5AEKB

Crystal structure of the human senp2 c548s in complex with the human sumo1 k48m f66w
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
b'EYIKLKVIGQDSSEIHFKVKMTTHLKKLMESYCQRQGVPMNSLRFLWEGQRIADNHTPKELGMEEEDVIEVYQEQTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 2
publication title Stepping Back and Forward on Sumo Folding Evolution
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 78
sequence length 78
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5aekB00
4FBJB 2ZVNA 4GMVA 4K81A 4WWOA 5GMVA 1C3TA 3L08A 3OJ4B 4MEMA 4URKA 3LJ3A 3L16A 2FNJB 4II2B 2CHWA 2LVPA 4GDLA 3VXWA 3NZUA 1M94A 4RM8A 2LJ5A 3RD2A 3ZTCA 2FCNA 2M1MA 2IY0B 3PT2B 3EHVA 4KIKB 1Y8RC 4GSWA 2G3QB 5DPRA 4DHZB 4EZJA 4A3OA 2XBBC 1WFYA 4MGZE 5D6JB 3SU8X 2JT4B 2KDBA 3U30A 3ZIMA 2KKCA 2KDEB 2KO3A 2KNBA 1RFAA 1YIWA 3VUWA 1GJZA 4JLCA 3MJWA 3H9DA 4W9EA 4B95A 2G45B 3ONSA 4HPLB 4TKNA 1WXAA 4IM3A 5DPSA 3MHSD 2LVOA 1WXSA 1WF9A 4HCPB 4LDTB 2C7HA 2KJRA 3ECIA 3DVGY 1IYFA 1WGDA 3WANA 1WH3A 3ML9A 5HKHA 2KWUB 4TQ0A 2KZRA 2B3AA 2KTRB 2LRUA 4AUQC 2FCSA 3PRZA 4GIVA 4BKSA 4DK5A 4MH0E 2C60A 1G6JA 2Z0DB 2L8JA 1WMHA 4NJ7A 1AARA 2KVRA 3A9JB 1YD8U 3KH0A 1TGZB 1LQBA 4FA6A 4CO7A 3JSVA 4P7IA 3PLUA 4PYUA 3APCA 4W9GA 3ZNGC 3H1UA 3QAQA 1WE7A 3QJZA 3N32A 4WJNA 2MQJA 4DXAB 2MW5A 2MA9B 2D2QA 2ZNVB 2JZ3B 2CU1A 1OGWA 2NS5A 2KFKA 5G55A 1F9JA 3HHMA 3ZUNA 2AWTA 2DAJA 1VCBA 4HDQA 3PLVA 2IO2B 4KSLC 3OAWA 4KZCA 2CR5A 3NY5A 3RUIB 1HE8A 3GOEA 1L2NA 2MBOA 2I1KA 5FR6A 1NBFC 1UBIA 4MJSA 3RZFA 2KJ6A 3ZVVA 3JVZX 3TMPB 1I42A 5DPTA 2RGFA 3H7PB 3Q3JA 2O2VA 3TIXA 5C1ZA 1UGMA 4ZDVA 2XK5B 3VUXA 4MGKE 2LRWA 4A20A 2DYMA 4JIOU 4W9FA 2KD0A 2DHZA 2DYBA 2KX3A 1ZW7A 5E6PA 2LUEA 3ENEA 2D11A 3ZLZA 2J0KA 3IG3A 3APDA 1WI0A 2WWZA 2GMIC 3TL5A 1EO6A 4EZKA 3R7QA 3DPDA 2L0FA 3UINB 4EZLA 2ZCCA 4G3XB 4EKUA 3U7DA 1P9DU 4M8NA 4N9F4 4AP4C 3TBLD 1V81A 2ASQA 1RAXA 3HIZA 3M3JA 3ZDTA 2N1VA 3R3MA 2KQ7A 2K6QA 5C23A 2BKFA 1OEYA 3Q3FA 2NPTA 1Q5WB 1E90A 2L05A 5AZFA 4DHZE 2ZPYA 2J7QB 3AU5A 3AXCA 3M63B 4OVVA 4GDLB 2MWSB 2Y5BB 4LDTD 4MGIE 1GC6A 3NS8A 2DENB 3IHPC 1SGHA 5L83A 2L0TA 2BGFA 4DBGA 3VFKA 1UD7A 2KHWB 2N1WA 4MELA 1FXTB 4TUUA 1X1MA 3WAOA 2K1FA 2Z59B 1H4RA 3DBRI 3NHEB 5E6OA 1P98A 3VUYA 2LI5A 2G4SA 4IC7B 1R4NI 2PE6B 2GBKA 2PEAA 3DVNU 3A1QA 4BVUC 3X0WA 2ZJDA 1KJTA 3V62A 4GDKA 4RM9A 3ZKJC 1V5TA 5KHQA 4ASWC 1E7VA 2HE7A 4PS8A 1GUAB 2K8CA 2OOBB 3JW0X 2KXJA 4ICUA 2IO1B 4W9IA 1S3SG 3QA8A 4WWNA 4ZRJA 3VHTC 3VVWB 4GXBA 4IWPA 2LWPA 5CTRC 3DDCB 1V9JA 3QQ8B 3H7SA 1E5WA 3QCAA 1I35A 4HCNB 1YX5B 2BKRB 2M17A 3KUZA 3KYCD 3NOBA 3PRPB 1CMXB 3HM3A 3JSVB 4GGQA 3VQIA 5DPWA 1WGGA 4WJOA 2REXA 3B1LX 4B9KA 1WX9A 1D3ZA 4HLEA 2EKEC 2JPHA 2KC2A 4I6LB 1P1AA 5LXIB 1ZKHA 2KFKB 4JL9A 1YQBA 4NPNA 1YJ1A 2IYDB 3ZNHB 5IA7A 1GG3A 4MGYE 2C7NB 3JYUA 4GB9A 3PGEA 4I6NB 2FCQA 2K25A 4YL8A 5J18A 4WAAA 4ZRKA 1WY8A 2IZVB 3ZDMC 4NAWB 2C5LC 3SDLC 2ZEQA 3WA0A 5AEKB 4ANWA 1UZXB 2N9XA 3UQAA 4HJKA 3ZTDA 2K8HA 2EMSA 3QWZB 1E8ZA 2L7RA 2O2VB 2WX1A 3CSFA 4HVBA 5CHVC 4MM3A 2LXCA 2C7MB 5JZEB 5CX3A 2O6VB 1TTNA 3WIMA 3U8ZA 3QIJA 2MCNB 3UF8A 4II3B 1OQYA 4KIKA 3QK0A 1UH6A 2BPSA 4DHJD 5AZGA 2J0MA 1WXVA 2KMAA 2LASA 3PTFC 2JY6A 2RR9A 1K8RB 2KWVB 2IO0B 1E8XA 3C0RB 4IG7B 4LJOB 4KSKC 3L0WB 4IM2A 4NQKE 2MLBA 2AL6A 4K1RB 4EEWA 2PE9A 2NCNA 5TR5A 2WX0A 1BT0A 4ZYNA 2DZIA 3WAPA 3VDZA 2HJ8A 4FJVB 4HPMB 2FAZA 2YVCA 2RSUA 1XD3B 3BINA 3DVNV 4MSMB 3PPAA 1XT9B 2N7EA 1P3QU 2V1YA 1WJ6A 2JF5A 4FLHA 1WX8A 2FIFA 2KTRA 3K9PB 2L3ZA 3UQBA 3VTVA 3KW5B 3L10B 3WALA 1E7UA 4HWIB 4J6IA 4RMAA 1RRBA 3RT3B 3QC8B 3PS6A 1WYWB 3UIPB 3VAWA 1QZEA 2YLMA 1OTRB 1EUVB 5J17A 1E8WA 4K7WA 3ZNID 1PQSA 4K7UA 4W9HA 5D7GA 2BYEA 2LGYA 2PPHA 2JXXA 3D32A 3NZSA 4FJZA 2JRIB 4IWOA 1Q0WB 3DCGA 3EC8A 3PSEB 4LCDE 4BKTA 3KYDD 3MTNB 1WIAA 5CHWA 4FJYA 3A1QB 3R7RA 2N9EB 2N4FA 3BY4B 4FULA 2CHZA 1WZ0A 4OVUA 2EMTA 5BO4B 3HM6X 4M0WB 2JZZA 2ZVOA 4BFRA 2KX0A 3VH3B 2KOXA 2GBNA 1NI2A 2FIDA 3L13A 3OLMD 2FCMA 2FUHB 2MP2A 3KUDB 4BOZB 4WWPA 2GBRA 2IY1B 5JHBA 3L54A 4HK2A 1WJUA 4I6PA 5DCNA 1WGRA 2G4DB 3L17A 2DZMA 2XK5A 4M8MA 4FN2A 4XX5A 3RZWC 4KV2A 1JRUA 2JUOA 2KTFA 2MBEA 4HDOA 4JGHB 4IM0A 4IWQA 5AZHA 4EFOA 2K6DB 3ZO5B 1SIFA 4W9DA 2LD9A 1V86A 3N30A 4ANVA 4EUTA 1SE9A 2A5UA 2KLGA 2KJHB 1VD2A 2K39A 3DBSA 3PHWB 4MDKE 3K9OB 2L76A 2ZCBA 1TBEA 4FADA 1WM3A 1V6EA 2O6VD 4ANXA 2MBHA 2J0JA 1WXMA 2KFJA 2M4NA 3V61A 3V6EB 2WDTB 4MSQB 1WJ4A 3VH4B 1EF1A 2KWCA 4KDIC 4W9CA 1J19A 2R2QA 1Z2MA 3PHXB 1WR6E 1WMHB 4IUMB 1V80A 5D94A 2DZJA 3A9KA 4WQOB 3T8MA 4GU2A 4DDGD 5JHAA 2N9PC 1U4AA 2KQSA 2LZ6A 4FHJA 3DBLI 2UYZB 4JQWC 3VTWA 2NBWB 3RYTA 4WJQA 2M8SA 2MSED 2NBUA 2MBQA 2Z0EB 3M62B 2NVUI 1Z5SB 2JVCA 3SHQA 4K7SA 4PYZA 2VRRB 4NNJB 3A4SC 3S2AA 2CHXA 3QARA 3ZRFA 2BYFA 2JRHA 3PV1A 1P0RA 3HK0A 4MJSB 2ZNVC 3DQVA 2DYOA 4XC2A 3ZNZB 3ALBA 4W9KA 5LLIA 1GNUA 3CF6E 2K8BA 3X23A 3I3TB 2V3SA 2D10A 1WGHA 2BYVE 3WAMA 4G11A 4W9JA 3IVFA 5IAAC 2NR2A 1ISNA 2KN5A 2D07B 2WYQA 2R2OA 3O65B 3ML8A 4KDLB 5G2NA 1LXDA 1KLVA 3AU4A 4F7ZA 3R66C 2C9WB 4AOFA 5JH5C 5E6NA 5D2MB 4E3CA 5EDSA 1V5OA 4KVGB 3RCZA 3N3KB 1WGYA 2BWES 3M95A 2AL3A 5KHOA 1OEYJ 3V6CB 3P2BA 1UBQA 2HTHA 2KK8A 3W1SA 4TQ1A 3GZNI 4BBNF 3QX1A 3SD5A 2A4ZA 4DWFA 3A33B 2PJHA 3KUCB 4A3PA 1A5RA 2NPTB 3APFA 3PRMB 1WX7A 2NBVB 3PVLA 2W9NA 4G50A 2RD0A 2L00B 3ZW3A 2KMCA 3A9JA 1EF5A 2GBJA 2MP2B 4NAWA 2LXAA 3T9LA 3V60A 2LGXA 4HXDA 2KLCA 2DZKA 4BBNC 1C1YB 1WRDB 3UIOB 2LVQA 3OJ3A 4AJYB 5J2RA 4NQLB 4F1SA 1RLFA 3B08A 1LFDA 2DX5B 2KC1A 3EFUA 4BKSD 4ZRIA 3W1YA 4GN1A 3LDZE 3H6NA 2O6VA 4IW0A 3DBHI 3IBEA 1ZGUB 3AULA 3TCAA 2HD5B 2RPQA 2QHOA 1J0GA 1E8YA 2N7DA 4NJ6A 2LGDA 4DDID 1H8CA 3CMMB 4ANUA 1KOTA 4B6WA 3A4RA 1XQQA 1MG8A 2JWZA 4GDKB 1V49A 3DOWA 4X57B 2CS4A 4E74A 1IPGA 2GOWA 2MX2A 3QHTA 5CHFA 2ZPNA 4XZ4A 1KM7A 2XEWA 3CSTA 1GC7A 3AI5A 2AYOB 3H7PA 1WE6A 2M0XA 1TZ1A 2I1JA 2OJRA 3DVGX 2UWQA 3ZRCA 4NY0A 1WZ3A 4BOSC 3A9KB 4W9LA 1LM8B 3VTUA 4DHJB 1J8CA 1Q1OA 2DAFA 4GOCA 4CHKA 3RULA 2BWFA 2GBMA 1NDDA 4EOYA 4LJPB 3PZDA 4PS3A 3TJPA 1R4MI 4WJPA 4CYEA 2BF8B 4AWJA 2KDIA 1WR1A 2ZZPB 1YX6B 2CKHB 2MBBB 1L7YA 1WM2A 4F8CB 5LXHA 4E71A 2MRPA 1IP9A 4PS7A 4KZ0A 1V2YA 4AJWA 1WJNA 2AEHA 3EECA 3PREA 1S1QB 2KANA 2IO3B 2KDFB 5L95C 3UGBB 3W1SC 4G0NB 2V4LA 4TV3A 2D3GA 3KVFB 4FHKA 4ICVA 3B0AA 1T0YA 1UELA 4BKGA 2IBIB 3IFWB
chains in the Genus database with same CATH superfamily
4FBJB 4K81A 2N7JA 1C3TA 4MT5A 3OJ4B 4URKA 1VZ7A 4GDLA 3VXWA 4JX1C 2IY0B 2H89B 1FNVA 2XBBC 1DGJA 1WFYA 5BYSA 2BS4B 5EE0A 2KNBA 1TKEA 3ZGZA 4JE3B 3H9DA 4W9EA 2KMMA 1WXAA 4IM3A 2M56B 1YN5A 2WNMA 1F2RI 1ZXIA 4LDTB 1QT9A 1IYFA 1WH3A 2KWUB 2KZRA 4BKSA 4AUQC 1HTOA 2W3SA 4MH0E 1G6JA 1T0RC 3KH0A 4XDCA 2INPE 1FO4A 3APCA 4W9GA 1F0ZA 1UNSA 3N32A 4DXAB 1I4PA 2MA9B 3CIRB 2NS5A 2KFKA 5G55A 1F9JA 4YWGG 3FAHA 2Z8LA 2CR5A 5AUIA 1L2NA 5FR6A 2I1KA 1NBFC 4N59A 1YNTE 3HVDA 3TMPB 2RDBC 5BMHA 1UWMA 3T3NA 1UGMA 4MGKE 3DWGC 2DYMA 3BYYB 2X38A 1L6VA 4KGTA 1E7PB 2AQ1B 3Q8AA 2WWZA 2WU5B 1EO6A 4EZKA 2L0FA 2ZCCA 4G3XB 2QIEB 1P9DU 4AP4C 1V81A 4L23A 3R3MA 1OEYA 2NPTA 1Q5WB 1AN8A 2WS3B 1QOBA 3M63B 1K52A 2DLBA 1GC6A 3IHPC 1MG4A 3DBHB 3AE1B 1V8CA 1XXGA 4ZOHC 4US8A 4YSZB 3P42A 2QDFA 2K1FA 2Z59B 3DBRI 3VUYA 2LI5A 2INNE 4UDUC 4HRSA 2K22A 2WDRB 3A1QA 4DXFA 2ZJDA 3V62A 4M0WA 1V5TA 5KHQA 4ASWC 2HE7A 4PS8A 4W9IA 2KXJA 4ICUA 4NAMA 4ZRJA 1S3SG 1TJEA 3QCAA 3AN1A 3UI3A 3IT6B 4Q2JA 1CMXB 3VQIA 3B1LX 1HXYD 2EKEC 2QCZA 5LXIB 5HHDG 2TSSA 1AWDA 4C7ZA 5IA7A 4USAA 5JXVA 1L0YB 1QOGA 3W5UB 3PGEA 4I6NB 2K25A 4ZHOA 4OZAA 5H92C 3AM9A 1DOXA 1WY8A 3Q3NC 2ZEQA 3WA0A 5AEKB 2N9XA 3UQAA 2PKOA 3CSFA 2UU7A 4HVBA 3LYYA 4RGOS 2LXCA 4II3B 1E9MA 2KMAA 1K8RB 2KWVB 2GRIA 2IO0B 4KSKC 3ABVB 2AL6A 4US9A 2BTEA 3TUOA 3H8HA 4ZYNA 2HJ1A 2HJ8A 1XLQA 2YVCA 2RSUA 3BINA 1T6BX 3DVNV 2W54A 1L4ZB 1P3QU 2KTRA 3AEDB 4JWSC 1TYGB 3VTVA 3WALA 4HWIB 2MJDA 3RNBC 5C3JB 1RRBA 3PS6A 3GS2A 3VAWA 1QZEA 3KWLA 1EUVB 5T8IA 1PQSA 4W9HA 5G5HA 2BBCA 2PPHA 2JXXA 3EUB2 3DCGA 3EC8A 3MTNB 1JCKB 5CHWA 4FJYA 4FULA 2M19A 3HM6X 1E6EB 1D4BA 1NI2A 2FUHB 2MP2A 1IUEA 1ZPSA 3KUDB 4BOZB 4WWPA 2IY1B 1JWBD 3Q8CA 1WJUA 2DZMA 3RZWC 4KV2A 5AZHA 3P4PB 3N30A 2SAKA 2L1AA 3RNFC 2KJHB 4MDKE 1L6UA 4ARIA 3P1MA 4ANXA 2MBHA 1WXMA 2M4NA 2WDTB 1V97A 3MHZA 3P63A 3I63C 4W9CA 1J19A 1WMHB 3LXFA 1SE3A 2GI9A 1HZ5A 1HQRD 2N9PC 3DBLI 3AH7A 3RYTA 3DHHC 2M8SA 1MPEA 2NVUI 1Z5SB 4IDIA 4YSYB 1FNWA 3A4SC 3S2AA 1OQQA 3ZRFA 2JRHA 3HK0A 1CK1A 4XC2A 3ALBA 1OQRA 2WDVB 2INDC 3SFDB 1QKZA 3I3TB 2NR2A 4S0RA 3ZJUA 3V05A 2E3TA 4KKIA 3N20C 2WP9B 3R66C 1GPXA 3RNGC 4P1CC 4WH4A 1TS3A 5E6NA 2OEDA 3RCZA 3MJ5A 1WGYA 3M95A 3P2BA 1D5XC 2WXJA 3WCQA 1SF0A 3SD5A 4P6VF 5E6JA 4B0EA 2V9HA 4DWFA 2PJHA 1FNUA 2NBVB 3PVLA 1WRIA 3AEEB 4G50A 1WGKA 2L00B 2KMCA 1XEEA 4NAWA 2LGXA 5BYQA 4AJYB 5FR3A 3B08A 1LFDA 3MFGA 2BVCA 4ZRIA 3NVZA 3LDZE 2J42A 4IW0A 3TCAA 3AULA 4NJ6A 2LGDA 4MACA 1H8CA 3B9JA 4B6WA 1YQ3B 2WXIA 1MG8A 4X57B 1IPGA 3QHTA 4XZ4A 3GZNB 3H7PA 3Q3MC 1WE6A 2K0PA 1V1PA 2MJ3A 4BOSC 3NG0A 2KYWA 3A9KB 3VTUA 4DHJB 1LO5D 1N62A 2DAFA 4LNNA 4CHKA 2ICIA 2BWFA 2GBMA 5IN7A 3R2TA 1L5PA 3TJPA 1RM6C 4WJPA 2CKHB 1L7YA 1WM2A 2QC8A 2RMMA 1SEBD 3AE8B 4KZ0A 2RPVA 3UGBB 4JWUC 3KVFB 3B0AA 2RDHA 5HFYA 1E10A 2WXQA 4A6QA 4GMVA 1J7AA 4MEMA 4II2B 1VJKA 4L2YA 2IGDA 4CQNA 4KIKB 3EHVA 2WXFA 4GSWA 2IGHA 5DPRA 4DHZB 4EZJA 4A3OA 1GOZA 1QQRA 4MGZE 5D6JB 3U30A 2JT4B 2HDEA 2KKCA 2KO3A 4RF0A 1RFAA 3MJWA 1C9FA 2G45B 4HPLB 4TKNA 3BVGA 4C4VA 3ML9A 5HKHA 4TQ0A 2LRUA 2EELA 1V1OA 4DK5A 1VLBA 2KVRA 1FCLA 1YD8U 4C56C 1TGZB 3OG5A 4CO7A 2XNAC 3QJZA 1NVID 1SJHD 2D2QA 2WXGA 2ZNVB 2CU1A 5H8YE 4P16A 2E6XA 3ZUNA 2DAJA 1VCBA 3OAWA 1ZDVA 2QILA 2AQ2B 1R7SA 5DPTA 1RWSA 2RGFA 3Q3JA 2O2VA 1F77A 3VUXA 2LRWA 2IJ0A 2QJLA 5HG2A 1AW7A 4XWWA 4JIOU 3U2SC 3AEFB 4L1BA 2KD0A 2DHZA 1EWCA 2DYBA 2BT6A 1ZW7A 2Y3AA 3AE9B 2D11A 3ZJTA 2J0KA 3APDA 1ET6A 1WI0A 3DHGC 2D3BA 3TL5A 3R7QA 3ZJVA 3DPDA 4LNFA 1F52A 1B1ZA 3AE7B 3U7DA 4YT0B 4N9F4 3KLSX 4OZCA 3HIZA 2N1VA 3Q3FA 3Q3OC 2L05A 3BYTB 4DHZE 1TS4A 2ZPYA 2QMTA 4GDLB 2MWSB 3NS8A 2BGFA 5LNK1 3VFKA 1HZ6A 1N5WA 2FBWB 1X1MA 1N60A 3NHEB 1P98A 4LNIA 1R4NI 2VH1A 2KQ4X 2DWQA 3AV8A 1FD6A 3C8YA 2OOBB 3JW0X 2IO1B 3ZXRA 2LWPA 5BMGA 2WXNA 2NTTA 3H7SA 1C4AA 1I35A 4HCNB 1YX5B 3KUZA 3KYCD 3HM3A 1WGGA 4WJOA 3NUHB 4XE0A 1GB4A 2JPHA 1CJEA 2KC2A 1ZP0B 2KFKB 3PZ8A 4JL9A 1P7EA 4NPNA 1XO3A 3RI7C 3MC8A 2IYDB 1GG3A 1K53A 4MGYE 3RNEC 5J18A 4WAAA 5EE1A 3ZDMC 4ANWA 1P7FA 3Q8EA 1MHXA 2EMSA 3QWZB 1VR9A 2L7RA 2L83A 4MM3A 3TEZA 3UF8A 2ZW1A 3QK0A 1UH6A 2BPSA 4DHJD 1SB3C 5AZGA 2J0MA 2CJNA 2LASA 3PTFC 1NYQA 2JY6A 2RR9A 3C0RB 2Y5PA 4WIPA 1I4QA 4LJOB 4IM2A 4NQKE 2MLBA 3DHIC 4EEWA 1ACCA 1M4VA 5TR5A 3VDZA 1GB1A 4FJVB 1XD3B 3PPAA 1WWTA 2V1YA 1SXTA 1WX8A 3B2FA 3K9PB 3KW5B 3L10B 4J6IA 2JX5A 4AS1A 2LUMA 5TSSA 3QC8B 1KRHA 2ACZB 1OTRB 4ACFA 4ITKA 5D7GA 1D6EC 2LGYA 3NZSA 4IWOA 1FEHA 1MVKA 1WIAA 1D5MC 3A1QB 2CHZA 5BO4B 4M0WB 2KOXA 4YSXB 2FCMA 2PLPA 3L54A 1NEKB 2G1EA 5DCNA 2G4DB 3EA6A 3L17A 3ZDTA 1JRUA 4JGHB 4IWQA 4IM0A 2WQYB 3ZO5B 4W9DA 4ANVA 4NZLB 2CJOA 1PDXA 2K39A 3PHWB 3K9OB 4FADA 2O6VD 3NVWA 2KFJA 3V61A 3VH4B 3RNAC 2KWCA 3EGRA 1EU4A 1TS2A 3RNCC 2JWUA 4LTUA 2DZJA 3CWIA 4WQOB 4DDGD 2LZ6A 1JWAD 2UYZB 1D5ZC 2NBWB 2MSED 2Z0EB 3M62B 3N9YC 1XCQL 5AUKA 3Q14C 2BB6A 4PYZA 1TY0A 2CHXA 1IGCA 3AE2B 4MJSB 4JPSA 1UUPA 3ZNZB 1GNUA 1KTKA 3NRZA 5D3DA 1F1HA 3VR9B 2KWDA 3X23A 5FKAC 1WGHA 2BYVE 2KACA 3WAMA 2JYTA 3ML8A 3V3XA 1VRAB 1T3QA 1JWMD 2C9WB 4WURA 1T0SC 3DBLB 4E3CA 1C79A 1V5OA 4KX6B 1JWSD 3U52E 2AL3A 4D2KA 3N1ZC 1OEYJ 3V6CB 3W1SA 1STEA 4BBNF 2A4ZA 3APFA 1SIJA 1Q10A 2R61A 3A9JA 4N6EB 1EF5A 2MP2B 3BZDB 3V60A 4BBNC 4DQOC 1C1YB 1WRDB 3UIOB 3OJ3A 5J2RA 4F1SA 2DX5B 4BKSD 3W1YA 3H6NA 3DBHI 3NS1A 4WWMA 3R8BA 4DDID 3BK2A 4MH8A 1KOTA 3AEGB 2V3PA 3A4RA 1XQQA 2JWZA 4GDKB 1A70A 4E74A 4C80A 1GC7A 2AYOB 4NY0A 2MHJA 4S17A 1Q1OA 4GOCA 3RULA 1NDDA 2KDIA 3W2DA 1WR1A 3ETRA 5LXHA 2LEKA 4ARCA 4PS7A 2LFIA 1IP9A 1V2YA 2WXHA 4M01A 1Y56A 1S1QB 2KDFB 5L95C 2V4LA 3Q6BA 4FHKA 4ICVA 1T0YA 1UELA 3IFWB 2ZVNA 1FXAA 4WWOA 2LJIA 2J53A 3FILA 3L08A 1C76A 3LB8C 2FNJB 2CHWA 2LVPA 3NZUA 2LJ5A 3ZTCA 2K3UA 2BYTA 2FCNA 2M1MA 1LGRA 1YN4A 5MPOA 1YMHE 3SU8X 1NENB 1XCTL 3BVZA 2L52A 1SJED 2N0SB 1QF6A 1YIWA 2V3NA 4HPPA 4YTMB 4KKJA 1KFYB 5DPSA 3DWMA 2LVOA 1WXSA 1WF9A 4HCPB 2KJRA 3ECIA 1WGDA 3WANA 2B3AA 1HTQA 3PRZA 1DYQA 2Z0DB 1PGBA 1WMHA 2L8JA 2X8XX 5D3IB 1LQBA 4KGRA 4FA6A 1CZPA 4O1NA 3JSVA 4P7IA 4PYUA 3ZNGC 1KLUD 3H1UA 3QAQA 4FXCA 2I38A 4WJNA 2AQ3B 1I4RA 2JZ3B 4HDQA 2AWTA 3PLVA 2IO2B 3GOEA 1C4PA 1UBIA 2MH7A 3ZVVA 3JVZX 3TEYA 3IT4B 1IBXA 3H7PB 4ZDVA 2XK5B 4A20A 1UWXA 2XN9C 3RPFC 5E6PA 2I2YA 2LUEA 3ENEA 4RH6A 1XLPA 1N5XA 1TIFA 2CU3A 3ZLZA 3IG3A 4IKGA 3U7ZA 1I7HA 1YJIA 3TBLD 4A90A 1RAXA 3M3JA 2KQ7A 5C23A 2BKFA 1ZDXA 4C7YA 3AU5A 3AXCA 2K5PA 2WXOA 1FRDA 4M02A 2L0TA 5HI1A 5L83A 4DBGA 1UD7A 1T5XD 2KHWB 2N1WA 1FXTB 4TUUA 3WAOA 4N58A 1H4RA 5E6OA 2KDMA 2G4SA 4IC7B 2PEAA 2GBKA 3X0WA 1YOVB 1YN3A 1E7VA 4LNOA 1GUAB 4C4VB 2K8CA 4WWNA 3QA8A 1DOYA 3VHTC 3VVWB 4GXBA 1FRRA 1V9JA 3QQ8B 1E5WA 3RD2A 4GGQA 3NOBA 5DPWA 1R4MB 5BMIA 2REXA 4B9KA 3EFCA 2MEKA 1D3ZA 4HLEA 2JXTA 1YQBA 3BWUD 1F2RC 1YJ1A 2IPKD 4OW0A 4GB9A 5EE9A 2OJWA 4YL8A 2IZVB 1QOAA 2NTSA 1ESFA 4LLGM 2K8HA 1E8ZA 2WDQB 2O2VB 1KH0A 2WX1A 5CHVC 2C7MB 5CX3A 2O6VB 2LGIA 3QIJA 3I57A 2VZKD 1OQYA 4KIKA 1PGAA 4EE2A 1JQ4A 1WXVA 1SBBB 3MC0B 1E8XA 3SEBA 2EKIA 1XLNA 2PE9A 2NCNA 2J4XA 2DZIA 2LMCA 1MI0A 4HPMB 2FAZA 4OHJA 4MSMB 1B9RA 2N7EA 2ON8A 1WJ6A 2JF5A 2FIFA 3UQBA 2L3ZA 1E7UA 4RMAA 4HJGE 3RT3B 2IDYA 1WYWB 3AE5B 4XYCA 2YLMA 1E8WA 4K7WA 3ZNID 4RF1A 2BYEA 1AYFA 3GP7A 3D32A 4BFRA 3KQ4A 4FJZA 2JRIB 2JYEA 4A55A 3AMZA 4BKTA 1ZOYB 4K3BA 3BY4B 2KX0A 3VH3B 3L13A 5JHBA 2WHIA 1FPYA 4HK2A 1XLOA 4FN2A 1PFDA 2JUOA 2KTFA 2MBEA 2ONQA 4HDOA 4IOIE 1FXIA 4XDDA 2K6DB 1SIFA 2LD9A 2MJEA 2A5UA 3DBSA 1SSNA 1GAQB 2L76A 1TBEA 3V6EB 3GE3C 1WJ4A 4KDIC 1YQ4B 2R2QA 3PHXB 1WR6E 5IOIA 4IUMB 1V80A 5D94A 5JHAA 4GU2A 3PO0A 3VR8B 4FHJA 1T0QC 1K50A 4MM3B 2JVCA 3SHQA 2WXLA 4K3CA 2BQQA 4REZA 1RFKA 1N6ZA 1VZ6A 3DBRB 2PW9A 2BYFA 1UGJA 1FFUA 1UF0A 3N1XC 3DQVA 1C78A 1BUIC 1L0XB 4NJCA 4W9KA 5LLIA 3AE4B 1K51A 3CF6E 4TMAB 2WLBA 5I4DA 3RN9C 2QSDA 3IAM1 1ISNA 2KN5A 5FK9C 2R2OA 5G2NA 1KLVA 4F7ZA 3Q8FA 3FC4A 3FKYA 1JMLA 1SE4A 5EDSA 2B76B 2BWES 2KK8A 4ZYSA 4TQ1A 3NVYA 2KVZA 5IO9A 5IKCM 3A33B 4A3PA 1A5RA 2BW2A 2NPTB 1I4GA 3PRMB 1TKGA 4ZRPA 2Y5CA 4OVZA 3ZW3A 3T9LA 4HXDA 1TZOA 2LVQA 4NQLB 1RLFA 3EFUA 3MP9A 4GN1A 1FIQA 3IBEA 1ZGUB 2HD5B 1DOIA 1CQVA 2RPQA 2BB5A 2QHOA 1J0GA 1E8YA 4B0MA 3AE6B 4A9AA 4ANUA 3DOWA 3HRDD 2JZPA 1KM7A 1JRPA 1TKYA 2XEWA 3CSTA 3Q8BA 2M0XA 1TZ1A 3BVMA 1PGXA 1ZE3D 3MC9A 3E56A 1LM8B 1J8CA 2NMQA 2PTLA 4J3OD 1ROEA 4LJPB 3PZDA 4PS3A 2WXKA 4CYEA 2ZZPB 1YX6B 1FMAD 2MRPA 4AJWA 1PYWD 3EECA 3PREA 2KANA 4XGAB 2H88B 3W1SC 4G0NB 4TV3A 1C77A 2WU2B 2IBIB 5GMVA 3R2IA 1FCCC 3LJ3A 3L16A 1QILA 4RM8A 1M94A 2GB1A 1N63A 3PT2B 1FFVA 1Y8RC 2G3QB 3HVZA 3ZYYX 2W55A 3VRBB 3B2GA 2KDBA 3ZIMA 2KDEB 3VUWA 1GJZA 4JLCA 4B95A 3T3OA 3ONSA 3IAS1 1WXQA 4QAYA 1SE2A 2D3AA 2JU6X 3MHSD 2C7HA 3DVGY 2OHFA 3I9V1 4YTNB 4WAFA 3ZXVA 2KTRB 5JH5C 2FCSA 1JROA 4GIVA 4YTPB 1MHHE 2C60A 4NJ7A 1AARA 3A9JB 2KAJA 2BS3B 3PLUA 4RCOA 4BAXA 4HEA1 1WE7A 1ENFA 2MQJA 2MW5A 1J7BA 2PVOD 1OGWA 2JQRB 3AEAB 3HHMA 2KN4A 2J52A 4KSLC 4KZCA 3NY5A 3RUIB 3TEXA 1HE8A 2MBOA 4RFBA 4MJSA 3RZFA 2Q5WD 2KJ6A 2IGGA 1I42A 1FM0D 1WSPA 3TIXA 5C1ZA 2DNFA 4W9FA 1BXTA 2KX3A 1BMLC 1VDVA 1HA5A 1QLBB 2GMIC 3UINB 3BIID 3OWEB 3SFEB 4EKUA 4M8NA 2ASQA 2VZKB 1YJJA 3Q2AC 2K6QA 1E90A 5AZFA 3FILB 2J7QB 4R3DA 4OVVA 2Y5BB 4LDTD 2ZW0A 4MGIE 2DENB 2W82A 1SGHA 1KLGD 4MELA 2PE6B 1ZXHA 3DVNU 4BVUC 1KJTA 4GDKA 4RM9A 3ZKJC 1WYGA 5GXGB 2L32A 2VH2A 4TSSA 1VZ8A 4WQMA 2M0AA 5CTRC 4IWPA 3DDCB 3TSSA 4YXDB 1TS5A 2W3RA 3PRPB 2BKRB 2M17A 3JSVB 4PT5A 2PMVA 1WX9A 4I6LB 1P1AA 1JW9D 1ZKHA 3AE3B 3GE8C 2WXMA 3RFZB 3ZNHB 2C7NB 3JYUA 1ET9A 4BZAA 2FCQA 1HEZE 1NYRA 4ZRKA 3NJTA 4NAWB 2C5LC 3SDLC 3AB5A 1IBXB 1UZXB 1I4XA 4HJKA 1J7CA 3ZTDA 4HROA 4DXGA 5JZEB 1TTNA 3WIMA 3U8ZA 2MCNB 4M00A 2D5GA 3RMKC 3AECB 4IG7B 3L0WB 3P4RB 4K1RB 3N1YC 4KGSA 2WX0A 1BT0A 3WAPA 2SEBD 2G9HD 1KF6B 4GLSC 2N9LA 1V1PB 4ZRQA 4HKZE 3U4EG 1XT9B 1N61A 4FLHA 1TY2A 3IXSA 4RGTA 3W5VB 3L4PA 3UIPB 3URYA 3TEWA 4OZBA 5J17A 4K7UA 5IP4D 2HTME 2FE8A 1Q0WB 3PSEB 4LCDE 3KYDD 1L0VB 4HKQA 2V4IB 3R7RA 2N9EB 2N4FA 1WZ0A 4OVUA 2EMTA 2JZZA 2ZVOA 4ZHPA 4A8XC 2GBNA 2FIDA 3OLMD 1MJDA 3SR6A 2GBRA 4RGNA 3BK1A 3KWVA 4I6PA 1E0ZA 1WGRA 4M8MA 2XK5A 1IGDA 4XX5A 1I4HA 1C4CA 4EFOA 3PZ7A 1V86A 4EUTA 1SE9A 2PIAA 2KLGA 1VD2A 2ZCBA 1JALA 1WM3A 1OFFA 1V6EA 3GB1A 1JWUD 2J0JA 4MSQB 4XWTA 1EF1A 2QEJC 1Z2MA 2LHEA 3A9KA 3T8MA 1U4AA 2KQSA 4RGMA 4JQWC 3VTWA 3AEBB 4WJQA 4RNAA 2WXPA 2NBUA 2MBQA 4K7SA 2V0GA 3HUIA 2VRRB 2LGSA 4NNJB 4LNKA 3P4SB 3QARA 3PV1A 1R4NB 1P0RA 2ZNVC 2DYOA 2YEPF 2K8BA 2V3SA 2D10A 2LHDA 4G11A 4W9JA 3IVFA 2WXRA 5IAAC 4LK0M 3W9CB 2D07B 2WYQA 3O65B 4KDLB 2WGSA 3I5JC 5G5GA 1LXDA 3AU4A 1TT5B 1XF5L 4AOFA 1MFWA 4H2AA 5D2MB 2DBYA 3O13A 3P4QB 4KVGB 2FUG1 2JSVX 3N3KB 5KHOA 1UBQA 2HTHA 3GZNI 3QX1A 1QOFA 3KUCB 1L4DB 1WX7A 5BYRA 2W9NA 3E9SA 2RD0A 4EZLA 2GBJA 2AX5A 2GLSA 2LXAA 2RDGA 2KLCA 2DZKA 2YEPB 3NZ3A 1EU3A 2KC1A 2PVGC 3NVVA 4C00A 2O6VA 2BS2B 5EE3A 2N7DA 4P1BC 2D3CA 3CMMB 5C2TB 2KT7A 3Q69A 1V49A 2CS4A 2GOWA 2MX2A 5CHFA 2ZPNA 3J9CA 1RYJA 3AI5A 1NI3A 1PUTA 2I1JA 3DVGX 2OJRA 4PK1A 1EM7A 2UWQA 3ZRCA 1WZ3A 4W9LA 4EOYA 1R4MI 3C19A 2BF8B 4AWJA 2K9XA 2MBBB 1ZUD2 4F8CB 3VRAB 4E71A 1WJNA 2AEHA 2INCC 2IO3B 4AQ7A 2N9KA 2D3GA 4BKGA 3ZQ4A 1EWYC
chains in the Genus database with same CATH topology
4FBJB 2ZVNA 4GMVA 4K81A 4WWOA 5GMVA 1C3TA 3L08A 3OJ4B 4MEMA 4URKA 3LJ3A 3L16A 2FNJB 4II2B 2CHWA 2LVPA 4GDLA 3VXWA 3NZUA 1M94A 4RM8A 2LJ5A 3RD2A 3ZTCA 2FCNA 2M1MA 2IY0B 3PT2B 3EHVA 4KIKB 1Y8RC 4GSWA 2G3QB 5DPRA 4DHZB 4EZJA 4A3OA 2XBBC 1WFYA 4MGZE 5D6JB 3SU8X 2JT4B 2KDBA 3U30A 3ZIMA 2KKCA 2KDEB 2KO3A 2KNBA 1RFAA 1YIWA 3VUWA 1GJZA 4JLCA 3MJWA 3H9DA 4W9EA 4B95A 2G45B 3ONSA 4HPLB 4TKNA 1WXAA 4IM3A 5DPSA 3MHSD 2LVOA 1WXSA 1WF9A 4HCPB 4LDTB 2C7HA 2KJRA 3ECIA 3DVGY 1IYFA 1WGDA 3WANA 1WH3A 3ML9A 5HKHA 2KWUB 4TQ0A 2KZRA 2B3AA 2KTRB 2LRUA 4AUQC 2FCSA 3PRZA 4GIVA 4BKSA 4DK5A 4MH0E 2C60A 1G6JA 2Z0DB 2L8JA 1WMHA 4NJ7A 1AARA 2KVRA 3A9JB 1YD8U 3KH0A 1TGZB 1LQBA 4FA6A 4CO7A 3JSVA 4P7IA 3PLUA 4PYUA 3APCA 4W9GA 3ZNGC 3H1UA 3QAQA 1WE7A 3QJZA 3N32A 4WJNA 2MQJA 4DXAB 2MW5A 2MA9B 2D2QA 2ZNVB 2JZ3B 2CU1A 1OGWA 2NS5A 2KFKA 5G55A 1F9JA 3HHMA 3ZUNA 2AWTA 2DAJA 1VCBA 4HDQA 3PLVA 2IO2B 4KSLC 3OAWA 4KZCA 2CR5A 3NY5A 3RUIB 1HE8A 3GOEA 1L2NA 2MBOA 2I1KA 5FR6A 1NBFC 1UBIA 4MJSA 3RZFA 2KJ6A 3ZVVA 3JVZX 3TMPB 1I42A 5DPTA 2RGFA 3H7PB 3Q3JA 2O2VA 3TIXA 5C1ZA 1UGMA 4ZDVA 2XK5B 3VUXA 4MGKE 2LRWA 4A20A 2DYMA 4JIOU 4W9FA 2KD0A 2DHZA 2DYBA 2KX3A 1ZW7A 5E6PA 2LUEA 3ENEA 2D11A 3ZLZA 2J0KA 3IG3A 3APDA 1WI0A 2WWZA 2GMIC 3TL5A 1EO6A 4EZKA 3R7QA 3DPDA 2L0FA 3UINB 4EZLA 2ZCCA 4G3XB 4EKUA 3U7DA 1P9DU 4M8NA 4N9F4 4AP4C 3TBLD 1V81A 2ASQA 1RAXA 3HIZA 3M3JA 3ZDTA 2N1VA 3R3MA 2KQ7A 2K6QA 5C23A 2BKFA 1OEYA 3Q3FA 2NPTA 1Q5WB 1E90A 2L05A 5AZFA 4DHZE 2ZPYA 2J7QB 3AU5A 3AXCA 3M63B 4OVVA 4GDLB 2MWSB 2Y5BB 4LDTD 4MGIE 1GC6A 3NS8A 2DENB 3IHPC 1SGHA 5L83A 2L0TA 2BGFA 4DBGA 3VFKA 1UD7A 2KHWB 2N1WA 4MELA 1FXTB 4TUUA 1X1MA 3WAOA 2K1FA 2Z59B 1H4RA 3DBRI 3NHEB 5E6OA 1P98A 3VUYA 2LI5A 2G4SA 4IC7B 1R4NI 2PE6B 2GBKA 2PEAA 3DVNU 3A1QA 4BVUC 3X0WA 2ZJDA 1KJTA 3V62A 4GDKA 4RM9A 3ZKJC 1V5TA 5KHQA 4ASWC 1E7VA 2HE7A 4PS8A 1GUAB 2K8CA 2OOBB 3JW0X 2KXJA 4ICUA 2IO1B 4W9IA 1S3SG 3QA8A 4WWNA 4ZRJA 3VHTC 3VVWB 4GXBA 4IWPA 2LWPA 5CTRC 3DDCB 1V9JA 3QQ8B 3H7SA 1E5WA 3QCAA 1I35A 4HCNB 1YX5B 2BKRB 2M17A 3KUZA 3KYCD 3NOBA 3PRPB 1CMXB 3HM3A 3JSVB 4GGQA 3VQIA 5DPWA 1WGGA 4WJOA 2REXA 3B1LX 4B9KA 1WX9A 1D3ZA 4HLEA 2EKEC 2JPHA 2KC2A 4I6LB 1P1AA 5LXIB 1ZKHA 2KFKB 4JL9A 1YQBA 4NPNA 1YJ1A 2IYDB 3ZNHB 5IA7A 1GG3A 4MGYE 2C7NB 3JYUA 4GB9A 3PGEA 4I6NB 2FCQA 2K25A 4YL8A 5J18A 4WAAA 4ZRKA 1WY8A 2IZVB 3ZDMC 4NAWB 2C5LC 3SDLC 2ZEQA 3WA0A 5AEKB 4ANWA 1UZXB 2N9XA 3UQAA 4HJKA 3ZTDA 2K8HA 2EMSA 3QWZB 1E8ZA 2L7RA 2O2VB 2WX1A 3CSFA 4HVBA 5CHVC 4MM3A 2LXCA 2C7MB 5JZEB 5CX3A 2O6VB 1TTNA 3WIMA 3U8ZA 3QIJA 2MCNB 3UF8A 4II3B 1OQYA 4KIKA 3QK0A 1UH6A 2BPSA 4DHJD 5AZGA 2J0MA 1WXVA 2KMAA 2LASA 3PTFC 2JY6A 2RR9A 1K8RB 2KWVB 2IO0B 1E8XA 3C0RB 4IG7B 4LJOB 4KSKC 3L0WB 4IM2A 4NQKE 2MLBA 2AL6A 4K1RB 4EEWA 2PE9A 2NCNA 5TR5A 2WX0A 1BT0A 4ZYNA 2DZIA 3WAPA 3VDZA 2HJ8A 4FJVB 4HPMB 2FAZA 2YVCA 2RSUA 1XD3B 3BINA 3DVNV 4MSMB 3PPAA 1XT9B 2N7EA 1P3QU 2V1YA 1WJ6A 2JF5A 4FLHA 1WX8A 2FIFA 2KTRA 3K9PB 2L3ZA 3UQBA 3VTVA 3KW5B 3L10B 3WALA 1E7UA 4HWIB 4J6IA 4RMAA 1RRBA 3RT3B 3QC8B 3PS6A 1WYWB 3UIPB 3VAWA 1QZEA 2YLMA 1OTRB 1EUVB 5J17A 1E8WA 4K7WA 3ZNID 1PQSA 4K7UA 4W9HA 5D7GA 2BYEA 2LGYA 2PPHA 2JXXA 3D32A 3NZSA 4FJZA 2JRIB 4IWOA 1Q0WB 3DCGA 3EC8A 3PSEB 4LCDE 4BKTA 3KYDD 3MTNB 1WIAA 5CHWA 4FJYA 3A1QB 3R7RA 2N9EB 2N4FA 3BY4B 4FULA 2CHZA 1WZ0A 4OVUA 2EMTA 5BO4B 3HM6X 4M0WB 2JZZA 2ZVOA 4BFRA 2KX0A 3VH3B 2KOXA 2GBNA 1NI2A 2FIDA 3L13A 3OLMD 2FCMA 2FUHB 2MP2A 3KUDB 4BOZB 4WWPA 2GBRA 2IY1B 5JHBA 3L54A 4HK2A 1WJUA 4I6PA 5DCNA 1WGRA 2G4DB 3L17A 2DZMA 2XK5A 4M8MA 4FN2A 4XX5A 3RZWC 4KV2A 1JRUA 2JUOA 2KTFA 2MBEA 4HDOA 4JGHB 4IM0A 4IWQA 5AZHA 4EFOA 2K6DB 3ZO5B 1SIFA 4W9DA 2LD9A 1V86A 3N30A 4ANVA 4EUTA 1SE9A 2A5UA 2KLGA 2KJHB 1VD2A 2K39A 3DBSA 3PHWB 4MDKE 3K9OB 2L76A 2ZCBA 1TBEA 4FADA 1WM3A 1V6EA 2O6VD 4ANXA 2MBHA 2J0JA 1WXMA 2KFJA 2M4NA 3V61A 3V6EB 2WDTB 4MSQB 1WJ4A 3VH4B 1EF1A 2KWCA 4KDIC 4W9CA 1J19A 2R2QA 1Z2MA 3PHXB 1WR6E 1WMHB 4IUMB 1V80A 5D94A 2DZJA 3A9KA 4WQOB 3T8MA 4GU2A 4DDGD 5JHAA 2N9PC 1U4AA 2KQSA 2LZ6A 4FHJA 3DBLI 2UYZB 4JQWC 3VTWA 2NBWB 3RYTA 4WJQA 2M8SA 2MSED 2NBUA 2MBQA 2Z0EB 3M62B 2NVUI 1Z5SB 2JVCA 3SHQA 4K7SA 4PYZA 2VRRB 4NNJB 3A4SC 3S2AA 2CHXA 3QARA 3ZRFA 2BYFA 2JRHA 3PV1A 1P0RA 3HK0A 4MJSB 2ZNVC 3DQVA 2DYOA 4XC2A 3ZNZB 3ALBA 4W9KA 5LLIA 1GNUA 3CF6E 2K8BA 3X23A 3I3TB 2V3SA 2D10A 1WGHA 2BYVE 3WAMA 4G11A 4W9JA 3IVFA 5IAAC 2NR2A 1ISNA 2KN5A 2D07B 2WYQA 2R2OA 3O65B 3ML8A 4KDLB 5G2NA 1LXDA 1KLVA 3AU4A 4F7ZA 3R66C 2C9WB 4AOFA 5JH5C 5E6NA 5D2MB 4E3CA 5EDSA 1V5OA 4KVGB 3RCZA 3N3KB 1WGYA 2BWES 3M95A 2AL3A 5KHOA 1OEYJ 3V6CB 3P2BA 1UBQA 2HTHA 2KK8A 3W1SA 4TQ1A 3GZNI 4BBNF 3QX1A 3SD5A 2A4ZA 4DWFA 3A33B 2PJHA 3KUCB 4A3PA 1A5RA 2NPTB 3APFA 3PRMB 1WX7A 2NBVB 3PVLA 2W9NA 4G50A 2RD0A 2L00B 3ZW3A 2KMCA 3A9JA 1EF5A 2GBJA 2MP2B 4NAWA 2LXAA 3T9LA 3V60A 2LGXA 4HXDA 2KLCA 2DZKA 4BBNC 1C1YB 1WRDB 3UIOB 2LVQA 3OJ3A 4AJYB 5J2RA 4NQLB 4F1SA 1RLFA 3B08A 1LFDA 2DX5B 2KC1A 3EFUA 4BKSD 4ZRIA 3W1YA 4GN1A 3LDZE 3H6NA 2O6VA 4IW0A 3DBHI 3IBEA 1ZGUB 3AULA 3TCAA 2HD5B 2RPQA 2QHOA 1J0GA 1E8YA 2N7DA 4NJ6A 2LGDA 4DDID 1H8CA 3CMMB 4ANUA 1KOTA 4B6WA 3A4RA 1XQQA 1MG8A 2JWZA 4GDKB 1V49A 3DOWA 4X57B 2CS4A 4E74A 1IPGA 2GOWA 2MX2A 3QHTA 5CHFA 2ZPNA 4XZ4A 1KM7A 2XEWA 3CSTA 1GC7A 3AI5A 2AYOB 3H7PA 1WE6A 2M0XA 1TZ1A 2I1JA 2OJRA 3DVGX 2UWQA 3ZRCA 4NY0A 1WZ3A 4BOSC 3A9KB 4W9LA 1LM8B 3VTUA 4DHJB 1J8CA 1Q1OA 2DAFA 4GOCA 4CHKA 3RULA 2BWFA 2GBMA 1NDDA 4EOYA 4LJPB 3PZDA 4PS3A 3TJPA 1R4MI 4WJPA 4CYEA 2BF8B 4AWJA 2KDIA 1WR1A 2ZZPB 1YX6B 2CKHB 2MBBB 1L7YA 1WM2A 4F8CB 5LXHA 4E71A 2MRPA 1IP9A 4PS7A 4KZ0A 1V2YA 4AJWA 1WJNA 2AEHA 3EECA 3PREA 1S1QB 2KANA 2IO3B 2KDFB 5L95C 3UGBB 3W1SC 4G0NB 2V4LA 4TV3A 2D3GA 3KVFB 4FHKA 4ICVA 3B0AA 1T0YA 1UELA 4BKGA 2IBIB 3IFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBJ B;  2ZVN A;  4GMV A;  4K81 A;  4WWO A;  5GMV A;  1C3T A;  3L08 A;  3OJ4 B;  4MEM A;  4URK A;  3LJ3 A;  3L16 A;  2FNJ B;  4II2 B;  2CHW A;  2LVP A;  4GDL A;  3VXW A;  3NZU A;  1M94 A;  4RM8 A;  2LJ5 A;  3RD2 A;  3ZTC A;  2FCN A;  2M1M A;  2IY0 B;  3PT2 B;  3EHV A;  4KIK B;  1Y8R C;  4GSW A;  2G3Q B;  5DPR A;  4DHZ B;  4EZJ A;  4A3O A;  2XBB C;  1WFY A;  4MGZ E;  5D6J B;  3SU8 X;  2JT4 B;  2KDB A;  3U30 A;  3ZIM A;  2KKC A;  2KDE B;  2KO3 A;  2KNB A;  1RFA A;  1YIW A;  3VUW A;  1GJZ A;  4JLC A;  3MJW A;  3H9D A;  4W9E A;  4B95 A;  2G45 B;  3ONS A;  4HPL B;  4TKN A;  1WXA A;  4IM3 A;  5DPS A;  3MHS D;  2LVO A;  1WXS A;  1WF9 A;  4HCP B;  4LDT B;  2C7H A;  2KJR A;  3ECI A;  3DVG Y;  1IYF A;  1WGD A;  3WAN A;  1WH3 A;  3ML9 A;  5HKH A;  2KWU B;  4TQ0 A;  2KZR A;  2B3A A;  2KTR B;  2LRU A;  4AUQ C;  2FCS A;  3PRZ A;  4GIV A;  4BKS A;  4DK5 A;  4MH0 E;  2C60 A;  1G6J A;  2Z0D B;  2L8J A;  1WMH A;  4NJ7 A;  1AAR A;  2KVR A;  3A9J B;  1YD8 U;  3KH0 A;  1TGZ B;  1LQB A;  4FA6 A;  4CO7 A;  3JSV A;  4P7I A;  3PLU A;  4PYU A;  3APC A;  4W9G A;  3ZNG C;  3H1U A;  3QAQ A;  1WE7 A;  3QJZ A;  3N32 A;  4WJN A;  2MQJ A;  4DXA B;  2MW5 A;  2MA9 B;  2D2Q A;  2ZNV B;  2JZ3 B;  2CU1 A;  1OGW A;  2NS5 A;  2KFK A;  5G55 A;  1F9J A;  3HHM A;  3ZUN A;  2AWT A;  2DAJ A;  1VCB A;  4HDQ A;  3PLV A;  2IO2 B;  4KSL C;  3OAW A;  4KZC A;  2CR5 A;  3NY5 A;  3RUI B;  1HE8 A;  3GOE A;  1L2N A;  2MBO A;  2I1K A;  5FR6 A;  1NBF C;  1UBI A;  4MJS A;  3RZF A;  2KJ6 A;  3ZVV A;  3JVZ X;  3TMP B;  1I42 A;  5DPT A;  2RGF A;  3H7P B;  3Q3J A;  2O2V A;  3TIX A;  5C1Z A;  1UGM A;  4ZDV A;  2XK5 B;  3VUX A;  4MGK E;  2LRW A;  4A20 A;  2DYM A;  4JIO U;  4W9F A;  2KD0 A;  2DHZ A;  2DYB A;  2KX3 A;  1ZW7 A;  5E6P A;  2LUE A;  3ENE A;  2D11 A;  3ZLZ A;  2J0K A;  3IG3 A;  3APD A;  1WI0 A;  2WWZ A;  2GMI C;  3TL5 A;  1EO6 A;  4EZK A;  3R7Q A;  3DPD A;  2L0F A;  3UIN B;  4EZL A;  2ZCC A;  4G3X B;  4EKU A;  3U7D A;  1P9D U;  4M8N A;  4N9F 4;  4AP4 C;  3TBL D;  1V81 A;  2ASQ A;  1RAX A;  3HIZ A;  3M3J A;  3ZDT A;  2N1V A;  3R3M A;  2KQ7 A;  2K6Q A;  5C23 A;  2BKF A;  1OEY A;  3Q3F A;  2NPT A;  1Q5W B;  1E90 A;  2L05 A;  5AZF A;  4DHZ E;  2ZPY A;  2J7Q B;  3AU5 A;  3AXC A;  3M63 B;  4OVV A;  4GDL B;  2MWS B;  2Y5B B;  4LDT D;  4MGI E;  1GC6 A;  3NS8 A;  2DEN B;  3IHP C;  1SGH A;  5L83 A;  2L0T A;  2BGF A;  4DBG A;  3VFK A;  1UD7 A;  2KHW B;  2N1W A;  4MEL A;  1FXT B;  4TUU A;  1X1M A;  3WAO A;  2K1F A;  2Z59 B;  1H4R A;  3DBR I;  3NHE B;  5E6O A;  1P98 A;  3VUY A;  2LI5 A;  2G4S A;  4IC7 B;  1R4N I;  2PE6 B;  2GBK A;  2PEA A;  3DVN U;  3A1Q A;  4BVU C;  3X0W A;  2ZJD A;  1KJT A;  3V62 A;  4GDK A;  4RM9 A;  3ZKJ C;  1V5T A;  5KHQ A;  4ASW C;  1E7V A;  2HE7 A;  4PS8 A;  1GUA B;  2K8C A;  2OOB B;  3JW0 X;  2KXJ A;  4ICU A;  2IO1 B;  4W9I A;  1S3S G;  3QA8 A;  4WWN A;  4ZRJ A;  3VHT C;  3VVW B;  4GXB A;  4IWP A;  2LWP A;  5CTR C;  3DDC B;  1V9J A;  3QQ8 B;  3H7S A;  1E5W A;  3QCA A;  1I35 A;  4HCN B;  1YX5 B;  2BKR B;  2M17 A;  3KUZ A;  3KYC D;  3NOB A;  3PRP B;  1CMX B;  3HM3 A;  3JSV B;  4GGQ A;  3VQI A;  5DPW A;  1WGG A;  4WJO A;  2REX A;  3B1L X;  4B9K A;  1WX9 A;  1D3Z A;  4HLE A;  2EKE C;  2JPH A;  2KC2 A;  4I6L B;  1P1A A;  5LXI B;  1ZKH A;  2KFK B;  4JL9 A;  1YQB A;  4NPN A;  1YJ1 A;  2IYD B;  3ZNH B;  5IA7 A;  1GG3 A;  4MGY E;  2C7N B;  3JYU A;  4GB9 A;  3PGE A;  4I6N B;  2FCQ A;  2K25 A;  4YL8 A;  5J18 A;  4WAA A;  4ZRK A;  1WY8 A;  2IZV B;  3ZDM C;  4NAW B;  2C5L C;  3SDL C;  2ZEQ A;  3WA0 A;  5AEK B;  4ANW A;  1UZX B;  2N9X A;  3UQA A;  4HJK A;  3ZTD A;  2K8H A;  2EMS A;  3QWZ B;  1E8Z A;  2L7R A;  2O2V B;  2WX1 A;  3CSF A;  4HVB A;  5CHV C;  4MM3 A;  2LXC A;  2C7M B;  5JZE B;  5CX3 A;  2O6V B;  1TTN A;  3WIM A;  3U8Z A;  3QIJ A;  2MCN B;  3UF8 A;  4II3 B;  1OQY A;  4KIK A;  3QK0 A;  1UH6 A;  2BPS A;  4DHJ D;  5AZG A;  2J0M A;  1WXV A;  2KMA A;  2LAS A;  3PTF C;  2JY6 A;  2RR9 A;  1K8R B;  2KWV B;  2IO0 B;  1E8X A;  3C0R B;  4IG7 B;  4LJO B;  4KSK C;  3L0W B;  4IM2 A;  4NQK E;  2MLB A;  2AL6 A;  4K1R B;  4EEW A;  2PE9 A;  2NCN A;  5TR5 A;  2WX0 A;  1BT0 A;  4ZYN A;  2DZI A;  3WAP A;  3VDZ A;  2HJ8 A;  4FJV B;  4HPM B;  2FAZ A;  2YVC A;  2RSU A;  1XD3 B;  3BIN A;  3DVN V;  4MSM B;  3PPA A;  1XT9 B;  2N7E A;  1P3Q U;  2V1Y A;  1WJ6 A;  2JF5 A;  4FLH A;  1WX8 A;  2FIF A;  2KTR A;  3K9P B;  2L3Z A;  3UQB A;  3VTV A;  3KW5 B;  3L10 B;  3WAL A;  1E7U A;  4HWI B;  4J6I A;  4RMA A;  1RRB A;  3RT3 B;  3QC8 B;  3PS6 A;  1WYW B;  3UIP B;  3VAW A;  1QZE A;  2YLM A;  1OTR B;  1EUV B;  5J17 A;  1E8W A;  4K7W A;  3ZNI D;  1PQS A;  4K7U A;  4W9H A;  5D7G A;  2BYE A;  2LGY A;  2PPH A;  2JXX A;  3D32 A;  3NZS A;  4FJZ A;  2JRI B;  4IWO A;  1Q0W B;  3DCG A;  3EC8 A;  3PSE B;  4LCD E;  4BKT A;  3KYD D;  3MTN B;  1WIA A;  5CHW A;  4FJY A;  3A1Q B;  3R7R A;  2N9E B;  2N4F A;  3BY4 B;  4FUL A;  2CHZ A;  1WZ0 A;  4OVU A;  2EMT A;  5BO4 B;  3HM6 X;  4M0W B;  2JZZ A;  2ZVO A;  4BFR A;  2KX0 A;  3VH3 B;  2KOX A;  2GBN A;  1NI2 A;  2FID A;  3L13 A;  3OLM D;  2FCM A;  2FUH B;  2MP2 A;  3KUD B;  4BOZ B;  4WWP A;  2GBR A;  2IY1 B;  5JHB A;  3L54 A;  4HK2 A;  1WJU A;  4I6P A;  5DCN A;  1WGR A;  2G4D B;  3L17 A;  2DZM A;  2XK5 A;  4M8M A;  4FN2 A;  4XX5 A;  3RZW C;  4KV2 A;  1JRU A;  2JUO A;  2KTF A;  2MBE A;  4HDO A;  4JGH B;  4IM0 A;  4IWQ A;  5AZH A;  4EFO A;  2K6D B;  3ZO5 B;  1SIF A;  4W9D A;  2LD9 A;  1V86 A;  3N30 A;  4ANV A;  4EUT A;  1SE9 A;  2A5U A;  2KLG A;  2KJH B;  1VD2 A;  2K39 A;  3DBS A;  3PHW B;  4MDK E;  3K9O B;  2L76 A;  2ZCB A;  1TBE A;  4FAD A;  1WM3 A;  1V6E A;  2O6V D;  4ANX A;  2MBH A;  2J0J A;  1WXM A;  2KFJ A;  2M4N A;  3V61 A;  3V6E B;  2WDT B;  4MSQ B;  1WJ4 A;  3VH4 B;  1EF1 A;  2KWC A;  4KDI C;  4W9C A;  1J19 A;  2R2Q A;  1Z2M A;  3PHX B;  1WR6 E;  1WMH B;  4IUM B;  1V80 A;  5D94 A;  2DZJ A;  3A9K A;  4WQO B;  3T8M A;  4GU2 A;  4DDG D;  5JHA A;  2N9P C;  1U4A A;  2KQS A;  2LZ6 A;  4FHJ A;  3DBL I;  2UYZ B;  4JQW C;  3VTW A;  2NBW B;  3RYT A;  4WJQ A;  2M8S A;  2MSE D;  2NBU A;  2MBQ A;  2Z0E B;  3M62 B;  2NVU I;  1Z5S B;  2JVC A;  3SHQ A;  4K7S A;  4PYZ A;  2VRR B;  4NNJ B;  3A4S C;  3S2A A;  2CHX A;  3QAR A;  3ZRF A;  2BYF A;  2JRH A;  3PV1 A;  1P0R A;  3HK0 A;  4MJS B;  2ZNV C;  3DQV A;  2DYO A;  4XC2 A;  3ZNZ B;  3ALB A;  4W9K A;  5LLI A;  1GNU A;  3CF6 E;  2K8B A;  3X23 A;  3I3T B;  2V3S A;  2D10 A;  1WGH A;  2BYV E;  3WAM A;  4G11 A;  4W9J A;  3IVF A;  5IAA C;  2NR2 A;  1ISN A;  2KN5 A;  2D07 B;  2WYQ A;  2R2O A;  3O65 B;  3ML8 A;  4KDL B;  5G2N A;  1LXD A;  1KLV A;  3AU4 A;  4F7Z A;  3R66 C;  2C9W B;  4AOF A;  5JH5 C;  5E6N A;  5D2M B;  4E3C A;  5EDS A;  1V5O A;  4KVG B;  3RCZ A;  3N3K B;  1WGY A;  2BWE S;  3M95 A;  2AL3 A;  5KHO A;  1OEY J;  3V6C B;  3P2B A;  1UBQ A;  2HTH A;  2KK8 A;  3W1S A;  4TQ1 A;  3GZN I;  4BBN F;  3QX1 A;  3SD5 A;  2A4Z A;  4DWF A;  3A33 B;  2PJH A;  3KUC B;  4A3P A;  1A5R A;  2NPT B;  3APF A;  3PRM B;  1WX7 A;  2NBV B;  3PVL A;  2W9N A;  4G50 A;  2RD0 A;  2L00 B;  3ZW3 A;  2KMC A;  3A9J A;  1EF5 A;  2GBJ A;  2MP2 B;  4NAW A;  2LXA A;  3T9L A;  3V60 A;  2LGX A;  4HXD A;  2KLC A;  2DZK A;  4BBN C;  1C1Y B;  1WRD B;  3UIO B;  2LVQ A;  3OJ3 A;  4AJY B;  5J2R A;  4NQL B;  4F1S A;  1RLF A;  3B08 A;  1LFD A;  2DX5 B;  2KC1 A;  3EFU A;  4BKS D;  4ZRI A;  3W1Y A;  4GN1 A;  3LDZ E;  3H6N A;  2O6V A;  4IW0 A;  3DBH I;  3IBE A;  1ZGU B;  3AUL A;  3TCA A;  2HD5 B;  2RPQ A;  2QHO A;  1J0G A;  1E8Y A;  2N7D A;  4NJ6 A;  2LGD A;  4DDI D;  1H8C A;  3CMM B;  4ANU A;  1KOT A;  4B6W A;  3A4R A;  1XQQ A;  1MG8 A;  2JWZ A;  4GDK B;  1V49 A;  3DOW A;  4X57 B;  2CS4 A;  4E74 A;  1IPG A;  2GOW A;  2MX2 A;  3QHT A;  5CHF A;  2ZPN A;  4XZ4 A;  1KM7 A;  2XEW A;  3CST A;  1GC7 A;  3AI5 A;  2AYO B;  3H7P A;  1WE6 A;  2M0X A;  1TZ1 A;  2I1J A;  2OJR A;  3DVG X;  2UWQ A;  3ZRC A;  4NY0 A;  1WZ3 A;  4BOS C;  3A9K B;  4W9L A;  1LM8 B;  3VTU A;  4DHJ B;  1J8C A;  1Q1O A;  2DAF A;  4GOC A;  4CHK A;  3RUL A;  2BWF A;  2GBM A;  1NDD A;  4EOY A;  4LJP B;  3PZD A;  4PS3 A;  3TJP A;  1R4M I;  4WJP A;  4CYE A;  2BF8 B;  4AWJ A;  2KDI A;  1WR1 A;  2ZZP B;  1YX6 B;  2CKH B;  2MBB B;  1L7Y A;  1WM2 A;  4F8C B;  5LXH A;  4E71 A;  2MRP A;  1IP9 A;  4PS7 A;  4KZ0 A;  1V2Y A;  4AJW A;  1WJN A;  2AEH A;  3EEC A;  3PRE A;  1S1Q B;  2KAN A;  2IO3 B;  2KDF B;  5L95 C;  3UGB B;  3W1S C;  4G0N B;  2V4L A;  4TV3 A;  2D3G A;  3KVF B;  4FHK A;  4ICV A;  3B0A A;  1T0Y A;  1UEL A;  4BKG A;  2IBI B;  3IFW B; 
#chains in the Genus database with same CATH topology
 4FBJ B;  4K81 A;  2N7J A;  1C3T A;  4MT5 A;  3OJ4 B;  4URK A;  1VZ7 A;  4GDL A;  3VXW A;  4JX1 C;  2IY0 B;  2H89 B;  1FNV A;  2XBB C;  1DGJ A;  1WFY A;  5BYS A;  2BS4 B;  5EE0 A;  2KNB A;  1TKE A;  3ZGZ A;  4JE3 B;  3H9D A;  4W9E A;  2KMM A;  1WXA A;  4IM3 A;  2M56 B;  1YN5 A;  2WNM A;  1F2R I;  1ZXI A;  4LDT B;  1QT9 A;  1IYF A;  1WH3 A;  2KWU B;  2KZR A;  4BKS A;  4AUQ C;  1HTO A;  2W3S A;  4MH0 E;  1G6J A;  1T0R C;  3KH0 A;  4XDC A;  2INP E;  1FO4 A;  3APC A;  4W9G A;  1F0Z A;  1UNS A;  3N32 A;  4DXA B;  1I4P A;  2MA9 B;  3CIR B;  2NS5 A;  2KFK A;  5G55 A;  1F9J A;  4YWG G;  3FAH A;  2Z8L A;  2CR5 A;  5AUI A;  1L2N A;  5FR6 A;  2I1K A;  1NBF C;  4N59 A;  1YNT E;  3HVD A;  3TMP B;  2RDB C;  5BMH A;  1UWM A;  3T3N A;  1UGM A;  4MGK E;  3DWG C;  2DYM A;  3BYY B;  2X38 A;  1L6V A;  4KGT A;  1E7P B;  2AQ1 B;  3Q8A A;  2WWZ A;  2WU5 B;  1EO6 A;  4EZK A;  2L0F A;  2ZCC A;  4G3X B;  2QIE B;  1P9D U;  4AP4 C;  1V81 A;  4L23 A;  3R3M A;  1OEY A;  2NPT A;  1Q5W B;  1AN8 A;  2WS3 B;  1QOB A;  3M63 B;  1K52 A;  2DLB A;  1GC6 A;  3IHP C;  1MG4 A;  3DBH B;  3AE1 B;  1V8C A;  1XXG A;  4ZOH C;  4US8 A;  4YSZ B;  3P42 A;  2QDF A;  2K1F A;  2Z59 B;  3DBR I;  3VUY A;  2LI5 A;  2INN E;  4UDU C;  4HRS A;  2K22 A;  2WDR B;  3A1Q A;  4DXF A;  2ZJD A;  3V62 A;  4M0W A;  1V5T A;  5KHQ A;  4ASW C;  2HE7 A;  4PS8 A;  4W9I A;  2KXJ A;  4ICU A;  4NAM A;  4ZRJ A;  1S3S G;  1TJE A;  3QCA A;  3AN1 A;  3UI3 A;  3IT6 B;  4Q2J A;  1CMX B;  3VQI A;  3B1L X;  1HXY D;  2EKE C;  2QCZ A;  5LXI B;  5HHD G;  2TSS A;  1AWD A;  4C7Z A;  5IA7 A;  4USA A;  5JXV A;  1L0Y B;  1QOG A;  3W5U B;  3PGE A;  4I6N B;  2K25 A;  4ZHO A;  4OZA A;  5H92 C;  3AM9 A;  1DOX A;  1WY8 A;  3Q3N C;  2ZEQ A;  3WA0 A;  5AEK B;  2N9X A;  3UQA A;  2PKO A;  3CSF A;  2UU7 A;  4HVB A;  3LYY A;  4RGO S;  2LXC A;  4II3 B;  1E9M A;  2KMA A;  1K8R B;  2KWV B;  2GRI A;  2IO0 B;  4KSK C;  3ABV B;  2AL6 A;  4US9 A;  2BTE A;  3TUO A;  3H8H A;  4ZYN A;  2HJ1 A;  2HJ8 A;  1XLQ A;  2YVC A;  2RSU A;  3BIN A;  1T6B X;  3DVN V;  2W54 A;  1L4Z B;  1P3Q U;  2KTR A;  3AED B;  4JWS C;  1TYG B;  3VTV A;  3WAL A;  4HWI B;  2MJD A;  3RNB C;  5C3J B;  1RRB A;  3PS6 A;  3GS2 A;  3VAW A;  1QZE A;  3KWL A;  1EUV B;  5T8I A;  1PQS A;  4W9H A;  5G5H A;  2BBC A;  2PPH A;  2JXX A;  3EUB 2;  3DCG A;  3EC8 A;  3MTN B;  1JCK B;  5CHW A;  4FJY A;  4FUL A;  2M19 A;  3HM6 X;  1E6E B;  1D4B A;  1NI2 A;  2FUH B;  2MP2 A;  1IUE A;  1ZPS A;  3KUD B;  4BOZ B;  4WWP A;  2IY1 B;  1JWB D;  3Q8C A;  1WJU A;  2DZM A;  3RZW C;  4KV2 A;  5AZH A;  3P4P B;  3N30 A;  2SAK A;  2L1A A;  3RNF C;  2KJH B;  4MDK E;  1L6U A;  4ARI A;  3P1M A;  4ANX A;  2MBH A;  1WXM A;  2M4N A;  2WDT B;  1V97 A;  3MHZ A;  3P63 A;  3I63 C;  4W9C A;  1J19 A;  1WMH B;  3LXF A;  1SE3 A;  2GI9 A;  1HZ5 A;  1HQR D;  2N9P C;  3DBL I;  3AH7 A;  3RYT A;  3DHH C;  2M8S A;  1MPE A;  2NVU I;  1Z5S B;  4IDI A;  4YSY B;  1FNW A;  3A4S C;  3S2A A;  1OQQ A;  3ZRF A;  2JRH A;  3HK0 A;  1CK1 A;  4XC2 A;  3ALB A;  1OQR A;  2WDV B;  2IND C;  3SFD B;  1QKZ A;  3I3T B;  2NR2 A;  4S0R A;  3ZJU A;  3V05 A;  2E3T A;  4KKI A;  3N20 C;  2WP9 B;  3R66 C;  1GPX A;  3RNG C;  4P1C C;  4WH4 A;  1TS3 A;  5E6N A;  2OED A;  3RCZ A;  3MJ5 A;  1WGY A;  3M95 A;  3P2B A;  1D5X C;  2WXJ A;  3WCQ A;  1SF0 A;  3SD5 A;  4P6V F;  5E6J A;  4B0E A;  2V9H A;  4DWF A;  2PJH A;  1FNU A;  2NBV B;  3PVL A;  1WRI A;  3AEE B;  4G50 A;  1WGK A;  2L00 B;  2KMC A;  1XEE A;  4NAW A;  2LGX A;  5BYQ A;  4AJY B;  5FR3 A;  3B08 A;  1LFD A;  3MFG A;  2BVC A;  4ZRI A;  3NVZ A;  3LDZ E;  2J42 A;  4IW0 A;  3TCA A;  3AUL A;  4NJ6 A;  2LGD A;  4MAC A;  1H8C A;  3B9J A;  4B6W A;  1YQ3 B;  2WXI A;  1MG8 A;  4X57 B;  1IPG A;  3QHT A;  4XZ4 A;  3GZN B;  3H7P A;  3Q3M C;  1WE6 A;  2K0P A;  1V1P A;  2MJ3 A;  4BOS C;  3NG0 A;  2KYW A;  3A9K B;  3VTU A;  4DHJ B;  1LO5 D;  1N62 A;  2DAF A;  4LNN A;  4CHK A;  2ICI A;  2BWF A;  2GBM A;  5IN7 A;  3R2T A;  1L5P A;  3TJP A;  1RM6 C;  4WJP A;  2CKH B;  1L7Y A;  1WM2 A;  2QC8 A;  2RMM A;  1SEB D;  3AE8 B;  4KZ0 A;  2RPV A;  3UGB B;  4JWU C;  3KVF B;  3B0A A;  2RDH A;  5HFY A;  1E10 A;  2WXQ A;  4A6Q A;  4GMV A;  1J7A A;  4MEM A;  4II2 B;  1VJK A;  4L2Y A;  2IGD A;  4CQN A;  4KIK B;  3EHV A;  2WXF A;  4GSW A;  2IGH A;  5DPR A;  4DHZ B;  4EZJ A;  4A3O A;  1GOZ A;  1QQR A;  4MGZ E;  5D6J B;  3U30 A;  2JT4 B;  2HDE A;  2KKC A;  2KO3 A;  4RF0 A;  1RFA A;  3MJW A;  1C9F A;  2G45 B;  4HPL B;  4TKN A;  3BVG A;  4C4V A;  3ML9 A;  5HKH A;  4TQ0 A;  2LRU A;  2EEL A;  1V1O A;  4DK5 A;  1VLB A;  2KVR A;  1FCL A;  1YD8 U;  4C56 C;  1TGZ B;  3OG5 A;  4CO7 A;  2XNA C;  3QJZ A;  1NVI D;  1SJH D;  2D2Q A;  2WXG A;  2ZNV B;  2CU1 A;  5H8Y E;  4P16 A;  2E6X A;  3ZUN A;  2DAJ A;  1VCB A;  3OAW A;  1ZDV A;  2QIL A;  2AQ2 B;  1R7S A;  5DPT A;  1RWS A;  2RGF A;  3Q3J A;  2O2V A;  1F77 A;  3VUX A;  2LRW A;  2IJ0 A;  2QJL A;  5HG2 A;  1AW7 A;  4XWW A;  4JIO U;  3U2S C;  3AEF B;  4L1B A;  2KD0 A;  2DHZ A;  1EWC A;  2DYB A;  2BT6 A;  1ZW7 A;  2Y3A A;  3AE9 B;  2D11 A;  3ZJT A;  2J0K A;  3APD A;  1ET6 A;  1WI0 A;  3DHG C;  2D3B A;  3TL5 A;  3R7Q A;  3ZJV A;  3DPD A;  4LNF A;  1F52 A;  1B1Z A;  3AE7 B;  3U7D A;  4YT0 B;  4N9F 4;  3KLS X;  4OZC A;  3HIZ A;  2N1V A;  3Q3F A;  3Q3O C;  2L05 A;  3BYT B;  4DHZ E;  1TS4 A;  2ZPY A;  2QMT A;  4GDL B;  2MWS B;  3NS8 A;  2BGF A;  5LNK 1;  3VFK A;  1HZ6 A;  1N5W A;  2FBW B;  1X1M A;  1N60 A;  3NHE B;  1P98 A;  4LNI A;  1R4N I;  2VH1 A;  2KQ4 X;  2DWQ A;  3AV8 A;  1FD6 A;  3C8Y A;  2OOB B;  3JW0 X;  2IO1 B;  3ZXR A;  2LWP A;  5BMG A;  2WXN A;  2NTT A;  3H7S A;  1C4A A;  1I35 A;  4HCN B;  1YX5 B;  3KUZ A;  3KYC D;  3HM3 A;  1WGG A;  4WJO A;  3NUH B;  4XE0 A;  1GB4 A;  2JPH A;  1CJE A;  2KC2 A;  1ZP0 B;  2KFK B;  3PZ8 A;  4JL9 A;  1P7E A;  4NPN A;  1XO3 A;  3RI7 C;  3MC8 A;  2IYD B;  1GG3 A;  1K53 A;  4MGY E;  3RNE C;  5J18 A;  4WAA A;  5EE1 A;  3ZDM C;  4ANW A;  1P7F A;  3Q8E A;  1MHX A;  2EMS A;  3QWZ B;  1VR9 A;  2L7R A;  2L83 A;  4MM3 A;  3TEZ A;  3UF8 A;  2ZW1 A;  3QK0 A;  1UH6 A;  2BPS A;  4DHJ D;  1SB3 C;  5AZG A;  2J0M A;  2CJN A;  2LAS A;  3PTF C;  1NYQ A;  2JY6 A;  2RR9 A;  3C0R B;  2Y5P A;  4WIP A;  1I4Q A;  4LJO B;  4IM2 A;  4NQK E;  2MLB A;  3DHI C;  4EEW A;  1ACC A;  1M4V A;  5TR5 A;  3VDZ A;  1GB1 A;  4FJV B;  1XD3 B;  3PPA A;  1WWT A;  2V1Y A;  1SXT A;  1WX8 A;  3B2F A;  3K9P B;  3KW5 B;  3L10 B;  4J6I A;  2JX5 A;  4AS1 A;  2LUM A;  5TSS A;  3QC8 B;  1KRH A;  2ACZ B;  1OTR B;  4ACF A;  4ITK A;  5D7G A;  1D6E C;  2LGY A;  3NZS A;  4IWO A;  1FEH A;  1MVK A;  1WIA A;  1D5M C;  3A1Q B;  2CHZ A;  5BO4 B;  4M0W B;  2KOX A;  4YSX B;  2FCM A;  2PLP A;  3L54 A;  1NEK B;  2G1E A;  5DCN A;  2G4D B;  3EA6 A;  3L17 A;  3ZDT A;  1JRU A;  4JGH B;  4IWQ A;  4IM0 A;  2WQY B;  3ZO5 B;  4W9D A;  4ANV A;  4NZL B;  2CJO A;  1PDX A;  2K39 A;  3PHW B;  3K9O B;  4FAD A;  2O6V D;  3NVW A;  2KFJ A;  3V61 A;  3VH4 B;  3RNA C;  2KWC A;  3EGR A;  1EU4 A;  1TS2 A;  3RNC C;  2JWU A;  4LTU A;  2DZJ A;  3CWI A;  4WQO B;  4DDG D;  2LZ6 A;  1JWA D;  2UYZ B;  1D5Z C;  2NBW B;  2MSE D;  2Z0E B;  3M62 B;  3N9Y C;  1XCQ L;  5AUK A;  3Q14 C;  2BB6 A;  4PYZ A;  1TY0 A;  2CHX A;  1IGC A;  3AE2 B;  4MJS B;  4JPS A;  1UUP A;  3ZNZ B;  1GNU A;  1KTK A;  3NRZ A;  5D3D A;  1F1H A;  3VR9 B;  2KWD A;  3X23 A;  5FKA C;  1WGH A;  2BYV E;  2KAC A;  3WAM A;  2JYT A;  3ML8 A;  3V3X A;  1VRA B;  1T3Q A;  1JWM D;  2C9W B;  4WUR A;  1T0S C;  3DBL B;  4E3C A;  1C79 A;  1V5O A;  4KX6 B;  1JWS D;  3U52 E;  2AL3 A;  4D2K A;  3N1Z C;  1OEY J;  3V6C B;  3W1S A;  1STE A;  4BBN F;  2A4Z A;  3APF A;  1SIJ A;  1Q10 A;  2R61 A;  3A9J A;  4N6E B;  1EF5 A;  2MP2 B;  3BZD B;  3V60 A;  4BBN C;  4DQO C;  1C1Y B;  1WRD B;  3UIO B;  3OJ3 A;  5J2R A;  4F1S A;  2DX5 B;  4BKS D;  3W1Y A;  3H6N A;  3DBH I;  3NS1 A;  4WWM A;  3R8B A;  4DDI D;  3BK2 A;  4MH8 A;  1KOT A;  3AEG B;  2V3P A;  3A4R A;  1XQQ A;  2JWZ A;  4GDK B;  1A70 A;  4E74 A;  4C80 A;  1GC7 A;  2AYO B;  4NY0 A;  2MHJ A;  4S17 A;  1Q1O A;  4GOC A;  3RUL A;  1NDD A;  2KDI A;  3W2D A;  1WR1 A;  3ETR A;  5LXH A;  2LEK A;  4ARC A;  4PS7 A;  2LFI A;  1IP9 A;  1V2Y A;  2WXH A;  4M01 A;  1Y56 A;  1S1Q B;  2KDF B;  5L95 C;  2V4L A;  3Q6B A;  4FHK A;  4ICV A;  1T0Y A;  1UEL A;  3IFW B;  2ZVN A;  1FXA A;  4WWO A;  2LJI A;  2J53 A;  3FIL A;  3L08 A;  1C76 A;  3LB8 C;  2FNJ B;  2CHW A;  2LVP A;  3NZU A;  2LJ5 A;  3ZTC A;  2K3U A;  2BYT A;  2FCN A;  2M1M A;  1LGR A;  1YN4 A;  5MPO A;  1YMH E;  3SU8 X;  1NEN B;  1XCT L;  3BVZ A;  2L52 A;  1SJE D;  2N0S B;  1QF6 A;  1YIW A;  2V3N A;  4HPP A;  4YTM B;  4KKJ A;  1KFY B;  5DPS A;  3DWM A;  2LVO A;  1WXS A;  1WF9 A;  4HCP B;  2KJR A;  3ECI A;  1WGD A;  3WAN A;  2B3A A;  1HTQ A;  3PRZ A;  1DYQ A;  2Z0D B;  1PGB A;  1WMH A;  2L8J A;  2X8X X;  5D3I B;  1LQB A;  4KGR A;  4FA6 A;  1CZP A;  4O1N A;  3JSV A;  4P7I A;  4PYU A;  3ZNG C;  1KLU D;  3H1U A;  3QAQ A;  4FXC A;  2I38 A;  4WJN A;  2AQ3 B;  1I4R A;  2JZ3 B;  4HDQ A;  2AWT A;  3PLV A;  2IO2 B;  3GOE A;  1C4P A;  1UBI A;  2MH7 A;  3ZVV A;  3JVZ X;  3TEY A;  3IT4 B;  1IBX A;  3H7P B;  4ZDV A;  2XK5 B;  4A20 A;  1UWX A;  2XN9 C;  3RPF C;  5E6P A;  2I2Y A;  2LUE A;  3ENE A;  4RH6 A;  1XLP A;  1N5X A;  1TIF A;  2CU3 A;  3ZLZ A;  3IG3 A;  4IKG A;  3U7Z A;  1I7H A;  1YJI A;  3TBL D;  4A90 A;  1RAX A;  3M3J A;  2KQ7 A;  5C23 A;  2BKF A;  1ZDX A;  4C7Y A;  3AU5 A;  3AXC A;  2K5P A;  2WXO A;  1FRD A;  4M02 A;  2L0T A;  5HI1 A;  5L83 A;  4DBG A;  1UD7 A;  1T5X D;  2KHW B;  2N1W A;  1FXT B;  4TUU A;  3WAO A;  4N58 A;  1H4R A;  5E6O A;  2KDM A;  2G4S A;  4IC7 B;  2PEA A;  2GBK A;  3X0W A;  1YOV B;  1YN3 A;  1E7V A;  4LNO A;  1GUA B;  4C4V B;  2K8C A;  4WWN A;  3QA8 A;  1DOY A;  3VHT C;  3VVW B;  4GXB A;  1FRR A;  1V9J A;  3QQ8 B;  1E5W A;  3RD2 A;  4GGQ A;  3NOB A;  5DPW A;  1R4M B;  5BMI A;  2REX A;  4B9K A;  3EFC A;  2MEK A;  1D3Z A;  4HLE A;  2JXT A;  1YQB A;  3BWU D;  1F2R C;  1YJ1 A;  2IPK D;  4OW0 A;  4GB9 A;  5EE9 A;  2OJW A;  4YL8 A;  2IZV B;  1QOA A;  2NTS A;  1ESF A;  4LLG M;  2K8H A;  1E8Z A;  2WDQ B;  2O2V B;  1KH0 A;  2WX1 A;  5CHV C;  2C7M B;  5CX3 A;  2O6V B;  2LGI A;  3QIJ A;  3I57 A;  2VZK D;  1OQY A;  4KIK A;  1PGA A;  4EE2 A;  1JQ4 A;  1WXV A;  1SBB B;  3MC0 B;  1E8X A;  3SEB A;  2EKI A;  1XLN A;  2PE9 A;  2NCN A;  2J4X A;  2DZI A;  2LMC A;  1MI0 A;  4HPM B;  2FAZ A;  4OHJ A;  4MSM B;  1B9R A;  2N7E A;  2ON8 A;  1WJ6 A;  2JF5 A;  2FIF A;  3UQB A;  2L3Z A;  1E7U A;  4RMA A;  4HJG E;  3RT3 B;  2IDY A;  1WYW B;  3AE5 B;  4XYC A;  2YLM A;  1E8W A;  4K7W A;  3ZNI D;  4RF1 A;  2BYE A;  1AYF A;  3GP7 A;  3D32 A;  4BFR A;  3KQ4 A;  4FJZ A;  2JRI B;  2JYE A;  4A55 A;  3AMZ A;  4BKT A;  1ZOY B;  4K3B A;  3BY4 B;  2KX0 A;  3VH3 B;  3L13 A;  5JHB A;  2WHI A;  1FPY A;  4HK2 A;  1XLO A;  4FN2 A;  1PFD A;  2JUO A;  2KTF A;  2MBE A;  2ONQ A;  4HDO A;  4IOI E;  1FXI A;  4XDD A;  2K6D B;  1SIF A;  2LD9 A;  2MJE A;  2A5U A;  3DBS A;  1SSN A;  1GAQ B;  2L76 A;  1TBE A;  3V6E B;  3GE3 C;  1WJ4 A;  4KDI C;  1YQ4 B;  2R2Q A;  3PHX B;  1WR6 E;  5IOI A;  4IUM B;  1V80 A;  5D94 A;  5JHA A;  4GU2 A;  3PO0 A;  3VR8 B;  4FHJ A;  1T0Q C;  1K50 A;  4MM3 B;  2JVC A;  3SHQ A;  2WXL A;  4K3C A;  2BQQ A;  4REZ A;  1RFK A;  1N6Z A;  1VZ6 A;  3DBR B;  2PW9 A;  2BYF A;  1UGJ A;  1FFU A;  1UF0 A;  3N1X C;  3DQV A;  1C78 A;  1BUI C;  1L0X B;  4NJC A;  4W9K A;  5LLI A;  3AE4 B;  1K51 A;  3CF6 E;  4TMA B;  2WLB A;  5I4D A;  3RN9 C;  2QSD A;  3IAM 1;  1ISN A;  2KN5 A;  5FK9 C;  2R2O A;  5G2N A;  1KLV A;  4F7Z A;  3Q8F A;  3FC4 A;  3FKY A;  1JML A;  1SE4 A;  5EDS A;  2B76 B;  2BWE S;  2KK8 A;  4ZYS A;  4TQ1 A;  3NVY A;  2KVZ A;  5IO9 A;  5IKC M;  3A33 B;  4A3P A;  1A5R A;  2BW2 A;  2NPT B;  1I4G A;  3PRM B;  1TKG A;  4ZRP A;  2Y5C A;  4OVZ A;  3ZW3 A;  3T9L A;  4HXD A;  1TZO A;  2LVQ A;  4NQL B;  1RLF A;  3EFU A;  3MP9 A;  4GN1 A;  1FIQ A;  3IBE A;  1ZGU B;  2HD5 B;  1DOI A;  1CQV A;  2RPQ A;  2BB5 A;  2QHO A;  1J0G A;  1E8Y A;  4B0M A;  3AE6 B;  4A9A A;  4ANU A;  3DOW A;  3HRD D;  2JZP A;  1KM7 A;  1JRP A;  1TKY A;  2XEW A;  3CST A;  3Q8B A;  2M0X A;  1TZ1 A;  3BVM A;  1PGX A;  1ZE3 D;  3MC9 A;  3E56 A;  1LM8 B;  1J8C A;  2NMQ A;  2PTL A;  4J3O D;  1ROE A;  4LJP B;  3PZD A;  4PS3 A;  2WXK A;  4CYE A;  2ZZP B;  1YX6 B;  1FMA D;  2MRP A;  4AJW A;  1PYW D;  3EEC A;  3PRE A;  2KAN A;  4XGA B;  2H88 B;  3W1S C;  4G0N B;  4TV3 A;  1C77 A;  2WU2 B;  2IBI B;  5GMV A;  3R2I A;  1FCC C;  3LJ3 A;  3L16 A;  1QIL A;  4RM8 A;  1M94 A;  2GB1 A;  1N63 A;  3PT2 B;  1FFV A;  1Y8R C;  2G3Q B;  3HVZ A;  3ZYY X;  2W55 A;  3VRB B;  3B2G A;  2KDB A;  3ZIM A;  2KDE B;  3VUW A;  1GJZ A;  4JLC A;  4B95 A;  3T3O A;  3ONS A;  3IAS 1;  1WXQ A;  4QAY A;  1SE2 A;  2D3A A;  2JU6 X;  3MHS D;  2C7H A;  3DVG Y;  2OHF A;  3I9V 1;  4YTN B;  4WAF A;  3ZXV A;  2KTR B;  5JH5 C;  2FCS A;  1JRO A;  4GIV A;  4YTP B;  1MHH E;  2C60 A;  4NJ7 A;  1AAR A;  3A9J B;  2KAJ A;  2BS3 B;  3PLU A;  4RCO A;  4BAX A;  4HEA 1;  1WE7 A;  1ENF A;  2MQJ A;  2MW5 A;  1J7B A;  2PVO D;  1OGW A;  2JQR B;  3AEA B;  3HHM A;  2KN4 A;  2J52 A;  4KSL C;  4KZC A;  3NY5 A;  3RUI B;  3TEX A;  1HE8 A;  2MBO A;  4RFB A;  4MJS A;  3RZF A;  2Q5W D;  2KJ6 A;  2IGG A;  1I42 A;  1FM0 D;  1WSP A;  3TIX A;  5C1Z A;  2DNF A;  4W9F A;  1BXT A;  2KX3 A;  1BML C;  1VDV A;  1HA5 A;  1QLB B;  2GMI C;  3UIN B;  3BII D;  3OWE B;  3SFE B;  4EKU A;  4M8N A;  2ASQ A;  2VZK B;  1YJJ A;  3Q2A C;  2K6Q A;  1E90 A;  5AZF A;  3FIL B;  2J7Q B;  4R3D A;  4OVV A;  2Y5B B;  4LDT D;  2ZW0 A;  4MGI E;  2DEN B;  2W82 A;  1SGH A;  1KLG D;  4MEL A;  2PE6 B;  1ZXH A;  3DVN U;  4BVU C;  1KJT A;  4GDK A;  4RM9 A;  3ZKJ C;  1WYG A;  5GXG B;  2L32 A;  2VH2 A;  4TSS A;  1VZ8 A;  4WQM A;  2M0A A;  5CTR C;  4IWP A;  3DDC B;  3TSS A;  4YXD B;  1TS5 A;  2W3R A;  3PRP B;  2BKR B;  2M17 A;  3JSV B;  4PT5 A;  2PMV A;  1WX9 A;  4I6L B;  1P1A A;  1JW9 D;  1ZKH A;  3AE3 B;  3GE8 C;  2WXM A;  3RFZ B;  3ZNH B;  2C7N B;  3JYU A;  1ET9 A;  4BZA A;  2FCQ A;  1HEZ E;  1NYR A;  4ZRK A;  3NJT A;  4NAW B;  2C5L C;  3SDL C;  3AB5 A;  1IBX B;  1UZX B;  1I4X A;  4HJK A;  1J7C A;  3ZTD A;  4HRO A;  4DXG A;  5JZE B;  1TTN A;  3WIM A;  3U8Z A;  2MCN B;  4M00 A;  2D5G A;  3RMK C;  3AEC B;  4IG7 B;  3L0W B;  3P4R B;  4K1R B;  3N1Y C;  4KGS A;  2WX0 A;  1BT0 A;  3WAP A;  2SEB D;  2G9H D;  1KF6 B;  4GLS C;  2N9L A;  1V1P B;  4ZRQ A;  4HKZ E;  3U4E G;  1XT9 B;  1N61 A;  4FLH A;  1TY2 A;  3IXS A;  4RGT A;  3W5V B;  3L4P A;  3UIP B;  3URY A;  3TEW A;  4OZB A;  5J17 A;  4K7U A;  5IP4 D;  2HTM E;  2FE8 A;  1Q0W B;  3PSE B;  4LCD E;  3KYD D;  1L0V B;  4HKQ A;  2V4I B;  3R7R A;  2N9E B;  2N4F A;  1WZ0 A;  4OVU A;  2EMT A;  2JZZ A;  2ZVO A;  4ZHP A;  4A8X C;  2GBN A;  2FID A;  3OLM D;  1MJD A;  3SR6 A;  2GBR A;  4RGN A;  3BK1 A;  3KWV A;  4I6P A;  1E0Z A;  1WGR A;  4M8M A;  2XK5 A;  1IGD A;  4XX5 A;  1I4H A;  1C4C A;  4EFO A;  3PZ7 A;  1V86 A;  4EUT A;  1SE9 A;  2PIA A;  2KLG A;  1VD2 A;  2ZCB A;  1JAL A;  1WM3 A;  1OFF A;  1V6E A;  3GB1 A;  1JWU D;  2J0J A;  4MSQ B;  4XWT A;  1EF1 A;  2QEJ C;  1Z2M A;  2LHE A;  3A9K A;  3T8M A;  1U4A A;  2KQS A;  4RGM A;  4JQW C;  3VTW A;  3AEB B;  4WJQ A;  4RNA A;  2WXP A;  2NBU A;  2MBQ A;  4K7S A;  2V0G A;  3HUI A;  2VRR B;  2LGS A;  4NNJ B;  4LNK A;  3P4S B;  3QAR A;  3PV1 A;  1R4N B;  1P0R A;  2ZNV C;  2DYO A;  2YEP F;  2K8B A;  2V3S A;  2D10 A;  2LHD A;  4G11 A;  4W9J A;  3IVF A;  2WXR A;  5IAA C;  4LK0 M;  3W9C B;  2D07 B;  2WYQ A;  3O65 B;  4KDL B;  2WGS A;  3I5J C;  5G5G A;  1LXD A;  3AU4 A;  1TT5 B;  1XF5 L;  4AOF A;  1MFW A;  4H2A A;  5D2M B;  2DBY A;  3O13 A;  3P4Q B;  4KVG B;  2FUG 1;  2JSV X;  3N3K B;  5KHO A;  1UBQ A;  2HTH A;  3GZN I;  3QX1 A;  1QOF A;  3KUC B;  1L4D B;  1WX7 A;  5BYR A;  2W9N A;  3E9S A;  2RD0 A;  4EZL A;  2GBJ A;  2AX5 A;  2GLS A;  2LXA A;  2RDG A;  2KLC A;  2DZK A;  2YEP B;  3NZ3 A;  1EU3 A;  2KC1 A;  2PVG C;  3NVV A;  4C00 A;  2O6V A;  2BS2 B;  5EE3 A;  2N7D A;  4P1B C;  2D3C A;  3CMM B;  5C2T B;  2KT7 A;  3Q69 A;  1V49 A;  2CS4 A;  2GOW A;  2MX2 A;  5CHF A;  2ZPN A;  3J9C A;  1RYJ A;  3AI5 A;  1NI3 A;  1PUT A;  2I1J A;  3DVG X;  2OJR A;  4PK1 A;  1EM7 A;  2UWQ A;  3ZRC A;  1WZ3 A;  4W9L A;  4EOY A;  1R4M I;  3C19 A;  2BF8 B;  4AWJ A;  2K9X A;  2MBB B;  1ZUD 2;  4F8C B;  3VRA B;  4E71 A;  1WJN A;  2AEH A;  2INC C;  2IO3 B;  4AQ7 A;  2N9K A;  2D3G A;  4BKG A;  3ZQ4 A;  1EWY C; 
#chains in the Genus database with same CATH homology
 4FBJ B;  2ZVN A;  4GMV A;  4K81 A;  4WWO A;  5GMV A;  1C3T A;  3L08 A;  3OJ4 B;  4MEM A;  4URK A;  3LJ3 A;  3L16 A;  2FNJ B;  4II2 B;  2CHW A;  2LVP A;  4GDL A;  3VXW A;  3NZU A;  1M94 A;  4RM8 A;  2LJ5 A;  3RD2 A;  3ZTC A;  2FCN A;  2M1M A;  2IY0 B;  3PT2 B;  3EHV A;  4KIK B;  1Y8R C;  4GSW A;  2G3Q B;  5DPR A;  4DHZ B;  4EZJ A;  4A3O A;  2XBB C;  1WFY A;  4MGZ E;  5D6J B;  3SU8 X;  2JT4 B;  2KDB A;  3U30 A;  3ZIM A;  2KKC A;  2KDE B;  2KO3 A;  2KNB A;  1RFA A;  1YIW A;  3VUW A;  1GJZ A;  4JLC A;  3MJW A;  3H9D A;  4W9E A;  4B95 A;  2G45 B;  3ONS A;  4HPL B;  4TKN A;  1WXA A;  4IM3 A;  5DPS A;  3MHS D;  2LVO A;  1WXS A;  1WF9 A;  4HCP B;  4LDT B;  2C7H A;  2KJR A;  3ECI A;  3DVG Y;  1IYF A;  1WGD A;  3WAN A;  1WH3 A;  3ML9 A;  5HKH A;  2KWU B;  4TQ0 A;  2KZR A;  2B3A A;  2KTR B;  2LRU A;  4AUQ C;  2FCS A;  3PRZ A;  4GIV A;  4BKS A;  4DK5 A;  4MH0 E;  2C60 A;  1G6J A;  2Z0D B;  2L8J A;  1WMH A;  4NJ7 A;  1AAR A;  2KVR A;  3A9J B;  1YD8 U;  3KH0 A;  1TGZ B;  1LQB A;  4FA6 A;  4CO7 A;  3JSV A;  4P7I A;  3PLU A;  4PYU A;  3APC A;  4W9G A;  3ZNG C;  3H1U A;  3QAQ A;  1WE7 A;  3QJZ A;  3N32 A;  4WJN A;  2MQJ A;  4DXA B;  2MW5 A;  2MA9 B;  2D2Q A;  2ZNV B;  2JZ3 B;  2CU1 A;  1OGW A;  2NS5 A;  2KFK A;  5G55 A;  1F9J A;  3HHM A;  3ZUN A;  2AWT A;  2DAJ A;  1VCB A;  4HDQ A;  3PLV A;  2IO2 B;  4KSL C;  3OAW A;  4KZC A;  2CR5 A;  3NY5 A;  3RUI B;  1HE8 A;  3GOE A;  1L2N A;  2MBO A;  2I1K A;  5FR6 A;  1NBF C;  1UBI A;  4MJS A;  3RZF A;  2KJ6 A;  3ZVV A;  3JVZ X;  3TMP B;  1I42 A;  5DPT A;  2RGF A;  3H7P B;  3Q3J A;  2O2V A;  3TIX A;  5C1Z A;  1UGM A;  4ZDV A;  2XK5 B;  3VUX A;  4MGK E;  2LRW A;  4A20 A;  2DYM A;  4JIO U;  4W9F A;  2KD0 A;  2DHZ A;  2DYB A;  2KX3 A;  1ZW7 A;  5E6P A;  2LUE A;  3ENE A;  2D11 A;  3ZLZ A;  2J0K A;  3IG3 A;  3APD A;  1WI0 A;  2WWZ A;  2GMI C;  3TL5 A;  1EO6 A;  4EZK A;  3R7Q A;  3DPD A;  2L0F A;  3UIN B;  4EZL A;  2ZCC A;  4G3X B;  4EKU A;  3U7D A;  1P9D U;  4M8N A;  4N9F 4;  4AP4 C;  3TBL D;  1V81 A;  2ASQ A;  1RAX A;  3HIZ A;  3M3J A;  3ZDT A;  2N1V A;  3R3M A;  2KQ7 A;  2K6Q A;  5C23 A;  2BKF A;  1OEY A;  3Q3F A;  2NPT A;  1Q5W B;  1E90 A;  2L05 A;  5AZF A;  4DHZ E;  2ZPY A;  2J7Q B;  3AU5 A;  3AXC A;  3M63 B;  4OVV A;  4GDL B;  2MWS B;  2Y5B B;  4LDT D;  4MGI E;  1GC6 A;  3NS8 A;  2DEN B;  3IHP C;  1SGH A;  5L83 A;  2L0T A;  2BGF A;  4DBG A;  3VFK A;  1UD7 A;  2KHW B;  2N1W A;  4MEL A;  1FXT B;  4TUU A;  1X1M A;  3WAO A;  2K1F A;  2Z59 B;  1H4R A;  3DBR I;  3NHE B;  5E6O A;  1P98 A;  3VUY A;  2LI5 A;  2G4S A;  4IC7 B;  1R4N I;  2PE6 B;  2GBK A;  2PEA A;  3DVN U;  3A1Q A;  4BVU C;  3X0W A;  2ZJD A;  1KJT A;  3V62 A;  4GDK A;  4RM9 A;  3ZKJ C;  1V5T A;  5KHQ A;  4ASW C;  1E7V A;  2HE7 A;  4PS8 A;  1GUA B;  2K8C A;  2OOB B;  3JW0 X;  2KXJ A;  4ICU A;  2IO1 B;  4W9I A;  1S3S G;  3QA8 A;  4WWN A;  4ZRJ A;  3VHT C;  3VVW B;  4GXB A;  4IWP A;  2LWP A;  5CTR C;  3DDC B;  1V9J A;  3QQ8 B;  3H7S A;  1E5W A;  3QCA A;  1I35 A;  4HCN B;  1YX5 B;  2BKR B;  2M17 A;  3KUZ A;  3KYC D;  3NOB A;  3PRP B;  1CMX B;  3HM3 A;  3JSV B;  4GGQ A;  3VQI A;  5DPW A;  1WGG A;  4WJO A;  2REX A;  3B1L X;  4B9K A;  1WX9 A;  1D3Z A;  4HLE A;  2EKE C;  2JPH A;  2KC2 A;  4I6L B;  1P1A A;  5LXI B;  1ZKH A;  2KFK B;  4JL9 A;  1YQB A;  4NPN A;  1YJ1 A;  2IYD B;  3ZNH B;  5IA7 A;  1GG3 A;  4MGY E;  2C7N B;  3JYU A;  4GB9 A;  3PGE A;  4I6N B;  2FCQ A;  2K25 A;  4YL8 A;  5J18 A;  4WAA A;  4ZRK A;  1WY8 A;  2IZV B;  3ZDM C;  4NAW B;  2C5L C;  3SDL C;  2ZEQ A;  3WA0 A;  5AEK B;  4ANW A;  1UZX B;  2N9X A;  3UQA A;  4HJK A;  3ZTD A;  2K8H A;  2EMS A;  3QWZ B;  1E8Z A;  2L7R A;  2O2V B;  2WX1 A;  3CSF A;  4HVB A;  5CHV C;  4MM3 A;  2LXC A;  2C7M B;  5JZE B;  5CX3 A;  2O6V B;  1TTN A;  3WIM A;  3U8Z A;  3QIJ A;  2MCN B;  3UF8 A;  4II3 B;  1OQY A;  4KIK A;  3QK0 A;  1UH6 A;  2BPS A;  4DHJ D;  5AZG A;  2J0M A;  1WXV A;  2KMA A;  2LAS A;  3PTF C;  2JY6 A;  2RR9 A;  1K8R B;  2KWV B;  2IO0 B;  1E8X A;  3C0R B;  4IG7 B;  4LJO B;  4KSK C;  3L0W B;  4IM2 A;  4NQK E;  2MLB A;  2AL6 A;  4K1R B;  4EEW A;  2PE9 A;  2NCN A;  5TR5 A;  2WX0 A;  1BT0 A;  4ZYN A;  2DZI A;  3WAP A;  3VDZ A;  2HJ8 A;  4FJV B;  4HPM B;  2FAZ A;  2YVC A;  2RSU A;  1XD3 B;  3BIN A;  3DVN V;  4MSM B;  3PPA A;  1XT9 B;  2N7E A;  1P3Q U;  2V1Y A;  1WJ6 A;  2JF5 A;  4FLH A;  1WX8 A;  2FIF A;  2KTR A;  3K9P B;  2L3Z A;  3UQB A;  3VTV A;  3KW5 B;  3L10 B;  3WAL A;  1E7U A;  4HWI B;  4J6I A;  4RMA A;  1RRB A;  3RT3 B;  3QC8 B;  3PS6 A;  1WYW B;  3UIP B;  3VAW A;  1QZE A;  2YLM A;  1OTR B;  1EUV B;  5J17 A;  1E8W A;  4K7W A;  3ZNI D;  1PQS A;  4K7U A;  4W9H A;  5D7G A;  2BYE A;  2LGY A;  2PPH A;  2JXX A;  3D32 A;  3NZS A;  4FJZ A;  2JRI B;  4IWO A;  1Q0W B;  3DCG A;  3EC8 A;  3PSE B;  4LCD E;  4BKT A;  3KYD D;  3MTN B;  1WIA A;  5CHW A;  4FJY A;  3A1Q B;  3R7R A;  2N9E B;  2N4F A;  3BY4 B;  4FUL A;  2CHZ A;  1WZ0 A;  4OVU A;  2EMT A;  5BO4 B;  3HM6 X;  4M0W B;  2JZZ A;  2ZVO A;  4BFR A;  2KX0 A;  3VH3 B;  2KOX A;  2GBN A;  1NI2 A;  2FID A;  3L13 A;  3OLM D;  2FCM A;  2FUH B;  2MP2 A;  3KUD B;  4BOZ B;  4WWP A;  2GBR A;  2IY1 B;  5JHB A;  3L54 A;  4HK2 A;  1WJU A;  4I6P A;  5DCN A;  1WGR A;  2G4D B;  3L17 A;  2DZM A;  2XK5 A;  4M8M A;  4FN2 A;  4XX5 A;  3RZW C;  4KV2 A;  1JRU A;  2JUO A;  2KTF A;  2MBE A;  4HDO A;  4JGH B;  4IM0 A;  4IWQ A;  5AZH A;  4EFO A;  2K6D B;  3ZO5 B;  1SIF A;  4W9D A;  2LD9 A;  1V86 A;  3N30 A;  4ANV A;  4EUT A;  1SE9 A;  2A5U A;  2KLG A;  2KJH B;  1VD2 A;  2K39 A;  3DBS A;  3PHW B;  4MDK E;  3K9O B;  2L76 A;  2ZCB A;  1TBE A;  4FAD A;  1WM3 A;  1V6E A;  2O6V D;  4ANX A;  2MBH A;  2J0J A;  1WXM A;  2KFJ A;  2M4N A;  3V61 A;  3V6E B;  2WDT B;  4MSQ B;  1WJ4 A;  3VH4 B;  1EF1 A;  2KWC A;  4KDI C;  4W9C A;  1J19 A;  2R2Q A;  1Z2M A;  3PHX B;  1WR6 E;  1WMH B;  4IUM B;  1V80 A;  5D94 A;  2DZJ A;  3A9K A;  4WQO B;  3T8M A;  4GU2 A;  4DDG D;  5JHA A;  2N9P C;  1U4A A;  2KQS A;  2LZ6 A;  4FHJ A;  3DBL I;  2UYZ B;  4JQW C;  3VTW A;  2NBW B;  3RYT A;  4WJQ A;  2M8S A;  2MSE D;  2NBU A;  2MBQ A;  2Z0E B;  3M62 B;  2NVU I;  1Z5S B;  2JVC A;  3SHQ A;  4K7S A;  4PYZ A;  2VRR B;  4NNJ B;  3A4S C;  3S2A A;  2CHX A;  3QAR A;  3ZRF A;  2BYF A;  2JRH A;  3PV1 A;  1P0R A;  3HK0 A;  4MJS B;  2ZNV C;  3DQV A;  2DYO A;  4XC2 A;  3ZNZ B;  3ALB A;  4W9K A;  5LLI A;  1GNU A;  3CF6 E;  2K8B A;  3X23 A;  3I3T B;  2V3S A;  2D10 A;  1WGH A;  2BYV E;  3WAM A;  4G11 A;  4W9J A;  3IVF A;  5IAA C;  2NR2 A;  1ISN A;  2KN5 A;  2D07 B;  2WYQ A;  2R2O A;  3O65 B;  3ML8 A;  4KDL B;  5G2N A;  1LXD A;  1KLV A;  3AU4 A;  4F7Z A;  3R66 C;  2C9W B;  4AOF A;  5JH5 C;  5E6N A;  5D2M B;  4E3C A;  5EDS A;  1V5O A;  4KVG B;  3RCZ A;  3N3K B;  1WGY A;  2BWE S;  3M95 A;  2AL3 A;  5KHO A;  1OEY J;  3V6C B;  3P2B A;  1UBQ A;  2HTH A;  2KK8 A;  3W1S A;  4TQ1 A;  3GZN I;  4BBN F;  3QX1 A;  3SD5 A;  2A4Z A;  4DWF A;  3A33 B;  2PJH A;  3KUC B;  4A3P A;  1A5R A;  2NPT B;  3APF A;  3PRM B;  1WX7 A;  2NBV B;  3PVL A;  2W9N A;  4G50 A;  2RD0 A;  2L00 B;  3ZW3 A;  2KMC A;  3A9J A;  1EF5 A;  2GBJ A;  2MP2 B;  4NAW A;  2LXA A;  3T9L A;  3V60 A;  2LGX A;  4HXD A;  2KLC A;  2DZK A;  4BBN C;  1C1Y B;  1WRD B;  3UIO B;  2LVQ A;  3OJ3 A;  4AJY B;  5J2R A;  4NQL B;  4F1S A;  1RLF A;  3B08 A;  1LFD A;  2DX5 B;  2KC1 A;  3EFU A;  4BKS D;  4ZRI A;  3W1Y A;  4GN1 A;  3LDZ E;  3H6N A;  2O6V A;  4IW0 A;  3DBH I;  3IBE A;  1ZGU B;  3AUL A;  3TCA A;  2HD5 B;  2RPQ A;  2QHO A;  1J0G A;  1E8Y A;  2N7D A;  4NJ6 A;  2LGD A;  4DDI D;  1H8C A;  3CMM B;  4ANU A;  1KOT A;  4B6W A;  3A4R A;  1XQQ A;  1MG8 A;  2JWZ A;  4GDK B;  1V49 A;  3DOW A;  4X57 B;  2CS4 A;  4E74 A;  1IPG A;  2GOW A;  2MX2 A;  3QHT A;  5CHF A;  2ZPN A;  4XZ4 A;  1KM7 A;  2XEW A;  3CST A;  1GC7 A;  3AI5 A;  2AYO B;  3H7P A;  1WE6 A;  2M0X A;  1TZ1 A;  2I1J A;  2OJR A;  3DVG X;  2UWQ A;  3ZRC A;  4NY0 A;  1WZ3 A;  4BOS C;  3A9K B;  4W9L A;  1LM8 B;  3VTU A;  4DHJ B;  1J8C A;  1Q1O A;  2DAF A;  4GOC A;  4CHK A;  3RUL A;  2BWF A;  2GBM A;  1NDD A;  4EOY A;  4LJP B;  3PZD A;  4PS3 A;  3TJP A;  1R4M I;  4WJP A;  4CYE A;  2BF8 B;  4AWJ A;  2KDI A;  1WR1 A;  2ZZP B;  1YX6 B;  2CKH B;  2MBB B;  1L7Y A;  1WM2 A;  4F8C B;  5LXH A;  4E71 A;  2MRP A;  1IP9 A;  4PS7 A;  4KZ0 A;  1V2Y A;  4AJW A;  1WJN A;  2AEH A;  3EEC A;  3PRE A;  1S1Q B;  2KAN A;  2IO3 B;  2KDF B;  5L95 C;  3UGB B;  3W1S C;  4G0N B;  2V4L A;  4TV3 A;  2D3G A;  3KVF B;  4FHK A;  4ICV A;  3B0A A;  1T0Y A;  1UEL A;  4BKG A;  2IBI B;  3IFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...