4JGHB

Structure of the socs2-elongin bc complex bound to an n-terminal fragment of cullin5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor of cytokine signaling 2
publication title Structural basis of intersubunit recognition in elongin BC-cullin 5-SOCS box ubiquitin-protein ligase complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 23
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4jghB00
1WJUA 4AJYB 2ZPYA 4FJYA 3ML8A 4G11A 4F7ZA 1V6EA 3WA0A 2KQSA 3AXCA 4PS7A 2XEWA 2JVCA 5AZGA 2MBQA 5AZFA 4RM8A 1Y8RC 1YX5B 2REXA 2JUOA 2KC2A 5CHFA 5C23A 3ONSA 2KDEB 4JL9A 2KTRA 2VRRB 3A9KB 5E6NA 4DHJD 2A4ZA 1AARA 2V3SA 2NS5A 3PS6A 4HPLB 1XT9B 4NQKE 3VUYA 3WALA 2WX0A 1YD8U 2FCMA 1WJ6A 3QAQA 1WX8A 2AWTA 1GUAB 2KD0A 4ICUA 3ZVVA 5LXIB 2K6QA 4ANVA 2XK5B 3ZDMC 3GOEA 1WXAA 4KZCA 1NBFC 4MSQB 4FLHA 4N9F4 2KDFB 4KV2A 2RSUA 1LM8B 4HLEA 1S1QB 5GMVA 1LXDA 4DHZB 3AULA 3QHTA 3UQBA 3MTNB 3KVFB 4ICVA 2KWCA 4JIOU 1LQBA 3A9JB 4MELA 3VAWA 3U30A 1Q5WB 5J18A 5DPWA 3UF8A 4B95A 2R2OA 4ZRIA 4EKUA 2BKFA 4FHJA 2LRWA 2D2QA 4CO7A 1TZ1A 3T9LA 2GBJA 5D6JB 2KWUB 1L7YA 1CMXB 2ZNVB 1PQSA 2ZVOA 4AP4C 4FA6A 4NAWB 2KXJA 2KJHB 4KIKB 1GC6A 4LDTD 4XZ4A 3L16A 4DBGA 1J0GA 2NBUA 2ZCBA 3PLVA 4HVBA 2LRUA 3ZIMA 1WJ4A 5E6OA 3TMPB 3UIPB 3UQAA 3DVGY 1SGHA 4M8NA 4RMAA 2HE7A 2HD5B 3A1QA 2JXXA 2N9XA 2D3GA 3T8MA 1HE8A 2DZMA 2JZ3B 4KDIC 4MGZE 2G4DB 1NI2A 4PYUA 4E3CA 1ZKHA 3APCA 1E5WA 3A4RA 1WR6E 3EC8A 4FULA 4KSKC 3RYTA 4ANXA 1OEYA 1VCBA 2KMCA 2LWPA 2BPSA 4DDID 1WE7A 4W9GA 1WRDB 1KM7A 3PHXB 4XX5A 3PREA 3B08A 2M4NA 1UZXB 1WMHA 1R4MI 3HHMA 2G3QB 3DBLI 2GMIC 2ZCCA 1WI0A 1WE6A 4AUQC 1E90A 2L8JA 1RFAA 4BFRA 1GG3A 2NR2A 4DWFA 3OJ4B 4A3PA 1WJNA 3A33B 2YLMA 2K1FA 3I3TB 1EF1A 3V6CB 1OTRB 2JWZA 2LZ6A 1P3QU 4GIVA 1V80A 4LJPB 4PS8A 2J0KA 5C1ZA 3ZNHB 4TQ1A 4WJNA 2OJRA 2KLGA 2FCQA 2GBMA 3ALBA 3DBRI 2FNJB 1VD2A 2QHOA 3QX1A 3EECA 3IFWB 1V86A 2RPQA 1JRUA 3PTFC 1S3SG 3VTUA 3WAPA 4EZJA 3X23A 2AEHA 2ZPNA 2WX1A 4MSMB 3VUWA 3RZFA 1YX6B 3KYCD 5L95C 2MX2A 3TL5A 1WYWB 2KOXA 3QJZA 2I1JA 2KJRA 4NPNA 3BY4B 4MJSA 3NOBA 4AWJA 2MA9B 3A1QB 3PPAA 4ASWC 2DZJA 3PZDA 2KJ6A 3Q3FA 1E8XA 2LVQA 3LDZE 2BKRB 3PGEA 2M0XA 5BO4B 2KK8A 4MEMA 1XQQA 4B9KA 1E8WA 3A4SC 5FR6A 2EMTA 3ENEA 4JGHB 4FBJB 4KSLC 4KZ0A 5DPRA 5JH5C 4W9CA 4AJWA 4F1SA 1WF9A 2AYOB 4HXDA 2LUEA 5CHVC 2C7NB 3N3KB 5E6PA 2CR5A 1WMHB 5CTRC 2MBHA 2JRIB 4EZKA 4K7SA 2JY6A 2N9EB 5HKHA 1P0RA 3QA8A 3V6EB 1IYFA 1A5RA 1ISNA 3QC8B 4FJZA 1E8ZA 1YIWA 2GBKA 2IZVB 2BWFA 4ANWA 3VHTC 1WM3A 3APFA 4W9IA 4BOSC 3SD5A 3L54A 2L3ZA 5D7GA 3VTWA 1UELA 2MBOA 2RD0A 1SIFA 2KTFA 4BBNF 3APDA 2NCNA 1R4NI 4W9LA 1ZGUB 2NPTB 4IWPA 2YVCA 3VH4B 3ZNGC 1IPGA 4TUUA 2PJHA 2J7QB 2LGYA 3PRPB 2DYOA 5G2NA 2K6DB 1V2YA 2O2VA 2MQJA 3P2BA 2M8SA 2BWES 1V9JA 2CHZA 4JLCA 2O6VA 3O65B 2ZVNA 3S2AA 4EOYA 3JYUA 3OLMD 3U8ZA 2A5UA 2N9PC 1WH3A 3H9DA 2BF8B 4WQOB 5LXHA 2BYVE 2GBNA 2OOBB 3W1YA 2Z0DB 2LD9A 2JRHA 2LXCA 4HDOA 4MJSB 4OVUA 4IUMB 2KN5A 2MWSB 2N4FA 2N7EA 2KQ7A 2N1VA 2C9WB 4I6PA 3M62B 4IW0A 2O6VD 3RZWC 1G6JA 2EKEC 2CS4A 4II2B 1EO6A 1V5OA 5KHQA 4II3B 2K8BA 4GMVA 2IYDB 2NVUI 3OJ3A 4F8CB 4M0WB 2KO3A 2MBEA 3D32A 2FAZA 4FN2A 2CHWA 2MLBA 5J17A 5EDSA 2MP2A 5G55A 3RD2A 3QIJA 2L76A 3CMMB 3ZLZA 4BKSA 1L2NA 3L08A 2KLCA 1GC7A 4J6IA 1MG8A 1Q1OA 2RGFA 5KHOA 4GGQA 4DK5A 1RRBA 2L0FA 3SU8X 1OGWA 3DVGX 1IP9A 2ZEQA 3B1LX 4NY0A 1C1YB 1RAXA 2KHWB 2ZNVC 1V5TA 3QCAA 5TR5A 3NHEB 2B3AA 4GU2A 2Y5BB 4WJOA 3W1SC 4WWPA 2IY0B 5L83A 4BKSD 2KVRA 2DHZA 3DPDA 3QK0A 4HDQA 2PE9A 3VUXA 4G50A 3CSTA 3L17A 4OVVA 3HIZA 1M94A 4EFOA 2PPHA 1WY8A 4MGIE 3PVLA 3VVWB 1WX7A 2FIDA 2JF5A 1WGGA 3UGBB 3Q3JA 3KW5B 2O2VB 3KYDD 4BKGA 4URKA 2KANA 1FXTB 1I42A 2C60A 4GSWA 2KC1A 1UGMA 4GDLA 4W9KA 2LGDA 2NPTA 1WGRA 4W9EA 3PHWB 2O6VB 3L0WB 3PLUA 2D11A 3SDLC 3UIOB 1X1MA 2IO1B 4BOZB 4I6LB 4IM2A 2BYFA 2KWVB 3TIXA 1WZ0A 4IM0A 2IY1B 4DDGD 2MCNB 3ZRFA 2UWQA 4TQ0A 1EF5A 2C5LC 3K9PB 2KFJA 4IC7B 4ZDVA 3L10B 4K81A 3VDZA 3DQVA 4W9HA 5AZHA 4ZRJA 5IAAC 2I1KA 5J2RA 1UBIA 1WXSA 4EEWA 3ZW3A 1H4RA 3VXWA 4HPMB 3VTVA 2CHXA 2KDIA 2L7RA 4LCDE 2LXAA 1WZ3A 3LJ3A 5CHWA 1GNUA 3ZNZB 4DHZE 5JZEB 2C7MB 4G3XB 2K39A 3DOWA 3NS8A 3VQIA 3HK0A 4GOCA 2MP2B 4MM3A 1V81A 3MHSD 3R7RA 1Z5SB 2LI5A 3N32A 4FJVB 1TBEA 4WAAA 2MW5A 1ZW7A 2KFKA 2KKCA 4MGYE 3EHVA 5IA7A 3DDCB 2G4SA 3DBSA 3IVFA 1EUVB 3ZTDA 4WWOA 4NJ7A 2M1MA 4PS3A 1OEYJ 1OQYA 4E71A 5AEKB 3NZSA 5JHBA 2L05A 2PE6B 4GB9A 4XC2A 3ZNID 4TV3A 2L0TA 2RR9A 2Z59B 3H1UA 3C0RB 4TKNA 2J0MA 1XD3B 1J8CA 4BKTA 4CHKA 1WFYA 3H7PA 1P1AA 2EMSA 2XBBC 3B0AA 2J0JA 5DCNA 4FHKA 3TJPA 3RUIB 2KMAA 3HM3A 3JSVA 3WIMA 3X0WA 3EFUA 3MJWA 5LLIA 4BVUC 2DAJA 2UYZB 3ZUNA 2LASA 4WJQA 1LFDA 2ASQA 3M95A 4JQWC 4GDLB 5CX3A 4CYEA 3DBHI 1TGZB 3AI5A 3PRMB 1E8YA 3KUZA 3L13A 2NBWB 4HK2A 4MH0E 4RM9A 3PRZA 2DAFA 2MRPA 2N7DA 4MDKE 4HCPB 1BT0A 3TCAA 2FUHB 3N30A 1TTNA 3H7SA 5D94A 4GN1A 3SHQA 3IHPC 3JVZX 3BINA 2K25A 2Z0EB 4K1RB 2C7HA 2AL6A 3ZTCA 4E74A 2IO3B 1I35A 4ZRKA 4GXBA 4NNJB 5DPSA 2DENB 2LJ5A 4K7UA 1C3TA 2V1YA 4NQLB 3KUDB 2DX5B 2FCSA 2DYBA 3PSEB 1RLFA 4GDKA 3DVNV 2JT4B 3JW0X 2DYMA 3PV1A 3V62A 2WYQA 3R3MA 1GJZA 3NY5A 1WXVA 1WXMA 2DZKA 2KDBA 2PEAA 2MSED 1Q0WB 3QARA 2WDTB 4DXAB 1SE9A 5JHAA 3IG3A 2FIFA 3VH3B 3ZDTA 4IWQA 3AU5A 2D07B 1F9JA 1WGDA 2HJ8A 1NDDA 2KX3A 4IM3A 2KFKB 1KOTA 3ZKJC 1E7VA 3K9OB 1T0YA 4M8MA 3NZUA 2KZRA 4NJ6A 3TBLD 1KLVA 2ZJDA 1WR1A 2G45B 4G0NB 1U4AA 3PT2B 4WJPA 4K7WA 2LGXA 2IO2B 3ECIA 2LVOA 3M3JA 1YJ1A 1Z2MA 2GBRA 3AU4A 4W9JA 4DHJB 4HCNB 2GOWA 2N1WA 3CSFA 1E7UA 4IG7B 3H7PB 4FADA 1UD7A 2L00B 3DCGA 2D10A 3OAWA 3JSVB 3V61A 3WAMA 2JPHA 3R7QA 3V60A 4BBNC 4ANUA 4EZLA 3U7DA 1WGYA 4YL8A 2KTRB 2M17A 3RULA 4I6NB 1V49A 3QWZB 5D2MB 4HJKA 1WIAA 2R2QA 4WWNA 2HTHA 3QQ8B 2WWZA 2IBIB 3A9KA 2DZIA 4LJOB 2K8HA 4X57B 1H8CA 2V4LA 4W9FA 2CU1A 3VFKA 3ZO5B 4KVGB 1YQBA 3KH0A 2CKHB 3DVNU 4A3OA 1UH6A 2MBBB 2XK5A 1P98A 3H6NA 4P7IA 3CF6E 1P9DU 4LDTB 2IO0B 3HM6X 3GZNI 4GDKB 2NBVB 4W9DA 3WAOA 1KJTA 1WM2A 3A9JA 1UBQA 2KNBA 4ZYNA 1QZEA 2BGFA 4EUTA 4AOFA 3KUCB 1WX9A 4A20A 1J19A 2KX0A 3RT3B 4KDLB 3R66C 4MGKE 4PYZA 1D3ZA 2W9NA 3IBEA 4B6WA 4HWIB 3RCZA 2ZZPB 2BYEA 4NAWA 3UINB 3ZRCA 3W1SA 3M63B 3ML9A 2LVPA 2K8CA 2FCNA 4KIKA 1WGHA 4IWOA 1K8RB 2AL3A 3WANA 5DPTA 2JZZA
chains in the Genus database with same CATH superfamily
1HZ6A 2AQ3B 2H88B 4WH4A 2MJ3A 4LNOA 2REXA 3ONSA 3IXSA 4KKIA 2JQRB 3A9KB 5E6NA 2A4ZA 1YMHE 3PS6A 3WALA 1FFUA 1YD8U 2FCMA 2WXKA 1WJ6A 1XLNA 3ZVVA 5LXIB 3GOEA 1WXAA 4LLGM 2RPVA 3AEBB 4AQ7A 1LXDA 4DHZB 3PZ7A 4JIOU 4MELA 1LQBA 4OZCA 1K51A 3UF8A 4B95A 2R2OA 1YN3A 3AE4B 3NVYA 4XWTA 4EKUA 1PDXA 4FHJA 1SBBB 1Q10A 1TZ1A 2ZNVB 4H2AA 1SIJA 2ZVOA 4AP4C 4R3DA 4KIKB 4DBGA 1KF6B 2SEBD 2JSVX 4XE0A 2ON8A 2LRUA 1GB1A 3TMPB 1HZ5A 3UIPB 2H89B 4M8NA 3P4SB 2JXXA 2N9XA 1HE8A 2DZMA 3HUIA 3VR9B 1C4AA 3APCA 1E5WA 2J4XA 1I4RA 3EC8A 4US9A 1MG4A 1VCBA 2KMCA 4XYCA 2LWPA 4DDID 1WRDB 4A8XC 3B08A 1UZXB 1R4MI 4RH6A 3DBLI 4YSZB 5IP4D 1C4CA 2BBCA 3A33B 2N9KA 5AUIA 2K1FA 2KDMA 1EF1A 3AE1B 2JWZA 3KWLA 1V80A 3Q8AA 3ZJVA 2J0KA 1L6UA 2OJRA 2KLGA 2EKIA 2GI9A 2QHOA 3EECA 1FNVA 2MJEA 3WAPA 3X23A 1KFYB 2ZPNA 1GAQB 2KOXA 3QJZA 1F52A 5FK9C 1WYGA 2W82A 2XN9C 1J7AA 2DZJA 3Q3FA 1E8XA 4C7YA 2LVQA 2BS3B 4MEMA 4HROA 1E8WA 1IBXB 5FR6A 3ENEA 4JGHB 1N5WA 5JH5C 2QDFA 4AJWA 3SR6A 2WXFA 3N3KB 4EE2A 4BZAA 4EZKA 1DYQA 4K7SA 5HKHA 3IT6B 4US8A 1N61A 1I4HA 3DHIC 1A5RA 4FJZA 1YN4A 2BWFA 3VHTC 5E6JA 2NMQA 4BOSC 2L3ZA 2KACA 5D7GA 2MBOA 2KYWA 3GE8C 4IWPA 2YVCA 2AQ2B 3ZNGC 1IPGA 4TUUA 2DYOA 4YSYB 3P2BA 3KWVA 2CHZA 3TEZA 2WU5B 3U8ZA 2LD9A 2JRHA 4C4VA 3NJTA 2N7JA 1K53A 5FKAC 2O6VD 1G6JA 2CS4A 4II2B 3AE5B 2K8BA 2KVZA 2IYDB 3OJ3A 4F8CB 4M0WB 3WCQA 4FN2A 5J17A 1E7PB 5EDSA 3RD2A 5IOIA 4IOIE 3L08A 2KLCA 2RGFA 2L0FA 5BYRA 1OGWA 1I4PA 1IP9A 2G1EA 4NAMA 4NZLB 1V5TA 3QCAA 4GU2A 1FXAA 3W1SC 4WWPA 4BAXA 1VR9A 2DHZA 2PE9A 1L4DB 1XCTL 2INPE 2WHIA 3Q6BA 1TS5A 4MGIE 1WX7A 1WGGA 3KW5B 3U4EG 3MJ5A 1UGMA 4W9KA 1UUPA 1JWAD 4A90A 2KWVB 1WZ0A 4IM0A 4A6QA 2KFJA 2VZKB 4K81A 1V8CA 1UBIA 2BT6A 3VUXA 3BVZA 5CHWA 2J42A 4G3XB 3DOWA 3KLSX 3NVWA 4GOCA 2MP2B 2JXTA 3Q69A 3R7RA 2QILA 1TBEA 4M0WA 3P1MA 4MGYE 1ENFA 3DBSA 4WIPA 2BB6A 3NZSA 2L05A 4GB9A 4TV3A 4TKNA 3FAHA 1J8CA 1AYFA 1WXQA 3VR8B 2EMSA 2JYEA 3TJPA 3RUIB 3HM3A 1AWDA 2ASQA 3M95A 3Q14C 4JQWC 4YTMB 2KAJA 3DBHI 1TGZB 2DAFA 1PUTA 1QOGA 1TTNA 3H7SA 3SHQA 3IHPC 4K1RB 4E74A 1I35A 4ZRKA 1FRRA 3BK2A 2LJ5A 4K7UA 2R61A 2NTSA 2DYBA 4OW0A 3V62A 1AN8A 2Y5PA 3QARA 2PEAA 1SE9A 5JHAA 3IG3A 3VH3B 3AE9B 1WGDA 1NDDA 2KX3A 3K9OB 1XLQA 2KZRA 4NJ6A 3MHZA 4FXCA 4G0NB 4K7WA 2LGXA 1OFFA 4WAFA 3AU4A 2Y5CA 1VLBA 5BMHA 1JCKB 1NEKB 2D10A 2WDVB 4MH8A 3JSVB 2XNAC 2UU7A 1P7FA 3WAMA 3R7QA 3V60A 4EZLA 4RCOA 2M17A 3T3OA 1UNSA 1TY2A 3TUOA 4HJKA 1WIAA 4WWNA 3TEYA 2HTHA 4ACFA 2OJWA 4X57B 1H8CA 3ZO5B 2WXGA 2RDHA 1PYWD 1EM7A 2D3AA 3HM6X 4KGTA 5G5GA 1N6ZA 1PGAA 1QT9A 4ZYNA 4D2KA 2Y3AA 4A20A 2WDRB 2KX0A 4ZYSA 4MGKE 1SF0A 1D3ZA 4B6WA 3BZDB 3FILB 1F2RC 2I38A 3RNAC 3ZRCA 3UINB 1SE4A 1TS4A 3ZXRA 2LVPA 1P7EA 4L23A 1ZDXA 1WGKA 3AN1A 4IWOA 1SSNA 1JALA 1PFDA 4FJYA 4G11A 2CJOA 3P63A 4F7ZA 1V6EA 1BMLC 3B2FA 5MPOA 2KQSA 3AXCA 4KKJA 2KC2A 5CHFA 4YT0B 2DWQA 4REZA 2INDC 3VUYA 2WX0A 2K9XA 1K52A 1DOXA 2KD0A 4ANVA 2XK5B 2IPKD 2Z8LA 4FLHA 4N9F4 4RGNA 4KV2A 4PT5A 2N0SB 3AULA 3QHTA 3KVFB 3VAWA 5J18A 3O13A 1JWSD 4RGTA 4ZRIA 2W54A 2HTME 2KT7A 3C8YA 1L7YA 3NUHB 4FA6A 4OVZA 4LDTD 1B9RA 1KH0A 3EUB2 4XGAB 1J0GA 2ZCBA 3RNFC 2VH2A 1QILA 3KQ4A 1WJ4A 1D5XC 3ZQ4A 1E6EB 2MH7A 4XWWA 3UQAA 3DVGY 4HJGE 2HD5B 3T8MA 2E3TA 4WWMA 4MGZE 4KDIC 2BVCA 1NI2A 2BQQA 4E3CA 1ZKHA 4KSKC 4FULA 4ANXA 3AE3B 4W9GA 3GS2A 4XX5A 4RNAA 3HHMA 4RF0A 2G3QB 2GMIC 1WI0A 1N63A 1E90A 1GG3A 1QLBB 3UI3A 3SFDB 2B76B 3Q8CA 2YLMA 4PS8A 3FKYA 4LJPB 1QKZA 2GBMA 3BIID 4N59A 3DBRI 3RFZB 3QX1A 1V86A 4EZJA 3VUWA 3MP9A 3RZFA 3HVDA 5L95C 1EU4A 2MX2A 3V05A 3TL5A 4ZRPA 1STEA 4NPNA 4MJSA 1I4QA 4AWJA 4RFBA 2BS4B 1T0QC 1TS3A 1WWTA 2DBYA 3LDZE 4M00A 2BKRB 3A4SC 2JX5A 1TKYA 2V3PA 1YNTE 2AYOB 5CHVC 2C7NB 5E6PA 4HRSA 5CTRC 3V6EB 1IYFA 3QC8B 3TEXA 1JWMD 1WM3A 2YEPF 3APFA 3SD5A 3L54A 1ROEA 1L5PA 4M02A 1SIFA 5BMIA 1F2RI 4W9LA 3VH4B 4AUQC 4CYEA 2PJHA 1LO5D 3PRPB 4TSSA 5G2NA 2LGIA 2K6DB 2MQJA 2PLPA 2M8SA 3O65B 3NG0A 3OLMD 2A5UA 2N9PC 2GBNA 4K3CA 1BUIC 2N4FA 1YOVB 1J7BA 2N1VA 4I6PA 3M62B 4IW0A 1EO6A 4II3B 2INNE 2NVUI 2KO3A 2MBEA 3D32A 2FAZA 2CHWA 5G55A 1UGJA 3QIJA 3CMMB 2LHDA 4BKSA 4J6IA 1MG8A 4GGQA 4DXFA 3DVGX 1I7HA 3B1LX 1C1YB 3LXFA 1RAXA 5TR5A 3EA6A 3NHEB 3E9SA 2Y5BB 2IY0B 5L83A 3DPDA 3QK0A 4G50A 3CSTA 1M94A 1ACCA 1FIQA 1A70A 2FIDA 3W9CB 1XO3A 1ZXIA 4URKA 1FXTB 2KC1A 3PHWB 2D11A 5FR3A 2OEDA 4BOZB 1FFVA 2WLBA 2JZPA 4C4VB 3ZRFA 3K9PB 4IC7B 3ZJUA 3L10B 3MC0B 1FNWA 5IAAC 1CZPA 4ZRJA 5J2RA 4JE3B 3ZW3A 1H4RA 3VXWA 4HPMB 2KDIA 4O1NA 3ZNZB 1XXGA 2C7MB 5HG2A 2K39A 3NS8A 2PIAA 2G9HD 2K3UA 2LI5A 3CWIA 1ZW7A 2KKCA 5IA7A 2Q5WD 2G4SA 3IVFA 2X8XX 5LNK1 3GP7A 3ZTDA 1C79A 4NJ7A 2M1MA 1HEZE 1R4MB 5JHBA 3DBLB 1DOIA 3DWGC 3ZNID 3H1UA 2J0MA 4BKTA 4CHKA 3B0AA 4FHKA 2BS2B 3AEFB 2KMMA 3T3NA 3R8BA 5CX3A 1SE3A 3L13A 2WXRA 2NBWB 4MH0E 4ARCA 2IGDA 3TCAA 3N30A 2M19A 4J3OD 2K25A 2IO3B 3RPFC 1C3TA 2V1YA 5IO9A 2FCSA 4GDKA 3JW0X 2JT4B 1GJZA 2QJLA 3NY5A 1WXVA 2DZKA 1FNUA 2WDTB 2FIFA 5G5HA 3ZDTA 4IWQA 3TSSA 1KOTA 1PGBA 1E7VA 1T0YA 3AB5A 4M8MA 2G45B 3PT2B 4M01A 1F0ZA 2IO2B 3I63C 1ZE3D 2LVOA 2IDYA 3M3JA 4S17A 1YJ1A 4W9JA 1L6VA 2W3SA 4IG7B 5JXVA 2L00B 1L0XB 3DCGA 1FRDA 4IKGA 3V61A 1XLOA 3BYYB 4TMAB 3RNGC 4AS1A 1CQVA 1HQRD 4YL8A 1MHXA 2KTRB 2LJIA 4I6NB 1V49A 3QWZB 1L0YB 1ZPSA 1JRPA 5TSSA 2WWZA 2DZIA 2CU1A 1YQBA 3BYTB 3DVNU 4A3OA 1UH6A 5C3JB 4P7IA 3CF6E 4ZOHC 3GZNI 1V97A 3V3XA 2NBVB 3NRZA 4C00A 3A9JA 2M56B 1KRHA 3AH7A 3B9JA 1WX9A 4YTPB 2WXOA 3RT3B 1RFKA 2PW9A 2W9NA 3IBEA 4HWIB 2ZZPB 1YQ3B 4NAWA 3ML9A 2K8CA 2FCNA 1VZ7A 3BK1A 1WGHA 5D3IB 1YJIA 5DPTA 2JZZA 2WXQA 1TYGB 4B0MA 2ZPYA 3TEWA 3ML8A 3WA0A 4PS7A 1YN5A 2JVCA 4ZHPA 5AZFA 4RM8A 1YX5B 4GLSC 1XEEA 2JUOA 2IJ0A 5IKCM 2KDEB 4JL9A 2KTRA 4DHJD 1AARA 3PO0A 2V3SA 2NS5A 5C2TB 4NQKE 4HEA1 3U7ZA 4P16A 3PZ8A 3QAQA 3RI7C 3NZ3A 3ZDMC 1MI0A 1V1PB 2KDFB 1SXTA 1LM8B 1T6BX 4ICVA 2KWCA 2GB1A 1FMAD 1Q5WB 3Q8BA 2J53A 5T8IA 2LRWA 2PKOA 2QIEB 1B1ZA 3T9LA 2GBJA 1CMXB 1PQSA 4B0EA 5BYQA 2NBUA 2BW2A 3ZIMA 5E6OA 4JX1C 1SGHA 4RMAA 3URYA 3A1QA 3DHGC 2JZ3B 2MJDA 2WQYB 2G4DB 1FXIA 3A4RA 2BPSA 1UF0A 3DBHB 1WE7A 3AEDB 3PREA 1WMHA 3DHHC 2GLSA 1HTOA 2ICIA 5AUKA 1NENB 4BFRA 2NR2A 4DWFA 2LUMA 4A3PA 2D5GA 3VRAB 1D6EC 1TJEA 1V1PA 2LGSA 3RMKC 3I3TB 4LNKA 3R2TA 1TS2A 4YWGG 1JWUD 3AM9A 2LZ6A 1P3QU 3I57A 4GIVA 5C1ZA 3P42A 3ZNHB 4TQ1A 3Q8EA 4WJNA 3ZYYX 2FCQA 3ALBA 5HI1A 3N1YC 1QF6A 5EE1A 1TIFA 3IFWB 2RPQA 1JRUA 1S3SG 2WXNA 4L2YA 1YX6B 3N1XC 2PMVA 1WYWB 2KJRA 3BY4B 3NOBA 2MA9B 3PPAA 1EU3A 2L32A 4ASWC 3PZDA 2MEKA 4B9KA 4FBJB 5DPRA 1D4BA 4W9CA 1C4PA 5H8YE 1WF9A 4DXGA 4HXDA 2LUEA 1ZDVA 2JRIB 4HKQA 1GB4A 3QA8A 1ISNA 1E8ZA 3L4PA 1YIWA 2IZVB 4ANWA 4W9IA 3U52E 3ZXVA 4A55A 1FD6A 4XDCA 2KTFA 4BBNF 2ZW1A 3APDA 1MFWA 5EE3A 1R4NI 2NPTB 2J7QB 2LGYA 2QEJC 1V2YA 5EE9A 3IT4B 2O2VA 2BWES 4OHJA 1V9JA 4JLCA 2O6VA 3Q8FA 3S2AA 4EOYA 3JYUA 1WH3A 2FE8A 2BF8B 5LXHA 2BYVE 3W1YA 2Z0DB 4HDOA 4OVUA 4MJSB 2KN5A 2MWSB 1ESFA 1N62A 1F77A 2JYTA 4MM3B 1V5OA 2BYTA 5KHQA 1Y56A 4GMVA 1J7CA 3FC4A 1C76A 4JPSA 1L2NA 3NVZA 1GC7A 1C78A 4DK5A 1RRBA 4NY0A 2TSSA 1FCLA 2B3AA 3H8HA 4KGSA 2BTEA 3AEEB 1NYQA 2KVRA 1C77A 1SB3C 3L17A 3HIZA 4EFOA 2PPHA 3AECB 3VVWB 2JF5A 2RDGA 3UGBB 4BKGA 2C60A 3E56A 4GDLA 2NPTA 3L0WB 3PLUA 3UIOB 4C80A 2IO1B 2WXHA 4IM2A 2AQ1B 2BYFA 3TIXA 2IY1B 2MCNB 2UWQA 2WXJA 1E0ZA 1HTQA 3DQVA 3LB8C 1C9FA 3VRBB 3MC8A 3VTVA 2CHXA 1PGXA 2L7RA 2SAKA 2LXAA 1WZ3A 3LJ3A 4LCDE 1GNUA 2PTLA 3VQIA 1ZUD2 3LYYA 4MM3A 1V81A 3MHSD 4FJVB 2MW5A 2KFKA 1BXTA 1JW9D 4OZAA 4PS3A 1OQYA 4E71A 4N6EB 2PE6B 3MC9A 4MT5A 1V1OA 3H7PA 1P1AA 1QOFA 1ZP0B 2J0JA 4L1BA 5DCNA 1EWYC 2KMAA 3NVVA 3X0WA 3MJWA 2HJ1A 3ZUNA 1LFDA 1E8YA 1KLUD 1JROA 4HK2A 4RM9A 4MDKE 4HCPB 1BT0A 3DBRB 4GN1A 1RM6C 2WGSA 2WP9B 3BINA 3ZTCA 2AL6A 5DPSA 4LNNA 2DENB 3KUDB 2DX5B 4K3BA 4NJCA 1CK1A 1RLFA 3PSEB 3PV1A 2DYMA 1YQ4B 2KDBA 1Q0WB 2CU3A 2D3BA 3W5VB 2HJ8A 4IM3A 3ZKJC 3TBLD 4RGOS 1WR1A 2VZKD 4WJPA 1U4AA 1NYRA 4HCNB 2N1WA 3CSFA 3RN9C 3OWEB 3AMZA 1KTKA 1UD7A 3ETRA 2WXMA 2ONQA 2JPHA 4USAA 4BBNC 4ANUA 1WGYA 3RULA 2X38A 1N5XA 2HDEA 3EGRA 3QQ8B 2IBIB 3A9KA 4LJOB 1ET6A 2K8HA 4MACA 1DOYA 2V4LA 5BMGA 2INCC 4W9FA 1I4XA 3GB1A 3RNEC 1VZ8A 4KVGB 3KH0A 3H6NA 1P9DU 2QSDA 2IO0B 4GDKB 4LDTB 1RYJA 1FCCC 2KWDA 5IN7A 1VJKA 3WAOA 1KJTA 1UWXA 4RF1A 4RGMA 1UBQA 2KNBA 4EUTA 4C56C 1J19A 1SE2A 3I5JC 1T0SC 1WSPA 4KDLB 3R66C 3RCZA 2L52A 3J9CA 1VDVA 2BYEA 1FPYA 4KIKA 1SJHD 1E10A 3EFCA 3WANA 1ZXHA 3AE2B 1WJUA 4AJYB 2WDQB 2KQ4X 3BVMA 4PK1A 3AE6B 4IDIA 2XEWA 1XCQL 5AZGA 2MBQA 1Y8RC 1MPEA 1OQQA 2V9HA 3DWMA 5C23A 2VRRB 4HPLB 1XT9B 1WX8A 2AWTA 1GUAB 2E6XA 4ICUA 3Q3OC 2K6QA 4KZCA 4MSQB 1NBFC 1FO4A 1K50A 2RSUA 4HLEA 1S1QB 5GMVA 2L83A 3UQBA 3MTNB 4LNIA 3A9JB 1E9MA 5DPWA 3U30A 3N20C 1TT5B 1JQ4A 2BKFA 2D2QA 4CO7A 4A9AA 5D6JB 2KWUB 2WXIA 3OG5A 4UDUC 4NAWB 2KXJA 2KJHB 1QOAA 1GC6A 3R2IA 3SEBA 4XZ4A 3L16A 1AW7A 3PLVA 4HVBA 3AV8A 2JU6X 1RWSA 2HE7A 1I4GA 2D3GA 2J52A 3B2GA 4PYUA 3P4RB 1OQRA 1WR6E 3RYTA 1IBXA 1OEYA 4P1BC 1SEBD 2W3RA 1KM7A 3PHXB 2M4NA 2IGHA 1L0VB 4ARIA 5EE0A 2ZCCA 1WE6A 2L8JA 1RFAA 3HVZA 3OJ4B 1WJNA 2VH1A 3V6CB 1TZOA 1OTRB 5HFYA 2K22A 2DNFA 2FNJB 1VD2A 1XF5L 3Q3MC 3PTFC 3VTUA 2AEHA 4MSMB 2WX1A 3KYCD 1TY0A 1YJJA 2I1JA 3ZGZA 4LTUA 2K0PA 3A1QB 2KJ6A 3PGEA 1UWMA 2LHEA 2M0XA 5BO4B 2KK8A 1XQQA 3AE8B 2I2YA 2EMTA 4KSLC 4KZ0A 3Q2AC 4F1SA 4LNFA 4P1CC 2CR5A 1IGCA 1WMHB 2MBHA 3I9V1 2JY6A 2N9EB 1P0RA 4CQNA 2GBKA 1SJED 4C7ZA 4YTNB 3GZNB 2LFIA 3VTWA 1UELA 2RD0A 4ITKA 1N60A 1IUEA 1IGDA 2NCNA 1ZGUB 3N9YC 2NTTA 5GXGB 4QAYA 2WXPA 4JWUC 2ZVNA 2IGGA 1HXYD 3H9DA 1JWBD 2EELA 4WQOB 2OOBB 2LXCA 4IUMB 1ZOYB 2N7EA 2KQ7A 2C9WB 5HHDG 3RZWC 2EKEC 3ZJTA 1T5XD 3IAS1 1MHHE 1LGRA 2MLBA 2MP2A 4HPPA 4OZBA 2L76A 3ZLZA 2DLBA 2AX5A 1Q1OA 2GRIA 5H92C 1QQRA 5KHOA 3SU8X 2ZEQA 1TKEA 2KHWB 2ZNVC 3IAM1 4S0RA 1GPXA 4WJOA 2WU2B 4BKSD 2QCZA 4OVVA 2V3NA 1WY8A 1GOZA 3MFGA 3PVLA 3NS1A 3Q3JA 1EWCA 2O2VB 3KYDD 3RNBC 2KANA 1I42A 1F1HA 4GSWA 1D5MC 2LGDA 1WGRA 4W9EA 2O6VB 3SDLC 1X1MA 4WURA 4I6LB 1XLPA 2QMTA 4N58A 4DDGD 2L1AA 4ZDVA 4TQ0A 1EF5A 2C5LC 1TKGA 3VDZA 4W9HA 5AZHA 2I1KA 1WXSA 4EEWA 2RMMA 2V0GA 4YSXB 4DHZE 3AE7B 5JZEB 3HK0A 4HKZE 1Z5SB 3N32A 4WAAA 3EHVA 3DDCB 1EUVB 3AEGB 4WWOA 1FEHA 1OEYJ 4YXDB 5AEKB 2ACZB 4XC2A 2L0TA 2RR9A 2Z59B 3C0RB 1XD3B 1WFYA 4P6VF 4KGRA 3ABVB 2XBBC 3W5UB 3JSVA 3WIMA 3EFUA 5LLIA 4DQOC 4BVUC 2DAJA 2UYZB 2LASA 4WJQA 1R7SA 4GDLB 3AI5A 2MHJA 3PRMB 3KUZA 3PRZA 1KLGD 2MRPA 2N7DA 2D3CA 2FUHB 3P4PB 5D94A 3JVZX 3HRDD 2Z0EB 2C7HA 2BB5A 3BWUD 2YEPB 4GXBA 4NNJB 5I4DA 1DGJA 1MVKA 3C19A 4NQLB 3U2SC 3DVNV 1NI3A 2WYQA 3R3MA 4HDQA 1WXMA 4DXAB 1VZ6A 2MSED 3RNCC 2CJNA 3AU5A 2D07B 1F9JA 2KFKB 5BYSA 3NZUA 1KLVA 2ZJDA 3FILA 4Q2JA 3ECIA 3P4QB 2K5PA 1WRIA 1Z2MA 2GBRA 1HA5A 2OHFA 4DHJB 2GOWA 1E7UA 3Q3NC 3H7PB 4FADA 2WNMA 1D5ZC 4KX6B 3OAWA 1VRAB 3W2DA 2FBWB 2M0AA 2LEKA 3U7DA 1ET9A 1R4NB 2W55A 5D2MB 2KN4A 2R2QA 1T0RC 3CIRB 3AEAB 1MJDA 1T3QA 2RDBC 3VFKA 5D3DA 2CKHB 4LK0M 2MBBB 2XK5A 1P98A 3GE3C 1FM0D 1L4ZB 2QC8A 3BVGA 4W9DA 1CJEA 1WM2A 2V4IB 1NVID 2PVGC 2JWUA 1QZEA 2BGFA 1JMLA 4AOFA 3KUCB 2WS3B 1M4VA 2FUG1 4PYZA 4ZRQA 1QOBA 2N9LA 4XDDA 4JWSC 2WXLA 3W1SA 3M63B 2ZW0A 2LMCA 4ZHOA 3N1ZC 4WQMA 1K8RB 2PVOD 2AL3A 3SFEB
chains in the Genus database with same CATH topology
1WJUA 4AJYB 2ZPYA 4FJYA 3ML8A 4G11A 4F7ZA 1V6EA 3WA0A 2KQSA 3AXCA 4PS7A 2XEWA 2JVCA 5AZGA 2MBQA 5AZFA 4RM8A 1Y8RC 1YX5B 2REXA 2JUOA 2KC2A 5CHFA 5C23A 3ONSA 2KDEB 4JL9A 2KTRA 2VRRB 3A9KB 5E6NA 4DHJD 2A4ZA 1AARA 2V3SA 2NS5A 3PS6A 4HPLB 1XT9B 4NQKE 3VUYA 3WALA 2WX0A 1YD8U 2FCMA 1WJ6A 3QAQA 1WX8A 2AWTA 1GUAB 2KD0A 4ICUA 3ZVVA 5LXIB 2K6QA 4ANVA 2XK5B 3ZDMC 3GOEA 1WXAA 4KZCA 1NBFC 4MSQB 4FLHA 4N9F4 2KDFB 4KV2A 2RSUA 1LM8B 4HLEA 1S1QB 5GMVA 1LXDA 4DHZB 3AULA 3QHTA 3UQBA 3MTNB 3KVFB 4ICVA 2KWCA 4JIOU 1LQBA 3A9JB 4MELA 3VAWA 3U30A 1Q5WB 5J18A 5DPWA 3UF8A 4B95A 2R2OA 4ZRIA 4EKUA 2BKFA 4FHJA 2LRWA 2D2QA 4CO7A 1TZ1A 3T9LA 2GBJA 5D6JB 2KWUB 1L7YA 1CMXB 2ZNVB 1PQSA 2ZVOA 4AP4C 4FA6A 4NAWB 2KXJA 2KJHB 4KIKB 1GC6A 4LDTD 4XZ4A 3L16A 4DBGA 1J0GA 2NBUA 2ZCBA 3PLVA 4HVBA 2LRUA 3ZIMA 1WJ4A 5E6OA 3TMPB 3UIPB 3UQAA 3DVGY 1SGHA 4M8NA 4RMAA 2HE7A 2HD5B 3A1QA 2JXXA 2N9XA 2D3GA 3T8MA 1HE8A 2DZMA 2JZ3B 4KDIC 4MGZE 2G4DB 1NI2A 4PYUA 4E3CA 1ZKHA 3APCA 1E5WA 3A4RA 1WR6E 3EC8A 4FULA 4KSKC 3RYTA 4ANXA 1OEYA 1VCBA 2KMCA 2LWPA 2BPSA 4DDID 1WE7A 4W9GA 1WRDB 1KM7A 3PHXB 4XX5A 3PREA 3B08A 2M4NA 1UZXB 1WMHA 1R4MI 3HHMA 2G3QB 3DBLI 2GMIC 2ZCCA 1WI0A 1WE6A 4AUQC 1E90A 2L8JA 1RFAA 4BFRA 1GG3A 2NR2A 4DWFA 3OJ4B 4A3PA 1WJNA 3A33B 2YLMA 2K1FA 3I3TB 1EF1A 3V6CB 1OTRB 2JWZA 2LZ6A 1P3QU 4GIVA 1V80A 4LJPB 4PS8A 2J0KA 5C1ZA 3ZNHB 4TQ1A 4WJNA 2OJRA 2KLGA 2FCQA 2GBMA 3ALBA 3DBRI 2FNJB 1VD2A 2QHOA 3QX1A 3EECA 3IFWB 1V86A 2RPQA 1JRUA 3PTFC 1S3SG 3VTUA 3WAPA 4EZJA 3X23A 2AEHA 2ZPNA 2WX1A 4MSMB 3VUWA 3RZFA 1YX6B 3KYCD 5L95C 2MX2A 3TL5A 1WYWB 2KOXA 3QJZA 2I1JA 2KJRA 4NPNA 3BY4B 4MJSA 3NOBA 4AWJA 2MA9B 3A1QB 3PPAA 4ASWC 2DZJA 3PZDA 2KJ6A 3Q3FA 1E8XA 2LVQA 3LDZE 2BKRB 3PGEA 2M0XA 5BO4B 2KK8A 4MEMA 1XQQA 4B9KA 1E8WA 3A4SC 5FR6A 2EMTA 3ENEA 4JGHB 4FBJB 4KSLC 4KZ0A 5DPRA 5JH5C 4W9CA 4AJWA 4F1SA 1WF9A 2AYOB 4HXDA 2LUEA 5CHVC 2C7NB 3N3KB 5E6PA 2CR5A 1WMHB 5CTRC 2MBHA 2JRIB 4EZKA 4K7SA 2JY6A 2N9EB 5HKHA 1P0RA 3QA8A 3V6EB 1IYFA 1A5RA 1ISNA 3QC8B 4FJZA 1E8ZA 1YIWA 2GBKA 2IZVB 2BWFA 4ANWA 3VHTC 1WM3A 3APFA 4W9IA 4BOSC 3SD5A 3L54A 2L3ZA 5D7GA 3VTWA 1UELA 2MBOA 2RD0A 1SIFA 2KTFA 4BBNF 3APDA 2NCNA 1R4NI 4W9LA 1ZGUB 2NPTB 4IWPA 2YVCA 3VH4B 3ZNGC 1IPGA 4TUUA 2PJHA 2J7QB 2LGYA 3PRPB 2DYOA 5G2NA 2K6DB 1V2YA 2O2VA 2MQJA 3P2BA 2M8SA 2BWES 1V9JA 2CHZA 4JLCA 2O6VA 3O65B 2ZVNA 3S2AA 4EOYA 3JYUA 3OLMD 3U8ZA 2A5UA 2N9PC 1WH3A 3H9DA 2BF8B 4WQOB 5LXHA 2BYVE 2GBNA 2OOBB 3W1YA 2Z0DB 2LD9A 2JRHA 2LXCA 4HDOA 4MJSB 4OVUA 4IUMB 2KN5A 2MWSB 2N4FA 2N7EA 2KQ7A 2N1VA 2C9WB 4I6PA 3M62B 4IW0A 2O6VD 3RZWC 1G6JA 2EKEC 2CS4A 4II2B 1EO6A 1V5OA 5KHQA 4II3B 2K8BA 4GMVA 2IYDB 2NVUI 3OJ3A 4F8CB 4M0WB 2KO3A 2MBEA 3D32A 2FAZA 4FN2A 2CHWA 2MLBA 5J17A 5EDSA 2MP2A 5G55A 3RD2A 3QIJA 2L76A 3CMMB 3ZLZA 4BKSA 1L2NA 3L08A 2KLCA 1GC7A 4J6IA 1MG8A 1Q1OA 2RGFA 5KHOA 4GGQA 4DK5A 1RRBA 2L0FA 3SU8X 1OGWA 3DVGX 1IP9A 2ZEQA 3B1LX 4NY0A 1C1YB 1RAXA 2KHWB 2ZNVC 1V5TA 3QCAA 5TR5A 3NHEB 2B3AA 4GU2A 2Y5BB 4WJOA 3W1SC 4WWPA 2IY0B 5L83A 4BKSD 2KVRA 2DHZA 3DPDA 3QK0A 4HDQA 2PE9A 3VUXA 4G50A 3CSTA 3L17A 4OVVA 3HIZA 1M94A 4EFOA 2PPHA 1WY8A 4MGIE 3PVLA 3VVWB 1WX7A 2FIDA 2JF5A 1WGGA 3UGBB 3Q3JA 3KW5B 2O2VB 3KYDD 4BKGA 4URKA 2KANA 1FXTB 1I42A 2C60A 4GSWA 2KC1A 1UGMA 4GDLA 4W9KA 2LGDA 2NPTA 1WGRA 4W9EA 3PHWB 2O6VB 3L0WB 3PLUA 2D11A 3SDLC 3UIOB 1X1MA 2IO1B 4BOZB 4I6LB 4IM2A 2BYFA 2KWVB 3TIXA 1WZ0A 4IM0A 2IY1B 4DDGD 2MCNB 3ZRFA 2UWQA 4TQ0A 1EF5A 2C5LC 3K9PB 2KFJA 4IC7B 4ZDVA 3L10B 4K81A 3VDZA 3DQVA 4W9HA 5AZHA 4ZRJA 5IAAC 2I1KA 5J2RA 1UBIA 1WXSA 4EEWA 3ZW3A 1H4RA 3VXWA 4HPMB 3VTVA 2CHXA 2KDIA 2L7RA 4LCDE 2LXAA 1WZ3A 3LJ3A 5CHWA 1GNUA 3ZNZB 4DHZE 5JZEB 2C7MB 4G3XB 2K39A 3DOWA 3NS8A 3VQIA 3HK0A 4GOCA 2MP2B 4MM3A 1V81A 3MHSD 3R7RA 1Z5SB 2LI5A 3N32A 4FJVB 1TBEA 4WAAA 2MW5A 1ZW7A 2KFKA 2KKCA 4MGYE 3EHVA 5IA7A 3DDCB 2G4SA 3DBSA 3IVFA 1EUVB 3ZTDA 4WWOA 4NJ7A 2M1MA 4PS3A 1OEYJ 1OQYA 4E71A 5AEKB 3NZSA 5JHBA 2L05A 2PE6B 4GB9A 4XC2A 3ZNID 4TV3A 2L0TA 2RR9A 2Z59B 3H1UA 3C0RB 4TKNA 2J0MA 1XD3B 1J8CA 4BKTA 4CHKA 1WFYA 3H7PA 1P1AA 2EMSA 2XBBC 3B0AA 2J0JA 5DCNA 4FHKA 3TJPA 3RUIB 2KMAA 3HM3A 3JSVA 3WIMA 3X0WA 3EFUA 3MJWA 5LLIA 4BVUC 2DAJA 2UYZB 3ZUNA 2LASA 4WJQA 1LFDA 2ASQA 3M95A 4JQWC 4GDLB 5CX3A 4CYEA 3DBHI 1TGZB 3AI5A 3PRMB 1E8YA 3KUZA 3L13A 2NBWB 4HK2A 4MH0E 4RM9A 3PRZA 2DAFA 2MRPA 2N7DA 4MDKE 4HCPB 1BT0A 3TCAA 2FUHB 3N30A 1TTNA 3H7SA 5D94A 4GN1A 3SHQA 3IHPC 3JVZX 3BINA 2K25A 2Z0EB 4K1RB 2C7HA 2AL6A 3ZTCA 4E74A 2IO3B 1I35A 4ZRKA 4GXBA 4NNJB 5DPSA 2DENB 2LJ5A 4K7UA 1C3TA 2V1YA 4NQLB 3KUDB 2DX5B 2FCSA 2DYBA 3PSEB 1RLFA 4GDKA 3DVNV 2JT4B 3JW0X 2DYMA 3PV1A 3V62A 2WYQA 3R3MA 1GJZA 3NY5A 1WXVA 1WXMA 2DZKA 2KDBA 2PEAA 2MSED 1Q0WB 3QARA 2WDTB 4DXAB 1SE9A 5JHAA 3IG3A 2FIFA 3VH3B 3ZDTA 4IWQA 3AU5A 2D07B 1F9JA 1WGDA 2HJ8A 1NDDA 2KX3A 4IM3A 2KFKB 1KOTA 3ZKJC 1E7VA 3K9OB 1T0YA 4M8MA 3NZUA 2KZRA 4NJ6A 3TBLD 1KLVA 2ZJDA 1WR1A 2G45B 4G0NB 1U4AA 3PT2B 4WJPA 4K7WA 2LGXA 2IO2B 3ECIA 2LVOA 3M3JA 1YJ1A 1Z2MA 2GBRA 3AU4A 4W9JA 4DHJB 4HCNB 2GOWA 2N1WA 3CSFA 1E7UA 4IG7B 3H7PB 4FADA 1UD7A 2L00B 3DCGA 2D10A 3OAWA 3JSVB 3V61A 3WAMA 2JPHA 3R7QA 3V60A 4BBNC 4ANUA 4EZLA 3U7DA 1WGYA 4YL8A 2KTRB 2M17A 3RULA 4I6NB 1V49A 3QWZB 5D2MB 4HJKA 1WIAA 2R2QA 4WWNA 2HTHA 3QQ8B 2WWZA 2IBIB 3A9KA 2DZIA 4LJOB 2K8HA 4X57B 1H8CA 2V4LA 4W9FA 2CU1A 3VFKA 3ZO5B 4KVGB 1YQBA 3KH0A 2CKHB 3DVNU 4A3OA 1UH6A 2MBBB 2XK5A 1P98A 3H6NA 4P7IA 3CF6E 1P9DU 4LDTB 2IO0B 3HM6X 3GZNI 4GDKB 2NBVB 4W9DA 3WAOA 1KJTA 1WM2A 3A9JA 1UBQA 2KNBA 4ZYNA 1QZEA 2BGFA 4EUTA 4AOFA 3KUCB 1WX9A 4A20A 1J19A 2KX0A 3RT3B 4KDLB 3R66C 4MGKE 4PYZA 1D3ZA 2W9NA 3IBEA 4B6WA 4HWIB 3RCZA 2ZZPB 2BYEA 4NAWA 3UINB 3ZRCA 3W1SA 3M63B 3ML9A 2LVPA 2K8CA 2FCNA 4KIKA 1WGHA 4IWOA 1K8RB 2AL3A 3WANA 5DPTA 2JZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJU A;  4AJY B;  2ZPY A;  4FJY A;  3ML8 A;  4G11 A;  4F7Z A;  1V6E A;  3WA0 A;  2KQS A;  3AXC A;  4PS7 A;  2XEW A;  2JVC A;  5AZG A;  2MBQ A;  5AZF A;  4RM8 A;  1Y8R C;  1YX5 B;  2REX A;  2JUO A;  2KC2 A;  5CHF A;  5C23 A;  3ONS A;  2KDE B;  4JL9 A;  2KTR A;  2VRR B;  3A9K B;  5E6N A;  4DHJ D;  2A4Z A;  1AAR A;  2V3S A;  2NS5 A;  3PS6 A;  4HPL B;  1XT9 B;  4NQK E;  3VUY A;  3WAL A;  2WX0 A;  1YD8 U;  2FCM A;  1WJ6 A;  3QAQ A;  1WX8 A;  2AWT A;  1GUA B;  2KD0 A;  4ICU A;  3ZVV A;  5LXI B;  2K6Q A;  4ANV A;  2XK5 B;  3ZDM C;  3GOE A;  1WXA A;  4KZC A;  1NBF C;  4MSQ B;  4FLH A;  4N9F 4;  2KDF B;  4KV2 A;  2RSU A;  1LM8 B;  4HLE A;  1S1Q B;  5GMV A;  1LXD A;  4DHZ B;  3AUL A;  3QHT A;  3UQB A;  3MTN B;  3KVF B;  4ICV A;  2KWC A;  4JIO U;  1LQB A;  3A9J B;  4MEL A;  3VAW A;  3U30 A;  1Q5W B;  5J18 A;  5DPW A;  3UF8 A;  4B95 A;  2R2O A;  4ZRI A;  4EKU A;  2BKF A;  4FHJ A;  2LRW A;  2D2Q A;  4CO7 A;  1TZ1 A;  3T9L A;  2GBJ A;  5D6J B;  2KWU B;  1L7Y A;  1CMX B;  2ZNV B;  1PQS A;  2ZVO A;  4AP4 C;  4FA6 A;  4NAW B;  2KXJ A;  2KJH B;  4KIK B;  1GC6 A;  4LDT D;  4XZ4 A;  3L16 A;  4DBG A;  1J0G A;  2NBU A;  2ZCB A;  3PLV A;  4HVB A;  2LRU A;  3ZIM A;  1WJ4 A;  5E6O A;  3TMP B;  3UIP B;  3UQA A;  3DVG Y;  1SGH A;  4M8N A;  4RMA A;  2HE7 A;  2HD5 B;  3A1Q A;  2JXX A;  2N9X A;  2D3G A;  3T8M A;  1HE8 A;  2DZM A;  2JZ3 B;  4KDI C;  4MGZ E;  2G4D B;  1NI2 A;  4PYU A;  4E3C A;  1ZKH A;  3APC A;  1E5W A;  3A4R A;  1WR6 E;  3EC8 A;  4FUL A;  4KSK C;  3RYT A;  4ANX A;  1OEY A;  1VCB A;  2KMC A;  2LWP A;  2BPS A;  4DDI D;  1WE7 A;  4W9G A;  1WRD B;  1KM7 A;  3PHX B;  4XX5 A;  3PRE A;  3B08 A;  2M4N A;  1UZX B;  1WMH A;  1R4M I;  3HHM A;  2G3Q B;  3DBL I;  2GMI C;  2ZCC A;  1WI0 A;  1WE6 A;  4AUQ C;  1E90 A;  2L8J A;  1RFA A;  4BFR A;  1GG3 A;  2NR2 A;  4DWF A;  3OJ4 B;  4A3P A;  1WJN A;  3A33 B;  2YLM A;  2K1F A;  3I3T B;  1EF1 A;  3V6C B;  1OTR B;  2JWZ A;  2LZ6 A;  1P3Q U;  4GIV A;  1V80 A;  4LJP B;  4PS8 A;  2J0K A;  5C1Z A;  3ZNH B;  4TQ1 A;  4WJN A;  2OJR A;  2KLG A;  2FCQ A;  2GBM A;  3ALB A;  3DBR I;  2FNJ B;  1VD2 A;  2QHO A;  3QX1 A;  3EEC A;  3IFW B;  1V86 A;  2RPQ A;  1JRU A;  3PTF C;  1S3S G;  3VTU A;  3WAP A;  4EZJ A;  3X23 A;  2AEH A;  2ZPN A;  2WX1 A;  4MSM B;  3VUW A;  3RZF A;  1YX6 B;  3KYC D;  5L95 C;  2MX2 A;  3TL5 A;  1WYW B;  2KOX A;  3QJZ A;  2I1J A;  2KJR A;  4NPN A;  3BY4 B;  4MJS A;  3NOB A;  4AWJ A;  2MA9 B;  3A1Q B;  3PPA A;  4ASW C;  2DZJ A;  3PZD A;  2KJ6 A;  3Q3F A;  1E8X A;  2LVQ A;  3LDZ E;  2BKR B;  3PGE A;  2M0X A;  5BO4 B;  2KK8 A;  4MEM A;  1XQQ A;  4B9K A;  1E8W A;  3A4S C;  5FR6 A;  2EMT A;  3ENE A;  4JGH B;  4FBJ B;  4KSL C;  4KZ0 A;  5DPR A;  5JH5 C;  4W9C A;  4AJW A;  4F1S A;  1WF9 A;  2AYO B;  4HXD A;  2LUE A;  5CHV C;  2C7N B;  3N3K B;  5E6P A;  2CR5 A;  1WMH B;  5CTR C;  2MBH A;  2JRI B;  4EZK A;  4K7S A;  2JY6 A;  2N9E B;  5HKH A;  1P0R A;  3QA8 A;  3V6E B;  1IYF A;  1A5R A;  1ISN A;  3QC8 B;  4FJZ A;  1E8Z A;  1YIW A;  2GBK A;  2IZV B;  2BWF A;  4ANW A;  3VHT C;  1WM3 A;  3APF A;  4W9I A;  4BOS C;  3SD5 A;  3L54 A;  2L3Z A;  5D7G A;  3VTW A;  1UEL A;  2MBO A;  2RD0 A;  1SIF A;  2KTF A;  4BBN F;  3APD A;  2NCN A;  1R4N I;  4W9L A;  1ZGU B;  2NPT B;  4IWP A;  2YVC A;  3VH4 B;  3ZNG C;  1IPG A;  4TUU A;  2PJH A;  2J7Q B;  2LGY A;  3PRP B;  2DYO A;  5G2N A;  2K6D B;  1V2Y A;  2O2V A;  2MQJ A;  3P2B A;  2M8S A;  2BWE S;  1V9J A;  2CHZ A;  4JLC A;  2O6V A;  3O65 B;  2ZVN A;  3S2A A;  4EOY A;  3JYU A;  3OLM D;  3U8Z A;  2A5U A;  2N9P C;  1WH3 A;  3H9D A;  2BF8 B;  4WQO B;  5LXH A;  2BYV E;  2GBN A;  2OOB B;  3W1Y A;  2Z0D B;  2LD9 A;  2JRH A;  2LXC A;  4HDO A;  4MJS B;  4OVU A;  4IUM B;  2KN5 A;  2MWS B;  2N4F A;  2N7E A;  2KQ7 A;  2N1V A;  2C9W B;  4I6P A;  3M62 B;  4IW0 A;  2O6V D;  3RZW C;  1G6J A;  2EKE C;  2CS4 A;  4II2 B;  1EO6 A;  1V5O A;  5KHQ A;  4II3 B;  2K8B A;  4GMV A;  2IYD B;  2NVU I;  3OJ3 A;  4F8C B;  4M0W B;  2KO3 A;  2MBE A;  3D32 A;  2FAZ A;  4FN2 A;  2CHW A;  2MLB A;  5J17 A;  5EDS A;  2MP2 A;  5G55 A;  3RD2 A;  3QIJ A;  2L76 A;  3CMM B;  3ZLZ A;  4BKS A;  1L2N A;  3L08 A;  2KLC A;  1GC7 A;  4J6I A;  1MG8 A;  1Q1O A;  2RGF A;  5KHO A;  4GGQ A;  4DK5 A;  1RRB A;  2L0F A;  3SU8 X;  1OGW A;  3DVG X;  1IP9 A;  2ZEQ A;  3B1L X;  4NY0 A;  1C1Y B;  1RAX A;  2KHW B;  2ZNV C;  1V5T A;  3QCA A;  5TR5 A;  3NHE B;  2B3A A;  4GU2 A;  2Y5B B;  4WJO A;  3W1S C;  4WWP A;  2IY0 B;  5L83 A;  4BKS D;  2KVR A;  2DHZ A;  3DPD A;  3QK0 A;  4HDQ A;  2PE9 A;  3VUX A;  4G50 A;  3CST A;  3L17 A;  4OVV A;  3HIZ A;  1M94 A;  4EFO A;  2PPH A;  1WY8 A;  4MGI E;  3PVL A;  3VVW B;  1WX7 A;  2FID A;  2JF5 A;  1WGG A;  3UGB B;  3Q3J A;  3KW5 B;  2O2V B;  3KYD D;  4BKG A;  4URK A;  2KAN A;  1FXT B;  1I42 A;  2C60 A;  4GSW A;  2KC1 A;  1UGM A;  4GDL A;  4W9K A;  2LGD A;  2NPT A;  1WGR A;  4W9E A;  3PHW B;  2O6V B;  3L0W B;  3PLU A;  2D11 A;  3SDL C;  3UIO B;  1X1M A;  2IO1 B;  4BOZ B;  4I6L B;  4IM2 A;  2BYF A;  2KWV B;  3TIX A;  1WZ0 A;  4IM0 A;  2IY1 B;  4DDG D;  2MCN B;  3ZRF A;  2UWQ A;  4TQ0 A;  1EF5 A;  2C5L C;  3K9P B;  2KFJ A;  4IC7 B;  4ZDV A;  3L10 B;  4K81 A;  3VDZ A;  3DQV A;  4W9H A;  5AZH A;  4ZRJ A;  5IAA C;  2I1K A;  5J2R A;  1UBI A;  1WXS A;  4EEW A;  3ZW3 A;  1H4R A;  3VXW A;  4HPM B;  3VTV A;  2CHX A;  2KDI A;  2L7R A;  4LCD E;  2LXA A;  1WZ3 A;  3LJ3 A;  5CHW A;  1GNU A;  3ZNZ B;  4DHZ E;  5JZE B;  2C7M B;  4G3X B;  2K39 A;  3DOW A;  3NS8 A;  3VQI A;  3HK0 A;  4GOC A;  2MP2 B;  4MM3 A;  1V81 A;  3MHS D;  3R7R A;  1Z5S B;  2LI5 A;  3N32 A;  4FJV B;  1TBE A;  4WAA A;  2MW5 A;  1ZW7 A;  2KFK A;  2KKC A;  4MGY E;  3EHV A;  5IA7 A;  3DDC B;  2G4S A;  3DBS A;  3IVF A;  1EUV B;  3ZTD A;  4WWO A;  4NJ7 A;  2M1M A;  4PS3 A;  1OEY J;  1OQY A;  4E71 A;  5AEK B;  3NZS A;  5JHB A;  2L05 A;  2PE6 B;  4GB9 A;  4XC2 A;  3ZNI D;  4TV3 A;  2L0T A;  2RR9 A;  2Z59 B;  3H1U A;  3C0R B;  4TKN A;  2J0M A;  1XD3 B;  1J8C A;  4BKT A;  4CHK A;  1WFY A;  3H7P A;  1P1A A;  2EMS A;  2XBB C;  3B0A A;  2J0J A;  5DCN A;  4FHK A;  3TJP A;  3RUI B;  2KMA A;  3HM3 A;  3JSV A;  3WIM A;  3X0W A;  3EFU A;  3MJW A;  5LLI A;  4BVU C;  2DAJ A;  2UYZ B;  3ZUN A;  2LAS A;  4WJQ A;  1LFD A;  2ASQ A;  3M95 A;  4JQW C;  4GDL B;  5CX3 A;  4CYE A;  3DBH I;  1TGZ B;  3AI5 A;  3PRM B;  1E8Y A;  3KUZ A;  3L13 A;  2NBW B;  4HK2 A;  4MH0 E;  4RM9 A;  3PRZ A;  2DAF A;  2MRP A;  2N7D A;  4MDK E;  4HCP B;  1BT0 A;  3TCA A;  2FUH B;  3N30 A;  1TTN A;  3H7S A;  5D94 A;  4GN1 A;  3SHQ A;  3IHP C;  3JVZ X;  3BIN A;  2K25 A;  2Z0E B;  4K1R B;  2C7H A;  2AL6 A;  3ZTC A;  4E74 A;  2IO3 B;  1I35 A;  4ZRK A;  4GXB A;  4NNJ B;  5DPS A;  2DEN B;  2LJ5 A;  4K7U A;  1C3T A;  2V1Y A;  4NQL B;  3KUD B;  2DX5 B;  2FCS A;  2DYB A;  3PSE B;  1RLF A;  4GDK A;  3DVN V;  2JT4 B;  3JW0 X;  2DYM A;  3PV1 A;  3V62 A;  2WYQ A;  3R3M A;  1GJZ A;  3NY5 A;  1WXV A;  1WXM A;  2DZK A;  2KDB A;  2PEA A;  2MSE D;  1Q0W B;  3QAR A;  2WDT B;  4DXA B;  1SE9 A;  5JHA A;  3IG3 A;  2FIF A;  3VH3 B;  3ZDT A;  4IWQ A;  3AU5 A;  2D07 B;  1F9J A;  1WGD A;  2HJ8 A;  1NDD A;  2KX3 A;  4IM3 A;  2KFK B;  1KOT A;  3ZKJ C;  1E7V A;  3K9O B;  1T0Y A;  4M8M A;  3NZU A;  2KZR A;  4NJ6 A;  3TBL D;  1KLV A;  2ZJD A;  1WR1 A;  2G45 B;  4G0N B;  1U4A A;  3PT2 B;  4WJP A;  4K7W A;  2LGX A;  2IO2 B;  3ECI A;  2LVO A;  3M3J A;  1YJ1 A;  1Z2M A;  2GBR A;  3AU4 A;  4W9J A;  4DHJ B;  4HCN B;  2GOW A;  2N1W A;  3CSF A;  1E7U A;  4IG7 B;  3H7P B;  4FAD A;  1UD7 A;  2L00 B;  3DCG A;  2D10 A;  3OAW A;  3JSV B;  3V61 A;  3WAM A;  2JPH A;  3R7Q A;  3V60 A;  4BBN C;  4ANU A;  4EZL A;  3U7D A;  1WGY A;  4YL8 A;  2KTR B;  2M17 A;  3RUL A;  4I6N B;  1V49 A;  3QWZ B;  5D2M B;  4HJK A;  1WIA A;  2R2Q A;  4WWN A;  2HTH A;  3QQ8 B;  2WWZ A;  2IBI B;  3A9K A;  2DZI A;  4LJO B;  2K8H A;  4X57 B;  1H8C A;  2V4L A;  4W9F A;  2CU1 A;  3VFK A;  3ZO5 B;  4KVG B;  1YQB A;  3KH0 A;  2CKH B;  3DVN U;  4A3O A;  1UH6 A;  2MBB B;  2XK5 A;  1P98 A;  3H6N A;  4P7I A;  3CF6 E;  1P9D U;  4LDT B;  2IO0 B;  3HM6 X;  3GZN I;  4GDK B;  2NBV B;  4W9D A;  3WAO A;  1KJT A;  1WM2 A;  3A9J A;  1UBQ A;  2KNB A;  4ZYN A;  1QZE A;  2BGF A;  4EUT A;  4AOF A;  3KUC B;  1WX9 A;  4A20 A;  1J19 A;  2KX0 A;  3RT3 B;  4KDL B;  3R66 C;  4MGK E;  4PYZ A;  1D3Z A;  2W9N A;  3IBE A;  4B6W A;  4HWI B;  3RCZ A;  2ZZP B;  2BYE A;  4NAW A;  3UIN B;  3ZRC A;  3W1S A;  3M63 B;  3ML9 A;  2LVP A;  2K8C A;  2FCN A;  4KIK A;  1WGH A;  4IWO A;  1K8R B;  2AL3 A;  3WAN A;  5DPT A;  2JZZ A; 
#chains in the Genus database with same CATH topology
 1HZ6 A;  2AQ3 B;  2H88 B;  4WH4 A;  2MJ3 A;  4LNO A;  2REX A;  3ONS A;  3IXS A;  4KKI A;  2JQR B;  3A9K B;  5E6N A;  2A4Z A;  1YMH E;  3PS6 A;  3WAL A;  1FFU A;  1YD8 U;  2FCM A;  2WXK A;  1WJ6 A;  1XLN A;  3ZVV A;  5LXI B;  3GOE A;  1WXA A;  4LLG M;  2RPV A;  3AEB B;  4AQ7 A;  1LXD A;  4DHZ B;  3PZ7 A;  4JIO U;  4MEL A;  1LQB A;  4OZC A;  1K51 A;  3UF8 A;  4B95 A;  2R2O A;  1YN3 A;  3AE4 B;  3NVY A;  4XWT A;  4EKU A;  1PDX A;  4FHJ A;  1SBB B;  1Q10 A;  1TZ1 A;  2ZNV B;  4H2A A;  1SIJ A;  2ZVO A;  4AP4 C;  4R3D A;  4KIK B;  4DBG A;  1KF6 B;  2SEB D;  2JSV X;  4XE0 A;  2ON8 A;  2LRU A;  1GB1 A;  3TMP B;  1HZ5 A;  3UIP B;  2H89 B;  4M8N A;  3P4S B;  2JXX A;  2N9X A;  1HE8 A;  2DZM A;  3HUI A;  3VR9 B;  1C4A A;  3APC A;  1E5W A;  2J4X A;  1I4R A;  3EC8 A;  4US9 A;  1MG4 A;  1VCB A;  2KMC A;  4XYC A;  2LWP A;  4DDI D;  1WRD B;  4A8X C;  3B08 A;  1UZX B;  1R4M I;  4RH6 A;  3DBL I;  4YSZ B;  5IP4 D;  1C4C A;  2BBC A;  3A33 B;  2N9K A;  5AUI A;  2K1F A;  2KDM A;  1EF1 A;  3AE1 B;  2JWZ A;  3KWL A;  1V80 A;  3Q8A A;  3ZJV A;  2J0K A;  1L6U A;  2OJR A;  2KLG A;  2EKI A;  2GI9 A;  2QHO A;  3EEC A;  1FNV A;  2MJE A;  3WAP A;  3X23 A;  1KFY B;  2ZPN A;  1GAQ B;  2KOX A;  3QJZ A;  1F52 A;  5FK9 C;  1WYG A;  2W82 A;  2XN9 C;  1J7A A;  2DZJ A;  3Q3F A;  1E8X A;  4C7Y A;  2LVQ A;  2BS3 B;  4MEM A;  4HRO A;  1E8W A;  1IBX B;  5FR6 A;  3ENE A;  4JGH B;  1N5W A;  5JH5 C;  2QDF A;  4AJW A;  3SR6 A;  2WXF A;  3N3K B;  4EE2 A;  4BZA A;  4EZK A;  1DYQ A;  4K7S A;  5HKH A;  3IT6 B;  4US8 A;  1N61 A;  1I4H A;  3DHI C;  1A5R A;  4FJZ A;  1YN4 A;  2BWF A;  3VHT C;  5E6J A;  2NMQ A;  4BOS C;  2L3Z A;  2KAC A;  5D7G A;  2MBO A;  2KYW A;  3GE8 C;  4IWP A;  2YVC A;  2AQ2 B;  3ZNG C;  1IPG A;  4TUU A;  2DYO A;  4YSY B;  3P2B A;  3KWV A;  2CHZ A;  3TEZ A;  2WU5 B;  3U8Z A;  2LD9 A;  2JRH A;  4C4V A;  3NJT A;  2N7J A;  1K53 A;  5FKA C;  2O6V D;  1G6J A;  2CS4 A;  4II2 B;  3AE5 B;  2K8B A;  2KVZ A;  2IYD B;  3OJ3 A;  4F8C B;  4M0W B;  3WCQ A;  4FN2 A;  5J17 A;  1E7P B;  5EDS A;  3RD2 A;  5IOI A;  4IOI E;  3L08 A;  2KLC A;  2RGF A;  2L0F A;  5BYR A;  1OGW A;  1I4P A;  1IP9 A;  2G1E A;  4NAM A;  4NZL B;  1V5T A;  3QCA A;  4GU2 A;  1FXA A;  3W1S C;  4WWP A;  4BAX A;  1VR9 A;  2DHZ A;  2PE9 A;  1L4D B;  1XCT L;  2INP E;  2WHI A;  3Q6B A;  1TS5 A;  4MGI E;  1WX7 A;  1WGG A;  3KW5 B;  3U4E G;  3MJ5 A;  1UGM A;  4W9K A;  1UUP A;  1JWA D;  4A90 A;  2KWV B;  1WZ0 A;  4IM0 A;  4A6Q A;  2KFJ A;  2VZK B;  4K81 A;  1V8C A;  1UBI A;  2BT6 A;  3VUX A;  3BVZ A;  5CHW A;  2J42 A;  4G3X B;  3DOW A;  3KLS X;  3NVW A;  4GOC A;  2MP2 B;  2JXT A;  3Q69 A;  3R7R A;  2QIL A;  1TBE A;  4M0W A;  3P1M A;  4MGY E;  1ENF A;  3DBS A;  4WIP A;  2BB6 A;  3NZS A;  2L05 A;  4GB9 A;  4TV3 A;  4TKN A;  3FAH A;  1J8C A;  1AYF A;  1WXQ A;  3VR8 B;  2EMS A;  2JYE A;  3TJP A;  3RUI B;  3HM3 A;  1AWD A;  2ASQ A;  3M95 A;  3Q14 C;  4JQW C;  4YTM B;  2KAJ A;  3DBH I;  1TGZ B;  2DAF A;  1PUT A;  1QOG A;  1TTN A;  3H7S A;  3SHQ A;  3IHP C;  4K1R B;  4E74 A;  1I35 A;  4ZRK A;  1FRR A;  3BK2 A;  2LJ5 A;  4K7U A;  2R61 A;  2NTS A;  2DYB A;  4OW0 A;  3V62 A;  1AN8 A;  2Y5P A;  3QAR A;  2PEA A;  1SE9 A;  5JHA A;  3IG3 A;  3VH3 B;  3AE9 B;  1WGD A;  1NDD A;  2KX3 A;  3K9O B;  1XLQ A;  2KZR A;  4NJ6 A;  3MHZ A;  4FXC A;  4G0N B;  4K7W A;  2LGX A;  1OFF A;  4WAF A;  3AU4 A;  2Y5C A;  1VLB A;  5BMH A;  1JCK B;  1NEK B;  2D10 A;  2WDV B;  4MH8 A;  3JSV B;  2XNA C;  2UU7 A;  1P7F A;  3WAM A;  3R7Q A;  3V60 A;  4EZL A;  4RCO A;  2M17 A;  3T3O A;  1UNS A;  1TY2 A;  3TUO A;  4HJK A;  1WIA A;  4WWN A;  3TEY A;  2HTH A;  4ACF A;  2OJW A;  4X57 B;  1H8C A;  3ZO5 B;  2WXG A;  2RDH A;  1PYW D;  1EM7 A;  2D3A A;  3HM6 X;  4KGT A;  5G5G A;  1N6Z A;  1PGA A;  1QT9 A;  4ZYN A;  4D2K A;  2Y3A A;  4A20 A;  2WDR B;  2KX0 A;  4ZYS A;  4MGK E;  1SF0 A;  1D3Z A;  4B6W A;  3BZD B;  3FIL B;  1F2R C;  2I38 A;  3RNA C;  3ZRC A;  3UIN B;  1SE4 A;  1TS4 A;  3ZXR A;  2LVP A;  1P7E A;  4L23 A;  1ZDX A;  1WGK A;  3AN1 A;  4IWO A;  1SSN A;  1JAL A;  1PFD A;  4FJY A;  4G11 A;  2CJO A;  3P63 A;  4F7Z A;  1V6E A;  1BML C;  3B2F A;  5MPO A;  2KQS A;  3AXC A;  4KKJ A;  2KC2 A;  5CHF A;  4YT0 B;  2DWQ A;  4REZ A;  2IND C;  3VUY A;  2WX0 A;  2K9X A;  1K52 A;  1DOX A;  2KD0 A;  4ANV A;  2XK5 B;  2IPK D;  2Z8L A;  4FLH A;  4N9F 4;  4RGN A;  4KV2 A;  4PT5 A;  2N0S B;  3AUL A;  3QHT A;  3KVF B;  3VAW A;  5J18 A;  3O13 A;  1JWS D;  4RGT A;  4ZRI A;  2W54 A;  2HTM E;  2KT7 A;  3C8Y A;  1L7Y A;  3NUH B;  4FA6 A;  4OVZ A;  4LDT D;  1B9R A;  1KH0 A;  3EUB 2;  4XGA B;  1J0G A;  2ZCB A;  3RNF C;  2VH2 A;  1QIL A;  3KQ4 A;  1WJ4 A;  1D5X C;  3ZQ4 A;  1E6E B;  2MH7 A;  4XWW A;  3UQA A;  3DVG Y;  4HJG E;  2HD5 B;  3T8M A;  2E3T A;  4WWM A;  4MGZ E;  4KDI C;  2BVC A;  1NI2 A;  2BQQ A;  4E3C A;  1ZKH A;  4KSK C;  4FUL A;  4ANX A;  3AE3 B;  4W9G A;  3GS2 A;  4XX5 A;  4RNA A;  3HHM A;  4RF0 A;  2G3Q B;  2GMI C;  1WI0 A;  1N63 A;  1E90 A;  1GG3 A;  1QLB B;  3UI3 A;  3SFD B;  2B76 B;  3Q8C A;  2YLM A;  4PS8 A;  3FKY A;  4LJP B;  1QKZ A;  2GBM A;  3BII D;  4N59 A;  3DBR I;  3RFZ B;  3QX1 A;  1V86 A;  4EZJ A;  3VUW A;  3MP9 A;  3RZF A;  3HVD A;  5L95 C;  1EU4 A;  2MX2 A;  3V05 A;  3TL5 A;  4ZRP A;  1STE A;  4NPN A;  4MJS A;  1I4Q A;  4AWJ A;  4RFB A;  2BS4 B;  1T0Q C;  1TS3 A;  1WWT A;  2DBY A;  3LDZ E;  4M00 A;  2BKR B;  3A4S C;  2JX5 A;  1TKY A;  2V3P A;  1YNT E;  2AYO B;  5CHV C;  2C7N B;  5E6P A;  4HRS A;  5CTR C;  3V6E B;  1IYF A;  3QC8 B;  3TEX A;  1JWM D;  1WM3 A;  2YEP F;  3APF A;  3SD5 A;  3L54 A;  1ROE A;  1L5P A;  4M02 A;  1SIF A;  5BMI A;  1F2R I;  4W9L A;  3VH4 B;  4AUQ C;  4CYE A;  2PJH A;  1LO5 D;  3PRP B;  4TSS A;  5G2N A;  2LGI A;  2K6D B;  2MQJ A;  2PLP A;  2M8S A;  3O65 B;  3NG0 A;  3OLM D;  2A5U A;  2N9P C;  2GBN A;  4K3C A;  1BUI C;  2N4F A;  1YOV B;  1J7B A;  2N1V A;  4I6P A;  3M62 B;  4IW0 A;  1EO6 A;  4II3 B;  2INN E;  2NVU I;  2KO3 A;  2MBE A;  3D32 A;  2FAZ A;  2CHW A;  5G55 A;  1UGJ A;  3QIJ A;  3CMM B;  2LHD A;  4BKS A;  4J6I A;  1MG8 A;  4GGQ A;  4DXF A;  3DVG X;  1I7H A;  3B1L X;  1C1Y B;  3LXF A;  1RAX A;  5TR5 A;  3EA6 A;  3NHE B;  3E9S A;  2Y5B B;  2IY0 B;  5L83 A;  3DPD A;  3QK0 A;  4G50 A;  3CST A;  1M94 A;  1ACC A;  1FIQ A;  1A70 A;  2FID A;  3W9C B;  1XO3 A;  1ZXI A;  4URK A;  1FXT B;  2KC1 A;  3PHW B;  2D11 A;  5FR3 A;  2OED A;  4BOZ B;  1FFV A;  2WLB A;  2JZP A;  4C4V B;  3ZRF A;  3K9P B;  4IC7 B;  3ZJU A;  3L10 B;  3MC0 B;  1FNW A;  5IAA C;  1CZP A;  4ZRJ A;  5J2R A;  4JE3 B;  3ZW3 A;  1H4R A;  3VXW A;  4HPM B;  2KDI A;  4O1N A;  3ZNZ B;  1XXG A;  2C7M B;  5HG2 A;  2K39 A;  3NS8 A;  2PIA A;  2G9H D;  2K3U A;  2LI5 A;  3CWI A;  1ZW7 A;  2KKC A;  5IA7 A;  2Q5W D;  2G4S A;  3IVF A;  2X8X X;  5LNK 1;  3GP7 A;  3ZTD A;  1C79 A;  4NJ7 A;  2M1M A;  1HEZ E;  1R4M B;  5JHB A;  3DBL B;  1DOI A;  3DWG C;  3ZNI D;  3H1U A;  2J0M A;  4BKT A;  4CHK A;  3B0A A;  4FHK A;  2BS2 B;  3AEF B;  2KMM A;  3T3N A;  3R8B A;  5CX3 A;  1SE3 A;  3L13 A;  2WXR A;  2NBW B;  4MH0 E;  4ARC A;  2IGD A;  3TCA A;  3N30 A;  2M19 A;  4J3O D;  2K25 A;  2IO3 B;  3RPF C;  1C3T A;  2V1Y A;  5IO9 A;  2FCS A;  4GDK A;  3JW0 X;  2JT4 B;  1GJZ A;  2QJL A;  3NY5 A;  1WXV A;  2DZK A;  1FNU A;  2WDT B;  2FIF A;  5G5H A;  3ZDT A;  4IWQ A;  3TSS A;  1KOT A;  1PGB A;  1E7V A;  1T0Y A;  3AB5 A;  4M8M A;  2G45 B;  3PT2 B;  4M01 A;  1F0Z A;  2IO2 B;  3I63 C;  1ZE3 D;  2LVO A;  2IDY A;  3M3J A;  4S17 A;  1YJ1 A;  4W9J A;  1L6V A;  2W3S A;  4IG7 B;  5JXV A;  2L00 B;  1L0X B;  3DCG A;  1FRD A;  4IKG A;  3V61 A;  1XLO A;  3BYY B;  4TMA B;  3RNG C;  4AS1 A;  1CQV A;  1HQR D;  4YL8 A;  1MHX A;  2KTR B;  2LJI A;  4I6N B;  1V49 A;  3QWZ B;  1L0Y B;  1ZPS A;  1JRP A;  5TSS A;  2WWZ A;  2DZI A;  2CU1 A;  1YQB A;  3BYT B;  3DVN U;  4A3O A;  1UH6 A;  5C3J B;  4P7I A;  3CF6 E;  4ZOH C;  3GZN I;  1V97 A;  3V3X A;  2NBV B;  3NRZ A;  4C00 A;  3A9J A;  2M56 B;  1KRH A;  3AH7 A;  3B9J A;  1WX9 A;  4YTP B;  2WXO A;  3RT3 B;  1RFK A;  2PW9 A;  2W9N A;  3IBE A;  4HWI B;  2ZZP B;  1YQ3 B;  4NAW A;  3ML9 A;  2K8C A;  2FCN A;  1VZ7 A;  3BK1 A;  1WGH A;  5D3I B;  1YJI A;  5DPT A;  2JZZ A;  2WXQ A;  1TYG B;  4B0M A;  2ZPY A;  3TEW A;  3ML8 A;  3WA0 A;  4PS7 A;  1YN5 A;  2JVC A;  4ZHP A;  5AZF A;  4RM8 A;  1YX5 B;  4GLS C;  1XEE A;  2JUO A;  2IJ0 A;  5IKC M;  2KDE B;  4JL9 A;  2KTR A;  4DHJ D;  1AAR A;  3PO0 A;  2V3S A;  2NS5 A;  5C2T B;  4NQK E;  4HEA 1;  3U7Z A;  4P16 A;  3PZ8 A;  3QAQ A;  3RI7 C;  3NZ3 A;  3ZDM C;  1MI0 A;  1V1P B;  2KDF B;  1SXT A;  1LM8 B;  1T6B X;  4ICV A;  2KWC A;  2GB1 A;  1FMA D;  1Q5W B;  3Q8B A;  2J53 A;  5T8I A;  2LRW A;  2PKO A;  2QIE B;  1B1Z A;  3T9L A;  2GBJ A;  1CMX B;  1PQS A;  4B0E A;  5BYQ A;  2NBU A;  2BW2 A;  3ZIM A;  5E6O A;  4JX1 C;  1SGH A;  4RMA A;  3URY A;  3A1Q A;  3DHG C;  2JZ3 B;  2MJD A;  2WQY B;  2G4D B;  1FXI A;  3A4R A;  2BPS A;  1UF0 A;  3DBH B;  1WE7 A;  3AED B;  3PRE A;  1WMH A;  3DHH C;  2GLS A;  1HTO A;  2ICI A;  5AUK A;  1NEN B;  4BFR A;  2NR2 A;  4DWF A;  2LUM A;  4A3P A;  2D5G A;  3VRA B;  1D6E C;  1TJE A;  1V1P A;  2LGS A;  3RMK C;  3I3T B;  4LNK A;  3R2T A;  1TS2 A;  4YWG G;  1JWU D;  3AM9 A;  2LZ6 A;  1P3Q U;  3I57 A;  4GIV A;  5C1Z A;  3P42 A;  3ZNH B;  4TQ1 A;  3Q8E A;  4WJN A;  3ZYY X;  2FCQ A;  3ALB A;  5HI1 A;  3N1Y C;  1QF6 A;  5EE1 A;  1TIF A;  3IFW B;  2RPQ A;  1JRU A;  1S3S G;  2WXN A;  4L2Y A;  1YX6 B;  3N1X C;  2PMV A;  1WYW B;  2KJR A;  3BY4 B;  3NOB A;  2MA9 B;  3PPA A;  1EU3 A;  2L32 A;  4ASW C;  3PZD A;  2MEK A;  4B9K A;  4FBJ B;  5DPR A;  1D4B A;  4W9C A;  1C4P A;  5H8Y E;  1WF9 A;  4DXG A;  4HXD A;  2LUE A;  1ZDV A;  2JRI B;  4HKQ A;  1GB4 A;  3QA8 A;  1ISN A;  1E8Z A;  3L4P A;  1YIW A;  2IZV B;  4ANW A;  4W9I A;  3U52 E;  3ZXV A;  4A55 A;  1FD6 A;  4XDC A;  2KTF A;  4BBN F;  2ZW1 A;  3APD A;  1MFW A;  5EE3 A;  1R4N I;  2NPT B;  2J7Q B;  2LGY A;  2QEJ C;  1V2Y A;  5EE9 A;  3IT4 B;  2O2V A;  2BWE S;  4OHJ A;  1V9J A;  4JLC A;  2O6V A;  3Q8F A;  3S2A A;  4EOY A;  3JYU A;  1WH3 A;  2FE8 A;  2BF8 B;  5LXH A;  2BYV E;  3W1Y A;  2Z0D B;  4HDO A;  4OVU A;  4MJS B;  2KN5 A;  2MWS B;  1ESF A;  1N62 A;  1F77 A;  2JYT A;  4MM3 B;  1V5O A;  2BYT A;  5KHQ A;  1Y56 A;  4GMV A;  1J7C A;  3FC4 A;  1C76 A;  4JPS A;  1L2N A;  3NVZ A;  1GC7 A;  1C78 A;  4DK5 A;  1RRB A;  4NY0 A;  2TSS A;  1FCL A;  2B3A A;  3H8H A;  4KGS A;  2BTE A;  3AEE B;  1NYQ A;  2KVR A;  1C77 A;  1SB3 C;  3L17 A;  3HIZ A;  4EFO A;  2PPH A;  3AEC B;  3VVW B;  2JF5 A;  2RDG A;  3UGB B;  4BKG A;  2C60 A;  3E56 A;  4GDL A;  2NPT A;  3L0W B;  3PLU A;  3UIO B;  4C80 A;  2IO1 B;  2WXH A;  4IM2 A;  2AQ1 B;  2BYF A;  3TIX A;  2IY1 B;  2MCN B;  2UWQ A;  2WXJ A;  1E0Z A;  1HTQ A;  3DQV A;  3LB8 C;  1C9F A;  3VRB B;  3MC8 A;  3VTV A;  2CHX A;  1PGX A;  2L7R A;  2SAK A;  2LXA A;  1WZ3 A;  3LJ3 A;  4LCD E;  1GNU A;  2PTL A;  3VQI A;  1ZUD 2;  3LYY A;  4MM3 A;  1V81 A;  3MHS D;  4FJV B;  2MW5 A;  2KFK A;  1BXT A;  1JW9 D;  4OZA A;  4PS3 A;  1OQY A;  4E71 A;  4N6E B;  2PE6 B;  3MC9 A;  4MT5 A;  1V1O A;  3H7P A;  1P1A A;  1QOF A;  1ZP0 B;  2J0J A;  4L1B A;  5DCN A;  1EWY C;  2KMA A;  3NVV A;  3X0W A;  3MJW A;  2HJ1 A;  3ZUN A;  1LFD A;  1E8Y A;  1KLU D;  1JRO A;  4HK2 A;  4RM9 A;  4MDK E;  4HCP B;  1BT0 A;  3DBR B;  4GN1 A;  1RM6 C;  2WGS A;  2WP9 B;  3BIN A;  3ZTC A;  2AL6 A;  5DPS A;  4LNN A;  2DEN B;  3KUD B;  2DX5 B;  4K3B A;  4NJC A;  1CK1 A;  1RLF A;  3PSE B;  3PV1 A;  2DYM A;  1YQ4 B;  2KDB A;  1Q0W B;  2CU3 A;  2D3B A;  3W5V B;  2HJ8 A;  4IM3 A;  3ZKJ C;  3TBL D;  4RGO S;  1WR1 A;  2VZK D;  4WJP A;  1U4A A;  1NYR A;  4HCN B;  2N1W A;  3CSF A;  3RN9 C;  3OWE B;  3AMZ A;  1KTK A;  1UD7 A;  3ETR A;  2WXM A;  2ONQ A;  2JPH A;  4USA A;  4BBN C;  4ANU A;  1WGY A;  3RUL A;  2X38 A;  1N5X A;  2HDE A;  3EGR A;  3QQ8 B;  2IBI B;  3A9K A;  4LJO B;  1ET6 A;  2K8H A;  4MAC A;  1DOY A;  2V4L A;  5BMG A;  2INC C;  4W9F A;  1I4X A;  3GB1 A;  3RNE C;  1VZ8 A;  4KVG B;  3KH0 A;  3H6N A;  1P9D U;  2QSD A;  2IO0 B;  4GDK B;  4LDT B;  1RYJ A;  1FCC C;  2KWD A;  5IN7 A;  1VJK A;  3WAO A;  1KJT A;  1UWX A;  4RF1 A;  4RGM A;  1UBQ A;  2KNB A;  4EUT A;  4C56 C;  1J19 A;  1SE2 A;  3I5J C;  1T0S C;  1WSP A;  4KDL B;  3R66 C;  3RCZ A;  2L52 A;  3J9C A;  1VDV A;  2BYE A;  1FPY A;  4KIK A;  1SJH D;  1E10 A;  3EFC A;  3WAN A;  1ZXH A;  3AE2 B;  1WJU A;  4AJY B;  2WDQ B;  2KQ4 X;  3BVM A;  4PK1 A;  3AE6 B;  4IDI A;  2XEW A;  1XCQ L;  5AZG A;  2MBQ A;  1Y8R C;  1MPE A;  1OQQ A;  2V9H A;  3DWM A;  5C23 A;  2VRR B;  4HPL B;  1XT9 B;  1WX8 A;  2AWT A;  1GUA B;  2E6X A;  4ICU A;  3Q3O C;  2K6Q A;  4KZC A;  4MSQ B;  1NBF C;  1FO4 A;  1K50 A;  2RSU A;  4HLE A;  1S1Q B;  5GMV A;  2L83 A;  3UQB A;  3MTN B;  4LNI A;  3A9J B;  1E9M A;  5DPW A;  3U30 A;  3N20 C;  1TT5 B;  1JQ4 A;  2BKF A;  2D2Q A;  4CO7 A;  4A9A A;  5D6J B;  2KWU B;  2WXI A;  3OG5 A;  4UDU C;  4NAW B;  2KXJ A;  2KJH B;  1QOA A;  1GC6 A;  3R2I A;  3SEB A;  4XZ4 A;  3L16 A;  1AW7 A;  3PLV A;  4HVB A;  3AV8 A;  2JU6 X;  1RWS A;  2HE7 A;  1I4G A;  2D3G A;  2J52 A;  3B2G A;  4PYU A;  3P4R B;  1OQR A;  1WR6 E;  3RYT A;  1IBX A;  1OEY A;  4P1B C;  1SEB D;  2W3R A;  1KM7 A;  3PHX B;  2M4N A;  2IGH A;  1L0V B;  4ARI A;  5EE0 A;  2ZCC A;  1WE6 A;  2L8J A;  1RFA A;  3HVZ A;  3OJ4 B;  1WJN A;  2VH1 A;  3V6C B;  1TZO A;  1OTR B;  5HFY A;  2K22 A;  2DNF A;  2FNJ B;  1VD2 A;  1XF5 L;  3Q3M C;  3PTF C;  3VTU A;  2AEH A;  4MSM B;  2WX1 A;  3KYC D;  1TY0 A;  1YJJ A;  2I1J A;  3ZGZ A;  4LTU A;  2K0P A;  3A1Q B;  2KJ6 A;  3PGE A;  1UWM A;  2LHE A;  2M0X A;  5BO4 B;  2KK8 A;  1XQQ A;  3AE8 B;  2I2Y A;  2EMT A;  4KSL C;  4KZ0 A;  3Q2A C;  4F1S A;  4LNF A;  4P1C C;  2CR5 A;  1IGC A;  1WMH B;  2MBH A;  3I9V 1;  2JY6 A;  2N9E B;  1P0R A;  4CQN A;  2GBK A;  1SJE D;  4C7Z A;  4YTN B;  3GZN B;  2LFI A;  3VTW A;  1UEL A;  2RD0 A;  4ITK A;  1N60 A;  1IUE A;  1IGD A;  2NCN A;  1ZGU B;  3N9Y C;  2NTT A;  5GXG B;  4QAY A;  2WXP A;  4JWU C;  2ZVN A;  2IGG A;  1HXY D;  3H9D A;  1JWB D;  2EEL A;  4WQO B;  2OOB B;  2LXC A;  4IUM B;  1ZOY B;  2N7E A;  2KQ7 A;  2C9W B;  5HHD G;  3RZW C;  2EKE C;  3ZJT A;  1T5X D;  3IAS 1;  1MHH E;  1LGR A;  2MLB A;  2MP2 A;  4HPP A;  4OZB A;  2L76 A;  3ZLZ A;  2DLB A;  2AX5 A;  1Q1O A;  2GRI A;  5H92 C;  1QQR A;  5KHO A;  3SU8 X;  2ZEQ A;  1TKE A;  2KHW B;  2ZNV C;  3IAM 1;  4S0R A;  1GPX A;  4WJO A;  2WU2 B;  4BKS D;  2QCZ A;  4OVV A;  2V3N A;  1WY8 A;  1GOZ A;  3MFG A;  3PVL A;  3NS1 A;  3Q3J A;  1EWC A;  2O2V B;  3KYD D;  3RNB C;  2KAN A;  1I42 A;  1F1H A;  4GSW A;  1D5M C;  2LGD A;  1WGR A;  4W9E A;  2O6V B;  3SDL C;  1X1M A;  4WUR A;  4I6L B;  1XLP A;  2QMT A;  4N58 A;  4DDG D;  2L1A A;  4ZDV A;  4TQ0 A;  1EF5 A;  2C5L C;  1TKG A;  3VDZ A;  4W9H A;  5AZH A;  2I1K A;  1WXS A;  4EEW A;  2RMM A;  2V0G A;  4YSX B;  4DHZ E;  3AE7 B;  5JZE B;  3HK0 A;  4HKZ E;  1Z5S B;  3N32 A;  4WAA A;  3EHV A;  3DDC B;  1EUV B;  3AEG B;  4WWO A;  1FEH A;  1OEY J;  4YXD B;  5AEK B;  2ACZ B;  4XC2 A;  2L0T A;  2RR9 A;  2Z59 B;  3C0R B;  1XD3 B;  1WFY A;  4P6V F;  4KGR A;  3ABV B;  2XBB C;  3W5U B;  3JSV A;  3WIM A;  3EFU A;  5LLI A;  4DQO C;  4BVU C;  2DAJ A;  2UYZ B;  2LAS A;  4WJQ A;  1R7S A;  4GDL B;  3AI5 A;  2MHJ A;  3PRM B;  3KUZ A;  3PRZ A;  1KLG D;  2MRP A;  2N7D A;  2D3C A;  2FUH B;  3P4P B;  5D94 A;  3JVZ X;  3HRD D;  2Z0E B;  2C7H A;  2BB5 A;  3BWU D;  2YEP B;  4GXB A;  4NNJ B;  5I4D A;  1DGJ A;  1MVK A;  3C19 A;  4NQL B;  3U2S C;  3DVN V;  1NI3 A;  2WYQ A;  3R3M A;  4HDQ A;  1WXM A;  4DXA B;  1VZ6 A;  2MSE D;  3RNC C;  2CJN A;  3AU5 A;  2D07 B;  1F9J A;  2KFK B;  5BYS A;  3NZU A;  1KLV A;  2ZJD A;  3FIL A;  4Q2J A;  3ECI A;  3P4Q B;  2K5P A;  1WRI A;  1Z2M A;  2GBR A;  1HA5 A;  2OHF A;  4DHJ B;  2GOW A;  1E7U A;  3Q3N C;  3H7P B;  4FAD A;  2WNM A;  1D5Z C;  4KX6 B;  3OAW A;  1VRA B;  3W2D A;  2FBW B;  2M0A A;  2LEK A;  3U7D A;  1ET9 A;  1R4N B;  2W55 A;  5D2M B;  2KN4 A;  2R2Q A;  1T0R C;  3CIR B;  3AEA B;  1MJD A;  1T3Q A;  2RDB C;  3VFK A;  5D3D A;  2CKH B;  4LK0 M;  2MBB B;  2XK5 A;  1P98 A;  3GE3 C;  1FM0 D;  1L4Z B;  2QC8 A;  3BVG A;  4W9D A;  1CJE A;  1WM2 A;  2V4I B;  1NVI D;  2PVG C;  2JWU A;  1QZE A;  2BGF A;  1JML A;  4AOF A;  3KUC B;  2WS3 B;  1M4V A;  2FUG 1;  4PYZ A;  4ZRQ A;  1QOB A;  2N9L A;  4XDD A;  4JWS C;  2WXL A;  3W1S A;  3M63 B;  2ZW0 A;  2LMC A;  4ZHO A;  3N1Z C;  4WQM A;  1K8R B;  2PVO D;  2AL3 A;  3SFE B; 
#chains in the Genus database with same CATH homology
 1WJU A;  4AJY B;  2ZPY A;  4FJY A;  3ML8 A;  4G11 A;  4F7Z A;  1V6E A;  3WA0 A;  2KQS A;  3AXC A;  4PS7 A;  2XEW A;  2JVC A;  5AZG A;  2MBQ A;  5AZF A;  4RM8 A;  1Y8R C;  1YX5 B;  2REX A;  2JUO A;  2KC2 A;  5CHF A;  5C23 A;  3ONS A;  2KDE B;  4JL9 A;  2KTR A;  2VRR B;  3A9K B;  5E6N A;  4DHJ D;  2A4Z A;  1AAR A;  2V3S A;  2NS5 A;  3PS6 A;  4HPL B;  1XT9 B;  4NQK E;  3VUY A;  3WAL A;  2WX0 A;  1YD8 U;  2FCM A;  1WJ6 A;  3QAQ A;  1WX8 A;  2AWT A;  1GUA B;  2KD0 A;  4ICU A;  3ZVV A;  5LXI B;  2K6Q A;  4ANV A;  2XK5 B;  3ZDM C;  3GOE A;  1WXA A;  4KZC A;  1NBF C;  4MSQ B;  4FLH A;  4N9F 4;  2KDF B;  4KV2 A;  2RSU A;  1LM8 B;  4HLE A;  1S1Q B;  5GMV A;  1LXD A;  4DHZ B;  3AUL A;  3QHT A;  3UQB A;  3MTN B;  3KVF B;  4ICV A;  2KWC A;  4JIO U;  1LQB A;  3A9J B;  4MEL A;  3VAW A;  3U30 A;  1Q5W B;  5J18 A;  5DPW A;  3UF8 A;  4B95 A;  2R2O A;  4ZRI A;  4EKU A;  2BKF A;  4FHJ A;  2LRW A;  2D2Q A;  4CO7 A;  1TZ1 A;  3T9L A;  2GBJ A;  5D6J B;  2KWU B;  1L7Y A;  1CMX B;  2ZNV B;  1PQS A;  2ZVO A;  4AP4 C;  4FA6 A;  4NAW B;  2KXJ A;  2KJH B;  4KIK B;  1GC6 A;  4LDT D;  4XZ4 A;  3L16 A;  4DBG A;  1J0G A;  2NBU A;  2ZCB A;  3PLV A;  4HVB A;  2LRU A;  3ZIM A;  1WJ4 A;  5E6O A;  3TMP B;  3UIP B;  3UQA A;  3DVG Y;  1SGH A;  4M8N A;  4RMA A;  2HE7 A;  2HD5 B;  3A1Q A;  2JXX A;  2N9X A;  2D3G A;  3T8M A;  1HE8 A;  2DZM A;  2JZ3 B;  4KDI C;  4MGZ E;  2G4D B;  1NI2 A;  4PYU A;  4E3C A;  1ZKH A;  3APC A;  1E5W A;  3A4R A;  1WR6 E;  3EC8 A;  4FUL A;  4KSK C;  3RYT A;  4ANX A;  1OEY A;  1VCB A;  2KMC A;  2LWP A;  2BPS A;  4DDI D;  1WE7 A;  4W9G A;  1WRD B;  1KM7 A;  3PHX B;  4XX5 A;  3PRE A;  3B08 A;  2M4N A;  1UZX B;  1WMH A;  1R4M I;  3HHM A;  2G3Q B;  3DBL I;  2GMI C;  2ZCC A;  1WI0 A;  1WE6 A;  4AUQ C;  1E90 A;  2L8J A;  1RFA A;  4BFR A;  1GG3 A;  2NR2 A;  4DWF A;  3OJ4 B;  4A3P A;  1WJN A;  3A33 B;  2YLM A;  2K1F A;  3I3T B;  1EF1 A;  3V6C B;  1OTR B;  2JWZ A;  2LZ6 A;  1P3Q U;  4GIV A;  1V80 A;  4LJP B;  4PS8 A;  2J0K A;  5C1Z A;  3ZNH B;  4TQ1 A;  4WJN A;  2OJR A;  2KLG A;  2FCQ A;  2GBM A;  3ALB A;  3DBR I;  2FNJ B;  1VD2 A;  2QHO A;  3QX1 A;  3EEC A;  3IFW B;  1V86 A;  2RPQ A;  1JRU A;  3PTF C;  1S3S G;  3VTU A;  3WAP A;  4EZJ A;  3X23 A;  2AEH A;  2ZPN A;  2WX1 A;  4MSM B;  3VUW A;  3RZF A;  1YX6 B;  3KYC D;  5L95 C;  2MX2 A;  3TL5 A;  1WYW B;  2KOX A;  3QJZ A;  2I1J A;  2KJR A;  4NPN A;  3BY4 B;  4MJS A;  3NOB A;  4AWJ A;  2MA9 B;  3A1Q B;  3PPA A;  4ASW C;  2DZJ A;  3PZD A;  2KJ6 A;  3Q3F A;  1E8X A;  2LVQ A;  3LDZ E;  2BKR B;  3PGE A;  2M0X A;  5BO4 B;  2KK8 A;  4MEM A;  1XQQ A;  4B9K A;  1E8W A;  3A4S C;  5FR6 A;  2EMT A;  3ENE A;  4JGH B;  4FBJ B;  4KSL C;  4KZ0 A;  5DPR A;  5JH5 C;  4W9C A;  4AJW A;  4F1S A;  1WF9 A;  2AYO B;  4HXD A;  2LUE A;  5CHV C;  2C7N B;  3N3K B;  5E6P A;  2CR5 A;  1WMH B;  5CTR C;  2MBH A;  2JRI B;  4EZK A;  4K7S A;  2JY6 A;  2N9E B;  5HKH A;  1P0R A;  3QA8 A;  3V6E B;  1IYF A;  1A5R A;  1ISN A;  3QC8 B;  4FJZ A;  1E8Z A;  1YIW A;  2GBK A;  2IZV B;  2BWF A;  4ANW A;  3VHT C;  1WM3 A;  3APF A;  4W9I A;  4BOS C;  3SD5 A;  3L54 A;  2L3Z A;  5D7G A;  3VTW A;  1UEL A;  2MBO A;  2RD0 A;  1SIF A;  2KTF A;  4BBN F;  3APD A;  2NCN A;  1R4N I;  4W9L A;  1ZGU B;  2NPT B;  4IWP A;  2YVC A;  3VH4 B;  3ZNG C;  1IPG A;  4TUU A;  2PJH A;  2J7Q B;  2LGY A;  3PRP B;  2DYO A;  5G2N A;  2K6D B;  1V2Y A;  2O2V A;  2MQJ A;  3P2B A;  2M8S A;  2BWE S;  1V9J A;  2CHZ A;  4JLC A;  2O6V A;  3O65 B;  2ZVN A;  3S2A A;  4EOY A;  3JYU A;  3OLM D;  3U8Z A;  2A5U A;  2N9P C;  1WH3 A;  3H9D A;  2BF8 B;  4WQO B;  5LXH A;  2BYV E;  2GBN A;  2OOB B;  3W1Y A;  2Z0D B;  2LD9 A;  2JRH A;  2LXC A;  4HDO A;  4MJS B;  4OVU A;  4IUM B;  2KN5 A;  2MWS B;  2N4F A;  2N7E A;  2KQ7 A;  2N1V A;  2C9W B;  4I6P A;  3M62 B;  4IW0 A;  2O6V D;  3RZW C;  1G6J A;  2EKE C;  2CS4 A;  4II2 B;  1EO6 A;  1V5O A;  5KHQ A;  4II3 B;  2K8B A;  4GMV A;  2IYD B;  2NVU I;  3OJ3 A;  4F8C B;  4M0W B;  2KO3 A;  2MBE A;  3D32 A;  2FAZ A;  4FN2 A;  2CHW A;  2MLB A;  5J17 A;  5EDS A;  2MP2 A;  5G55 A;  3RD2 A;  3QIJ A;  2L76 A;  3CMM B;  3ZLZ A;  4BKS A;  1L2N A;  3L08 A;  2KLC A;  1GC7 A;  4J6I A;  1MG8 A;  1Q1O A;  2RGF A;  5KHO A;  4GGQ A;  4DK5 A;  1RRB A;  2L0F A;  3SU8 X;  1OGW A;  3DVG X;  1IP9 A;  2ZEQ A;  3B1L X;  4NY0 A;  1C1Y B;  1RAX A;  2KHW B;  2ZNV C;  1V5T A;  3QCA A;  5TR5 A;  3NHE B;  2B3A A;  4GU2 A;  2Y5B B;  4WJO A;  3W1S C;  4WWP A;  2IY0 B;  5L83 A;  4BKS D;  2KVR A;  2DHZ A;  3DPD A;  3QK0 A;  4HDQ A;  2PE9 A;  3VUX A;  4G50 A;  3CST A;  3L17 A;  4OVV A;  3HIZ A;  1M94 A;  4EFO A;  2PPH A;  1WY8 A;  4MGI E;  3PVL A;  3VVW B;  1WX7 A;  2FID A;  2JF5 A;  1WGG A;  3UGB B;  3Q3J A;  3KW5 B;  2O2V B;  3KYD D;  4BKG A;  4URK A;  2KAN A;  1FXT B;  1I42 A;  2C60 A;  4GSW A;  2KC1 A;  1UGM A;  4GDL A;  4W9K A;  2LGD A;  2NPT A;  1WGR A;  4W9E A;  3PHW B;  2O6V B;  3L0W B;  3PLU A;  2D11 A;  3SDL C;  3UIO B;  1X1M A;  2IO1 B;  4BOZ B;  4I6L B;  4IM2 A;  2BYF A;  2KWV B;  3TIX A;  1WZ0 A;  4IM0 A;  2IY1 B;  4DDG D;  2MCN B;  3ZRF A;  2UWQ A;  4TQ0 A;  1EF5 A;  2C5L C;  3K9P B;  2KFJ A;  4IC7 B;  4ZDV A;  3L10 B;  4K81 A;  3VDZ A;  3DQV A;  4W9H A;  5AZH A;  4ZRJ A;  5IAA C;  2I1K A;  5J2R A;  1UBI A;  1WXS A;  4EEW A;  3ZW3 A;  1H4R A;  3VXW A;  4HPM B;  3VTV A;  2CHX A;  2KDI A;  2L7R A;  4LCD E;  2LXA A;  1WZ3 A;  3LJ3 A;  5CHW A;  1GNU A;  3ZNZ B;  4DHZ E;  5JZE B;  2C7M B;  4G3X B;  2K39 A;  3DOW A;  3NS8 A;  3VQI A;  3HK0 A;  4GOC A;  2MP2 B;  4MM3 A;  1V81 A;  3MHS D;  3R7R A;  1Z5S B;  2LI5 A;  3N32 A;  4FJV B;  1TBE A;  4WAA A;  2MW5 A;  1ZW7 A;  2KFK A;  2KKC A;  4MGY E;  3EHV A;  5IA7 A;  3DDC B;  2G4S A;  3DBS A;  3IVF A;  1EUV B;  3ZTD A;  4WWO A;  4NJ7 A;  2M1M A;  4PS3 A;  1OEY J;  1OQY A;  4E71 A;  5AEK B;  3NZS A;  5JHB A;  2L05 A;  2PE6 B;  4GB9 A;  4XC2 A;  3ZNI D;  4TV3 A;  2L0T A;  2RR9 A;  2Z59 B;  3H1U A;  3C0R B;  4TKN A;  2J0M A;  1XD3 B;  1J8C A;  4BKT A;  4CHK A;  1WFY A;  3H7P A;  1P1A A;  2EMS A;  2XBB C;  3B0A A;  2J0J A;  5DCN A;  4FHK A;  3TJP A;  3RUI B;  2KMA A;  3HM3 A;  3JSV A;  3WIM A;  3X0W A;  3EFU A;  3MJW A;  5LLI A;  4BVU C;  2DAJ A;  2UYZ B;  3ZUN A;  2LAS A;  4WJQ A;  1LFD A;  2ASQ A;  3M95 A;  4JQW C;  4GDL B;  5CX3 A;  4CYE A;  3DBH I;  1TGZ B;  3AI5 A;  3PRM B;  1E8Y A;  3KUZ A;  3L13 A;  2NBW B;  4HK2 A;  4MH0 E;  4RM9 A;  3PRZ A;  2DAF A;  2MRP A;  2N7D A;  4MDK E;  4HCP B;  1BT0 A;  3TCA A;  2FUH B;  3N30 A;  1TTN A;  3H7S A;  5D94 A;  4GN1 A;  3SHQ A;  3IHP C;  3JVZ X;  3BIN A;  2K25 A;  2Z0E B;  4K1R B;  2C7H A;  2AL6 A;  3ZTC A;  4E74 A;  2IO3 B;  1I35 A;  4ZRK A;  4GXB A;  4NNJ B;  5DPS A;  2DEN B;  2LJ5 A;  4K7U A;  1C3T A;  2V1Y A;  4NQL B;  3KUD B;  2DX5 B;  2FCS A;  2DYB A;  3PSE B;  1RLF A;  4GDK A;  3DVN V;  2JT4 B;  3JW0 X;  2DYM A;  3PV1 A;  3V62 A;  2WYQ A;  3R3M A;  1GJZ A;  3NY5 A;  1WXV A;  1WXM A;  2DZK A;  2KDB A;  2PEA A;  2MSE D;  1Q0W B;  3QAR A;  2WDT B;  4DXA B;  1SE9 A;  5JHA A;  3IG3 A;  2FIF A;  3VH3 B;  3ZDT A;  4IWQ A;  3AU5 A;  2D07 B;  1F9J A;  1WGD A;  2HJ8 A;  1NDD A;  2KX3 A;  4IM3 A;  2KFK B;  1KOT A;  3ZKJ C;  1E7V A;  3K9O B;  1T0Y A;  4M8M A;  3NZU A;  2KZR A;  4NJ6 A;  3TBL D;  1KLV A;  2ZJD A;  1WR1 A;  2G45 B;  4G0N B;  1U4A A;  3PT2 B;  4WJP A;  4K7W A;  2LGX A;  2IO2 B;  3ECI A;  2LVO A;  3M3J A;  1YJ1 A;  1Z2M A;  2GBR A;  3AU4 A;  4W9J A;  4DHJ B;  4HCN B;  2GOW A;  2N1W A;  3CSF A;  1E7U A;  4IG7 B;  3H7P B;  4FAD A;  1UD7 A;  2L00 B;  3DCG A;  2D10 A;  3OAW A;  3JSV B;  3V61 A;  3WAM A;  2JPH A;  3R7Q A;  3V60 A;  4BBN C;  4ANU A;  4EZL A;  3U7D A;  1WGY A;  4YL8 A;  2KTR B;  2M17 A;  3RUL A;  4I6N B;  1V49 A;  3QWZ B;  5D2M B;  4HJK A;  1WIA A;  2R2Q A;  4WWN A;  2HTH A;  3QQ8 B;  2WWZ A;  2IBI B;  3A9K A;  2DZI A;  4LJO B;  2K8H A;  4X57 B;  1H8C A;  2V4L A;  4W9F A;  2CU1 A;  3VFK A;  3ZO5 B;  4KVG B;  1YQB A;  3KH0 A;  2CKH B;  3DVN U;  4A3O A;  1UH6 A;  2MBB B;  2XK5 A;  1P98 A;  3H6N A;  4P7I A;  3CF6 E;  1P9D U;  4LDT B;  2IO0 B;  3HM6 X;  3GZN I;  4GDK B;  2NBV B;  4W9D A;  3WAO A;  1KJT A;  1WM2 A;  3A9J A;  1UBQ A;  2KNB A;  4ZYN A;  1QZE A;  2BGF A;  4EUT A;  4AOF A;  3KUC B;  1WX9 A;  4A20 A;  1J19 A;  2KX0 A;  3RT3 B;  4KDL B;  3R66 C;  4MGK E;  4PYZ A;  1D3Z A;  2W9N A;  3IBE A;  4B6W A;  4HWI B;  3RCZ A;  2ZZP B;  2BYE A;  4NAW A;  3UIN B;  3ZRC A;  3W1S A;  3M63 B;  3ML9 A;  2LVP A;  2K8C A;  2FCN A;  4KIK A;  1WGH A;  4IWO A;  1K8R B;  2AL3 A;  3WAN A;  5DPT A;  2JZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...