1XLPA

Structure of oxidized c73s putidaredoxin from pseudomonas putida
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-dependent structural reorganization in putidaredoxin, a vertebrate-type [2Fe-2S] ferredoxin from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Putidaredoxin
total genus 31
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature ec 1.9.3.2: Transferred entry: 1.7.2.1.
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xlpA00
1RYJA 2WU2B 3LB8C 4YSXB 2K9XA 1AYFA 2G1EA 1J7BA 2BT6A 1I7HA 1DOYA 1QF6A 2WDVB 1V97A 3P4RB 2PVGC 4HRSA 3W5VB 1DOXA 3FC4A 2CJNA 3DWMA 3HUIA 3NVYA 1JALA 1L6UA 1YJIA 2BS3B 2CU3A 4YTPB 3VR8B 1TJEA 2M56B 1JWAD 1FIQA 3AEAB 3EUB2 1AWDA 4LTUA 3PO0A 4USAA 1R7SA 4US8A 1DGJA 3NVVA 1QOAA 3AE8B 2L83A 2DBYA 5EE1A 3HRDD 1TKEA 3L4PA 4P6VF 1XO3A 1QOFA 1FRDA 2Q5WD 2LEKA 1FXAA 1J7AA 1VJKA 1N5WA 5G5HA 4N58A 3AE9B 1GAQB 1CJEA 3W5UB 1JRPA 3W9CB 4ZHOA 3NVZA 1VLBA 4C80A 1SIJA 1KFYB 1OFFA 3DWGC 3AH7A 3P4QB 4IDIA 2JX5A 3B2FA 3AM9A 5EE3A 3VRBB 2FBWB 3VR9B 2B76B 1E6EB 1N63A 5C2TB 1N5XA 2JQRB 1NENB 1QLBB 3AN1A 3ETRA 4YXDB 1N60A 2WP9B 2WDQB 5GXGB 2W54A 3AE3B 1TKGA 1L0VB 1A70A 2OHFA 4YT0B 1EWYC 1E7PB 3VRAB 1E0ZA 3P1MA 1PDXA 1RM6C 3CIRB 2WU5B 3BIID 5AUIA 1UWMA 1XLNA 1YQ4B 2E3TA 2MJ3A 4YTNB 2W3RA 1FMAD 2PIAA 3AEBB 3B9JA 3SFDB 2K22A 4FXCA 3AEFB 1NYQA 5H92C 2KAJA 2M19A 2H89B 1SB3C 1NVID 4JWUC 1NYRA 3ABVB 2AX5A 1FFUA 2PVOD 3FAHA 4N59A 2QJLA 3SFEB 1OQQA 2WLBA 4YSZB 1VDVA 2KMMA 3AE4B 1J7CA 1PFDA 4ZHPA 1NI3A 1TKYA 1JWBD 1NEKB 3HVZA 1WWTA 3LXFA 3P63A 2Y5CA 1FM0D 2MJDA 1E10A 4US9A 4JX1C 1L5PA 3AV8A 4YTMB 1F0ZA 1DOIA 3P4SB 2HTME 1KF6B 1FXIA 1L6VA 2PKOA 5EE9A 4HROA 1ZUD2 2EKIA 2N0SB 3CWIA 1GPXA 1N62A 1ZP0B 2BS4B 1ROEA 1T3QA 1WGKA 1JROA 1XLPA 3AE7B 4C7YA 2WDRB 1E9MA 4ZOHC 1KRHA 2W55A 1QOGA 2L52A 3NRZA 3ZYYX 1SF0A 1V8CA 4YSYB 2H88B 2MH7A 1WXQA 3NS1A 3RPFC 5G5GA 1QOBA 2DWQA 1YQ3B 3P4PB 1TYGB 1FO4A 4WWMA 3AEGB 2CJOA 4JWSC 1FFVA 4KX6B 1WYGA 1QT9A 1ZXIA 3KWLA 3B2GA 2QIEB 1RFKA 1RWSA 3AE1B 1PUTA 1B9RA 1ZOYB 3AEDB 1YJJA 1N61A 5H8YE 3SR6A 3NVWA 1CZPA 1XLOA 1JQ4A 3AECB 5C3JB 2ACZB 2BS2B 1XLQA 3WCQA 5MPOA 4N6EB 2MJEA 2WS3B 1OQRA 1FRRA 3AE5B 4C7ZA 5AUKA 3AEEB 3AMZA 1JW9D 1WRIA 3AB5A 1IUEA 2WQYB 2W3SA 4WQMA 4A9AA 3AE6B 4ITKA 5EE0A 2K5PA 3AE2B
chains in the Genus database with same CATH superfamily
2KN4A 1XD3B 4A20A 3B0AA 5DPWA 3DVNU 3A4RA 3ZJTA 2WDTB 1L6UA 3VR8B 1WX9A 2GBJA 3T8MA 4L23A 4WJNA 3PZ8A 4A3PA 3VXWA 3AE8B 2L83A 5GMVA 3AXCA 4HCPB 2RMMA 4GDKB 4ZHOA 2Y5PA 3W9CB 2BB5A 1KFYB 1OFFA 2IDYA 1N63A 4YXDB 4E74A 4LDTD 4OVUA 3VUYA 2WXRA 1A70A 2OHFA 2KZRA 3MP9A 1E8XA 3DBLI 1WH3A 1LGRA 5H92C 4NPNA 3W2DA 3E56A 3N9YC 3OJ4B 4P1CC 1QILA 1TGZB 4HWIB 1HZ6A 3GB1A 5DPSA 4E71A 1V1PA 4AWJA 3CWIA 3PZ7A 3BY4B 2BS4B 3NG0A 3N3KB 1QOGA 4FULA 2KX0A 3ZYYX 5IAAC 2JZ3B 1R4MB 2KTFA 2GOWA 2FNJB 3IHPC 4RFBA 2C5LC 2AQ1B 1S3SG 5TSSA 2Y3AA 2LZ6A 2KQ7A 3J9CA 3B1LX 2WDVB 1V97A 4HCNB 4BKTA 3UIPB 2KKCA 4EEWA 3RFZB 1TS2A 1QQRA 1YJIA 4UDUC 2KQSA 1GOZA 2OJRA 2JSVX 2L1AA 4DDGD 2M17A 4P6VF 4PS7A 3DBSA 1J7AA 2L8JA 4J3OD 3KLSX 2B3AA 4I6NB 3WAPA 1F9JA 1WZ0A 2IYDB 4C80A 4JL9A 1T6BX 4RF0A 3VRBB 2MP2A 3A9KA 2MSED 3Q14C 2N9LA 3V62A 3I63C 4XYCA 3SDLC 3VRAB 1E0ZA 4WJOA 2MHJA 1EF1A 1YN3A 1ZGUB 4EZLA 2WXHA 2CKHB 1PQSA 4HK2A 3Q8FA 4RH6A 3KH0A 3KUCB 2HDEA 5J17A 1P7EA 4RM8A 2KQ4X 3AE4B 1V86A 2J0MA 2INNE 3HVZA 3P63A 3LXFA 1TBEA 3EHVA 4BVUC 2DNFA 1P0RA 1L6VA 4W9IA 3GZNI 2L0TA 1OEYJ 3ZVVA 3L54A 1SJED 2V3PA 2L0FA 2O6VB 3DVGY 1IBXA 1RAXA 2V3NA 2QCZA 1F52A 1YD8U 3U7DA 3RULA 1V9JA 3M95A 4MH0E 3VFKA 4R3DA 2ZJDA 4M01A 3H9DA 1FRRA 4KDIC 1UWXA 3KWVA 2CU1A 1QKZA 4BKGA 1EF5A 3DPDA 4C00A 1TS5A 3A4SC 1ZW7A 2NPTA 1EU4A 3L0WB 3N30A 4XWWA 3OLMD 3VDZA 4BZAA 1I4GA 2XK5B 4J6IA 4B9KA 3W5VB 3RNBC 2Z0EB 1WF9A 4RGTA 4A8XC 1L4ZB 4JPSA 2JYTA 2W82A 1CQVA 3NVVA 2G4SA 1M94A 1V5OA 1HXYD 3R8BA 2D2QA 3W5UB 3NVZA 3VH3B 2M0XA 3HHMA 3H8HA 4IM2A 3GS2A 2QDFA 3NZUA 5IKCM 2D3GA 2DENB 4KIKA 2IGHA 1GB1A 4YTNB 2K0PA 3OJ3A 1P9DU 2IGDA 2KANA 4WAAA 4K81A 1FCCC 1V6EA 4GGQA 2WLBA 2LUMA 4W9FA 3QC8B 2RR9A 3Q6BA 3IT6B 1V5TA 3MJWA 2PKOA 1R4NI 3P42A 4KZ0A 4C4VB 2DYBA 3NZ3A 3AE7B 2LGYA 2WDRB 2IY1B 3V60A 3NRZA 3C19A 4KGRA 5IP4D 1V8CA 1ESFA 1GG3A 2DWQA 2V4IB 3O65B 1YMHE 4MJSB 3ZQ4A 2KLGA 4RCOA 1FD6A 2KD0A 3JVZX 1YJJA 1N61A 1YNTE 3V61A 4GSWA 1WGGA 1CZPA 4ARCA 4KV2A 3HM6X 3R2TA 1D4BA 3QIJA 4KGSA 2MBBB 3M62B 4A9AA 1Z2MA 3APFA 3LB8C 4ZRKA 1WXSA 3QQ8B 5E6OA 1PGBA 1P1AA 2RSUA 2LJ5A 4LTUA 2REXA 2I1JA 1FEHA 2HJ8A 4DWFA 4II2B 3V05A 1VD2A 1ZE3D 3H7PB 4ARIA 3NS8A 1F77A 4L2YA 4IWQA 4NY0A 3A1QA 3BK1A 3PHXB 4CYEA 2K25A 2KTRA 3APCA 2HTHA 5IO9A 1ET9A 2IBIB 2G9HD 1C77A 3GOEA 3SU8X 2C7MB 1WJUA 2OEDA 4XE0A 2PIAA 1Q5WB 2FCSA 3SFDB 1UF0A 4BKSA 5E6NA 3S2AA 1L0XB 1NVID 2O2VA 2RGFA 2WXOA 2LVQA 2N9KA 2PVOD 3PRMB 2WXMA 2LHEA 2XN9C 2LJIA 5BMGA 2N7EA 2MCNB 3TBLD 2CHXA 2Z59B 3DQVA 4DXAB 4HEA1 1F0ZA 3P4SB 2D5GA 2SEBD 4TMAB 3UI3A 4HROA 4WWOA 3QARA 2LGDA 2R2QA 2KJHB 5IOIA 1XXGA 1ROEA 2KWVB 2VH2A 2MRPA 3ONSA 3A33B 3EC8A 1WSPA 2KFKA 1Y8RC 2C60A 3A1QB 1H8CA 4JWSC 1FFVA 2GI9A 4MT5A 1WYGA 3AE1B 4KSKC 2ASQA 1RLFA 4KDLB 2PJHA 2BKRB 3UQAA 2UWQA 2LD9A 3WCQA 1XLQA 2L00B 5AUKA 3AB5A 3ZRCA 2WQYB 2ZVNA 3TIXA 3U4EG 1WFYA 4EFOA 3WANA 1QF6A 2FCMA 3ZO5B 4BBNC 2QEJC 1DOXA 3K9PB 1JALA 1P7FA 3QK0A 1AWDA 3DHGC 3IAS1 1V1PB 4MSQB 1XO3A 4YWGG 1I4QA 1WXMA 3EFUA 1CJEA 2KFKB 4ZDVA 2ZPNA 2I1KA 4EZJA 2MA9B 2RPQA 4IDIA 3B2FA 3M63B 2IPKD 2LGXA 1T0SC 1N5XA 1A5RA 2RDHA 3TEXA 2KTRB 1SJHD 2W54A 2JZZA 5D94A 2N9PC 3MFGA 2D3CA 1E7PB 3U52E 3RT3B 3VUXA 4DXGA 4I6LB 3ZUNA 2J0JA 3AU5A 4URKA 3ENEA 2J7QB 2O2VB 3BYYB 4S17A 2M19A 3VH4B 3KQ4A 2FE8A 4I6PA 1U4AA 2AX5A 1CMXB 4ZHPA 4BOZB 2Y5CA 3VQIA 1EUVB 1IYFA 4M0WA 1F2RC 2NTTA 1WGKA 1LO5D 2WXIA 3RNAC 3U7ZA 1SF0A 1YJ1A 1D5MC 3P4PB 1GNUA 3H1UA 3V3XA 1WGRA 2X38A 2IO1B 3RN9C 2WX0A 2BW2A 3AECB 2ACZB 2WYQA 4KZCA 4N6EB 3VTWA 4C7ZA 1JW9D 2BKFA 3MC9A 2LXAA 1RFAA 2AQ3B 1ZDXA 1V81A 4MGKE 1DOYA 2WGSA 1T0YA 3P4RB 4EKUA 4HRSA 1R4MI 2FCQA 3PHWB 2XK5A 2CJNA 3DWMA 2BS3B 2CU3A 4YTPB 1N6ZA 2M56B 2N7DA 4LK0M 3AEAB 2JPHA 1IGCA 1MG8A 3PLUA 3PO0A 3Q8AA 4K1RB 3U8ZA 1KLUD 3Q8CA 1ENFA 2JYEA 4GXBA 4IWPA 4LJOB 2Q5WD 4L1BA 2IGGA 3I9V1 1TT5B 4N58A 3OG5A 1V1OA 1GJZA 5FR3A 2LWPA 3KYCD 1WJ6A 5GXGB 2CHZA 2MX2A 2QHOA 4WWPA 1RM6C 2WU5B 1H4RA 4P1BC 4ANWA 4B0EA 3BYTB 2BPSA 1L4DB 3HVDA 3X0WA 3ML8A 3A9JB 3B08A 4FJZA 2KX3A 4DDID 4HLEA 1HA5A 3AV8A 2KK8A 5EE9A 1Y56A 2MWSB 3JYUA 2EKIA 3RZFA 4REZA 1T3QA 1JROA 1SIFA 4C4VA 4WAFA 1C9FA 4B0MA 5AEKB 1LFDA 3AEGB 5DCNA 1OQYA 2DZJA 5BYRA 4PS8A 4W9CA 2WX1A 1JCKB 4RGMA 1V49A 3RNCC 2W3SA 5TR5A 1WR1A 3APDA 4LNFA 2UU7A 1AYFA 3WA0A 3T9LA 4RGNA 4LNIA 3O13A 2IY0B 2DZIA 5E6PA 2QSDA 3VUWA 3W1SA 1TJEA 4JIOU 4II3B 4NNJB 2M1MA 4PYZA 4ASWC 2LGIA 4IM3A 3MTNB 4XDDA 2DBYA 2J52A 3IAM1 3ZRFA 2ZVOA 2MBEA 5IN7A 2OOBB 1LQBA 4EUTA 1JWMD 1KLGD 4GOCA 3AE9B 3L10B 3H7PA 2K39A 2YEPF 1SIJA 2KHWB 3P4QB 4CQNA 1C3TA 2AYOB 5CHWA 4PT5A 1R4NB 1QLBB 1T0RC 2UYZB 2KNBA 1TKGA 1I4PA 1C4CA 2PTLA 3DBRB 2IO2B 1WY8A 3BIID 4W9HA 5D7GA 2W3RA 3LDZE 4A3OA 3AEBB 3B9JA 5KHOA 3GE3C 2LUEA 4W9KA 1Q1OA 3UIOB 4PK1A 2KACA 4ZYSA 1NI3A 2IO3B 4IWOA 3R2IA 2RDBC 4B6WA 1I4RA 5FKAC 1BT0A 1D3ZA 3UQBA 1PGXA 3R7RA 1GB4A 1TS3A 1E90A 1SE3A 1I4HA 3ZDMC 1E9MA 2Z8LA 2L52A 3VTUA 1SGHA 5J18A 1YQ3B 1HTOA 1FO4A 2PPHA 1UGMA 2PE6B 3U30A 1PGAA 2ZPYA 3VVWB 2LFIA 3U2SC 3EFCA 5H8YE 3SR6A 1MVKA 3NVWA 1XQQA 4W9EA 2KMCA 1P98A 2EMTA 2J53A 3DBHB 5AZGA 2KOXA 3R66C 2KWCA 5JZEB 1YN5A 5JHAA 3HK0A 2QILA 2DAFA 5EE0A 4US8A 3AE2B 1TS4A 3ZIMA 1C78A 2ZZPB 4GDLB 2JF5A 4ANUA 2PVGC 1NBFC 2N9XA 4D2KA 2ON8A 4W9JA 3H7SA 3X23A 2YEPB 3ZNHB 4WQOB 1DGJA 3M3JA 4ZRQA 1VRAB 1Q0WB 1MFWA 3IFWB 5JXVA 2O6VA 4XC2A 1S1QB 3QX1A 4MH8A 2KJRA 3AM9A 4IM0A 1T0QC 3ZKJC 4B95A 1NENB 1N60A 3DHHC 1OTRB 1J0GA 2V9HA 4MEMA 2C9WB 1KLVA 2GBMA 4ZRIA 4FJVB 4GMVA 1XCTL 3T3NA 3OWEB 3TL5A 3ECIA 5FK9C 2VRRB 4MDKE 1FFUA 4ZRPA 2V0GA 1OQQA 5LLIA 2NS5A 1NI2A 1JWBD 3PGEA 2RDGA 1E10A 2BB6A 5LXIB 3SEBA 3CSTA 1K50A 3ZTCA 1TY2A 1SSNA 3WAMA 3IXSA 4ZOHC 2L05A 2JUOA 4C56C 4ANXA 2Z0DB 2WXLA 1OGWA 2JZPA 1STEA 1QT9A 2QIEB 4Q2JA 2DHZA 1MPEA 2K6QA 3PS6A 4AS1A 2JY6A 1IGDA 3QJZA 1HE8A 3V6CB 3MHZA 3JSVB 2V4LA 2BT6A 2JWUA 1SE4A 2LHDA 2BWES 1YX6B 4GU2A 3ZJVA 2L7RA 2I2YA 1WR6E 3IT4B 3ZXVA 1EU3A 1FIQA 5D3DA 1WJNA 4ANVA 2WNMA 3OAWA 2J0KA 4NAWA 3RNEC 4ACFA 1XT9B 4MSMB 3L4PA 1QOFA 1FRDA 5HHDG 1YN4A 1GAQB 4OHJA 3Q3MC 4RF1A 2VZKD 2WWZA 4OZCA 5JH5C 4HJKA 4ZRJA 5C1ZA 1E5WA 4AP4C 2W9NA 4IUMB 2BBCA 1FNUA 3P2BA 4W9DA 4ICUA 1UNSA 1UH6A 3JSVA 2FCNA 1FNWA 3DDCB 3PRZA 3URYA 2NPTB 2L32A 1PFDA 1VZ6A 3EGRA 2RPVA 3L13A 2BGFA 2XBBC 2K6DB 1FM0D 2MJDA 3SD5A 4YTMB 1TZ1A 2NVUI 1WGYA 2BYVE 3TEZA 1HTQA 4NJCA 1ZP0B 4IW0A 4TV3A 2WXPA 1KRHA 2ZW0A 4WWMA 4MJSA 4LJPB 1I35A 4TQ0A 1ZOYB 3AEDB 1XLOA 2A4ZA 1WM2A 4MGZE 1D6EC 1JQ4A 1C4PA 2BS2B 1FNVA 4K7SA 5BMIA 1MHHE 3GE8C 4ICVA 4FBJB 4GN1A 5JHBA 2K5PA 4YSXB 1K8RB 1J7BA 1I7HA 2MBHA 2BF8B 2D3AA 2L76A 4FA6A 3ZXRA 5BYQA 3PLVA 4O1NA 2JRHA 2D11A 1WE6A 2D07B 2KWDA 1R7SA 1GC7A 3NUHB 5E6JA 2LEKA 4M0WB 1FXAA 3CMMB 1WGHA 4A55A 1JRPA 2GMIC 3VTVA 2LI5A 2L3ZA 2JX5A 1MI0A 4HDOA 2PMVA 3GP7A 3ETRA 2AL6A 2WP9B 1ZXHA 3BZDB 1C79A 1L0VB 1XEEA 3UINB 3CIRB 4KSLC 3QWZB 4P16A 4FXCA 3N20C 3Q3OC 1YX5B 2H89B 1WMHA 4IC7B 3RNFC 4GDLA 3FAHA 4HJGE 3W1YA 5G55A 3Q8BA 1VDVA 2KMMA 1J7CA 2K8HA 4DK5A 1NEKB 2YVCA 3ZNGC 4G0NB 1Q10A 4MM3B 4A90A 5J2RA 3ZW3A 1WM3A 3FKYA 4EZKA 4BAXA 2TSSA 2DZKA 2MH7A 2KDBA 1WYWB 1ZDVA 1IBXB 1X1MA 2JXTA 1TTNA 3FILA 2CJOA 3N32A 2JVCA 1PUTA 1P3QU 4KVGB 2AWTA 4OZBA 2R61A 2YLMA 4KIKB 2INPE 2MBOA 3AMZA 4MGIE 2K8CA 2KJ6A 3ML9A 1EM7A 3AE6B 1RYJA 3D32A 3ALBA 2QC8A 3TJPA 3DBHI 2GBKA 2WXFA 3NY5A 4W9GA 2K8BA 1MG4A 2BVCA 4TUUA 2WXNA 4TQ1A 2LGSA 2ICIA 3TSSA 1VJKA 4FLHA 5CHVC 3Q8EA 3HM3A 1D5ZC 2M4NA 3FILB 4M8NA 2FBWB 4GIVA 3HIZA 2B76B 2RD0A 1M4VA 2JU6X 5D3IB 4XGAB 2WDQB 1TIFA 2KDIA 3PZDA 1SE2A 5CHFA 2NTSA 2I38A 3VHTC 2KMAA 5BYSA 1UWMA 2M8SA 4OW0A 3BK2A 3IBEA 4K3CA 2JRIB 2MW5A 5HKHA 4HKZE 1VZ7A 1LXDA 1NYRA 1V80A 3ABVB 4XWTA 2QJLA 4WURA 2LRWA 2K3UA 1WWTA 4RMAA 3WALA 3DVNV 1L5PA 4NJ6A 1UBQA 3L08A 4RM9A 1WE7A 2N0SB 1T5XD 3IVFA 3LJ3A 3VAWA 2IZVB 1ACCA 2HE7A 1K53A 2FUG1 2NCNA 4LDTB 5C23A 4PYUA 2H88B 3ZNZB 1WXQA 2GB1A 1SXTA 2KC2A 5LNK1 2OJWA 1L7YA 3CSFA 1B9RA 3IG3A 4JGHB 2ONQA 1UZXB 1YQBA 4HPLB 1AARA 2WS3B 2SAKA 3QAQA 4M00A 2DYMA 3TUOA 5DPRA 4LNOA 3PRPB 2V3SA 2G1EA 2N9EB 1K51A 2ZNVB 3TCAA 3ZLZA 4LCDE 2DLBA 3PT2B 4JLCA 2KVRA 3AI5A 1JWAD 4W9LA 2VH1A 3RMKC 3Q3NC 2G45B 2GRIA 4MGYE 1TKEA 4G3XB 3EECA 4FN2A 3BVGA 2AL3A 5AZFA 1F1HA 2DYOA 2INCC 2KLCA 2JQRB 2O6VD 1D5XC 1CK1A 2KO3A 2N4FA 1E8WA 3T3OA 5AUIA 4OVVA 2XEWA 3L16A 2K22A 2WXGA 3GZNB 4HPPA 1F2RI 3KUZA 1WXAA 4RGOS 1WX8A 4AJWA 2LMCA 1IPGA 2KDEB 1BUIC 1ET6A 1B1ZA 1KF6B 2ZNVC 4DHJD 3BVMA 5DPTA 4C7YA 1WI0A 1I42A 2BYEA 3MC0B 2V1YA 2AEHA 4IOIE 4CO7A 4FHKA 4GB9A 4DHZE 1TYGB 1GC6A 3B2GA 2WXQA 1YIWA 2PW9A 3Q2AC 3AE5B 1K52A 3AEEB 3DBRI 4WQMA 3KW5B 1AW7A 4NAMA 1L2NA 3WAOA 4A6QA 3RCZA 1V2YA 2FAZA 1VZ8A 2KN5A 4AQ7A 1KOTA 3UF8A 3EA6A 3ZDTA 4WIPA 1WJ4A 1WXVA 5KHQA 4F1SA 4NAWB 1N5WA 2PE9A 1VLBA 5IA7A 3ZTDA 2JXXA 3AULA 5EE3A 3VR9B 2INDC 3PTFC 3CF6E 5C2TB 2WXKA 3DVGX 4YT0B 3WIMA 5D6JB 3RYTA 2E3TA 2C7HA 1WX7A 1GUAB 5G2NA 1AN8A 3DHIC 5CTRC 1IP9A 2NR2A 2FIFA 4N59A 1FXTB 3SFEB 2QMTA 3KVFB 2R2OA 4K3BA 2MLBA 4US9A 4JX1C 2KYWA 3TEYA 1FXIA 3DBLB 1XLPA 4NQLB 3NS1A 3RPFC 2IJ0A 3JW0X 1VR9A 4LNNA 1ZXIA 2JWZA 2KT7A 3A9KB 2NBWB 1C76A 5MPOA 3KUDB 1WZ3A 2WHIA 2MJEA 2ZW1A 2FIDA 3I57A 1HEZE 4ITKA 5HI1A 4G50A 2K9XA 3TMPB 2NBVB 1SBBB 4WWNA 2EELA 1HZ5A 3EUB2 4USAA 3ZGZA 2PEAA 1QOAA 4N9F4 4DXFA 5EE1A 2IO0B 1KJTA 1DYQA 5HG2A 4WJQA 3V6EB 4RNAA 3RD2A 2KDFB 4XX5A 4TSSA 4KGTA 2MP2B 2BQQA 2CHWA 2KWUB 2KDMA 1EO6A 3L17A 3H6NA 2DZMA 4GLSC 3R3MA 3PREA 5I4DA 3PVLA 1XLNA 2A5UA 4AOFA 3N1ZC 2M0AA 3BVZA 2ZCBA 2KAJA 3Q3JA 1MHXA 4JWUC 1MJDA 2MQJA 4XDCA 4NZLB 3KYDD 1TKYA 1LM8B 4BKSD 2N7JA 4M8MA 1KTKA 4KKIA 2LVOA 4FHJA 5CX3A 2BYFA 3MC8A 4GDKA 4LNKA 4HPMB 1SEBD 2W55A 2ZEQA 4OZAA 1UD7A 2GBRA 4KX6B 3KWLA 5C3JB 1J8CA 3QCAA 5HFYA 4BBNF 1IUEA 2X8XX 1XF5L 1WRDB 2E6XA 4QAYA 4DHZB 2BWFA 1PYWD 1UBIA 3FC4A 4AUQC 3NVYA 5L95C 4HDQA 1HQRD 4K7WA 3DCGA 3DOWA 2VZKB 3HRDD 3C8YA 2NMQA 3MHSD 1NDDA 5FR6A 1XCQL 5G5HA 1JRUA 1TZOA 3K9OB 4S0RA 2J4XA 4LLGM 4AJYB 1E6EB 2LXCA 1E8YA 4MELA 2N1WA 3AE3B 3R7QA 5AZHA 1EWYC 1SE9A 3P1MA 1BMLC 1EWCA 1YQ4B 2MJ3A 1Z5SB 2KXJA 1FMAD 4NQKE 3AEFB 4BOSC 1WMHB 1SB3C 1L0YB 1FCLA 4FJYA 4IKGA 2K1FA 2J42A 5EDSA 4F7ZA 1WGDA 3QA8A 4IG7B 2XNAC 1UUPA 1ZUD2 4JE3B 3TEWA 1N62A 2FUHB 1ISNA 3N1XC 4M02A 1KH0A 3NZSA 2CR5A 4CHKA 4JQWC 3C0RB 1QZEA 1ZKHA 5G5GA 1QOBA 5BMHA 4G11A 4FADA 3BINA 1UELA 4TKNA 2C7NB 3UGBB 4E3CA 1C1YB 3PV1A 2EMSA 4DBGA 1JWSD 1I4XA 3PSEB 1OQRA 3PPAA 2N1VA 2HD5B 4XZ4A 3ZNID 3RI7C 1YOVB 3AU4A 3BWUD 2WU2B 2NBUA 1JWUD 2CS4A 4DHJB 3QHTA 3A9JA 3LYYA 1KM7A 1G6JA 4WH4A 4MM3A 3HUIA 5T8IA 4DQOC 3RNGC 4KKJA 2PLPA 4P7IA 2GLSA 2GBNA 2WXJA 1FPYA 3I5JC 1OEYA 3NHEB 1E7VA 4F8CB 3DWGC 1TY0A 2D10A 2LRUA 3AH7A 4OVZA 3NOBA 4YL8A 3AN1A 4NJ7A 2BYTA 4ZYNA 2BTEA 3MJ5A 4BFRA 1BXTA 3N1YC 1JMLA 1PDXA 4H2AA 2LASA 2Y5BB 1NYQA 2MEKA 1E8ZA 4EE2A 2DX5B 2G4DB 4YSZB 3SHQA 1E7UA 3I3TB 2G3QB 3Q3FA 2LVPA 3E9SA 2DAJA 2HJ1A 5L83A 1DOIA 2HTME 3RZWC 4HVBA 3NJTA 1WIAA 1GPXA 4EOYA 1RRBA 1VCBA 4K7UA 1UGJA 2ZCCA 4YSYB 5LXHA 2D3BA 2JT4B 3ZJUA 4MACA 1J19A 2KFJA 3RUIB 2EKEC 1RFKA 1RWSA 1C4AA 2AQ2B 1ZPSA 5BO4B 3W1SC 2KC1A 2MBQA 4HKQA 2KVZA 3Q69A 4PS3A 4X57B 1WRIA 4WJPA 4HXDA 5D2MB
chains in the Genus database with same CATH topology
2KN4A 4NAMA 2BT6A 2JWUA 1SE4A 2LHDA 1QF6A 4A6QA 3ZJTA 1VZ8A 2QEJC 4AQ7A 3ZJVA 1DOXA 2I2YA 1JALA 1L6UA 3IT4B 3VR8B 1EU3A 1P7FA 1FIQA 5D3DA 3EA6A 1AWDA 4L23A 3PZ8A 4WIPA 2WNMA 3AE8B 2L83A 3IAS1 1V1PB 3L4PA 1XO3A 1QOFA 2RMMA 1FRDA 4NAWB 4YWGG 4GDKB 5HHDG 1I4QA 1YN4A 1N5WA 1GAQB 1CJEA 2Y5PA 3W9CB 2BB5A 4ZHOA 4OHJA 1VLBA 4RF1A 1KFYB 1OFFA 4IDIA 2IDYA 3B2FA 2VZKD 5EE3A 4OZCA 3VR9B 2IPKD 1N63A 5C2TB 1N5XA 4YXDB 2RDHA 3TEXA 1SJHD 2WXKA 2W54A 2BBCA 2WXRA 1A70A 3MFGA 2OHFA 4YT0B 1E7PB 1FNUA 3U52E 4DXGA 3MP9A 2E3TA 1UNSA 1AN8A 5H92C 3BYYB 2M19A 3KQ4A 1FNWA 2FE8A 2AX5A 4N59A 3URYA 3SFEB 2QMTA 3W2DA 3E56A 2L32A 3N9YC 1PFDA 1VZ6A 3EGRA 2RPVA 4ZHPA 1QILA 2Y5CA 1FM0D 2MJDA 4US9A 4JX1C 3VQIA 4YTMB 1HZ6A 3GB1A 3TEYA 1FXIA 1V1PA 3TEZA 3CWIA 3PZ7A 4NJCA 4M0WA 1F2RC 1ZP0B 2NTTA 2BS4B 1WGKA 1XLPA 2WXPA 1LO5D 2WXIA 1KRHA 1QOGA 3ZYYX 3U7ZA 1SF0A 2ZW0A 3NS1A 3RPFC 1D5MC 2IJ0A 3P4PB 4WWMA 3V3XA 1VR9A 2X38A 1ZXIA 4TQ0A 1ZOYB 3AEDB 2BW2A 1XLOA 1JQ4A 1C76A 1D6EC 3AECB 4RFBA 1C4PA 2ACZB 2BS2B 5MPOA 2AQ1B 4N6EB 2MJEA 2ZW1A 1FNVA 5BMIA 4C7ZA 1MHHE 1JW9D 5TSSA 3I57A 2Y3AA 2AQ3B 1HEZE 4ITKA 2K5PA 5HI1A 4YSXB 1ZDXA 2K9XA 1DOYA 1J7BA 1I7HA 3J9CA 2WDVB 1V97A 3P4RB 4HRSA 1SBBB 5BYQA 2CJNA 3DWMA 3RFZB 1TS2A 1QQRA 1YJIA 2BS3B 2CU3A 2EELA 1GOZA 4O1NA 4UDUC 2M56B 4LK0M 1HZ5A 3AEAB 1IGCA 3EUB2 2KWDA 4USAA 3PO0A 3Q8AA 2JSVX 1R7SA 3ZGZA 1KLUD 3NUHB 1QOAA 5E6JA 2L1AA 3Q8CA 4DXFA 5EE1A 1ENFA 2JYEA 4P6VF 1DYQA 2Q5WD 4L1BA 2IGGA 2LEKA 1FXAA 3I9V1 5HG2A 1J7AA 4J3OD 4A55A 3KLSX 4RNAA 4N58A 1JRPA 4C80A 1T6BX 4RF0A 4TSSA 4KGTA 2JX5A 3VRBB 1MI0A 1V1OA 2KDMA 5FR3A 2PMVA 3GP7A 3ETRA 2N9LA 2WP9B 1ZXHA 5GXGB 3BZDB 1C79A 1L0VB 4GLSC 1XEEA 1E0ZA 3VRAB 5I4DA 1RM6C 3CIRB 2WU5B 1XLNA 1YN3A 2M0AA 4P16A 4B0EA 4FXCA 3BYTB 2WXHA 3BVZA 2KAJA 1L4DB 2H89B 3HVDA 3Q8FA 4RH6A 1MHXA 4JWUC 4HJGE 3FAHA 4XDCA 2HDEA 3Q8BA 4NZLB 1P7EA 1VDVA 2KMMA 2KQ4X 1J7CA 3AE4B 1TKYA 1NEKB 2INNE 3HVZA 3P63A 3LXFA 1Q10A 2N7JA 1KTKA 4KKIA 4MM3B 1HA5A 4A90A 3AV8A 1L6VA 1Y56A 5EE9A 2EKIA 4REZA 1SJED 2V3PA 1SEBD 2TSSA 1T3QA 1JROA 2W55A 4WAFA 1C9FA 4B0MA 1IBXA 2MH7A 2V3NA 1ZDVA 4OZAA 1IBXB 2JXTA 3AEGB 3FILA 2CJOA 4KX6B 3KWLA 1PUTA 5BYRA 4R3DA 5C3JB 4OZBA 5HFYA 2R61A 1FRRA 2INPE 1JCKB 3AMZA 4RGMA 1IUEA 1UWXA 3KWVA 2W3SA 1QKZA 1EM7A 3AE6B 1XF5L 1RYJA 1TS5A 2E6XA 1AYFA 1EU4A 4XWWA 1PYWD 2WXFA 1I4GA 3W5VB 3FC4A 4RGNA 3O13A 3NVYA 4RGTA 4A8XC 2QSDA 1L4ZB 3W1SA 4JPSA 1TJEA 1HQRD 2JYTA 2W82A 1CQVA 2LGIA 3NVVA 2WXNA 4XDDA 2DBYA 2J52A 2VZKB 3IAM1 3HRDD 4TQ1A 3C8YA 2ICIA 2NMQA 3TSSA 1HXYD 1XCQL 1VJKA 3R8BA 1JWMD 1KLGD 1TZOA 3AE9B 5G5HA 3W5UB 3NVZA 3Q8EA 2YEPF 1SIJA 1D5ZC 3FILB 3P4QB 4CQNA 2J4XA 4LLGM 2FBWB 2B76B 1E6EB 1M4VA 4PT5A 2JU6X 5D3IB 1QLBB 3H8HA 3GS2A 2WDQB 3AE3B 1SE2A 1TKGA 1I4PA 2NTSA 1C4CA 2I38A 1EWYC 2PTLA 5BYSA 3P1MA 2IGHA 1BMLC 1GB1A 3BIID 1EWCA 1UWMA 1YQ4B 5D7GA 2MJ3A 4OW0A 4YTNB 3BK2A 2W3RA 1FMAD 2K0PA 3AEBB 3B9JA 3AEFB 2IGDA 4HKZE 1VZ7A 1SB3C 1L0YB 1NYRA 3ABVB 1FCLA 1FCCC 4IKGA 2QJLA 4XWTA 2WLBA 4WURA 2LUMA 2KACA 4ZYSA 1NI3A 2J42A 3R2IA 2K3UA 1WWTA 1I4RA 1L5PA 5FKAC 3IT6B 2XNAC 1PGXA 2PKOA 1UUPA 3P42A 1GB4A 1TS3A 1ZUD2 2N0SB 4JE3B 3TEWA 1SE3A 1N62A 1T5XD 1ACCA 3NZ3A 3AE7B 1I4HA 2WDRB 1E9MA 1K53A 2Z8LA 2FUG1 3NRZA 1KH0A 2L52A 4KGRA 1V8CA 2H88B 1ESFA 1WXQA 2GB1A 1SXTA 5G5GA 1QOBA 2DWQA 1YQ3B 2V4IB 5BMHA 5LNK1 1FO4A 1YMHE 1PGAA 3ZQ4A 4RCOA 1FD6A 2LFIA 3U2SC 1B9RA 1YJJA 1N61A 1YNTE 5H8YE 3SR6A 1MVKA 2ONQA 3NVWA 1CZPA 4ARCA 1JWSD 1I4XA 2J53A 2WS3B 1OQRA 3R2TA 1D4BA 2SAKA 2DYMA 1YN5A 4KGSA 3TUOA 2QILA 4A9AA 4US8A 5EE0A 3AE2B 1TS4A 3BWUD 2WU2B 1C78A 3LB8C 1JWUD 4GDLB 2G1EA 1K51A 3LYYA 2PVGC 4WH4A 2DLBA 3HUIA 1PGBA 4D2KA 2ON8A 1JWAD 5T8IA 4DQOC 4LTUA 2YEPB 1FEHA 1DGJA 4KKJA 2PLPA 3V05A 2GRIA 1TKEA 4ZRQA 1VRAB 2WXJA 1ZE3D 5JXVA 4ARIA 3BVGA 3DWGC 1F77A 1TY0A 2DYOA 3AH7A 4MH8A 3AM9A 4L2YA 4OVZA 2JQRB 1D5XC 1NENB 3AN1A 3BK1A 1N60A 2BYTA 2BTEA 1CK1A 3MJ5A 1BXTA 1ET9A 1JMLA 3T3OA 2G9HD 5AUIA 1PDXA 4H2AA 1C77A 2OEDA 4XE0A 2PIAA 1XCTL 3SFDB 3T3NA 2K22A 3OWEB 2WXGA 1F2RI 1NYQA 2MEKA 1L0XB 1NVID 4RGOS 2WXOA 5FK9C 4EE2A 2N9KA 1FFUA 2PVOD 4ZRPA 2V0GA 1OQQA 2LMCA 4YSZB 2WXMA 2LHEA 2XN9C 2LJIA 1BUIC 1JWBD 5BMGA 1ET6A 1B1ZA 2RDGA 1E10A 2BB6A 3E9SA 4HEA1 1F0ZA 1DOIA 2D5GA 2HTME 1KF6B 2SEBD 3P4SB 4TMAB 3UI3A 4HROA 3BVMA 1GPXA 3SEBA 1K50A 4YTPB 1XXGA 1ROEA 1TY2A 4C7YA 1SSNA 3IXSA 3MC0B 4ZOHC 4IOIE 1UGJA 1WSPA 4C56C 4YSYB 2WXLA 1TYGB 3ZJUA 4JWSC 1FFVA 2JZPA 2GI9A 4MACA 1WYGA 4MT5A 1STEA 1QT9A 3B2GA 2QIEB 1RFKA 1RWSA 4Q2JA 1C4AA 3AE1B 1MPEA 1ZPSA 2AQ2B 2WXQA 4AS1A 1IGDA 3WCQA 1XLQA 2PW9A 4HKQA 3AE5B 3Q69A 5AUKA 1K52A 3AEEB 1WRIA 3AB5A 2WQYB 3MHZA 4WQMA 3U4EG 1AW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYJ A;  2WU2 B;  3LB8 C;  4YSX B;  2K9X A;  1AYF A;  2G1E A;  1J7B A;  2BT6 A;  1I7H A;  1DOY A;  1QF6 A;  2WDV B;  1V97 A;  3P4R B;  2PVG C;  4HRS A;  3W5V B;  1DOX A;  3FC4 A;  2CJN A;  3DWM A;  3HUI A;  3NVY A;  1JAL A;  1L6U A;  1YJI A;  2BS3 B;  2CU3 A;  4YTP B;  3VR8 B;  1TJE A;  2M56 B;  1JWA D;  1FIQ A;  3AEA B;  3EUB 2;  1AWD A;  4LTU A;  3PO0 A;  4USA A;  1R7S A;  4US8 A;  1DGJ A;  3NVV A;  1QOA A;  3AE8 B;  2L83 A;  2DBY A;  5EE1 A;  3HRD D;  1TKE A;  3L4P A;  4P6V F;  1XO3 A;  1QOF A;  1FRD A;  2Q5W D;  2LEK A;  1FXA A;  1J7A A;  1VJK A;  1N5W A;  5G5H A;  4N58 A;  3AE9 B;  1GAQ B;  1CJE A;  3W5U B;  1JRP A;  3W9C B;  4ZHO A;  3NVZ A;  1VLB A;  4C80 A;  1SIJ A;  1KFY B;  1OFF A;  3DWG C;  3AH7 A;  3P4Q B;  4IDI A;  2JX5 A;  3B2F A;  3AM9 A;  5EE3 A;  3VRB B;  2FBW B;  3VR9 B;  2B76 B;  1E6E B;  1N63 A;  5C2T B;  1N5X A;  2JQR B;  1NEN B;  1QLB B;  3AN1 A;  3ETR A;  4YXD B;  1N60 A;  2WP9 B;  2WDQ B;  5GXG B;  2W54 A;  3AE3 B;  1TKG A;  1L0V B;  1A70 A;  2OHF A;  4YT0 B;  1EWY C;  1E7P B;  3VRA B;  1E0Z A;  3P1M A;  1PDX A;  1RM6 C;  3CIR B;  2WU5 B;  3BII D;  5AUI A;  1UWM A;  1XLN A;  1YQ4 B;  2E3T A;  2MJ3 A;  4YTN B;  2W3R A;  1FMA D;  2PIA A;  3AEB B;  3B9J A;  3SFD B;  2K22 A;  4FXC A;  3AEF B;  1NYQ A;  5H92 C;  2KAJ A;  2M19 A;  2H89 B;  1SB3 C;  1NVI D;  4JWU C;  1NYR A;  3ABV B;  2AX5 A;  1FFU A;  2PVO D;  3FAH A;  4N59 A;  2QJL A;  3SFE B;  1OQQ A;  2WLB A;  4YSZ B;  1VDV A;  2KMM A;  3AE4 B;  1J7C A;  1PFD A;  4ZHP A;  1NI3 A;  1TKY A;  1JWB D;  1NEK B;  3HVZ A;  1WWT A;  3LXF A;  3P63 A;  2Y5C A;  1FM0 D;  2MJD A;  1E10 A;  4US9 A;  4JX1 C;  1L5P A;  3AV8 A;  4YTM B;  1F0Z A;  1DOI A;  3P4S B;  2HTM E;  1KF6 B;  1FXI A;  1L6V A;  2PKO A;  5EE9 A;  4HRO A;  1ZUD 2;  2EKI A;  2N0S B;  3CWI A;  1GPX A;  1N62 A;  1ZP0 B;  2BS4 B;  1ROE A;  1T3Q A;  1WGK A;  1JRO A;  1XLP A;  3AE7 B;  4C7Y A;  2WDR B;  1E9M A;  4ZOH C;  1KRH A;  2W55 A;  1QOG A;  2L52 A;  3NRZ A;  3ZYY X;  1SF0 A;  1V8C A;  4YSY B;  2H88 B;  2MH7 A;  1WXQ A;  3NS1 A;  3RPF C;  5G5G A;  1QOB A;  2DWQ A;  1YQ3 B;  3P4P B;  1TYG B;  1FO4 A;  4WWM A;  3AEG B;  2CJO A;  4JWS C;  1FFV A;  4KX6 B;  1WYG A;  1QT9 A;  1ZXI A;  3KWL A;  3B2G A;  2QIE B;  1RFK A;  1RWS A;  3AE1 B;  1PUT A;  1B9R A;  1ZOY B;  3AED B;  1YJJ A;  1N61 A;  5H8Y E;  3SR6 A;  3NVW A;  1CZP A;  1XLO A;  1JQ4 A;  3AEC B;  5C3J B;  2ACZ B;  2BS2 B;  1XLQ A;  3WCQ A;  5MPO A;  4N6E B;  2MJE A;  2WS3 B;  1OQR A;  1FRR A;  3AE5 B;  4C7Z A;  5AUK A;  3AEE B;  3AMZ A;  1JW9 D;  1WRI A;  3AB5 A;  1IUE A;  2WQY B;  2W3S A;  4WQM A;  4A9A A;  3AE6 B;  4ITK A;  5EE0 A;  2K5P A;  3AE2 B; 
#chains in the Genus database with same CATH topology
 2KN4 A;  1XD3 B;  4A20 A;  3B0A A;  5DPW A;  3DVN U;  3A4R A;  3ZJT A;  2WDT B;  1L6U A;  3VR8 B;  1WX9 A;  2GBJ A;  3T8M A;  4L23 A;  4WJN A;  3PZ8 A;  4A3P A;  3VXW A;  3AE8 B;  2L83 A;  5GMV A;  3AXC A;  4HCP B;  2RMM A;  4GDK B;  4ZHO A;  2Y5P A;  3W9C B;  2BB5 A;  1KFY B;  1OFF A;  2IDY A;  1N63 A;  4YXD B;  4E74 A;  4LDT D;  4OVU A;  3VUY A;  2WXR A;  1A70 A;  2OHF A;  2KZR A;  3MP9 A;  1E8X A;  3DBL I;  1WH3 A;  1LGR A;  5H92 C;  4NPN A;  3W2D A;  3E56 A;  3N9Y C;  3OJ4 B;  4P1C C;  1QIL A;  1TGZ B;  4HWI B;  1HZ6 A;  3GB1 A;  5DPS A;  4E71 A;  1V1P A;  4AWJ A;  3CWI A;  3PZ7 A;  3BY4 B;  2BS4 B;  3NG0 A;  3N3K B;  1QOG A;  4FUL A;  2KX0 A;  3ZYY X;  5IAA C;  2JZ3 B;  1R4M B;  2KTF A;  2GOW A;  2FNJ B;  3IHP C;  4RFB A;  2C5L C;  2AQ1 B;  1S3S G;  5TSS A;  2Y3A A;  2LZ6 A;  2KQ7 A;  3J9C A;  3B1L X;  2WDV B;  1V97 A;  4HCN B;  4BKT A;  3UIP B;  2KKC A;  4EEW A;  3RFZ B;  1TS2 A;  1QQR A;  1YJI A;  4UDU C;  2KQS A;  1GOZ A;  2OJR A;  2JSV X;  2L1A A;  4DDG D;  2M17 A;  4P6V F;  4PS7 A;  3DBS A;  1J7A A;  2L8J A;  4J3O D;  3KLS X;  2B3A A;  4I6N B;  3WAP A;  1F9J A;  1WZ0 A;  2IYD B;  4C80 A;  4JL9 A;  1T6B X;  4RF0 A;  3VRB B;  2MP2 A;  3A9K A;  2MSE D;  3Q14 C;  2N9L A;  3V62 A;  3I63 C;  4XYC A;  3SDL C;  3VRA B;  1E0Z A;  4WJO A;  2MHJ A;  1EF1 A;  1YN3 A;  1ZGU B;  4EZL A;  2WXH A;  2CKH B;  1PQS A;  4HK2 A;  3Q8F A;  4RH6 A;  3KH0 A;  3KUC B;  2HDE A;  5J17 A;  1P7E A;  4RM8 A;  2KQ4 X;  3AE4 B;  1V86 A;  2J0M A;  2INN E;  3HVZ A;  3P63 A;  3LXF A;  1TBE A;  3EHV A;  4BVU C;  2DNF A;  1P0R A;  1L6V A;  4W9I A;  3GZN I;  2L0T A;  1OEY J;  3ZVV A;  3L54 A;  1SJE D;  2V3P A;  2L0F A;  2O6V B;  3DVG Y;  1IBX A;  1RAX A;  2V3N A;  2QCZ A;  1F52 A;  1YD8 U;  3U7D A;  3RUL A;  1V9J A;  3M95 A;  4MH0 E;  3VFK A;  4R3D A;  2ZJD A;  4M01 A;  3H9D A;  1FRR A;  4KDI C;  1UWX A;  3KWV A;  2CU1 A;  1QKZ A;  4BKG A;  1EF5 A;  3DPD A;  4C00 A;  1TS5 A;  3A4S C;  1ZW7 A;  2NPT A;  1EU4 A;  3L0W B;  3N30 A;  4XWW A;  3OLM D;  3VDZ A;  4BZA A;  1I4G A;  2XK5 B;  4J6I A;  4B9K A;  3W5V B;  3RNB C;  2Z0E B;  1WF9 A;  4RGT A;  4A8X C;  1L4Z B;  4JPS A;  2JYT A;  2W82 A;  1CQV A;  3NVV A;  2G4S A;  1M94 A;  1V5O A;  1HXY D;  3R8B A;  2D2Q A;  3W5U B;  3NVZ A;  3VH3 B;  2M0X A;  3HHM A;  3H8H A;  4IM2 A;  3GS2 A;  2QDF A;  3NZU A;  5IKC M;  2D3G A;  2DEN B;  4KIK A;  2IGH A;  1GB1 A;  4YTN B;  2K0P A;  3OJ3 A;  1P9D U;  2IGD A;  2KAN A;  4WAA A;  4K81 A;  1FCC C;  1V6E A;  4GGQ A;  2WLB A;  2LUM A;  4W9F A;  3QC8 B;  2RR9 A;  3Q6B A;  3IT6 B;  1V5T A;  3MJW A;  2PKO A;  1R4N I;  3P42 A;  4KZ0 A;  4C4V B;  2DYB A;  3NZ3 A;  3AE7 B;  2LGY A;  2WDR B;  2IY1 B;  3V60 A;  3NRZ A;  3C19 A;  4KGR A;  5IP4 D;  1V8C A;  1ESF A;  1GG3 A;  2DWQ A;  2V4I B;  3O65 B;  1YMH E;  4MJS B;  3ZQ4 A;  2KLG A;  4RCO A;  1FD6 A;  2KD0 A;  3JVZ X;  1YJJ A;  1N61 A;  1YNT E;  3V61 A;  4GSW A;  1WGG A;  1CZP A;  4ARC A;  4KV2 A;  3HM6 X;  3R2T A;  1D4B A;  3QIJ A;  4KGS A;  2MBB B;  3M62 B;  4A9A A;  1Z2M A;  3APF A;  3LB8 C;  4ZRK A;  1WXS A;  3QQ8 B;  5E6O A;  1PGB A;  1P1A A;  2RSU A;  2LJ5 A;  4LTU A;  2REX A;  2I1J A;  1FEH A;  2HJ8 A;  4DWF A;  4II2 B;  3V05 A;  1VD2 A;  1ZE3 D;  3H7P B;  4ARI A;  3NS8 A;  1F77 A;  4L2Y A;  4IWQ A;  4NY0 A;  3A1Q A;  3BK1 A;  3PHX B;  4CYE A;  2K25 A;  2KTR A;  3APC A;  2HTH A;  5IO9 A;  1ET9 A;  2IBI B;  2G9H D;  1C77 A;  3GOE A;  3SU8 X;  2C7M B;  1WJU A;  2OED A;  4XE0 A;  2PIA A;  1Q5W B;  2FCS A;  3SFD B;  1UF0 A;  4BKS A;  5E6N A;  3S2A A;  1L0X B;  1NVI D;  2O2V A;  2RGF A;  2WXO A;  2LVQ A;  2N9K A;  2PVO D;  3PRM B;  2WXM A;  2LHE A;  2XN9 C;  2LJI A;  5BMG A;  2N7E A;  2MCN B;  3TBL D;  2CHX A;  2Z59 B;  3DQV A;  4DXA B;  4HEA 1;  1F0Z A;  3P4S B;  2D5G A;  2SEB D;  4TMA B;  3UI3 A;  4HRO A;  4WWO A;  3QAR A;  2LGD A;  2R2Q A;  2KJH B;  5IOI A;  1XXG A;  1ROE A;  2KWV B;  2VH2 A;  2MRP A;  3ONS A;  3A33 B;  3EC8 A;  1WSP A;  2KFK A;  1Y8R C;  2C60 A;  3A1Q B;  1H8C A;  4JWS C;  1FFV A;  2GI9 A;  4MT5 A;  1WYG A;  3AE1 B;  4KSK C;  2ASQ A;  1RLF A;  4KDL B;  2PJH A;  2BKR B;  3UQA A;  2UWQ A;  2LD9 A;  3WCQ A;  1XLQ A;  2L00 B;  5AUK A;  3AB5 A;  3ZRC A;  2WQY B;  2ZVN A;  3TIX A;  3U4E G;  1WFY A;  4EFO A;  3WAN A;  1QF6 A;  2FCM A;  3ZO5 B;  4BBN C;  2QEJ C;  1DOX A;  3K9P B;  1JAL A;  1P7F A;  3QK0 A;  1AWD A;  3DHG C;  3IAS 1;  1V1P B;  4MSQ B;  1XO3 A;  4YWG G;  1I4Q A;  1WXM A;  3EFU A;  1CJE A;  2KFK B;  4ZDV A;  2ZPN A;  2I1K A;  4EZJ A;  2MA9 B;  2RPQ A;  4IDI A;  3B2F A;  3M63 B;  2IPK D;  2LGX A;  1T0S C;  1N5X A;  1A5R A;  2RDH A;  3TEX A;  2KTR B;  1SJH D;  2W54 A;  2JZZ A;  5D94 A;  2N9P C;  3MFG A;  2D3C A;  1E7P B;  3U52 E;  3RT3 B;  3VUX A;  4DXG A;  4I6L B;  3ZUN A;  2J0J A;  3AU5 A;  4URK A;  3ENE A;  2J7Q B;  2O2V B;  3BYY B;  4S17 A;  2M19 A;  3VH4 B;  3KQ4 A;  2FE8 A;  4I6P A;  1U4A A;  2AX5 A;  1CMX B;  4ZHP A;  4BOZ B;  2Y5C A;  3VQI A;  1EUV B;  1IYF A;  4M0W A;  1F2R C;  2NTT A;  1WGK A;  1LO5 D;  2WXI A;  3RNA C;  3U7Z A;  1SF0 A;  1YJ1 A;  1D5M C;  3P4P B;  1GNU A;  3H1U A;  3V3X A;  1WGR A;  2X38 A;  2IO1 B;  3RN9 C;  2WX0 A;  2BW2 A;  3AEC B;  2ACZ B;  2WYQ A;  4KZC A;  4N6E B;  3VTW A;  4C7Z A;  1JW9 D;  2BKF A;  3MC9 A;  2LXA A;  1RFA A;  2AQ3 B;  1ZDX A;  1V81 A;  4MGK E;  1DOY A;  2WGS A;  1T0Y A;  3P4R B;  4EKU A;  4HRS A;  1R4M I;  2FCQ A;  3PHW B;  2XK5 A;  2CJN A;  3DWM A;  2BS3 B;  2CU3 A;  4YTP B;  1N6Z A;  2M56 B;  2N7D A;  4LK0 M;  3AEA B;  2JPH A;  1IGC A;  1MG8 A;  3PLU A;  3PO0 A;  3Q8A A;  4K1R B;  3U8Z A;  1KLU D;  3Q8C A;  1ENF A;  2JYE A;  4GXB A;  4IWP A;  4LJO B;  2Q5W D;  4L1B A;  2IGG A;  3I9V 1;  1TT5 B;  4N58 A;  3OG5 A;  1V1O A;  1GJZ A;  5FR3 A;  2LWP A;  3KYC D;  1WJ6 A;  5GXG B;  2CHZ A;  2MX2 A;  2QHO A;  4WWP A;  1RM6 C;  2WU5 B;  1H4R A;  4P1B C;  4ANW A;  4B0E A;  3BYT B;  2BPS A;  1L4D B;  3HVD A;  3X0W A;  3ML8 A;  3A9J B;  3B08 A;  4FJZ A;  2KX3 A;  4DDI D;  4HLE A;  1HA5 A;  3AV8 A;  2KK8 A;  5EE9 A;  1Y56 A;  2MWS B;  3JYU A;  2EKI A;  3RZF A;  4REZ A;  1T3Q A;  1JRO A;  1SIF A;  4C4V A;  4WAF A;  1C9F A;  4B0M A;  5AEK B;  1LFD A;  3AEG B;  5DCN A;  1OQY A;  2DZJ A;  5BYR A;  4PS8 A;  4W9C A;  2WX1 A;  1JCK B;  4RGM A;  1V49 A;  3RNC C;  2W3S A;  5TR5 A;  1WR1 A;  3APD A;  4LNF A;  2UU7 A;  1AYF A;  3WA0 A;  3T9L A;  4RGN A;  4LNI A;  3O13 A;  2IY0 B;  2DZI A;  5E6P A;  2QSD A;  3VUW A;  3W1S A;  1TJE A;  4JIO U;  4II3 B;  4NNJ B;  2M1M A;  4PYZ A;  4ASW C;  2LGI A;  4IM3 A;  3MTN B;  4XDD A;  2DBY A;  2J52 A;  3IAM 1;  3ZRF A;  2ZVO A;  2MBE A;  5IN7 A;  2OOB B;  1LQB A;  4EUT A;  1JWM D;  1KLG D;  4GOC A;  3AE9 B;  3L10 B;  3H7P A;  2K39 A;  2YEP F;  1SIJ A;  2KHW B;  3P4Q B;  4CQN A;  1C3T A;  2AYO B;  5CHW A;  4PT5 A;  1R4N B;  1QLB B;  1T0R C;  2UYZ B;  2KNB A;  1TKG A;  1I4P A;  1C4C A;  2PTL A;  3DBR B;  2IO2 B;  1WY8 A;  3BII D;  4W9H A;  5D7G A;  2W3R A;  3LDZ E;  4A3O A;  3AEB B;  3B9J A;  5KHO A;  3GE3 C;  2LUE A;  4W9K A;  1Q1O A;  3UIO B;  4PK1 A;  2KAC A;  4ZYS A;  1NI3 A;  2IO3 B;  4IWO A;  3R2I A;  2RDB C;  4B6W A;  1I4R A;  5FKA C;  1BT0 A;  1D3Z A;  3UQB A;  1PGX A;  3R7R A;  1GB4 A;  1TS3 A;  1E90 A;  1SE3 A;  1I4H A;  3ZDM C;  1E9M A;  2Z8L A;  2L52 A;  3VTU A;  1SGH A;  5J18 A;  1YQ3 B;  1HTO A;  1FO4 A;  2PPH A;  1UGM A;  2PE6 B;  3U30 A;  1PGA A;  2ZPY A;  3VVW B;  2LFI A;  3U2S C;  3EFC A;  5H8Y E;  3SR6 A;  1MVK A;  3NVW A;  1XQQ A;  4W9E A;  2KMC A;  1P98 A;  2EMT A;  2J53 A;  3DBH B;  5AZG A;  2KOX A;  3R66 C;  2KWC A;  5JZE B;  1YN5 A;  5JHA A;  3HK0 A;  2QIL A;  2DAF A;  5EE0 A;  4US8 A;  3AE2 B;  1TS4 A;  3ZIM A;  1C78 A;  2ZZP B;  4GDL B;  2JF5 A;  4ANU A;  2PVG C;  1NBF C;  2N9X A;  4D2K A;  2ON8 A;  4W9J A;  3H7S A;  3X23 A;  2YEP B;  3ZNH B;  4WQO B;  1DGJ A;  3M3J A;  4ZRQ A;  1VRA B;  1Q0W B;  1MFW A;  3IFW B;  5JXV A;  2O6V A;  4XC2 A;  1S1Q B;  3QX1 A;  4MH8 A;  2KJR A;  3AM9 A;  4IM0 A;  1T0Q C;  3ZKJ C;  4B95 A;  1NEN B;  1N60 A;  3DHH C;  1OTR B;  1J0G A;  2V9H A;  4MEM A;  2C9W B;  1KLV A;  2GBM A;  4ZRI A;  4FJV B;  4GMV A;  1XCT L;  3T3N A;  3OWE B;  3TL5 A;  3ECI A;  5FK9 C;  2VRR B;  4MDK E;  1FFU A;  4ZRP A;  2V0G A;  1OQQ A;  5LLI A;  2NS5 A;  1NI2 A;  1JWB D;  3PGE A;  2RDG A;  1E10 A;  2BB6 A;  5LXI B;  3SEB A;  3CST A;  1K50 A;  3ZTC A;  1TY2 A;  1SSN A;  3WAM A;  3IXS A;  4ZOH C;  2L05 A;  2JUO A;  4C56 C;  4ANX A;  2Z0D B;  2WXL A;  1OGW A;  2JZP A;  1STE A;  1QT9 A;  2QIE B;  4Q2J A;  2DHZ A;  1MPE A;  2K6Q A;  3PS6 A;  4AS1 A;  2JY6 A;  1IGD A;  3QJZ A;  1HE8 A;  3V6C B;  3MHZ A;  3JSV B;  2V4L A;  2BT6 A;  2JWU A;  1SE4 A;  2LHD A;  2BWE S;  1YX6 B;  4GU2 A;  3ZJV A;  2L7R A;  2I2Y A;  1WR6 E;  3IT4 B;  3ZXV A;  1EU3 A;  1FIQ A;  5D3D A;  1WJN A;  4ANV A;  2WNM A;  3OAW A;  2J0K A;  4NAW A;  3RNE C;  4ACF A;  1XT9 B;  4MSM B;  3L4P A;  1QOF A;  1FRD A;  5HHD G;  1YN4 A;  1GAQ B;  4OHJ A;  3Q3M C;  4RF1 A;  2VZK D;  2WWZ A;  4OZC A;  5JH5 C;  4HJK A;  4ZRJ A;  5C1Z A;  1E5W A;  4AP4 C;  2W9N A;  4IUM B;  2BBC A;  1FNU A;  3P2B A;  4W9D A;  4ICU A;  1UNS A;  1UH6 A;  3JSV A;  2FCN A;  1FNW A;  3DDC B;  3PRZ A;  3URY A;  2NPT B;  2L32 A;  1PFD A;  1VZ6 A;  3EGR A;  2RPV A;  3L13 A;  2BGF A;  2XBB C;  2K6D B;  1FM0 D;  2MJD A;  3SD5 A;  4YTM B;  1TZ1 A;  2NVU I;  1WGY A;  2BYV E;  3TEZ A;  1HTQ A;  4NJC A;  1ZP0 B;  4IW0 A;  4TV3 A;  2WXP A;  1KRH A;  2ZW0 A;  4WWM A;  4MJS A;  4LJP B;  1I35 A;  4TQ0 A;  1ZOY B;  3AED B;  1XLO A;  2A4Z A;  1WM2 A;  4MGZ E;  1D6E C;  1JQ4 A;  1C4P A;  2BS2 B;  1FNV A;  4K7S A;  5BMI A;  1MHH E;  3GE8 C;  4ICV A;  4FBJ B;  4GN1 A;  5JHB A;  2K5P A;  4YSX B;  1K8R B;  1J7B A;  1I7H A;  2MBH A;  2BF8 B;  2D3A A;  2L76 A;  4FA6 A;  3ZXR A;  5BYQ A;  3PLV A;  4O1N A;  2JRH A;  2D11 A;  1WE6 A;  2D07 B;  2KWD A;  1R7S A;  1GC7 A;  3NUH B;  5E6J A;  2LEK A;  4M0W B;  1FXA A;  3CMM B;  1WGH A;  4A55 A;  1JRP A;  2GMI C;  3VTV A;  2LI5 A;  2L3Z A;  2JX5 A;  1MI0 A;  4HDO A;  2PMV A;  3GP7 A;  3ETR A;  2AL6 A;  2WP9 B;  1ZXH A;  3BZD B;  1C79 A;  1L0V B;  1XEE A;  3UIN B;  3CIR B;  4KSL C;  3QWZ B;  4P16 A;  4FXC A;  3N20 C;  3Q3O C;  1YX5 B;  2H89 B;  1WMH A;  4IC7 B;  3RNF C;  4GDL A;  3FAH A;  4HJG E;  3W1Y A;  5G55 A;  3Q8B A;  1VDV A;  2KMM A;  1J7C A;  2K8H A;  4DK5 A;  1NEK B;  2YVC A;  3ZNG C;  4G0N B;  1Q10 A;  4MM3 B;  4A90 A;  5J2R A;  3ZW3 A;  1WM3 A;  3FKY A;  4EZK A;  4BAX A;  2TSS A;  2DZK A;  2MH7 A;  2KDB A;  1WYW B;  1ZDV A;  1IBX B;  1X1M A;  2JXT A;  1TTN A;  3FIL A;  2CJO A;  3N32 A;  2JVC A;  1PUT A;  1P3Q U;  4KVG B;  2AWT A;  4OZB A;  2R61 A;  2YLM A;  4KIK B;  2INP E;  2MBO A;  3AMZ A;  4MGI E;  2K8C A;  2KJ6 A;  3ML9 A;  1EM7 A;  3AE6 B;  1RYJ A;  3D32 A;  3ALB A;  2QC8 A;  3TJP A;  3DBH I;  2GBK A;  2WXF A;  3NY5 A;  4W9G A;  2K8B A;  1MG4 A;  2BVC A;  4TUU A;  2WXN A;  4TQ1 A;  2LGS A;  2ICI A;  3TSS A;  1VJK A;  4FLH A;  5CHV C;  3Q8E A;  3HM3 A;  1D5Z C;  2M4N A;  3FIL B;  4M8N A;  2FBW B;  4GIV A;  3HIZ A;  2B76 B;  2RD0 A;  1M4V A;  2JU6 X;  5D3I B;  4XGA B;  2WDQ B;  1TIF A;  2KDI A;  3PZD A;  1SE2 A;  5CHF A;  2NTS A;  2I38 A;  3VHT C;  2KMA A;  5BYS A;  1UWM A;  2M8S A;  4OW0 A;  3BK2 A;  3IBE A;  4K3C A;  2JRI B;  2MW5 A;  5HKH A;  4HKZ E;  1VZ7 A;  1LXD A;  1NYR A;  1V80 A;  3ABV B;  4XWT A;  2QJL A;  4WUR A;  2LRW A;  2K3U A;  1WWT A;  4RMA A;  3WAL A;  3DVN V;  1L5P A;  4NJ6 A;  1UBQ A;  3L08 A;  4RM9 A;  1WE7 A;  2N0S B;  1T5X D;  3IVF A;  3LJ3 A;  3VAW A;  2IZV B;  1ACC A;  2HE7 A;  1K53 A;  2FUG 1;  2NCN A;  4LDT B;  5C23 A;  4PYU A;  2H88 B;  3ZNZ B;  1WXQ A;  2GB1 A;  1SXT A;  2KC2 A;  5LNK 1;  2OJW A;  1L7Y A;  3CSF A;  1B9R A;  3IG3 A;  4JGH B;  2ONQ A;  1UZX B;  1YQB A;  4HPL B;  1AAR A;  2WS3 B;  2SAK A;  3QAQ A;  4M00 A;  2DYM A;  3TUO A;  5DPR A;  4LNO A;  3PRP B;  2V3S A;  2G1E A;  2N9E B;  1K51 A;  2ZNV B;  3TCA A;  3ZLZ A;  4LCD E;  2DLB A;  3PT2 B;  4JLC A;  2KVR A;  3AI5 A;  1JWA D;  4W9L A;  2VH1 A;  3RMK C;  3Q3N C;  2G45 B;  2GRI A;  4MGY E;  1TKE A;  4G3X B;  3EEC A;  4FN2 A;  3BVG A;  2AL3 A;  5AZF A;  1F1H A;  2DYO A;  2INC C;  2KLC A;  2JQR B;  2O6V D;  1D5X C;  1CK1 A;  2KO3 A;  2N4F A;  1E8W A;  3T3O A;  5AUI A;  4OVV A;  2XEW A;  3L16 A;  2K22 A;  2WXG A;  3GZN B;  4HPP A;  1F2R I;  3KUZ A;  1WXA A;  4RGO S;  1WX8 A;  4AJW A;  2LMC A;  1IPG A;  2KDE B;  1BUI C;  1ET6 A;  1B1Z A;  1KF6 B;  2ZNV C;  4DHJ D;  3BVM A;  5DPT A;  4C7Y A;  1WI0 A;  1I42 A;  2BYE A;  3MC0 B;  2V1Y A;  2AEH A;  4IOI E;  4CO7 A;  4FHK A;  4GB9 A;  4DHZ E;  1TYG B;  1GC6 A;  3B2G A;  2WXQ A;  1YIW A;  2PW9 A;  3Q2A C;  3AE5 B;  1K52 A;  3AEE B;  3DBR I;  4WQM A;  3KW5 B;  1AW7 A;  4NAM A;  1L2N A;  3WAO A;  4A6Q A;  3RCZ A;  1V2Y A;  2FAZ A;  1VZ8 A;  2KN5 A;  4AQ7 A;  1KOT A;  3UF8 A;  3EA6 A;  3ZDT A;  4WIP A;  1WJ4 A;  1WXV A;  5KHQ A;  4F1S A;  4NAW B;  1N5W A;  2PE9 A;  1VLB A;  5IA7 A;  3ZTD A;  2JXX A;  3AUL A;  5EE3 A;  3VR9 B;  2IND C;  3PTF C;  3CF6 E;  5C2T B;  2WXK A;  3DVG X;  4YT0 B;  3WIM A;  5D6J B;  3RYT A;  2E3T A;  2C7H A;  1WX7 A;  1GUA B;  5G2N A;  1AN8 A;  3DHI C;  5CTR C;  1IP9 A;  2NR2 A;  2FIF A;  4N59 A;  1FXT B;  3SFE B;  2QMT A;  3KVF B;  2R2O A;  4K3B A;  2MLB A;  4US9 A;  4JX1 C;  2KYW A;  3TEY A;  1FXI A;  3DBL B;  1XLP A;  4NQL B;  3NS1 A;  3RPF C;  2IJ0 A;  3JW0 X;  1VR9 A;  4LNN A;  1ZXI A;  2JWZ A;  2KT7 A;  3A9K B;  2NBW B;  1C76 A;  5MPO A;  3KUD B;  1WZ3 A;  2WHI A;  2MJE A;  2ZW1 A;  2FID A;  3I57 A;  1HEZ E;  4ITK A;  5HI1 A;  4G50 A;  2K9X A;  3TMP B;  2NBV B;  1SBB B;  4WWN A;  2EEL A;  1HZ5 A;  3EUB 2;  4USA A;  3ZGZ A;  2PEA A;  1QOA A;  4N9F 4;  4DXF A;  5EE1 A;  2IO0 B;  1KJT A;  1DYQ A;  5HG2 A;  4WJQ A;  3V6E B;  4RNA A;  3RD2 A;  2KDF B;  4XX5 A;  4TSS A;  4KGT A;  2MP2 B;  2BQQ A;  2CHW A;  2KWU B;  2KDM A;  1EO6 A;  3L17 A;  3H6N A;  2DZM A;  4GLS C;  3R3M A;  3PRE A;  5I4D A;  3PVL A;  1XLN A;  2A5U A;  4AOF A;  3N1Z C;  2M0A A;  3BVZ A;  2ZCB A;  2KAJ A;  3Q3J A;  1MHX A;  4JWU C;  1MJD A;  2MQJ A;  4XDC A;  4NZL B;  3KYD D;  1TKY A;  1LM8 B;  4BKS D;  2N7J A;  4M8M A;  1KTK A;  4KKI A;  2LVO A;  4FHJ A;  5CX3 A;  2BYF A;  3MC8 A;  4GDK A;  4LNK A;  4HPM B;  1SEB D;  2W55 A;  2ZEQ A;  4OZA A;  1UD7 A;  2GBR A;  4KX6 B;  3KWL A;  5C3J B;  1J8C A;  3QCA A;  5HFY A;  4BBN F;  1IUE A;  2X8X X;  1XF5 L;  1WRD B;  2E6X A;  4QAY A;  4DHZ B;  2BWF A;  1PYW D;  1UBI A;  3FC4 A;  4AUQ C;  3NVY A;  5L95 C;  4HDQ A;  1HQR D;  4K7W A;  3DCG A;  3DOW A;  2VZK B;  3HRD D;  3C8Y A;  2NMQ A;  3MHS D;  1NDD A;  5FR6 A;  1XCQ L;  5G5H A;  1JRU A;  1TZO A;  3K9O B;  4S0R A;  2J4X A;  4LLG M;  4AJY B;  1E6E B;  2LXC A;  1E8Y A;  4MEL A;  2N1W A;  3AE3 B;  3R7Q A;  5AZH A;  1EWY C;  1SE9 A;  3P1M A;  1BML C;  1EWC A;  1YQ4 B;  2MJ3 A;  1Z5S B;  2KXJ A;  1FMA D;  4NQK E;  3AEF B;  4BOS C;  1WMH B;  1SB3 C;  1L0Y B;  1FCL A;  4FJY A;  4IKG A;  2K1F A;  2J42 A;  5EDS A;  4F7Z A;  1WGD A;  3QA8 A;  4IG7 B;  2XNA C;  1UUP A;  1ZUD 2;  4JE3 B;  3TEW A;  1N62 A;  2FUH B;  1ISN A;  3N1X C;  4M02 A;  1KH0 A;  3NZS A;  2CR5 A;  4CHK A;  4JQW C;  3C0R B;  1QZE A;  1ZKH A;  5G5G A;  1QOB A;  5BMH A;  4G11 A;  4FAD A;  3BIN A;  1UEL A;  4TKN A;  2C7N B;  3UGB B;  4E3C A;  1C1Y B;  3PV1 A;  2EMS A;  4DBG A;  1JWS D;  1I4X A;  3PSE B;  1OQR A;  3PPA A;  2N1V A;  2HD5 B;  4XZ4 A;  3ZNI D;  3RI7 C;  1YOV B;  3AU4 A;  3BWU D;  2WU2 B;  2NBU A;  1JWU D;  2CS4 A;  4DHJ B;  3QHT A;  3A9J A;  3LYY A;  1KM7 A;  1G6J A;  4WH4 A;  4MM3 A;  3HUI A;  5T8I A;  4DQO C;  3RNG C;  4KKJ A;  2PLP A;  4P7I A;  2GLS A;  2GBN A;  2WXJ A;  1FPY A;  3I5J C;  1OEY A;  3NHE B;  1E7V A;  4F8C B;  3DWG C;  1TY0 A;  2D10 A;  2LRU A;  3AH7 A;  4OVZ A;  3NOB A;  4YL8 A;  3AN1 A;  4NJ7 A;  2BYT A;  4ZYN A;  2BTE A;  3MJ5 A;  4BFR A;  1BXT A;  3N1Y C;  1JML A;  1PDX A;  4H2A A;  2LAS A;  2Y5B B;  1NYQ A;  2MEK A;  1E8Z A;  4EE2 A;  2DX5 B;  2G4D B;  4YSZ B;  3SHQ A;  1E7U A;  3I3T B;  2G3Q B;  3Q3F A;  2LVP A;  3E9S A;  2DAJ A;  2HJ1 A;  5L83 A;  1DOI A;  2HTM E;  3RZW C;  4HVB A;  3NJT A;  1WIA A;  1GPX A;  4EOY A;  1RRB A;  1VCB A;  4K7U A;  1UGJ A;  2ZCC A;  4YSY B;  5LXH A;  2D3B A;  2JT4 B;  3ZJU A;  4MAC A;  1J19 A;  2KFJ A;  3RUI B;  2EKE C;  1RFK A;  1RWS A;  1C4A A;  2AQ2 B;  1ZPS A;  5BO4 B;  3W1S C;  2KC1 A;  2MBQ A;  4HKQ A;  2KVZ A;  3Q69 A;  4PS3 A;  4X57 B;  1WRI A;  4WJP A;  4HXD A;  5D2M B; 
#chains in the Genus database with same CATH homology
 2KN4 A;  4NAM A;  2BT6 A;  2JWU A;  1SE4 A;  2LHD A;  1QF6 A;  4A6Q A;  3ZJT A;  1VZ8 A;  2QEJ C;  4AQ7 A;  3ZJV A;  1DOX A;  2I2Y A;  1JAL A;  1L6U A;  3IT4 B;  3VR8 B;  1EU3 A;  1P7F A;  1FIQ A;  5D3D A;  3EA6 A;  1AWD A;  4L23 A;  3PZ8 A;  4WIP A;  2WNM A;  3AE8 B;  2L83 A;  3IAS 1;  1V1P B;  3L4P A;  1XO3 A;  1QOF A;  2RMM A;  1FRD A;  4NAW B;  4YWG G;  4GDK B;  5HHD G;  1I4Q A;  1YN4 A;  1N5W A;  1GAQ B;  1CJE A;  2Y5P A;  3W9C B;  2BB5 A;  4ZHO A;  4OHJ A;  1VLB A;  4RF1 A;  1KFY B;  1OFF A;  4IDI A;  2IDY A;  3B2F A;  2VZK D;  5EE3 A;  4OZC A;  3VR9 B;  2IPK D;  1N63 A;  5C2T B;  1N5X A;  4YXD B;  2RDH A;  3TEX A;  1SJH D;  2WXK A;  2W54 A;  2BBC A;  2WXR A;  1A70 A;  3MFG A;  2OHF A;  4YT0 B;  1E7P B;  1FNU A;  3U52 E;  4DXG A;  3MP9 A;  2E3T A;  1UNS A;  1AN8 A;  5H92 C;  3BYY B;  2M19 A;  3KQ4 A;  1FNW A;  2FE8 A;  2AX5 A;  4N59 A;  3URY A;  3SFE B;  2QMT A;  3W2D A;  3E56 A;  2L32 A;  3N9Y C;  1PFD A;  1VZ6 A;  3EGR A;  2RPV A;  4ZHP A;  1QIL A;  2Y5C A;  1FM0 D;  2MJD A;  4US9 A;  4JX1 C;  3VQI A;  4YTM B;  1HZ6 A;  3GB1 A;  3TEY A;  1FXI A;  1V1P A;  3TEZ A;  3CWI A;  3PZ7 A;  4NJC A;  4M0W A;  1F2R C;  1ZP0 B;  2NTT A;  2BS4 B;  1WGK A;  1XLP A;  2WXP A;  1LO5 D;  2WXI A;  1KRH A;  1QOG A;  3ZYY X;  3U7Z A;  1SF0 A;  2ZW0 A;  3NS1 A;  3RPF C;  1D5M C;  2IJ0 A;  3P4P B;  4WWM A;  3V3X A;  1VR9 A;  2X38 A;  1ZXI A;  4TQ0 A;  1ZOY B;  3AED B;  2BW2 A;  1XLO A;  1JQ4 A;  1C76 A;  1D6E C;  3AEC B;  4RFB A;  1C4P A;  2ACZ B;  2BS2 B;  5MPO A;  2AQ1 B;  4N6E B;  2MJE A;  2ZW1 A;  1FNV A;  5BMI A;  4C7Z A;  1MHH E;  1JW9 D;  5TSS A;  3I57 A;  2Y3A A;  2AQ3 B;  1HEZ E;  4ITK A;  2K5P A;  5HI1 A;  4YSX B;  1ZDX A;  2K9X A;  1DOY A;  1J7B A;  1I7H A;  3J9C A;  2WDV B;  1V97 A;  3P4R B;  4HRS A;  1SBB B;  5BYQ A;  2CJN A;  3DWM A;  3RFZ B;  1TS2 A;  1QQR A;  1YJI A;  2BS3 B;  2CU3 A;  2EEL A;  1GOZ A;  4O1N A;  4UDU C;  2M56 B;  4LK0 M;  1HZ5 A;  3AEA B;  1IGC A;  3EUB 2;  2KWD A;  4USA A;  3PO0 A;  3Q8A A;  2JSV X;  1R7S A;  3ZGZ A;  1KLU D;  3NUH B;  1QOA A;  5E6J A;  2L1A A;  3Q8C A;  4DXF A;  5EE1 A;  1ENF A;  2JYE A;  4P6V F;  1DYQ A;  2Q5W D;  4L1B A;  2IGG A;  2LEK A;  1FXA A;  3I9V 1;  5HG2 A;  1J7A A;  4J3O D;  4A55 A;  3KLS X;  4RNA A;  4N58 A;  1JRP A;  4C80 A;  1T6B X;  4RF0 A;  4TSS A;  4KGT A;  2JX5 A;  3VRB B;  1MI0 A;  1V1O A;  2KDM A;  5FR3 A;  2PMV A;  3GP7 A;  3ETR A;  2N9L A;  2WP9 B;  1ZXH A;  5GXG B;  3BZD B;  1C79 A;  1L0V B;  4GLS C;  1XEE A;  1E0Z A;  3VRA B;  5I4D A;  1RM6 C;  3CIR B;  2WU5 B;  1XLN A;  1YN3 A;  2M0A A;  4P16 A;  4B0E A;  4FXC A;  3BYT B;  2WXH A;  3BVZ A;  2KAJ A;  1L4D B;  2H89 B;  3HVD A;  3Q8F A;  4RH6 A;  1MHX A;  4JWU C;  4HJG E;  3FAH A;  4XDC A;  2HDE A;  3Q8B A;  4NZL B;  1P7E A;  1VDV A;  2KMM A;  2KQ4 X;  1J7C A;  3AE4 B;  1TKY A;  1NEK B;  2INN E;  3HVZ A;  3P63 A;  3LXF A;  1Q10 A;  2N7J A;  1KTK A;  4KKI A;  4MM3 B;  1HA5 A;  4A90 A;  3AV8 A;  1L6V A;  1Y56 A;  5EE9 A;  2EKI A;  4REZ A;  1SJE D;  2V3P A;  1SEB D;  2TSS A;  1T3Q A;  1JRO A;  2W55 A;  4WAF A;  1C9F A;  4B0M A;  1IBX A;  2MH7 A;  2V3N A;  1ZDV A;  4OZA A;  1IBX B;  2JXT A;  3AEG B;  3FIL A;  2CJO A;  4KX6 B;  3KWL A;  1PUT A;  5BYR A;  4R3D A;  5C3J B;  4OZB A;  5HFY A;  2R61 A;  1FRR A;  2INP E;  1JCK B;  3AMZ A;  4RGM A;  1IUE A;  1UWX A;  3KWV A;  2W3S A;  1QKZ A;  1EM7 A;  3AE6 B;  1XF5 L;  1RYJ A;  1TS5 A;  2E6X A;  1AYF A;  1EU4 A;  4XWW A;  1PYW D;  2WXF A;  1I4G A;  3W5V B;  3FC4 A;  4RGN A;  3O13 A;  3NVY A;  4RGT A;  4A8X C;  2QSD A;  1L4Z B;  3W1S A;  4JPS A;  1TJE A;  1HQR D;  2JYT A;  2W82 A;  1CQV A;  2LGI A;  3NVV A;  2WXN A;  4XDD A;  2DBY A;  2J52 A;  2VZK B;  3IAM 1;  3HRD D;  4TQ1 A;  3C8Y A;  2ICI A;  2NMQ A;  3TSS A;  1HXY D;  1XCQ L;  1VJK A;  3R8B A;  1JWM D;  1KLG D;  1TZO A;  3AE9 B;  5G5H A;  3W5U B;  3NVZ A;  3Q8E A;  2YEP F;  1SIJ A;  1D5Z C;  3FIL B;  3P4Q B;  4CQN A;  2J4X A;  4LLG M;  2FBW B;  2B76 B;  1E6E B;  1M4V A;  4PT5 A;  2JU6 X;  5D3I B;  1QLB B;  3H8H A;  3GS2 A;  2WDQ B;  3AE3 B;  1SE2 A;  1TKG A;  1I4P A;  2NTS A;  1C4C A;  2I38 A;  1EWY C;  2PTL A;  5BYS A;  3P1M A;  2IGH A;  1BML C;  1GB1 A;  3BII D;  1EWC A;  1UWM A;  1YQ4 B;  5D7G A;  2MJ3 A;  4OW0 A;  4YTN B;  3BK2 A;  2W3R A;  1FMA D;  2K0P A;  3AEB B;  3B9J A;  3AEF B;  2IGD A;  4HKZ E;  1VZ7 A;  1SB3 C;  1L0Y B;  1NYR A;  3ABV B;  1FCL A;  1FCC C;  4IKG A;  2QJL A;  4XWT A;  2WLB A;  4WUR A;  2LUM A;  2KAC A;  4ZYS A;  1NI3 A;  2J42 A;  3R2I A;  2K3U A;  1WWT A;  1I4R A;  1L5P A;  5FKA C;  3IT6 B;  2XNA C;  1PGX A;  2PKO A;  1UUP A;  3P42 A;  1GB4 A;  1TS3 A;  1ZUD 2;  2N0S B;  4JE3 B;  3TEW A;  1SE3 A;  1N62 A;  1T5X D;  1ACC A;  3NZ3 A;  3AE7 B;  1I4H A;  2WDR B;  1E9M A;  1K53 A;  2Z8L A;  2FUG 1;  3NRZ A;  1KH0 A;  2L52 A;  4KGR A;  1V8C A;  2H88 B;  1ESF A;  1WXQ A;  2GB1 A;  1SXT A;  5G5G A;  1QOB A;  2DWQ A;  1YQ3 B;  2V4I B;  5BMH A;  5LNK 1;  1FO4 A;  1YMH E;  1PGA A;  3ZQ4 A;  4RCO A;  1FD6 A;  2LFI A;  3U2S C;  1B9R A;  1YJJ A;  1N61 A;  1YNT E;  5H8Y E;  3SR6 A;  1MVK A;  2ONQ A;  3NVW A;  1CZP A;  4ARC A;  1JWS D;  1I4X A;  2J53 A;  2WS3 B;  1OQR A;  3R2T A;  1D4B A;  2SAK A;  2DYM A;  1YN5 A;  4KGS A;  3TUO A;  2QIL A;  4A9A A;  4US8 A;  5EE0 A;  3AE2 B;  1TS4 A;  3BWU D;  2WU2 B;  1C78 A;  3LB8 C;  1JWU D;  4GDL B;  2G1E A;  1K51 A;  3LYY A;  2PVG C;  4WH4 A;  2DLB A;  3HUI A;  1PGB A;  4D2K A;  2ON8 A;  1JWA D;  5T8I A;  4DQO C;  4LTU A;  2YEP B;  1FEH A;  1DGJ A;  4KKJ A;  2PLP A;  3V05 A;  2GRI A;  1TKE A;  4ZRQ A;  1VRA B;  2WXJ A;  1ZE3 D;  5JXV A;  4ARI A;  3BVG A;  3DWG C;  1F77 A;  1TY0 A;  2DYO A;  3AH7 A;  4MH8 A;  3AM9 A;  4L2Y A;  4OVZ A;  2JQR B;  1D5X C;  1NEN B;  3AN1 A;  3BK1 A;  1N60 A;  2BYT A;  2BTE A;  1CK1 A;  3MJ5 A;  1BXT A;  1ET9 A;  1JML A;  3T3O A;  2G9H D;  5AUI A;  1PDX A;  4H2A A;  1C77 A;  2OED A;  4XE0 A;  2PIA A;  1XCT L;  3SFD B;  3T3N A;  2K22 A;  3OWE B;  2WXG A;  1F2R I;  1NYQ A;  2MEK A;  1L0X B;  1NVI D;  4RGO S;  2WXO A;  5FK9 C;  4EE2 A;  2N9K A;  1FFU A;  2PVO D;  4ZRP A;  2V0G A;  1OQQ A;  2LMC A;  4YSZ B;  2WXM A;  2LHE A;  2XN9 C;  2LJI A;  1BUI C;  1JWB D;  5BMG A;  1ET6 A;  1B1Z A;  2RDG A;  1E10 A;  2BB6 A;  3E9S A;  4HEA 1;  1F0Z A;  1DOI A;  2D5G A;  2HTM E;  1KF6 B;  2SEB D;  3P4S B;  4TMA B;  3UI3 A;  4HRO A;  3BVM A;  1GPX A;  3SEB A;  1K50 A;  4YTP B;  1XXG A;  1ROE A;  1TY2 A;  4C7Y A;  1SSN A;  3IXS A;  3MC0 B;  4ZOH C;  4IOI E;  1UGJ A;  1WSP A;  4C56 C;  4YSY B;  2WXL A;  1TYG B;  3ZJU A;  4JWS C;  1FFV A;  2JZP A;  2GI9 A;  4MAC A;  1WYG A;  4MT5 A;  1STE A;  1QT9 A;  3B2G A;  2QIE B;  1RFK A;  1RWS A;  4Q2J A;  1C4A A;  3AE1 B;  1MPE A;  1ZPS A;  2AQ2 B;  2WXQ A;  4AS1 A;  1IGD A;  3WCQ A;  1XLQ A;  2PW9 A;  4HKQ A;  3AE5 B;  3Q69 A;  5AUK A;  1K52 A;  3AEE B;  1WRI A;  3AB5 A;  2WQY B;  3MHZ A;  4WQM A;  3U4E G;  1AW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...