2ZPNA

The crystal structure of saccharomyces cerevisiae atg8- atg19(412-415) complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 8
publication title Structural basis of target recognition by Atg8/LC3 during selective autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 30
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zpnA00
4LJOB 4PYZA 5G55A 3Q3JA 4GIVA 1YD8U 4G0NB 3WAPA 2IBIB 5FR6A 3UQBA 1JRUA 4WWOA 2DHZA 3PT2B 3IHPC 3CSFA 4RMAA 3ZTDA 2L8JA 1GG3A 4M8NA 2OJRA 4W9EA 3VAWA 4I6LB 4BOZB 2K25A 1UBQA 2GBKA 2M1MA 1WZ3A 4II3B 4G50A 3A1QB 3RD2A 4IWPA 4ANUA 3B0AA 2KC2A 3IBEA 2KANA 2KFKB 2NCNA 1IPGA 1R4NI 2J0JA 2LVQA 4GN1A 4MDKE 2KWUB 2KJ6A 3JSVB 1GC6A 3NOBA 4MJSB 4JLCA 2WWZA 2K8BA 3APFA 5KHQA 2IO0B 2DZKA 2HE7A 4E71A 5LXHA 2C9WB 4FJZA 3RT3B 4NQKE 3DPDA 2QHOA 5JH5C 1C3TA 3ZRFA 1EO6A 4IM2A 1H4RA 1Z2MA 4MH0E 2IZVB 2GBRA 2GBNA 2N4FA 1RRBA 3UF8A 3H9DA 4DDGD 1G6JA 2XEWA 4ICUA 4MELA 1E90A 5BO4B 1KM7A 4LCDE 2AEHA 3KYCD 1OEYA 1P98A 1WGYA 2KMCA 4CO7A 4MGIE 1RAXA 1E8ZA 2DZJA 4MGYE 2AYOB 1S1QB 5CHWA 2MBBB 2MBQA 5E6NA 4EOYA 3RULA 2CHWA 1WJUA 2EKEC 2DYBA 2V4LA 2NR2A 4GDKA 1NI2A 2BYFA 2KQ7A 3CMMB 3DVGY 2K8HA 2EMSA 5DPSA 3W1SA 5LXIB 2J0KA 2WYQA 3DBHI 4HLEA 3KUZA 4PYUA 5HKHA 2DZIA 3DVGX 3ZUNA 3L10B 3VFKA 2R2QA 3UINB 4EZJA 4BKTA 3ML9A 1UZXB 2MBHA 1HE8A 2KVRA 4DHZB 2N9XA 3VTWA 4BOSC 1GJZA 1WF9A 2RSUA 2M4NA 5AZGA 2MLBA 3VUXA 4IUMB 2ZCBA 1QZEA 4KIKB 4W9DA 3L54A 2LJ5A 1CMXB 4F1SA 1J19A 1ZGUB 2JPHA 3R3MA 4ZRJA 2BYEA 4GU2A 2O2VA 2Z0EB 4MSMB 1KLVA 4B95A 1KJTA 2DZMA 2ZNVC 5D6JB 2JRIB 4NJ6A 3ZNZB 2KDEB 4G11A 4BBNC 1WMHB 1WJ4A 2FCNA 4HXDA 3VQIA 2YVCA 3P2BA 5L83A 5KHOA 3ZDMC 2BF8B 2FNJB 2NS5A 3UQAA 3PHXB 4CYEA 2Z0DB 4NJ7A 2GBJA 3RYTA 2AL6A 2JZZA 2O6VA 2XK5A 5JHAA 2Z59B 3EHVA 2DYOA 2MBEA 4EFOA 4BFRA 2MBOA 2KTRB 2D11A 2M17A 3TBLD 1E8YA 4GOCA 3RZWC 4KSKC 2RR9A 2LGYA 4DBGA 5DPTA 4OVUA 2D07B 4A3OA 2HJ8A 4OVVA 2EMTA 4BKSD 4HDOA 2G4SA 3PRPB 1UD7A 3K9OB 3PLVA 3CSTA 3PV1A 2LI5A 3M95A 2CKHB 1P1AA 3LJ3A 3WALA 4NY0A 2K6QA 3OJ4B 4AOFA 4DXAB 2MX2A 1I35A 2MP2B 2N7DA 4KSLC 3VH3B 3ZRCA 2JZ3B 4HWIB 1VCBA 1E8XA 3PVLA 2K39A 4TV3A 3A1QA 4K7WA 2JF5A 3PRZA 1C1YB 3KW5B 3JW0X 4GGQA 3VUWA 3BINA 2MQJA 2KLGA 4IWOA 3NS8A 2BGFA 1SIFA 2VRRB 3JSVA 3L17A 4MJSA 3H7PB 1GC7A 3PS6A 1WXVA 1OQYA 4MM3A 2N7EA 2HD5B 2LD9A 3QJZA 4IM3A 3C0RB 2KX3A 4B9KA 2N1VA 2V1YA 3B1LX 5L95C 2D2QA 1WFYA 3S2AA 3N3KB 2FIFA 1YQBA 4PS8A 3ZVVA 4E3CA 1M94A 4G3XB 2HTHA 3QCAA 4W9GA 3N30A 5CHFA 2KKCA 5D2MB 2WX0A 3HM6X 2ASQA 4K7UA 2ZJDA 2G3QB 5AZFA 1WR6E 3W1SC 3CF6E 4GDLB 1TTNA 2L76A 4ICVA 1S3SG 3DQVA 2LRWA 1UBIA 2ZVNA 2UYZB 3KH0A 4XX5A 5E6PA 2JRHA 3A9KB 2ZNVB 2L05A 2O6VD 2LXCA 1L2NA 3M3JA 3PHWB 1WR1A 4E74A 3U7DA 1WE7A 3DVNV 1E7UA 2M8SA 3K9PB 2N9EB 2ZPYA 2ZZPB 4P7IA 3TJPA 1BT0A 2BWFA 2CHXA 4K1RB 4DWFA 4BKGA 2BKFA 3PREA 3QX1A 1IP9A 2C60A 2L00B 4HVBA 4EKUA 2ZPNA 3DBRI 2REXA 3MJWA 5AZHA 3ZW3A 1WM2A 5J18A 5JZEB 2KX0A 4IW0A 4ZRKA 4NAWA 2KZRA 2JT4B 3QQ8B 1WZ0A 2PEAA 3HIZA 2FCSA 3V60A 2KDIA 2FUHB 4EZKA 4ANVA 2W9NA 4JIOU 1OTRB 2KFJA 1UGMA 1V49A 2PE9A 4GSWA 1Z5SB 1AARA 2L3ZA 2M0XA 2MWSB 3VDZA 2B3AA 4ANXA 4CHKA 3QARA 3I3TB 1MG8A 5IAAC 1WMHA 3R7RA 4EEWA 3OAWA 4TKNA 3AXCA 4YL8A 2JWZA 3QC8B 1WX9A 3PSEB 4W9JA 4WJPA 3X23A 4DK5A 2CHZA 2IO2B 5AEKB 5IA7A 1WGRA 4GMVA 3DBLI 1V80A 2IY1B 1YX5B 3L13A 3APCA 1NDDA 3ML8A 5D7GA 3TMPB 2KTRA 2C7MB 2IYDB 4BVUC 1E5WA 4F8CB 1K8RB 3VUYA 2YLMA 1Q5WB 4TQ0A 4NPNA 2AWTA 4KV2A 4ZDVA 2MSED 1XD3B 2KQSA 3MHSD 1UELA 3DCGA 2BYVE 1H8CA 4J6IA 4WJOA 1KOTA 4RM9A 2GMIC 4NNJB 4AJYB 4FHJA 4HK2A 2FIDA 1WXSA 2MP2A 3GOEA 1L7YA 1FXTB 1V6EA 3MTNB 1EF5A 3IFWB 1P0RA 2IO1B 4FLHA 2WX1A 3VH4B 3V6EB 4EUTA 3JYUA 4BBNF 4FADA 2KNBA 3WAMA 1V2YA 1WXMA 4W9IA 1E7VA 3V62A 1Y8RC 1PQSA 2J7QB 2KTFA 3H7PA 3SD5A 2L0TA 3ZNGC 1A5RA 2NBWB 3GZNI 1OGWA 3ECIA 4A3PA 4NQLB 2KC1A 3IG3A 3VTVA 3AI5A 3R66C 4WAAA 3NZSA 3PZDA 4W9CA 4KZCA 1YJ1A 3HM3A 2OOBB 1WY8A 3OJ3A 3BY4B 4FJVB 1WGDA 3ZLZA 3R7QA 2LWPA 1WX8A 2CR5A 1ZW7A 3HK0A 1XQQA 3LDZE 2KFKA 2N1WA 4WJNA 5E6OA 3ZTCA 2G45B 4IC7B 2JUOA 4II2B 4FN2A 4GXBA 3RCZA 4GDLA 4JGHB 1RLFA 2KLCA 4K81A 2KO3A 2RPQA 4IM0A 1F9JA 3SHQA 2I1JA 2O6VB 4XZ4A 1WRDB 1WIAA 1D3ZA 3A9KA 3QK0A 1J8CA 2LRUA 5JHBA 1YIWA 3VHTC 2MW5A 2NPTB 5EDSA 4MSQB 2R2OA 4ANWA 1GUAB 2PPHA 4FULA 3A33B 2K1FA 2I1KA 3A9JB 4W9KA 3UGBB 5DPRA 4WJQA 2KWVB 1V9JA 2KXJA 4JL9A 5G2NA 3H1UA 2KJRA 4WWNA 3Q3FA 3L08A 5J2RA 2NBUA 4KZ0A 1VD2A 2KWCA 4RM8A 1WE6A 1Q1OA 2CS4A 2JXXA 3WANA 3L0WB 1WX7A 3ALBA 4LDTD 3RZFA 2MA9B 3TIXA 1WGGA 4IG7B 2FCQA 2KD0A 2LGXA 3A4SC 4W9HA 4ZRIA 1WJ6A 3X0WA 3ZNHB 2KJHB 2L0FA 1WM3A 4HCPB 2DYMA 3QWZB 3JVZX 2BKRB 3HHMA 2KOXA 1V81A 3AU4A 1SGHA 3QIJA 5CTRC 2KK8A 2DENB 3ZO5B 2UWQA 4AP4C 1U4AA 3QA8A 1E8WA 3T8MA 5GMVA 4ASWC 2L7RA 3D32A 2GOWA 4AUQC 2WDTB 5LLIA 1V5OA 4FA6A 2GBMA 3N32A 3KVFB 3DDCB 3NHEB 4KIKA 3T9LA 3VTUA 1X1MA 4FJYA 3W1YA 4W9LA 3NY5A 1ZKHA 2PJHA 2ZVOA 5DPWA 1XT9B 2K8CA 1WGHA 4DDID 3DBSA 4WWPA 1WI0A 4BKSA 2Y5BB 2JVCA 2A5UA 2V3SA 3DOWA 4FHKA 4I6PA 3VVWB 4AJWA 2RGFA 3A4RA 3ENEA 3PLUA 2ZEQA 4M0WB 4FBJB 3DVNU 3M62B 2A4ZA 4N9F4 2DX5B 1RFAA 1TGZB 2AL3A 1LM8B 2D3GA 4MGKE 4MEMA 3APDA 3SU8X 4KVGB 4KDIC 1NBFC 1SE9A 3EECA 1J0GA 3WA0A 4DHJB 3UIPB 3AULA 3UIOB 2KHWB 3O65B 3OLMD 1TBEA 5C23A 2PE6B 3VXWA 3U8ZA 3PTFC 3RUIB 2D10A 4TUUA 4X57B 1WXAA 1LXDA 3QAQA 5DCNA 1EF1A 3KYDD 2C7NB 4PS3A 2JY6A 1Q0WB 3AU5A 3EFUA 2XBBC 4W9FA 1TZ1A 4HPMB 3KUCB 4HCNB 4GDKB 1YX6B 4HJKA 4XC2A 1LFDA 2BPSA 4NAWB 3V61A 3IVFA 2DAJA 2LZ6A 1T0YA 1I42A 4DHJD 3EC8A 3SDLC 2KDBA 2LASA 1V5TA 1IYFA 1P3QU 2DAFA 1OEYJ 4PS7A 2K6DB 1R4MI 4MGZE 5J17A 5TR5A 5D94A 3WAOA 2IY0B 5CX3A 2LVPA 2NBVB 2LGDA 1GNUA 2KN5A 4M8MA 3ZNID 4GB9A 4KDLB 5CHVC 4WQOB 3ONSA 2O2VB 4HPLB 2LUEA 2LXAA 2NPTA 3ZKJC 2FAZA 2KDFB 4ZYNA 2BWES 3V6CB 3WIMA 3ZIMA 4EZLA 1ISNA 3H6NA 3H7SA 3A9JA 4I6NB 3KUDB 1WH3A 2KMAA 4A20A 1UH6A 2CU1A 3TL5A 2LVOA 4K7SA 4DHZE 4LDTB 2J0MA 2FCMA 1V86A 2C7HA 3L16A 3B08A 2XK5B 2ZCCA 3NZUA 3PGEA 2G4DB 4JQWC 2IO3B 4TQ1A 1LQBA 2N9PC 2MCNB 3U30A 3PPAA 4IWQA 3PRMB 3TCAA 1P9DU 4F7ZA 4URKA 1WYWB 4B6WA 4HDQA 2RD0A 3M63B 1EUVB 2C5LC 5C1ZA 1WJNA 3QHTA 4LJPB 2NVUI 2MRPA 3ZDTA 4AWJA
chains in the Genus database with same CATH superfamily
4LJOB 4PYZA 3Q3OC 4RMAA 4RGNA 3ZTDA 3BYYB 1L6VA 2V3PA 2IGGA 3VAWA 2GBKA 4JE3B 1WYGA 2LMCA 1R4NI 2J0JA 4MH8A 2KJ6A 5JH5C 2GB1A 2TSSA 1EO6A 2OJWA 2J4XA 4IM2A 1TY2A 1QOBA 1NEKB 4JPSA 2MJDA 4ICUA 4MELA 4LNNA 1F2RC 3LYYA 1OQRA 4CO7A 2BW2A 1RAXA 2AQ1B 3FKYA 4MGYE 5E6NA 2MBQA 5T8IA 3RULA 1WJUA 1NI2A 2WYQA 1D4BA 2WXLA 3KUZA 2DZIA 3DVGX 1I4GA 2R2QA 4BKTA 2N9XA 3NRZA 2MLBA 1QZEA 1BMLC 3CIRB 2LJ5A 4ZRJA 1I7HA 2Z0EB 1RYJA 4XDCA 4NJ6A 3ZNZB 2KDEB 3VQIA 1FMAD 5LNK1 2FNJB 4CYEA 4DXGA 3RYTA 2AL6A 2JSVX 1I4PA 2K9XA 2MBEA 4EFOA 2KTRB 3ZYYX 2PVGC 4EE2A 4ZYSA 2M17A 2G1EA 4GOCA 4KSKC 4DBGA 4OVUA 4BKSD 4HDOA 1MVKA 3PRPB 5TSSA 1L4ZB 1P1AA 4REZA 5JXVA 1JW9D 4O1NA 4RNAA 4BAXA 1E8XA 2G9HD 3MJ5A 3VUWA 3BINA 3NS8A 1K51A 1KTKA 3H7PB 2QDFA 4RFBA 1ZDVA 5HI1A 3FILB 4XWTA 3FAHA 3IT6B 1K52A 1WFYA 1L4DB 4PS8A 1KLGD 3E56A 4E3CA 3QCAA 4W9GA 4ZHOA 1HQRD 5D2MB 2ZJDA 5AZFA 1WR6E 4GDLB 2L76A 4M02A 2UYZB 4XX5A 3B9JA 3A9KB 3BVGA 4FXCA 2O6VD 3P4QB 2LUMA 4E74A 3U7DA 2Q5WD 4YXDB 2ZZPB 1BT0A 3AE9B 4K1RB 4BKGA 1HTOA 1IP9A 4HVBA 2PMVA 1F77A 1SBBB 2W3SA 3MJWA 5AZHA 1EWYC 2KX0A 3MC0B 2BB6A 4YSYB 2ONQA 1HTQA 2FCSA 2KDIA 2WXMA 4WAFA 1BXTA 1DOYA 1XEEA 2KFJA 2PE9A 1Z5SB 2B3AA 1YOVB 1WMHA 3DWGC 2JWZA 4NJCA 4WJPA 1VZ7A 1FO4A 1NDDA 1TKGA 3ML8A 4KKJA 4ZOHC 1E10A 4OW0A 4ZRPA 4ZDVA 2MSED 1XD3B 3MHSD 1CZPA 1UELA 1VDVA 1H8CA 4WJOA 3AEFB 2NMQA 4TSSA 4FHJA 4M00A 4HK2A 1WXSA 2RMMA 1V6EA 1HA5A 4MACA 5C2TB 1ZDXA 1F0ZA 4FLHA 2RDBC 2WXGA 2KNBA 3KLSX 1E7VA 1A5RA 3SD5A 4YSXB 3IG3A 2NTTA 4WAAA 4W9CA 3PZDA 2K22A 2LGSA 3HM3A 3OJ3A 3ZLZA 2CR5A 1ZW7A 1ET9A 3HK0A 2JUOA 4II2B 4JGHB 3T3NA 3SHQA 2KO3A 3AEAB 2KN4A 4XZ4A 3U2SC 1D3ZA 3Q3MC 4NZLB 3BK1A 4WJQA 4JL9A 3H1UA 2WXJA 3Q3FA 2W3RA 2WXQA 1VD2A 2KWCA 1SXTA 2CS4A 3WANA 2JXXA 2K5PA 3HRDD 3RNCC 4LDTD 3ALBA 3RZFA 4CQNA 2KD0A 2LGXA 1WJ6A 3ZNHB 4J3OD 4XGAB 4HCPB 2DYMA 3AU4A 1V81A 1WXQA 1SGHA 4ZRQA 2DENB 3WCQA 1T0RC 4KGTA 5E6JA 3T8MA 4YT0B 3P4PB 4AUQC 1CJEA 3T9LA 1X1MA 1P7FA 2ZVOA 4LNKA 2V3NA 2DWQA 4BKSA 2MEKA 4KKIA 1C4PA 4ARIA 3VVWB 1YN4A 2BS3B 2WXHA 2A4ZA 2DX5B 5IOIA 1LM8B 2EELA 2BS4B 4KVGB 4KDIC 1D6EC 3EECA 1J0GA 3ZJUA 3PTFC 4NAMA 3RUIB 2D10A 1WXAA 5IO9A 3AU5A 3BYTB 2L52A 2QSDA 1VJKA 2LZ6A 3NG0A 3RMKC 1JALA 3SDLC 1V5TA 3V05A 1AYFA 1P3QU 4PS7A 1ZPSA 3LB8C 5CX3A 1GB1A 3FILA 4KDLB 3BVZA 3ZKJC 1JWAD 2BWES 3WIMA 4EZLA 1WH3A 3HVZA 4B0MA 2LVOA 2XN9C 1SJED 3L16A 5EE0A 2ZCCA 2G4DB 4JQWC 2IO3B 4TQ1A 1JROA 3U30A 3PRMB 5EE9A 2PLPA 1P9DU 3N20C 1WYWB 1NYQA 1EUVB 2C5LC 5C1ZA 5HFYA 3RNBC 1SJHD 3BIID 3J9CA 5G55A 1N5XA 3NUHB 2IBIB 2DHZA 1V1OA 1VRAB 3PT2B 3IHPC 3CSFA 1XLPA 2L83A 1GG3A 4M8NA 4W9EA 2M1MA 4G50A 4RH6A 1TY0A 2KC2A 1JRPA 1MFWA 1IPGA 4OHJA 2KWUB 5AUKA 4JLCA 3APFA 1T0QC 4E71A 1C3TA 4NQKE 2QHOA 1JWUD 2W82A 4LTUA 2IZVB 3AE2B 4DDGD 1G6JA 2XEWA 1E90A 1XCQL 1KM7A 2DNFA 4LCDE 1OEYA 4P1BC 2JQRB 1MPEA 2ZW0A 2FE8A 1R4MB 4RF1A 2NR2A 3W5VB 4IDIA 3W1SA 3AB5A 1B1ZA 5HKHA 4EZJA 3NVWA 2ON8A 1HE8A 4R3DA 3VTWA 2WNMA 5HG2A 2RSUA 2M4NA 1ZP0B 3VUXA 2N9KA 2ZCBA 4W9DA 1C76A 1CMXB 3VTVA 1KLVA 2O2VA 2BBCA 2WXOA 2DZMA 5D6JB 1QILA 3HUIA 1WMHB 2UU7A 1WJ4A 4HXDA 2NS5A 5BYQA 2AQ2B 3PHXB 4OVZA 4H2AA 1LO5D 2FBWB 2GBJA 1V97A 2XK5A 2WU2B 1SF0A 1VR9A 2BB5A 4LK0M 5JHAA 2DYOA 2MBOA 1E8YA 2X8XX 3RZWC 2D3AA 5BMIA 5DPTA 2D07B 4A3OA 2HJ8A 1R4NB 4PT5A 3K9OB 4N6EB 3I5JC 3PV1A 1YQ4B 4NY0A 2K6QA 2MX2A 3VH3B 3PVLA 3A1QA 1PGAA 4K7WA 1FPYA 1C1YB 3JW0X 4GGQA 3TUOA 2MQJA 5EE3A 4IWOA 2BGFA 1WXVA 1FNVA 2PVOD 2N7EA 2HD5B 1ROEA 2L32A 2V1YA 5L95C 2FIFA 4G3XB 2HTHA 4K3BA 2KKCA 3VRAB 1V1PA 2G3QB 3MP9A 3W1SC 3RNAC 1S3SG 4YWGG 2H89B 2IGHA 2JYTA 2LRWA 2BS2B 2KWDA 1NVID 2VH1A 2ZNVB 2L05A 2WHIA 1L0VB 3H8HA 4RGTA 3W5UB 3AE3B 3V3XA 1WE7A 1I4XA 1K50A 4ARCA 2PKOA 1LGRA 2QMTA 3ZW3A 2BTEA 2INDC 1WM2A 2JU6X 1N63A 2KZRA 1WZ0A 3HIZA 1OTRB 3R8BA 4GSWA 2N7JA 2L3ZA 2M0AA 3VDZA 4ANXA 4CHKA 4WH4A 4XWWA 4N59A 4JWSC 3X23A 2HDEA 1PUTA 1WGRA 4GMVA 1FRRA 3L13A 3APCA 2I38A 1FFVA 3TMPB 3I9V1 1RFKA 1UGJA 1WSPA 1E5WA 2ICIA 1K8RB 1NENB 3VUYA 4BVUC 1Q5WB 1I4QA 1CK1A 2KQSA 3L4PA 1C78A 2BYVE 4J6IA 1L0XB 2IPKD 4AJYB 1TKEA 2FIDA 2MP2A 3GOEA 3FC4A 1EF5A 1TS5A 4IOIE 3JYUA 3WAMA 1PQSA 2J7QB 4RGOS 5IN7A 3GZNI 3ECIA 2CJOA 2RPVA 2KACA 4NQLB 2KC1A 3R66C 3NZSA 2D5GA 3R7QA 1WX8A 3Q2AC 1FD6A 3ZTCA 1XQQA 3LDZE 2N1WA 5E6OA 4XYCA 4C56C 1EM7A 3KWLA 1RLFA 4IM0A 1WWTA 1MJDA 2O6VB 4RGMA 3B2FA 1J8CA 1ZXIA 1YIWA 3VHTC 3BVMA 3GS2A 4ANWA 1QQRA 3A33B 1UNSA 2M56B 1V9JA 1JMLA 2IDYA 4WWNA 5J2RA 3U52E 2NBUA 4RM8A 1TZOA 2PW9A 3L0WB 2KVZA 2BQQA 1UWMA 3A4SC 3MC8A 3X0WA 3P4SB 1TKYA 1WM3A 3AE7B 3SEBA 3RNFC 3JVZX 2BKRB 4LNIA 2BYTA 1SB3C 3BK2A 5CTRC 2KAJA 4AP4C 1SE4A 1U4AA 4OZAA 1E8WA 5GMVA 2JWUA 2L7RA 3W1YA 2WDVB 2PJHA 3AN1A 4P1CC 3T3OA 5DPWA 2QILA 1ESFA 1ENFA 2WXRA 2WS3B 2JVCA 3AH7A 4FHKA 2V3SA 4I6PA 2E6XA 2YEPF 3A4RA 3PLUA 4FBJB 1RFAA 1TGZB 4ITKA 2AL3A 2D3GA 1UWXA 3SU8X 4UDUC 2HTME 2H88B 1B9RA 3UIOB 3Q8EA 3OLMD 5C23A 2PE6B 4ACFA 3O13A 4TUUA 4X57B 1EU3A 5DCNA 1EF1A 2JY6A 5BYSA 3VR8B 1ZUD2 3KUCB 1TS2A 4XC2A 3Q8BA 3V61A 4NAWB 1TS3A 3I63C 1HZ6A 1T0YA 2WXNA 2WXPA 1F52A 2OHFA 3EC8A 1KRHA 3MC9A 1IYFA 2DAFA 3TEWA 2K6DB 1C4CA 1BUIC 3WAOA 2LVPA 1YN5A 2NBVB 2LGDA 2KN5A 4M8MA 3LXFA 4GB9A 4L2YA 2O2VB 4HPLB 2LXAA 3ZIMA 2QJLA 4WIPA 4A20A 2CU1A 3W2DA 4DHZE 4LDTB 2J0MA 3P63A 5AUIA 3AE8B 2FCMA 1V86A 1N60A 2XK5B 3P1MA 1SSNA 4C80A 2AX5A 4IWQA 1PGXA 3M63B 2Y5CA 4BZAA 1SE3A 3Q14C 1WJNA 4S17A 2NVUI 3ZDTA 1XLQA 5G5HA 3MHZA 4GIVA 1YD8U 1OQQA 5FR6A 1JRUA 2B76B 4WWOA 3AEDB 1FFUA 3W9CB 2L8JA 2K25A 5MPOA 4II3B 3A1QB 3RD2A 4IWPA 4ANUA 3B0AA 3IBEA 2K0PA 2LVQA 4GN1A 4MDKE 4XDDA 1IUEA 1GC6A 3DHGC 5KHQA 2DZKA 4B0EA 2K3UA 2C9WB 3RT3B 3DPDA 2JYEA 3ZRFA 1D5MC 1H4RA 1Z2MA 4MH0E 1M4VA 3OWEB 2GBRA 2GBNA 1RRBA 4HKQA 2KDMA 4YTMB 1V1PB 1QF6A 3GE3C 3KYCD 1P98A 1T5XD 3NVYA 2KMCA 2LFIA 2DZJA 2AYOB 5CHWA 1YMHE 4EOYA 2DYBA 2V4LA 4GDKA 4A8XC 2KQ7A 3DVGY 5DPSA 4OZCA 4JX1C 2JZPA 4PYUA 1FNWA 2V4IB 3L10B 3ZUNA 3VFKA 3UINB 3ML9A 4DHZB 1E6EB 1KF6B 4KGSA 3VRBB 4IUMB 4KIKB 2INCC 4P16A 3L54A 4A90A 2WP9B 4F1SA 3DWMA 3R3MA 2BYEA 4GU2A 2LHDA 4MSMB 1KJTA 2ZNVC 4A6QA 2ACZB 4LLGM 2YVCA 3ETRA 3P2BA 5KHOA 2BF8B 2Z0DB 4NJ7A 5HHDG 2JZZA 2O6VA 3EHVA 3NZ3A 4BFRA 1QLBB 2PIAA 1ACCA 3R2TA 3U4EG 2RR9A 1QT9A 2QCZA 1RM6C 2EMTA 2G4SA 1UD7A 3AE5B 3M95A 3LJ3A 2RDHA 4HRSA 3TSSA 4DXAB 4N58A 2MP2B 3Q3NC 4L1BA 2WXKA 1VZ6A 2CJNA 4KSLC 3ZRCA 1UF0A 2JZ3B 4HWIB 1VCBA 1XLOA 2INPE 2K39A 1V8CA 2KLGA 1SIFA 2VRRB 3JSVA 4MJSA 3PZ7A 4QAYA 1J7CA 4MM3A 1AN8A 3U7ZA 3HVDA 4KGRA 2LD9A 3QJZA 2JXTA 4IM3A 4B9KA 3B1LX 1L0YB 3S2AA 3N3KB 1YQBA 1M94A 3N30A 5CHFA 3EUB2 1HEZE 2VZKD 3HM6X 4K7UA 5BMGA 1HXYD 3CF6E 1TTNA 1KH0A 2ZVNA 3KH0A 5E6PA 3NVZA 2E3TA 1E7PB 1L2NA 3M3JA 3PHWB 1WR1A 4L23A 3DVNV 1E7UA 1DOXA 1UUPA 2CHXA 3QX1A 4US8A 2GI9A 2L00B 4EKUA 1N5WA 1J7BA 1I4RA 2ZPNA 3AM9A 2REXA 5IP4D 5J18A 5JZEB 4IW0A 2ZW1A 4K3CA 1QOAA 2BT6A 4NAWA 3EA6A 3QQ8B 2FUHB 3RN9C 4ANVA 2W9NA 4ZHPA 5FK9C 1UGMA 1V49A 1PYWD 2MWSB 2V0GA 3QARA 3I3TB 1MG8A 3TEXA 5IAAC 4C7ZA 3RFZB 3OAWA 1GOZA 3AXCA 4YL8A 2IO2B 5AEKB 4LNOA 2WXIA 3Q6BA 2Z8LA 2C7MB 2EKIA 2IYDB 4F8CB 1NYRA 1YQ3B 4TQ0A 2Y5PA 3ZJTA 3DCGA 1KOTA 2INNE 2N0SB 1XCTL 3TEYA 3OG5A 4HEA1 2LGIA 3IFWB 1P0RA 2IO1B 2WX1A 3VH4B 2QIEB 4GLSC 3N1XC 4BBNF 4FADA 4RF0A 4W9IA 1Y8RC 2KTFA 2L0TA 2NBWB 1OGWA 1E9MA 2KMMA 4KZCA 4YTNB 4HJGE 2OOBB 3BY4B 4FJVB 1WGDA 1STEA 4WJNA 4FN2A 3RCZA 2MJ3A 3Q8CA 2KLCA 2RPQA 1F9JA 2I1JA 1HZ5A 3Q69A 3B2GA 1WRDB 2SEBD 3QK0A 4C7YA 2LRUA 3GB1A 5JHBA 3AE6B 5FR3A 2MW5A 5EDSA 4MSQB 1GUAB 4USAA 2FUG1 2I1KA 5DPRA 2KWVB 3L08A 3MFGA 1SE2A 2KYWA 1WX7A 1EU4A 2IGDA 2MA9B 4C4VA 1WGGA 4IG7B 2J53A 4W9HA 2J42A 3IAM1 1GAQB 1GPXA 2KK8A 3Q8AA 1C9FA 2W55A 2UWQA 3VR9B 1IBXB 3D32A 2MHJA 2WDTB 5LLIA 4JWUC 1V5OA 4FA6A 3N32A 3NHEB 3DDCB 4KIKA 3VTUA 4W9LA 3NY5A 1ZKHA 1YN3A 4DXFA 4DDID 2MJEA 4AS1A 3DBSA 4WWPA 2Y5BB 1JQ4A 2A5UA 3ENEA 2ZEQA 1VLBA 3DVNU 2LJIA 3APDA 3GZNB 1SE9A 3I57A 3WA0A 4DHJB 2XNAC 3ZXVA 3AULA 1TBEA 3IT4B 1TYGB 5G5GA 3U8ZA 1LXDA 3QAQA 3KYDD 4PS3A 2WQYB 4PK1A 3EFUA 2XBBC 1TZ1A 1D5XC 1FCCC 4HCNB 4GDKB 1YX6B 2BPSA 3IVFA 4HPPA 1I42A 2R61A 4DHJD 2KDBA 4HROA 1OEYJ 4MGZE 5J17A 5TR5A 5D94A 5CHVC 1K53A 2WGSA 2YEPB 2NPTA 1FNUA 2KDFB 4ZYNA 3V6CB 1ISNA 3H7SA 3A9JA 4I6NB 3KUDB 5BYRA 4P6VF 2KMAA 1AW7A 4C00A 3ZQ4A 3B08A 3PGEA 1N6ZA 1LQBA 1WRIA 1DYQA 1SEBD 3PPAA 3TCAA 4A55A 4URKA 4HDQA 1FM0D 2DLBA 3CWIA 2WXFA 2MRPA 4AWJA 1DOIA 2L1AA 1Y56A 3Q3JA 4G0NB 1FXAA 3WAPA 3UQBA 1PDXA 3SFEB 1ZE3D 2OJRA 4BOZB 4I6LB 1UBQA 1WZ3A 1A70A 2WDRB 4WWMA 5H92C 3RNGC 2KANA 3DBHB 2KFKB 2NCNA 3JSVB 3NOBA 4MJSB 2WWZA 2K8BA 2IO0B 5IKCM 5C3JB 1GB4A 4MM3B 2HE7A 5LXHA 1ET6A 4M0WA 4FJZA 3GP7A 3RPFC 1JWMD 2N4FA 3ABVB 3SR6A 1DGJA 3UF8A 3H9DA 3ZXRA 5BO4B 5BMHA 2GRIA 2AEHA 1WGYA 1MHXA 4MGIE 4MT5A 1E8ZA 3NJTA 1S1QB 2MBBB 1E0ZA 2AQ3B 2CHWA 2EKEC 2BYFA 4LNFA 3CMMB 5LXIB 2K8HA 2EMSA 2KQ4X 5D3DA 2J0KA 3DBHI 4HLEA 1IGCA 1ZOYB 2QEJC 3PZ8A 1UZXB 2MBHA 2KVRA 5I4DA 4BOSC 1GJZA 1WF9A 5AZGA 4XE0A 2KT7A 2D3BA 1J19A 1ZGUB 2JPHA 4B95A 2JRIB 4G11A 4BBNC 2FCNA 2DBYA 3EFCA 3N1YC 5L83A 3ZDMC 3UQAA 1KFYB 4S0RA 2Z59B 3NVVA 2D11A 3TBLD 3GE8C 4RCOA 2LGYA 4OVVA 4US9A 3PLVA 3CSTA 2LI5A 2NTSA 2CKHB 3WALA 4D2KA 3OJ4B 4AOFA 1I35A 1T3QA 1XO3A 1RWSA 2N7DA 1MI0A 3BZDB 1WGKA 4TV3A 2JF5A 3PRZA 3KW5B 3PO0A 2M19A 3L17A 1GC7A 3PS6A 1OQYA 1FEHA 1IBXA 3C0RB 3DBRB 2KX3A 2N1VA 1OFFA 2D2QA 3ZVVA 1MG4A 3Q8FA 2WX0A 1VZ8A 2ASQA 3BWUD 4ICVA 3DQVA 1UBIA 1F2RI 3AMZA 2JRHA 1FXIA 2RDGA 1J7AA 2LXCA 2WDQB 3DBLB 2M8SA 3K9PB 2N9EB 2ZPYA 4P7IA 3TJPA 2BWFA 4DWFA 1TIFA 2J52A 2BKFA 3PREA 4WQMA 2C60A 3NS1A 3DBRI 4C4VB 4ZRKA 2JT4B 1I4HA 2PEAA 4EZKA 3V60A 1NI3A 5FKAC 4JIOU 4HKZE 1AARA 2N9LA 2M0XA 1JWSD 3R7RA 4EEWA 4TKNA 3QC8B 1WX9A 3PSEB 4W9JA 4DK5A 2CHZA 5IA7A 3TEZA 3DBLI 1V80A 2IY1B 1YX5B 5D7GA 3P42A 3C19A 2KTRA 1N61A 1L6UA 3AEEB 3N1ZC 2YLMA 3EGRA 4NPNA 2AWTA 4KV2A 1AWDA 1QOGA 2Y3AA 4RM9A 2GMIC 4NNJB 1YJJA 3AECB 1MHHE 1L7YA 1PFDA 3MTNB 1FXTB 4Q2JA 2OEDA 1FCLA 4AQ7A 3KQ4A 3V6EB 4EUTA 1PGBA 2IJ0A 3C8YA 4YSZB 1V2YA 4M01A 1WXMA 3V62A 3AEGB 3H7PA 3ZNGC 3AE1B 4A3PA 3AI5A 5GXGB 2D3CA 5D3IB 1YJ1A 2VH2A 2VZKB 1WY8A 3E9SA 3AV8A 2LWPA 4TMAB 2KFKA 2G45B 4IC7B 1IGDA 4GXBA 4KX6B 4GDLA 4K81A 4OZBA 4DQOC 2MH7A 1KLUD 1WIAA 3A9KA 1Q10A 1JCKB 2X38A 1TT5B 1XLNA 2GLSA 2NPTB 2R2OA 2V9HA 2PPHA 4FULA 2K1FA 1D5ZC 3A9JB 4W9KA 3UGBB 1L5PA 2KXJA 5G2NA 3ZGZA 2KJRA 1ZXHA 4KZ0A 1WE6A 1Q1OA 2W54A 1QKZA 3TIXA 1FRDA 1YJIA 2FCQA 4ZRIA 1CQVA 2LEKA 2KJHB 3P4RB 1TJEA 2L0FA 3RI7C 3N9YC 3QWZB 3HHMA 2KOXA 1XXGA 1QOFA 3QIJA 3ZO5B 5H8YE 2PTLA 3DHHC 3QA8A 3SFDB 4ASWC 4WURA 2GOWA 1R7SA 5EE1A 2GBMA 3KVFB 4FJYA 2LHEA 1XT9B 2K8CA 1WGHA 1WI0A 3R2IA 2WLBA 3DOWA 4AJWA 2RGFA 4M0WB 3RNEC 3M62B 4N9F4 4MGKE 3AE4B 4MEMA 1NBFC 3UI3A 1N62A 3UIPB 1YNTE 2KHWB 3O65B 2I2YA 3VXWA 1P7EA 2C7NB 1Q0WB 4W9FA 4HPMB 1C4AA 4HJKA 1JWBD 4YTPB 1LFDA 3IAS1 3DHIC 1EWCA 2DAJA 2LASA 2HJ1A 1T6BX 1TS4A 1R4MI 2IY0B 1SIJA 4IKGA 2BVCA 2QC8A 4A9AA 1GNUA 3ZNID 3ZJVA 4WQOB 3ONSA 1F1HA 2SAKA 1T0SC 1XF5L 2LUEA 3AEBB 2FAZA 3H6NA 1UH6A 3TL5A 1C77A 2CU3A 4K7SA 2WU5B 3IXSA 2C7HA 3NZUA 1FIQA 2N9PC 2MCNB 3URYA 4F7ZA 4B6WA 2RD0A 3KWVA 1C79A 2JX5A 3QHTA 4LJPB
chains in the Genus database with same CATH topology
4LJOB 4PYZA 5G55A 3Q3JA 4GIVA 1YD8U 4G0NB 3WAPA 2IBIB 5FR6A 3UQBA 1JRUA 4WWOA 2DHZA 3PT2B 3IHPC 3CSFA 4RMAA 3ZTDA 2L8JA 1GG3A 4M8NA 2OJRA 4W9EA 3VAWA 4I6LB 4BOZB 2K25A 1UBQA 2GBKA 2M1MA 1WZ3A 4II3B 4G50A 3A1QB 3RD2A 4IWPA 4ANUA 3B0AA 2KC2A 3IBEA 2KANA 2KFKB 2NCNA 1IPGA 1R4NI 2J0JA 2LVQA 4GN1A 4MDKE 2KWUB 2KJ6A 3JSVB 1GC6A 3NOBA 4MJSB 4JLCA 2WWZA 2K8BA 3APFA 5KHQA 2IO0B 2DZKA 2HE7A 4E71A 5LXHA 2C9WB 4FJZA 3RT3B 4NQKE 3DPDA 2QHOA 5JH5C 1C3TA 3ZRFA 1EO6A 4IM2A 1H4RA 1Z2MA 4MH0E 2IZVB 2GBRA 2GBNA 2N4FA 1RRBA 3UF8A 3H9DA 4DDGD 1G6JA 2XEWA 4ICUA 4MELA 1E90A 5BO4B 1KM7A 4LCDE 2AEHA 3KYCD 1OEYA 1P98A 1WGYA 2KMCA 4CO7A 4MGIE 1RAXA 1E8ZA 2DZJA 4MGYE 2AYOB 1S1QB 5CHWA 2MBBB 2MBQA 5E6NA 4EOYA 3RULA 2CHWA 1WJUA 2EKEC 2DYBA 2V4LA 2NR2A 4GDKA 1NI2A 2BYFA 2KQ7A 3CMMB 3DVGY 2K8HA 2EMSA 5DPSA 3W1SA 5LXIB 2J0KA 2WYQA 3DBHI 4HLEA 3KUZA 4PYUA 5HKHA 2DZIA 3DVGX 3ZUNA 3L10B 3VFKA 2R2QA 3UINB 4EZJA 4BKTA 3ML9A 1UZXB 2MBHA 1HE8A 2KVRA 4DHZB 2N9XA 3VTWA 4BOSC 1GJZA 1WF9A 2RSUA 2M4NA 5AZGA 2MLBA 3VUXA 4IUMB 2ZCBA 1QZEA 4KIKB 4W9DA 3L54A 2LJ5A 1CMXB 4F1SA 1J19A 1ZGUB 2JPHA 3R3MA 4ZRJA 2BYEA 4GU2A 2O2VA 2Z0EB 4MSMB 1KLVA 4B95A 1KJTA 2DZMA 2ZNVC 5D6JB 2JRIB 4NJ6A 3ZNZB 2KDEB 4G11A 4BBNC 1WMHB 1WJ4A 2FCNA 4HXDA 3VQIA 2YVCA 3P2BA 5L83A 5KHOA 3ZDMC 2BF8B 2FNJB 2NS5A 3UQAA 3PHXB 4CYEA 2Z0DB 4NJ7A 2GBJA 3RYTA 2AL6A 2JZZA 2O6VA 2XK5A 5JHAA 2Z59B 3EHVA 2DYOA 2MBEA 4EFOA 4BFRA 2MBOA 2KTRB 2D11A 2M17A 3TBLD 1E8YA 4GOCA 3RZWC 4KSKC 2RR9A 2LGYA 4DBGA 5DPTA 4OVUA 2D07B 4A3OA 2HJ8A 4OVVA 2EMTA 4BKSD 4HDOA 2G4SA 3PRPB 1UD7A 3K9OB 3PLVA 3CSTA 3PV1A 2LI5A 3M95A 2CKHB 1P1AA 3LJ3A 3WALA 4NY0A 2K6QA 3OJ4B 4AOFA 4DXAB 2MX2A 1I35A 2MP2B 2N7DA 4KSLC 3VH3B 3ZRCA 2JZ3B 4HWIB 1VCBA 1E8XA 3PVLA 2K39A 4TV3A 3A1QA 4K7WA 2JF5A 3PRZA 1C1YB 3KW5B 3JW0X 4GGQA 3VUWA 3BINA 2MQJA 2KLGA 4IWOA 3NS8A 2BGFA 1SIFA 2VRRB 3JSVA 3L17A 4MJSA 3H7PB 1GC7A 3PS6A 1WXVA 1OQYA 4MM3A 2N7EA 2HD5B 2LD9A 3QJZA 4IM3A 3C0RB 2KX3A 4B9KA 2N1VA 2V1YA 3B1LX 5L95C 2D2QA 1WFYA 3S2AA 3N3KB 2FIFA 1YQBA 4PS8A 3ZVVA 4E3CA 1M94A 4G3XB 2HTHA 3QCAA 4W9GA 3N30A 5CHFA 2KKCA 5D2MB 2WX0A 3HM6X 2ASQA 4K7UA 2ZJDA 2G3QB 5AZFA 1WR6E 3W1SC 3CF6E 4GDLB 1TTNA 2L76A 4ICVA 1S3SG 3DQVA 2LRWA 1UBIA 2ZVNA 2UYZB 3KH0A 4XX5A 5E6PA 2JRHA 3A9KB 2ZNVB 2L05A 2O6VD 2LXCA 1L2NA 3M3JA 3PHWB 1WR1A 4E74A 3U7DA 1WE7A 3DVNV 1E7UA 2M8SA 3K9PB 2N9EB 2ZPYA 2ZZPB 4P7IA 3TJPA 1BT0A 2BWFA 2CHXA 4K1RB 4DWFA 4BKGA 2BKFA 3PREA 3QX1A 1IP9A 2C60A 2L00B 4HVBA 4EKUA 2ZPNA 3DBRI 2REXA 3MJWA 5AZHA 3ZW3A 1WM2A 5J18A 5JZEB 2KX0A 4IW0A 4ZRKA 4NAWA 2KZRA 2JT4B 3QQ8B 1WZ0A 2PEAA 3HIZA 2FCSA 3V60A 2KDIA 2FUHB 4EZKA 4ANVA 2W9NA 4JIOU 1OTRB 2KFJA 1UGMA 1V49A 2PE9A 4GSWA 1Z5SB 1AARA 2L3ZA 2M0XA 2MWSB 3VDZA 2B3AA 4ANXA 4CHKA 3QARA 3I3TB 1MG8A 5IAAC 1WMHA 3R7RA 4EEWA 3OAWA 4TKNA 3AXCA 4YL8A 2JWZA 3QC8B 1WX9A 3PSEB 4W9JA 4WJPA 3X23A 4DK5A 2CHZA 2IO2B 5AEKB 5IA7A 1WGRA 4GMVA 3DBLI 1V80A 2IY1B 1YX5B 3L13A 3APCA 1NDDA 3ML8A 5D7GA 3TMPB 2KTRA 2C7MB 2IYDB 4BVUC 1E5WA 4F8CB 1K8RB 3VUYA 2YLMA 1Q5WB 4TQ0A 4NPNA 2AWTA 4KV2A 4ZDVA 2MSED 1XD3B 2KQSA 3MHSD 1UELA 3DCGA 2BYVE 1H8CA 4J6IA 4WJOA 1KOTA 4RM9A 2GMIC 4NNJB 4AJYB 4FHJA 4HK2A 2FIDA 1WXSA 2MP2A 3GOEA 1L7YA 1FXTB 1V6EA 3MTNB 1EF5A 3IFWB 1P0RA 2IO1B 4FLHA 2WX1A 3VH4B 3V6EB 4EUTA 3JYUA 4BBNF 4FADA 2KNBA 3WAMA 1V2YA 1WXMA 4W9IA 1E7VA 3V62A 1Y8RC 1PQSA 2J7QB 2KTFA 3H7PA 3SD5A 2L0TA 3ZNGC 1A5RA 2NBWB 3GZNI 1OGWA 3ECIA 4A3PA 4NQLB 2KC1A 3IG3A 3VTVA 3AI5A 3R66C 4WAAA 3NZSA 3PZDA 4W9CA 4KZCA 1YJ1A 3HM3A 2OOBB 1WY8A 3OJ3A 3BY4B 4FJVB 1WGDA 3ZLZA 3R7QA 2LWPA 1WX8A 2CR5A 1ZW7A 3HK0A 1XQQA 3LDZE 2KFKA 2N1WA 4WJNA 5E6OA 3ZTCA 2G45B 4IC7B 2JUOA 4II2B 4FN2A 4GXBA 3RCZA 4GDLA 4JGHB 1RLFA 2KLCA 4K81A 2KO3A 2RPQA 4IM0A 1F9JA 3SHQA 2I1JA 2O6VB 4XZ4A 1WRDB 1WIAA 1D3ZA 3A9KA 3QK0A 1J8CA 2LRUA 5JHBA 1YIWA 3VHTC 2MW5A 2NPTB 5EDSA 4MSQB 2R2OA 4ANWA 1GUAB 2PPHA 4FULA 3A33B 2K1FA 2I1KA 3A9JB 4W9KA 3UGBB 5DPRA 4WJQA 2KWVB 1V9JA 2KXJA 4JL9A 5G2NA 3H1UA 2KJRA 4WWNA 3Q3FA 3L08A 5J2RA 2NBUA 4KZ0A 1VD2A 2KWCA 4RM8A 1WE6A 1Q1OA 2CS4A 2JXXA 3WANA 3L0WB 1WX7A 3ALBA 4LDTD 3RZFA 2MA9B 3TIXA 1WGGA 4IG7B 2FCQA 2KD0A 2LGXA 3A4SC 4W9HA 4ZRIA 1WJ6A 3X0WA 3ZNHB 2KJHB 2L0FA 1WM3A 4HCPB 2DYMA 3QWZB 3JVZX 2BKRB 3HHMA 2KOXA 1V81A 3AU4A 1SGHA 3QIJA 5CTRC 2KK8A 2DENB 3ZO5B 2UWQA 4AP4C 1U4AA 3QA8A 1E8WA 3T8MA 5GMVA 4ASWC 2L7RA 3D32A 2GOWA 4AUQC 2WDTB 5LLIA 1V5OA 4FA6A 2GBMA 3N32A 3KVFB 3DDCB 3NHEB 4KIKA 3T9LA 3VTUA 1X1MA 4FJYA 3W1YA 4W9LA 3NY5A 1ZKHA 2PJHA 2ZVOA 5DPWA 1XT9B 2K8CA 1WGHA 4DDID 3DBSA 4WWPA 1WI0A 4BKSA 2Y5BB 2JVCA 2A5UA 2V3SA 3DOWA 4FHKA 4I6PA 3VVWB 4AJWA 2RGFA 3A4RA 3ENEA 3PLUA 2ZEQA 4M0WB 4FBJB 3DVNU 3M62B 2A4ZA 4N9F4 2DX5B 1RFAA 1TGZB 2AL3A 1LM8B 2D3GA 4MGKE 4MEMA 3APDA 3SU8X 4KVGB 4KDIC 1NBFC 1SE9A 3EECA 1J0GA 3WA0A 4DHJB 3UIPB 3AULA 3UIOB 2KHWB 3O65B 3OLMD 1TBEA 5C23A 2PE6B 3VXWA 3U8ZA 3PTFC 3RUIB 2D10A 4TUUA 4X57B 1WXAA 1LXDA 3QAQA 5DCNA 1EF1A 3KYDD 2C7NB 4PS3A 2JY6A 1Q0WB 3AU5A 3EFUA 2XBBC 4W9FA 1TZ1A 4HPMB 3KUCB 4HCNB 4GDKB 1YX6B 4HJKA 4XC2A 1LFDA 2BPSA 4NAWB 3V61A 3IVFA 2DAJA 2LZ6A 1T0YA 1I42A 4DHJD 3EC8A 3SDLC 2KDBA 2LASA 1V5TA 1IYFA 1P3QU 2DAFA 1OEYJ 4PS7A 2K6DB 1R4MI 4MGZE 5J17A 5TR5A 5D94A 3WAOA 2IY0B 5CX3A 2LVPA 2NBVB 2LGDA 1GNUA 2KN5A 4M8MA 3ZNID 4GB9A 4KDLB 5CHVC 4WQOB 3ONSA 2O2VB 4HPLB 2LUEA 2LXAA 2NPTA 3ZKJC 2FAZA 2KDFB 4ZYNA 2BWES 3V6CB 3WIMA 3ZIMA 4EZLA 1ISNA 3H6NA 3H7SA 3A9JA 4I6NB 3KUDB 1WH3A 2KMAA 4A20A 1UH6A 2CU1A 3TL5A 2LVOA 4K7SA 4DHZE 4LDTB 2J0MA 2FCMA 1V86A 2C7HA 3L16A 3B08A 2XK5B 2ZCCA 3NZUA 3PGEA 2G4DB 4JQWC 2IO3B 4TQ1A 1LQBA 2N9PC 2MCNB 3U30A 3PPAA 4IWQA 3PRMB 3TCAA 1P9DU 4F7ZA 4URKA 1WYWB 4B6WA 4HDQA 2RD0A 3M63B 1EUVB 2C5LC 5C1ZA 1WJNA 3QHTA 4LJPB 2NVUI 2MRPA 3ZDTA 4AWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJO B;  4PYZ A;  5G55 A;  3Q3J A;  4GIV A;  1YD8 U;  4G0N B;  3WAP A;  2IBI B;  5FR6 A;  3UQB A;  1JRU A;  4WWO A;  2DHZ A;  3PT2 B;  3IHP C;  3CSF A;  4RMA A;  3ZTD A;  2L8J A;  1GG3 A;  4M8N A;  2OJR A;  4W9E A;  3VAW A;  4I6L B;  4BOZ B;  2K25 A;  1UBQ A;  2GBK A;  2M1M A;  1WZ3 A;  4II3 B;  4G50 A;  3A1Q B;  3RD2 A;  4IWP A;  4ANU A;  3B0A A;  2KC2 A;  3IBE A;  2KAN A;  2KFK B;  2NCN A;  1IPG A;  1R4N I;  2J0J A;  2LVQ A;  4GN1 A;  4MDK E;  2KWU B;  2KJ6 A;  3JSV B;  1GC6 A;  3NOB A;  4MJS B;  4JLC A;  2WWZ A;  2K8B A;  3APF A;  5KHQ A;  2IO0 B;  2DZK A;  2HE7 A;  4E71 A;  5LXH A;  2C9W B;  4FJZ A;  3RT3 B;  4NQK E;  3DPD A;  2QHO A;  5JH5 C;  1C3T A;  3ZRF A;  1EO6 A;  4IM2 A;  1H4R A;  1Z2M A;  4MH0 E;  2IZV B;  2GBR A;  2GBN A;  2N4F A;  1RRB A;  3UF8 A;  3H9D A;  4DDG D;  1G6J A;  2XEW A;  4ICU A;  4MEL A;  1E90 A;  5BO4 B;  1KM7 A;  4LCD E;  2AEH A;  3KYC D;  1OEY A;  1P98 A;  1WGY A;  2KMC A;  4CO7 A;  4MGI E;  1RAX A;  1E8Z A;  2DZJ A;  4MGY E;  2AYO B;  1S1Q B;  5CHW A;  2MBB B;  2MBQ A;  5E6N A;  4EOY A;  3RUL A;  2CHW A;  1WJU A;  2EKE C;  2DYB A;  2V4L A;  2NR2 A;  4GDK A;  1NI2 A;  2BYF A;  2KQ7 A;  3CMM B;  3DVG Y;  2K8H A;  2EMS A;  5DPS A;  3W1S A;  5LXI B;  2J0K A;  2WYQ A;  3DBH I;  4HLE A;  3KUZ A;  4PYU A;  5HKH A;  2DZI A;  3DVG X;  3ZUN A;  3L10 B;  3VFK A;  2R2Q A;  3UIN B;  4EZJ A;  4BKT A;  3ML9 A;  1UZX B;  2MBH A;  1HE8 A;  2KVR A;  4DHZ B;  2N9X A;  3VTW A;  4BOS C;  1GJZ A;  1WF9 A;  2RSU A;  2M4N A;  5AZG A;  2MLB A;  3VUX A;  4IUM B;  2ZCB A;  1QZE A;  4KIK B;  4W9D A;  3L54 A;  2LJ5 A;  1CMX B;  4F1S A;  1J19 A;  1ZGU B;  2JPH A;  3R3M A;  4ZRJ A;  2BYE A;  4GU2 A;  2O2V A;  2Z0E B;  4MSM B;  1KLV A;  4B95 A;  1KJT A;  2DZM A;  2ZNV C;  5D6J B;  2JRI B;  4NJ6 A;  3ZNZ B;  2KDE B;  4G11 A;  4BBN C;  1WMH B;  1WJ4 A;  2FCN A;  4HXD A;  3VQI A;  2YVC A;  3P2B A;  5L83 A;  5KHO A;  3ZDM C;  2BF8 B;  2FNJ B;  2NS5 A;  3UQA A;  3PHX B;  4CYE A;  2Z0D B;  4NJ7 A;  2GBJ A;  3RYT A;  2AL6 A;  2JZZ A;  2O6V A;  2XK5 A;  5JHA A;  2Z59 B;  3EHV A;  2DYO A;  2MBE A;  4EFO A;  4BFR A;  2MBO A;  2KTR B;  2D11 A;  2M17 A;  3TBL D;  1E8Y A;  4GOC A;  3RZW C;  4KSK C;  2RR9 A;  2LGY A;  4DBG A;  5DPT A;  4OVU A;  2D07 B;  4A3O A;  2HJ8 A;  4OVV A;  2EMT A;  4BKS D;  4HDO A;  2G4S A;  3PRP B;  1UD7 A;  3K9O B;  3PLV A;  3CST A;  3PV1 A;  2LI5 A;  3M95 A;  2CKH B;  1P1A A;  3LJ3 A;  3WAL A;  4NY0 A;  2K6Q A;  3OJ4 B;  4AOF A;  4DXA B;  2MX2 A;  1I35 A;  2MP2 B;  2N7D A;  4KSL C;  3VH3 B;  3ZRC A;  2JZ3 B;  4HWI B;  1VCB A;  1E8X A;  3PVL A;  2K39 A;  4TV3 A;  3A1Q A;  4K7W A;  2JF5 A;  3PRZ A;  1C1Y B;  3KW5 B;  3JW0 X;  4GGQ A;  3VUW A;  3BIN A;  2MQJ A;  2KLG A;  4IWO A;  3NS8 A;  2BGF A;  1SIF A;  2VRR B;  3JSV A;  3L17 A;  4MJS A;  3H7P B;  1GC7 A;  3PS6 A;  1WXV A;  1OQY A;  4MM3 A;  2N7E A;  2HD5 B;  2LD9 A;  3QJZ A;  4IM3 A;  3C0R B;  2KX3 A;  4B9K A;  2N1V A;  2V1Y A;  3B1L X;  5L95 C;  2D2Q A;  1WFY A;  3S2A A;  3N3K B;  2FIF A;  1YQB A;  4PS8 A;  3ZVV A;  4E3C A;  1M94 A;  4G3X B;  2HTH A;  3QCA A;  4W9G A;  3N30 A;  5CHF A;  2KKC A;  5D2M B;  2WX0 A;  3HM6 X;  2ASQ A;  4K7U A;  2ZJD A;  2G3Q B;  5AZF A;  1WR6 E;  3W1S C;  3CF6 E;  4GDL B;  1TTN A;  2L76 A;  4ICV A;  1S3S G;  3DQV A;  2LRW A;  1UBI A;  2ZVN A;  2UYZ B;  3KH0 A;  4XX5 A;  5E6P A;  2JRH A;  3A9K B;  2ZNV B;  2L05 A;  2O6V D;  2LXC A;  1L2N A;  3M3J A;  3PHW B;  1WR1 A;  4E74 A;  3U7D A;  1WE7 A;  3DVN V;  1E7U A;  2M8S A;  3K9P B;  2N9E B;  2ZPY A;  2ZZP B;  4P7I A;  3TJP A;  1BT0 A;  2BWF A;  2CHX A;  4K1R B;  4DWF A;  4BKG A;  2BKF A;  3PRE A;  3QX1 A;  1IP9 A;  2C60 A;  2L00 B;  4HVB A;  4EKU A;  2ZPN A;  3DBR I;  2REX A;  3MJW A;  5AZH A;  3ZW3 A;  1WM2 A;  5J18 A;  5JZE B;  2KX0 A;  4IW0 A;  4ZRK A;  4NAW A;  2KZR A;  2JT4 B;  3QQ8 B;  1WZ0 A;  2PEA A;  3HIZ A;  2FCS A;  3V60 A;  2KDI A;  2FUH B;  4EZK A;  4ANV A;  2W9N A;  4JIO U;  1OTR B;  2KFJ A;  1UGM A;  1V49 A;  2PE9 A;  4GSW A;  1Z5S B;  1AAR A;  2L3Z A;  2M0X A;  2MWS B;  3VDZ A;  2B3A A;  4ANX A;  4CHK A;  3QAR A;  3I3T B;  1MG8 A;  5IAA C;  1WMH A;  3R7R A;  4EEW A;  3OAW A;  4TKN A;  3AXC A;  4YL8 A;  2JWZ A;  3QC8 B;  1WX9 A;  3PSE B;  4W9J A;  4WJP A;  3X23 A;  4DK5 A;  2CHZ A;  2IO2 B;  5AEK B;  5IA7 A;  1WGR A;  4GMV A;  3DBL I;  1V80 A;  2IY1 B;  1YX5 B;  3L13 A;  3APC A;  1NDD A;  3ML8 A;  5D7G A;  3TMP B;  2KTR A;  2C7M B;  2IYD B;  4BVU C;  1E5W A;  4F8C B;  1K8R B;  3VUY A;  2YLM A;  1Q5W B;  4TQ0 A;  4NPN A;  2AWT A;  4KV2 A;  4ZDV A;  2MSE D;  1XD3 B;  2KQS A;  3MHS D;  1UEL A;  3DCG A;  2BYV E;  1H8C A;  4J6I A;  4WJO A;  1KOT A;  4RM9 A;  2GMI C;  4NNJ B;  4AJY B;  4FHJ A;  4HK2 A;  2FID A;  1WXS A;  2MP2 A;  3GOE A;  1L7Y A;  1FXT B;  1V6E A;  3MTN B;  1EF5 A;  3IFW B;  1P0R A;  2IO1 B;  4FLH A;  2WX1 A;  3VH4 B;  3V6E B;  4EUT A;  3JYU A;  4BBN F;  4FAD A;  2KNB A;  3WAM A;  1V2Y A;  1WXM A;  4W9I A;  1E7V A;  3V62 A;  1Y8R C;  1PQS A;  2J7Q B;  2KTF A;  3H7P A;  3SD5 A;  2L0T A;  3ZNG C;  1A5R A;  2NBW B;  3GZN I;  1OGW A;  3ECI A;  4A3P A;  4NQL B;  2KC1 A;  3IG3 A;  3VTV A;  3AI5 A;  3R66 C;  4WAA A;  3NZS A;  3PZD A;  4W9C A;  4KZC A;  1YJ1 A;  3HM3 A;  2OOB B;  1WY8 A;  3OJ3 A;  3BY4 B;  4FJV B;  1WGD A;  3ZLZ A;  3R7Q A;  2LWP A;  1WX8 A;  2CR5 A;  1ZW7 A;  3HK0 A;  1XQQ A;  3LDZ E;  2KFK A;  2N1W A;  4WJN A;  5E6O A;  3ZTC A;  2G45 B;  4IC7 B;  2JUO A;  4II2 B;  4FN2 A;  4GXB A;  3RCZ A;  4GDL A;  4JGH B;  1RLF A;  2KLC A;  4K81 A;  2KO3 A;  2RPQ A;  4IM0 A;  1F9J A;  3SHQ A;  2I1J A;  2O6V B;  4XZ4 A;  1WRD B;  1WIA A;  1D3Z A;  3A9K A;  3QK0 A;  1J8C A;  2LRU A;  5JHB A;  1YIW A;  3VHT C;  2MW5 A;  2NPT B;  5EDS A;  4MSQ B;  2R2O A;  4ANW A;  1GUA B;  2PPH A;  4FUL A;  3A33 B;  2K1F A;  2I1K A;  3A9J B;  4W9K A;  3UGB B;  5DPR A;  4WJQ A;  2KWV B;  1V9J A;  2KXJ A;  4JL9 A;  5G2N A;  3H1U A;  2KJR A;  4WWN A;  3Q3F A;  3L08 A;  5J2R A;  2NBU A;  4KZ0 A;  1VD2 A;  2KWC A;  4RM8 A;  1WE6 A;  1Q1O A;  2CS4 A;  2JXX A;  3WAN A;  3L0W B;  1WX7 A;  3ALB A;  4LDT D;  3RZF A;  2MA9 B;  3TIX A;  1WGG A;  4IG7 B;  2FCQ A;  2KD0 A;  2LGX A;  3A4S C;  4W9H A;  4ZRI A;  1WJ6 A;  3X0W A;  3ZNH B;  2KJH B;  2L0F A;  1WM3 A;  4HCP B;  2DYM A;  3QWZ B;  3JVZ X;  2BKR B;  3HHM A;  2KOX A;  1V81 A;  3AU4 A;  1SGH A;  3QIJ A;  5CTR C;  2KK8 A;  2DEN B;  3ZO5 B;  2UWQ A;  4AP4 C;  1U4A A;  3QA8 A;  1E8W A;  3T8M A;  5GMV A;  4ASW C;  2L7R A;  3D32 A;  2GOW A;  4AUQ C;  2WDT B;  5LLI A;  1V5O A;  4FA6 A;  2GBM A;  3N32 A;  3KVF B;  3DDC B;  3NHE B;  4KIK A;  3T9L A;  3VTU A;  1X1M A;  4FJY A;  3W1Y A;  4W9L A;  3NY5 A;  1ZKH A;  2PJH A;  2ZVO A;  5DPW A;  1XT9 B;  2K8C A;  1WGH A;  4DDI D;  3DBS A;  4WWP A;  1WI0 A;  4BKS A;  2Y5B B;  2JVC A;  2A5U A;  2V3S A;  3DOW A;  4FHK A;  4I6P A;  3VVW B;  4AJW A;  2RGF A;  3A4R A;  3ENE A;  3PLU A;  2ZEQ A;  4M0W B;  4FBJ B;  3DVN U;  3M62 B;  2A4Z A;  4N9F 4;  2DX5 B;  1RFA A;  1TGZ B;  2AL3 A;  1LM8 B;  2D3G A;  4MGK E;  4MEM A;  3APD A;  3SU8 X;  4KVG B;  4KDI C;  1NBF C;  1SE9 A;  3EEC A;  1J0G A;  3WA0 A;  4DHJ B;  3UIP B;  3AUL A;  3UIO B;  2KHW B;  3O65 B;  3OLM D;  1TBE A;  5C23 A;  2PE6 B;  3VXW A;  3U8Z A;  3PTF C;  3RUI B;  2D10 A;  4TUU A;  4X57 B;  1WXA A;  1LXD A;  3QAQ A;  5DCN A;  1EF1 A;  3KYD D;  2C7N B;  4PS3 A;  2JY6 A;  1Q0W B;  3AU5 A;  3EFU A;  2XBB C;  4W9F A;  1TZ1 A;  4HPM B;  3KUC B;  4HCN B;  4GDK B;  1YX6 B;  4HJK A;  4XC2 A;  1LFD A;  2BPS A;  4NAW B;  3V61 A;  3IVF A;  2DAJ A;  2LZ6 A;  1T0Y A;  1I42 A;  4DHJ D;  3EC8 A;  3SDL C;  2KDB A;  2LAS A;  1V5T A;  1IYF A;  1P3Q U;  2DAF A;  1OEY J;  4PS7 A;  2K6D B;  1R4M I;  4MGZ E;  5J17 A;  5TR5 A;  5D94 A;  3WAO A;  2IY0 B;  5CX3 A;  2LVP A;  2NBV B;  2LGD A;  1GNU A;  2KN5 A;  4M8M A;  3ZNI D;  4GB9 A;  4KDL B;  5CHV C;  4WQO B;  3ONS A;  2O2V B;  4HPL B;  2LUE A;  2LXA A;  2NPT A;  3ZKJ C;  2FAZ A;  2KDF B;  4ZYN A;  2BWE S;  3V6C B;  3WIM A;  3ZIM A;  4EZL A;  1ISN A;  3H6N A;  3H7S A;  3A9J A;  4I6N B;  3KUD B;  1WH3 A;  2KMA A;  4A20 A;  1UH6 A;  2CU1 A;  3TL5 A;  2LVO A;  4K7S A;  4DHZ E;  4LDT B;  2J0M A;  2FCM A;  1V86 A;  2C7H A;  3L16 A;  3B08 A;  2XK5 B;  2ZCC A;  3NZU A;  3PGE A;  2G4D B;  4JQW C;  2IO3 B;  4TQ1 A;  1LQB A;  2N9P C;  2MCN B;  3U30 A;  3PPA A;  4IWQ A;  3PRM B;  3TCA A;  1P9D U;  4F7Z A;  4URK A;  1WYW B;  4B6W A;  4HDQ A;  2RD0 A;  3M63 B;  1EUV B;  2C5L C;  5C1Z A;  1WJN A;  3QHT A;  4LJP B;  2NVU I;  2MRP A;  3ZDT A;  4AWJ A; 
#chains in the Genus database with same CATH topology
 4LJO B;  4PYZ A;  3Q3O C;  4RMA A;  4RGN A;  3ZTD A;  3BYY B;  1L6V A;  2V3P A;  2IGG A;  3VAW A;  2GBK A;  4JE3 B;  1WYG A;  2LMC A;  1R4N I;  2J0J A;  4MH8 A;  2KJ6 A;  5JH5 C;  2GB1 A;  2TSS A;  1EO6 A;  2OJW A;  2J4X A;  4IM2 A;  1TY2 A;  1QOB A;  1NEK B;  4JPS A;  2MJD A;  4ICU A;  4MEL A;  4LNN A;  1F2R C;  3LYY A;  1OQR A;  4CO7 A;  2BW2 A;  1RAX A;  2AQ1 B;  3FKY A;  4MGY E;  5E6N A;  2MBQ A;  5T8I A;  3RUL A;  1WJU A;  1NI2 A;  2WYQ A;  1D4B A;  2WXL A;  3KUZ A;  2DZI A;  3DVG X;  1I4G A;  2R2Q A;  4BKT A;  2N9X A;  3NRZ A;  2MLB A;  1QZE A;  1BML C;  3CIR B;  2LJ5 A;  4ZRJ A;  1I7H A;  2Z0E B;  1RYJ A;  4XDC A;  4NJ6 A;  3ZNZ B;  2KDE B;  3VQI A;  1FMA D;  5LNK 1;  2FNJ B;  4CYE A;  4DXG A;  3RYT A;  2AL6 A;  2JSV X;  1I4P A;  2K9X A;  2MBE A;  4EFO A;  2KTR B;  3ZYY X;  2PVG C;  4EE2 A;  4ZYS A;  2M17 A;  2G1E A;  4GOC A;  4KSK C;  4DBG A;  4OVU A;  4BKS D;  4HDO A;  1MVK A;  3PRP B;  5TSS A;  1L4Z B;  1P1A A;  4REZ A;  5JXV A;  1JW9 D;  4O1N A;  4RNA A;  4BAX A;  1E8X A;  2G9H D;  3MJ5 A;  3VUW A;  3BIN A;  3NS8 A;  1K51 A;  1KTK A;  3H7P B;  2QDF A;  4RFB A;  1ZDV A;  5HI1 A;  3FIL B;  4XWT A;  3FAH A;  3IT6 B;  1K52 A;  1WFY A;  1L4D B;  4PS8 A;  1KLG D;  3E56 A;  4E3C A;  3QCA A;  4W9G A;  4ZHO A;  1HQR D;  5D2M B;  2ZJD A;  5AZF A;  1WR6 E;  4GDL B;  2L76 A;  4M02 A;  2UYZ B;  4XX5 A;  3B9J A;  3A9K B;  3BVG A;  4FXC A;  2O6V D;  3P4Q B;  2LUM A;  4E74 A;  3U7D A;  2Q5W D;  4YXD B;  2ZZP B;  1BT0 A;  3AE9 B;  4K1R B;  4BKG A;  1HTO A;  1IP9 A;  4HVB A;  2PMV A;  1F77 A;  1SBB B;  2W3S A;  3MJW A;  5AZH A;  1EWY C;  2KX0 A;  3MC0 B;  2BB6 A;  4YSY B;  2ONQ A;  1HTQ A;  2FCS A;  2KDI A;  2WXM A;  4WAF A;  1BXT A;  1DOY A;  1XEE A;  2KFJ A;  2PE9 A;  1Z5S B;  2B3A A;  1YOV B;  1WMH A;  3DWG C;  2JWZ A;  4NJC A;  4WJP A;  1VZ7 A;  1FO4 A;  1NDD A;  1TKG A;  3ML8 A;  4KKJ A;  4ZOH C;  1E10 A;  4OW0 A;  4ZRP A;  4ZDV A;  2MSE D;  1XD3 B;  3MHS D;  1CZP A;  1UEL A;  1VDV A;  1H8C A;  4WJO A;  3AEF B;  2NMQ A;  4TSS A;  4FHJ A;  4M00 A;  4HK2 A;  1WXS A;  2RMM A;  1V6E A;  1HA5 A;  4MAC A;  5C2T B;  1ZDX A;  1F0Z A;  4FLH A;  2RDB C;  2WXG A;  2KNB A;  3KLS X;  1E7V A;  1A5R A;  3SD5 A;  4YSX B;  3IG3 A;  2NTT A;  4WAA A;  4W9C A;  3PZD A;  2K22 A;  2LGS A;  3HM3 A;  3OJ3 A;  3ZLZ A;  2CR5 A;  1ZW7 A;  1ET9 A;  3HK0 A;  2JUO A;  4II2 B;  4JGH B;  3T3N A;  3SHQ A;  2KO3 A;  3AEA B;  2KN4 A;  4XZ4 A;  3U2S C;  1D3Z A;  3Q3M C;  4NZL B;  3BK1 A;  4WJQ A;  4JL9 A;  3H1U A;  2WXJ A;  3Q3F A;  2W3R A;  2WXQ A;  1VD2 A;  2KWC A;  1SXT A;  2CS4 A;  3WAN A;  2JXX A;  2K5P A;  3HRD D;  3RNC C;  4LDT D;  3ALB A;  3RZF A;  4CQN A;  2KD0 A;  2LGX A;  1WJ6 A;  3ZNH B;  4J3O D;  4XGA B;  4HCP B;  2DYM A;  3AU4 A;  1V81 A;  1WXQ A;  1SGH A;  4ZRQ A;  2DEN B;  3WCQ A;  1T0R C;  4KGT A;  5E6J A;  3T8M A;  4YT0 B;  3P4P B;  4AUQ C;  1CJE A;  3T9L A;  1X1M A;  1P7F A;  2ZVO A;  4LNK A;  2V3N A;  2DWQ A;  4BKS A;  2MEK A;  4KKI A;  1C4P A;  4ARI A;  3VVW B;  1YN4 A;  2BS3 B;  2WXH A;  2A4Z A;  2DX5 B;  5IOI A;  1LM8 B;  2EEL A;  2BS4 B;  4KVG B;  4KDI C;  1D6E C;  3EEC A;  1J0G A;  3ZJU A;  3PTF C;  4NAM A;  3RUI B;  2D10 A;  1WXA A;  5IO9 A;  3AU5 A;  3BYT B;  2L52 A;  2QSD A;  1VJK A;  2LZ6 A;  3NG0 A;  3RMK C;  1JAL A;  3SDL C;  1V5T A;  3V05 A;  1AYF A;  1P3Q U;  4PS7 A;  1ZPS A;  3LB8 C;  5CX3 A;  1GB1 A;  3FIL A;  4KDL B;  3BVZ A;  3ZKJ C;  1JWA D;  2BWE S;  3WIM A;  4EZL A;  1WH3 A;  3HVZ A;  4B0M A;  2LVO A;  2XN9 C;  1SJE D;  3L16 A;  5EE0 A;  2ZCC A;  2G4D B;  4JQW C;  2IO3 B;  4TQ1 A;  1JRO A;  3U30 A;  3PRM B;  5EE9 A;  2PLP A;  1P9D U;  3N20 C;  1WYW B;  1NYQ A;  1EUV B;  2C5L C;  5C1Z A;  5HFY A;  3RNB C;  1SJH D;  3BII D;  3J9C A;  5G55 A;  1N5X A;  3NUH B;  2IBI B;  2DHZ A;  1V1O A;  1VRA B;  3PT2 B;  3IHP C;  3CSF A;  1XLP A;  2L83 A;  1GG3 A;  4M8N A;  4W9E A;  2M1M A;  4G50 A;  4RH6 A;  1TY0 A;  2KC2 A;  1JRP A;  1MFW A;  1IPG A;  4OHJ A;  2KWU B;  5AUK A;  4JLC A;  3APF A;  1T0Q C;  4E71 A;  1C3T A;  4NQK E;  2QHO A;  1JWU D;  2W82 A;  4LTU A;  2IZV B;  3AE2 B;  4DDG D;  1G6J A;  2XEW A;  1E90 A;  1XCQ L;  1KM7 A;  2DNF A;  4LCD E;  1OEY A;  4P1B C;  2JQR B;  1MPE A;  2ZW0 A;  2FE8 A;  1R4M B;  4RF1 A;  2NR2 A;  3W5V B;  4IDI A;  3W1S A;  3AB5 A;  1B1Z A;  5HKH A;  4EZJ A;  3NVW A;  2ON8 A;  1HE8 A;  4R3D A;  3VTW A;  2WNM A;  5HG2 A;  2RSU A;  2M4N A;  1ZP0 B;  3VUX A;  2N9K A;  2ZCB A;  4W9D A;  1C76 A;  1CMX B;  3VTV A;  1KLV A;  2O2V A;  2BBC A;  2WXO A;  2DZM A;  5D6J B;  1QIL A;  3HUI A;  1WMH B;  2UU7 A;  1WJ4 A;  4HXD A;  2NS5 A;  5BYQ A;  2AQ2 B;  3PHX B;  4OVZ A;  4H2A A;  1LO5 D;  2FBW B;  2GBJ A;  1V97 A;  2XK5 A;  2WU2 B;  1SF0 A;  1VR9 A;  2BB5 A;  4LK0 M;  5JHA A;  2DYO A;  2MBO A;  1E8Y A;  2X8X X;  3RZW C;  2D3A A;  5BMI A;  5DPT A;  2D07 B;  4A3O A;  2HJ8 A;  1R4N B;  4PT5 A;  3K9O B;  4N6E B;  3I5J C;  3PV1 A;  1YQ4 B;  4NY0 A;  2K6Q A;  2MX2 A;  3VH3 B;  3PVL A;  3A1Q A;  1PGA A;  4K7W A;  1FPY A;  1C1Y B;  3JW0 X;  4GGQ A;  3TUO A;  2MQJ A;  5EE3 A;  4IWO A;  2BGF A;  1WXV A;  1FNV A;  2PVO D;  2N7E A;  2HD5 B;  1ROE A;  2L32 A;  2V1Y A;  5L95 C;  2FIF A;  4G3X B;  2HTH A;  4K3B A;  2KKC A;  3VRA B;  1V1P A;  2G3Q B;  3MP9 A;  3W1S C;  3RNA C;  1S3S G;  4YWG G;  2H89 B;  2IGH A;  2JYT A;  2LRW A;  2BS2 B;  2KWD A;  1NVI D;  2VH1 A;  2ZNV B;  2L05 A;  2WHI A;  1L0V B;  3H8H A;  4RGT A;  3W5U B;  3AE3 B;  3V3X A;  1WE7 A;  1I4X A;  1K50 A;  4ARC A;  2PKO A;  1LGR A;  2QMT A;  3ZW3 A;  2BTE A;  2IND C;  1WM2 A;  2JU6 X;  1N63 A;  2KZR A;  1WZ0 A;  3HIZ A;  1OTR B;  3R8B A;  4GSW A;  2N7J A;  2L3Z A;  2M0A A;  3VDZ A;  4ANX A;  4CHK A;  4WH4 A;  4XWW A;  4N59 A;  4JWS C;  3X23 A;  2HDE A;  1PUT A;  1WGR A;  4GMV A;  1FRR A;  3L13 A;  3APC A;  2I38 A;  1FFV A;  3TMP B;  3I9V 1;  1RFK A;  1UGJ A;  1WSP A;  1E5W A;  2ICI A;  1K8R B;  1NEN B;  3VUY A;  4BVU C;  1Q5W B;  1I4Q A;  1CK1 A;  2KQS A;  3L4P A;  1C78 A;  2BYV E;  4J6I A;  1L0X B;  2IPK D;  4AJY B;  1TKE A;  2FID A;  2MP2 A;  3GOE A;  3FC4 A;  1EF5 A;  1TS5 A;  4IOI E;  3JYU A;  3WAM A;  1PQS A;  2J7Q B;  4RGO S;  5IN7 A;  3GZN I;  3ECI A;  2CJO A;  2RPV A;  2KAC A;  4NQL B;  2KC1 A;  3R66 C;  3NZS A;  2D5G A;  3R7Q A;  1WX8 A;  3Q2A C;  1FD6 A;  3ZTC A;  1XQQ A;  3LDZ E;  2N1W A;  5E6O A;  4XYC A;  4C56 C;  1EM7 A;  3KWL A;  1RLF A;  4IM0 A;  1WWT A;  1MJD A;  2O6V B;  4RGM A;  3B2F A;  1J8C A;  1ZXI A;  1YIW A;  3VHT C;  3BVM A;  3GS2 A;  4ANW A;  1QQR A;  3A33 B;  1UNS A;  2M56 B;  1V9J A;  1JML A;  2IDY A;  4WWN A;  5J2R A;  3U52 E;  2NBU A;  4RM8 A;  1TZO A;  2PW9 A;  3L0W B;  2KVZ A;  2BQQ A;  1UWM A;  3A4S C;  3MC8 A;  3X0W A;  3P4S B;  1TKY A;  1WM3 A;  3AE7 B;  3SEB A;  3RNF C;  3JVZ X;  2BKR B;  4LNI A;  2BYT A;  1SB3 C;  3BK2 A;  5CTR C;  2KAJ A;  4AP4 C;  1SE4 A;  1U4A A;  4OZA A;  1E8W A;  5GMV A;  2JWU A;  2L7R A;  3W1Y A;  2WDV B;  2PJH A;  3AN1 A;  4P1C C;  3T3O A;  5DPW A;  2QIL A;  1ESF A;  1ENF A;  2WXR A;  2WS3 B;  2JVC A;  3AH7 A;  4FHK A;  2V3S A;  4I6P A;  2E6X A;  2YEP F;  3A4R A;  3PLU A;  4FBJ B;  1RFA A;  1TGZ B;  4ITK A;  2AL3 A;  2D3G A;  1UWX A;  3SU8 X;  4UDU C;  2HTM E;  2H88 B;  1B9R A;  3UIO B;  3Q8E A;  3OLM D;  5C23 A;  2PE6 B;  4ACF A;  3O13 A;  4TUU A;  4X57 B;  1EU3 A;  5DCN A;  1EF1 A;  2JY6 A;  5BYS A;  3VR8 B;  1ZUD 2;  3KUC B;  1TS2 A;  4XC2 A;  3Q8B A;  3V61 A;  4NAW B;  1TS3 A;  3I63 C;  1HZ6 A;  1T0Y A;  2WXN A;  2WXP A;  1F52 A;  2OHF A;  3EC8 A;  1KRH A;  3MC9 A;  1IYF A;  2DAF A;  3TEW A;  2K6D B;  1C4C A;  1BUI C;  3WAO A;  2LVP A;  1YN5 A;  2NBV B;  2LGD A;  2KN5 A;  4M8M A;  3LXF A;  4GB9 A;  4L2Y A;  2O2V B;  4HPL B;  2LXA A;  3ZIM A;  2QJL A;  4WIP A;  4A20 A;  2CU1 A;  3W2D A;  4DHZ E;  4LDT B;  2J0M A;  3P63 A;  5AUI A;  3AE8 B;  2FCM A;  1V86 A;  1N60 A;  2XK5 B;  3P1M A;  1SSN A;  4C80 A;  2AX5 A;  4IWQ A;  1PGX A;  3M63 B;  2Y5C A;  4BZA A;  1SE3 A;  3Q14 C;  1WJN A;  4S17 A;  2NVU I;  3ZDT A;  1XLQ A;  5G5H A;  3MHZ A;  4GIV A;  1YD8 U;  1OQQ A;  5FR6 A;  1JRU A;  2B76 B;  4WWO A;  3AED B;  1FFU A;  3W9C B;  2L8J A;  2K25 A;  5MPO A;  4II3 B;  3A1Q B;  3RD2 A;  4IWP A;  4ANU A;  3B0A A;  3IBE A;  2K0P A;  2LVQ A;  4GN1 A;  4MDK E;  4XDD A;  1IUE A;  1GC6 A;  3DHG C;  5KHQ A;  2DZK A;  4B0E A;  2K3U A;  2C9W B;  3RT3 B;  3DPD A;  2JYE A;  3ZRF A;  1D5M C;  1H4R A;  1Z2M A;  4MH0 E;  1M4V A;  3OWE B;  2GBR A;  2GBN A;  1RRB A;  4HKQ A;  2KDM A;  4YTM B;  1V1P B;  1QF6 A;  3GE3 C;  3KYC D;  1P98 A;  1T5X D;  3NVY A;  2KMC A;  2LFI A;  2DZJ A;  2AYO B;  5CHW A;  1YMH E;  4EOY A;  2DYB A;  2V4L A;  4GDK A;  4A8X C;  2KQ7 A;  3DVG Y;  5DPS A;  4OZC A;  4JX1 C;  2JZP A;  4PYU A;  1FNW A;  2V4I B;  3L10 B;  3ZUN A;  3VFK A;  3UIN B;  3ML9 A;  4DHZ B;  1E6E B;  1KF6 B;  4KGS A;  3VRB B;  4IUM B;  4KIK B;  2INC C;  4P16 A;  3L54 A;  4A90 A;  2WP9 B;  4F1S A;  3DWM A;  3R3M A;  2BYE A;  4GU2 A;  2LHD A;  4MSM B;  1KJT A;  2ZNV C;  4A6Q A;  2ACZ B;  4LLG M;  2YVC A;  3ETR A;  3P2B A;  5KHO A;  2BF8 B;  2Z0D B;  4NJ7 A;  5HHD G;  2JZZ A;  2O6V A;  3EHV A;  3NZ3 A;  4BFR A;  1QLB B;  2PIA A;  1ACC A;  3R2T A;  3U4E G;  2RR9 A;  1QT9 A;  2QCZ A;  1RM6 C;  2EMT A;  2G4S A;  1UD7 A;  3AE5 B;  3M95 A;  3LJ3 A;  2RDH A;  4HRS A;  3TSS A;  4DXA B;  4N58 A;  2MP2 B;  3Q3N C;  4L1B A;  2WXK A;  1VZ6 A;  2CJN A;  4KSL C;  3ZRC A;  1UF0 A;  2JZ3 B;  4HWI B;  1VCB A;  1XLO A;  2INP E;  2K39 A;  1V8C A;  2KLG A;  1SIF A;  2VRR B;  3JSV A;  4MJS A;  3PZ7 A;  4QAY A;  1J7C A;  4MM3 A;  1AN8 A;  3U7Z A;  3HVD A;  4KGR A;  2LD9 A;  3QJZ A;  2JXT A;  4IM3 A;  4B9K A;  3B1L X;  1L0Y B;  3S2A A;  3N3K B;  1YQB A;  1M94 A;  3N30 A;  5CHF A;  3EUB 2;  1HEZ E;  2VZK D;  3HM6 X;  4K7U A;  5BMG A;  1HXY D;  3CF6 E;  1TTN A;  1KH0 A;  2ZVN A;  3KH0 A;  5E6P A;  3NVZ A;  2E3T A;  1E7P B;  1L2N A;  3M3J A;  3PHW B;  1WR1 A;  4L23 A;  3DVN V;  1E7U A;  1DOX A;  1UUP A;  2CHX A;  3QX1 A;  4US8 A;  2GI9 A;  2L00 B;  4EKU A;  1N5W A;  1J7B A;  1I4R A;  2ZPN A;  3AM9 A;  2REX A;  5IP4 D;  5J18 A;  5JZE B;  4IW0 A;  2ZW1 A;  4K3C A;  1QOA A;  2BT6 A;  4NAW A;  3EA6 A;  3QQ8 B;  2FUH B;  3RN9 C;  4ANV A;  2W9N A;  4ZHP A;  5FK9 C;  1UGM A;  1V49 A;  1PYW D;  2MWS B;  2V0G A;  3QAR A;  3I3T B;  1MG8 A;  3TEX A;  5IAA C;  4C7Z A;  3RFZ B;  3OAW A;  1GOZ A;  3AXC A;  4YL8 A;  2IO2 B;  5AEK B;  4LNO A;  2WXI A;  3Q6B A;  2Z8L A;  2C7M B;  2EKI A;  2IYD B;  4F8C B;  1NYR A;  1YQ3 B;  4TQ0 A;  2Y5P A;  3ZJT A;  3DCG A;  1KOT A;  2INN E;  2N0S B;  1XCT L;  3TEY A;  3OG5 A;  4HEA 1;  2LGI A;  3IFW B;  1P0R A;  2IO1 B;  2WX1 A;  3VH4 B;  2QIE B;  4GLS C;  3N1X C;  4BBN F;  4FAD A;  4RF0 A;  4W9I A;  1Y8R C;  2KTF A;  2L0T A;  2NBW B;  1OGW A;  1E9M A;  2KMM A;  4KZC A;  4YTN B;  4HJG E;  2OOB B;  3BY4 B;  4FJV B;  1WGD A;  1STE A;  4WJN A;  4FN2 A;  3RCZ A;  2MJ3 A;  3Q8C A;  2KLC A;  2RPQ A;  1F9J A;  2I1J A;  1HZ5 A;  3Q69 A;  3B2G A;  1WRD B;  2SEB D;  3QK0 A;  4C7Y A;  2LRU A;  3GB1 A;  5JHB A;  3AE6 B;  5FR3 A;  2MW5 A;  5EDS A;  4MSQ B;  1GUA B;  4USA A;  2FUG 1;  2I1K A;  5DPR A;  2KWV B;  3L08 A;  3MFG A;  1SE2 A;  2KYW A;  1WX7 A;  1EU4 A;  2IGD A;  2MA9 B;  4C4V A;  1WGG A;  4IG7 B;  2J53 A;  4W9H A;  2J42 A;  3IAM 1;  1GAQ B;  1GPX A;  2KK8 A;  3Q8A A;  1C9F A;  2W55 A;  2UWQ A;  3VR9 B;  1IBX B;  3D32 A;  2MHJ A;  2WDT B;  5LLI A;  4JWU C;  1V5O A;  4FA6 A;  3N32 A;  3NHE B;  3DDC B;  4KIK A;  3VTU A;  4W9L A;  3NY5 A;  1ZKH A;  1YN3 A;  4DXF A;  4DDI D;  2MJE A;  4AS1 A;  3DBS A;  4WWP A;  2Y5B B;  1JQ4 A;  2A5U A;  3ENE A;  2ZEQ A;  1VLB A;  3DVN U;  2LJI A;  3APD A;  3GZN B;  1SE9 A;  3I57 A;  3WA0 A;  4DHJ B;  2XNA C;  3ZXV A;  3AUL A;  1TBE A;  3IT4 B;  1TYG B;  5G5G A;  3U8Z A;  1LXD A;  3QAQ A;  3KYD D;  4PS3 A;  2WQY B;  4PK1 A;  3EFU A;  2XBB C;  1TZ1 A;  1D5X C;  1FCC C;  4HCN B;  4GDK B;  1YX6 B;  2BPS A;  3IVF A;  4HPP A;  1I42 A;  2R61 A;  4DHJ D;  2KDB A;  4HRO A;  1OEY J;  4MGZ E;  5J17 A;  5TR5 A;  5D94 A;  5CHV C;  1K53 A;  2WGS A;  2YEP B;  2NPT A;  1FNU A;  2KDF B;  4ZYN A;  3V6C B;  1ISN A;  3H7S A;  3A9J A;  4I6N B;  3KUD B;  5BYR A;  4P6V F;  2KMA A;  1AW7 A;  4C00 A;  3ZQ4 A;  3B08 A;  3PGE A;  1N6Z A;  1LQB A;  1WRI A;  1DYQ A;  1SEB D;  3PPA A;  3TCA A;  4A55 A;  4URK A;  4HDQ A;  1FM0 D;  2DLB A;  3CWI A;  2WXF A;  2MRP A;  4AWJ A;  1DOI A;  2L1A A;  1Y56 A;  3Q3J A;  4G0N B;  1FXA A;  3WAP A;  3UQB A;  1PDX A;  3SFE B;  1ZE3 D;  2OJR A;  4BOZ B;  4I6L B;  1UBQ A;  1WZ3 A;  1A70 A;  2WDR B;  4WWM A;  5H92 C;  3RNG C;  2KAN A;  3DBH B;  2KFK B;  2NCN A;  3JSV B;  3NOB A;  4MJS B;  2WWZ A;  2K8B A;  2IO0 B;  5IKC M;  5C3J B;  1GB4 A;  4MM3 B;  2HE7 A;  5LXH A;  1ET6 A;  4M0W A;  4FJZ A;  3GP7 A;  3RPF C;  1JWM D;  2N4F A;  3ABV B;  3SR6 A;  1DGJ A;  3UF8 A;  3H9D A;  3ZXR A;  5BO4 B;  5BMH A;  2GRI A;  2AEH A;  1WGY A;  1MHX A;  4MGI E;  4MT5 A;  1E8Z A;  3NJT A;  1S1Q B;  2MBB B;  1E0Z A;  2AQ3 B;  2CHW A;  2EKE C;  2BYF A;  4LNF A;  3CMM B;  5LXI B;  2K8H A;  2EMS A;  2KQ4 X;  5D3D A;  2J0K A;  3DBH I;  4HLE A;  1IGC A;  1ZOY B;  2QEJ C;  3PZ8 A;  1UZX B;  2MBH A;  2KVR A;  5I4D A;  4BOS C;  1GJZ A;  1WF9 A;  5AZG A;  4XE0 A;  2KT7 A;  2D3B A;  1J19 A;  1ZGU B;  2JPH A;  4B95 A;  2JRI B;  4G11 A;  4BBN C;  2FCN A;  2DBY A;  3EFC A;  3N1Y C;  5L83 A;  3ZDM C;  3UQA A;  1KFY B;  4S0R A;  2Z59 B;  3NVV A;  2D11 A;  3TBL D;  3GE8 C;  4RCO A;  2LGY A;  4OVV A;  4US9 A;  3PLV A;  3CST A;  2LI5 A;  2NTS A;  2CKH B;  3WAL A;  4D2K A;  3OJ4 B;  4AOF A;  1I35 A;  1T3Q A;  1XO3 A;  1RWS A;  2N7D A;  1MI0 A;  3BZD B;  1WGK A;  4TV3 A;  2JF5 A;  3PRZ A;  3KW5 B;  3PO0 A;  2M19 A;  3L17 A;  1GC7 A;  3PS6 A;  1OQY A;  1FEH A;  1IBX A;  3C0R B;  3DBR B;  2KX3 A;  2N1V A;  1OFF A;  2D2Q A;  3ZVV A;  1MG4 A;  3Q8F A;  2WX0 A;  1VZ8 A;  2ASQ A;  3BWU D;  4ICV A;  3DQV A;  1UBI A;  1F2R I;  3AMZ A;  2JRH A;  1FXI A;  2RDG A;  1J7A A;  2LXC A;  2WDQ B;  3DBL B;  2M8S A;  3K9P B;  2N9E B;  2ZPY A;  4P7I A;  3TJP A;  2BWF A;  4DWF A;  1TIF A;  2J52 A;  2BKF A;  3PRE A;  4WQM A;  2C60 A;  3NS1 A;  3DBR I;  4C4V B;  4ZRK A;  2JT4 B;  1I4H A;  2PEA A;  4EZK A;  3V60 A;  1NI3 A;  5FKA C;  4JIO U;  4HKZ E;  1AAR A;  2N9L A;  2M0X A;  1JWS D;  3R7R A;  4EEW A;  4TKN A;  3QC8 B;  1WX9 A;  3PSE B;  4W9J A;  4DK5 A;  2CHZ A;  5IA7 A;  3TEZ A;  3DBL I;  1V80 A;  2IY1 B;  1YX5 B;  5D7G A;  3P42 A;  3C19 A;  2KTR A;  1N61 A;  1L6U A;  3AEE B;  3N1Z C;  2YLM A;  3EGR A;  4NPN A;  2AWT A;  4KV2 A;  1AWD A;  1QOG A;  2Y3A A;  4RM9 A;  2GMI C;  4NNJ B;  1YJJ A;  3AEC B;  1MHH E;  1L7Y A;  1PFD A;  3MTN B;  1FXT B;  4Q2J A;  2OED A;  1FCL A;  4AQ7 A;  3KQ4 A;  3V6E B;  4EUT A;  1PGB A;  2IJ0 A;  3C8Y A;  4YSZ B;  1V2Y A;  4M01 A;  1WXM A;  3V62 A;  3AEG B;  3H7P A;  3ZNG C;  3AE1 B;  4A3P A;  3AI5 A;  5GXG B;  2D3C A;  5D3I B;  1YJ1 A;  2VH2 A;  2VZK B;  1WY8 A;  3E9S A;  3AV8 A;  2LWP A;  4TMA B;  2KFK A;  2G45 B;  4IC7 B;  1IGD A;  4GXB A;  4KX6 B;  4GDL A;  4K81 A;  4OZB A;  4DQO C;  2MH7 A;  1KLU D;  1WIA A;  3A9K A;  1Q10 A;  1JCK B;  2X38 A;  1TT5 B;  1XLN A;  2GLS A;  2NPT B;  2R2O A;  2V9H A;  2PPH A;  4FUL A;  2K1F A;  1D5Z C;  3A9J B;  4W9K A;  3UGB B;  1L5P A;  2KXJ A;  5G2N A;  3ZGZ A;  2KJR A;  1ZXH A;  4KZ0 A;  1WE6 A;  1Q1O A;  2W54 A;  1QKZ A;  3TIX A;  1FRD A;  1YJI A;  2FCQ A;  4ZRI A;  1CQV A;  2LEK A;  2KJH B;  3P4R B;  1TJE A;  2L0F A;  3RI7 C;  3N9Y C;  3QWZ B;  3HHM A;  2KOX A;  1XXG A;  1QOF A;  3QIJ A;  3ZO5 B;  5H8Y E;  2PTL A;  3DHH C;  3QA8 A;  3SFD B;  4ASW C;  4WUR A;  2GOW A;  1R7S A;  5EE1 A;  2GBM A;  3KVF B;  4FJY A;  2LHE A;  1XT9 B;  2K8C A;  1WGH A;  1WI0 A;  3R2I A;  2WLB A;  3DOW A;  4AJW A;  2RGF A;  4M0W B;  3RNE C;  3M62 B;  4N9F 4;  4MGK E;  3AE4 B;  4MEM A;  1NBF C;  3UI3 A;  1N62 A;  3UIP B;  1YNT E;  2KHW B;  3O65 B;  2I2Y A;  3VXW A;  1P7E A;  2C7N B;  1Q0W B;  4W9F A;  4HPM B;  1C4A A;  4HJK A;  1JWB D;  4YTP B;  1LFD A;  3IAS 1;  3DHI C;  1EWC A;  2DAJ A;  2LAS A;  2HJ1 A;  1T6B X;  1TS4 A;  1R4M I;  2IY0 B;  1SIJ A;  4IKG A;  2BVC A;  2QC8 A;  4A9A A;  1GNU A;  3ZNI D;  3ZJV A;  4WQO B;  3ONS A;  1F1H A;  2SAK A;  1T0S C;  1XF5 L;  2LUE A;  3AEB B;  2FAZ A;  3H6N A;  1UH6 A;  3TL5 A;  1C77 A;  2CU3 A;  4K7S A;  2WU5 B;  3IXS A;  2C7H A;  3NZU A;  1FIQ A;  2N9P C;  2MCN B;  3URY A;  4F7Z A;  4B6W A;  2RD0 A;  3KWV A;  1C79 A;  2JX5 A;  3QHT A;  4LJP B; 
#chains in the Genus database with same CATH homology
 4LJO B;  4PYZ A;  5G55 A;  3Q3J A;  4GIV A;  1YD8 U;  4G0N B;  3WAP A;  2IBI B;  5FR6 A;  3UQB A;  1JRU A;  4WWO A;  2DHZ A;  3PT2 B;  3IHP C;  3CSF A;  4RMA A;  3ZTD A;  2L8J A;  1GG3 A;  4M8N A;  2OJR A;  4W9E A;  3VAW A;  4I6L B;  4BOZ B;  2K25 A;  1UBQ A;  2GBK A;  2M1M A;  1WZ3 A;  4II3 B;  4G50 A;  3A1Q B;  3RD2 A;  4IWP A;  4ANU A;  3B0A A;  2KC2 A;  3IBE A;  2KAN A;  2KFK B;  2NCN A;  1IPG A;  1R4N I;  2J0J A;  2LVQ A;  4GN1 A;  4MDK E;  2KWU B;  2KJ6 A;  3JSV B;  1GC6 A;  3NOB A;  4MJS B;  4JLC A;  2WWZ A;  2K8B A;  3APF A;  5KHQ A;  2IO0 B;  2DZK A;  2HE7 A;  4E71 A;  5LXH A;  2C9W B;  4FJZ A;  3RT3 B;  4NQK E;  3DPD A;  2QHO A;  5JH5 C;  1C3T A;  3ZRF A;  1EO6 A;  4IM2 A;  1H4R A;  1Z2M A;  4MH0 E;  2IZV B;  2GBR A;  2GBN A;  2N4F A;  1RRB A;  3UF8 A;  3H9D A;  4DDG D;  1G6J A;  2XEW A;  4ICU A;  4MEL A;  1E90 A;  5BO4 B;  1KM7 A;  4LCD E;  2AEH A;  3KYC D;  1OEY A;  1P98 A;  1WGY A;  2KMC A;  4CO7 A;  4MGI E;  1RAX A;  1E8Z A;  2DZJ A;  4MGY E;  2AYO B;  1S1Q B;  5CHW A;  2MBB B;  2MBQ A;  5E6N A;  4EOY A;  3RUL A;  2CHW A;  1WJU A;  2EKE C;  2DYB A;  2V4L A;  2NR2 A;  4GDK A;  1NI2 A;  2BYF A;  2KQ7 A;  3CMM B;  3DVG Y;  2K8H A;  2EMS A;  5DPS A;  3W1S A;  5LXI B;  2J0K A;  2WYQ A;  3DBH I;  4HLE A;  3KUZ A;  4PYU A;  5HKH A;  2DZI A;  3DVG X;  3ZUN A;  3L10 B;  3VFK A;  2R2Q A;  3UIN B;  4EZJ A;  4BKT A;  3ML9 A;  1UZX B;  2MBH A;  1HE8 A;  2KVR A;  4DHZ B;  2N9X A;  3VTW A;  4BOS C;  1GJZ A;  1WF9 A;  2RSU A;  2M4N A;  5AZG A;  2MLB A;  3VUX A;  4IUM B;  2ZCB A;  1QZE A;  4KIK B;  4W9D A;  3L54 A;  2LJ5 A;  1CMX B;  4F1S A;  1J19 A;  1ZGU B;  2JPH A;  3R3M A;  4ZRJ A;  2BYE A;  4GU2 A;  2O2V A;  2Z0E B;  4MSM B;  1KLV A;  4B95 A;  1KJT A;  2DZM A;  2ZNV C;  5D6J B;  2JRI B;  4NJ6 A;  3ZNZ B;  2KDE B;  4G11 A;  4BBN C;  1WMH B;  1WJ4 A;  2FCN A;  4HXD A;  3VQI A;  2YVC A;  3P2B A;  5L83 A;  5KHO A;  3ZDM C;  2BF8 B;  2FNJ B;  2NS5 A;  3UQA A;  3PHX B;  4CYE A;  2Z0D B;  4NJ7 A;  2GBJ A;  3RYT A;  2AL6 A;  2JZZ A;  2O6V A;  2XK5 A;  5JHA A;  2Z59 B;  3EHV A;  2DYO A;  2MBE A;  4EFO A;  4BFR A;  2MBO A;  2KTR B;  2D11 A;  2M17 A;  3TBL D;  1E8Y A;  4GOC A;  3RZW C;  4KSK C;  2RR9 A;  2LGY A;  4DBG A;  5DPT A;  4OVU A;  2D07 B;  4A3O A;  2HJ8 A;  4OVV A;  2EMT A;  4BKS D;  4HDO A;  2G4S A;  3PRP B;  1UD7 A;  3K9O B;  3PLV A;  3CST A;  3PV1 A;  2LI5 A;  3M95 A;  2CKH B;  1P1A A;  3LJ3 A;  3WAL A;  4NY0 A;  2K6Q A;  3OJ4 B;  4AOF A;  4DXA B;  2MX2 A;  1I35 A;  2MP2 B;  2N7D A;  4KSL C;  3VH3 B;  3ZRC A;  2JZ3 B;  4HWI B;  1VCB A;  1E8X A;  3PVL A;  2K39 A;  4TV3 A;  3A1Q A;  4K7W A;  2JF5 A;  3PRZ A;  1C1Y B;  3KW5 B;  3JW0 X;  4GGQ A;  3VUW A;  3BIN A;  2MQJ A;  2KLG A;  4IWO A;  3NS8 A;  2BGF A;  1SIF A;  2VRR B;  3JSV A;  3L17 A;  4MJS A;  3H7P B;  1GC7 A;  3PS6 A;  1WXV A;  1OQY A;  4MM3 A;  2N7E A;  2HD5 B;  2LD9 A;  3QJZ A;  4IM3 A;  3C0R B;  2KX3 A;  4B9K A;  2N1V A;  2V1Y A;  3B1L X;  5L95 C;  2D2Q A;  1WFY A;  3S2A A;  3N3K B;  2FIF A;  1YQB A;  4PS8 A;  3ZVV A;  4E3C A;  1M94 A;  4G3X B;  2HTH A;  3QCA A;  4W9G A;  3N30 A;  5CHF A;  2KKC A;  5D2M B;  2WX0 A;  3HM6 X;  2ASQ A;  4K7U A;  2ZJD A;  2G3Q B;  5AZF A;  1WR6 E;  3W1S C;  3CF6 E;  4GDL B;  1TTN A;  2L76 A;  4ICV A;  1S3S G;  3DQV A;  2LRW A;  1UBI A;  2ZVN A;  2UYZ B;  3KH0 A;  4XX5 A;  5E6P A;  2JRH A;  3A9K B;  2ZNV B;  2L05 A;  2O6V D;  2LXC A;  1L2N A;  3M3J A;  3PHW B;  1WR1 A;  4E74 A;  3U7D A;  1WE7 A;  3DVN V;  1E7U A;  2M8S A;  3K9P B;  2N9E B;  2ZPY A;  2ZZP B;  4P7I A;  3TJP A;  1BT0 A;  2BWF A;  2CHX A;  4K1R B;  4DWF A;  4BKG A;  2BKF A;  3PRE A;  3QX1 A;  1IP9 A;  2C60 A;  2L00 B;  4HVB A;  4EKU A;  2ZPN A;  3DBR I;  2REX A;  3MJW A;  5AZH A;  3ZW3 A;  1WM2 A;  5J18 A;  5JZE B;  2KX0 A;  4IW0 A;  4ZRK A;  4NAW A;  2KZR A;  2JT4 B;  3QQ8 B;  1WZ0 A;  2PEA A;  3HIZ A;  2FCS A;  3V60 A;  2KDI A;  2FUH B;  4EZK A;  4ANV A;  2W9N A;  4JIO U;  1OTR B;  2KFJ A;  1UGM A;  1V49 A;  2PE9 A;  4GSW A;  1Z5S B;  1AAR A;  2L3Z A;  2M0X A;  2MWS B;  3VDZ A;  2B3A A;  4ANX A;  4CHK A;  3QAR A;  3I3T B;  1MG8 A;  5IAA C;  1WMH A;  3R7R A;  4EEW A;  3OAW A;  4TKN A;  3AXC A;  4YL8 A;  2JWZ A;  3QC8 B;  1WX9 A;  3PSE B;  4W9J A;  4WJP A;  3X23 A;  4DK5 A;  2CHZ A;  2IO2 B;  5AEK B;  5IA7 A;  1WGR A;  4GMV A;  3DBL I;  1V80 A;  2IY1 B;  1YX5 B;  3L13 A;  3APC A;  1NDD A;  3ML8 A;  5D7G A;  3TMP B;  2KTR A;  2C7M B;  2IYD B;  4BVU C;  1E5W A;  4F8C B;  1K8R B;  3VUY A;  2YLM A;  1Q5W B;  4TQ0 A;  4NPN A;  2AWT A;  4KV2 A;  4ZDV A;  2MSE D;  1XD3 B;  2KQS A;  3MHS D;  1UEL A;  3DCG A;  2BYV E;  1H8C A;  4J6I A;  4WJO A;  1KOT A;  4RM9 A;  2GMI C;  4NNJ B;  4AJY B;  4FHJ A;  4HK2 A;  2FID A;  1WXS A;  2MP2 A;  3GOE A;  1L7Y A;  1FXT B;  1V6E A;  3MTN B;  1EF5 A;  3IFW B;  1P0R A;  2IO1 B;  4FLH A;  2WX1 A;  3VH4 B;  3V6E B;  4EUT A;  3JYU A;  4BBN F;  4FAD A;  2KNB A;  3WAM A;  1V2Y A;  1WXM A;  4W9I A;  1E7V A;  3V62 A;  1Y8R C;  1PQS A;  2J7Q B;  2KTF A;  3H7P A;  3SD5 A;  2L0T A;  3ZNG C;  1A5R A;  2NBW B;  3GZN I;  1OGW A;  3ECI A;  4A3P A;  4NQL B;  2KC1 A;  3IG3 A;  3VTV A;  3AI5 A;  3R66 C;  4WAA A;  3NZS A;  3PZD A;  4W9C A;  4KZC A;  1YJ1 A;  3HM3 A;  2OOB B;  1WY8 A;  3OJ3 A;  3BY4 B;  4FJV B;  1WGD A;  3ZLZ A;  3R7Q A;  2LWP A;  1WX8 A;  2CR5 A;  1ZW7 A;  3HK0 A;  1XQQ A;  3LDZ E;  2KFK A;  2N1W A;  4WJN A;  5E6O A;  3ZTC A;  2G45 B;  4IC7 B;  2JUO A;  4II2 B;  4FN2 A;  4GXB A;  3RCZ A;  4GDL A;  4JGH B;  1RLF A;  2KLC A;  4K81 A;  2KO3 A;  2RPQ A;  4IM0 A;  1F9J A;  3SHQ A;  2I1J A;  2O6V B;  4XZ4 A;  1WRD B;  1WIA A;  1D3Z A;  3A9K A;  3QK0 A;  1J8C A;  2LRU A;  5JHB A;  1YIW A;  3VHT C;  2MW5 A;  2NPT B;  5EDS A;  4MSQ B;  2R2O A;  4ANW A;  1GUA B;  2PPH A;  4FUL A;  3A33 B;  2K1F A;  2I1K A;  3A9J B;  4W9K A;  3UGB B;  5DPR A;  4WJQ A;  2KWV B;  1V9J A;  2KXJ A;  4JL9 A;  5G2N A;  3H1U A;  2KJR A;  4WWN A;  3Q3F A;  3L08 A;  5J2R A;  2NBU A;  4KZ0 A;  1VD2 A;  2KWC A;  4RM8 A;  1WE6 A;  1Q1O A;  2CS4 A;  2JXX A;  3WAN A;  3L0W B;  1WX7 A;  3ALB A;  4LDT D;  3RZF A;  2MA9 B;  3TIX A;  1WGG A;  4IG7 B;  2FCQ A;  2KD0 A;  2LGX A;  3A4S C;  4W9H A;  4ZRI A;  1WJ6 A;  3X0W A;  3ZNH B;  2KJH B;  2L0F A;  1WM3 A;  4HCP B;  2DYM A;  3QWZ B;  3JVZ X;  2BKR B;  3HHM A;  2KOX A;  1V81 A;  3AU4 A;  1SGH A;  3QIJ A;  5CTR C;  2KK8 A;  2DEN B;  3ZO5 B;  2UWQ A;  4AP4 C;  1U4A A;  3QA8 A;  1E8W A;  3T8M A;  5GMV A;  4ASW C;  2L7R A;  3D32 A;  2GOW A;  4AUQ C;  2WDT B;  5LLI A;  1V5O A;  4FA6 A;  2GBM A;  3N32 A;  3KVF B;  3DDC B;  3NHE B;  4KIK A;  3T9L A;  3VTU A;  1X1M A;  4FJY A;  3W1Y A;  4W9L A;  3NY5 A;  1ZKH A;  2PJH A;  2ZVO A;  5DPW A;  1XT9 B;  2K8C A;  1WGH A;  4DDI D;  3DBS A;  4WWP A;  1WI0 A;  4BKS A;  2Y5B B;  2JVC A;  2A5U A;  2V3S A;  3DOW A;  4FHK A;  4I6P A;  3VVW B;  4AJW A;  2RGF A;  3A4R A;  3ENE A;  3PLU A;  2ZEQ A;  4M0W B;  4FBJ B;  3DVN U;  3M62 B;  2A4Z A;  4N9F 4;  2DX5 B;  1RFA A;  1TGZ B;  2AL3 A;  1LM8 B;  2D3G A;  4MGK E;  4MEM A;  3APD A;  3SU8 X;  4KVG B;  4KDI C;  1NBF C;  1SE9 A;  3EEC A;  1J0G A;  3WA0 A;  4DHJ B;  3UIP B;  3AUL A;  3UIO B;  2KHW B;  3O65 B;  3OLM D;  1TBE A;  5C23 A;  2PE6 B;  3VXW A;  3U8Z A;  3PTF C;  3RUI B;  2D10 A;  4TUU A;  4X57 B;  1WXA A;  1LXD A;  3QAQ A;  5DCN A;  1EF1 A;  3KYD D;  2C7N B;  4PS3 A;  2JY6 A;  1Q0W B;  3AU5 A;  3EFU A;  2XBB C;  4W9F A;  1TZ1 A;  4HPM B;  3KUC B;  4HCN B;  4GDK B;  1YX6 B;  4HJK A;  4XC2 A;  1LFD A;  2BPS A;  4NAW B;  3V61 A;  3IVF A;  2DAJ A;  2LZ6 A;  1T0Y A;  1I42 A;  4DHJ D;  3EC8 A;  3SDL C;  2KDB A;  2LAS A;  1V5T A;  1IYF A;  1P3Q U;  2DAF A;  1OEY J;  4PS7 A;  2K6D B;  1R4M I;  4MGZ E;  5J17 A;  5TR5 A;  5D94 A;  3WAO A;  2IY0 B;  5CX3 A;  2LVP A;  2NBV B;  2LGD A;  1GNU A;  2KN5 A;  4M8M A;  3ZNI D;  4GB9 A;  4KDL B;  5CHV C;  4WQO B;  3ONS A;  2O2V B;  4HPL B;  2LUE A;  2LXA A;  2NPT A;  3ZKJ C;  2FAZ A;  2KDF B;  4ZYN A;  2BWE S;  3V6C B;  3WIM A;  3ZIM A;  4EZL A;  1ISN A;  3H6N A;  3H7S A;  3A9J A;  4I6N B;  3KUD B;  1WH3 A;  2KMA A;  4A20 A;  1UH6 A;  2CU1 A;  3TL5 A;  2LVO A;  4K7S A;  4DHZ E;  4LDT B;  2J0M A;  2FCM A;  1V86 A;  2C7H A;  3L16 A;  3B08 A;  2XK5 B;  2ZCC A;  3NZU A;  3PGE A;  2G4D B;  4JQW C;  2IO3 B;  4TQ1 A;  1LQB A;  2N9P C;  2MCN B;  3U30 A;  3PPA A;  4IWQ A;  3PRM B;  3TCA A;  1P9D U;  4F7Z A;  4URK A;  1WYW B;  4B6W A;  4HDQ A;  2RD0 A;  3M63 B;  1EUV B;  2C5L C;  5C1Z A;  1WJN A;  3QHT A;  4LJP B;  2NVU I;  2MRP A;  3ZDT A;  4AWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...