5AEKB

Crystal structure of the human senp2 c548s in complex with the human sumo1 k48m f66w
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLMESYCQRQGVPMNSLRFLWEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stepping Back and Forward on Sumo Folding Evolution
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords SENTRIN-SPECIFIC PROTEASE 2
total genus 15
structure length 78
sequence length 78
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5aekB00
2KMCA 2MA9B 4TKNA 3AU4A 4F7ZA 4W9HA 2MBBB 1GNUA 4JGHB 4K7SA 5HKHA 2KVRA 4W9FA 4E74A 3QX1A 2MP2A 2GOWA 2LWPA 2LASA 3KUDB 3QWZB 3AULA 4KZ0A 2K8BA 4WJPA 1P9DU 4DK5A 1OEYJ 3NZUA 3PLUA 1OQYA 2KD0A 2KFKB 4GB9A 3X23A 2N9PC 2NVUI 4JQWC 3ZNID 1WJ6A 3R7RA 3ZNZB 2UYZB 1R4NI 5DPSA 3ZNHB 4I6PA 3L17A 4AUQC 3DCGA 3DQVA 2C7MB 3TBLD 2KX0A 4ANWA 1UZXB 2JRHA 3V62A 3MTNB 2KLCA 4MELA 1KM7A 3UIOB 3KYDD 3R7QA 2ZPYA 2C60A 4ZYNA 2FUHB 3APFA 1V86A 3PZDA 3AXCA 2KN5A 3SHQA 4NY0A 1KJTA 1KLVA 4BKSA 1OTRB 2BKFA 2KMAA 2L00B 2M8SA 3SD5A 2AEHA 2ZJDA 3R66C 2PE9A 3ZRFA 4IG7B 4NPNA 1YJ1A 3OLMD 4ZRJA 4BKTA 2IO3B 1YX5B 3I3TB 4RM9A 2O2VA 2NCNA 1E8YA 2Y5BB 1IPGA 4PYZA 5KHOA 3VTVA 3VXWA 2CU1A 3K9OB 2DZKA 4FLHA 2JZ3B 1GC7A 4A20A 2I1JA 2MLBA 1RLFA 2AL3A 1WY8A 1V80A 1Y8RC 4GDKB 1UBIA 3V60A 1UH6A 3A1QB 3V61A 2FCMA 2N4FA 3JVZX 2K25A 2K39A 4HWIB 1VD2A 3KH0A 2KX3A 4AOFA 1C3TA 2N1VA 4IW0A 2KLGA 4IM3A 4IWQA 5CHWA 1ZW7A 4IM2A 5DCNA 4HK2A 4FHJA 1E90A 1J0GA 1FXTB 2DENB 2LRUA 3WIMA 4DXAB 2DYOA 2KDIA 1XD3B 1WE6A 4JL9A 1WI0A 3APCA 4HXDA 3H6NA 3V6CB 4OVUA 2FCNA 2GBNA 3CSTA 3IHPC 4AJYB 3PT2B 1I42A 1Q5WB 1HE8A 2I1KA 2KOXA 3VUWA 4HCPB 5JHAA 4KZCA 4LJOB 3X0WA 3ML8A 4DDGD 3MHSD 3ZO5B 5CX3A 2D2QA 3A9KB 1TGZB 1WJNA 2JT4B 2XK5B 3CF6E 4BKGA 4ICUA 1WGRA 2RD0A 3IG3A 3ZDMC 2CKHB 2IY1B 3ZUNA 2ZEQA 3JW0X 1GUAB 4I6LB 1EF1A 3WALA 4DBGA 3UQBA 3OJ4B 2PJHA 5J17A 2N9XA 3RT3B 2R2OA 3RCZA 4II3B 3QJZA 4ANXA 1WGYA 2KZRA 2CR5A 4CHKA 3RYTA 1V49A 5JZEB 4CO7A 2LRWA 5CTRC 2LVQA 4K7WA 2L7RA 2IZVB 2C7HA 1XT9B 4FJYA 2MBOA 2BKRB 2J0MA 3NOBA 4JLCA 3UIPB 3JYUA 2GBJA 3KYCD 4WJNA 2FAZA 4RM8A 1H8CA 3QIJA 3MJWA 4A3OA 2KXJA 1E7UA 3H7PA 3RULA 5J2RA 1Z5SB 2V4LA 1SIFA 1VCBA 4NJ7A 3HM3A 2DX5B 3ZW3A 1Z2MA 3A4SC 2GMIC 2XK5A 1GG3A 3GZNI 2KFJA 3LJ3A 4G3XB 4K1RB 5LXIB 2IYDB 2LZ6A 2L0FA 3VQIA 2JZZA 4PYUA 1WF9A 1RFAA 2REXA 1QZEA 2RPQA 3KUCB 1NBFC 3H7SA 3WAPA 1WZ0A 2MBQA 1S1QB 1Q0WB 1UD7A 2LXCA 2NR2A 3PHWB 3N30A 3W1SC 3T9LA 4TQ0A 4W9CA 2FCSA 4ICVA 1ISNA 1F9JA 5JHBA 1EF5A 3B08A 4WQOB 1WGHA 1NDDA 2LJ5A 3QAQA 4YL8A 4DHZE 1WX7A 1G6JA 3NHEB 1GC6A 3S2AA 4GU2A 1T0YA 2JRIB 1J8CA 3L08A 1WR6E 2HTHA 3P2BA 3L10B 3PS6A 3VHTC 1WGDA 1V9JA 5DPTA 2KDFB 2XEWA 4XX5A 2FIDA 3A9JA 2MW5A 4AJWA 2NBVB 4OVVA 1CMXB 2KTFA 1WXMA 4MGKE 2FIFA 5LXHA 2MQJA 3UGBB 1E8ZA 5CHFA 5D6JB 2KNBA 2HD5B 1ZGUB 5GMVA 2VRRB 2MWSB 2KANA 2MBEA 2WX0A 4GMVA 2GBMA 3IFWB 3JSVA 1LM8B 1SE9A 3EC8A 4HVBA 1A5RA 3H9DA 1RRBA 3DPDA 4K7UA 3RZFA 4B95A 4AWJA 1ZKHA 4NNJB 4BKSD 4WWOA 2JUOA 1WH3A 3WANA 5C1ZA 3HHMA 2A4ZA 3GOEA 2WX1A 1V6EA 4ASWC 5AEKB 4MSMB 5DPWA 3TJPA 3ZNGC 4G50A 4WWNA 2KJ6A 3PREA 3SU8X 2N9EB 1V5TA 2K6DB 4MM3A 1P0RA 3B1LX 5AZFA 5G55A 1NI2A 1EUVB 2C9WB 3L16A 3RZWC 3A1QA 3H1UA 1LXDA 4EZKA 2IY0B 2FNJB 1LQBA 2O6VD 3ENEA 3SDLC 3PGEA 2RR9A 3Q3FA 2RSUA 4KV2A 4MJSB 2K8HA 2Z0DB 3HM6X 3V6EB 4DWFA 4EZLA 3UQAA 3U8ZA 3CSFA 1E7VA 2NPTB 1WXSA 3JSVB 1PQSA 1YX6B 2KKCA 2K8CA 2MRPA 1JRUA 4IM0A 4RMAA 4B9KA 2KWCA 4K81A 4WJQA 4TQ1A 2PPHA 3QQ8B 3PPAA 3IBEA 1WZ3A 4EUTA 5E6NA 2W9NA 2MP2B 1WM3A 1WMHA 1J19A 3LDZE 3NY5A 2C7NB 4E71A 2OJRA 2D10A 2DYMA 4W9LA 2HJ8A 2WYQA 4DDID 2IO2B 2MX2A 2NBWB 3A4RA 4W9IA 3VDZA 4KDIC 2KTRB 4GOCA 4NQLB 5EDSA 4MEMA 3T8MA 3DBLI 5IA7A 3VH3B 2GBKA 2KFKA 1WFYA 4PS8A 2K1FA 3M95A 4FN2A 3KW5B 4KSKC 4NAWB 4IUMB 1WXVA 2RGFA 4FULA 4ZRKA 4XZ4A 3DVGX 5D7GA 1U4AA 4II2B 3ECIA 3ZLZA 5JH5C 2XBBC 4W9KA 4DHZB 1UBQA 4GSWA 2LI5A 2BWFA 4AP4C 2D11A 4KIKA 1WJ4A 4GGQA 2ZCBA 4G11A 1GJZA 1YD8U 4LDTB 3PLVA 3OJ3A 1V81A 3TIXA 3BY4B 4GDKA 2BGFA 5L95C 2V1YA 2JPHA 2M4NA 4EFOA 4J6IA 4A3PA 4MH0E 3M62B 4F1SA 1E8XA 2CHXA 1V2YA 2L76A 4IWOA 4M8MA 2BYVE 3DVNU 3ZDTA 4FJZA 1XQQA 3D32A 2LGYA 1Q1OA 3PTFC 4HPLB 3VAWA 3ZTCA 5KHQA 1WMHB 2O2VB 2AWTA 4BBNC 3ZIMA 2L8JA 1H4RA 4EZJA 2LXAA 3CMMB 3DBSA 1E8WA 2V3SA 4ZDVA 4NQKE 1C1YB 2LVOA 2KTRA 2KWVB 3PRZA 4BFRA 3DBHI 3KVFB 4FHKA 3U7DA 2MCNB 3VH4B 2DAJA 4CYEA 3N32A 2M1MA 3HIZA 4FA6A 2NS5A 3Q3JA 2IO1B 2DZIA 3W1SA 2UWQA 2J7QB 2J0JA 3O65B 2G4SA 1L7YA 1V5OA 2JVCA 5DPRA 1WM2A 4FADA 4KIKB 3EFUA 2QHOA 2O6VA 3QK0A 3ZKJC 2LGDA 4I6NB 3VUYA 2MBHA 3PV1A 4G0NB 2KC2A 5TR5A 4GIVA 5IAAC 3BINA 4ZRIA 3HK0A 2LGXA 2ZNVB 3TL5A 1WE7A 4EOYA 4NAWA 2Z59B 2G4DB 2AYOB 1TBEA 1BT0A 1UGMA 3DVGY 3M3JA 3W1YA 2BF8B 5J18A 4MGYE 2JY6A 4LJPB 2KQ7A 5LLIA 4MSQB 2CHZA 5FR6A 1WX9A 1WJUA 3NZSA 4NJ6A 4N9F4 5AZGA 1M94A 4ANVA 4FBJB 3KUZA 4GN1A 3PSEB 2NBUA 1KOTA 2A5UA 3L0WB 1UELA 2JXXA 2G3QB 3ML9A 2R2QA 1D3ZA 1WXAA 4WJOA 3RD2A 2AL6A 4W9DA 2IO0B 2WWZA 2DZJA 4TUUA 5D94A 4EEWA 4M0WB 2YLMA 4P7IA 4B6WA 1WIAA 3TMPB 1K8RB 2CS4A 2O6VB 4E3CA 3M63B 2ZVNA 2KDEB 4HJKA 4HDOA 4HCNB 2D3GA 2ZZPB 3VTUA 2B3AA 2KDBA 2Z0EB 3ZVVA 4BOZB 4M8NA 2PEAA 4IC7B 4MGIE 4WWPA 2K6QA 2J0KA 3QC8B 5C23A 2CHWA 4FJVB 4HLEA 3B0AA 3IVFA 4JIOU 4WAAA 3VFKA 5BO4B 3H7PB 1WYWB 2JF5A 3PHXB 4EKUA 3OAWA 4ANUA 2BWES 2DZMA 3UINB 3NS8A 2KJHB 4MDKE 3WA0A 1YQBA 2GBRA 1OEYA 2L05A 3ZRCA 4PS3A 2OOBB 3PRMB 3QARA 4MGZE 2KO3A 2C5LC 2D07B 4W9JA 2KQSA 1E5WA 1TTNA 3QHTA 2KHWB 2ZVOA 2ZPNA 3TCAA 2KJRA 3RUIB 1RAXA 2JWZA 2MSED 2NPTA 3A9JB 3A9KA 3DOWA 4HPMB 3R3MA 2HE7A 3ZTDA 2EKEC 3L54A 1TZ1A 1MG8A 4DHJD 1SGHA 4URKA 5E6PA 2KC1A 4BOSC 2ASQA 2IBIB 3VUXA 3UF8A 5L83A 1IYFA 5AZHA 2M0XA 2KWUB 5D2MB 2L0TA 2FCQA 3DBRI 1OGWA 4GDLB 2LD9A 4KDLB 3ALBA 1X1MA 1AARA 3AI5A 2BYFA 2WDTB 2EMTA 4PS7A 4LCDE 2ZCCA 2PE6B 2N7EA 4TV3A 3WAOA 5G2NA 1EO6A 3EHVA 3QA8A 4GXBA 4HDQA 2G45B 5E6OA 1LFDA 1I35A 2DAFA 2BPSA 2N1WA 3L13A 5CHVC 4IWPA 2N7DA 4BBNF 3PVLA 4W9GA 2LUEA 1P98A 2M17A 4LDTD 4DHJB 2BYEA 3QCAA 1WGGA 2EMSA 2DHZA 3DVNV 3U30A 1IP9A 1YIWA 2ZNVC 3PRPB 1WX8A 4XC2A 2L3ZA 3N3KB 4W9EA 2KK8A 2YVCA 2LVPA 4KSLC 4BVUC 3EECA 1L2NA 4F8CB 3AU5A 1P1AA 4KVGB 4MJSA 4X57B 1WR1A 3ONSA 3A33B 1R4MI 3C0RB 2DYBA 3K9PB 4GDLA 1P3QU 3APDA 3DDCB 1WRDB 3VTWA 3WAMA 1S3SG 3VVWB
chains in the Genus database with same CATH superfamily
4JGHB 4K7SA 1QLBB 4WQMA 2MEKA 2KVZA 1RWSA 2LEKA 2IGGA 1PYWD 2KFKB 3LB8C 4JQWC 1ENFA 1SE2A 1MG4A 3R7RA 2HTME 1V8CA 4AUQC 3DCGA 1TYGB 2WS3B 1ET9A 1NENB 1FD6A 1K52A 3UIOB 3Q69A 1UUPA 5HFYA 3APFA 1V86A 3R2TA 3AXCA 2KN5A 4OZBA 3SHQA 1KLVA 4BKSA 1OTRB 3Q3NC 1ZUD2 4IG7B 2GI9A 1YJ1A 1F52A 1KF6B 1YX5B 2Y5BB 2GB1A 4PYZA 2CJNA 3VXWA 2JZ3B 2BYTA 4A20A 2AL3A 1V80A 3L4PA 3P1MA 1UH6A 3PZ7A 2FCMA 2K25A 4D2KA 2WXPA 2DBYA 2KLGA 3BWUD 4IWQA 4LK0M 4HK2A 4JL9A 1XD3B 1WE6A 2I38A 1WI0A 3RFZB 4HXDA 2FUG1 4YTPB 4OVUA 3CSTA 2WU5B 4HKZE 2KOXA 2I1KA 4KZCA 1VJKA 3MHSD 3AE3B 3AE5B 1FMAD 3CF6E 4BKGA 2IY1B 4RCOA 2OJWA 3JW0X 4I6LB 3WALA 2PJHA 5C2TB 2ON8A 4ANXA 1FFVA 4XE0A 2KZRA 2CR5A 1JALA 4M0WA 3RYTA 1R4MB 4RGTA 2C7HA 1Y56A 2ACZB 4FJYA 4YTNB 4JLCA 1YQ3B 4RM8A 5IOIA 4LNIA 3QIJA 3MJWA 4A3OA 4MH8A 5J2RA 1Z5SB 2HJ1A 2LFIA 1Z2MA 3A4SC 4N58A 2QILA 4K1RB 3AH7A 3PZ8A 1Q10A 1WF9A 2WXGA 2WLBA 4A6QA 1NBFC 3WAPA 2KMMA 1Q0WB 1UD7A 2LXCA 3HVDA 3N30A 4TQ0A 1IBXA 4W9CA 1TJEA 4ZRQA 1ISNA 1F9JA 1I4GA 1EF5A 3B08A 2LJ5A 3Q6BA 1L0XB 1G6JA 1ZPSA 3S2AA 1TS3A 1T0YA 1WR6E 3L10B 1FIQA 1V9JA 5G5GA 5DPTA 1YOVB 2FIDA 2KTFA 4A8XC 5LNK1 2FIFA 1C76A 5LXHA 1DOIA 3U52E 2KNBA 2Q5WD 3CWIA 1C4AA 2VRRB 5GMVA 3IFWB 3JSVA 4M02A 4BKSD 3HHMA 2WX1A 4ASWC 1SJED 1TS2A 3RN9C 5IO9A 5FKAC 2K6DB 1R4NB 2L83A 3B1LX 5G55A 3P4RB 5IP4D 4PK1A 1EUVB 3BYYB 2LGSA 3A1QA 3BVZA 2FNJB 2O6VD 3SDLC 3PGEA 3RNAC 3ZJVA 5I4DA 3V6EB 4EZLA 4DWFA 2K8HA 2KT7A 3NRZA 3Q8AA 1ZXIA 1GB1A 2MRPA 4B9KA 3KQ4A 4RMAA 3QQ8B 3AE2B 4BZAA 3BK1A 5E6NA 2W9NA 1N60A 1J19A 3TSSA 3A4RA 3VR9B 4MM3B 5IA7A 3DBLI 2KFKA 3EUB2 5AUKA 1WFYA 4FN2A 5MPOA 4KSKC 1M4VA 1U4AA 1XCTL 4II2B 5E6JA 2XBBC 4W9KA 5JH5C 2D11A 4HEA1 2KWDA 2IGDA 4YTMB 2M4NA 4J6IA 3DBRB 4A3PA 2ZW1A 3M62B 1I4HA 2MJ3A 2CHXA 4M8MA 2BYVE 2BB6A 5KHQA 4BBNC 1H4RA 4EZJA 3CMMB 4OZCA 4ZDVA 1E8WA 4NQKE 1UGJA 3DBHI 4ZOHC 4CYEA 3U7DA 2DAJA 2M1MA 1JWBD 2DZIA 2UWQA 1T3QA 3TUOA 1TT5B 5DPRA 1E7PB 2BB5A 4I6NB 1SXTA 3VUYA 5TR5A 5IAAC 4ZRIA 3TL5A 3ZXVA 2ZNVB 1TY2A 3WCQA 2JYEA 1N5XA 4HRSA 2Z59B 3DVGY 2MJDA 1VRAB 2BS2B 2CHZA 1WX9A 2OEDA 5AZGA 2DNFA 4FBJB 1L6VA 1NYRA 2J53A 2R2QA 1WXAA 3RD2A 4A55A 2WWZA 4M0WB 4RFBA 5BMIA 1WIAA 1K8RB 2CS4A 1HZ5A 2QEJC 4HJKA 1IUEA 2D3GA 3N1XC 1OQQA 4M8NA 2WXFA 4IC7B 2K6QA 3RNCC 3QC8B 2CHWA 4HLEA 2M0AA 3IVFA 3VFKA 1OFFA 3OAWA 3UINB 5BMHA 4MDKE 1YQBA 2RMMA 4P1BC 1OEYA 4PS3A 3PRMB 2D07B 4W9JA 2KQSA 3QHTA 2ZPNA 2WXKA 2KJRA 3RUIB 2JWZA 2G9HD 3DOWA 1T0SC 2KC1A 2KN4A 4BOSC 1TKEA 3TEYA 1IYFA 2M0XA 4KDLB 2LD9A 3ALBA 4MACA 4N59A 1UWXA 1QKZA 4LCDE 2ZCCA 2PE6B 2N7EA 2LMCA 3EHVA 3QA8A 2KACA 1EM7A 5T8IA 4LDTD 2BYEA 3RNBC 1WGGA 1FCLA 2DHZA 1SEBD 1WRIA 1C77A 1LO5D 4XDCA 3AE6B 4KSLC 3FC4A 2Y5PA 1P1AA 4MJSA 1R4MI 1YJJA 3VTWA 3WAMA 4TKNA 3AU4A 4F7ZA 2MBBB 2MJEA 3W5UB 2LASA 3QWZB 2K8BA 1P9DU 2V9HA 2KDMA 1OEYJ 3DHIC 1OQYA 2KD0A 1AWDA 4GB9A 2N9PC 3X23A 3U7ZA 4C4VB 3ZNZB 2UYZB 5DPSA 5EE3A 3GE8C 2PTLA 2NTSA 1YN5A 1FRDA 3KYDD 3R7QA 2ZPYA 2C60A 1QQRA 3H8HA 1DOYA 1N61A 4BAXA 2WDVB 4XYCA 2L00B 1AYFA 2AEHA 3R66C 2JZPA 3ZRFA 4USAA 3MHZA 3U2SC 3ETRA 2CU1A 4FLHA 2MLBA 5EE0A 3V60A 1UBIA 5FR3A 1K53A 2UU7A 2RDHA 1QILA 1MHXA 1MI0A 2WXJA 2N1VA 5CHWA 4IM2A 4KX6B 2K0PA 1J0GA 3T3OA 2KDIA 1JMLA 4OW0A 1FEHA 1P7FA 2R61A 3APCA 3H6NA 1V1PA 1ET6A 2FCNA 1Q5WB 1HE8A 3IT6B 2AQ3B 4DDGD 1WJNA 4KGRA 3C19A 3ZJUA 3IG3A 1TS4A 1FNUA 1GUAB 1HZ6A 1K50A 3AEEB 2WQYB 2R2OA 4II3B 3QJZA 1WGYA 2J52A 1A70A 3DWMA 1V49A 4ZYSA 5CTRC 2L7RA 2IZVB 2W55A 3JYUA 1FCCC 2GBJA 3KYCD 1H8CA 1FFUA 2KXJA 2BS3B 1E7UA 1DGJA 1SIFA 1VCBA 2J4XA 4NJ7A 2DX5B 4AQ7A 3ZW3A 1JCKB 2XK5A 4G3XB 2IYDB 3AEDB 1N6ZA 2W54A 3IT4B 3SR6A 4JE3B 3ABVB 1UNSA 1QZEA 5EE1A 1TKYA 5JHBA 4ICVA 4L2YA 4DHZE 1D5MC 4GU2A 3RI7C 1J8CA 3L08A 3GP7A 3P2BA 3VHTC 1J7CA 2ONQA 2WGSA 2BT6A 1I7HA 2PIAA 4B0EA 5IN7A 5CHFA 5D6JB 2HD5B 1VR9A 2MWSB 2KANA 4DXGA 2WX0A 4GMVA 2GBMA 5C3JB 4P16A 2CU3A 3AEGB 2QDFA 3EC8A 2H89B 1IGDA 1N62A 1SIJA 4WWOA 2JUOA 5C1ZA 3I9V1 1V6EA 5AEKB 4S0RA 5DPWA 3TJPA 3MFGA 3ZNGC 4A9AA 1HA5A 3PREA 3SU8X 4MM3A 5AZFA 3MJ5A 3MC9A 1NI2A 2C9WB 3MC8A 3RZWC 1LXDA 4US9A 1KFYB 2WXLA 2LJIA 4KV2A 2LUMA 4MJSB 3UQAA 1JWMD 1E7VA 3NJTA 2NPTB 4CQNA 1PFDA 2IGHA 2KKCA 2K8CA 1XO3A 4IM0A 1DOXA 4WJQA 4K81A 4A90A 2PPHA 2WU2B 1WZ3A 4EUTA 5BYSA 3LDZE 3J9CA 3NY5A 3N1YC 2HJ8A 2WYQA 2MX2A 3VDZA 4LTUA 5EDSA 4MEMA 2AQ1B 1JWAD 4PS8A 3TEXA 5TSSA 2MH7A 2RGFA 4ZRKA 3ZLZA 2WXQA 2LI5A 3SFDB 4LDTB 3PLVA 3NZ3A 3OJ3A 1V81A 4GDKA 2BGFA 1MPEA 2V1YA 1QT9A 1C79A 3AM9A 1E8XA 1V2YA 3MP9A 4IWOA 5EE9A 1YNTE 1J7AA 3DVNU 4FJZA 4C7ZA 1XQQA 3Q3MC 4HPLB 1Q1OA 4H2AA 3ZTCA 1WMHB 4LNOA 2AWTA 2ZW0A 3AN1A 3R8BA 1NEKB 1C1YB 2KTRA 1C9FA 3Q8CA 4M01A 2FBWB 3KVFB 3VH4B 2NS5A 2IO1B 3NVZA 3W1SA 1EWYC 4MT5A 2JVCA 1WM2A 2BS4B 4KIKB 3ZKJC 3AECB 2MBHA 4G0NB 1XF5L 3BINA 1ZDVA 4P6VF 4NAWA 2G4DB 2BW2A 2L52A 2AYOB 1TBEA 1BT0A 2DLBA 1CQVA 5FK9C 1WJUA 4NJ6A 4XDDA 2JWUA 4ANVA 1JQ4A 1GAQB 4GN1A 1UELA 2JXXA 2G3QB 3ML9A 4ARIA 2JYTA 4WJOA 5AUIA 1KLUD 2AL6A 3P4PB 4EEWA 2PKOA 3FKYA 2O6VB 3T3NA 1BXTA 4ACFA 2ZVNA 2KDEB 3VTUA 2B3AA 1C4CA 4MGIE 4WWPA 2J0KA 2E6XA 4JIOU 1TIFA 4WAAA 3N9YC 1T0QC 3BIID 1B1ZA 2GBRA 3U4EG 2K9XA 3KWVA 2OOBB 4KKJA 2K5PA 1E5WA 3TCAA 2KHWB 3ZXRA 4HPPA 2EELA 1RAXA 3A9JB 3R3MA 1TZ1A 1T5XD 3BK2A 2JX5A 2IBIB 1PGBA 5L83A 5AZHA 1VLBA 2L0TA 3DBRI 1OGWA 2IJ0A 1FNVA 1X1MA 1L4ZB 3AI5A 1J7BA 5HHDG 4C00A 2EMTA 4YSYB 2M56B 2WDQB 4HDQA 5IKCM 2N1WA 5H8YE 3ZJTA 2MHJA 4JPSA 3NUHB 3UI3A 1ZE3D 2LUEA 2M17A 1D5ZC 2W82A 3DVNV 2D3CA 1YIWA 2L3ZA 4W9EA 3EFCA 2LVPA 4BVUC 3TEWA 3EECA 3AU5A 1YQ4B 1WR1A 2Y3AA 3C0RB 2LHDA 2N9LA 1P3QU 1QOAA 2Z8LA 1S3SG 2KMCA 1VDVA 4W9HA 1GNUA 2KVRA 4W9FA 1FO4A 2MP2A 4L1BA 2GOWA 2LWPA 1JW9D 4M00A 2Y5CA 4DK5A 1D5XC 3IAM1 1ZOYB 4UDUC 3ZNID 1R4NI 2WXNA 3L17A 2PLPA 3P42A 2KX0A 2WXHA 1UZXB 5HI1A 2CJOA 1QF6A 1QOFA 4ZYNA 2FUHB 1KJTA 2BKFA 2KMAA 4KGSA 2M8SA 3SD5A 3B2FA 2ZJDA 2PE9A 2XN9C 3OLMD 2BBCA 2IO3B 4RM9A 3RNEC 3MC0B 2NCNA 1IGCA 1SE4A 1YJIA 5KHOA 1XLOA 3VTVA 2LGIA 5BYQA 1RLFA 1WY8A 1Y8RC 1STEA 4GDKB 3A1QB 2N4FA 1QOBA 2SEBD 2K39A 4HWIB 1VD2A 4IM3A 3FAHA 3NVYA 3VRBB 4FHJA 1I4QA 2DENB 2J42A 2LRUA 2PVGC 2QJLA 2DYOA 3WIMA 3Q2AC 2VZKB 3V6CB 3IHPC 1CZPA 5JHAA 4LJOB 2KYWA 3X0WA 2SAKA 3ZO5B 1C4PA 2D2QA 3A9KB 1TGZB 4RGNA 1SB3C 4US8A 2XK5B 1E10A 2RD0A 3ZDMC 2CKHB 4JX1C 1GB4A 1EF1A 4OHJA 3DWGC 3UQBA 3OJ4B 5J17A 2QCZA 1HTQA 2JQRB 2BVCA 2RPVA 2LRWA 3OWEB 4K7WA 3BVGA 3C8YA 1XT9B 3UIPB 3NOBA 4WURA 4WJNA 2FAZA 2LHEA 3BVMA 1FM0D 2I2YA 2BTEA 3HM3A 4Q2JA 2VH2A 1PGAA 2GMIC 2B76B 3GZNI 3LJ3A 1MJDA 5LXIB 4C4VA 2JZZA 1SJHD 3RPFC 2V3NA 4AS1A 2REXA 1N5WA 3KUCB 3NS1A 3H7SA 4XWTA 2HDEA 2MBQA 2NR2A 2GRIA 1WSPA 3T9LA 2FCSA 1AW7A 3FILA 1NDDA 3QAQA 4YL8A 1TZOA 1EU3A 3E56A 1E9MA 1WX7A 2W3RA 3NHEB 2KQ4X 3PS6A 1WGDA 2KDFB 4S17A 4XX5A 3A9JA 2BQQA 2MW5A 4DQOC 4AJWA 4YWGG 4RGMA 1EWCA 1WXMA 3AEFB 3UGBB 2INCC 1FNWA 3P4QB 3GB1A 4HVBA 1RRBA 3DPDA 2INNE 4AWJA 4NNJB 1WH3A 3WANA 3VR8B 3AMZA 4WH4A 3E9SA 3SFEB 2V4IB 4XGAB 4O1NA 4G50A 4WWNA 1WGKA 2N9EB 1P0RA 1D6EC 1PUTA 2TSSA 3H1UA 4EZKA 2IY0B 1L6UA 3ENEA 4DXFA 5GXGB 2RR9A 3Q3FA 2RSUA 1SSNA 3HM6X 3CSFA 1WXSA 1PQSA 4QAYA 1JRUA 2KWCA 3R2IA 3PPAA 5BYRA 2MP2B 1WMHA 4E71A 1BMLC 3GE3C 4XWWA 4K3BA 4DDID 1XLPA 2NBWB 1XLNA 4W9IA 2KTRB 4GOCA 4NQLB 1FXAA 1VZ7A 3ZQ4A 3V05A 2K1FA 3M95A 4XZ4A 5D7GA 1PDXA 3ECIA 4DHZB 2BWFA 4KIKA 1WJ4A 4GGQA 3URYA 2ZCBA 3LXFA 1YD8U 4WIPA 3TIXA 3N1ZC 5L95C 2WXMA 5BMGA 2JPHA 4EFOA 3RNFC 4YXDB 2GLSA 4F1SA 3I5JC 1MVKA 3ZDTA 3D32A 3PTFC 1EU4A 3ZIMA 2L8JA 2LXAA 2V3SA 4BFRA 1AN8A 4LNNA 1ZXHA 2MCNB 3HIZA 4FA6A 3BZDB 2WXIA 2WXRA 2J7QB 3HUIA 2G4SA 1L7YA 1V5OA 4FADA 1IBXB 2O6VA 2OHFA 2LGDA 4GIVA 2LGXA 3N20C 4EOYA 1UGMA 1ACCA 3W1YA 2BF8B 5J18A 1RFKA 4MGYE 2JY6A 4LJPB 2KQ7A 5LLIA 4MSQB 3NZSA 4N9F4 1M94A 2JSVX 3PSEB 1KOTA 3AE4B 3L0WB 5HG2A 4ZHPA 1D3ZA 4W9DA 2DZJA 4TUUA 3ZYYX 2YLMA 4E3CA 1WWTA 3V3XA 4HDOA 1HTOA 2ZZPB 3ZVVA 1F0ZA 2Z0EB 5D3IB 3SEBA 2PEAA 5C23A 5BO4B 1WYWB 4C56C 4EKUA 4LLGM 1E0ZA 1KH0A 1ESFA 3NS8A 2KJHB 2E3TA 4JWSC 4IKGA 2KAJA 2V0GA 1T6BX 4YSZB 3QARA 2KO3A 2C5LC 1I4RA 2PMVA 2JU6X 1VZ8A 1MG8A 2IDYA 4URKA 1SBBB 3VUXA 3UF8A 4YT0B 2FCQA 1NYQA 3CIRB 4OVZA 4PS7A 4K3CA 1EO6A 2G45B 1V1OA 2BPSA 2L1AA 1E6EB 1V97A 5CHVC 2VH1A 4W9GA 1P98A 4DHJB 4HROA 3U30A 1IP9A 1WX8A 4XC2A 3N3KB 1P7EA 2KK8A 4F8CB 1B9RA 2M19A 4KVGB 2X8XX 2DWQA 3O13A 3K9PB 4GDLA 3DDCB 1WRDB 3DBLB 4NAWB 2MA9B 2WXOA 5HKHA 1CJEA 1PGXA 4E74A 2AX5A 4FXCA 4RNAA 3QX1A 3KUDB 3AULA 4KZ0A 1CK1A 4WJPA 3Q8FA 3NZUA 3PLUA 3B2GA 2NVUI 1YN4A 1WJ6A 3ZNHB 4I6PA 3RNGC 3DQVA 2C7MB 3TBLD 4ANWA 1YMHE 2JRHA 4TSSA 3V62A 3MTNB 2KLCA 4MELA 1KM7A 2QC8A 2K22A 3PZDA 3DBHB 4NY0A 4YSXB 3DHGC 4NZLB 4NPNA 4BKTA 4ZRJA 2H88B 3I3TB 2O2VA 1KTKA 3IAS1 1E8YA 1IPGA 2WP9B 3K9OB 4NJCA 2DZKA 1RYJA 1GC7A 2I1JA 2NMQA 3AE1B 2L32A 2PVOD 1WXQA 4C80A 3B9JA 3V61A 3JVZX 3P4SB 3KH0A 1JROA 2KX3A 4AOFA 1C3TA 4IW0A 1ZW7A 2IPKD 5DCNA 1OQRA 1E90A 1FXTB 4DXAB 3RMKC 4REZA 4AJYB 2GBNA 1I42A 3PT2B 4KKIA 3VUWA 4HCPB 1ROEA 2ICIA 3ML8A 5CX3A 1F77A 2JT4B 1JWSD 1SF0A 4ICUA 1WGRA 3ZUNA 2ZEQA 4HKQA 2FE8A 4DBGA 2N9XA 3RT3B 1XEEA 4CHKA 5JZEB 4CO7A 2LVQA 4IOIE 5D3DA 1QOGA 2MBOA 2BKRB 2J0MA 3AE8B 4OZAA 1LGRA 4RF1A 3H7PA 3RULA 2V4LA 1MFWA 2WHIA 3AEBB 1GG3A 2KFJA 1F2RI 2LZ6A 1WYGA 2L0FA 3VQIA 1JWUD 2RDBC 1N63A 4PYUA 4PT5A 4RF0A 1RFAA 2RPQA 2INDC 1TKGA 1WZ0A 4IDIA 1S1QB 3PHWB 3W1SC 4WQOB 1WGHA 1XLQA 1GC6A 2JRIB 1GPXA 2HTHA 2N9KA 2N7JA 2XEWA 1VZ6A 2WNMA 4LNFA 2NBVB 4OVVA 1C78A 1CMXB 1KRHA 2WDRB 3LYYA 4MGKE 2MQJA 3Q14C 1E8ZA 1ZGUB 1L0YB 2MBEA 1LM8B 1SE9A 4KGTA 4P1CC 1A5RA 3H9DA 3RZFA 4K7UA 4B95A 1ZKHA 1NVID 2A4ZA 2N0SB 3GOEA 4MSMB 4B0MA 3AE7B 2KJ6A 1V5TA 3W9CB 2D5GA 2EKIA 3L16A 3Q8BA 1XCQL 3BYTB 1LQBA 1NI3A 2Z0DB 3U8ZA 1TS5A 3JSVB 1YX6B 4RGOS 1HXYD 4TQ1A 4ARCA 3IBEA 4WAFA 1BUIC 4RH6A 1WM3A 2C7NB 2OJRA 2D10A 2DYMA 4W9LA 2IO2B 2INPE 4KDIC 1GOZA 5H92C 2NTTA 3T8MA 3VH3B 2GBKA 3AE9B 3AEAB 3GZNB 3KW5B 3Q8EA 1WXVA 4FULA 4IUMB 3DVGX 1UBQA 4GSWA 4AP4C 4G11A 1GJZA 4ITKA 3BY4B 1DYQA 3EA6A 3EGRA 4MH0E 3KWLA 2L76A 4TMAB 3NVWA 2LGYA 3FILB 3VAWA 2O2VB 1ZDXA 1SE3A 3DBSA 2LVOA 2KWVB 3PRZA 4L23A 1RM6C 4FHKA 2X38A 2AQ2B 3N32A 3W5VB 4HJGE 1MHHE 3Q3JA 1ZP0B 3P63A 2J0JA 3O65B 1FRRA 2D3BA 3EFUA 2YEPF 2QHOA 3Q3OC 3QK0A 1HEZE 3OG5A 1UWMA 1L4DB 3PV1A 3HVZA 2KC2A 3HK0A 1WE7A 1D4BA 3M3JA 1T0RC 5FR6A 1L0VB 3I57A 3GS2A 2YEPB 1HQRD 2W3SA 3KUZA 2PW9A 2NBUA 3IXSA 2A5UA 1I4XA 5JXVA 3NG0A 2V3PA 2IO0B 5D94A 4GLSC 4P7IA 4B6WA 2RDGA 3TMPB 1L5PA 3M63B 4EE2A 2QSDA 4HCNB 4C7YA 2KDBA 2XNAC 3VRAB 4BOZB 4FJVB 3B0AA 1XXGA 1F2RC 3H7PB 2JF5A 3PHXB 4ANUA 2BWES 2DZMA 3TEZA 2G1EA 1F1HA 3WA0A 4J3OD 5G5HA 2L05A 3ZRCA 1K51A 3NVVA 4MGZE 2VZKD 1TTNA 2ZVOA 3PO0A 3KLSX 2NPTA 2MSED 4HPMB 3A9KA 1FXIA 2HE7A 3ZTDA 2EKEC 3L54A 4DHJD 1SGHA 1JRPA 5E6PA 3HRDD 1I4PA 2ASQA 3AV8A 4NAMA 2KWUB 5D2MB 4R3DA 4GDLB 2QMTA 3AB5A 1AARA 2BYFA 2WDTB 1V1PB 4ZHOA 4TV3A 2D3AA 4JWUC 3WAOA 5G2NA 1YN3A 4GXBA 3W2DA 5E6OA 1LFDA 1I35A 2DAFA 3L13A 4IWPA 2N7DA 2K3UA 4N6EB 4BBNF 3PVLA 3QCAA 2EMSA 1KLGD 2ZNVC 3PRPB 1R7SA 2YVCA 3ZGZA 1L2NA 4ZRPA 1UF0A 3I63C 2JXTA 1FPYA 4LNKA 1TY0A 2QIEB 4X57B 3ONSA 3A33B 4WWMA 2DYBA 3DHHC 3APDA 3RCZA 3VVWB
chains in the Genus database with same CATH topology
2KMCA 2MA9B 4TKNA 3AU4A 4F7ZA 4W9HA 2MBBB 1GNUA 4JGHB 4K7SA 5HKHA 2KVRA 4W9FA 4E74A 3QX1A 2MP2A 2GOWA 2LWPA 2LASA 3KUDB 3QWZB 3AULA 4KZ0A 2K8BA 4WJPA 1P9DU 4DK5A 1OEYJ 3NZUA 3PLUA 1OQYA 2KD0A 2KFKB 4GB9A 3X23A 2N9PC 2NVUI 4JQWC 3ZNID 1WJ6A 3R7RA 3ZNZB 2UYZB 1R4NI 5DPSA 3ZNHB 4I6PA 3L17A 4AUQC 3DCGA 3DQVA 2C7MB 3TBLD 2KX0A 4ANWA 1UZXB 2JRHA 3V62A 3MTNB 2KLCA 4MELA 1KM7A 3UIOB 3KYDD 3R7QA 2ZPYA 2C60A 4ZYNA 2FUHB 3APFA 1V86A 3PZDA 3AXCA 2KN5A 3SHQA 4NY0A 1KJTA 1KLVA 4BKSA 1OTRB 2BKFA 2KMAA 2L00B 2M8SA 3SD5A 2AEHA 2ZJDA 3R66C 2PE9A 3ZRFA 4IG7B 4NPNA 1YJ1A 3OLMD 4ZRJA 4BKTA 2IO3B 1YX5B 3I3TB 4RM9A 2O2VA 2NCNA 1E8YA 2Y5BB 1IPGA 4PYZA 5KHOA 3VTVA 3VXWA 2CU1A 3K9OB 2DZKA 4FLHA 2JZ3B 1GC7A 4A20A 2I1JA 2MLBA 1RLFA 2AL3A 1WY8A 1V80A 1Y8RC 4GDKB 1UBIA 3V60A 1UH6A 3A1QB 3V61A 2FCMA 2N4FA 3JVZX 2K25A 2K39A 4HWIB 1VD2A 3KH0A 2KX3A 4AOFA 1C3TA 2N1VA 4IW0A 2KLGA 4IM3A 4IWQA 5CHWA 1ZW7A 4IM2A 5DCNA 4HK2A 4FHJA 1E90A 1J0GA 1FXTB 2DENB 2LRUA 3WIMA 4DXAB 2DYOA 2KDIA 1XD3B 1WE6A 4JL9A 1WI0A 3APCA 4HXDA 3H6NA 3V6CB 4OVUA 2FCNA 2GBNA 3CSTA 3IHPC 4AJYB 3PT2B 1I42A 1Q5WB 1HE8A 2I1KA 2KOXA 3VUWA 4HCPB 5JHAA 4KZCA 4LJOB 3X0WA 3ML8A 4DDGD 3MHSD 3ZO5B 5CX3A 2D2QA 3A9KB 1TGZB 1WJNA 2JT4B 2XK5B 3CF6E 4BKGA 4ICUA 1WGRA 2RD0A 3IG3A 3ZDMC 2CKHB 2IY1B 3ZUNA 2ZEQA 3JW0X 1GUAB 4I6LB 1EF1A 3WALA 4DBGA 3UQBA 3OJ4B 2PJHA 5J17A 2N9XA 3RT3B 2R2OA 3RCZA 4II3B 3QJZA 4ANXA 1WGYA 2KZRA 2CR5A 4CHKA 3RYTA 1V49A 5JZEB 4CO7A 2LRWA 5CTRC 2LVQA 4K7WA 2L7RA 2IZVB 2C7HA 1XT9B 4FJYA 2MBOA 2BKRB 2J0MA 3NOBA 4JLCA 3UIPB 3JYUA 2GBJA 3KYCD 4WJNA 2FAZA 4RM8A 1H8CA 3QIJA 3MJWA 4A3OA 2KXJA 1E7UA 3H7PA 3RULA 5J2RA 1Z5SB 2V4LA 1SIFA 1VCBA 4NJ7A 3HM3A 2DX5B 3ZW3A 1Z2MA 3A4SC 2GMIC 2XK5A 1GG3A 3GZNI 2KFJA 3LJ3A 4G3XB 4K1RB 5LXIB 2IYDB 2LZ6A 2L0FA 3VQIA 2JZZA 4PYUA 1WF9A 1RFAA 2REXA 1QZEA 2RPQA 3KUCB 1NBFC 3H7SA 3WAPA 1WZ0A 2MBQA 1S1QB 1Q0WB 1UD7A 2LXCA 2NR2A 3PHWB 3N30A 3W1SC 3T9LA 4TQ0A 4W9CA 2FCSA 4ICVA 1ISNA 1F9JA 5JHBA 1EF5A 3B08A 4WQOB 1WGHA 1NDDA 2LJ5A 3QAQA 4YL8A 4DHZE 1WX7A 1G6JA 3NHEB 1GC6A 3S2AA 4GU2A 1T0YA 2JRIB 1J8CA 3L08A 1WR6E 2HTHA 3P2BA 3L10B 3PS6A 3VHTC 1WGDA 1V9JA 5DPTA 2KDFB 2XEWA 4XX5A 2FIDA 3A9JA 2MW5A 4AJWA 2NBVB 4OVVA 1CMXB 2KTFA 1WXMA 4MGKE 2FIFA 5LXHA 2MQJA 3UGBB 1E8ZA 5CHFA 5D6JB 2KNBA 2HD5B 1ZGUB 5GMVA 2VRRB 2MWSB 2KANA 2MBEA 2WX0A 4GMVA 2GBMA 3IFWB 3JSVA 1LM8B 1SE9A 3EC8A 4HVBA 1A5RA 3H9DA 1RRBA 3DPDA 4K7UA 3RZFA 4B95A 4AWJA 1ZKHA 4NNJB 4BKSD 4WWOA 2JUOA 1WH3A 3WANA 5C1ZA 3HHMA 2A4ZA 3GOEA 2WX1A 1V6EA 4ASWC 5AEKB 4MSMB 5DPWA 3TJPA 3ZNGC 4G50A 4WWNA 2KJ6A 3PREA 3SU8X 2N9EB 1V5TA 2K6DB 4MM3A 1P0RA 3B1LX 5AZFA 5G55A 1NI2A 1EUVB 2C9WB 3L16A 3RZWC 3A1QA 3H1UA 1LXDA 4EZKA 2IY0B 2FNJB 1LQBA 2O6VD 3ENEA 3SDLC 3PGEA 2RR9A 3Q3FA 2RSUA 4KV2A 4MJSB 2K8HA 2Z0DB 3HM6X 3V6EB 4DWFA 4EZLA 3UQAA 3U8ZA 3CSFA 1E7VA 2NPTB 1WXSA 3JSVB 1PQSA 1YX6B 2KKCA 2K8CA 2MRPA 1JRUA 4IM0A 4RMAA 4B9KA 2KWCA 4K81A 4WJQA 4TQ1A 2PPHA 3QQ8B 3PPAA 3IBEA 1WZ3A 4EUTA 5E6NA 2W9NA 2MP2B 1WM3A 1WMHA 1J19A 3LDZE 3NY5A 2C7NB 4E71A 2OJRA 2D10A 2DYMA 4W9LA 2HJ8A 2WYQA 4DDID 2IO2B 2MX2A 2NBWB 3A4RA 4W9IA 3VDZA 4KDIC 2KTRB 4GOCA 4NQLB 5EDSA 4MEMA 3T8MA 3DBLI 5IA7A 3VH3B 2GBKA 2KFKA 1WFYA 4PS8A 2K1FA 3M95A 4FN2A 3KW5B 4KSKC 4NAWB 4IUMB 1WXVA 2RGFA 4FULA 4ZRKA 4XZ4A 3DVGX 5D7GA 1U4AA 4II2B 3ECIA 3ZLZA 5JH5C 2XBBC 4W9KA 4DHZB 1UBQA 4GSWA 2LI5A 2BWFA 4AP4C 2D11A 4KIKA 1WJ4A 4GGQA 2ZCBA 4G11A 1GJZA 1YD8U 4LDTB 3PLVA 3OJ3A 1V81A 3TIXA 3BY4B 4GDKA 2BGFA 5L95C 2V1YA 2JPHA 2M4NA 4EFOA 4J6IA 4A3PA 4MH0E 3M62B 4F1SA 1E8XA 2CHXA 1V2YA 2L76A 4IWOA 4M8MA 2BYVE 3DVNU 3ZDTA 4FJZA 1XQQA 3D32A 2LGYA 1Q1OA 3PTFC 4HPLB 3VAWA 3ZTCA 5KHQA 1WMHB 2O2VB 2AWTA 4BBNC 3ZIMA 2L8JA 1H4RA 4EZJA 2LXAA 3CMMB 3DBSA 1E8WA 2V3SA 4ZDVA 4NQKE 1C1YB 2LVOA 2KTRA 2KWVB 3PRZA 4BFRA 3DBHI 3KVFB 4FHKA 3U7DA 2MCNB 3VH4B 2DAJA 4CYEA 3N32A 2M1MA 3HIZA 4FA6A 2NS5A 3Q3JA 2IO1B 2DZIA 3W1SA 2UWQA 2J7QB 2J0JA 3O65B 2G4SA 1L7YA 1V5OA 2JVCA 5DPRA 1WM2A 4FADA 4KIKB 3EFUA 2QHOA 2O6VA 3QK0A 3ZKJC 2LGDA 4I6NB 3VUYA 2MBHA 3PV1A 4G0NB 2KC2A 5TR5A 4GIVA 5IAAC 3BINA 4ZRIA 3HK0A 2LGXA 2ZNVB 3TL5A 1WE7A 4EOYA 4NAWA 2Z59B 2G4DB 2AYOB 1TBEA 1BT0A 1UGMA 3DVGY 3M3JA 3W1YA 2BF8B 5J18A 4MGYE 2JY6A 4LJPB 2KQ7A 5LLIA 4MSQB 2CHZA 5FR6A 1WX9A 1WJUA 3NZSA 4NJ6A 4N9F4 5AZGA 1M94A 4ANVA 4FBJB 3KUZA 4GN1A 3PSEB 2NBUA 1KOTA 2A5UA 3L0WB 1UELA 2JXXA 2G3QB 3ML9A 2R2QA 1D3ZA 1WXAA 4WJOA 3RD2A 2AL6A 4W9DA 2IO0B 2WWZA 2DZJA 4TUUA 5D94A 4EEWA 4M0WB 2YLMA 4P7IA 4B6WA 1WIAA 3TMPB 1K8RB 2CS4A 2O6VB 4E3CA 3M63B 2ZVNA 2KDEB 4HJKA 4HDOA 4HCNB 2D3GA 2ZZPB 3VTUA 2B3AA 2KDBA 2Z0EB 3ZVVA 4BOZB 4M8NA 2PEAA 4IC7B 4MGIE 4WWPA 2K6QA 2J0KA 3QC8B 5C23A 2CHWA 4FJVB 4HLEA 3B0AA 3IVFA 4JIOU 4WAAA 3VFKA 5BO4B 3H7PB 1WYWB 2JF5A 3PHXB 4EKUA 3OAWA 4ANUA 2BWES 2DZMA 3UINB 3NS8A 2KJHB 4MDKE 3WA0A 1YQBA 2GBRA 1OEYA 2L05A 3ZRCA 4PS3A 2OOBB 3PRMB 3QARA 4MGZE 2KO3A 2C5LC 2D07B 4W9JA 2KQSA 1E5WA 1TTNA 3QHTA 2KHWB 2ZVOA 2ZPNA 3TCAA 2KJRA 3RUIB 1RAXA 2JWZA 2MSED 2NPTA 3A9JB 3A9KA 3DOWA 4HPMB 3R3MA 2HE7A 3ZTDA 2EKEC 3L54A 1TZ1A 1MG8A 4DHJD 1SGHA 4URKA 5E6PA 2KC1A 4BOSC 2ASQA 2IBIB 3VUXA 3UF8A 5L83A 1IYFA 5AZHA 2M0XA 2KWUB 5D2MB 2L0TA 2FCQA 3DBRI 1OGWA 4GDLB 2LD9A 4KDLB 3ALBA 1X1MA 1AARA 3AI5A 2BYFA 2WDTB 2EMTA 4PS7A 4LCDE 2ZCCA 2PE6B 2N7EA 4TV3A 3WAOA 5G2NA 1EO6A 3EHVA 3QA8A 4GXBA 4HDQA 2G45B 5E6OA 1LFDA 1I35A 2DAFA 2BPSA 2N1WA 3L13A 5CHVC 4IWPA 2N7DA 4BBNF 3PVLA 4W9GA 2LUEA 1P98A 2M17A 4LDTD 4DHJB 2BYEA 3QCAA 1WGGA 2EMSA 2DHZA 3DVNV 3U30A 1IP9A 1YIWA 2ZNVC 3PRPB 1WX8A 4XC2A 2L3ZA 3N3KB 4W9EA 2KK8A 2YVCA 2LVPA 4KSLC 4BVUC 3EECA 1L2NA 4F8CB 3AU5A 1P1AA 4KVGB 4MJSA 4X57B 1WR1A 3ONSA 3A33B 1R4MI 3C0RB 2DYBA 3K9PB 4GDLA 1P3QU 3APDA 3DDCB 1WRDB 3VTWA 3WAMA 1S3SG 3VVWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMC A;  2MA9 B;  4TKN A;  3AU4 A;  4F7Z A;  4W9H A;  2MBB B;  1GNU A;  4JGH B;  4K7S A;  5HKH A;  2KVR A;  4W9F A;  4E74 A;  3QX1 A;  2MP2 A;  2GOW A;  2LWP A;  2LAS A;  3KUD B;  3QWZ B;  3AUL A;  4KZ0 A;  2K8B A;  4WJP A;  1P9D U;  4DK5 A;  1OEY J;  3NZU A;  3PLU A;  1OQY A;  2KD0 A;  2KFK B;  4GB9 A;  3X23 A;  2N9P C;  2NVU I;  4JQW C;  3ZNI D;  1WJ6 A;  3R7R A;  3ZNZ B;  2UYZ B;  1R4N I;  5DPS A;  3ZNH B;  4I6P A;  3L17 A;  4AUQ C;  3DCG A;  3DQV A;  2C7M B;  3TBL D;  2KX0 A;  4ANW A;  1UZX B;  2JRH A;  3V62 A;  3MTN B;  2KLC A;  4MEL A;  1KM7 A;  3UIO B;  3KYD D;  3R7Q A;  2ZPY A;  2C60 A;  4ZYN A;  2FUH B;  3APF A;  1V86 A;  3PZD A;  3AXC A;  2KN5 A;  3SHQ A;  4NY0 A;  1KJT A;  1KLV A;  4BKS A;  1OTR B;  2BKF A;  2KMA A;  2L00 B;  2M8S A;  3SD5 A;  2AEH A;  2ZJD A;  3R66 C;  2PE9 A;  3ZRF A;  4IG7 B;  4NPN A;  1YJ1 A;  3OLM D;  4ZRJ A;  4BKT A;  2IO3 B;  1YX5 B;  3I3T B;  4RM9 A;  2O2V A;  2NCN A;  1E8Y A;  2Y5B B;  1IPG A;  4PYZ A;  5KHO A;  3VTV A;  3VXW A;  2CU1 A;  3K9O B;  2DZK A;  4FLH A;  2JZ3 B;  1GC7 A;  4A20 A;  2I1J A;  2MLB A;  1RLF A;  2AL3 A;  1WY8 A;  1V80 A;  1Y8R C;  4GDK B;  1UBI A;  3V60 A;  1UH6 A;  3A1Q B;  3V61 A;  2FCM A;  2N4F A;  3JVZ X;  2K25 A;  2K39 A;  4HWI B;  1VD2 A;  3KH0 A;  2KX3 A;  4AOF A;  1C3T A;  2N1V A;  4IW0 A;  2KLG A;  4IM3 A;  4IWQ A;  5CHW A;  1ZW7 A;  4IM2 A;  5DCN A;  4HK2 A;  4FHJ A;  1E90 A;  1J0G A;  1FXT B;  2DEN B;  2LRU A;  3WIM A;  4DXA B;  2DYO A;  2KDI A;  1XD3 B;  1WE6 A;  4JL9 A;  1WI0 A;  3APC A;  4HXD A;  3H6N A;  3V6C B;  4OVU A;  2FCN A;  2GBN A;  3CST A;  3IHP C;  4AJY B;  3PT2 B;  1I42 A;  1Q5W B;  1HE8 A;  2I1K A;  2KOX A;  3VUW A;  4HCP B;  5JHA A;  4KZC A;  4LJO B;  3X0W A;  3ML8 A;  4DDG D;  3MHS D;  3ZO5 B;  5CX3 A;  2D2Q A;  3A9K B;  1TGZ B;  1WJN A;  2JT4 B;  2XK5 B;  3CF6 E;  4BKG A;  4ICU A;  1WGR A;  2RD0 A;  3IG3 A;  3ZDM C;  2CKH B;  2IY1 B;  3ZUN A;  2ZEQ A;  3JW0 X;  1GUA B;  4I6L B;  1EF1 A;  3WAL A;  4DBG A;  3UQB A;  3OJ4 B;  2PJH A;  5J17 A;  2N9X A;  3RT3 B;  2R2O A;  3RCZ A;  4II3 B;  3QJZ A;  4ANX A;  1WGY A;  2KZR A;  2CR5 A;  4CHK A;  3RYT A;  1V49 A;  5JZE B;  4CO7 A;  2LRW A;  5CTR C;  2LVQ A;  4K7W A;  2L7R A;  2IZV B;  2C7H A;  1XT9 B;  4FJY A;  2MBO A;  2BKR B;  2J0M A;  3NOB A;  4JLC A;  3UIP B;  3JYU A;  2GBJ A;  3KYC D;  4WJN A;  2FAZ A;  4RM8 A;  1H8C A;  3QIJ A;  3MJW A;  4A3O A;  2KXJ A;  1E7U A;  3H7P A;  3RUL A;  5J2R A;  1Z5S B;  2V4L A;  1SIF A;  1VCB A;  4NJ7 A;  3HM3 A;  2DX5 B;  3ZW3 A;  1Z2M A;  3A4S C;  2GMI C;  2XK5 A;  1GG3 A;  3GZN I;  2KFJ A;  3LJ3 A;  4G3X B;  4K1R B;  5LXI B;  2IYD B;  2LZ6 A;  2L0F A;  3VQI A;  2JZZ A;  4PYU A;  1WF9 A;  1RFA A;  2REX A;  1QZE A;  2RPQ A;  3KUC B;  1NBF C;  3H7S A;  3WAP A;  1WZ0 A;  2MBQ A;  1S1Q B;  1Q0W B;  1UD7 A;  2LXC A;  2NR2 A;  3PHW B;  3N30 A;  3W1S C;  3T9L A;  4TQ0 A;  4W9C A;  2FCS A;  4ICV A;  1ISN A;  1F9J A;  5JHB A;  1EF5 A;  3B08 A;  4WQO B;  1WGH A;  1NDD A;  2LJ5 A;  3QAQ A;  4YL8 A;  4DHZ E;  1WX7 A;  1G6J A;  3NHE B;  1GC6 A;  3S2A A;  4GU2 A;  1T0Y A;  2JRI B;  1J8C A;  3L08 A;  1WR6 E;  2HTH A;  3P2B A;  3L10 B;  3PS6 A;  3VHT C;  1WGD A;  1V9J A;  5DPT A;  2KDF B;  2XEW A;  4XX5 A;  2FID A;  3A9J A;  2MW5 A;  4AJW A;  2NBV B;  4OVV A;  1CMX B;  2KTF A;  1WXM A;  4MGK E;  2FIF A;  5LXH A;  2MQJ A;  3UGB B;  1E8Z A;  5CHF A;  5D6J B;  2KNB A;  2HD5 B;  1ZGU B;  5GMV A;  2VRR B;  2MWS B;  2KAN A;  2MBE A;  2WX0 A;  4GMV A;  2GBM A;  3IFW B;  3JSV A;  1LM8 B;  1SE9 A;  3EC8 A;  4HVB A;  1A5R A;  3H9D A;  1RRB A;  3DPD A;  4K7U A;  3RZF A;  4B95 A;  4AWJ A;  1ZKH A;  4NNJ B;  4BKS D;  4WWO A;  2JUO A;  1WH3 A;  3WAN A;  5C1Z A;  3HHM A;  2A4Z A;  3GOE A;  2WX1 A;  1V6E A;  4ASW C;  5AEK B;  4MSM B;  5DPW A;  3TJP A;  3ZNG C;  4G50 A;  4WWN A;  2KJ6 A;  3PRE A;  3SU8 X;  2N9E B;  1V5T A;  2K6D B;  4MM3 A;  1P0R A;  3B1L X;  5AZF A;  5G55 A;  1NI2 A;  1EUV B;  2C9W B;  3L16 A;  3RZW C;  3A1Q A;  3H1U A;  1LXD A;  4EZK A;  2IY0 B;  2FNJ B;  1LQB A;  2O6V D;  3ENE A;  3SDL C;  3PGE A;  2RR9 A;  3Q3F A;  2RSU A;  4KV2 A;  4MJS B;  2K8H A;  2Z0D B;  3HM6 X;  3V6E B;  4DWF A;  4EZL A;  3UQA A;  3U8Z A;  3CSF A;  1E7V A;  2NPT B;  1WXS A;  3JSV B;  1PQS A;  1YX6 B;  2KKC A;  2K8C A;  2MRP A;  1JRU A;  4IM0 A;  4RMA A;  4B9K A;  2KWC A;  4K81 A;  4WJQ A;  4TQ1 A;  2PPH A;  3QQ8 B;  3PPA A;  3IBE A;  1WZ3 A;  4EUT A;  5E6N A;  2W9N A;  2MP2 B;  1WM3 A;  1WMH A;  1J19 A;  3LDZ E;  3NY5 A;  2C7N B;  4E71 A;  2OJR A;  2D10 A;  2DYM A;  4W9L A;  2HJ8 A;  2WYQ A;  4DDI D;  2IO2 B;  2MX2 A;  2NBW B;  3A4R A;  4W9I A;  3VDZ A;  4KDI C;  2KTR B;  4GOC A;  4NQL B;  5EDS A;  4MEM A;  3T8M A;  3DBL I;  5IA7 A;  3VH3 B;  2GBK A;  2KFK A;  1WFY A;  4PS8 A;  2K1F A;  3M95 A;  4FN2 A;  3KW5 B;  4KSK C;  4NAW B;  4IUM B;  1WXV A;  2RGF A;  4FUL A;  4ZRK A;  4XZ4 A;  3DVG X;  5D7G A;  1U4A A;  4II2 B;  3ECI A;  3ZLZ A;  5JH5 C;  2XBB C;  4W9K A;  4DHZ B;  1UBQ A;  4GSW A;  2LI5 A;  2BWF A;  4AP4 C;  2D11 A;  4KIK A;  1WJ4 A;  4GGQ A;  2ZCB A;  4G11 A;  1GJZ A;  1YD8 U;  4LDT B;  3PLV A;  3OJ3 A;  1V81 A;  3TIX A;  3BY4 B;  4GDK A;  2BGF A;  5L95 C;  2V1Y A;  2JPH A;  2M4N A;  4EFO A;  4J6I A;  4A3P A;  4MH0 E;  3M62 B;  4F1S A;  1E8X A;  2CHX A;  1V2Y A;  2L76 A;  4IWO A;  4M8M A;  2BYV E;  3DVN U;  3ZDT A;  4FJZ A;  1XQQ A;  3D32 A;  2LGY A;  1Q1O A;  3PTF C;  4HPL B;  3VAW A;  3ZTC A;  5KHQ A;  1WMH B;  2O2V B;  2AWT A;  4BBN C;  3ZIM A;  2L8J A;  1H4R A;  4EZJ A;  2LXA A;  3CMM B;  3DBS A;  1E8W A;  2V3S A;  4ZDV A;  4NQK E;  1C1Y B;  2LVO A;  2KTR A;  2KWV B;  3PRZ A;  4BFR A;  3DBH I;  3KVF B;  4FHK A;  3U7D A;  2MCN B;  3VH4 B;  2DAJ A;  4CYE A;  3N32 A;  2M1M A;  3HIZ A;  4FA6 A;  2NS5 A;  3Q3J A;  2IO1 B;  2DZI A;  3W1S A;  2UWQ A;  2J7Q B;  2J0J A;  3O65 B;  2G4S A;  1L7Y A;  1V5O A;  2JVC A;  5DPR A;  1WM2 A;  4FAD A;  4KIK B;  3EFU A;  2QHO A;  2O6V A;  3QK0 A;  3ZKJ C;  2LGD A;  4I6N B;  3VUY A;  2MBH A;  3PV1 A;  4G0N B;  2KC2 A;  5TR5 A;  4GIV A;  5IAA C;  3BIN A;  4ZRI A;  3HK0 A;  2LGX A;  2ZNV B;  3TL5 A;  1WE7 A;  4EOY A;  4NAW A;  2Z59 B;  2G4D B;  2AYO B;  1TBE A;  1BT0 A;  1UGM A;  3DVG Y;  3M3J A;  3W1Y A;  2BF8 B;  5J18 A;  4MGY E;  2JY6 A;  4LJP B;  2KQ7 A;  5LLI A;  4MSQ B;  2CHZ A;  5FR6 A;  1WX9 A;  1WJU A;  3NZS A;  4NJ6 A;  4N9F 4;  5AZG A;  1M94 A;  4ANV A;  4FBJ B;  3KUZ A;  4GN1 A;  3PSE B;  2NBU A;  1KOT A;  2A5U A;  3L0W B;  1UEL A;  2JXX A;  2G3Q B;  3ML9 A;  2R2Q A;  1D3Z A;  1WXA A;  4WJO A;  3RD2 A;  2AL6 A;  4W9D A;  2IO0 B;  2WWZ A;  2DZJ A;  4TUU A;  5D94 A;  4EEW A;  4M0W B;  2YLM A;  4P7I A;  4B6W A;  1WIA A;  3TMP B;  1K8R B;  2CS4 A;  2O6V B;  4E3C A;  3M63 B;  2ZVN A;  2KDE B;  4HJK A;  4HDO A;  4HCN B;  2D3G A;  2ZZP B;  3VTU A;  2B3A A;  2KDB A;  2Z0E B;  3ZVV A;  4BOZ B;  4M8N A;  2PEA A;  4IC7 B;  4MGI E;  4WWP A;  2K6Q A;  2J0K A;  3QC8 B;  5C23 A;  2CHW A;  4FJV B;  4HLE A;  3B0A A;  3IVF A;  4JIO U;  4WAA A;  3VFK A;  5BO4 B;  3H7P B;  1WYW B;  2JF5 A;  3PHX B;  4EKU A;  3OAW A;  4ANU A;  2BWE S;  2DZM A;  3UIN B;  3NS8 A;  2KJH B;  4MDK E;  3WA0 A;  1YQB A;  2GBR A;  1OEY A;  2L05 A;  3ZRC A;  4PS3 A;  2OOB B;  3PRM B;  3QAR A;  4MGZ E;  2KO3 A;  2C5L C;  2D07 B;  4W9J A;  2KQS A;  1E5W A;  1TTN A;  3QHT A;  2KHW B;  2ZVO A;  2ZPN A;  3TCA A;  2KJR A;  3RUI B;  1RAX A;  2JWZ A;  2MSE D;  2NPT A;  3A9J B;  3A9K A;  3DOW A;  4HPM B;  3R3M A;  2HE7 A;  3ZTD A;  2EKE C;  3L54 A;  1TZ1 A;  1MG8 A;  4DHJ D;  1SGH A;  4URK A;  5E6P A;  2KC1 A;  4BOS C;  2ASQ A;  2IBI B;  3VUX A;  3UF8 A;  5L83 A;  1IYF A;  5AZH A;  2M0X A;  2KWU B;  5D2M B;  2L0T A;  2FCQ A;  3DBR I;  1OGW A;  4GDL B;  2LD9 A;  4KDL B;  3ALB A;  1X1M A;  1AAR A;  3AI5 A;  2BYF A;  2WDT B;  2EMT A;  4PS7 A;  4LCD E;  2ZCC A;  2PE6 B;  2N7E A;  4TV3 A;  3WAO A;  5G2N A;  1EO6 A;  3EHV A;  3QA8 A;  4GXB A;  4HDQ A;  2G45 B;  5E6O A;  1LFD A;  1I35 A;  2DAF A;  2BPS A;  2N1W A;  3L13 A;  5CHV C;  4IWP A;  2N7D A;  4BBN F;  3PVL A;  4W9G A;  2LUE A;  1P98 A;  2M17 A;  4LDT D;  4DHJ B;  2BYE A;  3QCA A;  1WGG A;  2EMS A;  2DHZ A;  3DVN V;  3U30 A;  1IP9 A;  1YIW A;  2ZNV C;  3PRP B;  1WX8 A;  4XC2 A;  2L3Z A;  3N3K B;  4W9E A;  2KK8 A;  2YVC A;  2LVP A;  4KSL C;  4BVU C;  3EEC A;  1L2N A;  4F8C B;  3AU5 A;  1P1A A;  4KVG B;  4MJS A;  4X57 B;  1WR1 A;  3ONS A;  3A33 B;  1R4M I;  3C0R B;  2DYB A;  3K9P B;  4GDL A;  1P3Q U;  3APD A;  3DDC B;  1WRD B;  3VTW A;  3WAM A;  1S3S G;  3VVW B; 
#chains in the Genus database with same CATH topology
 4JGH B;  4K7S A;  1QLB B;  4WQM A;  2MEK A;  2KVZ A;  1RWS A;  2LEK A;  2IGG A;  1PYW D;  2KFK B;  3LB8 C;  4JQW C;  1ENF A;  1SE2 A;  1MG4 A;  3R7R A;  2HTM E;  1V8C A;  4AUQ C;  3DCG A;  1TYG B;  2WS3 B;  1ET9 A;  1NEN B;  1FD6 A;  1K52 A;  3UIO B;  3Q69 A;  1UUP A;  5HFY A;  3APF A;  1V86 A;  3R2T A;  3AXC A;  2KN5 A;  4OZB A;  3SHQ A;  1KLV A;  4BKS A;  1OTR B;  3Q3N C;  1ZUD 2;  4IG7 B;  2GI9 A;  1YJ1 A;  1F52 A;  1KF6 B;  1YX5 B;  2Y5B B;  2GB1 A;  4PYZ A;  2CJN A;  3VXW A;  2JZ3 B;  2BYT A;  4A20 A;  2AL3 A;  1V80 A;  3L4P A;  3P1M A;  1UH6 A;  3PZ7 A;  2FCM A;  2K25 A;  4D2K A;  2WXP A;  2DBY A;  2KLG A;  3BWU D;  4IWQ A;  4LK0 M;  4HK2 A;  4JL9 A;  1XD3 B;  1WE6 A;  2I38 A;  1WI0 A;  3RFZ B;  4HXD A;  2FUG 1;  4YTP B;  4OVU A;  3CST A;  2WU5 B;  4HKZ E;  2KOX A;  2I1K A;  4KZC A;  1VJK A;  3MHS D;  3AE3 B;  3AE5 B;  1FMA D;  3CF6 E;  4BKG A;  2IY1 B;  4RCO A;  2OJW A;  3JW0 X;  4I6L B;  3WAL A;  2PJH A;  5C2T B;  2ON8 A;  4ANX A;  1FFV A;  4XE0 A;  2KZR A;  2CR5 A;  1JAL A;  4M0W A;  3RYT A;  1R4M B;  4RGT A;  2C7H A;  1Y56 A;  2ACZ B;  4FJY A;  4YTN B;  4JLC A;  1YQ3 B;  4RM8 A;  5IOI A;  4LNI A;  3QIJ A;  3MJW A;  4A3O A;  4MH8 A;  5J2R A;  1Z5S B;  2HJ1 A;  2LFI A;  1Z2M A;  3A4S C;  4N58 A;  2QIL A;  4K1R B;  3AH7 A;  3PZ8 A;  1Q10 A;  1WF9 A;  2WXG A;  2WLB A;  4A6Q A;  1NBF C;  3WAP A;  2KMM A;  1Q0W B;  1UD7 A;  2LXC A;  3HVD A;  3N30 A;  4TQ0 A;  1IBX A;  4W9C A;  1TJE A;  4ZRQ A;  1ISN A;  1F9J A;  1I4G A;  1EF5 A;  3B08 A;  2LJ5 A;  3Q6B A;  1L0X B;  1G6J A;  1ZPS A;  3S2A A;  1TS3 A;  1T0Y A;  1WR6 E;  3L10 B;  1FIQ A;  1V9J A;  5G5G A;  5DPT A;  1YOV B;  2FID A;  2KTF A;  4A8X C;  5LNK 1;  2FIF A;  1C76 A;  5LXH A;  1DOI A;  3U52 E;  2KNB A;  2Q5W D;  3CWI A;  1C4A A;  2VRR B;  5GMV A;  3IFW B;  3JSV A;  4M02 A;  4BKS D;  3HHM A;  2WX1 A;  4ASW C;  1SJE D;  1TS2 A;  3RN9 C;  5IO9 A;  5FKA C;  2K6D B;  1R4N B;  2L83 A;  3B1L X;  5G55 A;  3P4R B;  5IP4 D;  4PK1 A;  1EUV B;  3BYY B;  2LGS A;  3A1Q A;  3BVZ A;  2FNJ B;  2O6V D;  3SDL C;  3PGE A;  3RNA C;  3ZJV A;  5I4D A;  3V6E B;  4EZL A;  4DWF A;  2K8H A;  2KT7 A;  3NRZ A;  3Q8A A;  1ZXI A;  1GB1 A;  2MRP A;  4B9K A;  3KQ4 A;  4RMA A;  3QQ8 B;  3AE2 B;  4BZA A;  3BK1 A;  5E6N A;  2W9N A;  1N60 A;  1J19 A;  3TSS A;  3A4R A;  3VR9 B;  4MM3 B;  5IA7 A;  3DBL I;  2KFK A;  3EUB 2;  5AUK A;  1WFY A;  4FN2 A;  5MPO A;  4KSK C;  1M4V A;  1U4A A;  1XCT L;  4II2 B;  5E6J A;  2XBB C;  4W9K A;  5JH5 C;  2D11 A;  4HEA 1;  2KWD A;  2IGD A;  4YTM B;  2M4N A;  4J6I A;  3DBR B;  4A3P A;  2ZW1 A;  3M62 B;  1I4H A;  2MJ3 A;  2CHX A;  4M8M A;  2BYV E;  2BB6 A;  5KHQ A;  4BBN C;  1H4R A;  4EZJ A;  3CMM B;  4OZC A;  4ZDV A;  1E8W A;  4NQK E;  1UGJ A;  3DBH I;  4ZOH C;  4CYE A;  3U7D A;  2DAJ A;  2M1M A;  1JWB D;  2DZI A;  2UWQ A;  1T3Q A;  3TUO A;  1TT5 B;  5DPR A;  1E7P B;  2BB5 A;  4I6N B;  1SXT A;  3VUY A;  5TR5 A;  5IAA C;  4ZRI A;  3TL5 A;  3ZXV A;  2ZNV B;  1TY2 A;  3WCQ A;  2JYE A;  1N5X A;  4HRS A;  2Z59 B;  3DVG Y;  2MJD A;  1VRA B;  2BS2 B;  2CHZ A;  1WX9 A;  2OED A;  5AZG A;  2DNF A;  4FBJ B;  1L6V A;  1NYR A;  2J53 A;  2R2Q A;  1WXA A;  3RD2 A;  4A55 A;  2WWZ A;  4M0W B;  4RFB A;  5BMI A;  1WIA A;  1K8R B;  2CS4 A;  1HZ5 A;  2QEJ C;  4HJK A;  1IUE A;  2D3G A;  3N1X C;  1OQQ A;  4M8N A;  2WXF A;  4IC7 B;  2K6Q A;  3RNC C;  3QC8 B;  2CHW A;  4HLE A;  2M0A A;  3IVF A;  3VFK A;  1OFF A;  3OAW A;  3UIN B;  5BMH A;  4MDK E;  1YQB A;  2RMM A;  4P1B C;  1OEY A;  4PS3 A;  3PRM B;  2D07 B;  4W9J A;  2KQS A;  3QHT A;  2ZPN A;  2WXK A;  2KJR A;  3RUI B;  2JWZ A;  2G9H D;  3DOW A;  1T0S C;  2KC1 A;  2KN4 A;  4BOS C;  1TKE A;  3TEY A;  1IYF A;  2M0X A;  4KDL B;  2LD9 A;  3ALB A;  4MAC A;  4N59 A;  1UWX A;  1QKZ A;  4LCD E;  2ZCC A;  2PE6 B;  2N7E A;  2LMC A;  3EHV A;  3QA8 A;  2KAC A;  1EM7 A;  5T8I A;  4LDT D;  2BYE A;  3RNB C;  1WGG A;  1FCL A;  2DHZ A;  1SEB D;  1WRI A;  1C77 A;  1LO5 D;  4XDC A;  3AE6 B;  4KSL C;  3FC4 A;  2Y5P A;  1P1A A;  4MJS A;  1R4M I;  1YJJ A;  3VTW A;  3WAM A;  4TKN A;  3AU4 A;  4F7Z A;  2MBB B;  2MJE A;  3W5U B;  2LAS A;  3QWZ B;  2K8B A;  1P9D U;  2V9H A;  2KDM A;  1OEY J;  3DHI C;  1OQY A;  2KD0 A;  1AWD A;  4GB9 A;  2N9P C;  3X23 A;  3U7Z A;  4C4V B;  3ZNZ B;  2UYZ B;  5DPS A;  5EE3 A;  3GE8 C;  2PTL A;  2NTS A;  1YN5 A;  1FRD A;  3KYD D;  3R7Q A;  2ZPY A;  2C60 A;  1QQR A;  3H8H A;  1DOY A;  1N61 A;  4BAX A;  2WDV B;  4XYC A;  2L00 B;  1AYF A;  2AEH A;  3R66 C;  2JZP A;  3ZRF A;  4USA A;  3MHZ A;  3U2S C;  3ETR A;  2CU1 A;  4FLH A;  2MLB A;  5EE0 A;  3V60 A;  1UBI A;  5FR3 A;  1K53 A;  2UU7 A;  2RDH A;  1QIL A;  1MHX A;  1MI0 A;  2WXJ A;  2N1V A;  5CHW A;  4IM2 A;  4KX6 B;  2K0P A;  1J0G A;  3T3O A;  2KDI A;  1JML A;  4OW0 A;  1FEH A;  1P7F A;  2R61 A;  3APC A;  3H6N A;  1V1P A;  1ET6 A;  2FCN A;  1Q5W B;  1HE8 A;  3IT6 B;  2AQ3 B;  4DDG D;  1WJN A;  4KGR A;  3C19 A;  3ZJU A;  3IG3 A;  1TS4 A;  1FNU A;  1GUA B;  1HZ6 A;  1K50 A;  3AEE B;  2WQY B;  2R2O A;  4II3 B;  3QJZ A;  1WGY A;  2J52 A;  1A70 A;  3DWM A;  1V49 A;  4ZYS A;  5CTR C;  2L7R A;  2IZV B;  2W55 A;  3JYU A;  1FCC C;  2GBJ A;  3KYC D;  1H8C A;  1FFU A;  2KXJ A;  2BS3 B;  1E7U A;  1DGJ A;  1SIF A;  1VCB A;  2J4X A;  4NJ7 A;  2DX5 B;  4AQ7 A;  3ZW3 A;  1JCK B;  2XK5 A;  4G3X B;  2IYD B;  3AED B;  1N6Z A;  2W54 A;  3IT4 B;  3SR6 A;  4JE3 B;  3ABV B;  1UNS A;  1QZE A;  5EE1 A;  1TKY A;  5JHB A;  4ICV A;  4L2Y A;  4DHZ E;  1D5M C;  4GU2 A;  3RI7 C;  1J8C A;  3L08 A;  3GP7 A;  3P2B A;  3VHT C;  1J7C A;  2ONQ A;  2WGS A;  2BT6 A;  1I7H A;  2PIA A;  4B0E A;  5IN7 A;  5CHF A;  5D6J B;  2HD5 B;  1VR9 A;  2MWS B;  2KAN A;  4DXG A;  2WX0 A;  4GMV A;  2GBM A;  5C3J B;  4P16 A;  2CU3 A;  3AEG B;  2QDF A;  3EC8 A;  2H89 B;  1IGD A;  1N62 A;  1SIJ A;  4WWO A;  2JUO A;  5C1Z A;  3I9V 1;  1V6E A;  5AEK B;  4S0R A;  5DPW A;  3TJP A;  3MFG A;  3ZNG C;  4A9A A;  1HA5 A;  3PRE A;  3SU8 X;  4MM3 A;  5AZF A;  3MJ5 A;  3MC9 A;  1NI2 A;  2C9W B;  3MC8 A;  3RZW C;  1LXD A;  4US9 A;  1KFY B;  2WXL A;  2LJI A;  4KV2 A;  2LUM A;  4MJS B;  3UQA A;  1JWM D;  1E7V A;  3NJT A;  2NPT B;  4CQN A;  1PFD A;  2IGH A;  2KKC A;  2K8C A;  1XO3 A;  4IM0 A;  1DOX A;  4WJQ A;  4K81 A;  4A90 A;  2PPH A;  2WU2 B;  1WZ3 A;  4EUT A;  5BYS A;  3LDZ E;  3J9C A;  3NY5 A;  3N1Y C;  2HJ8 A;  2WYQ A;  2MX2 A;  3VDZ A;  4LTU A;  5EDS A;  4MEM A;  2AQ1 B;  1JWA D;  4PS8 A;  3TEX A;  5TSS A;  2MH7 A;  2RGF A;  4ZRK A;  3ZLZ A;  2WXQ A;  2LI5 A;  3SFD B;  4LDT B;  3PLV A;  3NZ3 A;  3OJ3 A;  1V81 A;  4GDK A;  2BGF A;  1MPE A;  2V1Y A;  1QT9 A;  1C79 A;  3AM9 A;  1E8X A;  1V2Y A;  3MP9 A;  4IWO A;  5EE9 A;  1YNT E;  1J7A A;  3DVN U;  4FJZ A;  4C7Z A;  1XQQ A;  3Q3M C;  4HPL B;  1Q1O A;  4H2A A;  3ZTC A;  1WMH B;  4LNO A;  2AWT A;  2ZW0 A;  3AN1 A;  3R8B A;  1NEK B;  1C1Y B;  2KTR A;  1C9F A;  3Q8C A;  4M01 A;  2FBW B;  3KVF B;  3VH4 B;  2NS5 A;  2IO1 B;  3NVZ A;  3W1S A;  1EWY C;  4MT5 A;  2JVC A;  1WM2 A;  2BS4 B;  4KIK B;  3ZKJ C;  3AEC B;  2MBH A;  4G0N B;  1XF5 L;  3BIN A;  1ZDV A;  4P6V F;  4NAW A;  2G4D B;  2BW2 A;  2L52 A;  2AYO B;  1TBE A;  1BT0 A;  2DLB A;  1CQV A;  5FK9 C;  1WJU A;  4NJ6 A;  4XDD A;  2JWU A;  4ANV A;  1JQ4 A;  1GAQ B;  4GN1 A;  1UEL A;  2JXX A;  2G3Q B;  3ML9 A;  4ARI A;  2JYT A;  4WJO A;  5AUI A;  1KLU D;  2AL6 A;  3P4P B;  4EEW A;  2PKO A;  3FKY A;  2O6V B;  3T3N A;  1BXT A;  4ACF A;  2ZVN A;  2KDE B;  3VTU A;  2B3A A;  1C4C A;  4MGI E;  4WWP A;  2J0K A;  2E6X A;  4JIO U;  1TIF A;  4WAA A;  3N9Y C;  1T0Q C;  3BII D;  1B1Z A;  2GBR A;  3U4E G;  2K9X A;  3KWV A;  2OOB B;  4KKJ A;  2K5P A;  1E5W A;  3TCA A;  2KHW B;  3ZXR A;  4HPP A;  2EEL A;  1RAX A;  3A9J B;  3R3M A;  1TZ1 A;  1T5X D;  3BK2 A;  2JX5 A;  2IBI B;  1PGB A;  5L83 A;  5AZH A;  1VLB A;  2L0T A;  3DBR I;  1OGW A;  2IJ0 A;  1FNV A;  1X1M A;  1L4Z B;  3AI5 A;  1J7B A;  5HHD G;  4C00 A;  2EMT A;  4YSY B;  2M56 B;  2WDQ B;  4HDQ A;  5IKC M;  2N1W A;  5H8Y E;  3ZJT A;  2MHJ A;  4JPS A;  3NUH B;  3UI3 A;  1ZE3 D;  2LUE A;  2M17 A;  1D5Z C;  2W82 A;  3DVN V;  2D3C A;  1YIW A;  2L3Z A;  4W9E A;  3EFC A;  2LVP A;  4BVU C;  3TEW A;  3EEC A;  3AU5 A;  1YQ4 B;  1WR1 A;  2Y3A A;  3C0R B;  2LHD A;  2N9L A;  1P3Q U;  1QOA A;  2Z8L A;  1S3S G;  2KMC A;  1VDV A;  4W9H A;  1GNU A;  2KVR A;  4W9F A;  1FO4 A;  2MP2 A;  4L1B A;  2GOW A;  2LWP A;  1JW9 D;  4M00 A;  2Y5C A;  4DK5 A;  1D5X C;  3IAM 1;  1ZOY B;  4UDU C;  3ZNI D;  1R4N I;  2WXN A;  3L17 A;  2PLP A;  3P42 A;  2KX0 A;  2WXH A;  1UZX B;  5HI1 A;  2CJO A;  1QF6 A;  1QOF A;  4ZYN A;  2FUH B;  1KJT A;  2BKF A;  2KMA A;  4KGS A;  2M8S A;  3SD5 A;  3B2F A;  2ZJD A;  2PE9 A;  2XN9 C;  3OLM D;  2BBC A;  2IO3 B;  4RM9 A;  3RNE C;  3MC0 B;  2NCN A;  1IGC A;  1SE4 A;  1YJI A;  5KHO A;  1XLO A;  3VTV A;  2LGI A;  5BYQ A;  1RLF A;  1WY8 A;  1Y8R C;  1STE A;  4GDK B;  3A1Q B;  2N4F A;  1QOB A;  2SEB D;  2K39 A;  4HWI B;  1VD2 A;  4IM3 A;  3FAH A;  3NVY A;  3VRB B;  4FHJ A;  1I4Q A;  2DEN B;  2J42 A;  2LRU A;  2PVG C;  2QJL A;  2DYO A;  3WIM A;  3Q2A C;  2VZK B;  3V6C B;  3IHP C;  1CZP A;  5JHA A;  4LJO B;  2KYW A;  3X0W A;  2SAK A;  3ZO5 B;  1C4P A;  2D2Q A;  3A9K B;  1TGZ B;  4RGN A;  1SB3 C;  4US8 A;  2XK5 B;  1E10 A;  2RD0 A;  3ZDM C;  2CKH B;  4JX1 C;  1GB4 A;  1EF1 A;  4OHJ A;  3DWG C;  3UQB A;  3OJ4 B;  5J17 A;  2QCZ A;  1HTQ A;  2JQR B;  2BVC A;  2RPV A;  2LRW A;  3OWE B;  4K7W A;  3BVG A;  3C8Y A;  1XT9 B;  3UIP B;  3NOB A;  4WUR A;  4WJN A;  2FAZ A;  2LHE A;  3BVM A;  1FM0 D;  2I2Y A;  2BTE A;  3HM3 A;  4Q2J A;  2VH2 A;  1PGA A;  2GMI C;  2B76 B;  3GZN I;  3LJ3 A;  1MJD A;  5LXI B;  4C4V A;  2JZZ A;  1SJH D;  3RPF C;  2V3N A;  4AS1 A;  2REX A;  1N5W A;  3KUC B;  3NS1 A;  3H7S A;  4XWT A;  2HDE A;  2MBQ A;  2NR2 A;  2GRI A;  1WSP A;  3T9L A;  2FCS A;  1AW7 A;  3FIL A;  1NDD A;  3QAQ A;  4YL8 A;  1TZO A;  1EU3 A;  3E56 A;  1E9M A;  1WX7 A;  2W3R A;  3NHE B;  2KQ4 X;  3PS6 A;  1WGD A;  2KDF B;  4S17 A;  4XX5 A;  3A9J A;  2BQQ A;  2MW5 A;  4DQO C;  4AJW A;  4YWG G;  4RGM A;  1EWC A;  1WXM A;  3AEF B;  3UGB B;  2INC C;  1FNW A;  3P4Q B;  3GB1 A;  4HVB A;  1RRB A;  3DPD A;  2INN E;  4AWJ A;  4NNJ B;  1WH3 A;  3WAN A;  3VR8 B;  3AMZ A;  4WH4 A;  3E9S A;  3SFE B;  2V4I B;  4XGA B;  4O1N A;  4G50 A;  4WWN A;  1WGK A;  2N9E B;  1P0R A;  1D6E C;  1PUT A;  2TSS A;  3H1U A;  4EZK A;  2IY0 B;  1L6U A;  3ENE A;  4DXF A;  5GXG B;  2RR9 A;  3Q3F A;  2RSU A;  1SSN A;  3HM6 X;  3CSF A;  1WXS A;  1PQS A;  4QAY A;  1JRU A;  2KWC A;  3R2I A;  3PPA A;  5BYR A;  2MP2 B;  1WMH A;  4E71 A;  1BML C;  3GE3 C;  4XWW A;  4K3B A;  4DDI D;  1XLP A;  2NBW B;  1XLN A;  4W9I A;  2KTR B;  4GOC A;  4NQL B;  1FXA A;  1VZ7 A;  3ZQ4 A;  3V05 A;  2K1F A;  3M95 A;  4XZ4 A;  5D7G A;  1PDX A;  3ECI A;  4DHZ B;  2BWF A;  4KIK A;  1WJ4 A;  4GGQ A;  3URY A;  2ZCB A;  3LXF A;  1YD8 U;  4WIP A;  3TIX A;  3N1Z C;  5L95 C;  2WXM A;  5BMG A;  2JPH A;  4EFO A;  3RNF C;  4YXD B;  2GLS A;  4F1S A;  3I5J C;  1MVK A;  3ZDT A;  3D32 A;  3PTF C;  1EU4 A;  3ZIM A;  2L8J A;  2LXA A;  2V3S A;  4BFR A;  1AN8 A;  4LNN A;  1ZXH A;  2MCN B;  3HIZ A;  4FA6 A;  3BZD B;  2WXI A;  2WXR A;  2J7Q B;  3HUI A;  2G4S A;  1L7Y A;  1V5O A;  4FAD A;  1IBX B;  2O6V A;  2OHF A;  2LGD A;  4GIV A;  2LGX A;  3N20 C;  4EOY A;  1UGM A;  1ACC A;  3W1Y A;  2BF8 B;  5J18 A;  1RFK A;  4MGY E;  2JY6 A;  4LJP B;  2KQ7 A;  5LLI A;  4MSQ B;  3NZS A;  4N9F 4;  1M94 A;  2JSV X;  3PSE B;  1KOT A;  3AE4 B;  3L0W B;  5HG2 A;  4ZHP A;  1D3Z A;  4W9D A;  2DZJ A;  4TUU A;  3ZYY X;  2YLM A;  4E3C A;  1WWT A;  3V3X A;  4HDO A;  1HTO A;  2ZZP B;  3ZVV A;  1F0Z A;  2Z0E B;  5D3I B;  3SEB A;  2PEA A;  5C23 A;  5BO4 B;  1WYW B;  4C56 C;  4EKU A;  4LLG M;  1E0Z A;  1KH0 A;  1ESF A;  3NS8 A;  2KJH B;  2E3T A;  4JWS C;  4IKG A;  2KAJ A;  2V0G A;  1T6B X;  4YSZ B;  3QAR A;  2KO3 A;  2C5L C;  1I4R A;  2PMV A;  2JU6 X;  1VZ8 A;  1MG8 A;  2IDY A;  4URK A;  1SBB B;  3VUX A;  3UF8 A;  4YT0 B;  2FCQ A;  1NYQ A;  3CIR B;  4OVZ A;  4PS7 A;  4K3C A;  1EO6 A;  2G45 B;  1V1O A;  2BPS A;  2L1A A;  1E6E B;  1V97 A;  5CHV C;  2VH1 A;  4W9G A;  1P98 A;  4DHJ B;  4HRO A;  3U30 A;  1IP9 A;  1WX8 A;  4XC2 A;  3N3K B;  1P7E A;  2KK8 A;  4F8C B;  1B9R A;  2M19 A;  4KVG B;  2X8X X;  2DWQ A;  3O13 A;  3K9P B;  4GDL A;  3DDC B;  1WRD B;  3DBL B;  4NAW B;  2MA9 B;  2WXO A;  5HKH A;  1CJE A;  1PGX A;  4E74 A;  2AX5 A;  4FXC A;  4RNA A;  3QX1 A;  3KUD B;  3AUL A;  4KZ0 A;  1CK1 A;  4WJP A;  3Q8F A;  3NZU A;  3PLU A;  3B2G A;  2NVU I;  1YN4 A;  1WJ6 A;  3ZNH B;  4I6P A;  3RNG C;  3DQV A;  2C7M B;  3TBL D;  4ANW A;  1YMH E;  2JRH A;  4TSS A;  3V62 A;  3MTN B;  2KLC A;  4MEL A;  1KM7 A;  2QC8 A;  2K22 A;  3PZD A;  3DBH B;  4NY0 A;  4YSX B;  3DHG C;  4NZL B;  4NPN A;  4BKT A;  4ZRJ A;  2H88 B;  3I3T B;  2O2V A;  1KTK A;  3IAS 1;  1E8Y A;  1IPG A;  2WP9 B;  3K9O B;  4NJC A;  2DZK A;  1RYJ A;  1GC7 A;  2I1J A;  2NMQ A;  3AE1 B;  2L32 A;  2PVO D;  1WXQ A;  4C80 A;  3B9J A;  3V61 A;  3JVZ X;  3P4S B;  3KH0 A;  1JRO A;  2KX3 A;  4AOF A;  1C3T A;  4IW0 A;  1ZW7 A;  2IPK D;  5DCN A;  1OQR A;  1E90 A;  1FXT B;  4DXA B;  3RMK C;  4REZ A;  4AJY B;  2GBN A;  1I42 A;  3PT2 B;  4KKI A;  3VUW A;  4HCP B;  1ROE A;  2ICI A;  3ML8 A;  5CX3 A;  1F77 A;  2JT4 B;  1JWS D;  1SF0 A;  4ICU A;  1WGR A;  3ZUN A;  2ZEQ A;  4HKQ A;  2FE8 A;  4DBG A;  2N9X A;  3RT3 B;  1XEE A;  4CHK A;  5JZE B;  4CO7 A;  2LVQ A;  4IOI E;  5D3D A;  1QOG A;  2MBO A;  2BKR B;  2J0M A;  3AE8 B;  4OZA A;  1LGR A;  4RF1 A;  3H7P A;  3RUL A;  2V4L A;  1MFW A;  2WHI A;  3AEB B;  1GG3 A;  2KFJ A;  1F2R I;  2LZ6 A;  1WYG A;  2L0F A;  3VQI A;  1JWU D;  2RDB C;  1N63 A;  4PYU A;  4PT5 A;  4RF0 A;  1RFA A;  2RPQ A;  2IND C;  1TKG A;  1WZ0 A;  4IDI A;  1S1Q B;  3PHW B;  3W1S C;  4WQO B;  1WGH A;  1XLQ A;  1GC6 A;  2JRI B;  1GPX A;  2HTH A;  2N9K A;  2N7J A;  2XEW A;  1VZ6 A;  2WNM A;  4LNF A;  2NBV B;  4OVV A;  1C78 A;  1CMX B;  1KRH A;  2WDR B;  3LYY A;  4MGK E;  2MQJ A;  3Q14 C;  1E8Z A;  1ZGU B;  1L0Y B;  2MBE A;  1LM8 B;  1SE9 A;  4KGT A;  4P1C C;  1A5R A;  3H9D A;  3RZF A;  4K7U A;  4B95 A;  1ZKH A;  1NVI D;  2A4Z A;  2N0S B;  3GOE A;  4MSM B;  4B0M A;  3AE7 B;  2KJ6 A;  1V5T A;  3W9C B;  2D5G A;  2EKI A;  3L16 A;  3Q8B A;  1XCQ L;  3BYT B;  1LQB A;  1NI3 A;  2Z0D B;  3U8Z A;  1TS5 A;  3JSV B;  1YX6 B;  4RGO S;  1HXY D;  4TQ1 A;  4ARC A;  3IBE A;  4WAF A;  1BUI C;  4RH6 A;  1WM3 A;  2C7N B;  2OJR A;  2D10 A;  2DYM A;  4W9L A;  2IO2 B;  2INP E;  4KDI C;  1GOZ A;  5H92 C;  2NTT A;  3T8M A;  3VH3 B;  2GBK A;  3AE9 B;  3AEA B;  3GZN B;  3KW5 B;  3Q8E A;  1WXV A;  4FUL A;  4IUM B;  3DVG X;  1UBQ A;  4GSW A;  4AP4 C;  4G11 A;  1GJZ A;  4ITK A;  3BY4 B;  1DYQ A;  3EA6 A;  3EGR A;  4MH0 E;  3KWL A;  2L76 A;  4TMA B;  3NVW A;  2LGY A;  3FIL B;  3VAW A;  2O2V B;  1ZDX A;  1SE3 A;  3DBS A;  2LVO A;  2KWV B;  3PRZ A;  4L23 A;  1RM6 C;  4FHK A;  2X38 A;  2AQ2 B;  3N32 A;  3W5V B;  4HJG E;  1MHH E;  3Q3J A;  1ZP0 B;  3P63 A;  2J0J A;  3O65 B;  1FRR A;  2D3B A;  3EFU A;  2YEP F;  2QHO A;  3Q3O C;  3QK0 A;  1HEZ E;  3OG5 A;  1UWM A;  1L4D B;  3PV1 A;  3HVZ A;  2KC2 A;  3HK0 A;  1WE7 A;  1D4B A;  3M3J A;  1T0R C;  5FR6 A;  1L0V B;  3I57 A;  3GS2 A;  2YEP B;  1HQR D;  2W3S A;  3KUZ A;  2PW9 A;  2NBU A;  3IXS A;  2A5U A;  1I4X A;  5JXV A;  3NG0 A;  2V3P A;  2IO0 B;  5D94 A;  4GLS C;  4P7I A;  4B6W A;  2RDG A;  3TMP B;  1L5P A;  3M63 B;  4EE2 A;  2QSD A;  4HCN B;  4C7Y A;  2KDB A;  2XNA C;  3VRA B;  4BOZ B;  4FJV B;  3B0A A;  1XXG A;  1F2R C;  3H7P B;  2JF5 A;  3PHX B;  4ANU A;  2BWE S;  2DZM A;  3TEZ A;  2G1E A;  1F1H A;  3WA0 A;  4J3O D;  5G5H A;  2L05 A;  3ZRC A;  1K51 A;  3NVV A;  4MGZ E;  2VZK D;  1TTN A;  2ZVO A;  3PO0 A;  3KLS X;  2NPT A;  2MSE D;  4HPM B;  3A9K A;  1FXI A;  2HE7 A;  3ZTD A;  2EKE C;  3L54 A;  4DHJ D;  1SGH A;  1JRP A;  5E6P A;  3HRD D;  1I4P A;  2ASQ A;  3AV8 A;  4NAM A;  2KWU B;  5D2M B;  4R3D A;  4GDL B;  2QMT A;  3AB5 A;  1AAR A;  2BYF A;  2WDT B;  1V1P B;  4ZHO A;  4TV3 A;  2D3A A;  4JWU C;  3WAO A;  5G2N A;  1YN3 A;  4GXB A;  3W2D A;  5E6O A;  1LFD A;  1I35 A;  2DAF A;  3L13 A;  4IWP A;  2N7D A;  2K3U A;  4N6E B;  4BBN F;  3PVL A;  3QCA A;  2EMS A;  1KLG D;  2ZNV C;  3PRP B;  1R7S A;  2YVC A;  3ZGZ A;  1L2N A;  4ZRP A;  1UF0 A;  3I63 C;  2JXT A;  1FPY A;  4LNK A;  1TY0 A;  2QIE B;  4X57 B;  3ONS A;  3A33 B;  4WWM A;  2DYB A;  3DHH C;  3APD A;  3RCZ A;  3VVW B; 
#chains in the Genus database with same CATH homology
 2KMC A;  2MA9 B;  4TKN A;  3AU4 A;  4F7Z A;  4W9H A;  2MBB B;  1GNU A;  4JGH B;  4K7S A;  5HKH A;  2KVR A;  4W9F A;  4E74 A;  3QX1 A;  2MP2 A;  2GOW A;  2LWP A;  2LAS A;  3KUD B;  3QWZ B;  3AUL A;  4KZ0 A;  2K8B A;  4WJP A;  1P9D U;  4DK5 A;  1OEY J;  3NZU A;  3PLU A;  1OQY A;  2KD0 A;  2KFK B;  4GB9 A;  3X23 A;  2N9P C;  2NVU I;  4JQW C;  3ZNI D;  1WJ6 A;  3R7R A;  3ZNZ B;  2UYZ B;  1R4N I;  5DPS A;  3ZNH B;  4I6P A;  3L17 A;  4AUQ C;  3DCG A;  3DQV A;  2C7M B;  3TBL D;  2KX0 A;  4ANW A;  1UZX B;  2JRH A;  3V62 A;  3MTN B;  2KLC A;  4MEL A;  1KM7 A;  3UIO B;  3KYD D;  3R7Q A;  2ZPY A;  2C60 A;  4ZYN A;  2FUH B;  3APF A;  1V86 A;  3PZD A;  3AXC A;  2KN5 A;  3SHQ A;  4NY0 A;  1KJT A;  1KLV A;  4BKS A;  1OTR B;  2BKF A;  2KMA A;  2L00 B;  2M8S A;  3SD5 A;  2AEH A;  2ZJD A;  3R66 C;  2PE9 A;  3ZRF A;  4IG7 B;  4NPN A;  1YJ1 A;  3OLM D;  4ZRJ A;  4BKT A;  2IO3 B;  1YX5 B;  3I3T B;  4RM9 A;  2O2V A;  2NCN A;  1E8Y A;  2Y5B B;  1IPG A;  4PYZ A;  5KHO A;  3VTV A;  3VXW A;  2CU1 A;  3K9O B;  2DZK A;  4FLH A;  2JZ3 B;  1GC7 A;  4A20 A;  2I1J A;  2MLB A;  1RLF A;  2AL3 A;  1WY8 A;  1V80 A;  1Y8R C;  4GDK B;  1UBI A;  3V60 A;  1UH6 A;  3A1Q B;  3V61 A;  2FCM A;  2N4F A;  3JVZ X;  2K25 A;  2K39 A;  4HWI B;  1VD2 A;  3KH0 A;  2KX3 A;  4AOF A;  1C3T A;  2N1V A;  4IW0 A;  2KLG A;  4IM3 A;  4IWQ A;  5CHW A;  1ZW7 A;  4IM2 A;  5DCN A;  4HK2 A;  4FHJ A;  1E90 A;  1J0G A;  1FXT B;  2DEN B;  2LRU A;  3WIM A;  4DXA B;  2DYO A;  2KDI A;  1XD3 B;  1WE6 A;  4JL9 A;  1WI0 A;  3APC A;  4HXD A;  3H6N A;  3V6C B;  4OVU A;  2FCN A;  2GBN A;  3CST A;  3IHP C;  4AJY B;  3PT2 B;  1I42 A;  1Q5W B;  1HE8 A;  2I1K A;  2KOX A;  3VUW A;  4HCP B;  5JHA A;  4KZC A;  4LJO B;  3X0W A;  3ML8 A;  4DDG D;  3MHS D;  3ZO5 B;  5CX3 A;  2D2Q A;  3A9K B;  1TGZ B;  1WJN A;  2JT4 B;  2XK5 B;  3CF6 E;  4BKG A;  4ICU A;  1WGR A;  2RD0 A;  3IG3 A;  3ZDM C;  2CKH B;  2IY1 B;  3ZUN A;  2ZEQ A;  3JW0 X;  1GUA B;  4I6L B;  1EF1 A;  3WAL A;  4DBG A;  3UQB A;  3OJ4 B;  2PJH A;  5J17 A;  2N9X A;  3RT3 B;  2R2O A;  3RCZ A;  4II3 B;  3QJZ A;  4ANX A;  1WGY A;  2KZR A;  2CR5 A;  4CHK A;  3RYT A;  1V49 A;  5JZE B;  4CO7 A;  2LRW A;  5CTR C;  2LVQ A;  4K7W A;  2L7R A;  2IZV B;  2C7H A;  1XT9 B;  4FJY A;  2MBO A;  2BKR B;  2J0M A;  3NOB A;  4JLC A;  3UIP B;  3JYU A;  2GBJ A;  3KYC D;  4WJN A;  2FAZ A;  4RM8 A;  1H8C A;  3QIJ A;  3MJW A;  4A3O A;  2KXJ A;  1E7U A;  3H7P A;  3RUL A;  5J2R A;  1Z5S B;  2V4L A;  1SIF A;  1VCB A;  4NJ7 A;  3HM3 A;  2DX5 B;  3ZW3 A;  1Z2M A;  3A4S C;  2GMI C;  2XK5 A;  1GG3 A;  3GZN I;  2KFJ A;  3LJ3 A;  4G3X B;  4K1R B;  5LXI B;  2IYD B;  2LZ6 A;  2L0F A;  3VQI A;  2JZZ A;  4PYU A;  1WF9 A;  1RFA A;  2REX A;  1QZE A;  2RPQ A;  3KUC B;  1NBF C;  3H7S A;  3WAP A;  1WZ0 A;  2MBQ A;  1S1Q B;  1Q0W B;  1UD7 A;  2LXC A;  2NR2 A;  3PHW B;  3N30 A;  3W1S C;  3T9L A;  4TQ0 A;  4W9C A;  2FCS A;  4ICV A;  1ISN A;  1F9J A;  5JHB A;  1EF5 A;  3B08 A;  4WQO B;  1WGH A;  1NDD A;  2LJ5 A;  3QAQ A;  4YL8 A;  4DHZ E;  1WX7 A;  1G6J A;  3NHE B;  1GC6 A;  3S2A A;  4GU2 A;  1T0Y A;  2JRI B;  1J8C A;  3L08 A;  1WR6 E;  2HTH A;  3P2B A;  3L10 B;  3PS6 A;  3VHT C;  1WGD A;  1V9J A;  5DPT A;  2KDF B;  2XEW A;  4XX5 A;  2FID A;  3A9J A;  2MW5 A;  4AJW A;  2NBV B;  4OVV A;  1CMX B;  2KTF A;  1WXM A;  4MGK E;  2FIF A;  5LXH A;  2MQJ A;  3UGB B;  1E8Z A;  5CHF A;  5D6J B;  2KNB A;  2HD5 B;  1ZGU B;  5GMV A;  2VRR B;  2MWS B;  2KAN A;  2MBE A;  2WX0 A;  4GMV A;  2GBM A;  3IFW B;  3JSV A;  1LM8 B;  1SE9 A;  3EC8 A;  4HVB A;  1A5R A;  3H9D A;  1RRB A;  3DPD A;  4K7U A;  3RZF A;  4B95 A;  4AWJ A;  1ZKH A;  4NNJ B;  4BKS D;  4WWO A;  2JUO A;  1WH3 A;  3WAN A;  5C1Z A;  3HHM A;  2A4Z A;  3GOE A;  2WX1 A;  1V6E A;  4ASW C;  5AEK B;  4MSM B;  5DPW A;  3TJP A;  3ZNG C;  4G50 A;  4WWN A;  2KJ6 A;  3PRE A;  3SU8 X;  2N9E B;  1V5T A;  2K6D B;  4MM3 A;  1P0R A;  3B1L X;  5AZF A;  5G55 A;  1NI2 A;  1EUV B;  2C9W B;  3L16 A;  3RZW C;  3A1Q A;  3H1U A;  1LXD A;  4EZK A;  2IY0 B;  2FNJ B;  1LQB A;  2O6V D;  3ENE A;  3SDL C;  3PGE A;  2RR9 A;  3Q3F A;  2RSU A;  4KV2 A;  4MJS B;  2K8H A;  2Z0D B;  3HM6 X;  3V6E B;  4DWF A;  4EZL A;  3UQA A;  3U8Z A;  3CSF A;  1E7V A;  2NPT B;  1WXS A;  3JSV B;  1PQS A;  1YX6 B;  2KKC A;  2K8C A;  2MRP A;  1JRU A;  4IM0 A;  4RMA A;  4B9K A;  2KWC A;  4K81 A;  4WJQ A;  4TQ1 A;  2PPH A;  3QQ8 B;  3PPA A;  3IBE A;  1WZ3 A;  4EUT A;  5E6N A;  2W9N A;  2MP2 B;  1WM3 A;  1WMH A;  1J19 A;  3LDZ E;  3NY5 A;  2C7N B;  4E71 A;  2OJR A;  2D10 A;  2DYM A;  4W9L A;  2HJ8 A;  2WYQ A;  4DDI D;  2IO2 B;  2MX2 A;  2NBW B;  3A4R A;  4W9I A;  3VDZ A;  4KDI C;  2KTR B;  4GOC A;  4NQL B;  5EDS A;  4MEM A;  3T8M A;  3DBL I;  5IA7 A;  3VH3 B;  2GBK A;  2KFK A;  1WFY A;  4PS8 A;  2K1F A;  3M95 A;  4FN2 A;  3KW5 B;  4KSK C;  4NAW B;  4IUM B;  1WXV A;  2RGF A;  4FUL A;  4ZRK A;  4XZ4 A;  3DVG X;  5D7G A;  1U4A A;  4II2 B;  3ECI A;  3ZLZ A;  5JH5 C;  2XBB C;  4W9K A;  4DHZ B;  1UBQ A;  4GSW A;  2LI5 A;  2BWF A;  4AP4 C;  2D11 A;  4KIK A;  1WJ4 A;  4GGQ A;  2ZCB A;  4G11 A;  1GJZ A;  1YD8 U;  4LDT B;  3PLV A;  3OJ3 A;  1V81 A;  3TIX A;  3BY4 B;  4GDK A;  2BGF A;  5L95 C;  2V1Y A;  2JPH A;  2M4N A;  4EFO A;  4J6I A;  4A3P A;  4MH0 E;  3M62 B;  4F1S A;  1E8X A;  2CHX A;  1V2Y A;  2L76 A;  4IWO A;  4M8M A;  2BYV E;  3DVN U;  3ZDT A;  4FJZ A;  1XQQ A;  3D32 A;  2LGY A;  1Q1O A;  3PTF C;  4HPL B;  3VAW A;  3ZTC A;  5KHQ A;  1WMH B;  2O2V B;  2AWT A;  4BBN C;  3ZIM A;  2L8J A;  1H4R A;  4EZJ A;  2LXA A;  3CMM B;  3DBS A;  1E8W A;  2V3S A;  4ZDV A;  4NQK E;  1C1Y B;  2LVO A;  2KTR A;  2KWV B;  3PRZ A;  4BFR A;  3DBH I;  3KVF B;  4FHK A;  3U7D A;  2MCN B;  3VH4 B;  2DAJ A;  4CYE A;  3N32 A;  2M1M A;  3HIZ A;  4FA6 A;  2NS5 A;  3Q3J A;  2IO1 B;  2DZI A;  3W1S A;  2UWQ A;  2J7Q B;  2J0J A;  3O65 B;  2G4S A;  1L7Y A;  1V5O A;  2JVC A;  5DPR A;  1WM2 A;  4FAD A;  4KIK B;  3EFU A;  2QHO A;  2O6V A;  3QK0 A;  3ZKJ C;  2LGD A;  4I6N B;  3VUY A;  2MBH A;  3PV1 A;  4G0N B;  2KC2 A;  5TR5 A;  4GIV A;  5IAA C;  3BIN A;  4ZRI A;  3HK0 A;  2LGX A;  2ZNV B;  3TL5 A;  1WE7 A;  4EOY A;  4NAW A;  2Z59 B;  2G4D B;  2AYO B;  1TBE A;  1BT0 A;  1UGM A;  3DVG Y;  3M3J A;  3W1Y A;  2BF8 B;  5J18 A;  4MGY E;  2JY6 A;  4LJP B;  2KQ7 A;  5LLI A;  4MSQ B;  2CHZ A;  5FR6 A;  1WX9 A;  1WJU A;  3NZS A;  4NJ6 A;  4N9F 4;  5AZG A;  1M94 A;  4ANV A;  4FBJ B;  3KUZ A;  4GN1 A;  3PSE B;  2NBU A;  1KOT A;  2A5U A;  3L0W B;  1UEL A;  2JXX A;  2G3Q B;  3ML9 A;  2R2Q A;  1D3Z A;  1WXA A;  4WJO A;  3RD2 A;  2AL6 A;  4W9D A;  2IO0 B;  2WWZ A;  2DZJ A;  4TUU A;  5D94 A;  4EEW A;  4M0W B;  2YLM A;  4P7I A;  4B6W A;  1WIA A;  3TMP B;  1K8R B;  2CS4 A;  2O6V B;  4E3C A;  3M63 B;  2ZVN A;  2KDE B;  4HJK A;  4HDO A;  4HCN B;  2D3G A;  2ZZP B;  3VTU A;  2B3A A;  2KDB A;  2Z0E B;  3ZVV A;  4BOZ B;  4M8N A;  2PEA A;  4IC7 B;  4MGI E;  4WWP A;  2K6Q A;  2J0K A;  3QC8 B;  5C23 A;  2CHW A;  4FJV B;  4HLE A;  3B0A A;  3IVF A;  4JIO U;  4WAA A;  3VFK A;  5BO4 B;  3H7P B;  1WYW B;  2JF5 A;  3PHX B;  4EKU A;  3OAW A;  4ANU A;  2BWE S;  2DZM A;  3UIN B;  3NS8 A;  2KJH B;  4MDK E;  3WA0 A;  1YQB A;  2GBR A;  1OEY A;  2L05 A;  3ZRC A;  4PS3 A;  2OOB B;  3PRM B;  3QAR A;  4MGZ E;  2KO3 A;  2C5L C;  2D07 B;  4W9J A;  2KQS A;  1E5W A;  1TTN A;  3QHT A;  2KHW B;  2ZVO A;  2ZPN A;  3TCA A;  2KJR A;  3RUI B;  1RAX A;  2JWZ A;  2MSE D;  2NPT A;  3A9J B;  3A9K A;  3DOW A;  4HPM B;  3R3M A;  2HE7 A;  3ZTD A;  2EKE C;  3L54 A;  1TZ1 A;  1MG8 A;  4DHJ D;  1SGH A;  4URK A;  5E6P A;  2KC1 A;  4BOS C;  2ASQ A;  2IBI B;  3VUX A;  3UF8 A;  5L83 A;  1IYF A;  5AZH A;  2M0X A;  2KWU B;  5D2M B;  2L0T A;  2FCQ A;  3DBR I;  1OGW A;  4GDL B;  2LD9 A;  4KDL B;  3ALB A;  1X1M A;  1AAR A;  3AI5 A;  2BYF A;  2WDT B;  2EMT A;  4PS7 A;  4LCD E;  2ZCC A;  2PE6 B;  2N7E A;  4TV3 A;  3WAO A;  5G2N A;  1EO6 A;  3EHV A;  3QA8 A;  4GXB A;  4HDQ A;  2G45 B;  5E6O A;  1LFD A;  1I35 A;  2DAF A;  2BPS A;  2N1W A;  3L13 A;  5CHV C;  4IWP A;  2N7D A;  4BBN F;  3PVL A;  4W9G A;  2LUE A;  1P98 A;  2M17 A;  4LDT D;  4DHJ B;  2BYE A;  3QCA A;  1WGG A;  2EMS A;  2DHZ A;  3DVN V;  3U30 A;  1IP9 A;  1YIW A;  2ZNV C;  3PRP B;  1WX8 A;  4XC2 A;  2L3Z A;  3N3K B;  4W9E A;  2KK8 A;  2YVC A;  2LVP A;  4KSL C;  4BVU C;  3EEC A;  1L2N A;  4F8C B;  3AU5 A;  1P1A A;  4KVG B;  4MJS A;  4X57 B;  1WR1 A;  3ONS A;  3A33 B;  1R4M I;  3C0R B;  2DYB A;  3K9P B;  4GDL A;  1P3Q U;  3APD A;  3DDC B;  1WRD B;  3VTW A;  3WAM A;  1S3S G;  3VVW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...