5D6JB

Crystal structure of a mycobacterial protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA synthase
publication title Crystal structure of FadD32, an enzyme essential for mycolic acid biosynthesis in mycobacteria.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Ligase/protein binding
total genus 16
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5d6jB00
1OTRB 2BYEA 2XEWA 3SDLC 1P98A 3QC8B 1OEYJ 2NS5A 1GC7A 4XC2A 3UF8A 1V80A 3AU5A 4KDLB 1K8RB 2HE7A 2RD0A 3T8MA 1WXVA 2I1KA 2LUEA 2ZJDA 4KV2A 2MRPA 3VFKA 4DDGD 2GOWA 4NAWA 2KJHB 3CF6E 4OVVA 2KDFB 2NPTB 4KVGB 4WJOA 4BVUC 3LJ3A 4IM2A 3RUIB 3PRZA 4P7IA 5AZHA 2NCNA 2CHZA 2KFKA 2L3ZA 1UBQA 1V6EA 2NBWB 2L76A 2O2VA 4EZLA 5CHFA 1WH3A 4CYEA 3EFUA 4G0NB 2MBOA 2Z0DB 2BWES 3DCGA 3WALA 3RULA 3VTVA 5L83A 2AL3A 2K8HA 3X23A 1X1MA 3KYCD 2DZKA 4HJKA 4II3B 2KJRA 4MGKE 2MCNB 2FCMA 2CKHB 3PPAA 3QWZB 3H6NA 5AZGA 2DZMA 5G55A 4CO7A 4PS7A 3QCAA 2IYDB 3ZRCA 4BOSC 3V60A 3JSVB 2GBJA 4ZRJA 1A5RA 1E7VA 4M8NA 3ML8A 1AARA 1E8WA 1WMHB 2C60A 3H7PB 3UIOB 2MA9B 1EUVB 4PS8A 3PRMB 1E8XA 3GOEA 3X0WA 3HIZA 3DVGY 2M4NA 2O6VD 3KUCB 3O65B 4MSMB 2FIDA 4WWNA 2ZCCA 1H4RA 3H7SA 1LXDA 3NZSA 4KDIC 1UZXB 1KM7A 1UD7A 2N1WA 2GBRA 3LDZE 3N30A 2ZVOA 4F8CB 2ZEQA 2G3QB 2JY6A 1OEYA 1F9JA 1YX5B 3I3TB 3PV1A 3L08A 1WXAA 1QZEA 5D2MB 3H9DA 3WIMA 4F7ZA 1RAXA 2I1JA 3ZO5B 1WGDA 4MEMA 2CHXA 3TIXA 4AP4C 2ZNVB 3UINB 4PYZA 2LI5A 3D32A 2AL6A 1WE7A 3QQ8B 4IG7B 1NDDA 2CHWA 2LWPA 3M62B 5L95C 3KUZA 1U4AA 2ZCBA 3JYUA 4B6WA 4BFRA 1RFAA 2KX0A 1H8CA 1TGZB 3OAWA 4KIKA 3DBLI 2KKCA 2W9NA 1RRBA 1PQSA 4AUQC 1WIAA 3ECIA 1J19A 3K9PB 3TCAA 4OVUA 3ZVVA 4K1RB 5GMVA 1WJUA 2V1YA 4LJPB 3TBLD 2KC1A 1KJTA 1WR1A 2MQJA 4X57B 2WDTB 3ZRFA 1I42A 2UWQA 4I6PA 4JQWC 4FLHA 2JWZA 5LXIB 2LJ5A 3PHWB 4TKNA 2RSUA 1V81A 3ZTDA 3DVGX 3A9KB 1Q0WB 1NI2A 3VUYA 3APDA 1GG3A 1V2YA 5JHBA 4B95A 4GU2A 2AEHA 1WE6A 3KH0A 1KOTA 4ZRKA 1KLVA 1GJZA 3VUWA 2WX0A 4W9LA 2KLGA 4WAAA 4EUTA 1HE8A 2LRWA 2J7QB 4NQKE 2ZPNA 1E5WA 3RT3B 3RZFA 4HK2A 2WWZA 2JRIB 2WX1A 5IAAC 3CMMB 3KVFB 2N9PC 2KC2A 1M94A 4MGZE 3QK0A 1L7YA 2RPQA 2KZRA 3AXCA 2JPHA 3RD2A 2BF8B 4JL9A 5D7GA 3R7RA 2MBHA 5LLIA 1UBIA 1UELA 4EOYA 4HCNB 3UQAA 3OJ4B 4A3PA 2KANA 4KZCA 4HXDA 5D6JB 4I6NB 2KD0A 4NNJB 3V61A 3JW0X 1IP9A 1Q5WB 1WX8A 3P2BA 2M0XA 1VCBA 4IW0A 4RM8A 3RCZA 3PTFC 1GNUA 1YX6B 2AWTA 5CHWA 4YL8A 4A20A 2PE9A 5TR5A 2OOBB 3MHSD 3VTUA 2G4SA 2CS4A 3U30A 2K39A 4E74A 4FULA 1P3QU 3PSEB 2Z59B 3A4RA 2BWFA 2R2OA 1TTNA 5E6PA 1WX7A 4JIOU 4XX5A 1T0YA 3ZNZB 5E6OA 2ZPYA 5JH5C 2KDEB 4G3XB 5JZEB 4MGIE 5JHAA 2KLCA 2MP2B 4TQ1A 4ZYNA 4ANWA 3VDZA 4GSWA 5CHVC 3JSVA 2N1VA 3M63B 4HPLB 3Q3FA 4GIVA 1SIFA 3R7QA 3SHQA 2KFKB 4WWPA 2O2VB 2LVPA 1WMHA 3CSTA 3K9OB 4DBGA 5AZFA 1Z5SB 2GBMA 1P1AA 2HD5B 4EEWA 3HM3A 4WJPA 3QIJA 4ZRIA 3PZDA 2L00B 2R2QA 2FIFA 4FJZA 3ZIMA 3B1LX 5C23A 4NJ7A 4W9JA 4N9F4 1WR6E 2D10A 1LM8B 2KOXA 2C7MB 5AEKB 3TMPB 2HJ8A 1XD3B 4IUMB 1EF1A 2KQSA 2LXAA 1V9JA 1BT0A 2K6DB 2O6VA 5CTRC 3WAMA 1WM2A 2IBIB 4DDID 4F1SA 3AULA 4BBNF 2EKEC 1TBEA 4GDKA 3L16A 2KVRA 3R66C 1EF5A 3V6EB 3ZDTA 5E6NA 1WFYA 2LVQA 1V86A 2EMSA 2LXCA 4I6LB 1J0GA 2IZVB 3QARA 4KSKC 2CR5A 2FCNA 3VHTC 2K6QA 2DENB 2LGXA 4WJNA 3DBRI 2IY0B 2DAJA 3IBEA 1LFDA 2NBVB 4MDKE 3VQIA 4KZ0A 4W9IA 2DZJA 3UGBB 3H1UA 3QAQA 4ASWC 2MX2A 3HM6X 2MLBA 4JGHB 3CSFA 3DVNU 4DHJB 3A9JB 3WAOA 4MELA 4NQLB 1WGGA 3A1QA 4MJSB 3QHTA 4GGQA 2L7RA 3MJWA 5J2RA 4EZJA 2BYFA 2ZZPB 3DVNV 2N4FA 1WGHA 3W1YA 4HDOA 2B3AA 2LVOA 2KWVB 2KHWB 1P9DU 2J0MA 3DOWA 2DHZA 3M95A 5IA7A 4W9DA 4NPNA 4W9FA 2DYMA 1E8YA 2HTHA 4HCPB 2WYQA 4W9CA 1UGMA 3C0RB 3PT2B 4XZ4A 4GOCA 3A9KA 4ANVA 5BO4B 1YIWA 4GDLA 1YD8U 1IYFA 2XK5A 4J6IA 2GMIC 4PS3A 4W9EA 2PPHA 3IVFA 2J0KA 3ALBA 4TV3A 1YJ1A 4K81A 4BKSD 1C3TA 3DBHI 2OJRA 1D3ZA 4IC7B 3W1SA 4RM9A 4LCDE 4FN2A 2D2QA 1E90A 3DQVA 3KUDB 4WWOA 2A5UA 4AJYB 2Z0EB 1WM3A 3RYTA 3DBSA 1WI0A 3V62A 4DXAB 4ANUA 5FR6A 3ENEA 2KTRB 2YLMA 2AYOB 2L0TA 5J18A 1WGYA 2IO3B 2FCQA 2LD9A 1E8ZA 1WF9A 1WJ6A 2M8SA 2KFJA 2PJHA 1C1YB 2IO0B 2IO2B 2JUOA 1OGWA 2PEAA 3N3KB 2N7DA 4JLCA 4KSLC 5DPSA 1NBFC 2K1FA 2YVCA 2RR9A 2KDBA 1YQBA 2FUHB 2D11A 2LZ6A 3ZLZA 2NPTA 2DX5B 1UH6A 2DZIA 3NZUA 3SU8X 4AOFA 3VTWA 2KWCA 3ONSA 1SGHA 2K25A 3L54A 1S3SG 3L17A 1IPGA 2CU1A 2EMTA 4LJOB 2M1MA 4NJ6A 1V49A 4II2B 3B08A 3VAWA 2REXA 4BOZB 2Y5BB 5DPRA 1XT9B 3PVLA 3L13A 3QX1A 1V5OA 4G50A 1EO6A 3NY5A 4AJWA 3U8ZA 2FAZA 2KMCA 2KX3A 4E71A 4HLEA 3NOBA 4URKA 3HK0A 3GZNI 2KQ7A 3EECA 3PLUA 3VH4B 2ZVNA 3APCA 2D07B 2MP2A 4NAWB 2G4DB 1MG8A 1XQQA 1ZW7A 5DPTA 1E7UA 5D94A 3IHPC 3EC8A 2KK8A 2VRRB 2ZNVC 2G45B 2JZ3B 4FHJA 4EZKA 3EHVA 2LGDA 2GBNA 3ML9A 1I35A 1WZ0A 4MGYE 3UIPB 3H7PA 2C7NB 4FA6A 3ZW3A 3ZNHB 4HPMB 2XBBC 4K7UA 2KTFA 4MM3A 1ZKHA 2V4LA 3NS8A 2LASA 3U7DA 1ISNA 5EDSA 1WXSA 4FBJB 3ZUNA 4ZDVA 4IWQA 3ZDMC 4K7SA 2KJ6A 3BINA 4IM0A 1Q1OA 4ANXA 2KMAA 3B0AA 3ZTCA 1RLFA 2NR2A 5G2NA 4EKUA 3SD5A 1LQBA 5CX3A 4TQ0A 2DYOA 5C1ZA 1V5TA 3MTNB 4W9KA 2M17A 3AI5A 4AWJA 5LXHA 5HKHA 1WJNA 1P0RA 4IM3A 3VH3B 3VXWA 2JZZA 3L0WB 2KWUB 1GC6A 1VD2A 1WY8A 2N9EB 4FADA 2ASQA 1G6JA 3WAPA 3JVZX 3A4SC 2D3GA 3PRPB 1WXMA 3QA8A 4DHJD 2MBQA 2BKRB 4HWIB 4DHZB 4FJVB 2KO3A 3DDCB 4G11A 4HVBA 3N32A 4HDQA 3A9JA 4ICVA 3W1SC 2K8CA 2O6VB 4DHZE 3RZWC 3ZNID 4MJSA 5DCNA 4IWOA 3T9LA 3IFWB 3UQBA 2MBBB 1WRDB 3A33B 4GDKB 4GXBA 4K7WA 4CHKA 3OJ3A 4IWPA 4PYUA 3Q3JA 1S1QB 3APFA 3M3JA 4MH0E 2JF5A 1SE9A 2LGYA 2K8BA 2UYZB 2N7EA 1GUAB 3WA0A 3AU4A 5KHQA 1FXTB 4LDTD 4BBNC 2C9WB 3HHMA 3PLVA 1J8CA 4FHKA 3PHXB 4EFOA 2J0JA 1JRUA 1WGRA 3PREA 4GN1A 2KDIA 4LDTB 2GBKA 3OLMD 4WJQA 3R3MA 3BY4B 2MBEA 4DK5A 1Z2MA 4BKGA 1WYWB 3PS6A 3DPDA 2IO1B 4E3CA 2KN5A 3PGEA 3A1QB 1OQYA 4TUUA 2MSED 2MW5A 3TJPA 4DWFA 4KIKB 2C7HA 3IG3A 5DPWA 4A3OA 5J17A 3VUXA 2L8JA 3NHEB 2JRHA 3VVWB 4FJYA 2KXJA 2BKFA 2BGFA 5KHOA 2LRUA 4BKSA 1R4NI 2L05A 1WZ3A 2V3SA 2KTRA 2N9XA 2MWSB 2IY1B 4B9KA 4BKTA 2FCSA 2L0FA 1CMXB 1TZ1A 2JT4B 2RGFA 2C5LC 4GDLB 2FNJB 4NY0A 3WANA 1Y8RC 2XK5B 3V6CB 2PE6B 2BYVE 2KNBA 4M0WB 2JXXA 2NVUI 3ZNGC 4MSQB 3ZKJC 3QJZA 4GMVA 2QHOA 2NBUA 4WQOB 1ZGUB 1WX9A 2DAFA 3L10B 4RMAA 4W9HA 1WJ4A 2JVCA 2BPSA 3KW5B 4GB9A 3KYDD 1R4MI 1L2NA 3TL5A 4M8MA 2A4ZA 4ICUA 2DYBA 3S2AA 4W9GA
chains in the Genus database with same CATH superfamily
2XEWA 1P98A 1UGJA 2HE7A 1QOFA 3VFKA 2GOWA 2PKOA 1JWSD 2KJHB 4IKGA 2QCZA 4KVGB 4BVUC 1P7EA 2CHZA 4LNKA 4EZLA 5TSSA 4G0NB 2K0PA 2AL3A 2E6XA 2QMTA 1X1MA 3AEBB 3Q2AC 3TEZA 2BS4B 2OEDA 4P1CC 4MGKE 1XLNA 1CJEA 1A70A 3DHHC 2LJIA 2W55A 3C19A 3ZRCA 2GBJA 3I9V1 1WMHB 3UIOB 2MA9B 1TT5B 4PS8A 1MJDA 3X0WA 3HIZA 2O6VD 1IUEA 2IPKD 3H7SA 3NUHB 1PGAA 2QIEB 3NZSA 1KM7A 1UD7A 3N1ZC 2D3CA 3WIMA 3ZO5B 3H8HA 1C78A 2XN9C 1I4RA 1L0YB 3QQ8B 3M62B 2J42A 3TEYA 1U4AA 2ZCBA 1SJED 2W9NA 1T0SC 4AUQC 2QJLA 1J19A 3K9PB 4JWUC 4K1RB 4LJPB 2G1EA 1QOAA 1KJTA 3Q3NC 1UF0A 4YT0B 1I42A 2UWQA 4I6PA 4JQWC 4FLHA 3VRBB 2WXGA 3RNEC 4OZCA 2RSUA 2WQYB 2PIAA 3APDA 1GG3A 1V2YA 2JX5A 4XDDA 2CJNA 2SEBD 3NG0A 2AEHA 1WE6A 2TSSA 1YJJA 3C8YA 3PO0A 4RF1A 1GJZA 1FXAA 4W9LA 4WAAA 2J7QB 4NQKE 3RT3B 1E5WA 3RZFA 2WWZA 2WX1A 3BK2A 1BMLC 1M94A 1VJKA 2W3SA 3IT6B 4WURA 4WWMA 1TKGA 1TZOA 2DNFA 3Q8BA 3UQAA 2FUG1 2KANA 4I6NB 1L6UA 2YEPB 2INPE 2RMMA 3RCZA 1BUIC 1YX6B 4YL8A 3DHGC 1GOZA 3KWLA 4A20A 5TR5A 3P4RB 2G4SA 1C77A 4E74A 1E10A 4JPSA 3PSEB 2Z59B 2BWFA 1QILA 2KDEB 2HDEA 5JZEB 4MGIE 1JWUD 2K3UA 3VDZA 4GSWA 5CHVC 2LEKA 3BWUD 2N1VA 2SAKA 3M63B 2KFKB 4RH6A 2O2VB 2LVPA 1WMHA 4DBGA 2HD5B 1AN8A 1TY2A 3IT4B 4FJZA 5C23A 3N1XC 1WR6E 2D10A 4B0MA 1XD3B 2H88B 1EF1A 4DDID 3ZJVA 2IBIB 4K3BA 4BBNF 2EKEC 4LK0M 3R66C 3ZDTA 2LVQA 2LXCA 1J0GA 4YTMB 2CR5A 3VHTC 1JALA 1C4AA 1LFDA 4JE3B 4KZ0A 4AS1A 2ZW1A 3HM6X 1ZPSA 3DVNU 3WAOA 1WGGA 3AE2B 2LGSA 1V1OA 3QHTA 4GGQA 2L7RA 2KWVB 2KHWB 1MG4A 3NVVA 4W9DA 3DBLB 2R61A 4W9FA 1SEBD 1KF6B 1D5ZC 2KQ4X 2DBYA 4XZ4A 4GOCA 1L4DB 1EU3A 1F1HA 1OQQA 4PS3A 4W9EA 4TV3A 3R2IA 2INDC 1YQ3B 1D3ZA 4RM9A 1NYQA 4LCDE 4RGOS 1TY0A 4WWOA 3DBSA 5FR6A 2AYOB 2K5PA 2M8SA 1K51A 3RMKC 2IO0B 2IO2B 2JUOA 3N3KB 3W5UB 2MHJA 4NJCA 2NMQA 4CQNA 1SE2A 2YVCA 1FNUA 1UH6A 2DZIA 3NZUA 4AOFA 2X38A 1IPGA 2CU1A 2RDHA 4II2B 3VAWA 3OG5A 2Y5BB 5EE1A 3L13A 3GE8C 1V5OA 4G50A 1EO6A 2KMCA 2KQ7A 4A55A 1SB3C 1KLGD 2D07B 1XQQA 1ZW7A 5DPTA 1E7UA 1XLQA 2G45B 1NEKB 3BVGA 4ITKA 3EHVA 5EE9A 1N5XA 3P42A 4HPMB 3MC0B 2V4LA 1L0VB 4ZDVA 4IWQA 4ZOHC 3R8BA 3BINA 4IM0A 4ANXA 3ZTCA 1RLFA 3SD5A 1LQBA 4KGRA 5CX3A 4TQ0A 1V5TA 3AI5A 4IM3A 3VXWA 3L0WB 2KWUB 4MT5A 1WY8A 2ASQA 1G6JA 3WAPA 5JXVA 3A4SC 2D3GA 3KQ4A 2BKRB 1ET6A 4DHZB 2LHEA 1IBXA 3N32A 1FXIA 4P1BC 3W1SC 4DHZE 3RZWC 2NTTA 5DCNA 3T9LA 3UQBA 1HTQA 4GDKB 4K7WA 3OJ3A 4IWPA 1V97A 3Q3JA 1ROEA 2J4XA 4MH0E 3Q8FA 3Q6BA 3RFZB 1GUAB 3WA0A 5KHQA 3ZQ4A 1FXTB 2L1AA 1C4CA 3PHXB 3RNGC 4LTUA 2J0JA 1JRUA 1WGRA 2W3RA 4WJQA 4DK5A 2MBEA 4BKGA 2KN5A 4NAMA 2MSED 2LUMA 3TJPA 2I2YA 4KIKB 3NHEB 4H2AA 2K22A 3HVDA 3AE9B 2MEKA 2IGDA 4JX1C 1KRHA 1OFFA 2V3SA 2MWSB 4B9KA 2JT4B 4GDLB 3AN1A 1IGCA 1XF5L 3WANA 1Y8RC 2XK5B 2PE6B 2KNBA 4M0WB 2B76B 4MSQB 2NBUA 3L10B 3KW5B 1PYWD 1L2NA 4M8MA 2A4ZA 4KGSA 4US8A 3S2AA 1JQ4A 1OTRB 2BYEA 3QC8B 1OEYJ 3UF8A 3AU5A 4DDGD 3NS1A 2CJOA 3IAS1 5FK9C 4WJOA 2V9HA 2N0SB 3OWEB 3LJ3A 3LB8C 1FNWA 3AE1B 4A8XC 4KX6B 4CYEA 3EFUA 1MVKA 2GLSA 2BWES 3WALA 2DZKA 2KJRA 3PPAA 5G5HA 2V0GA 2DZMA 4CO7A 4PS7A 1JWBD 2IYDB 2KDMA 3JSVB 4ZRJA 1A5RA 3BYTB 3ML8A 3AE7B 1E8WA 3H7PB 3SFEB 3PRMB 1EM7A 1E8XA 3BIID 3DVGY 2M4NA 3KUCB 3O65B 4WWNA 2WXRA 3FILB 4RGMA 1D4BA 1E6EB 1LXDA 2OHFA 2BW2A 1UZXB 1XEEA 2N1WA 3LDZE 2ZEQA 2G3QB 3L08A 4F7ZA 3HRDD 4TSSA 2ZNVB 1HEZE 2PTLA 2AL6A 1ET9A 1NDDA 2CHWA 2LWPA 5L95C 1N63A 4B6WA 4BFRA 1RFAA 4IOIE 2UU7A 4KIKA 2WXLA 4B0EA 4A6QA 2EELA 2KT7A 4C4VA 3GP7A 1R4NB 3A9KB 3R2TA 1NI2A 1EWYC 4M0WA 1ZDVA 3KH0A 2J53A 1JROA 1C76A 1RM6C 1KLVA 5BMIA 5T8IA 3RNBC 2LRWA 2ZPNA 1MFWA 3MP9A 2JRIB 1ZDXA 2RPVA 2N9PC 2KC2A 4MGZE 1E0ZA 2KZRA 2RDBC 2JPHA 3RD2A 1ZP0B 5D7GA 3OJ4B 3MC9A 5D6JB 3RNFC 4RF0A 1IP9A 1Q5WB 1VCBA 4IW0A 4RM8A 1GNUA 5CHWA 4KGTA 2PE9A 2OOBB 2CS4A 4ARIA 4FULA 3EFCA 1C9FA 2R2OA 1WSPA 1TTNA 1T0YA 1YN4A 2ZPYA 3AEGB 2KLCA 2MP2B 2D5GA 3JSVA 3Q3FA 3MJ5A 2W54A 3CSTA 2DLBA 3NRZA 2KACA 1P1AA 4ACFA 4EEWA 4WJPA 1JMLA 1TS4A 3PZDA 2L00B 2QSDA 2FIFA 4N9F4 5AEKB 1LM8B 3TMPB 2KQSA 4WAFA 2LXAA 2K6DB 1BT0A 4J3OD 3WAMA 3Q8AA 3AULA 1TBEA 2INCC 1EF5A 1V86A 2EMSA 2IZVB 3Q8EA 2FCNA 2LGXA 2OJWA 2DAJA 4MDKE 3VQIA 3AE6B 2DZJA 1B1ZA 3QAQA 2MLBA 5D3DA 4NQLB 1WWTA 3A1QA 4MJSB 3Q69A 1DYQA 5J2RA 3U52E 4L1BA 3DVNV 2N4FA 3AE4B 3EUB2 2B3AA 3I57A 1SE4A 2DHZA 1I7HA 2HTME 5IA7A 2VZKB 2HTHA 1E8YA 2MJEA 4W9CA 1UGMA 3PT2B 2BTEA 3A9KA 4HRSA 1YIWA 1FCLA 2JU6X 1HTOA 1DOXA 1GAQB 4PT5A 3LXFA 5HHDG 1YJ1A 1XLOA 1B9RA 2PVGC 1DGJA 1DOIA 3DQVA 1WM3A 2V3NA 1ZUD2 3SEBA 1QOBA 2LD9A 1WF9A 1WJ6A 1SXTA 1OGWA 3AH7A 1TYGB 1FIQA 1NBFC 2K1FA 5AUKA 2FUHB 2D11A 3ZLZA 3N20C 1T0QC 2JWUA 3ONSA 2K25A 1FFUA 2EMTA 1V49A 5DPRA 4AJWA 3B9JA 3U8ZA 2FAZA 3NOBA 3GZNI 3AM9A 3PLUA 3VH4B 2ZVNA 3APCA 2MP2A 2WXMA 2WU5B 1KH0A 2KK8A 2VRRB 3DWGC 3FKYA 1AYFA 4FHJA 2LGDA 2GBNA 3ML9A 1I35A 4L2YA 1K53A 3ETRA 3ZNHB 1ZE3D 2KTFA 1JCKB 2LASA 3IAM1 1ISNA 2BB5A 1HZ5A 4K7SA 2L52A 1UUPA 2DYOA 5C1ZA 1VR9A 4W9KA 2M17A 4AWJA 5LXHA 2WXIA 5HKHA 5EE0A 4YTNB 1GC6A 2KMMA 4FADA 3HVZA 3KWVA 3QA8A 4S17A 4DHJD 4HWIB 3U4EG 4FJVB 2KO3A 2MJ3A 4G11A 2O6VB 4MJSA 1GB1A 3TEXA 3TEWA 1S1QB 3AE5B 2AQ2B 1SE9A 1L5PA 2UYZB 1WXQA 1FMAD 2BS3B 4C56C 2C9WB 4GN1A 4LDTB 3EGRA 1FO4A 3OLMD 1XCQL 1C4PA 4PK1A 2IO1B 3PGEA 4LNNA 4TUUA 2PMVA 4HEA1 2CU3A 5DPWA 3IG3A 4A3OA 4RCOA 3VUXA 3VVWB 1OQRA 5IO9A 2BKFA 5KHOA 2IGGA 2BYTA 2WXHA 5IOIA 2WLBA 4ZRPA 1QQRA 3N1YC 5BMGA 4NY0A 4HJGE 4BZAA 2JXXA 3U7ZA 3ZKJC 1VRAB 3QJZA 2QHOA 3FAHA 2JVCA 2BPSA 1R4MI 1YMHE 4HKQA 3SDLC 2NS5A 1V80A 4KDLB 1K8RB 1MPEA 3I5JC 2MRPA 2IDYA 2ONQA 1FCCC 2RDGA 2KDFB 2NPTB 4YSYB 5AZHA 2ON8A 2NCNA 2KFKA 2L3ZA 2NBWB 2O2VA 1MI0A 2QC8A 1K50A 1FRRA 4RNAA 2Z0DB 3DCGA 3RULA 2K8HA 3X23A 1V1PB 3AEAB 2ZW0A 3CWIA 4HJKA 4II3B 3ZXVA 2MCNB 2FCMA 3QWZB 5BMHA 5AZGA 3ZJTA 1T6BX 1FPYA 1AARA 3U2SC 2C60A 1EUVB 3DHIC 3ZXRA 1D5XC 5BYSA 4MSMB 1Y56A 2FIDA 3WCQA 1STEA 1CK1A 3NJTA 2GBRA 3N30A 2ZVOA 1JWAD 1RWSA 1T5XD 3GE3C 1F9JA 2JYTA 1WXAA 3H9DA 3AE8B 2IJ0A 3UINB 4PYZA 1E9MA 2LI5A 3D32A 1WE7A 4C00A 5LNK1 2KX0A 1TGZB 1WYGA 2KKCA 1PQSA 3ECIA 2WXJA 4OVUA 5GMVA 2V1YA 3P4QB 3AECB 1KFYB 1HQRD 1WR1A 2MQJA 4X57B 4ZYSA 2JWZA 3PHWB 5C2TB 1Q0WB 4RGTA 4REZA 4MH8A 4GU2A 4M02A 1KOTA 4ZRKA 2WHIA 2KLGA 1PGXA 4EUTA 3TUOA 4HK2A 3KVFB 1N5WA 3O13A 3QK0A 3FC4A 4OVZA 3AXCA 1QOGA 4JL9A 3URYA 2MBHA 1MHHE 1UELA 4EOYA 4HCNB 2WXOA 1N61A 4KZCA 1XCTL 4NNJB 2AX5A 3JW0X 1SIJA 3V61A 1ZOYB 2GRIA 1T3QA 3VTUA 1VZ7A 2K39A 1QKZA 1D6EC 2MH7A 3I63C 1WX7A 4JIOU 5E6PA 1F2RC 1JWMD 5JH5C 3PZ8A 4G3XB 2AQ1B 5JHAA 4ANWA 3RPFC 2N9LA 1L6VA 2D3BA 3SR6A 3Q14C 4HPLB 4GIVA 3R7QA 2V4IB 5AZFA 1NI3A 1Z5SB 4D2KA 2JSVX 3B2FA 3HM3A 3QIJA 4ZRIA 3ZIMA 2LMCA 4W9JA 2KOXA 2C7MB 4A90A 1YN5A 2HJ8A 4IUMB 1V9JA 4AQ7A 5CTRC 1NVID 2IGHA 4GDKA 4IDIA 5E6NA 2BQQA 4NZLB 3VR9B 2YEPF 1M4VA 2Y3AA 2DENB 4WJNA 3DBRI 4GLSC 2K9XA 3AB5A 1QT9A 4YSXB 1FFVA 4W9IA 3UGBB 3H1UA 4C7ZA 3CSFA 3SFDB 4XWWA 1PGBA 2G9HD 1DOYA 4N6EB 4EZJA 2BYFA 3DWMA 3W1YA 4HDOA 1P9DU 2J0MA 3DOWA 1SSNA 4NPNA 1TJEA 2I38A 4QAYA 2DYMA 2WYQA 2N7JA 3C0RB 1WRIA 3W9CB 2WXPA 4ANVA 4RGNA 5BO4B 4GDLA 2XK5A 2MJDA 4J6IA 2GMIC 3LYYA 4OZBA 3P4SB 3IVFA 2J0KA 3ALBA 4K81A 2W82A 3DBHI 2OJRA 4FN2A 2D2QA 1E90A 3KUDB 4AJYB 3Q8CA 3RYTA 3DBHB 4EE2A 1NYRA 2KTRB 2YLMA 2L0TA 5J18A 2J52A 3ZGZA 1WGYA 2IO3B 2FCQA 2PJHA 1C1YB 4JLCA 2N7DA 1YOVB 4KSLC 5DPSA 4ZHOA 2KDBA 1YQBA 1VLBA 2AQ3B 2LZ6A 3IXSA 4RFBA 2KWCA 2M19A 1I4GA 1SGHA 1S3SG 2M1MA 1VDVA 3MHZA 4BOZB 1XT9B 3PVLA 3QX1A 1EU4A 3NY5A 1K52A 4E71A 4HKZE 3NVYA 3EECA 1SJHD 3E56A 4NAWB 2QDFA 2G4DB 1MG8A 1I4PA 3EC8A 2ZNVC 2JZ3B 4EZKA 4N59A 1SBBB 3UIPB 3H7PA 3Q3OC 3ZW3A 2XBBC 1ZKHA 4P16A 1WXSA 3FILA 2KMAA 3B0AA 2BT6A 2Z8LA 5G5GA 1WJNA 3VH3B 4YXDB 1VD2A 2N9EB 3UI3A 3DDCB 2ACZB 4ICVA 3ZNID 1ACCA 4IWOA 3IFWB 4GXBA 1P7FA 1TS2A 4PYUA 3RNCC 3AU4A 4LDTD 1AW7A 1YN3A 1ESFA 1JW9D 1KLUD 3PLVA 4FHKA 3ZYYX 2GBKA 4HPPA 2KWDA 3DPDA 4E3CA 3V05A 2MW5A 4DWFA 2BVCA 4UDUC 2L32A 4WIPA 2C7HA 5J17A 2L8JA 2JRHA 4ZHPA 4FJYA 1HA5A 1C79A 2BGFA 2LRUA 4BKSA 3NVWA 1UNSA 2KTRA 2N9XA 4S0RA 2JZPA 2WXFA 2LHDA 3NZ3A 4WQMA 2EKIA 4XE0A 4WQOB 1PUTA 1ZGUB 1WX9A 4RMAA 4ARCA 4GB9A 2WXNA 3ABVB 3KYDD 3MFGA 3TL5A 2VH2A 4USAA 4LNOA 5BYRA 4WH4A 1GC7A 4XC2A 2KAJA 4LLGM 2RD0A 4M01A 1WXVA 5E6JA 3T8MA 2I1KA 2LUEA 2ZJDA 4KV2A 4A9AA 3T3OA 4NAWA 4OVVA 3BVMA 3CF6E 3GZNB 4IM2A 3RUIB 3PRZA 4P7IA 2JQRB 1R7SA 1UBQA 1V6EA 2L76A 5CHFA 1F52A 1LO5D 1WH3A 3TSSA 2MBOA 4DXFA 3VTVA 5L83A 3KYCD 1FD6A 2CKHB 2WXKA 3H6NA 4YSZB 3RN9C 3VRAB 1J7BA 5G55A 2GB1A 3QCAA 2LGIA 4BOSC 3V60A 1GPXA 1N6ZA 4KKJA 1E7VA 3E9SA 4M8NA 4YWGG 3L4PA 1D5MC 2N9KA 3J9CA 5C3JB 3GOEA 1T0RC 1H4RA 2ZCCA 4KDIC 1FRDA 4F8CB 4HROA 1VZ8A 2FE8A 2JY6A 1OEYA 1YX5B 3I3TB 3PV1A 1BXTA 1QZEA 5D2MB 1RAXA 2I1JA 5IN7A 1YQ4B 4C7YA 1WGDA 4MEMA 2CHXA 3TIXA 5FR3A 4AP4C 1F0ZA 1IBXB 3W5VB 4ZRQA 4IG7B 4Q2JA 3KUZA 1IGDA 3JYUA 1H8CA 3OAWA 3DBLI 1RRBA 1WIAA 1HZ6A 3TCAA 2INNE 3AE3B 3ZVVA 1WJUA 3TBLD 2KC1A 3AV8A 2WDTB 3ZRFA 2Q5WD 5LXIB 2LJ5A 4TKNA 1V81A 3ZTDA 3DVGX 3B2GA 3VUYA 5JHBA 4B95A 1YNTE 3KLSX 1RYJA 2Y5PA 2D3AA 1QF6A 3VUWA 1Q10A 1LGRA 1PFDA 2WX0A 1HE8A 1I4HA 5IAAC 3CMMB 1L7YA 1R4MB 2RPQA 2BF8B 1N60A 3R7RA 3RNAC 5LLIA 1UBIA 2KVZA 4A3PA 4HXDA 2KD0A 1QLBB 1SE3A 2KN4A 1WX8A 3P2BA 2M0XA 2M56B 3PTFC 4XYCA 2AWTA 3T3NA 3MHSD 5I4DA 3U30A 2NTSA 4OW0A 1FEHA 5HI1A 1P3QU 2VH1A 3A4RA 2PLPA 4XX5A 3ZNZB 5E6OA 2WP9B 1AWDA 4YTPB 4TQ1A 4ZYNA 1I4XA 3P4PB 1SIFA 1EWCA 3SHQA 5HFYA 5IKCM 4WWPA 3K9OB 3BVZA 2GBMA 1J7CA 1FM0D 2R2QA 4MM3B 3B1LX 4K3CA 4NJ7A 2O6VA 3ZJUA 4F1SA 1WM2A 2KYWA 5GXGB 3L16A 2KVRA 3V6EB 1WFYA 4I6LB 5H8YE 1TIFA 3QARA 4KSKC 2ICIA 2K6QA 4C80A 3AEDB 4OHJA 2IY0B 4L23A 3IBEA 2NBVB 3GB1A 3N9YC 1CQVA 1PDXA 2M0AA 3GS2A 4ASWC 2MX2A 4JGHB 4DHJB 3RI7C 3A9JB 1F2RI 4MELA 1YJIA 4LNIA 3MJWA 2ZZPB 1WGHA 2LVOA 3M95A 3PZ7A 1MHXA 4HCPB 1FNVA 1F77A 1YD8U 3HUIA 1IYFA 2BB6A 2PPHA 1WGKA 4BKSD 5D3IB 1C3TA 2FBWB 4IC7B 3W1SA 1GB4A 3P1MA 2A5UA 5IP4D 2Z0EB 3V62A 1WI0A 4DXAB 4ANUA 3ENEA 4C4VB 2JXTA 1E8ZA 1ZXHA 2KFJA 2WDVB 2PEAA 4OZAA 2L83A 2QILA 1UWXA 2RR9A 2NPTA 2DX5B 3SU8X 2H89B 3P63A 3VTWA 4M00A 2BS2B 1SF0A 3L54A 3L17A 4LJOB 1JRPA 4NJ6A 3B08A 2REXA 2Y5CA 1NENB 4TMAB 4N58A 4HLEA 4FXCA 1V1PA 2KX3A 4URKA 3HK0A 5HG2A 3Q3MC 3BYYB 1HXYD 4JWSC 5D94A 3IHPC 2JYEA 3MC8A 4US9A 4MACA 1WZ0A 4MGYE 4DQOC 1L4ZB 3V3XA 2C7NB 4FA6A 2X8XX 4K7UA 5MPOA 1I4QA 2DWQA 2WS3B 3NS8A 4MM3A 3U7DA 5EDSA 1TKYA 1XLPA 5BYQA 4FBJB 3ZUNA 3AMZA 3ZDMC 2KJ6A 2WDQB 1Q1OA 5EE3A 3AEEB 2NR2A 5G2NA 4EKUA 2WU2B 3MTNB 3BK1A 4BAXA 5AUIA 1P0RA 5H92C 2JZZA 3BZDB 3JVZX 4XGAB 2WNMA 3EA6A 1TS5A 3PRPB 2HJ1A 2V3PA 4O1NA 1RFKA 1WXMA 2E3TA 2MBQA 4P6VF 4HVBA 3DBRB 4HDQA 4DXGA 3A9JA 4R3DA 2K8CA 2MBBB 1WRDB 3A33B 4CHKA 2PW9A 1TKEA 3APFA 3M3JA 4XDCA 2JF5A 2LGYA 2K8BA 2VZKD 2N7EA 1UWMA 2PVOD 2WGSA 4BBNC 2LFIA 1N62A 3HHMA 1VZ6A 1KTKA 1J8CA 4EFOA 3PREA 2GI9A 2XNAC 2KDIA 3R3MA 3BY4B 2BBCA 1Z2MA 1WYWB 3VR8B 3PS6A 3CIRB 1ENFA 3A1QB 1OQYA 1XXGA 1ZXIA 1V8CA 4LNFA 1XO3A 3AEFB 2KXJA 1E7PB 2QEJC 1R4NI 2L05A 1WZ3A 3W2DA 2IY1B 1J7AA 4BKTA 2FCSA 2L0FA 1CMXB 1TZ1A 2RGFA 2C5LC 2FNJB 1L0XB 3V6CB 1TS3A 2BYVE 5FKAC 2NVUI 3ZNGC 4GMVA 4XWTA 2WDRB 4KKIA 2DAFA 3NVZA 4W9HA 1WJ4A 1CZPA 4ICUA 2WXQA 2DYBA 4W9GA
chains in the Genus database with same CATH topology
1OTRB 2BYEA 2XEWA 3SDLC 1P98A 3QC8B 1OEYJ 2NS5A 1GC7A 4XC2A 3UF8A 1V80A 3AU5A 4KDLB 1K8RB 2HE7A 2RD0A 3T8MA 1WXVA 2I1KA 2LUEA 2ZJDA 4KV2A 2MRPA 3VFKA 4DDGD 2GOWA 4NAWA 2KJHB 3CF6E 4OVVA 2KDFB 2NPTB 4KVGB 4WJOA 4BVUC 3LJ3A 4IM2A 3RUIB 3PRZA 4P7IA 5AZHA 2NCNA 2CHZA 2KFKA 2L3ZA 1UBQA 1V6EA 2NBWB 2L76A 2O2VA 4EZLA 5CHFA 1WH3A 4CYEA 3EFUA 4G0NB 2MBOA 2Z0DB 2BWES 3DCGA 3WALA 3RULA 3VTVA 5L83A 2AL3A 2K8HA 3X23A 1X1MA 3KYCD 2DZKA 4HJKA 4II3B 2KJRA 4MGKE 2MCNB 2FCMA 2CKHB 3PPAA 3QWZB 3H6NA 5AZGA 2DZMA 5G55A 4CO7A 4PS7A 3QCAA 2IYDB 3ZRCA 4BOSC 3V60A 3JSVB 2GBJA 4ZRJA 1A5RA 1E7VA 4M8NA 3ML8A 1AARA 1E8WA 1WMHB 2C60A 3H7PB 3UIOB 2MA9B 1EUVB 4PS8A 3PRMB 1E8XA 3GOEA 3X0WA 3HIZA 3DVGY 2M4NA 2O6VD 3KUCB 3O65B 4MSMB 2FIDA 4WWNA 2ZCCA 1H4RA 3H7SA 1LXDA 3NZSA 4KDIC 1UZXB 1KM7A 1UD7A 2N1WA 2GBRA 3LDZE 3N30A 2ZVOA 4F8CB 2ZEQA 2G3QB 2JY6A 1OEYA 1F9JA 1YX5B 3I3TB 3PV1A 3L08A 1WXAA 1QZEA 5D2MB 3H9DA 3WIMA 4F7ZA 1RAXA 2I1JA 3ZO5B 1WGDA 4MEMA 2CHXA 3TIXA 4AP4C 2ZNVB 3UINB 4PYZA 2LI5A 3D32A 2AL6A 1WE7A 3QQ8B 4IG7B 1NDDA 2CHWA 2LWPA 3M62B 5L95C 3KUZA 1U4AA 2ZCBA 3JYUA 4B6WA 4BFRA 1RFAA 2KX0A 1H8CA 1TGZB 3OAWA 4KIKA 3DBLI 2KKCA 2W9NA 1RRBA 1PQSA 4AUQC 1WIAA 3ECIA 1J19A 3K9PB 3TCAA 4OVUA 3ZVVA 4K1RB 5GMVA 1WJUA 2V1YA 4LJPB 3TBLD 2KC1A 1KJTA 1WR1A 2MQJA 4X57B 2WDTB 3ZRFA 1I42A 2UWQA 4I6PA 4JQWC 4FLHA 2JWZA 5LXIB 2LJ5A 3PHWB 4TKNA 2RSUA 1V81A 3ZTDA 3DVGX 3A9KB 1Q0WB 1NI2A 3VUYA 3APDA 1GG3A 1V2YA 5JHBA 4B95A 4GU2A 2AEHA 1WE6A 3KH0A 1KOTA 4ZRKA 1KLVA 1GJZA 3VUWA 2WX0A 4W9LA 2KLGA 4WAAA 4EUTA 1HE8A 2LRWA 2J7QB 4NQKE 2ZPNA 1E5WA 3RT3B 3RZFA 4HK2A 2WWZA 2JRIB 2WX1A 5IAAC 3CMMB 3KVFB 2N9PC 2KC2A 1M94A 4MGZE 3QK0A 1L7YA 2RPQA 2KZRA 3AXCA 2JPHA 3RD2A 2BF8B 4JL9A 5D7GA 3R7RA 2MBHA 5LLIA 1UBIA 1UELA 4EOYA 4HCNB 3UQAA 3OJ4B 4A3PA 2KANA 4KZCA 4HXDA 5D6JB 4I6NB 2KD0A 4NNJB 3V61A 3JW0X 1IP9A 1Q5WB 1WX8A 3P2BA 2M0XA 1VCBA 4IW0A 4RM8A 3RCZA 3PTFC 1GNUA 1YX6B 2AWTA 5CHWA 4YL8A 4A20A 2PE9A 5TR5A 2OOBB 3MHSD 3VTUA 2G4SA 2CS4A 3U30A 2K39A 4E74A 4FULA 1P3QU 3PSEB 2Z59B 3A4RA 2BWFA 2R2OA 1TTNA 5E6PA 1WX7A 4JIOU 4XX5A 1T0YA 3ZNZB 5E6OA 2ZPYA 5JH5C 2KDEB 4G3XB 5JZEB 4MGIE 5JHAA 2KLCA 2MP2B 4TQ1A 4ZYNA 4ANWA 3VDZA 4GSWA 5CHVC 3JSVA 2N1VA 3M63B 4HPLB 3Q3FA 4GIVA 1SIFA 3R7QA 3SHQA 2KFKB 4WWPA 2O2VB 2LVPA 1WMHA 3CSTA 3K9OB 4DBGA 5AZFA 1Z5SB 2GBMA 1P1AA 2HD5B 4EEWA 3HM3A 4WJPA 3QIJA 4ZRIA 3PZDA 2L00B 2R2QA 2FIFA 4FJZA 3ZIMA 3B1LX 5C23A 4NJ7A 4W9JA 4N9F4 1WR6E 2D10A 1LM8B 2KOXA 2C7MB 5AEKB 3TMPB 2HJ8A 1XD3B 4IUMB 1EF1A 2KQSA 2LXAA 1V9JA 1BT0A 2K6DB 2O6VA 5CTRC 3WAMA 1WM2A 2IBIB 4DDID 4F1SA 3AULA 4BBNF 2EKEC 1TBEA 4GDKA 3L16A 2KVRA 3R66C 1EF5A 3V6EB 3ZDTA 5E6NA 1WFYA 2LVQA 1V86A 2EMSA 2LXCA 4I6LB 1J0GA 2IZVB 3QARA 4KSKC 2CR5A 2FCNA 3VHTC 2K6QA 2DENB 2LGXA 4WJNA 3DBRI 2IY0B 2DAJA 3IBEA 1LFDA 2NBVB 4MDKE 3VQIA 4KZ0A 4W9IA 2DZJA 3UGBB 3H1UA 3QAQA 4ASWC 2MX2A 3HM6X 2MLBA 4JGHB 3CSFA 3DVNU 4DHJB 3A9JB 3WAOA 4MELA 4NQLB 1WGGA 3A1QA 4MJSB 3QHTA 4GGQA 2L7RA 3MJWA 5J2RA 4EZJA 2BYFA 2ZZPB 3DVNV 2N4FA 1WGHA 3W1YA 4HDOA 2B3AA 2LVOA 2KWVB 2KHWB 1P9DU 2J0MA 3DOWA 2DHZA 3M95A 5IA7A 4W9DA 4NPNA 4W9FA 2DYMA 1E8YA 2HTHA 4HCPB 2WYQA 4W9CA 1UGMA 3C0RB 3PT2B 4XZ4A 4GOCA 3A9KA 4ANVA 5BO4B 1YIWA 4GDLA 1YD8U 1IYFA 2XK5A 4J6IA 2GMIC 4PS3A 4W9EA 2PPHA 3IVFA 2J0KA 3ALBA 4TV3A 1YJ1A 4K81A 4BKSD 1C3TA 3DBHI 2OJRA 1D3ZA 4IC7B 3W1SA 4RM9A 4LCDE 4FN2A 2D2QA 1E90A 3DQVA 3KUDB 4WWOA 2A5UA 4AJYB 2Z0EB 1WM3A 3RYTA 3DBSA 1WI0A 3V62A 4DXAB 4ANUA 5FR6A 3ENEA 2KTRB 2YLMA 2AYOB 2L0TA 5J18A 1WGYA 2IO3B 2FCQA 2LD9A 1E8ZA 1WF9A 1WJ6A 2M8SA 2KFJA 2PJHA 1C1YB 2IO0B 2IO2B 2JUOA 1OGWA 2PEAA 3N3KB 2N7DA 4JLCA 4KSLC 5DPSA 1NBFC 2K1FA 2YVCA 2RR9A 2KDBA 1YQBA 2FUHB 2D11A 2LZ6A 3ZLZA 2NPTA 2DX5B 1UH6A 2DZIA 3NZUA 3SU8X 4AOFA 3VTWA 2KWCA 3ONSA 1SGHA 2K25A 3L54A 1S3SG 3L17A 1IPGA 2CU1A 2EMTA 4LJOB 2M1MA 4NJ6A 1V49A 4II2B 3B08A 3VAWA 2REXA 4BOZB 2Y5BB 5DPRA 1XT9B 3PVLA 3L13A 3QX1A 1V5OA 4G50A 1EO6A 3NY5A 4AJWA 3U8ZA 2FAZA 2KMCA 2KX3A 4E71A 4HLEA 3NOBA 4URKA 3HK0A 3GZNI 2KQ7A 3EECA 3PLUA 3VH4B 2ZVNA 3APCA 2D07B 2MP2A 4NAWB 2G4DB 1MG8A 1XQQA 1ZW7A 5DPTA 1E7UA 5D94A 3IHPC 3EC8A 2KK8A 2VRRB 2ZNVC 2G45B 2JZ3B 4FHJA 4EZKA 3EHVA 2LGDA 2GBNA 3ML9A 1I35A 1WZ0A 4MGYE 3UIPB 3H7PA 2C7NB 4FA6A 3ZW3A 3ZNHB 4HPMB 2XBBC 4K7UA 2KTFA 4MM3A 1ZKHA 2V4LA 3NS8A 2LASA 3U7DA 1ISNA 5EDSA 1WXSA 4FBJB 3ZUNA 4ZDVA 4IWQA 3ZDMC 4K7SA 2KJ6A 3BINA 4IM0A 1Q1OA 4ANXA 2KMAA 3B0AA 3ZTCA 1RLFA 2NR2A 5G2NA 4EKUA 3SD5A 1LQBA 5CX3A 4TQ0A 2DYOA 5C1ZA 1V5TA 3MTNB 4W9KA 2M17A 3AI5A 4AWJA 5LXHA 5HKHA 1WJNA 1P0RA 4IM3A 3VH3B 3VXWA 2JZZA 3L0WB 2KWUB 1GC6A 1VD2A 1WY8A 2N9EB 4FADA 2ASQA 1G6JA 3WAPA 3JVZX 3A4SC 2D3GA 3PRPB 1WXMA 3QA8A 4DHJD 2MBQA 2BKRB 4HWIB 4DHZB 4FJVB 2KO3A 3DDCB 4G11A 4HVBA 3N32A 4HDQA 3A9JA 4ICVA 3W1SC 2K8CA 2O6VB 4DHZE 3RZWC 3ZNID 4MJSA 5DCNA 4IWOA 3T9LA 3IFWB 3UQBA 2MBBB 1WRDB 3A33B 4GDKB 4GXBA 4K7WA 4CHKA 3OJ3A 4IWPA 4PYUA 3Q3JA 1S1QB 3APFA 3M3JA 4MH0E 2JF5A 1SE9A 2LGYA 2K8BA 2UYZB 2N7EA 1GUAB 3WA0A 3AU4A 5KHQA 1FXTB 4LDTD 4BBNC 2C9WB 3HHMA 3PLVA 1J8CA 4FHKA 3PHXB 4EFOA 2J0JA 1JRUA 1WGRA 3PREA 4GN1A 2KDIA 4LDTB 2GBKA 3OLMD 4WJQA 3R3MA 3BY4B 2MBEA 4DK5A 1Z2MA 4BKGA 1WYWB 3PS6A 3DPDA 2IO1B 4E3CA 2KN5A 3PGEA 3A1QB 1OQYA 4TUUA 2MSED 2MW5A 3TJPA 4DWFA 4KIKB 2C7HA 3IG3A 5DPWA 4A3OA 5J17A 3VUXA 2L8JA 3NHEB 2JRHA 3VVWB 4FJYA 2KXJA 2BKFA 2BGFA 5KHOA 2LRUA 4BKSA 1R4NI 2L05A 1WZ3A 2V3SA 2KTRA 2N9XA 2MWSB 2IY1B 4B9KA 4BKTA 2FCSA 2L0FA 1CMXB 1TZ1A 2JT4B 2RGFA 2C5LC 4GDLB 2FNJB 4NY0A 3WANA 1Y8RC 2XK5B 3V6CB 2PE6B 2BYVE 2KNBA 4M0WB 2JXXA 2NVUI 3ZNGC 4MSQB 3ZKJC 3QJZA 4GMVA 2QHOA 2NBUA 4WQOB 1ZGUB 1WX9A 2DAFA 3L10B 4RMAA 4W9HA 1WJ4A 2JVCA 2BPSA 3KW5B 4GB9A 3KYDD 1R4MI 1L2NA 3TL5A 4M8MA 2A4ZA 4ICUA 2DYBA 3S2AA 4W9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTR B;  2BYE A;  2XEW A;  3SDL C;  1P98 A;  3QC8 B;  1OEY J;  2NS5 A;  1GC7 A;  4XC2 A;  3UF8 A;  1V80 A;  3AU5 A;  4KDL B;  1K8R B;  2HE7 A;  2RD0 A;  3T8M A;  1WXV A;  2I1K A;  2LUE A;  2ZJD A;  4KV2 A;  2MRP A;  3VFK A;  4DDG D;  2GOW A;  4NAW A;  2KJH B;  3CF6 E;  4OVV A;  2KDF B;  2NPT B;  4KVG B;  4WJO A;  4BVU C;  3LJ3 A;  4IM2 A;  3RUI B;  3PRZ A;  4P7I A;  5AZH A;  2NCN A;  2CHZ A;  2KFK A;  2L3Z A;  1UBQ A;  1V6E A;  2NBW B;  2L76 A;  2O2V A;  4EZL A;  5CHF A;  1WH3 A;  4CYE A;  3EFU A;  4G0N B;  2MBO A;  2Z0D B;  2BWE S;  3DCG A;  3WAL A;  3RUL A;  3VTV A;  5L83 A;  2AL3 A;  2K8H A;  3X23 A;  1X1M A;  3KYC D;  2DZK A;  4HJK A;  4II3 B;  2KJR A;  4MGK E;  2MCN B;  2FCM A;  2CKH B;  3PPA A;  3QWZ B;  3H6N A;  5AZG A;  2DZM A;  5G55 A;  4CO7 A;  4PS7 A;  3QCA A;  2IYD B;  3ZRC A;  4BOS C;  3V60 A;  3JSV B;  2GBJ A;  4ZRJ A;  1A5R A;  1E7V A;  4M8N A;  3ML8 A;  1AAR A;  1E8W A;  1WMH B;  2C60 A;  3H7P B;  3UIO B;  2MA9 B;  1EUV B;  4PS8 A;  3PRM B;  1E8X A;  3GOE A;  3X0W A;  3HIZ A;  3DVG Y;  2M4N A;  2O6V D;  3KUC B;  3O65 B;  4MSM B;  2FID A;  4WWN A;  2ZCC A;  1H4R A;  3H7S A;  1LXD A;  3NZS A;  4KDI C;  1UZX B;  1KM7 A;  1UD7 A;  2N1W A;  2GBR A;  3LDZ E;  3N30 A;  2ZVO A;  4F8C B;  2ZEQ A;  2G3Q B;  2JY6 A;  1OEY A;  1F9J A;  1YX5 B;  3I3T B;  3PV1 A;  3L08 A;  1WXA A;  1QZE A;  5D2M B;  3H9D A;  3WIM A;  4F7Z A;  1RAX A;  2I1J A;  3ZO5 B;  1WGD A;  4MEM A;  2CHX A;  3TIX A;  4AP4 C;  2ZNV B;  3UIN B;  4PYZ A;  2LI5 A;  3D32 A;  2AL6 A;  1WE7 A;  3QQ8 B;  4IG7 B;  1NDD A;  2CHW A;  2LWP A;  3M62 B;  5L95 C;  3KUZ A;  1U4A A;  2ZCB A;  3JYU A;  4B6W A;  4BFR A;  1RFA A;  2KX0 A;  1H8C A;  1TGZ B;  3OAW A;  4KIK A;  3DBL I;  2KKC A;  2W9N A;  1RRB A;  1PQS A;  4AUQ C;  1WIA A;  3ECI A;  1J19 A;  3K9P B;  3TCA A;  4OVU A;  3ZVV A;  4K1R B;  5GMV A;  1WJU A;  2V1Y A;  4LJP B;  3TBL D;  2KC1 A;  1KJT A;  1WR1 A;  2MQJ A;  4X57 B;  2WDT B;  3ZRF A;  1I42 A;  2UWQ A;  4I6P A;  4JQW C;  4FLH A;  2JWZ A;  5LXI B;  2LJ5 A;  3PHW B;  4TKN A;  2RSU A;  1V81 A;  3ZTD A;  3DVG X;  3A9K B;  1Q0W B;  1NI2 A;  3VUY A;  3APD A;  1GG3 A;  1V2Y A;  5JHB A;  4B95 A;  4GU2 A;  2AEH A;  1WE6 A;  3KH0 A;  1KOT A;  4ZRK A;  1KLV A;  1GJZ A;  3VUW A;  2WX0 A;  4W9L A;  2KLG A;  4WAA A;  4EUT A;  1HE8 A;  2LRW A;  2J7Q B;  4NQK E;  2ZPN A;  1E5W A;  3RT3 B;  3RZF A;  4HK2 A;  2WWZ A;  2JRI B;  2WX1 A;  5IAA C;  3CMM B;  3KVF B;  2N9P C;  2KC2 A;  1M94 A;  4MGZ E;  3QK0 A;  1L7Y A;  2RPQ A;  2KZR A;  3AXC A;  2JPH A;  3RD2 A;  2BF8 B;  4JL9 A;  5D7G A;  3R7R A;  2MBH A;  5LLI A;  1UBI A;  1UEL A;  4EOY A;  4HCN B;  3UQA A;  3OJ4 B;  4A3P A;  2KAN A;  4KZC A;  4HXD A;  5D6J B;  4I6N B;  2KD0 A;  4NNJ B;  3V61 A;  3JW0 X;  1IP9 A;  1Q5W B;  1WX8 A;  3P2B A;  2M0X A;  1VCB A;  4IW0 A;  4RM8 A;  3RCZ A;  3PTF C;  1GNU A;  1YX6 B;  2AWT A;  5CHW A;  4YL8 A;  4A20 A;  2PE9 A;  5TR5 A;  2OOB B;  3MHS D;  3VTU A;  2G4S A;  2CS4 A;  3U30 A;  2K39 A;  4E74 A;  4FUL A;  1P3Q U;  3PSE B;  2Z59 B;  3A4R A;  2BWF A;  2R2O A;  1TTN A;  5E6P A;  1WX7 A;  4JIO U;  4XX5 A;  1T0Y A;  3ZNZ B;  5E6O A;  2ZPY A;  5JH5 C;  2KDE B;  4G3X B;  5JZE B;  4MGI E;  5JHA A;  2KLC A;  2MP2 B;  4TQ1 A;  4ZYN A;  4ANW A;  3VDZ A;  4GSW A;  5CHV C;  3JSV A;  2N1V A;  3M63 B;  4HPL B;  3Q3F A;  4GIV A;  1SIF A;  3R7Q A;  3SHQ A;  2KFK B;  4WWP A;  2O2V B;  2LVP A;  1WMH A;  3CST A;  3K9O B;  4DBG A;  5AZF A;  1Z5S B;  2GBM A;  1P1A A;  2HD5 B;  4EEW A;  3HM3 A;  4WJP A;  3QIJ A;  4ZRI A;  3PZD A;  2L00 B;  2R2Q A;  2FIF A;  4FJZ A;  3ZIM A;  3B1L X;  5C23 A;  4NJ7 A;  4W9J A;  4N9F 4;  1WR6 E;  2D10 A;  1LM8 B;  2KOX A;  2C7M B;  5AEK B;  3TMP B;  2HJ8 A;  1XD3 B;  4IUM B;  1EF1 A;  2KQS A;  2LXA A;  1V9J A;  1BT0 A;  2K6D B;  2O6V A;  5CTR C;  3WAM A;  1WM2 A;  2IBI B;  4DDI D;  4F1S A;  3AUL A;  4BBN F;  2EKE C;  1TBE A;  4GDK A;  3L16 A;  2KVR A;  3R66 C;  1EF5 A;  3V6E B;  3ZDT A;  5E6N A;  1WFY A;  2LVQ A;  1V86 A;  2EMS A;  2LXC A;  4I6L B;  1J0G A;  2IZV B;  3QAR A;  4KSK C;  2CR5 A;  2FCN A;  3VHT C;  2K6Q A;  2DEN B;  2LGX A;  4WJN A;  3DBR I;  2IY0 B;  2DAJ A;  3IBE A;  1LFD A;  2NBV B;  4MDK E;  3VQI A;  4KZ0 A;  4W9I A;  2DZJ A;  3UGB B;  3H1U A;  3QAQ A;  4ASW C;  2MX2 A;  3HM6 X;  2MLB A;  4JGH B;  3CSF A;  3DVN U;  4DHJ B;  3A9J B;  3WAO A;  4MEL A;  4NQL B;  1WGG A;  3A1Q A;  4MJS B;  3QHT A;  4GGQ A;  2L7R A;  3MJW A;  5J2R A;  4EZJ A;  2BYF A;  2ZZP B;  3DVN V;  2N4F A;  1WGH A;  3W1Y A;  4HDO A;  2B3A A;  2LVO A;  2KWV B;  2KHW B;  1P9D U;  2J0M A;  3DOW A;  2DHZ A;  3M95 A;  5IA7 A;  4W9D A;  4NPN A;  4W9F A;  2DYM A;  1E8Y A;  2HTH A;  4HCP B;  2WYQ A;  4W9C A;  1UGM A;  3C0R B;  3PT2 B;  4XZ4 A;  4GOC A;  3A9K A;  4ANV A;  5BO4 B;  1YIW A;  4GDL A;  1YD8 U;  1IYF A;  2XK5 A;  4J6I A;  2GMI C;  4PS3 A;  4W9E A;  2PPH A;  3IVF A;  2J0K A;  3ALB A;  4TV3 A;  1YJ1 A;  4K81 A;  4BKS D;  1C3T A;  3DBH I;  2OJR A;  1D3Z A;  4IC7 B;  3W1S A;  4RM9 A;  4LCD E;  4FN2 A;  2D2Q A;  1E90 A;  3DQV A;  3KUD B;  4WWO A;  2A5U A;  4AJY B;  2Z0E B;  1WM3 A;  3RYT A;  3DBS A;  1WI0 A;  3V62 A;  4DXA B;  4ANU A;  5FR6 A;  3ENE A;  2KTR B;  2YLM A;  2AYO B;  2L0T A;  5J18 A;  1WGY A;  2IO3 B;  2FCQ A;  2LD9 A;  1E8Z A;  1WF9 A;  1WJ6 A;  2M8S A;  2KFJ A;  2PJH A;  1C1Y B;  2IO0 B;  2IO2 B;  2JUO A;  1OGW A;  2PEA A;  3N3K B;  2N7D A;  4JLC A;  4KSL C;  5DPS A;  1NBF C;  2K1F A;  2YVC A;  2RR9 A;  2KDB A;  1YQB A;  2FUH B;  2D11 A;  2LZ6 A;  3ZLZ A;  2NPT A;  2DX5 B;  1UH6 A;  2DZI A;  3NZU A;  3SU8 X;  4AOF A;  3VTW A;  2KWC A;  3ONS A;  1SGH A;  2K25 A;  3L54 A;  1S3S G;  3L17 A;  1IPG A;  2CU1 A;  2EMT A;  4LJO B;  2M1M A;  4NJ6 A;  1V49 A;  4II2 B;  3B08 A;  3VAW A;  2REX A;  4BOZ B;  2Y5B B;  5DPR A;  1XT9 B;  3PVL A;  3L13 A;  3QX1 A;  1V5O A;  4G50 A;  1EO6 A;  3NY5 A;  4AJW A;  3U8Z A;  2FAZ A;  2KMC A;  2KX3 A;  4E71 A;  4HLE A;  3NOB A;  4URK A;  3HK0 A;  3GZN I;  2KQ7 A;  3EEC A;  3PLU A;  3VH4 B;  2ZVN A;  3APC A;  2D07 B;  2MP2 A;  4NAW B;  2G4D B;  1MG8 A;  1XQQ A;  1ZW7 A;  5DPT A;  1E7U A;  5D94 A;  3IHP C;  3EC8 A;  2KK8 A;  2VRR B;  2ZNV C;  2G45 B;  2JZ3 B;  4FHJ A;  4EZK A;  3EHV A;  2LGD A;  2GBN A;  3ML9 A;  1I35 A;  1WZ0 A;  4MGY E;  3UIP B;  3H7P A;  2C7N B;  4FA6 A;  3ZW3 A;  3ZNH B;  4HPM B;  2XBB C;  4K7U A;  2KTF A;  4MM3 A;  1ZKH A;  2V4L A;  3NS8 A;  2LAS A;  3U7D A;  1ISN A;  5EDS A;  1WXS A;  4FBJ B;  3ZUN A;  4ZDV A;  4IWQ A;  3ZDM C;  4K7S A;  2KJ6 A;  3BIN A;  4IM0 A;  1Q1O A;  4ANX A;  2KMA A;  3B0A A;  3ZTC A;  1RLF A;  2NR2 A;  5G2N A;  4EKU A;  3SD5 A;  1LQB A;  5CX3 A;  4TQ0 A;  2DYO A;  5C1Z A;  1V5T A;  3MTN B;  4W9K A;  2M17 A;  3AI5 A;  4AWJ A;  5LXH A;  5HKH A;  1WJN A;  1P0R A;  4IM3 A;  3VH3 B;  3VXW A;  2JZZ A;  3L0W B;  2KWU B;  1GC6 A;  1VD2 A;  1WY8 A;  2N9E B;  4FAD A;  2ASQ A;  1G6J A;  3WAP A;  3JVZ X;  3A4S C;  2D3G A;  3PRP B;  1WXM A;  3QA8 A;  4DHJ D;  2MBQ A;  2BKR B;  4HWI B;  4DHZ B;  4FJV B;  2KO3 A;  3DDC B;  4G11 A;  4HVB A;  3N32 A;  4HDQ A;  3A9J A;  4ICV A;  3W1S C;  2K8C A;  2O6V B;  4DHZ E;  3RZW C;  3ZNI D;  4MJS A;  5DCN A;  4IWO A;  3T9L A;  3IFW B;  3UQB A;  2MBB B;  1WRD B;  3A33 B;  4GDK B;  4GXB A;  4K7W A;  4CHK A;  3OJ3 A;  4IWP A;  4PYU A;  3Q3J A;  1S1Q B;  3APF A;  3M3J A;  4MH0 E;  2JF5 A;  1SE9 A;  2LGY A;  2K8B A;  2UYZ B;  2N7E A;  1GUA B;  3WA0 A;  3AU4 A;  5KHQ A;  1FXT B;  4LDT D;  4BBN C;  2C9W B;  3HHM A;  3PLV A;  1J8C A;  4FHK A;  3PHX B;  4EFO A;  2J0J A;  1JRU A;  1WGR A;  3PRE A;  4GN1 A;  2KDI A;  4LDT B;  2GBK A;  3OLM D;  4WJQ A;  3R3M A;  3BY4 B;  2MBE A;  4DK5 A;  1Z2M A;  4BKG A;  1WYW B;  3PS6 A;  3DPD A;  2IO1 B;  4E3C A;  2KN5 A;  3PGE A;  3A1Q B;  1OQY A;  4TUU A;  2MSE D;  2MW5 A;  3TJP A;  4DWF A;  4KIK B;  2C7H A;  3IG3 A;  5DPW A;  4A3O A;  5J17 A;  3VUX A;  2L8J A;  3NHE B;  2JRH A;  3VVW B;  4FJY A;  2KXJ A;  2BKF A;  2BGF A;  5KHO A;  2LRU A;  4BKS A;  1R4N I;  2L05 A;  1WZ3 A;  2V3S A;  2KTR A;  2N9X A;  2MWS B;  2IY1 B;  4B9K A;  4BKT A;  2FCS A;  2L0F A;  1CMX B;  1TZ1 A;  2JT4 B;  2RGF A;  2C5L C;  4GDL B;  2FNJ B;  4NY0 A;  3WAN A;  1Y8R C;  2XK5 B;  3V6C B;  2PE6 B;  2BYV E;  2KNB A;  4M0W B;  2JXX A;  2NVU I;  3ZNG C;  4MSQ B;  3ZKJ C;  3QJZ A;  4GMV A;  2QHO A;  2NBU A;  4WQO B;  1ZGU B;  1WX9 A;  2DAF A;  3L10 B;  4RMA A;  4W9H A;  1WJ4 A;  2JVC A;  2BPS A;  3KW5 B;  4GB9 A;  3KYD D;  1R4M I;  1L2N A;  3TL5 A;  4M8M A;  2A4Z A;  4ICU A;  2DYB A;  3S2A A;  4W9G A; 
#chains in the Genus database with same CATH topology
 2XEW A;  1P98 A;  1UGJ A;  2HE7 A;  1QOF A;  3VFK A;  2GOW A;  2PKO A;  1JWS D;  2KJH B;  4IKG A;  2QCZ A;  4KVG B;  4BVU C;  1P7E A;  2CHZ A;  4LNK A;  4EZL A;  5TSS A;  4G0N B;  2K0P A;  2AL3 A;  2E6X A;  2QMT A;  1X1M A;  3AEB B;  3Q2A C;  3TEZ A;  2BS4 B;  2OED A;  4P1C C;  4MGK E;  1XLN A;  1CJE A;  1A70 A;  3DHH C;  2LJI A;  2W55 A;  3C19 A;  3ZRC A;  2GBJ A;  3I9V 1;  1WMH B;  3UIO B;  2MA9 B;  1TT5 B;  4PS8 A;  1MJD A;  3X0W A;  3HIZ A;  2O6V D;  1IUE A;  2IPK D;  3H7S A;  3NUH B;  1PGA A;  2QIE B;  3NZS A;  1KM7 A;  1UD7 A;  3N1Z C;  2D3C A;  3WIM A;  3ZO5 B;  3H8H A;  1C78 A;  2XN9 C;  1I4R A;  1L0Y B;  3QQ8 B;  3M62 B;  2J42 A;  3TEY A;  1U4A A;  2ZCB A;  1SJE D;  2W9N A;  1T0S C;  4AUQ C;  2QJL A;  1J19 A;  3K9P B;  4JWU C;  4K1R B;  4LJP B;  2G1E A;  1QOA A;  1KJT A;  3Q3N C;  1UF0 A;  4YT0 B;  1I42 A;  2UWQ A;  4I6P A;  4JQW C;  4FLH A;  3VRB B;  2WXG A;  3RNE C;  4OZC A;  2RSU A;  2WQY B;  2PIA A;  3APD A;  1GG3 A;  1V2Y A;  2JX5 A;  4XDD A;  2CJN A;  2SEB D;  3NG0 A;  2AEH A;  1WE6 A;  2TSS A;  1YJJ A;  3C8Y A;  3PO0 A;  4RF1 A;  1GJZ A;  1FXA A;  4W9L A;  4WAA A;  2J7Q B;  4NQK E;  3RT3 B;  1E5W A;  3RZF A;  2WWZ A;  2WX1 A;  3BK2 A;  1BML C;  1M94 A;  1VJK A;  2W3S A;  3IT6 B;  4WUR A;  4WWM A;  1TKG A;  1TZO A;  2DNF A;  3Q8B A;  3UQA A;  2FUG 1;  2KAN A;  4I6N B;  1L6U A;  2YEP B;  2INP E;  2RMM A;  3RCZ A;  1BUI C;  1YX6 B;  4YL8 A;  3DHG C;  1GOZ A;  3KWL A;  4A20 A;  5TR5 A;  3P4R B;  2G4S A;  1C77 A;  4E74 A;  1E10 A;  4JPS A;  3PSE B;  2Z59 B;  2BWF A;  1QIL A;  2KDE B;  2HDE A;  5JZE B;  4MGI E;  1JWU D;  2K3U A;  3VDZ A;  4GSW A;  5CHV C;  2LEK A;  3BWU D;  2N1V A;  2SAK A;  3M63 B;  2KFK B;  4RH6 A;  2O2V B;  2LVP A;  1WMH A;  4DBG A;  2HD5 B;  1AN8 A;  1TY2 A;  3IT4 B;  4FJZ A;  5C23 A;  3N1X C;  1WR6 E;  2D10 A;  4B0M A;  1XD3 B;  2H88 B;  1EF1 A;  4DDI D;  3ZJV A;  2IBI B;  4K3B A;  4BBN F;  2EKE C;  4LK0 M;  3R66 C;  3ZDT A;  2LVQ A;  2LXC A;  1J0G A;  4YTM B;  2CR5 A;  3VHT C;  1JAL A;  1C4A A;  1LFD A;  4JE3 B;  4KZ0 A;  4AS1 A;  2ZW1 A;  3HM6 X;  1ZPS A;  3DVN U;  3WAO A;  1WGG A;  3AE2 B;  2LGS A;  1V1O A;  3QHT A;  4GGQ A;  2L7R A;  2KWV B;  2KHW B;  1MG4 A;  3NVV A;  4W9D A;  3DBL B;  2R61 A;  4W9F A;  1SEB D;  1KF6 B;  1D5Z C;  2KQ4 X;  2DBY A;  4XZ4 A;  4GOC A;  1L4D B;  1EU3 A;  1F1H A;  1OQQ A;  4PS3 A;  4W9E A;  4TV3 A;  3R2I A;  2IND C;  1YQ3 B;  1D3Z A;  4RM9 A;  1NYQ A;  4LCD E;  4RGO S;  1TY0 A;  4WWO A;  3DBS A;  5FR6 A;  2AYO B;  2K5P A;  2M8S A;  1K51 A;  3RMK C;  2IO0 B;  2IO2 B;  2JUO A;  3N3K B;  3W5U B;  2MHJ A;  4NJC A;  2NMQ A;  4CQN A;  1SE2 A;  2YVC A;  1FNU A;  1UH6 A;  2DZI A;  3NZU A;  4AOF A;  2X38 A;  1IPG A;  2CU1 A;  2RDH A;  4II2 B;  3VAW A;  3OG5 A;  2Y5B B;  5EE1 A;  3L13 A;  3GE8 C;  1V5O A;  4G50 A;  1EO6 A;  2KMC A;  2KQ7 A;  4A55 A;  1SB3 C;  1KLG D;  2D07 B;  1XQQ A;  1ZW7 A;  5DPT A;  1E7U A;  1XLQ A;  2G45 B;  1NEK B;  3BVG A;  4ITK A;  3EHV A;  5EE9 A;  1N5X A;  3P42 A;  4HPM B;  3MC0 B;  2V4L A;  1L0V B;  4ZDV A;  4IWQ A;  4ZOH C;  3R8B A;  3BIN A;  4IM0 A;  4ANX A;  3ZTC A;  1RLF A;  3SD5 A;  1LQB A;  4KGR A;  5CX3 A;  4TQ0 A;  1V5T A;  3AI5 A;  4IM3 A;  3VXW A;  3L0W B;  2KWU B;  4MT5 A;  1WY8 A;  2ASQ A;  1G6J A;  3WAP A;  5JXV A;  3A4S C;  2D3G A;  3KQ4 A;  2BKR B;  1ET6 A;  4DHZ B;  2LHE A;  1IBX A;  3N32 A;  1FXI A;  4P1B C;  3W1S C;  4DHZ E;  3RZW C;  2NTT A;  5DCN A;  3T9L A;  3UQB A;  1HTQ A;  4GDK B;  4K7W A;  3OJ3 A;  4IWP A;  1V97 A;  3Q3J A;  1ROE A;  2J4X A;  4MH0 E;  3Q8F A;  3Q6B A;  3RFZ B;  1GUA B;  3WA0 A;  5KHQ A;  3ZQ4 A;  1FXT B;  2L1A A;  1C4C A;  3PHX B;  3RNG C;  4LTU A;  2J0J A;  1JRU A;  1WGR A;  2W3R A;  4WJQ A;  4DK5 A;  2MBE A;  4BKG A;  2KN5 A;  4NAM A;  2MSE D;  2LUM A;  3TJP A;  2I2Y A;  4KIK B;  3NHE B;  4H2A A;  2K22 A;  3HVD A;  3AE9 B;  2MEK A;  2IGD A;  4JX1 C;  1KRH A;  1OFF A;  2V3S A;  2MWS B;  4B9K A;  2JT4 B;  4GDL B;  3AN1 A;  1IGC A;  1XF5 L;  3WAN A;  1Y8R C;  2XK5 B;  2PE6 B;  2KNB A;  4M0W B;  2B76 B;  4MSQ B;  2NBU A;  3L10 B;  3KW5 B;  1PYW D;  1L2N A;  4M8M A;  2A4Z A;  4KGS A;  4US8 A;  3S2A A;  1JQ4 A;  1OTR B;  2BYE A;  3QC8 B;  1OEY J;  3UF8 A;  3AU5 A;  4DDG D;  3NS1 A;  2CJO A;  3IAS 1;  5FK9 C;  4WJO A;  2V9H A;  2N0S B;  3OWE B;  3LJ3 A;  3LB8 C;  1FNW A;  3AE1 B;  4A8X C;  4KX6 B;  4CYE A;  3EFU A;  1MVK A;  2GLS A;  2BWE S;  3WAL A;  2DZK A;  2KJR A;  3PPA A;  5G5H A;  2V0G A;  2DZM A;  4CO7 A;  4PS7 A;  1JWB D;  2IYD B;  2KDM A;  3JSV B;  4ZRJ A;  1A5R A;  3BYT B;  3ML8 A;  3AE7 B;  1E8W A;  3H7P B;  3SFE B;  3PRM B;  1EM7 A;  1E8X A;  3BII D;  3DVG Y;  2M4N A;  3KUC B;  3O65 B;  4WWN A;  2WXR A;  3FIL B;  4RGM A;  1D4B A;  1E6E B;  1LXD A;  2OHF A;  2BW2 A;  1UZX B;  1XEE A;  2N1W A;  3LDZ E;  2ZEQ A;  2G3Q B;  3L08 A;  4F7Z A;  3HRD D;  4TSS A;  2ZNV B;  1HEZ E;  2PTL A;  2AL6 A;  1ET9 A;  1NDD A;  2CHW A;  2LWP A;  5L95 C;  1N63 A;  4B6W A;  4BFR A;  1RFA A;  4IOI E;  2UU7 A;  4KIK A;  2WXL A;  4B0E A;  4A6Q A;  2EEL A;  2KT7 A;  4C4V A;  3GP7 A;  1R4N B;  3A9K B;  3R2T A;  1NI2 A;  1EWY C;  4M0W A;  1ZDV A;  3KH0 A;  2J53 A;  1JRO A;  1C76 A;  1RM6 C;  1KLV A;  5BMI A;  5T8I A;  3RNB C;  2LRW A;  2ZPN A;  1MFW A;  3MP9 A;  2JRI B;  1ZDX A;  2RPV A;  2N9P C;  2KC2 A;  4MGZ E;  1E0Z A;  2KZR A;  2RDB C;  2JPH A;  3RD2 A;  1ZP0 B;  5D7G A;  3OJ4 B;  3MC9 A;  5D6J B;  3RNF C;  4RF0 A;  1IP9 A;  1Q5W B;  1VCB A;  4IW0 A;  4RM8 A;  1GNU A;  5CHW A;  4KGT A;  2PE9 A;  2OOB B;  2CS4 A;  4ARI A;  4FUL A;  3EFC A;  1C9F A;  2R2O A;  1WSP A;  1TTN A;  1T0Y A;  1YN4 A;  2ZPY A;  3AEG B;  2KLC A;  2MP2 B;  2D5G A;  3JSV A;  3Q3F A;  3MJ5 A;  2W54 A;  3CST A;  2DLB A;  3NRZ A;  2KAC A;  1P1A A;  4ACF A;  4EEW A;  4WJP A;  1JML A;  1TS4 A;  3PZD A;  2L00 B;  2QSD A;  2FIF A;  4N9F 4;  5AEK B;  1LM8 B;  3TMP B;  2KQS A;  4WAF A;  2LXA A;  2K6D B;  1BT0 A;  4J3O D;  3WAM A;  3Q8A A;  3AUL A;  1TBE A;  2INC C;  1EF5 A;  1V86 A;  2EMS A;  2IZV B;  3Q8E A;  2FCN A;  2LGX A;  2OJW A;  2DAJ A;  4MDK E;  3VQI A;  3AE6 B;  2DZJ A;  1B1Z A;  3QAQ A;  2MLB A;  5D3D A;  4NQL B;  1WWT A;  3A1Q A;  4MJS B;  3Q69 A;  1DYQ A;  5J2R A;  3U52 E;  4L1B A;  3DVN V;  2N4F A;  3AE4 B;  3EUB 2;  2B3A A;  3I57 A;  1SE4 A;  2DHZ A;  1I7H A;  2HTM E;  5IA7 A;  2VZK B;  2HTH A;  1E8Y A;  2MJE A;  4W9C A;  1UGM A;  3PT2 B;  2BTE A;  3A9K A;  4HRS A;  1YIW A;  1FCL A;  2JU6 X;  1HTO A;  1DOX A;  1GAQ B;  4PT5 A;  3LXF A;  5HHD G;  1YJ1 A;  1XLO A;  1B9R A;  2PVG C;  1DGJ A;  1DOI A;  3DQV A;  1WM3 A;  2V3N A;  1ZUD 2;  3SEB A;  1QOB A;  2LD9 A;  1WF9 A;  1WJ6 A;  1SXT A;  1OGW A;  3AH7 A;  1TYG B;  1FIQ A;  1NBF C;  2K1F A;  5AUK A;  2FUH B;  2D11 A;  3ZLZ A;  3N20 C;  1T0Q C;  2JWU A;  3ONS A;  2K25 A;  1FFU A;  2EMT A;  1V49 A;  5DPR A;  4AJW A;  3B9J A;  3U8Z A;  2FAZ A;  3NOB A;  3GZN I;  3AM9 A;  3PLU A;  3VH4 B;  2ZVN A;  3APC A;  2MP2 A;  2WXM A;  2WU5 B;  1KH0 A;  2KK8 A;  2VRR B;  3DWG C;  3FKY A;  1AYF A;  4FHJ A;  2LGD A;  2GBN A;  3ML9 A;  1I35 A;  4L2Y A;  1K53 A;  3ETR A;  3ZNH B;  1ZE3 D;  2KTF A;  1JCK B;  2LAS A;  3IAM 1;  1ISN A;  2BB5 A;  1HZ5 A;  4K7S A;  2L52 A;  1UUP A;  2DYO A;  5C1Z A;  1VR9 A;  4W9K A;  2M17 A;  4AWJ A;  5LXH A;  2WXI A;  5HKH A;  5EE0 A;  4YTN B;  1GC6 A;  2KMM A;  4FAD A;  3HVZ A;  3KWV A;  3QA8 A;  4S17 A;  4DHJ D;  4HWI B;  3U4E G;  4FJV B;  2KO3 A;  2MJ3 A;  4G11 A;  2O6V B;  4MJS A;  1GB1 A;  3TEX A;  3TEW A;  1S1Q B;  3AE5 B;  2AQ2 B;  1SE9 A;  1L5P A;  2UYZ B;  1WXQ A;  1FMA D;  2BS3 B;  4C56 C;  2C9W B;  4GN1 A;  4LDT B;  3EGR A;  1FO4 A;  3OLM D;  1XCQ L;  1C4P A;  4PK1 A;  2IO1 B;  3PGE A;  4LNN A;  4TUU A;  2PMV A;  4HEA 1;  2CU3 A;  5DPW A;  3IG3 A;  4A3O A;  4RCO A;  3VUX A;  3VVW B;  1OQR A;  5IO9 A;  2BKF A;  5KHO A;  2IGG A;  2BYT A;  2WXH A;  5IOI A;  2WLB A;  4ZRP A;  1QQR A;  3N1Y C;  5BMG A;  4NY0 A;  4HJG E;  4BZA A;  2JXX A;  3U7Z A;  3ZKJ C;  1VRA B;  3QJZ A;  2QHO A;  3FAH A;  2JVC A;  2BPS A;  1R4M I;  1YMH E;  4HKQ A;  3SDL C;  2NS5 A;  1V80 A;  4KDL B;  1K8R B;  1MPE A;  3I5J C;  2MRP A;  2IDY A;  2ONQ A;  1FCC C;  2RDG A;  2KDF B;  2NPT B;  4YSY B;  5AZH A;  2ON8 A;  2NCN A;  2KFK A;  2L3Z A;  2NBW B;  2O2V A;  1MI0 A;  2QC8 A;  1K50 A;  1FRR A;  4RNA A;  2Z0D B;  3DCG A;  3RUL A;  2K8H A;  3X23 A;  1V1P B;  3AEA B;  2ZW0 A;  3CWI A;  4HJK A;  4II3 B;  3ZXV A;  2MCN B;  2FCM A;  3QWZ B;  5BMH A;  5AZG A;  3ZJT A;  1T6B X;  1FPY A;  1AAR A;  3U2S C;  2C60 A;  1EUV B;  3DHI C;  3ZXR A;  1D5X C;  5BYS A;  4MSM B;  1Y56 A;  2FID A;  3WCQ A;  1STE A;  1CK1 A;  3NJT A;  2GBR A;  3N30 A;  2ZVO A;  1JWA D;  1RWS A;  1T5X D;  3GE3 C;  1F9J A;  2JYT A;  1WXA A;  3H9D A;  3AE8 B;  2IJ0 A;  3UIN B;  4PYZ A;  1E9M A;  2LI5 A;  3D32 A;  1WE7 A;  4C00 A;  5LNK 1;  2KX0 A;  1TGZ B;  1WYG A;  2KKC A;  1PQS A;  3ECI A;  2WXJ A;  4OVU A;  5GMV A;  2V1Y A;  3P4Q B;  3AEC B;  1KFY B;  1HQR D;  1WR1 A;  2MQJ A;  4X57 B;  4ZYS A;  2JWZ A;  3PHW B;  5C2T B;  1Q0W B;  4RGT A;  4REZ A;  4MH8 A;  4GU2 A;  4M02 A;  1KOT A;  4ZRK A;  2WHI A;  2KLG A;  1PGX A;  4EUT A;  3TUO A;  4HK2 A;  3KVF B;  1N5W A;  3O13 A;  3QK0 A;  3FC4 A;  4OVZ A;  3AXC A;  1QOG A;  4JL9 A;  3URY A;  2MBH A;  1MHH E;  1UEL A;  4EOY A;  4HCN B;  2WXO A;  1N61 A;  4KZC A;  1XCT L;  4NNJ B;  2AX5 A;  3JW0 X;  1SIJ A;  3V61 A;  1ZOY B;  2GRI A;  1T3Q A;  3VTU A;  1VZ7 A;  2K39 A;  1QKZ A;  1D6E C;  2MH7 A;  3I63 C;  1WX7 A;  4JIO U;  5E6P A;  1F2R C;  1JWM D;  5JH5 C;  3PZ8 A;  4G3X B;  2AQ1 B;  5JHA A;  4ANW A;  3RPF C;  2N9L A;  1L6V A;  2D3B A;  3SR6 A;  3Q14 C;  4HPL B;  4GIV A;  3R7Q A;  2V4I B;  5AZF A;  1NI3 A;  1Z5S B;  4D2K A;  2JSV X;  3B2F A;  3HM3 A;  3QIJ A;  4ZRI A;  3ZIM A;  2LMC A;  4W9J A;  2KOX A;  2C7M B;  4A90 A;  1YN5 A;  2HJ8 A;  4IUM B;  1V9J A;  4AQ7 A;  5CTR C;  1NVI D;  2IGH A;  4GDK A;  4IDI A;  5E6N A;  2BQQ A;  4NZL B;  3VR9 B;  2YEP F;  1M4V A;  2Y3A A;  2DEN B;  4WJN A;  3DBR I;  4GLS C;  2K9X A;  3AB5 A;  1QT9 A;  4YSX B;  1FFV A;  4W9I A;  3UGB B;  3H1U A;  4C7Z A;  3CSF A;  3SFD B;  4XWW A;  1PGB A;  2G9H D;  1DOY A;  4N6E B;  4EZJ A;  2BYF A;  3DWM A;  3W1Y A;  4HDO A;  1P9D U;  2J0M A;  3DOW A;  1SSN A;  4NPN A;  1TJE A;  2I38 A;  4QAY A;  2DYM A;  2WYQ A;  2N7J A;  3C0R B;  1WRI A;  3W9C B;  2WXP A;  4ANV A;  4RGN A;  5BO4 B;  4GDL A;  2XK5 A;  2MJD A;  4J6I A;  2GMI C;  3LYY A;  4OZB A;  3P4S B;  3IVF A;  2J0K A;  3ALB A;  4K81 A;  2W82 A;  3DBH I;  2OJR A;  4FN2 A;  2D2Q A;  1E90 A;  3KUD B;  4AJY B;  3Q8C A;  3RYT A;  3DBH B;  4EE2 A;  1NYR A;  2KTR B;  2YLM A;  2L0T A;  5J18 A;  2J52 A;  3ZGZ A;  1WGY A;  2IO3 B;  2FCQ A;  2PJH A;  1C1Y B;  4JLC A;  2N7D A;  1YOV B;  4KSL C;  5DPS A;  4ZHO A;  2KDB A;  1YQB A;  1VLB A;  2AQ3 B;  2LZ6 A;  3IXS A;  4RFB A;  2KWC A;  2M19 A;  1I4G A;  1SGH A;  1S3S G;  2M1M A;  1VDV A;  3MHZ A;  4BOZ B;  1XT9 B;  3PVL A;  3QX1 A;  1EU4 A;  3NY5 A;  1K52 A;  4E71 A;  4HKZ E;  3NVY A;  3EEC A;  1SJH D;  3E56 A;  4NAW B;  2QDF A;  2G4D B;  1MG8 A;  1I4P A;  3EC8 A;  2ZNV C;  2JZ3 B;  4EZK A;  4N59 A;  1SBB B;  3UIP B;  3H7P A;  3Q3O C;  3ZW3 A;  2XBB C;  1ZKH A;  4P16 A;  1WXS A;  3FIL A;  2KMA A;  3B0A A;  2BT6 A;  2Z8L A;  5G5G A;  1WJN A;  3VH3 B;  4YXD B;  1VD2 A;  2N9E B;  3UI3 A;  3DDC B;  2ACZ B;  4ICV A;  3ZNI D;  1ACC A;  4IWO A;  3IFW B;  4GXB A;  1P7F A;  1TS2 A;  4PYU A;  3RNC C;  3AU4 A;  4LDT D;  1AW7 A;  1YN3 A;  1ESF A;  1JW9 D;  1KLU D;  3PLV A;  4FHK A;  3ZYY X;  2GBK A;  4HPP A;  2KWD A;  3DPD A;  4E3C A;  3V05 A;  2MW5 A;  4DWF A;  2BVC A;  4UDU C;  2L32 A;  4WIP A;  2C7H A;  5J17 A;  2L8J A;  2JRH A;  4ZHP A;  4FJY A;  1HA5 A;  1C79 A;  2BGF A;  2LRU A;  4BKS A;  3NVW A;  1UNS A;  2KTR A;  2N9X A;  4S0R A;  2JZP A;  2WXF A;  2LHD A;  3NZ3 A;  4WQM A;  2EKI A;  4XE0 A;  4WQO B;  1PUT A;  1ZGU B;  1WX9 A;  4RMA A;  4ARC A;  4GB9 A;  2WXN A;  3ABV B;  3KYD D;  3MFG A;  3TL5 A;  2VH2 A;  4USA A;  4LNO A;  5BYR A;  4WH4 A;  1GC7 A;  4XC2 A;  2KAJ A;  4LLG M;  2RD0 A;  4M01 A;  1WXV A;  5E6J A;  3T8M A;  2I1K A;  2LUE A;  2ZJD A;  4KV2 A;  4A9A A;  3T3O A;  4NAW A;  4OVV A;  3BVM A;  3CF6 E;  3GZN B;  4IM2 A;  3RUI B;  3PRZ A;  4P7I A;  2JQR B;  1R7S A;  1UBQ A;  1V6E A;  2L76 A;  5CHF A;  1F52 A;  1LO5 D;  1WH3 A;  3TSS A;  2MBO A;  4DXF A;  3VTV A;  5L83 A;  3KYC D;  1FD6 A;  2CKH B;  2WXK A;  3H6N A;  4YSZ B;  3RN9 C;  3VRA B;  1J7B A;  5G55 A;  2GB1 A;  3QCA A;  2LGI A;  4BOS C;  3V60 A;  1GPX A;  1N6Z A;  4KKJ A;  1E7V A;  3E9S A;  4M8N A;  4YWG G;  3L4P A;  1D5M C;  2N9K A;  3J9C A;  5C3J B;  3GOE A;  1T0R C;  1H4R A;  2ZCC A;  4KDI C;  1FRD A;  4F8C B;  4HRO A;  1VZ8 A;  2FE8 A;  2JY6 A;  1OEY A;  1YX5 B;  3I3T B;  3PV1 A;  1BXT A;  1QZE A;  5D2M B;  1RAX A;  2I1J A;  5IN7 A;  1YQ4 B;  4C7Y A;  1WGD A;  4MEM A;  2CHX A;  3TIX A;  5FR3 A;  4AP4 C;  1F0Z A;  1IBX B;  3W5V B;  4ZRQ A;  4IG7 B;  4Q2J A;  3KUZ A;  1IGD A;  3JYU A;  1H8C A;  3OAW A;  3DBL I;  1RRB A;  1WIA A;  1HZ6 A;  3TCA A;  2INN E;  3AE3 B;  3ZVV A;  1WJU A;  3TBL D;  2KC1 A;  3AV8 A;  2WDT B;  3ZRF A;  2Q5W D;  5LXI B;  2LJ5 A;  4TKN A;  1V81 A;  3ZTD A;  3DVG X;  3B2G A;  3VUY A;  5JHB A;  4B95 A;  1YNT E;  3KLS X;  1RYJ A;  2Y5P A;  2D3A A;  1QF6 A;  3VUW A;  1Q10 A;  1LGR A;  1PFD A;  2WX0 A;  1HE8 A;  1I4H A;  5IAA C;  3CMM B;  1L7Y A;  1R4M B;  2RPQ A;  2BF8 B;  1N60 A;  3R7R A;  3RNA C;  5LLI A;  1UBI A;  2KVZ A;  4A3P A;  4HXD A;  2KD0 A;  1QLB B;  1SE3 A;  2KN4 A;  1WX8 A;  3P2B A;  2M0X A;  2M56 B;  3PTF C;  4XYC A;  2AWT A;  3T3N A;  3MHS D;  5I4D A;  3U30 A;  2NTS A;  4OW0 A;  1FEH A;  5HI1 A;  1P3Q U;  2VH1 A;  3A4R A;  2PLP A;  4XX5 A;  3ZNZ B;  5E6O A;  2WP9 B;  1AWD A;  4YTP B;  4TQ1 A;  4ZYN A;  1I4X A;  3P4P B;  1SIF A;  1EWC A;  3SHQ A;  5HFY A;  5IKC M;  4WWP A;  3K9O B;  3BVZ A;  2GBM A;  1J7C A;  1FM0 D;  2R2Q A;  4MM3 B;  3B1L X;  4K3C A;  4NJ7 A;  2O6V A;  3ZJU A;  4F1S A;  1WM2 A;  2KYW A;  5GXG B;  3L16 A;  2KVR A;  3V6E B;  1WFY A;  4I6L B;  5H8Y E;  1TIF A;  3QAR A;  4KSK C;  2ICI A;  2K6Q A;  4C80 A;  3AED B;  4OHJ A;  2IY0 B;  4L23 A;  3IBE A;  2NBV B;  3GB1 A;  3N9Y C;  1CQV A;  1PDX A;  2M0A A;  3GS2 A;  4ASW C;  2MX2 A;  4JGH B;  4DHJ B;  3RI7 C;  3A9J B;  1F2R I;  4MEL A;  1YJI A;  4LNI A;  3MJW A;  2ZZP B;  1WGH A;  2LVO A;  3M95 A;  3PZ7 A;  1MHX A;  4HCP B;  1FNV A;  1F77 A;  1YD8 U;  3HUI A;  1IYF A;  2BB6 A;  2PPH A;  1WGK A;  4BKS D;  5D3I B;  1C3T A;  2FBW B;  4IC7 B;  3W1S A;  1GB4 A;  3P1M A;  2A5U A;  5IP4 D;  2Z0E B;  3V62 A;  1WI0 A;  4DXA B;  4ANU A;  3ENE A;  4C4V B;  2JXT A;  1E8Z A;  1ZXH A;  2KFJ A;  2WDV B;  2PEA A;  4OZA A;  2L83 A;  2QIL A;  1UWX A;  2RR9 A;  2NPT A;  2DX5 B;  3SU8 X;  2H89 B;  3P63 A;  3VTW A;  4M00 A;  2BS2 B;  1SF0 A;  3L54 A;  3L17 A;  4LJO B;  1JRP A;  4NJ6 A;  3B08 A;  2REX A;  2Y5C A;  1NEN B;  4TMA B;  4N58 A;  4HLE A;  4FXC A;  1V1P A;  2KX3 A;  4URK A;  3HK0 A;  5HG2 A;  3Q3M C;  3BYY B;  1HXY D;  4JWS C;  5D94 A;  3IHP C;  2JYE A;  3MC8 A;  4US9 A;  4MAC A;  1WZ0 A;  4MGY E;  4DQO C;  1L4Z B;  3V3X A;  2C7N B;  4FA6 A;  2X8X X;  4K7U A;  5MPO A;  1I4Q A;  2DWQ A;  2WS3 B;  3NS8 A;  4MM3 A;  3U7D A;  5EDS A;  1TKY A;  1XLP A;  5BYQ A;  4FBJ B;  3ZUN A;  3AMZ A;  3ZDM C;  2KJ6 A;  2WDQ B;  1Q1O A;  5EE3 A;  3AEE B;  2NR2 A;  5G2N A;  4EKU A;  2WU2 B;  3MTN B;  3BK1 A;  4BAX A;  5AUI A;  1P0R A;  5H92 C;  2JZZ A;  3BZD B;  3JVZ X;  4XGA B;  2WNM A;  3EA6 A;  1TS5 A;  3PRP B;  2HJ1 A;  2V3P A;  4O1N A;  1RFK A;  1WXM A;  2E3T A;  2MBQ A;  4P6V F;  4HVB A;  3DBR B;  4HDQ A;  4DXG A;  3A9J A;  4R3D A;  2K8C A;  2MBB B;  1WRD B;  3A33 B;  4CHK A;  2PW9 A;  1TKE A;  3APF A;  3M3J A;  4XDC A;  2JF5 A;  2LGY A;  2K8B A;  2VZK D;  2N7E A;  1UWM A;  2PVO D;  2WGS A;  4BBN C;  2LFI A;  1N62 A;  3HHM A;  1VZ6 A;  1KTK A;  1J8C A;  4EFO A;  3PRE A;  2GI9 A;  2XNA C;  2KDI A;  3R3M A;  3BY4 B;  2BBC A;  1Z2M A;  1WYW B;  3VR8 B;  3PS6 A;  3CIR B;  1ENF A;  3A1Q B;  1OQY A;  1XXG A;  1ZXI A;  1V8C A;  4LNF A;  1XO3 A;  3AEF B;  2KXJ A;  1E7P B;  2QEJ C;  1R4N I;  2L05 A;  1WZ3 A;  3W2D A;  2IY1 B;  1J7A A;  4BKT A;  2FCS A;  2L0F A;  1CMX B;  1TZ1 A;  2RGF A;  2C5L C;  2FNJ B;  1L0X B;  3V6C B;  1TS3 A;  2BYV E;  5FKA C;  2NVU I;  3ZNG C;  4GMV A;  4XWT A;  2WDR B;  4KKI A;  2DAF A;  3NVZ A;  4W9H A;  1WJ4 A;  1CZP A;  4ICU A;  2WXQ A;  2DYB A;  4W9G A; 
#chains in the Genus database with same CATH homology
 1OTR B;  2BYE A;  2XEW A;  3SDL C;  1P98 A;  3QC8 B;  1OEY J;  2NS5 A;  1GC7 A;  4XC2 A;  3UF8 A;  1V80 A;  3AU5 A;  4KDL B;  1K8R B;  2HE7 A;  2RD0 A;  3T8M A;  1WXV A;  2I1K A;  2LUE A;  2ZJD A;  4KV2 A;  2MRP A;  3VFK A;  4DDG D;  2GOW A;  4NAW A;  2KJH B;  3CF6 E;  4OVV A;  2KDF B;  2NPT B;  4KVG B;  4WJO A;  4BVU C;  3LJ3 A;  4IM2 A;  3RUI B;  3PRZ A;  4P7I A;  5AZH A;  2NCN A;  2CHZ A;  2KFK A;  2L3Z A;  1UBQ A;  1V6E A;  2NBW B;  2L76 A;  2O2V A;  4EZL A;  5CHF A;  1WH3 A;  4CYE A;  3EFU A;  4G0N B;  2MBO A;  2Z0D B;  2BWE S;  3DCG A;  3WAL A;  3RUL A;  3VTV A;  5L83 A;  2AL3 A;  2K8H A;  3X23 A;  1X1M A;  3KYC D;  2DZK A;  4HJK A;  4II3 B;  2KJR A;  4MGK E;  2MCN B;  2FCM A;  2CKH B;  3PPA A;  3QWZ B;  3H6N A;  5AZG A;  2DZM A;  5G55 A;  4CO7 A;  4PS7 A;  3QCA A;  2IYD B;  3ZRC A;  4BOS C;  3V60 A;  3JSV B;  2GBJ A;  4ZRJ A;  1A5R A;  1E7V A;  4M8N A;  3ML8 A;  1AAR A;  1E8W A;  1WMH B;  2C60 A;  3H7P B;  3UIO B;  2MA9 B;  1EUV B;  4PS8 A;  3PRM B;  1E8X A;  3GOE A;  3X0W A;  3HIZ A;  3DVG Y;  2M4N A;  2O6V D;  3KUC B;  3O65 B;  4MSM B;  2FID A;  4WWN A;  2ZCC A;  1H4R A;  3H7S A;  1LXD A;  3NZS A;  4KDI C;  1UZX B;  1KM7 A;  1UD7 A;  2N1W A;  2GBR A;  3LDZ E;  3N30 A;  2ZVO A;  4F8C B;  2ZEQ A;  2G3Q B;  2JY6 A;  1OEY A;  1F9J A;  1YX5 B;  3I3T B;  3PV1 A;  3L08 A;  1WXA A;  1QZE A;  5D2M B;  3H9D A;  3WIM A;  4F7Z A;  1RAX A;  2I1J A;  3ZO5 B;  1WGD A;  4MEM A;  2CHX A;  3TIX A;  4AP4 C;  2ZNV B;  3UIN B;  4PYZ A;  2LI5 A;  3D32 A;  2AL6 A;  1WE7 A;  3QQ8 B;  4IG7 B;  1NDD A;  2CHW A;  2LWP A;  3M62 B;  5L95 C;  3KUZ A;  1U4A A;  2ZCB A;  3JYU A;  4B6W A;  4BFR A;  1RFA A;  2KX0 A;  1H8C A;  1TGZ B;  3OAW A;  4KIK A;  3DBL I;  2KKC A;  2W9N A;  1RRB A;  1PQS A;  4AUQ C;  1WIA A;  3ECI A;  1J19 A;  3K9P B;  3TCA A;  4OVU A;  3ZVV A;  4K1R B;  5GMV A;  1WJU A;  2V1Y A;  4LJP B;  3TBL D;  2KC1 A;  1KJT A;  1WR1 A;  2MQJ A;  4X57 B;  2WDT B;  3ZRF A;  1I42 A;  2UWQ A;  4I6P A;  4JQW C;  4FLH A;  2JWZ A;  5LXI B;  2LJ5 A;  3PHW B;  4TKN A;  2RSU A;  1V81 A;  3ZTD A;  3DVG X;  3A9K B;  1Q0W B;  1NI2 A;  3VUY A;  3APD A;  1GG3 A;  1V2Y A;  5JHB A;  4B95 A;  4GU2 A;  2AEH A;  1WE6 A;  3KH0 A;  1KOT A;  4ZRK A;  1KLV A;  1GJZ A;  3VUW A;  2WX0 A;  4W9L A;  2KLG A;  4WAA A;  4EUT A;  1HE8 A;  2LRW A;  2J7Q B;  4NQK E;  2ZPN A;  1E5W A;  3RT3 B;  3RZF A;  4HK2 A;  2WWZ A;  2JRI B;  2WX1 A;  5IAA C;  3CMM B;  3KVF B;  2N9P C;  2KC2 A;  1M94 A;  4MGZ E;  3QK0 A;  1L7Y A;  2RPQ A;  2KZR A;  3AXC A;  2JPH A;  3RD2 A;  2BF8 B;  4JL9 A;  5D7G A;  3R7R A;  2MBH A;  5LLI A;  1UBI A;  1UEL A;  4EOY A;  4HCN B;  3UQA A;  3OJ4 B;  4A3P A;  2KAN A;  4KZC A;  4HXD A;  5D6J B;  4I6N B;  2KD0 A;  4NNJ B;  3V61 A;  3JW0 X;  1IP9 A;  1Q5W B;  1WX8 A;  3P2B A;  2M0X A;  1VCB A;  4IW0 A;  4RM8 A;  3RCZ A;  3PTF C;  1GNU A;  1YX6 B;  2AWT A;  5CHW A;  4YL8 A;  4A20 A;  2PE9 A;  5TR5 A;  2OOB B;  3MHS D;  3VTU A;  2G4S A;  2CS4 A;  3U30 A;  2K39 A;  4E74 A;  4FUL A;  1P3Q U;  3PSE B;  2Z59 B;  3A4R A;  2BWF A;  2R2O A;  1TTN A;  5E6P A;  1WX7 A;  4JIO U;  4XX5 A;  1T0Y A;  3ZNZ B;  5E6O A;  2ZPY A;  5JH5 C;  2KDE B;  4G3X B;  5JZE B;  4MGI E;  5JHA A;  2KLC A;  2MP2 B;  4TQ1 A;  4ZYN A;  4ANW A;  3VDZ A;  4GSW A;  5CHV C;  3JSV A;  2N1V A;  3M63 B;  4HPL B;  3Q3F A;  4GIV A;  1SIF A;  3R7Q A;  3SHQ A;  2KFK B;  4WWP A;  2O2V B;  2LVP A;  1WMH A;  3CST A;  3K9O B;  4DBG A;  5AZF A;  1Z5S B;  2GBM A;  1P1A A;  2HD5 B;  4EEW A;  3HM3 A;  4WJP A;  3QIJ A;  4ZRI A;  3PZD A;  2L00 B;  2R2Q A;  2FIF A;  4FJZ A;  3ZIM A;  3B1L X;  5C23 A;  4NJ7 A;  4W9J A;  4N9F 4;  1WR6 E;  2D10 A;  1LM8 B;  2KOX A;  2C7M B;  5AEK B;  3TMP B;  2HJ8 A;  1XD3 B;  4IUM B;  1EF1 A;  2KQS A;  2LXA A;  1V9J A;  1BT0 A;  2K6D B;  2O6V A;  5CTR C;  3WAM A;  1WM2 A;  2IBI B;  4DDI D;  4F1S A;  3AUL A;  4BBN F;  2EKE C;  1TBE A;  4GDK A;  3L16 A;  2KVR A;  3R66 C;  1EF5 A;  3V6E B;  3ZDT A;  5E6N A;  1WFY A;  2LVQ A;  1V86 A;  2EMS A;  2LXC A;  4I6L B;  1J0G A;  2IZV B;  3QAR A;  4KSK C;  2CR5 A;  2FCN A;  3VHT C;  2K6Q A;  2DEN B;  2LGX A;  4WJN A;  3DBR I;  2IY0 B;  2DAJ A;  3IBE A;  1LFD A;  2NBV B;  4MDK E;  3VQI A;  4KZ0 A;  4W9I A;  2DZJ A;  3UGB B;  3H1U A;  3QAQ A;  4ASW C;  2MX2 A;  3HM6 X;  2MLB A;  4JGH B;  3CSF A;  3DVN U;  4DHJ B;  3A9J B;  3WAO A;  4MEL A;  4NQL B;  1WGG A;  3A1Q A;  4MJS B;  3QHT A;  4GGQ A;  2L7R A;  3MJW A;  5J2R A;  4EZJ A;  2BYF A;  2ZZP B;  3DVN V;  2N4F A;  1WGH A;  3W1Y A;  4HDO A;  2B3A A;  2LVO A;  2KWV B;  2KHW B;  1P9D U;  2J0M A;  3DOW A;  2DHZ A;  3M95 A;  5IA7 A;  4W9D A;  4NPN A;  4W9F A;  2DYM A;  1E8Y A;  2HTH A;  4HCP B;  2WYQ A;  4W9C A;  1UGM A;  3C0R B;  3PT2 B;  4XZ4 A;  4GOC A;  3A9K A;  4ANV A;  5BO4 B;  1YIW A;  4GDL A;  1YD8 U;  1IYF A;  2XK5 A;  4J6I A;  2GMI C;  4PS3 A;  4W9E A;  2PPH A;  3IVF A;  2J0K A;  3ALB A;  4TV3 A;  1YJ1 A;  4K81 A;  4BKS D;  1C3T A;  3DBH I;  2OJR A;  1D3Z A;  4IC7 B;  3W1S A;  4RM9 A;  4LCD E;  4FN2 A;  2D2Q A;  1E90 A;  3DQV A;  3KUD B;  4WWO A;  2A5U A;  4AJY B;  2Z0E B;  1WM3 A;  3RYT A;  3DBS A;  1WI0 A;  3V62 A;  4DXA B;  4ANU A;  5FR6 A;  3ENE A;  2KTR B;  2YLM A;  2AYO B;  2L0T A;  5J18 A;  1WGY A;  2IO3 B;  2FCQ A;  2LD9 A;  1E8Z A;  1WF9 A;  1WJ6 A;  2M8S A;  2KFJ A;  2PJH A;  1C1Y B;  2IO0 B;  2IO2 B;  2JUO A;  1OGW A;  2PEA A;  3N3K B;  2N7D A;  4JLC A;  4KSL C;  5DPS A;  1NBF C;  2K1F A;  2YVC A;  2RR9 A;  2KDB A;  1YQB A;  2FUH B;  2D11 A;  2LZ6 A;  3ZLZ A;  2NPT A;  2DX5 B;  1UH6 A;  2DZI A;  3NZU A;  3SU8 X;  4AOF A;  3VTW A;  2KWC A;  3ONS A;  1SGH A;  2K25 A;  3L54 A;  1S3S G;  3L17 A;  1IPG A;  2CU1 A;  2EMT A;  4LJO B;  2M1M A;  4NJ6 A;  1V49 A;  4II2 B;  3B08 A;  3VAW A;  2REX A;  4BOZ B;  2Y5B B;  5DPR A;  1XT9 B;  3PVL A;  3L13 A;  3QX1 A;  1V5O A;  4G50 A;  1EO6 A;  3NY5 A;  4AJW A;  3U8Z A;  2FAZ A;  2KMC A;  2KX3 A;  4E71 A;  4HLE A;  3NOB A;  4URK A;  3HK0 A;  3GZN I;  2KQ7 A;  3EEC A;  3PLU A;  3VH4 B;  2ZVN A;  3APC A;  2D07 B;  2MP2 A;  4NAW B;  2G4D B;  1MG8 A;  1XQQ A;  1ZW7 A;  5DPT A;  1E7U A;  5D94 A;  3IHP C;  3EC8 A;  2KK8 A;  2VRR B;  2ZNV C;  2G45 B;  2JZ3 B;  4FHJ A;  4EZK A;  3EHV A;  2LGD A;  2GBN A;  3ML9 A;  1I35 A;  1WZ0 A;  4MGY E;  3UIP B;  3H7P A;  2C7N B;  4FA6 A;  3ZW3 A;  3ZNH B;  4HPM B;  2XBB C;  4K7U A;  2KTF A;  4MM3 A;  1ZKH A;  2V4L A;  3NS8 A;  2LAS A;  3U7D A;  1ISN A;  5EDS A;  1WXS A;  4FBJ B;  3ZUN A;  4ZDV A;  4IWQ A;  3ZDM C;  4K7S A;  2KJ6 A;  3BIN A;  4IM0 A;  1Q1O A;  4ANX A;  2KMA A;  3B0A A;  3ZTC A;  1RLF A;  2NR2 A;  5G2N A;  4EKU A;  3SD5 A;  1LQB A;  5CX3 A;  4TQ0 A;  2DYO A;  5C1Z A;  1V5T A;  3MTN B;  4W9K A;  2M17 A;  3AI5 A;  4AWJ A;  5LXH A;  5HKH A;  1WJN A;  1P0R A;  4IM3 A;  3VH3 B;  3VXW A;  2JZZ A;  3L0W B;  2KWU B;  1GC6 A;  1VD2 A;  1WY8 A;  2N9E B;  4FAD A;  2ASQ A;  1G6J A;  3WAP A;  3JVZ X;  3A4S C;  2D3G A;  3PRP B;  1WXM A;  3QA8 A;  4DHJ D;  2MBQ A;  2BKR B;  4HWI B;  4DHZ B;  4FJV B;  2KO3 A;  3DDC B;  4G11 A;  4HVB A;  3N32 A;  4HDQ A;  3A9J A;  4ICV A;  3W1S C;  2K8C A;  2O6V B;  4DHZ E;  3RZW C;  3ZNI D;  4MJS A;  5DCN A;  4IWO A;  3T9L A;  3IFW B;  3UQB A;  2MBB B;  1WRD B;  3A33 B;  4GDK B;  4GXB A;  4K7W A;  4CHK A;  3OJ3 A;  4IWP A;  4PYU A;  3Q3J A;  1S1Q B;  3APF A;  3M3J A;  4MH0 E;  2JF5 A;  1SE9 A;  2LGY A;  2K8B A;  2UYZ B;  2N7E A;  1GUA B;  3WA0 A;  3AU4 A;  5KHQ A;  1FXT B;  4LDT D;  4BBN C;  2C9W B;  3HHM A;  3PLV A;  1J8C A;  4FHK A;  3PHX B;  4EFO A;  2J0J A;  1JRU A;  1WGR A;  3PRE A;  4GN1 A;  2KDI A;  4LDT B;  2GBK A;  3OLM D;  4WJQ A;  3R3M A;  3BY4 B;  2MBE A;  4DK5 A;  1Z2M A;  4BKG A;  1WYW B;  3PS6 A;  3DPD A;  2IO1 B;  4E3C A;  2KN5 A;  3PGE A;  3A1Q B;  1OQY A;  4TUU A;  2MSE D;  2MW5 A;  3TJP A;  4DWF A;  4KIK B;  2C7H A;  3IG3 A;  5DPW A;  4A3O A;  5J17 A;  3VUX A;  2L8J A;  3NHE B;  2JRH A;  3VVW B;  4FJY A;  2KXJ A;  2BKF A;  2BGF A;  5KHO A;  2LRU A;  4BKS A;  1R4N I;  2L05 A;  1WZ3 A;  2V3S A;  2KTR A;  2N9X A;  2MWS B;  2IY1 B;  4B9K A;  4BKT A;  2FCS A;  2L0F A;  1CMX B;  1TZ1 A;  2JT4 B;  2RGF A;  2C5L C;  4GDL B;  2FNJ B;  4NY0 A;  3WAN A;  1Y8R C;  2XK5 B;  3V6C B;  2PE6 B;  2BYV E;  2KNB A;  4M0W B;  2JXX A;  2NVU I;  3ZNG C;  4MSQ B;  3ZKJ C;  3QJZ A;  4GMV A;  2QHO A;  2NBU A;  4WQO B;  1ZGU B;  1WX9 A;  2DAF A;  3L10 B;  4RMA A;  4W9H A;  1WJ4 A;  2JVC A;  2BPS A;  3KW5 B;  4GB9 A;  3KYD D;  1R4M I;  1L2N A;  3TL5 A;  4M8M A;  2A4Z A;  4ICU A;  2DYB A;  3S2A A;  4W9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...