5D6JB

Crystal structure of a mycobacterial protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of FadD32, an enzyme essential for mycolic acid biosynthesis in mycobacteria.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Ligase/protein binding
molecule keywords Acyl-CoA synthase
total genus 16
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5d6jB00
4B6WA 4BKSD 1XD3B 4GDKA 2D2QA 2KMCA 1ISNA 5E6PA 4HXDA 1GC7A 1E8XA 1LXDA 2MBOA 2LVPA 3EFUA 3HM3A 1R4MI 4GDKB 4JIOU 4MGYE 4E71A 3DBRI 5KHOA 4NQKE 3JYUA 2L0TA 3N32A 2V1YA 2IYDB 3R7QA 1J0GA 2L00B 4DHJB 4EEWA 2MBHA 3WANA 5DPSA 1SIFA 2HD5B 3N3KB 3ZLZA 1ZKHA 3ZVVA 3KVFB 3L17A 2O2VA 4NJ7A 4NAWB 3PRPB 2ASQA 4TQ1A 3VTWA 2CHZA 3ZRCA 3OLMD 3PT2B 4MEMA 4EUTA 3HK0A 2DAJA 3V62A 3R66C 1Q0WB 4GXBA 4ANVA 4K7SA 1WGHA 4JL9A 3L13A 4IWOA 2JZ3B 1KLVA 3APDA 1F9JA 4P7IA 2KDFB 3WIMA 5KHQA 1ZGUB 4OVUA 4ZRIA 1J19A 3VFKA 2EMTA 2JWZA 3S2AA 2MWSB 3KW5B 4B9KA 4F1SA 5J2RA 3ZTCA 2O6VB 3D32A 4DHJD 3ZW3A 2DZJA 3AU5A 3DQVA 2K25A 1E7VA 3DVGY 5DPTA 1IPGA 4FA6A 2GBJA 2OOBB 4F7ZA 5J18A 1IYFA 2D10A 5CHVC 3R7RA 2IY0B 4PYZA 1WM2A 2N7EA 4ZRKA 3AI5A 1E5WA 2LVOA 2JXXA 2RR9A 1WGYA 4RM9A 3TBLD 1FXTB 1WXMA 2K8CA 1V5TA 4BBNC 3DCGA 3PLVA 4K7UA 3ZDTA 3ML8A 3P2BA 5LLIA 3V61A 1KM7A 1XT9B 3NZUA 4FJZA 2YVCA 3GOEA 2LASA 1NDDA 3A33B 2MW5A 3AXCA 3ZNZB 3UQBA 2C5LC 2M1MA 4M0WB 3Q3JA 2IO3B 3PV1A 4A3PA 3EC8A 1VD2A 2R2QA 2RD0A 3IBEA 5JZEB 1Q5WB 3W1SC 4EZKA 2OJRA 1RAXA 4TKNA 3OAWA 2FCQA 2KJRA 2N7DA 2PE6B 3IG3A 3VUYA 2NS5A 4BKSA 3IFWB 3TCAA 3TL5A 3HIZA 2ZCCA 2FNJB 1WYWB 2K6DB 5L95C 5AZGA 5E6OA 2CKHB 1NBFC 1S3SG 4II3B 2KTFA 2D07B 4PS8A 1UBIA 2JUOA 3AULA 2JPHA 1OTRB 4X57B 3DPDA 2LRUA 3PREA 4JLCA 1WRDB 2KVRA 3MJWA 3UIPB 1E8ZA 3KUZA 4MGZE 1EUVB 3U30A 1U4AA 2KDBA 3CSTA 3PSEB 4GMVA 1TBEA 4BOZB 4FULA 1WM3A 2RGFA 1IP9A 4EFOA 2NBVB 2D11A 2N4FA 3K9PB 4KV2A 4FN2A 3NZSA 4NJ6A 2DAFA 2BWES 3ONSA 3VH4B 2Y5BB 4MELA 2NR2A 4LJPB 3R3MA 3EHVA 2L0FA 2BWFA 2KNBA 2IO2B 4NQLB 3SD5A 3NS8A 4GGQA 3LDZE 3VAWA 3JSVB 4GSWA 4W9GA 4CO7A 1WXVA 1LFDA 2BGFA 2JRIB 2L8JA 3GZNI 3TJPA 2J0KA 2KZRA 2KQ7A 2ZNVC 3QX1A 3LJ3A 4G0NB 4BKGA 5JHAA 2N1WA 4KZ0A 4BKTA 2KC2A 3UINB 3ZNGC 4W9EA 1J8CA 3RD2A 5FR6A 1WZ3A 2WDTB 1Z5SB 4BVUC 4ICUA 1YJ1A 3L0WB 5E6NA 2DHZA 2GOWA 1V6EA 3VQIA 2KANA 3JW0X 3QQ8B 2LXAA 3L08A 1EF1A 2C7MB 2I1KA 4HJKA 3PLUA 4XZ4A 3ZUNA 1E8YA 2KQSA 3B0AA 5EDSA 3OJ3A 2BKFA 3APCA 2KC1A 1R4NI 4HDOA 2IZVB 2FCMA 3DBLI 3V6EB 4KDIC 4KVGB 4PYUA 5AZHA 2NPTB 3M3JA 4URKA 4IW0A 3H7PB 1YX5B 2MA9B 4MM3A 2A4ZA 4JGHB 2O2VB 2MLBA 2RSUA 5TR5A 1CMXB 2ZEQA 3A9JA 2IO1B 5CHFA 4AWJA 4WJOA 4M8NA 4WJNA 2N1VA 4PS7A 4HPMB 2PJHA 3WALA 2BPSA 2Z0DB 4W9HA 3VVWB 1KOTA 4II2B 1OEYA 2HJ8A 3JVZX 3ZDMC 2VRRB 1MG8A 2KLCA 1HE8A 4MJSA 2YLMA 2EKEC 3SHQA 3Q3FA 2CU1A 3M62B 1G6JA 3BINA 4IM0A 1WF9A 4AJYB 3K9OB 2BKRB 2JRHA 2LZ6A 4TV3A 3WAPA 3UGBB 1JRUA 1V5OA 1K8RB 3T9LA 2KTRB 1EO6A 1WXSA 3W1SA 2LUEA 2KN5A 1RLFA 4GIVA 3MTNB 4ANXA 1P1AA 1WR1A 2V4LA 4FJVB 4HCPB 2XBBC 1WXAA 4ICVA 1H8CA 2MP2A 1GG3A 2BYVE 2DYOA 4XC2A 3ZRFA 2GBKA 4DWFA 2IY1B 3RZWC 4W9FA 3PRZA 4ANWA 3CF6E 2NBUA 3ENEA 3ZO5B 3M63B 3H1UA 3CMMB 4GU2A 3PS6A 4IWPA 2WX0A 2ZPNA 3NHEB 3B08A 1E8WA 4DHZB 4DK5A 3PGEA 2MRPA 4FBJB 4GN1A 1SGHA 2M4NA 4MGIE 1WMHA 1TGZB 2LVQA 5AZFA 2L05A 1H4RA 2G4DB 2KOXA 2XEWA 2KFJA 3L16A 4HK2A 4MH0E 1UBQA 3RCZA 4GDLA 5CTRC 4AOFA 3VUXA 2MSED 2CHXA 3A9KB 2DZMA 5C23A 2NBWB 2GBRA 2KDEB 4W9KA 1WFYA 2CHWA 2FUHB 2K8BA 2HE7A 1WJUA 1WE7A 3DBHI 2PE9A 3KUDB 2QHOA 2LI5A 2AEHA 2XK5A 5LXHA 2KFKB 3QA8A 1PQSA 2KWVB 3H7PA 3H9DA 3PRMB 4BBNF 2V3SA 3CSFA 2HTHA 1AARA 2PEAA 5D94A 2KO3A 3QJZA 4FHKA 4W9JA 2LJ5A 3TIXA 3RULA 2DZIA 3O65B 1WZ0A 3VTUA 1WH3A 2JT4B 2M8SA 5DPWA 4GB9A 1V2YA 1I42A 2AYOB 3PTFC 4G50A 2AWTA 4KZCA 2DENB 3QAQA 4NY0A 1VCBA 3L10B 1WI0A 2J0JA 4MDKE 1WX7A 2FIFA 2K39A 3QC8B 4WJQA 5CX3A 4ZYNA 2KFKA 1KJTA 4DBGA 4GOCA 3ZNHB 2K8HA 2KXJA 2CR5A 1UZXB 2G4SA 2JZZA 3DVNV 5D7GA 4RM8A 2L7RA 2LD9A 4A20A 2LRWA 3A1QA 1RFAA 1TZ1A 5CHWA 1V49A 4E3CA 4W9IA 2K1FA 1OQYA 2CS4A 4AUQC 1X1MA 3ZTDA 1V9JA 2ZVNA 1LM8B 2C7NB 4JQWC 4LJOB 2FCSA 4KDLB 4B95A 1YD8U 3KYCD 3HM6X 2W9NA 3SDLC 3DBSA 4KSLC 4MGKE 3DVGX 4I6NB 4FLHA 2L3ZA 5JHBA 1WIAA 1Y8RC 4IM3A 3KH0A 4WWOA 3WA0A 2I1JA 2KJHB 4G3XB 1YIWA 2DYBA 2KHWB 3VH3B 4I6PA 2IBIB 1GNUA 4DHZE 3QWZB 2MX2A 2KK8A 1XQQA 4KIKB 4K7WA 4MSMB 4HDQA 3DDCB 4EKUA 4M8MA 2C60A 3T8MA 1OEYJ 2LGXA 4LDTD 2EMSA 3PHWB 2AL6A 2MBBB 3X23A 3EECA 4HPLB 2Z59B 4BOSC 2MCNB 1Z2MA 3HHMA 1D3ZA 3QARA 3AU4A 1V86A 4OVVA 3W1YA 4WJPA 1V81A 2BYEA 4IC7B 5D2MB 2KX3A 2N9EB 2BYFA 2IO0B 3U8ZA 4HVBA 5GMVA 3NOBA 1UELA 1EF5A 2GMIC 4I6LB 4AJWA 2NVUI 2KD0A 4FJYA 5J17A 1WR6E 3WAOA 4KSKC 2KX0A 4ANUA 3C0RB 4K1RB 2KMAA 3DOWA 1P9DU 2PPHA 3KYDD 2DZKA 3QHTA 2GBNA 4LDTB 2O6VD 3ZIMA 4DDID 4PS3A 4ASWC 4IUMB 4MSQB 1T0YA 2O6VA 3OJ4B 2XK5B 4DDGD 2ZPYA 3B1LX 3PHXB 2C9WB 4W9CA 1L2NA 3A1QB 3UF8A 2KWCA 3QIJA 1OGWA 2KKCA 5C1ZA 1L7YA 2MQJA 5G2NA 2BF8B 4IM2A 1WGRA 2WYQA 1WJ4A 2M17A 3I3TB 2DX5B 1WX9A 1BT0A 2WWZA 3PVLA 4ZRJA 2K6QA 5HKHA 3ECIA 2KLGA 2D3GA 1LQBA 2NPTA 3VTVA 2ZNVB 1WJ6A 4NAWA 2LWPA 1I35A 3PZDA 3NY5A 1WGDA 2FAZA 5JH5C 4CHKA 1WMHB 2ZZPB 4HWIB 5LXIB 3A4SC 3VDZA 4EOYA 2G45B 2C7HA 1P3QU 1WGGA 1E90A 1Q1OA 2KWUB 2N9XA 3RUIB 4WWNA 3SU8X 5G55A 1NI2A 2G3QB 4FADA 4NNJB 3H7SA 2N9PC 3RYTA 3X0WA 4WWPA 2ZCBA 4TUUA 4WQOB 2JF5A 4HCNB 4A3OA 3ZNID 2M0XA 3BY4B 2UWQA 1C1YB 2NCNA 1YX6B 2LXCA 2LGYA 3KUCB 3N30A 2GBMA 4N9F4 2L76A 2RPQA 3UQAA 2MP2B 1GJZA 2J0MA 2Z0EB 2AL3A 4KIKA 5IA7A 1ZW7A 5IAAC 3RZFA 2UYZB 1RRBA 2KJ6A 4EZLA 2KTRA 1P0RA 4EZJA 3A4RA 3WAMA 3UIOB 1E7UA 3QK0A 2MBQA 3A9KA 3ALBA 4ZDVA 1WX8A 4IG7B 3VUWA 1WJNA 4XX5A 4DXAB 4GDLB 4TQ0A 4AP4C 4F8CB 1WE6A 3QCAA 2B3AA 1QZEA 3PPAA 5DCNA 3V60A 4MJSB 4E74A 1C3TA 3DVNU 1WY8A 3ML9A 4HLEA 2DYMA 1YQBA 2REXA 3IVFA 1P98A 3VXWA 4W9DA 4WAAA 4BFRA 4J6IA 3TMPB 3ZKJC 1GUAB 1V80A 2J7QB 2JY6A 5L83A 1SE9A 4LCDE 2WX1A 3L54A 1A5RA 3A9JB 4IWQA 3V6CB 5BO4B 3VHTC 4NPNA 3APFA 1UH6A 3U7DA 3H6NA 1GC6A 4YL8A 2ZVOA 3M95A 5D6JB 1M94A 2LGDA 2R2OA 1UGMA 4K81A 4G11A 2A5UA 4FHJA 4RMAA 2KDIA 2FCNA 1UD7A 3RT3B 3MHSD 2ZJDA 1TTNA 1S1QB 5DPRA 4CYEA 4W9LA 3JSVA 3IHPC 2FIDA 2MBEA 5AEKB 2JVCA
chains in the Genus database with same CATH superfamily
4B6WA 1XD3B 4GDKA 1T5XD 4HXDA 3HM3A 3BYYB 4MGYE 4NQKE 3CIRB 2V1YA 2IYDB 4O1NA 2AQ2B 2MBHA 3WANA 4N6EB 3ZLZA 3ZVVA 3L17A 3PRPB 2LHDA 3V62A 3TEWA 1AWDA 2GLSA 4HKQA 4GXBA 1YOVB 3NJTA 1YQ4B 1WGHA 1JROA 1N62A 1FFVA 1F9JA 3WIMA 5KHQA 1ZGUB 3S2AA 2MWSB 2VZKB 4P6VF 4DHJD 3D32A 4RGMA 2FBWB 3DQVA 3VR8B 4PK1A 1E7VA 5J18A 1OQQA 3V05A 2D10A 2IY0B 1PYWD 2E3TA 4ZRKA 1IGCA 5IP4D 1WGYA 4RM9A 1FXTB 4BBNC 3I9V1 4K7UA 4KGTA 1LGRA 3V61A 4YSXB 3GOEA 3N1YC 3LYYA 2MH7A 3L4PA 4YT0B 4JWUC 3ZNZB 4HJGE 4B0EA 2C5LC 1UNSA 3EA6A 3TEXA 4A3PA 3EC8A 3U7ZA 4CQNA 1DOXA 3IBEA 1Q5WB 4C4VB 2OJRA 1DGJA 1SIJA 1SSNA 2KJRA 4MH8A 3IG3A 2RDBC 3TL5A 3HIZA 1FRRA 1WYWB 4DXFA 2CKHB 1PGAA 4II3B 2KTFA 2JUOA 3AULA 2JPHA 2LRUA 1UWMA 1E8ZA 3ZGZA 2JQRB 3Q69A 3CSTA 1YJJA 1IP9A 4EFOA 3NZSA 2EKIA 2DAFA 3VH4B 3ONSA 2Y5BB 2NR2A 2L0FA 3ZYYX 4GGQA 2WXLA 4RCOA 1WXVA 1LFDA 3GZNI 2J0KA 5JHAA 4BKGA 3LJ3A 4G0NB 4KZ0A 4ZHPA 2I2YA 3UINB 5AUIA 5FR6A 1VDVA 4ICUA 1V6EA 1C9FA 2KANA 3AEAB 4XZ4A 3ZUNA 1E8YA 2KQSA 3B0AA 2BKFA 2I38A 3APCA 1R4NI 2IZVB 4PYUA 1QKZA 3AB5A 2MA9B 4JGHB 3ZJVA 4ITKA 3FILA 2RSUA 3A9JA 2IGHA 4AWJA 2BQQA 4W9HA 3VVWB 3Q3MC 4II2B 2QILA 2VRRB 1MG8A 2YLMA 2EKEC 1HZ6A 2CU1A 1G6JA 4AJYB 1QOFA 1STEA 1K8RB 4KX6B 2KTRB 3T3NA 4ANXA 1RLFA 4GIVA 2B76B 4FJVB 4HCPB 1GB1A 2BVCA 2K22A 2GBKA 1KH0A 4K3BA 2PTLA 3M63B 4GU2A 3I57A 4IWPA 3NHEB 2QDFA 1MPEA 3AN1A 3PGEA 4HROA 1RYJA 4FBJB 1JWAD 1SGHA 2M4NA 1M4VA 2M19A 2L05A 1H4RA 2LGSA 3ZJUA 2QMTA 4ZRQA 1L0VB 1EU4A 3GB1A 1KLGD 2NBWB 1ZUD2 2LFIA 1WXQA 4IOIE 2FUHB 2LGIA 1EU3A 2JYEA 2WXMA 2PE9A 3KUDB 3TUOA 2AEHA 1J7AA 2KFKB 2WDVB 3DWMA 4L2YA 1AARA 2G1EA 3DHHC 4L23A 3O65B 1WZ0A 1XCTL 1AYFA 4YTNB 1WH3A 2M8SA 4GB9A 1V2YA 2WXHA 2WGSA 1XLQA 2Y5PA 4G50A 2PVGC 4NY0A 1MG4A 1QOGA 1WI0A 3QC8B 5CX3A 4DBGA 2KFKA 1NYRA 4GOCA 3ZNHB 2G4SA 1UZXB 2JZZA 3DVNV 5D7GA 1MHHE 4A20A 1TKGA 3T3OA 2LRWA 1ET9A 1RFAA 1T0RC 1B1ZA 2K1FA 2KQ4X 2QC8A 4A6QA 1V9JA 2ZVNA 2C7NB 1I4GA 4JQWC 4LJOB 1YD8U 3HM6X 3DBSA 1EWYC 1TKEA 5BYQA 3RNGC 5JHBA 4IM3A 1Y8RC 4WWOA 1TS5A 2I1JA 2WS3B 1E9MA 1XO3A 1E0ZA 5IKCM 1GNUA 4HPPA 4KIKB 2RDHA 4M8MA 3GS2A 3LXFA 1VRAB 2MBBB 1GPXA 4BOSC 2INCC 3HHMA 1D5MC 4IC7B 2N9EB 3U8ZA 3Q8CA 2QJLA 3NOBA 5GMVA 2GMIC 1E7PB 2J52A 3C19A 5J17A 2X38A 4KSKC 2KX0A 3C0RB 3ZXRA 4K1RB 1P9DU 2VZKD 3KYDD 2BTEA 2DZKA 3QHTA 2GBNA 3W5UB 4MSQB 2O6VA 1SE2A 3GE3C 3OJ4B 1R4MB 4DDGD 2ZPYA 3PHXB 4RGTA 2MQJA 2BF8B 1WGRA 3RNEC 4ZRPA 4OW0A 2K6QA 2VH1A 2ZNVB 5D3DA 1PFDA 3NY5A 2WXOA 1J7CA 2ZZPB 3MJ5A 4HWIB 5LXIB 4EOYA 1P3QU 1WGGA 1E90A 3SU8X 4C7YA 3RYTA 4GLSC 2ZCBA 2GB1A 4TUUA 4A3OA 4HCNB 3TEYA 5BMGA 3DWGC 2N0SB 2NCNA 3N30A 1GJZA 4LNIA 1CJEA 2Z0EB 4KIKA 3RZFA 4EZLA 2WDQB 1P0RA 2K3UA 5C2TB 3A4RA 3AEFB 1VZ7A 3AM9A 2LMCA 2MBQA 4ZDVA 1WX8A 4IG7B 4DXAB 1WE6A 4ZHOA 1QZEA 1I4HA 4AS1A 2KMMA 2DYMA 1YQBA 2REXA 3P63A 1P98A 1L4DB 4WAAA 2JY6A 4IDIA 5AUKA 1FXAA 3A9JB 5BO4B 3U7DA 2ICIA 1YJIA 3M95A 4FXCA 4K3CA 1JWSD 1M94A 2XNAC 3RT3B 2HJ1A 2WXQA 1TTNA 3JSVA 2JVCA 2D2QA 4EE2A 2KMCA 2LVPA 1R4MI 2BBCA 4JIOU 1TY0A 3DBRI 4OZAA 1XF5L 2DNFA 3R7QA 4P16A 1V8CA 1N6ZA 3N9YC 2KN4A 3KVFB 2O2VA 3R2TA 1K50A 1SE3A 1PGXA 4YSZB 2ACZB 4K7SA 2Q5WD 4JL9A 4OVUA 1J19A 3VFKA 2JWZA 5E6JA 4USAA 3ZTCA 3EUB2 4WH4A 3FKYA 2DZJA 1I4RA 1IPGA 3BVZA 1IYFA 2OOBB 5CHVC 4PYZA 3RNCC 2V0GA 1E5WA 2JXXA 3HVZA 3TBLD 2K8CA 1FRDA 1V5TA 2BS2B 5LLIA 1C4PA 1UGJA 4XWWA 1XT9B 1SJED 4FJZA 2YVCA 2LASA 2OHFA 3AXCA 1UUPA 4YWGG 3NG0A 2QEJC 4M0WB 2IO3B 3PV1A 1GB4A 1VD2A 3VRAB 2RDGA 2R2QA 1LO5D 1N5WA 4TKNA 1FO4A 3NS1A 2M56B 2BT6A 2N9LA 2INNE 2WHIA 2ZCCA 1C4CA 2HDEA 5GXGB 4A8XC 3IXSA 1WWTA 4RGNA 4IKGA 5G5GA 1OTRB 2WP9B 4C80A 3PREA 1MVKA 3RMKC 3VR9B 4JLCA 1WRDB 4WAFA 3MJWA 2KDBA 4LNFA 4FULA 4XYCA 2D11A 2N4FA 1B9RA 1I7HA 3AE8B 4MELA 3R3MA 2BWFA 2WXNA 2KNBA 3VAWA 4GSWA 2L8JA 2KZRA 2MHJA 3QX1A 1XLOA 5HI1A 5TSSA 4A55A 3BVMA 2KC2A 2WLBA 1UWXA 3E56A 3Q2AC 5E6NA 2DHZA 1SB3C 1GAQB 2GRIA 3KWLA 3QQ8B 2LXAA 2I1KA 3PLUA 3J9CA 2JX5A 5EDSA 3OJ3A 4AQ7A 4WURA 4KVGB 3MC9A 2NPTB 3M3JA 2K9XA 5TR5A 1RWSA 1DYQA 2IO1B 3SFDB 5CHFA 4TMAB 4A90A 4M8NA 3NUHB 2BPSA 2Z0DB 1MFWA 1KOTA 1OEYA 2HJ8A 3JVZX 2KLCA 4M02A 2AX5A 1F52A 4MJSA 3ZXVA 3Q3FA 4LTUA 4P1CC 2YEPF 3M62B 4JPSA 4IM0A 2JRHA 4TV3A 1JRUA 1WXSA 3W1SA 2KN5A 3MTNB 2PMVA 5EE9A 4XGAB 4ICVA 4XC2A 4DWFA 3TEZA 4W9FA 3PRZA 3B9JA 3H1UA 5IO9A 1NEKB 2G9HD 3PS6A 2WU5B 1IBXB 2MRPA 1PDXA 4MGIE 1MI0A 2LVQA 5EE3A 2G4DB 1CQVA 3A9KB 2DZMA 2GBRA 2KDEB 1WFYA 2R61A 2QHOA 4XE0A 2XK5A 1PQSA 2KWVB 3R2IA 3V3XA 3CSFA 2HTHA 2PEAA 4LNOA 1FNUA 1NVID 2KO3A 3QJZA 1OQRA 4FHKA 2LJ5A 3TIXA 2DZIA 2TSSA 1TYGB 3VTUA 2JT4B 3RN9C 1RFKA 2AYOB 3PTFC 1GOZA 2LHEA 3QAQA 1ZDXA 1VCBA 3L10B 1WX7A 4XWTA 1KJTA 3P4QB 1L5PA 2K8HA 2KXJA 2CR5A 4M00A 2LD9A 1V49A 4DXGA 3KYCD 1AW7A 3SDLC 3VRBB 3DVGX 1FM0D 4FLHA 3NRZA 5H92C 3KH0A 3WA0A 2N7JA 4G3XB 3Q14C 1C76A 1V1PA 4DHZE 1BXTA 2BB5A 3AE3B 4HDQA 3DDCB 4EKUA 2C60A 3AEGB 3EECA 4HPLB 1ZDVA 4ACFA 1D3ZA 1NI3A 4OVVA 1WRIA 5BMHA 2BYFA 4WWMA 2AQ1B 1JALA 1XCQL 2KD0A 4FJYA 4KGRA 4YXDB 1TT5B 1NENB 1ZPSA 3DOWA 3RFZB 3ZIMA 1HTOA 2MJDA 1T0YA 4W9CA 5HHDG 3E9SA 1IBXA 2N9KA 2PKOA 3A1QB 3UF8A 2KWCA 1L7YA 5G2NA 4IM2A 3I3TB 2DX5B 3HUIA 1BT0A 4MT5A 5HKHA 1V1OA 2ZW0A 1LQBA 1WSPA 5H8YE 2L1AA 3W2DA 2BW2A 3A4SC 2KWUB 3RUIB 5G55A 4FADA 2JF5A 3ZNID 1HQRD 2UWQA 5MPOA 2L76A 2RPQA 2MP2B 4P1BC 3ZJTA 1JCKB 5IA7A 1ZW7A 2D3BA 4ARCA 2UYZB 1RRBA 4KKIA 2KTRA 3WAMA 1E7UA 3VUWA 1WJNA 4XX5A 4GDLB 1F0ZA 3AE9B 3IT4B 1WY8A 3IVFA 1YNTE 3TMPB 5L83A 1SE9A 2WX1A 3L54A 1A5RA 3OWEB 4NPNA 2W3RA 1UH6A 1EM7A 3H6NA 2WQYB 4OZCA 1FNWA 1UGMA 4K81A 3TSSA 1K51A 4NAMA 2KAJA 2ZJDA 3U52E 4JE3B 4CYEA 4W9LA 4WQMA 3ML9A 2MBEA 5EE0A 3MFGA 1GC7A 3EFUA 1LXDA 4NZLB 1HZ5A 4JWSC 1T3QA 3DBLB 1F2RC 3JYUA 1KF6B 3N32A 1CZPA 2NTSA 2WU2B 1J0GA 5T8IA 2L00B 4DHJB 3MC0B 1JWBD 5DPSA 2HD5B 3N3KB 1ZKHA 4NJ7A 1FCLA 3OLMD 3PT2B 3HK0A 4REZA 1I4XA 2Y3AA 1KLVA 3APDA 3AECB 3IAS1 4YTPB 1ZE3D 4ZRIA 3RPFC 2V3PA 5BYRA 5IOIA 2O6VB 4LNKA 3ZW3A 3LB8C 2PIAA 3AU5A 5DPTA 4FA6A 3R7RA 1WM2A 2UU7A 3AI5A 1FFUA 2QSDA 1QF6A 4US8A 3PLVA 4TSSA 3ML8A 1HTQA 3NZUA 2QIEB 2MW5A 3A33B 3Q3JA 4YSYB 3NVZA 2ON8A 2MEKA 2RD0A 3P1MA 5JZEB 3W1SC 4EZKA 1VLBA 3OAWA 2FCQA 1HEZE 3AEEB 4BKSA 3IFWB 3TCAA 4N58A 3IT6B 4WIPA 2K6DB 5E6OA 2HTME 1NBFC 1S3SG 3I5JC 1UBIA 2WXIA 3EFCA 4X57B 3DPDA 1P7FA 1EUVB 1NYQA 1U4AA 4R3DA 3PSEB 3MP9A 1TBEA 1DOYA 3W5VB 1WM3A 2J4XA 3K9PB 3CWIA 2BWES 3R8BA 4LJPB 3EHVA 1L6UA 2IO2B 3NS8A 3JSVB 4W9GA 2BGFA 3TJPA 2SEBD 1D4BA 1HA5A 2V4IB 2CU3A 3ZNGC 1J8CA 1XLNA 3Q8AA 3RD2A 1WZ3A 4PT5A 1J7BA 1Z5SB 4BVUC 1JWUD 3L0WB 1KFYB 1K52A 1SEBD 1ZP0B 3JW0X 2LUMA 2Y5CA 2C7MB 4HJKA 1C79A 2WXKA 1QLBB 2W54A 2XN9C 2KC1A 3BIID 3DBRB 4KDIC 2INDC 3KQ4A 4MM3A 1YX5B 3H7PB 2OJWA 1A70A 2CJOA 3RI7C 2JZPA 1CMXB 2ZEQA 4WJNA 2N1VA 1R4NB 2H89B 2PVOD 3ZDMC 4LK0M 3ABVB 3BINA 3K9OB 2BKRB 3Q8EA 1YN5A 1V5OA 4DQOC 3BWUD 4RF0A 1EO6A 2LUEA 4BZAA 1D6EC 1L6VA 1H8CA 4Q2JA 4BAXA 1QILA 1GG3A 2BYVE 2DYOA 1KRHA 3ZQ4A 2PLPA 3CF6E 3ZO5B 1ZXHA 2KWDA 2WX0A 2H88B 1P7EA 4DHZB 1EWCA 4DK5A 5EE1A 5I4DA 1CK1A 1QQRA 1WMHA 2EELA 5AZFA 2XEWA 2KFJA 3RCZA 1UBQA 4GDLA 3GZNB 1Y56A 1YN3A 2MSED 2CHXA 2RPVA 4RGOS 4W9KA 2K8BA 1ET6A 1WE7A 1BMLC 2LI5A 2D3AA 3QA8A 4BBNF 3H7PA 4MM3B 2IJ0A 1F77A 4W9JA 3RULA 4RFBA 1TS3A 1PUTA 5FR3A 5HFYA 5DPWA 2AQ3B 2JWUA 4KKJA 2VH2A 4KGSA 2WXFA 4KZCA 1C78A 1JRPA 1XEEA 2J0JA 2FIFA 3H8HA 4WJQA 3BK2A 1FD6A 4OZBA 4D2KA 4RM8A 3A1QA 1QOBA 5BMIA 4W9IA 1OQYA 4AUQC 1L0XB 1FEHA 1ACCA 4S0RA 1LM8B 4KSLC 4MGKE 1FCCC 1TKYA 2L3ZA 4RF1A 3BK1A 2DYBA 2KHWB 3VH3B 2LEKA 2KK8A 2L52A 2IDYA 4K7WA 4MSMB 3Q3NC 4US9A 3X23A 3Q3OC 2Z59B 2K5PA 2MCNB 4MACA 2ONQA 2NTTA 3W1YA 1V81A 4RNAA 1YQ3B 2IO0B 1JQ4A 4HVBA 4AJWA 1UELA 1EF5A 4I6LB 2NVUI 4ANUA 2PPHA 2O6VD 1Q10A 4ASWC 4IUMB 3Q8FA 3B1LX 2D3CA 1FNVA 3AE5B 1WX9A 2WWZA 3PVLA 4LLGM 2JSVX 2KLGA 2D3GA 3VTVA 1WJ6A 2LWPA 2X8XX 3PZDA 3AE1B 1WGDA 2IGDA 4CHKA 1I4PA 1WMHB 3VDZA 4ARIA 2C7HA 1C4AA 3AE2B 1Q1OA 2G3QB 4NNJB 2N9PC 3X0WA 4WWPA 4WQOB 4C4VA 4XDCA 3BY4B 3O13A 1D5ZC 1C1YB 1YX6B 2LGYA 2LXCA 2W55A 4N9F4 2LJIA 3UQAA 3SR6A 2KJ6A 3UIOB 3A9KA 1FIQA 2RMMA 4AP4C 2L32A 4LNNA 4F8CB 2ZW1A 2B3AA 3PPAA 5DCNA 1C3TA 4E74A 4HLEA 3VXWA 4J6IA 3NZ3A 3ZKJC 1GUAB 2FE8A 2W3SA 4HRSA 4M01A 3HVDA 4IWQA 3V6CB 3VHTC 2KACA 4JX1C 3APFA 1VZ8A 4YL8A 2ZVOA 2CJNA 5D6JB 3P4SB 3UI3A 4ZOHC 4G11A 5JXVA 4RMAA 2KDIA 1QOAA 3MHSD 1AN8A 1T0QC 1N5XA 5C3JB 1MJDA 2FIDA 4BKSD 5E6PA 1ISNA 2JU6X 3SFEB 1E8XA 2MBOA 4GDKB 1SBBB 2BYTA 4E71A 5KHOA 2L0TA 4NJCA 4EEWA 1SIFA 3P4RB 2FUG1 4TQ1A 4NAWB 2ASQA 2WNMA 3VTWA 2CHZA 3ZRCA 4H2AA 4MEMA 4EUTA 2DAJA 3HRDD 3R66C 1Q0WB 4ZYSA 4ANVA 3DHIC 3L13A 4IWOA 2JZ3B 3URYA 4HKZE 2KDFB 4P7IA 1WYGA 2EMTA 3KW5B 4B9KA 4F1SA 1VZ6A 2K0PA 5J2RA 2K25A 3DVGY 2GBJA 4F7ZA 2N7EA 1FMAD 2LVOA 2RR9A 2PW9A 3FAHA 1WXMA 3DCGA 1SJHD 3ZDTA 3P2BA 1KM7A 1RM6C 1NDDA 3UQBA 2M1MA 3AH7A 1F1HA 3WCQA 1R7SA 3KLSX 1IGDA 1RAXA 1E6EB 2E6XA 1HXYD 2N7DA 2PE6B 3VUYA 2NS5A 3MC8A 2FNJB 4A9AA 2KVZA 5L95C 2M0AA 5AZGA 1VJKA 2D07B 4PS8A 2KYWA 1YMHE 3NVVA 4C7ZA 2KVRA 3UIPB 3KUZA 4MGZE 3U30A 4GMVA 4YTMB 4BOZB 1V1PB 3B2FA 2RGFA 2NBVB 4KV2A 2W82A 4FN2A 4NJ6A 1DOIA 4NQLB 3SD5A 3LDZE 4QAYA 4CO7A 2JRIB 2ZNVC 2KQ7A 2NMQA 1C77A 5FKAC 2N1WA 4BKTA 4W9EA 1JWMD 1ZXIA 2WDTB 3GE8C 1E10A 3DBHB 1YJ1A 2GOWA 3KWVA 2BS4B 5IN7A 2WDRB 3VQIA 1TS2A 3GP7A 3L08A 1EF1A 2YEPB 5FK9C 1TZOA 3ETRA 1F2RI 3N20C 1PGBA 4HDOA 1K53A 2FCMA 3DBLI 3V6EB 2D5GA 3BVGA 5AZHA 4URKA 4IW0A 2GI9A 2A4ZA 3N1ZC 5BYSA 2O2VB 2MLBA 3OG5A 1SXTA 1TS4A 4WJOA 2J53A 1JW9D 4PS7A 4HPMB 2PJHA 3WALA 3NVYA 1WGKA 3Q6BA 3NVWA 1MHXA 1HE8A 3SHQA 2V9HA 5D3IB 1WF9A 3WAPA 2LZ6A 3UGBB 2QCZA 3MHZA 1N60A 3T9LA 1TY2A 3DHGC 2MJ3A 1P1AA 1WR1A 2V4LA 2WXRA 2XBBC 1WXAA 1L4ZB 2MP2A 3ZRFA 3U2SC 2IY1B 3RZWC 2KDMA 4ANWA 2NBUA 3ENEA 1ROEA 4J3OD 3CMMB 2ZPNA 3B08A 1E8WA 1QT9A 4GN1A 1TGZB 2DLBA 3U4EG 3AEDB 2KOXA 4MH0E 3L16A 4HK2A 5CTRC 4AOFA 3VUXA 1YN4A 1ESFA 5C23A 2DWQA 2L83A 2CHWA 2HE7A 1WJUA 1SF0A 3DBHI 1KTKA 5LXHA 3H9DA 3PRMB 2V3SA 5D94A 3AE4B 1ENFA 2KT7A 2MJEA 1I42A 4OVZA 4OHJA 2AWTA 3BYTB 4N59A 2DENB 1SE4A 3PO0A 2K39A 4S17A 4ZYNA 1UF0A 3I63C 2WXGA 2L7RA 1TZ1A 5CHWA 4E3CA 1OFFA 2CS4A 3AE7B 1X1MA 3ZTDA 3BZDB 1BUIC 2FCSA 3W9CB 3P4PB 4KDLB 4B95A 2W9NA 2JXTA 1N61A 2JYTA 3IAM1 4I6NB 5HG2A 3PZ7A 1WIAA 4XDDA 3AMZA 2KJHB 1YIWA 1T0SC 2DBYA 4I6PA 2IBIB 2SAKA 3QWZB 2MX2A 1XQQA 1N63A 2BB6A 3T8MA 1OEYJ 2LGXA 4LDTD 2EMSA 3PHWB 2AL6A 4C56C 2INPE 3P42A 4RH6A 1Z2MA 4HEA1 3QARA 3AU4A 4B0MA 1V86A 3B2GA 1IUEA 4WJPA 1FXIA 2BYEA 2Z8LA 3AV8A 5D2MB 2KX3A 1KLUD 3RNBC 1WR6E 1FPYA 3AE6B 3WAOA 2KMAA 1TIFA 1L0YB 4LDTB 3RNFC 4PS3A 4DDID 4M0WA 2IPKD 2J42A 2XK5B 3SEBA 2C9WB 1L2NA 5G5HA 3QIJA 1OGWA 2KKCA 5C1ZA 2WYQA 1TJEA 1WJ4A 2M17A 3FILB 4ZRJA 3ECIA 5LNK1 2NPTA 4NAWA 1I35A 5JH5C 2FAZA 4UDUC 2G45B 1XXGA 2N9XA 4WWNA 1NI2A 3H7SA 2M0XA 2IGGA 3KUCB 2GBMA 1I4QA 2J0MA 2AL3A 1XLPA 5IAAC 1V97A 4EZJA 2V3NA 3QK0A 3ALBA 3EGRA 4TQ0A 1D5XC 3QCAA 3V60A 4MJSB 3DVNU 3C8YA 1VR9A 4W9DA 4BFRA 1V80A 1ZOYB 2J7QB 4LCDE 4L1BA 1T6BX 3AEBB 2OEDA 3PZ8A 3N1XC 1GC6A 2WXJA 3FC4A 2WXPA 2LGDA 2R2OA 2A5UA 4FHJA 2FCNA 3RNAC 1UD7A 2BS3B 3Q8BA 4C00A 1S1QB 5DPRA 1JMLA 3IHPC 4MDKE 5AEKB
chains in the Genus database with same CATH topology
4B6WA 4BKSD 1XD3B 4GDKA 2D2QA 2KMCA 1ISNA 5E6PA 4HXDA 1GC7A 1E8XA 1LXDA 2MBOA 2LVPA 3EFUA 3HM3A 1R4MI 4GDKB 4JIOU 4MGYE 4E71A 3DBRI 5KHOA 4NQKE 3JYUA 2L0TA 3N32A 2V1YA 2IYDB 3R7QA 1J0GA 2L00B 4DHJB 4EEWA 2MBHA 3WANA 5DPSA 1SIFA 2HD5B 3N3KB 3ZLZA 1ZKHA 3ZVVA 3KVFB 3L17A 2O2VA 4NJ7A 4NAWB 3PRPB 2ASQA 4TQ1A 3VTWA 2CHZA 3ZRCA 3OLMD 3PT2B 4MEMA 4EUTA 3HK0A 2DAJA 3V62A 3R66C 1Q0WB 4GXBA 4ANVA 4K7SA 1WGHA 4JL9A 3L13A 4IWOA 2JZ3B 1KLVA 3APDA 1F9JA 4P7IA 2KDFB 3WIMA 5KHQA 1ZGUB 4OVUA 4ZRIA 1J19A 3VFKA 2EMTA 2JWZA 3S2AA 2MWSB 3KW5B 4B9KA 4F1SA 5J2RA 3ZTCA 2O6VB 3D32A 4DHJD 3ZW3A 2DZJA 3AU5A 3DQVA 2K25A 1E7VA 3DVGY 5DPTA 1IPGA 4FA6A 2GBJA 2OOBB 4F7ZA 5J18A 1IYFA 2D10A 5CHVC 3R7RA 2IY0B 4PYZA 1WM2A 2N7EA 4ZRKA 3AI5A 1E5WA 2LVOA 2JXXA 2RR9A 1WGYA 4RM9A 3TBLD 1FXTB 1WXMA 2K8CA 1V5TA 4BBNC 3DCGA 3PLVA 4K7UA 3ZDTA 3ML8A 3P2BA 5LLIA 3V61A 1KM7A 1XT9B 3NZUA 4FJZA 2YVCA 3GOEA 2LASA 1NDDA 3A33B 2MW5A 3AXCA 3ZNZB 3UQBA 2C5LC 2M1MA 4M0WB 3Q3JA 2IO3B 3PV1A 4A3PA 3EC8A 1VD2A 2R2QA 2RD0A 3IBEA 5JZEB 1Q5WB 3W1SC 4EZKA 2OJRA 1RAXA 4TKNA 3OAWA 2FCQA 2KJRA 2N7DA 2PE6B 3IG3A 3VUYA 2NS5A 4BKSA 3IFWB 3TCAA 3TL5A 3HIZA 2ZCCA 2FNJB 1WYWB 2K6DB 5L95C 5AZGA 5E6OA 2CKHB 1NBFC 1S3SG 4II3B 2KTFA 2D07B 4PS8A 1UBIA 2JUOA 3AULA 2JPHA 1OTRB 4X57B 3DPDA 2LRUA 3PREA 4JLCA 1WRDB 2KVRA 3MJWA 3UIPB 1E8ZA 3KUZA 4MGZE 1EUVB 3U30A 1U4AA 2KDBA 3CSTA 3PSEB 4GMVA 1TBEA 4BOZB 4FULA 1WM3A 2RGFA 1IP9A 4EFOA 2NBVB 2D11A 2N4FA 3K9PB 4KV2A 4FN2A 3NZSA 4NJ6A 2DAFA 2BWES 3ONSA 3VH4B 2Y5BB 4MELA 2NR2A 4LJPB 3R3MA 3EHVA 2L0FA 2BWFA 2KNBA 2IO2B 4NQLB 3SD5A 3NS8A 4GGQA 3LDZE 3VAWA 3JSVB 4GSWA 4W9GA 4CO7A 1WXVA 1LFDA 2BGFA 2JRIB 2L8JA 3GZNI 3TJPA 2J0KA 2KZRA 2KQ7A 2ZNVC 3QX1A 3LJ3A 4G0NB 4BKGA 5JHAA 2N1WA 4KZ0A 4BKTA 2KC2A 3UINB 3ZNGC 4W9EA 1J8CA 3RD2A 5FR6A 1WZ3A 2WDTB 1Z5SB 4BVUC 4ICUA 1YJ1A 3L0WB 5E6NA 2DHZA 2GOWA 1V6EA 3VQIA 2KANA 3JW0X 3QQ8B 2LXAA 3L08A 1EF1A 2C7MB 2I1KA 4HJKA 3PLUA 4XZ4A 3ZUNA 1E8YA 2KQSA 3B0AA 5EDSA 3OJ3A 2BKFA 3APCA 2KC1A 1R4NI 4HDOA 2IZVB 2FCMA 3DBLI 3V6EB 4KDIC 4KVGB 4PYUA 5AZHA 2NPTB 3M3JA 4URKA 4IW0A 3H7PB 1YX5B 2MA9B 4MM3A 2A4ZA 4JGHB 2O2VB 2MLBA 2RSUA 5TR5A 1CMXB 2ZEQA 3A9JA 2IO1B 5CHFA 4AWJA 4WJOA 4M8NA 4WJNA 2N1VA 4PS7A 4HPMB 2PJHA 3WALA 2BPSA 2Z0DB 4W9HA 3VVWB 1KOTA 4II2B 1OEYA 2HJ8A 3JVZX 3ZDMC 2VRRB 1MG8A 2KLCA 1HE8A 4MJSA 2YLMA 2EKEC 3SHQA 3Q3FA 2CU1A 3M62B 1G6JA 3BINA 4IM0A 1WF9A 4AJYB 3K9OB 2BKRB 2JRHA 2LZ6A 4TV3A 3WAPA 3UGBB 1JRUA 1V5OA 1K8RB 3T9LA 2KTRB 1EO6A 1WXSA 3W1SA 2LUEA 2KN5A 1RLFA 4GIVA 3MTNB 4ANXA 1P1AA 1WR1A 2V4LA 4FJVB 4HCPB 2XBBC 1WXAA 4ICVA 1H8CA 2MP2A 1GG3A 2BYVE 2DYOA 4XC2A 3ZRFA 2GBKA 4DWFA 2IY1B 3RZWC 4W9FA 3PRZA 4ANWA 3CF6E 2NBUA 3ENEA 3ZO5B 3M63B 3H1UA 3CMMB 4GU2A 3PS6A 4IWPA 2WX0A 2ZPNA 3NHEB 3B08A 1E8WA 4DHZB 4DK5A 3PGEA 2MRPA 4FBJB 4GN1A 1SGHA 2M4NA 4MGIE 1WMHA 1TGZB 2LVQA 5AZFA 2L05A 1H4RA 2G4DB 2KOXA 2XEWA 2KFJA 3L16A 4HK2A 4MH0E 1UBQA 3RCZA 4GDLA 5CTRC 4AOFA 3VUXA 2MSED 2CHXA 3A9KB 2DZMA 5C23A 2NBWB 2GBRA 2KDEB 4W9KA 1WFYA 2CHWA 2FUHB 2K8BA 2HE7A 1WJUA 1WE7A 3DBHI 2PE9A 3KUDB 2QHOA 2LI5A 2AEHA 2XK5A 5LXHA 2KFKB 3QA8A 1PQSA 2KWVB 3H7PA 3H9DA 3PRMB 4BBNF 2V3SA 3CSFA 2HTHA 1AARA 2PEAA 5D94A 2KO3A 3QJZA 4FHKA 4W9JA 2LJ5A 3TIXA 3RULA 2DZIA 3O65B 1WZ0A 3VTUA 1WH3A 2JT4B 2M8SA 5DPWA 4GB9A 1V2YA 1I42A 2AYOB 3PTFC 4G50A 2AWTA 4KZCA 2DENB 3QAQA 4NY0A 1VCBA 3L10B 1WI0A 2J0JA 4MDKE 1WX7A 2FIFA 2K39A 3QC8B 4WJQA 5CX3A 4ZYNA 2KFKA 1KJTA 4DBGA 4GOCA 3ZNHB 2K8HA 2KXJA 2CR5A 1UZXB 2G4SA 2JZZA 3DVNV 5D7GA 4RM8A 2L7RA 2LD9A 4A20A 2LRWA 3A1QA 1RFAA 1TZ1A 5CHWA 1V49A 4E3CA 4W9IA 2K1FA 1OQYA 2CS4A 4AUQC 1X1MA 3ZTDA 1V9JA 2ZVNA 1LM8B 2C7NB 4JQWC 4LJOB 2FCSA 4KDLB 4B95A 1YD8U 3KYCD 3HM6X 2W9NA 3SDLC 3DBSA 4KSLC 4MGKE 3DVGX 4I6NB 4FLHA 2L3ZA 5JHBA 1WIAA 1Y8RC 4IM3A 3KH0A 4WWOA 3WA0A 2I1JA 2KJHB 4G3XB 1YIWA 2DYBA 2KHWB 3VH3B 4I6PA 2IBIB 1GNUA 4DHZE 3QWZB 2MX2A 2KK8A 1XQQA 4KIKB 4K7WA 4MSMB 4HDQA 3DDCB 4EKUA 4M8MA 2C60A 3T8MA 1OEYJ 2LGXA 4LDTD 2EMSA 3PHWB 2AL6A 2MBBB 3X23A 3EECA 4HPLB 2Z59B 4BOSC 2MCNB 1Z2MA 3HHMA 1D3ZA 3QARA 3AU4A 1V86A 4OVVA 3W1YA 4WJPA 1V81A 2BYEA 4IC7B 5D2MB 2KX3A 2N9EB 2BYFA 2IO0B 3U8ZA 4HVBA 5GMVA 3NOBA 1UELA 1EF5A 2GMIC 4I6LB 4AJWA 2NVUI 2KD0A 4FJYA 5J17A 1WR6E 3WAOA 4KSKC 2KX0A 4ANUA 3C0RB 4K1RB 2KMAA 3DOWA 1P9DU 2PPHA 3KYDD 2DZKA 3QHTA 2GBNA 4LDTB 2O6VD 3ZIMA 4DDID 4PS3A 4ASWC 4IUMB 4MSQB 1T0YA 2O6VA 3OJ4B 2XK5B 4DDGD 2ZPYA 3B1LX 3PHXB 2C9WB 4W9CA 1L2NA 3A1QB 3UF8A 2KWCA 3QIJA 1OGWA 2KKCA 5C1ZA 1L7YA 2MQJA 5G2NA 2BF8B 4IM2A 1WGRA 2WYQA 1WJ4A 2M17A 3I3TB 2DX5B 1WX9A 1BT0A 2WWZA 3PVLA 4ZRJA 2K6QA 5HKHA 3ECIA 2KLGA 2D3GA 1LQBA 2NPTA 3VTVA 2ZNVB 1WJ6A 4NAWA 2LWPA 1I35A 3PZDA 3NY5A 1WGDA 2FAZA 5JH5C 4CHKA 1WMHB 2ZZPB 4HWIB 5LXIB 3A4SC 3VDZA 4EOYA 2G45B 2C7HA 1P3QU 1WGGA 1E90A 1Q1OA 2KWUB 2N9XA 3RUIB 4WWNA 3SU8X 5G55A 1NI2A 2G3QB 4FADA 4NNJB 3H7SA 2N9PC 3RYTA 3X0WA 4WWPA 2ZCBA 4TUUA 4WQOB 2JF5A 4HCNB 4A3OA 3ZNID 2M0XA 3BY4B 2UWQA 1C1YB 2NCNA 1YX6B 2LXCA 2LGYA 3KUCB 3N30A 2GBMA 4N9F4 2L76A 2RPQA 3UQAA 2MP2B 1GJZA 2J0MA 2Z0EB 2AL3A 4KIKA 5IA7A 1ZW7A 5IAAC 3RZFA 2UYZB 1RRBA 2KJ6A 4EZLA 2KTRA 1P0RA 4EZJA 3A4RA 3WAMA 3UIOB 1E7UA 3QK0A 2MBQA 3A9KA 3ALBA 4ZDVA 1WX8A 4IG7B 3VUWA 1WJNA 4XX5A 4DXAB 4GDLB 4TQ0A 4AP4C 4F8CB 1WE6A 3QCAA 2B3AA 1QZEA 3PPAA 5DCNA 3V60A 4MJSB 4E74A 1C3TA 3DVNU 1WY8A 3ML9A 4HLEA 2DYMA 1YQBA 2REXA 3IVFA 1P98A 3VXWA 4W9DA 4WAAA 4BFRA 4J6IA 3TMPB 3ZKJC 1GUAB 1V80A 2J7QB 2JY6A 5L83A 1SE9A 4LCDE 2WX1A 3L54A 1A5RA 3A9JB 4IWQA 3V6CB 5BO4B 3VHTC 4NPNA 3APFA 1UH6A 3U7DA 3H6NA 1GC6A 4YL8A 2ZVOA 3M95A 5D6JB 1M94A 2LGDA 2R2OA 1UGMA 4K81A 4G11A 2A5UA 4FHJA 4RMAA 2KDIA 2FCNA 1UD7A 3RT3B 3MHSD 2ZJDA 1TTNA 1S1QB 5DPRA 4CYEA 4W9LA 3JSVA 3IHPC 2FIDA 2MBEA 5AEKB 2JVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B6W A;  4BKS D;  1XD3 B;  4GDK A;  2D2Q A;  2KMC A;  1ISN A;  5E6P A;  4HXD A;  1GC7 A;  1E8X A;  1LXD A;  2MBO A;  2LVP A;  3EFU A;  3HM3 A;  1R4M I;  4GDK B;  4JIO U;  4MGY E;  4E71 A;  3DBR I;  5KHO A;  4NQK E;  3JYU A;  2L0T A;  3N32 A;  2V1Y A;  2IYD B;  3R7Q A;  1J0G A;  2L00 B;  4DHJ B;  4EEW A;  2MBH A;  3WAN A;  5DPS A;  1SIF A;  2HD5 B;  3N3K B;  3ZLZ A;  1ZKH A;  3ZVV A;  3KVF B;  3L17 A;  2O2V A;  4NJ7 A;  4NAW B;  3PRP B;  2ASQ A;  4TQ1 A;  3VTW A;  2CHZ A;  3ZRC A;  3OLM D;  3PT2 B;  4MEM A;  4EUT A;  3HK0 A;  2DAJ A;  3V62 A;  3R66 C;  1Q0W B;  4GXB A;  4ANV A;  4K7S A;  1WGH A;  4JL9 A;  3L13 A;  4IWO A;  2JZ3 B;  1KLV A;  3APD A;  1F9J A;  4P7I A;  2KDF B;  3WIM A;  5KHQ A;  1ZGU B;  4OVU A;  4ZRI A;  1J19 A;  3VFK A;  2EMT A;  2JWZ A;  3S2A A;  2MWS B;  3KW5 B;  4B9K A;  4F1S A;  5J2R A;  3ZTC A;  2O6V B;  3D32 A;  4DHJ D;  3ZW3 A;  2DZJ A;  3AU5 A;  3DQV A;  2K25 A;  1E7V A;  3DVG Y;  5DPT A;  1IPG A;  4FA6 A;  2GBJ A;  2OOB B;  4F7Z A;  5J18 A;  1IYF A;  2D10 A;  5CHV C;  3R7R A;  2IY0 B;  4PYZ A;  1WM2 A;  2N7E A;  4ZRK A;  3AI5 A;  1E5W A;  2LVO A;  2JXX A;  2RR9 A;  1WGY A;  4RM9 A;  3TBL D;  1FXT B;  1WXM A;  2K8C A;  1V5T A;  4BBN C;  3DCG A;  3PLV A;  4K7U A;  3ZDT A;  3ML8 A;  3P2B A;  5LLI A;  3V61 A;  1KM7 A;  1XT9 B;  3NZU A;  4FJZ A;  2YVC A;  3GOE A;  2LAS A;  1NDD A;  3A33 B;  2MW5 A;  3AXC A;  3ZNZ B;  3UQB A;  2C5L C;  2M1M A;  4M0W B;  3Q3J A;  2IO3 B;  3PV1 A;  4A3P A;  3EC8 A;  1VD2 A;  2R2Q A;  2RD0 A;  3IBE A;  5JZE B;  1Q5W B;  3W1S C;  4EZK A;  2OJR A;  1RAX A;  4TKN A;  3OAW A;  2FCQ A;  2KJR A;  2N7D A;  2PE6 B;  3IG3 A;  3VUY A;  2NS5 A;  4BKS A;  3IFW B;  3TCA A;  3TL5 A;  3HIZ A;  2ZCC A;  2FNJ B;  1WYW B;  2K6D B;  5L95 C;  5AZG A;  5E6O A;  2CKH B;  1NBF C;  1S3S G;  4II3 B;  2KTF A;  2D07 B;  4PS8 A;  1UBI A;  2JUO A;  3AUL A;  2JPH A;  1OTR B;  4X57 B;  3DPD A;  2LRU A;  3PRE A;  4JLC A;  1WRD B;  2KVR A;  3MJW A;  3UIP B;  1E8Z A;  3KUZ A;  4MGZ E;  1EUV B;  3U30 A;  1U4A A;  2KDB A;  3CST A;  3PSE B;  4GMV A;  1TBE A;  4BOZ B;  4FUL A;  1WM3 A;  2RGF A;  1IP9 A;  4EFO A;  2NBV B;  2D11 A;  2N4F A;  3K9P B;  4KV2 A;  4FN2 A;  3NZS A;  4NJ6 A;  2DAF A;  2BWE S;  3ONS A;  3VH4 B;  2Y5B B;  4MEL A;  2NR2 A;  4LJP B;  3R3M A;  3EHV A;  2L0F A;  2BWF A;  2KNB A;  2IO2 B;  4NQL B;  3SD5 A;  3NS8 A;  4GGQ A;  3LDZ E;  3VAW A;  3JSV B;  4GSW A;  4W9G A;  4CO7 A;  1WXV A;  1LFD A;  2BGF A;  2JRI B;  2L8J A;  3GZN I;  3TJP A;  2J0K A;  2KZR A;  2KQ7 A;  2ZNV C;  3QX1 A;  3LJ3 A;  4G0N B;  4BKG A;  5JHA A;  2N1W A;  4KZ0 A;  4BKT A;  2KC2 A;  3UIN B;  3ZNG C;  4W9E A;  1J8C A;  3RD2 A;  5FR6 A;  1WZ3 A;  2WDT B;  1Z5S B;  4BVU C;  4ICU A;  1YJ1 A;  3L0W B;  5E6N A;  2DHZ A;  2GOW A;  1V6E A;  3VQI A;  2KAN A;  3JW0 X;  3QQ8 B;  2LXA A;  3L08 A;  1EF1 A;  2C7M B;  2I1K A;  4HJK A;  3PLU A;  4XZ4 A;  3ZUN A;  1E8Y A;  2KQS A;  3B0A A;  5EDS A;  3OJ3 A;  2BKF A;  3APC A;  2KC1 A;  1R4N I;  4HDO A;  2IZV B;  2FCM A;  3DBL I;  3V6E B;  4KDI C;  4KVG B;  4PYU A;  5AZH A;  2NPT B;  3M3J A;  4URK A;  4IW0 A;  3H7P B;  1YX5 B;  2MA9 B;  4MM3 A;  2A4Z A;  4JGH B;  2O2V B;  2MLB A;  2RSU A;  5TR5 A;  1CMX B;  2ZEQ A;  3A9J A;  2IO1 B;  5CHF A;  4AWJ A;  4WJO A;  4M8N A;  4WJN A;  2N1V A;  4PS7 A;  4HPM B;  2PJH A;  3WAL A;  2BPS A;  2Z0D B;  4W9H A;  3VVW B;  1KOT A;  4II2 B;  1OEY A;  2HJ8 A;  3JVZ X;  3ZDM C;  2VRR B;  1MG8 A;  2KLC A;  1HE8 A;  4MJS A;  2YLM A;  2EKE C;  3SHQ A;  3Q3F A;  2CU1 A;  3M62 B;  1G6J A;  3BIN A;  4IM0 A;  1WF9 A;  4AJY B;  3K9O B;  2BKR B;  2JRH A;  2LZ6 A;  4TV3 A;  3WAP A;  3UGB B;  1JRU A;  1V5O A;  1K8R B;  3T9L A;  2KTR B;  1EO6 A;  1WXS A;  3W1S A;  2LUE A;  2KN5 A;  1RLF A;  4GIV A;  3MTN B;  4ANX A;  1P1A A;  1WR1 A;  2V4L A;  4FJV B;  4HCP B;  2XBB C;  1WXA A;  4ICV A;  1H8C A;  2MP2 A;  1GG3 A;  2BYV E;  2DYO A;  4XC2 A;  3ZRF A;  2GBK A;  4DWF A;  2IY1 B;  3RZW C;  4W9F A;  3PRZ A;  4ANW A;  3CF6 E;  2NBU A;  3ENE A;  3ZO5 B;  3M63 B;  3H1U A;  3CMM B;  4GU2 A;  3PS6 A;  4IWP A;  2WX0 A;  2ZPN A;  3NHE B;  3B08 A;  1E8W A;  4DHZ B;  4DK5 A;  3PGE A;  2MRP A;  4FBJ B;  4GN1 A;  1SGH A;  2M4N A;  4MGI E;  1WMH A;  1TGZ B;  2LVQ A;  5AZF A;  2L05 A;  1H4R A;  2G4D B;  2KOX A;  2XEW A;  2KFJ A;  3L16 A;  4HK2 A;  4MH0 E;  1UBQ A;  3RCZ A;  4GDL A;  5CTR C;  4AOF A;  3VUX A;  2MSE D;  2CHX A;  3A9K B;  2DZM A;  5C23 A;  2NBW B;  2GBR A;  2KDE B;  4W9K A;  1WFY A;  2CHW A;  2FUH B;  2K8B A;  2HE7 A;  1WJU A;  1WE7 A;  3DBH I;  2PE9 A;  3KUD B;  2QHO A;  2LI5 A;  2AEH A;  2XK5 A;  5LXH A;  2KFK B;  3QA8 A;  1PQS A;  2KWV B;  3H7P A;  3H9D A;  3PRM B;  4BBN F;  2V3S A;  3CSF A;  2HTH A;  1AAR A;  2PEA A;  5D94 A;  2KO3 A;  3QJZ A;  4FHK A;  4W9J A;  2LJ5 A;  3TIX A;  3RUL A;  2DZI A;  3O65 B;  1WZ0 A;  3VTU A;  1WH3 A;  2JT4 B;  2M8S A;  5DPW A;  4GB9 A;  1V2Y A;  1I42 A;  2AYO B;  3PTF C;  4G50 A;  2AWT A;  4KZC A;  2DEN B;  3QAQ A;  4NY0 A;  1VCB A;  3L10 B;  1WI0 A;  2J0J A;  4MDK E;  1WX7 A;  2FIF A;  2K39 A;  3QC8 B;  4WJQ A;  5CX3 A;  4ZYN A;  2KFK A;  1KJT A;  4DBG A;  4GOC A;  3ZNH B;  2K8H A;  2KXJ A;  2CR5 A;  1UZX B;  2G4S A;  2JZZ A;  3DVN V;  5D7G A;  4RM8 A;  2L7R A;  2LD9 A;  4A20 A;  2LRW A;  3A1Q A;  1RFA A;  1TZ1 A;  5CHW A;  1V49 A;  4E3C A;  4W9I A;  2K1F A;  1OQY A;  2CS4 A;  4AUQ C;  1X1M A;  3ZTD A;  1V9J A;  2ZVN A;  1LM8 B;  2C7N B;  4JQW C;  4LJO B;  2FCS A;  4KDL B;  4B95 A;  1YD8 U;  3KYC D;  3HM6 X;  2W9N A;  3SDL C;  3DBS A;  4KSL C;  4MGK E;  3DVG X;  4I6N B;  4FLH A;  2L3Z A;  5JHB A;  1WIA A;  1Y8R C;  4IM3 A;  3KH0 A;  4WWO A;  3WA0 A;  2I1J A;  2KJH B;  4G3X B;  1YIW A;  2DYB A;  2KHW B;  3VH3 B;  4I6P A;  2IBI B;  1GNU A;  4DHZ E;  3QWZ B;  2MX2 A;  2KK8 A;  1XQQ A;  4KIK B;  4K7W A;  4MSM B;  4HDQ A;  3DDC B;  4EKU A;  4M8M A;  2C60 A;  3T8M A;  1OEY J;  2LGX A;  4LDT D;  2EMS A;  3PHW B;  2AL6 A;  2MBB B;  3X23 A;  3EEC A;  4HPL B;  2Z59 B;  4BOS C;  2MCN B;  1Z2M A;  3HHM A;  1D3Z A;  3QAR A;  3AU4 A;  1V86 A;  4OVV A;  3W1Y A;  4WJP A;  1V81 A;  2BYE A;  4IC7 B;  5D2M B;  2KX3 A;  2N9E B;  2BYF A;  2IO0 B;  3U8Z A;  4HVB A;  5GMV A;  3NOB A;  1UEL A;  1EF5 A;  2GMI C;  4I6L B;  4AJW A;  2NVU I;  2KD0 A;  4FJY A;  5J17 A;  1WR6 E;  3WAO A;  4KSK C;  2KX0 A;  4ANU A;  3C0R B;  4K1R B;  2KMA A;  3DOW A;  1P9D U;  2PPH A;  3KYD D;  2DZK A;  3QHT A;  2GBN A;  4LDT B;  2O6V D;  3ZIM A;  4DDI D;  4PS3 A;  4ASW C;  4IUM B;  4MSQ B;  1T0Y A;  2O6V A;  3OJ4 B;  2XK5 B;  4DDG D;  2ZPY A;  3B1L X;  3PHX B;  2C9W B;  4W9C A;  1L2N A;  3A1Q B;  3UF8 A;  2KWC A;  3QIJ A;  1OGW A;  2KKC A;  5C1Z A;  1L7Y A;  2MQJ A;  5G2N A;  2BF8 B;  4IM2 A;  1WGR A;  2WYQ A;  1WJ4 A;  2M17 A;  3I3T B;  2DX5 B;  1WX9 A;  1BT0 A;  2WWZ A;  3PVL A;  4ZRJ A;  2K6Q A;  5HKH A;  3ECI A;  2KLG A;  2D3G A;  1LQB A;  2NPT A;  3VTV A;  2ZNV B;  1WJ6 A;  4NAW A;  2LWP A;  1I35 A;  3PZD A;  3NY5 A;  1WGD A;  2FAZ A;  5JH5 C;  4CHK A;  1WMH B;  2ZZP B;  4HWI B;  5LXI B;  3A4S C;  3VDZ A;  4EOY A;  2G45 B;  2C7H A;  1P3Q U;  1WGG A;  1E90 A;  1Q1O A;  2KWU B;  2N9X A;  3RUI B;  4WWN A;  3SU8 X;  5G55 A;  1NI2 A;  2G3Q B;  4FAD A;  4NNJ B;  3H7S A;  2N9P C;  3RYT A;  3X0W A;  4WWP A;  2ZCB A;  4TUU A;  4WQO B;  2JF5 A;  4HCN B;  4A3O A;  3ZNI D;  2M0X A;  3BY4 B;  2UWQ A;  1C1Y B;  2NCN A;  1YX6 B;  2LXC A;  2LGY A;  3KUC B;  3N30 A;  2GBM A;  4N9F 4;  2L76 A;  2RPQ A;  3UQA A;  2MP2 B;  1GJZ A;  2J0M A;  2Z0E B;  2AL3 A;  4KIK A;  5IA7 A;  1ZW7 A;  5IAA C;  3RZF A;  2UYZ B;  1RRB A;  2KJ6 A;  4EZL A;  2KTR A;  1P0R A;  4EZJ A;  3A4R A;  3WAM A;  3UIO B;  1E7U A;  3QK0 A;  2MBQ A;  3A9K A;  3ALB A;  4ZDV A;  1WX8 A;  4IG7 B;  3VUW A;  1WJN A;  4XX5 A;  4DXA B;  4GDL B;  4TQ0 A;  4AP4 C;  4F8C B;  1WE6 A;  3QCA A;  2B3A A;  1QZE A;  3PPA A;  5DCN A;  3V60 A;  4MJS B;  4E74 A;  1C3T A;  3DVN U;  1WY8 A;  3ML9 A;  4HLE A;  2DYM A;  1YQB A;  2REX A;  3IVF A;  1P98 A;  3VXW A;  4W9D A;  4WAA A;  4BFR A;  4J6I A;  3TMP B;  3ZKJ C;  1GUA B;  1V80 A;  2J7Q B;  2JY6 A;  5L83 A;  1SE9 A;  4LCD E;  2WX1 A;  3L54 A;  1A5R A;  3A9J B;  4IWQ A;  3V6C B;  5BO4 B;  3VHT C;  4NPN A;  3APF A;  1UH6 A;  3U7D A;  3H6N A;  1GC6 A;  4YL8 A;  2ZVO A;  3M95 A;  5D6J B;  1M94 A;  2LGD A;  2R2O A;  1UGM A;  4K81 A;  4G11 A;  2A5U A;  4FHJ A;  4RMA A;  2KDI A;  2FCN A;  1UD7 A;  3RT3 B;  3MHS D;  2ZJD A;  1TTN A;  1S1Q B;  5DPR A;  4CYE A;  4W9L A;  3JSV A;  3IHP C;  2FID A;  2MBE A;  5AEK B;  2JVC A; 
#chains in the Genus database with same CATH topology
 4B6W A;  1XD3 B;  4GDK A;  1T5X D;  4HXD A;  3HM3 A;  3BYY B;  4MGY E;  4NQK E;  3CIR B;  2V1Y A;  2IYD B;  4O1N A;  2AQ2 B;  2MBH A;  3WAN A;  4N6E B;  3ZLZ A;  3ZVV A;  3L17 A;  3PRP B;  2LHD A;  3V62 A;  3TEW A;  1AWD A;  2GLS A;  4HKQ A;  4GXB A;  1YOV B;  3NJT A;  1YQ4 B;  1WGH A;  1JRO A;  1N62 A;  1FFV A;  1F9J A;  3WIM A;  5KHQ A;  1ZGU B;  3S2A A;  2MWS B;  2VZK B;  4P6V F;  4DHJ D;  3D32 A;  4RGM A;  2FBW B;  3DQV A;  3VR8 B;  4PK1 A;  1E7V A;  5J18 A;  1OQQ A;  3V05 A;  2D10 A;  2IY0 B;  1PYW D;  2E3T A;  4ZRK A;  1IGC A;  5IP4 D;  1WGY A;  4RM9 A;  1FXT B;  4BBN C;  3I9V 1;  4K7U A;  4KGT A;  1LGR A;  3V61 A;  4YSX B;  3GOE A;  3N1Y C;  3LYY A;  2MH7 A;  3L4P A;  4YT0 B;  4JWU C;  3ZNZ B;  4HJG E;  4B0E A;  2C5L C;  1UNS A;  3EA6 A;  3TEX A;  4A3P A;  3EC8 A;  3U7Z A;  4CQN A;  1DOX A;  3IBE A;  1Q5W B;  4C4V B;  2OJR A;  1DGJ A;  1SIJ A;  1SSN A;  2KJR A;  4MH8 A;  3IG3 A;  2RDB C;  3TL5 A;  3HIZ A;  1FRR A;  1WYW B;  4DXF A;  2CKH B;  1PGA A;  4II3 B;  2KTF A;  2JUO A;  3AUL A;  2JPH A;  2LRU A;  1UWM A;  1E8Z A;  3ZGZ A;  2JQR B;  3Q69 A;  3CST A;  1YJJ A;  1IP9 A;  4EFO A;  3NZS A;  2EKI A;  2DAF A;  3VH4 B;  3ONS A;  2Y5B B;  2NR2 A;  2L0F A;  3ZYY X;  4GGQ A;  2WXL A;  4RCO A;  1WXV A;  1LFD A;  3GZN I;  2J0K A;  5JHA A;  4BKG A;  3LJ3 A;  4G0N B;  4KZ0 A;  4ZHP A;  2I2Y A;  3UIN B;  5AUI A;  5FR6 A;  1VDV A;  4ICU A;  1V6E A;  1C9F A;  2KAN A;  3AEA B;  4XZ4 A;  3ZUN A;  1E8Y A;  2KQS A;  3B0A A;  2BKF A;  2I38 A;  3APC A;  1R4N I;  2IZV B;  4PYU A;  1QKZ A;  3AB5 A;  2MA9 B;  4JGH B;  3ZJV A;  4ITK A;  3FIL A;  2RSU A;  3A9J A;  2IGH A;  4AWJ A;  2BQQ A;  4W9H A;  3VVW B;  3Q3M C;  4II2 B;  2QIL A;  2VRR B;  1MG8 A;  2YLM A;  2EKE C;  1HZ6 A;  2CU1 A;  1G6J A;  4AJY B;  1QOF A;  1STE A;  1K8R B;  4KX6 B;  2KTR B;  3T3N A;  4ANX A;  1RLF A;  4GIV A;  2B76 B;  4FJV B;  4HCP B;  1GB1 A;  2BVC A;  2K22 A;  2GBK A;  1KH0 A;  4K3B A;  2PTL A;  3M63 B;  4GU2 A;  3I57 A;  4IWP A;  3NHE B;  2QDF A;  1MPE A;  3AN1 A;  3PGE A;  4HRO A;  1RYJ A;  4FBJ B;  1JWA D;  1SGH A;  2M4N A;  1M4V A;  2M19 A;  2L05 A;  1H4R A;  2LGS A;  3ZJU A;  2QMT A;  4ZRQ A;  1L0V B;  1EU4 A;  3GB1 A;  1KLG D;  2NBW B;  1ZUD 2;  2LFI A;  1WXQ A;  4IOI E;  2FUH B;  2LGI A;  1EU3 A;  2JYE A;  2WXM A;  2PE9 A;  3KUD B;  3TUO A;  2AEH A;  1J7A A;  2KFK B;  2WDV B;  3DWM A;  4L2Y A;  1AAR A;  2G1E A;  3DHH C;  4L23 A;  3O65 B;  1WZ0 A;  1XCT L;  1AYF A;  4YTN B;  1WH3 A;  2M8S A;  4GB9 A;  1V2Y A;  2WXH A;  2WGS A;  1XLQ A;  2Y5P A;  4G50 A;  2PVG C;  4NY0 A;  1MG4 A;  1QOG A;  1WI0 A;  3QC8 B;  5CX3 A;  4DBG A;  2KFK A;  1NYR A;  4GOC A;  3ZNH B;  2G4S A;  1UZX B;  2JZZ A;  3DVN V;  5D7G A;  1MHH E;  4A20 A;  1TKG A;  3T3O A;  2LRW A;  1ET9 A;  1RFA A;  1T0R C;  1B1Z A;  2K1F A;  2KQ4 X;  2QC8 A;  4A6Q A;  1V9J A;  2ZVN A;  2C7N B;  1I4G A;  4JQW C;  4LJO B;  1YD8 U;  3HM6 X;  3DBS A;  1EWY C;  1TKE A;  5BYQ A;  3RNG C;  5JHB A;  4IM3 A;  1Y8R C;  4WWO A;  1TS5 A;  2I1J A;  2WS3 B;  1E9M A;  1XO3 A;  1E0Z A;  5IKC M;  1GNU A;  4HPP A;  4KIK B;  2RDH A;  4M8M A;  3GS2 A;  3LXF A;  1VRA B;  2MBB B;  1GPX A;  4BOS C;  2INC C;  3HHM A;  1D5M C;  4IC7 B;  2N9E B;  3U8Z A;  3Q8C A;  2QJL A;  3NOB A;  5GMV A;  2GMI C;  1E7P B;  2J52 A;  3C19 A;  5J17 A;  2X38 A;  4KSK C;  2KX0 A;  3C0R B;  3ZXR A;  4K1R B;  1P9D U;  2VZK D;  3KYD D;  2BTE A;  2DZK A;  3QHT A;  2GBN A;  3W5U B;  4MSQ B;  2O6V A;  1SE2 A;  3GE3 C;  3OJ4 B;  1R4M B;  4DDG D;  2ZPY A;  3PHX B;  4RGT A;  2MQJ A;  2BF8 B;  1WGR A;  3RNE C;  4ZRP A;  4OW0 A;  2K6Q A;  2VH1 A;  2ZNV B;  5D3D A;  1PFD A;  3NY5 A;  2WXO A;  1J7C A;  2ZZP B;  3MJ5 A;  4HWI B;  5LXI B;  4EOY A;  1P3Q U;  1WGG A;  1E90 A;  3SU8 X;  4C7Y A;  3RYT A;  4GLS C;  2ZCB A;  2GB1 A;  4TUU A;  4A3O A;  4HCN B;  3TEY A;  5BMG A;  3DWG C;  2N0S B;  2NCN A;  3N30 A;  1GJZ A;  4LNI A;  1CJE A;  2Z0E B;  4KIK A;  3RZF A;  4EZL A;  2WDQ B;  1P0R A;  2K3U A;  5C2T B;  3A4R A;  3AEF B;  1VZ7 A;  3AM9 A;  2LMC A;  2MBQ A;  4ZDV A;  1WX8 A;  4IG7 B;  4DXA B;  1WE6 A;  4ZHO A;  1QZE A;  1I4H A;  4AS1 A;  2KMM A;  2DYM A;  1YQB A;  2REX A;  3P63 A;  1P98 A;  1L4D B;  4WAA A;  2JY6 A;  4IDI A;  5AUK A;  1FXA A;  3A9J B;  5BO4 B;  3U7D A;  2ICI A;  1YJI A;  3M95 A;  4FXC A;  4K3C A;  1JWS D;  1M94 A;  2XNA C;  3RT3 B;  2HJ1 A;  2WXQ A;  1TTN A;  3JSV A;  2JVC A;  2D2Q A;  4EE2 A;  2KMC A;  2LVP A;  1R4M I;  2BBC A;  4JIO U;  1TY0 A;  3DBR I;  4OZA A;  1XF5 L;  2DNF A;  3R7Q A;  4P16 A;  1V8C A;  1N6Z A;  3N9Y C;  2KN4 A;  3KVF B;  2O2V A;  3R2T A;  1K50 A;  1SE3 A;  1PGX A;  4YSZ B;  2ACZ B;  4K7S A;  2Q5W D;  4JL9 A;  4OVU A;  1J19 A;  3VFK A;  2JWZ A;  5E6J A;  4USA A;  3ZTC A;  3EUB 2;  4WH4 A;  3FKY A;  2DZJ A;  1I4R A;  1IPG A;  3BVZ A;  1IYF A;  2OOB B;  5CHV C;  4PYZ A;  3RNC C;  2V0G A;  1E5W A;  2JXX A;  3HVZ A;  3TBL D;  2K8C A;  1FRD A;  1V5T A;  2BS2 B;  5LLI A;  1C4P A;  1UGJ A;  4XWW A;  1XT9 B;  1SJE D;  4FJZ A;  2YVC A;  2LAS A;  2OHF A;  3AXC A;  1UUP A;  4YWG G;  3NG0 A;  2QEJ C;  4M0W B;  2IO3 B;  3PV1 A;  1GB4 A;  1VD2 A;  3VRA B;  2RDG A;  2R2Q A;  1LO5 D;  1N5W A;  4TKN A;  1FO4 A;  3NS1 A;  2M56 B;  2BT6 A;  2N9L A;  2INN E;  2WHI A;  2ZCC A;  1C4C A;  2HDE A;  5GXG B;  4A8X C;  3IXS A;  1WWT A;  4RGN A;  4IKG A;  5G5G A;  1OTR B;  2WP9 B;  4C80 A;  3PRE A;  1MVK A;  3RMK C;  3VR9 B;  4JLC A;  1WRD B;  4WAF A;  3MJW A;  2KDB A;  4LNF A;  4FUL A;  4XYC A;  2D11 A;  2N4F A;  1B9R A;  1I7H A;  3AE8 B;  4MEL A;  3R3M A;  2BWF A;  2WXN A;  2KNB A;  3VAW A;  4GSW A;  2L8J A;  2KZR A;  2MHJ A;  3QX1 A;  1XLO A;  5HI1 A;  5TSS A;  4A55 A;  3BVM A;  2KC2 A;  2WLB A;  1UWX A;  3E56 A;  3Q2A C;  5E6N A;  2DHZ A;  1SB3 C;  1GAQ B;  2GRI A;  3KWL A;  3QQ8 B;  2LXA A;  2I1K A;  3PLU A;  3J9C A;  2JX5 A;  5EDS A;  3OJ3 A;  4AQ7 A;  4WUR A;  4KVG B;  3MC9 A;  2NPT B;  3M3J A;  2K9X A;  5TR5 A;  1RWS A;  1DYQ A;  2IO1 B;  3SFD B;  5CHF A;  4TMA B;  4A90 A;  4M8N A;  3NUH B;  2BPS A;  2Z0D B;  1MFW A;  1KOT A;  1OEY A;  2HJ8 A;  3JVZ X;  2KLC A;  4M02 A;  2AX5 A;  1F52 A;  4MJS A;  3ZXV A;  3Q3F A;  4LTU A;  4P1C C;  2YEP F;  3M62 B;  4JPS A;  4IM0 A;  2JRH A;  4TV3 A;  1JRU A;  1WXS A;  3W1S A;  2KN5 A;  3MTN B;  2PMV A;  5EE9 A;  4XGA B;  4ICV A;  4XC2 A;  4DWF A;  3TEZ A;  4W9F A;  3PRZ A;  3B9J A;  3H1U A;  5IO9 A;  1NEK B;  2G9H D;  3PS6 A;  2WU5 B;  1IBX B;  2MRP A;  1PDX A;  4MGI E;  1MI0 A;  2LVQ A;  5EE3 A;  2G4D B;  1CQV A;  3A9K B;  2DZM A;  2GBR A;  2KDE B;  1WFY A;  2R61 A;  2QHO A;  4XE0 A;  2XK5 A;  1PQS A;  2KWV B;  3R2I A;  3V3X A;  3CSF A;  2HTH A;  2PEA A;  4LNO A;  1FNU A;  1NVI D;  2KO3 A;  3QJZ A;  1OQR A;  4FHK A;  2LJ5 A;  3TIX A;  2DZI A;  2TSS A;  1TYG B;  3VTU A;  2JT4 B;  3RN9 C;  1RFK A;  2AYO B;  3PTF C;  1GOZ A;  2LHE A;  3QAQ A;  1ZDX A;  1VCB A;  3L10 B;  1WX7 A;  4XWT A;  1KJT A;  3P4Q B;  1L5P A;  2K8H A;  2KXJ A;  2CR5 A;  4M00 A;  2LD9 A;  1V49 A;  4DXG A;  3KYC D;  1AW7 A;  3SDL C;  3VRB B;  3DVG X;  1FM0 D;  4FLH A;  3NRZ A;  5H92 C;  3KH0 A;  3WA0 A;  2N7J A;  4G3X B;  3Q14 C;  1C76 A;  1V1P A;  4DHZ E;  1BXT A;  2BB5 A;  3AE3 B;  4HDQ A;  3DDC B;  4EKU A;  2C60 A;  3AEG B;  3EEC A;  4HPL B;  1ZDV A;  4ACF A;  1D3Z A;  1NI3 A;  4OVV A;  1WRI A;  5BMH A;  2BYF A;  4WWM A;  2AQ1 B;  1JAL A;  1XCQ L;  2KD0 A;  4FJY A;  4KGR A;  4YXD B;  1TT5 B;  1NEN B;  1ZPS A;  3DOW A;  3RFZ B;  3ZIM A;  1HTO A;  2MJD A;  1T0Y A;  4W9C A;  5HHD G;  3E9S A;  1IBX A;  2N9K A;  2PKO A;  3A1Q B;  3UF8 A;  2KWC A;  1L7Y A;  5G2N A;  4IM2 A;  3I3T B;  2DX5 B;  3HUI A;  1BT0 A;  4MT5 A;  5HKH A;  1V1O A;  2ZW0 A;  1LQB A;  1WSP A;  5H8Y E;  2L1A A;  3W2D A;  2BW2 A;  3A4S C;  2KWU B;  3RUI B;  5G55 A;  4FAD A;  2JF5 A;  3ZNI D;  1HQR D;  2UWQ A;  5MPO A;  2L76 A;  2RPQ A;  2MP2 B;  4P1B C;  3ZJT A;  1JCK B;  5IA7 A;  1ZW7 A;  2D3B A;  4ARC A;  2UYZ B;  1RRB A;  4KKI A;  2KTR A;  3WAM A;  1E7U A;  3VUW A;  1WJN A;  4XX5 A;  4GDL B;  1F0Z A;  3AE9 B;  3IT4 B;  1WY8 A;  3IVF A;  1YNT E;  3TMP B;  5L83 A;  1SE9 A;  2WX1 A;  3L54 A;  1A5R A;  3OWE B;  4NPN A;  2W3R A;  1UH6 A;  1EM7 A;  3H6N A;  2WQY B;  4OZC A;  1FNW A;  1UGM A;  4K81 A;  3TSS A;  1K51 A;  4NAM A;  2KAJ A;  2ZJD A;  3U52 E;  4JE3 B;  4CYE A;  4W9L A;  4WQM A;  3ML9 A;  2MBE A;  5EE0 A;  3MFG A;  1GC7 A;  3EFU A;  1LXD A;  4NZL B;  1HZ5 A;  4JWS C;  1T3Q A;  3DBL B;  1F2R C;  3JYU A;  1KF6 B;  3N32 A;  1CZP A;  2NTS A;  2WU2 B;  1J0G A;  5T8I A;  2L00 B;  4DHJ B;  3MC0 B;  1JWB D;  5DPS A;  2HD5 B;  3N3K B;  1ZKH A;  4NJ7 A;  1FCL A;  3OLM D;  3PT2 B;  3HK0 A;  4REZ A;  1I4X A;  2Y3A A;  1KLV A;  3APD A;  3AEC B;  3IAS 1;  4YTP B;  1ZE3 D;  4ZRI A;  3RPF C;  2V3P A;  5BYR A;  5IOI A;  2O6V B;  4LNK A;  3ZW3 A;  3LB8 C;  2PIA A;  3AU5 A;  5DPT A;  4FA6 A;  3R7R A;  1WM2 A;  2UU7 A;  3AI5 A;  1FFU A;  2QSD A;  1QF6 A;  4US8 A;  3PLV A;  4TSS A;  3ML8 A;  1HTQ A;  3NZU A;  2QIE B;  2MW5 A;  3A33 B;  3Q3J A;  4YSY B;  3NVZ A;  2ON8 A;  2MEK A;  2RD0 A;  3P1M A;  5JZE B;  3W1S C;  4EZK A;  1VLB A;  3OAW A;  2FCQ A;  1HEZ E;  3AEE B;  4BKS A;  3IFW B;  3TCA A;  4N58 A;  3IT6 B;  4WIP A;  2K6D B;  5E6O A;  2HTM E;  1NBF C;  1S3S G;  3I5J C;  1UBI A;  2WXI A;  3EFC A;  4X57 B;  3DPD A;  1P7F A;  1EUV B;  1NYQ A;  1U4A A;  4R3D A;  3PSE B;  3MP9 A;  1TBE A;  1DOY A;  3W5V B;  1WM3 A;  2J4X A;  3K9P B;  3CWI A;  2BWE S;  3R8B A;  4LJP B;  3EHV A;  1L6U A;  2IO2 B;  3NS8 A;  3JSV B;  4W9G A;  2BGF A;  3TJP A;  2SEB D;  1D4B A;  1HA5 A;  2V4I B;  2CU3 A;  3ZNG C;  1J8C A;  1XLN A;  3Q8A A;  3RD2 A;  1WZ3 A;  4PT5 A;  1J7B A;  1Z5S B;  4BVU C;  1JWU D;  3L0W B;  1KFY B;  1K52 A;  1SEB D;  1ZP0 B;  3JW0 X;  2LUM A;  2Y5C A;  2C7M B;  4HJK A;  1C79 A;  2WXK A;  1QLB B;  2W54 A;  2XN9 C;  2KC1 A;  3BII D;  3DBR B;  4KDI C;  2IND C;  3KQ4 A;  4MM3 A;  1YX5 B;  3H7P B;  2OJW A;  1A70 A;  2CJO A;  3RI7 C;  2JZP A;  1CMX B;  2ZEQ A;  4WJN A;  2N1V A;  1R4N B;  2H89 B;  2PVO D;  3ZDM C;  4LK0 M;  3ABV B;  3BIN A;  3K9O B;  2BKR B;  3Q8E A;  1YN5 A;  1V5O A;  4DQO C;  3BWU D;  4RF0 A;  1EO6 A;  2LUE A;  4BZA A;  1D6E C;  1L6V A;  1H8C A;  4Q2J A;  4BAX A;  1QIL A;  1GG3 A;  2BYV E;  2DYO A;  1KRH A;  3ZQ4 A;  2PLP A;  3CF6 E;  3ZO5 B;  1ZXH A;  2KWD A;  2WX0 A;  2H88 B;  1P7E A;  4DHZ B;  1EWC A;  4DK5 A;  5EE1 A;  5I4D A;  1CK1 A;  1QQR A;  1WMH A;  2EEL A;  5AZF A;  2XEW A;  2KFJ A;  3RCZ A;  1UBQ A;  4GDL A;  3GZN B;  1Y56 A;  1YN3 A;  2MSE D;  2CHX A;  2RPV A;  4RGO S;  4W9K A;  2K8B A;  1ET6 A;  1WE7 A;  1BML C;  2LI5 A;  2D3A A;  3QA8 A;  4BBN F;  3H7P A;  4MM3 B;  2IJ0 A;  1F77 A;  4W9J A;  3RUL A;  4RFB A;  1TS3 A;  1PUT A;  5FR3 A;  5HFY A;  5DPW A;  2AQ3 B;  2JWU A;  4KKJ A;  2VH2 A;  4KGS A;  2WXF A;  4KZC A;  1C78 A;  1JRP A;  1XEE A;  2J0J A;  2FIF A;  3H8H A;  4WJQ A;  3BK2 A;  1FD6 A;  4OZB A;  4D2K A;  4RM8 A;  3A1Q A;  1QOB A;  5BMI A;  4W9I A;  1OQY A;  4AUQ C;  1L0X B;  1FEH A;  1ACC A;  4S0R A;  1LM8 B;  4KSL C;  4MGK E;  1FCC C;  1TKY A;  2L3Z A;  4RF1 A;  3BK1 A;  2DYB A;  2KHW B;  3VH3 B;  2LEK A;  2KK8 A;  2L52 A;  2IDY A;  4K7W A;  4MSM B;  3Q3N C;  4US9 A;  3X23 A;  3Q3O C;  2Z59 B;  2K5P A;  2MCN B;  4MAC A;  2ONQ A;  2NTT A;  3W1Y A;  1V81 A;  4RNA A;  1YQ3 B;  2IO0 B;  1JQ4 A;  4HVB A;  4AJW A;  1UEL A;  1EF5 A;  4I6L B;  2NVU I;  4ANU A;  2PPH A;  2O6V D;  1Q10 A;  4ASW C;  4IUM B;  3Q8F A;  3B1L X;  2D3C A;  1FNV A;  3AE5 B;  1WX9 A;  2WWZ A;  3PVL A;  4LLG M;  2JSV X;  2KLG A;  2D3G A;  3VTV A;  1WJ6 A;  2LWP A;  2X8X X;  3PZD A;  3AE1 B;  1WGD A;  2IGD A;  4CHK A;  1I4P A;  1WMH B;  3VDZ A;  4ARI A;  2C7H A;  1C4A A;  3AE2 B;  1Q1O A;  2G3Q B;  4NNJ B;  2N9P C;  3X0W A;  4WWP A;  4WQO B;  4C4V A;  4XDC A;  3BY4 B;  3O13 A;  1D5Z C;  1C1Y B;  1YX6 B;  2LGY A;  2LXC A;  2W55 A;  4N9F 4;  2LJI A;  3UQA A;  3SR6 A;  2KJ6 A;  3UIO B;  3A9K A;  1FIQ A;  2RMM A;  4AP4 C;  2L32 A;  4LNN A;  4F8C B;  2ZW1 A;  2B3A A;  3PPA A;  5DCN A;  1C3T A;  4E74 A;  4HLE A;  3VXW A;  4J6I A;  3NZ3 A;  3ZKJ C;  1GUA B;  2FE8 A;  2W3S A;  4HRS A;  4M01 A;  3HVD A;  4IWQ A;  3V6C B;  3VHT C;  2KAC A;  4JX1 C;  3APF A;  1VZ8 A;  4YL8 A;  2ZVO A;  2CJN A;  5D6J B;  3P4S B;  3UI3 A;  4ZOH C;  4G11 A;  5JXV A;  4RMA A;  2KDI A;  1QOA A;  3MHS D;  1AN8 A;  1T0Q C;  1N5X A;  5C3J B;  1MJD A;  2FID A;  4BKS D;  5E6P A;  1ISN A;  2JU6 X;  3SFE B;  1E8X A;  2MBO A;  4GDK B;  1SBB B;  2BYT A;  4E71 A;  5KHO A;  2L0T A;  4NJC A;  4EEW A;  1SIF A;  3P4R B;  2FUG 1;  4TQ1 A;  4NAW B;  2ASQ A;  2WNM A;  3VTW A;  2CHZ A;  3ZRC A;  4H2A A;  4MEM A;  4EUT A;  2DAJ A;  3HRD D;  3R66 C;  1Q0W B;  4ZYS A;  4ANV A;  3DHI C;  3L13 A;  4IWO A;  2JZ3 B;  3URY A;  4HKZ E;  2KDF B;  4P7I A;  1WYG A;  2EMT A;  3KW5 B;  4B9K A;  4F1S A;  1VZ6 A;  2K0P A;  5J2R A;  2K25 A;  3DVG Y;  2GBJ A;  4F7Z A;  2N7E A;  1FMA D;  2LVO A;  2RR9 A;  2PW9 A;  3FAH A;  1WXM A;  3DCG A;  1SJH D;  3ZDT A;  3P2B A;  1KM7 A;  1RM6 C;  1NDD A;  3UQB A;  2M1M A;  3AH7 A;  1F1H A;  3WCQ A;  1R7S A;  3KLS X;  1IGD A;  1RAX A;  1E6E B;  2E6X A;  1HXY D;  2N7D A;  2PE6 B;  3VUY A;  2NS5 A;  3MC8 A;  2FNJ B;  4A9A A;  2KVZ A;  5L95 C;  2M0A A;  5AZG A;  1VJK A;  2D07 B;  4PS8 A;  2KYW A;  1YMH E;  3NVV A;  4C7Z A;  2KVR A;  3UIP B;  3KUZ A;  4MGZ E;  3U30 A;  4GMV A;  4YTM B;  4BOZ B;  1V1P B;  3B2F A;  2RGF A;  2NBV B;  4KV2 A;  2W82 A;  4FN2 A;  4NJ6 A;  1DOI A;  4NQL B;  3SD5 A;  3LDZ E;  4QAY A;  4CO7 A;  2JRI B;  2ZNV C;  2KQ7 A;  2NMQ A;  1C77 A;  5FKA C;  2N1W A;  4BKT A;  4W9E A;  1JWM D;  1ZXI A;  2WDT B;  3GE8 C;  1E10 A;  3DBH B;  1YJ1 A;  2GOW A;  3KWV A;  2BS4 B;  5IN7 A;  2WDR B;  3VQI A;  1TS2 A;  3GP7 A;  3L08 A;  1EF1 A;  2YEP B;  5FK9 C;  1TZO A;  3ETR A;  1F2R I;  3N20 C;  1PGB A;  4HDO A;  1K53 A;  2FCM A;  3DBL I;  3V6E B;  2D5G A;  3BVG A;  5AZH A;  4URK A;  4IW0 A;  2GI9 A;  2A4Z A;  3N1Z C;  5BYS A;  2O2V B;  2MLB A;  3OG5 A;  1SXT A;  1TS4 A;  4WJO A;  2J53 A;  1JW9 D;  4PS7 A;  4HPM B;  2PJH A;  3WAL A;  3NVY A;  1WGK A;  3Q6B A;  3NVW A;  1MHX A;  1HE8 A;  3SHQ A;  2V9H A;  5D3I B;  1WF9 A;  3WAP A;  2LZ6 A;  3UGB B;  2QCZ A;  3MHZ A;  1N60 A;  3T9L A;  1TY2 A;  3DHG C;  2MJ3 A;  1P1A A;  1WR1 A;  2V4L A;  2WXR A;  2XBB C;  1WXA A;  1L4Z B;  2MP2 A;  3ZRF A;  3U2S C;  2IY1 B;  3RZW C;  2KDM A;  4ANW A;  2NBU A;  3ENE A;  1ROE A;  4J3O D;  3CMM B;  2ZPN A;  3B08 A;  1E8W A;  1QT9 A;  4GN1 A;  1TGZ B;  2DLB A;  3U4E G;  3AED B;  2KOX A;  4MH0 E;  3L16 A;  4HK2 A;  5CTR C;  4AOF A;  3VUX A;  1YN4 A;  1ESF A;  5C23 A;  2DWQ A;  2L83 A;  2CHW A;  2HE7 A;  1WJU A;  1SF0 A;  3DBH I;  1KTK A;  5LXH A;  3H9D A;  3PRM B;  2V3S A;  5D94 A;  3AE4 B;  1ENF A;  2KT7 A;  2MJE A;  1I42 A;  4OVZ A;  4OHJ A;  2AWT A;  3BYT B;  4N59 A;  2DEN B;  1SE4 A;  3PO0 A;  2K39 A;  4S17 A;  4ZYN A;  1UF0 A;  3I63 C;  2WXG A;  2L7R A;  1TZ1 A;  5CHW A;  4E3C A;  1OFF A;  2CS4 A;  3AE7 B;  1X1M A;  3ZTD A;  3BZD B;  1BUI C;  2FCS A;  3W9C B;  3P4P B;  4KDL B;  4B95 A;  2W9N A;  2JXT A;  1N61 A;  2JYT A;  3IAM 1;  4I6N B;  5HG2 A;  3PZ7 A;  1WIA A;  4XDD A;  3AMZ A;  2KJH B;  1YIW A;  1T0S C;  2DBY A;  4I6P A;  2IBI B;  2SAK A;  3QWZ B;  2MX2 A;  1XQQ A;  1N63 A;  2BB6 A;  3T8M A;  1OEY J;  2LGX A;  4LDT D;  2EMS A;  3PHW B;  2AL6 A;  4C56 C;  2INP E;  3P42 A;  4RH6 A;  1Z2M A;  4HEA 1;  3QAR A;  3AU4 A;  4B0M A;  1V86 A;  3B2G A;  1IUE A;  4WJP A;  1FXI A;  2BYE A;  2Z8L A;  3AV8 A;  5D2M B;  2KX3 A;  1KLU D;  3RNB C;  1WR6 E;  1FPY A;  3AE6 B;  3WAO A;  2KMA A;  1TIF A;  1L0Y B;  4LDT B;  3RNF C;  4PS3 A;  4DDI D;  4M0W A;  2IPK D;  2J42 A;  2XK5 B;  3SEB A;  2C9W B;  1L2N A;  5G5H A;  3QIJ A;  1OGW A;  2KKC A;  5C1Z A;  2WYQ A;  1TJE A;  1WJ4 A;  2M17 A;  3FIL B;  4ZRJ A;  3ECI A;  5LNK 1;  2NPT A;  4NAW A;  1I35 A;  5JH5 C;  2FAZ A;  4UDU C;  2G45 B;  1XXG A;  2N9X A;  4WWN A;  1NI2 A;  3H7S A;  2M0X A;  2IGG A;  3KUC B;  2GBM A;  1I4Q A;  2J0M A;  2AL3 A;  1XLP A;  5IAA C;  1V97 A;  4EZJ A;  2V3N A;  3QK0 A;  3ALB A;  3EGR A;  4TQ0 A;  1D5X C;  3QCA A;  3V60 A;  4MJS B;  3DVN U;  3C8Y A;  1VR9 A;  4W9D A;  4BFR A;  1V80 A;  1ZOY B;  2J7Q B;  4LCD E;  4L1B A;  1T6B X;  3AEB B;  2OED A;  3PZ8 A;  3N1X C;  1GC6 A;  2WXJ A;  3FC4 A;  2WXP A;  2LGD A;  2R2O A;  2A5U A;  4FHJ A;  2FCN A;  3RNA C;  1UD7 A;  2BS3 B;  3Q8B A;  4C00 A;  1S1Q B;  5DPR A;  1JML A;  3IHP C;  4MDK E;  5AEK B; 
#chains in the Genus database with same CATH homology
 4B6W A;  4BKS D;  1XD3 B;  4GDK A;  2D2Q A;  2KMC A;  1ISN A;  5E6P A;  4HXD A;  1GC7 A;  1E8X A;  1LXD A;  2MBO A;  2LVP A;  3EFU A;  3HM3 A;  1R4M I;  4GDK B;  4JIO U;  4MGY E;  4E71 A;  3DBR I;  5KHO A;  4NQK E;  3JYU A;  2L0T A;  3N32 A;  2V1Y A;  2IYD B;  3R7Q A;  1J0G A;  2L00 B;  4DHJ B;  4EEW A;  2MBH A;  3WAN A;  5DPS A;  1SIF A;  2HD5 B;  3N3K B;  3ZLZ A;  1ZKH A;  3ZVV A;  3KVF B;  3L17 A;  2O2V A;  4NJ7 A;  4NAW B;  3PRP B;  2ASQ A;  4TQ1 A;  3VTW A;  2CHZ A;  3ZRC A;  3OLM D;  3PT2 B;  4MEM A;  4EUT A;  3HK0 A;  2DAJ A;  3V62 A;  3R66 C;  1Q0W B;  4GXB A;  4ANV A;  4K7S A;  1WGH A;  4JL9 A;  3L13 A;  4IWO A;  2JZ3 B;  1KLV A;  3APD A;  1F9J A;  4P7I A;  2KDF B;  3WIM A;  5KHQ A;  1ZGU B;  4OVU A;  4ZRI A;  1J19 A;  3VFK A;  2EMT A;  2JWZ A;  3S2A A;  2MWS B;  3KW5 B;  4B9K A;  4F1S A;  5J2R A;  3ZTC A;  2O6V B;  3D32 A;  4DHJ D;  3ZW3 A;  2DZJ A;  3AU5 A;  3DQV A;  2K25 A;  1E7V A;  3DVG Y;  5DPT A;  1IPG A;  4FA6 A;  2GBJ A;  2OOB B;  4F7Z A;  5J18 A;  1IYF A;  2D10 A;  5CHV C;  3R7R A;  2IY0 B;  4PYZ A;  1WM2 A;  2N7E A;  4ZRK A;  3AI5 A;  1E5W A;  2LVO A;  2JXX A;  2RR9 A;  1WGY A;  4RM9 A;  3TBL D;  1FXT B;  1WXM A;  2K8C A;  1V5T A;  4BBN C;  3DCG A;  3PLV A;  4K7U A;  3ZDT A;  3ML8 A;  3P2B A;  5LLI A;  3V61 A;  1KM7 A;  1XT9 B;  3NZU A;  4FJZ A;  2YVC A;  3GOE A;  2LAS A;  1NDD A;  3A33 B;  2MW5 A;  3AXC A;  3ZNZ B;  3UQB A;  2C5L C;  2M1M A;  4M0W B;  3Q3J A;  2IO3 B;  3PV1 A;  4A3P A;  3EC8 A;  1VD2 A;  2R2Q A;  2RD0 A;  3IBE A;  5JZE B;  1Q5W B;  3W1S C;  4EZK A;  2OJR A;  1RAX A;  4TKN A;  3OAW A;  2FCQ A;  2KJR A;  2N7D A;  2PE6 B;  3IG3 A;  3VUY A;  2NS5 A;  4BKS A;  3IFW B;  3TCA A;  3TL5 A;  3HIZ A;  2ZCC A;  2FNJ B;  1WYW B;  2K6D B;  5L95 C;  5AZG A;  5E6O A;  2CKH B;  1NBF C;  1S3S G;  4II3 B;  2KTF A;  2D07 B;  4PS8 A;  1UBI A;  2JUO A;  3AUL A;  2JPH A;  1OTR B;  4X57 B;  3DPD A;  2LRU A;  3PRE A;  4JLC A;  1WRD B;  2KVR A;  3MJW A;  3UIP B;  1E8Z A;  3KUZ A;  4MGZ E;  1EUV B;  3U30 A;  1U4A A;  2KDB A;  3CST A;  3PSE B;  4GMV A;  1TBE A;  4BOZ B;  4FUL A;  1WM3 A;  2RGF A;  1IP9 A;  4EFO A;  2NBV B;  2D11 A;  2N4F A;  3K9P B;  4KV2 A;  4FN2 A;  3NZS A;  4NJ6 A;  2DAF A;  2BWE S;  3ONS A;  3VH4 B;  2Y5B B;  4MEL A;  2NR2 A;  4LJP B;  3R3M A;  3EHV A;  2L0F A;  2BWF A;  2KNB A;  2IO2 B;  4NQL B;  3SD5 A;  3NS8 A;  4GGQ A;  3LDZ E;  3VAW A;  3JSV B;  4GSW A;  4W9G A;  4CO7 A;  1WXV A;  1LFD A;  2BGF A;  2JRI B;  2L8J A;  3GZN I;  3TJP A;  2J0K A;  2KZR A;  2KQ7 A;  2ZNV C;  3QX1 A;  3LJ3 A;  4G0N B;  4BKG A;  5JHA A;  2N1W A;  4KZ0 A;  4BKT A;  2KC2 A;  3UIN B;  3ZNG C;  4W9E A;  1J8C A;  3RD2 A;  5FR6 A;  1WZ3 A;  2WDT B;  1Z5S B;  4BVU C;  4ICU A;  1YJ1 A;  3L0W B;  5E6N A;  2DHZ A;  2GOW A;  1V6E A;  3VQI A;  2KAN A;  3JW0 X;  3QQ8 B;  2LXA A;  3L08 A;  1EF1 A;  2C7M B;  2I1K A;  4HJK A;  3PLU A;  4XZ4 A;  3ZUN A;  1E8Y A;  2KQS A;  3B0A A;  5EDS A;  3OJ3 A;  2BKF A;  3APC A;  2KC1 A;  1R4N I;  4HDO A;  2IZV B;  2FCM A;  3DBL I;  3V6E B;  4KDI C;  4KVG B;  4PYU A;  5AZH A;  2NPT B;  3M3J A;  4URK A;  4IW0 A;  3H7P B;  1YX5 B;  2MA9 B;  4MM3 A;  2A4Z A;  4JGH B;  2O2V B;  2MLB A;  2RSU A;  5TR5 A;  1CMX B;  2ZEQ A;  3A9J A;  2IO1 B;  5CHF A;  4AWJ A;  4WJO A;  4M8N A;  4WJN A;  2N1V A;  4PS7 A;  4HPM B;  2PJH A;  3WAL A;  2BPS A;  2Z0D B;  4W9H A;  3VVW B;  1KOT A;  4II2 B;  1OEY A;  2HJ8 A;  3JVZ X;  3ZDM C;  2VRR B;  1MG8 A;  2KLC A;  1HE8 A;  4MJS A;  2YLM A;  2EKE C;  3SHQ A;  3Q3F A;  2CU1 A;  3M62 B;  1G6J A;  3BIN A;  4IM0 A;  1WF9 A;  4AJY B;  3K9O B;  2BKR B;  2JRH A;  2LZ6 A;  4TV3 A;  3WAP A;  3UGB B;  1JRU A;  1V5O A;  1K8R B;  3T9L A;  2KTR B;  1EO6 A;  1WXS A;  3W1S A;  2LUE A;  2KN5 A;  1RLF A;  4GIV A;  3MTN B;  4ANX A;  1P1A A;  1WR1 A;  2V4L A;  4FJV B;  4HCP B;  2XBB C;  1WXA A;  4ICV A;  1H8C A;  2MP2 A;  1GG3 A;  2BYV E;  2DYO A;  4XC2 A;  3ZRF A;  2GBK A;  4DWF A;  2IY1 B;  3RZW C;  4W9F A;  3PRZ A;  4ANW A;  3CF6 E;  2NBU A;  3ENE A;  3ZO5 B;  3M63 B;  3H1U A;  3CMM B;  4GU2 A;  3PS6 A;  4IWP A;  2WX0 A;  2ZPN A;  3NHE B;  3B08 A;  1E8W A;  4DHZ B;  4DK5 A;  3PGE A;  2MRP A;  4FBJ B;  4GN1 A;  1SGH A;  2M4N A;  4MGI E;  1WMH A;  1TGZ B;  2LVQ A;  5AZF A;  2L05 A;  1H4R A;  2G4D B;  2KOX A;  2XEW A;  2KFJ A;  3L16 A;  4HK2 A;  4MH0 E;  1UBQ A;  3RCZ A;  4GDL A;  5CTR C;  4AOF A;  3VUX A;  2MSE D;  2CHX A;  3A9K B;  2DZM A;  5C23 A;  2NBW B;  2GBR A;  2KDE B;  4W9K A;  1WFY A;  2CHW A;  2FUH B;  2K8B A;  2HE7 A;  1WJU A;  1WE7 A;  3DBH I;  2PE9 A;  3KUD B;  2QHO A;  2LI5 A;  2AEH A;  2XK5 A;  5LXH A;  2KFK B;  3QA8 A;  1PQS A;  2KWV B;  3H7P A;  3H9D A;  3PRM B;  4BBN F;  2V3S A;  3CSF A;  2HTH A;  1AAR A;  2PEA A;  5D94 A;  2KO3 A;  3QJZ A;  4FHK A;  4W9J A;  2LJ5 A;  3TIX A;  3RUL A;  2DZI A;  3O65 B;  1WZ0 A;  3VTU A;  1WH3 A;  2JT4 B;  2M8S A;  5DPW A;  4GB9 A;  1V2Y A;  1I42 A;  2AYO B;  3PTF C;  4G50 A;  2AWT A;  4KZC A;  2DEN B;  3QAQ A;  4NY0 A;  1VCB A;  3L10 B;  1WI0 A;  2J0J A;  4MDK E;  1WX7 A;  2FIF A;  2K39 A;  3QC8 B;  4WJQ A;  5CX3 A;  4ZYN A;  2KFK A;  1KJT A;  4DBG A;  4GOC A;  3ZNH B;  2K8H A;  2KXJ A;  2CR5 A;  1UZX B;  2G4S A;  2JZZ A;  3DVN V;  5D7G A;  4RM8 A;  2L7R A;  2LD9 A;  4A20 A;  2LRW A;  3A1Q A;  1RFA A;  1TZ1 A;  5CHW A;  1V49 A;  4E3C A;  4W9I A;  2K1F A;  1OQY A;  2CS4 A;  4AUQ C;  1X1M A;  3ZTD A;  1V9J A;  2ZVN A;  1LM8 B;  2C7N B;  4JQW C;  4LJO B;  2FCS A;  4KDL B;  4B95 A;  1YD8 U;  3KYC D;  3HM6 X;  2W9N A;  3SDL C;  3DBS A;  4KSL C;  4MGK E;  3DVG X;  4I6N B;  4FLH A;  2L3Z A;  5JHB A;  1WIA A;  1Y8R C;  4IM3 A;  3KH0 A;  4WWO A;  3WA0 A;  2I1J A;  2KJH B;  4G3X B;  1YIW A;  2DYB A;  2KHW B;  3VH3 B;  4I6P A;  2IBI B;  1GNU A;  4DHZ E;  3QWZ B;  2MX2 A;  2KK8 A;  1XQQ A;  4KIK B;  4K7W A;  4MSM B;  4HDQ A;  3DDC B;  4EKU A;  4M8M A;  2C60 A;  3T8M A;  1OEY J;  2LGX A;  4LDT D;  2EMS A;  3PHW B;  2AL6 A;  2MBB B;  3X23 A;  3EEC A;  4HPL B;  2Z59 B;  4BOS C;  2MCN B;  1Z2M A;  3HHM A;  1D3Z A;  3QAR A;  3AU4 A;  1V86 A;  4OVV A;  3W1Y A;  4WJP A;  1V81 A;  2BYE A;  4IC7 B;  5D2M B;  2KX3 A;  2N9E B;  2BYF A;  2IO0 B;  3U8Z A;  4HVB A;  5GMV A;  3NOB A;  1UEL A;  1EF5 A;  2GMI C;  4I6L B;  4AJW A;  2NVU I;  2KD0 A;  4FJY A;  5J17 A;  1WR6 E;  3WAO A;  4KSK C;  2KX0 A;  4ANU A;  3C0R B;  4K1R B;  2KMA A;  3DOW A;  1P9D U;  2PPH A;  3KYD D;  2DZK A;  3QHT A;  2GBN A;  4LDT B;  2O6V D;  3ZIM A;  4DDI D;  4PS3 A;  4ASW C;  4IUM B;  4MSQ B;  1T0Y A;  2O6V A;  3OJ4 B;  2XK5 B;  4DDG D;  2ZPY A;  3B1L X;  3PHX B;  2C9W B;  4W9C A;  1L2N A;  3A1Q B;  3UF8 A;  2KWC A;  3QIJ A;  1OGW A;  2KKC A;  5C1Z A;  1L7Y A;  2MQJ A;  5G2N A;  2BF8 B;  4IM2 A;  1WGR A;  2WYQ A;  1WJ4 A;  2M17 A;  3I3T B;  2DX5 B;  1WX9 A;  1BT0 A;  2WWZ A;  3PVL A;  4ZRJ A;  2K6Q A;  5HKH A;  3ECI A;  2KLG A;  2D3G A;  1LQB A;  2NPT A;  3VTV A;  2ZNV B;  1WJ6 A;  4NAW A;  2LWP A;  1I35 A;  3PZD A;  3NY5 A;  1WGD A;  2FAZ A;  5JH5 C;  4CHK A;  1WMH B;  2ZZP B;  4HWI B;  5LXI B;  3A4S C;  3VDZ A;  4EOY A;  2G45 B;  2C7H A;  1P3Q U;  1WGG A;  1E90 A;  1Q1O A;  2KWU B;  2N9X A;  3RUI B;  4WWN A;  3SU8 X;  5G55 A;  1NI2 A;  2G3Q B;  4FAD A;  4NNJ B;  3H7S A;  2N9P C;  3RYT A;  3X0W A;  4WWP A;  2ZCB A;  4TUU A;  4WQO B;  2JF5 A;  4HCN B;  4A3O A;  3ZNI D;  2M0X A;  3BY4 B;  2UWQ A;  1C1Y B;  2NCN A;  1YX6 B;  2LXC A;  2LGY A;  3KUC B;  3N30 A;  2GBM A;  4N9F 4;  2L76 A;  2RPQ A;  3UQA A;  2MP2 B;  1GJZ A;  2J0M A;  2Z0E B;  2AL3 A;  4KIK A;  5IA7 A;  1ZW7 A;  5IAA C;  3RZF A;  2UYZ B;  1RRB A;  2KJ6 A;  4EZL A;  2KTR A;  1P0R A;  4EZJ A;  3A4R A;  3WAM A;  3UIO B;  1E7U A;  3QK0 A;  2MBQ A;  3A9K A;  3ALB A;  4ZDV A;  1WX8 A;  4IG7 B;  3VUW A;  1WJN A;  4XX5 A;  4DXA B;  4GDL B;  4TQ0 A;  4AP4 C;  4F8C B;  1WE6 A;  3QCA A;  2B3A A;  1QZE A;  3PPA A;  5DCN A;  3V60 A;  4MJS B;  4E74 A;  1C3T A;  3DVN U;  1WY8 A;  3ML9 A;  4HLE A;  2DYM A;  1YQB A;  2REX A;  3IVF A;  1P98 A;  3VXW A;  4W9D A;  4WAA A;  4BFR A;  4J6I A;  3TMP B;  3ZKJ C;  1GUA B;  1V80 A;  2J7Q B;  2JY6 A;  5L83 A;  1SE9 A;  4LCD E;  2WX1 A;  3L54 A;  1A5R A;  3A9J B;  4IWQ A;  3V6C B;  5BO4 B;  3VHT C;  4NPN A;  3APF A;  1UH6 A;  3U7D A;  3H6N A;  1GC6 A;  4YL8 A;  2ZVO A;  3M95 A;  5D6J B;  1M94 A;  2LGD A;  2R2O A;  1UGM A;  4K81 A;  4G11 A;  2A5U A;  4FHJ A;  4RMA A;  2KDI A;  2FCN A;  1UD7 A;  3RT3 B;  3MHS D;  2ZJD A;  1TTN A;  1S1Q B;  5DPR A;  4CYE A;  4W9L A;  3JSV A;  3IHP C;  2FID A;  2MBE A;  5AEK B;  2JVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...