1AW7A

Q136a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHALTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 56
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1997-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1aw7A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1aw7A01
3BVGA 2WV6D 1SJED 1LTGD 2O2LD 4C56C 1BCPF 1JWMD 4UDUC 1PTOC 1RDPD 1JWSD 1YN5A 1PRTC 1RCVD 1LTID 3R2TA 1EFID 1S5DD 1KTKA 1BCPC 3SEBA 1JWUD 1AW7A 1FD7D 1JR0D 1PTOB 1SJHD 1I4XA 2RDHA 2ICIA 1LO5D 2AQ2B 3BVMA 1JQYD 5ELCA 1SXTA 3MC0B 5ELEA 5FKAC 4NZLB 1LT4D 2CHBD 1T5XD 1MD2D 1V1PB 5TSSA 3DWPA 3EA6A 1D5MC 1HA5A 1EEFD 2Z8LA 4RGMA 3BYYB 5D3DA 4L63B 1L0XB 3MFGA 1PRTD 1LT5D 1FNWA 1LT3D 1JCKB 1XXGA 1CQVA 4BWGB 5FK9C 1FNUA 1BCPD 1S5ED 2XN9C 2IPKD 1M4VA 2XRSD 1V1OA 5ELDA 1QILA 1LTSD 2QILA 2NTTA 4RCOA 1LTTD 3DWAA 1TS3A 3OWEB 1PRTB 1ET9A 1TS5A 3R8BA 1LLRD 1LTAD 2IJ0A 4Z9CB 3URYA 1KLUD 1L0YB 4L6TB 1FGBD 1LTBD 4RHSA 3BZDB 1STEA 1PTOD 1F77A 5ELFA 1PZID 4RGOS 4TSSA 1CHQD 1I4HA 1BCPB 1DJRD 4RGNA 4DXGA 1RF2D 2J4XA 1EWCA 1DYQA 1SE4A 2SEBD 1EEID 1CT1D 1PTOH 1SE2A 1HTLD 1I4QA 3TSSA 1LTRD 1PYWD 1I4PA 1SBBB 1D5ZC 1V1PA 2XRQD 3GP7A 1XTCD 1YN4A 1I4GA 1B1ZA 3EFXD 3BYTB 4O1NA 1SE3A 4RGTA 1B44D 1UNSA 2R61A 1D6EC 3DWQA 1ET6A 3CHBD 4OHJA 1TS4A 1RD9D 2G9HD 1ENFA 5I4DA 1TY2A 1BXTA 4ZYSA 1TY0A 2NTSA 2QEJC 2XNAC 1G8ZD 1YN3A 1ESFA 1S5FD 4K6LA 1CHPD 1S5BD 3BVZA 4DXFA 2AQ3B 1PTOF 4RHRA 1CK1A 1UUPA 1FNVA 1PRTF 2AQ1B 1AN8A 2RDGA 1I4RA 1EU3A 1KLGD 3R2IA 1EU4A 1PZJD 1GOZA 1PZKD 3V05A 4RH6A 1S5CD 1HXYD 1LT6D 5D3IB 1TS2A 1D5XC 3KLSX 3W2DA 1HQRD 1SEBD 4RFBA 5ELBA 2TSSA 3O13A
chains in the Genus database with same CATH superfamily
1VF7A 3HOVG 2NVUI 5EJWA 2M00A 4L2YA 5G5HA 3E5SA 2WXHA 3DHHC 4K2LA 3L0WB 4J6IA 4ICUA 4APVA 1X56A 1WF9A 1N36L 4OW0A 1HH2P 3UDGA 1RJTA 2X6LA 2J0MA 1QG7A 4EQNA 5JPMC 1T0QC 2KC1A 4O0AA 2LHDA 2E3TA 1PTOB 5HI1A 1QOHA 3ND8A 5BO4B 3U7ZA 4HJ5A 2H88B 2KAJA 1SXTA 4R8NA 4JI8L 4LFCL 3ZUNA 4LF5L 2NMQA 3HKZB 1FM0D 4GU2A 3NBHA 3U30A 2EXDA 3STBD 5KYLA 3QA8A 1Q8IA 5ELOA 4QCLA 3E9HA 4JW0A 3I3CA 2DNCA 4FO2A 4B0MA 1LGRA 4K0KQ 3WDNA 2WAQG 1PGBA 2JQRB 1V8QA 2ZT9C 4KMUC 1II3A 1S3SG 5I9OA 5KHQA 4C1NI 4JX1C 2MHVA 5EQ0A 1OQRA 4JBWA 4DV0Q 2G45B 5CBAE 4DR5Q 1T6BX 5J22A 4BZAA 3PF5A 1EYCA 2KQSA 4ZRJA 4LNOA 2JA6B 2KFKA 2C7MB 2JXTA 1SYDA 1YIJA 4P16A 4F7ZA 1TS5A 4PMWA 4OWXB 4X3UA 2DLBA 3SK8A 2WACA 1SYEA 5G2NA 5FR3A 3K7AH 2QDFA 4YTPB 1AARA 1ZKHA 4KI0A 3PVLA 1WI5A 4WORA 5EPKA 1VQNA 2DJGC 2R93G 5C23A 1TIFA 4HTHA 4HSVA 1GHJA 3AV8A 1XYIA 3CF6E 5IY0A 3RNAC 4A76A 1JJCB 5I2YA 2KFJA 4OEMB 4E74A 3K81C 2J42A 3NSWA 2NYZD 4K7UA 1ENCA 4C3JB 3S2DB 2VH2A 2O2VB 5EPLA 4MGYE 2PVGC 1D5ZC 3GTPH 1YI2A 4DK3C 3GP7A 1EFWA 4XDXA 1TWCB 4ZRZA 3ZJUA 4LF6L 2XEWA 2O5IC 4RAUC 3A74A 3UE0A 1HE8A 2WDRB 1MG8A 1PH2A 1VQLA 5BMGA 3U7DA 3GTMH 1L4DB 1JQ4A 1VMPA 2R61A 4PQXA 4OONA 1N8RC 1BMLC 2M17A 1OTCA 1WJ4A 2BKFA 3D32A 3EFCA 1J7CA 3AEGB 4QUCA 2J0TD 4JI0Q 1Q12A 2L05A 2MRPA 2PI2A 2BS2B 5BN4A 1MBYA 2OQKA 2I1JA 1SB3C 4FBJB 2D11A 1MIUA 2AWOA 2WXNA 3SHLA 3BVZA 4X64L 2KHIA 3IL8A 1U9RA 2KYWA 5C0XH 2IO2B 4G3XB 1BBXC 1WD1A 2WXMA 3MTNB 1FNVA 1BKBA 1L2FA 1V9PA 2IBIB 3OSOA 1UF0A 1VQ6A 4HLEA 1EYAA 3ZXRA 2AUKA 2W55A 4FHKA 2NVXH 3GTOH 2HHHQ 3J7AF 4GNXB 3S15B 3TCAA 3VR8B 2K3UA 4AWJA 4J1MA 2OT2A 3P4RB 4JL9A 1QNKA 1LYLA 3I73A 1WTQA 3AYHB 1XQQA 2N55A 1RDPD 2K1FA 1VQPA 4OGQC 2EDGA 2L3ZA 1KNAA 3G4SA 1K8AC 5KIXA 4HCEA 4DR4Q 1KDBA 2Z0SA 3D6CA 1WVLA 4RMAA 4WWNA 4YWGG 1FO4A 1IBML 2N4FA 3TMEA 5LL6S 3EROA 3W1BA 2C60A 2N8NA 4AYBE 4MGIE 4R4TA 1C9FA 1JC7A 4DNTB 1J19A 4LK0M 4IJHA 1MD2D 4MTKA 3JYUA 2Q2HA 1HFGA 3T53B 4AYBG 4CDFC 2K0PA 2VB2X 4RGMA 4EEWA 3VA5A 1STAA 1H9RA 4C3JG 2V1YA 1ICWA 4BWGB 1SNQA 2A74C 2XN9C 4G50A 4OO1H 1SROA 5HHDG 1JE4A 4ZCKA 1WTPA 1WSPA 3APDA 3A5UA 1Z6HA 2QEXA 2EQSA 2R7DA 5HFYA 3D3RA 4XDCA 2EMTA 2DX5B 3V60A 1J5EL 1SIJA 4DR4L 3DBHI 3S1QB 4EE2A 1VCBA 2K5QA 2R7ZH 1K53A 4PS7A 2B2YA 2JZ3B 4IO9A 1XMQQ 1HNXL 1L6VA 2QMTA 4A93G 3PV0A 2HQEA 4RHSA 3E9SA 4AOFA 1Z9FA 2MCNB 1XLNA 1O78A 2LRUA 4ZLTF 2REXA 4BBSH 2WU5B 3KVFB 4N9PA 3Q8AA 2R2QA 5LNK1 3HOXG 4HK2A 1BUVT 4YT0B 1E24A 4KJOA 4A3CG 1WX7A 2GB1A 3ZRFA 2J0KA 1EWIA 4HJGE 2W3RA 1CUKA 3S2HH 2KACA 3RZFA 4P6VF 4ZHPA 1NSNS 2E8GA 3PZDA 1V1PA 1CJEA 1KAAA 3PIOA 2CJNA 1PFNA 2B2UC 1R4QB 4IQZA 2WX1A 3FDTA 3PV1A 1B1ZA 4OL7A 3J80i 4A3BH 2Y3AA 5FO7B 2DY7A 2GBNA 1ZUD2 3QQ8B 1EF1A 4ANVA 1DD2A 1EOVA 1MG4A 3CCSA 4XGAB 1P8LA 1NUCA 2D10A 2QCPX 1UWMA 3M4OB 3HKZE 1B70B 2Y0SG 1P7FA 3Q8BA 1CM9A 2D0OA 4JOIC 2BYVE 3PT2B 1KOTA 2B2YC 2NTSA 1JMCA 1H9SB 2QEJC 2CW0C 2F0MA 1KIXA 2FCSA 2H5XA 3I63C 4CHKA 4LF6Q 1IYFA 3N30A 2FUG1 1XNRL 2MP2A 4IPCA 3Q69A 1V9JA 2BS3B 3OJ3A 1ZEQX 1E22A 4HVBA 1J9OA 1G291 4BBRG 4W9KA 1K51A 3WIMA 4JI7L 3H09A 4DV5Q 1WM2A 2V9HA 3I9V1 1X54A 2Y5PA 2EYMA 3NVZA 1GUNA 1EUVB 1EY6A 1VQBA 4DHJB 1T0RC 2L8JA 4KD4A 1V43A 1GUOA 1D8LA 1NMFA 2FINB 2KECA 4IUVA 3ULJA 4BKSA 3O13A 4WAAA 2HCCA 4C3HG 4O2DA 5KHOA 4B3RQ 1LTGD 2EYOA 4PZ7A 4EKUA 4HJKA 4WAFA 3PSEB 3TEZA 4ARCA 2D3GA 1LTLA 1RCVD 1Z5SB 1GUAB 3Q8DA 5JEAG 1RFAA 1RYJA 2JA8G 3N1XC 3I90A 2R92B 1F52A 2BA1A 1N5XA 3S2AA 1SJHD 1EIGA 3A5ZB 3VRBB 3ZDTA 1HR0W 2M19A 3IAYA 3MC0B 4IPGA 1KQSA 1L5PA 1YVCA 2ZW1A 3V6CB 4UP7A 4A3JB 4FJZA 3T1YL 3I4NB 3M3YH 2DYBA 3AE5B 5J17A 2A1AA 3KOJA 1T0YA 2DAJA 2KWCA 3Q3JA 1K50A 4BBRH 2IGGA 4NJCA 2RMMA 3D4RA 3HHMA 1A8VA 3I55A 1YJJA 1N62A 3ZQ4A 4J6HA 1STHA 3AB9A 4A3IH 1JWAD 5C3EB 3HOWG 5IYDG 3CCLA 2L52A 3MJWA 4IFDJ 4CQNA 2WXOA 2EY6A 3J81i 2FHTA 3TREA 2R92G 1NENB 1ZXHA 2MBEA 4GN4B 2LUEA 4OX9L 4JBKA 3VUXA 4MELA 3LGJA 3Q2AC 3J81j 1TS3A 1JROA 3OWEB 1E10A 1VQ5A 2PPBC 1WFQA 3JAMc 2FE8A 2O2VA 1EL0A 2HD5B 2E5LL 5GAHC 1B9MA 2BT6A 2XWBB 3P1MA 4HRSA 2EYLA 4UHVA 3PO2B 4IUUA 2YTXA 4LF7Q 2WDVB 4A3EG 1UBIA 3F2CA 3X0WA 1XPOA 2ZJQA 1K0RA 2F0DA 1HNZQ 1SIFA 2JA9A 3SK4A 1D4BA 5DPWA 3AU4A 1I50H 2SEBD 3GTMB 4XYQA 1PVOA 3VQIA 1I4QA 2EYHA 1K28A 3T13A 4X57B 3VYSA 4NXNQ 1PH3A 3S1NH 2CWPA 2XRQD 2F0NA 3MJ5A 5KYIA 2PZWA 3T1HL 3RLOA 2JEAI 1EQTA 2KFKB 4HCSA 3CMMB 3BYTB 3K7UC 5KRUA 4R4CA 3UIPB 4RGTA 2YEPB 4A3FB 3MXNA 3V6EB 2VZKD 4WURA 5FOBB 1F9QA 2EIFA 3ULLA 1JB7A 2Q5WD 4IM0A 1X6OA 4OHJA 2R92H 1VQ9A 2MA9B 3LYYA 4XWWA 3IXSA 3N1YC 2NZ1D 2VQEQ 3KDFB 5BYSA 1VZ7A 1TY0A 3OPOA 1WMHA 2UXBQ 2WWZA 5C2TB 3WAMA 1XCTL 1CZPA 3G6EA 1S5FD 1FL0A 3Q3OC 5CTRC 1ISNA 3S17H 4DV6Q 2KQ7A 1GJZA 3R7RA 2I1KA 4A3KH 4E71A 1EZ6A 2AWNA 1HPCA 1AN8A 1BDOA 3VR2A 4BY1H 1HZAA 2N88A 1PZKD 1GOZA 1W2BA 1VF5C 1MI2A 2EYFA 1WTVA 3N1ZC 2L11A 3AQQA 4DHZE 3PLUA 1GUTA 2K28A 5GROA 2N78A 3MEHA 4DAVA 1EZ8A 3VDYA 2GBMA 3DBLI 1WGRA 4H2AA 2HJ8A 5C4ZA 2ZZPB 3M9BA 1HZ5A 1P98A 5D65A 2LGXA 1IYUA 5M5YH 3K58A 1VJKA 1JRPA 1PH4A 2JRHA 3VHTC 2UU7A 4EZJA 4S3SA 2MQJA 1E2VA 4YCVA 2FCQA 2PMZE 4GOPB 4WJ4A 2F0FA 2L00B 4HDQA 4DDGD 4DA2A 4URKA 1BCPC 1TIID 4DV5L 5IYCH 1RAXA 2K52A 4KVGB 4IW0A 2JYEA 3CCMA 2BW2A 2LS01 5LHY1 3AE6B 2VL6A 4JCVE 4DR5L 2CHZA 3FPPA 2B2TA 1VS0A 3TZUA 4FF1A 2WB1G 1EY0A 4R3DA 2QW7A 1E7UA 4JI4L 2KN5A 4XC2A 3DWPA 2C5CA 5M3FG 2KLCA 1U4LA 4ZRQA 2VB3X 5JJKA 3BIID 4HCNB 2H89B 2F0SA 1CKMA 4DV4Q 1OXVA 3WA0A 4YIJA 2BDNA 1DZ1A 3WWVA 2WKCA 4TVAB 3NWSA 2BKRB 4A3GH 4CDDC 5EE9A 4RF1A 3PIP3 2PCFB 5I9PA 4B9KA 2KX0A 4DK5A 1PFSA 4L23A 4BA1I 3GOEA 4OO1G 4BBSB 2DHZA 2KJHB 3DWAA 1SYCA 4DPGA 2D0PA 4ZYNA 1JB3A 2IZVB 3M3JA 4IUQA 4S17A 4C7ZA 2C9OA 1MJDA 3E3XA 4KIKA 2N7EA 4FLHA 5L95C 2EZVA 3URYA 4MM3A 2ZCBA 2N9XA 3WOEA 4NPNA 4HIKA 5IYCG 3I7FA 4KV6A 2PE9A 3T3NA 1EY7A 4C4VA 2LGDA 5ELFA 4RGOS 4TSSA 4KKSA 1A2TA 5IT9c 1I4HA 2LVOA 4C2MH 1BCPB 1K8MA 4FXDA 1E8XA 4KGSA 2JXMB 4H0LC 5J18A 4DN4M 1NY4A 1FPYA 1MHWC 4ZRIA 2RSNA 4II3B 1DXMA 5EE1A 4EUTA 2FUHB 1CT1D 3JSVA 3UF8A 3Q8FA 3NEMA 4DUZQ 2JQOA 1SBBB 1UZXB 2PQEA 2B63H 2N9KA 3J80L 4DAMA 2PO4A 2CHWA 3VA7A 5LMNL 4B3TL 4KHPL 4MJSA 4DV6L 3EBEA 3AEBB 3TDQA 1GPXA 3NUHB 2NVXB 1YX5B 4KJNA 4KY7A 5M3MB 3CCQA 1AYFA 4FA6A 3UDFA 5C5LA 5LXIB 1E7VA 3AEDB 2ZTEA 2ASQA 3DHQA 1F2LA 5I4DA 1HRJA 3EJIA 1XT9B 3NOBA 1B2TA 1VQ8A 3GTQB 1CI3M 3FP9A 3GS2A 4FN2A 4OIJA 3D6WA 3PO3G 4BA2I 1VR9A 2RGFA 5DPTA 3RPFC 3ERSX 1EIYB 2DENB 4DXFA 3QC8B 2Q2UA 3QIJA 5G5GA 5BR8Q 1VQDA 5E6NA 2K5NA 1IGDA 2C7HA 3CSFA 5IYDH 2BB5A 2KVMA 1LFDA 3QOJA 5M3FB 2RPVA 4WWPA 4O42A 1WYWB 1IBMQ 3A7AB 5CHWA 4V190 2ZTCA 3UI2A 3T16A 3W2DA 3A55A 1HNZL 2LUMA 3ML8A 4RMFA 1EOTA 1YIWA 3Q6BA 3FMCA 3J81L 1LM8B 1WWTA 3BINA 4YXDB 4GN3B 3RNUA 3QWZB 4W9JA 4YTNB 4KKUA 4QUFA 1U4AA 2A6ED 1PTOC 2B2VA 1LACA 3W5UB 3O65B 4I6NB 4BXXH 2WXGA 1L1OB 1DOMA 1OO9B 1VQAA 1TWHH 4A3MH 1VRAB 3NS1A 4GSWA 3P2BA 5AJ3Q 3T4AC 2WYQA 2V4LA 3E6ZX 4I65A 2F0LA 2FJ2A 5ELEA 5GADC 2LY7A 4JI6Q 4OX9Q 3G48A 2VNUD 1HHVA 3RULA 1T5XD 2MWSB 4TMAB 3QG1A 4YSZB 2KDFB 4Y52H 3VUYA 1TWGB 1HA5A 2NR2A 2RCNA 2Z6BA 3PO3B 1K8GA 1M90C 3MP9A 1C9OA 1TWFB 4HJAA 4HEA1 2RPQA 3K5OA 3QAQA 3HUIA 4G0NB 1VQFA 3M63B 4Q0FA 4NP5A 1CQVA 2BH2A 3VVWB 2PLPA 2JA6H 3RZWC 1VMCA 4KY5A 4QMGA 3I56A 1HUNA 1ACCA 3H7PB 2PZTA 3PHWB 4A3CH 3KLSA 2D3CA 3WOFA 1BBUA 2JN4A 2KC2A 3K59A 1GG3A 3G7LA 1UD7A 3VR3A 2K5HA 4TUUA 2ZM6L 3GTKH 2KUMA 1N9WA 3AU7A 2MJDA 1N60A 2K05A 2WXQA 2I46A 3E56A 3M95A 1Q8KA 4JI1L 2PNRC 3CD6A 3QR8A 1NVID 4A90A 2Y0SB 2YV5A 2E75C 4LNQA 3DBSA 5IOIA 5IA7A 5C4XG 3L0OA 1UGMA 2C7NB 2BYTA 1B53A 4MTNA 2IX3A 1RF2D 2IO0B 2MBHA 2KMCA 1L4ZB 1JMLA 1DYQA 2L55A 4OZBA 4FYDA 2ZPYA 5BYRA 2HCIA 1WJNA 1EQRA 2K14A 1EY5A 5J1ZA 2VQFL 3HGBA 3NBHB 5AZGA 1XTCD 2JJQA 3R3MA 3OIQA 2RDBC 2QKIC 2D2CC 1K3BC 2LXKA 3FC4A 4KGTA 4CKBA 2MUYA 4A3JG 2VUMH 1O7YA 3MEFA 1YITA 2V3NA 1TVXA 5AUIA 1RWSA 1ENFA 3J80c 2WXIA 2X8XX 3N9YC 3WAOA 2RBMA 4YCWA 3QIAA 3HKSA 2A68D 5LL6X 1S5BD 1A63A 3ZRCA 2M2LA 2PI2E 1F9SA 3CRLC 1YNND 2Q8IB 2QF7A 3J7AV 3EQLC 1I4RA 1L1OC 3QCAA 1X32A 3DM3A 2UXCQ 2UWQA 3MHZA 3V05A 1Q1OA 1S5CD 1SYGA 2RSOA 3SHQA 4X66L 1PGAA 1SF0A 3JSVB 2XVSA 1XWEA 2PZUA 1E8YA 2Z4IA 1TQOA 2LVQA 1NI3A 2XK5A 4QAYA 2O5JC 1ZOYB 3PCOB 4DK0A 3IFTA 4BBNF 1V81A 3M7GA 1YN5A 2O4XA 2F4IA 1KD1C 2PEAA 4PMBA 3D4DA 3DQVA 1DOYA 4RNAA 1A3VA 2WP8J 3KFUA 3PF4A 3ML9A 4TQUS 3EECA 5T1IA 3CW2C 4LUOA 1PLFA 1I4XA 1UBQA 5IOCA 2ICIA 1KABA 2AQ2B 4DR1Q 4XIGS 3N3KB 3RMHA 3GB1A 2F0TA 4JQWC 1V8CA 4C80A 3K57A 1C0AA 5FLMG 5C44G 5CV7A 4A3KG 2V4DA 4WJQA 3UDIA 3NS8A 4IWPA 1J8IA 3AECB 3CCJA 3NRZA 2ZM6Q 1G2TA 4JE3B 4IM2A 2P5ZX 3PUYA 2K39A 3PRZA 1S40A 4W9HA 4L1BA 5JEAH 1FIQA 3SDZA 1S5ED 3UGBB 2IPKD 5ELDA 2FCMA 3FEWX 5IODA 2VH1A 1T0SC 1TT5B 3PUVA 3HFZB 2N3SA 3DEPA 2A6HD 4DNIA 2B29A 4A3MB 1JJ2A 1PH6A 4LAAA 3ZTCA 1SNOA 1E1TA 4NB3A 4JI5Q 3ZNZB 4Z9CB 1I3QB 1I3QH 2Z4HA 3Q22A 1J0GA 1LTBD 1OXSC 5ELNA 1EIHA 3FKIG 3BZDB 3PREA 1I7HA 2INDC 3RN9C 2J53A 1PA6A 2NVQB 3R3OA 1Y56A 3K9PB 1DONA 4KN4C 2M8SA 1YNJC 4R1JA 1XJVA 1KHIA 4DU9A 3P63A 3QJYA 2JSOA 4XXEA 1DJRD 2Z6KC 3M4YA 1P16A 1KJTA 1A62A 5M3FH 1KL9A 5AFWA 3W1SA 4XT3B 5M3MH 3JAME 1RHPA 4YWKA 2PTLA 3PZ8A 1GUWA 3CXCA 1WGGA 2KJRA 4DV1L 3CPWA 1E7PB 2NPTB 5C44H 1GJXA 3HEJA 3A56A 3RNGC 5JJLA 2L7RA 4B3ML 4N6EB 2B63G 1WR6E 4CDEC 1WGDA 3UQAA 2KEDA 4X3SA 1NR4A 2KD0A 2OOBB 5JEAJ 4LJPB 1C4CA 5IGFA 1Y1WH 3MC8A 1YEZA 1CSQA 4DAYA 1UH6A 1K83B 4KGRA 2ZXOA 4YCUA 3IFWB 4K1RB 2K32A 5IP7H 4IOIE 4JI2Q 1MSGA 1UAPA 4H13C 1PHJA 5LMNW 1QVFA 1YN3A 4X65L 3S1RH 2OQ0A 2JWUA 1SYFA 2PJHA 4JIOU 3P20A 5E7NA 2B63B 2HIXA 3HRDD 3MXNB 4MN3A 3AE1B 4DR2Q 1TKWB 3H8HA 4K81A 4A20A 4BFRA 2JA6G 3H9DA 4P7IA 1C77A 2KCCA 1XLQA 4JYAQ 4ZKBB 1K73C 1ESRA 5FLXL 1DOKA 5C6AA 2MNAA 2RHQB 2F1MA 2N1VA 1JOKA 2VXWA 3AXCA 3LX0A 5CV8A 3CQZH 3KF6B 4X65Q 4A3GB 1HFNA 3SFDB 4BKGA 1WJJA 2A6EC 3OMCA 4OELB 3SR6A 2NB0A 4PK1A 1BCPF 4I7ZC 3RUIB 1XCQL 4M1UB 2IY5B 4MEMA 4OWTB 4CDCC 4IUNA 3L2PA 5AZFA 3HG9A 2G1EA 2Y5BB 1NBFC 2LSSA 4P75A 2QA4A 1FXAA 4BXXG 5E6JA 1PDXA 2E2HB 3HK0A 3DUZA 5GXGB 2X6GA 1P1AA 1JQYD 5G55A 4JOIA 1M94A 4QIWE 3NG0A 4F88A 2E6XA 2JRIB 2EOTA 2F0OA 2SAKA 1NYRA 5FR6A 4J8QA 1SRUA 3RNEC 2OEDA 3K9OB 3F1ZA 2QIEB 4FXKC 2KOXA 5L83A 3PTFC 3OMGA 1A5RA 1PH7A 1L1OA 3DBRI 3TN2A 4KD3A 4P73A 3K7AB 2BVCA 4HWIB 4BKTA 5FLXc 2XRSD 3OOCA 3I8ZA 1PFBA 2DZKA 3AE4B 2BA0A 4NAWB 4LFCQ 1PFMA 1NR2A 5HY6A 4OZAA 2L0TA 2FCNA 1K83H 1Y8RC 3PGZA 2BWFA 1CFMA 5JOBA 3TUOA 4NMZA 3J81E 1NYQA 2JT4B 2J7ZA 2HDLA 3H91A 3KJOA 4GB9A 3RNFC 1X55A 1N36Q 4A3PA 3TP8A 3TL5A 3F8TA 1HNWQ 1FGBD 1YBYA 3H3VH 1XPUA 1E1OA 1F77A 2EMSA 1HZ9A 4EQ5A 3RLNA 4NXML 4DR3Q 4LUVA 1DOIA 3ZJTA 1NEKB 3U2SC 2F0WA 5CR3A 5KNCA 4DV1Q 1Q7YC 4AJYB 2KQ3A 3H0GH 4TRDA 4K8JA 2IGHA 4C00A 2WS3B 3V3XA 1Y8PB 4P2CB 4LF4Q 2HE7A 2HTME 1PTOH 3PUZA 4B3TQ 4KHPQ 1F2YA 1PYWD 1WCMB 3U4VA 1ZXTA 2DYMA 1Y69U 4KV2A 4XWTA 5JHAA 2R7ZG 1VQKA 2F0VA 5AUKA 3AM9A 2HT1A 1E9MA 3PO0A 3EFXD 1TWAH 2F0KA 2K5VA 3S1MB 3H6MA 1Q81C 2MP2B 3A8KE 2ZJRA 1IYJB 3NP8A 4MHEA 2INCC 5DLQE 3V96A 4N58A 2KDMA 2GA4B 1EWYC 1TS4A 2L5TA 2RQXA 2Z0DB 5JJZA 1RKNA 1N34L 2F0PA 3OJ4B 3KUZA 2KCTA 4A6QA 5AEKB 1KLVA 4DUYL 3EGRA 3QHTA 2EJMA 5F2DA 1N5WA 1OEYJ 3ZNID 2YTYA 3HOYB 1IGCA 3L7ZC 3K5NA 3J7A5 4G7HC 3DLLA 3LDZE 1IW7D 4LNIA 1E8WA 2R93H 1FR3A 3SK5A 4ANXA 5H92C 4RH6A 1QT9A 4CHTB 1HZBA 4PV1C 1XX8A 1WX8A 3M4QA 1NJIC 5D94A 5IP4D 4IM3A 2QSDA 5CYUA 1W3SA 2WV6D 4JPBW 2ACZB 3LB8C 3I72A 2MFIA 4A3DH 2LWPA 2CH4A 5M5XB 1YX6B 2LHEA 3KUDB 2F3VA 3NHEB 2B2WC 4A55A 2WDTB 4YHHL 2LGYA 1YHQA 3W1GA 4ITKA 1WZ0A 4LDTD 2EYPA 1E3PA 4OVUA 3VYUA 3K5LA 1DGSA 5I6YA 1CA5A 4LNFA 1FGUA 3TMPB 5M3MG 5ELCA 1UE1A 1DCZA 5CORA 5FKAC 4BBSG 1TGZB 4LF7L 1OXTA 3GZNI 1KRSA 4XQJA 1XO3A 4KSKC 2MO1A 2CHBD 4IOAA 5TSSA 4D2KA 1HUMA 1CA6A 1GUGA 2UUBQ 2G4DB 3HS0C 3BYYB 4JI3Q 1SE8A 5HURA 3VXWA 3NZUA 1WGYA 2K03A 4AQYL 1QZEA 1AH9A 2JX5A 2M9VA 2F0UA 3U4ZA 5CMDA 3AI5A 1QNUA 3L08A 1XXGA 5J3BA 1NI2A 1MJCA 3W9CB 1GXDC 2AX5A 2XSCA 4A3MG 1N32Q 1BT0A 5DNFA 3TS0A 3R93A 5M9OA 2BWES 4JI8Q 2KWUB 4GGQA 4KKIA 4W9EA 3A0JA 4RCOA 4GKKL 5E3FA 3NUCA 1TZ1A 3ETRA 1WGHA 3G6JB 5DEHA 1ZGUB 3HVZA 3IRBA 2HDMA 5DPRA 1WRDB 3J80E 1EF5A 3APFA 4KKJA 4IWQA 1EY8A 3OLMD 4EOYA 4TKOB 1H4RA 1STEA 1PFDA 5FJ8H 2R3ZA 4ZK9B 2KCNA 3ONAB 3HOXH 1VDVA 4A93B 4L5TA 4ULLA 1N33L 1VZ8A 4IN3A 4C4VB 1OEYA 3A9JA 4DR1L 2ONQA 2QDBA 1JT8A 3QO2A 1HTLD 3KDFA 3TSSA 1BUIC 2JE6I 2E2IH 2EY2A 3J7ZC 1G51A 4R4IA 1TYGB 3ABVB 2X69A 3RZDH 3TEXA 4C3HH 1ZDXA 1SFOB 2CFMA 2OTLA 1SE3A 3HVDA 1XNRQ 1YQ4B 3IT6B 4FF2A 1GVPA 3I4LA 2V3PA 3AULA 3DWQA 1WI0A 4DK6C 2G9HD 1K3RA 2N7JA 3Q24A 3F2DA 1EQQA 1I6HB 1SAPA 4A3BB 1Y1VB 5IP7G 1JALA 3GDEA 1XPRA 1UEBA 4IWOA 1ESFA 3A54A 2F0JA 4TQ0A 1IHZA 1SSOA 3PMFA 4UY8C 3C19A 2WAQE 2VZKB 1VQIA 2D3BA 4ARIA 5D14A 2JA7G 1YMHE 2CWAA 2VZAA 3MZ5A 1KLGD 4QQBX 1UE7A 1QF6A 3FAHA 3OW7A 4BY7H 1EWHA 3OG5A 3RR5A 3HOWH 1GM5A 3C3LA 3K0XA 3A8JE 1QE6A 4WJWA 2UUAQ 5D6JB 1TWHB 3PGEA 1SJED 1U5KA 1VQMA 1MJEA 1CKNB 1L2NA 3PO2G 3BDOA 1WYGA 4GZYC 2M0AA 5JAVA 3C2PA 1WXVA 1O7LA 2AYOB 1GHKA 4FNFA 3S9WA 2GRIA 3R2TA 4G7OC 1S5DD 4JI2L 3TP5A 1XMQL 1HNXQ 3GTQH 3MWYW 1A70A 1NMGA 1GC7A 1EQVA 4DHZB 2CVRA 2GBRA 4N59A 1K0SA 2F3IA 2GMIC 1GD7A 2EY5A 2OJWA 3B2GA 1ILQA 1Q10A 2Z8LA 4AIMA 2JY6A 2YYZA 3IKJA 1FJGQ 3PZ7A 5D3DA 1AFPA 4L63B 1ZP0B 3ECIA 1RTOA 2BPSA 3LWEA 3VR9B 3B9JA 3T8MA 3SGIA 1GB1A 4Y7NH 3KK7A 2IW3A 2UUCL 2MX2A 3K80C 4ALPA 3M3YB 1JRUA 5BN5A 3GD7A 1D3ZA 4K8IA 5FLXE 2NTTA 1H9KA 3J81c 2K5WA 2ICEC 1ZW7A 1U4PA 4LNKA 3R8BA 3N20C 2B2VC 2OXPA 5CV5A 4GLXA 4M01A 2X38A 1WXQA 4XQNA 1FVIA 1X3GA 4EFOA 4J15A 4WJ3M 1PTOD 3Q3NC 2Q2IA 4JWSC 4NW2A 2LJ5A 2W9NA 2WLBA 2MQHA 4PS3A 3MA2B 4NXNL 3P4QB 2B2TC 2EVBA 1D2BA 3PIO3 1X3FA 2R93B 1QCBD 4FADA 4GNXC 3CIRB 1T5EA 4OXPA 5JH5C 1SE2A 3NENA 3VTVA 4BBRB 4K5WA 3TIXA 2A69C 4LCDE 1X3QA 4DUYQ 5LXHA 4CJ2C 3BK1A 4O1NA 4A3JH 2JYTA 1IBXB 3S2DH 2MPMA 4HPLB 2RVLA 4MDKE 4W9DA 1J8CA 3FKYA 3MXGA 4N8FA 2QHOA 4MACA 1I6HH 1VQCA 4QGUA 2M4NA 2HUGA 1E7ZA 1OQYA 3GV3A 1V97A 1SLJA 3BWUD 3JAML 2KVRA 1EIFA 4US8A 1TY2A 3B2FA 1TWAB 5HKHA 1STYA 2F0GA 2FXQA 2L32A 1JOOA 3V61A 3J7YW 3APCA 2LFNA 2F03A 4ANUA 3PSIA 4GOCA 2M1MA 3BDLA 2KENA 1C4QA 4IKGA 4AUQC 3UDXA 4JI0L 2PW5A 5KNDA 1UUPA 4FJVB 3MHBA 2EY1A 4GMVA 3I91A 5KGUA 1FRRA 3W1YA 3AFQA 1KDCA 1B4OA 2BDOA 3ERQA 3VR5A 2J7QB 4UP9A 2KMAA 1Q1BA 5EDSA 2AHOB 1V5OA 4K5XA 5JXVA 4DWFA 1WGKA 5IIFA 2UUCQ 1UEAB 2RR9A 2NBVB 2N9LA 2WINB 2N1WA 1XMOL 1JWMD 2OTJA 4A93H 3HOZH 2WQYB 1JWSD 3FHWA 2EKIA 4NNJB 4ANWA 1QOGA 4CBVA 5IO9A 4WWMA 3S17B 1EO6A 1Z7TA 1BR9A 1EFID 1ZYRD 2E2IB 2D9UA 1JWUD 4H44C 1VDZA 5TR5A 1FD7D 3A7LA 3UIOB 5LMUL 5IT9L 1QOAA 5IWAQ 1B7YB 1SYBA 2WXRA 4M8MA 3W1SC 4A3OA 1XTDA 1B9RA 2DGYA 1UELA 4DHJD 1WX9A 1V5TA 2KLGA 3HRZC 2WHIA 3ZNGC 2YU9H 1PDQA 3H6NA 3KBGA 4KN7C 1TXYA 3MFGA 3KQ4A 1YNTE 1BO0A 5M5WH 4DKAC 3GTOB 4HN7A 1QZGA 4MSMB 2DZJA 2F4VL 3KF8A 2QGQA 2I2YA 1F2MA 2G5DA 2K04A 4JBJA 1YZ6A 1T9HA 3U9SA 2KDEB 4FXCA 1I50B 3DHIC 4HXDA 4W9IA 3OWFA 4DBGA 1UWVA 1RLFA 1F9JA 4DR7Q 1ZPSA 1OGWA 2BF8B 4EZLA 3MTSA 4A3FH 1G91A 2R7ZB 2IJ0A 1DM0B 3KLWA 1QZHA 3U52E 1L0YB 1H8CA 2CCZA 2HDEA 5EKIA 1XMOQ 3PLVA 4GLVB 2BE5C 3BZKA 3H1UA 3DMUA 4BOZB 4F1SA 1SMYC 2KX3A 5DAUA 1SNMA 4YWMA 2VUMG 4PG3A 3GZNB 2E2JH 1L0WA 3RLFA 4LF9Q 2F52A 4OO1I 2L15A 2WXLA 4M0WB 3RZOH 4JPSA 1EWCA 2DUDA 4ZUIA 4XZ4A 1CMXB 3GTJH 2JSVX 3HOVH 2WXKA 2LGSA 5E6OA 1ILPA 1WXMA 3PO2H 3BS1A 2INPE 4GDKB 2JYOA 2WIIB 1LXDA 1VZ6A 1A6XA 2DN8A 2NCNA 4ABNA 2LFIA 1VQGA 3FRPB 5CHFA 3NK9A 1IPGA 4DUZL 3HM6X 4ZDVA 1VLBA 4F8MA 5DPSA 1WYDA 3GO5A 3CF5A 2MH7A 1TR5A 2L9HA 4XYOA 2K22A 3BZCA 4NJ7A 4GOPA 1HR0L 4A3FG 2SOBA 2IX1A 3BJUA 5E1FA 1YJNA 1RL2A 2I5LX 3MXUA 1SN8A 4Y7NB 4B3MQ 4Q5VA 5EPJA 3I57A 3HOUH 4ICVA 4TKNA 3PUWA 2Y0SE 4XT1B 2V4IB 2NVYB 2JK8A 3HOYH 3A8IE 1C3TA 3I4OA 3TEHB 1TWCH 2A5HA 4QJFA 3I4MG 1PRTF 2XWJB 1WE6A 3NE5B 2PPHA 3I4NH 4YL8A 4IFDH 4PNYA 5FO8B 1SNPA 3K5MA 3W5VB 3NBIA 4OVZA 1TS2A 3VYRA 1D5XC 1BQQT 1CQFA 1HTQA 1R4MB 4XX5A 3VH3B 5FLMH 2QCZA 3CAMA 4LFAQ 3UE1A 1KDAA 5K5PA 1A3TA 2OEOA 2W3SA 1D1KA 1OQQA 1QWYA 5GAGC 2BTEA 3D0FA 3S1MH 4NAMA 5J2RA 2JUOA 3BY4B 2XIWA 2PMVA 1S1QB 4FP5D 1WJ6A 2OHFA 3Q6SA 5E4WC 2ZEQA 3AMZA 3ULPA 4JGHB 2UYZB 4IPHA 4AJWA 2NWGA 2A6HC 4W9GA 1Q0WB 3B6YA 3JW0X 4P72A 2LXAA 1LT4D 2H1EA 5CC4A 4G11A 1S4ZA 1TZOA 1H95A 1GAQB 1CKOA 1HZCA 2GI9A 1KRTA 4WFN3 4EZKA 2CW0D 3T56B 4YHHQ 5CV4A 3I4NG 3GTKB 1J7AA 1PGXA 2GLSA 1F2ZA 4QIWB 1RIPA 1KF6B 1JE5A 2A69D 1SMYD 2RD0A 3RN5A 2NN6H 2KANA 3I3TB 4HMIA 3DVNV 3GTGB 4MGKE 1YOVB 3L13A 2M56B 3WCQA 4JI5L 4GIVA 5T8IA 4HMJA 3QX1A 1IBLQ 5IN7A 3I70A 4IJLA 2K25A 3VTWA 3C0RB 3PRPB 4REZA 4N9TA 1K8RB 1TWFH 1E2WA 1UE5A 3NTHA 1IYVA 3VAWA 5FO9B 3VUWA 2UU9Q 5JHBA 2YEPF 4AS1A 3ZYYX 4AP4C 3RZDB 4A3LG 4II2B 1KRHA 3SDLC 4DR2L 1AE2A 3VRAB 3Q8CA 4RM8A 5D7GA 1E8ZA 1A3UA 4US9A 3RN2A 3S2HB 3C1FA 4PS8A 2DNFA 4GLSC 4JC0A 2JPHA 4JLCA 2D62A 3GTGH 4DV2L 2KN4A 1X3EA 2K6DB 4CJ1B 2J4XA 2WGSA 3KF6A 3TS2A 3BU2A 1C7YA 4CKEA 1EEID 5IYBG 2RF4A 4ZRPA 4C3IB 1KAWA 1A0IA 1EM7A 2WP9B 2VRRB 4USAA 2INNE 3EFUA 4RCNA 4KDIC 1Y14B 4LJZC 5JPNC 1FJGL 4KX6B 4UAIA 1YN4A 2Z0EB 4B3SL 1CZWA 2L1BA 1PQSA 2JA7H 1IBLL 4B3RL 4M8AA 4DQOC 3PS6A 1O7ZA 4MZ9A 4CO7A 3OYYA 2L0CA 4K3CA 4KY6A 1D6EC 3JAMi 3EC8A 3KUCB 4N9F4 3CHBD 4IZ8A 3NWTA 2UXDQ 1RD9D 3FILB 3NTKA 4ZUJA 4ZOHC 4FJYA 2K50A 4A3LH 2FMCA 2WX0A 4X66Q 2KTFA 1U0LA 4DR3L 1S3OA 4R8IA 5C1ZA 4K6LA 2BYEA 3HOUB 1CHPD 1I94Q 3HM3A 1NTGA 3RNCC 2LMCA 3CCUA 2IHEA 2XBBC 4BBNC 4PZ8A 2LD9A 5C4JB 2FFKB 4FDBA 3DPDA 1U4RA 1Y1WG 2MBBB 3DXJC 3R2IA 2K7VA 2JA5G 4IUTA 2ZVOA 4ZKCB 4A3GG 3NZ3A 1F9PA 1LT6D 5AZHA 5D3IB 1YHBA 1DOXA 1P0RA 2N9EB 1CKNA 1GUSA 2TSSA 5ELBA 4YWLA 2EKEC 5IYBH 3A1QA 3LXFA 4KZ0A 1E0ZA 1ONLA 4NPSA 2WDQB 3ZLZA 1HTOA 4DDID 4IURA 4CGYB 1N61A 4UDUC 1KFYB 2KWDA 3D8GA 2KBNA 4KHVA 2MJEA 3RT3B 2WB1E 2K6QA 2N0SB 1D1IA 5A2QE 5C0XJ 2DWQA 3IFDA 2ZW0A 1EY9A 3ND9A 1VQ4A 2VQEL 1KTKA 3T1YQ 2ZNVC 3ZO5B 4LUZA 3GTLB 4YSXB 2HHHL 3CU7A 4RG1A 4KLKA 1WTOA 2F3WA 4EGVA 2OWOA 4QF4A 5C3WA 3QWNA 5NUCA 4LWCA 3J9CA 2RKSA 1WTXA 4GDKA 4XDDA 3NELA 4R9WA 1V1PB 5COYA 5IGBA 5C0XG 1SE9A 4DXAB 3M85A 3T1HQ 3BDCA 4HJ8A 2A4ZA 5IGCA 1KC8C 4P74A 2MW5A 2B3AA 3HIZA 3MHSD 2KHJA 4X64Q 4HPPA 4C7YA 3OTOL 2ZJPA 2SNSA 3GTPB 4FF4A 5IP9G 2IYDB 1M4VA 1Q46A 1LV9A 1QILA 4C3JH 4BY7B 4ME3A 3D31A 2EPBA 2JA5H 1XNQQ 1B9NA 1SMXA 2F0QA 2YTVA 1YJ1A 2D07B 2LGIA 2ZVNA 4WQMA 5C3JB 2KOLA 2FMMA 1PRTB 1VQEA 2GVAA 1AWDA 3IHPC 4HIOA 3TEWA 3V62A 4NXMQ 3U8ZA 2CHXA 2NVTH 1T3QA 5FJ8G 3E9IA 3S14B 4BVUC 1LUZA 3H94A 4L6TB 5I6WA 1S72A 3DOWA 3A9JB 1GNUA 4YY3Q 1YNJD 2JF5A 4NKLA 2UXBL 1Y1VH 4BAXA 3U58A 1IBKL 1CHQD 3SD5A 2UXCL 2BH8A 2D5DA 3KF8B 4RGNA 2ZNVB 4FULA 2IY1B 1I35A 5C4XB 5C5MA 2AMCB 2DAFA 3KLRA 3NTIA 1GC6A 2FIDA 4K0KL 4H02A 1NAPA 4JI6L 3RFZB 2PNHA 4JK1C 1FXTB 1HEZE 3CSTA 2R6GA 2XTIA 3Q3FA 1TU2B 3OIPA 3DDCB 2YU9B 1B50A 4YY3L 3DCGA 4EX5A 3M4PA 2ZXPA 3Q3MC 2KWVB 4Q2JA 2VW9A 5H8YE 2MP1A 1L6UA 2VQFQ 5D2MB 1BBWA 1PYSB 2GN5A 5IGDA 2B8GA 4PZ6A 3SXHA 3S16B 1FFVA 4M02A 4PT5A 4DV3Q 2GOWA 4AQ7A 2OF1A 1QUQA 1XNQL 3STBC 3KUPA 2W54A 3SFEB 2ZPNA 1BXTA 3HOXB 3ZNHB 2MLBA 3HOZB 2XNAC 2VUMB 2K5DA 4OIKA 3VYTA 4K6DA 3Q14C 5C4JH 3AMUA 2DJFC 3DHGC 5MPOA 2K8HA 1TKGA 1PTOF 1CK1A 2MJ3A 1F9RA 4A3IG 2ALYB 1UE6A 4P1BC 4CJ0B 3AEFB 1C4PA 2L0FA 1OTRB 4LJOB 3F2UA 3NY5A 2F0EA 2K4KA 4IFDG 5HGTA 3P75A 3N32A 1RODA 2IT1A 3H3VC 1J7BA 2IX0A 2EELA 4C56C 3CMAA 4NAWA 1YHAA 1GO3E 5BYQA 2AUJD 3ZGZA 4B9XA 2YVCA 1WRIA 2UUAL 3L10B 1LTID 4UPAA 5IGEA 1QJOA 1XLOA 4DF7A 4A3EH 3H7SA 3AE8B 2I38A 3M62B 3P1HA 4LF9L 3SEBA 1KXLA 4HSPA 1JORA 2BYFA 2ES2A 1SDFA 4WJNA 1VQOA 4H7BA 4QL5A 1LO5D 3HKZG 3BVMA 3RI7C 3IT4B 1WXAA 4WIPA 5GAEC 2D3AA 4NZLB 3ER0A 1BOSA 4KK7A 1C8CA 3AE2B 4XTCS 1R4NB 4GDLA 1TTNA 1R4PB 1R4NI 1M8AA 2NZHA 3TRZA 2PKOA 1ASZA 3L16A 3DVGY 3HOZG 2BQQA 4OZCA 3DBRB 2J52A 3NZSA 4EVOA 4GLAC 1WTRA 1X3PA 4B0EA 1A15A 1CSPA 1AZQA 3KW5B 4W9CA 4LK1C 3HOVB 1V1OA 2EYJA 1LTSD 2QILA 4KZCA 4ZAIA 3CC7A 5IT9E 1C76A 2WNMA 1LTTD 4IDIA 1NBWA 2H4OA 3T51B 2NBWB 5G3LD 2E2JB 1QKZA 1MGSA 2KXJA 2A68C 3CC4A 2L76A 2L12A 1LTAD 3NPPA 3ENEA 1V6EA 5KEEA 1YNNC 4X3KA 1A2UA 3RD4A 1PH1A 1UWXA 1G6PA 2LI5A 1VQHA 5CX3A 4WWOA 1J5EQ 4W9LA 1WH3A 3MXPA 1TWGH 3BG3A 3E0JA 4BS9A 4F7XA 2WXJA 2PIAA 2K9XA 4ZHOA 4A8XC 3DBHB 3E0EA 3X23A 1YJWA 4C3IG 3ZW3A 4PMCA 4LFBL 4KDLB 1EYDA 2DZIA 3CMEA 1AEXA 2F0HA 1WIAA 2KDIA 5C3EG 3L17A 1FFUA 3I4MB 3CKIB 1I4PA 3JC66 4E6IA 1R7SA 2AWTA 4DK1A 2Z9HA 5KNBA 1UGJA 1SSNA 3RNBC 3HOYG 5G3LF 3AE7B 3AN1A 3ZDMC 1YQBA 2D5GA 2QDLA 3EHVA 3NXWA 1WTWA 1V86A 3KH0A 4M00A 4MSQB 1W6KA 2NBUA 2L4NA 4LFBQ 3PRMB 1I6VC 1K52A 1N32L 1CZGA 4X6AH 2YLMA 1AZPA 5C4HA 4K7SA 4HKQA 2IL8A 3CCVA 2FAZA 4I6PA 4XE0A 4ZQ3A 2EJFC 1MHXA 4UP8A 2IWHA 4B95A 2CS4A 3ZTDA 3IAM1 2BCOA 1FXIA 1G2SA 4JI3L 3V2TA 1BNZA 5EE0A 1XLPA 3S1NB 1U4MA 4ILWA 1L0VB 5C3XA 1IW7C 3CP0A 4JI1Q 5JVH3 3K0YA 4K5VA 4LF4L 2RDGA 4POFA 2I5HA 4HJ9A 4G7ZC 2A19A 2AL6A 2JEBI 2CR5A 3A9KB 2VY3A 1H9MA 4DV3L 1PH9A 3KWLA 2B3GA 1LM0A 4ID6A 2V3SA 4DAPA 2O6VA 3AFPA 4X62Q 4WH4A 2NBFA 2Y5CA 1X1MA 3C1EA 3DBLB 5EGTA 3BVGA 4C2MB 5J39A 4NY0A 5GMVA 4DV7L 2O2LD 2PYKA 1RFKA 5HGQA 1I42A 4QY7A 1O7IA 2ZTDA 4IPDA 3VR4A 1D7QA 2ASBA 2WAQB 2XGTA 3Q23A 3SVMA 1YQ3B 4J3OD 2MGSA 2NN6G 3IG3A 3L54A 2KKCA 2RA4A 4KTAA 1V49A 2C9WB 2Q8RE 1MSHA 2TMPA 1JR0D 3FKIH 3SK6A 3HP3A 5EKLA 2RDHA 4MM3B 3EUB2 4WJPA 4DR6Q 1C79A 3P4SB 4JWUC 4A3IB 5JJIA 1SFOH 5LLIA 2ATWA 4R4QA 3A4RA 1AP0A 2A5UA 4G57A 2IGDA 1LQBA 2DNEA 1F2RI 2ZCCA 1EYGA 1D5MC 2QJLA 3VFKA 4I6LB 1W6JA 2PMZB 2LZ6A 2RDFA 1WZ3A 4BY1G 2KTRB 4MT5A 1L0XB 1PRTD 3LNNA 5EAYA 3EVQA 3ZJYC 2B2UA 2I0QA 5BN3A 1OXXK 3X3NA 2MJ8A 4DAYB 1JCKB 4X62L 3OW2A 1ZE3D 2HTHA 4WQOB 5H1SE 1FNUA 1WM3A 3EIVA 4XYCA 2HD3A 1TT2A 3SU8X 4OWWB 3UINB 3CC2A 3MVVA 1NCVA 2KEEA 3NQTA 1E0BA 1RRBA 2XK5B 2A8VA 4RM9A 3ICEA 3SR1A 1JWBD 1HZ6A 1SGHA 2KO3A 1IL8A 1ET9A 2PQAB 3W5OA 1SNCA 3FKIB 4G4KA 4R4OA 1WR1A 2NPTA 2O6VB 4IG7B 1LLRD 2K8CA 3Q8EA 1G6JA 3OAWA 1P9DU 3MFYA 4GXBA 2CH4W 4KHZA 4POGA 4RKLA 1PUTA 2V0GA 5A2QL 2E76C 3VR6A 5M5YB 1FCCC 4K14A 4DGZA 3Q0AA 2G9DA 4GOPC 1Q86C 2IY0B 3DVNU 1DOLA 1Y1VG 1HTPA 4DXGA 1QLBB 2Q2TA 2MBQA 5BMHA 3S16H 5I2XA 1VD2A 3A1QB 1KH0A 3GE8C 3I5JC 1SE4A 4PYUA 1B3AA 3AEEB 1KNEA 3P42A 4HROA 5ISRA 1PXUA 3AEAB 1FCLA 4TV3A 5IAAC 1HNWL 4KSLC 1STNA 3PIPA 3GE3C 2AKWB 5K36H 3ZIMA 2AEHA 2E2DC 4JVZA 1R9TH 3QK0A 5C44B 4AYBB 4NJ6A 3FVQA 4GKKQ 3M7NA 5EBCA 1E6EB 5HG2A 1VCIA 2JZZA 2IO1B 4A4IA 1B44D 4IUMB 4DR7L 4K3BA 2I5MX 1WXSA 2DYOA 1HCZA 3U4EG 2CJOA 4F8CB 2K01A 4E3CA 2O6VD 5CHVC 1WMHB 4IOCA 2K1BA 2KNBA 3KBXA 5AJ3L 3FILA 1GB4A 3H15A 3A4SC 3W3AA 2NVQH 3B1LX 1WJUA 3NJTA 1TBEA 4WRDA 4A3DB 1FMAD 1XD3B 2B76B 3WANA 1WCMG 2K5PA 1QB5D 2KA7A 3G71A 3S14H 1JJGA 3B08A 3PO3H 1HJPA 3L4PA 3PPAA 4TQ1A 3T9LA 4BOSC 2AQ3B 4HAEA 3HOUG 2WB1B 1I5FA 2MBOA 1B8AA 4CKCA 2Z6KA 4NQLB 5E6PA 2JXXA 4EQPA 5DM63 1PV4A 1EU4A 1H9JA 3I4MH 2LEKA 3P7JA 2WXFA 5A35A 3HZXA 2WU2B 2HJ1A 2LJIA 4F87A 3B0AA 5LMUQ 2B39A 2KJ6A 4HDOA 1HQRD 4DR6L 1SEBD 2Q8TA 4C1NK 1F1HA 2QC8A 4MIUA 1IP9A 5EBDA 4B3SQ 1ZKOA 5EKKA 2E5LQ 3NVWA 4B08A 1KM7A 1ZDVA 3S1QH 2WXPA 3TQYA 5K36G 1XEEA 3RUZA 1PRTC 3CCRA 3A33B 3DWGC 2N49A 3PQIA 1WOCA 2GBJA 4YSYB 4LF5Q 3IBEA 3A9KA 2D2QA 2BOSA 4JI4Q 2JA5B 3H0GG 2B8FA 4KKTA 3AE3B 2K75A 4RF0A 4HEDA 4GDLB 3TP7A 1IBKQ 1O80A 4U673 3QARA 2BB6A 2CKHB 3DWMA 2ON8A 1E2ZA 1BVSA 2F4VQ 2FBWB 4DNRB 1WCMH 5LMNQ 2ZXRA 1Q82C 2L83A 3DEOA 1R9TB 1CTMA 1LT5D 2BE5D 1FNWA 4ZRKA 1LT3D 2ENBA 2JVCA 5EE3A 5FK9C 1BCPD 3H0GB 1VQJA 4MH0E 3KYCD 5IWAL 2ID0A 2I07B 4RWSC 2C35B 3AU5A 1N6ZA 1FD6A 1STGA 1HQMC 1RTNA 1EY4A 2A73B 1K9MC 3IAS1 4FHJA 4OVVA 1DGJA 1STBA 2UUBL 1F2RC 2AL3A 2J0JA 1I94L 1HA6A 4A3EB 2B2WA 4DFAA 3PUXA 1OFFA 1WE7A 1F0ZA 4JG2A 3CRKC 3AEVA 1JW9D 3S15H 1PZID 3TEYA 4X3TA 1TKYA 4JI7Q 3CWIA 2NUCA 3K8AA 4JBMA 3S24A 5IKCM 3F2BA 5DM73 3TZDA 2SDFA 2CKZB 1XF5L 3C8YA 4LTUA 5BMIA 2CQOA 1M1KC 2KK8A 4V0BA 3WAPA 3ZXVA 2LXCA 2JA7B 4FVMA 1AE3A 1QUQB 2KHSA 2LXJA 4A3DG 1Q5WB 1NDDA 4ME5A 3KYDD 1MHHE 2BGFA 3JVZX 4EQOA 5GQOA 1MVKA 1C4AA 4A9AA 4DV4L 1I4GA 5T1GA 4LFAL 2PVOD 3H7PA 3D4WA 1Y8OB 4DV7Q 4MJSB 4RKBA 1LABA 2Z1CA 4HIDA 2V1CC 1UNSA 1VQ7A 2BBCA 2E2HH 3WALA 3VH4B 3X3MA 4ODGA 1ET6A 5CBEE 1H9SA 3QOLA 3HOWB 3ALBA 4HJ7A 2RHSB 1FEHA 2NS5A 3M4OH 3RCZA 1Q90A 1X9NA 4A75A 5JZEB 4K7WA 3ZKJC 3R66C 4IC7B 4L5RC 1Z47A 2DY8A 2WFWA 1TKEA 2JP1A 1V80A 1MKHA 3S1RB 2UU9L 3C46A 1QQRA 3MAQA 3K6OA 3CQZB 2HIVA 1N34Q 4LDTB 2MO0A 3UI3A 1WD0A 3AH7A 2HQLA 4C3IH 1WY8A 3I2ZA 5C0XI 2JA8H 2E74C 1MPEA 2DZMA 2M0XA 4JV5Q 2AQ1B 2G3QB 4B6WA 1BF4A 1EU3A 4I7AA 2UXDL 1RM6C 4MNOA 2GVBA 2R2OA 2F0IA 2MHJA 4HR7B 1Y1WB 4JV5L 1QOBA 1Q1EA 1B3QA 4RFBA 3TBLD 2IDYA 1ICFB 4N8X1 4JYAL 4HCPB 4M0WA 4RA8A 2PE6B 3PHXB 2K8BA 5BR8L 1Q3LA 2IHFA 4B9WA 2NZOA 2K33A 4U68A 4C3HB 2LKVA 1Z2MA 3SE0A 4FXGC 1IKLA 2VS1A 5E4XA 1IL2A 1G6ZA 2W82A 1ZYRC 2JZPA 4CYEA 2CU3A 3NVYA 1C48A 4WJOA 1J6QA 1R4MI 3P4PB 3NVVA 4L8JA 3AB5A 1PH5A 1FRDA 4MH8A 2KDBA 1AW7A 1E5WA 1L7YA 4L5QA 4DV0L 5L37A 2R7FA 3N52A 1C1YB 3CPFA 1C78A 3H3VI 4IALA 4BY1B 1SNDA 1JICA 3EA6A 4ACFA 1EEFD 1NNXA 4XQQA 2OJRA 4A3KB 3AE9B 4NQKE 3VDZA 2NN6I 3GQBA 1SR3A 4GS3A 2KJXA 1WTHA 5IP9H 4LF8L 1ZXIA 2KVZA 1EUJA 2L1AA 2PW7A 3EN2A 5C4XH 2CU1A 1ROEA 4GN1A 4HIMA 3T3OA 2FNJB 2WKDA 1WFYA 1V1QA 1NE3A 4A3BG 3QJZA 2LRWA 3U9OA 1YJ9A 3ZVVA 3VTUA 4PYZA 2LASA 4QB4A 5IGGA 1IXRA 3DVGX 4S0RA 4FF3A 1Y8NB 1YNXA 3L9AX 2EXZA 3GTLH 3RYTA 3MC9A 3QB3A 2C5LC 3BK2A 4LW1A 2K6AA 1QVCA 2NVTB 2PQAA 1YJIA 1X65A 1KLUD 4M8NA 1ENAA 2KZRA 2RSUA 3GV6A 2MEKA 3KJPA 2KQ4X 2ZJDA 3ONSA 3NHHA 1JOQA 5CV6A 2LMCB 2JWZA 2CQAA 1FYCA 4P71A 5IE8A 4ASWC 3R7QA 4BY7G 3FPUB 3UQBA 1TJEA 4L5SA 4GN5A 2BS4B 2KTRA 3ITPA 4GNXA 1P3QU 4BKSD 2Z59B 1N33Q 1MI0A 4LF8Q 4HPMB 1LTRD 4AH6A 2OCEA 4KIKB 1N63A 1E90A 2NVYH 3L3OC 4NDXA 4LLGM 1IUEA 4MGZE 5DCNA 1ML0D 5JVG3 4IFDI 2LVPA 2SNMA 5M5XH 2KCMA 2RCFA 4IUPA 2FIFA 2KHWB 1PH8A 3DM1A 4LMQD 3GTJB 1K8OA 2PW9A 4DV2Q 1MFWA 2DBYA 3TJPA 3RZOB 1IZ6A 1GKHA 2JU6X 4W9FA 3TBIB 1PMRA 3KWVA 1PYBA 4K2KA 2JA8B 3RMKC 1YD8U 2EE1A 4ZYSA 5C3EH 2N9PC 3N6RA 2IO3B 1G8ZD 3OHXC 2GBKA 4GKJQ 4HKZE 3TP6A 5CV9A 4AQYQ 3ZJVA 5CGKA 1QVGA 3OTOQ 3RD2A 3IVFA 3KYHC 4RHRA 1IBXA 1V2YA 2N7DA 1IKMA 2KT7A 4GKJL 1QOFA 3NQIA 4LNNA 1HR0Q 1PZJD 1OXUA 1ASYA 2EJGC 1HXYD 3CCEA 4P1CC 4YTMB 3KLSX 2G4SA 2MSED 1P7EA 3LJ3A 3U50C 5M5WB 3LWUA 2KMMA
chains in the Genus database with same CATH topology
1VF7A 5EJWA 2M00A 4L2YA 5G5HA 3E5SA 2WXHA 4K2LA 4OW0A 1RJTA 2X6LA 1QG7A 4EQNA 5JPMC 2LHDA 2E3TA 5HI1A 1PTOB 3U7ZA 1QOHA 3ND8A 2H88B 2KAJA 1SXTA 4R8NA 2NMQA 3HKZB 1FM0D 3NBHA 5KYLA 1Q8IA 4QCLA 3I3CA 2DNCA 4FO2A 4B0MA 3WDNA 1PGBA 2JQRB 1V8QA 2ZT9C 4KMUC 1II3A 5I9OA 4C1NI 4JX1C 2MHVA 5EQ0A 1OQRA 4JBWA 5CBAE 1T6BX 5J22A 1EYCA 2JA6B 2JXTA 1SYDA 4P16A 1TS5A 4PMWA 4X3UA 2DLBA 3SK8A 2WACA 1SYEA 5FR3A 4YTPB 4KI0A 4WORA 5EPKA 4HTHA 4HSVA 1GHJA 3AV8A 1XYIA 5I2YA 2J42A 3NSWA 2NYZD 1ENCA 4C3JB 3S2DB 5EPLA 2PVGC 1D5ZC 3GP7A 4XDXA 1TWCB 4ZRZA 3ZJUA 2O5IC 4RAUC 2WDRB 5BMGA 1L4DB 1JQ4A 1VMPA 2R61A 4PQXA 1BMLC 1J7CA 3AEGB 4QUCA 2J0TD 1Q12A 2BS2B 5BN4A 1MBYA 1SB3C 2AWOA 2WXNA 3SHLA 3BVZA 3IL8A 1U9RA 5C0XH 1BBXC 1WD1A 2WXMA 1FNVA 3OSOA 1EYAA 2AUKA 2W55A 3J7AF 3S15B 3VR8B 2K3UA 4J1MA 2OT2A 3P4RB 1QNKA 3I73A 1WTQA 2N55A 1RDPD 4OGQC 2EDGA 1KNAA 5KIXA 4HCEA 1KDBA 3D6CA 1WVLA 4YWGG 1FO4A 3TMEA 5LL6S 3EROA 1C9FA 1JC7A 4DNTB 4LK0M 1MD2D 1HFGA 3T53B 2K0PA 2VB2X 4RGMA 3VA5A 1STAA 1H9RA 4C3JG 1ICWA 4BWGB 1SNQA 2A74C 2XN9C 5HHDG 4OO1H 1JE4A 1WTPA 1WSPA 1Z6HA 5HFYA 3D3RA 4XDCA 1SIJA 3S1QB 4EE2A 2K5QA 1K53A 2B2YA 1L6VA 2QMTA 3E9SA 3PV0A 2HQEA 4RHSA 1XLNA 1O78A 5LNK1 4ZLTF 2WU5B 3Q8AA 4N9PA 1BUVT 4YT0B 4KJOA 2GB1A 4HJGE 2W3RA 2KACA 4P6VF 4ZHPA 1NSNS 1V1PA 1CJEA 1KAAA 2CJNA 1PFNA 2B2UC 1R4QB 4IQZA 3FDTA 1B1ZA 4OL7A 2Y3AA 5FO7B 2DY7A 1ZUD2 1DD2A 1NUCA 2QCPX 1UWMA 3M4OB 3Q8BA 1P7FA 1CM9A 2B2YC 2NTSA 1H9SB 2QEJC 2CW0C 2F0MA 2FUG1 3Q69A 2BS3B 1ZEQX 1J9OA 1G291 1K51A 3H09A 3NVZA 3I9V1 2Y5PA 2EYMA 1GUNA 1EY6A 4KD4A 1V43A 1GUOA 2KECA 4IUVA 2FINB 3O13A 2HCCA 4C3HG 1LTGD 2EYOA 4ARCA 4WAFA 3TEZA 1RCVD 5JEAG 1RYJA 3I90A 2R92B 2BA1A 1N5XA 1SJHD 1EIGA 3VRBB 2M19A 3IAYA 3MC0B 2ZW1A 1L5PA 4A3JB 3I4NB 3AE5B 1K50A 2IGGA 4NJCA 2RMMA 3D4RA 1YJJA 1N62A 3ZQ4A 4J6HA 1STHA 3AB9A 4CQNA 1JWAD 5C3EB 2L52A 4IFDJ 2WXOA 2EY6A 2FHTA 1NENB 1ZXHA 1TS3A 1JROA 3OWEB 1E10A 2PPBC 2FE8A 1EL0A 1B9MA 2BT6A 2XWBB 3P1MA 4HRSA 2EYLA 3PO2B 4IUUA 2WDVB 2F0DA 1D4BA 3SK4A 2SEBD 3GTMB 4XYQA 3VQIA 1I4QA 2EYHA 3T13A 3VYSA 2XRQD 2F0NA 3MJ5A 5KYIA 2PZWA 2JEAI 1EQTA 4HCSA 3BYTB 5KRUA 4RGTA 2YEPB 4A3FB 3MXNA 2VZKD 4WURA 5FOBB 1F9QA 2Q5WD 4OHJA 3LYYA 4XWWA 3IXSA 2NZ1D 5BYSA 1VZ7A 1TY0A 3OPOA 5C2TB 1XCTL 1CZPA 1S5FD 1EZ6A 2AWNA 1HPCA 1AN8A 1BDOA 3VR2A 2N88A 1GOZA 1PZKD 1VF5C 1MI2A 1WTVA 2EYFA 2L11A 1GUTA 2K28A 3MEHA 4DAVA 1EZ8A 4H2AA 5C4ZA 1HZ5A 5D65A 1IYUA 3K58A 1VJKA 1JRPA 4S3SA 1E2VA 2F0FA 4DA2A 1BCPC 1TIID 2JYEA 2BW2A 2LS01 5LHY1 3AE6B 3FPPA 2B2TA 3TZUA 4FF1A 1EY0A 4R3DA 3DWPA 2C5CA 1U4LA 4ZRQA 2VB3X 3BIID 2H89B 2F0SA 1OXVA 4YIJA 2BDNA 1DZ1A 2WKCA 3NWSA 5EE9A 4RF1A 3PIP3 2PCFB 5I9PA 4L23A 4BA1I 4OO1G 4BBSB 3DWAA 1SYCA 1JB3A 4IUQA 4C7ZA 2C9OA 2EZVA 3URYA 3WOEA 4KV6A 1EY7A 5ELFA 4RGOS 4TSSA 4KKSA 1A2TA 1I4HA 1BCPB 1K8MA 4FXDA 4KGSA 2JXMB 4H0LC 4DN4M 2RSNA 1DXMA 5EE1A 1CT1D 3Q8FA 1SBBB 2PQEA 2N9KA 3J80L 2PO4A 3VA7A 3AEBB 3TDQA 1GPXA 3NUHB 2NVXB 4KJNA 4KY7A 5M3MB 1AYFA 5C5LA 3AEDB 3DHQA 1F2LA 5I4DA 1HRJA 3EJIA 1B2TA 3GTQB 1CI3M 3GS2A 4OIJA 3D6WA 4BA2I 1VR9A 3RPFC 4DXFA 5G5GA 1IGDA 2BB5A 2KVMA 3QOJA 5M3FB 2RPVA 4O42A 3A7AB 4V190 3UI2A 3T16A 3W2DA 3A55A 2LUMA 1EOTA 3J81L 3FMCA 4YXDB 1WWTA 4YTNB 4KKUA 4QUFA 2A6ED 1PTOC 2B2VA 1LACA 3W5UB 2WXGA 1DOMA 1OO9B 1VRAB 3NS1A 3T4AC 3E6ZX 4I65A 2F0LA 2FJ2A 5ELEA 1HHVA 2LY7A 2VNUD 1T5XD 4TMAB 3QG1A 4YSZB 1TWGB 1HA5A 3PO3B 3MP9A 4HEA1 1TWFB 3K5OA 3HUIA 4Q0FA 4NP5A 1CQVA 2PLPA 1VMCA 4KY5A 4QMGA 1HUNA 1ACCA 2PZTA 3KLSA 3WOFA 3K59A 3G7LA 3VR3A 2KUMA 2MJDA 3AU7A 1N60A 2K05A 2WXQA 2I46A 3E56A 2PNRC 1NVID 4A90A 2Y0SB 2E75C 2BYTA 1B53A 2IX3A 1RF2D 1L4ZB 1JMLA 1DYQA 2L55A 4OZBA 4FYDA 5BYRA 2HCIA 1EY5A 5J1ZA 3HGBA 1XTCD 3OIQA 2QKIC 2D2CC 3FC4A 4KGTA 4CKBA 2MUYA 1O7YA 2V3NA 1TVXA 5AUIA 1RWSA 1ENFA 2WXIA 3N9YC 2RBMA 3QIAA 2A68D 5LL6X 1S5BD 2M2LA 1F9SA 3CRLC 1YNND 2Q8IB 2QF7A 3J7AV 3EQLC 1I4RA 1X32A 3MHZA 3V05A 1S5CD 1SYGA 2RSOA 1PGAA 1SF0A 2XVSA 1XWEA 2PZUA 2Z4IA 1TQOA 1NI3A 2O5JC 1ZOYB 4DK0A 3IFTA 3M7GA 1YN5A 2O4XA 2F4IA 4PMBA 3D4DA 1DOYA 4RNAA 1A3VA 2WP8J 4TQUS 5T1IA 1PLFA 1I4XA 5IOCA 2ICIA 1KABA 2AQ2B 4XIGS 3RMHA 3GB1A 2F0TA 1V8CA 4C80A 3K57A 5CV7A 2V4DA 1J8IA 3AECB 3NRZA 1G2TA 4JE3B 3PUYA 4L1BA 5JEAH 1FIQA 3SDZA 1S5ED 2IPKD 5ELDA 3FEWX 5IODA 3PUVA 3DEPA 2A6HD 4A3MB 4LAAA 1SNOA 4Z9CB 1I3QB 2Z4HA 3Q22A 1LTBD 1OXSC 1EIHA 3BZDB 1I7HA 2J53A 2NVQB 3R3OA 1Y56A 1DONA 4KN4C 1YNJC 4DU9A 3P63A 3QJYA 2JSOA 4XXEA 1DJRD 3M4YA 3W1SA 5AFWA 4XT3B 3JAME 1RHPA 2PTLA 3PZ8A 1GUWA 1E7PB 1GJXA 3HEJA 3A56A 4N6EB 2KEDA 4X3SA 1NR4A 5JEAJ 1C4CA 5IGFA 4DAYA 1K83B 4KGRA 2ZXOA 2K32A 4IOIE 1MSGA 1UAPA 4H13C 1YN3A 2JWUA 1SYFA 3P20A 2B63B 3HRDD 3AE1B 4MN3A 1TKWB 3H8HA 1C77A 2KCCA 1XLQA 4ZKBB 1ESRA 5FLXL 5C6AA 1DOKA 2F1MA 1JOKA 2VXWA 3LX0A 5CV8A 4A3GB 1HFNA 2A6EC 3OMCA 3SR6A 2NB0A 1BCPF 4I7ZC 1XCQL 4M1UB 4IUNA 3HG9A 2G1EA 1FXAA 5E6JA 1PDXA 2E2HB 3DUZA 5GXGB 2X6GA 1JQYD 4F88A 2E6XA 2SAKA 2EOTA 2F0OA 1NYRA 4J8QA 2OEDA 2QIEB 4FXKC 3OMGA 3TN2A 4KD3A 3K7AB 2XRSD 3OOCA 3I8ZA 1PFBA 3AE4B 2BA0A 4NAWB 1PFMA 1NR2A 4OZAA 1CFMA 5JOBA 3TUOA 4NMZA 3J81E 1NYQA 2J7ZA 2HDLA 3H91A 3TP8A 1FGBD 1F77A 1DOIA 3ZJTA 1NEKB 3U2SC 2F0WA 5CR3A 5KNCA 2KQ3A 4TRDA 4K8JA 2IGHA 2WS3B 3V3XA 1Y8PB 4P2CB 2HTME 1PTOH 3PUZA 1F2YA 1PYWD 1WCMB 1ZXTA 2DYMA 1Y69U 4XWTA 2F0VA 5AUKA 3AM9A 1E9MA 3PO0A 3EFXD 2F0KA 3S1MB 3H6MA 3A8KE 3NP8A 4MHEA 3V96A 4N58A 2KDMA 2GA4B 1EWYC 1TS4A 2L5TA 2RQXA 5JJZA 1RKNA 2F0PA 4A6QA 3EGRA 2EJMA 5F2DA 1N5WA 3HOYB 1IGCA 3L7ZC 3K5NA 4G7HC 1IW7D 1FR3A 3SK5A 5H92C 4RH6A 1QT9A 4CHTB 4PV1C 1XX8A 2QSDA 5CYUA 2WV6D 2ACZB 3LB8C 3I72A 5M5XB 2LHEA 2F3VA 2B2WC 4A55A 4ITKA 2EYPA 3VYUA 3K5LA 5I6YA 1CA5A 5ELCA 1DCZA 5CORA 5FKAC 3SFDB 1OXTA 4XQJA 1XO3A 2CHBD 5TSSA 4D2KA 1HUMA 1CA6A 1GUGA 3HS0C 3BYYB 5HURA 2K03A 2JX5A 2M9VA 2F0UA 5CMDA 1QNUA 1XXGA 3W9CB 1GXDC 2AX5A 2XSCA 5DNFA 3R93A 5M9OA 4KKIA 4RCOA 5E3FA 3NUCA 3ETRA 3G6JB 5DEHA 3HVZA 2HDMA 3J80E 4KKJA 1EY8A 4TKOB 1STEA 1PFDA 4ZK9B 2R3ZA 1VDVA 2KCNA 3ONAB 4A93B 4ULLA 1VZ8A 4IN3A 2ONQA 2QDBA 3QO2A 1HTLD 3TSSA 1BUIC 2JE6I 2EY2A 1TYGB 3ABVB 2X69A 3TEXA 1ZDXA 1SFOB 1SE3A 3HVDA 1YQ4B 3IT6B 4FF2A 3I4LA 2V3PA 3DWQA 2G9HD 2N7JA 3Q24A 1I6HB 1SAPA 4A3BB 1Y1VB 1JALA 1ESFA 3A54A 2F0JA 4TQ0A 1IHZA 1SSOA 3PMFA 2VZKB 4ARIA 5D14A 1YMHE 3MZ5A 1KLGD 1QF6A 3FAHA 3OW7A 1EWHA 3C3LA 4WJWA 3A8JE 1QE6A 1TWHB 1SJED 3BDOA 1WYGA 4GZYC 2M0AA 5JAVA 3C2PA 1O7LA 1GHKA 4FNFA 3S9WA 2GRIA 3R2TA 4G7OC 1S5DD 3TP5A 3MWYW 1A70A 1EQVA 2CVRA 4N59A 2EY5A 3B2GA 1ILQA 1Q10A 2Z8LA 2YYZA 3IKJA 3PZ7A 5D3DA 1AFPA 4L63B 1ZP0B 1RTOA 3LWEA 3VR9B 3B9JA 1GB1A 3KK7A 2IW3A 3M3YB 5BN5A 3GD7A 4K8IA 5FLXE 2NTTA 1H9KA 2K5WA 2ICEC 1U4PA 3R8BA 2B2VC 2OXPA 5CV5A 2X38A 1WXQA 4XQNA 1PTOD 4JWSC 4NW2A 2WLBA 3MA2B 3P4QB 2B2TC 2EVBA 1D2BA 3PIO3 2R93B 1QCBD 3CIRB 1T5EA 1SE2A 4BBRB 4K5WA 2A69C 1X3QA 4CJ2C 3BK1A 4O1NA 2JYTA 1IBXB 2MPMA 2RVLA 3MXGA 4MACA 2HUGA 3GV3A 1V97A 3BWUD 3JAML 4US8A 1TY2A 3B2FA 1TWAB 1STYA 2F0GA 2L32A 1JOOA 3J7YW 2LFNA 2F03A 3BDLA 1C4QA 4IKGA 2PW5A 5KNDA 1UUPA 3MHBA 2EY1A 3I91A 5KGUA 1FRRA 1KDCA 1B4OA 2BDOA 3ERQA 3VR5A 1Q1BA 5JXVA 4K5XA 1WGKA 5IIFA 1UEAB 2N9LA 2WINB 1JWMD 2WQYB 1JWSD 2EKIA 1QOGA 4CBVA 4WWMA 3S17B 1Z7TA 1BR9A 1EFID 1ZYRD 2E2IB 2D9UA 1JWUD 4H44C 1VDZA 1FD7D 3A7LA 5IT9L 1QOAA 1SYBA 2WXRA 1B9RA 3HRZC 1PDQA 3KBGA 4KN7C 3MFGA 3KQ4A 1YNTE 1BO0A 3GTOB 4HN7A 3KF8A 2I2YA 1F2MA 2K04A 3U9SA 4FXCA 1I50B 3OWFA 1ZPSA 3MTSA 1G91A 2R7ZB 2IJ0A 1DM0B 3U52E 1L0YB 2HDEA 5EKIA 2BE5C 3DMUA 1SMYC 5DAUA 1SNMA 4OO1I 3RLFA 2WXLA 4JPSA 1EWCA 4ZUIA 2JSVX 2WXKA 1ILPA 3BS1A 2INPE 4GDKB 2JYOA 2WIIB 1VZ6A 1A6XA 2DN8A 4ABNA 2LFIA 3FRPB 3NK9A 1VLBA 4F8MA 3GO5A 2MH7A 1TR5A 2L9HA 4XYOA 2K22A 2SOBA 2IX1A 5E1FA 3MXUA 4Y7NB 4Q5VA 5EPJA 3I57A 3PUWA 4XT1B 2V4IB 2NVYB 3A8IE 2A5HA 1PRTF 2XWJB 3NE5B 4IFDH 4PNYA 5FO8B 1SNPA 3K5MA 3W5VB 3NBIA 4OVZA 1TS2A 3VYRA 1D5XC 1BQQT 1CQFA 1KDAA 5K5PA 1A3TA 2OEOA 2W3SA 1D1KA 1OQQA 1QWYA 4NAMA 2XIWA 2PMVA 4FP5D 2OHFA 3Q6SA 5E4WC 3AMZA 2NWGA 2A6HC 1LT4D 2H1EA 5CC4A 1S4ZA 1TZOA 1GAQB 2GI9A 4WFN3 3T3NA 2CW0D 3T56B 3GTKB 5CV4A 1J7AA 1PGXA 1F2ZA 4QIWB 1KF6B 2A69D 1SMYD 2NN6H 4HMIA 3GTGB 2M56B 3WCQA 5T8IA 4HMJA 3I70A 4REZA 4N9TA 1E2WA 3NTHA 1IYVA 4AS1A 5FO9B 2YEPF 3ZYYX 3RZDB 1KRHA 3VRAB 3Q8CA 5D7GA 1A3UA 4US9A 3S2HB 3C1FA 4GLSC 2D62A 2KN4A 4CJ1B 2J4XA 4CKEA 1EEID 4ZRPA 4C3IB 2WP9B 1EM7A 4USAA 2INNE 4RCNA 4LJZC 5JPNC 4KX6B 4UAIA 1YN4A 1CZWA 2L1BA 4DQOC 4M8AA 1O7ZA 2L0CA 4KY6A 1D6EC 3CHBD 4IZ8A 3NWTA 1RD9D 3FILB 3NTKA 4ZUJA 4ZOHC 2FMCA 4R8IA 4K6LA 3HOUB 1CHPD 2LMCA 5C4JB 2FFKB 1U4RA 3DXJC 3R2IA 2K7VA 4IUTA 3NZ3A 4ZKCB 1F9PA 1LT6D 5D3IB 1DOXA 1GUSA 2TSSA 5ELBA 3LXFA 1E0ZA 1ONLA 2WDQB 4IURA 4CGYB 1N61A 4UDUC 1KFYB 2KWDA 3D8GA 4KHVA 2MJEA 2N0SB 1D1IA 5A2QE 5C0XJ 2DWQA 3IFDA 2ZW0A 1EY9A 3ND9A 1KTKA 3GTLB 4YSXB 3CU7A 1WTOA 2F3WA 4EGVA 4QF4A 5C3WA 3QWNA 5NUCA 3J9CA 1WTXA 2RKSA 4XDDA 4R9WA 5IGBA 1V1PB 5COYA 5C0XG 3M85A 3BDCA 5IGCA 4C7YA 2SNSA 3GTPB 4FF4A 1M4VA 1LV9A 1QILA 4BY7B 3D31A 2EPBA 2BTEA 1B9NA 4WQMA 2F0QA 2LGIA 5C3JB 2KOLA 2FMMA 1PRTB 1AWDA 3TEWA 1T3QA 3S14B 3H94A 4L6TB 5I6WA 1YNJD 4NKLA 1CHQD 2D5DA 4RGNA 5C4XB 5C5MA 3KLRA 3NTIA 1NAPA 3RFZB 4JK1C 1HEZE 2R6GA 1TU2B 3OIPA 2YU9B 1B50A 2ZXPA 4Q2JA 5H8YE 2MP1A 1L6UA 5IGDA 2B8GA 3S16B 3SXHA 1FFVA 4PT5A 4AQ7A 2OF1A 3KUPA 2W54A 3SFEB 1BXTA 3HOXB 3HOZB 2XNAC 2VUMB 2K5DA 4OIKA 3VYTA 4K6DA 3AMUA 5MPOA 1TKGA 1PTOF 1CK1A 2MJ3A 1F9RA 4CJ0B 3AEFB 1C4PA 3F2UA 2F0EA 4IFDG 5HGTA 3P75A 1RODA 2IT1A 3H3VC 1J7BA 2IX0A 2EELA 4C56C 5BYQA 2AUJD 3ZGZA 4B9XA 1WRIA 1LTID 5IGEA 1QJOA 1XLOA 4DF7A 3AE8B 2I38A 3P1HA 3SEBA 4HSPA 1JORA 1SDFA 4H7BA 1LO5D 3BVMA 3IT4B 4WIPA 4NZLB 1BOSA 4KK7A 1C8CA 3AE2B 4XTCS 1R4PB 1M8AA 2PKOA 4OZCA 2J52A 4EVOA 1WTRA 1X3PA 4B0EA 1A15A 1AZQA 4LK1C 3HOVB 1V1OA 2EYJA 1LTSD 2QILA 4ZAIA 5IT9E 1C76A 2WNMA 1LTTD 4IDIA 2H4OA 3T51B 5G3LD 2E2JB 1QKZA 1MGSA 2A68C 2L12A 1LTAD 3NPPA 5KEEA 1YNNC 4X3KA 1A2UA 3RD4A 1UWXA 3MXPA 3BG3A 3E0JA 4BS9A 4F7XA 2WXJA 2PIAA 2K9XA 4ZHOA 4A8XC 4C3IG 4PMCA 1EYDA 1AEXA 2F0HA 1FFUA 3I4MB 3CKIB 1I4PA 4E6IA 1R7SA 4DK1A 5KNBA 1UGJA 1SSNA 5G3LF 3AE7B 3AN1A 2D5GA 3NXWA 1WTWA 1W6KA 2L4NA 1I6VC 1K52A 1CZGA 1AZPA 5C4HA 4HKQA 2IL8A 4XE0A 4ZQ3A 2EJFC 1MHXA 2IWHA 3IAM1 2BCOA 1FXIA 1G2SA 3V2TA 1BNZA 5EE0A 1XLPA 3S1NB 1U4MA 4ILWA 1L0VB 5C3XA 1IW7C 5JVH3 3K0YA 4K5VA 2RDGA 4G7ZC 2JEBI 1H9MA 3KWLA 4ID6A 4DAPA 4WH4A 2NBFA 2Y5CA 3C1EA 5EGTA 3BVGA 4C2MB 5J39A 1RFKA 2O2LD 2PYKA 3VR4A 2WAQB 3Q23A 3SVMA 1YQ3B 4J3OD 2MGSA 2NN6G 2RA4A 4KTAA 2Q8RE 1MSHA 3SK6A 1JR0D 2TMPA 4MM3B 3HP3A 5EKLA 2RDHA 3EUB2 1C79A 3P4SB 4JWUC 4A3IB 1AP0A 2IGDA 4G57A 2DNEA 1F2RI 1D5MC 2QJLA 1W6JA 2PMZB 4MT5A 2RDFA 1L0XB 1PRTD 3LNNA 3EVQA 2B2UA 5BN3A 1OXXK 3X3NA 2MJ8A 1ZE3D 1JCKB 1FNUA 1TT2A 3MVVA 1NCVA 2KEEA 3NQTA 1E0BA 3SR1A 1JWBD 1HZ6A 1IL8A 1ET9A 1SNCA 3FKIB 4G4KA 1LLRD 3Q8EA 3MFYA 4KHZA 4RKLA 1PUTA 2V0GA 5A2QL 2E76C 3VR6A 5M5YB 1FCCC 4K14A 3Q0AA 4DGZA 2G9DA 1DOLA 1HTPA 4DXGA 1QLBB 5BMHA 5I2XA 1KH0A 1SE4A 1B3AA 3AEEB 1KNEA 3P42A 4HROA 5ISRA 1PXUA 3AEAB 1FCLA 1STNA 5K36H 2E2DC 5C44B 4AYBB 3FVQA 3M7NA 5EBCA 1E6EB 5HG2A 1VCIA 1B44D 3U4EG 2DYOA 1HCZA 2CJOA 2K01A 2K1BA 3KBXA 3FILA 1GB4A 3W3AA 4WRDA 4A3DB 1FMAD 2B76B 2K5PA 1QB5D 2KA7A 3L4PA 4TQ1A 2AQ3B 4HAEA 2WB1B 4CKCA 4EQPA 5DM63 2LEKA 1EU4A 1H9JA 3P7JA 2WXFA 5A35A 3HZXA 2WU2B 2LJIA 4F87A 2B39A 1HQRD 1SEBD 2Q8TA 4C1NK 4MIUA 5EBDA 1ZKOA 5EKKA 3NVWA 4B08A 1ZDVA 2WXPA 5K36G 1XEEA 3RUZA 1PRTC 3DWGC 4YSYB 2BOSA 2JA5B 2B8FA 4KKTA 3AE3B 4RF0A 4HEDA 4GDLB 3TP7A 1O80A 4U673 2BB6A 3DWMA 2ON8A 1E2ZA 2FBWB 4DNRB 2ZXRA 2L83A 3DEOA 1R9TB 1CTMA 1LT5D 2BE5D 1FNWA 1LT3D 2ENBA 5EE3A 5FK9C 1BCPD 3H0GB 2ID0A 2I07B 4RWSC 1FD6A 1STGA 1HQMC 1RTNA 1EY4A 2A73B 3IAS1 1DGJA 1STBA 1F2RC 1HA6A 4A3EB 2B2WA 4DFAA 3PUXA 1OFFA 1F0ZA 3CRKC 1JW9D 1PZID 3TEYA 4X3TA 1TKYA 3CWIA 2NUCA 5DM73 3TZDA 2SDFA 1XF5L 3C8YA 4LTUA 5BMIA 4V0BA 2JA7B 4FVMA 2KHSA 4ME5A 1MHHE 4EQOA 1MVKA 1C4AA 4A9AA 1I4GA 5T1GA 2PVOD 3D4WA 1Y8OB 4RKBA 1LABA 2Z1CA 2BBCA 1UNSA 3X3MA 4ODGA 1ET6A 5CBEE 1H9SA 3QOLA 3HOWB 1FEHA 1Q90A 1Z47A 2DY8A 1TKEA 2JP1A 3S1RB 3C46A 1QQRA 3MAQA 3K6OA 3CQZB 3UI3A 1WD0A 3AH7A 5C0XI 1MPEA 2E74C 2AQ1B 1BF4A 1EU3A 1RM6C 2F0IA 4HR7B 1Y1WB 1QOBA 1Q1EA 4RFBA 2IDYA 4M0WA 4RA8A 1Q3LA 4B9WA 2K33A 4U68A 4C3HB 2LKVA 3SE0A 4FXGC 1IKLA 5E4XA 1G6ZA 2W82A 1ZYRC 2JZPA 2CU3A 3NVYA 1C48A 3P4PB 3NVVA 4L8JA 3AB5A 1FRDA 4MH8A 1AW7A 3N52A 1C78A 4IALA 4BY1B 1SNDA 1JICA 3EA6A 1EEFD 4XQQA 4A3KB 3AE9B 2NN6I 3GQBA 1ZXIA 2KJXA 2L1AA 2PW7A 1ROEA 3T3OA 2WKDA 3U9OA 4QB4A 5IGGA 4FF3A 1Y8NB 3L9AX 2EXZA 3QB3A 3BK2A