1GPXA

C85s gapdx, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLSCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PUTIDAREDOXIN
publication title The solution structure of a gallium-substituted putidaredoxin mutant: GaPdx C85S.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 14
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gpxA00
1WWTA 1AWDA 2BS4B 5EE1A 1YJJA 3NVZA 4IDIA 5AUKA 5C2TB 4YSYB 2MH7A 2W54A 1FXIA 3B9JA 3AE5B 4HROA 4ITKA 2K9XA 3KWLA 2M56B 2W3RA 3VRAB 1QOBA 4KX6B 3HVZA 4YSZB 1R7SA 2MJ3A 1UWMA 5EE3A 1JWBD 1V97A 4N59A 5GXGB 2DBYA 2CJOA 1XLOA 2WU5B 3AE2B 3AB5A 1OQQA 4YTNB 3AEBB 1XLPA 3CWIA 2WU2B 3NS1A 3W9CB 4ZHOA 1FO4A 1N62A 3ZYYX 3FAHA 4LTUA 3P4SB 1WGKA 2L52A 3SFEB 5G5HA 1J7CA 1NYQA 1JW9D 1YQ3B 1E7PB 1DOYA 5G5GA 1EWYC 1RYJA 1KFYB 3AE7B 1YQ4B 2PIAA 3CIRB 3DWMA 3VR9B 3WCQA 2QJLA 3B2GA 3SFDB 1CJEA 1V8CA 3ABVB 2CJNA 2K5PA 1VJKA 3L4PA 1FIQA 4FXCA 1FFUA 4US8A 1QOAA 1KF6B 1SF0A 3W5UB 3P4PB 1I7HA 3AE1B 2WDRB 1ZUD2 1J7AA 1TYGB 1JALA 3AEFB 3BIID 2DWQA 4WWMA 3AEDB 4A9AA 1NEKB 2K22A 4HRSA 4JWSC 2L83A 1GPXA 1RFKA 1TKEA 3P4QB 3HRDD 1TKYA 2E3TA 3NVWA 1WRIA 2MJDA 3AV8A 1PDXA 1WXQA 1XO3A 4WQMA 5EE0A 3LB8C 3NRZA 1ZXIA 5H8YE 1QOGA 1XLQA 2JX5A 3B2FA 1NVID 3AEEB 3DWGC 2W3SA 2KMMA 3AE8B 1JROA 2EKIA 1NI3A 4C7ZA 4ZHPA 1FMAD 4JX1C 5MPOA 2ACZB 1E10A 2WDVB 3AH7A 3W5VB 2JQRB 1J7BA 1QOFA 1SIJA 2Q5WD 2KAJA 1RWSA 4US9A 2BT6A 1PUTA 2FBWB 4JWUC 4YSXB 1KRHA 4C80A 2LEKA 2QIEB 3AE6B 1TJEA 1VLBA 1L0VB 2H88B 3AE3B 3VRBB 3P4RB 1OQRA 1RM6C 2N0SB 3AE9B 1QLBB 1NENB 1T3QA 3AECB 1N60A 3AN1A 3FC4A 3NVVA 3P1MA 1JWAD 2H89B 4USAA 1ZOYB 3AEAB 1DOIA 2WP9B 1E9MA 1XLNA 3PO0A 4P6VF 1FM0D 5H92C 2W55A 1JQ4A 2PVGC 1JRPA 2G1EA 1F0ZA 1CZPA 3SR6A 1DGJA 2WS3B 2B76B 3RPFC 1N63A 4YTMB 1B9RA 1L6UA 3AMZA 1FRDA 2OHFA 3AEGB 4YXDB 3NVYA 1IUEA 5EE9A 4ZOHC 2CU3A 3LXFA 1FXAA 1YJIA 3HUIA 4YT0B 1A70A 1L6VA 2HTME 1DOXA 1ZP0B 2WQYB 4N58A 1NYRA 2PVOD 3P63A 4C7YA 1N61A 2BS3B 3AM9A 1PFDA 1WYGA 2M19A 2WLBA 4N6EB 5AUIA 1QF6A 1FFVA 3ETRA 1N5WA 1QT9A 4YTPB 1FRRA 2PKOA 2AX5A 1N5XA 1TKGA 1GAQB 1VDVA 1OFFA 2MJEA 1L5PA 1SB3C 3EUB2 2BS2B 3AE4B 3VR8B 1E0ZA 5C3JB 1ROEA 2Y5CA 2WDQB 1E6EB 1AYFA
chains in the Genus database with same CATH superfamily
2KN5A 4PT5A 3OJ3A 3SEBA 1XXGA 2J0KA 2NTSA 4GLSC 2K0PA 1K8RB 1LGRA 4NQKE 1MJDA 4AJYB 1XLPA 2WDTB 1HTOA 4DXFA 2KKCA 4KSLC 2HJ8A 1D3ZA 2RPVA 2LGXA 5L83A 4C4VB 3QWZB 5DPSA 1K53A 2ZNVC 4L2YA 3ZQ4A 1WE6A 2KYWA 2BYFA 1TYGB 2BYVE 2K22A 4GB9A 2YEPF 1TKEA 1SE9A 1XCTL 1PDXA 4MGIE 3MHZA 3QJZA 4CO7A 2KOXA 5MPOA 1AW7A 3W5VB 2JZZA 3AE3B 2IO3B 1TTNA 4C56C 2KTFA 3AXCA 4USAA 4AQ7A 4MGZE 3KYCD 1D4BA 3W1SC 1QILA 2YLMA 3DDCB 4MACA 1R4MI 3NVYA 3A1QB 3R66C 4JIOU 2PW9A 1L7YA 5LXIB 3LXFA 1WJNA 1A70A 2BBCA 3A9JA 1C4PA 2M19A 4N6EB 3PPAA 2FCSA 3DBHI 2IGDA 3NG0A 2MJEA 3AE4B 2WDQB 1E6EB 3VUYA 2VRRB 4II2B 2W3RA 3H7SA 3ZRCA 1QOBA 1UNSA 1UELA 1LXDA 4XWTA 2V3NA 4BVUC 3VUWA 2E6XA 3A1QA 3CF6E 2KWCA 4LNIA 2R2OA 2ZEQA 2DYMA 2KANA 3VTUA 4ANXA 4JGHB 2NVUI 4YTNB 2OJWA 3PRMB 3ZXVA 1HZ5A 1EWYC 2TSSA 3OJ4B 2JT4B 2QJLA 3B2GA 3UF8A 4WWPA 2CJNA 1VJKA 1HEZE 2GB1A 3UI3A 3D32A 1C3TA 3BK1A 1TZOA 3X0WA 3RN9C 1WR6E 2KQ7A 2C9WB 2WXPA 1JCKB 2K1FA 2DHZA 3LB8C 3M62B 1XD3B 3PZ8A 1WGYA 2LGSA 4PS3A 2ZVOA 2LGIA 2W9NA 3ZO5B 2Y5PA 3W2DA 2NPTB 2KZRA 1TJEA 1VLBA 4IKGA 2N0SB 1WXSA 2MBBB 3IHPC 1DOIA 5IP4D 1XLNA 2PVGC 2AYOB 4A3OA 1SIFA 2WS3B 3ALBA 4ICVA 1Q0WB 1GC6A 2AL6A 4ZOHC 4UDUC 3RNAC 1DYQA 1DOXA 5IN7A 2DAFA 4PS8A 3UQBA 2REXA 2KN4A 4W9DA 4W9EA 1T0RC 1OFFA 2MRPA 2JWUA 5CHVC 3FKYA 5D3DA 3H1UA 1T0YA 1FXIA 3GE8C 4W9FA 1I4PA 3DVNV 3APFA 1V2YA 5AZGA 1R4NI 2C60A 1F1HA 2FE8A 1IP9A 4MJSB 3PS6A 1Q10A 5TSSA 2PIAA 2IDYA 3PZ7A 3B0AA 1MPEA 4KIKA 3QA8A 3RULA 2N9LA 2N9XA 2JRIB 2K39A 2Z0EB 1KF6B 3P4PB 4HPPA 3KH0A 1L0YB 2C5LC 3AE1B 1MHHE 1HE8A 4KSKC 3I9V1 3Q8BA 1UZXB 1RFAA 1TZ1A 2NTTA 2KT7A 2V3SA 5BMHA 1GB4A 2GBRA 3Q8AA 1E8WA 4MT5A 2L76A 1NVID 2EKIA 2DX5B 1KJTA 4I6PA 3U52E 2C7HA 2V1YA 3ZJTA 1STEA 4J6IA 4HJGE 4QAYA 3NUHB 4TQ1A 2INDC 1MVKA 2LVPA 3P4RB 4GOCA 3Q3FA 5LNK1 1GG3A 1WGDA 4LDTD 1ZOYB 4ZRJA 2DYOA 4FJVB 4M01A 5H92C 3WAPA 1JRPA 2D10A 4FHKA 5DPRA 1F0ZA 2MEKA 3GE3C 3RCZA 2WXKA 4HEA1 3PREA 1FNUA 3MJ5A 1L6VA 4B0EA 4XX5A 2BS3B 5HI1A 2DYBA 1EWCA 2D3AA 2KXJA 1Q1OA 4P1BC 4K7UA 3J9CA 5D94A 3HVZA 4OW0A 1V1OA 5L95C 2ZJDA 3FILB 2G9HD 5JXVA 2EELA 2BKFA 3GZNB 2M4NA 4GXBA 3Q8FA 4M0WB 3SFEB 1J7CA 1WRDB 3CSTA 1YQ3B 2MBHA 3ZXRA 5G5GA 4P1CC 3AE7B 3VR9B 1WZ0A 3P2BA 2O6VB 3QX1A 2V4LA 2AQ2B 1SF0A 3L08A 2GBNA 3N1ZC 1MHXA 2GI9A 3NZ3A 2KHWB 2L0TA 2CHXA 1KOTA 3EGRA 5BMGA 2PE6B 3ZTCA 4K7SA 3ONSA 1ZXIA 2KMAA 2JX5A 4W9LA 4LNOA 2BYTA 4C7ZA 4KKIA 4M0WA 1FMAD 4JX1C 2ACZB 2JQRB 4US9A 2NBUA 1PUTA 2NR2A 2O6VA 2JSVX 5HG2A 2KD0A 5AZHA 2ZZPB 3H7PA 2IJ0A 3SHQA 1V6EA 4DQOC 3IVFA 3PTFC 3OG5A 4FJZA 1WF9A 3X23A 4AP4C 1WM3A 2QEJC 1E8XA 1ZP0B 2UYZB 2WQYB 1WH3A 2FIDA 2LVQA 5E6OA 1GOZA 1Y8RC 4A20A 3N30A 4TSSA 3WIMA 1I4RA 1V1PB 5J2RA 3UINB 3SDLC 1L5PA 2BS2B 1ROEA 5EE3A 2LGYA 1YN3A 2J7QB 3AU5A 3RUIB 4LLGM 2KX0A 2GOWA 4S17A 3PVLA 3EFUA 1WGHA 4KDLB 2GBJA 4CHKA 4GDKB 4DHJB 5G2NA 2PJHA 2WHIA 2WU5B 4KZ0A 3NHEB 4NJ6A 4F7ZA 3R2TA 3IBEA 2N7JA 5G5HA 1V1PA 4KKJA 2MWSB 4XDDA 3K9OB 2IGHA 4DBGA 1P9DU 5G55A 3U2SC 2JXTA 1F9JA 2D3BA 2KTRB 3W5UB 2FCMA 1M94A 3VH3B 2WDRB 3APCA 2RR9A 2DWQA 1RFKA 4LK0M 3V62A 2INNE 2JVCA 3HRDD 4NAWB 2CR5A 2DLBA 2QMTA 1P0RA 1V80A 4OVVA 3HM6X 4RH6A 3DBLB 2WWZA 1GB1A 4WIPA 5DPTA 4DWFA 5LLIA 1TBEA 1QOFA 5IA7A 3WA0A 3NZSA 1WSPA 4RM8A 2BTEA 4EE2A 1OQRA 4FXCA 4M8MA 3WAOA 1JWAD 2L32A 3ZGZA 3PO0A 3PZDA 1FM0D 2V0GA 5HKHA 4W9CA 1H8CA 3TEXA 1P7FA 4LNKA 5IKCM 2SEBD 3RT3B 2LHEA 3EC8A 1ENFA 3ZNGC 2HTHA 1D5XC 1WX8A 4BBNC 1L0XB 5D7GA 2MQJA 3DBSA 3JVZX 2K8CA 1VCBA 5C23A 1E5WA 3RNBC 3RZWC 4ICUA 2V9HA 3ZRFA 4S0RA 2LHDA 2KWVB 4I6NB 3B9JA 4BKTA 3BY4B 1WMHB 4I6LB 3MC0B 1B1ZA 1XEEA 1PGBA 3EECA 3KUCB 1XLOA 2BGFA 3DBRI 3P42A 1OQQA 1Y56A 3NJTA 1WZ3A 3H6NA 4ZRKA 1PGXA 1C4CA 3ZDTA 4FN2A 4F8CB 2K6DB 5HFYA 1UD7A 2KWDA 2WXNA 3L4PA 1WR1A 2MBEA 2A5UA 3VDZA 1MG4A 1UUPA 3QAQA 1WMHA 3VHTC 4Q2JA 2JRHA 1XQQA 1ZUD2 2FUG1 4LNFA 4JWSC 2L83A 3P4QB 1HTQA 5I4DA 2WXLA 1BT0A 3AV8A 4HKQA 3T3NA 3AEEB 4TMAB 2I2YA 3VAWA 3IXSA 4LNNA 4DDID 4TV3A 2EMTA 3V6CB 4YSXB 4B9KA 1CQVA 2WX1A 1LFDA 2LJ5A 1ZW7A 4NQLB 1EF5A 5JH5C 2Z8LA 1SE2A 5E6PA 2I1JA 5TR5A 3ZJVA 1GC7A 2DZIA 3I63C 1SE4A 1ZXHA 1ISNA 2D11A 3RZFA 3A9JB 3VTWA 1U4AA 1D6EC 4II3B 5CTRC 1UF0A 4B6WA 1TY0A 4HDOA 2R61A 1E90A 1WJUA 4HPMB 2BQQA 5IOIA 3EUB2 1E0ZA 2JF5A 3PSEB 2DZKA 4HCNB 2AEHA 1WWTA 3DVGX 2BW2A 3TEYA 4YSYB 4EFOA 4ARIA 3JW0X 3V6EB 2V3PA 1XT9B 4OHJA 3GOEA 4ZRQA 3QC8B 4BBNF 1V49A 2BB5A 3LDZE 4N59A 4BOZB 2WX0A 3AEBB 3P4SB 1ESFA 2ZCBA 2BB6A 2ZVNA 3LYYA 4A6QA 1V5TA 1E8ZA 3SFDB 1V8CA 3V61A 1SXTA 3M3JA 1KLVA 4IM3A 3BVMA 1GJZA 3H8HA 2PE9A 3ZDMC 2IY0B 3KYDD 1WXQA 2BF8B 4WQMA 5EE0A 3NRZA 4DHZB 2N4FA 3B08A 2D5GA 2V4IB 2GMIC 1EU4A 1G6JA 3E9SA 1RWSA 4RMAA 3R7QA 4IW0A 3NS8A 3A33B 1P98A 4EKUA 1LO5D 2VZKB 1JMLA 4WAFA 4E74A 1DGJA 2QILA 4JL9A 2WXGA 4DHJD 2L0FA 3DPDA 1YJIA 2AWTA 2WXFA 4W9KA 1E7UA 4LJPB 1FFVA 2JZ3B 2B3AA 5EE1A 3RNGC 4ZRPA 2W54A 1OTRB 2ZPNA 4XDCA 2J52A 3A4RA 2KVRA 2A4ZA 1UWMA 5BYQA 2JXXA 3WALA 2L7RA 4DDGD 3AE2B 4H2AA 1H4RA 4MSMB 1ET6A 2L1AA 3ZYYX 1DOYA 4G3XB 3R7RA 4KIKB 1QQRA 3HIZA 1V81A 2ZPYA 2KDBA 1XF5L 1D5ZC 1YX5B 4MGKE 4XYCA 2X38A 5D6JB 1Q5WB 2MX2A 3I3TB 3PRPB 4G0NB 4HXDA 1TS3A 4L23A 4IG7B 1NEKB 1SEBD 3TEZA 4HJKA 2MHJA 3MP9A 1UBIA 1HQRD 4PYZA 5DCNA 4PK1A 3NOBA 3AH7A 4BZAA 3Q8CA 4WJPA 4ANWA 3KLSX 1KRHA 4C80A 3VQIA 2LD9A 2KDFB 3AE9B 3DQVA 2VH1A 3KUZA 4HCPB 4RGOS 2WXOA 1JQ4A 2BYEA 4HDQA 3AMZA 1YIWA 5J17A 2XN9C 1ZKHA 2QSDA 1K50A 2IPKD 1FCCC 3QQ8B 3BYYB 2R2QA 3ZUNA 1YN4A 3VFKA 2KVZA 2PKOA 2N7EA 1R4MB 1VDVA 3VR8B 3AI5A 2BS4B 3NVZA 2LXAA 1F52A 2M56B 3DBLI 4KX6B 1ACCA 3C8YA 2K6QA 2QDFA 2WXHA 3UQAA 3TIXA 3DBHB 3PLUA 2IO1B 1V5OA 4KV2A 2BWES 3IG3A 3ZTDA 1E7PB 1YQ4B 3CIRB 1BMLC 1C4AA 5FK9C 1CMXB 1IGDA 2KFKA 3T8MA 1VD2A 2L05A 2L3ZA 2RD0A 3ML9A 4A9AA 1GPXA 4ZDVA 4JQWC 3W1SA 3N20C 3PGEA 2MJDA 3TCAA 4NNJB 3VH4B 1A5RA 3E56A 3DWGC 3EA6A 1VZ6A 2KAJA 1IBXA 3H7PB 4NJ7A 5D2MB 3Q69A 3P1MA 1EUVB 2INCC 3MC9A 1LM8B 3IAS1 1VZ8A 2O2VB 3ZW3A 1V9JA 4DHZE 2ZW1A 4EUTA 2W82A 2XK5B 2LRUA 4IWOA 2INPE 2BPSA 2HTME 1J0GA 3MJWA 4NAMA 4IUMB 1WGRA 1TS5A 3MC8A 1D5MC 1NDDA 3KUDB 4GDLA 1N5WA 4P16A 3UGBB 4YTPB 4PS7A 1TKGA 3B1LX 3UIPB 4JE3B 1WY8A 1YJJA 1WYWB 5AUKA 4F1SA 3KWLA 2O2VA 1C79A 2NS5A 3CMMB 2G45B 2XK5A 4DK5A 2GBMA 3N32A 1JWBD 4AS1A 4NPNA 1PGAA 3CWIA 2AQ3B 1KLUD 4OZCA 3ZNZB 2L52A 4NZLB 1WX9A 2DNFA 4D2KA 4RF1A 4GU2A 2N9EB 3N3KB 1IYFA 2VZKD 2ZW0A 1JALA 4HRSA 3DHHC 2WXIA 1T0QC 1P3QU 2KJHB 2JUOA 1JWSD 1PQSA 3DVNU 2FCNA 3ZIMA 2LASA 3Q3JA 1QOGA 3UIOB 1ZPSA 4XGAB 3M95A 4GIVA 2KMCA 5JHAA 4XWWA 4FBJB 1Z2MA 2M17A 3C19A 2QIEB 4FHJA 1L0VB 2KQSA 2ZCCA 2CS4A 2FAZA 1L2NA 3FC4A 1JRUA 2WP9B 3O13A 1BUIC 4JLCA 3ZNID 2B76B 1N63A 4W9JA 3ZKJC 2AQ1B 4E3CA 3OWEB 3VUXA 4WJQA 3QCAA 5E6NA 1TIFA 5IAAC 2LMCA 4B0MA 1AN8A 1WX7A 1PFDA 1QF6A 1MI0A 2IZVB 2X8XX 1YOVB 3AULA 3LJ3A 2AX5A 4BOSC 3QARA 4RGTA 4HKZE 2ICIA 1KM7A 4K3CA 2NCNA 1J19A 2MBOA 1TS2A 4CYEA 1CK1A 4IDIA 5C2TB 4HROA 3EFCA 1R7SA 3KW5B 2FCQA 2Y3AA 1C76A 3BVGA 4HPLB 3JSVB 1YJ1A 4BFRA 3NS1A 2KLGA 1FO4A 4M02A 3FAHA 4KGSA 2MSED 1YMHE 3Q3OC 1SJED 4AUQC 2K5PA 2J42A 4CQNA 3U7DA 4EOYA 1HA5A 2MLBA 3IT6B 3O65B 3BIID 4WWMA 3PT2B 3BVZA 3AEDB 2KLCA 2HDEA 1MG8A 5CHWA 2E3TA 3JSVA 4BKSA 5C1ZA 2WXQA 3VTVA 2MA9B 2RPQA 3B2FA 1HXYD 1KLGD 2K8BA 2KMMA 4WAAA 4DXGA 4RFBA 2BT6A 3HK0A 3PHXB 1I4HA 2RSUA 1T3QA 3TBLD 4WWNA 1BXTA 1E9MA 4GN1A 2L8JA 2LGDA 3SR6A 4EEWA 3PLVA 4LCDE 4LDTB 1F2RC 4YTMB 1FRDA 2D2QA 5KHQA 4GSWA 4MDKE 3AEGB 5D3IB 3GP7A 5FR6A 2PPHA 4A3PA 1FXAA 4B95A 1K51A 4IC7B 4C7YA 2LJIA 4R3DA 1JWUD 3CSFA 3RNCC 5BYRA 3ETRA 2VH2A 1QT9A 1UGMA 1F2RI 2IO2B 1N5XA 1I4QA 2IO0B 3HVDA 1I4XA 2M1MA 4XC2A 3RNEC 2WXRA 2RGFA 1T6BX 1RRBA 4WH4A 1IGCA 3N1XC 1WJ6A 3L0WB 2LUMA 4ANUA 2CJOA 5BO4B 1C9FA 2WU2B 4OZAA 1LQBA 1S1QB 2N7DA 5FKAC 2O6VD 1Z5SB 3V05A 4MSQB 2LXCA 4MH0E 1WIAA 3EHVA 4AOFA 4XE0A 2IBIB 1FIQA 4C4VA 1IPGA 2D07B 3I57A 2MCNB 5DPWA 2M0XA 1C77A 2G4SA 3NVWA 1WRIA 1XO3A 3TJPA 1I4GA 3R3MA 2QC8A 3U4EG 3I5JC 3RI7C 1OGWA 2W3SA 1L4ZB 1T5XD 4ZHPA 1MFWA 2LZ6A 2Q5WD 1X1MA 2J0JA 4L1BA 2LEKA 1OQYA 3MFGA 3AN1A 5BYSA 1QLBB 2KJ6A 2QHOA 3M63B 2FNJB 3T3OA 1OEYJ 2H89B 4P6VF 1RAXA 4X57B 3ZJUA 3BK2A 1KH0A 1C78A 4YXDB 1IUEA 1WGGA 2K3UA 2YEPB 2WXMA 5GMVA 3AU4A 4WQOB 4EZLA 2MP2B 3Q8EA 4HVBA 2IGGA 2LUEA 4RGNA 2HD5B 2NBVB 4NY0A 3HHMA 2FUHB 5E6JA 1SB3C 3GZNI 4US8A 1FEHA 2N1WA 3PRZA 4EZJA 4G11A 1I35A 2LRWA 2G4DB 2MBQA 1ZDVA 2DBYA 1PYWD 2SAKA 2MP2A 5JHBA 3PHWB 3BWUD 2KO3A 1GUAB 1JW9D 1WFYA 1RYJA 3DVGY 2HE7A 3VVWB 1CJEA 1YD8U 2DZJA 2KQ4X 4NJCA 1NI2A 4JPSA 4FULA 3H9DA 2GRIA 3DBRB 4A90A 3R2IA 4WURA 1WJ4A 3N1YC 4FJYA 1FPYA 4WJOA 2G3QB 4BKGA 1WI0A 1P7EA 5H8YE 2BVCA 3V60A 2J4XA 2ASQA 1JROA 4YWGG 2WDVB 1SIJA 2OEDA 1VZ7A 2PTLA 3SU8X 3ZLZA 3VRBB 1E10A 3AECB 2N9PC 1EU3A 2NPTA 3NVVA 1EF1A 2JU6X 4ARCA 4N9F4 3WAMA 2JWZA 1FD6A 2XEWA 1CZPA 4W9GA 3L13A 1WXVA 3ZNHB 3JYUA 4YT0B 3HUIA 3MTNB 2I38A 4BKSD 2KDMA 2ON8A 1NYRA 2PVOD 3L17A 4RF0A 3RMKC 2ONQA 2WLBA 1XCQL 2D3GA 2CKHB 1NBFC 2KC1A 2UWQA 1UWXA 1GAQB 2KNBA 1SJHD 2ZNVB 4IOIE 1YX6B 2XBBC 4ITKA 3AE5B 4BAXA 4XZ4A 4RM9A 3OAWA 4TQ0A 4ANVA 2QCZA 2IY1B 2LFIA 2MW5A 2L00B 1F77A 1ZGUB 2D3CA 2Z0DB 3AB5A 2LVOA 3IFWB 1V86A 3R8BA 3QIJA 2J53A 3Q2AC 4KGTA 4MJSA 1WGKA 2KFKB 2KFJA 3WCQA 1HZ6A 1FNVA 2CHZA 3PV1A 4KVGB 2M0AA 3BZDB 5HHDG 1FCLA 3L10B 2N1VA 4TKNA 4ZYNA 3RNFC 4M8NA 1TKYA 4OVUA 3T9LA 2JZPA 1XLQA 4IWPA 3NY5A 2JPHA 2NBWB 2GBKA 3Q3NC 1IBXB 5LXHA 4K7WA 2EKEC 2FBWB 1M4VA 2KWUB 1J8CA 3AE6B 2H88B 2UU7A 3NZUA 1TGZB 1FXTB 1YQBA 4AJWA 4URKA 4HWIB 1B9RA 1L6UA 1UBQA 4HK2A 2FIFA 4OVZA 3TSSA 4MM3B 3SD5A 3A4SC 2CU1A 3URYA 2PMVA 3P63A 4GDLB 1GNUA 1WYGA 4PYUA 1FRRA 3DHGC 1VRAB 5CHFA 5C3JB 1AYFA 1AWDA 4C00A 1I42A 4ASWC 3C0RB 3VRAB 1T0SC 4YSZB 1K52A 3HM3A 4K1RB 3TMPB 4MH8A 2PEAA 4OZBA 4ZYSA 3TEWA 2DENB 2BKRB 3A9KB 1SGHA 4IM2A 4KGRA 4MM3A 3KVFB 3FILA 4TUUA 2GLSA 2DZMA 4MEMA 2JY6A 2C7MB 4ZHOA 3DOWA 4LTUA 1WXMA 3GB1A 4M00A 1KFYB 5FR3A 3DWMA 2IYDB 2OJRA 5EDSA 5IO9A 2M8SA 1E8YA 2KACA 1P1AA 2Y5BB 1FFUA 4REZA 5J18A 1EM7A 3DHIC 3ML8A 2K8HA 5KHOA 1J7AA 1KTKA 3AEFB 1TY2A 3QK0A 4KZCA 3A9KA 3KWVA 2Z59B 4MELA 3W1YA 4LJOB 4E71A 1NI3A 2C7NB 5AZFA 3TL5A 1S3SG 3RD2A 4IM0A 2WGSA 1J7BA 1FNWA 4JWUC 1R4NB 4FADA 2XNAC 1JWMD 2KX3A 4P7IA 1RM6C 3Q14C 3U30A 3ZVVA 2W55A 1QKZA 1TS4A 3ENEA 4J3OD 3V3XA 2OHFA 1UGJA 4HLEA 2RDHA 2JYEA 3K9PB 4GMVA 1YNTE 1TT5B 4ZRIA 3WANA 2PLPA 4WJNA 4IWQA 1WXAA 3L16A 4RNAA 2WYQA 4FLHA 2KDEB 4KDIC 5T8IA 1E7VA 3MHSD 2I1KA 3OLMD 4RGMA 2LI5A 2KJRA 3RYTA 2LWPA 1OEYA 1VR9A 1SBBB 1UH6A 3N9YC 5AEKB 2MH7A 1WM2A 2K9XA 1C1YB 3U7ZA 5BMIA 2MJ3A 2YVCA 4W9HA 1V97A 3Q6BA 4G50A 1AARA 1RLFA 4RCOA 3VXWA 4MGYE 5JZEB 4GDKA 3W9CB 2N9KA 1N62A 4WWOA 1NYQA 1YN5A 3L54A 4DXAB 3ECIA 2RMMA 1EO6A 2EMSA 4GGQA 3ABVB 2DAJA 1QZEA 2JYTA 2BWFA 1QOAA 4FA6A 1I7HA 1ZE3D 2KTRA 1ZDXA 3U8ZA 3RFZB 3DCGA 2J0MA 3S2AA 2KK8A 2AL3A 1SE3A 2K25A 4NAWA 4AWJA 2WXJA 3AE8B 2NMQA 2CHWA 4YL8A 2WNMA 2KDIA 1L4DB 3BYTB 5GXGB 1NENB 2HJ1A 1N60A 5CX3A 1N6ZA 3AEAB 3BINA 3TUOA 2G1EA 4K81A 3RPFC 3Q3MC 4EZKA 5EE9A 4ACFA 2RDGA 1WE7A 2CU3A 4A55A 3QHTA 3GS2A 3APDA 4N58A 1N61A 3AM9A 5AUIA 3IT4B 2OOBB 4A8XC 2RDBC 4O1NA 1SSNA 2KC2A 4K3BA 3KQ4A 4W9IA 2Y5CA 3IAM1 1ET9A
chains in the Genus database with same CATH topology
2BS4B 1FEHA 3NVZA 4PT5A 1YN3A 3SEBA 4LLGM 1XXGA 2M56B 2NTSA 4GLSC 4KX6B 2K0PA 1ACCA 3C8YA 2WXHA 1ZDVA 4GDKB 2DBYA 2WU5B 1PYWD 2SAKA 1XLPA 4DXFA 3R2TA 3BWUD 2N7JA 5G5HA 1JW9D 1E7PB 2RPVA 1RYJA 1V1PA 1YQ4B 4KKJA 3CIRB 1BMLC 1C4AA 4XDDA 5FK9C 2IGHA 1K53A 1CJEA 4NJCA 2KQ4X 1IGDA 3U2SC 4L2YA 2JXTA 4JPSA 3ZQ4A 3W5UB 2GRIA 4A90A 3R2IA 4WURA 2WDRB 1TYGB 4A9AA 2DWQA 2K22A 1GPXA 2YEPF 1RFKA 4LK0M 1TKEA 2INNE 3W1SA 3HRDD 1XCTL 2MJDA 4NAWB 1PDXA 1P7EA 2DLBA 2QMTA 3MHZA 5H8YE 3E56A 2J4XA 4RH6A 3DWGC 3EA6A 1GB1A 1JROA 4WIPA 4YWGG 1VZ6A 5MPOA 1AW7A 2WDVB 3W5VB 1QOFA 1SIJA 2OEDA 2KAJA 1VZ7A 2PTLA 1IBXA 1WSPA 3AE3B 3VRBB 2BTEA 4C56C 4EE2A 1OQRA 1E10A 3AECB 4FXCA 1EU3A 3Q69A 3P1MA 3NVVA 1JWAD 2JU6X 2L32A 4USAA 4ARCA 4AQ7A 3ZGZA 3PO0A 1FD6A 1FM0D 2V0GA 3IAS1 1CZPA 1D4BA 1QILA 1VZ8A 3TEXA 1P7FA 4MACA 2SEBD 2LHEA 2ZW1A 3NVYA 1ENFA 2W82A 2PW9A 2INPE 1D5XC 3LXFA 4YT0B 3HUIA 1A70A 2HTME 2I38A 1L0XB 5D7GA 4NAMA 2KDMA 2BBCA 2ON8A 1NYRA 1TS5A 2PVOD 4RF0A 2ONQA 1C4PA 2M19A 2WLBA 1XCQL 4N6EB 1D5MC 1N5WA 4P16A 4YTPB 1UWXA 1TKGA 1GAQB 1SJHD 2IGDA 4IOIE 2MJEA 3AE4B 4JE3B 2WDQB 1E6EB 2LHDA 1YJJA 5AUKA 4ITKA 3B9JA 3AE5B 3KWLA 2W3RA 1C79A 1QOBA 1UNSA 3MC0B 4XWTA 2V3NA 4TQ0A 2E6XA 1B1ZA 1XEEA 1PGBA 2LFIA 1JWBD 2DYMA 1F77A 1XLOA 4AS1A 3AB5A 3P42A 1OQQA 1PGAA 1Y56A 4YTNB 3CWIA 2AQ3B 1KLUD 3R8BA 4OZCA 2J53A 4KGTA 1WGKA 1PGXA 2L52A 1C4CA 1HZ5A 1EWYC 2TSSA 5HFYA 3WCQA 1HZ6A 2QJLA 3B2GA 1FNVA 4NZLB 2KWDA 2WXNA 2CJNA 3L4PA 1VJKA 1HEZE 2GB1A 4D2KA 4RF1A 3UI3A 2M0AA 1UUPA 1TZOA 3BK1A 3BZDB 5HHDG 1FCLA 4Q2JA 2VZKD 2ZW0A 1ZUD2 2FUG1 1JALA 4HRSA 4JWSC 2L83A 2WXPA 1JCKB 2WXIA 3P4QB 1TKYA 2WXLA 5I4DA 3AV8A 1JWSD 2JZPA 4HKQA 3LB8C 3T3NA 3PZ8A 1QOGA 1XLQA 1ZPSA 3AEEB 4TMAB 2LGIA 2I2YA 1IBXB 3IXSA 4XWWA 2Y5PA 3W2DA 2FBWB 1M4VA 4YSXB 1CQVA 2QIEB 3AE6B 1TJEA 1VLBA 1L0VB 2H88B 4IKGA 2N0SB 3FC4A 1DOIA 2WP9B 1XLNA 2Z8LA 3O13A 1BUIC 1SE2A 2PVGC 2WS3B 2B76B 1B9RA 1N63A 3ZJVA 1L6UA 2AQ1B 1SE4A 1ZXHA 3OWEB 4OVZA 3TSSA 4ZOHC 4UDUC 2LMCA 4MM3B 1DYQA 1D6EC 1DOXA 4B0MA 3URYA 2PMVA 3P63A 1AN8A 1TY0A 4GDLB 2R61A 1PFDA 1WYGA 1QF6A 1MI0A 2KN4A 1FRRA 2AX5A 4RGTA 1OFFA 1VRAB 3EUB2 2ICIA 4HKZE 1E0ZA 2JWUA 5C3JB 1AYFA 1WWTA 1AWDA 1TS2A 1CK1A 4IDIA 5D3DA 2BW2A 5C2TB 4YSYB 4HROA 3TEYA 1FXIA 4ARIA 2V3PA 4OHJA 4ZRQA 3VRAB 1I4PA 4YSZB 1R7SA 1K52A 2Y3AA 4MH8A 4OZBA 4ZYSA 3TEWA 1C76A 4KGRA 2BB5A 3BVGA 3FILA 4N59A 2FE8A 3AEBB 3NS1A 4ZHOA 1FO4A 1Q10A 3FAHA 4KGSA 4LTUA 3GB1A 1YMHE 3P4SB 5TSSA 1ESFA 1KFYB 2BB6A 1SJED 2PIAA 3DWMA 3LYYA 5FR3A 4A6QA 2IDYA 3PZ7A 1MPEA 3SFDB 1V8CA 2KACA 2N9LA 1SXTA 2K5PA 2J42A 1FFUA 4REZA 1KF6B 4CQNA 3BVMA 3P4PB 1EM7A 1HA5A 3IT6B 1L0YB 3AE1B 3H8HA 1MHHE 3BIID 1J7AA 1KTKA 4WWMA 3AEFB 1TY2A 3BVZA 3AEDB 3I9V1 3Q8BA 2HDEA 3KWVA 2E3TA 2NTTA 1WXQA 5EE0A 4WQMA 5BMHA 3NRZA 1GB4A 2WXQA 3Q8AA 3B2FA 4MT5A 1HXYD 1NVID 1KLGD 2KMMA 2EKIA 1NI3A 2D5GA 2V4IB 4DXGA 3U52E 1J7BA 1EU4A 4RFBA 3E9SA 1RWSA 3ZJTA 1FNWA 1STEA 2BT6A 4HJGE 4JWUC 3NUHB 4TQ1A 2XNAC 1JWMD 1MVKA 1I4HA 3P4RB 1RM6C 1T3QA 1BXTA 5LNK1 1ZOYB 2DYOA 1E9MA 5H92C 1LO5D 2W55A 2VZKB 1JRPA 1QKZA 1TS4A 1F0ZA 1JMLA 4WAFA 3SR6A 1DGJA 4J3OD 1F2RC 4YTMB 2MEKA 3V3XA 1FRDA 1UGJA 2OHFA 2RDHA 2JYEA 3AEGB 2QILA 3GP7A 2WXKA 5D3IB 2WXGA 4HEA1 1YNTE 1FNUA 3MJ5A 1FXAA 1YJIA 2WXFA 1L6VA 4B0EA 1K51A 2PLPA 4C7YA 2LJIA 2BS3B 4R3DA 5HI1A 1JWUD 4RNAA 1FFVA 5BYRA 1EWCA 3ETRA 5T8IA 1QT9A 1F2RI 1N5XA 1I4QA 4RGMA 3HVDA 1VR9A 1SBBB 5EE1A 3N9YC 1I4XA 4ZRPA 3J9CA 2MH7A 2W54A 2WXRA 4XDCA 2K9XA 3HVZA 2J52A 4OW0A 3U7ZA 1V1OA 1T6BX 3FILB 4WH4A 1IGCA 2MJ3A 5BMIA 1UWMA 5BYQA 2G9HD 5JXVA 1V97A 2LUMA 2EELA 2CJOA 3AE2B 4RCOA 1C9FA 4H2AA 2WU2B 4OZAA 3W9CB 1ET6A 2L1AA 1N62A 2N9KA 3ZYYX 3Q8FA 5FKAC 3SFEB 1J7CA 1NYQA 1YN5A 1YQ3B 3V05A 1DOYA 5G5GA 1QQRA 3AE7B 3VR9B 2RMMA 1XF5L 1D5ZC 4XE0A 3ABVB 1FIQA 4US8A 2JYTA 1QOAA 1SF0A 2AQ2B 2X38A 1I7HA 1ZE3D 3I57A 1MHXA 1ZDXA 2GI9A 1TS3A 4L23A 3NZ3A 1NEKB 1SEBD 3RFZB 3TEZA 1C77A 3NVWA 1WRIA 3EGRA 5BMGA 1XO3A 3MP9A 1I4GA 1HQRD 1ZXIA 3U4EG 1SE3A 2JX5A 2WXJA 2W3SA 1L4ZB 2BYTA 3AE8B 1T5XD 4KKIA 4M0WA 4C7ZA 4ZHPA 1FMAD 4JX1C 2NMQA 2ACZB 3AH7A 2JQRB 2Q5WD 3Q8CA 2WNMA 4US9A 4L1BA 1PUTA 3KLSX 1KRHA 4C80A 2JSVX 2LEKA 1L4DB 5HG2A 3VQIA 3BYTB 3MFGA 3AE9B 3AN1A 5GXGB 5BYSA 1QLBB 1NENB 1N60A 3T3OA 2H89B 3AEAB 2IJ0A 4RGOS 4P6VF 2WXOA 1JQ4A 3TUOA 2G1EA 3ZJUA 3RPFC 4DQOC 3AMZA 3BK2A 1KH0A 1C78A 2XN9C 4YXDB 1IUEA 5EE9A 2K3UA 2RDGA 2QSDA 2CU3A 1K50A 2WXMA 2YEPB 2IPKD 4A55A 1FCCC 2QEJC 3GS2A 1ZP0B 2WQYB 3BYYB 4N58A 1N61A 3AM9A 1GOZA 5AUIA 3IT4B 1YN4A 3Q8EA 4A8XC 2IGGA 4RGNA 4TSSA 4O1NA 1SSNA 1I4RA 1V1PB 2PKOA 1VDVA 5E6JA 3KQ4A 3VR8B 1L5PA 1SB3C 2BS2B 1ROEA 2Y5CA 3IAM1 1ET9A 5EE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWT A;  1AWD A;  2BS4 B;  5EE1 A;  1YJJ A;  3NVZ A;  4IDI A;  5AUK A;  5C2T B;  4YSY B;  2MH7 A;  2W54 A;  1FXI A;  3B9J A;  3AE5 B;  4HRO A;  4ITK A;  2K9X A;  3KWL A;  2M56 B;  2W3R A;  3VRA B;  1QOB A;  4KX6 B;  3HVZ A;  4YSZ B;  1R7S A;  2MJ3 A;  1UWM A;  5EE3 A;  1JWB D;  1V97 A;  4N59 A;  5GXG B;  2DBY A;  2CJO A;  1XLO A;  2WU5 B;  3AE2 B;  3AB5 A;  1OQQ A;  4YTN B;  3AEB B;  1XLP A;  3CWI A;  2WU2 B;  3NS1 A;  3W9C B;  4ZHO A;  1FO4 A;  1N62 A;  3ZYY X;  3FAH A;  4LTU A;  3P4S B;  1WGK A;  2L52 A;  3SFE B;  5G5H A;  1J7C A;  1NYQ A;  1JW9 D;  1YQ3 B;  1E7P B;  1DOY A;  5G5G A;  1EWY C;  1RYJ A;  1KFY B;  3AE7 B;  1YQ4 B;  2PIA A;  3CIR B;  3DWM A;  3VR9 B;  3WCQ A;  2QJL A;  3B2G A;  3SFD B;  1CJE A;  1V8C A;  3ABV B;  2CJN A;  2K5P A;  1VJK A;  3L4P A;  1FIQ A;  4FXC A;  1FFU A;  4US8 A;  1QOA A;  1KF6 B;  1SF0 A;  3W5U B;  3P4P B;  1I7H A;  3AE1 B;  2WDR B;  1ZUD 2;  1J7A A;  1TYG B;  1JAL A;  3AEF B;  3BII D;  2DWQ A;  4WWM A;  3AED B;  4A9A A;  1NEK B;  2K22 A;  4HRS A;  4JWS C;  2L83 A;  1GPX A;  1RFK A;  1TKE A;  3P4Q B;  3HRD D;  1TKY A;  2E3T A;  3NVW A;  1WRI A;  2MJD A;  3AV8 A;  1PDX A;  1WXQ A;  1XO3 A;  4WQM A;  5EE0 A;  3LB8 C;  3NRZ A;  1ZXI A;  5H8Y E;  1QOG A;  1XLQ A;  2JX5 A;  3B2F A;  1NVI D;  3AEE B;  3DWG C;  2W3S A;  2KMM A;  3AE8 B;  1JRO A;  2EKI A;  1NI3 A;  4C7Z A;  4ZHP A;  1FMA D;  4JX1 C;  5MPO A;  2ACZ B;  1E10 A;  2WDV B;  3AH7 A;  3W5V B;  2JQR B;  1J7B A;  1QOF A;  1SIJ A;  2Q5W D;  2KAJ A;  1RWS A;  4US9 A;  2BT6 A;  1PUT A;  2FBW B;  4JWU C;  4YSX B;  1KRH A;  4C80 A;  2LEK A;  2QIE B;  3AE6 B;  1TJE A;  1VLB A;  1L0V B;  2H88 B;  3AE3 B;  3VRB B;  3P4R B;  1OQR A;  1RM6 C;  2N0S B;  3AE9 B;  1QLB B;  1NEN B;  1T3Q A;  3AEC B;  1N60 A;  3AN1 A;  3FC4 A;  3NVV A;  3P1M A;  1JWA D;  2H89 B;  4USA A;  1ZOY B;  3AEA B;  1DOI A;  2WP9 B;  1E9M A;  1XLN A;  3PO0 A;  4P6V F;  1FM0 D;  5H92 C;  2W55 A;  1JQ4 A;  2PVG C;  1JRP A;  2G1E A;  1F0Z A;  1CZP A;  3SR6 A;  1DGJ A;  2WS3 B;  2B76 B;  3RPF C;  1N63 A;  4YTM B;  1B9R A;  1L6U A;  3AMZ A;  1FRD A;  2OHF A;  3AEG B;  4YXD B;  3NVY A;  1IUE A;  5EE9 A;  4ZOH C;  2CU3 A;  3LXF A;  1FXA A;  1YJI A;  3HUI A;  4YT0 B;  1A70 A;  1L6V A;  2HTM E;  1DOX A;  1ZP0 B;  2WQY B;  4N58 A;  1NYR A;  2PVO D;  3P63 A;  4C7Y A;  1N61 A;  2BS3 B;  3AM9 A;  1PFD A;  1WYG A;  2M19 A;  2WLB A;  4N6E B;  5AUI A;  1QF6 A;  1FFV A;  3ETR A;  1N5W A;  1QT9 A;  4YTP B;  1FRR A;  2PKO A;  2AX5 A;  1N5X A;  1TKG A;  1GAQ B;  1VDV A;  1OFF A;  2MJE A;  1L5P A;  1SB3 C;  3EUB 2;  2BS2 B;  3AE4 B;  3VR8 B;  1E0Z A;  5C3J B;  1ROE A;  2Y5C A;  2WDQ B;  1E6E B;  1AYF A; 
#chains in the Genus database with same CATH topology
 2KN5 A;  4PT5 A;  3OJ3 A;  3SEB A;  1XXG A;  2J0K A;  2NTS A;  4GLS C;  2K0P A;  1K8R B;  1LGR A;  4NQK E;  1MJD A;  4AJY B;  1XLP A;  2WDT B;  1HTO A;  4DXF A;  2KKC A;  4KSL C;  2HJ8 A;  1D3Z A;  2RPV A;  2LGX A;  5L83 A;  4C4V B;  3QWZ B;  5DPS A;  1K53 A;  2ZNV C;  4L2Y A;  3ZQ4 A;  1WE6 A;  2KYW A;  2BYF A;  1TYG B;  2BYV E;  2K22 A;  4GB9 A;  2YEP F;  1TKE A;  1SE9 A;  1XCT L;  1PDX A;  4MGI E;  3MHZ A;  3QJZ A;  4CO7 A;  2KOX A;  5MPO A;  1AW7 A;  3W5V B;  2JZZ A;  3AE3 B;  2IO3 B;  1TTN A;  4C56 C;  2KTF A;  3AXC A;  4USA A;  4AQ7 A;  4MGZ E;  3KYC D;  1D4B A;  3W1S C;  1QIL A;  2YLM A;  3DDC B;  4MAC A;  1R4M I;  3NVY A;  3A1Q B;  3R66 C;  4JIO U;  2PW9 A;  1L7Y A;  5LXI B;  3LXF A;  1WJN A;  1A70 A;  2BBC A;  3A9J A;  1C4P A;  2M19 A;  4N6E B;  3PPA A;  2FCS A;  3DBH I;  2IGD A;  3NG0 A;  2MJE A;  3AE4 B;  2WDQ B;  1E6E B;  3VUY A;  2VRR B;  4II2 B;  2W3R A;  3H7S A;  3ZRC A;  1QOB A;  1UNS A;  1UEL A;  1LXD A;  4XWT A;  2V3N A;  4BVU C;  3VUW A;  2E6X A;  3A1Q A;  3CF6 E;  2KWC A;  4LNI A;  2R2O A;  2ZEQ A;  2DYM A;  2KAN A;  3VTU A;  4ANX A;  4JGH B;  2NVU I;  4YTN B;  2OJW A;  3PRM B;  3ZXV A;  1HZ5 A;  1EWY C;  2TSS A;  3OJ4 B;  2JT4 B;  2QJL A;  3B2G A;  3UF8 A;  4WWP A;  2CJN A;  1VJK A;  1HEZ E;  2GB1 A;  3UI3 A;  3D32 A;  1C3T A;  3BK1 A;  1TZO A;  3X0W A;  3RN9 C;  1WR6 E;  2KQ7 A;  2C9W B;  2WXP A;  1JCK B;  2K1F A;  2DHZ A;  3LB8 C;  3M62 B;  1XD3 B;  3PZ8 A;  1WGY A;  2LGS A;  4PS3 A;  2ZVO A;  2LGI A;  2W9N A;  3ZO5 B;  2Y5P A;  3W2D A;  2NPT B;  2KZR A;  1TJE A;  1VLB A;  4IKG A;  2N0S B;  1WXS A;  2MBB B;  3IHP C;  1DOI A;  5IP4 D;  1XLN A;  2PVG C;  2AYO B;  4A3O A;  1SIF A;  2WS3 B;  3ALB A;  4ICV A;  1Q0W B;  1GC6 A;  2AL6 A;  4ZOH C;  4UDU C;  3RNA C;  1DYQ A;  1DOX A;  5IN7 A;  2DAF A;  4PS8 A;  3UQB A;  2REX A;  2KN4 A;  4W9D A;  4W9E A;  1T0R C;  1OFF A;  2MRP A;  2JWU A;  5CHV C;  3FKY A;  5D3D A;  3H1U A;  1T0Y A;  1FXI A;  3GE8 C;  4W9F A;  1I4P A;  3DVN V;  3APF A;  1V2Y A;  5AZG A;  1R4N I;  2C60 A;  1F1H A;  2FE8 A;  1IP9 A;  4MJS B;  3PS6 A;  1Q10 A;  5TSS A;  2PIA A;  2IDY A;  3PZ7 A;  3B0A A;  1MPE A;  4KIK A;  3QA8 A;  3RUL A;  2N9L A;  2N9X A;  2JRI B;  2K39 A;  2Z0E B;  1KF6 B;  3P4P B;  4HPP A;  3KH0 A;  1L0Y B;  2C5L C;  3AE1 B;  1MHH E;  1HE8 A;  4KSK C;  3I9V 1;  3Q8B A;  1UZX B;  1RFA A;  1TZ1 A;  2NTT A;  2KT7 A;  2V3S A;  5BMH A;  1GB4 A;  2GBR A;  3Q8A A;  1E8W A;  4MT5 A;  2L76 A;  1NVI D;  2EKI A;  2DX5 B;  1KJT A;  4I6P A;  3U52 E;  2C7H A;  2V1Y A;  3ZJT A;  1STE A;  4J6I A;  4HJG E;  4QAY A;  3NUH B;  4TQ1 A;  2IND C;  1MVK A;  2LVP A;  3P4R B;  4GOC A;  3Q3F A;  5LNK 1;  1GG3 A;  1WGD A;  4LDT D;  1ZOY B;  4ZRJ A;  2DYO A;  4FJV B;  4M01 A;  5H92 C;  3WAP A;  1JRP A;  2D10 A;  4FHK A;  5DPR A;  1F0Z A;  2MEK A;  3GE3 C;  3RCZ A;  2WXK A;  4HEA 1;  3PRE A;  1FNU A;  3MJ5 A;  1L6V A;  4B0E A;  4XX5 A;  2BS3 B;  5HI1 A;  2DYB A;  1EWC A;  2D3A A;  2KXJ A;  1Q1O A;  4P1B C;  4K7U A;  3J9C A;  5D94 A;  3HVZ A;  4OW0 A;  1V1O A;  5L95 C;  2ZJD A;  3FIL B;  2G9H D;  5JXV A;  2EEL A;  2BKF A;  3GZN B;  2M4N A;  4GXB A;  3Q8F A;  4M0W B;  3SFE B;  1J7C A;  1WRD B;  3CST A;  1YQ3 B;  2MBH A;  3ZXR A;  5G5G A;  4P1C C;  3AE7 B;  3VR9 B;  1WZ0 A;  3P2B A;  2O6V B;  3QX1 A;  2V4L A;  2AQ2 B;  1SF0 A;  3L08 A;  2GBN A;  3N1Z C;  1MHX A;  2GI9 A;  3NZ3 A;  2KHW B;  2L0T A;  2CHX A;  1KOT A;  3EGR A;  5BMG A;  2PE6 B;  3ZTC A;  4K7S A;  3ONS A;  1ZXI A;  2KMA A;  2JX5 A;  4W9L A;  4LNO A;  2BYT A;  4C7Z A;  4KKI A;  4M0W A;  1FMA D;  4JX1 C;  2ACZ B;  2JQR B;  4US9 A;  2NBU A;  1PUT A;  2NR2 A;  2O6V A;  2JSV X;  5HG2 A;  2KD0 A;  5AZH A;  2ZZP B;  3H7P A;  2IJ0 A;  3SHQ A;  1V6E A;  4DQO C;  3IVF A;  3PTF C;  3OG5 A;  4FJZ A;  1WF9 A;  3X23 A;  4AP4 C;  1WM3 A;  2QEJ C;  1E8X A;  1ZP0 B;  2UYZ B;  2WQY B;  1WH3 A;  2FID A;  2LVQ A;  5E6O A;  1GOZ A;  1Y8R C;  4A20 A;  3N30 A;  4TSS A;  3WIM A;  1I4R A;  1V1P B;  5J2R A;  3UIN B;  3SDL C;  1L5P A;  2BS2 B;  1ROE A;  5EE3 A;  2LGY A;  1YN3 A;  2J7Q B;  3AU5 A;  3RUI B;  4LLG M;  2KX0 A;  2GOW A;  4S17 A;  3PVL A;  3EFU A;  1WGH A;  4KDL B;  2GBJ A;  4CHK A;  4GDK B;  4DHJ B;  5G2N A;  2PJH A;  2WHI A;  2WU5 B;  4KZ0 A;  3NHE B;  4NJ6 A;  4F7Z A;  3R2T A;  3IBE A;  2N7J A;  5G5H A;  1V1P A;  4KKJ A;  2MWS B;  4XDD A;  3K9O B;  2IGH A;  4DBG A;  1P9D U;  5G55 A;  3U2S C;  2JXT A;  1F9J A;  2D3B A;  2KTR B;  3W5U B;  2FCM A;  1M94 A;  3VH3 B;  2WDR B;  3APC A;  2RR9 A;  2DWQ A;  1RFK A;  4LK0 M;  3V62 A;  2INN E;  2JVC A;  3HRD D;  4NAW B;  2CR5 A;  2DLB A;  2QMT A;  1P0R A;  1V80 A;  4OVV A;  3HM6 X;  4RH6 A;  3DBL B;  2WWZ A;  1GB1 A;  4WIP A;  5DPT A;  4DWF A;  5LLI A;  1TBE A;  1QOF A;  5IA7 A;  3WA0 A;  3NZS A;  1WSP A;  4RM8 A;  2BTE A;  4EE2 A;  1OQR A;  4FXC A;  4M8M A;  3WAO A;  1JWA D;  2L32 A;  3ZGZ A;  3PO0 A;  3PZD A;  1FM0 D;  2V0G A;  5HKH A;  4W9C A;  1H8C A;  3TEX A;  1P7F A;  4LNK A;  5IKC M;  2SEB D;  3RT3 B;  2LHE A;  3EC8 A;  1ENF A;  3ZNG C;  2HTH A;  1D5X C;  1WX8 A;  4BBN C;  1L0X B;  5D7G A;  2MQJ A;  3DBS A;  3JVZ X;  2K8C A;  1VCB A;  5C23 A;  1E5W A;  3RNB C;  3RZW C;  4ICU A;  2V9H A;  3ZRF A;  4S0R A;  2LHD A;  2KWV B;  4I6N B;  3B9J A;  4BKT A;  3BY4 B;  1WMH B;  4I6L B;  3MC0 B;  1B1Z A;  1XEE A;  1PGB A;  3EEC A;  3KUC B;  1XLO A;  2BGF A;  3DBR I;  3P42 A;  1OQQ A;  1Y56 A;  3NJT A;  1WZ3 A;  3H6N A;  4ZRK A;  1PGX A;  1C4C A;  3ZDT A;  4FN2 A;  4F8C B;  2K6D B;  5HFY A;  1UD7 A;  2KWD A;  2WXN A;  3L4P A;  1WR1 A;  2MBE A;  2A5U A;  3VDZ A;  1MG4 A;  1UUP A;  3QAQ A;  1WMH A;  3VHT C;  4Q2J A;  2JRH A;  1XQQ A;  1ZUD 2;  2FUG 1;  4LNF A;  4JWS C;  2L83 A;  3P4Q B;  1HTQ A;  5I4D A;  2WXL A;  1BT0 A;  3AV8 A;  4HKQ A;  3T3N A;  3AEE B;  4TMA B;  2I2Y A;  3VAW A;  3IXS A;  4LNN A;  4DDI D;  4TV3 A;  2EMT A;  3V6C B;  4YSX B;  4B9K A;  1CQV A;  2WX1 A;  1LFD A;  2LJ5 A;  1ZW7 A;  4NQL B;  1EF5 A;  5JH5 C;  2Z8L A;  1SE2 A;  5E6P A;  2I1J A;  5TR5 A;  3ZJV A;  1GC7 A;  2DZI A;  3I63 C;  1SE4 A;  1ZXH A;  1ISN A;  2D11 A;  3RZF A;  3A9J B;  3VTW A;  1U4A A;  1D6E C;  4II3 B;  5CTR C;  1UF0 A;  4B6W A;  1TY0 A;  4HDO A;  2R61 A;  1E90 A;  1WJU A;  4HPM B;  2BQQ A;  5IOI A;  3EUB 2;  1E0Z A;  2JF5 A;  3PSE B;  2DZK A;  4HCN B;  2AEH A;  1WWT A;  3DVG X;  2BW2 A;  3TEY A;  4YSY B;  4EFO A;  4ARI A;  3JW0 X;  3V6E B;  2V3P A;  1XT9 B;  4OHJ A;  3GOE A;  4ZRQ A;  3QC8 B;  4BBN F;  1V49 A;  2BB5 A;  3LDZ E;  4N59 A;  4BOZ B;  2WX0 A;  3AEB B;  3P4S B;  1ESF A;  2ZCB A;  2BB6 A;  2ZVN A;  3LYY A;  4A6Q A;  1V5T A;  1E8Z A;  3SFD B;  1V8C A;  3V61 A;  1SXT A;  3M3J A;  1KLV A;  4IM3 A;  3BVM A;  1GJZ A;  3H8H A;  2PE9 A;  3ZDM C;  2IY0 B;  3KYD D;  1WXQ A;  2BF8 B;  4WQM A;  5EE0 A;  3NRZ A;  4DHZ B;  2N4F A;  3B08 A;  2D5G A;  2V4I B;  2GMI C;  1EU4 A;  1G6J A;  3E9S A;  1RWS A;  4RMA A;  3R7Q A;  4IW0 A;  3NS8 A;  3A33 B;  1P98 A;  4EKU A;  1LO5 D;  2VZK B;  1JML A;  4WAF A;  4E74 A;  1DGJ A;  2QIL A;  4JL9 A;  2WXG A;  4DHJ D;  2L0F A;  3DPD A;  1YJI A;  2AWT A;  2WXF A;  4W9K A;  1E7U A;  4LJP B;  1FFV A;  2JZ3 B;  2B3A A;  5EE1 A;  3RNG C;  4ZRP A;  2W54 A;  1OTR B;  2ZPN A;  4XDC A;  2J52 A;  3A4R A;  2KVR A;  2A4Z A;  1UWM A;  5BYQ A;  2JXX A;  3WAL A;  2L7R A;  4DDG D;  3AE2 B;  4H2A A;  1H4R A;  4MSM B;  1ET6 A;  2L1A A;  3ZYY X;  1DOY A;  4G3X B;  3R7R A;  4KIK B;  1QQR A;  3HIZ A;  1V81 A;  2ZPY A;  2KDB A;  1XF5 L;  1D5Z C;  1YX5 B;  4MGK E;  4XYC A;  2X38 A;  5D6J B;  1Q5W B;  2MX2 A;  3I3T B;  3PRP B;  4G0N B;  4HXD A;  1TS3 A;  4L23 A;  4IG7 B;  1NEK B;  1SEB D;  3TEZ A;  4HJK A;  2MHJ A;  3MP9 A;  1UBI A;  1HQR D;  4PYZ A;  5DCN A;  4PK1 A;  3NOB A;  3AH7 A;  4BZA A;  3Q8C A;  4WJP A;  4ANW A;  3KLS X;  1KRH A;  4C80 A;  3VQI A;  2LD9 A;  2KDF B;  3AE9 B;  3DQV A;  2VH1 A;  3KUZ A;  4HCP B;  4RGO S;  2WXO A;  1JQ4 A;  2BYE A;  4HDQ A;  3AMZ A;  1YIW A;  5J17 A;  2XN9 C;  1ZKH A;  2QSD A;  1K50 A;  2IPK D;  1FCC C;  3QQ8 B;  3BYY B;  2R2Q A;  3ZUN A;  1YN4 A;  3VFK A;  2KVZ A;  2PKO A;  2N7E A;  1R4M B;  1VDV A;  3VR8 B;  3AI5 A;  2BS4 B;  3NVZ A;  2LXA A;  1F52 A;  2M56 B;  3DBL I;  4KX6 B;  1ACC A;  3C8Y A;  2K6Q A;  2QDF A;  2WXH A;  3UQA A;  3TIX A;  3DBH B;  3PLU A;  2IO1 B;  1V5O A;  4KV2 A;  2BWE S;  3IG3 A;  3ZTD A;  1E7P B;  1YQ4 B;  3CIR B;  1BML C;  1C4A A;  5FK9 C;  1CMX B;  1IGD A;  2KFK A;  3T8M A;  1VD2 A;  2L05 A;  2L3Z A;  2RD0 A;  3ML9 A;  4A9A A;  1GPX A;  4ZDV A;  4JQW C;  3W1S A;  3N20 C;  3PGE A;  2MJD A;  3TCA A;  4NNJ B;  3VH4 B;  1A5R A;  3E56 A;  3DWG C;  3EA6 A;  1VZ6 A;  2KAJ A;  1IBX A;  3H7P B;  4NJ7 A;  5D2M B;  3Q69 A;  3P1M A;  1EUV B;  2INC C;  3MC9 A;  1LM8 B;  3IAS 1;  1VZ8 A;  2O2V B;  3ZW3 A;  1V9J A;  4DHZ E;  2ZW1 A;  4EUT A;  2W82 A;  2XK5 B;  2LRU A;  4IWO A;  2INP E;  2BPS A;  2HTM E;  1J0G A;  3MJW A;  4NAM A;  4IUM B;  1WGR A;  1TS5 A;  3MC8 A;  1D5M C;  1NDD A;  3KUD B;  4GDL A;  1N5W A;  4P16 A;  3UGB B;  4YTP B;  4PS7 A;  1TKG A;  3B1L X;  3UIP B;  4JE3 B;  1WY8 A;  1YJJ A;  1WYW B;  5AUK A;  4F1S A;  3KWL A;  2O2V A;  1C79 A;  2NS5 A;  3CMM B;  2G45 B;  2XK5 A;  4DK5 A;  2GBM A;  3N32 A;  1JWB D;  4AS1 A;  4NPN A;  1PGA A;  3CWI A;  2AQ3 B;  1KLU D;  4OZC A;  3ZNZ B;  2L52 A;  4NZL B;  1WX9 A;  2DNF A;  4D2K A;  4RF1 A;  4GU2 A;  2N9E B;  3N3K B;  1IYF A;  2VZK D;  2ZW0 A;  1JAL A;  4HRS A;  3DHH C;  2WXI A;  1T0Q C;  1P3Q U;  2KJH B;  2JUO A;  1JWS D;  1PQS A;  3DVN U;  2FCN A;  3ZIM A;  2LAS A;  3Q3J A;  1QOG A;  3UIO B;  1ZPS A;  4XGA B;  3M95 A;  4GIV A;  2KMC A;  5JHA A;  4XWW A;  4FBJ B;  1Z2M A;  2M17 A;  3C19 A;  2QIE B;  4FHJ A;  1L0V B;  2KQS A;  2ZCC A;  2CS4 A;  2FAZ A;  1L2N A;  3FC4 A;  1JRU A;  2WP9 B;  3O13 A;  1BUI C;  4JLC A;  3ZNI D;  2B76 B;  1N63 A;  4W9J A;  3ZKJ C;  2AQ1 B;  4E3C A;  3OWE B;  3VUX A;  4WJQ A;  3QCA A;  5E6N A;  1TIF A;  5IAA C;  2LMC A;  4B0M A;  1AN8 A;  1WX7 A;  1PFD A;  1QF6 A;  1MI0 A;  2IZV B;  2X8X X;  1YOV B;  3AUL A;  3LJ3 A;  2AX5 A;  4BOS C;  3QAR A;  4RGT A;  4HKZ E;  2ICI A;  1KM7 A;  4K3C A;  2NCN A;  1J19 A;  2MBO A;  1TS2 A;  4CYE A;  1CK1 A;  4IDI A;  5C2T B;  4HRO A;  3EFC A;  1R7S A;  3KW5 B;  2FCQ A;  2Y3A A;  1C76 A;  3BVG A;  4HPL B;  3JSV B;  1YJ1 A;  4BFR A;  3NS1 A;  2KLG A;  1FO4 A;  4M02 A;  3FAH A;  4KGS A;  2MSE D;  1YMH E;  3Q3O C;  1SJE D;  4AUQ C;  2K5P A;  2J42 A;  4CQN A;  3U7D A;  4EOY A;  1HA5 A;  2MLB A;  3IT6 B;  3O65 B;  3BII D;  4WWM A;  3PT2 B;  3BVZ A;  3AED B;  2KLC A;  2HDE A;  1MG8 A;  5CHW A;  2E3T A;  3JSV A;  4BKS A;  5C1Z A;  2WXQ A;  3VTV A;  2MA9 B;  2RPQ A;  3B2F A;  1HXY D;  1KLG D;  2K8B A;  2KMM A;  4WAA A;  4DXG A;  4RFB A;  2BT6 A;  3HK0 A;  3PHX B;  1I4H A;  2RSU A;  1T3Q A;  3TBL D;  4WWN A;  1BXT A;  1E9M A;  4GN1 A;  2L8J A;  2LGD A;  3SR6 A;  4EEW A;  3PLV A;  4LCD E;  4LDT B;  1F2R C;  4YTM B;  1FRD A;  2D2Q A;  5KHQ A;  4GSW A;  4MDK E;  3AEG B;  5D3I B;  3GP7 A;  5FR6 A;  2PPH A;  4A3P A;  1FXA A;  4B95 A;  1K51 A;  4IC7 B;  4C7Y A;  2LJI A;  4R3D A;  1JWU D;  3CSF A;  3RNC C;  5BYR A;  3ETR A;  2VH2 A;  1QT9 A;  1UGM A;  1F2R I;  2IO2 B;  1N5X A;  1I4Q A;  2IO0 B;  3HVD A;  1I4X A;  2M1M A;  4XC2 A;  3RNE C;  2WXR A;  2RGF A;  1T6B X;  1RRB A;  4WH4 A;  1IGC A;  3N1X C;  1WJ6 A;  3L0W B;  2LUM A;  4ANU A;  2CJO A;  5BO4 B;  1C9F A;  2WU2 B;  4OZA A;  1LQB A;  1S1Q B;  2N7D A;  5FKA C;  2O6V D;  1Z5S B;  3V05 A;  4MSQ B;  2LXC A;  4MH0 E;  1WIA A;  3EHV A;  4AOF A;  4XE0 A;  2IBI B;  1FIQ A;  4C4V A;  1IPG A;  2D07 B;  3I57 A;  2MCN B;  5DPW A;  2M0X A;  1C77 A;  2G4S A;  3NVW A;  1WRI A;  1XO3 A;  3TJP A;  1I4G A;  3R3M A;  2QC8 A;  3U4E G;  3I5J C;  3RI7 C;  1OGW A;  2W3S A;  1L4Z B;  1T5X D;  4ZHP A;  1MFW A;  2LZ6 A;  2Q5W D;  1X1M A;  2J0J A;  4L1B A;  2LEK A;  1OQY A;  3MFG A;  3AN1 A;  5BYS A;  1QLB B;  2KJ6 A;  2QHO A;  3M63 B;  2FNJ B;  3T3O A;  1OEY J;  2H89 B;  4P6V F;  1RAX A;  4X57 B;  3ZJU A;  3BK2 A;  1KH0 A;  1C78 A;  4YXD B;  1IUE A;  1WGG A;  2K3U A;  2YEP B;  2WXM A;  5GMV A;  3AU4 A;  4WQO B;  4EZL A;  2MP2 B;  3Q8E A;  4HVB A;  2IGG A;  2LUE A;  4RGN A;  2HD5 B;  2NBV B;  4NY0 A;  3HHM A;  2FUH B;  5E6J A;  1SB3 C;  3GZN I;  4US8 A;  1FEH A;  2N1W A;  3PRZ A;  4EZJ A;  4G11 A;  1I35 A;  2LRW A;  2G4D B;  2MBQ A;  1ZDV A;  2DBY A;  1PYW D;  2SAK A;  2MP2 A;  5JHB A;  3PHW B;  3BWU D;  2KO3 A;  1GUA B;  1JW9 D;  1WFY A;  1RYJ A;  3DVG Y;  2HE7 A;  3VVW B;  1CJE A;  1YD8 U;  2DZJ A;  2KQ4 X;  4NJC A;  1NI2 A;  4JPS A;  4FUL A;  3H9D A;  2GRI A;  3DBR B;  4A90 A;  3R2I A;  4WUR A;  1WJ4 A;  3N1Y C;  4FJY A;  1FPY A;  4WJO A;  2G3Q B;  4BKG A;  1WI0 A;  1P7E A;  5H8Y E;  2BVC A;  3V60 A;  2J4X A;  2ASQ A;  1JRO A;  4YWG G;  2WDV B;  1SIJ A;  2OED A;  1VZ7 A;  2PTL A;  3SU8 X;  3ZLZ A;  3VRB B;  1E10 A;  3AEC B;  2N9P C;  1EU3 A;  2NPT A;  3NVV A;  1EF1 A;  2JU6 X;  4ARC A;  4N9F 4;  3WAM A;  2JWZ A;  1FD6 A;  2XEW A;  1CZP A;  4W9G A;  3L13 A;  1WXV A;  3ZNH B;  3JYU A;  4YT0 B;  3HUI A;  3MTN B;  2I38 A;  4BKS D;  2KDM A;  2ON8 A;  1NYR A;  2PVO D;  3L17 A;  4RF0 A;  3RMK C;  2ONQ A;  2WLB A;  1XCQ L;  2D3G A;  2CKH B;  1NBF C;  2KC1 A;  2UWQ A;  1UWX A;  1GAQ B;  2KNB A;  1SJH D;  2ZNV B;  4IOI E;  1YX6 B;  2XBB C;  4ITK A;  3AE5 B;  4BAX A;  4XZ4 A;  4RM9 A;  3OAW A;  4TQ0 A;  4ANV A;  2QCZ A;  2IY1 B;  2LFI A;  2MW5 A;  2L00 B;  1F77 A;  1ZGU B;  2D3C A;  2Z0D B;  3AB5 A;  2LVO A;  3IFW B;  1V86 A;  3R8B A;  3QIJ A;  2J53 A;  3Q2A C;  4KGT A;  4MJS A;  1WGK A;  2KFK B;  2KFJ A;  3WCQ A;  1HZ6 A;  1FNV A;  2CHZ A;  3PV1 A;  4KVG B;  2M0A A;  3BZD B;  5HHD G;  1FCL A;  3L10 B;  2N1V A;  4TKN A;  4ZYN A;  3RNF C;  4M8N A;  1TKY A;  4OVU A;  3T9L A;  2JZP A;  1XLQ A;  4IWP A;  3NY5 A;  2JPH A;  2NBW B;  2GBK A;  3Q3N C;  1IBX B;  5LXH A;  4K7W A;  2EKE C;  2FBW B;  1M4V A;  2KWU B;  1J8C A;  3AE6 B;  2H88 B;  2UU7 A;  3NZU A;  1TGZ B;  1FXT B;  1YQB A;  4AJW A;  4URK A;  4HWI B;  1B9R A;  1L6U A;  1UBQ A;  4HK2 A;  2FIF A;  4OVZ A;  3TSS A;  4MM3 B;  3SD5 A;  3A4S C;  2CU1 A;  3URY A;  2PMV A;  3P63 A;  4GDL B;  1GNU A;  1WYG A;  4PYU A;  1FRR A;  3DHG C;  1VRA B;  5CHF A;  5C3J B;  1AYF A;  1AWD A;  4C00 A;  1I42 A;  4ASW C;  3C0R B;  3VRA B;  1T0S C;  4YSZ B;  1K52 A;  3HM3 A;  4K1R B;  3TMP B;  4MH8 A;  2PEA A;  4OZB A;  4ZYS A;  3TEW A;  2DEN B;  2BKR B;  3A9K B;  1SGH A;  4IM2 A;  4KGR A;  4MM3 A;  3KVF B;  3FIL A;  4TUU A;  2GLS A;  2DZM A;  4MEM A;  2JY6 A;  2C7M B;  4ZHO A;  3DOW A;  4LTU A;  1WXM A;  3GB1 A;  4M00 A;  1KFY B;  5FR3 A;  3DWM A;  2IYD B;  2OJR A;  5EDS A;  5IO9 A;  2M8S A;  1E8Y A;  2KAC A;  1P1A A;  2Y5B B;  1FFU A;  4REZ A;  5J18 A;  1EM7 A;  3DHI C;  3ML8 A;  2K8H A;  5KHO A;  1J7A A;  1KTK A;  3AEF B;  1TY2 A;  3QK0 A;  4KZC A;  3A9K A;  3KWV A;  2Z59 B;  4MEL A;  3W1Y A;  4LJO B;  4E71 A;  1NI3 A;  2C7N B;  5AZF A;  3TL5 A;  1S3S G;  3RD2 A;  4IM0 A;  2WGS A;  1J7B A;  1FNW A;  4JWU C;  1R4N B;  4FAD A;  2XNA C;  1JWM D;  2KX3 A;  4P7I A;  1RM6 C;  3Q14 C;  3U30 A;  3ZVV A;  2W55 A;  1QKZ A;  1TS4 A;  3ENE A;  4J3O D;  3V3X A;  2OHF A;  1UGJ A;  4HLE A;  2RDH A;  2JYE A;  3K9P B;  4GMV A;  1YNT E;  1TT5 B;  4ZRI A;  3WAN A;  2PLP A;  4WJN A;  4IWQ A;  1WXA A;  3L16 A;  4RNA A;  2WYQ A;  4FLH A;  2KDE B;  4KDI C;  5T8I A;  1E7V A;  3MHS D;  2I1K A;  3OLM D;  4RGM A;  2LI5 A;  2KJR A;  3RYT A;  2LWP A;  1OEY A;  1VR9 A;  1SBB B;  1UH6 A;  3N9Y C;  5AEK B;  2MH7 A;  1WM2 A;  2K9X A;  1C1Y B;  3U7Z A;  5BMI A;  2MJ3 A;  2YVC A;  4W9H A;  1V97 A;  3Q6B A;  4G50 A;  1AAR A;  1RLF A;  4RCO A;  3VXW A;  4MGY E;  5JZE B;  4GDK A;  3W9C B;  2N9K A;  1N62 A;  4WWO A;  1NYQ A;  1YN5 A;  3L54 A;  4DXA B;  3ECI A;  2RMM A;  1EO6 A;  2EMS A;  4GGQ A;  3ABV B;  2DAJ A;  1QZE A;  2JYT A;  2BWF A;  1QOA A;  4FA6 A;  1I7H A;  1ZE3 D;  2KTR A;  1ZDX A;  3U8Z A;  3RFZ B;  3DCG A;  2J0M A;  3S2A A;  2KK8 A;  2AL3 A;  1SE3 A;  2K25 A;  4NAW A;  4AWJ A;  2WXJ A;  3AE8 B;  2NMQ A;  2CHW A;  4YL8 A;  2WNM A;  2KDI A;  1L4D B;  3BYT B;  5GXG B;  1NEN B;  2HJ1 A;  1N60 A;  5CX3 A;  1N6Z A;  3AEA B;  3BIN A;  3TUO A;  2G1E A;  4K81 A;  3RPF C;  3Q3M C;  4EZK A;  5EE9 A;  4ACF A;  2RDG A;  1WE7 A;  2CU3 A;  4A55 A;  3QHT A;  3GS2 A;  3APD A;  4N58 A;  1N61 A;  3AM9 A;  5AUI A;  3IT4 B;  2OOB B;  4A8X C;  2RDB C;  4O1N A;  1SSN A;  2KC2 A;  4K3B A;  3KQ4 A;  4W9I A;  2Y5C A;  3IAM 1;  1ET9 A; 
#chains in the Genus database with same CATH homology
 2BS4 B;  1FEH A;  3NVZ A;  4PT5 A;  1YN3 A;  3SEB A;  4LLG M;  1XXG A;  2M56 B;  2NTS A;  4GLS C;  4KX6 B;  2K0P A;  1ACC A;  3C8Y A;  2WXH A;  1ZDV A;  4GDK B;  2DBY A;  2WU5 B;  1PYW D;  2SAK A;  1XLP A;  4DXF A;  3R2T A;  3BWU D;  2N7J A;  5G5H A;  1JW9 D;  1E7P B;  2RPV A;  1RYJ A;  1V1P A;  1YQ4 B;  4KKJ A;  3CIR B;  1BML C;  1C4A A;  4XDD A;  5FK9 C;  2IGH A;  1K53 A;  1CJE A;  4NJC A;  2KQ4 X;  1IGD A;  3U2S C;  4L2Y A;  2JXT A;  4JPS A;  3ZQ4 A;  3W5U B;  2GRI A;  4A90 A;  3R2I A;  4WUR A;  2WDR B;  1TYG B;  4A9A A;  2DWQ A;  2K22 A;  1GPX A;  2YEP F;  1RFK A;  4LK0 M;  1TKE A;  2INN E;  3W1S A;  3HRD D;  1XCT L;  2MJD A;  4NAW B;  1PDX A;  1P7E A;  2DLB A;  2QMT A;  3MHZ A;  5H8Y E;  3E56 A;  2J4X A;  4RH6 A;  3DWG C;  3EA6 A;  1GB1 A;  1JRO A;  4WIP A;  4YWG G;  1VZ6 A;  5MPO A;  1AW7 A;  2WDV B;  3W5V B;  1QOF A;  1SIJ A;  2OED A;  2KAJ A;  1VZ7 A;  2PTL A;  1IBX A;  1WSP A;  3AE3 B;  3VRB B;  2BTE A;  4C56 C;  4EE2 A;  1OQR A;  1E10 A;  3AEC B;  4FXC A;  1EU3 A;  3Q69 A;  3P1M A;  3NVV A;  1JWA D;  2JU6 X;  2L32 A;  4USA A;  4ARC A;  4AQ7 A;  3ZGZ A;  3PO0 A;  1FD6 A;  1FM0 D;  2V0G A;  3IAS 1;  1CZP A;  1D4B A;  1QIL A;  1VZ8 A;  3TEX A;  1P7F A;  4MAC A;  2SEB D;  2LHE A;  2ZW1 A;  3NVY A;  1ENF A;  2W82 A;  2PW9 A;  2INP E;  1D5X C;  3LXF A;  4YT0 B;  3HUI A;  1A70 A;  2HTM E;  2I38 A;  1L0X B;  5D7G A;  4NAM A;  2KDM A;  2BBC A;  2ON8 A;  1NYR A;  1TS5 A;  2PVO D;  4RF0 A;  2ONQ A;  1C4P A;  2M19 A;  2WLB A;  1XCQ L;  4N6E B;  1D5M C;  1N5W A;  4P16 A;  4YTP B;  1UWX A;  1TKG A;  1GAQ B;  1SJH D;  2IGD A;  4IOI E;  2MJE A;  3AE4 B;  4JE3 B;  2WDQ B;  1E6E B;  2LHD A;  1YJJ A;  5AUK A;  4ITK A;  3B9J A;  3AE5 B;  3KWL A;  2W3R A;  1C79 A;  1QOB A;  1UNS A;  3MC0 B;  4XWT A;  2V3N A;  4TQ0 A;  2E6X A;  1B1Z A;  1XEE A;  1PGB A;  2LFI A;  1JWB D;  2DYM A;  1F77 A;  1XLO A;  4AS1 A;  3AB5 A;  3P42 A;  1OQQ A;  1PGA A;  1Y56 A;  4YTN B;  3CWI A;  2AQ3 B;  1KLU D;  3R8B A;  4OZC A;  2J53 A;  4KGT A;  1WGK A;  1PGX A;  2L52 A;  1C4C A;  1HZ5 A;  1EWY C;  2TSS A;  5HFY A;  3WCQ A;  1HZ6 A;  2QJL A;  3B2G A;  1FNV A;  4NZL B;  2KWD A;  2WXN A;  2CJN A;  3L4P A;  1VJK A;  1HEZ E;  2GB1 A;  4D2K A;  4RF1 A;  3UI3 A;  2M0A A;  1UUP A;  1TZO A;  3BK1 A;  3BZD B;  5HHD G;  1FCL A;  4Q2J A;  2VZK D;  2ZW0 A;  1ZUD 2;  2FUG 1;  1JAL A;  4HRS A;  4JWS C;  2L83 A;  2WXP A;  1JCK B;  2WXI A;  3P4Q B;  1TKY A;  2WXL A;  5I4D A;  3AV8 A;  1JWS D;  2JZP A;  4HKQ A;  3LB8 C;  3T3N A;  3PZ8 A;  1QOG A;  1XLQ A;  1ZPS A;  3AEE B;  4TMA B;  2LGI A;  2I2Y A;  1IBX B;  3IXS A;  4XWW A;  2Y5P A;  3W2D A;  2FBW B;  1M4V A;  4YSX B;  1CQV A;  2QIE B;  3AE6 B;  1TJE A;  1VLB A;  1L0V B;  2H88 B;  4IKG A;  2N0S B;  3FC4 A;  1DOI A;  2WP9 B;  1XLN A;  2Z8L A;  3O13 A;  1BUI C;  1SE2 A;  2PVG C;  2WS3 B;  2B76 B;  1B9R A;  1N63 A;  3ZJV A;  1L6U A;  2AQ1 B;  1SE4 A;  1ZXH A;  3OWE B;  4OVZ A;  3TSS A;  4ZOH C;  4UDU C;  2LMC A;  4MM3 B;  1DYQ A;  1D6E C;  1DOX A;  4B0M A;  3URY A;  2PMV A;  3P63 A;  1AN8 A;  1TY0 A;  4GDL B;  2R61 A;  1PFD A;  1WYG A;  1QF6 A;  1MI0 A;  2KN4 A;  1FRR A;  2AX5 A;  4RGT A;  1OFF A;  1VRA B;  3EUB 2;  2ICI A;  4HKZ E;  1E0Z A;  2JWU A;  5C3J B;  1AYF A;  1WWT A;  1AWD A;  1TS2 A;  1CK1 A;  4IDI A;  5D3D A;  2BW2 A;  5C2T B;  4YSY B;  4HRO A;  3TEY A;  1FXI A;  4ARI A;  2V3P A;  4OHJ A;  4ZRQ A;  3VRA B;  1I4P A;  4YSZ B;  1R7S A;  1K52 A;  2Y3A A;  4MH8 A;  4OZB A;  4ZYS A;  3TEW A;  1C76 A;  4KGR A;  2BB5 A;  3BVG A;  3FIL A;  4N59 A;  2FE8 A;  3AEB B;  3NS1 A;  4ZHO A;  1FO4 A;  1Q10 A;  3FAH A;  4KGS A;  4LTU A;  3GB1 A;  1YMH E;  3P4S B;  5TSS A;  1ESF A;  1KFY B;  2BB6 A;  1SJE D;  2PIA A;  3DWM A;  3LYY A;  5FR3 A;  4A6Q A;  2IDY A;  3PZ7 A;  1MPE A;  3SFD B;  1V8C A;  2KAC A;  2N9L A;  1SXT A;  2K5P A;  2J42 A;  1FFU A;  4REZ A;  1KF6 B;  4CQN A;  3BVM A;  3P4P B;  1EM7 A;  1HA5 A;  3IT6 B;  1L0Y B;  3AE1 B;  3H8H A;  1MHH E;  3BII D;  1J7A A;  1KTK A;  4WWM A;  3AEF B;  1TY2 A;  3BVZ A;  3AED B;  3I9V 1;  3Q8B A;  2HDE A;  3KWV A;  2E3T A;  2NTT A;  1WXQ A;  5EE0 A;  4WQM A;  5BMH A;  3NRZ A;  1GB4 A;  2WXQ A;  3Q8A A;  3B2F A;  4MT5 A;  1HXY D;  1NVI D;  1KLG D;  2KMM A;  2EKI A;  1NI3 A;  2D5G A;  2V4I B;  4DXG A;  3U52 E;  1J7B A;  1EU4 A;  4RFB A;  3E9S A;  1RWS A;  3ZJT A;  1FNW A;  1STE A;  2BT6 A;  4HJG E;  4JWU C;  3NUH B;  4TQ1 A;  2XNA C;  1JWM D;  1MVK A;  1I4H A;  3P4R B;  1RM6 C;  1T3Q A;  1BXT A;  5LNK 1;  1ZOY B;  2DYO A;  1E9M A;  5H92 C;  1LO5 D;  2W55 A;  2VZK B;  1JRP A;  1QKZ A;  1TS4 A;  1F0Z A;  1JML A;  4WAF A;  3SR6 A;  1DGJ A;  4J3O D;  1F2R C;  4YTM B;  2MEK A;  3V3X A;  1FRD A;  1UGJ A;  2OHF A;  2RDH A;  2JYE A;  3AEG B;  2QIL A;  3GP7 A;  2WXK A;  5D3I B;  2WXG A;  4HEA 1;  1YNT E;  1FNU A;  3MJ5 A;  1FXA A;  1YJI A;  2WXF A;  1L6V A;  4B0E A;  1K51 A;  2PLP A;  4C7Y A;  2LJI A;  2BS3 B;  4R3D A;  5HI1 A;  1JWU D;  4RNA A;  1FFV A;  5BYR A;  1EWC A;  3ETR A;  5T8I A;  1QT9 A;  1F2R I;  1N5X A;  1I4Q A;  4RGM A;  3HVD A;  1VR9 A;  1SBB B;  5EE1 A;  3N9Y C;  1I4X A;  4ZRP A;  3J9C A;  2MH7 A;  2W54 A;  2WXR A;  4XDC A;  2K9X A;  3HVZ A;  2J52 A;  4OW0 A;  3U7Z A;  1V1O A;  1T6B X;  3FIL B;  4WH4 A;  1IGC A;  2MJ3 A;  5BMI A;  1UWM A;  5BYQ A;  2G9H D;  5JXV A;  1V97 A;  2LUM A;  2EEL A;  2CJO A;  3AE2 B;  4RCO A;  1C9F A;  4H2A A;  2WU2 B;  4OZA A;  3W9C B;  1ET6 A;  2L1A A;  1N62 A;  2N9K A;  3ZYY X;  3Q8F A;  5FKA C;  3SFE B;  1J7C A;  1NYQ A;  1YN5 A;  1YQ3 B;  3V05 A;  1DOY A;  5G5G A;  1QQR A;  3AE7 B;  3VR9 B;  2RMM A;  1XF5 L;  1D5Z C;  4XE0 A;  3ABV B;  1FIQ A;  4US8 A;  2JYT A;  1QOA A;  1SF0 A;  2AQ2 B;  2X38 A;  1I7H A;  1ZE3 D;  3I57 A;  1MHX A;  1ZDX A;  2GI9 A;  1TS3 A;  4L23 A;  3NZ3 A;  1NEK B;  1SEB D;  3RFZ B;  3TEZ A;  1C77 A;  3NVW A;  1WRI A;  3EGR A;  5BMG A;  1XO3 A;  3MP9 A;  1I4G A;  1HQR D;  1ZXI A;  3U4E G;  1SE3 A;  2JX5 A;  2WXJ A;  2W3S A;  1L4Z B;  2BYT A;  3AE8 B;  1T5X D;  4KKI A;  4M0W A;  4C7Z A;  4ZHP A;  1FMA D;  4JX1 C;  2NMQ A;  2ACZ B;  3AH7 A;  2JQR B;  2Q5W D;  3Q8C A;  2WNM A;  4US9 A;  4L1B A;  1PUT A;  3KLS X;  1KRH A;  4C80 A;  2JSV X;  2LEK A;  1L4D B;  5HG2 A;  3VQI A;  3BYT B;  3MFG A;  3AE9 B;  3AN1 A;  5GXG B;  5BYS A;  1QLB B;  1NEN B;  1N60 A;  3T3O A;  2H89 B;  3AEA B;  2IJ0 A;  4RGO S;  4P6V F;  2WXO A;  1JQ4 A;  3TUO A;  2G1E A;  3ZJU A;  3RPF C;  4DQO C;  3AMZ A;  3BK2 A;  1KH0 A;  1C78 A;  2XN9 C;  4YXD B;  1IUE A;  5EE9 A;  2K3U A;  2RDG A;  2QSD A;  2CU3 A;  1K50 A;  2WXM A;  2YEP B;  2IPK D;  4A55 A;  1FCC C;  2QEJ C;  3GS2 A;  1ZP0 B;  2WQY B;  3BYY B;  4N58 A;  1N61 A;  3AM9 A;  1GOZ A;  5AUI A;  3IT4 B;  1YN4 A;  3Q8E A;  4A8X C;  2IGG A;  4RGN A;  4TSS A;  4O1N A;  1SSN A;  1I4R A;  1V1P B;  2PKO A;  1VDV A;  5E6J A;  3KQ4 A;  3VR8 B;  1L5P A;  1SB3 C;  2BS2 B;  1ROE A;  2Y5C A;  3IAM 1;  1ET9 A;  5EE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...