4JGHB

Structure of the socs2-elongin bc complex bound to an n-terminal fragment of cullin5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor of cytokine signaling 2
publication title Structural basis of intersubunit recognition in elongin BC-cullin 5-SOCS box ubiquitin-protein ligase complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 23
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4jghB00
2V3SA 2KTRA 2CHWA 4ICVA 3MHSD 4GXBA 3ZDMC 3ML9A 4LJOB 4URKA 2KJHB 2UYZB 3A9JA 2BKRB 2JRHA 3Q3JA 4WJQA 2KJRA 2NS5A 1VD2A 1XT9B 2CHZA 5J18A 2K39A 1YX6B 3ZNHB 4HLEA 3JYUA 4G11A 1RFAA 2LVOA 2IYDB 4EZLA 3L17A 3ZNGC 2MRPA 3L0WB 2MP2A 2IO0B 2RSUA 3OAWA 4ANXA 3RZWC 2KDFB 4EUTA 1H8CA 5G2NA 4K7UA 4N9F4 2IO1B 4NAWB 1E8YA 1J19A 1LM8B 4GOCA 1AARA 3H9DA 2JWZA 3PVLA 1VCBA 4BKSD 4IWQA 1NI2A 3ZW3A 1GJZA 2UWQA 4WAAA 1WJNA 2FIDA 5GMVA 2N1WA 1V86A 1WR1A 2KTRB 2O2VA 4WJNA 2KLGA 4NY0A 4DHZB 1X1MA 3ZNID 4M8MA 2D2QA 3ZLZA 2ZCBA 3VXWA 3HK0A 4II2B 1OQYA 1UELA 2DENB 1XQQA 1WJ6A 3CSTA 2JZZA 3A9JB 2FCMA 4BOZB 3W1SA 3QJZA 1F9JA 3UGBB 4RM9A 4ANUA 1WZ3A 3L13A 1E8ZA 2K8HA 2KO3A 5CTRC 1WXAA 2CS4A 3HHMA 4GDLA 2K6DB 2MP2B 2K1FA 4CYEA 4CHKA 2PPHA 2Z0EB 1V80A 4FN2A 1YX5B 4FULA 3I3TB 5HKHA 3PTFC 4HJKA 4ANWA 2K8CA 3PRZA 2KX0A 2C7MB 4TV3A 1P0RA 3IHPC 1WM2A 2BF8B 2DZMA 1V2YA 1WZ0A 1K8RB 3U8ZA 1C3TA 2N4FA 5L95C 2HTHA 2J0MA 2O2VB 4KVGB 3QA8A 3PLUA 3PSEB 2KK8A 3VUWA 4DXAB 3V60A 3RULA 2A5UA 3NS8A 3TL5A 3PZDA 2JUOA 2V1YA 2FCQA 4IWPA 1OEYJ 1E7UA 4GN1A 2DYMA 2GMIC 2PE9A 3DBSA 2YLMA 4ANVA 2KD0A 2G3QB 4B6WA 1TTNA 2AWTA 4GMVA 3WA0A 2HJ8A 4GDLB 4BKSA 3TIXA 1E8WA 3GZNI 2ASQA 2LVPA 4AJWA 3DBLI 3AU4A 3M63B 2KKCA 1Q5WB 2LRWA 1S1QB 4EZKA 4DDGD 2D3GA 3ZVVA 2ZCCA 3QWZB 2BKFA 3QCAA 2RR9A 3RCZA 1FXTB 1Z2MA 5KHQA 4ZDVA 2MBQA 5D94A 2NBUA 1WGGA 5LXIB 2B3AA 4JIOU 3VTVA 3UF8A 2HD5B 1RAXA 4MSQB 1GG3A 4BBNC 1J0GA 4G50A 2L7RA 2G4SA 1UD7A 3APCA 3NZSA 5J2RA 4PS3A 4LJPB 1IYFA 2FCSA 2L76A 3BINA 3PPAA 4MGZE 5C1ZA 4MGKE 1CMXB 1WJ4A 2KC2A 4MSMB 4AWJA 4MH0E 3MTNB 3CMMB 2KNBA 1WGDA 2LUEA 4X57B 3CSFA 4IUMB 1TGZB 2JPHA 1WE7A 4IW0A 1G6JA 2GBRA 3DVGY 2V4LA 2C9WB 2BGFA 3KUCB 3PHXB 3EC8A 4W9IA 1V81A 2GBKA 2MLBA 2WYQA 5D6JB 2M0XA 1TZ1A 3A33B 2D07B 2D11A 1WGYA 1IP9A 1SIFA 4NQKE 1M94A 3H7SA 3ZRCA 4ICUA 3B08A 3WALA 1KLVA 4TKNA 2BWES 4JL9A 3NHEB 2LVQA 1WM3A 1E90A 3X0WA 1LXDA 1WJUA 2I1JA 2IZVB 1UZXB 4E71A 2CHXA 4W9FA 1WMHB 4MGIE 1ZGUB 4TQ0A 1WE6A 2N9XA 3PS6A 4W9HA 4HDOA 4K7SA 4MGYE 2NR2A 4BKTA 3HM3A 2D10A 4K7WA 3VFKA 2AEHA 2PJHA 2ZPYA 1Q0WB 1A5RA 4WWPA 1V49A 2IO2B 1OEYA 5DPTA 1RRBA 3QARA 4PYUA 3K9PB 2C5LC 5D2MB 3S2AA 3PT2B 3U7DA 5G55A 5JZEB 2EMSA 4GGQA 1J8CA 4FLHA 1WGHA 4W9JA 1C1YB 3QAQA 3QIJA 4KDIC 5AZHA 2GBJA 1JRUA 2JRIB 1V9JA 2LD9A 4HCNB 4IM0A 3WIMA 4DHJB 3OJ3A 2KXJA 2Z0DB 5CX3A 3DQVA 4W9DA 4E74A 4M0WB 4OVUA 2KX3A 4A3PA 2C7NB 1UBQA 2ZNVC 3CF6E 2L05A 3PV1A 4HCPB 3UIPB 1I42A 4GDKA 1PQSA 2KMCA 1T0YA 2LXCA 1P9DU 4B95A 2WX0A 3L54A 3VTWA 1EUVB 3AXCA 3LJ3A 4EZJA 2ZPNA 2LGDA 3APDA 2KANA 4MDKE 3ZIMA 1WXMA 3VAWA 4MM3A 4EFOA 3KYCD 3QC8B 2NVUI 1BT0A 3O65B 3ECIA 4M8NA 1Z5SB 1WI0A 4KDLB 3TJPA 1GNUA 2DAFA 5E6PA 2KDBA 3SU8X 3C0RB 3KW5B 5CHVC 3VQIA 2DZJA 3KUDB 2MBOA 1E8XA 2OJRA 3D32A 3IFWB 3ONSA 4MEMA 4A3OA 4MJSB 4BKGA 4DHZE 4DHJD 2N7DA 4NQLB 1YQBA 3RUIB 4OVVA 2PEAA 3IG3A 3T9LA 4IWOA 3W1YA 1WF9A 4GDKB 4YL8A 5TR5A 2DYOA 2WDTB 2L00B 2MBHA 4I6PA 4G3XB 2DHZA 5LXHA 2BPSA 3ML8A 2IBIB 3TBLD 4JGHB 4LDTD 3SDLC 3P2BA 4NJ6A 4MELA 2MA9B 4GU2A 4DDID 3UIOB 2KDIA 2ZVOA 5L83A 3V61A 1LQBA 2N9EB 3SD5A 1I35A 2NBVB 3SHQA 1SE9A 3KVFB 1WH3A 3R7QA 1NDDA 3AI5A 2A4ZA 2GBMA 1ISNA 2GOWA 1WMHA 2NBWB 4ZYNA 1XD3B 3KUZA 4HWIB 2C60A 2EMTA 3NZUA 2O6VB 4RMAA 1UBIA 4P7IA 1LFDA 2RGFA 2W9NA 4RM8A 1S3SG 1Y8RC 5EDSA 4ZRKA 3QX1A 2XEWA 1E7VA 3PGEA 1QZEA 4KSLC 2KC1A 4GIVA 4ZRIA 3RD2A 3N30A 3UQBA 1Q1OA 3DCGA 2LWPA 3A9KA 3WANA 2M4NA 4AJYB 3PRMB 4FJZA 3WAPA 1WRDB 2BWFA 4IM2A 1WGRA 2LI5A 4EEWA 2DAJA 4ASWC 3R66C 2LXAA 3K9OB 3M62B 4KV2A 2RPQA 1R4NI 3U30A 2FUHB 3Q3FA 4XX5A 5DPSA 4K1RB 2MWSB 3R3MA 3EHVA 3EFUA 3QK0A 2JF5A 4W9KA 4FA6A 4FBJB 2N7EA 2DZKA 4FJVB 1P98A 3IBEA 1V6EA 5JH5C 2LZ6A 1IPGA 2KQSA 2JZ3B 3V6CB 2DX5B 2WWZA 2ZJDA 1WR6E 2KVRA 3GOEA 3BY4B 2MW5A 3QQ8B 4KZCA 3WAOA 2FIFA 5JHBA 2ZEQA 4AP4C 3RZFA 4PS7A 1EF1A 2KFKA 2O6VD 3X23A 2L0FA 1KOTA 1R4MI 1YIWA 4CO7A 2KMAA 3PHWB 4DWFA 2NPTA 5IA7A 4W9EA 2KHWB 3VTUA 2ZNVB 3A9KB 2BYFA 2M1MA 2Z59B 4HXDA 2KWVB 2KTFA 5E6NA 5DPRA 4PS8A 1ZKHA 2IY0B 2KWUB 3OLMD 2OOBB 4K81A 3UQAA 1TBEA 3KH0A 3T8MA 4HPMB 4IG7B 5CHWA 2BYVE 1GC7A 2VRRB 4MJSA 2LRUA 5J17A 1WYWB 2QHOA 2L0TA 3AULA 3JVZX 4J6IA 2JVCA 2KN5A 2CKHB 3JSVA 4KZ0A 3A4SC 1D3ZA 4JLCA 3KYDD 1V5OA 1SGHA 1GC6A 5CHFA 4LDTB 2MX2A 2REXA 3H7PB 1WFYA 2AYOB 3ALBA 2BYEA 4I6LB 3EECA 3ZKJC 5E6OA 3H1UA 1YD8U 5KHOA 3DVNV 3DOWA 4F8CB 2KWCA 4I6NB 2L8JA 4WJPA 2KFKB 3ZTDA 1U4AA 2WX1A 1WX8A 3DVGX 2NPTB 3PLVA 1WX9A 1KJTA 1V5TA 4BBNF 3ZDTA 4F7ZA 3B0AA 3UINB 1OGWA 4FJYA 3V62A 3VH4B 2FCNA 2HE7A 2K8BA 4TQ1A 4HDQA 4WWOA 2J0KA 3ZTCA 4AUQC 4B9KA 2LASA 2JY6A 3ZNZB 4XC2A 4AOFA 2LGYA 2R2QA 5DCNA 2FNJB 1GUAB 3HM6X 3HIZA 2IY1B 1MG8A 3JSVB 4ZRJA 2O6VA 2KJ6A 3L16A 3NOBA 2EKEC 1YJ1A 4NPNA 1EO6A 4NJ7A 2MCNB 2MQJA 5AEKB 3MJWA 5D7GA 3DDCB 4G0NB 2GBNA 1ZW7A 3L10B 3V6EB 2XK5A 4DBGA 3TMPB 3A1QA 3OJ4B 1EF5A 2ZZPB 4W9CA 3IVFA 1KM7A 2FAZA 1UGMA 3DBHI 3R7RA 2M17A 4HPLB 2PE6B 3APFA 5LLIA 3VUYA 2G4DB 4F1SA 4W9GA 4KIKA 1L2NA 3DPDA 2C7HA 3ENEA 4KSKC 3VH3B 3N3KB 4IC7B 5BO4B 2XBBC 4FHKA 3M95A 3PRPB 1E5WA 2L3ZA 3LDZE 5AZGA 2JXXA 2N1VA 3RYTA 3VUXA 2KLCA 5IAAC 5DPWA 2IO3B 2NCNA 3JW0X 3NY5A 3ZUNA 2LJ5A 2AL6A 2KDEB 3DBRI 4JQWC 3VHTC 3RT3B 1OTRB 2DYBA 2J7QB 3W1SC 3B1LX 2ZVNA 2J0JA 1UH6A 1WX7A 1HE8A 2KFJA 3QHTA 1P1AA 4BVUC 3TCAA 4GSWA 4BOSC 3VVWB 4DK5A 4HK2A 3WAMA 2JT4B 4IM3A 2KZRA 1L7YA 3H6NA 3L08A 2N9PC 4EKUA 4FADA 1RLFA 2XK5B 2K6QA 3M3JA 4WQOB 1WIAA 3A1QB 4A20A 2Y5BB 2DZIA 4NNJB 4GB9A 4E3CA 2K25A 4XZ4A 3N32A 3ZO5B 4EOYA 2R2OA 1P3QU 2G45B 2MBBB 1H4RA 5FR6A 4W9LA 2AL3A 4KIKB 3ZRFA 2I1KA 3PREA 1WY8A 4FHJA 2KQ7A 5JHAA 4BFRA 4WJOA 4NAWA 2M8SA 2LGXA 3A4RA 4LCDE 2MSED 2CU1A 2YVCA 2KOXA 2CR5A 3AU5A 4HVBA 4TUUA 5C23A 1WXSA 3H7PA 4PYZA 5AZFA 1NBFC 4WWNA 4II3B 2RD0A 3DVNU 3VDZA 2MBEA 1WXVA
chains in the Genus database with same CATH superfamily
2V3SA 2KTRA 4JPSA 3DWMA 3OWEB 4GXBA 3FILA 3ML9A 4LJOB 4URKA 2UYZB 2KJRA 1VD2A 2CHZA 5J18A 3HVDA 4RF0A 1D5ZC 2KQ4X 1C79A 1R4MB 1RFAA 2LVOA 2RSUA 1H8CA 5G2NA 5BMGA 4N9F4 3IAS1 4NAWB 2Y5PA 2IDYA 4GLSC 1HTOA 3PVLA 2HDEA 3ZW3A 2FIDA 3H8HA 4DHZB 2RPVA 4WJNA 4XWWA 3ZLZA 3HK0A 4LLGM 2JYTA 1UELA 2JZZA 2FCMA 3RFZB 3QJZA 2WDQB 2K0PA 3Q2AC 3L13A 2K8HA 2KO3A 1UNSA 2CS4A 4KX6B 1YX5B 3PTFC 1JRPA 4HJGE 1JW9D 4TV3A 3DHGC 1WZ0A 1F2RI 3W5UB 2N4FA 2HTHA 3TEWA 4KVGB 1C4CA 3AEEB 2JUOA 4YSXB 3KWVA 4IWPA 1VR9A 4REZA 2PVGC 1IUEA 4ANVA 5C3JB 1Y56A 4GMVA 4ZYSA 3I57A 3DBLI 2LRWA 4ACFA 3TEXA 3B2GA 2D3GA 3ZVVA 2RDGA 2BKFA 1M4VA 2WXQA 1HZ5A 5D94A 3AH7A 3ZJTA 3DBLB 3SR6A 5LXIB 3U52E 2B3AA 2J53A 1JROA 4BBNC 4G50A 4XGAB 2L7RA 2G4SA 1UD7A 3APCA 3NZSA 2LHDA 4PS3A 2I2YA 1IYFA 1D5MC 3BINA 3PPAA 2FCSA 2INCC 3I63C 4LTUA 1FPYA 3CMMB 4BAXA 3CSFA 4A8XC 2GBRA 3DVGY 3TSSA 2C9WB 4W9IA 2MLBA 2D07B 1SIFA 4NQKE 3H7SA 4LNIA 4ICUA 3E9SA 3WALA 2BWES 2BT6A 1WM3A 2I1JA 2CJNA 1UZXB 3HUIA 4W9FA 1NVID 3BYTB 1WE6A 3PS6A 2BS2B 3HM3A 2D10A 2ZPYA 2NMQA 1A5RA 1V49A 1OEYA 1RYJA 2EELA 3U7DA 1TKGA 1WGHA 4W9JA 1C1YB 2K3UA 3ZJVA 1I4QA 3AMZA 1JRUA 1FCLA 4DHJB 2RDHA 3OJ3A 5CX3A 3DQVA 4E74A 4OVUA 2NTSA 3C19A 1UBQA 1I42A 3UIPB 3Q6BA 2KMCA 2WXNA 3L54A 3VTWA 2PW9A 2LGDA 2L83A 2KANA 1J7AA 1WXMA 4MM3A 1PGAA 3KYCD 4OVZA 2M19A 3ECIA 4M8NA 4KDLB 1C77A 4O1NA 3TJPA 2MEKA 3C0RB 3PZ7A 5CHVC 3VQIA 2MBOA 1DGJA 4DHJD 3W1YA 4IWOA 1WF9A 1P7FA 2K5PA 2INDC 3NJTA 5LXHA 2BPSA 2IBIB 1SE4A 1TY0A 1K51A 2QILA 2V4IB 4GU2A 1XLNA 4DDID 1N60A 3MHZA 1VZ6A 1LQBA 2CU3A 3SD5A 1I35A 3SHQA 3GZNB 1SE9A 2IGHA 2WXMA 1FD6A 2JXTA 3AI5A 4XDCA 2MH7A 1WMHA 4N59A 1NI3A 1XD3B 1T5XD 1QOGA 2X38A 1GAQB 1SSNA 1L0VB 1LFDA 2MJEA 2RGFA 5EDSA 4YSYB 3QX1A 3PGEA 4WIPA 4ZRIA 2KC1A 3SFDB 4P1CC 2QC8A 3DCGA 2LWPA 3WANA 1XLQA 5IP4D 3WAPA 1WGRA 4EEWA 4NZLB 4L2YA 3R66C 3J9CA 1R4NI 5DPSA 3ZXRA 3BVGA 4K1RB 3P4PB 2N7EA 1F77A 1QOAA 2WWZA 2ZJDA 1R4NB 3BY4B 1MHXA 2ZEQA 4AP4C 1ZPSA 2PTLA 1YIWA 1C4PA 4CO7A 4DWFA 2ZNVB 2M1MA 2Z59B 1P7EA 2KTFA 3NVVA 1IGCA 5E6NA 5DPRA 2JQRB 2INNE 1IGDA 4ARIA 1GC7A 2VRRB 1WYWB 3VRAB 4J6IA 2JVCA 1XO3A 1D3ZA 2ZW1A 1SGHA 2MX2A 1F0ZA 3AE8B 2Y3AA 4XYCA 3ALBA 2BYEA 4XE0A 3ZKJC 2MJDA 4M00A 3ZTDA 2KFKB 1QLBB 2ON8A 3CIRB 4OZCA 3UINB 4B0EA 2HE7A 4AUQC 4B9KA 1STEA 2JY6A 2LGYA 2R2QA 3HM6X 1MG8A 3JSVB 3AE4B 1EO6A 4NJ7A 1MG4A 2MCNB 3DHIC 5HHDG 3A1QA 4C80A 1KM7A 1I4GA 3R7RA 1EM7A 3AE1B 2V9HA 3DPDA 1MHHE 5BYRA 1ZXHA 4UDUC 1PUTA 4YWGG 2N1VA 3Q3NC 3RYTA 5IAAC 3NY5A 1HQRD 2KDEB 3VHTC 2WXIA 1OTRB 1N62A 4BVUC 1HE8A 2KMMA 4GSWA 3W9CB 3WAMA 1KLUD 2KZRA 3H6NA 4FADA 5H8YE 1RLFA 2K6QA 2DNFA 4GB9A 4US8A 2QIEB 2R2OA 5JHAA 2DLBA 4BFRA 2LJIA 3AM9A 3VRBB 2M8SA 2L52A 2LGXA 2JZPA 3A4RA 5EE3A 2GI9A 2IGGA 4PK1A 1HTQA 1WXSA 4PYZA 1NBFC 4LNOA 4WWNA 2L32A 2KVZA 3ETRA 5IN7A 4YXDB 3ZDMC 3LB8C 1N5WA 3A9JA 4C00A 1EWCA 2VZKD 1XT9B 2K39A 3L17A 5FK9C 2MP2A 3I9V1 3OAWA 4TMAB 1HEZE 2IO1B 2M56B 1CQVA 1XLOA 3P4QB 1VCBA 3NVWA 4C4VB 1EU4A 3NVZA 1WJNA 5GMVA 1SEBD 1WR1A 2O2VA 2KLGA 4NY0A 3ZNID 4M8MA 2ZCBA 1E10A 4II2B 1OQYA 3AECB 2DENB 1WJ6A 3CSTA 3UGBB 1WZ3A 5HI1A 3SFEB 4GDLA 2K6DB 2K1FA 4CHKA 3NS1A 4FULA 3I3TB 5BMHA 2K8CA 2PVOD 4WQMA 1VDVA 3PO0A 1B9RA 5G5GA 2BF8B 3NVYA 1C3TA 3RNFC 1R7SA 3Q3OC 1ESFA 4C7ZA 4LNFA 4XWTA 3PSEB 3VUWA 3W5VB 4DXAB 3V60A 3NS8A 3TL5A 1GOZA 2KACA 4GN1A 2DYMA 2GMIC 2PE9A 2YLMA 3GS2A 2N7JA 2G3QB 4B6WA 2AWTA 3WA0A 2HJ8A 4BKSA 3FAHA 3AU4A 2B76B 1V1OA 4MM3B 1S1QB 3QWZB 2MBQA 2N9KA 1DYQA 3VTVA 3UF8A 1RAXA 3DBRB 2PMVA 1GG3A 3RPFC 1L0XB 4LJPB 2BB6A 2L76A 1C4AA 5D3IB 1F1HA 1WRIA 1WJ4A 4HROA 2LUEA 1TGZB 1WE7A 2W54A 4QAYA 2V4LA 4C56C 2WGSA 2GBKA 2WYQA 5D6JB 3A33B 1KFYB 1HXYD 3ZRCA 1YJIA 1KLVA 1FNVA 4JL9A 3NHEB 2LVQA 2PIAA 1WJUA 4E71A 1WMHB 4HDOA 4K7SA 4MGYE 1E6EB 2PJHA 2IO2B 5DPTA 1RRBA 1ENFA 3K9PB 5D2MB 4ZRQA 3R2IA 5G55A 3HVZA 3IT6B 5FKAC 3QAQA 5AZHA 2GBJA 4IM0A 1V9JA 2KXJA 2JYEA 4M0WB 1JWAD 2KX3A 3Q3MC 3CF6E 4HCPB 3U4EG 2LUMA 3BZDB 2KAJA 1EUVB 4WH4A 4EZJA 2SEBD 2WQYB 4RH6A 3OG5A 4P1BC 1WI0A 1YMHE 1GNUA 1L4ZB 2KDBA 2DZJA 2K22A 1E8XA 2OJRA 3D32A 3ONSA 4MEMA 4DHZE 2N7DA 1YQBA 3T9LA 3B9JA 4GDKB 4YL8A 2DYOA 1PYWD 2WDTB 2L00B 1I4PA 2MBHA 4I6PA 3Q8BA 1GB4A 2L1AA 3TBLD 2WXHA 1CK1A 3TUOA 4MELA 4OHJA 2NBVB 5BMIA 3KVFB 1NDDA 2A4ZA 1ISNA 2BTEA 4ZYNA 1JQ4A 4P7IA 1ROEA 4A90A 1Y8RC 4ZRKA 1DOXA 3RNCC 1OQRA 2M4NA 4RGNA 2BVCA 4FJZA 2WXGA 4N6EB 4IM2A 2DAJA 4ASWC 1HA5A 2LXAA 3M62B 4KV2A 1TS3A 4XX5A 1FNWA 1YOVB 1JMLA 2MWSB 3R3MA 3EHVA 2JF5A 3BK1A 2GB1A 1P98A 1ZXIA 1SXTA 5JH5C 2LZ6A 2PKOA 2DX5B 2FIFA 3RZFA 1EF1A 2AX5A 2L0FA 3WCQA 3PHWB 2NPTA 5IA7A 2KHWB 4K3CA 3A9KB 2KWVB 4R3DA 1F52A 1FRDA 1ZKHA 2KWUB 4K81A 3UQAA 3TEZA 3KH0A 3T8MA 4HPMB 4IG7B 5CHWA 4MJSA 2LRUA 2QHOA 2L0TA 4N58A 2KN5A 2CKHB 3A4SC 5IOIA 4P16A 1KTKA 1GC6A 1FRRA 3N1XC 5I4DA 2REXA 1JALA 1ZE3D 5E6OA 3H1UA 1YD8U 2WXOA 1BMLC 2KWCA 2RMMA 4I6NB 2WX1A 4NJCA 1ET9A 1YNTE 3DVGX 3PLVA 1B1ZA 1V5TA 1TS5A 4F7ZA 1N61A 3T3OA 3VH4B 2J0KA 3ZTCA 1QOFA 2BS4B 4XC2A 5DCNA 1I4RA 2O6VA 2KJ6A 3NOBA 2EKEC 2AQ2B 3RNEC 1I4XA 2MQJA 3DDCB 4G0NB 3L10B 1ZW7A 2XK5A 2QDFA 3OJ4B 1IBXB 2ZZPB 4LNKA 4W9CA 4JE3B 2V0GA 5EE9A 1PGBA 2PE6B 3APFA 5LLIA 4W9GA 2C7HA 3ENEA 4WWMA 4KSKC 3N3KB 3P4SB 5BO4B 3M95A 4WURA 5E6JA 2RDBC 1SE3A 2JXXA 3VUXA 4LK0M 4AQ7A 2INPE 2NCNA 3FKYA 3JW0X 3ZUNA 1F2RC 3W1SC 3B1LX 2K9XA 1WX7A 2KFJA 3QHTA 1KRHA 2V3NA 3TCAA 4DK5A 4BOSC 1SF0A 4HK2A 2JT4B 3L08A 4EKUA 1FM0D 1JCKB 2DZIA 3Q69A 4E3CA 2K25A 4XZ4A 4EOYA 2G45B 4XDDA 1H4RA 5FR6A 4KIKB 4FHJA 2KQ7A 1EU3A 2V3PA 2LMCA 3AEBB 4NAWA 4LCDE 2MSED 4L1BA 2VH1A 4TUUA 5C23A 5LNK1 3H7PA 2AQ3B 1ACCA 1FNUA 4FXCA 3DVNU 3VDZA 3NRZA 3ZQ4A 2J4XA 4L23A 4HKQA 4ICVA 1QILA 3GB1A 2KJHB 4BZAA 3Q3JA 2JRHA 2WU5B 4WJQA 1AWDA 3MJ5A 4HLEA 4A55A 3JYUA 4IKGA 3RI7C 3RNGC 2IYDB 2JX5A 3ZNGC 2G1EA 4EUTA 2KDFB 1SJHD 1J7BA 4RF1A 1AARA 1ZP0B 2ICIA 3H9DA 4EE2A 1BXTA 2JWZA 3E56A 4BKSD 4IWQA 2UWQA 4WAAA 4MT5A 2KTRB 4ZRPA 4Q2JA 3FILB 2BW2A 2OHFA 1K52A 3ZJUA 1TT5B 3W1SA 1F9JA 1PGXA 4RM9A 2J42A 2WDVB 4YTPB 5CTRC 4DXGA 1YQ3B 1ET6A 2PPHA 1L5PA 2Z0EB 1V80A 1DOYA 1ZDXA 4FN2A 3BVMA 5HKHA 4HJKA 2C7MB 3IHPC 1V1PA 1V2YA 1K8RB 2WDRB 5IKCM 1WWTA 1L6VA 4RGOS 1AW7A 4S17A 1DOIA 2KK8A 1I4HA 3RULA 1TKEA 1D6EC 3PZDA 2FCQA 3DBSA 2XNAC 1TTNA 1E7PB 1SJED 3TIXA 2NTTA 2ASQA 2LVPA 2MJ3A 1Q5WB 4EZKA 2ZCCA 3AN1A 2RR9A 3C8YA 1Z2MA 5KHQA 4ZDVA 3KQ4A 1TY2A 2VZKB 4JIOU 3EGRA 1XXGA 3ABVB 1JWSD 2WXKA 4MSQB 5J2RA 2BBCA 2KT7A 1FIQA 2LHEA 4MGKE 1CMXB 2KC2A 4AWJA 4MSMB 1V8CA 2KNBA 4IUMB 2WNMA 4IW0A 2BGFA 3KUCB 1FXAA 1V81A 1L2NA 2M0XA 2D11A 1UF0A 1M94A 2GLSA 3P42A 1SE2A 1N63A 4TKNA 2IJ0A 1SIJA 2FUG1 2CHXA 4MGIE 1ZGUB 4TQ0A 2IGDA 1JWMD 3LYYA 3SEBA 2NR2A 1NENB 3VFKA 4K7WA 1GPXA 2AEHA 1Q0WB 4WWPA 2WHIA 2QMTA 1FXIA 5HFYA 4PYUA 4OZBA 5JZEB 2EMSA 4GGQA 3ZXVA 3QIJA 2JRIB 4HCNB 3WIMA 2WP9B 2ZNVC 5BYQA 2L05A 1PQSA 1T0YA 2WX0A 1QOBA 2JU6X 2W3SA 3AXCA 3APDA 1YN3A 2CJOA 4MDKE 3VAWA 1TYGB 4EFOA 2Z8LA 3QC8B 2OJWA 2LEKA 2NVUI 1BT0A 5E6PA 3AEFB 3Q8FA 1TJEA 3IFWB 4A3OA 2I38A 4MJSB 4BKGA 2KDMA 2PEAA 3IG3A 3BK2A 5G5HA 5TR5A 1Q10A 4G3XB 2DHZA 2ONQA 2WU2B 3ML8A 3IXSA 4JGHB 1MI0A 4LDTD 2MA9B 2ZVOA 3U2SC 5L83A 3V61A 2N9EB 1UGJA 2WXFA 1WH3A 3GE3C 2GBMA 2KN4A 2GOWA 1YQ4B 1VRAB 1YN5A 2D5GA 2NBWB 1T3QA 2EMTA 2O6VB 1C78A 1UBIA 1QT9A 4RM8A 1S3SG 4JWUC 4D2KA 2XEWA 1E7VA 1TKYA 4KSLC 4GIVA 4RGMA 3UQBA 1FFUA 1Q1OA 3AE2B 4AJYB 3PRMB 1TS4A 2FBWB 2LI5A 4YTMB 2RPQA 3U30A 3Q3FA 3EFUA 4FA6A 4FBJB 2DZKA 1E9MA 4FJVB 3RNBC 3IBEA 1V6EA 1IPGA 2W82A 2JZ3B 3V6CB 4YSZB 3VR8B 1FMAD 1QKZA 1WR6E 3AE6B 1QF6A 4RFBA 1JWBD 3GOEA 2MW5A 3PZ8A 3QQ8B 3WAOA 1CJEA 4US9A 3R8BA 1HZ6A 2KFKA 2O6VD 3X23A 1R4MI 2KMAA 4YT0B 3VTUA 2BYFA 4HXDA 1K50A 2D3BA 2IY0B 2OOBB 1I7HA 2MHJA 2BYVE 1ZUD2 1AN8A 1XCQL 3JVZX 3JSVA 4JLCA 3KYDD 1V5OA 1WYGA 3H7PB 5HG2A 1NYRA 1WFYA 4I6LB 3EECA 3DOWA 4ZOHC 2WXLA 1T6BX 4P6VF 5TSSA 4MH8A 1OQQA 1U4AA 3URYA 1WX9A 3TEYA 4ARCA 1KJTA 4BBNF 4K3BA 1RM6C 3B0AA 1KLGD 4FJYA 3V62A 2FCNA 1PDXA 2K8BA 4TQ1A 4WWOA 1XLPA 3ZYYX 4IOIE 2FNJB 3N20C 1GUAB 3HIZA 2IY1B 4ZRJA 1GB1A 3L16A 4NPNA 1YJ1A 4CQNA 1CZPA 5AEKB 4HKZE 5D7GA 2GBNA 1YN4A 3BVZA 3IVFA 1UGMA 3VUYA 2D3AA 2G4DB 4IC7B 2IPKD 2XBBC 1E5WA 4DQOC 2YEPF 1FFVA 4KGSA 1VJKA 2AL6A 3DHHC 4JQWC 2J7QB 2J0JA 3VVWB 1V1PB 1L7YA 1MJDA 4KKIA 3V3XA 3A1QB 1TS2A 4JWSC 2Y5BB 4NNJB 3KWLA 1V97A 1T0RC 1ZDVA 4RGTA 4W9LA 2I1KA 1WY8A 4WJOA 2JSVX 1L6UA 4OZAA 4KKJA 1A70A 2CU1A 3AU5A 4C4VA 4PT5A 2WXPA 2RD0A 3NUHB 3MC0B 2MBEA 3BIID 2CHWA 4M02A 2LGIA 3MHSD 1D4BA 2BKRB 4RNAA 2NS5A 1YX6B 3W2DA 3ZNHB 4G11A 4YTNB 4EZLA 2MRPA 3L0WB 2IO0B 4ANXA 3RZWC 4RCOA 4K7UA 1E8YA 1J19A 1LM8B 2WS3B 4GOCA 2HJ1A 1RWSA 5JXVA 4KGRA 1NI2A 2BS3B 3AE5B 1GJZA 4ZHOA 2N1WA 1L4DB 1V86A 1JWUD 1X1MA 2E6XA 2D2QA 3VXWA 4TSSA 1MPEA 1T0QC 1XQQA 3A9JB 4BOZB 3LXFA 4ANUA 1E8ZA 1WXAA 3HHMA 2MP2B 2H89B 4CYEA 3FC4A 3L4PA 4ANWA 2AQ1B 3PRZA 2KX0A 2QCZA 1P0RA 1WM2A 2DZMA 3U8ZA 1K53A 4LNNA 5L95C 2J0MA 5IO9A 2O2VB 4DXFA 3U7ZA 3QA8A 2Y5CA 3PLUA 2A5UA 2V1YA 4ITKA 1OEYJ 1E7UA 4KGTA 2KD0A 5FR3A 4GDLB 1E8WA 1TIFA 3GZNI 3KLSX 4JX1C 4AJWA 3M63B 2KKCA 3Q8AA 4DDGD 3QCAA 3RCZA 1FXTB 2J52A 5GXGB 1AYFA 2W3RA 3V05A 2NBUA 1WGGA 2HD5B 1E0ZA 1VLBA 1J0GA 4H2AA 1WSPA 2H88B 4MGZE 1XF5L 4IDIA 5C1ZA 1SBBB 4MH0E 3P1MA 3MTNB 1WGDA 4X57B 2JPHA 1G6JA 3BWUD 3IT4B 5C2TB 4C7YA 3PHXB 3EC8A 1IP9A 1TZ1A 1WGYA 3P4RB 4M0WA 1J7CA 3B08A 1VZ7A 4WAFA 3I5JC 4USAA 1E90A 3X0WA 1LXDA 2IZVB 1PFDA 3Q8EA 1FCCC 2N9XA 4W9HA 4BKTA 3AE7B 2QSDA 3Q14C 3EFCA 1MFWA 3QARA 1NYQA 2C5LC 3RMKC 3S2AA 3PT2B 1J8CA 4FLHA 2Q5WD 4KDIC 4HEA1 2LD9A 2R61A 1D5XC 5T8IA 2Z0DB 4W9DA 3N9YC 2WXJA 4A3PA 2C7NB 2BQQA 3AE9B 3PV1A 2DBYA 4GDKA 3Q8CA 2LXCA 1P9DU 4B95A 1NEKB 1BUIC 3LJ3A 2ZPNA 3GE8C 3ZIMA 3O65B 1Z5SB 2DAFA 2LFIA 3SU8X 3KW5B 2OEDA 3KUDB 3RNAC 2BYTA 3MC8A 3EUB2 3N1YC 4NQLB 2X8XX 3RUIB 4OVVA 2GRIA 1XEEA 2G9HD 1FEHA 4ZHPA 2EKIA 3R2TA 3AV8A 3SDLC 3BYYB 3P2BA 2HTME 4NJ6A 3RN9C 2QEJC 3UIOB 2KDIA 1N5XA 4MACA 2BB5A 2N9LA 3ZGZA 1KF6B 3R7QA 1MVKA 2WXRA 3NZ3A 3KUZA 4HWIB 2C60A 3NG0A 3NZUA 4RMAA 2W9NA 5AUKA 3RD2A 1QZEA 3N30A 3AEDB 3A9KA 3CWIA 1WRDB 2BWFA 5MPOA 3HRDD 3K9OB 3MC9A 5AUIA 2DWQA 2FUHB 1QQRA 3QK0A 4W9KA 2TSSA 5EE1A 3O13A 1C9FA 2KQSA 2KVRA 1VZ8A 2FE8A 3B2FA 4KZCA 5JHBA 3DWGC 1N6ZA 4PS7A 4M01A 2KYWA 1KOTA 1FO4A 4J3OD 4W9EA 2ACZB 3P63A 4PS8A 1OFFA 3OLMD 1TBEA 2XN9C 2PLPA 1YJJA 4AS1A 5J17A 3N1ZC 1SB3C 3AULA 1L0YB 4KZ0A 5BYSA 4HRSA 4S0RA 1UWMA 2KWDA 5CHFA 4LDTB 1LGRA 2QJLA 2VH2A 2AYOB 3VR9B 3IAM1 5KHOA 3AB5A 3MP9A 1IBXA 3DVNV 4F8CB 2L8JA 4WJPA 1WX8A 5EE0A 2NPTB 1UUPA 1LO5D 3ZDTA 2W55A 1OGWA 4HDQA 2LASA 3ZNZB 1TZOA 2JWUA 4AOFA 3AEAB 1ZOYB 2ZW0A 3EA6A 2N0SB 1EWYC 3MFGA 3MJWA 3V6EB 4DBGA 3TMPB 1WGKA 1XCTL 2SAKA 2UU7A 1EF5A 1KH0A 2FAZA 3DBHI 2LGSA 2M17A 4HPLB 4F1SA 4KIKA 3VH3B 4FHKA 3PRPB 2L3ZA 3LDZE 5AZGA 3DBHB 2KLCA 2WLBA 1T0SC 5DPWA 2IO3B 2LJ5A 3DBRI 5D3DA 3RT3B 4OW0A 2DYBA 2ZVNA 2D3CA 1UH6A 1P1AA 4IM3A 4A9AA 1WXQA 2N9PC 3AE3B 2XK5B 4WQOB 3M3JA 1WIAA 1RFKA 4A20A 2M0AA 1UWXA 3N32A 3ZO5B 4HPPA 1P3QU 4A6QA 2E3TA 2MBBB 3ZRFA 2AL3A 3PREA 1C76A 3AEGB 5H92C 3T3NA 2YEPB 2YVCA 4HVBA 2KOXA 2CR5A 4B0MA 3GP7A 5AZFA 4NAMA 4II3B 3UI3A 1WXVA
chains in the Genus database with same CATH topology
2V3SA 2KTRA 2CHWA 4ICVA 3MHSD 4GXBA 3ZDMC 3ML9A 4LJOB 4URKA 2KJHB 2UYZB 3A9JA 2BKRB 2JRHA 3Q3JA 4WJQA 2KJRA 2NS5A 1VD2A 1XT9B 2CHZA 5J18A 2K39A 1YX6B 3ZNHB 4HLEA 3JYUA 4G11A 1RFAA 2LVOA 2IYDB 4EZLA 3L17A 3ZNGC 2MRPA 3L0WB 2MP2A 2IO0B 2RSUA 3OAWA 4ANXA 3RZWC 2KDFB 4EUTA 1H8CA 5G2NA 4K7UA 4N9F4 2IO1B 4NAWB 1E8YA 1J19A 1LM8B 4GOCA 1AARA 3H9DA 2JWZA 3PVLA 1VCBA 4BKSD 4IWQA 1NI2A 3ZW3A 1GJZA 2UWQA 4WAAA 1WJNA 2FIDA 5GMVA 2N1WA 1V86A 1WR1A 2KTRB 2O2VA 4WJNA 2KLGA 4NY0A 4DHZB 1X1MA 3ZNID 4M8MA 2D2QA 3ZLZA 2ZCBA 3VXWA 3HK0A 4II2B 1OQYA 1UELA 2DENB 1XQQA 1WJ6A 3CSTA 2JZZA 3A9JB 2FCMA 4BOZB 3W1SA 3QJZA 1F9JA 3UGBB 4RM9A 4ANUA 1WZ3A 3L13A 1E8ZA 2K8HA 2KO3A 5CTRC 1WXAA 2CS4A 3HHMA 4GDLA 2K6DB 2MP2B 2K1FA 4CYEA 4CHKA 2PPHA 2Z0EB 1V80A 4FN2A 1YX5B 4FULA 3I3TB 5HKHA 3PTFC 4HJKA 4ANWA 2K8CA 3PRZA 2KX0A 2C7MB 4TV3A 1P0RA 3IHPC 1WM2A 2BF8B 2DZMA 1V2YA 1WZ0A 1K8RB 3U8ZA 1C3TA 2N4FA 5L95C 2HTHA 2J0MA 2O2VB 4KVGB 3QA8A 3PLUA 3PSEB 2KK8A 3VUWA 4DXAB 3V60A 3RULA 2A5UA 3NS8A 3TL5A 3PZDA 2JUOA 2V1YA 2FCQA 4IWPA 1OEYJ 1E7UA 4GN1A 2DYMA 2GMIC 2PE9A 3DBSA 2YLMA 4ANVA 2KD0A 2G3QB 4B6WA 1TTNA 2AWTA 4GMVA 3WA0A 2HJ8A 4GDLB 4BKSA 3TIXA 1E8WA 3GZNI 2ASQA 2LVPA 4AJWA 3DBLI 3AU4A 3M63B 2KKCA 1Q5WB 2LRWA 1S1QB 4EZKA 4DDGD 2D3GA 3ZVVA 2ZCCA 3QWZB 2BKFA 3QCAA 2RR9A 3RCZA 1FXTB 1Z2MA 5KHQA 4ZDVA 2MBQA 5D94A 2NBUA 1WGGA 5LXIB 2B3AA 4JIOU 3VTVA 3UF8A 2HD5B 1RAXA 4MSQB 1GG3A 4BBNC 1J0GA 4G50A 2L7RA 2G4SA 1UD7A 3APCA 3NZSA 5J2RA 4PS3A 4LJPB 1IYFA 2FCSA 2L76A 3BINA 3PPAA 4MGZE 5C1ZA 4MGKE 1CMXB 1WJ4A 2KC2A 4MSMB 4AWJA 4MH0E 3MTNB 3CMMB 2KNBA 1WGDA 2LUEA 4X57B 3CSFA 4IUMB 1TGZB 2JPHA 1WE7A 4IW0A 1G6JA 2GBRA 3DVGY 2V4LA 2C9WB 2BGFA 3KUCB 3PHXB 3EC8A 4W9IA 1V81A 2GBKA 2MLBA 2WYQA 5D6JB 2M0XA 1TZ1A 3A33B 2D07B 2D11A 1WGYA 1IP9A 1SIFA 4NQKE 1M94A 3H7SA 3ZRCA 4ICUA 3B08A 3WALA 1KLVA 4TKNA 2BWES 4JL9A 3NHEB 2LVQA 1WM3A 1E90A 3X0WA 1LXDA 1WJUA 2I1JA 2IZVB 1UZXB 4E71A 2CHXA 4W9FA 1WMHB 4MGIE 1ZGUB 4TQ0A 1WE6A 2N9XA 3PS6A 4W9HA 4HDOA 4K7SA 4MGYE 2NR2A 4BKTA 3HM3A 2D10A 4K7WA 3VFKA 2AEHA 2PJHA 2ZPYA 1Q0WB 1A5RA 4WWPA 1V49A 2IO2B 1OEYA 5DPTA 1RRBA 3QARA 4PYUA 3K9PB 2C5LC 5D2MB 3S2AA 3PT2B 3U7DA 5G55A 5JZEB 2EMSA 4GGQA 1J8CA 4FLHA 1WGHA 4W9JA 1C1YB 3QAQA 3QIJA 4KDIC 5AZHA 2GBJA 1JRUA 2JRIB 1V9JA 2LD9A 4HCNB 4IM0A 3WIMA 4DHJB 3OJ3A 2KXJA 2Z0DB 5CX3A 3DQVA 4W9DA 4E74A 4M0WB 4OVUA 2KX3A 4A3PA 2C7NB 1UBQA 2ZNVC 3CF6E 2L05A 3PV1A 4HCPB 3UIPB 1I42A 4GDKA 1PQSA 2KMCA 1T0YA 2LXCA 1P9DU 4B95A 2WX0A 3L54A 3VTWA 1EUVB 3AXCA 3LJ3A 4EZJA 2ZPNA 2LGDA 3APDA 2KANA 4MDKE 3ZIMA 1WXMA 3VAWA 4MM3A 4EFOA 3KYCD 3QC8B 2NVUI 1BT0A 3O65B 3ECIA 4M8NA 1Z5SB 1WI0A 4KDLB 3TJPA 1GNUA 2DAFA 5E6PA 2KDBA 3SU8X 3C0RB 3KW5B 5CHVC 3VQIA 2DZJA 3KUDB 2MBOA 1E8XA 2OJRA 3D32A 3IFWB 3ONSA 4MEMA 4A3OA 4MJSB 4BKGA 4DHZE 4DHJD 2N7DA 4NQLB 1YQBA 3RUIB 4OVVA 2PEAA 3IG3A 3T9LA 4IWOA 3W1YA 1WF9A 4GDKB 4YL8A 5TR5A 2DYOA 2WDTB 2L00B 2MBHA 4I6PA 4G3XB 2DHZA 5LXHA 2BPSA 3ML8A 2IBIB 3TBLD 4JGHB 4LDTD 3SDLC 3P2BA 4NJ6A 4MELA 2MA9B 4GU2A 4DDID 3UIOB 2KDIA 2ZVOA 5L83A 3V61A 1LQBA 2N9EB 3SD5A 1I35A 2NBVB 3SHQA 1SE9A 3KVFB 1WH3A 3R7QA 1NDDA 3AI5A 2A4ZA 2GBMA 1ISNA 2GOWA 1WMHA 2NBWB 4ZYNA 1XD3B 3KUZA 4HWIB 2C60A 2EMTA 3NZUA 2O6VB 4RMAA 1UBIA 4P7IA 1LFDA 2RGFA 2W9NA 4RM8A 1S3SG 1Y8RC 5EDSA 4ZRKA 3QX1A 2XEWA 1E7VA 3PGEA 1QZEA 4KSLC 2KC1A 4GIVA 4ZRIA 3RD2A 3N30A 3UQBA 1Q1OA 3DCGA 2LWPA 3A9KA 3WANA 2M4NA 4AJYB 3PRMB 4FJZA 3WAPA 1WRDB 2BWFA 4IM2A 1WGRA 2LI5A 4EEWA 2DAJA 4ASWC 3R66C 2LXAA 3K9OB 3M62B 4KV2A 2RPQA 1R4NI 3U30A 2FUHB 3Q3FA 4XX5A 5DPSA 4K1RB 2MWSB 3R3MA 3EHVA 3EFUA 3QK0A 2JF5A 4W9KA 4FA6A 4FBJB 2N7EA 2DZKA 4FJVB 1P98A 3IBEA 1V6EA 5JH5C 2LZ6A 1IPGA 2KQSA 2JZ3B 3V6CB 2DX5B 2WWZA 2ZJDA 1WR6E 2KVRA 3GOEA 3BY4B 2MW5A 3QQ8B 4KZCA 3WAOA 2FIFA 5JHBA 2ZEQA 4AP4C 3RZFA 4PS7A 1EF1A 2KFKA 2O6VD 3X23A 2L0FA 1KOTA 1R4MI 1YIWA 4CO7A 2KMAA 3PHWB 4DWFA 2NPTA 5IA7A 4W9EA 2KHWB 3VTUA 2ZNVB 3A9KB 2BYFA 2M1MA 2Z59B 4HXDA 2KWVB 2KTFA 5E6NA 5DPRA 4PS8A 1ZKHA 2IY0B 2KWUB 3OLMD 2OOBB 4K81A 3UQAA 1TBEA 3KH0A 3T8MA 4HPMB 4IG7B 5CHWA 2BYVE 1GC7A 2VRRB 4MJSA 2LRUA 5J17A 1WYWB 2QHOA 2L0TA 3AULA 3JVZX 4J6IA 2JVCA 2KN5A 2CKHB 3JSVA 4KZ0A 3A4SC 1D3ZA 4JLCA 3KYDD 1V5OA 1SGHA 1GC6A 5CHFA 4LDTB 2MX2A 2REXA 3H7PB 1WFYA 2AYOB 3ALBA 2BYEA 4I6LB 3EECA 3ZKJC 5E6OA 3H1UA 1YD8U 5KHOA 3DVNV 3DOWA 4F8CB 2KWCA 4I6NB 2L8JA 4WJPA 2KFKB 3ZTDA 1U4AA 2WX1A 1WX8A 3DVGX 2NPTB 3PLVA 1WX9A 1KJTA 1V5TA 4BBNF 3ZDTA 4F7ZA 3B0AA 3UINB 1OGWA 4FJYA 3V62A 3VH4B 2FCNA 2HE7A 2K8BA 4TQ1A 4HDQA 4WWOA 2J0KA 3ZTCA 4AUQC 4B9KA 2LASA 2JY6A 3ZNZB 4XC2A 4AOFA 2LGYA 2R2QA 5DCNA 2FNJB 1GUAB 3HM6X 3HIZA 2IY1B 1MG8A 3JSVB 4ZRJA 2O6VA 2KJ6A 3L16A 3NOBA 2EKEC 1YJ1A 4NPNA 1EO6A 4NJ7A 2MCNB 2MQJA 5AEKB 3MJWA 5D7GA 3DDCB 4G0NB 2GBNA 1ZW7A 3L10B 3V6EB 2XK5A 4DBGA 3TMPB 3A1QA 3OJ4B 1EF5A 2ZZPB 4W9CA 3IVFA 1KM7A 2FAZA 1UGMA 3DBHI 3R7RA 2M17A 4HPLB 2PE6B 3APFA 5LLIA 3VUYA 2G4DB 4F1SA 4W9GA 4KIKA 1L2NA 3DPDA 2C7HA 3ENEA 4KSKC 3VH3B 3N3KB 4IC7B 5BO4B 2XBBC 4FHKA 3M95A 3PRPB 1E5WA 2L3ZA 3LDZE 5AZGA 2JXXA 2N1VA 3RYTA 3VUXA 2KLCA 5IAAC 5DPWA 2IO3B 2NCNA 3JW0X 3NY5A 3ZUNA 2LJ5A 2AL6A 2KDEB 3DBRI 4JQWC 3VHTC 3RT3B 1OTRB 2DYBA 2J7QB 3W1SC 3B1LX 2ZVNA 2J0JA 1UH6A 1WX7A 1HE8A 2KFJA 3QHTA 1P1AA 4BVUC 3TCAA 4GSWA 4BOSC 3VVWB 4DK5A 4HK2A 3WAMA 2JT4B 4IM3A 2KZRA 1L7YA 3H6NA 3L08A 2N9PC 4EKUA 4FADA 1RLFA 2XK5B 2K6QA 3M3JA 4WQOB 1WIAA 3A1QB 4A20A 2Y5BB 2DZIA 4NNJB 4GB9A 4E3CA 2K25A 4XZ4A 3N32A 3ZO5B 4EOYA 2R2OA 1P3QU 2G45B 2MBBB 1H4RA 5FR6A 4W9LA 2AL3A 4KIKB 3ZRFA 2I1KA 3PREA 1WY8A 4FHJA 2KQ7A 5JHAA 4BFRA 4WJOA 4NAWA 2M8SA 2LGXA 3A4RA 4LCDE 2MSED 2CU1A 2YVCA 2KOXA 2CR5A 3AU5A 4HVBA 4TUUA 5C23A 1WXSA 3H7PA 4PYZA 5AZFA 1NBFC 4WWNA 4II3B 2RD0A 3DVNU 3VDZA 2MBEA 1WXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3S A;  2KTR A;  2CHW A;  4ICV A;  3MHS D;  4GXB A;  3ZDM C;  3ML9 A;  4LJO B;  4URK A;  2KJH B;  2UYZ B;  3A9J A;  2BKR B;  2JRH A;  3Q3J A;  4WJQ A;  2KJR A;  2NS5 A;  1VD2 A;  1XT9 B;  2CHZ A;  5J18 A;  2K39 A;  1YX6 B;  3ZNH B;  4HLE A;  3JYU A;  4G11 A;  1RFA A;  2LVO A;  2IYD B;  4EZL A;  3L17 A;  3ZNG C;  2MRP A;  3L0W B;  2MP2 A;  2IO0 B;  2RSU A;  3OAW A;  4ANX A;  3RZW C;  2KDF B;  4EUT A;  1H8C A;  5G2N A;  4K7U A;  4N9F 4;  2IO1 B;  4NAW B;  1E8Y A;  1J19 A;  1LM8 B;  4GOC A;  1AAR A;  3H9D A;  2JWZ A;  3PVL A;  1VCB A;  4BKS D;  4IWQ A;  1NI2 A;  3ZW3 A;  1GJZ A;  2UWQ A;  4WAA A;  1WJN A;  2FID A;  5GMV A;  2N1W A;  1V86 A;  1WR1 A;  2KTR B;  2O2V A;  4WJN A;  2KLG A;  4NY0 A;  4DHZ B;  1X1M A;  3ZNI D;  4M8M A;  2D2Q A;  3ZLZ A;  2ZCB A;  3VXW A;  3HK0 A;  4II2 B;  1OQY A;  1UEL A;  2DEN B;  1XQQ A;  1WJ6 A;  3CST A;  2JZZ A;  3A9J B;  2FCM A;  4BOZ B;  3W1S A;  3QJZ A;  1F9J A;  3UGB B;  4RM9 A;  4ANU A;  1WZ3 A;  3L13 A;  1E8Z A;  2K8H A;  2KO3 A;  5CTR C;  1WXA A;  2CS4 A;  3HHM A;  4GDL A;  2K6D B;  2MP2 B;  2K1F A;  4CYE A;  4CHK A;  2PPH A;  2Z0E B;  1V80 A;  4FN2 A;  1YX5 B;  4FUL A;  3I3T B;  5HKH A;  3PTF C;  4HJK A;  4ANW A;  2K8C A;  3PRZ A;  2KX0 A;  2C7M B;  4TV3 A;  1P0R A;  3IHP C;  1WM2 A;  2BF8 B;  2DZM A;  1V2Y A;  1WZ0 A;  1K8R B;  3U8Z A;  1C3T A;  2N4F A;  5L95 C;  2HTH A;  2J0M A;  2O2V B;  4KVG B;  3QA8 A;  3PLU A;  3PSE B;  2KK8 A;  3VUW A;  4DXA B;  3V60 A;  3RUL A;  2A5U A;  3NS8 A;  3TL5 A;  3PZD A;  2JUO A;  2V1Y A;  2FCQ A;  4IWP A;  1OEY J;  1E7U A;  4GN1 A;  2DYM A;  2GMI C;  2PE9 A;  3DBS A;  2YLM A;  4ANV A;  2KD0 A;  2G3Q B;  4B6W A;  1TTN A;  2AWT A;  4GMV A;  3WA0 A;  2HJ8 A;  4GDL B;  4BKS A;  3TIX A;  1E8W A;  3GZN I;  2ASQ A;  2LVP A;  4AJW A;  3DBL I;  3AU4 A;  3M63 B;  2KKC A;  1Q5W B;  2LRW A;  1S1Q B;  4EZK A;  4DDG D;  2D3G A;  3ZVV A;  2ZCC A;  3QWZ B;  2BKF A;  3QCA A;  2RR9 A;  3RCZ A;  1FXT B;  1Z2M A;  5KHQ A;  4ZDV A;  2MBQ A;  5D94 A;  2NBU A;  1WGG A;  5LXI B;  2B3A A;  4JIO U;  3VTV A;  3UF8 A;  2HD5 B;  1RAX A;  4MSQ B;  1GG3 A;  4BBN C;  1J0G A;  4G50 A;  2L7R A;  2G4S A;  1UD7 A;  3APC A;  3NZS A;  5J2R A;  4PS3 A;  4LJP B;  1IYF A;  2FCS A;  2L76 A;  3BIN A;  3PPA A;  4MGZ E;  5C1Z A;  4MGK E;  1CMX B;  1WJ4 A;  2KC2 A;  4MSM B;  4AWJ A;  4MH0 E;  3MTN B;  3CMM B;  2KNB A;  1WGD A;  2LUE A;  4X57 B;  3CSF A;  4IUM B;  1TGZ B;  2JPH A;  1WE7 A;  4IW0 A;  1G6J A;  2GBR A;  3DVG Y;  2V4L A;  2C9W B;  2BGF A;  3KUC B;  3PHX B;  3EC8 A;  4W9I A;  1V81 A;  2GBK A;  2MLB A;  2WYQ A;  5D6J B;  2M0X A;  1TZ1 A;  3A33 B;  2D07 B;  2D11 A;  1WGY A;  1IP9 A;  1SIF A;  4NQK E;  1M94 A;  3H7S A;  3ZRC A;  4ICU A;  3B08 A;  3WAL A;  1KLV A;  4TKN A;  2BWE S;  4JL9 A;  3NHE B;  2LVQ A;  1WM3 A;  1E90 A;  3X0W A;  1LXD A;  1WJU A;  2I1J A;  2IZV B;  1UZX B;  4E71 A;  2CHX A;  4W9F A;  1WMH B;  4MGI E;  1ZGU B;  4TQ0 A;  1WE6 A;  2N9X A;  3PS6 A;  4W9H A;  4HDO A;  4K7S A;  4MGY E;  2NR2 A;  4BKT A;  3HM3 A;  2D10 A;  4K7W A;  3VFK A;  2AEH A;  2PJH A;  2ZPY A;  1Q0W B;  1A5R A;  4WWP A;  1V49 A;  2IO2 B;  1OEY A;  5DPT A;  1RRB A;  3QAR A;  4PYU A;  3K9P B;  2C5L C;  5D2M B;  3S2A A;  3PT2 B;  3U7D A;  5G55 A;  5JZE B;  2EMS A;  4GGQ A;  1J8C A;  4FLH A;  1WGH A;  4W9J A;  1C1Y B;  3QAQ A;  3QIJ A;  4KDI C;  5AZH A;  2GBJ A;  1JRU A;  2JRI B;  1V9J A;  2LD9 A;  4HCN B;  4IM0 A;  3WIM A;  4DHJ B;  3OJ3 A;  2KXJ A;  2Z0D B;  5CX3 A;  3DQV A;  4W9D A;  4E74 A;  4M0W B;  4OVU A;  2KX3 A;  4A3P A;  2C7N B;  1UBQ A;  2ZNV C;  3CF6 E;  2L05 A;  3PV1 A;  4HCP B;  3UIP B;  1I42 A;  4GDK A;  1PQS A;  2KMC A;  1T0Y A;  2LXC A;  1P9D U;  4B95 A;  2WX0 A;  3L54 A;  3VTW A;  1EUV B;  3AXC A;  3LJ3 A;  4EZJ A;  2ZPN A;  2LGD A;  3APD A;  2KAN A;  4MDK E;  3ZIM A;  1WXM A;  3VAW A;  4MM3 A;  4EFO A;  3KYC D;  3QC8 B;  2NVU I;  1BT0 A;  3O65 B;  3ECI A;  4M8N A;  1Z5S B;  1WI0 A;  4KDL B;  3TJP A;  1GNU A;  2DAF A;  5E6P A;  2KDB A;  3SU8 X;  3C0R B;  3KW5 B;  5CHV C;  3VQI A;  2DZJ A;  3KUD B;  2MBO A;  1E8X A;  2OJR A;  3D32 A;  3IFW B;  3ONS A;  4MEM A;  4A3O A;  4MJS B;  4BKG A;  4DHZ E;  4DHJ D;  2N7D A;  4NQL B;  1YQB A;  3RUI B;  4OVV A;  2PEA A;  3IG3 A;  3T9L A;  4IWO A;  3W1Y A;  1WF9 A;  4GDK B;  4YL8 A;  5TR5 A;  2DYO A;  2WDT B;  2L00 B;  2MBH A;  4I6P A;  4G3X B;  2DHZ A;  5LXH A;  2BPS A;  3ML8 A;  2IBI B;  3TBL D;  4JGH B;  4LDT D;  3SDL C;  3P2B A;  4NJ6 A;  4MEL A;  2MA9 B;  4GU2 A;  4DDI D;  3UIO B;  2KDI A;  2ZVO A;  5L83 A;  3V61 A;  1LQB A;  2N9E B;  3SD5 A;  1I35 A;  2NBV B;  3SHQ A;  1SE9 A;  3KVF B;  1WH3 A;  3R7Q A;  1NDD A;  3AI5 A;  2A4Z A;  2GBM A;  1ISN A;  2GOW A;  1WMH A;  2NBW B;  4ZYN A;  1XD3 B;  3KUZ A;  4HWI B;  2C60 A;  2EMT A;  3NZU A;  2O6V B;  4RMA A;  1UBI A;  4P7I A;  1LFD A;  2RGF A;  2W9N A;  4RM8 A;  1S3S G;  1Y8R C;  5EDS A;  4ZRK A;  3QX1 A;  2XEW A;  1E7V A;  3PGE A;  1QZE A;  4KSL C;  2KC1 A;  4GIV A;  4ZRI A;  3RD2 A;  3N30 A;  3UQB A;  1Q1O A;  3DCG A;  2LWP A;  3A9K A;  3WAN A;  2M4N A;  4AJY B;  3PRM B;  4FJZ A;  3WAP A;  1WRD B;  2BWF A;  4IM2 A;  1WGR A;  2LI5 A;  4EEW A;  2DAJ A;  4ASW C;  3R66 C;  2LXA A;  3K9O B;  3M62 B;  4KV2 A;  2RPQ A;  1R4N I;  3U30 A;  2FUH B;  3Q3F A;  4XX5 A;  5DPS A;  4K1R B;  2MWS B;  3R3M A;  3EHV A;  3EFU A;  3QK0 A;  2JF5 A;  4W9K A;  4FA6 A;  4FBJ B;  2N7E A;  2DZK A;  4FJV B;  1P98 A;  3IBE A;  1V6E A;  5JH5 C;  2LZ6 A;  1IPG A;  2KQS A;  2JZ3 B;  3V6C B;  2DX5 B;  2WWZ A;  2ZJD A;  1WR6 E;  2KVR A;  3GOE A;  3BY4 B;  2MW5 A;  3QQ8 B;  4KZC A;  3WAO A;  2FIF A;  5JHB A;  2ZEQ A;  4AP4 C;  3RZF A;  4PS7 A;  1EF1 A;  2KFK A;  2O6V D;  3X23 A;  2L0F A;  1KOT A;  1R4M I;  1YIW A;  4CO7 A;  2KMA A;  3PHW B;  4DWF A;  2NPT A;  5IA7 A;  4W9E A;  2KHW B;  3VTU A;  2ZNV B;  3A9K B;  2BYF A;  2M1M A;  2Z59 B;  4HXD A;  2KWV B;  2KTF A;  5E6N A;  5DPR A;  4PS8 A;  1ZKH A;  2IY0 B;  2KWU B;  3OLM D;  2OOB B;  4K81 A;  3UQA A;  1TBE A;  3KH0 A;  3T8M A;  4HPM B;  4IG7 B;  5CHW A;  2BYV E;  1GC7 A;  2VRR B;  4MJS A;  2LRU A;  5J17 A;  1WYW B;  2QHO A;  2L0T A;  3AUL A;  3JVZ X;  4J6I A;  2JVC A;  2KN5 A;  2CKH B;  3JSV A;  4KZ0 A;  3A4S C;  1D3Z A;  4JLC A;  3KYD D;  1V5O A;  1SGH A;  1GC6 A;  5CHF A;  4LDT B;  2MX2 A;  2REX A;  3H7P B;  1WFY A;  2AYO B;  3ALB A;  2BYE A;  4I6L B;  3EEC A;  3ZKJ C;  5E6O A;  3H1U A;  1YD8 U;  5KHO A;  3DVN V;  3DOW A;  4F8C B;  2KWC A;  4I6N B;  2L8J A;  4WJP A;  2KFK B;  3ZTD A;  1U4A A;  2WX1 A;  1WX8 A;  3DVG X;  2NPT B;  3PLV A;  1WX9 A;  1KJT A;  1V5T A;  4BBN F;  3ZDT A;  4F7Z A;  3B0A A;  3UIN B;  1OGW A;  4FJY A;  3V62 A;  3VH4 B;  2FCN A;  2HE7 A;  2K8B A;  4TQ1 A;  4HDQ A;  4WWO A;  2J0K A;  3ZTC A;  4AUQ C;  4B9K A;  2LAS A;  2JY6 A;  3ZNZ B;  4XC2 A;  4AOF A;  2LGY A;  2R2Q A;  5DCN A;  2FNJ B;  1GUA B;  3HM6 X;  3HIZ A;  2IY1 B;  1MG8 A;  3JSV B;  4ZRJ A;  2O6V A;  2KJ6 A;  3L16 A;  3NOB A;  2EKE C;  1YJ1 A;  4NPN A;  1EO6 A;  4NJ7 A;  2MCN B;  2MQJ A;  5AEK B;  3MJW A;  5D7G A;  3DDC B;  4G0N B;  2GBN A;  1ZW7 A;  3L10 B;  3V6E B;  2XK5 A;  4DBG A;  3TMP B;  3A1Q A;  3OJ4 B;  1EF5 A;  2ZZP B;  4W9C A;  3IVF A;  1KM7 A;  2FAZ A;  1UGM A;  3DBH I;  3R7R A;  2M17 A;  4HPL B;  2PE6 B;  3APF A;  5LLI A;  3VUY A;  2G4D B;  4F1S A;  4W9G A;  4KIK A;  1L2N A;  3DPD A;  2C7H A;  3ENE A;  4KSK C;  3VH3 B;  3N3K B;  4IC7 B;  5BO4 B;  2XBB C;  4FHK A;  3M95 A;  3PRP B;  1E5W A;  2L3Z A;  3LDZ E;  5AZG A;  2JXX A;  2N1V A;  3RYT A;  3VUX A;  2KLC A;  5IAA C;  5DPW A;  2IO3 B;  2NCN A;  3JW0 X;  3NY5 A;  3ZUN A;  2LJ5 A;  2AL6 A;  2KDE B;  3DBR I;  4JQW C;  3VHT C;  3RT3 B;  1OTR B;  2DYB A;  2J7Q B;  3W1S C;  3B1L X;  2ZVN A;  2J0J A;  1UH6 A;  1WX7 A;  1HE8 A;  2KFJ A;  3QHT A;  1P1A A;  4BVU C;  3TCA A;  4GSW A;  4BOS C;  3VVW B;  4DK5 A;  4HK2 A;  3WAM A;  2JT4 B;  4IM3 A;  2KZR A;  1L7Y A;  3H6N A;  3L08 A;  2N9P C;  4EKU A;  4FAD A;  1RLF A;  2XK5 B;  2K6Q A;  3M3J A;  4WQO B;  1WIA A;  3A1Q B;  4A20 A;  2Y5B B;  2DZI A;  4NNJ B;  4GB9 A;  4E3C A;  2K25 A;  4XZ4 A;  3N32 A;  3ZO5 B;  4EOY A;  2R2O A;  1P3Q U;  2G45 B;  2MBB B;  1H4R A;  5FR6 A;  4W9L A;  2AL3 A;  4KIK B;  3ZRF A;  2I1K A;  3PRE A;  1WY8 A;  4FHJ A;  2KQ7 A;  5JHA A;  4BFR A;  4WJO A;  4NAW A;  2M8S A;  2LGX A;  3A4R A;  4LCD E;  2MSE D;  2CU1 A;  2YVC A;  2KOX A;  2CR5 A;  3AU5 A;  4HVB A;  4TUU A;  5C23 A;  1WXS A;  3H7P A;  4PYZ A;  5AZF A;  1NBF C;  4WWN A;  4II3 B;  2RD0 A;  3DVN U;  3VDZ A;  2MBE A;  1WXV A; 
#chains in the Genus database with same CATH topology
 2V3S A;  2KTR A;  4JPS A;  3DWM A;  3OWE B;  4GXB A;  3FIL A;  3ML9 A;  4LJO B;  4URK A;  2UYZ B;  2KJR A;  1VD2 A;  2CHZ A;  5J18 A;  3HVD A;  4RF0 A;  1D5Z C;  2KQ4 X;  1C79 A;  1R4M B;  1RFA A;  2LVO A;  2RSU A;  1H8C A;  5G2N A;  5BMG A;  4N9F 4;  3IAS 1;  4NAW B;  2Y5P A;  2IDY A;  4GLS C;  1HTO A;  3PVL A;  2HDE A;  3ZW3 A;  2FID A;  3H8H A;  4DHZ B;  2RPV A;  4WJN A;  4XWW A;  3ZLZ A;  3HK0 A;  4LLG M;  2JYT A;  1UEL A;  2JZZ A;  2FCM A;  3RFZ B;  3QJZ A;  2WDQ B;  2K0P A;  3Q2A C;  3L13 A;  2K8H A;  2KO3 A;  1UNS A;  2CS4 A;  4KX6 B;  1YX5 B;  3PTF C;  1JRP A;  4HJG E;  1JW9 D;  4TV3 A;  3DHG C;  1WZ0 A;  1F2R I;  3W5U B;  2N4F A;  2HTH A;  3TEW A;  4KVG B;  1C4C A;  3AEE B;  2JUO A;  4YSX B;  3KWV A;  4IWP A;  1VR9 A;  4REZ A;  2PVG C;  1IUE A;  4ANV A;  5C3J B;  1Y56 A;  4GMV A;  4ZYS A;  3I57 A;  3DBL I;  2LRW A;  4ACF A;  3TEX A;  3B2G A;  2D3G A;  3ZVV A;  2RDG A;  2BKF A;  1M4V A;  2WXQ A;  1HZ5 A;  5D94 A;  3AH7 A;  3ZJT A;  3DBL B;  3SR6 A;  5LXI B;  3U52 E;  2B3A A;  2J53 A;  1JRO A;  4BBN C;  4G50 A;  4XGA B;  2L7R A;  2G4S A;  1UD7 A;  3APC A;  3NZS A;  2LHD A;  4PS3 A;  2I2Y A;  1IYF A;  1D5M C;  3BIN A;  3PPA A;  2FCS A;  2INC C;  3I63 C;  4LTU A;  1FPY A;  3CMM B;  4BAX A;  3CSF A;  4A8X C;  2GBR A;  3DVG Y;  3TSS A;  2C9W B;  4W9I A;  2MLB A;  2D07 B;  1SIF A;  4NQK E;  3H7S A;  4LNI A;  4ICU A;  3E9S A;  3WAL A;  2BWE S;  2BT6 A;  1WM3 A;  2I1J A;  2CJN A;  1UZX B;  3HUI A;  4W9F A;  1NVI D;  3BYT B;  1WE6 A;  3PS6 A;  2BS2 B;  3HM3 A;  2D10 A;  2ZPY A;  2NMQ A;  1A5R A;  1V49 A;  1OEY A;  1RYJ A;  2EEL A;  3U7D A;  1TKG A;  1WGH A;  4W9J A;  1C1Y B;  2K3U A;  3ZJV A;  1I4Q A;  3AMZ A;  1JRU A;  1FCL A;  4DHJ B;  2RDH A;  3OJ3 A;  5CX3 A;  3DQV A;  4E74 A;  4OVU A;  2NTS A;  3C19 A;  1UBQ A;  1I42 A;  3UIP B;  3Q6B A;  2KMC A;  2WXN A;  3L54 A;  3VTW A;  2PW9 A;  2LGD A;  2L83 A;  2KAN A;  1J7A A;  1WXM A;  4MM3 A;  1PGA A;  3KYC D;  4OVZ A;  2M19 A;  3ECI A;  4M8N A;  4KDL B;  1C77 A;  4O1N A;  3TJP A;  2MEK A;  3C0R B;  3PZ7 A;  5CHV C;  3VQI A;  2MBO A;  1DGJ A;  4DHJ D;  3W1Y A;  4IWO A;  1WF9 A;  1P7F A;  2K5P A;  2IND C;  3NJT A;  5LXH A;  2BPS A;  2IBI B;  1SE4 A;  1TY0 A;  1K51 A;  2QIL A;  2V4I B;  4GU2 A;  1XLN A;  4DDI D;  1N60 A;  3MHZ A;  1VZ6 A;  1LQB A;  2CU3 A;  3SD5 A;  1I35 A;  3SHQ A;  3GZN B;  1SE9 A;  2IGH A;  2WXM A;  1FD6 A;  2JXT A;  3AI5 A;  4XDC A;  2MH7 A;  1WMH A;  4N59 A;  1NI3 A;  1XD3 B;  1T5X D;  1QOG A;  2X38 A;  1GAQ B;  1SSN A;  1L0V B;  1LFD A;  2MJE A;  2RGF A;  5EDS A;  4YSY B;  3QX1 A;  3PGE A;  4WIP A;  4ZRI A;  2KC1 A;  3SFD B;  4P1C C;  2QC8 A;  3DCG A;  2LWP A;  3WAN A;  1XLQ A;  5IP4 D;  3WAP A;  1WGR A;  4EEW A;  4NZL B;  4L2Y A;  3R66 C;  3J9C A;  1R4N I;  5DPS A;  3ZXR A;  3BVG A;  4K1R B;  3P4P B;  2N7E A;  1F77 A;  1QOA A;  2WWZ A;  2ZJD A;  1R4N B;  3BY4 B;  1MHX A;  2ZEQ A;  4AP4 C;  1ZPS A;  2PTL A;  1YIW A;  1C4P A;  4CO7 A;  4DWF A;  2ZNV B;  2M1M A;  2Z59 B;  1P7E A;  2KTF A;  3NVV A;  1IGC A;  5E6N A;  5DPR A;  2JQR B;  2INN E;  1IGD A;  4ARI A;  1GC7 A;  2VRR B;  1WYW B;  3VRA B;  4J6I A;  2JVC A;  1XO3 A;  1D3Z A;  2ZW1 A;  1SGH A;  2MX2 A;  1F0Z A;  3AE8 B;  2Y3A A;  4XYC A;  3ALB A;  2BYE A;  4XE0 A;  3ZKJ C;  2MJD A;  4M00 A;  3ZTD A;  2KFK B;  1QLB B;  2ON8 A;  3CIR B;  4OZC A;  3UIN B;  4B0E A;  2HE7 A;  4AUQ C;  4B9K A;  1STE A;  2JY6 A;  2LGY A;  2R2Q A;  3HM6 X;  1MG8 A;  3JSV B;  3AE4 B;  1EO6 A;  4NJ7 A;  1MG4 A;  2MCN B;  3DHI C;  5HHD G;  3A1Q A;  4C80 A;  1KM7 A;  1I4G A;  3R7R A;  1EM7 A;  3AE1 B;  2V9H A;  3DPD A;  1MHH E;  5BYR A;  1ZXH A;  4UDU C;  1PUT A;  4YWG G;  2N1V A;  3Q3N C;  3RYT A;  5IAA C;  3NY5 A;  1HQR D;  2KDE B;  3VHT C;  2WXI A;  1OTR B;  1N62 A;  4BVU C;  1HE8 A;  2KMM A;  4GSW A;  3W9C B;  3WAM A;  1KLU D;  2KZR A;  3H6N A;  4FAD A;  5H8Y E;  1RLF A;  2K6Q A;  2DNF A;  4GB9 A;  4US8 A;  2QIE B;  2R2O A;  5JHA A;  2DLB A;  4BFR A;  2LJI A;  3AM9 A;  3VRB B;  2M8S A;  2L52 A;  2LGX A;  2JZP A;  3A4R A;  5EE3 A;  2GI9 A;  2IGG A;  4PK1 A;  1HTQ A;  1WXS A;  4PYZ A;  1NBF C;  4LNO A;  4WWN A;  2L32 A;  2KVZ A;  3ETR A;  5IN7 A;  4YXD B;  3ZDM C;  3LB8 C;  1N5W A;  3A9J A;  4C00 A;  1EWC A;  2VZK D;  1XT9 B;  2K39 A;  3L17 A;  5FK9 C;  2MP2 A;  3I9V 1;  3OAW A;  4TMA B;  1HEZ E;  2IO1 B;  2M56 B;  1CQV A;  1XLO A;  3P4Q B;  1VCB A;  3NVW A;  4C4V B;  1EU4 A;  3NVZ A;  1WJN A;  5GMV A;  1SEB D;  1WR1 A;  2O2V A;  2KLG A;  4NY0 A;  3ZNI D;  4M8M A;  2ZCB A;  1E10 A;  4II2 B;  1OQY A;  3AEC B;  2DEN B;  1WJ6 A;  3CST A;  3UGB B;  1WZ3 A;  5HI1 A;  3SFE B;  4GDL A;  2K6D B;  2K1F A;  4CHK A;  3NS1 A;  4FUL A;  3I3T B;  5BMH A;  2K8C A;  2PVO D;  4WQM A;  1VDV A;  3PO0 A;  1B9R A;  5G5G A;  2BF8 B;  3NVY A;  1C3T A;  3RNF C;  1R7S A;  3Q3O C;  1ESF A;  4C7Z A;  4LNF A;  4XWT A;  3PSE B;  3VUW A;  3W5V B;  4DXA B;  3V60 A;  3NS8 A;  3TL5 A;  1GOZ A;  2KAC A;  4GN1 A;  2DYM A;  2GMI C;  2PE9 A;  2YLM A;  3GS2 A;  2N7J A;  2G3Q B;  4B6W A;  2AWT A;  3WA0 A;  2HJ8 A;  4BKS A;  3FAH A;  3AU4 A;  2B76 B;  1V1O A;  4MM3 B;  1S1Q B;  3QWZ B;  2MBQ A;  2N9K A;  1DYQ A;  3VTV A;  3UF8 A;  1RAX A;  3DBR B;  2PMV A;  1GG3 A;  3RPF C;  1L0X B;  4LJP B;  2BB6 A;  2L76 A;  1C4A A;  5D3I B;  1F1H A;  1WRI A;  1WJ4 A;  4HRO A;  2LUE A;  1TGZ B;  1WE7 A;  2W54 A;  4QAY A;  2V4L A;  4C56 C;  2WGS A;  2GBK A;  2WYQ A;  5D6J B;  3A33 B;  1KFY B;  1HXY D;  3ZRC A;  1YJI A;  1KLV A;  1FNV A;  4JL9 A;  3NHE B;  2LVQ A;  2PIA A;  1WJU A;  4E71 A;  1WMH B;  4HDO A;  4K7S A;  4MGY E;  1E6E B;  2PJH A;  2IO2 B;  5DPT A;  1RRB A;  1ENF A;  3K9P B;  5D2M B;  4ZRQ A;  3R2I A;  5G55 A;  3HVZ A;  3IT6 B;  5FKA C;  3QAQ A;  5AZH A;  2GBJ A;  4IM0 A;  1V9J A;  2KXJ A;  2JYE A;  4M0W B;  1JWA D;  2KX3 A;  3Q3M C;  3CF6 E;  4HCP B;  3U4E G;  2LUM A;  3BZD B;  2KAJ A;  1EUV B;  4WH4 A;  4EZJ A;  2SEB D;  2WQY B;  4RH6 A;  3OG5 A;  4P1B C;  1WI0 A;  1YMH E;  1GNU A;  1L4Z B;  2KDB A;  2DZJ A;  2K22 A;  1E8X A;  2OJR A;  3D32 A;  3ONS A;  4MEM A;  4DHZ E;  2N7D A;  1YQB A;  3T9L A;  3B9J A;  4GDK B;  4YL8 A;  2DYO A;  1PYW D;  2WDT B;  2L00 B;  1I4P A;  2MBH A;  4I6P A;  3Q8B A;  1GB4 A;  2L1A A;  3TBL D;  2WXH A;  1CK1 A;  3TUO A;  4MEL A;  4OHJ A;  2NBV B;  5BMI A;  3KVF B;  1NDD A;  2A4Z A;  1ISN A;  2BTE A;  4ZYN A;  1JQ4 A;  4P7I A;  1ROE A;  4A90 A;  1Y8R C;  4ZRK A;  1DOX A;  3RNC C;  1OQR A;  2M4N A;  4RGN A;  2BVC A;  4FJZ A;  2WXG A;  4N6E B;  4IM2 A;  2DAJ A;  4ASW C;  1HA5 A;  2LXA A;  3M62 B;  4KV2 A;  1TS3 A;  4XX5 A;  1FNW A;  1YOV B;  1JML A;  2MWS B;  3R3M A;  3EHV A;  2JF5 A;  3BK1 A;  2GB1 A;  1P98 A;  1ZXI A;  1SXT A;  5JH5 C;  2LZ6 A;  2PKO A;  2DX5 B;  2FIF A;  3RZF A;  1EF1 A;  2AX5 A;  2L0F A;  3WCQ A;  3PHW B;  2NPT A;  5IA7 A;  2KHW B;  4K3C A;  3A9K B;  2KWV B;  4R3D A;  1F52 A;  1FRD A;  1ZKH A;  2KWU B;  4K81 A;  3UQA A;  3TEZ A;  3KH0 A;  3T8M A;  4HPM B;  4IG7 B;  5CHW A;  4MJS A;  2LRU A;  2QHO A;  2L0T A;  4N58 A;  2KN5 A;  2CKH B;  3A4S C;  5IOI A;  4P16 A;  1KTK A;  1GC6 A;  1FRR A;  3N1X C;  5I4D A;  2REX A;  1JAL A;  1ZE3 D;  5E6O A;  3H1U A;  1YD8 U;  2WXO A;  1BML C;  2KWC A;  2RMM A;  4I6N B;  2WX1 A;  4NJC A;  1ET9 A;  1YNT E;  3DVG X;  3PLV A;  1B1Z A;  1V5T A;  1TS5 A;  4F7Z A;  1N61 A;  3T3O A;  3VH4 B;  2J0K A;  3ZTC A;  1QOF A;  2BS4 B;  4XC2 A;  5DCN A;  1I4R A;  2O6V A;  2KJ6 A;  3NOB A;  2EKE C;  2AQ2 B;  3RNE C;  1I4X A;  2MQJ A;  3DDC B;  4G0N B;  3L10 B;  1ZW7 A;  2XK5 A;  2QDF A;  3OJ4 B;  1IBX B;  2ZZP B;  4LNK A;  4W9C A;  4JE3 B;  2V0G A;  5EE9 A;  1PGB A;  2PE6 B;  3APF A;  5LLI A;  4W9G A;  2C7H A;  3ENE A;  4WWM A;  4KSK C;  3N3K B;  3P4S B;  5BO4 B;  3M95 A;  4WUR A;  5E6J A;  2RDB C;  1SE3 A;  2JXX A;  3VUX A;  4LK0 M;  4AQ7 A;  2INP E;  2NCN A;  3FKY A;  3JW0 X;  3ZUN A;  1F2R C;  3W1S C;  3B1L X;  2K9X A;  1WX7 A;  2KFJ A;  3QHT A;  1KRH A;  2V3N A;  3TCA A;  4DK5 A;  4BOS C;  1SF0 A;  4HK2 A;  2JT4 B;  3L08 A;  4EKU A;  1FM0 D;  1JCK B;  2DZI A;  3Q69 A;  4E3C A;  2K25 A;  4XZ4 A;  4EOY A;  2G45 B;  4XDD A;  1H4R A;  5FR6 A;  4KIK B;  4FHJ A;  2KQ7 A;  1EU3 A;  2V3P A;  2LMC A;  3AEB B;  4NAW A;  4LCD E;  2MSE D;  4L1B A;  2VH1 A;  4TUU A;  5C23 A;  5LNK 1;  3H7P A;  2AQ3 B;  1ACC A;  1FNU A;  4FXC A;  3DVN U;  3VDZ A;  3NRZ A;  3ZQ4 A;  2J4X A;  4L23 A;  4HKQ A;  4ICV A;  1QIL A;  3GB1 A;  2KJH B;  4BZA A;  3Q3J A;  2JRH A;  2WU5 B;  4WJQ A;  1AWD A;  3MJ5 A;  4HLE A;  4A55 A;  3JYU A;  4IKG A;  3RI7 C;  3RNG C;  2IYD B;  2JX5 A;  3ZNG C;  2G1E A;  4EUT A;  2KDF B;  1SJH D;  1J7B A;  4RF1 A;  1AAR A;  1ZP0 B;  2ICI A;  3H9D A;  4EE2 A;  1BXT A;  2JWZ A;  3E56 A;  4BKS D;  4IWQ A;  2UWQ A;  4WAA A;  4MT5 A;  2KTR B;  4ZRP A;  4Q2J A;  3FIL B;  2BW2 A;  2OHF A;  1K52 A;  3ZJU A;  1TT5 B;  3W1S A;  1F9J A;  1PGX A;  4RM9 A;  2J42 A;  2WDV B;  4YTP B;  5CTR C;  4DXG A;  1YQ3 B;  1ET6 A;  2PPH A;  1L5P A;  2Z0E B;  1V80 A;  1DOY A;  1ZDX A;  4FN2 A;  3BVM A;  5HKH A;  4HJK A;  2C7M B;  3IHP C;  1V1P A;  1V2Y A;  1K8R B;  2WDR B;  5IKC M;  1WWT A;  1L6V A;  4RGO S;  1AW7 A;  4S17 A;  1DOI A;  2KK8 A;  1I4H A;  3RUL A;  1TKE A;  1D6E C;  3PZD A;  2FCQ A;  3DBS A;  2XNA C;  1TTN A;  1E7P B;  1SJE D;  3TIX A;  2NTT A;  2ASQ A;  2LVP A;  2MJ3 A;  1Q5W B;  4EZK A;  2ZCC A;  3AN1 A;  2RR9 A;  3C8Y A;  1Z2M A;  5KHQ A;  4ZDV A;  3KQ4 A;  1TY2 A;  2VZK B;  4JIO U;  3EGR A;  1XXG A;  3ABV B;  1JWS D;  2WXK A;  4MSQ B;  5J2R A;  2BBC A;  2KT7 A;  1FIQ A;  2LHE A;  4MGK E;  1CMX B;  2KC2 A;  4AWJ A;  4MSM B;  1V8C A;  2KNB A;  4IUM B;  2WNM A;  4IW0 A;  2BGF A;  3KUC B;  1FXA A;  1V81 A;  1L2N A;  2M0X A;  2D11 A;  1UF0 A;  1M94 A;  2GLS A;  3P42 A;  1SE2 A;  1N63 A;  4TKN A;  2IJ0 A;  1SIJ A;  2FUG 1;  2CHX A;  4MGI E;  1ZGU B;  4TQ0 A;  2IGD A;  1JWM D;  3LYY A;  3SEB A;  2NR2 A;  1NEN B;  3VFK A;  4K7W A;  1GPX A;  2AEH A;  1Q0W B;  4WWP A;  2WHI A;  2QMT A;  1FXI A;  5HFY A;  4PYU A;  4OZB A;  5JZE B;  2EMS A;  4GGQ A;  3ZXV A;  3QIJ A;  2JRI B;  4HCN B;  3WIM A;  2WP9 B;  2ZNV C;  5BYQ A;  2L05 A;  1PQS A;  1T0Y A;  2WX0 A;  1QOB A;  2JU6 X;  2W3S A;  3AXC A;  3APD A;  1YN3 A;  2CJO A;  4MDK E;  3VAW A;  1TYG B;  4EFO A;  2Z8L A;  3QC8 B;  2OJW A;  2LEK A;  2NVU I;  1BT0 A;  5E6P A;  3AEF B;  3Q8F A;  1TJE A;  3IFW B;  4A3O A;  2I38 A;  4MJS B;  4BKG A;  2KDM A;  2PEA A;  3IG3 A;  3BK2 A;  5G5H A;  5TR5 A;  1Q10 A;  4G3X B;  2DHZ A;  2ONQ A;  2WU2 B;  3ML8 A;  3IXS A;  4JGH B;  1MI0 A;  4LDT D;  2MA9 B;  2ZVO A;  3U2S C;  5L83 A;  3V61 A;  2N9E B;  1UGJ A;  2WXF A;  1WH3 A;  3GE3 C;  2GBM A;  2KN4 A;  2GOW A;  1YQ4 B;  1VRA B;  1YN5 A;  2D5G A;  2NBW B;  1T3Q A;  2EMT A;  2O6V B;  1C78 A;  1UBI A;  1QT9 A;  4RM8 A;  1S3S G;  4JWU C;  4D2K A;  2XEW A;  1E7V A;  1TKY A;  4KSL C;  4GIV A;  4RGM A;  3UQB A;  1FFU A;  1Q1O A;  3AE2 B;  4AJY B;  3PRM B;  1TS4 A;  2FBW B;  2LI5 A;  4YTM B;  2RPQ A;  3U30 A;  3Q3F A;  3EFU A;  4FA6 A;  4FBJ B;  2DZK A;  1E9M A;  4FJV B;  3RNB C;  3IBE A;  1V6E A;  1IPG A;  2W82 A;  2JZ3 B;  3V6C B;  4YSZ B;  3VR8 B;  1FMA D;  1QKZ A;  1WR6 E;  3AE6 B;  1QF6 A;  4RFB A;  1JWB D;  3GOE A;  2MW5 A;  3PZ8 A;  3QQ8 B;  3WAO A;  1CJE A;  4US9 A;  3R8B A;  1HZ6 A;  2KFK A;  2O6V D;  3X23 A;  1R4M I;  2KMA A;  4YT0 B;  3VTU A;  2BYF A;  4HXD A;  1K50 A;  2D3B A;  2IY0 B;  2OOB B;  1I7H A;  2MHJ A;  2BYV E;  1ZUD 2;  1AN8 A;  1XCQ L;  3JVZ X;  3JSV A;  4JLC A;  3KYD D;  1V5O A;  1WYG A;  3H7P B;  5HG2 A;  1NYR A;  1WFY A;  4I6L B;  3EEC A;  3DOW A;  4ZOH C;  2WXL A;  1T6B X;  4P6V F;  5TSS A;  4MH8 A;  1OQQ A;  1U4A A;  3URY A;  1WX9 A;  3TEY A;  4ARC A;  1KJT A;  4BBN F;  4K3B A;  1RM6 C;  3B0A A;  1KLG D;  4FJY A;  3V62 A;  2FCN A;  1PDX A;  2K8B A;  4TQ1 A;  4WWO A;  1XLP A;  3ZYY X;  4IOI E;  2FNJ B;  3N20 C;  1GUA B;  3HIZ A;  2IY1 B;  4ZRJ A;  1GB1 A;  3L16 A;  4NPN A;  1YJ1 A;  4CQN A;  1CZP A;  5AEK B;  4HKZ E;  5D7G A;  2GBN A;  1YN4 A;  3BVZ A;  3IVF A;  1UGM A;  3VUY A;  2D3A A;  2G4D B;  4IC7 B;  2IPK D;  2XBB C;  1E5W A;  4DQO C;  2YEP F;  1FFV A;  4KGS A;  1VJK A;  2AL6 A;  3DHH C;  4JQW C;  2J7Q B;  2J0J A;  3VVW B;  1V1P B;  1L7Y A;  1MJD A;  4KKI A;  3V3X A;  3A1Q B;  1TS2 A;  4JWS C;  2Y5B B;  4NNJ B;  3KWL A;  1V97 A;  1T0R C;  1ZDV A;  4RGT A;  4W9L A;  2I1K A;  1WY8 A;  4WJO A;  2JSV X;  1L6U A;  4OZA A;  4KKJ A;  1A70 A;  2CU1 A;  3AU5 A;  4C4V A;  4PT5 A;  2WXP A;  2RD0 A;  3NUH B;  3MC0 B;  2MBE A;  3BII D;  2CHW A;  4M02 A;  2LGI A;  3MHS D;  1D4B A;  2BKR B;  4RNA A;  2NS5 A;  1YX6 B;  3W2D A;  3ZNH B;  4G11 A;  4YTN B;  4EZL A;  2MRP A;  3L0W B;  2IO0 B;  4ANX A;  3RZW C;  4RCO A;  4K7U A;  1E8Y A;  1J19 A;  1LM8 B;  2WS3 B;  4GOC A;  2HJ1 A;  1RWS A;  5JXV A;  4KGR A;  1NI2 A;  2BS3 B;  3AE5 B;  1GJZ A;  4ZHO A;  2N1W A;  1L4D B;  1V86 A;  1JWU D;  1X1M A;  2E6X A;  2D2Q A;  3VXW A;  4TSS A;  1MPE A;  1T0Q C;  1XQQ A;  3A9J B;  4BOZ B;  3LXF A;  4ANU A;  1E8Z A;  1WXA A;  3HHM A;  2MP2 B;  2H89 B;  4CYE A;  3FC4 A;  3L4P A;  4ANW A;  2AQ1 B;  3PRZ A;  2KX0 A;  2QCZ A;  1P0R A;  1WM2 A;  2DZM A;  3U8Z A;  1K53 A;  4LNN A;  5L95 C;  2J0M A;  5IO9 A;  2O2V B;  4DXF A;  3U7Z A;  3QA8 A;  2Y5C A;  3PLU A;  2A5U A;  2V1Y A;  4ITK A;  1OEY J;  1E7U A;  4KGT A;  2KD0 A;  5FR3 A;  4GDL B;  1E8W A;  1TIF A;  3GZN I;  3KLS X;  4JX1 C;  4AJW A;  3M63 B;  2KKC A;  3Q8A A;  4DDG D;  3QCA A;  3RCZ A;  1FXT B;  2J52 A;  5GXG B;  1AYF A;  2W3R A;  3V05 A;  2NBU A;  1WGG A;  2HD5 B;  1E0Z A;  1VLB A;  1J0G A;  4H2A A;  1WSP A;  2H88 B;  4MGZ E;  1XF5 L;  4IDI A;  5C1Z A;  1SBB B;  4MH0 E;  3P1M A;  3MTN B;  1WGD A;  4X57 B;  2JPH A;  1G6J A;  3BWU D;  3IT4 B;  5C2T B;  4C7Y A;  3PHX B;  3EC8 A;  1IP9 A;  1TZ1 A;  1WGY A;  3P4R B;  4M0W A;  1J7C A;  3B08 A;  1VZ7 A;  4WAF A;  3I5J C;  4USA A;  1E90 A;  3X0W A;  1LXD A;  2IZV B;  1PFD A;  3Q8E A;  1FCC C;  2N9X A;  4W9H A;  4BKT A;  3AE7 B;  2QSD A;  3Q14 C;  3EFC A;  1MFW A;  3QAR A;  1NYQ A;  2C5L C;  3RMK C;  3S2A A;  3PT2 B;  1J8C A;  4FLH A;  2Q5W D;  4KDI C;  4HEA 1;  2LD9 A;  2R61 A;  1D5X C;  5T8I A;  2Z0D B;  4W9D A;  3N9Y C;  2WXJ A;  4A3P A;  2C7N B;  2BQQ A;  3AE9 B;  3PV1 A;  2DBY A;  4GDK A;  3Q8C A;  2LXC A;  1P9D U;  4B95 A;  1NEK B;  1BUI C;  3LJ3 A;  2ZPN A;  3GE8 C;  3ZIM A;  3O65 B;  1Z5S B;  2DAF A;  2LFI A;  3SU8 X;  3KW5 B;  2OED A;  3KUD B;  3RNA C;  2BYT A;  3MC8 A;  3EUB 2;  3N1Y C;  4NQL B;  2X8X X;  3RUI B;  4OVV A;  2GRI A;  1XEE A;  2G9H D;  1FEH A;  4ZHP A;  2EKI A;  3R2T A;  3AV8 A;  3SDL C;  3BYY B;  3P2B A;  2HTM E;  4NJ6 A;  3RN9 C;  2QEJ C;  3UIO B;  2KDI A;  1N5X A;  4MAC A;  2BB5 A;  2N9L A;  3ZGZ A;  1KF6 B;  3R7Q A;  1MVK A;  2WXR A;  3NZ3 A;  3KUZ A;  4HWI B;  2C60 A;  3NG0 A;  3NZU A;  4RMA A;  2W9N A;  5AUK A;  3RD2 A;  1QZE A;  3N30 A;  3AED B;  3A9K A;  3CWI A;  1WRD B;  2BWF A;  5MPO A;  3HRD D;  3K9O B;  3MC9 A;  5AUI A;  2DWQ A;  2FUH B;  1QQR A;  3QK0 A;  4W9K A;  2TSS A;  5EE1 A;  3O13 A;  1C9F A;  2KQS A;  2KVR A;  1VZ8 A;  2FE8 A;  3B2F A;  4KZC A;  5JHB A;  3DWG C;  1N6Z A;  4PS7 A;  4M01 A;  2KYW A;  1KOT A;  1FO4 A;  4J3O D;  4W9E A;  2ACZ B;  3P63 A;  4PS8 A;  1OFF A;  3OLM D;  1TBE A;  2XN9 C;  2PLP A;  1YJJ A;  4AS1 A;  5J17 A;  3N1Z C;  1SB3 C;  3AUL A;  1L0Y B;  4KZ0 A;  5BYS A;  4HRS A;  4S0R A;  1UWM A;  2KWD A;  5CHF A;  4LDT B;  1LGR A;  2QJL A;  2VH2 A;  2AYO B;  3VR9 B;  3IAM 1;  5KHO A;  3AB5 A;  3MP9 A;  1IBX A;  3DVN V;  4F8C B;  2L8J A;  4WJP A;  1WX8 A;  5EE0 A;  2NPT B;  1UUP A;  1LO5 D;  3ZDT A;  2W55 A;  1OGW A;  4HDQ A;  2LAS A;  3ZNZ B;  1TZO A;  2JWU A;  4AOF A;  3AEA B;  1ZOY B;  2ZW0 A;  3EA6 A;  2N0S B;  1EWY C;  3MFG A;  3MJW A;  3V6E B;  4DBG A;  3TMP B;  1WGK A;  1XCT L;  2SAK A;  2UU7 A;  1EF5 A;  1KH0 A;  2FAZ A;  3DBH I;  2LGS A;  2M17 A;  4HPL B;  4F1S A;  4KIK A;  3VH3 B;  4FHK A;  3PRP B;  2L3Z A;  3LDZ E;  5AZG A;  3DBH B;  2KLC A;  2WLB A;  1T0S C;  5DPW A;  2IO3 B;  2LJ5 A;  3DBR I;  5D3D A;  3RT3 B;  4OW0 A;  2DYB A;  2ZVN A;  2D3C A;  1UH6 A;  1P1A A;  4IM3 A;  4A9A A;  1WXQ A;  2N9P C;  3AE3 B;  2XK5 B;  4WQO B;  3M3J A;  1WIA A;  1RFK A;  4A20 A;  2M0A A;  1UWX A;  3N32 A;  3ZO5 B;  4HPP A;  1P3Q U;  4A6Q A;  2E3T A;  2MBB B;  3ZRF A;  2AL3 A;  3PRE A;  1C76 A;  3AEG B;  5H92 C;  3T3N A;  2YEP B;  2YVC A;  4HVB A;  2KOX A;  2CR5 A;  4B0M A;  3GP7 A;  5AZF A;  4NAM A;  4II3 B;  3UI3 A;  1WXV A; 
#chains in the Genus database with same CATH homology
 2V3S A;  2KTR A;  2CHW A;  4ICV A;  3MHS D;  4GXB A;  3ZDM C;  3ML9 A;  4LJO B;  4URK A;  2KJH B;  2UYZ B;  3A9J A;  2BKR B;  2JRH A;  3Q3J A;  4WJQ A;  2KJR A;  2NS5 A;  1VD2 A;  1XT9 B;  2CHZ A;  5J18 A;  2K39 A;  1YX6 B;  3ZNH B;  4HLE A;  3JYU A;  4G11 A;  1RFA A;  2LVO A;  2IYD B;  4EZL A;  3L17 A;  3ZNG C;  2MRP A;  3L0W B;  2MP2 A;  2IO0 B;  2RSU A;  3OAW A;  4ANX A;  3RZW C;  2KDF B;  4EUT A;  1H8C A;  5G2N A;  4K7U A;  4N9F 4;  2IO1 B;  4NAW B;  1E8Y A;  1J19 A;  1LM8 B;  4GOC A;  1AAR A;  3H9D A;  2JWZ A;  3PVL A;  1VCB A;  4BKS D;  4IWQ A;  1NI2 A;  3ZW3 A;  1GJZ A;  2UWQ A;  4WAA A;  1WJN A;  2FID A;  5GMV A;  2N1W A;  1V86 A;  1WR1 A;  2KTR B;  2O2V A;  4WJN A;  2KLG A;  4NY0 A;  4DHZ B;  1X1M A;  3ZNI D;  4M8M A;  2D2Q A;  3ZLZ A;  2ZCB A;  3VXW A;  3HK0 A;  4II2 B;  1OQY A;  1UEL A;  2DEN B;  1XQQ A;  1WJ6 A;  3CST A;  2JZZ A;  3A9J B;  2FCM A;  4BOZ B;  3W1S A;  3QJZ A;  1F9J A;  3UGB B;  4RM9 A;  4ANU A;  1WZ3 A;  3L13 A;  1E8Z A;  2K8H A;  2KO3 A;  5CTR C;  1WXA A;  2CS4 A;  3HHM A;  4GDL A;  2K6D B;  2MP2 B;  2K1F A;  4CYE A;  4CHK A;  2PPH A;  2Z0E B;  1V80 A;  4FN2 A;  1YX5 B;  4FUL A;  3I3T B;  5HKH A;  3PTF C;  4HJK A;  4ANW A;  2K8C A;  3PRZ A;  2KX0 A;  2C7M B;  4TV3 A;  1P0R A;  3IHP C;  1WM2 A;  2BF8 B;  2DZM A;  1V2Y A;  1WZ0 A;  1K8R B;  3U8Z A;  1C3T A;  2N4F A;  5L95 C;  2HTH A;  2J0M A;  2O2V B;  4KVG B;  3QA8 A;  3PLU A;  3PSE B;  2KK8 A;  3VUW A;  4DXA B;  3V60 A;  3RUL A;  2A5U A;  3NS8 A;  3TL5 A;  3PZD A;  2JUO A;  2V1Y A;  2FCQ A;  4IWP A;  1OEY J;  1E7U A;  4GN1 A;  2DYM A;  2GMI C;  2PE9 A;  3DBS A;  2YLM A;  4ANV A;  2KD0 A;  2G3Q B;  4B6W A;  1TTN A;  2AWT A;  4GMV A;  3WA0 A;  2HJ8 A;  4GDL B;  4BKS A;  3TIX A;  1E8W A;  3GZN I;  2ASQ A;  2LVP A;  4AJW A;  3DBL I;  3AU4 A;  3M63 B;  2KKC A;  1Q5W B;  2LRW A;  1S1Q B;  4EZK A;  4DDG D;  2D3G A;  3ZVV A;  2ZCC A;  3QWZ B;  2BKF A;  3QCA A;  2RR9 A;  3RCZ A;  1FXT B;  1Z2M A;  5KHQ A;  4ZDV A;  2MBQ A;  5D94 A;  2NBU A;  1WGG A;  5LXI B;  2B3A A;  4JIO U;  3VTV A;  3UF8 A;  2HD5 B;  1RAX A;  4MSQ B;  1GG3 A;  4BBN C;  1J0G A;  4G50 A;  2L7R A;  2G4S A;  1UD7 A;  3APC A;  3NZS A;  5J2R A;  4PS3 A;  4LJP B;  1IYF A;  2FCS A;  2L76 A;  3BIN A;  3PPA A;  4MGZ E;  5C1Z A;  4MGK E;  1CMX B;  1WJ4 A;  2KC2 A;  4MSM B;  4AWJ A;  4MH0 E;  3MTN B;  3CMM B;  2KNB A;  1WGD A;  2LUE A;  4X57 B;  3CSF A;  4IUM B;  1TGZ B;  2JPH A;  1WE7 A;  4IW0 A;  1G6J A;  2GBR A;  3DVG Y;  2V4L A;  2C9W B;  2BGF A;  3KUC B;  3PHX B;  3EC8 A;  4W9I A;  1V81 A;  2GBK A;  2MLB A;  2WYQ A;  5D6J B;  2M0X A;  1TZ1 A;  3A33 B;  2D07 B;  2D11 A;  1WGY A;  1IP9 A;  1SIF A;  4NQK E;  1M94 A;  3H7S A;  3ZRC A;  4ICU A;  3B08 A;  3WAL A;  1KLV A;  4TKN A;  2BWE S;  4JL9 A;  3NHE B;  2LVQ A;  1WM3 A;  1E90 A;  3X0W A;  1LXD A;  1WJU A;  2I1J A;  2IZV B;  1UZX B;  4E71 A;  2CHX A;  4W9F A;  1WMH B;  4MGI E;  1ZGU B;  4TQ0 A;  1WE6 A;  2N9X A;  3PS6 A;  4W9H A;  4HDO A;  4K7S A;  4MGY E;  2NR2 A;  4BKT A;  3HM3 A;  2D10 A;  4K7W A;  3VFK A;  2AEH A;  2PJH A;  2ZPY A;  1Q0W B;  1A5R A;  4WWP A;  1V49 A;  2IO2 B;  1OEY A;  5DPT A;  1RRB A;  3QAR A;  4PYU A;  3K9P B;  2C5L C;  5D2M B;  3S2A A;  3PT2 B;  3U7D A;  5G55 A;  5JZE B;  2EMS A;  4GGQ A;  1J8C A;  4FLH A;  1WGH A;  4W9J A;  1C1Y B;  3QAQ A;  3QIJ A;  4KDI C;  5AZH A;  2GBJ A;  1JRU A;  2JRI B;  1V9J A;  2LD9 A;  4HCN B;  4IM0 A;  3WIM A;  4DHJ B;  3OJ3 A;  2KXJ A;  2Z0D B;  5CX3 A;  3DQV A;  4W9D A;  4E74 A;  4M0W B;  4OVU A;  2KX3 A;  4A3P A;  2C7N B;  1UBQ A;  2ZNV C;  3CF6 E;  2L05 A;  3PV1 A;  4HCP B;  3UIP B;  1I42 A;  4GDK A;  1PQS A;  2KMC A;  1T0Y A;  2LXC A;  1P9D U;  4B95 A;  2WX0 A;  3L54 A;  3VTW A;  1EUV B;  3AXC A;  3LJ3 A;  4EZJ A;  2ZPN A;  2LGD A;  3APD A;  2KAN A;  4MDK E;  3ZIM A;  1WXM A;  3VAW A;  4MM3 A;  4EFO A;  3KYC D;  3QC8 B;  2NVU I;  1BT0 A;  3O65 B;  3ECI A;  4M8N A;  1Z5S B;  1WI0 A;  4KDL B;  3TJP A;  1GNU A;  2DAF A;  5E6P A;  2KDB A;  3SU8 X;  3C0R B;  3KW5 B;  5CHV C;  3VQI A;  2DZJ A;  3KUD B;  2MBO A;  1E8X A;  2OJR A;  3D32 A;  3IFW B;  3ONS A;  4MEM A;  4A3O A;  4MJS B;  4BKG A;  4DHZ E;  4DHJ D;  2N7D A;  4NQL B;  1YQB A;  3RUI B;  4OVV A;  2PEA A;  3IG3 A;  3T9L A;  4IWO A;  3W1Y A;  1WF9 A;  4GDK B;  4YL8 A;  5TR5 A;  2DYO A;  2WDT B;  2L00 B;  2MBH A;  4I6P A;  4G3X B;  2DHZ A;  5LXH A;  2BPS A;  3ML8 A;  2IBI B;  3TBL D;  4JGH B;  4LDT D;  3SDL C;  3P2B A;  4NJ6 A;  4MEL A;  2MA9 B;  4GU2 A;  4DDI D;  3UIO B;  2KDI A;  2ZVO A;  5L83 A;  3V61 A;  1LQB A;  2N9E B;  3SD5 A;  1I35 A;  2NBV B;  3SHQ A;  1SE9 A;  3KVF B;  1WH3 A;  3R7Q A;  1NDD A;  3AI5 A;  2A4Z A;  2GBM A;  1ISN A;  2GOW A;  1WMH A;  2NBW B;  4ZYN A;  1XD3 B;  3KUZ A;  4HWI B;  2C60 A;  2EMT A;  3NZU A;  2O6V B;  4RMA A;  1UBI A;  4P7I A;  1LFD A;  2RGF A;  2W9N A;  4RM8 A;  1S3S G;  1Y8R C;  5EDS A;  4ZRK A;  3QX1 A;  2XEW A;  1E7V A;  3PGE A;  1QZE A;  4KSL C;  2KC1 A;  4GIV A;  4ZRI A;  3RD2 A;  3N30 A;  3UQB A;  1Q1O A;  3DCG A;  2LWP A;  3A9K A;  3WAN A;  2M4N A;  4AJY B;  3PRM B;  4FJZ A;  3WAP A;  1WRD B;  2BWF A;  4IM2 A;  1WGR A;  2LI5 A;  4EEW A;  2DAJ A;  4ASW C;  3R66 C;  2LXA A;  3K9O B;  3M62 B;  4KV2 A;  2RPQ A;  1R4N I;  3U30 A;  2FUH B;  3Q3F A;  4XX5 A;  5DPS A;  4K1R B;  2MWS B;  3R3M A;  3EHV A;  3EFU A;  3QK0 A;  2JF5 A;  4W9K A;  4FA6 A;  4FBJ B;  2N7E A;  2DZK A;  4FJV B;  1P98 A;  3IBE A;  1V6E A;  5JH5 C;  2LZ6 A;  1IPG A;  2KQS A;  2JZ3 B;  3V6C B;  2DX5 B;  2WWZ A;  2ZJD A;  1WR6 E;  2KVR A;  3GOE A;  3BY4 B;  2MW5 A;  3QQ8 B;  4KZC A;  3WAO A;  2FIF A;  5JHB A;  2ZEQ A;  4AP4 C;  3RZF A;  4PS7 A;  1EF1 A;  2KFK A;  2O6V D;  3X23 A;  2L0F A;  1KOT A;  1R4M I;  1YIW A;  4CO7 A;  2KMA A;  3PHW B;  4DWF A;  2NPT A;  5IA7 A;  4W9E A;  2KHW B;  3VTU A;  2ZNV B;  3A9K B;  2BYF A;  2M1M A;  2Z59 B;  4HXD A;  2KWV B;  2KTF A;  5E6N A;  5DPR A;  4PS8 A;  1ZKH A;  2IY0 B;  2KWU B;  3OLM D;  2OOB B;  4K81 A;  3UQA A;  1TBE A;  3KH0 A;  3T8M A;  4HPM B;  4IG7 B;  5CHW A;  2BYV E;  1GC7 A;  2VRR B;  4MJS A;  2LRU A;  5J17 A;  1WYW B;  2QHO A;  2L0T A;  3AUL A;  3JVZ X;  4J6I A;  2JVC A;  2KN5 A;  2CKH B;  3JSV A;  4KZ0 A;  3A4S C;  1D3Z A;  4JLC A;  3KYD D;  1V5O A;  1SGH A;  1GC6 A;  5CHF A;  4LDT B;  2MX2 A;  2REX A;  3H7P B;  1WFY A;  2AYO B;  3ALB A;  2BYE A;  4I6L B;  3EEC A;  3ZKJ C;  5E6O A;  3H1U A;  1YD8 U;  5KHO A;  3DVN V;  3DOW A;  4F8C B;  2KWC A;  4I6N B;  2L8J A;  4WJP A;  2KFK B;  3ZTD A;  1U4A A;  2WX1 A;  1WX8 A;  3DVG X;  2NPT B;  3PLV A;  1WX9 A;  1KJT A;  1V5T A;  4BBN F;  3ZDT A;  4F7Z A;  3B0A A;  3UIN B;  1OGW A;  4FJY A;  3V62 A;  3VH4 B;  2FCN A;  2HE7 A;  2K8B A;  4TQ1 A;  4HDQ A;  4WWO A;  2J0K A;  3ZTC A;  4AUQ C;  4B9K A;  2LAS A;  2JY6 A;  3ZNZ B;  4XC2 A;  4AOF A;  2LGY A;  2R2Q A;  5DCN A;  2FNJ B;  1GUA B;  3HM6 X;  3HIZ A;  2IY1 B;  1MG8 A;  3JSV B;  4ZRJ A;  2O6V A;  2KJ6 A;  3L16 A;  3NOB A;  2EKE C;  1YJ1 A;  4NPN A;  1EO6 A;  4NJ7 A;  2MCN B;  2MQJ A;  5AEK B;  3MJW A;  5D7G A;  3DDC B;  4G0N B;  2GBN A;  1ZW7 A;  3L10 B;  3V6E B;  2XK5 A;  4DBG A;  3TMP B;  3A1Q A;  3OJ4 B;  1EF5 A;  2ZZP B;  4W9C A;  3IVF A;  1KM7 A;  2FAZ A;  1UGM A;  3DBH I;  3R7R A;  2M17 A;  4HPL B;  2PE6 B;  3APF A;  5LLI A;  3VUY A;  2G4D B;  4F1S A;  4W9G A;  4KIK A;  1L2N A;  3DPD A;  2C7H A;  3ENE A;  4KSK C;  3VH3 B;  3N3K B;  4IC7 B;  5BO4 B;  2XBB C;  4FHK A;  3M95 A;  3PRP B;  1E5W A;  2L3Z A;  3LDZ E;  5AZG A;  2JXX A;  2N1V A;  3RYT A;  3VUX A;  2KLC A;  5IAA C;  5DPW A;  2IO3 B;  2NCN A;  3JW0 X;  3NY5 A;  3ZUN A;  2LJ5 A;  2AL6 A;  2KDE B;  3DBR I;  4JQW C;  3VHT C;  3RT3 B;  1OTR B;  2DYB A;  2J7Q B;  3W1S C;  3B1L X;  2ZVN A;  2J0J A;  1UH6 A;  1WX7 A;  1HE8 A;  2KFJ A;  3QHT A;  1P1A A;  4BVU C;  3TCA A;  4GSW A;  4BOS C;  3VVW B;  4DK5 A;  4HK2 A;  3WAM A;  2JT4 B;  4IM3 A;  2KZR A;  1L7Y A;  3H6N A;  3L08 A;  2N9P C;  4EKU A;  4FAD A;  1RLF A;  2XK5 B;  2K6Q A;  3M3J A;  4WQO B;  1WIA A;  3A1Q B;  4A20 A;  2Y5B B;  2DZI A;  4NNJ B;  4GB9 A;  4E3C A;  2K25 A;  4XZ4 A;  3N32 A;  3ZO5 B;  4EOY A;  2R2O A;  1P3Q U;  2G45 B;  2MBB B;  1H4R A;  5FR6 A;  4W9L A;  2AL3 A;  4KIK B;  3ZRF A;  2I1K A;  3PRE A;  1WY8 A;  4FHJ A;  2KQ7 A;  5JHA A;  4BFR A;  4WJO A;  4NAW A;  2M8S A;  2LGX A;  3A4R A;  4LCD E;  2MSE D;  2CU1 A;  2YVC A;  2KOX A;  2CR5 A;  3AU5 A;  4HVB A;  4TUU A;  5C23 A;  1WXS A;  3H7P A;  4PYZ A;  5AZF A;  1NBF C;  4WWN A;  4II3 B;  2RD0 A;  3DVN U;  3VDZ A;  2MBE A;  1WXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...