1AW7A

Q136a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHALTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 56
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1997-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1aw7A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1aw7A01
1D5XC 3SEBA 1I4GA 4L6TB 1BCPC 1XTCD 1LTRD 4UDUC 1KLGD 2XRQD 1CQVA 1TS2A 3R2IA 4RGNA 4DXFA 3R2TA 1CHPD 1AW7A 1TS4A 2SEBD 2G9HD 5D3IB 3OWEB 5ELFA 1FNVA 1SXTA 1EU4A 2NTTA 2O2LD 1L0XB 1LO5D 2IPKD 4RGTA 1CT1D 1FNUA 1D6EC 1STEA 1SE4A 4RFBA 3EFXD 1JWSD 1TY2A 5ELCA 2IJ0A 1D5MC 1JWMD 1LTAD 3DWQA 1V1PB 3EA6A 5ELDA 1DJRD 1RD9D 3BVZA 1SBBB 1AN8A 1DYQA 2QEJC 1ET6A 3BYTB 1JWUD 2WV6D 1M4VA 1TS3A 1JQYD 1XXGA 1B1ZA 4RHRA 3O13A 1YN3A 1PRTC 1I4RA 4L63B 1LLRD 1S5DD 1UNSA 4ZYSA 1EFID 1F77A 3GP7A 1BXTA 1SE2A 4BWGB 1T5XD 4RHSA 1PTOF 4RGOS 1HTLD 1I4QA 1LTBD 1S5CD 5D3DA 2Z8LA 1YN5A 1ET9A 1PTOH 1FNWA 1BCPF 2QILA 1I4PA 1BCPB 1PRTD 2XNAC 1CHQD 3MFGA 5I4DA 1JR0D 1JCKB 3W2DA 2XRSD 1FGBD 1G8ZD 1RCVD 4TSSA 1HA5A 1PTOD 3TSSA 1LT4D 2ICIA 1LT6D 2AQ2B 1PYWD 1V1PA 1CK1A 1I4HA 1LTTD 3BZDB 5FK9C 1ESFA 2AQ1B 2J4XA 2RDHA 3V05A 1S5FD 3BVMA 1S5BD 3CHBD 1TY0A 1SJED 1KTKA 3KLSX 1PZKD 1RF2D 3BVGA 1QILA 1BCPD 1SJHD 1GOZA 1L0YB 4O1NA 3R8BA 1EEID 1EEFD 1I4XA 1RDPD 1EWCA 1PZJD 1D5ZC 1LTID 1LTGD 1PZID 2TSSA 3URYA 1TS5A 1MD2D 4RGMA 1PRTB 5ELEA 1LT3D 4Z9CB 1S5ED 1PTOB 4OHJA 3DWAA 1YN4A 1PRTF 2RDGA 4C56C 1EU3A 1PTOC 1LTSD 4RCOA 5ELBA 5FKAC 3DWPA 1B44D 3MC0B 1SE3A 1HXYD 4K6LA 1FD7D 1SEBD 1UUPA 2XN9C 1HQRD 4NZLB 2NTSA 2AQ3B 2R61A 1KLUD 4DXGA 1ENFA 1V1OA 3BYYB 2CHBD 5TSSA 1LT5D 4RH6A
chains in the Genus database with same CATH superfamily
3T53B 3HOZG 3TBIB 1SIFA 1MJDA 1I94Q 1WX7A 1Z6HA 1KF6B 1V6EA 3RLNA 2CH4A 1XEEA 2B2WA 4HIMA 4HJ8A 1HR0W 4JI0Q 3K7UC 3AV8A 2Z6KA 3VH3B 2MP2A 1KLGD 1UZXB 1ZXIA 2OJWA 3HVZA 4KHVA 1CZWA 2RD0A 1N33Q 3TMPB 3ZNZB 1U4PA 2JA9A 2GA4B 1OFFA 1KXLA 2G9HD 2QW7A 1KFYB 1YIJA 4WQMA 1WGKA 4KZ0A 3UE1A 1VQDA 1D4BA 2NTTA 2REXA 4OELB 4A3MH 3ML8A 1V49A 1L6UA 1X1MA 3I7FA 1D6EC 4CKBA 4GMVA 2IBIB 3MC9A 4FHJA 1SE4A 3PIP3 1KABA 4A90A 2VL6A 1ASYA 1LTAD 3A8JE 1PFDA 4ME5A 1EZ8A 4LNQA 1DOMA 2ZXOA 1Y8RC 4X3TA 3ZVVA 2KOLA 3B6YA 4MTKA 1IXRA 1IKLA 2MJ3A 1AEXA 4JWUC 1FR3A 5EQ0A 3DBRI 3IRBA 2PPHA 2WGSA 1SB3C 1I35A 5DAUA 1C3TA 3HOWH 1AFPA 1C4PA 4WIPA 2QDBA 3HRZC 2DYOA 5TR5A 4ARIA 4DK1A 5FO9B 1V5OA 4WJOA 3DHHC 2F0SA 3GTGB 5GXGB 1PTOF 1RLFA 4CO7A 2FAZA 2OCEA 3HOVG 2LGDA 5M3FH 3GS2A 4TRDA 4IUUA 4IJHA 4RMFA 1P7EA 2Z9HA 1E7VA 2BKRB 5EDSA 4E74A 4JG2A 5BN5A 2PE6B 3PUVA 4B3RL 2RMMA 2WXIA 1PH4A 4YSZB 1NMFA 4R8IA 1VQCA 4QIWE 3TN2A 3QJZA 3GTPH 2K5WA 2XNAC 3B2FA 3LXFA 3VYTA 4YHHL 5BN3A 2NVUI 4B9KA 1KRSA 1XTDA 2C35B 3D31A 2RA4A 3TP6A 2CKHB 4IFDG 4DR3Q 1EYCA 3CRKC 5DM63 1KC8C 1I7HA 2JK8A 2HCCA 3DXJC 3NHHA 4LK1C 2A6HC 1HA5A 4HJAA 3BIID 5BYRA 3ZXRA 1SYGA 5HKHA 2F0VA 1PFBA 2HQEA 2LXAA 3P63A 4GOPB 2PMZE 4JI7L 5EBDA 4IPHA 1CK1A 4A3KB 4BXXH 4GS3A 5DLQE 2PO4A 4GOPC 4YSYB 4IFDH 3L16A 2EJMA 4BBRH 3Q6BA 2J42A 3HP3A 3W5UB 2UUAL 2F0JA 3I90A 2AQ1B 4URKA 3CXCA 5E1FA 2GBMA 5IGEA 2LGIA 3ML9A 2NVXH 2LKVA 4DAYB 2IO0B 3ABVB 4MEMA 1SJHD 4L1BA 2PI2E 2D07B 2NN6H 3NE5B 2PVOD 4KGTA 2Q8RE 3RN5A 2UWQA 4L5TA 1HNZL 4DR2L 1NEKB 4C3HB 3W1SA 3NOBA 2YTVA 4W9EA 1RHPA 1BQQT 1TKWB 4KN4C 5C0XH 1OQRA 4L23A 1YNTE 1PVOA 4FHKA 1E9MA 3MC0B 3VUWA 3I9V1 4EEWA 1UH6A 3GTKB 2X38A 1U4LA 4WWMA 2ZVOA 4XZ4A 3FAHA 1DGSA 5KGUA 2Q2HA 5LMNW 4BBSG 1KOTA 2AQ3B 3G6JB 5T1GA 3ULLA 5KRUA 2DZKA 3UDFA 1C79A 4KI0A 3MVVA 3PLVA 3APDA 2B3AA 3DHGC 3VRAB 1CKMA 1IBML 1ZGUB 2CU1A 2IL8A 1E2VA 2KEEA 1LTRD 3OHXC 1YHBA 3KWLA 1F2RC 4FXDA 3ZKJC 3R2IA 1XNRQ 2F0TA 1G51A 2FHTA 1CHPD 1N32L 3LB8C 4GDKB 3TEZA 2ONQA 4C7ZA 2CHXA 1YOVB 2ASQA 2N9LA 5LXHA 1AZPA 1GC6A 3ONSA 4L2YA 4HK2A 1JB7A 2B2YA 4GDLA 4XDCA 2KEDA 4UY8C 3W1SC 4QJFA 4XDXA 2BWES 2LRWA 4E3CA 2BA1A 4A6QA 3TRZA 1VS0A 2V3SA 4XE0A 4R4TA 4DR2Q 1CM9A 4RM9A 3BVZA 1A8VA 1LUZA 3ZJYC 3FMCA 1B9NA 1TS3A 3AE4B 1DM0B 5C44G 3L08A 1WTVA 2PVGC 3QOLA 1FXTB 5FJ8G 2MX2A 3CCJA 3CF5A 4C3IH 2YTYA 3F2UA 2QC8A 5GAEC 3K9PB 4ZYNA 3D4RA 3U7ZA 1SR3A 3NSWA 1STYA 4A3OA 3CRLC 4DAMA 1WCMB 2LXJA 4PYZA 3DBSA 1L7YA 1R9TB 1WX9A 1HTLD 4K8IA 2C7NB 1QNKA 2WKDA 3I4LA 4WORA 2AMCB 5IT9c 1LTBD 3F2DA 2KTRA 3B2GA 4RNAA 1UELA 1J19A 1LGRA 1GUSA 3AFQA 3RZOB 2E2JH 1A3UA 2L0TA 4BY7G 1PGBA 1VQAA 3Q3FA 1PH3A 5I2XA 4MHEA 3MTSA 1NI3A 1X56A 4RA8A 4ZK9B 3UI2A 3D3RA 2JA8B 2AWOA 1SNPA 2K22A 2R92B 3VA7A 1PH1A 3HOXH 1TZOA 5EBCA 2WAQE 5F2DA 2DY7A 2ZJRA 1OTRB 2MP1A 1WY8A 4OL7A 1ZDVA 3A9KB 3D6WA 2K25A 3N20C 3PIO3 1TTNA 1Y8NB 3RNCC 5IP4D 1ESFA 4IUVA 1MHHE 1WTHA 2A19A 1H9KA 1C7YA 4A3FG 3RT3B 1HCZA 5IYCH 1GOZA 5K5PA 2FBWB 1IBLL 3CCVA 4HAEA 2UUAQ 4EFOA 3EHVA 5M3MB 2JEBI 5G3LD 2PEAA 5JHAA 2I46A 3NTKA 2D3AA 2BCOA 4WJPA 4QMGA 4RCOA 5IWAL 4POGA 2BOSA 4OX9L 4LF7Q 3GB1A 4GSWA 3CCSA 3E5SA 1K50A 2MHVA 4N6EB 2Q2TA 1PUTA 3QG1A 1UUPA 3CPWA 1E0BA 1ASZA 1KLUD 2F3VA 4RCNA 1E24A 2A69C 2ZTDA 3GE3C 2MHJA 5D65A 1N61A 2FINB 3M4YA 4WURA 3SHQA 4BY7B 2I5LX 1AYFA 3HOWG 3N9YC 4L5QA 3CC4A 2JA5B 4KV6A 5CV8A 1AARA 5C3EH 1EWYC 2ZZPB 3T3NA 1SYBA 2MJDA 4FADA 4UDUC 1ZW7A 5NUCA 3WALA 2EYMA 1LYLA 5C2TB 4LNIA 3H9DA 3QAQA 3R2TA 5JPMC 3AFPA 2WLBA 5T1IA 2VQEQ 3S1QH 1TYGB 4TUUA 1FNVA 2TMPA 5E6JA 1EU4A 1K9MC 3S14H 1SYDA 3WOEA 4OIJA 1TWFB 1HFGA 1IGDA 3ZIMA 1BKBA 4CDFC 1UBQA 3EFXD 1TU2B 2E6XA 3J81j 5CC4A 1Y1WB 4DV6L 3DVGY 4B3SQ 1A62A 3T4AC 3EC8A 3VH4B 1GAQB 1X32A 3UI3A 1T5EA 2GVBA 3FKIH 3TQYA 3DDCB 1BF4A 4XYCA 1RL2A 4CYEA 3T16A 1N34L 2ID0A 4DV2L 2KWCA 2RDBC 2RHSB 1EY9A 3M4QA 2E2DC 2NZOA 2ALYB 3A4RA 5DPTA 3HFZB 2YV5A 1MG4A 5LNK1 4IJLA 4ZQ3A 1A15A 4ZYSA 2K6QA 3RPFC 1STHA 1Q0WB 4IOAA 2KLCA 2D3BA 3QWZB 2VY3A 2SNMA 2QEXA 5DEHA 1HZ9A 1QZGA 1WJUA 3Q3OC 3TP7A 2HDEA 2EKEC 4YTPB 2Z4HA 1EY0A 4DUZL 1VZ8A 1QNUA 2KC2A 2M0AA 2MJ8A 2QDFA 2ZCBA 3W1YA 1FL0A 3I4NG 3EUB2 2R92H 2MSED 2D0PA 3ZJTA 3L13A 5FO7B 1E6EB 1WGHA 1FGBD 1JOKA 3PRZA 2MBOA 2V1CC 5T8IA 3NBIA 3LNNA 1EFWA 3T1YQ 4MELA 2OT2A 1CSPA 4HDOA 3D4WA 2CJOA 4BKGA 1MVKA 3RZOH 1K8MA 1HR0L 5C23A 1K73C 3LDZE 2B29A 2IT1A 2L83A 3DLLA 4K14A 3TS2A 3I72A 1KRTA 4K3CA 2KCTA 4YY3Q 4K0KQ 1MIUA 2J4XA 1WM2A 4Q2JA 1G291 1K3RA 1HZCA 3VTUA 1C9FA 2V9HA 3CCQA 4XQQA 4F8MA 4KDLB 5EKLA 2PMZB 1JOQA 2LFIA 2AYOB 1EEID 3QOJA 2JY6A 3J7AV 3LX0A 2TSSA 2GBRA 2ZJPA 1TS5A 5IGCA 1N62A 1Q81C 4HJGE 4M01A 1CQFA 4MJSB 4ZDVA 5LL6X 1S5ED 1M94A 1VCBA 2M2LA 4B95A 2VZAA 3EROA 1PTOC 3TZUA 3J80i 2JUOA 1WE7A 2DHZA 1XCQL 1D1KA 1RTOA 2CQAA 3S1QB 4DDID 1VF7A 2BS2B 4GKJL 2EOTA 1E8ZA 2B2TA 2DNFA 4H13C 3UE0A 2VB2X 4OX9Q 1FJGL 3AE1B 3IFDA 4O2DA 1PH7A 4RH6A 3P7JA 4NXMQ 2RSNA 2I0QA 3CIRB 3HOUB 4N8FA 1WWTA 2KQ7A 4PS8A 1VCIA 3K80C 4M1UB 1S1QB 3HHMA 5LL6S 2EYJA 5IT9L 1ZDXA 3KJOA 1K53A 1P8LA 1E2ZA 3X3MA 5IYCG 1VMPA 4BA2I 4RGNA 1UWMA 2X8XX 2JZ3B 5IGBA 1Y8PB 2K75A 2WIIB 1SXTA 2WKCA 3KDFB 3HM6X 2QJLA 2VXWA 4LW1A 2BWFA 1XLOA 2INPE 1ZKOA 2KUMA 4TQUS 1NCVA 5LMUQ 1CMXB 5C1ZA 5IT9E 1YNNC 2JA5H 4P71A 3PRMB 2NB0A 4HJ5A 3RR5A 5BR8L 4YCUA 1DGJA 2A68C 2K39A 1TY2A 2QSDA 2OHFA 4B0MA 2KDEB 4YTNB 4KVGB 1BOSA 4YWKA 2BT6A 1Q10A 2WU5B 3NG0A 3KF8A 2DYBA 2R93H 1XYIA 2BYTA 1R4PB 2A6HD 4P16A 3PF4A 1M4VA 1H9SB 3C1FA 2FNJB 2NBUA 4HPMB 2LVOA 5BYSA 4DR7L 2UXBL 1ISNA 5AJ3L 4TQ1A 1TWHB 4YWMA 1SROA 3ND8A 2EYFA 3J7ZC 4NJ7A 1BXTA 4GKJQ 2UXCL 3U7DA 4DR4L 3RNEC 1FJGQ 2EXZA 3HOYH 3AEBB 1WR6E 3ZDMC 2BDOA 4ALPA 4ID6A 4V190 3K8AA 4MTNA 4QL5A 3BG3A 1SF0A 2K3UA 3R3OA 4JW0A 2VS1A 3C3LA 5E6NA 3ZJVA 1WRIA 1PRTD 2GVAA 3IBEA 1S3OA 4HJ7A 3QX1A 4KX6B 4DK6C 5AUKA 3I63C 4MZ9A 2JA7H 3NBHB 3W2DA 3NS1A 2L76A 3JW0X 3J81i 2VRRB 2W3SA 4W9HA 1WSPA 1I94L 2BH2A 1E2WA 2F0PA 2AKWB 4IUQA 2IX3A 3PO3H 3NTHA 3CC7A 2KN5A 4K7UA 2NZ1D 1FFVA 1YNJD 2AQ2B 3K5OA 4NMZA 2JXMB 2K5HA 5E6PA 5MPOA 4NQLB 2JA7G 2E2HB 4CGYB 3BDLA 5BR8Q 3JAME 3M63B 4NXNL 1UGJA 2WP8J 4LCDE 4EZJA 1VQ6A 4BS9A 2ES2A 1SAPA 1Z7TA 1B8AA 1S5BD 5EJWA 1HZ5A 1NYRA 4GLVB 1Q8KA 1V5TA 4NXNQ 1WYWB 5E4WC 4M02A 5HGQA 3HOWB 4JBKA 4LFAL 1NENB 1SDFA 3DVGX 4DQOC 5AJ3Q 2MQHA 1J7BA 4A3LH 2RSOA 4RGMA 3MXUA 1XQQA 2PIAA 3AMZA 2K5QA 4J15A 4P73A 5IGDA 4FXCA 3FKIB 1L1OA 4U68A 1K0SA 3HIZA 4CDEC 1TWAH 2ENBA 1KIXA 4A3DH 1J7AA 1L4DB 2K0PA 2N88A 4JI2L 5FLMG 2LWPA 3C19A 3FP9A 4ZKCB 5KHQA 1Q90A 3QB3A 2WXHA 2J0TD 3BINA 5D6JB 1CKNA 3M7NA 4AQYQ 1Y1VG 2PPBC 2KFJA 3B0AA 3VYRA 3A56A 1FRRA 1G6JA 4XYQA 5TSSA 4EZKA 1SNQA 1WI5A 4BY1H 4OXPA 1HQMC 1I4GA 3PQIA 4ZRJA 2O5IC 2ON8A 3P4RB 4X62L 3OIQA 4PYUA 4FVMA 2B2VC 3S1RH 1NJIC 2OXPA 2M1MA 1KJTA 2Y5BB 3RNGC 4ASWC 2SDFA 3GTJH 3L3OC 3KUDB 4GU2A 4NDXA 1TS4A 4AP4C 3STBD 2G9DA 1VQOA 1T9HA 4OONA 3S17H 2HE7A 1T0QC 1VDZA 4NY0A 2BS3B 2KXJA 1SFOB 3GTQB 3A7AB 1O80A 4WRDA 1CKNB 2D62A 5FR3A 2D9UA 1YJ9A 1TWCH 2KHWB 1X6OA 4C80A 5DCNA 1E1OA 2ZXPA 4JBJA 4R8NA 3K58A 3OJ4B 2GI9A 3VVWB 4F8CB 2V4IB 1DJRD 2E75C 4ARCA 3NVZA 3H1UA 2PZUA 2RCNA 4KN7C 2RHQB 4IW0A 1WXAA 3BDOA 5C3JB 2F0QA 3OMGA 4N9PA 3UDXA 2LRUA 1T0YA 1V8CA 4XX5A 2HT1A 1HNZQ 3J81L 3Q8AA 1K8AC 5FLXL 4PMWA 3DMUA 3CU7A 2DY8A 1BBXC 2ZT9C 3F8TA 2CS4A 3Q6SA 4BWGB 1R4NI 4C3HH 4AQYL 4DR7Q 4ZAIA 2UXBQ 1L4ZB 3HG9A 3S1MB 2IY0B 2LVPA 2L9HA 4CJ1B 1SMXA 1S5CD 3OWFA 5D3DA 2Z8LA 2L8JA 5EPKA 2WDRB 1EQVA 2N4FA 4ANVA 3MZ5A 4GLSC 1I4PA 1PA6A 1GC7A 1LM0A 3KOJA 3HVDA 1I3QH 3H91A 4ZUIA 1Y69U 2UXDQ 4W9IA 4TKOB 3AEDB 4KLKA 1HNXQ 2KAJA 2JSOA 3CSTA 3DPDA 1SSNA 2K5NA 1YQBA 3H0GH 4LF8Q 1XLNA 3RYTA 4B08A 2EKIA 2KJHB 2MBHA 2WXJA 4AWJA 1LFDA 2P5ZX 1E7ZA 1WCMG 4WAAA 3V60A 2J7QB 4HEDA 3U4ZA 2CHWA 1FIQA 2FFKB 3J7AF 2EYPA 4QIWB 5BYQA 4LF8L 5KHOA 4K1RB 3RMKC 4JI3Q 4GZYC 2ATWA 2N7EA 3AE9B 1E7PB 2KVZA 5JVH3 2A68D 3KFUA 1BCPD 3VA5A 3GTOH 3NY5A 5CTRC 4DV6Q 2OTJA 4RF0A 4IFDJ 1D1IA 3RI7C 3RN9C 4A20A 3ZGZA 3KF8B 5M3FB 4OVUA 5IWAQ 2M9VA 2KZRA 2F0DA 5LHY1 1JOOA 3WDNA 1PRTB 2JA8G 2HQLA 2MBQA 2CVRA 4XXEA 3J7A5 1MGSA 2N1WA 4LNFA 5HG2A 1XMQQ 1F2YA 5EKIA 4C56C 5IP9H 1F9RA 1FMAD 5FKAC 2KK8A 4XGAB 2I07B 3AEGB 4JGHB 3GTMB 1TVXA 5A2QE 2FUHB 4K6LA 3M7GA 4MJSA 4JPBW 3CCEA 2ZCCA 2VH1A 4A3JB 4BAXA 1SYCA 1Y8OB 2Z6KC 3A8IE 3I73A 3W5VB 2FE8A 3S1RB 5I2YA 1EOVA 2XRQD 5H8YE 1NDDA 1AE3A 4LWCA 4BBRG 1K83H 1HNXL 1ROEA 1WJ6A 3WAPA 4L6TB 1STAA 4HSVA 1F9QA 1VQPA 2JXTA 1DOXA 3L9AX 4ZRPA 1VZ7A 5GQOA 2JYOA 2BB5A 1CQVA 4W9KA 1U4RA 4F7ZA 3NENA 4RKBA 1TXYA 2K5VA 3KH0A 1PYBA 4C7YA 4OZBA 4GXBA 3T51B 4MM3B 1OQQA 4N9F4 2O2LD 5J18A 1TWAB 4BFRA 5CBEE 4KKJA 2N9XA 4TV3A 3PHXB 3H7SA 4W9LA 3HKZE 5E6OA 3VYSA 3N1XC 3NUCA 2CWAA 4I65A 1PDXA 4FDBA 5JJLA 2KCNA 2LXKA 3KLSA 3AEFB 4LTUA 1DYQA 2JA5G 1EIFA 2HCIA 3RLOA 3BYTB 3S2HH 2NVYH 1Q86C 4YL8A 3EGRA 1IBLQ 4D2KA 2JP1A 1JQYD 3J80E 4MGYE 4DU9A 2VUMG 3E0EA 3P1HA 3RNFC 3SK5A 2VB3X 4AUQC 1X3EA 1S5DD 4CHKA 1UNSA 2I5HA 4BBSB 4JV5L 4G57A 2UU7A 2OF1A 3ITPA 3ZLZA 2M19A 1QWYA 4IOCA 1S4ZA 4M8AA 3NWTA 4FO2A 1KD1C 1VQ9A 2KMAA 2SNSA 4BA1I 1Q82C 3S16B 1TJEA 4FJYA 1A3TA 2CW0C 2MPMA 1Z2MA 1IUEA 2IZVB 3CMAA 3T1YL 3BDCA 3OMCA 2IW3A 3H0GB 2IGDA 3SU8X 1YJWA 4IM0A 1VQMA 2Q2IA 4NXML 2CQOA 2NN6I 3MA2B 1HR0Q 3GO5A 3J80c 2W3RA 2E2IH 4C4VA 1RCVD 1VR9A 5EE3A 1PTOD 1YNXA 3AB5A 4HCEA 3AI5A 3K9OB 3E9HA 2E5LL 1LT6D 3SE0A 1V1PA 4WWOA 2VH2A 4DV4Q 1JC7A 1M90C 4BBSH 4KHPQ 2E2IB 3AQQA 4NKLA 4II2B 2VQEL 5AUIA 4UAIA 3FPPA 3PTFC 1TWHH 2DN8A 2Y0SE 2N9PC 4RMAA 4HLEA 4WFN3 4KD3A 2O2VB 3A5ZB 1J0GA 3NZSA 1YVCA 3KLSX 4HCNB 2E3TA 4O1NA 4N8X1 4DK5A 3K59A 1Z47A 4JCVE 4XT3B 3PRPB 2B3GA 2HIVA 1I3QB 3GTPB 3CCLA 4JI3L 2WACA 1MD2D 1WJJA 5JJZA 1WMHA 1R7SA 2I38A 2L11A 2C9WB 4IPCA 1K8GA 2LASA 5IODA 3VYUA 2V4LA 4I6NB 1YN4A 2B39A 5JAVA 3J81E 2L0FA 2RDGA 2DENB 3EECA 4K7SA 2AEHA 1C4CA 4LJOB 1YNND 3H3VH 3GTGH 2C7MB 2JX5A 4B9XA 3FILA 1IBXA 2BYFA 4L5SA 1M8AA 1XPUA 3H7PA 3I3CA 3W5OA 2KDMA 5KYIA 2BQQA 4NZLB 4A3PA 5C0XG 4DHZB 1SSOA 1NYQA 2NCNA 1ENFA 5C44H 3TS0A 1C77A 3PT2B 4IC7B 4YWGG 4LF9L 1L2NA 3KK7A 5IIFA 3I3TB 1QOAA 2X6GA 4AYBE 3FHWA 1XTCD 1WZ0A 1TZ1A 2PJHA 3Q3NC 2NUCA 4O42A 5C0XI 3I4OA 2L55A 2WX0A 2DZMA 1TS2A 5C4JH 2BYEA 4A8XC 3MJ5A 3FILB 4DN4M 4JYAQ 4PZ7A 2N7JA 3KYDD 1V43A 5DPRA 1HNWL 1TKGA 4C3JG 1ESRA 3R7QA 2LSSA 5EKKA 4JVZA 2F4IA 3L4PA 1XWEA 3U50C 4IPDA 4DK3C 2BW2A 3PV1A 3A5UA 3MXNA 1WOCA 1J8IA 2CHZA 1QQRA 3JSVB 5A2QL 1VQFA 1MI2A 1L1OC 1F2MA 3KQ4A 1AN8A 4B9WA 1GKHA 1SE8A 4IN3A 4A55A 5JXVA 1UD7A 4MNOA 2I5MX 3SFDB 2D10A 5IOCA 2UU9Q 1TT5B 1HTQA 4DR4Q 3TP5A 1EYDA 1YBYA 3I2ZA 3NK9A 3X3NA 4Y52H 4IUNA 4A93G 2ZNVB 3GP7A 3WAMA 2H4OA 4P74A 3GTLB 5D94A 2EY6A 5KIXA 3OLMD 3A33B 1WI0A 5COYA 4FXGC 2DJFC 1VQNA 2BF8B 5KNDA 3M3YH 4MH8A 2K05A 2JPHA 3Q69A 1V81A 5JH5C 4C3HG 3M4OH 1XF5L 1R4QB 3HOXG 3EFUA 2LFNA 2B63H 2PQEA 3PGEA 4IUMB 4R4IA 4BXXG 3MEFA 3T1HL 4OVVA 3Q24A 3OG5A 4E71A 2KOXA 1MKHA 2RSUA 2KTRB 4A3IG 4WH4A 3L0WB 4JI0L 3CQZH 1YMHE 1A2TA 3DHIC 3RFZB 5KNCA 2PKOA 5CHVC 2NMQA 2QCZA 3FPUB 3IKJA 1KL9A 2YLMA 2H89B 4DBGA 3FDTA 2LUMA 2HD3A 2RR9A 4JI1L 2E2HH 2NYZD 3TREA 1OEYJ 3TCAA 1NR2A 2DJGC 5CYUA 1N36L 3BVMA 2IX0A 5K36H 3SR1A 1KLVA 5C5LA 2F03A 4FF4A 3KJPA 3LWEA 4KHPL 2Z0DB 1PZKD 4JOIA 3AE5B 4HCSA 4GN5A 2JA7B 1TR5A 1RDPD 2MJEA 2NR2A 3NP8A 3VDYA 3S1MH 3PREA 2FCNA 3S15H 4IM3A 1P16A 2M56B 1IYFA 3HKZG 2W55A 3I70A 1QT9A 3Q8FA 1EU3A 2K1FA 4DV1Q 1WZ3A 4HPLB 1A5RA 1XPOA 3TEHB 1L0VB 2WXFA 4L8JA 1Y14B 3ERSX 3GDEA 4IKGA 2CJNA 4ZCKA 1I6HB 4WJ3M 2DAJA 2OQ0A 3P42A 3EBEA 2KKCA 1Q5WB 3H6MA 3DBHB 1A2UA 1E8YA 2J52A 2M17A 3T1HQ 4BY1B 2K03A 1QUQA 1AP0A 1TWCB 1XX8A 1UEAB 2WU2B 2QF7A 4A3BG 3WOFA 4CHTB 2PW9A 3JSVA 4AJWA 4IUPA 1FFUA 1JWAD 2XEWA 3HOVB 2JQRB 3I56A 3M62B 1VQ4A 4JOIC 4X65L 3L54A 2WXOA 3OTOQ 4RAUC 1LO5D 1VF5C 3CAMA 5D2MB 1H9SA 1VZ6A 4BKSA 1F2ZA 1STEA 3IL8A 1AWDA 2F0WA 4DV7L 2MQJA 5DPSA 3QIAA 3PMFA 1EUJA 4ITKA 1WTOA 1JWMD 5HY6A 3OTOL 5I9PA 1SN8A 4K5VA 3UQAA 3PIPA 2MUYA 1HNWQ 1QOBA 2GBNA 3TEXA 2QEJC 3Q0AA 1BUIC 2FIDA 4IPGA 2KFKB 2WV6D 3HOUH 5M5XH 2KO3A 2KVRA 3NTIA 4EUTA 1OEYA 4NW2A 1XXGA 3DEPA 1W2BA 1C8CA 3O13A 1XNQQ 1WXMA 4JBMA 1J5EL 2OQKA 5D7GA 1DXMA 3PHWB 5LXIB 2V3PA 1WGDA 4G50A 4BOZB 2M4NA 1IBXB 2IGGA 4B3TQ 1LTLA 3RCZA 4RHSA 4GLAC 3UIPB 4ME3A 2BA0A 4AQ7A 1RJTA 1TWGH 1I4QA 3SDLC 1IGCA 2QCPX 5KEEA 2KJ6A 4J6IA 2F0EA 3ZQ4A 1ET9A 3S2DH 1C1YB 3PUYA 4EQOA 2KA7A 3H3VI 2UXCQ 3U4VA 1R4MI 4I7AA 1GUAB 2I2YA 1X9NA 1BNZA 1D2BA 2G4DB 3KVFB 4NAMA 3WCQA 4HKZE 2MCNB 1NBFC 2N49A 1J8CA 3AE8B 4EGVA 2KDIA 2W82A 3UINB 1IW7C 4ULLA 2R2OA 2NVQH 2V1YA 1LT4D 5CX3A 1U5KA 4K8JA 1VRAB 1WGGA 4DPGA 1JMLA 1B53A 2RBMA 4R4CA 5IO9A 1NY4A 1WD1A 4DV7Q 1Q46A 2RGFA 1EM7A 3MP9A 3IXSA 2H5XA 4BY1G 2KHSA 2WNMA 2WAQB 1C78A 2BVCA 5IYDH 2JU6X 1SJED 4LF5L 2RF4A 2XBBC 1QILA 1K51A 4HCPB 4ANWA 2BE5D 2E76C 2C5CA 2RQXA 1N36Q 1TKEA 4GDLB 2FJ2A 3K6OA 1WH3A 1WXQA 4DHJB 2XGTA 3I4MG 1SLJA 3SDZA 5FR6A 3JC66 2HJ8A 1H9JA 2KWVB 2OWOA 1N60A 3C0RB 4QB4A 2O2VA 5ELBA 5G2NA 1K0RA 1KM7A 2BB6A 5L37A 1QJOA 4S17A 4A3GH 2LHDA 3C46A 4LDTD 1WGRA 2FIFA 4YXDB 1ZYRD 1EY4A 1WJ4A 2LGYA 1NR4A 2CR5A 2IO3B 4LUZA 1YIWA 4YIJA 2QHOA 1QE6A 2DGYA 3KLRA 1MHWC 4WJWA 4HSPA 4UP8A 1Y1VB 4DAYA 4DV1L 1JALA 1HE8A 4A75A 2KVMA 3GD7A 3ETRA 2IY1B 3SK6A 1D5XC 3CMEA 4HIKA 3A9JA 3C2PA 4GGQA 4OGQC 4A93H 2XIWA 1B7YB 2ZPYA 2JA6B 3TEWA 4ACFA 3K7AH 1EY5A 2EIFA 2JQOA 1Y1WH 1Z5SB 4LNOA 1LM8B 4P6VF 1Z9FA 1EQQA 3RNUA 4A3CG 4WJ4A 2D3CA 1CZGA 2KJXA 1RTNA 3AB9A 2N1VA 2WYQA 4MH0E 3ZTDA 2DYMA 3P4SB 2Z6BA 2FUG1 4EOYA 2DX5B 2EZVA 5IYDG 3OSOA 2XTIA 4UPAA 5ELCA 5JOBA 4A3DG 1D7QA 2KDFB 4DWFA 2B63G 3AULA 3PZDA 1O78A 3EVQA 4DR1Q 2E8GA 1Q1BA 2R3ZA 2R6GA 3CC2A 4A93B 2L00B 4XC2A 3E3XA 3J80L 2L32A 1OTCA 3NXWA 3EIVA 4Q5VA 1ET6A 1HA6A 1IL2A 4BBNF 3OW7A 4X66Q 3Q8DA 2ZVNA 1RFKA 4MGKE 3K81C 3ZTCA 2EY2A 3QO2A 3OW2A 3AE3B 4C4VB 1QOHA 3ZJUA 2AUKA 4ZUJA 2RPQA 5AZHA 1ENAA 1FYCA 3ND9A 4P75A 2IYDB 2QMTA 1G91A 3FKYA 3OIPA 4JLCA 2KECA 1V8QA 3I4NH 1KH0A 1NTGA 1PFMA 4WWNA 2D0OA 2KNBA 3L10B 4F7XA 3ZNGC 2RCFA 4RKLA 2CFMA 3PO3G 4B3MQ 3HOXB 1JROA 4LMQD 1X3FA 2HIXA 3V96A 5M3MH 1U4MA 1EIGA 4GNXA 4DV4L 1LV9A 1X65A 3MJWA 1B9MA 1X3QA 1G8ZD 3ENEA 4LNNA 2O4XA 2GBJA 2MP2B 4A76A 1PHJA 4IQZA 3KLWA 4FBJB 3HOUG 2E2JB 3M95A 3NJTA 4HN7A 4DR6Q 4PS3A 1V86A 2DZJA 4GN4B 3I57A 1O7ZA 5JEAJ 1TWGB 2BH8A 3NELA 4LJPB 4H02A 1GJZA 2K01A 1QVCA 4ZLTF 2NS5A 3VRBB 4FN2A 3BVGA 1UE5A 1SE9A 5IA7A 2A6ED 4QQBX 5C3EG 5IYBG 1G6ZA 4B3SL 1ZKHA 4EX5A 1QVFA 5AZGA 1TIID 3P1MA 2O5JC 2MFIA 3BZCA 3ZYYX 2OOBB 4QCLA 1GB1A 5J17A 1EWIA 3RUIB 1SYEA 2QGQA 4X64L 5HURA 1BBUA 3RUZA 3J81c 4M00A 5M5YH 4MDKE 1E7UA 4QUFA 4AH6A 1JE5A 1SE3A 1YHAA 5E3FA 1FXIA 2ZM6Q 4HR7B 2IO1B 2YTXA 4OW0A 3ULPA 4ZRIA 1V97A 2HTME 2F3WA 3TMEA 2JRHA 5D14A 1DOIA 5IAAC 1HZAA 3S9WA 2FMCA 3T56B 1JRUA 5FLMH 1L5PA 3L0OA 3GQBA 4IOIE 3HS0C 1YJNA 3E9SA 2J0JA 1H9RA 4J6HA 1VQ5A 4LF6Q 4NPNA 2R93B 4W9GA 1OXTA 4WQOB 1BMLC 2MBBB 4APVA 1N63A 4FXKC 3RZDH 1VQHA 4YCVA 4B6WA 2LI5A 4LF4L 5G3LF 2V4DA 4DR6L 4PV1C 1F2RI 4OWTB 2WXLA 5D3IB 2F0UA 1UWXA 3MFYA 3SFEB 2KANA 1BVSA 3TUOA 1OO9B 1VQJA 4KZCA 4KKSA 1V80A 3ZW3A 1JT8A 5CV7A 4XYOA 4GN3B 1SIJA 5IP9G 4AS1A 4RFBA 2LJIA 1JB3A 1F9SA 3AEVA 3ZO5B 3QQ8B 4YY3L 4K0KL 1V1PB 4KV2A 4C3IG 5FLXE 5EAYA 4OEMB 5IYBH 3U58A 1GXDC 1XD3B 1VLBA 1B70B 2IWHA 2N0SB 5H92C 1DONA 1SBBB 3AEAB 3AH7A 2KBNA 1H8CA 5JPNC 2QA4A 1PH5A 5IN7A 4DUYQ 4EKUA 2BE5C 3S15B 2C5LC 1F0ZA 4XTCS 4X64Q 1OGWA 1OXXK 2G4SA 4DR5Q 4DR1L 4FF1A 4JI6Q 1HEZE 2MH7A 1MJCA 3R3MA 3D6CA 1PDQA 5KNBA 2IO2B 1F77A 4IURA 4HIDA 2L52A 4X66L 3HM3A 4KJOA 1O7YA 3VDZA 3EN2A 4HTHA 4OO1H 1JORA 3H15A 3A1QA 3QWNA 1WE6A 4G7ZC 4S0RA 4CKCA 3NUHB 4PMBA 2JYTA 3KW5B 4A3MG 4O0AA 3ERQA 4LF6L 1KNEA 1T3QA 1PMRA 1L6VA 3TBLD 3KDFA 4XWTA 1WVLA 2JZPA 5JJIA 2WXRA 3V62A 2EYHA 5J2RA 2OEOA 4ANXA 2FCQA 1CI3M 4NJ6A 2KCMA 1Q7YC 2NBWB 2R93G 4W9DA 5GROA 3A0JA 4JI8L 3HK0A 1PYWD 2JA6G 4BBRB 3X0WA 2UUBL 1GB4A 3QJYA 3WANA 1LTTD 1WRDB 3QK0A 3NEMA 2WFWA 5LMUL 4QUCA 2IGHA 3PGZA 2KX0A 4J1MA 4HWIB 3CQZB 4QGUA 1TY0A 2EMSA 4JI5Q 1FM0D 4PT5A 1DOKA 5J3BA 4CBVA 5C4XB 1GG3A 2GBKA 2NPTB 4TKNA 3T3OA 1PZID 2B63B 5M9OA 1S3SG 1K52A 5K36G 1VDVA 3P4QB 4FF2A 4DK0A 3AEEB 4W9FA 2K9XA 2EVBA 1A6XA 4ICUA 4BVUC 1T6BX 1PRTF 2K28A 4X3KA 2L4NA 5M3MG 5J39A 1YI2A 2UU9L 3LYYA 3ICEA 4ZHPA 3I4MB 3V2TA 1STBA 2UUCL 4OO1G 1GUNA 3BK1A 3RZFA 3GOEA 5C3XA 2KWDA 1UE1A 3KUPA 3JAML 2FCMA 2ZTEA 2ZTCA 3CPFA 2R61A 1FGUA 3V6EB 4YTMB 5ISRA 1VJKA 4LFBL 2BS4B 4G7OC 2V3NA 5M5WH 4YHHQ 3VHTC 3ZNHB 1DZ1A 2YVCA 4FJVB 1K83B 2DLBA 2R7ZG 3GZNB 4G3XB 4PK1A 1F1HA 2G3QB 3H8HA 2R2QA 4ODGA 4A3KG 2K8BA 2KQ4X 2O6VB 4GOCA 2WQYB 3QA8A 4MIUA 4FLHA 1IHZA 2A74C 1PFNA 2EYLA 1C4AA 1AW7A 3HOVH 4IDIA 2JSVX 5EE1A 1YITA 1FCCC 5ELFA 5I6WA 2GB1A 2OEDA 3A7LA 3D8GA 1SGHA 3U4EG 5M3FG 1L0XB 4RGTA 4A3MB 2KACA 1UAPA 3S14B 1JWBD 3MC8A 3SD5A 4JI5L 4P7IA 1WX8A 2C60A 3A4SC 3G6EA 1MFWA 2PW5A 1K3BC 4OVZA 2IDYA 3J7YW 1WTPA 1XNQL 4WAFA 2K50A 3GTOB 1QOGA 1QG7A 3C8YA 2H88B 1KDCA 2A6EC 2NBVB 4H44C 3HOZB 2NZHA 4AIMA 4LFAQ 2YU9B 1BDOA 1TQOA 4HJKA 2XWJB 1ENCA 4ZRQA 1HZ6A 1XPRA 2DNEA 2BBCA 1GHKA 4CDDC 5DNFA 2JYEA 4FP5D 4OWXB 4EZLA 2EMTA 3CKIB 5JJKA 2ZEQA 3I5JC 4KIKA 1DD2A 2B76B 1B4OA 1I50B 2F0MA 3SVMA 2MBEA 1CUKA 1EY8A 1GUTA 2N78A 4US9A 3QCAA 3PUXA 1GPXA 1BCPF 4W9JA 1EY7A 1UEBA 2M00A 4DFAA 1QLBB 3N6RA 1OQYA 4EE2A 5I4DA 4NB3A 3M4PA 3SK4A 3MHZA 1YX5B 3RULA 5IKCM 3PO2G 1Q8IA 4Y7NB 2F4VQ 3ZUNA 4X62Q 3RNBC 2A73B 1QZHA 2KN4A 2W54A 1YZ6A 3PIOA 1JMCA 2L12A 4M0WB 3B1LX 4CJ2C 1GO3E 1EQRA 4DNRB 1Y56A 4K5WA 2MNAA 2F4VL 4DA2A 2HD5B 3AU4A 4KK7A 4N58A 4BOSC 4P1CC 5C3WA 1VQGA 4GIVA 2AWNA 4JI8Q 3ALBA 2PNRC 4QAYA 1HFNA 5CBAE 4REZA 2JA8H 3X23A 3JAMi 5CV4A 5E4XA 2B2TC 2KD0A 2KCCA 1H4RA 4JI1Q 1PQSA 1L0YB 4MACA 2PI2A 1B50A 1PZJD 1I50H 1LTGD 2F0KA 3K5MA 3S2AA 4KTAA 1SYFA 2HTHA 1PTOB 3GV6A 4IWPA 2KYWA 1QUQB 3PUZA 3DWPA 1J5EQ 1ICFB 3HOZH 3G48A 1HUMA 1HXYD 3CSFA 1WCMH 1NE3A 4C1NI 2XN9C 3A1QB 2AHOB 3IVFA 2FCSA 4MSQB 5CHWA 3GTJB 1WFQA 3KYHC 3HOYG 2IY5B 2INCC 4CKEA 3HKZB 3DWGC 2PMVA 2K7VA 2Z1CA 2JJQA 2L1AA 1X3PA 4FULA 4RG1A 2EDGA 3DBLB 1HUNA 4OO1I 4LK0M 4LFCQ 2X6LA 2L3ZA 3V3XA 2HUGA 3UDGA 4PQXA 5BO4B 4DHZE 3E6ZX 5IP7H 2UXDL 4USAA 3TIXA 3WA0A 1U9RA 2BYVE 4OIKA 2B2UA 4A3IH 2WS3B 3AM9A 3PV0A 1GHJA 3JVZX 3I4MH 3LWUA 1EWHA 1W6JA 4A3JH 4CJ0B 3FRPB 3V6CB 1HH2P 3D0FA 3VR6A 1JWSD 1B3AA 4PMCA 4A3IB 5HFYA 3AE2B 4JWSC 2EYOA 1RYJA 3PO2B 3CCRA 2DWQA 1QCBD 1A3VA 4A3BB 2MWSB 5C4XH 4E6IA 2JT4B 2XVSA 5I9OA 4UP7A 2K32A 1MG8A 1ZOYB 1BUVT 3Q8BA 2O6VD 3V61A 2SAKA 3GV3A 4A3DB 1EF5A 1PRTC 3I8ZA 2L7RA 5BN4A 1V9JA 4BKTA 3BWUD 4P72A 2PZTA 2IX1A 1HRJA 3PS6A 2QDLA 3A74A 1SE2A 2K5DA 4IG7B 1AE2A 3GTMH 3PO0A 5EE0A 1NBWA 2N9KA 3G7LA 3T9LA 3DBLI 5LMNQ 3PO3B 4A3CH 1YNJC 3H3VC 2C7HA 2WB1E 2Z4IA 1PTOH 3P2BA 3N52A 1PV4A 3APFA 4B3TL 3VAWA 1N6ZA 3NS8A 5EPJA 1Q1EA 1V2YA 3UQBA 3ZRCA 4LUOA 3RN2A 5LMNL 4A3LG 2KC1A 1WF9A 2WHIA 1E1TA 2JE6I 3AU5A 3PUWA 3Q8CA 1E22A 2INNE 4EVOA 1EL0A 3Q22A 1KDBA 3CW2C 3CP0A 4F87A 2RDFA 2F0FA 3K0YA 4PZ8A 2ZJQA 4NQKE 4HVBA 3SXHA 1A70A 4H2AA 2AUJD 1EIYB 2K4KA 1M1KC 2L1BA 3UGBB 3VTVA 1DCZA 4Y7NH 3U9OA 5H1SE 3RD4A 1NVID 1RFAA 4DXAB 2R7ZH 2J0KA 1AH9A 4CQNA 1TGZB 3MHSD 2N9EB 2Z0SA 2HDMA 4JI4Q 3FKIG 3MXPA 1C48A 5IGGA 2G1EA 1IKMA 3PCOB 4QF4A 4LF5Q 1JW9D 2WB1G 2LEKA 2CCZA 1W3SA 1WIAA 2JF5A 3RD2A 2Q5WD 3WAOA 2MO1A 3KF6B 1LTSD 4GKKL 1DOLA 1UE7A 2CWPA 1WYDA 4KY6A 5ELOA 1WR1A 2WXQA 1OXSC 4ANUA 4G7HC 1ICWA 1V1QA 3L7ZC 3NPPA 5CR3A 3RMHA 2NVYB 1GUOA 1SEBD 4JV5Q 3Q3JA 1GD7A 3C1EA 3N3KB 3AE7B 2J7ZA 5IGFA 1XCTL 3Q14C 4MN3A 4DKAC 3NZUA 3PLUA 4IM2A 2Q8TA 1EO6A 3JYUA 2CHBD 2WDVB 2EY1A 1VMCA 4HDQA 4DV5L 2B2UC 3G4SA 2KMMA 4K2LA 2B2WC 1GUWA 3DVNV 3MAQA 4XDDA 3U9SA 2Q8IB 4IFDI 3VQIA 2KMCA 1SNCA 1V9PA 1YHQA 1IP9A 3IFWB 4LAAA 3PSEB 1GUGA 4LFCL 2HHHQ 4PZ6A 4R1JA 1YQ4B 4HEA1 4JC0A 1ZE3D 3OWEB 4X3UA 1RAXA 3W9CB 1F9PA 2YEPF 4JX1C 1TT2A 2E5LQ 3AMUA 2MGSA 3CF6E 5EGTA 4GNXB 2LXCA 4DNIA 2VQFQ 1STGA 4EQPA 4ABNA 3FC4A 3DQVA 2KHIA 2GN5A 4K6DA 4NNJB 3Q23A 1HTOA 2GLSA 1D5MC 2YYZA 2AL3A 4NAWA 3DWQA 4Q0FA 1UWVA 4A3GB 4DR5L 3M9BA 5ELDA 2XSCA 1G2TA 2B2VA 4RF1A 1MI0A 4IUTA 1WTQA 1JRPA 1QKZA 1T0RC 4DV3Q 1G2SA 1R4MB 5M5WB 3ECIA 5FO8B 4GKKQ 5M5YB 2LUEA 4GB9A 3NVVA 1LACA 4L63B 5CGKA 3B9JA 2JVCA 1MSHA 4MT5A 1UBIA 1B9RA 4LUVA 2WXGA 1PGXA 4JPSA 1GNUA 4DDGD 4ZRZA 4TVAB 1Y1WG 3PF5A 2GRIA 5AEKB 1EUVB 4XQJA 4G11A 2JWZA 1IZ6A 3IAS1 3N32A 1YN5A 4DV5Q 5DM73 1IBKQ 4UP9A 1RODA 3F2BA 4KKIA 1C0AA 2V0GA 1F9JA 2I1KA 4C00A 3ONAB 1YJIA 1PH6A 5EPLA 3HUIA 1BCPB 4EQNA 3U52E 1EOTA 2H1EA 3VR5A 3K57A 3R66C 1BT0A 2JXXA 4LF9Q 3H7PB 2ZW1A 4K2KA 5HI1A 2LY7A 1IBKL 1CSQA 1CTMA 2UUBQ 2MA9B 4YSXB 3VTWA 1WD0A 1CA5A 4HMJA 4B3ML 2HDLA 3TSSA 1W6KA 3MXNB 1TBEA 4H0LC 3EQLC 1QOFA 5AFWA 1B3QA 1JJCB 1GM5A 3JAMc 4H7BA 2LMCA 3R93A 4K3BA 2JZZA 4K5XA 3BZDB 4X6AH 2LJ5A 3IAYA 1MSGA 3A8KE 1BO0A 5FK9C 3HOYB 4JYAL 1T0SC 3V05A 4R9WA 3RLFA 2WXMA 2K5PA 1U4AA 4P1BC 1IL8A 5G5GA 1NSNS 3R8BA 4ZKBB 1ZEQX 5GAHC 1HPCA 4J8QA 1VQLA 2ZXRA 2NWGA 3URYA 2VNUD 1IYVA 1ONLA 2I1JA 3K5NA 2KTFA 3VFKA 1S72A 3I4NB 1CKOA 1H95A 4OZAA 1NNXA 5M5XB 4HJ9A 1YJJA 5ELEA 4Z9CB 1ZXHA 2K6DB 3DWMA 2PW7A 4C3JB 3E56A 3VR9B 1TWFH 4JI6L 1WXVA 2HJ1A 2K33A 4BBNC 2R7FA 1YEZA 3WWVA 3AE6B 3IT4B 1FD7D 3Q2AC 1NAPA 3DEOA 3HKSA 2AWTA 4GNXC 4B3RQ 2JA6H 3S24A 2EE1A 2OJRA 3F2CA 3TL5A 2NVTH 1P3QU 4HROA 2CH4W 2ZM6L 1TKYA 2WXNA 1XNRL 4BY7H 1ACCA 4G4KA 3SEBA 4DR3L 4A3FH 2M0XA 3DVNU 3M3JA 2D2CC 1J7CA 2F0NA 2CKZB 2KFKA 1FO4A 2WAQG 4NPSA 5FOBB 3S17B 4R4QA 2EPBA 2YEPB 5CHFA 2DUDA 4DHJD 4C1NK 4HKQA 5L83A 2D5DA 2F0OA 2NVTB 3M85A 1VQ7A 3A9KA 3MXGA 2KHJA 1X55A 1PFSA 3T13A 4LF4Q 1F52A 1WGYA 1CZPA 3VR8B 1ZPSA 3S1NH 1EYGA 1P9DU 4JQWC 1Y1VH 1J6QA 1I6VC 2VQFL 1E0ZA 1F2LA 2EY5A 3ZRFA 2R7ZB 5IOIA 1IW7D 4A3FB 2CW0D 5LLIA 3VXWA 1LABA 4FYDA 2BDNA 3DM1A 4YWLA 4PNYA 1CJEA 2ACZB 2RKSA 1B1ZA 3HGBA 4RHRA 4JI2Q 2Y3AA 4WJQA 2MLBA 1LLRD 3QARA 4LLGM 1ML0D 3U2SC 4DUYL 2D3GA 2NPTA 2OTLA 3PZ8A 4I6PA 4DV3L 1EF1A 3GZNI 1X54A 3KWVA 2R92G 1JICA 4RGOS 1S40A 1CA6A 3PZ7A 3P4PB 2RVLA 3BU2A 3ER0A 3QIJA 1YD8U 3HRDD 3MWYW 2NVQB 1YJ1A 1L1OB 1XT9B 5A35A 4K7WA 1JE4A 2XWBB 5FLXc 1ILPA 1NI2A 1EY6A 2C9OA 5J1ZA 1C9OA 1II3A 2F52A 4ILWA 1DOYA 2WINB 1IYUA 1KAWA 1K8OA 4LFBQ 4FF3A 2VW9A 2AX5A 1JR0D 3DCGA 2IHFA 2Q2UA 1ZXTA 3EFCA 3NQIA 3TJPA 4US8A 1N32Q 2UYZB 2SOBA 2MRPA 2VUMB 1LQBA 4II3B 2RPVA 2F0IA 1G6PA 1WFYA 1XLQA 3APCA 4X57B 2L15A 2VUMH 2EJGC 5E7NA 3BK2A 4MM3A 4BZAA 2NN6G 5I6YA 1KQSA 4AYBG 2DNCA 4X65Q 1E8XA 3VR3A 2K1BA 4GLXA 3QHTA 4KKTA 5C5MA 4C3IB 3ZDTA 3E0JA 1RIPA 3A54A 3MTNB 2MO0A 4LJZC 2KQSA 4NAWB 2KLGA 4GDKA 4IALA 3GTLH 1VD2A 3CWIA 4J3OD 1KTKA 1FRDA 2KX3A 4QY7A 4JL9A 1JQ4A 4EQ5A 1QVGA 5GAGC 2LS01 2EJFC 4A3BH 5C4XG 3NBHA 1EWCA 1P98A 1D5ZC 4A3GG 3N1ZC 1P0RA 3TEYA 5JEAH 2BGFA 2L0CA 3NWSA 4IO9A 3NZ3A 4KY5A 2K8HA 1HJPA 1N9WA 5C4HA 4JBWA 3AN1A 3IFTA 4A3EG 4KJNA 4R3DA 3PSIA 4CDCC 4ICVA 4RM8A 1SNOA 4YCWA 2PZWA 4I7ZC 1FPYA 1U0LA 1B44D 1YX6B 3P75A 2PQAB 5G55A 1HQRD 2NTSA 1SRUA 3MHBA 1E10A 2JN4A 2WWZA 3BYYB 4DV0Q 4AJYB 1LT5D 1WTXA 2F0GA 2UUCQ 3S1NB 3KF6A 5FJ8H 1VQEA 3H94A 1EZ6A 1N8RC 2FMMA 4M0WA 3FVQA 3W1BA 5JVG3 1K8RB 4XIGS 2N7DA 3K7AB 5L95C 3CCUA 5CV5A 1B2TA 4F1SA 4KY7A 4DV0L 3G71A 2M8SA 4A3JG 2G45B 4MGIE 4UHVA 1O7LA 2JRIB 1Q12A 2SEBD 1I42A 3GTKH 4KMUC 1KRHA 2ASBA 3PPAA 4XWWA 5J22A 4POFA 4KSLC 2IPKD 1CT1D 3BZKA 4ZRKA 4KGSA 1FNUA 3D4DA 1IYJB 3W3AA 1TIFA 3R7RA 4NJCA 3VUYA 1RKNA 2Y5PA 3UIOB 3DBRB 1RRBA 1N34Q 1YQ3B 2IJ0A 1SMYC 4N9TA 4FJZA 3H6NA 2A5HA 5CMDA 1PXUA 2LGSA 3SK8A 2EQSA 4KIKB 2N55A 1RD9D 3QR8A 4XT1B 5C3EB 4HPPA 4I6LB 2EXDA 5JEAG 1N5XA 5JZEB 1KAAA 4A9AA 1JWUD 3BY4B 4FNFA 2D2QA 1XMQL 1UF0A 3SGIA 2N8NA 2JEAI 1YN3A 2GOWA 2N3SA 5AZFA 3DUZA 5GADC 1VQBA 3MEHA 4DGZA 5CV6A 5CV9A 1EFID 2F3IA 2K6AA 3CCMA 2PYKA 4A3KH 1XLPA 3E9IA 2D5GA 2WDTB 2ZPNA 4BKSD 4XQNA 1R4NB 2BPSA 3IAM1 1J9OA 2A8VA 1ZUD2 3A9JB 3CD6A 1PYSB 3AECB 1P1AA 5C6AA 3I91A 2LHEA 3AXCA 4YT0B 2LD9A 2NVXB 5CORA 4TQ0A 1OXVA 2BTEA 3TP8A 3TZDA 2DBYA 3MFGA 1JJGA 1FXAA 2IHEA 4HMIA 2EELA 3DBHI 2ICEC 2XRSD 2PNHA 5IP7G 1ZP0B 3SR6A 4KDIC 1WMHB 3PVLA 5JHBA 1I5FA 3M3YB 3KUCB 3RNAC 4JIOU 2PCFB 1VQ8A 1KNAA 4NP5A 2ICIA 2ZJDA 3CMMB 4W9CA 1MHXA 2Y0SB 3B08A 2R7DA 2WXPA 4RWSC 5IY0A 2QKIC 4FA6A 1A0IA 1PGAA 4IZ8A 4B0EA 1S5FD 3K0XA 2K04A 1WXSA 2K52A 3QC8B 2F0LA 5GMVA 5HHDG 3KYCD 4IWQA 1FCLA 3BS1A 3HEJA 1RF2D 1MJEA 3OAWA 1WTRA 2B8GA 3AU7A 2VZKD 1I4XA 2PTLA 2PQAA 3ZNID 1LTID 2LMCB 1C4QA 3KBXA 1FVIA 4JK1C 3I55A 2L5TA 3SHLA 3WIMA 3S2HB 2KJRA 1LT3D 1WYGA 1XJVA 4OHJA 1OXUA 3DWAA 3S2DB 1E5WA 1CFMA 2LZ6A 2E74C 1ILQA 5DPWA 4GN1A 1HHVA 1SNDA 2WB1B 3LGJA 3Q3MC 4HXDA 4K81A 2J53A 4WJNA 3RZWC 1QB5D 2D11A 3AYHB 1XO3A 3OJ3A 3NRZA 4DUZQ 3STBC 1EQTA 4IWOA 3OOCA 2INDC 3IHPC 1SNMA 4PS7A 3DM3A 4DXGA 1V1OA 2A1AA 1Q3LA 5ELNA 3O65B 1A63A 1PH8A 2VZKB 2WXKA 1MBYA 1N5WA 3J9CA 2F0HA 4V0BA 1BCPC 1EIHA 2WX1A 2Z59B 1NMGA 2KWUB 3KUZA 2A5UA 3PO2H 3KBGA 2WDQB 2ZNVC 4C2MH 4DXFA 5BMIA 1VQIA 5C4JB 5BMGA 1D8LA 4U673 2AL6A 4MSMB 3T8MA 3U8ZA 3H09A 2Y0SG 2W9NA 4LNKA 3NVYA 1X3GA 4A3EH 1VQKA 2LGXA 2QIEB 1O7IA 1IPGA 4M8MA 3UDIA 1UGMA 3Q8EA 5BMHA 4S3SA 5C44B 2DAFA 3L17A 3EA6A 1BBWA 2KT7A 1HTPA 2X69A 2A4ZA 1WTWA 1UE6A 2A69D 4ZHOA 2K14A 3F1ZA 1XMOQ 3IT6B 4KGRA 3U30A 3OPOA 3TDQA 4JI4L 1D3ZA 2KENA 2KQ3A 3DOWA 1BR9A 3NHEB 2F1MA 1K28A 3OYYA 4LF7L 1I6HH 4ZOHC 1I4RA 1JJ2A 4KKUA 5G5HA 1MPEA 3NVWA 1XMOL 2PLPA 1E3PA 1STNA 4DV2Q 1KDAA 3GE8C 3BJUA 1T5XD 4KHZA 4HIOA 2Y5CA 2BKFA 2ZW0A 1RWSA 2XK5A 1P7FA 3VR4A 4C3JH 4R4OA 1QF6A 3L2PA 4OZCA 1FNWA 2QILA 4F88A 4DNTB 5EE9A 1CHQD 1QZEA 1L2FA 5KYLA 1WJNA 2Z0EB 4JI7Q 1JCKB 4L5RC 1WM3A 4WWPA 3P20A 1KHIA 3HZXA 1PH9A 3UF8A 3ULJA 4TSSA 1LXDA 3N30A 2L05A 3FEWX 2G5DA 4AOFA 3K5LA 4DAVA 3M4OB 4MGZE 1N33L 4DF7A 1GJXA 1I4HA 2CU3A 2HHHL 4LDTB 4DAPA 3W1GA 2J0MA 3NQTA 1PH2A 1Q1OA 2XK5B 4JE3B 4OWWB 1FEHA 2B2YC 2RDHA 4A4IA 5IE8A 4KD4A 1HZBA 3CHBD 1FD6A 3IG3A 2JWUA 5C0XJ 4AYBB 1ZYRC 1L0WA 4GOPA 2GMIC 1SMYD 4HRSA 1EEFD 3S16H 5C4ZA 4KSKC 3ZXVA 1R9TH 2KDBA 2NBFA 2MW5A 2WP9B 4N59A 3DHQA 4PG3A 1GVPA 2O6VA 1PLFA 3VR2A 4G0NB 4A3EB 1EYAA 3D32A 3VUXA 1C76A 4P2CB 2DZIA 1NUCA 2FXQA 2LVQA 3H0GG 5HGTA 1H9MA 2K8CA 1AZQA 4X3SA 4M8NA 3A55A 1IBMQ 4C2MB 2B8FA 4TMAB 3EJIA 3LJ3A 2MEKA 3N1YC 3RZDB 1E90A 1E8WA 1RM6C 1SFOH 3GTQH 2PE9A 2YU9H
chains in the Genus database with same CATH topology
3T53B 3TBIB 1Z6HA 1KF6B 1XEEA 2B2WA 3AV8A 1KLGD 1ZXIA 3HVZA 4KHVA 1CZWA 1U4PA 2GA4B 1OFFA 2G9HD 1KFYB 4WQMA 1WGKA 1D4BA 2NTTA 1L6UA 1D6EC 4CKBA 1SE4A 3PIP3 1KABA 4A90A 1LTAD 3A8JE 1PFDA 4ME5A 1EZ8A 1DOMA 2ZXOA 4X3TA 2KOLA 1IKLA 2MJ3A 1AEXA 4JWUC 1FR3A 5EQ0A 1SB3C 5DAUA 1AFPA 1C4PA 4WIPA 2QDBA 3HRZC 2DYOA 4ARIA 4DK1A 5FO9B 2F0SA 3GTGB 5GXGB 1PTOF 3GS2A 4TRDA 4IUUA 1P7EA 5BN5A 3PUVA 2RMMA 4YSZB 2WXIA 4R8IA 3TN2A 2K5WA 2XNAC 3B2FA 3LXFA 3VYTA 5BN3A 3D31A 3TP6A 2RA4A 4IFDG 1EYCA 3CRKC 5DM63 1I7HA 3DXJC 2HCCA 3NHHA 3BIID 4LK1C 2A6HC 1HA5A 5BYRA 1SYGA 2F0VA 1PFBA 2HQEA 3P63A 5EBDA 4A3KB 1CK1A 4YSYB 2PO4A 4IFDH 2EJMA 2J42A 3HP3A 3W5UB 2F0JA 3I90A 2AQ1B 5E1FA 5IGEA 2LGIA 2LKVA 3ABVB 4L1BA 1SJHD 2NN6H 3NE5B 2PVOD 4KGTA 2Q8RE 1NEKB 4C3HB 3W1SA 1RHPA 1TKWB 1BQQT 4KN4C 5C0XH 1OQRA 4L23A 1YNTE 1E9MA 3MC0B 3I9V1 3GTKB 2X38A 1U4LA 4WWMA 3FAHA 5KGUA 2AQ3B 3G6JB 5T1GA 5KRUA 1C79A 4KI0A 3MVVA 3VRAB 2IL8A 1E2VA 2KEEA 1LTRD 3OHXC 3KWLA 1F2RC 4FXDA 3R2IA 3TEZA 2F0TA 2FHTA 3LB8C 1CHPD 4GDKB 2ONQA 4C7ZA 2N9LA 1AZPA 4L2YA 2B2YA 4XDCA 2KEDA 4XDXA 2BA1A 4A6QA 4XE0A 1CM9A 3BVZA 3FMCA 1B9NA 1TS3A 3AE4B 1DM0B 1WTVA 2PVGC 3QOLA 3F2UA 3U7ZA 3D4RA 3NSWA 1STYA 3CRLC 1WCMB 1R9TB 1HTLD 4K8IA 1QNKA 2WKDA 3I4LA 4WORA 3B2GA 1LTBD 4RNAA 1GUSA 3RZOB 1A3UA 1PGBA 5I2XA 4MHEA 3MTSA 1NI3A 4RA8A 4ZK9B 3UI2A 3D3RA 2JA8B 2AWOA 1SNPA 2K22A 2R92B 3VA7A 1TZOA 5EBCA 5F2DA 2DY7A 1ZDVA 2MP1A 4OL7A 3D6WA 3PIO3 1Y8NB 1ESFA 4IUVA 1MHHE 1H9KA 1HCZA 1GOZA 5K5PA 2FBWB 4HAEA 5M3MB 2JEBI 5G3LD 2I46A 3NTKA 2BCOA 4QMGA 4RCOA 2BOSA 3GB1A 3E5SA 1K50A 2MHVA 4N6EB 1PUTA 3QG1A 1UUPA 1E0BA 1KLUD 2F3VA 4RCNA 2A69C 5D65A 1N61A 2FINB 3M4YA 4WURA 4BY7B 1AYFA 3N9YC 2JA5B 4KV6A 5CV8A 1EWYC 3T3NA 1SYBA 2MJDA 4UDUC 5NUCA 2EYMA 5C2TB 3R2TA 5JPMC 2WLBA 5T1IA 1TYGB 5E6JA 1FNVA 2TMPA 1EU4A 1SYDA 3WOEA 4OIJA 1TWFB 1HFGA 1IGDA 3EFXD 1TU2B 2E6XA 5CC4A 1Y1WB 3T4AC 1GAQB 1X32A 3UI3A 1T5EA 1BF4A 3T16A 2ID0A 1EY9A 2E2DC 5LNK1 4ZYSA 4ZQ3A 1A15A 3RPFC 1STHA 2SNMA 5DEHA 3TP7A 2HDEA 4YTPB 2Z4HA 1EY0A 1VZ8A 1QNUA 2M0AA 2MJ8A 3EUB2 3ZJTA 5FO7B 1E6EB 1FGBD 1JOKA 5T8IA 3NBIA 3LNNA 2OT2A 3D4WA 2CJOA 1MVKA 1K8MA 2IT1A 2L83A 4K14A 3I72A 4Q2JA 2J4XA 1G291 1C9FA 4XQQA 4F8MA 5EKLA 2PMZB 1JOQA 2LFIA 1EEID 3QOJA 3J7AV 2TSSA 3LX0A 1N62A 1TS5A 5IGCA 4HJGE 1CQFA 5LL6X 1S5ED 2M2LA 3EROA 1PTOC 3TZUA 1XCQL 1D1KA 1RTOA 2CQAA 3S1QB 1VF7A 2BS2B 2EOTA 2B2TA 4H13C 2VB2X 3AE1B 3IFDA 4RH6A 3P7JA 2RSNA 3CIRB 3HOUB 1WWTA 1VCIA 4M1UB 5LL6S 2EYJA 5IT9L 1ZDXA 1K53A 1E2ZA 3X3MA 1VMPA 4BA2I 4RGNA 1UWMA 5IGBA 1Y8PB 2WIIB 1SXTA 2WKCA 2QJLA 2VXWA 1XLOA 2INPE 1ZKOA 2KUMA 4TQUS 1NCVA 5IT9E 1YNNC 2NB0A 1DGJA 2A68C 1TY2A 2QSDA 2OHFA 4B0MA 4YTNB 1BOSA 2BT6A 1Q10A 2WU5B 3KF8A 1XYIA 2BYTA 1R4PB 2A6HD 4P16A 1M4VA 1H9SB 3C1FA 5BYSA 4TQ1A 1TWHB 3ND8A 2EYFA 1BXTA 2EXZA 3AEBB 2BDOA 4ID6A 4V190 2K3UA 3BG3A 1SF0A 3R3OA 3C3LA 3ZJVA 1WRIA 1PRTD 4KX6B 5AUKA 3NS1A 3W2DA 2W3SA 1WSPA 1E2WA 2F0PA 4IUQA 2IX3A 3NTHA 2NZ1D 1FFVA 1YNJD 2AQ2B 3K5OA 4NMZA 2JXMB 5MPOA 2E2HB 4CGYB 3BDLA 3JAME 1UGJA 2WP8J 4BS9A 1SAPA 1Z7TA 1S5BD 5EJWA 1HZ5A 1NYRA 5E4WC 3HOWB 1NENB 1SDFA 4DQOC 1J7BA 2RSOA 4RGMA 3MXUA 2PIAA 3AMZA 2K5QA 5IGDA 4FXCA 3FKIB 4U68A 2ENBA 1L4DB 1J7AA 2K0PA 2N88A 4ZKCB 1Q90A 3QB3A 2WXHA 2J0TD 3M7NA 2PPBC 3VYRA 3A56A 1FRRA 4XYQA 5TSSA 1SNQA 1HQMC 1I4GA 2O5IC 2ON8A 3P4RB 3OIQA 4FVMA 2B2VC 2OXPA 2SDFA 3L3OC 4NDXA 1TS4A 2G9DA 1VDZA 2BS3B 1SFOB 3GTQB 3A7AB 1O80A 4WRDA 2D62A 5FR3A 2D9UA 4C80A 4R8NA 2ZXPA 3K58A 2GI9A 2V4IB 1DJRD 2E75C 4ARCA 3NVZA 2PZUA 4KN7C 3BDOA 5C3JB 2F0QA 3OMGA 4N9PA 1V8CA 3J81L 3Q8AA 5FLXL 4PMWA 3DMUA 3CU7A 2DY8A 1BBXC 2ZT9C 3Q6SA 4BWGB 1L4ZB 4ZAIA 3HG9A 3S1MB 2L9HA 4CJ1B 3OWFA 1S5CD 5D3DA 2Z8LA 5EPKA 2WDRB 1EQVA 3MZ5A 4GLSC 1I4PA 3HVDA 3H91A 1Y69U 4ZUIA 4TKOB 3AEDB 2KAJA 2JSOA 1SSNA 1XLNA 4B08A 2EKIA 2WXJA 4HEDA 1FIQA 2FFKB 3J7AF 4QIWB 2EYPA 5BYQA 4GZYC 3AE9B 1E7PB 5JVH3 2A68D 1BCPD 3VA5A 3ZGZA 4IFDJ 1D1IA 5M3FB 2M9VA 2F0DA 5LHY1 1JOOA 3WDNA 1PRTB 2CVRA 4XXEA 5HG2A 1MGSA 1F2YA 5EKIA 4C56C 1F9RA 1FMAD 5FKAC 2I07B 3AEGB 3GTMB 1TVXA 5A2QE 4K6LA 3M7GA 4A3JB 1SYCA 1Y8OB 3A8IE 3I73A 3W5VB 2FE8A 3S1RB 5I2YA 2XRQD 5H8YE 1ROEA 4L6TB 1STAA 4HSVA 1F9QA 2JXTA 1DOXA 3L9AX 4ZRPA 1VZ7A 2JYOA 2BB5A 1CQVA 1U4RA 4RKBA 4C7YA 4OZBA 3T51B 4MM3B 1OQQA 2O2LD 1TWAB 5CBEE 4KKJA 3VYSA 3NUCA 4I65A 1PDXA 2KCNA 3KLSA 3AEFB 4LTUA 1DYQA 2HCIA 3BYTB 4D2KA 3EGRA 2JP1A 1JQYD 3J80E 4DU9A 3P1HA 3SK5A 2VB3X 1S5DD 1UNSA 4BBSB 4G57A 2OF1A 3ITPA 2M19A 1QWYA 1S4ZA 4M8AA 3NWTA 4FO2A 2SNSA 4BA1I 3S16B 1TJEA 1A3TA 2CW0C 2MPMA 1IUEA 3BDCA 3OMCA 2IW3A 3H0GB 2IGDA 2NN6I 3MA2B 3GO5A 2W3RA 1RCVD 1VR9A 5EE3A 1PTOD 3AB5A 4HCEA 1LT6D 3SE0A 1V1PA 1JC7A 2E2IB 5AUIA 4NKLA 4UAIA 3FPPA 2DN8A 4WFN3 4KD3A 3KLSX 2E3TA 4O1NA 3K59A 1Z47A 4XT3B 1I3QB 3GTPB 3I57A 2WACA 1MD2D 5JJZA 2I38A 4RF0A 1R7SA 2L11A 5IODA 3VYUA 1YN4A 2B39A 5JAVA 3J81E 2RDGA 1C4CA 1YNND 2JX5A 4B9XA 3FILA 1IBXA 1M8AA 3I3CA 2KDMA 4NZLB 5KYIA 5C0XG 1SSOA 1NYQA 1ENFA 1C77A 4YWGG 3KK7A 5IIFA 1QOAA 2X6GA 1XTCD 2NUCA 4O42A 5C0XI 2L55A 1TS2A 4A8XC 3MJ5A 3FILB 4DN4M 2N7JA 1V43A 1TKGA 4C3JG 1ESRA 5EKKA 3L4PA 2F4IA 1XWEA 2BW2A 3MXNA 1J8IA 1QQRA 5A2QL 1MI2A 1F2MA 3KQ4A 1AN8A 4B9WA 4A55A 4IN3A 5JXVA 3SFDB 5IOCA 3TP5A 1EYDA 3NK9A 3X3NA 4IUNA 3GP7A 2H4OA 3GTLB 2EY6A 5KIXA 5COYA 4FXGC 5KNDA 4MH8A 2K05A 3Q69A 4C3HG 1XF5L 1R4QB 2LFNA 2PQEA 3Q24A 4WH4A 1YMHE 1A2TA 3RFZB 5KNCA 2PKOA 2NMQA 3FPUB 3IKJA 2H89B 3FDTA 2LUMA 2NYZD 1NR2A 5CYUA 2IX0A 3BVMA 5K36H 3SR1A 5C5LA 2F03A 4FF4A 3LWEA 1PZKD 3AE5B 4HCSA 2JA7B 1TR5A 1RDPD 2MJEA 3NP8A 2M56B 2W55A 3I70A 1QT9A 3Q8FA 1EU3A 1L0VB 2WXFA 4L8JA 4IKGA 2CJNA 1I6HB 3P42A 3H6MA 1A2UA 2J52A 4BY1B 2K03A 1AP0A 1TWCB 1XX8A 1UEAB 2WU2B 2QF7A 3WOFA 4CHTB 2PW9A 4IUPA 1FFUA 1JWAD 3HOVB 2JQRB 2WXOA 4RAUC 1LO5D 1VF5C 1H9SA 1VZ6A 1F2ZA 1STEA 3IL8A 1AWDA 2F0WA 3QIAA 3PMFA 4ITKA 1WTOA 1JWMD 5I9PA 4K5VA 1QOBA 2MUYA 3TEXA 2QEJC 3Q0AA 1BUIC 2WV6D 3NTIA 4NW2A 1XXGA 3DEPA 1C8CA 3O13A 5D7GA 1DXMA 2V3PA 1IBXB 2IGGA 4RHSA 2BA0A 4AQ7A 1RJTA 1I4QA 1IGCA 2QCPX 5KEEA 2F0EA 3ZQ4A 1ET9A 3PUYA 4EQOA 2KA7A 2I2YA 1BNZA 1D2BA 4NAMA 3WCQA 4HKZE 3AE8B 4EGVA 2W82A 1IW7C 4ULLA 1LT4D 4K8JA 1VRAB 1JMLA 1B53A 2RBMA 1WD1A 1EM7A 3MP9A 3IXSA 2KHSA 2WNMA 2WAQB 1C78A 2JU6X 1SJED 1QILA 1K51A 2BE5D 2E76C 2C5CA 2RQXA 1TKEA 4GDLB 2FJ2A 3K6OA 1WXQA 3SDZA 1H9JA 1N60A 4QB4A 5ELBA 2BB6A 1QJOA 2LHDA 3C46A 4YXDB 1ZYRD 1EY4A 1NR4A 4YIJA 1QE6A 3KLRA 4WJWA 4HSPA 1Y1VB 4DAYA 1JALA 2KVMA 3GD7A 3ETRA 3SK6A 1D5XC 3C2PA 4OGQC 2XIWA 3TEWA 2JA6B 1EY5A 4P6VF 1CZGA 2KJXA 1RTNA 3AB9A 2DYMA 3P4SB 2FUG1 2EZVA 3OSOA 5JOBA 5ELCA 1O78A 3EVQA 1Q1BA 2R3ZA 2R6GA 4A93B 3J80L 2L32A 3NXWA 4Q5VA 1ET6A 1HA6A 3OW7A 1RFKA 2EY2A 3QO2A 3AE3B 1QOHA 3ZJUA 2AUKA 4ZUJA 1ENAA 1FYCA 3ND9A 2QMTA 1G91A 3OIPA 2KECA 1V8QA 1KH0A 1PFMA 4F7XA 4RKLA 1JROA 3HOXB 4LMQD 3V96A 1U4MA 1EIGA 1LV9A 1B9MA 1X3QA 1G8ZD 2O4XA 4IQZA 2E2JB 4HN7A 1O7ZA 5JEAJ 1TWGB 2K01A 4ZLTF 3VRBB 3BVGA 2A6ED 1G6ZA 1TIID 3P1MA 2O5JC 3ZYYX 4QCLA 1GB1A 1SYEA 5HURA 3RUZA 4QUFA 1SE3A 5E3FA 1FXIA 4HR7B 4OW0A 1V97A 2HTME 2F3WA 3TMEA 5D14A 1DOIA 3S9WA 2FMCA 3T56B 1L5PA 4IOIE 3GQBA 3HS0C 3E9SA 1H9RA 4J6HA 2R93B 1OXTA 1BMLC 1N63A 4FXKC 5G3LF 2V4DA 4PV1C 1F2RI 2WXLA 5D3IB 2F0UA 1UWXA 3MFYA 3SFEB 3TUOA 1OO9B 4KKSA 5CV7A 4XYOA 1SIJA 4AS1A 4RFBA 2LJIA 1JB3A 1F9SA 1V1PB 4C3IG 5FLXE 2N0SB 1VLBA 1GXDC 5H92C 2IWHA 1DONA 1SBBB 3AEAB 3AH7A 5JPNC 2BE5C 3S15B 1F0ZA 4XTCS 1OXXK 2MH7A 4FF1A 1HEZE 3D6CA 1PDQA 5KNBA 1F77A 4IURA 2L52A 4KJOA 1O7YA 4HTHA 4OO1H 1JORA 3QWNA 4G7ZC 4CKCA 3NUHB 4PMBA 2JYTA 3ERQA 1KNEA 1T3QA 1PMRA 1L6VA 4XWTA 1WVLA 2JZPA 2WXRA 2EYHA 2OEOA 1CI3M 1PYWD 4BBRB 1GB4A 3QJYA 1LTTD 4QUCA 2IGHA 4J1MA 3CQZB 1TY0A 1FM0D 4PT5A 1DOKA 4CBVA 5C4XB 3T3OA 1PZID 2B63B 5M9OA 1K52A 5K36G 1VDVA 3P4QB 4FF2A 4DK0A 3AEEB 2K9XA 2EVBA 1A6XA 1T6BX 1PRTF 2K28A 4X3KA 2L4NA 5J39A 3LYYA 4ZHPA 3I4MB 3V2TA 1STBA 4OO1G 1GUNA 3BK1A 5C3XA 2KWDA 3KUPA 3JAML 2R61A 4YTMB 5ISRA 1VJKA 2BS4B 4G7OC 2V3NA 1DZ1A 1K83B 2DLBA 3H8HA 4ODGA 2KQ4X 2WQYB 4MIUA 1IHZA 2A74C 1PFNA 2EYLA 1C4AA 1AW7A 4IDIA 5EE1A 2JSVX 1FCCC 2OEDA 5ELFA 5I6WA 2GB1A 3A7LA 3D8GA 3U4EG 1L0XB 4RGTA 4A3MB 2KACA 1UAPA 3S14B 1JWBD 2PW5A 4OVZA 2IDYA 3J7YW 1WTPA 4WAFA 3GTOB 1QOGA 3C8YA 1QG7A 2H88B 1KDCA 2A6EC 4H44C 3HOZB 2YU9B 1BDOA 1TQOA 2XWJB 1ENCA 4ZRQA 1HZ6A 2DNEA 2BBCA 1GHKA 5DNFA 2JYEA 4FP5D 3CKIB 1DD2A 2B76B 1B4OA 1I50B 2F0MA 3SVMA 1EY8A 1GUTA 4US9A 3PUXA 1GPXA 1BCPF 1EY7A 2M00A 4DFAA 1QLBB 3N6RA 4EE2A 5I4DA 3SK4A 3MHZA 1Q8IA 4Y7NB 2A73B 2KN4A 2W54A 2L12A 4CJ2C 4DNRB 1Y56A 4K5WA 4DA2A 4KK7A 4N58A 5C3WA 2AWNA 2PNRC 1HFNA 5CBAE 4REZA 5CV4A 5E4XA 2B2TC 2KCCA 1L0YB 4MACA 1B50A 1PZJD 1LTGD 2F0KA 3K5MA 4KTAA 1SYFA 1PTOB 3GV6A 3PUZA 3DWPA 1HUMA 1HXYD 4C1NI 2XN9C 3GTJB 4CKEA 3HKZB 3DWGC 2PMVA 2K7VA 2Z1CA 2L1AA 1X3PA 2EDGA 1HUNA 4OO1I 4LK0M 2X6LA 3V3XA 2HUGA 4PQXA 3E6ZX 4USAA 1U9RA 4OIKA 2B2UA 2WS3B 3AM9A 3PV0A 1GHJA 3LWUA 1EWHA 1W6JA 4CJ0B 3FRPB 3VR6A 1JWSD 1B3AA 4PMCA 4A3IB 5HFYA 3AE2B 4JWSC 2EYOA 1RYJA 3PO2B 2DWQA 1QCBD 1A3VA 4A3BB 4E6IA 2XVSA 5I9OA 2K32A 1ZOYB 1BUVT 3Q8BA 2SAKA 3GV3A 4A3DB 1PRTC 3I8ZA 5BN4A 3BWUD 2PZTA 2IX1A 1HRJA 1SE2A 2K5DA 3PO0A 5EE0A 2N9KA 3G7LA 3PO3B 1YNJC 3H3VC 2Z4IA 1PTOH 3N52A 5EPJA 1Q1EA 2JE6I 3PUWA 3Q8CA 2INNE 4EVOA 1EL0A 3Q22A 1KDBA 4F87A 2RDFA 2F0FA 3K0YA 3SXHA 1A70A 4H2AA 2AUJD 2L1BA 1DCZA 3U9OA 3RD4A 1NVID 4CQNA 2HDMA 3MXPA 1C48A 5IGGA 2G1EA 1IKMA 4QF4A 1JW9D 2Q5WD 1LTSD 1DOLA 4KY6A 2WXQA 1OXSC 4G7HC 1ICWA 3L7ZC 3NPPA 5CR3A 3RMHA 2NVYB 1GUOA 1SEBD 3C1EA 3AE7B 2J7ZA 5IGFA 1XCTL 4MN3A 2Q8TA 2CHBD 2WDVB 2EY1A 1VMCA 2B2UC 2KMMA 4K2LA 2B2WC 1GUWA 3MAQA 4XDDA 3U9SA 2Q8IB 4IFDI 3VQIA 1SNCA 4LAAA 1GUGA 4HEA1 1YQ4B 1ZE3D 3OWEB 4X3UA 3W9CB 1F9PA 2YEPF 4JX1C 1TT2A 3AMUA 2MGSA 5EGTA 1STGA 4EQPA 4ABNA 3FC4A 4K6DA 3Q23A 1D5MC 2YYZA 3DWQA 4Q0FA 4A3GB 5ELDA 2XSCA 1G2TA 2B2VA 4RF1A 1MI0A 4IUTA 1WTQA 1JRPA 1QKZA 1G2SA 5M5WB 5FO8B 5M5YB 3NVVA 1LACA 4L63B 5CGKA 3B9JA 1MSHA 4MT5A 1B9RA 2WXGA 1PGXA 4JPSA 4ZRZA 2GRIA 4XQJA 3IAS1 1YN5A 5DM73 4KKIA 1RODA 2V0GA 3ONAB 1YJIA 5EPLA 3HUIA 1BCPB 4EQNA 3U52E 1EOTA 2H1EA 3VR5A 3K57A 2ZW1A 4K2KA 5HI1A 2LY7A 1CTMA 4YSXB 1WD0A 1CA5A 4HMJA 2HDLA 3TSSA 1W6KA 4H0LC 3EQLC 1QOFA 5AFWA 4H7BA 2LMCA 3R93A 4K5XA 3BZDB 3IAYA 1MSGA 3A8KE 1BO0A 5FK9C 3HOYB 3V05A 4R9WA 3RLFA 2WXMA 2K5PA 1IL8A 5G5GA 1NSNS 3R8BA 4ZKBB 1ZEQX 1HPCA 4J8QA 2VNUD 2ZXRA 2NWGA 3URYA 1IYVA 1ONLA 3K5NA 3I4NB 4OZAA 1YJJA 5M5XB 5ELEA 4Z9CB 1ZXHA 3DWMA 2PW7A 4C3JB 3E56A 3VR9B 2K33A 3AE6B 3IT4B 1FD7D 1NAPA 3DEOA 2EE1A 4HROA 2WXNA 1TKYA 1ACCA 4G4KA 3SEBA 2D2CC 1J7CA 2F0NA 1FO4A 5FOBB 3S17B 2EPBA 2YEPB 4C1NK 4HKQA 2D5DA 2F0OA 2NVTB 3M85A 3MXGA 3T13A 1CZPA 3VR8B 1ZPSA 1I6VC 1E0ZA 1F2LA 2EY5A 2R7ZB 1IW7D 4A3FB 2CW0D 1LABA 4FYDA 2BDNA 3DM1A 1CJEA 4PNYA 2ACZB 2RKSA 1B1ZA 3HGBA 4RHRA 2Y3AA 4LLGM 1LLRD 1ML0D 3U2SC 3PZ8A 3KWVA 1JICA 1CA6A 4RGOS 3PZ7A 3P4PB 2RVLA 3HRDD 3MWYW 2NVQB 5A35A 1JE4A 2XWBB 1ILPA 1EY6A 2C9OA 5J1ZA 1DOYA 1II3A 4ILWA 2WINB 1IYUA 1K8OA 4FF3A 2AX5A 1JR0D 1ZXTA 3NQIA 4US8A 2SOBA 2VUMB 2RPVA 2F0IA 1XLQA 2EJGC 3BK2A 2NN6G 5I6YA 2DNCA 3VR3A 2K1BA 4KKTA 5C5MA 4C3IB 3E0JA 3A54A 4LJZC 4NAWB 4IALA 3CWIA 4J3OD 1KTKA 1FRDA 1JQ4A 2LS01 2EJFC 3NBHA 1EWCA 1D5ZC 3TEYA 5JEAH 2L0CA 3NWSA 3NZ3A 4KY5A 5C4HA 4JBWA 3AN1A 3IFTA 4KJNA 4R3DA 1SNOA 2PZWA 4I7ZC 1B44D 3P75A 1HQRD 2NTSA 3MHBA 1E10A 3BYYB 1LT5D 1WTXA 2F0GA 3S1NB 3H94A 1EZ6A 2FMMA 4M0WA 3FVQA 5JVG3 4XIGS 3K7AB 5CV5A 1B2TA 4KY7A 1O7LA 1Q12A 2SEBD 4XWWA 4KMUC 1KRHA 5J22A 2IPKD 1CT1D 4KGSA 1FNUA 3D4DA 3W3AA 4NJCA 1RKNA 2Y5PA 1YQ3B 2IJ0A 1SMYC 4N9TA 2A5HA 5CMDA 1PXUA 3SK8A 2N55A 1RD9D 5C3EB 4XT1B 5JEAG 1N5XA 1KAAA 4A9AA 1JWUD 4FNFA 2JEAI 1YN3A 3DUZA 4DGZA 3MEHA 2LEKA 5CV6A 5CV9A 1EFID 2K6AA 1XLPA 2PYKA 2D5GA 4XQNA 3IAM1 1J9OA 1ZUD2 3AECB 5C6AA 3I91A 2LHEA 4YT0B 4TQ0A 2NVXB 5CORA 1OXVA 2BTEA 3TP8A 3TZDA 2DBYA 3MFGA 1FXAA 4HMIA 2EELA 2ICEC 2XRSD 1ZP0B 3SR6A 3M3YB 2PCFB 1KNAA 4NP5A 2ICIA 1MHXA 2Y0SB 2WXPA 4RWSC 2QKIC 1PGAA 4IZ8A 4B0EA 1S5FD 2K04A 5HHDG 2F0LA 1FCLA 3BS1A 3HEJA 1RF2D 1WTRA 2B8GA 3AU7A 2VZKD 1I4XA 2PTLA 1LTID 2LMCB 1C4QA 3KBXA 4JK1C 2L5TA 3SHLA 3S2HB 1LT3D 1WYGA 4OHJA 1OXUA 3DWAA 3S2DB 1CFMA 2E74C 1ILQA 1HHVA 1SNDA 2WB1B 2J53A 1QB5D 1XO3A 3NRZA 1EQTA 3OOCA 1SNMA 4DXGA 1V1OA 1Q3LA 2VZKB 2WXKA 1MBYA 1N5WA 3J9CA 2F0HA 4V0BA 1BCPC 1EIHA 3KBGA 2WDQB 4DXFA 5BMIA 5C4JB 5BMGA 4U673 3H09A 3NVYA 2QIEB 3Q8EA 5BMHA 4S3SA 5C44B 3EA6A 1HTPA 2X69A 1WTWA 2A69D 4ZHOA 3IT6B 4KGRA 3OPOA 3TDQA 2KQ3A 1BR9A 2F1MA 4ZOHC 1I4RA 4KKUA 5G5HA 1MPEA 3NVWA 2PLPA 1STNA 1KDAA