1XLPA

Structure of oxidized c73s putidaredoxin from pseudomonas putida
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putidaredoxin
publication title Redox-dependent structural reorganization in putidaredoxin, a vertebrate-type [2Fe-2S] ferredoxin from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 31
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature ec 1.9.3.2: Transferred entry: 1.7.2.1.
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xlpA00
1NYQA 5G5GA 2Q5WD 4A9AA 1OQRA 1QOFA 1TKEA 2B76B 1QOAA 4P6VF 1E7PB 1TYGB 5EE9A 3HUIA 4JWUC 3AEGB 4US9A 3VRBB 1FIQA 4US8A 1KFYB 1JALA 2AX5A 1RWSA 2K9XA 2PVOD 3AE4B 4FXCA 1XLOA 1GAQB 1WGKA 4ZOHC 2WDQB 1YJJA 2L52A 2K5PA 3SFEB 4JX1C 2WQYB 1FRDA 1J7CA 1N61A 3L4PA 2L83A 1FM0D 1WRIA 2WU2B 3FAHA 3LB8C 3NS1A 2QIEB 4C7ZA 5EE0A 4C80A 1XLNA 1YQ4B 3B2FA 1FRRA 1J7AA 2G1EA 2N0SB 1AWDA 3AH7A 3KWLA 4JWSC 4YTPB 3DWGC 5G5HA 4KX6B 5C3JB 1B9RA 3P1MA 1DOYA 1NEKB 3ETRA 1ROEA 1V8CA 1ZP0B 2PVGC 2MJDA 1GPXA 2CJNA 5MPOA 1AYFA 3CIRB 2MJEA 3AEBB 3AEFB 5AUIA 2KMMA 4YT0B 1SIJA 1XLQA 1L5PA 3AE5B 1E9MA 1T3QA 2DBYA 2W3SA 1FFVA 1DGJA 2ACZB 2BS3B 2CU3A 2MJ3A 2W54A 5EE1A 3W9CB 3WCQA 2WU5B 1KRHA 4YSYB 3AEDB 2Y5CA 1E6EB 3AE1B 3AECB 1YQ3B 4N6EB 2WLBA 3PO0A 2K22A 3ZYYX 1TKGA 3AE6B 1N5XA 1VDVA 2M56B 2WP9B 3AN1A 2PKOA 3VRAB 4LTUA 3AM9A 1PFDA 4YTMB 3AMZA 3P63A 3FC4A 3P4QB 1VLBA 3NVWA 3AE3B 1JRPA 2JQRB 3AE2B 2H88B 1RYJA 2QJLA 2JX5A 2WDVB 2H89B 4HRSA 4WQMA 1NVID 2W3RA 3BIID 4N58A 3NRZA 3B2GA 1OFFA 3AE8B 5H8YE 1OQQA 1QF6A 2MH7A 1CZPA 1ZOYB 1QLBB 3AE9B 1R7SA 1L6UA 1UWMA 2CJOA 3HVZA 3EUB2 3NVZA 3VR8B 3SR6A 1WYGA 3CWIA 5C2TB 2KAJA 3SFDB 4ZHPA 2HTME 2BT6A 4YSZB 2LEKA 1XLPA 4YTNB 4YSXB 1JWBD 1FO4A 1FXAA 2FBWB 1WWTA 2WS3B 1RM6C 1L6VA 4USAA 1PUTA 5AUKA 1L0VB 1RFKA 1TJEA 2EKIA 1QT9A 4YXDB 1QOGA 1FMAD 1JW9D 1E10A 1DOIA 1A70A 1EWYC 2OHFA 2BS4B 3DWMA 3LXFA 1KF6B 1XO3A 1ZUD2 3AEEB 4IDIA 3NVVA 3VR9B 1DOXA 1WXQA 4HROA 1TKYA 2E3TA 1N63A 1SB3C 1YJIA 2DWQA 3AB5A 1JROA 3AE7B 1CJEA 1N62A 1FXIA 3HRDD 1NYRA 2BS2B 2M19A 1V97A 3NVYA 4ITKA 4N59A 5GXGB 1N5WA 4C7YA 1E0ZA 4ZHOA 1PDXA 3B9JA 3P4PB 1J7BA 3P4RB 1SF0A 1JQ4A 3RPFC 1NENB 3AEAB 3P4SB 5EE3A 3W5UB 1F0ZA 1FFUA 2W55A 1NI3A 1ZXIA 3ABVB 4WWMA 3W5VB 2PIAA 3AV8A 2WDRB 1IUEA 1JWAD 1N60A 1VJKA 5H92C 1QOBA 1I7HA
chains in the Genus database with same CATH superfamily
1C79A 5JHBA 4MEMA 5G55A 2N7DA 1UD7A 4A3OA 2KQ4X 1TYGB 3V6CB 3Q8FA 2KDFB 4ZOHC 3WAMA 4EZJA 1LGRA 5D7GA 1HE8A 1T0YA 1WM2A 3ZLZA 1WE6A 1XEEA 3N1ZC 3B1LX 3B2FA 1F52A 1KLVA 2G1EA 2WXHA 1VD2A 1DOYA 1NEKB 1WI0A 3OAWA 2MJDA 4NY0A 2WXRA 4G0NB 1EWCA 2KDMA 4K3BA 1PGAA 1SIFA 2RR9A 1TBEA 2ACZB 2K6DB 2JY6A 3OJ3A 5IAAC 3W1SC 4TQ0A 4GN1A 5KHOA 2EELA 4CQNA 1GOZA 1IGDA 1RRBA 3RULA 2FIFA 4MM3B 3VRAB 3DBRB 1BXTA 3P4QB 2IJ0A 2IO2B 2DZMA 4XC2A 4J6IA 1L4ZB 2H89B 3MJWA 3QK0A 2FE8A 1QF6A 2V3NA 1V80A 1Q1OA 3NVZA 1F2RI 1ZDVA 3I57A 4YSZB 2K8BA 4YTNB 1JWBD 1L6VA 2L05A 3JW0X 1P98A 4YXDB 4JLCA 1A70A 1YX6B 2BS4B 3A4RA 3U2SC 4IDIA 4AOFA 3JYUA 4PS8A 1C4CA 5JH5C 4HROA 3J9CA 2V0GA 5CX3A 3VDZA 1CJEA 1N62A 1FXIA 5EDSA 1MHHE 3Q6BA 2LI5A 4NJCA 5E6NA 5CTRC 2J0MA 2JUOA 2WDRB 4E74A 3W5VB 2JU6X 1VR9A 4KV2A 2V1YA 5E6OA 2KD0A 3IT4B 2LGDA 1XLOA 3A1QB 5IA7A 2BKRB 4N9F4 2N4FA 1S1QB 5J17A 2GBJA 3Q8CA 2N1VA 1J8CA 3RYTA 5D6JB 2K0PA 1CQVA 1I35A 5HI1A 3MP9A 1TS2A 4OHJA 1GPXA 3O13A 2LGXA 4GDLA 1V9JA 2KKCA 4YT0B 2AL6A 2D2QA 2W9NA 2KMAA 2NR2A 2AQ3B 4W9HA 5BMHA 2LVOA 2WLBA 2Y3AA 1I4XA 2K22A 4WJNA 3VFKA 1WX8A 2SAKA 4EKUA 2JQRB 3ZXVA 4NQLB 1WE7A 5E6JA 1ZGUB 1A5RA 4W9CA 2WXMA 2J7QB 2INNE 4ACFA 3WIMA 2KMCA 4E3CA 3NHEB 1M94A 4GB9A 3LDZE 4WWNA 4REZA 1RFAA 2AQ2B 4USAA 1UH6A 4KIKB 5FR3A 1P1AA 5LLIA 2FUHB 4MGKE 4RFBA 2KX0A 3VUYA 4YL8A 1EU3A 2J52A 4MH0E 2LHEA 2MW5A 4RF0A 3DBHI 4IOIE 3RPFC 4AJWA 4GDKB 1OQYA 3ML9A 4RGNA 2W3RA 5BYRA 2L1AA 3PRPB 3ZJTA 1TKEA 3P2BA 1HXYD 4MJSB 1OEYJ 1IP9A 3GZNI 2LRUA 2JSVX 4DHJD 1UUPA 1SE2A 3R7QA 2GBRA 1D6EC 1UELA 5G5HA 2NBUA 2HTHA 2L0TA 2RDBC 4FADA 2KO3A 3BVZA 4A90A 4MELA 3B0AA 1SSNA 2BWFA 1V81A 2D5GA 3RT3B 4DQOC 3AEDB 2AQ1B 4N6EB 4ZRKA 3PO0A 4BZAA 2KYWA 2MLBA 3PHWB 3KW5B 4H2AA 5TR5A 3NVWA 3AE3B 1JRPA 4XDCA 1NVID 2KVZA 3Q3NC 4ZDVA 1PQSA 2DNFA 1R7SA 1DYQA 3A9JB 3ONSA 1WYGA 1C4PA 4ZHPA 2KWDA 1ZKHA 5BO4B 1X1MA 2HDEA 2R2QA 3H6NA 2LVPA 4I6NB 4O1NA 4NJ6A 2BYVE 2DYBA 3NVVA 3ZGZA 1TKYA 4MSMB 3VVWB 3FKYA 3RN9C 1Q0WB 4RM8A 3QHTA 3ZRCA 3B9JA 1SJHD 3RNGC 1GUAB 2ASQA 2MEKA 2RPVA 3TMPB 4FA6A 2I38A 4HKZE 1HZ5A 3PZ7A 2O6VD 3EFCA 1QOFA 2D3GA 3Q14C 3VTWA 2B76B 1E7PB 5EE9A 1M4VA 2HE7A 3ZQ4A 2G45B 5KHQA 1SE4A 4DWFA 3KH0A 1R4NB 2HJ8A 2QILA 3L4PA 2XN9C 3AULA 2KTRA 3EA6A 1WRIA 1XLNA 3MTNB 3PPAA 1I4GA 3P1MA 4EEWA 3I5JC 3IBEA 1MVKA 1K8RB 4BKTA 3QX1A 1AYFA 4NAWA 1WJ6A 3VUXA 3AE5B 2W3SA 5EE1A 4XZ4A 2KFKB 5C1ZA 5IN7A 2NVUI 3DVNU 5AZHA 1FCLA 4C56C 2WXLA 3CMMB 3AM9A 4RM9A 4A3PA 3ZIMA 3DHIC 3K9PB 1YOVB 3A9KB 2WGSA 2QEJC 4W9GA 1WM3A 3PLVA 2G4DB 2LZ6A 5BYQA 5AZGA 1YMHE 1NDDA 1Z5SB 4L2YA 2INDC 4JGHB 2YVCA 3I63C 4A8XC 1JW9D 2GLSA 4MGZE 5L95C 2CHWA 2MBOA 1KH0A 2QDFA 1EO6A 3VR9B 2JXTA 2LGYA 1YJIA 4WJQA 2MA9B 2KJRA 2KLGA 3ZDTA 1P3QU 3VH4B 2G9HD 4XWTA 3ABVB 3ZVVA 2JPHA 4HPPA 3L54A 1YIWA 3ZTCA 1WSPA 2N7JA 3AU4A 1OQRA 2IO1B 4KGTA 3V05A 3I3TB 1WGHA 1BMLC 1T6BX 1V2YA 2QSDA 3L16A 2MP2B 1WYWB 3IVFA 1UGJA 4MDKE 3PREA 3EHVA 4M0WA 4DBGA 4C7ZA 3MJ5A 1JRUA 3MHSD 3HIZA 2L3ZA 2OEDA 3DQVA 5IKCM 1ROEA 1ZP0B 4RMAA 4P16A 3DDCB 3CIRB 1ISNA 3NOBA 1XQQA 2C7NB 1ESFA 3OG5A 3OLMD 2JXXA 1I4PA 4HCNB 3Q2AC 3S2AA 3H7PA 4HPMB 3A33B 5FKAC 1Z2MA 3P63A 2KK8A 2C9WB 1VCBA 1E7VA 3ZO5B 1YN3A 1FNUA 4W9FA 3UIPB 1OFFA 3ML8A 3QQ8B 5D3IB 1ZOYB 3QCAA 4ANUA 2LMCA 2QCZA 2HTME 2WXJA 4HLEA 2O2VA 2LFIA 1EF1A 4HEA1 4EZLA 2PE6B 1YJ1A 5T8IA 2ZCCA 2YLMA 2LJ5A 4HDQA 2JRIB 3Q8EA 3VXWA 2LUEA 1WXAA 1B1ZA 3PLUA 5C23A 2N9PC 1P0RA 4KGSA 3KVFB 4L23A 2IDYA 1VZ6A 1NYRA 2LUMA 3AXCA 1WFYA 1V86A 3NJTA 2MBQA 3P4SB 2V3SA 5HHDG 2MSED 1NI3A 3VH3B 3Q69A 4WQOB 4YWGG 2EMTA 1AARA 1QOBA 1I7HA 2RDHA 1NYQA 2ZJDA 3NUHB 4TQ1A 1KOTA 1C78A 4ZRJA 1RWSA 4BKGA 3Q3JA 2MBEA 1XT9B 1JCKB 3APFA 2KNBA 4K7WA 1CMXB 3PV1A 3DBHB 4ICVA 2RSUA 4EE2A 1J7AA 5C3JB 2IZVB 2K6QA 1V8CA 2BKFA 4IUMB 3KUDB 1I42A 4BKSA 1SIJA 3CSTA 5DPRA 3BK2A 2C7HA 3TEZA 3APDA 3WCQA 4PS3A 2MQJA 1K52A 3C8YA 1SE3A 3RZWC 4DHJB 2WXNA 4LTUA 1PYWD 4HXDA 3AE2B 2QJLA 1WF9A 2JX5A 1AN8A 4I6PA 2BYTA 3NRZA 2MBBB 3BY4B 1OQQA 1I4RA 1R4MI 3N1YC 5C2TB 3KUCB 2GB1A 1F1HA 3MHZA 3PZDA 1MPEA 4B0MA 2EKIA 2BF8B 2J53A 3A4SC 4WURA 4GGQA 4P1BC 2OOBB 3JSVB 3HM3A 4F8CB 2E3TA 1JROA 2KZRA 1XXGA 3N1XC 4N59A 2DYOA 3RNBC 2DHZA 1GB4A 2X38A 3K9OB 3KUZA 1UNSA 4F1SA 5DCNA 2YEPB 1WJ4A 5BMGA 1QOAA 1D5ZC 1L0YB 1HZ6A 4C4VB 1JALA 2G4SA 2NPTB 1UF0A 2WXQA 2M17A 4ZRQA 2QC8A 4ANVA 2DAJA 3DHHC 3EC8A 3FAHA 1Q10A 2XK5B 1F77A 3DWGC 3NZUA 4HVBA 2I2YA 4IG7B 2LVQA 5MPOA 4LNFA 2KMMA 2LWPA 3RFZB 1XLQA 2O6VB 5AZFA 4BBNC 2MWSB 3W9CB 1OTRB 1OEYA 3R2IA 4YSYB 3C19A 4KKIA 4BOSC 4DXAB 2IO0B 3ZYYX 3AN1A 2BQQA 2KC2A 3IAS1 4WQMA 4N58A 2MX2A 2JWUA 4XWWA 1KLGD 1IGCA 1UWMA 3KYCD 3VR8B 3W1SA 3CWIA 4C00A 1XLPA 1N6ZA 3WAPA 1PGBA 3RD2A 1PUTA 3L10B 1TJEA 1UGMA 4RCOA 3PHXB 1E10A 1DOIA 2Z8LA 1FXTB 4MT5A 1TS3A 4XDDA 2DX5B 3AEEB 1WH3A 2D11A 4LDTB 2M19A 5GXGB 3TCAA 1J19A 3V3XA 3X23A 2LJIA 4ZHOA 3QJZA 4IWOA 4S17A 1F0ZA 2LXCA 4KZCA 4BBNF 2KXJA 3DVGX 3R8BA 4W9KA 1VJKA 3U7ZA 3N20C 2BB6A 4AQ7A 2PLPA 1S3SG 2PVOD 1TZOA 1WXSA 4LNKA 2FCSA 1GG3A 1LXDA 2K3UA 4LK0M 1JWUD 3DBLI 5L83A 1YQBA 1N61A 1EUVB 4IWPA 4KVGB 3AU5A 2IBIB 2IGHA 3QA8A 4M01A 1UWXA 3W1YA 4M8NA 1SJED 4LLGM 1HEZE 2AYOB 3ZXRA 1YNTE 2BWES 1T3QA 2DBYA 1WX7A 2BS3B 1XCTL 4MGIE 4WWPA 2BGFA 3L0WB 3H1UA 4ARIA 4K7UA 2IY0B 4EZKA 2L8JA 1TY2A 2WXPA 2BPSA 2K8HA 3QWZB 2WDVB 2CS4A 3ZJVA 2KWCA 1KM7A 3RNAC 1WR1A 1WGRA 5DPSA 4NPNA 4PYUA 2J42A 3ZJUA 2WX1A 4RH6A 4LJPB 5BMIA 1FO4A 1Y8RC 2D3AA 4OVUA 1L0VB 2N9XA 4AP4C 1QQRA 2V3PA 4WH4A 4DK5A 5D2MB 1ZW7A 1WX9A 3V60A 3U8ZA 2MP2A 1FEHA 1V5OA 1LM8B 1VRAB 1Q5WB 3M63B 5GMVA 1RAXA 1FFUA 2LHDA 4W9JA 1T0RC 3ECIA 1IUEA 1EF5A 2XBBC 1CK1A 4TUUA 3TBLD 3TUOA 1QZEA 3H9DA 2UYZB 1IBXA 4XGAB 1E8XA 3HUIA 2WXIA 4US8A 3PGEA 1WMHA 1HA5A 1WGYA 1V1PA 1WGKA 2E6XA 3ZNGC 2K39A 2K5PA 4AS1A 3LB8C 2WU2B 3NS1A 4RNAA 2FAZA 2MRPA 2WHIA 3M95A 3BK1A 2D3CA 2BTEA 5G2NA 3MC9A 5HKHA 1KTKA 4FLHA 3ETRA 5HFYA 3I9V1 1HTOA 4G3XB 3TL5A 2GBMA 3AI5A 3FILA 3AEBB 4GMVA 4DHZE 3VQIA 1IYFA 1WXVA 4GDLB 1C4AA 4KSKC 1LO5D 4EOYA 2RDGA 4ARCA 1E6EB 3PZ8A 4PT5A 3PT2B 2KTFA 1ZPSA 1PFDA 3FC4A 1VLBA 3Q3MC 4IM0A 1C77A 3DVNV 4XE0A 2KACA 2BVCA 4HK2A 3TIXA 5H8YE 4KDIC 1CZPA 2K8CA 1L6UA 3CSFA 4P7IA 3SR6A 2GI9A 3DOWA 4ZRIA 3BYTB 2CU1A 4HWIB 5AUKA 4CO7A 2JRHA 4B6WA 5J2RA 4GU2A 4F7ZA 2LD9A 1GC6A 2BB5A 3M3JA 4LDTD 3R2TA 2L0FA 1C3TA 2VH2A 2W82A 2DWQA 4AUQC 4M8MA 3UINB 2L76A 4C7YA 1V97A 2DZJA 2CHZA 1R4MB 2KJHB 1LQBA 4JE3B 1JQ4A 2W55A 2BBCA 1LFDA 4WWMA 2KHWB 3VTUA 2N9KA 3OWEB 1JWAD 1K51A 2KVRA 3V62A 3O65B 4A9AA 2RD0A 1SGHA 3Q8AA 4W9EA 4WAAA 2KN5A 1K53A 3RNFC 1E8YA 2BW2A 1NBFC 4FXCA 3IAM1 2WYQA 2D3BA 2WXGA 4BVUC 2Z0DB 3ZNID 4ANWA 2KANA 2LRWA 4HCPB 4JWSC 3UQAA 2UU7A 3HHMA 1TZ1A 2CJNA 2D07B 2IY1B 2L32A 3GS2A 4GSWA 2YEPF 1E8WA 2R61A 4OVVA 4RGTA 1E9MA 2DZIA 3BZDB 1TS5A 2WXOA 3QAQA 4M00A 4S0RA 2Y5PA 4LJOB 4MM3A 3AE1B 2BYFA 4PS7A 1VDVA 2NBWB 2WXKA 3IFWB 2H88B 4ICUA 4ASWC 1P7FA 3CF6E 3GOEA 1GNUA 3PS6A 3UI3A 3RNEC 4W9DA 3T3OA 4LNOA 4XX5A 3QC8B 4FN2A 3WAOA 1WZ3A 3DCGA 2LASA 3MC0B 5CHVC 4BFRA 1RFKA 1QT9A 2IYDB 3ZRFA 2NPTA 4OZBA 1V6EA 3BVGA 2G3QB 4HPLB 5D94A 2J0JA 2ZPYA 1N63A 1SB3C 4R3DA 3MC8A 4FHJA 2DAFA 1BUIC 2K1FA 5HG2A 1E5WA 2XK5A 1RLFA 3EGRA 4HJKA 3AV8A 3E9SA 2RMMA 4X57B 2XEWA 2Q5WD 1H8CA 2NS5A 4KSLC 3A1QA 4WAFA 4NNJB 4DHZB 1P9DU 2AX5A 4IW0A 2FCQA 2KQ7A 3SEBA 1GAQB 3UF8A 5AEKB 1FRDA 4J3OD 1TT5B 3N3KB 4IM3A 1T0QC 1FM0D 4PK1A 2V9HA 4TSSA 3ZDMC 2KLCA 1EU4A 3WALA 2N0SB 4HJGE 3TJPA 3DBSA 3VHTC 1QKZA 3PRMB 4OZAA 1QILA 1L5PA 1TGZB 4NAWB 4IC7B 3IT6B 1HQRD 4IM2A 5BYSA 3GE3C 1N5XA 2PKOA 2WXFA 4LCDE 4MACA 3BVMA 2CR5A 2JWZA 3NY5A 1R4NI 3AE8B 2MH7A 3X0WA 2WDTB 2CJOA 2M1MA 2C5LC 4KIKA 2ZVOA 1D5MC 3GZNB 1WWTA 2UWQA 2LXAA 2QMTA 3NZSA 1EWYC 3LXFA 4ANXA 3T3NA 1KJTA 1EM7A 3RNCC 3HRDD 2L00B 1E0ZA 2X8XX 2ZZPB 3NVYA 4GDKA 2KDIA 5DPWA 1SF0A 5JXVA 2JZ3B 3AEAB 1T0SC 4JL9A 1MG8A 2ON8A 5H92C 4MJSA 1FNWA 2GBNA 4DDGD 3H8HA 1XD3B 1WR6E 2I1JA 4TKNA 2GBKA 2JYEA 1YJJA 2CHXA 3U52E 2ZEQA 3BINA 1ZE3D 2B3AA 4A20A 4KDLB 1OGWA 3SHQA 2HJ1A 1FRRA 3V6EB 4M0WB 3AH7A 3KWLA 4YTPB 4KKJA 4KGRA 2DYMA 1YN5A 3HM6X 3ZNZB 5LXHA 3N30A 4DXGA 2K25A 3GP7A 3PTFC 1WJNA 2Y5CA 1WIAA 4WJPA 2KN4A 1JMLA 1MG4A 3QIJA 2RPQA 5IP4D 3H7PB 3URYA 1GC7A 1L4DB 3BIID 3A9JA 3B2GA 2KFJA 2GOWA 1QLBB 3RZFA 3HVZA 3EUB2 3KWVA 2ICIA 1H4RA 2LGSA 2BT6A 2LEKA 2FBWB 4P1CC 3PVLA 1ET9A 4URKA 2O2VB 3KQ4A 2PPHA 3M62B 2JF5A 4WJOA 4LNNA 2FCMA 3UQBA 1UZXB 1FCCC 2JZZA 4FULA 5LXIB 2BS2B 2A5UA 3ENEA 2N7EA 3P4PB 4WWOA 1F2RC 3T9LA 2WWZA 1GB1A 3W5UB 2XNAC 1MJDA 3U7DA 2ZW0A 2DENB 3VAWA 3P42A 1N60A 1U4AA 1I4HA 2VRRB 2KDEB 5G5GA 3RI7C 2V4LA 3AEGB 1C9FA 3AE4B 3RUIB 2Z59B 3SU8X 2L7RA 2L83A 1YQ4B 1TY0A 1Y56A 3R7RA 4KZ0A 2I1KA 1K50A 4ZYSA 2MHJA 3IXSA 3V61A 2KFKA 3HK0A 2W54A 2MJ3A 2KT7A 2KQSA 1L0XB 4HDOA 3AECB 1FNVA 2Y5BB 1V49A 4DDID 4JPSA 1D4BA 4EFOA 1TKGA 3AE6B 2M56B 1TTNA 2KWUB 3A9KA 1KLUD 3WANA 1WY8A 4HRSA 1ET6A 4IKGA 4ZRPA 3EECA 1XCQL 1MI0A 5FK9C 1MFWA 5D3DA 2ZVNA 2HD5B 3ZUNA 1IPGA 4FHKA 2KWVB 3W2DA 4FBJB 1QOGA 1FMAD 1TS4A 3JVZX 1XF5L 1ZXHA 3TSSA 2ZNVB 4B95A 3EFUA 4GIVA 2FUG1 3AE7B 4RGOS 3AB5A 2J0KA 4ITKA 1N5WA 4MH8A 2INPE 3ZTDA 5EE3A 2N1WA 1WXMA 4DXFA 2RGFA 3OJ4B 2PIAA 1PDXA 2NCNA 3N9YC 4NAMA 3R66C 4FJZA 1PGXA 3VRBB 3KLSX 4NQKE 1SXTA 4IWQA 4II2B 3PRZA 2L52A 3DBRI 4K81A 1J7CA 4MSQB 2C60A 4G11A 2DLBA 5TSSA 2KC1A 4C80A 3LYYA 2QIEB 2AWTA 3R3MA 2D10A 1WZ0A 5E6PA 4A6QA 3AEFB 3TEWA 3VUWA 4RGMA 3UGBB 1WRDB 4CHKA 1YQ3B 2C7MB 3NZ3A 1AW7A 2M0AA 1NI2A 1RYJA 3Q8BA 4RF1A 4OZCA 2AEHA 4GLSC 4BAXA 1YD8U 2VZKB 2J4XA 2KAJA 3BWUD 2V4IB 3L08A 4YSXB 1FXAA 4OVZA 2NBVB 1RM6C 2M8SA 2IO3B 2OJRA 2ZPNA 2OHFA 2EKEC 4BOZB 3NS8A 5DPTA 4TMAB 3BYYB 4LNIA 1P7EA 2GMIC 5IOIA 1T5XD 2WNMA 1NENB 1ZXIA 1GJZA 5IO9A 3L13A 1WJUA 4P6VF 4W9LA 4EUTA 4US9A 3PSEB 1FIQA 4AWJA 2K9XA 2VH1A 2ZW1A 3MFGA 2N9EB 2WDQB 2KDBA 3RCZA 4II3B 4JX1C 3TEYA 5EE0A 3ZW3A 3DPDA 2REXA 2EMSA 3GB1A 4KX6B 5FR6A 2PEAA 2FCNA 3B08A 3GE8C 4G50A 2JT4B 2Z0EB 2MJEA 1HTQA 5AUIA 5CHWA 4BKSD 3HVDA 1V1OA 1DGJA 2CU3A 3IG3A 2IPKD 4M02A 1KRHA 4HKQA 2AL3A 3NG0A 1YN4A 4MGYE 4TV3A 1JWSD 2WP9B 4YTMB 3AMZA 2ONQA 4QAYA 4CYEA 1TIFA 1WGDA 2NTTA 1ENFA 1UBQA 2PJHA 2SEBD 4ZYNA 2A4ZA 3SFDB 1MHXA 1STEA 4L1BA 1JWMD 3C0RB 3APCA 4OW0A 1C76A 1SEBD 2M0XA 3JSVA 2CKHB 3U4EG 4K1RB 1XO3A 1ZUD2 4D2KA 3SDLC 3DHGC 3UIOB 1DOXA 3WA0A 1WXQA 3E56A 4NZLB 4Q2JA 3AE9B 2INCC 1SE9A 2NMQA 2KOXA 4W9IA 2IGDA 2JVCA 3U30A 1J7BA 2N9LA 3VTVA 5LNK1 4JIOU 4E71A 4B0EA 2FNJB 4C4VA 4I6LB 1ACCA 4JWUC 2JZPA 2NTSA 1KFYB 3RMKC 3QARA 1I4QA 4A55A 3L17A 1IBXB 2ZCBA 1FPYA 2WX0A 4B9KA 4PYZA 1WMHB 3SFEB 1V1PB 2WQYB 2KJ6A 1C1YB 1F9JA 1E8ZA 3N32A 4JQWC 2MBHA 1AWDA 1B9RA 4GOCA 2PVGC 2O6VA 2TSSA 2PTLA 4FJVB 4NJ7A 3KYDD 4K7SA 1ZDXA 3ALBA 2M4NA 1VZ7A 2PE9A 1FFVA 2OJWA 4GXBA 3FILB 2BYEA 2WU5B 1FD6A 1BT0A 1SBBB 3LJ3A 1G6JA 3SD5A 2R2OA 5JZEB 2DZKA 2QHOA 2KTRB 1E90A 2ZNVC 2VZKD 2MCNB 5J18A 3D32A 1YX5B 2PW9A 3Q3OC 2FIDA 3H7SA 1VZ8A 2WS3B 3Q3FA 4AJYB 4FJYA 5CHFA 1WGGA 3DBLB 2IGGA 4UDUC 3DVGY 3DWMA 1KF6B 1E7UA 4XYCA 2JYTA 5I4DA 4WIPA 1V5TA 1J0GA 1UBIA 5JHAA 2LGIA 3IHPC 1D5XC 3P4RB 1L7YA 3ZNHB 4K3CA 2PMVA 3ZKJC 1L2NA 2KX3A 1D3ZA 3T8MA 2GRIA 3TEXA
chains in the Genus database with same CATH topology
3TUOA 1C79A 1WSPA 2N7JA 5G5GA 1OQRA 1IBXA 4KGTA 2KQ4X 1TYGB 3V05A 3HUIA 1BMLC 2WXIA 3AEGB 4US8A 1C9FA 1HA5A 1T6BX 3AE4B 3Q8FA 1V1PA 2QSDA 1WGKA 4ZOHC 2E6XA 5D7GA 2K5PA 1UGJA 4AS1A 2L83A 4M0WA 3LB8C 4C7ZA 2WU2B 3NS1A 4RNAA 1XEEA 1YQ4B 3MJ5A 1TY0A 3B2FA 3BK1A 1Y56A 2G1EA 2BTEA 2WXHA 2OEDA 1K50A 1DOYA 1KTKA 1NEKB 3ETRA 1ROEA 1ZP0B 5HFYA 3I9V1 2MJDA 4ZYSA 2WXRA 1EWCA 2KDMA 4P16A 1PGAA 3AEBB 3CIRB 3FILA 3IXSA 2ACZB 2W54A 3VQIA 2MJ3A 4GDLB 1C4AA 1ESFA 1LO5D 4TQ0A 1L0XB 2EELA 2RDGA 1I4PA 4ARCA 1E6EB 1FNVA 3AECB 3PZ8A 1GOZA 4PT5A 4CQNA 4JPSA 1D4BA 1IGDA 5FKAC 4MM3B 1TKGA 3AE6B 2M56B 3VRAB 1ZPSA 1PFDA 3P63A 1BXTA 3FC4A 3P4QB 1KLUD 1VLBA 2IJ0A 1C77A 1L4ZB 2H89B 4HRSA 1ET6A 2KACA 4IKGA 4XE0A 1YN3A 1FNUA 4ZRPA 1XCQL 1MI0A 2FE8A 5FK9C 5H8YE 1OFFA 1QF6A 2V3NA 1CZPA 5D3IB 5D3DA 1ZOYB 3NVZA 1L6UA 1F2RI 3SR6A 2GI9A 1ZDVA 2LMCA 3I57A 2HTME 2WXJA 4YSZB 4YTNB 2LFIA 1JWBD 3BYTB 1L6VA 3W2DA 5AUKA 4HEA1 4YXDB 1QOGA 1FMAD 5T8IA 1A70A 2BS4B 1TS4A 3Q8EA 2BB5A 3U2SC 3R2TA 1B1ZA 4IDIA 1XF5L 1ZXHA 3TSSA 1C4CA 4HROA 2W82A 3J9CA 2FUG1 3AE7B 4KGSA 2DWQA 3AB5A 4RGOS 2V0GA 1CJEA 1N62A 1FXIA 1MHHE 4L23A 2IDYA 1VZ6A 1NYRA 4C7YA 1V97A 2LUMA 4ITKA 1N5WA 4MH8A 2INPE 4NJCA 1JQ4A 4JE3B 3P4SB 5EE3A 5HHDG 2W55A 2BBCA 1NI3A 4WWMA 4DXFA 2N9KA 2PIAA 3OWEB 3Q69A 2WDRB 1JWAD 1K51A 4YWGG 3W5VB 1QOBA 1PDXA 1I7HA 2RDHA 1NYQA 2JU6X 3NUHB 4A9AA 3N9YC 1VR9A 4NAMA 4TQ1A 3Q8AA 1PGXA 3VRBB 1C78A 1K53A 3KLSX 1SXTA 2BW2A 1RWSA 3IAM1 4FXCA 3IT4B 1XLOA 2WXGA 2L52A 3Q8CA 1J7CA 1JCKB 2DLBA 5TSSA 4C80A 3LYYA 2QIEB 2K0PA 1J7AA 4JWSC 4EE2A 1CQVA 5C3JB 5HI1A 3MP9A 1TS2A 1V8CA 4OHJA 1GPXA 2CJNA 3O13A 2L32A 3GS2A 4A6QA 3AEFB 2YEPF 4YT0B 1SIJA 2R61A 4RGTA 1E9MA 3BZDB 3TEWA 3BK2A 1TS5A 4RGMA 3TEZA 2WXOA 2AQ3B 3WCQA 2Y5PA 5BMHA 1K52A 3AE1B 3C8YA 1YQ3B 2WLBA 2Y3AA 1I4XA 1SE3A 2K22A 3NZ3A 1AW7A 1VDVA 2WXNA 4LTUA 1PYWD 2WXKA 2SAKA 2M0AA 2JQRB 3AE2B 2H88B 1RYJA 2QJLA 2JX5A 3Q8BA 1AN8A 1P7FA 4RF1A 5E6JA 4OZCA 4GLSC 2BYTA 3NRZA 3UI3A 1OQQA 2VZKB 3T3OA 2WXMA 1I4RA 2INNE 2J4XA 5C2TB 2GB1A 2KAJA 3BWUD 3MHZA 2V4IB 4YSXB 3MC0B 1FXAA 4OVZA 4REZA 1MPEA 1RM6C 4USAA 2AQ2B 4B0MA 1RFKA 2EKIA 1QT9A 5FR3A 2J53A 4WURA 4RFBA 2OHFA 4OZBA 4TMAB 1EU3A 3BVGA 2J52A 3BYYB 2E3TA 1N63A 1SB3C 1JROA 2LHEA 1P7EA 1XXGA 4R3DA 4N59A 4RF0A 2DYOA 1BUIC 1T5XD 5HG2A 4IOIE 2WNMA 3RPFC 1NENB 4GDKB 1GB4A 1ZXIA 2X38A 3EGRA 3AV8A 3E9SA 4RGNA 1UNSA 2RMMA 2W3RA 5BYRA 2L1AA 2YEPB 2Q5WD 5BMGA 3ZJTA 1TKEA 4P6VF 1QOAA 1HXYD 1D5ZC 4WAFA 1L0YB 1HZ6A 4US9A 1FIQA 1JALA 2AX5A 3SEBA 2K9XA 1GAQB 2WXQA 2ZW1A 2JSVX 3MFGA 4ZRQA 2WDQB 4JX1C 1FRDA 4J3OD 1UUPA 3TEYA 1SE2A 1FM0D 3FAHA 5EE0A 4TSSA 1Q10A 1EU4A 1D6EC 2N0SB 1F77A 3GB1A 5G5HA 3DWGC 4KX6B 2I2YA 4HJGE 3BVZA 1QKZA 5MPOA 4A90A 2MJEA 5AUIA 2KMMA 1QILA 4OZAA 3RFZB 3HVDA 1XLQA 1L5PA 1SSNA 1V1OA 1DGJA 2CU3A 3W9CB 4NAWB 3R2IA 3IT6B 2D5GA 2IPKD 1KRHA 4YSYB 4HKQA 4KKIA 3AEDB 4DQOC 1HQRD 2AQ1B 4N6EB 1YN4A 3PO0A 5BYSA 3ZYYX 1N5XA 1JWSD 2WP9B 3AN1A 2PKOA 4YTMB 2WXFA 3AMZA 4H2AA 2ONQA 3AE3B 1JRPA 3IAS1 3NVWA 4MACA 3BVMA 4XDCA 4WQMA 1NVID 2NTTA 4N58A 2JWUA 1ENFA 3AE8B 4XWWA 2MH7A 1KLGD 2SEBD 1R7SA 1IGCA 1DYQA 1UWMA 2CJOA 3VR8B 3W1SA 1WYGA 3CWIA 3SFDB 1MHXA 1C4PA 1STEA 4ZHPA 1XLPA 2KWDA 4L1BA 1D5MC 1JWMD 1PGBA 1WWTA 1PUTA 1TJEA 4OW0A 2QMTA 1C76A 4RCOA 1SEBD 1E10A 1DOIA 2Z8LA 3U4EG 1EWYC 2HDEA 3LXFA 4MT5A 4O1NA 1TS3A 4XDDA 1XO3A 1ZUD2 4D2KA 3AEEB 3T3NA 3NVVA 1DOXA 1WXQA 3E56A 4NZLB 4Q2JA 3ZGZA 1TKYA 3AE9B 1EM7A 3HRDD 2M19A 5GXGB 2NMQA 3NVYA 3V3XA 1E0ZA 2LJIA 4ZHOA 2IGDA 3B9JA 1SJHD 1J7BA 1SF0A 2MEKA 2N9LA 5JXVA 3AEAB 1F0ZA 2RPVA 5LNK1 3R8BA 2ON8A 4B0EA 1VJKA 5H92C 2I38A 4HKZE 3U7ZA 1HZ5A 3PZ7A 1FNWA 2BB6A 1QOFA 4AQ7A 2B76B 1E7PB 5EE9A 1ACCA 3H8HA 1M4VA 2PLPA 2JZPA 4JWUC 2NTSA 1KFYB 1I4QA 4A55A 2PVOD 1IBXB 1TZOA 3ZQ4A 1SE4A 2K3UA 2JYEA 4LK0M 1YJJA 3U52E 2QILA 1JWUD 1V1PB 2WQYB 3SFEB 1N61A 3L4PA 2XN9C 1ZE3D 3EA6A 1WRIA 1XLNA 2IGHA 1FRRA 1UWXA 1I4GA 1AWDA 3AH7A 3KWLA 1B9RA 4YTPB 4KKJA 3P1MA 1SJED 4KGRA 2DYMA 2PVGC 1MVKA 4LLGM 2TSSA 1HEZE 2PTLA 1YN5A 1AYFA 1ZDXA 1YNTE 3AE5B 4DXGA 1T3QA 1VZ7A 2DBYA 2W3SA 1FFVA 2BS3B 5EE1A 3FILB 3GP7A 2WU5B 1XCTL 1FD6A 2Y5CA 1SBBB 1FCLA 2KN4A 1JMLA 4ARIA 4C56C 2WXLA 1TY2A 2WXPA 3AM9A 3URYA 2WDVB 3ZJVA 2VZKD 1L4DB 3BIID 2QEJC 3B2GA 2PW9A 1QLBB 3HVZA 3EUB2 3KWVA 2ICIA 5BYQA 1YMHE 2J42A 3ZJUA 2BT6A 2LEKA 4L2YA 4RH6A 5BMIA 1FO4A 2FBWB 1VZ8A 2WS3B 1L0VB 1ET9A 4A8XC 1JW9D 1QQRA 2V3PA 3KQ4A 4WH4A 2IGGA 4UDUC 3DWMA 1KF6B 1FCCC 1FEHA 1KH0A 3VR9B 2JYTA 5I4DA 2JXTA 1YJIA 4WIPA 1VRAB 2BS2B 2LGIA 3P4PB 1F2RC 1GB1A 1D5XC 3P4RB 2G9HD 3W5UB 4XWTA 2PMVA 2XNAC 1FFUA 2LHDA 3ABVB 2ZW0A 2GRIA 3P42A 1IUEA 1N60A 3TEXA 1I4HA 1CK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYQ A;  5G5G A;  2Q5W D;  4A9A A;  1OQR A;  1QOF A;  1TKE A;  2B76 B;  1QOA A;  4P6V F;  1E7P B;  1TYG B;  5EE9 A;  3HUI A;  4JWU C;  3AEG B;  4US9 A;  3VRB B;  1FIQ A;  4US8 A;  1KFY B;  1JAL A;  2AX5 A;  1RWS A;  2K9X A;  2PVO D;  3AE4 B;  4FXC A;  1XLO A;  1GAQ B;  1WGK A;  4ZOH C;  2WDQ B;  1YJJ A;  2L52 A;  2K5P A;  3SFE B;  4JX1 C;  2WQY B;  1FRD A;  1J7C A;  1N61 A;  3L4P A;  2L83 A;  1FM0 D;  1WRI A;  2WU2 B;  3FAH A;  3LB8 C;  3NS1 A;  2QIE B;  4C7Z A;  5EE0 A;  4C80 A;  1XLN A;  1YQ4 B;  3B2F A;  1FRR A;  1J7A A;  2G1E A;  2N0S B;  1AWD A;  3AH7 A;  3KWL A;  4JWS C;  4YTP B;  3DWG C;  5G5H A;  4KX6 B;  5C3J B;  1B9R A;  3P1M A;  1DOY A;  1NEK B;  3ETR A;  1ROE A;  1V8C A;  1ZP0 B;  2PVG C;  2MJD A;  1GPX A;  2CJN A;  5MPO A;  1AYF A;  3CIR B;  2MJE A;  3AEB B;  3AEF B;  5AUI A;  2KMM A;  4YT0 B;  1SIJ A;  1XLQ A;  1L5P A;  3AE5 B;  1E9M A;  1T3Q A;  2DBY A;  2W3S A;  1FFV A;  1DGJ A;  2ACZ B;  2BS3 B;  2CU3 A;  2MJ3 A;  2W54 A;  5EE1 A;  3W9C B;  3WCQ A;  2WU5 B;  1KRH A;  4YSY B;  3AED B;  2Y5C A;  1E6E B;  3AE1 B;  3AEC B;  1YQ3 B;  4N6E B;  2WLB A;  3PO0 A;  2K22 A;  3ZYY X;  1TKG A;  3AE6 B;  1N5X A;  1VDV A;  2M56 B;  2WP9 B;  3AN1 A;  2PKO A;  3VRA B;  4LTU A;  3AM9 A;  1PFD A;  4YTM B;  3AMZ A;  3P63 A;  3FC4 A;  3P4Q B;  1VLB A;  3NVW A;  3AE3 B;  1JRP A;  2JQR B;  3AE2 B;  2H88 B;  1RYJ A;  2QJL A;  2JX5 A;  2WDV B;  2H89 B;  4HRS A;  4WQM A;  1NVI D;  2W3R A;  3BII D;  4N58 A;  3NRZ A;  3B2G A;  1OFF A;  3AE8 B;  5H8Y E;  1OQQ A;  1QF6 A;  2MH7 A;  1CZP A;  1ZOY B;  1QLB B;  3AE9 B;  1R7S A;  1L6U A;  1UWM A;  2CJO A;  3HVZ A;  3EUB 2;  3NVZ A;  3VR8 B;  3SR6 A;  1WYG A;  3CWI A;  5C2T B;  2KAJ A;  3SFD B;  4ZHP A;  2HTM E;  2BT6 A;  4YSZ B;  2LEK A;  1XLP A;  4YTN B;  4YSX B;  1JWB D;  1FO4 A;  1FXA A;  2FBW B;  1WWT A;  2WS3 B;  1RM6 C;  1L6V A;  4USA A;  1PUT A;  5AUK A;  1L0V B;  1RFK A;  1TJE A;  2EKI A;  1QT9 A;  4YXD B;  1QOG A;  1FMA D;  1JW9 D;  1E10 A;  1DOI A;  1A70 A;  1EWY C;  2OHF A;  2BS4 B;  3DWM A;  3LXF A;  1KF6 B;  1XO3 A;  1ZUD 2;  3AEE B;  4IDI A;  3NVV A;  3VR9 B;  1DOX A;  1WXQ A;  4HRO A;  1TKY A;  2E3T A;  1N63 A;  1SB3 C;  1YJI A;  2DWQ A;  3AB5 A;  1JRO A;  3AE7 B;  1CJE A;  1N62 A;  1FXI A;  3HRD D;  1NYR A;  2BS2 B;  2M19 A;  1V97 A;  3NVY A;  4ITK A;  4N59 A;  5GXG B;  1N5W A;  4C7Y A;  1E0Z A;  4ZHO A;  1PDX A;  3B9J A;  3P4P B;  1J7B A;  3P4R B;  1SF0 A;  1JQ4 A;  3RPF C;  1NEN B;  3AEA B;  3P4S B;  5EE3 A;  3W5U B;  1F0Z A;  1FFU A;  2W55 A;  1NI3 A;  1ZXI A;  3ABV B;  4WWM A;  3W5V B;  2PIA A;  3AV8 A;  2WDR B;  1IUE A;  1JWA D;  1N60 A;  1VJK A;  5H92 C;  1QOB A;  1I7H A; 
#chains in the Genus database with same CATH topology
 1C79 A;  5JHB A;  4MEM A;  5G55 A;  2N7D A;  1UD7 A;  4A3O A;  2KQ4 X;  1TYG B;  3V6C B;  3Q8F A;  2KDF B;  4ZOH C;  3WAM A;  4EZJ A;  1LGR A;  5D7G A;  1HE8 A;  1T0Y A;  1WM2 A;  3ZLZ A;  1WE6 A;  1XEE A;  3N1Z C;  3B1L X;  3B2F A;  1F52 A;  1KLV A;  2G1E A;  2WXH A;  1VD2 A;  1DOY A;  1NEK B;  1WI0 A;  3OAW A;  2MJD A;  4NY0 A;  2WXR A;  4G0N B;  1EWC A;  2KDM A;  4K3B A;  1PGA A;  1SIF A;  2RR9 A;  1TBE A;  2ACZ B;  2K6D B;  2JY6 A;  3OJ3 A;  5IAA C;  3W1S C;  4TQ0 A;  4GN1 A;  5KHO A;  2EEL A;  4CQN A;  1GOZ A;  1IGD A;  1RRB A;  3RUL A;  2FIF A;  4MM3 B;  3VRA B;  3DBR B;  1BXT A;  3P4Q B;  2IJ0 A;  2IO2 B;  2DZM A;  4XC2 A;  4J6I A;  1L4Z B;  2H89 B;  3MJW A;  3QK0 A;  2FE8 A;  1QF6 A;  2V3N A;  1V80 A;  1Q1O A;  3NVZ A;  1F2R I;  1ZDV A;  3I57 A;  4YSZ B;  2K8B A;  4YTN B;  1JWB D;  1L6V A;  2L05 A;  3JW0 X;  1P98 A;  4YXD B;  4JLC A;  1A70 A;  1YX6 B;  2BS4 B;  3A4R A;  3U2S C;  4IDI A;  4AOF A;  3JYU A;  4PS8 A;  1C4C A;  5JH5 C;  4HRO A;  3J9C A;  2V0G A;  5CX3 A;  3VDZ A;  1CJE A;  1N62 A;  1FXI A;  5EDS A;  1MHH E;  3Q6B A;  2LI5 A;  4NJC A;  5E6N A;  5CTR C;  2J0M A;  2JUO A;  2WDR B;  4E74 A;  3W5V B;  2JU6 X;  1VR9 A;  4KV2 A;  2V1Y A;  5E6O A;  2KD0 A;  3IT4 B;  2LGD A;  1XLO A;  3A1Q B;  5IA7 A;  2BKR B;  4N9F 4;  2N4F A;  1S1Q B;  5J17 A;  2GBJ A;  3Q8C A;  2N1V A;  1J8C A;  3RYT A;  5D6J B;  2K0P A;  1CQV A;  1I35 A;  5HI1 A;  3MP9 A;  1TS2 A;  4OHJ A;  1GPX A;  3O13 A;  2LGX A;  4GDL A;  1V9J A;  2KKC A;  4YT0 B;  2AL6 A;  2D2Q A;  2W9N A;  2KMA A;  2NR2 A;  2AQ3 B;  4W9H A;  5BMH A;  2LVO A;  2WLB A;  2Y3A A;  1I4X A;  2K22 A;  4WJN A;  3VFK A;  1WX8 A;  2SAK A;  4EKU A;  2JQR B;  3ZXV A;  4NQL B;  1WE7 A;  5E6J A;  1ZGU B;  1A5R A;  4W9C A;  2WXM A;  2J7Q B;  2INN E;  4ACF A;  3WIM A;  2KMC A;  4E3C A;  3NHE B;  1M94 A;  4GB9 A;  3LDZ E;  4WWN A;  4REZ A;  1RFA A;  2AQ2 B;  4USA A;  1UH6 A;  4KIK B;  5FR3 A;  1P1A A;  5LLI A;  2FUH B;  4MGK E;  4RFB A;  2KX0 A;  3VUY A;  4YL8 A;  1EU3 A;  2J52 A;  4MH0 E;  2LHE A;  2MW5 A;  4RF0 A;  3DBH I;  4IOI E;  3RPF C;  4AJW A;  4GDK B;  1OQY A;  3ML9 A;  4RGN A;  2W3R A;  5BYR A;  2L1A A;  3PRP B;  3ZJT A;  1TKE A;  3P2B A;  1HXY D;  4MJS B;  1OEY J;  1IP9 A;  3GZN I;  2LRU A;  2JSV X;  4DHJ D;  1UUP A;  1SE2 A;  3R7Q A;  2GBR A;  1D6E C;  1UEL A;  5G5H A;  2NBU A;  2HTH A;  2L0T A;  2RDB C;  4FAD A;  2KO3 A;  3BVZ A;  4A90 A;  4MEL A;  3B0A A;  1SSN A;  2BWF A;  1V81 A;  2D5G A;  3RT3 B;  4DQO C;  3AED B;  2AQ1 B;  4N6E B;  4ZRK A;  3PO0 A;  4BZA A;  2KYW A;  2MLB A;  3PHW B;  3KW5 B;  4H2A A;  5TR5 A;  3NVW A;  3AE3 B;  1JRP A;  4XDC A;  1NVI D;  2KVZ A;  3Q3N C;  4ZDV A;  1PQS A;  2DNF A;  1R7S A;  1DYQ A;  3A9J B;  3ONS A;  1WYG A;  1C4P A;  4ZHP A;  2KWD A;  1ZKH A;  5BO4 B;  1X1M A;  2HDE A;  2R2Q A;  3H6N A;  2LVP A;  4I6N B;  4O1N A;  4NJ6 A;  2BYV E;  2DYB A;  3NVV A;  3ZGZ A;  1TKY A;  4MSM B;  3VVW B;  3FKY A;  3RN9 C;  1Q0W B;  4RM8 A;  3QHT A;  3ZRC A;  3B9J A;  1SJH D;  3RNG C;  1GUA B;  2ASQ A;  2MEK A;  2RPV A;  3TMP B;  4FA6 A;  2I38 A;  4HKZ E;  1HZ5 A;  3PZ7 A;  2O6V D;  3EFC A;  1QOF A;  2D3G A;  3Q14 C;  3VTW A;  2B76 B;  1E7P B;  5EE9 A;  1M4V A;  2HE7 A;  3ZQ4 A;  2G45 B;  5KHQ A;  1SE4 A;  4DWF A;  3KH0 A;  1R4N B;  2HJ8 A;  2QIL A;  3L4P A;  2XN9 C;  3AUL A;  2KTR A;  3EA6 A;  1WRI A;  1XLN A;  3MTN B;  3PPA A;  1I4G A;  3P1M A;  4EEW A;  3I5J C;  3IBE A;  1MVK A;  1K8R B;  4BKT A;  3QX1 A;  1AYF A;  4NAW A;  1WJ6 A;  3VUX A;  3AE5 B;  2W3S A;  5EE1 A;  4XZ4 A;  2KFK B;  5C1Z A;  5IN7 A;  2NVU I;  3DVN U;  5AZH A;  1FCL A;  4C56 C;  2WXL A;  3CMM B;  3AM9 A;  4RM9 A;  4A3P A;  3ZIM A;  3DHI C;  3K9P B;  1YOV B;  3A9K B;  2WGS A;  2QEJ C;  4W9G A;  1WM3 A;  3PLV A;  2G4D B;  2LZ6 A;  5BYQ A;  5AZG A;  1YMH E;  1NDD A;  1Z5S B;  4L2Y A;  2IND C;  4JGH B;  2YVC A;  3I63 C;  4A8X C;  1JW9 D;  2GLS A;  4MGZ E;  5L95 C;  2CHW A;  2MBO A;  1KH0 A;  2QDF A;  1EO6 A;  3VR9 B;  2JXT A;  2LGY A;  1YJI A;  4WJQ A;  2MA9 B;  2KJR A;  2KLG A;  3ZDT A;  1P3Q U;  3VH4 B;  2G9H D;  4XWT A;  3ABV B;  3ZVV A;  2JPH A;  4HPP A;  3L54 A;  1YIW A;  3ZTC A;  1WSP A;  2N7J A;  3AU4 A;  1OQR A;  2IO1 B;  4KGT A;  3V05 A;  3I3T B;  1WGH A;  1BML C;  1T6B X;  1V2Y A;  2QSD A;  3L16 A;  2MP2 B;  1WYW B;  3IVF A;  1UGJ A;  4MDK E;  3PRE A;  3EHV A;  4M0W A;  4DBG A;  4C7Z A;  3MJ5 A;  1JRU A;  3MHS D;  3HIZ A;  2L3Z A;  2OED A;  3DQV A;  5IKC M;  1ROE A;  1ZP0 B;  4RMA A;  4P16 A;  3DDC B;  3CIR B;  1ISN A;  3NOB A;  1XQQ A;  2C7N B;  1ESF A;  3OG5 A;  3OLM D;  2JXX A;  1I4P A;  4HCN B;  3Q2A C;  3S2A A;  3H7P A;  4HPM B;  3A33 B;  5FKA C;  1Z2M A;  3P63 A;  2KK8 A;  2C9W B;  1VCB A;  1E7V A;  3ZO5 B;  1YN3 A;  1FNU A;  4W9F A;  3UIP B;  1OFF A;  3ML8 A;  3QQ8 B;  5D3I B;  1ZOY B;  3QCA A;  4ANU A;  2LMC A;  2QCZ A;  2HTM E;  2WXJ A;  4HLE A;  2O2V A;  2LFI A;  1EF1 A;  4HEA 1;  4EZL A;  2PE6 B;  1YJ1 A;  5T8I A;  2ZCC A;  2YLM A;  2LJ5 A;  4HDQ A;  2JRI B;  3Q8E A;  3VXW A;  2LUE A;  1WXA A;  1B1Z A;  3PLU A;  5C23 A;  2N9P C;  1P0R A;  4KGS A;  3KVF B;  4L23 A;  2IDY A;  1VZ6 A;  1NYR A;  2LUM A;  3AXC A;  1WFY A;  1V86 A;  3NJT A;  2MBQ A;  3P4S B;  2V3S A;  5HHD G;  2MSE D;  1NI3 A;  3VH3 B;  3Q69 A;  4WQO B;  4YWG G;  2EMT A;  1AAR A;  1QOB A;  1I7H A;  2RDH A;  1NYQ A;  2ZJD A;  3NUH B;  4TQ1 A;  1KOT A;  1C78 A;  4ZRJ A;  1RWS A;  4BKG A;  3Q3J A;  2MBE A;  1XT9 B;  1JCK B;  3APF A;  2KNB A;  4K7W A;  1CMX B;  3PV1 A;  3DBH B;  4ICV A;  2RSU A;  4EE2 A;  1J7A A;  5C3J B;  2IZV B;  2K6Q A;  1V8C A;  2BKF A;  4IUM B;  3KUD B;  1I42 A;  4BKS A;  1SIJ A;  3CST A;  5DPR A;  3BK2 A;  2C7H A;  3TEZ A;  3APD A;  3WCQ A;  4PS3 A;  2MQJ A;  1K52 A;  3C8Y A;  1SE3 A;  3RZW C;  4DHJ B;  2WXN A;  4LTU A;  1PYW D;  4HXD A;  3AE2 B;  2QJL A;  1WF9 A;  2JX5 A;  1AN8 A;  4I6P A;  2BYT A;  3NRZ A;  2MBB B;  3BY4 B;  1OQQ A;  1I4R A;  1R4M I;  3N1Y C;  5C2T B;  3KUC B;  2GB1 A;  1F1H A;  3MHZ A;  3PZD A;  1MPE A;  4B0M A;  2EKI A;  2BF8 B;  2J53 A;  3A4S C;  4WUR A;  4GGQ A;  4P1B C;  2OOB B;  3JSV B;  3HM3 A;  4F8C B;  2E3T A;  1JRO A;  2KZR A;  1XXG A;  3N1X C;  4N59 A;  2DYO A;  3RNB C;  2DHZ A;  1GB4 A;  2X38 A;  3K9O B;  3KUZ A;  1UNS A;  4F1S A;  5DCN A;  2YEP B;  1WJ4 A;  5BMG A;  1QOA A;  1D5Z C;  1L0Y B;  1HZ6 A;  4C4V B;  1JAL A;  2G4S A;  2NPT B;  1UF0 A;  2WXQ A;  2M17 A;  4ZRQ A;  2QC8 A;  4ANV A;  2DAJ A;  3DHH C;  3EC8 A;  3FAH A;  1Q10 A;  2XK5 B;  1F77 A;  3DWG C;  3NZU A;  4HVB A;  2I2Y A;  4IG7 B;  2LVQ A;  5MPO A;  4LNF A;  2KMM A;  2LWP A;  3RFZ B;  1XLQ A;  2O6V B;  5AZF A;  4BBN C;  2MWS B;  3W9C B;  1OTR B;  1OEY A;  3R2I A;  4YSY B;  3C19 A;  4KKI A;  4BOS C;  4DXA B;  2IO0 B;  3ZYY X;  3AN1 A;  2BQQ A;  2KC2 A;  3IAS 1;  4WQM A;  4N58 A;  2MX2 A;  2JWU A;  4XWW A;  1KLG D;  1IGC A;  1UWM A;  3KYC D;  3VR8 B;  3W1S A;  3CWI A;  4C00 A;  1XLP A;  1N6Z A;  3WAP A;  1PGB A;  3RD2 A;  1PUT A;  3L10 B;  1TJE A;  1UGM A;  4RCO A;  3PHX B;  1E10 A;  1DOI A;  2Z8L A;  1FXT B;  4MT5 A;  1TS3 A;  4XDD A;  2DX5 B;  3AEE B;  1WH3 A;  2D11 A;  4LDT B;  2M19 A;  5GXG B;  3TCA A;  1J19 A;  3V3X A;  3X23 A;  2LJI A;  4ZHO A;  3QJZ A;  4IWO A;  4S17 A;  1F0Z A;  2LXC A;  4KZC A;  4BBN F;  2KXJ A;  3DVG X;  3R8B A;  4W9K A;  1VJK A;  3U7Z A;  3N20 C;  2BB6 A;  4AQ7 A;  2PLP A;  1S3S G;  2PVO D;  1TZO A;  1WXS A;  4LNK A;  2FCS A;  1GG3 A;  1LXD A;  2K3U A;  4LK0 M;  1JWU D;  3DBL I;  5L83 A;  1YQB A;  1N61 A;  1EUV B;  4IWP A;  4KVG B;  3AU5 A;  2IBI B;  2IGH A;  3QA8 A;  4M01 A;  1UWX A;  3W1Y A;  4M8N A;  1SJE D;  4LLG M;  1HEZ E;  2AYO B;  3ZXR A;  1YNT E;  2BWE S;  1T3Q A;  2DBY A;  1WX7 A;  2BS3 B;  1XCT L;  4MGI E;  4WWP A;  2BGF A;  3L0W B;  3H1U A;  4ARI A;  4K7U A;  2IY0 B;  4EZK A;  2L8J A;  1TY2 A;  2WXP A;  2BPS A;  2K8H A;  3QWZ B;  2WDV B;  2CS4 A;  3ZJV A;  2KWC A;  1KM7 A;  3RNA C;  1WR1 A;  1WGR A;  5DPS A;  4NPN A;  4PYU A;  2J42 A;  3ZJU A;  2WX1 A;  4RH6 A;  4LJP B;  5BMI A;  1FO4 A;  1Y8R C;  2D3A A;  4OVU A;  1L0V B;  2N9X A;  4AP4 C;  1QQR A;  2V3P A;  4WH4 A;  4DK5 A;  5D2M B;  1ZW7 A;  1WX9 A;  3V60 A;  3U8Z A;  2MP2 A;  1FEH A;  1V5O A;  1LM8 B;  1VRA B;  1Q5W B;  3M63 B;  5GMV A;  1RAX A;  1FFU A;  2LHD A;  4W9J A;  1T0R C;  3ECI A;  1IUE A;  1EF5 A;  2XBB C;  1CK1 A;  4TUU A;  3TBL D;  3TUO A;  1QZE A;  3H9D A;  2UYZ B;  1IBX A;  4XGA B;  1E8X A;  3HUI A;  2WXI A;  4US8 A;  3PGE A;  1WMH A;  1HA5 A;  1WGY A;  1V1P A;  1WGK A;  2E6X A;  3ZNG C;  2K39 A;  2K5P A;  4AS1 A;  3LB8 C;  2WU2 B;  3NS1 A;  4RNA A;  2FAZ A;  2MRP A;  2WHI A;  3M95 A;  3BK1 A;  2D3C A;  2BTE A;  5G2N A;  3MC9 A;  5HKH A;  1KTK A;  4FLH A;  3ETR A;  5HFY A;  3I9V 1;  1HTO A;  4G3X B;  3TL5 A;  2GBM A;  3AI5 A;  3FIL A;  3AEB B;  4GMV A;  4DHZ E;  3VQI A;  1IYF A;  1WXV A;  4GDL B;  1C4A A;  4KSK C;  1LO5 D;  4EOY A;  2RDG A;  4ARC A;  1E6E B;  3PZ8 A;  4PT5 A;  3PT2 B;  2KTF A;  1ZPS A;  1PFD A;  3FC4 A;  1VLB A;  3Q3M C;  4IM0 A;  1C77 A;  3DVN V;  4XE0 A;  2KAC A;  2BVC A;  4HK2 A;  3TIX A;  5H8Y E;  4KDI C;  1CZP A;  2K8C A;  1L6U A;  3CSF A;  4P7I A;  3SR6 A;  2GI9 A;  3DOW A;  4ZRI A;  3BYT B;  2CU1 A;  4HWI B;  5AUK A;  4CO7 A;  2JRH A;  4B6W A;  5J2R A;  4GU2 A;  4F7Z A;  2LD9 A;  1GC6 A;  2BB5 A;  3M3J A;  4LDT D;  3R2T A;  2L0F A;  1C3T A;  2VH2 A;  2W82 A;  2DWQ A;  4AUQ C;  4M8M A;  3UIN B;  2L76 A;  4C7Y A;  1V97 A;  2DZJ A;  2CHZ A;  1R4M B;  2KJH B;  1LQB A;  4JE3 B;  1JQ4 A;  2W55 A;  2BBC A;  1LFD A;  4WWM A;  2KHW B;  3VTU A;  2N9K A;  3OWE B;  1JWA D;  1K51 A;  2KVR A;  3V62 A;  3O65 B;  4A9A A;  2RD0 A;  1SGH A;  3Q8A A;  4W9E A;  4WAA A;  2KN5 A;  1K53 A;  3RNF C;  1E8Y A;  2BW2 A;  1NBF C;  4FXC A;  3IAM 1;  2WYQ A;  2D3B A;  2WXG A;  4BVU C;  2Z0D B;  3ZNI D;  4ANW A;  2KAN A;  2LRW A;  4HCP B;  4JWS C;  3UQA A;  2UU7 A;  3HHM A;  1TZ1 A;  2CJN A;  2D07 B;  2IY1 B;  2L32 A;  3GS2 A;  4GSW A;  2YEP F;  1E8W A;  2R61 A;  4OVV A;  4RGT A;  1E9M A;  2DZI A;  3BZD B;  1TS5 A;  2WXO A;  3QAQ A;  4M00 A;  4S0R A;  2Y5P A;  4LJO B;  4MM3 A;  3AE1 B;  2BYF A;  4PS7 A;  1VDV A;  2NBW B;  2WXK A;  3IFW B;  2H88 B;  4ICU A;  4ASW C;  1P7F A;  3CF6 E;  3GOE A;  1GNU A;  3PS6 A;  3UI3 A;  3RNE C;  4W9D A;  3T3O A;  4LNO A;  4XX5 A;  3QC8 B;  4FN2 A;  3WAO A;  1WZ3 A;  3DCG A;  2LAS A;  3MC0 B;  5CHV C;  4BFR A;  1RFK A;  1QT9 A;  2IYD B;  3ZRF A;  2NPT A;  4OZB A;  1V6E A;  3BVG A;  2G3Q B;  4HPL B;  5D94 A;  2J0J A;  2ZPY A;  1N63 A;  1SB3 C;  4R3D A;  3MC8 A;  4FHJ A;  2DAF A;  1BUI C;  2K1F A;  5HG2 A;  1E5W A;  2XK5 A;  1RLF A;  3EGR A;  4HJK A;  3AV8 A;  3E9S A;  2RMM A;  4X57 B;  2XEW A;  2Q5W D;  1H8C A;  2NS5 A;  4KSL C;  3A1Q A;  4WAF A;  4NNJ B;  4DHZ B;  1P9D U;  2AX5 A;  4IW0 A;  2FCQ A;  2KQ7 A;  3SEB A;  1GAQ B;  3UF8 A;  5AEK B;  1FRD A;  4J3O D;  1TT5 B;  3N3K B;  4IM3 A;  1T0Q C;  1FM0 D;  4PK1 A;  2V9H A;  4TSS A;  3ZDM C;  2KLC A;  1EU4 A;  3WAL A;  2N0S B;  4HJG E;  3TJP A;  3DBS A;  3VHT C;  1QKZ A;  3PRM B;  4OZA A;  1QIL A;  1L5P A;  1TGZ B;  4NAW B;  4IC7 B;  3IT6 B;  1HQR D;  4IM2 A;  5BYS A;  3GE3 C;  1N5X A;  2PKO A;  2WXF A;  4LCD E;  4MAC A;  3BVM A;  2CR5 A;  2JWZ A;  3NY5 A;  1R4N I;  3AE8 B;  2MH7 A;  3X0W A;  2WDT B;  2CJO A;  2M1M A;  2C5L C;  4KIK A;  2ZVO A;  1D5M C;  3GZN B;  1WWT A;  2UWQ A;  2LXA A;  2QMT A;  3NZS A;  1EWY C;  3LXF A;  4ANX A;  3T3N A;  1KJT A;  1EM7 A;  3RNC C;  3HRD D;  2L00 B;  1E0Z A;  2X8X X;  2ZZP B;  3NVY A;  4GDK A;  2KDI A;  5DPW A;  1SF0 A;  5JXV A;  2JZ3 B;  3AEA B;  1T0S C;  4JL9 A;  1MG8 A;  2ON8 A;  5H92 C;  4MJS A;  1FNW A;  2GBN A;  4DDG D;  3H8H A;  1XD3 B;  1WR6 E;  2I1J A;  4TKN A;  2GBK A;  2JYE A;  1YJJ A;  2CHX A;  3U52 E;  2ZEQ A;  3BIN A;  1ZE3 D;  2B3A A;  4A20 A;  4KDL B;  1OGW A;  3SHQ A;  2HJ1 A;  1FRR A;  3V6E B;  4M0W B;  3AH7 A;  3KWL A;  4YTP B;  4KKJ A;  4KGR A;  2DYM A;  1YN5 A;  3HM6 X;  3ZNZ B;  5LXH A;  3N30 A;  4DXG A;  2K25 A;  3GP7 A;  3PTF C;  1WJN A;  2Y5C A;  1WIA A;  4WJP A;  2KN4 A;  1JML A;  1MG4 A;  3QIJ A;  2RPQ A;  5IP4 D;  3H7P B;  3URY A;  1GC7 A;  1L4D B;  3BII D;  3A9J A;  3B2G A;  2KFJ A;  2GOW A;  1QLB B;  3RZF A;  3HVZ A;  3EUB 2;  3KWV A;  2ICI A;  1H4R A;  2LGS A;  2BT6 A;  2LEK A;  2FBW B;  4P1C C;  3PVL A;  1ET9 A;  4URK A;  2O2V B;  3KQ4 A;  2PPH A;  3M62 B;  2JF5 A;  4WJO A;  4LNN A;  2FCM A;  3UQB A;  1UZX B;  1FCC C;  2JZZ A;  4FUL A;  5LXI B;  2BS2 B;  2A5U A;  3ENE A;  2N7E A;  3P4P B;  4WWO A;  1F2R C;  3T9L A;  2WWZ A;  1GB1 A;  3W5U B;  2XNA C;  1MJD A;  3U7D A;  2ZW0 A;  2DEN B;  3VAW A;  3P42 A;  1N60 A;  1U4A A;  1I4H A;  2VRR B;  2KDE B;  5G5G A;  3RI7 C;  2V4L A;  3AEG B;  1C9F A;  3AE4 B;  3RUI B;  2Z59 B;  3SU8 X;  2L7R A;  2L83 A;  1YQ4 B;  1TY0 A;  1Y56 A;  3R7R A;  4KZ0 A;  2I1K A;  1K50 A;  4ZYS A;  2MHJ A;  3IXS A;  3V61 A;  2KFK A;  3HK0 A;  2W54 A;  2MJ3 A;  2KT7 A;  2KQS A;  1L0X B;  4HDO A;  3AEC B;  1FNV A;  2Y5B B;  1V49 A;  4DDI D;  4JPS A;  1D4B A;  4EFO A;  1TKG A;  3AE6 B;  2M56 B;  1TTN A;  2KWU B;  3A9K A;  1KLU D;  3WAN A;  1WY8 A;  4HRS A;  1ET6 A;  4IKG A;  4ZRP A;  3EEC A;  1XCQ L;  1MI0 A;  5FK9 C;  1MFW A;  5D3D A;  2ZVN A;  2HD5 B;  3ZUN A;  1IPG A;  4FHK A;  2KWV B;  3W2D A;  4FBJ B;  1QOG A;  1FMA D;  1TS4 A;  3JVZ X;  1XF5 L;  1ZXH A;  3TSS A;  2ZNV B;  4B95 A;  3EFU A;  4GIV A;  2FUG 1;  3AE7 B;  4RGO S;  3AB5 A;  2J0K A;  4ITK A;  1N5W A;  4MH8 A;  2INP E;  3ZTD A;  5EE3 A;  2N1W A;  1WXM A;  4DXF A;  2RGF A;  3OJ4 B;  2PIA A;  1PDX A;  2NCN A;  3N9Y C;  4NAM A;  3R66 C;  4FJZ A;  1PGX A;  3VRB B;  3KLS X;  4NQK E;  1SXT A;  4IWQ A;  4II2 B;  3PRZ A;  2L52 A;  3DBR I;  4K81 A;  1J7C A;  4MSQ B;  2C60 A;  4G11 A;  2DLB A;  5TSS A;  2KC1 A;  4C80 A;  3LYY A;  2QIE B;  2AWT A;  3R3M A;  2D10 A;  1WZ0 A;  5E6P A;  4A6Q A;  3AEF B;  3TEW A;  3VUW A;  4RGM A;  3UGB B;  1WRD B;  4CHK A;  1YQ3 B;  2C7M B;  3NZ3 A;  1AW7 A;  2M0A A;  1NI2 A;  1RYJ A;  3Q8B A;  4RF1 A;  4OZC A;  2AEH A;  4GLS C;  4BAX A;  1YD8 U;  2VZK B;  2J4X A;  2KAJ A;  3BWU D;  2V4I B;  3L08 A;  4YSX B;  1FXA A;  4OVZ A;  2NBV B;  1RM6 C;  2M8S A;  2IO3 B;  2OJR A;  2ZPN A;  2OHF A;  2EKE C;  4BOZ B;  3NS8 A;  5DPT A;  4TMA B;  3BYY B;  4LNI A;  1P7E A;  2GMI C;  5IOI A;  1T5X D;  2WNM A;  1NEN B;  1ZXI A;  1GJZ A;  5IO9 A;  3L13 A;  1WJU A;  4P6V F;  4W9L A;  4EUT A;  4US9 A;  3PSE B;  1FIQ A;  4AWJ A;  2K9X A;  2VH1 A;  2ZW1 A;  3MFG A;  2N9E B;  2WDQ B;  2KDB A;  3RCZ A;  4II3 B;  4JX1 C;  3TEY A;  5EE0 A;  3ZW3 A;  3DPD A;  2REX A;  2EMS A;  3GB1 A;  4KX6 B;  5FR6 A;  2PEA A;  2FCN A;  3B08 A;  3GE8 C;  4G50 A;  2JT4 B;  2Z0E B;  2MJE A;  1HTQ A;  5AUI A;  5CHW A;  4BKS D;  3HVD A;  1V1O A;  1DGJ A;  2CU3 A;  3IG3 A;  2IPK D;  4M02 A;  1KRH A;  4HKQ A;  2AL3 A;  3NG0 A;  1YN4 A;  4MGY E;  4TV3 A;  1JWS D;  2WP9 B;  4YTM B;  3AMZ A;  2ONQ A;  4QAY A;  4CYE A;  1TIF A;  1WGD A;  2NTT A;  1ENF A;  1UBQ A;  2PJH A;  2SEB D;  4ZYN A;  2A4Z A;  3SFD B;  1MHX A;  1STE A;  4L1B A;  1JWM D;  3C0R B;  3APC A;  4OW0 A;  1C76 A;  1SEB D;  2M0X A;  3JSV A;  2CKH B;  3U4E G;  4K1R B;  1XO3 A;  1ZUD 2;  4D2K A;  3SDL C;  3DHG C;  3UIO B;  1DOX A;  3WA0 A;  1WXQ A;  3E56 A;  4NZL B;  4Q2J A;  3AE9 B;  2INC C;  1SE9 A;  2NMQ A;  2KOX A;  4W9I A;  2IGD A;  2JVC A;  3U30 A;  1J7B A;  2N9L A;  3VTV A;  5LNK 1;  4JIO U;  4E71 A;  4B0E A;  2FNJ B;  4C4V A;  4I6L B;  1ACC A;  4JWU C;  2JZP A;  2NTS A;  1KFY B;  3RMK C;  3QAR A;  1I4Q A;  4A55 A;  3L17 A;  1IBX B;  2ZCB A;  1FPY A;  2WX0 A;  4B9K A;  4PYZ A;  1WMH B;  3SFE B;  1V1P B;  2WQY B;  2KJ6 A;  1C1Y B;  1F9J A;  1E8Z A;  3N32 A;  4JQW C;  2MBH A;  1AWD A;  1B9R A;  4GOC A;  2PVG C;  2O6V A;  2TSS A;  2PTL A;  4FJV B;  4NJ7 A;  3KYD D;  4K7S A;  1ZDX A;  3ALB A;  2M4N A;  1VZ7 A;  2PE9 A;  1FFV A;  2OJW A;  4GXB A;  3FIL B;  2BYE A;  2WU5 B;  1FD6 A;  1BT0 A;  1SBB B;  3LJ3 A;  1G6J A;  3SD5 A;  2R2O A;  5JZE B;  2DZK A;  2QHO A;  2KTR B;  1E90 A;  2ZNV C;  2VZK D;  2MCN B;  5J18 A;  3D32 A;  1YX5 B;  2PW9 A;  3Q3O C;  2FID A;  3H7S A;  1VZ8 A;  2WS3 B;  3Q3F A;  4AJY B;  4FJY A;  5CHF A;  1WGG A;  3DBL B;  2IGG A;  4UDU C;  3DVG Y;  3DWM A;  1KF6 B;  1E7U A;  4XYC A;  2JYT A;  5I4D A;  4WIP A;  1V5T A;  1J0G A;  1UBI A;  5JHA A;  2LGI A;  3IHP C;  1D5X C;  3P4R B;  1L7Y A;  3ZNH B;  4K3C A;  2PMV A;  3ZKJ C;  1L2N A;  2KX3 A;  1D3Z A;  3T8M A;  2GRI A;  3TEX A; 
#chains in the Genus database with same CATH homology
 3TUO A;  1C79 A;  1WSP A;  2N7J A;  5G5G A;  1OQR A;  1IBX A;  4KGT A;  2KQ4 X;  1TYG B;  3V05 A;  3HUI A;  1BML C;  2WXI A;  3AEG B;  4US8 A;  1C9F A;  1HA5 A;  1T6B X;  3AE4 B;  3Q8F A;  1V1P A;  2QSD A;  1WGK A;  4ZOH C;  2E6X A;  5D7G A;  2K5P A;  1UGJ A;  4AS1 A;  2L83 A;  4M0W A;  3LB8 C;  4C7Z A;  2WU2 B;  3NS1 A;  4RNA A;  1XEE A;  1YQ4 B;  3MJ5 A;  1TY0 A;  3B2F A;  3BK1 A;  1Y56 A;  2G1E A;  2BTE A;  2WXH A;  2OED A;  1K50 A;  1DOY A;  1KTK A;  1NEK B;  3ETR A;  1ROE A;  1ZP0 B;  5HFY A;  3I9V 1;  2MJD A;  4ZYS A;  2WXR A;  1EWC A;  2KDM A;  4P16 A;  1PGA A;  3AEB B;  3CIR B;  3FIL A;  3IXS A;  2ACZ B;  2W54 A;  3VQI A;  2MJ3 A;  4GDL B;  1C4A A;  1ESF A;  1LO5 D;  4TQ0 A;  1L0X B;  2EEL A;  2RDG A;  1I4P A;  4ARC A;  1E6E B;  1FNV A;  3AEC B;  3PZ8 A;  1GOZ A;  4PT5 A;  4CQN A;  4JPS A;  1D4B A;  1IGD A;  5FKA C;  4MM3 B;  1TKG A;  3AE6 B;  2M56 B;  3VRA B;  1ZPS A;  1PFD A;  3P63 A;  1BXT A;  3FC4 A;  3P4Q B;  1KLU D;  1VLB A;  2IJ0 A;  1C77 A;  1L4Z B;  2H89 B;  4HRS A;  1ET6 A;  2KAC A;  4IKG A;  4XE0 A;  1YN3 A;  1FNU A;  4ZRP A;  1XCQ L;  1MI0 A;  2FE8 A;  5FK9 C;  5H8Y E;  1OFF A;  1QF6 A;  2V3N A;  1CZP A;  5D3I B;  5D3D A;  1ZOY B;  3NVZ A;  1L6U A;  1F2R I;  3SR6 A;  2GI9 A;  1ZDV A;  2LMC A;  3I57 A;  2HTM E;  2WXJ A;  4YSZ B;  4YTN B;  2LFI A;  1JWB D;  3BYT B;  1L6V A;  3W2D A;  5AUK A;  4HEA 1;  4YXD B;  1QOG A;  1FMA D;  5T8I A;  1A70 A;  2BS4 B;  1TS4 A;  3Q8E A;  2BB5 A;  3U2S C;  3R2T A;  1B1Z A;  4IDI A;  1XF5 L;  1ZXH A;  3TSS A;  1C4C A;  4HRO A;  2W82 A;  3J9C A;  2FUG 1;  3AE7 B;  4KGS A;  2DWQ A;  3AB5 A;  4RGO S;  2V0G A;  1CJE A;  1N62 A;  1FXI A;  1MHH E;  4L23 A;  2IDY A;  1VZ6 A;  1NYR A;  4C7Y A;  1V97 A;  2LUM A;  4ITK A;  1N5W A;  4MH8 A;  2INP E;  4NJC A;  1JQ4 A;  4JE3 B;  3P4S B;  5EE3 A;  5HHD G;  2W55 A;  2BBC A;  1NI3 A;  4WWM A;  4DXF A;  2N9K A;  2PIA A;  3OWE B;  3Q69 A;  2WDR B;  1JWA D;  1K51 A;  4YWG G;  3W5V B;  1QOB A;  1PDX A;  1I7H A;  2RDH A;  1NYQ A;  2JU6 X;  3NUH B;  4A9A A;  3N9Y C;  1VR9 A;  4NAM A;  4TQ1 A;  3Q8A A;  1PGX A;  3VRB B;  1C78 A;  1K53 A;  3KLS X;  1SXT A;  2BW2 A;  1RWS A;  3IAM 1;  4FXC A;  3IT4 B;  1XLO A;  2WXG A;  2L52 A;  3Q8C A;  1J7C A;  1JCK B;  2DLB A;  5TSS A;  4C80 A;  3LYY A;  2QIE B;  2K0P A;  1J7A A;  4JWS C;  4EE2 A;  1CQV A;  5C3J B;  5HI1 A;  3MP9 A;  1TS2 A;  1V8C A;  4OHJ A;  1GPX A;  2CJN A;  3O13 A;  2L32 A;  3GS2 A;  4A6Q A;  3AEF B;  2YEP F;  4YT0 B;  1SIJ A;  2R61 A;  4RGT A;  1E9M A;  3BZD B;  3TEW A;  3BK2 A;  1TS5 A;  4RGM A;  3TEZ A;  2WXO A;  2AQ3 B;  3WCQ A;  2Y5P A;  5BMH A;  1K52 A;  3AE1 B;  3C8Y A;  1YQ3 B;  2WLB A;  2Y3A A;  1I4X A;  1SE3 A;  2K22 A;  3NZ3 A;  1AW7 A;  1VDV A;  2WXN A;  4LTU A;  1PYW D;  2WXK A;  2SAK A;  2M0A A;  2JQR B;  3AE2 B;  2H88 B;  1RYJ A;  2QJL A;  2JX5 A;  3Q8B A;  1AN8 A;  1P7F A;  4RF1 A;  5E6J A;  4OZC A;  4GLS C;  2BYT A;  3NRZ A;  3UI3 A;  1OQQ A;  2VZK B;  3T3O A;  2WXM A;  1I4R A;  2INN E;  2J4X A;  5C2T B;  2GB1 A;  2KAJ A;  3BWU D;  3MHZ A;  2V4I B;  4YSX B;  3MC0 B;  1FXA A;  4OVZ A;  4REZ A;  1MPE A;  1RM6 C;  4USA A;  2AQ2 B;  4B0M A;  1RFK A;  2EKI A;  1QT9 A;  5FR3 A;  2J53 A;  4WUR A;  4RFB A;  2OHF A;  4OZB A;  4TMA B;  1EU3 A;  3BVG A;  2J52 A;  3BYY B;  2E3T A;  1N63 A;  1SB3 C;  1JRO A;  2LHE A;  1P7E A;  1XXG A;  4R3D A;  4N59 A;  4RF0 A;  2DYO A;  1BUI C;  1T5X D;  5HG2 A;  4IOI E;  2WNM A;  3RPF C;  1NEN B;  4GDK B;  1GB4 A;  1ZXI A;  2X38 A;  3EGR A;  3AV8 A;  3E9S A;  4RGN A;  1UNS A;  2RMM A;  2W3R A;  5BYR A;  2L1A A;  2YEP B;  2Q5W D;  5BMG A;  3ZJT A;  1TKE A;  4P6V F;  1QOA A;  1HXY D;  1D5Z C;  4WAF A;  1L0Y B;  1HZ6 A;  4US9 A;  1FIQ A;  1JAL A;  2AX5 A;  3SEB A;  2K9X A;  1GAQ B;  2WXQ A;  2ZW1 A;  2JSV X;  3MFG A;  4ZRQ A;  2WDQ B;  4JX1 C;  1FRD A;  4J3O D;  1UUP A;  3TEY A;  1SE2 A;  1FM0 D;  3FAH A;  5EE0 A;  4TSS A;  1Q10 A;  1EU4 A;  1D6E C;  2N0S B;  1F77 A;  3GB1 A;  5G5H A;  3DWG C;  4KX6 B;  2I2Y A;  4HJG E;  3BVZ A;  1QKZ A;  5MPO A;  4A90 A;  2MJE A;  5AUI A;  2KMM A;  1QIL A;  4OZA A;  3RFZ B;  3HVD A;  1XLQ A;  1L5P A;  1SSN A;  1V1O A;  1DGJ A;  2CU3 A;  3W9C B;  4NAW B;  3R2I A;  3IT6 B;  2D5G A;  2IPK D;  1KRH A;  4YSY B;  4HKQ A;  4KKI A;  3AED B;  4DQO C;  1HQR D;  2AQ1 B;  4N6E B;  1YN4 A;  3PO0 A;  5BYS A;  3ZYY X;  1N5X A;  1JWS D;  2WP9 B;  3AN1 A;  2PKO A;  4YTM B;  2WXF A;  3AMZ A;  4H2A A;  2ONQ A;  3AE3 B;  1JRP A;  3IAS 1;  3NVW A;  4MAC A;  3BVM A;  4XDC A;  4WQM A;  1NVI D;  2NTT A;  4N58 A;  2JWU A;  1ENF A;  3AE8 B;  4XWW A;  2MH7 A;  1KLG D;  2SEB D;  1R7S A;  1IGC A;  1DYQ A;  1UWM A;  2CJO A;  3VR8 B;  3W1S A;  1WYG A;  3CWI A;  3SFD B;  1MHX A;  1C4P A;  1STE A;  4ZHP A;  1XLP A;  2KWD A;  4L1B A;  1D5M C;  1JWM D;  1PGB A;  1WWT A;  1PUT A;  1TJE A;  4OW0 A;  2QMT A;  1C76 A;  4RCO A;  1SEB D;  1E10 A;  1DOI A;  2Z8L A;  3U4E G;  1EWY C;  2HDE A;  3LXF A;  4MT5 A;  4O1N A;  1TS3 A;  4XDD A;  1XO3 A;  1ZUD 2;  4D2K A;  3AEE B;  3T3N A;  3NVV A;  1DOX A;  1WXQ A;  3E56 A;  4NZL B;  4Q2J A;  3ZGZ A;  1TKY A;  3AE9 B;  1EM7 A;  3HRD D;  2M19 A;  5GXG B;  2NMQ A;  3NVY A;  3V3X A;  1E0Z A;  2LJI A;  4ZHO A;  2IGD A;  3B9J A;  1SJH D;  1J7B A;  1SF0 A;  2MEK A;  2N9L A;  5JXV A;  3AEA B;  1F0Z A;  2RPV A;  5LNK 1;  3R8B A;  2ON8 A;  4B0E A;  1VJK A;  5H92 C;  2I38 A;  4HKZ E;  3U7Z A;  1HZ5 A;  3PZ7 A;  1FNW A;  2BB6 A;  1QOF A;  4AQ7 A;  2B76 B;  1E7P B;  5EE9 A;  1ACC A;  3H8H A;  1M4V A;  2PLP A;  2JZP A;  4JWU C;  2NTS A;  1KFY B;  1I4Q A;  4A55 A;  2PVO D;  1IBX B;  1TZO A;  3ZQ4 A;  1SE4 A;  2K3U A;  2JYE A;  4LK0 M;  1YJJ A;  3U52 E;  2QIL A;  1JWU D;  1V1P B;  2WQY B;  3SFE B;  1N61 A;  3L4P A;  2XN9 C;  1ZE3 D;  3EA6 A;  1WRI A;  1XLN A;  2IGH A;  1FRR A;  1UWX A;  1I4G A;  1AWD A;  3AH7 A;  3KWL A;  1B9R A;  4YTP B;  4KKJ A;  3P1M A;  1SJE D;  4KGR A;  2DYM A;  2PVG C;  1MVK A;  4LLG M;  2TSS A;  1HEZ E;  2PTL A;  1YN5 A;  1AYF A;  1ZDX A;  1YNT E;  3AE5 B;  4DXG A;  1T3Q A;  1VZ7 A;  2DBY A;  2W3S A;  1FFV A;  2BS3 B;  5EE1 A;  3FIL B;  3GP7 A;  2WU5 B;  1XCT L;  1FD6 A;  2Y5C A;  1SBB B;  1FCL A;  2KN4 A;  1JML A;  4ARI A;  4C56 C;  2WXL A;  1TY2 A;  2WXP A;  3AM9 A;  3URY A;  2WDV B;  3ZJV A;  2VZK D;  1L4D B;  3BII D;  2QEJ C;  3B2G A;  2PW9 A;  1QLB B;  3HVZ A;  3EUB 2;  3KWV A;  2ICI A;  5BYQ A;  1YMH E;  2J42 A;  3ZJU A;  2BT6 A;  2LEK A;  4L2Y A;  4RH6 A;  5BMI A;  1FO4 A;  2FBW B;  1VZ8 A;  2WS3 B;  1L0V B;  1ET9 A;  4A8X C;  1JW9 D;  1QQR A;  2V3P A;  3KQ4 A;  4WH4 A;  2IGG A;  4UDU C;  3DWM A;  1KF6 B;  1FCC C;  1FEH A;  1KH0 A;  3VR9 B;  2JYT A;  5I4D A;  2JXT A;  1YJI A;  4WIP A;  1VRA B;  2BS2 B;  2LGI A;  3P4P B;  1F2R C;  1GB1 A;  1D5X C;  3P4R B;  2G9H D;  3W5U B;  4XWT A;  2PMV A;  2XNA C;  1FFU A;  2LHD A;  3ABV B;  2ZW0 A;  2GRI A;  3P42 A;  1IUE A;  1N60 A;  3TEX A;  1I4H A;  1CK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...