1GPXA

C85s gapdx, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLSCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTIDAREDOXIN
publication title The solution structure of a gallium-substituted putidaredoxin mutant: GaPdx C85S.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
total genus 14
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gpxA00
4WWMA 1JWBD 1L6UA 2BT6A 2PVGC 3AEGB 3NVVA 1EWYC 3AH7A 3LXFA 3P4SB 3SFEB 4YSZB 1FRDA 1I7HA 3VR8B 2DWQA 3AEAB 4USAA 1GPXA 3AE5B 1JQ4A 2QJLA 1WYGA 1F0ZA 2M56B 1XLPA 1DOYA 4FXCA 1ROEA 4YXDB 5EE1A 1ZP0B 2KMMA 2L83A 3BIID 3B2GA 3EUB2 3AE8B 3KWLA 4YTMB 1QOGA 1FXAA 2H88B 1CZPA 2K5PA 2WU5B 3AE2B 2BS2B 1TYGB 4HROA 5H92C 1OQRA 4YTNB 3W5VB 1QF6A 4JWSC 1ZXIA 2G1EA 1YQ3B 3AE3B 4JWUC 1WXQA 3ABVB 4US9A 4IDIA 1DOIA 2PIAA 4P6VF 1PFDA 5C2TB 3SFDB 3WCQA 1QLBB 1XLQA 1YJIA 3P63A 2M19A 3AB5A 3PO0A 4C7ZA 4LTUA 1XLNA 2H89B 1E9MA 3NVWA 5EE3A 2HTME 3RPFC 5GXGB 2CJNA 3DWGC 1YJJA 3AMZA 3W5UB 2WLBA 1R7SA 1ZOYB 2MH7A 2W3RA 3B2FA 2WS3B 1TKYA 4JX1C 1KFYB 1OFFA 1RYJA 1N63A 1J7CA 1ZUD2 1QOBA 2AX5A 3AE7B 2N0SB 1E6EB 4N6EB 4YTPB 1T3QA 3HUIA 3P4QB 3HRDD 1J7AA 2K22A 2WP9B 2WDVB 1NEKB 1FIQA 1XLOA 1JW9D 3AE4B 3AE9B 3ETRA 3W9CB 1FM0D 3B9JA 2Y5CA 1FXIA 3NS1A 1SF0A 1FFVA 2B76B 3LB8C 1NYRA 1AWDA 1QT9A 1XO3A 2WDRB 1DGJA 2QIEB 3AN1A 3AE6B 4US8A 1NYQA 1VJKA 1WRIA 5G5GA 1E10A 1IUEA 3SR6A 5EE0A 1A70A 1NI3A 2KAJA 3ZYYX 2CU3A 1VLBA 1VDVA 3NVZA 3AEDB 4ZHOA 1NENB 2WU2B 1JWAD 1TKEA 3AEFB 2EKIA 2JX5A 2JQRB 2BS4B 5AUKA 3VRBB 2Q5WD 4YSXB 2PKOA 1QOFA 1KRHA 2CJOA 1N62A 3AV8A 2MJ3A 3NRZA 1N5WA 1RM6C 1B9RA 1TKGA 1CJEA 1E7PB 1GAQB 2WQYB 4C7YA 3P4RB 3AEBB 4N58A 1WGKA 1OQQA 1V8CA 1L6VA 5AUIA 4ITKA 2PVOD 3AM9A 3FAHA 1SB3C 5MPOA 2ACZB 1SIJA 3AEEB 2E3TA 5H8YE 4A9AA 3VRAB 4WQMA 2OHFA 3L4PA 2W3SA 1YQ4B 1FRRA 2WDQB 2DBYA 2MJEA 3P4PB 4C80A 1QOAA 5EE9A 1AYFA 1V97A 2FBWB 3CWIA 1FFUA 2L52A 1RFKA 3FC4A 5G5HA 4ZHPA 3AE1B 3DWMA 1TJEA 1WWTA 2MJDA 3CIRB 1RWSA 5C3JB 3P1MA 3VR9B 1E0ZA 3HVZA 1N61A 1DOXA 1N5XA 1KF6B 4ZOHC 1JROA 2W55A 1FMAD 1PDXA 1NVID 1L0VB 4N59A 4YT0B 1J7BA 1N60A 2K9XA 2W54A 1FO4A 1JRPA 1PUTA 3AECB 4KX6B 1L5PA 1UWMA 1JALA 4HRSA 2BS3B 3NVYA 2LEKA 4YSYB
chains in the Genus database with same CATH superfamily
4W9CA 3VR8B 2KTFA 4USAA 4C4VA 3U2SC 3TEYA 1ROEA 3L10B 4A55A 5BO4B 5DPSA 3PZ8A 1SSNA 1FXAA 2MBHA 2WXLA 2R61A 1TYGB 3RN9C 1QF6A 3PTFC 4EKUA 1PFDA 4X57B 2JWZA 1PQSA 3MC8A 2I38A 3S2AA 3NVWA 1V1PB 3MC0B 2NPTB 1R4NI 2OEDA 2W3RA 3CSFA 1T0RC 1OFFA 1T0SC 1ZUD2 2FCNA 2K1FA 2N0SB 1E6EB 5D94A 1A5RA 1SGHA 2DZIA 4JL9A 3ML8A 3H6NA 5AZHA 2YEPF 3LB8C 2EELA 2N7DA 3K9PB 2ZVNA 2KAJA 3NVZA 2WXIA 3N30A 3BINA 1ESFA 5AUKA 1E8YA 1KRHA 2ZNVC 2D3BA 2MP2A 2KX0A 2KNBA 4HJGE 1WGKA 1V8CA 4JIOU 1L6VA 1UBIA 1K50A 1F1HA 2HD5B 1KLGD 2MSED 2RMMA 1SBBB 1MVKA 5AZFA 4XWWA 2EMTA 3CMMB 2QDFA 2L1AA 3IHPC 2KX3A 1RWSA 2KDIA 2V9HA 1KF6B 4HWIB 4KGTA 3X0WA 3Q6BA 3QJZA 3PSEB 3AH7A 2JSVX 2KTRB 1GPXA 2QJLA 2YLMA 2JF5A 2PLPA 5TSSA 3R3MA 1HA5A 4W9IA 1VZ6A 4RF1A 2G45B 4YTMB 1CZPA 3ZUNA 3SU8X 4E74A 2MCNB 1RRBA 4TV3A 1SJED 4RH6A 1Z5SB 2AQ3B 3PVLA 3UIOB 1WXQA 1LO5D 3VQIA 4WWNA 4WJQA 2KDBA 4MM3B 2N1VA 4JX1C 5FR6A 1N63A 1SE9A 4IWQA 4YTPB 2OJWA 3P4QB 3NS8A 2WP9B 1XLOA 5G2NA 4ZRJA 4HKZE 2K6DB 2BQQA 3ENEA 1QT9A 2MHJA 3ZKJC 2QIEB 2NBWB 1WXAA 1IUEA 2RDBC 1NI3A 2KC2A 2LGDA 1QZEA 3RFZB 4NAWB 2MEKA 3ZNHB 1XT9B 1N5WA 1E7PB 2E6XA 1ACCA 5DCNA 2N9XA 1QKZA 1TZOA 5AUIA 1TTNA 4K1RB 3AEEB 3OAWA 2VH1A 3JSVA 1WRDB 1TS5A 4ZYSA 2IPKD 1UF0A 2GMIC 4QAYA 3FILA 2L00B 2KO3A 3CWIA 3R2IA 2JZPA 1YMHE 3VUWA 4AUQC 3O65B 3P42A 3DVNV 1I4GA 1E0ZA 2KTRA 1PUTA 1UD7A 2I2YA 4M8MA 3VUYA 3PZ7A 1AARA 3DPDA 4XDDA 4BKTA 2KHWB 4IM0A 4DXAB 3WAOA 3AEAB 4KGRA 1TS3A 5E6OA 3O13A 2PPHA 3UF8A 1C4CA 1C79A 1WJUA 2JPHA 2WXFA 3ZDTA 1D5ZC 1QOGA 1BMLC 3RULA 2BS2B 2LXCA 3R2TA 2ONQA 1ZXIA 2CHWA 1KTKA 1YQ3B 2RD0A 2RPQA 1DOIA 5HKHA 4KIKB 1OQYA 3Q3OC 1MHXA 1YJIA 4LK0M 4F8CB 4C7ZA 1K53A 2ZZPB 3N3KB 2ZW0A 1WMHB 1WSPA 4BKSA 2A4ZA 2WS3B 1ET6A 3MTNB 3LYYA 4RF0A 4HPLB 3AE9B 2VH2A 3W9CB 4MGIE 1RAXA 3Q8EA 2WXMA 3IT4B 2SEBD 5L83A 3VFKA 2NTSA 5E6NA 2JRHA 4I6NB 2LGXA 3W1SA 2KN5A 3SR6A 4TUUA 2MW5A 2CU3A 3AEDB 1T6BX 2WU2B 1I4XA 1XCTL 4YSXB 4AJYB 1QOFA 4HEA1 3KLSX 3R7QA 4DDGD 2JXXA 3KW5B 3P4RB 1VCBA 4FADA 1M4VA 2PJHA 3MHZA 1MG4A 2IYDB 4MJSA 1TT5B 2GBJA 4RGNA 3U7ZA 1EF1A 3CF6E 5G5HA 3AE1B 3EFUA 2C7MB 2EMSA 2WXOA 1UWXA 4BFRA 1K51A 4YT0B 4ZRKA 1FO4A 4XYCA 3N1XC 4KX6B 3RI7C 1XD3B 5FK9C 1WGRA 3J9CA 4WH4A 2GBNA 1EO6A 2K6QA 4XX5A 3IXSA 2IO1B 2O6VB 3KWVA 2LFIA 2WDTB 1MG8A 2JYTA 2LZ6A 1P98A 1WH3A 5KHQA 3TJPA 1WMHA 1X1MA 2PE9A 4NQKE 3ZVVA 3EGRA 2PIAA 4LNOA 2LASA 2KDMA 3PRZA 3KUZA 2BBCA 3MP9A 3ML9A 3HK0A 4FJVB 1T0YA 4GIVA 2KD0A 4G3XB 4CQNA 2PE6B 2XEWA 4II3B 4HPMB 3HM6X 3R8BA 2N7JA 3ZDMC 1FM0D 1SXTA 4CHKA 1LGRA 3MC9A 4MSMB 1F2RC 2JXTA 2PW9A 1NYQA 1WRIA 4RGOS 2MX2A 2KLGA 2G3QB 5DPRA 3T3NA 3QIJA 4B0EA 2EKIA 2BS4B 3VRBB 1CQVA 1FNUA 2WXRA 1VZ8A 2MQJA 3IG3A 2NBUA 5C1ZA 3AM9A 3TEWA 4A20A 1UGMA 5H8YE 3L4PA 3U30A 2WHIA 4C80A 2R2OA 3EA6A 3DDCB 3PHWB 2KFKB 3FC4A 1EUVB 2KMAA 5JZEB 2GBRA 2QSDA 5BYSA 4DHZB 1PGXA 3B1LX 1V81A 3DBSA 1BT0A 4KSKC 3PT2B 2Y5BB 4N59A 2NTTA 3MJWA 5IOIA 2WX1A 4NQLB 5DPWA 3RMKC 5EDSA 2BS3B 4B0MA 1OGWA 2O6VA 1WE7A 2DWQA 1N6ZA 3TSSA 1WYGA 1F0ZA 3I3TB 1GB4A 2KZRA 2K3UA 3N32A 2N7EA 2L76A 2KQ7A 5BMIA 2Z0DB 3W1SC 4C00A 1GC6A 3M63B 4M0WB 2RR9A 3UQAA 4FN2A 2M0AA 2FCMA 4G0NB 2FIFA 1XLQA 3QX1A 1JCKB 3ZJVA 3H8HA 2CJNA 4G50A 3NG0A 2KLCA 1Y8RC 4AJWA 3DBHI 4W9FA 1D6EC 4PT5A 1FXIA 5HHDG 5FR3A 3NS1A 4HPPA 1XO3A 3SEBA 2N9EB 1F77A 3ZYYX 3N20C 1UELA 2G4SA 1T5XD 2KMCA 2KJRA 2PKOA 3VH3B 2CJOA 2J42A 1I35A 4DHJD 1UZXB 1HXYD 2KXJA 1AW7A 3DVGX 5JHBA 4JPSA 4ITKA 1I4QA 1LFDA 3RNBC 2RGFA 2WGSA 1L4DB 1ZE3D 1RFKA 3KVFB 4GLSC 4JQWC 3P1MA 1F52A 4HK2A 4EUTA 1N61A 1DOXA 4A8XC 3A33B 1WM2A 4MH8A 4WWMA 2L32A 1MJDA 4MGZE 4DHZE 3VTUA 1EWYC 4LDTB 3SFEB 4YSZB 2K25A 4M0WA 2N4FA 1WE6A 3A1QB 4MGYE 1DYQA 4IOIE 2BF8B 4Q2JA 2INNE 4M02A 4E3CA 4AS1A 1WXSA 3A9KB 3W5VB 3MJ5A 4TQ0A 2W9NA 1JWMD 3BK1A 4JWUC 3SD5A 4LLGM 1QLBB 3P63A 2KT7A 2N9PC 3DWGC 3TCAA 3QCAA 3Q8CA 4OVVA 4BAXA 4UDUC 1STEA 1XEEA 1BXTA 4JGHB 4ZDVA 3RNAC 2BWFA 4E71A 2AYOB 1DGJA 2UYZB 3AE6B 4W9LA 2O2VA 2JQRB 4NPNA 3V6CB 3BZDB 4F1SA 3NRZA 4PYUA 2WXGA 1WJNA 2BVCA 4XDCA 4YL8A 3VTWA 1WM3A 5FKAC 2K8HA 3FAHA 2E3TA 2BGFA 4LNNA 3ZXRA 2C60A 2J0JA 4MT5A 4B95A 2DAFA 3DHGC 1TGZB 1PYWD 4B6WA 3A1QA 3B0AA 1JWSD 1JMLA 2W54A 4GOCA 3PGEA 1XCQL 3BK2A 2FUG1 3TEZA 2PVGC 2L3ZA 5CHVC 4ZRQA 4WAAA 3N1ZC 4AQ7A 3A9KA 5G55A 3AE5B 3OLMD 2D11A 2LGYA 2WNMA 4FJZA 2WXNA 1WX9A 3ZRFA 3DVNU 3RCZA 1C1YB 2LGSA 2K5PA 2KANA 2WU5B 2ZJDA 4W9JA 1V5OA 1IPGA 4L2YA 1V9JA 3RNGC 3URYA 1YD8U 2XBBC 3WCQA 4L1BA 3GS2A 3AB5A 4GDKB 1YNTE 3HM3A 1P7FA 4BZAA 5EE3A 3ZO5B 3H1UA 3Q8FA 3HVDA 4OW0A 1TKYA 2D10A 2KK8A 1P0RA 1KLVA 3V62A 4EFOA 1VZ7A 1V1PA 3PRPB 4IUMB 2NPTA 3B9JA 1EM7A 3VXWA 4RCOA 2KJHB 4OVZA 3AN1A 1WX8A 1ET9A 1E7VA 1E10A 3ZXVA 3JW0X 4KDLB 1Z2MA 3VUXA 2FAZA 1JWAD 4XC2A 4PS8A 2IY0B 2QILA 1L4ZB 4XGAB 1S3SG 2MJ3A 4G11A 4A6QA 4N58A 2ZPNA 2JWUA 3T9LA 2PVOD 4DQOC 2WYQA 2W3SA 4O1NA 2AQ1B 1HEZE 2WXHA 2MJEA 3Q8AA 4R3DA 2N9LA 3RNFC 3H9DA 3HIZA 3UI3A 2C7NB 3VDZA 3VAWA 1L0VB 3ZLZA 4YSYB 4BKSD 1L6UA 4KKJA 4GMVA 2NBVB 3TEXA 4HDOA 4ANUA 1SEBD 2IGDA 2LMCA 1V2YA 3CSTA 2G9HD 3I63C 1ZP0B 2MBEA 1WGGA 1FCCC 3X23A 3PPAA 4GDKA 3AE8B 3KWLA 3AE2B 2XN9C 4ACFA 5LXIB 1ISNA 5D7GA 1UBQA 3W1YA 4H2AA 1KLUD 3L0WB 3V3XA 2FCSA 1V80A 1HZ5A 4PYZA 1XQQA 1TZ1A 2H89B 4WURA 2I1JA 2HTME 4M8NA 2N1WA 5GXGB 2WX0A 2GLSA 2X38A 2WLBA 3DBLB 5LXHA 4W9EA 4RGMA 3PLVA 2HJ1A 4MM3A 2ZCCA 4NZLB 4DXFA 2Y5CA 2DZMA 4RNAA 1MHHE 2MWSB 1SE3A 5EE0A 1A70A 1WGDA 4ZRPA 3D32A 1NENB 2CHZA 1D4BA 4GDLB 3OJ4B 1E90A 1EU3A 1TKGA 2V3NA 4DBGA 4BOZB 5IN7A 4GXBA 4NAWA 4PS7A 2OHFA 4A90A 1YQ4B 1FEHA 2LVQA 4I6PA 4ARCA 3CIRB 1KM7A 3VR9B 1N5XA 1PGBA 3DBLI 2W55A 1AN8A 2AL3A 1VR9A 4BOSC 4WAFA 1OEYA 2K8BA 1V86A 4LNKA 3P4SB 2UWQA 4NNJB 1B1ZA 5BYQA 4PK1A 3SHQA 1J8CA 2JUOA 3TUOA 4GB9A 1XLPA 3NJTA 4B9KA 3DBRB 5CHWA 2C7HA 2LXAA 4P1BC 2LVPA 1WGYA 2XNAC 1C9FA 4YTNB 2HJ8A 2KQ4X 3AE3B 5AEKB 3W2DA 2DHZA 5C2TB 4K7WA 3GE3C 4RFBA 4K7UA 2QEJC 4D2KA 1GOZA 4KIKA 2PEAA 3MHSD 2IBIB 1WR1A 5IA7A 2JY6A 2ON8A 3TL5A 2JRIB 2MBQA 5JHAA 4IG7B 1AWDA 2B3AA 4CO7A 4FULA 2D2QA 4ZHOA 3H7PB 1GG3A 4HDQA 2IY1B 2JX5A 1XXGA 4BVUC 2K0PA 3DBRI 1TS4A 3N9YC 3PREA 5BMGA 3DQVA 3KUCB 3I57A 3V60A 4HKQA 3EFCA 3Q3NC 1C77A 2J52A 4FHJA 3QHTA 1WZ0A 2IO0B 1NBFC 2HE7A 3BVZA 1N60A 4EZKA 1ZGUB 3AECB 2AEHA 2LRWA 2KWVB 4AP4C 2ZNVB 3C19A 2AQ2B 5LNK1 2IJ0A 1JQ4A 4OVUA 2IO3B 2CU1A 1ZKHA 5EE1A 3T8MA 2KMMA 2M8SA 2LD9A 2KDEB 1ZXHA 3KUDB 2GOWA 5IP4D 2Z8LA 4HROA 3ONSA 4LJPB 2G1EA 2VZKD 3L13A 4MEMA 5D2MB 4IKGA 1E9MA 2DX5B 2KWUB 1E5WA 3AMZA 1I4RA 3T3OA 1Q5WB 2XK5B 3ZIMA 3VVWB 5AZGA 1YN5A 1J7CA 2MLBA 4N6EB 2WXPA 4N9F4 4IW0A 4WJNA 2WDVB 4EE2A 1KH0A 2D07B 4ICVA 1E8WA 1WF9A 2QMTA 2WDRB 3I5JC 3WAPA 3TMPB 1YIWA 3R66C 3OG5A 3I9V1 2BW2A 4LJOB 3Q14C 4TQ1A 1Q10A 1GAQB 3QC8B 4P7IA 3ZNID 5I4DA 1Q1OA 2QCZA 1IGCA 2KDFB 2IGHA 4C56C 1ZPSA 2GI9A 2WXQA 1XF5L 1TY2A 2BB5A 1WGHA 2MJDA 1Y56A 1I42A 2BYEA 1C4PA 1LQBA 1V1OA 3HVZA 3EECA 4K3CA 4KGSA 4M01A 3GZNB 5CTRC 2NS5A 3Q2AC 2KFKA 1L5PA 4DHJB 1UWMA 4OHJA 1IYFA 3NVYA 2BKFA 3AXCA 3BVMA 4P16A 1I7HA 2CS4A 2L7RA 2FUHB 1KOTA 2L8JA 4WIPA 1DOYA 2WWZA 3NHEB 4IWPA 4RM9A 4BBNF 3EUB2 2FNJB 2DYOA 2ZEQA 3NY5A 2K39A 4HXDA 2D3GA 3V6EB 4MELA 2G4DB 4OZBA 4TMAB 2Z59B 4ANVA 2D3AA 2ZCBA 1SJHD 4OZCA 3ZGZA 1YJ1A 4P6VF 2KWDA 1LXDA 3N1YC 4AWJA 3ZW3A 4JLCA 1R7SA 2TSSA 2X8XX 1C4AA 4IM3A 3TIXA 3AE7B 1QOBA 3GZNI 1CK1A 3HUIA 2ZW1A 4GN1A 2L0TA 1J7AA 4WJOA 4NJ7A 1JW9D 3JYUA 3V05A 2QHOA 4BKGA 4EZJA 4TKNA 5G5GA 4DXGA 1VDVA 2CHXA 5LLIA 1Q0WB 3QAQA 3LDZE 3AV8A 1N62A 3IAS1 1RM6C 4M00A 2WXKA 2INDC 4NJCA 3UIPB 1YOVB 4WQMA 3ZNZB 2DBYA 2N9KA 2L52A 4J6IA 2JVCA 2VRRB 3WAMA 5DPTA 2DENB 2HDEA 2INCC 1FPYA 1EU4A 3GE8C 1JROA 3ZTCA 4WWOA 1J19A 1F9JA 3FKYA 4NJ6A 3LJ3A 3Q8BA 5EE9A 1HE8A 3AU4A 3DHIC 3RT3B 3VHTC 2LJ5A 2BPSA 4RMAA 2JU6X 3B2GA 1ZDVA 4ARIA 1JWUD 1L2NA 3WA0A 2JZ3B 1LM8B 3UQBA 2GB1A 4HJKA 2BYFA 2DYMA 1E7UA 1QILA 3ABVB 3EC8A 1GUAB 4US9A 4IDIA 1K8RB 1P7EA 3PO0A 1PGAA 1G6JA 1WXVA 3VH4B 1V6EA 3IBEA 1J0GA 1ZOYB 1YN4A 4FBJB 2EKEC 2AX5A 2QC8A 2ASQA 2HTHA 1T3QA 4I6LB 3L16A 3RZWC 3PHXB 3V61A 3IAM1 2BTEA 4TSSA 3PZDA 1UUPA 1NI2A 2B76B 3BY4B 1GNUA 4US8A 2RSUA 4S0RA 4MDKE 3UINB 2FE8A 1WFYA 4DWFA 3JSVB 3APDA 2DNFA 2J7QB 3M3JA 3FILB 4K81A 2J0MA 2LHDA 1EF5A 3IFWB 2GRIA 4W9KA 4KKIA 1SIJA 3C0RB 1WX7A 3GP7A 2DYBA 4WQOB 2NVUI 4ANXA 3U7DA 3A9JB 4ZHPA 2PTLA 4URKA 1FXTB 1WWTA 1V49A 2SAKA 2REXA 1PDXA 1YN3A 3UGBB 1HZ6A 1VRAB 2J4XA 2L05A 1UGJA 2OJRA 1TBEA 2BT6A 3LXFA 1MPEA 2C5LC 2NMQA 2YEPB 5IO9A 2M1MA 2M56B 5D3IB 2J53A 1FD6A 1MFWA 2KVRA 2L83A 3L08A 3Q3MC 2V3PA 1ZDXA 2JYEA 3HHMA 3K9OB 5H92C 3M95A 2NCNA 4FA6A 2Y5PA 4W9GA 1EWCA 2D3CA 1XLNA 3JVZX 3QARA 2GBMA 4A3OA 3ZNGC 3W5UB 5CHFA 3B2FA 1F2RI 5D3DA 1TS2A 1BUIC 2LWPA 4K7SA 3RD2A 1E8XA 3ALBA 4HLEA 1E8ZA 1WJ4A 2LVOA 5J17A 1VJKA 2MRPA 4KZ0A 1YX5B 3EHVA 1VLBA 5HI1A 4HCPB 1C76A 3AEFB 1ZW7A 4REZA 4MJSB 2Q5WD 2BWES 3PRMB 2MA9B 3AULA 4KDIC 4C7YA 3A9JA 3AEBB 3BYTB 1SB3C 2ACZB 1H8CA 4W9DA 1OEYJ 3GOEA 2WDQB 2UU7A 1QOAA 3TBLD 2FBWB 1FFUA 2RPVA 2IGGA 5KHOA 1P3QU 3NUHB 5JH5C 2CKHB 5BMHA 3C8YA 2BYVE 3KYDD 1SE2A 4IM2A 4GGQA 2LUMA 1GJZA 1IBXB 1WXMA 3U52E 5BYRA 1J7BA 1I4HA 4ASWC 1HTQA 1JALA 4HRSA 4EZLA 2LEKA 2LUEA 3NVVA 3KH0A 2IZVB 1WYWB 1U4AA 4ANWA 1RLFA 2LGIA 1WI0A 4LCDE 1YQBA 3U8ZA 2OOBB 3SDLC 3E56A 1JRUA 5IAAC 3DCGA 1C3TA 4MGKE 1ENFA 3OJ3A 3RPFC 3NZUA 4BBNC 5E6JA 2MH7A 1D5XC 1YX6B 4WWPA 1RYJA 1TY0A 4ZRIA 3ZJTA 4KZCA 4MH0E 5L95C 1TIFA 4MACA 1MI0A 1SF0A 2W82A 2RDGA 1VD2A 4GU2A 3L17A 3R7RA 4AOFA 4WJPA 4DDID 3ZRCA 3VTVA 1SE4A 2WXJA 1SIFA 2KQSA 1H4RA 1I4PA 1CJEA 1M94A 2KACA 1WJ6A 2IO2B 2KVZA 3QA8A 4A9AA 4GDLA 1IBXA 2IDYA 3KYCD 4L23A 1V97A 4GSWA 2O6VD 1IGDA 5C23A 3QWZB 2RDHA 5C3JB 1GB1A 5J18A 4IWOA 2DAJA 4ZOHC 2A5UA 1FMAD 1HTOA 2BKRB 3L54A 3RYTA 3PLUA 4LNIA 4CYEA 1JWBD 2DZKA 4JE3B 2PMVA 2MBOA 2BB6A 2KOXA 2V4IB 4RM8A 3RNCC 1T0QC 4KSLC 4MSQB 4YXDB 3DOWA 4KVGB 1WZ3A 1D5MC 5T8IA 3AU5A 2Y3AA 3WANA 3ZTDA 1HQRD 4PS3A 2M17A 1OQRA 2J0KA 4FJYA 4JWSC 2LRUA 2KWCA 3BVGA 1FCLA 3H7SA 2KKCA 2V4LA 3SFDB 3BYYB 4A3PA 4LTUA 4F7ZA 3P2BA 2DLBA 1UH6A 4FHKA 1YJJA 3M62B 3NZSA 4J3OD 1S1QB 3Q3JA 4DK5A 1OTRB 4II2B 2R2QA 3AE4B 1NEKB 1FIQA 1L7YA 2KJ6A 2YVCA 4XE0A 1NYRA 2JT4B 3DHHC 2VZKB 3APFA 3NZ3A 3ZQ4A 3GB1A 2D5GA 3IT6B 3PV1A 4YWGG 1QQRA 1L0XB 3DBHB 1B9RA 1OQQA 3QK0A 1CMXB 5MPOA 3H7PA 1RFAA 2GBKA 5D6JB 2ZVOA 2M4NA 1V5TA 2Z0EB 1P1AA 2V1YA 4XZ4A 3RZFA 4ICUA 1P9DU 1FRRA 3P4PB 5HFYA 3QQ8B 1TJEA 5TR5A 1GC7A 3RUIB 1NVID 1WIAA 2FCQA 2K9XA 2KYWA 3B08A 1JRPA 4NY0A 5E6PA 4XWTA 5IKCM 2V3SA 3KQ4A 2FIDA 1WR6E 2I1KA 3AEGB 2BYTA 4P1CC 1FRDA 2LJIA 1WY8A 3Q69A 3WIMA 4W9HA 2KFJA 4FXCA 2DZJA 3BIID 2KN4A 1R4MB 2V0GA 2H88B 2KC1A 3RNEC 2INPE 3E9SA 4C4VB 4RGTA 3A4SC 1FNVA 2M19A 3NOBA 2ICIA 5CX3A 4EOYA 3PS6A 4OZAA 2LHEA 5J2RA 1K52A 4HVBA 1UNSA 2AL6A 1KFYB 1IP9A 5JXVA 2M0XA 3AI5A 3HRDD 2K22A 2O2VB 3ETRA 4HCNB 3IVFA 2XK5A 4IC7B 1FFVA 3APCA 1C78A 2NR2A 2AWTA 3DVGY 5HG2A 2CR5A 1L0YB 4ZYNA 1TKEA 4NAMA 3U4EG 4K3BA 3MFGA 1R4MI 2WQYB 4KV2A 4S17A 4LDTD 1KJTA 3VRAB 2MBBB 1FNWA 2ZPYA 2C9WB 1AYFA 3OWEB 2MP2B 4LNFA 4FLHA 1D3ZA 5GMVA 3DWMA 1R4NB 2K8CA 3BWUD 4EEWA 2JZZA 2L0FA 1NDDA 3A4RA 3ZJUA 2LI5A 3WALA 3ECIA 3Q3FA
chains in the Genus database with same CATH topology
2BT6A 3LXFA 3P4SB 1MPEA 1B1ZA 5BYQA 3VR8B 2DWQA 2NMQA 2YEPB 4USAA 3TSSA 1WYGA 1F0ZA 3TUOA 1GB4A 2M56B 5D3IB 2K3UA 3U2SC 1XLPA 2J53A 3TEYA 1FD6A 1ROEA 5BMIA 2L83A 4A55A 3PZ8A 1SSNA 1FXAA 2WXLA 2V3PA 1ZDXA 2JYEA 2R61A 1TYGB 2XNAC 5H92C 1C9FA 4YTNB 1QF6A 2KQ4X 2M0AA 3AE3B 2Y5PA 3W2DA 1EWCA 5C2TB 1PFDA 1XLQA 2I38A 1XLNA 4RFBA 1JCKB 2QEJC 3NVWA 3ZJVA 4D2KA 1V1PB 3H8HA 2CJNA 3MC0B 1GOZA 3W5UB 2OEDA 1F2RI 2W3RA 3B2FA 5D3DA 1OFFA 1TS2A 1ZUD2 2N0SB 1BUIC 1E6EB 1D6EC 4PT5A 2YEPF 1FXIA 5HHDG 5FR3A 3NS1A 3LB8C 1AWDA 1XO3A 2EELA 1VJKA 3SEBA 2KAJA 1F77A 3ZYYX 3NVZA 1VLBA 2WXIA 5HI1A 4ZHOA 1C76A 3AEFB 1ESFA 5AUKA 2JX5A 1T5XD 1XXGA 4REZA 2Q5WD 2K0PA 2PKOA 1KRHA 2CJOA 2J42A 1HXYD 1TS4A 3N9YC 5BMGA 4C7YA 4HJGE 1AW7A 3AEBB 1WGKA 1V8CA 3BYTB 1L6VA 4JPSA 4ITKA 1I4QA 1K50A 1SB3C 2ACZB 3I57A 1KLGD 2RMMA 4HKQA 1SBBB 1MVKA 2WDQB 1QOAA 4XWWA 1C77A 2FBWB 2J52A 1L4DB 1FFUA 1ZE3D 1RFKA 2L1AA 2IGGA 2RPVA 3NUHB 1RWSA 4GLSC 3P1MA 5BMHA 3C8YA 1DOXA 1N61A 1SE2A 4A8XC 1KF6B 4KGTA 2LUMA 1IBXB 3U52E 5BYRA 3BVZA 1J7BA 1I4HA 1N60A 3AECB 1JALA 4HRSA 4MH8A 2LEKA 4WWMA 2L32A 3NVVA 1EWYC 3AH7A 2AQ2B 3SFEB 4YSZB 5LNK1 2JSVX 4M0WA 2IJ0A 1GPXA 1JQ4A 2QJLA 1DYQA 4IOIE 4Q2JA 2INNE 2PLPA 5TSSA 5EE1A 1HA5A 2KMMA 1VZ6A 2LGIA 1ZXHA 4RF1A 4AS1A 4YTMB 1CZPA 2Z8LA 4HROA 3W5VB 3MJ5A 4TQ0A 1SJED 2G1EA 3E56A 4RH6A 2AQ3B 1JWMD 2VZKD 3BK1A 1WXQA 4JWUC 1LO5D 4LLGM 1QLBB 3VQIA 3P63A 4IKGA 1ENFA 1E9MA 3RPFC 3DWGC 4MM3B 3AMZA 1I4RA 5E6JA 3T3OA 3Q8CA 2MH7A 1D5XC 4UDUC 4JX1C 1YN5A 1N63A 1RYJA 1J7CA 1TY0A 4N6EB 1STEA 4YTPB 2WXPA 1XEEA 3P4QB 3ZJTA 1BXTA 2WP9B 2WDVB 4EE2A 1XLOA 1KH0A 4HKZE 4MACA 1MI0A 1SF0A 1QT9A 2QMTA 2W82A 1DGJA 2RDGA 2WDRB 2QIEB 3AE6B 1IUEA 1NI3A 3I9V1 3RFZB 2JQRB 1SE4A 2WXJA 2BW2A 2MEKA 4NAWB 4TQ1A 1Q10A 3BZDB 3NRZA 1I4PA 1N5WA 2WXGA 1CJEA 1E7PB 2E6XA 1GAQB 2KACA 1ACCA 4XDCA 1QKZA 1TZOA 5AUIA 5FKAC 5I4DA 3FAHA 3AEEB 2E3TA 4A9AA 1IGCA 1IBXA 1TS5A 4ZYSA 2IGHA 2IPKD 2IDYA 3FILA 4L23A 4C56C 1V97A 1ZPSA 3CWIA 2GI9A 2WXQA 3R2IA 2JZPA 4MT5A 1XF5L 1IGDA 1YMHE 1TY2A 2BB5A 2MJDA 1Y56A 2RDHA 5C3JB 1GB1A 1C4PA 1PYWD 1I4GA 1V1OA 3P42A 3HVZA 1E0ZA 4KGSA 4ZOHC 1JWSD 1FMAD 1JMLA 2W54A 1PUTA 2I2YA 1L5PA 1UWMA 4OHJA 1XCQL 3PZ7A 3BK2A 3NVYA 4XDDA 2FUG1 1JWBD 3TEZA 2PVGC 3BVMA 4ZRQA 4P16A 1I7HA 4JE3B 4AQ7A 3AEAB 3AE5B 4KGRA 1TS3A 2PMVA 3O13A 2WNMA 2BB6A 2V4IB 4WIPA 1DOYA 2WXNA 4YXDB 1C4CA 1C79A 3EUB2 2DYOA 2WXFA 1D5ZC 1D5MC 1QOGA 2Y3AA 2WU5B 1BMLC 2K5PA 5T8IA 4OZBA 2BS2B 4TMAB 3R2TA 1HQRD 2ONQA 1OQRA 1SJHD 4JWSC 1ZXIA 4L2YA 1KTKA 4OZCA 1YQ3B 3ZGZA 3BVGA 1FCLA 3URYA 1DOIA 4P6VF 2KWDA 3SFDB 3WCQA 1MHXA 4L1BA 3GS2A 1YJIA 3BYYB 4LK0M 3AB5A 4GDKB 1K53A 4LTUA 4C7ZA 1YNTE 1P7FA 5EE3A 2DLBA 2ZW0A 3Q8FA 3HVDA 1YJJA 4OW0A 1R7SA 1WSPA 2TSSA 1C4AA 4J3OD 2WS3B 1TKYA 1ET6A 3AE7B 1QOBA 3LYYA 4RF0A 1VZ7A 1CK1A 1V1PA 3HUIA 2ZW1A 1J7AA 3AE4B 1NEKB 1FIQA 3AE9B 1JW9D 3W9CB 3V05A 3B9JA 4XE0A 1EM7A 3Q8EA 2WXMA 3IT4B 4RCOA 2SEBD 1NYRA 4OVZA 2VZKB 3NZ3A 2NTSA 3AN1A 3ZQ4A 1ET9A 1E10A 5G5GA 3W1SA 3GB1A 3SR6A 4DXGA 2CU3A 1VDVA 2D5GA 3IT6B 3AEDB 1T6BX 4YWGG 2WU2B 1I4XA 1JWAD 1XCTL 2QILA 4YSXB 1QQRA 1L4ZB 1QOFA 3AV8A 1N62A 4HEA1 2MJ3A 3IAS1 1RM6C 1L0XB 3KLSX 1B9RA 4A6QA 2WXKA 3P4RB 4N58A 1OQQA 4NJCA 2JWUA 1M4VA 5MPOA 2PVOD 3MHZA 4DQOC 4WQMA 2W3SA 4O1NA 2AQ1B 1HEZE 1FRRA 2WXHA 4RGNA 2DBYA 2MJEA 3P4PB 3Q8AA 4R3DA 2N9LA 5HFYA 2N9KA 3U7ZA 5G5HA 2L52A 3AE1B 1TJEA 3UI3A 2HDEA 1EU4A 2WXOA 1UWXA 1JROA 1NVID 1L0VB 1K51A 4YT0B 2K9XA 1FO4A 1JRPA 4KX6B 4XWTA 3Q8BA 3J9CA 3KQ4A 4YSYB 5EE9A 5FK9C 1L6UA 4WH4A 3AEGB 4KKJA 2BYTA 1FRDA 2LJIA 3Q69A 3TEXA 3IXSA 1SEBD 2IGDA 2LMCA 4FXCA 2G9HD 1ZP0B 2JU6X 3BIID 1FCCC 2KN4A 3B2GA 1ZDVA 4ARIA 3KWVA 3AE8B 2LFIA 3KWLA 1JWUD 2V0GA 2H88B 3AE2B 2XN9C 2JYTA 5D7GA 2GB1A 4H2AA 1KLUD 2INPE 3E9SA 2DYMA 3V3XA 4RGTA 1QILA 3ABVB 3EGRA 1HZ5A 4US9A 4IDIA 2PIAA 1P7EA 2KDMA 1FNVA 2M19A 2BBCA 3MP9A 3PO0A 2H89B 4WURA 1PGAA 2ICIA 4OZAA 2HTME 2LHEA 5GXGB 4CQNA 2X38A 2WLBA 1K52A 1ZOYB 1UNSA 1YN4A 4RGMA 1KFYB 2AX5A 5JXVA 1T3QA 3HRDD 2K22A 3R8BA 2N7JA 3ETRA 4NZLB 3IAM1 4DXFA 1FM0D 2BTEA 1SXTA 2Y5CA 4TSSA 1UUPA 1FFVA 2B76B 4RNAA 1C78A 1F2RC 1MHHE 2JXTA 2PW9A 1SE3A 5HG2A 4US8A 1NYQA 1WRIA 4RGOS 5EE0A 1A70A 3T3NA 4B0EA 4ZRPA 1L0YB 1NENB 1TKEA 2EKIA 2BS4B 3VRBB 2FE8A 4NAMA 1CQVA 1D4BA 4GDLB 1FNUA 2WXRA 3U4EG 1VZ8A 3MFGA 1EU3A 1TKGA 3FILB 2WQYB 2LHDA 2V3NA 3AM9A 2GRIA 3TEWA 4KKIA 1SIJA 5H8YE 3VRAB 2OHFA 4A90A 3GP7A 1FNWA 3L4PA 1YQ4B 4C80A 1AYFA 3EA6A 3OWEB 1FEHA 3FC4A 4ZHPA 2PTLA 3DWMA 1WWTA 2QSDA 5BYSA 3CIRB 4ARCA 3BWUD 2SAKA 3VR9B 1PGXA 1N5XA 1PGBA 2W55A 1AN8A 1PDXA 3ZJUA 1YN3A 1VR9A 4N59A 2NTTA 1HZ6A 1VRAB 2J4XA 4WAFA 1UGJA 2BS3B 4B0MA 2ON8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WWM A;  1JWB D;  1L6U A;  2BT6 A;  2PVG C;  3AEG B;  3NVV A;  1EWY C;  3AH7 A;  3LXF A;  3P4S B;  3SFE B;  4YSZ B;  1FRD A;  1I7H A;  3VR8 B;  2DWQ A;  3AEA B;  4USA A;  1GPX A;  3AE5 B;  1JQ4 A;  2QJL A;  1WYG A;  1F0Z A;  2M56 B;  1XLP A;  1DOY A;  4FXC A;  1ROE A;  4YXD B;  5EE1 A;  1ZP0 B;  2KMM A;  2L83 A;  3BII D;  3B2G A;  3EUB 2;  3AE8 B;  3KWL A;  4YTM B;  1QOG A;  1FXA A;  2H88 B;  1CZP A;  2K5P A;  2WU5 B;  3AE2 B;  2BS2 B;  1TYG B;  4HRO A;  5H92 C;  1OQR A;  4YTN B;  3W5V B;  1QF6 A;  4JWS C;  1ZXI A;  2G1E A;  1YQ3 B;  3AE3 B;  4JWU C;  1WXQ A;  3ABV B;  4US9 A;  4IDI A;  1DOI A;  2PIA A;  4P6V F;  1PFD A;  5C2T B;  3SFD B;  3WCQ A;  1QLB B;  1XLQ A;  1YJI A;  3P63 A;  2M19 A;  3AB5 A;  3PO0 A;  4C7Z A;  4LTU A;  1XLN A;  2H89 B;  1E9M A;  3NVW A;  5EE3 A;  2HTM E;  3RPF C;  5GXG B;  2CJN A;  3DWG C;  1YJJ A;  3AMZ A;  3W5U B;  2WLB A;  1R7S A;  1ZOY B;  2MH7 A;  2W3R A;  3B2F A;  2WS3 B;  1TKY A;  4JX1 C;  1KFY B;  1OFF A;  1RYJ A;  1N63 A;  1J7C A;  1ZUD 2;  1QOB A;  2AX5 A;  3AE7 B;  2N0S B;  1E6E B;  4N6E B;  4YTP B;  1T3Q A;  3HUI A;  3P4Q B;  3HRD D;  1J7A A;  2K22 A;  2WP9 B;  2WDV B;  1NEK B;  1FIQ A;  1XLO A;  1JW9 D;  3AE4 B;  3AE9 B;  3ETR A;  3W9C B;  1FM0 D;  3B9J A;  2Y5C A;  1FXI A;  3NS1 A;  1SF0 A;  1FFV A;  2B76 B;  3LB8 C;  1NYR A;  1AWD A;  1QT9 A;  1XO3 A;  2WDR B;  1DGJ A;  2QIE B;  3AN1 A;  3AE6 B;  4US8 A;  1NYQ A;  1VJK A;  1WRI A;  5G5G A;  1E10 A;  1IUE A;  3SR6 A;  5EE0 A;  1A70 A;  1NI3 A;  2KAJ A;  3ZYY X;  2CU3 A;  1VLB A;  1VDV A;  3NVZ A;  3AED B;  4ZHO A;  1NEN B;  2WU2 B;  1JWA D;  1TKE A;  3AEF B;  2EKI A;  2JX5 A;  2JQR B;  2BS4 B;  5AUK A;  3VRB B;  2Q5W D;  4YSX B;  2PKO A;  1QOF A;  1KRH A;  2CJO A;  1N62 A;  3AV8 A;  2MJ3 A;  3NRZ A;  1N5W A;  1RM6 C;  1B9R A;  1TKG A;  1CJE A;  1E7P B;  1GAQ B;  2WQY B;  4C7Y A;  3P4R B;  3AEB B;  4N58 A;  1WGK A;  1OQQ A;  1V8C A;  1L6V A;  5AUI A;  4ITK A;  2PVO D;  3AM9 A;  3FAH A;  1SB3 C;  5MPO A;  2ACZ B;  1SIJ A;  3AEE B;  2E3T A;  5H8Y E;  4A9A A;  3VRA B;  4WQM A;  2OHF A;  3L4P A;  2W3S A;  1YQ4 B;  1FRR A;  2WDQ B;  2DBY A;  2MJE A;  3P4P B;  4C80 A;  1QOA A;  5EE9 A;  1AYF A;  1V97 A;  2FBW B;  3CWI A;  1FFU A;  2L52 A;  1RFK A;  3FC4 A;  5G5H A;  4ZHP A;  3AE1 B;  3DWM A;  1TJE A;  1WWT A;  2MJD A;  3CIR B;  1RWS A;  5C3J B;  3P1M A;  3VR9 B;  1E0Z A;  3HVZ A;  1N61 A;  1DOX A;  1N5X A;  1KF6 B;  4ZOH C;  1JRO A;  2W55 A;  1FMA D;  1PDX A;  1NVI D;  1L0V B;  4N59 A;  4YT0 B;  1J7B A;  1N60 A;  2K9X A;  2W54 A;  1FO4 A;  1JRP A;  1PUT A;  3AEC B;  4KX6 B;  1L5P A;  1UWM A;  1JAL A;  4HRS A;  2BS3 B;  3NVY A;  2LEK A;  4YSY B; 
#chains in the Genus database with same CATH topology
 4W9C A;  3VR8 B;  2KTF A;  4USA A;  4C4V A;  3U2S C;  3TEY A;  1ROE A;  3L10 B;  4A55 A;  5BO4 B;  5DPS A;  3PZ8 A;  1SSN A;  1FXA A;  2MBH A;  2WXL A;  2R61 A;  1TYG B;  3RN9 C;  1QF6 A;  3PTF C;  4EKU A;  1PFD A;  4X57 B;  2JWZ A;  1PQS A;  3MC8 A;  2I38 A;  3S2A A;  3NVW A;  1V1P B;  3MC0 B;  2NPT B;  1R4N I;  2OED A;  2W3R A;  3CSF A;  1T0R C;  1OFF A;  1T0S C;  1ZUD 2;  2FCN A;  2K1F A;  2N0S B;  1E6E B;  5D94 A;  1A5R A;  1SGH A;  2DZI A;  4JL9 A;  3ML8 A;  3H6N A;  5AZH A;  2YEP F;  3LB8 C;  2EEL A;  2N7D A;  3K9P B;  2ZVN A;  2KAJ A;  3NVZ A;  2WXI A;  3N30 A;  3BIN A;  1ESF A;  5AUK A;  1E8Y A;  1KRH A;  2ZNV C;  2D3B A;  2MP2 A;  2KX0 A;  2KNB A;  4HJG E;  1WGK A;  1V8C A;  4JIO U;  1L6V A;  1UBI A;  1K50 A;  1F1H A;  2HD5 B;  1KLG D;  2MSE D;  2RMM A;  1SBB B;  1MVK A;  5AZF A;  4XWW A;  2EMT A;  3CMM B;  2QDF A;  2L1A A;  3IHP C;  2KX3 A;  1RWS A;  2KDI A;  2V9H A;  1KF6 B;  4HWI B;  4KGT A;  3X0W A;  3Q6B A;  3QJZ A;  3PSE B;  3AH7 A;  2JSV X;  2KTR B;  1GPX A;  2QJL A;  2YLM A;  2JF5 A;  2PLP A;  5TSS A;  3R3M A;  1HA5 A;  4W9I A;  1VZ6 A;  4RF1 A;  2G45 B;  4YTM B;  1CZP A;  3ZUN A;  3SU8 X;  4E74 A;  2MCN B;  1RRB A;  4TV3 A;  1SJE D;  4RH6 A;  1Z5S B;  2AQ3 B;  3PVL A;  3UIO B;  1WXQ A;  1LO5 D;  3VQI A;  4WWN A;  4WJQ A;  2KDB A;  4MM3 B;  2N1V A;  4JX1 C;  5FR6 A;  1N63 A;  1SE9 A;  4IWQ A;  4YTP B;  2OJW A;  3P4Q B;  3NS8 A;  2WP9 B;  1XLO A;  5G2N A;  4ZRJ A;  4HKZ E;  2K6D B;  2BQQ A;  3ENE A;  1QT9 A;  2MHJ A;  3ZKJ C;  2QIE B;  2NBW B;  1WXA A;  1IUE A;  2RDB C;  1NI3 A;  2KC2 A;  2LGD A;  1QZE A;  3RFZ B;  4NAW B;  2MEK A;  3ZNH B;  1XT9 B;  1N5W A;  1E7P B;  2E6X A;  1ACC A;  5DCN A;  2N9X A;  1QKZ A;  1TZO A;  5AUI A;  1TTN A;  4K1R B;  3AEE B;  3OAW A;  2VH1 A;  3JSV A;  1WRD B;  1TS5 A;  4ZYS A;  2IPK D;  1UF0 A;  2GMI C;  4QAY A;  3FIL A;  2L00 B;  2KO3 A;  3CWI A;  3R2I A;  2JZP A;  1YMH E;  3VUW A;  4AUQ C;  3O65 B;  3P42 A;  3DVN V;  1I4G A;  1E0Z A;  2KTR A;  1PUT A;  1UD7 A;  2I2Y A;  4M8M A;  3VUY A;  3PZ7 A;  1AAR A;  3DPD A;  4XDD A;  4BKT A;  2KHW B;  4IM0 A;  4DXA B;  3WAO A;  3AEA B;  4KGR A;  1TS3 A;  5E6O A;  3O13 A;  2PPH A;  3UF8 A;  1C4C A;  1C79 A;  1WJU A;  2JPH A;  2WXF A;  3ZDT A;  1D5Z C;  1QOG A;  1BML C;  3RUL A;  2BS2 B;  2LXC A;  3R2T A;  2ONQ A;  1ZXI A;  2CHW A;  1KTK A;  1YQ3 B;  2RD0 A;  2RPQ A;  1DOI A;  5HKH A;  4KIK B;  1OQY A;  3Q3O C;  1MHX A;  1YJI A;  4LK0 M;  4F8C B;  4C7Z A;  1K53 A;  2ZZP B;  3N3K B;  2ZW0 A;  1WMH B;  1WSP A;  4BKS A;  2A4Z A;  2WS3 B;  1ET6 A;  3MTN B;  3LYY A;  4RF0 A;  4HPL B;  3AE9 B;  2VH2 A;  3W9C B;  4MGI E;  1RAX A;  3Q8E A;  2WXM A;  3IT4 B;  2SEB D;  5L83 A;  3VFK A;  2NTS A;  5E6N A;  2JRH A;  4I6N B;  2LGX A;  3W1S A;  2KN5 A;  3SR6 A;  4TUU A;  2MW5 A;  2CU3 A;  3AED B;  1T6B X;  2WU2 B;  1I4X A;  1XCT L;  4YSX B;  4AJY B;  1QOF A;  4HEA 1;  3KLS X;  3R7Q A;  4DDG D;  2JXX A;  3KW5 B;  3P4R B;  1VCB A;  4FAD A;  1M4V A;  2PJH A;  3MHZ A;  1MG4 A;  2IYD B;  4MJS A;  1TT5 B;  2GBJ A;  4RGN A;  3U7Z A;  1EF1 A;  3CF6 E;  5G5H A;  3AE1 B;  3EFU A;  2C7M B;  2EMS A;  2WXO A;  1UWX A;  4BFR A;  1K51 A;  4YT0 B;  4ZRK A;  1FO4 A;  4XYC A;  3N1X C;  4KX6 B;  3RI7 C;  1XD3 B;  5FK9 C;  1WGR A;  3J9C A;  4WH4 A;  2GBN A;  1EO6 A;  2K6Q A;  4XX5 A;  3IXS A;  2IO1 B;  2O6V B;  3KWV A;  2LFI A;  2WDT B;  1MG8 A;  2JYT A;  2LZ6 A;  1P98 A;  1WH3 A;  5KHQ A;  3TJP A;  1WMH A;  1X1M A;  2PE9 A;  4NQK E;  3ZVV A;  3EGR A;  2PIA A;  4LNO A;  2LAS A;  2KDM A;  3PRZ A;  3KUZ A;  2BBC A;  3MP9 A;  3ML9 A;  3HK0 A;  4FJV B;  1T0Y A;  4GIV A;  2KD0 A;  4G3X B;  4CQN A;  2PE6 B;  2XEW A;  4II3 B;  4HPM B;  3HM6 X;  3R8B A;  2N7J A;  3ZDM C;  1FM0 D;  1SXT A;  4CHK A;  1LGR A;  3MC9 A;  4MSM B;  1F2R C;  2JXT A;  2PW9 A;  1NYQ A;  1WRI A;  4RGO S;  2MX2 A;  2KLG A;  2G3Q B;  5DPR A;  3T3N A;  3QIJ A;  4B0E A;  2EKI A;  2BS4 B;  3VRB B;  1CQV A;  1FNU A;  2WXR A;  1VZ8 A;  2MQJ A;  3IG3 A;  2NBU A;  5C1Z A;  3AM9 A;  3TEW A;  4A20 A;  1UGM A;  5H8Y E;  3L4P A;  3U30 A;  2WHI A;  4C80 A;  2R2O A;  3EA6 A;  3DDC B;  3PHW B;  2KFK B;  3FC4 A;  1EUV B;  2KMA A;  5JZE B;  2GBR A;  2QSD A;  5BYS A;  4DHZ B;  1PGX A;  3B1L X;  1V81 A;  3DBS A;  1BT0 A;  4KSK C;  3PT2 B;  2Y5B B;  4N59 A;  2NTT A;  3MJW A;  5IOI A;  2WX1 A;  4NQL B;  5DPW A;  3RMK C;  5EDS A;  2BS3 B;  4B0M A;  1OGW A;  2O6V A;  1WE7 A;  2DWQ A;  1N6Z A;  3TSS A;  1WYG A;  1F0Z A;  3I3T B;  1GB4 A;  2KZR A;  2K3U A;  3N32 A;  2N7E A;  2L76 A;  2KQ7 A;  5BMI A;  2Z0D B;  3W1S C;  4C00 A;  1GC6 A;  3M63 B;  4M0W B;  2RR9 A;  3UQA A;  4FN2 A;  2M0A A;  2FCM A;  4G0N B;  2FIF A;  1XLQ A;  3QX1 A;  1JCK B;  3ZJV A;  3H8H A;  2CJN A;  4G50 A;  3NG0 A;  2KLC A;  1Y8R C;  4AJW A;  3DBH I;  4W9F A;  1D6E C;  4PT5 A;  1FXI A;  5HHD G;  5FR3 A;  3NS1 A;  4HPP A;  1XO3 A;  3SEB A;  2N9E B;  1F77 A;  3ZYY X;  3N20 C;  1UEL A;  2G4S A;  1T5X D;  2KMC A;  2KJR A;  2PKO A;  3VH3 B;  2CJO A;  2J42 A;  1I35 A;  4DHJ D;  1UZX B;  1HXY D;  2KXJ A;  1AW7 A;  3DVG X;  5JHB A;  4JPS A;  4ITK A;  1I4Q A;  1LFD A;  3RNB C;  2RGF A;  2WGS A;  1L4D B;  1ZE3 D;  1RFK A;  3KVF B;  4GLS C;  4JQW C;  3P1M A;  1F52 A;  4HK2 A;  4EUT A;  1N61 A;  1DOX A;  4A8X C;  3A33 B;  1WM2 A;  4MH8 A;  4WWM A;  2L32 A;  1MJD A;  4MGZ E;  4DHZ E;  3VTU A;  1EWY C;  4LDT B;  3SFE B;  4YSZ B;  2K25 A;  4M0W A;  2N4F A;  1WE6 A;  3A1Q B;  4MGY E;  1DYQ A;  4IOI E;  2BF8 B;  4Q2J A;  2INN E;  4M02 A;  4E3C A;  4AS1 A;  1WXS A;  3A9K B;  3W5V B;  3MJ5 A;  4TQ0 A;  2W9N A;  1JWM D;  3BK1 A;  4JWU C;  3SD5 A;  4LLG M;  1QLB B;  3P63 A;  2KT7 A;  2N9P C;  3DWG C;  3TCA A;  3QCA A;  3Q8C A;  4OVV A;  4BAX A;  4UDU C;  1STE A;  1XEE A;  1BXT A;  4JGH B;  4ZDV A;  3RNA C;  2BWF A;  4E71 A;  2AYO B;  1DGJ A;  2UYZ B;  3AE6 B;  4W9L A;  2O2V A;  2JQR B;  4NPN A;  3V6C B;  3BZD B;  4F1S A;  3NRZ A;  4PYU A;  2WXG A;  1WJN A;  2BVC A;  4XDC A;  4YL8 A;  3VTW A;  1WM3 A;  5FKA C;  2K8H A;  3FAH A;  2E3T A;  2BGF A;  4LNN A;  3ZXR A;  2C60 A;  2J0J A;  4MT5 A;  4B95 A;  2DAF A;  3DHG C;  1TGZ B;  1PYW D;  4B6W A;  3A1Q A;  3B0A A;  1JWS D;  1JML A;  2W54 A;  4GOC A;  3PGE A;  1XCQ L;  3BK2 A;  2FUG 1;  3TEZ A;  2PVG C;  2L3Z A;  5CHV C;  4ZRQ A;  4WAA A;  3N1Z C;  4AQ7 A;  3A9K A;  5G55 A;  3AE5 B;  3OLM D;  2D11 A;  2LGY A;  2WNM A;  4FJZ A;  2WXN A;  1WX9 A;  3ZRF A;  3DVN U;  3RCZ A;  1C1Y B;  2LGS A;  2K5P A;  2KAN A;  2WU5 B;  2ZJD A;  4W9J A;  1V5O A;  1IPG A;  4L2Y A;  1V9J A;  3RNG C;  3URY A;  1YD8 U;  2XBB C;  3WCQ A;  4L1B A;  3GS2 A;  3AB5 A;  4GDK B;  1YNT E;  3HM3 A;  1P7F A;  4BZA A;  5EE3 A;  3ZO5 B;  3H1U A;  3Q8F A;  3HVD A;  4OW0 A;  1TKY A;  2D10 A;  2KK8 A;  1P0R A;  1KLV A;  3V62 A;  4EFO A;  1VZ7 A;  1V1P A;  3PRP B;  4IUM B;  2NPT A;  3B9J A;  1EM7 A;  3VXW A;  4RCO A;  2KJH B;  4OVZ A;  3AN1 A;  1WX8 A;  1ET9 A;  1E7V A;  1E10 A;  3ZXV A;  3JW0 X;  4KDL B;  1Z2M A;  3VUX A;  2FAZ A;  1JWA D;  4XC2 A;  4PS8 A;  2IY0 B;  2QIL A;  1L4Z B;  4XGA B;  1S3S G;  2MJ3 A;  4G11 A;  4A6Q A;  4N58 A;  2ZPN A;  2JWU A;  3T9L A;  2PVO D;  4DQO C;  2WYQ A;  2W3S A;  4O1N A;  2AQ1 B;  1HEZ E;  2WXH A;  2MJE A;  3Q8A A;  4R3D A;  2N9L A;  3RNF C;  3H9D A;  3HIZ A;  3UI3 A;  2C7N B;  3VDZ A;  3VAW A;  1L0V B;  3ZLZ A;  4YSY B;  4BKS D;  1L6U A;  4KKJ A;  4GMV A;  2NBV B;  3TEX A;  4HDO A;  4ANU A;  1SEB D;  2IGD A;  2LMC A;  1V2Y A;  3CST A;  2G9H D;  3I63 C;  1ZP0 B;  2MBE A;  1WGG A;  1FCC C;  3X23 A;  3PPA A;  4GDK A;  3AE8 B;  3KWL A;  3AE2 B;  2XN9 C;  4ACF A;  5LXI B;  1ISN A;  5D7G A;  1UBQ A;  3W1Y A;  4H2A A;  1KLU D;  3L0W B;  3V3X A;  2FCS A;  1V80 A;  1HZ5 A;  4PYZ A;  1XQQ A;  1TZ1 A;  2H89 B;  4WUR A;  2I1J A;  2HTM E;  4M8N A;  2N1W A;  5GXG B;  2WX0 A;  2GLS A;  2X38 A;  2WLB A;  3DBL B;  5LXH A;  4W9E A;  4RGM A;  3PLV A;  2HJ1 A;  4MM3 A;  2ZCC A;  4NZL B;  4DXF A;  2Y5C A;  2DZM A;  4RNA A;  1MHH E;  2MWS B;  1SE3 A;  5EE0 A;  1A70 A;  1WGD A;  4ZRP A;  3D32 A;  1NEN B;  2CHZ A;  1D4B A;  4GDL B;  3OJ4 B;  1E90 A;  1EU3 A;  1TKG A;  2V3N A;  4DBG A;  4BOZ B;  5IN7 A;  4GXB A;  4NAW A;  4PS7 A;  2OHF A;  4A90 A;  1YQ4 B;  1FEH A;  2LVQ A;  4I6P A;  4ARC A;  3CIR B;  1KM7 A;  3VR9 B;  1N5X A;  1PGB A;  3DBL I;  2W55 A;  1AN8 A;  2AL3 A;  1VR9 A;  4BOS C;  4WAF A;  1OEY A;  2K8B A;  1V86 A;  4LNK A;  3P4S B;  2UWQ A;  4NNJ B;  1B1Z A;  5BYQ A;  4PK1 A;  3SHQ A;  1J8C A;  2JUO A;  3TUO A;  4GB9 A;  1XLP A;  3NJT A;  4B9K A;  3DBR B;  5CHW A;  2C7H A;  2LXA A;  4P1B C;  2LVP A;  1WGY A;  2XNA C;  1C9F A;  4YTN B;  2HJ8 A;  2KQ4 X;  3AE3 B;  5AEK B;  3W2D A;  2DHZ A;  5C2T B;  4K7W A;  3GE3 C;  4RFB A;  4K7U A;  2QEJ C;  4D2K A;  1GOZ A;  4KIK A;  2PEA A;  3MHS D;  2IBI B;  1WR1 A;  5IA7 A;  2JY6 A;  2ON8 A;  3TL5 A;  2JRI B;  2MBQ A;  5JHA A;  4IG7 B;  1AWD A;  2B3A A;  4CO7 A;  4FUL A;  2D2Q A;  4ZHO A;  3H7P B;  1GG3 A;  4HDQ A;  2IY1 B;  2JX5 A;  1XXG A;  4BVU C;  2K0P A;  3DBR I;  1TS4 A;  3N9Y C;  3PRE A;  5BMG A;  3DQV A;  3KUC B;  3I57 A;  3V60 A;  4HKQ A;  3EFC A;  3Q3N C;  1C77 A;  2J52 A;  4FHJ A;  3QHT A;  1WZ0 A;  2IO0 B;  1NBF C;  2HE7 A;  3BVZ A;  1N60 A;  4EZK A;  1ZGU B;  3AEC B;  2AEH A;  2LRW A;  2KWV B;  4AP4 C;  2ZNV B;  3C19 A;  2AQ2 B;  5LNK 1;  2IJ0 A;  1JQ4 A;  4OVU A;  2IO3 B;  2CU1 A;  1ZKH A;  5EE1 A;  3T8M A;  2KMM A;  2M8S A;  2LD9 A;  2KDE B;  1ZXH A;  3KUD B;  2GOW A;  5IP4 D;  2Z8L A;  4HRO A;  3ONS A;  4LJP B;  2G1E A;  2VZK D;  3L13 A;  4MEM A;  5D2M B;  4IKG A;  1E9M A;  2DX5 B;  2KWU B;  1E5W A;  3AMZ A;  1I4R A;  3T3O A;  1Q5W B;  2XK5 B;  3ZIM A;  3VVW B;  5AZG A;  1YN5 A;  1J7C A;  2MLB A;  4N6E B;  2WXP A;  4N9F 4;  4IW0 A;  4WJN A;  2WDV B;  4EE2 A;  1KH0 A;  2D07 B;  4ICV A;  1E8W A;  1WF9 A;  2QMT A;  2WDR B;  3I5J C;  3WAP A;  3TMP B;  1YIW A;  3R66 C;  3OG5 A;  3I9V 1;  2BW2 A;  4LJO B;  3Q14 C;  4TQ1 A;  1Q10 A;  1GAQ B;  3QC8 B;  4P7I A;  3ZNI D;  5I4D A;  1Q1O A;  2QCZ A;  1IGC A;  2KDF B;  2IGH A;  4C56 C;  1ZPS A;  2GI9 A;  2WXQ A;  1XF5 L;  1TY2 A;  2BB5 A;  1WGH A;  2MJD A;  1Y56 A;  1I42 A;  2BYE A;  1C4P A;  1LQB A;  1V1O A;  3HVZ A;  3EEC A;  4K3C A;  4KGS A;  4M01 A;  3GZN B;  5CTR C;  2NS5 A;  3Q2A C;  2KFK A;  1L5P A;  4DHJ B;  1UWM A;  4OHJ A;  1IYF A;  3NVY A;  2BKF A;  3AXC A;  3BVM A;  4P16 A;  1I7H A;  2CS4 A;  2L7R A;  2FUH B;  1KOT A;  2L8J A;  4WIP A;  1DOY A;  2WWZ A;  3NHE B;  4IWP A;  4RM9 A;  4BBN F;  3EUB 2;  2FNJ B;  2DYO A;  2ZEQ A;  3NY5 A;  2K39 A;  4HXD A;  2D3G A;  3V6E B;  4MEL A;  2G4D B;  4OZB A;  4TMA B;  2Z59 B;  4ANV A;  2D3A A;  2ZCB A;  1SJH D;  4OZC A;  3ZGZ A;  1YJ1 A;  4P6V F;  2KWD A;  1LXD A;  3N1Y C;  4AWJ A;  3ZW3 A;  4JLC A;  1R7S A;  2TSS A;  2X8X X;  1C4A A;  4IM3 A;  3TIX A;  3AE7 B;  1QOB A;  3GZN I;  1CK1 A;  3HUI A;  2ZW1 A;  4GN1 A;  2L0T A;  1J7A A;  4WJO A;  4NJ7 A;  1JW9 D;  3JYU A;  3V05 A;  2QHO A;  4BKG A;  4EZJ A;  4TKN A;  5G5G A;  4DXG A;  1VDV A;  2CHX A;  5LLI A;  1Q0W B;  3QAQ A;  3LDZ E;  3AV8 A;  1N62 A;  3IAS 1;  1RM6 C;  4M00 A;  2WXK A;  2IND C;  4NJC A;  3UIP B;  1YOV B;  4WQM A;  3ZNZ B;  2DBY A;  2N9K A;  2L52 A;  4J6I A;  2JVC A;  2VRR B;  3WAM A;  5DPT A;  2DEN B;  2HDE A;  2INC C;  1FPY A;  1EU4 A;  3GE8 C;  1JRO A;  3ZTC A;  4WWO A;  1J19 A;  1F9J A;  3FKY A;  4NJ6 A;  3LJ3 A;  3Q8B A;  5EE9 A;  1HE8 A;  3AU4 A;  3DHI C;  3RT3 B;  3VHT C;  2LJ5 A;  2BPS A;  4RMA A;  2JU6 X;  3B2G A;  1ZDV A;  4ARI A;  1JWU D;  1L2N A;  3WA0 A;  2JZ3 B;  1LM8 B;  3UQB A;  2GB1 A;  4HJK A;  2BYF A;  2DYM A;  1E7U A;  1QIL A;  3ABV B;  3EC8 A;  1GUA B;  4US9 A;  4IDI A;  1K8R B;  1P7E A;  3PO0 A;  1PGA A;  1G6J A;  1WXV A;  3VH4 B;  1V6E A;  3IBE A;  1J0G A;  1ZOY B;  1YN4 A;  4FBJ B;  2EKE C;  2AX5 A;  2QC8 A;  2ASQ A;  2HTH A;  1T3Q A;  4I6L B;  3L16 A;  3RZW C;  3PHX B;  3V61 A;  3IAM 1;  2BTE A;  4TSS A;  3PZD A;  1UUP A;  1NI2 A;  2B76 B;  3BY4 B;  1GNU A;  4US8 A;  2RSU A;  4S0R A;  4MDK E;  3UIN B;  2FE8 A;  1WFY A;  4DWF A;  3JSV B;  3APD A;  2DNF A;  2J7Q B;  3M3J A;  3FIL B;  4K81 A;  2J0M A;  2LHD A;  1EF5 A;  3IFW B;  2GRI A;  4W9K A;  4KKI A;  1SIJ A;  3C0R B;  1WX7 A;  3GP7 A;  2DYB A;  4WQO B;  2NVU I;  4ANX A;  3U7D A;  3A9J B;  4ZHP A;  2PTL A;  4URK A;  1FXT B;  1WWT A;  1V49 A;  2SAK A;  2REX A;  1PDX A;  1YN3 A;  3UGB B;  1HZ6 A;  1VRA B;  2J4X A;  2L05 A;  1UGJ A;  2OJR A;  1TBE A;  2BT6 A;  3LXF A;  1MPE A;  2C5L C;  2NMQ A;  2YEP B;  5IO9 A;  2M1M A;  2M56 B;  5D3I B;  2J53 A;  1FD6 A;  1MFW A;  2KVR A;  2L83 A;  3L08 A;  3Q3M C;  2V3P A;  1ZDX A;  2JYE A;  3HHM A;  3K9O B;  5H92 C;  3M95 A;  2NCN A;  4FA6 A;  2Y5P A;  4W9G A;  1EWC A;  2D3C A;  1XLN A;  3JVZ X;  3QAR A;  2GBM A;  4A3O A;  3ZNG C;  3W5U B;  5CHF A;  3B2F A;  1F2R I;  5D3D A;  1TS2 A;  1BUI C;  2LWP A;  4K7S A;  3RD2 A;  1E8X A;  3ALB A;  4HLE A;  1E8Z A;  1WJ4 A;  2LVO A;  5J17 A;  1VJK A;  2MRP A;  4KZ0 A;  1YX5 B;  3EHV A;  1VLB A;  5HI1 A;  4HCP B;  1C76 A;  3AEF B;  1ZW7 A;  4REZ A;  4MJS B;  2Q5W D;  2BWE S;  3PRM B;  2MA9 B;  3AUL A;  4KDI C;  4C7Y A;  3A9J A;  3AEB B;  3BYT B;  1SB3 C;  2ACZ B;  1H8C A;  4W9D A;  1OEY J;  3GOE A;  2WDQ B;  2UU7 A;  1QOA A;  3TBL D;  2FBW B;  1FFU A;  2RPV A;  2IGG A;  5KHO A;  1P3Q U;  3NUH B;  5JH5 C;  2CKH B;  5BMH A;  3C8Y A;  2BYV E;  3KYD D;  1SE2 A;  4IM2 A;  4GGQ A;  2LUM A;  1GJZ A;  1IBX B;  1WXM A;  3U52 E;  5BYR A;  1J7B A;  1I4H A;  4ASW C;  1HTQ A;  1JAL A;  4HRS A;  4EZL A;  2LEK A;  2LUE A;  3NVV A;  3KH0 A;  2IZV B;  1WYW B;  1U4A A;  4ANW A;  1RLF A;  2LGI A;  1WI0 A;  4LCD E;  1YQB A;  3U8Z A;  2OOB B;  3SDL C;  3E56 A;  1JRU A;  5IAA C;  3DCG A;  1C3T A;  4MGK E;  1ENF A;  3OJ3 A;  3RPF C;  3NZU A;  4BBN C;  5E6J A;  2MH7 A;  1D5X C;  1YX6 B;  4WWP A;  1RYJ A;  1TY0 A;  4ZRI A;  3ZJT A;  4KZC A;  4MH0 E;  5L95 C;  1TIF A;  4MAC A;  1MI0 A;  1SF0 A;  2W82 A;  2RDG A;  1VD2 A;  4GU2 A;  3L17 A;  3R7R A;  4AOF A;  4WJP A;  4DDI D;  3ZRC A;  3VTV A;  1SE4 A;  2WXJ A;  1SIF A;  2KQS A;  1H4R A;  1I4P A;  1CJE A;  1M94 A;  2KAC A;  1WJ6 A;  2IO2 B;  2KVZ A;  3QA8 A;  4A9A A;  4GDL A;  1IBX A;  2IDY A;  3KYC D;  4L23 A;  1V97 A;  4GSW A;  2O6V D;  1IGD A;  5C23 A;  3QWZ B;  2RDH A;  5C3J B;  1GB1 A;  5J18 A;  4IWO A;  2DAJ A;  4ZOH C;  2A5U A;  1FMA D;  1HTO A;  2BKR B;  3L54 A;  3RYT A;  3PLU A;  4LNI A;  4CYE A;  1JWB D;  2DZK A;  4JE3 B;  2PMV A;  2MBO A;  2BB6 A;  2KOX A;  2V4I B;  4RM8 A;  3RNC C;  1T0Q C;  4KSL C;  4MSQ B;  4YXD B;  3DOW A;  4KVG B;  1WZ3 A;  1D5M C;  5T8I A;  3AU5 A;  2Y3A A;  3WAN A;  3ZTD A;  1HQR D;  4PS3 A;  2M17 A;  1OQR A;  2J0K A;  4FJY A;  4JWS C;  2LRU A;  2KWC A;  3BVG A;  1FCL A;  3H7S A;  2KKC A;  2V4L A;  3SFD B;  3BYY B;  4A3P A;  4LTU A;  4F7Z A;  3P2B A;  2DLB A;  1UH6 A;  4FHK A;  1YJJ A;  3M62 B;  3NZS A;  4J3O D;  1S1Q B;  3Q3J A;  4DK5 A;  1OTR B;  4II2 B;  2R2Q A;  3AE4 B;  1NEK B;  1FIQ A;  1L7Y A;  2KJ6 A;  2YVC A;  4XE0 A;  1NYR A;  2JT4 B;  3DHH C;  2VZK B;  3APF A;  3NZ3 A;  3ZQ4 A;  3GB1 A;  2D5G A;  3IT6 B;  3PV1 A;  4YWG G;  1QQR A;  1L0X B;  3DBH B;  1B9R A;  1OQQ A;  3QK0 A;  1CMX B;  5MPO A;  3H7P A;  1RFA A;  2GBK A;  5D6J B;  2ZVO A;  2M4N A;  1V5T A;  2Z0E B;  1P1A A;  2V1Y A;  4XZ4 A;  3RZF A;  4ICU A;  1P9D U;  1FRR A;  3P4P B;  5HFY A;  3QQ8 B;  1TJE A;  5TR5 A;  1GC7 A;  3RUI B;  1NVI D;  1WIA A;  2FCQ A;  2K9X A;  2KYW A;  3B08 A;  1JRP A;  4NY0 A;  5E6P A;  4XWT A;  5IKC M;  2V3S A;  3KQ4 A;  2FID A;  1WR6 E;  2I1K A;  3AEG B;  2BYT A;  4P1C C;  1FRD A;  2LJI A;  1WY8 A;  3Q69 A;  3WIM A;  4W9H A;  2KFJ A;  4FXC A;  2DZJ A;  3BII D;  2KN4 A;  1R4M B;  2V0G A;  2H88 B;  2KC1 A;  3RNE C;  2INP E;  3E9S A;  4C4V B;  4RGT A;  3A4S C;  1FNV A;  2M19 A;  3NOB A;  2ICI A;  5CX3 A;  4EOY A;  3PS6 A;  4OZA A;  2LHE A;  5J2R A;  1K52 A;  4HVB A;  1UNS A;  2AL6 A;  1KFY B;  1IP9 A;  5JXV A;  2M0X A;  3AI5 A;  3HRD D;  2K22 A;  2O2V B;  3ETR A;  4HCN B;  3IVF A;  2XK5 A;  4IC7 B;  1FFV A;  3APC A;  1C78 A;  2NR2 A;  2AWT A;  3DVG Y;  5HG2 A;  2CR5 A;  1L0Y B;  4ZYN A;  1TKE A;  4NAM A;  3U4E G;  4K3B A;  3MFG A;  1R4M I;  2WQY B;  4KV2 A;  4S17 A;  4LDT D;  1KJT A;  3VRA B;  2MBB B;  1FNW A;  2ZPY A;  2C9W B;  1AYF A;  3OWE B;  2MP2 B;  4LNF A;  4FLH A;  1D3Z A;  5GMV A;  3DWM A;  1R4N B;  2K8C A;  3BWU D;  4EEW A;  2JZZ A;  2L0F A;  1NDD A;  3A4R A;  3ZJU A;  2LI5 A;  3WAL A;  3ECI A;  3Q3F A; 
#chains in the Genus database with same CATH homology
 2BT6 A;  3LXF A;  3P4S B;  1MPE A;  1B1Z A;  5BYQ A;  3VR8 B;  2DWQ A;  2NMQ A;  2YEP B;  4USA A;  3TSS A;  1WYG A;  1F0Z A;  3TUO A;  1GB4 A;  2M56 B;  5D3I B;  2K3U A;  3U2S C;  1XLP A;  2J53 A;  3TEY A;  1FD6 A;  1ROE A;  5BMI A;  2L83 A;  4A55 A;  3PZ8 A;  1SSN A;  1FXA A;  2WXL A;  2V3P A;  1ZDX A;  2JYE A;  2R61 A;  1TYG B;  2XNA C;  5H92 C;  1C9F A;  4YTN B;  1QF6 A;  2KQ4 X;  2M0A A;  3AE3 B;  2Y5P A;  3W2D A;  1EWC A;  5C2T B;  1PFD A;  1XLQ A;  2I38 A;  1XLN A;  4RFB A;  1JCK B;  2QEJ C;  3NVW A;  3ZJV A;  4D2K A;  1V1P B;  3H8H A;  2CJN A;  3MC0 B;  1GOZ A;  3W5U B;  2OED A;  1F2R I;  2W3R A;  3B2F A;  5D3D A;  1OFF A;  1TS2 A;  1ZUD 2;  2N0S B;  1BUI C;  1E6E B;  1D6E C;  4PT5 A;  2YEP F;  1FXI A;  5HHD G;  5FR3 A;  3NS1 A;  3LB8 C;  1AWD A;  1XO3 A;  2EEL A;  1VJK A;  3SEB A;  2KAJ A;  1F77 A;  3ZYY X;  3NVZ A;  1VLB A;  2WXI A;  5HI1 A;  4ZHO A;  1C76 A;  3AEF B;  1ESF A;  5AUK A;  2JX5 A;  1T5X D;  1XXG A;  4REZ A;  2Q5W D;  2K0P A;  2PKO A;  1KRH A;  2CJO A;  2J42 A;  1HXY D;  1TS4 A;  3N9Y C;  5BMG A;  4C7Y A;  4HJG E;  1AW7 A;  3AEB B;  1WGK A;  1V8C A;  3BYT B;  1L6V A;  4JPS A;  4ITK A;  1I4Q A;  1K50 A;  1SB3 C;  2ACZ B;  3I57 A;  1KLG D;  2RMM A;  4HKQ A;  1SBB B;  1MVK A;  2WDQ B;  1QOA A;  4XWW A;  1C77 A;  2FBW B;  2J52 A;  1L4D B;  1FFU A;  1ZE3 D;  1RFK A;  2L1A A;  2IGG A;  2RPV A;  3NUH B;  1RWS A;  4GLS C;  3P1M A;  5BMH A;  3C8Y A;  1DOX A;  1N61 A;  1SE2 A;  4A8X C;  1KF6 B;  4KGT A;  2LUM A;  1IBX B;  3U52 E;  5BYR A;  3BVZ A;  1J7B A;  1I4H A;  1N60 A;  3AEC B;  1JAL A;  4HRS A;  4MH8 A;  2LEK A;  4WWM A;  2L32 A;  3NVV A;  1EWY C;  3AH7 A;  2AQ2 B;  3SFE B;  4YSZ B;  5LNK 1;  2JSV X;  4M0W A;  2IJ0 A;  1GPX A;  1JQ4 A;  2QJL A;  1DYQ A;  4IOI E;  4Q2J A;  2INN E;  2PLP A;  5TSS A;  5EE1 A;  1HA5 A;  2KMM A;  1VZ6 A;  2LGI A;  1ZXH A;  4RF1 A;  4AS1 A;  4YTM B;  1CZP A;  2Z8L A;  4HRO A;  3W5V B;  3MJ5 A;  4TQ0 A;  1SJE D;  2G1E A;  3E56 A;  4RH6 A;  2AQ3 B;  1JWM D;  2VZK D;  3BK1 A;  1WXQ A;  4JWU C;  1LO5 D;  4LLG M;  1QLB B;  3VQI A;  3P63 A;  4IKG A;  1ENF A;  1E9M A;  3RPF C;  3DWG C;  4MM3 B;  3AMZ A;  1I4R A;  5E6J A;  3T3O A;  3Q8C A;  2MH7 A;  1D5X C;  4UDU C;  4JX1 C;  1YN5 A;  1N63 A;  1RYJ A;  1J7C A;  1TY0 A;  4N6E B;  1STE A;  4YTP B;  2WXP A;  1XEE A;  3P4Q B;  3ZJT A;  1BXT A;  2WP9 B;  2WDV B;  4EE2 A;  1XLO A;  1KH0 A;  4HKZ E;  4MAC A;  1MI0 A;  1SF0 A;  1QT9 A;  2QMT A;  2W82 A;  1DGJ A;  2RDG A;  2WDR B;  2QIE B;  3AE6 B;  1IUE A;  1NI3 A;  3I9V 1;  3RFZ B;  2JQR B;  1SE4 A;  2WXJ A;  2BW2 A;  2MEK A;  4NAW B;  4TQ1 A;  1Q10 A;  3BZD B;  3NRZ A;  1I4P A;  1N5W A;  2WXG A;  1CJE A;  1E7P B;  2E6X A;  1GAQ B;  2KAC A;  1ACC A;  4XDC A;  1QKZ A;  1TZO A;  5AUI A;  5FKA C;  5I4D A;  3FAH A;  3AEE B;  2E3T A;  4A9A A;  1IGC A;  1IBX A;  1TS5 A;  4ZYS A;  2IGH A;  2IPK D;  2IDY A;  3FIL A;  4L23 A;  4C56 C;  1V97 A;  1ZPS A;  3CWI A;  2GI9 A;  2WXQ A;  3R2I A;  2JZP A;  4MT5 A;  1XF5 L;  1IGD A;  1YMH E;  1TY2 A;  2BB5 A;  2MJD A;  1Y56 A;  2RDH A;  5C3J B;  1GB1 A;  1C4P A;  1PYW D;  1I4G A;  1V1O A;  3P42 A;  3HVZ A;  1E0Z A;  4KGS A;  4ZOH C;  1JWS D;  1FMA D;  1JML A;  2W54 A;  1PUT A;  2I2Y A;  1L5P A;  1UWM A;  4OHJ A;  1XCQ L;  3PZ7 A;  3BK2 A;  3NVY A;  4XDD A;  2FUG 1;  1JWB D;  3TEZ A;  2PVG C;  3BVM A;  4ZRQ A;  4P16 A;  1I7H A;  4JE3 B;  4AQ7 A;  3AEA B;  3AE5 B;  4KGR A;  1TS3 A;  2PMV A;  3O13 A;  2WNM A;  2BB6 A;  2V4I B;  4WIP A;  1DOY A;  2WXN A;  4YXD B;  1C4C A;  1C79 A;  3EUB 2;  2DYO A;  2WXF A;  1D5Z C;  1D5M C;  1QOG A;  2Y3A A;  2WU5 B;  1BML C;  2K5P A;  5T8I A;  4OZB A;  2BS2 B;  4TMA B;  3R2T A;  1HQR D;  2ONQ A;  1OQR A;  1SJH D;  4JWS C;  1ZXI A;  4L2Y A;  1KTK A;  4OZC A;  1YQ3 B;  3ZGZ A;  3BVG A;  1FCL A;  3URY A;  1DOI A;  4P6V F;  2KWD A;  3SFD B;  3WCQ A;  1MHX A;  4L1B A;  3GS2 A;  1YJI A;  3BYY B;  4LK0 M;  3AB5 A;  4GDK B;  1K53 A;  4LTU A;  4C7Z A;  1YNT E;  1P7F A;  5EE3 A;  2DLB A;  2ZW0 A;  3Q8F A;  3HVD A;  1YJJ A;  4OW0 A;  1R7S A;  1WSP A;  2TSS A;  1C4A A;  4J3O D;  2WS3 B;  1TKY A;  1ET6 A;  3AE7 B;  1QOB A;  3LYY A;  4RF0 A;  1VZ7 A;  1CK1 A;  1V1P A;  3HUI A;  2ZW1 A;  1J7A A;  3AE4 B;  1NEK B;  1FIQ A;  3AE9 B;  1JW9 D;  3W9C B;  3V05 A;  3B9J A;  4XE0 A;  1EM7 A;  3Q8E A;  2WXM A;  3IT4 B;  4RCO A;  2SEB D;  1NYR A;  4OVZ A;  2VZK B;  3NZ3 A;  2NTS A;  3AN1 A;  3ZQ4 A;  1ET9 A;  1E10 A;  5G5G A;  3W1S A;  3GB1 A;  3SR6 A;  4DXG A;  2CU3 A;  1VDV A;  2D5G A;  3IT6 B;  3AED B;  1T6B X;  4YWG G;  2WU2 B;  1I4X A;  1JWA D;  1XCT L;  2QIL A;  4YSX B;  1QQR A;  1L4Z B;  1QOF A;  3AV8 A;  1N62 A;  4HEA 1;  2MJ3 A;  3IAS 1;  1RM6 C;  1L0X B;  3KLS X;  1B9R A;  4A6Q A;  2WXK A;  3P4R B;  4N58 A;  1OQQ A;  4NJC A;  2JWU A;  1M4V A;  5MPO A;  2PVO D;  3MHZ A;  4DQO C;  4WQM A;  2W3S A;  4O1N A;  2AQ1 B;  1HEZ E;  1FRR A;  2WXH A;  4RGN A;  2DBY A;  2MJE A;  3P4P B;  3Q8A A;  4R3D A;  2N9L A;  5HFY A;  2N9K A;  3U7Z A;  5G5H A;  2L52 A;  3AE1 B;  1TJE A;  3UI3 A;  2HDE A;  1EU4 A;  2WXO A;  1UWX A;  1JRO A;  1NVI D;  1L0V B;  1K51 A;  4YT0 B;  2K9X A;  1FO4 A;  1JRP A;  4KX6 B;  4XWT A;  3Q8B A;  3J9C A;  3KQ4 A;  4YSY B;  5EE9 A;  5FK9 C;  1L6U A;  4WH4 A;  3AEG B;  4KKJ A;  2BYT A;  1FRD A;  2LJI A;  3Q69 A;  3TEX A;  3IXS A;  1SEB D;  2IGD A;  2LMC A;  4FXC A;  2G9H D;  1ZP0 B;  2JU6 X;  3BII D;  1FCC C;  2KN4 A;  3B2G A;  1ZDV A;  4ARI A;  3KWV A;  3AE8 B;  2LFI A;  3KWL A;  1JWU D;  2V0G A;  2H88 B;  3AE2 B;  2XN9 C;  2JYT A;  5D7G A;  2GB1 A;  4H2A A;  1KLU D;  2INP E;  3E9S A;  2DYM A;  3V3X A;  4RGT A;  1QIL A;  3ABV B;  3EGR A;  1HZ5 A;  4US9 A;  4IDI A;  2PIA A;  1P7E A;  2KDM A;  1FNV A;  2M19 A;  2BBC A;  3MP9 A;  3PO0 A;  2H89 B;  4WUR A;  1PGA A;  2ICI A;  4OZA A;  2HTM E;  2LHE A;  5GXG B;  4CQN A;  2X38 A;  2WLB A;  1K52 A;  1ZOY B;  1UNS A;  1YN4 A;  4RGM A;  1KFY B;  2AX5 A;  5JXV A;  1T3Q A;  3HRD D;  2K22 A;  3R8B A;  2N7J A;  3ETR A;  4NZL B;  3IAM 1;  4DXF A;  1FM0 D;  2BTE A;  1SXT A;  2Y5C A;  4TSS A;  1UUP A;  1FFV A;  2B76 B;  4RNA A;  1C78 A;  1F2R C;  1MHH E;  2JXT A;  2PW9 A;  1SE3 A;  5HG2 A;  4US8 A;  1NYQ A;  1WRI A;  4RGO S;  5EE0 A;  1A70 A;  3T3N A;  4B0E A;  4ZRP A;  1L0Y B;  1NEN B;  1TKE A;  2EKI A;  2BS4 B;  3VRB B;  2FE8 A;  4NAM A;  1CQV A;  1D4B A;  4GDL B;  1FNU A;  2WXR A;  3U4E G;  1VZ8 A;  3MFG A;  1EU3 A;  1TKG A;  3FIL B;  2WQY B;  2LHD A;  2V3N A;  3AM9 A;  2GRI A;  3TEW A;  4KKI A;  1SIJ A;  5H8Y E;  3VRA B;  2OHF A;  4A90 A;  3GP7 A;  1FNW A;  3L4P A;  1YQ4 B;  4C80 A;  1AYF A;  3EA6 A;  3OWE B;  1FEH A;  3FC4 A;  4ZHP A;  2PTL A;  3DWM A;  1WWT A;  2QSD A;  5BYS A;  3CIR B;  4ARC A;  3BWU D;  2SAK A;  3VR9 B;  1PGX A;  1N5X A;  1PGB A;  2W55 A;  1AN8 A;  1PDX A;  3ZJU A;  1YN3 A;  1VR9 A;  4N59 A;  2NTT A;  1HZ6 A;  1VRA B;  2J4X A;  4WAF A;  1UGJ A;  2BS3 B;  4B0M A;  2ON8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...