3AXCA

Crystal structure of linear diubiquitin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
b'MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
molecule tags Signaling protein
source organism Homo sapiens
publication title Structure of a compact conformation of linear diubiquitin
pubmed doi rcsb
total genus 42
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3axcA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3axcA02
2MBQA 1R4NI 1GG3A 3EC8A 4ZDVA 4RMAA 3DBHI 2MX2A 3LDZE 2KMCA 3KW5B 4HDOA 1L7YA 3QK0A 4E3CA 3UF8A 5AEKB 1LQBA 3DPDA 3QWZB 2GOWA 1WGDA 1J19A 4ANUA 3DBRI 1ISNA 2WDTB 2WYQA 1A5RA 2BYFA 2KFJA 4KV2A 3MJWA 3ZNHB 4BBNF 2ZVOA 4WWOA 3ZVVA 4E74A 4FA6A 2HJ8A 3KH0A 2MRPA 3QHTA 2AL3A 1P1AA 2ASQA 4GIVA 3U8ZA 2MBBB 1KJTA 4LJPB 4CYEA 4XX5A 2N7EA 1E8WA 4RM8A 4WJPA 2ZPNA 3HK0A 2HE7A 2FCQA 2DZIA 5J17A 2J0MA 2CHXA 2KJHB 1VCBA 2MCNB 4B95A 1G6JA 4GXBA 3H7PB 5KHOA 4A20A 3AU5A 3OJ4B 3PS6A 3VUYA 2DZMA 2Z59B 2JXXA 2V1YA 3PRMB 3UINB 1WJ4A 1YJ1A 3GZNI 2JPHA 2K25A 2DZKA 4A3OA 4WJNA 2KDFB 3ALBA 3EHVA 4WQOB 4W9FA 5DCNA 3TL5A 3B08A 5KHQA 3PREA 3ZW3A 3PZDA 4EZJA 4OVVA 4DXAB 4TKNA 3K9OB 3UIOB 4AOFA 2CS4A 4EZKA 2KZRA 1D3ZA 1E8YA 4AWJA 3U30A 4EFOA 3VVWB 2DHZA 4HVBA 3H7SA 4PS3A 2DENB 3Q3FA 2G4SA 3QAQA 3VHTC 4HPLB 1GUAB 3RCZA 1EUVB 3ZRFA 1U4AA 2NBUA 2NPTB 2JRIB 2O6VD 1NDDA 2KHWB 3L17A 3ZO5B 2BWFA 1OEYJ 1WM2A 2WWZA 5E6PA 2MW5A 2KKCA 3ZTDA 1E8ZA 4M8NA 2K8BA 4GDKB 2MBHA 3APFA 4WWPA 2BPSA 2M0XA 4I6LB 2CR5A 1WX8A 2L3ZA 2LI5A 2N9XA 3M95A 3PHXB 4JIOU 2C9WB 2LXAA 2FCMA 3I3TB 4B6WA 3T9LA 2KJRA 2N4FA 1IPGA 2IBIB 1XD3B 3SDLC 4YL8A 3A33B 3N32A 2KTFA 2PE6B 4MEMA 4CHKA 2IO1B 3JVZX 1E7VA 3VUXA 1WGYA 1WX7A 1WY8A 3W1YA 1Y8RC 5D7GA 2LGDA 1XT9B 1V2YA 5C1ZA 1JRUA 2ZCBA 1LFDA 2IZVB 2ZVNA 4W9CA 2KFKB 1Z2MA 4KDIC 2KC2A 3WIMA 1WR6E 4IM2A 2UWQA 4DDID 5D2MB 4K7UA 2LASA 3X0WA 2MA9B 3T8MA 4BBNC 2NBWB 2IY0B 3R7RA 4KDLB 4NJ6A 1XQQA 3VQIA 4MM3A 1I35A 1Q5WB 2REXA 3ENEA 2KLCA 5AZFA 2KDBA 2OOBB 3PTFC 1SE9A 2MWSB 4MJSB 1WJUA 2CHZA 4F8CB 2KQSA 4KSLC 4DBGA 3TMPB 3VFKA 4I6PA 2RGFA 2YLMA 2KK8A 4LJOB 4EZLA 3HIZA 2KX0A 3BY4B 3QIJA 5L95C 3AU4A 3ZNZB 5G55A 1OEYA 1WZ0A 2KWVB 4GDLA 3TJPA 2NVUI 3DBLI 3VAWA 4N9F4 3EFUA 2CKHB 2RR9A 4DHJD 2NBVB 4OVUA 4K1RB 4JLCA 4FHJA 2RSUA 1WR1A 3H1UA 3IVFA 3OJ3A 4W9KA 3WAMA 1UD7A 1WGGA 2K6QA 2W9NA 3RULA 3TBLD 2DZJA 2C5LC 3L16A 4GMVA 4GDLB 2M17A 3A1QB 4GSWA 3JSVB 5DPRA 3QC8B 4DHJB 4F1SA 5J2RA 3P2BA 4FHKA 1I42A 2LD9A 3ZDMC 2BF8B 2JY6A 2CU1A 4ANVA 2L8JA 4IUMB 2D10A 2JVCA 3GOEA 3NZUA 2GBJA 1GJZA 3H6NA 4ANXA 5GMVA 3UGBB 4IG7B 1X1MA 1ZGUB 2LUEA 1WMHB 4ICVA 3CF6E 1PQSA 4TV3A 1E5WA 3IG3A 4IWQA 4TQ0A 1M94A 1KOTA 1V86A 1YIWA 1RFAA 2I1KA 3DCGA 1V5TA 4BFRA 2KTRA 5CTRC 1LM8B 2FIFA 2ZEQA 2LVOA 2LRWA 4MGKE 3MTNB 2BYEA 1TZ1A 1WE6A 2C60A 1RRBA 4NAWA 1WZ3A 2M4NA 3WA0A 2K8CA 3N30A 2J0KA 2LRUA 2RPQA 3QJZA 3TCAA 2JUOA 1T0YA 2LVPA 2XEWA 4W9IA 2UYZB 3IHPC 4MSQB 1Q1OA 4E71A 1L2NA 3ZRCA 1Z5SB 4HXDA 4BKGA 3VUWA 2FNJB 2GBRA 2MSED 2PJHA 3K9PB 2DX5B 3SD5A 1V81A 3SHQA 3NS8A 4II3B 2B3AA 2K6DB 3WAPA 2JWZA 2CHWA 2EMSA 2WX0A 3ML9A 4IWOA 3ZUNA 4BKSA 5JHAA 3WAOA 1P0RA 4LDTD 4IM3A 1S3SG 1WJNA 2LGYA 3O65B 4MGYE 3QCAA 3PVLA 2VRRB 3H9DA 1EF1A 2DYOA 3L08A 3PT2B 5CHFA 4ZRJA 2KX3A 4MJSA 3HM3A 3LJ3A 3PRZA 3QX1A 2K1FA 5CHWA 2KJ6A 3CMMB 3A9KA 1K8RB 4FJYA 1TGZB 2DAFA 4BOSC 2JF5A 1GNUA 3B0AA 4FBJB 2LVQA 3ZNGC 3N3KB 4FN2A 2KFKA 2FIDA 2EKEC 3DVGY 5D94A 3ZNID 1H4RA 3WALA 2BYVE 3DVGX 3V6CB 2KTRB 1YD8U 2PEAA 2MBOA 3A1QA 2BGFA 3ZIMA 2LWPA 3VH3B 1IYFA 1V9JA 5G2NA 2FCSA 3PRPB 1WE7A 5LLIA 4URKA 2GBNA 3PSEB 4CO7A 1UBIA 3JYUA 3WANA 3L54A 4KIKB 3ZDTA 1GC7A 2PE9A 3R3MA 4K81A 1H8CA 1WYWB 3MHSD 1KM7A 4ASWC 4BOZB 4AUQC 4RM9A 3ONSA 3IFWB 1S1QB 3NHEB 4IW0A 4BKTA 1RLFA 1SIFA 2KC1A 2ZZPB 4A3PA 4HCNB 3RYTA 4TQ1A 2M1MA 4K7SA 1WGHA 2KXJA 3IBEA 4G50A 2IO3B 4KZCA 1WF9A 5L83A 2C7MB 4MDKE 1IP9A 5TR5A 3DVNU 4FADA 1V80A 2N9PC 2Z0DB 2KVRA 3D32A 2NCNA 4GOCA 2G45B 3JSVA 4GDKA 4NNJB 4DHZE 2L0FA 4P7IA 3SU8X 1BT0A 3AI5A 5JHBA 4W9DA 4NAWB 2N1VA 3DDCB 3UQBA 3V6EB 2XBBC 1FXTB 3ML8A 1QZEA 3KUZA 2A4ZA 4M8MA 2BKFA 2G4DB 3ZKJC 4XC2A 1SGHA 4MGIE 4NY0A 3BINA 2O6VA 2N1WA 4WAAA 1J8CA 1WGRA 3APCA 3R7QA 3ZTCA 3KYCD 2A5UA 4II2B 3B1LX 3U7DA 1WXSA 3AULA 4PS7A 1R4MI 1WH3A 2GBMA 3PLVA 1HE8A 4DWFA 3KYDD 3KVFB 1WMHA 2AEHA 2MP2A 2IO2B 3S2AA 1ZW7A 4B9KA 3JW0X 2PPHA 2O2VB 3A9JB 4EKUA 1E90A 2JZ3B 3NZSA 3RZFA 3C0RB 1TBEA 1UELA 3PHWB 1UGMA 4GB9A 4XZ4A 3RZWC 2EMTA 5C23A 2KO3A 2V4LA 2KDIA 2HTHA 5IA7A 4W9LA 2IY1B 2MQJA 4J6IA 1WJ6A 2XK5A 1EO6A 5BO4B 3W1SA 2C7NB 4F7ZA 3QQ8B 3VXWA 2HD5B 1GC6A 2ZCCA 4HWIB 3VTVA 3UQAA 4K7WA 5JZEB 2NR2A 2QHOA 3KUCB 2KDEB 2NPTA 2AWTA 3DOWA 3HHMA 2J0JA 4HCPB 2DYMA 1P3QU 2GBKA 4LCDE 3CSTA 4HK2A 2D07B 2IO0B 3ZLZA 3V60A 5AZGA 5HKHA 5DPWA 1UZXB 3VH4B 5D6JB 1NBFC 4KSKC 2KANA 4NJ7A 4FULA 4GN1A 2JZZA 4FJZA 3RUIB 4EUTA 3A4RA 3VDZA 4FLHA 2G3QB 1C1YB 2C7HA 2KLGA 3QA8A 4PS8A 3Q3JA 3TIXA 2AL6A 2YVCA 1WXAA 4ANWA 1YX5B 2N9EB 3NOBA 2ZPYA 2FCNA 5CHVC 2OJRA 4TUUA 1WIAA 4KVGB 1C3TA 2L7RA 5FR6A 4ZYNA 2K8HA 4PYUA 2M8SA 2N7DA 3X23A 5IAAC 1F9JA 4M0WB 1WXMA 4EOYA 1WI0A 2KQ7A 2LJ5A 1YQBA 4WJOA 4DK5A 2JT4B 4W9HA 1V49A 2GMIC 4IWPA 4GU2A 4BKSD 4AP4C 1P9DU 1OQYA 3RT3B 4DHZB 2KNBA 1UH6A 3PGEA 2WX1A 3NY5A 2LXCA 4ZRIA 2KN5A 2DAJA 2L76A 4JGHB 4W9EA 4KIKA 5JH5C 2NS5A 3A4SC 3W1SC 1NI2A 4ZRKA 1AARA 1V6EA 2L0TA 2KMAA 3L0WB 1P98A 1WM3A 2BKRB 4JQWC 2MBEA 4ICUA 2O6VB 1LXDA 2D11A 2RD0A 5DPTA 4HLEA 1Q0WB 2D3GA 4MGZE 4EEWA 1ZKHA 2DYBA 2FAZA 4IC7B 4MH0E 4G3XB 1VD2A 3OAWA 4FJVB 4NPNA 1WRDB 1WXVA 2LZ6A 3M63B 2O2VA 3A9JA 2FUHB 3HM6X 4G11A 2MP2B 1E8XA 2Z0EB 5AZHA 4HDQA 4NQKE 3RD2A 3VTWA 5E6OA 3V62A 1UBQA 2D2QA 5LXHA 1J0GA 4LDTB 4KZ0A 2I1JA 5CX3A 3VTUA 3AXCA 1RAXA 2ZNVB 2KWCA 3M62B 4PYZA 2LGXA 1YX6B 4HPMB 3V61A 3H7PA 4WJQA 2KWUB 2ZJDA 2MLBA 4MSMB 3R66C 3OLMD 4DDGD 2L05A 1WX9A 1OTRB 1EF5A 3DQVA 2XK5B 4JL9A 2K39A 3APDA 1TTNA 2Y5BB 1V5OA 2AYOB 3DVNV 4IM0A 4W9JA 3QARA 2BWES 1OGWA 4X57B 4AJWA 4I6NB 4WWNA 4BVUC 2R2QA 4GGQA 2ZNVC 3A9KB 2KOXA 3UIPB 3PPAA 1E7UA 3KUDB 2L00B 4G0NB 4HJKA 2V3SA 3CSFA 2KD0A 1CMXB 3L13A 3EECA 1WFYA 5E6NA 2JRHA 3L10B 2IYDB 4AJYB 4W9GA 5LXIB 3DBSA 3ECIA 1KLVA 5DPSA 2J7QB 3PLUA 3PV1A 4NQLB 5EDSA 1MG8A 4MELA 5J18A 3M3JA 2R2OA
chains in the Genus database with same CATH superfamily
2W3RA 2LHEA 2MX2A 3T3NA 4E3CA 1L7YA 3UF8A 5AEKB 2JQRB 2J42A 3NS1A 2BYFA 1YQ4B 3ZNHB 4FA6A 2HJ8A 1J7AA 1P1AA 1HTQA 4GIVA 3U8ZA 5H8YE 4LJPB 4RM8A 1JW9D 2ZPNA 2MCNB 3AE3B 3H7PB 5KHOA 3AU5A 3BZDB 2WXKA 3UINB 1B1ZA 1PGBA 1FXIA 4A3OA 2OJWA 5DCNA 3PREA 3PZDA 4EZJA 4OVVA 2LGSA 4TKNA 2JYEA 2V3NA 4EZKA 1YOVB 1D3ZA 4AWJA 4EFOA 2DHZA 4HVBA 3VRBB 1XCQL 3VHTC 3AE5B 3P1MA 2NBUA 2JRIB 4S0RA 1NDDA 3L17A 2BWFA 2Y5PA 1I4XA 2L3ZA 3M95A 4JIOU 3ZYYX 3TEWA 2PKOA 3A33B 4P1CC 2M19A 1R4MB 1F2RI 2IO1B 2WHIA 1EWCA 1XLNA 1T0RC 3W1YA 3CIRB 1JQ4A 4ITKA 2ZCBA 3BYTB 2KFKB 3U52E 3AH7A 2WXJA 3WIMA 3J9CA 4ZRPA 3X0WA 1RWSA 3Q14C 2REXA 5AZFA 2OOBB 3PTFC 1SE9A 1FO4A 1FRRA 1PUTA 2MWSB 4C00A 4MJSB 1GOZA 2RGFA 4ZYSA 4EZLA 3HIZA 2SAKA 4OZCA 2KX0A 3BY4B 1NENB 2QILA 4K3CA 1L0YB 3AEEB 1WZ0A 2KWVB 2QIEB 2HTME 2QMTA 1EM7A 2CKHB 2RR9A 1M4VA 4WIPA 4FHJA 4A90A 3IVFA 2TSSA 4OVZA 2LMCA 2W9NA 1MJDA 4F1SA 1T5XD 1D4BA 4MH8A 1SF0A 2WXOA 3ZDMC 2CU1A 3NZUA 2K9XA 3AE9B 3Q69A 4IG7B 1X1MA 5IO9A 2WXPA 1PQSA 4TV3A 1E5WA 2KACA 1YJJA 1D5ZC 1KH0A 3RNCC 2WXFA 5CTRC 1MI0A 1LM8B 1FM0D 4MGKE 3BVMA 1WZ3A 4XDCA 3BWUD 2LRUA 2PIAA 3QJZA 2JUOA 1HTOA 4E71A 2INNE 3ZRCA 1ENFA 4BKGA 2L1AA 1YN3A 4KKJA 1V97A 3KLSX 2Z8LA 2DX5B 3NRZA 1V81A 2LFIA 2JWZA 2CHWA 2EMSA 2WX0A 3ML9A 4IWOA 2KN4A 3ZUNA 4BKSA 5JHAA 3IT4B 1SB3C 4MGYE 3PVLA 4ZRJA 2KX3A 2Y5CA 3PRZA 4C7ZA 3CMMB 4C4VA 1FXAA 3GB1A 5AUIA 2WXNA 2KTRB 1IYFA 5G2NA 3ZQ4A 5MPOA 1UBIA 3ZDTA 3MHSD 3NHEB 1SIFA 2ZZPB 4HCNB 2M1MA 2RPVA 3IBEA 4G50A 1QT9A 3W5UB 4KZCA 4RGMA 4WQMA 4FADA 3DVNU 2W55A 5BMHA 2G45B 1Y56A 4GDKA 3DHIC 4DHZE 2L0FA 4P7IA 3AI5A 2RDBC 2K22A 5JHBA 3R2IA 3DDCB 3UQBA 1R7SA 1QZEA 3ZKJC 4XC2A 1ET6A 2ICIA 3APCA 1AW7A 3ZTCA 2CJOA 3B1LX 3U7DA 3AULA 2K3UA 3Q8CA 5E6JA 3KYDD 3NG0A 2AEHA 2BYTA 3JW0X 2O2VB 4EKUA 5LNK1 3Q8BA 3PHWB 3RZWC 2KDIA 4W9LA 1WJ6A 1E9MA 3W1SA 3QQ8B 3VXWA 3VTVA 4K7WA 2OHFA 2QHOA 3FILB 2KDEB 2AWTA 1P3QU 2GBKA 2D07B 2WDRB 3O13A 4TMAB 4FULA 3ZJTA 3AE7B 1JWSD 2PW9A 2CJNA 1WYGA 3A4RA 4FLHA 2KLGA 1EU4A 2H89B 1WXAA 4ANWA 4LNKA 4QAYA 4O1NA 4ZOHC 1JCKB 1ZDVA 2FCNA 5CHVC 1KF6B 2L7RA 5FR6A 2K8HA 2M8SA 2N7DA 3X23A 4YWGG 1ZP0B 3B9JA 1V1OA 1WXMA 2LJ5A 4W9HA 1TYGB 1V49A 2GMIC 3SFDB 1FNWA 3RT3B 4DHZB 2KNBA 1UH6A 4ZRIA 2LXCA 2DAJA 2L76A 5JH5C 3Q3OC 2N9LA 4ZRKA 2E6XA 3L4PA 1WM3A 4JQWC 2O6VB 4YT0B 4MGZE 1JALA 4IC7B 3I9V1 4RF1A 1WRDB 2I2YA 2FUHB 4G11A 1E8XA 4HKQA 4HDQA 2EKIA 4NZLB 3RD2A 3TEXA 5BMIA 5LXHA 3LYYA 3VTUA 2KAJA 3AXCA 1YX6B 4HPMB 2PVOD 3ABVB 1F1HA 3SEBA 3OLMD 5FKAC 2L05A 2XK5B 2K39A 2WLBA 2BB6A 4W9JA 1BXTA 2BWES 1OGWA 2EELA 3QARA 4WWNA 4HRSA 1JWMD 3GE3C 1UF0A 3PPAA 2Q5WD 4YTNB 4DQOC 3EECA 4W9GA 3C8YA 3ECIA 1KLVA 3PLUA 2N7JA 2PLPA 4MELA 5J18A 3M3JA 1R4NI 2G9HD 3EC8A 2NMQA 3DBHI 2KMCA 3FKYA 1K53A 3QK0A 1LQBA 3DPDA 3DBRI 2WDTB 2WYQA 1CJEA 5D3IB 2KFJA 1TS5A 4NAMA 3MJWA 4E74A 3RI7C 3GZNB 3ZJUA 2MRPA 5FK9C 2AQ2B 2MBBB 1KJTA 3C19A 3HK0A 2FCQA 2DZIA 5J17A 4KGSA 2CHXA 2KJHB 1VCBA 4GXBA 3PS6A 2DZMA 2JXXA 2V1YA 4EE2A 4M01A 3GZNI 1YJ1A 2K25A 1IUEA 3NVWA 4UDUC 1FFVA 4W9FA 4RH6A 4KX6B 3ZW3A 1N62A 2UU7A 4DXAB 4AOFA 1ZOYB 2KZRA 1JWUD 1TKEA 3U30A 1DOIA 2DBYA 2VZKB 3H7SA 3Q3FA 2G4SA 4HPLB 1GUAB 3ZGZA 1OEYJ 2WWZA 3ZTDA 2BPSA 1WX8A 2V0GA 1GB4A 1I4PA 1QKZA 1EU3A 3I3TB 5BMGA 3T9LA 1IPGA 1XD3B 3N32A 3NZ3A 3R8BA 2D3AA 1EWYC 1L0VB 3VUXA 2WDVB 1RFKA 1Y8RC 2LGDA 5C1ZA 5GXGB 1Z2MA 4KDIC 2KC2A 1WR6E 4IM2A 4WURA 4DDID 4K7UA 4C80A 3R7RA 4KDLB 4MM3A 4R3DA 2KDBA 1WJUA 4RGOS 2CHZA 4KSLC 3TMPB 4I6PA 4L1BA 2KK8A 4LJOB 1MG4A 5L95C 4LK0M 3AU4A 5G55A 1XF5L 3ZXRA 2NVUI 1YN4A 3WAMA 1UD7A 2MEKA 2DZJA 1PYWD 3L16A 1C9FA 4GSWA 1I4RA 2PMVA 3AEAB 4FHKA 2LD9A 1VLBA 4IUMB 3GOEA 2JVCA 1GJZA 1TZOA 2QEJC 1SJED 4ANXA 2LUEA 1FNVA 3IG3A 4TQ0A 1M94A 1YIWA 4A6QA 1K50A 2I1KA 3EGRA 2M4NA 3N30A 2J0KA 2RPQA 3TCAA 4DXFA 1AWDA 2DLBA 1ESFA 1Z5SB 4P1BC 2WDQB 1KFYB 3SD5A 4C7YA 3PZ7A 1HXYD 1JWAD 1WGKA 2LGYA 3RN9C 2DYOA 3I63C 3P63A 1P7EA 1TJEA 5TSSA 1F77A 1I7HA 2BS3B 2DAFA 4FBJB 2LVQA 3N3KB 3RNFC 1UWMA 1TIFA 4P16A 3ZNID 1H4RA 3WALA 3ZIMA 3V6CB 3A1QA 2BGFA 1P7FA 3RNEC 4A9AA 5IP4D 5LLIA 4KGRA 2GBNA 3FC4A 4KIKB 2PE9A 1WYWB 2GLSA 3DHGC 4RM9A 3IFWB 4IW0A 1VZ8A 2N9KA 2XNAC 4TQ1A 4K7SA 1IP9A 4MDKE 2JYTA 1V80A 4GOCA 2LEKA 3V3XA 1BT0A 2N0SB 1XO3A 3MC0B 2N1VA 1ZUD2 4HPPA 4M8MA 2A4ZA 1T6BX 2G4DB 3AEDB 1SGHA 4LNOA 3BINA 2O6VA 2N1WA 3FAHA 1J8CA 3MC9A 3KYCD 2BS2B 3KWLA 1WH3A 2GBMA 4PS7A 3PLVA 1DOYA 1XLPA 1C4PA 3S2AA 4B9KA 4MM3B 2QCZA 2JZ3B 3NZSA 2WXQA 1E6EB 4XZ4A 2K5PA 5C23A 2HTHA 4N6EB 1JWBD 4J6IA 1WSPA 2WXRA 5BO4B 2WU5B 2LHDA 1I4QA 1GC6A 3UQAA 1UUPA 4B0MA 2INDC 2NPTA 3DOWA 3DWMA 3LB8C 3E56A 4HK2A 2IO0B 3N9YC 2WNMA 5AZGA 5HKHA 5D6JB 1NBFC 4HROA 3PO0A 3N1ZC 2JZZA 4FJZA 3RUIB 5AUKA 3B2FA 3QA8A 1NYQA 2AL6A 1YX5B 2ZPYA 4TSSA 2MH7A 4TUUA 1WRIA 4ZYNA 1I4GA 4EOYA 4WJOA 2JT4B 1XXGA 4AP4C 1MHXA 2JU6X 1OFFA 1F2RC 2WX1A 3NY5A 4W9EA 4YTPB 4KIKA 2NS5A 3W1SC 3FILA 1DOXA 3U7ZA 1AARA 2M0AA 1V6EA 2BKRB 3ZJVA 1LXDA 1VZ6A 2RD0A 3N1XC 1Q0WB 3BYYB 2FAZA 1C4AA 3E9SA 1VR9A 4NPNA 1I4HA 2MP2B 1ROEA 4S17A 3VTWA 2B76B 5FR3A 3V62A 2WU2B 1N63A 1RAXA 2W3SA 3OWEB 2KWCA 2WXHA 2LGXA 1FEHA 3H7PA 3KQ4A 1HZ6A 3AE1B 4MSMB 3R66C 1CK1A 3Q3NC 1EF5A 1UGJA 3EFCA 3RFZB 4KGTA 2AYOB 1PDXA 4AJWA 4I6NB 2IDYA 2R2QA 2OEDA 2ZNVC 2KOXA 3UIPB 1E7UA 2GB1A 2V3SA 2QC8A 3CSFA 1NYRA 3EA6A 3VR8B 3BVZA 4L23A 4AJYB 2PTLA 3PV1A 1MG8A 1B9RA 1ZXIA 2MBQA 1GG3A 4ZDVA 4RMAA 3LDZE 3KW5B 4M00A 2GOWA 1WGDA 1J19A 2I38A 3AE4B 1ISNA 3MHZA 4N59A 1Q10A 1VZ7A 3RNBC 1N60A 4BBNF 3QHTA 1NVID 2ASQA 3MJ5A 3BK2A 3ZXVA 4M02A 2J0MA 2WP9B 1G6JA 2KVZA 4A20A 2Z59B 3PRMB 3SR6A 3TSSA 2FUG1 4LNFA 2KDFB 3ALBA 3EHVA 4WQOB 2QJLA 2VZKD 3TL5A 3B08A 5KHQA 4Q2JA 3K9OB 3UIOB 1VJKA 1E8YA 4PS3A 2DENB 3ZRFA 1U4AA 2NPTB 4H2AA 2KHWB 3GP7A 4L2YA 3ZO5B 1FCLA 1WM2A 3P42A 2K8BA 2MBHA 3APFA 4WWPA 3W9CB 2M0XA 2CR5A 2N9XA 3RNAC 2L83A 3PHXB 4ARCA 1JMLA 1FNUA 1RM6C 4PT5A 1JROA 2KTFA 2PE6B 4CHKA 3TEZA 1WXQA 4RNAA 1E0ZA 2QDFA 1WX7A 1WY8A 4WH4A 5D7GA 1XT9B 3AEBB 2WS3B 1JRUA 3B2GA 1LFDA 2BQQA 4W9CA 2Y3AA 3P4PB 4GLSC 3AE2B 5D2MB 2LASA 4BBNC 2IY0B 3VQIA 2D3BA 4USAA 4FXCA 2GI9A 1SJHD 5EE0A 2KQSA 4DBGA 1ZXHA 1MVKA 1J7CA 1E10A 2BT6A 4GDLA 3VAWA 4N9F4 2NBVB 4OVUA 3GE8C 1WR1A 1ZE3D 3H1UA 5G5GA 2BS4B 1HA5A 2C5LC 4HEA1 4GMVA 3N20C 3JSVB 5DPRA 1OQRA 1K51A 4DHJB 3P2BA 1I42A 2JY6A 2L8JA 2D10A 2GBJA 1SBBB 3NVYA 1ZGUB 3CF6E 5T8IA 1TY2A 3AEGB 1KOTA 1V86A 1RFAA 2DWQA 1V5TA 2RDGA 2L52A 2W82A 4A55A 2LRWA 3MTNB 1TZ1A 2WXIA 1WE6A 2C60A 1RRBA 3WA0A 1FPYA 4RFBA 4OZAA 1T0YA 3Q2AC 2XEWA 2UYZB 4MSQB 1Q1OA 3RNGC 1SXTA 4HXDA 3CWIA 1PFDA 2FNJB 2GBRA 2MSED 2PJHA 3K9PB 3HUIA 2AQ3B 3I5JC 2BB5A 3SHQA 4II3B 2B3AA 4JPSA 3WAPA 1GAQB 1UWXA 3WAOA 1P0RA 4LDTD 1YMHE 4XE0A 2V3PA 3O65B 3QCAA 2VRRB 1EF1A 3ETRA 3DBRB 3HM3A 5CHWA 2NTSA 2KJ6A 3A9KA 4FJYA 1ZDXA 2D3CA 1TGZB 3Q3MC 1MFWA 2JF5A 2NTTA 3B0AA 3ZNGC 1PGAA 4AS1A 2KFKA 2FIDA 2EKEC 5HI1A 3DVGY 3DVGX 2PEAA 1YD8U 2MBOA 3VH3B 1UNSA 3LXFA 2RDHA 3PRPB 4CO7A 3BVGA 3WANA 1IGCA 3L54A 1H8CA 1GC7A 3R3MA 4K81A 2M56B 3ONSA 1S1QB 1RLFA 2KC1A 3W2DA 2KXJA 4XYCA 2IO3B 2C7MB 1HQRD 3EUB2 2INCC 3WCQA 2Z0DB 2KVRA 5G5HA 2NCNA 2X38A 4WAFA 4M0WA 3IAM1 2JX5A 3SU8X 4W9DA 2IPKD 1FXTB 1LGRA 3KUZA 2BKFA 4NY0A 4WAAA 4II2B 1HE8A 3KVFB 1WMHA 2MP2A 5IN7A 2PPHA 2VH2A 1FD6A 3RZFA 1UELA 1TS2A 4BAXA 2V4LA 1C78A 2IY1B 2K0PA 4A8XC 2XK5A 2C7NB 5JZEB 2NR2A 4US8A 1XCTL 3MFGA 1L6VA 3HHMA 2J0JA 4HCPB 3CSTA 2V9HA 1IBXB 3VH4B 4KSKC 2KANA 4NJ7A 4GN1A 1C79A 4LLGM 1C1YB 2C7HA 4PK1A 2YVCA 4P6VF 2N9EB 2OJRA 1N6ZA 4PYUA 1YQ3B 5IAAC 4M0WB 1C76A 2KQ7A 1L4DB 1YQBA 2FBWB 4DK5A 4IWPA 4GU2A 2WXLA 1P9DU 4LTUA 4IKGA 3PGEA 3VRAB 4JGHB 2ONQA 3A4SC 2MBEA 2D11A 5DPTA 4EEWA 2DYBA 5I4DA 4MH0E 4MT5A 4REZA 4G3XB 3OAWA 4FJVB 1WXVA 1E7PB 3A9JA 3M63B 3HM6X 1QOBA 2BBCA 5BYQA 4NQKE 4WWMA 1D6EC 1TS3A 1MHHE 1FFUA 1UBQA 1SE3A 1FRDA 1J0GA 4LDTB 4KZ0A 2I1JA 4RGTA 3P4SB 2CU3A 3IXSA 3DHHC 2ZNVB 4PYZA 1DYQA 3NVVA 2ZJDA 5H92C 4DDGD 4YSXB 1WX9A 2SEBD 4JL9A 3APDA 1TTNA 5EE1A 2Y5BB 1V5OA 4DXGA 4IM0A 4BVUC 2L32A 3A9KB 1L5PA 3DBHB 2L00B 4G0NB 4HJKA 2ZW0A 1QILA 3MP9A 1BMLC 5E6NA 2JRHA 3L10B 2IYDB 1TKYA 3NVZA 5DPSA 2J7QB 3AB5A 1FIQA 4NQLB 5EDSA 4J3OD 3DWGC 2W54A 2R2OA 2MJEA 2WGSA 2KWDA 1C77A 1QF6A 4HDOA 3QWZB 1D5XC 2WQYB 4ANUA 1A5RA 4KV2A 2ZVOA 4WWOA 3ZVVA 3KH0A 2AL3A 2KT7A 2G1EA 2J4XA 4CYEA 4XX5A 2N7EA 1E8WA 4LNNA 4WJPA 2HE7A 1RYJA 1QQRA 1SE2A 4B95A 1JRPA 1ACCA 3OJ4B 3VUYA 1TY0A 3IAS1 1WJ4A 3DBLB 2JPHA 4ZRQA 2DZKA 2AX5A 4WJNA 1HEZE 1MPEA 3VR9B 2WXGA 2CS4A 2YEPB 4XWWA 2JZPA 3VVWB 3AV8A 4RF0A 2YEPF 3QAQA 3AM9A 3RCZA 1EUVB 1QOAA 2O6VD 4N58A 3AMZA 1BUIC 5E6PA 2MW5A 2KKCA 1E8ZA 2R61A 4M8NA 4GDKB 3AN1A 2RMMA 4I6LB 2INPE 2LI5A 3Q6BA 2C9WB 2LXAA 2FCMA 3AE8B 4B6WA 2KJRA 2N4FA 2IBIB 4JWSC 3SDLC 4YL8A 4ZHPA 4MEMA 1N5WA 3JVZX 5EE9A 3W5VB 1E7VA 3PZ8A 4YTMB 1WGYA 5BYSA 2JSVX 1V2YA 2KQ4X 2IZVB 2ZVNA 1GB1A 2FE8A 2UWQA 2MA9B 3T8MA 2NBWB 4NJ6A 1XQQA 1I35A 3Q8FA 1Q5WB 3ENEA 2KLCA 1KLUD 4F8CB 4ZHOA 3VFKA 2YLMA 3QIJA 2QSDA 3ZNZB 2JXTA 1OEYA 4US9A 3TJPA 3DBLI 5IOIA 3EFUA 4DHJD 4K1RB 4JLCA 2RSUA 3NUHB 1N61A 2MJDA 3OJ3A 4W9KA 1F52A 4JWUC 1WGGA 2K6QA 1CQVA 3RULA 3TBLD 2WXMA 2M17A 3A1QB 4GDLB 1VDVA 5J2RA 3QC8B 2KMMA 1ZPSA 2BF8B 4ANVA 1SEBD 1OQQA 3H6NA 4IDIA 5GMVA 3UGBB 1V8CA 1KTKA 4ICVA 1WMHB 2HJ1A 4IWQA 1WWTA 3P4QB 4YSZB 3HVDA 3DCGA 4OW0A 1SSNA 2KTRA 1XLQA 4ACFA 4BFRA 2BTEA 2FIFA 2ZEQA 2LVOA 2J52A 2BYEA 1YNTE 1L6UA 4NAWA 1VRAB 3HRDD 2K8CA 4C4VB 4MACA 5C3JB 3NJTA 1YJIA 2LVPA 3URYA 4W9IA 3IHPC 1L2NA 2KDMA 3HVZA 3SFEB 3VUWA 4K3BA 5D3DA 1IGDA 3NS8A 3P4RB 2K6DB 5BYRA 2LGIA 2MJ3A 4IM3A 1S3SG 1WJNA 4CQNA 3L08A 3H9DA 3PT2B 5CHFA 3MC8A 2IGHA 4MJSA 2X8XX 2ON8A 3LJ3A 3QX1A 2JWUA 2K1FA 3AE6B 2E3TA 4XGAB 1K8RB 4BOSC 3BIID 1GNUA 1CZPA 2VH1A 4FN2A 1A70A 4ARIA 1L0XB 5D94A 2BYVE 1KRHA 4BZAA 2LWPA 4YXDB 2ACZB 1V9JA 2FCSA 1WE7A 4URKA 5JXVA 2KYWA 2PVGC 3PSEB 2LJIA 3JYUA 1KM7A 4ASWC 4BOZB 4XDDA 4AUQC 4BKTA 4A3PA 3AEFB 3RYTA 1WGHA 1WF9A 5L83A 3OG5A 1K52A 5TR5A 5IKCM 2N9PC 2IJ0A 3D32A 4JE3B 3TUOA 3JSVA 4NNJB 2ZW1A 5HG2A 1N5XA 2IGGA 1QOFA 3R2TA 5HHDG 4NAWB 3V6EB 2XBBC 3ML8A 1ET9A 4MGIE 1WGRA 3R7QA 2A5UA 1PGXA 3N1YC 2H88B 1LO5D 1WXSA 1R4MI 4DWFA 3UI3A 2IO2B 1ZW7A 3A9JB 1E90A 4AQ7A 3C0RB 1TBEA 1UGMA 2HDEA 4GB9A 4D2KA 2EMTA 2V4IB 2KO3A 5IA7A 2MQJA 3H8HA 1EO6A 3KWVA 4F7ZA 1QOGA 2HD5B 2ZCCA 4HWIB 1XLOA 1YN5A 3U2SC 3KUCB 1XEEA 2DYMA 4LCDE 1T0QC 3ZLZA 3V60A 5DPWA 1UZXB 2AQ1B 3AECB 1L4ZB 3RMKC 4EUTA 3GS2A 3VDZA 2DNFA 2G3QB 4PS8A 3Q3JA 3TIXA 1IBXA 3BK1A 3NOBA 3Q8AA 1WIAA 4KVGB 1C3TA 1AN8A 3U4EG 5EE3A 1F9JA 2GRIA 1SE4A 2XN9C 1NI3A 4C56C 1FMAD 1QLBB 1WI0A 4KKIA 1KLGD 4BKSD 1OQYA 4HJGE 2KN5A 3TEYA 2IGDA 1R4NB 2MHJA 1SIJA 4RGNA 1NI2A 2L0TA 2KMAA 3L0WB 1P98A 4HKZE 2BVCA 2LUMA 4ICUA 3IT6B 3Q8EA 4HLEA 2D3GA 4XWTA 1ZKHA 1T0SC 4NJCA 2BW2A 2D5GA 1VD2A 1T3QA 2LZ6A 2O2VA 4IOIE 2Z0EB 5AZHA 1C4CA 3RPFC 1FCCC 4OHJA 5E6OA 2D2QA 5HFYA 1NEKB 1TS4A 5CX3A 1TKGA 1D5MC 1HZ5A 3M62B 1F0ZA 3V61A 1STEA 5C2TB 4WJQA 2KWUB 3T3OA 1AYFA 1TT5B 2MLBA 3V05A 1OTRB 3DQVA 3I57A 1V1PB 1GPXA 3DVNV 4YSYB 1DGJA 4X57B 4GGQA 1V1PA 4JX1C 3KUDB 3L13A 2KD0A 1CMXB 1WFYA 4B0EA 5LXIB 3DBSA 4OZBA 2J53A 1J7BA 4LNIA 4RCOA
chains in the Genus database with same CATH topology
2MBQA 1R4NI 1GG3A 3EC8A 4ZDVA 4RMAA 3DBHI 2MX2A 3LDZE 2KMCA 3KW5B 4HDOA 1L7YA 3QK0A 4E3CA 3UF8A 5AEKB 1LQBA 3DPDA 3QWZB 2GOWA 1WGDA 1J19A 4ANUA 3DBRI 1ISNA 2WDTB 2WYQA 1A5RA 2BYFA 2KFJA 4KV2A 3MJWA 3ZNHB 4BBNF 2ZVOA 4WWOA 3ZVVA 4E74A 4FA6A 2HJ8A 3KH0A 2MRPA 3QHTA 2AL3A 1P1AA 2ASQA 4GIVA 3U8ZA 2MBBB 1KJTA 4LJPB 4CYEA 4XX5A 2N7EA 1E8WA 4RM8A 4WJPA 2ZPNA 3HK0A 2HE7A 2FCQA 2DZIA 5J17A 2J0MA 2CHXA 2KJHB 1VCBA 2MCNB 4B95A 1G6JA 4GXBA 3H7PB 5KHOA 4A20A 3AU5A 3OJ4B 3PS6A 3VUYA 2DZMA 2Z59B 2JXXA 2V1YA 3PRMB 3UINB 1WJ4A 1YJ1A 3GZNI 2JPHA 2K25A 2DZKA 4A3OA 4WJNA 2KDFB 3ALBA 3EHVA 4WQOB 4W9FA 5DCNA 3TL5A 3B08A 5KHQA 3PREA 3ZW3A 3PZDA 4EZJA 4OVVA 4DXAB 4TKNA 3K9OB 3UIOB 4AOFA 2CS4A 4EZKA 2KZRA 1D3ZA 1E8YA 4AWJA 3U30A 4EFOA 3VVWB 2DHZA 4HVBA 3H7SA 4PS3A 2DENB 3Q3FA 2G4SA 3QAQA 3VHTC 4HPLB 1GUAB 3RCZA 1EUVB 3ZRFA 1U4AA 2NBUA 2NPTB 2JRIB 2O6VD 1NDDA 2KHWB 3L17A 3ZO5B 2BWFA 1OEYJ 1WM2A 2WWZA 5E6PA 2MW5A 2KKCA 3ZTDA 1E8ZA 4M8NA 2K8BA 4GDKB 2MBHA 3APFA 4WWPA 2BPSA 2M0XA 4I6LB 2CR5A 1WX8A 2L3ZA 2LI5A 2N9XA 3M95A 3PHXB 4JIOU 2C9WB 2LXAA 2FCMA 3I3TB 4B6WA 3T9LA 2KJRA 2N4FA 1IPGA 2IBIB 1XD3B 3SDLC 4YL8A 3A33B 3N32A 2KTFA 2PE6B 4MEMA 4CHKA 2IO1B 3JVZX 1E7VA 3VUXA 1WGYA 1WX7A 1WY8A 3W1YA 1Y8RC 5D7GA 2LGDA 1XT9B 1V2YA 5C1ZA 1JRUA 2ZCBA 1LFDA 2IZVB 2ZVNA 4W9CA 2KFKB 1Z2MA 4KDIC 2KC2A 3WIMA 1WR6E 4IM2A 2UWQA 4DDID 5D2MB 4K7UA 2LASA 3X0WA 2MA9B 3T8MA 4BBNC 2NBWB 2IY0B 3R7RA 4KDLB 4NJ6A 1XQQA 3VQIA 4MM3A 1I35A 1Q5WB 2REXA 3ENEA 2KLCA 5AZFA 2KDBA 2OOBB 3PTFC 1SE9A 2MWSB 4MJSB 1WJUA 2CHZA 4F8CB 2KQSA 4KSLC 4DBGA 3TMPB 3VFKA 4I6PA 2RGFA 2YLMA 2KK8A 4LJOB 4EZLA 3HIZA 2KX0A 3BY4B 3QIJA 5L95C 3AU4A 3ZNZB 5G55A 1OEYA 1WZ0A 2KWVB 4GDLA 3TJPA 2NVUI 3DBLI 3VAWA 4N9F4 3EFUA 2CKHB 2RR9A 4DHJD 2NBVB 4OVUA 4K1RB 4JLCA 4FHJA 2RSUA 1WR1A 3H1UA 3IVFA 3OJ3A 4W9KA 3WAMA 1UD7A 1WGGA 2K6QA 2W9NA 3RULA 3TBLD 2DZJA 2C5LC 3L16A 4GMVA 4GDLB 2M17A 3A1QB 4GSWA 3JSVB 5DPRA 3QC8B 4DHJB 4F1SA 5J2RA 3P2BA 4FHKA 1I42A 2LD9A 3ZDMC 2BF8B 2JY6A 2CU1A 4ANVA 2L8JA 4IUMB 2D10A 2JVCA 3GOEA 3NZUA 2GBJA 1GJZA 3H6NA 4ANXA 5GMVA 3UGBB 4IG7B 1X1MA 1ZGUB 2LUEA 1WMHB 4ICVA 3CF6E 1PQSA 4TV3A 1E5WA 3IG3A 4IWQA 4TQ0A 1M94A 1KOTA 1V86A 1YIWA 1RFAA 2I1KA 3DCGA 1V5TA 4BFRA 2KTRA 5CTRC 1LM8B 2FIFA 2ZEQA 2LVOA 2LRWA 4MGKE 3MTNB 2BYEA 1TZ1A 1WE6A 2C60A 1RRBA 4NAWA 1WZ3A 2M4NA 3WA0A 2K8CA 3N30A 2J0KA 2LRUA 2RPQA 3QJZA 3TCAA 2JUOA 1T0YA 2LVPA 2XEWA 4W9IA 2UYZB 3IHPC 4MSQB 1Q1OA 4E71A 1L2NA 3ZRCA 1Z5SB 4HXDA 4BKGA 3VUWA 2FNJB 2GBRA 2MSED 2PJHA 3K9PB 2DX5B 3SD5A 1V81A 3SHQA 3NS8A 4II3B 2B3AA 2K6DB 3WAPA 2JWZA 2CHWA 2EMSA 2WX0A 3ML9A 4IWOA 3ZUNA 4BKSA 5JHAA 3WAOA 1P0RA 4LDTD 4IM3A 1S3SG 1WJNA 2LGYA 3O65B 4MGYE 3QCAA 3PVLA 2VRRB 3H9DA 1EF1A 2DYOA 3L08A 3PT2B 5CHFA 4ZRJA 2KX3A 4MJSA 3HM3A 3LJ3A 3PRZA 3QX1A 2K1FA 5CHWA 2KJ6A 3CMMB 3A9KA 1K8RB 4FJYA 1TGZB 2DAFA 4BOSC 2JF5A 1GNUA 3B0AA 4FBJB 2LVQA 3ZNGC 3N3KB 4FN2A 2KFKA 2FIDA 2EKEC 3DVGY 5D94A 3ZNID 1H4RA 3WALA 2BYVE 3DVGX 3V6CB 2KTRB 1YD8U 2PEAA 2MBOA 3A1QA 2BGFA 3ZIMA 2LWPA 3VH3B 1IYFA 1V9JA 5G2NA 2FCSA 3PRPB 1WE7A 5LLIA 4URKA 2GBNA 3PSEB 4CO7A 1UBIA 3JYUA 3WANA 3L54A 4KIKB 3ZDTA 1GC7A 2PE9A 3R3MA 4K81A 1H8CA 1WYWB 3MHSD 1KM7A 4ASWC 4BOZB 4AUQC 4RM9A 3ONSA 3IFWB 1S1QB 3NHEB 4IW0A 4BKTA 1RLFA 1SIFA 2KC1A 2ZZPB 4A3PA 4HCNB 3RYTA 4TQ1A 2M1MA 4K7SA 1WGHA 2KXJA 3IBEA 4G50A 2IO3B 4KZCA 1WF9A 5L83A 2C7MB 4MDKE 1IP9A 5TR5A 3DVNU 4FADA 1V80A 2N9PC 2Z0DB 2KVRA 3D32A 2NCNA 4GOCA 2G45B 3JSVA 4GDKA 4NNJB 4DHZE 2L0FA 4P7IA 3SU8X 1BT0A 3AI5A 5JHBA 4W9DA 4NAWB 2N1VA 3DDCB 3UQBA 3V6EB 2XBBC 1FXTB 3ML8A 1QZEA 3KUZA 2A4ZA 4M8MA 2BKFA 2G4DB 3ZKJC 4XC2A 1SGHA 4MGIE 4NY0A 3BINA 2O6VA 2N1WA 4WAAA 1J8CA 1WGRA 3APCA 3R7QA 3ZTCA 3KYCD 2A5UA 4II2B 3B1LX 3U7DA 1WXSA 3AULA 4PS7A 1R4MI 1WH3A 2GBMA 3PLVA 1HE8A 4DWFA 3KYDD 3KVFB 1WMHA 2AEHA 2MP2A 2IO2B 3S2AA 1ZW7A 4B9KA 3JW0X 2PPHA 2O2VB 3A9JB 4EKUA 1E90A 2JZ3B 3NZSA 3RZFA 3C0RB 1TBEA 1UELA 3PHWB 1UGMA 4GB9A 4XZ4A 3RZWC 2EMTA 5C23A 2KO3A 2V4LA 2KDIA 2HTHA 5IA7A 4W9LA 2IY1B 2MQJA 4J6IA 1WJ6A 2XK5A 1EO6A 5BO4B 3W1SA 2C7NB 4F7ZA 3QQ8B 3VXWA 2HD5B 1GC6A 2ZCCA 4HWIB 3VTVA 3UQAA 4K7WA 5JZEB 2NR2A 2QHOA 3KUCB 2KDEB 2NPTA 2AWTA 3DOWA 3HHMA 2J0JA 4HCPB 2DYMA 1P3QU 2GBKA 4LCDE 3CSTA 4HK2A 2D07B 2IO0B 3ZLZA 3V60A 5AZGA 5HKHA 5DPWA 1UZXB 3VH4B 5D6JB 1NBFC 4KSKC 2KANA 4NJ7A 4FULA 4GN1A 2JZZA 4FJZA 3RUIB 4EUTA 3A4RA 3VDZA 4FLHA 2G3QB 1C1YB 2C7HA 2KLGA 3QA8A 4PS8A 3Q3JA 3TIXA 2AL6A 2YVCA 1WXAA 4ANWA 1YX5B 2N9EB 3NOBA 2ZPYA 2FCNA 5CHVC 2OJRA 4TUUA 1WIAA 4KVGB 1C3TA 2L7RA 5FR6A 4ZYNA 2K8HA 4PYUA 2M8SA 2N7DA 3X23A 5IAAC 1F9JA 4M0WB 1WXMA 4EOYA 1WI0A 2KQ7A 2LJ5A 1YQBA 4WJOA 4DK5A 2JT4B 4W9HA 1V49A 2GMIC 4IWPA 4GU2A 4BKSD 4AP4C 1P9DU 1OQYA 3RT3B 4DHZB 2KNBA 1UH6A 3PGEA 2WX1A 3NY5A 2LXCA 4ZRIA 2KN5A 2DAJA 2L76A 4JGHB 4W9EA 4KIKA 5JH5C 2NS5A 3A4SC 3W1SC 1NI2A 4ZRKA 1AARA 1V6EA 2L0TA 2KMAA 3L0WB 1P98A 1WM3A 2BKRB 4JQWC 2MBEA 4ICUA 2O6VB 1LXDA 2D11A 2RD0A 5DPTA 4HLEA 1Q0WB 2D3GA 4MGZE 4EEWA 1ZKHA 2DYBA 2FAZA 4IC7B 4MH0E 4G3XB 1VD2A 3OAWA 4FJVB 4NPNA 1WRDB 1WXVA 2LZ6A 3M63B 2O2VA 3A9JA 2FUHB 3HM6X 4G11A 2MP2B 1E8XA 2Z0EB 5AZHA 4HDQA 4NQKE 3RD2A 3VTWA 5E6OA 3V62A 1UBQA 2D2QA 5LXHA 1J0GA 4LDTB 4KZ0A 2I1JA 5CX3A 3VTUA 3AXCA 1RAXA 2ZNVB 2KWCA 3M62B 4PYZA 2LGXA 1YX6B 4HPMB 3V61A 3H7PA 4WJQA 2KWUB 2ZJDA 2MLBA 4MSMB 3R66C 3OLMD 4DDGD 2L05A 1WX9A 1OTRB 1EF5A 3DQVA 2XK5B 4JL9A 2K39A 3APDA 1TTNA 2Y5BB 1V5OA 2AYOB 3DVNV 4IM0A 4W9JA 3QARA 2BWES 1OGWA 4X57B 4AJWA 4I6NB 4WWNA 4BVUC 2R2QA 4GGQA 2ZNVC 3A9KB 2KOXA 3UIPB 3PPAA 1E7UA 3KUDB 2L00B 4G0NB 4HJKA 2V3SA 3CSFA 2KD0A 1CMXB 3L13A 3EECA 1WFYA 5E6NA 2JRHA 3L10B 2IYDB 4AJYB 4W9GA 5LXIB 3DBSA 3ECIA 1KLVA 5DPSA 2J7QB 3PLUA 3PV1A 4NQLB 5EDSA 1MG8A 4MELA 5J18A 3M3JA 2R2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBQ A;  1R4N I;  1GG3 A;  3EC8 A;  4ZDV A;  4RMA A;  3DBH I;  2MX2 A;  3LDZ E;  2KMC A;  3KW5 B;  4HDO A;  1L7Y A;  3QK0 A;  4E3C A;  3UF8 A;  5AEK B;  1LQB A;  3DPD A;  3QWZ B;  2GOW A;  1WGD A;  1J19 A;  4ANU A;  3DBR I;  1ISN A;  2WDT B;  2WYQ A;  1A5R A;  2BYF A;  2KFJ A;  4KV2 A;  3MJW A;  3ZNH B;  4BBN F;  2ZVO A;  4WWO A;  3ZVV A;  4E74 A;  4FA6 A;  2HJ8 A;  3KH0 A;  2MRP A;  3QHT A;  2AL3 A;  1P1A A;  2ASQ A;  4GIV A;  3U8Z A;  2MBB B;  1KJT A;  4LJP B;  4CYE A;  4XX5 A;  2N7E A;  1E8W A;  4RM8 A;  4WJP A;  2ZPN A;  3HK0 A;  2HE7 A;  2FCQ A;  2DZI A;  5J17 A;  2J0M A;  2CHX A;  2KJH B;  1VCB A;  2MCN B;  4B95 A;  1G6J A;  4GXB A;  3H7P B;  5KHO A;  4A20 A;  3AU5 A;  3OJ4 B;  3PS6 A;  3VUY A;  2DZM A;  2Z59 B;  2JXX A;  2V1Y A;  3PRM B;  3UIN B;  1WJ4 A;  1YJ1 A;  3GZN I;  2JPH A;  2K25 A;  2DZK A;  4A3O A;  4WJN A;  2KDF B;  3ALB A;  3EHV A;  4WQO B;  4W9F A;  5DCN A;  3TL5 A;  3B08 A;  5KHQ A;  3PRE A;  3ZW3 A;  3PZD A;  4EZJ A;  4OVV A;  4DXA B;  4TKN A;  3K9O B;  3UIO B;  4AOF A;  2CS4 A;  4EZK A;  2KZR A;  1D3Z A;  1E8Y A;  4AWJ A;  3U30 A;  4EFO A;  3VVW B;  2DHZ A;  4HVB A;  3H7S A;  4PS3 A;  2DEN B;  3Q3F A;  2G4S A;  3QAQ A;  3VHT C;  4HPL B;  1GUA B;  3RCZ A;  1EUV B;  3ZRF A;  1U4A A;  2NBU A;  2NPT B;  2JRI B;  2O6V D;  1NDD A;  2KHW B;  3L17 A;  3ZO5 B;  2BWF A;  1OEY J;  1WM2 A;  2WWZ A;  5E6P A;  2MW5 A;  2KKC A;  3ZTD A;  1E8Z A;  4M8N A;  2K8B A;  4GDK B;  2MBH A;  3APF A;  4WWP A;  2BPS A;  2M0X A;  4I6L B;  2CR5 A;  1WX8 A;  2L3Z A;  2LI5 A;  2N9X A;  3M95 A;  3PHX B;  4JIO U;  2C9W B;  2LXA A;  2FCM A;  3I3T B;  4B6W A;  3T9L A;  2KJR A;  2N4F A;  1IPG A;  2IBI B;  1XD3 B;  3SDL C;  4YL8 A;  3A33 B;  3N32 A;  2KTF A;  2PE6 B;  4MEM A;  4CHK A;  2IO1 B;  3JVZ X;  1E7V A;  3VUX A;  1WGY A;  1WX7 A;  1WY8 A;  3W1Y A;  1Y8R C;  5D7G A;  2LGD A;  1XT9 B;  1V2Y A;  5C1Z A;  1JRU A;  2ZCB A;  1LFD A;  2IZV B;  2ZVN A;  4W9C A;  2KFK B;  1Z2M A;  4KDI C;  2KC2 A;  3WIM A;  1WR6 E;  4IM2 A;  2UWQ A;  4DDI D;  5D2M B;  4K7U A;  2LAS A;  3X0W A;  2MA9 B;  3T8M A;  4BBN C;  2NBW B;  2IY0 B;  3R7R A;  4KDL B;  4NJ6 A;  1XQQ A;  3VQI A;  4MM3 A;  1I35 A;  1Q5W B;  2REX A;  3ENE A;  2KLC A;  5AZF A;  2KDB A;  2OOB B;  3PTF C;  1SE9 A;  2MWS B;  4MJS B;  1WJU A;  2CHZ A;  4F8C B;  2KQS A;  4KSL C;  4DBG A;  3TMP B;  3VFK A;  4I6P A;  2RGF A;  2YLM A;  2KK8 A;  4LJO B;  4EZL A;  3HIZ A;  2KX0 A;  3BY4 B;  3QIJ A;  5L95 C;  3AU4 A;  3ZNZ B;  5G55 A;  1OEY A;  1WZ0 A;  2KWV B;  4GDL A;  3TJP A;  2NVU I;  3DBL I;  3VAW A;  4N9F 4;  3EFU A;  2CKH B;  2RR9 A;  4DHJ D;  2NBV B;  4OVU A;  4K1R B;  4JLC A;  4FHJ A;  2RSU A;  1WR1 A;  3H1U A;  3IVF A;  3OJ3 A;  4W9K A;  3WAM A;  1UD7 A;  1WGG A;  2K6Q A;  2W9N A;  3RUL A;  3TBL D;  2DZJ A;  2C5L C;  3L16 A;  4GMV A;  4GDL B;  2M17 A;  3A1Q B;  4GSW A;  3JSV B;  5DPR A;  3QC8 B;  4DHJ B;  4F1S A;  5J2R A;  3P2B A;  4FHK A;  1I42 A;  2LD9 A;  3ZDM C;  2BF8 B;  2JY6 A;  2CU1 A;  4ANV A;  2L8J A;  4IUM B;  2D10 A;  2JVC A;  3GOE A;  3NZU A;  2GBJ A;  1GJZ A;  3H6N A;  4ANX A;  5GMV A;  3UGB B;  4IG7 B;  1X1M A;  1ZGU B;  2LUE A;  1WMH B;  4ICV A;  3CF6 E;  1PQS A;  4TV3 A;  1E5W A;  3IG3 A;  4IWQ A;  4TQ0 A;  1M94 A;  1KOT A;  1V86 A;  1YIW A;  1RFA A;  2I1K A;  3DCG A;  1V5T A;  4BFR A;  2KTR A;  5CTR C;  1LM8 B;  2FIF A;  2ZEQ A;  2LVO A;  2LRW A;  4MGK E;  3MTN B;  2BYE A;  1TZ1 A;  1WE6 A;  2C60 A;  1RRB A;  4NAW A;  1WZ3 A;  2M4N A;  3WA0 A;  2K8C A;  3N30 A;  2J0K A;  2LRU A;  2RPQ A;  3QJZ A;  3TCA A;  2JUO A;  1T0Y A;  2LVP A;  2XEW A;  4W9I A;  2UYZ B;  3IHP C;  4MSQ B;  1Q1O A;  4E71 A;  1L2N A;  3ZRC A;  1Z5S B;  4HXD A;  4BKG A;  3VUW A;  2FNJ B;  2GBR A;  2MSE D;  2PJH A;  3K9P B;  2DX5 B;  3SD5 A;  1V81 A;  3SHQ A;  3NS8 A;  4II3 B;  2B3A A;  2K6D B;  3WAP A;  2JWZ A;  2CHW A;  2EMS A;  2WX0 A;  3ML9 A;  4IWO A;  3ZUN A;  4BKS A;  5JHA A;  3WAO A;  1P0R A;  4LDT D;  4IM3 A;  1S3S G;  1WJN A;  2LGY A;  3O65 B;  4MGY E;  3QCA A;  3PVL A;  2VRR B;  3H9D A;  1EF1 A;  2DYO A;  3L08 A;  3PT2 B;  5CHF A;  4ZRJ A;  2KX3 A;  4MJS A;  3HM3 A;  3LJ3 A;  3PRZ A;  3QX1 A;  2K1F A;  5CHW A;  2KJ6 A;  3CMM B;  3A9K A;  1K8R B;  4FJY A;  1TGZ B;  2DAF A;  4BOS C;  2JF5 A;  1GNU A;  3B0A A;  4FBJ B;  2LVQ A;  3ZNG C;  3N3K B;  4FN2 A;  2KFK A;  2FID A;  2EKE C;  3DVG Y;  5D94 A;  3ZNI D;  1H4R A;  3WAL A;  2BYV E;  3DVG X;  3V6C B;  2KTR B;  1YD8 U;  2PEA A;  2MBO A;  3A1Q A;  2BGF A;  3ZIM A;  2LWP A;  3VH3 B;  1IYF A;  1V9J A;  5G2N A;  2FCS A;  3PRP B;  1WE7 A;  5LLI A;  4URK A;  2GBN A;  3PSE B;  4CO7 A;  1UBI A;  3JYU A;  3WAN A;  3L54 A;  4KIK B;  3ZDT A;  1GC7 A;  2PE9 A;  3R3M A;  4K81 A;  1H8C A;  1WYW B;  3MHS D;  1KM7 A;  4ASW C;  4BOZ B;  4AUQ C;  4RM9 A;  3ONS A;  3IFW B;  1S1Q B;  3NHE B;  4IW0 A;  4BKT A;  1RLF A;  1SIF A;  2KC1 A;  2ZZP B;  4A3P A;  4HCN B;  3RYT A;  4TQ1 A;  2M1M A;  4K7S A;  1WGH A;  2KXJ A;  3IBE A;  4G50 A;  2IO3 B;  4KZC A;  1WF9 A;  5L83 A;  2C7M B;  4MDK E;  1IP9 A;  5TR5 A;  3DVN U;  4FAD A;  1V80 A;  2N9P C;  2Z0D B;  2KVR A;  3D32 A;  2NCN A;  4GOC A;  2G45 B;  3JSV A;  4GDK A;  4NNJ B;  4DHZ E;  2L0F A;  4P7I A;  3SU8 X;  1BT0 A;  3AI5 A;  5JHB A;  4W9D A;  4NAW B;  2N1V A;  3DDC B;  3UQB A;  3V6E B;  2XBB C;  1FXT B;  3ML8 A;  1QZE A;  3KUZ A;  2A4Z A;  4M8M A;  2BKF A;  2G4D B;  3ZKJ C;  4XC2 A;  1SGH A;  4MGI E;  4NY0 A;  3BIN A;  2O6V A;  2N1W A;  4WAA A;  1J8C A;  1WGR A;  3APC A;  3R7Q A;  3ZTC A;  3KYC D;  2A5U A;  4II2 B;  3B1L X;  3U7D A;  1WXS A;  3AUL A;  4PS7 A;  1R4M I;  1WH3 A;  2GBM A;  3PLV A;  1HE8 A;  4DWF A;  3KYD D;  3KVF B;  1WMH A;  2AEH A;  2MP2 A;  2IO2 B;  3S2A A;  1ZW7 A;  4B9K A;  3JW0 X;  2PPH A;  2O2V B;  3A9J B;  4EKU A;  1E90 A;  2JZ3 B;  3NZS A;  3RZF A;  3C0R B;  1TBE A;  1UEL A;  3PHW B;  1UGM A;  4GB9 A;  4XZ4 A;  3RZW C;  2EMT A;  5C23 A;  2KO3 A;  2V4L A;  2KDI A;  2HTH A;  5IA7 A;  4W9L A;  2IY1 B;  2MQJ A;  4J6I A;  1WJ6 A;  2XK5 A;  1EO6 A;  5BO4 B;  3W1S A;  2C7N B;  4F7Z A;  3QQ8 B;  3VXW A;  2HD5 B;  1GC6 A;  2ZCC A;  4HWI B;  3VTV A;  3UQA A;  4K7W A;  5JZE B;  2NR2 A;  2QHO A;  3KUC B;  2KDE B;  2NPT A;  2AWT A;  3DOW A;  3HHM A;  2J0J A;  4HCP B;  2DYM A;  1P3Q U;  2GBK A;  4LCD E;  3CST A;  4HK2 A;  2D07 B;  2IO0 B;  3ZLZ A;  3V60 A;  5AZG A;  5HKH A;  5DPW A;  1UZX B;  3VH4 B;  5D6J B;  1NBF C;  4KSK C;  2KAN A;  4NJ7 A;  4FUL A;  4GN1 A;  2JZZ A;  4FJZ A;  3RUI B;  4EUT A;  3A4R A;  3VDZ A;  4FLH A;  2G3Q B;  1C1Y B;  2C7H A;  2KLG A;  3QA8 A;  4PS8 A;  3Q3J A;  3TIX A;  2AL6 A;  2YVC A;  1WXA A;  4ANW A;  1YX5 B;  2N9E B;  3NOB A;  2ZPY A;  2FCN A;  5CHV C;  2OJR A;  4TUU A;  1WIA A;  4KVG B;  1C3T A;  2L7R A;  5FR6 A;  4ZYN A;  2K8H A;  4PYU A;  2M8S A;  2N7D A;  3X23 A;  5IAA C;  1F9J A;  4M0W B;  1WXM A;  4EOY A;  1WI0 A;  2KQ7 A;  2LJ5 A;  1YQB A;  4WJO A;  4DK5 A;  2JT4 B;  4W9H A;  1V49 A;  2GMI C;  4IWP A;  4GU2 A;  4BKS D;  4AP4 C;  1P9D U;  1OQY A;  3RT3 B;  4DHZ B;  2KNB A;  1UH6 A;  3PGE A;  2WX1 A;  3NY5 A;  2LXC A;  4ZRI A;  2KN5 A;  2DAJ A;  2L76 A;  4JGH B;  4W9E A;  4KIK A;  5JH5 C;  2NS5 A;  3A4S C;  3W1S C;  1NI2 A;  4ZRK A;  1AAR A;  1V6E A;  2L0T A;  2KMA A;  3L0W B;  1P98 A;  1WM3 A;  2BKR B;  4JQW C;  2MBE A;  4ICU A;  2O6V B;  1LXD A;  2D11 A;  2RD0 A;  5DPT A;  4HLE A;  1Q0W B;  2D3G A;  4MGZ E;  4EEW A;  1ZKH A;  2DYB A;  2FAZ A;  4IC7 B;  4MH0 E;  4G3X B;  1VD2 A;  3OAW A;  4FJV B;  4NPN A;  1WRD B;  1WXV A;  2LZ6 A;  3M63 B;  2O2V A;  3A9J A;  2FUH B;  3HM6 X;  4G11 A;  2MP2 B;  1E8X A;  2Z0E B;  5AZH A;  4HDQ A;  4NQK E;  3RD2 A;  3VTW A;  5E6O A;  3V62 A;  1UBQ A;  2D2Q A;  5LXH A;  1J0G A;  4LDT B;  4KZ0 A;  2I1J A;  5CX3 A;  3VTU A;  3AXC A;  1RAX A;  2ZNV B;  2KWC A;  3M62 B;  4PYZ A;  2LGX A;  1YX6 B;  4HPM B;  3V61 A;  3H7P A;  4WJQ A;  2KWU B;  2ZJD A;  2MLB A;  4MSM B;  3R66 C;  3OLM D;  4DDG D;  2L05 A;  1WX9 A;  1OTR B;  1EF5 A;  3DQV A;  2XK5 B;  4JL9 A;  2K39 A;  3APD A;  1TTN A;  2Y5B B;  1V5O A;  2AYO B;  3DVN V;  4IM0 A;  4W9J A;  3QAR A;  2BWE S;  1OGW A;  4X57 B;  4AJW A;  4I6N B;  4WWN A;  4BVU C;  2R2Q A;  4GGQ A;  2ZNV C;  3A9K B;  2KOX A;  3UIP B;  3PPA A;  1E7U A;  3KUD B;  2L00 B;  4G0N B;  4HJK A;  2V3S A;  3CSF A;  2KD0 A;  1CMX B;  3L13 A;  3EEC A;  1WFY A;  5E6N A;  2JRH A;  3L10 B;  2IYD B;  4AJY B;  4W9G A;  5LXI B;  3DBS A;  3ECI A;  1KLV A;  5DPS A;  2J7Q B;  3PLU A;  3PV1 A;  4NQL B;  5EDS A;  1MG8 A;  4MEL A;  5J18 A;  3M3J A;  2R2O A; 
#chains in the Genus database with same CATH topology
 2W3R A;  2LHE A;  2MX2 A;  3T3N A;  4E3C A;  1L7Y A;  3UF8 A;  5AEK B;  2JQR B;  2J42 A;  3NS1 A;  2BYF A;  1YQ4 B;  3ZNH B;  4FA6 A;  2HJ8 A;  1J7A A;  1P1A A;  1HTQ A;  4GIV A;  3U8Z A;  5H8Y E;  4LJP B;  4RM8 A;  1JW9 D;  2ZPN A;  2MCN B;  3AE3 B;  3H7P B;  5KHO A;  3AU5 A;  3BZD B;  2WXK A;  3UIN B;  1B1Z A;  1PGB A;  1FXI A;  4A3O A;  2OJW A;  5DCN A;  3PRE A;  3PZD A;  4EZJ A;  4OVV A;  2LGS A;  4TKN A;  2JYE A;  2V3N A;  4EZK A;  1YOV B;  1D3Z A;  4AWJ A;  4EFO A;  2DHZ A;  4HVB A;  3VRB B;  1XCQ L;  3VHT C;  3AE5 B;  3P1M A;  2NBU A;  2JRI B;  4S0R A;  1NDD A;  3L17 A;  2BWF A;  2Y5P A;  1I4X A;  2L3Z A;  3M95 A;  4JIO U;  3ZYY X;  3TEW A;  2PKO A;  3A33 B;  4P1C C;  2M19 A;  1R4M B;  1F2R I;  2IO1 B;  2WHI A;  1EWC A;  1XLN A;  1T0R C;  3W1Y A;  3CIR B;  1JQ4 A;  4ITK A;  2ZCB A;  3BYT B;  2KFK B;  3U52 E;  3AH7 A;  2WXJ A;  3WIM A;  3J9C A;  4ZRP A;  3X0W A;  1RWS A;  3Q14 C;  2REX A;  5AZF A;  2OOB B;  3PTF C;  1SE9 A;  1FO4 A;  1FRR A;  1PUT A;  2MWS B;  4C00 A;  4MJS B;  1GOZ A;  2RGF A;  4ZYS A;  4EZL A;  3HIZ A;  2SAK A;  4OZC A;  2KX0 A;  3BY4 B;  1NEN B;  2QIL A;  4K3C A;  1L0Y B;  3AEE B;  1WZ0 A;  2KWV B;  2QIE B;  2HTM E;  2QMT A;  1EM7 A;  2CKH B;  2RR9 A;  1M4V A;  4WIP A;  4FHJ A;  4A90 A;  3IVF A;  2TSS A;  4OVZ A;  2LMC A;  2W9N A;  1MJD A;  4F1S A;  1T5X D;  1D4B A;  4MH8 A;  1SF0 A;  2WXO A;  3ZDM C;  2CU1 A;  3NZU A;  2K9X A;  3AE9 B;  3Q69 A;  4IG7 B;  1X1M A;  5IO9 A;  2WXP A;  1PQS A;  4TV3 A;  1E5W A;  2KAC A;  1YJJ A;  1D5Z C;  1KH0 A;  3RNC C;  2WXF A;  5CTR C;  1MI0 A;  1LM8 B;  1FM0 D;  4MGK E;  3BVM A;  1WZ3 A;  4XDC A;  3BWU D;  2LRU A;  2PIA A;  3QJZ A;  2JUO A;  1HTO A;  4E71 A;  2INN E;  3ZRC A;  1ENF A;  4BKG A;  2L1A A;  1YN3 A;  4KKJ A;  1V97 A;  3KLS X;  2Z8L A;  2DX5 B;  3NRZ A;  1V81 A;  2LFI A;  2JWZ A;  2CHW A;  2EMS A;  2WX0 A;  3ML9 A;  4IWO A;  2KN4 A;  3ZUN A;  4BKS A;  5JHA A;  3IT4 B;  1SB3 C;  4MGY E;  3PVL A;  4ZRJ A;  2KX3 A;  2Y5C A;  3PRZ A;  4C7Z A;  3CMM B;  4C4V A;  1FXA A;  3GB1 A;  5AUI A;  2WXN A;  2KTR B;  1IYF A;  5G2N A;  3ZQ4 A;  5MPO A;  1UBI A;  3ZDT A;  3MHS D;  3NHE B;  1SIF A;  2ZZP B;  4HCN B;  2M1M A;  2RPV A;  3IBE A;  4G50 A;  1QT9 A;  3W5U B;  4KZC A;  4RGM A;  4WQM A;  4FAD A;  3DVN U;  2W55 A;  5BMH A;  2G45 B;  1Y56 A;  4GDK A;  3DHI C;  4DHZ E;  2L0F A;  4P7I A;  3AI5 A;  2RDB C;  2K22 A;  5JHB A;  3R2I A;  3DDC B;  3UQB A;  1R7S A;  1QZE A;  3ZKJ C;  4XC2 A;  1ET6 A;  2ICI A;  3APC A;  1AW7 A;  3ZTC A;  2CJO A;  3B1L X;  3U7D A;  3AUL A;  2K3U A;  3Q8C A;  5E6J A;  3KYD D;  3NG0 A;  2AEH A;  2BYT A;  3JW0 X;  2O2V B;  4EKU A;  5LNK 1;  3Q8B A;  3PHW B;  3RZW C;  2KDI A;  4W9L A;  1WJ6 A;  1E9M A;  3W1S A;  3QQ8 B;  3VXW A;  3VTV A;  4K7W A;  2OHF A;  2QHO A;  3FIL B;  2KDE B;  2AWT A;  1P3Q U;  2GBK A;  2D07 B;  2WDR B;  3O13 A;  4TMA B;  4FUL A;  3ZJT A;  3AE7 B;  1JWS D;  2PW9 A;  2CJN A;  1WYG A;  3A4R A;  4FLH A;  2KLG A;  1EU4 A;  2H89 B;  1WXA A;  4ANW A;  4LNK A;  4QAY A;  4O1N A;  4ZOH C;  1JCK B;  1ZDV A;  2FCN A;  5CHV C;  1KF6 B;  2L7R A;  5FR6 A;  2K8H A;  2M8S A;  2N7D A;  3X23 A;  4YWG G;  1ZP0 B;  3B9J A;  1V1O A;  1WXM A;  2LJ5 A;  4W9H A;  1TYG B;  1V49 A;  2GMI C;  3SFD B;  1FNW A;  3RT3 B;  4DHZ B;  2KNB A;  1UH6 A;  4ZRI A;  2LXC A;  2DAJ A;  2L76 A;  5JH5 C;  3Q3O C;  2N9L A;  4ZRK A;  2E6X A;  3L4P A;  1WM3 A;  4JQW C;  2O6V B;  4YT0 B;  4MGZ E;  1JAL A;  4IC7 B;  3I9V 1;  4RF1 A;  1WRD B;  2I2Y A;  2FUH B;  4G11 A;  1E8X A;  4HKQ A;  4HDQ A;  2EKI A;  4NZL B;  3RD2 A;  3TEX A;  5BMI A;  5LXH A;  3LYY A;  3VTU A;  2KAJ A;  3AXC A;  1YX6 B;  4HPM B;  2PVO D;  3ABV B;  1F1H A;  3SEB A;  3OLM D;  5FKA C;  2L05 A;  2XK5 B;  2K39 A;  2WLB A;  2BB6 A;  4W9J A;  1BXT A;  2BWE S;  1OGW A;  2EEL A;  3QAR A;  4WWN A;  4HRS A;  1JWM D;  3GE3 C;  1UF0 A;  3PPA A;  2Q5W D;  4YTN B;  4DQO C;  3EEC A;  4W9G A;  3C8Y A;  3ECI A;  1KLV A;  3PLU A;  2N7J A;  2PLP A;  4MEL A;  5J18 A;  3M3J A;  1R4N I;  2G9H D;  3EC8 A;  2NMQ A;  3DBH I;  2KMC A;  3FKY A;  1K53 A;  3QK0 A;  1LQB A;  3DPD A;  3DBR I;  2WDT B;  2WYQ A;  1CJE A;  5D3I B;  2KFJ A;  1TS5 A;  4NAM A;  3MJW A;  4E74 A;  3RI7 C;  3GZN B;  3ZJU A;  2MRP A;  5FK9 C;  2AQ2 B;  2MBB B;  1KJT A;  3C19 A;  3HK0 A;  2FCQ A;  2DZI A;  5J17 A;  4KGS A;  2CHX A;  2KJH B;  1VCB A;  4GXB A;  3PS6 A;  2DZM A;  2JXX A;  2V1Y A;  4EE2 A;  4M01 A;  3GZN I;  1YJ1 A;  2K25 A;  1IUE A;  3NVW A;  4UDU C;  1FFV A;  4W9F A;  4RH6 A;  4KX6 B;  3ZW3 A;  1N62 A;  2UU7 A;  4DXA B;  4AOF A;  1ZOY B;  2KZR A;  1JWU D;  1TKE A;  3U30 A;  1DOI A;  2DBY A;  2VZK B;  3H7S A;  3Q3F A;  2G4S A;  4HPL B;  1GUA B;  3ZGZ A;  1OEY J;  2WWZ A;  3ZTD A;  2BPS A;  1WX8 A;  2V0G A;  1GB4 A;  1I4P A;  1QKZ A;  1EU3 A;  3I3T B;  5BMG A;  3T9L A;  1IPG A;  1XD3 B;  3N32 A;  3NZ3 A;  3R8B A;  2D3A A;  1EWY C;  1L0V B;  3VUX A;  2WDV B;  1RFK A;  1Y8R C;  2LGD A;  5C1Z A;  5GXG B;  1Z2M A;  4KDI C;  2KC2 A;  1WR6 E;  4IM2 A;  4WUR A;  4DDI D;  4K7U A;  4C80 A;  3R7R A;  4KDL B;  4MM3 A;  4R3D A;  2KDB A;  1WJU A;  4RGO S;  2CHZ A;  4KSL C;  3TMP B;  4I6P A;  4L1B A;  2KK8 A;  4LJO B;  1MG4 A;  5L95 C;  4LK0 M;  3AU4 A;  5G55 A;  1XF5 L;  3ZXR A;  2NVU I;  1YN4 A;  3WAM A;  1UD7 A;  2MEK A;  2DZJ A;  1PYW D;  3L16 A;  1C9F A;  4GSW A;  1I4R A;  2PMV A;  3AEA B;  4FHK A;  2LD9 A;  1VLB A;  4IUM B;  3GOE A;  2JVC A;  1GJZ A;  1TZO A;  2QEJ C;  1SJE D;  4ANX A;  2LUE A;  1FNV A;  3IG3 A;  4TQ0 A;  1M94 A;  1YIW A;  4A6Q A;  1K50 A;  2I1K A;  3EGR A;  2M4N A;  3N30 A;  2J0K A;  2RPQ A;  3TCA A;  4DXF A;  1AWD A;  2DLB A;  1ESF A;  1Z5S B;  4P1B C;  2WDQ B;  1KFY B;  3SD5 A;  4C7Y A;  3PZ7 A;  1HXY D;  1JWA D;  1WGK A;  2LGY A;  3RN9 C;  2DYO A;  3I63 C;  3P63 A;  1P7E A;  1TJE A;  5TSS A;  1F77 A;  1I7H A;  2BS3 B;  2DAF A;  4FBJ B;  2LVQ A;  3N3K B;  3RNF C;  1UWM A;  1TIF A;  4P16 A;  3ZNI D;  1H4R A;  3WAL A;  3ZIM A;  3V6C B;  3A1Q A;  2BGF A;  1P7F A;  3RNE C;  4A9A A;  5IP4 D;  5LLI A;  4KGR A;  2GBN A;  3FC4 A;  4KIK B;  2PE9 A;  1WYW B;  2GLS A;  3DHG C;  4RM9 A;  3IFW B;  4IW0 A;  1VZ8 A;  2N9K A;  2XNA C;  4TQ1 A;  4K7S A;  1IP9 A;  4MDK E;  2JYT A;  1V80 A;  4GOC A;  2LEK A;  3V3X A;  1BT0 A;  2N0S B;  1XO3 A;  3MC0 B;  2N1V A;  1ZUD 2;  4HPP A;  4M8M A;  2A4Z A;  1T6B X;  2G4D B;  3AED B;  1SGH A;  4LNO A;  3BIN A;  2O6V A;  2N1W A;  3FAH A;  1J8C A;  3MC9 A;  3KYC D;  2BS2 B;  3KWL A;  1WH3 A;  2GBM A;  4PS7 A;  3PLV A;  1DOY A;  1XLP A;  1C4P A;  3S2A A;  4B9K A;  4MM3 B;  2QCZ A;  2JZ3 B;  3NZS A;  2WXQ A;  1E6E B;  4XZ4 A;  2K5P A;  5C23 A;  2HTH A;  4N6E B;  1JWB D;  4J6I A;  1WSP A;  2WXR A;  5BO4 B;  2WU5 B;  2LHD A;  1I4Q A;  1GC6 A;  3UQA A;  1UUP A;  4B0M A;  2IND C;  2NPT A;  3DOW A;  3DWM A;  3LB8 C;  3E56 A;  4HK2 A;  2IO0 B;  3N9Y C;  2WNM A;  5AZG A;  5HKH A;  5D6J B;  1NBF C;  4HRO A;  3PO0 A;  3N1Z C;  2JZZ A;  4FJZ A;  3RUI B;  5AUK A;  3B2F A;  3QA8 A;  1NYQ A;  2AL6 A;  1YX5 B;  2ZPY A;  4TSS A;  2MH7 A;  4TUU A;  1WRI A;  4ZYN A;  1I4G A;  4EOY A;  4WJO A;  2JT4 B;  1XXG A;  4AP4 C;  1MHX A;  2JU6 X;  1OFF A;  1F2R C;  2WX1 A;  3NY5 A;  4W9E A;  4YTP B;  4KIK A;  2NS5 A;  3W1S C;  3FIL A;  1DOX A;  3U7Z A;  1AAR A;  2M0A A;  1V6E A;  2BKR B;  3ZJV A;  1LXD A;  1VZ6 A;  2RD0 A;  3N1X C;  1Q0W B;  3BYY B;  2FAZ A;  1C4A A;  3E9S A;  1VR9 A;  4NPN A;  1I4H A;  2MP2 B;  1ROE A;  4S17 A;  3VTW A;  2B76 B;  5FR3 A;  3V62 A;  2WU2 B;  1N63 A;  1RAX A;  2W3S A;  3OWE B;  2KWC A;  2WXH A;  2LGX A;  1FEH A;  3H7P A;  3KQ4 A;  1HZ6 A;  3AE1 B;  4MSM B;  3R66 C;  1CK1 A;  3Q3N C;  1EF5 A;  1UGJ A;  3EFC A;  3RFZ B;  4KGT A;  2AYO B;  1PDX A;  4AJW A;  4I6N B;  2IDY A;  2R2Q A;  2OED A;  2ZNV C;  2KOX A;  3UIP B;  1E7U A;  2GB1 A;  2V3S A;  2QC8 A;  3CSF A;  1NYR A;  3EA6 A;  3VR8 B;  3BVZ A;  4L23 A;  4AJY B;  2PTL A;  3PV1 A;  1MG8 A;  1B9R A;  1ZXI A;  2MBQ A;  1GG3 A;  4ZDV A;  4RMA A;  3LDZ E;  3KW5 B;  4M00 A;  2GOW A;  1WGD A;  1J19 A;  2I38 A;  3AE4 B;  1ISN A;  3MHZ A;  4N59 A;  1Q10 A;  1VZ7 A;  3RNB C;  1N60 A;  4BBN F;  3QHT A;  1NVI D;  2ASQ A;  3MJ5 A;  3BK2 A;  3ZXV A;  4M02 A;  2J0M A;  2WP9 B;  1G6J A;  2KVZ A;  4A20 A;  2Z59 B;  3PRM B;  3SR6 A;  3TSS A;  2FUG 1;  4LNF A;  2KDF B;  3ALB A;  3EHV A;  4WQO B;  2QJL A;  2VZK D;  3TL5 A;  3B08 A;  5KHQ A;  4Q2J A;  3K9O B;  3UIO B;  1VJK A;  1E8Y A;  4PS3 A;  2DEN B;  3ZRF A;  1U4A A;  2NPT B;  4H2A A;  2KHW B;  3GP7 A;  4L2Y A;  3ZO5 B;  1FCL A;  1WM2 A;  3P42 A;  2K8B A;  2MBH A;  3APF A;  4WWP A;  3W9C B;  2M0X A;  2CR5 A;  2N9X A;  3RNA C;  2L83 A;  3PHX B;  4ARC A;  1JML A;  1FNU A;  1RM6 C;  4PT5 A;  1JRO A;  2KTF A;  2PE6 B;  4CHK A;  3TEZ A;  1WXQ A;  4RNA A;  1E0Z A;  2QDF A;  1WX7 A;  1WY8 A;  4WH4 A;  5D7G A;  1XT9 B;  3AEB B;  2WS3 B;  1JRU A;  3B2G A;  1LFD A;  2BQQ A;  4W9C A;  2Y3A A;  3P4P B;  4GLS C;  3AE2 B;  5D2M B;  2LAS A;  4BBN C;  2IY0 B;  3VQI A;  2D3B A;  4USA A;  4FXC A;  2GI9 A;  1SJH D;  5EE0 A;  2KQS A;  4DBG A;  1ZXH A;  1MVK A;  1J7C A;  1E10 A;  2BT6 A;  4GDL A;  3VAW A;  4N9F 4;  2NBV B;  4OVU A;  3GE8 C;  1WR1 A;  1ZE3 D;  3H1U A;  5G5G A;  2BS4 B;  1HA5 A;  2C5L C;  4HEA 1;  4GMV A;  3N20 C;  3JSV B;  5DPR A;  1OQR A;  1K51 A;  4DHJ B;  3P2B A;  1I42 A;  2JY6 A;  2L8J A;  2D10 A;  2GBJ A;  1SBB B;  3NVY A;  1ZGU B;  3CF6 E;  5T8I A;  1TY2 A;  3AEG B;  1KOT A;  1V86 A;  1RFA A;  2DWQ A;  1V5T A;  2RDG A;  2L52 A;  2W82 A;  4A55 A;  2LRW A;  3MTN B;  1TZ1 A;  2WXI A;  1WE6 A;  2C60 A;  1RRB A;  3WA0 A;  1FPY A;  4RFB A;  4OZA A;  1T0Y A;  3Q2A C;  2XEW A;  2UYZ B;  4MSQ B;  1Q1O A;  3RNG C;  1SXT A;  4HXD A;  3CWI A;  1PFD A;  2FNJ B;  2GBR A;  2MSE D;  2PJH A;  3K9P B;  3HUI A;  2AQ3 B;  3I5J C;  2BB5 A;  3SHQ A;  4II3 B;  2B3A A;  4JPS A;  3WAP A;  1GAQ B;  1UWX A;  3WAO A;  1P0R A;  4LDT D;  1YMH E;  4XE0 A;  2V3P A;  3O65 B;  3QCA A;  2VRR B;  1EF1 A;  3ETR A;  3DBR B;  3HM3 A;  5CHW A;  2NTS A;  2KJ6 A;  3A9K A;  4FJY A;  1ZDX A;  2D3C A;  1TGZ B;  3Q3M C;  1MFW A;  2JF5 A;  2NTT A;  3B0A A;  3ZNG C;  1PGA A;  4AS1 A;  2KFK A;  2FID A;  2EKE C;  5HI1 A;  3DVG Y;  3DVG X;  2PEA A;  1YD8 U;  2MBO A;  3VH3 B;  1UNS A;  3LXF A;  2RDH A;  3PRP B;  4CO7 A;  3BVG A;  3WAN A;  1IGC A;  3L54 A;  1H8C A;  1GC7 A;  3R3M A;  4K81 A;  2M56 B;  3ONS A;  1S1Q B;  1RLF A;  2KC1 A;  3W2D A;  2KXJ A;  4XYC A;  2IO3 B;  2C7M B;  1HQR D;  3EUB 2;  2INC C;  3WCQ A;  2Z0D B;  2KVR A;  5G5H A;  2NCN A;  2X38 A;  4WAF A;  4M0W A;  3IAM 1;  2JX5 A;  3SU8 X;  4W9D A;  2IPK D;  1FXT B;  1LGR A;  3KUZ A;  2BKF A;  4NY0 A;  4WAA A;  4II2 B;  1HE8 A;  3KVF B;  1WMH A;  2MP2 A;  5IN7 A;  2PPH A;  2VH2 A;  1FD6 A;  3RZF A;  1UEL A;  1TS2 A;  4BAX A;  2V4L A;  1C78 A;  2IY1 B;  2K0P A;  4A8X C;  2XK5 A;  2C7N B;  5JZE B;  2NR2 A;  4US8 A;  1XCT L;  3MFG A;  1L6V A;  3HHM A;  2J0J A;  4HCP B;  3CST A;  2V9H A;  1IBX B;  3VH4 B;  4KSK C;  2KAN A;  4NJ7 A;  4GN1 A;  1C79 A;  4LLG M;  1C1Y B;  2C7H A;  4PK1 A;  2YVC A;  4P6V F;  2N9E B;  2OJR A;  1N6Z A;  4PYU A;  1YQ3 B;  5IAA C;  4M0W B;  1C76 A;  2KQ7 A;  1L4D B;  1YQB A;  2FBW B;  4DK5 A;  4IWP A;  4GU2 A;  2WXL A;  1P9D U;  4LTU A;  4IKG A;  3PGE A;  3VRA B;  4JGH B;  2ONQ A;  3A4S C;  2MBE A;  2D11 A;  5DPT A;  4EEW A;  2DYB A;  5I4D A;  4MH0 E;  4MT5 A;  4REZ A;  4G3X B;  3OAW A;  4FJV B;  1WXV A;  1E7P B;  3A9J A;  3M63 B;  3HM6 X;  1QOB A;  2BBC A;  5BYQ A;  4NQK E;  4WWM A;  1D6E C;  1TS3 A;  1MHH E;  1FFU A;  1UBQ A;  1SE3 A;  1FRD A;  1J0G A;  4LDT B;  4KZ0 A;  2I1J A;  4RGT A;  3P4S B;  2CU3 A;  3IXS A;  3DHH C;  2ZNV B;  4PYZ A;  1DYQ A;  3NVV A;  2ZJD A;  5H92 C;  4DDG D;  4YSX B;  1WX9 A;  2SEB D;  4JL9 A;  3APD A;  1TTN A;  5EE1 A;  2Y5B B;  1V5O A;  4DXG A;  4IM0 A;  4BVU C;  2L32 A;  3A9K B;  1L5P A;  3DBH B;  2L00 B;  4G0N B;  4HJK A;  2ZW0 A;  1QIL A;  3MP9 A;  1BML C;  5E6N A;  2JRH A;  3L10 B;  2IYD B;  1TKY A;  3NVZ A;  5DPS A;  2J7Q B;  3AB5 A;  1FIQ A;  4NQL B;  5EDS A;  4J3O D;  3DWG C;  2W54 A;  2R2O A;  2MJE A;  2WGS A;  2KWD A;  1C77 A;  1QF6 A;  4HDO A;  3QWZ B;  1D5X C;  2WQY B;  4ANU A;  1A5R A;  4KV2 A;  2ZVO A;  4WWO A;  3ZVV A;  3KH0 A;  2AL3 A;  2KT7 A;  2G1E A;  2J4X A;  4CYE A;  4XX5 A;  2N7E A;  1E8W A;  4LNN A;  4WJP A;  2HE7 A;  1RYJ A;  1QQR A;  1SE2 A;  4B95 A;  1JRP A;  1ACC A;  3OJ4 B;  3VUY A;  1TY0 A;  3IAS 1;  1WJ4 A;  3DBL B;  2JPH A;  4ZRQ A;  2DZK A;  2AX5 A;  4WJN A;  1HEZ E;  1MPE A;  3VR9 B;  2WXG A;  2CS4 A;  2YEP B;  4XWW A;  2JZP A;  3VVW B;  3AV8 A;  4RF0 A;  2YEP F;  3QAQ A;  3AM9 A;  3RCZ A;  1EUV B;  1QOA A;  2O6V D;  4N58 A;  3AMZ A;  1BUI C;  5E6P A;  2MW5 A;  2KKC A;  1E8Z A;  2R61 A;  4M8N A;  4GDK B;  3AN1 A;  2RMM A;  4I6L B;  2INP E;  2LI5 A;  3Q6B A;  2C9W B;  2LXA A;  2FCM A;  3AE8 B;  4B6W A;  2KJR A;  2N4F A;  2IBI B;  4JWS C;  3SDL C;  4YL8 A;  4ZHP A;  4MEM A;  1N5W A;  3JVZ X;  5EE9 A;  3W5V B;  1E7V A;  3PZ8 A;  4YTM B;  1WGY A;  5BYS A;  2JSV X;  1V2Y A;  2KQ4 X;  2IZV B;  2ZVN A;  1GB1 A;  2FE8 A;  2UWQ A;  2MA9 B;  3T8M A;  2NBW B;  4NJ6 A;  1XQQ A;  1I35 A;  3Q8F A;  1Q5W B;  3ENE A;  2KLC A;  1KLU D;  4F8C B;  4ZHO A;  3VFK A;  2YLM A;  3QIJ A;  2QSD A;  3ZNZ B;  2JXT A;  1OEY A;  4US9 A;  3TJP A;  3DBL I;  5IOI A;  3EFU A;  4DHJ D;  4K1R B;  4JLC A;  2RSU A;  3NUH B;  1N61 A;  2MJD A;  3OJ3 A;  4W9K A;  1F52 A;  4JWU C;  1WGG A;  2K6Q A;  1CQV A;  3RUL A;  3TBL D;  2WXM A;  2M17 A;  3A1Q B;  4GDL B;  1VDV A;  5J2R A;  3QC8 B;  2KMM A;  1ZPS A;  2BF8 B;  4ANV A;  1SEB D;  1OQQ A;  3H6N A;  4IDI A;  5GMV A;  3UGB B;  1V8C A;  1KTK A;  4ICV A;  1WMH B;  2HJ1 A;  4IWQ A;  1WWT A;  3P4Q B;  4YSZ B;  3HVD A;  3DCG A;  4OW0 A;  1SSN A;  2KTR A;  1XLQ A;  4ACF A;  4BFR A;  2BTE A;  2FIF A;  2ZEQ A;  2LVO A;  2J52 A;  2BYE A;  1YNT E;  1L6U A;  4NAW A;  1VRA B;  3HRD D;  2K8C A;  4C4V B;  4MAC A;  5C3J B;  3NJT A;  1YJI A;  2LVP A;  3URY A;  4W9I A;  3IHP C;  1L2N A;  2KDM A;  3HVZ A;  3SFE B;  3VUW A;  4K3B A;  5D3D A;  1IGD A;  3NS8 A;  3P4R B;  2K6D B;  5BYR A;  2LGI A;  2MJ3 A;  4IM3 A;  1S3S G;  1WJN A;  4CQN A;  3L08 A;  3H9D A;  3PT2 B;  5CHF A;  3MC8 A;  2IGH A;  4MJS A;  2X8X X;  2ON8 A;  3LJ3 A;  3QX1 A;  2JWU A;  2K1F A;  3AE6 B;  2E3T A;  4XGA B;  1K8R B;  4BOS C;  3BII D;  1GNU A;  1CZP A;  2VH1 A;  4FN2 A;  1A70 A;  4ARI A;  1L0X B;  5D94 A;  2BYV E;  1KRH A;  4BZA A;  2LWP A;  4YXD B;  2ACZ B;  1V9J A;  2FCS A;  1WE7 A;  4URK A;  5JXV A;  2KYW A;  2PVG C;  3PSE B;  2LJI A;  3JYU A;  1KM7 A;  4ASW C;  4BOZ B;  4XDD A;  4AUQ C;  4BKT A;  4A3P A;  3AEF B;  3RYT A;  1WGH A;  1WF9 A;  5L83 A;  3OG5 A;  1K52 A;  5TR5 A;  5IKC M;  2N9P C;  2IJ0 A;  3D32 A;  4JE3 B;  3TUO A;  3JSV A;  4NNJ B;  2ZW1 A;  5HG2 A;  1N5X A;  2IGG A;  1QOF A;  3R2T A;  5HHD G;  4NAW B;  3V6E B;  2XBB C;  3ML8 A;  1ET9 A;  4MGI E;  1WGR A;  3R7Q A;  2A5U A;  1PGX A;  3N1Y C;  2H88 B;  1LO5 D;  1WXS A;  1R4M I;  4DWF A;  3UI3 A;  2IO2 B;  1ZW7 A;  3A9J B;  1E90 A;  4AQ7 A;  3C0R B;  1TBE A;  1UGM A;  2HDE A;  4GB9 A;  4D2K A;  2EMT A;  2V4I B;  2KO3 A;  5IA7 A;  2MQJ A;  3H8H A;  1EO6 A;  3KWV A;  4F7Z A;  1QOG A;  2HD5 B;  2ZCC A;  4HWI B;  1XLO A;  1YN5 A;  3U2S C;  3KUC B;  1XEE A;  2DYM A;  4LCD E;  1T0Q C;  3ZLZ A;  3V60 A;  5DPW A;  1UZX B;  2AQ1 B;  3AEC B;  1L4Z B;  3RMK C;  4EUT A;  3GS2 A;  3VDZ A;  2DNF A;  2G3Q B;  4PS8 A;  3Q3J A;  3TIX A;  1IBX A;  3BK1 A;  3NOB A;  3Q8A A;  1WIA A;  4KVG B;  1C3T A;  1AN8 A;  3U4E G;  5EE3 A;  1F9J A;  2GRI A;  1SE4 A;  2XN9 C;  1NI3 A;  4C56 C;  1FMA D;  1QLB B;  1WI0 A;  4KKI A;  1KLG D;  4BKS D;  1OQY A;  4HJG E;  2KN5 A;  3TEY A;  2IGD A;  1R4N B;  2MHJ A;  1SIJ A;  4RGN A;  1NI2 A;  2L0T A;  2KMA A;  3L0W B;  1P98 A;  4HKZ E;  2BVC A;  2LUM A;  4ICU A;  3IT6 B;  3Q8E A;  4HLE A;  2D3G A;  4XWT A;  1ZKH A;  1T0S C;  4NJC A;  2BW2 A;  2D5G A;  1VD2 A;  1T3Q A;  2LZ6 A;  2O2V A;  4IOI E;  2Z0E B;  5AZH A;  1C4C A;  3RPF C;  1FCC C;  4OHJ A;  5E6O A;  2D2Q A;  5HFY A;  1NEK B;  1TS4 A;  5CX3 A;  1TKG A;  1D5M C;  1HZ5 A;  3M62 B;  1F0Z A;  3V61 A;  1STE A;  5C2T B;  4WJQ A;  2KWU B;  3T3O A;  1AYF A;  1TT5 B;  2MLB A;  3V05 A;  1OTR B;  3DQV A;  3I57 A;  1V1P B;  1GPX A;  3DVN V;  4YSY B;  1DGJ A;  4X57 B;  4GGQ A;  1V1P A;  4JX1 C;  3KUD B;  3L13 A;  2KD0 A;  1CMX B;  1WFY A;  4B0E A;  5LXI B;  3DBS A;  4OZB A;  2J53 A;  1J7B A;  4LNI A;  4RCO A; 
#chains in the Genus database with same CATH homology
 2MBQ A;  1R4N I;  1GG3 A;  3EC8 A;  4ZDV A;  4RMA A;  3DBH I;  2MX2 A;  3LDZ E;  2KMC A;  3KW5 B;  4HDO A;  1L7Y A;  3QK0 A;  4E3C A;  3UF8 A;  5AEK B;  1LQB A;  3DPD A;  3QWZ B;  2GOW A;  1WGD A;  1J19 A;  4ANU A;  3DBR I;  1ISN A;  2WDT B;  2WYQ A;  1A5R A;  2BYF A;  2KFJ A;  4KV2 A;  3MJW A;  3ZNH B;  4BBN F;  2ZVO A;  4WWO A;  3ZVV A;  4E74 A;  4FA6 A;  2HJ8 A;  3KH0 A;  2MRP A;  3QHT A;  2AL3 A;  1P1A A;  2ASQ A;  4GIV A;  3U8Z A;  2MBB B;  1KJT A;  4LJP B;  4CYE A;  4XX5 A;  2N7E A;  1E8W A;  4RM8 A;  4WJP A;  2ZPN A;  3HK0 A;  2HE7 A;  2FCQ A;  2DZI A;  5J17 A;  2J0M A;  2CHX A;  2KJH B;  1VCB A;  2MCN B;  4B95 A;  1G6J A;  4GXB A;  3H7P B;  5KHO A;  4A20 A;  3AU5 A;  3OJ4 B;  3PS6 A;  3VUY A;  2DZM A;  2Z59 B;  2JXX A;  2V1Y A;  3PRM B;  3UIN B;  1WJ4 A;  1YJ1 A;  3GZN I;  2JPH A;  2K25 A;  2DZK A;  4A3O A;  4WJN A;  2KDF B;  3ALB A;  3EHV A;  4WQO B;  4W9F A;  5DCN A;  3TL5 A;  3B08 A;  5KHQ A;  3PRE A;  3ZW3 A;  3PZD A;  4EZJ A;  4OVV A;  4DXA B;  4TKN A;  3K9O B;  3UIO B;  4AOF A;  2CS4 A;  4EZK A;  2KZR A;  1D3Z A;  1E8Y A;  4AWJ A;  3U30 A;  4EFO A;  3VVW B;  2DHZ A;  4HVB A;  3H7S A;  4PS3 A;  2DEN B;  3Q3F A;  2G4S A;  3QAQ A;  3VHT C;  4HPL B;  1GUA B;  3RCZ A;  1EUV B;  3ZRF A;  1U4A A;  2NBU A;  2NPT B;  2JRI B;  2O6V D;  1NDD A;  2KHW B;  3L17 A;  3ZO5 B;  2BWF A;  1OEY J;  1WM2 A;  2WWZ A;  5E6P A;  2MW5 A;  2KKC A;  3ZTD A;  1E8Z A;  4M8N A;  2K8B A;  4GDK B;  2MBH A;  3APF A;  4WWP A;  2BPS A;  2M0X A;  4I6L B;  2CR5 A;  1WX8 A;  2L3Z A;  2LI5 A;  2N9X A;  3M95 A;  3PHX B;  4JIO U;  2C9W B;  2LXA A;  2FCM A;  3I3T B;  4B6W A;  3T9L A;  2KJR A;  2N4F A;  1IPG A;  2IBI B;  1XD3 B;  3SDL C;  4YL8 A;  3A33 B;  3N32 A;  2KTF A;  2PE6 B;  4MEM A;  4CHK A;  2IO1 B;  3JVZ X;  1E7V A;  3VUX A;  1WGY A;  1WX7 A;  1WY8 A;  3W1Y A;  1Y8R C;  5D7G A;  2LGD A;  1XT9 B;  1V2Y A;  5C1Z A;  1JRU A;  2ZCB A;  1LFD A;  2IZV B;  2ZVN A;  4W9C A;  2KFK B;  1Z2M A;  4KDI C;  2KC2 A;  3WIM A;  1WR6 E;  4IM2 A;  2UWQ A;  4DDI D;  5D2M B;  4K7U A;  2LAS A;  3X0W A;  2MA9 B;  3T8M A;  4BBN C;  2NBW B;  2IY0 B;  3R7R A;  4KDL B;  4NJ6 A;  1XQQ A;  3VQI A;  4MM3 A;  1I35 A;  1Q5W B;  2REX A;  3ENE A;  2KLC A;  5AZF A;  2KDB A;  2OOB B;  3PTF C;  1SE9 A;  2MWS B;  4MJS B;  1WJU A;  2CHZ A;  4F8C B;  2KQS A;  4KSL C;  4DBG A;  3TMP B;  3VFK A;  4I6P A;  2RGF A;  2YLM A;  2KK8 A;  4LJO B;  4EZL A;  3HIZ A;  2KX0 A;  3BY4 B;  3QIJ A;  5L95 C;  3AU4 A;  3ZNZ B;  5G55 A;  1OEY A;  1WZ0 A;  2KWV B;  4GDL A;  3TJP A;  2NVU I;  3DBL I;  3VAW A;  4N9F 4;  3EFU A;  2CKH B;  2RR9 A;  4DHJ D;  2NBV B;  4OVU A;  4K1R B;  4JLC A;  4FHJ A;  2RSU A;  1WR1 A;  3H1U A;  3IVF A;  3OJ3 A;  4W9K A;  3WAM A;  1UD7 A;  1WGG A;  2K6Q A;  2W9N A;  3RUL A;  3TBL D;  2DZJ A;  2C5L C;  3L16 A;  4GMV A;  4GDL B;  2M17 A;  3A1Q B;  4GSW A;  3JSV B;  5DPR A;  3QC8 B;  4DHJ B;  4F1S A;  5J2R A;  3P2B A;  4FHK A;  1I42 A;  2LD9 A;  3ZDM C;  2BF8 B;  2JY6 A;  2CU1 A;  4ANV A;  2L8J A;  4IUM B;  2D10 A;  2JVC A;  3GOE A;  3NZU A;  2GBJ A;  1GJZ A;  3H6N A;  4ANX A;  5GMV A;  3UGB B;  4IG7 B;  1X1M A;  1ZGU B;  2LUE A;  1WMH B;  4ICV A;  3CF6 E;  1PQS A;  4TV3 A;  1E5W A;  3IG3 A;  4IWQ A;  4TQ0 A;  1M94 A;  1KOT A;  1V86 A;  1YIW A;  1RFA A;  2I1K A;  3DCG A;  1V5T A;  4BFR A;  2KTR A;  5CTR C;  1LM8 B;  2FIF A;  2ZEQ A;  2LVO A;  2LRW A;  4MGK E;  3MTN B;  2BYE A;  1TZ1 A;  1WE6 A;  2C60 A;  1RRB A;  4NAW A;  1WZ3 A;  2M4N A;  3WA0 A;  2K8C A;  3N30 A;  2J0K A;  2LRU A;  2RPQ A;  3QJZ A;  3TCA A;  2JUO A;  1T0Y A;  2LVP A;  2XEW A;  4W9I A;  2UYZ B;  3IHP C;  4MSQ B;  1Q1O A;  4E71 A;  1L2N A;  3ZRC A;  1Z5S B;  4HXD A;  4BKG A;  3VUW A;  2FNJ B;  2GBR A;  2MSE D;  2PJH A;  3K9P B;  2DX5 B;  3SD5 A;  1V81 A;  3SHQ A;  3NS8 A;  4II3 B;  2B3A A;  2K6D B;  3WAP A;  2JWZ A;  2CHW A;  2EMS A;  2WX0 A;  3ML9 A;  4IWO A;  3ZUN A;  4BKS A;  5JHA A;  3WAO A;  1P0R A;  4LDT D;  4IM3 A;  1S3S G;  1WJN A;  2LGY A;  3O65 B;  4MGY E;  3QCA A;  3PVL A;  2VRR B;  3H9D A;  1EF1 A;  2DYO A;  3L08 A;  3PT2 B;  5CHF A;  4ZRJ A;  2KX3 A;  4MJS A;  3HM3 A;  3LJ3 A;  3PRZ A;  3QX1 A;  2K1F A;  5CHW A;  2KJ6 A;  3CMM B;  3A9K A;  1K8R B;  4FJY A;  1TGZ B;  2DAF A;  4BOS C;  2JF5 A;  1GNU A;  3B0A A;  4FBJ B;  2LVQ A;  3ZNG C;  3N3K B;  4FN2 A;  2KFK A;  2FID A;  2EKE C;  3DVG Y;  5D94 A;  3ZNI D;  1H4R A;  3WAL A;  2BYV E;  3DVG X;  3V6C B;  2KTR B;  1YD8 U;  2PEA A;  2MBO A;  3A1Q A;  2BGF A;  3ZIM A;  2LWP A;  3VH3 B;  1IYF A;  1V9J A;  5G2N A;  2FCS A;  3PRP B;  1WE7 A;  5LLI A;  4URK A;  2GBN A;  3PSE B;  4CO7 A;  1UBI A;  3JYU A;  3WAN A;  3L54 A;  4KIK B;  3ZDT A;  1GC7 A;  2PE9 A;  3R3M A;  4K81 A;  1H8C A;  1WYW B;  3MHS D;  1KM7 A;  4ASW C;  4BOZ B;  4AUQ C;  4RM9 A;  3ONS A;  3IFW B;  1S1Q B;  3NHE B;  4IW0 A;  4BKT A;  1RLF A;  1SIF A;  2KC1 A;  2ZZP B;  4A3P A;  4HCN B;  3RYT A;  4TQ1 A;  2M1M A;  4K7S A;  1WGH A;  2KXJ A;  3IBE A;  4G50 A;  2IO3 B;  4KZC A;  1WF9 A;  5L83 A;  2C7M B;  4MDK E;  1IP9 A;  5TR5 A;  3DVN U;  4FAD A;  1V80 A;  2N9P C;  2Z0D B;  2KVR A;  3D32 A;  2NCN A;  4GOC A;  2G45 B;  3JSV A;  4GDK A;  4NNJ B;  4DHZ E;  2L0F A;  4P7I A;  3SU8 X;  1BT0 A;  3AI5 A;  5JHB A;  4W9D A;  4NAW B;  2N1V A;  3DDC B;  3UQB A;  3V6E B;  2XBB C;  1FXT B;  3ML8 A;  1QZE A;  3KUZ A;  2A4Z A;  4M8M A;  2BKF A;  2G4D B;  3ZKJ C;  4XC2 A;  1SGH A;  4MGI E;  4NY0 A;  3BIN A;  2O6V A;  2N1W A;  4WAA A;  1J8C A;  1WGR A;  3APC A;  3R7Q A;  3ZTC A;  3KYC D;  2A5U A;  4II2 B;  3B1L X;  3U7D A;  1WXS A;  3AUL A;  4PS7 A;  1R4M I;  1WH3 A;  2GBM A;  3PLV A;  1HE8 A;  4DWF A;  3KYD D;  3KVF B;  1WMH A;  2AEH A;  2MP2 A;  2IO2 B;  3S2A A;  1ZW7 A;  4B9K A;  3JW0 X;  2PPH A;  2O2V B;  3A9J B;  4EKU A;  1E90 A;  2JZ3 B;  3NZS A;  3RZF A;  3C0R B;  1TBE A;  1UEL A;  3PHW B;  1UGM A;  4GB9 A;  4XZ4 A;  3RZW C;  2EMT A;  5C23 A;  2KO3 A;  2V4L A;  2KDI A;  2HTH A;  5IA7 A;  4W9L A;  2IY1 B;  2MQJ A;  4J6I A;  1WJ6 A;  2XK5 A;  1EO6 A;  5BO4 B;  3W1S A;  2C7N B;  4F7Z A;  3QQ8 B;  3VXW A;  2HD5 B;  1GC6 A;  2ZCC A;  4HWI B;  3VTV A;  3UQA A;  4K7W A;  5JZE B;  2NR2 A;  2QHO A;  3KUC B;  2KDE B;  2NPT A;  2AWT A;  3DOW A;  3HHM A;  2J0J A;  4HCP B;  2DYM A;  1P3Q U;  2GBK A;  4LCD E;  3CST A;  4HK2 A;  2D07 B;  2IO0 B;  3ZLZ A;  3V60 A;  5AZG A;  5HKH A;  5DPW A;  1UZX B;  3VH4 B;  5D6J B;  1NBF C;  4KSK C;  2KAN A;  4NJ7 A;  4FUL A;  4GN1 A;  2JZZ A;  4FJZ A;  3RUI B;  4EUT A;  3A4R A;  3VDZ A;  4FLH A;  2G3Q B;  1C1Y B;  2C7H A;  2KLG A;  3QA8 A;  4PS8 A;  3Q3J A;  3TIX A;  2AL6 A;  2YVC A;  1WXA A;  4ANW A;  1YX5 B;  2N9E B;  3NOB A;  2ZPY A;  2FCN A;  5CHV C;  2OJR A;  4TUU A;  1WIA A;  4KVG B;  1C3T A;  2L7R A;  5FR6 A;  4ZYN A;  2K8H A;  4PYU A;  2M8S A;  2N7D A;  3X23 A;  5IAA C;  1F9J A;  4M0W B;  1WXM A;  4EOY A;  1WI0 A;  2KQ7 A;  2LJ5 A;  1YQB A;  4WJO A;  4DK5 A;  2JT4 B;  4W9H A;  1V49 A;  2GMI C;  4IWP A;  4GU2 A;  4BKS D;  4AP4 C;  1P9D U;  1OQY A;  3RT3 B;  4DHZ B;  2KNB A;  1UH6 A;  3PGE A;  2WX1 A;  3NY5 A;  2LXC A;  4ZRI A;  2KN5 A;  2DAJ A;  2L76 A;  4JGH B;  4W9E A;  4KIK A;  5JH5 C;  2NS5 A;  3A4S C;  3W1S C;  1NI2 A;  4ZRK A;  1AAR A;  1V6E A;  2L0T A;  2KMA A;  3L0W B;  1P98 A;  1WM3 A;  2BKR B;  4JQW C;  2MBE A;  4ICU A;  2O6V B;  1LXD A;  2D11 A;  2RD0 A;  5DPT A;  4HLE A;  1Q0W B;  2D3G A;  4MGZ E;  4EEW A;  1ZKH A;  2DYB A;  2FAZ A;  4IC7 B;  4MH0 E;  4G3X B;  1VD2 A;  3OAW A;  4FJV B;  4NPN A;  1WRD B;  1WXV A;  2LZ6 A;  3M63 B;  2O2V A;  3A9J A;  2FUH B;  3HM6 X;  4G11 A;  2MP2 B;  1E8X A;  2Z0E B;  5AZH A;  4HDQ A;  4NQK E;  3RD2 A;  3VTW A;  5E6O A;  3V62 A;  1UBQ A;  2D2Q A;  5LXH A;  1J0G A;  4LDT B;  4KZ0 A;  2I1J A;  5CX3 A;  3VTU A;  3AXC A;  1RAX A;  2ZNV B;  2KWC A;  3M62 B;  4PYZ A;  2LGX A;  1YX6 B;  4HPM B;  3V61 A;  3H7P A;  4WJQ A;  2KWU B;  2ZJD A;  2MLB A;  4MSM B;  3R66 C;  3OLM D;  4DDG D;  2L05 A;  1WX9 A;  1OTR B;  1EF5 A;  3DQV A;  2XK5 B;  4JL9 A;  2K39 A;  3APD A;  1TTN A;  2Y5B B;  1V5O A;  2AYO B;  3DVN V;  4IM0 A;  4W9J A;  3QAR A;  2BWE S;  1OGW A;  4X57 B;  4AJW A;  4I6N B;  4WWN A;  4BVU C;  2R2Q A;  4GGQ A;  2ZNV C;  3A9K B;  2KOX A;  3UIP B;  3PPA A;  1E7U A;  3KUD B;  2L00 B;  4G0N B;  4HJK A;  2V3S A;  3CSF A;  2KD0 A;  1CMX B;  3L13 A;  3EEC A;  1WFY A;  5E6N A;  2JRH A;  3L10 B;  2IYD B;  4AJY B;  4W9G A;  5LXI B;  3DBS A;  3ECI A;  1KLV A;  5DPS A;  2J7Q B;  3PLU A;  3PV1 A;  4NQL B;  5EDS A;  1MG8 A;  4MEL A;  5J18 A;  3M3J A;  2R2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...