1GPXA

C85s gapdx, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLSCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTIDAREDOXIN
publication title The solution structure of a gallium-substituted putidaredoxin mutant: GaPdx C85S.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
total genus 14
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gpxA00
1QOFA 2OHFA 1L0VB 1V97A 3AE5B 3AB5A 3VR9B 4P6VF 3PO0A 4C7YA 3AEFB 3B9JA 2JX5A 2H88B 2BS4B 1YQ3B 1VLBA 1XLPA 4HROA 5AUIA 1J7BA 2CU3A 3AN1A 4N58A 3W5UB 1E0ZA 3NVVA 1WXQA 1L5PA 1JQ4A 4N59A 3HRDD 1RM6C 1ROEA 2G1EA 2ACZB 3AEBB 5C3JB 4A9AA 3HUIA 5H8YE 1VDVA 1NEKB 2W3RA 3P1MA 3RPFC 3B2GA 1WGKA 1GAQB 1WWTA 1NYQA 1E6EB 2PIAA 3AE1B 3AE2B 1ZP0B 1CJEA 3AMZA 2CJNA 3CWIA 3P4QB 4N6EB 1OQQA 3VR8B 1RFKA 4C80A 1L6UA 2K5PA 2W3SA 2Q5WD 1B9RA 1N63A 1XLOA 3AE8B 3P4PB 1FIQA 1N61A 3AH7A 1EWYC 1FFUA 2B76B 3AE7B 1TKYA 2MH7A 3AEAB 2WLBA 3CIRB 3HVZA 3LXFA 1NENB 2KAJA 4ITKA 4YTPB 2DWQA 4YSYB 1TKEA 1YJIA 4US9A 4YXDB 1QOBA 4JX1C 3ABVB 5H92C 3P4RB 3LB8C 1IUEA 2MJDA 1UWMA 3AEDB 1ZUD2 3B2FA 4WQMA 2K22A 1FO4A 1FRDA 2H89B 1XO3A 3W9CB 2AX5A 1TYGB 1L6VA 1E7PB 1YQ4B 1AYFA 1T3QA 2E3TA 2WQYB 3NS1A 4USAA 3FC4A 2LEKA 5G5GA 1DOXA 1VJKA 1N60A 2PVGC 3ETRA 3NVWA 1AWDA 2EKIA 3AE4B 1A70A 2WU2B 2WDVB 1CZPA 3AE9B 3P63A 1WRIA 5C2TB 3WCQA 1OFFA 5EE1A 1DGJA 1JWAD 2QJLA 2PVOD 1N5WA 1R7SA 2L52A 2W55A 3EUB2 3FAHA 1FXIA 1V8CA 1WYGA 5AUKA 3VRAB 4YSZB 4YT0B 1JW9D 5G5HA 2BS3B 2K9XA 3BIID 4ZHPA 2JQRB 2N0SB 1PUTA 2W54A 1KFYB 3P4SB 1ZOYB 5EE0A 5EE3A 1SB3C 4YSXB 1N62A 4ZHOA 1E10A 5MPOA 2M19A 1FFVA 1KF6B 3AE6B 4JWUC 4YTMB 2MJ3A 1XLNA 1FMAD 3SR6A 3SFEB 1FM0D 1NI3A 3AECB 1JRPA 1PFDA 1QLBB 2WS3B 1KRHA 1RWSA 1JWBD 1JROA 1E9MA 2BT6A 2PKOA 1QT9A 2WU5B 1QOGA 3NRZA 3DWMA 1YJJA 4US8A 2HTME 1ZXIA 4HRSA 3AE3B 3AM9A 1N5XA 3AEEB 1PDXA 3VRBB 1I7HA 2CJOA 1FXAA 1GPXA 1FRRA 4LTUA 3AV8A 1QF6A 5GXGB 4JWSC 2FBWB 2BS2B 3DWGC 3L4PA 4ZOHC 3SFDB 2L83A 3NVYA 3KWLA 1F0ZA 2QIEB 1SIJA 2DBYA 4WWMA 2MJEA 4KX6B 4FXCA 2KMMA 1OQRA 1QOAA 3AEGB 3W5VB 5EE9A 1RYJA 1NVID 1NYRA 1XLQA 4YTNB 1SF0A 3NVZA 1J7CA 1TJEA 2M56B 2Y5CA 3ZYYX 4C7ZA 2WDRB 4IDIA 2WDQB 1JALA 1TKGA 1DOYA 2WP9B 1J7AA 1DOIA
chains in the Genus database with same CATH superfamily
2SEBD 3T8MA 2IDYA 3RNAC 2QHOA 3I57A 2LVOA 1MPEA 3VUYA 5BYSA 4HCNB 1L4ZB 2LVQA 4ARCA 3Q8FA 3RMKC 3TJPA 4A9AA 3PS6A 4L1BA 4DXAB 3VR8B 2KO3A 2J42A 3Q69A 2G45B 2CS4A 4OZBA 4YXDB 1FNWA 4GU2A 1GC6A 3HVDA 1WX7A 2K22A 1SJHD 2KANA 2L8JA 4LNOA 1VZ6A 3NS1A 1BT0A 3TEXA 5LNK1 2MX2A 3PHXB 4KIKA 1WRIA 3SEBA 1B9RA 3OLMD 2CHZA 4ACFA 3UGBB 4G0NB 3KYCD 2M19A 2NCNA 1TBEA 4G3XB 4RF0A 4XC2A 2NTTA 1FCLA 3VFKA 1QF6A 1WZ0A 2BS2B 3U30A 2I1JA 1OGWA 4ARIA 1SIJA 1WGGA 4OVUA 2KWUB 5CHWA 3TL5A 3PGEA 3GS2A 4NPNA 2KWVB 4BFRA 3VUXA 1K53A 2MW5A 2M56B 2XK5B 3AE5B 1WY8A 3P2BA 1YMHE 4C7YA 2BS4B 4MACA 4EFOA 3PZ8A 3EGRA 5IO9A 2BB6A 2ZJDA 1VCBA 1JQ4A 4ANWA 2DLBA 4MH8A 3FILA 4HK2A 3HUIA 2ZNVC 1VDVA 4A90A 1EWCA 4RF1A 2LRUA 2M1MA 1Z2MA 4N6EB 4I6PA 2K0PA 4KGTA 3P4PB 3X23A 3AE7B 2AQ2B 2O2VA 1ACCA 4W9JA 5JH5C 1J19A 1SE2A 1UELA 3SDLC 2L05A 1ZGUB 4IWOA 4KVGB 4MSQB 3IAM1 3VUWA 4HKZE 1RAXA 1XO3A 3W9CB 1L2NA 4A3PA 4M8NA 2KACA 4W9HA 1AWDA 2Z0EB 3Q3JA 1EU4A 2KNBA 4S17A 5EE1A 1JWUD 2MEKA 4F8CB 5G5HA 4IOIE 1XCTL 2DZIA 2HTHA 1KF6B 2BBCA 5HFYA 1WI0A 2AL3A 3RFZB 3A9KA 3DWMA 4W9FA 5JHBA 2BYFA 3ML8A 3EHVA 1UZXB 1N5XA 2LASA 4E74A 4W9IA 2PE6B 3APFA 2R61A 2LGDA 1UBIA 3E56A 2D11A 1V9JA 4YTNB 1SF0A 4C7ZA 1TKGA 2JSVX 4GDKA 3V61A 4HLEA 3HHMA 4MGIE 1QZEA 4XX5A 3UI3A 3B9JA 2DZMA 1HQRD 1T0YA 3VXWA 4N58A 3W5UB 3IFWB 2D3CA 2XBBC 4EE2A 1UBQA 1L5PA 3SD5A 1IGCA 3RNFC 3VHTC 2ZNVB 2WXPA 4NQKE 4URKA 5BMIA 1RFKA 2K6QA 1GG3A 5BYRA 2DZKA 3ZRCA 3N30A 1WMHB 4KKIA 1EWYC 3DVGX 3BVGA 2JWZA 3KUCB 2NPTA 1SEBD 4KSLC 4US9A 3TEWA 4ANUA 2QSDA 1UGMA 2INPE 1FRDA 1WR6E 2K1FA 1I4RA 2WXMA 1FXTB 2XNAC 3A9JA 2J4XA 2FIDA 2PVGC 2KFKA 4PT5A 5C2TB 1I42A 3ZIMA 2LRWA 1P0RA 1XCQL 3U2SC 3LDZE 3IXSA 2GI9A 4YT0B 2KX3A 2N9LA 2BS3B 3DBLI 1WFYA 1K51A 3VAWA 4NY0A 2DENB 3ZW3A 3TMPB 1EM7A 2LGIA 2WXLA 1HTQA 2ZCCA 3KLSX 4REZA 2JUOA 2ON8A 4RGOS 3ZTCA 2LGSA 1HXYD 4MT5A 3AE3B 4K7UA 2VRRB 3AEEB 2IY0B 5L95C 2M4NA 2N9XA 3PREA 1V1PA 2KWDA 4LTUA 5BMGA 3QWZB 2DNFA 3NVYA 1WYWB 1RYJA 2C9WB 4S0RA 1UWXA 2FAZA 1EUVB 2WP9B 2WWZA 2WXIA 2OHFA 4HJKA 2BVCA 3DCGA 2FCNA 4B95A 2BWFA 2KVRA 2L76A 4J3OD 4PK1A 3BINA 1WRDB 2JXTA 3A33B 2IO1B 2J0MA 2VH2A 1WE7A 3L16A 4WJOA 1BXTA 1WF9A 4NJ6A 2ACZB 2XEWA 2FUG1 2D10A 2JZZA 4IW0A 3T9LA 4JLCA 2K5PA 2C7MB 1ENFA 3L54A 3AE8B 1P7FA 3GE8C 1XXGA 3ZUNA 1AARA 3IG3A 2B76B 1TKYA 1D5ZC 2DWQA 3ZDMC 3KW5B 1YJIA 2HE7A 1C4PA 3A1QB 2V9HA 1MG8A 2E3TA 2OOBB 1AN8A 5TR5A 2N4FA 4GB9A 2I38A 1CZPA 2QCZA 4PS8A 3ALBA 1OQYA 2PVOD 3FAHA 5AUKA 1WYGA 5T8IA 4E3CA 1JW9D 1L0YB 4M0WA 2BYTA 3RNGC 2A5UA 2OEDA 4ZHOA 2CHXA 2BPSA 2JRIB 4LK0M 4HVBA 1PQSA 4HWIB 3AU4A 4C4VA 3WAMA 2HTME 4LNFA 3PT2B 2ZEQA 3AU5A 3UQBA 2LGXA 2KMMA 2N9EB 3AEGB 3WAPA 2KD0A 2DYMA 2V3NA 1C9FA 4KZCA 3DHHC 3EA6A 1V97A 2C60A 1BUIC 2Y5PA 4HPPA 3UINB 4J6IA 1XLPA 2IO3B 1J7BA 2KOXA 2J0JA 1ZW7A 1WJ6A 4JQWC 3HRDD 2LFIA 3BZDB 1KOTA 2G3QB 4MH0E 2KWCA 4WAAA 5E6JA 3UIPB 1IP9A 2IGGA 2INDC 3WIMA 1L0XB 3L4PA 4ITKA 4RFBA 1V6EA 3Q3OC 4WIPA 1STEA 1KTKA 3ZRFA 2NBUA 2JT4B 3BK2A 1T0RC 3PLVA 3R8BA 4KGRA 2WXGA 1GOZA 1F52A 2HJ1A 1JRUA 3U4EG 2LEKA 2BKFA 1N60A 2IGHA 4HKQA 2WDVB 3RN9C 2L52A 3CF6E 3X0WA 2KQ4X 2NTSA 1V86A 1YN3A 3VTWA 5BO4B 3L0WB 2GBMA 3U7ZA 3Q8AA 2JXXA 2FIFA 1WM3A 2QDFA 1JRPA 4AQ7A 1VR9A 2L0TA 5HI1A 2KJHB 2FNJB 5J18A 2IGDA 2DAJA 2LI5A 2MBHA 4MJSA 2KMAA 3BVZA 3QQ8B 1KLVA 1F77A 3SFDB 3N1YC 2W82A 3WANA 2MJEA 2RPQA 3APDA 3R7RA 3R66C 1VZ8A 4WJPA 2J52A 4AUQC 4TUUA 1DOYA 4ZRQA 4OVZA 4BKGA 1P1AA 2BB5A 3PO0A 4CO7A 2MRPA 3DBLB 2ZW1A 2JX5A 2H88B 4HDQA 3DVNU 1IPGA 4FJYA 3H7PA 3I5JC 4OHJA 4N59A 3ONSA 3AEBB 3ZXRA 1RRBA 4JGHB 2KDIA 4KIKB 5BMHA 3B08A 3HIZA 5CHVC 1YN5A 2M0XA 3WAOA 1WSPA 4BZAA 2KC2A 4HJGE 3I3TB 3H7SA 2BYVE 3LXFA 4ZDVA 4RH6A 1WJUA 3U8ZA 4C00A 5H92C 4UDUC 4P7IA 3KVFB 4G11A 2SAKA 2LWPA 1TIFA 3ZNHB 4OVVA 1V80A 2JYEA 4A8XC 3AE9B 2UU7A 3QJZA 2NVUI 2DYOA 2W55A 1C3TA 4MM3A 2R2OA 4MELA 3BIID 4WWNA 2GRIA 2BWES 4F7ZA 4LCDE 2OJRA 5D3IB 2EMTA 2M17A 4IWQA 3Q6BA 4YSXB 2WXOA 4AWJA 2HDEA 1GJZA 5J17A 3NRZA 1T0QC 4WURA 2KKCA 2HD5B 3RUIB 3T3OA 3R7QA 2FBWB 2RD0A 3DWGC 2WDTB 3FKYA 3P42A 4I6LB 4BKSD 3O13A 1F0ZA 2Z0DB 4CQNA 1P98A 4KX6B 2M8SA 1YN4A 1NYRA 1WR1A 3C19A 4NZLB 3SU8X 3V6CB 5IP4D 1R4MI 2O2VB 3DHGC 3IHPC 3AEFB 3C8YA 3Q3MC 2KDBA 5IN7A 4MGYE 1ROEA 4RGMA 5H8YE 1T6BX 4K3CA 3N9YC 1LFDA 2C7HA 1OQQA 1EO6A 1VRAB 2O6VA 3ML9A 3VH3B 1FPYA 2K3UA 2N9KA 2KAJA 5IOIA 1HZ6A 4FADA 3Q2AC 1PGXA 1NI2A 1FO4A 3JSVB 5CTRC 2K8CA 3KUDB 1AYFA 2K8HA 2LUMA 3FC4A 1VJKA 3NVWA 2PW9A 3P63A 3WCQA 1OFFA 1WXSA 1N5WA 2NS5A 2Z59B 3OWEB 4WJQA 1OEYA 4N9F4 3EFUA 2ZPNA 3BVMA 3QA8A 4BVUC 4ZRPA 1ZKHA 4AOFA 5EE0A 1AW7A 3T3NA 1I4GA 2RSUA 1KJTA 3MHSD 1XD3B 1FEHA 4DQOC 2D3GA 3LYYA 4BOZB 1QT9A 1JCKB 1ZXIA 4MGKE 4IM2A 1C76A 2MCNB 4A55A 5D3DA 4KDIC 3N3KB 5FKAC 4ZOHC 3U7DA 2L83A 1TT5B 2V0GA 3DDCB 3DPDA 4RGTA 1F1HA 1CMXB 3ZYYX 1UNSA 5DPTA 1DOIA 1QOFA 1QILA 3MJWA 4XDDA 4IM0A 2OJWA 2XK5A 2UWQA 3EECA 5HHDG 2WXJA 3BYYB 1K50A 1YQ3B 4EEWA 4GDLB 4HROA 1E0ZA 3OAWA 4KGSA 2J0KA 1L4DB 1RM6C 4MSMB 3KWVA 1TS3A 4TKNA 1I4HA 1XF5L 4LNKA 2KYWA 4RCOA 3IT6B 1ZP0B 3P4QB 4NJ7A 2IO0B 1Z5SB 3S2AA 1FIQA 2XN9C 1MVKA 1JWSD 5GMVA 4RM9A 2EKEC 3PRMB 1S3SG 3RCZA 2NR2A 2MP2B 3P4RB 1KLUD 2WXFA 3BWUD 4GXBA 3QCAA 4ZRKA 1KH0A 4JPSA 2EKIA 2AWTA 3VQIA 1JWAD 2IYDB 2LMCA 2N1VA 1LXDA 3DBSA 1D5MC 4DHZE 4X57B 1ZOYB 2EMSA 1PYWD 2J53A 2MJ3A 3W1SC 2KTRB 2RGFA 4AJYB 1ET6A 1E9MA 3TUOA 5C1ZA 1QOGA 3TSSA 2FE8A 2QC8A 1N6ZA 1IBXB 3ECIA 1D5XC 1VZ7A 4M02A 1U4AA 4KSKC 5DPRA 3Q8BA 1HE8A 2BYEA 3ZNZB 4DXGA 3H1UA 5EE9A 4W9GA 1D4BA 2ICIA 1TJEA 3RZFA 2L1AA 4RM8A 3SR6A 3ENEA 1CK1A 2KLGA 1EF5A 2YLMA 2PJHA 4RGNA 3ZDTA 1LO5D 2INNE 2D3AA 3AN1A 4KV2A 5E6PA 4ASWC 4F1SA 4LDTB 4AS1A 4LNIA 3R2IA 2JZPA 2JZ3B 4GOCA 2KHWB 4FN2A 4GMVA 3AE1B 1HTOA 1R4NB 1CJEA 2CKHB 2NBWB 4C80A 4HCPB 3ZJVA 2X38A 2V4IB 1MG4A 1SJED 1P7EA 4L23A 3AH7A 2WX0A 4JIOU 3CIRB 5KHQA 4HDOA 2JWUA 4YSYB 3GZNI 1WMHA 3PVLA 4JX1C 4EKUA 3IAS1 3A4RA 1ZUD2 1V5TA 1L6VA 4CYEA 5C23A 1C77A 1R4MB 2D2QA 1T5XD 1QKZA 2E6XA 2LZ6A 3ETRA 3V62A 1GNUA 1E8ZA 1TS2A 2INCC 2ZZPB 4H2AA 2GBNA 3V3XA 4BBNF 4GGQA 3HK0A 3L08A 4P16A 2LXAA 1N62A 3W2DA 4M8MA 3ZGZA 3NHEB 3PTFC 4K1RB 1EF1A 4EUTA 4NNJB 2LVPA 2WU5B 4DDID 1I4QA 2N9PC 4L2YA 4CHKA 2N7EA 2GOWA 5IKCM 1B1ZA 1FRRA 3RI7C 4LDTD 2WXHA 2KN4A 1OQRA 1I4PA 5J2RA 4W9EA 3ZTDA 2WDRB 1D6EC 1E5WA 3DBRI 4BAXA 3PZDA 1L0VB 2MQJA 1ESFA 3D32A 4OZCA 4P6VF 1C4AA 4LNNA 3QIJA 1FNUA 1P9DU 4W9CA 2RDHA 4LJOB 4K7WA 4ICVA 3NUHB 4XGAB 1QQRA 1WXAA 3UIOB 1E7VA 2PIAA 4PYUA 2CJNA 3QARA 4WWPA 5LLIA 3HVZA 3DBHI 3Q14C 2REXA 3PPAA 2FCSA 3KUZA 3R2TA 4Q2JA 4PS3A 2L7RA 1UWMA 2KMCA 1YX5B 4B9KA 2QEJC 4NQLB 3RNEC 1TZOA 4EZKA 1YQ4B 4B0EA 5AZGA 3A1QA 1T3QA 4USAA 5G5GA 1SSNA 4FHKA 1E90A 1JWMD 1XQQA 1DGJA 2QJLA 3EUB2 2IO2B 4WAFA 5AEKB 4YL8A 4WH4A 3V6EB 1PUTA 2LJ5A 1WIAA 4YTMB 3Q8EA 1K52A 3SFEB 3MHZA 3K9OB 3NJTA 1RWSA 2NBVB 4DK5A 4US8A 5AZHA 4GLSC 3MFGA 2MSED 2DX5B 2WGSA 3VRBB 3MC9A 2ZVOA 2N7DA 1YD8U 2A4ZA 1C4CA 4WWMA 3PLUA 4FXCA 3N1ZC 3W5VB 2KJ6A 1NVID 3NG0A 2I2YA 2CR5A 2MBEA 1JALA 1J0GA 4IWPA 3I63C 4FLHA 3UQAA 2ZW0A 1SGHA 2G9HD 3TEZA 4G50A 2GBRA 1WXMA 2I1KA 1SIFA 1L7YA 2MBOA 3OJ3A 2W9NA 4XDCA 2WX1A 3NY5A 3PRPB 4K7SA 2LHEA 4NAWA 1WE6A 1GAQB 3DQVA 1NYQA 1WGRA 3Q8CA 2V4LA 2GLSA 4R3DA 3CWIA 1J8CA 1XLOA 3AEAB 1XT9B 2RPVA 3ABVB 5D7GA 5D94A 1E7PB 2IZVB 5D2MB 2ONQA 1DOXA 3AXCA 3OJ4B 3QX1A 5TSSA 5DPWA 2Y3AA 4KZ0A 2DYBA 3VRAB 4RMAA 1Q10A 4BKTA 4TV3A 4KKJA 3B1LX 3ZKJC 2MA9B 3JW0X 2BKRB 2VH1A 4PYZA 4ANXA 4DWFA 3OG5A 2JVCA 2KZRA 1XLNA 2J7QB 1PFDA 2KQSA 2WXNA 4YWGG 3K9PB 4TSSA 4TQ1A 2YEPB 1LQBA 4KDLB 4D2KA 5IAAC 2AEHA 3M62B 5L83A 4WJNA 1GPXA 3M63B 3AV8A 1EU3A 2QMTA 3GZNB 1CQVA 2V1YA 3TIXA 2K25A 1QOAA 2GBKA 5HKHA 3NVZA 3VTUA 2G4DB 2O6VB 2JPHA 3NS8A 1TY2A 2PE9A 2KX0A 1ISNA 1R4NI 2RDGA 1VLBA 3RD2A 3FILB 3SHQA 4W9KA 4B6WA 3I9V1 1Q0WB 2MWSB 4IG7B 4BKSA 4IUMB 2G1EA 3PZ7A 5C3JB 4K81A 1T0SC 3IBEA 5BYQA 3ZJTA 2C7NB 3RPFC 1WGKA 3CMMB 1YOVB 1NDDA 1YQBA 2Q5WD 3AULA 3Q3FA 4ANVA 1OTRB 3N32A 3ZVVA 1FFUA 4FJVB 4ICUA 1UH6A 1NBFC 1E7UA 1FD6A 3H9DA 1IYFA 3DBRB 1A5RA 2AL6A 3N1XC 1YJ1A 1WJNA 4ZYSA 2PPHA 5CX3A 3GB1A 1UD7A 3V60A 2PTLA 3NVVA 4ZHPA 5JXVA 4MEMA 5G55A 4NJCA 4XWTA 3DHIC 2K6DB 3A4SC 2JQRB 2N0SB 3NZ3A 1SB3C 1F2RI 3ZNID 5MPOA 3A9KB 5LXHA 1FM0D 1FNVA 2O6VD 3MC0B 4HRSA 3AM9A 1WX8A 2FCMA 1PDXA 3DBHB 2CJOA 1H4RA 1FXAA 3EC8A 4FULA 5GXGB 1GC7A 4JWSC 2LHDA 4DHZB 2V3SA 2GMIC 3KWLA 1DYQA 1SE4A 4TQ0A 3IT4B 3C0RB 2RR9A 3VVWB 3CSFA 4GDKB 2K39A 1WX9A 3ZQ4A 4IDIA 1TY0A 3LJ3A 3V05A 1V49A 3QC8B 4W9LA 2G4SA 1Q1OA 2CU3A 1KM7A 2KXJA 2VZKB 2X8XX 1RLFA 5JZEB 2FCQA 1WGHA 1Y56A 1TS5A 4W9DA 5EDSA 4II2B 2DHZA 4HXDA 1IGDA 1WWTA 5E6NA 2NPTB 4WWOA 1GB1A 3U52E 3DOWA 1HEZE 1N61A 3M3JA 4BOSC 1WH3A 5G2NA 1TKEA 2RDBC 3A9JB 1IUEA 3ZJUA 3MJ5A 4HPMB 1Y8RC 2KFKB 3L17A 2IY1B 1TYGB 3ZNGC 3ZLZA 4IC7B 1MJDA 2D07B 1BMLC 2JRHA 3KYDD 1FCCC 3JSVA 2JYTA 4M01A 2JF5A 3DVGY 1MFWA 2Y5BB 4P1CC 3P4SB 2R2QA 5D6JB 1V2YA 1M4VA 2KDMA 2C5LC 2B3AA 3AE6B 4JWUC 3GOEA 1ZE3D 1QLBB 1ZXHA 1V1PB 2KT7A 1YJJA 3M95A 3RULA 2BW2A 5KHOA 3JVZX 4AP4C 3CSTA 2KDEB 2VZKD 4DDGD 2TSSA 4GN1A 2BTEA 4NAMA 5DCNA 2Y5CA 3N20C 2NMQA 3GE3C 2YVCA 1J7AA 2KDFB 3H8HA 1MHHE 4FA6A 3VH4B 2EELA 4E71A 3GP7A 4ZRIA 2PLPA 1F2RC 4DXFA 1UF0A 1WXQA 3NOBA 4GDLA 4AJWA 1I4XA 1WGDA 1LGRA 3B2GA 3H6NA 1PGAA 2KK8A 2RMMA 1YNTE 2KVZA 5FR6A 2KFJA 3PSEB 2WYQA 2D5GA 3B0AA 4IM3A 4K3BA 2ZPYA 2MH7A 1NENB 4WQOB 4XE0A 2KN5A 5E6OA 3EFCA 3LB8C 2MJDA 1GB4A 3L13A 1WJ4A 2N7JA 4WQMA 4FBJB 1K8RB 2AX5A 2YEPF 2MP2A 2BQQA 1X1MA 4A20A 4M0WB 2BF8B 4II3B 4ZRJA 2W54A 4DHJB 4GIVA 1SE3A 2DZJA 4C4VB 1FMAD 2ASQA 3AECB 4HPLB 4EZLA 2BT6A 1UGJA 3HM3A 2KTRA 3URYA 1SE9A 2BGFA 1I7HA 1IBXA 2GBJA 3PHWB 2DBYA 4LJPB 1F9JA 3WA0A 4MDKE 1J7CA 2WDQB 3QK0A 3W1YA 2V3PA 2K8BA 3NZUA 2HJ8A 3AB5A 4EOYA 5AZFA 2LD9A 2IJ0A 1E8XA 3RT3B 2WXQA 5AUIA 4EZJA 2L0FA 2WXRA 2MBQA 4P1BC 2MHJA 3NZSA 3UF8A 1NEKB 2CU1A 2W3RA 4MGZE 5I4DA 1E6EB 3ZXVA 4OZAA 4GSWA 1TGZB 1L6UA 2JY6A 1I35A 3IVFA 1N63A 1SXTA 1WM2A 4FHJA 1RFAA 3TEYA 4HEA1 2WLBA 3O65B 4DHJD 4YTPB 1ZDVA 3BY4B 3BYTB 2IBIB 1QOBA 3AEDB 3B2FA 5LXIB 2L00B 2H89B 2PEAA 2WXKA 3PV1A 4QAYA 3AE4B 2WU2B 2ZCBA 2GB1A 1R7SA 1V8CA 3WALA 1JMLA 3QHTA 1ET9A 4I6NB 5JHAA 5EE3A 3HM6X 3RZWC 1E10A 5HG2A 1FFVA 2KTFA 1ZDXA 4JL9A 4MJSB 1NI3A 1Q5WB 1JWBD 1JROA 1KRHA 2KQ7A 2PKOA 1WZ3A 2AYOB 3W1SA 1D3ZA 1UUPA 1TS4A 1GUAB 1ZPSA 4OW0A 3L10B 4NAWB 5DPSA 1HZ5A 1E8YA 4A3OA 2MBBB 4RNAA 3MC8A 4XYCA 1XLQA 1KLGD 4LLGM 1HA5A 2KLCA 2LXCA 3KH0A 3RNCC 3VR9B 3DVNV 1YIWA 4A6QA 2LGYA 3VDZA 2KJRA 3H7PB 2JU6X 1SBBB 4B0MA 4DBGA 2QILA 2Z8LA 4C56C 1C78A 3VTVA 3E9SA 3J9CA 1YX6B 3P1MA 3MP9A 2CHWA 3R3MA 2IPKD 2MLBA 3AE2B 2PMVA 3AMZA 1PGBA 3APCA 2W3SA 4PS7A 1V5OA 2WNMA 1C79A 4TMAB 1WGYA 4O1NA 2L3ZA 3RYTA 2WHIA 4FJZA 2AQ1B 1MI0A 2WQYB 3AI5A 2AQ3B 1P3QU 5FK9C 4MM3B 2LJIA 1A70A 4XWWA 2D3BA 1V81A 1XEEA 2M0AA 4JE3B 1OEYJ 5FR3A 1FXIA 3Q3NC 1VD2A 3JYUA 4YSZB 1H8CA 1E8WA 2FUHB 2K9XA 2UYZB 1KFYB 4IKGA 4BBNC 3ZO5B 5IA7A 2L32A 1S1QB 2WS3B 2DAFA 1G6JA 2N1WA 1C1YB 2LUEA 4XZ4A 1TTNA 3RNBC 3MTNB 3PRZA 1WXVA 1TZ1A 4ZYNA 2KC1A 1V1OA 3TCAA 2QIEB 5CHFA 3KQ4A 1M94A 3QAQA 1MHXA 3BK1A 3TBLD 1LM8B 2ZVNA 4M00A
chains in the Genus database with same CATH topology
1V97A 2SEBD 3V05A 1CK1A 1BUIC 2IDYA 2Y5PA 3I57A 4RGNA 1LO5D 2INNE 1MPEA 5BYSA 1XLPA 1J7BA 2CU3A 3AN1A 1L4ZB 4AS1A 2VZKB 3R2IA 2JZPA 3HRDD 2LFIA 4ARCA 3Q8FA 3BZDB 1Y56A 1TS5A 4A9AA 1IGDA 1WWTA 4L1BA 3AE1B 1CJEA 4C80A 5E6JA 3VR8B 2X38A 2V4IB 3ZJVA 2IGGA 2J42A 1SJED 1GB1A 1P7EA 4L23A 3U52E 3Q69A 1HEZE 1L0XB 1N61A 3AH7A 3L4PA 3CIRB 4ITKA 4RFBA 2JWUA 4WIPA 4OZBA 4YSYB 1STEA 1TKEA 4YXDB 1KTKA 4JX1C 1FNWA 3BK2A 3IAS1 3R8BA 1IUEA 4KGRA 1ZUD2 3HVDA 2WXGA 1GOZA 3ZJUA 3MJ5A 2K22A 1SJHD 1L6VA 1TYGB 1C77A 1VZ6A 3NS1A 3U4EG 3TEXA 5LNK1 1T5XD 1QKZA 2E6XA 2LEKA 1BMLC 3ETRA 1FCCC 1N60A 2IGHA 2JYTA 4HKQA 2WDVB 1TS2A 1WRIA 3SEBA 1B9RA 2L52A 4H2AA 3V3XA 2KQ4X 2NTSA 1YN3A 3P4SB 3W2DA 4P16A 1M4VA 1N62A 3U7ZA 2KDMA 2M19A 3AE6B 3Q8AA 4JWUC 3ZGZA 1ZE3D 1JRPA 1QLBB 2WU5B 4AQ7A 1ZXHA 1I4QA 1V1PB 1VR9A 4L2YA 5HI1A 1YJJA 2IGDA 4RF0A 3BVZA 1B1ZA 2NTTA 1FCLA 1FRRA 2BW2A 1QF6A 1F77A 3SFDB 2BS2B 2W82A 4ARIA 1SIJA 2VZKD 2WXHA 2MJEA 2KN4A 1OQRA 2TSSA 1I4PA 3GS2A 1VZ8A 2BTEA 4NAMA 1K53A 2J52A 2M56B 2Y5CA 1DOYA 2WDRB 1D6EC 2NMQA 4ZRQA 1J7AA 3AE5B 4OVZA 1L0VB 2BB5A 1ESFA 3H8HA 1MHHE 2EELA 1YMHE 4OZCA 1C4AA 3GP7A 3PO0A 4P6VF 4C7YA 2PLPA 2ZW1A 2JX5A 1FNUA 2H88B 2BS4B 4MACA 2RDHA 3PZ8A 3EGRA 1F2RC 2BB6A 4DXFA 1WXQA 1JQ4A 4OHJA 4N59A 2DLBA 4MH8A 3FILA 3NUHB 3AEBB 3HUIA 1I4XA 1QQRA 5BMHA 1VDVA 4A90A 1EWCA 3B2GA 4RF1A 1PGAA 2PIAA 2RMMA 4N6EB 1YNTE 2CJNA 1YN5A 2D5GA 2K0PA 1WSPA 4KGTA 3P4PB 4HJGE 3HVZA 3AE7B 2AQ2B 2MH7A 3LXFA 1NENB 1ACCA 4RH6A 4XE0A 1SE2A 3R2TA 4Q2JA 5H92C 4UDUC 3IAM1 3LB8C 2MJDA 1UWMA 1GB4A 4HKZE 2N7JA 4WQMA 2SAKA 2QEJC 1TZOA 1XO3A 3W9CB 2AX5A 1YQ4B 4B0EA 2YEPF 1T3QA 4USAA 5G5GA 2KACA 1SSNA 2JYEA 4A8XC 1AWDA 3AE9B 1EU4A 1JWMD 5EE1A 1DGJA 2QJLA 3EUB2 2DYOA 2W55A 4WAFA 1JWUD 2MEKA 5G5HA 4WH4A 3BIID 4IOIE 2W54A 2GRIA 1PUTA 1XCTL 5D3IB 4YSXB 1SE3A 1KF6B 2BBCA 4YTMB 2WXOA 1FMAD 3Q8EA 1K52A 5HFYA 3SFEB 3MHZA 3AECB 2HDEA 3RFZB 1RWSA 2BT6A 3NRZA 4WURA 3DWMA 1UGJA 4US8A 1N5XA 4GLSC 3MFGA 3URYA 3T3OA 3VRBB 1I7HA 2FBWB 3P42A 3DWGC 1IBXA 3O13A 1C4CA 1F0ZA 4CQNA 2DBYA 2R61A 4WWMA 4KX6B 4FXCA 3W5VB 3E56A 1YN4A 1NVID 1NYRA 4YTNB 1SF0A 4C7ZA 1J7CA 2I2YA 4NZLB 2WDQB 1JALA 1TKGA 2JSVX 2V3PA 3AB5A 2ZW0A 2G9HD 3TEZA 3AEFB 3UI3A 3B9JA 2IJ0A 1HQRD 2WXQA 5AUIA 4N58A 3C8YA 3W5UB 2WXRA 4EE2A 4XDCA 1L5PA 1ROEA 4RGMA 1IGCA 5H8YE 2WXPA 2LHEA 1NEKB 1T6BX 2W3RA 5I4DA 1GAQB 3Q8CA 1NYQA 3N9YC 1E6EB 5BMIA 4R3DA 3CWIA 1OQQA 1RFKA 4OZAA 1L6UA 1VRAB 5BYRA 1N63A 1XLOA 1SXTA 3TEYA 4KKIA 1EWYC 3AEAB 3BVGA 2WLBA 4HEA1 2K3UA 2N9KA 2KAJA 2RPVA 4YTPB 1ZDVA 1SEBD 3BYTB 4US9A 1HZ6A 1QOBA 3TEWA 3ABVB 1PGXA 3AEDB 3B2FA 2QSDA 5D7GA 2INPE 1FO4A 1FRDA 2H89B 1E7PB 1I4RA 1AYFA 2LUMA 2WXMA 2XNAC 2J4XA 2ONQA 2WXKA 3FC4A 1DOXA 1VJKA 3NVWA 2PVGC 2PW9A 3AE4B 4PT5A 2WU2B 5C2TB 3P63A 3WCQA 1OFFA 2GB1A 5TSSA 1N5WA 1R7SA 2Y3AA 1XCQL 3VRAB 3U2SC 1V8CA 3OWEB 3IXSA 2GI9A 1JMLA 4YT0B 1Q10A 4KKJA 2N9LA 2BS3B 3BVMA 4ZRPA 1ET9A 5EE0A 1AW7A 1K51A 3T3NA 1I4GA 5EE3A 1E10A 5HG2A 1FFVA 1ZDXA 1XLNA 1EM7A 1FEHA 1NI3A 2LGIA 2WXLA 4DQOC 3KLSX 4REZA 1PFDA 2ON8A 1JWBD 1JROA 1KRHA 2WXNA 3LYYA 4RGOS 2PKOA 1QT9A 4TSSA 4YWGG 1JCKB 4TQ1A 3W1SA 2YEPB 1UUPA 1HXYD 1ZXIA 4MT5A 3AE3B 4D2KA 3AEEB 1C76A 1TS4A 1V1PA 1GPXA 4A55A 5D3DA 2KWDA 3AV8A 1ZPSA 4LTUA 5FKAC 1EU3A 2QMTA 4OW0A 1CQVA 5BMGA 4ZOHC 2L83A 3NVYA 4NAWB 1QOAA 1HZ5A 2V0GA 4RGTA 1RYJA 4RNAA 1UWXA 1XLQA 1KLGD 3NVZA 3ZYYX 1UNSA 4LLGM 1HA5A 2WP9B 1TY2A 2WXIA 1DOIA 1QOFA 2OHFA 1QILA 3VR9B 4XDDA 5HHDG 4A6QA 2WXJA 3BYYB 1K50A 2RDGA 1YQ3B 1VLBA 2JU6X 4J3OD 1SBBB 4B0MA 4GDLB 2JXTA 3FILB 4HROA 2QILA 2Z8LA 1E0ZA 3I9V1 4C56C 1C78A 4KGSA 1L4DB 1BXTA 1RM6C 2G1EA 2ACZB 3E9SA 3J9CA 3KWVA 1TS3A 3PZ7A 5C3JB 5BYQA 2FUG1 1I4HA 1XF5L 3P1MA 3ZJTA 3RPFC 1WGKA 3MP9A 2IPKD 4RCOA 3AE2B 1ZP0B 3IT6B 2PMVA 3AMZA 1PGBA 3P4QB 2K5PA 2W3SA 2Q5WD 1ENFA 3AE8B 1P7FA 1XXGA 1FIQA 2XN9C 2WNMA 1C79A 1MVKA 1FFUA 1JWSD 2B76B 1TKYA 1D5ZC 2DWQA 1YJIA 4TMAB 1C4PA 1FD6A 3P4RB 1KLUD 4O1NA 2AQ1B 1MI0A 2WXFA 3BWUD 2E3TA 2WQYB 1AN8A 2AQ3B 4ZYSA 5FK9C 3GB1A 1KH0A 4JPSA 2EKIA 4MM3B 2I38A 1A70A 2LJIA 3VQIA 1CZPA 4XWWA 1XEEA 2M0AA 4JE3B 2PTLA 3NVVA 1JWAD 4ZHPA 2PVOD 3FAHA 5AUKA 5JXVA 5FR3A 1FXIA 1WYGA 2LMCA 4YSZB 5T8IA 1JW9D 1L0YB 4M0WA 1D5MC 4NJCA 4XWTA 2BYTA 2K9XA 2JQRB 2N0SB 1KFYB 1ZOYB 3NZ3A 2OEDA 1SB3C 4IKGA 4ZHOA 1F2RI 1PYWD 5MPOA 2J53A 2MJ3A 4LK0M 1FM0D 2L32A 1FNVA 2WS3B 1ET6A 3MC0B 1E9MA 3TUOA 1QOGA 2HTME 4HRSA 3TSSA 3AM9A 2FE8A 1IBXB 1PDXA 2CJOA 1D5XC 1FXAA 1VZ7A 5GXGB 4JWSC 2LHDA 1V1OA 3KWLA 1DYQA 2QIEB 1SE4A 3KQ4A 3Q8BA 4TQ0A 3IT4B 2KMMA 3AEGB 4DXGA 5EE9A 4GDKB 1MHXA 1D4BA 3BK1A 2DYMA 3ZQ4A 2V3NA 2ICIA 1TJEA 2L1AA 4IDIA 1C9FA 1TY0A 3SR6A 3EA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QOF A;  2OHF A;  1L0V B;  1V97 A;  3AE5 B;  3AB5 A;  3VR9 B;  4P6V F;  3PO0 A;  4C7Y A;  3AEF B;  3B9J A;  2JX5 A;  2H88 B;  2BS4 B;  1YQ3 B;  1VLB A;  1XLP A;  4HRO A;  5AUI A;  1J7B A;  2CU3 A;  3AN1 A;  4N58 A;  3W5U B;  1E0Z A;  3NVV A;  1WXQ A;  1L5P A;  1JQ4 A;  4N59 A;  3HRD D;  1RM6 C;  1ROE A;  2G1E A;  2ACZ B;  3AEB B;  5C3J B;  4A9A A;  3HUI A;  5H8Y E;  1VDV A;  1NEK B;  2W3R A;  3P1M A;  3RPF C;  3B2G A;  1WGK A;  1GAQ B;  1WWT A;  1NYQ A;  1E6E B;  2PIA A;  3AE1 B;  3AE2 B;  1ZP0 B;  1CJE A;  3AMZ A;  2CJN A;  3CWI A;  3P4Q B;  4N6E B;  1OQQ A;  3VR8 B;  1RFK A;  4C80 A;  1L6U A;  2K5P A;  2W3S A;  2Q5W D;  1B9R A;  1N63 A;  1XLO A;  3AE8 B;  3P4P B;  1FIQ A;  1N61 A;  3AH7 A;  1EWY C;  1FFU A;  2B76 B;  3AE7 B;  1TKY A;  2MH7 A;  3AEA B;  2WLB A;  3CIR B;  3HVZ A;  3LXF A;  1NEN B;  2KAJ A;  4ITK A;  4YTP B;  2DWQ A;  4YSY B;  1TKE A;  1YJI A;  4US9 A;  4YXD B;  1QOB A;  4JX1 C;  3ABV B;  5H92 C;  3P4R B;  3LB8 C;  1IUE A;  2MJD A;  1UWM A;  3AED B;  1ZUD 2;  3B2F A;  4WQM A;  2K22 A;  1FO4 A;  1FRD A;  2H89 B;  1XO3 A;  3W9C B;  2AX5 A;  1TYG B;  1L6V A;  1E7P B;  1YQ4 B;  1AYF A;  1T3Q A;  2E3T A;  2WQY B;  3NS1 A;  4USA A;  3FC4 A;  2LEK A;  5G5G A;  1DOX A;  1VJK A;  1N60 A;  2PVG C;  3ETR A;  3NVW A;  1AWD A;  2EKI A;  3AE4 B;  1A70 A;  2WU2 B;  2WDV B;  1CZP A;  3AE9 B;  3P63 A;  1WRI A;  5C2T B;  3WCQ A;  1OFF A;  5EE1 A;  1DGJ A;  1JWA D;  2QJL A;  2PVO D;  1N5W A;  1R7S A;  2L52 A;  2W55 A;  3EUB 2;  3FAH A;  1FXI A;  1V8C A;  1WYG A;  5AUK A;  3VRA B;  4YSZ B;  4YT0 B;  1JW9 D;  5G5H A;  2BS3 B;  2K9X A;  3BII D;  4ZHP A;  2JQR B;  2N0S B;  1PUT A;  2W54 A;  1KFY B;  3P4S B;  1ZOY B;  5EE0 A;  5EE3 A;  1SB3 C;  4YSX B;  1N62 A;  4ZHO A;  1E10 A;  5MPO A;  2M19 A;  1FFV A;  1KF6 B;  3AE6 B;  4JWU C;  4YTM B;  2MJ3 A;  1XLN A;  1FMA D;  3SR6 A;  3SFE B;  1FM0 D;  1NI3 A;  3AEC B;  1JRP A;  1PFD A;  1QLB B;  2WS3 B;  1KRH A;  1RWS A;  1JWB D;  1JRO A;  1E9M A;  2BT6 A;  2PKO A;  1QT9 A;  2WU5 B;  1QOG A;  3NRZ A;  3DWM A;  1YJJ A;  4US8 A;  2HTM E;  1ZXI A;  4HRS A;  3AE3 B;  3AM9 A;  1N5X A;  3AEE B;  1PDX A;  3VRB B;  1I7H A;  2CJO A;  1FXA A;  1GPX A;  1FRR A;  4LTU A;  3AV8 A;  1QF6 A;  5GXG B;  4JWS C;  2FBW B;  2BS2 B;  3DWG C;  3L4P A;  4ZOH C;  3SFD B;  2L83 A;  3NVY A;  3KWL A;  1F0Z A;  2QIE B;  1SIJ A;  2DBY A;  4WWM A;  2MJE A;  4KX6 B;  4FXC A;  2KMM A;  1OQR A;  1QOA A;  3AEG B;  3W5V B;  5EE9 A;  1RYJ A;  1NVI D;  1NYR A;  1XLQ A;  4YTN B;  1SF0 A;  3NVZ A;  1J7C A;  1TJE A;  2M56 B;  2Y5C A;  3ZYY X;  4C7Z A;  2WDR B;  4IDI A;  2WDQ B;  1JAL A;  1TKG A;  1DOY A;  2WP9 B;  1J7A A;  1DOI A; 
#chains in the Genus database with same CATH topology
 2SEB D;  3T8M A;  2IDY A;  3RNA C;  2QHO A;  3I57 A;  2LVO A;  1MPE A;  3VUY A;  5BYS A;  4HCN B;  1L4Z B;  2LVQ A;  4ARC A;  3Q8F A;  3RMK C;  3TJP A;  4A9A A;  3PS6 A;  4L1B A;  4DXA B;  3VR8 B;  2KO3 A;  2J42 A;  3Q69 A;  2G45 B;  2CS4 A;  4OZB A;  4YXD B;  1FNW A;  4GU2 A;  1GC6 A;  3HVD A;  1WX7 A;  2K22 A;  1SJH D;  2KAN A;  2L8J A;  4LNO A;  1VZ6 A;  3NS1 A;  1BT0 A;  3TEX A;  5LNK 1;  2MX2 A;  3PHX B;  4KIK A;  1WRI A;  3SEB A;  1B9R A;  3OLM D;  2CHZ A;  4ACF A;  3UGB B;  4G0N B;  3KYC D;  2M19 A;  2NCN A;  1TBE A;  4G3X B;  4RF0 A;  4XC2 A;  2NTT A;  1FCL A;  3VFK A;  1QF6 A;  1WZ0 A;  2BS2 B;  3U30 A;  2I1J A;  1OGW A;  4ARI A;  1SIJ A;  1WGG A;  4OVU A;  2KWU B;  5CHW A;  3TL5 A;  3PGE A;  3GS2 A;  4NPN A;  2KWV B;  4BFR A;  3VUX A;  1K53 A;  2MW5 A;  2M56 B;  2XK5 B;  3AE5 B;  1WY8 A;  3P2B A;  1YMH E;  4C7Y A;  2BS4 B;  4MAC A;  4EFO A;  3PZ8 A;  3EGR A;  5IO9 A;  2BB6 A;  2ZJD A;  1VCB A;  1JQ4 A;  4ANW A;  2DLB A;  4MH8 A;  3FIL A;  4HK2 A;  3HUI A;  2ZNV C;  1VDV A;  4A90 A;  1EWC A;  4RF1 A;  2LRU A;  2M1M A;  1Z2M A;  4N6E B;  4I6P A;  2K0P A;  4KGT A;  3P4P B;  3X23 A;  3AE7 B;  2AQ2 B;  2O2V A;  1ACC A;  4W9J A;  5JH5 C;  1J19 A;  1SE2 A;  1UEL A;  3SDL C;  2L05 A;  1ZGU B;  4IWO A;  4KVG B;  4MSQ B;  3IAM 1;  3VUW A;  4HKZ E;  1RAX A;  1XO3 A;  3W9C B;  1L2N A;  4A3P A;  4M8N A;  2KAC A;  4W9H A;  1AWD A;  2Z0E B;  3Q3J A;  1EU4 A;  2KNB A;  4S17 A;  5EE1 A;  1JWU D;  2MEK A;  4F8C B;  5G5H A;  4IOI E;  1XCT L;  2DZI A;  2HTH A;  1KF6 B;  2BBC A;  5HFY A;  1WI0 A;  2AL3 A;  3RFZ B;  3A9K A;  3DWM A;  4W9F A;  5JHB A;  2BYF A;  3ML8 A;  3EHV A;  1UZX B;  1N5X A;  2LAS A;  4E74 A;  4W9I A;  2PE6 B;  3APF A;  2R61 A;  2LGD A;  1UBI A;  3E56 A;  2D11 A;  1V9J A;  4YTN B;  1SF0 A;  4C7Z A;  1TKG A;  2JSV X;  4GDK A;  3V61 A;  4HLE A;  3HHM A;  4MGI E;  1QZE A;  4XX5 A;  3UI3 A;  3B9J A;  2DZM A;  1HQR D;  1T0Y A;  3VXW A;  4N58 A;  3W5U B;  3IFW B;  2D3C A;  2XBB C;  4EE2 A;  1UBQ A;  1L5P A;  3SD5 A;  1IGC A;  3RNF C;  3VHT C;  2ZNV B;  2WXP A;  4NQK E;  4URK A;  5BMI A;  1RFK A;  2K6Q A;  1GG3 A;  5BYR A;  2DZK A;  3ZRC A;  3N30 A;  1WMH B;  4KKI A;  1EWY C;  3DVG X;  3BVG A;  2JWZ A;  3KUC B;  2NPT A;  1SEB D;  4KSL C;  4US9 A;  3TEW A;  4ANU A;  2QSD A;  1UGM A;  2INP E;  1FRD A;  1WR6 E;  2K1F A;  1I4R A;  2WXM A;  1FXT B;  2XNA C;  3A9J A;  2J4X A;  2FID A;  2PVG C;  2KFK A;  4PT5 A;  5C2T B;  1I42 A;  3ZIM A;  2LRW A;  1P0R A;  1XCQ L;  3U2S C;  3LDZ E;  3IXS A;  2GI9 A;  4YT0 B;  2KX3 A;  2N9L A;  2BS3 B;  3DBL I;  1WFY A;  1K51 A;  3VAW A;  4NY0 A;  2DEN B;  3ZW3 A;  3TMP B;  1EM7 A;  2LGI A;  2WXL A;  1HTQ A;  2ZCC A;  3KLS X;  4REZ A;  2JUO A;  2ON8 A;  4RGO S;  3ZTC A;  2LGS A;  1HXY D;  4MT5 A;  3AE3 B;  4K7U A;  2VRR B;  3AEE B;  2IY0 B;  5L95 C;  2M4N A;  2N9X A;  3PRE A;  1V1P A;  2KWD A;  4LTU A;  5BMG A;  3QWZ B;  2DNF A;  3NVY A;  1WYW B;  1RYJ A;  2C9W B;  4S0R A;  1UWX A;  2FAZ A;  1EUV B;  2WP9 B;  2WWZ A;  2WXI A;  2OHF A;  4HJK A;  2BVC A;  3DCG A;  2FCN A;  4B95 A;  2BWF A;  2KVR A;  2L76 A;  4J3O D;  4PK1 A;  3BIN A;  1WRD B;  2JXT A;  3A33 B;  2IO1 B;  2J0M A;  2VH2 A;  1WE7 A;  3L16 A;  4WJO A;  1BXT A;  1WF9 A;  4NJ6 A;  2ACZ B;  2XEW A;  2FUG 1;  2D10 A;  2JZZ A;  4IW0 A;  3T9L A;  4JLC A;  2K5P A;  2C7M B;  1ENF A;  3L54 A;  3AE8 B;  1P7F A;  3GE8 C;  1XXG A;  3ZUN A;  1AAR A;  3IG3 A;  2B76 B;  1TKY A;  1D5Z C;  2DWQ A;  3ZDM C;  3KW5 B;  1YJI A;  2HE7 A;  1C4P A;  3A1Q B;  2V9H A;  1MG8 A;  2E3T A;  2OOB B;  1AN8 A;  5TR5 A;  2N4F A;  4GB9 A;  2I38 A;  1CZP A;  2QCZ A;  4PS8 A;  3ALB A;  1OQY A;  2PVO D;  3FAH A;  5AUK A;  1WYG A;  5T8I A;  4E3C A;  1JW9 D;  1L0Y B;  4M0W A;  2BYT A;  3RNG C;  2A5U A;  2OED A;  4ZHO A;  2CHX A;  2BPS A;  2JRI B;  4LK0 M;  4HVB A;  1PQS A;  4HWI B;  3AU4 A;  4C4V A;  3WAM A;  2HTM E;  4LNF A;  3PT2 B;  2ZEQ A;  3AU5 A;  3UQB A;  2LGX A;  2KMM A;  2N9E B;  3AEG B;  3WAP A;  2KD0 A;  2DYM A;  2V3N A;  1C9F A;  4KZC A;  3DHH C;  3EA6 A;  1V97 A;  2C60 A;  1BUI C;  2Y5P A;  4HPP A;  3UIN B;  4J6I A;  1XLP A;  2IO3 B;  1J7B A;  2KOX A;  2J0J A;  1ZW7 A;  1WJ6 A;  4JQW C;  3HRD D;  2LFI A;  3BZD B;  1KOT A;  2G3Q B;  4MH0 E;  2KWC A;  4WAA A;  5E6J A;  3UIP B;  1IP9 A;  2IGG A;  2IND C;  3WIM A;  1L0X B;  3L4P A;  4ITK A;  4RFB A;  1V6E A;  3Q3O C;  4WIP A;  1STE A;  1KTK A;  3ZRF A;  2NBU A;  2JT4 B;  3BK2 A;  1T0R C;  3PLV A;  3R8B A;  4KGR A;  2WXG A;  1GOZ A;  1F52 A;  2HJ1 A;  1JRU A;  3U4E G;  2LEK A;  2BKF A;  1N60 A;  2IGH A;  4HKQ A;  2WDV B;  3RN9 C;  2L52 A;  3CF6 E;  3X0W A;  2KQ4 X;  2NTS A;  1V86 A;  1YN3 A;  3VTW A;  5BO4 B;  3L0W B;  2GBM A;  3U7Z A;  3Q8A A;  2JXX A;  2FIF A;  1WM3 A;  2QDF A;  1JRP A;  4AQ7 A;  1VR9 A;  2L0T A;  5HI1 A;  2KJH B;  2FNJ B;  5J18 A;  2IGD A;  2DAJ A;  2LI5 A;  2MBH A;  4MJS A;  2KMA A;  3BVZ A;  3QQ8 B;  1KLV A;  1F77 A;  3SFD B;  3N1Y C;  2W82 A;  3WAN A;  2MJE A;  2RPQ A;  3APD A;  3R7R A;  3R66 C;  1VZ8 A;  4WJP A;  2J52 A;  4AUQ C;  4TUU A;  1DOY A;  4ZRQ A;  4OVZ A;  4BKG A;  1P1A A;  2BB5 A;  3PO0 A;  4CO7 A;  2MRP A;  3DBL B;  2ZW1 A;  2JX5 A;  2H88 B;  4HDQ A;  3DVN U;  1IPG A;  4FJY A;  3H7P A;  3I5J C;  4OHJ A;  4N59 A;  3ONS A;  3AEB B;  3ZXR A;  1RRB A;  4JGH B;  2KDI A;  4KIK B;  5BMH A;  3B08 A;  3HIZ A;  5CHV C;  1YN5 A;  2M0X A;  3WAO A;  1WSP A;  4BZA A;  2KC2 A;  4HJG E;  3I3T B;  3H7S A;  2BYV E;  3LXF A;  4ZDV A;  4RH6 A;  1WJU A;  3U8Z A;  4C00 A;  5H92 C;  4UDU C;  4P7I A;  3KVF B;  4G11 A;  2SAK A;  2LWP A;  1TIF A;  3ZNH B;  4OVV A;  1V80 A;  2JYE A;  4A8X C;  3AE9 B;  2UU7 A;  3QJZ A;  2NVU I;  2DYO A;  2W55 A;  1C3T A;  4MM3 A;  2R2O A;  4MEL A;  3BII D;  4WWN A;  2GRI A;  2BWE S;  4F7Z A;  4LCD E;  2OJR A;  5D3I B;  2EMT A;  2M17 A;  4IWQ A;  3Q6B A;  4YSX B;  2WXO A;  4AWJ A;  2HDE A;  1GJZ A;  5J17 A;  3NRZ A;  1T0Q C;  4WUR A;  2KKC A;  2HD5 B;  3RUI B;  3T3O A;  3R7Q A;  2FBW B;  2RD0 A;  3DWG C;  2WDT B;  3FKY A;  3P42 A;  4I6L B;  4BKS D;  3O13 A;  1F0Z A;  2Z0D B;  4CQN A;  1P98 A;  4KX6 B;  2M8S A;  1YN4 A;  1NYR A;  1WR1 A;  3C19 A;  4NZL B;  3SU8 X;  3V6C B;  5IP4 D;  1R4M I;  2O2V B;  3DHG C;  3IHP C;  3AEF B;  3C8Y A;  3Q3M C;  2KDB A;  5IN7 A;  4MGY E;  1ROE A;  4RGM A;  5H8Y E;  1T6B X;  4K3C A;  3N9Y C;  1LFD A;  2C7H A;  1OQQ A;  1EO6 A;  1VRA B;  2O6V A;  3ML9 A;  3VH3 B;  1FPY A;  2K3U A;  2N9K A;  2KAJ A;  5IOI A;  1HZ6 A;  4FAD A;  3Q2A C;  1PGX A;  1NI2 A;  1FO4 A;  3JSV B;  5CTR C;  2K8C A;  3KUD B;  1AYF A;  2K8H A;  2LUM A;  3FC4 A;  1VJK A;  3NVW A;  2PW9 A;  3P63 A;  3WCQ A;  1OFF A;  1WXS A;  1N5W A;  2NS5 A;  2Z59 B;  3OWE B;  4WJQ A;  1OEY A;  4N9F 4;  3EFU A;  2ZPN A;  3BVM A;  3QA8 A;  4BVU C;  4ZRP A;  1ZKH A;  4AOF A;  5EE0 A;  1AW7 A;  3T3N A;  1I4G A;  2RSU A;  1KJT A;  3MHS D;  1XD3 B;  1FEH A;  4DQO C;  2D3G A;  3LYY A;  4BOZ B;  1QT9 A;  1JCK B;  1ZXI A;  4MGK E;  4IM2 A;  1C76 A;  2MCN B;  4A55 A;  5D3D A;  4KDI C;  3N3K B;  5FKA C;  4ZOH C;  3U7D A;  2L83 A;  1TT5 B;  2V0G A;  3DDC B;  3DPD A;  4RGT A;  1F1H A;  1CMX B;  3ZYY X;  1UNS A;  5DPT A;  1DOI A;  1QOF A;  1QIL A;  3MJW A;  4XDD A;  4IM0 A;  2OJW A;  2XK5 A;  2UWQ A;  3EEC A;  5HHD G;  2WXJ A;  3BYY B;  1K50 A;  1YQ3 B;  4EEW A;  4GDL B;  4HRO A;  1E0Z A;  3OAW A;  4KGS A;  2J0K A;  1L4D B;  1RM6 C;  4MSM B;  3KWV A;  1TS3 A;  4TKN A;  1I4H A;  1XF5 L;  4LNK A;  2KYW A;  4RCO A;  3IT6 B;  1ZP0 B;  3P4Q B;  4NJ7 A;  2IO0 B;  1Z5S B;  3S2A A;  1FIQ A;  2XN9 C;  1MVK A;  1JWS D;  5GMV A;  4RM9 A;  2EKE C;  3PRM B;  1S3S G;  3RCZ A;  2NR2 A;  2MP2 B;  3P4R B;  1KLU D;  2WXF A;  3BWU D;  4GXB A;  3QCA A;  4ZRK A;  1KH0 A;  4JPS A;  2EKI A;  2AWT A;  3VQI A;  1JWA D;  2IYD B;  2LMC A;  2N1V A;  1LXD A;  3DBS A;  1D5M C;  4DHZ E;  4X57 B;  1ZOY B;  2EMS A;  1PYW D;  2J53 A;  2MJ3 A;  3W1S C;  2KTR B;  2RGF A;  4AJY B;  1ET6 A;  1E9M A;  3TUO A;  5C1Z A;  1QOG A;  3TSS A;  2FE8 A;  2QC8 A;  1N6Z A;  1IBX B;  3ECI A;  1D5X C;  1VZ7 A;  4M02 A;  1U4A A;  4KSK C;  5DPR A;  3Q8B A;  1HE8 A;  2BYE A;  3ZNZ B;  4DXG A;  3H1U A;  5EE9 A;  4W9G A;  1D4B A;  2ICI A;  1TJE A;  3RZF A;  2L1A A;  4RM8 A;  3SR6 A;  3ENE A;  1CK1 A;  2KLG A;  1EF5 A;  2YLM A;  2PJH A;  4RGN A;  3ZDT A;  1LO5 D;  2INN E;  2D3A A;  3AN1 A;  4KV2 A;  5E6P A;  4ASW C;  4F1S A;  4LDT B;  4AS1 A;  4LNI A;  3R2I A;  2JZP A;  2JZ3 B;  4GOC A;  2KHW B;  4FN2 A;  4GMV A;  3AE1 B;  1HTO A;  1R4N B;  1CJE A;  2CKH B;  2NBW B;  4C80 A;  4HCP B;  3ZJV A;  2X38 A;  2V4I B;  1MG4 A;  1SJE D;  1P7E A;  4L23 A;  3AH7 A;  2WX0 A;  4JIO U;  3CIR B;  5KHQ A;  4HDO A;  2JWU A;  4YSY B;  3GZN I;  1WMH A;  3PVL A;  4JX1 C;  4EKU A;  3IAS 1;  3A4R A;  1ZUD 2;  1V5T A;  1L6V A;  4CYE A;  5C23 A;  1C77 A;  1R4M B;  2D2Q A;  1T5X D;  1QKZ A;  2E6X A;  2LZ6 A;  3ETR A;  3V62 A;  1GNU A;  1E8Z A;  1TS2 A;  2INC C;  2ZZP B;  4H2A A;  2GBN A;  3V3X A;  4BBN F;  4GGQ A;  3HK0 A;  3L08 A;  4P16 A;  2LXA A;  1N62 A;  3W2D A;  4M8M A;  3ZGZ A;  3NHE B;  3PTF C;  4K1R B;  1EF1 A;  4EUT A;  4NNJ B;  2LVP A;  2WU5 B;  4DDI D;  1I4Q A;  2N9P C;  4L2Y A;  4CHK A;  2N7E A;  2GOW A;  5IKC M;  1B1Z A;  1FRR A;  3RI7 C;  4LDT D;  2WXH A;  2KN4 A;  1OQR A;  1I4P A;  5J2R A;  4W9E A;  3ZTD A;  2WDR B;  1D6E C;  1E5W A;  3DBR I;  4BAX A;  3PZD A;  1L0V B;  2MQJ A;  1ESF A;  3D32 A;  4OZC A;  4P6V F;  1C4A A;  4LNN A;  3QIJ A;  1FNU A;  1P9D U;  4W9C A;  2RDH A;  4LJO B;  4K7W A;  4ICV A;  3NUH B;  4XGA B;  1QQR A;  1WXA A;  3UIO B;  1E7V A;  2PIA A;  4PYU A;  2CJN A;  3QAR A;  4WWP A;  5LLI A;  3HVZ A;  3DBH I;  3Q14 C;  2REX A;  3PPA A;  2FCS A;  3KUZ A;  3R2T A;  4Q2J A;  4PS3 A;  2L7R A;  1UWM A;  2KMC A;  1YX5 B;  4B9K A;  2QEJ C;  4NQL B;  3RNE C;  1TZO A;  4EZK A;  1YQ4 B;  4B0E A;  5AZG A;  3A1Q A;  1T3Q A;  4USA A;  5G5G A;  1SSN A;  4FHK A;  1E90 A;  1JWM D;  1XQQ A;  1DGJ A;  2QJL A;  3EUB 2;  2IO2 B;  4WAF A;  5AEK B;  4YL8 A;  4WH4 A;  3V6E B;  1PUT A;  2LJ5 A;  1WIA A;  4YTM B;  3Q8E A;  1K52 A;  3SFE B;  3MHZ A;  3K9O B;  3NJT A;  1RWS A;  2NBV B;  4DK5 A;  4US8 A;  5AZH A;  4GLS C;  3MFG A;  2MSE D;  2DX5 B;  2WGS A;  3VRB B;  3MC9 A;  2ZVO A;  2N7D A;  1YD8 U;  2A4Z A;  1C4C A;  4WWM A;  3PLU A;  4FXC A;  3N1Z C;  3W5V B;  2KJ6 A;  1NVI D;  3NG0 A;  2I2Y A;  2CR5 A;  2MBE A;  1JAL A;  1J0G A;  4IWP A;  3I63 C;  4FLH A;  3UQA A;  2ZW0 A;  1SGH A;  2G9H D;  3TEZ A;  4G50 A;  2GBR A;  1WXM A;  2I1K A;  1SIF A;  1L7Y A;  2MBO A;  3OJ3 A;  2W9N A;  4XDC A;  2WX1 A;  3NY5 A;  3PRP B;  4K7S A;  2LHE A;  4NAW A;  1WE6 A;  1GAQ B;  3DQV A;  1NYQ A;  1WGR A;  3Q8C A;  2V4L A;  2GLS A;  4R3D A;  3CWI A;  1J8C A;  1XLO A;  3AEA B;  1XT9 B;  2RPV A;  3ABV B;  5D7G A;  5D94 A;  1E7P B;  2IZV B;  5D2M B;  2ONQ A;  1DOX A;  3AXC A;  3OJ4 B;  3QX1 A;  5TSS A;  5DPW A;  2Y3A A;  4KZ0 A;  2DYB A;  3VRA B;  4RMA A;  1Q10 A;  4BKT A;  4TV3 A;  4KKJ A;  3B1L X;  3ZKJ C;  2MA9 B;  3JW0 X;  2BKR B;  2VH1 A;  4PYZ A;  4ANX A;  4DWF A;  3OG5 A;  2JVC A;  2KZR A;  1XLN A;  2J7Q B;  1PFD A;  2KQS A;  2WXN A;  4YWG G;  3K9P B;  4TSS A;  4TQ1 A;  2YEP B;  1LQB A;  4KDL B;  4D2K A;  5IAA C;  2AEH A;  3M62 B;  5L83 A;  4WJN A;  1GPX A;  3M63 B;  3AV8 A;  1EU3 A;  2QMT A;  3GZN B;  1CQV A;  2V1Y A;  3TIX A;  2K25 A;  1QOA A;  2GBK A;  5HKH A;  3NVZ A;  3VTU A;  2G4D B;  2O6V B;  2JPH A;  3NS8 A;  1TY2 A;  2PE9 A;  2KX0 A;  1ISN A;  1R4N I;  2RDG A;  1VLB A;  3RD2 A;  3FIL B;  3SHQ A;  4W9K A;  4B6W A;  3I9V 1;  1Q0W B;  2MWS B;  4IG7 B;  4BKS A;  4IUM B;  2G1E A;  3PZ7 A;  5C3J B;  4K81 A;  1T0S C;  3IBE A;  5BYQ A;  3ZJT A;  2C7N B;  3RPF C;  1WGK A;  3CMM B;  1YOV B;  1NDD A;  1YQB A;  2Q5W D;  3AUL A;  3Q3F A;  4ANV A;  1OTR B;  3N32 A;  3ZVV A;  1FFU A;  4FJV B;  4ICU A;  1UH6 A;  1NBF C;  1E7U A;  1FD6 A;  3H9D A;  1IYF A;  3DBR B;  1A5R A;  2AL6 A;  3N1X C;  1YJ1 A;  1WJN A;  4ZYS A;  2PPH A;  5CX3 A;  3GB1 A;  1UD7 A;  3V60 A;  2PTL A;  3NVV A;  4ZHP A;  5JXV A;  4MEM A;  5G55 A;  4NJC A;  4XWT A;  3DHI C;  2K6D B;  3A4S C;  2JQR B;  2N0S B;  3NZ3 A;  1SB3 C;  1F2R I;  3ZNI D;  5MPO A;  3A9K B;  5LXH A;  1FM0 D;  1FNV A;  2O6V D;  3MC0 B;  4HRS A;  3AM9 A;  1WX8 A;  2FCM A;  1PDX A;  3DBH B;  2CJO A;  1H4R A;  1FXA A;  3EC8 A;  4FUL A;  5GXG B;  1GC7 A;  4JWS C;  2LHD A;  4DHZ B;  2V3S A;  2GMI C;  3KWL A;  1DYQ A;  1SE4 A;  4TQ0 A;  3IT4 B;  3C0R B;  2RR9 A;  3VVW B;  3CSF A;  4GDK B;  2K39 A;  1WX9 A;  3ZQ4 A;  4IDI A;  1TY0 A;  3LJ3 A;  3V05 A;  1V49 A;  3QC8 B;  4W9L A;  2G4S A;  1Q1O A;  2CU3 A;  1KM7 A;  2KXJ A;  2VZK B;  2X8X X;  1RLF A;  5JZE B;  2FCQ A;  1WGH A;  1Y56 A;  1TS5 A;  4W9D A;  5EDS A;  4II2 B;  2DHZ A;  4HXD A;  1IGD A;  1WWT A;  5E6N A;  2NPT B;  4WWO A;  1GB1 A;  3U52 E;  3DOW A;  1HEZ E;  1N61 A;  3M3J A;  4BOS C;  1WH3 A;  5G2N A;  1TKE A;  2RDB C;  3A9J B;  1IUE A;  3ZJU A;  3MJ5 A;  4HPM B;  1Y8R C;  2KFK B;  3L17 A;  2IY1 B;  1TYG B;  3ZNG C;  3ZLZ A;  4IC7 B;  1MJD A;  2D07 B;  1BML C;  2JRH A;  3KYD D;  1FCC C;  3JSV A;  2JYT A;  4M01 A;  2JF5 A;  3DVG Y;  1MFW A;  2Y5B B;  4P1C C;  3P4S B;  2R2Q A;  5D6J B;  1V2Y A;  1M4V A;  2KDM A;  2C5L C;  2B3A A;  3AE6 B;  4JWU C;  3GOE A;  1ZE3 D;  1QLB B;  1ZXH A;  1V1P B;  2KT7 A;  1YJJ A;  3M95 A;  3RUL A;  2BW2 A;  5KHO A;  3JVZ X;  4AP4 C;  3CST A;  2KDE B;  2VZK D;  4DDG D;  2TSS A;  4GN1 A;  2BTE A;  4NAM A;  5DCN A;  2Y5C A;  3N20 C;  2NMQ A;  3GE3 C;  2YVC A;  1J7A A;  2KDF B;  3H8H A;  1MHH E;  4FA6 A;  3VH4 B;  2EEL A;  4E71 A;  3GP7 A;  4ZRI A;  2PLP A;  1F2R C;  4DXF A;  1UF0 A;  1WXQ A;  3NOB A;  4GDL A;  4AJW A;  1I4X A;  1WGD A;  1LGR A;  3B2G A;  3H6N A;  1PGA A;  2KK8 A;  2RMM A;  1YNT E;  2KVZ A;  5FR6 A;  2KFJ A;  3PSE B;  2WYQ A;  2D5G A;  3B0A A;  4IM3 A;  4K3B A;  2ZPY A;  2MH7 A;  1NEN B;  4WQO B;  4XE0 A;  2KN5 A;  5E6O A;  3EFC A;  3LB8 C;  2MJD A;  1GB4 A;  3L13 A;  1WJ4 A;  2N7J A;  4WQM A;  4FBJ B;  1K8R B;  2AX5 A;  2YEP F;  2MP2 A;  2BQQ A;  1X1M A;  4A20 A;  4M0W B;  2BF8 B;  4II3 B;  4ZRJ A;  2W54 A;  4DHJ B;  4GIV A;  1SE3 A;  2DZJ A;  4C4V B;  1FMA D;  2ASQ A;  3AEC B;  4HPL B;  4EZL A;  2BT6 A;  1UGJ A;  3HM3 A;  2KTR A;  3URY A;  1SE9 A;  2BGF A;  1I7H A;  1IBX A;  2GBJ A;  3PHW B;  2DBY A;  4LJP B;  1F9J A;  3WA0 A;  4MDK E;  1J7C A;  2WDQ B;  3QK0 A;  3W1Y A;  2V3P A;  2K8B A;  3NZU A;  2HJ8 A;  3AB5 A;  4EOY A;  5AZF A;  2LD9 A;  2IJ0 A;  1E8X A;  3RT3 B;  2WXQ A;  5AUI A;  4EZJ A;  2L0F A;  2WXR A;  2MBQ A;  4P1B C;  2MHJ A;  3NZS A;  3UF8 A;  1NEK B;  2CU1 A;  2W3R A;  4MGZ E;  5I4D A;  1E6E B;  3ZXV A;  4OZA A;  4GSW A;  1TGZ B;  1L6U A;  2JY6 A;  1I35 A;  3IVF A;  1N63 A;  1SXT A;  1WM2 A;  4FHJ A;  1RFA A;  3TEY A;  4HEA 1;  2WLB A;  3O65 B;  4DHJ D;  4YTP B;  1ZDV A;  3BY4 B;  3BYT B;  2IBI B;  1QOB A;  3AED B;  3B2F A;  5LXI B;  2L00 B;  2H89 B;  2PEA A;  2WXK A;  3PV1 A;  4QAY A;  3AE4 B;  2WU2 B;  2ZCB A;  2GB1 A;  1R7S A;  1V8C A;  3WAL A;  1JML A;  3QHT A;  1ET9 A;  4I6N B;  5JHA A;  5EE3 A;  3HM6 X;  3RZW C;  1E10 A;  5HG2 A;  1FFV A;  2KTF A;  1ZDX A;  4JL9 A;  4MJS B;  1NI3 A;  1Q5W B;  1JWB D;  1JRO A;  1KRH A;  2KQ7 A;  2PKO A;  1WZ3 A;  2AYO B;  3W1S A;  1D3Z A;  1UUP A;  1TS4 A;  1GUA B;  1ZPS A;  4OW0 A;  3L10 B;  4NAW B;  5DPS A;  1HZ5 A;  1E8Y A;  4A3O A;  2MBB B;  4RNA A;  3MC8 A;  4XYC A;  1XLQ A;  1KLG D;  4LLG M;  1HA5 A;  2KLC A;  2LXC A;  3KH0 A;  3RNC C;  3VR9 B;  3DVN V;  1YIW A;  4A6Q A;  2LGY A;  3VDZ A;  2KJR A;  3H7P B;  2JU6 X;  1SBB B;  4B0M A;  4DBG A;  2QIL A;  2Z8L A;  4C56 C;  1C78 A;  3VTV A;  3E9S A;  3J9C A;  1YX6 B;  3P1M A;  3MP9 A;  2CHW A;  3R3M A;  2IPK D;  2MLB A;  3AE2 B;  2PMV A;  3AMZ A;  1PGB A;  3APC A;  2W3S A;  4PS7 A;  1V5O A;  2WNM A;  1C79 A;  4TMA B;  1WGY A;  4O1N A;  2L3Z A;  3RYT A;  2WHI A;  4FJZ A;  2AQ1 B;  1MI0 A;  2WQY B;  3AI5 A;  2AQ3 B;  1P3Q U;  5FK9 C;  4MM3 B;  2LJI A;  1A70 A;  4XWW A;  2D3B A;  1V81 A;  1XEE A;  2M0A A;  4JE3 B;  1OEY J;  5FR3 A;  1FXI A;  3Q3N C;  1VD2 A;  3JYU A;  4YSZ B;  1H8C A;  1E8W A;  2FUH B;  2K9X A;  2UYZ B;  1KFY B;  4IKG A;  4BBN C;  3ZO5 B;  5IA7 A;  2L32 A;  1S1Q B;  2WS3 B;  2DAF A;  1G6J A;  2N1W A;  1C1Y B;  2LUE A;  4XZ4 A;  1TTN A;  3RNB C;  3MTN B;  3PRZ A;  1WXV A;  1TZ1 A;  4ZYN A;  2KC1 A;  1V1O A;  3TCA A;  2QIE B;  5CHF A;  3KQ4 A;  1M94 A;  3QAQ A;  1MHX A;  3BK1 A;  3TBL D;  1LM8 B;  2ZVN A;  4M00 A; 
#chains in the Genus database with same CATH homology
 1V97 A;  2SEB D;  3V05 A;  1CK1 A;  1BUI C;  2IDY A;  2Y5P A;  3I57 A;  4RGN A;  1LO5 D;  2INN E;  1MPE A;  5BYS A;  1XLP A;  1J7B A;  2CU3 A;  3AN1 A;  1L4Z B;  4AS1 A;  2VZK B;  3R2I A;  2JZP A;  3HRD D;  2LFI A;  4ARC A;  3Q8F A;  3BZD B;  1Y56 A;  1TS5 A;  4A9A A;  1IGD A;  1WWT A;  4L1B A;  3AE1 B;  1CJE A;  4C80 A;  5E6J A;  3VR8 B;  2X38 A;  2V4I B;  3ZJV A;  2IGG A;  2J42 A;  1SJE D;  1GB1 A;  1P7E A;  4L23 A;  3U52 E;  3Q69 A;  1HEZ E;  1L0X B;  1N61 A;  3AH7 A;  3L4P A;  3CIR B;  4ITK A;  4RFB A;  2JWU A;  4WIP A;  4OZB A;  4YSY B;  1STE A;  1TKE A;  4YXD B;  1KTK A;  4JX1 C;  1FNW A;  3BK2 A;  3IAS 1;  3R8B A;  1IUE A;  4KGR A;  1ZUD 2;  3HVD A;  2WXG A;  1GOZ A;  3ZJU A;  3MJ5 A;  2K22 A;  1SJH D;  1L6V A;  1TYG B;  1C77 A;  1VZ6 A;  3NS1 A;  3U4E G;  3TEX A;  5LNK 1;  1T5X D;  1QKZ A;  2E6X A;  2LEK A;  1BML C;  3ETR A;  1FCC C;  1N60 A;  2IGH A;  2JYT A;  4HKQ A;  2WDV B;  1TS2 A;  1WRI A;  3SEB A;  1B9R A;  2L52 A;  4H2A A;  3V3X A;  2KQ4 X;  2NTS A;  1YN3 A;  3P4S B;  3W2D A;  4P16 A;  1M4V A;  1N62 A;  3U7Z A;  2KDM A;  2M19 A;  3AE6 B;  3Q8A A;  4JWU C;  3ZGZ A;  1ZE3 D;  1JRP A;  1QLB B;  2WU5 B;  4AQ7 A;  1ZXH A;  1I4Q A;  1V1P B;  1VR9 A;  4L2Y A;  5HI1 A;  1YJJ A;  2IGD A;  4RF0 A;  3BVZ A;  1B1Z A;  2NTT A;  1FCL A;  1FRR A;  2BW2 A;  1QF6 A;  1F77 A;  3SFD B;  2BS2 B;  2W82 A;  4ARI A;  1SIJ A;  2VZK D;  2WXH A;  2MJE A;  2KN4 A;  1OQR A;  2TSS A;  1I4P A;  3GS2 A;  1VZ8 A;  2BTE A;  4NAM A;  1K53 A;  2J52 A;  2M56 B;  2Y5C A;  1DOY A;  2WDR B;  1D6E C;  2NMQ A;  4ZRQ A;  1J7A A;  3AE5 B;  4OVZ A;  1L0V B;  2BB5 A;  1ESF A;  3H8H A;  1MHH E;  2EEL A;  1YMH E;  4OZC A;  1C4A A;  3GP7 A;  3PO0 A;  4P6V F;  4C7Y A;  2PLP A;  2ZW1 A;  2JX5 A;  1FNU A;  2H88 B;  2BS4 B;  4MAC A;  2RDH A;  3PZ8 A;  3EGR A;  1F2R C;  2BB6 A;  4DXF A;  1WXQ A;  1JQ4 A;  4OHJ A;  4N59 A;  2DLB A;  4MH8 A;  3FIL A;  3NUH B;  3AEB B;  3HUI A;  1I4X A;  1QQR A;  5BMH A;  1VDV A;  4A90 A;  1EWC A;  3B2G A;  4RF1 A;  1PGA A;  2PIA A;  2RMM A;  4N6E B;  1YNT E;  2CJN A;  1YN5 A;  2D5G A;  2K0P A;  1WSP A;  4KGT A;  3P4P B;  4HJG E;  3HVZ A;  3AE7 B;  2AQ2 B;  2MH7 A;  3LXF A;  1NEN B;  1ACC A;  4RH6 A;  4XE0 A;  1SE2 A;  3R2T A;  4Q2J A;  5H92 C;  4UDU C;  3IAM 1;  3LB8 C;  2MJD A;  1UWM A;  1GB4 A;  4HKZ E;  2N7J A;  4WQM A;  2SAK A;  2QEJ C;  1TZO A;  1XO3 A;  3W9C B;  2AX5 A;  1YQ4 B;  4B0E A;  2YEP F;  1T3Q A;  4USA A;  5G5G A;  2KAC A;  1SSN A;  2JYE A;  4A8X C;  1AWD A;  3AE9 B;  1EU4 A;  1JWM D;  5EE1 A;  1DGJ A;  2QJL A;  3EUB 2;  2DYO A;  2W55 A;  4WAF A;  1JWU D;  2MEK A;  5G5H A;  4WH4 A;  3BII D;  4IOI E;  2W54 A;  2GRI A;  1PUT A;  1XCT L;  5D3I B;  4YSX B;  1SE3 A;  1KF6 B;  2BBC A;  4YTM B;  2WXO A;  1FMA D;  3Q8E A;  1K52 A;  5HFY A;  3SFE B;  3MHZ A;  3AEC B;  2HDE A;  3RFZ B;  1RWS A;  2BT6 A;  3NRZ A;  4WUR A;  3DWM A;  1UGJ A;  4US8 A;  1N5X A;  4GLS C;  3MFG A;  3URY A;  3T3O A;  3VRB B;  1I7H A;  2FBW B;  3P42 A;  3DWG C;  1IBX A;  3O13 A;  1C4C A;  1F0Z A;  4CQN A;  2DBY A;  2R61 A;  4WWM A;  4KX6 B;  4FXC A;  3W5V B;  3E56 A;  1YN4 A;  1NVI D;  1NYR A;  4YTN B;  1SF0 A;  4C7Z A;  1J7C A;  2I2Y A;  4NZL B;  2WDQ B;  1JAL A;  1TKG A;  2JSV X;  2V3P A;  3AB5 A;  2ZW0 A;  2G9H D;  3TEZ A;  3AEF B;  3UI3 A;  3B9J A;  2IJ0 A;  1HQR D;  2WXQ A;  5AUI A;  4N58 A;  3C8Y A;  3W5U B;  2WXR A;  4EE2 A;  4XDC A;  1L5P A;  1ROE A;  4RGM A;  1IGC A;  5H8Y E;  2WXP A;  2LHE A;  1NEK B;  1T6B X;  2W3R A;  5I4D A;  1GAQ B;  3Q8C A;  1NYQ A;  3N9Y C;  1E6E B;  5BMI A;  4R3D A;  3CWI A;  1OQQ A;  1RFK A;  4OZA A;  1L6U A;  1VRA B;  5BYR A;  1N63 A;  1XLO A;  1SXT A;  3TEY A;  4KKI A;  1EWY C;  3AEA B;  3BVG A;  2WLB A;  4HEA 1;  2K3U A;  2N9K A;  2KAJ A;  2RPV A;  4YTP B;  1ZDV A;  1SEB D;  3BYT B;  4US9 A;  1HZ6 A;  1QOB A;  3TEW A;  3ABV B;  1PGX A;  3AED B;  3B2F A;  2QSD A;  5D7G A;  2INP E;  1FO4 A;  1FRD A;  2H89 B;  1E7P B;  1I4R A;  1AYF A;  2LUM A;  2WXM A;  2XNA C;  2J4X A;  2ONQ A;  2WXK A;  3FC4 A;  1DOX A;  1VJK A;  3NVW A;  2PVG C;  2PW9 A;  3AE4 B;  4PT5 A;  2WU2 B;  5C2T B;  3P63 A;  3WCQ A;  1OFF A;  2GB1 A;  5TSS A;  1N5W A;  1R7S A;  2Y3A A;  1XCQ L;  3VRA B;  3U2S C;  1V8C A;  3OWE B;  3IXS A;  2GI9 A;  1JML A;  4YT0 B;  1Q10 A;  4KKJ A;  2N9L A;  2BS3 B;  3BVM A;  4ZRP A;  1ET9 A;  5EE0 A;  1AW7 A;  1K51 A;  3T3N A;  1I4G A;  5EE3 A;  1E10 A;  5HG2 A;  1FFV A;  1ZDX A;  1XLN A;  1EM7 A;  1FEH A;  1NI3 A;  2LGI A;  2WXL A;  4DQO C;  3KLS X;  4REZ A;  1PFD A;  2ON8 A;  1JWB D;  1JRO A;  1KRH A;  2WXN A;  3LYY A;  4RGO S;  2PKO A;  1QT9 A;  4TSS A;  4YWG G;  1JCK B;  4TQ1 A;  3W1S A;  2YEP B;  1UUP A;  1HXY D;  1ZXI A;  4MT5 A;  3AE3 B;  4D2K A;  3AEE B;  1C76 A;  1TS4 A;  1V1P A;  1GPX A;  4A55 A;  5D3D A;  2KWD A;  3AV8 A;  1ZPS A;  4LTU A;  5FKA C;  1EU3 A;  2QMT A;  4OW0 A;  1CQV A;  5BMG A;  4ZOH C;  2L83 A;  3NVY A;  4NAW B;  1QOA A;  1HZ5 A;  2V0G A;  4RGT A;  1RYJ A;  4RNA A;  1UWX A;  1XLQ A;  1KLG D;  3NVZ A;  3ZYY X;  1UNS A;  4LLG M;  1HA5 A;  2WP9 B;  1TY2 A;  2WXI A;  1DOI A;  1QOF A;  2OHF A;  1QIL A;  3VR9 B;  4XDD A;  5HHD G;  4A6Q A;  2WXJ A;  3BYY B;  1K50 A;  2RDG A;  1YQ3 B;  1VLB A;  2JU6 X;  4J3O D;  1SBB B;  4B0M A;  4GDL B;  2JXT A;  3FIL B;  4HRO A;  2QIL A;  2Z8L A;  1E0Z A;  3I9V 1;  4C56 C;  1C78 A;  4KGS A;  1L4D B;  1BXT A;  1RM6 C;  2G1E A;  2ACZ B;  3E9S A;  3J9C A;  3KWV A;  1TS3 A;  3PZ7 A;  5C3J B;  5BYQ A;  2FUG 1;  1I4H A;  1XF5 L;  3P1M A;  3ZJT A;  3RPF C;  1WGK A;  3MP9 A;  2IPK D;  4RCO A;  3AE2 B;  1ZP0 B;  3IT6 B;  2PMV A;  3AMZ A;  1PGB A;  3P4Q B;  2K5P A;  2W3S A;  2Q5W D;  1ENF A;  3AE8 B;  1P7F A;  1XXG A;  1FIQ A;  2XN9 C;  2WNM A;  1C79 A;  1MVK A;  1FFU A;  1JWS D;  2B76 B;  1TKY A;  1D5Z C;  2DWQ A;  1YJI A;  4TMA B;  1C4P A;  1FD6 A;  3P4R B;  1KLU D;  4O1N A;  2AQ1 B;  1MI0 A;  2WXF A;  3BWU D;  2E3T A;  2WQY B;  1AN8 A;  2AQ3 B;  4ZYS A;  5FK9 C;  3GB1 A;  1KH0 A;  4JPS A;  2EKI A;  4MM3 B;  2I38 A;  1A70 A;  2LJI A;  3VQI A;  1CZP A;  4XWW A;  1XEE A;  2M0A A;  4JE3 B;  2PTL A;  3NVV A;  1JWA D;  4ZHP A;  2PVO D;  3FAH A;  5AUK A;  5JXV A;  5FR3 A;  1FXI A;  1WYG A;  2LMC A;  4YSZ B;  5T8I A;  1JW9 D;  1L0Y B;  4M0W A;  1D5M C;  4NJC A;  4XWT A;  2BYT A;  2K9X A;  2JQR B;  2N0S B;  1KFY B;  1ZOY B;  3NZ3 A;  2OED A;  1SB3 C;  4IKG A;  4ZHO A;  1F2R I;  1PYW D;  5MPO A;  2J53 A;  2MJ3 A;  4LK0 M;  1FM0 D;  2L32 A;  1FNV A;  2WS3 B;  1ET6 A;  3MC0 B;  1E9M A;  3TUO A;  1QOG A;  2HTM E;  4HRS A;  3TSS A;  3AM9 A;  2FE8 A;  1IBX B;  1PDX A;  2CJO A;  1D5X C;  1FXA A;  1VZ7 A;  5GXG B;  4JWS C;  2LHD A;  1V1O A;  3KWL A;  1DYQ A;  2QIE B;  1SE4 A;  3KQ4 A;  3Q8B A;  4TQ0 A;  3IT4 B;  2KMM A;  3AEG B;  4DXG A;  5EE9 A;  4GDK B;  1MHX A;  1D4B A;  3BK1 A;  2DYM A;  3ZQ4 A;  2V3N A;  2ICI A;  1TJE A;  2L1A A;  4IDI A;  1C9F A;  1TY0 A;  3SR6 A;  3EA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...