1GPXA

C85s gapdx, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
106
structure length
106
Chain Sequence
b'SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLSCQIIMTPELDGIVVDVPDRQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTIDAREDOXIN
publication title The solution structure of a gallium-substituted putidaredoxin mutant: GaPdx C85S.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
total genus 14
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gpxA00
1N61A 1WXQA 1N60A 2K5PA 2WP9B 3AEGB 2ACZB 2W3RA 4ZHOA 3WCQA 1JWAD 4YTPB 2BS4B 4YXDB 3HVZA 2EKIA 3AE4B 1DOYA 3FC4A 1EWYC 1YJJA 3AN1A 3P4SB 5AUKA 5MPOA 4HRSA 1JQ4A 3VR8B 1QOBA 1R7SA 3EUB2 3P4RB 5G5HA 1FMAD 1NEKB 1KRHA 2B76B 1E7PB 1NYRA 3AE8B 1CZPA 5H8YE 4YT0B 2M19A 3CIRB 3AB5A 4N6EB 1JRPA 4N59A 1ZP0B 1QLBB 1QOAA 1TKEA 2WS3B 2H89B 1VDVA 1KF6B 1OQRA 2K9XA 3LXFA 5AUIA 4P6VF 5EE3A 4ZHPA 1E10A 3P1MA 1DGJA 2DWQA 1E9MA 4ZOHC 3AE9B 3AEDB 4YTMB 1XLNA 1NI3A 3AE2B 1TYGB 2WU2B 1J7CA 4N58A 1I7HA 3AEEB 1IUEA 1CJEA 2H88B 3AMZA 4US9A 3VRBB 1QF6A 1FIQA 3B2GA 1WWTA 3DWGC 1N5XA 2WDVB 3HUIA 2PVGC 2G1EA 3AM9A 1B9RA 1PFDA 2W55A 2W54A 2WU5B 2MJDA 3P4QB 1RYJA 2OHFA 1QOGA 1RM6C 2MH7A 1RWSA 2AX5A 1AWDA 4YSYB 4YTNB 1L5PA 3SFDB 2DBYA 1PDXA 4JX1C 2BS3B 1NYQA 3P63A 1FFUA 2K22A 1SF0A 2JX5A 3SFEB 1QT9A 1OFFA 4WQMA 2W3SA 1ROEA 2M56B 1PUTA 2WDQB 3VR9B 3B2FA 1J7BA 2LEKA 4JWSC 4LTUA 4IDIA 1SIJA 1V8CA 1WGKA 3ZYYX 1FRDA 1NVID 3HRDD 1TJEA 3NS1A 3AEBB 1E6EB 1FXIA 1KFYB 2PVOD 3NVVA 5C2TB 3W9CB 1FO4A 1DOXA 1JALA 2FBWB 1GAQB 1XO3A 3W5VB 5GXGB 2WLBA 4A9AA 1T3QA 4C80A 1FM0D 1XLQA 2E3TA 2KAJA 2HTME 2MJEA 4JWUC 1SB3C 3AE7B 1JWBD 1GPXA 1OQQA 4ITKA 5C3JB 1YQ4B 1FFVA 1WRIA 1L0VB 1NENB 1ZUD2 2MJ3A 2QIEB 4WWMA 1DOIA 4C7YA 1XLOA 1ZOYB 2BT6A 3AEAB 1AYFA 3VRAB 2KMMA 1L6UA 1VJKA 5G5GA 1FXAA 3ETRA 3AEFB 1UWMA 1TKGA 2CJOA 3DWMA 3KWLA 2WQYB 4HROA 3L4PA 1TKYA 3AECB 1N5WA 4FXCA 2PKOA 1L6VA 3SR6A 2L52A 3ABVB 2QJLA 3BIID 5EE9A 2CU3A 1YQ3B 3PO0A 2Q5WD 1JW9D 1RFKA 2PIAA 3AV8A 1F0ZA 3W5UB 1QOFA 5H92C 2Y5CA 3AE5B 1N62A 4US8A 3RPFC 1YJIA 4YSXB 3NVYA 3FAHA 2L83A 5EE1A 1A70A 4YSZB 2JQRB 3AE6B 4USAA 1XLPA 3NRZA 1WYGA 3NVWA 4KX6B 1VLBA 2CJNA 3B9JA 3AE1B 5EE0A 1J7AA 1JROA 1FRRA 2BS2B 3AH7A 3CWIA 3LB8C 3NVZA 1V97A 2N0SB 1ZXIA 1N63A 4C7ZA 1E0ZA 3P4PB 3AE3B 2WDRB
chains in the Genus database with same CATH superfamily
2L7RA 2WP9B 1S1QB 4XWTA 3WCQA 4YXDB 3K9PB 1DOYA 3FC4A 3AN1A 2JZPA 2KLCA 3BZDB 3ZIMA 2M19A 4M0WA 2AL3A 2PEAA 3NJTA 4P6VF 4AUQC 3DCGA 3LJ3A 4RGMA 2H88B 4W9JA 4DBGA 3DBRB 2EELA 4XE0A 1WXSA 2G1EA 5D2MB 2MJDA 2JWZA 3P63A 4JLCA 2K8CA 2AL6A 1JMLA 4A20A 1F1HA 2AYOB 3FILA 1MJDA 2WXRA 3VR9B 1OEYJ 1TT5B 2GMIC 2I1JA 2JY6A 2LXAA 4MGKE 2DYMA 2YEPB 1XXGA 3NS1A 5HG2A 4NJ6A 2KANA 1OTRB 1KM7A 1DYQA 3U7DA 1N6ZA 2KTRB 2KACA 3VFKA 4JE3B 3V61A 1V1PB 2BT6A 5CX3A 2LJ5A 4K3CA 4E3CA 2XNAC 3DWMA 1J19A 4HROA 5DCNA 4BAXA 2KQSA 2IGGA 3TEWA 3SD5A 2J7QB 1QZEA 1QOFA 1V9JA 3T8MA 2DHZA 3W1YA 3NVYA 2KJRA 1EWCA 3ECIA 2Y5PA 1T0SC 1XLPA 4KX6B 3CWIA 2N0SB 2VZKB 2KVZA 4JL9A 5E6NA 5BYSA 2K5PA 3EHVA 5J2RA 4DQOC 2XN9C 2L8JA 2EKIA 1YJJA 3BINA 4HRSA 4WWOA 2QDFA 4RM9A 1ISNA 4ANVA 3ALBA 1TTNA 4BFRA 2K8BA 4C4VA 4N59A 2N9LA 4TKNA 5EE3A 1GJZA 2LJIA 2CU1A 2K0PA 3TMPB 3HIZA 4US9A 4G0NB 3PSEB 5JHBA 1WWTA 3VVWB 1J0GA 1PFDA 1RYJA 3NZUA 4FLHA 1D5MC 3AXCA 4US8A 1L5PA 2KVRA 2QSDA 2BW2A 4N9F4 2NCNA 4OZBA 1I4RA 4NAMA 4GDKB 4L2YA 2MP2B 2IO0B 2L05A 4W9IA 2DZKA 1WGKA 3N20C 4XGAB 1TJEA 2BWFA 2CHWA 3GOEA 2M8SA 2INNE 4K7UA 1P9DU 2NS5A 4P1CC 2IZVB 4MSQB 3GZNI 2GI9A 3MHZA 2N7JA 4EZJA 2V0GA 5G5GA 2C7NB 3VUWA 1UWMA 2BVCA 1P3QU 2JYEA 3BIID 3H9DA 3L13A 4LK0M 1UBQA 5C23A 4ANUA 5H92C 4RF0A 3T3NA 1M4VA 2LWPA 1ZE3D 5EE1A 5J17A 3PREA 2J0MA 3M63B 3AE6B 3GS2A 1R4NI 2PE6B 2A4ZA 1V49A 4PK1A 3TUOA 3MC0B 2DZIA 5FR6A 2RR9A 4HPMB 1IGCA 4NAWB 1I4GA 1NEKB 2V9HA 5TSSA 4BOSC 1VDVA 3PZDA 2O2VA 2BKRB 1BXTA 1LO5D 1E9MA 2K8HA 3BK1A 2KDMA 2KC1A 2JZZA 4KIKA 4S0RA 2IO2B 4NY0A 1AN8A 3B2GA 2UYZB 2PVGC 1FPYA 3W1SC 4LNNA 2W54A 4OVUA 3UQBA 1WX8A 3RFZB 1RWSA 2AX5A 4YTNB 1C79A 2EKEC 2FCQA 1V2YA 4LNKA 2Y3AA 2KXJA 3B2FA 1PGXA 4JPSA 3R8BA 2QEJC 3TEZA 2L1AA 2NPTA 1LFDA 2K3UA 4CO7A 1SJHD 1L0XB 3N9YC 4OZAA 4WAAA 2REXA 1T3QA 2D2QA 2E3TA 1I4HA 2D3GA 4PT5A 4G3XB 2PTLA 2IYDB 4C7YA 3KUDB 2LMCA 4LNFA 2D3CA 2WQYB 3L4PA 3N1XC 3DBLB 3ZJTA 2ZPNA 4A90A 1F0ZA 3DQVA 3IAS1 3AE5B 3V6CB 2L00B 4EFOA 2C60A 3I9V1 4K7SA 2WXMA 1YN4A 2R2OA 2MBHA 3P2BA 4NJCA 4AJYB 3CSTA 3OJ3A 3HK0A 2BYFA 5LNK1 3P42A 3DVNV 1D5ZC 1TIFA 3UIOB 4WQOB 5AZFA 1QOBA 2WXKA 4HJGE 4WJPA 3DHIC 4MH0E 5H8YE 3ZO5B 3R3MA 3PT2B 2BB6A 1ZW7A 3IG3A 1TS3A 2LHEA 5DPSA 1C4CA 3ZDTA 3NS8A 4N58A 2KFJA 3AEEB 1CJEA 2DLBA 1I35A 4OZCA 2FAZA 4CQNA 3SFDB 3RNEC 1OFFA 4WQMA 3A1QB 4A8XC 4TSSA 4ZRQA 2AWTA 3URYA 1F77A 3SEBA 5T8IA 1F2RC 3VTVA 3AEBB 2PVOD 2MBBB 4JQWC 5AZHA 1WXMA 3B08A 3NOBA 3EECA 4RFBA 2MWSB 1KLVA 4GSWA 3GE8C 1AYFA 2XK5B 4P1BC 1FXAA 3DBSA 2X38A 1WI0A 3QHTA 3Q6BA 2PKOA 2L52A 2NTTA 1YQ3B 4BBNF 3ZVVA 4X57B 2Y5CA 1FNVA 3RPFC 3N3KB 2L83A 3R7QA 4IKGA 4ZRJA 3KLSX 2CJNA 5EE0A 4EZLA 1UWXA 1JRUA 3K9OB 2MLBA 1N61A 2IO1B 3MJWA 2W3RA 1TS5A 3Q69A 1JWAD 2KHWB 4YTPB 2GBRA 1YQBA 5MPOA 3R2IA 2N4FA 5L95C 2V3SA 5AUIA 1OQRA 1WE6A 4IWOA 3DBRI 1VR9A 4TQ1A 2KOXA 4YTMB 1GB1A 3AU4A 1GOZA 1NDDA 4I6LB 3VDZA 2VH1A 2DBYA 2JUOA 4GDKA 1FFUA 2RGFA 3TJPA 1GC6A 4XDCA 3Q3JA 1Z5SB 4M8MA 3N1ZC 2O2VB 3MC8A 3L10B 5D6JB 2MBOA 3UQAA 3A9KB 3W5VB 2QCZA 3I63C 3V05A 1T5XD 2HTME 1TZ1A 1YQ4B 1VZ6A 3KQ4A 1DOIA 3BY4B 1ZOYB 3AEAB 2GBKA 3CSFA 2GB1A 1D5XC 1H4RA 4C00A 2CJOA 3HHMA 2MX2A 1IBXB 2QC8A 1X1MA 2I1KA 5D3IB 3ZDMC 2BB5A 3PLUA 2L0TA 4J3OD 5BYRA 1WR1A 2K1FA 2PMVA 4WJOA 3B9JA 1YOVB 3VXWA 3RNBC 1XCQL 1EM7A 1JROA 4FBJB 2KLGA 3ZXVA 2GBJA 1P7FA 2J0KA 3U8ZA 3AEGB 3X23A 4S17A 4W9FA 4NAWA 2JT4B 1EWYC 5AUKA 4GIVA 3ZLZA 4WURA 3O65B 1E7PB 2LXCA 4ZRIA 2WGSA 2SEBD 3MP9A 3RD2A 4FULA 1DGJA 1P98A 5BMGA 3BVZA 1EUVB 1WIAA 2NBWB 4HJKA 3RYTA 2MQJA 4A55A 2JZ3B 3AMZA 2RSUA 4K81A 4OVZA 3LYYA 4IM3A 2C9WB 1WGDA 3VUXA 1QOGA 4I6PA 5IAAC 1WXAA 4L1BA 1K51A 3B0AA 2WDQB 2L32A 1VD2A 2LVQA 1J7BA 1WMHB 3APDA 3V60A 2N7DA 2KQ7A 3NZ3A 4HDQA 2N7EA 1K53A 1FRDA 4GB9A 2ZNVC 2V1YA 1K8RB 1FXIA 4TUUA 1DOXA 3DBHI 2GBMA 3TEXA 1I42A 2BBCA 3I3TB 1GAQB 1XO3A 2WLBA 2KAJA 2IGDA 3L08A 1ZDXA 3AE7B 3RUIB 3PPAA 4MJSA 1BMLC 5C3JB 5IN7A 2HJ8A 1WRIA 1NENB 2WX0A 2KJ6A 2JRHA 3R66C 1L6UA 2A5UA 5I4DA 5KHOA 3AECB 3QWZB 3L16A 2ZEQA 2FCSA 4KKIA 1JW9D 1SE3A 3AV8A 1HZ6A 2DX5B 1SE2A 5CHWA 3ZNID 4YSXB 3ZTDA 3E9SA 3QA8A 1MHXA 3U7ZA 1E0ZA 2V4IB 5E6OA 2JXTA 1HE8A 1FCLA 1FMAD 1T0QC 1P1AA 2CR5A 2WHIA 4WWNA 1ZP0B 3O13A 1GG3A 4PS3A 2SAKA 3BVGA 1YIWA 1ZXHA 4UDUC 1SE4A 1GUAB 1L0YB 2KK8A 2ZVOA 4M8NA 3RNGC 3X0WA 2DNFA 3BYYB 2W55A 2KWUB 1RM6C 2IPKD 3A1QA 1AWDA 2LRWA 1HXYD 2D11A 3QIJA 5JXVA 3A4SC 1MPEA 4EKUA 2EMTA 3MJ5A 3WALA 2NBVB 4II3B 1WY8A 1WZ3A 4HKZE 2BQQA 1WFYA 3U2SC 2D3AA 3HRDD 2G4SA 4IOIE 3NVVA 1JALA 3QAQA 4GN1A 4W9GA 3Q3NC 4EZKA 2GLSA 1SB3C 3PV1A 3PRZA 4RGOS 2JYTA 2XK5A 4FHKA 1L0VB 2KZRA 3C0RB 4J6IA 2KT7A 1UD7A 3DBLI 4K3BA 3U52E 2G9HD 1CMXB 3JVZX 2KJHB 3M3JA 2IY1B 3EGRA 2DYBA 2I2YA 1N5WA 1BT0A 1GNUA 1STEA 2INPE 2FIDA 1RFKA 3UINB 2G3QB 3IHPC 3H8HA 4E74A 5CHVC 4USAA 4AWJA 1FXTB 4F8CB 1FRRA 2BS2B 4QAYA 1WX9A 2NBUA 4R3DA 2KD0A 3Q14C 1S3SG 4RGTA 1HZ5A 2CS4A 1C3TA 3AE4B 1WM2A 3QCAA 2WWZA 4W9LA 4I6NB 1TY2A 3AB5A 1QLBB 4XC2A 2LGDA 4WWPA 1WJ6A 1FD6A 1UZXB 2ZPYA 5JHAA 3AE9B 4NJ7A 2JWUA 1M94A 2OJWA 2L76A 3IXSA 3Q8CA 3Q3OC 1QQRA 2ZCCA 2WU5B 3M95A 2MH7A 3C19A 2LGXA 5G55A 1WJ4A 2BKFA 3WANA 4FJYA 4RM8A 3EFCA 4KV2A 1MI0A 2G4DB 4BKGA 3N30A 2LEKA 2UU7A 1SIFA 3A9KA 3TBLD 1QILA 3PRPB 1E7VA 4A3OA 3RNAC 4FN2A 2IJ0A 1WM3A 3NY5A 1XLQA 5HFYA 4A6QA 2ZJDA 2V3PA 1OQQA 4FHJA 2PJHA 1ZUD2 3OAWA 5IA7A 5IOIA 2ZVNA 4IC7B 1IBXA 2OOBB 1WGGA 3ML8A 1SXTA 3WAOA 3BK2A 3VHTC 4W9DA 2INDC 3RZWC 4BBNC 2HTHA 4K7WA 4KGRA 1IPGA 3OLMD 1L4DB 1IGDA 1RLFA 2KTFA 5BMIA 1JWMD 3FAHA 4AP4C 3APCA 3A33B 4MJSB 3RN9C 2ONQA 3Q8AA 3VTWA 3MC9A 2LI5A 4AJWA 2INCC 3RNCC 3SHQA 3RZFA 2J42A 3IAM1 5G2NA 1ZGUB 2NTSA 2WYQA 3QQ8B 2JSVX 2WXQA 4DDGD 3CF6E 4ASWC 2MCNB 4M00A 2ICIA 2O6VD 1XLNA 3ZNZB 3VRBB 1I7HA 5J18A 2QHOA 1GB4A 4P16A 4WH4A 4D2KA 1D6EC 2OEDA 3UIPB 2FNJB 3PHXB 2LUEA 3PHWB 2K22A 1YN3A 1WMHA 2WXIA 4LDTD 1PUTA 1SJED 2KC2A 4KDIC 1IP9A 3KH0A 2WXGA 2D3BA 2WXOA 1SIJA 3PTFC 1Q1OA 2IBIB 4NZLB 3Q3MC 1AW7A 3RULA 3EC8A 4NPNA 1JCKB 1NBFC 3HM3A 2NR2A 2MBQA 1C76A 1KLGD 2PPHA 3T9LA 4FA6A 3AI5A 1U4AA 5KHQA 3NZSA 2FCMA 3ETRA 1SE9A 2DAFA 3KWLA 3RMKC 3KVFB 5D7GA 2R61A 4AQ7A 1EU4A 3DHGC 3JSVB 3L17A 2Q5WD 2KFKA 1XF5L 2OJRA 5IP4D 1E5WA 4O1NA 1I4PA 4WJNA 2RDBC 4NQLB 4DK5A 4GMVA 3NVWA 1J8CA 1Q0WB 2NMQA 4RCOA 1E8YA 5CHFA 1NI2A 1L4ZB 2WXHA 1JQ4A 1FCCC 2IDYA 3FKYA 3ZNGC 4H2AA 1JRPA 3TL5A 1TKEA 1KF6B 3LXFA 4GDLB 1RAXA 2JXXA 1F52A 5D3DA 4WJQA 3V3XA 4L23A 1IUEA 2LASA 1ZKHA 3OWEB 3DWGC 1WF9A 3HM6X 3P4QB 3VTUA 4KVGB 2KN4A 1PGAA 2MEKA 3A9JA 4BVUC 5EDSA 4G50A 2M0AA 2WNMA 4ZYNA 4A3PA 1GC7A 4RGNA 2LGYA 2KWVB 2X8XX 1TS4A 4KKJA 4IWQA 5C2TB 2NVUI 1D3ZA 3I5JC 1KOTA 2GRIA 4C56C 2HD5B 2FUG1 2KMMA 2N9KA 3N32A 2KX3A 4HKQA 2Z8LA 2XEWA 4DXGA 2L0FA 1P0RA 3ONSA 5DPWA 1YX6B 3E56A 4EOYA 4P7IA 1WJUA 5EE9A 3GE3C 2MSED 3RCZA 1V81A 1V80A 2G45B 2PE9A 4DXAB 3VH4B 1LQBA 1SGHA 3UI3A 4RNAA 4GOCA 4MEMA 4LNIA 1JWUD 3P4PB 1UGMA 4PYUA 3DHHC 3EFUA 2PW9A 2L3ZA 3WAMA 4M02A 3ZKJC 5E6JA 2FIFA 2KMAA 3EUB2 3Q8EA 1HQRD 2VH2A 3RT3B 1WSPA 3HVDA 1XQQA 4KSKC 1T6BX 2IY0B 2WXPA 4B0MA 2DWQA 4ZOHC 2FE8A 3Q2AC 2WU2B 1J7CA 4MM3B 2RPQA 1FIQA 2KKCA 1N5XA 3D32A 5CTRC 1C77A 1K50A 4WAFA 2OHFA 3NG0A 4YSYB 3PZ8A 4JX1C 3T3OA 1SF0A 2C7HA 1VRAB 3VUYA 4B9KA 4DHJD 2LVOA 2DZMA 1IYFA 3NHEB 3PRMB 4IDIA 3MFGA 2JRIB 2HJ1A 4GU2A 1KH0A 3QC8B 3SU8X 2RPVA 1H8CA 3KUZA 3CMMB 2V3NA 4OW0A 1FFVA 3KYCD 4ARIA 2CHZA 1UNSA 2ZW0A 3GB1A 1WJNA 2WX1A 3MHSD 2MA9B 4FJZA 1ET9A 1CK1A 4B95A 1UELA 1LM8B 5HHDG 4HCNB 4RMAA 1E7UA 2KO3A 1A70A 2JQRB 1UBIA 3IFWB 3JYUA 2KYWA 1CQVA 4XYCA 1WE7A 2CKHB 2LGIA 1R4MB 3DVGX 2BS4B 2O6VB 4HWIB 3H1UA 5G5HA 2J52A 1CZPA 2KFKB 3V6EB 3VH3B 2LHDA 1T0RC 1F9JA 5L83A 1EF5A 4GLSC 1D4BA 3AE2B 1TYGB 3H7SA 2QILA 2Z0EB 4LDTB 4LCDE 4HLEA 2C7MB 1OEYA 3AM9A 4DDID 2YVCA 3Q3FA 1B9RA 3H7PB 1I4QA 1JWSD 2J4XA 1RFAA 3PLVA 2LFIA 4JGHB 4W9HA 4PYZA 5FR3A 4IM2A 3OJ4B 1XT9B 2MHJA 4JWSC 1V8CA 1UH6A 4E71A 1ACCA 2MRPA 1C4AA 2TSSA 3RI7C 4KSLC 2CHXA 3BVMA 2KWCA 2KDEB 2Z59B 1E8XA 1KLUD 1V6EA 3ZQ4A 3KUCB 1FNUA 3ENEA 3N1YC 2BTEA 4HPLB 1YN5A 1PYWD 2W9NA 2ZW1A 4GGQA 3A9JB 4MSMB 1MFWA 3AEFB 3JSVA 5IKCM 1XD3B 4ANWA 2KDIA 2BYEA 1XCTL 1V5OA 2QJLA 1PGBA 2PIAA 2M0XA 4M01A 5BO4B 3ZGZA 4MGIE 4IM0A 2RDHA 2J53A 3BWUD 3QK0A 5LLIA 3ZNHB 2N9EB 1WYGA 1J7AA 4KGSA 1I4XA 3UGBB 4XX5A 4WIPA 1V97A 1ZXIA 1N63A 1Q10A 1V86A 2RD0A 1UF0A 4EUTA 1N60A 2ACZB 3Q8FA 4HK2A 1SSNA 2BGFA 1EF1A 3M62B 1Q5WB 2XBBC 1WYWB 3TCAA 4BZAA 4GDLA 4JIOU 1OGWA 1TZOA 5JZEB 1WGYA 2RDGA 2GBNA 1T0YA 2EMSA 2HE7A 2K9XA 4IW0A 1E10A 4K1RB 3ZW3A 4REZA 1Y8RC 2VRRB 4KGTA 2QMTA 3Q8BA 3A4RA 3L54A 3AEDB 1QF6A 3TEYA 1YD8U 5AEKB 2KN5A 2C5LC 3APFA 1VZ8A 1LGRA 3R7RA 3DPDA 3DBHB 1C1YB 2BS3B 1G6JA 4BKTA 1ROEA 4OHJA 2M56B 4RH6A 5E6PA 1TY0A 1WH3A 3IT4B 1V1OA 3W1SA 1NVID 1KFYB 4HXDA 5BMHA 3PS6A 2R2QA 3W2DA 4JWUC 1L2NA 4DHZE 1PQSA 4IWPA 2KDFB 2ZCBA 4MELA 4XDDA 2MBEA 3DVNU 3PGEA 3ZRCA 3IBEA 3RNFC 3VAWA 2ZNVB 1SBBB 5FKAC 1L6VA 2N1WA 2V4LA 2BYVE 5LXIB 2BWES 2I38A 4HEA1 4CYEA 4PS8A 1WR6E 3AH7A 1YMHE 2WXFA 4C7ZA 1EO6A 4B6WA 4ZHOA 4YWGG 4B0EA 2KDBA 1KJTA 2LZ6A 2LVPA 1HTQA 3ZJUA 1VCBA 3J9CA 1YNTE 4CHKA 3SDLC 3AE8B 1NYRA 2KX0A 4YL8A 2M1MA 2WS3B 2DYOA 1YJ1A 4ZHPA 2Y5BB 4MM3A 2N9PC 4KZ0A 4DHZB 4M0WB 1FO4A 3UF8A 2AQ3B 1Z2MA 2Z0DB 4ZYSA 4DHJB 2YLMA 5LXHA 2JF5A 3PVLA 2WXNA 4ARCA 3IVFA 2D10A 2JX5A 3TSSA 2D5GA 2W3SA 1EU3A 1RRBA 3V62A 4MGZE 4LTUA 3FILB 1KTKA 2ASQA 5C1ZA 1C4PA 4BOZB 4URKA 1SEBD 5GXGB 2MJEA 1ESFA 1GPXA 3L0WB 1YX5B 2ON8A 1BUIC 2WXLA 4MDKE 4FADA 3BYTB 1VJKA 3GZNB 3ZUNA 2K6QA 1E8ZA 3S2AA 2WDTB 3QJZA 1TKYA 4FXCA 4XWWA 3PO0A 4HVBA 4ACFA 5D94A 3W5UB 3U30A 1WRDB 4FJVB 5JH5C 1ZDVA 4AS1A 2FCNA 4TV3A 4RF1A 4ANXA 3LB8C 3WAPA 2K6DB 4TMAB 1WXQA 1R4NB 2O6VA 5FK9C 1WZ0A 3LDZE 1Y56A 4LJPB 1MVKA 3WIMA 4HDOA 3P4SB 4ICUA 3VR8B 2JVCA 1R7SA 3P4RB 4Q2JA 2VZKD 4II2B 2B76B 3TIXA 3AULA 3CIRB 4W9KA 2DAJA 1WGHA 2H89B 4LNOA 3I57A 1FNWA 3P1MA 4F1SA 4C4VB 1TS2A 1NI3A 2N1VA 2RMMA 4TQ0A 1ZPSA 3H7PA 2KNBA 2KTRA 3C8YA 1XEEA 2JU6X 1MG8A 2UWQA 4MT5A 2DENB 3ZRFA 1V1PA 1PDXA 4MH8A 4G11A 3IT6B 4LLGM 1L7YA 1HTOA 1TGZB 3U4EG 1QKZA 4W9CA 1UGJA 3AU5A 1MG4A 3OG5A 1E6EB 1B1ZA 2BYTA 1C9FA 2LRUA 2FBWB 2BPSA 4EE2A 1JWBD 3PZ7A 3EA6A 5IO9A 4WWMA 3KYDD 1F2RI 1XLOA 1WX7A 4MGYE 4DXFA 4IG7B 4ZRKA 4KDLB 2LD9A 3QX1A 1V5TA 3SR6A 2KWDA 4ZDVA 3ABVB 2CU3A 4ICVA 2J0JA 5DPRA 3QARA 2B3AA 4PS7A 3ZJVA 2KQ4X 4DWFA 2WXJA 4HPPA 4YSZB 3NRZA 3ZTCA 1VLBA 2E6XA 3AE1B 3VQIA 1R4MI 3NVZA 1LXDA 1YJIA 3AE3B 5HKHA 2AQ2B 4XZ4A 3HVZA 5DPTA 4BKSD 1MHHE 4ZRPA 1KRHA 1VZ7A 2MP2A 2ZZPB 4KZCA 4YT0B 5GMVA 1A5RA 2AEHA 4N6EB 1TBEA 4EEWA 1QOAA 1UUPA 1AARA 2HDEA 3B1LX 1OQYA 3DOWA 1C78A 2K25A 3NUHB 1HA5A 2WDVB 5BYQA 3HUIA 4KIKB 3KW5B 5AZGA 4NQKE 4OVVA 3ML9A 2KMCA 1NYQA 3SFEB 1QT9A 3WA0A 1P7EA 1E90A 3ZXRA 2AQ1B 2LUMA 2PLPA 1FEHA 1ET6A 3JW0X 3ZYYX 3W9CB 5HI1A 2NPTB 2GOWA 4IUMB 3DVGY 4A9AA 4C80A 1FM0D 4W9EA 4F7ZA 4HCPB 4ITKA 3MTNB 4BKSA 2MJ3A 2QIEB 3R2TA 5TR5A 3VRAB 3H6NA 1TKGA 4NNJB 3DDCB 4GXBA 2IO3B 3GP7A 2FUHB 1WXVA 1HEZE 2BF8B 2DZJA 2M17A 2M4NA 2D07B 4MACA 2N9XA 4LJOB 2K39A 3KWVA 1N62A 1ENFA 1E8WA 2LGSA 4AOFA 1WGRA 2MW5A 1K52A 2W82A 2JPHA 2YEPF 2IGHA 2WDRB
chains in the Genus database with same CATH topology
1N61A 2WP9B 1N60A 2ACZB 2W3RA 1TS5A 3Q8FA 4XWTA 3Q69A 3WCQA 1SSNA 2J42A 1JWAD 4YTPB 4YXDB 1DOYA 3FC4A 3AN1A 2JZPA 5MPOA 3R2IA 3IAM1 3BZDB 2NTSA 1TZOA 2JSVX 2WXQA 2M19A 2RDGA 4M0WA 5AUIA 1OQRA 2K9XA 1E10A 4P6VF 2ICIA 4REZA 4KGTA 1VR9A 2QMTA 4TQ1A 3Q8BA 3AEDB 4YTMB 1XLNA 3VRBB 1I7HA 4RGMA 1QF6A 2H88B 1GB1A 2EELA 3TEYA 1GB4A 4P16A 4WH4A 1GOZA 4XE0A 2G1EA 4D2KA 1D6EC 2OEDA 1VZ8A 2MJDA 2DBYA 2BS3B 3P63A 1FFUA 2K22A 1YN3A 1JMLA 2WXIA 1ROEA 4OHJA 2M56B 4RH6A 1PUTA 1SJED 3FILA 1TY0A 2WXRA 3VR9B 4XDCA 2WXGA 2WXOA 3IT4B 1SIJA 2DYMA 2YEPB 1XXGA 1V1OA 3W1SA 1NVID 4NZLB 3NS1A 1AW7A 1KFYB 5HG2A 1JCKB 3W5VB 5BMHA 1DYQA 3V05A 3W2DA 1T5XD 1C76A 2HTME 1KLGD 4JWUC 2KACA 1YQ4B 4JE3B 1VZ6A 3KQ4A 1DOIA 4XDDA 1V1PB 1ZOYB 2BT6A 3AEAB 2GB1A 3ETRA 1D5XC 2XNAC 2CJOA 3DWMA 3KWLA 4HROA 5D7GA 2R61A 4AQ7A 1IBXB 1EU4A 1SBBB 5FKAC 1L6VA 2IGGA 5D3IB 2Q5WD 3TEWA 2BB5A 1XF5L 1QOFA 4J3OD 5BYRA 4O1NA 1I4PA 3NVYA 2I38A 1EWCA 4HEA1 2PMVA 2Y5PA 1XLPA 4KX6B 3NVWA 3B9JA 1XCQL 1EM7A 1JROA 3AH7A 1YMHE 2WXFA 3CWIA 4C7ZA 2N0SB 2VZKB 1P7FA 5BYSA 2K5PA 3AEGB 2NMQA 4RCOA 4ZHOA 4DQOC 2XN9C 4YWGG 4B0EA 2EKIA 1L4ZB 1EWYC 1YJJA 2WXHA 5AUKA 3ZJUA 1JQ4A 1FCCC 4HRSA 3J9CA 1YNTE 4WURA 2IDYA 3AE8B 1E7PB 1NYRA 2SEBD 3MP9A 4H2AA 1JRPA 4N59A 2WS3B 1TKEA 2DYOA 1KF6B 2N9LA 3LXFA 4GDLB 2ONQA 5EE3A 4ZHPA 1DGJA 5BMGA 3BVZA 2LJIA 2K0PA 5D3DA 1FO4A 3V3XA 4A55A 4L23A 1IUEA 4US9A 3AMZA 2AQ3B 3OWEB 4OVZA 1WWTA 3DWGC 4ZYSA 3LYYA 1PFDA 3P4QB 1RYJA 2WXNA 1QOGA 1D5MC 2KN4A 1PGAA 2MEKA 4US8A 1L5PA 4ARCA 4L1BA 2JX5A 2QSDA 2BW2A 1K51A 3TSSA 2D5GA 2W3SA 2M0AA 1EU3A 4OZBA 1I4RA 2WDQB 4NAMA 2WNMA 2L32A 4GDKB 4L2YA 1J7BA 4LTUA 3FILB 1KTKA 4RGNA 3NZ3A 1K53A 1WGKA 1FRDA 1TJEA 1C4PA 1FXIA 1TS4A 4KKJA 5C2TB 1DOXA 3TEXA 1SEBD 2BBCA 1GAQB 1XO3A 2INNE 5GXGB 2WLBA 2KAJA 2MJEA 1ESFA 2GRIA 2IGDA 1ZDXA 4C56C 1GPXA 3AE7B 1BMLC 5C3JB 2ON8A 2GI9A 3MHZA 1BUIC 1WRIA 1NENB 2WXLA 2N7JA 2FUG1 2V0GA 3BYTB 2KMMA 1L6UA 1VJKA 5G5GA 2N9KA 1UWMA 4HKQA 2Z8LA 5I4DA 4DXGA 1TKYA 3AECB 4FXCA 4XWWA 2JYEA 3E56A 3BIID 5EE9A 3PO0A 4KKIA 4LK0M 1JW9D 1SE3A 3AV8A 3W5UB 5H92C 1HZ6A 4RF0A 3T3NA 1M4VA 1SE2A 1ZE3D 4YSXB 5EE1A 3E9SA 2W82A 3AE6B 1ZDVA 4AS1A 3GS2A 1MHXA 3UI3A 4RF1A 4RNAA 3LB8C 3U7ZA 1E0ZA 2V4IB 4TMAB 1JWUD 3P4PB 1WXQA 5FK9C 3TUOA 1Y56A 3MC0B 2PW9A 1MVKA 2JXTA 5E6JA 3P4SB 1IGCA 1FCLA 3VR8B 1R7SA 3EUB2 3Q8EA 1I4GA 3P4RB 1FMAD 4NAWB 1NEKB 2VZKD 4Q2JA 1HQRD 2B76B 1WSPA 5TSSA 3HVDA 3CIRB 1ZP0B 2H89B 1VDVA 3O13A 1T6BX 2SAKA 3I57A 1FNWA 3BVGA 1ZXHA 3P1MA 1BXTA 1TS2A 2WXPA 1LO5D 4UDUC 2DWQA 4B0MA 1E9MA 4ZOHC 2FE8A 2KDMA 1NI3A 1SE4A 3BK1A 2WU2B 1J7CA 1L0YB 4MM3B 2RMMA 4TQ0A 1ZPSA 1FIQA 1AN8A 3B2GA 1N5XA 3C8YA 1XEEA 2JU6X 2PVGC 3BYYB 1C77A 2W55A 2W54A 1K50A 4WAFA 2OHFA 1RM6C 4MT5A 2IPKD 3RFZB 1RWSA 2AX5A 1AWDA 4YSYB 4YTNB 1HXYD 1V1PA 1PDXA 3PZ8A 4JX1C 4MH8A 1C79A 3T3OA 1SF0A 3IT6B 4LLGM 1VRAB 5JXVA 1MPEA 2Y3AA 3B2FA 1PGXA 4JPSA 3R8BA 3MJ5A 3U4EG 2QEJC 3TEZA 1QKZA 4IDIA 4HKZE 2L1AA 2K3UA 3MFGA 3U2SC 1UGJA 3HRDD 4IOIE 3NVVA 1SJHD 1E6EB 1L0XB 3N9YC 1B1ZA 2BYTA 1C9FA 4OZAA 1JALA 1KH0A 2FBWB 2RPVA 1T3QA 2E3TA 2V3NA 1I4HA 4OW0A 4EE2A 4PT5A 1SB3C 1JWBD 3PZ7A 3EA6A 4RGOS 1FFVA 2JYTA 4ARIA 1UNSA 1L0VB 2ZW0A 2PTLA 3GB1A 4WWMA 4C7YA 1F2RI 1XLOA 2LMCA 4DXFA 3U52E 2G9HD 2WQYB 3EGRA 3L4PA 2I2YA 1N5WA 3SR6A 2KWDA 3ZJTA 1ET9A 3ABVB 1CK1A 2CU3A 1STEA 2INPE 4A90A 1RFKA 1F0ZA 3H8HA 3IAS1 3AE5B 5HHDG 3ZJVA 2KQ4X 2WXJA 4YSZB 1A70A 3I9V1 2JQRB 2WXMA 4USAA 1YN4A 3NRZA 2YEPF 1VLBA 2E6XA 3AE1B 3VQIA 1CQVA 1FRRA 2BS2B 3NVZA 1YJIA 3AE3B 4R3DA 4NJCA 2AQ2B 4RGTA 1HZ5A 2LGIA 2BS4B 5LNK1 3HVZA 3AE4B 3P42A 1D5ZC 1QOBA 5G5HA 2WXKA 1MHHE 4HJGE 4ZRPA 1KRHA 1TY2A 1VZ7A 2J52A 1CZPA 5H8YE 4YT0B 3AB5A 4N6EB 1QLBB 1QOAA 2BB6A 1UUPA 2LHDA 1TS3A 2HDEA 2LHEA 3Q8AA 1FD6A 1C78A 1C4CA 3AE9B 4GLSC 2JWUA 1D4BA 3AE2B 1TYGB 4N58A 3AEEB 1CJEA 2QILA 3NUHB 3IXSA 1HA5A 3Q8CA 1QQRA 2WDVB 5BYQA 2DLBA 3HUIA 3AM9A 1B9RA 1I4QA 1JWSD 2J4XA 2WU5B 4OZCA 2MH7A 4CQNA 2LFIA 3SFDB 1NYQA 3SFEB 1QT9A 5FR3A 1OFFA 4WQMA 4A8XC 4TSSA 4ZRQA 1MI0A 3URYA 1F77A 1P7EA 3SEBA 2LEKA 4JWSC 2AQ1B 5T8IA 2LUMA 1QILA 1V8CA 1FEHA 1F2RC 2PLPA 1ET6A 3ZYYX 1ACCA 3AEBB 2PVOD 1C4AA 3W9CB 2TSSA 5HI1A 2IJ0A 3BVMA 4A9AA 4C80A 1FM0D 1XLQA 5HFYA 4A6QA 1KLUD 2V3PA 4RFBA 1OQQA 3ZQ4A 4ITKA 1FNUA 2BTEA 1ZUD2 2MJ3A 2QIEB 3R2TA 1YN5A 1PYWD 2ZW1A 3VRAB 1AYFA 1FXAA 1IBXA 2X38A 3AEFB 1TKGA 1SXTA 3GP7A 3BK2A 1HEZE 1XCTL 2PKOA 2L52A 2QJLA 4MACA 2NTTA 1YQ3B 1PGBA 2PIAA 4KGRA 3KWVA 1L4DB 2Y5CA 3ZGZA 1N62A 1IGDA 1FNVA 3RPFC 2RDHA 5BMIA 1JWMD 2J53A 2L83A 3BWUD 3FAHA 4IKGA 1ENFA 3KLSX 1WYGA 2CJNA 5EE0A 1J7AA 4KGSA 1I4XA 1UWXA 4WIPA 1K52A 1V97A 1ZXIA 1N63A 1Q10A 2IGHA 2WDRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N61 A;  1WXQ A;  1N60 A;  2K5P A;  2WP9 B;  3AEG B;  2ACZ B;  2W3R A;  4ZHO A;  3WCQ A;  1JWA D;  4YTP B;  2BS4 B;  4YXD B;  3HVZ A;  2EKI A;  3AE4 B;  1DOY A;  3FC4 A;  1EWY C;  1YJJ A;  3AN1 A;  3P4S B;  5AUK A;  5MPO A;  4HRS A;  1JQ4 A;  3VR8 B;  1QOB A;  1R7S A;  3EUB 2;  3P4R B;  5G5H A;  1FMA D;  1NEK B;  1KRH A;  2B76 B;  1E7P B;  1NYR A;  3AE8 B;  1CZP A;  5H8Y E;  4YT0 B;  2M19 A;  3CIR B;  3AB5 A;  4N6E B;  1JRP A;  4N59 A;  1ZP0 B;  1QLB B;  1QOA A;  1TKE A;  2WS3 B;  2H89 B;  1VDV A;  1KF6 B;  1OQR A;  2K9X A;  3LXF A;  5AUI A;  4P6V F;  5EE3 A;  4ZHP A;  1E10 A;  3P1M A;  1DGJ A;  2DWQ A;  1E9M A;  4ZOH C;  3AE9 B;  3AED B;  4YTM B;  1XLN A;  1NI3 A;  3AE2 B;  1TYG B;  2WU2 B;  1J7C A;  4N58 A;  1I7H A;  3AEE B;  1IUE A;  1CJE A;  2H88 B;  3AMZ A;  4US9 A;  3VRB B;  1QF6 A;  1FIQ A;  3B2G A;  1WWT A;  3DWG C;  1N5X A;  2WDV B;  3HUI A;  2PVG C;  2G1E A;  3AM9 A;  1B9R A;  1PFD A;  2W55 A;  2W54 A;  2WU5 B;  2MJD A;  3P4Q B;  1RYJ A;  2OHF A;  1QOG A;  1RM6 C;  2MH7 A;  1RWS A;  2AX5 A;  1AWD A;  4YSY B;  4YTN B;  1L5P A;  3SFD B;  2DBY A;  1PDX A;  4JX1 C;  2BS3 B;  1NYQ A;  3P63 A;  1FFU A;  2K22 A;  1SF0 A;  2JX5 A;  3SFE B;  1QT9 A;  1OFF A;  4WQM A;  2W3S A;  1ROE A;  2M56 B;  1PUT A;  2WDQ B;  3VR9 B;  3B2F A;  1J7B A;  2LEK A;  4JWS C;  4LTU A;  4IDI A;  1SIJ A;  1V8C A;  1WGK A;  3ZYY X;  1FRD A;  1NVI D;  3HRD D;  1TJE A;  3NS1 A;  3AEB B;  1E6E B;  1FXI A;  1KFY B;  2PVO D;  3NVV A;  5C2T B;  3W9C B;  1FO4 A;  1DOX A;  1JAL A;  2FBW B;  1GAQ B;  1XO3 A;  3W5V B;  5GXG B;  2WLB A;  4A9A A;  1T3Q A;  4C80 A;  1FM0 D;  1XLQ A;  2E3T A;  2KAJ A;  2HTM E;  2MJE A;  4JWU C;  1SB3 C;  3AE7 B;  1JWB D;  1GPX A;  1OQQ A;  4ITK A;  5C3J B;  1YQ4 B;  1FFV A;  1WRI A;  1L0V B;  1NEN B;  1ZUD 2;  2MJ3 A;  2QIE B;  4WWM A;  1DOI A;  4C7Y A;  1XLO A;  1ZOY B;  2BT6 A;  3AEA B;  1AYF A;  3VRA B;  2KMM A;  1L6U A;  1VJK A;  5G5G A;  1FXA A;  3ETR A;  3AEF B;  1UWM A;  1TKG A;  2CJO A;  3DWM A;  3KWL A;  2WQY B;  4HRO A;  3L4P A;  1TKY A;  3AEC B;  1N5W A;  4FXC A;  2PKO A;  1L6V A;  3SR6 A;  2L52 A;  3ABV B;  2QJL A;  3BII D;  5EE9 A;  2CU3 A;  1YQ3 B;  3PO0 A;  2Q5W D;  1JW9 D;  1RFK A;  2PIA A;  3AV8 A;  1F0Z A;  3W5U B;  1QOF A;  5H92 C;  2Y5C A;  3AE5 B;  1N62 A;  4US8 A;  3RPF C;  1YJI A;  4YSX B;  3NVY A;  3FAH A;  2L83 A;  5EE1 A;  1A70 A;  4YSZ B;  2JQR B;  3AE6 B;  4USA A;  1XLP A;  3NRZ A;  1WYG A;  3NVW A;  4KX6 B;  1VLB A;  2CJN A;  3B9J A;  3AE1 B;  5EE0 A;  1J7A A;  1JRO A;  1FRR A;  2BS2 B;  3AH7 A;  3CWI A;  3LB8 C;  3NVZ A;  1V97 A;  2N0S B;  1ZXI A;  1N63 A;  4C7Z A;  1E0Z A;  3P4P B;  3AE3 B;  2WDR B; 
#chains in the Genus database with same CATH topology
 2L7R A;  2WP9 B;  1S1Q B;  4XWT A;  3WCQ A;  4YXD B;  3K9P B;  1DOY A;  3FC4 A;  3AN1 A;  2JZP A;  2KLC A;  3BZD B;  3ZIM A;  2M19 A;  4M0W A;  2AL3 A;  2PEA A;  3NJT A;  4P6V F;  4AUQ C;  3DCG A;  3LJ3 A;  4RGM A;  2H88 B;  4W9J A;  4DBG A;  3DBR B;  2EEL A;  4XE0 A;  1WXS A;  2G1E A;  5D2M B;  2MJD A;  2JWZ A;  3P63 A;  4JLC A;  2K8C A;  2AL6 A;  1JML A;  4A20 A;  1F1H A;  2AYO B;  3FIL A;  1MJD A;  2WXR A;  3VR9 B;  1OEY J;  1TT5 B;  2GMI C;  2I1J A;  2JY6 A;  2LXA A;  4MGK E;  2DYM A;  2YEP B;  1XXG A;  3NS1 A;  5HG2 A;  4NJ6 A;  2KAN A;  1OTR B;  1KM7 A;  1DYQ A;  3U7D A;  1N6Z A;  2KTR B;  2KAC A;  3VFK A;  4JE3 B;  3V61 A;  1V1P B;  2BT6 A;  5CX3 A;  2LJ5 A;  4K3C A;  4E3C A;  2XNA C;  3DWM A;  1J19 A;  4HRO A;  5DCN A;  4BAX A;  2KQS A;  2IGG A;  3TEW A;  3SD5 A;  2J7Q B;  1QZE A;  1QOF A;  1V9J A;  3T8M A;  2DHZ A;  3W1Y A;  3NVY A;  2KJR A;  1EWC A;  3ECI A;  2Y5P A;  1T0S C;  1XLP A;  4KX6 B;  3CWI A;  2N0S B;  2VZK B;  2KVZ A;  4JL9 A;  5E6N A;  5BYS A;  2K5P A;  3EHV A;  5J2R A;  4DQO C;  2XN9 C;  2L8J A;  2EKI A;  1YJJ A;  3BIN A;  4HRS A;  4WWO A;  2QDF A;  4RM9 A;  1ISN A;  4ANV A;  3ALB A;  1TTN A;  4BFR A;  2K8B A;  4C4V A;  4N59 A;  2N9L A;  4TKN A;  5EE3 A;  1GJZ A;  2LJI A;  2CU1 A;  2K0P A;  3TMP B;  3HIZ A;  4US9 A;  4G0N B;  3PSE B;  5JHB A;  1WWT A;  3VVW B;  1J0G A;  1PFD A;  1RYJ A;  3NZU A;  4FLH A;  1D5M C;  3AXC A;  4US8 A;  1L5P A;  2KVR A;  2QSD A;  2BW2 A;  4N9F 4;  2NCN A;  4OZB A;  1I4R A;  4NAM A;  4GDK B;  4L2Y A;  2MP2 B;  2IO0 B;  2L05 A;  4W9I A;  2DZK A;  1WGK A;  3N20 C;  4XGA B;  1TJE A;  2BWF A;  2CHW A;  3GOE A;  2M8S A;  2INN E;  4K7U A;  1P9D U;  2NS5 A;  4P1C C;  2IZV B;  4MSQ B;  3GZN I;  2GI9 A;  3MHZ A;  2N7J A;  4EZJ A;  2V0G A;  5G5G A;  2C7N B;  3VUW A;  1UWM A;  2BVC A;  1P3Q U;  2JYE A;  3BII D;  3H9D A;  3L13 A;  4LK0 M;  1UBQ A;  5C23 A;  4ANU A;  5H92 C;  4RF0 A;  3T3N A;  1M4V A;  2LWP A;  1ZE3 D;  5EE1 A;  5J17 A;  3PRE A;  2J0M A;  3M63 B;  3AE6 B;  3GS2 A;  1R4N I;  2PE6 B;  2A4Z A;  1V49 A;  4PK1 A;  3TUO A;  3MC0 B;  2DZI A;  5FR6 A;  2RR9 A;  4HPM B;  1IGC A;  4NAW B;  1I4G A;  1NEK B;  2V9H A;  5TSS A;  4BOS C;  1VDV A;  3PZD A;  2O2V A;  2BKR B;  1BXT A;  1LO5 D;  1E9M A;  2K8H A;  3BK1 A;  2KDM A;  2KC1 A;  2JZZ A;  4KIK A;  4S0R A;  2IO2 B;  4NY0 A;  1AN8 A;  3B2G A;  2UYZ B;  2PVG C;  1FPY A;  3W1S C;  4LNN A;  2W54 A;  4OVU A;  3UQB A;  1WX8 A;  3RFZ B;  1RWS A;  2AX5 A;  4YTN B;  1C79 A;  2EKE C;  2FCQ A;  1V2Y A;  4LNK A;  2Y3A A;  2KXJ A;  3B2F A;  1PGX A;  4JPS A;  3R8B A;  2QEJ C;  3TEZ A;  2L1A A;  2NPT A;  1LFD A;  2K3U A;  4CO7 A;  1SJH D;  1L0X B;  3N9Y C;  4OZA A;  4WAA A;  2REX A;  1T3Q A;  2D2Q A;  2E3T A;  1I4H A;  2D3G A;  4PT5 A;  4G3X B;  2PTL A;  2IYD B;  4C7Y A;  3KUD B;  2LMC A;  4LNF A;  2D3C A;  2WQY B;  3L4P A;  3N1X C;  3DBL B;  3ZJT A;  2ZPN A;  4A90 A;  1F0Z A;  3DQV A;  3IAS 1;  3AE5 B;  3V6C B;  2L00 B;  4EFO A;  2C60 A;  3I9V 1;  4K7S A;  2WXM A;  1YN4 A;  2R2O A;  2MBH A;  3P2B A;  4NJC A;  4AJY B;  3CST A;  3OJ3 A;  3HK0 A;  2BYF A;  5LNK 1;  3P42 A;  3DVN V;  1D5Z C;  1TIF A;  3UIO B;  4WQO B;  5AZF A;  1QOB A;  2WXK A;  4HJG E;  4WJP A;  3DHI C;  4MH0 E;  5H8Y E;  3ZO5 B;  3R3M A;  3PT2 B;  2BB6 A;  1ZW7 A;  3IG3 A;  1TS3 A;  2LHE A;  5DPS A;  1C4C A;  3ZDT A;  3NS8 A;  4N58 A;  2KFJ A;  3AEE B;  1CJE A;  2DLB A;  1I35 A;  4OZC A;  2FAZ A;  4CQN A;  3SFD B;  3RNE C;  1OFF A;  4WQM A;  3A1Q B;  4A8X C;  4TSS A;  4ZRQ A;  2AWT A;  3URY A;  1F77 A;  3SEB A;  5T8I A;  1F2R C;  3VTV A;  3AEB B;  2PVO D;  2MBB B;  4JQW C;  5AZH A;  1WXM A;  3B08 A;  3NOB A;  3EEC A;  4RFB A;  2MWS B;  1KLV A;  4GSW A;  3GE8 C;  1AYF A;  2XK5 B;  4P1B C;  1FXA A;  3DBS A;  2X38 A;  1WI0 A;  3QHT A;  3Q6B A;  2PKO A;  2L52 A;  2NTT A;  1YQ3 B;  4BBN F;  3ZVV A;  4X57 B;  2Y5C A;  1FNV A;  3RPF C;  3N3K B;  2L83 A;  3R7Q A;  4IKG A;  4ZRJ A;  3KLS X;  2CJN A;  5EE0 A;  4EZL A;  1UWX A;  1JRU A;  3K9O B;  2MLB A;  1N61 A;  2IO1 B;  3MJW A;  2W3R A;  1TS5 A;  3Q69 A;  1JWA D;  2KHW B;  4YTP B;  2GBR A;  1YQB A;  5MPO A;  3R2I A;  2N4F A;  5L95 C;  2V3S A;  5AUI A;  1OQR A;  1WE6 A;  4IWO A;  3DBR I;  1VR9 A;  4TQ1 A;  2KOX A;  4YTM B;  1GB1 A;  3AU4 A;  1GOZ A;  1NDD A;  4I6L B;  3VDZ A;  2VH1 A;  2DBY A;  2JUO A;  4GDK A;  1FFU A;  2RGF A;  3TJP A;  1GC6 A;  4XDC A;  3Q3J A;  1Z5S B;  4M8M A;  3N1Z C;  2O2V B;  3MC8 A;  3L10 B;  5D6J B;  2MBO A;  3UQA A;  3A9K B;  3W5V B;  2QCZ A;  3I63 C;  3V05 A;  1T5X D;  2HTM E;  1TZ1 A;  1YQ4 B;  1VZ6 A;  3KQ4 A;  1DOI A;  3BY4 B;  1ZOY B;  3AEA B;  2GBK A;  3CSF A;  2GB1 A;  1D5X C;  1H4R A;  4C00 A;  2CJO A;  3HHM A;  2MX2 A;  1IBX B;  2QC8 A;  1X1M A;  2I1K A;  5D3I B;  3ZDM C;  2BB5 A;  3PLU A;  2L0T A;  4J3O D;  5BYR A;  1WR1 A;  2K1F A;  2PMV A;  4WJO A;  3B9J A;  1YOV B;  3VXW A;  3RNB C;  1XCQ L;  1EM7 A;  1JRO A;  4FBJ B;  2KLG A;  3ZXV A;  2GBJ A;  1P7F A;  2J0K A;  3U8Z A;  3AEG B;  3X23 A;  4S17 A;  4W9F A;  4NAW A;  2JT4 B;  1EWY C;  5AUK A;  4GIV A;  3ZLZ A;  4WUR A;  3O65 B;  1E7P B;  2LXC A;  4ZRI A;  2WGS A;  2SEB D;  3MP9 A;  3RD2 A;  4FUL A;  1DGJ A;  1P98 A;  5BMG A;  3BVZ A;  1EUV B;  1WIA A;  2NBW B;  4HJK A;  3RYT A;  2MQJ A;  4A55 A;  2JZ3 B;  3AMZ A;  2RSU A;  4K81 A;  4OVZ A;  3LYY A;  4IM3 A;  2C9W B;  1WGD A;  3VUX A;  1QOG A;  4I6P A;  5IAA C;  1WXA A;  4L1B A;  1K51 A;  3B0A A;  2WDQ B;  2L32 A;  1VD2 A;  2LVQ A;  1J7B A;  1WMH B;  3APD A;  3V60 A;  2N7D A;  2KQ7 A;  3NZ3 A;  4HDQ A;  2N7E A;  1K53 A;  1FRD A;  4GB9 A;  2ZNV C;  2V1Y A;  1K8R B;  1FXI A;  4TUU A;  1DOX A;  3DBH I;  2GBM A;  3TEX A;  1I42 A;  2BBC A;  3I3T B;  1GAQ B;  1XO3 A;  2WLB A;  2KAJ A;  2IGD A;  3L08 A;  1ZDX A;  3AE7 B;  3RUI B;  3PPA A;  4MJS A;  1BML C;  5C3J B;  5IN7 A;  2HJ8 A;  1WRI A;  1NEN B;  2WX0 A;  2KJ6 A;  2JRH A;  3R66 C;  1L6U A;  2A5U A;  5I4D A;  5KHO A;  3AEC B;  3QWZ B;  3L16 A;  2ZEQ A;  2FCS A;  4KKI A;  1JW9 D;  1SE3 A;  3AV8 A;  1HZ6 A;  2DX5 B;  1SE2 A;  5CHW A;  3ZNI D;  4YSX B;  3ZTD A;  3E9S A;  3QA8 A;  1MHX A;  3U7Z A;  1E0Z A;  2V4I B;  5E6O A;  2JXT A;  1HE8 A;  1FCL A;  1FMA D;  1T0Q C;  1P1A A;  2CR5 A;  2WHI A;  4WWN A;  1ZP0 B;  3O13 A;  1GG3 A;  4PS3 A;  2SAK A;  3BVG A;  1YIW A;  1ZXH A;  4UDU C;  1SE4 A;  1GUA B;  1L0Y B;  2KK8 A;  2ZVO A;  4M8N A;  3RNG C;  3X0W A;  2DNF A;  3BYY B;  2W55 A;  2KWU B;  1RM6 C;  2IPK D;  3A1Q A;  1AWD A;  2LRW A;  1HXY D;  2D11 A;  3QIJ A;  5JXV A;  3A4S C;  1MPE A;  4EKU A;  2EMT A;  3MJ5 A;  3WAL A;  2NBV B;  4II3 B;  1WY8 A;  1WZ3 A;  4HKZ E;  2BQQ A;  1WFY A;  3U2S C;  2D3A A;  3HRD D;  2G4S A;  4IOI E;  3NVV A;  1JAL A;  3QAQ A;  4GN1 A;  4W9G A;  3Q3N C;  4EZK A;  2GLS A;  1SB3 C;  3PV1 A;  3PRZ A;  4RGO S;  2JYT A;  2XK5 A;  4FHK A;  1L0V B;  2KZR A;  3C0R B;  4J6I A;  2KT7 A;  1UD7 A;  3DBL I;  4K3B A;  3U52 E;  2G9H D;  1CMX B;  3JVZ X;  2KJH B;  3M3J A;  2IY1 B;  3EGR A;  2DYB A;  2I2Y A;  1N5W A;  1BT0 A;  1GNU A;  1STE A;  2INP E;  2FID A;  1RFK A;  3UIN B;  2G3Q B;  3IHP C;  3H8H A;  4E74 A;  5CHV C;  4USA A;  4AWJ A;  1FXT B;  4F8C B;  1FRR A;  2BS2 B;  4QAY A;  1WX9 A;  2NBU A;  4R3D A;  2KD0 A;  3Q14 C;  1S3S G;  4RGT A;  1HZ5 A;  2CS4 A;  1C3T A;  3AE4 B;  1WM2 A;  3QCA A;  2WWZ A;  4W9L A;  4I6N B;  1TY2 A;  3AB5 A;  1QLB B;  4XC2 A;  2LGD A;  4WWP A;  1WJ6 A;  1FD6 A;  1UZX B;  2ZPY A;  5JHA A;  3AE9 B;  4NJ7 A;  2JWU A;  1M94 A;  2OJW A;  2L76 A;  3IXS A;  3Q8C A;  3Q3O C;  1QQR A;  2ZCC A;  2WU5 B;  3M95 A;  2MH7 A;  3C19 A;  2LGX A;  5G55 A;  1WJ4 A;  2BKF A;  3WAN A;  4FJY A;  4RM8 A;  3EFC A;  4KV2 A;  1MI0 A;  2G4D B;  4BKG A;  3N30 A;  2LEK A;  2UU7 A;  1SIF A;  3A9K A;  3TBL D;  1QIL A;  3PRP B;  1E7V A;  4A3O A;  3RNA C;  4FN2 A;  2IJ0 A;  1WM3 A;  3NY5 A;  1XLQ A;  5HFY A;  4A6Q A;  2ZJD A;  2V3P A;  1OQQ A;  4FHJ A;  2PJH A;  1ZUD 2;  3OAW A;  5IA7 A;  5IOI A;  2ZVN A;  4IC7 B;  1IBX A;  2OOB B;  1WGG A;  3ML8 A;  1SXT A;  3WAO A;  3BK2 A;  3VHT C;  4W9D A;  2IND C;  3RZW C;  4BBN C;  2HTH A;  4K7W A;  4KGR A;  1IPG A;  3OLM D;  1L4D B;  1IGD A;  1RLF A;  2KTF A;  5BMI A;  1JWM D;  3FAH A;  4AP4 C;  3APC A;  3A33 B;  4MJS B;  3RN9 C;  2ONQ A;  3Q8A A;  3VTW A;  3MC9 A;  2LI5 A;  4AJW A;  2INC C;  3RNC C;  3SHQ A;  3RZF A;  2J42 A;  3IAM 1;  5G2N A;  1ZGU B;  2NTS A;  2WYQ A;  3QQ8 B;  2JSV X;  2WXQ A;  4DDG D;  3CF6 E;  4ASW C;  2MCN B;  4M00 A;  2ICI A;  2O6V D;  1XLN A;  3ZNZ B;  3VRB B;  1I7H A;  5J18 A;  2QHO A;  1GB4 A;  4P16 A;  4WH4 A;  4D2K A;  1D6E C;  2OED A;  3UIP B;  2FNJ B;  3PHX B;  2LUE A;  3PHW B;  2K22 A;  1YN3 A;  1WMH A;  2WXI A;  4LDT D;  1PUT A;  1SJE D;  2KC2 A;  4KDI C;  1IP9 A;  3KH0 A;  2WXG A;  2D3B A;  2WXO A;  1SIJ A;  3PTF C;  1Q1O A;  2IBI B;  4NZL B;  3Q3M C;  1AW7 A;  3RUL A;  3EC8 A;  4NPN A;  1JCK B;  1NBF C;  3HM3 A;  2NR2 A;  2MBQ A;  1C76 A;  1KLG D;  2PPH A;  3T9L A;  4FA6 A;  3AI5 A;  1U4A A;  5KHQ A;  3NZS A;  2FCM A;  3ETR A;  1SE9 A;  2DAF A;  3KWL A;  3RMK C;  3KVF B;  5D7G A;  2R61 A;  4AQ7 A;  1EU4 A;  3DHG C;  3JSV B;  3L17 A;  2Q5W D;  2KFK A;  1XF5 L;  2OJR A;  5IP4 D;  1E5W A;  4O1N A;  1I4P A;  4WJN A;  2RDB C;  4NQL B;  4DK5 A;  4GMV A;  3NVW A;  1J8C A;  1Q0W B;  2NMQ A;  4RCO A;  1E8Y A;  5CHF A;  1NI2 A;  1L4Z B;  2WXH A;  1JQ4 A;  1FCC C;  2IDY A;  3FKY A;  3ZNG C;  4H2A A;  1JRP A;  3TL5 A;  1TKE A;  1KF6 B;  3LXF A;  4GDL B;  1RAX A;  2JXX A;  1F52 A;  5D3D A;  4WJQ A;  3V3X A;  4L23 A;  1IUE A;  2LAS A;  1ZKH A;  3OWE B;  3DWG C;  1WF9 A;  3HM6 X;  3P4Q B;  3VTU A;  4KVG B;  2KN4 A;  1PGA A;  2MEK A;  3A9J A;  4BVU C;  5EDS A;  4G50 A;  2M0A A;  2WNM A;  4ZYN A;  4A3P A;  1GC7 A;  4RGN A;  2LGY A;  2KWV B;  2X8X X;  1TS4 A;  4KKJ A;  4IWQ A;  5C2T B;  2NVU I;  1D3Z A;  3I5J C;  1KOT A;  2GRI A;  4C56 C;  2HD5 B;  2FUG 1;  2KMM A;  2N9K A;  3N32 A;  2KX3 A;  4HKQ A;  2Z8L A;  2XEW A;  4DXG A;  2L0F A;  1P0R A;  3ONS A;  5DPW A;  1YX6 B;  3E56 A;  4EOY A;  4P7I A;  1WJU A;  5EE9 A;  3GE3 C;  2MSE D;  3RCZ A;  1V81 A;  1V80 A;  2G45 B;  2PE9 A;  4DXA B;  3VH4 B;  1LQB A;  1SGH A;  3UI3 A;  4RNA A;  4GOC A;  4MEM A;  4LNI A;  1JWU D;  3P4P B;  1UGM A;  4PYU A;  3DHH C;  3EFU A;  2PW9 A;  2L3Z A;  3WAM A;  4M02 A;  3ZKJ C;  5E6J A;  2FIF A;  2KMA A;  3EUB 2;  3Q8E A;  1HQR D;  2VH2 A;  3RT3 B;  1WSP A;  3HVD A;  1XQQ A;  4KSK C;  1T6B X;  2IY0 B;  2WXP A;  4B0M A;  2DWQ A;  4ZOH C;  2FE8 A;  3Q2A C;  2WU2 B;  1J7C A;  4MM3 B;  2RPQ A;  1FIQ A;  2KKC A;  1N5X A;  3D32 A;  5CTR C;  1C77 A;  1K50 A;  4WAF A;  2OHF A;  3NG0 A;  4YSY B;  3PZ8 A;  4JX1 C;  3T3O A;  1SF0 A;  2C7H A;  1VRA B;  3VUY A;  4B9K A;  4DHJ D;  2LVO A;  2DZM A;  1IYF A;  3NHE B;  3PRM B;  4IDI A;  3MFG A;  2JRI B;  2HJ1 A;  4GU2 A;  1KH0 A;  3QC8 B;  3SU8 X;  2RPV A;  1H8C A;  3KUZ A;  3CMM B;  2V3N A;  4OW0 A;  1FFV A;  3KYC D;  4ARI A;  2CHZ A;  1UNS A;  2ZW0 A;  3GB1 A;  1WJN A;  2WX1 A;  3MHS D;  2MA9 B;  4FJZ A;  1ET9 A;  1CK1 A;  4B95 A;  1UEL A;  1LM8 B;  5HHD G;  4HCN B;  4RMA A;  1E7U A;  2KO3 A;  1A70 A;  2JQR B;  1UBI A;  3IFW B;  3JYU A;  2KYW A;  1CQV A;  4XYC A;  1WE7 A;  2CKH B;  2LGI A;  1R4M B;  3DVG X;  2BS4 B;  2O6V B;  4HWI B;  3H1U A;  5G5H A;  2J52 A;  1CZP A;  2KFK B;  3V6E B;  3VH3 B;  2LHD A;  1T0R C;  1F9J A;  5L83 A;  1EF5 A;  4GLS C;  1D4B A;  3AE2 B;  1TYG B;  3H7S A;  2QIL A;  2Z0E B;  4LDT B;  4LCD E;  4HLE A;  2C7M B;  1OEY A;  3AM9 A;  4DDI D;  2YVC A;  3Q3F A;  1B9R A;  3H7P B;  1I4Q A;  1JWS D;  2J4X A;  1RFA A;  3PLV A;  2LFI A;  4JGH B;  4W9H A;  4PYZ A;  5FR3 A;  4IM2 A;  3OJ4 B;  1XT9 B;  2MHJ A;  4JWS C;  1V8C A;  1UH6 A;  4E71 A;  1ACC A;  2MRP A;  1C4A A;  2TSS A;  3RI7 C;  4KSL C;  2CHX A;  3BVM A;  2KWC A;  2KDE B;  2Z59 B;  1E8X A;  1KLU D;  1V6E A;  3ZQ4 A;  3KUC B;  1FNU A;  3ENE A;  3N1Y C;  2BTE A;  4HPL B;  1YN5 A;  1PYW D;  2W9N A;  2ZW1 A;  4GGQ A;  3A9J B;  4MSM B;  1MFW A;  3AEF B;  3JSV A;  5IKC M;  1XD3 B;  4ANW A;  2KDI A;  2BYE A;  1XCT L;  1V5O A;  2QJL A;  1PGB A;  2PIA A;  2M0X A;  4M01 A;  5BO4 B;  3ZGZ A;  4MGI E;  4IM0 A;  2RDH A;  2J53 A;  3BWU D;  3QK0 A;  5LLI A;  3ZNH B;  2N9E B;  1WYG A;  1J7A A;  4KGS A;  1I4X A;  3UGB B;  4XX5 A;  4WIP A;  1V97 A;  1ZXI A;  1N63 A;  1Q10 A;  1V86 A;  2RD0 A;  1UF0 A;  4EUT A;  1N60 A;  2ACZ B;  3Q8F A;  4HK2 A;  1SSN A;  2BGF A;  1EF1 A;  3M62 B;  1Q5W B;  2XBB C;  1WYW B;  3TCA A;  4BZA A;  4GDL A;  4JIO U;  1OGW A;  1TZO A;  5JZE B;  1WGY A;  2RDG A;  2GBN A;  1T0Y A;  2EMS A;  2HE7 A;  2K9X A;  4IW0 A;  1E10 A;  4K1R B;  3ZW3 A;  4REZ A;  1Y8R C;  2VRR B;  4KGT A;  2QMT A;  3Q8B A;  3A4R A;  3L54 A;  3AED B;  1QF6 A;  3TEY A;  1YD8 U;  5AEK B;  2KN5 A;  2C5L C;  3APF A;  1VZ8 A;  1LGR A;  3R7R A;  3DPD A;  3DBH B;  1C1Y B;  2BS3 B;  1G6J A;  4BKT A;  1ROE A;  4OHJ A;  2M56 B;  4RH6 A;  5E6P A;  1TY0 A;  1WH3 A;  3IT4 B;  1V1O A;  3W1S A;  1NVI D;  1KFY B;  4HXD A;  5BMH A;  3PS6 A;  2R2Q A;  3W2D A;  4JWU C;  1L2N A;  4DHZ E;  1PQS A;  4IWP A;  2KDF B;  2ZCB A;  4MEL A;  4XDD A;  2MBE A;  3DVN U;  3PGE A;  3ZRC A;  3IBE A;  3RNF C;  3VAW A;  2ZNV B;  1SBB B;  5FKA C;  1L6V A;  2N1W A;  2V4L A;  2BYV E;  5LXI B;  2BWE S;  2I38 A;  4HEA 1;  4CYE A;  4PS8 A;  1WR6 E;  3AH7 A;  1YMH E;  2WXF A;  4C7Z A;  1EO6 A;  4B6W A;  4ZHO A;  4YWG G;  4B0E A;  2KDB A;  1KJT A;  2LZ6 A;  2LVP A;  1HTQ A;  3ZJU A;  1VCB A;  3J9C A;  1YNT E;  4CHK A;  3SDL C;  3AE8 B;  1NYR A;  2KX0 A;  4YL8 A;  2M1M A;  2WS3 B;  2DYO A;  1YJ1 A;  4ZHP A;  2Y5B B;  4MM3 A;  2N9P C;  4KZ0 A;  4DHZ B;  4M0W B;  1FO4 A;  3UF8 A;  2AQ3 B;  1Z2M A;  2Z0D B;  4ZYS A;  4DHJ B;  2YLM A;  5LXH A;  2JF5 A;  3PVL A;  2WXN A;  4ARC A;  3IVF A;  2D10 A;  2JX5 A;  3TSS A;  2D5G A;  2W3S A;  1EU3 A;  1RRB A;  3V62 A;  4MGZ E;  4LTU A;  3FIL B;  1KTK A;  2ASQ A;  5C1Z A;  1C4P A;  4BOZ B;  4URK A;  1SEB D;  5GXG B;  2MJE A;  1ESF A;  1GPX A;  3L0W B;  1YX5 B;  2ON8 A;  1BUI C;  2WXL A;  4MDK E;  4FAD A;  3BYT B;  1VJK A;  3GZN B;  3ZUN A;  2K6Q A;  1E8Z A;  3S2A A;  2WDT B;  3QJZ A;  1TKY A;  4FXC A;  4XWW A;  3PO0 A;  4HVB A;  4ACF A;  5D94 A;  3W5U B;  3U30 A;  1WRD B;  4FJV B;  5JH5 C;  1ZDV A;  4AS1 A;  2FCN A;  4TV3 A;  4RF1 A;  4ANX A;  3LB8 C;  3WAP A;  2K6D B;  4TMA B;  1WXQ A;  1R4N B;  2O6V A;  5FK9 C;  1WZ0 A;  3LDZ E;  1Y56 A;  4LJP B;  1MVK A;  3WIM A;  4HDO A;  3P4S B;  4ICU A;  3VR8 B;  2JVC A;  1R7S A;  3P4R B;  4Q2J A;  2VZK D;  4II2 B;  2B76 B;  3TIX A;  3AUL A;  3CIR B;  4W9K A;  2DAJ A;  1WGH A;  2H89 B;  4LNO A;  3I57 A;  1FNW A;  3P1M A;  4F1S A;  4C4V B;  1TS2 A;  1NI3 A;  2N1V A;  2RMM A;  4TQ0 A;  1ZPS A;  3H7P A;  2KNB A;  2KTR A;  3C8Y A;  1XEE A;  2JU6 X;  1MG8 A;  2UWQ A;  4MT5 A;  2DEN B;  3ZRF A;  1V1P A;  1PDX A;  4MH8 A;  4G11 A;  3IT6 B;  4LLG M;  1L7Y A;  1HTO A;  1TGZ B;  3U4E G;  1QKZ A;  4W9C A;  1UGJ A;  3AU5 A;  1MG4 A;  3OG5 A;  1E6E B;  1B1Z A;  2BYT A;  1C9F A;  2LRU A;  2FBW B;  2BPS A;  4EE2 A;  1JWB D;  3PZ7 A;  3EA6 A;  5IO9 A;  4WWM A;  3KYD D;  1F2R I;  1XLO A;  1WX7 A;  4MGY E;  4DXF A;  4IG7 B;  4ZRK A;  4KDL B;  2LD9 A;  3QX1 A;  1V5T A;  3SR6 A;  2KWD A;  4ZDV A;  3ABV B;  2CU3 A;  4ICV A;  2J0J A;  5DPR A;  3QAR A;  2B3A A;  4PS7 A;  3ZJV A;  2KQ4 X;  4DWF A;  2WXJ A;  4HPP A;  4YSZ B;  3NRZ A;  3ZTC A;  1VLB A;  2E6X A;  3AE1 B;  3VQI A;  1R4M I;  3NVZ A;  1LXD A;  1YJI A;  3AE3 B;  5HKH A;  2AQ2 B;  4XZ4 A;  3HVZ A;  5DPT A;  4BKS D;  1MHH E;  4ZRP A;  1KRH A;  1VZ7 A;  2MP2 A;  2ZZP B;  4KZC A;  4YT0 B;  5GMV A;  1A5R A;  2AEH A;  4N6E B;  1TBE A;  4EEW A;  1QOA A;  1UUP A;  1AAR A;  2HDE A;  3B1L X;  1OQY A;  3DOW A;  1C78 A;  2K25 A;  3NUH B;  1HA5 A;  2WDV B;  5BYQ A;  3HUI A;  4KIK B;  3KW5 B;  5AZG A;  4NQK E;  4OVV A;  3ML9 A;  2KMC A;  1NYQ A;  3SFE B;  1QT9 A;  3WA0 A;  1P7E A;  1E90 A;  3ZXR A;  2AQ1 B;  2LUM A;  2PLP A;  1FEH A;  1ET6 A;  3JW0 X;  3ZYY X;  3W9C B;  5HI1 A;  2NPT B;  2GOW A;  4IUM B;  3DVG Y;  4A9A A;  4C80 A;  1FM0 D;  4W9E A;  4F7Z A;  4HCP B;  4ITK A;  3MTN B;  4BKS A;  2MJ3 A;  2QIE B;  3R2T A;  5TR5 A;  3VRA B;  3H6N A;  1TKG A;  4NNJ B;  3DDC B;  4GXB A;  2IO3 B;  3GP7 A;  2FUH B;  1WXV A;  1HEZ E;  2BF8 B;  2DZJ A;  2M17 A;  2M4N A;  2D07 B;  4MAC A;  2N9X A;  4LJO B;  2K39 A;  3KWV A;  1N62 A;  1ENF A;  1E8W A;  2LGS A;  4AOF A;  1WGR A;  2MW5 A;  1K52 A;  2W82 A;  2JPH A;  2YEP F;  2IGH A;  2WDR B; 
#chains in the Genus database with same CATH homology
 1N61 A;  2WP9 B;  1N60 A;  2ACZ B;  2W3R A;  1TS5 A;  3Q8F A;  4XWT A;  3Q69 A;  3WCQ A;  1SSN A;  2J42 A;  1JWA D;  4YTP B;  4YXD B;  1DOY A;  3FC4 A;  3AN1 A;  2JZP A;  5MPO A;  3R2I A;  3IAM 1;  3BZD B;  2NTS A;  1TZO A;  2JSV X;  2WXQ A;  2M19 A;  2RDG A;  4M0W A;  5AUI A;  1OQR A;  2K9X A;  1E10 A;  4P6V F;  2ICI A;  4REZ A;  4KGT A;  1VR9 A;  2QMT A;  4TQ1 A;  3Q8B A;  3AED B;  4YTM B;  1XLN A;  3VRB B;  1I7H A;  4RGM A;  1QF6 A;  2H88 B;  1GB1 A;  2EEL A;  3TEY A;  1GB4 A;  4P16 A;  4WH4 A;  1GOZ A;  4XE0 A;  2G1E A;  4D2K A;  1D6E C;  2OED A;  1VZ8 A;  2MJD A;  2DBY A;  2BS3 B;  3P63 A;  1FFU A;  2K22 A;  1YN3 A;  1JML A;  2WXI A;  1ROE A;  4OHJ A;  2M56 B;  4RH6 A;  1PUT A;  1SJE D;  3FIL A;  1TY0 A;  2WXR A;  3VR9 B;  4XDC A;  2WXG A;  2WXO A;  3IT4 B;  1SIJ A;  2DYM A;  2YEP B;  1XXG A;  1V1O A;  3W1S A;  1NVI D;  4NZL B;  3NS1 A;  1AW7 A;  1KFY B;  5HG2 A;  1JCK B;  3W5V B;  5BMH A;  1DYQ A;  3V05 A;  3W2D A;  1T5X D;  1C76 A;  2HTM E;  1KLG D;  4JWU C;  2KAC A;  1YQ4 B;  4JE3 B;  1VZ6 A;  3KQ4 A;  1DOI A;  4XDD A;  1V1P B;  1ZOY B;  2BT6 A;  3AEA B;  2GB1 A;  3ETR A;  1D5X C;  2XNA C;  2CJO A;  3DWM A;  3KWL A;  4HRO A;  5D7G A;  2R61 A;  4AQ7 A;  1IBX B;  1EU4 A;  1SBB B;  5FKA C;  1L6V A;  2IGG A;  5D3I B;  2Q5W D;  3TEW A;  2BB5 A;  1XF5 L;  1QOF A;  4J3O D;  5BYR A;  4O1N A;  1I4P A;  3NVY A;  2I38 A;  1EWC A;  4HEA 1;  2PMV A;  2Y5P A;  1XLP A;  4KX6 B;  3NVW A;  3B9J A;  1XCQ L;  1EM7 A;  1JRO A;  3AH7 A;  1YMH E;  2WXF A;  3CWI A;  4C7Z A;  2N0S B;  2VZK B;  1P7F A;  5BYS A;  2K5P A;  3AEG B;  2NMQ A;  4RCO A;  4ZHO A;  4DQO C;  2XN9 C;  4YWG G;  4B0E A;  2EKI A;  1L4Z B;  1EWY C;  1YJJ A;  2WXH A;  5AUK A;  3ZJU A;  1JQ4 A;  1FCC C;  4HRS A;  3J9C A;  1YNT E;  4WUR A;  2IDY A;  3AE8 B;  1E7P B;  1NYR A;  2SEB D;  3MP9 A;  4H2A A;  1JRP A;  4N59 A;  2WS3 B;  1TKE A;  2DYO A;  1KF6 B;  2N9L A;  3LXF A;  4GDL B;  2ONQ A;  5EE3 A;  4ZHP A;  1DGJ A;  5BMG A;  3BVZ A;  2LJI A;  2K0P A;  5D3D A;  1FO4 A;  3V3X A;  4A55 A;  4L23 A;  1IUE A;  4US9 A;  3AMZ A;  2AQ3 B;  3OWE B;  4OVZ A;  1WWT A;  3DWG C;  4ZYS A;  3LYY A;  1PFD A;  3P4Q B;  1RYJ A;  2WXN A;  1QOG A;  1D5M C;  2KN4 A;  1PGA A;  2MEK A;  4US8 A;  1L5P A;  4ARC A;  4L1B A;  2JX5 A;  2QSD A;  2BW2 A;  1K51 A;  3TSS A;  2D5G A;  2W3S A;  2M0A A;  1EU3 A;  4OZB A;  1I4R A;  2WDQ B;  4NAM A;  2WNM A;  2L32 A;  4GDK B;  4L2Y A;  1J7B A;  4LTU A;  3FIL B;  1KTK A;  4RGN A;  3NZ3 A;  1K53 A;  1WGK A;  1FRD A;  1TJE A;  1C4P A;  1FXI A;  1TS4 A;  4KKJ A;  5C2T B;  1DOX A;  3TEX A;  1SEB D;  2BBC A;  1GAQ B;  1XO3 A;  2INN E;  5GXG B;  2WLB A;  2KAJ A;  2MJE A;  1ESF A;  2GRI A;  2IGD A;  1ZDX A;  4C56 C;  1GPX A;  3AE7 B;  1BML C;  5C3J B;  2ON8 A;  2GI9 A;  3MHZ A;  1BUI C;  1WRI A;  1NEN B;  2WXL A;  2N7J A;  2FUG 1;  2V0G A;  3BYT B;  2KMM A;  1L6U A;  1VJK A;  5G5G A;  2N9K A;  1UWM A;  4HKQ A;  2Z8L A;  5I4D A;  4DXG A;  1TKY A;  3AEC B;  4FXC A;  4XWW A;  2JYE A;  3E56 A;  3BII D;  5EE9 A;  3PO0 A;  4KKI A;  4LK0 M;  1JW9 D;  1SE3 A;  3AV8 A;  3W5U B;  5H92 C;  1HZ6 A;  4RF0 A;  3T3N A;  1M4V A;  1SE2 A;  1ZE3 D;  4YSX B;  5EE1 A;  3E9S A;  2W82 A;  3AE6 B;  1ZDV A;  4AS1 A;  3GS2 A;  1MHX A;  3UI3 A;  4RF1 A;  4RNA A;  3LB8 C;  3U7Z A;  1E0Z A;  2V4I B;  4TMA B;  1JWU D;  3P4P B;  1WXQ A;  5FK9 C;  3TUO A;  1Y56 A;  3MC0 B;  2PW9 A;  1MVK A;  2JXT A;  5E6J A;  3P4S B;  1IGC A;  1FCL A;  3VR8 B;  1R7S A;  3EUB 2;  3Q8E A;  1I4G A;  3P4R B;  1FMA D;  4NAW B;  1NEK B;  2VZK D;  4Q2J A;  1HQR D;  2B76 B;  1WSP A;  5TSS A;  3HVD A;  3CIR B;  1ZP0 B;  2H89 B;  1VDV A;  3O13 A;  1T6B X;  2SAK A;  3I57 A;  1FNW A;  3BVG A;  1ZXH A;  3P1M A;  1BXT A;  1TS2 A;  2WXP A;  1LO5 D;  4UDU C;  2DWQ A;  4B0M A;  1E9M A;  4ZOH C;  2FE8 A;  2KDM A;  1NI3 A;  1SE4 A;  3BK1 A;  2WU2 B;  1J7C A;  1L0Y B;  4MM3 B;  2RMM A;  4TQ0 A;  1ZPS A;  1FIQ A;  1AN8 A;  3B2G A;  1N5X A;  3C8Y A;  1XEE A;  2JU6 X;  2PVG C;  3BYY B;  1C77 A;  2W55 A;  2W54 A;  1K50 A;  4WAF A;  2OHF A;  1RM6 C;  4MT5 A;  2IPK D;  3RFZ B;  1RWS A;  2AX5 A;  1AWD A;  4YSY B;  4YTN B;  1HXY D;  1V1P A;  1PDX A;  3PZ8 A;  4JX1 C;  4MH8 A;  1C79 A;  3T3O A;  1SF0 A;  3IT6 B;  4LLG M;  1VRA B;  5JXV A;  1MPE A;  2Y3A A;  3B2F A;  1PGX A;  4JPS A;  3R8B A;  3MJ5 A;  3U4E G;  2QEJ C;  3TEZ A;  1QKZ A;  4IDI A;  4HKZ E;  2L1A A;  2K3U A;  3MFG A;  3U2S C;  1UGJ A;  3HRD D;  4IOI E;  3NVV A;  1SJH D;  1E6E B;  1L0X B;  3N9Y C;  1B1Z A;  2BYT A;  1C9F A;  4OZA A;  1JAL A;  1KH0 A;  2FBW B;  2RPV A;  1T3Q A;  2E3T A;  2V3N A;  1I4H A;  4OW0 A;  4EE2 A;  4PT5 A;  1SB3 C;  1JWB D;  3PZ7 A;  3EA6 A;  4RGO S;  1FFV A;  2JYT A;  4ARI A;  1UNS A;  1L0V B;  2ZW0 A;  2PTL A;  3GB1 A;  4WWM A;  4C7Y A;  1F2R I;  1XLO A;  2LMC A;  4DXF A;  3U52 E;  2G9H D;  2WQY B;  3EGR A;  3L4P A;  2I2Y A;  1N5W A;  3SR6 A;  2KWD A;  3ZJT A;  1ET9 A;  3ABV B;  1CK1 A;  2CU3 A;  1STE A;  2INP E;  4A90 A;  1RFK A;  1F0Z A;  3H8H A;  3IAS 1;  3AE5 B;  5HHD G;  3ZJV A;  2KQ4 X;  2WXJ A;  4YSZ B;  1A70 A;  3I9V 1;  2JQR B;  2WXM A;  4USA A;  1YN4 A;  3NRZ A;  2YEP F;  1VLB A;  2E6X A;  3AE1 B;  3VQI A;  1CQV A;  1FRR A;  2BS2 B;  3NVZ A;  1YJI A;  3AE3 B;  4R3D A;  4NJC A;  2AQ2 B;  4RGT A;  1HZ5 A;  2LGI A;  2BS4 B;  5LNK 1;  3HVZ A;  3AE4 B;  3P42 A;  1D5Z C;  1QOB A;  5G5H A;  2WXK A;  1MHH E;  4HJG E;  4ZRP A;  1KRH A;  1TY2 A;  1VZ7 A;  2J52 A;  1CZP A;  5H8Y E;  4YT0 B;  3AB5 A;  4N6E B;  1QLB B;  1QOA A;  2BB6 A;  1UUP A;  2LHD A;  1TS3 A;  2HDE A;  2LHE A;  3Q8A A;  1FD6 A;  1C78 A;  1C4C A;  3AE9 B;  4GLS C;  2JWU A;  1D4B A;  3AE2 B;  1TYG B;  4N58 A;  3AEE B;  1CJE A;  2QIL A;  3NUH B;  3IXS A;  1HA5 A;  3Q8C A;  1QQR A;  2WDV B;  5BYQ A;  2DLB A;  3HUI A;  3AM9 A;  1B9R A;  1I4Q A;  1JWS D;  2J4X A;  2WU5 B;  4OZC A;  2MH7 A;  4CQN A;  2LFI A;  3SFD B;  1NYQ A;  3SFE B;  1QT9 A;  5FR3 A;  1OFF A;  4WQM A;  4A8X C;  4TSS A;  4ZRQ A;  1MI0 A;  3URY A;  1F77 A;  1P7E A;  3SEB A;  2LEK A;  4JWS C;  2AQ1 B;  5T8I A;  2LUM A;  1QIL A;  1V8C A;  1FEH A;  1F2R C;  2PLP A;  1ET6 A;  3ZYY X;  1ACC A;  3AEB B;  2PVO D;  1C4A A;  3W9C B;  2TSS A;  5HI1 A;  2IJ0 A;  3BVM A;  4A9A A;  4C80 A;  1FM0 D;  1XLQ A;  5HFY A;  4A6Q A;  1KLU D;  2V3P A;  4RFB A;  1OQQ A;  3ZQ4 A;  4ITK A;  1FNU A;  2BTE A;  1ZUD 2;  2MJ3 A;  2QIE B;  3R2T A;  1YN5 A;  1PYW D;  2ZW1 A;  3VRA B;  1AYF A;  1FXA A;  1IBX A;  2X38 A;  3AEF B;  1TKG A;  1SXT A;  3GP7 A;  3BK2 A;  1HEZ E;  1XCT L;  2PKO A;  2L52 A;  2QJL A;  4MAC A;  2NTT A;  1YQ3 B;  1PGB A;  2PIA A;  4KGR A;  3KWV A;  1L4D B;  2Y5C A;  3ZGZ A;  1N62 A;  1IGD A;  1FNV A;  3RPF C;  2RDH A;  5BMI A;  1JWM D;  2J53 A;  2L83 A;  3BWU D;  3FAH A;  4IKG A;  1ENF A;  3KLS X;  1WYG A;  2CJN A;  5EE0 A;  1J7A A;  4KGS A;  1I4X A;  1UWX A;  4WIP A;  1K52 A;  1V97 A;  1ZXI A;  1N63 A;  1Q10 A;  2IGH A;  2WDR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...