5AEKB

Crystal structure of the human senp2 c548s in complex with the human sumo1 k48m f66w
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLMESYCQRQGVPMNSLRFLWEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SENTRIN-SPECIFIC PROTEASE 2
publication title Stepping Back and Forward on Sumo Folding Evolution
rcsb
source organism Homo sapiens
total genus 15
structure length 78
sequence length 78
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5aekB00
1E8ZA 2Z0DB 1RRBA 3APFA 4NAWB 1RAXA 3N3KB 1NBFC 4NPNA 1P0RA 2NS5A 1H4RA 2MP2B 3R3MA 1J0GA 3VDZA 3IBEA 4RM9A 2FCSA 3AI5A 4F7ZA 3VH3B 4P7IA 2V3SA 1WJUA 3DPDA 5CHVC 1IYFA 3OJ3A 4F1SA 4FA6A 1ZKHA 3ZTDA 3WIMA 2WDTB 3PRMB 2M0XA 1I42A 1V49A 5AEKB 4K7SA 3DQVA 4DHZE 2AYOB 3TBLD 2L76A 3A1QB 3WAMA 3ZDTA 3IHPC 3VXWA 4ASWC 1V6EA 4DHJB 4HXDA 2KOXA 3IFWB 3QHTA 2MSED 3BINA 1WE6A 2JUOA 4MGKE 4IM3A 4ZRJA 2KDIA 2A4ZA 1P1AA 2KJRA 2JT4B 2N7EA 4A3OA 2DX5B 5E6NA 2FUHB 4FJZA 3S2AA 2N1WA 1WM3A 3M3JA 2KD0A 3OJ4B 1S3SG 1EF5A 3JW0X 3ZNHB 3VUWA 1WGRA 3ECIA 5C1ZA 2M1MA 2O6VD 3MHSD 1E7UA 3DOWA 2ZCBA 3QQ8B 4LJOB 3UQAA 4DDID 2KTFA 2LRWA 2R2OA 4X57B 2IBIB 1ZW7A 2ZPNA 2K1FA 2MX2A 2MWSB 2LXAA 1HE8A 4G50A 4M0WB 3V6CB 3NHEB 2FIDA 1YD8U 2L0FA 3QWZB 5J18A 1BT0A 2BYFA 4A3PA 5AZFA 1LXDA 2CHXA 5J17A 3X23A 3ML8A 2MBOA 2RGFA 2NPTB 2Z0EB 3AULA 3L0WB 3OAWA 2DZKA 4TV3A 4ZRIA 1WH3A 1GUAB 4WAAA 4OVUA 3UGBB 1PQSA 3H6NA 3JSVA 2ZJDA 4K7UA 3AU5A 1QZEA 4BKSA 2MLBA 3H1UA 1E90A 3QC8B 4OVVA 2RR9A 5CHWA 2NVUI 4YL8A 5AZHA 1V5TA 2AL6A 2O6VA 1Y8RC 2Z59B 1WYWB 3IG3A 1X1MA 2BYEA 4HK2A 4KV2A 1K8RB 2XEWA 2LI5A 1V80A 2IO0B 2KLCA 1WJNA 1KJTA 2L8JA 2GMIC 3PLUA 4HPMB 2XK5B 2DZIA 3A9JA 4IG7B 4K7WA 4KVGB 4LCDE 2JF5A 1OTRB 1P3QU 2KFKA 4HVBA 2BKRB 1J19A 1YJ1A 4HDQA 4K1RB 4IW0A 1WMHA 4MDKE 3U8ZA 3A4SC 3EECA 1EUVB 2N4FA 3I3TB 4DXAB 3P2BA 3KUZA 4W9DA 2PE6B 4W9FA 1WGDA 3C0RB 4FJVB 4EOYA 4NQLB 1IP9A 1V81A 2UWQA 4I6PA 5LLIA 2N1VA 3L10B 4NAWA 3ZRCA 1R4MI 3EFUA 1GC6A 2ZNVC 3ZNID 2GBJA 4GXBA 5KHOA 2KJHB 2DENB 5DPSA 2LVQA 4KIKA 3M63B 2IZVB 3ZTCA 1Z2MA 1XQQA 2AEHA 5FR6A 1UH6A 3VTWA 3BY4B 2CS4A 2DAJA 2IY0B 4DK5A 2BWES 3O65B 3TMPB 1WR6E 2KDBA 1T0YA 2MW5A 3DVNU 1WZ3A 2JRIB 3IVFA 2K8CA 2R2QA 4KSKC 3SHQA 3T8MA 2KX3A 1F9JA 3DVNV 1RFAA 3B1LX 1KLVA 3A9KB 3DVGY 4RM8A 4WJOA 3WA0A 3W1SC 2JVCA 3V61A 2KN5A 4JQWC 1YX6B 4BVUC 4CYEA 3PRZA 4EZKA 4DHZB 1RLFA 5IA7A 2K6DB 3M95A 2VRRB 2ZNVB 2KWUB 4EFOA 3UQBA 4KDLB 5J2RA 1WX8A 2CHWA 3QJZA 2NCNA 3H9DA 2RPQA 5JHAA 1P9DU 2BPSA 4MSQB 3RZFA 4M8MA 2XBBC 4EKUA 2WYQA 4TKNA 4NY0A 3R66C 2LUEA 1M94A 2KDEB 3KH0A 3PTFC 3A33B 4ICVA 2MBBB 3R7QA 2ZVNA 3NY5A 2FIFA 2NBUA 4A20A 1E8WA 4GDLA 2DAFA 2Y5BB 1TBEA 4GDKA 3K9PB 4MGYE 3RYTA 4EUTA 1NDDA 5JHBA 1YX5B 3EHVA 4BKSD 2DZJA 3JYUA 3M62B 4I6LB 4JLCA 3VFKA 1OEYJ 2N7DA 2N9EB 4BBNC 2J0KA 1TGZB 2KMAA 2LZ6A 2J7QB 3RULA 4B9KA 4FHJA 1VCBA 4IUMB 2IO2B 4TUUA 4E74A 4XZ4A 4GMVA 5D2MB 3SDLC 2EMSA 3QK0A 4B95A 2JWZA 3HK0A 2FCQA 3HHMA 2LGYA 2KFJA 5LXIB 3V62A 3VHTC 4PS8A 2HTHA 2BGFA 2ZVOA 1UELA 2DHZA 2HE7A 2K8BA 2KLGA 3U7DA 1VD2A 2XK5A 1WZ0A 2ZEQA 4KZCA 4FADA 2DYOA 1WXMA 2G4SA 4LDTD 1TTNA 2MCNB 3PVLA 1SGHA 3KUDB 4PYZA 4EEWA 1UD7A 2CKHB 3PRPB 2BKFA 4NJ7A 3ZW3A 5LXHA 1V5OA 5TR5A 4WWOA 3TJPA 2L3ZA 2FCMA 1KM7A 2OJRA 3RCZA 5DPRA 2HD5B 4FULA 2O2VA 1V86A 2L0TA 3ZRFA 1ZGUB 4PS3A 1MG8A 4ANWA 5G2NA 1J8CA 1WE7A 2PE9A 1FXTB 1WI0A 1YQBA 2G45B 4KZ0A 4MJSA 5JZEB 3NZUA 3B0AA 1EO6A 2JXXA 3GOEA 1GG3A 3K9OB 3KYDD 4WJPA 4ICUA 1SE9A 3H7PA 4W9HA 1R4NI 4HCPB 5C23A 3ZNGC 2V4LA 3D32A 3OLMD 1UBQA 3APCA 4MH0E 3UF8A 2LASA 4FHKA 2I1KA 2JY6A 2BWFA 2LVOA 3WAPA 2KZRA 3PHXB 2ASQA 4HWIB 1P98A 2CHZA 4MEMA 3PV1A 3X0WA 1G6JA 3A9KA 2N9PC 1EF1A 3VUYA 2MQJA 3DCGA 4I6NB 4IM2A 3VTVA 4ZRKA 2LGDA 2WWZA 3L08A 4ZYNA 4PS7A 1WGHA 2WX1A 1WY8A 1IPGA 4JGHB 2MP2A 5CHFA 2FNJB 3PZDA 4XX5A 3ZO5B 4GGQA 4DWFA 4KSLC 2EMTA 5DCNA 3TL5A 3B08A 5GMVA 4W9CA 3A4RA 4N9F4 3N30A 3WANA 3ZVVA 5HKHA 3CSFA 3VQIA 4MELA 4MM3A 3KVFB 4W9GA 1WXSA 2KHWB 3JSVB 4GIVA 2KWCA 2C7HA 2GBMA 2AL3A 3GZNI 3ML9A 4G0NB 2D2QA 1I35A 3ALBA 3A1QA 2KK8A 2A5UA 3NOBA 1H8CA 1WRDB 1WR1A 2O6VB 5D94A 2MBHA 4DBGA 2KJ6A 3DDCB 4GSWA 5E6OA 1E5WA 2QHOA 4EZLA 1E7VA 3PREA 4W9JA 2J0JA 3A9JB 1LFDA 2D07B 3ZDMC 4II2B 3CSTA 2KFKB 1WX7A 4W9EA 2V1YA 1KOTA 1SIFA 1WMHB 5E6PA 2KTRB 4BFRA 5G55A 1XD3B 2KANA 2M17A 1V2YA 2JZ3B 1YIWA 3V6EB 2UYZB 2KO3A 2YVCA 3SU8X 1S1QB 1C1YB 1WX9A 2NBVB 4G3XB 2BF8B 2MBQA 4J6IA 4WWNA 3PSEB 3QARA 3R7RA 4F8CB 3H7SA 3CMMB 4IWPA 2M4NA 5CTRC 4HPLB 2FAZA 2PPHA 2KXJA 5D6JB 1WGGA 4IM0A 3KUCB 1D3ZA 2L7RA 4HDOA 4MGIE 1AARA 2LWPA 2MA9B 2PJHA 3U30A 2B3AA 3UINB 2WX0A 4BBNF 4W9IA 1WGYA 2KC1A 2G4DB 2GBKA 2C5LC 3JVZX 3PLVA 4IWQA 4PYUA 2MBEA 3HM3A 4KIKB 2NPTA 4JL9A 1Q0WB 3HIZA 3QCAA 3W1YA 1E8YA 4M8NA 2KWVB 2L00B 2DZMA 3QAQA 2NR2A 2LXCA 2NBWB 3AXCA 5JH5C 3V60A 2C60A 1WF9A 1WIAA 2C9WB 2I1JA 4ANXA 4CHKA 3PGEA 4RMAA 3L16A 5AZGA 1L7YA 3Q3FA 3UIPB 5CX3A 3PHWB 4NJ6A 3VUXA 4FN2A 2KC2A 2KQSA 2GBRA 1OEYA 3Q3JA 3RT3B 1U4AA 4HCNB 4WJNA 4FBJB 2D3GA 3L13A 5EDSA 1NI2A 2PEAA 4NNJB 4XC2A 3LJ3A 2LJ5A 4AUQC 1ISNA 1OGWA 4GU2A 2HJ8A 1Q5WB 4E3CA 2M8SA 2FCNA 2BYVE 2K6QA 4HLEA 3RD2A 2N9XA 1Q1OA 3ENEA 4GB9A 2GOWA 1V9JA 3MTNB 3HM6X 1WM2A 4URKA 4ZDVA 4AJYB 2L05A 4LJPB 4B6WA 3N32A 2W9NA 4GDLB 1C3TA 4TQ1A 2C7MB 3VVWB 4JIOU 5L95C 4AOFA 2LD9A 4GDKB 3RUIB 4AWJA 2KMCA 4AJWA 5D7GA 1Z5SB 3KYCD 4BOZB 1LQBA 5KHQA 4GOCA 2AWTA 2KDFB 2JPHA 2K8HA 3ZKJC 3VH4B 1UBIA 3PS6A 4G11A 1GJZA 2CU1A 1WJ6A 4W9LA 4DHJD 2JRHA 4BOSC 2D11A 2MRPA 2IO3B 3ZUNA 2CR5A 2D10A 3DVGX 4KDIC 3KW5B 4IWOA 3PT2B 2IY1B 3DBLI 4AP4C 2GBNA 4E71A 3WAOA 2DYMA 2YLMA 1L2NA 4DDGD 4EZJA 3RZWC 2KQ7A 3MJWA 4FJYA 5DPTA 2G3QB 2IYDB 2IO1B 3DBSA 2LGXA 5BO4B 4K81A 4CO7A 2RD0A 2KKCA 3QIJA 1LM8B 3SD5A 5IAAC 3LDZE 2KTRA 3TIXA 3VAWA 3TCAA 2KNBA 2EKEC 4GN1A 3DBRI 2K39A 1JRUA 1WXAA 1WFYA 2ZCCA 3NZSA 1WXVA 3CF6E 4TQ0A 2LVPA 2O2VB 3AU4A 3UIOB 3ZNZB 4WQOB 2KX0A 2DYBA 3APDA 2K25A 3WALA 2ZZPB 4ANUA 4WJQA 2JZZA 4BKTA 4ANVA 2ZPYA 4MJSB 4MGZE 4W9KA 3NS8A 1OQYA 2OOBB 1CMXB 2REXA 3QA8A 3QX1A 3H7PB 3L17A 4FLHA 3W1SA 2KVRA 1TZ1A 3ONSA 5L83A 4NQKE 2LRUA 2RSUA 1GNUA 4IC7B 4BKGA 2C7NB 3DBHI 3T9LA 1UGMA 4HJKA 5DPWA 1UZXB 4LDTB 4WWPA 3EC8A 1XT9B 3PPAA 1E8XA 4MSMB 3ZIMA 3ZLZA 4II3B 3L54A 1A5RA 1WJ4A 3VTUA 2J0MA 1GC7A
chains in the Genus database with same CATH superfamily
1E8ZA 3APFA 1RAXA 1H4RA 3R3MA 3VDZA 1WJUA 4FA6A 4DXGA 2OHFA 3VRBB 5AEKB 4K7SA 4DHZE 3TBLD 3AE8B 4DHJB 3VXWA 5H8YE 2MSED 1WE6A 3R8BA 4ZRJA 2CU3A 2A4ZA 4LTUA 1P1AA 5AUIA 4KKIA 1WGRA 2O6VD 3MHSD 5G5GA 2FE8A 2IBIB 3J9CA 4WAFA 2MX2A 4BZAA 1E10A 3NHEB 1YD8U 4A3PA 5EE1A 1LXDA 5J17A 3ML8A 2RGFA 4OHJA 2NPTB 3TEYA 4TV3A 1E9MA 1ZXIA 4WAAA 3UGBB 2XNAC 2PKOA 4BKSA 4DXFA 3AU5A 3RNCC 1JWAD 3VR9B 5AZHA 2NVUI 2WXIA 2MH7A 3Q8FA 2O6VA 1WYWB 1GB1A 4HK2A 2WXMA 1WJNA 2KLCA 1C9FA 3GE8C 2KMMA 2KFKA 4K1RB 4MDKE 1DOYA 1L6UA 4L1BA 3EECA 1RM6C 2N4FA 4DXAB 4W9DA 2PE6B 1WGDA 3C0RB 1AW7A 4NQLB 2NMQA 1V81A 2UWQA 2N1VA 5HHDG 1R4MI 2NTTA 3BVMA 3DHGC 4OZAA 1BMLC 1SJED 3M63B 2YEPB 2AEHA 2JX5A 2CS4A 2IY0B 1PGBA 3O65B 4DK5A 2MW5A 4ARCA 2K8CA 3T8MA 3H8HA 3DVNV 3B1LX 1KLVA 1PYWD 1WSPA 4RM8A 1XCTL 2GRIA 3W1SC 2JXTA 1YX6B 4XE0A 4BVUC 3PRZA 5D3IB 1F2RI 1RLFA 2K6DB 2INCC 4L2YA 3P42A 2OJWA 2JZPA 5IO9A 5J2RA 2BPSA 4NJCA 2DNFA 4EKUA 2LUEA 1M94A 3RN9C 3PTFC 4ICVA 2MBBB 3VRAB 2DAFA 3AEDB 4GDKA 3BYTB 4TSSA 4MGYE 4EUTA 5JHBA 3M62B 3E56A 1N60A 3NUHB 4I6LB 4N6EB 1I4XA 2N7DA 2J0KA 4HRSA 1KRHA 2W54A 4XZ4A 2ONQA 3HK0A 2LGYA 2KFJA 5LXIB 4PS8A 2QEJC 2DHZA 2WXJA 3U7DA 1VD2A 2XK5A 1P7FA 1FFVA 4KZCA 2G4SA 3BK2A 1YJJA 2KWDA 2MCNB 3PVLA 3KUDB 1YN5A 2BS4B 4NJ7A 3ZW3A 5LXHA 2FCMA 3Q3NC 1V86A 1J8CA 1ZGUB 4ANWA 1WI0A 3FKYA 3FILA 3KLSX 4MJSA 3NZ3A 1D5ZC 1F0ZA 2R61A 1UBQA 2W3RA 2JY6A 2LJIA 2AQ3B 2ZW0A 5C2TB 4OZBA 4HWIB 2CHZA 4YXDB 4MEMA 1B9RA 1G6JA 2N9PC 2MQJA 3DCGA 4ZYNA 4PS7A 2WX1A 1WY8A 2MP2A 2FNJB 4XX5A 3ZO5B 4DWFA 3WANA 3ZVVA 4KGTA 2GB1A 3VQIA 4LNFA 2C7HA 3GZNI 1E6EB 3ML9A 1I35A 2KK8A 4JPSA 2A5UA 3NOBA 2O6VB 3IT4B 5D94A 2KJ6A 5E6OA 1E5WA 4IDIA 2QHOA 1E7VA 4W9JA 4II2B 4OZCA 1NI3A 2KFKB 2WDRB 4W9EA 1VR9A 4D2KA 2M17A 1V2YA 1NENB 1EU4A 2KO3A 2YVCA 1C1YB 2MBQA 4WWNA 3DWGC 3R7RA 4F8CB 3H7SA 5D6JB 4YSYB 2L7RA 2LWPA 2MA9B 2B3AA 3UINB 2WXLA 1JWUD 1SE4A 1WGYA 3JVZX 2G4DB 1P7EA 1EWYC 5MPOA 1IGCA 1E0ZA 2NR2A 1ZPSA 3V60A 2JYEA 2C60A 1I4HA 1WF9A 4N58A 1WIAA 2I1JA 4CHKA 3PGEA 1L7YA 3Q3FA 1KH0A 4NJ6A 3O13A 2KC2A 1GB4A 1OEYA 3RT3B 4HKQA 1V1OA 1NI2A 3N1ZC 2KT7A 2PEAA 2LJ5A 1Q5WB 2LFIA 1FRDA 2K6QA 1Q1OA 2GOWA 4RH6A 1WM2A 4URKA 1C3TA 3N32A 4TQ1A 4JIOU 4C7YA 5L95C 3BWUD 4GDKB 4AJWA 2JSVX 1Z5SB 3KYCD 4XWTA 1UBIA 3RPFC 1T6BX 4A6QA 4DHJD 2JRHA 4TMAB 4BOSC 2ZW1A 2MRPA 3AE3B 3DBLB 2CR5A 1FXIA 2V9HA 1ZE3D 3Q3OC 1XCQL 2GBNA 1ET9A 4EZJA 1NEKB 3AE7B 2MHJA 2G3QB 5E6JA 5C3JB 2D3CA 2WXHA 4K81A 2RD0A 1C4PA 3LDZE 5JXVA 3TCAA 3TEWA 2EKEC 4N59A 3DBRI 2ZCCA 1F52A 1JRUA 1WXVA 3RI7C 4TQ0A 3MC0B 3APDA 4YTPB 3WALA 2ZZPB 4ANUA 3FILB 2JZZA 1SF0A 1AN8A 4MJSB 4MGZE 1IGDA 3QA8A 2E6XA 1MJDA 2KVRA 3ONSA 2LRUA 2RSUA 4IKGA 1UGJA 2WDVB 4Q2JA 3ETRA 3P1MA 3ZLZA 1TJEA 3GE3C 3Q8CA 3Q3MC 2Z0DB 3BVZA 4NAWB 4NPNA 1P0RA 2NS5A 2MP2B 1J0GA 2FCSA 3AI5A 4F7ZA 2V3SA 1IYFA 3DPDA 3KQ4A 2G1EA 2MEKA 4F1SA 2WXKA 1K53A 2E3TA 2WDTB 2M0XA 4S17A 3DQVA 1SB3C 3WAMA 3ZDTA 3IHPC 4MGKE 4IM3A 2L1AA 3ZYYX 2N7EA 2DX5B 5E6NA 2FUHB 1XF5L 3S2AA 3AE6B 1FNUA 3AECB 4FXCA 3FAHA 2ZCBA 3QQ8B 3UQAA 4O1NA 2KACA 1I4PA 3T3OA 1ZW7A 1RFKA 1SJHD 2MWSB 3DHHC 4G50A 3V6CB 3NRZA 2L0FA 1XLQA 2LHEA 3LB8C 3X23A 1VRAB 1SEBD 3AULA 3L0WB 3OAWA 2PW9A 2LHDA 1WH3A 3UI3A 1PQSA 4S0RA 1E90A 4RGOS 4YL8A 2AL6A 1Y8RC 3IG3A 1X1MA 2WQYB 4NZLB 2XEWA 1V80A 1KJTA 1GOZA 2GMIC 4IG7B 4K7WA 4KVGB 3A9JA 4B0EA 2JF5A 3TSSA 2BKRB 1J19A 2QDFA 3E9SA 2INDC 2IDYA 3U8ZA 1FNWA 3BYYB 3A4SC 1EUVB 3P2BA 3SFDB 1ZP0B 3EGRA 4W9FA 4FJVB 1CJEA 5LLIA 1AYFA 3L10B 3ZRCA 1SXTA 1T0QC 3AEAB 4A90A 5IKCM 4GXBA 2KJHB 5FR3A 2M19A 3AE1B 5GXGB 3ZTCA 3VTWA 4RCOA 1ZUD2 2DAJA 2BWES 3U7ZA 1WR6E 2KDBA 3KWVA 2JRIB 2L32A 1AWDA 1RFAA 1YQ3B 3A9KB 4WJOA 2BBCA 3WA0A 3DHIC 1UUPA 2KN5A 4DHZB 4RFBA 1MFWA 3M95A 1ZDXA 2VRRB 2ZNVB 2KWUB 2AX5A 5JHAA 1P9DU 2K22A 4M8MA 4TKNA 4A9AA 5FKAC 2UU7A 3R7QA 3NY5A 4M0WA 3Q2AC 2Y5BB 1NDDA 4P1BC 1YX5B 3RNAC 4BKSD 3JYUA 1ZOYB 1OEYJ 2MJEA 1C79A 1IBXA 2EMSA 2J52A 1FXAA 2D3BA 3MC9A 2Y5CA 3VHTC 2HTHA 2BGFA 2DBYA 2IGHA 2K5PA 2K8BA 2H88B 4RGMA 4XGAB 1DOIA 2DYOA 3V3XA 3PRPB 2L83A 3RFZB 2I38A 3TJPA 1N62A 3RCZA 3I9V1 4FULA 2O2VA 2WXGA 2YEPF 1WE7A 1YQBA 1YMHE 4M01A 5JZEB 4K3CA 1OQRA 1R4NB 3GOEA 1GG3A 3KYDD 4WJPA 4ICUA 1L4ZB 1SE9A 4LLGM 5C23A 3ZNGC 3D32A 3OLMD 4QAYA 3APCA 4R3DA 1GPXA 1VDVA 2KZRA 3PHXB 3PV1A 3X0WA 1QOFA 4I6NB 4IM2A 2WWZA 1XLOA 2N0SB 2EMTA 5DCNA 1JW9D 2HJ1A 5HKHA 2WU2B 1V1PA 4MELA 4MM3A 4RF0A 4W9GA 1WXSA 4G0NB 3GB1A 3PZ8A 3A1QA 5D3DA 3DWMA 5IOIA 3T3NA 1WRDB 1WR1A 4LNKA 2MBHA 1YN4A 3DDCB 3TEZA 2H89B 3A9JB 1TS3A 3ZDMC 4ZRQA 2KTRB 2KANA 3V6EB 1WX9A 1MHXA 2D3AA 1STEA 5CTRC 2PPHA 4IM0A 3FC4A 1JCKB 3KUCB 2LGSA 1AARA 2PJHA 3U30A 1LGRA 2OEDA 2K0PA 1UF0A 4W9IA 2GBKA 2C5LC 1QQRA 2MBEA 4A55A 4JL9A 3BK1A 1E8YA 2M56B 2IGGA 4M8NA 3IT6B 2L00B 3QAQA 2LXCA 2X38A 2WNMA 4AQ7A 5AZGA 4C4VA 3UIPB 5CX3A 3PHWB 2KQSA 4P1CC 4WJNA 4FBJB 2D3GA 1FNVA 4ZOHC 2HJ8A 1I4GA 2M8SA 1XLNA 2N9XA 5BYQA 3HM6X 4AJYB 4LJPB 4B6WA 2W9NA 1OFFA 3AEGB 3NG0A 4AOFA 2LD9A 2MJDA 4AWJA 2KMCA 5D7GA 2K8HA 3ZKJC 3OWEB 3VR8B 1GJZA 1WJ6A 4W9LA 1UWMA 2IO3B 1IBXB 2D10A 1MVKA 3PT2B 1V8CA 3DBLI 3ZJTA 4E71A 2DYMA 2YLMA 1SE3A 3BZDB 3MJWA 4FJYA 2IO1B 3DBSA 4CO7A 1PDXA 3RNFC 2KKCA 3QIJA 1LM8B 4EE2A 5IAAC 3TEXA 2QSDA 1MG4A 1CK1A 1WXAA 2O2VB 3UIOB 3Q8EA 3ZNZB 5I4DA 4WJQA 4BKTA 4UDUC 1DYQA 1T0SC 3L4PA 3NS1A 1FD6A 2D5GA 2REXA 1FCCC 3DBHB 1VLBA 2V3PA 1GNUA 4IC7B 3I57A 2C7NB 2N9KA 2GLSA 1A70A 4LK0M 1HQRD 1XT9B 1D5XC 4MSMB 3ZIMA 1WJ4A 4XWWA 2BQQA 3VTUA 3N3KB 1NBFC 5BYRA 3IBEA 4RM9A 1L6VA 4P7IA 1FM0D 1ZKHA 2G9HD 4HKZE 4MM3B 3PRMB 3P63A 1HTQA 1V49A 4YSXB 3AEFB 2AYOB 2L76A 3A1QB 4ASWC 1V6EA 4JWUC 3IFWB 4YTMB 4XYCA 2KDIA 2KJRA 2JT4B 3W9CB 2WXNA 3AV8A 4A3OA 4FJZA 1CQVA 1WM3A 3OJ4B 4XDCA 4YT0B 2ICIA 3ZNHB 2V3NA 3AE2B 3ECIA 2M1MA 3V05A 3B2GA 3DOWA 4LJOB 2KTFA 3HVDA 2RPVA 4X57B 2ZPNA 2LXAA 2FBWB 1HE8A 1M4VA 4C7ZA 2FIDA 1E7PB 3QWZB 5J18A 3ZGZA 1PGAA 2CHXA 2J53A 3BIID 2MBOA 2Z0EB 2DZKA 4ZRIA 4WH4A 1GUAB 3MJ5A 3JSVA 4K7UA 3HVZA 2BVCA 1QZEA 1J7CA 2MLBA 3AE4B 3H1UA 1OQQA 3QC8B 1V5TA 2BYEA 2V0GA 4KV2A 4ARIA 1KFYB 1K8RB 2L8JA 3PLUA 4HPMB 2XK5B 2DZIA 1OTRB 2HDEA 1P3QU 4HVBA 2WP9B 4HDQA 4IW0A 1WMHA 5AUKA 4LNOA 3I3TB 4HROA 3KUZA 4EOYA 1IP9A 1HA5A 1RWSA 2WDQB 4I6PA 2XN9C 1QOGA 1TY0A 2ZNVC 3ZNID 2I2YA 2GBJA 5G5HA 5KHOA 1WXQA 2DENB 2FUG1 5DPSA 4KIKA 1K52A 1Z2MA 4M00A 3BY4B 1FPYA 2BS2B 3DVNU 1T0YA 2J42A 1GAQB 1WZ3A 2TSSA 4ZHPA 4KSKC 1IUEA 1F9JA 1TZOA 1QKZA 4B0MA 4ITKA 3DVGY 1PFDA 1JWSD 4P6VF 2N9LA 3B2FA 3P4PB 2JYTA 3UQBA 4KDLB 1WX8A 2CHWA 3QJZA 4BAXA 1FCLA 1EU3A 2RPQA 1TYGB 3R2TA 4MSQB 2W82A 1NYQA 4NY0A 3R66C 5H92C 2KDEB 3KH0A 3A33B 1L0XB 2ZVNA 2FIFA 2NBUA 3RYTA 4HEA1 2DZJA 3I63C 4BBNC 2LZ6A 3RULA 2J7QB 4B9KA 4WURA 4FHJA 4TUUA 3ZJUA 4GMVA 5D2MB 3SDLC 1TS4A 4B95A 2JWZA 2V4IB 1JQ4A 1SSNA 4KGSA 1QILA 1N5XA 2ZVOA 3LYYA 1HZ5A 1WZ0A 2KVZA 4US9A 2ZEQA 4LNIA 1WXMA 1TTNA 4EEWA 1UD7A 2CKHB 2IPKD 3SFEB 2BKFA 1V5OA 5TR5A 4WWOA 4JX1C 2L0TA 3ZRFA 4PS3A 1MG8A 5G2NA 1L0VB 2PE9A 2KN4A 1FXTB 2G45B 3NZUA 1EO6A 2JXXA 1BXTA 1R4NI 2EELA 2V4LA 1QT9A 3UF8A 2LASA 2I1KA 5EE9A 4A8XC 2QCZA 1I4QA 4WIPA 2BWFA 2LVOA 2ASQA 2AQ1B 2QILA 3PO0A 3EA6A 3VUYA 3VTVA 4ZRKA 1J7BA 3OG5A 4JGHB 1IPGA 5CHFA 3W2DA 2K3UA 1HEZE 4KSLC 3TL5A 3B08A 5GMVA 4KKJA 2WXQA 3URYA 4REZA 3JSVB 4GIVA 2AL3A 2ON8A 3RNGC 1C77A 2JWUA 3ZXVA 3P4RB 4EZLA 1LFDA 1L5PA 3CSTA 4ACFA 1WX7A 2WLBA 3AEBB 1KOTA 3MHZA 1JWMD 1SIFA 1WMHB 5E6PA 4ZYSA 5IN7A 5G55A 4KGRA 2Y3AA 2UYZB 1S1QB 2NBVB 2BF8B 4J6IA 3PSEB 2Z8LA 3QARA 5HI1A 3RNBC 1YQ4B 4IWPA 1DOXA 4HPLB 1D3ZA 1D5MC 2DLBA 4HDOA 2CJNA 3U52E 2BB5A 4BBNF 4PYUA 1I7HA 2WXOA 3HM3A 2BS3B 4KIKB 2RDBC 3QCAA 2KWVB 2N7JA 5JH5C 2NBWB 4ANXA 4RMAA 3L16A 1K51A 1XO3A 2PIAA 2GBRA 3Q3JA 1U4AA 3TUOA 4HCNB 1TT5B 3ZXRA 3L13A 1TKYA 4RNAA 4NNJB 4XC2A 3LJ3A 1QF6A 1D6EC 4GU2A 2FCNA 2BYVE 4YWGG 3RD2A 3ENEA 4GB9A 4L23A 1V9JA 4ZDVA 2L05A 1KF6B 4P16A 3RUIB 2KQ4X 3NJTA 4GOCA 2AWTA 2JPHA 2VH1A 1SBBB 4G11A 5IP4D 4IOIE 1YJIA 4NAMA 2D11A 3ZUNA 4KDIC 3DVGX 2LUMA 3KW5B 1F77A 2MJ3A 2Y5PA 1T5XD 3WAOA 1L2NA 1J7AA 2KQ7A 2Q5WD 2LGXA 4WQMA 3NVZA 3TIXA 4J3OD 3VAWA 2KNBA 1WFYA 1L4DB 3NZSA 1F2RC 1LO5D 2KX0A 2K25A 1ZXHA 3N20C 3NS8A 4XDDA 4WWMA 4RF1A 1CMXB 1WYGA 4FLHA 1XLPA 5EE0A 2PMVA 3W1SA 3CIRB 1TZ1A 5L83A 1WRIA 4BKGA 3DBHI 3T9LA 3ZQ4A 4HJKA 5DPWA 4WWPA 5BYSA 1E8XA 4II3B 1Q10A 3AM9A 5KHQA 1GC7A 1RRBA 1EM7A 1KTKA 1N61A 1VZ8A 4AS1A 3VH3B 5CHVC 4CQNA 1V97A 3OJ3A 2VZKB 3AN1A 5LNK1 3ZTDA 3WIMA 3PZ7A 1I42A 1BUIC 2EKIA 3Q14C 4HXDA 2KOXA 2QIEB 3QHTA 2JU6X 1FMAD 1ACCA 3BINA 2JUOA 4MACA 2DWQA 1TKGA 4HPPA 5EE3A 2N1WA 3M3JA 2KD0A 1S3SG 1EF5A 3JW0X 1YNTE 3VUWA 5BMHA 5C1ZA 3RNEC 3N1XC 1E7UA 3IXSA 4DDID 2PLPA 2LRWA 2WGSA 2R2OA 2K1FA 3CWIA 1F1HA 1JMLA 4M0WB 1FRRA 1BT0A 2BYFA 3MFGA 5AZFA 1T0RC 4RGTA 2BYTA 3Q69A 2INPE 1QOAA 1L0YB 2QC8A 4OVUA 1EWCA 3H6NA 2ZJDA 1C78A 1ESFA 2QMTA 1QOBA 1N6ZA 4OVVA 5CHWA 2RR9A 2Z59B 4DQOC 3HUIA 2J4XA 2LI5A 2IO0B 4LCDE 3IAS1 1YJ1A 1TIFA 3Q6BA 3AH7A 3B9JA 2BT6A 3SR6A 2LEKA 1K50A 1R4MB 5FK9C 1MPEA 1VJKA 2SEBD 3C19A 4NAWA 3EFUA 1GC6A 1XXGA 2LVQA 2IZVB 3P4SB 1VZ6A 1XQQA 5FR6A 4PT5A 1UH6A 2W55A 1WGKA 3HRDD 1SE2A 2RDHA 3TMPB 3IVFA 3SHQA 2R2QA 1ET6A 4C80A 2KX3A 2L52A 1VZ7A 2KAJA 1C76A 2JVCA 3V61A 3GS2A 2WXFA 4JQWC 2INNE 4CYEA 4EZKA 3EUB2 5IA7A 5BMGA 4KX6B 4EFOA 1V1PB 1NVID 2NCNA 3H9DA 3RZFA 3NVYA 2XBBC 2WYQA 3Q8AA 1C4AA 3C8YA 2M0AA 5BMIA 4A20A 1E8WA 4GDLA 1PUTA 2CJOA 1UWXA 1TBEA 1JROA 3K9PB 3EHVA 1TS5A 4JLCA 2WU5B 3VFKA 4MH8A 2N9EB 1MI0A 2KMAA 1TGZB 3R2IA 4JE3B 4YTNB 3ABVB 2NTSA 4USAA 1N5WA 1VCBA 4IUMB 2IO2B 4E74A 3QK0A 2AQ2B 1C4CA 2FCQA 3HHMA 4ZHOA 3V62A 1UELA 2HE7A 2PTLA 2KLGA 3W5UB 1CZPA 4FADA 4LDTD 1SGHA 3I5JC 4PYZA 1FO4A 3P4QB 2SAKA 2L3ZA 2OJRA 1KM7A 4LNNA 5DPRA 2HD5B 3WCQA 1D4BA 2BW2A 1FFUA 1YN3A 1SIJA 4KZ0A 1JALA 4C4VB 2LGIA 3B0AA 4M02A 3K9OB 1KLGD 3H7PA 4W9HA 4HCPB 3IAM1 2GI9A 4MH0E 4FHKA 3AEEB 3KWLA 5HFYA 3WAPA 3AE9B 1DGJA 1P98A 5T8IA 4YSZB 3A9KA 1EF1A 3MP9A 2LGDA 3L08A 3RMKC 1MHHE 1WGHA 1ZDVA 4PK1A 3PZDA 4GGQA 1UNSA 3N9YC 4W9CA 3A4RA 4H2AA 4N9F4 3N30A 3CSFA 2RDGA 3GZNB 3KVFB 2KHWB 2IJ0A 2PVGC 1ROEA 2VH2A 2KWCA 1JWBD 2GBMA 4ZRPA 3AMZA 2D2QA 1XEEA 1PGXA 2WHIA 3ALBA 1H8CA 2ACZB 4DBGA 4GSWA 1RYJA 3PREA 2J0JA 2D07B 3NVVA 2V1YA 4K3BA 4OW0A 4BFRA 1B1ZA 1XD3B 3EFCA 2JZ3B 1YIWA 4HJGE 3LXFA 3SU8X 2KDMA 4C56C 4G3XB 3CMMB 2IGDA 2M4NA 2FAZA 2KXJA 1WGGA 4MGIE 1ENFA 2WX0A 2X8XX 3PLVA 2B76B 2KC1A 4IWQA 2NPTA 3Q8BA 1Q0WB 1WWTA 3HIZA 3W1YA 1HZ6A 2DZMA 3AXCA 3GP7A 1TKEA 2C9WB 2LMCA 1FIQA 3U2SC 2QJLA 3VUXA 4FN2A 5EDSA 2BTEA 4AUQC 1I4RA 1ISNA 1OGWA 1R7SA 4E3CA 2WS3B 4HLEA 2HTME 1FEHA 3MTNB 4RGNA 2WXPA 2JQRB 1T3QA 3U4EG 4GDLB 2C7MB 2VZKD 3VVWB 2BB6A 4BOZB 1LQBA 1HTOA 1Y56A 3AE5B 2KDFB 3AB5A 4MT5A 3VH4B 3PS6A 2CU1A 2K9XA 1TS2A 5HG2A 4IWOA 1TY2A 2IY1B 4AP4C 3ZJVA 4DDGD 3RZWC 5DPTA 3SEBA 2IYDB 4JWSC 5BO4B 2KYWA 3SD5A 3DBRB 2KTRA 2RMMA 2PVOD 5TSSA 4GN1A 3BVGA 2K39A 3CF6E 4C00A 2LVPA 2W3SA 3AU4A 3MC8A 3N1YC 4WQOB 2DYBA 1YOVB 4OVZA 4ANVA 2ZPYA 4W9KA 3NVWA 1OQYA 3W5VB 2OOBB 1QLBB 3QX1A 3H7PB 3L17A 1KLUD 4US8A 1JRPA 4NQKE 1N63A 1HXYD 1UGMA 1UZXB 1NYRA 4LDTB 3EC8A 3PPAA 1A5RA 3L54A 2WXRA 2J0MA 4GLSC
chains in the Genus database with same CATH topology
1E8ZA 2Z0DB 1RRBA 3APFA 4NAWB 1RAXA 3N3KB 1NBFC 4NPNA 1P0RA 2NS5A 1H4RA 2MP2B 3R3MA 1J0GA 3VDZA 3IBEA 4RM9A 2FCSA 3AI5A 4F7ZA 3VH3B 4P7IA 2V3SA 1WJUA 3DPDA 5CHVC 1IYFA 3OJ3A 4F1SA 4FA6A 1ZKHA 3ZTDA 3WIMA 2WDTB 3PRMB 2M0XA 1I42A 1V49A 5AEKB 4K7SA 3DQVA 4DHZE 2AYOB 3TBLD 2L76A 3A1QB 3WAMA 3ZDTA 3IHPC 3VXWA 4ASWC 1V6EA 4DHJB 4HXDA 2KOXA 3IFWB 3QHTA 2MSED 3BINA 1WE6A 2JUOA 4MGKE 4IM3A 4ZRJA 2KDIA 2A4ZA 1P1AA 2KJRA 2JT4B 2N7EA 4A3OA 2DX5B 5E6NA 2FUHB 4FJZA 3S2AA 2N1WA 1WM3A 3M3JA 2KD0A 3OJ4B 1S3SG 1EF5A 3JW0X 3ZNHB 3VUWA 1WGRA 3ECIA 5C1ZA 2M1MA 2O6VD 3MHSD 1E7UA 3DOWA 2ZCBA 3QQ8B 4LJOB 3UQAA 4DDID 2KTFA 2LRWA 2R2OA 4X57B 2IBIB 1ZW7A 2ZPNA 2K1FA 2MX2A 2MWSB 2LXAA 1HE8A 4G50A 4M0WB 3V6CB 3NHEB 2FIDA 1YD8U 2L0FA 3QWZB 5J18A 1BT0A 2BYFA 4A3PA 5AZFA 1LXDA 2CHXA 5J17A 3X23A 3ML8A 2MBOA 2RGFA 2NPTB 2Z0EB 3AULA 3L0WB 3OAWA 2DZKA 4TV3A 4ZRIA 1WH3A 1GUAB 4WAAA 4OVUA 3UGBB 1PQSA 3H6NA 3JSVA 2ZJDA 4K7UA 3AU5A 1QZEA 4BKSA 2MLBA 3H1UA 1E90A 3QC8B 4OVVA 2RR9A 5CHWA 2NVUI 4YL8A 5AZHA 1V5TA 2AL6A 2O6VA 1Y8RC 2Z59B 1WYWB 3IG3A 1X1MA 2BYEA 4HK2A 4KV2A 1K8RB 2XEWA 2LI5A 1V80A 2IO0B 2KLCA 1WJNA 1KJTA 2L8JA 2GMIC 3PLUA 4HPMB 2XK5B 2DZIA 3A9JA 4IG7B 4K7WA 4KVGB 4LCDE 2JF5A 1OTRB 1P3QU 2KFKA 4HVBA 2BKRB 1J19A 1YJ1A 4HDQA 4K1RB 4IW0A 1WMHA 4MDKE 3U8ZA 3A4SC 3EECA 1EUVB 2N4FA 3I3TB 4DXAB 3P2BA 3KUZA 4W9DA 2PE6B 4W9FA 1WGDA 3C0RB 4FJVB 4EOYA 4NQLB 1IP9A 1V81A 2UWQA 4I6PA 5LLIA 2N1VA 3L10B 4NAWA 3ZRCA 1R4MI 3EFUA 1GC6A 2ZNVC 3ZNID 2GBJA 4GXBA 5KHOA 2KJHB 2DENB 5DPSA 2LVQA 4KIKA 3M63B 2IZVB 3ZTCA 1Z2MA 1XQQA 2AEHA 5FR6A 1UH6A 3VTWA 3BY4B 2CS4A 2DAJA 2IY0B 4DK5A 2BWES 3O65B 3TMPB 1WR6E 2KDBA 1T0YA 2MW5A 3DVNU 1WZ3A 2JRIB 3IVFA 2K8CA 2R2QA 4KSKC 3SHQA 3T8MA 2KX3A 1F9JA 3DVNV 1RFAA 3B1LX 1KLVA 3A9KB 3DVGY 4RM8A 4WJOA 3WA0A 3W1SC 2JVCA 3V61A 2KN5A 4JQWC 1YX6B 4BVUC 4CYEA 3PRZA 4EZKA 4DHZB 1RLFA 5IA7A 2K6DB 3M95A 2VRRB 2ZNVB 2KWUB 4EFOA 3UQBA 4KDLB 5J2RA 1WX8A 2CHWA 3QJZA 2NCNA 3H9DA 2RPQA 5JHAA 1P9DU 2BPSA 4MSQB 3RZFA 4M8MA 2XBBC 4EKUA 2WYQA 4TKNA 4NY0A 3R66C 2LUEA 1M94A 2KDEB 3KH0A 3PTFC 3A33B 4ICVA 2MBBB 3R7QA 2ZVNA 3NY5A 2FIFA 2NBUA 4A20A 1E8WA 4GDLA 2DAFA 2Y5BB 1TBEA 4GDKA 3K9PB 4MGYE 3RYTA 4EUTA 1NDDA 5JHBA 1YX5B 3EHVA 4BKSD 2DZJA 3JYUA 3M62B 4I6LB 4JLCA 3VFKA 1OEYJ 2N7DA 2N9EB 4BBNC 2J0KA 1TGZB 2KMAA 2LZ6A 2J7QB 3RULA 4B9KA 4FHJA 1VCBA 4IUMB 2IO2B 4TUUA 4E74A 4XZ4A 4GMVA 5D2MB 3SDLC 2EMSA 3QK0A 4B95A 2JWZA 3HK0A 2FCQA 3HHMA 2LGYA 2KFJA 5LXIB 3V62A 3VHTC 4PS8A 2HTHA 2BGFA 2ZVOA 1UELA 2DHZA 2HE7A 2K8BA 2KLGA 3U7DA 1VD2A 2XK5A 1WZ0A 2ZEQA 4KZCA 4FADA 2DYOA 1WXMA 2G4SA 4LDTD 1TTNA 2MCNB 3PVLA 1SGHA 3KUDB 4PYZA 4EEWA 1UD7A 2CKHB 3PRPB 2BKFA 4NJ7A 3ZW3A 5LXHA 1V5OA 5TR5A 4WWOA 3TJPA 2L3ZA 2FCMA 1KM7A 2OJRA 3RCZA 5DPRA 2HD5B 4FULA 2O2VA 1V86A 2L0TA 3ZRFA 1ZGUB 4PS3A 1MG8A 4ANWA 5G2NA 1J8CA 1WE7A 2PE9A 1FXTB 1WI0A 1YQBA 2G45B 4KZ0A 4MJSA 5JZEB 3NZUA 3B0AA 1EO6A 2JXXA 3GOEA 1GG3A 3K9OB 3KYDD 4WJPA 4ICUA 1SE9A 3H7PA 4W9HA 1R4NI 4HCPB 5C23A 3ZNGC 2V4LA 3D32A 3OLMD 1UBQA 3APCA 4MH0E 3UF8A 2LASA 4FHKA 2I1KA 2JY6A 2BWFA 2LVOA 3WAPA 2KZRA 3PHXB 2ASQA 4HWIB 1P98A 2CHZA 4MEMA 3PV1A 3X0WA 1G6JA 3A9KA 2N9PC 1EF1A 3VUYA 2MQJA 3DCGA 4I6NB 4IM2A 3VTVA 4ZRKA 2LGDA 2WWZA 3L08A 4ZYNA 4PS7A 1WGHA 2WX1A 1WY8A 1IPGA 4JGHB 2MP2A 5CHFA 2FNJB 3PZDA 4XX5A 3ZO5B 4GGQA 4DWFA 4KSLC 2EMTA 5DCNA 3TL5A 3B08A 5GMVA 4W9CA 3A4RA 4N9F4 3N30A 3WANA 3ZVVA 5HKHA 3CSFA 3VQIA 4MELA 4MM3A 3KVFB 4W9GA 1WXSA 2KHWB 3JSVB 4GIVA 2KWCA 2C7HA 2GBMA 2AL3A 3GZNI 3ML9A 4G0NB 2D2QA 1I35A 3ALBA 3A1QA 2KK8A 2A5UA 3NOBA 1H8CA 1WRDB 1WR1A 2O6VB 5D94A 2MBHA 4DBGA 2KJ6A 3DDCB 4GSWA 5E6OA 1E5WA 2QHOA 4EZLA 1E7VA 3PREA 4W9JA 2J0JA 3A9JB 1LFDA 2D07B 3ZDMC 4II2B 3CSTA 2KFKB 1WX7A 4W9EA 2V1YA 1KOTA 1SIFA 1WMHB 5E6PA 2KTRB 4BFRA 5G55A 1XD3B 2KANA 2M17A 1V2YA 2JZ3B 1YIWA 3V6EB 2UYZB 2KO3A 2YVCA 3SU8X 1S1QB 1C1YB 1WX9A 2NBVB 4G3XB 2BF8B 2MBQA 4J6IA 4WWNA 3PSEB 3QARA 3R7RA 4F8CB 3H7SA 3CMMB 4IWPA 2M4NA 5CTRC 4HPLB 2FAZA 2PPHA 2KXJA 5D6JB 1WGGA 4IM0A 3KUCB 1D3ZA 2L7RA 4HDOA 4MGIE 1AARA 2LWPA 2MA9B 2PJHA 3U30A 2B3AA 3UINB 2WX0A 4BBNF 4W9IA 1WGYA 2KC1A 2G4DB 2GBKA 2C5LC 3JVZX 3PLVA 4IWQA 4PYUA 2MBEA 3HM3A 4KIKB 2NPTA 4JL9A 1Q0WB 3HIZA 3QCAA 3W1YA 1E8YA 4M8NA 2KWVB 2L00B 2DZMA 3QAQA 2NR2A 2LXCA 2NBWB 3AXCA 5JH5C 3V60A 2C60A 1WF9A 1WIAA 2C9WB 2I1JA 4ANXA 4CHKA 3PGEA 4RMAA 3L16A 5AZGA 1L7YA 3Q3FA 3UIPB 5CX3A 3PHWB 4NJ6A 3VUXA 4FN2A 2KC2A 2KQSA 2GBRA 1OEYA 3Q3JA 3RT3B 1U4AA 4HCNB 4WJNA 4FBJB 2D3GA 3L13A 5EDSA 1NI2A 2PEAA 4NNJB 4XC2A 3LJ3A 2LJ5A 4AUQC 1ISNA 1OGWA 4GU2A 2HJ8A 1Q5WB 4E3CA 2M8SA 2FCNA 2BYVE 2K6QA 4HLEA 3RD2A 2N9XA 1Q1OA 3ENEA 4GB9A 2GOWA 1V9JA 3MTNB 3HM6X 1WM2A 4URKA 4ZDVA 4AJYB 2L05A 4LJPB 4B6WA 3N32A 2W9NA 4GDLB 1C3TA 4TQ1A 2C7MB 3VVWB 4JIOU 5L95C 4AOFA 2LD9A 4GDKB 3RUIB 4AWJA 2KMCA 4AJWA 5D7GA 1Z5SB 3KYCD 4BOZB 1LQBA 5KHQA 4GOCA 2AWTA 2KDFB 2JPHA 2K8HA 3ZKJC 3VH4B 1UBIA 3PS6A 4G11A 1GJZA 2CU1A 1WJ6A 4W9LA 4DHJD 2JRHA 4BOSC 2D11A 2MRPA 2IO3B 3ZUNA 2CR5A 2D10A 3DVGX 4KDIC 3KW5B 4IWOA 3PT2B 2IY1B 3DBLI 4AP4C 2GBNA 4E71A 3WAOA 2DYMA 2YLMA 1L2NA 4DDGD 4EZJA 3RZWC 2KQ7A 3MJWA 4FJYA 5DPTA 2G3QB 2IYDB 2IO1B 3DBSA 2LGXA 5BO4B 4K81A 4CO7A 2RD0A 2KKCA 3QIJA 1LM8B 3SD5A 5IAAC 3LDZE 2KTRA 3TIXA 3VAWA 3TCAA 2KNBA 2EKEC 4GN1A 3DBRI 2K39A 1JRUA 1WXAA 1WFYA 2ZCCA 3NZSA 1WXVA 3CF6E 4TQ0A 2LVPA 2O2VB 3AU4A 3UIOB 3ZNZB 4WQOB 2KX0A 2DYBA 3APDA 2K25A 3WALA 2ZZPB 4ANUA 4WJQA 2JZZA 4BKTA 4ANVA 2ZPYA 4MJSB 4MGZE 4W9KA 3NS8A 1OQYA 2OOBB 1CMXB 2REXA 3QA8A 3QX1A 3H7PB 3L17A 4FLHA 3W1SA 2KVRA 1TZ1A 3ONSA 5L83A 4NQKE 2LRUA 2RSUA 1GNUA 4IC7B 4BKGA 2C7NB 3DBHI 3T9LA 1UGMA 4HJKA 5DPWA 1UZXB 4LDTB 4WWPA 3EC8A 1XT9B 3PPAA 1E8XA 4MSMB 3ZIMA 3ZLZA 4II3B 3L54A 1A5RA 1WJ4A 3VTUA 2J0MA 1GC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E8Z A;  2Z0D B;  1RRB A;  3APF A;  4NAW B;  1RAX A;  3N3K B;  1NBF C;  4NPN A;  1P0R A;  2NS5 A;  1H4R A;  2MP2 B;  3R3M A;  1J0G A;  3VDZ A;  3IBE A;  4RM9 A;  2FCS A;  3AI5 A;  4F7Z A;  3VH3 B;  4P7I A;  2V3S A;  1WJU A;  3DPD A;  5CHV C;  1IYF A;  3OJ3 A;  4F1S A;  4FA6 A;  1ZKH A;  3ZTD A;  3WIM A;  2WDT B;  3PRM B;  2M0X A;  1I42 A;  1V49 A;  5AEK B;  4K7S A;  3DQV A;  4DHZ E;  2AYO B;  3TBL D;  2L76 A;  3A1Q B;  3WAM A;  3ZDT A;  3IHP C;  3VXW A;  4ASW C;  1V6E A;  4DHJ B;  4HXD A;  2KOX A;  3IFW B;  3QHT A;  2MSE D;  3BIN A;  1WE6 A;  2JUO A;  4MGK E;  4IM3 A;  4ZRJ A;  2KDI A;  2A4Z A;  1P1A A;  2KJR A;  2JT4 B;  2N7E A;  4A3O A;  2DX5 B;  5E6N A;  2FUH B;  4FJZ A;  3S2A A;  2N1W A;  1WM3 A;  3M3J A;  2KD0 A;  3OJ4 B;  1S3S G;  1EF5 A;  3JW0 X;  3ZNH B;  3VUW A;  1WGR A;  3ECI A;  5C1Z A;  2M1M A;  2O6V D;  3MHS D;  1E7U A;  3DOW A;  2ZCB A;  3QQ8 B;  4LJO B;  3UQA A;  4DDI D;  2KTF A;  2LRW A;  2R2O A;  4X57 B;  2IBI B;  1ZW7 A;  2ZPN A;  2K1F A;  2MX2 A;  2MWS B;  2LXA A;  1HE8 A;  4G50 A;  4M0W B;  3V6C B;  3NHE B;  2FID A;  1YD8 U;  2L0F A;  3QWZ B;  5J18 A;  1BT0 A;  2BYF A;  4A3P A;  5AZF A;  1LXD A;  2CHX A;  5J17 A;  3X23 A;  3ML8 A;  2MBO A;  2RGF A;  2NPT B;  2Z0E B;  3AUL A;  3L0W B;  3OAW A;  2DZK A;  4TV3 A;  4ZRI A;  1WH3 A;  1GUA B;  4WAA A;  4OVU A;  3UGB B;  1PQS A;  3H6N A;  3JSV A;  2ZJD A;  4K7U A;  3AU5 A;  1QZE A;  4BKS A;  2MLB A;  3H1U A;  1E90 A;  3QC8 B;  4OVV A;  2RR9 A;  5CHW A;  2NVU I;  4YL8 A;  5AZH A;  1V5T A;  2AL6 A;  2O6V A;  1Y8R C;  2Z59 B;  1WYW B;  3IG3 A;  1X1M A;  2BYE A;  4HK2 A;  4KV2 A;  1K8R B;  2XEW A;  2LI5 A;  1V80 A;  2IO0 B;  2KLC A;  1WJN A;  1KJT A;  2L8J A;  2GMI C;  3PLU A;  4HPM B;  2XK5 B;  2DZI A;  3A9J A;  4IG7 B;  4K7W A;  4KVG B;  4LCD E;  2JF5 A;  1OTR B;  1P3Q U;  2KFK A;  4HVB A;  2BKR B;  1J19 A;  1YJ1 A;  4HDQ A;  4K1R B;  4IW0 A;  1WMH A;  4MDK E;  3U8Z A;  3A4S C;  3EEC A;  1EUV B;  2N4F A;  3I3T B;  4DXA B;  3P2B A;  3KUZ A;  4W9D A;  2PE6 B;  4W9F A;  1WGD A;  3C0R B;  4FJV B;  4EOY A;  4NQL B;  1IP9 A;  1V81 A;  2UWQ A;  4I6P A;  5LLI A;  2N1V A;  3L10 B;  4NAW A;  3ZRC A;  1R4M I;  3EFU A;  1GC6 A;  2ZNV C;  3ZNI D;  2GBJ A;  4GXB A;  5KHO A;  2KJH B;  2DEN B;  5DPS A;  2LVQ A;  4KIK A;  3M63 B;  2IZV B;  3ZTC A;  1Z2M A;  1XQQ A;  2AEH A;  5FR6 A;  1UH6 A;  3VTW A;  3BY4 B;  2CS4 A;  2DAJ A;  2IY0 B;  4DK5 A;  2BWE S;  3O65 B;  3TMP B;  1WR6 E;  2KDB A;  1T0Y A;  2MW5 A;  3DVN U;  1WZ3 A;  2JRI B;  3IVF A;  2K8C A;  2R2Q A;  4KSK C;  3SHQ A;  3T8M A;  2KX3 A;  1F9J A;  3DVN V;  1RFA A;  3B1L X;  1KLV A;  3A9K B;  3DVG Y;  4RM8 A;  4WJO A;  3WA0 A;  3W1S C;  2JVC A;  3V61 A;  2KN5 A;  4JQW C;  1YX6 B;  4BVU C;  4CYE A;  3PRZ A;  4EZK A;  4DHZ B;  1RLF A;  5IA7 A;  2K6D B;  3M95 A;  2VRR B;  2ZNV B;  2KWU B;  4EFO A;  3UQB A;  4KDL B;  5J2R A;  1WX8 A;  2CHW A;  3QJZ A;  2NCN A;  3H9D A;  2RPQ A;  5JHA A;  1P9D U;  2BPS A;  4MSQ B;  3RZF A;  4M8M A;  2XBB C;  4EKU A;  2WYQ A;  4TKN A;  4NY0 A;  3R66 C;  2LUE A;  1M94 A;  2KDE B;  3KH0 A;  3PTF C;  3A33 B;  4ICV A;  2MBB B;  3R7Q A;  2ZVN A;  3NY5 A;  2FIF A;  2NBU A;  4A20 A;  1E8W A;  4GDL A;  2DAF A;  2Y5B B;  1TBE A;  4GDK A;  3K9P B;  4MGY E;  3RYT A;  4EUT A;  1NDD A;  5JHB A;  1YX5 B;  3EHV A;  4BKS D;  2DZJ A;  3JYU A;  3M62 B;  4I6L B;  4JLC A;  3VFK A;  1OEY J;  2N7D A;  2N9E B;  4BBN C;  2J0K A;  1TGZ B;  2KMA A;  2LZ6 A;  2J7Q B;  3RUL A;  4B9K A;  4FHJ A;  1VCB A;  4IUM B;  2IO2 B;  4TUU A;  4E74 A;  4XZ4 A;  4GMV A;  5D2M B;  3SDL C;  2EMS A;  3QK0 A;  4B95 A;  2JWZ A;  3HK0 A;  2FCQ A;  3HHM A;  2LGY A;  2KFJ A;  5LXI B;  3V62 A;  3VHT C;  4PS8 A;  2HTH A;  2BGF A;  2ZVO A;  1UEL A;  2DHZ A;  2HE7 A;  2K8B A;  2KLG A;  3U7D A;  1VD2 A;  2XK5 A;  1WZ0 A;  2ZEQ A;  4KZC A;  4FAD A;  2DYO A;  1WXM A;  2G4S A;  4LDT D;  1TTN A;  2MCN B;  3PVL A;  1SGH A;  3KUD B;  4PYZ A;  4EEW A;  1UD7 A;  2CKH B;  3PRP B;  2BKF A;  4NJ7 A;  3ZW3 A;  5LXH A;  1V5O A;  5TR5 A;  4WWO A;  3TJP A;  2L3Z A;  2FCM A;  1KM7 A;  2OJR A;  3RCZ A;  5DPR A;  2HD5 B;  4FUL A;  2O2V A;  1V86 A;  2L0T A;  3ZRF A;  1ZGU B;  4PS3 A;  1MG8 A;  4ANW A;  5G2N A;  1J8C A;  1WE7 A;  2PE9 A;  1FXT B;  1WI0 A;  1YQB A;  2G45 B;  4KZ0 A;  4MJS A;  5JZE B;  3NZU A;  3B0A A;  1EO6 A;  2JXX A;  3GOE A;  1GG3 A;  3K9O B;  3KYD D;  4WJP A;  4ICU A;  1SE9 A;  3H7P A;  4W9H A;  1R4N I;  4HCP B;  5C23 A;  3ZNG C;  2V4L A;  3D32 A;  3OLM D;  1UBQ A;  3APC A;  4MH0 E;  3UF8 A;  2LAS A;  4FHK A;  2I1K A;  2JY6 A;  2BWF A;  2LVO A;  3WAP A;  2KZR A;  3PHX B;  2ASQ A;  4HWI B;  1P98 A;  2CHZ A;  4MEM A;  3PV1 A;  3X0W A;  1G6J A;  3A9K A;  2N9P C;  1EF1 A;  3VUY A;  2MQJ A;  3DCG A;  4I6N B;  4IM2 A;  3VTV A;  4ZRK A;  2LGD A;  2WWZ A;  3L08 A;  4ZYN A;  4PS7 A;  1WGH A;  2WX1 A;  1WY8 A;  1IPG A;  4JGH B;  2MP2 A;  5CHF A;  2FNJ B;  3PZD A;  4XX5 A;  3ZO5 B;  4GGQ A;  4DWF A;  4KSL C;  2EMT A;  5DCN A;  3TL5 A;  3B08 A;  5GMV A;  4W9C A;  3A4R A;  4N9F 4;  3N30 A;  3WAN A;  3ZVV A;  5HKH A;  3CSF A;  3VQI A;  4MEL A;  4MM3 A;  3KVF B;  4W9G A;  1WXS A;  2KHW B;  3JSV B;  4GIV A;  2KWC A;  2C7H A;  2GBM A;  2AL3 A;  3GZN I;  3ML9 A;  4G0N B;  2D2Q A;  1I35 A;  3ALB A;  3A1Q A;  2KK8 A;  2A5U A;  3NOB A;  1H8C A;  1WRD B;  1WR1 A;  2O6V B;  5D94 A;  2MBH A;  4DBG A;  2KJ6 A;  3DDC B;  4GSW A;  5E6O A;  1E5W A;  2QHO A;  4EZL A;  1E7V A;  3PRE A;  4W9J A;  2J0J A;  3A9J B;  1LFD A;  2D07 B;  3ZDM C;  4II2 B;  3CST A;  2KFK B;  1WX7 A;  4W9E A;  2V1Y A;  1KOT A;  1SIF A;  1WMH B;  5E6P A;  2KTR B;  4BFR A;  5G55 A;  1XD3 B;  2KAN A;  2M17 A;  1V2Y A;  2JZ3 B;  1YIW A;  3V6E B;  2UYZ B;  2KO3 A;  2YVC A;  3SU8 X;  1S1Q B;  1C1Y B;  1WX9 A;  2NBV B;  4G3X B;  2BF8 B;  2MBQ A;  4J6I A;  4WWN A;  3PSE B;  3QAR A;  3R7R A;  4F8C B;  3H7S A;  3CMM B;  4IWP A;  2M4N A;  5CTR C;  4HPL B;  2FAZ A;  2PPH A;  2KXJ A;  5D6J B;  1WGG A;  4IM0 A;  3KUC B;  1D3Z A;  2L7R A;  4HDO A;  4MGI E;  1AAR A;  2LWP A;  2MA9 B;  2PJH A;  3U30 A;  2B3A A;  3UIN B;  2WX0 A;  4BBN F;  4W9I A;  1WGY A;  2KC1 A;  2G4D B;  2GBK A;  2C5L C;  3JVZ X;  3PLV A;  4IWQ A;  4PYU A;  2MBE A;  3HM3 A;  4KIK B;  2NPT A;  4JL9 A;  1Q0W B;  3HIZ A;  3QCA A;  3W1Y A;  1E8Y A;  4M8N A;  2KWV B;  2L00 B;  2DZM A;  3QAQ A;  2NR2 A;  2LXC A;  2NBW B;  3AXC A;  5JH5 C;  3V60 A;  2C60 A;  1WF9 A;  1WIA A;  2C9W B;  2I1J A;  4ANX A;  4CHK A;  3PGE A;  4RMA A;  3L16 A;  5AZG A;  1L7Y A;  3Q3F A;  3UIP B;  5CX3 A;  3PHW B;  4NJ6 A;  3VUX A;  4FN2 A;  2KC2 A;  2KQS A;  2GBR A;  1OEY A;  3Q3J A;  3RT3 B;  1U4A A;  4HCN B;  4WJN A;  4FBJ B;  2D3G A;  3L13 A;  5EDS A;  1NI2 A;  2PEA A;  4NNJ B;  4XC2 A;  3LJ3 A;  2LJ5 A;  4AUQ C;  1ISN A;  1OGW A;  4GU2 A;  2HJ8 A;  1Q5W B;  4E3C A;  2M8S A;  2FCN A;  2BYV E;  2K6Q A;  4HLE A;  3RD2 A;  2N9X A;  1Q1O A;  3ENE A;  4GB9 A;  2GOW A;  1V9J A;  3MTN B;  3HM6 X;  1WM2 A;  4URK A;  4ZDV A;  4AJY B;  2L05 A;  4LJP B;  4B6W A;  3N32 A;  2W9N A;  4GDL B;  1C3T A;  4TQ1 A;  2C7M B;  3VVW B;  4JIO U;  5L95 C;  4AOF A;  2LD9 A;  4GDK B;  3RUI B;  4AWJ A;  2KMC A;  4AJW A;  5D7G A;  1Z5S B;  3KYC D;  4BOZ B;  1LQB A;  5KHQ A;  4GOC A;  2AWT A;  2KDF B;  2JPH A;  2K8H A;  3ZKJ C;  3VH4 B;  1UBI A;  3PS6 A;  4G11 A;  1GJZ A;  2CU1 A;  1WJ6 A;  4W9L A;  4DHJ D;  2JRH A;  4BOS C;  2D11 A;  2MRP A;  2IO3 B;  3ZUN A;  2CR5 A;  2D10 A;  3DVG X;  4KDI C;  3KW5 B;  4IWO A;  3PT2 B;  2IY1 B;  3DBL I;  4AP4 C;  2GBN A;  4E71 A;  3WAO A;  2DYM A;  2YLM A;  1L2N A;  4DDG D;  4EZJ A;  3RZW C;  2KQ7 A;  3MJW A;  4FJY A;  5DPT A;  2G3Q B;  2IYD B;  2IO1 B;  3DBS A;  2LGX A;  5BO4 B;  4K81 A;  4CO7 A;  2RD0 A;  2KKC A;  3QIJ A;  1LM8 B;  3SD5 A;  5IAA C;  3LDZ E;  2KTR A;  3TIX A;  3VAW A;  3TCA A;  2KNB A;  2EKE C;  4GN1 A;  3DBR I;  2K39 A;  1JRU A;  1WXA A;  1WFY A;  2ZCC A;  3NZS A;  1WXV A;  3CF6 E;  4TQ0 A;  2LVP A;  2O2V B;  3AU4 A;  3UIO B;  3ZNZ B;  4WQO B;  2KX0 A;  2DYB A;  3APD A;  2K25 A;  3WAL A;  2ZZP B;  4ANU A;  4WJQ A;  2JZZ A;  4BKT A;  4ANV A;  2ZPY A;  4MJS B;  4MGZ E;  4W9K A;  3NS8 A;  1OQY A;  2OOB B;  1CMX B;  2REX A;  3QA8 A;  3QX1 A;  3H7P B;  3L17 A;  4FLH A;  3W1S A;  2KVR A;  1TZ1 A;  3ONS A;  5L83 A;  4NQK E;  2LRU A;  2RSU A;  1GNU A;  4IC7 B;  4BKG A;  2C7N B;  3DBH I;  3T9L A;  1UGM A;  4HJK A;  5DPW A;  1UZX B;  4LDT B;  4WWP A;  3EC8 A;  1XT9 B;  3PPA A;  1E8X A;  4MSM B;  3ZIM A;  3ZLZ A;  4II3 B;  3L54 A;  1A5R A;  1WJ4 A;  3VTU A;  2J0M A;  1GC7 A; 
#chains in the Genus database with same CATH topology
 1E8Z A;  3APF A;  1RAX A;  1H4R A;  3R3M A;  3VDZ A;  1WJU A;  4FA6 A;  4DXG A;  2OHF A;  3VRB B;  5AEK B;  4K7S A;  4DHZ E;  3TBL D;  3AE8 B;  4DHJ B;  3VXW A;  5H8Y E;  2MSE D;  1WE6 A;  3R8B A;  4ZRJ A;  2CU3 A;  2A4Z A;  4LTU A;  1P1A A;  5AUI A;  4KKI A;  1WGR A;  2O6V D;  3MHS D;  5G5G A;  2FE8 A;  2IBI B;  3J9C A;  4WAF A;  2MX2 A;  4BZA A;  1E10 A;  3NHE B;  1YD8 U;  4A3P A;  5EE1 A;  1LXD A;  5J17 A;  3ML8 A;  2RGF A;  4OHJ A;  2NPT B;  3TEY A;  4TV3 A;  1E9M A;  1ZXI A;  4WAA A;  3UGB B;  2XNA C;  2PKO A;  4BKS A;  4DXF A;  3AU5 A;  3RNC C;  1JWA D;  3VR9 B;  5AZH A;  2NVU I;  2WXI A;  2MH7 A;  3Q8F A;  2O6V A;  1WYW B;  1GB1 A;  4HK2 A;  2WXM A;  1WJN A;  2KLC A;  1C9F A;  3GE8 C;  2KMM A;  2KFK A;  4K1R B;  4MDK E;  1DOY A;  1L6U A;  4L1B A;  3EEC A;  1RM6 C;  2N4F A;  4DXA B;  4W9D A;  2PE6 B;  1WGD A;  3C0R B;  1AW7 A;  4NQL B;  2NMQ A;  1V81 A;  2UWQ A;  2N1V A;  5HHD G;  1R4M I;  2NTT A;  3BVM A;  3DHG C;  4OZA A;  1BML C;  1SJE D;  3M63 B;  2YEP B;  2AEH A;  2JX5 A;  2CS4 A;  2IY0 B;  1PGB A;  3O65 B;  4DK5 A;  2MW5 A;  4ARC A;  2K8C A;  3T8M A;  3H8H A;  3DVN V;  3B1L X;  1KLV A;  1PYW D;  1WSP A;  4RM8 A;  1XCT L;  2GRI A;  3W1S C;  2JXT A;  1YX6 B;  4XE0 A;  4BVU C;  3PRZ A;  5D3I B;  1F2R I;  1RLF A;  2K6D B;  2INC C;  4L2Y A;  3P42 A;  2OJW A;  2JZP A;  5IO9 A;  5J2R A;  2BPS A;  4NJC A;  2DNF A;  4EKU A;  2LUE A;  1M94 A;  3RN9 C;  3PTF C;  4ICV A;  2MBB B;  3VRA B;  2DAF A;  3AED B;  4GDK A;  3BYT B;  4TSS A;  4MGY E;  4EUT A;  5JHB A;  3M62 B;  3E56 A;  1N60 A;  3NUH B;  4I6L B;  4N6E B;  1I4X A;  2N7D A;  2J0K A;  4HRS A;  1KRH A;  2W54 A;  4XZ4 A;  2ONQ A;  3HK0 A;  2LGY A;  2KFJ A;  5LXI B;  4PS8 A;  2QEJ C;  2DHZ A;  2WXJ A;  3U7D A;  1VD2 A;  2XK5 A;  1P7F A;  1FFV A;  4KZC A;  2G4S A;  3BK2 A;  1YJJ A;  2KWD A;  2MCN B;  3PVL A;  3KUD B;  1YN5 A;  2BS4 B;  4NJ7 A;  3ZW3 A;  5LXH A;  2FCM A;  3Q3N C;  1V86 A;  1J8C A;  1ZGU B;  4ANW A;  1WI0 A;  3FKY A;  3FIL A;  3KLS X;  4MJS A;  3NZ3 A;  1D5Z C;  1F0Z A;  2R61 A;  1UBQ A;  2W3R A;  2JY6 A;  2LJI A;  2AQ3 B;  2ZW0 A;  5C2T B;  4OZB A;  4HWI B;  2CHZ A;  4YXD B;  4MEM A;  1B9R A;  1G6J A;  2N9P C;  2MQJ A;  3DCG A;  4ZYN A;  4PS7 A;  2WX1 A;  1WY8 A;  2MP2 A;  2FNJ B;  4XX5 A;  3ZO5 B;  4DWF A;  3WAN A;  3ZVV A;  4KGT A;  2GB1 A;  3VQI A;  4LNF A;  2C7H A;  3GZN I;  1E6E B;  3ML9 A;  1I35 A;  2KK8 A;  4JPS A;  2A5U A;  3NOB A;  2O6V B;  3IT4 B;  5D94 A;  2KJ6 A;  5E6O A;  1E5W A;  4IDI A;  2QHO A;  1E7V A;  4W9J A;  4II2 B;  4OZC A;  1NI3 A;  2KFK B;  2WDR B;  4W9E A;  1VR9 A;  4D2K A;  2M17 A;  1V2Y A;  1NEN B;  1EU4 A;  2KO3 A;  2YVC A;  1C1Y B;  2MBQ A;  4WWN A;  3DWG C;  3R7R A;  4F8C B;  3H7S A;  5D6J B;  4YSY B;  2L7R A;  2LWP A;  2MA9 B;  2B3A A;  3UIN B;  2WXL A;  1JWU D;  1SE4 A;  1WGY A;  3JVZ X;  2G4D B;  1P7E A;  1EWY C;  5MPO A;  1IGC A;  1E0Z A;  2NR2 A;  1ZPS A;  3V60 A;  2JYE A;  2C60 A;  1I4H A;  1WF9 A;  4N58 A;  1WIA A;  2I1J A;  4CHK A;  3PGE A;  1L7Y A;  3Q3F A;  1KH0 A;  4NJ6 A;  3O13 A;  2KC2 A;  1GB4 A;  1OEY A;  3RT3 B;  4HKQ A;  1V1O A;  1NI2 A;  3N1Z C;  2KT7 A;  2PEA A;  2LJ5 A;  1Q5W B;  2LFI A;  1FRD A;  2K6Q A;  1Q1O A;  2GOW A;  4RH6 A;  1WM2 A;  4URK A;  1C3T A;  3N32 A;  4TQ1 A;  4JIO U;  4C7Y A;  5L95 C;  3BWU D;  4GDK B;  4AJW A;  2JSV X;  1Z5S B;  3KYC D;  4XWT A;  1UBI A;  3RPF C;  1T6B X;  4A6Q A;  4DHJ D;  2JRH A;  4TMA B;  4BOS C;  2ZW1 A;  2MRP A;  3AE3 B;  3DBL B;  2CR5 A;  1FXI A;  2V9H A;  1ZE3 D;  3Q3O C;  1XCQ L;  2GBN A;  1ET9 A;  4EZJ A;  1NEK B;  3AE7 B;  2MHJ A;  2G3Q B;  5E6J A;  5C3J B;  2D3C A;  2WXH A;  4K81 A;  2RD0 A;  1C4P A;  3LDZ E;  5JXV A;  3TCA A;  3TEW A;  2EKE C;  4N59 A;  3DBR I;  2ZCC A;  1F52 A;  1JRU A;  1WXV A;  3RI7 C;  4TQ0 A;  3MC0 B;  3APD A;  4YTP B;  3WAL A;  2ZZP B;  4ANU A;  3FIL B;  2JZZ A;  1SF0 A;  1AN8 A;  4MJS B;  4MGZ E;  1IGD A;  3QA8 A;  2E6X A;  1MJD A;  2KVR A;  3ONS A;  2LRU A;  2RSU A;  4IKG A;  1UGJ A;  2WDV B;  4Q2J A;  3ETR A;  3P1M A;  3ZLZ A;  1TJE A;  3GE3 C;  3Q8C A;  3Q3M C;  2Z0D B;  3BVZ A;  4NAW B;  4NPN A;  1P0R A;  2NS5 A;  2MP2 B;  1J0G A;  2FCS A;  3AI5 A;  4F7Z A;  2V3S A;  1IYF A;  3DPD A;  3KQ4 A;  2G1E A;  2MEK A;  4F1S A;  2WXK A;  1K53 A;  2E3T A;  2WDT B;  2M0X A;  4S17 A;  3DQV A;  1SB3 C;  3WAM A;  3ZDT A;  3IHP C;  4MGK E;  4IM3 A;  2L1A A;  3ZYY X;  2N7E A;  2DX5 B;  5E6N A;  2FUH B;  1XF5 L;  3S2A A;  3AE6 B;  1FNU A;  3AEC B;  4FXC A;  3FAH A;  2ZCB A;  3QQ8 B;  3UQA A;  4O1N A;  2KAC A;  1I4P A;  3T3O A;  1ZW7 A;  1RFK A;  1SJH D;  2MWS B;  3DHH C;  4G50 A;  3V6C B;  3NRZ A;  2L0F A;  1XLQ A;  2LHE A;  3LB8 C;  3X23 A;  1VRA B;  1SEB D;  3AUL A;  3L0W B;  3OAW A;  2PW9 A;  2LHD A;  1WH3 A;  3UI3 A;  1PQS A;  4S0R A;  1E90 A;  4RGO S;  4YL8 A;  2AL6 A;  1Y8R C;  3IG3 A;  1X1M A;  2WQY B;  4NZL B;  2XEW A;  1V80 A;  1KJT A;  1GOZ A;  2GMI C;  4IG7 B;  4K7W A;  4KVG B;  3A9J A;  4B0E A;  2JF5 A;  3TSS A;  2BKR B;  1J19 A;  2QDF A;  3E9S A;  2IND C;  2IDY A;  3U8Z A;  1FNW A;  3BYY B;  3A4S C;  1EUV B;  3P2B A;  3SFD B;  1ZP0 B;  3EGR A;  4W9F A;  4FJV B;  1CJE A;  5LLI A;  1AYF A;  3L10 B;  3ZRC A;  1SXT A;  1T0Q C;  3AEA B;  4A90 A;  5IKC M;  4GXB A;  2KJH B;  5FR3 A;  2M19 A;  3AE1 B;  5GXG B;  3ZTC A;  3VTW A;  4RCO A;  1ZUD 2;  2DAJ A;  2BWE S;  3U7Z A;  1WR6 E;  2KDB A;  3KWV A;  2JRI B;  2L32 A;  1AWD A;  1RFA A;  1YQ3 B;  3A9K B;  4WJO A;  2BBC A;  3WA0 A;  3DHI C;  1UUP A;  2KN5 A;  4DHZ B;  4RFB A;  1MFW A;  3M95 A;  1ZDX A;  2VRR B;  2ZNV B;  2KWU B;  2AX5 A;  5JHA A;  1P9D U;  2K22 A;  4M8M A;  4TKN A;  4A9A A;  5FKA C;  2UU7 A;  3R7Q A;  3NY5 A;  4M0W A;  3Q2A C;  2Y5B B;  1NDD A;  4P1B C;  1YX5 B;  3RNA C;  4BKS D;  3JYU A;  1ZOY B;  1OEY J;  2MJE A;  1C79 A;  1IBX A;  2EMS A;  2J52 A;  1FXA A;  2D3B A;  3MC9 A;  2Y5C A;  3VHT C;  2HTH A;  2BGF A;  2DBY A;  2IGH A;  2K5P A;  2K8B A;  2H88 B;  4RGM A;  4XGA B;  1DOI A;  2DYO A;  3V3X A;  3PRP B;  2L83 A;  3RFZ B;  2I38 A;  3TJP A;  1N62 A;  3RCZ A;  3I9V 1;  4FUL A;  2O2V A;  2WXG A;  2YEP F;  1WE7 A;  1YQB A;  1YMH E;  4M01 A;  5JZE B;  4K3C A;  1OQR A;  1R4N B;  3GOE A;  1GG3 A;  3KYD D;  4WJP A;  4ICU A;  1L4Z B;  1SE9 A;  4LLG M;  5C23 A;  3ZNG C;  3D32 A;  3OLM D;  4QAY A;  3APC A;  4R3D A;  1GPX A;  1VDV A;  2KZR A;  3PHX B;  3PV1 A;  3X0W A;  1QOF A;  4I6N B;  4IM2 A;  2WWZ A;  1XLO A;  2N0S B;  2EMT A;  5DCN A;  1JW9 D;  2HJ1 A;  5HKH A;  2WU2 B;  1V1P A;  4MEL A;  4MM3 A;  4RF0 A;  4W9G A;  1WXS A;  4G0N B;  3GB1 A;  3PZ8 A;  3A1Q A;  5D3D A;  3DWM A;  5IOI A;  3T3N A;  1WRD B;  1WR1 A;  4LNK A;  2MBH A;  1YN4 A;  3DDC B;  3TEZ A;  2H89 B;  3A9J B;  1TS3 A;  3ZDM C;  4ZRQ A;  2KTR B;  2KAN A;  3V6E B;  1WX9 A;  1MHX A;  2D3A A;  1STE A;  5CTR C;  2PPH A;  4IM0 A;  3FC4 A;  1JCK B;  3KUC B;  2LGS A;  1AAR A;  2PJH A;  3U30 A;  1LGR A;  2OED A;  2K0P A;  1UF0 A;  4W9I A;  2GBK A;  2C5L C;  1QQR A;  2MBE A;  4A55 A;  4JL9 A;  3BK1 A;  1E8Y A;  2M56 B;  2IGG A;  4M8N A;  3IT6 B;  2L00 B;  3QAQ A;  2LXC A;  2X38 A;  2WNM A;  4AQ7 A;  5AZG A;  4C4V A;  3UIP B;  5CX3 A;  3PHW B;  2KQS A;  4P1C C;  4WJN A;  4FBJ B;  2D3G A;  1FNV A;  4ZOH C;  2HJ8 A;  1I4G A;  2M8S A;  1XLN A;  2N9X A;  5BYQ A;  3HM6 X;  4AJY B;  4LJP B;  4B6W A;  2W9N A;  1OFF A;  3AEG B;  3NG0 A;  4AOF A;  2LD9 A;  2MJD A;  4AWJ A;  2KMC A;  5D7G A;  2K8H A;  3ZKJ C;  3OWE B;  3VR8 B;  1GJZ A;  1WJ6 A;  4W9L A;  1UWM A;  2IO3 B;  1IBX B;  2D10 A;  1MVK A;  3PT2 B;  1V8C A;  3DBL I;  3ZJT A;  4E71 A;  2DYM A;  2YLM A;  1SE3 A;  3BZD B;  3MJW A;  4FJY A;  2IO1 B;  3DBS A;  4CO7 A;  1PDX A;  3RNF C;  2KKC A;  3QIJ A;  1LM8 B;  4EE2 A;  5IAA C;  3TEX A;  2QSD A;  1MG4 A;  1CK1 A;  1WXA A;  2O2V B;  3UIO B;  3Q8E A;  3ZNZ B;  5I4D A;  4WJQ A;  4BKT A;  4UDU C;  1DYQ A;  1T0S C;  3L4P A;  3NS1 A;  1FD6 A;  2D5G A;  2REX A;  1FCC C;  3DBH B;  1VLB A;  2V3P A;  1GNU A;  4IC7 B;  3I57 A;  2C7N B;  2N9K A;  2GLS A;  1A70 A;  4LK0 M;  1HQR D;  1XT9 B;  1D5X C;  4MSM B;  3ZIM A;  1WJ4 A;  4XWW A;  2BQQ A;  3VTU A;  3N3K B;  1NBF C;  5BYR A;  3IBE A;  4RM9 A;  1L6V A;  4P7I A;  1FM0 D;  1ZKH A;  2G9H D;  4HKZ E;  4MM3 B;  3PRM B;  3P63 A;  1HTQ A;  1V49 A;  4YSX B;  3AEF B;  2AYO B;  2L76 A;  3A1Q B;  4ASW C;  1V6E A;  4JWU C;  3IFW B;  4YTM B;  4XYC A;  2KDI A;  2KJR A;  2JT4 B;  3W9C B;  2WXN A;  3AV8 A;  4A3O A;  4FJZ A;  1CQV A;  1WM3 A;  3OJ4 B;  4XDC A;  4YT0 B;  2ICI A;  3ZNH B;  2V3N A;  3AE2 B;  3ECI A;  2M1M A;  3V05 A;  3B2G A;  3DOW A;  4LJO B;  2KTF A;  3HVD A;  2RPV A;  4X57 B;  2ZPN A;  2LXA A;  2FBW B;  1HE8 A;  1M4V A;  4C7Z A;  2FID A;  1E7P B;  3QWZ B;  5J18 A;  3ZGZ A;  1PGA A;  2CHX A;  2J53 A;  3BII D;  2MBO A;  2Z0E B;  2DZK A;  4ZRI A;  4WH4 A;  1GUA B;  3MJ5 A;  3JSV A;  4K7U A;  3HVZ A;  2BVC A;  1QZE A;  1J7C A;  2MLB A;  3AE4 B;  3H1U A;  1OQQ A;  3QC8 B;  1V5T A;  2BYE A;  2V0G A;  4KV2 A;  4ARI A;  1KFY B;  1K8R B;  2L8J A;  3PLU A;  4HPM B;  2XK5 B;  2DZI A;  1OTR B;  2HDE A;  1P3Q U;  4HVB A;  2WP9 B;  4HDQ A;  4IW0 A;  1WMH A;  5AUK A;  4LNO A;  3I3T B;  4HRO A;  3KUZ A;  4EOY A;  1IP9 A;  1HA5 A;  1RWS A;  2WDQ B;  4I6P A;  2XN9 C;  1QOG A;  1TY0 A;  2ZNV C;  3ZNI D;  2I2Y A;  2GBJ A;  5G5H A;  5KHO A;  1WXQ A;  2DEN B;  2FUG 1;  5DPS A;  4KIK A;  1K52 A;  1Z2M A;  4M00 A;  3BY4 B;  1FPY A;  2BS2 B;  3DVN U;  1T0Y A;  2J42 A;  1GAQ B;  1WZ3 A;  2TSS A;  4ZHP A;  4KSK C;  1IUE A;  1F9J A;  1TZO A;  1QKZ A;  4B0M A;  4ITK A;  3DVG Y;  1PFD A;  1JWS D;  4P6V F;  2N9L A;  3B2F A;  3P4P B;  2JYT A;  3UQB A;  4KDL B;  1WX8 A;  2CHW A;  3QJZ A;  4BAX A;  1FCL A;  1EU3 A;  2RPQ A;  1TYG B;  3R2T A;  4MSQ B;  2W82 A;  1NYQ A;  4NY0 A;  3R66 C;  5H92 C;  2KDE B;  3KH0 A;  3A33 B;  1L0X B;  2ZVN A;  2FIF A;  2NBU A;  3RYT A;  4HEA 1;  2DZJ A;  3I63 C;  4BBN C;  2LZ6 A;  3RUL A;  2J7Q B;  4B9K A;  4WUR A;  4FHJ A;  4TUU A;  3ZJU A;  4GMV A;  5D2M B;  3SDL C;  1TS4 A;  4B95 A;  2JWZ A;  2V4I B;  1JQ4 A;  1SSN A;  4KGS A;  1QIL A;  1N5X A;  2ZVO A;  3LYY A;  1HZ5 A;  1WZ0 A;  2KVZ A;  4US9 A;  2ZEQ A;  4LNI A;  1WXM A;  1TTN A;  4EEW A;  1UD7 A;  2CKH B;  2IPK D;  3SFE B;  2BKF A;  1V5O A;  5TR5 A;  4WWO A;  4JX1 C;  2L0T A;  3ZRF A;  4PS3 A;  1MG8 A;  5G2N A;  1L0V B;  2PE9 A;  2KN4 A;  1FXT B;  2G45 B;  3NZU A;  1EO6 A;  2JXX A;  1BXT A;  1R4N I;  2EEL A;  2V4L A;  1QT9 A;  3UF8 A;  2LAS A;  2I1K A;  5EE9 A;  4A8X C;  2QCZ A;  1I4Q A;  4WIP A;  2BWF A;  2LVO A;  2ASQ A;  2AQ1 B;  2QIL A;  3PO0 A;  3EA6 A;  3VUY A;  3VTV A;  4ZRK A;  1J7B A;  3OG5 A;  4JGH B;  1IPG A;  5CHF A;  3W2D A;  2K3U A;  1HEZ E;  4KSL C;  3TL5 A;  3B08 A;  5GMV A;  4KKJ A;  2WXQ A;  3URY A;  4REZ A;  3JSV B;  4GIV A;  2AL3 A;  2ON8 A;  3RNG C;  1C77 A;  2JWU A;  3ZXV A;  3P4R B;  4EZL A;  1LFD A;  1L5P A;  3CST A;  4ACF A;  1WX7 A;  2WLB A;  3AEB B;  1KOT A;  3MHZ A;  1JWM D;  1SIF A;  1WMH B;  5E6P A;  4ZYS A;  5IN7 A;  5G55 A;  4KGR A;  2Y3A A;  2UYZ B;  1S1Q B;  2NBV B;  2BF8 B;  4J6I A;  3PSE B;  2Z8L A;  3QAR A;  5HI1 A;  3RNB C;  1YQ4 B;  4IWP A;  1DOX A;  4HPL B;  1D3Z A;  1D5M C;  2DLB A;  4HDO A;  2CJN A;  3U52 E;  2BB5 A;  4BBN F;  4PYU A;  1I7H A;  2WXO A;  3HM3 A;  2BS3 B;  4KIK B;  2RDB C;  3QCA A;  2KWV B;  2N7J A;  5JH5 C;  2NBW B;  4ANX A;  4RMA A;  3L16 A;  1K51 A;  1XO3 A;  2PIA A;  2GBR A;  3Q3J A;  1U4A A;  3TUO A;  4HCN B;  1TT5 B;  3ZXR A;  3L13 A;  1TKY A;  4RNA A;  4NNJ B;  4XC2 A;  3LJ3 A;  1QF6 A;  1D6E C;  4GU2 A;  2FCN A;  2BYV E;  4YWG G;  3RD2 A;  3ENE A;  4GB9 A;  4L23 A;  1V9J A;  4ZDV A;  2L05 A;  1KF6 B;  4P16 A;  3RUI B;  2KQ4 X;  3NJT A;  4GOC A;  2AWT A;  2JPH A;  2VH1 A;  1SBB B;  4G11 A;  5IP4 D;  4IOI E;  1YJI A;  4NAM A;  2D11 A;  3ZUN A;  4KDI C;  3DVG X;  2LUM A;  3KW5 B;  1F77 A;  2MJ3 A;  2Y5P A;  1T5X D;  3WAO A;  1L2N A;  1J7A A;  2KQ7 A;  2Q5W D;  2LGX A;  4WQM A;  3NVZ A;  3TIX A;  4J3O D;  3VAW A;  2KNB A;  1WFY A;  1L4D B;  3NZS A;  1F2R C;  1LO5 D;  2KX0 A;  2K25 A;  1ZXH A;  3N20 C;  3NS8 A;  4XDD A;  4WWM A;  4RF1 A;  1CMX B;  1WYG A;  4FLH A;  1XLP A;  5EE0 A;  2PMV A;  3W1S A;  3CIR B;  1TZ1 A;  5L83 A;  1WRI A;  4BKG A;  3DBH I;  3T9L A;  3ZQ4 A;  4HJK A;  5DPW A;  4WWP A;  5BYS A;  1E8X A;  4II3 B;  1Q10 A;  3AM9 A;  5KHQ A;  1GC7 A;  1RRB A;  1EM7 A;  1KTK A;  1N61 A;  1VZ8 A;  4AS1 A;  3VH3 B;  5CHV C;  4CQN A;  1V97 A;  3OJ3 A;  2VZK B;  3AN1 A;  5LNK 1;  3ZTD A;  3WIM A;  3PZ7 A;  1I42 A;  1BUI C;  2EKI A;  3Q14 C;  4HXD A;  2KOX A;  2QIE B;  3QHT A;  2JU6 X;  1FMA D;  1ACC A;  3BIN A;  2JUO A;  4MAC A;  2DWQ A;  1TKG A;  4HPP A;  5EE3 A;  2N1W A;  3M3J A;  2KD0 A;  1S3S G;  1EF5 A;  3JW0 X;  1YNT E;  3VUW A;  5BMH A;  5C1Z A;  3RNE C;  3N1X C;  1E7U A;  3IXS A;  4DDI D;  2PLP A;  2LRW A;  2WGS A;  2R2O A;  2K1F A;  3CWI A;  1F1H A;  1JML A;  4M0W B;  1FRR A;  1BT0 A;  2BYF A;  3MFG A;  5AZF A;  1T0R C;  4RGT A;  2BYT A;  3Q69 A;  2INP E;  1QOA A;  1L0Y B;  2QC8 A;  4OVU A;  1EWC A;  3H6N A;  2ZJD A;  1C78 A;  1ESF A;  2QMT A;  1QOB A;  1N6Z A;  4OVV A;  5CHW A;  2RR9 A;  2Z59 B;  4DQO C;  3HUI A;  2J4X A;  2LI5 A;  2IO0 B;  4LCD E;  3IAS 1;  1YJ1 A;  1TIF A;  3Q6B A;  3AH7 A;  3B9J A;  2BT6 A;  3SR6 A;  2LEK A;  1K50 A;  1R4M B;  5FK9 C;  1MPE A;  1VJK A;  2SEB D;  3C19 A;  4NAW A;  3EFU A;  1GC6 A;  1XXG A;  2LVQ A;  2IZV B;  3P4S B;  1VZ6 A;  1XQQ A;  5FR6 A;  4PT5 A;  1UH6 A;  2W55 A;  1WGK A;  3HRD D;  1SE2 A;  2RDH A;  3TMP B;  3IVF A;  3SHQ A;  2R2Q A;  1ET6 A;  4C80 A;  2KX3 A;  2L52 A;  1VZ7 A;  2KAJ A;  1C76 A;  2JVC A;  3V61 A;  3GS2 A;  2WXF A;  4JQW C;  2INN E;  4CYE A;  4EZK A;  3EUB 2;  5IA7 A;  5BMG A;  4KX6 B;  4EFO A;  1V1P B;  1NVI D;  2NCN A;  3H9D A;  3RZF A;  3NVY A;  2XBB C;  2WYQ A;  3Q8A A;  1C4A A;  3C8Y A;  2M0A A;  5BMI A;  4A20 A;  1E8W A;  4GDL A;  1PUT A;  2CJO A;  1UWX A;  1TBE A;  1JRO A;  3K9P B;  3EHV A;  1TS5 A;  4JLC A;  2WU5 B;  3VFK A;  4MH8 A;  2N9E B;  1MI0 A;  2KMA A;  1TGZ B;  3R2I A;  4JE3 B;  4YTN B;  3ABV B;  2NTS A;  4USA A;  1N5W A;  1VCB A;  4IUM B;  2IO2 B;  4E74 A;  3QK0 A;  2AQ2 B;  1C4C A;  2FCQ A;  3HHM A;  4ZHO A;  3V62 A;  1UEL A;  2HE7 A;  2PTL A;  2KLG A;  3W5U B;  1CZP A;  4FAD A;  4LDT D;  1SGH A;  3I5J C;  4PYZ A;  1FO4 A;  3P4Q B;  2SAK A;  2L3Z A;  2OJR A;  1KM7 A;  4LNN A;  5DPR A;  2HD5 B;  3WCQ A;  1D4B A;  2BW2 A;  1FFU A;  1YN3 A;  1SIJ A;  4KZ0 A;  1JAL A;  4C4V B;  2LGI A;  3B0A A;  4M02 A;  3K9O B;  1KLG D;  3H7P A;  4W9H A;  4HCP B;  3IAM 1;  2GI9 A;  4MH0 E;  4FHK A;  3AEE B;  3KWL A;  5HFY A;  3WAP A;  3AE9 B;  1DGJ A;  1P98 A;  5T8I A;  4YSZ B;  3A9K A;  1EF1 A;  3MP9 A;  2LGD A;  3L08 A;  3RMK C;  1MHH E;  1WGH A;  1ZDV A;  4PK1 A;  3PZD A;  4GGQ A;  1UNS A;  3N9Y C;  4W9C A;  3A4R A;  4H2A A;  4N9F 4;  3N30 A;  3CSF A;  2RDG A;  3GZN B;  3KVF B;  2KHW B;  2IJ0 A;  2PVG C;  1ROE A;  2VH2 A;  2KWC A;  1JWB D;  2GBM A;  4ZRP A;  3AMZ A;  2D2Q A;  1XEE A;  1PGX A;  2WHI A;  3ALB A;  1H8C A;  2ACZ B;  4DBG A;  4GSW A;  1RYJ A;  3PRE A;  2J0J A;  2D07 B;  3NVV A;  2V1Y A;  4K3B A;  4OW0 A;  4BFR A;  1B1Z A;  1XD3 B;  3EFC A;  2JZ3 B;  1YIW A;  4HJG E;  3LXF A;  3SU8 X;  2KDM A;  4C56 C;  4G3X B;  3CMM B;  2IGD A;  2M4N A;  2FAZ A;  2KXJ A;  1WGG A;  4MGI E;  1ENF A;  2WX0 A;  2X8X X;  3PLV A;  2B76 B;  2KC1 A;  4IWQ A;  2NPT A;  3Q8B A;  1Q0W B;  1WWT A;  3HIZ A;  3W1Y A;  1HZ6 A;  2DZM A;  3AXC A;  3GP7 A;  1TKE A;  2C9W B;  2LMC A;  1FIQ A;  3U2S C;  2QJL A;  3VUX A;  4FN2 A;  5EDS A;  2BTE A;  4AUQ C;  1I4R A;  1ISN A;  1OGW A;  1R7S A;  4E3C A;  2WS3 B;  4HLE A;  2HTM E;  1FEH A;  3MTN B;  4RGN A;  2WXP A;  2JQR B;  1T3Q A;  3U4E G;  4GDL B;  2C7M B;  2VZK D;  3VVW B;  2BB6 A;  4BOZ B;  1LQB A;  1HTO A;  1Y56 A;  3AE5 B;  2KDF B;  3AB5 A;  4MT5 A;  3VH4 B;  3PS6 A;  2CU1 A;  2K9X A;  1TS2 A;  5HG2 A;  4IWO A;  1TY2 A;  2IY1 B;  4AP4 C;  3ZJV A;  4DDG D;  3RZW C;  5DPT A;  3SEB A;  2IYD B;  4JWS C;  5BO4 B;  2KYW A;  3SD5 A;  3DBR B;  2KTR A;  2RMM A;  2PVO D;  5TSS A;  4GN1 A;  3BVG A;  2K39 A;  3CF6 E;  4C00 A;  2LVP A;  2W3S A;  3AU4 A;  3MC8 A;  3N1Y C;  4WQO B;  2DYB A;  1YOV B;  4OVZ A;  4ANV A;  2ZPY A;  4W9K A;  3NVW A;  1OQY A;  3W5V B;  2OOB B;  1QLB B;  3QX1 A;  3H7P B;  3L17 A;  1KLU D;  4US8 A;  1JRP A;  4NQK E;  1N63 A;  1HXY D;  1UGM A;  1UZX B;  1NYR A;  4LDT B;  3EC8 A;  3PPA A;  1A5R A;  3L54 A;  2WXR A;  2J0M A;  4GLS C; 
#chains in the Genus database with same CATH homology
 1E8Z A;  2Z0D B;  1RRB A;  3APF A;  4NAW B;  1RAX A;  3N3K B;  1NBF C;  4NPN A;  1P0R A;  2NS5 A;  1H4R A;  2MP2 B;  3R3M A;  1J0G A;  3VDZ A;  3IBE A;  4RM9 A;  2FCS A;  3AI5 A;  4F7Z A;  3VH3 B;  4P7I A;  2V3S A;  1WJU A;  3DPD A;  5CHV C;  1IYF A;  3OJ3 A;  4F1S A;  4FA6 A;  1ZKH A;  3ZTD A;  3WIM A;  2WDT B;  3PRM B;  2M0X A;  1I42 A;  1V49 A;  5AEK B;  4K7S A;  3DQV A;  4DHZ E;  2AYO B;  3TBL D;  2L76 A;  3A1Q B;  3WAM A;  3ZDT A;  3IHP C;  3VXW A;  4ASW C;  1V6E A;  4DHJ B;  4HXD A;  2KOX A;  3IFW B;  3QHT A;  2MSE D;  3BIN A;  1WE6 A;  2JUO A;  4MGK E;  4IM3 A;  4ZRJ A;  2KDI A;  2A4Z A;  1P1A A;  2KJR A;  2JT4 B;  2N7E A;  4A3O A;  2DX5 B;  5E6N A;  2FUH B;  4FJZ A;  3S2A A;  2N1W A;  1WM3 A;  3M3J A;  2KD0 A;  3OJ4 B;  1S3S G;  1EF5 A;  3JW0 X;  3ZNH B;  3VUW A;  1WGR A;  3ECI A;  5C1Z A;  2M1M A;  2O6V D;  3MHS D;  1E7U A;  3DOW A;  2ZCB A;  3QQ8 B;  4LJO B;  3UQA A;  4DDI D;  2KTF A;  2LRW A;  2R2O A;  4X57 B;  2IBI B;  1ZW7 A;  2ZPN A;  2K1F A;  2MX2 A;  2MWS B;  2LXA A;  1HE8 A;  4G50 A;  4M0W B;  3V6C B;  3NHE B;  2FID A;  1YD8 U;  2L0F A;  3QWZ B;  5J18 A;  1BT0 A;  2BYF A;  4A3P A;  5AZF A;  1LXD A;  2CHX A;  5J17 A;  3X23 A;  3ML8 A;  2MBO A;  2RGF A;  2NPT B;  2Z0E B;  3AUL A;  3L0W B;  3OAW A;  2DZK A;  4TV3 A;  4ZRI A;  1WH3 A;  1GUA B;  4WAA A;  4OVU A;  3UGB B;  1PQS A;  3H6N A;  3JSV A;  2ZJD A;  4K7U A;  3AU5 A;  1QZE A;  4BKS A;  2MLB A;  3H1U A;  1E90 A;  3QC8 B;  4OVV A;  2RR9 A;  5CHW A;  2NVU I;  4YL8 A;  5AZH A;  1V5T A;  2AL6 A;  2O6V A;  1Y8R C;  2Z59 B;  1WYW B;  3IG3 A;  1X1M A;  2BYE A;  4HK2 A;  4KV2 A;  1K8R B;  2XEW A;  2LI5 A;  1V80 A;  2IO0 B;  2KLC A;  1WJN A;  1KJT A;  2L8J A;  2GMI C;  3PLU A;  4HPM B;  2XK5 B;  2DZI A;  3A9J A;  4IG7 B;  4K7W A;  4KVG B;  4LCD E;  2JF5 A;  1OTR B;  1P3Q U;  2KFK A;  4HVB A;  2BKR B;  1J19 A;  1YJ1 A;  4HDQ A;  4K1R B;  4IW0 A;  1WMH A;  4MDK E;  3U8Z A;  3A4S C;  3EEC A;  1EUV B;  2N4F A;  3I3T B;  4DXA B;  3P2B A;  3KUZ A;  4W9D A;  2PE6 B;  4W9F A;  1WGD A;  3C0R B;  4FJV B;  4EOY A;  4NQL B;  1IP9 A;  1V81 A;  2UWQ A;  4I6P A;  5LLI A;  2N1V A;  3L10 B;  4NAW A;  3ZRC A;  1R4M I;  3EFU A;  1GC6 A;  2ZNV C;  3ZNI D;  2GBJ A;  4GXB A;  5KHO A;  2KJH B;  2DEN B;  5DPS A;  2LVQ A;  4KIK A;  3M63 B;  2IZV B;  3ZTC A;  1Z2M A;  1XQQ A;  2AEH A;  5FR6 A;  1UH6 A;  3VTW A;  3BY4 B;  2CS4 A;  2DAJ A;  2IY0 B;  4DK5 A;  2BWE S;  3O65 B;  3TMP B;  1WR6 E;  2KDB A;  1T0Y A;  2MW5 A;  3DVN U;  1WZ3 A;  2JRI B;  3IVF A;  2K8C A;  2R2Q A;  4KSK C;  3SHQ A;  3T8M A;  2KX3 A;  1F9J A;  3DVN V;  1RFA A;  3B1L X;  1KLV A;  3A9K B;  3DVG Y;  4RM8 A;  4WJO A;  3WA0 A;  3W1S C;  2JVC A;  3V61 A;  2KN5 A;  4JQW C;  1YX6 B;  4BVU C;  4CYE A;  3PRZ A;  4EZK A;  4DHZ B;  1RLF A;  5IA7 A;  2K6D B;  3M95 A;  2VRR B;  2ZNV B;  2KWU B;  4EFO A;  3UQB A;  4KDL B;  5J2R A;  1WX8 A;  2CHW A;  3QJZ A;  2NCN A;  3H9D A;  2RPQ A;  5JHA A;  1P9D U;  2BPS A;  4MSQ B;  3RZF A;  4M8M A;  2XBB C;  4EKU A;  2WYQ A;  4TKN A;  4NY0 A;  3R66 C;  2LUE A;  1M94 A;  2KDE B;  3KH0 A;  3PTF C;  3A33 B;  4ICV A;  2MBB B;  3R7Q A;  2ZVN A;  3NY5 A;  2FIF A;  2NBU A;  4A20 A;  1E8W A;  4GDL A;  2DAF A;  2Y5B B;  1TBE A;  4GDK A;  3K9P B;  4MGY E;  3RYT A;  4EUT A;  1NDD A;  5JHB A;  1YX5 B;  3EHV A;  4BKS D;  2DZJ A;  3JYU A;  3M62 B;  4I6L B;  4JLC A;  3VFK A;  1OEY J;  2N7D A;  2N9E B;  4BBN C;  2J0K A;  1TGZ B;  2KMA A;  2LZ6 A;  2J7Q B;  3RUL A;  4B9K A;  4FHJ A;  1VCB A;  4IUM B;  2IO2 B;  4TUU A;  4E74 A;  4XZ4 A;  4GMV A;  5D2M B;  3SDL C;  2EMS A;  3QK0 A;  4B95 A;  2JWZ A;  3HK0 A;  2FCQ A;  3HHM A;  2LGY A;  2KFJ A;  5LXI B;  3V62 A;  3VHT C;  4PS8 A;  2HTH A;  2BGF A;  2ZVO A;  1UEL A;  2DHZ A;  2HE7 A;  2K8B A;  2KLG A;  3U7D A;  1VD2 A;  2XK5 A;  1WZ0 A;  2ZEQ A;  4KZC A;  4FAD A;  2DYO A;  1WXM A;  2G4S A;  4LDT D;  1TTN A;  2MCN B;  3PVL A;  1SGH A;  3KUD B;  4PYZ A;  4EEW A;  1UD7 A;  2CKH B;  3PRP B;  2BKF A;  4NJ7 A;  3ZW3 A;  5LXH A;  1V5O A;  5TR5 A;  4WWO A;  3TJP A;  2L3Z A;  2FCM A;  1KM7 A;  2OJR A;  3RCZ A;  5DPR A;  2HD5 B;  4FUL A;  2O2V A;  1V86 A;  2L0T A;  3ZRF A;  1ZGU B;  4PS3 A;  1MG8 A;  4ANW A;  5G2N A;  1J8C A;  1WE7 A;  2PE9 A;  1FXT B;  1WI0 A;  1YQB A;  2G45 B;  4KZ0 A;  4MJS A;  5JZE B;  3NZU A;  3B0A A;  1EO6 A;  2JXX A;  3GOE A;  1GG3 A;  3K9O B;  3KYD D;  4WJP A;  4ICU A;  1SE9 A;  3H7P A;  4W9H A;  1R4N I;  4HCP B;  5C23 A;  3ZNG C;  2V4L A;  3D32 A;  3OLM D;  1UBQ A;  3APC A;  4MH0 E;  3UF8 A;  2LAS A;  4FHK A;  2I1K A;  2JY6 A;  2BWF A;  2LVO A;  3WAP A;  2KZR A;  3PHX B;  2ASQ A;  4HWI B;  1P98 A;  2CHZ A;  4MEM A;  3PV1 A;  3X0W A;  1G6J A;  3A9K A;  2N9P C;  1EF1 A;  3VUY A;  2MQJ A;  3DCG A;  4I6N B;  4IM2 A;  3VTV A;  4ZRK A;  2LGD A;  2WWZ A;  3L08 A;  4ZYN A;  4PS7 A;  1WGH A;  2WX1 A;  1WY8 A;  1IPG A;  4JGH B;  2MP2 A;  5CHF A;  2FNJ B;  3PZD A;  4XX5 A;  3ZO5 B;  4GGQ A;  4DWF A;  4KSL C;  2EMT A;  5DCN A;  3TL5 A;  3B08 A;  5GMV A;  4W9C A;  3A4R A;  4N9F 4;  3N30 A;  3WAN A;  3ZVV A;  5HKH A;  3CSF A;  3VQI A;  4MEL A;  4MM3 A;  3KVF B;  4W9G A;  1WXS A;  2KHW B;  3JSV B;  4GIV A;  2KWC A;  2C7H A;  2GBM A;  2AL3 A;  3GZN I;  3ML9 A;  4G0N B;  2D2Q A;  1I35 A;  3ALB A;  3A1Q A;  2KK8 A;  2A5U A;  3NOB A;  1H8C A;  1WRD B;  1WR1 A;  2O6V B;  5D94 A;  2MBH A;  4DBG A;  2KJ6 A;  3DDC B;  4GSW A;  5E6O A;  1E5W A;  2QHO A;  4EZL A;  1E7V A;  3PRE A;  4W9J A;  2J0J A;  3A9J B;  1LFD A;  2D07 B;  3ZDM C;  4II2 B;  3CST A;  2KFK B;  1WX7 A;  4W9E A;  2V1Y A;  1KOT A;  1SIF A;  1WMH B;  5E6P A;  2KTR B;  4BFR A;  5G55 A;  1XD3 B;  2KAN A;  2M17 A;  1V2Y A;  2JZ3 B;  1YIW A;  3V6E B;  2UYZ B;  2KO3 A;  2YVC A;  3SU8 X;  1S1Q B;  1C1Y B;  1WX9 A;  2NBV B;  4G3X B;  2BF8 B;  2MBQ A;  4J6I A;  4WWN A;  3PSE B;  3QAR A;  3R7R A;  4F8C B;  3H7S A;  3CMM B;  4IWP A;  2M4N A;  5CTR C;  4HPL B;  2FAZ A;  2PPH A;  2KXJ A;  5D6J B;  1WGG A;  4IM0 A;  3KUC B;  1D3Z A;  2L7R A;  4HDO A;  4MGI E;  1AAR A;  2LWP A;  2MA9 B;  2PJH A;  3U30 A;  2B3A A;  3UIN B;  2WX0 A;  4BBN F;  4W9I A;  1WGY A;  2KC1 A;  2G4D B;  2GBK A;  2C5L C;  3JVZ X;  3PLV A;  4IWQ A;  4PYU A;  2MBE A;  3HM3 A;  4KIK B;  2NPT A;  4JL9 A;  1Q0W B;  3HIZ A;  3QCA A;  3W1Y A;  1E8Y A;  4M8N A;  2KWV B;  2L00 B;  2DZM A;  3QAQ A;  2NR2 A;  2LXC A;  2NBW B;  3AXC A;  5JH5 C;  3V60 A;  2C60 A;  1WF9 A;  1WIA A;  2C9W B;  2I1J A;  4ANX A;  4CHK A;  3PGE A;  4RMA A;  3L16 A;  5AZG A;  1L7Y A;  3Q3F A;  3UIP B;  5CX3 A;  3PHW B;  4NJ6 A;  3VUX A;  4FN2 A;  2KC2 A;  2KQS A;  2GBR A;  1OEY A;  3Q3J A;  3RT3 B;  1U4A A;  4HCN B;  4WJN A;  4FBJ B;  2D3G A;  3L13 A;  5EDS A;  1NI2 A;  2PEA A;  4NNJ B;  4XC2 A;  3LJ3 A;  2LJ5 A;  4AUQ C;  1ISN A;  1OGW A;  4GU2 A;  2HJ8 A;  1Q5W B;  4E3C A;  2M8S A;  2FCN A;  2BYV E;  2K6Q A;  4HLE A;  3RD2 A;  2N9X A;  1Q1O A;  3ENE A;  4GB9 A;  2GOW A;  1V9J A;  3MTN B;  3HM6 X;  1WM2 A;  4URK A;  4ZDV A;  4AJY B;  2L05 A;  4LJP B;  4B6W A;  3N32 A;  2W9N A;  4GDL B;  1C3T A;  4TQ1 A;  2C7M B;  3VVW B;  4JIO U;  5L95 C;  4AOF A;  2LD9 A;  4GDK B;  3RUI B;  4AWJ A;  2KMC A;  4AJW A;  5D7G A;  1Z5S B;  3KYC D;  4BOZ B;  1LQB A;  5KHQ A;  4GOC A;  2AWT A;  2KDF B;  2JPH A;  2K8H A;  3ZKJ C;  3VH4 B;  1UBI A;  3PS6 A;  4G11 A;  1GJZ A;  2CU1 A;  1WJ6 A;  4W9L A;  4DHJ D;  2JRH A;  4BOS C;  2D11 A;  2MRP A;  2IO3 B;  3ZUN A;  2CR5 A;  2D10 A;  3DVG X;  4KDI C;  3KW5 B;  4IWO A;  3PT2 B;  2IY1 B;  3DBL I;  4AP4 C;  2GBN A;  4E71 A;  3WAO A;  2DYM A;  2YLM A;  1L2N A;  4DDG D;  4EZJ A;  3RZW C;  2KQ7 A;  3MJW A;  4FJY A;  5DPT A;  2G3Q B;  2IYD B;  2IO1 B;  3DBS A;  2LGX A;  5BO4 B;  4K81 A;  4CO7 A;  2RD0 A;  2KKC A;  3QIJ A;  1LM8 B;  3SD5 A;  5IAA C;  3LDZ E;  2KTR A;  3TIX A;  3VAW A;  3TCA A;  2KNB A;  2EKE C;  4GN1 A;  3DBR I;  2K39 A;  1JRU A;  1WXA A;  1WFY A;  2ZCC A;  3NZS A;  1WXV A;  3CF6 E;  4TQ0 A;  2LVP A;  2O2V B;  3AU4 A;  3UIO B;  3ZNZ B;  4WQO B;  2KX0 A;  2DYB A;  3APD A;  2K25 A;  3WAL A;  2ZZP B;  4ANU A;  4WJQ A;  2JZZ A;  4BKT A;  4ANV A;  2ZPY A;  4MJS B;  4MGZ E;  4W9K A;  3NS8 A;  1OQY A;  2OOB B;  1CMX B;  2REX A;  3QA8 A;  3QX1 A;  3H7P B;  3L17 A;  4FLH A;  3W1S A;  2KVR A;  1TZ1 A;  3ONS A;  5L83 A;  4NQK E;  2LRU A;  2RSU A;  1GNU A;  4IC7 B;  4BKG A;  2C7N B;  3DBH I;  3T9L A;  1UGM A;  4HJK A;  5DPW A;  1UZX B;  4LDT B;  4WWP A;  3EC8 A;  1XT9 B;  3PPA A;  1E8X A;  4MSM B;  3ZIM A;  3ZLZ A;  4II3 B;  3L54 A;  1A5R A;  1WJ4 A;  3VTU A;  2J0M A;  1GC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...