5AEKB

Crystal structure of the human senp2 c548s in complex with the human sumo1 k48m f66w
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLMESYCQRQGVPMNSLRFLWEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 2
publication title Stepping Back and Forward on Sumo Folding Evolution
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 78
sequence length 78
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5aekB00
1TTNA 2KJ6A 3QARA 1V80A 1OEYA 1UBQA 3OJ4B 3PPAA 2NPTA 4FJZA 4FA6A 3H7PA 2EMTA 3APDA 5LLIA 4FJYA 3DQVA 2FNJB 3EHVA 4K1RB 3ZRCA 4I6NB 1L7YA 2AYOB 2KXJA 1WJUA 1E8WA 4FN2A 2KMAA 4JL9A 2O6VD 3Q3JA 4I6PA 4MSQB 4DBGA 2IY0B 1EF1A 4HPLB 3APCA 4F8CB 2LJ5A 2N9PC 4ANXA 4NAWA 3VVWB 2GBRA 2JZ3B 1WYWB 2N1WA 2JRIB 3DVGX 5L95C 3K9OB 3RYTA 3ML9A 3X0WA 1WE7A 3JSVB 3OJ3A 1YJ1A 1Y8RC 3UIOB 3L10B 2KO3A 1WGDA 2Z59B 4GGQA 1E8XA 3CSFA 2KJHB 4KSKC 3TMPB 3UQBA 4BKGA 4ZRKA 2C5LC 2WWZA 1WX8A 4LJPB 5GMVA 4LDTD 2IO1B 3ZDTA 3VTUA 1ISNA 2CR5A 2KTRB 3GZNI 3ONSA 3UQAA 3SU8X 1KJTA 3ZDMC 2RR9A 4MGIE 3M3JA 2FIDA 4W9HA 3PVLA 2Z0DB 4TQ1A 2WDTB 1AARA 5LXIB 4MELA 1P9DU 2OJRA 3L54A 3NY5A 2GBMA 4TUUA 4YL8A 3VQIA 4DHZE 3RD2A 4XC2A 1P3QU 2KDIA 3KVFB 4LDTB 2I1JA 3V61A 3B1LX 1P1AA 5IA7A 3PV1A 4KVGB 3QC8B 1KOTA 2KK8A 2WX0A 3CMMB 4KIKB 4BKSD 4ICVA 2HTHA 2K8BA 2MBOA 4J6IA 2GOWA 4BOZB 4EKUA 1IP9A 5D6JB 4ZDVA 4G0NB 1GC7A 2KWUB 2KFKB 2DX5B 3JVZX 4EFOA 5AEKB 3H1UA 1WJ4A 3A1QB 3K9PB 2QHOA 4W9CA 1ZW7A 4A3PA 1Z5SB 5AZFA 1IPGA 2XK5A 3A9KB 2KLGA 4WJPA 1WM3A 3H9DA 4WWNA 3VH4B 1G6JA 5LXHA 3MTNB 2IO2B 3R7RA 3H7PB 2A5UA 2K1FA 2NS5A 3S2AA 4TKNA 3PSEB 4WJNA 1V81A 2M17A 4RM8A 1GUAB 4W9IA 4BKTA 2KTRA 3V6CB 3NHEB 3R66C 4P7IA 2D2QA 2JVCA 2N7EA 3AU4A 4FHKA 4E74A 4IUMB 3VXWA 4DHZB 3UINB 2G4DB 5DPWA 2OOBB 2LXCA 3ML8A 4M0WB 5J2RA 4FBJB 2NBWB 2V3SA 4NAWB 3U8ZA 4EUTA 2EMSA 4IWPA 2Y5BB 2LVOA 2ZNVC 1RLFA 2M8SA 2ZPNA 3RULA 3VUXA 4CHKA 2D3GA 3L17A 1GC6A 2V4LA 3PHWB 3O65B 4KZCA 1TBEA 3KW5B 1KM7A 1WGHA 2K39A 3L0WB 2B3AA 1V6EA 2CKHB 5IAAC 2JWZA 3WANA 3PTFC 2ZCCA 4MEMA 2AL6A 2KX3A 3M95A 2PPHA 3ALBA 4B95A 2R2QA 3AXCA 3M63B 2O2VB 2KFJA 4KDLB 4DDID 3ENEA 2DAJA 4B6WA 1VD2A 2J0KA 3PGEA 2GBNA 4PS8A 3A9KA 4A20A 4AJWA 3MJWA 3PRZA 3EC8A 4MGKE 2KD0A 1J0GA 2L7RA 1XD3B 2KN5A 3BY4B 3ZRFA 2KANA 1JRUA 4IWQA 4MDKE 4W9EA 3VH3B 1WJNA 1M94A 5JHAA 1YX5B 2FCQA 4II3B 3JYUA 3L13A 2YVCA 3KH0A 3VUWA 5KHQA 3UF8A 2NR2A 2CHXA 2DHZA 3H7SA 5DPTA 3LDZE 5E6NA 3QJZA 2BF8B 4A3OA 2UWQA 3PLUA 4G50A 1RRBA 1ZGUB 1RAXA 2NVUI 2RPQA 4WQOB 3R7QA 4URKA 1IYFA 3ECIA 1WXMA 3D32A 2R2OA 1J19A 2MW5A 2XK5B 4AWJA 2KJRA 2C9WB 4KZ0A 2J7QB 2DAFA 5JHBA 1WXAA 4NJ7A 2IO3B 3P2BA 3ZNZB 4PYZA 2DZJA 4WWPA 3W1SA 2O2VA 2MP2A 1V5OA 4E3CA 2G3QB 2PEAA 4M8NA 3W1SC 2L05A 1XQQA 4GMVA 2ZCBA 3QAQA 3VTWA 2BKRB 1XT9B 4N9F4 1J8CA 1GNUA 1TGZB 2FIFA 2C60A 1WM2A 2J0MA 2M0XA 2ZNVB 2KDFB 5E6OA 2G4SA 4GDKA 4TV3A 2GMIC 2MQJA 3HM6X 4WWOA 2ZJDA 5CHWA 4GIVA 1WZ0A 4JLCA 4AOFA 3NS8A 1CMXB 1L2NA 3AULA 4TQ0A 4EZJA 2DZMA 5DCNA 5J18A 1D3ZA 3DBSA 3QHTA 5JZEB 4FULA 2K6QA 1C1YB 1UH6A 4LCDE 4EZKA 3W1YA 1EF5A 2CHZA 2K6DB 4M8MA 4DXAB 5CX3A 1LFDA 3L16A 3NZSA 1NI2A 1P0RA 2KWVB 3VHTC 4IWOA 4BBNC 2JT4B 4KV2A 1WFYA 2N7DA 3AI5A 4IM2A 3DCGA 2ZPYA 3B0AA 4CO7A 3DVGY 4GSWA 3V62A 2HJ8A 2KDBA 5C23A 1UD7A 3H6NA 4AUQC 1PQSA 2L00B 3EFUA 3ZO5B 1YX6B 3U7DA 3PRMB 2W9NA 2REXA 2CHWA 2K25A 3PT2B 3T9LA 1E90A 1KLVA 2AL3A 4HXDA 1FXTB 2L0TA 2KMCA 2VRRB 1EUVB 5DPRA 2KC2A 2LVQA 2BYEA 1I35A 1WMHB 2NBVB 2LD9A 1SGHA 2PJHA 2DZIA 2GBKA 3ZNID 2KQSA 4FLHA 4JGHB 1WRDB 4BOSC 1Q5WB 4MJSA 2O6VA 3AU5A 4MH0E 3SD5A 5EDSA 2ZZPB 4IW0A 4EEWA 3RUIB 2LGXA 4FJVB 3UGBB 5D94A 3WALA 2GBJA 4BFRA 4HLEA 4K7SA 3JW0X 2LASA 1NBFC 1OEYJ 2MCNB 3T8MA 1P98A 2DYMA 2AWTA 4OVVA 3OLMD 5J17A 4HJKA 3ZNHB 4W9DA 4NY0A 2LUEA 3SDLC 4DHJB 3N32A 1V2YA 5AZGA 4KSLC 1UBIA 2LZ6A 4HPMB 5D2MB 3PZDA 3HM3A 3IHPC 2ASQA 2XBBC 4W9JA 1WGGA 2JXXA 3DDCB 4IC7B 4MGYE 3KUZA 2KVRA 4WJOA 1WGRA 3WAMA 4WJQA 5L83A 2L3ZA 1F9JA 1Z2MA 2MP2B 1V9JA 3APFA 3TBLD 3ZLZA 2MWSB 3QWZB 1U4AA 4HK2A 2A4ZA 3Q3FA 3TJPA 5HKHA 2KZRA 3N30A 1E8ZA 5G2NA 3A33B 1OGWA 2PE6B 1WY8A 1HE8A 4GU2A 1H4RA 1WJ6A 2N9EB 2K8CA 4II2B 3BINA 1R4MI 2ZVOA 1K8RB 3DOWA 4GDKB 4ASWC 2IO0B 3EECA 3KUDB 1WX7A 4NJ6A 3RZFA 1WXSA 4GB9A 2MBBB 2MBQA 2LRUA 3QQ8B 1LQBA 1WMHA 3ZIMA 2RGFA 4HWIB 4XX5A 2D10A 5D7GA 4BVUC 1LM8B 3A4RA 4AP4C 5C1ZA 2JZZA 2MSED 4IG7B 3I3TB 4I6LB 4BKSA 2AEHA 3R3MA 4ZRIA 4BBNF 3DBRI 3IG3A 4MGZE 1OTRB 4DWFA 3L08A 2WX1A 2G45B 4DK5A 4GDLA 3LJ3A 4F1SA 4K7WA 1TZ1A 2FCSA 4MSMB 5KHOA 3CF6E 3A4SC 2BGFA 2C7MB 2UYZB 2XEWA 3IVFA 1WX9A 1R4NI 3HK0A 3A9JA 5CHVC 1E5WA 3PREA 4GOCA 1WXVA 2LRWA 1S1QB 2JPHA 4XZ4A 3WA0A 4ANVA 1V49A 3V6EB 3C0RB 2FAZA 2KOXA 4B9KA 3TCAA 4IM3A 2BKFA 1GG3A 2KDEB 3ZNGC 2KLCA 3QK0A 4EOYA 4K7UA 2NCNA 5DPSA 4CYEA 1WIAA 2KHWB 3B08A 1GJZA 5CTRC 2LGYA 2HD5B 1UELA 2M1MA 2KC1A 2LGDA 2KTFA 4MJSB 2O6VB 2DYOA 4OVUA 3VFKA 2KQ7A 1I42A 3PS6A 4F7ZA 4WAAA 1H8CA 2MBEA 3TL5A 2FCNA 2BPSA 1E7UA 4ICUA 4ANWA 4NNJB 2K8HA 1T0YA 2IY1B 2M4NA 3ZUNA 2L76A 2DENB 2J0JA 3M62B 3OAWA 3IBEA 5G55A 3PLVA 4W9LA 2JY6A 1V86A 4ANUA 4MM3A 1E8YA 4RMAA 4ZRJA 2FUHB 1VCBA 2D11A 1QZEA 2MLBA 4W9KA 1UZXB 3IFWB 1YQBA 2BWES 4JQWC 1S3SG 2JRHA 1ZKHA 2MX2A 2I1KA 3HHMA 3QA8A 2DZKA 3KYCD 4EZLA 1MG8A 3N3KB 2LI5A 3PRPB 2MRPA 2C7NB 2KWCA 3DBLI 1WF9A 2LWPA 4X57B 3SHQA 5JH5C 4PYUA 2C7HA 4NQKE 3KUCB 5E6PA 2YLMA 1WR6E 2WYQA 1NDDA 2N4FA 2ZEQA 1E7VA 4DHJD 4KDIC 1WH3A 2EKEC 2RSUA 2ZVNA 1BT0A 3JSVA 3ZTDA 3QIJA 3V60A 1OQYA 2BWFA 4G3XB 4G11A 4NPNA 1LXDA 4GN1A 4HVBA 3U30A 1RFAA 3DPDA 4JIOU 3MHSD 5AZHA 3TIXA 1WI0A 2IBIB 1WR1A 2Z0EB 2NPTB 3VUYA 2V1YA 4HDOA 1UGMA 2HE7A 1V5TA 4GDLB 4GXBA 4IM0A 4FADA 2JUOA 3ZVVA 3UIPB 2N1VA 4PS3A 1EO6A 4W9FA 3WAOA 5CHFA 4DDGD 1A5RA 2FCMA 3A9JB 4ZYNA 1WE6A 3X23A 1Q1OA 3VTVA 4AJYB 3WAPA 2IYDB 4LJOB 4RM9A 2MBHA 1X1MA 4HCNB 2L8JA 3DVNU 1YD8U 1SE9A 3HIZA 3RZWC 3WIMA 3PHXB 2D07B 2DYBA 3ZW3A 1WGYA 2IZVB 2KNBA 2RD0A 5FR6A 3ZKJC 2L0FA 3QCAA 1WZ3A 2CS4A 3KYDD 4E71A 5TR5A 2CU1A 2PE9A 4KIKA 3NZUA 4W9GA 2KX0A 2N9XA 4FHJA 3QX1A 2BYVE 3ZTCA 2BYFA 2JF5A 2KFKA 3VAWA 1YIWA 3VDZA 3CSTA 3A1QA 1SIFA 2MA9B 4NQLB 1C3TA 2NBUA 4K81A 4HDQA 2KKCA 3DVNV 2LVPA 3RCZA 3GOEA 4PS7A 3DBHI 1Q0WB 3NOBA 4HCPB 3RT3B 2LXAA 5BO4B
chains in the Genus database with same CATH superfamily
3QARA 3PPAA 4FA6A 2AQ1B 1TKGA 4PT5A 3ZRCA 2KXJA 1V97A 1E8WA 1JCKB 1VJKA 4I6PA 2JWUA 2IY0B 1EF1A 4HPLB 3APCA 1JWMD 2JZ3B 2N1WA 2JRIB 4OVZA 3GZNB 3K9OB 2YEPF 2XNAC 1TKEA 1SSNA 2KJHB 1WX8A 1CK1A 2KVZA 4OW0A 3VTUA 2CR5A 2PKOA 2RR9A 3AMZA 5BMIA 1P9DU 2GBMA 4XC2A 2GRIA 2N7JA 4LDTB 2VZKD 5IA7A 4ICVA 2HTHA 2K8BA 4J6IA 4BOZB 2KFKB 1GB4A 5AEKB 3H1UA 1WJ4A 3A1QB 3K9PB 1JALA 1K53A 1ZW7A 2JYTA 1HEZE 3A9KB 2NMQA 1WM3A 3VH4B 4WWNA 2E3TA 1QLBB 5LXHA 3V3XA 2H88B 2IO2B 2J42A 1V81A 1IGDA 1MI0A 1GUAB 3V6CB 2JVCA 3AU4A 1ZXIA 4FHKA 4DHZB 2L83A 2G4DB 1SB3C 3TUOA 2LXCA 3NVWA 4S17A 4FBJB 1QOFA 4RGOS 2Y5BB 2ZNVC 2ZPNA 3GS2A 3VUXA 4N6EB 1R7SA 4K3BA 1XLQA 2W3SA 1WGHA 2CKHB 5IAAC 3WANA 1UF0A 2ZCCA 4MEMA 4C7YA 3ALBA 4B95A 2R2QA 1YOVB 1N62A 4XDDA 4WAFA 2GBNA 3AM9A 3TEZA 2WXIA 4ITKA 1PGAA 3ZRFA 1XD3B 3AEEB 2Y5CA 4W9EA 3AEAB 5C2TB 2KAJA 4II3B 2YVCA 3KH0A 5KHQA 3UF8A 2NR2A 1L0YB 2DHZA 4AQ7A 5E6NA 3RNCC 2RPQA 3R7QA 5AUIA 4HJGE 3U4EG 2R2OA 2C9WB 5JHBA 1UGJA 1MHXA 1WXAA 3N1XC 4ZHOA 4E3CA 1WRIA 3W1SC 4ZRQA 3AEBB 2ZW0A 3QAQA 1J8CA 1HA5A 2J0MA 2C60A 2M0XA 2GMIC 2MQJA 3HM6X 3B2FA 2ZJDA 4GIVA 4JLCA 4AOFA 3AULA 4EZJA 1KH0A 1D3ZA 4FULA 3EA6A 1YMHE 3BVMA 4EZKA 4LCDE 2CHZA 1ESFA 1NI3A 4YTPB 3OWEB 3DBLB 2INPE 4S0RA 1NI2A 1P0RA 4IWOA 4KV2A 4LK0M 1YJIA 3WCQA 1DOIA 3B0AA 4GSWA 4TMAB 3U7DA 3PRMB 2W9NA 1P7EA 2REXA 2V9HA 1KLVA 2KN4A 1FXTB 1XO3A 4KGSA 2LVQA 4KKIA 2LD9A 2PJHA 2DZIA 2GBKA 2H89B 4JGHB 1WRDB 3AU5A 5IOIA 2LGXA 1BXTA 4BFRA 2GBJA 1KF6B 4HLEA 1NYRA 5G5HA 1OEYJ 3MHZA 2DYMA 1NYQA 5J17A 1GPXA 1V2YA 2LZ6A 2PTLA 1XXGA 5EE9A 2ACZB 2L3ZA 3AB5A 3RNBC 1J7AA 1V9JA 3RMKC 1U4AA 2A4ZA 3TJPA 2KZRA 2V0GA 3SFEB 4H2AA 5IO9A 1H4RA 1WJ6A 2N9EB 3DBRB 3OG5A 2K8CA 4II2B 1XLPA 2ZVOA 5T8IA 3KUDB 4IOIE 5FR3A 1WXSA 2MBBB 3N20C 3VRAB 1WWTA 2NTTA 2D10A 1HZ6A 1I4HA 2W55A 3A4RA 5C1ZA 4P1CC 2MSED 2BS3B 1E0ZA 2EELA 2W54A 4JX1C 1NENB 2J52A 4F1SA 4MSMB 5KHOA 1FMAD 1GOZA 1R4NI 4GOCA 1WXVA 1S1QB 2MJDA 3RI7C 3AEGB 4B9KA 3URYA 3Q8AA 1XF5L 3TCAA 4IM3A 1LO5D 3ZNGC 2KLCA 3KQ4A 1WIAA 2PLPA 2KHWB 1GJZA 3NVVA 2KTFA 3RFZB 4L23A 3I57A 3IT6B 3VFKA 1I42A 3PS6A 4WAAA 4KGRA 2MBEA 2K8HA 4YTMB 1N60A 1TY2A 1DOXA 5G55A 4W9LA 4RF0A 1E6EB 3E56A 1MJDA 4JWUC 5HG2A 4O1NA 1YN3A 1UZXB 4D2KA 3AE6B 1ACCA 1PYWD 2DZKA 1B9RA 1MG8A 2LI5A 3PRPB 3SEBA 2LUMA 3DBLI 2KWCA 1EU4A 4A8XC 1Y56A 1JROA 4PYUA 3FKYA 4NQKE 4DHJD 2VZKB 1DGJA 3JSVA 3V60A 4ZRPA 4G11A 5TSSA 3U30A 5AZHA 1WI0A 1XCTL 2Z0EB 2NPTB 2V1YA 5E6JA 3SR6A 3WAOA 1A5RA 4RGMA 2ZW1A 4ZYNA 2W3RA 5EE3A 2BS2B 2MBHA 4YSXB 3DVNU 5G5GA 5LNK1 2DYBA 2KNBA 3QCAA 2CS4A 4W9GA 4FHJA 2JF5A 2V4IB 3VAWA 2INDC 2FBWB 3CSTA 4WURA 2KKCA 1HZ5A 1SEBD 3AE4B 4R3DA 4HKQA 4DXGA 3GOEA 2I38A 2BVCA 3P63A 3NOBA 1CJEA 2KJ6A 1OEYA 3Q6BA 1VZ7A 3APDA 4FJYA 1RWSA 1XCQL 2QC8A 4K1RB 4MH8A 3MC0B 2PVGC 4M0WA 3LYYA 2N9PC 4ANXA 2WNMA 5L95C 4LNKA 1YQ3B 3ML9A 3X0WA 3JSVB 1YJ1A 2JQRB 3L10B 1FFVA 2KO3A 3CSFA 3TMPB 2C5LC 4LJPB 5GMVA 2KTRB 4P6VF 3ONSA 3SU8X 2RDHA 1D6EC 3M3JA 2FIDA 4W9HA 1I4XA 3PVLA 4TQ1A 4US8A 2WDTB 1AARA 3E9SA 4RGNA 3L54A 3NY5A 3VQIA 4DHZE 4FXCA 2Y5PA 1P3QU 3KVFB 2I1JA 4YWGG 5BYQA 1J7CA 1FRRA 2W82A 3KLSX 3PV1A 4KVGB 3QC8B 4OZBA 2WX0A 3ZJVA 2GOWA 5D6JB 4ZDVA 1GC7A 1OQQA 2KWUB 2DX5B 3JVZX 4EFOA 1EM7A 3ABVB 5AZFA 1YN4A 1G6JA 2WXJA 3S2AA 1DOYA 2D3AA 4WJNA 4N59A 1JWSD 1MFWA 3W5VB 2N7EA 3Q3MC 4E74A 2CU3A 3UINB 1D5ZC 5DPWA 4M0WB 4MT5A 1RLFA 2M8SA 2INNE 3N1YC 4KZCA 1TBEA 2N9LA 3KW5B 3RNAC 3BVGA 1FFUA 1KFYB 3AEDB 2KX3A 3AXCA 3M63B 2O2VB 2KFJA 4KDLB 3ENEA 3TSSA 2DAJA 4B6WA 3A9KA 4A20A 3PRZA 3EC8A 4A90A 2L7RA 2KANA 2JZPA 4MDKE 2D5GA 2X38A 1M94A 1AYFA 1EU3A 4C4VA 1OFFA 1SJHD 1YX5B 1SIJA 1K52A 3AE8B 3LDZE 2UWQA 1ZXHA 1ZGUB 3ECIA 1Q10A 1WXMA 3D32A 1I7HA 1N6ZA 3R2IA 4KZ0A 2J7QB 4JPSA 4C80A 2QILA 4NJ7A 1K51A 2IO3B 1ENFA 2DZJA 4WWPA 1TJEA 2MP2A 3TEYA 1V5OA 1TKYA 2PEAA 2L05A 4KKJA 1XT9B 1TGZB 1C77A 2G4SA 2BYTA 2ONQA 5J18A 2K0PA 5DCNA 3QHTA 5JZEB 4M8MA 5CX3A 4BBNC 3NG0A 1XLOA 1WFYA 3AI5A 4IM2A 2ZPYA 1TIFA 1C9FA 3V62A 2HJ8A 4XGAB 1N5XA 3ZO5B 1PGBA 1IGCA 2CHWA 3T9LA 1E90A 2AL3A 2L32A 2L0TA 4C4VB 2KC2A 1I35A 1SGHA 2Z8LA 4YSZB 1SBBB 3MJ5A 3ZNID 4FLHA 1ZUD2 4BOSC 4M00A 2QJLA 4EEWA 1T5XD 3RUIB 4FJVB 3UGBB 3WALA 1A70A 2N0SB 1D5XC 4HROA 4K7SA 3T8MA 2AWTA 4OVVA 3OLMD 4HJKA 3ZNHB 4NY0A 2LUEA 4DHJB 3P4SB 5AZGA 1UBIA 2BBCA 3NVYA 1WGGA 3DDCB 4IC7B 4MGYE 2OHFA 4WJOA 1C78A 2MP2B 3APFA 3ZLZA 3QWZB 3PZ8A 3N30A 1E8ZA 5G2NA 4NZLB 2WXGA 4GU2A 2WDVB 2IO0B 3ZJTA 3IAM1 1C4PA 4JE3B 4RFBA 2DBYA 4GB9A 2QSDA 2MBQA 1R4NB 4HWIB 2MHJA 4BVUC 2WDRB 3Q3NC 4AP4C 2R61A 3VR8B 2JZZA 5H92C 4ZRIA 2LFIA 1OTRB 3KWVA 4LNNA 2IGGA 4GDLA 1XEEA 1TZ1A 2OEDA 3A4SC 3IVFA 2BB6A 1KLGD 3KWLA 5FK9C 3AH7A 4P1BC 5GXGB 1E5WA 3DHGC 1V49A 3C0RB 2LEKA 2BKFA 3DHIC 2KACA 3Q2AC 1YJJA 4K7UA 4LTUA 4DXFA 1JWAD 5CTRC 2PVOD 2KC1A 4OVUA 2I2YA 4KGTA 2K22A 2Q5WD 4M01A 2FCNA 1MPEA 2G9HD 3ZUNA 4HKZE 2DENB 1VRAB 2J0JA 1SF0A 3IBEA 1OQRA 5AUKA 2UU7A 1N63A 2MJEA 4W9KA 3IFWB 4M02A 2BWES 4OHJA 5BYSA 1ZKHA 5BMGA 3KYCD 1RM6C 2MRPA 4Q2JA 1WF9A 2LWPA 3SHQA 5JH5C 1F0ZA 1NDDA 5HHDG 3ZTDA 1OQYA 4GN1A 3DPDA 4JIOU 3MHSD 2DLBA 3CWIA 3IXSA 4B0EA 4GDLB 4FADA 3UIPB 1EO6A 3NJTA 4DDGD 4DQOC 1WE6A 3X23A 3VTVA 3FILA 1X1MA 4C00A 1YD8U 2QEJC 2WXQA 2WS3B 3ZW3A 3T3NA 5FR6A 1UNSA 2L0FA 2K9XA 1LGRA 1UWXA 3KYDD 2CU1A 4KIKA 1N61A 3NZUA 1J7BA 1MHHE 1ZOYB 3ZTCA 1SE3A 1FXIA 3ZYYX 2MA9B 1F2RI 3RCZA 3DBHI 2KMMA 2RDGA 3RT3B 1L4DB 1TTNA 2LJIA 4FJZA 3OJ4B 2NPTA 3H7PA 2EMTA 1T0SC 5LLIA 3EHVA 4I6NB 2ICIA 1CZPA 1WJUA 4JWSC 3ZJUA 3AE3B 2AQ3B 2O6VD 3Q3JA 4MSQB 4HEA1 1WYGA 5IKCM 1TS4A 2LJ5A 3C8YA 4NAWA 3P1MA 2GBRA 2AX5A 3DVGX 1PDXA 2YEPB 1P7FA 2LGIA 5IN7A 3TEXA 3OJ3A 1Y8RC 1WGDA 1EWYC 4TSSA 3UQBA 2FE8A 4BKGA 4ZRKA 2WWZA 4LDTD 2B76B 3UQAA 4XDCA 2RMMA 1BMLC 5JXVA 2JYEA 3FILB 1ZDXA 4RF1A 4YL8A 4XE0A 2KDIA 1TY0A 1NVID 3B1LX 2WXKA 3BYYB 1KOTA 4KIKB 3CMMB 2IDYA 2WXHA 4L1BA 1I4QA 4A3PA 1Z5SB 1HQRD 3H9DA 2BQQA 2JSVX 3R7RA 1XLNA 2A5UA 3H7PB 3U7ZA 2NS5A 1EWCA 3PSEB 1QOBA 2J53A 2M17A 4RM8A 1HXYD 2D3BA 2KTRA 2MEKA 4P7IA 2D2QA 3VXWA 2IGDA 3Q8CA 2OOBB 2CJNA 3ML8A 2J4XA 2CJOA 2NBWB 4NAWB 3U8ZA 4EUTA 2EMSA 2SEBD 2LVOA 4CHKA 3L17A 2OJWA 3PHWB 3O65B 4N58A 3L0WB 2K39A 3EGRA 2B3AA 1V6EA 1R4MB 4K3CA 1ET9A 2AL6A 3M95A 4AS1A 1V1OA 4DDID 4ZYSA 1VD2A 1QF6A 4LNFA 4PS8A 3AN1A 4MGKE 3AEFB 2BTEA 1J0GA 3LXFA 2KN5A 3AE7B 3BY4B 2WGSA 3P4PB 1JRUA 3VH3B 3Q8EA 4C56C 1WJNA 2ON8A 3JYUA 3VUWA 1VLBA 1T0RC 2CHXA 5DPTA 1JWUD 3W2DA 2V3PA 4G50A 1RRBA 2HJ1A 3BYTB 4WQOB 4YTNB 2Y3AA 4A9AA 1WXQA 2BW2A 2DAFA 4PK1A 3ZNZB 3HVZA 1AW7A 2O2VA 4ZHPA 1E9MA 4M8NA 1D4BA 1XQQA 2WU2B 4GMVA 2ZCBA 2BKRB 4RGTA 2KDFB 5E6OA 3BZDB 4GDKA 1FXAA 4TV3A 1L6VA 3O13A 1WZ0A 3I9V1 5BYRA 1C4AA 1L2NA 1MG4A 1MVKA 2LHEA 3DBSA 2PMVA 1C1YB 1EF5A 4QAYA 1HTOA 1LFDA 2HTME 3L16A 3VHTC 1I4PA 1RYJA 1PGXA 4CO7A 4ARIA 1YN5A 4WWMA 2RDBC 4AUQC 1PQSA 1SJED 2K25A 4HXDA 1E7PB 3P4RB 2VRRB 2WXFA 2BYEA 2DNFA 1WMHB 2RPVA 5HI1A 3R8BA 1DYQA 2INCC 2O6VA 4MH0E 3SD5A 2ZZPB 3TEWA 5D94A 3JW0X 2LASA 1P98A 3NVZA 4W9DA 3AV8A 4HPMB 5D2MB 1FIQA 3IHPC 4W9JA 2JXXA 2KVRA 4WJQA 1L0VB 5I4DA 1Z2MA 4HK2A 5HKHA 4HRSA 1OGWA 3RNGC 2PE6B 1HE8A 3UI3A 3BINA 1R4MI 2KYWA 2MJ3A 4GDKB 4BAXA 3EECA 4NJ6A 3AE2B 3DWMA 3QQ8B 5H8YE 4XX5A 2PIAA 3NS1A 4IG7B 1ZDVA 4I6LB 2AEHA 4BBNF 3LB8C 4DWFA 2WX1A 2G45B 4DK5A 4UDUC 4K7WA 1PFDA 2BGFA 2C7MB 2XEWA 3HK0A 3A9JA 5CHVC 4NAMA 3PREA 2LGSA 2JPHA 2LRWA 4XZ4A 3V6EB 2KOXA 1GG3A 2FUG1 2KDEB 2L1AA 2WXMA 3MC9A 4LNIA 4EOYA 2NCNA 4CYEA 1E10A 3B08A 1UELA 2LGDA 2O6VB 2WLBA 3SFDB 2KQ7A 3BIID 4WIPA 4F7ZA 4ARCA 3AE9B 4ICUA 4ANWA 1YQ4B 1T0YA 2WXRA 2IY1B 2M4NA 2BT6A 3OAWA 5IP4D 1ZE3D 2V3NA 1L6UA 1V86A 4WQMA 4MM3A 2LHDA 4L2YA 1E8YA 4RMAA 4ZRJA 2FUHB 1VCBA 2D11A 1TT5B 3Q69A 4JQWC 3MC8A 2JRHA 3MFGA 3W9CB 1PUTA 2MX2A 3Q14C 3R2TA 1FNWA 4ACFA 3AE5B 1FM0D 4CQNA 2C7NB 4X57B 2YLMA 2WYQA 2ZEQA 1E7VA 2GI9A 1WH3A 2ZVNA 1BT0A 3QIJA 4G3XB 4HVBA 4US9A 1FPYA 4BZAA 1WR1A 4YXDB 3VUYA 4HDOA 1UGMA 2HE7A 1V5TA 4GXBA 2JUOA 3ZVVA 1JMLA 2N1VA 4PS3A 4W9FA 1JWBD 3A9JB 3BK2A 2WU5B 1Q1OA 2WXNA 4AJYB 3IT4B 3WAPA 1UUPA 4LJOB 4RM9A 4XYCA 1TZOA 3RNEC 4HCNB 3GE3C 2G1EA 2L8JA 3HIZA 3RZWC 2D07B 1JW9D 2DWQA 2WXOA 3U2SC 2RD0A 1FRDA 3DBHB 4B0MA 1WZ3A 5TR5A 1WGKA 4EE2A 4RH6A 2IPKD 2KX0A 2N9XA 2NTSA 2TSSA 1YIWA 3VDZA 1SIFA 2QMTA 4NQLB 1C3TA 2NBUA 4HDQA 3DVNV 4LLGM 2LXAA 5BO4B 1SE2A 4MM3B 1V80A 1UBQA 1FNVA 5D3IB 2WQYB 3DQVA 2FNJB 1L7YA 2AYOB 3N1ZC 4A6QA 3RN9C 4YT0B 4FN2A 2KMAA 4JL9A 4DBGA 5BMHA 4F8CB 1KRHA 1TYGB 3VVWB 1WYWB 3RYTA 1WE7A 2MH7A 2WDQB 1KTKA 3UIOB 4KX6B 4XWWA 2Z59B 1ET6A 4GGQA 4ZOHC 1JRPA 1E8XA 1ROEA 2BS4B 4KSKC 2IO1B 3ZDTA 1ISNA 3GZNI 1I4GA 1KJTA 3ZDMC 3HUIA 4MGIE 1TS5A 3GP7A 2Z0DB 5LXIB 2SAKA 3VR9B 4MELA 2OJRA 4TUUA 3PZ7A 4IDIA 3RD2A 1QILA 4J3OD 3V61A 1P1AA 4REZA 1TS2A 1SE4A 3ZXRA 2KK8A 3RPFC 4BKSD 4HPPA 2MBOA 3V05A 4EKUA 1IP9A 4G0NB 1B1ZA 1T0QC 1FO4A 2QHOA 4W9CA 2JU6X 2WXPA 2M0AA 3VRBB 1IPGA 2XK5A 4WJPA 2KLGA 3U52E 2K5PA 1QOGA 2GLSA 3MTNB 3IAS1 3AE1B 2K1FA 4TKNA 4W9IA 4BKTA 2GB1A 1QQRA 1T3QA 2JX5A 3NHEB 3R66C 4IUMB 5J2RA 4OZAA 4P16A 2V3SA 3BVZA 4IWPA 3RULA 2D3GA 1GC6A 4YSYB 2V4LA 2WP9B 2M56B 1KM7A 1GAQB 2JWZA 1L5PA 3PTFC 3RNFC 2PPHA 2X8XX 2J0KA 3AECB 3PGEA 1L4ZB 4RNAA 3B9JA 4AJWA 3MJWA 1C76A 4A55A 2KD0A 1QOAA 3Q3OC 3N9YC 4IWQA 3GE8C 5JHAA 2FCQA 3L13A 1AWDA 3H7SA 1BUIC 3QJZA 2BF8B 4A3OA 3PLUA 2E6XA 2NVUI 1RAXA 4URKA 2L52A 1IYFA 1J19A 2MW5A 2XK5B 4AWJA 2KJRA 1FCLA 1FD6A 3HRDD 2KWDA 3P2BA 4RCOA 4PYZA 3W1SA 1VZ6A 2G3QB 1IBXA 3VTWA 1V1PA 2IGHA 4N9F4 1GNUA 2FIFA 2ZNVB 1WM2A 2KT7A 3I63C 2K3UA 4LNOA 1V8CA 4WWOA 5CHWA 1FNUA 3NS8A 1CMXB 1N5WA 4TQ0A 1QT9A 2DZMA 2AQ2B 3ZQ4A 2K6QA 1UH6A 3W1YA 3Q8BA 2K6DB 3NRZA 4DXAB 4USAA 3W5UB 3NZSA 2KWVB 1ZP0B 1ZPSA 2JT4B 1L0XB 2N7DA 2WHIA 3DCGA 2EKIA 2M19A 3DVGY 5MPOA 2KDBA 5C23A 1UD7A 3H6NA 1VZ8A 3EFUA 2L00B 1YX6B 3GB1A 3L4PA 3PT2B 3HVDA 3J9CA 2IJ0A 2KMCA 1EUVB 5DPRA 2NBVB 2KQSA 1Q5WB 4MJSA 3B2GA 5EDSA 4IW0A 1QKZA 1T6BX 4XWTA 3Q8FA 1NBFC 2MCNB 1FCCC 3SDLC 3N32A 2D3CA 4KSLC 3PZDA 3HM3A 2ASQA 2XBBC 1GB1A 1HTQA 3KUZA 1WGRA 3WAMA 3C19A 5L83A 1F9JA 3TBLD 2MWSB 5EE0A 3BWUD 3Q3FA 1IBXB 3A33B 3P42A 1I4RA 1WY8A 1V1PB 1M4VA 1TS3A 3ZXVA 1K8RB 3DOWA 4ASWC 1WX7A 1D5MC 3RZFA 1FEHA 3EFCA 5C3JB 2LRUA 1LQBA 1WMHA 4MACA 3ZIMA 1C79A 2RGFA 5D7GA 1LM8B 5EE1A 4BKSA 3I3TB 3R3MA 3DBRI 1F1HA 3IG3A 4MGZE 1WSPA 1STEA 3L08A 3BK1A 3LJ3A 1F77A 1C4CA 3NZ3A 2FCSA 1AN8A 3CF6E 2UYZB 1WX9A 2N9KA 3WA0A 4C7ZA 4ANVA 2FAZA 4IKGA 1VDVA 3QK0A 5DPSA 1F2RC 2LGYA 2HD5B 1UWMA 2M1MA 5HFYA 4MJSB 1F52A 1KLUD 3H8HA 5D3DA 2DYOA 3T3OA 3DWGC 2VH2A 1H8CA 2WXLA 3TL5A 2BPSA 1E7UA 3FAHA 1K50A 4NNJB 2L76A 3M62B 3NUHB 3PLVA 2JY6A 4ANUA 3I5JC 3EUB2 2QCZA 1QZEA 2MLBA 1YQBA 1S3SG 1VR9A 4OZCA 3ETRA 2I1KA 1RFKA 3HHMA 3QA8A 4EZLA 1SXTA 3N3KB 5FKAC 2C7HA 3DHHC 3KUCB 5E6PA 1WR6E 2N4FA 1NEKB 4KDIC 2EKEC 2RSUA 3FC4A 2BWFA 4NPNA 1LXDA 1RFAA 2JXTA 3TIXA 2IBIB 2PW9A 1CQVA 2KQ4X 4IM0A 3CIRB 5CHFA 4GLSC 2KDMA 2FCMA 4NJCA 2QIEB 2IYDB 1SE9A 3P4QB 3WIMA 3PHXB 4WH4A 1WGYA 3MP9A 2IZVB 2QDFA 3ZKJC 1IUEA 1YNTE 2VH1A 4E71A 2PE9A 1JQ4A 2HDEA 2BYVE 3QX1A 2BYFA 3PO0A 2KFKA 2LMCA 3A1QA 4K81A 2LVPA 3ZGZA 2BB5A 4PS7A 1Q0WB 4HCPB 2XN9C
chains in the Genus database with same CATH topology
1TTNA 2KJ6A 3QARA 1V80A 1OEYA 1UBQA 3OJ4B 3PPAA 2NPTA 4FJZA 4FA6A 3H7PA 2EMTA 3APDA 5LLIA 4FJYA 3DQVA 2FNJB 3EHVA 4K1RB 3ZRCA 4I6NB 1L7YA 2AYOB 2KXJA 1WJUA 1E8WA 4FN2A 2KMAA 4JL9A 2O6VD 3Q3JA 4I6PA 4MSQB 4DBGA 2IY0B 1EF1A 4HPLB 3APCA 4F8CB 2LJ5A 2N9PC 4ANXA 4NAWA 3VVWB 2GBRA 2JZ3B 1WYWB 2N1WA 2JRIB 3DVGX 5L95C 3K9OB 3RYTA 3ML9A 3X0WA 1WE7A 3JSVB 3OJ3A 1YJ1A 1Y8RC 3UIOB 3L10B 2KO3A 1WGDA 2Z59B 4GGQA 1E8XA 3CSFA 2KJHB 4KSKC 3TMPB 3UQBA 4BKGA 4ZRKA 2C5LC 2WWZA 1WX8A 4LJPB 5GMVA 4LDTD 2IO1B 3ZDTA 3VTUA 1ISNA 2CR5A 2KTRB 3GZNI 3ONSA 3UQAA 3SU8X 1KJTA 3ZDMC 2RR9A 4MGIE 3M3JA 2FIDA 4W9HA 3PVLA 2Z0DB 4TQ1A 2WDTB 1AARA 5LXIB 4MELA 1P9DU 2OJRA 3L54A 3NY5A 2GBMA 4TUUA 4YL8A 3VQIA 4DHZE 3RD2A 4XC2A 1P3QU 2KDIA 3KVFB 4LDTB 2I1JA 3V61A 3B1LX 1P1AA 5IA7A 3PV1A 4KVGB 3QC8B 1KOTA 2KK8A 2WX0A 3CMMB 4KIKB 4BKSD 4ICVA 2HTHA 2K8BA 2MBOA 4J6IA 2GOWA 4BOZB 4EKUA 1IP9A 5D6JB 4ZDVA 4G0NB 1GC7A 2KWUB 2KFKB 2DX5B 3JVZX 4EFOA 5AEKB 3H1UA 1WJ4A 3A1QB 3K9PB 2QHOA 4W9CA 1ZW7A 4A3PA 1Z5SB 5AZFA 1IPGA 2XK5A 3A9KB 2KLGA 4WJPA 1WM3A 3H9DA 4WWNA 3VH4B 1G6JA 5LXHA 3MTNB 2IO2B 3R7RA 3H7PB 2A5UA 2K1FA 2NS5A 3S2AA 4TKNA 3PSEB 4WJNA 1V81A 2M17A 4RM8A 1GUAB 4W9IA 4BKTA 2KTRA 3V6CB 3NHEB 3R66C 4P7IA 2D2QA 2JVCA 2N7EA 3AU4A 4FHKA 4E74A 4IUMB 3VXWA 4DHZB 3UINB 2G4DB 5DPWA 2OOBB 2LXCA 3ML8A 4M0WB 5J2RA 4FBJB 2NBWB 2V3SA 4NAWB 3U8ZA 4EUTA 2EMSA 4IWPA 2Y5BB 2LVOA 2ZNVC 1RLFA 2M8SA 2ZPNA 3RULA 3VUXA 4CHKA 2D3GA 3L17A 1GC6A 2V4LA 3PHWB 3O65B 4KZCA 1TBEA 3KW5B 1KM7A 1WGHA 2K39A 3L0WB 2B3AA 1V6EA 2CKHB 5IAAC 2JWZA 3WANA 3PTFC 2ZCCA 4MEMA 2AL6A 2KX3A 3M95A 2PPHA 3ALBA 4B95A 2R2QA 3AXCA 3M63B 2O2VB 2KFJA 4KDLB 4DDID 3ENEA 2DAJA 4B6WA 1VD2A 2J0KA 3PGEA 2GBNA 4PS8A 3A9KA 4A20A 4AJWA 3MJWA 3PRZA 3EC8A 4MGKE 2KD0A 1J0GA 2L7RA 1XD3B 2KN5A 3BY4B 3ZRFA 2KANA 1JRUA 4IWQA 4MDKE 4W9EA 3VH3B 1WJNA 1M94A 5JHAA 1YX5B 2FCQA 4II3B 3JYUA 3L13A 2YVCA 3KH0A 3VUWA 5KHQA 3UF8A 2NR2A 2CHXA 2DHZA 3H7SA 5DPTA 3LDZE 5E6NA 3QJZA 2BF8B 4A3OA 2UWQA 3PLUA 4G50A 1RRBA 1ZGUB 1RAXA 2NVUI 2RPQA 4WQOB 3R7QA 4URKA 1IYFA 3ECIA 1WXMA 3D32A 2R2OA 1J19A 2MW5A 2XK5B 4AWJA 2KJRA 2C9WB 4KZ0A 2J7QB 2DAFA 5JHBA 1WXAA 4NJ7A 2IO3B 3P2BA 3ZNZB 4PYZA 2DZJA 4WWPA 3W1SA 2O2VA 2MP2A 1V5OA 4E3CA 2G3QB 2PEAA 4M8NA 3W1SC 2L05A 1XQQA 4GMVA 2ZCBA 3QAQA 3VTWA 2BKRB 1XT9B 4N9F4 1J8CA 1GNUA 1TGZB 2FIFA 2C60A 1WM2A 2J0MA 2M0XA 2ZNVB 2KDFB 5E6OA 2G4SA 4GDKA 4TV3A 2GMIC 2MQJA 3HM6X 4WWOA 2ZJDA 5CHWA 4GIVA 1WZ0A 4JLCA 4AOFA 3NS8A 1CMXB 1L2NA 3AULA 4TQ0A 4EZJA 2DZMA 5DCNA 5J18A 1D3ZA 3DBSA 3QHTA 5JZEB 4FULA 2K6QA 1C1YB 1UH6A 4LCDE 4EZKA 3W1YA 1EF5A 2CHZA 2K6DB 4M8MA 4DXAB 5CX3A 1LFDA 3L16A 3NZSA 1NI2A 1P0RA 2KWVB 3VHTC 4IWOA 4BBNC 2JT4B 4KV2A 1WFYA 2N7DA 3AI5A 4IM2A 3DCGA 2ZPYA 3B0AA 4CO7A 3DVGY 4GSWA 3V62A 2HJ8A 2KDBA 5C23A 1UD7A 3H6NA 4AUQC 1PQSA 2L00B 3EFUA 3ZO5B 1YX6B 3U7DA 3PRMB 2W9NA 2REXA 2CHWA 2K25A 3PT2B 3T9LA 1E90A 1KLVA 2AL3A 4HXDA 1FXTB 2L0TA 2KMCA 2VRRB 1EUVB 5DPRA 2KC2A 2LVQA 2BYEA 1I35A 1WMHB 2NBVB 2LD9A 1SGHA 2PJHA 2DZIA 2GBKA 3ZNID 2KQSA 4FLHA 4JGHB 1WRDB 4BOSC 1Q5WB 4MJSA 2O6VA 3AU5A 4MH0E 3SD5A 5EDSA 2ZZPB 4IW0A 4EEWA 3RUIB 2LGXA 4FJVB 3UGBB 5D94A 3WALA 2GBJA 4BFRA 4HLEA 4K7SA 3JW0X 2LASA 1NBFC 1OEYJ 2MCNB 3T8MA 1P98A 2DYMA 2AWTA 4OVVA 3OLMD 5J17A 4HJKA 3ZNHB 4W9DA 4NY0A 2LUEA 3SDLC 4DHJB 3N32A 1V2YA 5AZGA 4KSLC 1UBIA 2LZ6A 4HPMB 5D2MB 3PZDA 3HM3A 3IHPC 2ASQA 2XBBC 4W9JA 1WGGA 2JXXA 3DDCB 4IC7B 4MGYE 3KUZA 2KVRA 4WJOA 1WGRA 3WAMA 4WJQA 5L83A 2L3ZA 1F9JA 1Z2MA 2MP2B 1V9JA 3APFA 3TBLD 3ZLZA 2MWSB 3QWZB 1U4AA 4HK2A 2A4ZA 3Q3FA 3TJPA 5HKHA 2KZRA 3N30A 1E8ZA 5G2NA 3A33B 1OGWA 2PE6B 1WY8A 1HE8A 4GU2A 1H4RA 1WJ6A 2N9EB 2K8CA 4II2B 3BINA 1R4MI 2ZVOA 1K8RB 3DOWA 4GDKB 4ASWC 2IO0B 3EECA 3KUDB 1WX7A 4NJ6A 3RZFA 1WXSA 4GB9A 2MBBB 2MBQA 2LRUA 3QQ8B 1LQBA 1WMHA 3ZIMA 2RGFA 4HWIB 4XX5A 2D10A 5D7GA 4BVUC 1LM8B 3A4RA 4AP4C 5C1ZA 2JZZA 2MSED 4IG7B 3I3TB 4I6LB 4BKSA 2AEHA 3R3MA 4ZRIA 4BBNF 3DBRI 3IG3A 4MGZE 1OTRB 4DWFA 3L08A 2WX1A 2G45B 4DK5A 4GDLA 3LJ3A 4F1SA 4K7WA 1TZ1A 2FCSA 4MSMB 5KHOA 3CF6E 3A4SC 2BGFA 2C7MB 2UYZB 2XEWA 3IVFA 1WX9A 1R4NI 3HK0A 3A9JA 5CHVC 1E5WA 3PREA 4GOCA 1WXVA 2LRWA 1S1QB 2JPHA 4XZ4A 3WA0A 4ANVA 1V49A 3V6EB 3C0RB 2FAZA 2KOXA 4B9KA 3TCAA 4IM3A 2BKFA 1GG3A 2KDEB 3ZNGC 2KLCA 3QK0A 4EOYA 4K7UA 2NCNA 5DPSA 4CYEA 1WIAA 2KHWB 3B08A 1GJZA 5CTRC 2LGYA 2HD5B 1UELA 2M1MA 2KC1A 2LGDA 2KTFA 4MJSB 2O6VB 2DYOA 4OVUA 3VFKA 2KQ7A 1I42A 3PS6A 4F7ZA 4WAAA 1H8CA 2MBEA 3TL5A 2FCNA 2BPSA 1E7UA 4ICUA 4ANWA 4NNJB 2K8HA 1T0YA 2IY1B 2M4NA 3ZUNA 2L76A 2DENB 2J0JA 3M62B 3OAWA 3IBEA 5G55A 3PLVA 4W9LA 2JY6A 1V86A 4ANUA 4MM3A 1E8YA 4RMAA 4ZRJA 2FUHB 1VCBA 2D11A 1QZEA 2MLBA 4W9KA 1UZXB 3IFWB 1YQBA 2BWES 4JQWC 1S3SG 2JRHA 1ZKHA 2MX2A 2I1KA 3HHMA 3QA8A 2DZKA 3KYCD 4EZLA 1MG8A 3N3KB 2LI5A 3PRPB 2MRPA 2C7NB 2KWCA 3DBLI 1WF9A 2LWPA 4X57B 3SHQA 5JH5C 4PYUA 2C7HA 4NQKE 3KUCB 5E6PA 2YLMA 1WR6E 2WYQA 1NDDA 2N4FA 2ZEQA 1E7VA 4DHJD 4KDIC 1WH3A 2EKEC 2RSUA 2ZVNA 1BT0A 3JSVA 3ZTDA 3QIJA 3V60A 1OQYA 2BWFA 4G3XB 4G11A 4NPNA 1LXDA 4GN1A 4HVBA 3U30A 1RFAA 3DPDA 4JIOU 3MHSD 5AZHA 3TIXA 1WI0A 2IBIB 1WR1A 2Z0EB 2NPTB 3VUYA 2V1YA 4HDOA 1UGMA 2HE7A 1V5TA 4GDLB 4GXBA 4IM0A 4FADA 2JUOA 3ZVVA 3UIPB 2N1VA 4PS3A 1EO6A 4W9FA 3WAOA 5CHFA 4DDGD 1A5RA 2FCMA 3A9JB 4ZYNA 1WE6A 3X23A 1Q1OA 3VTVA 4AJYB 3WAPA 2IYDB 4LJOB 4RM9A 2MBHA 1X1MA 4HCNB 2L8JA 3DVNU 1YD8U 1SE9A 3HIZA 3RZWC 3WIMA 3PHXB 2D07B 2DYBA 3ZW3A 1WGYA 2IZVB 2KNBA 2RD0A 5FR6A 3ZKJC 2L0FA 3QCAA 1WZ3A 2CS4A 3KYDD 4E71A 5TR5A 2CU1A 2PE9A 4KIKA 3NZUA 4W9GA 2KX0A 2N9XA 4FHJA 3QX1A 2BYVE 3ZTCA 2BYFA 2JF5A 2KFKA 3VAWA 1YIWA 3VDZA 3CSTA 3A1QA 1SIFA 2MA9B 4NQLB 1C3TA 2NBUA 4K81A 4HDQA 2KKCA 3DVNV 2LVPA 3RCZA 3GOEA 4PS7A 3DBHI 1Q0WB 3NOBA 4HCPB 3RT3B 2LXAA 5BO4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TTN A;  2KJ6 A;  3QAR A;  1V80 A;  1OEY A;  1UBQ A;  3OJ4 B;  3PPA A;  2NPT A;  4FJZ A;  4FA6 A;  3H7P A;  2EMT A;  3APD A;  5LLI A;  4FJY A;  3DQV A;  2FNJ B;  3EHV A;  4K1R B;  3ZRC A;  4I6N B;  1L7Y A;  2AYO B;  2KXJ A;  1WJU A;  1E8W A;  4FN2 A;  2KMA A;  4JL9 A;  2O6V D;  3Q3J A;  4I6P A;  4MSQ B;  4DBG A;  2IY0 B;  1EF1 A;  4HPL B;  3APC A;  4F8C B;  2LJ5 A;  2N9P C;  4ANX A;  4NAW A;  3VVW B;  2GBR A;  2JZ3 B;  1WYW B;  2N1W A;  2JRI B;  3DVG X;  5L95 C;  3K9O B;  3RYT A;  3ML9 A;  3X0W A;  1WE7 A;  3JSV B;  3OJ3 A;  1YJ1 A;  1Y8R C;  3UIO B;  3L10 B;  2KO3 A;  1WGD A;  2Z59 B;  4GGQ A;  1E8X A;  3CSF A;  2KJH B;  4KSK C;  3TMP B;  3UQB A;  4BKG A;  4ZRK A;  2C5L C;  2WWZ A;  1WX8 A;  4LJP B;  5GMV A;  4LDT D;  2IO1 B;  3ZDT A;  3VTU A;  1ISN A;  2CR5 A;  2KTR B;  3GZN I;  3ONS A;  3UQA A;  3SU8 X;  1KJT A;  3ZDM C;  2RR9 A;  4MGI E;  3M3J A;  2FID A;  4W9H A;  3PVL A;  2Z0D B;  4TQ1 A;  2WDT B;  1AAR A;  5LXI B;  4MEL A;  1P9D U;  2OJR A;  3L54 A;  3NY5 A;  2GBM A;  4TUU A;  4YL8 A;  3VQI A;  4DHZ E;  3RD2 A;  4XC2 A;  1P3Q U;  2KDI A;  3KVF B;  4LDT B;  2I1J A;  3V61 A;  3B1L X;  1P1A A;  5IA7 A;  3PV1 A;  4KVG B;  3QC8 B;  1KOT A;  2KK8 A;  2WX0 A;  3CMM B;  4KIK B;  4BKS D;  4ICV A;  2HTH A;  2K8B A;  2MBO A;  4J6I A;  2GOW A;  4BOZ B;  4EKU A;  1IP9 A;  5D6J B;  4ZDV A;  4G0N B;  1GC7 A;  2KWU B;  2KFK B;  2DX5 B;  3JVZ X;  4EFO A;  5AEK B;  3H1U A;  1WJ4 A;  3A1Q B;  3K9P B;  2QHO A;  4W9C A;  1ZW7 A;  4A3P A;  1Z5S B;  5AZF A;  1IPG A;  2XK5 A;  3A9K B;  2KLG A;  4WJP A;  1WM3 A;  3H9D A;  4WWN A;  3VH4 B;  1G6J A;  5LXH A;  3MTN B;  2IO2 B;  3R7R A;  3H7P B;  2A5U A;  2K1F A;  2NS5 A;  3S2A A;  4TKN A;  3PSE B;  4WJN A;  1V81 A;  2M17 A;  4RM8 A;  1GUA B;  4W9I A;  4BKT A;  2KTR A;  3V6C B;  3NHE B;  3R66 C;  4P7I A;  2D2Q A;  2JVC A;  2N7E A;  3AU4 A;  4FHK A;  4E74 A;  4IUM B;  3VXW A;  4DHZ B;  3UIN B;  2G4D B;  5DPW A;  2OOB B;  2LXC A;  3ML8 A;  4M0W B;  5J2R A;  4FBJ B;  2NBW B;  2V3S A;  4NAW B;  3U8Z A;  4EUT A;  2EMS A;  4IWP A;  2Y5B B;  2LVO A;  2ZNV C;  1RLF A;  2M8S A;  2ZPN A;  3RUL A;  3VUX A;  4CHK A;  2D3G A;  3L17 A;  1GC6 A;  2V4L A;  3PHW B;  3O65 B;  4KZC A;  1TBE A;  3KW5 B;  1KM7 A;  1WGH A;  2K39 A;  3L0W B;  2B3A A;  1V6E A;  2CKH B;  5IAA C;  2JWZ A;  3WAN A;  3PTF C;  2ZCC A;  4MEM A;  2AL6 A;  2KX3 A;  3M95 A;  2PPH A;  3ALB A;  4B95 A;  2R2Q A;  3AXC A;  3M63 B;  2O2V B;  2KFJ A;  4KDL B;  4DDI D;  3ENE A;  2DAJ A;  4B6W A;  1VD2 A;  2J0K A;  3PGE A;  2GBN A;  4PS8 A;  3A9K A;  4A20 A;  4AJW A;  3MJW A;  3PRZ A;  3EC8 A;  4MGK E;  2KD0 A;  1J0G A;  2L7R A;  1XD3 B;  2KN5 A;  3BY4 B;  3ZRF A;  2KAN A;  1JRU A;  4IWQ A;  4MDK E;  4W9E A;  3VH3 B;  1WJN A;  1M94 A;  5JHA A;  1YX5 B;  2FCQ A;  4II3 B;  3JYU A;  3L13 A;  2YVC A;  3KH0 A;  3VUW A;  5KHQ A;  3UF8 A;  2NR2 A;  2CHX A;  2DHZ A;  3H7S A;  5DPT A;  3LDZ E;  5E6N A;  3QJZ A;  2BF8 B;  4A3O A;  2UWQ A;  3PLU A;  4G50 A;  1RRB A;  1ZGU B;  1RAX A;  2NVU I;  2RPQ A;  4WQO B;  3R7Q A;  4URK A;  1IYF A;  3ECI A;  1WXM A;  3D32 A;  2R2O A;  1J19 A;  2MW5 A;  2XK5 B;  4AWJ A;  2KJR A;  2C9W B;  4KZ0 A;  2J7Q B;  2DAF A;  5JHB A;  1WXA A;  4NJ7 A;  2IO3 B;  3P2B A;  3ZNZ B;  4PYZ A;  2DZJ A;  4WWP A;  3W1S A;  2O2V A;  2MP2 A;  1V5O A;  4E3C A;  2G3Q B;  2PEA A;  4M8N A;  3W1S C;  2L05 A;  1XQQ A;  4GMV A;  2ZCB A;  3QAQ A;  3VTW A;  2BKR B;  1XT9 B;  4N9F 4;  1J8C A;  1GNU A;  1TGZ B;  2FIF A;  2C60 A;  1WM2 A;  2J0M A;  2M0X A;  2ZNV B;  2KDF B;  5E6O A;  2G4S A;  4GDK A;  4TV3 A;  2GMI C;  2MQJ A;  3HM6 X;  4WWO A;  2ZJD A;  5CHW A;  4GIV A;  1WZ0 A;  4JLC A;  4AOF A;  3NS8 A;  1CMX B;  1L2N A;  3AUL A;  4TQ0 A;  4EZJ A;  2DZM A;  5DCN A;  5J18 A;  1D3Z A;  3DBS A;  3QHT A;  5JZE B;  4FUL A;  2K6Q A;  1C1Y B;  1UH6 A;  4LCD E;  4EZK A;  3W1Y A;  1EF5 A;  2CHZ A;  2K6D B;  4M8M A;  4DXA B;  5CX3 A;  1LFD A;  3L16 A;  3NZS A;  1NI2 A;  1P0R A;  2KWV B;  3VHT C;  4IWO A;  4BBN C;  2JT4 B;  4KV2 A;  1WFY A;  2N7D A;  3AI5 A;  4IM2 A;  3DCG A;  2ZPY A;  3B0A A;  4CO7 A;  3DVG Y;  4GSW A;  3V62 A;  2HJ8 A;  2KDB A;  5C23 A;  1UD7 A;  3H6N A;  4AUQ C;  1PQS A;  2L00 B;  3EFU A;  3ZO5 B;  1YX6 B;  3U7D A;  3PRM B;  2W9N A;  2REX A;  2CHW A;  2K25 A;  3PT2 B;  3T9L A;  1E90 A;  1KLV A;  2AL3 A;  4HXD A;  1FXT B;  2L0T A;  2KMC A;  2VRR B;  1EUV B;  5DPR A;  2KC2 A;  2LVQ A;  2BYE A;  1I35 A;  1WMH B;  2NBV B;  2LD9 A;  1SGH A;  2PJH A;  2DZI A;  2GBK A;  3ZNI D;  2KQS A;  4FLH A;  4JGH B;  1WRD B;  4BOS C;  1Q5W B;  4MJS A;  2O6V A;  3AU5 A;  4MH0 E;  3SD5 A;  5EDS A;  2ZZP B;  4IW0 A;  4EEW A;  3RUI B;  2LGX A;  4FJV B;  3UGB B;  5D94 A;  3WAL A;  2GBJ A;  4BFR A;  4HLE A;  4K7S A;  3JW0 X;  2LAS A;  1NBF C;  1OEY J;  2MCN B;  3T8M A;  1P98 A;  2DYM A;  2AWT A;  4OVV A;  3OLM D;  5J17 A;  4HJK A;  3ZNH B;  4W9D A;  4NY0 A;  2LUE A;  3SDL C;  4DHJ B;  3N32 A;  1V2Y A;  5AZG A;  4KSL C;  1UBI A;  2LZ6 A;  4HPM B;  5D2M B;  3PZD A;  3HM3 A;  3IHP C;  2ASQ A;  2XBB C;  4W9J A;  1WGG A;  2JXX A;  3DDC B;  4IC7 B;  4MGY E;  3KUZ A;  2KVR A;  4WJO A;  1WGR A;  3WAM A;  4WJQ A;  5L83 A;  2L3Z A;  1F9J A;  1Z2M A;  2MP2 B;  1V9J A;  3APF A;  3TBL D;  3ZLZ A;  2MWS B;  3QWZ B;  1U4A A;  4HK2 A;  2A4Z A;  3Q3F A;  3TJP A;  5HKH A;  2KZR A;  3N30 A;  1E8Z A;  5G2N A;  3A33 B;  1OGW A;  2PE6 B;  1WY8 A;  1HE8 A;  4GU2 A;  1H4R A;  1WJ6 A;  2N9E B;  2K8C A;  4II2 B;  3BIN A;  1R4M I;  2ZVO A;  1K8R B;  3DOW A;  4GDK B;  4ASW C;  2IO0 B;  3EEC A;  3KUD B;  1WX7 A;  4NJ6 A;  3RZF A;  1WXS A;  4GB9 A;  2MBB B;  2MBQ A;  2LRU A;  3QQ8 B;  1LQB A;  1WMH A;  3ZIM A;  2RGF A;  4HWI B;  4XX5 A;  2D10 A;  5D7G A;  4BVU C;  1LM8 B;  3A4R A;  4AP4 C;  5C1Z A;  2JZZ A;  2MSE D;  4IG7 B;  3I3T B;  4I6L B;  4BKS A;  2AEH A;  3R3M A;  4ZRI A;  4BBN F;  3DBR I;  3IG3 A;  4MGZ E;  1OTR B;  4DWF A;  3L08 A;  2WX1 A;  2G45 B;  4DK5 A;  4GDL A;  3LJ3 A;  4F1S A;  4K7W A;  1TZ1 A;  2FCS A;  4MSM B;  5KHO A;  3CF6 E;  3A4S C;  2BGF A;  2C7M B;  2UYZ B;  2XEW A;  3IVF A;  1WX9 A;  1R4N I;  3HK0 A;  3A9J A;  5CHV C;  1E5W A;  3PRE A;  4GOC A;  1WXV A;  2LRW A;  1S1Q B;  2JPH A;  4XZ4 A;  3WA0 A;  4ANV A;  1V49 A;  3V6E B;  3C0R B;  2FAZ A;  2KOX A;  4B9K A;  3TCA A;  4IM3 A;  2BKF A;  1GG3 A;  2KDE B;  3ZNG C;  2KLC A;  3QK0 A;  4EOY A;  4K7U A;  2NCN A;  5DPS A;  4CYE A;  1WIA A;  2KHW B;  3B08 A;  1GJZ A;  5CTR C;  2LGY A;  2HD5 B;  1UEL A;  2M1M A;  2KC1 A;  2LGD A;  2KTF A;  4MJS B;  2O6V B;  2DYO A;  4OVU A;  3VFK A;  2KQ7 A;  1I42 A;  3PS6 A;  4F7Z A;  4WAA A;  1H8C A;  2MBE A;  3TL5 A;  2FCN A;  2BPS A;  1E7U A;  4ICU A;  4ANW A;  4NNJ B;  2K8H A;  1T0Y A;  2IY1 B;  2M4N A;  3ZUN A;  2L76 A;  2DEN B;  2J0J A;  3M62 B;  3OAW A;  3IBE A;  5G55 A;  3PLV A;  4W9L A;  2JY6 A;  1V86 A;  4ANU A;  4MM3 A;  1E8Y A;  4RMA A;  4ZRJ A;  2FUH B;  1VCB A;  2D11 A;  1QZE A;  2MLB A;  4W9K A;  1UZX B;  3IFW B;  1YQB A;  2BWE S;  4JQW C;  1S3S G;  2JRH A;  1ZKH A;  2MX2 A;  2I1K A;  3HHM A;  3QA8 A;  2DZK A;  3KYC D;  4EZL A;  1MG8 A;  3N3K B;  2LI5 A;  3PRP B;  2MRP A;  2C7N B;  2KWC A;  3DBL I;  1WF9 A;  2LWP A;  4X57 B;  3SHQ A;  5JH5 C;  4PYU A;  2C7H A;  4NQK E;  3KUC B;  5E6P A;  2YLM A;  1WR6 E;  2WYQ A;  1NDD A;  2N4F A;  2ZEQ A;  1E7V A;  4DHJ D;  4KDI C;  1WH3 A;  2EKE C;  2RSU A;  2ZVN A;  1BT0 A;  3JSV A;  3ZTD A;  3QIJ A;  3V60 A;  1OQY A;  2BWF A;  4G3X B;  4G11 A;  4NPN A;  1LXD A;  4GN1 A;  4HVB A;  3U30 A;  1RFA A;  3DPD A;  4JIO U;  3MHS D;  5AZH A;  3TIX A;  1WI0 A;  2IBI B;  1WR1 A;  2Z0E B;  2NPT B;  3VUY A;  2V1Y A;  4HDO A;  1UGM A;  2HE7 A;  1V5T A;  4GDL B;  4GXB A;  4IM0 A;  4FAD A;  2JUO A;  3ZVV A;  3UIP B;  2N1V A;  4PS3 A;  1EO6 A;  4W9F A;  3WAO A;  5CHF A;  4DDG D;  1A5R A;  2FCM A;  3A9J B;  4ZYN A;  1WE6 A;  3X23 A;  1Q1O A;  3VTV A;  4AJY B;  3WAP A;  2IYD B;  4LJO B;  4RM9 A;  2MBH A;  1X1M A;  4HCN B;  2L8J A;  3DVN U;  1YD8 U;  1SE9 A;  3HIZ A;  3RZW C;  3WIM A;  3PHX B;  2D07 B;  2DYB A;  3ZW3 A;  1WGY A;  2IZV B;  2KNB A;  2RD0 A;  5FR6 A;  3ZKJ C;  2L0F A;  3QCA A;  1WZ3 A;  2CS4 A;  3KYD D;  4E71 A;  5TR5 A;  2CU1 A;  2PE9 A;  4KIK A;  3NZU A;  4W9G A;  2KX0 A;  2N9X A;  4FHJ A;  3QX1 A;  2BYV E;  3ZTC A;  2BYF A;  2JF5 A;  2KFK A;  3VAW A;  1YIW A;  3VDZ A;  3CST A;  3A1Q A;  1SIF A;  2MA9 B;  4NQL B;  1C3T A;  2NBU A;  4K81 A;  4HDQ A;  2KKC A;  3DVN V;  2LVP A;  3RCZ A;  3GOE A;  4PS7 A;  3DBH I;  1Q0W B;  3NOB A;  4HCP B;  3RT3 B;  2LXA A;  5BO4 B; 
#chains in the Genus database with same CATH topology
 3QAR A;  3PPA A;  4FA6 A;  2AQ1 B;  1TKG A;  4PT5 A;  3ZRC A;  2KXJ A;  1V97 A;  1E8W A;  1JCK B;  1VJK A;  4I6P A;  2JWU A;  2IY0 B;  1EF1 A;  4HPL B;  3APC A;  1JWM D;  2JZ3 B;  2N1W A;  2JRI B;  4OVZ A;  3GZN B;  3K9O B;  2YEP F;  2XNA C;  1TKE A;  1SSN A;  2KJH B;  1WX8 A;  1CK1 A;  2KVZ A;  4OW0 A;  3VTU A;  2CR5 A;  2PKO A;  2RR9 A;  3AMZ A;  5BMI A;  1P9D U;  2GBM A;  4XC2 A;  2GRI A;  2N7J A;  4LDT B;  2VZK D;  5IA7 A;  4ICV A;  2HTH A;  2K8B A;  4J6I A;  4BOZ B;  2KFK B;  1GB4 A;  5AEK B;  3H1U A;  1WJ4 A;  3A1Q B;  3K9P B;  1JAL A;  1K53 A;  1ZW7 A;  2JYT A;  1HEZ E;  3A9K B;  2NMQ A;  1WM3 A;  3VH4 B;  4WWN A;  2E3T A;  1QLB B;  5LXH A;  3V3X A;  2H88 B;  2IO2 B;  2J42 A;  1V81 A;  1IGD A;  1MI0 A;  1GUA B;  3V6C B;  2JVC A;  3AU4 A;  1ZXI A;  4FHK A;  4DHZ B;  2L83 A;  2G4D B;  1SB3 C;  3TUO A;  2LXC A;  3NVW A;  4S17 A;  4FBJ B;  1QOF A;  4RGO S;  2Y5B B;  2ZNV C;  2ZPN A;  3GS2 A;  3VUX A;  4N6E B;  1R7S A;  4K3B A;  1XLQ A;  2W3S A;  1WGH A;  2CKH B;  5IAA C;  3WAN A;  1UF0 A;  2ZCC A;  4MEM A;  4C7Y A;  3ALB A;  4B95 A;  2R2Q A;  1YOV B;  1N62 A;  4XDD A;  4WAF A;  2GBN A;  3AM9 A;  3TEZ A;  2WXI A;  4ITK A;  1PGA A;  3ZRF A;  1XD3 B;  3AEE B;  2Y5C A;  4W9E A;  3AEA B;  5C2T B;  2KAJ A;  4II3 B;  2YVC A;  3KH0 A;  5KHQ A;  3UF8 A;  2NR2 A;  1L0Y B;  2DHZ A;  4AQ7 A;  5E6N A;  3RNC C;  2RPQ A;  3R7Q A;  5AUI A;  4HJG E;  3U4E G;  2R2O A;  2C9W B;  5JHB A;  1UGJ A;  1MHX A;  1WXA A;  3N1X C;  4ZHO A;  4E3C A;  1WRI A;  3W1S C;  4ZRQ A;  3AEB B;  2ZW0 A;  3QAQ A;  1J8C A;  1HA5 A;  2J0M A;  2C60 A;  2M0X A;  2GMI C;  2MQJ A;  3HM6 X;  3B2F A;  2ZJD A;  4GIV A;  4JLC A;  4AOF A;  3AUL A;  4EZJ A;  1KH0 A;  1D3Z A;  4FUL A;  3EA6 A;  1YMH E;  3BVM A;  4EZK A;  4LCD E;  2CHZ A;  1ESF A;  1NI3 A;  4YTP B;  3OWE B;  3DBL B;  2INP E;  4S0R A;  1NI2 A;  1P0R A;  4IWO A;  4KV2 A;  4LK0 M;  1YJI A;  3WCQ A;  1DOI A;  3B0A A;  4GSW A;  4TMA B;  3U7D A;  3PRM B;  2W9N A;  1P7E A;  2REX A;  2V9H A;  1KLV A;  2KN4 A;  1FXT B;  1XO3 A;  4KGS A;  2LVQ A;  4KKI A;  2LD9 A;  2PJH A;  2DZI A;  2GBK A;  2H89 B;  4JGH B;  1WRD B;  3AU5 A;  5IOI A;  2LGX A;  1BXT A;  4BFR A;  2GBJ A;  1KF6 B;  4HLE A;  1NYR A;  5G5H A;  1OEY J;  3MHZ A;  2DYM A;  1NYQ A;  5J17 A;  1GPX A;  1V2Y A;  2LZ6 A;  2PTL A;  1XXG A;  5EE9 A;  2ACZ B;  2L3Z A;  3AB5 A;  3RNB C;  1J7A A;  1V9J A;  3RMK C;  1U4A A;  2A4Z A;  3TJP A;  2KZR A;  2V0G A;  3SFE B;  4H2A A;  5IO9 A;  1H4R A;  1WJ6 A;  2N9E B;  3DBR B;  3OG5 A;  2K8C A;  4II2 B;  1XLP A;  2ZVO A;  5T8I A;  3KUD B;  4IOI E;  5FR3 A;  1WXS A;  2MBB B;  3N20 C;  3VRA B;  1WWT A;  2NTT A;  2D10 A;  1HZ6 A;  1I4H A;  2W55 A;  3A4R A;  5C1Z A;  4P1C C;  2MSE D;  2BS3 B;  1E0Z A;  2EEL A;  2W54 A;  4JX1 C;  1NEN B;  2J52 A;  4F1S A;  4MSM B;  5KHO A;  1FMA D;  1GOZ A;  1R4N I;  4GOC A;  1WXV A;  1S1Q B;  2MJD A;  3RI7 C;  3AEG B;  4B9K A;  3URY A;  3Q8A A;  1XF5 L;  3TCA A;  4IM3 A;  1LO5 D;  3ZNG C;  2KLC A;  3KQ4 A;  1WIA A;  2PLP A;  2KHW B;  1GJZ A;  3NVV A;  2KTF A;  3RFZ B;  4L23 A;  3I57 A;  3IT6 B;  3VFK A;  1I42 A;  3PS6 A;  4WAA A;  4KGR A;  2MBE A;  2K8H A;  4YTM B;  1N60 A;  1TY2 A;  1DOX A;  5G55 A;  4W9L A;  4RF0 A;  1E6E B;  3E56 A;  1MJD A;  4JWU C;  5HG2 A;  4O1N A;  1YN3 A;  1UZX B;  4D2K A;  3AE6 B;  1ACC A;  1PYW D;  2DZK A;  1B9R A;  1MG8 A;  2LI5 A;  3PRP B;  3SEB A;  2LUM A;  3DBL I;  2KWC A;  1EU4 A;  4A8X C;  1Y56 A;  1JRO A;  4PYU A;  3FKY A;  4NQK E;  4DHJ D;  2VZK B;  1DGJ A;  3JSV A;  3V60 A;  4ZRP A;  4G11 A;  5TSS A;  3U30 A;  5AZH A;  1WI0 A;  1XCT L;  2Z0E B;  2NPT B;  2V1Y A;  5E6J A;  3SR6 A;  3WAO A;  1A5R A;  4RGM A;  2ZW1 A;  4ZYN A;  2W3R A;  5EE3 A;  2BS2 B;  2MBH A;  4YSX B;  3DVN U;  5G5G A;  5LNK 1;  2DYB A;  2KNB A;  3QCA A;  2CS4 A;  4W9G A;  4FHJ A;  2JF5 A;  2V4I B;  3VAW A;  2IND C;  2FBW B;  3CST A;  4WUR A;  2KKC A;  1HZ5 A;  1SEB D;  3AE4 B;  4R3D A;  4HKQ A;  4DXG A;  3GOE A;  2I38 A;  2BVC A;  3P63 A;  3NOB A;  1CJE A;  2KJ6 A;  1OEY A;  3Q6B A;  1VZ7 A;  3APD A;  4FJY A;  1RWS A;  1XCQ L;  2QC8 A;  4K1R B;  4MH8 A;  3MC0 B;  2PVG C;  4M0W A;  3LYY A;  2N9P C;  4ANX A;  2WNM A;  5L95 C;  4LNK A;  1YQ3 B;  3ML9 A;  3X0W A;  3JSV B;  1YJ1 A;  2JQR B;  3L10 B;  1FFV A;  2KO3 A;  3CSF A;  3TMP B;  2C5L C;  4LJP B;  5GMV A;  2KTR B;  4P6V F;  3ONS A;  3SU8 X;  2RDH A;  1D6E C;  3M3J A;  2FID A;  4W9H A;  1I4X A;  3PVL A;  4TQ1 A;  4US8 A;  2WDT B;  1AAR A;  3E9S A;  4RGN A;  3L54 A;  3NY5 A;  3VQI A;  4DHZ E;  4FXC A;  2Y5P A;  1P3Q U;  3KVF B;  2I1J A;  4YWG G;  5BYQ A;  1J7C A;  1FRR A;  2W82 A;  3KLS X;  3PV1 A;  4KVG B;  3QC8 B;  4OZB A;  2WX0 A;  3ZJV A;  2GOW A;  5D6J B;  4ZDV A;  1GC7 A;  1OQQ A;  2KWU B;  2DX5 B;  3JVZ X;  4EFO A;  1EM7 A;  3ABV B;  5AZF A;  1YN4 A;  1G6J A;  2WXJ A;  3S2A A;  1DOY A;  2D3A A;  4WJN A;  4N59 A;  1JWS D;  1MFW A;  3W5V B;  2N7E A;  3Q3M C;  4E74 A;  2CU3 A;  3UIN B;  1D5Z C;  5DPW A;  4M0W B;  4MT5 A;  1RLF A;  2M8S A;  2INN E;  3N1Y C;  4KZC A;  1TBE A;  2N9L A;  3KW5 B;  3RNA C;  3BVG A;  1FFU A;  1KFY B;  3AED B;  2KX3 A;  3AXC A;  3M63 B;  2O2V B;  2KFJ A;  4KDL B;  3ENE A;  3TSS A;  2DAJ A;  4B6W A;  3A9K A;  4A20 A;  3PRZ A;  3EC8 A;  4A90 A;  2L7R A;  2KAN A;  2JZP A;  4MDK E;  2D5G A;  2X38 A;  1M94 A;  1AYF A;  1EU3 A;  4C4V A;  1OFF A;  1SJH D;  1YX5 B;  1SIJ A;  1K52 A;  3AE8 B;  3LDZ E;  2UWQ A;  1ZXH A;  1ZGU B;  3ECI A;  1Q10 A;  1WXM A;  3D32 A;  1I7H A;  1N6Z A;  3R2I A;  4KZ0 A;  2J7Q B;  4JPS A;  4C80 A;  2QIL A;  4NJ7 A;  1K51 A;  2IO3 B;  1ENF A;  2DZJ A;  4WWP A;  1TJE A;  2MP2 A;  3TEY A;  1V5O A;  1TKY A;  2PEA A;  2L05 A;  4KKJ A;  1XT9 B;  1TGZ B;  1C77 A;  2G4S A;  2BYT A;  2ONQ A;  5J18 A;  2K0P A;  5DCN A;  3QHT A;  5JZE B;  4M8M A;  5CX3 A;  4BBN C;  3NG0 A;  1XLO A;  1WFY A;  3AI5 A;  4IM2 A;  2ZPY A;  1TIF A;  1C9F A;  3V62 A;  2HJ8 A;  4XGA B;  1N5X A;  3ZO5 B;  1PGB A;  1IGC A;  2CHW A;  3T9L A;  1E90 A;  2AL3 A;  2L32 A;  2L0T A;  4C4V B;  2KC2 A;  1I35 A;  1SGH A;  2Z8L A;  4YSZ B;  1SBB B;  3MJ5 A;  3ZNI D;  4FLH A;  1ZUD 2;  4BOS C;  4M00 A;  2QJL A;  4EEW A;  1T5X D;  3RUI B;  4FJV B;  3UGB B;  3WAL A;  1A70 A;  2N0S B;  1D5X C;  4HRO A;  4K7S A;  3T8M A;  2AWT A;  4OVV A;  3OLM D;  4HJK A;  3ZNH B;  4NY0 A;  2LUE A;  4DHJ B;  3P4S B;  5AZG A;  1UBI A;  2BBC A;  3NVY A;  1WGG A;  3DDC B;  4IC7 B;  4MGY E;  2OHF A;  4WJO A;  1C78 A;  2MP2 B;  3APF A;  3ZLZ A;  3QWZ B;  3PZ8 A;  3N30 A;  1E8Z A;  5G2N A;  4NZL B;  2WXG A;  4GU2 A;  2WDV B;  2IO0 B;  3ZJT A;  3IAM 1;  1C4P A;  4JE3 B;  4RFB A;  2DBY A;  4GB9 A;  2QSD A;  2MBQ A;  1R4N B;  4HWI B;  2MHJ A;  4BVU C;  2WDR B;  3Q3N C;  4AP4 C;  2R61 A;  3VR8 B;  2JZZ A;  5H92 C;  4ZRI A;  2LFI A;  1OTR B;  3KWV A;  4LNN A;  2IGG A;  4GDL A;  1XEE A;  1TZ1 A;  2OED A;  3A4S C;  3IVF A;  2BB6 A;  1KLG D;  3KWL A;  5FK9 C;  3AH7 A;  4P1B C;  5GXG B;  1E5W A;  3DHG C;  1V49 A;  3C0R B;  2LEK A;  2BKF A;  3DHI C;  2KAC A;  3Q2A C;  1YJJ A;  4K7U A;  4LTU A;  4DXF A;  1JWA D;  5CTR C;  2PVO D;  2KC1 A;  4OVU A;  2I2Y A;  4KGT A;  2K22 A;  2Q5W D;  4M01 A;  2FCN A;  1MPE A;  2G9H D;  3ZUN A;  4HKZ E;  2DEN B;  1VRA B;  2J0J A;  1SF0 A;  3IBE A;  1OQR A;  5AUK A;  2UU7 A;  1N63 A;  2MJE A;  4W9K A;  3IFW B;  4M02 A;  2BWE S;  4OHJ A;  5BYS A;  1ZKH A;  5BMG A;  3KYC D;  1RM6 C;  2MRP A;  4Q2J A;  1WF9 A;  2LWP A;  3SHQ A;  5JH5 C;  1F0Z A;  1NDD A;  5HHD G;  3ZTD A;  1OQY A;  4GN1 A;  3DPD A;  4JIO U;  3MHS D;  2DLB A;  3CWI A;  3IXS A;  4B0E A;  4GDL B;  4FAD A;  3UIP B;  1EO6 A;  3NJT A;  4DDG D;  4DQO C;  1WE6 A;  3X23 A;  3VTV A;  3FIL A;  1X1M A;  4C00 A;  1YD8 U;  2QEJ C;  2WXQ A;  2WS3 B;  3ZW3 A;  3T3N A;  5FR6 A;  1UNS A;  2L0F A;  2K9X A;  1LGR A;  1UWX A;  3KYD D;  2CU1 A;  4KIK A;  1N61 A;  3NZU A;  1J7B A;  1MHH E;  1ZOY B;  3ZTC A;  1SE3 A;  1FXI A;  3ZYY X;  2MA9 B;  1F2R I;  3RCZ A;  3DBH I;  2KMM A;  2RDG A;  3RT3 B;  1L4D B;  1TTN A;  2LJI A;  4FJZ A;  3OJ4 B;  2NPT A;  3H7P A;  2EMT A;  1T0S C;  5LLI A;  3EHV A;  4I6N B;  2ICI A;  1CZP A;  1WJU A;  4JWS C;  3ZJU A;  3AE3 B;  2AQ3 B;  2O6V D;  3Q3J A;  4MSQ B;  4HEA 1;  1WYG A;  5IKC M;  1TS4 A;  2LJ5 A;  3C8Y A;  4NAW A;  3P1M A;  2GBR A;  2AX5 A;  3DVG X;  1PDX A;  2YEP B;  1P7F A;  2LGI A;  5IN7 A;  3TEX A;  3OJ3 A;  1Y8R C;  1WGD A;  1EWY C;  4TSS A;  3UQB A;  2FE8 A;  4BKG A;  4ZRK A;  2WWZ A;  4LDT D;  2B76 B;  3UQA A;  4XDC A;  2RMM A;  1BML C;  5JXV A;  2JYE A;  3FIL B;  1ZDX A;  4RF1 A;  4YL8 A;  4XE0 A;  2KDI A;  1TY0 A;  1NVI D;  3B1L X;  2WXK A;  3BYY B;  1KOT A;  4KIK B;  3CMM B;  2IDY A;  2WXH A;  4L1B A;  1I4Q A;  4A3P A;  1Z5S B;  1HQR D;  3H9D A;  2BQQ A;  2JSV X;  3R7R A;  1XLN A;  2A5U A;  3H7P B;  3U7Z A;  2NS5 A;  1EWC A;  3PSE B;  1QOB A;  2J53 A;  2M17 A;  4RM8 A;  1HXY D;  2D3B A;  2KTR A;  2MEK A;  4P7I A;  2D2Q A;  3VXW A;  2IGD A;  3Q8C A;  2OOB B;  2CJN A;  3ML8 A;  2J4X A;  2CJO A;  2NBW B;  4NAW B;  3U8Z A;  4EUT A;  2EMS A;  2SEB D;  2LVO A;  4CHK A;  3L17 A;  2OJW A;  3PHW B;  3O65 B;  4N58 A;  3L0W B;  2K39 A;  3EGR A;  2B3A A;  1V6E A;  1R4M B;  4K3C A;  1ET9 A;  2AL6 A;  3M95 A;  4AS1 A;  1V1O A;  4DDI D;  4ZYS A;  1VD2 A;  1QF6 A;  4LNF A;  4PS8 A;  3AN1 A;  4MGK E;  3AEF B;  2BTE A;  1J0G A;  3LXF A;  2KN5 A;  3AE7 B;  3BY4 B;  2WGS A;  3P4P B;  1JRU A;  3VH3 B;  3Q8E A;  4C56 C;  1WJN A;  2ON8 A;  3JYU A;  3VUW A;  1VLB A;  1T0R C;  2CHX A;  5DPT A;  1JWU D;  3W2D A;  2V3P A;  4G50 A;  1RRB A;  2HJ1 A;  3BYT B;  4WQO B;  4YTN B;  2Y3A A;  4A9A A;  1WXQ A;  2BW2 A;  2DAF A;  4PK1 A;  3ZNZ B;  3HVZ A;  1AW7 A;  2O2V A;  4ZHP A;  1E9M A;  4M8N A;  1D4B A;  1XQQ A;  2WU2 B;  4GMV A;  2ZCB A;  2BKR B;  4RGT A;  2KDF B;  5E6O A;  3BZD B;  4GDK A;  1FXA A;  4TV3 A;  1L6V A;  3O13 A;  1WZ0 A;  3I9V 1;  5BYR A;  1C4A A;  1L2N A;  1MG4 A;  1MVK A;  2LHE A;  3DBS A;  2PMV A;  1C1Y B;  1EF5 A;  4QAY A;  1HTO A;  1LFD A;  2HTM E;  3L16 A;  3VHT C;  1I4P A;  1RYJ A;  1PGX A;  4CO7 A;  4ARI A;  1YN5 A;  4WWM A;  2RDB C;  4AUQ C;  1PQS A;  1SJE D;  2K25 A;  4HXD A;  1E7P B;  3P4R B;  2VRR B;  2WXF A;  2BYE A;  2DNF A;  1WMH B;  2RPV A;  5HI1 A;  3R8B A;  1DYQ A;  2INC C;  2O6V A;  4MH0 E;  3SD5 A;  2ZZP B;  3TEW A;  5D94 A;  3JW0 X;  2LAS A;  1P98 A;  3NVZ A;  4W9D A;  3AV8 A;  4HPM B;  5D2M B;  1FIQ A;  3IHP C;  4W9J A;  2JXX A;  2KVR A;  4WJQ A;  1L0V B;  5I4D A;  1Z2M A;  4HK2 A;  5HKH A;  4HRS A;  1OGW A;  3RNG C;  2PE6 B;  1HE8 A;  3UI3 A;  3BIN A;  1R4M I;  2KYW A;  2MJ3 A;  4GDK B;  4BAX A;  3EEC A;  4NJ6 A;  3AE2 B;  3DWM A;  3QQ8 B;  5H8Y E;  4XX5 A;  2PIA A;  3NS1 A;  4IG7 B;  1ZDV A;  4I6L B;  2AEH A;  4BBN F;  3LB8 C;  4DWF A;  2WX1 A;  2G45 B;  4DK5 A;  4UDU C;  4K7W A;  1PFD A;  2BGF A;  2C7M B;  2XEW A;  3HK0 A;  3A9J A;  5CHV C;  4NAM A;  3PRE A;  2LGS A;  2JPH A;  2LRW A;  4XZ4 A;  3V6E B;  2KOX A;  1GG3 A;  2FUG 1;  2KDE B;  2L1A A;  2WXM A;  3MC9 A;  4LNI A;  4EOY A;  2NCN A;  4CYE A;  1E10 A;  3B08 A;  1UEL A;  2LGD A;  2O6V B;  2WLB A;  3SFD B;  2KQ7 A;  3BII D;  4WIP A;  4F7Z A;  4ARC A;  3AE9 B;  4ICU A;  4ANW A;  1YQ4 B;  1T0Y A;  2WXR A;  2IY1 B;  2M4N A;  2BT6 A;  3OAW A;  5IP4 D;  1ZE3 D;  2V3N A;  1L6U A;  1V86 A;  4WQM A;  4MM3 A;  2LHD A;  4L2Y A;  1E8Y A;  4RMA A;  4ZRJ A;  2FUH B;  1VCB A;  2D11 A;  1TT5 B;  3Q69 A;  4JQW C;  3MC8 A;  2JRH A;  3MFG A;  3W9C B;  1PUT A;  2MX2 A;  3Q14 C;  3R2T A;  1FNW A;  4ACF A;  3AE5 B;  1FM0 D;  4CQN A;  2C7N B;  4X57 B;  2YLM A;  2WYQ A;  2ZEQ A;  1E7V A;  2GI9 A;  1WH3 A;  2ZVN A;  1BT0 A;  3QIJ A;  4G3X B;  4HVB A;  4US9 A;  1FPY A;  4BZA A;  1WR1 A;  4YXD B;  3VUY A;  4HDO A;  1UGM A;  2HE7 A;  1V5T A;  4GXB A;  2JUO A;  3ZVV A;  1JML A;  2N1V A;  4PS3 A;  4W9F A;  1JWB D;  3A9J B;  3BK2 A;  2WU5 B;  1Q1O A;  2WXN A;  4AJY B;  3IT4 B;  3WAP A;  1UUP A;  4LJO B;  4RM9 A;  4XYC A;  1TZO A;  3RNE C;  4HCN B;  3GE3 C;  2G1E A;  2L8J A;  3HIZ A;  3RZW C;  2D07 B;  1JW9 D;  2DWQ A;  2WXO A;  3U2S C;  2RD0 A;  1FRD A;  3DBH B;  4B0M A;  1WZ3 A;  5TR5 A;  1WGK A;  4EE2 A;  4RH6 A;  2IPK D;  2KX0 A;  2N9X A;  2NTS A;  2TSS A;  1YIW A;  3VDZ A;  1SIF A;  2QMT A;  4NQL B;  1C3T A;  2NBU A;  4HDQ A;  3DVN V;  4LLG M;  2LXA A;  5BO4 B;  1SE2 A;  4MM3 B;  1V80 A;  1UBQ A;  1FNV A;  5D3I B;  2WQY B;  3DQV A;  2FNJ B;  1L7Y A;  2AYO B;  3N1Z C;  4A6Q A;  3RN9 C;  4YT0 B;  4FN2 A;  2KMA A;  4JL9 A;  4DBG A;  5BMH A;  4F8C B;  1KRH A;  1TYG B;  3VVW B;  1WYW B;  3RYT A;  1WE7 A;  2MH7 A;  2WDQ B;  1KTK A;  3UIO B;  4KX6 B;  4XWW A;  2Z59 B;  1ET6 A;  4GGQ A;  4ZOH C;  1JRP A;  1E8X A;  1ROE A;  2BS4 B;  4KSK C;  2IO1 B;  3ZDT A;  1ISN A;  3GZN I;  1I4G A;  1KJT A;  3ZDM C;  3HUI A;  4MGI E;  1TS5 A;  3GP7 A;  2Z0D B;  5LXI B;  2SAK A;  3VR9 B;  4MEL A;  2OJR A;  4TUU A;  3PZ7 A;  4IDI A;  3RD2 A;  1QIL A;  4J3O D;  3V61 A;  1P1A A;  4REZ A;  1TS2 A;  1SE4 A;  3ZXR A;  2KK8 A;  3RPF C;  4BKS D;  4HPP A;  2MBO A;  3V05 A;  4EKU A;  1IP9 A;  4G0N B;  1B1Z A;  1T0Q C;  1FO4 A;  2QHO A;  4W9C A;  2JU6 X;  2WXP A;  2M0A A;  3VRB B;  1IPG A;  2XK5 A;  4WJP A;  2KLG A;  3U52 E;  2K5P A;  1QOG A;  2GLS A;  3MTN B;  3IAS 1;  3AE1 B;  2K1F A;  4TKN A;  4W9I A;  4BKT A;  2GB1 A;  1QQR A;  1T3Q A;  2JX5 A;  3NHE B;  3R66 C;  4IUM B;  5J2R A;  4OZA A;  4P16 A;  2V3S A;  3BVZ A;  4IWP A;  3RUL A;  2D3G A;  1GC6 A;  4YSY B;  2V4L A;  2WP9 B;  2M56 B;  1KM7 A;  1GAQ B;  2JWZ A;  1L5P A;  3PTF C;  3RNF C;  2PPH A;  2X8X X;  2J0K A;  3AEC B;  3PGE A;  1L4Z B;  4RNA A;  3B9J A;  4AJW A;  3MJW A;  1C76 A;  4A55 A;  2KD0 A;  1QOA A;  3Q3O C;  3N9Y C;  4IWQ A;  3GE8 C;  5JHA A;  2FCQ A;  3L13 A;  1AWD A;  3H7S A;  1BUI C;  3QJZ A;  2BF8 B;  4A3O A;  3PLU A;  2E6X A;  2NVU I;  1RAX A;  4URK A;  2L52 A;  1IYF A;  1J19 A;  2MW5 A;  2XK5 B;  4AWJ A;  2KJR A;  1FCL A;  1FD6 A;  3HRD D;  2KWD A;  3P2B A;  4RCO A;  4PYZ A;  3W1S A;  1VZ6 A;  2G3Q B;  1IBX A;  3VTW A;  1V1P A;  2IGH A;  4N9F 4;  1GNU A;  2FIF A;  2ZNV B;  1WM2 A;  2KT7 A;  3I63 C;  2K3U A;  4LNO A;  1V8C A;  4WWO A;  5CHW A;  1FNU A;  3NS8 A;  1CMX B;  1N5W A;  4TQ0 A;  1QT9 A;  2DZM A;  2AQ2 B;  3ZQ4 A;  2K6Q A;  1UH6 A;  3W1Y A;  3Q8B A;  2K6D B;  3NRZ A;  4DXA B;  4USA A;  3W5U B;  3NZS A;  2KWV B;  1ZP0 B;  1ZPS A;  2JT4 B;  1L0X B;  2N7D A;  2WHI A;  3DCG A;  2EKI A;  2M19 A;  3DVG Y;  5MPO A;  2KDB A;  5C23 A;  1UD7 A;  3H6N A;  1VZ8 A;  3EFU A;  2L00 B;  1YX6 B;  3GB1 A;  3L4P A;  3PT2 B;  3HVD A;  3J9C A;  2IJ0 A;  2KMC A;  1EUV B;  5DPR A;  2NBV B;  2KQS A;  1Q5W B;  4MJS A;  3B2G A;  5EDS A;  4IW0 A;  1QKZ A;  1T6B X;  4XWT A;  3Q8F A;  1NBF C;  2MCN B;  1FCC C;  3SDL C;  3N32 A;  2D3C A;  4KSL C;  3PZD A;  3HM3 A;  2ASQ A;  2XBB C;  1GB1 A;  1HTQ A;  3KUZ A;  1WGR A;  3WAM A;  3C19 A;  5L83 A;  1F9J A;  3TBL D;  2MWS B;  5EE0 A;  3BWU D;  3Q3F A;  1IBX B;  3A33 B;  3P42 A;  1I4R A;  1WY8 A;  1V1P B;  1M4V A;  1TS3 A;  3ZXV A;  1K8R B;  3DOW A;  4ASW C;  1WX7 A;  1D5M C;  3RZF A;  1FEH A;  3EFC A;  5C3J B;  2LRU A;  1LQB A;  1WMH A;  4MAC A;  3ZIM A;  1C79 A;  2RGF A;  5D7G A;  1LM8 B;  5EE1 A;  4BKS A;  3I3T B;  3R3M A;  3DBR I;  1F1H A;  3IG3 A;  4MGZ E;  1WSP A;  1STE A;  3L08 A;  3BK1 A;  3LJ3 A;  1F77 A;  1C4C A;  3NZ3 A;  2FCS A;  1AN8 A;  3CF6 E;  2UYZ B;  1WX9 A;  2N9K A;  3WA0 A;  4C7Z A;  4ANV A;  2FAZ A;  4IKG A;  1VDV A;  3QK0 A;  5DPS A;  1F2R C;  2LGY A;  2HD5 B;  1UWM A;  2M1M A;  5HFY A;  4MJS B;  1F52 A;  1KLU D;  3H8H A;  5D3D A;  2DYO A;  3T3O A;  3DWG C;  2VH2 A;  1H8C A;  2WXL A;  3TL5 A;  2BPS A;  1E7U A;  3FAH A;  1K50 A;  4NNJ B;  2L76 A;  3M62 B;  3NUH B;  3PLV A;  2JY6 A;  4ANU A;  3I5J C;  3EUB 2;  2QCZ A;  1QZE A;  2MLB A;  1YQB A;  1S3S G;  1VR9 A;  4OZC A;  3ETR A;  2I1K A;  1RFK A;  3HHM A;  3QA8 A;  4EZL A;  1SXT A;  3N3K B;  5FKA C;  2C7H A;  3DHH C;  3KUC B;  5E6P A;  1WR6 E;  2N4F A;  1NEK B;  4KDI C;  2EKE C;  2RSU A;  3FC4 A;  2BWF A;  4NPN A;  1LXD A;  1RFA A;  2JXT A;  3TIX A;  2IBI B;  2PW9 A;  1CQV A;  2KQ4 X;  4IM0 A;  3CIR B;  5CHF A;  4GLS C;  2KDM A;  2FCM A;  4NJC A;  2QIE B;  2IYD B;  1SE9 A;  3P4Q B;  3WIM A;  3PHX B;  4WH4 A;  1WGY A;  3MP9 A;  2IZV B;  2QDF A;  3ZKJ C;  1IUE A;  1YNT E;  2VH1 A;  4E71 A;  2PE9 A;  1JQ4 A;  2HDE A;  2BYV E;  3QX1 A;  2BYF A;  3PO0 A;  2KFK A;  2LMC A;  3A1Q A;  4K81 A;  2LVP A;  3ZGZ A;  2BB5 A;  4PS7 A;  1Q0W B;  4HCP B;  2XN9 C; 
#chains in the Genus database with same CATH homology
 1TTN A;  2KJ6 A;  3QAR A;  1V80 A;  1OEY A;  1UBQ A;  3OJ4 B;  3PPA A;  2NPT A;  4FJZ A;  4FA6 A;  3H7P A;  2EMT A;  3APD A;  5LLI A;  4FJY A;  3DQV A;  2FNJ B;  3EHV A;  4K1R B;  3ZRC A;  4I6N B;  1L7Y A;  2AYO B;  2KXJ A;  1WJU A;  1E8W A;  4FN2 A;  2KMA A;  4JL9 A;  2O6V D;  3Q3J A;  4I6P A;  4MSQ B;  4DBG A;  2IY0 B;  1EF1 A;  4HPL B;  3APC A;  4F8C B;  2LJ5 A;  2N9P C;  4ANX A;  4NAW A;  3VVW B;  2GBR A;  2JZ3 B;  1WYW B;  2N1W A;  2JRI B;  3DVG X;  5L95 C;  3K9O B;  3RYT A;  3ML9 A;  3X0W A;  1WE7 A;  3JSV B;  3OJ3 A;  1YJ1 A;  1Y8R C;  3UIO B;  3L10 B;  2KO3 A;  1WGD A;  2Z59 B;  4GGQ A;  1E8X A;  3CSF A;  2KJH B;  4KSK C;  3TMP B;  3UQB A;  4BKG A;  4ZRK A;  2C5L C;  2WWZ A;  1WX8 A;  4LJP B;  5GMV A;  4LDT D;  2IO1 B;  3ZDT A;  3VTU A;  1ISN A;  2CR5 A;  2KTR B;  3GZN I;  3ONS A;  3UQA A;  3SU8 X;  1KJT A;  3ZDM C;  2RR9 A;  4MGI E;  3M3J A;  2FID A;  4W9H A;  3PVL A;  2Z0D B;  4TQ1 A;  2WDT B;  1AAR A;  5LXI B;  4MEL A;  1P9D U;  2OJR A;  3L54 A;  3NY5 A;  2GBM A;  4TUU A;  4YL8 A;  3VQI A;  4DHZ E;  3RD2 A;  4XC2 A;  1P3Q U;  2KDI A;  3KVF B;  4LDT B;  2I1J A;  3V61 A;  3B1L X;  1P1A A;  5IA7 A;  3PV1 A;  4KVG B;  3QC8 B;  1KOT A;  2KK8 A;  2WX0 A;  3CMM B;  4KIK B;  4BKS D;  4ICV A;  2HTH A;  2K8B A;  2MBO A;  4J6I A;  2GOW A;  4BOZ B;  4EKU A;  1IP9 A;  5D6J B;  4ZDV A;  4G0N B;  1GC7 A;  2KWU B;  2KFK B;  2DX5 B;  3JVZ X;  4EFO A;  5AEK B;  3H1U A;  1WJ4 A;  3A1Q B;  3K9P B;  2QHO A;  4W9C A;  1ZW7 A;  4A3P A;  1Z5S B;  5AZF A;  1IPG A;  2XK5 A;  3A9K B;  2KLG A;  4WJP A;  1WM3 A;  3H9D A;  4WWN A;  3VH4 B;  1G6J A;  5LXH A;  3MTN B;  2IO2 B;  3R7R A;  3H7P B;  2A5U A;  2K1F A;  2NS5 A;  3S2A A;  4TKN A;  3PSE B;  4WJN A;  1V81 A;  2M17 A;  4RM8 A;  1GUA B;  4W9I A;  4BKT A;  2KTR A;  3V6C B;  3NHE B;  3R66 C;  4P7I A;  2D2Q A;  2JVC A;  2N7E A;  3AU4 A;  4FHK A;  4E74 A;  4IUM B;  3VXW A;  4DHZ B;  3UIN B;  2G4D B;  5DPW A;  2OOB B;  2LXC A;  3ML8 A;  4M0W B;  5J2R A;  4FBJ B;  2NBW B;  2V3S A;  4NAW B;  3U8Z A;  4EUT A;  2EMS A;  4IWP A;  2Y5B B;  2LVO A;  2ZNV C;  1RLF A;  2M8S A;  2ZPN A;  3RUL A;  3VUX A;  4CHK A;  2D3G A;  3L17 A;  1GC6 A;  2V4L A;  3PHW B;  3O65 B;  4KZC A;  1TBE A;  3KW5 B;  1KM7 A;  1WGH A;  2K39 A;  3L0W B;  2B3A A;  1V6E A;  2CKH B;  5IAA C;  2JWZ A;  3WAN A;  3PTF C;  2ZCC A;  4MEM A;  2AL6 A;  2KX3 A;  3M95 A;  2PPH A;  3ALB A;  4B95 A;  2R2Q A;  3AXC A;  3M63 B;  2O2V B;  2KFJ A;  4KDL B;  4DDI D;  3ENE A;  2DAJ A;  4B6W A;  1VD2 A;  2J0K A;  3PGE A;  2GBN A;  4PS8 A;  3A9K A;  4A20 A;  4AJW A;  3MJW A;  3PRZ A;  3EC8 A;  4MGK E;  2KD0 A;  1J0G A;  2L7R A;  1XD3 B;  2KN5 A;  3BY4 B;  3ZRF A;  2KAN A;  1JRU A;  4IWQ A;  4MDK E;  4W9E A;  3VH3 B;  1WJN A;  1M94 A;  5JHA A;  1YX5 B;  2FCQ A;  4II3 B;  3JYU A;  3L13 A;  2YVC A;  3KH0 A;  3VUW A;  5KHQ A;  3UF8 A;  2NR2 A;  2CHX A;  2DHZ A;  3H7S A;  5DPT A;  3LDZ E;  5E6N A;  3QJZ A;  2BF8 B;  4A3O A;  2UWQ A;  3PLU A;  4G50 A;  1RRB A;  1ZGU B;  1RAX A;  2NVU I;  2RPQ A;  4WQO B;  3R7Q A;  4URK A;  1IYF A;  3ECI A;  1WXM A;  3D32 A;  2R2O A;  1J19 A;  2MW5 A;  2XK5 B;  4AWJ A;  2KJR A;  2C9W B;  4KZ0 A;  2J7Q B;  2DAF A;  5JHB A;  1WXA A;  4NJ7 A;  2IO3 B;  3P2B A;  3ZNZ B;  4PYZ A;  2DZJ A;  4WWP A;  3W1S A;  2O2V A;  2MP2 A;  1V5O A;  4E3C A;  2G3Q B;  2PEA A;  4M8N A;  3W1S C;  2L05 A;  1XQQ A;  4GMV A;  2ZCB A;  3QAQ A;  3VTW A;  2BKR B;  1XT9 B;  4N9F 4;  1J8C A;  1GNU A;  1TGZ B;  2FIF A;  2C60 A;  1WM2 A;  2J0M A;  2M0X A;  2ZNV B;  2KDF B;  5E6O A;  2G4S A;  4GDK A;  4TV3 A;  2GMI C;  2MQJ A;  3HM6 X;  4WWO A;  2ZJD A;  5CHW A;  4GIV A;  1WZ0 A;  4JLC A;  4AOF A;  3NS8 A;  1CMX B;  1L2N A;  3AUL A;  4TQ0 A;  4EZJ A;  2DZM A;  5DCN A;  5J18 A;  1D3Z A;  3DBS A;  3QHT A;  5JZE B;  4FUL A;  2K6Q A;  1C1Y B;  1UH6 A;  4LCD E;  4EZK A;  3W1Y A;  1EF5 A;  2CHZ A;  2K6D B;  4M8M A;  4DXA B;  5CX3 A;  1LFD A;  3L16 A;  3NZS A;  1NI2 A;  1P0R A;  2KWV B;  3VHT C;  4IWO A;  4BBN C;  2JT4 B;  4KV2 A;  1WFY A;  2N7D A;  3AI5 A;  4IM2 A;  3DCG A;  2ZPY A;  3B0A A;  4CO7 A;  3DVG Y;  4GSW A;  3V62 A;  2HJ8 A;  2KDB A;  5C23 A;  1UD7 A;  3H6N A;  4AUQ C;  1PQS A;  2L00 B;  3EFU A;  3ZO5 B;  1YX6 B;  3U7D A;  3PRM B;  2W9N A;  2REX A;  2CHW A;  2K25 A;  3PT2 B;  3T9L A;  1E90 A;  1KLV A;  2AL3 A;  4HXD A;  1FXT B;  2L0T A;  2KMC A;  2VRR B;  1EUV B;  5DPR A;  2KC2 A;  2LVQ A;  2BYE A;  1I35 A;  1WMH B;  2NBV B;  2LD9 A;  1SGH A;  2PJH A;  2DZI A;  2GBK A;  3ZNI D;  2KQS A;  4FLH A;  4JGH B;  1WRD B;  4BOS C;  1Q5W B;  4MJS A;  2O6V A;  3AU5 A;  4MH0 E;  3SD5 A;  5EDS A;  2ZZP B;  4IW0 A;  4EEW A;  3RUI B;  2LGX A;  4FJV B;  3UGB B;  5D94 A;  3WAL A;  2GBJ A;  4BFR A;  4HLE A;  4K7S A;  3JW0 X;  2LAS A;  1NBF C;  1OEY J;  2MCN B;  3T8M A;  1P98 A;  2DYM A;  2AWT A;  4OVV A;  3OLM D;  5J17 A;  4HJK A;  3ZNH B;  4W9D A;  4NY0 A;  2LUE A;  3SDL C;  4DHJ B;  3N32 A;  1V2Y A;  5AZG A;  4KSL C;  1UBI A;  2LZ6 A;  4HPM B;  5D2M B;  3PZD A;  3HM3 A;  3IHP C;  2ASQ A;  2XBB C;  4W9J A;  1WGG A;  2JXX A;  3DDC B;  4IC7 B;  4MGY E;  3KUZ A;  2KVR A;  4WJO A;  1WGR A;  3WAM A;  4WJQ A;  5L83 A;  2L3Z A;  1F9J A;  1Z2M A;  2MP2 B;  1V9J A;  3APF A;  3TBL D;  3ZLZ A;  2MWS B;  3QWZ B;  1U4A A;  4HK2 A;  2A4Z A;  3Q3F A;  3TJP A;  5HKH A;  2KZR A;  3N30 A;  1E8Z A;  5G2N A;  3A33 B;  1OGW A;  2PE6 B;  1WY8 A;  1HE8 A;  4GU2 A;  1H4R A;  1WJ6 A;  2N9E B;  2K8C A;  4II2 B;  3BIN A;  1R4M I;  2ZVO A;  1K8R B;  3DOW A;  4GDK B;  4ASW C;  2IO0 B;  3EEC A;  3KUD B;  1WX7 A;  4NJ6 A;  3RZF A;  1WXS A;  4GB9 A;  2MBB B;  2MBQ A;  2LRU A;  3QQ8 B;  1LQB A;  1WMH A;  3ZIM A;  2RGF A;  4HWI B;  4XX5 A;  2D10 A;  5D7G A;  4BVU C;  1LM8 B;  3A4R A;  4AP4 C;  5C1Z A;  2JZZ A;  2MSE D;  4IG7 B;  3I3T B;  4I6L B;  4BKS A;  2AEH A;  3R3M A;  4ZRI A;  4BBN F;  3DBR I;  3IG3 A;  4MGZ E;  1OTR B;  4DWF A;  3L08 A;  2WX1 A;  2G45 B;  4DK5 A;  4GDL A;  3LJ3 A;  4F1S A;  4K7W A;  1TZ1 A;  2FCS A;  4MSM B;  5KHO A;  3CF6 E;  3A4S C;  2BGF A;  2C7M B;  2UYZ B;  2XEW A;  3IVF A;  1WX9 A;  1R4N I;  3HK0 A;  3A9J A;  5CHV C;  1E5W A;  3PRE A;  4GOC A;  1WXV A;  2LRW A;  1S1Q B;  2JPH A;  4XZ4 A;  3WA0 A;  4ANV A;  1V49 A;  3V6E B;  3C0R B;  2FAZ A;  2KOX A;  4B9K A;  3TCA A;  4IM3 A;  2BKF A;  1GG3 A;  2KDE B;  3ZNG C;  2KLC A;  3QK0 A;  4EOY A;  4K7U A;  2NCN A;  5DPS A;  4CYE A;  1WIA A;  2KHW B;  3B08 A;  1GJZ A;  5CTR C;  2LGY A;  2HD5 B;  1UEL A;  2M1M A;  2KC1 A;  2LGD A;  2KTF A;  4MJS B;  2O6V B;  2DYO A;  4OVU A;  3VFK A;  2KQ7 A;  1I42 A;  3PS6 A;  4F7Z A;  4WAA A;  1H8C A;  2MBE A;  3TL5 A;  2FCN A;  2BPS A;  1E7U A;  4ICU A;  4ANW A;  4NNJ B;  2K8H A;  1T0Y A;  2IY1 B;  2M4N A;  3ZUN A;  2L76 A;  2DEN B;  2J0J A;  3M62 B;  3OAW A;  3IBE A;  5G55 A;  3PLV A;  4W9L A;  2JY6 A;  1V86 A;  4ANU A;  4MM3 A;  1E8Y A;  4RMA A;  4ZRJ A;  2FUH B;  1VCB A;  2D11 A;  1QZE A;  2MLB A;  4W9K A;  1UZX B;  3IFW B;  1YQB A;  2BWE S;  4JQW C;  1S3S G;  2JRH A;  1ZKH A;  2MX2 A;  2I1K A;  3HHM A;  3QA8 A;  2DZK A;  3KYC D;  4EZL A;  1MG8 A;  3N3K B;  2LI5 A;  3PRP B;  2MRP A;  2C7N B;  2KWC A;  3DBL I;  1WF9 A;  2LWP A;  4X57 B;  3SHQ A;  5JH5 C;  4PYU A;  2C7H A;  4NQK E;  3KUC B;  5E6P A;  2YLM A;  1WR6 E;  2WYQ A;  1NDD A;  2N4F A;  2ZEQ A;  1E7V A;  4DHJ D;  4KDI C;  1WH3 A;  2EKE C;  2RSU A;  2ZVN A;  1BT0 A;  3JSV A;  3ZTD A;  3QIJ A;  3V60 A;  1OQY A;  2BWF A;  4G3X B;  4G11 A;  4NPN A;  1LXD A;  4GN1 A;  4HVB A;  3U30 A;  1RFA A;  3DPD A;  4JIO U;  3MHS D;  5AZH A;  3TIX A;  1WI0 A;  2IBI B;  1WR1 A;  2Z0E B;  2NPT B;  3VUY A;  2V1Y A;  4HDO A;  1UGM A;  2HE7 A;  1V5T A;  4GDL B;  4GXB A;  4IM0 A;  4FAD A;  2JUO A;  3ZVV A;  3UIP B;  2N1V A;  4PS3 A;  1EO6 A;  4W9F A;  3WAO A;  5CHF A;  4DDG D;  1A5R A;  2FCM A;  3A9J B;  4ZYN A;  1WE6 A;  3X23 A;  1Q1O A;  3VTV A;  4AJY B;  3WAP A;  2IYD B;  4LJO B;  4RM9 A;  2MBH A;  1X1M A;  4HCN B;  2L8J A;  3DVN U;  1YD8 U;  1SE9 A;  3HIZ A;  3RZW C;  3WIM A;  3PHX B;  2D07 B;  2DYB A;  3ZW3 A;  1WGY A;  2IZV B;  2KNB A;  2RD0 A;  5FR6 A;  3ZKJ C;  2L0F A;  3QCA A;  1WZ3 A;  2CS4 A;  3KYD D;  4E71 A;  5TR5 A;  2CU1 A;  2PE9 A;  4KIK A;  3NZU A;  4W9G A;  2KX0 A;  2N9X A;  4FHJ A;  3QX1 A;  2BYV E;  3ZTC A;  2BYF A;  2JF5 A;  2KFK A;  3VAW A;  1YIW A;  3VDZ A;  3CST A;  3A1Q A;  1SIF A;  2MA9 B;  4NQL B;  1C3T A;  2NBU A;  4K81 A;  4HDQ A;  2KKC A;  3DVN V;  2LVP A;  3RCZ A;  3GOE A;  4PS7 A;  3DBH I;  1Q0W B;  3NOB A;  4HCP B;  3RT3 B;  2LXA A;  5BO4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...