1GOZA

Structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
228
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKDKRKSCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENTEROTOXIN TYPE B
publication title Structural and Functional Role of Threonine 112 in a Superantigen Staphylococcus Aureus Enterotoxin B.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Enterotoxin
total genus 64
structure length 228
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1gozA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gozA02
2Z8LA 1HXYD 2QILA 1HA5A 1KLGD 1BCPD 1EWCA 5I4DA 4UDUC 5ELFA 1RCVD 1RF2D 4L6TB 5D3IB 2WV6D 3URYA 4ZYSA 1LTBD 2XN9C 1HQRD 4DXGA 1JWMD 1LT4D 4TSSA 1CK1A 1SE3A 1TS4A 1UNSA 1ESFA 1LT5D 2AQ1B 1AN8A 1JCKB 3R2IA 4Z9CB 2CHBD 2NTSA 1V1PA 3MFGA 1SEBD 3O13A 1BCPF 2RDHA 5ELCA 3V05A 1I4XA 1ET6A 2SEBD 1S5DD 1EEFD 2TSSA 3BYTB 3OWEB 5D3DA 1EU3A 2QEJC 1D5MC 1TY0A 2NTTA 1PZKD 1BCPC 1SJED 1CT1D 2G9HD 1GOZA 3SEBA 1BCPB 4RH6A 4NZLB 1B1ZA 5ELDA 4RCOA 1PZJD 1BXTA 1I4QA 1KTKA 3KLSX 1S5CD 1PTOD 1T5XD 1DJRD 3EA6A 1CHPD 3BVGA 5ELEA 4RHSA 1LO5D 1EEID 1PRTD 3MC0B 1LT3D 1LLRD 1EFID 4OHJA 3CHBD 1L0YB 1FNWA 4C56C 1B44D 1PYWD 1EU4A 2IPKD 1ENFA 1LT6D 1I4HA 2XRSD 1FGBD 3BVZA 3GP7A 3EFXD 2ICIA 1S5ED 1YN4A 1I4RA 1LTID 4RFBA 1L0XB 1UUPA 1M4VA 4RGMA 5FKAC 1PTOF 3R8BA 1LTSD 1DYQA 1JR0D 3DWAA 2O2LD 1F77A 1ET9A 1TY2A 1SBBB 1I4GA 5FK9C 1I4PA 1XTCD 1PRTF 1YN3A 1FNVA 2J4XA 1TS5A 1PTOC 4RGTA 1CHQD 1PZID 1PTOB 1QILA 1JWUD 1S5BD 4BWGB 4DXFA 1FNUA 1MD2D 1PRTC 3BYYB 1V1OA 2AQ2B 1PRTB 1D5XC 2IJ0A 4O1NA 1KLUD 3DWPA 4RGOS 1SXTA 1PTOH 3DWQA 3W2DA 1JWSD 1SJHD 1RDPD 1LTTD 1G8ZD 1TS3A 2R61A 5TSSA 1LTAD 2XRQD 4L63B 2XNAC 1XXGA 1SE2A 1RD9D 3BVMA 1V1PB 1AW7A 1STEA 1HTLD 1YN5A 1JQYD 4K6LA 1LTGD 4RGNA 1S5FD 3R2TA 1D5ZC 1LTRD 1SE4A 1FD7D 5ELBA 1CQVA 2RDGA 4RHRA 3TSSA 1D6EC 2AQ3B 3BZDB 1TS2A
chains in the Genus database with same CATH superfamily
4FHJA 1HNZL 2NVYB 3CCSA 3PLUA 1F2LA 2D9UA 1R4QB 3NQTA 1WGYA 2INDC 2FFKB 2NVTB 2V1YA 4HPLB 2K1FA 3W1SC 1HR0W 4CDEC 3RD4A 3MXNA 4UDUC 2VQFQ 5DM73 1AH9A 4LFAL 1JC7A 2H89B 1TWFH 3RZFA 2MHVA 3N6RA 2HTHA 1JJ2A 2MRPA 2RVLA 2NZHA 1VMPA 4TSSA 4X3KA 5JVG3 1HUNA 1F1HA 3Q24A 1M90C 1HCZA 4KHPQ 1Q0WB 2MP1A 3OOCA 2ZCCA 3H7PB 2MO1A 1TGZB 1B9NA 4C3HB 2NBFA 1QWYA 2WP8J 1CTMA 2EIFA 2NTSA 5C0XH 1K8AC 5ELCA 3ND9A 4R3DA 2JJQA 5CYUA 4P1CC 2JSVX 1QCBD 2JA7H 2EOTA 3QIJA 4S17A 1TT5B 4F8CB 1HPCA 1B70B 4OONA 3OW2A 1CMXB 2KD0A 2HD3A 2GMIC 4XE0A 3RNGC 2DY7A 3KWLA 1A5RA 2L8JA 5FO7B 4BY7G 1S1QB 3IBEA 4N9F4 2WAQG 3KUCB 2BF8B 4KK7A 3SDLC 2RKSA 3TP5A 1D1KA 1WTXA 2LRWA 4J8QA 3KYDD 2O2VA 5C3JB 3F2DA 2EY2A 4QY7A 2KANA 4WQOB 1Z47A 4G7OC 2VB3X 1MG4A 4DNRB 1IHZA 2F0WA 3IRBA 1N8RC 2E2HB 2NPTB 1VQ9A 1FCCC 2UXCQ 2DZIA 2KOLA 2XEWA 4I6LB 1J8CA 3DM1A 4NJ6A 5EAYA 4ZKCB 1PFSA 4YL8A 1YNND 4JI2Q 3Q0AA 3N9YC 3S24A 4DV1L 4KIKA 3KDFB 1XMQQ 4CBVA 2L7RA 1TVXA 2VZAA 5DNFA 4MGIE 1XPRA 4KKUA 3PO2B 3OYYA 2GBJA 3VUYA 2F0HA 4LK1C 1JE4A 4P2CB 4C3IG 1VD2A 2L0FA 2PE6B 3LXFA 1EWIA 3T9LA 2A6HC 1FEHA 5EBDA 4ZHPA 4NP5A 3H0GB 4RGMA 5LMNQ 4DV7Q 2JA5H 2KMCA 2M0AA 1WTOA 5BYQA 3J7AV 4FULA 3KBGA 4PMBA 2ES2A 5JOBA 3HOUB 3V6CB 4MT5A 1PXUA 3NPPA 3AEBB 1TS5A 2JUOA 2AYOB 3HOXH 3S1QH 5C44H 2KWDA 1DOIA 2C35B 1CZPA 1PTOB 3AYHB 1JWUD 2NUCA 3CC7A 2XBBC 1FNUA 3A74A 4BY1B 4BKSA 1E10A 1E9MA 1WZ0A 2PMZB 2WB1B 1C9OA 4O1NA 4XT3B 3ZNID 2A6ED 2F4VL 2VQEL 1KFYB 1Q3LA 2QJLA 2W54A 1KNAA 4RNAA 4IUQA 1EIYB 1Y8NB 3I91A 2PYKA 1X32A 4A3MB 3KLWA 3FDTA 3PUXA 2KDFB 2LHEA 2M8SA 2H88B 2OHFA 1MHWC 1TS3A 4I6PA 1LTAD 2N49A 2EY6A 3VYUA 1NCVA 2MO0A 1QF6A 4DR2Q 1SE2A 3IAM1 2EMSA 4II3B 2EKIA 1TYGB 3MA2B 1J9OA 5C5MA 3HVZA 4HPMB 1LTRD 2I46A 3KBXA 2G4DB 4X64Q 1B9RA 3TEHB 5IYBG 1X1MA 4BOSC 1QNUA 3FMCA 1CSPA 2EYMA 1T0RC 1UD7A 2FUG1 1VF5C 4S3SA 2QDBA 2WGSA 3BIID 3QCAA 3ZRFA 1ZYRD 4MN3A 1GB1A 2ZJPA 2DAJA 1PH2A 1Y1VH 2FMMA 1GUTA 4DKAC 2MP2A 2NWGA 4L6TB 1E1OA 4K5XA 3KJOA 3URYA 3GZNI 2IT1A 1WE6A 1BVSA 2B2WA 1WI5A 1KD1C 2KHIA 3ITPA 1FXAA 1ESFA 3JAML 2AQ1B 4O0AA 5KGUA 1R4MB 2KJHB 2R92G 2JYTA 4A3BB 3BDOA 1SIJA 3FKIG 3KF6B 4FJVB 3FPUB 1XNRQ 2K7VA 2XWBB 2E5LQ 3I72A 4PG3A 4DK3C 2F0TA 4FF2A 4G11A 1S5DD 2HIVA 1NUCA 5BMGA 3RULA 5BO4B 1O80A 4HEDA 5M5YH 4X6AH 4HDOA 1K73C 5IKCM 1HNZQ 3S15H 3K57A 1BCPC 2F0MA 2K50A 1S3SG 2L76A 4LJOB 4W9CA 3RNEC 4EUTA 3GE3C 1OFFA 4ZOHC 3J81j 1DOKA 4IUPA 4LFAQ 2CW0C 4R9WA 3Q6SA 3OG5A 3IKJA 1N36L 3BDLA 3AEGB 2X6GA 4AYBB 5HI1A 3B2FA 1WSPA 4QUFA 1C77A 3EHVA 4XYQA 4C3IH 4RHSA 1EF1A 1I7HA 1K50A 3NY5A 4CQNA 1KQSA 3NHEB 2DZJA 2JYEA 4LF9L 3VH4B 3FVQA 1IYUA 1LT3D 1QZGA 1NMFA 2PNRC 3J81L 2QF7A 2WU5B 2JA5B 2K6AA 1FNWA 3NUCA 1I94L 3CMAA 1JE5A 2J0JA 5IGGA 1Q81C 4OO1I 2K0PA 1PYSB 3EFXD 1FVIA 1WJ4A 1LTID 3HG9A 4REZA 1UUPA 1UE1A 5C44B 1OTCA 3S1QB 3AMUA 4HTHA 4DU9A 2E74C 1PH8A 2MH7A 3AE9B 1PDXA 3EFCA 2WXMA 2Q2TA 3CKIB 3I2ZA 2PVGC 2L05A 4CKCA 4FVMA 4UPAA 3MAQA 2HTME 2Z1CA 1JICA 1SMYC 3NZSA 1N32L 1QILA 1YHQA 1F2RI 1VMCA 3MXNB 1Z5SB 2HCIA 3T13A 1E7ZA 3E6ZX 3VQIA 1T5EA 2LMCB 2GBRA 4WJNA 2A69D 2B2WC 4JW0A 1E6EB 4MNOA 4MGZE 3RN2A 5M5WH 4DV1Q 2FIDA 1K8RB 1SXTA 3TEZA 1Q1BA 1W6JA 3LX0A 1J7AA 2Y3AA 3W2DA 3A4SC 4XYCA 2RSUA 3D4DA 3GOEA 2EY1A 3FRPB 2IY5B 2MBHA 1FGUA 4L63B 3HIZA 4K1RB 2F0EA 3K7AH 1WXAA 4IG7B 4HVBA 1CSQA 1SNPA 4HK2A 3V6EB 1WOCA 1V49A 1SR3A 2KJ6A 1STHA 3PHXB 3VR6A 1Q8KA 4LNKA 1EY4A 3RNBC 4DV0L 4BXXG 5ELBA 3TMEA 3CF6E 2ZXRA 1WRIA 3AB5A 1EUJA 1WI0A 2O2VB 3MTNB 1PV4A 2BPSA 3LDZE 3I4NG 3BWUD 2EXZA 4JI0L 2D0OA 3E3XA 3SE0A 4C1NK 2EYPA 3PRMB 2R92H 4BBSB 3V2TA 2VB2X 4GGQA 1K0SA 3H7SA 3ER0A 4KI0A 2MUYA 5I6YA 5IGBA 2VQEQ 2F4VQ 4D2KA 1VQGA 3FKIH 4IPGA 2JEBI 3S2HH 1OXUA 1YJJA 4UP7A 4DXGA 4A3EB 2Y5CA 4IUNA 1B50A 3R3OA 2YTXA 4HAEA 1TWAB 5M5YB 3QC8B 1K0RA 3O13A 4G0NB 4XQNA 4JI7L 3D6CA 1YD8U 2RCNA 2KECA 1EEFD 5CV5A 1S40A 4WJ4A 1ZGUB 2L1BA 2PEAA 3CSFA 3RR5A 2V0GA 1UGJA 2LVOA 3A7AB 3H8HA 5J17A 3PT2B 1ESRA 3IVFA 3FPPA 1BCPB 4KV2A 2OF1A 1ZKHA 2KX0A 3APCA 4GXBA 1E1TA 3IFTA 5E7NA 3EGRA 1FD6A 2EPBA 3AE3B 2R2OA 3PMFA 1ZE3D 4AJYB 2INPE 1PTOD 4YWLA 3HOYH 4QQBX 3E0EA 4DR6L 3GTJH 4K2LA 4XZ4A 4JYAL 1H9SA 1N61A 2E2DC 1VQNA 1ISNA 1FPYA 1L4ZB 5EE3A 2KFKA 4AQYL 2IHFA 2QCZA 3DBLI 5BN4A 4AIMA 1IGDA 3A1QA 1X55A 2IPKD 3IHPC 4OELB 3HOZG 2FUHB 3AULA 3EFUA 4TQ1A 3AU5A 4QIWB 1XX8A 1YN4A 2BS3B 3T1YL 1TQOA 4Q2JA 5EDSA 4A3IG 4WRDA 2O2LD 3D6WA 1C4PA 5HURA 3T1HL 3EC8A 1SBBB 3GO5A 1C3TA 2MA9B 3CSTA 2KHWB 4DV6L 4JIOU 1M8AA 1C1YB 3WOFA 4P7IA 2MGSA 3RNUA 3PS6A 1N36Q 4JI4L 2JXMB 1EY6A 4IWPA 5JAVA 1J6QA 2MP2B 1F9SA 5NUCA 4R8IA 1SDFA 3S2AA 5AZHA 2B39A 2KDEB 2Q8RE 4ME3A 1JB3A 3K7AB 3J9CA 1BKBA 4LF9Q 5AUKA 3HOVG 3QX1A 3VH3B 1NBWA 4C00A 4BXXH 5CORA 5CX3A 4K2KA 4JBJA 2CS4A 1I94Q 1Y1WH 2JA8G 1WJUA 2QW7A 2KN4A 5LMNW 3TJPA 2K52A 3H09A 3I3TB 2WDQB 4CKBA 4LFCL 1N60A 3GTQB 1OTRB 2MCNB 2K5WA 2FCMA 4JV5L 5GAHC 3FP9A 4A3JH 3TEXA 4E3CA 3A8KE 1Y8RC 2Q2IA 1Q7YC 2YTYA 5CBAE 2BBCA 2NVXH 2AX5A 4NJCA 1GXDC 1DONA 2KHJA 1T0SC 1N32Q 1SYFA 3K5OA 1WTQA 2RSOA 3S2HB 4P74A 1KM7A 4TQUS 3ONAB 2ZNVC 2M2LA 1ZDXA 3GDEA 4A3GG 1HFNA 5D3IB 2GI9A 3EJIA 4WFN3 1F9QA 2LKVA 3CCQA 5CC4A 2VNUD 4NNJB 1IZ6A 3P1MA 2X38A 3ZO5B 1UGMA 4C2MH 1KRHA 2DENB 1WY8A 1A63A 4J1MA 4X62L 4UY8C 4A3CH 1HEZE 2WXIA 3DM3A 4F88A 4Z9CB 2WU2B 4ZRZA 3KVFB 3CIRB 2WXKA 4DV0Q 4W9FA 1E22A 1T3QA 1I4XA 3DBHB 4ICVA 1MG8A 3DEPA 4N8X1 2IW3A 5D3DA 4W9KA 4I7ZC 1WZ3A 3GTOB 3HVDA 5M3FG 4QUCA 4DGZA 1TY0A 4JCVE 3W5UB 2A6HD 3I9V1 1CT1D 1OQQA 4JI0Q 2KEDA 4ZK9B 5EPJA 1RFAA 2DBYA 3GTJB 4GSWA 2ACZB 2REXA 1EYDA 1EWYC 2IO0B 3M3JA 5DPSA 1H8CA 2HQEA 1W3SA 4HSPA 3NWTA 2LUMA 4NQLB 1JORA 1S5CD 4UP8A 3KUDB 1GC7A 4WH4A 2AWNA 2L52A 2LEKA 5JEAG 3K58A 2HCCA 3HOZH 1WRDB 1XJVA 4GDKA 3NZUA 2D5DA 2QGQA 3QOLA 3FHWA 1JB7A 3P4PB 1CJEA 3AEDB 1VQ8A 2K5PA 4YCVA 3S16H 4OVZA 3ZLZA 1LLRD 2D2CC 5IN7A 1FIQA 4HCNB 2J0KA 3I5JC 4JI7Q 3EUB2 2VH1A 1TR5A 5DPWA 3CPFA 3RPFC 1U4LA 2FMCA 3JVZX 3U9OA 1K51A 4AUQC 2D3BA 2C60A 2A5UA 3J7YW 3ZNHB 1K8OA 1DZ1A 4HIMA 4P6VF 4KGTA 3TREA 1ET9A 2WXLA 3NS1A 1ASYA 4EEWA 3VRAB 2C9OA 3C2PA 1TZOA 2KZRA 3HRZC 4C3HG 3HOVH 2F3WA 3Q3NC 2DX5B 3VFKA 2F0SA 1WJJA 1CHQD 1CZWA 4OIKA 5C5LA 3X23A 2A73B 1AZQA 3I90A 1R4NI 4A3KB 2JA8H 4MM3A 1VLBA 4DR6Q 4JYAQ 1Y1WB 2QHOA 3IAS1 4GDLA 1KAWA 3GZNB 4LNQA 2KQ4X 4A3DH 5HG2A 2ZTCA 3GTMB 4NAWB 2JVCA 3TS2A 1VF7A 1I42A 1RDPD 1X54A 3RI7C 4HN7A 1FMAD 1YNXA 4A3JB 3VTWA 1TWHH 2I2YA 2N88A 5HFYA 3NHHA 4QAYA 1AW7A 1STEA 4YWMA 5KRUA 3T1YQ 3UDFA 5H8YE 2E76C 4XGAB 3LWUA 2AMCB 2LGYA 1SE4A 1ENCA 1YQ4B 3T1HQ 2LJ5A 2EYOA 4A3GH 3K0YA 4DV6Q 4AWJA 4FBJB 3ZJUA 2RDGA 1D6EC 3AE4B 4K7SA 2WACA 2BWFA 4JI4Q 4NDXA 3PO2G 2BDOA 4HIDA 1SN8A 1D8LA 3K7UC 5H1SE 1BCPD 4YIJA 2IHEA 2ZNVB 1V6EA 5KHQA 1AP0A 3W9CB 2WV6D 4DHZE 4BKSD 1A15A 4URKA 2CW0D 1H9SB 3Q3OC 1O7YA 1J8IA 3HOUG 3KW5B 1UAPA 1C0AA 1CK1A 4L5SA 4LJZC 2KFKB 4IM2A 4EZLA 5C4JH 1WFYA 4KTAA 2NB0A 1DOYA 3PZ7A 2N7DA 3A1QB 4EZJA 3CCLA 3ML8A 1F2ZA 4BY1G 2HQLA 2LSSA 4LFCQ 2NN6G 2F0OA 3MEFA 3UE0A 3ML9A 1AEXA 4JV5Q 4K0KL 2NBUA 2WB1G 1ICFB 1ET6A 2SEBD 1WXVA 3DVNU 4ALPA 1IW7C 2FCSA 4A3MG 1MFWA 3RNCC 2CH4W 5I9OA 4WWNA 2KVZA 4DK5A 4EE2A 5G3LF 1BMLC 3SEBA 5KNBA 4B3TL 2J7ZA 3I4MB 4RMAA 2K9XA 1TU2B 4TVAB 3P42A 4CHKA 4H02A 2KWVB 2NVYH 3TBIB 1KAAA 4RM9A 1WGDA 3OMCA 2JT4B 2WXNA 1OEYA 4KKJA 2NVTH 3F2CA 2Y5BB 3NRZA 1F0ZA 1X3PA 1SMYD 2DJFC 3N1XC 1DJRD 1FYCA 1NR2A 2E8GA 3T16A 4XTCS 3GV6A 4X62Q 2KWUB 3VDZA 4CDFC 3SK8A 2KUMA 5C6AA 2GOWA 5JHAA 1PYWD 1YX5B 4KZCA 4BVUC 2ID0A 1I4HA 3E56A 1KH0A 1L0XB 4PNYA 1V9JA 1UE5A 5C0XG 5DAUA 3K81C 2QDFA 2JA7G 5CV7A 1G2TA 1NI2A 2R7ZH 5JEAJ 2ICEC 2J4XA 4A3BG 3ENEA 1IYJB 1F52A 2V3SA 2PVOD 3VYSA 4A3DB 2F4IA 2F3IA 2HDLA 1QLBB 3HKZB 5CV9A 1WCMB 2HHHL 2B3AA 1JOQA 4XQQA 2PCFB 2LFNA 2E2HH 3E9SA 1D5XC 2J7QB 3P1HA 3QWNA 1LYLA 3VVWB 1MI0A 3OTOL 3L08A 1NDDA 2G5DA 1L2FA 3K5LA 2N1WA 2E3TA 2CWAA 3HM6X 1QT9A 1L0VB 2JSOA 4EQ5A 2PW7A 3DQVA 4I65A 4ZRQA 3MVVA 4JI3L 3PTFC 4I6NB 1SNMA 1V43A 4AYBG 4JX1C 3PO2H 2RA4A 2L55A 1QVFA 3OJ3A 1L1OA 1FL0A 4K6LA 1S5FD 1VQJA 1FD7D 4MJSA 1Q82C 1PHJA 3H0GH 3S17B 5EKKA 5J18A 3AEAB 4RHRA 2LJIA 2AQ3B 1WXSA 2JA5G 1VQ5A 1TT2A 4RA8A 1L6UA 3UDGA 4YWKA 2E6XA 4ID6A 1ZOYB 2L12A 2B63B 2LVPA 1A2TA 1E2VA 3OLMD 3S2DB 1Q90A 2RBMA 3HOXG 1AWDA 5C44G 4HEA1 2KXJA 2JEAI 4AQ7A 2NN6H 3J80L 3PV1A 3L10B 1LUZA 4GDKB 2A1AA 2JRIB 4ZYSA 4LF5L 4A9AA 4ACFA 1HQRD 3M4OB 1B7YB 4TQ0A 4MELA 1SYGA 3STBC 1WVLA 2EQSA 2FCQA 3AE8B 4A90A 4YT0B 4DR5L 4YTMB 3QQ8B 2F0UA 4RKBA 4IALA 5CGKA 4ME5A 5EBCA 3AI5A 4CYEA 4DDID 1WJ6A 3NJTA 3MFGA 3V05A 1VQ4A 3H94A 1VQAA 3D0FA 4JBWA 1H9JA 1PH4A 3PVLA 2XK5A 2P5ZX 2C9WB 3JYUA 1TJEA 2X8XX 4M8MA 1HZ5A 2KJXA 1DD2A 4N6EB 4PYUA 3RMKC 2PMZE 2CJOA 2VRRB 3Q8BA 1SSOA 4RCOA 2B8FA 2BVCA 2DNCA 2LMCA 3DWMA 3P4QB 1I4QA 4MM3B 3DVGX 4PS3A 2CH4A 4EQPA 2ZW0A 4IM3A 1JALA 4GDLB 2X69A 3RN5A 4WURA 3TDQA 5AJ3L 1QKZA 1Y1VG 3CP0A 3NENA 2YVCA 1X9NA 3AMZA 2QIEB 3X0WA 2CKZB 2I38A 2KVRA 3PO3B 2D0PA 4N9TA 1GUOA 1B44D 4K0KQ 4BBSG 4A3BH 4W9EA 1L1OC 2B3GA 4DAMA 1Y56A 2PKOA 2K39A 4OXPA 2XRSD 2R7ZB 1JJCB 3CC4A 1V5OA 1XF5L 3TQYA 1PYBA 1GUAB 3VAWA 4RM8A 4JI1L 4A3EG 1NR4A 5CTRC 1ACCA 1IUEA 2MQJA 3SFEB 1C78A 1PH5A 4B3TQ 1JRPA 2F0PA 2Y0SE 3I56A 1I4PA 4Y52H 1P9DU 1FM0D 3F2BA 2L3ZA 2WP9B 1PRTF 1YN3A 4JPBW 3HZXA 4F7XA 1GUNA 1GAQB 5BYSA 4DF7A 1EYAA 4HIKA 1KF6B 3I4LA 4DAPA 1GM5A 2ONQA 3RZOB 2DZMA 2HD5B 3M4PA 1SE9A 4LDTB 1G6JA 4L8JA 1WGRA 1V1OA 2AQ2B 3M9BA 3DLLA 4WIPA 3MWYW 1W6KA 4QB4A 1RTOA 3B9JA 3EQLC 2MJ8A 4IUUA 2K8BA 2OJRA 3SK5A 1WF9A 5FR6A 2QEXA 3VR9B 5CMDA 3L0WB 1WR1A 1SJHD 3JSVA 4LF4L 5C0XJ 1C8CA 2UXBL 5TSSA 3DCGA 4BBRB 5C1ZA 1IBXA 2IBIB 1HNXL 1P1AA 1X3GA 3NVWA 3DHQA 1L6VA 2KCNA 4ZRKA 1PQSA 2OQ0A 3TP8A 4GN4B 2AWOA 2K6QA 2O4XA 1WX8A 4OX9L 4XT1B 1NNXA 1CQVA 3VHTC 1MHHE 2VZKB 2PW9A 4RAUC 1XMOL 2H4OA 3M62B 5E6OA 2RPVA 2HHHQ 3Q8EA 4JI5L 5GXGB 1UELA 2N9EB 1HA5A 1MGSA 2OJWA 4M02A 3SD5A 1YIWA 2F0NA 4DXAB 3TN2A 4DA2A 3SU8X 2BQQA 3VYTA 1RF2D 3SR6A 3ZGZA 3APFA 4KV6A 1LM0A 4B9WA 3OTOQ 3ABVB 1Z9FA 1FRRA 2L15A 4KDLB 5J3BA 4WORA 3AV8A 4DR1L 1PFNA 4JI3Q 2KX3A 3N1ZC 1QOHA 1AN8A 2EYLA 2K5DA 1WWTA 2W82A 2MPMA 4KDIC 4IFDG 4FA6A 3ULPA 3VA5A 4HIOA 2ZJRA 4K6DA 1KC8C 2G3QB 5CV4A 2RDHA 3S1MB 4IN3A 1BBWA 4G3XB 4V190 4YSYB 4XWWA 2YU9B 3PGEA 4MEMA 3VUXA 4KY6A 2FE8A 1FR3A 5LL6X 4GN1A 4OZBA 2F0VA 1UZXB 1WIAA 2FAZA 4RH6A 5JZEB 2G1EA 5LMUL 3A56A 4Q0FA 4LTUA 1N62A 2OTJA 1P0RA 2BYTA 3P63A 3RLOA 5JHBA 2V1CC 1EFWA 4LF5Q 4BBSH 3WAOA 3G7LA 1BBXC 2GBKA 4FF1A 4GOPB 2ZVNA 4DR5Q 5BYRA 3Q8CA 3PRPB 3J7AF 4A3EH 4JL9A 3APDA 1Z6HA 2Z4HA 3RMHA 2DHZA 1IBKQ 1XO3A 1WYGA 3C1EA 3CHBD 3OIQA 3M85A 1SNCA 3AXCA 4K81A 5DLQE 1TWAH 1UF0A 4ABNA 1LT6D 1LM8B 2C5CA 2Q8TA 4P73A 4N58A 4EQOA 1L1OB 4B9KA 2RPQA 2M4NA 4MJSB 3DWGC 3R8BA 1XPOA 3MP9A 1MI2A 1E0BA 5AEKB 1O7IA 3CRLC 4JBMA 4ITKA 3TCAA 2BCOA 1Y69U 2HT1A 1YHAA 4X57B 5CHFA 4J3OD 4JQWC 2QKIC 3W1YA 2DYMA 2WAQE 1GG3A 4GN5A 2N7JA 4RGTA 4R4QA 4WJOA 4G50A 4BWGB 2K33A 4DXFA 2JA9A 5GQOA 5IP9H 5AJ3Q 2W3SA 5GAGC 4GOCA 1WM3A 4IPCA 1RJTA 1YITA 3AQQA 1KLUD 2WFWA 1YJ9A 2BT6A 3Q2AC 5K36H 5ISRA 4EGVA 2E2IH 2CVRA 5FLXL 3HOYG 5EE1A 1N5WA 3ZNGC 5EKLA 2ENBA 4IPHA 4LLGM 5IYDG 1C4QA 3K80C 1IGCA 2IO1B 4CO7A 1I6VC 3WDNA 2NS5A 3AEFB 5IIFA 2DNEA 1R9TB 1SSNA 4JI1Q 2EZVA 1ENAA 2QA4A 2XK5B 2B2UA 5FLXE 3CCMA 1RFKA 2MSED 1KNEA 5C4XH 5FO9B 1TWCH 1PFDA 4NAMA 2AUKA 3RUZA 2F0KA 4YCUA 1TS2A 2GVAA 2JWUA 3OIPA 4K7WA 4MIUA 1IW7D 3X3NA 1SFOB 4C7YA 2KTRA 2UUAL 4KVGB 4MH0E 5L37A 4P72A 5KHOA 3V3XA 1BQQT 1IPGA 4JE3B 3S1RB 3KOJA 1WD1A 3R3MA 2HJ1A 4IFDH 3CMEA 1WXMA 3WIMA 2V4IB 2EELA 2K03A 1QVCA 3HS0C 2DUDA 4LF4Q 2FNJB 2UXBQ 3L54A 3N52A 1Y8PB 2OTLA 1R7SA 2JWZA 4HJ9A 3NBHA 1AZPA 1HNXQ 3KUZA 1YVCA 2JU6X 1DOMA 1JOOA 1V1QA 3MFYA 5CHWA 1GHKA 2B2TA 3DVNV 3HEJA 2KDMA 4CJ0B 1Y1WG 2DYBA 4MGKE 4CKEA 4HROA 4DAYA 2FINB 4OX9Q 3GTQH 3UINB 1N63A 1CZGA 3OWEB 1XMOQ 4H2AA 3QAQA 4M00A 2DGYA 4P16A 2FJ2A 1BBUA 3CCJA 4A3JG 1DOXA 4JI5Q 1XCTL 2WQYB 2N7EA 3W5OA 3H15A 2BYVE 1LFDA 1V80A 2ON8A 5E6PA 3K9PB 2D3GA 5IGEA 1K83B 3EROA 5J22A 4ANWA 1T0YA 4IZ8A 4TV3A 3CD6A 3WA0A 2MWSB 1HZBA 2BS4B 2UU7A 4NAWA 2M1MA 2EDGA 4DR1Q 3HRDD 2K4KA 4LDTD 4R4CA 2KCTA 1YJNA 4JI6L 3U4EG 1X3EA 3JSVB 4NY0A 3U30A 1QQRA 1IBXB 3QJYA 2WXFA 1TIID 1VQPA 1U4AA 1WH3A 3G4SA 3M3YB 3B2GA 4JVZA 3BZCA 3P2BA 4S0RA 5CR3A 5K5PA 4BY7B 3RN9C 4ZAIA 5E6NA 1O7ZA 3QR8A 4NW2A 4U673 4A3CG 3PQIA 1JWBD 1VCBA 4G7HC 2N9LA 1MHXA 2K01A 5CV6A 3S1NH 2L32A 1QOFA 3CRKC 1F77A 3RFZB 3S14B 1UE6A 1F2YA 3CCRA 3GTOH 2WKDA 4KKTA 5LMUQ 3U52E 5DCNA 1TXYA 2VZKD 1QUQA 5HGQA 1WJNA 3HK0A 1VQDA 5BMIA 4DAVA 2E2IB 4Y7NB 5IYDH 4KD4A 1MD2D 1YQ3B 5M3MB 4M0WA 1RTNA 2I07B 2LUEA 1XLOA 2R3ZA 1DGSA 3P4RB 2QC8A 2HDMA 2D5GA 2K5VA 1N34L 4BFRA 5IT9c 3AFQA 1P7FA 3UF8A 1CQFA 2Z0SA 5C4XB 2NZ1D 1UBIA 1TWCB 3STBD 4A4IA 2LRUA 1G291 1CUKA 1RWSA 1PGBA 4NPNA 4AP4C 2WXQA 1OQYA 2F0GA 4A93H 2M17A 5IOCA 4YXDB 3CCVA 3KYCD 3OAWA 1UH6A 4BZAA 1B2TA 2UUCL 1MIUA 4FXGC 5GADC 3ND8A 1VQMA 2WLBA 1CFMA 3BZDB 3QB3A 4QJFA 5LHY1 1VQFA 1ZEQX 2HE7A 2PI2E 1J7CA 1OXTA 4QGUA 1LXDA 4L2YA 2L0TA 2DZKA 2MBOA 4LUZA 3D4WA 1V8CA 1VZ7A 4A3KH 2QCPX 3T3OA 3AEEB 2GBNA 2BH8A 4A6QA 4ASWC 2ZVOA 1A0IA 1EL0A 1XEEA 1STGA 2SAKA 1LT4D 1KRTA 4B3ML 1PUTA 3N20C 3AM9A 1TS4A 1PGXA 3GTMH 4C4VB 1A3VA 4A3DG 3NEMA 4H13C 5JPMC 3CWIA 4XDXA 3Q14C 1X65A 3HKZG 2HDEA 3SDZA 4IC7B 3R2IA 3W5VB 4N9PA 4UHVA 1QNKA 2M00A 3O65B 3KWVA 3I3CA 2LVQA 3IFWB 1TIFA 4B6WA 3OJ4B 3OSOA 3NE5B 1K3RA 2R93B 4ARCA 4A75A 1DM0B 1K28A 1WXQA 4W9HA 1KDBA 1E24A 1NE3A 1WGKA 5IAAC 4LNIA 1GOZA 2UUAQ 1AARA 4L1BA 4ZRIA 1WE7A 2RHQB 2N1VA 1B1ZA 2FHTA 3MHBA 3IT6B 2FIFA 3NWSA 2FCNA 1EQQA 2RR9A 2ZW1A 4IURA 4PV1C 4DR7L 2IY0B 1WYWB 4X3UA 1KHIA 3IL8A 3BVGA 4AH6A 4CHTB 1YMHE 2W9NA 3RYTA 2PNHA 3Q8AA 1YIJA 3CMMB 4FF4A 5EPLA 1PMRA 5HGTA 2B63G 1EFID 3T4AC 4XIGS 1EO6A 4KSLC 5HKHA 4C56C 4PMCA 2JN4A 5IP7H 5EQ0A 3S1NB 4B95A 2RQXA 5HHDG 1STNA 4IUMB 4FP5D 3TP6A 3ALBA 1BOSA 4DR3L 1FGBD 4OO1H 2KENA 2ICIA 3H3VI 2GBMA 1I4RA 1ASZA 2LGDA 3QARA 4MACA 1KOTA 4IWQA 2PQEA 2N9XA 3TRZA 4MDKE 3NBIA 1DYQA 1F2RC 2N8NA 3U9SA 2XTIA 2SNMA 2F0JA 4R4IA 4B3SL 1I4GA 3H91A 3OPOA 1FNVA 4IUTA 4LW1A 2VUMH 4ZRPA 2DLBA 1ZPSA 2KTRB 2RDFA 1E8ZA 5CBEE 3I4MH 2LGIA 1SAPA 3G6JB 1B53A 4JWUC 4GKJL 1Z7TA 3UDXA 2Z6KA 1PRTC 4MH8A 1Y14B 3KLRA 4FYDA 3GD7A 2VY3A 1K8GA 4YTNB 3TBLD 3MXPA 4JI6Q 3JC66 1HZAA 2B8GA 4GNXA 3NXWA 2BGFA 3T51B 1N33L 1YI2A 2NN6I 1O7LA 2K3UA 3Q22A 3NBHB 3RUIB 1DOLA 3PIPA 4A93B 4DDGD 2V3PA 3Q23A 1IL2A 2BKRB 2EVBA 2AHOB 2EXDA 3K8AA 4POGA 1XT9B 1TWGB 1GHJA 2IDYA 4HDQA 3HFZB 3OWFA 1NENB 2CHWA 1BUVT 1VQCA 1E2WA 2W55A 4DAYB 4BKTA 3NSWA 1CKNA 1OXXK 3VUWA 4IM0A 2VS1A 1FO4A 4EKUA 1LQBA 4YCWA 3CQZB 1P3QU 2JPHA 4B0EA 4IQZA 1V86A 5J2RA 4YTPB 4HR7B 1NY4A 5GROA 5D94A 2LS01 2UU9L 2R7ZG 1G2SA 2E2JB 2K25A 1HTPA 1WM2A 2OEDA 4GKKL 1EY7A 4WWPA 5LLIA 3VR5A 1NTGA 1WCMH 1GNUA 2INCC 3L9AX 4X65L 1KABA 3Q8FA 4DBGA 3A5UA 2WXOA 1MBYA 3OW7A 2UYZB 1NVID 3L16A 4HPPA 3E9IA 3QWZB 2H5XA 4KMUC 1N34Q 4JC0A 2RGFA 4KD3A 3L0OA 2I1JA 1I50B 4BA1I 1VQ6A 3KK7A 2BWES 3PF5A 1VQBA 3UE1A 4A76A 2V4DA 5C0XI 3A5ZB 2KYWA 3RNAC 4ANXA 2JRHA 1P8LA 4HRSA 5IOIA 2WXHA 1HQMC 1KRSA 2B76B 3FC4A 3HOWB 1R4MI 2UUCQ 3MTSA 2NVUI 1MJCA 1H9KA 2H1EA 1EUVB 2QEJC 1I6HB 3U58A 1U0LA 3S17H 2B2VA 3AE7B 1A6XA 1NYQA 4PZ8A 4HMJA 4BBRG 1D2BA 4J6HA 1Q86C 3H0GG 3NTKA 4FNFA 1QUQB 4WWMA 3TZUA 4PS8A 1QOAA 4PS7A 2Z6KC 4NXNL 2B63H 2D62A 3GS2A 4MSQB 5JXVA 2MBEA 4M0WB 2IZVB 1ILQA 3DPDA 3FAHA 1C4CA 4F7ZA 3S2DH 3F8TA 2A74C 3V61A 3QG1A 4FF3A 3IXSA 4B3MQ 3UI3A 1RYJA 2L00B 4N59A 1NYRA 3HGBA 3Q3FA 2JZPA 2LGXA 3M4OH 3SFDB 5E1FA 3MC0B 5G55A 4ZHOA 4POFA 1EY9A 4LF6L 1GUGA 2D2QA 1VRAB 1JJGA 1L0YB 1O78A 1L2NA 1OXSC 4CJ2C 1ENFA 4LF8L 3AN1A 3ZUNA 4ZYNA 2I5MX 1JRUA 2VUMB 1N9WA 1TBEA 4NKLA 4LAAA 4ZUJA 1RLFA 3DOWA 1IP9A 1JR0D 1E7PB 3VTUA 4ANUA 3CCEA 2J0TD 2L1AA 3R7RA 2RD0A 5KEEA 1SGHA 1ZUD2 4WAFA 4GLVB 3BZKA 3S9WA 1X3FA 3CC2A 1UWVA 4HKQA 1EZ6A 5JJZA 3U2SC 3N30A 4TMAB 2MW5A 5J39A 1M1KC 1UBQA 4EX5A 4DR7Q 4XQJA 2CQOA 3HM3A 4ANVA 2D3AA 5GMVA 5FLMH 1E8XA 2BKFA 1C76A 3D31A 5EGTA 1YJWA 3GE8C 1PRTB 2XIWA 4YY3L 5BR8L 4HJ7A 2EJGC 2HUGA 3K0XA 2LGSA 4IW0A 2YV5A 3CPWA 3A8JE 2R6GA 1JWSD 3E0JA 1K3BC 2BW2A 2PZTA 3C3LA 3PO3H 1QVGA 4DR3Q 1WD0A 3I63C 1GJZA 1RD9D 3NQIA 2KFJA 1U9RA 2ZPNA 4GU2A 1AFPA 2KDBA 3H6NA 2ZT9C 5JVH3 2MX2A 1OQRA 5EE0A 2PQAB 3JAMc 1AE3A 3A9KA 3ZVVA 4B3SQ 2KK8A 2JY6A 5IT9E 1HA6A 1YX6B 3PGZA 2DNFA 2M56B 3MJ5A 3Q3MC 3DMUA 4CDCC 4PMWA 1MSHA 3GTLH 4J15A 1G6PA 3DBRI 1SNOA 3A0JA 3PUZA 1YBYA 4GKJQ 3T3NA 1KLGD 4DV4L 1BNZA 5JJKA 3RCZA 3T56B 3F1ZA 2V4LA 4YSZB 4OWWB 5I4DA 4LK0M 1WTHA 3RZOH 4GOPA 2DN8A 1N33Q 2NYZD 5AUIA 1HJPA 4UP9A 4H0LC 1WMHB 4KGSA 2EYFA 1Y8OB 5G3LD 1E5WA 1XLPA 2N9PC 3JW0X 3TZDA 1E0ZA 2ZXPA 1LT5D 3E9HA 4TKOB 4LNOA 4PT5A 2E75C 3HKSA 5D7GA 4BBRH 1OO9B 4P1BC 2LD9A 2BOSA 2CWPA 2N4FA 4WAAA 3C1FA 1ZXTA 3J81c 4DHZB 2WXGA 4RMFA 2L5TA 3AH7A 3I55A 1EU3A 4PZ6A 1CA5A 1W2BA 3I57A 2Z0EB 1WX9A 2NTTA 5J1ZA 1NMGA 4ILWA 2K6DB 5CHVC 3ERSX 1X6OA 2UU9Q 1Q46A 2LXKA 2O5IC 4JLCA 5ELDA 4ODGA 4GKKQ 4JI8L 1IBLL 3QOJA 4GS3A 3NVVA 1A62A 1RIPA 4X65Q 1A8VA 1HHVA 1H4RA 2RDBC 4ZRJA 4YWGG 5ELNA 5D6JB 3RD2A 4A3FB 1D4BA 4AJWA 4F1SA 4GNXB 1NI3A 3A7LA 4M8AA 4IUVA 3DBLB 3SK4A 1EY0A 1K52A 1PH9A 5C3EB 2EKEC 3UDIA 1IBKL 3C46A 2JA6H 2F0DA 1E2ZA 3IFDA 1YNTE 5T1IA 4HWIB 1QE6A 3V62A 3DHGC 1UEAB 2B2YA 3PIOA 4HCEA 2JE6I 3DEOA 2ZXOA 2K5QA 5IP4D 4LNFA 4MSMB 5E3FA 1EF5A 3ZIMA 4RF1A 1TKYA 2J0MA 1CKNB 1S5ED 4IJLA 5FKAC 2WB1E 4RFBA 5EJWA 1WTWA 4DUZL 3S1MH 1YJ1A 4FHKA 1LTSD 1JROA 2DWQA 2AL3A 2YU9H 2WX1A 5C2TB 1L7YA 1S72A 1XTCD 3T53B 2KA7A 2PZWA 4P75A 4NXNQ 4KKSA 4DV3L 1PZID 1PA6A 1E7VA 4GOPC 4B08A 1EYGA 1WTRA 1OEYJ 4J6IA 3AU4A 2XVSA 3KFUA 1PVOA 4EZKA 3DWPA 5LNK1 4IFDI 4IPDA 4L5RC 4LF6Q 1JMCA 3WWVA 1ILPA 3GTKB 5IO9A 1YNJC 3ZW3A 3MZ5A 1BF4A 4LF8Q 2XNAC 2QMTA 1IXRA 4BBNF 5BMHA 5CV8A 5IYCH 5BN5A 5I9PA 1C7YA 3GTLB 3DBSA 1HZ6A 4HJ5A 5IGCA 2UXDL 2KC1A 4JPSA 4NMZA 1MJEA 2WIIB 5DPRA 2IY1B 1SROA 1AE2A 2L11A 4GLXA 4WWOA 2YYZA 2JYOA 1VQ7A 1RRBA 3K6OA 5A35A 1VS0A 5DM63 1EQVA 4A3LG 3GTPB 1EOTA 5IGFA 4QF4A 2C7NB 3TS0A 4I7AA 3CF5A 4EVOA 3L17A 5BR8Q 4YY3Q 2NMQA 5ELFA 5FOBB 4C7ZA 3ULLA 2PE9A 2KMMA 2PIAA 3B08A 5IP9G 1BT0A 3JAMi 2B2YC 2K1BA 4KN7C 4DK0A 3RZWC 1HTOA 5K36G 3PO0A 2EYHA 3VYRA 4E6IA 4R4TA 4QCLA 5M3MG 4DNTB 2D10A 3K9OB 3F2UA 1QZEA 3NS8A 2KEEA 1V1PA 1SEBD 4LF7L 4AYBE 2F52A 4CDDC 1R9TH 2I5HA 4KZ0A 2D3CA 1STYA 4LUVA 3BYTB 3SXHA 2IX1A 1JWAD 1L5PA 4XWTA 2O6VA 1I35A 2KNBA 1F9JA 3VA7A 1B8AA 1Q8IA 3DBHI 2BDNA 4DV4Q 3Q8DA 5C4XG 3QJZA 2FBWB 3ZNZB 4K3BA 1XYIA 4WJQA 1R4PB 1SFOH 2JA6B 1YJIA 2MLBA 1KTKA 2G9DA 2MBBB 4R1JA 1ZW7A 3S1RH 2LWPA 3QA8A 2YEPB 2ZPYA 2IGDA 4GMVA 5DPTA 1T5XD 5AFWA 3A55A 1H9RA 1G6ZA 1LTLA 1YZ6A 2NBWB 3J81i 3ICEA 2IGGA 1PRTD 2SOBA 3BY4B 4OW0A 5D14A 2V3NA 3MJWA 5FJ8H 3WALA 4H7BA 4C3JB 1IBML 5I2XA 1HZCA 5KYIA 4NQKE 1EU4A 4N8FA 5FR3A 1V81A 3KH0A 3PSEB 1E90A 5E6JA 1X3QA 1XTDA 1VQEA 3QO2A 3BVZA 3V96A 1V5TA 2LFIA 2DY8A 2ZJQA 3MC8A 3A9KB 4NPSA 1D7QA 4HJKA 3K5MA 2HIXA 1A3TA 4USAA 1YOVB 3DWAA 2OOBB 2PTLA 4US8A 3G6EA 4IO9A 1R4NB 3SR1A 2CFMA 2ZTEA 4L5TA 3AE6B 2OWOA 2QSDA 4JI8Q 1IBLQ 2KQ3A 4LWCA 1VDVA 1IKMA 3SK6A 2N0SB 2KWCA 1DGJA 2WXJA 3PZ8A 2EYJA 1PH3A 2JZZA 3LYYA 3X3MA 3LWEA 2BE5C 1K83H 1TWFB 2X6LA 4JWSC 2R93G 3P75A 4C4VA 2Z4IA 2IJ0A 1G51A 1A70A 2KQ7A 3PZDA 3UGBB 3TEYA 2KCCA 1TKWB 1LACA 1SNQA 4WJWA 2Y0SB 3H6MA 1G8ZD 1NAPA 2GN5A 1F9RA 2R61A 2A4ZA 1FXTB 2LXCA 3AECB 2L0CA 3HP3A 1FJGL 4A20A 1GC6A 2R2QA 4A3LH 3C0RB 3DDCB 2JA7B 3EVQA 4DUZQ 3M3YH 3FILA 2IL8A 5C3WA 3FKYA 4BY7H 2AL6A 3A4RA 3PRZA 3VRBB 1PDQA 4A3OA 5EKIA 1WTPA 3A9JB 1KDAA 2M9VA 4LCDE 1STAA 3TSSA 5I2YA 4DV3Q 3GB1A 2K14A 3S14H 1NEKB 2Z0DB 4UAIA 1WYDA 2LHDA 1F9PA 3JAME 2JQRB 4H44C 4FADA 1A3UA 2YTVA 1EWCA 3SHLA 3VR2A 4R4OA 4Y7NH 1MVKA 1RCVD 5M3MH 1IYVA 2EE1A 1WTVA 1Z2MA 1HFGA 3KF8B 4W9LA 1RKNA 1LTBD 1VCIA 1XNQL 4FO2A 2ZTDA 4B3RL 1TTNA 2AEHA 4IOAA 2PMVA 1JWMD 2CQAA 1UNSA 2BS2B 4RG1A 4XYOA 4M8NA 4W9GA 3OMGA 5KNCA 1J19A 2KJRA 2NR2A 4W9DA 3U7ZA 3OHXC 3DHHC 4ZUIA 1DCZA 1JCKB 4NB3A 2UXDQ 1C48A 4KHZA 4K5VA 5C3XA 2KO3A 3DXJC 2GRIA 4FDBA 2DYOA 2CU3A 2Q8IB 5G5GA 1EM7A 3A8IE 1IL8A 1Q5WB 1II3A 1VQIA 4A93G 4QL5A 2B29A 1SJED 4KJNA 1PGAA 3ZQ4A 3R66C 3HOXB 4BOZB 3L3OC 5EE9A 4FJYA 2F0QA 3J81E 1PLFA 3EBEA 5T8IA 3I70A 5IY0A 3KQ4A 4QIWE 1WGGA 3MHZA 1B3AA 4XXEA 2ALYB 2CR5A 3CAMA 2INNE 5M5XH 1LO5D 2GLSA 3U7DA 4A3KG 4ZDVA 1LV9A 1EEID 1X56A 3NP8A 1WR6E 1HR0L 3ZDMC 1SE8A 5BN3A 5IWAL 5JJLA 1KLVA 5E4XA 5IODA 2ZEQA 4XC2A 4LF7Q 1M94A 2PI2A 1LGRA 4X3SA 2I0QA 2CU1A 3PF4A 4IWOA 1ML0D 2F1MA 5IYBH 4G7ZC 4KY7A 4NXML 1N5XA 2YEPF 3A33B 3V60A 3P20A 2CJNA 1PTOF 3AU7A 2BB5A 3E5SA 3I8ZA 2WXPA 4FXCA 3D4RA 2R93H 2IX0A 2NZOA 2WX0A 2EJFC 1KL9A 3N32A 3TUOA 1UWMA 3J7ZC 3DBRB 4RKLA 1FCLA 3IAYA 4IFDJ 1SIFA 4MZ9A 2DJGC 3GV3A 2XSCA 5C4ZA 1E8WA 1GO3E 1Y1VB 1FRDA 3M7GA 3HOWG 1BDOA 5COYA 2BYEA 4BAXA 4QMGA 3NK9A 2NVQH 4DV2L 4CJ1B 4HSVA 1QOBA 4DUYL 1SF0A 3GQBA 1EIFA 1JQ4A 4KKIA 4RGOS 3LJ3A 2XGTA 3DWQA 4JGHB 5DEHA 2LZ6A 1CM9A 3ZJVA 2ASQA 2WS3B 1IBMQ 3NG0A 1A2UA 2B2UC 4JG2A 4DHJB 2PZUA 4KSKC 4K7UA 2LY7A 3WCQA 2WAQB 2WHIA 4MTKA 3AFPA 1XXGA 1T0QC 2VH2A 2D07B 1EZ8A 1Q1OA 4KIKB 1V1PB 4HJ8A 2RCFA 2YLMA 2GA4B 1VZ8A 3PUVA 1HTLD 2KT7A 4M01A 2R7FA 4RGNA 5IP7G 1NSNS 4EFOA 3BG3A 3EIVA 2O6VB 4V0BA 3KUPA 4BS9A 3S15B 4OO1G 2A19A 4DK1A 2C7MB 1EY8A 1Q12A 1UWXA 1EIGA 4K8JA 3WANA 2F3VA 4WQMA 4E74A 3ZJTA 2F0IA 4HKZE 1KJTA 2Z8LA 4XDDA 1HXYD 1GJXA 4TKNA 1OXVA 3ZYYX 4DNIA 1ZP0B 4ZCKA 4FXDA 2MBQA 2VUMG 5JH5C 3BJUA 4O2DA 1ONLA 1GVPA 2KCMA 1GUWA 1ICWA 3PIP3 3I4MG 2Q5WD 2WKCA 5LXIB 4C3IB 1C79A 4A3PA 1L4DB 2B2TC 3NTIA 2A8VA 4RF0A 4KN4C 5JJIA 4W9IA 3PUWA 3J7A5 1FJGQ 3CW2C 1J7BA 3RNFC 2A68C 1IKLA 3DUZA 1TWGH 3D3RA 3Q69A 1B9MA 2CHBD 1GKHA 4HCPB 1VQLA 3N3KB 3ZTDA 1XCQL 2MHJA 3K5NA 1S4ZA 1ZKOA 3ZRCA 3VTVA 2CCZA 4AOFA 1XQQA 3ZTCA 1RL2A 2OT2A 2I1KA 3D8GA 1PZKD 1STBA 4IDIA 2G9HD 5G2NA 2KDIA 2L4NA 2MEKA 3I73A 3CQZH 5FO8B 3C8YA 3WAMA 4ZQ3A 4NZLB 4YHHL 3TP7A 2RMMA 2Z59B 1PZJD 1UE7A 2L9HA 5M5XB 2J42A 1RAXA 3CCUA 1E8YA 1C4AA 2Z9HA 2E2JH 4OEMB 3SVMA 2WDRB 3KLSX 3LNNA 1XNQQ 2RHSB 4B3RQ 2D11A 1U5KA 2K04A 2JXXA 5M5WB 2LASA 4DQOC 1CHPD 2WXRA 5KIXA 1HNWL 3AE1B 2WDTB 1WCMG 2MJEA 3RZDH 2OXPA 2PLPA 5I6WA 4JBKA 1I50H 3P4SB 2Q2UA 1BO0A 2PQAA 3ZDTA 5T1GA 4JOIA 1BUIC 4L23A 2NCNA 3FILB 1LABA 1YNJD 1P7EA 2IX3A 1UEBA 1Q10A 2PPHA 3PPAA 3GP7A 1VDZA 3KJPA 1XWEA 2WNMA 2ATWA 1SB3C 4LJPB 2IO3B 2NBVB 1C9FA 2PJHA 3HOWH 2PO4A 1EYCA 1HE8A 1VJKA 2RSNA 3BDCA 5C4HA 3I4NH 1P16A 4OZAA 5FK9C 1I6HH 2NVQB 3W1BA 1ZXHA 2KC2A 1EQTA 1T9HA 2F0FA 5G5HA 1QB5D 3VR8B 1RODA 4HXDA 3ERQA 2EY5A 2IGHA 2CKHB 1XLNA 3U50C 2R92B 1V8QA 2BA1A 1YNNC 4EOYA 1WMHA 1U4RA 3A54A 3FKIB 3EN2A 2EMTA 1JOKA 3R93A 1T6BX 4KX6B 1YEZA 4PK1A 4Q5VA 1P98A 4DPGA 4DR4L 3NUHB 4KHVA 1EOVA 1HR0Q 4KY5A 3L2PA 5IWAQ 1EWHA 4GLAC 4ICUA 4PZ7A 2K22A 3IG3A 5A2QL 1JMLA 3KYHC 1LTTD 1ROEA 4IOCA 2QDLA 3J80c 3ETRA 2XRQD 4KGRA 1J5EL 4PYZA 1U4PA 4K8IA 4L5QA 2ZJDA 3BVMA 4DV5L 4NXMQ 1TKGA 4A3FG 3AB9A 4ULLA 3L13A 3I4OA 2BB6A 1JQYD 2K28A 2J53A 1LTGD 2N9KA 3R2TA 1D5ZC 1FXIA 2C5LC 3NVYA 5C3EG 4OGQC 1TKEA 2JZ3B 4X66L 2L83A 3Q3JA 2WINB 4BBNC 2N55A 2JXTA 5A2QE 4ZLTF 4W9JA 1U4MA 1PFBA 1CA6A 2ZM6L 1VQHA 1H9MA 4APVA 2PW5A 2M0XA 2M19A 2GB1A 2A5HA 3ECIA 3PV0A 2A6EC 4DV2Q 4WJ3M 3NELA 3IT4B 3TIXA 1CI3M 4KJOA 1B4OA 4DUYQ 3HOYB 1L0WA 3I7FA 3AEVA 1QZHA 3UQBA 3C19A 2XN9C 2K75A 3GTGH 5FLMG 1V9PA 1SLJA 2IO2B 2KLGA 3MHSD 1SE3A 3U4ZA 5LL6S 1I5FA 3FEWX 4E71A 4YSXB 3PCOB 4JOIC 2KQSA 1SRUA 2K32A 5AZFA 3PREA 3U8ZA 2LI5A 1NBFC 4MGYE 2C7HA 1I3QH 4A3IH 1BCPF 3PO3G 2KACA 4DWFA 2K8CA 3QHTA 2N78A 4HMIA 4C80A 2TSSA 3B0AA 4US9A 1ZYRC 3M4QA 2BTEA 5IA7A 2LXAA 1GPXA 3TMPB 3PHWB 3SGIA 2OQKA 1BXTA 3UQAA 3RZDB 5M9OA 3M63B 3NVZA 2KOXA 2MJ3A 1EIHA 1RHPA 4K5WA 1PFMA 1D1IA 3EA6A 3PLVA 3DVGY 3NZ3A 4G57A 3ZXRA 2BE5D 1IYFA 2IWHA 2KBNA 1MSGA 5L95C 1J0GA 5F2DA 3PSIA 4OL7A 1QOGA 4OHJA 2BA0A 3H7PA 1PH7A 1TZ1A 3I4NB 3HKZE 4AQYQ 3WAPA 4DHJD 3HHMA 2UUBL 2UWQA 4LFBL 2I5LX 3BK1A 3MC9A 3MEHA 1ZDVA 1VR9A 2V9HA 2AUJD 1SNDA 1QG7A 3SHQA 4M1UB 4X3TA 3L7ZC 2KVMA 2PPBC 2NVXB 2AWTA 2KLCA 2W3RA 3BU2A 1XPUA 2HJ8A 4YHHQ 4IKGA 1GD7A 1SYCA 1YQBA 2O6VD 4GLSC 4P71A 4GNXC 1K9MC 1GB4A 1F2MA 1E7UA 4HJGE 3G48A 3M7NA 3UIOB 1S5BD 1JW9D 3CU7A 1YHBA 1JT8A 4OWXB 5GAEC 1SYDA 1HNWQ 3PUYA 5D65A 2VQFL 4A3FH 2NPTA 3ONSA 3PIO3 2F0LA 4G4KA 1MKHA 4C2MB 3ZKJC 2KHSA 3VR4A 5C3EH 1VQOA 2K5NA 2K05A 2KMAA 4GB9A 4U68A 3HUIA 3KDFA 4RCNA 2JA6G 4KHPL 5TR5A 5ELOA 2JX5A 2OCEA 3NTHA 3VXWA 1HUMA 5IGDA 3WOEA 1YN5A 5M3FH 5AZGA 4PQXA 2KAJA 1FFVA 1WFQA 3W3AA 1NJIC 3P7JA 2MJDA 4C3JG 1RM6C 3L4PA 4RWSC 3G71A 2A69C 3BS1A 3ZXVA 2QILA 3GTGB 5H92C 2Q2HA 5JEAH 3J80i 2EJMA 3BINA 5MPOA 1OGWA 1EQRA 3HOZB 4GIVA 5IT9L 4DR4Q 3LB8C 2VW9A 4OVVA 2UXCL 2Y5PA 3S16B 2K8HA 3QIAA 4MTNA 1I3QB 4F87A 4A3IB 4GN3B 2F03A 1J5EQ 1HTQA 3AE5B 4HJAA 4JI2L 3GTKH 1Q1EA 1CKOA 4DV5Q 2CHXA 1MJDA 4NJ7A 2GVBA 3ZJYC 2B2VC 1XMQL 1H95A 4FJZA 4XDCA 4AS1A 1EY5A 1V2YA 1DXMA 2SDFA 2JQOA 4X66Q 4JK1C 2DAFA 3K59A 1B3QA 5IYCG 2ZM6Q 2ZCBA 2Y0SG 4C3HH 2J52A 4LNNA 1HZ9A 5LMNL 4DV7L 1D5MC 1KDCA 4HLEA 3HOVB 1XD3B 4F8MA 4XX5A 1K8MA 1ZXIA 1SYBA 2Z6BA 5KYLA 2KN5A 2JA8B 4IOIE 3GTPH 2VL6A 3T8MA 3EECA 3M4YA 4OZCA 1PH6A 3W1SA 3AE2B 1S3OA 2MQHA 4WJPA 2JF5A 1D3ZA 2SNSA 2LXJA 2FXQA 5ELEA 5C23A 2R7DA 2CHZA 4FN2A 1CKMA 4OVUA 1XLQA 5LXHA 2ZZPB 4ZKBB 3H3VC 1TWHB 4TRDA 1BR9A 3UI2A 3BK2A 2G45B 2N3SA 4DFAA 3MXGA 1V97A 4TUUA 2AKWB 2BYFA 3D32A 3N1YC 5L83A 4DN4M 5FLXc 3KF6A 4DR2L 2KTFA 3RLFA 4MHEA 3A9JA 2OEOA 3H1UA 4FLHA 4LMQD 3VDYA 4DK6C 4IJHA 1M4VA 4A3GB 1VQKA 3H3VH 3M95A 1AYFA 2BH2A 3RT3B 3RLNA 1TY2A 5JPNC 1KXLA 2K5HA 4X64L 3LGJA 3W1GA 1SMXA 4GZYC 2WWZA 1PTOC 3DHIC 1N6ZA 2ASBA 2MNAA 3TEWA 5EPKA 4LUOA 4C1NI 2RF4A 1HRJA 4EQNA 3KF8A 1K53A 2G4SA 2IYDB 2XWJB 1WX7A 2JK8A 3ULJA 3B6YA 3HOUH 3BYYB 1FFUA 4A55A 4BA2I 1MPEA 4A8XC 2KKCA 3U4VA 3MXUA 1G91A 1WGHA 4B0MA 4HCSA 1PTOH 3CXCA 2WDVB 5C4JB 1GUSA 4FXKC 4BY1H 5D2MB 3UIPB 5M3FB 4B9XA 2VXWA 3H9DA 1HH2P 2O5JC 2WYQA 1KIXA 4ARIA 4OIJA 2UUBQ 4KLKA 1PH1A 4C3JH 4LFBQ 1SYEA 4II2B 2TMPA 4O42A 1QJOA 5FJ8G 4A3MH 2MFIA 5E4WC 4R8NA 3B1LX 3QK0A 1XNRL 2A68D 3R7QA 4OWTB 5KNDA 2JP1A 2E5LL 4BKGA 3J80E 4K3CA 5IE8A 4CGYB 1VZ6A 1E3PA 3TL5A 3VR3A 3Q6BA 4K14A 3NOBA 3KLSA 5HY6A
chains in the Genus database with same CATH topology
2NVYB 1F2LA 2D9UA 1R4QB 3NQTA 2FFKB 2NVTB 3RD4A 3MXNA 4UDUC 5DM73 1JC7A 2H89B 2MHVA 3N6RA 2RVLA 4TSSA 1VMPA 4X3KA 5JVG3 1HUNA 3Q24A 1HCZA 2MP1A 3OOCA 1B9NA 4C3HB 2NBFA 1QWYA 2WP8J 1CTMA 2NTSA 5C0XH 4R3DA 5ELCA 3ND9A 5CYUA 2JSVX 1QCBD 2EOTA 1HPCA 4XE0A 2DY7A 3KWLA 5FO7B 4KK7A 2RKSA 3TP5A 1D1KA 1WTXA 5C3JB 4J8QA 2EY2A 1Z47A 4G7OC 2VB3X 4DNRB 1IHZA 2F0WA 2E2HB 1FCCC 2KOLA 3DM1A 4ZKCB 1YNND 3Q0AA 3N9YC 4CBVA 1TVXA 5DNFA 4KKUA 3PO2B 2F0HA 4LK1C 1JE4A 4P2CB 4C3IG 3LXFA 2A6HC 1FEHA 5EBDA 4ZHPA 4NP5A 3H0GB 4RGMA 2M0AA 1WTOA 5BYQA 3J7AV 3KBGA 4PMBA 5JOBA 3HOUB 4MT5A 1PXUA 3NPPA 3AEBB 1TS5A 2KWDA 1DOIA 1CZPA 1PTOB 1JWUD 2NUCA 1FNUA 4BY1B 1E10A 1E9MA 2PMZB 2WB1B 4O1NA 4XT3B 2A6ED 1KFYB 1Q3LA 2QJLA 2W54A 1KNAA 4RNAA 4IUQA 1Y8NB 3I91A 2PYKA 1X32A 4A3MB 2LHEA 3FDTA 3PUXA 2OHFA 2H88B 1TS3A 1LTAD 2EY6A 3VYUA 1NCVA 1QF6A 1SE2A 3IAM1 2EKIA 1TYGB 3MA2B 1J9OA 5C5MA 3HVZA 1LTRD 2I46A 3KBXA 1B9RA 1QNUA 3FMCA 2EYMA 2FUG1 1VF5C 4S3SA 2QDBA 3BIID 1ZYRD 4MN3A 1GB1A 2FMMA 1GUTA 2NWGA 4L6TB 4K5XA 3URYA 2IT1A 2B2WA 3ITPA 1FXAA 1ESFA 3JAML 2AQ1B 5KGUA 2JYTA 4A3BB 3BDOA 1SIJA 3FPUB 2K7VA 2XWBB 3I72A 2F0TA 4FF2A 1S5DD 5BMGA 1NUCA 1O80A 4HEDA 3K57A 1BCPC 2F0MA 4ZOHC 1OFFA 1DOKA 4IUPA 2CW0C 4R9WA 3Q6SA 3IKJA 3BDLA 3AEGB 2X6GA 4AYBB 5HI1A 3B2FA 1WSPA 4QUFA 1C77A 4XYQA 1I7HA 4RHSA 4CQNA 1K50A 2JYEA 3FVQA 1IYUA 1LT3D 2PNRC 3J81L 2WU5B 2QF7A 2JA5B 2K6AA 1FNWA 3NUCA 5IGGA 4OO1I 2K0PA 3EFXD 1LTID 3HG9A 4REZA 1UUPA 3S1QB 5C44B 3AMUA 4HTHA 4DU9A 2E74C 3AE9B 2MH7A 1PDXA 2WXMA 3CKIB 2PVGC 4CKCA 4FVMA 2HTME 3MAQA 2Z1CA 1JICA 1SMYC 1QILA 1F2RI 1VMCA 2HCIA 3T13A 3E6ZX 3VQIA 1T5EA 2LMCB 2A69D 2B2WC 1E6EB 1SXTA 3TEZA 1Q1BA 1W6JA 3LX0A 1J7AA 2Y3AA 3W2DA 3D4DA 2EY1A 3FRPB 4L63B 2F0EA 1SNPA 1STHA 3VR6A 1EY4A 5ELBA 3TMEA 2ZXRA 1WRIA 3AB5A 3BWUD 2EXZA 3SE0A 4C1NK 2EYPA 4BBSB 3V2TA 2VB2X 4KI0A 2MUYA 5I6YA 5IGBA 4D2KA 2JEBI 1OXUA 1YJJA 4DXGA 4A3EB 2Y5CA 4IUNA 1B50A 3R3OA 4HAEA 1TWAB 5M5YB 3O13A 4XQNA 3D6CA 2KECA 1EEFD 5CV5A 2V0GA 2L1BA 1UGJA 3A7AB 3H8HA 1ESRA 3FPPA 1BCPB 2OF1A 3IFTA 3EGRA 1FD6A 2EPBA 3AE3B 3PMFA 1ZE3D 2INPE 1PTOD 4K2LA 1H9SA 1N61A 2E2DC 5EE3A 1L4ZB 5BN4A 1IGDA 2IPKD 4TQ1A 4QIWB 1XX8A 1YN4A 2BS3B 1TQOA 4Q2JA 1C4PA 4WRDA 2O2LD 3D6WA 5HURA 1SBBB 3GO5A 1M8AA 3WOFA 2MGSA 2JXMB 1EY6A 5JAVA 1F9SA 5NUCA 4R8IA 1SDFA 2B39A 2Q8RE 1JB3A 3K7AB 3J9CA 5AUKA 5CORA 4K2KA 2KN4A 3H09A 2WDQB 4CKBA 1N60A 3GTQB 2K5WA 3TEXA 3A8KE 5CBAE 2BBCA 2AX5A 4NJCA 1GXDC 1DONA 1SYFA 3K5OA 1WTQA 2RSOA 3S2HB 4TQUS 3ONAB 2M2LA 1ZDXA 1HFNA 5D3IB 2GI9A 3EJIA 4WFN3 1F9QA 2LKVA 5CC4A 2VNUD 3P1MA 2X38A 1KRHA 4J1MA 1HEZE 2WXIA 4F88A 4Z9CB 2WU2B 4ZRZA 3CIRB 2WXKA 1T3QA 1I4XA 3DEPA 2IW3A 5D3DA 4I7ZC 3HVDA 3GTOB 4QUCA 4DGZA 1TY0A 3W5UB 2A6HD 3I9V1 1CT1D 1OQQA 2KEDA 4ZK9B 5EPJA 2DBYA 3GTJB 2ACZB 1EYDA 1EWYC 2HQEA 4HSPA 3NWTA 2LUMA 1JORA 1S5CD 4WH4A 2AWNA 2L52A 2LEKA 5JEAG 3K58A 2HCCA 2D5DA 3QOLA 3P4PB 1CJEA 3AEDB 2K5PA 4OVZA 1LLRD 2D2CC 1FIQA 3EUB2 1TR5A 3RPFC 1U4LA 2FMCA 3U9OA 1K51A 3J7YW 1K8OA 1DZ1A 4P6VF 4KGTA 1ET9A 2WXLA 3NS1A 3VRAB 2C9OA 3C2PA 1TZOA 3HRZC 4C3HG 2F3WA 2F0SA 1CHQD 1CZWA 4OIKA 5C5LA 2A73B 1AZQA 3I90A 4A3KB 1VLBA 1Y1WB 3IAS1 2KQ4X 5HG2A 3GTMB 4NAWB 1VF7A 1RDPD 4HN7A 1FMAD 4A3JB 2I2YA 2N88A 5HFYA 3NHHA 1AW7A 1STEA 5KRUA 5H8YE 2E76C 3LWUA 1SE4A 1ENCA 1YQ4B 2EYOA 3K0YA 3ZJUA 2RDGA 1D6EC 3AE4B 2WACA 4NDXA 2BDOA 1BCPD 4YIJA 1AP0A 3W9CB 2WV6D 1A15A 2CW0D 1H9SB 1O7YA 1J8IA 1UAPA 1CK1A 4LJZC 4KTAA 2NB0A 1DOYA 3PZ7A 1F2ZA 2NN6G 2F0OA 1AEXA 1ET6A 2SEBD 1IW7C 5I9OA 4EE2A 5G3LF 1BMLC 3SEBA 5KNBA 2J7ZA 3I4MB 2K9XA 1TU2B 3P42A 3TBIB 1KAAA 2WXNA 3OMCA 4KKJA 3NRZA 1F0ZA 1X3PA 1SMYD 1DJRD 1FYCA 1NR2A 3T16A 4XTCS 3GV6A 3SK8A 2KUMA 5C6AA 1PYWD 2ID0A 1I4HA 3E56A 1KH0A 1L0XB 4PNYA 5C0XG 5DAUA 5CV7A 1G2TA 5JEAJ 2ICEC 2J4XA 2PVOD 3VYSA 4A3DB 2F4IA 2HDLA 1QLBB 3HKZB 5CV9A 1WCMB 1JOQA 4XQQA 2PCFB 2LFNA 3E9SA 1D5XC 3P1HA 3QWNA 1MI0A 3K5LA 2E3TA 1QT9A 1L0VB 2JSOA 2PW7A 4ZRQA 4I65A 3MVVA 1SNMA 1V43A 4JX1C 2RA4A 2L55A 4K6LA 1S5FD 1FD7D 3S17B 5EKKA 3AEAB 4RHRA 2LJIA 2AQ3B 1TT2A 4RA8A 1L6UA 2E6XA 4ID6A 1ZOYB 2L12A 2B63B 1A2TA 1E2VA 3S2DB 1Q90A 2RBMA 1AWDA 4HEA1 2JEAI 4AQ7A 2NN6H 3J80L 4GDKB 4ZYSA 4A9AA 1HQRD 3M4OB 4TQ0A 1SYGA 3AE8B 1WVLA 4A90A 4YT0B 4YTMB 2F0UA 4RKBA 4IALA 5CGKA 4ME5A 5EBCA 3MFGA 3V05A 3H94A 4JBWA 1H9JA 1TJEA 1HZ5A 2KJXA 1DD2A 4N6EB 2CJOA 3Q8BA 1SSOA 4RCOA 2B8FA 2LMCA 2DNCA 3DWMA 3P4QB 1I4QA 4MM3B 2ZW0A 4EQPA 1JALA 4GDLB 2X69A 4WURA 3TDQA 1QKZA 3AMZA 2QIEB 2I38A 3PO3B 4N9TA 1GUOA 1B44D 1Y56A 2PKOA 2R7ZB 2XRSD 1XF5L 1NR4A 1ACCA 1IUEA 1C78A 1JRPA 2F0PA 1I4PA 1FM0D 2WP9B 1PRTF 1YN3A 3HZXA 4F7XA 1GUNA 1GAQB 5BYSA 4DF7A 1EYAA 1KF6B 3I4LA 4DAPA 2ONQA 3RZOB 4L8JA 1V1OA 2AQ2B 4WIPA 3MWYW 1W6KA 4QB4A 1RTOA 3B9JA 3EQLC 2MJ8A 4IUUA 3SK5A 3VR9B 5CMDA 1SJHD 5C0XJ 1C8CA 5TSSA 4BBRB 1IBXA 3NVWA 3DHQA 1L6VA 2KCNA 3TP8A 2AWOA 2O4XA 4XT1B 1CQVA 1MHHE 2VZKB 2PW9A 4RAUC 2H4OA 2RPVA 3Q8EA 5GXGB 1HA5A 1MGSA 2F0NA 3TN2A 4DA2A 3VYTA 1RF2D 3SR6A 3ZGZA 4KV6A 4B9WA 3ABVB 1FRRA 4WORA 3AV8A 1PFNA 1QOHA 1AN8A 2EYLA 2K5DA 1WWTA 2W82A 2MPMA 4IFDG 3VA5A 4K6DA 5CV4A 2RDHA 3S1MB 4IN3A 4XWWA 4V190 4YSYB 2YU9B 4KY6A 2FE8A 1FR3A 5LL6X 4OZBA 2F0VA 4RH6A 2G1EA 3A56A 4Q0FA 4LTUA 1N62A 2BYTA 3P63A 3G7LA 1BBXC 4FF1A 5BYRA 3Q8CA 3J7AF 3SFEB 1Z6HA 2Z4HA 3RMHA 1XO3A 1WYGA 3C1EA 3CHBD 3OIQA 3M85A 1SNCA 4ABNA 1LT6D 2C5CA 2Q8TA 4N58A 4EQOA 3DWGC 3R8BA 3MP9A 1MI2A 1E0BA 3CRLC 4ITKA 2BCOA 1Y69U 4J3OD 2QKIC 2DYMA 2N7JA 4RGTA 4BWGB 2K33A 4DXFA 2W3SA 1RJTA 1KLUD 2BT6A 5K36H 5ISRA 4EGVA 2CVRA 5FLXL 1N5WA 5EKLA 2ENBA 4LLGM 1C4QA 1IGCA 1I6VC 3WDNA 3AEFB 5IIFA 2DNEA 1R9TB 1SSNA 2EZVA 1ENAA 2B2UA 5FLXE 1RFKA 1KNEA 5FO9B 1PFDA 4NAMA 2AUKA 3RUZA 2F0KA 1TS2A 2JWUA 3OIPA 4MIUA 1IW7D 3X3NA 1SFOB 4C7YA 3V3XA 1BQQT 4JE3B 3S1RB 1WD1A 4IFDH 2V4IB 2EELA 2K03A 3HS0C 3N52A 1Y8PB 1R7SA 1AZPA 3NBHA 2JU6X 1DOMA 1JOOA 3MFYA 1GHKA 2B2TA 3HEJA 2KDMA 4CJ0B 4CKEA 4HROA 4DAYA 2FINB 1N63A 1CZGA 3OWEB 4H2AA 4P16A 2FJ2A 1DOXA 1XCTL 2WQYB 2ON8A 5IGEA 1K83B 3EROA 5J22A 4IZ8A 2BS4B 2EDGA 3HRDD 3U4EG 1QQRA 1IBXB 3QJYA 2WXFA 1TIID 3M3YB 3B2GA 5CR3A 5K5PA 4BY7B 4ZAIA 1O7ZA 4NW2A 4U673 1JWBD 4G7HC 2N9LA 1MHXA 2K01A 5CV6A 2L32A 1QOFA 3CRKC 1F77A 3S14B 1F2YA 2WKDA 4KKTA 3U52E 2VZKD 5BMIA 4DAVA 2E2IB 4Y7NB 4KD4A 1MD2D 1YQ3B 5M3MB 4M0WA 1RTNA 2I07B 1XLOA 2R3ZA 3P4RB 2HDMA 2D5GA 1P7FA 1CQFA 5C4XB 2NZ1D 1TWCB 1G291 1RWSA 1PGBA 2WXQA 2F0GA 5IOCA 4YXDB 1B2TA 4FXGC 3ND8A 2WLBA 1CFMA 3BZDB 3QB3A 5LHY1 1ZEQX 1J7CA 1OXTA 4L2YA 3D4WA 1V8CA 1VZ7A 2QCPX 3T3OA 3AEEB 4A6QA 1EL0A 1XEEA 1STGA 2SAKA 1LT4D 1PUTA 3AM9A 1TS4A 1PGXA 1A3VA 4H13C 5JPMC 3CWIA 4XDXA 2HDEA 3SDZA 3R2IA 3W5VB 4N9PA 1QNKA 2M00A 3KWVA 3I3CA 3OSOA 3NE5B 2R93B 4ARCA 1DM0B 1WXQA 1KDBA 1WGKA 4L1BA 1GOZA 1B1ZA 2FHTA 3MHBA 3IT6B 3NWSA 2ZW1A 4IURA 4PV1C 4X3UA 3IL8A 3BVGA 1YMHE 4CHTB 3Q8AA 4FF4A 5EPLA 1PMRA 5HGTA 1EFID 3T4AC 4XIGS 4C56C 4PMCA 5EQ0A 3S1NB 2RQXA 1STNA 4FP5D 3TP6A 1BOSA 1FGBD 4OO1H 2ICIA 4MACA 1I4RA 2PQEA 3NBIA 1DYQA 1F2RC 3U9SA 2SNMA 2F0JA 1I4GA 3H91A 3OPOA 1FNVA 4IUTA 4ZRPA 2DLBA 1ZPSA 2RDFA 5CBEE 2LGIA 1SAPA 3G6JB 1B53A 4JWUC 1Z7TA 4MH8A 1PRTC 3KLRA 4FYDA 3GD7A 4YTNB 3MXPA 2B8GA 3NXWA 3T51B 2NN6I 1O7LA 2K3UA 3Q22A 1DOLA 4A93B 2V3PA 3Q23A 2EVBA 1TWGB 1GHJA 2IDYA 3OWFA 1NENB 1BUVT 1E2WA 2W55A 3NSWA 1OXXK 1FO4A 3CQZB 4B0EA 4IQZA 4YTPB 4HR7B 2LS01 2OEDA 2E2JB 1G2SA 1HTPA 1EY7A 3VR5A 3L9AX 1KABA 3Q8FA 2WXOA 1MBYA 3OW7A 1NVID 4KMUC 4KD3A 1I50B 4BA1I 3KK7A 2V4DA 5C0XI 4HRSA 2WXHA 1HQMC 2B76B 3FC4A 3HOWB 3MTSA 1H9KA 2H1EA 2QEJC 1I6HB 2B2VA 3AE7B 1A6XA 1NYQA 4HMJA 1D2BA 4J6HA 4FNFA 3NTKA 4WWMA 3TZUA 1QOAA 2D62A 3GS2A 5JXVA 1ILQA 3FAHA 1C4CA 2A74C 3QG1A 4FF3A 3IXSA 3UI3A 1RYJA 4N59A 1NYRA 3HGBA 2JZPA 3SFDB 5E1FA 3MC0B 4ZHOA 1EY9A 1GUGA 1VRAB 1L0YB 1O78A 1OXSC 4CJ2C 1ENFA 3AN1A 2VUMB 4NKLA 4LAAA 4ZUJA 1JR0D 1E7PB 2J0TD 2L1AA 5KEEA 1ZUD2 4WAFA 3S9WA 4HKQA 1EZ6A 5JJZA 3U2SC 4TMAB 5J39A 4XQJA 1C76A 3D31A 5EGTA 1PRTB 2XIWA 2EJGC 2HUGA 3A8JE 2R6GA 1JWSD 3E0JA 2BW2A 2PZTA 3C3LA 1WD0A 1RD9D 3NQIA 1U9RA 1AFPA 2ZT9C 5JVH3 1OQRA 5EE0A 5IT9E 1HA6A 2M56B 3MJ5A 3DMUA 4PMWA 1MSHA 1SNOA 3PUZA 3T3NA 1KLGD 1BNZA 3T56B 4YSZB 5I4DA 4LK0M 2DN8A 2NYZD 5AUIA 4H0LC 4KGSA 2EYFA 1Y8OB 5G3LD 1XLPA 3TZDA 1E0ZA 2ZXPA 1LT5D 4TKOB 4PT5A 5D7GA 2E75C 1OO9B 2BOSA 3C1FA 1ZXTA 2WXGA 2L5TA 3AH7A 1EU3A 1CA5A 3I57A 2NTTA 5J1ZA 4ILWA 2O5IC 5ELDA 4ODGA 3QOJA 3NVVA 1HHVA 4YWGG 4A3FB 1D4BA 1NI3A 3A7LA 4M8AA 4IUVA 3SK4A 1EY0A 1K52A 5C3EB 3C46A 2F0DA 1E2ZA 3IFDA 1YNTE 5T1IA 1QE6A 1UEAB 2B2YA 4HCEA 2JE6I 3DEOA 2ZXOA 2K5QA 5E3FA 4RF1A 1TKYA 1S5ED 5FKAC 4RFBA 5EJWA 1WTWA 1LTSD 1JROA 2DWQA 5C2TB 1XTCD 3T53B 2KA7A 2PZWA 4KKSA 1PZID 4B08A 1WTRA 2XVSA 3DWPA 5LNK1 4IFDI 1ILPA 3GTKB 1YNJC 3MZ5A 1BF4A 2XNAC 2QMTA 5BMHA 5CV8A 5BN5A 5I9PA 3GTLB 1HZ6A 5IGCA 4JPSA 4NMZA 2WIIB 2L11A 2YYZA 2JYOA 3K6OA 5A35A 5DM63 1EQVA 3GTPB 1EOTA 5IGFA 4QF4A 4EVOA 2NMQA 5ELFA 5FOBB 4C7ZA 2KMMA 2PIAA 2B2YC 2K1BA 4KN7C 4DK0A 5K36G 3PO0A 2EYHA 3VYRA 4E6IA 4QCLA 4DNTB 3F2UA 2KEEA 1V1PA 1SEBD 1STYA 2IX1A 3BYTB 3SXHA 1JWAD 1L5PA 4XWTA 3VA7A 1Q8IA 2BDNA 2FBWB 1XYIA 1R4PB 2JA6B 1YJIA 1KTKA 2G9DA 2YEPB 2IGDA 1T5XD 5AFWA 3A55A 1H9RA 1G6ZA 4OW0A 2IGGA 1PRTD 2SOBA 5D14A 2V3NA 4H7BA 4C3JB 5I2XA 5KYIA 1EU4A 5FR3A 5E6JA 1X3QA 3QO2A 3BVZA 3V96A 2LFIA 2DY8A 3K5MA 1A3TA 4USAA 3DWAA 2PTLA 4US8A 3SR1A 3AE6B 2QSDA 2KQ3A 1VDVA 1IKMA 3SK6A 2N0SB 1DGJA 2WXJA 3PZ8A 2EYJA 3LYYA 3X3MA 3LWEA 2BE5C 1TWFB 2X6LA 4JWSC 3P75A 2Z4IA 2IJ0A 1A70A 3TEYA 2KCCA 1TKWB 1LACA 1SNQA 4WJWA 2Y0SB 3H6MA 1G8ZD 1NAPA 2R61A 1F9RA 3AECB 2L0CA 3HP3A 3FILA 2JA7B 3EVQA 2IL8A 5C3WA 3VRBB 1PDQA 5EKIA 1WTPA 1KDAA 2M9VA 1STAA 3TSSA 5I2YA 3GB1A 1NEKB 4UAIA 2LHDA 1F9PA 3JAME 2JQRB 4H44C 1A3UA 1EWCA 3SHLA 3VR2A 1MVKA 1RCVD 1IYVA 2EE1A 1WTVA 1HFGA 1RKNA 1LTBD 1VCIA 4FO2A 2PMVA 1JWMD 2CQAA 1UNSA 2BS2B 4XYOA 3OMGA 5KNCA 3U7ZA 3OHXC 4ZUIA 1DCZA 1JCKB 1C48A 4KHZA 4K5VA 5C3XA 3DXJC 2GRIA 2DYOA 2CU3A 2Q8IB 5G5GA 1EM7A 3A8IE 1IL8A 1II3A 1SJED 4KJNA 1PGAA 3ZQ4A 3HOXB 3L3OC 5EE9A 2F0QA 3J81E 1PLFA 5T8IA 3I70A 3KQ4A 3MHZA 1B3AA 4XXEA 2INNE 1LO5D 1LV9A 1EEID 3NP8A 5BN3A 5E4XA 5IODA 4X3SA 1ML0D 2F1MA 4G7ZC 1N5XA 4KY7A 2YEPF 3P20A 2CJNA 1PTOF 3AU7A 2BB5A 3E5SA 3I8ZA 2WXPA 4FXCA 3D4RA 2IX0A 2EJFC 3TUOA 1UWMA 4RKLA 1FCLA 3IAYA 4IFDJ 3GV3A 2XSCA 5C4ZA 1Y1VB 1FRDA 3M7GA 1BDOA 5COYA 4QMGA 3NK9A 4CJ1B 4HSVA 1QOBA 1SF0A 3GQBA 1JQ4A 4KKIA 4RGOS 3DWQA 5DEHA 3ZJVA 1CM9A 2WS3B 1A2UA 2B2UC 2PZUA 3WCQA 2LY7A 2WAQB 1XXGA 1EZ8A 1V1PB 2GA4B 1VZ8A 3PUVA 1HTLD 4RGNA 1NSNS 3BG3A 4V0BA 3KUPA 4BS9A 3S15B 4OO1G 4DK1A 1EY8A 1Q12A 1UWXA 1EIGA 4K8JA 3ZJTA 2F3VA 4WQMA 2F0IA 4HKZE 4XDDA 2Z8LA 1HXYD 1GJXA 1OXVA 3ZYYX 1ZP0B 4FXDA 1ONLA 1GUWA 1ICWA 3PIP3 2Q5WD 2WKCA 4C3IB 1C79A 1L4DB 2B2TC 3NTIA 4RF0A 4KN4C 3PUWA 1J7BA 2A68C 1IKLA 3DUZA 3D3RA 3Q69A 1B9MA 2CHBD 1XCQL 3K5NA 1S4ZA 1ZKOA 2OT2A 4IDIA 3D8GA 1PZKD 1STBA 2G9HD 2L4NA 2MEKA 3I73A 3C8YA 5FO8B 4ZQ3A 4NZLB 3TP7A 2RMMA 1PZJD 2L9HA 5M5XB 2J42A 1C4AA 2WDRB 3SVMA 3KLSX 3LNNA 2K04A 5M5WB 4DQOC 1CHPD 2WXRA 5KIXA 3AE1B 2MJEA 2OXPA 2PLPA 5I6WA 3P4SB 1BO0A 5T1GA 1BUIC 4L23A 3FILB 1LABA 1YNJD 1P7EA 2IX3A 1Q10A 3GP7A 1VDZA 2WNMA 1XWEA 1SB3C 1C9FA 2PO4A 1EYCA 1VJKA 2RSNA 3BDCA 5C4HA 4OZAA 5FK9C 2NVQB 1ZXHA 1EQTA 2F0FA 5G5HA 1QB5D 3VR8B 1RODA 3ERQA 2EY5A 2IGHA 1XLNA 2R92B 1V8QA 2BA1A 1YNNC 1U4RA 3A54A 3FKIB 1JOKA 3R93A 1T6BX 4KX6B 4Q5VA 3NUHB 4KHVA 4KY5A 1EWHA 2K22A 5A2QL 1JMLA 1LTTD 1ROEA 3ETRA 2XRQD 4KGRA 1U4PA 4K8IA 3BVMA 1TKGA 3AB9A 4ULLA 2BB6A 1JQYD 2K28A 2J53A 1LTGD 2N9KA 3R2TA 1D5ZC 1FXIA 3NVYA 5HHDG 1TKEA 4OGQC 2L83A 2WINB 2N55A 2JXTA 5A2QE 4ZLTF 1U4MA 1PFBA 1CA6A 1H9MA 2PW5A 2M19A 2GB1A 2A5HA 3PV0A 2A6EC 3IT4B 1CI3M 4KJOA 1B4OA 3HOYB 2XN9C 1SE3A 5LL6S 3FEWX 4YSXB 2K32A 1BCPF 2KACA 4C80A 4HMIA 2TSSA 4US9A 1ZYRC 2BTEA 1GPXA 1BXTA 3RZDB 5M9OA 3NVZA 2MJ3A 1EIHA 1RHPA 4K5WA 1PFMA 1D1IA 3EA6A 3NZ3A 4G57A 2BE5D 2IWHA 1MSGA 5F2DA 4OL7A 1QOGA 4OHJA 2BA0A 3I4NB 3BK1A 3MEHA 1ZDVA 1VR9A 2AUJD 1SNDA 1QG7A 4M1UB 4X3TA 3L7ZC 2KVMA 2PPBC 2NVXB 2W3RA 4IKGA 3RFZB 1SYCA 4GLSC 1GB4A 1F2MA 4HJGE 3M7NA 1S5BD 1JW9D 3CU7A 1SYDA 3PUYA 5D65A 3PIO3 2F0LA 4G4KA 4C2MB 2KHSA 3VR4A 2K05A 4U68A 3HUIA 4RCNA 2JX5A 3NTHA 1HUMA 5IGDA 3WOEA 1YN5A 4PQXA 2KAJA 1FFVA 3W3AA 3P7JA 2MJDA 4C3JG 1RM6C 3L4PA 4RWSC 3BS1A 2A69C 2QILA 3GTGB 5H92C 5JEAH 2EJMA 5MPOA 3HOZB 5IT9L 3LB8C 2Y5PA 3S16B 3QIAA 1I3QB 4F87A 4A3IB 2F03A 3AE5B 1Q1EA 2B2VC 4AS1A 4XDCA 1EY5A 1DXMA 2SDFA 4JK1C 3K59A 2J52A 1D5MC 1KDCA 3HOVB 4F8MA 1K8MA 1ZXIA 1SYBA 5KYLA 4IOIE 2JA8B 3M4YA 4OZCA 3W1SA 3AE2B 2SNSA 5ELEA 1XLQA 4ZKBB 3H3VC 1TWHB 4TRDA 1BR9A 3UI2A 3BK2A 4DFAA 3MXGA </