1T5XD

Hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A Polymorphic Pocket at the P10 Position Contributes to Peptide Binding Specificity in Class II MHC Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 69
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1t5xD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1t5xD02
1GOZA 1KTKA 2IJ0A 1HXYD 5ELEA 3O13A 1YN5A 1PZKD 1BCPB 1STEA 1JR0D 1QILA 1AW7A 1TS2A 2QEJC 1HTLD 3CHBD 1B44D 4RFBA 5FKAC 1L0XB 1RCVD 1JWSD 1CK1A 1D5ZC 1PTOC 2G9HD 1SE3A 3TSSA 1LT3D 1LT5D 1TY0A 1V1OA 1YN3A 3BVMA 3BVZA 3BZDB 1EU4A 1UUPA 1M4VA 1BCPC 1V1PA 3EFXD 1JCKB 1EFID 1LTRD 4NZLB 1TS3A 1MD2D 4L6TB 2ICIA 2QILA 1LLRD 1PRTD 1LTBD 4OHJA 1RF2D 3MC0B 1D6EC 1L0YB 1EU3A 1ET9A 2O2LD 3SEBA 4RGMA 3R8BA 1LTTD 1FNUA 1SE4A 5I4DA 1EEID 1RDPD 4C56C 1I4PA 3EA6A 3DWPA 1SE2A 1EWCA 3W2DA 1LTGD 4ZYSA 5ELDA 1RD9D 1AN8A 2IPKD 1D5MC 1LTSD 3OWEB 1PRTF 1PZJD 1G8ZD 5ELCA 4RGTA 2XRQD 2NTSA 3KLSX 2WV6D 1SJHD 2AQ1B 2RDGA 1YN4A 2TSSA 4RHRA 2R61A 5TSSA 3DWQA 1LTAD 4RCOA 4RH6A 2XNAC 4DXFA 4RGNA 1XXGA 5D3IB 1EEFD 4UDUC 3R2IA 1LO5D 4L63B 1SJED 1LTID 1FD7D 1S5FD 1PRTB 1SEBD 3V05A 1LT4D 2AQ2B 1B1ZA 2XN9C 2Z8LA 5D3DA 1I4HA 1F77A 1HQRD 1CHQD 4RGOS 2SEBD 1I4GA 1FGBD 1JWUD 4BWGB 3DWAA 1CT1D 5ELBA 3MFGA 1BCPD 1T5XD 1UNSA 3BYYB 1BXTA 3BVGA 4TSSA 1DYQA 1PZID 2CHBD 2AQ3B 3GP7A 1PTOF 1I4XA 1SBBB 1XTCD 3URYA 1DJRD 1JQYD 2XRSD 1HA5A 1S5DD 2RDHA 1S5BD 1FNWA 1PRTC 1LT6D 2J4XA 1KLGD 1SXTA 4DXGA 1BCPF 1JWMD 1D5XC 1ESFA 1TS5A 1PTOD 1I4RA 1FNVA 3BYTB 4Z9CB 1ET6A 2NTTA 3R2TA 4O1NA 1TY2A 1PTOH 1V1PB 1TS4A 5ELFA 1PTOB 1CQVA 1CHPD 1S5CD 4RHSA 4K6LA 1KLUD 1S5ED 1ENFA 1PYWD 5FK9C 1I4QA
chains in the Genus database with same CATH superfamily
4MTNA 1UE5A 3L54A 1F2RI 1JRPA 3NXWA 5HY6A 2GBRA 4GSWA 1AW7A 4KKSA 2N9EB 2QEJC 4IUPA 2K4KA 5CR3A 3OWFA 5C23A 3K5OA 3BG3A 1FFVA 2E6XA 3MP9A 3Q3FA 4X65L 1YJNA 1IGCA 4B08A 1Y8OB 3E5SA 4FF4A 2V4IB 3WAOA 4DHZB 4DK5A 2QF7A 3WAPA 3A54A 1U9RA 2LY7A 2XBBC 4A3OA 4DN4M 3MA2B 2O5IC 3I4NH 1ACCA 3B2FA 4JI2Q 2FE8A 2ZVOA 2ON8A 1QT9A 3ETRA 2BH2A 2CU1A 4A3JB 2PPBC 3D31A 2DX5B 3A9JB 2Z0SA 4ZKCB 1HZ9A 2BE5D 1J7AA 3DHHC 2KCCA 4YCWA 1IYVA 3QHTA 1NMFA 2IW3A 2RA4A 5I2XA 4DR6L 2BA1A 1YHBA 2JA5G 2J53A 1HFNA 1K53A 1QZEA 1STAA 1Q1BA 1WI0A 3PO2G 3C46A 4A3CH 4GN1A 1CZGA 3LWUA 1PXUA 2PCFB 5ELDA 1SDFA 3RN5A 2R7ZB 3OMGA 2RSUA 1JOOA 1WWTA 5IYBG 2OCEA 1KH0A 2JXMB 3PCOB 4TRDA 1PZJD 3HOXG 4I6LB 1PHJA 2NB0A 1KL9A 2KC1A 2L7RA 2B3AA 4TQUS 2N9KA 2MGSA 1VCIA 2CCZA 1YJIA 1BQQT 4DXFA 4GLXA 4G3XB 1QVCA 3KDFB 4GN3B 4UDUC 4FJVB 3TUOA 2EKIA 3N32A 1FD7D 1GUAB 4C3IG 3DWMA 2ZTCA 2EE1A 1MHWC 1SEBD 1YBYA 3T1HQ 1JJGA 2F0HA 1SYGA 1IBLQ 3D4WA 1JMCA 1KJTA 2PW9A 1ONLA 2XWBB 4HJ7A 5DPTA 2KC2A 3IKJA 3K8AA 1FM0D 2UUBQ 4HPMB 1G51A 3M4YA 1YJWA 1ZYRC 4X64Q 1H9RA 4PMWA 2JU6X 2RMMA 1HNWQ 1O7LA 1WFQA 1HZ6A 5LMNQ 2PO4A 4B9XA 3MFGA 1V1QA 4DV2L 3N1YC 4MH0E 4KIKB 1SAPA 1WGKA 2RD0A 4JG2A 3D3RA 3OLMD 4ASWC 5LNK1 2K14A 4W9DA 3KYCD 3TL5A 1UZXB 1KDBA 5IGDA 4X66L 1KM7A 1Q10A 4KY5A 4GN4B 5D2MB 2L11A 1D1IA 4KKIA 2RCFA 3PO0A 1FNWA 5LHY1 1GUWA 4KHPQ 4FVMA 1DGSA 2KTRB 3OG5A 1MG8A 3RNAC 3BK1A 3VTVA 1DOKA 4NJCA 4H44C 4A3LH 3JSVB 5C3XA 2Y0SE 3A9KB 1HTQA 4LNKA 2N88A 1BO0A 3QOLA 4XGAB 4DXAB 3DUZA 2KJXA 2DBYA 2JA9A 3D32A 2DZMA 4CBVA 4KGRA 3SFDB 1L1OC 1HA6A 1IKLA 2IJ0A 2EY5A 2R7FA 2ZM6Q 3K0XA 3ZJVA 1WOCA 4HIOA 2A74C 2M8SA 4A3EG 4LF6L 3GTPB 2I1JA 3VR8B 3U9SA 4L23A 1E8XA 1VQCA 4DK1A 1YHQA 4LF4Q 2OOBB 4AYBE 1Q7YC 4US9A 1RCVD 3T3OA 1L1OA 2JE6I 3NP8A 5JJLA 2N78A 4DDID 1CK1A 2IX0A 5IGBA 1PTOC 2RKSA 3PTFC 1ZYRD 3A5UA 5HI1A 4D2KA 1K52A 3R7QA 3HFZB 1EY6A 3A55A 3TSSA 3MEFA 1LT3D 1A2UA 4PYUA 4O2DA 1WJNA 1E7PB 3LGJA 2QJLA 3GE3C 2PLPA 1NBWA 5FJ8G 2BF8B 2DHZA 1P8LA 3BZDB 1PH1A 4KKJA 1BCPC 2KYWA 5DM73 4MSQB 5CHVC 4NZLB 5HHDG 1HZ5A 1EY7A 4JI2L 1UBIA 1WFYA 3DVNV 2O4XA 2KFJA 4HPPA 1EQTA 4OGQC 2HDLA 3K58A 2JA6H 2LWPA 2QIEB 2VZKD 1PGXA 2PEAA 3I70A 3MVVA 1N8RC 3TEYA 2X69A 4ANVA 2HCCA 1EOVA 2YTXA 1VZ8A 4PMBA 1C8CA 5EE3A 4MDKE 2RSOA 1PH7A 4IKGA 3AMZA 1C3TA 2D0OA 5C4ZA 1T5EA 2JEAI 1LTSD 3P20A 5ISRA 3FILA 2JA5B 3I63C 3ZLZA 3RULA 4A90A 5K36G 5C4XB 4UAIA 3H6MA 1WRIA 4WORA 2KHIA 1FXTB 1P7EA 5BYSA 1SJHD 2EDGA 2V0GA 5D94A 2YU9B 2QCPX 2HE7A 1R4NI 2K03A 5JHBA 5JEAJ 4BY7G 2KFKA 2MRPA 1K8MA 3FKIG 1Y69U 4HMJA 1K3BC 2EIFA 5KIXA 4BXXH 1EY9A 3R2IA 2QKIC 1AFPA 1JOKA 4HSPA 1EZ6A 3HOWB 1R4PB 3J81E 2NYZD 3QIAA 2KKCA 4OEMB 2R93H 2JYOA 4A3BH 2LS01 1Q0WB 4H2AA 2OEOA 2JWUA 1CKOA 4JI4Q 2KJ6A 3CPFA 2WXHA 4KD3A 1BCPD 1H9SB 2KX3A 2JSOA 5LMNL 4YSXB 2E74C 3WANA 3Q3NC 2JSVX 2AEHA 2KN4A 1QOGA 1JQYD 3S1RB 2QCZA 5M3MG 4IO9A 1WTOA 2PQAB 4BBSG 1VQIA 1WCMB 4GGQA 3CKIB 1DOXA 3EECA 3AE8B 4GNXC 2VW9A 4KHPL 2KX0A 4EQPA 2Z6BA 2WLBA 3Q23A 4MNOA 4WAFA 4JI7L 1EY4A 3UDFA 2CQAA 4G7HC 3F2BA 2AUJD 4AUQC 4YTMB 4DR2Q 1ASYA 2M0XA 2C60A 2K50A 4M0WA 4WURA 2K0PA 3ZRFA 4GNXA 1HXYD 1R9TB 1SNCA 2N7EA 5C3EB 3UDXA 3RFZB 1LABA 1YIJA 1KAWA 4A75A 2XSCA 3P1HA 3W5UB 2ZM6L 1N5WA 2O2VB 3PIP3 4F8MA 4GKKQ 4QB4A 3DVGY 4ANUA 1JWSD 4L5QA 4LF4L 2V3SA 4HJAA 1Y1WG 4B9KA 4JOIC 2PTLA 4KHZA 2MNAA 2Q5WD 4F8CB 2K5NA 2VY3A 2MX2A 3ZGZA 2KOXA 2DENB 2INPE 5CX3A 3P4RB 2ZXOA 2LMCA 1HFGA 4CYEA 1DOYA 4HN7A 1QWYA 4EZKA 4JOIA 3J81j 4JI3Q 3Q8BA 3N20C 4QJFA 4AS1A 1LLRD 1TTNA 1L2NA 2CHZA 1MPEA 1U4MA 1JALA 1OXXK 1YJJA 2DYOA 3A7LA 4XC2A 1U4AA 4HJGE 5CV5A 3RN9C 2W82A 4ICVA 3H6NA 4G11A 4BBRB 3RMHA 3U52E 1U0LA 1YOVB 1DCZA 3VYTA 3CF5A 1L4DB 2WKDA 3HKZG 3QJYA 4R4IA 1SE2A 1V9JA 4W9CA 1TKEA 1N5XA 2KCTA 1PRTF 1G6ZA 4W9KA 2KANA 3GB1A 4LUVA 3U9OA 2UU9Q 2JA7B 1JW9D 3A33B 1TKYA 1A0IA 2NVYB 4YHHL 4A3JH 1RFAA 1UWMA 4P75A 1WE6A 3FAHA 4AP4C 3PUYA 1TWFH 2EY2A 4I7AA 5FLXc 2KQSA 2O6VB 2Y5CA 2XNAC 1G6JA 1EIGA 3ND8A 4A3FB 2LXKA 1WJ4A 5JHAA 1PYBA 1OTCA 2N9PC 3UI3A 3SHQA 2IX3A 3PV1A 2VUMG 3V05A 4B3MQ 1B2TA 1IKMA 4QIWE 2UXBQ 4FA6A 1I4HA 5EPLA 3P4QB 2CH4A 2E2DC 3ZIMA 3V6EB 2R7ZH 3VR9B 2OJRA 3STBC 3ZNID 3APDA 2B63B 4R9WA 1CSPA 2A6EC 3I91A 2HHHL 5G2NA 4B95A 1VMCA 3I5JC 4JI4L 5BN4A 1DYQA 1RLFA 4M8NA 4EEWA 4IJHA 3ZUNA 2L05A 2H1EA 2VQFL 3G6JB 1ENAA 4PZ7A 2F4VQ 3H3VH 3FMCA 1KF6B 1ILPA 3R3MA 2OEDA 4A3GG 3KQ4A 4OVZA 1WTHA 3RLFA 4MGIE 3TMPB 4GKJL 4PS8A 4IW0A 3S1NB 4JI5Q 1N61A 3W5VB 2B2VC 5M3FB 4L5SA 1OGWA 2JXTA 3M95A 2L83A 3X23A 2RR9A 2CVRA 3SK6A 2KN5A 2DZJA 3F2DA 3ZDTA 4DK6C 4RHSA 3SDLC 1IBML 2V1CC 5C3JB 1ZXIA 4EQ5A 5IT9c 4HK2A 2B2VA 2PPHA 2YTYA 3F2UA 3NVZA 2FINB 4URKA 2I38A 1AH9A 4B6WA 2WNMA 1NCVA 2KJRA 3KLWA 1A3VA 2KZRA 3U8ZA 2PW7A 3UINB 1EUJA 1ICWA 4DR2L 4QUCA 3PZDA 4DGZA 3RYTA 3CMMB 2CHXA 4RMFA 2AUKA 3OOCA 1K0RA 4GDLA 2PE6B 2WAQB 2KHJA 1EYDA 3DEOA 3CQZB 2CHWA 2K25A 2WP9B 1BUIC 4LJPB 4MJSA 3VXWA 5T8IA 1XQQA 4GKKL 3LJ3A 1QG7A 1FFUA 4JYAQ 3STBD 2F0VA 2E8GA 2A6ED 5T1IA 4A3KB 4UY8C 4AWJA 3M63B 3KBGA 1JJ2A 1ZXHA 4EFOA 2HD3A 1EZ8A 1A6XA 1CMXB 2K01A 4FULA 1STNA 1WM2A 4PT5A 5BO4B 1STBA 4HLEA 4OWTB 2BW2A 4I6PA 3MXUA 4A3IH 2ICIA 5FOBB 1PH3A 4YWGG 2LXCA 4JI3L 4IUTA 1L0YB 2KBNA 3CCVA 4DR7Q 4LNFA 5EGTA 1FRDA 4QF4A 2BB6A 3NZSA 1UGMA 3J80L 2SOBA 1BVSA 2BT6A 2BKRB 1VF7A 1IYUA 3GTKH 4ZRQA 3NQIA 1WZ0A 3QC8B 5BMGA 3W1YA 4IOAA 3Q0AA 1XCQL 1G8ZD 3E0EA 2B8GA 5C6AA 4E71A 1T9HA 4X57B 4L8JA 1WY8A 4H02A 3HG9A 2AWNA 1V80A 4L5TA 2K33A 2JEBI 5E4WC 2AQ1B 2K22A 2FCQA 5TSSA 1VQ5A 4JGHB 4WQMA 3VDZA 2QGQA 1SGHA 1WXSA 3MHBA 3Q8CA 3P7JA 3AV8A 3ERQA 1UEBA 1YQ4B 4A3DG 2LEKA 4W9EA 1IBKL 1GVPA 4XWTA 1V43A 3GTJB 1GJXA 4KY6A 3KJPA 1B8AA 1VZ7A 4W9IA 1SSNA 4DHJD 4KI0A 2N3SA 3K0YA 3HOZG 2YVCA 1HNZQ 2JQOA 3VFKA 1CHQD 1WM3A 2KTFA 1J0GA 5JPMC 4LDTB 3HM3A 4B3ML 2DWQA 1V8CA 4FN2A 3Q3OC 1PGAA 4WJNA 1EIFA 2UXBL 2JA5H 3S2DB 2ENBA 5ELBA 4LLGM 4OZAA 1Y8RC 1SROA 1JB3A 1E2ZA 1SNMA 5C4XH 1QOAA 3BYYB 3HEJA 2MJEA 4BKSA 1IZ6A 5HGTA 1YX5B 3FP9A 1B3AA 4OIKA 3M85A 4LF5Q 3HS0C 5JOBA 1I4XA 2YU9H 5IYBH 1CA6A 2JVCA 1XTCD 1I94L 5J2RA 1WH3A 1LV9A 3RD4A 3HOXH 2WQYB 1ASZA 4IWOA 2A6HC 3PREA 3RNEC 4B3SQ 2WX0A 3GD7A 1F1HA 2K6QA 4I6NB 2F4VL 4YL8A 1XNQQ 4A8XC 1SXTA 2AHOB 3VYUA 4DBGA 2DYBA 2MO0A 5J18A 2I07B 1GHJA 5C3WA 3HOWH 1EYCA 2C9OA 2K8CA 1TWGB 3VR4A 1AYFA 3PZ7A 1WYDA 3R2TA 1SIJA 2IZVB 3RCZA 1WR1A 4F87A 4GDKB 1TS4A 4JV5Q 4NJ7A 2EJGC 2WDRB 1U5KA 4GOPA 1XMQQ 1TIID 3A0JA 1HUMA 4PZ8A 3H7PB 1L6VA 3KF6A 3MC9A 1S5ED 2A5HA 4TQ1A 3I4LA 1YVCA 4BBNF 2RDFA 2EYMA 1KQSA 4DV0Q 4LFCQ 1FEHA 4P1CC 4UP9A 3MHZA 5ELEA 1YN5A 3IAS1 1SN8A 2XTIA 2A8VA 4IZ8A 2L0TA 4WQOB 1QF6A 2RCNA 3S1RH 3NE5B 5KYIA 3SHLA 5LXHA 4BKSD 2RPQA 2ZJDA 5JJIA 2BS3B 2GLSA 4B0MA 4XDCA 4WJ3M 1EIYB 4ZRPA 2EY1A 2SDFA 4JCVE 1Q5WB 3AU4A 5A2QE 2MH7A 4JX1C 4BKGA 4UP8A 3OPOA 1N6ZA 3A1QA 4B0EA 3CCLA 5IGCA 3E9HA 1V1OA 1YN3A 2NS5A 3UQBA 4LNQA 1VDZA 2OQKA 1C77A 1PH6A 1OQQA 2RSNA 1CKMA 1UUPA 2MHVA 3T56B 2A6HD 3UDGA 1R9TH 1V97A 2K39A 4W9GA 5C3EH 1E2WA 1I50B 2HIXA 4EVOA 3AEAB 3C0RB 1STHA 3NBHB 3SFEB 4OHJA 2WB1G 2J0TD 1WE7A 1SFOH 3ZJTA 4FYDA 3HUIA 1WZ3A 5M5XB 1KC8C 4RNAA 5I9PA 2JZZA 3R8BA 5FLXE 1D2BA 2X6GA 4A3EH 2V3NA 4DR7L 1XT9B 3IHPC 5GROA 3U4ZA 1WGGA 2HDMA 2Y0SB 2XEWA 4DFAA 2L76A 2LRWA 4P73A 3KVFB 4ARIA 2MSED 2NBUA 4EGVA 4FXCA 2C7HA 1EL0A 3N30A 4OVVA 1A70A 1EY0A 5IWAQ 3V3XA 4OL7A 1ROEA 2EKEC 4KTAA 1ENCA 2XIWA 1RTOA 4KKUA 1XCTL 2WXOA 4K0KQ 4LNIA 3I73A 1I7HA 2D3CA 3QOJA 3HRZC 1X3FA 1LTAD 3GTMH 2ACZB 5FJ8H 2C9WB 3OHXC 2ZW0A 3DVNU 4WIPA 4JI6Q 4IURA 3HVDA 4AYBB 1LO5D 1PFBA 3EJIA 4S3SA 3M7GA 4MELA 2WXFA 1S5FD 3A9JA 4YSYB 2F0GA 4Q5VA 2K52A 4BBRH 1X65A 4X6AH 1WGYA 3EFUA 3LDZE 4JBMA 2Y5BB 2WXLA 2HQLA 3ZRCA 4RGOS 2R93B 4NXML 4A3BB 4DR3Q 3S2AA 4C80A 3DDCB 4KSKC 4NW2A 2WYQA 2BDNA 1HNZL 3U4EG 4C4VB 1EWYC 1X3PA 2PMVA 3BZKA 3A74A 2NCNA 2V3PA 2MBEA 3CIRB 4LW1A 3I90A 3NEMA 2F0MA 2K5VA 1TWAB 4NPSA 4TSSA 5FO9B 2JA7H 4OW0A 2NVYH 4RWSC 1MJDA 3J80i 2KDBA 2KQ7A 3Q69A 4G7ZC 3CC2A 1VQDA 5HGQA 1WJ6A 1BOSA 4OO1H 5K36H 4LF5L 4K14A 1K51A 2B2WC 2MJDA 1VMPA 2N1WA 1GB4A 3CXCA 2FUG1 2CR5A 3KJOA 2G45B 4B3SL 3MXNB 1Y8PB 1PFMA 1Q8KA 4Z9CB 2K5DA 1XNQL 4E3CA 3KDFA 3MTNB 1NYQA 4G7OC 2D3BA 3KW5B 5BR8Q 2B2WA 3H0GB 1S5CD 1T0QC 4LFBQ 1WX7A 2B63H 4EOYA 3BK2A 3HOVG 3P2BA 4JV5L 1K50A 1V9PA 2KWVB 4NAWA 3MTSA 2K6AA 3H91A 1MGSA 4IUVA 4JBKA 4WJWA 2JYTA 4C3HG 4LFCL 4DV0L 4NAMA 1QILA 3U2SC 4FBJB 3J81c 1BBWA 3M3YB 4ID6A 4F7ZA 5FKAC 4OELB 3S1NH 4HIMA 4MIUA 2PVOD 3FRPB 3WOEA 5JEAG 3QJZA 5MPOA 4DAMA 2ZVNA 2UUAQ 4WWMA 1Q86C 2LGYA 4MM3B 2UUCQ 1NY4A 1E9MA 4ACFA 2PZUA 1II3A 1N9WA 4IPGA 4YY3Q 3UI2A 2MWSB 1RIPA 1BNZA 2G9HD 1Q8IA 1SE3A 4YCVA 1BT0A 4LF7Q 4RAUC 1SNOA 4DV6Q 2PE9A 3BZCA 4K8JA 3BS1A 2NUCA 4EX5A 1YNXA 3VUWA 3ZNZB 3JSVA 2F3WA 3HKZE 1C4QA 3TQYA 1ESRA 2FJ2A 4HAEA 2N0SB 1Q1EA 4JI8L 1IHZA 4DUYQ 2JA8G 1O80A 1O7IA 4J1MA 4KV6A 5CC4A 4N59A 1F2MA 4QMGA 5J17A 2IWHA 4II3B 3ULPA 1XD3B 1BF4A 3VUYA 1SNPA 3QWZB 3HKSA 2WHIA 5I6WA 2JK8A 3CQZH 1WTPA 2CU3A 2KENA 1E5WA 1NR2A 1E3PA 1L0VB 1EEID 2BB5A 3SVMA 1J9OA 4USAA 3N6RA 4X3TA 3KLRA 4DNTB 1NNXA 2XVSA 5BN3A 4X62Q 4ZRKA 1RD9D 1AN8A 2PZTA 1C4PA 1XLNA 4A3KH 5JAVA 4OWWB 2FAZA 2UWQA 4PYZA 1MI2A 2UYZB 4IALA 1I3QH 2JYEA 1Y1WH 3RZFA 1FXAA 2BYEA 4XX5A 1F2YA 2W3RA 5IWAL 3J9CA 1TT2A 3GTLB 1IPGA 2AL3A 2LVPA 1TWFB 5AEKB 2NZOA 3AMUA 1GC7A 1VQJA 2WXNA 3WCQA 4FHJA 1E0BA 1PFSA 4H0LC 1VQ6A 2CWAA 3I4OA 2IL8A 4J8QA 1XYIA 4L63B 1SJED 2KDIA 5GAGC 4HROA 2SNMA 5IY0A 2IGHA 1EQQA 1EY8A 5EJWA 1HTOA 4MT5A 3UIOB 2ICEC 2OT2A 2AQ2B 3GZNB 4IQZA 1K8GA 3K5MA 1D7QA 1QVGA 5CV7A 3TP7A 1PGBA 1STYA 1K8RB 1YHAA 1EM7A 2ZJRA 1C9FA 3CMEA 1A3TA 5JVH3 1F9JA 4BBNC 4DR3L 3PHWB 1YIWA 1KLVA 3BVGA 4DR5Q 3E0JA 4LFAQ 4NKLA 4U68A 1VR9A 2OHFA 1DGJA 1MBYA 1WJUA 2A68C 2CQOA 3AM9A 3URYA 1KDCA 1OXSC 2MQHA 2F3VA 1GO3E 4YCUA 2MCNB 5LXIB 1H95A 3GTJH 4L1BA 2IO3B 1YMHE 4DUZQ 2EPBA 4CJ0B 4DV5L 1QNUA 4HCPB 4U673 4KMUC 2F0JA 2MFIA 3S15H 2B2TC 4W9FA 1BUVT 1FXIA 3J7ZC 2L5TA 1KABA 3S2DH 2YEPF 5HURA 1Q46A 4RM8A 1I35A 1NENB 1ENFA 5BR8L 2WXKA 1WMHA 4HDOA 4JI0Q 2NN6I 3AE1B 1X3QA 5E1FA 2B2TA 1QUQB 4FHKA 4ZLTF 3H94A 3BDCA 5KHOA 5T1GA 1MJCA 1YEZA 1HTLD 1IBXB 1L2FA 1DONA 1NEKB 3MHSD 5L37A 1OFFA 1L0XB 3S1QH 3SXHA 2EMSA 4IPDA 4C3HB 4FF3A 2VH2A 5DPSA 3L2PA 4QIWB 3VRBB 1TWGH 2BA0A 5FR3A 2BQQA 1WYWB 4K5VA 3QG1A 1IL8A 2UUAL 4IUNA 5FO7B 5K5PA 3OTOL 2UUCL 3W3AA 4V0BA 4YY3L 4K2KA 3IXSA 3R66C 1K3RA 4KN4C 1WR6E 5IAAC 3NTHA 4LF7L 3NELA 1CA5A 1EU4A 3PRPB 3ZDMC 1A5RA 3JAMc 2A68D 4Q0FA 4DV6L 3AE7B 3OJ3A 1EFID 4MGKE 1EYAA 5C44G 1LGRA 1MIUA 4L6TB 4XIGS 1GUTA 4IJLA 3ULLA 4A3IB 3AEVA 2WDQB 2E2HB 4K7UA 1RF2D 4JWSC 1D6EC 2K8HA 2DY7A 4DUYL 3W5OA 3GQBA 4B9WA 1XX8A 4FF1A 2NPTB 3V61A 4XDXA 3R93A 3D6WA 1TWHH 1KD1C 2IO2B 1UH6A 2G5DA 5I4DA 1XLPA 4M02A 1RDPD 2K32A 3I4MG 2BDOA 3UDIA 4IFDJ 4JBWA 1DD2A 3MJ5A 2R7DA 3GTKB 4HTHA 5ELNA 2CS4A 1B70B 3B6YA 5FLMH 1C1YB 3LB8C 1O78A 4K81A 1X56A 4X62L 3J7AF 2N7JA 1OXTA 1Y56A 1B50A 3DWGC 2NTSA 3VHTC 4A55A 4HIKA 2EMTA 3HOYG 1YN4A 1G2TA 2OWOA 2TSSA 1E1OA 2R61A 1ZUD2 1CM9A 2MJ3A 1I50H 4RCOA 5HKHA 3P4PB 4BKTA 2I46A 3N1ZC 4RGNA 4GZYC 4PMCA 5D3IB 4NQKE 4A3PA 1P3QU 1TBEA 1GD7A 4LMQD 3L17A 2Q2UA 5M5XH 2L52A 1XMOQ 2GA4B 3EC8A 3FHWA 4DPGA 3HOUG 4IM0A 1LT4D 4A76A 1Z2MA 5IE8A 3L0WB 4DK0A 5L95C 3DHGC 2JY6A 2Y3AA 3IVFA 1HQRD 3E3XA 2MA9B 5AFWA 4HJ9A 2D2QA 1OQYA 5ELOA 2LVOA 1YQ3B 2RGFA 2JJQA 1R4MI 2XGTA 1BMLC 3LNNA 2DLBA 3APFA 1UWXA 4FNFA 3RR5A 3I55A 3CCQA 4OX9Q 2DJGC 1Q81C 3PO2B 1YX6B 1N63A 3T1YQ 1PTOF 3IBEA 2B3GA 1C78A 4DR5L 2K5HA 3HOXB 1EQRA 1HA5A 2F0OA 3TZUA 1A8VA 3GO5A 3HK0A 2YEPB 2F4IA 4A4IA 3S1MB 2PNHA 2L1BA 1BCPF 5M9OA 1VQFA 1VRAB 1PTOD 3DBHI 5H92C 4R4OA 2QDFA 3RZWC 1X54A 3WAMA 2RBMA 3OW2A 4O1NA 1C0AA 3M3JA 2MP2A 2NVUI 3CW2C 4DUZL 4V190 4GN5A 2AL6A 1B9NA 2L12A 3T1HL 4C3IB 1MHXA 1YNTE 2PVGC 1IBLL 4L2YA 5KHQA 3OYYA 3HOZH 2ZNVC 1ZKHA 1BBXC 1TWAH 2UUBL 3PRMB 2B29A 4X64L 2DZIA 2D10A 1HNWL 2IHEA 1PZKD 1VLBA 4MGYE 5KNDA 3ULJA 5J22A 4JI0L 1S3OA 2IY0B 4TMAB 4G0NB 2L4NA 4WJQA 1TS2A 5C0XH 2D3AA 2GVBA 1JWBD 2QDBA 1F52A 1VD2A 1HZAA 1E6EB 2KWUB 3NWTA 2D3GA 1JC7A 2JPHA 1ILQA 2ZW1A 1WTWA 1Z7TA 4OONA 4ME3A 2WB1E 1EO6A 3LXFA 4QGUA 3I3TB 1E90A 3H0GH 4BS9A 4A9AA 1B9RA 2JQRB 4IFDI 5DLQE 2LD9A 5M5YB 1VQNA 4DWFA 4DV7Q 3VR6A 1JOQA 4C2MB 1JROA 1YJ1A 4R8IA 4KDLB 1OO9B 3DBSA 4L5RC 2PYKA 1K9MC 3AB9A 3PRZA 3S16B 1OEYJ 2R92G 1JJCB 3WALA 4K8IA 2K5PA 3U58A 1N33Q 2K05A 3M3YH 2AX5A 4JPSA 3CMAA 4WJ4A 4I65A 4BY1G 3VYSA 3L7ZC 4DR1Q 1SFOB 4AJYB 2VZKB 4RGMA 3SD5A 4DHZE 4IUQA 1FR3A 4TUUA 2KAJA 2VB2X 5JPNC 4A3EB 1F9PA 2CJNA 2UXDQ 1Y1VG 4X3UA 5IP9G 1D5MC 4AH6A 4HPLB 4ALPA 3UF8A 1E8ZA 2F0DA 3QAQA 5I9OA 3DBHB 2WV6D 1UGJA 1SYCA 1WGHA 1PVOA 1L1OB 2F52A 2QW7A 3IFDA 5A35A 3RPFC 3VVWB 3DWQA 3T4AC 4K7SA 3CRLC 4E6IA 3GTMB 4C7ZA 5BMHA 1P98A 4IWPA 1Q90A 3HVZA 3ERSX 3KOJA 2AMCB 3NS1A 4F1SA 1K28A 4DF7A 3ZJUA 3CC4A 3I4NG 3BIID 1WD0A 1XO3A 2N1VA 1NR4A 4NMZA 3T53B 5KNCA 1XMOL 3F8TA 3HGBA 4BWGB 1JWUD 2IYDB 1PV4A 1J7BA 4R3DA 3BDLA 3WA0A 2BYTA 3AB5A 1AE3A 4C1NK 3VRAB 1IXRA 1NAPA 4KJNA 3CF6E 2PW5A 2ZJPA 5IN7A 5AJ3Q 5BMIA 2M9VA 3Q8DA 1WX8A 1SYEA 4GIVA 3GTLH 4OX9L 2O5JC 4DV1Q 2NBVB 4A3MG 1RJTA 4A3CG 3C1EA 3T1YL 1XTDA 4POGA 1QCBD 4RF0A 3KYHC 2VQEQ 3FILB 2PMZE 2ZT9C 4KGSA 1WTQA 4K3CA 1MI0A 3P1MA 2KMCA 2KK8A 1FNVA 4BY7B 3TBIB 3FKIB 2ASBA 5JH5C 3P4SB 1JQ4A 2E5LQ 1FRRA 2EYOA 1O7ZA 2C5LC 2KFKB 1V81A 3PGEA 3T8MA 1YNJC 3DBRB 1GNUA 3PIO3 2WXMA 3OMCA 4II2B 3ABVB 4LJOB 1QKZA 1NDDA 4UPAA 1S3SG 2EY6A 2IY5B 2MBOA 2F0NA 1VQLA 3IT4B 5JJZA 2DJFC 3RUIB 1IYJB 2LUEA 4IM3A 2PI2A 1AP0A 1AE2A 3K80C 2Z59B 4A20A 3JAME 2V1YA 2FHTA 4C1NI 1EWIA 2E3TA 5G55A 3KF8A 3DHIC 4JBJA 2FIFA 2KLGA 4KGTA 4I7ZC 4FO2A 5M3MB 1WTVA 3IFTA 4HEDA 4BBSB 2Z9HA 1YD8U 2F03A 4QCLA 1J19A 3NOBA 5HG2A 2GMIC 3MJWA 5G3LD 2LASA 2QMTA 5E4XA 2X38A 1JCKB 1LTRD 1QZGA 4A6QA 4X3KA 1TT5B 4DV7L 3KFUA 4JW0A 3JYUA 1L6UA 1H8CA 1EUVB 4HSVA 3BINA 1RRBA 1ZPSA 1B4OA 4N8X1 3EBEA 4DDGD 1CFMA 2Z6KC 2LXJA 3PO3G 3T51B 4PG3A 5EPJA 4C3HH 3NRZA 4M0WB 1H9MA 3KBXA 4DR1L 5IIFA 5FLXL 4GNXB 2PZWA 3KLSA 2CKHB 2IBIB 3KUPA 3LWEA 3RNCC 5IKCM 1NSNS 1YNJD 1GG3A 3FEWX 5E3FA 2Z6KA 3RMKC 3I72A 2UXDL 1I3QB 1PH5A 5IODA 2QHOA 1Y1WB 2YLMA 3IG3A 3CC7A 2WIIB 4BA2I 1P9DU 5H1SE 1RFKA 2LSSA 3KYDD 1DZ1A 4IM2A 3DHQA 3HZXA 4ZRJA 3M4OB 3ZQ4A 3SU8X 3MXGA 2E2HH 4ANWA 4DKAC 2BBCA 1VQKA 3Q6SA 2KHWB 3ZXRA 2IGDA 4YTPB 1RTNA 2Q2HA 1NE3A 1PRTB 1V2YA 2FUHB 3QQ8B 2J0KA 2LMCB 1BBUA 1EFWA 3NSWA 4IG7B 1F77A 1EF1A 2EYLA 3R3OA 3ZJYC 1XPOA 1TIFA 3EUB2 4JPBW 2RDBC 2C5CA 1HR0Q 3PGZA 4RMAA 2NBWB 1KNAA 3RNGC 5EE1A 3NUCA 2JA6G 3N3KB 2KVZA 5DPRA 3HKZB 1KFYB 4WWNA 1K83B 4XQJA 1X6OA 3NPPA 2NN6G 2B8FA 2EJMA 2UU9L 1A2TA 4P2CB 5IT9L 2C7MB 2L1AA 4DV1L 3I3CA 4ZHOA 4DXGA 3M62B 1QLBB 1CI3M 1PDXA 3A8JE 3EGRA 3E6ZX 5IYDG 1ET6A 3DBLB 2GRIA 4TKNA 5J1ZA 1TY2A 1TVXA 3CCEA 3BJUA 1J5EQ 2K75A 3S15B 2IT1A 3OIQA 4A93G 3RI7C 3SE0A 2EYFA 4NPNA 4OXPA 2MW5A 2VUMB 2E2IB 3NHEB 4BXXG 2E5LL 3L4PA 3PO2H 1O7YA 2BOSA 2FIDA 1XNRQ 3O13A 2KEDA 1XPRA 2N49A 3DLLA 3LX0A 4KY7A 2IDYA 2LGDA 3ML9A 3U7ZA 1A15A 2ZEQA 2F0IA 5CBEE 4J3OD 3PLUA 1K0SA 1FCCC 2KQ4X 2XK5A 1PFNA 3PF4A 2DN8A 2NVTB 3TEXA 4JE3B 2FFKB 1NBFC 4C00A 3S1MH 5DM63 2M19A 4QY7A 3S1QB 4K3BA 4DV3Q 2HIVA 1PMRA 2LFIA 3K81C 5C1ZA 1UBQA 2GN5A 2KVRA 2B2UC 1V8QA 4A3GB 3QX1A 1KXLA 4JI5L 1SB3C 2CH4W 2BPSA 4C7YA 3M7NA 2Q2IA 1OXVA 3H09A 4C3IH 2PNRC 3Q3JA 1E7VA 2P5ZX 1MKHA 1VQPA 3EIVA 4M8AA 1JRUA 5GXGB 2LHEA 5I2YA 3KUDB 4QQBX 3L16A 4NXNQ 2B2UA 4KZCA 2KT7A 1STGA 5IO9A 1GB1A 2L55A 3MEHA 1X32A 4TKOB 1FGUA 1D8LA 1HR0W 1TGZB 2WS3B 2W54A 1OXUA 4GOCA 1PLFA 1HE8A 3AU5A 1TWHB 1SE4A 2VB3X 1WF9A 2LRUA 5JZEB 3CSTA 3WDNA 2ONQA 4NB3A 1RL2A 3W2DA 2D11A 3AFPA 4OO1I 3NZ3A 5JVG3 1N34Q 2JF5A 2N9LA 3OWEB 3A8IE 5C5LA 5CTRC 1CQFA 3K7AH 5M5YH 4JYAL 1IW7C 2XRQD 4G4KA 2RQXA 4C2MH 1I5FA 3ITPA 3H15A 3KH0A 1HCZA 5CV8A 1VQ4A 2HJ8A 1TZOA 3VR5A 3S16H 1W3SA 1VCBA 4NQLB 4LUOA 2DY8A 2V4DA 2R6GA 2W55A 3DVGX 1MFWA 5IGEA 3UIPB 1F2ZA 4FADA 4LAAA 1UE1A 2F0QA 2LKVA 2LI5A 1X55A 2Z8LA 1V86A 1E8WA 2AWTA 2A4ZA 5J3BA 1M8AA 3E9IA 4LF9Q 2R2QA 3QK0A 2SEBD 5CORA 1S1QB 4DHJB 1FL0A 3ZTCA 4MEMA 5TR5A 4EZJA 1BDOA 3V60A 3ZW3A 1UNSA 2WKCA 4EUTA 3VH4B 1C76A 3I8ZA 4HCSA 3PT2B 3I57A 3WWVA 3GP7A 2MBQA 2A19A 4W9LA 4X65Q 1NYRA 4WRDA 1CZPA 3APCA 1DM0B 2RDHA 4ZQ3A 1T0SC 2M1MA 1S5BD 4G57A 1LM0A 3JVZX 2VNUD 5L83A 1UEAB 1X1MA 4UP7A 1GUSA 4ZHPA 1B3QA 1HJPA 2VH1A 3CSFA 3PPAA 4A3JG 5DAUA 2KXJA 1YJ9A 1EY5A 1I6VC 1PTOH 4A3DB 1TXYA 5ELFA 1SSOA 4JC0A 2KDEB 1IW7D 1NI3A 1RODA 4GB9A 3HOUH 3QR8A 3FPUB 4YIJA 4YWKA 4EQNA 1J5EL 1XF5L 1G6PA 4IFDG 1SF0A 3HOZB 1UWVA 3PIPA 2Y5PA 4W9JA 3BWUD 3TJPA 5BN5A 1KTKA 3J7YW 5EDSA 3G48A 4DR6Q 1STEA 4DNIA 4KDIC 5C4HA 2RHQB 2K7VA 4GLVB 1UELA 1CKNB 1VF5C 1XNRL 1IL2A 3J80E 2R7ZG 1EF5A 4RFBA 1WXAA 3HRDD 3MZ5A 3AECB 3U4VA 3GV6A 3TBLD 4ICUA 4KKTA 1M94A 5GAEC 3RD2A 4QUFA 4BY7H 3FKIH 4M00A 2INNE 1ZXTA 1M90C 1KRTA 1I42A 3N1XC 2CKZB 3A5ZB 4K5XA 4NDXA 1AZPA 2WU5B 3MAQA 5IOIA 2LHDA 2RHSB 4P72A 5FO8B 4WFN3 1HEZE 2MLBA 3AE4B 1XMQL 3RZOB 1LQBA 1MG4A 1HNXQ 2WDTB 4WJOA 1VQ8A 3RLNA 3AE2B 1GJZA 1VS0A 1Q12A 2FNJB 4NXNL 3T9LA 2AWOA 2G4SA 4KIKA 1KIXA 4GOPB 5CYUA 1JE4A 3SEBA 1UAPA 3CPWA 3PHXB 1LTTD 3NTIA 4CDDC 4DAYB 3NVYA 1KRHA 2M56B 1GUGA 3AEEB 1SE9A 1EWCA 4JK1C 2R2OA 4ANXA 5M3MH 3TEWA 2NVXH 2BYVE 3F2CA 4BBSH 3V62A 2LFNA 1E7ZA 2KTRA 1I6HH 4RG1A 3ZVVA 4YSZB 2ZCBA 4K6DA 5IYCG 4O42A 3MC8A 4S0RA 3GDEA 1DOMA 1Z6HA 4C3JG 2WDVB 3A9KA 1W6JA 1B7YB 4RH6A 4E74A 3TIXA 3N52A 3AE5B 3Q2AC 3EQLC 3NTKA 1XXGA 3S2HB 3DQVA 2F3IA 2GOWA 3JW0X 3TEZA 3GTGB 3NG0A 3GS2A 3QCAA 4HRSA 1AZQA 4FXDA 1GAQB 3EHVA 5IA7A 4OIJA 2R92H 2DUDA 3AULA 3W9CB 1B1ZA 2EOTA 4Y7NH 1ZW7A 1R4NB 3PUVA 1QQRA 2G1EA 2WB1B 2W9NA 1IP9A 4BY1H 1K8AC 3B2GA 2MJ8A 5DEHA 3TMEA 4LF9L 2NWGA 4XT3B 4LK0M 1TKGA 1Y1VH 3D6CA 1KDAA 1NUCA 2AQ3B 2I0QA 1FPYA 4TVAB 3ZYYX 5IP9H 1ZDXA 4GMVA 1E24A 4R4QA 3CAMA 1PH4A 2VZAA 3AFQA 1KAAA 1TWCB 1OEYA 1ZGUB 3M4OH 2BKFA 4K0KL 1VQAA 3I56A 4B3TQ 3VA7A 2KWCA 2X8XX 1ESFA 1QOFA 1TS5A 5EKKA 1VQHA 5C0XJ 4JI6L 3AE6B 3TP5A 1V5TA 2JWZA 1S40A 1V1PB 2Z4IA 1A3UA 2QDLA 1G2SA 3J81L 1N36Q 1ZEQX 2MQJA 5D65A 4WWPA 3DXJC 1WSPA 1GPXA 2PI2E 1YZ6A 3J7A5 2NVQB 4M01A 4IN3A 2L8JA 3ENEA 2JRIB 1K83H 2JXXA 1KHIA 3M9BA 3M4PA 3TN2A 3S17B 1J8CA 1G91A 3X0WA 1PA6A 2GBNA 4GS3A 3ZXVA 5EAYA 3TP8A 2VS1A 3DCGA 4GU2A 2EYPA 3K9PB 2YYZA 1TQOA 2B2YC 5C4XG 2F0KA 2ASQA 4A3MH 3SK8A 4QAYA 3H8HA 1CJEA 4YT0B 3VAWA 1SNQA 5EKLA 4PS7A 3NVWA 3RNBC 4CKCA 2N7DA 4EE2A 4XTCS 3KUZA 3DMUA 3FPPA 4LWCA 3ZNHB 1H9JA 3BVZA 2VUMH 2D5DA 2B2YA 3SDZA 2E2IH 1E22A 2OJWA 3AEFB 3WIMA 3AEBB 3CD6A 3Q24A 4FF2A 3A7AB 3HP3A 2H4OA 4LFBL 1TS3A 2Q8RE 3HOWG 2DAJA 3GTOB 1VQ9A 2I5HA 2QILA 4KHVA 1D4BA 1ISNA 1Y14B 4IOCA 3HOVB 3MC0B 1HNXL 1H9SA 5BYRA 1R4QB 2DNEA 2YV5A 4DK3C 2NVTH 2EYHA 4KD4A 1T6BX 2PMZB 1WIAA 1C4CA 3JC66 5COYA 2ZTDA 4KN7C 2HT1A 4KVGB 2K6DB 3BY4B 1OTRB 1T3QA 3PLVA 3PSIA 5IOCA 2MO1A 1C48A 1MJEA 4NAWB 4BVUC 2HUGA 3DWPA 1TZ1A 4A3GH 2C35B 1KNEA 2IPKD 2PQAA 3D8GA 3VYRA 2V4LA 4PV1C 4TQ0A 4F7XA 2JZPA 1LXDA 2ZXRA 2HTHA 3Q6BA 1JORA 1WCMG 2IX1A 2GBKA 4RM9A 2F0TA 1T0YA 4BZAA 3GV3A 3AH7A 1MHHE 4LNNA 2H89B 1NTGA 2L0CA 2K1FA 2F0WA 4NP5A 4C3JB 4DQOC 1WD1A 4JI7Q 1B9MA 2D07B 1E2VA 1SR3A 2JA8B 2Q8TA 2PJHA 5IGFA 5NUCA 5E6PA 2LGSA 2TMPA 3RZDH 1ZOYB 2O2VA 2OF1A 3OAWA 4R4CA 5C3EG 1QJOA 1M1KC 2WWZA 3PO3H 4HKZE 5E6NA 5C0XI 2E2JB 1P1AA 5FR6A 2I5LX 1T5XD 3D0FA 3ECIA 3MXPA 1W6KA 1FO4A 1BR9A 3SR6A 1AARA 2RF4A 1P16A 3X3NA 3RNUA 4KZ0A 1XPUA 2PKOA 2CW0C 1VQMA 4KLKA 3RLOA 4XWWA 4XYOA 1VDVA 4IDIA 1N32Q 3NZUA 5LMUQ 1FJGQ 5C4JH 4RCNA 1D5XC 4AIMA 3BDOA 2KECA 3BYTB 2X6LA 2NTTA 3NQTA 4HMIA 4B3TL 5EPKA 4R4TA 2FMCA 3W1SC 3PF5A 2NZHA 4DR4Q 3VTUA 4IPHA 1SMYC 2JN4A 3UE1A 2KMMA 2RPVA 1C4AA 5FK9C 1N36L 1NI2A 5CV9A 4N9PA 3IRBA 2EJFC 4BBRG 1T0RC 4XXEA 2BVCA 3W1SA 1CUKA 2FCMA 2J7QB 1YITA 5LMNW 4LFAL 3CHBD 4YTNB 1B44D 1WXQA 4KJOA 1UE6A 2SNSA 3P42A 1K73C 3KK7A 3S24A 2F0SA 2NN6H 3JAML 2Q2TA 1LYLA 1GC6A 2BGFA 4Y52H 2JA7G 1RM6C 2O6VA 3IAM1 5E7NA 2MPMA 3QARA 2ZPNA 4DV4Q 3L0OA 3AU7A 4A3DH 5DNFA 3T16A 5IP7G 4YHHQ 2WXRA 1Z47A 3C2PA 2A69C 4OO1G 1TY0A 3NHHA 4GXBA 1ML0D 4A3FG 2KA7A 5IYDH 3K9OB 2WFWA 3RT3B 2KCNA 4CHKA 2N55A 5AUIA 3NBIA 4A93H 4RKBA 1P0RA 3KWLA 4LCDE 4P7IA 2H5XA 5M5WH 2KCMA 4PZ6A 3ICEA 2KMAA 2CW0D 3ZKJC 3L9AX 4N58A 4CDEC 2Z4HA 2HJ1A 2M0AA 4US8A 3J81i 2M17A 3WOFA 1WRDB 4ZYNA 2WXIA 5GMVA 2B63G 2H88B 2HTME 2MBHA 2L9HA 2VRRB 4CKEA 1WMHB 3VQIA 2HHHQ 4DA2A 3QB3A 5AZFA 1HH2P 1QE6A 1SMYD 2J7ZA 1C79A 2I1KA 2LJ5A 2PIAA 1QB5D 3PSEB 2VQFQ 2JT4B 2MHJA 3ONSA 3K7AB 3S14B 3Q22A 2MP1A 1L0WA 2WP8J 2O6VD 3U30A 3G7LA 2B76B 2PQEA 4GKJQ 3RZOH 5M3FG 3GZNI 1JICA 1IGDA 4IUMB 3IAYA 1E1TA 1X3EA 1ICFB 1VQEA 3C1FA 4XT1B 3PZ8A 3RN2A 4AJWA 1LTID 2HD5B 4FXGC 3TS0A 2N4FA 5D7GA 3U7DA 5C44B 5D3DA 1PH8A 1IBMQ 3TDQA 4CDCC 1B53A 5KNBA 1NJIC 3IT6B 2A69D 2BWFA 4JLCA 1I4GA 1FGBD 1N60A 1TYGB 3H3VI 2ZCCA 2ALYB 3GTQB 1SNDA 2N8NA 3DWAA 1AWDA 2CWPA 4LK1C 3DM3A 2BTEA 1L5PA 2N9XA 3CCMA 4X3SA 5EBCA 1PFDA 3I4MB 1XEEA 2LGXA 2WAQG 2JX5A 3M4QA 3HHMA 1LTLA 3Q8AA 1DXMA 1HHVA 2KO3A 2XRSD 4XDDA 3I2ZA 3S2HH 4A3KG 1PRTC 2K5QA 2J4XA 1HZBA 1KLGD 3GTGH 3HOYB 1CZWA 3A56A 2ZTEA 1EIHA 4ME5A 1JWMD 4CO7A 5GAHC 1Z9FA 4MTKA 1I4RA 4POFA 4FJYA 1N32L 4FDBA 2MUYA 3OSOA 5LMUL 1FJGL 4J15A 1PTOB 4LJZC 2FCSA 1CQVA 2IGGA 5E6OA 1RAXA 4K6LA 1F9QA 3HOUB 3OW7A 1QOBA 1JE5A 5E6JA 2ZPYA 1PYWD 3L08A 4BA1I 4J6HA 3FKYA 3MWYW 2EXDA 4YWMA 4M1UB 4DR4L 4WJPA 2M00A 4IWQA 1BCPB 2KLCA 3VTWA 1TWCH 1EYGA 1LUZA 2R3ZA 2F0EA 2WU2B 4XE0A 3GOEA 3PQIA 1SMXA 1H9KA 2W3SA 4GLAC 1VJKA 4MN3A 1GUOA 3G71A 5CV6A 4MGZE 2FBWB 2QSDA 4CDFC 4XQNA 1E8YA 3L10B 5EE0A 2I2YA 4R1JA 3K5NA 1WTRA 3NY5A 4O0AA 4ZRZA 2F0LA 3CRKC 4RKLA 3EFCA 2BH8A 4DV4L 1WVLA 3QA8A 4ZUJA 3ER0A 2NVQH 2K9XA 3AI5A 1Y8NB 1WXMA 2JZ3B 5CV4A 1IBKQ 2BS4B 1LACA 3QO2A 2D0PA 1XJVA 3S17H 3C19A 4BOSC 1XLOA 1WGRA 5EE9A 1V49A 1PRTD 2WX1A 1LTBD 4MACA 5DCNA 2MP2B 4IFDH 1QOHA 4FLHA 4KX6B 2BS2B 4ZCKA 3ZO5B 2O2LD 1J6QA 3UGBB 2VL6A 1FNUA 5G3LF 2M4NA 2V9HA 1EWHA 1F2RC 3EA6A 3Q14C 1NVID 3TEHB 4LF8Q 1CTMA 2K28A 2Z0EB 2NVXB 5IGGA 1SLJA 1J8IA 4J6IA 1WXVA 3PV0A 1K8OA 1I94Q 5A2QL 4RGTA 2AYOB 1I6HB 2B39A 1GKHA 3I7FA 1FVIA 2ZNVB 1ZE3D 1GM5A 3JAMi 1S72A 3J80c 4GDKA 3GTOH 2OTJA 3H7PA 4B3RQ 1DOIA 2WXJA 4HVBA 1SRUA 1EQVA 4A3LG 3CCSA 3HOVH 2FCNA 3CU7A 1ZKOA 3AE9B 1E0ZA 1SIFA 3NVVA 3AE3B 2MBBB 1FIQA 4BAXA 1PH2A 4LDTD 4MSMB 2R92B 1TU2B 1PUTA 2GBJA 1N33L 2WXGA 2RVLA 1VZ6A 3B1LX 2AKWB 4HDQA 1FYCA 4Y7NB 1EOTA 2C7NB 2DAFA 4H7BA 3K7UC 1JWAD 2EELA 3G4SA 2G9DA 4IOIE 4XZ4A 1KRSA 1UE7A 3ND9A 2K3UA 4BY1B 4HJKA 2KACA 2Q8IB 3RUZA 5JEAH 3K6OA 4IUUA 5AZGA 1HUNA 4BOZB 4TV3A 4Q2JA 5CBAE 1OQRA 2K5WA 1Y1VB 2I5MX 2NBFA 4K1RB 4M8MA 4ABNA 4DU9A 2CJOA 2K04A 3B9JA 1DJRD 2F0UA 3Q8FA 5J39A 5IYCH 3PUXA 1LT6D 5FLMG 3T13A 3CCUA 2L15A 4C3JH 4ZK9B 3ZNGC 2WACA 1HTPA 2FXQA 2J52A 3NS8A 4CJ2C 2FMMA 4FP5D 2JA8H 2WGSA 4HWIB 3S9WA 3NBHA 5EBDA 3J7AV 4CKBA 2ES2A 2K8BA 2OTLA 4P74A 4LNOA 4LUZA 3CCRA 2IY1B 3SK4A 1D3ZA 3DOWA 2E2JH 1KLUD 3I4NB 1A62A 5GQOA 1FMAD 2IO0B 2J42A 2EQSA 2KUMA 4K2LA 1I4QA 4KSLC 4EKUA 1F0ZA 3X3MA 1L4ZB 2Z0DB 1Q1OA 3VDYA 3GTPH 2JP1A 1WTXA 1H4RA 3W1GA 2UU7A 1JR0D 2Y0SG 1RHPA 5LL6S 1Q82C 4PNYA 1QVFA 4AQYQ 5AJ3L 4ZUIA 4XQQA 3AQQA 4XYQA 1P7FA 1V6EA 2LGIA 3NJTA 2KNBA 5HFYA 2QA4A 3FVQA 2UXCQ 1D5ZC 2D2CC 2ID0A 1F9SA 3P75A 2VQEL 4A3MB 1PH9A 3DPDA 4FJZA 3V96A 5G5GA 5KYLA 3BVMA 3U50C 1TR5A 2DNCA 5EQ0A 4DAVA 4AYBG 1DOLA 1XWEA 1NMGA 2NZ1D 5LL6X 5JXVA 4MH8A 3SGIA 2Z1CA 4ODGA 4C4VA 1WYGA 2L0FA 4GLSC 2R93G 4A3BG 2D9UA 1SE8A 2INCC 1EU3A 4JI1Q 3PVLA 5CMDA 4PQXA 1HRJA 5G5HA 5D14A 4NXMQ 2KVMA 1VQBA 2E75C 1N62A 3ZTDA 2LXAA 1IYFA 2DYMA 1U4RA 1VQ7A 2VXWA 2J0JA 3RNFC 4C56C 4CJ1B 1CKNA 3LYYA 1SYFA 2F1MA 4REZA 1LTGD 4ZYSA 2QC8A 4PK1A 3CCJA 5KRUA 3PMFA 1TKWB 1G291 4HR7B 1F2LA 1YQBA 4JWUC 1R7SA 3MXNA 3KWVA 5C0XG 3KUCB 2LJIA 2WXPA 4LF8L 1RWSA 2KOLA 2G3QB 4ZDVA 3KLSX 3E56A 4NJ6A 2JUOA 3AN1A 3I9V1 3KF8B 4RHRA 3NUHB 4N6EB 4S17A 3DM1A 3BU2A 3PS6A 4MHEA 2F0PA 5H8YE 4K7WA 1CSQA 4GOPC 1A63A 2DGYA 3TREA 3VR2A 3VUXA 1EEFD 4JVZA 1JB7A 3A4SC 3H0GG 4B3RL 4ZOHC 3D4DA 2EYJA 1L7YA 3P63A 2XN9C 3CWIA 4MZ9A 4P71A 4HJ8A 2KD0A 2JRHA 3RZDB 5LLIA 3TS2A 4OVUA 2M2LA 4APVA 3PO3B 2GBMA 4DAYA 1C9OA 2ZJQA 2HQEA 3PUWA 4HKQA 4N9F4 4F88A 3S14H 3IFWB 3B0AA 4MM3A 1BXTA 1GHKA 1PZID 1MSHA 2CHBD 1JMLA 4GDLB 5DPWA 4ARCA 5C5MA 1SBBB 4MJSB 4ZAIA 3NK9A 2OXPA 3ML8A 2KHSA 2KEEA 2BWES 3OJ4B 4BFRA 1S5DD 2KWDA 3H1UA 5CHFA 2WINB 4EZLA 3A8KE 2REXA 3EROA 1WCMH 1Z5SB 4N8FA 4ZKBB 3DBRI 4P6VF 2DNFA 2NR2A 3OIPA 5C44H 5C4JB 1U4LA 5JJKA 1PDQA 4P1BC 4JIOU 2ATWA 1WGDA 3AXCA 4YXDB 1BKBA 3GTQH 1E7UA 4OWXB 1VQOA 4HIDA 2J0MA 3FDTA 4JI8Q 3VR3A 4NY0A 4HCEA 2EZVA 1HQMC 3H7SA 2LVQA 2K1BA 3I4MH 1MSGA 1GOZA 4ULLA 1HR0L 2DZKA 2LUMA 3B08A 2L32A 1MVKA 4JL9A 3UE0A 3C8YA 1FCLA 2JA6B 2MEKA 1Q3LA 1ZP0B 1J7CA 3EVQA 1UF0A 3HOYH 2YTVA 5KGUA 5GADC 4AQYL 1GXDC 1SYDA 4ZRIA 2XWJB 2IHFA 1AEXA 1QNKA 3V2TA 4CGYB 3R7RA 3C3LA 1LT5D 5D6JB 1JT8A 2UXCL 2L00B 1PYSB 3H9DA 5IP4D 1TJEA 2ZZPB 4FXKC 2A73B 4HEA1 2GI9A 4K5WA 4G50A 2NMQA 3QIJA 4AOFA 3EFXD 1M4VA 1S4ZA 1V1PA 1W2BA 1XLQA 4UHVA 4A93B 3W1BA 1MD2D 3H3VC 5M5WB 4KV2A 5F2DA 2A5UA 3A4RA 3AEDB 2E76C 2KJHB 1IUEA 3E9SA 3ALBA 3IL8A 1ET9A 5EKIA 3G6EA 4IPCA 5KEEA 3N9YC 3O65B 1YNNC 4JI1L 4PS3A 3EN2A 4DNRB 1I4PA 1V5OA 1WJJA 3T3NA 5C2TB 4IC7B 4DV3L 3L3OC 2EVBA 1ZDVA 5CHWA 5ELCA 2ZXPA 4YWLA 2GB1A 3L13A 3AEGB 3K57A 2XK5B 4P16A 4KK7A 3Q8EA 2KDMA 4WAAA 2RDGA 3K5LA 3VH3B 4N9TA 5IP7H 3FC4A 4AQ7A 1UD7A 2HCIA 2BYFA 5IT9E 4EQOA 2INDC 2WXQA 3NENA 4A3FH 1U4PA 1GUNA 4WH4A 4ITKA 4DV5Q 2L3ZA 1VQGA 4JQWC 3SK5A 2KQ3A 4CHTB 2BCOA 3NWSA 4LTUA 2IO1B 1HPCA 3TP6A 4R8NA 1QZHA 2WAQE 1QUQA 3KF6B 1C7YA 2CFMA 4HCNB 1X3GA 2D62A 3D4RA 4ILWA 4WWOA 4HJ5A 2D5GA 4DV2Q 3UQAA 3TCAA 1F9RA 1IBXA 4W9HA 4HXDA 4RA8A 3CP0A 1CT1D 4XYCA 1HZCA 2GVAA 2F0FA 3Q3MC 3QWNA 2G4DB 4X66Q 1X9NA 1N34L 3TRZA 4OZCA 4DAPA 2KDFB 3DBLI 2OQ0A 1WX9A 2QEXA 4NNJB 4H13C 3SR1A 3DEPA 3GE8C 2LZ6A 1LM8B 1R4MB 3ONAB 5AUKA 3A1QB 1FD6A 1YNND 2BE5C 2A1AA 4QL5A 5M3FH 1PQSA 3VA5A 3HIZA 3PIOA 1SYBA 1RKNA 3OTOQ 3MFYA 3F1ZA 1D1KA 3K59A 1LFDA 1RYJA 4OZBA 1KOTA 2SAKA 5CGKA 2EXZA 5I6YA 3AYHB 4CQNA 1WI5A 3HM6X 5BYQA 2NPTA 1CHPD 1YI2A 4A3IG 2HDEA 3V6CB 3PUZA 4RF1A 5AZHA 1E10A 4LF6Q 3TZDA
chains in the Genus database with same CATH topology
1F2RI 1JRPA 3NXWA 1AW7A 4KKSA 2QEJC 4IUPA 5CR3A 3OWFA 3K5OA 3BG3A 1FFVA 2E6XA 3MP9A 1IGCA 4B08A 1Y8OB 3E5SA 4FF4A 2V4IB 2QF7A 3A54A 1U9RA 2LY7A 4DN4M 3MA2B 2O5IC 1ACCA 3B2FA 2FE8A 2ON8A 1QT9A 3ETRA 4A3JB 2PPBC 3D31A 4ZKCB 2BE5D 1J7AA 2KCCA 1IYVA 2IW3A 2RA4A 5I2XA 2BA1A 2J53A 1HFNA 1K53A 1STAA 1Q1BA 3C46A 1CZGA 3LWUA 1PXUA 2PCFB 5ELDA 1SDFA 2R7ZB 3OMGA 1JOOA 1WWTA 1KH0A 2JXMB 4TRDA 1PZJD 2NB0A 4TQUS 2N9KA 2MGSA 1VCIA 1YJIA 1BQQT 4DXFA 4UDUC 3TUOA 2EKIA 1FD7D 3DWMA 4C3IG 2EE1A 1SEBD 2F0HA 1SYGA 3D4WA 2PW9A 1ONLA 2XWBB 3IKJA 1FM0D 3M4YA 1ZYRC 2JU6X 1H9RA 4PMWA 2RMMA 4YTMB 1O7LA 1HZ6A 2PO4A 4B9XA 3MFGA 1SAPA 1WGKA 3D3RA 5LNK1 1KDBA 5IGDA 1Q10A 4KY5A 2L11A 1D1IA 4KKIA 3PO0A 1FNWA 5LHY1 1GUWA 4FVMA 3BK1A 1DOKA 4NJCA 4H44C 5C3XA 2N88A 1BO0A 3QOLA 3DUZA 2KJXA 2DBYA 4CBVA 4KGRA 3SFDB 1HA6A 1IKLA 2IJ0A 2EY5A 3ZJVA 2A74C 3GTPB 3VR8B 3U9SA 4L23A 4DK1A 4US9A 1RCVD 3T3OA 2JE6I 3NP8A 1CK1A 2IX0A 5IGBA 1PTOC 2RKSA 1ZYRD 5HI1A 4D2KA 1K52A 1EY6A 3A55A 3TSSA 1LT3D 1A2UA 1E7PB 2QJLA 2PLPA 3BZDB 4KKJA 1BCPC 5DM73 4NZLB 5HHDG 1HZ5A 1EY7A 2O4XA 1EQTA 4OGQC 2HDLA 3K58A 2VZKD 2QIEB 1PGXA 3TEYA 3I70A 3MVVA 2X69A 2HCCA 1VZ8A 4PMBA 1C8CA 5EE3A 2RSOA 4IKGA 3AMZA 5C4ZA 1T5EA 2JEAI 1LTSD 3P20A 5ISRA 3FILA 2JA5B 4A90A 5K36G 5C4XB 4UAIA 3H6MA 1WRIA 4WORA 5BYSA 1P7EA 1SJHD 2EDGA 2V0GA 2YU9B 2QCPX 2K03A 5JEAJ 1K8MA 1Y69U 4HMJA 5KIXA 1EY9A 3R2IA 2QKIC 1AFPA 1JOKA 4HSPA 1EZ6A 3HOWB 1R4PB 3J81E 2NYZD 3QIAA 2JYOA 2LS01 4H2AA 2OEOA 2JWUA 2WXHA 4KD3A 1BCPD 1H9SB 2JSOA 4YSXB 2E74C 2JSVX 2KN4A 1QOGA 1JQYD 3S1RB 1WTOA 1WCMB 3CKIB 1DOXA 3AE8B 4EQPA 2WLBA 3Q23A 4WAFA 1EY4A 2CQAA 4G7HC 2AUJD 4M0WA 4WURA 2K0PA 1HXYD 1R9TB 1SNCA 5C3EB 3RFZB 1LABA 2XSCA 3P1HA 3W5UB 1N5WA 3PIP3 4F8MA 4QB4A 1JWSD 2PTLA 4KHZA 2Q5WD 3ZGZA 2INPE 3P4RB 2ZXOA 2LMCA 1HFGA 1DOYA 4HN7A 1QWYA 3Q8BA 4AS1A 1LLRD 1MPEA 1U4MA 1JALA 1OXXK 1YJJA 2DYOA 3A7LA 4HJGE 5CV5A 2W82A 4BBRB 3RMHA 3U52E 1DCZA 3VYTA 1L4DB 2WKDA 3QJYA 1SE2A 1TKEA 1N5XA 1PRTF 1G6ZA 3GB1A 3U9OA 2JA7B 1JW9D 1TKYA 2NVYB 1UWMA 3FAHA 3PUYA 2EY2A 2Y5CA 2XNAC 1EIGA 3ND8A 4A3FB 3UI3A 2IX3A 3V05A 1B2TA 1IKMA 1I4HA 5EPLA 3P4QB 2E2DC 3VR9B 2B63B 4R9WA 2A6EC 3I91A 1VMCA 5BN4A 1DYQA 2H1EA 3G6JB 1ENAA 3FMCA 1KF6B 1ILPA 2OEDA 4OVZA 3KQ4A 3RLFA 3S1NB 1N61A 3W5VB 2B2VC 5M3FB 2JXTA 2L83A 2CVRA 3SK6A 4RHSA 5C3JB 1ZXIA 2B2VA 3F2UA 3NVZA 2FINB 2I38A 2WNMA 1NCVA 1A3VA 2PW7A 1ICWA 4QUCA 4DGZA 2AUKA 3OOCA 2WAQB 3DEOA 1EYDA 3CQZB 2WP9B 1BUIC 5T8IA 1QG7A 1FFUA 2F0VA 2A6ED 5T1IA 4A3KB 3KBGA 1ZXHA 1EZ8A 1A6XA 2K01A 1STNA 4PT5A 1STBA 2BW2A 3MXUA 2ICIA 5FOBB 4YWGG 4IUTA 1L0YB 5EGTA 1FRDA 4QF4A 2BB6A 3J80L 2SOBA 2BT6A 1VF7A 1IYUA 4ZRQA 3NQIA 5BMGA 3Q0AA 1XCQL 1G8ZD 2B8GA 5C6AA 4L8JA 3HG9A 2AWNA 2K33A 2JEBI 5E4WC 2AQ1B 2K22A 5TSSA 4WQMA 3MHBA 3Q8CA 3P7JA 3AV8A 3ERQA 1YQ4B 2LEKA 4XWTA 1V43A 3GTJB 1GJXA 4KY6A 1VZ7A 1SSNA 4KI0A 3K0YA 1CHQD 5JPMC 2DWQA 1V8CA 1PGAA 3S2DB 2ENBA 5ELBA 4LLGM 4OZAA 1JB3A 1E2ZA 1SNMA 1QOAA 3BYYB 3HEJA 2MJEA 5HGTA 1B3AA 4OIKA 3M85A 3HS0C 5JOBA 1I4XA 1CA6A 1XTCD 1LV9A 3RD4A 2WQYB 2A6HC 3GD7A 4A8XC 1SXTA 3VYUA 2I07B 1GHJA 5C3WA 1EYCA 2C9OA 3VR4A 1TWGB 1AYFA 3PZ7A 3R2TA 1SIJA 4F87A 4GDKB 1TS4A 2EJGC 2WDRB 1TIID 1HUMA 1L6VA 1S5ED 2A5HA 4TQ1A 3I4LA 2RDFA 2EYMA 1FEHA 3MHZA 5ELEA 1YN5A 3IAS1 4IZ8A 1QF6A 3NE5B 5KYIA 3SHLA 2BS3B 4B0MA 4XDCA 4ZRPA 2EY1A 2SDFA 5A2QE 2MH7A 4JX1C 3OPOA 4B0EA 5IGCA 1YN3A 1V1OA 1VDZA 1C77A 1OQQA 2RSNA 1UUPA 2MHVA 3T56B 2A6HD 1V97A 1E2WA 1I50B 4EVOA 3AEAB 1STHA 3SFEB 4OHJA 2J0TD 3ZJTA 4FYDA 3HUIA 5M5XB 4RNAA 5I9PA 3R8BA 5FLXE 1D2BA 2X6GA 2V3NA 2HDMA 2Y0SB 4DFAA 4ARIA 4EGVA 4FXCA 1EL0A 1A70A 1EY0A 3V3XA 4OL7A 1ROEA 4KTAA 1ENCA 2XIWA 1RTOA 4KKUA 1XCTL 2WXOA 3I73A 1I7HA 3QOJA 3HRZC 1LTAD 2ACZB 3OHXC 2ZW0A 4WIPA 4IURA 3HVDA 4AYBB 1LO5D 1PFBA 3EJIA 4S3SA 3M7GA 2WXFA 1S5FD 4YSYB 2F0GA 4Q5VA 2WXLA 4RGOS 2R93B 4C80A 4A3BB 4NW2A 2BDNA 3U4EG 1EWYC 1X3PA 2PMVA 2V3PA 3CIRB 3I90A 2F0MA 5FO9B 1TWAB 4TSSA 4OW0A 4RWSC 3Q69A 4G7ZC 1BOSA 4OO1H 5K36H 4K14A 1K51A 2B2WC 2MJDA 1VMPA 1GB4A 2FUG1 1Y8PB 1PFMA 4Z9CB 2K5DA 1NYQA 4G7OC 2B2WA 3H0GB 1S5CD 3BK2A 1K50A 3MTSA 2K6AA 3H91A 1MGSA 4IUVA 4WJWA 2JYTA 4C3HG 4NAMA 1QILA 3U2SC 3M3YB 4ID6A 5FKAC 4MIUA 2PVOD 3FRPB 3WOEA 5JEAG 5MPOA 4WWMA 4MM3B 1E9MA 2PZUA 1II3A 3UI2A 1BNZA 2G9HD 1Q8IA 1SE3A 4RAUC 1SNOA 4K8JA 3BS1A 2NUCA 2F3WA 1C4QA 1ESRA 2FJ2A 4HAEA 2N0SB 1Q1EA 4N59A 1IHZA 1O80A 4J1MA 4KV6A 5CC4A 1F2MA 4QMGA 2IWHA 1BF4A 1SNPA 5I6WA 1WTPA 2CU3A 1NR2A 1L0VB 1EEID 2BB5A 3SVMA 1J9OA 4USAA 3N6RA 4X3TA 3KLRA 4DNTB 2XVSA 5BN3A 1RD9D 1AN8A 2PZTA 1C4PA 1XLNA 5JAVA 1MI2A 4IALA 2JYEA 1FXAA 1F2YA 2W3RA 3J9CA 1TT2A 3GTLB 1TWFB 3AMUA 2WXNA 3WCQA 1E0BA 4H0LC 2IL8A 4J8QA 1XYIA 4L63B 1SJED 4HROA 2SNMA 2IGHA 1EY8A 5EJWA 4MT5A 2ICEC 2OT2A 2AQ2B 4IQZA 3K5MA 5CV7A 3TP7A 1PGBA 1STYA 1EM7A 1C9FA 1A3TA 5JVH3 3BVGA 3E0JA 4NKLA 4U68A 1VR9A 2OHFA 1DGJA 1MBYA 2A68C 3AM9A 3URYA 1KDCA 1OXSC 2F3VA 4L1BA 1YMHE 2EPBA 4CJ0B 1QNUA 4U673 4KMUC 2F0JA 2B2TC 1BUVT 1FXIA 2L5TA 1KABA 2YEPF 5HURA 1NENB 1ENFA 2WXKA 2NN6I 3AE1B 1X3QA 5E1FA 2B2TA 4ZLTF 3H94A 3BDCA 5T1GA 1IBXB 1HTLD 1DONA 1NEKB 1OFFA 1L0XB 3SXHA 4C3HB 4FF3A 3VRBB 4QIWB 2BA0A 5FR3A 4K5VA 3QG1A 1IL8A 4IUNA 5FO7B 5K5PA 3W3AA 4V0BA 3IXSA 4K2KA 4KN4C 3NTHA 1CA5A 1EU4A 2A68D 4Q0FA 3AE7B 1EFID 1EYAA 4L6TB 4XIGS 1GUTA 4A3IB 2WDQB 2E2HB 1RF2D 4JWSC 1D6EC 2DY7A 3GQBA 4B9WA 1XX8A 4FF1A 4XDXA 3R93A 3D6WA 5I4DA 1XLPA 1RDPD 2K32A 2BDOA 4IFDJ 4JBWA 1DD2A 3MJ5A 3GTKB 4HTHA 3LB8C 1O78A 3J7AF 2N7JA 1OXTA 1Y56A 1B50A 3DWGC 2NTSA 4A55A 1YN4A 1G2TA 2TSSA 2R61A 1ZUD2 1CM9A 2MJ3A 4RCOA 3P4PB 2I46A 4RGNA 4GZYC 4PMCA 5D3IB 4LMQD 2L52A 2GA4B 1LT4D 4DK0A 2Y3AA 1HQRD 5AFWA 1YQ3B 1BMLC 3LNNA 2DLBA 1UWXA 4FNFA 3PO2B 1N63A 1PTOF 1C78A 3HOXB 1HA5A 2F0OA 3TZUA 3GO5A 2YEPB 2F4IA 3S1MB 2L1BA 1BCPF 5M9OA 1VRAB 1PTOD 5H92C 2RBMA 4O1NA 4V190 1B9NA 2L12A 4C3IB 1MHXA 1YNTE 2PVGC 4L2YA 1BBXC 1PZKD 1VLBA 5KNDA 5J22A 4TMAB 2L4NA 1TS2A 5C0XH 1JWBD 2QDBA 1E6EB 3NWTA 1JC7A 1ILQA 2ZW1A 1WTWA 1Z7TA 3LXFA 4BS9A 4A9AA 1B9RA 2JQRB 4IFDI 5M5YB 3VR6A 1JOQA 4C2MB 1JROA 4R8IA 1OO9B 2PYKA 3AB9A 3S16B 4K8IA 2K5PA 2AX5A 2K05A 4JPSA 4I65A 3VYSA 3L7ZC 1SFOB 2VZKB 4RGMA 4IUQA 1FR3A 2KAJA 2VB2X 5JPNC 4A3EB 1F9PA 2CJNA 4X3UA 1D5MC 2F0DA 5I9OA 2WV6D 1UGJA 1SYCA 3IFDA 5A35A 3RPFC 3DWQA 3T4AC 3CRLC 4E6IA 3GTMB 4C7ZA 5BMHA 1Q90A 3NS1A 4DF7A 3ZJUA 3BIID 1WD0A 1XO3A 1NR4A 4NMZA 3T53B 5KNCA 3HGBA 4BWGB 1JWUD 1J7BA 4R3DA 3BDLA 2BYTA 3AB5A 4C1NK 3VRAB 1NAPA 4KJNA 2PW5A 5BMIA 2M9VA 1SYEA 2O5JC 1RJTA 3C1EA 1QCBD 4RF0A 3FILB 2ZT9C 4KGSA 1WTQA 1MI0A 3P1MA 1FNVA 4BY7B 3TBIB 3FKIB 3P4SB 1JQ4A 1FRRA 2EYOA 1O7ZA 1YNJC 3PIO3 2WXMA 3OMCA 3ABVB 1QKZA 2EY6A 2F0NA 3IT4B 5JJZA 1AP0A 3JAME 2FHTA 4C1NI 2E3TA 3KF8A 4KGTA 4I7ZC 4FO2A 5M3MB 1WTVA 3IFTA 4HEDA 4BBSB 2F03A 4QCLA 5HG2A 5G3LD 2QMTA 5E4XA 2X38A 1JCKB 1LTRD 4A6QA 4X3KA 1L6UA 4HSVA 1ZPSA 1B4OA 1CFMA 3T51B 5EPJA 3NRZA 1H9MA 3KBXA 5IIFA 5FLXL 2PZWA 3KLSA 3KUPA 3LWEA 1NSNS 1YNJD 3FEWX 5E3FA 3I72A 1I3QB 5IODA 1Y1WB 2WIIB 4BA2I 1RFKA 1DZ1A 3DHQA 3HZXA 3M4OB 3ZQ4A 3MXGA 2BBCA 3Q6SA 2IGDA 4YTPB 1RTNA 1PRTB 2LMCB 3NSWA 1F77A 2EYLA 3R3OA 3EUB2 2C5CA 1KNAA 5EE1A 3NUCA 3HKZB 1KFYB 1K83B 4XQJA 3NPPA 2NN6G 2B8FA 2EJMA 1A2TA 4P2CB 5IT9L 2L1AA 3I3CA 4ZHOA 4DXGA 1QLBB 1CI3M 1PDXA 3A8JE 3EGRA 3E6ZX 1ET6A 2GRIA 5J1ZA 1TY2A 1TVXA 3S15B 2IT1A 3OIQA 3SE0A 2EYFA 2VUMB 2E2IB 3L4PA 1O7YA 2BOSA 3O13A 2KEDA 2IDYA 3LX0A 4KY7A 3U7ZA 1A15A 2F0IA 5CBEE 4J3OD 1FCCC 2KQ4X 1PFNA 2NVTB 2DN8A 3TEXA 4JE3B 2FFKB 5DM63 2M19A 3S1QB 1PMRA 2LFIA 2B2UC 1V8QA 4A3GB 1SB3C 4C7YA 3M7NA 1OXVA 3H09A 2PNRC 4M8AA 5GXGB 2LHEA 5I2YA 2B2UA 1STGA 1GB1A 2L55A 3MEHA 1X32A 4TKOB 2WS3B 2W54A 1OXUA 1PLFA 1TWHB 1SE4A 2VB3X 3WDNA 2ONQA 3W2DA 4OO1I 3NZ3A 5JVG3 2N9LA 3OWEB 3A8IE 5C5LA 1CQFA 1IW7C 2XRQD 4G4KA 2RQXA 3ITPA 1HCZA 5CV8A 1TZOA 3VR5A 2DY8A 2V4DA 2R6GA 2W55A 5IGEA 1F2ZA 4LAAA 2F0QA 2LKVA 2Z8LA 1M8AA 2SEBD 5CORA 1BDOA 1UNSA 2WKCA 1C76A 3I8ZA 4HCSA 3I57A 3GP7A 1NYRA 4WRDA 1CZPA 1DM0B 2RDHA 4ZQ3A 1S5BD 4G57A 2VNUD 1UEAB 1GUSA 4ZHPA 5DAUA 1EY5A 1I6VC 1PTOH 4A3DB 5ELFA 1SSOA 1IW7D 1NI3A 1RODA 4YIJA 3FPUB 4EQNA 1XF5L 2Y5PA 4IFDG 1SF0A 3HOZB 3BWUD 5BN5A 1KTKA 3J7YW 1STEA 5C4HA 2K7VA 1VF5C 3J80E 4RFBA 3HRDD 3MZ5A 3AECB 3GV6A 4KKTA 4QUFA 2INNE 1ZXTA 4K5XA 4NDXA 1AZPA 2WU5B 3MAQA 2LHDA 5FO8B 4WFN3 1HEZE 3AE4B 3RZOB 3AE2B 1Q12A 2AWOA 5CYUA 1JE4A 3SEBA 1UAPA 1LTTD 3NTIA 3NVYA 1KRHA 2M56B 1GUGA 3AEEB 1EWCA 4JK1C 3TEWA 2LFNA 4YSZB 4K6DA 4O42A 2WDVB 1DOMA 1Z6HA 4C3JG 1W6JA 4RH6A 3N52A 3AE5B 3EQLC 3NTKA 1XXGA 3S2HB 3TEZA 3GTGB 4HRSA 3GS2A 1AZQA 4FXDA 1GAQB 4OIJA 3W9CB 1B1ZA 2EOTA 3PUVA 1QQRA 2G1EA 2WB1B 3B2GA 2MJ8A 5DEHA 3TMEA 2NWGA 4XT3B 4LK0M 1TKGA 3D6CA 3HVZA 1KDAA 1NUCA 2AQ3B 1ZDXA 3ZYYX 1KAAA 1TWCB 3VA7A 1ESFA 1QOFA 1TS5A 5EKKA 5C0XJ 3AE6B 3TP5A 1V1PB 2Z4IA 1A3UA 1G2SA 3J81L 1ZEQX 5D65A 3DXJC 1WSPA 1GPXA 2NVQB 4IN3A 3TN2A 3S17B 1G91A 3TP8A 2EYPA 2YYZA 1TQOA 2B2YC 2F0KA 3SK8A 3H8HA 1CJEA 4YT0B 1SNQA 5EKLA 3NVWA 4CKCA 4EE2A 4XTCS 3DMUA 3FPPA 1H9JA 3BVZA 2D5DA 2B2YA 3SDZA 3AEFB 3AEBB 3Q24A 4FF2A 3A7AB 3HP3A 2H4OA 1TS3A 2Q8RE 3GTOB 2QILA 4KHVA 1D4BA 3HOVB 3MC0B 5BYRA 1H9SA 1R4QB 2DNEA 2EYHA 4KD4A 1T6BX 2PMZB 1C4CA 5COYA 4KN7C 1T3QA 5IOCA 4NAWB 1C48A 2HUGA 3DWPA 1KNEA 2IPKD 3D8GA 3VYRA 4PV1C 4TQ0A 4F7XA 2JZPA 2ZXRA 1JORA 2IX1A 2F0TA 3GV3A 3AH7A 1MHHE 2H89B 2L0CA 2F0WA 4NP5A 4C3JB 4DQOC 1WD1A 1B9MA 1E2VA 2JA8B 2Q8TA 5IGFA 5NUCA 2TMPA 1ZOYB 2OF1A 1QJOA 4HKZE 5C0XI 2E2JB 1T5XD 3MXPA 1W6KA 1FO4A 1BR9A 3SR6A 3X3NA 2PKOA 2CW0C 4XWWA 4XYOA 1VDVA 4IDIA 4RCNA 1D5XC 3BDOA 2KECA 3BYTB 2X6LA 2NTTA 3NQTA 4HMIA 5EPKA 2FMCA 1SMYC 2KMMA 2RPVA 1C4AA 5FK9C 5CV9A 4N9PA 2EJFC 4XXEA 3W1SA 3CHBD 4YTNB 1B44D 1WXQA 4KJOA 2SNSA 3P42A 3KK7A 2F0SA 2NN6H 3JAML 3IAM1 1RM6C 2MPMA 3AU7A 5DNFA 3T16A 2WXRA 1Z47A 3C2PA 2A69C 4OO1G 1TY0A 3NHHA 1ML0D 2KA7A 2KCNA 2N55A 5AUIA 3NBIA 4RKBA 3KWLA 2CW0D 3L9AX 4N58A 2Z4HA 2M0AA 4US8A 3WOFA 2WXIA 2H88B 2HTME 2L9HA 4CKEA 3VQIA 4DA2A 3QB3A 1QE6A 1SMYD 2PIAA 2J7ZA 1C79A 1QB5D 3K7AB 3S14B 3Q22A 2MP1A 2WP8J 3G7LA 2B76B 2PQEA 1JICA 1IGDA 3IAYA 3C1FA 4XT1B 3PZ8A 1LTID 4FXGC 5D7GA 5C44B 5D3DA 3TDQA 5KNBA 1B53A 3IT6B 2A69D 1I4GA 1FGBD 1N60A 1TYGB 3GTQB 1SNDA 3DWAA 1AWDA 4LK1C 2BTEA 1L5PA 4X3SA 5EBCA 1PFDA 3I4MB 1XEEA 2JX5A 3Q8AA 1DXMA 1HHVA 2XRSD 4XDDA 1PRTC 2K5QA 2J4XA 1KLGD 3HOYB 1CZWA 3A56A 1EIHA 4ME5A 1JWMD 1I4RA 2MUYA 3OSOA 4LJZC 1PTOB 2IGGA 1CQVA 4K6LA 1F9QA 3HOUB 3OW7A 1QOBA 5E6JA 1PYWD 4BA1I 4J6HA 3MWYW 4M1UB 2M00A 1BCPB 2R3ZA 2F0EA 2WU2B 4XE0A 1H9KA 2W3SA 1VJKA 4MN3A 1GUOA 5CV6A 2FBWB 2QSDA 4XQNA 5EE0A 2I2YA 3K5NA 1WTRA 4ZRZA 2F0LA 3CRKC 4RKLA 1WVLA 4ZUJA 2K9XA 1Y8NB 5CV4A 2BS4B 1LACA 3QO2A 1XLOA 5EE9A 1PRTD 4MACA 1LTBD 4IFDH 1QOHA 4KX6B 2BS2B 2O2LD 1FNUA 5G3LF 1EWHA 1F2RC 3EA6A 1NVID 1CTMA 2K28A 2NVXB 5IGGA 1J8IA 3PV0A 1K8OA 5A2QL 4RGTA 1I6HB 2B39A 1ZE3D 1DOIA 2WXJA 1EQVA 3CU7A 1ZKOA 3AE9B 1E0ZA 3NVVA 3AE3B 1FIQA 2R92B 1TU2B 1PUTA 2WXGA 2RVLA 1VZ6A 1FYCA 4Y7NB 1EOTA 4H7BA 1JWAD 2EELA 4IOIE 2G9DA 3ND9A 2K3UA 4BY1B 2KACA 2Q8IB 3RUZA 5JEAH 3K6OA 4IUUA 1HUNA 4Q2JA 5CBAE 1OQRA 2K5WA 1Y1VB 2NBFA 4ABNA 4DU9A 2CJOA 2K04A 3B9JA 1DJRD 2F0UA 3Q8FA 5J39A 3PUXA 1LT6D 3T13A 4ZK9B 2WACA 1HTPA 2J52A 4CJ2C 2FMMA 4FP5D 3S9WA 3NBHA 5EBDA 3J7AV 4CKBA 3SK4A 1KLUD 3I4NB 2J42A 1FMAD 2KUMA 4K2LA 1I4QA 1F0ZA 3X3MA 1L4ZB 2JP1A 1WTXA 1JR0D 1RHPA 5LL6S 4PNYA 4ZUIA 4XQQA 4XYQA 1P7FA 2LGIA 5HFYA 3FVQA 1D5ZC 2D2CC 2ID0A 1F9SA 3P75A 4A3MB 5G5GA 3V96A 5KYLA 3BVMA 1TR5A 2DNCA 5EQ0A 4DAVA 1DOLA 1XWEA 2NZ1D 5LL6X 5JXVA 4MH8A 2Z1CA 4ODGA 1WYGA 4GLSC 2D9UA 1EU3A 5CMDA 4PQXA 1HRJA 5G5HA 5D14A 2KVMA 1N62A 2E75C 2DYMA 1U4RA 2VXWA 4C56C 4CJ1B 3LYYA 1SYFA 2F1MA 4REZA 1LTGD 4ZYSA 5KRUA 3PMFA 1TKWB 1G291 4HR7B 1F2LA 4JWUC 1R7SA 3MXNA 3KWVA 5C0XG 2LJIA 2WXPA 1RWSA 2KOLA 3KLSX 3E56A 3AN1A 3I9V1 4RHRA 3NUHB 4N6EB 3DM1A 4MHEA 2F0PA 5H8YE 3VR2A 1EEFD 4ZOHC 3D4DA 2EYJA 3P63A 2XN9C 3CWIA 3RZDB 2M2LA 3PO3B 4DAYA 4HKQA 2HQEA 3PUWA 4F88A 1BXTA 1GHKA 1PZID 1MSHA 2CHBD 1JMLA 4GDLB 4ARCA 5C5MA 1SBBB 4ZAIA 3NK9A 2OXPA 2KHSA 2KEEA 1S5DD 2KWDA 2WINB 3A8KE 3EROA 4ZKBB 4P6VF 3OIPA 5C4JB 1U4LA 1PDQA 4YXDB 3FDTA 3VR3A 4HCEA 2EZVA 1HQMC 2K1BA 1MSGA 1GOZA 4ULLA 2LUMA 2L32A 1MVKA 3C8YA 1FCLA 2JA6B 2MEKA 1Q3LA 1ZP0B 1J7CA 3EVQA 5KGUA 1GXDC 1SYDA 2XWJB 1AEXA 1QNKA 3V2TA 4CGYB 3C3LA 1LT5D 1TJEA 4FXKC 2A73B 4HEA1 2GI9A 4K5WA 2NMQA 3EFXD 1M4VA 1S4ZA 1V1PA 1XLQA 4A93B 1MD2D 3H3VC 5M5WB 5F2DA 3AEDB 2E76C 1IUEA 3E9SA 3IL8A 1ET9A 5EKIA 5KEEA 3N9YC 1YNNC 4DNRB 1I4PA 3T3NA 5C2TB 3L3OC 2EVBA 1ZDVA 5ELCA 2ZXPA 2GB1A