2ZPNA

The crystal structure of saccharomyces cerevisiae atg8- atg19(412-415) complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of target recognition by Atg8/LC3 during selective autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
total genus 30
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zpnA00
1WXAA 2LVPA 3NS8A 4G11A 5J17A 2ZZPB 4GOCA 1KOTA 2EMTA 5C1ZA 5E6NA 3TCAA 3V62A 2ZEQA 2DHZA 5LLIA 4EEWA 2YLMA 5LXIB 2N9PC 4MGIE 1EUVB 2XK5A 3B08A 1KJTA 3L17A 4HJKA 4WWPA 3L0WB 1UZXB 3PHWB 4KZ0A 2FIDA 2LGYA 5AZFA 2KDEB 2KXJA 2KJRA 3C0RB 3H6NA 4BBNF 4BOSC 1UBQA 1JRUA 4KSKC 3WIMA 2JY6A 3ENEA 3ZKJC 2G3QB 3M3JA 2GBKA 4PYUA 4ZDVA 2CR5A 4F8CB 2KJHB 2REXA 3W1YA 2K8HA 4IG7B 1R4NI 3CF6E 2GBMA 2ZPNA 1CMXB 2NBVB 2MBEA 3T9LA 1E8XA 2JRIB 3KH0A 2HD5B 2FCSA 1NDDA 2KNBA 2RD0A 3S2AA 3PRMB 3X0WA 2IYDB 5FR6A 2KTFA 3ZNGC 2L7RA 2M1MA 3A1QA 1KM7A 3JSVA 2GMIC 4W9IA 5G2NA 3RYTA 3VH3B 5D94A 4WJNA 4CYEA 4MSMB 1C1YB 1TGZB 1ISNA 2IO0B 4RM9A 1WGDA 5JHAA 1WH3A 3N3KB 2KTRB 1WE7A 2L8JA 2LRWA 5J2RA 4FHKA 2KDBA 2HTHA 1OEYA 1ZGUB 4BKGA 2LVOA 4XC2A 4NAWA 2BWFA 4A20A 3HM6X 2V3SA 4XZ4A 2WYQA 2XEWA 1SGHA 2RR9A 4TQ0A 1WR6E 3U30A 4M8MA 3ZRFA 4F7ZA 2LZ6A 1I42A 2Y5BB 2AL6A 1NI2A 1WXMA 2FAZA 4AJWA 3ZNHB 4DHJD 5JZEB 2V4LA 4MJSA 3U7DA 3TJPA 3V60A 1T0YA 2WX0A 3HM3A 4AP4C 4WWNA 5KHOA 4FADA 1YX6B 1WJUA 3QC8B 4LDTB 2N1WA 3K9OB 2MRPA 2DENB 1SIFA 2O6VA 2D11A 3OAWA 3JVZX 4XX5A 3VFKA 4AUQC 3PVLA 2J7QB 2I1KA 1YJ1A 4WAAA 5AZHA 3ZUNA 1C3TA 1V80A 2CHWA 1UGMA 2BYFA 3PGEA 4NAWB 4OVUA 4W9CA 4BKTA 3VTWA 1V5OA 1NBFC 2N4FA 3QAQA 2Z59B 4A3OA 1D3ZA 5CTRC 1TZ1A 4GDLA 4N9F4 1M94A 4FA6A 2M8SA 3ZIMA 2CS4A 3A9JB 1V6EA 2QHOA 3AU4A 3MJWA 4W9KA 3JW0X 3ZLZA 2JT4B 2K8BA 1E8YA 1WM3A 4WWOA 2LXAA 5L95C 2WWZA 2M4NA 4II3B 1WGYA 2MCNB 5AZGA 2O2VB 4J6IA 2KDFB 2ZCBA 4K7SA 3ALBA 4HXDA 3QA8A 4JLCA 4BVUC 1WIAA 3DCGA 4DXAB 1GJZA 4NJ7A 2IBIB 4MELA 2L3ZA 2IO3B 3OJ4B 2B3AA 3PZDA 4GDKA 3DVGY 4IM2A 4E3CA 3DDCB 4MGYE 2O6VB 1WZ3A 1WXSA 1OQYA 2O2VA 2MP2B 3UINB 4RMAA 3WALA 1Y8RC 2C5LC 1OGWA 2KVRA 2YVCA 3MTNB 1WXVA 1V81A 4BOZB 3VUXA 5LXHA 1X1MA 1V49A 2KOXA 3W1SA 3PSEB 4B9KA 2BWES 3R3MA 2N9XA 4FLHA 1PQSA 2JF5A 5E6OA 2KFKB 3AU5A 3KUZA 4LDTD 3L10B 1LQBA 4W9FA 4B6WA 2R2OA 2KANA 3UIPB 2MBBB 2ZPYA 3DQVA 4PYZA 5DPRA 2UWQA 4BKSD 4MGZE 3ZTCA 1ZKHA 3PLVA 4MDKE 3L54A 2JZZA 4ICVA 2M17A 1IP9A 2KX0A 4W9JA 2JVCA 2Z0DB 2IY0B 1WGRA 2K1FA 2KTRA 3AI5A 1GC7A 4GDLB 3SU8X 4AWJA 3IFWB 4KIKA 1S3SG 3QCAA 4LJPB 5TR5A 3MHSD 2EMSA 4CO7A 2Z0EB 2RPQA 2ZCCA 3H1UA 4JQWC 3A9JA 3JSVB 5L83A 3ZVVA 3ZO5B 3QJZA 3ML9A 1UBIA 1P1AA 3H7PB 3RT3B 2C7HA 2KMAA 1VD2A 2LVQA 1HE8A 1R4MI 3PHXB 5GMVA 1P98A 4NPNA 2CKHB 2AL3A 3A4SC 2R2QA 4GMVA 3ZDTA 2KMCA 2A5UA 2NBWB 1Z5SB 2KLCA 4LJOB 4IW0A 1QZEA 3WAPA 1V86A 4WQOB 1TTNA 2KWCA 2K6QA 3PLUA 3Q3JA 4GGQA 3KYCD 3VVWB 2GBRA 4ASWC 3ECIA 1V9JA 5IAAC 3V6CB 4KIKB 3HK0A 4HDOA 1GUAB 1EF5A 1WRDB 1XQQA 2LXCA 2JWZA 2MBQA 2AYOB 3LDZE 4WJOA 2KO3A 3SD5A 3N30A 1YQBA 2NS5A 4DBGA 3AXCA 2BGFA 2UYZB 2BKFA 4EZJA 5D7GA 3RCZA 2VRRB 2KC2A 3N32A 3SDLC 3WANA 1WYWB 5J18A 2ZNVB 5G55A 3JYUA 3UQBA 4K7WA 1WMHB 3WAMA 3NOBA 1WZ0A 2GOWA 2IO2B 2MBOA 3EC8A 3HIZA 3L16A 4BBNC 4KDLB 1RAXA 2D07B 4ZRKA 3ZDMC 1RLFA 2CHXA 3PTFC 3DPDA 3L08A 2LI5A 2G4SA 1WGGA 2KC1A 2M0XA 3A9KB 3TL5A 4JIOU 3M62B 2D2QA 2DX5B 2EKEC 4ANUA 2J0MA 5IA7A 2ZNVC 2JRHA 3KW5B 3U8ZA 1P9DU 3NHEB 4ANVA 1J8CA 1E8ZA 4HVBA 4GU2A 1WR1A 4TKNA 2DAJA 3KUDB 2LD9A 1EF1A 1RFAA 4EUTA 2WDTB 4W9HA 4EFOA 2N1VA 2C60A 4W9EA 1WX8A 3DBHI 2HE7A 4FBJB 3P2BA 4EZKA 1KLVA 2KWUB 3M63B 4G50A 4ZRJA 4AJYB 4B95A 3T8MA 2G45B 4WJPA 1LM8B 2NVUI 3IVFA 3QQ8B 1F9JA 1FXTB 1ZW7A 4HPLB 1V5TA 4I6LB 4M0WB 4RM8A 4IWPA 4NY0A 3UF8A 2PJHA 4DDGD 3DBLI 4FJVB 4K1RB 2MW5A 1XT9B 3V6EB 2L0TA 4I6PA 3A4RA 2NCNA 3KUCB 4ANXA 4MJSB 3CSTA 3DVGX 3ZRCA 1OEYJ 1WY8A 4DHZE 1UH6A 3OLMD 2JXXA 3DVNU 5BO4B 2L00B 4W9GA 4FULA 2K39A 1UD7A 4OVVA 5JH5C 2NR2A 2BYVE 2GBNA 1H4RA 3PRZA 4GB9A 4EOYA 3PS6A 4KZCA 4EZLA 1A5RA 2MX2A 4TUUA 2FUHB 4HDQA 2K6DB 4DHJB 2KJ6A 4W9LA 1AARA 1EO6A 4TV3A 3GZNI 2DZIA 2K8CA 1WF9A 1YIWA 4ZRIA 4E74A 2DZJA 2KFJA 3OJ3A 3ONSA 4P7IA 1P3QU 3O65B 2FCMA 1E90A 3B1LX 2BKRB 2A4ZA 2ZJDA 3PV1A 3VHTC 1Q5WB 3WAOA 4G0NB 4IM3A 2KHWB 3VTUA 1WM2A 4HWIB 3VQIA 1L7YA 3B0AA 5CHFA 3R7RA 2MBHA 3A33B 2NPTB 3PRPB 4HPMB 2HJ8A 4URKA 4K7UA 1J0GA 4LCDE 2J0KA 3QIJA 3L13A 4GXBA 5JHBA 2BPSA 2PE6B 1OTRB 2DYBA 5DPTA 2IZVB 3A1QB 3UQAA 3NZSA 4AOFA 1WFYA 2I1JA 3LJ3A 1P0RA 3UIOB 4JGHB 1U4AA 3BY4B 3V61A 2N9EB 1GC6A 4GDKB 2LRUA 1WX9A 3EHVA 4DK5A 2LGDA 2ZVNA 1GG3A 2DZKA 2BYEA 2J0JA 2KFKA 3A9KA 2V1YA 3HHMA 5AEKB 2MP2A 4GIVA 3KVFB 1XD3B 3RZWC 2MSED 4NQKE 5HKHA 5DPWA 3QK0A 2RGFA 2RSUA 4FHJA 4IWOA 3PPAA 4HK2A 1IPGA 2L0FA 2DAFA 1RRBA 3IG3A 4HCNB 5KHQA 2DYMA 3APDA 3R66C 2MA9B 4A3PA 2JZ3B 3ZTDA 2MLBA 3VTVA 2MQJA 2NBUA 4IC7B 4NQLB 3EFUA 2LJ5A 2DYOA 4FJYA 1LXDA 3EECA 1V2YA 2GBJA 3RZFA 5E6PA 4MEMA 2LASA 3RUIB 1TBEA 3ML8A 1E7VA 2JPHA 3RULA 1Q0WB 1YX5B 2BF8B 2KQ7A 2KX3A 3APCA 4I6NB 4NNJB 4DHZB 1WMHA 2KLGA 3M95A 4IUMB 2NPTA 2LGXA 4M8NA 1E5WA 3X23A 4BFRA 2OOBB 2KD0A 2L05A 1YD8U 3VAWA 3H7SA 3VUWA 3CSFA 5DPSA 4K81A 4E71A 1WE6A 4WJQA 4TQ1A 2KKCA 3QARA 3WA0A 4DDID 2JUOA 1BT0A 2KDIA 3NY5A 4KVGB 3VDZA 1E8WA 1LFDA 2O6VD 3IHPC 3NZUA 3Q3FA 3TIXA 3D32A 3DBRI 1H8CA 2AEHA 2CU1A 4FN2A 4GSWA 3QHTA 1WX7A 4X57B 2N7DA 3QWZB 1J19A 1WI0A 2PEAA 2ASQA 5EDSA 5C23A 2FCNA 2DZMA 2XBBC 2MWSB 4G3XB 1MG8A 2K25A 2L76A 5CHVC 4MGKE 2G4DB 2KK8A 4FJZA 2IY1B 1WGHA 3QX1A 4MSQB 3TBLD 5D6JB 3UGBB 2C7MB 1K8RB 1WJ6A 2W9NA 3CMMB 2WX1A 2KZRA 2LWPA 3ZW3A 3H9DA 1WJNA 2IO1B 3VXWA 4IM0A 3DVNV 4KDIC 2PE9A 2ZVOA 4ANWA 4HLEA 1IYFA 4NJ6A 4ZYNA 2FIFA 3IBEA 2KWVB 4MM3A 3SHQA 4GN1A 2N7EA 3TMPB 3ZNID 3GOEA 4II2B 1G6JA 2D10A 3RD2A 4KSLC 1UELA 3W1SC 1SE9A 3DOWA 3VUYA 1I35A 4KV2A 3PREA 4MH0E 4PS7A 4JL9A 4BKSA 2D3GA 4HCPB 4CHKA 3BINA 1VCBA 3ZNZB 1L2NA 2KN5A 2KQSA 2XK5B 5D2MB 3VH4B 5CHWA 3K9PB 5DCNA 1GNUA 1Q1OA 2C7NB 2FNJB 2CHZA 3I3TB 2OJRA 2LUEA 3PT2B 4IWQA 4YL8A 1WJ4A 3H7PA 4PS3A 5CX3A 4PS8A 3KYDD 2FCQA 4ICUA 3AULA 1E7UA 3DBSA 2AWTA 3R7QA 4W9DA 4EKUA 4DWFA 3APFA 2C9WB 2PPHA 1Z2MA 1S1QB 4F1SA
chains in the Genus database with same CATH superfamily
4G11A 3RNBC 3U7ZA 2OJWA 3V62A 5G5HA 3AV8A 2YLMA 4MGIE 1EUVB 3B2FA 3B08A 3R2TA 4A90A 4HJGE 1HQRD 2KJRA 4BBNF 4BOSC 1UBQA 3NVVA 2PKOA 3ZKJC 4S0RA 3C19A 4F8CB 1QQRA 4IG7B 3I63C 3CF6E 1CJEA 1CMXB 4A9AA 2NBVB 1P7FA 3T9LA 2JRIB 3KH0A 2FCSA 1C4AA 3PO0A 1YMHE 1GPXA 2IYDB 3E56A 5FR6A 1QILA 2WDQB 1QOAA 1ZOYB 3IT6B 1WGDA 5JHAA 1WH3A 1N61A 2KDBA 2HTHA 2GRIA 2BVCA 4XZ4A 2XEWA 4TQ0A 1WR6E 3TEYA 2KN4A 2WXRA 1FNWA 3ZRFA 3SFEB 1I42A 2QSDA 1RWSA 2MJ3A 3ZXVA 4DHJD 2V4LA 1T0YA 2WX0A 4LDTB 2O6VA 5HI1A 2D11A 1C3TA 3NJTA 3ZUNA 1T0RC 4OVUA 3VTWA 1TZOA 2Z59B 5HFYA 4GDLA 4N9F4 1M94A 3A9JB 3AU4A 2TSSA 3ZLZA 1JWMD 1WM3A 1C76A 5L95C 1VDVA 2AQ1B 2MCNB 2O2VB 4K7SA 1HZ6A 1AN8A 4DXAB 2LHEA 1KRHA 2QCZA 3DVGY 1WZ3A 1WXSA 1Q10A 2LJIA 3UINB 5GXGB 4B0EA 1Y8RC 1WXVA 5LXHA 1UGJA 3VRBB 2KOXA 2ICIA 3W1SA 4UDUC 1YQ4B 3OWEB 3R3MA 1ZE3D 4FLHA 1XLNA 3AE9B 5DPRA 1PGAA 3PLVA 3L54A 1SEBD 2BQQA 2KX0A 4W9JA 4GDLB 1JALA 3AI5A 3IFWB 1I4PA 2J53A 4KIKA 3QCAA 2IDYA 2VH1A 3MHSD 2Z0EB 3H1UA 3A9JA 3JSVB 4JX1C 4US9A 2FUG1 3ZO5B 3ML9A 1UBIA 1P1AA 4DXGA 2KMAA 1VD2A 1FCCC 2I2YA 4NPNA 2CKHB 1TKYA 2KACA 4GMVA 2A5UA 3WAPA 4Q2JA 1V86A 4GGQA 1DOYA 3KYCD 3I5JC 1V1PA 2MHJA 2LXCA 1FCLA 4B0MA 4XDDA 1EM7A 1YQBA 3AXCA 1RFKA 4A55A 2BKFA 3ZQ4A 3SDLC 1TS3A 2ZNVB 3JYUA 4K7WA 3P63A 5IKCM 2MBOA 3HIZA 2PVOD 4HEA1 2X8XX 1HEZE 1IGCA 1RLFA 3DPDA 4XWWA 2DX5B 2E6XA 1NI3A 1FNVA 5IA7A 2LD9A 1EF1A 4EUTA 4OZAA 5BMIA 4P6VF 2N1VA 5I4DA 2FE8A 4EZKA 2KWUB 4C56C 4ZRJA 4AJYB 4WJPA 2L32A 1V97A 3QQ8B 1ZW7A 2RDBC 1V5TA 4DDGD 1MG4A 4FJVB 4N59A 4I6PA 3A4RA 1J7AA 3RFZB 2HDEA 3CSTA 2QIEB 1N60A 4DHZE 3OLMD 3W2DA 5BO4B 1FFUA 4OVVA 1YN5A 1H4RA 4GB9A 3PS6A 4BZAA 2D3CA 2MX2A 3Q6BA 1MPEA 4C7YA 3GZNI 1YIWA 4E74A 3Q8AA 3AEAB 3P4QB 2KFJA 2GB1A 4P7IA 1P3QU 1I4QA 2MEKA 2GI9A 3VHTC 1Q5WB 4G0NB 1N63A 3VTUA 1WM2A 1KTKA 2VZKB 1WXQA 3ZYYX 3PRPB 1J0GA 4HPMB 3FILB 5JHBA 2DYBA 2WXJA 3A1QB 1GB1A 5EE1A 3AEFB 1GC6A 2LRUA 3EHVA 2ZVNA 2DZKA 1XD3B 4NQKE 5HKHA 3BIID 2RGFA 1WSPA 3PPAA 1FPYA 2Y5CA 3APDA 1AYFA 4HKQA 4FJYA 1K53A 2W3SA 2WXNA 2GBJA 1DGJA 3E9SA 3RUIB 2BB5A 4L2YA 4I6NB 2KLGA 4BFRA 4N6EB 3VAWA 1L5PA 5DPSA 1HA5A 3W5VB 2Q5WD 3MFGA 1L0VB 4WJQA 3QARA 3WA0A 1BT0A 1L6UA 2O6VD 1H8CA 2ON8A 2XN9C 2W82A 1PGXA 4X57B 3EA6A 1J19A 1WI0A 5EDSA 2ASQA 5C3JB 2FCNA 2MWSB 4XE0A 1MG8A 2L76A 5CHVC 4MGKE 3CIRB 3KWLA 4FJZA 1CZPA 3TBLD 3BZDB 3ZJTA 1R7SA 1QLBB 2JYEA 2LWPA 4KDIC 4RGTA 1XLOA 2FIFA 1WRIA 1QT9A 4MM3A 3TMPB 2D10A 3DOWA 3VUYA 4MH0E 4HCPB 4CHKA 3NVZA 4JE3B 1L2NA 2KN5A 3VH4B 3DBRB 2B76B 2OJRA 4YL8A 2KVZA 2LGSA 5CX3A 1FM0D 1TJEA 1XCQL 1IBXB 3R2IA 3DBSA 5H92C 3APFA 4C00A 2C9WB 5BMGA 1S1QB 4F1SA 2ZZPB 4GOCA 1KOTA 3W5UB 2INPE 4ACFA 5LLIA 3I9V1 3HRDD 1ZXIA 3Q69A 3TEZA 1SXTA 4HJKA 1HTQA 2IGHA 1QOBA 2ACZB 1JCKB 2LGYA 1VZ8A 4RCOA 2Y3AA 4KSKC 3TEWA 4ZDVA 2KJHB 2REXA 3W1YA 2WXGA 3P4SB 4FXCA 3TSSA 3PRMB 3RNEC 2PMVA 4ZHPA 2KTFA 4IOIE 3ZNGC 3AH7A 2L7RA 2M1MA 3A1QA 3JSVA 2GMIC 4WJNA 1SF0A 1TGZB 1ISNA 4JWSC 1N6ZA 5J2RA 4FHKA 1ZGUB 2BWFA 2G1EA 2M56B 1E9MA 3U30A 1SIJA 1C4CA 3HVDA 4M02A 4YT0B 2Y5BB 3H8HA 3GZNB 1WXMA 2FAZA 2KMMA 1J7BA 4LNFA 4MJSA 3V60A 4WWNA 5KHOA 3QC8B 3VFKA 2DENB 3PVLA 5HHDG 4WAAA 1TIFA 4AS1A 2CHWA 3VR9B 1UGMA 1V5OA 3B9JA 2N4FA 3QAQA 1AWDA 1VR9A 1D3ZA 5CTRC 2MJDA 1I7HA 2M8SA 2G9HD 2CS4A 4WH4A 2JT4B 2K8BA 3BYYB 4J6IA 1TY0A 4JLCA 2WP9B 3ALBA 3QA8A 1EU3A 1GJZA 3GS2A 2IBIB 4MELA 1SE4A 2IO3B 2V9HA 4GLSC 4MGYE 2BS3B 1L6VA 2O6VB 2O2VA 4YSYB 1AW7A 3TEXA 2IJ0A 1C4PA 2C5LC 2YVCA 3MTNB 4BOZB 3VUXA 2JQRB 3PZ7A 2WXFA 3P4RB 1PQSA 2JF5A 3DWGC 2KFKB 3LB8C 1L0YB 4ARCA 3UIPB 2ZPYA 5AUIA 3DQVA 4PYZA 4BKSD 1OFFA 2UWQA 2V4IB 2JZZA 2JVCA 1VRAB 1WGRA 2KTRA 4YXDB 1GC7A 4JPSA 5AUKA 5TR5A 4OZBA 1UF0A 4WQMA 1LO5D 4JQWC 3ZVVA 3AEDB 3H7PB 1T3QA 3DHGC 1HE8A 3PHXB 1Z5SB 2INDC 2KWCA 2INCC 5IO9A 4PK1A 4ASWC 3ECIA 3V6CB 4KIKB 3HK0A 4HDOA 1GUAB 1XQQA 5H8YE 4YSZB 2VH2A 2PTLA 1NEKB 1STEA 3LDZE 4WJOA 2NS5A 2BGFA 4RGMA 3NZ3A 3RNAC 2KC2A 1F2RC 4LNOA 1WYWB 5J18A 3UQBA 1ESFA 3NOBA 4USAA 4BBNC 4NZLB 1RAXA 2D07B 4ZRKA 1KFYB 1VZ6A 3WCQA 1XLPA 3PTFC 2LI5A 2KC1A 3TL5A 3M62B 2NTTA 1M4VA 2ZNVC 4ANVA 4HVBA 1RFAA 5BMHA 2C60A 3DBHI 3P2BA 3BVZA 1KLVA 2NVUI 1FXTB 4I6LB 4IWPA 3UF8A 2PJHA 3DBLI 1XT9B 1EWYC 2L0TA 3KUCB 3IAS1 3U2SC 3N1ZC 4MJSB 3DVGX 1OEYJ 2ONQA 2DLBA 4W9GA 1UD7A 2V3PA 1I4GA 1E7PB 4KZCA 4EZLA 1IUEA 1SSNA 2MJEA 4HDQA 2Z8LA 2N9LA 2KJ6A 1FEHA 1L0XB 2K8CA 4ZRIA 4US8A 1IGDA 4ZRPA 3B1LX 2KAJA 1F77A 1E0ZA 4P16A 2KYWA 5CHFA 3R7RA 1N5XA 4RH6A 2WXOA 3QIJA 3L13A 4GXBA 4R3DA 1JWSD 2PE6B 4HRSA 2D5GA 3UQAA 2I1JA 1U4AA 3BY4B 4JWUC 2N9EB 3AE6B 4DK5A 2LGDA 5BYQA 1E10A 2BYEA 2KFKA 5AEKB 1FFVA 3RZWC 2MSED 2QDFA 4YTPB 2K5PA 4YSXB 1F0ZA 1RRBA 5KHQA 2JU6X 1QF6A 3R66C 3ZTDA 2MLBA 5EE3A 5FK9C 2MQJA 3VTVA 2NBUA 4IC7B 2LJ5A 2DYOA 1LXDA 4YTMB 2OHFA 1IBXA 3DHIC 3Q3MC 3ML8A 3RULA 2BYTA 2KX3A 2BF8B 3APCA 4LNIA 2ZW1A 4MACA 1E5WA 4M8NA 5IP4D 2OOBB 3Q14C 1C77A 5BYSA 1WE6A 3ZJUA 3Q3OC 2VZKD 2CU1A 4GSWA 3VRAB 1ENFA 1CK1A 2PEAA 1UNSA 1TT5B 1MFWA 2XBBC 3N1YC 2M0AA 4G3XB 2K25A 1MHXA 1NYQA 2G4DB 4M00A 1WGHA 3UGBB 5FR3A 1K8RB 2DBYA 2WX1A 3ZW3A 2IO1B 4IM0A 1K51A 4LTUA 2ZVOA 3GE8C 1C9FA 1GOZA 3IBEA 1N5WA 4GN1A 2N7EA 1FRRA 4IDIA 1BXTA 2WXPA 4DXFA 4KV2A 5BYRA 3P1MA 4JL9A 4XWTA 4KKIA 3BINA 1VCBA 3ZNZB 4OZCA 3U4EG 1MJDA 1FRDA 2X38A 3K9PB 1Q1OA 2C7NB 2CHZA 2FNJB 1WWTA 4PS3A 4PS8A 4BAXA 2FCQA 3R7QA 4OVZA 3J9CA 4HROA 4DWFA 2JXTA 2PW9A 4W9HA 4KGTA 1Z2MA 4ZOHC 1WXAA 2LVPA 3NS8A 5J17A 4AQ7A 2EMTA 5C1ZA 5E6NA 2ZEQA 2BS2B 4EE2A 4EEWA 2N9PC 2IPKD 3FKYA 2XK5A 3NUHB 1KJTA 4WWPA 1SB3C 3L0WB 2HTME 1UZXB 1R4MB 4KZ0A 2KDEB 2IGDA 3H6NA 3BVMA 1JRUA 2GBKA 2CR5A 1ET6A 1R4NI 3RMKC 1J7CA 2ZPNA 2WXMA 1Y56A 3Q2AC 2MBEA 1B9RA 1E8XA 2HD5B 2LEKA 1BMLC 1T0SC 3FILA 3S2AA 3AE1B 5MPOA 3X0WA 4P1CC 1C79A 1KM7A 4W9IA 1F1HA 3VH3B 5D94A 4CYEA 4HKZE 3SEBA 4RM9A 4MT5A 3HUIA 2KTRB 2L8JA 2LRWA 2LVOA 4NAWA 4A20A 4KKJA 2N7JA 4M8MA 2LZ6A 2AL6A 1NVID 3NVWA 4AJWA 1BUIC 1E6EB 1TKGA 1ZDXA 3ZNHB 3Q8BA 4ZYSA 5JZEB 3TJPA 4AP4C 3HM3A 2WGSA 4FADA 2JX5A 1YX6B 2N1WA 2MRPA 1YJJA 3JVZX 1F52A 3LXFA 5FKAC 2J7QB 5AZHA 2WU2B 1V80A 4W9CA 2WXKA 3SR6A 4A3OA 1K52A 1KLGD 2WNMA 1TZ1A 4FA6A 1V6EA 2QHOA 3MJWA 4W9KA 3JW0X 1E8YA 3PZ8A 2WWZA 1WGYA 5AZGA 4NJCA 2KDFB 2ZCBA 4BVUC 4RFBA 4NJ7A 4GDKA 2B3AA 4E3CA 3DDCB 1PGBA 2MP2B 4RMAA 4ZRQA 2KVRA 1OGWA 3MC9A 1X1MA 1DOXA 3PSEB 2BWES 1A70A 5E6OA 3AU5A 2H89B 3L10B 4W9FA 2R2OA 3IAM1 2MBBB 2WU5B 4MGZE 2LFIA 4ICVA 2M17A 1UWXA 2BT6A 2W55A 2Z0DB 5IOIA 2K1FA 3SU8X 1V1PB 1LGRA 1V8CA 3DBHB 1S3SG 2D3AA 5EE9A 3FAHA 2ZCCA 2W3RA 2D3BA 2SAKA 1PDXA 3RT3B 2C7HA 1T0QC 1KH0A 1JQ4A 1P98A 2ZW0A 2AL3A 3A4SC 3ZDTA 2KMCA 2NBWB 4LJOB 4YWGG 1QZEA 3N9YC 1TTNA 2K6QA 3PLUA 3VVWB 2MH7A 4RF1A 2GBRA 3AN1A 1V9JA 2N9KA 1PUTA 4KGSA 1EF5A 3NG0A 2JWZA 2MBQA 3P42A 2AYOB 1VJKA 2KO3A 3N30A 4DBGA 2UYZB 4RGOS 5D7GA 2VRRB 1PYWD 1XLQA 3B2GA 5G55A 1WMHB 1WZ0A 2IO2B 1OQRA 4KDLB 3AEEB 1D4BA 2DNFA 1FXAA 2PVGC 1UWMA 2CHXA 2NTSA 2QJLA 3L08A 2M0XA 4ANUA 2J0MA 3UI3A 2JRHA 5G5GA 3U8ZA 1E8ZA 4TMAB 4GU2A 1WR1A 4TKNA 1XEEA 2WDTB 4MH8A 1JW9D 4EFOA 4W9EA 4XDCA 2XNAC 2DWQA 2HE7A 1ZUD2 3T8MA 2G45B 2QMTA 3IVFA 3DWMA 2LHDA 4HPLB 4M0WB 4NY0A 4K1RB 2FBWB 1JROA 1D5XC 2NCNA 2CJNA 3VR8B 2L00B 2E3TA 4FULA 4RGNA 5JH5C 4MM3B 2BYVE 3PRZA 4EOYA 3Q8CA 2BBCA 2NMQA 2JWUA 2K6DB 3T3OA 2WLBA 4TV3A 1PFDA 2L1AA 1YJIA 3OJ3A 3OG5A 3O65B 1E90A 4WWMA 2BKRB 2ZJDA 4IM3A 2KHWB 4HWIB 1L7YA 3B0AA 3AM9A 1XCTL 3A33B 2WS3B 4XYCA 2BPSA 1B1ZA 2IZVB 1TS4A 3UIOB 3V61A 1GG3A 2BS4B 3HHMA 2AQ2B 1D5ZC 3EUB2 3IT4B 4REZA 5DPWA 3QK0A 2R61A 2L0FA 2DAFA 2DYMA 1ZXHA 2MA9B 1TS5A 3BWUD 3V05A 2JZ3B 4NQLB 3EFUA 2EELA 1D6EC 4KX6B 5EE0A 1GB4A 4MEMA 2LASA 2JPHA 2AX5A 2KQ7A 4DHZB 3SFDB 3M95A 4IUMB 2LGXA 2KD0A 1YD8U 3AE8B 3VUWA 3CSFA 4K81A 4S17A 3AE7B 4N58A 1NYRA 2JUOA 1R4NB 4J3OD 3VDZA 3RPFC 1LFDA 3IHPC 3Q3FA 3TIXA 4HPPA 3D32A 2AEHA 2I38A 3MC8A 2AQ3B 2N7DA 3QWZB 5C2TB 2DZMA 3GE3C 1HXYD 4O1NA 4H2AA 2KK8A 2JYTA 2IY1B 4MSQB 5LNK1 2WDRB 1YNTE 2C7MB 2W9NA 3CMMB 3H9DA 1WJNA 3VXWA 2RMMA 4K3BA 3NVYA 4HLEA 4WAFA 4NJ6A 1F2RI 4ZYNA 3I57A 4P1BC 2KWVB 3SHQA 3ZNID 3GOEA 4KSLC 1UELA 3W1SC 1SE9A 1JWUD 1V1OA 1I35A 4A6QA 1T5XD 2D3GA 3ZXRA 4ITKA 1MVKA 2KQSA 5DCNA 1GNUA 2YEPF 3KYDD 4ICUA 1E7UA 1C78A 4W9DA 4EKUA 2N0SB 3U52E 3KLSX 4RM8A 2BB6A 4OHJA 3KQ4A 2UU7A 2WQYB 3TCAA 2DHZA 3GP7A 5LXIB 2EKIA 1ET9A 1QOFA 3EGRA 3L17A 3RNGC 2GLSA 2L83A 3PHWB 2FIDA 2M19A 5AZFA 2KT7A 2KXJA 3AEBB 3C0RB 3WIMA 2JY6A 3ENEA 2G3QB 3M3JA 4PYUA 2K8HA 1K50A 1RYJA 1FNUA 2GBMA 2K3UA 3N20C 3NRZA 3BVGA 2IGGA 2YEPB 1I4HA 1NDDA 2KNBA 2RD0A 1YN3A 2LGIA 1RM6C 2KQ4X 3RYTA 5G2NA 4MSMB 1C1YB 3AMZA 2IO0B 3N3KB 1WE7A 2KDMA 1OEYA 4BKGA 4XC2A 2WXLA 2OEDA 2HJ1A 2V3SA 3HM6X 2K0PA 2WYQA 1SGHA 2RR9A 4K3CA 4F7ZA 1NI2A 5D3IB 3BYTB 3U7DA 4OW0A 1HTOA 1WJUA 3K9OB 3OAWA 1QOGA 1SIFA 4AUQC 4XX5A 2I1KA 1YJ1A 3BK2A 2LMCA 2BYFA 3PGEA 4NAWB 4BKTA 1NBFC 1XF5L 3EFCA 3URYA 1XO3A 3DBLB 3ZIMA 1QKZA 4CQNA 4WWOA 2LXAA 4II3B 2M4NA 4HXDA 1WIAA 1XXGA 3DCGA 1ROEA 2L3ZA 3OJ4B 3RI7C 3PZDA 4IM2A 4WURA 4LNNA 3ETRA 1OQYA 1YOVB 3WALA 1SJHD 1V81A 3ZGZA 1V49A 1ZP0B 3DHHC 4B9KA 3IXSA 4ZHOA 1MHHE 2N9XA 3KUZA 4LDTD 2WXHA 1LQBA 4B6WA 2J42A 2KANA 3N1XC 3ZTCA 1JWBD 1ZKHA 4MDKE 3C8YA 1IP9A 3RN9C 2KWDA 2IY0B 1CQVA 1YQ3B 4AWJA 1FMAD 4LJPB 2QILA 1FIQA 2EMSA 4CO7A 2RPQA 5E6JA 5L83A 3QJZA 2L52A 3AE4B 3RNCC 1TS2A 2JSVX 2LVQA 2WHIA 1L4ZB 4TSSA 1R4MI 5GMVA 2R2QA 1JRPA 2KLCA 4KGRA 4IW0A 4WQOB 3Q3JA 2RDGA 5IAAC 1WRDB 1I4XA 3AE3B 2WXQA 1DYQA 4C7ZA 2LUMA 3SD5A 4C80A 1YN4A 4EZJA 3RCZA 3N32A 3L4PA 3WANA 3WAMA 2GOWA 3EC8A 3L16A 1J8CA 3Q8EA 3ZDMC 1P7EA 4LK0M 1EWCA 4QAYA 2G4SA 1WGGA 1FD6A 3A9KB 4JIOU 2PLPA 2D2QA 2EKEC 4M01A 2RDHA 3RNFC 3KW5B 1P9DU 3NHEB 4C4VA 1OQQA 2DAJA 1SE3A 3KUDB 1WX8A 3MHZA 4FBJB 3M63B 1JMLA 5IN7A 4G50A 2BW2A 4B95A 4C4VB 2INNE 5HG2A 1LM8B 1F9JA 5D3DA 3MC0B 1FXIA 1SJED 2MW5A 3V6EB 4ANXA 2SEBD 2J52A 3ZRCA 1WY8A 1UH6A 2JXXA 3DVNU 5T8IA 2K39A 2NR2A 2GBNA 4IKGA 2RPVA 1JWAD 1TY2A 1A5RA 3Q3NC 3AB5A 4TUUA 2FUHB 1TYGB 4DHJB 2CJOA 4W9LA 1AARA 3AE2B 1EO6A 2K9XA 2DZIA 1NENB 1WF9A 3KWVA 2DZJA 3ONSA 2FCMA 3W9CB 2A4ZA 3PV1A 1UUPA 4L1BA 1ACCA 3WAOA 1T6BX 1MI0A 3R8BA 3VQIA 2MBHA 2NPTB 3GB1A 2HJ8A 4URKA 4K7UA 4LCDE 2J0KA 2QC8A 3AEGB 2K22A 1OTRB 1N62A 5DPTA 3NZSA 4AOFA 1WFYA 3LJ3A 3AECB 1P0RA 3BK1A 4JGHB 4LLGM 4GDKB 1WX9A 3ZJVA 2J0JA 3A9KA 2V1YA 2MP2A 4GIVA 3KVFB 4PT5A 3HVZA 1SE2A 4M0WA 2V3NA 4LNKA 1DOIA 2RSUA 3P4PB 4FHJA 4IWOA 4HK2A 1IPGA 4HCNB 3IG3A 2W54A 4A3PA 3LYYA 3CWIA 1FO4A 4D2KA 1L4DB 1VLBA 1V2YA 3EECA 1HZ5A 3RZFA 3ABVB 5E6PA 1TBEA 1E7VA 1Q0WB 1YX5B 5TSSA 4YTNB 2H88B 4NNJB 1WMHA 2NPTA 3X23A 2L05A 5JXVA 3H7SA 4ARIA 2WXIA 2J4XA 2WDVB 4A8XC 1TKEA 4E71A 1SBBB 3NS1A 4TQ1A 2KKCA 4DDID 4RF0A 2Y5PA 2KDIA 3NY5A 4KVGB 2BTEA 4DQOC 3T3NA 1E8WA 1GAQB 3MP9A 3NZUA 1WGKA 2CU3A 3DBRI 3FC4A 4FN2A 4L23A 3QHTA 1WX7A 1KF6B 3V3XA 5C23A 4WIPA 3TUOA 3QX1A 5D6JB 1ZDVA 1D5MC 1WJ6A 2KZRA 3O13A 4XGAB 3DVNV 2PE9A 4ANWA 2QEJC 1IYFA 2PIAA 4NAMA 3Q8FA 4II2B 1G6JA 3RD2A 2JZPA 1EU4A 3PREA 4PS7A 4BKSA 1KLUD 2V0GA 2XK5B 5D2MB 5CHWA 3I3TB 2LUEA 3MJ5A 3PT2B 4IWQA 1WJ4A 3H7PA 4RNAA 3AULA 2AWTA 1VZ7A 1ZPSA 2PPHA 1I4RA 3AE5B 1WYGA
chains in the Genus database with same CATH topology
1WXAA 2LVPA 3NS8A 4G11A 5J17A 2ZZPB 4GOCA 1KOTA 2EMTA 5C1ZA 5E6NA 3TCAA 3V62A 2ZEQA 2DHZA 5LLIA 4EEWA 2YLMA 5LXIB 2N9PC 4MGIE 1EUVB 2XK5A 3B08A 1KJTA 3L17A 4HJKA 4WWPA 3L0WB 1UZXB 3PHWB 4KZ0A 2FIDA 2LGYA 5AZFA 2KDEB 2KXJA 2KJRA 3C0RB 3H6NA 4BBNF 4BOSC 1UBQA 1JRUA 4KSKC 3WIMA 2JY6A 3ENEA 3ZKJC 2G3QB 3M3JA 2GBKA 4PYUA 4ZDVA 2CR5A 4F8CB 2KJHB 2REXA 3W1YA 2K8HA 4IG7B 1R4NI 3CF6E 2GBMA 2ZPNA 1CMXB 2NBVB 2MBEA 3T9LA 1E8XA 2JRIB 3KH0A 2HD5B 2FCSA 1NDDA 2KNBA 2RD0A 3S2AA 3PRMB 3X0WA 2IYDB 5FR6A 2KTFA 3ZNGC 2L7RA 2M1MA 3A1QA 1KM7A 3JSVA 2GMIC 4W9IA 5G2NA 3RYTA 3VH3B 5D94A 4WJNA 4CYEA 4MSMB 1C1YB 1TGZB 1ISNA 2IO0B 4RM9A 1WGDA 5JHAA 1WH3A 3N3KB 2KTRB 1WE7A 2L8JA 2LRWA 5J2RA 4FHKA 2KDBA 2HTHA 1OEYA 1ZGUB 4BKGA 2LVOA 4XC2A 4NAWA 2BWFA 4A20A 3HM6X 2V3SA 4XZ4A 2WYQA 2XEWA 1SGHA 2RR9A 4TQ0A 1WR6E 3U30A 4M8MA 3ZRFA 4F7ZA 2LZ6A 1I42A 2Y5BB 2AL6A 1NI2A 1WXMA 2FAZA 4AJWA 3ZNHB 4DHJD 5JZEB 2V4LA 4MJSA 3U7DA 3TJPA 3V60A 1T0YA 2WX0A 3HM3A 4AP4C 4WWNA 5KHOA 4FADA 1YX6B 1WJUA 3QC8B 4LDTB 2N1WA 3K9OB 2MRPA 2DENB 1SIFA 2O6VA 2D11A 3OAWA 3JVZX 4XX5A 3VFKA 4AUQC 3PVLA 2J7QB 2I1KA 1YJ1A 4WAAA 5AZHA 3ZUNA 1C3TA 1V80A 2CHWA 1UGMA 2BYFA 3PGEA 4NAWB 4OVUA 4W9CA 4BKTA 3VTWA 1V5OA 1NBFC 2N4FA 3QAQA 2Z59B 4A3OA 1D3ZA 5CTRC 1TZ1A 4GDLA 4N9F4 1M94A 4FA6A 2M8SA 3ZIMA 2CS4A 3A9JB 1V6EA 2QHOA 3AU4A 3MJWA 4W9KA 3JW0X 3ZLZA 2JT4B 2K8BA 1E8YA 1WM3A 4WWOA 2LXAA 5L95C 2WWZA 2M4NA 4II3B 1WGYA 2MCNB 5AZGA 2O2VB 4J6IA 2KDFB 2ZCBA 4K7SA 3ALBA 4HXDA 3QA8A 4JLCA 4BVUC 1WIAA 3DCGA 4DXAB 1GJZA 4NJ7A 2IBIB 4MELA 2L3ZA 2IO3B 3OJ4B 2B3AA 3PZDA 4GDKA 3DVGY 4IM2A 4E3CA 3DDCB 4MGYE 2O6VB 1WZ3A 1WXSA 1OQYA 2O2VA 2MP2B 3UINB 4RMAA 3WALA 1Y8RC 2C5LC 1OGWA 2KVRA 2YVCA 3MTNB 1WXVA 1V81A 4BOZB 3VUXA 5LXHA 1X1MA 1V49A 2KOXA 3W1SA 3PSEB 4B9KA 2BWES 3R3MA 2N9XA 4FLHA 1PQSA 2JF5A 5E6OA 2KFKB 3AU5A 3KUZA 4LDTD 3L10B 1LQBA 4W9FA 4B6WA 2R2OA 2KANA 3UIPB 2MBBB 2ZPYA 3DQVA 4PYZA 5DPRA 2UWQA 4BKSD 4MGZE 3ZTCA 1ZKHA 3PLVA 4MDKE 3L54A 2JZZA 4ICVA 2M17A 1IP9A 2KX0A 4W9JA 2JVCA 2Z0DB 2IY0B 1WGRA 2K1FA 2KTRA 3AI5A 1GC7A 4GDLB 3SU8X 4AWJA 3IFWB 4KIKA 1S3SG 3QCAA 4LJPB 5TR5A 3MHSD 2EMSA 4CO7A 2Z0EB 2RPQA 2ZCCA 3H1UA 4JQWC 3A9JA 3JSVB 5L83A 3ZVVA 3ZO5B 3QJZA 3ML9A 1UBIA 1P1AA 3H7PB 3RT3B 2C7HA 2KMAA 1VD2A 2LVQA 1HE8A 1R4MI 3PHXB 5GMVA 1P98A 4NPNA 2CKHB 2AL3A 3A4SC 2R2QA 4GMVA 3ZDTA 2KMCA 2A5UA 2NBWB 1Z5SB 2KLCA 4LJOB 4IW0A 1QZEA 3WAPA 1V86A 4WQOB 1TTNA 2KWCA 2K6QA 3PLUA 3Q3JA 4GGQA 3KYCD 3VVWB 2GBRA 4ASWC 3ECIA 1V9JA 5IAAC 3V6CB 4KIKB 3HK0A 4HDOA 1GUAB 1EF5A 1WRDB 1XQQA 2LXCA 2JWZA 2MBQA 2AYOB 3LDZE 4WJOA 2KO3A 3SD5A 3N30A 1YQBA 2NS5A 4DBGA 3AXCA 2BGFA 2UYZB 2BKFA 4EZJA 5D7GA 3RCZA 2VRRB 2KC2A 3N32A 3SDLC 3WANA 1WYWB 5J18A 2ZNVB 5G55A 3JYUA 3UQBA 4K7WA 1WMHB 3WAMA 3NOBA 1WZ0A 2GOWA 2IO2B 2MBOA 3EC8A 3HIZA 3L16A 4BBNC 4KDLB 1RAXA 2D07B 4ZRKA 3ZDMC 1RLFA 2CHXA 3PTFC 3DPDA 3L08A 2LI5A 2G4SA 1WGGA 2KC1A 2M0XA 3A9KB 3TL5A 4JIOU 3M62B 2D2QA 2DX5B 2EKEC 4ANUA 2J0MA 5IA7A 2ZNVC 2JRHA 3KW5B 3U8ZA 1P9DU 3NHEB 4ANVA 1J8CA 1E8ZA 4HVBA 4GU2A 1WR1A 4TKNA 2DAJA 3KUDB 2LD9A 1EF1A 1RFAA 4EUTA 2WDTB 4W9HA 4EFOA 2N1VA 2C60A 4W9EA 1WX8A 3DBHI 2HE7A 4FBJB 3P2BA 4EZKA 1KLVA 2KWUB 3M63B 4G50A 4ZRJA 4AJYB 4B95A 3T8MA 2G45B 4WJPA 1LM8B 2NVUI 3IVFA 3QQ8B 1F9JA 1FXTB 1ZW7A 4HPLB 1V5TA 4I6LB 4M0WB 4RM8A 4IWPA 4NY0A 3UF8A 2PJHA 4DDGD 3DBLI 4FJVB 4K1RB 2MW5A 1XT9B 3V6EB 2L0TA 4I6PA 3A4RA 2NCNA 3KUCB 4ANXA 4MJSB 3CSTA 3DVGX 3ZRCA 1OEYJ 1WY8A 4DHZE 1UH6A 3OLMD 2JXXA 3DVNU 5BO4B 2L00B 4W9GA 4FULA 2K39A 1UD7A 4OVVA 5JH5C 2NR2A 2BYVE 2GBNA 1H4RA 3PRZA 4GB9A 4EOYA 3PS6A 4KZCA 4EZLA 1A5RA 2MX2A 4TUUA 2FUHB 4HDQA 2K6DB 4DHJB 2KJ6A 4W9LA 1AARA 1EO6A 4TV3A 3GZNI 2DZIA 2K8CA 1WF9A 1YIWA 4ZRIA 4E74A 2DZJA 2KFJA 3OJ3A 3ONSA 4P7IA 1P3QU 3O65B 2FCMA 1E90A 3B1LX 2BKRB 2A4ZA 2ZJDA 3PV1A 3VHTC 1Q5WB 3WAOA 4G0NB 4IM3A 2KHWB 3VTUA 1WM2A 4HWIB 3VQIA 1L7YA 3B0AA 5CHFA 3R7RA 2MBHA 3A33B 2NPTB 3PRPB 4HPMB 2HJ8A 4URKA 4K7UA 1J0GA 4LCDE 2J0KA 3QIJA 3L13A 4GXBA 5JHBA 2BPSA 2PE6B 1OTRB 2DYBA 5DPTA 2IZVB 3A1QB 3UQAA 3NZSA 4AOFA 1WFYA 2I1JA 3LJ3A 1P0RA 3UIOB 4JGHB 1U4AA 3BY4B 3V61A 2N9EB 1GC6A 4GDKB 2LRUA 1WX9A 3EHVA 4DK5A 2LGDA 2ZVNA 1GG3A 2DZKA 2BYEA 2J0JA 2KFKA 3A9KA 2V1YA 3HHMA 5AEKB 2MP2A 4GIVA 3KVFB 1XD3B 3RZWC 2MSED 4NQKE 5HKHA 5DPWA 3QK0A 2RGFA 2RSUA 4FHJA 4IWOA 3PPAA 4HK2A 1IPGA 2L0FA 2DAFA 1RRBA 3IG3A 4HCNB 5KHQA 2DYMA 3APDA 3R66C 2MA9B 4A3PA 2JZ3B 3ZTDA 2MLBA 3VTVA 2MQJA 2NBUA 4IC7B 4NQLB 3EFUA 2LJ5A 2DYOA 4FJYA 1LXDA 3EECA 1V2YA 2GBJA 3RZFA 5E6PA 4MEMA 2LASA 3RUIB 1TBEA 3ML8A 1E7VA 2JPHA 3RULA 1Q0WB 1YX5B 2BF8B 2KQ7A 2KX3A 3APCA 4I6NB 4NNJB 4DHZB 1WMHA 2KLGA 3M95A 4IUMB 2NPTA 2LGXA 4M8NA 1E5WA 3X23A 4BFRA 2OOBB 2KD0A 2L05A 1YD8U 3VAWA 3H7SA 3VUWA 3CSFA 5DPSA 4K81A 4E71A 1WE6A 4WJQA 4TQ1A 2KKCA 3QARA 3WA0A 4DDID 2JUOA 1BT0A 2KDIA 3NY5A 4KVGB 3VDZA 1E8WA 1LFDA 2O6VD 3IHPC 3NZUA 3Q3FA 3TIXA 3D32A 3DBRI 1H8CA 2AEHA 2CU1A 4FN2A 4GSWA 3QHTA 1WX7A 4X57B 2N7DA 3QWZB 1J19A 1WI0A 2PEAA 2ASQA 5EDSA 5C23A 2FCNA 2DZMA 2XBBC 2MWSB 4G3XB 1MG8A 2K25A 2L76A 5CHVC 4MGKE 2G4DB 2KK8A 4FJZA 2IY1B 1WGHA 3QX1A 4MSQB 3TBLD 5D6JB 3UGBB 2C7MB 1K8RB 1WJ6A 2W9NA 3CMMB 2WX1A 2KZRA 2LWPA 3ZW3A 3H9DA 1WJNA 2IO1B 3VXWA 4IM0A 3DVNV 4KDIC 2PE9A 2ZVOA 4ANWA 4HLEA 1IYFA 4NJ6A 4ZYNA 2FIFA 3IBEA 2KWVB 4MM3A 3SHQA 4GN1A 2N7EA 3TMPB 3ZNID 3GOEA 4II2B 1G6JA 2D10A 3RD2A 4KSLC 1UELA 3W1SC 1SE9A 3DOWA 3VUYA 1I35A 4KV2A 3PREA 4MH0E 4PS7A 4JL9A 4BKSA 2D3GA 4HCPB 4CHKA 3BINA 1VCBA 3ZNZB 1L2NA 2KN5A 2KQSA 2XK5B 5D2MB 3VH4B 5CHWA 3K9PB 5DCNA 1GNUA 1Q1OA 2C7NB 2FNJB 2CHZA 3I3TB 2OJRA 2LUEA 3PT2B 4IWQA 4YL8A 1WJ4A 3H7PA 4PS3A 5CX3A 4PS8A 3KYDD 2FCQA 4ICUA 3AULA 1E7UA 3DBSA 2AWTA 3R7QA 4W9DA 4EKUA 4DWFA 3APFA 2C9WB 2PPHA 1Z2MA 1S1QB 4F1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXA A;  2LVP A;  3NS8 A;  4G11 A;  5J17 A;  2ZZP B;  4GOC A;  1KOT A;  2EMT A;  5C1Z A;  5E6N A;  3TCA A;  3V62 A;  2ZEQ A;  2DHZ A;  5LLI A;  4EEW A;  2YLM A;  5LXI B;  2N9P C;  4MGI E;  1EUV B;  2XK5 A;  3B08 A;  1KJT A;  3L17 A;  4HJK A;  4WWP A;  3L0W B;  1UZX B;  3PHW B;  4KZ0 A;  2FID A;  2LGY A;  5AZF A;  2KDE B;  2KXJ A;  2KJR A;  3C0R B;  3H6N A;  4BBN F;  4BOS C;  1UBQ A;  1JRU A;  4KSK C;  3WIM A;  2JY6 A;  3ENE A;  3ZKJ C;  2G3Q B;  3M3J A;  2GBK A;  4PYU A;  4ZDV A;  2CR5 A;  4F8C B;  2KJH B;  2REX A;  3W1Y A;  2K8H A;  4IG7 B;  1R4N I;  3CF6 E;  2GBM A;  2ZPN A;  1CMX B;  2NBV B;  2MBE A;  3T9L A;  1E8X A;  2JRI B;  3KH0 A;  2HD5 B;  2FCS A;  1NDD A;  2KNB A;  2RD0 A;  3S2A A;  3PRM B;  3X0W A;  2IYD B;  5FR6 A;  2KTF A;  3ZNG C;  2L7R A;  2M1M A;  3A1Q A;  1KM7 A;  3JSV A;  2GMI C;  4W9I A;  5G2N A;  3RYT A;  3VH3 B;  5D94 A;  4WJN A;  4CYE A;  4MSM B;  1C1Y B;  1TGZ B;  1ISN A;  2IO0 B;  4RM9 A;  1WGD A;  5JHA A;  1WH3 A;  3N3K B;  2KTR B;  1WE7 A;  2L8J A;  2LRW A;  5J2R A;  4FHK A;  2KDB A;  2HTH A;  1OEY A;  1ZGU B;  4BKG A;  2LVO A;  4XC2 A;  4NAW A;  2BWF A;  4A20 A;  3HM6 X;  2V3S A;  4XZ4 A;  2WYQ A;  2XEW A;  1SGH A;  2RR9 A;  4TQ0 A;  1WR6 E;  3U30 A;  4M8M A;  3ZRF A;  4F7Z A;  2LZ6 A;  1I42 A;  2Y5B B;  2AL6 A;  1NI2 A;  1WXM A;  2FAZ A;  4AJW A;  3ZNH B;  4DHJ D;  5JZE B;  2V4L A;  4MJS A;  3U7D A;  3TJP A;  3V60 A;  1T0Y A;  2WX0 A;  3HM3 A;  4AP4 C;  4WWN A;  5KHO A;  4FAD A;  1YX6 B;  1WJU A;  3QC8 B;  4LDT B;  2N1W A;  3K9O B;  2MRP A;  2DEN B;  1SIF A;  2O6V A;  2D11 A;  3OAW A;  3JVZ X;  4XX5 A;  3VFK A;  4AUQ C;  3PVL A;  2J7Q B;  2I1K A;  1YJ1 A;  4WAA A;  5AZH A;  3ZUN A;  1C3T A;  1V80 A;  2CHW A;  1UGM A;  2BYF A;  3PGE A;  4NAW B;  4OVU A;  4W9C A;  4BKT A;  3VTW A;  1V5O A;  1NBF C;  2N4F A;  3QAQ A;  2Z59 B;  4A3O A;  1D3Z A;  5CTR C;  1TZ1 A;  4GDL A;  4N9F 4;  1M94 A;  4FA6 A;  2M8S A;  3ZIM A;  2CS4 A;  3A9J B;  1V6E A;  2QHO A;  3AU4 A;  3MJW A;  4W9K A;  3JW0 X;  3ZLZ A;  2JT4 B;  2K8B A;  1E8Y A;  1WM3 A;  4WWO A;  2LXA A;  5L95 C;  2WWZ A;  2M4N A;  4II3 B;  1WGY A;  2MCN B;  5AZG A;  2O2V B;  4J6I A;  2KDF B;  2ZCB A;  4K7S A;  3ALB A;  4HXD A;  3QA8 A;  4JLC A;  4BVU C;  1WIA A;  3DCG A;  4DXA B;  1GJZ A;  4NJ7 A;  2IBI B;  4MEL A;  2L3Z A;  2IO3 B;  3OJ4 B;  2B3A A;  3PZD A;  4GDK A;  3DVG Y;  4IM2 A;  4E3C A;  3DDC B;  4MGY E;  2O6V B;  1WZ3 A;  1WXS A;  1OQY A;  2O2V A;  2MP2 B;  3UIN B;  4RMA A;  3WAL A;  1Y8R C;  2C5L C;  1OGW A;  2KVR A;  2YVC A;  3MTN B;  1WXV A;  1V81 A;  4BOZ B;  3VUX A;  5LXH A;  1X1M A;  1V49 A;  2KOX A;  3W1S A;  3PSE B;  4B9K A;  2BWE S;  3R3M A;  2N9X A;  4FLH A;  1PQS A;  2JF5 A;  5E6O A;  2KFK B;  3AU5 A;  3KUZ A;  4LDT D;  3L10 B;  1LQB A;  4W9F A;  4B6W A;  2R2O A;  2KAN A;  3UIP B;  2MBB B;  2ZPY A;  3DQV A;  4PYZ A;  5DPR A;  2UWQ A;  4BKS D;  4MGZ E;  3ZTC A;  1ZKH A;  3PLV A;  4MDK E;  3L54 A;  2JZZ A;  4ICV A;  2M17 A;  1IP9 A;  2KX0 A;  4W9J A;  2JVC A;  2Z0D B;  2IY0 B;  1WGR A;  2K1F A;  2KTR A;  3AI5 A;  1GC7 A;  4GDL B;  3SU8 X;  4AWJ A;  3IFW B;  4KIK A;  1S3S G;  3QCA A;  4LJP B;  5TR5 A;  3MHS D;  2EMS A;  4CO7 A;  2Z0E B;  2RPQ A;  2ZCC A;  3H1U A;  4JQW C;  3A9J A;  3JSV B;  5L83 A;  3ZVV A;  3ZO5 B;  3QJZ A;  3ML9 A;  1UBI A;  1P1A A;  3H7P B;  3RT3 B;  2C7H A;  2KMA A;  1VD2 A;  2LVQ A;  1HE8 A;  1R4M I;  3PHX B;  5GMV A;  1P98 A;  4NPN A;  2CKH B;  2AL3 A;  3A4S C;  2R2Q A;  4GMV A;  3ZDT A;  2KMC A;  2A5U A;  2NBW B;  1Z5S B;  2KLC A;  4LJO B;  4IW0 A;  1QZE A;  3WAP A;  1V86 A;  4WQO B;  1TTN A;  2KWC A;  2K6Q A;  3PLU A;  3Q3J A;  4GGQ A;  3KYC D;  3VVW B;  2GBR A;  4ASW C;  3ECI A;  1V9J A;  5IAA C;  3V6C B;  4KIK B;  3HK0 A;  4HDO A;  1GUA B;  1EF5 A;  1WRD B;  1XQQ A;  2LXC A;  2JWZ A;  2MBQ A;  2AYO B;  3LDZ E;  4WJO A;  2KO3 A;  3SD5 A;  3N30 A;  1YQB A;  2NS5 A;  4DBG A;  3AXC A;  2BGF A;  2UYZ B;  2BKF A;  4EZJ A;  5D7G A;  3RCZ A;  2VRR B;  2KC2 A;  3N32 A;  3SDL C;  3WAN A;  1WYW B;  5J18 A;  2ZNV B;  5G55 A;  3JYU A;  3UQB A;  4K7W A;  1WMH B;  3WAM A;  3NOB A;  1WZ0 A;  2GOW A;  2IO2 B;  2MBO A;  3EC8 A;  3HIZ A;  3L16 A;  4BBN C;  4KDL B;  1RAX A;  2D07 B;  4ZRK A;  3ZDM C;  1RLF A;  2CHX A;  3PTF C;  3DPD A;  3L08 A;  2LI5 A;  2G4S A;  1WGG A;  2KC1 A;  2M0X A;  3A9K B;  3TL5 A;  4JIO U;  3M62 B;  2D2Q A;  2DX5 B;  2EKE C;  4ANU A;  2J0M A;  5IA7 A;  2ZNV C;  2JRH A;  3KW5 B;  3U8Z A;  1P9D U;  3NHE B;  4ANV A;  1J8C A;  1E8Z A;  4HVB A;  4GU2 A;  1WR1 A;  4TKN A;  2DAJ A;  3KUD B;  2LD9 A;  1EF1 A;  1RFA A;  4EUT A;  2WDT B;  4W9H A;  4EFO A;  2N1V A;  2C60 A;  4W9E A;  1WX8 A;  3DBH I;  2HE7 A;  4FBJ B;  3P2B A;  4EZK A;  1KLV A;  2KWU B;  3M63 B;  4G50 A;  4ZRJ A;  4AJY B;  4B95 A;  3T8M A;  2G45 B;  4WJP A;  1LM8 B;  2NVU I;  3IVF A;  3QQ8 B;  1F9J A;  1FXT B;  1ZW7 A;  4HPL B;  1V5T A;  4I6L B;  4M0W B;  4RM8 A;  4IWP A;  4NY0 A;  3UF8 A;  2PJH A;  4DDG D;  3DBL I;  4FJV B;  4K1R B;  2MW5 A;  1XT9 B;  3V6E B;  2L0T A;  4I6P A;  3A4R A;  2NCN A;  3KUC B;  4ANX A;  4MJS B;  3CST A;  3DVG X;  3ZRC A;  1OEY J;  1WY8 A;  4DHZ E;  1UH6 A;  3OLM D;  2JXX A;  3DVN U;  5BO4 B;  2L00 B;  4W9G A;  4FUL A;  2K39 A;  1UD7 A;  4OVV A;  5JH5 C;  2NR2 A;  2BYV E;  2GBN A;  1H4R A;  3PRZ A;  4GB9 A;  4EOY A;  3PS6 A;  4KZC A;  4EZL A;  1A5R A;  2MX2 A;  4TUU A;  2FUH B;  4HDQ A;  2K6D B;  4DHJ B;  2KJ6 A;  4W9L A;  1AAR A;  1EO6 A;  4TV3 A;  3GZN I;  2DZI A;  2K8C A;  1WF9 A;  1YIW A;  4ZRI A;  4E74 A;  2DZJ A;  2KFJ A;  3OJ3 A;  3ONS A;  4P7I A;  1P3Q U;  3O65 B;  2FCM A;  1E90 A;  3B1L X;  2BKR B;  2A4Z A;  2ZJD A;  3PV1 A;  3VHT C;  1Q5W B;  3WAO A;  4G0N B;  4IM3 A;  2KHW B;  3VTU A;  1WM2 A;  4HWI B;  3VQI A;  1L7Y A;  3B0A A;  5CHF A;  3R7R A;  2MBH A;  3A33 B;  2NPT B;  3PRP B;  4HPM B;  2HJ8 A;  4URK A;  4K7U A;  1J0G A;  4LCD E;  2J0K A;  3QIJ A;  3L13 A;  4GXB A;  5JHB A;  2BPS A;  2PE6 B;  1OTR B;  2DYB A;  5DPT A;  2IZV B;  3A1Q B;  3UQA A;  3NZS A;  4AOF A;  1WFY A;  2I1J A;  3LJ3 A;  1P0R A;  3UIO B;  4JGH B;  1U4A A;  3BY4 B;  3V61 A;  2N9E B;  1GC6 A;  4GDK B;  2LRU A;  1WX9 A;  3EHV A;  4DK5 A;  2LGD A;  2ZVN A;  1GG3 A;  2DZK A;  2BYE A;  2J0J A;  2KFK A;  3A9K A;  2V1Y A;  3HHM A;  5AEK B;  2MP2 A;  4GIV A;  3KVF B;  1XD3 B;  3RZW C;  2MSE D;  4NQK E;  5HKH A;  5DPW A;  3QK0 A;  2RGF A;  2RSU A;  4FHJ A;  4IWO A;  3PPA A;  4HK2 A;  1IPG A;  2L0F A;  2DAF A;  1RRB A;  3IG3 A;  4HCN B;  5KHQ A;  2DYM A;  3APD A;  3R66 C;  2MA9 B;  4A3P A;  2JZ3 B;  3ZTD A;  2MLB A;  3VTV A;  2MQJ A;  2NBU A;  4IC7 B;  4NQL B;  3EFU A;  2LJ5 A;  2DYO A;  4FJY A;  1LXD A;  3EEC A;  1V2Y A;  2GBJ A;  3RZF A;  5E6P A;  4MEM A;  2LAS A;  3RUI B;  1TBE A;  3ML8 A;  1E7V A;  2JPH A;  3RUL A;  1Q0W B;  1YX5 B;  2BF8 B;  2KQ7 A;  2KX3 A;  3APC A;  4I6N B;  4NNJ B;  4DHZ B;  1WMH A;  2KLG A;  3M95 A;  4IUM B;  2NPT A;  2LGX A;  4M8N A;  1E5W A;  3X23 A;  4BFR A;  2OOB B;  2KD0 A;  2L05 A;  1YD8 U;  3VAW A;  3H7S A;  3VUW A;  3CSF A;  5DPS A;  4K81 A;  4E71 A;  1WE6 A;  4WJQ A;  4TQ1 A;  2KKC A;  3QAR A;  3WA0 A;  4DDI D;  2JUO A;  1BT0 A;  2KDI A;  3NY5 A;  4KVG B;  3VDZ A;  1E8W A;  1LFD A;  2O6V D;  3IHP C;  3NZU A;  3Q3F A;  3TIX A;  3D32 A;  3DBR I;  1H8C A;  2AEH A;  2CU1 A;  4FN2 A;  4GSW A;  3QHT A;  1WX7 A;  4X57 B;  2N7D A;  3QWZ B;  1J19 A;  1WI0 A;  2PEA A;  2ASQ A;  5EDS A;  5C23 A;  2FCN A;  2DZM A;  2XBB C;  2MWS B;  4G3X B;  1MG8 A;  2K25 A;  2L76 A;  5CHV C;  4MGK E;  2G4D B;  2KK8 A;  4FJZ A;  2IY1 B;  1WGH A;  3QX1 A;  4MSQ B;  3TBL D;  5D6J B;  3UGB B;  2C7M B;  1K8R B;  1WJ6 A;  2W9N A;  3CMM B;  2WX1 A;  2KZR A;  2LWP A;  3ZW3 A;  3H9D A;  1WJN A;  2IO1 B;  3VXW A;  4IM0 A;  3DVN V;  4KDI C;  2PE9 A;  2ZVO A;  4ANW A;  4HLE A;  1IYF A;  4NJ6 A;  4ZYN A;  2FIF A;  3IBE A;  2KWV B;  4MM3 A;  3SHQ A;  4GN1 A;  2N7E A;  3TMP B;  3ZNI D;  3GOE A;  4II2 B;  1G6J A;  2D10 A;  3RD2 A;  4KSL C;  1UEL A;  3W1S C;  1SE9 A;  3DOW A;  3VUY A;  1I35 A;  4KV2 A;  3PRE A;  4MH0 E;  4PS7 A;  4JL9 A;  4BKS A;  2D3G A;  4HCP B;  4CHK A;  3BIN A;  1VCB A;  3ZNZ B;  1L2N A;  2KN5 A;  2KQS A;  2XK5 B;  5D2M B;  3VH4 B;  5CHW A;  3K9P B;  5DCN A;  1GNU A;  1Q1O A;  2C7N B;  2FNJ B;  2CHZ A;  3I3T B;  2OJR A;  2LUE A;  3PT2 B;  4IWQ A;  4YL8 A;  1WJ4 A;  3H7P A;  4PS3 A;  5CX3 A;  4PS8 A;  3KYD D;  2FCQ A;  4ICU A;  3AUL A;  1E7U A;  3DBS A;  2AWT A;  3R7Q A;  4W9D A;  4EKU A;  4DWF A;  3APF A;  2C9W B;  2PPH A;  1Z2M A;  1S1Q B;  4F1S A; 
#chains in the Genus database with same CATH topology
 4G11 A;  3RNB C;  3U7Z A;  2OJW A;  3V62 A;  5G5H A;  3AV8 A;  2YLM A;  4MGI E;  1EUV B;  3B2F A;  3B08 A;  3R2T A;  4A90 A;  4HJG E;  1HQR D;  2KJR A;  4BBN F;  4BOS C;  1UBQ A;  3NVV A;  2PKO A;  3ZKJ C;  4S0R A;  3C19 A;  4F8C B;  1QQR A;  4IG7 B;  3I63 C;  3CF6 E;  1CJE A;  1CMX B;  4A9A A;  2NBV B;  1P7F A;  3T9L A;  2JRI B;  3KH0 A;  2FCS A;  1C4A A;  3PO0 A;  1YMH E;  1GPX A;  2IYD B;  3E56 A;  5FR6 A;  1QIL A;  2WDQ B;  1QOA A;  1ZOY B;  3IT6 B;  1WGD A;  5JHA A;  1WH3 A;  1N61 A;  2KDB A;  2HTH A;  2GRI A;  2BVC A;  4XZ4 A;  2XEW A;  4TQ0 A;  1WR6 E;  3TEY A;  2KN4 A;  2WXR A;  1FNW A;  3ZRF A;  3SFE B;  1I42 A;  2QSD A;  1RWS A;  2MJ3 A;  3ZXV A;  4DHJ D;  2V4L A;  1T0Y A;  2WX0 A;  4LDT B;  2O6V A;  5HI1 A;  2D11 A;  1C3T A;  3NJT A;  3ZUN A;  1T0R C;  4OVU A;  3VTW A;  1TZO A;  2Z59 B;  5HFY A;  4GDL A;  4N9F 4;  1M94 A;  3A9J B;  3AU4 A;  2TSS A;  3ZLZ A;  1JWM D;  1WM3 A;  1C76 A;  5L95 C;  1VDV A;  2AQ1 B;  2MCN B;  2O2V B;  4K7S A;  1HZ6 A;  1AN8 A;  4DXA B;  2LHE A;  1KRH A;  2QCZ A;  3DVG Y;  1WZ3 A;  1WXS A;  1Q10 A;  2LJI A;  3UIN B;  5GXG B;  4B0E A;  1Y8R C;  1WXV A;  5LXH A;  1UGJ A;  3VRB B;  2KOX A;  2ICI A;  3W1S A;  4UDU C;  1YQ4 B;  3OWE B;  3R3M A;  1ZE3 D;  4FLH A;  1XLN A;  3AE9 B;  5DPR A;  1PGA A;  3PLV A;  3L54 A;  1SEB D;  2BQQ A;  2KX0 A;  4W9J A;  4GDL B;  1JAL A;  3AI5 A;  3IFW B;  1I4P A;  2J53 A;  4KIK A;  3QCA A;  2IDY A;  2VH1 A;  3MHS D;  2Z0E B;  3H1U A;  3A9J A;  3JSV B;  4JX1 C;  4US9 A;  2FUG 1;  3ZO5 B;  3ML9 A;  1UBI A;  1P1A A;  4DXG A;  2KMA A;  1VD2 A;  1FCC C;  2I2Y A;  4NPN A;  2CKH B;  1TKY A;  2KAC A;  4GMV A;  2A5U A;  3WAP A;  4Q2J A;  1V86 A;  4GGQ A;  1DOY A;  3KYC D;  3I5J C;  1V1P A;  2MHJ A;  2LXC A;  1FCL A;  4B0M A;  4XDD A;  1EM7 A;  1YQB A;  3AXC A;  1RFK A;  4A55 A;  2BKF A;  3ZQ4 A;  3SDL C;  1TS3 A;  2ZNV B;  3JYU A;  4K7W A;  3P63 A;  5IKC M;  2MBO A;  3HIZ A;  2PVO D;  4HEA 1;  2X8X X;  1HEZ E;  1IGC A;  1RLF A;  3DPD A;  4XWW A;  2DX5 B;  2E6X A;  1NI3 A;  1FNV A;  5IA7 A;  2LD9 A;  1EF1 A;  4EUT A;  4OZA A;  5BMI A;  4P6V F;  2N1V A;  5I4D A;  2FE8 A;  4EZK A;  2KWU B;  4C56 C;  4ZRJ A;  4AJY B;  4WJP A;  2L32 A;  1V97 A;  3QQ8 B;  1ZW7 A;  2RDB C;  1V5T A;  4DDG D;  1MG4 A;  4FJV B;  4N59 A;  4I6P A;  3A4R A;  1J7A A;  3RFZ B;  2HDE A;  3CST A;  2QIE B;  1N60 A;  4DHZ E;  3OLM D;  3W2D A;  5BO4 B;  1FFU A;  4OVV A;  1YN5 A;  1H4R A;  4GB9 A;  3PS6 A;  4BZA A;  2D3C A;  2MX2 A;  3Q6B A;  1MPE A;  4C7Y A;  3GZN I;  1YIW A;  4E74 A;  3Q8A A;  3AEA B;  3P4Q B;  2KFJ A;  2GB1 A;  4P7I A;  1P3Q U;  1I4Q A;  2MEK A;  2GI9 A;  3VHT C;  1Q5W B;  4G0N B;  1N63 A;  3VTU A;  1WM2 A;  1KTK A;  2VZK B;  1WXQ A;  3ZYY X;  3PRP B;  1J0G A;  4HPM B;  3FIL B;  5JHB A;  2DYB A;  2WXJ A;  3A1Q B;  1GB1 A;  5EE1 A;  3AEF B;  1GC6 A;  2LRU A;  3EHV A;  2ZVN A;  2DZK A;  1XD3 B;  4NQK E;  5HKH A;  3BII D;  2RGF A;  1WSP A;  3PPA A;  1FPY A;  2Y5C A;  3APD A;  1AYF A;  4HKQ A;  4FJY A;  1K53 A;  2W3S A;  2WXN A;  2GBJ A;  1DGJ A;  3E9S A;  3RUI B;  2BB5 A;  4L2Y A;  4I6N B;  2KLG A;  4BFR A;  4N6E B;  3VAW A;  1L5P A;  5DPS A;  1HA5 A;  3W5V B;  2Q5W D;  3MFG A;  1L0V B;  4WJQ A;  3QAR A;  3WA0 A;  1BT0 A;  1L6U A;  2O6V D;  1H8C A;  2ON8 A;  2XN9 C;  2W82 A;  1PGX A;  4X57 B;  3EA6 A;  1J19 A;  1WI0 A;  5EDS A;  2ASQ A;  5C3J B;  2FCN A;  2MWS B;  4XE0 A;  1MG8 A;  2L76 A;  5CHV C;  4MGK E;  3CIR B;  3KWL A;  4FJZ A;  1CZP A;  3TBL D;  3BZD B;  3ZJT A;  1R7S A;  1QLB B;  2JYE A;  2LWP A;  4KDI C;  4RGT A;  1XLO A;  2FIF A;  1WRI A;  1QT9 A;  4MM3 A;  3TMP B;  2D10 A;  3DOW A;  3VUY A;  4MH0 E;  4HCP B;  4CHK A;  3NVZ A;  4JE3 B;  1L2N A;  2KN5 A;  3VH4 B;  3DBR B;  2B76 B;  2OJR A;  4YL8 A;  2KVZ A;  2LGS A;  5CX3 A;  1FM0 D;  1TJE A;  1XCQ L;  1IBX B;  3R2I A;  3DBS A;  5H92 C;  3APF A;  4C00 A;  2C9W B;  5BMG A;  1S1Q B;  4F1S A;  2ZZP B;  4GOC A;  1KOT A;  3W5U B;  2INP E;  4ACF A;  5LLI A;  3I9V 1;  3HRD D;  1ZXI A;  3Q69 A;  3TEZ A;  1SXT A;  4HJK A;  1HTQ A;  2IGH A;  1QOB A;  2ACZ B;  1JCK B;  2LGY A;  1VZ8 A;  4RCO A;  2Y3A A;  4KSK C;  3TEW A;  4ZDV A;  2KJH B;  2REX A;  3W1Y A;  2WXG A;  3P4S B;  4FXC A;  3TSS A;  3PRM B;  3RNE C;  2PMV A;  4ZHP A;  2KTF A;  4IOI E;  3ZNG C;  3AH7 A;  2L7R A;  2M1M A;  3A1Q A;  3JSV A;  2GMI C;  4WJN A;  1SF0 A;  1TGZ B;  1ISN A;  4JWS C;  1N6Z A;  5J2R A;  4FHK A;  1ZGU B;  2BWF A;  2G1E A;  2M56 B;  1E9M A;  3U30 A;  1SIJ A;  1C4C A;  3HVD A;  4M02 A;  4YT0 B;  2Y5B B;  3H8H A;  3GZN B;  1WXM A;  2FAZ A;  2KMM A;  1J7B A;  4LNF A;  4MJS A;  3V60 A;  4WWN A;  5KHO A;  3QC8 B;  3VFK A;  2DEN B;  3PVL A;  5HHD G;  4WAA A;  1TIF A;  4AS1 A;  2CHW A;  3VR9 B;  1UGM A;  1V5O A;  3B9J A;  2N4F A;  3QAQ A;  1AWD A;  1VR9 A;  1D3Z A;  5CTR C;  2MJD A;  1I7H A;  2M8S A;  2G9H D;  2CS4 A;  4WH4 A;  2JT4 B;  2K8B A;  3BYY B;  4J6I A;  1TY0 A;  4JLC A;  2WP9 B;  3ALB A;  3QA8 A;  1EU3 A;  1GJZ A;  3GS2 A;  2IBI B;  4MEL A;  1SE4 A;  2IO3 B;  2V9H A;  4GLS C;  4MGY E;  2BS3 B;  1L6V A;  2O6V B;  2O2V A;  4YSY B;  1AW7 A;  3TEX A;  2IJ0 A;  1C4P A;  2C5L C;  2YVC A;  3MTN B;  4BOZ B;  3VUX A;  2JQR B;  3PZ7 A;  2WXF A;  3P4R B;  1PQS A;  2JF5 A;  3DWG C;  2KFK B;  3LB8 C;  1L0Y B;  4ARC A;  3UIP B;  2ZPY A;  5AUI A;  3DQV A;  4PYZ A;  4BKS D;  1OFF A;  2UWQ A;  2V4I B;  2JZZ A;  2JVC A;  1VRA B;  1WGR A;  2KTR A;  4YXD B;  1GC7 A;  4JPS A;  5AUK A;  5TR5 A;  4OZB A;  1UF0 A;  4WQM A;  1LO5 D;  4JQW C;  3ZVV A;  3AED B;  3H7P B;  1T3Q A;  3DHG C;  1HE8 A;  3PHX B;  1Z5S B;  2IND C;  2KWC A;  2INC C;  5IO9 A;  4PK1 A;  4ASW C;  3ECI A;  3V6C B;  4KIK B;  3HK0 A;  4HDO A;  1GUA B;  1XQQ A;  5H8Y E;  4YSZ B;  2VH2 A;  2PTL A;  1NEK B;  1STE A;  3LDZ E;  4WJO A;  2NS5 A;  2BGF A;  4RGM A;  3NZ3 A;  3RNA C;  2KC2 A;  1F2R C;  4LNO A;  1WYW B;  5J18 A;  3UQB A;  1ESF A;  3NOB A;  4USA A;  4BBN C;  4NZL B;  1RAX A;  2D07 B;  4ZRK A;  1KFY B;  1VZ6 A;  3WCQ A;  1XLP A;  3PTF C;  2LI5 A;  2KC1 A;  3TL5 A;  3M62 B;  2NTT A;  1M4V A;  2ZNV C;  4ANV A;  4HVB A;  1RFA A;  5BMH A;  2C60 A;  3DBH I;  3P2B A;  3BVZ A;  1KLV A;  2NVU I;  1FXT B;  4I6L B;  4IWP A;  3UF8 A;  2PJH A;  3DBL I;  1XT9 B;  1EWY C;  2L0T A;  3KUC B;  3IAS 1;  3U2S C;  3N1Z C;  4MJS B;  3DVG X;  1OEY J;  2ONQ A;  2DLB A;  4W9G A;  1UD7 A;  2V3P A;  1I4G A;  1E7P B;  4KZC A;  4EZL A;  1IUE A;  1SSN A;  2MJE A;  4HDQ A;  2Z8L A;  2N9L A;  2KJ6 A;  1FEH A;  1L0X B;  2K8C A;  4ZRI A;  4US8 A;  1IGD A;  4ZRP A;  3B1L X;  2KAJ A;  1F77 A;  1E0Z A;  4P16 A;  2KYW A;  5CHF A;  3R7R A;  1N5X A;  4RH6 A;  2WXO A;  3QIJ A;  3L13 A;  4GXB A;  4R3D A;  1JWS D;  2PE6 B;  4HRS A;  2D5G A;  3UQA A;  2I1J A;  1U4A A;  3BY4 B;  4JWU C;  2N9E B;  3AE6 B;  4DK5 A;  2LGD A;  5BYQ A;  1E10 A;  2BYE A;  2KFK A;  5AEK B;  1FFV A;  3RZW C;  2MSE D;  2QDF A;  4YTP B;  2K5P A;  4YSX B;  1F0Z A;  1RRB A;  5KHQ A;  2JU6 X;  1QF6 A;  3R66 C;  3ZTD A;  2MLB A;  5EE3 A;  5FK9 C;  2MQJ A;  3VTV A;  2NBU A;  4IC7 B;  2LJ5 A;  2DYO A;  1LXD A;  4YTM B;  2OHF A;  1IBX A;  3DHI C;  3Q3M C;  3ML8 A;  3RUL A;  2BYT A;  2KX3 A;  2BF8 B;  3APC A;  4LNI A;  2ZW1 A;  4MAC A;  1E5W A;  4M8N A;  5IP4 D;  2OOB B;  3Q14 C;  1C77 A;  5BYS A;  1WE6 A;  3ZJU A;  3Q3O C;  2VZK D;  2CU1 A;  4GSW A;  3VRA B;  1ENF A;  1CK1 A;  2PEA A;  1UNS A;  1TT5 B;  1MFW A;  2XBB C;  3N1Y C;  2M0A A;  4G3X B;  2K25 A;  1MHX A;  1NYQ A;  2G4D B;  4M00 A;  1WGH A;  3UGB B;  5FR3 A;  1K8R B;  2DBY A;  2WX1 A;  3ZW3 A;  2IO1 B;  4IM0 A;  1K51 A;  4LTU A;  2ZVO A;  3GE8 C;  1C9F A;  1GOZ A;  3IBE A;  1N5W A;  4GN1 A;  2N7E A;  1FRR A;  4IDI A;  1BXT A;  2WXP A;  4DXF A;  4KV2 A;  5BYR A;  3P1M A;  4JL9 A;  4XWT A;  4KKI A;  3BIN A;  1VCB A;  3ZNZ B;  4OZC A;  3U4E G;  1MJD A;  1FRD A;  2X38 A;  3K9P B;  1Q1O A;  2C7N B;  2CHZ A;  2FNJ B;  1WWT A;  4PS3 A;  4PS8 A;  4BAX A;  2FCQ A;  3R7Q A;  4OVZ A;  3J9C A;  4HRO A;  4DWF A;  2JXT A;  2PW9 A;  4W9H A;  4KGT A;  1Z2M A;  4ZOH C;  1WXA A;  2LVP A;  3NS8 A;  5J17 A;  4AQ7 A;  2EMT A;  5C1Z A;  5E6N A;  2ZEQ A;  2BS2 B;  4EE2 A;  4EEW A;  2N9P C;  2IPK D;  3FKY A;  2XK5 A;  3NUH B;  1KJT A;  4WWP A;  1SB3 C;  3L0W B;  2HTM E;  1UZX B;  1R4M B;  4KZ0 A;  2KDE B;  2IGD A;  3H6N A;  3BVM A;  1JRU A;  2GBK A;  2CR5 A;  1ET6 A;  1R4N I;  3RMK C;  1J7C A;  2ZPN A;  2WXM A;  1Y56 A;  3Q2A C;  2MBE A;  1B9R A;  1E8X A;  2HD5 B;  2LEK A;  1BML C;  1T0S C;  3FIL A;  3S2A A;  3AE1 B;  5MPO A;  3X0W A;  4P1C C;  1C79 A;  1KM7 A;  4W9I A;  1F1H A;  3VH3 B;  5D94 A;  4CYE A;  4HKZ E;  3SEB A;  4RM9 A;  4MT5 A;  3HUI A;  2KTR B;  2L8J A;  2LRW A;  2LVO A;  4NAW A;  4A20 A;  4KKJ A;  2N7J A;  4M8M A;  2LZ6 A;  2AL6 A;  1NVI D;  3NVW A;  4AJW A;  1BUI C;  1E6E B;  1TKG A;  1ZDX A;  3ZNH B;  3Q8B A;  4ZYS A;  5JZE B;  3TJP A;  4AP4 C;  3HM3 A;  2WGS A;  4FAD A;  2JX5 A;  1YX6 B;  2N1W A;  2MRP A;  1YJJ A;  3JVZ X;  1F52 A;  3LXF A;  5FKA C;  2J7Q B;  5AZH A;  2WU2 B;  1V80 A;  4W9C A;  2WXK A;  3SR6 A;  4A3O A;  1K52 A;  1KLG D;  2WNM A;  1TZ1 A;  4FA6 A;  1V6E A;  2QHO A;  3MJW A;  4W9K A;  3JW0 X;  1E8Y A;  3PZ8 A;  2WWZ A;  1WGY A;  5AZG A;  4NJC A;  2KDF B;  2ZCB A;  4BVU C;  4RFB A;  4NJ7 A;  4GDK A;  2B3A A;  4E3C A;  3DDC B;  1PGB A;  2MP2 B;  4RMA A;  4ZRQ A;  2KVR A;  1OGW A;  3MC9 A;  1X1M A;  1DOX A;  3PSE B;  2BWE S;  1A70 A;  5E6O A;  3AU5 A;  2H89 B;  3L10 B;  4W9F A;  2R2O A;  3IAM 1;  2MBB B;  2WU5 B;  4MGZ E;  2LFI A;  4ICV A;  2M17 A;  1UWX A;  2BT6 A;  2W55 A;  2Z0D B;  5IOI A;  2K1F A;  3SU8 X;  1V1P B;  1LGR A;  1V8C A;  3DBH B;  1S3S G;  2D3A A;  5EE9 A;  3FAH A;  2ZCC A;  2W3R A;  2D3B A;  2SAK A;  1PDX A;  3RT3 B;  2C7H A;  1T0Q C;  1KH0 A;  1JQ4 A;  1P98 A;  2ZW0 A;  2AL3 A;  3A4S C;  3ZDT A;  2KMC A;  2NBW B;  4LJO B;  4YWG G;  1QZE A;  3N9Y C;  1TTN A;  2K6Q A;  3PLU A;  3VVW B;  2MH7 A;  4RF1 A;  2GBR A;  3AN1 A;  1V9J A;  2N9K A;  1PUT A;  4KGS A;  1EF5 A;  3NG0 A;  2JWZ A;  2MBQ A;  3P42 A;  2AYO B;  1VJK A;  2KO3 A;  3N30 A;  4DBG A;  2UYZ B;  4RGO S;  5D7G A;  2VRR B;  1PYW D;  1XLQ A;  3B2G A;  5G55 A;  1WMH B;  1WZ0 A;  2IO2 B;  1OQR A;  4KDL B;  3AEE B;  1D4B A;  2DNF A;  1FXA A;  2PVG C;  1UWM A;  2CHX A;  2NTS A;  2QJL A;  3L08 A;  2M0X A;  4ANU A;  2J0M A;  3UI3 A;  2JRH A;  5G5G A;  3U8Z A;  1E8Z A;  4TMA B;  4GU2 A;  1WR1 A;  4TKN A;  1XEE A;  2WDT B;  4MH8 A;  1JW9 D;  4EFO A;  4W9E A;  4XDC A;  2XNA C;  2DWQ A;  2HE7 A;  1ZUD 2;  3T8M A;  2G45 B;  2QMT A;  3IVF A;  3DWM A;  2LHD A;  4HPL B;  4M0W B;  4NY0 A;  4K1R B;  2FBW B;  1JRO A;  1D5X C;  2NCN A;  2CJN A;  3VR8 B;  2L00 B;  2E3T A;  4FUL A;  4RGN A;  5JH5 C;  4MM3 B;  2BYV E;  3PRZ A;  4EOY A;  3Q8C A;  2BBC A;  2NMQ A;  2JWU A;  2K6D B;  3T3O A;  2WLB A;  4TV3 A;  1PFD A;  2L1A A;  1YJI A;  3OJ3 A;  3OG5 A;  3O65 B;  1E90 A;  4WWM A;  2BKR B;  2ZJD A;  4IM3 A;  2KHW B;  4HWI B;  1L7Y A;  3B0A A;  3AM9 A;  1XCT L;  3A33 B;  2WS3 B;  4XYC A;  2BPS A;  1B1Z A;  2IZV B;  1TS4 A;  3UIO B;  3V61 A;  1GG3 A;  2BS4 B;  3HHM A;  2AQ2 B;  1D5Z C;  3EUB 2;  3IT4 B;  4REZ A;  5DPW A;  3QK0 A;  2R61 A;  2L0F A;  2DAF A;  2DYM A;  1ZXH A;  2MA9 B;  1TS5 A;  3BWU D;  3V05 A;  2JZ3 B;  4NQL B;  3EFU A;  2EEL A;  1D6E C;  4KX6 B;  5EE0 A;  1GB4 A;  4MEM A;  2LAS A;  2JPH A;  2AX5 A;  2KQ7 A;  4DHZ B;  3SFD B;  3M95 A;  4IUM B;  2LGX A;  2KD0 A;  1YD8 U;  3AE8 B;  3VUW A;  3CSF A;  4K81 A;  4S17 A;  3AE7 B;  4N58 A;  1NYR A;  2JUO A;  1R4N B;  4J3O D;  3VDZ A;  3RPF C;  1LFD A;  3IHP C;  3Q3F A;  3TIX A;  4HPP A;  3D32 A;  2AEH A;  2I38 A;  3MC8 A;  2AQ3 B;  2N7D A;  3QWZ B;  5C2T B;  2DZM A;  3GE3 C;  1HXY D;  4O1N A;  4H2A A;  2KK8 A;  2JYT A;  2IY1 B;  4MSQ B;  5LNK 1;  2WDR B;  1YNT E;  2C7M B;  2W9N A;  3CMM B;  3H9D A;  1WJN A;  3VXW A;  2RMM A;  4K3B A;  3NVY A;  4HLE A;  4WAF A;  4NJ6 A;  1F2R I;  4ZYN A;  3I57 A;  4P1B C;  2KWV B;  3SHQ A;  3ZNI D;  3GOE A;  4KSL C;  1UEL A;  3W1S C;  1SE9 A;  1JWU D;  1V1O A;  1I35 A;  4A6Q A;  1T5X D;  2D3G A;  3ZXR A;  4ITK A;  1MVK A;  2KQS A;  5DCN A;  1GNU A;  2YEP F;  3KYD D;  4ICU A;  1E7U A;  1C78 A;  4W9D A;  4EKU A;  2N0S B;  3U52 E;  3KLS X;  4RM8 A;  2BB6 A;  4OHJ A;  3KQ4 A;  2UU7 A;  2WQY B;  3TCA A;  2DHZ A;  3GP7 A;  5LXI B;  2EKI A;  1ET9 A;  1QOF A;  3EGR A;  3L17 A;  3RNG C;  2GLS A;  2L83 A;  3PHW B;  2FID A;  2M19 A;  5AZF A;  2KT7 A;  2KXJ A;  3AEB B;  3C0R B;  3WIM A;  2JY6 A;  3ENE A;  2G3Q B;  3M3J A;  4PYU A;  2K8H A;  1K50 A;  1RYJ A;  1FNU A;  2GBM A;  2K3U A;  3N20 C;  3NRZ A;  3BVG A;  2IGG A;  2YEP B;  1I4H A;  1NDD A;  2KNB A;  2RD0 A;  1YN3 A;  2LGI A;  1RM6 C;  2KQ4 X;  3RYT A;  5G2N A;  4MSM B;  1C1Y B;  3AMZ A;  2IO0 B;  3N3K B;  1WE7 A;  2KDM A;  1OEY A;  4BKG A;  4XC2 A;  2WXL A;  2OED A;  2HJ1 A;  2V3S A;  3HM6 X;  2K0P A;  2WYQ A;  1SGH A;  2RR9 A;  4K3C A;  4F7Z A;  1NI2 A;  5D3I B;  3BYT B;  3U7D A;  4OW0 A;  1HTO A;  1WJU A;  3K9O B;  3OAW A;  1QOG A;  1SIF A;  4AUQ C;  4XX5 A;  2I1K A;  1YJ1 A;  3BK2 A;  2LMC A;  2BYF A;  3PGE A;  4NAW B;  4BKT A;  1NBF C;  1XF5 L;  3EFC A;  3URY A;  1XO3 A;  3DBL B;  3ZIM A;  1QKZ A;  4CQN A;  4WWO A;  2LXA A;  4II3 B;  2M4N A;  4HXD A;  1WIA A;  1XXG A;  3DCG A;  1ROE A;  2L3Z A;  3OJ4 B;  3RI7 C;  3PZD A;  4IM2 A;  4WUR A;  4LNN A;  3ETR A;  1OQY A;  1YOV B;  3WAL A;  1SJH D;  1V81 A;  3ZGZ A;  1V49 A;  1ZP0 B;  3DHH C;  4B9K A;  3IXS A;  4ZHO A;  1MHH E;  2N9X A;  3KUZ A;  4LDT D;  2WXH A;  1LQB A;  4B6W A;  2J42 A;  2KAN A;  3N1X C;  3ZTC A;  1JWB D;  1ZKH A;  4MDK E;  3C8Y A;  1IP9 A;  3RN9 C;  2KWD A;  2IY0 B;  1CQV A;  1YQ3 B;  4AWJ A;  1FMA D;  4LJP B;  2QIL A;  1FIQ A;  2EMS A;  4CO7 A;  2RPQ A;  5E6J A;  5L83 A;  3QJZ A;  2L52 A;  3AE4 B;  3RNC C;  1TS2 A;  2JSV X;  2LVQ A;  2WHI A;  1L4Z B;  4TSS A;  1R4M I;  5GMV A;  2R2Q A;  1JRP A;  2KLC A;  4KGR A;  4IW0 A;  4WQO B;  3Q3J A;  2RDG A;  5IAA C;  1WRD B;  1I4X A;  3AE3 B;  2WXQ A;  1DYQ A;  4C7Z A;  2LUM A;  3SD5 A;  4C80 A;  1YN4 A;  4EZJ A;  3RCZ A;  3N32 A;  3L4P A;  3WAN A;  3WAM A;  2GOW A;  3EC8 A;  3L16 A;  1J8C A;  3Q8E A;  3ZDM C;  1P7E A;  4LK0 M;  1EWC A;  4QAY A;  2G4S A;  1WGG A;  1FD6 A;  3A9K B;  4JIO U;  2PLP A;  2D2Q A;  2EKE C;  4M01 A;  2RDH A;  3RNF C;  3KW5 B;  1P9D U;  3NHE B;  4C4V A;  1OQQ A;  2DAJ A;  1SE3 A;  3KUD B;  1WX8 A;  3MHZ A;  4FBJ B;  3M63 B;  1JML A;  5IN7 A;  4G50 A;  2BW2 A;  4B95 A;  4C4V B;  2INN E;  5HG2 A;  1LM8 B;  1F9J A;  5D3D A;  3MC0 B;  1FXI A;  1SJE D;  2MW5 A;  3V6E B;  4ANX A;  2SEB D;  2J52 A;  3ZRC A;  1WY8 A;  1UH6 A;  2JXX A;  3DVN U;  5T8I A;  2K39 A;  2NR2 A;  2GBN A;  4IKG A;  2RPV A;  1JWA D;  1TY2 A;  1A5R A;  3Q3N C;  3AB5 A;  4TUU A;  2FUH B;  1TYG B;  4DHJ B;  2CJO A;  4W9L A;  1AAR A;  3AE2 B;  1EO6 A;  2K9X A;  2DZI A;  1NEN B;  1WF9 A;  3KWV A;  2DZJ A;  3ONS A;  2FCM A;  3W9C B;  2A4Z A;  3PV1 A;  1UUP A;  4L1B A;  1ACC A;  3WAO A;  1T6B X;  1MI0 A;  3R8B A;  3VQI A;  2MBH A;  2NPT B;  3GB1 A;  2HJ8 A;  4URK A;  4K7U A;  4LCD E;  2J0K A;  2QC8 A;  3AEG B;  2K22 A;  1OTR B;  1N62 A;  5DPT A;  3NZS A;  4AOF A;  1WFY A;  3LJ3 A;  3AEC B;  1P0R A;  3BK1 A;  4JGH B;  4LLG M;  4GDK B;  1WX9 A;  3ZJV A;  2J0J A;  3A9K A;  2V1Y A;  2MP2 A;  4GIV A;  3KVF B;  4PT5 A;  3HVZ A;  1SE2 A;  4M0W A;  2V3N A;  4LNK A;  1DOI A;  2RSU A;  3P4P B;  4FHJ A;  4IWO A;  4HK2 A;  1IPG A;  4HCN B;  3IG3 A;  2W54 A;  4A3P A;  3LYY A;  3CWI A;  1FO4 A;  4D2K A;  1L4D B;  1VLB A;  1V2Y A;  3EEC A;  1HZ5 A;  3RZF A;  3ABV B;  5E6P A;  1TBE A;  1E7V A;  1Q0W B;  1YX5 B;  5TSS A;  4YTN B;  2H88 B;  4NNJ B;  1WMH A;  2NPT A;  3X23 A;  2L05 A;  5JXV A;  3H7S A;  4ARI A;  2WXI A;  2J4X A;  2WDV B;  4A8X C;  1TKE A;  4E71 A;  1SBB B;  3NS1 A;  4TQ1 A;  2KKC A;  4DDI D;  4RF0 A;  2Y5P A;  2KDI A;  3NY5 A;  4KVG B;  2BTE A;  4DQO C;  3T3N A;  1E8W A;  1GAQ B;  3MP9 A;  3NZU A;  1WGK A;  2CU3 A;  3DBR I;  3FC4 A;  4FN2 A;  4L23 A;  3QHT A;  1WX7 A;  1KF6 B;  3V3X A;  5C23 A;  4WIP A;  3TUO A;  3QX1 A;  5D6J B;  1ZDV A;  1D5M C;  1WJ6 A;  2KZR A;  3O13 A;  4XGA B;  3DVN V;  2PE9 A;  4ANW A;  2QEJ C;  1IYF A;  2PIA A;  4NAM A;  3Q8F A;  4II2 B;  1G6J A;  3RD2 A;  2JZP A;  1EU4 A;  3PRE A;  4PS7 A;  4BKS A;  1KLU D;  2V0G A;  2XK5 B;  5D2M B;  5CHW A;  3I3T B;  2LUE A;  3MJ5 A;  3PT2 B;  4IWQ A;  1WJ4 A;  3H7P A;  4RNA A;  3AUL A;  2AWT A;  1VZ7 A;  1ZPS A;  2PPH A;  1I4R A;  3AE5 B;  1WYG A; 
#chains in the Genus database with same CATH homology
 1WXA A;  2LVP A;  3NS8 A;  4G11 A;  5J17 A;  2ZZP B;  4GOC A;  1KOT A;  2EMT A;  5C1Z A;  5E6N A;  3TCA A;  3V62 A;  2ZEQ A;  2DHZ A;  5LLI A;  4EEW A;  2YLM A;  5LXI B;  2N9P C;  4MGI E;  1EUV B;  2XK5 A;  3B08 A;  1KJT A;  3L17 A;  4HJK A;  4WWP A;  3L0W B;  1UZX B;  3PHW B;  4KZ0 A;  2FID A;  2LGY A;  5AZF A;  2KDE B;  2KXJ A;  2KJR A;  3C0R B;  3H6N A;  4BBN F;  4BOS C;  1UBQ A;  1JRU A;  4KSK C;  3WIM A;  2JY6 A;  3ENE A;  3ZKJ C;  2G3Q B;  3M3J A;  2GBK A;  4PYU A;  4ZDV A;  2CR5 A;  4F8C B;  2KJH B;  2REX A;  3W1Y A;  2K8H A;  4IG7 B;  1R4N I;  3CF6 E;  2GBM A;  2ZPN A;  1CMX B;  2NBV B;  2MBE A;  3T9L A;  1E8X A;  2JRI B;  3KH0 A;  2HD5 B;  2FCS A;  1NDD A;  2KNB A;  2RD0 A;  3S2A A;  3PRM B;  3X0W A;  2IYD B;  5FR6 A;  2KTF A;  3ZNG C;  2L7R A;  2M1M A;  3A1Q A;  1KM7 A;  3JSV A;  2GMI C;  4W9I A;  5G2N A;  3RYT A;  3VH3 B;  5D94 A;  4WJN A;  4CYE A;  4MSM B;  1C1Y B;  1TGZ B;  1ISN A;  2IO0 B;  4RM9 A;  1WGD A;  5JHA A;  1WH3 A;  3N3K B;  2KTR B;  1WE7 A;  2L8J A;  2LRW A;  5J2R A;  4FHK A;  2KDB A;  2HTH A;  1OEY A;  1ZGU B;  4BKG A;  2LVO A;  4XC2 A;  4NAW A;  2BWF A;  4A20 A;  3HM6 X;  2V3S A;  4XZ4 A;  2WYQ A;  2XEW A;  1SGH A;  2RR9 A;  4TQ0 A;  1WR6 E;  3U30 A;  4M8M A;  3ZRF A;  4F7Z A;  2LZ6 A;  1I42 A;  2Y5B B;  2AL6 A;  1NI2 A;  1WXM A;  2FAZ A;  4AJW A;  3ZNH B;  4DHJ D;  5JZE B;  2V4L A;  4MJS A;  3U7D A;  3TJP A;  3V60 A;  1T0Y A;  2WX0 A;  3HM3 A;  4AP4 C;  4WWN A;  5KHO A;  4FAD A;  1YX6 B;  1WJU A;  3QC8 B;  4LDT B;  2N1W A;  3K9O B;  2MRP A;  2DEN B;  1SIF A;  2O6V A;  2D11 A;  3OAW A;  3JVZ X;  4XX5 A;  3VFK A;  4AUQ C;  3PVL A;  2J7Q B;  2I1K A;  1YJ1 A;  4WAA A;  5AZH A;  3ZUN A;  1C3T A;  1V80 A;  2CHW A;  1UGM A;  2BYF A;  3PGE A;  4NAW B;  4OVU A;  4W9C A;  4BKT A;  3VTW A;  1V5O A;  1NBF C;  2N4F A;  3QAQ A;  2Z59 B;  4A3O A;  1D3Z A;  5CTR C;  1TZ1 A;  4GDL A;  4N9F 4;  1M94 A;  4FA6 A;  2M8S A;  3ZIM A;  2CS4 A;  3A9J B;  1V6E A;  2QHO A;  3AU4 A;  3MJW A;  4W9K A;  3JW0 X;  3ZLZ A;  2JT4 B;  2K8B A;  1E8Y A;  1WM3 A;  4WWO A;  2LXA A;  5L95 C;  2WWZ A;  2M4N A;  4II3 B;  1WGY A;  2MCN B;  5AZG A;  2O2V B;  4J6I A;  2KDF B;  2ZCB A;  4K7S A;  3ALB A;  4HXD A;  3QA8 A;  4JLC A;  4BVU C;  1WIA A;  3DCG A;  4DXA B;  1GJZ A;  4NJ7 A;  2IBI B;  4MEL A;  2L3Z A;  2IO3 B;  3OJ4 B;  2B3A A;  3PZD A;  4GDK A;  3DVG Y;  4IM2 A;  4E3C A;  3DDC B;  4MGY E;  2O6V B;  1WZ3 A;  1WXS A;  1OQY A;  2O2V A;  2MP2 B;  3UIN B;  4RMA A;  3WAL A;  1Y8R C;  2C5L C;  1OGW A;  2KVR A;  2YVC A;  3MTN B;  1WXV A;  1V81 A;  4BOZ B;  3VUX A;  5LXH A;  1X1M A;  1V49 A;  2KOX A;  3W1S A;  3PSE B;  4B9K A;  2BWE S;  3R3M A;  2N9X A;  4FLH A;  1PQS A;  2JF5 A;  5E6O A;  2KFK B;  3AU5 A;  3KUZ A;  4LDT D;  3L10 B;  1LQB A;  4W9F A;  4B6W A;  2R2O A;  2KAN A;  3UIP B;  2MBB B;  2ZPY A;  3DQV A;  4PYZ A;  5DPR A;  2UWQ A;  4BKS D;  4MGZ E;  3ZTC A;  1ZKH A;  3PLV A;  4MDK E;  3L54 A;  2JZZ A;  4ICV A;  2M17 A;  1IP9 A;  2KX0 A;  4W9J A;  2JVC A;  2Z0D B;  2IY0 B;  1WGR A;  2K1F A;  2KTR A;  3AI5 A;  1GC7 A;  4GDL B;  3SU8 X;  4AWJ A;  3IFW B;  4KIK A;  1S3S G;  3QCA A;  4LJP B;  5TR5 A;  3MHS D;  2EMS A;  4CO7 A;  2Z0E B;  2RPQ A;  2ZCC A;  3H1U A;  4JQW C;  3A9J A;  3JSV B;  5L83 A;  3ZVV A;  3ZO5 B;  3QJZ A;  3ML9 A;  1UBI A;  1P1A A;  3H7P B;  3RT3 B;  2C7H A;  2KMA A;  1VD2 A;  2LVQ A;  1HE8 A;  1R4M I;  3PHX B;  5GMV A;  1P98 A;  4NPN A;  2CKH B;  2AL3 A;  3A4S C;  2R2Q A;  4GMV A;  3ZDT A;  2KMC A;  2A5U A;  2NBW B;  1Z5S B;  2KLC A;  4LJO B;  4IW0 A;  1QZE A;  3WAP A;  1V86 A;  4WQO B;  1TTN A;  2KWC A;  2K6Q A;  3PLU A;  3Q3J A;  4GGQ A;  3KYC D;  3VVW B;  2GBR A;  4ASW C;  3ECI A;  1V9J A;  5IAA C;  3V6C B;  4KIK B;  3HK0 A;  4HDO A;  1GUA B;  1EF5 A;  1WRD B;  1XQQ A;  2LXC A;  2JWZ A;  2MBQ A;  2AYO B;  3LDZ E;  4WJO A;  2KO3 A;  3SD5 A;  3N30 A;  1YQB A;  2NS5 A;  4DBG A;  3AXC A;  2BGF A;  2UYZ B;  2BKF A;  4EZJ A;  5D7G A;  3RCZ A;  2VRR B;  2KC2 A;  3N32 A;  3SDL C;  3WAN A;  1WYW B;  5J18 A;  2ZNV B;  5G55 A;  3JYU A;  3UQB A;  4K7W A;  1WMH B;  3WAM A;  3NOB A;  1WZ0 A;  2GOW A;  2IO2 B;  2MBO A;  3EC8 A;  3HIZ A;  3L16 A;  4BBN C;  4KDL B;  1RAX A;  2D07 B;  4ZRK A;  3ZDM C;  1RLF A;  2CHX A;  3PTF C;  3DPD A;  3L08 A;  2LI5 A;  2G4S A;  1WGG A;  2KC1 A;  2M0X A;  3A9K B;  3TL5 A;  4JIO U;  3M62 B;  2D2Q A;  2DX5 B;  2EKE C;  4ANU A;  2J0M A;  5IA7 A;  2ZNV C;  2JRH A;  3KW5 B;  3U8Z A;  1P9D U;  3NHE B;  4ANV A;  1J8C A;  1E8Z A;  4HVB A;  4GU2 A;  1WR1 A;  4TKN A;  2DAJ A;  3KUD B;  2LD9 A;  1EF1 A;  1RFA A;  4EUT A;  2WDT B;  4W9H A;  4EFO A;  2N1V A;  2C60 A;  4W9E A;  1WX8 A;  3DBH I;  2HE7 A;  4FBJ B;  3P2B A;  4EZK A;  1KLV A;  2KWU B;  3M63 B;  4G50 A;  4ZRJ A;  4AJY B;  4B95 A;  3T8M A;  2G45 B;  4WJP A;  1LM8 B;  2NVU I;  3IVF A;  3QQ8 B;  1F9J A;  1FXT B;  1ZW7 A;  4HPL B;  1V5T A;  4I6L B;  4M0W B;  4RM8 A;  4IWP A;  4NY0 A;  3UF8 A;  2PJH A;  4DDG D;  3DBL I;  4FJV B;  4K1R B;  2MW5 A;  1XT9 B;  3V6E B;  2L0T A;  4I6P A;  3A4R A;  2NCN A;  3KUC B;  4ANX A;  4MJS B;  3CST A;  3DVG X;  3ZRC A;  1OEY J;  1WY8 A;  4DHZ E;  1UH6 A;  3OLM D;  2JXX A;  3DVN U;  5BO4 B;  2L00 B;  4W9G A;  4FUL A;  2K39 A;  1UD7 A;  4OVV A;  5JH5 C;  2NR2 A;  2BYV E;  2GBN A;  1H4R A;  3PRZ A;  4GB9 A;  4EOY A;  3PS6 A;  4KZC A;  4EZL A;  1A5R A;  2MX2 A;  4TUU A;  2FUH B;  4HDQ A;  2K6D B;  4DHJ B;  2KJ6 A;  4W9L A;  1AAR A;  1EO6 A;  4TV3 A;  3GZN I;  2DZI A;  2K8C A;  1WF9 A;  1YIW A;  4ZRI A;  4E74 A;  2DZJ A;  2KFJ A;  3OJ3 A;  3ONS A;  4P7I A;  1P3Q U;  3O65 B;  2FCM A;  1E90 A;  3B1L X;  2BKR B;  2A4Z A;  2ZJD A;  3PV1 A;  3VHT C;  1Q5W B;  3WAO A;  4G0N B;  4IM3 A;  2KHW B;  3VTU A;  1WM2 A;  4HWI B;  3VQI A;  1L7Y A;  3B0A A;  5CHF A;  3R7R A;  2MBH A;  3A33 B;  2NPT B;  3PRP B;  4HPM B;  2HJ8 A;  4URK A;  4K7U A;  1J0G A;  4LCD E;  2J0K A;  3QIJ A;  3L13 A;  4GXB A;  5JHB A;  2BPS A;  2PE6 B;  1OTR B;  2DYB A;  5DPT A;  2IZV B;  3A1Q B;  3UQA A;  3NZS A;  4AOF A;  1WFY A;  2I1J A;  3LJ3 A;  1P0R A;  3UIO B;  4JGH B;  1U4A A;  3BY4 B;  3V61 A;  2N9E B;  1GC6 A;  4GDK B;  2LRU A;  1WX9 A;  3EHV A;  4DK5 A;  2LGD A;  2ZVN A;  1GG3 A;  2DZK A;  2BYE A;  2J0J A;  2KFK A;  3A9K A;  2V1Y A;  3HHM A;  5AEK B;  2MP2 A;  4GIV A;  3KVF B;  1XD3 B;  3RZW C;  2MSE D;  4NQK E;  5HKH A;  5DPW A;  3QK0 A;  2RGF A;  2RSU A;  4FHJ A;  4IWO A;  3PPA A;  4HK2 A;  1IPG A;  2L0F A;  2DAF A;  1RRB A;  3IG3 A;  4HCN B;  5KHQ A;  2DYM A;  3APD A;  3R66 C;  2MA9 B;  4A3P A;  2JZ3 B;  3ZTD A;  2MLB A;  3VTV A;  2MQJ A;  2NBU A;  4IC7 B;  4NQL B;  3EFU A;  2LJ5 A;  2DYO A;  4FJY A;  1LXD A;  3EEC A;  1V2Y A;  2GBJ A;  3RZF A;  5E6P A;  4MEM A;  2LAS A;  3RUI B;  1TBE A;  3ML8 A;  1E7V A;  2JPH A;  3RUL A;  1Q0W B;  1YX5 B;  2BF8 B;  2KQ7 A;  2KX3 A;  3APC A;  4I6N B;  4NNJ B;  4DHZ B;  1WMH A;  2KLG A;  3M95 A;  4IUM B;  2NPT A;  2LGX A;  4M8N A;  1E5W A;  3X23 A;  4BFR A;  2OOB B;  2KD0 A;  2L05 A;  1YD8 U;  3VAW A;  3H7S A;  3VUW A;  3CSF A;  5DPS A;  4K81 A;  4E71 A;  1WE6 A;  4WJQ A;  4TQ1 A;  2KKC A;  3QAR A;  3WA0 A;  4DDI D;  2JUO A;  1BT0 A;  2KDI A;  3NY5 A;  4KVG B;  3VDZ A;  1E8W A;  1LFD A;  2O6V D;  3IHP C;  3NZU A;  3Q3F A;  3TIX A;  3D32 A;  3DBR I;  1H8C A;  2AEH A;  2CU1 A;  4FN2 A;  4GSW A;  3QHT A;  1WX7 A;  4X57 B;  2N7D A;  3QWZ B;  1J19 A;  1WI0 A;  2PEA A;  2ASQ A;  5EDS A;  5C23 A;  2FCN A;  2DZM A;  2XBB C;  2MWS B;  4G3X B;  1MG8 A;  2K25 A;  2L76 A;  5CHV C;  4MGK E;  2G4D B;  2KK8 A;  4FJZ A;  2IY1 B;  1WGH A;  3QX1 A;  4MSQ B;  3TBL D;  5D6J B;  3UGB B;  2C7M B;  1K8R B;  1WJ6 A;  2W9N A;  3CMM B;  2WX1 A;  2KZR A;  2LWP A;  3ZW3 A;  3H9D A;  1WJN A;  2IO1 B;  3VXW A;  4IM0 A;  3DVN V;  4KDI C;  2PE9 A;  2ZVO A;  4ANW A;  4HLE A;  1IYF A;  4NJ6 A;  4ZYN A;  2FIF A;  3IBE A;  2KWV B;  4MM3 A;  3SHQ A;  4GN1 A;  2N7E A;  3TMP B;  3ZNI D;  3GOE A;  4II2 B;  1G6J A;  2D10 A;  3RD2 A;  4KSL C;  1UEL A;  3W1S C;  1SE9 A;  3DOW A;  3VUY A;  1I35 A;  4KV2 A;  3PRE A;  4MH0 E;  4PS7 A;  4JL9 A;  4BKS A;  2D3G A;  4HCP B;  4CHK A;  3BIN A;  1VCB A;  3ZNZ B;  1L2N A;  2KN5 A;  2KQS A;  2XK5 B;  5D2M B;  3VH4 B;  5CHW A;  3K9P B;  5DCN A;  1GNU A;  1Q1O A;  2C7N B;  2FNJ B;  2CHZ A;  3I3T B;  2OJR A;  2LUE A;  3PT2 B;  4IWQ A;  4YL8 A;  1WJ4 A;  3H7P A;  4PS3 A;  5CX3 A;  4PS8 A;  3KYD D;  2FCQ A;  4ICU A;  3AUL A;  1E7U A;  3DBS A;  2AWT A;  3R7Q A;  4W9D A;  4EKU A;  4DWF A;  3APF A;  2C9W B;  2PPH A;  1Z2M A;  1S1Q B;  4F1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...