2ZPNA

The crystal structure of saccharomyces cerevisiae atg8- atg19(412-415) complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
b'MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 8
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title Structural basis of target recognition by Atg8/LC3 during selective autophagy
pubmed doi rcsb
total genus 30
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zpnA00
5DPTA 2N7EA 2KTRA 2MBQA 1U4AA 2BYEA 2C5LC 2LI5A 5CHWA 2KJHB 1NI2A 1WX7A 2BWFA 4NY0A 2K6DB 3PHXB 4MEMA 4DWFA 4DHZE 1WFYA 1WR6E 5IA7A 4KIKA 4HDOA 4XC2A 5DPSA 1E5WA 1WI0A 2DZKA 3V6EB 2O2VB 2KWUB 2AL6A 4ICUA 5KHOA 5JHAA 2HTHA 2KO3A 5CTRC 1UZXB 2KTRB 2LXCA 2LRWA 4GDLA 4GSWA 4F7ZA 3Q3FA 2L0FA 2KXJA 4IWOA 3AU4A 5D6JB 1S3SG 3QJZA 4M8NA 3WALA 3SD5A 1RLFA 2XK5A 1V81A 3LDZE 2ZCBA 1A5RA 1GUAB 1H4RA 4EZJA 3HK0A 3TBLD 3HM3A 2BKRB 3N32A 3ML8A 1WH3A 2KFKA 4FJZA 3PLUA 2JZ3B 2Z0EB 3A9JB 4IC7B 4ICVA 4YL8A 2K1FA 2NPTB 2XK5B 4BKTA 4EEWA 3UQBA 3QIJA 2FUHB 4GDKB 4K1RB 1V5OA 4MGKE 2WX0A 3UQAA 3OJ3A 2L8JA 2YLMA 2EMSA 2NS5A 1V2YA 4W9FA 2MRPA 1WGHA 2J0MA 2J0KA 2MBBB 2LGDA 3ZKJC 4K81A 2ZJDA 3APFA 3PV1A 4JLCA 1VD2A 4GOCA 4FADA 2IO2B 2OOBB 2MX2A 3H6NA 3IVFA 4NQKE 3ZO5B 2CS4A 3PS6A 3VH3B 3OJ4B 5LLIA 2Z0DB 2LASA 2GBRA 1P1AA 1LQBA 5JHBA 1VCBA 5D94A 2XBBC 3A33B 3LJ3A 4GDKA 2MBHA 1L7YA 2BKFA 3U7DA 3ZUNA 5AEKB 5L95C 5CHVC 4NQLB 4NPNA 3APCA 2LUEA 3IBEA 3DPDA 1IP9A 2MA9B 1RFAA 2O2VA 3KYCD 2NR2A 2KTFA 5AZGA 3P2BA 2A5UA 4E3CA 2O6VD 3QAQA 2FIDA 2JUOA 2IO0B 4GDLB 1E8WA 1SIFA 2KMCA 4NNJB 2BGFA 2GOWA 5JH5C 4GIVA 4JQWC 4MDKE 2IZVB 2N9PC 1WYWB 2IY1B 2NBUA 3MTNB 2N1WA 1E7UA 4NJ7A 1WE7A 4BOZB 1V49A 2LXAA 4DBGA 3R3MA 1LFDA 2KLGA 1UD7A 2FNJB 3DBHI 3PZDA 3PHWB 1NDDA 3TCAA 3L16A 4FHKA 4FA6A 5LXIB 1ZKHA 1WMHA 3ZIMA 2DX5B 2L76A 2CHWA 2MSED 3PRPB 3JVZX 4ZDVA 1E8ZA 2L05A 4WJNA 1E7VA 1WXAA 2DAFA 2FAZA 2BF8B 2KFKB 2AWTA 1I42A 2CKHB 3M95A 3AI5A 4MSMB 4EKUA 2UWQA 5AZHA 3SU8X 2OJRA 3JYUA 2CU1A 3B0AA 1YIWA 4HPLB 4HPMB 1V9JA 3QARA 2KDBA 2L0TA 2MW5A 3HIZA 3N30A 2FIFA 1V6EA 2RPQA 5FR6A 4WJOA 1G6JA 4TQ0A 4W9CA 4W9EA 4M8MA 2MBEA 4AJYB 3A9JA 5BO4B 2IO1B 2FCQA 4HXDA 1YQBA 3DCGA 4MGIE 2N4FA 3GZNI 1EO6A 5D7GA 2D3GA 4DHJB 2KJ6A 2MCNB 1WX8A 3PPAA 3DVGY 3UIPB 4G3XB 1KLVA 2BPSA 4K7UA 2C7MB 4GB9A 4WWNA 1WM3A 3ZNGC 4JGHB 2KZRA 4HJKA 2IBIB 1OTRB 1GC7A 1RRBA 4JL9A 4XZ4A 1Y8RC 2KNBA 3ECIA 2DHZA 2KHWB 1WJ4A 1XT9B 4IUMB 3VAWA 2NVUI 3UINB 1WZ3A 2JT4B 3NY5A 4I6PA 3QHTA 2LRUA 3TIXA 4EUTA 2JWZA 2KX3A 4TQ1A 4DHJD 1UELA 5D2MB 4BKSA 3VUXA 3OAWA 2ZVNA 3NHEB 3S2AA 4MM3A 4FULA 3SHQA 1TGZB 3T8MA 2K6QA 1WM2A 3NS8A 1J0GA 3EECA 2D2QA 3UF8A 1SE9A 3H7SA 4HCPB 2JPHA 3H9DA 1EF5A 3GOEA 2CHZA 4KZ0A 3M3JA 4MGYE 3ZNHB 2MLBA 4KIKB 2GMIC 3DOWA 4A3PA 2YVCA 4W9GA 1WGRA 3QA8A 4AWJA 1CMXB 4CYEA 1F9JA 2KLCA 1TTNA 3L0WB 4MELA 2PE9A 1UBQA 4PS7A 4AUQC 3JSVB 2GBJA 5JZEB 4G50A 1E8XA 3H7PA 4LCDE 2RSUA 2GBNA 1Z5SB 4DXAB 4HDQA 2KC2A 3WAOA 2LGXA 3DQVA 3QK0A 2ZPNA 3R7QA 3V60A 3WIMA 2D07B 2CR5A 3A1QA 2UYZB 2EKEC 2IO3B 2RGFA 4KSLC 1WJ6A 2JF5A 4GMVA 3EFUA 4MJSA 1Q1OA 2KDFB 4DDID 3HM6X 4LJPB 2NBVB 2LVOA 4PYUA 4EFOA 1ZGUB 3KUZA 2WYQA 4BOSC 1T0YA 3RT3B 4G0NB 5J18A 4ZRJA 3IG3A 2M0XA 3PSEB 2O6VA 2LJ5A 1ISNA 1OEYA 2KD0A 3I3TB 2MP2A 4W9LA 4K7SA 1IPGA 2LVPA 4FN2A 2DYOA 4B95A 4HLEA 2NCNA 2ZNVC 4B6WA 2JRIB 3ZTCA 3QQ8B 3ML9A 4II2B 4WAAA 1JRUA 4KV2A 3V6CB 4HK2A 4IWQA 4IG7B 1WXSA 4BFRA 1WZ0A 3IHPC 4NAWB 3VXWA 5L83A 4MH0E 3NZSA 3BY4B 2MWSB 1WGDA 4WWOA 4LDTB 3ENEA 3PRMB 5G55A 3BINA 2KVRA 3V61A 2BYFA 2ZZPB 2DZIA 3MHSD 2NPTA 3W1SC 3CMMB 2JXXA 3K9PB 2D10A 4CO7A 3AXCA 5LXHA 3A9KB 2QHOA 3PGEA 2M4NA 3VUWA 1KOTA 4BVUC 4IM2A 2MP2B 2C9WB 3WA0A 4ZRKA 3ZNZB 4FBJB 2LD9A 2WDTB 1XD3B 2J0JA 2LGYA 4RMAA 3B08A 3VTUA 3C0RB 3DVNU 1WJUA 3ZLZA 2ZVOA 4TKNA 3ZW3A 5CX3A 2I1KA 1MG8A 2KDIA 1J19A 3A1QB 3DBSA 2B3AA 4AJWA 1OEYJ 4HVBA 2FCSA 3RYTA 3X23A 1GJZA 3MJWA 2LWPA 4IWPA 2G4DB 2KX0A 2WWZA 4F8CB 1AARA 4KZCA 1V5TA 1P98A 4N9F4 1TBEA 2AL3A 3O65B 2JVCA 2MQJA 2O6VB 1E90A 1LM8B 2ZEQA 3R7RA 4OVUA 3QWZB 2IY0B 2M1MA 3N3KB 1X1MA 2GBMA 3A4RA 1KM7A 3ZTDA 1LXDA 1BT0A 2PE6B 4BBNF 3U8ZA 1Z2MA 3UIOB 1IYFA 2ZNVB 1XQQA 3WANA 3QX1A 1WGYA 2AEHA 3EHVA 5GMVA 2IYDB 1GC6A 2FCNA 4WQOB 4F1SA 2Y5BB 5E6NA 4LJOB 4BKSD 3CSTA 2K8HA 2V4LA 1NBFC 2L3ZA 3L10B 4IM3A 4MJSB 3TL5A 1OQYA 2BWES 3W1SA 1RAXA 3A9KA 2LZ6A 3ZRFA 2PEAA 1EF1A 2KQ7A 4M0WB 3PT2B 4XX5A 2GBKA 2JZZA 3VVWB 4W9JA 3PREA 4II3B 3CF6E 2DZMA 2KOXA 1WE6A 3KVFB 1YJ1A 4OVVA 4FJVB 2N7DA 4TV3A 1E8YA 3RCZA 2N9EB 4K7WA 3RULA 4BKGA 3M63B 2REXA 3SDLC 5KHQA 4MGZE 1GNUA 2N9XA 4EZKA 3KH0A 4W9HA 5IAAC 1ZW7A 2VRRB 1R4MI 2K25A 1YD8U 2G3QB 5AZFA 1YX6B 3VUYA 4AP4C 3U30A 3ZRCA 2KMAA 5HKHA 4FLHA 5C23A 4PS8A 5CHFA 1WRDB 4KDIC 4AOFA 4DHZB 3VTVA 3T9LA 4KSKC 1V80A 3PVLA 3L08A 1UBIA 3TMPB 4E71A 1S1QB 2ASQA 3DDCB 2RD0A 2K8BA 3H7PB 3L17A 2L7RA 2DENB 2DYMA 2DZJA 2KK8A 2PJHA 3KUCB 3RZWC 1UH6A 2KKCA 2KWCA 4I6LB 2C7NB 5C1ZA 3EC8A 4WJQA 2R2OA 4G11A 2DAJA 3VHTC 2KDEB 4WWPA 3IFWB 3DVGX 4W9KA 4ANVA 2MBOA 3DBLI 1FXTB 2NBWB 2M17A 2KFJA 1SGHA 5DPWA 4TUUA 3R66C 4W9DA 2ZCCA 2D11A 2J7QB 3OLMD 1TZ1A 2G4SA 3PTFC 5E6OA 2JRHA 4PS3A 3M62B 4W9IA 4RM8A 4A3OA 2K8CA 3ONSA 4ASWC 3L13A 4A20A 4DK5A 1PQSA 2AYOB 4P7IA 4X57B 3VFKA 3ALBA 1WIAA 5J17A 3KW5B 4PYZA 1WGGA 2PPHA 2RR9A 2C7HA 3X0WA 3A4SC 2L00B 2KWVB 1WX9A 1WXMA 2KJRA 2V3SA 3K9OB 5J2RA 1C3TA 1J8CA 4JIOU 3Q3JA 3JW0X 2EMTA 5TR5A 2ZPYA 2I1JA 1L2NA 3ZDTA 2A4ZA 2HD5B 3W1YA 3WAMA 3VTWA 4ANXA 1H8CA 2KANA 5DPRA 4ANUA 2DYBA 1WF9A 2BYVE 3JSVA 1I35A 2M8SA 4CHKA 2WX1A 1WMHB 4NAWA 2N1VA 2XEWA 5EDSA 5G2NA 4BBNC 4I6NB 2CHXA 4HCNB 3ZDMC 3DVNV 2V1YA 3NZUA 4EOYA 4FJYA 4NJ6A 1Q0WB 4B9KA 3RZFA 4KDLB 1EUVB 4GU2A 1OGWA 3PRZA 3B1LX 4GGQA 4GXBA 2C60A 3APDA 4RM9A 3D32A 3TJPA 4WJPA 3CSFA 1WY8A 5DCNA 1WXVA 5E6PA 3VDZA 1Q5WB 1WJNA 1P9DU 2G45B 3VQIA 4IW0A 1HE8A 4DDGD 3KUDB 1QZEA 1R4NI 1D3ZA 1KJTA 2Z59B 3ZVVA 1V86A 3AU5A 3RD2A 3DBRI 1GG3A 4ZYNA 3PLVA 2R2QA 4URKA 4HWIB 2KQSA 3V62A 3L54A 2K39A 1P0RA 3WAPA 4FHJA 4KVGB 3QCAA 3QC8B 1P3QU 3HHMA 2KN5A 3UGBB 3ZNID 3AULA 1M94A 2HJ8A 1YX5B 1K8RB 1C1YB 4E74A 2HE7A 1WR1A 2JY6A 4GN1A 2LVQA 3NOBA 3RUIB 2KC1A 2W9NA 1UGMA 4ANWA 4LDTD 2FCMA 3H1UA 4EZLA 4MSQB 3KYDD 4ZRIA 4J6IA 3VH4B 4IM0A
chains in the Genus database with same CATH superfamily
2KTRA 2LI5A 1WX7A 5FR3A 2WXIA 3Q8BA 1WI0A 2V3PA 1UWMA 3NZ3A 4ICUA 1DOIA 4WH4A 3Q3FA 1KLUD 2KXJA 4IWOA 3QJZA 2XK5A 1V81A 2B76B 4G0NB 1ZE3D 3PLUA 4YL8A 1XLQA 3QIJA 2FUHB 1JW9D 4K1RB 1V5OA 4HEA1 4MGKE 2EMSA 1V2YA 2MRPA 3N9YC 4OW0A 2LGDA 3ZKJC 1QKZA 1VD2A 3TEWA 3NS1A 2IO2B 2OOBB 4NQKE 2RDHA 1HXYD 3OJ4B 1LQBA 5JHBA 4JWSC 2INNE 4GDKA 4DXGA 1L7YA 2BKFA 5L95C 4USAA 3GS2A 4NPNA 3APCA 3VRAB 1IP9A 2MA9B 2QC8A 3P2BA 2A5UA 4RF0A 3QAQA 4GDLB 1SIFA 4GIVA 4JQWC 4MDKE 2IZVB 4NJ7A 2TSSA 2LHDA 3AEAB 4NJCA 3R3MA 4RH6A 2W82A 2KLGA 2KQ4X 2FNJB 4WQMA 1RYJA 2BTEA 3HVZA 4FHKA 2OHFA 1XF5L 1R4MB 2DX5B 1YJJA 2CHWA 1KFYB 1TS3A 4WJNA 1STEA 1DOYA 1I42A 1TZOA 3M95A 3NVWA 3AI5A 1YIWA 1TY0A 4MT5A 1VZ8A 2KDBA 2L0TA 2MJEA 4ZYSA 3HIZA 3N30A 2FIFA 4W9CA 4RGOS 2VH1A 2MBEA 4AJYB 3A9JA 2IO1B 5TSSA 5D7GA 2JXTA 3Q6BA 2M19A 3DVGY 3EGRA 3UIPB 1MFWA 1JMLA 2BPSA 5AUKA 2WXLA 3ZNGC 2G9HD 1I4RA 5AUIA 4DQOC 1YQ3B 5C3JB 1OTRB 1RRBA 3AE9B 3Q2AC 2BBCA 2KHWB 1WJ4A 1XT9B 4IUMB 3VAWA 2NVUI 1C4PA 4I6PA 3MC0B 1V1PB 4DHJD 3VUXA 3OAWA 2ZVNA 3S2AA 1C4AA 3EECA 3RMKC 4KZ0A 4MGYE 4KIKB 1OQRA 2GMIC 2YVCA 3QA8A 1C9FA 1F9JA 3B2GA 2KLCA 4MELA 3MHZA 4AUQC 2GBJA 3DBRB 1TKEA 3H7PA 2N9KA 2LMCA 1C78A 1Z5SB 3MFGA 2KACA 3WIMA 2CR5A 3A1QA 1ACCA 2RGFA 1C77A 2IO3B 3ABVB 3EFUA 1Q1OA 2J53A 2KDFB 3HM6X 2NBVB 2WDVB 1T0YA 5J18A 3IG3A 1F77A 4OVZA 1ZPSA 5FK9C 1N61A 2LVPA 5G5GA 4B95A 1YN3A 2JRIB 2UU7A 1JRUA 4YT0B 4BFRA 5L83A 3IAM1 2PKOA 5BMIA 1A70A 4WWOA 4LDTB 2D3BA 5G55A 4B0EA 2KVRA 3V61A 2BYFA 3AECB 2DZIA 1D5XC 2BT6A 2OEDA 3W1SC 4CO7A 3RNAC 3SEBA 3PGEA 1KOTA 3AE2B 2MP2B 3GP7A 2QILA 1ET6A 3ZNZB 3Q69A 3AV8A 2WDTB 1TIFA 2ZVOA 4TKNA 3ZW3A 1IUEA 5IOIA 3A1QB 4YSYB 1D4BA 2FCSA 3KWVA 3DHIC 1SE3A 4IWPA 2G4DB 2KX0A 2WWZA 4KZCA 1P98A 2EELA 2K5PA 2O6VB 4OVUA 3QWZB 2IY0B 2L1AA 2M1MA 3BYTB 2GBMA 1KM7A 4C80A 1BT0A 1Z2MA 3UIOB 1AN8A 4M02A 1IYFA 1SF0A 3WANA 1CK1A 1WGYA 4LNNA 2IYDB 2FCNA 2Y5PA 5D3IB 1UWXA 4IM3A 3L10B 4M00A 4WURA 4ARIA 3V3XA 2KQ7A 1GOZA 1XLPA 1SIJA 4FJVB 1E8YA 3RCZA 3SDLC 2REXA 1NYRA 4EZKA 4MM3B 2WU2B 1QT9A 2PVOD 3Q8CA 5IAAC 1ZW7A 4N6EB 5AZFA 2IGGA 3U30A 2KMAA 1T5XD 3KWLA 5CHFA 2M0AA 2J4XA 1RFKA 4KDIC 4DHZB 1V80A 3TMPB 3PZ8A 1SJED 2HJ1A 2DENB 1IBXB 2PJHA 3RZWC 5C1ZA 2CJNA 1M4VA 1PGAA 2R2OA 2BS4B 2DAJA 4LNIA 1SBBB 2LHEA 3VHTC 4A55A 3IFWB 2MBOA 1FXTB 2NBWB 2KFJA 4W9DA 2JRHA 4RM8A 2K8CA 4X57B 1CZPA 2VH2A 3N1XC 3ALBA 3EUB2 5J17A 2M56B 2C7HA 3A4SC 1C3TA 1WXMA 1TS4A 1J8CA 2LFIA 2W55A 3Q3JA 2ZPYA 1L2NA 3W1YA 2WLBA 2MHJA 1I7HA 1H8CA 1Q10A 1I35A 2XEWA 4I6NB 4HCNB 2V1YA 3DHGC 5FKAC 2AQ2B 2D3AA 1P7FA 3TJPA 2QCZA 3D32A 1K52A 5DCNA 5E6PA 4RGMA 2FBWB 1WRIA 4XWWA 4IW0A 4DDGD 1D3ZA 3AU5A 3RD2A 1GG3A 2KYWA 2R2QA 4HWIB 3FILA 1P0RA 4RNAA 1GPXA 5BMGA 3AE4B 1JQ4A 2KN5A 5IO9A 1M94A 1YX5B 1C1YB 4E74A 2HE7A 1JCKB 2CU3A 4RGNA 2JY6A 2LVQA 1TJEA 1HQRD 2FCMA 3H1UA 3ZJTA 1XXGA 3PO0A 2JQRB 2XN9C 4KGSA 3VH4B 3O13A 2BYEA 2C5LC 4DWFA 4DHZE 1WFYA 1WR6E 1RM6C 4XC2A 5DPSA 5IN7A 2DZKA 4DXFA 2KWUB 3T3NA 5KHOA 2HTHA 5CTRC 2KTRB 2LXCA 4GDLA 4GSWA 2AQ1B 5D6JB 4M8NA 3SD5A 1RLFA 1FIQA 1L0XB 5D3DA 4LNFA 1A5RA 1GUAB 4EZJA 3TBLD 4FJZA 1MHXA 4ICVA 3E56A 2JZ3B 2K1FA 2NPTB 3IAS1 4XWTA 1YN4A 3UQAA 1LGRA 3IT4B 3OJ3A 2YLMA 1VRAB 2BQQA 1EM7A 2W3RA 3DHHC 4XDCA 2WXJA 2ZJDA 4JLCA 3RI7C 3EFCA 4GOCA 4JWUC 1N63A 2WXHA 3IVFA 3ZO5B 1BUIC 3VH3B 2H89B 4XDDA 2IPKD 1VCBA 1HZ5A 2MBHA 3U7DA 1D5ZC 1JWSD 2DNFA 2LUEA 2O2VA 4ZHOA 4E3CA 5C2TB 2FIDA 2JYEA 2MJDA 1E8WA 2KMCA 2BGFA 4P1BC 4WIPA 1WYWB 2N1WA 1E7UA 4BOZB 1ZDVA 1SE2A 3RNBC 1KRHA 4DBGA 1LFDA 2QDFA 1F0ZA 1ZXIA 5EE0A 1ZKHA 1RWSA 3PRPB 3JVZX 1E8ZA 3I9V1 1FO4A 4M0WA 1E7VA 1AW7A 2BF8B 3DBHB 2KVZA 1UNSA 2BYTA 1SSNA 1SEBD 3GE3C 2OJRA 2WXFA 3SU8X 4D2KA 2KDMA 1J7CA 4YWGG 1V9JA 3RFZB 4QAYA 3VRBB 1L4ZB 2X8XX 3C19A 4M8MA 1DYQA 1QOBA 4MGIE 4RFBA 1FXAA 2D3GA 4DHJB 5GXGB 4YSZB 3ZJVA 2LEKA 1WM3A 4JGHB 4HJKA 2IBIB 4XZ4A 2DHZA 1DOXA 4IOIE 3TIXA 2LRUA 2WDRB 2JWZA 3GZNB 3I63C 4S17A 2IGHA 1UELA 4TQ1A 5D2MB 4BKSA 1MG4A 2R61A 4MM3A 3T8MA 3BVMA 1TGZB 3UF8A 2AQ3B 2LGSA 3H7SA 2JPHA 1EF5A 2ZW0A 2MLBA 4A3PA 3DOWA 4W9GA 3IXSA 1PDXA 4AQ7A 1FFUA 3JSVB 2QEJC 4G50A 3U52E 1AWDA 3P4RB 4HDQA 1V1PA 3WAOA 1GB1A 3V60A 1C76A 2RPVA 4KSLC 1L6VA 1JWUD 4MJSA 3NVYA 4PYUA 4EFOA 4ZRJA 2O6VA 3FILB 1ISNA 2KD0A 3W5VB 4W9LA 4K7SA 1IPGA 2CJOA 4HLEA 1F2RC 2NCNA 2ZNVC 2KAJA 2VZKD 3ML9A 3B9JA 4II2B 4WAAA 3Q8AA 1WYGA 1WZ0A 3VXWA 3BY4B 1I4PA 3PRMB 3BINA 3MHSD 2NPTA 2I38A 2D10A 4HROA 3VUWA 3AH7A 4IM2A 2C9WB 1C4CA 3IT6B 4ZRPA 1N5WA 2N9LA 3BK2A 2ON8A 3VTUA 3DVNU 1WJUA 3LYYA 5CX3A 2I1KA 4WAFA 2MH7A 1ESFA 5H92C 4HVBA 4BZAA 1JWMD 3X23A 4HRSA 4C56C 1GJZA 1OFFA 5HFYA 3MJWA 1UF0A 3AEBB 4F8CB 1V5TA 2I2YA 1PFDA 4N9F4 4K3BA 3NJTA 2MQJA 3Q3NC 5BYQA 1ENFA 1F2RI 3HUIA 1LXDA 3RNEC 3ZGZA 4J3OD 2ZNVB 3AEDB 3QX1A 5GMVA 1GC6A 4LNOA 2Y5BB 2INPE 4LJOB 2L3ZA 1OQYA 2BWES 3ZRFA 4ITKA 4L2YA 1EF1A 2WP9B 4YTNB 2GBKA 2PLPA 4II3B 3C8YA 2DZMA 2NTSA 3CWIA 4TV3A 4REZA 3BYYB 4K7WA 4BKGA 5KHQA 2V9HA 1GNUA 1NVID 3KH0A 5I4DA 2K25A 3AE3B 4AP4C 1EU3A 1XCTL 2DWQA 3ZRCA 1QILA 4FLHA 1QLBB 3B2FA 4AOFA 2PW9A 3L08A 2PVGC 4US8A 3RNFC 1ZXHA 2RD0A 3KUCB 1UH6A 2KWCA 2C7NB 4WJQA 3H8HA 4OZCA 2KDEB 1TY2A 4RF1A 4HJGE 3DVGX 4W9KA 3DBLI 1SGHA 4TUUA 3R66C 2ZCCA 1N5XA 1SE4A 3OLMD 2J42A 4PS3A 3ONSA 1JROA 5LNK1 3I57A 4P7IA 1WIAA 4LLGM 3KW5B 4RCOA 2RR9A 3X0WA 2IJ0A 2KWVB 2KJRA 2V3SA 3MJ5A 1QOGA 4JE3B 3R2TA 5TR5A 2YEPF 3ZDTA 2HD5B 1FNVA 2WHIA 4YTPB 1K50A 4ANXA 2KANA 2IGDA 2DYBA 1WF9A 2M8SA 2WX1A 4NAWA 2N1VA 4BBNC 2QJLA 3DVNV 4B9KA 1Q0WB 4KDLB 2BB6A 1OGWA 3B1LX 1MHHE 2LUMA 2KT7A 4GXBA 2SEBD 1Q5WB 1WJNA 2G45B 3VQIA 1J7BA 2L32A 2FE8A 3NUHB 1SB3C 3MC9A 1NEKB 4ZYNA 4URKA 3BVZA 3V62A 3WAPA 1L4DB 3UGBB 2Y5CA 5IP4D 3AN1A 3WCQA 3RUIB 1UGMA 4ANWA 1QOAA 1I4HA 1XLOA 3KYDD 4J6IA 3P42A 4MACA 3U4EG 2MBQA 1L0VB 5CHWA 2BWFA 2K6DB 4MEMA 5EE9A 3URYA 1E7PB 3NVZA 4KIKA 3W9CB 5IA7A 4HDOA 1N60A 1E5WA 3AE7B 2O2VB 2L83A 3VR9B 1Y56A 1S3SG 2ZCBA 2V4IB 3HM3A 3N32A 3TEZA 3ML8A 2XK5B 3UQBA 1YJIA 2WXRA 1GAQB 2WX0A 4LTUA 1KLGD 2NS5A 3KLSX 4N59A 1WGHA 3GE8C 4FADA 5BMHA 2MX2A 3H6NA 3SFDB 2WU5B 2CS4A 3PS6A 5LLIA 2Z0DB 3BZDB 5D94A 2XBBC 3DBLB 3LJ3A 1TT5B 5HG2A 5AEKB 2Z8LA 3IBEA 5AZGA 2ACZB 2JUOA 4NNJB 5JH5C 3TSSA 3J9CA 2N9PC 2DBYA 2NBUA 3MTNB 3KQ4A 4BAXA 1V49A 2LXAA 2OJWA 4HKQA 1UD7A 3TUOA 4C4VB 4A8XC 5HHDG 3PHWB 1YN5A 3TCAA 3L16A 1WMHA 4ARCA 3ZIMA 2MSED 3BK1A 1TYGB 4ZDVA 3TEXA 1HEZE 2KFKB 1YMHE 3U7ZA 4MSMB 4EKUA 1WGKA 2UWQA 3EA6A 2INCC 3JYUA 3AMZA 3B0AA 2BS2B 4HPLB 3AE8B 4HPMB 1MPEA 2MW5A 2WXPA 1V6EA 2NMQA 2RPQA 1G6JA 4W9EA 1FMAD 3RNCC 3W2DA 2GRIA 3DCGA 1MVKA 2N4FA 2FUG1 1EO6A 3GZNI 1V1OA 1TS2A 1WX8A 4KKIA 3PPAA 4G3XB 1KLVA 2INDC 4GB9A 4WWNA 5HI1A 2BVCA 2KNBA 1YNTE 1P7EA 3NY5A 2JT4B 1R7SA 4EUTA 3QHTA 4IKGA 4KGRA 4FULA 1J0GA 1WM2A 4JX1C 1QQRA 1SE9A 4HCPB 3H9DA 3M3JA 4XGAB 2ONQA 3NG0A 4AWJA 2KN4A 2AX5A 2G1EA 1IGDA 4TMAB 2PE9A 1UBQA 4PS7A 1VJKA 5JZEB 1E8XA 2RSUA 4DXAB 2LGXA 1WXQA 3DQVA 1QF6A 2ZPNA 2BW2A 3RNGC 3R7QA 3N1ZC 2GI9A 1HTQA 1K53A 2UYZB 3Q14C 2EKEC 4GMVA 3LB8C 2J52A 2K0PA 4RGTA 2LVOA 1KF6B 2WYQA 4BOSC 2M0XA 2LJ5A 1OEYA 2MP2A 4OHJA 2DYOA 1FCCC 3ZTCA 1PYWD 4KV2A 3MP9A 3V6CB 4IG7B 1WXSA 1BXTA 1F1HA 4MH0E 2MWSB 2XNAC 1WGDA 3ENEA 4ZHPA 3P4SB 4NZLB 4O1NA 3AXCA 2QHOA 2V3NA 2VZKB 2M4NA 3WA0A 4M01A 4ZRKA 2WXOA 4FBJB 2K3UA 3ZJUA 1VZ7A 1XD3B 2J0JA 4FXCA 4RMAA 3B08A 3C0RB 3ZLZA 1N6ZA 2KDIA 1J19A 5BYSA 2PTLA 3DBSA 2X38A 2B3AA 2JSVX 2WXNA 4KX6B 1GB4A 1IBXA 1AARA 1FRRA 3DWMA 4P6VF 1LM8B 3N3KB 1X1MA 2JWUA 3A4RA 3ZTDA 2PE6B 3HRDD 3SR6A 4P16A 1MI0A 2AEHA 4GLSC 4F1SA 4MJSB 2K8HA 3TL5A 1NBFC 2W3SA 2RMMA 3ZXRA 2LZ6A 2PEAA 1AYFA 4M0WB 3VVWB 4W9JA 3PREA 3LXFA 4AS1A 2KOXA 4A6QA 1WE6A 3KVFB 1YJ1A 4OVVA 3RULA 3M63B 4WWMA 2W54A 3Q8EA 1R4NB 5MPOA 1R4MI 1D5MC 2G3QB 3VUYA 5HKHA 4KKJA 4PS8A 1SJHD 3VTVA 3T9LA 1QOFA 1S1QB 2JYTA 2ASQA 3DDCB 2WDQB 3H7PB 2K8BA 4LNKA 2DZJA 2KK8A 2KKCA 4I6LB 4G11A 4ANVA 4PK1A 1NYQA 5DPWA 3FAHA 1VZ6A 2SAKA 3AEGB 5E6OA 4W9IA 4ASWC 1I4QA 2N0SB 2WGSA 4A20A 1PQSA 3VFKA 4PYZA 5EE3A 4LK0M 1FCLA 1WX9A 4JIOU 2EMTA 1HTOA 2KMMA 4NAMA 4ANUA 3JSVA 4S0RA 5EDSA 2ZW1A 3ZDMC 2CHXA 4EOYA 3NZUA 2EKIA 3E9SA 4NJ6A 4JPSA 1EUVB 5E6JA 4A9AA 1JWBD 3ZQ4A 4YTMB 2C60A 3APDA 4RM9A 4WJPA 4MH8A 3CSFA 1WY8A 2WXKA 1WXVA 3VDZA 1P9DU 1JWAD 4TSSA 3P4QB 1HE8A 3P1MA 1V86A 3DBRI 4OZBA 2PIAA 3BVGA 3ZXVA 1FNWA 3ZYYX 2BS3B 2YEPB 2K39A 3L54A 4FHJA 4KVGB 3QCAA 1T0RC 1P3QU 3AULA 1K8RB 1WR1A 1C79A 3RN9C 1EU4A 3NOBA 4MSQB 2NTTA 1ZP0B 4IM0A 5DPTA 2N7EA 1U4AA 3NRZA 1HA5A 1K51A 2KJHB 1NI2A 1XLNA 3MC8A 4NY0A 3PHXB 2D3CA 4L1BA 2GB1A 3P4PB 1T0QC 1I4XA 3V6EB 2AL6A 1TKYA 2JU6X 2KO3A 5JHAA 1UZXB 2LRWA 4F7ZA 2L0FA 3AU4A 3WALA 1YOVB 1E0ZA 3LDZE 1UGJA 1H4RA 5EE1A 4EE2A 3HK0A 2BKRB 2E3TA 1WH3A 2KFKA 4IC7B 2Z0EB 3A9JB 4EEWA 4BKTA 4GDKB 4US9A 2L8JA 5BYRA 3L4PA 4W9FA 1EWCA 2J0MA 2J0KA 2MBBB 4K81A 3APFA 3PV1A 1KTKA 4C4VA 2N7JA 3VR8B 4ZOHC 2LASA 2GBRA 1P1AA 1WWTA 3UI3A 1FNUA 3A33B 1VDVA 3ZUNA 5CHVC 4NQLB 3DPDA 1RFAA 3KYCD 2NR2A 2KTFA 3V05A 2O6VD 3P63A 2IO0B 3I5JC 1XCQL 2GOWA 3N1YC 4Q2JA 2WXQA 2IY1B 1WE7A 1FPYA 5H8YE 3DBHI 3PZDA 1NDDA 1EWYC 4FA6A 5LXIB 4C7ZA 2L76A 2L05A 4N58A 4HKZE 1WXAA 2DAFA 2FAZA 3TEYA 2AWTA 4YSXB 2CKHB 1DGJA 5AZHA 2CU1A 4YXDB 2MEKA 3R2IA 2JX5A 3QARA 4KGTA 3AE1B 3BWUD 5FR6A 4WJOA 1HZ6A 1NENB 4TQ0A 3NVVA 5BO4B 2FCQA 4HXDA 1YQBA 3RPFC 3SFEB 2KJ6A 1FEHA 2MCNB 2QIEB 1VLBA 1T3QA 1ZDXA 2DLBA 3OG5A 4K7UA 4R3DA 2C7MB 2KZRA 1GC7A 4JL9A 1Y8RC 3ECIA 3UINB 4UDUC 1WZ3A 2KX3A 3CIRB 3NHEB 3SHQA 2WXGA 2K6QA 3NS8A 2D2QA 1B9RA 2V0GA 1F52A 3GOEA 2CHZA 3ZNHB 3R8BA 1WGRA 2E6XA 1CMXB 4CYEA 1TTNA 3L0WB 4XYCA 4LCDE 3T3OA 2GBNA 3U2SC 2KC2A 4C7YA 4P1CC 3QK0A 2D07B 3AEEB 1WJ6A 2JF5A 4DDID 4LJPB 1KH0A 1ZGUB 3KUZA 3RT3B 2QMTA 1FXIA 3PSEB 3BIID 1CQVA 3I3TB 1JALA 1E10A 4FN2A 1E9MA 4B6WA 3AE5B 3QQ8B 1PUTA 4HK2A 4IWQA 4NAWB 3IHPC 1PGBA 4C00A 3NZSA 1V97A 2ZZPB 2H88B 1T6BX 3CMMB 2JXXA 3K9PB 5LXHA 3A9KB 4BVUC 2LD9A 3AM9A 1PGXA 2LGYA 3N20C 3Q3OC 1MG8A 3AE6B 3ETRA 4K3CA 2Q5WD 4AJWA 1OEYJ 3RYTA 1B1ZA 1FRDA 2L52A 2LWPA 2HDEA 1TBEA 2AL3A 3O65B 4HPPA 2JVCA 2PMVA 5G5HA 1E90A 2ZEQA 5T8IA 3R7RA 4OZAA 1T0SC 5JXVA 1ROEA 1XO3A 1N62A 4BBNF 3U8ZA 2WNMA 1BMLC 1XQQA 3EHVA 4WQOB 2GLSA 1TS5A 5E6NA 4BKSD 2D5GA 3CSTA 2V4LA 4ACFA 4L23A 3W1SA 1RAXA 3A9KA 3HVDA 3PT2B 4XX5A 2JZPA 2JZZA 3CF6E 3AB5A 1V8CA 2N7DA 2N9EB 1L0YB 4MGZE 2LJIA 2N9XA 2RDGA 2HTME 1FFVA 1OQQA 4W9HA 1E6EB 2VRRB 1IGCA 1YD8U 1YX6B 1ET9A 3W5UB 1L5PA 1JRPA 5C23A 1WRDB 4XE0A 1XEEA 4H2AA 4KSKC 3PVLA 1CJEA 1UBIA 4E71A 3L17A 2K22A 2L7RA 2DYMA 2QSDA 1L6UA 1D6EC 3EC8A 2WXMA 3FKYA 4WWPA 2M17A 2D11A 2J7QB 1NI3A 1TZ1A 2G4SA 3PTFC 3M62B 4A3OA 2IDYA 1UUPA 3L13A 4A90A 4DK5A 2AYOB 5IKCM 2KWDA 2LGIA 1WGGA 4B0MA 2PPHA 4PT5A 2L00B 3K9OB 5J2RA 2K9XA 3JW0X 2WS3B 1LO5D 1YQ4B 4CQNA 2I1JA 2A4ZA 1SXTA 3WAMA 3VTWA 5DPRA 3FC4A 2BYVE 4CHKA 1WMHB 2RDBC 2WQYB 5G2NA 4FJYA 3GB1A 1TKGA 4ZRQA 3AEFB 3RZFA 2Y3AA 4GU2A 3PRZA 4GGQA 3DWGC 1ZOYB 3Q8FA 4IDIA 2MJ3A 3Q3MC 3KUDB 1QZEA 1R4NI 1KJTA 2Z59B 3ZVVA 1I4GA 2BB5A 3PLVA 2KQSA 1ZUD2 1MJDA 1FD6A 3QC8B 3HHMA 3ZNID 2HJ8A 1FM0D 2ICIA 3OWEB 4GN1A 2KC1A 2W9NA 4LDTD 1VR9A 1WSPA 4EZLA 4ZRIA 3PZ7A 1J7AA
chains in the Genus database with same CATH topology
5DPTA 2N7EA 2KTRA 2MBQA 1U4AA 2BYEA 2C5LC 2LI5A 5CHWA 2KJHB 1NI2A 1WX7A 2BWFA 4NY0A 2K6DB 3PHXB 4MEMA 4DWFA 4DHZE 1WFYA 1WR6E 5IA7A 4KIKA 4HDOA 4XC2A 5DPSA 1E5WA 1WI0A 2DZKA 3V6EB 2O2VB 2KWUB 2AL6A 4ICUA 5KHOA 5JHAA 2HTHA 2KO3A 5CTRC 1UZXB 2KTRB 2LXCA 2LRWA 4GDLA 4GSWA 4F7ZA 3Q3FA 2L0FA 2KXJA 4IWOA 3AU4A 5D6JB 1S3SG 3QJZA 4M8NA 3WALA 3SD5A 1RLFA 2XK5A 1V81A 3LDZE 2ZCBA 1A5RA 1GUAB 1H4RA 4EZJA 3HK0A 3TBLD 3HM3A 2BKRB 3N32A 3ML8A 1WH3A 2KFKA 4FJZA 3PLUA 2JZ3B 2Z0EB 3A9JB 4IC7B 4ICVA 4YL8A 2K1FA 2NPTB 2XK5B 4BKTA 4EEWA 3UQBA 3QIJA 2FUHB 4GDKB 4K1RB 1V5OA 4MGKE 2WX0A 3UQAA 3OJ3A 2L8JA 2YLMA 2EMSA 2NS5A 1V2YA 4W9FA 2MRPA 1WGHA 2J0MA 2J0KA 2MBBB 2LGDA 3ZKJC 4K81A 2ZJDA 3APFA 3PV1A 4JLCA 1VD2A 4GOCA 4FADA 2IO2B 2OOBB 2MX2A 3H6NA 3IVFA 4NQKE 3ZO5B 2CS4A 3PS6A 3VH3B 3OJ4B 5LLIA 2Z0DB 2LASA 2GBRA 1P1AA 1LQBA 5JHBA 1VCBA 5D94A 2XBBC 3A33B 3LJ3A 4GDKA 2MBHA 1L7YA 2BKFA 3U7DA 3ZUNA 5AEKB 5L95C 5CHVC 4NQLB 4NPNA 3APCA 2LUEA 3IBEA 3DPDA 1IP9A 2MA9B 1RFAA 2O2VA 3KYCD 2NR2A 2KTFA 5AZGA 3P2BA 2A5UA 4E3CA 2O6VD 3QAQA 2FIDA 2JUOA 2IO0B 4GDLB 1E8WA 1SIFA 2KMCA 4NNJB 2BGFA 2GOWA 5JH5C 4GIVA 4JQWC 4MDKE 2IZVB 2N9PC 1WYWB 2IY1B 2NBUA 3MTNB 2N1WA 1E7UA 4NJ7A 1WE7A 4BOZB 1V49A 2LXAA 4DBGA 3R3MA 1LFDA 2KLGA 1UD7A 2FNJB 3DBHI 3PZDA 3PHWB 1NDDA 3TCAA 3L16A 4FHKA 4FA6A 5LXIB 1ZKHA 1WMHA 3ZIMA 2DX5B 2L76A 2CHWA 2MSED 3PRPB 3JVZX 4ZDVA 1E8ZA 2L05A 4WJNA 1E7VA 1WXAA 2DAFA 2FAZA 2BF8B 2KFKB 2AWTA 1I42A 2CKHB 3M95A 3AI5A 4MSMB 4EKUA 2UWQA 5AZHA 3SU8X 2OJRA 3JYUA 2CU1A 3B0AA 1YIWA 4HPLB 4HPMB 1V9JA 3QARA 2KDBA 2L0TA 2MW5A 3HIZA 3N30A 2FIFA 1V6EA 2RPQA 5FR6A 4WJOA 1G6JA 4TQ0A 4W9CA 4W9EA 4M8MA 2MBEA 4AJYB 3A9JA 5BO4B 2IO1B 2FCQA 4HXDA 1YQBA 3DCGA 4MGIE 2N4FA 3GZNI 1EO6A 5D7GA 2D3GA 4DHJB 2KJ6A 2MCNB 1WX8A 3PPAA 3DVGY 3UIPB 4G3XB 1KLVA 2BPSA 4K7UA 2C7MB 4GB9A 4WWNA 1WM3A 3ZNGC 4JGHB 2KZRA 4HJKA 2IBIB 1OTRB 1GC7A 1RRBA 4JL9A 4XZ4A 1Y8RC 2KNBA 3ECIA 2DHZA 2KHWB 1WJ4A 1XT9B 4IUMB 3VAWA 2NVUI 3UINB 1WZ3A 2JT4B 3NY5A 4I6PA 3QHTA 2LRUA 3TIXA 4EUTA 2JWZA 2KX3A 4TQ1A 4DHJD 1UELA 5D2MB 4BKSA 3VUXA 3OAWA 2ZVNA 3NHEB 3S2AA 4MM3A 4FULA 3SHQA 1TGZB 3T8MA 2K6QA 1WM2A 3NS8A 1J0GA 3EECA 2D2QA 3UF8A 1SE9A 3H7SA 4HCPB 2JPHA 3H9DA 1EF5A 3GOEA 2CHZA 4KZ0A 3M3JA 4MGYE 3ZNHB 2MLBA 4KIKB 2GMIC 3DOWA 4A3PA 2YVCA 4W9GA 1WGRA 3QA8A 4AWJA 1CMXB 4CYEA 1F9JA 2KLCA 1TTNA 3L0WB 4MELA 2PE9A 1UBQA 4PS7A 4AUQC 3JSVB 2GBJA 5JZEB 4G50A 1E8XA 3H7PA 4LCDE 2RSUA 2GBNA 1Z5SB 4DXAB 4HDQA 2KC2A 3WAOA 2LGXA 3DQVA 3QK0A 2ZPNA 3R7QA 3V60A 3WIMA 2D07B 2CR5A 3A1QA 2UYZB 2EKEC 2IO3B 2RGFA 4KSLC 1WJ6A 2JF5A 4GMVA 3EFUA 4MJSA 1Q1OA 2KDFB 4DDID 3HM6X 4LJPB 2NBVB 2LVOA 4PYUA 4EFOA 1ZGUB 3KUZA 2WYQA 4BOSC 1T0YA 3RT3B 4G0NB 5J18A 4ZRJA 3IG3A 2M0XA 3PSEB 2O6VA 2LJ5A 1ISNA 1OEYA 2KD0A 3I3TB 2MP2A 4W9LA 4K7SA 1IPGA 2LVPA 4FN2A 2DYOA 4B95A 4HLEA 2NCNA 2ZNVC 4B6WA 2JRIB 3ZTCA 3QQ8B 3ML9A 4II2B 4WAAA 1JRUA 4KV2A 3V6CB 4HK2A 4IWQA 4IG7B 1WXSA 4BFRA 1WZ0A 3IHPC 4NAWB 3VXWA 5L83A 4MH0E 3NZSA 3BY4B 2MWSB 1WGDA 4WWOA 4LDTB 3ENEA 3PRMB 5G55A 3BINA 2KVRA 3V61A 2BYFA 2ZZPB 2DZIA 3MHSD 2NPTA 3W1SC 3CMMB 2JXXA 3K9PB 2D10A 4CO7A 3AXCA 5LXHA 3A9KB 2QHOA 3PGEA 2M4NA 3VUWA 1KOTA 4BVUC 4IM2A 2MP2B 2C9WB 3WA0A 4ZRKA 3ZNZB 4FBJB 2LD9A 2WDTB 1XD3B 2J0JA 2LGYA 4RMAA 3B08A 3VTUA 3C0RB 3DVNU 1WJUA 3ZLZA 2ZVOA 4TKNA 3ZW3A 5CX3A 2I1KA 1MG8A 2KDIA 1J19A 3A1QB 3DBSA 2B3AA 4AJWA 1OEYJ 4HVBA 2FCSA 3RYTA 3X23A 1GJZA 3MJWA 2LWPA 4IWPA 2G4DB 2KX0A 2WWZA 4F8CB 1AARA 4KZCA 1V5TA 1P98A 4N9F4 1TBEA 2AL3A 3O65B 2JVCA 2MQJA 2O6VB 1E90A 1LM8B 2ZEQA 3R7RA 4OVUA 3QWZB 2IY0B 2M1MA 3N3KB 1X1MA 2GBMA 3A4RA 1KM7A 3ZTDA 1LXDA 1BT0A 2PE6B 4BBNF 3U8ZA 1Z2MA 3UIOB 1IYFA 2ZNVB 1XQQA 3WANA 3QX1A 1WGYA 2AEHA 3EHVA 5GMVA 2IYDB 1GC6A 2FCNA 4WQOB 4F1SA 2Y5BB 5E6NA 4LJOB 4BKSD 3CSTA 2K8HA 2V4LA 1NBFC 2L3ZA 3L10B 4IM3A 4MJSB 3TL5A 1OQYA 2BWES 3W1SA 1RAXA 3A9KA 2LZ6A 3ZRFA 2PEAA 1EF1A 2KQ7A 4M0WB 3PT2B 4XX5A 2GBKA 2JZZA 3VVWB 4W9JA 3PREA 4II3B 3CF6E 2DZMA 2KOXA 1WE6A 3KVFB 1YJ1A 4OVVA 4FJVB 2N7DA 4TV3A 1E8YA 3RCZA 2N9EB 4K7WA 3RULA 4BKGA 3M63B 2REXA 3SDLC 5KHQA 4MGZE 1GNUA 2N9XA 4EZKA 3KH0A 4W9HA 5IAAC 1ZW7A 2VRRB 1R4MI 2K25A 1YD8U 2G3QB 5AZFA 1YX6B 3VUYA 4AP4C 3U30A 3ZRCA 2KMAA 5HKHA 4FLHA 5C23A 4PS8A 5CHFA 1WRDB 4KDIC 4AOFA 4DHZB 3VTVA 3T9LA 4KSKC 1V80A 3PVLA 3L08A 1UBIA 3TMPB 4E71A 1S1QB 2ASQA 3DDCB 2RD0A 2K8BA 3H7PB 3L17A 2L7RA 2DENB 2DYMA 2DZJA 2KK8A 2PJHA 3KUCB 3RZWC 1UH6A 2KKCA 2KWCA 4I6LB 2C7NB 5C1ZA 3EC8A 4WJQA 2R2OA 4G11A 2DAJA 3VHTC 2KDEB 4WWPA 3IFWB 3DVGX 4W9KA 4ANVA 2MBOA 3DBLI 1FXTB 2NBWB 2M17A 2KFJA 1SGHA 5DPWA 4TUUA 3R66C 4W9DA 2ZCCA 2D11A 2J7QB 3OLMD 1TZ1A 2G4SA 3PTFC 5E6OA 2JRHA 4PS3A 3M62B 4W9IA 4RM8A 4A3OA 2K8CA 3ONSA 4ASWC 3L13A 4A20A 4DK5A 1PQSA 2AYOB 4P7IA 4X57B 3VFKA 3ALBA 1WIAA 5J17A 3KW5B 4PYZA 1WGGA 2PPHA 2RR9A 2C7HA 3X0WA 3A4SC 2L00B 2KWVB 1WX9A 1WXMA 2KJRA 2V3SA 3K9OB 5J2RA 1C3TA 1J8CA 4JIOU 3Q3JA 3JW0X 2EMTA 5TR5A 2ZPYA 2I1JA 1L2NA 3ZDTA 2A4ZA 2HD5B 3W1YA 3WAMA 3VTWA 4ANXA 1H8CA 2KANA 5DPRA 4ANUA 2DYBA 1WF9A 2BYVE 3JSVA 1I35A 2M8SA 4CHKA 2WX1A 1WMHB 4NAWA 2N1VA 2XEWA 5EDSA 5G2NA 4BBNC 4I6NB 2CHXA 4HCNB 3ZDMC 3DVNV 2V1YA 3NZUA 4EOYA 4FJYA 4NJ6A 1Q0WB 4B9KA 3RZFA 4KDLB 1EUVB 4GU2A 1OGWA 3PRZA 3B1LX 4GGQA 4GXBA 2C60A 3APDA 4RM9A 3D32A 3TJPA 4WJPA 3CSFA 1WY8A 5DCNA 1WXVA 5E6PA 3VDZA 1Q5WB 1WJNA 1P9DU 2G45B 3VQIA 4IW0A 1HE8A 4DDGD 3KUDB 1QZEA 1R4NI 1D3ZA 1KJTA 2Z59B 3ZVVA 1V86A 3AU5A 3RD2A 3DBRI 1GG3A 4ZYNA 3PLVA 2R2QA 4URKA 4HWIB 2KQSA 3V62A 3L54A 2K39A 1P0RA 3WAPA 4FHJA 4KVGB 3QCAA 3QC8B 1P3QU 3HHMA 2KN5A 3UGBB 3ZNID 3AULA 1M94A 2HJ8A 1YX5B 1K8RB 1C1YB 4E74A 2HE7A 1WR1A 2JY6A 4GN1A 2LVQA 3NOBA 3RUIB 2KC1A 2W9NA 1UGMA 4ANWA 4LDTD 2FCMA 3H1UA 4EZLA 4MSQB 3KYDD 4ZRIA 4J6IA 3VH4B 4IM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DPT A;  2N7E A;  2KTR A;  2MBQ A;  1U4A A;  2BYE A;  2C5L C;  2LI5 A;  5CHW A;  2KJH B;  1NI2 A;  1WX7 A;  2BWF A;  4NY0 A;  2K6D B;  3PHX B;  4MEM A;  4DWF A;  4DHZ E;  1WFY A;  1WR6 E;  5IA7 A;  4KIK A;  4HDO A;  4XC2 A;  5DPS A;  1E5W A;  1WI0 A;  2DZK A;  3V6E B;  2O2V B;  2KWU B;  2AL6 A;  4ICU A;  5KHO A;  5JHA A;  2HTH A;  2KO3 A;  5CTR C;  1UZX B;  2KTR B;  2LXC A;  2LRW A;  4GDL A;  4GSW A;  4F7Z A;  3Q3F A;  2L0F A;  2KXJ A;  4IWO A;  3AU4 A;  5D6J B;  1S3S G;  3QJZ A;  4M8N A;  3WAL A;  3SD5 A;  1RLF A;  2XK5 A;  1V81 A;  3LDZ E;  2ZCB A;  1A5R A;  1GUA B;  1H4R A;  4EZJ A;  3HK0 A;  3TBL D;  3HM3 A;  2BKR B;  3N32 A;  3ML8 A;  1WH3 A;  2KFK A;  4FJZ A;  3PLU A;  2JZ3 B;  2Z0E B;  3A9J B;  4IC7 B;  4ICV A;  4YL8 A;  2K1F A;  2NPT B;  2XK5 B;  4BKT A;  4EEW A;  3UQB A;  3QIJ A;  2FUH B;  4GDK B;  4K1R B;  1V5O A;  4MGK E;  2WX0 A;  3UQA A;  3OJ3 A;  2L8J A;  2YLM A;  2EMS A;  2NS5 A;  1V2Y A;  4W9F A;  2MRP A;  1WGH A;  2J0M A;  2J0K A;  2MBB B;  2LGD A;  3ZKJ C;  4K81 A;  2ZJD A;  3APF A;  3PV1 A;  4JLC A;  1VD2 A;  4GOC A;  4FAD A;  2IO2 B;  2OOB B;  2MX2 A;  3H6N A;  3IVF A;  4NQK E;  3ZO5 B;  2CS4 A;  3PS6 A;  3VH3 B;  3OJ4 B;  5LLI A;  2Z0D B;  2LAS A;  2GBR A;  1P1A A;  1LQB A;  5JHB A;  1VCB A;  5D94 A;  2XBB C;  3A33 B;  3LJ3 A;  4GDK A;  2MBH A;  1L7Y A;  2BKF A;  3U7D A;  3ZUN A;  5AEK B;  5L95 C;  5CHV C;  4NQL B;  4NPN A;  3APC A;  2LUE A;  3IBE A;  3DPD A;  1IP9 A;  2MA9 B;  1RFA A;  2O2V A;  3KYC D;  2NR2 A;  2KTF A;  5AZG A;  3P2B A;  2A5U A;  4E3C A;  2O6V D;  3QAQ A;  2FID A;  2JUO A;  2IO0 B;  4GDL B;  1E8W A;  1SIF A;  2KMC A;  4NNJ B;  2BGF A;  2GOW A;  5JH5 C;  4GIV A;  4JQW C;  4MDK E;  2IZV B;  2N9P C;  1WYW B;  2IY1 B;  2NBU A;  3MTN B;  2N1W A;  1E7U A;  4NJ7 A;  1WE7 A;  4BOZ B;  1V49 A;  2LXA A;  4DBG A;  3R3M A;  1LFD A;  2KLG A;  1UD7 A;  2FNJ B;  3DBH I;  3PZD A;  3PHW B;  1NDD A;  3TCA A;  3L16 A;  4FHK A;  4FA6 A;  5LXI B;  1ZKH A;  1WMH A;  3ZIM A;  2DX5 B;  2L76 A;  2CHW A;  2MSE D;  3PRP B;  3JVZ X;  4ZDV A;  1E8Z A;  2L05 A;  4WJN A;  1E7V A;  1WXA A;  2DAF A;  2FAZ A;  2BF8 B;  2KFK B;  2AWT A;  1I42 A;  2CKH B;  3M95 A;  3AI5 A;  4MSM B;  4EKU A;  2UWQ A;  5AZH A;  3SU8 X;  2OJR A;  3JYU A;  2CU1 A;  3B0A A;  1YIW A;  4HPL B;  4HPM B;  1V9J A;  3QAR A;  2KDB A;  2L0T A;  2MW5 A;  3HIZ A;  3N30 A;  2FIF A;  1V6E A;  2RPQ A;  5FR6 A;  4WJO A;  1G6J A;  4TQ0 A;  4W9C A;  4W9E A;  4M8M A;  2MBE A;  4AJY B;  3A9J A;  5BO4 B;  2IO1 B;  2FCQ A;  4HXD A;  1YQB A;  3DCG A;  4MGI E;  2N4F A;  3GZN I;  1EO6 A;  5D7G A;  2D3G A;  4DHJ B;  2KJ6 A;  2MCN B;  1WX8 A;  3PPA A;  3DVG Y;  3UIP B;  4G3X B;  1KLV A;  2BPS A;  4K7U A;  2C7M B;  4GB9 A;  4WWN A;  1WM3 A;  3ZNG C;  4JGH B;  2KZR A;  4HJK A;  2IBI B;  1OTR B;  1GC7 A;  1RRB A;  4JL9 A;  4XZ4 A;  1Y8R C;  2KNB A;  3ECI A;  2DHZ A;  2KHW B;  1WJ4 A;  1XT9 B;  4IUM B;  3VAW A;  2NVU I;  3UIN B;  1WZ3 A;  2JT4 B;  3NY5 A;  4I6P A;  3QHT A;  2LRU A;  3TIX A;  4EUT A;  2JWZ A;  2KX3 A;  4TQ1 A;  4DHJ D;  1UEL A;  5D2M B;  4BKS A;  3VUX A;  3OAW A;  2ZVN A;  3NHE B;  3S2A A;  4MM3 A;  4FUL A;  3SHQ A;  1TGZ B;  3T8M A;  2K6Q A;  1WM2 A;  3NS8 A;  1J0G A;  3EEC A;  2D2Q A;  3UF8 A;  1SE9 A;  3H7S A;  4HCP B;  2JPH A;  3H9D A;  1EF5 A;  3GOE A;  2CHZ A;  4KZ0 A;  3M3J A;  4MGY E;  3ZNH B;  2MLB A;  4KIK B;  2GMI C;  3DOW A;  4A3P A;  2YVC A;  4W9G A;  1WGR A;  3QA8 A;  4AWJ A;  1CMX B;  4CYE A;  1F9J A;  2KLC A;  1TTN A;  3L0W B;  4MEL A;  2PE9 A;  1UBQ A;  4PS7 A;  4AUQ C;  3JSV B;  2GBJ A;  5JZE B;  4G50 A;  1E8X A;  3H7P A;  4LCD E;  2RSU A;  2GBN A;  1Z5S B;  4DXA B;  4HDQ A;  2KC2 A;  3WAO A;  2LGX A;  3DQV A;  3QK0 A;  2ZPN A;  3R7Q A;  3V60 A;  3WIM A;  2D07 B;  2CR5 A;  3A1Q A;  2UYZ B;  2EKE C;  2IO3 B;  2RGF A;  4KSL C;  1WJ6 A;  2JF5 A;  4GMV A;  3EFU A;  4MJS A;  1Q1O A;  2KDF B;  4DDI D;  3HM6 X;  4LJP B;  2NBV B;  2LVO A;  4PYU A;  4EFO A;  1ZGU B;  3KUZ A;  2WYQ A;  4BOS C;  1T0Y A;  3RT3 B;  4G0N B;  5J18 A;  4ZRJ A;  3IG3 A;  2M0X A;  3PSE B;  2O6V A;  2LJ5 A;  1ISN A;  1OEY A;  2KD0 A;  3I3T B;  2MP2 A;  4W9L A;  4K7S A;  1IPG A;  2LVP A;  4FN2 A;  2DYO A;  4B95 A;  4HLE A;  2NCN A;  2ZNV C;  4B6W A;  2JRI B;  3ZTC A;  3QQ8 B;  3ML9 A;  4II2 B;  4WAA A;  1JRU A;  4KV2 A;  3V6C B;  4HK2 A;  4IWQ A;  4IG7 B;  1WXS A;  4BFR A;  1WZ0 A;  3IHP C;  4NAW B;  3VXW A;  5L83 A;  4MH0 E;  3NZS A;  3BY4 B;  2MWS B;  1WGD A;  4WWO A;  4LDT B;  3ENE A;  3PRM B;  5G55 A;  3BIN A;  2KVR A;  3V61 A;  2BYF A;  2ZZP B;  2DZI A;  3MHS D;  2NPT A;  3W1S C;  3CMM B;  2JXX A;  3K9P B;  2D10 A;  4CO7 A;  3AXC A;  5LXH A;  3A9K B;  2QHO A;  3PGE A;  2M4N A;  3VUW A;  1KOT A;  4BVU C;  4IM2 A;  2MP2 B;  2C9W B;  3WA0 A;  4ZRK A;  3ZNZ B;  4FBJ B;  2LD9 A;  2WDT B;  1XD3 B;  2J0J A;  2LGY A;  4RMA A;  3B08 A;  3VTU A;  3C0R B;  3DVN U;  1WJU A;  3ZLZ A;  2ZVO A;  4TKN A;  3ZW3 A;  5CX3 A;  2I1K A;  1MG8 A;  2KDI A;  1J19 A;  3A1Q B;  3DBS A;  2B3A A;  4AJW A;  1OEY J;  4HVB A;  2FCS A;  3RYT A;  3X23 A;  1GJZ A;  3MJW A;  2LWP A;  4IWP A;  2G4D B;  2KX0 A;  2WWZ A;  4F8C B;  1AAR A;  4KZC A;  1V5T A;  1P98 A;  4N9F 4;  1TBE A;  2AL3 A;  3O65 B;  2JVC A;  2MQJ A;  2O6V B;  1E90 A;  1LM8 B;  2ZEQ A;  3R7R A;  4OVU A;  3QWZ B;  2IY0 B;  2M1M A;  3N3K B;  1X1M A;  2GBM A;  3A4R A;  1KM7 A;  3ZTD A;  1LXD A;  1BT0 A;  2PE6 B;  4BBN F;  3U8Z A;  1Z2M A;  3UIO B;  1IYF A;  2ZNV B;  1XQQ A;  3WAN A;  3QX1 A;  1WGY A;  2AEH A;  3EHV A;  5GMV A;  2IYD B;  1GC6 A;  2FCN A;  4WQO B;  4F1S A;  2Y5B B;  5E6N A;  4LJO B;  4BKS D;  3CST A;  2K8H A;  2V4L A;  1NBF C;  2L3Z A;  3L10 B;  4IM3 A;  4MJS B;  3TL5 A;  1OQY A;  2BWE S;  3W1S A;  1RAX A;  3A9K A;  2LZ6 A;  3ZRF A;  2PEA A;  1EF1 A;  2KQ7 A;  4M0W B;  3PT2 B;  4XX5 A;  2GBK A;  2JZZ A;  3VVW B;  4W9J A;  3PRE A;  4II3 B;  3CF6 E;  2DZM A;  2KOX A;  1WE6 A;  3KVF B;  1YJ1 A;  4OVV A;  4FJV B;  2N7D A;  4TV3 A;  1E8Y A;  3RCZ A;  2N9E B;  4K7W A;  3RUL A;  4BKG A;  3M63 B;  2REX A;  3SDL C;  5KHQ A;  4MGZ E;  1GNU A;  2N9X A;  4EZK A;  3KH0 A;  4W9H A;  5IAA C;  1ZW7 A;  2VRR B;  1R4M I;  2K25 A;  1YD8 U;  2G3Q B;  5AZF A;  1YX6 B;  3VUY A;  4AP4 C;  3U30 A;  3ZRC A;  2KMA A;  5HKH A;  4FLH A;  5C23 A;  4PS8 A;  5CHF A;  1WRD B;  4KDI C;  4AOF A;  4DHZ B;  3VTV A;  3T9L A;  4KSK C;  1V80 A;  3PVL A;  3L08 A;  1UBI A;  3TMP B;  4E71 A;  1S1Q B;  2ASQ A;  3DDC B;  2RD0 A;  2K8B A;  3H7P B;  3L17 A;  2L7R A;  2DEN B;  2DYM A;  2DZJ A;  2KK8 A;  2PJH A;  3KUC B;  3RZW C;  1UH6 A;  2KKC A;  2KWC A;  4I6L B;  2C7N B;  5C1Z A;  3EC8 A;  4WJQ A;  2R2O A;  4G11 A;  2DAJ A;  3VHT C;  2KDE B;  4WWP A;  3IFW B;  3DVG X;  4W9K A;  4ANV A;  2MBO A;  3DBL I;  1FXT B;  2NBW B;  2M17 A;  2KFJ A;  1SGH A;  5DPW A;  4TUU A;  3R66 C;  4W9D A;  2ZCC A;  2D11 A;  2J7Q B;  3OLM D;  1TZ1 A;  2G4S A;  3PTF C;  5E6O A;  2JRH A;  4PS3 A;  3M62 B;  4W9I A;  4RM8 A;  4A3O A;  2K8C A;  3ONS A;  4ASW C;  3L13 A;  4A20 A;  4DK5 A;  1PQS A;  2AYO B;  4P7I A;  4X57 B;  3VFK A;  3ALB A;  1WIA A;  5J17 A;  3KW5 B;  4PYZ A;  1WGG A;  2PPH A;  2RR9 A;  2C7H A;  3X0W A;  3A4S C;  2L00 B;  2KWV B;  1WX9 A;  1WXM A;  2KJR A;  2V3S A;  3K9O B;  5J2R A;  1C3T A;  1J8C A;  4JIO U;  3Q3J A;  3JW0 X;  2EMT A;  5TR5 A;  2ZPY A;  2I1J A;  1L2N A;  3ZDT A;  2A4Z A;  2HD5 B;  3W1Y A;  3WAM A;  3VTW A;  4ANX A;  1H8C A;  2KAN A;  5DPR A;  4ANU A;  2DYB A;  1WF9 A;  2BYV E;  3JSV A;  1I35 A;  2M8S A;  4CHK A;  2WX1 A;  1WMH B;  4NAW A;  2N1V A;  2XEW A;  5EDS A;  5G2N A;  4BBN C;  4I6N B;  2CHX A;  4HCN B;  3ZDM C;  3DVN V;  2V1Y A;  3NZU A;  4EOY A;  4FJY A;  4NJ6 A;  1Q0W B;  4B9K A;  3RZF A;  4KDL B;  1EUV B;  4GU2 A;  1OGW A;  3PRZ A;  3B1L X;  4GGQ A;  4GXB A;  2C60 A;  3APD A;  4RM9 A;  3D32 A;  3TJP A;  4WJP A;  3CSF A;  1WY8 A;  5DCN A;  1WXV A;  5E6P A;  3VDZ A;  1Q5W B;  1WJN A;  1P9D U;  2G45 B;  3VQI A;  4IW0 A;  1HE8 A;  4DDG D;  3KUD B;  1QZE A;  1R4N I;  1D3Z A;  1KJT A;  2Z59 B;  3ZVV A;  1V86 A;  3AU5 A;  3RD2 A;  3DBR I;  1GG3 A;  4ZYN A;  3PLV A;  2R2Q A;  4URK A;  4HWI B;  2KQS A;  3V62 A;  3L54 A;  2K39 A;  1P0R A;  3WAP A;  4FHJ A;  4KVG B;  3QCA A;  3QC8 B;  1P3Q U;  3HHM A;  2KN5 A;  3UGB B;  3ZNI D;  3AUL A;  1M94 A;  2HJ8 A;  1YX5 B;  1K8R B;  1C1Y B;  4E74 A;  2HE7 A;  1WR1 A;  2JY6 A;  4GN1 A;  2LVQ A;  3NOB A;  3RUI B;  2KC1 A;  2W9N A;  1UGM A;  4ANW A;  4LDT D;  2FCM A;  3H1U A;  4EZL A;  4MSQ B;  3KYD D;  4ZRI A;  4J6I A;  3VH4 B;  4IM0 A; 
#chains in the Genus database with same CATH topology
 2KTR A;  2LI5 A;  1WX7 A;  5FR3 A;  2WXI A;  3Q8B A;  1WI0 A;  2V3P A;  1UWM A;  3NZ3 A;  4ICU A;  1DOI A;  4WH4 A;  3Q3F A;  1KLU D;  2KXJ A;  4IWO A;  3QJZ A;  2XK5 A;  1V81 A;  2B76 B;  4G0N B;  1ZE3 D;  3PLU A;  4YL8 A;  1XLQ A;  3QIJ A;  2FUH B;  1JW9 D;  4K1R B;  1V5O A;  4HEA 1;  4MGK E;  2EMS A;  1V2Y A;  2MRP A;  3N9Y C;  4OW0 A;  2LGD A;  3ZKJ C;  1QKZ A;  1VD2 A;  3TEW A;  3NS1 A;  2IO2 B;  2OOB B;  4NQK E;  2RDH A;  1HXY D;  3OJ4 B;  1LQB A;  5JHB A;  4JWS C;  2INN E;  4GDK A;  4DXG A;  1L7Y A;  2BKF A;  5L95 C;  4USA A;  3GS2 A;  4NPN A;  3APC A;  3VRA B;  1IP9 A;  2MA9 B;  2QC8 A;  3P2B A;  2A5U A;  4RF0 A;  3QAQ A;  4GDL B;  1SIF A;  4GIV A;  4JQW C;  4MDK E;  2IZV B;  4NJ7 A;  2TSS A;  2LHD A;  3AEA B;  4NJC A;  3R3M A;  4RH6 A;  2W82 A;  2KLG A;  2KQ4 X;  2FNJ B;  4WQM A;  1RYJ A;  2BTE A;  3HVZ A;  4FHK A;  2OHF A;  1XF5 L;  1R4M B;  2DX5 B;  1YJJ A;  2CHW A;  1KFY B;  1TS3 A;  4WJN A;  1STE A;  1DOY A;  1I42 A;  1TZO A;  3M95 A;  3NVW A;  3AI5 A;  1YIW A;  1TY0 A;  4MT5 A;  1VZ8 A;  2KDB A;  2L0T A;  2MJE A;  4ZYS A;  3HIZ A;  3N30 A;  2FIF A;  4W9C A;  4RGO S;  2VH1 A;  2MBE A;  4AJY B;  3A9J A;  2IO1 B;  5TSS A;  5D7G A;  2JXT A;  3Q6B A;  2M19 A;  3DVG Y;  3EGR A;  3UIP B;  1MFW A;  1JML A;  2BPS A;  5AUK A;  2WXL A;  3ZNG C;  2G9H D;  1I4R A;  5AUI A;  4DQO C;  1YQ3 B;  5C3J B;  1OTR B;  1RRB A;  3AE9 B;  3Q2A C;  2BBC A;  2KHW B;  1WJ4 A;  1XT9 B;  4IUM B;  3VAW A;  2NVU I;  1C4P A;  4I6P A;  3MC0 B;  1V1P B;  4DHJ D;  3VUX A;  3OAW A;  2ZVN A;  3S2A A;  1C4A A;  3EEC A;  3RMK C;  4KZ0 A;  4MGY E;  4KIK B;  1OQR A;  2GMI C;  2YVC A;  3QA8 A;  1C9F A;  1F9J A;  3B2G A;  2KLC A;  4MEL A;  3MHZ A;  4AUQ C;  2GBJ A;  3DBR B;  1TKE A;  3H7P A;  2N9K A;  2LMC A;  1C78 A;  1Z5S B;  3MFG A;  2KAC A;  3WIM A;  2CR5 A;  3A1Q A;  1ACC A;  2RGF A;  1C77 A;  2IO3 B;  3ABV B;  3EFU A;  1Q1O A;  2J53 A;  2KDF B;  3HM6 X;  2NBV B;  2WDV B;  1T0Y A;  5J18 A;  3IG3 A;  1F77 A;  4OVZ A;  1ZPS A;  5FK9 C;  1N61 A;  2LVP A;  5G5G A;  4B95 A;  1YN3 A;  2JRI B;  2UU7 A;  1JRU A;  4YT0 B;  4BFR A;  5L83 A;  3IAM 1;  2PKO A;  5BMI A;  1A70 A;  4WWO A;  4LDT B;  2D3B A;  5G55 A;  4B0E A;  2KVR A;  3V61 A;  2BYF A;  3AEC B;  2DZI A;  1D5X C;  2BT6 A;  2OED A;  3W1S C;  4CO7 A;  3RNA C;  3SEB A;  3PGE A;  1KOT A;  3AE2 B;  2MP2 B;  3GP7 A;  2QIL A;  1ET6 A;  3ZNZ B;  3Q69 A;  3AV8 A;  2WDT B;  1TIF A;  2ZVO A;  4TKN A;  3ZW3 A;  1IUE A;  5IOI A;  3A1Q B;  4YSY B;  1D4B A;  2FCS A;  3KWV A;  3DHI C;  1SE3 A;  4IWP A;  2G4D B;  2KX0 A;  2WWZ A;  4KZC A;  1P98 A;  2EEL A;  2K5P A;  2O6V B;  4OVU A;  3QWZ B;  2IY0 B;  2L1A A;  2M1M A;  3BYT B;  2GBM A;  1KM7 A;  4C80 A;  1BT0 A;  1Z2M A;  3UIO B;  1AN8 A;  4M02 A;  1IYF A;  1SF0 A;  3WAN A;  1CK1 A;  1WGY A;  4LNN A;  2IYD B;  2FCN A;  2Y5P A;  5D3I B;  1UWX A;  4IM3 A;  3L10 B;  4M00 A;  4WUR A;  4ARI A;  3V3X A;  2KQ7 A;  1GOZ A;  1XLP A;  1SIJ A;  4FJV B;  1E8Y A;  3RCZ A;  3SDL C;  2REX A;  1NYR A;  4EZK A;  4MM3 B;  2WU2 B;  1QT9 A;  2PVO D;  3Q8C A;  5IAA C;  1ZW7 A;  4N6E B;  5AZF A;  2IGG A;  3U30 A;  2KMA A;  1T5X D;  3KWL A;  5CHF A;  2M0A A;  2J4X A;  1RFK A;  4KDI C;  4DHZ B;  1V80 A;  3TMP B;  3PZ8 A;  1SJE D;  2HJ1 A;  2DEN B;  1IBX B;  2PJH A;  3RZW C;  5C1Z A;  2CJN A;  1M4V A;  1PGA A;  2R2O A;  2BS4 B;  2DAJ A;  4LNI A;  1SBB B;  2LHE A;  3VHT C;  4A55 A;  3IFW B;  2MBO A;  1FXT B;  2NBW B;  2KFJ A;  4W9D A;  2JRH A;  4RM8 A;  2K8C A;  4X57 B;  1CZP A;  2VH2 A;  3N1X C;  3ALB A;  3EUB 2;  5J17 A;  2M56 B;  2C7H A;  3A4S C;  1C3T A;  1WXM A;  1TS4 A;  1J8C A;  2LFI A;  2W55 A;  3Q3J A;  2ZPY A;  1L2N A;  3W1Y A;  2WLB A;  2MHJ A;  1I7H A;  1H8C A;  1Q10 A;  1I35 A;  2XEW A;  4I6N B;  4HCN B;  2V1Y A;  3DHG C;  5FKA C;  2AQ2 B;  2D3A A;  1P7F A;  3TJP A;  2QCZ A;  3D32 A;  1K52 A;  5DCN A;  5E6P A;  4RGM A;  2FBW B;  1WRI A;  4XWW A;  4IW0 A;  4DDG D;  1D3Z A;  3AU5 A;  3RD2 A;  1GG3 A;  2KYW A;  2R2Q A;  4HWI B;  3FIL A;  1P0R A;  4RNA A;  1GPX A;  5BMG A;  3AE4 B;  1JQ4 A;  2KN5 A;  5IO9 A;  1M94 A;  1YX5 B;  1C1Y B;  4E74 A;  2HE7 A;  1JCK B;  2CU3 A;  4RGN A;  2JY6 A;  2LVQ A;  1TJE A;  1HQR D;  2FCM A;  3H1U A;  3ZJT A;  1XXG A;  3PO0 A;  2JQR B;  2XN9 C;  4KGS A;  3VH4 B;  3O13 A;  2BYE A;  2C5L C;  4DWF A;  4DHZ E;  1WFY A;  1WR6 E;  1RM6 C;  4XC2 A;  5DPS A;  5IN7 A;  2DZK A;  4DXF A;  2KWU B;  3T3N A;  5KHO A;  2HTH A;  5CTR C;  2KTR B;  2LXC A;  4GDL A;  4GSW A;  2AQ1 B;  5D6J B;  4M8N A;  3SD5 A;  1RLF A;  1FIQ A;  1L0X B;  5D3D A;  4LNF A;  1A5R A;  1GUA B;  4EZJ A;  3TBL D;  4FJZ A;  1MHX A;  4ICV A;  3E56 A;  2JZ3 B;  2K1F A;  2NPT B;  3IAS 1;  4XWT A;  1YN4 A;  3UQA A;  1LGR A;  3IT4 B;  3OJ3 A;  2YLM A;  1VRA B;  2BQQ A;  1EM7 A;  2W3R A;  3DHH C;  4XDC A;  2WXJ A;  2ZJD A;  4JLC A;  3RI7 C;  3EFC A;  4GOC A;  4JWU C;  1N63 A;  2WXH A;  3IVF A;  3ZO5 B;  1BUI C;  3VH3 B;  2H89 B;  4XDD A;  2IPK D;  1VCB A;  1HZ5 A;  2MBH A;  3U7D A;  1D5Z C;  1JWS D;  2DNF A;  2LUE A;  2O2V A;  4ZHO A;  4E3C A;  5C2T B;  2FID A;  2JYE A;  2MJD A;  1E8W A;  2KMC A;  2BGF A;  4P1B C;  4WIP A;  1WYW B;  2N1W A;  1E7U A;  4BOZ B;  1ZDV A;  1SE2 A;  3RNB C;  1KRH A;  4DBG A;  1LFD A;  2QDF A;  1F0Z A;  1ZXI A;  5EE0 A;  1ZKH A;  1RWS A;  3PRP B;  3JVZ X;  1E8Z A;  3I9V 1;  1FO4 A;  4M0W A;  1E7V A;  1AW7 A;  2BF8 B;  3DBH B;  2KVZ A;  1UNS A;  2BYT A;  1SSN A;  1SEB D;  3GE3 C;  2OJR A;  2WXF A;  3SU8 X;  4D2K A;  2KDM A;  1J7C A;  4YWG G;  1V9J A;  3RFZ B;  4QAY A;  3VRB B;  1L4Z B;  2X8X X;  3C19 A;  4M8M A;  1DYQ A;  1QOB A;  4MGI E;  4RFB A;  1FXA A;  2D3G A;  4DHJ B;  5GXG B;  4YSZ B;  3ZJV A;  2LEK A;  1WM3 A;  4JGH B;  4HJK A;  2IBI B;  4XZ4 A;  2DHZ A;  1DOX A;  4IOI E;  3TIX A;  2LRU A;  2WDR B;  2JWZ A;  3GZN B;  3I63 C;  4S17 A;  2IGH A;  1UEL A;  4TQ1 A;  5D2M B;  4BKS A;  1MG4 A;  2R61 A;  4MM3 A;  3T8M A;  3BVM A;  1TGZ B;  3UF8 A;  2AQ3 B;  2LGS A;  3H7S A;  2JPH A;  1EF5 A;  2ZW0 A;  2MLB A;  4A3P A;  3DOW A;  4W9G A;  3IXS A;  1PDX A;  4AQ7 A;  1FFU A;  3JSV B;  2QEJ C;  4G50 A;  3U52 E;  1AWD A;  3P4R B;  4HDQ A;  1V1P A;  3WAO A;  1GB1 A;  3V60 A;  1C76 A;  2RPV A;  4KSL C;  1L6V A;  1JWU D;  4MJS A;  3NVY A;  4PYU A;  4EFO A;  4ZRJ A;  2O6V A;  3FIL B;  1ISN A;  2KD0 A;  3W5V B;  4W9L A;  4K7S A;  1IPG A;  2CJO A;  4HLE A;  1F2R C;  2NCN A;  2ZNV C;  2KAJ A;  2VZK D;  3ML9 A;  3B9J A;  4II2 B;  4WAA A;  3Q8A A;  1WYG A;  1WZ0 A;  3VXW A;  3BY4 B;  1I4P A;  3PRM B;  3BIN A;  3MHS D;  2NPT A;  2I38 A;  2D10 A;  4HRO A;  3VUW A;  3AH7 A;  4IM2 A;  2C9W B;  1C4C A;  3IT6 B;  4ZRP A;  1N5W A;  2N9L A;  3BK2 A;  2ON8 A;  3VTU A;  3DVN U;  1WJU A;  3LYY A;  5CX3 A;  2I1K A;  4WAF A;  2MH7 A;  1ESF A;  5H92 C;  4HVB A;  4BZA A;  1JWM D;  3X23 A;  4HRS A;  4C56 C;  1GJZ A;  1OFF A;  5HFY A;  3MJW A;  1UF0 A;  3AEB B;  4F8C B;  1V5T A;  2I2Y A;  1PFD A;  4N9F 4;  4K3B A;  3NJT A;  2MQJ A;  3Q3N C;  5BYQ A;  1ENF A;  1F2R I;  3HUI A;  1LXD A;  3RNE C;  3ZGZ A;  4J3O D;  2ZNV B;  3AED B;  3QX1 A;  5GMV A;  1GC6 A;  4LNO A;  2Y5B B;  2INP E;  4LJO B;  2L3Z A;  1OQY A;  2BWE S;  3ZRF A;  4ITK A;  4L2Y A;  1EF1 A;  2WP9 B;  4YTN B;  2GBK A;  2PLP A;  4II3 B;  3C8Y A;  2DZM A;  2NTS A;  3CWI A;  4TV3 A;  4REZ A;  3BYY B;  4K7W A;  4BKG A;  5KHQ A;  2V9H A;  1GNU A;  1NVI D;  3KH0 A;  5I4D A;  2K25 A;  3AE3 B;  4AP4 C;  1EU3 A;  1XCT L;  2DWQ A;  3ZRC A;  1QIL A;  4FLH A;  1QLB B;  3B2F A;  4AOF A;  2PW9 A;  3L08 A;  2PVG C;  4US8 A;  3RNF C;  1ZXH A;  2RD0 A;  3KUC B;  1UH6 A;  2KWC A;  2C7N B;  4WJQ A;  3H8H A;  4OZC A;  2KDE B;  1TY2 A;  4RF1 A;  4HJG E;  3DVG X;  4W9K A;  3DBL I;  1SGH A;  4TUU A;  3R66 C;  2ZCC A;  1N5X A;  1SE4 A;  3OLM D;  2J42 A;  4PS3 A;  3ONS A;  1JRO A;  5LNK 1;  3I57 A;  4P7I A;  1WIA A;  4LLG M;  3KW5 B;  4RCO A;  2RR9 A;  3X0W A;  2IJ0 A;  2KWV B;  2KJR A;  2V3S A;  3MJ5 A;  1QOG A;  4JE3 B;  3R2T A;  5TR5 A;  2YEP F;  3ZDT A;  2HD5 B;  1FNV A;  2WHI A;  4YTP B;  1K50 A;  4ANX A;  2KAN A;  2IGD A;  2DYB A;  1WF9 A;  2M8S A;  2WX1 A;  4NAW A;  2N1V A;  4BBN C;  2QJL A;  3DVN V;  4B9K A;  1Q0W B;  4KDL B;  2BB6 A;  1OGW A;  3B1L X;  1MHH E;  2LUM A;  2KT7 A;  4GXB A;  2SEB D;  1Q5W B;  1WJN A;  2G45 B;  3VQI A;  1J7B A;  2L32 A;  2FE8 A;  3NUH B;  1SB3 C;  3MC9 A;  1NEK B;  4ZYN A;  4URK A;  3BVZ A;  3V62 A;  3WAP A;  1L4D B;  3UGB B;  2Y5C A;  5IP4 D;  3AN1 A;  3WCQ A;  3RUI B;  1UGM A;  4ANW A;  1QOA A;  1I4H A;  1XLO A;  3KYD D;  4J6I A;  3P42 A;  4MAC A;  3U4E G;  2MBQ A;  1L0V B;  5CHW A;  2BWF A;  2K6D B;  4MEM A;  5EE9 A;  3URY A;  1E7P B;  3NVZ A;  4KIK A;  3W9C B;  5IA7 A;  4HDO A;  1N60 A;  1E5W A;  3AE7 B;  2O2V B;  2L83 A;  3VR9 B;  1Y56 A;  1S3S G;  2ZCB A;  2V4I B;  3HM3 A;  3N32 A;  3TEZ A;  3ML8 A;  2XK5 B;  3UQB A;  1YJI A;  2WXR A;  1GAQ B;  2WX0 A;  4LTU A;  1KLG D;  2NS5 A;  3KLS X;  4N59 A;  1WGH A;  3GE8 C;  4FAD A;  5BMH A;  2MX2 A;  3H6N A;  3SFD B;  2WU5 B;  2CS4 A;  3PS6 A;  5LLI A;  2Z0D B;  3BZD B;  5D94 A;  2XBB C;  3DBL B;  3LJ3 A;  1TT5 B;  5HG2 A;  5AEK B;  2Z8L A;  3IBE A;  5AZG A;  2ACZ B;  2JUO A;  4NNJ B;  5JH5 C;  3TSS A;  3J9C A;  2N9P C;  2DBY A;  2NBU A;  3MTN B;  3KQ4 A;  4BAX A;  1V49 A;  2LXA A;  2OJW A;  4HKQ A;  1UD7 A;  3TUO A;  4C4V B;  4A8X C;  5HHD G;  3PHW B;  1YN5 A;  3TCA A;  3L16 A;  1WMH A;  4ARC A;  3ZIM A;  2MSE D;  3BK1 A;  1TYG B;  4ZDV A;  3TEX A;  1HEZ E;  2KFK B;  1YMH E;  3U7Z A;  4MSM B;  4EKU A;  1WGK A;  2UWQ A;  3EA6 A;  2INC C;  3JYU A;  3AMZ A;  3B0A A;  2BS2 B;  4HPL B;  3AE8 B;  4HPM B;  1MPE A;  2MW5 A;  2WXP A;  1V6E A;  2NMQ A;  2RPQ A;  1G6J A;  4W9E A;  1FMA D;  3RNC C;  3W2D A;  2GRI A;  3DCG A;  1MVK A;  2N4F A;  2FUG 1;  1EO6 A;  3GZN I;  1V1O A;  1TS2 A;  1WX8 A;  4KKI A;  3PPA A;  4G3X B;  1KLV A;  2IND C;  4GB9 A;  4WWN A;  5HI1 A;  2BVC A;  2KNB A;  1YNT E;  1P7E A;  3NY5 A;  2JT4 B;  1R7S A;  4EUT A;  3QHT A;  4IKG A;  4KGR A;  4FUL A;  1J0G A;  1WM2 A;  4JX1 C;  1QQR A;  1SE9 A;  4HCP B;  3H9D A;  3M3J A;  4XGA B;  2ONQ A;  3NG0 A;  4AWJ A;  2KN4 A;  2AX5 A;  2G1E A;  1IGD A;  4TMA B;  2PE9 A;  1UBQ A;  4PS7 A;  1VJK A;  5JZE B;  1E8X A;  2RSU A;  4DXA B;  2LGX A;  1WXQ A;  3DQV A;  1QF6 A;  2ZPN A;  2BW2 A;  3RNG C;  3R7Q A;  3N1Z C;  2GI9 A;  1HTQ A;  1K53 A;  2UYZ B;  3Q14 C;  2EKE C;  4GMV A;  3LB8 C;  2J52 A;  2K0P A;  4RGT A;  2LVO A;  1KF6 B;  2WYQ A;  4BOS C;  2M0X A;  2LJ5 A;  1OEY A;  2MP2 A;  4OHJ A;  2DYO A;  1FCC C;  3ZTC A;  1PYW D;  4KV2 A;  3MP9 A;  3V6C B;  4IG7 B;  1WXS A;  1BXT A;  1F1H A;  4MH0 E;  2MWS B;  2XNA C;  1WGD A;  3ENE A;  4ZHP A;  3P4S B;  4NZL B;  4O1N A;  3AXC A;  2QHO A;  2V3N A;  2VZK B;  2M4N A;  3WA0 A;  4M01 A;  4ZRK A;  2WXO A;  4FBJ B;  2K3U A;  3ZJU A;  1VZ7 A;  1XD3 B;  2J0J A;  4FXC A;  4RMA A;  3B08 A;  3C0R B;  3ZLZ A;  1N6Z A;  2KDI A;  1J19 A;  5BYS A;  2PTL A;  3DBS A;  2X38 A;  2B3A A;  2JSV X;  2WXN A;  4KX6 B;  1GB4 A;  1IBX A;  1AAR A;  1FRR A;  3DWM A;  4P6V F;  1LM8 B;  3N3K B;  1X1M A;  2JWU A;  3A4R A;  3ZTD A;  2PE6 B;  3HRD D;  3SR6 A;  4P16 A;  1MI0 A;  2AEH A;  4GLS C;  4F1S A;  4MJS B;  2K8H A;  3TL5 A;  1NBF C;  2W3S A;  2RMM A;  3ZXR A;  2LZ6 A;  2PEA A;  1AYF A;  4M0W B;  3VVW B;  4W9J A;  3PRE A;  3LXF A;  4AS1 A;  2KOX A;  4A6Q A;  1WE6 A;  3KVF B;  1YJ1 A;  4OVV A;  3RUL A;  3M63 B;  4WWM A;  2W54 A;  3Q8E A;  1R4N B;  5MPO A;  1R4M I;  1D5M C;  2G3Q B;  3VUY A;  5HKH A;  4KKJ A;  4PS8 A;  1SJH D;  3VTV A;  3T9L A;  1QOF A;  1S1Q B;  2JYT A;  2ASQ A;  3DDC B;  2WDQ B;  3H7P B;  2K8B A;  4LNK A;  2DZJ A;  2KK8 A;  2KKC A;  4I6L B;  4G11 A;  4ANV A;  4PK1 A;  1NYQ A;  5DPW A;  3FAH A;  1VZ6 A;  2SAK A;  3AEG B;  5E6O A;  4W9I A;  4ASW C;  1I4Q A;  2N0S B;  2WGS A;  4A20 A;  1PQS A;  3VFK A;  4PYZ A;  5EE3 A;  4LK0 M;  1FCL A;  1WX9 A;  4JIO U;  2EMT A;  1HTO A;  2KMM A;  4NAM A;  4ANU A;  3JSV A;  4S0R A;  5EDS A;  2ZW1 A;  3ZDM C;  2CHX A;  4EOY A;  3NZU A;  2EKI A;  3E9S A;  4NJ6 A;  4JPS A;  1EUV B;  5E6J A;  4A9A A;  1JWB D;  3ZQ4 A;  4YTM B;  2C60 A;  3APD A;  4RM9 A;  4WJP A;  4MH8 A;  3CSF A;  1WY8 A;  2WXK A;  1WXV A;  3VDZ A;  1P9D U;  1JWA D;  4TSS A;  3P4Q B;  1HE8 A;  3P1M A;  1V86 A;  3DBR I;  4OZB A;  2PIA A;  3BVG A;  3ZXV A;  1FNW A;  3ZYY X;  2BS3 B;  2YEP B;  2K39 A;  3L54 A;  4FHJ A;  4KVG B;  3QCA A;  1T0R C;  1P3Q U;  3AUL A;  1K8R B;  1WR1 A;  1C79 A;  3RN9 C;  1EU4 A;  3NOB A;  4MSQ B;  2NTT A;  1ZP0 B;  4IM0 A;  5DPT A;  2N7E A;  1U4A A;  3NRZ A;  1HA5 A;  1K51 A;  2KJH B;  1NI2 A;  1XLN A;  3MC8 A;  4NY0 A;  3PHX B;  2D3C A;  4L1B A;  2GB1 A;  3P4P B;  1T0Q C;  1I4X A;  3V6E B;  2AL6 A;  1TKY A;  2JU6 X;  2KO3 A;  5JHA A;  1UZX B;  2LRW A;  4F7Z A;  2L0F A;  3AU4 A;  3WAL A;  1YOV B;  1E0Z A;  3LDZ E;  1UGJ A;  1H4R A;  5EE1 A;  4EE2 A;  3HK0 A;  2BKR B;  2E3T A;  1WH3 A;  2KFK A;  4IC7 B;  2Z0E B;  3A9J B;  4EEW A;  4BKT A;  4GDK B;  4US9 A;  2L8J A;  5BYR A;  3L4P A;  4W9F A;  1EWC A;  2J0M A;  2J0K A;  2MBB B;  4K81 A;  3APF A;  3PV1 A;  1KTK A;  4C4V A;  2N7J A;  3VR8 B;  4ZOH C;  2LAS A;  2GBR A;  1P1A A;  1WWT A;  3UI3 A;  1FNU A;  3A33 B;  1VDV A;  3ZUN A;  5CHV C;  4NQL B;  3DPD A;  1RFA A;  3KYC D;  2NR2 A;  2KTF A;  3V05 A;  2O6V D;  3P63 A;  2IO0 B;  3I5J C;  1XCQ L;  2GOW A;  3N1Y C;  4Q2J A;  2WXQ A;  2IY1 B;  1WE7 A;  1FPY A;  5H8Y E;  3DBH I;  3PZD A;  1NDD A;  1EWY C;  4FA6 A;  5LXI B;  4C7Z A;  2L76 A;  2L05 A;  4N58 A;  4HKZ E;  1WXA A;  2DAF A;  2FAZ A;  3TEY A;  2AWT A;  4YSX B;  2CKH B;  1DGJ A;  5AZH A;  2CU1 A;  4YXD B;  2MEK A;  3R2I A;  2JX5 A;  3QAR A;  4KGT A;  3AE1 B;  3BWU D;  5FR6 A;  4WJO A;  1HZ6 A;  1NEN B;  4TQ0 A;  3NVV A;  5BO4 B;  2FCQ A;  4HXD A;  1YQB A;  3RPF C;  3SFE B;  2KJ6 A;  1FEH A;  2MCN B;  2QIE B;  1VLB A;  1T3Q A;  1ZDX A;  2DLB A;  3OG5 A;  4K7U A;  4R3D A;  2C7M B;  2KZR A;  1GC7 A;  4JL9 A;  1Y8R C;  3ECI A;  3UIN B;  4UDU C;  1WZ3 A;  2KX3 A;  3CIR B;  3NHE B;  3SHQ A;  2WXG A;  2K6Q A;  3NS8 A;  2D2Q A;  1B9R A;  2V0G A;  1F52 A;  3GOE A;  2CHZ A;  3ZNH B;  3R8B A;  1WGR A;  2E6X A;  1CMX B;  4CYE A;  1TTN A;  3L0W B;  4XYC A;  4LCD E;  3T3O A;  2GBN A;  3U2S C;  2KC2 A;  4C7Y A;  4P1C C;  3QK0 A;  2D07 B;  3AEE B;  1WJ6 A;  2JF5 A;  4DDI D;  4LJP B;  1KH0 A;  1ZGU B;  3KUZ A;  3RT3 B;  2QMT A;  1FXI A;  3PSE B;  3BII D;  1CQV A;  3I3T B;  1JAL A;  1E10 A;  4FN2 A;  1E9M A;  4B6W A;  3AE5 B;  3QQ8 B;  1PUT A;  4HK2 A;  4IWQ A;  4NAW B;  3IHP C;  1PGB A;  4C00 A;  3NZS A;  1V97 A;  2ZZP B;  2H88 B;  1T6B X;  3CMM B;  2JXX A;  3K9P B;  5LXH A;  3A9K B;  4BVU C;  2LD9 A;  3AM9 A;  1PGX A;  2LGY A;  3N20 C;  3Q3O C;  1MG8 A;  3AE6 B;  3ETR A;  4K3C A;  2Q5W D;  4AJW A;  1OEY J;  3RYT A;  1B1Z A;  1FRD A;  2L52 A;  2LWP A;  2HDE A;  1TBE A;  2AL3 A;  3O65 B;  4HPP A;  2JVC A;  2PMV A;  5G5H A;  1E90 A;  2ZEQ A;  5T8I A;  3R7R A;  4OZA A;  1T0S C;  5JXV A;  1ROE A;  1XO3 A;  1N62 A;  4BBN F;  3U8Z A;  2WNM A;  1BML C;  1XQQ A;  3EHV A;  4WQO B;  2GLS A;  1TS5 A;  5E6N A;  4BKS D;  2D5G A;  3CST A;  2V4L A;  4ACF A;  4L23 A;  3W1S A;  1RAX A;  3A9K A;  3HVD A;  3PT2 B;  4XX5 A;  2JZP A;  2JZZ A;  3CF6 E;  3AB5 A;  1V8C A;  2N7D A;  2N9E B;  1L0Y B;  4MGZ E;  2LJI A;  2N9X A;  2RDG A;  2HTM E;  1FFV A;  1OQQ A;  4W9H A;  1E6E B;  2VRR B;  1IGC A;  1YD8 U;  1YX6 B;  1ET9 A;  3W5U B;  1L5P A;  1JRP A;  5C23 A;  1WRD B;  4XE0 A;  1XEE A;  4H2A A;  4KSK C;  3PVL A;  1CJE A;  1UBI A;  4E71 A;  3L17 A;  2K22 A;  2L7R A;  2DYM A;  2QSD A;  1L6U A;  1D6E C;  3EC8 A;  2WXM A;  3FKY A;  4WWP A;  2M17 A;  2D11 A;  2J7Q B;  1NI3 A;  1TZ1 A;  2G4S A;  3PTF C;  3M62 B;  4A3O A;  2IDY A;  1UUP A;  3L13 A;  4A90 A;  4DK5 A;  2AYO B;  5IKC M;  2KWD A;  2LGI A;  1WGG A;  4B0M A;  2PPH A;  4PT5 A;  2L00 B;  3K9O B;  5J2R A;  2K9X A;  3JW0 X;  2WS3 B;  1LO5 D;  1YQ4 B;  4CQN A;  2I1J A;  2A4Z A;  1SXT A;  3WAM A;  3VTW A;  5DPR A;  3FC4 A;  2BYV E;  4CHK A;  1WMH B;  2RDB C;  2WQY B;  5G2N A;  4FJY A;  3GB1 A;  1TKG A;  4ZRQ A;  3AEF B;  3RZF A;  2Y3A A;  4GU2 A;  3PRZ A;  4GGQ A;  3DWG C;  1ZOY B;  3Q8F A;  4IDI A;  2MJ3 A;  3Q3M C;  3KUD B;  1QZE A;  1R4N I;  1KJT A;  2Z59 B;  3ZVV A;  1I4G A;  2BB5 A;  3PLV A;  2KQS A;  1ZUD 2;  1MJD A;  1FD6 A;  3QC8 B;  3HHM A;  3ZNI D;  2HJ8 A;  1FM0 D;  2ICI A;  3OWE B;  4GN1 A;  2KC1 A;  2W9N A;  4LDT D;  1VR9 A;  1WSP A;  4EZL A;  4ZRI A;  3PZ7 A;  1J7A A; 
#chains in the Genus database with same CATH homology
 5DPT A;  2N7E A;  2KTR A;  2MBQ A;  1U4A A;  2BYE A;  2C5L C;  2LI5 A;  5CHW A;  2KJH B;  1NI2 A;  1WX7 A;  2BWF A;  4NY0 A;  2K6D B;  3PHX B;  4MEM A;  4DWF A;  4DHZ E;  1WFY A;  1WR6 E;  5IA7 A;  4KIK A;  4HDO A;  4XC2 A;  5DPS A;  1E5W A;  1WI0 A;  2DZK A;  3V6E B;  2O2V B;  2KWU B;  2AL6 A;  4ICU A;  5KHO A;  5JHA A;  2HTH A;  2KO3 A;  5CTR C;  1UZX B;  2KTR B;  2LXC A;  2LRW A;  4GDL A;  4GSW A;  4F7Z A;  3Q3F A;  2L0F A;  2KXJ A;  4IWO A;  3AU4 A;  5D6J B;  1S3S G;  3QJZ A;  4M8N A;  3WAL A;  3SD5 A;  1RLF A;  2XK5 A;  1V81 A;  3LDZ E;  2ZCB A;  1A5R A;  1GUA B;  1H4R A;  4EZJ A;  3HK0 A;  3TBL D;  3HM3 A;  2BKR B;  3N32 A;  3ML8 A;  1WH3 A;  2KFK A;  4FJZ A;  3PLU A;  2JZ3 B;  2Z0E B;  3A9J B;  4IC7 B;  4ICV A;  4YL8 A;  2K1F A;  2NPT B;  2XK5 B;  4BKT A;  4EEW A;  3UQB A;  3QIJ A;  2FUH B;  4GDK B;  4K1R B;  1V5O A;  4MGK E;  2WX0 A;  3UQA A;  3OJ3 A;  2L8J A;  2YLM A;  2EMS A;  2NS5 A;  1V2Y A;  4W9F A;  2MRP A;  1WGH A;  2J0M A;  2J0K A;  2MBB B;  2LGD A;  3ZKJ C;  4K81 A;  2ZJD A;  3APF A;  3PV1 A;  4JLC A;  1VD2 A;  4GOC A;  4FAD A;  2IO2 B;  2OOB B;  2MX2 A;  3H6N A;  3IVF A;  4NQK E;  3ZO5 B;  2CS4 A;  3PS6 A;  3VH3 B;  3OJ4 B;  5LLI A;  2Z0D B;  2LAS A;  2GBR A;  1P1A A;  1LQB A;  5JHB A;  1VCB A;  5D94 A;  2XBB C;  3A33 B;  3LJ3 A;  4GDK A;  2MBH A;  1L7Y A;  2BKF A;  3U7D A;  3ZUN A;  5AEK B;  5L95 C;  5CHV C;  4NQL B;  4NPN A;  3APC A;  2LUE A;  3IBE A;  3DPD A;  1IP9 A;  2MA9 B;  1RFA A;  2O2V A;  3KYC D;  2NR2 A;  2KTF A;  5AZG A;  3P2B A;  2A5U A;  4E3C A;  2O6V D;  3QAQ A;  2FID A;  2JUO A;  2IO0 B;  4GDL B;  1E8W A;  1SIF A;  2KMC A;  4NNJ B;  2BGF A;  2GOW A;  5JH5 C;  4GIV A;  4JQW C;  4MDK E;  2IZV B;  2N9P C;  1WYW B;  2IY1 B;  2NBU A;  3MTN B;  2N1W A;  1E7U A;  4NJ7 A;  1WE7 A;  4BOZ B;  1V49 A;  2LXA A;  4DBG A;  3R3M A;  1LFD A;  2KLG A;  1UD7 A;  2FNJ B;  3DBH I;  3PZD A;  3PHW B;  1NDD A;  3TCA A;  3L16 A;  4FHK A;  4FA6 A;  5LXI B;  1ZKH A;  1WMH A;  3ZIM A;  2DX5 B;  2L76 A;  2CHW A;  2MSE D;  3PRP B;  3JVZ X;  4ZDV A;  1E8Z A;  2L05 A;  4WJN A;  1E7V A;  1WXA A;  2DAF A;  2FAZ A;  2BF8 B;  2KFK B;  2AWT A;  1I42 A;  2CKH B;  3M95 A;  3AI5 A;  4MSM B;  4EKU A;  2UWQ A;  5AZH A;  3SU8 X;  2OJR A;  3JYU A;  2CU1 A;  3B0A A;  1YIW A;  4HPL B;  4HPM B;  1V9J A;  3QAR A;  2KDB A;  2L0T A;  2MW5 A;  3HIZ A;  3N30 A;  2FIF A;  1V6E A;  2RPQ A;  5FR6 A;  4WJO A;  1G6J A;  4TQ0 A;  4W9C A;  4W9E A;  4M8M A;  2MBE A;  4AJY B;  3A9J A;  5BO4 B;  2IO1 B;  2FCQ A;  4HXD A;  1YQB A;  3DCG A;  4MGI E;  2N4F A;  3GZN I;  1EO6 A;  5D7G A;  2D3G A;  4DHJ B;  2KJ6 A;  2MCN B;  1WX8 A;  3PPA A;  3DVG Y;  3UIP B;  4G3X B;  1KLV A;  2BPS A;  4K7U A;  2C7M B;  4GB9 A;  4WWN A;  1WM3 A;  3ZNG C;  4JGH B;  2KZR A;  4HJK A;  2IBI B;  1OTR B;  1GC7 A;  1RRB A;  4JL9 A;  4XZ4 A;  1Y8R C;  2KNB A;  3ECI A;  2DHZ A;  2KHW B;  1WJ4 A;  1XT9 B;  4IUM B;  3VAW A;  2NVU I;  3UIN B;  1WZ3 A;  2JT4 B;  3NY5 A;  4I6P A;  3QHT A;  2LRU A;  3TIX A;  4EUT A;  2JWZ A;  2KX3 A;  4TQ1 A;  4DHJ D;  1UEL A;  5D2M B;  4BKS A;  3VUX A;  3OAW A;  2ZVN A;  3NHE B;  3S2A A;  4MM3 A;  4FUL A;  3SHQ A;  1TGZ B;  3T8M A;  2K6Q A;  1WM2 A;  3NS8 A;  1J0G A;  3EEC A;  2D2Q A;  3UF8 A;  1SE9 A;  3H7S A;  4HCP B;  2JPH A;  3H9D A;  1EF5 A;  3GOE A;  2CHZ A;  4KZ0 A;  3M3J A;  4MGY E;  3ZNH B;  2MLB A;  4KIK B;  2GMI C;  3DOW A;  4A3P A;  2YVC A;  4W9G A;  1WGR A;  3QA8 A;  4AWJ A;  1CMX B;  4CYE A;  1F9J A;  2KLC A;  1TTN A;  3L0W B;  4MEL A;  2PE9 A;  1UBQ A;  4PS7 A;  4AUQ C;  3JSV B;  2GBJ A;  5JZE B;  4G50 A;  1E8X A;  3H7P A;  4LCD E;  2RSU A;  2GBN A;  1Z5S B;  4DXA B;  4HDQ A;  2KC2 A;  3WAO A;  2LGX A;  3DQV A;  3QK0 A;  2ZPN A;  3R7Q A;  3V60 A;  3WIM A;  2D07 B;  2CR5 A;  3A1Q A;  2UYZ B;  2EKE C;  2IO3 B;  2RGF A;  4KSL C;  1WJ6 A;  2JF5 A;  4GMV A;  3EFU A;  4MJS A;  1Q1O A;  2KDF B;  4DDI D;  3HM6 X;  4LJP B;  2NBV B;  2LVO A;  4PYU A;  4EFO A;  1ZGU B;  3KUZ A;  2WYQ A;  4BOS C;  1T0Y A;  3RT3 B;  4G0N B;  5J18 A;  4ZRJ A;  3IG3 A;  2M0X A;  3PSE B;  2O6V A;  2LJ5 A;  1ISN A;  1OEY A;  2KD0 A;  3I3T B;  2MP2 A;  4W9L A;  4K7S A;  1IPG A;  2LVP A;  4FN2 A;  2DYO A;  4B95 A;  4HLE A;  2NCN A;  2ZNV C;  4B6W A;  2JRI B;  3ZTC A;  3QQ8 B;  3ML9 A;  4II2 B;  4WAA A;  1JRU A;  4KV2 A;  3V6C B;  4HK2 A;  4IWQ A;  4IG7 B;  1WXS A;  4BFR A;  1WZ0 A;  3IHP C;  4NAW B;  3VXW A;  5L83 A;  4MH0 E;  3NZS A;  3BY4 B;  2MWS B;  1WGD A;  4WWO A;  4LDT B;  3ENE A;  3PRM B;  5G55 A;  3BIN A;  2KVR A;  3V61 A;  2BYF A;  2ZZP B;  2DZI A;  3MHS D;  2NPT A;  3W1S C;  3CMM B;  2JXX A;  3K9P B;  2D10 A;  4CO7 A;  3AXC A;  5LXH A;  3A9K B;  2QHO A;  3PGE A;  2M4N A;  3VUW A;  1KOT A;  4BVU C;  4IM2 A;  2MP2 B;  2C9W B;  3WA0 A;  4ZRK A;  3ZNZ B;  4FBJ B;  2LD9 A;  2WDT B;  1XD3 B;  2J0J A;  2LGY A;  4RMA A;  3B08 A;  3VTU A;  3C0R B;  3DVN U;  1WJU A;  3ZLZ A;  2ZVO A;  4TKN A;  3ZW3 A;  5CX3 A;  2I1K A;  1MG8 A;  2KDI A;  1J19 A;  3A1Q B;  3DBS A;  2B3A A;  4AJW A;  1OEY J;  4HVB A;  2FCS A;  3RYT A;  3X23 A;  1GJZ A;  3MJW A;  2LWP A;  4IWP A;  2G4D B;  2KX0 A;  2WWZ A;  4F8C B;  1AAR A;  4KZC A;  1V5T A;  1P98 A;  4N9F 4;  1TBE A;  2AL3 A;  3O65 B;  2JVC A;  2MQJ A;  2O6V B;  1E90 A;  1LM8 B;  2ZEQ A;  3R7R A;  4OVU A;  3QWZ B;  2IY0 B;  2M1M A;  3N3K B;  1X1M A;  2GBM A;  3A4R A;  1KM7 A;  3ZTD A;  1LXD A;  1BT0 A;  2PE6 B;  4BBN F;  3U8Z A;  1Z2M A;  3UIO B;  1IYF A;  2ZNV B;  1XQQ A;  3WAN A;  3QX1 A;  1WGY A;  2AEH A;  3EHV A;  5GMV A;  2IYD B;  1GC6 A;  2FCN A;  4WQO B;  4F1S A;  2Y5B B;  5E6N A;  4LJO B;  4BKS D;  3CST A;  2K8H A;  2V4L A;  1NBF C;  2L3Z A;  3L10 B;  4IM3 A;  4MJS B;  3TL5 A;  1OQY A;  2BWE S;  3W1S A;  1RAX A;  3A9K A;  2LZ6 A;  3ZRF A;  2PEA A;  1EF1 A;  2KQ7 A;  4M0W B;  3PT2 B;  4XX5 A;  2GBK A;  2JZZ A;  3VVW B;  4W9J A;  3PRE A;  4II3 B;  3CF6 E;  2DZM A;  2KOX A;  1WE6 A;  3KVF B;  1YJ1 A;  4OVV A;  4FJV B;  2N7D A;  4TV3 A;  1E8Y A;  3RCZ A;  2N9E B;  4K7W A;  3RUL A;  4BKG A;  3M63 B;  2REX A;  3SDL C;  5KHQ A;  4MGZ E;  1GNU A;  2N9X A;  4EZK A;  3KH0 A;  4W9H A;  5IAA C;  1ZW7 A;  2VRR B;  1R4M I;  2K25 A;  1YD8 U;  2G3Q B;  5AZF A;  1YX6 B;  3VUY A;  4AP4 C;  3U30 A;  3ZRC A;  2KMA A;  5HKH A;  4FLH A;  5C23 A;  4PS8 A;  5CHF A;  1WRD B;  4KDI C;  4AOF A;  4DHZ B;  3VTV A;  3T9L A;  4KSK C;  1V80 A;  3PVL A;  3L08 A;  1UBI A;  3TMP B;  4E71 A;  1S1Q B;  2ASQ A;  3DDC B;  2RD0 A;  2K8B A;  3H7P B;  3L17 A;  2L7R A;  2DEN B;  2DYM A;  2DZJ A;  2KK8 A;  2PJH A;  3KUC B;  3RZW C;  1UH6 A;  2KKC A;  2KWC A;  4I6L B;  2C7N B;  5C1Z A;  3EC8 A;  4WJQ A;  2R2O A;  4G11 A;  2DAJ A;  3VHT C;  2KDE B;  4WWP A;  3IFW B;  3DVG X;  4W9K A;  4ANV A;  2MBO A;  3DBL I;  1FXT B;  2NBW B;  2M17 A;  2KFJ A;  1SGH A;  5DPW A;  4TUU A;  3R66 C;  4W9D A;  2ZCC A;  2D11 A;  2J7Q B;  3OLM D;  1TZ1 A;  2G4S A;  3PTF C;  5E6O A;  2JRH A;  4PS3 A;  3M62 B;  4W9I A;  4RM8 A;  4A3O A;  2K8C A;  3ONS A;  4ASW C;  3L13 A;  4A20 A;  4DK5 A;  1PQS A;  2AYO B;  4P7I A;  4X57 B;  3VFK A;  3ALB A;  1WIA A;  5J17 A;  3KW5 B;  4PYZ A;  1WGG A;  2PPH A;  2RR9 A;  2C7H A;  3X0W A;  3A4S C;  2L00 B;  2KWV B;  1WX9 A;  1WXM A;  2KJR A;  2V3S A;  3K9O B;  5J2R A;  1C3T A;  1J8C A;  4JIO U;  3Q3J A;  3JW0 X;  2EMT A;  5TR5 A;  2ZPY A;  2I1J A;  1L2N A;  3ZDT A;  2A4Z A;  2HD5 B;  3W1Y A;  3WAM A;  3VTW A;  4ANX A;  1H8C A;  2KAN A;  5DPR A;  4ANU A;  2DYB A;  1WF9 A;  2BYV E;  3JSV A;  1I35 A;  2M8S A;  4CHK A;  2WX1 A;  1WMH B;  4NAW A;  2N1V A;  2XEW A;  5EDS A;  5G2N A;  4BBN C;  4I6N B;  2CHX A;  4HCN B;  3ZDM C;  3DVN V;  2V1Y A;  3NZU A;  4EOY A;  4FJY A;  4NJ6 A;  1Q0W B;  4B9K A;  3RZF A;  4KDL B;  1EUV B;  4GU2 A;  1OGW A;  3PRZ A;  3B1L X;  4GGQ A;  4GXB A;  2C60 A;  3APD A;  4RM9 A;  3D32 A;  3TJP A;  4WJP A;  3CSF A;  1WY8 A;  5DCN A;  1WXV A;  5E6P A;  3VDZ A;  1Q5W B;  1WJN A;  1P9D U;  2G45 B;  3VQI A;  4IW0 A;  1HE8 A;  4DDG D;  3KUD B;  1QZE A;  1R4N I;  1D3Z A;  1KJT A;  2Z59 B;  3ZVV A;  1V86 A;  3AU5 A;  3RD2 A;  3DBR I;  1GG3 A;  4ZYN A;  3PLV A;  2R2Q A;  4URK A;  4HWI B;  2KQS A;  3V62 A;  3L54 A;  2K39 A;  1P0R A;  3WAP A;  4FHJ A;  4KVG B;  3QCA A;  3QC8 B;  1P3Q U;  3HHM A;  2KN5 A;  3UGB B;  3ZNI D;  3AUL A;  1M94 A;  2HJ8 A;  1YX5 B;  1K8R B;  1C1Y B;  4E74 A;  2HE7 A;  1WR1 A;  2JY6 A;  4GN1 A;  2LVQ A;  3NOB A;  3RUI B;  2KC1 A;  2W9N A;  1UGM A;  4ANW A;  4LDT D;  2FCM A;  3H1U A;  4EZL A;  4MSQ B;  3KYD D;  4ZRI A;  4J6I A;  3VH4 B;  4IM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...