1XLPA

Structure of oxidized c73s putidaredoxin from pseudomonas putida
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin
publication title Redox-dependent structural reorganization in putidaredoxin, a vertebrate-type [2Fe-2S] ferredoxin from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 31
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature ec 1.9.3.2: Transferred entry: 1.7.2.1.
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xlpA00
1L5PA 2HTME 2L52A 3AN1A 3FC4A 4N59A 2WS3B 3AEEB 5AUIA 1DOXA 1DOYA 1N63A 2H88B 1WRIA 3FAHA 3LB8C 3AE9B 3AE2B 3AMZA 1IUEA 2MH7A 1ROEA 2BS2B 3P63A 3DWGC 1E7PB 1F0ZA 1L6VA 1ZOYB 3CIRB 1TKYA 1JRPA 1TKGA 3SFDB 2PIAA 1N61A 3AE3B 4C7ZA 3NVWA 4YSYB 3P4RB 3P1MA 4LTUA 1J7AA 2PVOD 2QJLA 3LXFA 4YTMB 1ZXIA 4N6EB 2MJ3A 1J7CA 4C7YA 2PVGC 4C80A 3B9JA 2PKOA 1CJEA 1YJIA 4ZHPA 3AEGB 3DWMA 2QIEB 4JX1C 1KRHA 5C2TB 1UWMA 1WWTA 1JALA 3NVYA 1GPXA 3L4PA 3AE6B 3B2GA 5EE9A 5MPOA 1YQ3B 1I7HA 3NVZA 1WYGA 1VDVA 3W5VB 1VJKA 3HVZA 1ZP0B 1FMAD 1E10A 5C3JB 2W55A 1PUTA 2ACZB 3PO0A 3SFEB 1JWAD 1QOFA 2W3SA 1T3QA 1N62A 1XLOA 3CWIA 1RWSA 4HRSA 4KX6B 1B9RA 3AH7A 2B76B 4JWUC 2AX5A 1E9MA 1QLBB 3AE1B 1A70A 1J7BA 1TJEA 2K22A 3SR6A 1XLPA 1NI3A 1CZPA 3AE4B 1YJJA 2WU2B 3EUB2 1KFYB 2N0SB 2JX5A 1SB3C 1DGJA 2W54A 1N5XA 1XLNA 1XO3A 3AE7B 4P6VF 5AUKA 1RFKA 1WXQA 1PFDA 4YTNB 3VRBB 2OHFA 3AECB 2CJNA 4YT0B 2BT6A 3VRAB 1FIQA 5EE3A 1E0ZA 1TKEA 1QOAA 3BIID 4JWSC 2JQRB 5H92C 3NRZA 2K5PA 3AEFB 3VR9B 2WLBA 3KWLA 4YSZB 4ZHOA 2L83A 1JROA 1L6UA 3AE5B 3P4SB 2M19A 4WQMA 1OQRA 1SF0A 2DWQA 1RYJA 2WQYB 2WP9B 4WWMA 1WGKA 3HUIA 3P4PB 4YTPB 3AE8B 1FM0D 2W3RA 1FFUA 2KAJA 1PDXA 4YSXB 1JW9D 5EE1A 4YXDB 1FRDA 2G1EA 1V97A 3AV8A 2LEKA 1TYGB 3NS1A 5G5GA 3W9CB 1NVID 1JQ4A 4USAA 1L0VB 1R7SA 1YQ4B 2EKIA 1N5WA 1XLQA 4US8A 3AEAB 3RPFC 3WCQA 1N60A 2BS4B 1AWDA 1V8CA 2K9XA 1OQQA 1FFVA 2E3TA 1OFFA 3AM9A 5EE0A 3AEDB 4IDIA 1NENB 3B2FA 1QOBA 1SIJA 3AEBB 5H8YE 1AYFA 1ZUD2 2DBYA 2MJDA 1FO4A 2FBWB 1NEKB 1FXAA 1E6EB 1EWYC 1RM6C 2KMMA 2M56B 2Q5WD 4A9AA 1GAQB 4ZOHC 2WDQB 3NVVA 1QOGA 3ABVB 2CU3A 3HRDD 1FXIA 5GXGB 2CJOA 4US9A 1DOIA 4FXCA 4N58A 1NYRA 2H89B 1QT9A 3VR8B 3W5UB 2WU5B 1JWBD 2MJEA 2BS3B 2WDRB 3AB5A 3P4QB 4HROA 4ITKA 1KF6B 2Y5CA 2WDVB 1QF6A 3ETRA 1FRRA 5G5HA 1NYQA 3ZYYX 1VLBA
chains in the Genus database with same CATH superfamily
4AP4C 1ZXHA 3ML8A 4WJNA 3J9CA 2FCSA 2QCZA 1ROEA 1FXTB 4ARIA 5T8IA 3CSFA 3B1LX 3ZTDA 4PT5A 2JPHA 3H9DA 1HTOA 5D6JB 1PYWD 4ZRIA 1S1QB 1WWTA 3NVYA 3NZUA 5EE9A 1L0YB 2JZZA 1UGMA 2J53A 3HHMA 4L1BA 1B1ZA 1QOFA 1SE4A 4WWOA 2V4IB 4JWUC 1ZW7A 1QLBB 3NG0A 1TS2A 4MGKE 1D5XC 5E6JA 1JWSD 5D2MB 4ARCA 3KYDD 5IP4D 3V61A 4II2B 4MDKE 1HQRD 4M8NA 2QDFA 3FILA 2AL6A 2L00B 4YSZB 2LZ6A 2NS5A 2WXHA 1PGAA 4LJPB 4YTPB 2BGFA 5DPWA 2BB6A 3DCGA 3B08A 2D10A 2LEKA 4PYUA 3NS1A 1JQ4A 4US8A 2ON8A 3QCAA 1XLQA 4ZYSA 3AM9A 2K9XA 1YD8U 3Q8BA 2LVQA 4RGMA 3FILB 1FO4A 2KMMA 2WXQA 2L0FA 1QOGA 4PS7A 1FXIA 2I1KA 1KLUD 2AWTA 2ZEQA 3VUWA 3GP7A 3VUXA 5L83A 2G3QB 4EOYA 3BVMA 3TL5A 1KM7A 4LDTD 1WM3A 2JSVX 3WAOA 2L32A 2IGGA 3AEEB 3BK1A 1N63A 3N1YC 3UQAA 4NQLB 3KYCD 3ZQ4A 4HLEA 3DVGY 2ASQA 4ANXA 3DWGC 1WI0A 1EU3A 4MGYE 5DPRA 2DZIA 1D4BA 1YJIA 3B2GA 2JWZA 3GB1A 3V3XA 1F9JA 1L7YA 3AI5A 3L16A 1E9MA 2XBBC 3EUB2 2KWUB 1JWMD 4YTNB 2LGXA 2RMMA 3AECB 4NZLB 2NMQA 3LYYA 5DPSA 4WH4A 1RFAA 2LUMA 2INPE 2JWUA 2CHXA 2N7JA 2JXTA 5DCNA 3WA0A 2WYQA 4H2AA 2M4NA 2KWCA 4ZHOA 1L6UA 2I38A 1WZ3A 4WWMA 4LDTB 1RYJA 2WQYB 1HTQA 5HHDG 2MBHA 4C56C 2KMAA 5EE1A 1CQVA 5FR6A 1L0VB 1WGGA 4XX5A 4KSLC 1TGZB 1HZ6A 1TS4A 4GB9A 1MVKA 4LNKA 1U4AA 4A9AA 1PQSA 1WRDB 2WDQB 3ZIMA 4KVGB 1V81A 4OZCA 3A4SC 1WE7A 3DBRB 3P4QB 1WJUA 2V3PA 3SHQA 2RPQA 4FHJA 2L52A 4N59A 2LXAA 2O2VB 2EMSA 3FAHA 3RNAC 2MWSB 3N20C 1ZPSA 3L17A 3P63A 4MT5A 3IT4B 2D11A 3MJWA 4QAYA 3B0AA 3Q3OC 4A3PA 4C7ZA 3NVWA 5IOIA 1KH0A 2IY0B 5IAAC 2VRRB 3ZVVA 2LGYA 2PVGC 1ZDXA 2RPVA 1UWMA 2CU1A 5BMGA 1KOTA 3ZXVA 3T9LA 5MPOA 3ZKJC 3NHEB 3VVWB 2NPTA 4LLGM 3KH0A 5C3JB 4IWOA 4KGTA 3VHTC 3A9KA 2KFKA 3MC9A 4HRSA 3X23A 4J6IA 1IYFA 2K22A 1CZPA 1LQBA 1HA5A 1YJJA 3Q3NC 1RLFA 1GNUA 4LNIA 3K9PB 3AE7B 1XLNA 4WJOA 2JXXA 2NBWB 1BMLC 2DAFA 2WXKA 4CO7A 2QEJC 2AL3A 4HDOA 3CMMB 3QAQA 3A9KB 2KFKB 2ZZPB 3NRZA 1BXTA 3V6CB 1EO6A 4KZ0A 4KZCA 3ZDTA 3TEYA 4FHKA 1WGKA 3ZNGC 3RZFA 4EZLA 3U30A 4YSXB 2HJ1A 2LRUA 2WXIA 2BYEA 5J2RA 1SE2A 4USAA 2EKIA 3RNGC 1VD2A 1X1MA 2QSDA 2LVOA 3V05A 2JYTA 3N1ZC 2LGIA 4W9IA 1AYFA 4ASWC 1G6JA 2X38A 2DBYA 3QARA 1I4HA 1TIFA 2D3GA 4JGHB 3DPDA 1MJDA 4N58A 3MJ5A 4II3B 2JZPA 4EZKA 1QQRA 2DNFA 2LUEA 1KF6B 2L05A 3BYTB 2BBCA 2BVCA 5G5HA 2WGSA 1UNSA 5HG2A 2SEBD 1KTKA 4C4VB 4K7WA 3AN1A 2D3CA 1OTRB 4WWNA 4P1CC 1IUEA 4NJ7A 4OVUA 3ML9A 3PVLA 1K8RB 2PIAA 4IUMB 1TT5B 1QZEA 3NZ3A 3VQIA 2ZW1A 4M0WA 1P98A 3DVGX 2AQ2B 1JCKB 3ENEA 1CJEA 1MG8A 2PW9A 5C2TB 4IM2A 3RD2A 3ZNHB 2MRPA 3D32A 3DBHB 2W9NA 4BKSD 4K3BA 4REZA 1C4CA 3M95A 3QQ8B 3FKYA 1WR6E 4IM0A 3KUZA 1Z5SB 1XQQA 3A4RA 4M0WB 1L4ZB 3Q3FA 4S17A 1WJNA 2KN5A 2XK5A 2MSED 5GMVA 3IT6B 4HEA1 1K50A 2D3AA 1MI0A 1GC7A 1UF0A 2JY6A 2KVRA 2K6DB 3KQ4A 4AS1A 3QA8A 4W9FA 3AEFB 4WJPA 3U2SC 3AE5B 3GOEA 3LDZE 3TEXA 3RNFC 2PPHA 3PTFC 2IO0B 2WWZA 2XK5B 3ZDMC 4BKSA 4C00A 1NVID 4RF1A 3C8YA 1R7SA 1OQQA 1FFVA 1M4VA 4WAAA 1P7EA 1QOBA 4XC2A 2KT7A 1Q1OA 1N6ZA 1SEBD 4AWJA 2CU3A 2WDTB 4DDGD 2X8XX 1V1OA 2BF8B 2Y3AA 3RNEC 2M1MA 2A5UA 3T3NA 3DBLB 1JWBD 2PE9A 4DK5A 3EECA 4ITKA 1KJTA 1C77A 4EZJA 2KXJA 3L0WB 4A3OA 1VLBA 1M94A 1HE8A 2C7HA 4ANVA 2WS3B 2N7DA 3K9OB 3PLVA 1WZ0A 3L08A 3EHVA 1F0ZA 1L6VA 4YSYB 1WSPA 4YTMB 3AU4A 3ZJVA 3RYTA 1V80A 3BYYB 4BZAA 1P0RA 2E6XA 1H4RA 1LM8B 3MC0B 5CHWA 3IVFA 1WYGA 4BAXA 4RMAA 4XYCA 1E10A 4MGIE 1WGYA 3UIOB 1OEYJ 2KDBA 1AN8A 3R2TA 2PEAA 4ZRPA 3R7QA 3HVDA 3WIMA 1KFYB 1XO3A 2WXJA 4MGZE 1OGWA 4WURA 1R4MB 3L10B 2NTTA 2DYOA 2OJRA 1IGCA 2I1JA 1QOAA 3BIID 1WGRA 2JQRB 1E5WA 4MEMA 1OQRA 5LXHA 2WP9B 3QWZB 3QK0A 1T6BX 1Y8RC 4LNOA 5JZEB 1FFUA 4W9LA 1PDXA 2ZVOA 4YXDB 3IHPC 2DYBA 4NAMA 3VFKA 3A9JA 1N5WA 4RGTA 1AWDA 2HTHA 3SDLC 4K3CA 2KK8A 2KDEB 1OEYA 3U8ZA 2EMTA 1EWYC 1D3ZA 3WAMA 4EEWA 4ZOHC 1K51A 3N32A 3RT3B 2L1AA 2UU7A 3AB5A 1I4RA 3I63C 2ZPNA 2IY1B 1MFWA 3GZNI 4MM3A 3ETRA 2IGDA 4MELA 1L4DB 3APFA 2Y5BB 3Q2AC 1ESFA 3O65B 3LB8C 3PREA 3AE9B 3AE2B 1VZ7A 1EWCA 2KD0A 2UYZB 4UDUC 1GUAB 4MM3B 1XF5L 3LXFA 2LVPA 3NZSA 3PZ7A 4KKJA 5D7GA 1WGHA 4A6QA 3I5JC 4AJWA 1ET6A 3EA6A 5IN7A 3L4PA 3EC8A 1STEA 3PZ8A 2L7RA 1ZP0B 4YWGG 3SU8X 4B0MA 3SFEB 5KHQA 3VTUA 4TV3A 3DBSA 4BFRA 1C79A 3AE1B 2KTRA 2J7QB 1WM2A 1ZKHA 2JVCA 3RI7C 4P7IA 3W5UB 5CTRC 1RFKA 3ZJTA 4JL9A 3DHIC 5HFYA 4L23A 3PZDA 4JWSC 4X57B 4DHZB 5D94A 2N9EB 2KTRB 4WQMA 4FA6A 2DWQA 2N4FA 1R4NI 2BKFA 2BYTA 5J18A 4JPSA 1UWXA 1WGDA 4AQ7A 5JH5C 4HCPB 3RPFC 1NBFC 5C1ZA 3PHWB 1CK1A 4CYEA 1OFFA 2BTEA 3S2AA 1NENB 3B2FA 4W9GA 4LNNA 2YVCA 3BY4B 4US9A 5G2NA 2IZVB 2KDFB 4I6PA 2WU5B 2GBKA 2GI9A 3MP9A 2WDVB 4WIPA 2DENB 2KX3A 5E6PA 4W9JA 3W1SA 2KVZA 5AUIA 1DOXA 2H88B 1TS3A 5BMIA 3Q8AA 3P2BA 3HIZA 4ACFA 3BINA 1P3QU 4NNJB 2AYOB 1V1PA 2V0GA 5CX3A 2LJIA 1MPEA 1YN3A 5KHOA 2JZ3B 1ZXIA 4LCDE 2C7NB 4C80A 1IP9A 2KTFA 3ZJUA 3VH4B 3ZW3A 3DWMA 2DAJA 3UF8A 1JALA 1YQ3B 4HKZE 2TSSA 1XEEA 2FIDA 3I9V1 3RMKC 2V3NA 5TSSA 2DHZA 1V1PB 2AX5A 2MEKA 1XLPA 4FLHA 2JRHA 3OLMD 2IJ0A 4DXAB 4GXBA 4NPNA 3VRBB 4RF0A 2N1VA 1WXQA 1PFDA 2KJHB 2WXLA 3OJ3A 3Q8EA 2LJ5A 2KACA 4OW0A 1FIQA 3DQVA 3UINB 3AU5A 4ICVA 1XD3B 2LGDA 1F52A 1YMHE 1E8WA 3RFZB 3P4PB 4WWPA 1HEZE 1C76A 3ZGZA 3V6EB 4JLCA 1VRAB 1YQ4B 4ICUA 3JYUA 3WCQA 1A5RA 2BS4B 1IBXA 1L2NA 5H8YE 4ZRQA 4RM8A 3PT2B 1FXAA 1E6EB 2WX0A 2PE6B 2K25A 1NYRA 2K8HA 2KLCA 2L76A 1RAXA 4DXGA 1T0SC 2FCQA 4JQWC 3H6NA 2Y5CA 4R3DA 4XZ4A 4OZBA 3QX1A 1RRBA 1BUIC 1IBXB 1NYQA 2RSUA 4HCNB 1AW7A 3FC4A 4DDID 5FR3A 4PS3A 2GLSA 3DOWA 2K6QA 2O2VA 5BMHA 1S3SG 2HJ8A 1WXAA 1D5MC 2J0KA 1P7FA 3U7DA 2N9KA 1SJED 1J7CA 3ZXRA 4ZHPA 2ZNVC 2QIEB 4JX1C 3C19A 1E90A 1WX7A 2JRIB 2AEHA 4HVBA 5IA7A 3L54A 4A20A 3V62A 3AH7A 2KJ6A 4IWPA 3ZLZA 2CS4A 1SIFA 2W54A 4ANWA 4FJYA 1Z2MA 2WXOA 1PGBA 3X0WA 1TTNA 2K5PA 3Q6BA 2DLBA 2HD5B 4K7UA 4W9KA 3ALBA 3JSVA 3P4SB 4RH6A 1UELA 3WALA 5DPTA 4AUQC 1F2RC 4G11A 4I6NB 3W9CB 1FCLA 3RUIB 2FCNA 2YEPF 3P42A 2W82A 4XDCA 4JE3B 2K8CA 3RN9C 4TQ1A 3JSVB 2K39A 1UGJA 2MW5A 4F7ZA 1XCTL 1GB1A 1VCBA 1C78A 4HROA 2KDMA 1J19A 2ZCCA 3VUYA 2O6VD 1LGRA 3NJTA 1EF1A 4C4VA 3ZRFA 4HJKA 1E8YA 4KGSA 3A33B 4C7YA 1FD6A 3ZUNA 2KZRA 3APDA 3W5VB 2KWVB 3ZNZB 3CWIA 2UWQA 1T5XD 3UIPB 2FAZA 2WU2B 2C7MB 2PLPA 5BYQA 3KUDB 4N9F4 1WMHA 3UI3A 5E6OA 1I42A 2J42A 4KIKA 1V86A 2REXA 4XWTA 3UQBA 1YIWA 3VXWA 2WLBA 2LRWA 2MQJA 4ZYNA 3AE8B 5AZHA 2A4ZA 1FRDA 2C60A 2LASA 3Q8CA 2MA9B 1WMHB 4DBGA 4HPMB 4KIKB 2LHEA 4HJGE 1CMXB 2M56B 3PLUA 2Q5WD 5BO4B 3NVVA 1YX6B 2RR9A 3BWUD 2RDHA 1QT9A 4BOSC 2D3BA 2MJEA 2SAKA 4O1NA 2CHZA 2QILA 2DYMA 1WJ6A 1QKZA 3ZYYX 1BT0A 3TIXA 2JF5A 2GBRA 4NQKE 1TY2A 2BS2B 2RDGA 1Q5WB 2WXGA 4NAWB 1TKYA 1JRPA 1P1AA 4TMAB 2V3SA 4MJSB 3N1XC 3CF6E 4BVUC 3TEZA 4B6WA 1WF9A 4GDKB 5JHBA 4F1SA 5JXVA 1FPYA 1KRHA 3VAWA 5D3IB 2KNBA 1UUPA 1VDVA 1E8XA 4HPPA 1FMAD 2KQSA 2LMCA 5C23A 1XT9B 1RWSA 2B76B 1Q10A 2OEDA 1J7BA 3RCZA 1EUVB 3ZRCA 2L0TA 4RGNA 3OG5A 4GGQA 5L95C 3BVZA 5IKCM 4EUTA 3TCAA 3VRAB 2ZW0A 5EE3A 2N1WA 5AZGA 1TKEA 2D5GA 2L3ZA 1GJZA 2DZJA 3VR9B 3NUHB 1SE3A 3O13A 1JROA 2INDC 4AOFA 3V60A 3QC8B 2ZVNA 1YX5B 2KHWB 2LXCA 2EKEC 1JW9D 4OVZA 2QMTA 1KLVA 3TJPA 3R66C 3L13A 4OVVA 3H7SA 1V8CA 1ZGUB 2IGHA 3CSTA 1WXVA 1GAQB 2I2YA 5GXGB 1WE6A 5FKAC 2CKHB 2XN9C 4BOZB 1IPGA 3OJ4B 3WAPA 3M62B 2KN4A 5J17A 3N30A 4M02A 2BYFA 3GS2A 4HKQA 2EELA 3TEWA 1FNWA 3TMPB 1JWUD 4BKGA 3PSEB 3HK0A 2MP2A 3DHGC 3P4RB 1MHXA 4LNFA 1EM7A 4RGOS 1V5TA 3I57A 2IO2B 3VDZA 4WAFA 2RGFA 4KDIC 1TS5A 1WJ4A 4W9HA 2W55A 1PUTA 3QJZA 1FCCC 1T3QA 4F8CB 2MCNB 3MHZA 2MP2B 2Z0EB 4PS8A 4OHJA 2WXFA 1I4QA 2ZJDA 1L0XB 2J4XA 2CJNA 4MH0E 2MX2A 3DVNU 2LD9A 4RFBA 2IDYA 1H8CA 2N7EA 1D6EC 1V5OA 2M17A 1TBEA 4NJ6A 2L83A 1IGDA 3H1UA 1SF0A 3SEBA 3A1QA 2KAJA 2OOBB 3ECIA 2KLGA 3UGBB 2NCNA 4D2KA 4ZRJA 2KKCA 1Q0WB 4BBNF 2KQ7A 4ANUA 5EDSA 1N60A 2KMCA 2FE8A 2M8SA 5CHFA 1WXSA 1FEHA 4IDIA 2ICIA 3AEBB 4HWIB 2K8BA 1DYQA 3ABVB 2GMIC 2CJOA 3A1QB 4S0RA 4Q2JA 4FULA 3W1SC 4JIOU 2KX0A 4XE0A 3Q69A 3WANA 3LJ3A 2GBJA 4CQNA 2NTSA 3OAWA 3DBRI 1GB4A 1WRIA 2GB1A 2CR5A 1SE9A 2R61A 3AE3B 2ZCBA 4CHKA 2G4DB 4RNAA 1J7AA 4E74A 4N6EB 2K0PA 4TUUA 2MBBB 1ZE3D 2D2QA 1F77A 3T8MA 1VJKA 2Z8LA 4FN2A 3PO0A 2Z0DB 1N62A 5TR5A 2XNAC 2KJRA 5LXIB 4G0NB 1LFDA 1NI2A 4M01A 3APCA 2INNE 4G50A 1DGJA 1WY8A 2WHIA 1EU4A 3SD5A 1V2YA 1GC6A 1I4GA 3N9YC 3PHXB 2BYVE 3NY5A 1LO5D 3GE3C 4B9KA 4TQ0A 2FIFA 2DX5B 2CHWA 2G4SA 5BYRA 2GBMA 3EFCA 3GE8C 2FUHB 1SBBB 2W3RA 2V9HA 4E71A 4LK0M 1Y56A 3AV8A 3BZDB 3BVGA 4LJOB 1XXGA 1WX9A 1WX8A 2IPKD 4IKGA 1QILA 2DZMA 4XWWA 5G55A 2KFJA 3GZNB 2BB5A 2MJDA 3IAS1 5H92C 2MBOA 4FXCA 3R8BA 1WFYA 2FNJB 2J52A 4WJQA 4HK2A 3TSSA 4KGRA 2BS3B 3DDCB 3RZWC 2QC8A 3AULA 3MFGA 4P1BC 1UD7A 3TBLD 1UZXB 2LFIA 4EFOA 4GMVA 1GOZA 3OWEB 1GG3A 3SFDB 1N61A 1JMLA 3Q8FA 1YNTE 4K1RB 3QIJA 1F2RI 2KC2A 3VTVA 1WIAA 3U7ZA 2KWDA 3KUCB 1GPXA 1ACCA 3AE6B 1I7HA 2C9WB 1PGXA 2IBIB 4M00A 3Q3JA 4BBNC 5LLIA 4IC7B 1JWAD 3VTWA 1YN4A 1KLGD 4GLSC 3SR6A 1VR9A 3H7PA 4FBJB 2PJHA 3DBHI 1UH6A 4P6VF 1V6EA 1R4NB 3TUOA 4XGAB 1VZ8A 5HI1A 4W9DA 4YL8A 2ONQA 3H7PB 1E7VA 4RM9A 4W9CA 2PTLA 1FM0D 5AZFA 2QHOA 3RNBC 2G1EA 4KV2A 4FADA 1TYGB 4DXFA 2N9LA 3JVZX 3AEAB 2E3TA 2G45B 3W2DA 1ZUD2 4AJYB 1C4PA 2Y5PA 4IOIE 3NS8A 3PRZA 1DOIA 3IBEA 3I3TB 1P9DU 2JYEA 2N9PC 4GSWA 1E8ZA 3HM6X 1QF6A 4BKTA 2BW2A 1L5PA 2KYWA 2RD0A 3DBLI 3KW5B 2MH7A 3MHSD 4B95A 1C1YB 2R2QA 4MSQB 1ZOYB 4J3OD 3M63B 5FK9C 1T0QC 3PGEA 3B9JA 3AEGB 4GOCA 2NPTB 2WXNA 3U4EG 4GN1A 4DHZE 4P16A 2ACZB 2ZNVB 4KX6B 5LNK1 3U52E 1TJEA 2KANA 2JUOA 4I6LB 1C4AA 4GDLA 4ZDVA 1OQYA 2JX5A 3RULA 2BT6A 1YOVB 2R2OA 2HE7A 3HM3A 1HZ5A 4IG7B 5D3DA 5I4DA 2VH1A 2M0XA 1WH3A 2WXPA 3KWLA 3PPAA 4GDLB 3DVNV 2MLBA 1R4MI 2O6VA 2LI5A 2BKRB 3PRPB 1WR1A 2KOXA 2MBEA 4NJCA 2LGSA 3AEDB 1TZOA 4L2YA 2L8JA 1LXDA 2VZKD 1V49A 2D07B 1XCQL 1MG4A 2O6VB 2WDRB 3Q3MC 1YQBA 2AQ1B 1ET9A 2DZKA 2XEWA 3HRDD 2WXRA 2KQ4X 3RNCC 2J0MA 1TY0A 1DOYA 1C9FA 2GOWA 3IG3A 4GIVA 2WX1A 2GBNA 2M0AA 3ZO5B 1E7PB 4PK1A 4TKNA 3CIRB 1TKGA 4HXDA 4NAWA 3P1MA 2PVOD 2QJLA 3IFWB 4IM3A 1SGHA 2PKOA 2IYDB 4MJSA 2BWES 3QHTA 2MBQA 4GDKA 2B3AA 1V9JA 3T3OA 4DHJD 3HVZA 2W3SA 1XLOA 2J0JA 3H8HA 3N3KB 1A70A 3ONSA 3R7RA 1NI3A 2LHDA 4HDQA 3ZTCA 3AE4B 3MTNB 4M8MA 5AUKA 2VZKB 3URYA 4W9EA 1F1HA 4IW0A 4YT0B 1ENFA 1SSNA 2K1FA 3VH3B 1YJ1A 2M19A 2NBVB 4EKUA 1ISNA 5HKHA 3PRMB 3NOBA 2AQ3B 4TSSA 4EE2A 2MHJA 1V97A 5G5GA 2VH2A 2BWFA 2PMVA 5EE0A 3PV1A 2WXMA 1AARA 4DWFA 4KKIA 5JHAA 3DHHC 2ZPYA 4IWQA 2NVUI 4G3XB 5E6NA 4RCOA 3VR8B 2IO3B 3BK2A 4FJZA 4DHJB 3E9SA 3PS6A 1T0YA 4K81A 3E56A 1MHHE 1I4PA 1SXTA 4GU2A 2NBUA 1FRRA 1K52A 2GRIA 2KDIA 3JW0X 2HTME 3AXCA 3MC8A 2FCMA 5AEKB 3C0RB 3AMZA 4A8XC 1UBQA 2JU6X 1TZ1A 4HPLB 1HXYD 3KWVA 3EFUA 3M3JA 1FNVA 2IO1B 3Q14C 4LTUA 4DQOC 1JRUA 2MJ3A 2YLMA 4XDDA 1J8CA 2BPSA 2KC1A 5CHVC 4E3CA 3IAM1 1SJHD 3R3MA 3NVZA 4ZRKA 4NY0A 3ZNID 1YN5A 4K7SA 3EGRA 1C3TA 1WYWB 1B9RA 1I4XA 1NDDA 2HDEA 1VZ6A 1FNUA 4URKA 2INCC 2OJWA 2N0SB 1SB3C 1N5XA 2YEPB 1WXMA 4A55A 1T0RC 2OHFA 3W1YA 1UBIA 2FUG1 5BYSA 2JT4B 2K3UA 1E0ZA 2LWPA 2RDBC 1D5ZC 2BQQA 3KVFB 1I35A 5IO9A 4MH8A 2Z59B 3HUIA 4WQOB 1K53A 3A9JB 3R2IA 4MACA 3KLSX 2G9HD 2V1YA 2NR2A 2C5LC 2N9XA 2WNMA 2KO3A 2V4LA 1SIJA 4OZAA 4B0EA 2FBWB 1NEKB 1RM6C 3IXSA 4FJVB 1ZDVA 2H89B 1E7UA 4A90A 4PYZA 1EF5A 4MSMB 4KSKC 1J0GA 4KDLB
chains in the Genus database with same CATH topology
1ZXHA 2WS3B 2LFIA 3J9CA 1ROEA 1F0ZA 1GOZA 1L6VA 3OWEB 4ARIA 5T8IA 3SFDB 1N61A 4YSYB 1WSPA 1JMLA 3Q8FA 4PT5A 4YTMB 4KGSA 1YNTE 3ZJVA 3BYYB 1F2RI 1PYWD 4C7YA 2E6XA 1FD6A 3MC0B 1WWTA 2KWDA 3NVYA 3U7ZA 5EE9A 1ACCA 1L0YB 3AE6B 1GPXA 1I7HA 1WYGA 1PGXA 3W5VB 2J53A 1E10A 4L1BA 1JWAD 1B1ZA 1QOFA 3CWIA 1SE4A 1YN4A 1T5XD 1KLGD 2V4IB 1AN8A 4GLSC 4JWUC 3R2TA 1QLBB 3SR6A 1VR9A 4ZRPA 3HVDA 1TS2A 1D5XC 5E6JA 2WU2B 1JWSD 1KFYB 4P6VF 1XO3A 2PLPA 2WXJA 5BYQA 4ARCA 3TUOA 4WURA 2NTTA 1VZ8A 3UI3A 2DYOA 5HI1A 1IGCA 2J42A 1HQRD 1QOAA 3BIID 4XWTA 3FILA 2JQRB 4YSZB 2ONQA 2WLBA 2WXHA 1OQRA 2WP9B 1PGAA 4YTPB 2PTLA 1T6BX 3AE8B 1FM0D 1FFUA 1PDXA 4YXDB 1FRDA 2BB6A 2G1EA 4NAMA 1JQ4A 2LEKA 1TYGB 3NS1A 4DXFA 2N9LA 3Q8CA 4US8A 2ON8A 1N5WA 1XLQA 4ZYSA 3AEAB 4RGTA 3AM9A 2K9XA 1AWDA 2E3TA 3Q8BA 4RGMA 2LHEA 4HJGE 3FILB 3W2DA 1ZUD2 1FO4A 2KMMA 2M56B 1C4PA 1EWYC 2WXQA 2Q5WD 2Y5PA 4IOIE 4ZOHC 3NVVA 1K51A 1QOGA 1FXIA 1DOIA 1KLUD 3BWUD 2L1AA 1QT9A 2RDHA 3AB5A 2MJEA 2SAKA 1I4RA 2JYEA 3GP7A 4O1NA 2QILA 2DYMA 1QF6A 3BVMA 3ETRA 1QKZA 3ZYYX 2IGDA 2BW2A 1L5PA 1L4DB 2JSVX 2L32A 1ESFA 2IGGA 3AEEB 3BK1A 1N63A 3LB8C 3AE9B 3AE2B 1VZ7A 1EWCA 3ZQ4A 2MH7A 1TY2A 2BS2B 2RDGA 3DWGC 2WXGA 4NAWB 1ZOYB 1TKYA 1JRPA 4TMAB 4J3OD 4UDUC 4MM3B 1XF5L 1EU3A 3LXFA 3PZ7A 5D7GA 4KKJA 5FK9C 4A6QA 4GDKB 3TEZA 1D4BA 5JXVA 1ET6A 3B9JA 1YJIA 3EA6A 3AEGB 1KRHA 5D3IB 3L4PA 2WXNA 3B2GA 3U4EG 1STEA 1UUPA 3PZ8A 1VDVA 1ZP0B 1FMAD 4P16A 4YWGG 4B0MA 2ACZB 3SFEB 3GB1A 3V3XA 2LMCA 1RWSA 4KX6B 5LNK1 2B76B 1Q10A 3U52E 1C79A 1E9MA 3AE1B 2OEDA 1TJEA 1J7BA 1C4AA 3EUB2 4RGNA 2JX5A 3W5UB 1JWMD 1RFKA 4YTNB 2RMMA 3AECB 3BVZA 4NZLB 2NMQA 2BT6A 3ZJTA 3LYYA 3VRAB 2ZW0A 4WH4A 5EE3A 2LUMA 2INPE 2JWUA 1HZ5A 5HFYA 1TKEA 5D3DA 4L23A 2N7JA 2D5GA 5I4DA 2JXTA 4JWSC 2WXPA 4H2AA 3VR9B 3KWLA 3NUHB 1SE3A 3O13A 4ZHOA 1JROA 1L6UA 2I38A 4WQMA 4WWMA 2DWQA 1RYJA 2WQYB 4GDLB 5HHDG 2BYTA 4C56C 1JW9D 1UWXA 4JPSA 4OVZA 2QMTA 5EE1A 1CQVA 4AQ7A 1L0VB 3RPFC 4NJCA 1V8CA 1CK1A 2BTEA 1OFFA 3AEDB 1HZ6A 1TS4A 2IGHA 1MVKA 1NENB 3B2FA 1TZOA 4L2YA 4A9AA 2VZKD 1GAQB 2WDQB 2I2YA 5GXGB 4OZCA 4US9A 1XCQL 5FKAC 2XN9C 2WU5B 2WDRB 3P4QB 2V3PA 2GI9A 2KN4A 3MP9A 2WDVB 4WIPA 2AQ1B 1ET9A 3HRDD 2WXRA 2KQ4X 2L52A 3GS2A 4N59A 3W1SA 1TY0A 5AUIA 1DOXA 4HKQA 1C9FA 2H88B 1DOYA 3FAHA 1TS3A 5BMIA 3Q8AA 2EELA 3TEWA 1ZPSA 1FNWA 2M0AA 3P63A 4MT5A 3IT4B 1E7PB 1JWUD 3CIRB 1V1PA 1TKGA 4C7ZA 2V0GA 2LJIA 3NVWA 1MPEA 3P4RB 1YN3A 1MHXA 1KH0A 3P1MA 1EM7A 2PVOD 2QJLA 4RGOS 1ZXIA 4C80A 2PVGC 1ZDXA 3ZJUA 2PKOA 2RPVA 3I57A 3DWMA 4WAFA 1UWMA 5BMGA 1JALA 5MPOA 3T3OA 1TS5A 1YQ3B 4HKZE 2TSSA 1XEEA 3HVZA 4LLGM 5C3JB 2W55A 1PUTA 3I9V1 1FCCC 2V3NA 2W3SA 1T3QA 1XLOA 4KGTA 5TSSA 4HRSA 1V1PB 3MHZA 3H8HA 2AX5A 2MEKA 1A70A 2K22A 1XLPA 1NI3A 2LHDA 4OHJA 1CZPA 3AE4B 1HA5A 1YJJA 2WXFA 2IJ0A 1I4QA 3AE7B 5AUKA 1XLNA 2VZKB 4RF0A 3URYA 1WXQA 1L0XB 1PFDA 2WXLA 3VRBB 3Q8EA 2J4XA 2CJNA 4YT0B 1BMLC 2KACA 2WXKA 4OW0A 1ENFA 1FIQA 4RFBA 1SSNA 2QEJC 2IDYA 1D6EC 3NRZA 1BXTA 1YMHE 2L83A 1IGDA 2M19A 1SF0A 3TEYA 1WGKA 3RFZB 3P4PB 3SEBA 2KAJA 4YSXB 2AQ3B 1HEZE 1C76A 2WXIA 4TSSA 3ZGZA 4D2KA 4EE2A 1V97A 5G5GA 1SE2A 4USAA 1VRAB 1YQ4B 2EKIA 3WCQA 1N60A 2FE8A 2PMVA 2BS4B 5EE0A 2QSDA 1FEHA 1IBXA 2WXMA 4IDIA 3V05A 2JYTA 2ICIA 4KKIA 2LGIA 3AEBB 5H8YE 1AYFA 2X38A 4ZRQA 2DBYA 1I4HA 1FXAA 1E6EB 1DYQA 3ABVB 2CJOA 4RCOA 4N58A 1NYRA 3VR8B 3BK2A 4Q2JA 3MJ5A 2JZPA 3E9SA 4DXGA 1QQRA 3E56A 4XE0A 1MHHE 1KF6B 2Y5CA 1I4PA 4R3DA 1SXTA 4OZBA 3BYTB 3Q69A 2BBCA 1BUIC 1FRRA 1IBXB 1K52A 5G5HA 1NYQA 2GRIA 1UNSA 5HG2A 4CQNA 2SEBD 1AW7A 1KTKA 2NTSA 3AN1A 2HTME 3FC4A 5FR3A 1GB4A 1WRIA 2GB1A 3AMZA 1IUEA 4A8XC 5BMHA 2JU6X 1HXYD 3KWVA 1D5MC 2PIAA 1P7FA 2R61A 3AE3B 2N9KA 4RNAA 1FNVA 4LTUA 1J7AA 1SJED 2ZW1A 3NZ3A 4M0WA 3VQIA 4DQOC 4N6EB 2K0PA 2AQ2B 1JCKB 2MJ3A 1J7CA 4XDDA 1CJEA 4ZHPA 2QIEB 1ZE3D 2PW9A 4JX1C 5C2TB 3IAM1 1SJHD 1F77A 3NVZA 1YN5A 1VJKA 2Z8LA 3EGRA 1C4CA 4REZA 3PO0A 1N62A 1B9RA 1I4XA 3AH7A 2XNAC 2HDEA 1VZ6A 1FNUA 1L4ZB 2N0SB 1SB3C 2INNE 1DGJA 2W54A 1N5XA 2YEPB 1EU4A 4A55A 2OHFA 3IT6B 4HEA1 2WXOA 2FUG1 5BYSA 1K50A 1MI0A 2K3UA 1E0ZA 1I4GA 1PGBA 3N9YC 1D5ZC 1LO5D 3KQ4A 4AS1A 2K5PA 3AEFB 2DLBA 4TQ0A 3U2SC 3AE5B 3P4SB 3TEXA 4RH6A 5BYRA 4MH8A 3HUIA 1SBBB 2W3RA 1K53A 3R2IA 1F2RC 4MACA 4LK0M 1Y56A 3AV8A 3BZDB 3KLSX 3BVGA 3W9CB 1NVID 2G9HD 4RF1A 3C8YA 1FCLA 1R7SA 1XXGA 2IPKD 2YEPF 1OQQA 1FFVA 2W82A 1QILA 3P42A 4IKGA 1M4VA 4JE3B 4XDCA 4XWWA 2WNMA 1P7EA 1QOBA 1SIJA 4OZAA 4B0EA 2BB5A 2MJDA 4TQ1A 2FBWB 1NEKB 1RM6C 3IXSA 1ZDVA 3IAS1 1SEBD 5H92C 2CU3A 4FXCA 3R8BA 1V1OA 1UGJA 2H89B 2J52A 2Y3AA 1GB1A 1XCTL 3T3NA 3TSSA 4KGRA 4A90A 1JWBD 2BS3B 1C78A 4HROA 2KDMA 4ITKA 1C77A 3MFGA 1VLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L5P A;  2HTM E;  2L52 A;  3AN1 A;  3FC4 A;  4N59 A;  2WS3 B;  3AEE B;  5AUI A;  1DOX A;  1DOY A;  1N63 A;  2H88 B;  1WRI A;  3FAH A;  3LB8 C;  3AE9 B;  3AE2 B;  3AMZ A;  1IUE A;  2MH7 A;  1ROE A;  2BS2 B;  3P63 A;  3DWG C;  1E7P B;  1F0Z A;  1L6V A;  1ZOY B;  3CIR B;  1TKY A;  1JRP A;  1TKG A;  3SFD B;  2PIA A;  1N61 A;  3AE3 B;  4C7Z A;  3NVW A;  4YSY B;  3P4R B;  3P1M A;  4LTU A;  1J7A A;  2PVO D;  2QJL A;  3LXF A;  4YTM B;  1ZXI A;  4N6E B;  2MJ3 A;  1J7C A;  4C7Y A;  2PVG C;  4C80 A;  3B9J A;  2PKO A;  1CJE A;  1YJI A;  4ZHP A;  3AEG B;  3DWM A;  2QIE B;  4JX1 C;  1KRH A;  5C2T B;  1UWM A;  1WWT A;  1JAL A;  3NVY A;  1GPX A;  3L4P A;  3AE6 B;  3B2G A;  5EE9 A;  5MPO A;  1YQ3 B;  1I7H A;  3NVZ A;  1WYG A;  1VDV A;  3W5V B;  1VJK A;  3HVZ A;  1ZP0 B;  1FMA D;  1E10 A;  5C3J B;  2W55 A;  1PUT A;  2ACZ B;  3PO0 A;  3SFE B;  1JWA D;  1QOF A;  2W3S A;  1T3Q A;  1N62 A;  1XLO A;  3CWI A;  1RWS A;  4HRS A;  4KX6 B;  1B9R A;  3AH7 A;  2B76 B;  4JWU C;  2AX5 A;  1E9M A;  1QLB B;  3AE1 B;  1A70 A;  1J7B A;  1TJE A;  2K22 A;  3SR6 A;  1XLP A;  1NI3 A;  1CZP A;  3AE4 B;  1YJJ A;  2WU2 B;  3EUB 2;  1KFY B;  2N0S B;  2JX5 A;  1SB3 C;  1DGJ A;  2W54 A;  1N5X A;  1XLN A;  1XO3 A;  3AE7 B;  4P6V F;  5AUK A;  1RFK A;  1WXQ A;  1PFD A;  4YTN B;  3VRB B;  2OHF A;  3AEC B;  2CJN A;  4YT0 B;  2BT6 A;  3VRA B;  1FIQ A;  5EE3 A;  1E0Z A;  1TKE A;  1QOA A;  3BII D;  4JWS C;  2JQR B;  5H92 C;  3NRZ A;  2K5P A;  3AEF B;  3VR9 B;  2WLB A;  3KWL A;  4YSZ B;  4ZHO A;  2L83 A;  1JRO A;  1L6U A;  3AE5 B;  3P4S B;  2M19 A;  4WQM A;  1OQR A;  1SF0 A;  2DWQ A;  1RYJ A;  2WQY B;  2WP9 B;  4WWM A;  1WGK A;  3HUI A;  3P4P B;  4YTP B;  3AE8 B;  1FM0 D;  2W3R A;  1FFU A;  2KAJ A;  1PDX A;  4YSX B;  1JW9 D;  5EE1 A;  4YXD B;  1FRD A;  2G1E A;  1V97 A;  3AV8 A;  2LEK A;  1TYG B;  3NS1 A;  5G5G A;  3W9C B;  1NVI D;  1JQ4 A;  4USA A;  1L0V B;  1R7S A;  1YQ4 B;  2EKI A;  1N5W A;  1XLQ A;  4US8 A;  3AEA B;  3RPF C;  3WCQ A;  1N60 A;  2BS4 B;  1AWD A;  1V8C A;  2K9X A;  1OQQ A;  1FFV A;  2E3T A;  1OFF A;  3AM9 A;  5EE0 A;  3AED B;  4IDI A;  1NEN B;  3B2F A;  1QOB A;  1SIJ A;  3AEB B;  5H8Y E;  1AYF A;  1ZUD 2;  2DBY A;  2MJD A;  1FO4 A;  2FBW B;  1NEK B;  1FXA A;  1E6E B;  1EWY C;  1RM6 C;  2KMM A;  2M56 B;  2Q5W D;  4A9A A;  1GAQ B;  4ZOH C;  2WDQ B;  3NVV A;  1QOG A;  3ABV B;  2CU3 A;  3HRD D;  1FXI A;  5GXG B;  2CJO A;  4US9 A;  1DOI A;  4FXC A;  4N58 A;  1NYR A;  2H89 B;  1QT9 A;  3VR8 B;  3W5U B;  2WU5 B;  1JWB D;  2MJE A;  2BS3 B;  2WDR B;  3AB5 A;  3P4Q B;  4HRO A;  4ITK A;  1KF6 B;  2Y5C A;  2WDV B;  1QF6 A;  3ETR A;  1FRR A;  5G5H A;  1NYQ A;  3ZYY X;  1VLB A; 
#chains in the Genus database with same CATH topology
 4AP4 C;  1ZXH A;  3ML8 A;  4WJN A;  3J9C A;  2FCS A;  2QCZ A;  1ROE A;  1FXT B;  4ARI A;  5T8I A;  3CSF A;  3B1L X;  3ZTD A;  4PT5 A;  2JPH A;  3H9D A;  1HTO A;  5D6J B;  1PYW D;  4ZRI A;  1S1Q B;  1WWT A;  3NVY A;  3NZU A;  5EE9 A;  1L0Y B;  2JZZ A;  1UGM A;  2J53 A;  3HHM A;  4L1B A;  1B1Z A;  1QOF A;  1SE4 A;  4WWO A;  2V4I B;  4JWU C;  1ZW7 A;  1QLB B;  3NG0 A;  1TS2 A;  4MGK E;  1D5X C;  5E6J A;  1JWS D;  5D2M B;  4ARC A;  3KYD D;  5IP4 D;  3V61 A;  4II2 B;  4MDK E;  1HQR D;  4M8N A;  2QDF A;  3FIL A;  2AL6 A;  2L00 B;  4YSZ B;  2LZ6 A;  2NS5 A;  2WXH A;  1PGA A;  4LJP B;  4YTP B;  2BGF A;  5DPW A;  2BB6 A;  3DCG A;  3B08 A;  2D10 A;  2LEK A;  4PYU A;  3NS1 A;  1JQ4 A;  4US8 A;  2ON8 A;  3QCA A;  1XLQ A;  4ZYS A;  3AM9 A;  2K9X A;  1YD8 U;  3Q8B A;  2LVQ A;  4RGM A;  3FIL B;  1FO4 A;  2KMM A;  2WXQ A;  2L0F A;  1QOG A;  4PS7 A;  1FXI A;  2I1K A;  1KLU D;  2AWT A;  2ZEQ A;  3VUW A;  3GP7 A;  3VUX A;  5L83 A;  2G3Q B;  4EOY A;  3BVM A;  3TL5 A;  1KM7 A;  4LDT D;  1WM3 A;  2JSV X;  3WAO A;  2L32 A;  2IGG A;  3AEE B;  3BK1 A;  1N63 A;  3N1Y C;  3UQA A;  4NQL B;  3KYC D;  3ZQ4 A;  4HLE A;  3DVG Y;  2ASQ A;  4ANX A;  3DWG C;  1WI0 A;  1EU3 A;  4MGY E;  5DPR A;  2DZI A;  1D4B A;  1YJI A;  3B2G A;  2JWZ A;  3GB1 A;  3V3X A;  1F9J A;  1L7Y A;  3AI5 A;  3L16 A;  1E9M A;  2XBB C;  3EUB 2;  2KWU B;  1JWM D;  4YTN B;  2LGX A;  2RMM A;  3AEC B;  4NZL B;  2NMQ A;  3LYY A;  5DPS A;  4WH4 A;  1RFA A;  2LUM A;  2INP E;  2JWU A;  2CHX A;  2N7J A;  2JXT A;  5DCN A;  3WA0 A;  2WYQ A;  4H2A A;  2M4N A;  2KWC A;  4ZHO A;  1L6U A;  2I38 A;  1WZ3 A;  4WWM A;  4LDT B;  1RYJ A;  2WQY B;  1HTQ A;  5HHD G;  2MBH A;  4C56 C;  2KMA A;  5EE1 A;  1CQV A;  5FR6 A;  1L0V B;  1WGG A;  4XX5 A;  4KSL C;  1TGZ B;  1HZ6 A;  1TS4 A;  4GB9 A;  1MVK A;  4LNK A;  1U4A A;  4A9A A;  1PQS A;  1WRD B;  2WDQ B;  3ZIM A;  4KVG B;  1V81 A;  4OZC A;  3A4S C;  1WE7 A;  3DBR B;  3P4Q B;  1WJU A;  2V3P A;  3SHQ A;  2RPQ A;  4FHJ A;  2L52 A;  4N59 A;  2LXA A;  2O2V B;  2EMS A;  3FAH A;  3RNA C;  2MWS B;  3N20 C;  1ZPS A;  3L17 A;  3P63 A;  4MT5 A;  3IT4 B;  2D11 A;  3MJW A;  4QAY A;  3B0A A;  3Q3O C;  4A3P A;  4C7Z A;  3NVW A;  5IOI A;  1KH0 A;  2IY0 B;  5IAA C;  2VRR B;  3ZVV A;  2LGY A;  2PVG C;  1ZDX A;  2RPV A;  1UWM A;  2CU1 A;  5BMG A;  1KOT A;  3ZXV A;  3T9L A;  5MPO A;  3ZKJ C;  3NHE B;  3VVW B;  2NPT A;  4LLG M;  3KH0 A;  5C3J B;  4IWO A;  4KGT A;  3VHT C;  3A9K A;  2KFK A;  3MC9 A;  4HRS A;  3X23 A;  4J6I A;  1IYF A;  2K22 A;  1CZP A;  1LQB A;  1HA5 A;  1YJJ A;  3Q3N C;  1RLF A;  1GNU A;  4LNI A;  3K9P B;  3AE7 B;  1XLN A;  4WJO A;  2JXX A;  2NBW B;  1BML C;  2DAF A;  2WXK A;  4CO7 A;  2QEJ C;  2AL3 A;  4HDO A;  3CMM B;  3QAQ A;  3A9K B;  2KFK B;  2ZZP B;  3NRZ A;  1BXT A;  3V6C B;  1EO6 A;  4KZ0 A;  4KZC A;  3ZDT A;  3TEY A;  4FHK A;  1WGK A;  3ZNG C;  3RZF A;  4EZL A;  3U30 A;  4YSX B;  2HJ1 A;  2LRU A;  2WXI A;  2BYE A;  5J2R A;  1SE2 A;  4USA A;  2EKI A;  3RNG C;  1VD2 A;  1X1M A;  2QSD A;  2LVO A;  3V05 A;  2JYT A;  3N1Z C;  2LGI A;  4W9I A;  1AYF A;  4ASW C;  1G6J A;  2X38 A;  2DBY A;  3QAR A;  1I4H A;  1TIF A;  2D3G A;  4JGH B;  3DPD A;  1MJD A;  4N58 A;  3MJ5 A;  4II3 B;  2JZP A;  4EZK A;  1QQR A;  2DNF A;  2LUE A;  1KF6 B;  2L05 A;  3BYT B;  2BBC A;  2BVC A;  5G5H A;  2WGS A;  1UNS A;  5HG2 A;  2SEB D;  1KTK A;  4C4V B;  4K7W A;  3AN1 A;  2D3C A;  1OTR B;  4WWN A;  4P1C C;  1IUE A;  4NJ7 A;  4OVU A;  3ML9 A;  3PVL A;  1K8R B;  2PIA A;  4IUM B;  1TT5 B;  1QZE A;  3NZ3 A;  3VQI A;  2ZW1 A;  4M0W A;  1P98 A;  3DVG X;  2AQ2 B;  1JCK B;  3ENE A;  1CJE A;  1MG8 A;  2PW9 A;  5C2T B;  4IM2 A;  3RD2 A;  3ZNH B;  2MRP A;  3D32 A;  3DBH B;  2W9N A;  4BKS D;  4K3B A;  4REZ A;  1C4C A;  3M95 A;  3QQ8 B;  3FKY A;  1WR6 E;  4IM0 A;  3KUZ A;  1Z5S B;  1XQQ A;  3A4R A;  4M0W B;  1L4Z B;  3Q3F A;  4S17 A;  1WJN A;  2KN5 A;  2XK5 A;  2MSE D;  5GMV A;  3IT6 B;  4HEA 1;  1K50 A;  2D3A A;  1MI0 A;  1GC7 A;  1UF0 A;  2JY6 A;  2KVR A;  2K6D B;  3KQ4 A;  4AS1 A;  3QA8 A;  4W9F A;  3AEF B;  4WJP A;  3U2S C;  3AE5 B;  3GOE A;  3LDZ E;  3TEX A;  3RNF C;  2PPH A;  3PTF C;  2IO0 B;  2WWZ A;  2XK5 B;  3ZDM C;  4BKS A;  4C00 A;  1NVI D;  4RF1 A;  3C8Y A;  1R7S A;  1OQQ A;  1FFV A;  1M4V A;  4WAA A;  1P7E A;  1QOB A;  4XC2 A;  2KT7 A;  1Q1O A;  1N6Z A;  1SEB D;  4AWJ A;  2CU3 A;  2WDT B;  4DDG D;  2X8X X;  1V1O A;  2BF8 B;  2Y3A A;  3RNE C;  2M1M A;  2A5U A;  3T3N A;  3DBL B;  1JWB D;  2PE9 A;  4DK5 A;  3EEC A;  4ITK A;  1KJT A;  1C77 A;  4EZJ A;  2KXJ A;  3L0W B;  4A3O A;  1VLB A;  1M94 A;  1HE8 A;  2C7H A;  4ANV A;  2WS3 B;  2N7D A;  3K9O B;  3PLV A;  1WZ0 A;  3L08 A;  3EHV A;  1F0Z A;  1L6V A;  4YSY B;  1WSP A;  4YTM B;  3AU4 A;  3ZJV A;  3RYT A;  1V80 A;  3BYY B;  4BZA A;  1P0R A;  2E6X A;  1H4R A;  1LM8 B;  3MC0 B;  5CHW A;  3IVF A;  1WYG A;  4BAX A;  4RMA A;  4XYC A;  1E10 A;  4MGI E;  1WGY A;  3UIO B;  1OEY J;  2KDB A;  1AN8 A;  3R2T A;  2PEA A;  4ZRP A;  3R7Q A;  3HVD A;  3WIM A;  1KFY B;  1XO3 A;  2WXJ A;  4MGZ E;  1OGW A;  4WUR A;  1R4M B;  3L10 B;  2NTT A;  2DYO A;  2OJR A;  1IGC A;  2I1J A;  1QOA A;  3BII D;  1WGR A;  2JQR B;  1E5W A;  4MEM A;  1OQR A;  5LXH A;  2WP9 B;  3QWZ B;  3QK0 A;  1T6B X;  1Y8R C;  4LNO A;  5JZE B;  1FFU A;  4W9L A;  1PDX A;  2ZVO A;  4YXD B;  3IHP C;  2DYB A;  4NAM A;  3VFK A;  3A9J A;  1N5W A;  4RGT A;  1AWD A;  2HTH A;  3SDL C;  4K3C A;  2KK8 A;  2KDE B;  1OEY A;  3U8Z A;  2EMT A;  1EWY C;  1D3Z A;  3WAM A;  4EEW A;  4ZOH C;  1K51 A;  3N32 A;  3RT3 B;  2L1A A;  2UU7 A;  3AB5 A;  1I4R A;  3I63 C;  2ZPN A;  2IY1 B;  1MFW A;  3GZN I;  4MM3 A;  3ETR A;  2IGD A;  4MEL A;  1L4D B;  3APF A;  2Y5B B;  3Q2A C;  1ESF A;  3O65 B;  3LB8 C;  3PRE A;  3AE9 B;  3AE2 B;  1VZ7 A;  1EWC A;  2KD0 A;  2UYZ B;  4UDU C;  1GUA B;  4MM3 B;  1XF5 L;  3LXF A;  2LVP A;  3NZS A;  3PZ7 A;  4KKJ A;  5D7G A;  1WGH A;  4A6Q A;  3I5J C;  4AJW A;  1ET6 A;  3EA6 A;  5IN7 A;  3L4P A;  3EC8 A;  1STE A;  3PZ8 A;  2L7R A;  1ZP0 B;  4YWG G;  3SU8 X;  4B0M A;  3SFE B;  5KHQ A;  3VTU A;  4TV3 A;  3DBS A;  4BFR A;  1C79 A;  3AE1 B;  2KTR A;  2J7Q B;  1WM2 A;  1ZKH A;  2JVC A;  3RI7 C;  4P7I A;  3W5U B;  5CTR C;  1RFK A;  3ZJT A;  4JL9 A;  3DHI C;  5HFY A;  4L23 A;  3PZD A;  4JWS C;  4X57 B;  4DHZ B;  5D94 A;  2N9E B;  2KTR B;  4WQM A;  4FA6 A;  2DWQ A;  2N4F A;  1R4N I;  2BKF A;  2BYT A;  5J18 A;  4JPS A;  1UWX A;  1WGD A;  4AQ7 A;  5JH5 C;  4HCP B;  3RPF C;  1NBF C;  5C1Z A;  3PHW B;  1CK1 A;  4CYE A;  1OFF A;  2BTE A;  3S2A A;  1NEN B;  3B2F A;  4W9G A;  4LNN A;  2YVC A;  3BY4 B;  4US9 A;  5G2N A;  2IZV B;  2KDF B;  4I6P A;  2WU5 B;  2GBK A;  2GI9 A;  3MP9 A;  2WDV B;  4WIP A;  2DEN B;  2KX3 A;  5E6P A;  4W9J A;  3W1S A;  2KVZ A;  5AUI A;  1DOX A;  2H88 B;  1TS3 A;  5BMI A;  3Q8A A;  3P2B A;  3HIZ A;  4ACF A;  3BIN A;  1P3Q U;  4NNJ B;  2AYO B;  1V1P A;  2V0G A;  5CX3 A;  2LJI A;  1MPE A;  1YN3 A;  5KHO A;  2JZ3 B;  1ZXI A;  4LCD E;  2C7N B;  4C80 A;  1IP9 A;  2KTF A;  3ZJU A;  3VH4 B;  3ZW3 A;  3DWM A;  2DAJ A;  3UF8 A;  1JAL A;  1YQ3 B;  4HKZ E;  2TSS A;  1XEE A;  2FID A;  3I9V 1;  3RMK C;  2V3N A;  5TSS A;  2DHZ A;  1V1P B;  2AX5 A;  2MEK A;  1XLP A;  4FLH A;  2JRH A;  3OLM D;  2IJ0 A;  4DXA B;  4GXB A;  4NPN A;  3VRB B;  4RF0 A;  2N1V A;  1WXQ A;  1PFD A;  2KJH B;  2WXL A;  3OJ3 A;  3Q8E A;  2LJ5 A;  2KAC A;  4OW0 A;  1FIQ A;  3DQV A;  3UIN B;  3AU5 A;  4ICV A;  1XD3 B;  2LGD A;  1F52 A;  1YMH E;  1E8W A;  3RFZ B;  3P4P B;  4WWP A;  1HEZ E;  1C76 A;  3ZGZ A;  3V6E B;  4JLC A;  1VRA B;  1YQ4 B;  4ICU A;  3JYU A;  3WCQ A;  1A5R A;  2BS4 B;  1IBX A;  1L2N A;  5H8Y E;  4ZRQ A;  4RM8 A;  3PT2 B;  1FXA A;  1E6E B;  2WX0 A;  2PE6 B;  2K25 A;  1NYR A;  2K8H A;  2KLC A;  2L76 A;  1RAX A;  4DXG A;  1T0S C;  2FCQ A;  4JQW C;  3H6N A;  2Y5C A;  4R3D A;  4XZ4 A;  4OZB A;  3QX1 A;  1RRB A;  1BUI C;  1IBX B;  1NYQ A;  2RSU A;  4HCN B;  1AW7 A;  3FC4 A;  4DDI D;  5FR3 A;  4PS3 A;  2GLS A;  3DOW A;  2K6Q A;  2O2V A;  5BMH A;  1S3S G;  2HJ8 A;  1WXA A;  1D5M C;  2J0K A;  1P7F A;  3U7D A;  2N9K A;  1SJE D;  1J7C A;  3ZXR A;  4ZHP A;  2ZNV C;  2QIE B;  4JX1 C;  3C19 A;  1E90 A;  1WX7 A;  2JRI B;  2AEH A;  4HVB A;  5IA7 A;  3L54 A;  4A20 A;  3V62 A;  3AH7 A;  2KJ6 A;  4IWP A;  3ZLZ A;  2CS4 A;  1SIF A;  2W54 A;  4ANW A;  4FJY A;  1Z2M A;  2WXO A;  1PGB A;  3X0W A;  1TTN A;  2K5P A;  3Q6B A;  2DLB A;  2HD5 B;  4K7U A;  4W9K A;  3ALB A;  3JSV A;  3P4S B;  4RH6 A;  1UEL A;  3WAL A;  5DPT A;  4AUQ C;  1F2R C;  4G11 A;  4I6N B;  3W9C B;  1FCL A;  3RUI B;  2FCN A;  2YEP F;  3P42 A;  2W82 A;  4XDC A;  4JE3 B;  2K8C A;  3RN9 C;  4TQ1 A;  3JSV B;  2K39 A;  1UGJ A;  2MW5 A;  4F7Z A;  1XCT L;  1GB1 A;  1VCB A;  1C78 A;  4HRO A;  2KDM A;  1J19 A;  2ZCC A;  3VUY A;  2O6V D;  1LGR A;  3NJT A;  1EF1 A;  4C4V A;  3ZRF A;  4HJK A;  1E8Y A;  4KGS A;  3A33 B;  4C7Y A;  1FD6 A;  3ZUN A;  2KZR A;  3APD A;  3W5V B;  2KWV B;  3ZNZ B;  3CWI A;  2UWQ A;  1T5X D;  3UIP B;  2FAZ A;  2WU2 B;  2C7M B;  2PLP A;  5BYQ A;  3KUD B;  4N9F 4;  1WMH A;  3UI3 A;  5E6O A;  1I42 A;  2J42 A;  4KIK A;  1V86 A;  2REX A;  4XWT A;  3UQB A;  1YIW A;  3VXW A;  2WLB A;  2LRW A;  2MQJ A;  4ZYN A;  3AE8 B;  5AZH A;  2A4Z A;  1FRD A;  2C60 A;  2LAS A;  3Q8C A;  2MA9 B;  1WMH B;  4DBG A;  4HPM B;  4KIK B;  2LHE A;  4HJG E;  1CMX B;  2M56 B;  3PLU A;  2Q5W D;  5BO4 B;  3NVV A;  1YX6 B;  2RR9 A;  3BWU D;  2RDH A;  1QT9 A;  4BOS C;  2D3B A;  2MJE A;  2SAK A;  4O1N A;  2CHZ A;  2QIL A;  2DYM A;  1WJ6 A;  1QKZ A;  3ZYY X;  1BT0 A;  3TIX A;  2JF5 A;  2GBR A;  4NQK E;  1TY2 A;  2BS2 B;  2RDG A;  1Q5W B;  2WXG A;  4NAW B;  1TKY A;  1JRP A;  1P1A A;  4TMA B;  2V3S A;  4MJS B;  3N1X C;  3CF6 E;  4BVU C;  3TEZ A;  4B6W A;  1WF9 A;  4GDK B;  5JHB A;  4F1S A;  5JXV A;  1FPY A;  1KRH A;  3VAW A;  5D3I B;  2KNB A;  1UUP A;  1VDV A;  1E8X A;  4HPP A;  1FMA D;  2KQS A;  2LMC A;  5C23 A;  1XT9 B;  1RWS A;  2B76 B;  1Q10 A;  2OED A;  1J7B A;  3RCZ A;  1EUV B;  3ZRC A;  2L0T A;  4RGN A;  3OG5 A;  4GGQ A;  5L95 C;  3BVZ A;  5IKC M;  4EUT A;  3TCA A;  3VRA B;  2ZW0 A;  5EE3 A;  2N1W A;  5AZG A;  1TKE A;  2D5G A;  2L3Z A;  1GJZ A;  2DZJ A;  3VR9 B;  3NUH B;  1SE3 A;  3O13 A;  1JRO A;  2IND C;  4AOF A;  3V60 A;  3QC8 B;  2ZVN A;  1YX5 B;  2KHW B;  2LXC A;  2EKE C;  1JW9 D;  4OVZ A;  2QMT A;  1KLV A;  3TJP A;  3R66 C;  3L13 A;  4OVV A;  3H7S A;  1V8C A;  1ZGU B;  2IGH A;  3CST A;  1WXV A;  1GAQ B;  2I2Y A;  5GXG B;  1WE6 A;  5FKA C;  2CKH B;  2XN9 C;  4BOZ B;  1IPG A;  3OJ4 B;  3WAP A;  3M62 B;  2KN4 A;  5J17 A;  3N30 A;  4M02 A;  2BYF A;  3GS2 A;  4HKQ A;  2EEL A;  3TEW A;  1FNW A;  3TMP B;  1JWU D;  4BKG A;  3PSE B;  3HK0 A;  2MP2 A;  3DHG C;  3P4R B;  1MHX A;  4LNF A;  1EM7 A;  4RGO S;  1V5T A;  3I57 A;  2IO2 B;  3VDZ A;  4WAF A;  2RGF A;  4KDI C;  1TS5 A;  1WJ4 A;  4W9H A;  2W55 A;  1PUT A;  3QJZ A;  1FCC C;  1T3Q A;  4F8C B;  2MCN B;  3MHZ A;  2MP2 B;  2Z0E B;  4PS8 A;  4OHJ A;  2WXF A;  1I4Q A;  2ZJD A;  1L0X B;  2J4X A;  2CJN A;  4MH0 E;  2MX2 A;  3DVN U;  2LD9 A;  4RFB A;  2IDY A;  1H8C A;  2N7E A;  1D6E C;  1V5O A;  2M17 A;  1TBE A;  4NJ6 A;  2L83 A;  1IGD A;  3H1U A;  1SF0 A;  3SEB A;  3A1Q A;  2KAJ A;  2OOB B;  3ECI A;  2KLG A;  3UGB B;  2NCN A;  4D2K A;  4ZRJ A;  2KKC A;  1Q0W B;  4BBN F;  2KQ7 A;  4ANU A;  5EDS A;  1N60 A;  2KMC A;  2FE8 A;  2M8S A;  5CHF A;  1WXS A;  1FEH A;  4IDI A;  2ICI A;  3AEB B;  4HWI B;  2K8B A;  1DYQ A;  3ABV B;  2GMI C;  2CJO A;  3A1Q B;  4S0R A;  4Q2J A;  4FUL A;  3W1S C;  4JIO U;  2KX0 A;  4XE0 A;  3Q69 A;  3WAN A;  3LJ3 A;  2GBJ A;  4CQN A;  2NTS A;  3OAW A;  3DBR I;  1GB4 A;  1WRI A;  2GB1 A;  2CR5 A;  1SE9 A;  2R61 A;  3AE3 B;  2ZCB A;  4CHK A;  2G4D B;  4RNA A;  1J7A A;  4E74 A;  4N6E B;  2K0P A;  4TUU A;  2MBB B;  1ZE3 D;  2D2Q A;  1F77 A;  3T8M A;  1VJK A;  2Z8L A;  4FN2 A;  3PO0 A;  2Z0D B;  1N62 A;  5TR5 A;  2XNA C;  2KJR A;  5LXI B;  4G0N B;  1LFD A;  1NI2 A;  4M01 A;  3APC A;  2INN E;  4G50 A;  1DGJ A;  1WY8 A;  2WHI A;  1EU4 A;  3SD5 A;  1V2Y A;  1GC6 A;  1I4G A;  3N9Y C;  3PHX B;  2BYV E;  3NY5 A;  1LO5 D;  3GE3 C;  4B9K A;  4TQ0 A;  2FIF A;  2DX5 B;  2CHW A;  2G4S A;  5BYR A;  2GBM A;  3EFC A;  3GE8 C;  2FUH B;  1SBB B;  2W3R A;  2V9H A;  4E71 A;  4LK0 M;  1Y56 A;  3AV8 A;  3BZD B;  3BVG A;  4LJO B;  1XXG A;  1WX9 A;  1WX8 A;  2IPK D;  4IKG A;  1QIL A;  2DZM A;  4XWW A;  5G55 A;  2KFJ A;  3GZN B;  2BB5 A;  2MJD A;  3IAS 1;  5H92 C;  2MBO A;  4FXC A;  3R8B A;  1WFY A;  2FNJ B;  2J52 A;  4WJQ A;  4HK2 A;  3TSS A;  4KGR A;  2BS3 B;  3DDC B;  3RZW C;  2QC8 A;  3AUL A;  3MFG A;  4P1B C;  1UD7 A;  3TBL D;  1UZX B;  2LFI A;  4EFO A;  4GMV A;  1GOZ A;  3OWE B;  1GG3 A;  3SFD B;  1N61 A;  1JML A;  3Q8F A;  1YNT E;  4K1R B;  3QIJ A;  1F2R I;  2KC2 A;  3VTV A;  1WIA A;  3U7Z A;  2KWD A;  3KUC B;  1GPX A;  1ACC A;  3AE6 B;  1I7H A;  2C9W B;  1PGX A;  2IBI B;  4M00 A;  3Q3J A;  4BBN C;  5LLI A;  4IC7 B;  1JWA D;  3VTW A;  1YN4 A;  1KLG D;  4GLS C;  3SR6 A;  1VR9 A;  3H7P A;  4FBJ B;  2PJH A;  3DBH I;  1UH6 A;  4P6V F;  1V6E A;  1R4N B;  3TUO A;  4XGA B;  1VZ8 A;  5HI1 A;  4W9D A;  4YL8 A;  2ONQ A;  3H7P B;  1E7V A;  4RM9 A;  4W9C A;  2PTL A;  1FM0 D;  5AZF A;  2QHO A;  3RNB C;  2G1E A;  4KV2 A;  4FAD A;  1TYG B;  4DXF A;  2N9L A;  3JVZ X;  3AEA B;  2E3T A;  2G45 B;  3W2D A;  1ZUD 2;  4AJY B;  1C4P A;  2Y5P A;  4IOI E;  3NS8 A;  3PRZ A;  1DOI A;  3IBE A;  3I3T B;  1P9D U;  2JYE A;  2N9P C;  4GSW A;  1E8Z A;  3HM6 X;  1QF6 A;  4BKT A;  2BW2 A;  1L5P A;  2KYW A;  2RD0 A;  3DBL I;  3KW5 B;  2MH7 A;  3MHS D;  4B95 A;  1C1Y B;  2R2Q A;  4MSQ B;  1ZOY B;  4J3O D;  3M63 B;  5FK9 C;  1T0Q C;  3PGE A;  3B9J A;  3AEG B;  4GOC A;  2NPT B;  2WXN A;  3U4E G;  4GN1 A;  4DHZ E;  4P16 A;  2ACZ B;  2ZNV B;  4KX6 B;  5LNK 1;  3U52 E;  1TJE A;  2KAN A;  2JUO A;  4I6L B;  1C4A A;  4GDL A;  4ZDV A;  1OQY A;  2JX5 A;  3RUL A;  2BT6 A;  1YOV B;  2R2O A;  2HE7 A;  3HM3 A;  1HZ5 A;  4IG7 B;  5D3D A;  5I4D A;  2VH1 A;  2M0X A;  1WH3 A;  2WXP A;  3KWL A;  3PPA A;  4GDL B;  3DVN V;  2MLB A;  1R4M I;  2O6V A;  2LI5 A;  2BKR B;  3PRP B;  1WR1 A;  2KOX A;  2MBE A;  4NJC A;  2LGS A;  3AED B;  1TZO A;  4L2Y A;  2L8J A;  1LXD A;  2VZK D;  1V49 A;  2D07 B;  1XCQ L;  1MG4 A;  2O6V B;  2WDR B;  3Q3M C;  1YQB A;  2AQ1 B;  1ET9 A;  2DZK A;  2XEW A;  3HRD D;  2WXR A;  2KQ4 X;  3RNC C;  2J0M A;  1TY0 A;  1DOY A;  1C9F A;  2GOW A;  3IG3 A;  4GIV A;  2WX1 A;  2GBN A;  2M0A A;  3ZO5 B;  1E7P B;  4PK1 A;  4TKN A;  3CIR B;  1TKG A;  4HXD A;  4NAW A;  3P1M A;  2PVO D;  2QJL A;  3IFW B;  4IM3 A;  1SGH A;  2PKO A;  2IYD B;  4MJS A;  2BWE S;  3QHT A;  2MBQ A;  4GDK A;  2B3A A;  1V9J A;  3T3O A;  4DHJ D;  3HVZ A;  2W3S A;  1XLO A;  2J0J A;  3H8H A;  3N3K B;  1A70 A;  3ONS A;  3R7R A;  1NI3 A;  2LHD A;  4HDQ A;  3ZTC A;  3AE4 B;  3MTN B;  4M8M A;  5AUK A;  2VZK B;  3URY A;  4W9E A;  1F1H A;  4IW0 A;  4YT0 B;  1ENF A;  1SSN A;  2K1F A;  3VH3 B;  1YJ1 A;  2M19 A;  2NBV B;  4EKU A;  1ISN A;  5HKH A;  3PRM B;  3NOB A;  2AQ3 B;  4TSS A;  4EE2 A;  2MHJ A;  1V97 A;  5G5G A;  2VH2 A;  2BWF A;  2PMV A;  5EE0 A;  3PV1 A;  2WXM A;  1AAR A;  4DWF A;  4KKI A;  5JHA A;  3DHH C;  2ZPY A;  4IWQ A;  2NVU I;  4G3X B;  5E6N A;  4RCO A;  3VR8 B;  2IO3 B;  3BK2 A;  4FJZ A;  4DHJ B;  3E9S A;  3PS6 A;  1T0Y A;  4K81 A;  3E56 A;  1MHH E;  1I4P A;  1SXT A;  4GU2 A;  2NBU A;  1FRR A;  1K52 A;  2GRI A;  2KDI A;  3JW0 X;  2HTM E;  3AXC A;  3MC8 A;  2FCM A;  5AEK B;  3C0R B;  3AMZ A;  4A8X C;  1UBQ A;  2JU6 X;  1TZ1 A;  4HPL B;  1HXY D;  3KWV A;  3EFU A;  3M3J A;  1FNV A;  2IO1 B;  3Q14 C;  4LTU A;  4DQO C;  1JRU A;  2MJ3 A;  2YLM A;  4XDD A;  1J8C A;  2BPS A;  2KC1 A;  5CHV C;  4E3C A;  3IAM 1;  1SJH D;  3R3M A;  3NVZ A;  4ZRK A;  4NY0 A;  3ZNI D;  1YN5 A;  4K7S A;  3EGR A;  1C3T A;  1WYW B;  1B9R A;  1I4X A;  1NDD A;  2HDE A;  1VZ6 A;  1FNU A;  4URK A;  2INC C;  2OJW A;  2N0S B;  1SB3 C;  1N5X A;  2YEP B;  1WXM A;  4A55 A;  1T0R C;  2OHF A;  3W1Y A;  1UBI A;  2FUG 1;  5BYS A;  2JT4 B;  2K3U A;  1E0Z A;  2LWP A;  2RDB C;  1D5Z C;  2BQQ A;  3KVF B;  1I35 A;  5IO9 A;  4MH8 A;  2Z59 B;  3HUI A;  4WQO B;  1K53 A;  3A9J B;  3R2I A;  4MAC A;  3KLS X;  2G9H D;  2V1Y A;  2NR2 A;  2C5L C;  2N9X A;  2WNM A;  2KO3 A;  2V4L A;  1SIJ A;  4OZA A;  4B0E A;  2FBW B;  1NEK B;  1RM6 C;  3IXS A;  4FJV B;  1ZDV A;  2H89 B;  1E7U A;  4A90 A;  4PYZ A;  1EF5 A;  4MSM B;  4KSK C;  1J0G A;  4KDL B; 
#chains in the Genus database with same CATH homology
 1ZXH A;  2WS3 B;  2LFI A;  3J9C A;  1ROE A;  1F0Z A;  1GOZ A;  1L6V A;  3OWE B;  4ARI A;  5T8I A;  3SFD B;  1N61 A;  4YSY B;  1WSP A;  1JML A;  3Q8F A;  4PT5 A;  4YTM B;  4KGS A;  1YNT E;  3ZJV A;  3BYY B;  1F2R I;  1PYW D;  4C7Y A;  2E6X A;  1FD6 A;  3MC0 B;  1WWT A;  2KWD A;  3NVY A;  3U7Z A;  5EE9 A;  1ACC A;  1L0Y B;  3AE6 B;  1GPX A;  1I7H A;  1WYG A;  1PGX A;  3W5V B;  2J53 A;  1E10 A;  4L1B A;  1JWA D;  1B1Z A;  1QOF A;  3CWI A;  1SE4 A;  1YN4 A;  1T5X D;  1KLG D;  2V4I B;  1AN8 A;  4GLS C;  4JWU C;  3R2T A;  1QLB B;  3SR6 A;  1VR9 A;  4ZRP A;  3HVD A;  1TS2 A;  1D5X C;  5E6J A;  2WU2 B;  1JWS D;  1KFY B;  4P6V F;  1XO3 A;  2PLP A;  2WXJ A;  5BYQ A;  4ARC A;  3TUO A;  4WUR A;  2NTT A;  1VZ8 A;  3UI3 A;  2DYO A;  5HI1 A;  1IGC A;  2J42 A;  1HQR D;  1QOA A;  3BII D;  4XWT A;  3FIL A;  2JQR B;  4YSZ B;  2ONQ A;  2WLB A;  2WXH A;  1OQR A;  2WP9 B;  1PGA A;  4YTP B;  2PTL A;  1T6B X;  3AE8 B;  1FM0 D;  1FFU A;  1PDX A;  4YXD B;  1FRD A;  2BB6 A;  2G1E A;  4NAM A;  1JQ4 A;  2LEK A;  1TYG B;  3NS1 A;  4DXF A;  2N9L A;  3Q8C A;  4US8 A;  2ON8 A;  1N5W A;  1XLQ A;  4ZYS A;  3AEA B;  4RGT A;  3AM9 A;  2K9X A;  1AWD A;  2E3T A;  3Q8B A;  4RGM A;  2LHE A;  4HJG E;  3FIL B;  3W2D A;  1ZUD 2;  1FO4 A;  2KMM A;  2M56 B;  1C4P A;  1EWY C;  2WXQ A;  2Q5W D;  2Y5P A;  4IOI E;  4ZOH C;  3NVV A;  1K51 A;  1QOG A;  1FXI A;  1DOI A;  1KLU D;  3BWU D;  2L1A A;  1QT9 A;  2RDH A;  3AB5 A;  2MJE A;  2SAK A;  1I4R A;  2JYE A;  3GP7 A;  4O1N A;  2QIL A;  2DYM A;  1QF6 A;  3BVM A;  3ETR A;  1QKZ A;  3ZYY X;  2IGD A;  2BW2 A;  1L5P A;  1L4D B;  2JSV X;  2L32 A;  1ESF A;  2IGG A;  3AEE B;  3BK1 A;  1N63 A;  3LB8 C;  3AE9 B;  3AE2 B;  1VZ7 A;  1EWC A;  3ZQ4 A;  2MH7 A;  1TY2 A;  2BS2 B;  2RDG A;  3DWG C;  2WXG A;  4NAW B;  1ZOY B;  1TKY A;  1JRP A;  4TMA B;  4J3O D;  4UDU C;  4MM3 B;  1XF5 L;  1EU3 A;  3LXF A;  3PZ7 A;  5D7G A;  4KKJ A;  5FK9 C;  4A6Q A;  4GDK B;  3TEZ A;  1D4B A;  5JXV A;  1ET6 A;  3B9J A;  1YJI A;  3EA6 A;  3AEG B;  1KRH A;  5D3I B;  3L4P A;  2WXN A;  3B2G A;  3U4E G;  1STE A;  1UUP A;  3PZ8 A;  1VDV A;  1ZP0 B;  1FMA D;  4P16 A;  4YWG G;  4B0M A;  2ACZ B;  3SFE B;  3GB1 A;  3V3X A;  2LMC A;  1RWS A;  4KX6 B;  5LNK 1;  2B76 B;  1Q10 A;  3U52 E;  1C79 A;  1E9M A;  3AE1 B;  2OED A;  1TJE A;  1J7B A;  1C4A A;  3EUB 2;  4RGN A;  2JX5 A;  3W5U B;  1JWM D;  1RFK A;  4YTN B;  2RMM A;  3AEC B;  3BVZ A;  4NZL B;  2NMQ A;  2BT6 A;  3ZJT A;  3LYY A;  3VRA B;  2ZW0 A;  4WH4 A;  5EE3 A;  2LUM A;  2INP E;  2JWU A;  1HZ5 A;  5HFY A;  1TKE A;  5D3D A;  4L23 A;  2N7J A;  2D5G A;  5I4D A;  2JXT A;  4JWS C;  2WXP A;  4H2A A;  3VR9 B;  3KWL A;  3NUH B;  1SE3 A;  3O13 A;  4ZHO A;  1JRO A;  1L6U A;  2I38 A;  4WQM A;  4WWM A;  2DWQ A;  1RYJ A;  2WQY B;  4GDL B;  5HHD G;  2BYT A;  4C56 C;  1JW9 D;  1UWX A;  4JPS A;  4OVZ A;  2QMT A;  5EE1 A;  1CQV A;  4AQ7 A;  1L0V B;  3RPF C;  4NJC A;  1V8C A;  1CK1 A;  2BTE A;  1OFF A;  3AED B;  1HZ6 A;  1TS4 A;  2IGH A;  1MVK A;  1NEN B;  3B2F A;  1TZO A;  4L2Y A;  4A9A A;  2VZK D;  1GAQ B;  2WDQ B;  2I2Y A;  5GXG B;  4OZC A;  4US9 A;  1XCQ L;  5FKA C;  2XN9 C;  2WU5 B;  2WDR B;  3P4Q B;  2V3P A;  2GI9 A;  2KN4 A;  3MP9 A;  2WDV B;  4WIP A;  2AQ1 B;  1ET9 A;  3HRD D;  2WXR A;  2KQ4 X;  2L52 A;  3GS2 A;  4N59 A;  3W1S A;  1TY0 A;  5AUI A;  1DOX A;  4HKQ A;  1C9F A;  2H88 B;  1DOY A;  3FAH A;  1TS3 A;  5BMI A;  3Q8A A;  2EEL A;  3TEW A;  1ZPS A;  1FNW A;  2M0A A;  3P63 A;  4MT5 A;  3IT4 B;  1E7P B;  1JWU D;  3CIR B;  1V1P A;  1TKG A;  4C7Z A;  2V0G A;  2LJI A;  3NVW A;  1MPE A;  3P4R B;  1YN3 A;  1MHX A;  1KH0 A;  3P1M A;  1EM7 A;  2PVO D;  2QJL A;  4RGO S;  1ZXI A;  4C80 A;  2PVG C;  1ZDX A;  3ZJU A;  2PKO A;  2RPV A;  3I57 A;  3DWM A;  4WAF A;  1UWM A;  5BMG A;  1JAL A;  5MPO A;  3T3O A;  1TS5 A;  1YQ3 B;  4HKZ E;  2TSS A;  1XEE A;  3HVZ A;  4LLG M;  5C3J B;  2W55 A;  1PUT A;  3I9V 1;  1FCC C;  2V3N A;  2W3S A;  1T3Q A;  1XLO A;  4KGT A;  5TSS A;  4HRS A;  1V1P B;  3MHZ A;  3H8H A;  2AX5 A;  2MEK A;  1A70 A;  2K22 A;  1XLP A;  1NI3 A;  2LHD A;  4OHJ A;  1CZP A;  3AE4 B;  1HA5 A;  1YJJ A;  2WXF A;  2IJ0 A;  1I4Q A;  3AE7 B;  5AUK A;  1XLN A;  2VZK B;  4RF0 A;  3URY A;  1WXQ A;  1L0X B;  1PFD A;  2WXL A;  3VRB B;  3Q8E A;  2J4X A;  2CJN A;  4YT0 B;  1BML C;  2KAC A;  2WXK A;  4OW0 A;  1ENF A;  1FIQ A;  4RFB A;  1SSN A;  2QEJ C;  2IDY A;  1D6E C;  3NRZ A;  1BXT A;  1YMH E;  2L83 A;  1IGD A;  2M19 A;  1SF0 A;  3TEY A;  1WGK A;  3RFZ B;  3P4P B;  3SEB A;  2KAJ A;  4YSX B;  2AQ3 B;  1HEZ E;  1C76 A;  2WXI A;  4TSS A;  3ZGZ A;  4D2K A;  4EE2 A;  1V97 A;  5G5G A;  1SE2 A;  4USA A;  1VRA B;  1YQ4 B;  2EKI A;  3WCQ A;  1N60 A;  2FE8 A;  2PMV A;  2BS4 B;  5EE0 A;  2QSD A;  1FEH A;  1IBX A;  2WXM A;  4IDI A;  3V05 A;  2JYT A;  2ICI A;  4KKI A;  2LGI A;  3AEB B;  5H8Y E;  1AYF A;  2X38 A;  4ZRQ A;  2DBY A;  1I4H A;  1FXA A;  1E6E B;  1DYQ A;  3ABV B;  2CJO A;  4RCO A;  4N58 A;  1NYR A;  3VR8 B;  3BK2 A;  4Q2J A;  3MJ5 A;  2JZP A;  3E9S A;  4DXG A;  1QQR A;  3E56 A;  4XE0 A;  1MHH E;  1KF6 B;  2Y5C A;  1I4P A;  4R3D A;  1SXT A;  4OZB A;  3BYT B;  3Q69 A;  2BBC A;  1BUI C;  1FRR A;  1IBX B;  1K52 A;  5G5H A;  1NYQ A;  2GRI A;  1UNS A;  5HG2 A;  4CQN A;  2SEB D;  1AW7 A;  1KTK A;  2NTS A;  3AN1 A;  2HTM E;  3FC4 A;  5FR3 A;  1GB4 A;  1WRI A;  2GB1 A;  3AMZ A;  1IUE A;  4A8X C;  5BMH A;  2JU6 X;  1HXY D;  3KWV A;  1D5M C;  2PIA A;  1P7F A;  2R61 A;  3AE3 B;  2N9K A;  4RNA A;  1FNV A;  4LTU A;  1J7A A;  1SJE D;  2ZW1 A;  3NZ3 A;  4M0W A;  3VQI A;  4DQO C;  4N6E B;  2K0P A;  2AQ2 B;  1JCK B;  2MJ3 A;  1J7C A;  4XDD A;  1CJE A;  4ZHP A;  2QIE B;  1ZE3 D;  2PW9 A;  4JX1 C;  5C2T B;  3IAM 1;  1SJH D;  1F77 A;  3NVZ A;  1YN5 A;  1VJK A;  2Z8L A;  3EGR A;  1C4C A;  4REZ A;  3PO0 A;  1N62 A;  1B9R A;  1I4X A;  3AH7 A;  2XNA C;  2HDE A;  1VZ6 A;  1FNU A;  1L4Z B;  2N0S B;  1SB3 C;  2INN E;  1DGJ A;  2W54 A;  1N5X A;  2YEP B;  1EU4 A;  4A55 A;  2OHF A;  3IT6 B;  4HEA 1;  2WXO A;  2FUG 1;  5BYS A;  1K50 A;  1MI0 A;  2K3U A;  1E0Z A;  1I4G A;  1PGB A;  3N9Y C;  1D5Z C;  1LO5 D;  3KQ4 A;  4AS1 A;  2K5P A;  3AEF B;  2DLB A;  4TQ0 A;  3U2S C;  3AE5 B;  3P4S B;  3TEX A;  4RH6 A;  5BYR A;  4MH8 A;  3HUI A;  1SBB B;  2W3R A;  1K53 A;  3R2I A;  1F2R C;  4MAC A;  4LK0 M;  1Y56 A;  3AV8 A;  3BZD B;  3KLS X;  3BVG A;  3W9C B;  1NVI D;  2G9H D;  4RF1 A;  3C8Y A;  1FCL A;  1R7S A;  1XXG A;  2IPK D;  2YEP F;  1OQQ A;  1FFV A;  2W82 A;  1QIL A;  3P42 A;  4IKG A;  1M4V A;  4JE3 B;  4XDC A;  4XWW A;  2WNM A;  1P7E A;  1QOB A;  1SIJ A;  4OZA A;  4B0E A;  2BB5 A;  2MJD A;  4TQ1 A;  2FBW B;  1NEK B;  1RM6 C;  3IXS A;  1ZDV A;  3IAS 1;  1SEB D;  5H92 C;  2CU3 A;  4FXC A;  3R8B A;  1V1O A;  1UGJ A;  2H89 B;  2J52 A;  2Y3A A;  1GB1 A;  1XCT L;  3T3N A;  3TSS A;  4KGR A;  4A90 A;  1JWB D;  2BS3 B;  1C78 A;  4HRO A;  2KDM A;  4ITK A;  1C77 A;  3MFG A;  1VLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...