1AW7A

Q136a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
b'STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHALTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 56
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1997-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1aw7A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1aw7A01
1LTSD 5ELDA 1ET6A 1SE3A 2QEJC 1JQYD 1PRTC 1YN5A 1KTKA 2RDHA 1QILA 1RCVD 3URYA 5I4DA 3R8BA 2R61A 4L6TB 1TS3A 1PZKD 1LT3D 1AW7A 1GOZA 1SEBD 1FNVA 1AN8A 1I4GA 5FK9C 1EU3A 4BWGB 1PTOB 1TS4A 3W2DA 3TSSA 1CHQD 1BCPF 4OHJA 1EEID 1M4VA 4Z9CB 1S5ED 1F77A 1TY2A 4RFBA 1V1PB 1JWSD 1KLUD 2IPKD 5ELBA 2XNAC 1JWUD 5ELFA 1PTOC 1S5CD 1PZID 3BYTB 1S5FD 5FKAC 2AQ3B 1ET9A 4RH6A 5TSSA 1FD7D 2Z8LA 1CT1D 2SEBD 2NTTA 3MC0B 3BVZA 1D5MC 1CHPD 1XXGA 2WV6D 1YN4A 3DWPA 1EFID 1SBBB 1CK1A 3DWQA 5ELCA 1I4PA 2CHBD 2TSSA 1B44D 1ENFA 3BYYB 1I4XA 2XRQD 3DWAA 1XTCD 1PTOF 2AQ1B 1HTLD 1I4HA 1LTRD 1SE2A 1LLRD 2J4XA 5D3DA 1D6EC 1RDPD 1L0YB 3R2TA 1RF2D 3CHBD 3BVMA 3MFGA 1TY0A 4TSSA 1SXTA 1D5ZC 1FGBD 1S5DD 4RGTA 4NZLB 1BXTA 1SE4A 1HA5A 4L63B 1TS2A 4RHSA 2XRSD 1T5XD 3SEBA 4DXFA 3R2IA 1S5BD 4K6LA 1BCPD 1I4RA 3EA6A 2NTSA 1STEA 1DYQA 3EFXD 4O1NA 1LT6D 5ELEA 1EU4A 1PRTD 1MD2D 1LTTD 4RHRA 1TS5A 1SJED 2QILA 1V1PA 3KLSX 2ICIA 1L0XB 1LTGD 1EEFD 1LT5D 2IJ0A 2O2LD 1I4QA 1JCKB 1LTID 4RGOS 1CQVA 1HQRD 1PYWD 4DXGA 3OWEB 1RD9D 1FNWA 1UNSA 1LTBD 1PTOH 1SJHD 1LT4D 3BZDB 3O13A 1PZJD 1V1OA 5D3IB 1FNUA 1BCPB 1EWCA 1UUPA 1LTAD 1D5XC 2AQ2B 2RDGA 3GP7A 1JWMD 3V05A 4C56C 4ZYSA 1YN3A 1B1ZA 1KLGD 1PRTB 2XN9C 1LO5D 1PTOD 4UDUC 3BVGA 1JR0D 1DJRD 2G9HD 1PRTF 1G8ZD 4RGNA 1ESFA 4RCOA 1BCPC 1HXYD 4RGMA
chains in the Genus database with same CATH superfamily
1JW9D 3I57A 1VMPA 3AU5A 1Y14B 1K0SA 2LUMA 1PRTC 3ZJYC 1HA6A 2C9OA 2RDHA 4HSVA 4PG3A 4YWMA 1K51A 4L6TB 4EQPA 4FF2A 2HIVA 2CVRA 4KY7A 1T9HA 1C7YA 2EYLA 4P1BC 3UQBA 2WQYB 3HOYG 3U7ZA 3NG0A 4NXNQ 2N7DA 4IPGA 3VTVA 3AE5B 4JI2L 3K0XA 1A8VA 3TSSA 2LEKA 3EECA 4P16A 2B2TC 2YVCA 3ZDTA 2CHXA 1TY2A 4PNYA 3S1MH 3Q8DA 2KDEB 1YQBA 4LDTB 1CUKA 4IZ8A 1JORA 4JLCA 1PYSB 2PO4A 5EBDA 1DD2A 2KOLA 2MBBB 5FKAC 5C4XB 2KT7A 2BOSA 2IDYA 1VF7A 1TR5A 4LF5Q 2OTLA 1IP9A 4X64Q 2KQSA 4Q0FA 4A3IB 3IT6B 4JOIC 1YN4A 2DYMA 1BR9A 2GBKA 4DK6C 2E75C 3GV3A 2KLCA 3DHGC 3ZVVA 2WACA 3V61A 2AQ1B 5D94A 2L3ZA 4LF6L 1WTXA 2Y0SG 4GMVA 2K5NA 4B3SQ 2J4XA 1SNQA 4IWQA 3IG3A 2K52A 3H91A 1JT8A 2A73B 2OOBB 5IN7A 1RM6C 2N7EA 2D10A 1LYLA 2JA7G 4A9AA 2ACZB 2OJRA 3CCMA 1CKNB 3ERQA 3ITPA 2UXBL 2DYBA 1KDAA 4DR1Q 2IGDA 2KX0A 2OJWA 4MH0E 3ZW3A 1WE7A 2N4FA 5IP7H 3GTJB 1ENCA 2HT1A 4L23A 2B2TA 3STBC 4A3JB 4HCEA 1F9PA 1HZBA 1QKZA 5EDSA 4OO1G 3PGZA 3MEFA 4LF4L 4A3GG 3NTKA 1EUJA 5J1ZA 3KW5B 5IYBG 1QWYA 2F0SA 4KHPL 5C3WA 4TKOB 3IHPC 2PIAA 3NOBA 3RZFA 3SFEB 4AWJA 3I4MH 4TV3A 3FKIH 4I7AA 3H3VI 1EL0A 2ONQA 1HNWL 2EKIA 2L52A 2L15A 2F0UA 3RMHA 2L05A 2HTHA 1CA6A 3K7UC 2XGTA 1ZKOA 3ZTDA 2IJ0A 3C8YA 5NUCA 1PYWD 1TYGB 5BN3A 4X62L 3PO2G 3H7PA 3Q8FA 4MT5A 1U4MA 2INPE 2OQ0A 1PTOH 1C78A 2F0QA 1KH0A 1QCBD 3NY5A 5CC4A 2KD0A 3F2BA 3E9SA 3KWVA 4KSKC 2RF4A 3A74A 1QVGA 3H1UA 2I5HA 2OF1A 2L1BA 4OX9Q 1MKHA 1CFMA 4ITKA 4EEWA 2KWCA 1QZHA 4DN4M 5JEAG 2QEXA 1G6PA 2WXQA 4MZ9A 4K7SA 1Q81C 4L1BA 1KD1C 1A0IA 1WM2A 2NVTB 4DAYB 4RCOA 4DV5Q 1E7VA 4F8MA 3HRDD 4J1MA 4JI4Q 2IO3B 1STHA 2PQAA 1BT0A 4K5WA 4N9F4 1IL8A 4WQMA 3PGEA 3WAMA 3L08A 3P1HA 5L37A 1HH2P 3RLNA 2G45B 1XD3B 1KXLA 3KUZA 3NHEB 2UXCL 4ZDVA 4GN3B 1TS3A 1SLJA 4DAMA 1LT3D 2HUGA 1ZKHA 3CQZH 1HTPA 1T0SC 2KOXA 1YIJA 3RN5A 1E90A 4L5RC 5CV8A 1NUCA 5DNFA 3UINB 3GDEA 2LMCA 3AECB 5EE1A 2JE6I 2MO0A 4K0KL 4GXBA 1NMGA 3U52E 4DDID 5LMNQ 4O0AA 1XMOL 2V0GA 2OXPA 1TZOA 2EDGA 3T51B 3NJTA 4JI0Q 4DKAC 4HDQA 2I1JA 1B9MA 4XT3B 4DA2A 3U4EG 4AIMA 2KCCA 2BH2A 1BUVT 4B0EA 1KM7A 4BXXH 4DR4Q 2ZTCA 1T0YA 3PRMB 3UE1A 2X8XX 3BIID 4M0WA 1J0GA 4HK2A 3D3RA 2R6GA 2IX0A 3S2HB 2VB2X 1XQQA 2LWPA 5BN5A 3ICEA 1QOHA 1V5TA 2KVMA 3Q24A 4JI7Q 2BT6A 4K1RB 2KCTA 4A20A 5IGEA 2DJGC 3LDZE 3ND9A 2KFKA 4CKEA 4KX6B 1I4XA 2V1YA 4O2DA 1ML0D 1X56A 3JAMi 1TXYA 2BE5C 2JA8H 3MHSD 4DV2L 2MBHA 2E2HH 3A0JA 2NMQA 2DY8A 1HTQA 1BNZA 3S16B 1VCBA 3QK0A 2KUMA 2FCSA 2L76A 5EE9A 4A3BG 4QUCA 3B1LX 4TSSA 2ZW1A 1EY8A 2INNE 1VQ4A 3AFQA 2VUMB 1Q7YC 3S14B 2WYQA 4ANWA 1PFBA 2BKFA 4RHSA 3Q3JA 4TQ0A 1G51A 2XRSD 4JPBW 2K4KA 5LMUQ 1NSNS 1U9RA 2X6GA 4R8NA 1WMHA 2NPTA 3EFUA 4QCLA 3R2IA 1K8AC 1Z5SB 2BW2A 2DZKA 3A9JA 4KGSA 4MGYE 1F0ZA 4P71A 2WGSA 1STEA 5EPKA 3HOVB 5C0XG 5GMVA 3ZQ4A 5ELEA 3NVVA 4XYCA 4E74A 4C7ZA 2I2YA 1X3FA 4RHRA 4HEA1 3KDFB 4EZLA 1PH1A 4CDFC 1QVCA 1PH6A 3W5UB 2PZWA 4ZOHC 1MI2A 1M1KC 1HR0Q 2A5UA 4APVA 1UNSA 1QOGA 1B4OA 1LT4D 3I3CA 2DWQA 4DWFA 3ZUNA 3W1GA 2RHSB 2IW3A 4A3LG 4GLSC 1E24A 1FRDA 3VHTC 1BO0A 2LSSA 3C0RB 1VQBA 5IGFA 1HUNA 2AEHA 4M01A 3Q3MC 4V0BA 5C0XI 1IW7D 1KRTA 5M3FB 1N32L 2K14A 4P75A 1L1OB 3TRZA 2KX3A 4B3RQ 1NMFA 1IHZA 3VH4B 3GTQH 5C5LA 4LNQA 1HTOA 2O4XA 3SR1A 4E71A 3AMZA 2JA7H 2NCNA 1H9SA 3K80C 1P8LA 1CJEA 1V8CA 1WIAA 1STAA 1VZ7A 3R8BA 2N9XA 4ZRIA 4DV4Q 4AJWA 2KQ3A 2ZNVB 2F1MA 4OO1H 3QJZA 3F2UA 2KC2A 4JX1C 2R93G 4KIKB 1HZCA 1EWIA 2BKRB 1LXDA 3K5NA 4BWGB 4LNNA 4OZBA 2ZVNA 5JVG3 2IX1A 2WU5B 4WJWA 2NN6G 3LX0A 2Y5CA 2Z0EB 2PW7A 1I5FA 2KHWB 3DWGC 4PV1C 2D3GA 2RDFA 4Z9CB 3TIXA 1P1AA 3MJ5A 2ZTDA 3NBHA 1F9SA 5I6YA 4KJNA 1G6ZA 4PZ7A 1JWSD 2M1MA 2MPMA 5ELBA 1RHPA 5IP9H 3S1RH 3PO2H 4DR6Q 5IYCG 4EUTA 1PZID 4A3CG 1GUNA 1S5FD 4HCNB 2GB1A 3NRZA 1ET9A 5GQOA 1Q1OA 1GB4A 5EE3A 4CGYB 4JI6Q 1T0RC 1PXUA 3EUB2 1SB3C 3V6EB 4LK0M 5JEAJ 5D65A 3M4YA 3I90A 4IUUA 5JEAH 4DR3L 2OEDA 1U4LA 2XK5A 1OXTA 5IYDG 4GKJL 3GTOB 2W3RA 5AJ3Q 4YT0B 1QZGA 1CK1A 3IVFA 2KACA 3CC7A 3BWUD 1QUQA 3VA7A 5IT9c 2HD5B 4W9DA 4WWOA 4DDGD 1XTCD 4FULA 4OWTB 1SE8A 1V8QA 5FJ8G 4AOFA 3FKYA 4KHVA 2GBMA 3DUZA 1SNCA 2LXJA 2VY3A 4EVOA 2HHHL 1N60A 3K5LA 2EQSA 2WIIB 3AEGB 1TKGA 1SFOB 1O78A 2WXIA 4ZKCB 3AB9A 1LQBA 4FO2A 5M5XB 5C4JH 4RF0A 5IT9L 3T56B 2FBWB 4RF1A 3QC8B 5JHAA 3GB1A 1ZP0B 1LABA 2JX5A 2A19A 1TWHB 5EQ0A 3PIPA 5AUIA 1D4BA 2JXMB 5GAGC 1BCPD 3HOXB 1NYRA 4G3XB 3PO3B 5KYIA 1MGSA 1DM0B 5C44G 3GTKB 1FIQA 2ZPNA 4K8JA 1TT5B 2WXKA 3HOWH 2B39A 2LI5A 4EQNA 4HCPB 1TKWB 5HKHA 3WWVA 1KDCA 5FLXE 1S3OA 1FXIA 3JSVA 2WNMA 3DWMA 3KUCB 3MVVA 1QZEA 5JJLA 3Q69A 4JWSC 2FIFA 3VFKA 4G7ZC 1PDQA 4XXEA 2GA4B 1I4QA 4HKQA 4C3IB 1WXAA 3WOEA 1I3QH 1QQRA 4NQLB 3NSWA 3CCVA 2C60A 1VQNA 2XWJB 3RNFC 2DX5B 2O6VA 4GOPC 3DBSA 1SYCA 1TWAH 3DLLA 1L6UA 3A9KB 5J17A 4URKA 4IOAA 2KZRA 2KCMA 4YY3Q 3QR8A 3J80c 1YEZA 3TMEA 1PTOD 4KSLC 4IOCA 1JR0D 4B95A 1STNA 2MP2B 1IKMA 1FYCA 1SRUA 5FR6A 3ZIMA 2G9DA 3P2BA 4G57A 2QEJC 4AQYQ 4YWLA 3I4NB 2Y5PA 3PUYA 2GLSA 3V2TA 1C4QA 2EYHA 2GBNA 5DPRA 2R61A 4A4IA 3J80L 2KJHB 1ISNA 1XMQQ 1N5XA 4NAWA 1JMLA 1K8RB 2OCEA 5M3MH 1TKYA 3HVZA 2Q8TA 5C0XJ 1HFNA 4DUZL 2JWZA 3NUCA 2BVCA 4LUOA 4TQ1A 3NQIA 5E6NA 2C7NB 4AQ7A 2YLMA 1NNXA 2F0OA 5C6AA 4LF9Q 1N33L 1WXQA 2AX5A 3RZDB 2RSUA 2W55A 2ZPYA 3P4QB 4IPHA 4FLHA 3AH7A 2A6HC 1XPUA 2HQLA 4MACA 1EOTA 2JA6G 3KH0A 3ZDMC 2XNAC 3JVZX 4HDOA 4WIPA 4B3TL 3IBEA 1F2MA 2IZVB 4EZJA 3OHXC 3ULPA 3I2ZA 3KJPA 1GAQB 1UH6A 4GOPA 4KKIA 4A3LH 3MAQA 1E6EB 1SIJA 3ULLA 2NUCA 2F4VL 4BBRB 2MW5A 1B3AA 3OMGA 2G4SA 3BVZA 4BKSA 2QKIC 1V6EA 3JW0X 2PTLA 5EPJA 2MQJA 1MJEA 1A3TA 1KQSA 3I63C 4F88A 4A3MG 4LFAL 2NVUI 4RKLA 1ILPA 3FRPB 4C3HB 1F9QA 1L6VA 4CHTB 2N9EB 4LLGM 2TSSA 1B44D 4L5SA 5H8YE 4CYEA 3TEZA 1SF0A 1SMYC 4H02A 2CR5A 1NAPA 4U68A 1GUOA 3SE0A 2AWTA 4G0NB 2PPBC 2HTME 3K59A 3A8JE 1PGBA 1ESRA 2K5QA 4M00A 4KMUC 4I65A 2MHJA 4WWPA 2M56B 5KHQA 3APCA 1C4CA 3WCQA 3GE8C 3KUPA 5HGQA 4KI0A 5CYUA 2N9LA 2R93H 2K28A 2PEAA 1NI3A 1EQVA 5H1SE 3AEBB 4NPNA 1O7YA 1Q8IA 1YHQA 4PK1A 3H0GG 1HA5A 2NN6H 3H3VC 4DFAA 1KL9A 2EY5A 2NZHA 4UP8A 3SEBA 2RGFA 3DBLI 2N78A 1KAWA 4FVMA 4JK1C 4P74A 2IX3A 1SNDA 3CMMB 4YXDB 2XWBB 1UF0A 3EFXD 2HD3A 4LW1A 1Y1WH 3CD6A 5FOBB 1XYIA 4X3TA 1YQ3B 4DV1L 2WXNA 3E3XA 4A3CH 1EQRA 3CXCA 1DOYA 5HHDG 1FGUA 1V43A 1E8WA 3G71A 4CO7A 2RA4A 3P63A 2MJ8A 3FDTA 3CPWA 5I9OA 1T0QC 1EEFD 4NY0A 2ZTEA 4ZUJA 1FJGQ 1EO6A 4GZYC 2GOWA 1RD9D 1NE3A 3I73A 3VR6A 3TZUA 1O80A 5IYDH 1IBLL 1R9TH 4A3EB 1Y1VB 1XCTL 5K5PA 1WGRA 3FEWX 2AQ2B 1CMXB 3IFWB 4FBJB 4X66Q 4DAPA 5KEEA 3NS8A 4KV6A 4DV7L 5FJ8H 2ZEQA 2JSOA 5ELNA 3AE3B 4JI5L 3V60A 3TS0A 4IALA 4HJ5A 1DOIA 2LFIA 2F52A 5CORA 1MPEA 5JXVA 3PVLA 1TVXA 2R92B 4O42A 4DF7A 1OO9B 2VW9A 3VTUA 4K14A 4N8X1 2C7HA 3QIAA 2A5HA 1N8RC 1FMAD 3NVYA 3PRPB 3JAME 1PFDA 1WXVA 1ET6A 2KLGA 4W9CA 5AUKA 3U4VA 1KTKA 4GLXA 4OL7A 4HIMA 3P4RB 3L3OC 1RWSA 2LGDA 1CQFA 4IFDG 3R66C 1CKNA 5J3BA 2LGSA 3AMUA 4N9PA 2UXDL 1FNVA 3U58A 2FNJB 2PI2E 2B8FA 1AWDA 4WORA 2LRUA 3LYYA 1ZUD2 4LMQD 2D0OA 2MLBA 2EYJA 1WYGA 1NENB 3W2DA 1DOMA 1E7UA 1PGAA 4CKBA 4YSYB 2F0MA 3HOZG 2QA4A 5A35A 2CKZB 3A7LA 1QF6A 3HFZB 1V49A 1S5CD 4XDCA 3ZXRA 2WXOA 4DR5L 1A3UA 1G6JA 4HR7B 4IFDI 4IUPA 2L8JA 4PMWA 3BU2A 5CR3A 1R4MB 1WF9A 4A3KB 3WIMA 2PJHA 1PH8A 2JRHA 3UI3A 1WOCA 2QC8A 4ALPA 2VZKD 4MSQB 1TIFA 3FPUB 2KN5A 2UU9Q 2CH4A 1RTNA 2JYOA 1UD7A 1BVSA 2V9HA 4IPDA 2BYEA 2VNUD 3X3NA 1RKNA 4KGTA 3S2DH 4OGQC 1CZWA 3SK4A 2NS5A 4R4CA 5JPNC 2E5LQ 2GBJA 2LVQA 3PTFC 1QOBA 2BA0A 5KHOA 2PZTA 4JBKA 3VR9B 2VL6A 3N9YC 4LF7L 3AU7A 1X3PA 4I6PA 2WAQB 3W3AA 5EAYA 2B63B 1KOTA 4K5VA 3A1QB 1SXTA 3OSOA 2J0TD 5CHFA 3NPPA 4NJCA 1FGBD 2Y5BB 1YZ6A 4CBVA 1IBML 2JVCA 1Y56A 1UE5A 4R4IA 1ZYRD 3L17A 3T3NA 4HAEA 1TWFB 3ENEA 2L0TA 4DXFA 1A2UA 4POFA 2VXWA 1WX7A 3QHTA 4C3JB 4G50A 5EKKA 4BKTA 2BBCA 3R93A 2ZW0A 2NTSA 4MTNA 2D07B 1I50H 1EUVB 2BYTA 4J8QA 2JA6H 1LT6D 1DGJA 1YX6B 1EU4A 1RTOA 1WH3A 4C2MH 2WKDA 1LTTD 4XC2A 1FO4A 1C9OA 5JAVA 4DQOC 5I9PA 3I4MB 3TBIB 1OXVA 2LXKA 4FDBA 3CU7A 3GTLH 3ND8A 4XQQA 2FE8A 1J8IA 3AEAB 3IAS1 2F0VA 2O2LD 1UE6A 3NEMA 3M3JA 3M62B 1OQYA 2R7ZG 4WWMA 1BBUA 4JI3L 3CW2C 3AE4B 1MVKA 1E10A 4TVAB 2N1WA 3O13A 4FF1A 2IY1B 3FAHA 3N3KB 2ZM6L 4W9KA 2R2OA 4W9FA 1PHJA 1E2VA 2EPBA 1DOLA 4A55A 4PMCA 5M9OA 2RDGA 1YJJA 3IL8A 3V05A 3GZNI 4PMBA 2A8VA 4OZAA 3ZO5B 1VQCA 1A62A 2VH2A 2OTJA 3SHQA 2N55A 4ASWC 1IPGA 3BVGA 3ML8A 1XLOA 3P20A 3PO0A 1HZ9A 4EKUA 4YTPB 2JT4B 2F0IA 2QJLA 1WI5A 3APFA 1WJ6A 4ME5A 1CSQA 3P1MA 3NTHA 1WFQA 2MJ3A 1L1OC 2C9WB 4A3DH 1KC8C 1YI2A 2EYOA 3H0GH 4HJ8A 1HNXQ 4DR7L 4HJ9A 2L00B 4UP9A 3E0EA 4XX5A 2KHJA 1GOZA 1ROEA 5IY0A 2EMTA 3RD2A 4E3CA 1RFAA 3QB3A 1STYA 2E74C 1IBKL 2EIFA 1I4GA 5EKIA 1TKEA 1D2BA 3KYHC 3VDYA 4A93G 3BDOA 3N52A 4CDEC 4DV6L 3DBRB 4USAA 3V62A 3CQZB 1MHXA 4OVZA 1VS0A 4GIVA 4YWGG 1YNJD 4OXPA 3W9CB 1CHQD 1STBA 3M4QA 1UBQA 4JI1L 2ZNVC 3W5VB 1EEID 2ZXPA 4IQZA 3RR5A 3ALBA 1NDDA 1S5ED 2VH1A 3L54A 4ANUA 4CQNA 4OWWB 3ZYYX 3T8MA 5LLIA 3WANA 2D3CA 4C7YA 1N6ZA 4K81A 3U50C 1L2FA 1WWTA 3Q8CA 4ANVA 1ICFB 1WX8A 1YNXA 5FR3A 4ZHOA 3AM9A 1CT1D 2K1FA 3EGRA 3MC0B 1ASZA 3VUYA 1MG4A 5DM63 4P1CC 3N1YC 2GVBA 5I2XA 2WXRA 5HGTA 2IHEA 1S1QB 2W82A 4LNIA 1FRRA 3AXCA 4PQXA 3CC4A 4KV2A 3DWQA 2JSVX 1RODA 1NEKB 3KBXA 2C7MB 2K22A 3N32A 4F7ZA 5EKLA 1C1YB 3KLWA 4UY8C 4I7ZC 1Y8OB 5GAEC 1WR1A 1YMHE 3FILA 5BO4B 1I4HA 1HPCA 1V80A 1HEZE 4X3UA 1IBXB 1WTHA 1JOKA 4RKBA 5GXGB 4IFDJ 1XCQL 4WJOA 1EYCA 1HE8A 1XEEA 4L5TA 2JA8B 2F3WA 3NQTA 1Q1EA 1B50A 2Q2HA 5IE8A 5JJZA 3DDCB 3DCGA 1X3GA 4GN4B 3GTGH 1Q46A 2E2JH 4QF4A 4W9JA 4X65L 2H88B 2KWVB 2QIEB 4RGTA 3CF6E 3S2AA 4K8IA 2SNMA 1BXTA 4NP5A 4A3IG 1I6HB 1AYFA 4N6EB 4HLEA 3D6WA 4B08A 3AB5A 4IUMB 2F0TA 2UXCQ 4IN3A 4KIKA 3HOZH 2Z9HA 4U673 1S5BD 2Z59B 4QAYA 3AE6B 1DYQA 1AE2A 3IKJA 2BB5A 3D4WA 3S9WA 2KDIA 2FMMA 4A3FB 4NAMA 1PRTD 2B2VC 4LWCA 2AWOA 2BDNA 5GROA 2WXJA 1SYEA 3G4SA 4K0KQ 2KJRA 3ZJVA 2FXQA 4BY1H 2D3AA 3J9CA 3NTIA 4IM2A 2CU3A 3T1YQ 1WCMG 4OVUA 2KECA 4W9GA 4A3JG 2B3AA 4DV3Q 3UF8A 4HMJA 1JE4A 1OXSC 3KF8B 4JYAQ 4M8AA 2LUEA 1EWCA 3I4LA 3J7AV 1M94A 1VMCA 2BWFA 1AEXA 1H4RA 4MH8A 4B9XA 1WD1A 3TBLD 1ICWA 4CHKA 1ACCA 2PKOA 1UE7A 2ALYB 3A54A 5BYSA 1Q10A 5A2QL 3CCEA 2R7FA 1I94Q 4IURA 1OTCA 1HXYD 1GG3A 4FP5D 1WRIA 2IGGA 5DCNA 4BBNF 2Z6BA 3UIPB 3K7AH 2KBNA 1SE3A 4KHZA 1AH9A 4L5QA 1V5OA 4CDCC 2ZVOA 4DV2Q 1WFYA 3AQQA 4JOIA 4Y7NB 3J7ZC 2AYOB 2KTFA 3P4SB 2EY1A 1Q90A 4KY6A 2UUCQ 3QCAA 4BBSH 3QG1A 3Q3FA 3NBIA 1SROA 3TREA 1BKBA 2MBEA 1Z9FA 2L0FA 3KOJA 1XNRL 2WDRB 1EIFA 4OHJA 1VDZA 2JZ3B 1YOVB 2DJFC 3LWEA 4QIWB 3PUXA 1YD8U 1KLUD 2R7ZH 5LMNW 1RRBA 3VAWA 1II3A 4XQJA 3MXNA 4AUQC 5BMGA 1FL0A 1MBYA 3STBD 3QOJA 1YX5B 3DM1A 5E6JA 3JYUA 2F03A 2JZZA 4DHZB 3S1RB 2VZKB 1SR3A 1T3QA 2N9KA 1BBWA 4N9TA 1E7ZA 4ZRPA 4JI8Q 1XXGA 4HPPA 2K39A 1A70A 4IOIE 5I6WA 1N9WA 3DHHC 3VYUA 4GN5A 5KYLA 3S15H 2KJ6A 2XBBC 1EWHA 1YQ4B 4HROA 1D3ZA 1FCLA 3A9KA 1I4PA 1SAPA 4KJOA 1ENFA 2AHOB 4IDIA 1GUAB 2RPQA 5IGDA 3B0AA 3VR8B 5T1IA 5C1ZA 1Y8PB 1S3SG 5CBAE 2M4NA 1L2NA 2VQEQ 1N32Q 2MP2A 4REZA 4BKGA 1X1MA 2IYDB 1RJTA 1LGRA 2G4DB 3R2TA 3CWIA 3BVMA 2KMMA 2PW9A 1V9PA 2DAFA 4A93H 2F0KA 2RDBC 1EYAA 1UZXB 3S17H 1N63A 4DK1A 4H7BA 1ENAA 2D9UA 5CHVC 3NELA 3ZXVA 1A6XA 1Q12A 3HM3A 3RNBC 5C4JB 1NI2A 2YV5A 2CKHB 4B3SL 1EM7A 5I2YA 1SIFA 3PIOA 1J8CA 3HK0A 3Q8AA 1R4PB 4NKLA 1U5KA 3RNUA 1MD2D 2LZ6A 4OONA 2K03A 2Z4HA 2WHIA 5LXHA 3EFCA 5C2TB 2H4OA 4DR1L 3MTSA 4ULLA 3HOWB 3UIOB 3CAMA 3ZGZA 1G2SA 1TJEA 1KAAA 2CJOA 3K8AA 4BBNC 1HQRD 2HQEA 1J7CA 2B8GA 4XIGS 3C19A 5CTRC 3HOYH 2JJQA 3TEYA 2YTVA 4DUYQ 1QNKA 1HR0W 3CCQA 4II3B 1BDOA 1I3QB 5J39A 3KUDB 2EXZA 2WB1E 1JWMD 2Q8IB 1KLGD 1H9JA 2BYVE 4I6NB 2MA9B 4PS3A 4AH6A 2YTXA 4DR3Q 3M4OB 3C46A 1G8ZD 1XLQA 4M8MA 2X6LA 5D2MB 1L5PA 4NDXA 4FJYA 5C3XA 1KHIA 4YWKA 1YN5A 1UAPA 2KDBA 2BA1A 2BS2B 1QILA 1HRJA 2RSOA 2I38A 2A1AA 2K9XA 2W9NA 2MFIA 2HHHQ 2KCNA 1CZGA 2L0CA 5T1GA 3MXPA 4GU2A 2LKVA 1YNTE 4DV0Q 1VQMA 3OMCA 2BF8B 3H6NA 2JRIB 3X23A 2GN5A 1DOKA 2UUAL 3MZ5A 3M3YB 1WGHA 4IM0A 1YHBA 3RFZB 2QMTA 2BE5D 3DHQA 2V4DA 3VA5A 4DV5L 3L0WB 4KKSA 4GDLA 5M3MB 4FADA 2JU6X 1MG8A 1NCVA 2EY6A 4YHHQ 4NMZA 3H3VH 1M4VA 5AEKB 4W9EA 4PS8A 1FXAA 1H9RA 1V1PB 2JK8A 3UDFA 3G48A 1JALA 5ELFA 1WCMH 2F0FA 1JQ4A 2LRWA 4JGHB 2L32A 2UYZB 4A3JH 2PZUA 1GVPA 2EJGC 3VYRA 4EOYA 3ZJUA 2SEBD 3HS0C 2J53A 3MTNB 5IODA 1CHPD 5E7NA 1W3SA 2EE1A 4GS3A 4A3GH 4MGZE 1EZ6A 2CH4W 3BS1A 5IYBH 4BVUC 1U4AA 4KKTA 5LMNL 3G6JB 3J80i 2MRPA 2NYZD 4H0LC 5CGKA 2JYEA 2TMPA 5AZGA 1ILQA 1O7IA 3BYYB 2EJFC 4AYBB 2CU1A 4N59A 5E3FA 4DR4L 2MWSB 1K83H 4QL5A 3I72A 4EE2A 4A90A 4GKKQ 4LCDE 3DVNV 3HZXA 2F0LA 2XSCA 3E9IA 4FF4A 4IG7B 3SDZA 3K58A 3DQVA 1G291 1RFKA 1TY0A 2FHTA 2ZJPA 2N9PC 1N34L 4JI7L 4BA1I 2UUBL 1YBYA 1FD6A 2MBOA 3K9PB 2R93B 3AYHB 5J2RA 3SD5A 4FA6A 1WYDA 4NQKE 4F87A 2ZCCA 1E1OA 3SK5A 2PPHA 4L8JA 3PCOB 4K6LA 3TP8A 3J81c 3I5JC 3C1FA 2B2UC 4N8FA 3D4DA 2WP8J 2BQQA 1SNOA 4LF8L 2WX0A 2AL6A 1TS5A 4ME3A 1SJED 2EYFA 1Y1WB 5BMIA 5EPLA 5FO8B 1N33Q 2E2IH 4HCSA 2GVAA 2ASBA 3HOUB 1KNAA 4JBWA 4FXGC 4XWWA 1FNWA 3J81L 1KFYB 1WXSA 4B3TQ 1YIWA 2ATWA 2QSDA 4KLKA 1GO3E 1KF6B 2JEAI 2CHZA 2J52A 1A2TA 4OWXB 3C2PA 1RAXA 1HNZQ 5EE0A 1TWCH 1X32A 3ZTCA 1R9TB 3HOXG 1EF5A 4FNFA 3NS1A 3KF6A 4EQ5A 2F0WA 3UDXA 1IYUA 3VR2A 1TIID 2K8CA 3R3OA 4ACFA 1MI0A 4PZ8A 3TDQA 3H7SA 4UP7A 2G9HD 3ABVB 4NJ6A 1HR0L 4NXMQ 3A8IE 5KNDA 1IL2A 3H7PB 4C3IG 5CMDA 1Q5WB 4KN4C 4KVGB 4WAAA 3MHZA 3RNAC 1KLVA 4RA8A 4RG1A 3BDCA 3CKIB 2NVYH 3DM3A 3X3MA 5IOCA 4LFCQ 3A1QA 1WJ4A 2A6EC 5BN4A 1PV4A 4B3RL 5G5HA 1A15A 3I55A 2MO1A 1EU3A 2O6VD 4PS7A 3D31A 5LL6S 4HIKA 3J7A5 5CV6A 2IY0B 2IBIB 3ML9A 1WJJA 1IXRA 4HWIB 4OEMB 2ES2A 5T8IA 2HCIA 2WDVB 2KJXA 2CW0C 2FINB 5DAUA 1CA5A 3S16H 1ZW7A 3C1EA 2WS3B 3CSFA 3L4PA 3U7DA 3ZNGC 1I35A 2PQAB 1EY6A 4DV4L 1QG7A 3E6ZX 1DGSA 2EXDA 5ISRA 4BA2I 2H89B 4A3BH 2INCC 2AWNA 3I4NG 2FCNA 2LXCA 3S14H 1OQQA 4Q5VA 2DBYA 5E1FA 3I3TB 2K1BA 3FP9A 4K6DA 1GHJA 3VXWA 2NBWB 2WAQE 1JRUA 4FXKC 3A56A 2WB1G 1D5MC 4Q2JA 2LMCB 2WV6D 4DNTB 4EGVA 3GS2A 4GOCA 1C79A 1VQIA 5C0XH 2HIXA 4GNXB 2R3ZA 3P4PB 2VS1A 4H44C 2JUOA 1HZ5A 4DR6L 2K25A 3KBGA 4C80A 2A69D 2M2LA 3ZNZB 4RCNA 2F0DA 1LTRD 4RAUC 1QT9A 2MBQA 3QO2A 1B9RA 3TEXA 3OLMD 4JI5Q 1R4NB 3A7AB 3S2DB 3APDA 1PFSA 1ASYA 1XTDA 3MXGA 3BG3A 1SSNA 3TN2A 5M5YH 2KQ7A 4M1UB 1FXTB 3VYTA 1KRHA 4N58A 4KD4A 3RMKC 4WRDA 3I70A 5AJ3L 1SNPA 4R4TA 2VZAA 1VJKA 2K01A 2KMCA 1EZ8A 4BKSD 2IGHA 4NZLB 4AS1A 3TMPB 1E9MA 2WXMA 1B8AA 4B3MQ 3CRKC 4S3SA 2J0KA 2N3SA 1VLBA 4C3HG 2O2VA 3VYSA 4DAVA 1K53A 2KC1A 5IWAQ 5BR8Q 3IAYA 2J7ZA 4BY7B 4GDKA 5IA7A 1XX8A 2WXFA 1GUTA 2K05A 3AV8A 3DVNU 2KTRA 2SAKA 1J9OA 2AUJD 2J0JA 1BF4A 4YCWA 2E8GA 2WU2B 3KLSX 2LGXA 3TZDA 4DR2L 4RMFA 1FFVA 1CQVA 1YNND 4ID6A 4AP4C 1C4PA 1N36Q 2NPTB 4DK5A 1KNEA 5FO7B 4DR5Q 2EMSA 2RD0A 5EGTA 3HM6X 3IAM1 3A9JB 3S1QH 1XF5L 1I6VC 4ODGA 5DPTA 2DNEA 1LTAD 1J5EQ 2LGIA 3UDGA 2BPSA 2A6HD 1HJPA 3AEVA 4NNJB 4KGRA 2XN9C 3M9BA 4UDUC 4JCVE 4LNOA 3ONSA 1YJ9A 1QOAA 5C3EG 4BOSC 4WURA 4ARIA 2Z1CA 2KFJA 5IYCH 2M0XA 2L4NA 3CMAA 2K6DB 5HURA 1ZDXA 2ZZPB 2K6AA 1WTQA 2Q5WD 4HJ7A 4LDTD 3J81j 3IRBA 3URYA 4PT5A 3KYDD 2JA9A 1FCCC 2JXTA 3DBHB 1YJNA 3GTOH 2V1CC 1Y1VG 4YY3L 4A3EG 2CFMA 4A3DB 3ETRA 3PRZA 1GJXA 1XLPA 2K8BA 5M5WH 4NJ7A 2GMIC 1M8AA 4MM3B 2F0GA 1SMYD 2PI2A 4JVZA 4FHKA 1CKMA 4R1JA 1PVOA 2JN4A 3T1HL 3R3MA 2G1EA 4J6HA 1HQMC 3K0YA 2MCNB 4AQYL 2I5MX 1X54A 2XVSA 1P98A 2B3GA 1H9SB 2R92G 4W9HA 3HP3A 4RFBA 2JF5A 2F0JA 1SFOH 2QGQA 3S24A 1XMQL 2L11A 2PLPA 3DEOA 1GUGA 1UE1A 3DBHI 3HKSA 1KJTA 4GSWA 1AARA 1Q1BA 1EF1A 3T13A 1PUTA 1WM3A 2OEOA 2FMCA 4B9WA 3RZOH 3EHVA 2CWAA 1WZ3A 1K8OA 1UWMA 5CHWA 4DK3C 3HOXH 4X3SA 4IW0A 3ULJA 3GTKH 4JI3Q 2Q2UA 2KXJA 5C44H 4XT1B 1VQ7A 2YU9H 1XNQQ 5AZHA 1LV9A 3NBHB 2XIWA 1DCZA 1AZQA 1VQHA 4HKZE 1KDBA 2V4IB 2YTYA 1ZXHA 5IT9E 4C3IH 1X3QA 2WWZA 1SE2A 2KWUB 3NWSA 1B9NA 2KANA 4PZ6A 4RWSC 2RHQB 1F2YA 3PHWB 1IUEA 3RLOA 2K32A 3KLSA 5CV7A 1FPYA 1GUSA 3CC2A 3S1MB 2BGFA 2DYOA 3AE7B 5DPWA 1TQOA 2VQFQ 5CX3A 4A3KG 1Q82C 3DXJC 3FMCA 1GXDC 2MGSA 3E5SA 3W5OA 4JV5Q 1E7PB 3QOLA 3GTGB 1AP0A 3Q6BA 1SE4A 2H1EA 1O7LA 3B6YA 2E2JB 4DR7Q 1EYGA 2BB6A 5IP4D 1GB1A 1E8ZA 1C48A 3HKZB 4TQUS 4IPCA 4YCVA 5G55A 3BZKA 3MXUA 1T6BX 4LFBQ 1WGGA 1X55A 1N61A 3TUOA 4CJ0B 1C9FA 1JICA 3I4NH 2RCNA 4FXCA 2WXPA 5D7GA 1S72A 3TEWA 4HPMB 3VTWA 5IGBA 2PE6B 2NVXH 1YITA 2PVOD 2CQOA 2L5TA 4DAYA 5JVH3 2RPVA 4IC7B 2WAQG 1ONLA 2B63G 1R4MI 2JA5G 3HIZA 3U30A 3LNNA 3RLFA 3WAOA 4BY1B 3SFDB 5E4WC 1Z2MA 4YSXB 4IKGA 5KIXA 3QARA 4ZRZA 3CF5A 2A68C 3PQIA 2MP1A 5D3IB 3VRAB 5CV9A 1BCPB 3GP7A 4C3JG 3RZDH 5L95C 2EYPA 2JY6A 4H13C 4W9IA 2LASA 1F52A 4LTUA 5KRUA 2D3BA 5DLQE 1GC6A 4BFRA 1WTVA 2FCQA 1CM9A 1K28A 3K57A 3J80E 1DJRD 4G7OC 1FJGL 1PRTF 4QGUA 1PGXA 2NVQH 3GOEA 4DGZA 3AE9B 3I4MG 2DHZA 4IJHA 4WFN3 4UPAA 4JI2Q 1IGCA 2X38A 2IL8A 1FFUA 1RYJA 3FKIB 1JQYD 3F2CA 1K3RA 1VQ6A 1J19A 1EQQA 2D5GA 1WTRA 4ABNA 4JG2A 2V3PA 1B53A 2D11A 4DHZE 4A3PA 1PH5A 1UWVA 2K50A 2L12A 4C3HH 1PA6A 4P6VF 4A3MH 2EVBA 4HN7A 3MA2B 1VQFA 3A4SC 1SE9A 3AEEB 3L13A 4C4VB 1PTOB 1TS4A 1K73C 4BBSB 1RLFA 5ELOA 2DENB 1SYGA 4B0MA 4ANXA 2ZXRA 2INDC 1YNJC 1LUZA 3U9SA 3O65B 2IPKD 2MHVA 4PYUA 2J7QB 2C5CA 2L9HA 1YJIA 4EZKA 4NAWB 4LF6Q 2IO0B 1EOVA 3DOWA 3OTOL 3DVGX 1C77A 3GV6A 1C4AA 1TZ1A 3AEDB 1C0AA 4F8CB 2HJ8A 4A6QA 3PF5A 3MHBA 2KKCA 2UXBQ 5C3EH 1L4ZB 3Q22A 2OHFA 1WYWB 1WXMA 2BWES 2KO3A 2XEWA 3OW2A 3QIJA 3RN9C 2XRQD 4HMIA 3S15B 3AFPA 2DZJA 4JBMA 4XZ4A 1WR6E 2BTEA 4GLAC 3TP6A 4LF4Q 3L16A 4A8XC 1C76A 4KHPQ 3F1ZA 2F3VA 3PSEB 1EY7A 3KDFA 2JZPA 4MIUA 3MFGA 1HNWQ 2RVLA 3ZRFA 3CCJA 2LHEA 2QHOA 1WTPA 3DBRI 3DEPA 3ZNHB 4MEMA 3U2SC 1XWEA 2BH8A 1HHVA 3N6RA 2H5XA 3HEJA 2KEDA 4X62Q 2WXLA 3P42A 1VCIA 3EA6A 4M8NA 3D32A 2EYMA 3B2FA 5AFWA 3CSTA 2YEPB 1L1OA 4ICVA 3MP9A 1XNRQ 2QILA 3NE5B 1V1PA 2K5PA 1FR3A 2PE9A 3OW7A 2JA8G 2LY7A 1K9MC 1QLBB 3HHMA 1LTID 4IFDH 5C4XG 3NXWA 1K3BC 5HFYA 1EIHA 1EY0A 1SDFA 2E2HB 4KZ0A 2N49A 2PMZB 1LTBD 5GADC 1SJHD 4K3BA 4K7UA 1SMXA 5BMHA 1WGDA 3CIRB 4FXDA 1D8LA 3HOYB 2KNBA 1MJDA 3KFUA 5EBCA 3GTMH 1IZ6A 1YHAA 1JB7A 1F2RI 4DK0A 4QMGA 1OTRB 2JXXA 5G3LD 2K7VA 1QVFA 1GNUA 1P9DU 1LO5D 4A3FG 1V2YA 4LNFA 1GJZA 3PMFA 1Y8RC 1BQQT 3E9HA 1PH9A 3HGBA 1VQ9A 2XTIA 1U4RA 3QAQA 1VQLA 2LJIA 5C23A 3TJPA 3B08A 2BCOA 1CSPA 4R4QA 4A3KH 1W6KA 3KJOA 1OXXK 3G6EA 3Q0AA 1VR9A 1PLFA 1RCVD 1P3QU 3TL5A 4HVBA 1XMOQ 1WI0A 2I1KA 1BOSA 3BJUA 4YTMB 3GO5A 1STGA 2F0HA 1AW7A 2N1VA 2K3UA 4IM3A 2W54A 1V1QA 3KLRA 4OIKA 3PIP3 3PPAA 3VR3A 3VH3B 4GGQA 4Y52H 1SYFA 4GN1A 1QE6A 4OW0A 2WXHA 4J6IA 1E8XA 3A5UA 3VUXA 3RUIB 2E2DC 4P73A 3C3LA 1UGJA 2KQ4X 2MEKA 1TWGH 2CJNA 4OELB 3EROA 1Z7TA 3N20C 2KDFB 1CTMA 3SVMA 1F77A 3PZDA 1HNXL 4AYBE 3NVZA 1A3VA 2B63H 2JA5H 4P2CB 4RNAA 2Y0SB 2PMVA 2BDOA 5HI1A 5E6OA 3MC8A 4JIOU 1GPXA 4HXDA 2HDLA 3GTQB 1BUIC 3PLVA 3V96A 2WP9B 2JA7B 4EX5A 4R4OA 1WCMB 1TWFH 4IO9A 2KYWA 3AEFB 4JE3B 3CCUA 4C3JH 2NTTA 2WFWA 2I0QA 1NVID 3IT4B 1TGZB 1GD7A 4R3DA 2SOBA 1EY9A 1ZDVA 3GE3C 4JBJA 5FLMG 3KWLA 1QB5D 1EFID 1SN8A 1ZEQX 2B2VA 4F7XA 3TQYA 4XQNA 4A3GB 1P7FA 4ICUA 3VDZA 2KAJA 1V9JA 2O5JC 1ZXIA 1R7SA 3M95A 5G2NA 1P7EA 3RCZA 4B9KA 2JWUA 3NP8A 2K75A 1WVLA 4II2B 2UU7A 2MJDA 4US8A 5D3DA 4NPSA 4GNXC 3GTPH 1RDPD 1Y8NB 4X3KA 3T4AC 2WDQB 1PYBA 2ON8A 4WJNA 1K83B 5IP9G 1JOQA 2A74C 2HDMA 3E0JA 4NXNL 1Q86C 3PO2B 1NBFC 1VZ6A 1K50A 2MNAA 4OO1I 2MSED 1TS2A 4A75A 4J3OD 4HSPA 4JPSA 3RT3B 4IWPA 1JJCB 3FPPA 5IKCM 1VQPA 2AUKA 2D2CC 2F0PA 3RULA 3SR6A 1IYJB 4YIJA 2UUAQ 2KENA 5FLXc 1H95A 4HIOA 3S1NH 1D1IA 2J42A 3SDLC 1EYDA 3D0FA 4MGKE 3PF4A 1WGYA 4LF5L 3R7QA 1HCZA 3J7AF 1X65A 3OPOA 4X64L 3KQ4A 4JW0A 3PLUA 2D2QA 4ZK9B 2NB0A 5GAHC 3SU8X 2E2IB 1I7HA 3DPDA 5FLXL 3CPFA 1HUMA 2A4ZA 5G5GA 4S0RA 1OEYA 1YVCA 3M85A 5HG2A 4F1SA 1JJ2A 1D5XC 3A5ZB 1FVIA 4MGIE 1NBWA 2B29A 3K5OA 4GNXA 3NK9A 1TWCB 3P7JA 4MHEA 2M0AA 3T1YL 3UQAA 3CCSA 3W1BA 3HOWG 3RPFC 1E0ZA 1N62A 3LXFA 2Z6KC 2ASQA 3FHWA 3L10B 3D6CA 4DV3L 3CCLA 3TP7A 4JYAL 2LVPA 3HUIA 3QA8A 5JOBA 4PYZA 3RZWC 3PV0A 1Y69U 4DU9A 4QUFA 4K2LA 2VUMG 1KIXA 1OXUA 3B9JA 1WTWA 1AN8A 1ZPSA 2NVYB 1N34Q 5IAAC 2UUBQ 3J81i 3G7LA 4A76A 1I94L 1JC7A 2B76B 3HOVG 3I9V1 3U8ZA 1BCPF 3WDNA 1IYVA 1TWAB 2KVZA 1SYBA 3CRLC 4GKJQ 4TMAB 1VQJA 5C4XH 1IW7C 3IFTA 3K81C 4EFOA 2DUDA 1BMLC 2UUCL 1PMRA 2QDBA 3J7YW 2CCZA 3Q8BA 2QDFA 1MJCA 4LF8Q 4OZCA 2HCCA 1I6HH 5TSSA 1X9NA 4K5XA 3T16A 2ZJQA 4FF3A 4A3BB 3ZLZA 4A3IH 2R2QA 2V3SA 4OX9L 4BZAA 1H8CA 4BOZB 3VQIA 1VQ8A 1P16A 2AMCB 3M4PA 4DHJD 3EBEA 3V3XA 4A3FH 2ZCBA 1S4ZA 4ZAIA 2CHWA 3NVWA 5M3MG 1F1HA 2K5WA 2DZIA 2K8HA 2KWDA 2LXAA 1UEAB 3N1ZC 5M3FG 2CHBD 4WH4A 4IUNA 2FUG1 2Z6KA 4JI4L 4YTNB 2E3TA 5HY6A 1PTOF 3W1YA 2PNRC 4IWOA 3K9OB 3QX1A 1E1TA 1VQ5A 3D4RA 1PH2A 1JWAD 4I6LB 4ARCA 2I5LX 1JJGA 3PS6A 3RYTA 2C35B 1RF2D 2DGYA 3R7RA 4XYOA 4JI8L 2OT2A 3GTJH 5LNK1 2RSNA 3QWNA 4NW2A 2JQOA 1K8GA 2JEBI 3K5MA 1D5ZC 1VQEA 1IKLA 2AKWB 1F2ZA 4R9WA 3IXSA 5M5YB 4P7IA 2MJEA 2KHIA 3NZSA 1WTOA 2SDFA 1CKOA 1XO3A 2N0SB 1T5XD 1EIYB 4JWUC 3HG9A 4JQWC 4MM3A 2VQEL 2JQRB 3PZ8A 3FILB 3DMUA 2L7RA 5D6JB 4JI0L 3A55A 4AYBG 1NR4A 5KNBA 3T9LA 2KMAA 5E4XA 3N1XC 5JH5C 2M00A 4ZKBB 1YJWA 3BK2A 3OJ4B 4HEDA 4Y7NH 3LWUA 1MSGA 5IIFA 1A5RA 3QJYA 1VF5C 1WGKA 1PFMA 1E8YA 3EVQA 3AE2B 3PUZA 2ID0A 4OVVA 1V86A 1HZAA 1DZ1A 3BZDB 5FLMH 3NENA 5A2QE 4DPGA 4DNIA 3AN1A 4KY5A 1NY4A 1YN3A 2RCFA 2NVTH 1PRTB 3S1QB 2Q8RE 2VRRB 1U0LA 4MN3A 2N7JA 1ZXTA 4DUZQ 3Q6SA 4WJ4A 2FAZA 3DHIC 3JAMc 1Y1WG 3L7ZC 1BCPC 3EJIA 3UI2A 4RGMA 1LTSD 4DUYL 2YEPF 4XYQA 2QW7A 3I56A 1NTGA 3HOUG 3A8KE 1VQOA 5I4DA 2LS01 2N88A 4P72A 5LMUL 1KABA 2EOTA 5C4HA 3ZNID 2G5DA 1JOOA 4C00A 4KZCA 2LGYA 4YSZB 2W3SA 4E6IA 3RUZA 3JAML 2NN6I 2CWPA 3QQ8B 3H9DA 2O5IC 1SYDA 2F4VQ 5M5WB 1OGWA 2K33A 5IGCA 2ZJRA 1AZPA 3PO3G 2EELA 2EJMA 4LK1C 4B6WA 1DONA 3I4OA 2JPHA 5C4ZA 4WJQA 2QCZA 5JJIA 4BAXA 4LFAQ 3PHXB 2YYZA 4XDDA 3T3OA 1JWUD 1SNMA 1PTOC 4DV0L 2PVGC 3P75A 2BS3B 2UWQA 3BYTB 1O7ZA 2B2WC 2FFKB 2AQ3B 2JP1A 3KYCD 3OJ3A 1E0BA 2FJ2A 4LJZC 1FD7D 1C8CA 2Z8LA 4IJLA 3S2HH 5C5MA 3KVFB 4HJGE 4MNOA 2KEEA 3EQLC 4DR2Q 1AE3A 2MX2A 3PSIA 1SSOA 4YHHL 3RN2A 2F3IA 2M9VA 3VRBB 1PFNA 2B2UA 3RZOB 2NZ1D 1FM0D 3Q3OC 4HTHA 3OG5A 3D8GA 5C44B 3HKZE 1I42A 4OIJA 1PDXA 2NBFA 1VQKA 2YU9B 3EC8A 3ZKJC 2ENBA 3ZRCA 1F2LA 1VQGA 3MXNB 2N8NA 1M90C 2RBMA 5JJKA 4H2AA 4JL9A 2A69C 1E2WA 1Q3LA 2ZXOA 1E5WA 1OQRA 2REXA 3Q3NC 1LTLA 2VUMH 4DV1Q 4ZHPA 4KN7C 1JWBD 1JE5A 2IO2B 1SGHA 1UGMA 2KDMA 3W1SC 1LM0A 5DM73 4M02A 2Z0SA 1LFDA 3GD7A 1S40A 4L63B 3HOVH 3TEHB 2K04A 4XDXA 5F2DA 3T53B 4CKCA 1GUWA 3RNGC 2PNHA 3M4OH 3PUVA 3SHLA 2IO1B 3TP5A 5BYRA 1B2TA 4GKKL 2IWHA 1IBLQ 4KKJA 5COYA 4C4VA 4ZYNA 4O1NA 1IGDA 2F0NA 2Z0DB 4X6AH 1EY5A 3GQBA 2B2WA 1AFPA 3MC9A 3TCAA 1K8MA 5CV5A 1JB3A 3T1HQ 4DV7Q 1G91A 4JI6L 4DBGA 1L0XB 4ILWA 1TT2A 4QJFA 2A6ED 2LVOA 3LGJA 5K36G 1L7YA 3E56A 4MDKE 4HIDA 2NVXB 4M0WB 4DXGA 3M3YH 3B2GA 4QQBX 1F2RC 4MELA 3UGBB 3ZJTA 1X6OA 4BBRG 1CZPA 2WB1B 3BDLA 2SNSA 2OWOA 3A33B 1YNNC 1TTNA 2K0PA 5M3FH 2CW0D 1V1OA 1JRPA 5J18A 1GKHA 2WDTB 4C56C 1A63A 3ONAB 4ZCKA 1J7AA 2KFKB 4BY7G 1KRSA 1OFFA 3K6OA 2UXDQ 2KN4A 4S17A 1LM8B 2G3QB 4US9A 2BYFA 1R4NI 1MFWA 4RGNA 1J6QA 1WD0A 1ESFA 4G7HC 2NWGA 1HZ6A 1E22A 1V97A 3VVWB 2ZT9C 1I50B 1VZ8A 1G2TA 2JA6B 4ZUIA 1ZE3D 2BS4B 1VRAB 5TR5A 3W1SA 4DXAB 2NVQB 4C2MB 3AI5A 3AU4A 5CV4A 1HNZL 2AL3A 3LJ3A 1PZKD 1QNUA 3GTLB 1DOXA 1SEBD 2L1AA 4GLVB 1WMHB 2I07B 2KK8A 4NB3A 1W2BA 1WX9A 1PH4A 5J22A 2RMMA 4X57B 1H9MA 1Z47A 3I8ZA 2IHFA 1YJ1A 3ER0A 4A3MB 4KD3A 4NXML 3DBLB 2LHDA 1B70B 4LUZA 3I91A 1JROA 4KDLB 4KTAA 4TUUA 3PV1A 3M7GA 2HJ1A 2NBUA 3DVGY 3F8TA 2K5DA 1LACA 4V190 4LFCL 1L4DB 1WRDB 1E3PA 4K3CA 1IBXA 3MWYW 4WJPA 2VB3X 1T5EA 4RH6A 2M8SA 1U4PA 3SXHA 3F2DA 3NZUA 4DHJB 1CI3M 4A3DG 5DPSA 1VQAA 3M7NA 1R4QB 4FHJA 2LFNA 3H0GB 4LF7Q 4CDDC 4GDLB 2PQEA 1IBMQ 4UHVA 2NBVB 3QWZB 4WAFA 3PZ7A 1NR2A 5C3EB 4POGA 2QCPX 2K5HA 5IOIA 1XPRA 2IT1A 3HOUH 3Q14C 2R7DA 1LLRD 5KNCA 2WXGA 4L2YA 5H92C 1WY8A 1W6JA 1D6EC 2ZJDA 1J7BA 4QB4A 1L0YB 2MUYA 5M5XH 4FN2A 2D5DA 2X69A 2CS4A 3PT2B 4ZRKA 1K0RA 3NHHA 2LJ5A 3X0WA 1D7QA 1F9RA 1TWHH 1L0VB 2K6QA 4FJVB 4K2KA 2LD9A 5IO9A 2PMZE 2GI9A 3AULA 2MH7A 3PO3H 4LF9L 3NUHB 3LB8C 3ERSX 4LNKA 2MQHA 5E6PA 2DY7A 4YL8A 5L83A 4ZLTF 3KF8A 4QY7A 1BBXC 4LUVA 2ZM6Q 3OYYA 2WX1A 2QF7A 3U9OA 2Q2IA 3J81E 3Q23A 1UWXA 2B2YC 4J15A 3L2PA 1WSPA 2J0MA 4HRSA 4YCUA 1EIGA 2CQAA 3JC66 1LTGD 4RGOS 1LT5D 1UELA 2FUHB 4DNRB 4B3ML 1IYFA 3WALA 1MIUA 1PQSA 3OOCA 5IWAL 5BR8L 2NR2A 2XK5B 4MJSB 3RNEC 1PZJD 4D2KA 3BINA 3BZCA 1EFWA 3OTOQ 2P5ZX 2M19A 1QUQB 1B1ZA 3HKZG 3NWTA 2C5LC 1MHHE 3BY4B 2KHSA 1PH7A 1IBKQ 2D62A 4ZRJA 1ZYRC 3RI7C 1MSHA 3UDIA 1XLNA 3GTMB 3SGIA 4DV6Q 3HOZB 4FYDA 1V81A 3HVDA 1UUPA 5IGGA 1OEYJ 1N36L 5ELDA 4JI1Q 1UBIA 2WLBA 5AZFA 2Y0SE 3PUWA 4GB9A 4MSMB 3KK7A 4KK7A 4BY1G 2JYTA 1J5EL 1JMCA 1C3TA 2WINB 4JC0A 1F9JA 1X3EA 1B3QA 5FK9C 3CMEA 4WQOB 3KF6B 3MJWA 2HE7A 4XE0A 3EN2A 2B2YA 2NZOA 5IP7G 4XWTA 3PIO3 1EWYC 4ZQ3A 1NJIC 3N30A 5EJWA 2HDEA 5C3JB 3H15A 5G3LF 1UEBA 4HJKA 2DLBA 4UAIA 3JSVB 2RQXA 1TWGB 5K36H 2K5VA 2DZMA 3MEHA 3H6MA 5LXIB 3FKIG 2F0EA 4QIWE 4MTKA 4BS9A 1PH3A 4BBRH 5JPMC 1K52A 2JA5B 1QJOA 1GC7A 4WWNA 3H94A 1D1KA 3H09A 2RKSA 4X66L 1MHWC 3K7AB 1WZ0A 2O6VB 4LAAA 3PREA 2DNCA 3OIQA 2QDLA 3VR4A 4BY7H 1RIPA 4CJ2C 2DN8A 2Z4IA 4BBSG 3DWPA 1Q8KA 3V6CB 1XPOA 4HJAA 1SBBB 4IUVA 5ELCA 4X65Q 1E2ZA 2FCMA 3GZNB 2IY5B 3A4RA 3DWAA 2PYKA 3AE1B 4G11A 2Y3AA 4MJSA 3VUWA 2D0PA 1HTLD 2EY2A 3L0OA 5JHBA 4TKNA 3RD4A 3H8HA 3FC4A 1GM5A 3TS2A 3AE8B 2PW5A 4RM9A 2EZVA 1H9KA 3CHBD 1Q0WB 2L55A 4LJOB 4AJYB 2A68D 2M17A 1VDVA 3GTPB 2R7ZB 3OIPA 5DEHA 1WE6A 4KDIC 2E76C 1XNQL 2V3NA 4LJPB 1S5DD 2EKEC 2V4LA 1HFGA 4CJ1B 2DAJA 2RR9A 1NYQA 3OAWA 1P0RA 5LHY1 3RNCC 4ZRQA 4TRDA 4HPLB 1WJUA 2DNFA 2OQKA 3CCRA 1I4RA 2WKCA 1Z6HA 4WJ3M 2L83A 4RM8A 4G4KA 3SK8A 1FEHA 1WJNA 1VQDA 2E6XA 1GHKA 1ZOYB 4KKUA 3EIVA 2VQFL 3MFYA 3FVQA 4RMAA 3S1NB 3BK1A 3IFDA 2ICIA 4C1NK 4A3OA 2PCFB 1DXMA 2I46A 4GOPB 4JV5L 4EQOA 1JCKB 3NZ3A 4XTCS 3U4ZA 1Y1VH 5KGUA 4A3EH 2KA7A 3OWEB 3UE0A 1RL2A 1EQTA 1L0WA 3CP0A 3SK6A 2UU9L 4W9LA 4K7WA 4BXXG 5BYQA 3I7FA 4LFBL 2F4IA 2ICEC 5CBEE 1QOFA 4R8IA 1TU2B 1B7YB 2O2VB 3M63B 4IUQA 1FNUA 3HRZC 4ZYSA 4A93B 4GDKB 3Q2AC 3WOFA 1XJVA 4XGAB 2KVRA 5LL6X 2E5LL 2GBRA 3S17B 3WAPA 1XT9B 2R92H 5FO9B 1EY4A 1VD2A 5D14A 2KTRB 3OWFA 5JZEB 4IUTA 3VR5A 4C1NI 1ZGUB 2FIDA 5MPOA 3L9AX 3Q8EA 1TBEA 3ECIA 3WA0A 1N5WA 2Q2TA 4FJZA 2GRIA
chains in the Genus database with same CATH topology
1JW9D 3I57A 1VMPA 2LUMA 1PRTC 1HA6A 2C9OA 2RDHA 4HSVA 1K51A 4L6TB 4EQPA 4FF2A 2CVRA 4KY7A 2EYLA 2WQYB 3U7ZA 3AE5B 2LEKA 3TSSA 4P16A 2B2TC 1TY2A 4PNYA 4IZ8A 1JORA 5EBDA 2PO4A 1DD2A 2KOLA 5FKAC 5C4XB 2BOSA 2IDYA 1VF7A 1TR5A 4Q0FA 4A3IB 3IT6B 1YN4A 2DYMA 1BR9A 2E75C 3GV3A 2WACA 2AQ1B 1WTXA 2J4XA 1SNQA 3H91A 2A73B 1RM6C 4A9AA 2ACZB 3ERQA 3ITPA 2IGDA 1KDAA 3GTJB 1ENCA 4L23A 2B2TA 4A3JB 4HCEA 1F9PA 1QKZA 4OO1G 3NTKA 5J1ZA 1QWYA 2F0SA 5C3WA 4TKOB 2PIAA 3SFEB 1EL0A 2ONQA 2EKIA 2L52A 2F0UA 3RMHA 1CA6A 1ZKOA 2IJ0A 3C8YA 5NUCA 1PYWD 1TYGB 5BN3A 3Q8FA 4MT5A 1U4MA 2INPE 1PTOH 1C78A 2F0QA 1KH0A 1QCBD 5CC4A 3E9SA 3KWVA 2OF1A 2L1BA 1CFMA 4ITKA 4DN4M 5JEAG 2WXQA 4L1BA 2NVTB 4RCOA 4F8MA 3HRDD 4J1MA 1STHA 4K5WA 1IL8A 4WQMA 3P1HA 3ZGZA 1TS3A 1LT3D 2HUGA 1HTPA 5CV8A 1NUCA 5DNFA 2LMCA 3AECB 5EE1A 2JE6I 3U52E 2V0GA 2OXPA 1TZOA 2EDGA 3T51B 1B9MA 4XT3B 4DA2A 3U4EG 2KCCA 1BUVT 4B0EA 3BIID 4M0WA 3D3RA 2R6GA 2IX0A 3S2HB 2VB2X 5BN5A 1QOHA 2KVMA 3Q24A 2BT6A 5IGEA 3ND9A 4CKEA 4KX6B 1I4XA 1ML0D 2BE5C 2NMQA 2DY8A 1BNZA 3S16B 2KUMA 5EE9A 4QUCA 4TSSA 2ZW1A 1EY8A 2INNE 2VUMB 3S14B 1PFBA 4RHSA 4TQ0A 2XRSD 1NSNS 1U9RA 2X6GA 4R8NA 4QCLA 3R2IA 2BW2A 4KGSA 1F0ZA 1STEA 5EPKA 3HOVB 5C0XG 3ZQ4A 5ELEA 3NVVA 4C7ZA 2I2YA 4RHRA 4HEA1 3W5UB 2PZWA 4ZOHC 1MI2A 1UNSA 1QOGA 1B4OA 1LT4D 3I3CA 2DWQA 4GLSC 2IW3A 1FRDA 1BO0A 5IGFA 1HUNA 4V0BA 5C0XI 1IW7D 5M3FB 1IHZA 5C5LA 2O4XA 3SR1A 3AMZA 1H9SA 1CJEA 1V8CA 1STAA 1VZ7A 3R8BA 2KQ3A 2F1MA 4OO1H 3F2UA 4JX1C 3K5NA 4BWGB 4OZBA 5JVG3 2IX1A 2WU5B 4WJWA 2NN6G 3LX0A 2Y5CA 2PW7A 3DWGC 4PV1C 2RDFA 4Z9CB 3MJ5A 3NBHA 1F9SA 5I6YA 4KJNA 1G6ZA 1JWSD 2MPMA 5ELBA 1RHPA 1PZID 1GUNA 1S5FD 2GB1A 3NRZA 1ET9A 1GB4A 5EE3A 4CGYB 3EUB2 1PXUA 1SB3C 4LK0M 5JEAJ 5D65A 3M4YA 3I90A 4IUUA 5JEAH 2OEDA 3PZ7A 1U4LA 1OXTA 3GTOB 2W3RA 4YT0B 1CK1A 2KACA 3BWUD 3VA7A 1XTCD 1V8QA 4KHVA 3DUZA 1SNCA 4EVOA 1N60A 3K5LA 2WIIB 3AEGB 1TKGA 1SFOB 1O78A 2WXIA 4ZKCB 3AB9A 4FO2A 5M5XB 4RF0A 5IT9L 3T56B 2FBWB 4RF1A 3GB1A 1ZP0B 1LABA 2JX5A 5EQ0A 1TWHB 5AUIA 1D4BA 2JXMB 1BCPD 3HOXB 1NYRA 3PO3B 5KYIA 1MGSA 1DM0B 3GTKB 1FIQA 4K8JA 2WXKA 2B39A 4EQNA 1TKWB 5FLXE 1KDCA 1FXIA 2WNMA 3DWMA 3MVVA 4JWSC 3Q69A 4G7ZC 1PDQA 4XXEA 2GA4B 1I4QA 4HKQA 4C3IB 3WOEA 1QQRA 3NSWA 2XWJB 1SYCA 1L6UA 3TMEA 1PTOD 1JR0D 1STNA 1IKMA 1FYCA 2G9DA 4G57A 2QEJC 3I4NB 2Y5PA 3PUYA 3V2TA 1C4QA 2EYHA 2R61A 3J80L 1N5XA 1JMLA 1TKYA 3HVZA 2Q8TA 5C0XJ 1HFNA 3NUCA 4TQ1A 3NQIA 4AQ7A 5C6AA 2F0OA 1WXQA 2AX5A 3RZDB 3P4QB 2W55A 3AH7A 2A6HC 4MACA 1EOTA 2XNAC 4WIPA 1F2MA 3OHXC 1GAQB 4KKIA 3MAQA 1E6EB 1SIJA 2NUCA 4BBRB 1B3AA 3OMGA 3BVZA 2QKIC 2PTLA 5EPJA 1A3TA 4F88A 4RKLA 1ILPA 3FRPB 4C3HB 1F9QA 1L6VA 4CHTB 5H8YE 4LLGM 2TSSA 1B44D 3TEZA 1SF0A 1SMYC 1NAPA 4U68A 1GUOA 3SE0A 2PPBC 2HTME 3K59A 3A8JE 1PGBA 1ESRA 2K5QA 4KMUC 4I65A 2M56B 1C4CA 3WCQA 3KUPA 4KI0A 5CYUA 2N9LA 2K28A 1NI3A 1EQVA 3AEBB 1O7YA 1Q8IA 1HA5A 2NN6H 3H3VC 4DFAA 2EY5A 3SEBA 4FVMA 4JK1C 2IX3A 4YXDB 1SNDA 2XWBB 3EFXD 1YQ3B 5FOBB 1XYIA 4X3TA 2WXNA 1DOYA 5HHDG 1V43A 2RA4A 3P63A 2MJ8A 3FDTA 5I9OA 1EEFD 4ZUJA 4GZYC 1RD9D 3VR6A 3I73A 3TZUA 1O80A 4A3EB 1Y1VB 1XCTL 5K5PA 3FEWX 2AQ2B 4DAPA 5KEEA 4KV6A 2JSOA 3AE3B 4IALA 1DOIA 2LFIA 5CORA 1MPEA 5JXVA 1TVXA 2R92B 4O42A 4DF7A 1OO9B 4K14A 3QIAA 2A5HA 1FMAD 3NVYA 3JAME 1PFDA 5AUKA 1ET6A 1KTKA 3P4RB 4OL7A 3L3OC 1RWSA 1CQFA 4IFDG 3AMUA 4N9PA 1FNVA 1AWDA 2B8FA 4WORA 3LYYA 1ZUD2 4LMQD 2EYJA 1WYGA 1NENB 3W2DA 1DOMA 1PGAA 4YSYB 4CKBA 2F0MA 5A35A 3A7LA 1QF6A 1S5CD 4XDCA 2WXOA 1A3UA 4HR7B 4IFDI 4IUPA 4PMWA 5CR3A 4A3KB 3UI3A 2VZKD 3FPUB 1RTNA 2JYOA 2VNUD 3X3NA 1RKNA 4KGTA 4OGQC 1CZWA 3SK4A 5JPNC 1QOBA 2BA0A 2PZTA 3VR9B 3N9YC 3AU7A 1X3PA 2WAQB 3W3AA 2B63B 4K5VA 1SXTA 3OSOA 2J0TD 3NPPA 4NJCA 1FGBD 4CBVA 1Y56A 1ZYRD 3T3NA 4HAEA 1TWFB 4DXFA 1A2UA 2VXWA 4C3JB 5EKKA 2BBCA 3R93A 2ZW0A 2NTSA 2BYTA 4J8QA 1LT6D 1DGJA 1EU4A 1RTOA 2WKDA 1LTTD 1FO4A 4DQOC 5JAVA 5I9PA 3I4MB 3TBIB 1OXVA 3IAS1 3CU7A 3ND8A 4XQQA 2FE8A 1J8IA 3AEAB 2F0VA 2O2LD 4WWMA 3AE4B 1E10A 1MVKA 3O13A 4FF1A 3FAHA 1E2VA 2EPBA 1DOLA 4PMCA 5M9OA 2RDGA 1YJJA 3IL8A 3V05A 4PMBA 4OZAA 2N55A 3BVGA 1XLOA 3P20A 3PO0A 4YTPB 2F0IA 2QJLA 4ME5A 3P1MA 3NTHA 2MJ3A 2EYOA 1GOZA 1ROEA 3QB3A 1STYA 2E74C 1TKEA 1I4GA 5EKIA 3L4PA 1D2BA 3BDOA 3N52A 4USAA 3CQZB 1MHXA 4OVZA 4YWGG 3W9CB 1YNJD 1CHQD 1STBA 3W5VB 1EEID 2ZXPA 4IQZA 1S5ED 4CQNA 3ZYYX 4C7YA 1WWTA 3Q8CA 5FR3A 4ZHOA 3AM9A 1CT1D 3EGRA 3MC0B 5DM63 5I2XA 2WXRA 5HGTA 2W82A 1FRRA 4PQXA 3DWQA 2JSVX 1RODA 1NEKB 3KBXA 2K22A 5EKLA 4I7ZC 1Y8OB 1YMHE 3FILA 1I4HA 1HPCA 1HEZE 4X3UA 1IBXB 1JOKA 4RKBA 5GXGB 4IFDJ 1XCQL 1EYCA 1XEEA 2JA8B 1B50A 2F3WA 3NQTA 1Q1EA 5JJZA 4QF4A 2H88B 2QIEB 4RGTA 4K8IA 2SNMA 1BXTA 4NP5A 1I6HB 1AYFA 4N6EB 3D6WA 4B08A 3AB5A 2F0TA 4IN3A 4U673 1S5BD 3AE6B 1DYQA 3IKJA 4NAMA 2BB5A 3D4WA 3S9WA 2FMMA 4A3FB 1PRTD 2B2VC 2AWOA 2BDNA 2WXJA 1SYEA 3ZJVA 3J9CA 3NTIA 2CU3A 2KECA 4HMJA 1JE4A 1OXSC 4M8AA 1EWCA 3I4LA 3J7AV 1VMCA 1AEXA 4MH8A 4B9XA 1WD1A 1ICWA 1ACCA 2PKOA 3A54A 5BYSA 1Q10A 5A2QL 4IURA 2IGGA 1HXYD 4FP5D 1WRIA 4KHZA 1SE3A 4Y7NB 3P4SB 2EY1A 1Q90A 4KY6A 3QG1A 3NBIA 2WDRB 4OHJA 1VDZA 3LWEA 4QIWB 3PUXA 1KLUD 1II3A 4XQJA 3MXNA 5BMGA 1MBYA 3QOJA 5E6JA 3DM1A 2F03A 3S1RB 2VZKB 1T3QA 2N9KA 4N9TA 4ZRPA 1XXGA 1A70A 4IOIE 5I6WA 3VYUA 5KYLA 1EWHA 1YQ4B 4HROA 1FCLA 1I4PA 1SAPA 4KJOA 1ENFA 4IDIA 5IGDA 3VR8B 5T1IA 1Y8PB 5CBAE 4REZA 1RJTA 3R2TA 3CWIA 3BVMA 2KMMA 2PW9A 2F0KA 1EYAA 1N63A 4DK1A 4H7BA 1ENAA 2D9UA 1A6XA 1Q12A 5C4JB 1EM7A 5I2YA 3Q8AA 1R4PB 4NKLA 1MD2D 2K03A 2Z4HA 5C2TB 2H4OA 3MTSA 4ULLA 3HOWB 1G2SA 1TJEA 1KAAA 2CJOA 1HQRD 2HQEA 1J7CA 2B8GA 4XIGS 3TEYA 1QNKA 1BDOA 1I3QB 5J39A 2EXZA 1JWMD 2Q8IB 1KLGD 1H9JA 3M4OB 3C46A 1G8ZD 1XLQA 2X6LA 1L5PA 4NDXA 5C3XA 1YN5A 1UAPA 2BA1A 2BS2B 1QILA 1HRJA 2RSOA 2I38A 2K9XA 2KCNA 1CZGA 2L0CA 5T1GA 3MXPA 2LKVA 1YNTE 3OMCA 1DOKA 3MZ5A 3M3YB 3RFZB 2QMTA 2BE5D 3DHQA 2V4DA 3VA5A 4KKSA 5M3MB 2JU6X 1NCVA 2EY6A 4NMZA 1M4VA 1FXAA 1H9RA 1V1PB 1JALA 5ELFA 1JQ4A 2F0FA 2L32A 2PZUA 2EJGC 3VYRA 3ZJUA 2SEBD 3HS0C 2J53A 5IODA 1CHPD 2EE1A 1EZ6A 3BS1A 4KKTA 3G6JB 2NYZD 4H0LC 5CGKA 2JYEA 2TMPA 1ILQA 3BYYB 2EJFC 4AYBB 4N59A 5E3FA 4EE2A 3I72A 4A90A 3HZXA 2F0LA 2XSCA 4FF4A 3SDZA 3K58A 1G291 1RFKA 1TY0A 2FHTA 4BA1I 1FD6A 2R93B 4F87A 3SK5A 3TP8A 4K6LA 4L8JA 3C1FA 2B2UC 3D4DA 2WP8J 1SNOA 1TS5A 1SJED 2EYFA 1Y1WB 5BMIA 5FO8B 5EPLA 4HCSA 3HOUB 1KNAA 4JBWA 4FXGC 4XWWA 1FNWA 3J81L 1KFYB 2QSDA 1KF6B 2JEAI 2J52A 1A2TA 3C2PA 5EE0A 1X32A 1R9TB 4FNFA 3NS1A 2F0WA 3VR2A 1IYUA 1TIID 3R3OA 1MI0A 3TDQA 3ABVB 2G9HD 3A8IE 5KNDA 4C3IG 5CMDA 4KN4C 3MHZA 4RA8A 3BDCA 3CKIB 3X3MA 5IOCA 2A6EC 5BN4A 5G5HA 1A15A 1EU3A 3D31A 5LL6S 5CV6A 5T8IA 2HCIA 2WDVB 2KJXA 2CW0C 2FINB 5DAUA 1CA5A 2WS3B 3C1EA 1EY6A 1QG7A 3E6ZX 5ISRA 2H89B 4BA2I 2AWNA 1OQQA 4Q5VA 2DBYA 5E1FA 2K1BA 4K6DA 1GHJA 4FXKC 3A56A 1D5MC 4Q2JA 2LMCB 2WV6D 4DNTB 4EGVA 3GS2A 1C79A 5C0XH 3P4PB 2R3ZA 4H44C 1HZ5A 3KBGA 4C80A 2A69D 2M2LA 4RCNA 2F0DA 1LTRD 4RAUC 1QT9A 3QO2A 1B9RA 3TEXA 3A7AB 3S2DB 3MXGA 3BG3A 1SSNA 3TN2A 4M1UB 3VYTA 1KRHA 4N58A 4KD4A 4WRDA 3I70A 1SNPA 1VJKA 2K01A 1EZ8A 4AS1A 2IGHA 4NZLB 1E9MA 2WXMA 3CRKC 4S3SA 1VLBA 4C3HG 3VYSA 4DAVA 1K53A 3IAYA 2J7ZA 4BY7B 1XX8A 2WXFA 1GUTA 2K05A 3AV8A 2SAKA 1J9OA 2AUJD 1BF4A 2WU2B 3KLSX 3TZDA 1FFVA 1CQVA 1YNND 4ID6A 1C4PA 1KNEA 5FO7B 3IAM1 5EGTA 1XF5L 1I6VC 4ODGA 2DNEA 1LTAD 2LGIA 2A6HD 4KGRA 2XN9C 4UDUC 1QOAA 4WURA 4ARIA 2Z1CA 2L4NA 5HURA 1ZDXA 2K6AA 1WTQA 2Q5WD 3URYA 4PT5A 1FCCC 2JXTA 4A3DB 3ETRA 1GJXA 1XLPA 1M8AA 4MM3B 2F0GA 1SMYD 2G1EA 4J6HA 1HQMC 3K0YA 2XVSA 1H9SB 3HP3A 4RFBA 2F0JA 2L11A 2PLPA 3DEOA 1GUGA 1Q1BA 3T13A 1PUTA 2OEOA 2FMCA 4B9WA 1K8OA 1UWMA 4X3SA 4XT1B 1LV9A 2XIWA 1DCZA 1AZQA 4HKZE 1KDBA 2V4IB 1ZXHA 5IT9E 1X3QA 1SE2A 3NWSA 1B9NA 4RWSC 1F2YA 1IUEA 2DYOA 2K32A 3KLSA 5CV7A 1GUSA 3S1MB 3AE7B 1TQOA 3DXJC 3FMCA 1GXDC 2MGSA 3E5SA 1E7PB 3QOLA 3GTGB 1AP0A 1SE4A 2H1EA 1O7LA 2E2JB 2BB6A 1GB1A 1C48A 3HKZB 4TQUS 3MXUA 1T6BX 1N61A 3TUOA 1C9FA 4CJ0B 1JICA 4FXCA 3TEWA 2WXPA 5D7GA 5IGBA 2PVOD 2L5TA 4DAYA 5JVH3 2RPVA 1ONLA 3LNNA 3RLFA 4BY1B 3SFDB 5E4WC 4YSXB 4IKGA 5KIXA 4ZRZA 2A68C 2MP1A 5D3IB 3VRAB 5CV9A 1BCPB 3GP7A 4C3JG 2EYPA 4H13C 4LTUA 5KRUA 1WTVA 1CM9A 3K57A 3J80E 1DJRD 4G7OC 1PGXA 1PRTF 4DGZA 3AE9B 4WFN3 1IGCA 2X38A 2IL8A 1FFUA 1RYJA 3FKIB 1JQYD 2D5GA 1WTRA 4ABNA 2V3PA 1B53A 2L12A 4P6VF 2EVBA 4HN7A 3MA2B 3AEEB 1PTOB 1TS4A 4BBSB 1SYGA 4B0MA 2ZXRA 1YNJC 3U9SA 2IPKD 2MHVA 2C5CA 2L9HA 1YJIA 4NAWB 1C77A 3GV6A 1C4AA 3AEDB 4A6QA 3MHBA 1L4ZB 3Q22A 2OHFA 2XRQD 4HMIA 3S15B 2BTEA 3TP6A 4A8XC 1C76A 2F3VA 1EY7A 2JZPA 4MIUA 3MFGA 2RVLA 2LHEA 1WTPA 3DEPA 3U2SC 1XWEA 1HHVA 3N6RA 3HEJA 2KEDA 2WXLA 3P42A 1VCIA 3EA6A 2EYMA 3B2FA 5AFWA 2YEPB 3MP9A 2QILA 3NE5B 1V1PA 2K5PA 1FR3A 3OW7A 2LY7A 1QLBB 1LTID 4IFDH 3NXWA 5HFYA 1EIHA 1EY0A 1SDFA 2E2HB 2PMZB 1LTBD 5BMHA 1SJHD 3CIRB 4FXDA 3HOYB 5EBCA 1F2RI 4DK0A 4QMGA 5G3LD 2K7VA 1LO5D 3PMFA 1BQQT 3HGBA 1U4RA 2LJIA 2BCOA 1W6KA 1OXXK 3Q0AA 1VR9A 1PLFA 1RCVD 1BOSA 3GO5A 1STGA 2F0HA 1AW7A 2K3UA 2W54A 4OIKA 3KLRA 3PIP3 3VR3A 1SYFA 4OW0A 1QE6A 2WXHA 2E2DC 2KQ4X 3C3LA 1UGJA 2MEKA 2CJNA 3EROA 1Z7TA 1CTMA 3SVMA 1F77A 3NVZA 1A3VA 4P2CB 4RNAA 2Y0SB 2PMVA 2BDOA 5HI1A 1GPXA 2HDLA 3GTQB 1BUIC 3V96A 2WP9B 2JA7B 1WCMB 3AEFB 4JE3B 2NTTA 3IT4B 1NVID 4R3DA 2SOBA 1EY9A 1ZDVA 3KWLA 1QB5D 1EFID 1P7FA 4F7XA 1ZEQX 2B2VA 4XQNA 4A3GB 4A55A 2KAJA 2O5JC 1ZXIA 1R7SA 1P7EA 2JWUA 3NP8A 1WVLA 2MJDA 4US8A 5D3DA 1RDPD 1Y8NB 4X3KA 3T4AC 2WDQB 2ON8A 1K83B 1JOQA 2A74C 2HDMA 3E0JA 3PO2B 1VZ6A 1K50A 4OO1I 1TS2A 4J3OD 4JPSA 4HSPA 3FPPA 2AUKA 2D2CC 2F0PA 3SR6A 4YIJA 2J42A 1D1IA 1EYDA 1HCZA 3J7AF 3OPOA 3KQ4A 4ZK9B 2NB0A 2E2IB 1I7HA 5FLXL 1HUMA 5G5GA 3M85A 5HG2A 1D5XC 3K5OA 3NK9A 1TWCB 3P7JA 4MHEA 2M0AA 3RPFC 1E0ZA 1N62A 3LXFA 3D6CA 3TP7A 3HUIA 5JOBA 3PV0A 1Y69U 4DU9A 4QUFA 4K2LA 1OXUA 3B9JA 1WTWA 1AN8A 1ZPSA 2NVYB 3G7LA 1JC7A 2B76B 3I9V1 1BCPF 3WDNA 1IYVA 1TWAB 1SYBA 3CRLC 4TMAB 1IW7C 3IFTA 1BMLC 1PMRA 2QDBA 3J7YW 3Q8BA 4OZCA 2HCCA 5TSSA 4K5XA 3T16A 4FF3A 4A3BB 3VQIA 3V3XA 3NVWA 1S4ZA 4ZAIA 2K5WA 2KWDA 1UEAB 4WH4A 2CHBD 4IUNA 2FUG1 4YTNB 2E3TA 1PTOF 2PNRC 3D4RA 1JWAD 4ARCA 1RF2D 4XYOA 2OT2A 5LNK1 2RSNA 3QWNA 4NW2A 2JEBI 3K5MA 1D5ZC 3IXSA 1IKLA 1F2ZA 4R9WA 5M5YB 2MJEA 1WTOA 2SDFA 1XO3A 2N0SB 1T5XD 4JWUC 3HG9A 3PZ8A 2JQRB 3FILB 3DMUA 3A55A 1NR4A 5KNBA 5E4XA 2M00A 4ZKBB 3BK2A 4HEDA 3LWUA 1MSGA 5IIFA 3QJYA 1VF5C 1WGKA 1PFMA 3EVQA 3AE2B 3PUZA 2ID0A 1DZ1A 3BZDB 5A2QE 3AN1A 4KY5A 1YN3A 1PRTB 3S1QB 2Q8RE 4MN3A 2N7JA 1ZXTA 3Q6SA 3L7ZC 1BCPC 3EJIA 3UI2A 4RGMA 1LTSD 2YEPF 4XYQA 3A8KE 5I4DA 2LS01 2N88A 1KABA 2EOTA 5C4HA 1JOOA 4YSZB 2W3SA 4E6IA 3RUZA 3JAML 2NN6I 2O5IC 1SYDA 5M5WB 2K33A 5IGCA 1AZPA 2EELA 2EJMA 4LK1C 1DONA 5C4ZA 2YYZA 4XDDA 3T3OA 1JWUD 1SNMA 1PTOC 2PVGC 3P75A 2BS3B 3BYTB 1O7ZA 2B2WC 2FFKB 2AQ3B 2JP1A 1E0BA 2FJ2A 4LJZC 1FD7D 1C8CA 2Z8LA 4HJGE 5C5MA 2KEEA 3EQLC 1SSOA 2M9VA 3VRBB 1PFNA 2B2UA 3RZOB 2NZ1D 1FM0D 4HTHA 3D8GA 5C44B 4OIJA 1PDXA 2NBFA 2YU9B 2ENBA 1F2LA 2RBMA 4H2AA 2A69C 1E2WA 1Q3LA 2ZXOA 1OQRA 4ZHPA 4KN7C 1JWBD 2KDMA 5DM73 3GD7A 4L63B 4YTMB 2K04A 4XDXA 5F2DA 3T53B 4CKCA 1GUWA 3PUVA 3SHLA 5BYRA 3TP5A 1B2TA 2IWHA 4KKJA 5COYA 4O1NA 1IGDA 2F0NA 1EY5A 3GQBA 2B2WA 1AFPA 1K8MA 5CV5A 1JB3A 1G91A 1L0XB 4ILWA 1TT2A 2A6ED 5K36G 3E56A 2NVXB 4DXGA 3B2GA 1F2RC 3ZJTA 1CZPA 2WB1B 3BDLA 2SNSA 1YNNC 2K0PA 2CW0D 1V1OA 1JRPA 4C56C 3ONAB 1J7AA 1OFFA 3K6OA 2KN4A 4US9A 4RGNA 1HZ6A 1WD0A 1ESFA 4G7HC 2NWGA 1V97A 2ZT9C 1I50B 1VZ8A 1G2TA 2JA6B 4ZUIA 1ZE3D 2BS4B 1VRAB 3W1SA 2NVQB 4C2MB 5CV4A 1PZKD 1QNUA 3GTLB 1DOXA 1SEBD 2L1AA 2I07B 5J22A 2RMMA 1H9MA 1Z47A 3I8ZA 4A3MB 4KD3A 2LHDA 3I91A 1JROA 4KTAA 3M7GA 2K5DA 1LACA 4V190 1L4DB 1IBXA 3MWYW 2VB3X 1T5EA 4RH6A 1U4PA 3SXHA 1CI3M 3M7NA 1R4QB 2LFNA 3H0GB 4GDLB 2PQEA 4WAFA 1NR2A 5C3EB 2QCPX 2IT1A 5KNCA 1LLRD 2WXGA 4L2YA 5H92C 1W6JA 1D6EC 1J7BA 4QB4A 1L0YB 2MUYA 2D5DA 2X69A 3NHHA 1F9RA 1L0VB 4K2KA 2GI9A 2MH7A 3NUHB 3LB8C 2DY7A 4ZLTF 3KF8A 1BBXC 2QF7A 3U9OA 3J81E 3Q23A 1UWXA 2B2YC 1WSPA 4HRSA 1EIGA 2CQAA 1LTGD 4RGOS 1LT5D 4DNRB 3OOCA 1PZJD 4D2KA 2M19A 1B1ZA 3NWTA 1MHHE 2KHSA 2D62A 1ZYRC 1MSHA 1XLNA 3GTMB 3HOZB 4FYDA 3HVDA 1UUPA 5IGGA 5ELDA 2WLBA 3PUWA 3KK7A 4KK7A 2JYTA 2WINB 5FK9C 4XE0A 2B2YA 4XWTA 3PIO3 1EWYC 4ZQ3A 5EJWA 2HDEA 5C3JB 5G3LF 2DLBA 4UAIA 2RQXA 1TWGB 5K36H 3MEHA 3H6MA 2F0EA 4BS9A 5JPMC 1K52A 2JA5B 1QJOA 3H94A 1D1KA 3H09A 2RKSA 3K7AB 4LAAA 2DNCA 3OIQA 3VR4A 4CJ2C 2DN8A 2Z4IA 3DWPA 1SBBB 4IUVA 5ELCA 1E2ZA 3DWAA 2PYKA 3AE1B 2Y3AA 1HTLD 2EY2A 3RD4A 3H8HA 3FC4A 3AE8B 2PW5A 2EZVA 1H9KA 3CHBD 2L55A 2A68D 1VDVA 3GTPB 2R7ZB 3OIPA