5D6JB

Crystal structure of a mycobacterial protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/protein binding
molecule keywords Acyl-CoA synthase
publication title Crystal structure of FadD32, an enzyme essential for mycolic acid biosynthesis in mycobacteria.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
total genus 16
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5d6jB00
3R7QA 4NAWA 2FAZA 3KW5B 2O6VA 3AU4A 1XT9B 3ZVVA 1WH3A 2LXCA 4XZ4A 3VVWB 3ZNHB 5CTRC 2WWZA 2OJRA 5D2MB 4DHZB 1CMXB 4HWIB 2KK8A 4MJSB 4IUMB 5GMVA 4AJYB 4IWPA 4ZRKA 3HM3A 4BBNC 2XK5B 1ZW7A 4LJOB 3PS6A 3CMMB 4F7ZA 4ZDVA 4GDKB 2NBWB 1GJZA 2KANA 2KDIA 2MBOA 2RR9A 5AZFA 4HLEA 1QZEA 3ZKJC 2JPHA 3DVNV 1KOTA 2R2QA 2KNBA 2HD5B 3KYCD 1LXDA 1WF9A 2K39A 1L7YA 4EOYA 5DCNA 2BGFA 2LGXA 3K9PB 4HDOA 3V6EB 4TQ1A 3QAQA 1A5RA 2FIFA 2DAFA 5CHWA 1D3ZA 3CSTA 2NBVB 2BYEA 3ZDMC 3APCA 3L08A 4NNJB 4FADA 2G4SA 2MA9B 3H7SA 3K9OB 4KDIC 1M94A 2N9EB 1P0RA 2WDTB 3NHEB 4G11A 2LGYA 4MSMB 2ASQA 4PS8A 4PS3A 4ANUA 2EMSA 4DHZE 1X1MA 1S3SG 3ECIA 4FJZA 3WALA 3H1UA 3ZO5B 1I42A 2LI5A 1EF1A 1NBFC 5E6PA 3UIPB 2IY1B 1XD3B 2M4NA 1V86A 4W9LA 4JIOU 2IYDB 2CS4A 3A9JA 1PQSA 4G3XB 4ANWA 3ZW3A 2KFJA 5AEKB 3MJWA 1WE6A 3ZTCA 3UIOB 2N9PC 2I1JA 2BPSA 3H6NA 5D6JB 2KX0A 4RM9A 3TJPA 2O2VA 4AUQC 3W1SA 2MRPA 3H7PB 1LQBA 4IM3A 5DPSA 4KSLC 2KJ6A 2MP2B 3EFUA 4WWOA 2KC1A 3IBEA 2BYVE 4LDTD 2K6DB 2GOWA 5LLIA 1E8XA 2EKEC 2ZPYA 3QWZB 4P7IA 1C3TA 4BFRA 4BKGA 4N9F4 3RUIB 3ZTDA 5DPWA 2KQ7A 3BY4B 3VXWA 4AWJA 3WAOA 1E8YA 5HKHA 3V62A 1BT0A 2FCSA 4NQLB 4W9KA 2K8CA 2KLGA 3JVZX 3L0WB 5KHQA 1YJ1A 1TBEA 2KFKB 4ZYNA 1ZGUB 3S2AA 1Y8RC 1WXSA 4F1SA 1YX6B 1V80A 3AU5A 3JYUA 1EUVB 2C7NB 3CF6E 2AEHA 4FBJB 4EZLA 5LXIB 2IBIB 4ICUA 4JQWC 4GDLA 2NR2A 3WANA 4K1RB 4PYUA 4W9GA 2K8HA 4BKSA 2DZJA 1E8ZA 3VAWA 5EDSA 3Q3JA 1OGWA 3DVGY 4LCDE 2J0KA 4F8CB 3HM6X 1E7UA 1WR6E 4M8NA 4MGZE 2DZIA 2KTRA 2W9NA 3A33B 2CU1A 4FJVB 3SDLC 2ZVOA 5CHVC 3T8MA 3ZNGC 3JSVA 3ZUNA 3B1LX 2M17A 1WFYA 3X0WA 2C60A 2KXJA 2D11A 2D3GA 1E7VA 3PGEA 4AJWA 4LDTB 4ANXA 4MEMA 1UGMA 3PT2B 3VDZA 4HPMB 2IY0B 4I6PA 5LXHA 3ENEA 4IG7B 2ZPNA 4XC2A 2LJ5A 4XX5A 3RULA 5AZGA 4DHJD 4X57B 2MBHA 3PHWB 4I6NB 4CYEA 2LZ6A 4GB9A 1FXTB 4GGQA 5JZEB 1WY8A 2L76A 2Y5BB 1V5OA 4MJSA 4NJ6A 2PJHA 3RD2A 1J8CA 2DYMA 4K7SA 3RZFA 1C1YB 4GXBA 3B0AA 2AYOB 2XK5A 5DPRA 5TR5A 3ZRCA 3A9KA 2BKRB 4ICVA 3QIJA 2DZKA 1OEYA 2M1MA 4MH0E 2BF8B 2BKFA 3V6CB 2KWUB 4W9FA 1WGHA 3V60A 2LRWA 1I35A 2NPTB 2JRIB 2DZMA 2ZCBA 4GIVA 4GOCA 2KMAA 5E6OA 1V5TA 2KDEB 2V3SA 2N9XA 3MTNB 1P1AA 1UBQA 2LVPA 2KC2A 3NS8A 4M0WB 1SIFA 2KX3A 3DVGX 2UWQA 2V4LA 2DAJA 3ML9A 4URKA 4IM2A 2IO0B 4W9DA 4DWFA 2N1WA 2M8SA 1ZKHA 3OJ3A 1WMHB 3IVFA 1J19A 2D2QA 5G2NA 2KHWB 4MM3A 3PV1A 3IHPC 4HDQA 1VD2A 3R7RA 2GBKA 2ZCCA 3U30A 4DHJB 3TBLD 3RYTA 1NI2A 4MGIE 3H9DA 3RZWC 2MX2A 2OOBB 1WX8A 3U7DA 1KM7A 3KUDB 3QK0A 3TIXA 3P2BA 5AZHA 2N1VA 5C23A 4FA6A 3H7PA 1T0YA 3RCZA 2BWFA 4EZJA 3X23A 3O65B 4KZCA 2IO3B 2LVOA 3PRMB 4LJPB 4WJQA 2L05A 2KLCA 4KV2A 1VCBA 2PEAA 5BO4B 1GC6A 5DPTA 3OAWA 2XEWA 1WGRA 2LWPA 4FHJA 3NZUA 4II2B 4EKUA 4IW0A 4WJNA 3SU8X 1UH6A 3DBLI 4W9HA 3UQBA 3NY5A 4GN1A 3QQ8B 4B95A 2ZEQA 4A3OA 3A1QB 1WZ3A 3EECA 4IC7B 2GBMA 4A3PA 3PSEB 3DOWA 1UELA 4B9KA 1GG3A 2HE7A 3APFA 2NBUA 5CHFA 2AL6A 2PPHA 2PE9A 2BYFA 3QA8A 2XBBC 5IA7A 2LUEA 3QX1A 3ONSA 1RFAA 1WZ0A 2IO1B 1GC7A 3M95A 4HCNB 4W9JA 4BOZB 3D32A 4GU2A 2K25A 3TL5A 3VQIA 1RAXA 1WGGA 3KUCB 1WJ6A 4G50A 2LRUA 4DK5A 3LDZE 1MG8A 1LM8B 1GUAB 2QHOA 2ZVNA 4HJKA 3A4RA 3AI5A 3ZNID 2B3AA 5D94A 4HVBA 3VTUA 1OEYJ 2L0TA 4II3B 4KIKB 2MBBB 5KHOA 2K8BA 2C5LC 2LGDA 3EC8A 2LVQA 1GNUA 4RMAA 1IP9A 4TKNA 2Z0DB 5G55A 3N3KB 3VTVA 2JZZA 1YIWA 2CKHB 3B08A 3DBRI 3EHVA 2RGFA 1TZ1A 3TCAA 1HE8A 4KDLB 5J18A 4BKTA 2O6VD 1Q5WB 2ZNVB 1AARA 3M3JA 4W9CA 3NOBA 4ANVA 2KJHB 4NQKE 2R2OA 4FULA 4G0NB 4WWNA 1UZXB 3PRPB 3KVFB 3DVNU 4DBGA 5L95C 2IO2B 3DPDA 4JGHB 4MELA 4MGKE 4YL8A 3W1YA 5CX3A 1L2NA 2MWSB 1WXAA 2A5UA 3UF8A 1SGHA 1WM2A 1EO6A 2ZZPB 3GOEA 3IFWB 3ZRFA 4BBNF 5L83A 4KSKC 2L3ZA 4IM0A 2NS5A 3UGBB 3VUYA 2KVRA 2KOXA 2FUHB 3DQVA 3N30A 4IWOA 2V1YA 1OTRB 1TGZB 3QCAA 2NPTA 4GDKA 4W9IA 3WIMA 4A20A 1YD8U 2KZRA 2WYQA 4HK2A 1P3QU 2WX1A 2MBQA 3QC8B 4WJOA 2DENB 1R4MI 2C9WB 2J0MA 4K7WA 4OVVA 5E6NA 2DYOA 4I6LB 1WX9A 2M0XA 2RSUA 1WYWB 2D10A 2FIDA 2GBNA 4BVUC 3UQAA 1R4NI 3ZIMA 2NCNA 3PLVA 3KYDD 3M62B 4GMVA 4WWPA 4IWQA 1WMHA 5JH5C 1V6EA 4JLCA 3PREA 2FCMA 4NAWB 5JHBA 2O6VB 3AULA 2A4ZA 2AL3A 2MSED 5IAAC 1G6JA 1WM3A 3N32A 2KDFB 3GZNI 4EEWA 1H4RA 2L0FA 2MQJA 3VUWA 1XQQA 2N7DA 2EMTA 3A9KB 1WJNA 2DHZA 1S1QB 3L17A 4KZ0A 3DBSA 5D7GA 2KTFA 2WX0A 3UINB 2J7QB 2L00B 2KKCA 4E3CA 3HK0A 1E5WA 4HXDA 4ASWC 1KJTA 2K1FA 1LFDA 3QHTA 4ZRJA 2JT4B 2LD9A 1Q0WB 2JZ3B 2DYBA 3DCGA 3PVLA 3WA0A 4TV3A 4CO7A 2UYZB 3ZDTA 3TMPB 4MDKE 3PZDA 2KN5A 1J0GA 1V2YA 4NY0A 3KUZA 2KWCA 2MP2A 3PRZA 2G3QB 4K7UA 2G45B 3HIZA 4DDID 1YX5B 3W1SC 2ZJDA 2I1KA 4HPLB 3OLMD 4WQOB 2Z0EB 1V9JA 3PHXB 3VH3B 4AOFA 1P98A 3NZSA 3U8ZA 1WIAA 2DX5B 2Z59B 3A1QA 3VFKA 4DXAB 2JXXA 2VRRB 1SE9A 1WXVA 2JVCA 3V61A 1IPGA 3ZNZB 4CHKA 1YQBA 4M8MA 3ML8A 4FHKA 2J0JA 3APDA 1F9JA 2KMCA 3Q3FA 4BOSC 2GBRA 2HJ8A 2L8JA 2LASA 2RPQA 2MCNB 3A4SC 2KFKA 2N7EA 4MSQB 2CHWA 2IZVB 1U4AA 1EF5A 5FR6A 1WX7A 2KD0A 2KJRA 3L13A 5J2RA 4EUTA 3HHMA 3L16A 3VHTC 1RLFA 1TTNA 2ZNVC 3M63B 4BKSD 3A9JB 2N4FA 4K81A 2MLBA 3VH4B 2GMIC 2D07B 2YVCA 2JWZA 3ALBA 4NJ7A 1RRBA 1WJ4A 2YLMA 3JW0X 4GSWA 4EZKA 2JUOA 1V49A 3DDCB 4KIKA 5C1ZA 5J17A 1KLVA 4KVGB 2O2VB 3L10B 4AP4C 4E71A 1WE7A 1WRDB 1E90A 1Q1OA 2K6QA 3KH0A 4HCPB 4JL9A 4NPNA 3C0RB 3R3MA 3WAMA 1WI0A 4EFOA 3OJ4B 3RT3B 2G4DB 2GBJA 2MW5A 5JHAA 4DDGD 1V81A 2PE6B 2KWVB 3AXCA 3DBHI 1NDDA 1WXMA 1ISNA 2KDBA 1Z5SB 2CR5A 4RM8A 2CHZA 4MGYE 3LJ3A 3VTWA 3MHSD 4FLHA 4TQ0A 4ZRIA 3SHQA 2MBEA 1E8WA 4B6WA 1K8RB 2LXAA 4WJPA 2C7HA 4PYZA 2FCQA 2KQSA 3BINA 3PTFC 1IYFA 1JRUA 2REXA 3I3TB 3PPAA 1WGDA 1UD7A 4OVUA 2FNJB 4W9EA 2BWES 4TUUA 4GDLB 4PS7A 2JF5A 3CSFA 3IG3A 2KO3A 3L54A 1P9DU 1Z2MA 3PLUA 2RD0A 2AWTA 3QARA 1WR1A 4FJYA 2FCNA 1OQYA 2C7MB 2KTRB 2CHXA 2JRHA 2JY6A 4FN2A 3SD5A 3JSVB 1WJUA 1UBIA 2NVUI 3ZLZA 2L7RA 4J6IA 4WAAA 4E74A 1H8CA 3T9LA 2HTHA 1WGYA 3QJZA 3VUXA 3WAPA 3R66C
chains in the Genus database with same CATH superfamily
1JCKB 4BZAA 1XT9B 4DXGA 1D4BA 1YOVB 1B9RA 4RF0A 3RMKC 4ZHPA 2KK8A 1VJKA 2IGDA 4LNFA 2OHFA 4MJSB 4LJOB 4F7ZA 4ZDVA 3NVYA 2KANA 2KDIA 4MH8A 1KOTA 2HD5B 2K39A 4EOYA 5DCNA 2LGXA 5HI1A 4TQ1A 3QAQA 1N61A 1GAQB 3CSTA 2BYEA 3L08A 5HG2A 4FADA 4G11A 1SE2A 1ZP0B 2LGYA 2ASQA 4DHZE 2EMSA 2BYTA 1EF1A 3UIPB 1F77A 1XD3B 3AE8B 2IYDB 4G3XB 1ZDXA 4ANWA 3ZW3A 2KFJA 5AEKB 3ZTCA 1VRAB 2KX0A 3TJPA 4HKQA 3P42A 1GPXA 5DPSA 2LGIA 3EFUA 2KC1A 3IBEA 2EKEC 3QWZB 3VR8B 2WXNA 3AE6B 4BKGA 4N9F4 5JXVA 5H8YE 2L1AA 1FD6A 2FCSA 3JVZX 3L0WB 1YJ1A 3RN9C 3S2AA 1Y8RC 4F1SA 3CF6E 1P7FA 2I38A 4EZLA 2IBIB 4ICUA 4BKSA 2DZJA 4ITKA 3AB5A 4ZHOA 4S0RA 1N6ZA 4ACFA 1WFYA 4L2YA 2D11A 3RNFC 2W54A 2IGHA 5FKAC 3N1ZC 2ZPNA 2K9XA 4XC2A 3R2TA 4YXDB 4X57B 4YTNB 4I6NB 4CYEA 2LZ6A 4GB9A 1FXTB 5JZEB 2L76A 2PVGC 3RD2A 4YTPB 1OFFA 4GXBA 5DPRA 3URYA 4ICVA 2DZKA 1HQRD 1TY0A 2BF8B 2ZW1A 1TS2A 1WGHA 2EKIA 4GIVA 4GOCA 2KDEB 2V3SA 1UBQA 2LVPA 4NJCA 3DVGX 2UWQA 4URKA 5BMGA 2IO0B 2GRIA 1WMHB 1QKZA 1QOBA 1CQVA 2KHWB 1I4HA 4MM3A 4KGTA 3E9SA 3TBLD 1D5ZC 1NI2A 3GZNB 4XDDA 2QMTA 3QK0A 1V97A 5C23A 1T0YA 3RCZA 3X23A 4A90A 2IO3B 2LVOA 3N1YC 3IT6B 1BMLC 2XEWA 2LWPA 3SU8X 2Y5CA 3UQBA 2KT7A 4HEA1 3NY5A 4B95A 3QQ8B 2E6XA 1TZOA 2QILA 1GG3A 3APFA 2KQ4X 5IA7A 2PPHA 1MVKA 2KVZA 1WZ0A 2IO1B 3AEGB 1YN5A 3H8HA 1ROEA 3D32A 4GU2A 2ON8A 1RAXA 1WGGA 4P16A 3KUCB 1GB1A 2LRUA 2YEPB 3A4RA 4HVBA 1OEYJ 1JWMD 4II3B 2MBBB 2FBWB 5KHOA 5I4DA 2X8XX 3SFDB 1GNUA 4PT5A 4TKNA 3B08A 3EHVA 2RGFA 3TCAA 1HE8A 4KDLB 3IAS1 4W9CA 4OHJA 3Q6BA 1J7AA 4WWNA 1FRRA 4FXCA 4USAA 1C79A 2K0PA 3HUIA 5CX3A 3RI7C 2MWSB 1WXAA 2A5UA 1L2NA 3IFWB 2ZZPB 3WCQA 2L3ZA 4IM0A 1K53A 3UGBB 1MFWA 1BXTA 3W2DA 1TGZB 1XCQL 2CJOA 2NPTA 3WIMA 4A20A 1F2RC 4YSYB 4WJOA 4K7WA 2J0MA 4OVVA 2DYOA 5GXGB 4O1NA 1K52A 3R2IA 1QILA 3ZIMA 3Q3MC 2NCNA 3KYDD 2KAJA 2D3CA 4IWQA 3GB1A 3MC0B 3NVWA 1I4XA 4ARIA 4JLCA 1IBXB 3PREA 2O6VB 3DHGC 5IAAC 2PVOD 2KDFB 3ZXRA 4EEWA 3VUWA 2MQJA 1NENB 3TEZA 1XQQA 3A9KB 3DBSA 4KKJA 1TT5B 1KJTA 2QCZA 2LD9A 2JZ3B 4CO7A 3ZDTA 4YWGG 3OWEB 2KWCA 2MP2A 4K7UA 2G45B 2JXTA 2Z8LA 3W1SC 2WXHA 1V9JA 4AOFA 1QOFA 3NZSA 1WIAA 3A1QA 2Z59B 1SE9A 5BMIA 3ZNZB 1IPGA 4CHKA 2D3BA 2J0JA 2WHIA 3Q3FA 2RPQA 1D6EC 2WGSA 2INPE 5FR6A 1WX7A 3L13A 1NVID 2ZW0A 1RLFA 3HRDD 3EA6A 2YVCA 1MPEA 3P4PB 1WXQA 1V49A 3DDCB 2O2VB 2LJIA 1Q1OA 4JL9A 3WAMA 4EFOA 1TYGB 4LLGM 4RGNA 3B9JA 5JHAA 4DDGD 5T8IA 2PE6B 2KWVB 2NTTA 2CR5A 4EE2A 4DXFA 3MHSD 4ARCA 4FLHA 4TQ0A 1QOAA 2M19A 4WJPA 3ETRA 2WXLA 2VZKB 2C7HA 4PYZA 2VH1A 4C4VA 4B0EA 3KWLA 2AX5A 1JRPA 2KQSA 1KFYB 2Y3AA 4OZCA 3T3NA 3L54A 1YMHE 1Z2MA 1SJED 3PLUA 3I5JC 3P4QB 3QARA 2QIEB 4RCOA 4FN2A 2KTRB 4M02A 1WJUA 4C7YA 3ZLZA 1H8CA 3Q8EA 2BTEA 3WAPA 3QJZA 3RNAC 3FILA 3R7QA 3W5VB 2D5GA 4NAWA 3KW5B 1SB3C 3ZVVA 1C4CA 3VVWB 1SBBB 4DHZB 2AQ3B 4AJYB 4IWPA 4YSZB 1ZW7A 3PS6A 4GDKB 1FCCC 2RDHA 4JX1C 4HLEA 3L4PA 4IDIA 1WSPA 2N7JA 3KYCD 1LXDA 3NS1A 2WXQA 2YEPF 3BZDB 2DWQA 4HDOA 4HROA 5CHWA 2IDYA 3APCA 1TY2A 2MA9B 1M94A 2N9EB 1P0RA 3NHEB 5LNK1 1RYJA 4PS8A 1JWUD 3ABVB 1S3SG 3ECIA 4FJZA 3WALA 3H1UA 3TUOA 3MFGA 2PIAA 1NBFC 2IY1B 1N60A 2MEKA 5BMHA 3A9JA 3AE5B 2LMCA 3UIOB 2N9PC 3H6NA 3H7PB 1SIJA 5HHDG 2K6DB 2GOWA 1E8XA 4P7IA 1XCTL 1YN3A 1C3TA 4N6EB 4AS1A 4B0MA 3ZTDA 2K5PA 2RDGA 2GI9A 2L83A 1DOIA 4RNAA 4W9KA 2KFKB 1DOYA 5G5HA 1ZGUB 4A6QA 1WXSA 1K51A 2DLBA 2C7NB 1HTOA 1FM0D 3WANA 1ENFA 4K1RB 2K8HA 3BYYB 4F8CB 2N9LA 1E7UA 1WR6E 4A55A 2BVCA 2W9NA 4FJVB 3DHIC 3RFZB 3JSVA 2M17A 4TSSA 4XWWA 3X0WA 1E7VA 3AEAB 4AJWA 4JWUC 2EELA 4LDTB 1E6EB 2PLPA 3BVMA 2IY0B 3RPFC 4I6PA 2MBHA 4A8XC 4OZBA 2PTLA 1WY8A 2JX5A 2QSDA 3U7ZA 4MJSA 4K3CA 4NJ6A 2PJHA 1J8CA 3VRBB 4JPSA 1NYQA 3FC4A 1E0ZA 1QT9A 2BKRB 2PW9A 4MH0E 3FKYA 4W9FA 1JALA 2CJNA 2LRWA 1N5XA 2DZMA 2BT6A 5E6OA 5MPOA 4M0WB 2KC2A 4GLSC 1SIFA 2KX3A 2V4LA 2WDRB 2CU3A 4IM2A 2N1WA 2M8SA 1ZKHA 3OJ3A 4YSXB 5G2NA 1MHHE 3R7RA 2GBKA 2ZCCA 3RZWC 2MX2A 3P63A 4L23A 3SEBA 5IN7A 1ET6A 1NEKB 2WP9B 4LJPB 4WJQA 3AMZA 4KV2A 2XNAC 4C00A 5DPTA 4QAYA 2LHEA 4IW0A 2AQ1B 1T6BX 3TEXA 1UH6A 3DBLI 4W9HA 4A3OA 3EECA 4A3PA 2GBMA 1I7HA 3PSEB 4OVZA 2LFIA 3DOWA 3GS2A 2HE7A 5HFYA 2NBUA 3QA8A 2BYFA 2LUEA 2WXKA 1FFVA 2UU7A 4W9JA 1HA5A 2K25A 2DBYA 3Q14C 1WJ6A 2W82A 4G50A 4DK5A 1MG8A 2QHOA 3ZNID 1FPYA 3MHZA 4KIKB 2MHJA 1HZ5A 2C5LC 2K8BA 2TSSA 4RMAA 4WAFA 1IP9A 4DQOC 5D3IB 1NYRA 2V3NA 3DBRI 3R8BA 1YQ4B 1L0YB 2O6VD 2KN4A 1T3QA 1Q5WB 2M0AA 2KJHB 1UWXA 4NQKE 2R2OA 4JGHB 3W1YA 3UF8A 1EO6A 3VRAB 5L83A 4KSKC 2NS5A 3VUYA 2KOXA 4IWOA 3DQVA 3N30A 1AWDA 3CIRB 4OW0A 2KZRA 1P3QU 1FXAA 2MBQA 4ZYSA 1IGCA 1R7SA 1XLQA 2M0XA 1WYWB 4BVUC 3UQAA 3PLVA 1HXYD 1WMHA 5JH5C 1AN8A 2J4XA 4M01A 5FK9C 2FCMA 2A4ZA 2AL3A 3N32A 3N9YC 1R4NB 2L0FA 3L17A 1WJNA 1S1QB 3VTVA 1EU3A 2DNFA 4HXDA 2X38A 1LFDA 3PVLA 4LK0M 3E56A 2UYZB 1XF5L 2ONQA 3TMPB 3BK2A 4MDKE 1J0GA 1L4ZB 3KUZA 3TEYA 2G3QB 3AEDB 2ZJDA 2Z0EB 2B76B 4HRSA 2DX5B 4DXAB 1KH0A 2JXXA 2VRRB 2JVCA 4FHKA 4YTMB 2VZKD 1F9JA 3APDA 4MM3B 4BOSC 3I9V1 2HJ8A 1DYQA 2LASA 1D5MC 2N7EA 2E3TA 4MACA 2KD0A 5J2RA 2MJDA 1SF0A 3L16A 3VHTC 3M63B 1UF0A 4K81A 2MLBA 3VH4B 2GMIC 3ALBA 4NJ7A 1MHXA 4GSWA 1RRBA 1WJ4A 3JW0X 2JUOA 1KLVA 1C9FA 4KVGB 3L10B 4AP4C 5E6PA 2I2YA 1ACCA 1WI0A 3B2FA 1MI0A 4P1BC 3AXCA 1WXMA 4RM8A 1Y56A 2CHZA 3LJ3A 1JMLA 1CK1A 3BVGA 1SXTA 1K8RB 1CZPA 3DBHB 1M4VA 1K50A 3BINA 3PTFC 2ACZB 1IYFA 3PPAA 2REXA 3I3TB 1RFKA 4LTUA 5TSSA 4ZRQA 4W9EA 4GDLB 3NUHB 2R61A 3P4RB 1P9DU 2RD0A 1L0VB 1OQYA 2C7MB 2CHXA 2JRHA 1J7BA 2JY6A 1FFUA 2NVUI 4WAAA 3MJ5A 3N20C 1IBXA 2FAZA 1V1PB 1XLPA 2O6VA 3AU4A 2LXCA 3ZNHB 4NZLB 2N9KA 2WWZA 2OJRA 2FUG1 5D2MB 2WU2B 4HWIB 3RNBC 2WXMA 4LNKA 4IUMB 2QDFA 5GMVA 4BAXA 4ZRKA 4BBNC 2XK5B 5AUIA 4XE0A 1GJZA 1L6UA 3AN1A 2MBOA 1QOGA 3PO0A 3DVNV 2Y5PA 2BGFA 5EE0A 3K9PB 2RPVA 3LXFA 3V6EB 1A5RA 2FIFA 2DAFA 2NBVB 3ZDMC 4NNJB 4LNNA 3H7SA 3VR9B 4MSMB 1X1MA 3W9CB 1ET9A 3W5UB 1C76A 1I42A 4JE3B 1F0ZA 2M4NA 4RH6A 2V0GA 2AQ2B 5IO9A 4JIOU 1C4AA 1PQSA 3AEEB 3MJWA 1WE6A 2I1JA 2BPSA 5D6JB 4RM9A 2O2VA 2MRPA 1LQBA 4IM3A 4XWTA 2KJ6A 2LGSA 2MP2B 4WWOA 2KMMA 2GLSA 3IXSA 4LDTD 1PGBA 1OQRA 1ZDVA 1YN4A 2WDVB 1A70A 2KQ7A 1RM6C 4AWJA 3WAOA 1E8YA 5HKHA 3V62A 1J7CA 2K8CA 1TBEA 2MJ3A 1YX6B 1EUVB 3Q3NC 2AEHA 3SR6A 4FBJB 3EUB2 2NR2A 4W9GA 4UDUC 1E8ZA 1ESFA 3Q3JA 3DVGY 4LCDE 2WXPA 2H88B 3HM6X 4MGZE 1KRHA 2KTRA 3A33B 3SDLC 2MH7A 2ZVOA 3ZNGC 1V8CA 2V9HA 2C60A 1E9MA 4WURA 1UGMA 1IGDA 4HPMB 1HTQA 5LXHA 3TEWA 4IG7B 4XX5A 3RULA 2XN9C 3PHWB 4IOIE 4GGQA 1C4PA 1V5OA 3MC9A 3RZFA 3N1XC 3AV8A 3GP7A 3OG5A 4K7SA 3B0AA 2AYOB 5TR5A 1OEYA 2M1MA 1QLBB 5BYRA 2KWUB 4P6VF 2JRIB 2ZCBA 1LO5D 3RNGC 3KLSX 4TMAB 1P1AA 2HTME 3BK1A 3T3OA 3U52E 2DAJA 3ML9A 1STEA 1QF6A 2WXIA 2MJEA 3DHHC 3IVFA 1J19A 4RGTA 2RDBC 3PV1A 3U30A 4HDQA 1VD2A 4DHJB 4RFBA 3RYTA 1E7PB 3H9DA 3V05A 1TKGA 1KM7A 3P2BA 1VZ7A 2N1VA 1FRDA 1N5WA 4FA6A 3H7PA 4HKZE 2WDQB 3BWUD 4EZJA 3O65B 2RMMA 3PRMB 3NVZA 2L05A 3DWGC 2KLCA 1XEEA 4US8A 2OEDA 3NZUA 4II2B 4LNIA 4EKUA 4CQNA 4WJNA 4GN1A 2HDEA 4IC7B 1UELA 2Q5WD 2KACA 5CHFA 2AL6A 3QX1A 1RFAA 5E6JA 1GC7A 3M95A 2L32A 4HCNB 4BOZB 3TL5A 3VQIA 1PGAA 3LDZE 1GUAB 4KKIA 2ZVNA 3AI5A 2B3AA 5D94A 2LHDA 1FCLA 3VTUA 1FXIA 1TS3A 2NMQA 2JZPA 2JZZA 1YIWA 2CKHB 1FNVA 1ZXIA 2FE8A 5J18A 1YJJA 2ZNVB 4HPPA 5BYSA 4FULA 4G0NB 1UZXB 3PRPB 5L95C 2IO2B 1AYFA 3DPDA 4MGKE 2KDMA 3U4EG 1PFDA 1GB4A 3GOEA 3ZRFA 4M00A 2KVRA 3TSSA 1OTRB 3QCAA 4HK2A 2WYQA 1SE4A 2DENB 1R4MI 4M0WA 5E6NA 1WX9A 2RSUA 3IT4B 2D10A 2FIDA 2GBNA 4L1BA 1VLBA 2K3UA 1KLGD 3AECB 3M62B 4WWPA 1KF6B 1EU4A 1ZUD2 1PDXA 5JHBA 1G6JA 1H4RA 3AE9B 2DHZA 1I4PA 3UINB 2WX0A 2J7QB 3HK0A 4XYCA 3QHTA 2K1FA 4ZRJA 2BS3B 2DYBA 3WA0A 3V3XA 4TV3A 2W55A 2PMVA 4C7ZA 3LB8C 3HIZA 1YX5B 1L5PA 4HPLB 4WQOB 3OLMD 1N62A 3PHXB 3VH3B 1P98A 2W3SA 1T0SC 3VFKA 2W3RA 3V61A 1YQBA 4M8MA 3AE1B 3ML8A 1V1OA 3HVDA 2GBRA 3AEBB 2M56B 3A4SC 1U4AA 1EF5A 1XO3A 2ZNVC 3ZJVA 3BIID 3Q2AC 1TIFA 2D07B 2YLMA 4EZKA 3ZYYX 2GB1A 1ZOYB 4KIKA 4LNOA 2LUMA 4HCPB 3KH0A 2QC8A 3ZQ4A 3OJ4B 3RT3B 2G4DB 1EWYC 2GBJA 2MW5A 1D5XC 3BVZA 1JQ4A 2JSVX 3VTWA 3ZJTA 2MBEA 2LXAA 2WXGA 5BYQA 5EE3A 1VDVA 4OVUA 4TUUA 4K3BA 3IG3A 3LYYA 3AE2B 2BB6A 3EFCA 4FJYA 3Q8FA 2WLBA 3SD5A 2WQYB 1UBIA 4J6IA 1PYWD 4H2AA 2HTHA 4C56C 3R66C 5C3JB 1WH3A 2WNMA 4XZ4A 3ZXVA 1UNSA 5CTRC 1FEHA 1CMXB 3HM3A 2BQQA 1YQ3B 4YT0B 3IAM1 3CMMB 2NBWB 1JW9D 1WWTA 3GE8C 2RR9A 5AZFA 1WRIA 1QZEA 3ZKJC 2JPHA 2SAKA 4WH4A 2R2QA 2KNBA 1WF9A 1L7YA 5FR3A 1UWMA 2QJLA 3RNCC 1D3ZA 1KLUD 2G4SA 4KDIC 3K9OB 1EM7A 4IKGA 2WDTB 4OZAA 4ANUA 4PS3A 2WU5B 3I63C 3ZO5B 2LI5A 4US9A 1V86A 3AE4B 3P1MA 4W9LA 2CS4A 1T0QC 5IOIA 4PK1A 4WWMA 4AUQC 2VH2A 3W1SA 1I4GA 1T5XD 1Q10A 4KSLC 2BYVE 3BYTB 1IUEA 3AEFB 5LLIA 2ZPYA 1F52A 4BFRA 1F1HA 1HEZE 3RUIB 5DPWA 3BY4B 3VXWA 1VR9A 1JWAD 3I57A 2OJWA 1BT0A 4NQLB 2KLGA 2L52A 5KHQA 2ICIA 4ZYNA 2BBCA 2V4IB 3C19A 1V80A 3AU5A 3JYUA 4N58A 1TKEA 2N0SB 5LXIB 1HZ6A 4GDLA 4JQWC 4PYUA 3VAWA 5EDSA 2WS3B 1OGWA 2J0KA 4M8NA 2DZIA 2CU1A 1I4RA 5CHVC 3T8MA 3ZUNA 3B1LX 2KXJA 4RGMA 2D3GA 3PGEA 1MG4A 4ANXA 4MEMA 3PT2B 2G9HD 3VDZA 4D2KA 1V1PA 3NRZA 3ENEA 1FO4A 5IP4D 2LJ5A 4DHJD 5IKCM 5AZGA 1P7EA 3AE7B 2JU6X 2Y5BB 1C77A 2IPKD 2DYMA 1C1YB 4JWSC 2XK5A 1ZPSA 5G5GA 3ZRCA 3A9KA 3QIJA 2BKFA 1TJEA 3V6CB 3Q3OC 1I4QA 1VZ6A 2JQRB 3V60A 1TS5A 1I35A 2NPTB 2KMAA 2WXJA 1V5TA 3NG0A 2N9XA 2INDC 2INCC 3MTNB 3NS8A 1R4MB 4W9DA 4DWFA 1VZ8A 1NI3A 5AUKA 4J3OD 2D2QA 1SJHD 3IHPC 2WXRA 4MGIE 3P4SB 3PZ8A 2OOBB 1WX8A 1TKYA 3ZGZA 3U7DA 3TIXA 3KUDB 1T0RC 4XDCA 5AZHA 4KX6B 2BWFA 4KZCA 2D3AA 1VCBA 2PEAA 5BO4B 1GC6A 2KYWA 3OAWA 1N63A 1WGRA 4FHJA 4MT5A 1LGRA 1OQQA 2JYEA 5C2TB 1SEBD 2JYTA 2ZEQA 3A1QB 1WZ3A 2BS2B 5EE9A 4B9KA 3AE3B 2NTSA 2PE9A 2XBBC 2JWUA 1WGKA 3ONSA 3DBLB 5H92C 4NAMA 3NJTA 3DWMA 3CWIA 1LM8B 4HJKA 4XGAB 1GOZA 2WXOA 1E10A 4RGOS 2L0TA 3B2GA 2LGDA 3EC8A 2LVQA 2WXFA 2Z0DB 4WQMA 1L6VA 1YNTE 4HJGE 5G55A 3N3KB 1EWCA 2BS4B 1TZ1A 4BKTA 4C80A 2QEJC 1AARA 3M3JA 3NOBA 1FNWA 4ANVA 3SFEB 3HVZA 1ZE3D 3DBRB 2BB5A 3Q8AA 3KVFB 3DVNU 1QQRA 4DBGA 1B1ZA 3AM9A 5D3DA 3EGRA 4KGRA 4AQ7A 4MELA 4YL8A 4C4VB 1DOXA 1JWBD 4BBNF 1SGHA 1WM2A 3FAHA 1PGXA 4ZOHC 2BW2A 2FUHB 1XLNA 1SSNA 2V1YA 4GDKA 4W9IA 1YD8U 1FNUA 2KWDA 1MJDA 2WX1A 3Q8CA 4R3DA 3QC8B 1PUTA 2C9WB 1RWSA 4I6LB 2HJ1A 4ZRPA 1FIQA 3Q69A 1R4NI 3UI3A 1UUPA 4GMVA 3FILB 3Q8BA 1V6EA 4NAWB 1F2RI 3AULA 1XLOA 2MSED 1WM3A 3GZNI 2G1EA 2N7DA 2EMTA 4KZ0A 2INNE 5D7GA 4E3CA 2KTFA 2L00B 2KKCA 1E5WA 4ASWC 3GE3C 3C8YA 2JT4B 3ZJUA 1Q0WB 3DCGA 3PZDA 2KN5A 4N59A 1V2YA 4NY0A 1FMAD 3PRZA 4DDID 2I1KA 3U8ZA 1YJIA 1WXVA 3U2SC 2H89B 2J53A 2KMCA 4RF1A 3MP9A 2L8JA 2MCNB 4Q2JA 2KFKA 1DGJA 3RNEC 4MSQB 2CHWA 2IZVB 1UGJA 2KJRA 4EUTA 3HHMA 1CJEA 1TTNA 1SE3A 1JROA 4BKSD 3A9JB 2N4FA 3J9CA 2SEBD 2JWZA 2K22A 2IJ0A 5C1ZA 5J17A 4WIPA 4E71A 1WE7A 1WRDB 1E90A 2K6QA 1WYGA 4NPNA 3C0RB 3R3MA 3PZ7A 1L4DB 3NZ3A 5EE1A 1V81A 3AH7A 3DBHI 1NDDA 2J52A 1KTKA 2J42A 2KDBA 1ISNA 1Z5SB 4MGYE 1BUIC 4ZRIA 3SHQA 1E8WA 4S17A 1JWSD 2PKOA 4B6WA 4KGSA 1L0XB 3O13A 2FCQA 2IGGA 2LEKA 1JRUA 3KQ4A 1WGDA 1UD7A 3NVVA 2FNJB 2BWES 4P1CC 4PS7A 2JF5A 4REZA 2V3PA 3CSFA 2KO3A 3KWVA 2AWTA 1WR1A 4A9AA 1ZXHA 2FCNA 3JSVB 1C78A 2L7RA 4E74A 1XXGA 3T9LA 1TS4A 1WGYA 3VUXA 3MC8A 1AW7A
chains in the Genus database with same CATH topology
3R7QA 4NAWA 2FAZA 3KW5B 2O6VA 3AU4A 1XT9B 3ZVVA 1WH3A 2LXCA 4XZ4A 3VVWB 3ZNHB 5CTRC 2WWZA 2OJRA 5D2MB 4DHZB 1CMXB 4HWIB 2KK8A 4MJSB 4IUMB 5GMVA 4AJYB 4IWPA 4ZRKA 3HM3A 4BBNC 2XK5B 1ZW7A 4LJOB 3PS6A 3CMMB 4F7ZA 4ZDVA 4GDKB 2NBWB 1GJZA 2KANA 2KDIA 2MBOA 2RR9A 5AZFA 4HLEA 1QZEA 3ZKJC 2JPHA 3DVNV 1KOTA 2R2QA 2KNBA 2HD5B 3KYCD 1LXDA 1WF9A 2K39A 1L7YA 4EOYA 5DCNA 2BGFA 2LGXA 3K9PB 4HDOA 3V6EB 4TQ1A 3QAQA 1A5RA 2FIFA 2DAFA 5CHWA 1D3ZA 3CSTA 2NBVB 2BYEA 3ZDMC 3APCA 3L08A 4NNJB 4FADA 2G4SA 2MA9B 3H7SA 3K9OB 4KDIC 1M94A 2N9EB 1P0RA 2WDTB 3NHEB 4G11A 2LGYA 4MSMB 2ASQA 4PS8A 4PS3A 4ANUA 2EMSA 4DHZE 1X1MA 1S3SG 3ECIA 4FJZA 3WALA 3H1UA 3ZO5B 1I42A 2LI5A 1EF1A 1NBFC 5E6PA 3UIPB 2IY1B 1XD3B 2M4NA 1V86A 4W9LA 4JIOU 2IYDB 2CS4A 3A9JA 1PQSA 4G3XB 4ANWA 3ZW3A 2KFJA 5AEKB 3MJWA 1WE6A 3ZTCA 3UIOB 2N9PC 2I1JA 2BPSA 3H6NA 5D6JB 2KX0A 4RM9A 3TJPA 2O2VA 4AUQC 3W1SA 2MRPA 3H7PB 1LQBA 4IM3A 5DPSA 4KSLC 2KJ6A 2MP2B 3EFUA 4WWOA 2KC1A 3IBEA 2BYVE 4LDTD 2K6DB 2GOWA 5LLIA 1E8XA 2EKEC 2ZPYA 3QWZB 4P7IA 1C3TA 4BFRA 4BKGA 4N9F4 3RUIB 3ZTDA 5DPWA 2KQ7A 3BY4B 3VXWA 4AWJA 3WAOA 1E8YA 5HKHA 3V62A 1BT0A 2FCSA 4NQLB 4W9KA 2K8CA 2KLGA 3JVZX 3L0WB 5KHQA 1YJ1A 1TBEA 2KFKB 4ZYNA 1ZGUB 3S2AA 1Y8RC 1WXSA 4F1SA 1YX6B 1V80A 3AU5A 3JYUA 1EUVB 2C7NB 3CF6E 2AEHA 4FBJB 4EZLA 5LXIB 2IBIB 4ICUA 4JQWC 4GDLA 2NR2A 3WANA 4K1RB 4PYUA 4W9GA 2K8HA 4BKSA 2DZJA 1E8ZA 3VAWA 5EDSA 3Q3JA 1OGWA 3DVGY 4LCDE 2J0KA 4F8CB 3HM6X 1E7UA 1WR6E 4M8NA 4MGZE 2DZIA 2KTRA 2W9NA 3A33B 2CU1A 4FJVB 3SDLC 2ZVOA 5CHVC 3T8MA 3ZNGC 3JSVA 3ZUNA 3B1LX 2M17A 1WFYA 3X0WA 2C60A 2KXJA 2D11A 2D3GA 1E7VA 3PGEA 4AJWA 4LDTB 4ANXA 4MEMA 1UGMA 3PT2B 3VDZA 4HPMB 2IY0B 4I6PA 5LXHA 3ENEA 4IG7B 2ZPNA 4XC2A 2LJ5A 4XX5A 3RULA 5AZGA 4DHJD 4X57B 2MBHA 3PHWB 4I6NB 4CYEA 2LZ6A 4GB9A 1FXTB 4GGQA 5JZEB 1WY8A 2L76A 2Y5BB 1V5OA 4MJSA 4NJ6A 2PJHA 3RD2A 1J8CA 2DYMA 4K7SA 3RZFA 1C1YB 4GXBA 3B0AA 2AYOB 2XK5A 5DPRA 5TR5A 3ZRCA 3A9KA 2BKRB 4ICVA 3QIJA 2DZKA 1OEYA 2M1MA 4MH0E 2BF8B 2BKFA 3V6CB 2KWUB 4W9FA 1WGHA 3V60A 2LRWA 1I35A 2NPTB 2JRIB 2DZMA 2ZCBA 4GIVA 4GOCA 2KMAA 5E6OA 1V5TA 2KDEB 2V3SA 2N9XA 3MTNB 1P1AA 1UBQA 2LVPA 2KC2A 3NS8A 4M0WB 1SIFA 2KX3A 3DVGX 2UWQA 2V4LA 2DAJA 3ML9A 4URKA 4IM2A 2IO0B 4W9DA 4DWFA 2N1WA 2M8SA 1ZKHA 3OJ3A 1WMHB 3IVFA 1J19A 2D2QA 5G2NA 2KHWB 4MM3A 3PV1A 3IHPC 4HDQA 1VD2A 3R7RA 2GBKA 2ZCCA 3U30A 4DHJB 3TBLD 3RYTA 1NI2A 4MGIE 3H9DA 3RZWC 2MX2A 2OOBB 1WX8A 3U7DA 1KM7A 3KUDB 3QK0A 3TIXA 3P2BA 5AZHA 2N1VA 5C23A 4FA6A 3H7PA 1T0YA 3RCZA 2BWFA 4EZJA 3X23A 3O65B 4KZCA 2IO3B 2LVOA 3PRMB 4LJPB 4WJQA 2L05A 2KLCA 4KV2A 1VCBA 2PEAA 5BO4B 1GC6A 5DPTA 3OAWA 2XEWA 1WGRA 2LWPA 4FHJA 3NZUA 4II2B 4EKUA 4IW0A 4WJNA 3SU8X 1UH6A 3DBLI 4W9HA 3UQBA 3NY5A 4GN1A 3QQ8B 4B95A 2ZEQA 4A3OA 3A1QB 1WZ3A 3EECA 4IC7B 2GBMA 4A3PA 3PSEB 3DOWA 1UELA 4B9KA 1GG3A 2HE7A 3APFA 2NBUA 5CHFA 2AL6A 2PPHA 2PE9A 2BYFA 3QA8A 2XBBC 5IA7A 2LUEA 3QX1A 3ONSA 1RFAA 1WZ0A 2IO1B 1GC7A 3M95A 4HCNB 4W9JA 4BOZB 3D32A 4GU2A 2K25A 3TL5A 3VQIA 1RAXA 1WGGA 3KUCB 1WJ6A 4G50A 2LRUA 4DK5A 3LDZE 1MG8A 1LM8B 1GUAB 2QHOA 2ZVNA 4HJKA 3A4RA 3AI5A 3ZNID 2B3AA 5D94A 4HVBA 3VTUA 1OEYJ 2L0TA 4II3B 4KIKB 2MBBB 5KHOA 2K8BA 2C5LC 2LGDA 3EC8A 2LVQA 1GNUA 4RMAA 1IP9A 4TKNA 2Z0DB 5G55A 3N3KB 3VTVA 2JZZA 1YIWA 2CKHB 3B08A 3DBRI 3EHVA 2RGFA 1TZ1A 3TCAA 1HE8A 4KDLB 5J18A 4BKTA 2O6VD 1Q5WB 2ZNVB 1AARA 3M3JA 4W9CA 3NOBA 4ANVA 2KJHB 4NQKE 2R2OA 4FULA 4G0NB 4WWNA 1UZXB 3PRPB 3KVFB 3DVNU 4DBGA 5L95C 2IO2B 3DPDA 4JGHB 4MELA 4MGKE 4YL8A 3W1YA 5CX3A 1L2NA 2MWSB 1WXAA 2A5UA 3UF8A 1SGHA 1WM2A 1EO6A 2ZZPB 3GOEA 3IFWB 3ZRFA 4BBNF 5L83A 4KSKC 2L3ZA 4IM0A 2NS5A 3UGBB 3VUYA 2KVRA 2KOXA 2FUHB 3DQVA 3N30A 4IWOA 2V1YA 1OTRB 1TGZB 3QCAA 2NPTA 4GDKA 4W9IA 3WIMA 4A20A 1YD8U 2KZRA 2WYQA 4HK2A 1P3QU 2WX1A 2MBQA 3QC8B 4WJOA 2DENB 1R4MI 2C9WB 2J0MA 4K7WA 4OVVA 5E6NA 2DYOA 4I6LB 1WX9A 2M0XA 2RSUA 1WYWB 2D10A 2FIDA 2GBNA 4BVUC 3UQAA 1R4NI 3ZIMA 2NCNA 3PLVA 3KYDD 3M62B 4GMVA 4WWPA 4IWQA 1WMHA 5JH5C 1V6EA 4JLCA 3PREA 2FCMA 4NAWB 5JHBA 2O6VB 3AULA 2A4ZA 2AL3A 2MSED 5IAAC 1G6JA 1WM3A 3N32A 2KDFB 3GZNI 4EEWA 1H4RA 2L0FA 2MQJA 3VUWA 1XQQA 2N7DA 2EMTA 3A9KB 1WJNA 2DHZA 1S1QB 3L17A 4KZ0A 3DBSA 5D7GA 2KTFA 2WX0A 3UINB 2J7QB 2L00B 2KKCA 4E3CA 3HK0A 1E5WA 4HXDA 4ASWC 1KJTA 2K1FA 1LFDA 3QHTA 4ZRJA 2JT4B 2LD9A 1Q0WB 2JZ3B 2DYBA 3DCGA 3PVLA 3WA0A 4TV3A 4CO7A 2UYZB 3ZDTA 3TMPB 4MDKE 3PZDA 2KN5A 1J0GA 1V2YA 4NY0A 3KUZA 2KWCA 2MP2A 3PRZA 2G3QB 4K7UA 2G45B 3HIZA 4DDID 1YX5B 3W1SC 2ZJDA 2I1KA 4HPLB 3OLMD 4WQOB 2Z0EB 1V9JA 3PHXB 3VH3B 4AOFA 1P98A 3NZSA 3U8ZA 1WIAA 2DX5B 2Z59B 3A1QA 3VFKA 4DXAB 2JXXA 2VRRB 1SE9A 1WXVA 2JVCA 3V61A 1IPGA 3ZNZB 4CHKA 1YQBA 4M8MA 3ML8A 4FHKA 2J0JA 3APDA 1F9JA 2KMCA 3Q3FA 4BOSC 2GBRA 2HJ8A 2L8JA 2LASA 2RPQA 2MCNB 3A4SC 2KFKA 2N7EA 4MSQB 2CHWA 2IZVB 1U4AA 1EF5A 5FR6A 1WX7A 2KD0A 2KJRA 3L13A 5J2RA 4EUTA 3HHMA 3L16A 3VHTC 1RLFA 1TTNA 2ZNVC 3M63B 4BKSD 3A9JB 2N4FA 4K81A 2MLBA 3VH4B 2GMIC 2D07B 2YVCA 2JWZA 3ALBA 4NJ7A 1RRBA 1WJ4A 2YLMA 3JW0X 4GSWA 4EZKA 2JUOA 1V49A 3DDCB 4KIKA 5C1ZA 5J17A 1KLVA 4KVGB 2O2VB 3L10B 4AP4C 4E71A 1WE7A 1WRDB 1E90A 1Q1OA 2K6QA 3KH0A 4HCPB 4JL9A 4NPNA 3C0RB 3R3MA 3WAMA 1WI0A 4EFOA 3OJ4B 3RT3B 2G4DB 2GBJA 2MW5A 5JHAA 4DDGD 1V81A 2PE6B 2KWVB 3AXCA 3DBHI 1NDDA 1WXMA 1ISNA 2KDBA 1Z5SB 2CR5A 4RM8A 2CHZA 4MGYE 3LJ3A 3VTWA 3MHSD 4FLHA 4TQ0A 4ZRIA 3SHQA 2MBEA 1E8WA 4B6WA 1K8RB 2LXAA 4WJPA 2C7HA 4PYZA 2FCQA 2KQSA 3BINA 3PTFC 1IYFA 1JRUA 2REXA 3I3TB 3PPAA 1WGDA 1UD7A 4OVUA 2FNJB 4W9EA 2BWES 4TUUA 4GDLB 4PS7A 2JF5A 3CSFA 3IG3A 2KO3A 3L54A 1P9DU 1Z2MA 3PLUA 2RD0A 2AWTA 3QARA 1WR1A 4FJYA 2FCNA 1OQYA 2C7MB 2KTRB 2CHXA 2JRHA 2JY6A 4FN2A 3SD5A 3JSVB 1WJUA 1UBIA 2NVUI 3ZLZA 2L7RA 4J6IA 4WAAA 4E74A 1H8CA 3T9LA 2HTHA 1WGYA 3QJZA 3VUXA 3WAPA 3R66C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7Q A;  4NAW A;  2FAZ A;  3KW5 B;  2O6V A;  3AU4 A;  1XT9 B;  3ZVV A;  1WH3 A;  2LXC A;  4XZ4 A;  3VVW B;  3ZNH B;  5CTR C;  2WWZ A;  2OJR A;  5D2M B;  4DHZ B;  1CMX B;  4HWI B;  2KK8 A;  4MJS B;  4IUM B;  5GMV A;  4AJY B;  4IWP A;  4ZRK A;  3HM3 A;  4BBN C;  2XK5 B;  1ZW7 A;  4LJO B;  3PS6 A;  3CMM B;  4F7Z A;  4ZDV A;  4GDK B;  2NBW B;  1GJZ A;  2KAN A;  2KDI A;  2MBO A;  2RR9 A;  5AZF A;  4HLE A;  1QZE A;  3ZKJ C;  2JPH A;  3DVN V;  1KOT A;  2R2Q A;  2KNB A;  2HD5 B;  3KYC D;  1LXD A;  1WF9 A;  2K39 A;  1L7Y A;  4EOY A;  5DCN A;  2BGF A;  2LGX A;  3K9P B;  4HDO A;  3V6E B;  4TQ1 A;  3QAQ A;  1A5R A;  2FIF A;  2DAF A;  5CHW A;  1D3Z A;  3CST A;  2NBV B;  2BYE A;  3ZDM C;  3APC A;  3L08 A;  4NNJ B;  4FAD A;  2G4S A;  2MA9 B;  3H7S A;  3K9O B;  4KDI C;  1M94 A;  2N9E B;  1P0R A;  2WDT B;  3NHE B;  4G11 A;  2LGY A;  4MSM B;  2ASQ A;  4PS8 A;  4PS3 A;  4ANU A;  2EMS A;  4DHZ E;  1X1M A;  1S3S G;  3ECI A;  4FJZ A;  3WAL A;  3H1U A;  3ZO5 B;  1I42 A;  2LI5 A;  1EF1 A;  1NBF C;  5E6P A;  3UIP B;  2IY1 B;  1XD3 B;  2M4N A;  1V86 A;  4W9L A;  4JIO U;  2IYD B;  2CS4 A;  3A9J A;  1PQS A;  4G3X B;  4ANW A;  3ZW3 A;  2KFJ A;  5AEK B;  3MJW A;  1WE6 A;  3ZTC A;  3UIO B;  2N9P C;  2I1J A;  2BPS A;  3H6N A;  5D6J B;  2KX0 A;  4RM9 A;  3TJP A;  2O2V A;  4AUQ C;  3W1S A;  2MRP A;  3H7P B;  1LQB A;  4IM3 A;  5DPS A;  4KSL C;  2KJ6 A;  2MP2 B;  3EFU A;  4WWO A;  2KC1 A;  3IBE A;  2BYV E;  4LDT D;  2K6D B;  2GOW A;  5LLI A;  1E8X A;  2EKE C;  2ZPY A;  3QWZ B;  4P7I A;  1C3T A;  4BFR A;  4BKG A;  4N9F 4;  3RUI B;  3ZTD A;  5DPW A;  2KQ7 A;  3BY4 B;  3VXW A;  4AWJ A;  3WAO A;  1E8Y A;  5HKH A;  3V62 A;  1BT0 A;  2FCS A;  4NQL B;  4W9K A;  2K8C A;  2KLG A;  3JVZ X;  3L0W B;  5KHQ A;  1YJ1 A;  1TBE A;  2KFK B;  4ZYN A;  1ZGU B;  3S2A A;  1Y8R C;  1WXS A;  4F1S A;  1YX6 B;  1V80 A;  3AU5 A;  3JYU A;  1EUV B;  2C7N B;  3CF6 E;  2AEH A;  4FBJ B;  4EZL A;  5LXI B;  2IBI B;  4ICU A;  4JQW C;  4GDL A;  2NR2 A;  3WAN A;  4K1R B;  4PYU A;  4W9G A;  2K8H A;  4BKS A;  2DZJ A;  1E8Z A;  3VAW A;  5EDS A;  3Q3J A;  1OGW A;  3DVG Y;  4LCD E;  2J0K A;  4F8C B;  3HM6 X;  1E7U A;  1WR6 E;  4M8N A;  4MGZ E;  2DZI A;  2KTR A;  2W9N A;  3A33 B;  2CU1 A;  4FJV B;  3SDL C;  2ZVO A;  5CHV C;  3T8M A;  3ZNG C;  3JSV A;  3ZUN A;  3B1L X;  2M17 A;  1WFY A;  3X0W A;  2C60 A;  2KXJ A;  2D11 A;  2D3G A;  1E7V A;  3PGE A;  4AJW A;  4LDT B;  4ANX A;  4MEM A;  1UGM A;  3PT2 B;  3VDZ A;  4HPM B;  2IY0 B;  4I6P A;  5LXH A;  3ENE A;  4IG7 B;  2ZPN A;  4XC2 A;  2LJ5 A;  4XX5 A;  3RUL A;  5AZG A;  4DHJ D;  4X57 B;  2MBH A;  3PHW B;  4I6N B;  4CYE A;  2LZ6 A;  4GB9 A;  1FXT B;  4GGQ A;  5JZE B;  1WY8 A;  2L76 A;  2Y5B B;  1V5O A;  4MJS A;  4NJ6 A;  2PJH A;  3RD2 A;  1J8C A;  2DYM A;  4K7S A;  3RZF A;  1C1Y B;  4GXB A;  3B0A A;  2AYO B;  2XK5 A;  5DPR A;  5TR5 A;  3ZRC A;  3A9K A;  2BKR B;  4ICV A;  3QIJ A;  2DZK A;  1OEY A;  2M1M A;  4MH0 E;  2BF8 B;  2BKF A;  3V6C B;  2KWU B;  4W9F A;  1WGH A;  3V60 A;  2LRW A;  1I35 A;  2NPT B;  2JRI B;  2DZM A;  2ZCB A;  4GIV A;  4GOC A;  2KMA A;  5E6O A;  1V5T A;  2KDE B;  2V3S A;  2N9X A;  3MTN B;  1P1A A;  1UBQ A;  2LVP A;  2KC2 A;  3NS8 A;  4M0W B;  1SIF A;  2KX3 A;  3DVG X;  2UWQ A;  2V4L A;  2DAJ A;  3ML9 A;  4URK A;  4IM2 A;  2IO0 B;  4W9D A;  4DWF A;  2N1W A;  2M8S A;  1ZKH A;  3OJ3 A;  1WMH B;  3IVF A;  1J19 A;  2D2Q A;  5G2N A;  2KHW B;  4MM3 A;  3PV1 A;  3IHP C;  4HDQ A;  1VD2 A;  3R7R A;  2GBK A;  2ZCC A;  3U30 A;  4DHJ B;  3TBL D;  3RYT A;  1NI2 A;  4MGI E;  3H9D A;  3RZW C;  2MX2 A;  2OOB B;  1WX8 A;  3U7D A;  1KM7 A;  3KUD B;  3QK0 A;  3TIX A;  3P2B A;  5AZH A;  2N1V A;  5C23 A;  4FA6 A;  3H7P A;  1T0Y A;  3RCZ A;  2BWF A;  4EZJ A;  3X23 A;  3O65 B;  4KZC A;  2IO3 B;  2LVO A;  3PRM B;  4LJP B;  4WJQ A;  2L05 A;  2KLC A;  4KV2 A;  1VCB A;  2PEA A;  5BO4 B;  1GC6 A;  5DPT A;  3OAW A;  2XEW A;  1WGR A;  2LWP A;  4FHJ A;  3NZU A;  4II2 B;  4EKU A;  4IW0 A;  4WJN A;  3SU8 X;  1UH6 A;  3DBL I;  4W9H A;  3UQB A;  3NY5 A;  4GN1 A;  3QQ8 B;  4B95 A;  2ZEQ A;  4A3O A;  3A1Q B;  1WZ3 A;  3EEC A;  4IC7 B;  2GBM A;  4A3P A;  3PSE B;  3DOW A;  1UEL A;  4B9K A;  1GG3 A;  2HE7 A;  3APF A;  2NBU A;  5CHF A;  2AL6 A;  2PPH A;  2PE9 A;  2BYF A;  3QA8 A;  2XBB C;  5IA7 A;  2LUE A;  3QX1 A;  3ONS A;  1RFA A;  1WZ0 A;  2IO1 B;  1GC7 A;  3M95 A;  4HCN B;  4W9J A;  4BOZ B;  3D32 A;  4GU2 A;  2K25 A;  3TL5 A;  3VQI A;  1RAX A;  1WGG A;  3KUC B;  1WJ6 A;  4G50 A;  2LRU A;  4DK5 A;  3LDZ E;  1MG8 A;  1LM8 B;  1GUA B;  2QHO A;  2ZVN A;  4HJK A;  3A4R A;  3AI5 A;  3ZNI D;  2B3A A;  5D94 A;  4HVB A;  3VTU A;  1OEY J;  2L0T A;  4II3 B;  4KIK B;  2MBB B;  5KHO A;  2K8B A;  2C5L C;  2LGD A;  3EC8 A;  2LVQ A;  1GNU A;  4RMA A;  1IP9 A;  4TKN A;  2Z0D B;  5G55 A;  3N3K B;  3VTV A;  2JZZ A;  1YIW A;  2CKH B;  3B08 A;  3DBR I;  3EHV A;  2RGF A;  1TZ1 A;  3TCA A;  1HE8 A;  4KDL B;  5J18 A;  4BKT A;  2O6V D;  1Q5W B;  2ZNV B;  1AAR A;  3M3J A;  4W9C A;  3NOB A;  4ANV A;  2KJH B;  4NQK E;  2R2O A;  4FUL A;  4G0N B;  4WWN A;  1UZX B;  3PRP B;  3KVF B;  3DVN U;  4DBG A;  5L95 C;  2IO2 B;  3DPD A;  4JGH B;  4MEL A;  4MGK E;  4YL8 A;  3W1Y A;  5CX3 A;  1L2N A;  2MWS B;  1WXA A;  2A5U A;  3UF8 A;  1SGH A;  1WM2 A;  1EO6 A;  2ZZP B;  3GOE A;  3IFW B;  3ZRF A;  4BBN F;  5L83 A;  4KSK C;  2L3Z A;  4IM0 A;  2NS5 A;  3UGB B;  3VUY A;  2KVR A;  2KOX A;  2FUH B;  3DQV A;  3N30 A;  4IWO A;  2V1Y A;  1OTR B;  1TGZ B;  3QCA A;  2NPT A;  4GDK A;  4W9I A;  3WIM A;  4A20 A;  1YD8 U;  2KZR A;  2WYQ A;  4HK2 A;  1P3Q U;  2WX1 A;  2MBQ A;  3QC8 B;  4WJO A;  2DEN B;  1R4M I;  2C9W B;  2J0M A;  4K7W A;  4OVV A;  5E6N A;  2DYO A;  4I6L B;  1WX9 A;  2M0X A;  2RSU A;  1WYW B;  2D10 A;  2FID A;  2GBN A;  4BVU C;  3UQA A;  1R4N I;  3ZIM A;  2NCN A;  3PLV A;  3KYD D;  3M62 B;  4GMV A;  4WWP A;  4IWQ A;  1WMH A;  5JH5 C;  1V6E A;  4JLC A;  3PRE A;  2FCM A;  4NAW B;  5JHB A;  2O6V B;  3AUL A;  2A4Z A;  2AL3 A;  2MSE D;  5IAA C;  1G6J A;  1WM3 A;  3N32 A;  2KDF B;  3GZN I;  4EEW A;  1H4R A;  2L0F A;  2MQJ A;  3VUW A;  1XQQ A;  2N7D A;  2EMT A;  3A9K B;  1WJN A;  2DHZ A;  1S1Q B;  3L17 A;  4KZ0 A;  3DBS A;  5D7G A;  2KTF A;  2WX0 A;  3UIN B;  2J7Q B;  2L00 B;  2KKC A;  4E3C A;  3HK0 A;  1E5W A;  4HXD A;  4ASW C;  1KJT A;  2K1F A;  1LFD A;  3QHT A;  4ZRJ A;  2JT4 B;  2LD9 A;  1Q0W B;  2JZ3 B;  2DYB A;  3DCG A;  3PVL A;  3WA0 A;  4TV3 A;  4CO7 A;  2UYZ B;  3ZDT A;  3TMP B;  4MDK E;  3PZD A;  2KN5 A;  1J0G A;  1V2Y A;  4NY0 A;  3KUZ A;  2KWC A;  2MP2 A;  3PRZ A;  2G3Q B;  4K7U A;  2G45 B;  3HIZ A;  4DDI D;  1YX5 B;  3W1S C;  2ZJD A;  2I1K A;  4HPL B;  3OLM D;  4WQO B;  2Z0E B;  1V9J A;  3PHX B;  3VH3 B;  4AOF A;  1P98 A;  3NZS A;  3U8Z A;  1WIA A;  2DX5 B;  2Z59 B;  3A1Q A;  3VFK A;  4DXA B;  2JXX A;  2VRR B;  1SE9 A;  1WXV A;  2JVC A;  3V61 A;  1IPG A;  3ZNZ B;  4CHK A;  1YQB A;  4M8M A;  3ML8 A;  4FHK A;  2J0J A;  3APD A;  1F9J A;  2KMC A;  3Q3F A;  4BOS C;  2GBR A;  2HJ8 A;  2L8J A;  2LAS A;  2RPQ A;  2MCN B;  3A4S C;  2KFK A;  2N7E A;  4MSQ B;  2CHW A;  2IZV B;  1U4A A;  1EF5 A;  5FR6 A;  1WX7 A;  2KD0 A;  2KJR A;  3L13 A;  5J2R A;  4EUT A;  3HHM A;  3L16 A;  3VHT C;  1RLF A;  1TTN A;  2ZNV C;  3M63 B;  4BKS D;  3A9J B;  2N4F A;  4K81 A;  2MLB A;  3VH4 B;  2GMI C;  2D07 B;  2YVC A;  2JWZ A;  3ALB A;  4NJ7 A;  1RRB A;  1WJ4 A;  2YLM A;  3JW0 X;  4GSW A;  4EZK A;  2JUO A;  1V49 A;  3DDC B;  4KIK A;  5C1Z A;  5J17 A;  1KLV A;  4KVG B;  2O2V B;  3L10 B;  4AP4 C;  4E71 A;  1WE7 A;  1WRD B;  1E90 A;  1Q1O A;  2K6Q A;  3KH0 A;  4HCP B;  4JL9 A;  4NPN A;  3C0R B;  3R3M A;  3WAM A;  1WI0 A;  4EFO A;  3OJ4 B;  3RT3 B;  2G4D B;  2GBJ A;  2MW5 A;  5JHA A;  4DDG D;  1V81 A;  2PE6 B;  2KWV B;  3AXC A;  3DBH I;  1NDD A;  1WXM A;  1ISN A;  2KDB A;  1Z5S B;  2CR5 A;  4RM8 A;  2CHZ A;  4MGY E;  3LJ3 A;  3VTW A;  3MHS D;  4FLH A;  4TQ0 A;  4ZRI A;  3SHQ A;  2MBE A;  1E8W A;  4B6W A;  1K8R B;  2LXA A;  4WJP A;  2C7H A;  4PYZ A;  2FCQ A;  2KQS A;  3BIN A;  3PTF C;  1IYF A;  1JRU A;  2REX A;  3I3T B;  3PPA A;  1WGD A;  1UD7 A;  4OVU A;  2FNJ B;  4W9E A;  2BWE S;  4TUU A;  4GDL B;  4PS7 A;  2JF5 A;  3CSF A;  3IG3 A;  2KO3 A;  3L54 A;  1P9D U;  1Z2M A;  3PLU A;  2RD0 A;  2AWT A;  3QAR A;  1WR1 A;  4FJY A;  2FCN A;  1OQY A;  2C7M B;  2KTR B;  2CHX A;  2JRH A;  2JY6 A;  4FN2 A;  3SD5 A;  3JSV B;  1WJU A;  1UBI A;  2NVU I;  3ZLZ A;  2L7R A;  4J6I A;  4WAA A;  4E74 A;  1H8C A;  3T9L A;  2HTH A;  1WGY A;  3QJZ A;  3VUX A;  3WAP A;  3R66 C; 
#chains in the Genus database with same CATH topology
 1JCK B;  4BZA A;  1XT9 B;  4DXG A;  1D4B A;  1YOV B;  1B9R A;  4RF0 A;  3RMK C;  4ZHP A;  2KK8 A;  1VJK A;  2IGD A;  4LNF A;  2OHF A;  4MJS B;  4LJO B;  4F7Z A;  4ZDV A;  3NVY A;  2KAN A;  2KDI A;  4MH8 A;  1KOT A;  2HD5 B;  2K39 A;  4EOY A;  5DCN A;  2LGX A;  5HI1 A;  4TQ1 A;  3QAQ A;  1N61 A;  1GAQ B;  3CST A;  2BYE A;  3L08 A;  5HG2 A;  4FAD A;  4G11 A;  1SE2 A;  1ZP0 B;  2LGY A;  2ASQ A;  4DHZ E;  2EMS A;  2BYT A;  1EF1 A;  3UIP B;  1F77 A;  1XD3 B;  3AE8 B;  2IYD B;  4G3X B;  1ZDX A;  4ANW A;  3ZW3 A;  2KFJ A;  5AEK B;  3ZTC A;  1VRA B;  2KX0 A;  3TJP A;  4HKQ A;  3P42 A;  1GPX A;  5DPS A;  2LGI A;  3EFU A;  2KC1 A;  3IBE A;  2EKE C;  3QWZ B;  3VR8 B;  2WXN A;  3AE6 B;  4BKG A;  4N9F 4;  5JXV A;  5H8Y E;  2L1A A;  1FD6 A;  2FCS A;  3JVZ X;  3L0W B;  1YJ1 A;  3RN9 C;  3S2A A;  1Y8R C;  4F1S A;  3CF6 E;  1P7F A;  2I38 A;  4EZL A;  2IBI B;  4ICU A;  4BKS A;  2DZJ A;  4ITK A;  3AB5 A;  4ZHO A;  4S0R A;  1N6Z A;  4ACF A;  1WFY A;  4L2Y A;  2D11 A;  3RNF C;  2W54 A;  2IGH A;  5FKA C;  3N1Z C;  2ZPN A;  2K9X A;  4XC2 A;  3R2T A;  4YXD B;  4X57 B;  4YTN B;  4I6N B;  4CYE A;  2LZ6 A;  4GB9 A;  1FXT B;  5JZE B;  2L76 A;  2PVG C;  3RD2 A;  4YTP B;  1OFF A;  4GXB A;  5DPR A;  3URY A;  4ICV A;  2DZK A;  1HQR D;  1TY0 A;  2BF8 B;  2ZW1 A;  1TS2 A;  1WGH A;  2EKI A;  4GIV A;  4GOC A;  2KDE B;  2V3S A;  1UBQ A;  2LVP A;  4NJC A;  3DVG X;  2UWQ A;  4URK A;  5BMG A;  2IO0 B;  2GRI A;  1WMH B;  1QKZ A;  1QOB A;  1CQV A;  2KHW B;  1I4H A;  4MM3 A;  4KGT A;  3E9S A;  3TBL D;  1D5Z C;  1NI2 A;  3GZN B;  4XDD A;  2QMT A;  3QK0 A;  1V97 A;  5C23 A;  1T0Y A;  3RCZ A;  3X23 A;  4A90 A;  2IO3 B;  2LVO A;  3N1Y C;  3IT6 B;  1BML C;  2XEW A;  2LWP A;  3SU8 X;  2Y5C A;  3UQB A;  2KT7 A;  4HEA 1;  3NY5 A;  4B95 A;  3QQ8 B;  2E6X A;  1TZO A;  2QIL A;  1GG3 A;  3APF A;  2KQ4 X;  5IA7 A;  2PPH A;  1MVK A;  2KVZ A;  1WZ0 A;  2IO1 B;  3AEG B;  1YN5 A;  3H8H A;  1ROE A;  3D32 A;  4GU2 A;  2ON8 A;  1RAX A;  1WGG A;  4P16 A;  3KUC B;  1GB1 A;  2LRU A;  2YEP B;  3A4R A;  4HVB A;  1OEY J;  1JWM D;  4II3 B;  2MBB B;  2FBW B;  5KHO A;  5I4D A;  2X8X X;  3SFD B;  1GNU A;  4PT5 A;  4TKN A;  3B08 A;  3EHV A;  2RGF A;  3TCA A;  1HE8 A;  4KDL B;  3IAS 1;  4W9C A;  4OHJ A;  3Q6B A;  1J7A A;  4WWN A;  1FRR A;  4FXC A;  4USA A;  1C79 A;  2K0P A;  3HUI A;  5CX3 A;  3RI7 C;  2MWS B;  1WXA A;  2A5U A;  1L2N A;  3IFW B;  2ZZP B;  3WCQ A;  2L3Z A;  4IM0 A;  1K53 A;  3UGB B;  1MFW A;  1BXT A;  3W2D A;  1TGZ B;  1XCQ L;  2CJO A;  2NPT A;  3WIM A;  4A20 A;  1F2R C;  4YSY B;  4WJO A;  4K7W A;  2J0M A;  4OVV A;  2DYO A;  5GXG B;  4O1N A;  1K52 A;  3R2I A;  1QIL A;  3ZIM A;  3Q3M C;  2NCN A;  3KYD D;  2KAJ A;  2D3C A;  4IWQ A;  3GB1 A;  3MC0 B;  3NVW A;  1I4X A;  4ARI A;  4JLC A;  1IBX B;  3PRE A;  2O6V B;  3DHG C;  5IAA C;  2PVO D;  2KDF B;  3ZXR A;  4EEW A;  3VUW A;  2MQJ A;  1NEN B;  3TEZ A;  1XQQ A;  3A9K B;  3DBS A;  4KKJ A;  1TT5 B;  1KJT A;  2QCZ A;  2LD9 A;  2JZ3 B;  4CO7 A;  3ZDT A;  4YWG G;  3OWE B;  2KWC A;  2MP2 A;  4K7U A;  2G45 B;  2JXT A;  2Z8L A;  3W1S C;  2WXH A;  1V9J A;  4AOF A;  1QOF A;  3NZS A;  1WIA A;  3A1Q A;  2Z59 B;  1SE9 A;  5BMI A;  3ZNZ B;  1IPG A;  4CHK A;  2D3B A;  2J0J A;  2WHI A;  3Q3F A;  2RPQ A;  1D6E C;  2WGS A;  2INP E;  5FR6 A;  1WX7 A;  3L13 A;  1NVI D;  2ZW0 A;  1RLF A;  3HRD D;  3EA6 A;  2YVC A;  1MPE A;  3P4P B;  1WXQ A;  1V49 A;  3DDC B;  2O2V B;  2LJI A;  1Q1O A;  4JL9 A;  3WAM A;  4EFO A;  1TYG B;  4LLG M;  4RGN A;  3B9J A;  5JHA A;  4DDG D;  5T8I A;  2PE6 B;  2KWV B;  2NTT A;  2CR5 A;  4EE2 A;  4DXF A;  3MHS D;  4ARC A;  4FLH A;  4TQ0 A;  1QOA A;  2M19 A;  4WJP A;  3ETR A;  2WXL A;  2VZK B;  2C7H A;  4PYZ A;  2VH1 A;  4C4V A;  4B0E A;  3KWL A;  2AX5 A;  1JRP A;  2KQS A;  1KFY B;  2Y3A A;  4OZC A;  3T3N A;  3L54 A;  1YMH E;  1Z2M A;  1SJE D;  3PLU A;  3I5J C;  3P4Q B;  3QAR A;  2QIE B;  4RCO A;  4FN2 A;  2KTR B;  4M02 A;  1WJU A;  4C7Y A;  3ZLZ A;  1H8C A;  3Q8E A;  2BTE A;  3WAP A;  3QJZ A;  3RNA C;  3FIL A;  3R7Q A;  3W5V B;  2D5G A;  4NAW A;  3KW5 B;  1SB3 C;  3ZVV A;  1C4C A;  3VVW B;  1SBB B;  4DHZ B;  2AQ3 B;  4AJY B;  4IWP A;  4YSZ B;  1ZW7 A;  3PS6 A;  4GDK B;  1FCC C;  2RDH A;  4JX1 C;  4HLE A;  3L4P A;  4IDI A;  1WSP A;  2N7J A;  3KYC D;  1LXD A;  3NS1 A;  2WXQ A;  2YEP F;  3BZD B;  2DWQ A;  4HDO A;  4HRO A;  5CHW A;  2IDY A;  3APC A;  1TY2 A;  2MA9 B;  1M94 A;  2N9E B;  1P0R A;  3NHE B;  5LNK 1;  1RYJ A;  4PS8 A;  1JWU D;  3ABV B;  1S3S G;  3ECI A;  4FJZ A;  3WAL A;  3H1U A;  3TUO A;  3MFG A;  2PIA A;  1NBF C;  2IY1 B;  1N60 A;  2MEK A;  5BMH A;  3A9J A;  3AE5 B;  2LMC A;  3UIO B;  2N9P C;  3H6N A;  3H7P B;  1SIJ A;  5HHD G;  2K6D B;  2GOW A;  1E8X A;  4P7I A;  1XCT L;  1YN3 A;  1C3T A;  4N6E B;  4AS1 A;  4B0M A;  3ZTD A;  2K5P A;  2RDG A;  2GI9 A;  2L83 A;  1DOI A;  4RNA A;  4W9K A;  2KFK B;  1DOY A;  5G5H A;  1ZGU B;  4A6Q A;  1WXS A;  1K51 A;  2DLB A;  2C7N B;  1HTO A;  1FM0 D;  3WAN A;  1ENF A;  4K1R B;  2K8H A;  3BYY B;  4F8C B;  2N9L A;  1E7U A;  1WR6 E;  4A55 A;  2BVC A;  2W9N A;  4FJV B;  3DHI C;  3RFZ B;  3JSV A;  2M17 A;  4TSS A;  4XWW A;  3X0W A;  1E7V A;  3AEA B;  4AJW A;  4JWU C;  2EEL A;  4LDT B;  1E6E B;  2PLP A;  3BVM A;  2IY0 B;  3RPF C;  4I6P A;  2MBH A;  4A8X C;  4OZB A;  2PTL A;  1WY8 A;  2JX5 A;  2QSD A;  3U7Z A;  4MJS A;  4K3C A;  4NJ6 A;  2PJH A;  1J8C A;  3VRB B;  4JPS A;  1NYQ A;  3FC4 A;  1E0Z A;  1QT9 A;  2BKR B;  2PW9 A;  4MH0 E;  3FKY A;  4W9F A;  1JAL A;  2CJN A;  2LRW A;  1N5X A;  2DZM A;  2BT6 A;  5E6O A;  5MPO A;  4M0W B;  2KC2 A;  4GLS C;  1SIF A;  2KX3 A;  2V4L A;  2WDR B;  2CU3 A;  4IM2 A;  2N1W A;  2M8S A;  1ZKH A;  3OJ3 A;  4YSX B;  5G2N A;  1MHH E;  3R7R A;  2GBK A;  2ZCC A;  3RZW C;  2MX2 A;  3P63 A;  4L23 A;  3SEB A;  5IN7 A;  1ET6 A;  1NEK B;  2WP9 B;  4LJP B;  4WJQ A;  3AMZ A;  4KV2 A;  2XNA C;  4C00 A;  5DPT A;  4QAY A;  2LHE A;  4IW0 A;  2AQ1 B;  1T6B X;  3TEX A;  1UH6 A;  3DBL I;  4W9H A;  4A3O A;  3EEC A;  4A3P A;  2GBM A;  1I7H A;  3PSE B;  4OVZ A;  2LFI A;  3DOW A;  3GS2 A;  2HE7 A;  5HFY A;  2NBU A;  3QA8 A;  2BYF A;  2LUE A;  2WXK A;  1FFV A;  2UU7 A;  4W9J A;  1HA5 A;  2K25 A;  2DBY A;  3Q14 C;  1WJ6 A;  2W82 A;  4G50 A;  4DK5 A;  1MG8 A;  2QHO A;  3ZNI D;  1FPY A;  3MHZ A;  4KIK B;  2MHJ A;  1HZ5 A;  2C5L C;  2K8B A;  2TSS A;  4RMA A;  4WAF A;  1IP9 A;  4DQO C;  5D3I B;  1NYR A;  2V3N A;  3DBR I;  3R8B A;  1YQ4 B;  1L0Y B;  2O6V D;  2KN4 A;  1T3Q A;  1Q5W B;  2M0A A;  2KJH B;  1UWX A;  4NQK E;  2R2O A;  4JGH B;  3W1Y A;  3UF8 A;  1EO6 A;  3VRA B;  5L83 A;  4KSK C;  2NS5 A;  3VUY A;  2KOX A;  4IWO A;  3DQV A;  3N30 A;  1AWD A;  3CIR B;  4OW0 A;  2KZR A;  1P3Q U;  1FXA A;  2MBQ A;  4ZYS A;  1IGC A;  1R7S A;  1XLQ A;  2M0X A;  1WYW B;  4BVU C;  3UQA A;  3PLV A;  1HXY D;  1WMH A;  5JH5 C;  1AN8 A;  2J4X A;  4M01 A;  5FK9 C;  2FCM A;  2A4Z A;  2AL3 A;  3N32 A;  3N9Y C;  1R4N B;  2L0F A;  3L17 A;  1WJN A;  1S1Q B;  3VTV A;  1EU3 A;  2DNF A;  4HXD A;  2X38 A;  1LFD A;  3PVL A;  4LK0 M;  3E56 A;  2UYZ B;  1XF5 L;  2ONQ A;  3TMP B;  3BK2 A;  4MDK E;  1J0G A;  1L4Z B;  3KUZ A;  3TEY A;  2G3Q B;  3AED B;  2ZJD A;  2Z0E B;  2B76 B;  4HRS A;  2DX5 B;  4DXA B;  1KH0 A;  2JXX A;  2VRR B;  2JVC A;  4FHK A;  4YTM B;  2VZK D;  1F9J A;  3APD A;  4MM3 B;  4BOS C;  3I9V 1;  2HJ8 A;  1DYQ A;  2LAS A;  1D5M C;  2N7E A;  2E3T A;  4MAC A;  2KD0 A;  5J2R A;  2MJD A;  1SF0 A;  3L16 A;  3VHT C;  3M63 B;  1UF0 A;  4K81 A;  2MLB A;  3VH4 B;  2GMI C;  3ALB A;  4NJ7 A;  1MHX A;  4GSW A;  1RRB A;  1WJ4 A;  3JW0 X;  2JUO A;  1KLV A;  1C9F A;  4KVG B;  3L10 B;  4AP4 C;  5E6P A;  2I2Y A;  1ACC A;  1WI0 A;  3B2F A;  1MI0 A;  4P1B C;  3AXC A;  1WXM A;  4RM8 A;  1Y56 A;  2CHZ A;  3LJ3 A;  1JML A;  1CK1 A;  3BVG A;  1SXT A;  1K8R B;  1CZP A;  3DBH B;  1M4V A;  1K50 A;  3BIN A;  3PTF C;  2ACZ B;  1IYF A;  3PPA A;  2REX A;  3I3T B;  1RFK A;  4LTU A;  5TSS A;  4ZRQ A;  4W9E A;  4GDL B;  3NUH B;  2R61 A;  3P4R B;  1P9D U;  2RD0 A;  1L0V B;  1OQY A;  2C7M B;  2CHX A;  2JRH A;  1J7B A;  2JY6 A;  1FFU A;  2NVU I;  4WAA A;  3MJ5 A;  3N20 C;  1IBX A;  2FAZ A;  1V1P B;  1XLP A;  2O6V A;  3AU4 A;  2LXC A;  3ZNH B;  4NZL B;  2N9K A;  2WWZ A;  2OJR A;  2FUG 1;  5D2M B;  2WU2 B;  4HWI B;  3RNB C;  2WXM A;  4LNK A;  4IUM B;  2QDF A;  5GMV A;  4BAX A;  4ZRK A;  4BBN C;  2XK5 B;  5AUI A;  4XE0 A;  1GJZ A;  1L6U A;  3AN1 A;  2MBO A;  1QOG A;  3PO0 A;  3DVN V;  2Y5P A;  2BGF A;  5EE0 A;  3K9P B;  2RPV A;  3LXF A;  3V6E B;  1A5R A;  2FIF A;  2DAF A;  2NBV B;  3ZDM C;  4NNJ B;  4LNN A;  3H7S A;  3VR9 B;  4MSM B;  1X1M A;  3W9C B;  1ET9 A;  3W5U B;  1C76 A;  1I42 A;  4JE3 B;  1F0Z A;  2M4N A;  4RH6 A;  2V0G A;  2AQ2 B;  5IO9 A;  4JIO U;  1C4A A;  1PQS A;  3AEE B;  3MJW A;  1WE6 A;  2I1J A;  2BPS A;  5D6J B;  4RM9 A;  2O2V A;  2MRP A;  1LQB A;  4IM3 A;  4XWT A;  2KJ6 A;  2LGS A;  2MP2 B;  4WWO A;  2KMM A;  2GLS A;  3IXS A;  4LDT D;  1PGB A;  1OQR A;  1ZDV A;  1YN4 A;  2WDV B;  1A70 A;  2KQ7 A;  1RM6 C;  4AWJ A;  3WAO A;  1E8Y A;  5HKH A;  3V62 A;  1J7C A;  2K8C A;  1TBE A;  2MJ3 A;  1YX6 B;  1EUV B;  3Q3N C;  2AEH A;  3SR6 A;  4FBJ B;  3EUB 2;  2NR2 A;  4W9G A;  4UDU C;  1E8Z A;  1ESF A;  3Q3J A;  3DVG Y;  4LCD E;  2WXP A;  2H88 B;  3HM6 X;  4MGZ E;  1KRH A;  2KTR A;  3A33 B;  3SDL C;  2MH7 A;  2ZVO A;  3ZNG C;  1V8C A;  2V9H A;  2C60 A;  1E9M A;  4WUR A;  1UGM A;  1IGD A;  4HPM B;  1HTQ A;  5LXH A;  3TEW A;  4IG7 B;  4XX5 A;  3RUL A;  2XN9 C;  3PHW B;  4IOI E;  4GGQ A;  1C4P A;  1V5O A;  3MC9 A;  3RZF A;  3N1X C;  3AV8 A;  3GP7 A;  3OG5 A;  4K7S A;  3B0A A;  2AYO B;  5TR5 A;  1OEY A;  2M1M A;  1QLB B;  5BYR A;  2KWU B;  4P6V F;  2JRI B;  2ZCB A;  1LO5 D;  3RNG C;  3KLS X;  4TMA B;  1P1A A;  2HTM E;  3BK1 A;  3T3O A;  3U52 E;  2DAJ A;  3ML9 A;  1STE A;  1QF6 A;  2WXI A;  2MJE A;  3DHH C;  3IVF A;  1J19 A;  4RGT A;  2RDB C;  3PV1 A;  3U30 A;  4HDQ A;  1VD2 A;  4DHJ B;  4RFB A;  3RYT A;  1E7P B;  3H9D A;  3V05 A;  1TKG A;  1KM7 A;  3P2B A;  1VZ7 A;  2N1V A;  1FRD A;  1N5W A;  4FA6 A;  3H7P A;  4HKZ E;  2WDQ B;  3BWU D;  4EZJ A;  3O65 B;  2RMM A;  3PRM B;  3NVZ A;  2L05 A;  3DWG C;  2KLC A;  1XEE A;  4US8 A;  2OED A;  3NZU A;  4II2 B;  4LNI A;  4EKU A;  4CQN A;  4WJN A;  4GN1 A;  2HDE A;  4IC7 B;  1UEL A;  2Q5W D;  2KAC A;  5CHF A;  2AL6 A;  3QX1 A;  1RFA A;  5E6J A;  1GC7 A;  3M95 A;  2L32 A;  4HCN B;  4BOZ B;  3TL5 A;  3VQI A;  1PGA A;  3LDZ E;  1GUA B;  4KKI A;  2ZVN A;  3AI5 A;  2B3A A;  5D94 A;  2LHD A;  1FCL A;  3VTU A;  1FXI A;  1TS3 A;  2NMQ A;  2JZP A;  2JZZ A;  1YIW A;  2CKH B;  1FNV A;  1ZXI A;  2FE8 A;  5J18 A;  1YJJ A;  2ZNV B;  4HPP A;  5BYS A;  4FUL A;  4G0N B;  1UZX B;  3PRP B;  5L95 C;  2IO2 B;  1AYF A;  3DPD A;  4MGK E;  2KDM A;  3U4E G;  1PFD A;  1GB4 A;  3GOE A;  3ZRF A;  4M00 A;  2KVR A;  3TSS A;  1OTR B;  3QCA A;  4HK2 A;  2WYQ A;  1SE4 A;  2DEN B;  1R4M I;  4M0W A;  5E6N A;  1WX9 A;  2RSU A;  3IT4 B;  2D10 A;  2FID A;  2GBN A;  4L1B A;  1VLB A;  2K3U A;  1KLG D;  3AEC B;  3M62 B;  4WWP A;  1KF6 B;  1EU4 A;  1ZUD 2;  1PDX A;  5JHB A;  1G6J A;  1H4R A;  3AE9 B;  2DHZ A;  1I4P A;  3UIN B;  2WX0 A;  2J7Q B;  3HK0 A;  4XYC A;  3QHT A;  2K1F A;  4ZRJ A;  2BS3 B;  2DYB A;  3WA0 A;  3V3X A;  4TV3 A;  2W55 A;  2PMV A;  4C7Z A;  3LB8 C;  3HIZ A;  1YX5 B;  1L5P A;  4HPL B;  4WQO B;  3OLM D;  1N62 A;  3PHX B;  3VH3 B;  1P98 A;  2W3S A;  1T0S C;  3VFK A;  2W3R A;  3V61 A;  1YQB A;  4M8M A;  3AE1 B;  3ML8 A;  1V1O A;  3HVD A;  2GBR A;  3AEB B;  2M56 B;  3A4S C;  1U4A A;  1EF5 A;  1XO3 A;  2ZNV C;  3ZJV A;  3BII D;  3Q2A C;  1TIF A;  2D07 B;  2YLM A;  4EZK A;  3ZYY X;  2GB1 A;  1ZOY B;  4KIK A;  4LNO A;  2LUM A;  4HCP B;  3KH0 A;  2QC8 A;  3ZQ4 A;  3OJ4 B;  3RT3 B;  2G4D B;  1EWY C;  2GBJ A;  2MW5 A;  1D5X C;  3BVZ A;  1JQ4 A;  2JSV X;  3VTW A;  3ZJT A;  2MBE A;  2LXA A;  2WXG A;  5BYQ A;  5EE3 A;  1VDV A;  4OVU A;  4TUU A;  4K3B A;  3IG3 A;  3LYY A;  3AE2 B;  2BB6 A;  3EFC A;  4FJY A;  3Q8F A;  2WLB A;  3SD5 A;  2WQY B;  1UBI A;  4J6I A;  1PYW D;  4H2A A;  2HTH A;  4C56 C;  3R66 C;  5C3J B;  1WH3 A;  2WNM A;  4XZ4 A;  3ZXV A;  1UNS A;  5CTR C;  1FEH A;  1CMX B;  3HM3 A;  2BQQ A;  1YQ3 B;  4YT0 B;  3IAM 1;  3CMM B;  2NBW B;  1JW9 D;  1WWT A;  3GE8 C;  2RR9 A;  5AZF A;  1WRI A;  1QZE A;  3ZKJ C;  2JPH A;  2SAK A;  4WH4 A;  2R2Q A;  2KNB A;  1WF9 A;  1L7Y A;  5FR3 A;  1UWM A;  2QJL A;  3RNC C;  1D3Z A;  1KLU D;  2G4S A;  4KDI C;  3K9O B;  1EM7 A;  4IKG A;  2WDT B;  4OZA A;  4ANU A;  4PS3 A;  2WU5 B;  3I63 C;  3ZO5 B;  2LI5 A;  4US9 A;  1V86 A;  3AE4 B;  3P1M A;  4W9L A;  2CS4 A;  1T0Q C;  5IOI A;  4PK1 A;  4WWM A;  4AUQ C;  2VH2 A;  3W1S A;  1I4G A;  1T5X D;  1Q10 A;  4KSL C;  2BYV E;  3BYT B;  1IUE A;  3AEF B;  5LLI A;  2ZPY A;  1F52 A;  4BFR A;  1F1H A;  1HEZ E;  3RUI B;  5DPW A;  3BY4 B;  3VXW A;  1VR9 A;  1JWA D;  3I57 A;  2OJW A;  1BT0 A;  4NQL B;  2KLG A;  2L52 A;  5KHQ A;  2ICI A;  4ZYN A;  2BBC A;  2V4I B;  3C19 A;  1V80 A;  3AU5 A;  3JYU A;  4N58 A;  1TKE A;  2N0S B;  5LXI B;  1HZ6 A;  4GDL A;  4JQW C;  4PYU A;  3VAW A;  5EDS A;  2WS3 B;  1OGW A;  2J0K A;  4M8N A;  2DZI A;  2CU1 A;  1I4R A;  5CHV C;  3T8M A;  3ZUN A;  3B1L X;  2KXJ A;  4RGM A;  2D3G A;  3PGE A;  1MG4 A;  4ANX A;  4MEM A;  3PT2 B;  2G9H D;  3VDZ A;  4D2K A;  1V1P A;  3NRZ A;  3ENE A;  1FO4 A;  5IP4 D;  2LJ5 A;  4DHJ D;  5IKC M;  5AZG A;  1P7E A;  3AE7 B;  2JU6 X;  2Y5B B;  1C77 A;  2IPK D;  2DYM A;  1C1Y B;  4JWS C;  2XK5 A;  1ZPS A;  5G5G A;  3ZRC A;  3A9K A;  3QIJ A;  2BKF A;  1TJE A;  3V6C B;  3Q3O C;  1I4Q A;  1VZ6 A;  2JQR B;  3V60 A;  1TS5 A;  1I35 A;  2NPT B;  2KMA A;  2WXJ A;  1V5T A;  3NG0 A;  2N9X A;  2IND C;  2INC C;  3MTN B;  3NS8 A;  1R4M B;  4W9D A;  4DWF A;  1VZ8 A;  1NI3 A;  5AUK A;  4J3O D;  2D2Q A;  1SJH D;  3IHP C;  2WXR A;  4MGI E;  3P4S B;  3PZ8 A;  2OOB B;  1WX8 A;  1TKY A;  3ZGZ A;  3U7D A;  3TIX A;  3KUD B;  1T0R C;  4XDC A;  5AZH A;  4KX6 B;  2BWF A;  4KZC A;  2D3A A;  1VCB A;  2PEA A;  5BO4 B;  1GC6 A;  2KYW A;  3OAW A;  1N63 A;  1WGR A;  4FHJ A;  4MT5 A;  1LGR A;  1OQQ A;  2JYE A;  5C2T B;  1SEB D;  2JYT A;  2ZEQ A;  3A1Q B;  1WZ3 A;  2BS2 B;  5EE9 A;  4B9K A;  3AE3 B;  2NTS A;  2PE9 A;  2XBB C;  2JWU A;  1WGK A;  3ONS A;  3DBL B;  5H92 C;  4NAM A;  3NJT A;  3DWM A;  3CWI A;  1LM8 B;  4HJK A;  4XGA B;  1GOZ A;  2WXO A;  1E10 A;  4RGO S;  2L0T A;  3B2G A;  2LGD A;  3EC8 A;  2LVQ A;  2WXF A;  2Z0D B;  4WQM A;  1L6V A;  1YNT E;  4HJG E;  5G55 A;  3N3K B;  1EWC A;  2BS4 B;  1TZ1 A;  4BKT A;  4C80 A;  2QEJ C;  1AAR A;  3M3J A;  3NOB A;  1FNW A;  4ANV A;  3SFE B;  3HVZ A;  1ZE3 D;  3DBR B;  2BB5 A;  3Q8A A;  3KVF B;  3DVN U;  1QQR A;  4DBG A;  1B1Z A;  3AM9 A;  5D3D A;  3EGR A;  4KGR A;  4AQ7 A;  4MEL A;  4YL8 A;  4C4V B;  1DOX A;  1JWB D;  4BBN F;  1SGH A;  1WM2 A;  3FAH A;  1PGX A;  4ZOH C;  2BW2 A;  2FUH B;  1XLN A;  1SSN A;  2V1Y A;  4GDK A;  4W9I A;  1YD8 U;  1FNU A;  2KWD A;  1MJD A;  2WX1 A;  3Q8C A;  4R3D A;  3QC8 B;  1PUT A;  2C9W B;  1RWS A;  4I6L B;  2HJ1 A;  4ZRP A;  1FIQ A;  3Q69 A;  1R4N I;  3UI3 A;  1UUP A;  4GMV A;  3FIL B;  3Q8B A;  1V6E A;  4NAW B;  1F2R I;  3AUL A;  1XLO A;  2MSE D;  1WM3 A;  3GZN I;  2G1E A;  2N7D A;  2EMT A;  4KZ0 A;  2INN E;  5D7G A;  4E3C A;  2KTF A;  2L00 B;  2KKC A;  1E5W A;  4ASW C;  3GE3 C;  3C8Y A;  2JT4 B;  3ZJU A;  1Q0W B;  3DCG A;  3PZD A;  2KN5 A;  4N59 A;  1V2Y A;  4NY0 A;  1FMA D;  3PRZ A;  4DDI D;  2I1K A;  3U8Z A;  1YJI A;  1WXV A;  3U2S C;  2H89 B;  2J53 A;  2KMC A;  4RF1 A;  3MP9 A;  2L8J A;  2MCN B;  4Q2J A;  2KFK A;  1DGJ A;  3RNE C;  4MSQ B;  2CHW A;  2IZV B;  1UGJ A;  2KJR A;  4EUT A;  3HHM A;  1CJE A;  1TTN A;  1SE3 A;  1JRO A;  4BKS D;  3A9J B;  2N4F A;  3J9C A;  2SEB D;  2JWZ A;  2K22 A;  2IJ0 A;  5C1Z A;  5J17 A;  4WIP A;  4E71 A;  1WE7 A;  1WRD B;  1E90 A;  2K6Q A;  1WYG A;  4NPN A;  3C0R B;  3R3M A;  3PZ7 A;  1L4D B;  3NZ3 A;  5EE1 A;  1V81 A;  3AH7 A;  3DBH I;  1NDD A;  2J52 A;  1KTK A;  2J42 A;  2KDB A;  1ISN A;  1Z5S B;  4MGY E;  1BUI C;  4ZRI A;  3SHQ A;  1E8W A;  4S17 A;  1JWS D;  2PKO A;  4B6W A;  4KGS A;  1L0X B;  3O13 A;  2FCQ A;  2IGG A;  2LEK A;  1JRU A;  3KQ4 A;  1WGD A;  1UD7 A;  3NVV A;  2FNJ B;  2BWE S;  4P1C C;  4PS7 A;  2JF5 A;  4REZ A;  2V3P A;  3CSF A;  2KO3 A;  3KWV A;  2AWT A;  1WR1 A;  4A9A A;  1ZXH A;  2FCN A;  3JSV B;  1C78 A;  2L7R A;  4E74 A;  1XXG A;  3T9L A;  1TS4 A;  1WGY A;  3VUX A;  3MC8 A;  1AW7 A; 
#chains in the Genus database with same CATH homology
 3R7Q A;  4NAW A;  2FAZ A;  3KW5 B;  2O6V A;  3AU4 A;  1XT9 B;  3ZVV A;  1WH3 A;  2LXC A;  4XZ4 A;  3VVW B;  3ZNH B;  5CTR C;  2WWZ A;  2OJR A;  5D2M B;  4DHZ B;  1CMX B;  4HWI B;  2KK8 A;  4MJS B;  4IUM B;  5GMV A;  4AJY B;  4IWP A;  4ZRK A;  3HM3 A;  4BBN C;  2XK5 B;  1ZW7 A;  4LJO B;  3PS6 A;  3CMM B;  4F7Z A;  4ZDV A;  4GDK B;  2NBW B;  1GJZ A;  2KAN A;  2KDI A;  2MBO A;  2RR9 A;  5AZF A;  4HLE A;  1QZE A;  3ZKJ C;  2JPH A;  3DVN V;  1KOT A;  2R2Q A;  2KNB A;  2HD5 B;  3KYC D;  1LXD A;  1WF9 A;  2K39 A;  1L7Y A;  4EOY A;  5DCN A;  2BGF A;  2LGX A;  3K9P B;  4HDO A;  3V6E B;  4TQ1 A;  3QAQ A;  1A5R A;  2FIF A;  2DAF A;  5CHW A;  1D3Z A;  3CST A;  2NBV B;  2BYE A;  3ZDM C;  3APC A;  3L08 A;  4NNJ B;  4FAD A;  2G4S A;  2MA9 B;  3H7S A;  3K9O B;  4KDI C;  1M94 A;  2N9E B;  1P0R A;  2WDT B;  3NHE B;  4G11 A;  2LGY A;  4MSM B;  2ASQ A;  4PS8 A;  4PS3 A;  4ANU A;  2EMS A;  4DHZ E;  1X1M A;  1S3S G;  3ECI A;  4FJZ A;  3WAL A;  3H1U A;  3ZO5 B;  1I42 A;  2LI5 A;  1EF1 A;  1NBF C;  5E6P A;  3UIP B;  2IY1 B;  1XD3 B;  2M4N A;  1V86 A;  4W9L A;  4JIO U;  2IYD B;  2CS4 A;  3A9J A;  1PQS A;  4G3X B;  4ANW A;  3ZW3 A;  2KFJ A;  5AEK B;  3MJW A;  1WE6 A;  3ZTC A;  3UIO B;  2N9P C;  2I1J A;  2BPS A;  3H6N A;  5D6J B;  2KX0 A;  4RM9 A;  3TJP A;  2O2V A;  4AUQ C;  3W1S A;  2MRP A;  3H7P B;  1LQB A;  4IM3 A;  5DPS A;  4KSL C;  2KJ6 A;  2MP2 B;  3EFU A;  4WWO A;  2KC1 A;  3IBE A;  2BYV E;  4LDT D;  2K6D B;  2GOW A;  5LLI A;  1E8X A;  2EKE C;  2ZPY A;  3QWZ B;  4P7I A;  1C3T A;  4BFR A;  4BKG A;  4N9F 4;  3RUI B;  3ZTD A;  5DPW A;  2KQ7 A;  3BY4 B;  3VXW A;  4AWJ A;  3WAO A;  1E8Y A;  5HKH A;  3V62 A;  1BT0 A;  2FCS A;  4NQL B;  4W9K A;  2K8C A;  2KLG A;  3JVZ X;  3L0W B;  5KHQ A;  1YJ1 A;  1TBE A;  2KFK B;  4ZYN A;  1ZGU B;  3S2A A;  1Y8R C;  1WXS A;  4F1S A;  1YX6 B;  1V80 A;  3AU5 A;  3JYU A;  1EUV B;  2C7N B;  3CF6 E;  2AEH A;  4FBJ B;  4EZL A;  5LXI B;  2IBI B;  4ICU A;  4JQW C;  4GDL A;  2NR2 A;  3WAN A;  4K1R B;  4PYU A;  4W9G A;  2K8H A;  4BKS A;  2DZJ A;  1E8Z A;  3VAW A;  5EDS A;  3Q3J A;  1OGW A;  3DVG Y;  4LCD E;  2J0K A;  4F8C B;  3HM6 X;  1E7U A;  1WR6 E;  4M8N A;  4MGZ E;  2DZI A;  2KTR A;  2W9N A;  3A33 B;  2CU1 A;  4FJV B;  3SDL C;  2ZVO A;  5CHV C;  3T8M A;  3ZNG C;  3JSV A;  3ZUN A;  3B1L X;  2M17 A;  1WFY A;  3X0W A;  2C60 A;  2KXJ A;  2D11 A;  2D3G A;  1E7V A;  3PGE A;  4AJW A;  4LDT B;  4ANX A;  4MEM A;  1UGM A;  3PT2 B;  3VDZ A;  4HPM B;  2IY0 B;  4I6P A;  5LXH A;  3ENE A;  4IG7 B;  2ZPN A;  4XC2 A;  2LJ5 A;  4XX5 A;  3RUL A;  5AZG A;  4DHJ D;  4X57 B;  2MBH A;  3PHW B;  4I6N B;  4CYE A;  2LZ6 A;  4GB9 A;  1FXT B;  4GGQ A;  5JZE B;  1WY8 A;  2L76 A;  2Y5B B;  1V5O A;  4MJS A;  4NJ6 A;  2PJH A;  3RD2 A;  1J8C A;  2DYM A;  4K7S A;  3RZF A;  1C1Y B;  4GXB A;  3B0A A;  2AYO B;  2XK5 A;  5DPR A;  5TR5 A;  3ZRC A;  3A9K A;  2BKR B;  4ICV A;  3QIJ A;  2DZK A;  1OEY A;  2M1M A;  4MH0 E;  2BF8 B;  2BKF A;  3V6C B;  2KWU B;  4W9F A;  1WGH A;  3V60 A;  2LRW A;  1I35 A;  2NPT B;  2JRI B;  2DZM A;  2ZCB A;  4GIV A;  4GOC A;  2KMA A;  5E6O A;  1V5T A;  2KDE B;  2V3S A;  2N9X A;  3MTN B;  1P1A A;  1UBQ A;  2LVP A;  2KC2 A;  3NS8 A;  4M0W B;  1SIF A;  2KX3 A;  3DVG X;  2UWQ A;  2V4L A;  2DAJ A;  3ML9 A;  4URK A;  4IM2 A;  2IO0 B;  4W9D A;  4DWF A;  2N1W A;  2M8S A;  1ZKH A;  3OJ3 A;  1WMH B;  3IVF A;  1J19 A;  2D2Q A;  5G2N A;  2KHW B;  4MM3 A;  3PV1 A;  3IHP C;  4HDQ A;  1VD2 A;  3R7R A;  2GBK A;  2ZCC A;  3U30 A;  4DHJ B;  3TBL D;  3RYT A;  1NI2 A;  4MGI E;  3H9D A;  3RZW C;  2MX2 A;  2OOB B;  1WX8 A;  3U7D A;  1KM7 A;  3KUD B;  3QK0 A;  3TIX A;  3P2B A;  5AZH A;  2N1V A;  5C23 A;  4FA6 A;  3H7P A;  1T0Y A;  3RCZ A;  2BWF A;  4EZJ A;  3X23 A;  3O65 B;  4KZC A;  2IO3 B;  2LVO A;  3PRM B;  4LJP B;  4WJQ A;  2L05 A;  2KLC A;  4KV2 A;  1VCB A;  2PEA A;  5BO4 B;  1GC6 A;  5DPT A;  3OAW A;  2XEW A;  1WGR A;  2LWP A;  4FHJ A;  3NZU A;  4II2 B;  4EKU A;  4IW0 A;  4WJN A;  3SU8 X;  1UH6 A;  3DBL I;  4W9H A;  3UQB A;  3NY5 A;  4GN1 A;  3QQ8 B;  4B95 A;  2ZEQ A;  4A3O A;  3A1Q B;  1WZ3 A;  3EEC A;  4IC7 B;  2GBM A;  4A3P A;  3PSE B;  3DOW A;  1UEL A;  4B9K A;  1GG3 A;  2HE7 A;  3APF A;  2NBU A;  5CHF A;  2AL6 A;  2PPH A;  2PE9 A;  2BYF A;  3QA8 A;  2XBB C;  5IA7 A;  2LUE A;  3QX1 A;  3ONS A;  1RFA A;  1WZ0 A;  2IO1 B;  1GC7 A;  3M95 A;  4HCN B;  4W9J A;  4BOZ B;  3D32 A;  4GU2 A;  2K25 A;  3TL5 A;  3VQI A;  1RAX A;  1WGG A;  3KUC B;  1WJ6 A;  4G50 A;  2LRU A;  4DK5 A;  3LDZ E;  1MG8 A;  1LM8 B;  1GUA B;  2QHO A;  2ZVN A;  4HJK A;  3A4R A;  3AI5 A;  3ZNI D;  2B3A A;  5D94 A;  4HVB A;  3VTU A;  1OEY J;  2L0T A;  4II3 B;  4KIK B;  2MBB B;  5KHO A;  2K8B A;  2C5L C;  2LGD A;  3EC8 A;  2LVQ A;  1GNU A;  4RMA A;  1IP9 A;  4TKN A;  2Z0D B;  5G55 A;  3N3K B;  3VTV A;  2JZZ A;  1YIW A;  2CKH B;  3B08 A;  3DBR I;  3EHV A;  2RGF A;  1TZ1 A;  3TCA A;  1HE8 A;  4KDL B;  5J18 A;  4BKT A;  2O6V D;  1Q5W B;  2ZNV B;  1AAR A;  3M3J A;  4W9C A;  3NOB A;  4ANV A;  2KJH B;  4NQK E;  2R2O A;  4FUL A;  4G0N B;  4WWN A;  1UZX B;  3PRP B;  3KVF B;  3DVN U;  4DBG A;  5L95 C;  2IO2 B;  3DPD A;  4JGH B;  4MEL A;  4MGK E;  4YL8 A;  3W1Y A;  5CX3 A;  1L2N A;  2MWS B;  1WXA A;  2A5U A;  3UF8 A;  1SGH A;  1WM2 A;  1EO6 A;  2ZZP B;  3GOE A;  3IFW B;  3ZRF A;  4BBN F;  5L83 A;  4KSK C;  2L3Z A;  4IM0 A;  2NS5 A;  3UGB B;  3VUY A;  2KVR A;  2KOX A;  2FUH B;  3DQV A;  3N30 A;  4IWO A;  2V1Y A;  1OTR B;  1TGZ B;  3QCA A;  2NPT A;  4GDK A;  4W9I A;  3WIM A;  4A20 A;  1YD8 U;  2KZR A;  2WYQ A;  4HK2 A;  1P3Q U;  2WX1 A;  2MBQ A;  3QC8 B;  4WJO A;  2DEN B;  1R4M I;  2C9W B;  2J0M A;  4K7W A;  4OVV A;  5E6N A;  2DYO A;  4I6L B;  1WX9 A;  2M0X A;  2RSU A;  1WYW B;  2D10 A;  2FID A;  2GBN A;  4BVU C;  3UQA A;  1R4N I;  3ZIM A;  2NCN A;  3PLV A;  3KYD D;  3M62 B;  4GMV A;  4WWP A;  4IWQ A;  1WMH A;  5JH5 C;  1V6E A;  4JLC A;  3PRE A;  2FCM A;  4NAW B;  5JHB A;  2O6V B;  3AUL A;  2A4Z A;  2AL3 A;  2MSE D;  5IAA C;  1G6J A;  1WM3 A;  3N32 A;  2KDF B;  3GZN I;  4EEW A;  1H4R A;  2L0F A;  2MQJ A;  3VUW A;  1XQQ A;  2N7D A;  2EMT A;  3A9K B;  1WJN A;  2DHZ A;  1S1Q B;  3L17 A;  4KZ0 A;  3DBS A;  5D7G A;  2KTF A;  2WX0 A;  3UIN B;  2J7Q B;  2L00 B;  2KKC A;  4E3C A;  3HK0 A;  1E5W A;  4HXD A;  4ASW C;  1KJT A;  2K1F A;  1LFD A;  3QHT A;  4ZRJ A;  2JT4 B;  2LD9 A;  1Q0W B;  2JZ3 B;  2DYB A;  3DCG A;  3PVL A;  3WA0 A;  4TV3 A;  4CO7 A;  2UYZ B;  3ZDT A;  3TMP B;  4MDK E;  3PZD A;  2KN5 A;  1J0G A;  1V2Y A;  4NY0 A;  3KUZ A;  2KWC A;  2MP2 A;  3PRZ A;  2G3Q B;  4K7U A;  2G45 B;  3HIZ A;  4DDI D;  1YX5 B;  3W1S C;  2ZJD A;  2I1K A;  4HPL B;  3OLM D;  4WQO B;  2Z0E B;  1V9J A;  3PHX B;  3VH3 B;  4AOF A;  1P98 A;  3NZS A;  3U8Z A;  1WIA A;  2DX5 B;  2Z59 B;  3A1Q A;  3VFK A;  4DXA B;  2JXX A;  2VRR B;  1SE9 A;  1WXV A;  2JVC A;  3V61 A;  1IPG A;  3ZNZ B;  4CHK A;  1YQB A;  4M8M A;  3ML8 A;  4FHK A;  2J0J A;  3APD A;  1F9J A;  2KMC A;  3Q3F A;  4BOS C;  2GBR A;  2HJ8 A;  2L8J A;  2LAS A;  2RPQ A;  2MCN B;  3A4S C;  2KFK A;  2N7E A;  4MSQ B;  2CHW A;  2IZV B;  1U4A A;  1EF5 A;  5FR6 A;  1WX7 A;  2KD0 A;  2KJR A;  3L13 A;  5J2R A;  4EUT A;  3HHM A;  3L16 A;  3VHT C;  1RLF A;  1TTN A;  2ZNV C;  3M63 B;  4BKS D;  3A9J B;  2N4F A;  4K81 A;  2MLB A;  3VH4 B;  2GMI C;  2D07 B;  2YVC A;  2JWZ A;  3ALB A;  4NJ7 A;  1RRB A;  1WJ4 A;  2YLM A;  3JW0 X;  4GSW A;  4EZK A;  2JUO A;  1V49 A;  3DDC B;  4KIK A;  5C1Z A;  5J17 A;  1KLV A;  4KVG B;  2O2V B;  3L10 B;  4AP4 C;  4E71 A;  1WE7 A;  1WRD B;  1E90 A;  1Q1O A;  2K6Q A;  3KH0 A;  4HCP B;  4JL9 A;  4NPN A;  3C0R B;  3R3M A;  3WAM A;  1WI0 A;  4EFO A;  3OJ4 B;  3RT3 B;  2G4D B;  2GBJ A;  2MW5 A;  5JHA A;  4DDG D;  1V81 A;  2PE6 B;  2KWV B;  3AXC A;  3DBH I;  1NDD A;  1WXM A;  1ISN A;  2KDB A;  1Z5S B;  2CR5 A;  4RM8 A;  2CHZ A;  4MGY E;  3LJ3 A;  3VTW A;  3MHS D;  4FLH A;  4TQ0 A;  4ZRI A;  3SHQ A;  2MBE A;  1E8W A;  4B6W A;  1K8R B;  2LXA A;  4WJP A;  2C7H A;  4PYZ A;  2FCQ A;  2KQS A;  3BIN A;  3PTF C;  1IYF A;  1JRU A;  2REX A;  3I3T B;  3PPA A;  1WGD A;  1UD7 A;  4OVU A;  2FNJ B;  4W9E A;  2BWE S;  4TUU A;  4GDL B;  4PS7 A;  2JF5 A;  3CSF A;  3IG3 A;  2KO3 A;  3L54 A;  1P9D U;  1Z2M A;  3PLU A;  2RD0 A;  2AWT A;  3QAR A;  1WR1 A;  4FJY A;  2FCN A;  1OQY A;  2C7M B;  2KTR B;  2CHX A;  2JRH A;  2JY6 A;  4FN2 A;  3SD5 A;  3JSV B;  1WJU A;  1UBI A;  2NVU I;  3ZLZ A;  2L7R A;  4J6I A;  4WAA A;  4E74 A;  1H8C A;  3T9L A;  2HTH A;  1WGY A;  3QJZ A;  3VUX A;  3WAP A;  3R66 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...