3N20C

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201v mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 26
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n20C00
1T0QC 3RI7C 3GE8C 2INDC 3N1XC 3RNFC 3N20C 3RNBC 3DHIC 3RNEC 4P1CC 3I63C 3RMKC 3DHHC 3Q3OC 3RNGC 3GE3C 3Q3MC 3Q2AC 1T0RC 3N1YC 3Q3NC 3RNCC 3N1ZC 3I5JC 3DHGC 2RDBC 1T0SC 3RN9C 4P1BC 2INCC 3Q14C 3RNAC
chains in the Genus database with same CATH superfamily
2WX1A 4ZHPA 1BXTA 3H8HA 3VH4B 3CWIA 3RYTA 2ZJDA 2M17A 1SE9A 4K7UA 3Q8AA 2QSDA 5FKAC 3PZ7A 2KDMA 3PLVA 1R4NB 1C77A 4NAWA 4A6QA 4LNFA 3APCA 1F1HA 2BT6A 3A4SC 2W3RA 3ONSA 4RGOS 1UD7A 1ZDVA 2IDYA 4FULA 1D4BA 3NG0A 2KHWB 2BKFA 4XWWA 1A70A 2OOBB 2BYEA 2W3SA 4BKTA 1E7VA 3VH3B 4R3DA 3IAS1 4ASWC 2LI5A 5EE3A 2G3QB 2I1KA 1E8ZA 2MEKA 2EKIA 4WAFA 1WH3A 3AI5A 4BZAA 2D10A 5J2RA 3VQIA 2AX5A 4HCPB 3RPFC 1JWSD 5J18A 1WJNA 1RM6C 4WQOB 4P6VF 1WY8A 3L4PA 1RFKA 1WMHA 3ZUNA 2JT4B 3A9JA 1OQRA 4GDLA 2D11A 1T0QC 2BYFA 4FXCA 2NPTA 1HTQA 2N0SB 1P1AA 3RCZA 1YN5A 2BTEA 2HJ1A 2J4XA 1EUVB 1JMLA 2NPTB 1HEZE 4PT5A 2W55A 4DDID 4OZAA 3J9CA 4NQKE 3KYCD 1VR9A 3B1LX 2I38A 2QEJC 3WAOA 1XEEA 2PW9A 2QC8A 2LFIA 4BAXA 2QJLA 3DQVA 1F0ZA 3AULA 3N3KB 3Q3OC 1C78A 2OHFA 3FILB 1S1QB 2LGXA 3ZRFA 5MPOA 1WYGA 1J8CA 4J6IA 1ACCA 4IOIE 2WXNA 2J52A 3DOWA 4L1BA 4ARCA 1HZ6A 1ROEA 1TTNA 1IP9A 4MH0E 1JWAD 4ZRQA 2CU1A 4PYUA 4HPMB 1WJ4A 4S0RA 2J7QB 3LDZE 3L13A 4DXGA 1HQRD 4IDIA 3JVZX 2KTRB 3BYTB 3E9SA 4GXBA 4X57B 2E3TA 4YTMB 4H2AA 2MBEA 4K7SA 2KMCA 1VZ6A 2KJ6A 2NBWB 4W9LA 2LD9A 1HE8A 3TEYA 1UH6A 1WX7A 2AQ2B 3RULA 2KACA 4XWTA 4C80A 1WF9A 4WIPA 3URYA 3L08A 3UIPB 1VJKA 4OHJA 2JUOA 1E8YA 2E6XA 1FIQA 4W9KA 1TZOA 1CJEA 3HM6X 5CHWA 5KHOA 4B0MA 1K52A 2CHWA 5FR6A 1EU4A 1ZE3D 2AYOB 1UUPA 2LJIA 2KVRA 4BBNF 3N1XC 2KYWA 3IG3A 2LVOA 1GAQB 2O6VB 2GBMA 2JXTA 3NVZA 4QAYA 1N61A 4IM3A 5TR5A 1P7FA 2FCQA 3V05A 3ZGZA 1KH0A 4LNOA 4LLGM 5G2NA 1A5RA 1UGMA 2MH7A 5LLIA 3BY4B 2NS5A 2KT7A 3ZQ4A 1WE7A 2D3GA 3ML8A 4KSLC 3SD5A 2MBHA 3C19A 2CR5A 1N5WA 3IVFA 2N7JA 5D94A 5L95C 3SFEB 2KDBA 2DAJA 2WDQB 3B08A 1FEHA 3TIXA 4BKSA 1TBEA 1F77A 2V3NA 3BINA 3QQ8B 4LK0M 3Q3FA 5DPWA 5JHBA 1ZXHA 1QOFA 2OJWA 3IAM1 1OQQA 2JRIB 2LGDA 1SE2A 2EMSA 3NZSA 1PYWD 1PQSA 1IYFA 3U4EG 2MHJA 1GB1A 2M19A 5TSSA 4YL8A 3DBHI 4XZ4A 3NZ3A 3GZNI 5E6OA 1V1PA 4WJNA 2NCNA 1V1PB 2C7NB 5E6JA 2WDTB 1NEKB 1JW9D 2LHEA 4JX1C 3NZUA 2QCZA 4DHJD 2J0KA 1WSPA 4ZHOA 5DPSA 4JE3B 1FMAD 4GIVA 1MG8A 1YQ3B 3WIMA 1RWSA 1SEBD 4EZKA 2MSED 2Z0DB 5AZGA 1C9FA 1SJHD 3Q8BA 2KWCA 3I57A 3DCGA 4ZRIA 3Q3JA 2R61A 4G11A 1F2RI 4HPLB 3UQBA 3D32A 3BYYB 2BW2A 3TJPA 2DWQA 1YJJA 3PHWB 3ZW3A 2YLMA 4JGHB 1TKEA 4TQ1A 1E0ZA 1KOTA 2INNE 3ENEA 3H6NA 1LM8B 2C60A 4P16A 3TEZA 5IP4D 2CJNA 4BBNC 3CMMB 1XCTL 1N5XA 2WXLA 2WX0A 3UIOB 4A55A 3B2FA 1L4ZB 1QQRA 1DYQA 2ZPNA 3HK0A 3KUCB 3PZDA 2LWPA 1SIFA 3DBHB 2XNAC 3GZNB 3AE4B 1STEA 4TKNA 2Y5CA 3T9LA 2V3PA 5AUKA 1YQBA 4ZDVA 4ANUA 4HXDA 2WP9B 2LXAA 4RH6A 2DZKA 1YMHE 4W9CA 1ZUD2 3ZXVA 4ZYSA 4M0WA 3X23A 4RCOA 2SEBD 3AECB 3RNBC 2NBVB 2L0TA 2KX0A 4N9F4 1E5WA 4FHKA 1C4AA 4L23A 2WXPA 4FA6A 2G45B 3H9DA 2GBJA 2EELA 1CK1A 4KGRA 4B95A 1J7BA 4KVGB 4XGAB 3H7PB 2RR9A 4US9A 4RF1A 3P4SB 3IFWB 2DYMA 2LVPA 1NBFC 4HCNB 4PYZA 3AN1A 2BBCA 4BKSD 2KTFA 2JX5A 2K1FA 4MH8A 4PS8A 4O1NA 2FAZA 1BT0A 1L6VA 4C56C 1PGXA 4KDIC 2L00B 5JH5C 2WU5B 1HA5A 5HG2A 2HTHA 4IWQA 2M8SA 5H92C 4EZJA 1SSNA 2L83A 3PTFC 3PT2B 2BB5A 1E10A 4KZ0A 2KANA 3AEAB 4KIKB 4I6LB 1JWBD 4OVUA 2Z8LA 4RMAA 5C23A 1EU3A 2HJ8A 3B2GA 1T5XD 3BZDB 2JF5A 1WE6A 3TEWA 2KC1A 4M8NA 5GMVA 1WGRA 2CKHB 2RGFA 3ZTDA 2WXMA 3DPDA 2KNBA 2RPQA 3FAHA 2KDEB 1KM7A 2MWSB 1BMLC 2WDRB 3OJ3A 1NENB 3EUB2 2IO0B 2DHZA 1MG4A 3L16A 4G0NB 4C00A 1V5TA 3Q6BA 2IGGA 2KX3A 2MQJA 3HHMA 3C0RB 5HKHA 3RMKC 4BOSC 2B3AA 3VUWA 4M01A 5HFYA 2WS3B 3TEXA 3AE6B 3PGEA 1KF6B 3NUHB 4OW0A 4USAA 1ZGUB 5CHFA 2BKRB 3ALBA 3A33B 3LB8C 4F1SA 2N9XA 4WJOA 3V62A 1V6EA 2CU3A 2DYBA 1IGDA 1MHXA 3AE9B 1L5PA 2WDVB 2FE8A 2WXFA 2PJHA 1Q5WB 3K9OB 3P4QB 2NMQA 1V9JA 5DCNA 1WXVA 1D3ZA 4RM9A 5G5HA 3PV1A 4ARIA 2YEPF 2VRRB 1GG3A 1LXDA 1VRAB 4KKIA 4CQNA 3R2TA 3R66C 1P98A 4W9IA 2DYOA 1WZ3A 1VD2A 4K1RB 1WX8A 4WAAA 1V97A 1N60A 1FXTB 1XF5L 4XDCA 2B76B 2V0GA 3QWZB 2RMMA 3PRPB 3QARA 4K81A 4N58A 1XO3A 4HKZE 3A1QA 3Q8FA 4AJYB 4HROA 4KZCA 3ABVB 1H4RA 2PTLA 1WXMA 3A1QB 4L2YA 4D2KA 4IC7B 3ZIMA 1ZP0B 5D2MB 2KJHB 1QF6A 1I4GA 2M0XA 4MSMB 1MFWA 4JWSC 1RFAA 1VDVA 2KQ7A 4N6EB 4FN2A 5JZEB 3KUZA 2VZKB 2WXIA 5HI1A 3VVWB 4W9EA 3AB5A 1WXSA 2QHOA 4IG7B 2XBBC 1WIAA 1N6ZA 2GBRA 4CYEA 2CJOA 4PK1A 4KGTA 4LDTD 2KDFB 2AL6A 1FXAA 1FRRA 3QC8B 2PPHA 4TV3A 2WXOA 2ONQA 3AEEB 1D6EC 2AL3A 2KWUB 2BWFA 4PS7A 4B9KA 3RNCC 2ON8A 1J19A 3NS1A 3QAQA 4HRSA 2K39A 3RN9C 3APDA 1Q1OA 3NHEB 4RNAA 4ZOHC 5EE1A 3ZTCA 1KLVA 1XQQA 3C8YA 1P0RA 2KLCA 1H8CA 2K3UA 2NVUI 2KDIA 3FILA 3U2SC 3GE3C 3PS6A 1QOAA 2CHXA 2PE6B 4YSXB 1TKYA 2KMAA 1OEYJ 3HIZA 5EE0A 1FO4A 4XDDA 1V49A 4DHJB 4K7WA 2Y5PA 3V3XA 3DBLI 2KTRA 1P3QU 2V9HA 4C4VB 1JCKB 3VUXA 1FRDA 1YN4A 4W9GA 4Q2JA 3N1ZC 4A9AA 3KVFB 4HKQA 2M1MA 3ZVVA 3ZNGC 2X38A 3ZYYX 1FD6A 1FFUA 3TL5A 2N1WA 2OJRA 4A8XC 2KVZA 1CMXB 2K9XA 2FIDA 2HTME 1MI0A 3KLSX 1FFVA 3FKYA 4FJYA 2IY0B 1C76A 1UZXB 4A3PA 3W1SC 3N1YC 3WAMA 2IO3B 4EE2A 4EUTA 1V86A 2H88B 1M4VA 2JZZA 3IBEA 2L0FA 2W9NA 1WJUA 1N63A 1PDXA 2O6VA 2O2VB 1PGBA 1V5OA 3AE5B 1SJED 3B0AA 2ACZB 3ZDMC 1WFYA 2YEPB 1WRIA 1GB4A 2KOXA 3N30A 2D07B 2H89B 1JRPA 3W9CB 4FADA 3V6EB 2DZJA 3DWGC 3APFA 2L3ZA 1DOIA 1YJIA 3CSFA 2PEAA 4XX5A 4ZYNA 4ZRKA 4IWOA 1UWXA 2K8BA 2PKOA 1PFDA 4UDUC 1UWMA 1FXIA 2LUMA 1PGAA 2LEKA 2NBUA 1EM7A 3DBLB 4MM3A 1I4PA 3W1SA 4AP4C 1TS2A 1VCBA 2IGDA 2WXJA 1T0SC 4MM3B 4EFOA 2J0JA 1QILA 4A3OA 3MC0B 2JU6X 1RAXA 2MW5A 2RPVA 1GOZA 2XN9C 3ZJVA 1TY0A 3QX1A 3PHXB 2K5PA 4JIOU 2BYVE 4ANXA 2MJDA 2ZW0A 1WJ6A 4GDKB 1C3TA 4KSKC 4FHJA 3KW5B 1J0GA 3Q8CA 2MA9B 3WANA 1I42A 4URKA 2FNJB 4ACFA 3QA8A 2M0AA 3VAWA 2JWZA 1N62A 3NVWA 3L17A 2VH1A 1EO6A 3IXSA 4A90A 2FUG1 1UF0A 1FCLA 5H8YE 2PIAA 1M94A 4IM0A 3DVNV 2N9EB 2HD5B 2K22A 3VXWA 3CSTA 2I2YA 2VH2A 3AEDB 2GRIA 2ZEQA 3UI3A 2HDEA 2MBOA 4TQ0A 3NOBA 3P63A 1F2RC 1Y56A 1L7YA 1RRBA 1Z2MA 3P1MA 3GS2A 1ZPSA 4K3BA 3Q3NC 3HVDA 1XLOA 3JYUA 2FCMA 4GN1A 1T0YA 1JWMD 3UQAA 3ZLZA 2TSSA 1WR1A 2JYEA 1JWUD 3CF6E 3B9JA 3SR6A 5J17A 4EOYA 2A5UA 4KDLB 2LJ5A 4YWGG 1IUEA 1NYRA 1GC7A 1SIJA 1ZOYB 2C5LC 2KC2A 2LRUA 4WH4A 3KUDB 2SAKA 1XLNA 1V81A 4OVVA 4AUQC 2O6VD 3VR9B 3MC9A 3V61A 1SE3A 2DNFA 1NDDA 4E3CA 3WCQA 2LGIA 3T8MA 1VZ8A 3ECIA 2JRHA 1LFDA 1SF0A 2JSVX 1I4XA 2LMCA 3FC4A 5BYQA 2LHDA 2KWDA 2GLSA 4BKGA 2J0MA 3W5UB 2AWTA 4GLSC 4GGQA 2LVQA 2PLPA 3OAWA 4HDQA 3M63B 2KJRA 4P1BC 4E74A 5IAAC 4DHZB 2MLBA 1YIWA 3H7PA 2W54A 1FPYA 2N7EA 2K8HA 3DHIC 3DBRI 4MGIE 4HEA1 1E8XA 3JSVB 2FUHB 4A20A 5IOIA 4GMVA 2MP2B 3KQ4A 2CHZA 3MJWA 4DQOC 2Z0EB 2D5GA 3VR8B 1K51A 3VRBB 2BS2B 1G6JA 4WWNA 3IT4B 1I4RA 2WHIA 1WGDA 4MACA 1ET6A 4RFBA 4MEMA 1Y8RC 1VLBA 2BS4B 1D5ZC 1EF1A 1NYQA 3L0WB 2RSUA 4YSZB 2BGFA 2L1AA 3N32A 3BK2A 3U7ZA 1TY2A 5FR3A 3EFCA 3LYYA 2D2QA 2KQSA 4LNIA 4KIKA 4NNJB 4IKGA 2Q5WD 3RFZB 1DOYA 4IM2A 5BYSA 2RDHA 3MTNB 1TS4A 3ZNID 1ESFA 2GB1A 1PUTA 2Y3AA 2KLGA 5AZFA 2K0PA 1MHHE 3RZFA 1QOGA 3OJ4B 2XK5B 4DXAB 2N9KA 3PRMB 4KKJA 1AWDA 2Z59B 3LJ3A 1P9DU 1S3SG 4EEWA 2UYZB 4B0EA 3AE2B 2INPE 1XD3B 3TUOA 2V4LA 3DBRB 3RUIB 1I4HA 5BYRA 2GMIC 4N59A 4IWPA 2NTSA 3AU5A 1YX5B 1JQ4A 2G4SA 4W9HA 2V3SA 4NJCA 1WGYA 1TYGB 4I6PA 1R4MI 5IN7A 3Q2AC 4WURA 4B6WA 2KAJA 4EKUA 4JPSA 1JRUA 2KFKB 2WXQA 3E56A 5IA7A 2RDBC 2JY6A 3VTVA 4FJVB 4W9DA 3GP7A 1SE4A 2INCC 4G3XB 1TT5B 2LUEA 2V1YA 1LQBA 4KGSA 4C7ZA 2QILA 4S17A 3O13A 3ZJTA 2AQ3B 1ZKHA 2BB6A 2JZ3B 3NY5A 1L0XB 3K9PB 4WWPA 2IYDB 2W82A 4FBJB 1HTOA 1MPEA 3UINB 3ZKJC 3AE8B 3H1UA 4II3B 3VRAB 3KH0A 5C1ZA 2JVCA 2BWES 3BVMA 4RM8A 5BMGA 2WQYB 5GXGB 2KQ4X 2LGYA 3IHPC 3SU8X 1X1MA 1EF5A 3NVYA 3NS8A 4JLCA 2WLBA 3VTWA 4KX6B 3UF8A 4GOCA 3A9KB 4HVBA 4WQMA 1F52A 2BVCA 2DZIA 2IJ0A 5EE9A 3R7RA 1K8RB 2WU2B 3DDCB 4IUMB 2IO1B 3Q3MC 1R4MB 1EWYC 1JALA 2L52A 3X0WA 2NTTA 2AQ1B 1NI3A 5D7GA 2WXRA 1UELA 4NAWB 2N7DA 2DBYA 1DGJA 1Q0WB 1OTRB 4ANVA 1E7UA 4RF0A 4XC2A 3T3NA 1E6EB 3MFGA 2KKCA 2KWVB 3TMPB 4HLEA 1GNUA 1D5MC 2PVOD 3EFUA 1BUIC 5KHQA 2G9HD 3KWLA 3WA0A 1T3QA 3ZNHB 5JXVA 2JPHA 3VFKA 2LXCA 5AUIA 3SDLC 2WGSA 3O65B 2KZRA 3HRDD 4II2B 1KJTA 1V8CA 1P7EA 1WM3A 3AE1B 3MHSD 3I3TB 1VZ7A 2ZCBA 3OLMD 4MDKE 2LZ6A 2Y5BB 4NJ7A 3AE3B 2EMTA 2L76A 4WWMA 4ZRPA 2IY1B 2C7MB 1ZDXA 3VUYA 2KN4A 2ZVOA 4M00A 1NI2A 3PREA 1WMHB 3A9JB 4GDLB 2X8XX 3BVGA 1GUAB 2N1VA 1E90A 1E7PB 2BS3B 4P7IA 1T0RC 3HVZA 1LO5D 3R3MA 2D3BA 1I4QA 1FNUA 1WZ0A 2UU7A 4HPPA 3SHQA 4MELA 2NR2A 1AW7A 3DVGX 1KLGD 1OFFA 1B9RA 4OVZA 1L6UA 1YJ1A 2V4IB 2FCSA 1UNSA 1QOBA 3I63C 1WRDB 4C4VA 1TS5A 2M56B 4GU2A 4LNKA 4HK2A 4AOFA 1K50A 1KRHA 2ZVNA 5IO9A 4FLHA 1WGKA 3SFDB 4ZRJA 2ZZPB 4MSQB 1E8WA 3NRZA 3P4PB 5IKCM 1V80A 2DZMA 3AE7B 1WGHA 1D5XC 2JWUA 3ZO5B 2HE7A 3HUIA 3V6CB 1K53A 3V60A 2AEHA 1UBQA 2I1JA 3NVVA 3GOEA 4F7ZA 2LGSA 2ZNVC 1YN3A 1AN8A 2O2VA 1R7SA 1MJDA 3P2BA 1WM2A 3IT6B 4OZCA 2IPKD 4EZLA 2JXXA 3AEGB 1CQVA 1CZPA 5AEKB 3RT3B 3QHTA 3M95A 1HXYD 2GI9A 3ETRA 3VDZA 5CHVC 2KN5A 2GOWA 2WXGA 3RNAC 3Q14C 5D3IB 4MGKE 4US8A 4XE0A 5I4DA 5C3JB 3ZDTA 4W9FA 1TKGA 1IPGA 2DENB 4RGNA 3MC8A 3MP9A 2VZKD 5CTRC 1LGRA 3AXCA 3MJ5A 1QKZA 5L83A 1GPXA 1YNTE 4HDOA 3EGRA 4K3CA 4E71A 2KK8A 4NAMA 5BMHA 4GSWA 2REXA 1TGZB 2IGHA 2MJEA 1MVKA 2KD0A 1F9JA 2PVGC 2ZNVB 4GDKA 2JZPA 5BMIA 1J7CA 4AWJA 4AQ7A 3SEBA 1L0VB 2KO3A 3L54A 2RD0A 4TMAB 4LJPB 3AV8A 4IW0A 4HJKA 3VHTC 4DK5A 2FIFA 2IO2B 3WAPA 5JHAA 5C2TB 4RGTA 2DLBA 3P4RB 3RZWC 4BFRA 2ZCCA 2K6DB 4PS3A 2PE9A 4YTPB 3Q8EA 2M4NA 4JQWC 4WWOA 3TCAA 3PZ8A 5D6JB 3AU4A 4P1CC 3PSEB 3EC8A 2PMVA 2BF8B 5E6PA 1DOXA 2N9PC 1FNVA 1HZ5A 4DWFA 1SXTA 3I5JC 4DBGA 3ZXRA 2G1EA 3PPAA 1NVID 2K6QA 2ICIA 3OG5A 2A4ZA 5HHDG 1IGCA 1L4DB 5BO4B 4C7YA 3U52E 4MT5A 1IBXA 2CS4A 3ZNZB 3R8BA 2L32A 1IBXB 3L10B 3ML9A 1C4CA 1WX9A 2WYQA 5G55A 3AEBB 2ASQA 2N9LA 2ZW1A 4MGYE 4XYCA 3Q69A 1WYWB 2MBBB 4MJSA 3DVNU 2GBNA 1AARA 3JW0X 5LXHA 2WXKA 4DDGD 1GJZA 1OGWA 4MJSB 3EHVA 3KYDD 4ANWA 1FNWA 1UGJA 2L8JA 3DVGY 3DWMA 2KFJA 3RNGC 3BVZA 3PRZA 4JL9A 3R2IA 4M02A 4CO7A 2BPSA 2WXHA 3BK1A 5DPTA 4REZA 3M3JA 3EECA 1I7HA 4ICVA 3BIID 3W1YA 4YXDB 3H7SA 1TIFA 3T3OA 1XLPA 4RGMA 2D3AA 3U8ZA 2WWZA 4NQLB 1QZEA 1FM0D 3DHHC 3WALA 2OEDA 1UBIA 3W5VB 2KMMA 4BVUC 5DPRA 1OQYA 3MHZA 2MCNB 1C4PA 2L05A 2XEWA 3S2AA 5G5GA 1WR6E 3TBLD 4TSSA 3PLUA 1E9MA 5FK9C 3GE8C 3N9YC 1SBBB 4M0WB 5LNK1 3LXFA 3JSVA 1XT9B 3QK0A 2QIEB 1AYFA 3QCAA 2MBQA 2MP2A 3DBSA 3HM3A 3CIRB 1V1OA 2JQRB 1GC6A 4G50A 4HJGE 4BOZB 1YD8U 4I6NB 1OEYA 4CHKA 2INDC 5D3DA 2WNMA 1ZW7A 3NJTA 3U7DA 3R7QA 1WI0A 3QIJA 1TS3A 3AM9A 3KWVA 3OWEB 4M8MA 1QLBB 1L2NA 1WXQA 1KFYB 2L7RA 4OZBA 1TZ1A 3GB1A 2QMTA 4NZLB 4LCDE 1ENFA 3ZRCA 3P42A 3AH7A 4FJZA 2C7HA 2J42A 1SB3C 3PVLA 4NY0A 2ZPYA 1JROA 4ITKA 3RNEC 2G4DB 2J53A 4LJOB 5EDSA 4TUUA 2C9WB 2BYTA 2UWQA 4YTNB 2R2OA 4YSYB 3BWUD 4GB9A 4F8CB 4LNNA 1ISNA 2XK5A 3TSSA 1U4AA 1YX6B 1QT9A 3AEFB 5LXIB 3RI7C 3I9V1 2MRPA 4JWUC 4AS1A 1YOVB 1J7AA 4WJPA 1YQ4B 4ICUA 1WXAA 2R2QA 2FCNA 1WGGA 1XCQL 2DAFA 2EKEC 2FBWB 1KLUD 2IZVB 4LDTB 1T6BX 1V2YA 4W9JA 1SGHA 3RD2A 3AMZA 3EA6A 2N4FA 1C1YB 1ET9A 3UGBB 2K8CA 3RNFC 4HWIB 4NJ6A 1R4NI 4YT0B 2KFKA 5CX3A 5T8IA 2LASA 4NPNA 3ZJUA 5E6NA 3DHGC 1L0YB 3U30A 1I35A 1XXGA 1WWTA 2MJ3A 3M62B 1FCCC 2MX2A 3N20C 1XLQA 3QJZA 4KV2A 1Z5SB 3VTUA 1EWCA 2LRWA 1ZXIA 2DX5B 1KTKA 4J3OD 3PO0A 1Q10A 4LTUA 2K25A 2RDGA 2QDFA 4AJWA 2JYTA 1B1ZA 2YVCA 4MGZE 4WJQA 4DHZE 2IBIB 1TJEA 5AZHA 4DXFA 2GBKA 1C79A 2KXJA 1RLFA 3A4RA 3W2DA 2BQQA 1RYJA 2D3CA 3A9KA
chains in the Genus database with same CATH topology
1T0QC 3RI7C 3GE8C 2INDC 3N1XC 3RNFC 3N20C 3RNBC 3DHIC 3RNEC 4P1CC 3I63C 3RMKC 3DHHC 3Q3OC 3RNGC 3GE3C 3Q3MC 3Q2AC 1T0RC 3N1YC 3Q3NC 3RNCC 3N1ZC 3I5JC 3DHGC 2RDBC 1T0SC 3RN9C 4P1BC 2INCC 3Q14C 3RNAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Q C;  3RI7 C;  3GE8 C;  2IND C;  3N1X C;  3RNF C;  3N20 C;  3RNB C;  3DHI C;  3RNE C;  4P1C C;  3I63 C;  3RMK C;  3DHH C;  3Q3O C;  3RNG C;  3GE3 C;  3Q3M C;  3Q2A C;  1T0R C;  3N1Y C;  3Q3N C;  3RNC C;  3N1Z C;  3I5J C;  3DHG C;  2RDB C;  1T0S C;  3RN9 C;  4P1B C;  2INC C;  3Q14 C;  3RNA C; 
#chains in the Genus database with same CATH topology
 2WX1 A;  4ZHP A;  1BXT A;  3H8H A;  3VH4 B;  3CWI A;  3RYT A;  2ZJD A;  2M17 A;  1SE9 A;  4K7U A;  3Q8A A;  2QSD A;  5FKA C;  3PZ7 A;  2KDM A;  3PLV A;  1R4N B;  1C77 A;  4NAW A;  4A6Q A;  4LNF A;  3APC A;  1F1H A;  2BT6 A;  3A4S C;  2W3R A;  3ONS A;  4RGO S;  1UD7 A;  1ZDV A;  2IDY A;  4FUL A;  1D4B A;  3NG0 A;  2KHW B;  2BKF A;  4XWW A;  1A70 A;  2OOB B;  2BYE A;  2W3S A;  4BKT A;  1E7V A;  3VH3 B;  4R3D A;  3IAS 1;  4ASW C;  2LI5 A;  5EE3 A;  2G3Q B;  2I1K A;  1E8Z A;  2MEK A;  2EKI A;  4WAF A;  1WH3 A;  3AI5 A;  4BZA A;  2D10 A;  5J2R A;  3VQI A;  2AX5 A;  4HCP B;  3RPF C;  1JWS D;  5J18 A;  1WJN A;  1RM6 C;  4WQO B;  4P6V F;  1WY8 A;  3L4P A;  1RFK A;  1WMH A;  3ZUN A;  2JT4 B;  3A9J A;  1OQR A;  4GDL A;  2D11 A;  1T0Q C;  2BYF A;  4FXC A;  2NPT A;  1HTQ A;  2N0S B;  1P1A A;  3RCZ A;  1YN5 A;  2BTE A;  2HJ1 A;  2J4X A;  1EUV B;  1JML A;  2NPT B;  1HEZ E;  4PT5 A;  2W55 A;  4DDI D;  4OZA A;  3J9C A;  4NQK E;  3KYC D;  1VR9 A;  3B1L X;  2I38 A;  2QEJ C;  3WAO A;  1XEE A;  2PW9 A;  2QC8 A;  2LFI A;  4BAX A;  2QJL A;  3DQV A;  1F0Z A;  3AUL A;  3N3K B;  3Q3O C;  1C78 A;  2OHF A;  3FIL B;  1S1Q B;  2LGX A;  3ZRF A;  5MPO A;  1WYG A;  1J8C A;  4J6I A;  1ACC A;  4IOI E;  2WXN A;  2J52 A;  3DOW A;  4L1B A;  4ARC A;  1HZ6 A;  1ROE A;  1TTN A;  1IP9 A;  4MH0 E;  1JWA D;  4ZRQ A;  2CU1 A;  4PYU A;  4HPM B;  1WJ4 A;  4S0R A;  2J7Q B;  3LDZ E;  3L13 A;  4DXG A;  1HQR D;  4IDI A;  3JVZ X;  2KTR B;  3BYT B;  3E9S A;  4GXB A;  4X57 B;  2E3T A;  4YTM B;  4H2A A;  2MBE A;  4K7S A;  2KMC A;  1VZ6 A;  2KJ6 A;  2NBW B;  4W9L A;  2LD9 A;  1HE8 A;  3TEY A;  1UH6 A;  1WX7 A;  2AQ2 B;  3RUL A;  2KAC A;  4XWT A;  4C80 A;  1WF9 A;  4WIP A;  3URY A;  3L08 A;  3UIP B;  1VJK A;  4OHJ A;  2JUO A;  1E8Y A;  2E6X A;  1FIQ A;  4W9K A;  1TZO A;  1CJE A;  3HM6 X;  5CHW A;  5KHO A;  4B0M A;  1K52 A;  2CHW A;  5FR6 A;  1EU4 A;  1ZE3 D;  2AYO B;  1UUP A;  2LJI A;  2KVR A;  4BBN F;  3N1X C;  2KYW A;  3IG3 A;  2LVO A;  1GAQ B;  2O6V B;  2GBM A;  2JXT A;  3NVZ A;  4QAY A;  1N61 A;  4IM3 A;  5TR5 A;  1P7F A;  2FCQ A;  3V05 A;  3ZGZ A;  1KH0 A;  4LNO A;  4LLG M;  5G2N A;  1A5R A;  1UGM A;  2MH7 A;  5LLI A;  3BY4 B;  2NS5 A;  2KT7 A;  3ZQ4 A;  1WE7 A;  2D3G A;  3ML8 A;  4KSL C;  3SD5 A;  2MBH A;  3C19 A;  2CR5 A;  1N5W A;  3IVF A;  2N7J A;  5D94 A;  5L95 C;  3SFE B;  2KDB A;  2DAJ A;  2WDQ B;  3B08 A;  1FEH A;  3TIX A;  4BKS A;  1TBE A;  1F77 A;  2V3N A;  3BIN A;  3QQ8 B;  4LK0 M;  3Q3F A;  5DPW A;  5JHB A;  1ZXH A;  1QOF A;  2OJW A;  3IAM 1;  1OQQ A;  2JRI B;  2LGD A;  1SE2 A;  2EMS A;  3NZS A;  1PYW D;  1PQS A;  1IYF A;  3U4E G;  2MHJ A;  1GB1 A;  2M19 A;  5TSS A;  4YL8 A;  3DBH I;  4XZ4 A;  3NZ3 A;  3GZN I;  5E6O A;  1V1P A;  4WJN A;  2NCN A;  1V1P B;  2C7N B;  5E6J A;  2WDT B;  1NEK B;  1JW9 D;  2LHE A;  4JX1 C;  3NZU A;  2QCZ A;  4DHJ D;  2J0K A;  1WSP A;  4ZHO A;  5DPS A;  4JE3 B;  1FMA D;  4GIV A;  1MG8 A;  1YQ3 B;  3WIM A;  1RWS A;  1SEB D;  4EZK A;  2MSE D;  2Z0D B;  5AZG A;  1C9F A;  1SJH D;  3Q8B A;  2KWC A;  3I57 A;  3DCG A;  4ZRI A;  3Q3J A;  2R61 A;  4G11 A;  1F2R I;  4HPL B;  3UQB A;  3D32 A;  3BYY B;  2BW2 A;  3TJP A;  2DWQ A;  1YJJ A;  3PHW B;  3ZW3 A;  2YLM A;  4JGH B;  1TKE A;  4TQ1 A;  1E0Z A;  1KOT A;  2INN E;  3ENE A;  3H6N A;  1LM8 B;  2C60 A;  4P16 A;  3TEZ A;  5IP4 D;  2CJN A;  4BBN C;  3CMM B;  1XCT L;  1N5X A;  2WXL A;  2WX0 A;  3UIO B;  4A55 A;  3B2F A;  1L4Z B;  1QQR A;  1DYQ A;  2ZPN A;  3HK0 A;  3KUC B;  3PZD A;  2LWP A;  1SIF A;  3DBH B;  2XNA C;  3GZN B;  3AE4 B;  1STE A;  4TKN A;  2Y5C A;  3T9L A;  2V3P A;  5AUK A;  1YQB A;  4ZDV A;  4ANU A;  4HXD A;  2WP9 B;  2LXA A;  4RH6 A;  2DZK A;  1YMH E;  4W9C A;  1ZUD 2;  3ZXV A;  4ZYS A;  4M0W A;  3X23 A;  4RCO A;  2SEB D;  3AEC B;  3RNB C;  2NBV B;  2L0T A;  2KX0 A;  4N9F 4;  1E5W A;  4FHK A;  1C4A A;  4L23 A;  2WXP A;  4FA6 A;  2G45 B;  3H9D A;  2GBJ A;  2EEL A;  1CK1 A;  4KGR A;  4B95 A;  1J7B A;  4KVG B;  4XGA B;  3H7P B;  2RR9 A;  4US9 A;  4RF1 A;  3P4S B;  3IFW B;  2DYM A;  2LVP A;  1NBF C;  4HCN B;  4PYZ A;  3AN1 A;  2BBC A;  4BKS D;  2KTF A;  2JX5 A;  2K1F A;  4MH8 A;  4PS8 A;  4O1N A;  2FAZ A;  1BT0 A;  1L6V A;  4C56 C;  1PGX A;  4KDI C;  2L00 B;  5JH5 C;  2WU5 B;  1HA5 A;  5HG2 A;  2HTH A;  4IWQ A;  2M8S A;  5H92 C;  4EZJ A;  1SSN A;  2L83 A;  3PTF C;  3PT2 B;  2BB5 A;  1E10 A;  4KZ0 A;  2KAN A;  3AEA B;  4KIK B;  4I6L B;  1JWB D;  4OVU A;  2Z8L A;  4RMA A;  5C23 A;  1EU3 A;  2HJ8 A;  3B2G A;  1T5X D;  3BZD B;  2JF5 A;  1WE6 A;  3TEW A;  2KC1 A;  4M8N A;  5GMV A;  1WGR A;  2CKH B;  2RGF A;  3ZTD A;  2WXM A;  3DPD A;  2KNB A;  2RPQ A;  3FAH A;  2KDE B;  1KM7 A;  2MWS B;  1BML C;  2WDR B;  3OJ3 A;  1NEN B;  3EUB 2;  2IO0 B;  2DHZ A;  1MG4 A;  3L16 A;  4G0N B;  4C00 A;  1V5T A;  3Q6B A;  2IGG A;  2KX3 A;  2MQJ A;  3HHM A;  3C0R B;  5HKH A;  3RMK C;  4BOS C;  2B3A A;  3VUW A;  4M01 A;  5HFY A;  2WS3 B;  3TEX A;  3AE6 B;  3PGE A;  1KF6 B;  3NUH B;  4OW0 A;  4USA A;  1ZGU B;  5CHF A;  2BKR B;  3ALB A;  3A33 B;  3LB8 C;  4F1S A;  2N9X A;  4WJO A;  3V62 A;  1V6E A;  2CU3 A;  2DYB A;  1IGD A;  1MHX A;  3AE9 B;  1L5P A;  2WDV B;  2FE8 A;  2WXF A;  2PJH A;  1Q5W B;  3K9O B;  3P4Q B;  2NMQ A;  1V9J A;  5DCN A;  1WXV A;  1D3Z A;  4RM9 A;  5G5H A;  3PV1 A;  4ARI A;  2YEP F;  2VRR B;  1GG3 A;  1LXD A;  1VRA B;  4KKI A;  4CQN A;  3R2T A;  3R66 C;  1P98 A;  4W9I A;  2DYO A;  1WZ3 A;  1VD2 A;  4K1R B;  1WX8 A;  4WAA A;  1V97 A;  1N60 A;  1FXT B;  1XF5 L;  4XDC A;  2B76 B;  2V0G A;  3QWZ B;  2RMM A;  3PRP B;  3QAR A;  4K81 A;  4N58 A;  1XO3 A;  4HKZ E;  3A1Q A;  3Q8F A;  4AJY B;  4HRO A;  4KZC A;  3ABV B;  1H4R A;  2PTL A;  1WXM A;  3A1Q B;  4L2Y A;  4D2K A;  4IC7 B;  3ZIM A;  1ZP0 B;  5D2M B;  2KJH B;  1QF6 A;  1I4G A;  2M0X A;  4MSM B;  1MFW A;  4JWS C;  1RFA A;  1VDV A;  2KQ7 A;  4N6E B;  4FN2 A;  5JZE B;  3KUZ A;  2VZK B;  2WXI A;  5HI1 A;  3VVW B;  4W9E A;  3AB5 A;  1WXS A;  2QHO A;  4IG7 B;  2XBB C;  1WIA A;  1N6Z A;  2GBR A;  4CYE A;  2CJO A;  4PK1 A;  4KGT A;  4LDT D;  2KDF B;  2AL6 A;  1FXA A;  1FRR A;  3QC8 B;  2PPH A;  4TV3 A;  2WXO A;  2ONQ A;  3AEE B;  1D6E C;  2AL3 A;  2KWU B;  2BWF A;  4PS7 A;  4B9K A;  3RNC C;  2ON8 A;  1J19 A;  3NS1 A;  3QAQ A;  4HRS A;  2K39 A;  3RN9 C;  3APD A;  1Q1O A;  3NHE B;  4RNA A;  4ZOH C;  5EE1 A;  3ZTC A;  1KLV A;  1XQQ A;  3C8Y A;  1P0R A;  2KLC A;  1H8C A;  2K3U A;  2NVU I;  2KDI A;  3FIL A;  3U2S C;  3GE3 C;  3PS6 A;  1QOA A;  2CHX A;  2PE6 B;  4YSX B;  1TKY A;  2KMA A;  1OEY J;  3HIZ A;  5EE0 A;  1FO4 A;  4XDD A;  1V49 A;  4DHJ B;  4K7W A;  2Y5P A;  3V3X A;  3DBL I;  2KTR A;  1P3Q U;  2V9H A;  4C4V B;  1JCK B;  3VUX A;  1FRD A;  1YN4 A;  4W9G A;  4Q2J A;  3N1Z C;  4A9A A;  3KVF B;  4HKQ A;  2M1M A;  3ZVV A;  3ZNG C;  2X38 A;  3ZYY X;  1FD6 A;  1FFU A;  3TL5 A;  2N1W A;  2OJR A;  4A8X C;  2KVZ A;  1CMX B;  2K9X A;  2FID A;  2HTM E;  1MI0 A;  3KLS X;  1FFV A;  3FKY A;  4FJY A;  2IY0 B;  1C76 A;  1UZX B;  4A3P A;  3W1S C;  3N1Y C;  3WAM A;  2IO3 B;  4EE2 A;  4EUT A;  1V86 A;  2H88 B;  1M4V A;  2JZZ A;  3IBE A;  2L0F A;  2W9N A;  1WJU A;  1N63 A;  1PDX A;  2O6V A;  2O2V B;  1PGB A;  1V5O A;  3AE5 B;  1SJE D;  3B0A A;  2ACZ B;  3ZDM C;  1WFY A;  2YEP B;  1WRI A;  1GB4 A;  2KOX A;  3N30 A;  2D07 B;  2H89 B;  1JRP A;  3W9C B;  4FAD A;  3V6E B;  2DZJ A;  3DWG C;  3APF A;  2L3Z A;  1DOI A;  1YJI A;  3CSF A;  2PEA A;  4XX5 A;  4ZYN A;  4ZRK A;  4IWO A;  1UWX A;  2K8B A;  2PKO A;  1PFD A;  4UDU C;  1UWM A;  1FXI A;  2LUM A;  1PGA A;  2LEK A;  2NBU A;  1EM7 A;  3DBL B;  4MM3 A;  1I4P A;  3W1S A;  4AP4 C;  1TS2 A;  1VCB A;  2IGD A;  2WXJ A;  1T0S C;  4MM3 B;  4EFO A;  2J0J A;  1QIL A;  4A3O A;  3MC0 B;  2JU6 X;  1RAX A;  2MW5 A;  2RPV A;  1GOZ A;  2XN9 C;  3ZJV A;  1TY0 A;  3QX1 A;  3PHX B;  2K5P A;  4JIO U;  2BYV E;  4ANX A;  2MJD A;  2ZW0 A;  1WJ6 A;  4GDK B;  1C3T A;  4KSK C;  4FHJ A;  3KW5 B;  1J0G A;  3Q8C A;  2MA9 B;  3WAN A;  1I42 A;  4URK A;  2FNJ B;  4ACF A;  3QA8 A;  2M0A A;  3VAW A;  2JWZ A;  1N62 A;  3NVW A;  3L17 A;  2VH1 A;  1EO6 A;  3IXS A;  4A90 A;  2FUG 1;  1UF0 A;  1FCL A;  5H8Y E;  2PIA A;  1M94 A;  4IM0 A;  3DVN V;  2N9E B;  2HD5 B;  2K22 A;  3VXW A;  3CST A;  2I2Y A;  2VH2 A;  3AED B;  2GRI A;  2ZEQ A;  3UI3 A;  2HDE A;  2MBO A;  4TQ0 A;  3NOB A;  3P63 A;  1F2R C;  1Y56 A;  1L7Y A;  1RRB A;  1Z2M A;  3P1M A;  3GS2 A;  1ZPS A;  4K3B A;  3Q3N C;  3HVD A;  1XLO A;  3JYU A;  2FCM A;  4GN1 A;  1T0Y A;  1JWM D;  3UQA A;  3ZLZ A;  2TSS A;  1WR1 A;  2JYE A;  1JWU D;  3CF6 E;  3B9J A;  3SR6 A;  5J17 A;  4EOY A;  2A5U A;  4KDL B;  2LJ5 A;  4YWG G;  1IUE A;  1NYR A;  1GC7 A;  1SIJ A;  1ZOY B;  2C5L C;  2KC2 A;  2LRU A;  4WH4 A;  3KUD B;  2SAK A;  1XLN A;  1V81 A;  4OVV A;  4AUQ C;  2O6V D;  3VR9 B;  3MC9 A;  3V61 A;  1SE3 A;  2DNF A;  1NDD A;  4E3C A;  3WCQ A;  2LGI A;  3T8M A;  1VZ8 A;  3ECI A;  2JRH A;  1LFD A;  1SF0 A;  2JSV X;  1I4X A;  2LMC A;  3FC4 A;  5BYQ A;  2LHD A;  2KWD A;  2GLS A;  4BKG A;  2J0M A;  3W5U B;  2AWT A;  4GLS C;  4GGQ A;  2LVQ A;  2PLP A;  3OAW A;  4HDQ A;  3M63 B;  2KJR A;  4P1B C;  4E74 A;  5IAA C;  4DHZ B;  2MLB A;  1YIW A;  3H7P A;  2W54 A;  1FPY A;  2N7E A;  2K8H A;  3DHI C;  3DBR I;  4MGI E;  4HEA 1;  1E8X A;  3JSV B;  2FUH B;  4A20 A;  5IOI A;  4GMV A;  2MP2 B;  3KQ4 A;  2CHZ A;  3MJW A;  4DQO C;  2Z0E B;  2D5G A;  3VR8 B;  1K51 A;  3VRB B;  2BS2 B;  1G6J A;  4WWN A;  3IT4 B;  1I4R A;  2WHI A;  1WGD A;  4MAC A;  1ET6 A;  4RFB A;  4MEM A;  1Y8R C;  1VLB A;  2BS4 B;  1D5Z C;  1EF1 A;  1NYQ A;  3L0W B;  2RSU A;  4YSZ B;  2BGF A;  2L1A A;  3N32 A;  3BK2 A;  3U7Z A;  1TY2 A;  5FR3 A;  3EFC A;  3LYY A;  2D2Q A;  2KQS A;  4LNI A;  4KIK A;  4NNJ B;  4IKG A;  2Q5W D;  3RFZ B;  1DOY A;  4IM2 A;  5BYS A;  2RDH A;  3MTN B;  1TS4 A;  3ZNI D;  1ESF A;  2GB1 A;  1PUT A;  2Y3A A;  2KLG A;  5AZF A;  2K0P A;  1MHH E;  3RZF A;  1QOG A;  3OJ4 B;  2XK5 B;  4DXA B;  2N9K A;  3PRM B;  4KKJ A;  1AWD A;  2Z59 B;  3LJ3 A;  1P9D U;  1S3S G;  4EEW A;  2UYZ B;  4B0E A;  3AE2 B;  2INP E;  1XD3 B;  3TUO A;  2V4L A;  3DBR B;  3RUI B;  1I4H A;  5BYR A;  2GMI C;  4N59 A;  4IWP A;  2NTS A;  3AU5 A;  1YX5 B;  1JQ4 A;  2G4S A;  4W9H A;  2V3S A;  4NJC A;  1WGY A;  1TYG B;  4I6P A;  1R4M I;  5IN7 A;  3Q2A C;  4WUR A;  4B6W A;  2KAJ A;  4EKU A;  4JPS A;  1JRU A;  2KFK B;  2WXQ A;  3E56 A;  5IA7 A;  2RDB C;  2JY6 A;  3VTV A;  4FJV B;  4W9D A;  3GP7 A;  1SE4 A;  2INC C;  4G3X B;  1TT5 B;  2LUE A;  2V1Y A;  1LQB A;  4KGS A;  4C7Z A;  2QIL A;  4S17 A;  3O13 A;  3ZJT A;  2AQ3 B;  1ZKH A;  2BB6 A;  2JZ3 B;  3NY5 A;  1L0X B;  3K9P B;  4WWP A;  2IYD B;  2W82 A;  4FBJ B;  1HTO A;  1MPE A;  3UIN B;  3ZKJ C;  3AE8 B;  3H1U A;  4II3 B;  3VRA B;  3KH0 A;  5C1Z A;  2JVC A;  2BWE S;  3BVM A;  4RM8 A;  5BMG A;  2WQY B;  5GXG B;  2KQ4 X;  2LGY A;  3IHP C;  3SU8 X;  1X1M A;  1EF5 A;  3NVY A;  3NS8 A;  4JLC A;  2WLB A;  3VTW A;  4KX6 B;  3UF8 A;  4GOC A;  3A9K B;  4HVB A;  4WQM A;  1F52 A;  2BVC A;  2DZI A;  2IJ0 A;  5EE9 A;  3R7R A;  1K8R B;  2WU2 B;  3DDC B;  4IUM B;  2IO1 B;  3Q3M C;  1R4M B;  1EWY C;  1JAL A;  2L52 A;  3X0W A;  2NTT A;  2AQ1 B;  1NI3 A;  5D7G A;  2WXR A;  1UEL A;  4NAW B;  2N7D A;  2DBY A;  1DGJ A;  1Q0W B;  1OTR B;  4ANV A;  1E7U A;  4RF0 A;  4XC2 A;  3T3N A;  1E6E B;  3MFG A;  2KKC A;  2KWV B;  3TMP B;  4HLE A;  1GNU A;  1D5M C;  2PVO D;  3EFU A;  1BUI C;  5KHQ A;  2G9H D;  3KWL A;  3WA0 A;  1T3Q A;  3ZNH B;  5JXV A;  2JPH A;  3VFK A;  2LXC A;  5AUI A;  3SDL C;  2WGS A;  3O65 B;  2KZR A;  3HRD D;  4II2 B;  1KJT A;  1V8C A;  1P7E A;  1WM3 A;  3AE1 B;  3MHS D;  3I3T B;  1VZ7 A;  2ZCB A;  3OLM D;  4MDK E;  2LZ6 A;  2Y5B B;  4NJ7 A;  3AE3 B;  2EMT A;  2L76 A;  4WWM A;  4ZRP A;  2IY1 B;  2C7M B;  1ZDX A;  3VUY A;  2KN4 A;  2ZVO A;  4M00 A;  1NI2 A;  3PRE A;  1WMH B;  3A9J B;  4GDL B;  2X8X X;  3BVG A;  1GUA B;  2N1V A;  1E90 A;  1E7P B;  2BS3 B;  4P7I A;  1T0R C;  3HVZ A;  1LO5 D;  3R3M A;  2D3B A;  1I4Q A;  1FNU A;  1WZ0 A;  2UU7 A;  4HPP A;  3SHQ A;  4MEL A;  2NR2 A;  1AW7 A;  3DVG X;  1KLG D;  1OFF A;  1B9R A;  4OVZ A;  1L6U A;  1YJ1 A;  2V4I B;  2FCS A;  1UNS A;  1QOB A;  3I63 C;  1WRD B;  4C4V A;  1TS5 A;  2M56 B;  4GU2 A;  4LNK A;  4HK2 A;  4AOF A;  1K50 A;  1KRH A;  2ZVN A;  5IO9 A;  4FLH A;  1WGK A;  3SFD B;  4ZRJ A;  2ZZP B;  4MSQ B;  1E8W A;  3NRZ A;  3P4P B;  5IKC M;  1V80 A;  2DZM A;  3AE7 B;  1WGH A;  1D5X C;  2JWU A;  3ZO5 B;  2HE7 A;  3HUI A;  3V6C B;  1K53 A;  3V60 A;  2AEH A;  1UBQ A;  2I1J A;  3NVV A;  3GOE A;  4F7Z A;  2LGS A;  2ZNV C;  1YN3 A;  1AN8 A;  2O2V A;  1R7S A;  1MJD A;  3P2B A;  1WM2 A;  3IT6 B;  4OZC A;  2IPK D;  4EZL A;  2JXX A;  3AEG B;  1CQV A;  1CZP A;  5AEK B;  3RT3 B;  3QHT A;  3M95 A;  1HXY D;  2GI9 A;  3ETR A;  3VDZ A;  5CHV C;  2KN5 A;  2GOW A;  2WXG A;  3RNA C;  3Q14 C;  5D3I B;  4MGK E;  4US8 A;  4XE0 A;  5I4D A;  5C3J B;  3ZDT A;  4W9F A;  1TKG A;  1IPG A;  2DEN B;  4RGN A;  3MC8 A;  3MP9 A;  2VZK D;  5CTR C;  1LGR A;  3AXC A;  3MJ5 A;  1QKZ A;  5L83 A;  1GPX A;  1YNT E;  4HDO A;  3EGR A;  4K3C A;  4E71 A;  2KK8 A;  4NAM A;  5BMH A;  4GSW A;  2REX A;  1TGZ B;  2IGH A;  2MJE A;  1MVK A;  2KD0 A;  1F9J A;  2PVG C;  2ZNV B;  4GDK A;  2JZP A;  5BMI A;  1J7C A;  4AWJ A;  4AQ7 A;  3SEB A;  1L0V B;  2KO3 A;  3L54 A;  2RD0 A;  4TMA B;  4LJP B;  3AV8 A;  4IW0 A;  4HJK A;  3VHT C;  4DK5 A;  2FIF A;  2IO2 B;  3WAP A;  5JHA A;  5C2T B;  4RGT A;  2DLB A;  3P4R B;  3RZW C;  4BFR A;  2ZCC A;  2K6D B;  4PS3 A;  2PE9 A;  4YTP B;  3Q8E A;  2M4N A;  4JQW C;  4WWO A;  3TCA A;  3PZ8 A;  5D6J B;  3AU4 A;  4P1C C;  3PSE B;  3EC8 A;  2PMV A;  2BF8 B;  5E6P A;  1DOX A;  2N9P C;  1FNV A;  1HZ5 A;  4DWF A;  1SXT A;  3I5J C;  4DBG A;  3ZXR A;  2G1E A;  3PPA A;  1NVI D;  2K6Q A;  2ICI A;  3OG5 A;  2A4Z A;  5HHD G;  1IGC A;  1L4D B;  5BO4 B;  4C7Y A;  3U52 E;  4MT5 A;  1IBX A;  2CS4 A;  3ZNZ B;  3R8B A;  2L32 A;  1IBX B;  3L10 B;  3ML9 A;  1C4C A;  1WX9 A;  2WYQ A;  5G55 A;  3AEB B;  2ASQ A;  2N9L A;  2ZW1 A;  4MGY E;  4XYC A;  3Q69 A;  1WYW B;  2MBB B;  4MJS A;  3DVN U;  2GBN A;  1AAR A;  3JW0 X;  5LXH A;  2WXK A;  4DDG D;  1GJZ A;  1OGW A;  4MJS B;  3EHV A;  3KYD D;  4ANW A;  1FNW A;  1UGJ A;  2L8J A;  3DVG Y;  3DWM A;  2KFJ A;  3RNG C;  3BVZ A;  3PRZ A;  4JL9 A;  3R2I A;  4M02 A;  4CO7 A;  2BPS A;  2WXH A;  3BK1 A;  5DPT A;  4REZ A;  3M3J A;  3EEC A;  1I7H A;  4ICV A;  3BII D;  3W1Y A;  4YXD B;  3H7S A;  1TIF A;  3T3O A;  1XLP A;  4RGM A;  2D3A A;  3U8Z A;  2WWZ A;  4NQL B;  1QZE A;  1FM0 D;  3DHH C;  3WAL A;  2OED A;  1UBI A;  3W5V B;  2KMM A;  4BVU C;  5DPR A;  1OQY A;  3MHZ A;  2MCN B;  1C4P A;  2L05 A;  2XEW A;  3S2A A;  5G5G A;  1WR6 E;  3TBL D;  4TSS A;  3PLU A;  1E9M A;  5FK9 C;  3GE8 C;  3N9Y C;  1SBB B;  4M0W B;  5LNK 1;  3LXF A;  3JSV A;  1XT9 B;  3QK0 A;  2QIE B;  1AYF A;  3QCA A;  2MBQ A;  2MP2 A;  3DBS A;  3HM3 A;  3CIR B;  1V1O A;  2JQR B;  1GC6 A;  4G50 A;  4HJG E;  4BOZ B;  1YD8 U;  4I6N B;  1OEY A;  4CHK A;  2IND C;  5D3D A;  2WNM A;  1ZW7 A;  3NJT A;  3U7D A;  3R7Q A;  1WI0 A;  3QIJ A;  1TS3 A;  3AM9 A;  3KWV A;  3OWE B;  4M8M A;  1QLB B;  1L2N A;  1WXQ A;  1KFY B;  2L7R A;  4OZB A;  1TZ1 A;  3GB1 A;  2QMT A;  4NZL B;  4LCD E;  1ENF A;  3ZRC A;  3P42 A;  3AH7 A;  4FJZ A;  2C7H A;  2J42 A;  1SB3 C;  3PVL A;  4NY0 A;  2ZPY A;  1JRO A;  4ITK A;  3RNE C;  2G4D B;  2J53 A;  4LJO B;  5EDS A;  4TUU A;  2C9W B;  2BYT A;  2UWQ A;  4YTN B;  2R2O A;  4YSY B;  3BWU D;  4GB9 A;  4F8C B;  4LNN A;  1ISN A;  2XK5 A;  3TSS A;  1U4A A;  1YX6 B;  1QT9 A;  3AEF B;  5LXI B;  3RI7 C;  3I9V 1;  2MRP A;  4JWU C;  4AS1 A;  1YOV B;  1J7A A;  4WJP A;  1YQ4 B;  4ICU A;  1WXA A;  2R2Q A;  2FCN A;  1WGG A;  1XCQ L;  2DAF A;  2EKE C;  2FBW B;  1KLU D;  2IZV B;  4LDT B;  1T6B X;  1V2Y A;  4W9J A;  1SGH A;  3RD2 A;  3AMZ A;  3EA6 A;  2N4F A;  1C1Y B;  1ET9 A;  3UGB B;  2K8C A;  3RNF C;  4HWI B;  4NJ6 A;  1R4N I;  4YT0 B;  2KFK A;  5CX3 A;  5T8I A;  2LAS A;  4NPN A;  3ZJU A;  5E6N A;  3DHG C;  1L0Y B;  3U30 A;  1I35 A;  1XXG A;  1WWT A;  2MJ3 A;  3M62 B;  1FCC C;  2MX2 A;  3N20 C;  1XLQ A;  3QJZ A;  4KV2 A;  1Z5S B;  3VTU A;  1EWC A;  2LRW A;  1ZXI A;  2DX5 B;  1KTK A;  4J3O D;  3PO0 A;  1Q10 A;  4LTU A;  2K25 A;  2RDG A;  2QDF A;  4AJW A;  2JYT A;  1B1Z A;  2YVC A;  4MGZ E;  4WJQ A;  4DHZ E;  2IBI B;  1TJE A;  5AZH A;  4DXF A;  2GBK A;  1C79 A;  2KXJ A;  1RLF A;  3A4R A;  3W2D A;  2BQQ A;  1RYJ A;  2D3C A;  3A9K A; 
#chains in the Genus database with same CATH homology
 1T0Q C;  3RI7 C;  3GE8 C;  2IND C;  3N1X C;  3RNF C;  3N20 C;  3RNB C;  3DHI C;  3RNE C;  4P1C C;  3I63 C;  3RMK C;  3DHH C;  3Q3O C;  3RNG C;  3GE3 C;  3Q3M C;  3Q2A C;  1T0R C;  3N1Y C;  3Q3N C;  3RNC C;  3N1Z C;  3I5J C;  3DHG C;  2RDB C;  1T0S C;  3RN9 C;  4P1B C;  2INC C;  3Q14 C;  3RNA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...