1AW7A

Q136a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHALTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 56
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1997-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1aw7A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1aw7A01
1RD9D 1SJED 1EEID 1EFID 1LTSD 1LT6D 1S5DD 5ELCA 1LTAD 1SEBD 4C56C 1FD7D 3BVGA 1KTKA 1BXTA 1HA5A 2XRQD 1SE4A 4K6LA 1XTCD 2QILA 1PZKD 1FNUA 1LT4D 4L6TB 5ELEA 1YN3A 2G9HD 1PZJD 3DWQA 1L0YB 4RCOA 1SE2A 1ET6A 1QILA 1CQVA 4TSSA 2Z8LA 3TSSA 1TS5A 4RGTA 3BZDB 1BCPF 1PTOH 5FK9C 1LO5D 1AW7A 1D5XC 1KLGD 1I4QA 1LTID 1UUPA 1YN5A 1PRTB 2IJ0A 4NZLB 1FNVA 1EU3A 1LLRD 1PRTD 1TY0A 1SE3A 3GP7A 2XRSD 4UDUC 1B1ZA 1XXGA 2AQ1B 5D3IB 1GOZA 1I4HA 1JWUD 1V1OA 4RGNA 1TS3A 4DXFA 4Z9CB 1F77A 1BCPC 5ELDA 1EEFD 1RF2D 1TY2A 5D3DA 1JWMD 1PTOB 3BYTB 1S5FD 2NTTA 1PTOD 4RFBA 1TS4A 1MD2D 2NTSA 1V1PB 3EFXD 4RHRA 5TSSA 1CK1A 2WV6D 1FGBD 1KLUD 1JWSD 3MC0B 1JCKB 1G8ZD 2TSSA 2XNAC 3V05A 5FKAC 1LT5D 1PRTF 1I4GA 1AN8A 1LTGD 1T5XD 1S5ED 1L0XB 1PYWD 1LTBD 2ICIA 4RH6A 2RDHA 1M4VA 2RDGA 3O13A 1HXYD 2SEBD 2O2LD 3DWPA 2IPKD 4RGMA 1STEA 3R2IA 3DWAA 1CHPD 3URYA 1PRTC 1CHQD 1JR0D 4O1NA 4DXGA 3EA6A 1YN4A 1ESFA 1UNSA 4OHJA 3R8BA 2QEJC 2CHBD 2AQ3B 1BCPD 1I4RA 1TS2A 1D5ZC 1HTLD 1ENFA 1EWCA 1LTRD 4ZYSA 1RDPD 1EU4A 1ET9A 1LTTD 2R61A 1B44D 1PTOC 1CT1D 1SJHD 3BYYB 2J4XA 3MFGA 1DJRD 4RHSA 1S5BD 3W2DA 1PZID 4RGOS 1I4PA 2XN9C 1D6EC 1V1PA 1S5CD 3R2TA 1D5MC 1SXTA 3SEBA 3KLSX 1PTOF 3OWEB 4L63B 2AQ2B 1DYQA 5ELBA 3CHBD 5I4DA 1FNWA 1LT3D 1HQRD 4BWGB 5ELFA 3BVZA 1SBBB 1I4XA 1RCVD 3BVMA 1JQYD 1BCPB
chains in the Genus database with same CATH superfamily
1YNNC 2R93B 3NZ3A 3V2TA 1JJ2A 2LGIA 2MH7A 5C3EH 5HY6A 1EFWA 4XC2A 3SVMA 1YQ4B 2A68D 2N49A 1JOKA 4OWXB 4IOCA 5IP7H 5C4XB 4DK5A 1P7FA 1E0ZA 3HOYG 3WANA 3W1SA 2KTRB 2WKCA 3N32A 2K7VA 1FNUA 3HOVH 2L3ZA 2VXWA 1SYEA 1WFYA 3QB3A 4LF6Q 4LLGM 1TJEA 4HDQA 3MHZA 1CQFA 2MUYA 4BOSC 3ECIA 3B6YA 1A8VA 4A3EB 5C0XG 3T1HL 1X1MA 2PW9A 4FJYA 1V49A 1FRDA 3GTJB 1NYQA 2EY5A 4IWPA 2OHFA 4P7IA 3AEAB 2CQAA 1AWDA 3LDZE 4JBWA 3OPOA 5MPOA 4FJZA 5IKCM 2EE1A 1N32Q 2KEEA 4A3MB 2KAJA 4ME5A 4ALPA 2R92H 3AULA 3CW2C 2A69D 2LS01 5JHAA 3NRZA 1I4HA 3QJZA 1HR0W 1EQQA 5GAGC 5F2DA 4D2KA 4KDIC 3ETRA 4KGRA 4C80A 3FRPB 1FGUA 1NI2A 1K52A 2KCTA 3U4EG 3KYCD 5CV4A 1TY2A 4FBJB 5C44H 4DPGA 3BYTB 1S5FD 4GDKA 4AYBG 2K6AA 3A8JE 1IYJB 3GDEA 3RZOH 2JRHA 1HNXQ 4DHZB 1HTQA 3M3YB 4A93G 1QUQA 3V6CB 2KC1A 5I6YA 3KLSA 2N9XA 3V05A 2WB1G 4JWSC 2JP1A 3VVWB 4IUNA 1I35A 2FCSA 4DV7Q 2DGYA 3L10B 3ZO5B 2DN8A 1GC7A 1DOMA 4GDLB 4OO1H 2MEKA 1R4QB 5IWAL 2E2HB 3N6RA 5COYA 1ROEA 4HMIA 2J0KA 2N0SB 1WXQA 3DOWA 3J7YW 3I9V1 2I0QA 4F7ZA 1ZP0B 4PK1A 3MTSA 1E0BA 4HIMA 4A3LG 1A3VA 1N36L 2OOBB 1I3QH 3T4AC 2QDFA 4LNQA 2PMVA 4B08A 2NVUI 1J5EQ 3Q6SA 3SK4A 3S1NH 1P7EA 4BBRH 5FO9B 1HTOA 4ZHOA 1T0SC 2Q8RE 3EHVA 2KTFA 4OHJA 2BS4B 3VUYA 1P9DU 1K8AC 1M94A 1PDXA 3LJ3A 4PYZA 3NE5B 1FL0A 2M0AA 3K7UC 4L5TA 4V190 4IUTA 4CJ1B 2R2QA 4G0NB 2KECA 4DV3L 3V96A 5IYDH 1B44D 1TR5A 2HE7A 1RKNA 3KFUA 4J3OD 5K5PA 2F4VL 2WAQG 1EUVB 1UF0A 1WMHA 3Q0AA 4JW0A 5G2NA 3GD7A 5D14A 4LFAQ 4GLAC 2UU9Q 1WF9A 1QB5D 5FLMH 2BE5C 1WE7A 1WGYA 3KYHC 2WXPA 4L63B 4TQ1A 4ZRPA 4UPAA 2JWUA 3K9OB 1FNWA 4US9A 3IT4B 4RNAA 4BWGB 4KSKC 4EGVA 1IW7D 4PMWA 2JA5G 3VTVA 2IZVB 3S14B 1BCPB 1B7YB 1R9TH 4JL9A 4AP4C 3HOUB 1NE3A 2OT2A 4MZ9A 2CH4W 2KQ4X 2LKVA 4C4VA 5KNCA 2O6VB 2VUMH 1FD7D 3Q23A 2O6VD 4BAXA 3NZUA 4KJOA 1X65A 3U8ZA 3PQIA 2FUG1 2EPBA 4BA2I 3NVYA 4OW0A 2QILA 1LT4D 4A8XC 3C1FA 4QGUA 1YN3A 4H02A 4S17A 3CKIB 3MAQA 1MGSA 5AUIA 4PQXA 3RNAC 4F87A 1HR0Q 5H1SE 4N59A 4K2KA 2ATWA 1KLVA 4EQOA 1GB1A 1XWEA 4OEMB 2G9DA 4LW1A 4X57B 2B2UC 3NQTA 2NBFA 1WTXA 1X6OA 2RR9A 1XYIA 4DGZA 4G7OC 1Q1EA 2DZIA 1KL9A 1WJJA 3FILA 3KDFB 2DNFA 1F52A 4JGHB 4HSVA 3AE3B 2QKIC 3PSIA 1K8GA 4B3ML 3GTOB 1CZPA 4OO1I 3MZ5A 1TY0A 5AZGA 4NPNA 1SE9A 2AQ1B 4LAAA 3D4RA 4LUVA 1JWUD 4I6NB 3UE1A 3S16H 2WYQA 4F7XA 3NXWA 4CDDC 1KD1C 3DWMA 2F0EA 4IWQA 5G5HA 2HDLA 3K80C 1WRIA 3HOWG 4EZKA 1V80A 2E75C 2MQHA 3HOZB 1X3GA 1IKMA 2DZKA 3CCEA 1H9SA 3ZLZA 3OIPA 4LTUA 5DPTA 1EY7A 1CK1A 1F9RA 3APFA 1XCTL 1IBKQ 5IGDA 4P2CB 3S1QH 1XPUA 4DV4Q 1H4RA 2FCMA 1Z7TA 3S2AA 1Q1BA 4XTCS 3OW2A 2E2IH 4WQOB 1AE3A 1EIHA 2C35B 3NBHA 5IA7A 3HVDA 1LM8B 4MSMB 2RDBC 2F3VA 3VDYA 2BKFA 3UI3A 5EDSA 4K5XA 5IT9E 2WS3B 4K3BA 4A3CH 1ZEQX 2RHSB 2V3SA 4DR2L 4C3HH 2WXRA 4P71A 3P4QB 3AFPA 3F2BA 1ASYA 1YOVB 4RMAA 3EA6A 1G6JA 3DHHC 3M63B 2K4KA 4J15A 4JV5Q 3A1QA 4HPMB 2LRUA 4PNYA 3UDIA 1T0QC 1YNTE 2K32A 3CCRA 4IUVA 5DNFA 4DR4L 1FXIA 2QDBA 2PE9A 1PGAA 1RDPD 4IFDH 4LNOA 5DCNA 3APDA 3R7QA 4YWLA 1OGWA 2VH1A 1JB7A 1GB4A 3CCVA 5G55A 3C8YA 4X66Q 3U58A 4MTKA 3N1XC 1S5BD 3GTLH 2PLPA 2HD3A 3PUVA 2QC8A 2W3RA 2L0TA 3AN1A 3KWLA 1EY6A 3E0JA 5DM63 4B3SQ 4R4CA 2M00A 1RLFA 5M5XH 4CYEA 3W5OA 1G91A 2N9LA 4JI4L 2WHIA 2MJEA 4BVUC 3FAHA 1UZXB 5JVG3 4DV5Q 2IX1A 2CR5A 1RAXA 4HAEA 1YITA 3S17H 3MVVA 4DAMA 3A74A 3VDZA 1H9KA 2GN5A 1UWVA 4QB4A 4ZAIA 5JJZA 3JW0X 4H0LC 1LT6D 4DV0Q 3GTQB 4USAA 3PV1A 1JOOA 1Y1WG 3MHBA 4PG3A 1SE4A 3PIPA 5LL6X 1VQJA 4KN7C 3VTWA 1KDBA 4AYBE 4IUPA 1EOTA 2N88A 5JXVA 4JQWC 3CPFA 2ALYB 3U9SA 2JA7B 3BS1A 3T1YL 3RNEC 4BKSA 1V43A 4F1SA 2QDLA 2WB1E 3KYDD 3OJ3A 2ACZB 1CQVA 2R7DA 2DAFA 2HTHA 5BN3A 2K6QA 3I4MH 2PNRC 4QF4A 1E90A 4EZJA 5LLIA 3F1ZA 4FXGC 5CR3A 2B2UA 4HMJA 1GO3E 3L3OC 1AW7A 1YNXA 4JPBW 4KV6A 1TWFB 3TQYA 2F0QA 2Q2TA 2R7ZB 1TVXA 4NKLA 1K51A 2INNE 1WYGA 4NAMA 4NZLB 5KEEA 3OIQA 4MT5A 1IGDA 3H09A 4JOIC 1VQ4A 1UE1A 4V0BA 4CDEC 4A3JG 2WLBA 2BB5A 4UHVA 1YNND 2HUGA 1WOCA 1UBIA 2FXQA 1WI0A 1WJNA 4IO9A 2PEAA 3DDCB 1SN8A 4XE0A 3RZWC 3Q3MC 4CBVA 4LFCQ 4WJOA 1WX7A 2IW3A 4JYAL 2C9WB 2JJQA 4JI1Q 1U4MA 4PV1C 2VQEQ 1C76A 1WM3A 2JA9A 3P4PB 2JA6B 1ENAA 5C3EB 4K7UA 4W9JA 4WORA 5C4JB 3I4NG 2VS1A 1J6QA 1GXDC 1MJEA 2WAQE 1Q82C 1QF6A 1CM9A 1Q0WB 3VA5A 1U4RA 1UGMA 1EZ6A 3H3VC 2KQ7A 4G11A 3Q8EA 1Q10A 1KF6B 3O13A 5M3FB 2YU9H 4NDXA 1HUMA 1HZ9A 3GO5A 2FJ2A 3J80i 2LGDA 1TZOA 3URYA 4O1NA 3X3NA 3RULA 2RBMA 1PXUA 4ZHPA 1SNCA 1EF1A 1SYDA 3TZUA 3PO3B 3ZVVA 2JWZA 1ZKHA 2E5LQ 4J8QA 1KFYB 3HM6X 3NJTA 1L4ZB 4GKKL 5C0XJ 3MXNB 4JVZA 4A3IG 3Q69A 5E6PA 3RUIB 1E8XA 3VH3B 4A3BH 2H89B 4FP5D 2D3BA 2ZW1A 4HSPA 1EIFA 4JI0L 4TVAB 2R93H 1TKEA 1YHBA 3L7ZC 4C2MH 2R92G 4RF0A 4R1JA 1WGHA 3E0EA 2A8VA 4GOCA 3P75A 3TS0A 3CF5A 4AJYB 5C4XH 5C44B 3OW7A 3OTOL 3N1ZC 4X65L 1VQLA 4BY7H 1VRAB 3GTGH 3RZOB 1EWHA 2O4XA 2UUAQ 1D5MC 1GAQB 3LNNA 2N7DA 3OHXC 5ELOA 4FVMA 4EQPA 3M4QA 3NTHA 2BCOA 1XNRQ 3GE3C 4BOZB 3KF8A 1A62A 1K8MA 4IWOA 1D1KA 2NVYH 3SK5A 1I4XA 5D7GA 4LUZA 3SK6A 5FLXL 3OJ4B 3E9HA 2IO1B 4JI7L 1EY8A 3ULJA 3BDLA 2N55A 3R3MA 4J6IA 4UY8C 5ELCA 4DR1Q 1VQOA 3DM1A 2WNMA 4MDKE 1EYAA 3C1EA 1I3QB 4ZQ3A 2W55A 1PZKD 1LFDA 2LFIA 2M0XA 3G4SA 1PH2A 2Y0SG 1PZJD 2PYKA 2PMZB 1KAAA 1VQKA 1MSGA 2DNEA 3S1NB 2MHVA 4JC0A 5AJ3Q 1Y56A 2EMTA 4CJ2C 1E2VA 1NI3A 1LABA 2I2YA 3A9KA 4L5SA 1S3OA 1VQNA 2X69A 1I50B 3SHQA 3E9SA 4RM9A 4URKA 5EGTA 1LO5D 3AH7A 2BE5D 4JI8Q 4I6LB 2AKWB 3JC66 3HHMA 2J53A 2E74C 2KJXA 3EN2A 2C5LC 3HOXH 1OFFA 4AQYL 3AEBB 5IYBG 1HZBA 5IP4D 1TIFA 3JAME 4G7ZC 2BS2B 2UUBQ 3PHWB 4JOIA 1ZDXA 3PZ8A 5CGKA 5EPLA 2GLSA 4PS7A 1GJXA 2E2HH 3CCJA 1RIPA 1NR4A 3W5VB 2G1EA 3C19A 4GN1A 1EWYC 1WYDA 3UIPB 3IG3A 1R9TB 3H6MA 3EFXD 3QC8B 1KNEA 4GN4B 4BKSD 3MC0B 1JCKB 3AXCA 1SYGA 4YSZB 1GUNA 1XMOQ 3H94A 2VUMB 1HEZE 3DBHI 2ICEC 4A3DG 3AFQA 4QAYA 2WDVB 2IX3A 3RZFA 4B3TQ 4JI3Q 3D3RA 2LJIA 3TEXA 2V4DA 4A3KG 1EY5A 1WSPA 1IL8A 1PYWD 1PLFA 3TP6A 2RDHA 3TL5A 4MH0E 2OEOA 2WXLA 4AUQC 1GNUA 3VR3A 4C3IB 3G71A 1C7YA 2KYWA 4H2AA 2O2LD 1K0SA 1IZ6A 1QE6A 3M62B 3ZNHB 1M90C 3DWAA 4L23A 5DEHA 3CCMA 1WTVA 1L4DB 4AWJA 3CD6A 3CMAA 1I7HA 2JA8B 5C5LA 2NZ1D 2LMCB 2IYDB 4LJPB 4N58A 2AQ3B 2I1KA 3ZTCA 3BIID 5J39A 2BH2A 3J81c 1ENFA 4IURA 4NJ6A 1PFSA 1FYCA 1RWSA 1XO3A 2R61A 4RKBA 1R4PB 3S14H 1L0WA 2REXA 1PTOC 3S16B 1CT1D 3HOUH 2KJRA 3HVZA 2QIEB 1UD7A 1UWMA 2MBBB 2BYFA 5C0XI 5KHOA 4A55A 2JXXA 3QHTA 1CKMA 4AQ7A 4ILWA 1XMQQ 2JEAI 1OTRB 2D0PA 3AQQA 1N60A 1CI3M 3MJWA 1O7ZA 4KHZA 1BO0A 2OTLA 1S3SG 2DENB 1Z9FA 1W3SA 3CHBD 3S1QB 1HQRD 1E9MA 2EDGA 3WWVA 2K50A 1VMCA 3S2DH 1YJ1A 4LF5L 5IT9c 2F52A 2F4IA 2IT1A 2RVLA 4KHPQ 1P98A 4Q2JA 1SJED 2YEPF 2WXOA 1ASZA 1WR6E 1E8WA 1WTWA 4ANXA 4FA6A 2KBNA 4C56C 5HGTA 3AE8B 2RCFA 3Q8DA 2LXKA 3KBGA 4C1NI 5EBDA 2Q2UA 3GZNI 1MI0A 1QVGA 4ZDVA 2A6HC 2DWQA 3QX1A 2Z0DB 2ONQA 5H92C 3GTMH 2QEXA 2AWOA 4C00A 2LY7A 1IKLA 4HJ9A 1J7CA 1L0YB 2ZNVC 5E4WC 4U673 1JT8A 1D3ZA 4DAYA 2R3ZA 4WAFA 1ET6A 1STHA 2WDRB 2CKZB 5IYCG 1DONA 2RMMA 2BWFA 2L5TA 2A1AA 3W1GA 4X62Q 3QIAA 5CV7A 1N33Q 2YV5A 1HNZQ 1Y1VG 1KHIA 4K14A 1Y8RC 2LGYA 2UU7A 5IE8A 4DNRB 2UXDQ 3HKSA 2LXCA 1PRTB 1EU3A 1PRTD 2UUCQ 2VW9A 3D6WA 2PJHA 4IFDG 2O2VA 4ZCKA 2DAJA 5D3IB 3NS8A 3QO2A 5M5XB 4RCNA 3L4PA 2WX1A 1HPCA 4CKCA 2WXHA 1F77A 4LF4L 3M9BA 2LGXA 4DR6Q 2LSSA 1J7BA 1I6VC 4HCSA 4MNOA 3T13A 1ZOYB 4LUOA 2IO3B 1A3UA 1V1PB 1X56A 4GOPC 3RNFC 2CW0C 4QQBX 5CYUA 2LASA 1JWSD 2F0LA 4YIJA 5C3WA 3H8HA 2AL6A 4IDIA 4XDCA 3T1HQ 1LUZA 1QOBA 2LFNA 4ICUA 1I4GA 1LTGD 5C4ZA 4A3FH 1L0XB 1E1OA 1MSHA 3SHLA 4HJ5A 2ZZPB 4HCPB 2WDTB 1WJUA 2EZVA 1Z6HA 4LNNA 2XK5B 1OQQA 4ZUIA 2RCNA 2NVTH 2KKCA 1RODA 4EX5A 1AZQA 1F2ZA 4DV6L 1N6ZA 2LWPA 2SOBA 2D2QA 2Z6BA 3LB8C 3J7AF 1GG3A 4IM2A 4DUZL 2NUCA 2V9HA 1WTRA 4ME3A 4JX1C 3R8BA 1A15A 2EYOA 4PZ8A 1WZ0A 4FHJA 1PUTA 4PZ6A 4XDDA 2A5HA 1F2RI 4NJCA 2AUKA 4FHKA 1P16A 2BWES 3NS1A 3X23A 2BH8A 2Y0SE 3QR8A 2G45B 3EIVA 1WGKA 2EY1A 3PRMB 4ANVA 2MSED 3GTQH 4TQUS 4LDTB 4GKJQ 1HJPA 3AEEB 4LDTD 3I90A 3L08A 5G5GA 1EY0A 4LF8Q 2LEKA 1X54A 5IWAQ 3ERQA 5I6WA 3KLSX 1B2TA 5KHQA 4JI5L 1QLBB 5T8IA 1VQAA 2L0CA 4K6DA 1N36Q 2JQOA 3BVZA 2K0PA 1V8QA 1RJTA 3I70A 3QA8A 5CV6A 3A9JB 1IBLQ 2F0TA 4R9WA 5FOBB 4LCDE 4FXKC 4W9FA 1WFQA 1LYLA 3RD2A 1J9OA 5BYQA 5IGGA 2SNSA 3SR6A 3VR8B 2YU9B 5L37A 4BBSG 1A63A 3J81L 2L32A 2XRQD 2R7ZH 4YCUA 4KLKA 5G3LD 2Z6KC 4WIPA 3ITPA 2N9KA 4GGQA 1HFNA 2F0IA 4DV3Q 1MJCA 4WFN3 3MEFA 3RUZA 3M4OH 2YVCA 2Q8IB 1JALA 2L12A 4OELB 1WTQA 5KIXA 3PO2H 2EKIA 1EWIA 3A56A 3VH4B 3TDQA 3NP8A 4IPGA 4DR5L 2WQYB 3PLUA 4H44C 1JMCA 1V81A 4CQNA 4APVA 3I3TB 5CHWA 1ZXTA 5EPJA 1MG4A 1AYFA 1XLQA 3DBHB 2LHEA 3QOJA 1LTID 1NBWA 4TMAB 2JA6H 1TIID 2PPBC 5IT9L 4C2MB 1MHWC 5C4JH 1LLRD 2BGFA 3F2CA 2J52A 4MH8A 1B1ZA 2VL6A 2QF7A 4GN5A 3B2FA 4BY7B 4ASWC 1F2LA 3H0GH 2RKSA 4RKLA 3GTGB 3PUWA 4HCEA 5KNDA 3WAOA 1FJGL 4FULA 1FVIA 1YVCA 4QY7A 4MSQB 4L1BA 2IY5B 3H7PA 1PDQA 2NVYB 3NEMA 5KYIA 1R4NI 5M3FH 1HZ5A 2F0DA 1AFPA 2G4DB 4POFA 4I65A 2KFKB 3I5JC 3CQZH 4M1UB 4OL7A 1MD2D 2NWGA 2EQSA 4C3JG 3M85A 4KIKA 1KRTA 2EYJA 1FGBD 1CA5A 2R2OA 4W9KA 5JAVA 1G8ZD 4EQ5A 3PCOB 2ES2A 4GOPA 3PO3H 4A3EG 5GROA 1IPGA 1AN8A 1NUCA 2PQAA 1DM0B 1F2MA 1GC6A 2N4FA 1MHHE 4KV2A 2JEBI 3U7ZA 4RM8A 3AECB 1NTGA 2NMQA 4QIWE 1AE2A 4B3MQ 3CC7A 1M4VA 1HE8A 4ZLTF 4A3MG 2RDGA 3MC8A 3IFDA 1K0RA 2M1MA 3K5MA 1YJ9A 2KT7A 3PUZA 3HKZB 4DXGA 3PIO3 1ENCA 5CV8A 3K5NA 2ZVOA 4P16A 3B2GA 2K28A 4KY7A 3CIRB 2K5PA 5C23A 3RT3B 3MXUA 2GBRA 3JAMc 2KCNA 2AUJD 2F0FA 4DV2L 1IYVA 2ENBA 4P1BC 1HZCA 4RAUC 3MC9A 1I42A 1TS2A 4GNXC 1XPOA 3PF4A 4OVZA 4XZ4A 3HOXB 4REZA 3N30A 2C5CA 4NQKE 5FJ8G 1OXXK 2A6EC 1R7SA 4BXXG 1C77A 1HNWQ 3PS6A 2D62A 4AYBB 3GZNB 3ZDMC 4A90A 4DXAB 2ZXOA 2N9EB 4A3GH 4A93B 1DOKA 2GRIA 3QQ8B 2WXNA 3RN2A 2W82A 5AZHA 1TWCB 1M1KC 1UEBA 1FXAA 1L1OC 2M17A 1FO4A 2N7JA 2W54A 2XWJB 1Z5SB 1E3PA 2NN6G 4M8AA 4IUUA 3PTFC 1Q81C 1CKNB 3I4LA 3CCUA 4PMCA 5ELFA 4DR2Q 1VS0A 1W2BA 2I5LX 3H7SA 1FRRA 2A5UA 3V60A 1I50H 1NMGA 1K83B 2JXMB 5I9PA 2NZOA 2WXGA 3T9LA 5JZEB 4P74A 2Z0SA 5EE3A 1DOXA 1WJ6A 2C7NB 4HJAA 1UWXA 2HTME 4DR4Q 3LGJA 3J7AV 1ILPA 3RNBC 4YCVA 2MCNB 4DUYQ 2K75A 5E6JA 1FCCC 2CHZA 1ZXIA 4HWIB 3A4RA 3OYYA 4I7AA 2Z6KA 4LK0M 4JPSA 3KVFB 1N61A 4LJZC 5A2QE 3Q8BA 5JJLA 1WX8A 3AEFB 2PI2E 2NPTA 1WXMA 2Z8LA 1IHZA 2L7RA 4KKJA 2JZ3B 3TMEA 1GJZA 3KF6B 4R4OA 4JI4Q 2JSVX 3T51B 5AEKB 2JQRB 1LTLA 1YN5A 4HJKA 1SNQA 2F03A 1PGXA 2IJ0A 1CA6A 3S24A 1KNAA 2DY7A 3WA0A 3W1BA 2NCNA 5CHFA 2EELA 2MW5A 2UXCL 4WJ4A 3EGRA 3VTUA 4X64L 3AU4A 4KGSA 4HK2A 2QCPX 1CUKA 1PMRA 2KFJA 3P4SB 3S2DB 3GV3A 4WRDA 3M4YA 4C3IH 5M5WH 1MJDA 1WCMB 3I7FA 1SMXA 4DR3L 3ZTDA 1VQIA 5BR8L 1KQSA 1PFBA 2WV6D 3T1YQ 4Y52H 2GMIC 3VXWA 3D31A 2QCZA 3ULPA 4HIKA 2NBWB 2WDQB 3FC4A 3MFYA 1XTDA 1SE8A 3FMCA 3DHIC 4JWUC 3RYTA 2JA8H 4MM3A 3MXGA 3PRPB 4ACFA 1VF5C 3AE7B 5IP9G 1I5FA 2YTYA 1MKHA 2F0VA 4P73A 2KMCA 2KJ6A 4B0EA 3RR5A 3GTMB 1PH7A 1K3RA 3J81j 2LHDA 4O0AA 3W1YA 4FF4A 2CVRA 3J7ZC 3VUWA 4LNKA 2E3TA 1UAPA 4L8JA 1CSQA 1FFUA 2Z1CA 3S2HB 1SB3C 3Q3JA 3ZXRA 2L11A 3MHSD 4GXBA 4ANUA 1PA6A 1OQRA 1BF4A 3PZ7A 3F2DA 2X8XX 1SRUA 3DVGY 4P72A 2B8GA 3H7PB 1ESFA 3UDXA 2R7FA 4B9XA 1QZEA 4JYAQ 4ANWA 1PYSB 1YBYA 5LXHA 2RD0A 1HTLD 3NBIA 3SK8A 2V1CC 5M3MG 3K58A 2Y5PA 3HOZG 1GVPA 1NBFC 3FVQA 2F0KA 2J7ZA 3N52A 3I55A 1Q3LA 4GNXA 1E8ZA 3DVGX 3SU8X 2NBUA 3BZCA 3Q3NC 3AMZA 3J80E 2CW0D 4HPPA 2PQAB 1TWGB 3NHEB 3QWZB 2E2JH 3Q8FA 1JICA 1NCVA 2L8JA 1EL0A 4IFDJ 1BKBA 2PZUA 2M9VA 1L1OA 1T5EA 1J19A 1PTOF 1VF7A 1LT3D 1VQ8A 4XT1B 1E2ZA 5I2YA 2RGFA 5LXIB 3NWTA 1YQ3B 2QMTA 3CMEA 1N9WA 1E1TA 2GB1A 4GDKB 3RCZA 3AEGB 4A3FB 4EFOA 3ZRCA 2Y5BB 1QOHA 4DF7A 1QUQB 4LF9L 3ML9A 1PHJA 2WXQA 5T1GA 4AJWA 1ZDVA 3APCA 2M2LA 3WAMA 2EJGC 4GKKQ 4L5QA 3PUXA 2NVTB 1AP0A 1TZ1A 5J2RA 3C2PA 5K36H 2Q5WD 2EOTA 1IP9A 2IHEA 2AYOB 4MJSA 2SDFA 3ZJYC 4JI0Q 3I56A 1C1YB 4IM0A 5IODA 1YNJC 3DLLA 2DZMA 2IGGA 1DXMA 4K2LA 3KUDB 4WWOA 4WWPA 3CU7A 2ZXPA 3HGBA 1R4NB 2BVCA 4UP7A 2IX0A 5HG2A 3VYSA 4RF1A 1HRJA 4X65Q 1QILA 1WZ3A 2D07B 1SYFA 2JXTA 5BYRA 1STBA 5FR3A 1F9JA 3KBXA 4US8A 1O78A 3BZDB 1BCPF 1QZGA 1QWYA 3NVZA 1E24A 3R7RA 5FO8B 1E22A 1D5XC 1L2FA 3SDZA 1WX9A 4EOYA 4CKBA 2IBIB 4DV1Q 1N5WA 3DUZA 4G50A 4LFAL 5JJKA 2LUMA 1SE3A 2A73B 4JI7Q 3GTPB 2V0GA 1WXVA 1HQMC 3RN5A 4TV3A 3V62A 3PGEA 4LNIA 2CCZA 1DGSA 5D65A 1TS3A 3DQVA 3N9YC 2PIAA 5A35A 1E7ZA 3DCGA 4OX9L 1U0LA 2G5DA 3KLRA 3QG1A 2B63H 3AE5B 4EUTA 4FYDA 2KEDA 1WMHB 2EYFA 1ZYRD 3U52E 4BS9A 5JEAG 3IFTA 4PS3A 1Y1WB 3CF6E 4M00A 4ULLA 2Z9HA 2FFKB 4DHZE 3VR4A 1E5WA 3T16A 2JYTA 5T1IA 4OZBA 4XGAB 2JA7G 2DUDA 2F3IA 2F0UA 3AU7A 4KK7A 2L52A 3D32A 1SROA 3I73A 1PVOA 3ZW3A 2ICIA 4RH6A 4K8JA 2KXJA 4MHEA 1Z47A 2ZM6L 3M4OB 2WKDA 1FEHA 1T3QA 3P1MA 4YT0B 4C4VB 2N8NA 2VB3X 4QL5A 3PO2B 1K8RB 2PKOA 3DMUA 1Y8PB 4W9DA 4MACA 2I46A 4HJGE 2DJGC 1ISNA 2J0MA 1STEA 1B53A 1I94L 2IGHA 2X6LA 5IIFA 3UQAA 5IGEA 2K8HA 1C4CA 2HJ8A 3AB9A 3CCQA 3AYHB 3AU5A 1G2SA 2C60A 4NQLB 2HDMA 4YY3L 1UNSA 3C46A 4FXCA 1U4LA 4CHTB 3SDLC 4FJVB 1D5ZC 1GUOA 2MO1A 5ELNA 5E7NA 1EY4A 1ET9A 3H0GB 5EAYA 1NR2A 4WAAA 2MP1A 3FILB 3PT2B 1BT0A 2J4XA 2L15A 3C0RB 5C3EG 4EEWA 3SXHA 2C7HA 1DJRD 1FM0D 3W9CB 3D8GA 3NPPA 1JE5A 2BOSA 5IP7G 1YQBA 1QNKA 1K50A 4IOIE 1JC7A 1WTOA 3ZJTA 2J0JA 1ICWA 2OF1A 3CQZB 3FKIH 3IRBA 2NYZD 2EKEC 3HOVG 3IVFA 2WFWA 2MPMA 1TWHH 3DWGC 2KLGA 4ICVA 4Q5VA 3OLMD 4C7YA 2KUMA 4IM3A 4YSXB 3ZNZB 4DAVA 5M3FG 3J81i 1VQPA 1TKWB 1SE2A 1RCVD 4LMQD 1E8YA 3KQ4A 1A2UA 2AEHA 1H9SB 4BFRA 1QVFA 4OGQC 1S5DD 2LXJA 2KOXA 2F0JA 3E5SA 3HP3A 4YHHL 2FCNA 2BYVE 2F0HA 1HA5A 1BBWA 2EYPA 4K6LA 3TEHB 1MHXA 5C2TB 4KMUC 4L6TB 3NBHB 4B3RL 3ULLA 1RTNA 4RG1A 3P1HA 3PIOA 3OG5A 3AEVA 5DM73 2J0TD 2MP2A 1OXTA 2ZVNA 2L55A 2KDMA 2KN4A 5KNBA 1HFGA 2Q8TA 4BY1H 1U4AA 2B3AA 2XBBC 5JH5C 2IDYA 1AZPA 1II3A 4DKAC 5C44G 1D1IA 2MBQA 4G4KA 2B2WC 2LZ6A 1BMLC 2K22A 2NB0A 1KLGD 3HEJA 5EJWA 3ND8A 3HOYH 4A4IA 2D9UA 3RLFA 2VQFQ 4LF5Q 4A3GB 4R4QA 3HK0A 3A1QB 1BR9A 4N6EB 2NVXB 1B8AA 2R6GA 3GP7A 1ZE3D 2XRSD 3ML8A 4LFBQ 1QOGA 1IYUA 5NUCA 3AE1B 1F1HA 3S1MB 2GA4B 3KUPA 2OJWA 1VQMA 5BMHA 2WXFA 4OO1G 4IN3A 4EQNA 5C0XH 4MJSB 4IC7B 5EKLA 4PMBA 2O5JC 2A68C 2D10A 1TT2A 2VY3A 3Q22A 1SDFA 3R3OA 3H3VI 4QCLA 3K5LA 5HFYA 4W9IA 1SYCA 5HHDG 2B39A 1FCLA 1Q5WB 5LMUL 3S1RH 4X3TA 1SMYC 4BBRG 2PO4A 5JPNC 4ZYNA 2D5DA 4DN4M 3KUCB 1A0IA 3WALA 3GE8C 2GVAA 5LMNL 2H1EA 1KDAA 2WXMA 4OWWB 5IGCA 1IUEA 1JRPA 2QHOA 3HZXA 4R8IA 4IJLA 3U9OA 2PZWA 5M9OA 1WD1A 3QOLA 3L2PA 1XNQL 2PI2A 1HA6A 1JWAD 4DDID 1Q46A 5IYDG 1ZPSA 1XLOA 3P2BA 1LACA 1X32A 4KY6A 3KH0A 3CXCA 3HIZA 3PSEB 3TEZA 3ZRFA 4W9HA 1S1QB 4A93H 1KJTA 1TWCH 1GPXA 2UXBQ 4HIOA 5FLMG 4LF4Q 2PE6B 5AUKA 2A69C 2EYHA 4HEDA 3NVVA 3E3XA 2ZJPA 2JZPA 3CSFA 4HVBA 3STBC 4DFAA 5I9OA 3D6CA 4JI2L 3UIOB 1S4ZA 5H8YE 4KVGB 4M01A 5E1FA 4M0WA 4NY0A 2KDBA 5CC4A 3WIMA 4LFCL 1K83H 3TZDA 4A3LH 2MFIA 2K05A 2IWHA 2VUMG 4G3XB 2JYEA 3QARA 2VQEL 5M5WB 4M02A 4TKNA 1SXTA 3FHWA 2O5IC 1X3PA 2GI9A 4ZOHC 4DNIA 1JOQA 4DV6Q 4WJQA 1VQGA 5GADC 3A8KE 2LRWA 2B3GA 3NUCA 4M8MA 5EQ0A 4AH6A 3RI7C 1WI5A 2L9HA 3TUOA 1XLNA 3RD4A 2N7EA 1G6ZA 4DUZQ 4IQZA 3RN9C 3M7GA 3VR5A 2F0PA 2OWOA 4E71A 3K0XA 2BS3B 1WR1A 2HIVA 2Z4HA 4OONA 4CJ0B 4LF7L 2MLBA 5FR6A 2BDOA 2QGQA 3AB5A 3JSVA 1O80A 1E6EB 1Q12A 2DBYA 1C9OA 1NY4A 3A7LA 1N34L 3QIJA 2I5MX 1CZGA 4HLEA 2BKRB 1T9HA 3ZJVA 4OVVA 2JA5H 2CU1A 4TSSA 4MEMA 2MQJA 3J80c 2RDFA 4HR7B 4RGTA 2WACA 3UI2A 1NYRA 4ZRZA 5FK9C 4JI5Q 5EKKA 1NAPA 1GUGA 1WCMH 2IY0B 2M56B 3EFUA 2B2WA 2ZCCA 2GBMA 2KN5A 3NG0A 3JVZX 3PZDA 1Q90A 2E2JB 3KWVA 1WXSA 3Q8CA 5JOBA 1IBMQ 2KENA 1F9PA 3FP9A 5D6JB 1C4AA 4ID6A 4O42A 1AEXA 2YLMA 4FO2A 1YMHE 3B0AA 4DDGD 1NSNS 3FEWX 3LYYA 1BCPC 4CDCC 2EXDA 1SF0A 2KLCA 3UDGA 1STAA 2E6XA 2VZKD 1X9NA 2OEDA 3HM3A 3TMPB 4A3CG 2NTTA 2BQQA 3PO0A 1FXTB 1QCBD 3S2HH 4C3HG 1OO9B 1KXLA 2KOLA 4K0KL 2MP2B 3VUXA 4DR1L 2RSUA 1KLUD 4WJPA 4TQ0A 1ZW7A 1X55A 3J7A5 3BY4B 3Q2AC 3KF8B 4DR5Q 2KTRA 3VR9B 2KWCA 2L0FA 2MO0A 4YL8A 2L83A 2PVOD 2K52A 2DHZA 3SGIA 2WX0A 3M95A 2L76A 5AJ3L 4AS1A 3L16A 1O7IA 1SYBA 1VCIA 3CRKC 5L95C 1BUVT 3I72A 2IPKD 4ABNA 1TWGH 4TRDA 3A0JA 2JPHA 1MIUA 3A8IE 5D94A 2BBCA 4NXML 2RSOA 4OWTB 1IXRA 3AEDB 1RL2A 5AZFA 3CCLA 2DNCA 2V1YA 4W9GA 2KCCA 3DPDA 1GHJA 3EECA 4HIDA 5DAUA 1ESRA 3A9KB 4CO7A 3ZXVA 1Q1OA 5TR5A 2MGSA 2KWUB 4S0RA 4GLVB 1C4PA 1EU4A 1CMXB 1UH6A 1P3QU 5DLQE 1STNA 3OMGA 4NXNL 1VR9A 4A3OA 2F0SA 2EXZA 2VZAA 1HCZA 1QVCA 2B63B 2RF4A 3W2DA 3IKJA 3TEWA 2JU6X 3Q3OC 2ZTEA 2K5HA 2K6DB 1U9RA 2I07B 2HDEA 4LK1C 5C6AA 1E7UA 2KK8A 4KKIA 3B9JA 2K5VA 1S72A 1ZXHA 1VDVA 1B9NA 3U7DA 4HTHA 2WIIB 3BVMA 4X6AH 1GHKA 3MXPA 1RD9D 5JEAJ 4GDLA 2EMSA 2K39A 3RZDH 1YHQA 3I4MG 1WTHA 3PF5A 3QCAA 4ARIA 1KC8C 4DV2Q 1WVLA 3OSOA 5FLXE 1LTAD 1GM5A 1C4QA 1LXDA 3KUZA 3BVGA 1SR3A 1PFDA 4BKTA 4KSLC 1WE6A 1DOYA 3K57A 2K03A 2HJ1A 2KC2A 4M0WB 2KVRA 3GTPH 1PGBA 4ZRIA 1VQ9A 3GTKB 2FIFA 4NAWA 1KABA 2PMZE 1A70A 4ODGA 4XQNA 1JW9D 5I2XA 2GBKA 2VH2A 4M8NA 4IZ8A 3UGBB 3GQBA 2LD9A 4U68A 3GOEA 1OXUA 2OXPA 3U30A 2KJHB 1PQSA 1TKGA 4A75A 3RPFC 1Y1WH 3UE0A 4DNTB 2D3AA 2KHWB 5BN4A 1JRUA 1YD8U 1C8CA 5C5MA 3B08A 1XXGA 3H91A 1L7YA 3DHGC 3FKIB 1XF5L 2HHHL 4XQJA 1TWHB 2MBEA 3EQLC 2MBHA 5ELDA 1DGJA 3LWEA 1J8IA 3DVNV 1L6UA 1YX5B 4RA8A 2INCC 2KNBA 1VQEA 2F4VQ 2INDC 4K3CA 5KYLA 4OXPA 3EC8A 1PH3A 1Q8KA 2WP9B 1IBXA 4KGTA 2WINB 3RNCC 1GD7A 1K53A 3AV8A 1VQBA 2TSSA 4WWNA 5ISRA 3WOFA 3IL8A 3IAM1 4EVOA 5J1ZA 1PRTF 4OIJA 4A3JH 2MRPA 3BWUD 2H88B 2JSOA 2PTLA 2FINB 1V9JA 2WGSA 2OQ0A 3IT6B 3DHQA 4A3BG 5IOIA 4A76A 1VQDA 5BO4B 2R93G 1L6VA 2FIDA 2BPSA 1V2YA 1N33L 2SEBD 4L5RC 4BY1B 3DWPA 1Z2MA 2UXCQ 2ZXRA 4KKSA 5C4XG 1YJIA 3KK7A 2XEWA 1J0GA 4X64Q 2N1VA 3KDFA 4TKOB 4BY7G 3I4NH 3ONSA 1D2BA 4WJWA 4HCNB 2DX5B 4FN2A 3HOYB 1G2TA 1N5XA 2UUCL 4DAYB 1EM7A 2KMMA 1GUSA 3RLOA 2QEJC 2CHBD 2F3WA 4IUQA 4P75A 2KA7A 4DWFA 5HKHA 2PCFB 1PH8A 1L5PA 4DR3Q 2CKHB 3EBEA 5BR8Q 4GZYC 4J1MA 4ZYSA 1U5KA 1TGZB 3TIXA 3UQBA 1LTTD 2L00B 3D4DA 1XD3B 4WWMA 3BYYB 1KAWA 4DR6L 1Y14B 4KKUA 4UP8A 1QKZA 5EE9A 3OAWA 1SMYD 4C3JB 1XPRA 4MGIE 1CFMA 3AM9A 4N8FA 1JJGA 1BVSA 2BTEA 3NUHB 1D6EC 4XXEA 3U4ZA 1S5CD 4OIKA 2HIXA 1Q7YC 1VZ6A 2LUEA 2O2VB 4DR7L 1VLBA 3S1RB 4IALA 2KVZA 3ZGZA 2KQ3A 5M5YB 4IPDA 4A3IH 2CWPA 1P8LA 2JZZA 3CPWA 2K01A 4GN3B 2I1JA 2MJ8A 4UAIA 1EOVA 4XT3B 1JWBD 2IO2B 1GUAB 1D4BA 3HS0C 3P4RB 4KHVA 2FE8A 3CC4A 4OZAA 3HKZG 1LTSD 3MP9A 4AOFA 3IHPC 3X0WA 2XSCA 2XWBB 2B2TC 2MHJA 1SEBD 2LJ5A 2X6GA 1WJ4A 2Z59B 2D5GA 2KDIA 4MIUA 5BMIA 3ND9A 5ELEA 1VCBA 2DYMA 3AE2B 1JE4A 3ZJUA 3STBD 4DK6C 3HOXG 1KDCA 2OQKA 2NVXH 4Y7NB 3K8AA 1STGA 2XIWA 4JI6L 2D3CA 2WB1B 2IY1B 1ILQA 3NOBA 3DVNU 4IUMB 4A3PA 3T3OA 4RWSC 3S1MH 3V3XA 2Q2IA 1NDDA 3PLVA 4P6VF 3TSSA 3RMHA 3P20A 4NB3A 3G6JB 1N62A 3I3CA 3CWIA 2ZTCA 5HI1A 2JX5A 3E9IA 5D2MB 5JJIA 2K14A 1K8OA 2NR2A 2JN4A 1STYA 4GKJL 3IFWB 4X3KA 4B95A 3G6EA 4IPCA 1QNUA 1NNXA 1N63A 5G3LF 4LF8L 1YIWA 4RMFA 2NVQH 4LF9Q 4DK3C 4ZUJA 1WIAA 2PNHA 4YTNB 5HURA 4FLHA 4YWMA 3EFCA 1EEFD 4GLXA 1PTOB 4TUUA 1IBLL 4KDLB 1PTOD 4N8X1 2KZRA 1TS4A 2NTSA 1DCZA 4RHRA 5TSSA 4NAWB 5BMGA 3TP7A 3K81C 4XIGS 4MTNA 1JJCB 2WAQB 1MI2A 3H9DA 4LWCA 5CV5A 2K25A 2FBWB 5IYBH 2FUHB 3I4OA 1SFOB 1LGRA 1FD6A 2DZJA 4XX5A 3H1UA 2L1BA 3FPPA 3G48A 2MNAA 1XQQA 2D11A 1A6XA 1Y8NB 2FCQA 2M8SA 1H9RA 4BBNC 3HOUG 3BINA 3ALBA 3TEYA 1W6JA 2D3GA 2JA5B 1EYGA 1YJNA 3NY5A 1V1QA 3U2SC 1TXYA 1WXAA 3TREA 2MA9B 4ZKCB 3L0OA 2BF8B 3L17A 4WH4A 1EYDA 2KHSA 3NELA 4QUCA 4HPLB 3T8MA 3MWYW 4OX9Q 4A3DH 2G3QB 1SIFA 3V61A 2A6HD 1I6HH 1BCPD 1TTNA 5CHVC 4PS8A 4A3KH 1IBXB 2ZNVB 4F88A 3KLWA 2EY2A 1EWCA 5E6OA 1WCMG 2F0MA 3VR2A 3NTIA 4LF6L 1KIXA 1G6PA 1VQ5A 1F0ZA 1EQRA 3I8ZA 1A3TA 2D2CC 1EQTA 2B29A 4RGOS 3ZNGC 4CKEA 5GAHC 1YJWA 1OXVA 2ZM6Q 2FHTA 3ERSX 2KX3A 1MPEA 3P63A 4OVUA 2RHQB 4B0MA 1YX6B 4II2B 4HKZE 1N32L 1EO6A 2X38A 2ZEQA 2GBJA 1I94Q 1OTCA 1FIQA 1QOAA 4F8MA 1EEID 4HEA1 1YHAA 2JY6A 3MA2B 1TYGB 2ZW0A 3I91A 4YY3Q 4KIKB 4C7ZA 4FNFA 5LMNW 4NNJB 3WOEA 1OXSC 2E8GA 3HOWB 3K0YA 1PV4A 3GB1A 4GOPB 1B70B 5CV9A 2B2TA 1FPYA 1EIGA 3PMFA 2K04A 2KANA 2WU2B 1NEKB 1K73C 1HNXL 3J81E 2SAKA 4E3CA 5M3MB 3I63C 1RHPA 4KI0A 3RNUA 1MFWA 5J3BA 3MXNA 5JVH3 4IJHA 3MEHA 4XDXA 5EE1A 3U4VA 3A54A 4DV7L 1HNWL 2MX2A 1V6EA 3VHTC 3N20C 3K6OA 1BQQT 2CH4A 2AMCB 3BK1A 3R93A 5JPMC 1C78A 1I4QA 4DQOC 3VYTA 3JAML 3WAPA 4IG7B 1VQHA 5LL6S 1XLPA 3NSWA 4UDUC 1SSOA 1LQBA 2KQSA 1FFVA 3A7AB 4A3FG 1J5EL 1H8CA 2CJNA 5C3JB 3ICEA 3DEOA 4YHHQ 3EUB2 1VZ8A 4L2YA 3PV0A 1PFNA 1UELA 5IYCH 4ZK9B 3WCQA 1G51A 5D3DA 2L05A 1JWMD 5FLXc 1K28A 4B3RQ 4XYCA 5GAEC 1XX8A 3OTOQ 1Y1VH 4RFBA 3VA7A 1F2YA 1V5TA 5CTRC 4HDOA 3Q14C 3RZDB 5C3XA 2H5XA 2B2VC 1TT5B 2GOWA 3QWNA 2INPE 3OOCA 4C1NK 1WM2A 1SGHA 1AH9A 4DUYL 4JBJA 3S15H 3C3LA 1VJKA 4GLSC 4ITKA 2MJ3A 2CQOA 5GQOA 1SIJA 2F0NA 3VAWA 2UU9L 5EPKA 2KD0A 1HZ6A 5J22A 2QA4A 2N9PC 2JT4B 3DBRI 1HXYD 1AARA 3NZSA 2HQLA 3ZYYX 4RGMA 1WGDA 4J6HA 3R2IA 2FAZA 1CHPD 2YTVA 2HD5B 1PRTC 1CHQD 4II3B 1JB3A 3Q24A 4YSYB 3VRBB 3HKZE 2LGSA 3RFZB 5E4XA 1X3FA 3VR6A 5FO7B 1I4RA 2NPTB 1V9PA 1ZUD2 1X3QA 1ACCA 1B9MA 3W3AA 4R8NA 3I57A 5LMUQ 2KWVB 4A9AA 1ZGUB 1DOLA 3PUYA 4KJNA 1HR0L 4FF1A 3LXFA 4KD4A 5LMNQ 2B76B 4FADA 3N1YC 2KVMA 2K5DA 4PZ7A 4F8CB 1I4PA 2R7ZG 3SD5A 4HRSA 1L0VB 4K81A 2Y3AA 4AQYQ 1LM0A 4B9WA 4WJ3M 1XNQQ 1OEYJ 1E7VA 4W9EA 1GKHA 1HTPA 1WD0A 5IOCA 3DEPA 2G4SA 4UP9A 2OTJA 1KRSA 2F0GA 3GTKH 2AHOB 3ONAB 3PO2G 1SBBB 1YEZA 3IBEA 3A5ZB 4NJ7A 3H3VH 4A3JB 3ZKJC 1V97A 2FMMA 1DZ1A 2DJFC 3K9PB 4IKGA 1BDOA 4DK1A 2FNJB 4IPHA 1VDZA 4PYUA 2K5QA 2BA1A 1KTKA 4JI2Q 3CC2A 2JA6G 3A55A 4MM3B 2K1BA 3IAYA 3PRZA 3HRZC 2SNMA 4YWGG 3TS2A 4WURA 1RYJA 1JMLA 1EY9A 3K7AH 4KKTA 3H0GG 3I4NB 5DPSA 4RCOA 2LMCA 1C79A 4FDBA 3UF8A 3K59A 1IBKL 5J17A 4OZCA 1TWAH 3O65B 4DV4L 1O7YA 2P5ZX 3G7LA 4A6QA 4BA1I 5BN5A 2ON8A 4N9PA 4DA2A 2RQXA 4KZ0A 4IFDI 5LNK1 2UWQA 3HG9A 1DD2A 4BBSH 2ZJDA 3VYRA 2QJLA 3HOVB 1FNVA 1K9MC 3EROA 3PO3G 4NPSA 4YCWA 1H9JA 1NMFA 3TJPA 1EIYB 1WYWB 2B8FA 3WDNA 4GNXB 4LF7Q 3CSTA 4DXFA 3N3KB 4JLCA 3ER0A 5KRUA 2OCEA 4A3IB 4JK1C 4I7ZC 2A6ED 1WRDB 3R66C 3ZUNA 3CP0A 4JV5L 2ZPNA 2EYLA 1N34Q 4H13C 2PZTA 3VYUA 1CTMA 1FR3A 4POGA 2BYEA 1SLJA 2ZCBA 1L1OB 2R92B 3SR1A 3SFEB 2A4ZA 4AIMA 3M3JA 3H15A 2V4IB 4MELA 4YXDB 4X66L 1T6BX 4R3DA 3TP5A 2B2VA 1KH0A 2TMPA 2EIFA 1T5XD 3LWUA 4IOAA 1NVID 3K5OA 1JROA 4B3SL 1VQ6A 5KGUA 3DBSA 2CFMA 3RNGC 4QMGA 4GB9A 3TBLD 2LVPA 4KTAA 1F9SA 1UE7A 4A3GG 4DV5L 3H6NA 5CX3A 3ZIMA 3VFKA 1EZ8A 5IY0A 4C3JH 3KJOA 4KD3A 1RFAA 4G57A 4MGKE 5IO9A 3TCAA 4K7WA 4X3SA 1Q86C 4DV1L 2JYOA 4FF3A 3EJIA 3TBIB 1PH5A 2J42A 4DV0L 2BB6A 2KO3A 1SAPA 3W5UB 1UBQA 2EVBA 4A3EH 4K5WA 3NTKA 3AMUA 4GMVA 2CJOA 3D4WA 3GTJH 1OQYA 5M5YH 3BG3A 1PH4A 2ASBA 2GBNA 2YEPB 4K0KQ 2Y0SB 2NVQB 5EKIA 3IXSA 2W9NA 1Y69U 4A3MH 2W3SA 1SJHD 3MFGA 4JBMA 3SFDB 1B9RA 2EY6A 2Y5CA 4JCVE 1VQ7A 4P1CC 3AE6B 4EKUA 2IGDA 2Q2HA 3NK9A 4GIVA 2PW5A 2CS4A 2I5HA 4BBRB 4HROA 2JE6I 3BK2A 1HHVA 1V1PA 1MVKA 3TP8A 1QOFA 3SE0A 1YJJA 1EQVA 1RM6C 1WWTA 2JRIB 3P42A 4HXDA 4DHJB 5I4DA 1RFKA 4Y7NH 2YTXA 1R4MI 1XEEA 3BJUA 1NENB 4CGYB 4DHJD 2KDFB 2PVGC 5BYSA 5FJ8H 2A19A 2V3NA 3DBLI 3GS2A 1IYFA 1JQYD 2AWNA 1XT9B 2HCCA 3L9AX 3M3YH 4BXXH 4NXMQ 2DLBA 1MBYA 5CBEE 4B9KA 2XK5A 4YWKA 5AFWA 2KWDA 3GV6A 5EE0A 3AE4B 2LVQA 1CJEA 1BXTA 1D7QA 4MGZE 2CU3A 2WP8J 2K8BA 4H7BA 2NN6H 1WTPA 1E10A 2G9HD 1M8AA 4JI1L 4JG2A 3DWQA 5L83A 4NXNQ 3M7NA 1QT9A 1V5OA 4CDFC 4A3DB 3CAMA 2LVOA 1SSNA 2WXIA 4GSWA 1I6HB 4MN3A 4W9LA 3PVLA 2F0OA 1TS5A 4A3KB 2NS5A 4BZAA 1HUNA 4NMZA 1PH1A 4R4IA 1PTOH 1SNPA 4C3IG 1V8CA 2B2YC 2DYBA 3X3MA 2ZTDA 3A33B 4N9F4 4EE2A 3M4PA 1A5RA 2KHIA 2AWTA 3QAQA 1QQRA 3ENEA 5LHY1 1SNMA 1WH3A 3Q6BA 4ZRJA 3FKYA 2JA8G 1T0RC 4A20A 1EUJA 1GOZA 1WGGA 2FMCA 2XGTA 1SFOH 4PT5A 1V1OA 4B6WA 3DBRB 4DK0A 4RGNA 1V86A 2V4LA 2RA4A 2CWAA 1BNZA 1RTOA 3QK0A 4XWWA 1X3EA 2EJMA 4MGYE 2H4OA 2C9OA 2E5LL 2K3UA 1OEYA 4LNFA 2HCIA 4XQQA 3A9JA 3FPUB 4ZRQA 3VRAB 1Y8OB 2I38A 1GUWA 2QW7A 2Z0EB 4KY5A 2XNAC 4QJFA 4DAPA 5C4HA 4E74A 1VQFA 1LT5D 2KDEB 1CSPA 2BA0A 2ZJQA 1YI2A 1GUTA 2XTIA 2F1MA 2RSNA 4O2DA 4QIWB 1S5ED 5J18A 2VB2X 1B3AA 1CKOA 3P7JA 4NW2A 2M19A 1QZHA 1K3BC 2UUAL 1B50A 2E2DC 1P0RA 2PQEA 1IW7C 1TQOA 1EYCA 1XNRL 2VZKB 4XYOA 4X3UA 1CZWA 1PYBA 4DU9A 1HZAA 2K5WA 3CMMB 2HHHQ 1JR0D 3KJPA 1YN4A 4ARCA 1ML0D 3L13A 4HJ7A 2K9XA 2VQFL 2E2IB 4BBNF 2KACA 1T0YA 3FDTA 5IP9H 4K1RB 4FF2A 4LFBL 1YNJD 5E6NA 3ZNID 1BUIC 1LTRD 2N1WA 1H95A 1U4PA 2NN6I 2K8CA 3GTOH 4C3HB 2LXAA 1H9MA 4K7SA 1BOSA 1PZID 1UE6A 2KFKA 3HOWH 5K36G 1C3TA 5E3FA 1PH9A 1F2RC 1BBXC 3ABVB 1Y1VB 4JBKA 3RLNA 4DBGA 1F9QA 3SEBA 1LV9A 3I2ZA 3OWEB 1DYQA 2BDNA 3F2UA 2CHWA 1N8RC 2BW2A 2LI5A 4JI8L 1FJGQ 1B4OA 2ZT9C 1NJIC 4FXDA 5M3MH 1KRHA 3AI5A 3PPAA 2K1FA 2M4NA 1IGCA 5JHBA 2K5NA 3HOZH 4GU2A 3S15B 2IO0B 2XVSA 3B1LX 4JIOU 2E76C 1YIJA 3JYUA 1VMPA 4HN7A 1VQCA 2D0OA 3DM3A 1EFID 3NQIA 1WY8A 3A4SC 3EVQA 3W1SC 4GS3A 3TN2A 3GTLB 4YTPB 2UUBL 2WWZA 2MWSB 4IW0A 1JORA 3J9CA 2WXJA 2YYZA 4LJOB 1BBUA 1XTCD 5A2QL 2HQEA 2UXBL 3V6EB 1KOTA 4XWTA 2HT1A 3DXJC 3LX0A 2JF5A 2WXKA 4WJNA 4W9CA 3HUIA 2DYOA 4CHKA 3OWFA 3S17B 1UGJA 4KZCA 1A2TA 2PPHA 2L4NA 3JAMi 4N9TA 1XMOL 4XYQA 1C0AA 2QSDA 4I6PA 3PREA 2B63G 1E7PB 3E6ZX 4JI3L 4B3TL 1S40A 5IGBA 4DR7Q 3L0WB 3HFZB 3QJYA 3A5UA 2KX0A 3T53B 3PHXB 3VQIA 3ZDTA 2L1AA 1UUPA 3OMCA 4ZKBB 1J8CA 4WQMA 2N3SA 2B2YA 4K5VA 4R4TA 1RRBA 1SNDA 3NENA 1L2NA 2A74C 2MJDA 4K8IA 5IN7A 1ONLA 4JE3B 3KW5B 4Z9CB 1UEAB 1CKNA 3NHHA 1QG7A 1D8LA 1IL2A 3I4MB 1RF2D 3D0FA 3AE9B 5IAAC 1WGRA 5DPRA 4ZRKA 3IAS1 5GXGB 1W6KA 3BDOA 1PH6A 1DOIA 3UDFA 1VZ7A 4JI6Q 3MTNB 5DPWA 1G291 3ZQ4A 3NWSA 1HH2P 5IGFA 3E56A 4KN4C 4QUFA 3L54A 2CHXA 3RMKC 3MJ5A 5EBCA 3Q8AA 1O7LA 5FKAC 1P1AA 5CBAE 1VD2A 2C7MB 3CCSA 1XCQL 2NBVB 4Q0FA 3KOJA 2AL3A 3UINB 1ZKOA 1TBEA 2IL8A 1LTBD 2KMAA 1XMQL 2VNUD 3NVWA 5CORA 1ICFB 3K7AB 1UE5A 2JVCA 2Z4IA 2GVBA 2MBOA 2EJFC 3PGZA 5C1ZA 1TWAB 3JSVB 5JEAH 3PIP3 1MG8A 1JQ4A 2ZPYA 4G7HC 3KF6A 3U50C 2J7QB 4KHPL 2KHJA 3S9WA 3CRLC 1R4MB 5CMDA 2UYZB 3FKIG 2JA7H 1FMAD 1Q8IA 2V3PA 4YTMB 2RPQA 4BBSB 3DBLB 4EZLA 2IHFA 3T3NA 1KM7A 1IBML 2O6VA 1C9FA 1QJOA 4BKGA 2N78A 3J80L 5GMVA 4HKQA 2K33A 3BZKA 4HJ8A 2ASQA 5HGQA 2RPVA 1E2WA 2BT6A 1ZYRC 4NP5A 3T56B 2VRRB 1TKYA 1PFMA 1TWFH 2WU5B 2OJRA 1EF5A 2F0WA 3Q3FA 4RHSA 4KX6B 2EYMA 3F8TA 1XJVA 2BYTA 2XN9C 2DY8A 4E6IA 4X62L 3R2TA 2ZJRA 3BDCA 2NZHA 3BU2A 3TRZA 5ELBA 1B3QA 2AQ2B 1HNZL 4S3SA 2PW7A 2KCMA 1C48A 1YZ6A 1SNOA 2JUOA 3HRDD 1TU2B 4A3BB 2UXDL 2ID0A 2AX5A 2JK8A 4BY1G 1J7AA
chains in the Genus database with same CATH topology
1YNNC 2R93B 3NZ3A 3V2TA 2LGIA 2MH7A 3SVMA 1YQ4B 2A68D 5C4XB 1JOKA 1P7FA 1E0ZA 3W1SA 2WKCA 2K7VA 1FNUA 2VXWA 1SYEA 3QB3A 4LLGM 1TJEA 3MHZA 1CQFA 2MUYA 4A3EB 5C0XG 2PW9A 1FRDA 3GTJB 1NYQA 2EY5A 2OHFA 3AEAB 2CQAA 1AWDA 5MPOA 4JBWA 3OPOA 2EE1A 2KAJA 2KEEA 4A3MB 4ME5A 2A69D 2LS01 3NRZA 1I4HA 5F2DA 4D2KA 4KGRA 3ETRA 4C80A 3FRPB 1K52A 3U4EG 5CV4A 1TY2A 3BYTB 1S5FD 2K6AA 3A8JE 3M3YB 5I6YA 3KLSA 3V05A 4JWSC 2JP1A 4IUNA 2DN8A 1DOMA 4GDLB 4OO1H 2MEKA 1R4QB 1ROEA 2E2HB 3N6RA 5COYA 2N0SB 4HMIA 3I9V1 1WXQA 3J7YW 1ZP0B 3MTSA 1E0BA 1A3VA 3T4AC 2PMVA 4B08A 3Q6SA 3SK4A 1P7EA 5FO9B 4ZHOA 2Q8RE 4OHJA 2BS4B 1PDXA 3NE5B 2M0AA 4V190 4IUTA 4CJ1B 2KECA 3V96A 1B44D 1TR5A 1RKNA 4J3OD 5K5PA 3Q0AA 3GD7A 5D14A 1QB5D 2BE5C 2WXPA 4L63B 4TQ1A 4ZRPA 2JWUA 1FNWA 4US9A 3IT4B 4RNAA 4BWGB 4EGVA 1IW7D 4PMWA 3S14B 1BCPB 3HOUB 2OT2A 2KQ4X 2LKVA 5KNCA 1FD7D 3Q23A 4KJOA 2FUG1 2EPBA 4BA2I 3NVYA 4OW0A 2QILA 1LT4D 4A8XC 3C1FA 1YN3A 3CKIB 3MAQA 1MGSA 5AUIA 4PQXA 4F87A 4N59A 4K2KA 4EQOA 1GB1A 1XWEA 2G9DA 2B2UC 3NQTA 2NBFA 1WTXA 1XYIA 4DGZA 4G7OC 1Q1EA 3FILA 4HSVA 3AE3B 2QKIC 3GTOB 1CZPA 4OO1I 3MZ5A 1TY0A 2AQ1B 4LAAA 3D4RA 1JWUD 4F7XA 3NXWA 3DWMA 2F0EA 2HDLA 1WRIA 2E75C 3HOZB 1IKMA 1H9SA 3OIPA 4LTUA 1EY7A 1CK1A 1F9RA 1XCTL 5IGDA 4P2CB 1Z7TA 1Q1BA 4XTCS 1EIHA 3NBHA 3HVDA 2F3VA 3UI3A 4K5XA 5IT9E 2WS3B 1ZEQX 2WXRA 3P4QB 3EA6A 4PNYA 1YNTE 2K32A 4IUVA 5DNFA 1FXIA 2QDBA 1PGAA 1RDPD 4IFDH 1GB4A 3C8YA 1S5BD 2PLPA 3PUVA 2W3RA 3AN1A 3KWLA 1EY6A 3E0JA 5DM63 2M00A 1G91A 2N9LA 2MJEA 3FAHA 5JVG3 2IX1A 4HAEA 3MVVA 1H9KA 4QB4A 4ZAIA 5JJZA 4H0LC 1LT6D 3GTQB 4USAA 1JOOA 3MHBA 1SE4A 5LL6X 4KN7C 1KDBA 4IUPA 1EOTA 2N88A 5JXVA 3U9SA 2JA7B 3BS1A 1V43A 2ACZB 1CQVA 5BN3A 2PNRC 4QF4A 4FXGC 5CR3A 2B2UA 4HMJA 3L3OC 1AW7A 4KV6A 5G5HA 1TWFB 2INNE 2F0QA 2R7ZB 1K51A 1TVXA 4NKLA 1WYGA 4NAMA 4NZLB 5KEEA 3OIQA 4MT5A 1IGDA 3H09A 4V0BA 2WLBA 2BB5A 1YNND 2HUGA 4XE0A 4CBVA 2IW3A 1U4MA 4PV1C 1C76A 3P4PB 2JA6B 1ENAA 5C3EB 4WORA 5C4JB 1GXDC 1QF6A 1CM9A 3VA5A 1U4RA 1EZ6A 3H3VC 3Q8EA 1Q10A 1KF6B 3O13A 5M3FB 4NDXA 1HUMA 3GO5A 2FJ2A 1TZOA 3URYA 4O1NA 3X3NA 2RBMA 1PXUA 4ZHPA 1SNCA 1SYDA 3TZUA 3PO3B 1KFYB 4J8QA 1L4ZB 5C0XJ 3Q69A 2H89B 4FP5D 2ZW1A 4HSPA 1TKEA 3L7ZC 4RF0A 3P75A 5C44B 3OW7A 1VRAB 3RZOB 1EWHA 2O4XA 1D5MC 1GAQB 3LNNA 3OHXC 4FVMA 4EQPA 3NTHA 2BCOA 3KF8A 1K8MA 1D1KA 3SK5A 1I4XA 5D7GA 3SK6A 5FLXL 1EY8A 3BDLA 2N55A 5ELCA 3DM1A 2WNMA 1EYAA 3C1EA 1I3QB 4ZQ3A 2W55A 1PZKD 2LFIA 1PZJD 2PYKA 2PMZB 1KAAA 3S1NB 1MSGA 2DNEA 2MHVA 1Y56A 4CJ2C 1E2VA 1NI3A 1LABA 2I2YA 2X69A 1I50B 3E9SA 5EGTA 1LO5D 3AH7A 2BE5D 2J53A 2E74C 2KJXA 1OFFA 3AEBB 3JAME 4G7ZC 2BS2B 3PZ8A 1ZDXA 5CGKA 5EPLA 1GJXA 3W5VB 1NR4A 2G1EA 1EWYC 1R9TB 3H6MA 3EFXD 1KNEA 3MC0B 1JCKB 1SYGA 4YSZB 1GUNA 3H94A 2VUMB 1HEZE 2ICEC 2WDVB 2IX3A 2LJIA 3D3RA 3TEXA 2V4DA 1EY5A 1WSPA 1IL8A 1PYWD 1PLFA 3TP6A 2RDHA 2OEOA 2WXLA 3VR3A 4C3IB 4H2AA 2O2LD 1QE6A 3DWAA 4L23A 5DEHA 1L4DB 1WTVA 1I7HA 2JA8B 5C5LA 2NZ1D 2LMCB 4N58A 2AQ3B 3BIID 5J39A 1ENFA 4IURA 1XO3A 1FYCA 1RWSA 2R61A 4RKBA 1R4PB 3HVZA 1PTOC 3S16B 1CT1D 2QIEB 1UWMA 5C0XI 4A55A 4AQ7A 4ILWA 2JEAI 1N60A 1CI3M 1O7ZA 4KHZA 1BO0A 3CHBD 3S1QB 1HQRD 1E9MA 2EDGA 1VMCA 2F4IA 2IT1A 2RVLA 4Q2JA 1SJED 2YEPF 2WXOA 1WTWA 5HGTA 4C56C 3AE8B 3KBGA 4C1NI 5EBDA 1MI0A 2A6HC 2DWQA 2ONQA 5H92C 2AWOA 2LY7A 1IKLA 1J7CA 1L0YB 5E4WC 4U673 4DAYA 2R3ZA 4WAFA 1ET6A 1STHA 2WDRB 1DONA 2RMMA 2L5TA 3QIAA 5CV7A 4K14A 4DNRB 1PRTB 1EU3A 1PRTD 3D6WA 4IFDG 5D3IB 3QO2A 5M5XB 4RCNA 3L4PA 1HPCA 4CKCA 2WXHA 1F77A 1J7BA 1I6VC 4HCSA 3T13A 1ZOYB 1A3UA 1V1PB 2CW0C 5CYUA 1JWSD 2F0LA 4YIJA 5C3WA 3H8HA 4IDIA 4XDCA 1QOBA 2LFNA 1I4GA 1LTGD 5C4ZA 1L0XB 1MSHA 3SHLA 2EZVA 1Z6HA 1OQQA 4ZUIA 1RODA 1AZQA 1F2ZA 2SOBA 3LB8C 3J7AF 2NUCA 1WTRA 4JX1C 3R8BA 1A15A 2EYOA 4XDDA 1PUTA 2A5HA 1F2RI 4NJCA 2AUKA 3NS1A 1WGKA 2EY1A 4TQUS 3AEEB 5G5GA 3I90A 1EY0A 2LEKA 3ERQA 5I6WA 3KLSX 1B2TA 1QLBB 5T8IA 4K6DA 2L0CA 2K0PA 3BVZA 1V8QA 1RJTA 3I70A 5CV6A 2F0TA 4R9WA 5FOBB 4FXKC 1J9OA 5BYQA 5IGGA 2SNSA 3SR6A 3VR8B 2YU9B 3J81L 2L32A 2XRQD 5G3LD 4WIPA 3ITPA 2N9KA 1HFNA 2F0IA 4WFN3 3RUZA 2Q8IB 1JALA 2L12A 1WTQA 5KIXA 2EKIA 3A56A 3TDQA 3NP8A 2WQYB 4CQNA 4H44C 1ZXTA 5EPJA 1AYFA 1XLQA 2LHEA 3QOJA 1LTID 4TMAB 1TIID 2PPBC 5IT9L 4C2MB 1LLRD 2J52A 4MH8A 1B1ZA 2QF7A 3B2FA 4BY7B 1F2LA 3GTGB 2RKSA 4RKLA 5KNDA 3PUWA 4HCEA 4L1BA 1PDQA 2NVYB 5KYIA 1HZ5A 2F0DA 1AFPA 4I65A 4M1UB 4OL7A 1MD2D 2NWGA 4C3JG 3M85A 2EYJA 1FGBD 1CA5A 5JAVA 1G8ZD 1AN8A 1NUCA 3U7ZA 1DM0B 1F2MA 1MHHE 2JEBI 3AECB 2NMQA 1M4VA 4ZLTF 2RDGA 3IFDA 3K5MA 3PUZA 3HKZB 4DXGA 3PIO3 1ENCA 5CV8A 3K5NA 4P16A 3B2GA 2K28A 4KY7A 3CIRB 2K5PA 3MXUA 2KCNA 2AUJD 2F0FA 1IYVA 2ENBA 4RAUC 1TS2A 4OVZA 3HOXB 4REZA 2C5CA 1OXXK 2A6EC 1R7SA 1C77A 2D62A 4AYBB 4A90A 2ZXOA 4A93B 1DOKA 2GRIA 2WXNA 2W82A 1TWCB 1FXAA 1FO4A 2N7JA 2W54A 2XWJB 2NN6G 4M8AA 4IUUA 3I4LA 4PMCA 5ELFA 1FRRA 5I9PA 2JXMB 1K83B 2WXGA 5EE3A 1DOXA 1UWXA 2HTME 3J7AV 1ILPA 5E6JA 1FCCC 1ZXIA 4LK0M 4JPSA 1N61A 4LJZC 5A2QE 3Q8BA 3AEFB 2Z8LA 1IHZA 4KKJA 3TMEA 2JSVX 3T51B 2JQRB 1YN5A 1SNQA 2F03A 1PGXA 2IJ0A 1CA6A 1KNAA 2DY7A 2EELA 3EGRA 4KGSA 2QCPX 1PMRA 3P4SB 3S2DB 3GV3A 4WRDA 3M4YA 1WCMB 1PFBA 2WV6D 3D31A 2WDQB 3FC4A 3MFYA 3FMCA 4JWUC 3MXGA 1VF5C 3AE7B 2F0VA 4B0EA 3GTMB 2LHDA 4FF4A 2CVRA 2E3TA 1UAPA 4L8JA 1FFUA 2Z1CA 3S2HB 1SB3C 2L11A 1OQRA 1BF4A 3PZ7A 2B8GA 1ESFA 4B9XA 1HTLD 3NBIA 3SK8A 3K58A 2Y5PA 3FVQA 2F0KA 2J7ZA 3N52A 1Q3LA 3AMZA 3J80E 2CW0D 1TWGB 3Q8FA 1JICA 1NCVA 1EL0A 4IFDJ 2PZUA 2M9VA 1T5EA 1PTOF 1VF7A 1LT3D 4XT1B 1E2ZA 5I2YA 3NWTA 1YQ3B 2QMTA 2GB1A 4GDKB 3AEGB 4A3FB 1QOHA 4DF7A 2WXQA 5T1GA 1ZDVA 2M2LA 2EJGC 3PUXA 2NVTB 1AP0A 3C2PA 5K36H 2Q5WD 2EOTA 2SDFA 5BMHA 5IODA 1YNJC 2IGGA 1DXMA 4K2LA 3CU7A 2ZXPA 3HGBA 5HG2A 2IX0A 3VYSA 4RF1A 1HRJA 2JXTA 1QILA 5BYRA 5FR3A 1SYFA 1STBA 3KBXA 4US8A 1O78A 3BZDB 1BCPF 1QWYA 3NVZA 5FO8B 1D5XC 3SDZA 4CKBA 1N5WA 3DUZA 2LUMA 1SE3A 2A73B 3GTPB 2V0GA 1HQMC 5D65A 1TS3A 3N9YC 2PIAA 5A35A 3QG1A 3KLRA 3AE5B 4FYDA 2KEDA 3U52E 2EYFA 1ZYRD 4BS9A 5JEAG 3IFTA 1Y1WB 4ULLA 2FFKB 3VR4A 3T16A 2JYTA 5T1IA 4OZBA 3AU7A 2F0UA 4KK7A 2L52A 3I73A 2ICIA 4RH6A 4K8JA 4MHEA 1Z47A 3M4OB 1FEHA 2WKDA 1T3QA 3P1MA 4YT0B 3PO2B 2VB3X 2PKOA 3DMUA 1Y8PB 4MACA 2I46A 4HJGE 1STEA 1B53A 2IGHA 2X6LA 5IIFA 5IGEA 1C4CA 3AB9A 1G2SA 2HDMA 3C46A 1UNSA 4FXCA 1U4LA 4CHTB 1D5ZC 1GUOA 1EY4A 1ET9A 3H0GB 1NR2A 2MP1A 3FILB 2J4XA 3SXHA 1DJRD 1FM0D 3W9CB 3D8GA 2BOSA 3NPPA 4IOIE 1QNKA 1K50A 1JC7A 1WTOA 3ZJTA 1ICWA 2OF1A 3CQZB 2NYZD 2MPMA 3DWGC 4Q5VA 4C7YA 2KUMA 4YSXB 4DAVA 3KQ4A 1TKWB 1RCVD 1SE2A 4LMQD 1A2UA 1H9SB 4OGQC 1S5DD 2F0JA 3E5SA 3HP3A 2F0HA 1HA5A 2EYPA 1MHXA 4K6LA 5C2TB 4KMUC 4L6TB 1RTNA 3P1HA 5DM73 2J0TD 1OXTA 2L55A 2KDMA 2KN4A 5KNBA 1HFGA 2Q8TA 2IDYA 1AZPA 1II3A 1D1IA 4G4KA 2B2WC 1BMLC 2K22A 2NB0A 1KLGD 3HEJA 5EJWA 3ND8A 2D9UA 3RLFA 4A3GB 1BR9A 4N6EB 2NVXB 1ZE3D 2R6GA 3GP7A 2XRSD 1QOGA 1IYUA 5NUCA 3AE1B 3S1MB 2GA4B 3KUPA 2WXFA 4OO1G 4IN3A 4EQNA 5C0XH 5EKLA 4PMBA 2O5JC 2A68C 1TT2A 3Q22A 1SDFA 3R3OA 4QCLA 3K5LA 5HFYA 1SYCA 5HHDG 2B39A 1FCLA 4X3TA 1SMYC 5JPNC 2PO4A 2D5DA 4DN4M 2H1EA 1KDAA 2WXMA 5IGCA 1IUEA 1JRPA 3HZXA 4R8IA 3U9OA 2PZWA 5M9OA 1WD1A 3QOLA 1HA6A 1JWAD 1ZPSA 1XLOA 1LACA 1X32A 4KY6A 3TEZA 1GPXA 5AUKA 2A69C 2EYHA 4HEDA 3NVVA 2JZPA 4DFAA 5I9OA 3D6CA 1S4ZA 5H8YE 5E1FA 4M0WA 5CC4A 3TZDA 2K05A 2IWHA 2JYEA 5M5WB 1SXTA 2O5IC 1X3PA 2GI9A 4ZOHC 1JOQA 3A8KE 3NUCA 5EQ0A 3TUOA 2L9HA 1XLNA 3RD4A 1G6ZA 4IQZA 3M7GA 3VR5A 2F0PA 2BS3B 2Z4HA 4CJ0B 2BDOA 3AB5A 1O80A 1E6EB 1Q12A 2DBYA 3A7LA 1CZGA 3ZJVA 4TSSA 2RDFA 4HR7B 4RGTA 2WACA 3UI2A 1NYRA 4ZRZA 5FK9C 5EKKA 1GUGA 1NAPA 2M56B 2B2WA 1Q90A 2E2JB 3KWVA 3Q8CA 5JOBA 1F9PA 1C4AA 4ID6A 4O42A 1AEXA 4FO2A 1YMHE 1NSNS 3FEWX 3LYYA 1BCPC 1SF0A 1STAA 2E6XA 2VZKD 2OEDA 3PO0A 2NTTA 1QCBD 4C3HG 1OO9B 2KOLA 1KLUD 4TQ0A 3VR9B 2L83A 2PVOD 4AS1A 1SYBA 1VCIA 3CRKC 1BUVT 3I72A 2IPKD 4ABNA 4TRDA 3A8IE 2BBCA 2RSOA 3AEDB 2DNCA 2KCCA 1GHJA 5DAUA 1ESRA 2MGSA 1C4PA 1EU4A 1STNA 3OMGA 1VR9A 2F0SA 2EXZA 1HCZA 2B63B 3W2DA 3IKJA 3TEWA 2JU6X 1U9RA 2I07B 2HDEA 4LK1C 5C6AA 4KKIA 3B9JA 1ZXHA 1VDVA 1B9NA 4HTHA 2WIIB 3BVMA 1GHKA 3MXPA 1RD9D 5JEAJ 4ARIA 1WVLA 3OSOA 5FLXE 1LTAD 1C4QA 3BVGA 1PFDA 1DOYA 3K57A 2K03A 1PGBA 3GTKB 1KABA 1A70A 4ODGA 4XQNA 1JW9D 5I2XA 4IZ8A 3GQBA 4U68A 1OXUA 2OXPA 1TKGA 3RPFC 4DNTB 5BN4A 1C8CA 5C5MA 1XXGA 3H91A 3FKIB 1XF5L 4XQJA 1TWHB 3EQLC 5ELDA 1DGJA 3LWEA 1J8IA 1L6UA 4RA8A 5KYLA 2WP9B 1IBXA 4KGTA 2WINB 1K53A 3AV8A 2TSSA 5ISRA 3WOFA 3IL8A 3IAM1 4EVOA 5J1ZA 1PRTF 4OIJA 3BWUD 2H88B 2JSOA 2PTLA 2FINB 3IT6B 3DHQA 1L6VA 2SEBD 4BY1B 3DWPA 2ZXRA 4KKSA 1YJIA 3KK7A 4TKOB 1D2BA 4WJWA 3HOYB 1G2TA 1N5XA 2KMMA 1EM7A 1GUSA 2QEJC 2CHBD 2F3WA 4IUQA 2KA7A 2PCFB 1L5PA 4GZYC 4J1MA 4ZYSA 1LTTD 3D4DA 4WWMA 3BYYB 4KKUA 1QKZA 5EE9A 1SMYD 4C3JB 1CFMA 3AM9A 2BTEA 3NUHB 1D6EC 4XXEA 4OIKA 1S5CD 1VZ6A 1VLBA 3S1RB 4IALA 3ZGZA 2KQ3A 5M5YB 2K01A 2MJ8A 4UAIA 4XT3B 1JWBD 1D4BA 3HS0C 3P4RB 4KHVA 2FE8A 4OZAA 1LTSD 3MP9A 2XSCA 2XWBB 2B2TC 1SEBD 2X6GA 2D5GA 4MIUA 5BMIA 3ND9A 5ELEA 3AE2B 2DYMA 3ZJUA 1JE4A 1KDCA 4Y7NB 1STGA 2XIWA 3T3OA 2WB1B 1ILQA 4RWSC 3V3XA 4P6VF 3TSSA 3RMHA 3P20A 3G6JB 1N62A 3I3CA 3CWIA 5HI1A 2JX5A 1K8OA 1STYA 4X3KA 1QNUA 1N63A 5G3LF 4ZUJA 4YTNB 5HURA 1EEFD 1PTOB 1PTOD 1TS4A 2NTSA 1DCZA 4RHRA 5TSSA 4NAWB 5BMGA 3TP7A 4XIGS 2WAQB 1MI2A 5CV5A 2FBWB 1SFOB 1FD6A 2L1BA 3FPPA 1A6XA 1Y8NB 1H9RA 3TEYA 1W6JA 2JA5B 3U2SC 4ZKCB 4WH4A 1EYDA 2KHSA 4QUCA 3MWYW 2A6HD 1BCPD 1IBXB 4F88A 2EY2A 1EWCA 2F0MA 3VR2A 3NTIA 1F0ZA 3I8ZA 1A3TA 2D2CC 1EQTA 4RGOS 4CKEA 1OXVA 2FHTA 1MPEA 3P63A 4B0MA 4HKZE 2X38A 1FIQA 1QOAA 4F8MA 1EEID 4HEA1 3MA2B 1TYGB 2ZW0A 3I91A 4C7ZA 4FNFA 3WOEA 1OXSC 3HOWB 3K0YA 3GB1A 5CV9A 2B2TA 1EIGA 3PMFA 2K04A 2WU2B 1NEKB 2SAKA 3J81E 5M3MB 1RHPA 4KI0A 3MXNA 5JVH3 3MEHA 4XDXA 5EE1A 3A54A 3K6OA 1BQQT 3BK1A 3R93A 5JPMC 1C78A 1I4QA 4DQOC 3VYTA 3JAML 5LL6S 1XLPA 3NSWA 4UDUC 1SSOA 1FFVA 3A7AB 2CJNA 5C3JB 3EUB2 3DEOA 1VZ8A 4L2YA 3PV0A 1PFNA 4ZK9B 3WCQA 5D3DA 1JWMD 1XX8A 3VA7A 4RFBA 1F2YA 3RZDB 5C3XA 2B2VC 3QWNA 2INPE 3OOCA 4C1NK 3C3LA 1VJKA 4GLSC 4ITKA 2MJ3A 1SIJA 2F0NA 5EPKA 1HZ6A 5J22A 1HXYD 3ZYYX 4RGMA 4J6HA 3R2IA 1CHPD 1PRTC 1CHQD 1JB3A 3Q24A 4YSYB 3VRBB 3RFZB 5E4XA 3VR6A 5FO7B 1I4RA 1ZUD2 1X3QA 1ACCA 1B9MA 3W3AA 4R8NA 3I57A 4A9AA 1DOLA 3PUYA 4KJNA 4FF1A 3LXFA 4KD4A 2B76B 2KVMA 2K5DA 1I4PA 4HRSA 1L0VB 2Y3AA 4B9WA 1HTPA 1WD0A 5IOCA 3DEPA 2F0GA 3ONAB 1SBBB 4A3JB 1V97A 2FMMA 1DZ1A 4IKGA 1BDOA 4DK1A 1VDZA 2K5QA 2BA1A 1KTKA 3A55A 4MM3B 2K1BA 3IAYA 3HRZC 2SNMA 4YWGG 4WURA 1RYJA 1JMLA 1EY9A 4KKTA 3I4NB 4RCOA 2LMCA 1C79A 3K59A 4OZCA 1O7YA 3G7LA 4A6QA 4BA1I 5BN5A 2ON8A 4N9PA 4DA2A 2RQXA 4IFDI 5LNK1 3HG9A 1DD2A 3VYRA 2QJLA 3HOVB 1FNVA 3EROA 1H9JA 2B8FA 3WDNA 4DXFA 5KRUA 4A3IB 4JK1C 4I7ZC 2A6ED 2EYLA 4H13C 2PZTA 3VYUA 1CTMA 1FR3A 2R92B 3SR1A 3SFEB 4YXDB 2V4IB 1T6BX 4R3DA 3TP5A 2B2VA 1KH0A 2TMPA 1T5XD 3LWUA 1NVID 3K5OA 1JROA 5KGUA 4QMGA 4KTAA 1F9SA 1EZ8A 4KD3A 4G57A 4X3SA 4FF3A 2JYOA 3EJIA 3TBIB 2J42A 2BB6A 1SAPA 3W5UB 2EVBA 4K5WA 3NTKA 3AMUA 2CJOA 3D4WA 3BG3A 2YEPB 2Y0SB 2NVQB 5EKIA 3IXSA 1Y69U 2W3SA 1SJHD 3MFGA 3SFDB 1B9RA 2EY6A 2Y5CA 3AE6B 2IGDA 3NK9A 2PW5A 4BBRB 4HROA 2JE6I 3BK2A 1HHVA 1V1PA 1MVKA 3TP8A 1QOFA 3SE0A 1YJJA 1EQVA 1RM6C 1WWTA 3P42A 5I4DA 1RFKA 1XEEA 1NENB 4CGYB 5BYSA 2PVGC 2V3NA 3GS2A 1JQYD 2AWNA 2HCCA 3L9AX 2DLBA 1MBYA 5CBEE 5AFWA 2KWDA 3GV6A 5EE0A 3AE4B 1CJEA 1BXTA 2CU3A 2WP8J 4H7BA 2NN6H 1WTPA 1E10A 2G9HD 1M8AA 3DWQA 3M7NA 1QT9A 4A3DB 2WXIA 1SSNA 1I6HB 4MN3A 2F0OA 1TS5A 4A3KB 1HUNA 4NMZA 1PTOH 1SNPA 4C3IG 1V8CA 2B2YC 3X3MA 4EE2A 1QQRA 5LHY1 1SNMA 1GOZA 2FMCA 4PT5A 1V1OA 4DK0A 4RGNA 2RA4A 1BNZA 1RTOA 4XWWA 2EJMA 2H4OA 2C9OA 2K3UA 2HCIA 4XQQA 3FPUB 4ZRQA 3VRAB 1Y8OB 2I38A 1GUWA 4KY5A 2XNAC 4DAPA 5C4HA 1LT5D 2BA0A 1GUTA 2F1MA 2RSNA 4QIWB 1S5ED 2VB2X 1B3AA 3P7JA 2M19A 4NW2A 1B50A 2E2DC 2PQEA 1IW7C 1TQOA 1EYCA 2VZKB 4XYOA 4X3UA 1CZWA 4DU9A 2K5WA 1JR0D 1YN4A 4ARCA 1ML0D 2K9XA 2E2IB 2KACA 3FDTA 4FF2A 1YNJD 1BUIC 1LTRD 1U4PA 2NN6I 4C3HB 1H9MA 1BOSA 1PZID 5K36G 5E3FA 1F2RC 1BBXC 3ABVB 1Y1VB 1F9QA 3SEBA 1LV9A 3OWEB 1DYQA 2BDNA 3F2UA 2BW2A 1KRHA 1B4OA 2ZT9C 4FXDA 1IGCA 3S15B 2XVSA 2E76C 1VMPA 4HN7A 3NQIA 1EFID 3EVQA 3TN2A 3GTLB 4YTPB 1JORA 3J9CA 2WXJA 2YYZA 1XTCD 5A2QL 2HQEA 4XWTA 3DXJC 3LX0A 2WXKA 3HUIA 2DYOA 3OWFA 3S17B 1UGJA 1A2TA 2QSDA 2L4NA 4N9TA 4XYQA 1E7PB 3E6ZX 5IGBA 3QJYA 3VQIA 3T53B 2L1AA 1UUPA 3OMCA 4ZKBB 4WQMA 2B2YA 4K5VA 1SNDA 2A74C 2MJDA 4K8IA 1ONLA 4JE3B 4Z9CB 1UEAB 3NHHA 1QG7A 3I4MB 1RF2D 3AE9B 3IAS1 5GXGB 1W6KA 3BDOA 1DOIA 1VZ7A 1G291 3ZQ4A 3NWSA 5IGFA 3E56A 4KN4C