIE 1ZDXA 2LY7A 3ZJUA 2JA7B 5CV4A 2WB1B 3MXPA 1EU3A 2JYOA 2JYTA 3QOLA 4XTCS 1V8QA 3IAYA 4NW2A 1EIGA 3NVYA 4K2LA 3I8ZA 3M7NA 1C79A 1TWAB 4IUQA 4KY6A 3C1FA 3U4EG 3AEDB 1Q1EA 4PMWA 3R2IA 2QJLA 2L12A 1ICWA 4M1UB 4Q2JA 5BN5A 2L0CA 1EQTA 1SYGA 1JWAD 2J42A 2EYHA 5FKAC 5G3LF 2YEPB 1RKNA 1MSGA 1L6UA 3K5MA 1QNUA 1IL8A 2HCIA 5C0XH 1WSPA 2WDQB 3SXHA 1YN4A 3A7LA 2D5DA 3TSSA 4A90A 3MTSA 2G9HD 2B76B 5EKLA 4KMUC 3T16A 3AE9B 2SEBD 2WXKA 1XEEA 1WVLA 2A5HA 1U4LA 4IQZA 5DM73 5AFWA 4P16A 4NP5A 2MH7A 3LB8C 3VR8B 3MFGA 1DOIA 1G91A 4F88A 3AE1B 2EYJA 3VR4A 2B2TA 5G5HA 1JOQA 5I6WA 2AWOA 1BQQT 3S9WA 2BS4B 3GTMB 5C2TB 3GD7A 1FR3A 2L1BA 1F2LA 2A73B 4G7ZC 2G9DA 3TMEA 1RTNA 4RH6A 2B2VC 2H4OA 4O1NA 3URYA 5MPOA 3T56B 1EIHA 2KQ4X 4CJ1B 1QNKA 1NAPA 3T51B 3ZYYX 1SE2A 1ENFA 1E9MA 4L6TB 3ABVB 4MACA 2VNUD 1AFPA 1B50A 1S5CD 1DONA 2PIAA 3AECB 1SNQA 2WKDA 3BVZA 1VR9A 3EQLC 3TP8A 4A3MB 1SF0A 1ZYRD 1ZPSA 1SYEA 5KYLA 4G57A 4OIJA 2MPMA 2W3SA 2AUJD 5FLXL 1V1PA 5M5YB 1QOHA 2ZW0A 3FMCA 3TP5A 1GXDC 2EZVA 3ERQA 1CZPA 4UDUC 1O7YA 5D14A 1CI3M 4WFN3 4X3UA 4QIWB 2DLBA 4FNFA 1V1PB 5C4ZA 5CBAE 5EE1A 1ZDVA 5JJZA 5JXVA 1L4ZB 1CT1D 5LHY1 3LXFA 2XIWA 2YYZA 5EPJA 4L23A 5NUCA 4HMIA 2A68D 3I3CA 5FR3A 1OXSC 1PTOH 3V05A 3DUZA 3EUB2 1C8CA 5DNFA 1ZUD2 5E1FA 4K8JA 4R9WA 1GUSA 2E75C 3IAM1 1Y56A 3BDLA 4XQQA 4WQMA 2PPBC 2RMMA 2O5IC 3ZJVA 1SIJA 1E2ZA 1JR0D 4XQNA 4A3JB 3TP7A 2DWQA 1W6JA 2BS3B 4TQ0A 3PIP3 1S5DD 1LTTD 1STGA 2N9KA 4MT5A 5ELFA 1KTKA 3HP3A 5CV7A 3OSOA 3SK4A 4DQOC 1JROA 3M4YA 1LTRD 5I2YA 4OW0A 4X3TA 4IUNA 4A3IB 4DA2A 3S2DB 3SFDB 3PZ8A 4KV6A 1Z7TA 1A15A 1A3UA 3A8IE 1J8IA 3OMGA 2N55A 4IFDI 1H9KA 3AMUA 2EELA 4BS9A 3S14B 2KCCA 1NEKB 4V190 2GI9A 3ZGZA 5C0XG 4EE2A 3RZDB 3X3MA 1VCIA 3E5SA 3NUHB 4G4KA 1A6XA 2LFNA 2CHBD 5D7GA 2N0SB 1FFVA 4QB4A 1DJRD 5EBDA 5DEHA 2DNCA 4FF3A 3WOFA 1HPCA 3NHHA 4OL7A 3HOWB 1G2TA 4US9A 2KCNA 3AU7A 2PVGC 3Q69A 2NVTB 3A54A 2XSCA 3PUYA 1IW7C 2F0WA 2JXTA 4ZUIA 2BCOA 5C3JB 3NWSA 1TYGB 1SYCA 2KN4A 3VR5A 5JVG3 2R6GA 1CK1A 1CZGA 4OVZA 1SYBA 3HGBA 2NN6I 1N60A 4A3KB 2F4IA 4K6LA 1MGSA 4A3FB 1MD2D 3R2TA 1LLRD 5C4XB 2M00A 1QB5D 2F0TA 4JBWA 4DFAA 4HEA1 2OXPA 4IUTA 1KNAA 1NUCA 3M4OB 1ENCA 3DWQA 3P42A 1JICA 2NBFA 1VDVA 3AEEB 4NAWB 4TKOB 4TSSA 5C6AA 2F0FA 1VLBA 3K59A 1HUMA 1BCPF 1LTGD 4PV1C 2WDRB 3AEGB 1KNEA 2NMQA 1PZJD 2WXHA 1DOMA 2J53A 3GQBA 5T8IA 3R3OA 3TEZA 3KLRA 5IGEA 3FRPB 3HOUB 3I4NB 2EJFC 3HG9A 2SNSA 2C5CA 1YNJC 2K22A 3ND8A 5EQ0A 2KOLA 3LWEA 1MPEA 1J7BA 5JEAJ 1NYQA 3K7AB 2EYOA 1P7EA 2N7JA 4KJOA 2L5TA 5ISRA 3HZXA 1HRJA 3VYUA 2R92B 5KRUA 1FNVA 1DZ1A 1L6VA 1GUTA 3W9CB 3W1SA 3TDQA 4XYQA 2ZXRA 1SE3A 4Q0FA 3OIPA 5H92C 3HKZB 4ZYSA 2HCCA 4JX1C 3LYYA 1KAAA 2DYOA 1DOYA 1DCZA 1HXYD 1BUIC 2JA5B 4Y7NB 1STAA 1VF5C 3D6CA 4RFBA 2X38A 1STNA 3DM1A 4RCNA 1TWCB 2K0PA 2EJGC 2L55A 5EE3A 2N9LA 5IT9L 4ABNA 3RUZA 1WGKA 2L11A 5CBEE 1N61A 1HCZA 5BN3A 1IKMA 1VJKA 3H91A 3FILA 1PRTB 1Y8PB 3MHBA 1SEBD 3GTKB 1ESFA 1EL0A 3P4SB 1NSNS 4ZRPA 1XLPA 4XT1B 5CMDA 2PVOD 3GTPB 1DGJA 2MEKA 4REZA 1HHVA 2W82A 3GTOB 3BDCA 1DYQA 2F0JA 3AB9A 4C7ZA 3H94A 1SMYD 1STYA 4ID6A 4XE0A 1WYGA 5K36G 4RGMA 4B9WA 4RGTA 5IGCA 1SJHD 4IN3A 5C3XA 2KAJA 3AV8A 1EY9A 4WURA 1YNND 4H0LC 4K14A 3FVQA 3AMZA 3E0JA 2PZTA 4O42A 3M7GA 1EYCA 1L5PA 3AN1A 4ME5A 1E10A 2Y5PA 3HUIA 1FCCC 5D3IB 3S1MB 4ZK9B 1TKWB 3NRZA 1DOKA 2PZWA 3OPOA 2Z1CA 3NWTA 4FF4A 2BE5C 4H2AA 5ELBA 1RODA 4RKLA 5LNK1 1CHQD 1LABA 1KDAA 2PTLA 3SEBA 1FM0D 1JC7A 1V8CA 3RFZB 2FJ2A 1KRHA 1NR4A 1J9OA 1PMRA 1N63A 1FXAA 1WTPA 3HEJA 2K05A 4PQXA 2BTEA 1WTXA 3VR2A 2AWNA 2R93B 1SBBB 4FXGC 4K6DA 3A56A 3P4PB 1ZXHA 1AZPA 1ZYRC 3HOYB 3DWGC 1SJED 5KEEA 3BVMA 4NKLA 3WDNA 2EE1A 1D2BA 2WXGA 3AE7B 4N9TA 1Y69U 3Q8CA 2EY5A 4QUFA 4ITKA 1C9FA 4EGVA 4C1NI 5EE9A 1Y1WB 5JAVA 1YNTE 3SHLA 1KFYB 1XWEA 3NPPA 1V97A 5BMHA 2M19A 1N62A 2NUCA 1F9SA 5M9OA 1EY4A 3EA6A 5ELDA 3SR6A 1V43A 1TY2A 3SDZA 1BUVT 3OIQA 3W2DA 5BMIA 2PNRC 2W55A 4J8QA 4C3JG 2Y5CA 3NS1A 4P2CB 4GZYC 2BS2B 1KDBA 3D4DA 4U673 3S16B 1R7SA 2A69C 2WDVB 5COYA 2RA4A 2EY6A 1PTOB 3DMUA 4WAFA 1HQRD 5IT9E 2V4IB 3VR3A 3S1QB 1WTRA 2Q8RE 1M4VA 1RHPA 4H7BA 3NTHA 4QUCA 1AN8A 1KLUD 2ZXPA 4ZQ3A 5KNBA 2LJIA 1A70A 1WD1A 4IALA 2TSSA 1O80A 1C4PA 2Q8IB 1MVKA 3D31A 5E4WC 3IAS1 2MUYA 3G7LA 2WXJA 2DN8A 4OZCA 3EVQA 1F2MA 1QF6A 5M3MB 3C46A 1PLFA 2D9UA 1VZ7A 4CKEA 2I38A 2HDMA 2XWBB 3E6ZX 3ND9A 1QOAA 1H9JA 1XLNA 2WS3B 4BY1B 4LJZC 2DNEA 1TKGA 3PO3B 1TWGB 4OO1G 2VUMB 4ZUJA 1ROEA 4C3HG 2PW5A 5E3FA 3UI2A 4HKZE 5I6YA 4P6VF 1ZKOA 1WXQA 1BOSA 4RA8A 1WRIA 1NVID 1F0ZA 1V1OA 3SR1A 2L32A 1PZKD 4DAYA 2CJOA 3LNNA 1BXTA 2TMPA 3V2TA 1UWXA 1JE4A 1B9RA 5IODA 2IGDA 2MHVA 1BNZA 1XCQL 2JZPA 1H9SB 2B2UC 2KDMA 2K33A 2XNAC 5M3FB 3SK6A 1CQFA 1QOBA 2A6ED 3D6WA 1JW9D 1SDFA 1LT6D 2K28A 1XCTL 2PLPA 2G1EA 5I2XA 1Q8IA 2HDLA 2Y0SB 3S2HB 1HUNA 4HN7A 2DYMA 4L2YA 2RQXA 2SOBA 2XRQD 4A9AA 2B2WC 2KEEA 2WACA 2WXQA 2NYZD 2RDGA 1LTBD 5IIFA 1L0VB 4HSPA 4QMGA 4M8AA 2EY1A 1YN5A 3EFXD 5I9OA 1PYWD 2E6XA 4UAIA 1D6EC 4YIJA 2I07B 1E2VA 5BYRA 1RTOA 3GTLB 1SXTA 2R3ZA 1K8OA 4HR7B 2BDOA 1TWFB 2SAKA 1U4MA 1EY5A 5M5WB 4CQNA 2A6EC 2VZKB 2B8GA 1ILPA 2NB0A 1B4OA 3VA7A 2K03A 1C4QA 1JWUD 2BA0A 1JOKA 2EYPA 5C0XJ 1FNWA 5HI1A 2Q8TA 1Y8OB 3K57A 3D3RA 3FAHA 3QIAA 2RDHA 3D8GA 2EPBA 2K9XA 1U4PA 5BYQA 3TBIB 2RPVA 2IGHA 3AE2B 2BT6A 5HG2A 4ZHPA 5HFYA 2NVQB 1FRRA 1KH0A 2GA4B 2DBYA 1OQQA 3AE4B 4RNAA 1GHKA 1E0ZA 4LTUA 5K36H 5EKKA 1WCMB 1R4QB 1C76A 3RZOB 1CTMA 1UGJA 2NVXB 2K32A 1HEZE 2K6AA 3PIO3 1IYVA 4FYDA 3KBGA 1QCBD 2VXWA 1BO0A 3KBXA 4DF7A 4IFDG 2B2YC 4OZAA 1FO4A 3WOEA 3GP7A 3MHZA 2KECA 3IT4B 4BA2I 2PCFB 1U9RA 1JWBD 1TZOA 1XX8A 4KHVA 3NQTA 1HFNA 2WNMA 4C3IG 5IGGA 5IGDA 4ZOHC 2FINB 3MXNA 2J4XA 4HCSA 1R9TB 4N6EB 2W3RA 3PO2B 3FKIB 3RPFC 1JMLA 3EROA 1MBYA 1YNJD 3AE3B 2WP8J 5IOCA 2K04A 2WINB 1F9PA 4RHSA 3L7ZC 1N5XA 1D1KA 2B2TC 5ELCA 3U9OA 4A8XC 1ZP0B 1CA5A 4OHJA 1K50A 2KEDA 1YJIA 1MSHA 5JPNC 1F2ZA 3R8BA 4XT3B 4BY7B 4IKGA 5DM63 1IHZA 1IYUA 3ITPA 1J7CA 2QF7A 4TQUS 3TZDA 2IT1A 3HOXB 2K5DA 2PZUA 1JQYD 2PQEA 3VR9B 3C1EA 2JSOA 1Y8NB 4DAVA 2X69A 3K6OA 3BZDB 5HURA 3KQ4A 3E9SA 3FEWX 5EPKA 4M0WA 2A6HD 1DOXA 1DM0B 2SDFA 2M9VA 4DXFA 1VF7A 1UAPA 5CV6A 3A7AB 1C78A 3J7AV 1NCVA 5C4JB 4LAAA 2MJ8A 1XLQA 4X3SA 1CHPD 1SE4A 2F3WA 2BA1A 2K3UA 2IX1A 4C80A 3AEFB 3Q6SA 2RBMA 3JAME 1FGBD 5H8YE 4F8MA 1PGXA 1JALA 1F2YA 3UI3A 4IDIA 1ET9A 4KKUA 4S3SA 3HS0C 3MXUA 2B63B 1CJEA 1RYJA 4HSVA 1EY0A 2H88B 2E3TA 1I4PA 2EJMA 2NZ1D 1WWTA 3VA5A 4ZLTF 4OGQC 2O4XA 3TN2A 2R61A 4JWUC 5KNCA 1E2WA 3LX0A 1YN3A 1UUPA 3NSWA 1BCPC 3PUVA 2E2IB 3N9YC 1PZID 4NJCA 4JE3B 5JPMC 3J80E 1ZXTA 2N88A 2JE6I 3DEPA 2EKIA 1B2TA 1FFUA 1T5XD 2V4DA 2L52A 2V3PA 4FO2A 4K5VA 2QMTA 1HTLD 1GUGA 1WD0A 3I57A 2L4NA 2WXNA 2O5JC 5HHDG 1XTCD 2FBWB 3NBIA 3K5OA 4KKJA 1FMAD 3FPUB 2WKCA 4KKTA 3NVWA 5KGUA 3T3OA 1SYFA 5FO9B 2ZT9C 1K52A 2WXRA 3HOZB 4CJ2C 1O78A 1XO3A 3AE5B 1EEID 3L3OC 4K8IA 5CV8A 3M85A 2B2VA 3U9SA 1A2TA 4KKSA 1D5MC 4YTNB 2KWDA 1II3A 1JOOA 2AUKA 3KLSX 2PYKA 3IL8A 3GV6A 1RWSA 1Q3LA 4FXDA 3FDTA 1JRPA 4FVMA 3EGRA 1Z6HA 5T1GA 1GPXA 2LMCB 3VYTA 4L1BA 2D62A 2ICIA 1ILQA 2FFKB 2LHEA 3B9JA 4ZHOA 1TS5A 4YSZB 3D4WA 2LEKA 1CFMA 3MP9A 2WQYB 1SNCA 1SNMA 1QE6A 3A8JE 1GAQB 4KGTA 1OXTA 2HQEA 1S5FD 4B08A 3MAQA 5C5LA 4KY5A 1EWYC 1LO5D 5GXGB 2DY7A 5AUIA 4X3KA 5ELEA 4YSXB 1YQ3B 4C3IB 4CBVA 4HJGE 2F03A 3KWVA 4A6QA 5CV5A 3K5LA 2JEBI 4YTPB 2ACZB 2A6HC 1BMLC 1SYDA 5FK9C 1F2RI 1VDZA 4FXKC 3MJ5A 1IGDA 1B9MA 1OXXK 5IGFA 4IUPA 4DXGA 3S1RB 3TZUA 2JA8B 4FF1A 2B8FA 4MN3A 2BBCA 4USAA 1TR5A 1E6EB 3JAML 1A2UA 5BMGA 2EOTA 4L63B 1IUEA 2KACA 2VB2X 3J7AF 2EDGA 5J1ZA 3W5VB 3TEWA 1ZXIA 1M8AA 4CHTB 3CQZB 2RSOA 2F0EA 4DNRB 3HRDD 2FMCA 1L4DB 3N52A 1GHJA 5E6JA 3I9V1 5AUKA 1EYAA 4HRSA 4RKBA 2F0OA 2F0VA 1QILA 1IW7D 1WTWA 5EPLA 3ZJTA 2IJ0A 1C48A 3FC4A 3M3YB 1TKYA 2LHDA 3SFEB 1AP0A 2NN6H 3H0GB 1BF4A 4DGZA 3BIID 2INNE 5A2QL 3A8KE 5FO8B 2DY8A 1HA5A 5CC4A 3MZ5A 3DXJC 3DHQA 2I46A 5F2DA 3OOCA 4DAPA 4C1NK 1Y1VB 4GLSC 1P7FA 1PFNA 1VMPA 2JWUA 3B2FA 5JVH3 2HUGA 1BR9A 5KYIA 1C77A 4IUUA 2JP1A 2BB5A 5FLXE 4AQ7A 1G8ZD 5C3EB 1OXVA 5EKIA 2F0LA 1T6BX 1IBXB 5K5PA 2F0DA 4J3OD 2LFIA 2FUG1 4EQPA 1VZ8A 3BYYB 3PO0A 3S1NB 4ARCA 3CRKC 4RF0A 1STEA 1KLGD 1EY7A 1EY8A 3P4RB 4G7HC 3L9AX 1SAPA 1TS2A 3MWYW 3B2GA 4RHRA 1PDXA 5FO7B 5FOBB 1EEFD 3IFDA 2XVSA 4TRDA 1D5XC 1QT9A 1OO9B 1G2SA 4KY7A 5EBCA 2M56B 3P7JA 4WH4A 1QWYA 3WCQA 1NENB 2RKSA 3QJYA 1CQVA 2BE5D 3PMFA 1QKZA 4KKIA 4XWWA 5C5MA 5DAUA 3E56A 1HQMC 2KUMA 3A55A 3RD4A 3GO5A 1PTOC 1AW7A 1QOFA 4A55A 5KNDA 1D4BA 1IKLA 2A68C 3BK1A 3T3NA 1F9RA 1QOGA 1FCLA 2JU6X 1TT2A 1F2RC 3U2SC 1I3QB 4KHZA 5D3DA 3R93A 1H9RA 3ZQ4A 1EY6A 1X3QA 2LS01 2M0AA 1WTOA 1CA6A 4XXEA 5KIXA 1UNSA 2B2YA 5LL6S 3NUCA 2F0SA 3P1MA 3I72A 2JX5A 2PKOA 3GTQB 1I50B 1I6HB 3PV0A 4I65A 4QCLA 2ENBA 4OO1I 5CYUA 5A2QE 1HFGA 4XDDA 4MH8A 2F0UA