2ZPNA

The crystal structure of saccharomyces cerevisiae atg8- atg19(412-415) complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
publication title Structural basis of target recognition by Atg8/LC3 during selective autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zpnA00
1YQBA 3A9KA 3ZNID 4JGHB 1BT0A 1P3QU 2RGFA 3PHWB 3A1QA 1V5TA 2LRUA 2ZJDA 4WJQA 4LCDE 2BWFA 1GC7A 5C23A 3CSTA 2I1JA 2FNJB 1EO6A 2M17A 3GOEA 4ICVA 1KLVA 4KZCA 3M63B 4ANUA 1D3ZA 4J6IA 4WWNA 3VUWA 1F9JA 1WM3A 3S2AA 3L17A 3ZIMA 1WGYA 3CSFA 2XEWA 4WJNA 4TQ0A 1P98A 4I6NB 1NDDA 4BBNF 2KJHB 2XK5A 5G55A 2MBQA 4KZ0A 2LUEA 3P2BA 4M0WB 4EZJA 3TL5A 3ZTDA 3PZDA 4IWQA 4NQKE 2KDEB 2WX0A 5D94A 3VTUA 4HVBA 2N9XA 4K7WA 3V60A 2LVOA 2BKRB 2KC2A 1VCBA 2GBNA 4PS7A 2NPTA 3L54A 2V1YA 2D2QA 4IWOA 4E3CA 4WQOB 4ASWC 1E8YA 2Z59B 3A9JB 4MGKE 1YIWA 2KANA 3EECA 1UD7A 2ZCCA 5D2MB 1UZXB 2B3AA 3ZKJC 1GC6A 3OAWA 1WE7A 3AU5A 1WGRA 2N4FA 3IG3A 2AL3A 1EUVB 2YVCA 3L08A 5J18A 2A4ZA 2KVRA 3TJPA 2DZJA 3NZSA 3VXWA 5L83A 5CHVC 1C3TA 3GZNI 1FXTB 4ZRJA 2W9NA 2RSUA 2NVUI 4IM2A 4ANWA 3X0WA 1L2NA 1PQSA 5DPTA 3RYTA 3VVWB 4X57B 2PEAA 1KM7A 2L3ZA 2ZVNA 4HCPB 3VFKA 3VUXA 1X1MA 1OEYA 3A9KB 5IA7A 1TZ1A 2KD0A 2IYDB 2MW5A 3T8MA 3QCAA 2PE6B 1LQBA 4BKSA 3A1QB 3PS6A 5J17A 2PPHA 1WXSA 3RULA 1E8ZA 1WXAA 4HK2A 4W9IA 1WI0A 4ANVA 4MSQB 2BGFA 1R4MI 4P7IA 3ZUNA 3PSEB 2CKHB 3CMMB 4WWPA 2I1KA 2FCQA 2ZPYA 2KLGA 5BO4B 2R2QA 2XK5B 5KHQA 2DENB 3LJ3A 3QWZB 3ML9A 3OJ3A 2KKCA 4G50A 1WFYA 3M95A 2LGDA 3JVZX 3KYCD 5AEKB 2MQJA 5JZEB 5AZFA 2KFKA 3KW5B 4HJKA 4JQWC 1SE9A 2HJ8A 4ZYNA 3VUYA 4GSWA 1WJ6A 5FR6A 2C9WB 4DK5A 3NOBA 3IBEA 3VDZA 2HTHA 1K8RB 2A5UA 4IM3A 2GBKA 2DYBA 2VRRB 2G4SA 2NPTB 3L0WB 3R7QA 4FA6A 2LGXA 4BFRA 2G45B 3R7RA 2G3QB 4FULA 2FAZA 1WZ0A 3RT3B 1M94A 4URKA 4BOZB 2JPHA 3NS8A 4AOFA 1QZEA 4MGYE 5D7GA 4EEWA 3WAPA 2D3GA 2N7EA 2YLMA 3QARA 2JUOA 4MGIE 2UWQA 2KTRA 3LDZE 1V6EA 3ZDTA 1EF5A 1XD3B 1TTNA 4MH0E 3H1UA 2LRWA 1WJUA 3PT2B 3UIPB 1U4AA 3ALBA 4W9DA 4II3B 3TBLD 3VQIA 1V86A 2L76A 3AU4A 3L13A 1E90A 1P1AA 3UQBA 1WXVA 2GBRA 3K9PB 1KJTA 2IO2B 3QA8A 3I3TB 2C7MB 4JLCA 2MBHA 2KX3A 3NHEB 3PLUA 2AYOB 3DVNV 1GUAB 4I6LB 2EMSA 1WGGA 1WMHA 4DHZB 1WH3A 2WX1A 4GOCA 4KDLB 2M8SA 2JVCA 2DZMA 4IG7B 2IBIB 4KV2A 2R2OA 3TIXA 4BOSC 3B1LX 1V81A 3A33B 2LVQA 2JZZA 1KOTA 3H7SA 3RZWC 3QAQA 5HKHA 2KO3A 4W9CA 3ZW3A 2L0FA 2IO1B 2KFKB 3WAMA 2XBBC 2GMIC 1I35A 3KUZA 5TR5A 4FBJB 3VTVA 2CS4A 1E7VA 2D11A 2RPQA 3V6EB 4WJPA 3B08A 4W9LA 4IC7B 5AZHA 4F1SA 2K25A 2C60A 2BYFA 1V80A 2OOBB 1GNUA 3DCGA 2K6DB 3DVGX 1V9JA 2K8BA 4WAAA 4FN2A 3JSVA 2IO3B 5JH5C 1MG8A 3QX1A 3M62B 3T9LA 3IHPC 2DYMA 3BY4B 2FUHB 2ZCBA 2ZZPB 2AEHA 1YX5B 2REXA 1P9DU 2KTRB 2MP2A 3HM3A 4HWIB 4B6WA 4ZRKA 2LXCA 2V3SA 4JIOU 2CU1A 2CHXA 4E74A 2KTFA 4AUQC 1JRUA 3W1SC 2KJ6A 1RFAA 1WZ3A 2KC1A 2DYOA 2JF5A 3H7PA 3HM6X 3A4SC 3N32A 4FHKA 3ZTCA 4GB9A 2BYVE 4BKGA 4XC2A 4DHJB 1YX6B 1WY8A 3Q3JA 1C1YB 1VD2A 4BKTA 5CTRC 2N1WA 2IY1B 4W9JA 5G2NA 5E6PA 4NJ7A 3PGEA 5C1ZA 5JHBA 3SDLC 2IY0B 1NBFC 3WAOA 1UBQA 4MGZE 1WMHB 4II2B 3MTNB 3DDCB 2L00B 4NQLB 2BYEA 4NNJB 2G4DB 4MM3A 3UF8A 2KZRA 2KWVB 4GN1A 4GXBA 3DVGY 4I6PA 3APFA 2C5LC 2KDBA 4DHZE 2UYZB 5DCNA 2NBVB 2ZNVB 2HE7A 1WJ4A 3IVFA 4PS8A 3ONSA 3MHSD 2EMTA 3U8ZA 2KK8A 2RD0A 4MDKE 4M8NA 3PRPB 5GMVA 4NAWA 1RRBA 2M4NA 4DXAB 4MJSA 1UGMA 4AWJA 1OQYA 3B0AA 2KHWB 2J0MA 1OGWA 4FADA 5J2RA 4GDKA 4DHJD 1OEYJ 4IWPA 1OTRB 5DPSA 3R66C 3VHTC 2FCNA 2KXJA 2D10A 5IAAC 2O6VA 1TBEA 2DAFA 2KDFB 3ZDMC 2WDTB 3JSVB 2L8JA 2OJRA 4G11A 2EKEC 3WANA 3K9OB 1H8CA 3HK0A 2NR2A 2MP2B 4KSKC 3PRMB 2MRPA 2NBWB 2KQ7A 2NS5A 1WE6A 3D32A 2LGYA 1WGHA 2Z0EB 5DPRA 2M1MA 2CR5A 4N9F4 3H7PB 4OVUA 3PPAA 3DBLI 3ZNGC 4BVUC 4TV3A 3UQAA 4YL8A 3KUDB 1SIFA 4KSLC 4HDOA 4LJOB 2D07B 4PYZA 3KUCB 1WX7A 1IPGA 1GJZA 1Q5WB 2FIDA 3CF6E 4K7UA 2AWTA 4WWOA 2LJ5A 4FLHA 3DOWA 3PRZA 2Z0DB 2KOXA 3RCZA 3EHVA 2LVPA 4TQ1A 5LXHA 2KMAA 4HLEA 1EF1A 4NY0A 4RM8A 1LXDA 3IFWB 3SHQA 1WX8A 2MA9B 2GBMA 2WWZA 4FJVB 1LFDA 4B95A 5CHWA 2LZ6A 1ISNA 2GOWA 2KX0A 3OLMD 1CMXB 3VTWA 2K39A 4KVGB 1WJNA 3VAWA 1WXMA 4W9GA 1HE8A 2ZPNA 3AI5A 3PLVA 4NAWB 1E7UA 4W9KA 2BPSA 1LM8B 1GG3A 3EFUA 4MJSB 4RMAA 3TCAA 4GDKB 3ZLZA 2DAJA 1NI2A 4CYEA 1UBIA 3PTFC 1ZKHA 1J8CA 3PVLA 4KDIC 3DBHI 1V5OA 2O6VB 4HDQA 4BBNC 2WYQA 2L0TA 2QHOA 2O2VA 3L16A 2JY6A 3M3JA 4XZ4A 4A3PA 1IYFA 5D6JB 3ZRCA 1G6JA 2JWZA 4GIVA 4HPMB 4LJPB 5CHFA 4RM9A 2MX2A 3N30A 3UIOB 4EKUA 2V4LA 2MBEA 2N1VA 4G0NB 2DZIA 3H6NA 4MEMA 4FJYA 4BKSD 2MLBA 3AXCA 3V62A 3DPDA 3QIJA 1E5WA 2N7DA 2J7QB 2K1FA 3H9DA 3DQVA 4DBGA 4EUTA 3BINA 2CHZA 4DDGD 4KIKA 4F7ZA 2MSED 3KYDD 3DBRI 1WR6E 1J19A 4AP4C 2KLCA 4OVVA 2PE9A 5KHOA 3UINB 2BKFA 2JRIB 4A3OA 4GDLA 4CO7A 2KMCA 2MWSB 1S1QB 2ASQA 2ZEQA 2K6QA 1A5RA 1UH6A 3NZUA 3AULA 2L05A 3QHTA 3DBSA 4DWFA 1UELA 4WJOA 4EFOA 3QK0A 2MBOA 1IP9A 2O6VD 2HD5B 3JW0X 3ZO5B 4ICUA 1RAXA 2LD9A 3KVFB 3W1YA 4GGQA 4CHKA 1SGHA 3MJWA 4E71A 3ZRFA 1Z5SB 5DPWA 4LDTB 1V49A 2JZ3B 2K8CA 2RR9A 2C7HA 4EOYA 2ZNVC 1ZGUB 5JHAA 2KN5A 1V2YA 3C0RB 1Q0WB 3ZNHB 4AJYB 3PHXB 2M0XA 4GU2A 1WM2A 2JT4B 4IM0A 1WYWB 3ECIA 1S3SG 4IUMB 1Q1OA 4JL9A 2DHZA 2KFJA 4IW0A 4EZLA 4PS3A 2K8HA 4W9EA 3WIMA 4EZKA 3PREA 3DVNU 4ZDVA 4F8CB 3WALA 2N9EB 1WF9A 5CX3A 2O2VB 5E6NA 1R4NI 4ZRIA 1E8WA 1WGDA 2GBJA 2L7RA 5E6OA 2FCSA 2N9PC 4TUUA 2KWUB 2NCNA 3OJ4B 1J0GA 3HIZA 3QC8B 1YD8U 2IO0B 3VH3B 2LASA 3O65B 5LXIB 3VH4B 3NY5A 2MBBB 1I42A 3V6CB 2KJRA 3ENEA 2J0JA 2LWPA 1WX9A 3TMPB 3SD5A 4G3XB 3A4RA 1WRDB 3PV1A 2CHWA 4KIKB 2Y5BB 2BWES 1RLFA 2LXAA 1AARA 2C7NB 3KH0A 4LDTD 2ZVOA 4W9HA 1YJ1A 3ZNZB 4B9KA 4GDLB 3QJZA 4GMVA 2MCNB 2JRHA 5AZGA 4W9FA 4ANXA 4K81A 2FIFA 2KWCA 4M8MA 4FJZA 3ML8A 4FHJA 4NJ6A 2J0KA 1T0YA 5L95C 4TKNA 1P0RA 3SU8X 2IZVB 3RD2A 2FCMA 1TGZB 1XT9B 1E8XA 2DX5B 3A9JA 3X23A 3APCA 3HHMA 4NPNA 3RUIB 5EDSA 3U7DA 1Z2MA 3QQ8B 2KDIA 2AL6A 2DZKA 2KQSA 1H4RA 1WR1A 2PJHA 3UGBB 2LI5A 3W1SA 4MSMB 3U30A 1L7YA 4A20A 3L10B 1ZW7A 4HPLB 3ZVVA 4K1RB 2JXXA 4HCNB 3V61A 4HXDA 4K7SA 4DDID 4MELA 4XX5A 3WA0A 3EC8A 5LLIA 2NBUA 3Q3FA 3RZFA 4AJWA 1WIAA 2KNBA 3JYUA 3N3KB 3APDA 2BF8B 1Y8RC 1XQQA 4PYUA 3R3MA
chains in the Genus database with same CATH superfamily
1YQBA 3A9KA 4JWUC 3ZNID 3A1QA 3ABVB 1GC7A 1QKZA 3M63B 3VUWA 1MG4A 3CSFA 1F52A 4WJNA 4TQ0A 2WDRB 1C76A 5G55A 4KZ0A 3NS1A 3TL5A 2WX0A 1IBXB 2B76B 2N9XA 3V60A 2LVOA 4JWSC 4IKGA 4GLSC 2FUG1 4O1NA 2D2QA 4E3CA 4ASWC 2Z59B 1KFYB 2KANA 5I4DA 1UD7A 2B3AA 2K9XA 3OAWA 3IG3A 1WGRA 3L08A 5J18A 2ZW0A 2ACZB 2KVRA 3ZXRA 2DZJA 3NJTA 3GZNI 1YN4A 1KF6B 2NVUI 4ANWA 3IT4B 4WH4A 3ZJTA 1PQSA 2PEAA 3VUXA 5IA7A 3A9KB 3RNEC 1T5XD 2IYDB 2PE6B 1LQBA 3A1QB 4HPPA 4LNKA 3PS6A 2PPHA 3Q3NC 5AUKA 4P7IA 3U4EG 2I1KA 4JE3B 2KKCA 4G50A 3GB1A 5AEKB 2MQJA 5JZEB 5BMGA 3VUYA 4GSWA 3IBEA 2W3SA 1BMLC 5BYRA 2KVZA 3KWLA 2DYBA 2VRRB 2G4SA 4FA6A 2LGXA 3R7RA 1TJEA 1M94A 1HTOA 4P1BC 1K53A 1QZEA 4MGYE 2LGSA 4EEWA 2D3GA 2N7EA 3RNCC 3H1UA 1WJUA 1U4AA 4REZA 1YOVB 2D3AA 3KWVA 1V86A 3E56A 1P1AA 2K22A 1KJTA 2IO2B 3DBHB 1VZ6A 1JWAD 5IOIA 4XDCA 1HQRD 4DHZB 2BVCA 4AQ7A 1J7AA 4BOSC 1V81A 3A33B 1SB3C 4YSXB 4YTPB 3RZWC 3QAQA 4M01A 3WAMA 1I35A 3J9CA 1E7VA 1AN8A 4J3OD 3B08A 1HZ5A 5AZHA 2C60A 2OOBB 3N1ZC 1N5WA 3JSVA 1CK1A 1ZDXA 2IGGA 2FUHB 2ZCBA 2ZZPB 1P9DU 2WP9B 4ZRKA 2LXCA 2V3SA 2INCC 4C7ZA 4AUQC 1XLQA 1JRUA 3HM6X 1WZ3A 1TY2A 4FHKA 4GB9A 2BYVE 1YX6B 1XO3A 2IY1B 4W9JA 2KQ4X 4NJ7A 5JHBA 3OWEB 5FR3A 3AECB 2IY0B 1QOAA 2CU3A 4BZAA 1C77A 1Q10A 3DDCB 3LB8C 2BYEA 4MM3A 2KZRA 3APFA 1MFWA 2KDBA 3SFDB 4DHZE 2NBVB 1WJ4A 3IVFA 4PS8A 3U8ZA 1K52A 2QDFA 4M8NA 3PRPB 1ENFA 3DHGC 1C4AA 1UGMA 2KHWB 2J0MA 5J2RA 5DPSA 3R66C 2KXJA 1XLOA 1WWTA 4WIPA 3JSVB 2KN4A 2NMQA 1F77A 3HK0A 2NR2A 2I2YA 1JWBD 3D32A 4ZRQA 1WGHA 4KGSA 4N9F4 2CR5A 1I7HA 2WQYB 4TV3A 1L0YB 4YL8A 3C19A 4JX1C 2D07B 1FRRA 4K7UA 2AWTA 2LJ5A 1E10A 2Z0DB 3RCZA 3EHVA 1XCQL 3DWMA 4HLEA 4MM3B 3SHQA 3P4PB 1LFDA 1CMXB 3Q3MC 5E6JA 3NVWA 2K39A 1GG3A 3Q8CA 3TCAA 2BT6A 1YNTE 4JPSA 3P4RB 2L83A 3P63A 1UBIA 3PTFC 1XLPA 3DBHI 4HDQA 3M3JA 2JWZA 4GIVA 2V4IB 1I4XA 3UIOB 4EKUA 3EUB2 5EE0A 4G0NB 4P1CC 1OQQA 4OW0A 4RGNA 3BK1A 2QCZA 2N7DA 2J7QB 2K1FA 3H9DA 4RFBA 3BINA 2CHZA 1WR6E 1FCCC 1EM7A 2KLCA 1JMLA 5KHOA 3UINB 1VLBA 2BKFA 1KLUD 3LXFA 1S1QB 2HJ1A 2K6QA 2JWUA 3NZUA 4RNAA 1FFUA 2L05A 1ZUD2 3QHTA 4USAA 1UELA 4EFOA 3FC4A 4ICUA 4K3BA 4WURA 2KDMA 4GGQA 4NAMA 1JROA 1SGHA 3GS2A 1R4MB 1V49A 2JZ3B 2K8CA 2ZNVC 3P1MA 1RM6C 4AJYB 4GU2A 1WM2A 2JT4B 4EZLA 1FIQA 4W9EA 3DVNU 3TUOA 1WF9A 4ZHOA 1E8WA 1WGDA 2N9PC 5FKAC 1J0GA 3HIZA 3VH3B 2PMVA 3VH4B 2QEJC 3VR8B 3V6CB 3FAHA 2LWPA 1WX9A 4G3XB 3A4RA 2BS3B 4IDIA 5HG2A 2Y5BB 4ARIA 2BWES 2LXAA 2C7NB 1VDVA 3KH0A 2BS2B 3ZNZB 4B9KA 4GMVA 4EE2A 1E6EB 5AZGA 2VH1A 4K81A 2WGSA 4FJZA 4FHJA 2J0KA 2K0PA 2IZVB 1ZP0B 2FCMA 1F2RI 4XE0A 3DHHC 3RUIB 2INNE 2KDIA 1H4RA 2N0SB 1MVKA 4MSMB 4A20A 1ZW7A 3ZVVA 4K7SA 4UDUC 2GLSA 3WA0A 3EC8A 3C8YA 2NBUA 1YN3A 3RZFA 3APDA 2WXQA 2G9HD 4PYUA 3R3MA 1N60A 1BT0A 2RGFA 3PHWB 2ZJDA 3MHZA 2WDVB 1EU3A 3AEAB 1EO6A 1TIFA 4C80A 4ANUA 1D3ZA 1WM3A 2XEWA 2XK5A 2MBQA 2CJNA 3P2BA 4M0WB 4A9AA 1D6EC 3GZNB 4NQKE 3MC0B 3VTUA 2X8XX 4HVBA 1JWUD 4K7WA 1YMHE 1VCBA 3VR9B 2J42A 1SE2A 2KAJA 4MGKE 1YIWA 3EGRA 1GC6A 3AU5A 3TJPA 3VXWA 5L83A 1C3TA 5H92C 3TEWA 2Y3AA 1L2NA 3ZJVA 3VVWB 1A70A 2AX5A 3OG5A 2LJIA 4N59A 1KM7A 1L0VB 2G1EA 1TZ1A 3MP9A 2MW5A 1C4PA 3ZQ4A 5EE9A 4BKSA 4DXGA 5J17A 2INDC 4AS1A 3NUHB 1WXSA 3RULA 3W5UB 1C79A 4HK2A 4MSQB 1R4MI 3ZUNA 2H88B 4A55A 2CKHB 3CMMB 2ZPYA 5BO4B 2XK5B 5KHQA 3NVYA 3OJ3A 2XN9C 1HEZE 1N63A 3M95A 2LGDA 3JVZX 3KYCD 1STEA 3KW5B 4HJKA 2HJ8A 1WJ6A 5FR6A 4DK5A 3GE3C 3AE4B 2PW9A 4N6EB 1FEHA 4BFRA 2KWDA 2FAZA 1K51A 3RT3B 2JPHA 3T3OA 3WAPA 3NVVA 4MGIE 2MH7A 2YEPB 2RMMA 2GI9A 2KTRA 4RGTA 4MH0E 1QT9A 3PT2B 3B2FA 3V05A 4W9DA 2EKIA 3AU4A 4A6QA 4LNFA 3L13A 3N1XC 5HI1A 1WXVA 2RDBC 4HEA1 4JLCA 2MBHA 1L0XB 1WMHA 2WX1A 4KDLB 1WSPA 2M8SA 2WXHA 2JVCA 2DZMA 4IG7B 3ZGZA 3DWGC 2Y5PA 2RPVA 3AE2B 2LEKA 3H7SA 1VR9A 2IO1B 4L1BA 2GMIC 1SJHD 2TSSA 5TR5A 4FBJB 4WJPA 4F1SA 1V80A 3DCGA 2IO3B 4CQNA 3QX1A 3BY4B 4YTNB 2KTRB 2MP2A 1PYWD 1XF5L 4JIOU 2CU1A 3W1SC 3HVZA 1C78A 2KJ6A 2DYOA 3H7PA 3Q6BA 4B0EA 1JRPA 4P16A 4BKGA 4XC2A 4A90A 4BKTA 3Q2AC 4BAXA 2N1WA 2LMCA 5JXVA 2WU5B 3PGEA 3SDLC 1GPXA 3WAOA 3U2SC 4MGZE 1WMHB 2L00B 3EA6A 2G4DB 4GXBA 2KWVB 3DVGY 2UYZB 2HE7A 2MJEA 3TSSA 2M4NA 1OQYA 3B0AA 3W9CB 1I4GA 4GDKA 1TKGA 4IWPA 3VHTC 2FCNA 3WCQA 2DAFA 2KDFB 1FMAD 2MHJA 2L8JA 4TSSA 2EKEC 3WANA 2PLPA 3K9OB 1KRHA 1JWSD 2MP2B 2KMMA 2MRPA 2NBWB 4TMAB 5DPRA 3H7PB 4BVUC 4MACA 1SIFA 2WDQB 1WX7A 2FIDA 3CF6E 1XLNA 3DOWA 1J7CA 4TQ1A 5LXHA 2KMAA 4NY0A 4RM8A 3IFWB 1WX8A 2MA9B 1EWYC 1L5PA 1ISNA 2KX0A 2PIAA 2WXFA 1E7UA 1LM8B 1TKYA 4RMAA 2VH2A 1OQRA 4GDKB 5EE1A 1B1ZA 2BTEA 1L6UA 4KDIC 1N6ZA 1V5OA 4BBNC 3AMZA 1ZPSA 3L16A 2O2VA 4XZ4A 4R3DA 1IYFA 4LJPB 5CHFA 4RM9A 1T6BX 2MBEA 2EELA 2N1VA 5EE3A 4MEMA 4FJYA 2MLBA 1I4QA 2FBWB 2LHEA 3DQVA 2K3UA 1HA5A 2D3BA 4KIKA 4F7ZA 2MSED 1FNWA 3KYDD 1J19A 3R2TA 4AP4C 4OVVA 4CO7A 2MWSB 3HUIA 4DWFA 4WJOA 2IDYA 1IP9A 5IKCM 1RAXA 5TSSA 2QJLA 3ZRFA 1SBBB 2JZPA 4EOYA 5JHAA 2KN5A 3C0RB 1Q0WB 1IGDA 3ZNHB 2V0GA 4IM0A 1S3SG 5D3DA 1Q1OA 4IW0A 3FILA 4EZKA 1PDXA 4ZDVA 2W3RA 4HKQA 2N9EB 1BUIC 2O2VB 5E6NA 3SR6A 2FCSA 3URYA 2WLBA 2NCNA 1DGJA 3QC8B 3TEYA 2LASA 5GXGB 2MBBB 1F2RC 1I42A 2KJRA 3ENEA 4C56C 3TMPB 3O13A 3AE7B 3SD5A 3PV1A 2ICIA 4KIKB 1QOFA 1QF6A 2NTTA 2WXNA 2WXMA 2MCNB 2XNAC 2L32A 2FIFA 4XWTA 4M8MA 2GB1A 5D3IB 3SU8X 1CZPA 3RD2A 2OHFA 1AYFA 3APCA 2V3NA 5EDSA 4LLGM 2JYTA 3U7DA 2AL6A 1WR1A 3L10B 4HCNB 1F1HA 4HXDA 3FILB 3RNAC 3DHIC 5LLIA 2AQ3B 3Q3FA 3BWUD 3PZ8A 4AJWA 1NEKB 3N3KB 2LFIA 1Y8RC 1P3QU 2N9LA 1V5TA 3IAM1 4WJQA 2BWFA 3BZDB 5C23A 3AV8A 3CSTA 2FNJB 2M17A 4P6VF 1KLVA 2WXKA 4J6IA 4WWNA 1ET9A 1F9JA 1P7FA 1R7SA 3L17A 1WGYA 4YXDB 1T0RC 3AE5B 2E3TA 1NDDA 4BBNF 4EZJA 3ZTDA 3Q3OC 3PZDA 2WXRA 4IWQA 1T3QA 1TY0A 1WRIA 2BKRB 2KC2A 1T0SC 2NPTA 3L54A 2V1YA 4IWOA 1AW7A 1E8YA 1UF0A 2JX5A 2D3CA 3VRAB 5D2MB 3ZKJC 1WE7A 2MJ3A 2N4FA 2AL3A 2YVCA 3NZSA 4ZRJA 5DPTA 1FCLA 2ZVNA 3MC9A 3VFKA 1DOXA 4LNOA 5IO9A 3T8MA 4FXCA 3MJ5A 3AEFB 1TYGB 1WI0A 3N1YC 2BGFA 1MHHE 3AEBB 1UNSA 4WWPA 2FCQA 2KLGA 3SFEB 1QILA 1NYRA 3ML9A 3FKYA 1VRAB 1E7PB 2KFKA 5AZFA 4ZYNA 4JQWC 1J7BA 2C9WB 4XDDA 3VDZA 4M0WA 1K8RB 2A5UA 4IM3A 2GBKA 3AM9A 1JALA 2NPTB 4YSZB 1DYQA 2G3QB 1WZ0A 4URKA 4BOZB 3NS8A 3RPFC 5D7GA 2JUOA 3ZDTA 3LDZE 2WNMA 4OZCA 2JSVX 2K5PA 4WQMA 1SF0A 3TBLD 4II3B 2L76A 1MJDA 4HKZE 1HXYD 1RWSA 3B2GA 3K9PB 2WS3B 3QA8A 3U52E 2J4XA 1V8CA 3I3TB 1LO5D 3Q8BA 2KX3A 1FD6A 2AYOB 3R2IA 4I6LB 1WGGA 3NRZA 4GOCA 1SXTA 1V1PA 3V3XA 4KV2A 2WXGA 1PFDA 3B1LX 2D5GA 1FXIA 2LVQA 5IP4D 2JZZA 1KOTA 5HKHA 4S0RA 1FFVA 2KO3A 3DBRB 1WYGA 2KFKB 2XBBC 3KUZA 3NVZA 2CS4A 2D11A 2WXIA 3V6EB 4W9LA 1B9RA 2K25A 2BYFA 1GNUA 1V9JA 2K8BA 4FN2A 1UWMA 1ZXIA 2DWQA 1MG8A 3M62B 2DYMA 2AEHA 2REXA 2VZKB 2KTFA 2SAKA 3N30A 2JF5A 3ZTCA 3A4SC 3Q3JA 3KLSX 1D4BA 4WWMA 5CTRC 2IPKD 1C4CA 1RYJA 5G2NA 5C1ZA 3BVGA 1ZXHA 1TS5A 1NBFC 4US9A 1UBQA 1FM0D 2KYWA 4II2B 1TS3A 3UF8A 1V1PB 4NJCA 2L1AA 4RGMA 3ONSA 3MHSD 5GMVA 1RRBA 4XYCA 1Y56A 2AQ2B 1IGCA 3BVMA 2D10A 2O6VA 1TBEA 2WDTB 4G11A 3AEDB 2INPE 3R8BA 3MFGA 1D5XC 3PRMB 3HRDD 2KQ7A 2LGYA 2Z0EB 2BBCA 4YTMB 4OVUA 2ZW1A 4KSLC 4HDOA 4LJOB 4OZAA 1SJED 4PT5A 4PYZA 3KUCB 1Q5WB 3LYYA 1SE4A 4KGTA 3KQ4A 3PRZA 2N9KA 1N5XA 1SIJA 1EF1A 2CJOA 2GBMA 2WWZA 1GAQB 3CIRB 5CHWA 3Q8FA 1E0ZA 3VTWA 2QSDA 1VZ8A 1WJNA 3VAWA 4W9GA 3RI7C 3AI5A 3AE3B 1KLGD 2BPSA 1XEEA 4B0MA 4YT0B 3BYYB 4D2KA 4IOIE 1J8CA 2O6VB 2WYQA 1D5MC 2JY6A 4A3PA 1L4ZB 5D6JB 3ZRCA 1G6JA 1TS4A 2E6XA 1PGAA 2DZIA 4BKSD 4XGAB 3V62A 3AB5A 2JYEA 1NENB 5G5GA 3H8HA 4DDGD 4M00A 1ESFA 3DBRI 3RNGC 2PE9A 1YJJA 1SSNA 4M02A 2KMCA 2ASQA 3RN9C 4ACFA 1A5RA 1UH6A 4WAFA 3AULA 5MPOA 2QC8A 3DBSA 2O6VD 2HD5B 3KVFB 1UGJA 1ZOYB 3RFZB 2RDGA 1F0ZA 3W2DA 1Z5SB 4RCOA 2C7HA 2UU7A 3AE6B 4KX6B 1WYWB 3ECIA 4JL9A 2DHZA 4PS3A 2K8HA 3WIMA 3PREA 2BB6A 2BB5A 3WALA 2OJWA 1FRDA 2W82A 2FE8A 4TUUA 2IGHA 4OVZA 2IO0B 3O65B 3BVZA 4ZYSA 2J0JA 4H2AA 1FO4A 1RLFA 2PVGC 2MEKA 2ZVOA 1YJ1A 3AE8B 3QJZA 2JRHA 4W9FA 4ANXA 2J52A 2R61A 1MPEA 2BW2A 4NJ6A 1T0YA 5L95C 4TKNA 2WXJA 2YEPF 1TGZB 1XT9B 1E8XA 3A9JA 3X23A 3B9JA 3HHMA 4NPNA 4Q2JA 1Z2MA 2KQSA 2DZKA 5FK9C 1VZ7A 3UGBB 5AUIA 3NZ3A 3U30A 3AEEB 4HPLB 4K1RB 2DLBA 2JXXA 3V61A 2J53A 4DDID 5LNK1 3JYUA 3AH7A 1FPYA 1QLBB 2BF8B 1KTKA 4JGHB 1GB1A 2LRUA 2IJ0A 1OFFA 1L6VA 4LCDE 2BQQA 2I1JA 4L23A 3GOEA 1SEBD 4ICVA 4KZCA 1JCKB 3P4QB 2LHDA 3S2AA 3ZIMA 1P98A 4I6NB 1DOIA 2KJHB 4ZOHC 3AE9B 2LUEA 5G5HA 4N58A 2M0AA 4S17A 1ZE3D 4DQOC 5D94A 2KDEB 4C4VA 1K50A 4RF0A 1SE3A 2GBNA 4PS7A 4WQOB 3A9JB 2I38A 3EECA 2ZCCA 1UZXB 1CJEA 1EUVB 1EU4A 2A4ZA 5CHVC 1T0QC 3U7ZA 1FXTB 2W9NA 4OHJA 2RSUA 4IM2A 4LNNA 1IUEA 3X0WA 3RYTA 4X57B 5HHDG 1NVID 1VJKA 2L3ZA 4HCPB 1X1MA 1OEYA 4HROA 2KD0A 3QCAA 2WXLA 4YSYB 3Q8AA 1E8ZA 1WXAA 4W9IA 4ANVA 3PSEB 2OEDA 2R2QA 2DENB 1MI0A 3LJ3A 3QWZB 3DBLB 1WFYA 3AEGB 4ITKA 3P4SB 4LK0M 1SE9A 1UUPA 4C4VB 3NOBA 2HTHA 3Q14C 4RGOS 3L0WB 3R7QA 3SEBA 2G45B 4FULA 2Y5CA 3N20C 3MC8A 4AOFA 2YLMA 3QARA 2UWQA 1V6EA 1EF5A 1XXGA 4PK1A 1XD3B 1TTNA 3IAS1 1C9FA 5BYSA 1HZ6A 2LRWA 3UIPB 3ALBA 3VQIA 1ZDVA 4RH6A 1KH0A 2V9HA 1E90A 3UQBA 2GBRA 1V1OA 4XWWA 2C7MB 1MHXA 1PGXA 1AWDA 2KACA 1N61A 3NHEB 3PLUA 3DVNV 5HFYA 1GUAB 2EMSA 1WH3A 2DNFA 1PGBA 3IT6B 1I4HA 2H89B 2Q5WD 1FXAA 3AN1A 3TEXA 2IBIB 2R2OA 3P42A 3TIXA 3VRBB 2QIEB 2BYTA 2PVOD 4W9CA 3ZW3A 2L0FA 2Z8LA 5C2TB 4ARCA 4MT5A 2L52A 2M56B 3VTVA 2RPQA 3ZJUA 4IC7B 1UWXA 2K6DB 3DVGX 4WAAA 3UI3A 4C00A 3I5JC 5T8IA 5JH5C 2KT7A 3T9LA 3IHPC 1YX5B 3ZXVA 3HM3A 4HWIB 4B6WA 1GOZA 4ZRPA 5BMIA 1YN5A 2CHXA 4E74A 1RFAA 2KC1A 3N32A 1TKEA 4A8XC 4DHJB 1WY8A 1C1YB 1VD2A 3Q8EA 1D5ZC 5C3JB 5E6PA 3I9V1 4NZLB 1HTQA 1R4NB 2JXTA 3MTNB 2WU2B 4NQLB 4NNJB 4GN1A 4I6PA 2C5LC 2W54A 3IXSA 5DCNA 2JQRB 2ZNVB 3BIID 1E9MA 2EMTA 4OZBA 2KK8A 2RD0A 4MDKE 4RF1A 4NAWA 1TS2A 4DXAB 3GE8C 1JWMD 4MJSA 4AWJA 1OGWA 1YJIA 1GB4A 3CWIA 4FADA 4DHJD 1OEYJ 1OTRB 1NI3A 1QOBA 3I57A 3EFCA 5IAAC 2ONQA 4KKIA 3ZDMC 2OJRA 2PKOA 1H8CA 4KSKC 3PZ7A 1TZOA 3HVDA 2NS5A 1WE6A 2SEBD 2M1MA 2LGIA 3PPAA 3DBLI 3ZNGC 3UQAA 3KUDB 4K3CA 2AQ1B 4DXFA 1I4PA 4HJGE 1P7EA 1ACCA 1IPGA 1GJZA 4WWOA 2WXOA 4FLHA 3ZYYX 2KOXA 2LVPA 2WXPA 3RMKC 4LTUA 1LXDA 2JU6X 4FJVB 4B95A 2W55A 2LZ6A 2GOWA 1XCTL 3OLMD 3AE1B 1FNUA 4KVGB 2NTSA 1WXMA 1HE8A 2ZPNA 3PLVA 1I4RA 1JW9D 4NAWB 4W9KA 2MJDA 3EFUA 4MJSB 1M4VA 3ZLZA 2DAJA 2V3PA 1NI2A 4CYEA 1ZKHA 3PVLA 2L0TA 2QHOA 4KKJA 4HPMB 3T3NA 1RFKA 1LGRA 2MX2A 2V4LA 3H6NA 3AXCA 4ZHPA 3DPDA 3QIJA 2M19A 4HRSA 1E5WA 3RNBC 4EUTA 4DBGA 1BXTA 3RNFC 1TT5B 1NYQA 2LUMA 1EWCA 2X38A 2JRIB 4A3OA 4GDLA 3L4PA 2ZEQA 4KGRA 3W5VB 2BS4B 3BYTB 2ON8A 3QK0A 2MBOA 3JW0X 1WGKA 3ZO5B 2LD9A 3W1YA 4CHKA 3MJWA 5H8YE 1DOYA 4E71A 4MH8A 5DPWA 3NG0A 4LDTB 5BYQA 4LNIA 2RR9A 1ZGUB 1V2YA 2PTLA 3PHXB 2M0XA 5BMHA 2VZKD 2RDHA 2GRIA 4IUMB 4YWGG 2KFJA 2WHIA 4F8CB 5CX3A 1R4NI 3E9SA 2GBJA 3GP7A 2L7RA 4ZRIA 5E6OA 2KWUB 3OJ4B 4US8A 2HDEA 2N7JA 4C7YA 1YD8U 5LXIB 3NY5A 1N62A 1YQ4B 4L2YA 1WRDB 2CHWA 3N9YC 3TEZA 1WXQA 1AARA 4LDTD 4W9HA 2DBYA 3Q69A 4GDLB 3BK2A 2KWCA 1IBXA 3PO0A 3ML8A 2QILA 1P0RA 1QOGA 1ROEA 2DX5B 1L4DB 3QQ8B 1YQ3B 1CQVA 2PJHA 1FNVA 2HTME 2LI5A 3W1SA 1L7YA 2IGDA 4QAYA 1ET6A 1QQRA 3ETRA 1PUTA 1JQ4A 4MELA 1V97A 4XX5A 5IN7A 1WIAA 2KNBA 3I63C 2QMTA 1XQQA
chains in the Genus database with same CATH topology
1YQBA 3A9KA 3ZNID 4JGHB 1BT0A 1P3QU 2RGFA 3PHWB 3A1QA 1V5TA 2LRUA 2ZJDA 4WJQA 4LCDE 2BWFA 1GC7A 5C23A 3CSTA 2I1JA 2FNJB 1EO6A 2M17A 3GOEA 4ICVA 1KLVA 4KZCA 3M63B 4ANUA 1D3ZA 4J6IA 4WWNA 3VUWA 1F9JA 1WM3A 3S2AA 3L17A 3ZIMA 1WGYA 3CSFA 2XEWA 4WJNA 4TQ0A 1P98A 4I6NB 1NDDA 4BBNF 2KJHB 2XK5A 5G55A 2MBQA 4KZ0A 2LUEA 3P2BA 4M0WB 4EZJA 3TL5A 3ZTDA 3PZDA 4IWQA 4NQKE 2KDEB 2WX0A 5D94A 3VTUA 4HVBA 2N9XA 4K7WA 3V60A 2LVOA 2BKRB 2KC2A 1VCBA 2GBNA 4PS7A 2NPTA 3L54A 2V1YA 2D2QA 4IWOA 4E3CA 4WQOB 4ASWC 1E8YA 2Z59B 3A9JB 4MGKE 1YIWA 2KANA 3EECA 1UD7A 2ZCCA 5D2MB 1UZXB 2B3AA 3ZKJC 1GC6A 3OAWA 1WE7A 3AU5A 1WGRA 2N4FA 3IG3A 2AL3A 1EUVB 2YVCA 3L08A 5J18A 2A4ZA 2KVRA 3TJPA 2DZJA 3NZSA 3VXWA 5L83A 5CHVC 1C3TA 3GZNI 1FXTB 4ZRJA 2W9NA 2RSUA 2NVUI 4IM2A 4ANWA 3X0WA 1L2NA 1PQSA 5DPTA 3RYTA 3VVWB 4X57B 2PEAA 1KM7A 2L3ZA 2ZVNA 4HCPB 3VFKA 3VUXA 1X1MA 1OEYA 3A9KB 5IA7A 1TZ1A 2KD0A 2IYDB 2MW5A 3T8MA 3QCAA 2PE6B 1LQBA 4BKSA 3A1QB 3PS6A 5J17A 2PPHA 1WXSA 3RULA 1E8ZA 1WXAA 4HK2A 4W9IA 1WI0A 4ANVA 4MSQB 2BGFA 1R4MI 4P7IA 3ZUNA 3PSEB 2CKHB 3CMMB 4WWPA 2I1KA 2FCQA 2ZPYA 2KLGA 5BO4B 2R2QA 2XK5B 5KHQA 2DENB 3LJ3A 3QWZB 3ML9A 3OJ3A 2KKCA 4G50A 1WFYA 3M95A 2LGDA 3JVZX 3KYCD 5AEKB 2MQJA 5JZEB 5AZFA 2KFKA 3KW5B 4HJKA 4JQWC 1SE9A 2HJ8A 4ZYNA 3VUYA 4GSWA 1WJ6A 5FR6A 2C9WB 4DK5A 3NOBA 3IBEA 3VDZA 2HTHA 1K8RB 2A5UA 4IM3A 2GBKA 2DYBA 2VRRB 2G4SA 2NPTB 3L0WB 3R7QA 4FA6A 2LGXA 4BFRA 2G45B 3R7RA 2G3QB 4FULA 2FAZA 1WZ0A 3RT3B 1M94A 4URKA 4BOZB 2JPHA 3NS8A 4AOFA 1QZEA 4MGYE 5D7GA 4EEWA 3WAPA 2D3GA 2N7EA 2YLMA 3QARA 2JUOA 4MGIE 2UWQA 2KTRA 3LDZE 1V6EA 3ZDTA 1EF5A 1XD3B 1TTNA 4MH0E 3H1UA 2LRWA 1WJUA 3PT2B 3UIPB 1U4AA 3ALBA 4W9DA 4II3B 3TBLD 3VQIA 1V86A 2L76A 3AU4A 3L13A 1E90A 1P1AA 3UQBA 1WXVA 2GBRA 3K9PB 1KJTA 2IO2B 3QA8A 3I3TB 2C7MB 4JLCA 2MBHA 2KX3A 3NHEB 3PLUA 2AYOB 3DVNV 1GUAB 4I6LB 2EMSA 1WGGA 1WMHA 4DHZB 1WH3A 2WX1A 4GOCA 4KDLB 2M8SA 2JVCA 2DZMA 4IG7B 2IBIB 4KV2A 2R2OA 3TIXA 4BOSC 3B1LX 1V81A 3A33B 2LVQA 2JZZA 1KOTA 3H7SA 3RZWC 3QAQA 5HKHA 2KO3A 4W9CA 3ZW3A 2L0FA 2IO1B 2KFKB 3WAMA 2XBBC 2GMIC 1I35A 3KUZA 5TR5A 4FBJB 3VTVA 2CS4A 1E7VA 2D11A 2RPQA 3V6EB 4WJPA 3B08A 4W9LA 4IC7B 5AZHA 4F1SA 2K25A 2C60A 2BYFA 1V80A 2OOBB 1GNUA 3DCGA 2K6DB 3DVGX 1V9JA 2K8BA 4WAAA 4FN2A 3JSVA 2IO3B 5JH5C 1MG8A 3QX1A 3M62B 3T9LA 3IHPC 2DYMA 3BY4B 2FUHB 2ZCBA 2ZZPB 2AEHA 1YX5B 2REXA 1P9DU 2KTRB 2MP2A 3HM3A 4HWIB 4B6WA 4ZRKA 2LXCA 2V3SA 4JIOU 2CU1A 2CHXA 4E74A 2KTFA 4AUQC 1JRUA 3W1SC 2KJ6A 1RFAA 1WZ3A 2KC1A 2DYOA 2JF5A 3H7PA 3HM6X 3A4SC 3N32A 4FHKA 3ZTCA 4GB9A 2BYVE 4BKGA 4XC2A 4DHJB 1YX6B 1WY8A 3Q3JA 1C1YB 1VD2A 4BKTA 5CTRC 2N1WA 2IY1B 4W9JA 5G2NA 5E6PA 4NJ7A 3PGEA 5C1ZA 5JHBA 3SDLC 2IY0B 1NBFC 3WAOA 1UBQA 4MGZE 1WMHB 4II2B 3MTNB 3DDCB 2L00B 4NQLB 2BYEA 4NNJB 2G4DB 4MM3A 3UF8A 2KZRA 2KWVB 4GN1A 4GXBA 3DVGY 4I6PA 3APFA 2C5LC 2KDBA 4DHZE 2UYZB 5DCNA 2NBVB 2ZNVB 2HE7A 1WJ4A 3IVFA 4PS8A 3ONSA 3MHSD 2EMTA 3U8ZA 2KK8A 2RD0A 4MDKE 4M8NA 3PRPB 5GMVA 4NAWA 1RRBA 2M4NA 4DXAB 4MJSA 1UGMA 4AWJA 1OQYA 3B0AA 2KHWB 2J0MA 1OGWA 4FADA 5J2RA 4GDKA 4DHJD 1OEYJ 4IWPA 1OTRB 5DPSA 3R66C 3VHTC 2FCNA 2KXJA 2D10A 5IAAC 2O6VA 1TBEA 2DAFA 2KDFB 3ZDMC 2WDTB 3JSVB 2L8JA 2OJRA 4G11A 2EKEC 3WANA 3K9OB 1H8CA 3HK0A 2NR2A 2MP2B 4KSKC 3PRMB 2MRPA 2NBWB 2KQ7A 2NS5A 1WE6A 3D32A 2LGYA 1WGHA 2Z0EB 5DPRA 2M1MA 2CR5A 4N9F4 3H7PB 4OVUA 3PPAA 3DBLI 3ZNGC 4BVUC 4TV3A 3UQAA 4YL8A 3KUDB 1SIFA 4KSLC 4HDOA 4LJOB 2D07B 4PYZA 3KUCB 1WX7A 1IPGA 1GJZA 1Q5WB 2FIDA 3CF6E 4K7UA 2AWTA 4WWOA 2LJ5A 4FLHA 3DOWA 3PRZA 2Z0DB 2KOXA 3RCZA 3EHVA 2LVPA 4TQ1A 5LXHA 2KMAA 4HLEA 1EF1A 4NY0A 4RM8A 1LXDA 3IFWB 3SHQA 1WX8A 2MA9B 2GBMA 2WWZA 4FJVB 1LFDA 4B95A 5CHWA 2LZ6A 1ISNA 2GOWA 2KX0A 3OLMD 1CMXB 3VTWA 2K39A 4KVGB 1WJNA 3VAWA 1WXMA 4W9GA 1HE8A 2ZPNA 3AI5A 3PLVA 4NAWB 1E7UA 4W9KA 2BPSA 1LM8B 1GG3A 3EFUA 4MJSB 4RMAA 3TCAA 4GDKB 3ZLZA 2DAJA 1NI2A 4CYEA 1UBIA 3PTFC 1ZKHA 1J8CA 3PVLA 4KDIC 3DBHI 1V5OA 2O6VB 4HDQA 4BBNC 2WYQA 2L0TA 2QHOA 2O2VA 3L16A 2JY6A 3M3JA 4XZ4A 4A3PA 1IYFA 5D6JB 3ZRCA 1G6JA 2JWZA 4GIVA 4HPMB 4LJPB 5CHFA 4RM9A 2MX2A 3N30A 3UIOB 4EKUA 2V4LA 2MBEA 2N1VA 4G0NB 2DZIA 3H6NA 4MEMA 4FJYA 4BKSD 2MLBA 3AXCA 3V62A 3DPDA 3QIJA 1E5WA 2N7DA 2J7QB 2K1FA 3H9DA 3DQVA 4DBGA 4EUTA 3BINA 2CHZA 4DDGD 4KIKA 4F7ZA 2MSED 3KYDD 3DBRI 1WR6E 1J19A 4AP4C 2KLCA 4OVVA 2PE9A 5KHOA 3UINB 2BKFA 2JRIB 4A3OA 4GDLA 4CO7A 2KMCA 2MWSB 1S1QB 2ASQA 2ZEQA 2K6QA 1A5RA 1UH6A 3NZUA 3AULA 2L05A 3QHTA 3DBSA 4DWFA 1UELA 4WJOA 4EFOA 3QK0A 2MBOA 1IP9A 2O6VD 2HD5B 3JW0X 3ZO5B 4ICUA 1RAXA 2LD9A 3KVFB 3W1YA 4GGQA 4CHKA 1SGHA 3MJWA 4E71A 3ZRFA 1Z5SB 5DPWA 4LDTB 1V49A 2JZ3B 2K8CA 2RR9A 2C7HA 4EOYA 2ZNVC 1ZGUB 5JHAA 2KN5A 1V2YA 3C0RB 1Q0WB 3ZNHB 4AJYB 3PHXB 2M0XA 4GU2A 1WM2A 2JT4B 4IM0A 1WYWB 3ECIA 1S3SG 4IUMB 1Q1OA 4JL9A 2DHZA 2KFJA 4IW0A 4EZLA 4PS3A 2K8HA 4W9EA 3WIMA 4EZKA 3PREA 3DVNU 4ZDVA 4F8CB 3WALA 2N9EB 1WF9A 5CX3A 2O2VB 5E6NA 1R4NI 4ZRIA 1E8WA 1WGDA 2GBJA 2L7RA 5E6OA 2FCSA 2N9PC 4TUUA 2KWUB 2NCNA 3OJ4B 1J0GA 3HIZA 3QC8B 1YD8U 2IO0B 3VH3B 2LASA 3O65B 5LXIB 3VH4B 3NY5A 2MBBB 1I42A 3V6CB 2KJRA 3ENEA 2J0JA 2LWPA 1WX9A 3TMPB 3SD5A 4G3XB 3A4RA 1WRDB 3PV1A 2CHWA 4KIKB 2Y5BB 2BWES 1RLFA 2LXAA 1AARA 2C7NB 3KH0A 4LDTD 2ZVOA 4W9HA 1YJ1A 3ZNZB 4B9KA 4GDLB 3QJZA 4GMVA 2MCNB 2JRHA 5AZGA 4W9FA 4ANXA 4K81A 2FIFA 2KWCA 4M8MA 4FJZA 3ML8A 4FHJA 4NJ6A 2J0KA 1T0YA 5L95C 4TKNA 1P0RA 3SU8X 2IZVB 3RD2A 2FCMA 1TGZB 1XT9B 1E8XA 2DX5B 3A9JA 3X23A 3APCA 3HHMA 4NPNA 3RUIB 5EDSA 3U7DA 1Z2MA 3QQ8B 2KDIA 2AL6A 2DZKA 2KQSA 1H4RA 1WR1A 2PJHA 3UGBB 2LI5A 3W1SA 4MSMB 3U30A 1L7YA 4A20A 3L10B 1ZW7A 4HPLB 3ZVVA 4K1RB 2JXXA 4HCNB 3V61A 4HXDA 4K7SA 4DDID 4MELA 4XX5A 3WA0A 3EC8A 5LLIA 2NBUA 3Q3FA 3RZFA 4AJWA 1WIAA 2KNBA 3JYUA 3N3KB 3APDA 2BF8B 1Y8RC 1XQQA 4PYUA 3R3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQB A;  3A9K A;  3ZNI D;  4JGH B;  1BT0 A;  1P3Q U;  2RGF A;  3PHW B;  3A1Q A;  1V5T A;  2LRU A;  2ZJD A;  4WJQ A;  4LCD E;  2BWF A;  1GC7 A;  5C23 A;  3CST A;  2I1J A;  2FNJ B;  1EO6 A;  2M17 A;  3GOE A;  4ICV A;  1KLV A;  4KZC A;  3M63 B;  4ANU A;  1D3Z A;  4J6I A;  4WWN A;  3VUW A;  1F9J A;  1WM3 A;  3S2A A;  3L17 A;  3ZIM A;  1WGY A;  3CSF A;  2XEW A;  4WJN A;  4TQ0 A;  1P98 A;  4I6N B;  1NDD A;  4BBN F;  2KJH B;  2XK5 A;  5G55 A;  2MBQ A;  4KZ0 A;  2LUE A;  3P2B A;  4M0W B;  4EZJ A;  3TL5 A;  3ZTD A;  3PZD A;  4IWQ A;  4NQK E;  2KDE B;  2WX0 A;  5D94 A;  3VTU A;  4HVB A;  2N9X A;  4K7W A;  3V60 A;  2LVO A;  2BKR B;  2KC2 A;  1VCB A;  2GBN A;  4PS7 A;  2NPT A;  3L54 A;  2V1Y A;  2D2Q A;  4IWO A;  4E3C A;  4WQO B;  4ASW C;  1E8Y A;  2Z59 B;  3A9J B;  4MGK E;  1YIW A;  2KAN A;  3EEC A;  1UD7 A;  2ZCC A;  5D2M B;  1UZX B;  2B3A A;  3ZKJ C;  1GC6 A;  3OAW A;  1WE7 A;  3AU5 A;  1WGR A;  2N4F A;  3IG3 A;  2AL3 A;  1EUV B;  2YVC A;  3L08 A;  5J18 A;  2A4Z A;  2KVR A;  3TJP A;  2DZJ A;  3NZS A;  3VXW A;  5L83 A;  5CHV C;  1C3T A;  3GZN I;  1FXT B;  4ZRJ A;  2W9N A;  2RSU A;  2NVU I;  4IM2 A;  4ANW A;  3X0W A;  1L2N A;  1PQS A;  5DPT A;  3RYT A;  3VVW B;  4X57 B;  2PEA A;  1KM7 A;  2L3Z A;  2ZVN A;  4HCP B;  3VFK A;  3VUX A;  1X1M A;  1OEY A;  3A9K B;  5IA7 A;  1TZ1 A;  2KD0 A;  2IYD B;  2MW5 A;  3T8M A;  3QCA A;  2PE6 B;  1LQB A;  4BKS A;  3A1Q B;  3PS6 A;  5J17 A;  2PPH A;  1WXS A;  3RUL A;  1E8Z A;  1WXA A;  4HK2 A;  4W9I A;  1WI0 A;  4ANV A;  4MSQ B;  2BGF A;  1R4M I;  4P7I A;  3ZUN A;  3PSE B;  2CKH B;  3CMM B;  4WWP A;  2I1K A;  2FCQ A;  2ZPY A;  2KLG A;  5BO4 B;  2R2Q A;  2XK5 B;  5KHQ A;  2DEN B;  3LJ3 A;  3QWZ B;  3ML9 A;  3OJ3 A;  2KKC A;  4G50 A;  1WFY A;  3M95 A;  2LGD A;  3JVZ X;  3KYC D;  5AEK B;  2MQJ A;  5JZE B;  5AZF A;  2KFK A;  3KW5 B;  4HJK A;  4JQW C;  1SE9 A;  2HJ8 A;  4ZYN A;  3VUY A;  4GSW A;  1WJ6 A;  5FR6 A;  2C9W B;  4DK5 A;  3NOB A;  3IBE A;  3VDZ A;  2HTH A;  1K8R B;  2A5U A;  4IM3 A;  2GBK A;  2DYB A;  2VRR B;  2G4S A;  2NPT B;  3L0W B;  3R7Q A;  4FA6 A;  2LGX A;  4BFR A;  2G45 B;  3R7R A;  2G3Q B;  4FUL A;  2FAZ A;  1WZ0 A;  3RT3 B;  1M94 A;  4URK A;  4BOZ B;  2JPH A;  3NS8 A;  4AOF A;  1QZE A;  4MGY E;  5D7G A;  4EEW A;  3WAP A;  2D3G A;  2N7E A;  2YLM A;  3QAR A;  2JUO A;  4MGI E;  2UWQ A;  2KTR A;  3LDZ E;  1V6E A;  3ZDT A;  1EF5 A;  1XD3 B;  1TTN A;  4MH0 E;  3H1U A;  2LRW A;  1WJU A;  3PT2 B;  3UIP B;  1U4A A;  3ALB A;  4W9D A;  4II3 B;  3TBL D;  3VQI A;  1V86 A;  2L76 A;  3AU4 A;  3L13 A;  1E90 A;  1P1A A;  3UQB A;  1WXV A;  2GBR A;  3K9P B;  1KJT A;  2IO2 B;  3QA8 A;  3I3T B;  2C7M B;  4JLC A;  2MBH A;  2KX3 A;  3NHE B;  3PLU A;  2AYO B;  3DVN V;  1GUA B;  4I6L B;  2EMS A;  1WGG A;  1WMH A;  4DHZ B;  1WH3 A;  2WX1 A;  4GOC A;  4KDL B;  2M8S A;  2JVC A;  2DZM A;  4IG7 B;  2IBI B;  4KV2 A;  2R2O A;  3TIX A;  4BOS C;  3B1L X;  1V81 A;  3A33 B;  2LVQ A;  2JZZ A;  1KOT A;  3H7S A;  3RZW C;  3QAQ A;  5HKH A;  2KO3 A;  4W9C A;  3ZW3 A;  2L0F A;  2IO1 B;  2KFK B;  3WAM A;  2XBB C;  2GMI C;  1I35 A;  3KUZ A;  5TR5 A;  4FBJ B;  3VTV A;  2CS4 A;  1E7V A;  2D11 A;  2RPQ A;  3V6E B;  4WJP A;  3B08 A;  4W9L A;  4IC7 B;  5AZH A;  4F1S A;  2K25 A;  2C60 A;  2BYF A;  1V80 A;  2OOB B;  1GNU A;  3DCG A;  2K6D B;  3DVG X;  1V9J A;  2K8B A;  4WAA A;  4FN2 A;  3JSV A;  2IO3 B;  5JH5 C;  1MG8 A;  3QX1 A;  3M62 B;  3T9L A;  3IHP C;  2DYM A;  3BY4 B;  2FUH B;  2ZCB A;  2ZZP B;  2AEH A;  1YX5 B;  2REX A;  1P9D U;  2KTR B;  2MP2 A;  3HM3 A;  4HWI B;  4B6W A;  4ZRK A;  2LXC A;  2V3S A;  4JIO U;  2CU1 A;  2CHX A;  4E74 A;  2KTF A;  4AUQ C;  1JRU A;  3W1S C;  2KJ6 A;  1RFA A;  1WZ3 A;  2KC1 A;  2DYO A;  2JF5 A;  3H7P A;  3HM6 X;  3A4S C;  3N32 A;  4FHK A;  3ZTC A;  4GB9 A;  2BYV E;  4BKG A;  4XC2 A;  4DHJ B;  1YX6 B;  1WY8 A;  3Q3J A;  1C1Y B;  1VD2 A;  4BKT A;  5CTR C;  2N1W A;  2IY1 B;  4W9J A;  5G2N A;  5E6P A;  4NJ7 A;  3PGE A;  5C1Z A;  5JHB A;  3SDL C;  2IY0 B;  1NBF C;  3WAO A;  1UBQ A;  4MGZ E;  1WMH B;  4II2 B;  3MTN B;  3DDC B;  2L00 B;  4NQL B;  2BYE A;  4NNJ B;  2G4D B;  4MM3 A;  3UF8 A;  2KZR A;  2KWV B;  4GN1 A;  4GXB A;  3DVG Y;  4I6P A;  3APF A;  2C5L C;  2KDB A;  4DHZ E;  2UYZ B;  5DCN A;  2NBV B;  2ZNV B;  2HE7 A;  1WJ4 A;  3IVF A;  4PS8 A;  3ONS A;  3MHS D;  2EMT A;  3U8Z A;  2KK8 A;  2RD0 A;  4MDK E;  4M8N A;  3PRP B;  5GMV A;  4NAW A;  1RRB A;  2M4N A;  4DXA B;  4MJS A;  1UGM A;  4AWJ A;  1OQY A;  3B0A A;  2KHW B;  2J0M A;  1OGW A;  4FAD A;  5J2R A;  4GDK A;  4DHJ D;  1OEY J;  4IWP A;  1OTR B;  5DPS A;  3R66 C;  3VHT C;  2FCN A;  2KXJ A;  2D10 A;  5IAA C;  2O6V A;  1TBE A;  2DAF A;  2KDF B;  3ZDM C;  2WDT B;  3JSV B;  2L8J A;  2OJR A;  4G11 A;  2EKE C;  3WAN A;  3K9O B;  1H8C A;  3HK0 A;  2NR2 A;  2MP2 B;  4KSK C;  3PRM B;  2MRP A;  2NBW B;  2KQ7 A;  2NS5 A;  1WE6 A;  3D32 A;  2LGY A;  1WGH A;  2Z0E B;  5DPR A;  2M1M A;  2CR5 A;  4N9F 4;  3H7P B;  4OVU A;  3PPA A;  3DBL I;  3ZNG C;  4BVU C;  4TV3 A;  3UQA A;  4YL8 A;  3KUD B;  1SIF A;  4KSL C;  4HDO A;  4LJO B;  2D07 B;  4PYZ A;  3KUC B;  1WX7 A;  1IPG A;  1GJZ A;  1Q5W B;  2FID A;  3CF6 E;  4K7U A;  2AWT A;  4WWO A;  2LJ5 A;  4FLH A;  3DOW A;  3PRZ A;  2Z0D B;  2KOX A;  3RCZ A;  3EHV A;  2LVP A;  4TQ1 A;  5LXH A;  2KMA A;  4HLE A;  1EF1 A;  4NY0 A;  4RM8 A;  1LXD A;  3IFW B;  3SHQ A;  1WX8 A;  2MA9 B;  2GBM A;  2WWZ A;  4FJV B;  1LFD A;  4B95 A;  5CHW A;  2LZ6 A;  1ISN A;  2GOW A;  2KX0 A;  3OLM D;  1CMX B;  3VTW A;  2K39 A;  4KVG B;  1WJN A;  3VAW A;  1WXM A;  4W9G A;  1HE8 A;  2ZPN A;  3AI5 A;  3PLV A;  4NAW B;  1E7U A;  4W9K A;  2BPS A;  1LM8 B;  1GG3 A;  3EFU A;  4MJS B;  4RMA A;  3TCA A;  4GDK B;  3ZLZ A;  2DAJ A;  1NI2 A;  4CYE A;  1UBI A;  3PTF C;  1ZKH A;  1J8C A;  3PVL A;  4KDI C;  3DBH I;  1V5O A;  2O6V B;  4HDQ A;  4BBN C;  2WYQ A;  2L0T A;  2QHO A;  2O2V A;  3L16 A;  2JY6 A;  3M3J A;  4XZ4 A;  4A3P A;  1IYF A;  5D6J B;  3ZRC A;  1G6J A;  2JWZ A;  4GIV A;  4HPM B;  4LJP B;  5CHF A;  4RM9 A;  2MX2 A;  3N30 A;  3UIO B;  4EKU A;  2V4L A;  2MBE A;  2N1V A;  4G0N B;  2DZI A;  3H6N A;  4MEM A;  4FJY A;  4BKS D;  2MLB A;  3AXC A;  3V62 A;  3DPD A;  3QIJ A;  1E5W A;  2N7D A;  2J7Q B;  2K1F A;  3H9D A;  3DQV A;  4DBG A;  4EUT A;  3BIN A;  2CHZ A;  4DDG D;  4KIK A;  4F7Z A;  2MSE D;  3KYD D;  3DBR I;  1WR6 E;  1J19 A;  4AP4 C;  2KLC A;  4OVV A;  2PE9 A;  5KHO A;  3UIN B;  2BKF A;  2JRI B;  4A3O A;  4GDL A;  4CO7 A;  2KMC A;  2MWS B;  1S1Q B;  2ASQ A;  2ZEQ A;  2K6Q A;  1A5R A;  1UH6 A;  3NZU A;  3AUL A;  2L05 A;  3QHT A;  3DBS A;  4DWF A;  1UEL A;  4WJO A;  4EFO A;  3QK0 A;  2MBO A;  1IP9 A;  2O6V D;  2HD5 B;  3JW0 X;  3ZO5 B;  4ICU A;  1RAX A;  2LD9 A;  3KVF B;  3W1Y A;  4GGQ A;  4CHK A;  1SGH A;  3MJW A;  4E71 A;  3ZRF A;  1Z5S B;  5DPW A;  4LDT B;  1V49 A;  2JZ3 B;  2K8C A;  2RR9 A;  2C7H A;  4EOY A;  2ZNV C;  1ZGU B;  5JHA A;  2KN5 A;  1V2Y A;  3C0R B;  1Q0W B;  3ZNH B;  4AJY B;  3PHX B;  2M0X A;  4GU2 A;  1WM2 A;  2JT4 B;  4IM0 A;  1WYW B;  3ECI A;  1S3S G;  4IUM B;  1Q1O A;  4JL9 A;  2DHZ A;  2KFJ A;  4IW0 A;  4EZL A;  4PS3 A;  2K8H A;  4W9E A;  3WIM A;  4EZK A;  3PRE A;  3DVN U;  4ZDV A;  4F8C B;  3WAL A;  2N9E B;  1WF9 A;  5CX3 A;  2O2V B;  5E6N A;  1R4N I;  4ZRI A;  1E8W A;  1WGD A;  2GBJ A;  2L7R A;  5E6O A;  2FCS A;  2N9P C;  4TUU A;  2KWU B;  2NCN A;  3OJ4 B;  1J0G A;  3HIZ A;  3QC8 B;  1YD8 U;  2IO0 B;  3VH3 B;  2LAS A;  3O65 B;  5LXI B;  3VH4 B;  3NY5 A;  2MBB B;  1I42 A;  3V6C B;  2KJR A;  3ENE A;  2J0J A;  2LWP A;  1WX9 A;  3TMP B;  3SD5 A;  4G3X B;  3A4R A;  1WRD B;  3PV1 A;  2CHW A;  4KIK B;  2Y5B B;  2BWE S;  1RLF A;  2LXA A;  1AAR A;  2C7N B;  3KH0 A;  4LDT D;  2ZVO A;  4W9H A;  1YJ1 A;  3ZNZ B;  4B9K A;  4GDL B;  3QJZ A;  4GMV A;  2MCN B;  2JRH A;  5AZG A;  4W9F A;  4ANX A;  4K81 A;  2FIF A;  2KWC A;  4M8M A;  4FJZ A;  3ML8 A;  4FHJ A;  4NJ6 A;  2J0K A;  1T0Y A;  5L95 C;  4TKN A;  1P0R A;  3SU8 X;  2IZV B;  3RD2 A;  2FCM A;  1TGZ B;  1XT9 B;  1E8X A;  2DX5 B;  3A9J A;  3X23 A;  3APC A;  3HHM A;  4NPN A;  3RUI B;  5EDS A;  3U7D A;  1Z2M A;  3QQ8 B;  2KDI A;  2AL6 A;  2DZK A;  2KQS A;  1H4R A;  1WR1 A;  2PJH A;  3UGB B;  2LI5 A;  3W1S A;  4MSM B;  3U30 A;  1L7Y A;  4A20 A;  3L10 B;  1ZW7 A;  4HPL B;  3ZVV A;  4K1R B;  2JXX A;  4HCN B;  3V61 A;  4HXD A;  4K7S A;  4DDI D;  4MEL A;  4XX5 A;  3WA0 A;  3EC8 A;  5LLI A;  2NBU A;  3Q3F A;  3RZF A;  4AJW A;  1WIA A;  2KNB A;  3JYU A;  3N3K B;  3APD A;  2BF8 B;  1Y8R C;  1XQQ A;  4PYU A;  3R3M A; 
#chains in the Genus database with same CATH topology
 1YQB A;  3A9K A;  4JWU C;  3ZNI D;  3A1Q A;  3ABV B;  1GC7 A;  1QKZ A;  3M63 B;  3VUW A;  1MG4 A;  3CSF A;  1F52 A;  4WJN A;  4TQ0 A;  2WDR B;  1C76 A;  5G55 A;  4KZ0 A;  3NS1 A;  3TL5 A;  2WX0 A;  1IBX B;  2B76 B;  2N9X A;  3V60 A;  2LVO A;  4JWS C;  4IKG A;  4GLS C;  2FUG 1;  4O1N A;  2D2Q A;  4E3C A;  4ASW C;  2Z59 B;  1KFY B;  2KAN A;  5I4D A;  1UD7 A;  2B3A A;  2K9X A;  3OAW A;  3IG3 A;  1WGR A;  3L08 A;  5J18 A;  2ZW0 A;  2ACZ B;  2KVR A;  3ZXR A;  2DZJ A;  3NJT A;  3GZN I;  1YN4 A;  1KF6 B;  2NVU I;  4ANW A;  3IT4 B;  4WH4 A;  3ZJT A;  1PQS A;  2PEA A;  3VUX A;  5IA7 A;  3A9K B;  3RNE C;  1T5X D;  2IYD B;  2PE6 B;  1LQB A;  3A1Q B;  4HPP A;  4LNK A;  3PS6 A;  2PPH A;  3Q3N C;  5AUK A;  4P7I A;  3U4E G;  2I1K A;  4JE3 B;  2KKC A;  4G50 A;  3GB1 A;  5AEK B;  2MQJ A;  5JZE B;  5BMG A;  3VUY A;  4GSW A;  3IBE A;  2W3S A;  1BML C;  5BYR A;  2KVZ A;  3KWL A;  2DYB A;  2VRR B;  2G4S A;  4FA6 A;  2LGX A;  3R7R A;  1TJE A;  1M94 A;  1HTO A;  4P1B C;  1K53 A;  1QZE A;  4MGY E;  2LGS A;  4EEW A;  2D3G A;  2N7E A;  3RNC C;  3H1U A;  1WJU A;  1U4A A;  4REZ A;  1YOV B;  2D3A A;  3KWV A;  1V86 A;  3E56 A;  1P1A A;  2K22 A;  1KJT A;  2IO2 B;  3DBH B;  1VZ6 A;  1JWA D;  5IOI A;  4XDC A;  1HQR D;  4DHZ B;  2BVC A;  4AQ7 A;  1J7A A;  4BOS C;  1V81 A;  3A33 B;  1SB3 C;  4YSX B;  4YTP B;  3RZW C;  3QAQ A;  4M01 A;  3WAM A;  1I35 A;  3J9C A;  1E7V A;  1AN8 A;  4J3O D;  3B08 A;  1HZ5 A;  5AZH A;  2C60 A;  2OOB B;  3N1Z C;  1N5W A;  3JSV A;  1CK1 A;  1ZDX A;  2IGG A;  2FUH B;  2ZCB A;  2ZZP B;  1P9D U;  2WP9 B;  4ZRK A;  2LXC A;  2V3S A;  2INC C;  4C7Z A;  4AUQ C;  1XLQ A;  1JRU A;  3HM6 X;  1WZ3 A;  1TY2 A;  4FHK A;  4GB9 A;  2BYV E;  1YX6 B;  1XO3 A;  2IY1 B;  4W9J A;  2KQ4 X;  4NJ7 A;  5JHB A;  3OWE B;  5FR3 A;  3AEC B;  2IY0 B;  1QOA A;  2CU3 A;  4BZA A;  1C77 A;  1Q10 A;  3DDC B;  3LB8 C;  2BYE A;  4MM3 A;  2KZR A;  3APF A;  1MFW A;  2KDB A;  3SFD B;  4DHZ E;  2NBV B;  1WJ4 A;  3IVF A;  4PS8 A;  3U8Z A;  1K52 A;  2QDF A;  4M8N A;  3PRP B;  1ENF A;  3DHG C;  1C4A A;  1UGM A;  2KHW B;  2J0M A;  5J2R A;  5DPS A;  3R66 C;  2KXJ A;  1XLO A;  1WWT A;  4WIP A;  3JSV B;  2KN4 A;  2NMQ A;  1F77 A;  3HK0 A;  2NR2 A;  2I2Y A;  1JWB D;  3D32 A;  4ZRQ A;  1WGH A;  4KGS A;  4N9F 4;  2CR5 A;  1I7H A;  2WQY B;  4TV3 A;  1L0Y B;  4YL8 A;  3C19 A;  4JX1 C;  2D07 B;  1FRR A;  4K7U A;  2AWT A;  2LJ5 A;  1E10 A;  2Z0D B;  3RCZ A;  3EHV A;  1XCQ L;  3DWM A;  4HLE A;  4MM3 B;  3SHQ A;  3P4P B;  1LFD A;  1CMX B;  3Q3M C;  5E6J A;  3NVW A;  2K39 A;  1GG3 A;  3Q8C A;  3TCA A;  2BT6 A;  1YNT E;  4JPS A;  3P4R B;  2L83 A;  3P63 A;  1UBI A;  3PTF C;  1XLP A;  3DBH I;  4HDQ A;  3M3J A;  2JWZ A;  4GIV A;  2V4I B;  1I4X A;  3UIO B;  4EKU A;  3EUB 2;  5EE0 A;  4G0N B;  4P1C C;  1OQQ A;  4OW0 A;  4RGN A;  3BK1 A;  2QCZ A;  2N7D A;  2J7Q B;  2K1F A;  3H9D A;  4RFB A;  3BIN A;  2CHZ A;  1WR6 E;  1FCC C;  1EM7 A;  2KLC A;  1JML A;  5KHO A;  3UIN B;  1VLB A;  2BKF A;  1KLU D;  3LXF A;  1S1Q B;  2HJ1 A;  2K6Q A;  2JWU A;  3NZU A;  4RNA A;  1FFU A;  2L05 A;  1ZUD 2;  3QHT A;  4USA A;  1UEL A;  4EFO A;  3FC4 A;  4ICU A;  4K3B A;  4WUR A;  2KDM A;  4GGQ A;  4NAM A;  1JRO A;  1SGH A;  3GS2 A;  1R4M B;  1V49 A;  2JZ3 B;  2K8C A;  2ZNV C;  3P1M A;  1RM6 C;  4AJY B;  4GU2 A;  1WM2 A;  2JT4 B;  4EZL A;  1FIQ A;  4W9E A;  3DVN U;  3TUO A;  1WF9 A;  4ZHO A;  1E8W A;  1WGD A;  2N9P C;  5FKA C;  1J0G A;  3HIZ A;  3VH3 B;  2PMV A;  3VH4 B;  2QEJ C;  3VR8 B;  3V6C B;  3FAH A;  2LWP A;  1WX9 A;  4G3X B;  3A4R A;  2BS3 B;  4IDI A;  5HG2 A;  2Y5B B;  4ARI A;  2BWE S;  2LXA A;  2C7N B;  1VDV A;  3KH0 A;  2BS2 B;  3ZNZ B;  4B9K A;  4GMV A;  4EE2 A;  1E6E B;  5AZG A;  2VH1 A;  4K81 A;  2WGS A;  4FJZ A;  4FHJ A;  2J0K A;  2K0P A;  2IZV B;  1ZP0 B;  2FCM A;  1F2R I;  4XE0 A;  3DHH C;  3RUI B;  2INN E;  2KDI A;  1H4R A;  2N0S B;  1MVK A;  4MSM B;  4A20 A;  1ZW7 A;  3ZVV A;  4K7S A;  4UDU C;  2GLS A;  3WA0 A;  3EC8 A;  3C8Y A;  2NBU A;  1YN3 A;  3RZF A;  3APD A;  2WXQ A;  2G9H D;  4PYU A;  3R3M A;  1N60 A;  1BT0 A;  2RGF A;  3PHW B;  2ZJD A;  3MHZ A;  2WDV B;  1EU3 A;  3AEA B;  1EO6 A;  1TIF A;  4C80 A;  4ANU A;  1D3Z A;  1WM3 A;  2XEW A;  2XK5 A;  2MBQ A;  2CJN A;  3P2B A;  4M0W B;  4A9A A;  1D6E C;  3GZN B;  4NQK E;  3MC0 B;  3VTU A;  2X8X X;  4HVB A;  1JWU D;  4K7W A;  1YMH E;  1VCB A;  3VR9 B;  2J42 A;  1SE2 A;  2KAJ A;  4MGK E;  1YIW A;  3EGR A;  1GC6 A;  3AU5 A;  3TJP A;  3VXW A;  5L83 A;  1C3T A;  5H92 C;  3TEW A;  2Y3A A;  1L2N A;  3ZJV A;  3VVW B;  1A70 A;  2AX5 A;  3OG5 A;  2LJI A;  4N59 A;  1KM7 A;  1L0V B;  2G1E A;  1TZ1 A;  3MP9 A;  2MW5 A;  1C4P A;  3ZQ4 A;  5EE9 A;  4BKS A;  4DXG A;  5J17 A;  2IND C;  4AS1 A;  3NUH B;  1WXS A;  3RUL A;  3W5U B;  1C79 A;  4HK2 A;  4MSQ B;  1R4M I;  3ZUN A;  2H88 B;  4A55 A;  2CKH B;  3CMM B;  2ZPY A;  5BO4 B;  2XK5 B;  5KHQ A;  3NVY A;  3OJ3 A;  2XN9 C;  1HEZ E;  1N63 A;  3M95 A;  2LGD A;  3JVZ X;  3KYC D;  1STE A;  3KW5 B;  4HJK A;  2HJ8 A;  1WJ6 A;  5FR6 A;  4DK5 A;  3GE3 C;  3AE4 B;  2PW9 A;  4N6E B;  1FEH A;  4BFR A;  2KWD A;  2FAZ A;  1K51 A;  3RT3 B;  2JPH A;  3T3O A;  3WAP A;  3NVV A;  4MGI E;  2MH7 A;  2YEP B;  2RMM A;  2GI9 A;  2KTR A;  4RGT A;  4MH0 E;  1QT9 A;  3PT2 B;  3B2F A;  3V05 A;  4W9D A;  2EKI A;  3AU4 A;  4A6Q A;  4LNF A;  3L13 A;  3N1X C;  5HI1 A;  1WXV A;  2RDB C;  4HEA 1;  4JLC A;  2MBH A;  1L0X B;  1WMH A;  2WX1 A;  4KDL B;  1WSP A;  2M8S A;  2WXH A;  2JVC A;  2DZM A;  4IG7 B;  3ZGZ A;  3DWG C;  2Y5P A;  2RPV A;  3AE2 B;  2LEK A;  3H7S A;  1VR9 A;  2IO1 B;  4L1B A;  2GMI C;  1SJH D;  2TSS A;  5TR5 A;  4FBJ B;  4WJP A;  4F1S A;  1V80 A;  3DCG A;  2IO3 B;  4CQN A;  3QX1 A;  3BY4 B;  4YTN B;  2KTR B;  2MP2 A;  1PYW D;  1XF5 L;  4JIO U;  2CU1 A;  3W1S C;  3HVZ A;  1C78 A;  2KJ6 A;  2DYO A;  3H7P A;  3Q6B A;  4B0E A;  1JRP A;  4P16 A;  4BKG A;  4XC2 A;  4A90 A;  4BKT A;  3Q2A C;  4BAX A;  2N1W A;  2LMC A;  5JXV A;  2WU5 B;  3PGE A;  3SDL C;  1GPX A;  3WAO A;  3U2S C;  4MGZ E;  1WMH B;  2L00 B;  3EA6 A;  2G4D B;  4GXB A;  2KWV B;  3DVG Y;  2UYZ B;  2HE7 A;  2MJE A;  3TSS A;  2M4N A;  1OQY A;  3B0A A;  3W9C B;  1I4G A;  4GDK A;  1TKG A;  4IWP A;  3VHT C;  2FCN A;  3WCQ A;  2DAF A;  2KDF B;  1FMA D;  2MHJ A;  2L8J A;  4TSS A;  2EKE C;  3WAN A;  2PLP A;  3K9O B;  1KRH A;  1JWS D;  2MP2 B;  2KMM A;  2MRP A;  2NBW B;  4TMA B;  5DPR A;  3H7P B;  4BVU C;  4MAC A;  1SIF A;  2WDQ B;  1WX7 A;  2FID A;  3CF6 E;  1XLN A;  3DOW A;  1J7C A;  4TQ1 A;  5LXH A;  2KMA A;  4NY0 A;  4RM8 A;  3IFW B;  1WX8 A;  2MA9 B;  1EWY C;  1L5P A;  1ISN A;  2KX0 A;  2PIA A;  2WXF A;  1E7U A;  1LM8 B;  1TKY A;  4RMA A;  2VH2 A;  1OQR A;  4GDK B;  5EE1 A;  1B1Z A;  2BTE A;  1L6U A;  4KDI C;  1N6Z A;  1V5O A;  4BBN C;  3AMZ A;  1ZPS A;  3L16 A;  2O2V A;  4XZ4 A;  4R3D A;  1IYF A;  4LJP B;  5CHF A;  4RM9 A;  1T6B X;  2MBE A;  2EEL A;  2N1V A;  5EE3 A;  4MEM A;  4FJY A;  2MLB A;  1I4Q A;  2FBW B;  2LHE A;  3DQV A;  2K3U A;  1HA5 A;  2D3B A;  4KIK A;  4F7Z A;  2MSE D;  1FNW A;  3KYD D;  1J19 A;  3R2T A;  4AP4 C;  4OVV A;  4CO7 A;  2MWS B;  3HUI A;  4DWF A;  4WJO A;  2IDY A;  1IP9 A;  5IKC M;  1RAX A;  5TSS A;  2QJL A;  3ZRF A;  1SBB B;  2JZP A;  4EOY A;  5JHA A;  2KN5 A;  3C0R B;  1Q0W B;  1IGD A;  3ZNH B;  2V0G A;  4IM0 A;  1S3S G;  5D3D A;  1Q1O A;  4IW0 A;  3FIL A;  4EZK A;  1PDX A;  4ZDV A;  2W3R A;  4HKQ A;  2N9E B;  1BUI C;  2O2V B;  5E6N A;  3SR6 A;  2FCS A;  3URY A;  2WLB A;  2NCN A;  1DGJ A;  3QC8 B;  3TEY A;  2LAS A;  5GXG B;  2MBB B;  1F2R C;  1I42 A;  2KJR A;  3ENE A;  4C56 C;  3TMP B;  3O13 A;  3AE7 B;  3SD5 A;  3PV1 A;  2ICI A;  4KIK B;  1QOF A;  1QF6 A;  2NTT A;  2WXN A;  2WXM A;  2MCN B;  2XNA C;  2L32 A;  2FIF A;  4XWT A;  4M8M A;  2GB1 A;  5D3I B;  3SU8 X;  1CZP A;  3RD2 A;  2OHF A;  1AYF A;  3APC A;  2V3N A;  5EDS A;  4LLG M;  2JYT A;  3U7D A;  2AL6 A;  1WR1 A;  3L10 B;  4HCN B;  1F1H A;  4HXD A;  3FIL B;  3RNA C;  3DHI C;  5LLI A;  2AQ3 B;  3Q3F A;  3BWU D;  3PZ8 A;  4AJW A;  1NEK B;  3N3K B;  2LFI A;  1Y8R C;  1P3Q U;  2N9L A;  1V5T A;  3IAM 1;  4WJQ A;  2BWF A;  3BZD B;  5C23 A;  3AV8 A;  3CST A;  2FNJ B;  2M17 A;  4P6V F;  1KLV A;  2WXK A;  4J6I A;  4WWN A;  1ET9 A;  1F9J A;  1P7F A;  1R7S A;  3L17 A;  1WGY A;  4YXD B;  1T0R C;  3AE5 B;  2E3T A;  1NDD A;  4BBN F;  4EZJ A;  3ZTD A;  3Q3O C;  3PZD A;  2WXR A;  4IWQ A;  1T3Q A;  1TY0 A;  1WRI A;  2BKR B;  2KC2 A;  1T0S C;  2NPT A;  3L54 A;  2V1Y A;  4IWO A;  1AW7 A;  1E8Y A;  1UF0 A;  2JX5 A;  2D3C A;  3VRA B;  5D2M B;  3ZKJ C;  1WE7 A;  2MJ3 A;  2N4F A;  2AL3 A;  2YVC A;  3NZS A;  4ZRJ A;  5DPT A;  1FCL A;  2ZVN A;  3MC9 A;  3VFK A;  1DOX A;  4LNO A;  5IO9 A;  3T8M A;  4FXC A;  3MJ5 A;  3AEF B;  1TYG B;  1WI0 A;  3N1Y C;  2BGF A;  1MHH E;  3AEB B;  1UNS A;  4WWP A;  2FCQ A;  2KLG A;  3SFE B;  1QIL A;  1NYR A;  3ML9 A;  3FKY A;  1VRA B;  1E7P B;  2KFK A;  5AZF A;  4ZYN A;  4JQW C;  1J7B A;  2C9W B;  4XDD A;  3VDZ A;  4M0W A;  1K8R B;  2A5U A;  4IM3 A;  2GBK A;  3AM9 A;  1JAL A;  2NPT B;  4YSZ B;  1DYQ A;  2G3Q B;  1WZ0 A;  4URK A;  4BOZ B;  3NS8 A;  3RPF C;  5D7G A;  2JUO A;  3ZDT A;  3LDZ E;  2WNM A;  4OZC A;  2JSV X;  2K5P A;  4WQM A;  1SF0 A;  3TBL D;  4II3 B;  2L76 A;  1MJD A;  4HKZ E;  1HXY D;  1RWS A;  3B2G A;  3K9P B;  2WS3 B;  3QA8 A;  3U52 E;  2J4X A;  1V8C A;  3I3T B;  1LO5 D;  3Q8B A;  2KX3 A;  1FD6 A;  2AYO B;  3R2I A;  4I6L B;  1WGG A;  3NRZ A;  4GOC A;  1SXT A;  1V1P A;  3V3X A;  4KV2 A;  2WXG A;  1PFD A;  3B1L X;  2D5G A;  1FXI A;  2LVQ A;  5IP4 D;  2JZZ A;  1KOT A;  5HKH A;  4S0R A;  1FFV A;  2KO3 A;  3DBR B;  1WYG A;  2KFK B;  2XBB C;  3KUZ A;  3NVZ A;  2CS4 A;  2D11 A;  2WXI A;  3V6E B;  4W9L A;  1B9R A;  2K25 A;  2BYF A;  1GNU A;  1V9J A;  2K8B A;  4FN2 A;  1UWM A;  1ZXI A;  2DWQ A;  1MG8 A;  3M62 B;  2DYM A;  2AEH A;  2REX A;  2VZK B;  2KTF A;  2SAK A;  3N30 A;  2JF5 A;  3ZTC A;  3A4S C;  3Q3J A;  3KLS X;  1D4B A;  4WWM A;  5CTR C;  2IPK D;  1C4C A;  1RYJ A;  5G2N A;  5C1Z A;  3BVG A;  1ZXH A;  1TS5 A;  1NBF C;  4US9 A;  1UBQ A;  1FM0 D;  2KYW A;  4II2 B;  1TS3 A;  3UF8 A;  1V1P B;  4NJC A;  2L1A A;  4RGM A;  3ONS A;  3MHS D;  5GMV A;  1RRB A;  4XYC A;  1Y56 A;  2AQ2 B;  1IGC A;  3BVM A;  2D10 A;  2O6V A;  1TBE A;  2WDT B;  4G11 A;  3AED B;  2INP E;  3R8B A;  3MFG A;  1D5X C;  3PRM B;  3HRD D;  2KQ7 A;  2LGY A;  2Z0E B;  2BBC A;  4YTM B;  4OVU A;  2ZW1 A;  4KSL C;  4HDO A;  4LJO B;  4OZA A;  1SJE D;  4PT5 A;  4PYZ A;  3KUC B;  1Q5W B;  3LYY A;  1SE4 A;  4KGT A;  3KQ4 A;  3PRZ A;  2N9K A;  1N5X A;  1SIJ A;  1EF1 A;  2CJO A;  2GBM A;  2WWZ A;  1GAQ B;  3CIR B;  5CHW A;  3Q8F A;  1E0Z A;  3VTW A;  2QSD A;  1VZ8 A;  1WJN A;  3VAW A;  4W9G A;  3RI7 C;  3AI5 A;  3AE3 B;  1KLG D;  2BPS A;  1XEE A;  4B0M A;  4YT0 B;  3BYY B;  4D2K A;  4IOI E;  1J8C A;  2O6V B;  2WYQ A;  1D5M C;  2JY6 A;  4A3P A;  1L4Z B;  5D6J B;  3ZRC A;  1G6J A;  1TS4 A;  2E6X A;  1PGA A;  2DZI A;  4BKS D;  4XGA B;  3V62 A;  3AB5 A;  2JYE A;  1NEN B;  5G5G A;  3H8H A;  4DDG D;  4M00 A;  1ESF A;  3DBR I;  3RNG C;  2PE9 A;  1YJJ A;  1SSN A;  4M02 A;  2KMC A;  2ASQ A;  3RN9 C;  4ACF A;  1A5R A;  1UH6 A;  4WAF A;  3AUL A;  5MPO A;  2QC8 A;  3DBS A;  2O6V D;  2HD5 B;  3KVF B;  1UGJ A;  1ZOY B;  3RFZ B;  2RDG A;  1F0Z A;  3W2D A;  1Z5S B;  4RCO A;  2C7H A;  2UU7 A;  3AE6 B;  4KX6 B;  1WYW B;  3ECI A;  4JL9 A;  2DHZ A;  4PS3 A;  2K8H A;  3WIM A;  3PRE A;  2BB6 A;  2BB5 A;  3WAL A;  2OJW A;  1FRD A;  2W82 A;  2FE8 A;  4TUU A;  2IGH A;  4OVZ A;  2IO0 B;  3O65 B;  3BVZ A;  4ZYS A;  2J0J A;  4H2A A;  1FO4 A;  1RLF A;  2PVG C;  2MEK A;  2ZVO A;  1YJ1 A;  3AE8 B;  3QJZ A;  2JRH A;  4W9F A;  4ANX A;  2J52 A;  2R61 A;  1MPE A;  2BW2 A;  4NJ6 A;  1T0Y A;  5L95 C;  4TKN A;  2WXJ A;  2YEP F;  1TGZ B;  1XT9 B;  1E8X A;  3A9J A;  3X23 A;  3B9J A;  3HHM A;  4NPN A;  4Q2J A;  1Z2M A;  2KQS A;  2DZK A;  5FK9 C;  1VZ7 A;  3UGB B;  5AUI A;  3NZ3 A;  3U30 A;  3AEE B;  4HPL B;  4K1R B;  2DLB A;  2JXX A;  3V61 A;  2J53 A;  4DDI D;  5LNK 1;  3JYU A;  3AH7 A;  1FPY A;  1QLB B;  2BF8 B;  1KTK A;  4JGH B;  1GB1 A;  2LRU A;  2IJ0 A;  1OFF A;  1L6V A;  4LCD E;  2BQQ A;  2I1J A;  4L23 A;  3GOE A;  1SEB D;  4ICV A;  4KZC A;  1JCK B;  3P4Q B;  2LHD A;  3S2A A;  3ZIM A;  1P98 A;  4I6N B;  1DOI A;  2KJH B;  4ZOH C;  3AE9 B;  2LUE A;  5G5H A;  4N58 A;  2M0A A;  4S17 A;  1ZE3 D;  4DQO C;  5D94 A;  2KDE B;  4C4V A;  1K50 A;  4RF0 A;  1SE3 A;  2GBN A;  4PS7 A;  4WQO B;  3A9J B;  2I38 A;  3EEC A;  2ZCC A;  1UZX B;  1CJE A;  1EUV B;  1EU4 A;  2A4Z A;  5CHV C;  1T0Q C;  3U7Z A;  1FXT B;  2W9N A;  4OHJ A;  2RSU A;  4IM2 A;  4LNN A;  1IUE A;  3X0W A;  3RYT A;  4X57 B;  5HHD G;  1NVI D;  1VJK A;  2L3Z A;  4HCP B;  1X1M A;  1OEY A;  4HRO A;  2KD0 A;  3QCA A;  2WXL A;  4YSY B;  3Q8A A;  1E8Z A;  1WXA A;  4W9I A;  4ANV A;  3PSE B;  2OED A;  2R2Q A;  2DEN B;  1MI0 A;  3LJ3 A;  3QWZ B;  3DBL B;  1WFY A;  3AEG B;  4ITK A;  3P4S B;  4LK0 M;  1SE9 A;  1UUP A;  4C4V B;  3NOB A;  2HTH A;  3Q14 C;  4RGO S;  3L0W B;  3R7Q A;  3SEB A;  2G45 B;  4FUL A;  2Y5C A;  3N20 C;  3MC8 A;  4AOF A;  2YLM A;  3QAR A;  2UWQ A;  1V6E A;  1EF5 A;  1XXG A;  4PK1 A;  1XD3 B;  1TTN A;  3IAS 1;  1C9F A;  5BYS A;  1HZ6 A;  2LRW A;  3UIP B;  3ALB A;  3VQI A;  1ZDV A;  4RH6 A;  1KH0 A;  2V9H A;  1E90 A;  3UQB A;  2GBR A;  1V1O A;  4XWW A;  2C7M B;  1MHX A;  1PGX A;  1AWD A;  2KAC A;  1N61 A;  3NHE B;  3PLU A;  3DVN V;  5HFY A;  1GUA B;  2EMS A;  1WH3 A;  2DNF A;  1PGB A;  3IT6 B;  1I4H A;  2H89 B;  2Q5W D;  1FXA A;  3AN1 A;  3TEX A;  2IBI B;  2R2O A;  3P42 A;  3TIX A;  3VRB B;  2QIE B;  2BYT A;  2PVO D;  4W9C A;  3ZW3 A;  2L0F A;  2Z8L A;  5C2T B;  4ARC A;  4MT5 A;  2L52 A;  2M56 B;  3VTV A;  2RPQ A;  3ZJU A;  4IC7 B;  1UWX A;  2K6D B;  3DVG X;  4WAA A;  3UI3 A;  4C00 A;  3I5J C;  5T8I A;  5JH5 C;  2KT7 A;  3T9L A;  3IHP C;  1YX5 B;  3ZXV A;  3HM3 A;  4HWI B;  4B6W A;  1GOZ A;  4ZRP A;  5BMI A;  1YN5 A;  2CHX A;  4E74 A;  1RFA A;  2KC1 A;  3N32 A;  1TKE A;  4A8X C;  4DHJ B;  1WY8 A;  1C1Y B;  1VD2 A;  3Q8E A;  1D5Z C;  5C3J B;  5E6P A;  3I9V 1;  4NZL B;  1HTQ A;  1R4N B;  2JXT A;  3MTN B;  2WU2 B;  4NQL B;  4NNJ B;  4GN1 A;  4I6P A;  2C5L C;  2W54 A;  3IXS A;  5DCN A;  2JQR B;  2ZNV B;  3BII D;  1E9M A;  2EMT A;  4OZB A;  2KK8 A;  2RD0 A;  4MDK E;  4RF1 A;  4NAW A;  1TS2 A;  4DXA B;  3GE8 C;  1JWM D;  4MJS A;  4AWJ A;  1OGW A;  1YJI A;  1GB4 A;  3CWI A;  4FAD A;  4DHJ D;  1OEY J;  1OTR B;  1NI3 A;  1QOB A;  3I57 A;  3EFC A;  5IAA C;  2ONQ A;  4KKI A;  3ZDM C;  2OJR A;  2PKO A;  1H8C A;  4KSK C;  3PZ7 A;  1TZO A;  3HVD A;  2NS5 A;  1WE6 A;  2SEB D;  2M1M A;  2LGI A;  3PPA A;  3DBL I;  3ZNG C;  3UQA A;  3KUD B;  4K3C A;  2AQ1 B;  4DXF A;  1I4P A;  4HJG E;  1P7E A;  1ACC A;  1IPG A;  1GJZ A;  4WWO A;  2WXO A;  4FLH A;  3ZYY X;  2KOX A;  2LVP A;  2WXP A;  3RMK C;  4LTU A;  1LXD A;  2JU6 X;  4FJV B;  4B95 A;  2W55 A;  2LZ6 A;  2GOW A;  1XCT L;  3OLM D;  3AE1 B;  1FNU A;  4KVG B;  2NTS A;  1WXM A;  1HE8 A;  2ZPN A;  3PLV A;  1I4R A;  1JW9 D;  4NAW B;  4W9K A;  2MJD A;  3EFU A;  4MJS B;  1M4V A;  3ZLZ A;  2DAJ A;  2V3P A;  1NI2 A;  4CYE A;  1ZKH A;  3PVL A;  2L0T A;  2QHO A;  4KKJ A;  4HPM B;  3T3N A;  1RFK A;  1LGR A;  2MX2 A;  2V4L A;  3H6N A;  3AXC A;  4ZHP A;  3DPD A;  3QIJ A;  2M19 A;  4HRS A;  1E5W A;  3RNB C;  4EUT A;  4DBG A;  1BXT A;  3RNF C;  1TT5 B;  1NYQ A;  2LUM A;  1EWC A;  2X38 A;  2JRI B;  4A3O A;  4GDL A;  3L4P A;  2ZEQ A;  4KGR A;  3W5V B;  2BS4 B;  3BYT B;  2ON8 A;  3QK0 A;  2MBO A;  3JW0 X;  1WGK A;  3ZO5 B;  2LD9 A;  3W1Y A;  4CHK A;  3MJW A;  5H8Y E;  1DOY A;  4E71 A;  4MH8 A;  5DPW A;  3NG0 A;  4LDT B;  5BYQ A;  4LNI A;  2RR9 A;  1ZGU B;  1V2Y A;  2PTL A;  3PHX B;  2M0X A;  5BMH A;  2VZK D;  2RDH A;  2GRI A;  4IUM B;  4YWG G;  2KFJ A;  2WHI A;  4F8C B;  5CX3 A;  1R4N I;  3E9S A;  2GBJ A;  3GP7 A;  2L7R A;  4ZRI A;  5E6O A;  2KWU B;  3OJ4 B;  4US8 A;  2HDE A;  2N7J A;  4C7Y A;  1YD8 U;  5LXI B;  3NY5 A;  1N62 A;  1YQ4 B;  4L2Y A;  1WRD B;  2CHW A;  3N9Y C;  3TEZ A;  1WXQ A;  1AAR A;  4LDT D;  4W9H A;  2DBY A;  3Q69 A;  4GDL B;  3BK2 A;  2KWC A;  1IBX A;  3PO0 A;  3ML8 A;  2QIL A;  1P0R A;  1QOG A;  1ROE A;  2DX5 B;  1L4D B;  3QQ8 B;  1YQ3 B;  1CQV A;  2PJH A;  1FNV A;  2HTM E;  2LI5 A;  3W1S A;  1L7Y A;  2IGD A;  4QAY A;  1ET6 A;  1QQR A;  3ETR A;  1PUT A;  1JQ4 A;  4MEL A;  1V97 A;  4XX5 A;  5IN7 A;  1WIA A;  2KNB A;  3I63 C;  2QMT A;  1XQQ A; 
#chains in the Genus database with same CATH homology
 1YQB A;  3A9K A;  3ZNI D;  4JGH B;  1BT0 A;  1P3Q U;  2RGF A;  3PHW B;  3A1Q A;  1V5T A;  2LRU A;  2ZJD A;  4WJQ A;  4LCD E;  2BWF A;  1GC7 A;  5C23 A;  3CST A;  2I1J A;  2FNJ B;  1EO6 A;  2M17 A;  3GOE A;  4ICV A;  1KLV A;  4KZC A;  3M63 B;  4ANU A;  1D3Z A;  4J6I A;  4WWN A;  3VUW A;  1F9J A;  1WM3 A;  3S2A A;  3L17 A;  3ZIM A;  1WGY A;  3CSF A;  2XEW A;  4WJN A;  4TQ0 A;  1P98 A;  4I6N B;  1NDD A;  4BBN F;  2KJH B;  2XK5 A;  5G55 A;  2MBQ A;  4KZ0 A;  2LUE A;  3P2B A;  4M0W B;  4EZJ A;  3TL5 A;  3ZTD A;  3PZD A;  4IWQ A;  4NQK E;  2KDE B;  2WX0 A;  5D94 A;  3VTU A;  4HVB A;  2N9X A;  4K7W A;  3V60 A;  2LVO A;  2BKR B;  2KC2 A;  1VCB A;  2GBN A;  4PS7 A;  2NPT A;  3L54 A;  2V1Y A;  2D2Q A;  4IWO A;  4E3C A;  4WQO B;  4ASW C;  1E8Y A;  2Z59 B;  3A9J B;  4MGK E;  1YIW A;  2KAN A;  3EEC A;  1UD7 A;  2ZCC A;  5D2M B;  1UZX B;  2B3A A;  3ZKJ C;  1GC6 A;  3OAW A;  1WE7 A;  3AU5 A;  1WGR A;  2N4F A;  3IG3 A;  2AL3 A;  1EUV B;  2YVC A;  3L08 A;  5J18 A;  2A4Z A;  2KVR A;  3TJP A;  2DZJ A;  3NZS A;  3VXW A;  5L83 A;  5CHV C;  1C3T A;  3GZN I;  1FXT B;  4ZRJ A;  2W9N A;  2RSU A;  2NVU I;  4IM2 A;  4ANW A;  3X0W A;  1L2N A;  1PQS A;  5DPT A;  3RYT A;  3VVW B;  4X57 B;  2PEA A;  1KM7 A;  2L3Z A;  2ZVN A;  4HCP B;  3VFK A;  3VUX A;  1X1M A;  1OEY A;  3A9K B;  5IA7 A;  1TZ1 A;  2KD0 A;  2IYD B;  2MW5 A;  3T8M A;  3QCA A;  2PE6 B;  1LQB A;  4BKS A;  3A1Q B;  3PS6 A;  5J17 A;  2PPH A;  1WXS A;  3RUL A;  1E8Z A;  1WXA A;  4HK2 A;  4W9I A;  1WI0 A;  4ANV A;  4MSQ B;  2BGF A;  1R4M I;  4P7I A;  3ZUN A;  3PSE B;  2CKH B;  3CMM B;  4WWP A;  2I1K A;  2FCQ A;  2ZPY A;  2KLG A;  5BO4 B;  2R2Q A;  2XK5 B;  5KHQ A;  2DEN B;  3LJ3 A;  3QWZ B;  3ML9 A;  3OJ3 A;  2KKC A;  4G50 A;  1WFY A;  3M95 A;  2LGD A;  3JVZ X;  3KYC D;  5AEK B;  2MQJ A;  5JZE B;  5AZF A;  2KFK A;  3KW5 B;  4HJK A;  4JQW C;  1SE9 A;  2HJ8 A;  4ZYN A;  3VUY A;  4GSW A;  1WJ6 A;  5FR6 A;  2C9W B;  4DK5 A;  3NOB A;  3IBE A;  3VDZ A;  2HTH A;  1K8R B;  2A5U A;  4IM3 A;  2GBK A;  2DYB A;  2VRR B;  2G4S A;  2NPT B;  3L0W B;  3R7Q A;  4FA6 A;  2LGX A;  4BFR A;  2G45 B;  3R7R A;  2G3Q B;  4FUL A;  2FAZ A;  1WZ0 A;  3RT3 B;  1M94 A;  4URK A;  4BOZ B;  2JPH A;  3NS8 A;  4AOF A;  1QZE A;  4MGY E;  5D7G A;  4EEW A;  3WAP A;  2D3G A;  2N7E A;  2YLM A;  3QAR A;  2JUO A;  4MGI E;  2UWQ A;  2KTR A;  3LDZ E;  1V6E A;  3ZDT A;  1EF5 A;  1XD3 B;  1TTN A;  4MH0 E;  3H1U A;  2LRW A;  1WJU A;  3PT2 B;  3UIP B;  1U4A A;  3ALB A;  4W9D A;  4II3 B;  3TBL D;  3VQI A;  1V86 A;  2L76 A;  3AU4 A;  3L13 A;  1E90 A;  1P1A A;  3UQB A;  1WXV A;  2GBR A;  3K9P B;  1KJT A;  2IO2 B;  3QA8 A;  3I3T B;  2C7M B;  4JLC A;  2MBH A;  2KX3 A;  3NHE B;  3PLU A;  2AYO B;  3DVN V;  1GUA B;  4I6L B;  2EMS A;  1WGG A;  1WMH A;  4DHZ B;  1WH3 A;  2WX1 A;  4GOC A;  4KDL B;  2M8S A;  2JVC A;  2DZM A;  4IG7 B;  2IBI B;  4KV2 A;  2R2O A;  3TIX A;  4BOS C;  3B1L X;  1V81 A;  3A33 B;  2LVQ A;  2JZZ A;  1KOT A;  3H7S A;  3RZW C;  3QAQ A;  5HKH A;  2KO3 A;  4W9C A;  3ZW3 A;  2L0F A;  2IO1 B;  2KFK B;  3WAM A;  2XBB C;  2GMI C;  1I35 A;  3KUZ A;  5TR5 A;  4FBJ B;  3VTV A;  2CS4 A;  1E7V A;  2D11 A;  2RPQ A;  3V6E B;  4WJP A;  3B08 A;  4W9L A;  4IC7 B;  5AZH A;  4F1S A;  2K25 A;  2C60 A;  2BYF A;  1V80 A;  2OOB B;  1GNU A;  3DCG A;  2K6D B;  3DVG X;  1V9J A;  2K8B A;  4WAA A;  4FN2 A;  3JSV A;  2IO3 B;  5JH5 C;  1MG8 A;  3QX1 A;  3M62 B;  3T9L A;  3IHP C;  2DYM A;  3BY4 B;  2FUH B;  2ZCB A;  2ZZP B;  2AEH A;  1YX5 B;  2REX A;  1P9D U;  2KTR B;  2MP2 A;  3HM3 A;  4HWI B;  4B6W A;  4ZRK A;  2LXC A;  2V3S A;  4JIO U;  2CU1 A;  2CHX A;  4E74 A;  2KTF A;  4AUQ C;  1JRU A;  3W1S C;  2KJ6 A;  1RFA A;  1WZ3 A;  2KC1 A;  2DYO A;  2JF5 A;  3H7P A;  3HM6 X;  3A4S C;  3N32 A;  4FHK A;  3ZTC A;  4GB9 A;  2BYV E;  4BKG A;  4XC2 A;  4DHJ B;  1YX6 B;  1WY8 A;  3Q3J A;  1C1Y B;  1VD2 A;  4BKT A;  5CTR C;  2N1W A;  2IY1 B;  4W9J A;  5G2N A;  5E6P A;  4NJ7 A;  3PGE A;  5C1Z A;  5JHB A;  3SDL C;  2IY0 B;  1NBF C;  3WAO A;  1UBQ A;  4MGZ E;  1WMH B;  4II2 B;  3MTN B;  3DDC B;  2L00 B;  4NQL B;  2BYE A;  4NNJ B;  2G4D B;  4MM3 A;  3UF8 A;  2KZR A;  2KWV B;  4GN1 A;  4GXB A;  3DVG Y;  4I6P A;  3APF A;  2C5L C;  2KDB A;  4DHZ E;  2UYZ B;  5DCN A;  2NBV B;  2ZNV B;  2HE7 A;  1WJ4 A;  3IVF A;  4PS8 A;  3ONS A;  3MHS D;  2EMT A;  3U8Z A;  2KK8 A;  2RD0 A;  4MDK E;  4M8N A;  3PRP B;  5GMV A;  4NAW A;  1RRB A;  2M4N A;  4DXA B;  4MJS A;  1UGM A;  4AWJ A;  1OQY A;  3B0A A;  2KHW B;  2J0M A;  1OGW A;  4FAD A;  5J2R A;  4GDK A;  4DHJ D;  1OEY J;  4IWP A;  1OTR B;  5DPS A;  3R66 C;  3VHT C;  2FCN A;  2KXJ A;  2D10 A;  5IAA C;  2O6V A;  1TBE A;  2DAF A;  2KDF B;  3ZDM C;  2WDT B;  3JSV B;  2L8J A;  2OJR A;  4G11 A;  2EKE C;  3WAN A;  3K9O B;  1H8C A;  3HK0 A;  2NR2 A;  2MP2 B;  4KSK C;  3PRM B;  2MRP A;  2NBW B;  2KQ7 A;  2NS5 A;  1WE6 A;  3D32 A;  2LGY A;  1WGH A;  2Z0E B;  5DPR A;  2M1M A;  2CR5 A;  4N9F 4;  3H7P B;  4OVU A;  3PPA A;  3DBL I;  3ZNG C;  4BVU C;  4TV3 A;  3UQA A;  4YL8 A;  3KUD B;  1SIF A;  4KSL C;  4HDO A;  4LJO B;  2D07 B;  4PYZ A;  3KUC B;  1WX7 A;  1IPG A;  1GJZ A;  1Q5W B;  2FID A;  3CF6 E;  4K7U A;  2AWT A;  4WWO A;  2LJ5 A;  4FLH A;  3DOW A;  3PRZ A;  2Z0D B;  2KOX A;  3RCZ A;  3EHV A;  2LVP A;  4TQ1 A;  5LXH A;  2KMA A;  4HLE A;  1EF1 A;  4NY0 A;  4RM8 A;  1LXD A;  3IFW B;  3SHQ A;  1WX8 A;  2MA9 B;  2GBM A;  2WWZ A;  4FJV B;  1LFD A;  4B95 A;  5CHW A;  2LZ6 A;  1ISN A;  2GOW A;  2KX0 A;  3OLM D;  1CMX B;  3VTW A;  2K39 A;  4KVG B;  1WJN A;  3VAW A;  1WXM A;  4W9G A;  1HE8 A;  2ZPN A;  3AI5 A;  3PLV A;  4NAW B;  1E7U A;  4W9K A;  2BPS A;  1LM8 B;  1GG3 A;  3EFU A;  4MJS B;  4RMA A;  3TCA A;  4GDK B;  3ZLZ A;  2DAJ A;  1NI2 A;  4CYE A;  1UBI A;  3PTF C;  1ZKH A;  1J8C A;  3PVL A;  4KDI C;  3DBH I;  1V5O A;  2O6V B;  4HDQ A;  4BBN C;  2WYQ A;  2L0T A;  2QHO A;  2O2V A;  3L16 A;  2JY6 A;  3M3J A;  4XZ4 A;  4A3P A;  1IYF A;  5D6J B;  3ZRC A;  1G6J A;  2JWZ A;  4GIV A;  4HPM B;  4LJP B;  5CHF A;  4RM9 A;  2MX2 A;  3N30 A;  3UIO B;  4EKU A;  2V4L A;  2MBE A;  2N1V A;  4G0N B;  2DZI A;  3H6N A;  4MEM A;  4FJY A;  4BKS D;  2MLB A;  3AXC A;  3V62 A;  3DPD A;  3QIJ A;  1E5W A;  2N7D A;  2J7Q B;  2K1F A;  3H9D A;  3DQV A;  4DBG A;  4EUT A;  3BIN A;  2CHZ A;  4DDG D;  4KIK A;  4F7Z A;  2MSE D;  3KYD D;  3DBR I;  1WR6 E;  1J19 A;  4AP4 C;  2KLC A;  4OVV A;  2PE9 A;  5KHO A;  3UIN B;  2BKF A;  2JRI B;  4A3O A;  4GDL A;  4CO7 A;  2KMC A;  2MWS B;  1S1Q B;  2ASQ A;  2ZEQ A;  2K6Q A;  1A5R A;  1UH6 A;  3NZU A;  3AUL A;  2L05 A;  3QHT A;  3DBS A;  4DWF A;  1UEL A;  4WJO A;  4EFO A;  3QK0 A;  2MBO A;  1IP9 A;  2O6V D;  2HD5 B;  3JW0 X;  3ZO5 B;  4ICU A;  1RAX A;  2LD9 A;  3KVF B;  3W1Y A;  4GGQ A;  4CHK A;  1SGH A;  3MJW A;  4E71 A;  3ZRF A;  1Z5S B;  5DPW A;  4LDT B;  1V49 A;  2JZ3 B;  2K8C A;  2RR9 A;  2C7H A;  4EOY A;  2ZNV C;  1ZGU B;  5JHA A;  2KN5 A;  1V2Y A;  3C0R B;  1Q0W B;  3ZNH B;  4AJY B;  3PHX B;  2M0X A;  4GU2 A;  1WM2 A;  2JT4 B;  4IM0 A;  1WYW B;  3ECI A;  1S3S G;  4IUM B;  1Q1O A;  4JL9 A;  2DHZ A;  2KFJ A;  4IW0 A;  4EZL A;  4PS3 A;  2K8H A;  4W9E A;  3WIM A;  4EZK A;  3PRE A;  3DVN U;  4ZDV A;  4F8C B;  3WAL A;  2N9E B;  1WF9 A;  5CX3 A;  2O2V B;  5E6N A;  1R4N I;  4ZRI A;  1E8W A;  1WGD A;  2GBJ A;  2L7R A;  5E6O A;  2FCS A;  2N9P C;  4TUU A;  2KWU B;  2NCN A;  3OJ4 B;  1J0G A;  3HIZ A;  3QC8 B;  1YD8 U;  2IO0 B;  3VH3 B;  2LAS A;  3O65 B;  5LXI B;  3VH4 B;  3NY5 A;  2MBB B;  1I42 A;  3V6C B;  2KJR A;  3ENE A;  2J0J A;  2LWP A;  1WX9 A;  3TMP B;  3SD5 A;  4G3X B;  3A4R A;  1WRD B;  3PV1 A;  2CHW A;  4KIK B;  2Y5B B;  2BWE S;  1RLF A;  2LXA A;  1AAR A;  2C7N B;  3KH0 A;  4LDT D;  2ZVO A;  4W9H A;  1YJ1 A;  3ZNZ B;  4B9K A;  4GDL B;  3QJZ A;  4GMV A;  2MCN B;  2JRH A;  5AZG A;  4W9F A;  4ANX A;  4K81 A;  2FIF A;  2KWC A;  4M8M A;  4FJZ A;  3ML8 A;  4FHJ A;  4NJ6 A;  2J0K A;  1T0Y A;  5L95 C;  4TKN A;  1P0R A;  3SU8 X;  2IZV B;  3RD2 A;  2FCM A;  1TGZ B;  1XT9 B;  1E8X A;  2DX5 B;  3A9J A;  3X23 A;  3APC A;  3HHM A;  4NPN A;  3RUI B;  5EDS A;  3U7D A;  1Z2M A;  3QQ8 B;  2KDI A;  2AL6 A;  2DZK A;  2KQS A;  1H4R A;  1WR1 A;  2PJH A;  3UGB B;  2LI5 A;  3W1S A;  4MSM B;  3U30 A;  1L7Y A;  4A20 A;  3L10 B;  1ZW7 A;  4HPL B;  3ZVV A;  4K1R B;  2JXX A;  4HCN B;  3V61 A;  4HXD A;  4K7S A;  4DDI D;  4MEL A;  4XX5 A;  3WA0 A;  3EC8 A;  5LLI A;  2NBU A;  3Q3F A;  3RZF A;  4AJW A;  1WIA A;  2KNB A;  3JYU A;  3N3K B;  3APD A;  2BF8 B;  1Y8R C;  1XQQ A;  4PYU A;  3R3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...