5AEKB

Crystal structure of the human senp2 c548s in complex with the human sumo1 k48m f66w
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLMESYCQRQGVPMNSLRFLWEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 2
publication title Stepping Back and Forward on Sumo Folding Evolution
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 78
sequence length 78
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5aekB00
1E90A 3VTVA 4HCNB 1NDDA 1Y8RC 5JHBA 2L05A 2KQ7A 2UWQA 3H7PA 2WX0A 2ZPNA 1V2YA 2EMSA 4MGKE 3IG3A 3RUIB 2O6VA 1TGZB 1YQBA 3M62B 1WFYA 4AJWA 2ZNVC 1V80A 2L8JA 4BVUC 4ZYNA 2KJ6A 4W9CA 3L0WB 3TJPA 1J8CA 3ZVVA 4MH0E 4WJQA 2KMCA 2LI5A 1WIAA 4K81A 2GBKA 3T8MA 4MSQB 4FBJB 2BF8B 4IWQA 3I3TB 2IY1B 3KUZA 3HK0A 1UZXB 4GDKB 2LVQA 3DCGA 4URKA 2KJRA 3PPAA 2GMIC 3UQAA 1H4RA 3QA8A 4M8NA 3UIPB 1GUAB 2MBOA 2N4FA 2QHOA 4IUMB 2IO0B 2REXA 3TCAA 3BINA 2MW5A 3ZTDA 4X57B 2MP2A 1MG8A 3PRZA 3RZFA 2WWZA 2DYMA 3UF8A 1KOTA 2KC1A 1WGGA 1WJUA 2PJHA 4TV3A 3V6EB 2JRHA 3DVGX 4KIKB 1SE9A 1UBIA 1V5TA 5GMVA 4IG7B 3ZLZA 1LXDA 3B1LX 1YIWA 2Z0EB 4EEWA 4A20A 4W9EA 2ZVNA 4FJYA 3ENEA 2BYEA 2MA9B 2IY0B 4GB9A 1C1YB 3PRPB 1WI0A 2IYDB 2HJ8A 3KUDB 1P3QU 2GBMA 4NJ6A 3TL5A 4RM8A 3IVFA 3PLUA 4WJNA 4HCPB 3C0RB 3TBLD 3VDZA 4B95A 2CS4A 4NJ7A 2IO1B 4ANXA 2LRWA 3UQBA 2K8BA 3VTUA 4KZ0A 2JT4B 4ZRKA 1OEYJ 3VHTC 2M0XA 2D10A 3RCZA 2J0KA 1E8WA 2KMAA 4XZ4A 4HLEA 3BY4B 4ZRIA 4ANVA 2KZRA 1P0RA 3PV1A 4EKUA 2KD0A 2RPQA 2KWUB 4W9GA 2EMTA 2RR9A 1S1QB 3DOWA 3KVFB 1WX7A 5E6OA 4TQ1A 2FNJB 2Z59B 3PHXB 4AWJA 2MLBA 3ZNID 2M17A 4HXDA 4AUQC 2IO3B 2ZVOA 2LXAA 4GMVA 1IYFA 1XQQA 5AZGA 2NBWB 3V6CB 4BKSA 2G4SA 3QIJA 3QX1A 4ICUA 3VTWA 1GC7A 2MX2A 2C7HA 1RAXA 1ZW7A 4KVGB 1F9JA 2C60A 2R2QA 2C7NB 2AEHA 1WGHA 1LQBA 3PHWB 5C1ZA 1WF9A 5IAAC 1R4MI 3B0AA 4A3PA 4EFOA 3ZW3A 3U7DA 2ZPYA 5CHWA 2N7EA 5D7GA 5HKHA 4G0NB 1SGHA 1Q0WB 4GDLB 4E71A 2ZCCA 3A9KB 3MJWA 5JZEB 2NCNA 3SHQA 2LD9A 3UIOB 2K6DB 2GBJA 2FCQA 4LDTB 2HTHA 2KFKB 2BWES 2KQSA 2M1MA 3N30A 1E8ZA 4KIKA 1C3TA 5AZHA 3W1YA 1E8YA 2XK5B 2D3GA 4GIVA 4A3OA 4ASWC 1IP9A 2CKHB 2KTRB 5DPSA 3L10B 3VUWA 2FAZA 3VFKA 2DAFA 5AZFA 1GJZA 5IA7A 4NNJB 3K9OB 3V60A 2KWCA 3ZDTA 3Q3JA 4K7UA 1KJTA 3EECA 4NQKE 2ZCBA 4XX5A 4G50A 2PE9A 3ZNZB 2XEWA 2C7MB 1XT9B 1EF1A 2A5UA 1T0YA 2JUOA 4G11A 2M8SA 2KHWB 2KNBA 5C23A 1WY8A 4IC7B 1RFAA 1FXTB 3AU5A 2FCSA 5D2MB 3UGBB 4MJSA 2CHWA 3WAPA 1EO6A 2NPTA 1L2NA 1V5OA 3PGEA 3ZDMC 2BWFA 2MBEA 2N1VA 4DBGA 2D11A 3SDLC 4BKSD 2HD5B 4MM3A 3T9LA 4TKNA 2FCMA 2RD0A 2GBRA 3IHPC 5LLIA 4WWPA 2FCNA 1WXAA 2L00B 3L17A 3A33B 1H8CA 1V86A 2G4DB 2DAJA 3KUCB 2ASQA 4LCDE 4DDID 1PQSA 1J19A 1WR6E 2JZZA 5G55A 1Z5SB 4JQWC 1NBFC 2LRUA 2JXXA 4GGQA 2Y5BB 3MHSD 3DBHI 2DYBA 4GN1A 1V6EA 3PRMB 1G6JA 1Z2MA 2L7RA 3JW0X 4NY0A 4II2B 4JLCA 4EOYA 2AYOB 2NBUA 2ZEQA 3KH0A 4W9HA 2JZ3B 4DHZB 1A5RA 1L7YA 3QWZB 2FUHB 4KZCA 3DPDA 3JVZX 3TIXA 4WJPA 1UD7A 1I35A 1WMHB 2KN5A 4DHJB 3DBSA 1WZ0A 4WJOA 3R7QA 4J6IA 2MWSB 5G2NA 2I1KA 2NS5A 2V3SA 4FJZA 4E74A 1GC6A 1WM3A 2G45B 4EZKA 2C9WB 3QCAA 1QZEA 2KOXA 1U4AA 3MTNB 3M63B 2XBBC 2AL6A 1NI2A 4YL8A 2I1JA 3N32A 5E6PA 3VVWB 3H1UA 4ANUA 2LJ5A 4KSKC 3CSTA 1HE8A 2KK8A 5EDSA 3ZNHB 2DYOA 1Q5WB 2LVOA 3A9JA 3JSVB 3OJ4B 1YJ1A 1E7VA 4EZLA 2BGFA 4AOFA 3L08A 1GNUA 1YX5B 3CSFA 3NZSA 4P7IA 3LDZE 5DPTA 2RSUA 1VCBA 5FR6A 4AP4C 3CMMB 3H7PB 1X1MA 2K6QA 2DX5B 2WYQA 3UINB 3QHTA 2JRIB 2KXJA 2O6VB 2BYVE 2ZZPB 2LUEA 2KDEB 3NS8A 3PT2B 2DZIA 2DZKA 2O2VB 3RD2A 4TUUA 1J0GA 1WGRA 2CU1A 3ZRCA 1LM8B 2LASA 2B3AA 2PE6B 3WA0A 4ANWA 3A4RA 3PREA 1UBQA 4IM0A 2K39A 3HM6X 4KV2A 5D94A 2ZNVB 4FADA 4PS8A 4GDKA 1E7UA 2M4NA 4KSLC 4WQOB 2N9PC 4W9IA 4B9KA 4FULA 2MBBB 1WH3A 2WX1A 4ZRJA 1WRDB 1WGYA 4E3CA 1P98A 2L0TA 1TTNA 2KDIA 4NQLB 2D2QA 3LJ3A 2LXCA 1Q1OA 2N9XA 2MP2B 4FA6A 2KX3A 4GU2A 1UGMA 5DPWA 4BKGA 3WAOA 3ML8A 2MBQA 4HDQA 3DVNV 1WYWB 3HIZA 1S3SG 4MGYE 3X0WA 3HHMA 3N3KB 3VH4B 1EUVB 4PS7A 4MDKE 3ALBA 2GBNA 2KJHB 4KDIC 3V62A 4CYEA 2HE7A 4N9F4 5E6NA 3ZNGC 4MEMA 1WXMA 3QARA 3EC8A 1WR1A 2RGFA 3U30A 3DDCB 5D6JB 4MSMB 3VXWA 3R7RA 2J0MA 4MGIE 3PS6A 1YD8U 4M0WB 1UH6A 3AU4A 3B08A 3GZNI 1WXVA 3PLVA 1AARA 2AWTA 4IM3A 4BKTA 1WX9A 3QC8B 4I6LB 2BYFA 4LJOB 4F7ZA 1VD2A 3OJ3A 1WZ3A 3QQ8B 4WAAA 4ZDVA 4IM2A 2J0JA 3JYUA 3L54A 1OTRB 1WE7A 2KLGA 2A4ZA 1TBEA 3DBLI 3PZDA 4NAWB 2IBIB 2V4LA 4IW0A 3DQVA 1XD3B 3U8ZA 3DBRI 4G3XB 5J2RA 2LGXA 4JGHB 1ZGUB 2K1FA 4LJPB 2K8CA 2KO3A 2PEAA 3GOEA 3VUXA 3APFA 2OOBB 4W9DA 4BBNF 2LZ6A 2O2VA 1WGDA 2KTFA 3P2BA 1SIFA 4DHZE 4JIOU 4IWOA 4OVUA 3NZUA 2DHZA 3H6NA 4BFRA 2KANA 1WX8A 2CHXA 3VUYA 1WJ6A 5CHFA 2N7DA 4BOSC 5L95C 1R4NI 4HK2A 2W9NA 1CMXB 3NY5A 2NBVB 2DENB 2JY6A 2MQJA 4HPLB 2Z0DB 3Q3FA 3VAWA 2MSED 4HWIB 4F1SA 3TMPB 4EZJA 2MCNB 5DPRA 4KDLB 3ZKJC 1OEYA 4GDLA 5LXIB 3A9KA 5LXHA 1TZ1A 4DHJD 2CR5A 3WANA 2MBHA 3H9DA 3A1QB 3QAQA 4WWNA 2YLMA 5KHOA 1V9JA 4RM9A 2L0FA 2KFKA 2JF5A 2YVCA 3QK0A 4NPNA 3W1SC 4CHKA 4CO7A 1OQYA 2KDFB 2KDBA 3PVLA 1P9DU 3IBEA 3EHVA 4XC2A 2XK5A 2J7QB 4W9KA 5CTRC 3QJZA 2IO2B 2ZJDA 4I6NB 2KTRA 3ZO5B 2C5LC 5AEKB 4HPMB 4GXBA 4DWFA 3W1SA 3RULA 1WJ4A 3NOBA 2KX0A 3KW5B 4FHJA 2LGDA 5DCNA 2L76A 3ECIA 2L3ZA 3ZUNA 1V49A 5TR5A 3APDA 4W9FA 1D3ZA 2EKEC 2N9EB 1BT0A 3D32A 3PTFC 4ICVA 4MGZE 2JPHA 1GG3A 2BKRB 2WDTB 3DVGY 2AL3A 2GOWA 4HDOA 5J18A 5JHAA 2UYZB 4TQ0A 1WM2A 2KKCA 3R3MA 4RMAA 3AI5A 2MRPA 4WWOA 4MJSB 2FIDA 1EF5A 5CX3A 2NPTB 3DVNU 2O6VD 3H7SA 3KYDD 3ZTCA 4NAWA 3HM3A 4DK5A 5KHQA 3CF6E 1E8XA 3APCA 3ML9A 1RLFA 4BOZB 2PPHA 3IFWB 2KFJA 3L16A 3VQIA 4HVBA 1IPGA 4IWPA 1E5WA 4OVVA 4W9LA 4DXAB 3PSEB 3KYCD 2IZVB 4MELA 4B6WA 1RRBA 2DZMA 4BBNC 5BO4B 1K8RB 5L83A 3VH3B 3A9JB 3AULA 3ZRFA 2VRRB 4PYZA 1UELA 4PS3A 3RZWC 4FLHA 4PYUA 3WAMA 4FJVB 2KC2A 4K1RB 4W9JA 2G3QB 3EFUA 3SU8X 4II3B 3ZIMA 4GSWA 3M95A 1WXSA 5JH5C 2NVUI 2LVPA 3OLMD 3M3JA 2KLCA 4AJYB 1WMHA 5CHVC 1ZKHA 3RYTA 3O65B 4LDTD 2LGYA 3R66C 4M8MA 3RT3B 3S2AA 1WE6A 2BKFA 2D07B 2JVCA 2R2OA 1KM7A 3K9PB 4HJKA 3A4SC 4GOCA 3ONSA 2OJRA 2K8HA 4DDGD 2BPSA 3OAWA 1YX6B 3SD5A 3A1QA 4FN2A 2V1YA 3WIMA 4F8CB 1M94A 1I42A 4I6PA 5J17A 3X23A 3AXCA 3L13A 4EUTA 2K25A 2NR2A 4K7SA 3WALA 1KLVA 4K7WA 2JWZA 2KWVB 3V61A 2LWPA 1ISNA 2KVRA 2CHZA 1P1AA 1LFDA 4FHKA 1OGWA 3NHEB 4JL9A 3JSVA 2FIFA 1JRUA 2N1WA 1V81A 1WJNA 2DZJA
chains in the Genus database with same CATH superfamily
1NDDA 1Y8RC 2IDYA 4YXDB 2JWUA 2PW9A 1L6VA 2EMSA 3IG3A 1KF6B 3RUIB 3M62B 1V1PB 1V80A 3DHIC 1F52A 3LYYA 1HEZE 2GB1A 3N1ZC 3U2SC 2VZKD 3HRDD 3HK0A 3EFCA 1TS4A 1H4RA 3UIPB 2N4FA 5IN7A 4FXCA 4X57B 1MVKA 1TS5A 3ETRA 1P7FA 1KOTA 1WGGA 3E9SA 4TV3A 3DVGX 4KIKB 2WXMA 1SE9A 1JWUD 3ZLZA 2ZVNA 4P1BC 4A8XC 2BBCA 3KUDB 4NJ6A 2KMMA 3AE9B 2IO1B 4ANXA 3HUIA 4TSSA 4YTPB 1D5XC 2JT4B 5HG2A 1OEYJ 3VHTC 2M0XA 2J0KA 1E8WA 2KMAA 3BY4B 4ZRIA 2KZRA 3TEZA 2KWUB 4C4VA 2RR9A 3W5UB 2ONQA 3AB5A 3ZYYX 1F0ZA 4YWGG 4AUQC 2IO3B 5AZGA 1ZOYB 5D3DA 4KVGB 1F9JA 1TKEA 2VH1A 1ZDVA 2JYEA 1N6ZA 1VRAB 2AQ1B 4EFOA 4P6VF 3U7DA 5HKHA 2WS3B 4G0NB 2ZCCA 3MJWA 3UIOB 2FCQA 2IGHA 4LDTB 2JX5A 3N30A 4XWTA 4ASWC 3TSSA 2CKHB 1F2RI 5DPSA 4K3CA 1IGCA 4HROA 4HPPA 2AQ2B 4K7UA 3EECA 4XX5A 4G50A 2K0PA 5D3IB 1SB3C 1XCQL 1EF1A 1MG4A 1SE2A 3Q2AC 3KQ4A 2FCSA 2FBWB 4MJSA 2QIEB 1L2NA 1D4BA 1V5OA 2N7JA 2MBEA 2N1VA 3AECB 1JWAD 3SDLC 4BKSD 4L2YA 4MM3A 1T0SC 2FCMA 2RD0A 4ZHOA 3IHPC 5LLIA 3A33B 2G4DB 3KUCB 4HEA1 2WXFA 1Z5SB 4REZA 1V6EA 1Z2MA 3JW0X 1FRRA 4II2B 4JLCA 3GE8C 2NBUA 2ZEQA 4S17A 3TEXA 1L7YA 2X8XX 1RWSA 2KN5A 3DBSA 3R7QA 5G5HA 1FCLA 4RGTA 2NS5A 4ZHPA 4E74A 1GC6A 3KWVA 1WM3A 2CU3A 4EZKA 2C9WB 2KOXA 4ACFA 1U4AA 2WXLA 1K52A 3I63C 3VVWB 3N32A 2DWQA 2N0SB 1KRHA 4KSKC 3CSTA 1HE8A 2KK8A 5EDSA 3ZNHB 2LVOA 4AOFA 1YX5B 2QILA 4P7IA 5DPTA 3B2GA 3MFGA 2WXHA 4RFBA 3AV8A 2JRIB 2KXJA 2ZZPB 1FIQA 2O2VB 3RD2A 2MHJA 3WCQA 1WGRA 3A4RA 4IM0A 3R8BA 4PS8A 2Q5WD 2MBBB 2WX1A 2OJWA 3FKYA 2D2QA 2MP2B 4GU2A 4BKGA 5HI1A 4O1NA 3X0WA 3R2TA 1YQ3B 4PS7A 4NAMA 4MDKE 4KDIC 1SF0A 4N9F4 3ZNGC 1N61A 2RGFA 1SE4A 3U30A 5BMHA 4MSMB 4H2AA 3VXWA 4MGIE 1VR9A 2RDGA 2WXIA 1K50A 5T8IA 1WX9A 3QC8B 4I6LB 4F7ZA 2XN9C 1I4QA 1WZ3A 4AQ7A 2J0JA 1SXTA 3OWEB 1TBEA 3DBLI 5H8YE 1XLPA 2V4LA 2H89B 1XD3B 3DBRI 4TMAB 1QOGA 1B9RA 3NVYA 3ZXVA 2K8CA 2KO3A 4BBNF 2N9LA 1SIFA 3NZUA 2KANA 4BOSC 5L95C 1R4NI 1L5PA 3P4SB 2W9NA 3AN1A 3Q3FA 2MCNB 5DPRA 4KDLB 1OEYA 5LXIB 4GLSC 4DHJD 3A1QB 3Q8EA 2L0FA 1Y56A 2JF5A 4CO7A 1VLBA 2KDBA 3PVLA 3EHVA 1WWTA 5CTRC 4I6NB 4HPMB 4DWFA 1NYQA 1ZPSA 2WXJA 3RMKC 3NOBA 2KX0A 3Q8CA 2L3ZA 1V49A 1JMLA 1N5XA 4MGZE 1BT0A 1GG3A 2BKRB 5J18A 2BS2B 5JHAA 3O13A 3V3XA 2KKCA 4RMAA 1SIJA 3AI5A 4KKJA 2FIDA 1EF5A 5CX3A 3DVNU 3H7SA 4NAWA 1EWYC 1TS2A 1IPGA 4DXAB 4W9LA 4MELA 1QKZA 2BS3B 4B6WA 2VRRB 1L6UA 4YSYB 3MHZA 1UWXA 4FJVB 1PGBA 3CIRB 4QAYA 3ZIMA 4GSWA 5JH5C 4AJYB 2BT6A 3O65B 2LGYA 3RT3B 2QMTA 2D07B 4YTMB 3K9PB 3A4SC 2BPSA 4FN2A 1CQVA 3X23A 3AXCA 3BZDB 4K7SA 1KLVA 1AWDA 3V61A 2CHZA 4CQNA 1P1AA 4FHKA 3FILB 1VJKA 3A9JB 2DZJA 5JHBA 3N20C 2L05A 4RH6A 2WX0A 2LGSA 2ZPNA 3P1MA 2IPKD 4MGKE 1TGZB 2W3SA 2L8JA 3TJPA 4W9CA 2KACA 3L0WB 1J8CA 4MH0E 4WJQA 4LTUA 2VH2A 4K81A 4M00A 4FBJB 2BF8B 2IY1B 1AN8A 4GDKB 3DCGA 2GMIC 3GE3C 2MEKA 3NRZA 4IUMB 2K5PA 2MW5A 3GP7A 3ZTDA 2WDQB 1YJJA 1RFKA 4OVZA 2DYMA 2INPE 1QOAA 2J53A 2JRHA 1M4VA 1UBIA 1V5TA 1LXDA 2BYTA 4W9EA 2ZW1A 3ENEA 2IY0B 4GB9A 4WIPA 4RM8A 3IVFA 2JXTA 4WJNA 4HCPB 3TBLD 4B95A 3SEBA 5EE3A 2WQYB 1BXTA 3T3OA 1PFDA 1B1ZA 4XZ4A 4EKUA 1XLNA 4W9GA 1I4HA 1S1QB 1K51A 3DOWA 4R3DA 5E6OA 3PO0A 4TQ1A 2Z59B 1MFWA 2INNE 4AWJA 2MLBA 2M17A 2BS4B 4HXDA 1T3QA 2K22A 2ZVOA 2LXAA 1TYGB 3I9V1 2G4SA 3QIJA 4ICUA 4WWMA 2Y5CA 2PVOD 1GC7A 2MX2A 2R2QA 2C7NB 1JCKB 3PHWB 1LQBA 4ZRQA 1P7EA 1WF9A 5IAAC 3DBHB 4PT5A 4KGRA 2KQ4X 2N7EA 3BYTB 3BVMA 4GDLB 2IGGA 3A9KB 4E71A 2NCNA 2GBJA 2EKIA 2BWES 4KIKA 3W1YA 4GIVA 2I2YA 3BYYB 3VUWA 2FAZA 4L1BA 3VFKA 5IA7A 2KAJA 3P4PB 1C79A 1I4PA 1ZXHA 3K9OB 3V60A 1TS3A 1TZOA 4NQKE 3N1YC 2ZCBA 1UGJA 4G11A 4IC7B 3AU5A 5FR3A 5D2MB 2E6XA 5TSSA 4DBGA 2D11A 3P63A 1JRPA 1MPEA 4N58A 3ZGZA 2FCNA 3L17A 1H8CA 4DDID 2ASQA 1E6EB 3AE1B 1WR6E 4LNIA 3VR9B 1C78A 5BMGA 2JXXA 2INCC 2D3CA 4GN1A 3PRMB 1G6JA 1WGKA 3DHHC 2QC8A 4EOYA 2BB5A 4DHZB 3KH0A 1KLUD 2FUHB 1UD7A 1FFUA 4WJOA 5H92C 2BQQA 4KGTA 2MWSB 5G2NA 1YNTE 2L83A 4XE0A 3U4EG 2KVZA 3ABVB 3MTNB 3M63B 1FO4A 4YTNB 2AL6A 4YL8A 4HJGE 3H1UA 3RPFC 3GZNB 1YJ1A 4BAXA 1WYGA 3B2FA 3CSFA 5FR6A 2YEPF 3CMMB 3J9CA 2WYQA 2KDEB 3PT2B 1ROEA 2DZIA 2DZKA 3ZQ4A 2J52A 2CU1A 2W54A 4B0EA 2B3AA 3PREA 2K39A 3HM6X 5D94A 4JX1C 1E7UA 4KSLC 2N9PC 4W9IA 3FAHA 4ZRJA 1WGYA 1IUEA 1TTNA 1R7SA 5G5GA 1Q1OA 2N9XA 4FA6A 1MHXA 5DPWA 4YSZB 3ML8A 4HDQA 1V97A 3AEGB 4MGYE 3AE7B 3VH4B 4WURA 2INDC 1RM6C 1FCCC 4J3OD 1QOBA 1YD8U 3AU4A 1L0VB 4XDCA 3B08A 4ITKA 1GB4A 1AARA 4IM3A 4WH4A 3GB1A 3PZ8A 2CJNA 4LJOB 1GPXA 4C4VB 3JYUA 3L54A 1KH0A 3PZDA 3HVZA 2IBIB 4IW0A 4K3BA 3IAM1 1YOVB 4JGHB 3VUXA 2VZKB 1BUIC 2LZ6A 2O2VA 4C80A 1T6BX 3P2BA 4JIOU 1C9FA 1E0ZA 3H6NA 4BFRA 1WX8A 1WJ6A 2QCZA 4KGSA 5CHFA 3LXFA 5BYRA 1PGAA 1ACCA 1ZXIA 2NBVB 4LLGM 1VZ8A 2Z0DB 4F1SA 3TMPB 3ZKJC 1IGDA 3EUB2 3Q8FA 3V05A 3NG0A 2CR5A 4N59A 3H9DA 3Q8AA 5KHOA 1SE3A 3RI7C 4RM9A 2KFKA 2Z8LA 3W1SC 4CHKA 1OQYA 1MJDA 2XK5A 3QJZA 2IO2B 2ZJDA 3ZO5B 2KTRA 4GXBA 3BK2A 2KN4A 3MC0B 1XXGA 5DCNA 1HA5A 3ECIA 3APDA 2EKEC 3D32A 1E7PB 1YMHE 4C7YA 5IP4D 2UYZB 2WDRB 2PLPA 3R3MA 1EU3A 4MJSB 3C8YA 3KYDD 2O6VD 1DOIA 4C7ZA 4BOZB 3L16A 4RF1A 4HVBA 4OVVA 1L4ZB 2DBYA 3PSEB 2TSSA 2DZMA 1K8RB 3VH3B 3ZRFA 2YEPB 2X38A 4FLHA 3WAMA 2KC2A 1F77A 2WXPA 4K1RB 2RPVA 4II3B 1WXSA 1JWMD 2LVPA 3OLMD 3M3JA 1WMHA 2AQ3B 2WGSA 3S2AA 2BKFA 2EELA 4HJKA 4GOCA 2OJRA 1YX6B 3SD5A 3A1QA 2DNFA 4LK0M 4XYCA 5LNK1 3Q8BA 4EUTA 2LHEA 2FE8A 4XDDA 2LWPA 1LFDA 3JSVA 2FIFA 2HDEA 4IM2A 2GLSA 3Q69A 1HZ5A 3VTVA 1Q10A 4HCNB 2KQ7A 4JPSA 3H7PA 1V1OA 4US8A 1FPYA 2O6VA 4AJWA 4USAA 4BVUC 2KJ6A 1T0QC 2KMCA 3DWGC 2NTTA 4MSQB 1JWSD 3ZJUA 3I3TB 3KUZA 1UZXB 4URKA 3UQAA 3QA8A 4M8NA 3BWUD 2QHOA 1BMLC 4KKIA 2REXA 2ICIA 3BINA 3TEYA 5FKAC 3BK1A 1MG8A 4IKGA 3PRZA 3RZFA 3UF8A 2UU7A 1SJED 3VRBB 1WJUA 1SBBB 4IG7B 1L0YB 1YIWA 4A20A 1NENB 4AS1A 4FJYA 2MA9B 4IDIA 1WI0A 1LO5D 1P3QU 3TL5A 2WNMA 3PLUA 2CS4A 4NJ7A 4RCOA 4M01A 3I57A 4M0WA 1T0RC 1I4XA 3NVWA 2D10A 2RDBC 1EWCA 3C19A 4YSXB 1P0RA 3PV1A 2JZPA 2MJDA 2KD0A 2RPQA 3FILA 1FNVA 1N62A 2EMTA 1STEA 3KVFB 5MPOA 1C4PA 3PHXB 2WU5B 3BVZA 2M19A 3E56A 4MACA 3ZXRA 5HHDG 1ET6A 1IYFA 1XQQA 2NBWB 3AE6B 3QX1A 4DXFA 3VTWA 2CJOA 1TT5B 1ZW7A 1KTKA 1YN5A 2C60A 2AEHA 1ENFA 1WGHA 5C1ZA 1R4MI 2J4XA 5CHWA 5D7GA 1SGHA 1Q0WB 3RN9C 4UDUC 3SHQA 2LD9A 1YJIA 5IOIA 2KDMA 3AMZA 2KQSA 2M1MA 1E8ZA 2WXGA 2D3GA 4YT0B 4MT5A 1YN4A 4OZBA 2NMQA 4ZYSA 1ESFA 4NNJB 2KWCA 1TKYA 2XEWA 4P1CC 2JUOA 2A5UA 2M8SA 5C23A 1WY8A 3B9JA 1FXTB 1GAQB 3UGBB 2ON8A 2BTEA 2CHWA 2LHDA 1EO6A 2NPTA 3ZDMC 2DLBA 2QSDA 1IBXA 2HD5B 4TKNA 2GBRA 1HQRD 4WWPA 1WXAA 4P16A 4LCDE 4PK1A 2JZZA 5G55A 3T3NA 1NBFC 2LRUA 3H8HA 3MHSD 3DBHI 2L7RA 5GXGB 3AE5B 2HJ1A 2AYOB 5EE1A 3QWZB 4KZCA 3DPDA 4DHJB 1C77A 1WXQA 2N9KA 1I4RA 4FJZA 2I1KA 1J7AA 2G9HD 3IXSA 1F1HA 2G45B 2ACZB 3EA6A 2L32A 1QZEA 1C4AA 3N1XC 2V9HA 3RNEC 1JRUA 1QILA 1Q5WB 4EZLA 1CJEA 3OJ4B 1E7VA 2RMMA 3L08A 1GNUA 1NYRA 4OHJA 1FD6A 3LDZE 2RSUA 1VCBA 4AP4C 3UINB 3I5JC 1V1PA 2BYVE 2LUEA 3NS8A 4KX6B 2GRIA 2PVGC 3LB8C 2PE6B 2ZW0A 4ANWA 4XGAB 1UBQA 5IKCM 4FADA 2ZNVB 2MJEA 4WQOB 3RNCC 3KWLA 1SSNA 2HTME 2L0TA 4NQLB 3LJ3A 4ZOHC 2KX3A 1UGMA 1QOFA 1XF5L 3DVNV 2WXRA 3HHMA 3N3KB 3IT4B 1ZE3D 3ALBA 2GBNA 2V3NA 2AX5A 3V62A 4CYEA 4HRSA 4MEMA 1WXMA 2Y3AA 1FNUA 2I38A 3EC8A 3QARA 3R7RA 4DQOC 1FNWA 3PS6A 2LEKA 2PTLA 1UH6A 4C56C 3GZNI 2M0AA 3NZ3A 1VZ6A 3PLVA 4BKTA 2AWTA 2B76B 2BYFA 3MC9A 1VD2A 4WAAA 4ZDVA 3W9CB 1OTRB 1WE7A 2KLGA 4RGOS 4G3XB 5J2RA 2K3UA 1WRIA 1FFVA 2PEAA 3GOEA 3APFA 1WGDA 2KTFA 4N6EB 4DHZE 2GI9A 4IWOA 4OVUA 2DHZA 2CHXA 4ZRPA 2N7DA 1CMXB 3NY5A 2DENB 1SJHD 1UUPA 3VAWA 3NVZA 3SR6A 2OHFA 5BYSA 3SFEB 5LXHA 1TZ1A 2WU2B 2MBHA 4WWNA 5IO9A 1V9JA 4NPNA 4C00A 3AEBB 1YQ4B 1P9DU 3IBEA 4W9KA 1QQRA 1CK1A 1KFYB 3Q6BA 1MHHE 3RULA 1I7HA 3KW5B 2LGDA 3ZUNA 2BW2A 3AE3B 2N9EB 3PTFC 2JPHA 2MJ3A 2WDTB 2AL3A 2GOWA 1EM7A 3AE2B 3P4QB 1ZP0B 4TQ0A 5EE9A 3FC4A 3ZJTA 2MRPA 3RFZB 1AYFA 3RNFC 3EGRA 3CF6E 3ML9A 1RLFA 2PPHA 3IFWB 4NJCA 5EE0A 1E5WA 2PMVA 3KYCD 2BB6A 4BBNC 5BO4B 5L83A 4ARIA 1JROA 4PYUA 1UWMA 3NUHB 2G3QB 2JSVX 2WHIA 3SU8X 2KLCA 4HKZE 3RNBC 5CHVC 1ZKHA 3R66C 4M8MA 2V3PA 2LFIA 2K8HA 4DDGD 1J7BA 3Q14C 2LJIA 4F8CB 3NS1A 4I6PA 2SEBD 2WXQA 3OG5A 2K25A 2NR2A 2PKOA 1ZDXA 4K7WA 1ISNA 2KVRA 3AH7A 1C76A 5E6JA 4Q2JA 1V81A 1T5XD 1E90A 2UWQA 2WXOA 4US9A 1ET9A 4L23A 3ZJVA 1V2YA 3BIID 2Y5PA 1YQBA 1WFYA 5JXVA 2ZNVC 4ZYNA 5AUIA 3ZVVA 5FK9C 2WLBA 1TJEA 2LI5A 1WIAA 2GBKA 3T8MA 1L0XB 4IWQA 2LVQA 2KJRA 3PPAA 1GUAB 2MBOA 2IO0B 3TCAA 2MP2A 3URYA 3NJTA 2WWZA 2KC1A 2PJHA 3V6EB 5GMVA 1KLGD 4LNFA 3B1LX 4EEWA 1D5ZC 2Z0EB 2BYEA 1C1YB 1HTQA 3PRPB 2IYDB 2HJ8A 2GBMA 3HVDA 2NTSA 3C0RB 3VDZA 2K9XA 2LRWA 3UQBA 2K8BA 3VTUA 4KZ0A 1FXAA 4ZRKA 3BVGA 3RCZA 4HLEA 4ANVA 1RYJA 2QJLA 2D5GA 1NI3A 1TY0A 1WX7A 1VZ7A 2FNJB 1A70A 4MM3B 3ZNID 2LUMA 4A90A 4GMVA 4NZLB 1CZPA 3V6CB 1LGRA 4BKSA 2D3BA 4D2KA 2C7HA 1RAXA 3U7ZA 1SEBD 1DYQA 1FM0D 3B0AA 4A3PA 3ZW3A 2ZPYA 2OEDA 4RNAA 1MI0A 2PIAA 4JWUC 5JZEB 1N60A 2MH7A 5C2TB 2K6DB 2HTHA 2KFKB 1D5MC 1EU4A 1OQQA 3NVVA 1C3TA 2KYWA 3GS2A 5AZHA 1DOYA 1E8YA 2XK5B 4WAFA 1XLQA 4A3OA 1IP9A 2KTRB 3L10B 1FEHA 1NVID 2DAFA 3Q3OC 5AZFA 1GJZA 1UNSA 2IGDA 2RDHA 3Q3JA 3ZDTA 1KJTA 1PYWD 2PE9A 3ZNZB 2C7MB 1XT9B 1T0YA 2KHWB 2KNBA 4RGMA 4RGNA 1E10A 1RFAA 1DOXA 1TKGA 3WAPA 3VRAB 3PGEA 2BWFA 1JALA 3U52E 5BYQA 3T9LA 3DWMA 1I4GA 2L1AA 2L00B 1V86A 2DAJA 1PQSA 1J19A 1XEEA 1GOZA 2JYTA 4JQWC 4GGQA 2Y5BB 1OFFA 2DYBA 3AEAB 4XWWA 1PUTA 4NY0A 3AEDB 3VR8B 1QT9A 4W9HA 2JZ3B 1A5RA 3AEEB 3TIXA 3JVZX 1I35A 1PGXA 4WJPA 1WMHB 1WZ0A 1JW9D 1HZ6A 4J6IA 1QLBB 2G1EA 2KT7A 2V3SA 1OQRA 3QCAA 3MJ5A 3Q3NC 2W55A 1NI2A 5E6PA 2I1JA 4ANUA 1K53A 2LJ5A 3IAS1 2DYOA 3JSVB 3A9JA 2BGFA 1FMAD 1XO3A 3P4RB 2JQRB 4MH8A 3NZSA 3H7PB 1X1MA 3Q3MC 1XCTL 2K6QA 2DX5B 3DBLB 3QHTA 2O6VB 5I4DA 3DBRB 4TUUA 1J0GA 3AE8B 3ZRCA 1LM8B 2LASA 4OW0A 3WA0A 4KV2A 1XLOA 1UF0A 4DXGA 4GDKA 2M4NA 1N5WA 4LNOA 4B9KA 4FULA 1R4NB 1WH3A 3P42A 1WRDB 2JU6X 4E3CA 1P98A 2KDIA 2LXCA 2J42A 2WP9B 1QF6A 3WAOA 1GB1A 2MBQA 1WSPA 1WYWB 3HIZA 1S3SG 2LMCA 4RF0A 1F2RC 2IJ0A 4EE2A 1EUVB 1N63A 2KJHB 2HE7A 5E6NA 1WR1A 3DDCB 5D6JB 5C3JB 3MC8A 1E9MA 2J0MA 4M0WB 4B0MA 2H88B 1WXVA 3OJ3A 3QQ8B 5BMIA 2A4ZA 4NAWB 2QEJC 3DQVA 1C4CA 3U8ZA 4HKQA 2LGXA 1ZGUB 2K1FA 4LJPB 3MP9A 3TUOA 1D6EC 2OOBB 4W9DA 3AEFB 2D3AA 3DHGC 2V4IB 3VUYA 1PDXA 4HK2A 3AM9A 4JE3B 1YN3A 4S0RA 2JY6A 2MQJA 4HPLB 1L4DB 2MSED 4HWIB 2KWDA 3N9YC 2BVCA 4EZJA 1TIFA 1R4MB 3TEWA 2LGIA 2FUG1 4GDLA 3A9KA 3W5VB 3WANA 3R2IA 3QAQA 2YLMA 2WXKA 2XNAC 2WXNA 4A6QA 2YVCA 3QK0A 1J7CA 2KDFB 3CWIA 5HFYA 2QDFA 4XC2A 1FRDA 2J7QB 3AE4B 3RNAC 5AEKB 2C5LC 3W1SA 2E3TA 4A9AA 1WJ4A 2WDVB 4FHJA 2L76A 4WQMA 1AW7A 5TR5A 4W9FA 1D3ZA 4ICVA 3DVGY 4HDOA 3RNGC 1WM2A 1HXYD 4M02A 4WWOA 4OZCA 2NPTB 2W3RA 3ZTCA 4BZAA 2L52A 3HM3A 4DK5A 2M56B 1HTOA 4A55A 5KHQA 1E8XA 1IBXB 3APCA 3SFDB 2KFJA 3VQIA 4IWPA 2IZVB 1RRBA 2R61A 2V0GA 3AULA 4PYZA 1UELA 3KLSX 4PS3A 3RZWC 4ARCA 4W9JA 1DGJA 1NEKB 1V8CA 3EFUA 3UI3A 3M95A 2W82A 1FXIA 2NVUI 3IT6B 3RYTA 1VDVA 4LDTD 4OZAA 1WE6A 1TY2A 2JVCA 1KM7A 2R2OA 4JWSC 3ONSA 3OAWA 2V1YA 3WIMA 1JQ4A 3PZ7A 1M94A 1I42A 4LNKA 5J17A 4IOIE 3L13A 3WALA 2SAKA 3W2DA 2JWZA 2KWVB 3L4PA 1ZUD2 4LNNA 1OGWA 3NHEB 4JL9A 1JWBD 2XBBC 2N1WA 5AUKA 1WJNA
chains in the Genus database with same CATH topology
1E90A 3VTVA 4HCNB 1NDDA 1Y8RC 5JHBA 2L05A 2KQ7A 2UWQA 3H7PA 2WX0A 2ZPNA 1V2YA 2EMSA 4MGKE 3IG3A 3RUIB 2O6VA 1TGZB 1YQBA 3M62B 1WFYA 4AJWA 2ZNVC 1V80A 2L8JA 4BVUC 4ZYNA 2KJ6A 4W9CA 3L0WB 3TJPA 1J8CA 3ZVVA 4MH0E 4WJQA 2KMCA 2LI5A 1WIAA 4K81A 2GBKA 3T8MA 4MSQB 4FBJB 2BF8B 4IWQA 3I3TB 2IY1B 3KUZA 3HK0A 1UZXB 4GDKB 2LVQA 3DCGA 4URKA 2KJRA 3PPAA 2GMIC 3UQAA 1H4RA 3QA8A 4M8NA 3UIPB 1GUAB 2MBOA 2N4FA 2QHOA 4IUMB 2IO0B 2REXA 3TCAA 3BINA 2MW5A 3ZTDA 4X57B 2MP2A 1MG8A 3PRZA 3RZFA 2WWZA 2DYMA 3UF8A 1KOTA 2KC1A 1WGGA 1WJUA 2PJHA 4TV3A 3V6EB 2JRHA 3DVGX 4KIKB 1SE9A 1UBIA 1V5TA 5GMVA 4IG7B 3ZLZA 1LXDA 3B1LX 1YIWA 2Z0EB 4EEWA 4A20A 4W9EA 2ZVNA 4FJYA 3ENEA 2BYEA 2MA9B 2IY0B 4GB9A 1C1YB 3PRPB 1WI0A 2IYDB 2HJ8A 3KUDB 1P3QU 2GBMA 4NJ6A 3TL5A 4RM8A 3IVFA 3PLUA 4WJNA 4HCPB 3C0RB 3TBLD 3VDZA 4B95A 2CS4A 4NJ7A 2IO1B 4ANXA 2LRWA 3UQBA 2K8BA 3VTUA 4KZ0A 2JT4B 4ZRKA 1OEYJ 3VHTC 2M0XA 2D10A 3RCZA 2J0KA 1E8WA 2KMAA 4XZ4A 4HLEA 3BY4B 4ZRIA 4ANVA 2KZRA 1P0RA 3PV1A 4EKUA 2KD0A 2RPQA 2KWUB 4W9GA 2EMTA 2RR9A 1S1QB 3DOWA 3KVFB 1WX7A 5E6OA 4TQ1A 2FNJB 2Z59B 3PHXB 4AWJA 2MLBA 3ZNID 2M17A 4HXDA 4AUQC 2IO3B 2ZVOA 2LXAA 4GMVA 1IYFA 1XQQA 5AZGA 2NBWB 3V6CB 4BKSA 2G4SA 3QIJA 3QX1A 4ICUA 3VTWA 1GC7A 2MX2A 2C7HA 1RAXA 1ZW7A 4KVGB 1F9JA 2C60A 2R2QA 2C7NB 2AEHA 1WGHA 1LQBA 3PHWB 5C1ZA 1WF9A 5IAAC 1R4MI 3B0AA 4A3PA 4EFOA 3ZW3A 3U7DA 2ZPYA 5CHWA 2N7EA 5D7GA 5HKHA 4G0NB 1SGHA 1Q0WB 4GDLB 4E71A 2ZCCA 3A9KB 3MJWA 5JZEB 2NCNA 3SHQA 2LD9A 3UIOB 2K6DB 2GBJA 2FCQA 4LDTB 2HTHA 2KFKB 2BWES 2KQSA 2M1MA 3N30A 1E8ZA 4KIKA 1C3TA 5AZHA 3W1YA 1E8YA 2XK5B 2D3GA 4GIVA 4A3OA 4ASWC 1IP9A 2CKHB 2KTRB 5DPSA 3L10B 3VUWA 2FAZA 3VFKA 2DAFA 5AZFA 1GJZA 5IA7A 4NNJB 3K9OB 3V60A 2KWCA 3ZDTA 3Q3JA 4K7UA 1KJTA 3EECA 4NQKE 2ZCBA 4XX5A 4G50A 2PE9A 3ZNZB 2XEWA 2C7MB 1XT9B 1EF1A 2A5UA 1T0YA 2JUOA 4G11A 2M8SA 2KHWB 2KNBA 5C23A 1WY8A 4IC7B 1RFAA 1FXTB 3AU5A 2FCSA 5D2MB 3UGBB 4MJSA 2CHWA 3WAPA 1EO6A 2NPTA 1L2NA 1V5OA 3PGEA 3ZDMC 2BWFA 2MBEA 2N1VA 4DBGA 2D11A 3SDLC 4BKSD 2HD5B 4MM3A 3T9LA 4TKNA 2FCMA 2RD0A 2GBRA 3IHPC 5LLIA 4WWPA 2FCNA 1WXAA 2L00B 3L17A 3A33B 1H8CA 1V86A 2G4DB 2DAJA 3KUCB 2ASQA 4LCDE 4DDID 1PQSA 1J19A 1WR6E 2JZZA 5G55A 1Z5SB 4JQWC 1NBFC 2LRUA 2JXXA 4GGQA 2Y5BB 3MHSD 3DBHI 2DYBA 4GN1A 1V6EA 3PRMB 1G6JA 1Z2MA 2L7RA 3JW0X 4NY0A 4II2B 4JLCA 4EOYA 2AYOB 2NBUA 2ZEQA 3KH0A 4W9HA 2JZ3B 4DHZB 1A5RA 1L7YA 3QWZB 2FUHB 4KZCA 3DPDA 3JVZX 3TIXA 4WJPA 1UD7A 1I35A 1WMHB 2KN5A 4DHJB 3DBSA 1WZ0A 4WJOA 3R7QA 4J6IA 2MWSB 5G2NA 2I1KA 2NS5A 2V3SA 4FJZA 4E74A 1GC6A 1WM3A 2G45B 4EZKA 2C9WB 3QCAA 1QZEA 2KOXA 1U4AA 3MTNB 3M63B 2XBBC 2AL6A 1NI2A 4YL8A 2I1JA 3N32A 5E6PA 3VVWB 3H1UA 4ANUA 2LJ5A 4KSKC 3CSTA 1HE8A 2KK8A 5EDSA 3ZNHB 2DYOA 1Q5WB 2LVOA 3A9JA 3JSVB 3OJ4B 1YJ1A 1E7VA 4EZLA 2BGFA 4AOFA 3L08A 1GNUA 1YX5B 3CSFA 3NZSA 4P7IA 3LDZE 5DPTA 2RSUA 1VCBA 5FR6A 4AP4C 3CMMB 3H7PB 1X1MA 2K6QA 2DX5B 2WYQA 3UINB 3QHTA 2JRIB 2KXJA 2O6VB 2BYVE 2ZZPB 2LUEA 2KDEB 3NS8A 3PT2B 2DZIA 2DZKA 2O2VB 3RD2A 4TUUA 1J0GA 1WGRA 2CU1A 3ZRCA 1LM8B 2LASA 2B3AA 2PE6B 3WA0A 4ANWA 3A4RA 3PREA 1UBQA 4IM0A 2K39A 3HM6X 4KV2A 5D94A 2ZNVB 4FADA 4PS8A 4GDKA 1E7UA 2M4NA 4KSLC 4WQOB 2N9PC 4W9IA 4B9KA 4FULA 2MBBB 1WH3A 2WX1A 4ZRJA 1WRDB 1WGYA 4E3CA 1P98A 2L0TA 1TTNA 2KDIA 4NQLB 2D2QA 3LJ3A 2LXCA 1Q1OA 2N9XA 2MP2B 4FA6A 2KX3A 4GU2A 1UGMA 5DPWA 4BKGA 3WAOA 3ML8A 2MBQA 4HDQA 3DVNV 1WYWB 3HIZA 1S3SG 4MGYE 3X0WA 3HHMA 3N3KB 3VH4B 1EUVB 4PS7A 4MDKE 3ALBA 2GBNA 2KJHB 4KDIC 3V62A 4CYEA 2HE7A 4N9F4 5E6NA 3ZNGC 4MEMA 1WXMA 3QARA 3EC8A 1WR1A 2RGFA 3U30A 3DDCB 5D6JB 4MSMB 3VXWA 3R7RA 2J0MA 4MGIE 3PS6A 1YD8U 4M0WB 1UH6A 3AU4A 3B08A 3GZNI 1WXVA 3PLVA 1AARA 2AWTA 4IM3A 4BKTA 1WX9A 3QC8B 4I6LB 2BYFA 4LJOB 4F7ZA 1VD2A 3OJ3A 1WZ3A 3QQ8B 4WAAA 4ZDVA 4IM2A 2J0JA 3JYUA 3L54A 1OTRB 1WE7A 2KLGA 2A4ZA 1TBEA 3DBLI 3PZDA 4NAWB 2IBIB 2V4LA 4IW0A 3DQVA 1XD3B 3U8ZA 3DBRI 4G3XB 5J2RA 2LGXA 4JGHB 1ZGUB 2K1FA 4LJPB 2K8CA 2KO3A 2PEAA 3GOEA 3VUXA 3APFA 2OOBB 4W9DA 4BBNF 2LZ6A 2O2VA 1WGDA 2KTFA 3P2BA 1SIFA 4DHZE 4JIOU 4IWOA 4OVUA 3NZUA 2DHZA 3H6NA 4BFRA 2KANA 1WX8A 2CHXA 3VUYA 1WJ6A 5CHFA 2N7DA 4BOSC 5L95C 1R4NI 4HK2A 2W9NA 1CMXB 3NY5A 2NBVB 2DENB 2JY6A 2MQJA 4HPLB 2Z0DB 3Q3FA 3VAWA 2MSED 4HWIB 4F1SA 3TMPB 4EZJA 2MCNB 5DPRA 4KDLB 3ZKJC 1OEYA 4GDLA 5LXIB 3A9KA 5LXHA 1TZ1A 4DHJD 2CR5A 3WANA 2MBHA 3H9DA 3A1QB 3QAQA 4WWNA 2YLMA 5KHOA 1V9JA 4RM9A 2L0FA 2KFKA 2JF5A 2YVCA 3QK0A 4NPNA 3W1SC 4CHKA 4CO7A 1OQYA 2KDFB 2KDBA 3PVLA 1P9DU 3IBEA 3EHVA 4XC2A 2XK5A 2J7QB 4W9KA 5CTRC 3QJZA 2IO2B 2ZJDA 4I6NB 2KTRA 3ZO5B 2C5LC 5AEKB 4HPMB 4GXBA 4DWFA 3W1SA 3RULA 1WJ4A 3NOBA 2KX0A 3KW5B 4FHJA 2LGDA 5DCNA 2L76A 3ECIA 2L3ZA 3ZUNA 1V49A 5TR5A 3APDA 4W9FA 1D3ZA 2EKEC 2N9EB 1BT0A 3D32A 3PTFC 4ICVA 4MGZE 2JPHA 1GG3A 2BKRB 2WDTB 3DVGY 2AL3A 2GOWA 4HDOA 5J18A 5JHAA 2UYZB 4TQ0A 1WM2A 2KKCA 3R3MA 4RMAA 3AI5A 2MRPA 4WWOA 4MJSB 2FIDA 1EF5A 5CX3A 2NPTB 3DVNU 2O6VD 3H7SA 3KYDD 3ZTCA 4NAWA 3HM3A 4DK5A 5KHQA 3CF6E 1E8XA 3APCA 3ML9A 1RLFA 4BOZB 2PPHA 3IFWB 2KFJA 3L16A 3VQIA 4HVBA 1IPGA 4IWPA 1E5WA 4OVVA 4W9LA 4DXAB 3PSEB 3KYCD 2IZVB 4MELA 4B6WA 1RRBA 2DZMA 4BBNC 5BO4B 1K8RB 5L83A 3VH3B 3A9JB 3AULA 3ZRFA 2VRRB 4PYZA 1UELA 4PS3A 3RZWC 4FLHA 4PYUA 3WAMA 4FJVB 2KC2A 4K1RB 4W9JA 2G3QB 3EFUA 3SU8X 4II3B 3ZIMA 4GSWA 3M95A 1WXSA 5JH5C 2NVUI 2LVPA 3OLMD 3M3JA 2KLCA 4AJYB 1WMHA 5CHVC 1ZKHA 3RYTA 3O65B 4LDTD 2LGYA 3R66C 4M8MA 3RT3B 3S2AA 1WE6A 2BKFA 2D07B 2JVCA 2R2OA 1KM7A 3K9PB 4HJKA 3A4SC 4GOCA 3ONSA 2OJRA 2K8HA 4DDGD 2BPSA 3OAWA 1YX6B 3SD5A 3A1QA 4FN2A 2V1YA 3WIMA 4F8CB 1M94A 1I42A 4I6PA 5J17A 3X23A 3AXCA 3L13A 4EUTA 2K25A 2NR2A 4K7SA 3WALA 1KLVA 4K7WA 2JWZA 2KWVB 3V61A 2LWPA 1ISNA 2KVRA 2CHZA 1P1AA 1LFDA 4FHKA 1OGWA 3NHEB 4JL9A 3JSVA 2FIFA 1JRUA 2N1WA 1V81A 1WJNA 2DZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E90 A;  3VTV A;  4HCN B;  1NDD A;  1Y8R C;  5JHB A;  2L05 A;  2KQ7 A;  2UWQ A;  3H7P A;  2WX0 A;  2ZPN A;  1V2Y A;  2EMS A;  4MGK E;  3IG3 A;  3RUI B;  2O6V A;  1TGZ B;  1YQB A;  3M62 B;  1WFY A;  4AJW A;  2ZNV C;  1V80 A;  2L8J A;  4BVU C;  4ZYN A;  2KJ6 A;  4W9C A;  3L0W B;  3TJP A;  1J8C A;  3ZVV A;  4MH0 E;  4WJQ A;  2KMC A;  2LI5 A;  1WIA A;  4K81 A;  2GBK A;  3T8M A;  4MSQ B;  4FBJ B;  2BF8 B;  4IWQ A;  3I3T B;  2IY1 B;  3KUZ A;  3HK0 A;  1UZX B;  4GDK B;  2LVQ A;  3DCG A;  4URK A;  2KJR A;  3PPA A;  2GMI C;  3UQA A;  1H4R A;  3QA8 A;  4M8N A;  3UIP B;  1GUA B;  2MBO A;  2N4F A;  2QHO A;  4IUM B;  2IO0 B;  2REX A;  3TCA A;  3BIN A;  2MW5 A;  3ZTD A;  4X57 B;  2MP2 A;  1MG8 A;  3PRZ A;  3RZF A;  2WWZ A;  2DYM A;  3UF8 A;  1KOT A;  2KC1 A;  1WGG A;  1WJU A;  2PJH A;  4TV3 A;  3V6E B;  2JRH A;  3DVG X;  4KIK B;  1SE9 A;  1UBI A;  1V5T A;  5GMV A;  4IG7 B;  3ZLZ A;  1LXD A;  3B1L X;  1YIW A;  2Z0E B;  4EEW A;  4A20 A;  4W9E A;  2ZVN A;  4FJY A;  3ENE A;  2BYE A;  2MA9 B;  2IY0 B;  4GB9 A;  1C1Y B;  3PRP B;  1WI0 A;  2IYD B;  2HJ8 A;  3KUD B;  1P3Q U;  2GBM A;  4NJ6 A;  3TL5 A;  4RM8 A;  3IVF A;  3PLU A;  4WJN A;  4HCP B;  3C0R B;  3TBL D;  3VDZ A;  4B95 A;  2CS4 A;  4NJ7 A;  2IO1 B;  4ANX A;  2LRW A;  3UQB A;  2K8B A;  3VTU A;  4KZ0 A;  2JT4 B;  4ZRK A;  1OEY J;  3VHT C;  2M0X A;  2D10 A;  3RCZ A;  2J0K A;  1E8W A;  2KMA A;  4XZ4 A;  4HLE A;  3BY4 B;  4ZRI A;  4ANV A;  2KZR A;  1P0R A;  3PV1 A;  4EKU A;  2KD0 A;  2RPQ A;  2KWU B;  4W9G A;  2EMT A;  2RR9 A;  1S1Q B;  3DOW A;  3KVF B;  1WX7 A;  5E6O A;  4TQ1 A;  2FNJ B;  2Z59 B;  3PHX B;  4AWJ A;  2MLB A;  3ZNI D;  2M17 A;  4HXD A;  4AUQ C;  2IO3 B;  2ZVO A;  2LXA A;  4GMV A;  1IYF A;  1XQQ A;  5AZG A;  2NBW B;  3V6C B;  4BKS A;  2G4S A;  3QIJ A;  3QX1 A;  4ICU A;  3VTW A;  1GC7 A;  2MX2 A;  2C7H A;  1RAX A;  1ZW7 A;  4KVG B;  1F9J A;  2C60 A;  2R2Q A;  2C7N B;  2AEH A;  1WGH A;  1LQB A;  3PHW B;  5C1Z A;  1WF9 A;  5IAA C;  1R4M I;  3B0A A;  4A3P A;  4EFO A;  3ZW3 A;  3U7D A;  2ZPY A;  5CHW A;  2N7E A;  5D7G A;  5HKH A;  4G0N B;  1SGH A;  1Q0W B;  4GDL B;  4E71 A;  2ZCC A;  3A9K B;  3MJW A;  5JZE B;  2NCN A;  3SHQ A;  2LD9 A;  3UIO B;  2K6D B;  2GBJ A;  2FCQ A;  4LDT B;  2HTH A;  2KFK B;  2BWE S;  2KQS A;  2M1M A;  3N30 A;  1E8Z A;  4KIK A;  1C3T A;  5AZH A;  3W1Y A;  1E8Y A;  2XK5 B;  2D3G A;  4GIV A;  4A3O A;  4ASW C;  1IP9 A;  2CKH B;  2KTR B;  5DPS A;  3L10 B;  3VUW A;  2FAZ A;  3VFK A;  2DAF A;  5AZF A;  1GJZ A;  5IA7 A;  4NNJ B;  3K9O B;  3V60 A;  2KWC A;  3ZDT A;  3Q3J A;  4K7U A;  1KJT A;  3EEC A;  4NQK E;  2ZCB A;  4XX5 A;  4G50 A;  2PE9 A;  3ZNZ B;  2XEW A;  2C7M B;  1XT9 B;  1EF1 A;  2A5U A;  1T0Y A;  2JUO A;  4G11 A;  2M8S A;  2KHW B;  2KNB A;  5C23 A;  1WY8 A;  4IC7 B;  1RFA A;  1FXT B;  3AU5 A;  2FCS A;  5D2M B;  3UGB B;  4MJS A;  2CHW A;  3WAP A;  1EO6 A;  2NPT A;  1L2N A;  1V5O A;  3PGE A;  3ZDM C;  2BWF A;  2MBE A;  2N1V A;  4DBG A;  2D11 A;  3SDL C;  4BKS D;  2HD5 B;  4MM3 A;  3T9L A;  4TKN A;  2FCM A;  2RD0 A;  2GBR A;  3IHP C;  5LLI A;  4WWP A;  2FCN A;  1WXA A;  2L00 B;  3L17 A;  3A33 B;  1H8C A;  1V86 A;  2G4D B;  2DAJ A;  3KUC B;  2ASQ A;  4LCD E;  4DDI D;  1PQS A;  1J19 A;  1WR6 E;  2JZZ A;  5G55 A;  1Z5S B;  4JQW C;  1NBF C;  2LRU A;  2JXX A;  4GGQ A;  2Y5B B;  3MHS D;  3DBH I;  2DYB A;  4GN1 A;  1V6E A;  3PRM B;  1G6J A;  1Z2M A;  2L7R A;  3JW0 X;  4NY0 A;  4II2 B;  4JLC A;  4EOY A;  2AYO B;  2NBU A;  2ZEQ A;  3KH0 A;  4W9H A;  2JZ3 B;  4DHZ B;  1A5R A;  1L7Y A;  3QWZ B;  2FUH B;  4KZC A;  3DPD A;  3JVZ X;  3TIX A;  4WJP A;  1UD7 A;  1I35 A;  1WMH B;  2KN5 A;  4DHJ B;  3DBS A;  1WZ0 A;  4WJO A;  3R7Q A;  4J6I A;  2MWS B;  5G2N A;  2I1K A;  2NS5 A;  2V3S A;  4FJZ A;  4E74 A;  1GC6 A;  1WM3 A;  2G45 B;  4EZK A;  2C9W B;  3QCA A;  1QZE A;  2KOX A;  1U4A A;  3MTN B;  3M63 B;  2XBB C;  2AL6 A;  1NI2 A;  4YL8 A;  2I1J A;  3N32 A;  5E6P A;  3VVW B;  3H1U A;  4ANU A;  2LJ5 A;  4KSK C;  3CST A;  1HE8 A;  2KK8 A;  5EDS A;  3ZNH B;  2DYO A;  1Q5W B;  2LVO A;  3A9J A;  3JSV B;  3OJ4 B;  1YJ1 A;  1E7V A;  4EZL A;  2BGF A;  4AOF A;  3L08 A;  1GNU A;  1YX5 B;  3CSF A;  3NZS A;  4P7I A;  3LDZ E;  5DPT A;  2RSU A;  1VCB A;  5FR6 A;  4AP4 C;  3CMM B;  3H7P B;  1X1M A;  2K6Q A;  2DX5 B;  2WYQ A;  3UIN B;  3QHT A;  2JRI B;  2KXJ A;  2O6V B;  2BYV E;  2ZZP B;  2LUE A;  2KDE B;  3NS8 A;  3PT2 B;  2DZI A;  2DZK A;  2O2V B;  3RD2 A;  4TUU A;  1J0G A;  1WGR A;  2CU1 A;  3ZRC A;  1LM8 B;  2LAS A;  2B3A A;  2PE6 B;  3WA0 A;  4ANW A;  3A4R A;  3PRE A;  1UBQ A;  4IM0 A;  2K39 A;  3HM6 X;  4KV2 A;  5D94 A;  2ZNV B;  4FAD A;  4PS8 A;  4GDK A;  1E7U A;  2M4N A;  4KSL C;  4WQO B;  2N9P C;  4W9I A;  4B9K A;  4FUL A;  2MBB B;  1WH3 A;  2WX1 A;  4ZRJ A;  1WRD B;  1WGY A;  4E3C A;  1P98 A;  2L0T A;  1TTN A;  2KDI A;  4NQL B;  2D2Q A;  3LJ3 A;  2LXC A;  1Q1O A;  2N9X A;  2MP2 B;  4FA6 A;  2KX3 A;  4GU2 A;  1UGM A;  5DPW A;  4BKG A;  3WAO A;  3ML8 A;  2MBQ A;  4HDQ A;  3DVN V;  1WYW B;  3HIZ A;  1S3S G;  4MGY E;  3X0W A;  3HHM A;  3N3K B;  3VH4 B;  1EUV B;  4PS7 A;  4MDK E;  3ALB A;  2GBN A;  2KJH B;  4KDI C;  3V62 A;  4CYE A;  2HE7 A;  4N9F 4;  5E6N A;  3ZNG C;  4MEM A;  1WXM A;  3QAR A;  3EC8 A;  1WR1 A;  2RGF A;  3U30 A;  3DDC B;  5D6J B;  4MSM B;  3VXW A;  3R7R A;  2J0M A;  4MGI E;  3PS6 A;  1YD8 U;  4M0W B;  1UH6 A;  3AU4 A;  3B08 A;  3GZN I;  1WXV A;  3PLV A;  1AAR A;  2AWT A;  4IM3 A;  4BKT A;  1WX9 A;  3QC8 B;  4I6L B;  2BYF A;  4LJO B;  4F7Z A;  1VD2 A;  3OJ3 A;  1WZ3 A;  3QQ8 B;  4WAA A;  4ZDV A;  4IM2 A;  2J0J A;  3JYU A;  3L54 A;  1OTR B;  1WE7 A;  2KLG A;  2A4Z A;  1TBE A;  3DBL I;  3PZD A;  4NAW B;  2IBI B;  2V4L A;  4IW0 A;  3DQV A;  1XD3 B;  3U8Z A;  3DBR I;  4G3X B;  5J2R A;  2LGX A;  4JGH B;  1ZGU B;  2K1F A;  4LJP B;  2K8C A;  2KO3 A;  2PEA A;  3GOE A;  3VUX A;  3APF A;  2OOB B;  4W9D A;  4BBN F;  2LZ6 A;  2O2V A;  1WGD A;  2KTF A;  3P2B A;  1SIF A;  4DHZ E;  4JIO U;  4IWO A;  4OVU A;  3NZU A;  2DHZ A;  3H6N A;  4BFR A;  2KAN A;  1WX8 A;  2CHX A;  3VUY A;  1WJ6 A;  5CHF A;  2N7D A;  4BOS C;  5L95 C;  1R4N I;  4HK2 A;  2W9N A;  1CMX B;  3NY5 A;  2NBV B;  2DEN B;  2JY6 A;  2MQJ A;  4HPL B;  2Z0D B;  3Q3F A;  3VAW A;  2MSE D;  4HWI B;  4F1S A;  3TMP B;  4EZJ A;  2MCN B;  5DPR A;  4KDL B;  3ZKJ C;  1OEY A;  4GDL A;  5LXI B;  3A9K A;  5LXH A;  1TZ1 A;  4DHJ D;  2CR5 A;  3WAN A;  2MBH A;  3H9D A;  3A1Q B;  3QAQ A;  4WWN A;  2YLM A;  5KHO A;  1V9J A;  4RM9 A;  2L0F A;  2KFK A;  2JF5 A;  2YVC A;  3QK0 A;  4NPN A;  3W1S C;  4CHK A;  4CO7 A;  1OQY A;  2KDF B;  2KDB A;  3PVL A;  1P9D U;  3IBE A;  3EHV A;  4XC2 A;  2XK5 A;  2J7Q B;  4W9K A;  5CTR C;  3QJZ A;  2IO2 B;  2ZJD A;  4I6N B;  2KTR A;  3ZO5 B;  2C5L C;  5AEK B;  4HPM B;  4GXB A;  4DWF A;  3W1S A;  3RUL A;  1WJ4 A;  3NOB A;  2KX0 A;  3KW5 B;  4FHJ A;  2LGD A;  5DCN A;  2L76 A;  3ECI A;  2L3Z A;  3ZUN A;  1V49 A;  5TR5 A;  3APD A;  4W9F A;  1D3Z A;  2EKE C;  2N9E B;  1BT0 A;  3D32 A;  3PTF C;  4ICV A;  4MGZ E;  2JPH A;  1GG3 A;  2BKR B;  2WDT B;  3DVG Y;  2AL3 A;  2GOW A;  4HDO A;  5J18 A;  5JHA A;  2UYZ B;  4TQ0 A;  1WM2 A;  2KKC A;  3R3M A;  4RMA A;  3AI5 A;  2MRP A;  4WWO A;  4MJS B;  2FID A;  1EF5 A;  5CX3 A;  2NPT B;  3DVN U;  2O6V D;  3H7S A;  3KYD D;  3ZTC A;  4NAW A;  3HM3 A;  4DK5 A;  5KHQ A;  3CF6 E;  1E8X A;  3APC A;  3ML9 A;  1RLF A;  4BOZ B;  2PPH A;  3IFW B;  2KFJ A;  3L16 A;  3VQI A;  4HVB A;  1IPG A;  4IWP A;  1E5W A;  4OVV A;  4W9L A;  4DXA B;  3PSE B;  3KYC D;  2IZV B;  4MEL A;  4B6W A;  1RRB A;  2DZM A;  4BBN C;  5BO4 B;  1K8R B;  5L83 A;  3VH3 B;  3A9J B;  3AUL A;  3ZRF A;  2VRR B;  4PYZ A;  1UEL A;  4PS3 A;  3RZW C;  4FLH A;  4PYU A;  3WAM A;  4FJV B;  2KC2 A;  4K1R B;  4W9J A;  2G3Q B;  3EFU A;  3SU8 X;  4II3 B;  3ZIM A;  4GSW A;  3M95 A;  1WXS A;  5JH5 C;  2NVU I;  2LVP A;  3OLM D;  3M3J A;  2KLC A;  4AJY B;  1WMH A;  5CHV C;  1ZKH A;  3RYT A;  3O65 B;  4LDT D;  2LGY A;  3R66 C;  4M8M A;  3RT3 B;  3S2A A;  1WE6 A;  2BKF A;  2D07 B;  2JVC A;  2R2O A;  1KM7 A;  3K9P B;  4HJK A;  3A4S C;  4GOC A;  3ONS A;  2OJR A;  2K8H A;  4DDG D;  2BPS A;  3OAW A;  1YX6 B;  3SD5 A;  3A1Q A;  4FN2 A;  2V1Y A;  3WIM A;  4F8C B;  1M94 A;  1I42 A;  4I6P A;  5J17 A;  3X23 A;  3AXC A;  3L13 A;  4EUT A;  2K25 A;  2NR2 A;  4K7S A;  3WAL A;  1KLV A;  4K7W A;  2JWZ A;  2KWV B;  3V61 A;  2LWP A;  1ISN A;  2KVR A;  2CHZ A;  1P1A A;  1LFD A;  4FHK A;  1OGW A;  3NHE B;  4JL9 A;  3JSV A;  2FIF A;  1JRU A;  2N1W A;  1V81 A;  1WJN A;  2DZJ A; 
#chains in the Genus database with same CATH topology
 1NDD A;  1Y8R C;  2IDY A;  4YXD B;  2JWU A;  2PW9 A;  1L6V A;  2EMS A;  3IG3 A;  1KF6 B;  3RUI B;  3M62 B;  1V1P B;  1V80 A;  3DHI C;  1F52 A;  3LYY A;  1HEZ E;  2GB1 A;  3N1Z C;  3U2S C;  2VZK D;  3HRD D;  3HK0 A;  3EFC A;  1TS4 A;  1H4R A;  3UIP B;  2N4F A;  5IN7 A;  4FXC A;  4X57 B;  1MVK A;  1TS5 A;  3ETR A;  1P7F A;  1KOT A;  1WGG A;  3E9S A;  4TV3 A;  3DVG X;  4KIK B;  2WXM A;  1SE9 A;  1JWU D;  3ZLZ A;  2ZVN A;  4P1B C;  4A8X C;  2BBC A;  3KUD B;  4NJ6 A;  2KMM A;  3AE9 B;  2IO1 B;  4ANX A;  3HUI A;  4TSS A;  4YTP B;  1D5X C;  2JT4 B;  5HG2 A;  1OEY J;  3VHT C;  2M0X A;  2J0K A;  1E8W A;  2KMA A;  3BY4 B;  4ZRI A;  2KZR A;  3TEZ A;  2KWU B;  4C4V A;  2RR9 A;  3W5U B;  2ONQ A;  3AB5 A;  3ZYY X;  1F0Z A;  4YWG G;  4AUQ C;  2IO3 B;  5AZG A;  1ZOY B;  5D3D A;  4KVG B;  1F9J A;  1TKE A;  2VH1 A;  1ZDV A;  2JYE A;  1N6Z A;  1VRA B;  2AQ1 B;  4EFO A;  4P6V F;  3U7D A;  5HKH A;  2WS3 B;  4G0N B;  2ZCC A;  3MJW A;  3UIO B;  2FCQ A;  2IGH A;  4LDT B;  2JX5 A;  3N30 A;  4XWT A;  4ASW C;  3TSS A;  2CKH B;  1F2R I;  5DPS A;  4K3C A;  1IGC A;  4HRO A;  4HPP A;  2AQ2 B;  4K7U A;  3EEC A;  4XX5 A;  4G50 A;  2K0P A;  5D3I B;  1SB3 C;  1XCQ L;  1EF1 A;  1MG4 A;  1SE2 A;  3Q2A C;  3KQ4 A;  2FCS A;  2FBW B;  4MJS A;  2QIE B;  1L2N A;  1D4B A;  1V5O A;  2N7J A;  2MBE A;  2N1V A;  3AEC B;  1JWA D;  3SDL C;  4BKS D;  4L2Y A;  4MM3 A;  1T0S C;  2FCM A;  2RD0 A;  4ZHO A;  3IHP C;  5LLI A;  3A33 B;  2G4D B;  3KUC B;  4HEA 1;  2WXF A;  1Z5S B;  4REZ A;  1V6E A;  1Z2M A;  3JW0 X;  1FRR A;  4II2 B;  4JLC A;  3GE8 C;  2NBU A;  2ZEQ A;  4S17 A;  3TEX A;  1L7Y A;  2X8X X;  1RWS A;  2KN5 A;  3DBS A;  3R7Q A;  5G5H A;  1FCL A;  4RGT A;  2NS5 A;  4ZHP A;  4E74 A;  1GC6 A;  3KWV A;  1WM3 A;  2CU3 A;  4EZK A;  2C9W B;  2KOX A;  4ACF A;  1U4A A;  2WXL A;  1K52 A;  3I63 C;  3VVW B;  3N32 A;  2DWQ A;  2N0S B;  1KRH A;  4KSK C;  3CST A;  1HE8 A;  2KK8 A;  5EDS A;  3ZNH B;  2LVO A;  4AOF A;  1YX5 B;  2QIL A;  4P7I A;  5DPT A;  3B2G A;  3MFG A;  2WXH A;  4RFB A;  3AV8 A;  2JRI B;  2KXJ A;  2ZZP B;  1FIQ A;  2O2V B;  3RD2 A;  2MHJ A;  3WCQ A;  1WGR A;  3A4R A;  4IM0 A;  3R8B A;  4PS8 A;  2Q5W D;  2MBB B;  2WX1 A;  2OJW A;  3FKY A;  2D2Q A;  2MP2 B;  4GU2 A;  4BKG A;  5HI1 A;  4O1N A;  3X0W A;  3R2T A;  1YQ3 B;  4PS7 A;  4NAM A;  4MDK E;  4KDI C;  1SF0 A;  4N9F 4;  3ZNG C;  1N61 A;  2RGF A;  1SE4 A;  3U30 A;  5BMH A;  4MSM B;  4H2A A;  3VXW A;  4MGI E;  1VR9 A;  2RDG A;  2WXI A;  1K50 A;  5T8I A;  1WX9 A;  3QC8 B;  4I6L B;  4F7Z A;  2XN9 C;  1I4Q A;  1WZ3 A;  4AQ7 A;  2J0J A;  1SXT A;  3OWE B;  1TBE A;  3DBL I;  5H8Y E;  1XLP A;  2V4L A;  2H89 B;  1XD3 B;  3DBR I;  4TMA B;  1QOG A;  1B9R A;  3NVY A;  3ZXV A;  2K8C A;  2KO3 A;  4BBN F;  2N9L A;  1SIF A;  3NZU A;  2KAN A;  4BOS C;  5L95 C;  1R4N I;  1L5P A;  3P4S B;  2W9N A;  3AN1 A;  3Q3F A;  2MCN B;  5DPR A;  4KDL B;  1OEY A;  5LXI B;  4GLS C;  4DHJ D;  3A1Q B;  3Q8E A;  2L0F A;  1Y56 A;  2JF5 A;  4CO7 A;  1VLB A;  2KDB A;  3PVL A;  3EHV A;  1WWT A;  5CTR C;  4I6N B;  4HPM B;  4DWF A;  1NYQ A;  1ZPS A;  2WXJ A;  3RMK C;  3NOB A;  2KX0 A;  3Q8C A;  2L3Z A;  1V49 A;  1JML A;  1N5X A;  4MGZ E;  1BT0 A;  1GG3 A;  2BKR B;  5J18 A;  2BS2 B;  5JHA A;  3O13 A;  3V3X A;  2KKC A;  4RMA A;  1SIJ A;  3AI5 A;  4KKJ A;  2FID A;  1EF5 A;  5CX3 A;  3DVN U;  3H7S A;  4NAW A;  1EWY C;  1TS2 A;  1IPG A;  4DXA B;  4W9L A;  4MEL A;  1QKZ A;  2BS3 B;  4B6W A;  2VRR B;  1L6U A;  4YSY B;  3MHZ A;  1UWX A;  4FJV B;  1PGB A;  3CIR B;  4QAY A;  3ZIM A;  4GSW A;  5JH5 C;  4AJY B;  2BT6 A;  3O65 B;  2LGY A;  3RT3 B;  2QMT A;  2D07 B;  4YTM B;  3K9P B;  3A4S C;  2BPS A;  4FN2 A;  1CQV A;  3X23 A;  3AXC A;  3BZD B;  4K7S A;  1KLV A;  1AWD A;  3V61 A;  2CHZ A;  4CQN A;  1P1A A;  4FHK A;  3FIL B;  1VJK A;  3A9J B;  2DZJ A;  5JHB A;  3N20 C;  2L05 A;  4RH6 A;  2WX0 A;  2LGS A;  2ZPN A;  3P1M A;  2IPK D;  4MGK E;  1TGZ B;  2W3S A;  2L8J A;  3TJP A;  4W9C A;  2KAC A;  3L0W B;  1J8C A;  4MH0 E;  4WJQ A;  4LTU A;  2VH2 A;  4K81 A;  4M00 A;  4FBJ B;  2BF8 B;  2IY1 B;  1AN8 A;  4GDK B;  3DCG A;  2GMI C;  3GE3 C;  2MEK A;  3NRZ A;  4IUM B;  2K5P A;  2MW5 A;  3GP7 A;  3ZTD A;  2WDQ B;  1YJJ A;  1RFK A;  4OVZ A;  2DYM A;  2INP E;  1QOA A;  2J53 A;  2JRH A;  1M4V A;  1UBI A;  1V5T A;  1LXD A;  2BYT A;  4W9E A;  2ZW1 A;  3ENE A;  2IY0 B;  4GB9 A;  4WIP A;  4RM8 A;  3IVF A;  2JXT A;  4WJN A;  4HCP B;  3TBL D;  4B95 A;  3SEB A;  5EE3 A;  2WQY B;  1BXT A;  3T3O A;  1PFD A;  1B1Z A;  4XZ4 A;  4EKU A;  1XLN A;  4W9G A;  1I4H A;  1S1Q B;  1K51 A;  3DOW A;  4R3D A;  5E6O A;  3PO0 A;  4TQ1 A;  2Z59 B;  1MFW A;  2INN E;  4AWJ A;  2MLB A;  2M17 A;  2BS4 B;  4HXD A;  1T3Q A;  2K22 A;  2ZVO A;  2LXA A;  1TYG B;  3I9V 1;  2G4S A;  3QIJ A;  4ICU A;  4WWM A;  2Y5C A;  2PVO D;  1GC7 A;  2MX2 A;  2R2Q A;  2C7N B;  1JCK B;  3PHW B;  1LQB A;  4ZRQ A;  1P7E A;  1WF9 A;  5IAA C;  3DBH B;  4PT5 A;  4KGR A;  2KQ4 X;  2N7E A;  3BYT B;  3BVM A;  4GDL B;  2IGG A;  3A9K B;  4E71 A;  2NCN A;  2GBJ A;  2EKI A;  2BWE S;  4KIK A;  3W1Y A;  4GIV A;  2I2Y A;  3BYY B;  3VUW A;  2FAZ A;  4L1B A;  3VFK A;  5IA7 A;  2KAJ A;  3P4P B;  1C79 A;  1I4P A;  1ZXH A;  3K9O B;  3V60 A;  1TS3 A;  1TZO A;  4NQK E;  3N1Y C;  2ZCB A;  1UGJ A;  4G11 A;  4IC7 B;  3AU5 A;  5FR3 A;  5D2M B;  2E6X A;  5TSS A;  4DBG A;  2D11 A;  3P63 A;  1JRP A;  1MPE A;  4N58 A;  3ZGZ A;  2FCN A;  3L17 A;  1H8C A;  4DDI D;  2ASQ A;  1E6E B;  3AE1 B;  1WR6 E;  4LNI A;  3VR9 B;  1C78 A;  5BMG A;  2JXX A;  2INC C;  2D3C A;  4GN1 A;  3PRM B;  1G6J A;  1WGK A;  3DHH C;  2QC8 A;  4EOY A;  2BB5 A;  4DHZ B;  3KH0 A;  1KLU D;  2FUH B;  1UD7 A;  1FFU A;  4WJO A;  5H92 C;  2BQQ A;  4KGT A;  2MWS B;  5G2N A;  1YNT E;  2L83 A;  4XE0 A;  3U4E G;  2KVZ A;  3ABV B;  3MTN B;  3M63 B;  1FO4 A;  4YTN B;  2AL6 A;  4YL8 A;  4HJG E;  3H1U A;  3RPF C;  3GZN B;  1YJ1 A;  4BAX A;  1WYG A;  3B2F A;  3CSF A;  5FR6 A;  2YEP F;  3CMM B;  3J9C A;  2WYQ A;  2KDE B;  3PT2 B;  1ROE A;  2DZI A;  2DZK A;  3ZQ4 A;  2J52 A;  2CU1 A;  2W54 A;  4B0E A;  2B3A A;  3PRE A;  2K39 A;  3HM6 X;  5D94 A;  4JX1 C;  1E7U A;  4KSL C;  2N9P C;  4W9I A;  3FAH A;  4ZRJ A;  1WGY A;  1IUE A;  1TTN A;  1R7S A;  5G5G A;  1Q1O A;  2N9X A;  4FA6 A;  1MHX A;  5DPW A;  4YSZ B;  3ML8 A;  4HDQ A;  1V97 A;  3AEG B;  4MGY E;  3AE7 B;  3VH4 B;  4WUR A;  2IND C;  1RM6 C;  1FCC C;  4J3O D;  1QOB A;  1YD8 U;  3AU4 A;  1L0V B;  4XDC A;  3B08 A;  4ITK A;  1GB4 A;  1AAR A;  4IM3 A;  4WH4 A;  3GB1 A;  3PZ8 A;  2CJN A;  4LJO B;  1GPX A;  4C4V B;  3JYU A;  3L54 A;  1KH0 A;  3PZD A;  3HVZ A;  2IBI B;  4IW0 A;  4K3B A;  3IAM 1;  1YOV B;  4JGH B;  3VUX A;  2VZK B;  1BUI C;  2LZ6 A;  2O2V A;  4C80 A;  1T6B X;  3P2B A;  4JIO U;  1C9F A;  1E0Z A;  3H6N A;  4BFR A;  1WX8 A;  1WJ6 A;  2QCZ A;  4KGS A;  5CHF A;  3LXF A;  5BYR A;  1PGA A;  1ACC A;  1ZXI A;  2NBV B;  4LLG M;  1VZ8 A;  2Z0D B;  4F1S A;  3TMP B;  3ZKJ C;  1IGD A;  3EUB 2;  3Q8F A;  3V05 A;  3NG0 A;  2CR5 A;  4N59 A;  3H9D A;  3Q8A A;  5KHO A;  1SE3 A;  3RI7 C;  4RM9 A;  2KFK A;  2Z8L A;  3W1S C;  4CHK A;  1OQY A;  1MJD A;  2XK5 A;  3QJZ A;  2IO2 B;  2ZJD A;  3ZO5 B;  2KTR A;  4GXB A;  3BK2 A;  2KN4 A;  3MC0 B;  1XXG A;  5DCN A;  1HA5 A;  3ECI A;  3APD A;  2EKE C;  3D32 A;  1E7P B;  1YMH E;  4C7Y A;  5IP4 D;  2UYZ B;  2WDR B;  2PLP A;  3R3M A;  1EU3 A;  4MJS B;  3C8Y A;  3KYD D;  2O6V D;  1DOI A;  4C7Z A;  4BOZ B;  3L16 A;  4RF1 A;  4HVB A;  4OVV A;  1L4Z B;  2DBY A;  3PSE B;  2TSS A;  2DZM A;  1K8R B;  3VH3 B;  3ZRF A;  2YEP B;  2X38 A;  4FLH A;  3WAM A;  2KC2 A;  1F77 A;  2WXP A;  4K1R B;  2RPV A;  4II3 B;  1WXS A;  1JWM D;  2LVP A;  3OLM D;  3M3J A;  1WMH A;  2AQ3 B;  2WGS A;  3S2A A;  2BKF A;  2EEL A;  4HJK A;  4GOC A;  2OJR A;  1YX6 B;  3SD5 A;  3A1Q A;  2DNF A;  4LK0 M;  4XYC A;  5LNK 1;  3Q8B A;  4EUT A;  2LHE A;  2FE8 A;  4XDD A;  2LWP A;  1LFD A;  3JSV A;  2FIF A;  2HDE A;  4IM2 A;  2GLS A;  3Q69 A;  1HZ5 A;  3VTV A;  1Q10 A;  4HCN B;  2KQ7 A;  4JPS A;  3H7P A;  1V1O A;  4US8 A;  1FPY A;  2O6V A;  4AJW A;  4USA A;  4BVU C;  2KJ6 A;  1T0Q C;  2KMC A;  3DWG C;  2NTT A;  4MSQ B;  1JWS D;  3ZJU A;  3I3T B;  3KUZ A;  1UZX B;  4URK A;  3UQA A;  3QA8 A;  4M8N A;  3BWU D;  2QHO A;  1BML C;  4KKI A;  2REX A;  2ICI A;  3BIN A;  3TEY A;  5FKA C;  3BK1 A;  1MG8 A;  4IKG A;  3PRZ A;  3RZF A;  3UF8 A;  2UU7 A;  1SJE D;  3VRB B;  1WJU A;  1SBB B;  4IG7 B;  1L0Y B;  1YIW A;  4A20 A;  1NEN B;  4AS1 A;  4FJY A;  2MA9 B;  4IDI A;  1WI0 A;  1LO5 D;  1P3Q U;  3TL5 A;  2WNM A;  3PLU A;  2CS4 A;  4NJ7 A;  4RCO A;  4M01 A;  3I57 A;  4M0W A;  1T0R C;  1I4X A;  3NVW A;  2D10 A;  2RDB C;  1EWC A;  3C19 A;  4YSX B;  1P0R A;  3PV1 A;  2JZP A;  2MJD A;  2KD0 A;  2RPQ A;  3FIL A;  1FNV A;  1N62 A;  2EMT A;  1STE A;  3KVF B;  5MPO A;  1C4P A;  3PHX B;  2WU5 B;  3BVZ A;  2M19 A;  3E56 A;  4MAC A;  3ZXR A;  5HHD G;  1ET6 A;  1IYF A;  1XQQ A;  2NBW B;  3AE6 B;  3QX1 A;  4DXF A;  3VTW A;  2CJO A;  1TT5 B;  1ZW7 A;  1KTK A;  1YN5 A;  2C60 A;  2AEH A;  1ENF A;  1WGH A;  5C1Z A;  1R4M I;  2J4X A;  5CHW A;  5D7G A;  1SGH A;  1Q0W B;  3RN9 C;  4UDU C;  3SHQ A;  2LD9 A;  1YJI A;  5IOI A;  2KDM A;  3AMZ A;  2KQS A;  2M1M A;  1E8Z A;  2WXG A;  2D3G A;  4YT0 B;  4MT5 A;  1YN4 A;  4OZB A;  2NMQ A;  4ZYS A;  1ESF A;  4NNJ B;  2KWC A;  1TKY A;  2XEW A;  4P1C C;  2JUO A;  2A5U A;  2M8S A;  5C23 A;  1WY8 A;  3B9J A;  1FXT B;  1GAQ B;  3UGB B;  2ON8 A;  2BTE A;  2CHW A;  2LHD A;  1EO6 A;  2NPT A;  3ZDM C;  2DLB A;  2QSD A;  1IBX A;  2HD5 B;  4TKN A;  2GBR A;  1HQR D;  4WWP A;  1WXA A;  4P16 A;  4LCD E;  4PK1 A;  2JZZ A;  5G55 A;  3T3N A;  1NBF C;  2LRU A;  3H8H A;  3MHS D;  3DBH I;  2L7R A;  5GXG B;  3AE5 B;  2HJ1 A;  2AYO B;  5EE1 A;  3QWZ B;  4KZC A;  3DPD A;  4DHJ B;  1C77 A;  1WXQ A;  2N9K A;  1I4R A;  4FJZ A;  2I1K A;  1J7A A;  2G9H D;  3IXS A;  1F1H A;  2G45 B;  2ACZ B;  3EA6 A;  2L32 A;  1QZE A;  1C4A A;  3N1X C;  2V9H A;  3RNE C;  1JRU A;  1QIL A;  1Q5W B;  4EZL A;  1CJE A;  3OJ4 B;  1E7V A;  2RMM A;  3L08 A;  1GNU A;  1NYR A;  4OHJ A;  1FD6 A;  3LDZ E;  2RSU A;  1VCB A;  4AP4 C;  3UIN B;  3I5J C;  1V1P A;  2BYV E;  2LUE A;  3NS8 A;  4KX6 B;  2GRI A;  2PVG C;  3LB8 C;  2PE6 B;  2ZW0 A;  4ANW A;  4XGA B;  1UBQ A;  5IKC M;  4FAD A;  2ZNV B;  2MJE A;  4WQO B;  3RNC C;  3KWL A;  1SSN A;  2HTM E;  2L0T A;  4NQL B;  3LJ3 A;  4ZOH C;  2KX3 A;  1UGM A;  1QOF A;  1XF5 L;  3DVN V;  2WXR A;  3HHM A;  3N3K B;  3IT4 B;  1ZE3 D;  3ALB A;  2GBN A;  2V3N A;  2AX5 A;  3V62 A;  4CYE A;  4HRS A;  4MEM A;  1WXM A;  2Y3A A;  1FNU A;  2I38 A;  3EC8 A;  3QAR A;  3R7R A;  4DQO C;  1FNW A;  3PS6 A;  2LEK A;  2PTL A;  1UH6 A;  4C56 C;  3GZN I;  2M0A A;  3NZ3 A;  1VZ6 A;  3PLV A;  4BKT A;  2AWT A;  2B76 B;  2BYF A;  3MC9 A;  1VD2 A;  4WAA A;  4ZDV A;  3W9C B;  1OTR B;  1WE7 A;  2KLG A;  4RGO S;  4G3X B;  5J2R A;  2K3U A;  1WRI A;  1FFV A;  2PEA A;  3GOE A;  3APF A;  1WGD A;  2KTF A;  4N6E B;  4DHZ E;  2GI9 A;  4IWO A;  4OVU A;  2DHZ A;  2CHX A;  4ZRP A;  2N7D A;  1CMX B;  3NY5 A;  2DEN B;  1SJH D;  1UUP A;  3VAW A;  3NVZ A;  3SR6 A;  2OHF A;  5BYS A;  3SFE B;  5LXH A;  1TZ1 A;  2WU2 B;  2MBH A;  4WWN A;  5IO9 A;  1V9J A;  4NPN A;  4C00 A;  3AEB B;  1YQ4 B;  1P9D U;  3IBE A;  4W9K A;  1QQR A;  1CK1 A;  1KFY B;  3Q6B A;  1MHH E;  3RUL A;  1I7H A;  3KW5 B;  2LGD A;  3ZUN A;  2BW2 A;  3AE3 B;  2N9E B;  3PTF C;  2JPH A;  2MJ3 A;  2WDT B;  2AL3 A;  2GOW A;  1EM7 A;  3AE2 B;  3P4Q B;  1ZP0 B;  4TQ0 A;  5EE9 A;  3FC4 A;  3ZJT A;  2MRP A;  3RFZ B;  1AYF A;  3RNF C;  3EGR A;  3CF6 E;  3ML9 A;  1RLF A;  2PPH A;  3IFW B;  4NJC A;  5EE0 A;  1E5W A;  2PMV A;  3KYC D;  2BB6 A;  4BBN C;  5BO4 B;  5L83 A;  4ARI A;  1JRO A;  4PYU A;  1UWM A;  3NUH B;  2G3Q B;  2JSV X;  2WHI A;  3SU8 X;  2KLC A;  4HKZ E;  3RNB C;  5CHV C;  1ZKH A;  3R66 C;  4M8M A;  2V3P A;  2LFI A;  2K8H A;  4DDG D;  1J7B A;  3Q14 C;  2LJI A;  4F8C B;  3NS1 A;  4I6P A;  2SEB D;  2WXQ A;  3OG5 A;  2K25 A;  2NR2 A;  2PKO A;  1ZDX A;  4K7W A;  1ISN A;  2KVR A;  3AH7 A;  1C76 A;  5E6J A;  4Q2J A;  1V81 A;  1T5X D;  1E90 A;  2UWQ A;  2WXO A;  4US9 A;  1ET9 A;  4L23 A;  3ZJV A;  1V2Y A;  3BII D;  2Y5P A;  1YQB A;  1WFY A;  5JXV A;  2ZNV C;  4ZYN A;  5AUI A;  3ZVV A;  5FK9 C;  2WLB A;  1TJE A;  2LI5 A;  1WIA A;  2GBK A;  3T8M A;  1L0X B;  4IWQ A;  2LVQ A;  2KJR A;  3PPA A;  1GUA B;  2MBO A;  2IO0 B;  3TCA A;  2MP2 A;  3URY A;  3NJT A;  2WWZ A;  2KC1 A;  2PJH A;  3V6E B;  5GMV A;  1KLG D;  4LNF A;  3B1L X;  4EEW A;  1D5Z C;  2Z0E B;  2BYE A;  1C1Y B;  1HTQ A;  3PRP B;  2IYD B;  2HJ8 A;  2GBM A;  3HVD A;  2NTS A;  3C0R B;  3VDZ A;  2K9X A;  2LRW A;  3UQB A;  2K8B A;  3VTU A;  4KZ0 A;  1FXA A;  4ZRK A;  3BVG A;  3RCZ A;  4HLE A;  4ANV A;  1RYJ A;  2QJL A;  2D5G A;  1NI3 A;  1TY0 A;  1WX7 A;  1VZ7 A;  2FNJ B;  1A70 A;  4MM3 B;  3ZNI D;  2LUM A;  4A90 A;  4GMV A;  4NZL B;  1CZP A;  3V6C B;  1LGR A;  4BKS A;  2D3B A;  4D2K A;  2C7H A;  1RAX A;  3U7Z A;  1SEB D;  1DYQ A;  1FM0 D;  3B0A A;  4A3P A;  3ZW3 A;  2ZPY A;  2OED A;  4RNA A;  1MI0 A;  2PIA A;  4JWU C;  5JZE B;  1N60 A;  2MH7 A;  5C2T B;  2K6D B;  2HTH A;  2KFK B;  1D5M C;  1EU4 A;  1OQQ A;  3NVV A;  1C3T A;  2KYW A;  3GS2 A;  5AZH A;  1DOY A;  1E8Y A;  2XK5 B;  4WAF A;  1XLQ A;  4A3O A;  1IP9 A;  2KTR B;  3L10 B;  1FEH A;  1NVI D;  2DAF A;  3Q3O C;  5AZF A;  1GJZ A;  1UNS A;  2IGD A;  2RDH A;  3Q3J A;  3ZDT A;  1KJT A;  1PYW D;  2PE9 A;  3ZNZ B;  2C7M B;  1XT9 B;  1T0Y A;  2KHW B;  2KNB A;  4RGM A;  4RGN A;  1E10 A;  1RFA A;  1DOX A;  1TKG A;  3WAP A;  3VRA B;  3PGE A;  2BWF A;  1JAL A;  3U52 E;  5BYQ A;  3T9L A;  3DWM A;  1I4G A;  2L1A A;  2L00 B;  1V86 A;  2DAJ A;  1PQS A;  1J19 A;  1XEE A;  1GOZ A;  2JYT A;  4JQW C;  4GGQ A;  2Y5B B;  1OFF A;  2DYB A;  3AEA B;  4XWW A;  1PUT A;  4NY0 A;  3AED B;  3VR8 B;  1QT9 A;  4W9H A;  2JZ3 B;  1A5R A;  3AEE B;  3TIX A;  3JVZ X;  1I35 A;  1PGX A;  4WJP A;  1WMH B;  1WZ0 A;  1JW9 D;  1HZ6 A;  4J6I A;  1QLB B;  2G1E A;  2KT7 A;  2V3S A;  1OQR A;  3QCA A;  3MJ5 A;  3Q3N C;  2W55 A;  1NI2 A;  5E6P A;  2I1J A;  4ANU A;  1K53 A;  2LJ5 A;  3IAS 1;  2DYO A;  3JSV B;  3A9J A;  2BGF A;  1FMA D;  1XO3 A;  3P4R B;  2JQR B;  4MH8 A;  3NZS A;  3H7P B;  1X1M A;  3Q3M C;  1XCT L;  2K6Q A;  2DX5 B;  3DBL B;  3QHT A;  2O6V B;  5I4D A;  3DBR B;  4TUU A;  1J0G A;  3AE8 B;  3ZRC A;  1LM8 B;  2LAS A;  4OW0 A;  3WA0 A;  4KV2 A;  1XLO A;  1UF0 A;  4DXG A;  4GDK A;  2M4N A;  1N5W A;  4LNO A;  4B9K A;  4FUL A;  1R4N B;  1WH3 A;  3P42 A;  1WRD B;  2JU6 X;  4E3C A;  1P98 A;  2KDI A;  2LXC A;  2J42 A;  2WP9 B;  1QF6 A;  3WAO A;  1GB1 A;  2MBQ A;  1WSP A;  1WYW B;  3HIZ A;  1S3S G;  2LMC A;  4RF0 A;  1F2R C;  2IJ0 A;  4EE2 A;  1EUV B;  1N63 A;  2KJH B;  2HE7 A;  5E6N A;  1WR1 A;  3DDC B;  5D6J B;  5C3J B;  3MC8 A;  1E9M A;  2J0M A;  4M0W B;  4B0M A;  2H88 B;  1WXV A;  3OJ3 A;  3QQ8 B;  5BMI A;  2A4Z A;  4NAW B;  2QEJ C;  3DQV A;  1C4C A;  3U8Z A;  4HKQ A;  2LGX A;  1ZGU B;  2K1F A;  4LJP B;  3MP9 A;  3TUO A;  1D6E C;  2OOB B;  4W9D A;  3AEF B;  2D3A A;  3DHG C;  2V4I B;  3VUY A;  1PDX A;  4HK2 A;  3AM9 A;  4JE3 B;  1YN3 A;  4S0R A;  2JY6 A;  2MQJ A;  4HPL B;  1L4D B;  2MSE D;  4HWI B;  2KWD A;  3N9Y C;  2BVC A;  4EZJ A;  1TIF A;  1R4M B;  3TEW A;  2LGI A;  2FUG 1;  4GDL A;  3A9K A;  3W5V B;  3WAN A;  3R2I A;  3QAQ A;  2YLM A;  2WXK A;  2XNA C;  2WXN A;  4A6Q A;  2YVC A;  3QK0 A;  1J7C A;  2KDF B;  3CWI A;  5HFY A;  2QDF A;  4XC2 A;  1FRD A;  2J7Q B;  3AE4 B;  3RNA C;  5AEK B;  2C5L C;  3W1S A;  2E3T A;  4A9A A;  1WJ4 A;  2WDV B;  4FHJ A;  2L76 A;  4WQM A;  1AW7 A;  5TR5 A;  4W9F A;  1D3Z A;  4ICV A;  3DVG Y;  4HDO A;  3RNG C;  1WM2 A;  1HXY D;  4M02 A;  4WWO A;  4OZC A;  2NPT B;  2W3R A;  3ZTC A;  4BZA A;  2L52 A;  3HM3 A;  4DK5 A;  2M56 B;  1HTO A;  4A55 A;  5KHQ A;  1E8X A;  1IBX B;  3APC A;  3SFD B;  2KFJ A;  3VQI A;  4IWP A;  2IZV B;  1RRB A;  2R61 A;  2V0G A;  3AUL A;  4PYZ A;  1UEL A;  3KLS X;  4PS3 A;  3RZW C;  4ARC A;  4W9J A;  1DGJ A;  1NEK B;  1V8C A;  3EFU A;  3UI3 A;  3M95 A;  2W82 A;  1FXI A;  2NVU I;  3IT6 B;  3RYT A;  1VDV A;  4LDT D;  4OZA A;  1WE6 A;  1TY2 A;  2JVC A;  1KM7 A;  2R2O A;  4JWS C;  3ONS A;  3OAW A;  2V1Y A;  3WIM A;  1JQ4 A;  3PZ7 A;  1M94 A;  1I42 A;  4LNK A;  5J17 A;  4IOI E;  3L13 A;  3WAL A;  2SAK A;  3W2D A;  2JWZ A;  2KWV B;  3L4P A;  1ZUD 2;  4LNN A;  1OGW A;  3NHE B;  4JL9 A;  1JWB D;  2XBB C;  2N1W A;  5AUK A;  1WJN A; 
#chains in the Genus database with same CATH homology
 1E90 A;  3VTV A;  4HCN B;  1NDD A;  1Y8R C;  5JHB A;  2L05 A;  2KQ7 A;  2UWQ A;  3H7P A;  2WX0 A;  2ZPN A;  1V2Y A;  2EMS A;  4MGK E;  3IG3 A;  3RUI B;  2O6V A;  1TGZ B;  1YQB A;  3M62 B;  1WFY A;  4AJW A;  2ZNV C;  1V80 A;  2L8J A;  4BVU C;  4ZYN A;  2KJ6 A;  4W9C A;  3L0W B;  3TJP A;  1J8C A;  3ZVV A;  4MH0 E;  4WJQ A;  2KMC A;  2LI5 A;  1WIA A;  4K81 A;  2GBK A;  3T8M A;  4MSQ B;  4FBJ B;  2BF8 B;  4IWQ A;  3I3T B;  2IY1 B;  3KUZ A;  3HK0 A;  1UZX B;  4GDK B;  2LVQ A;  3DCG A;  4URK A;  2KJR A;  3PPA A;  2GMI C;  3UQA A;  1H4R A;  3QA8 A;  4M8N A;  3UIP B;  1GUA B;  2MBO A;  2N4F A;  2QHO A;  4IUM B;  2IO0 B;  2REX A;  3TCA A;  3BIN A;  2MW5 A;  3ZTD A;  4X57 B;  2MP2 A;  1MG8 A;  3PRZ A;  3RZF A;  2WWZ A;  2DYM A;  3UF8 A;  1KOT A;  2KC1 A;  1WGG A;  1WJU A;  2PJH A;  4TV3 A;  3V6E B;  2JRH A;  3DVG X;  4KIK B;  1SE9 A;  1UBI A;  1V5T A;  5GMV A;  4IG7 B;  3ZLZ A;  1LXD A;  3B1L X;  1YIW A;  2Z0E B;  4EEW A;  4A20 A;  4W9E A;  2ZVN A;  4FJY A;  3ENE A;  2BYE A;  2MA9 B;  2IY0 B;  4GB9 A;  1C1Y B;  3PRP B;  1WI0 A;  2IYD B;  2HJ8 A;  3KUD B;  1P3Q U;  2GBM A;  4NJ6 A;  3TL5 A;  4RM8 A;  3IVF A;  3PLU A;  4WJN A;  4HCP B;  3C0R B;  3TBL D;  3VDZ A;  4B95 A;  2CS4 A;  4NJ7 A;  2IO1 B;  4ANX A;  2LRW A;  3UQB A;  2K8B A;  3VTU A;  4KZ0 A;  2JT4 B;  4ZRK A;  1OEY J;  3VHT C;  2M0X A;  2D10 A;  3RCZ A;  2J0K A;  1E8W A;  2KMA A;  4XZ4 A;  4HLE A;  3BY4 B;  4ZRI A;  4ANV A;  2KZR A;  1P0R A;  3PV1 A;  4EKU A;  2KD0 A;  2RPQ A;  2KWU B;  4W9G A;  2EMT A;  2RR9 A;  1S1Q B;  3DOW A;  3KVF B;  1WX7 A;  5E6O A;  4TQ1 A;  2FNJ B;  2Z59 B;  3PHX B;  4AWJ A;  2MLB A;  3ZNI D;  2M17 A;  4HXD A;  4AUQ C;  2IO3 B;  2ZVO A;  2LXA A;  4GMV A;  1IYF A;  1XQQ A;  5AZG A;  2NBW B;  3V6C B;  4BKS A;  2G4S A;  3QIJ A;  3QX1 A;  4ICU A;  3VTW A;  1GC7 A;  2MX2 A;  2C7H A;  1RAX A;  1ZW7 A;  4KVG B;  1F9J A;  2C60 A;  2R2Q A;  2C7N B;  2AEH A;  1WGH A;  1LQB A;  3PHW B;  5C1Z A;  1WF9 A;  5IAA C;  1R4M I;  3B0A A;  4A3P A;  4EFO A;  3ZW3 A;  3U7D A;  2ZPY A;  5CHW A;  2N7E A;  5D7G A;  5HKH A;  4G0N B;  1SGH A;  1Q0W B;  4GDL B;  4E71 A;  2ZCC A;  3A9K B;  3MJW A;  5JZE B;  2NCN A;  3SHQ A;  2LD9 A;  3UIO B;  2K6D B;  2GBJ A;  2FCQ A;  4LDT B;  2HTH A;  2KFK B;  2BWE S;  2KQS A;  2M1M A;  3N30 A;  1E8Z A;  4KIK A;  1C3T A;  5AZH A;  3W1Y A;  1E8Y A;  2XK5 B;  2D3G A;  4GIV A;  4A3O A;  4ASW C;  1IP9 A;  2CKH B;  2KTR B;  5DPS A;  3L10 B;  3VUW A;  2FAZ A;  3VFK A;  2DAF A;  5AZF A;  1GJZ A;  5IA7 A;  4NNJ B;  3K9O B;  3V60 A;  2KWC A;  3ZDT A;  3Q3J A;  4K7U A;  1KJT A;  3EEC A;  4NQK E;  2ZCB A;  4XX5 A;  4G50 A;  2PE9 A;  3ZNZ B;  2XEW A;  2C7M B;  1XT9 B;  1EF1 A;  2A5U A;  1T0Y A;  2JUO A;  4G11 A;  2M8S A;  2KHW B;  2KNB A;  5C23 A;  1WY8 A;  4IC7 B;  1RFA A;  1FXT B;  3AU5 A;  2FCS A;  5D2M B;  3UGB B;  4MJS A;  2CHW A;  3WAP A;  1EO6 A;  2NPT A;  1L2N A;  1V5O A;  3PGE A;  3ZDM C;  2BWF A;  2MBE A;  2N1V A;  4DBG A;  2D11 A;  3SDL C;  4BKS D;  2HD5 B;  4MM3 A;  3T9L A;  4TKN A;  2FCM A;  2RD0 A;  2GBR A;  3IHP C;  5LLI A;  4WWP A;  2FCN A;  1WXA A;  2L00 B;  3L17 A;  3A33 B;  1H8C A;  1V86 A;  2G4D B;  2DAJ A;  3KUC B;  2ASQ A;  4LCD E;  4DDI D;  1PQS A;  1J19 A;  1WR6 E;  2JZZ A;  5G55 A;  1Z5S B;  4JQW C;  1NBF C;  2LRU A;  2JXX A;  4GGQ A;  2Y5B B;  3MHS D;  3DBH I;  2DYB A;  4GN1 A;  1V6E A;  3PRM B;  1G6J A;  1Z2M A;  2L7R A;  3JW0 X;  4NY0 A;  4II2 B;  4JLC A;  4EOY A;  2AYO B;  2NBU A;  2ZEQ A;  3KH0 A;  4W9H A;  2JZ3 B;  4DHZ B;  1A5R A;  1L7Y A;  3QWZ B;  2FUH B;  4KZC A;  3DPD A;  3JVZ X;  3TIX A;  4WJP A;  1UD7 A;  1I35 A;  1WMH B;  2KN5 A;  4DHJ B;  3DBS A;  1WZ0 A;  4WJO A;  3R7Q A;  4J6I A;  2MWS B;  5G2N A;  2I1K A;  2NS5 A;  2V3S A;  4FJZ A;  4E74 A;  1GC6 A;  1WM3 A;  2G45 B;  4EZK A;  2C9W B;  3QCA A;  1QZE A;  2KOX A;  1U4A A;  3MTN B;  3M63 B;  2XBB C;  2AL6 A;  1NI2 A;  4YL8 A;  2I1J A;  3N32 A;  5E6P A;  3VVW B;  3H1U A;  4ANU A;  2LJ5 A;  4KSK C;  3CST A;  1HE8 A;  2KK8 A;  5EDS A;  3ZNH B;  2DYO A;  1Q5W B;  2LVO A;  3A9J A;  3JSV B;  3OJ4 B;  1YJ1 A;  1E7V A;  4EZL A;  2BGF A;  4AOF A;  3L08 A;  1GNU A;  1YX5 B;  3CSF A;  3NZS A;  4P7I A;  3LDZ E;  5DPT A;  2RSU A;  1VCB A;  5FR6 A;  4AP4 C;  3CMM B;  3H7P B;  1X1M A;  2K6Q A;  2DX5 B;  2WYQ A;  3UIN B;  3QHT A;  2JRI B;  2KXJ A;  2O6V B;  2BYV E;  2ZZP B;  2LUE A;  2KDE B;  3NS8 A;  3PT2 B;  2DZI A;  2DZK A;  2O2V B;  3RD2 A;  4TUU A;  1J0G A;  1WGR A;  2CU1 A;  3ZRC A;  1LM8 B;  2LAS A;  2B3A A;  2PE6 B;  3WA0 A;  4ANW A;  3A4R A;  3PRE A;  1UBQ A;  4IM0 A;  2K39 A;  3HM6 X;  4KV2 A;  5D94 A;  2ZNV B;  4FAD A;  4PS8 A;  4GDK A;  1E7U A;  2M4N A;  4KSL C;  4WQO B;  2N9P C;  4W9I A;  4B9K A;  4FUL A;  2MBB B;  1WH3 A;  2WX1 A;  4ZRJ A;  1WRD B;  1WGY A;  4E3C A;  1P98 A;  2L0T A;  1TTN A;  2KDI A;  4NQL B;  2D2Q A;  3LJ3 A;  2LXC A;  1Q1O A;  2N9X A;  2MP2 B;  4FA6 A;  2KX3 A;  4GU2 A;  1UGM A;  5DPW A;  4BKG A;  3WAO A;  3ML8 A;  2MBQ A;  4HDQ A;  3DVN V;  1WYW B;  3HIZ A;  1S3S G;  4MGY E;  3X0W A;  3HHM A;  3N3K B;  3VH4 B;  1EUV B;  4PS7 A;  4MDK E;  3ALB A;  2GBN A;  2KJH B;  4KDI C;  3V62 A;  4CYE A;  2HE7 A;  4N9F 4;  5E6N A;  3ZNG C;  4MEM A;  1WXM A;  3QAR A;  3EC8 A;  1WR1 A;  2RGF A;  3U30 A;  3DDC B;  5D6J B;  4MSM B;  3VXW A;  3R7R A;  2J0M A;  4MGI E;  3PS6 A;  1YD8 U;  4M0W B;  1UH6 A;  3AU4 A;  3B08 A;  3GZN I;  1WXV A;  3PLV A;  1AAR A;  2AWT A;  4IM3 A;  4BKT A;  1WX9 A;  3QC8 B;  4I6L B;  2BYF A;  4LJO B;  4F7Z A;  1VD2 A;  3OJ3 A;  1WZ3 A;  3QQ8 B;  4WAA A;  4ZDV A;  4IM2 A;  2J0J A;  3JYU A;  3L54 A;  1OTR B;  1WE7 A;  2KLG A;  2A4Z A;  1TBE A;  3DBL I;  3PZD A;  4NAW B;  2IBI B;  2V4L A;  4IW0 A;  3DQV A;  1XD3 B;  3U8Z A;  3DBR I;  4G3X B;  5J2R A;  2LGX A;  4JGH B;  1ZGU B;  2K1F A;  4LJP B;  2K8C A;  2KO3 A;  2PEA A;  3GOE A;  3VUX A;  3APF A;  2OOB B;  4W9D A;  4BBN F;  2LZ6 A;  2O2V A;  1WGD A;  2KTF A;  3P2B A;  1SIF A;  4DHZ E;  4JIO U;  4IWO A;  4OVU A;  3NZU A;  2DHZ A;  3H6N A;  4BFR A;  2KAN A;  1WX8 A;  2CHX A;  3VUY A;  1WJ6 A;  5CHF A;  2N7D A;  4BOS C;  5L95 C;  1R4N I;  4HK2 A;  2W9N A;  1CMX B;  3NY5 A;  2NBV B;  2DEN B;  2JY6 A;  2MQJ A;  4HPL B;  2Z0D B;  3Q3F A;  3VAW A;  2MSE D;  4HWI B;  4F1S A;  3TMP B;  4EZJ A;  2MCN B;  5DPR A;  4KDL B;  3ZKJ C;  1OEY A;  4GDL A;  5LXI B;  3A9K A;  5LXH A;  1TZ1 A;  4DHJ D;  2CR5 A;  3WAN A;  2MBH A;  3H9D A;  3A1Q B;  3QAQ A;  4WWN A;  2YLM A;  5KHO A;  1V9J A;  4RM9 A;  2L0F A;  2KFK A;  2JF5 A;  2YVC A;  3QK0 A;  4NPN A;  3W1S C;  4CHK A;  4CO7 A;  1OQY A;  2KDF B;  2KDB A;  3PVL A;  1P9D U;  3IBE A;  3EHV A;  4XC2 A;  2XK5 A;  2J7Q B;  4W9K A;  5CTR C;  3QJZ A;  2IO2 B;  2ZJD A;  4I6N B;  2KTR A;  3ZO5 B;  2C5L C;  5AEK B;  4HPM B;  4GXB A;  4DWF A;  3W1S A;  3RUL A;  1WJ4 A;  3NOB A;  2KX0 A;  3KW5 B;  4FHJ A;  2LGD A;  5DCN A;  2L76 A;  3ECI A;  2L3Z A;  3ZUN A;  1V49 A;  5TR5 A;  3APD A;  4W9F A;  1D3Z A;  2EKE C;  2N9E B;  1BT0 A;  3D32 A;  3PTF C;  4ICV A;  4MGZ E;  2JPH A;  1GG3 A;  2BKR B;  2WDT B;  3DVG Y;  2AL3 A;  2GOW A;  4HDO A;  5J18 A;  5JHA A;  2UYZ B;  4TQ0 A;  1WM2 A;  2KKC A;  3R3M A;  4RMA A;  3AI5 A;  2MRP A;  4WWO A;  4MJS B;  2FID A;  1EF5 A;  5CX3 A;  2NPT B;  3DVN U;  2O6V D;  3H7S A;  3KYD D;  3ZTC A;  4NAW A;  3HM3 A;  4DK5 A;  5KHQ A;  3CF6 E;  1E8X A;  3APC A;  3ML9 A;  1RLF A;  4BOZ B;  2PPH A;  3IFW B;  2KFJ A;  3L16 A;  3VQI A;  4HVB A;  1IPG A;  4IWP A;  1E5W A;  4OVV A;  4W9L A;  4DXA B;  3PSE B;  3KYC D;  2IZV B;  4MEL A;  4B6W A;  1RRB A;  2DZM A;  4BBN C;  5BO4 B;  1K8R B;  5L83 A;  3VH3 B;  3A9J B;  3AUL A;  3ZRF A;  2VRR B;  4PYZ A;  1UEL A;  4PS3 A;  3RZW C;  4FLH A;  4PYU A;  3WAM A;  4FJV B;  2KC2 A;  4K1R B;  4W9J A;  2G3Q B;  3EFU A;  3SU8 X;  4II3 B;  3ZIM A;  4GSW A;  3M95 A;  1WXS A;  5JH5 C;  2NVU I;  2LVP A;  3OLM D;  3M3J A;  2KLC A;  4AJY B;  1WMH A;  5CHV C;  1ZKH A;  3RYT A;  3O65 B;  4LDT D;  2LGY A;  3R66 C;  4M8M A;  3RT3 B;  3S2A A;  1WE6 A;  2BKF A;  2D07 B;  2JVC A;  2R2O A;  1KM7 A;  3K9P B;  4HJK A;  3A4S C;  4GOC A;  3ONS A;  2OJR A;  2K8H A;  4DDG D;  2BPS A;  3OAW A;  1YX6 B;  3SD5 A;  3A1Q A;  4FN2 A;  2V1Y A;  3WIM A;  4F8C B;  1M94 A;  1I42 A;  4I6P A;  5J17 A;  3X23 A;  3AXC A;  3L13 A;  4EUT A;  2K25 A;  2NR2 A;  4K7S A;  3WAL A;  1KLV A;  4K7W A;  2JWZ A;  2KWV B;  3V61 A;  2LWP A;  1ISN A;  2KVR A;  2CHZ A;  1P1A A;  1LFD A;  4FHK A;  1OGW A;  3NHE B;  4JL9 A;  3JSV A;  2FIF A;  1JRU A;  2N1W A;  1V81 A;  1WJN A;  2DZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...