1T5XD

Hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A Polymorphic Pocket at the P10 Position Contributes to Peptide Binding Specificity in Class II MHC Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 69
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1t5xD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1t5xD02
1F77A 1LT5D 3R8BA 3CHBD 2RDGA 1CT1D 1DYQA 1CHPD 1SE3A 1EU4A 4L6TB 5FKAC 3EA6A 4RGMA 1S5DD 4RH6A 5TSSA 1BXTA 4RFBA 2R61A 2WV6D 3W2DA 1EWCA 1AN8A 1L0XB 1PRTC 1SJED 1TS4A 2RDHA 3BVZA 3V05A 1RD9D 1KTKA 4Z9CB 1EEFD 1SE4A 1LO5D 1S5BD 1LTSD 2G9HD 1HTLD 1BCPC 1GOZA 3BYTB 3KLSX 1D5XC 1JQYD 1TY2A 1LTAD 2SEBD 3EFXD 2ICIA 1LT4D 2AQ3B 1PZKD 2NTSA 1QILA 1PRTF 1PZID 1D5ZC 1SEBD 2XN9C 2IPKD 3DWQA 1HXYD 4DXFA 3SEBA 2CHBD 3R2IA 1ET9A 3DWAA 1I4PA 1LT3D 3BYYB 1TS2A 1V1PB 4C56C 3MC0B 1CQVA 1RCVD 4RGTA 3URYA 1FD7D 1LLRD 1ESFA 2QILA 4DXGA 1YN4A 1BCPF 1PTOC 3DWPA 1XXGA 1SXTA 1EFID 1EEID 3GP7A 2TSSA 1S5FD 1HQRD 4UDUC 5D3DA 1HA5A 1DJRD 1LTTD 4RGOS 4L63B 4BWGB 1RDPD 1PTOF 1CK1A 1BCPB 1YN5A 1D5MC 1RF2D 1JCKB 1PRTD 3BZDB 4TSSA 4RHRA 1B44D 2XNAC 2AQ2B 3OWEB 4NZLB 1B1ZA 2IJ0A 1JR0D 1TS5A 1M4VA 1STEA 1ENFA 1FNVA 1AW7A 1KLUD 1I4HA 2XRQD 2QEJC 4RHSA 1LT6D 2Z8LA 1LTGD 1YN3A 5ELFA 2AQ1B 3BVMA 1BCPD 1ET6A 1I4GA 5ELDA 1JWUD 1D6EC 3MFGA 1PRTB 5ELBA 3TSSA 5I4DA 1XTCD 4RCOA 4O1NA 5FK9C 3R2TA 1SE2A 1KLGD 1FGBD 1PTOB 4ZYSA 2NTTA 1I4XA 1UUPA 1JWMD 1FNUA 1S5ED 4K6LA 1I4QA 1JWSD 2J4XA 4OHJA 1LTID 1UNSA 1EU3A 1V1OA 5D3IB 1PYWD 3BVGA 2O2LD 1PTOD 5ELCA 1S5CD 1G8ZD 1V1PA 1L0YB 1T5XD 1FNWA 5ELEA 3O13A 4RGNA 1TS3A 1CHQD 1I4RA 1MD2D 1TY0A 1SJHD 1PZJD 1LTRD 1LTBD 1PTOH 2XRSD 1SBBB
chains in the Genus database with same CATH superfamily
3VDZA 2PPHA 3ZVVA 3AEEB 2JF5A 2Z0DB 4HJ7A 1QUQA 4KV2A 1RIPA 4ZUIA 1WMHA 1QJOA 4J6IA 4XDDA 2L3ZA 1E22A 1X54A 1S5DD 2WDVB 2MJ8A 3CD6A 1OXUA 2WV6D 5AUIA 3V3XA 4KSLC 3DHQA 2MP2B 4EE2A 3RN2A 4DR2Q 2WXMA 4PQXA 4DV6L 1STNA 1KTKA 3OWFA 1JRPA 2HCIA 4LWCA 2UXDL 1B4OA 1YD8U 3QX1A 3QB3A 1X9NA 4A4IA 5C3JB 4A3LG 4GLSC 3SVMA 4DHJD 5A2QL 4J3OD 1CI3M 4UP7A 3RT3B 2NTSA 5LMNQ 2V4DA 4KN4C 4TKNA 2F3IA 1A3UA 2QKIC 3DWQA 3ZQ4A 2Z0SA 2LXCA 2KDFB 2WGSA 3V6CB 1QG7A 1RCVD 3T16A 4W9FA 3LWUA 1UEBA 1X6OA 1TYGB 4KKIA 4B0MA 3GTQH 2PJHA 3KBGA 4F7ZA 2JA7G 4WWOA 4XDXA 2DZJA 1PFMA 2BA0A 3N30A 1JRUA 1N9WA 1YBYA 3Q8DA 4GLXA 2UU9Q 2EXZA 4C2MB 3B2FA 4B3RL 1MKHA 3B2GA 4LDTB 2GVAA 3OTOL 3S16H 1G2SA 4N8X1 4FF3A 3ERSX 3F2DA 4UDUC 3D32A 4KKTA 1TWGB 3I3TB 1V81A 2MFIA 3ZNZB 2NVTH 2KWDA 2UWQA 5J22A 3HOYH 4L63B 1DD2A 5IA7A 2VB3X 2RDBC 2JWUA 3QQ8B 3I90A 3TQYA 1YN5A 1I94Q 2C7HA 2J52A 5M5YB 2V3PA 5E1FA 4LUVA 2CCZA 5E3FA 2F03A 1F2ZA 1QLBB 1B1ZA 3HKSA 2HIVA 4AIMA 2MGSA 3ZNHB 1L0WA 2JXXA 1KD1C 3WALA 2REXA 4P73A 2NWGA 2L11A 4A3FB 1B9MA 4QUCA 2AQ1B 1NEKB 5C0XJ 2MP2A 2BWES 4IPHA 3EUB2 2EYPA 2WXPA 2K5VA 1K83B 3CPWA 4P1BC 1JMCA 2RCFA 2BE5D 2GBRA 1BUIC 2VUMG 2K05A 2IY5B 3S1MH 4HEA1 5C4JB 2KNBA 1STHA 3SHLA 1BQQT 1JMLA 3VH3B 3R7RA 1I4XA 2O6VA 3PCOB 3OIQA 4QQBX 3DBHI 3K0YA 2Y0SB 4GKKQ 4LMQD 5DLQE 3RZDH 2ASQA 2VW9A 4G7ZC 3CAMA 1AZPA 3DDCB 1YVCA 2F0GA 4RKLA 1D8LA 2ZM6Q 3EJIA 3I70A 4K7SA 3FPUB 3SDZA 1KC8C 2IO1B 1A15A 2OQKA 1I4RA 4Q5VA 5CV5A 1TY0A 3NSWA 3P1HA 4DK1A 4FF1A 1IL2A 4ZRQA 1E9MA 2BKRB 4DV1Q 3OG5A 2ZJRA 2E6XA 3HOVH 4II3B 3CHBD 4BVUC 4RMFA 3UF8A 2LGXA 2BT6A 1CHPD 2FE8A 1SDFA 3N1ZC 4ANVA 1Y8NB 1PFBA 3EA6A 4IUNA 2ASBA 2PW9A 3VRBB 3S2HB 1B53A 1CKNB 3D6CA 4LUOA 3FKIG 1XNQL 4WIPA 3HOUB 1TTNA 1DXMA 3AB5A 1SYFA 2K8HA 3TJPA 1NBWA 1GB1A 4MM3B 1NYRA 4FN2A 4PT5A 1MVKA 1AH9A 2INPE 1Q10A 1WRDB 2DZMA 4WH4A 4LJOB 1T3QA 2KACA 3B08A 2BW2A 3A5ZB 1KAWA 1SYDA 4DR1Q 1XF5L 2CWAA 4A3EG 3T51B 2WXGA 1EOTA 2OEOA 1H9MA 1HXYD 1IUEA 4WAFA 2BA1A 2DHZA 5CC4A 2K1BA 3UIOB 1BO0A 3QO2A 2H88B 1TWAH 2C7NB 3P4PB 2BDOA 5EBDA 2DBYA 4IWPA 1VQLA 1VQNA 1QOGA 3CMAA 1BNZA 1LABA 4NXNQ 1CZGA 2K03A 5CORA 1RODA 3T4AC 1N34Q 4K81A 4LNIA 3L0OA 2WXFA 3BG3A 1PDXA 3AEGB 2NBVB 1NUCA 2XWBB 1YQBA 3LYYA 4IOIE 1YITA 2E2IH 3LJ3A 3NTIA 3W5VB 3BDLA 4BBSH 4RF1A 2PW5A 2TSSA 5IAAC 4JL9A 3H09A 5BO4B 1HQRD 1ZKOA 1EZ8A 2F0NA 4WJ4A 3QC8B 4PK1A 1WJNA 2KCNA 3NVVA 2VQFL 1MFWA 3VR6A 2A4ZA 2O2VB 1IYVA 1QOBA 3CRLC 3RD4A 2QGQA 1QT9A 4DV5Q 4MDKE 3DHGC 2CU3A 2LHDA 2BYEA 3TL5A 1EYAA 1B3QA 1DOKA 4DWFA 1JCKB 3DUZA 2JA5G 5HGQA 3VTWA 2Q2IA 2FFKB 4J8QA 1J7CA 1GVPA 4HCPB 2WINB 2CH4A 4XE0A 5LXHA 3T53B 3HOWB 2EKEC 4DNRB 1OO9B 5M3FB 4C3JG 3MVVA 1CKNA 3UI3A 3M4PA 1BCPD 4X65L 2WACA 3DM3A 4JBKA 4JI2Q 5IP7H 4MM3A 3K0XA 1YIWA 5FO9B 4DUZL 1ZKHA 4G11A 1FGBD 1GAQB 4OWTB 1HUMA 3BDOA 1AE2A 1BKBA 4LK1C 2YTXA 1F9QA 4X62L 1C8CA 3NS8A 2MQHA 3VR4A 1K52A 2HCCA 1VQ5A 1JWSD 4R4TA 4TMAB 4R4OA 2AL6A 1K73C 2N7JA 2ZXPA 1ASYA 1SROA 1YZ6A 3U4EG 4LFCQ 1IW7C 2HJ1A 3IHPC 2KA7A 4OIKA 1BOSA 1P16A 3NPPA 2WP8J 5IT9L 5C0XI 1NJIC 3M4OH 3HKZE 2IO2B 4XT1B 3W1BA 2V4IB 4EEWA 1FFUA 4JBJA 3TZDA 1XPOA 4HJ9A 4XWWA 3Q22A 2WAQB 1KM7A 1EIFA 4DR7L 2K25A 3GV6A 1SBBB 1SE8A 3S14H 2E2JB 2ZPYA 3VR2A 1XYIA 2J0TD 3S2DH 2KYWA 4S17A 3Q3MC 2QCZA 2WB1B 4W9LA 1OQRA 1WGGA 3K5MA 2F0SA 1K28A 2H4OA 1N32Q 1XCQL 1E0ZA 1SAPA 2IWHA 1J9OA 4RFBA 1C7YA 2PIAA 5M5WH 3W2DA 2O2VA 1BDOA 4ZHPA 2KECA 3P63A 1TS4A 5AZFA 3RLOA 2WXNA 2ZNVC 2ZZPB 3KUCB 4GOCA 3Q6BA 1ZXTA 1EFWA 5J18A 1P3QU 5C0XH 3L0WB 1B9RA 2M0XA 3DHIC 2ZEQA 1N33L 4DUYQ 2C5CA 2GI9A 1SNQA 4P6VF 4OX9L 3RZOH 1XMOQ 4OONA 2WAQE 1TWHB 2VQEL 5KNDA 2OF1A 1W2BA 1N36L 1E8XA 1UWVA 3NEMA 2K6DB 5KHOA 4NW2A 2LMCB 4A3IH 1FM0D 3IBEA 4HMJA 4II2B 4XC2A 2WB1E 2IPKD 3ECIA 1KABA 1X32A 3J80E 3AE1B 2N78A 3X3NA 5BMGA 3CWIA 2B63H 5LL6S 5BN3A 1EYDA 3DVGX 3J7AF 5FO8B 2WHIA 5BMHA 1AP0A 3NZUA 1QE6A 1BCPF 2F3VA 3S2AA 4A3GH 4ARIA 1A62A 2JA6G 1H9KA 1FVIA 2EELA 5AJ3Q 2O4XA 1T0SC 1EWHA 2M17A 2XIWA 4XQJA 4GGQA 2HDEA 3U9OA 2D5GA 4JBWA 2OT2A 2B8GA 4HPPA 3PO3H 3KF6B 1GJZA 3J80i 1VQGA 3BZKA 3MP9A 4IC7B 2E8GA 2N9PC 5BR8L 2KCTA 1AE3A 1TWFB 2L12A 3KLRA 1S1QB 4GXBA 1GG3A 3EROA 4C00A 1X3QA 1J5EQ 2YU9B 1ACCA 1EF1A 3S15H 3I7FA 3VTUA 1MGSA 1I5FA 4IKGA 3C19A 1RF2D 4ZDVA 1QNKA 3CSFA 4A3FG 3K80C 5LMUQ 2XNAC 3A4SC 3OWEB 3HVZA 2E2DC 1NMGA 1QZGA 1P7EA 2E5LL 5IP9H 3KWLA 4G50A 3UE0A 1STEA 5IYBG 2EJMA 1BF4A 4DR4L 3N3KB 1FCLA 1HNZL 3MHSD 4P7IA 2DJGC 1NVID 3I4MH 1ML0D 1L6UA 4HDQA 3NS1A 3GTPB 3QWZB 3ABVB 3KJOA 2IBIB 2XWJB 1LQBA 1MBYA 3BK2A 1PRTB 2BF8B 4B9XA 2HIXA 1ZDXA 2CHXA 2NN6G 3RNBC 3WAOA 3T3OA 4N8FA 2QCPX 5BN5A 3UDGA 2Y0SG 4LF5L 1WYGA 1RWSA 1JWMD 4GLAC 3KYCD 4RNAA 3JAME 4ZKCB 2R7ZB 3EIVA 1J19A 2YLMA 3AMZA 3PREA 2HHHL 4BOSC 4ZOHC 2LD9A 4QIWB 2IYDB 3WOFA 2GOWA 5FLXE 1MJEA 2VY3A 1EU3A 4M8NA 1X3PA 1V1OA 1ZP0B 1EIHA 1HNWL 2ZCCA 1ILPA 2PMZB 5JVG3 1F9SA 1HJPA 1L0YB 2ENBA 2K5DA 3MAQA 1EL0A 1WRIA 1MD2D 4A3BB 1L1OB 2CVRA 3L3OC 4I6LB 2VL6A 1NDDA 2L7RA 3A7LA 4F88A 2GBJA 2L76A 2VH2A 4A55A 1WYWB 3JAMi 2PMVA 2B29A 4QGUA 4H7BA 2AMCB 4TRDA 5KYLA 1DOLA 4OZBA 3G71A 2R6GA 1J7BA 2Z0EB 4HRSA 3KF6A 4DK6C 3DCGA 2ZCBA 2D3CA 3AE7B 1ZDVA 2KJXA 3TDQA 1DM0B 1MHWC 2FUHB 1K3RA 2C35B 3SFEB 5IGGA 2R93H 3H1UA 4M1UB 3ZLZA 1WCMH 2RVLA 3I73A 3CCRA 1SYBA 3EC8A 3Q23A 2JK8A 1GB4A 1Y1VH 2ATWA 1Q8KA 4DBGA 5EKIA 4A3CH 1HTLD 1SMYC 1I3QH 4DV2L 2B2VA 4US9A 2ICIA 4LNQA 4IG7B 5AZHA 1XLQA 1JJGA 3NENA 1VLBA 5TR5A 1PDQA 4NAMA 5D94A 3DEOA 1WY8A 2LVPA 3DWAA 4IFDG 3AU5A 1HTOA 1RAXA 3ZKJC 1EYCA 4LF9Q 2G3QB 2QILA 2LEKA 1NNXA 1C4PA 3AM9A 3L08A 3HK0A 2DGYA 2CH4W 5IGCA 1OTCA 3ML8A 2AWTA 4MACA 1SXTA 3W3AA 2WS3B 1D3ZA 2DNEA 1HA6A 1PYBA 2MO0A 1JORA 2VZKB 2KK8A 3U50C 1F9RA 4E71A 1JC7A 1Q1EA 2K4KA 5ISRA 4RGOS 1ZXIA 4JI4Q 1JOQA 2L00B 2HD5B 3CQZB 3K8AA 3NZ3A 3M95A 1IHZA 1ICWA 2KQSA 1L1OA 4KD3A 2N9LA 2A74C 2N9XA 3SXHA 2MBEA 1SSOA 4KY7A 1HZAA 1BT0A 3HOWG 2CFMA 1V80A 3J81E 2KHWB 2INCC 3HKZG 5M3FG 1NSNS 3D6WA 4GLVB 4KJOA 3SK8A 2I46A 5CR3A 2KX3A 3KQ4A 2N9KA 3GTMB 1YNTE 1SGHA 2B2TA 2KN4A 3AH7A 1FJGL 2I0QA 4FJZA 3IAS1 3SE0A 3RULA 4GNXB 4HJGE 4J15A 4DR2L 2K5PA 3P20A 2MLBA 1Z9FA 5E6NA 4YCUA 2ICEC 5MPOA 1A3TA 1E5WA 2Q2HA 2JP1A 4KI0A 4DV3Q 4CHKA 3J81i 4I65A 4OO1I 4U673 2K5QA 3GE8C 2NVYH 2KCMA 5JEAG 2NVXH 5CHFA 4ZRIA 1FNUA 2LUMA 5E6PA 4A9AA 1ZE3D 3MJWA 1IYJB 2KLGA 1GUSA 1Q5WB 2ID0A 1NMFA 2R7FA 4IFDJ 1TT5B 1GC6A 2WAQG 3BVGA 4A20A 3ZXVA 2B2UA 3U2SC 1MG8A 2JZPA 1F1HA 3NK9A 4JV5L 1WR1A 4PYUA 4HIMA 4AUQC 3O13A 1PYSB 4IUQA 1FPYA 3STBC 2KC2A 2VH1A 2WB1G 4CGYB 4BY7B 1N61A 3GS2A 1U4PA 3OPOA 3DBLB 2C9OA 3LWEA 1DONA 2OQ0A 1V2YA 2V3NA 2C9WB 1FEHA 1Q46A 4OO1H 2KT7A 4E3CA 3U7ZA 1ASZA 2LJIA 1RLFA 4ICVA 4MEMA 3I63C 1WX7A 1L4ZB 2OEDA 1Q7YC 4LW1A 3BS1A 1PH6A 3GB1A 2NPTA 1V49A 2XSCA 4FF2A 4US8A 5C3WA 1Z7TA 2I5HA 1QWYA 3NHHA 2F4VQ 3LB8C 4JLCA 1KLVA 4LF7Q 3PPAA 3Q14C 1QOAA 1RD9D 3X0WA 2E74C 1OGWA 3JYUA 2YEPF 4ILWA 2NZOA 3TZUA 4R4CA 3U52E 1R9TB 1R4MB 2G9HD 4EUTA 2JA9A 5AUKA 1Z5SB 3HGBA 2D2CC 4H13C 2QIEB 3PUZA 2VRRB 2KKCA 1D5XC 3P4QB 3VR9B 2XK5B 1WI0A 3IFTA 1SFOB 1RKNA 2D3GA 2EYLA 2ALYB 2MPMA 2FNJB 1DGJA 3A56A 2XN9C 1TKWB 1RTNA 4MZ9A 3ONSA 1WGYA 2PQAB 5G2NA 3A9JB 3KUPA 3VAWA 2BWFA 3AE6B 4GNXA 1E10A 1KRTA 5GAGC 4XGAB 3HRDD 1XX8A 5HFYA 2DYBA 1CQVA 4CJ2C 3TS2A 2SOBA 2D0OA 1ESFA 1ZOYB 3APCA 4B6WA 1A2TA 3BY4B 1CZPA 3ZTDA 3FILA 5GAEC 1IW7D 4JW0A 2VS1A 1EWYC 1NI3A 1PTOC 1WTPA 2QMTA 1VQOA 3E9SA 3FAHA 4I7AA 1VQKA 3RNFC 1BMLC 1KF6B 4X3KA 4CJ1B 2GBKA 3K9OB 4GKKL 4ZK9B 1EEID 2AHOB 2RQXA 2MQJA 4GB9A 3NZSA 3JSVB 4AS1A 5LHY1 1HA5A 1L5PA 3DWGC 5HKHA 1X56A 4N58A 1WGRA 3KF8B 4A93H 1V9JA 1E2ZA 2RBMA 2E2HB 1EUJA 4FADA 3OMCA 5JHAA 5M5YH 1W6KA 4QY7A 2J0MA 2RCNA 1WXAA 4DV1L 1PH7A 3SD5A 1NR2A 1WXVA 3NWTA 1CSQA 1G6ZA 5HURA 2B2YA 1XEEA 3Q3NC 4TUUA 2E76C 2IJ0A 1QCBD 4J1MA 4DAVA 1PGBA 2NBWB 2KXJA 5EPJA 1YIJA 5HI1A 3BINA 1PFNA 2FIDA 4ANXA 4KN7C 1RYJA 3S1QB 1UE7A 3NTKA 3J7YW 1PH2A 1VQAA 3C3LA 2R7ZG 4RCOA 4C3HB 4HKZE 3H0GB 2DNFA 3WIMA 3CCJA 4IO9A 2I5MX 4YHHQ 2EMTA 1UE5A 1G6PA 1RFKA 4JGHB 4W9JA 1O7IA 1I6HB 4BBRB 3ENEA 2IHFA 2XK5A 4YWGG 3F1ZA 3L4PA 1LACA 2X8XX 4A3DB 5FR6A 4DR1L 5IY0A 2KHIA 3V61A 2KQ3A 1B7YB 2EXDA 2PI2E 4BY1H 2PQAA 2M1MA 5D3IB 1MHXA 2JYEA 1AARA 3M3YB 2FMMA 2IO3B 4R4QA 3TP5A 3KUDB 2ZTEA 1TS3A 1UE1A 4NXNL 5IOCA 5JJKA 3FC4A 1IBML 1GUGA 5DNFA 1ONLA 4TQUS 1F77A 4N9F4 2JY6A 3SR6A 3JC66 4ZAIA 5IGFA 1AFPA 5C44H 3I56A 1EM7A 1K8OA 2KVRA 4WWNA 3H15A 3CCSA 1KJTA 2H1EA 3ZTCA 5E4XA 3PIPA 3HOUH 4JPBW 4ID6A 3G4SA 2MBBB 4IFDI 2W54A 2FXQA 4A3KH 3S1RB 1LV9A 2W55A 1PRTC 3OJ4B 3GV3A 1U4AA 3ND8A 4N9TA 2KMAA 3TUOA 4JK1C 2KJHB 2A68C 1HZCA 3WOEA 5C3XA 5EPKA 3TEHB 2R92G 1YNNC 3GE3C 1QQRA 4LAAA 3LNNA 3S24A 3T1YL 4GMVA 4ZCKA 1F9PA 1AYFA 2PI2A 4B3TL 1ZPSA 3Q0AA 1JQYD 1V5TA 1GHJA 1IYFA 3IFWB 1PZID 4X3TA 4DV0Q 3GTJH 2CU1A 3E9IA 1A6XA 1Q3LA 1HRJA 3RUIB 2MW5A 1EY8A 3BYYB 2GBNA 2HQEA 4JI2L 2JA8B 2J53A 3PSEB 1C48A 4A90A 1GUAB 1LLRD 1SLJA 1XTDA 4CDDC 5NUCA 1IGDA 4I6PA 4OZCA 1LTLA 2F0UA 4V0BA 3PMFA 5A35A 1BBXC 5CMDA 3KUZA 3DWPA 2RR9A 3KYHC 1PH1A 1VMCA 1TGZB 2IGGA 1T9HA 3GD7A 3N52A 2JXTA 4GN3B 5ELNA 1YJ1A 3DPDA 3CP0A 4YXDB 2IX3A 4LF6L 2Y3AA 4C7YA 3TP8A 1XMQL 2JRHA 2O6VB 3H9DA 1CSPA 3HP3A 4A3JH 4JX1C 3FHWA 1F2MA 3CRKC 3HIZA 5I6YA 3MWYW 1HZ6A 3DBRB 5I9OA 2J0JA 3QR8A 2UUAQ 2JVCA 4OZAA 2Q8IB 5D14A 1BR9A 3RNUA 1E90A 1CZWA 2KHSA 1SF0A 3TP7A 3PF4A 1VQ4A 1LM0A 4QCLA 5M5XH 2EY6A 3T56B 3GTOH 1D5MC 2Z6KC 3IL8A 3PUWA 3ZJUA 4X66Q 4FJYA 4L1BA 1U4RA 4IPDA 4K8IA 4DV7L 4K0KQ 1ENFA 1VQFA 3QJYA 4IPGA 3ZYYX 1XLOA 2BYVE 2MBOA 1I4HA 2LGDA 4C3IH 1LUZA 1FO4A 4LCDE 1SMYD 4B3MQ 2HTME 2JA6B 3NUHB 1JWUD 1KNEA 2QDBA 3D31A 3MFGA 1N5XA 4XWTA 5FJ8H 3K6OA 2QSDA 2KUMA 1WVLA 3D4RA 3S1NH 2ZTDA 3F2CA 1ZEQX 3N20C 4DAYB 4LNFA 2JYTA 4DXAB 1XMOL 1EY9A 2LZ6A 3QG1A 2FINB 5T1IA 4K6LA 3UDFA 1KRSA 3K7AH 1Y1WH 3GOEA 4DK5A 2MH7A 1HHVA 2J4XA 1K8MA 3ERQA 1OEYA 5EE3A 3DM1A 3CC7A 3A0JA 4BY7G 4LF8Q 1GKHA 3H7SA 1YHAA 3CF5A 1T0QC 3AU4A 5C2TB 2HDMA 1T5XD 2AWOA 2PW7A 2RSOA 2UUBQ 2MO1A 5IOIA 4RGNA 3VVWB 3ZJTA 1CHQD 4RG1A 2I1KA 2RHQB 5IODA 1M1KC 3GDEA 1PTOH 4RKBA 4JPSA 1F0ZA 1Q90A 4HIOA 3FPPA 4RF0A 5AJ3L 3HM3A 3RD2A 2M2LA 1A3VA 3IRBA 2RDGA 1CT1D 5T1GA 4WJNA 4YT0B 2I38A 4XX5A 4JI7Q 5IYDH 4YTPB 4RGMA 2MA9B 4P72A 2N55A 4GDKB 4JI1Q 1EIYB 3PUYA 2Z6BA 3KH0A 3W1SA 4CJ0B 3BJUA 5GADC 3WANA 2KJRA 4YTMB 3G7LA 2KBNA 5KYIA 3VQIA 1WM3A 4GKJQ 3SR1A 5GROA 2UUCQ 1SE4A 4OWWB 4P71A 1C76A 3R66C 4A8XC 1ISNA 3L13A 5JHBA 2MCNB 1XNRL 4WJQA 4X64L 2QDFA 2NUCA 1WD0A 4IURA 3FP9A 3I4NB 2AQ3B 1N5WA 4GIVA 1PGAA 1UGJA 1U0LA 2PYKA 4POGA 4CO7A 2J7QB 1SSNA 3KOJA 3K59A 5JVH3 2PVOD 4KK7A 1I4PA 3PTFC 3H91A 1MPEA 5G3LF 2K50A 3I8ZA 1Q12A 2ZJDA 3HUIA 3X23A 2ZVNA 4DAYA 1M90C 5J3BA 3RCZA 3NQIA 2WKCA 3CCVA 3SHQA 4L5QA 4IQZA 5IYCG 3STBD 4KY6A 1OTRB 3QCAA 3AYHB 4G57A 1IPGA 3EBEA 4PZ8A 4DR5Q 2N7DA 2BTEA 4PG3A 3CCMA 2VB2X 3HOXH 4IOCA 1EYGA 5D7GA 5L37A 2ZTCA 3UINB 1RDPD 4KHZA 3ZIMA 3I4OA 4KTAA 4A3MB 4M0WA 1CKMA 4XYOA 2DUDA 2IY0B 1KHIA 4TSSA 4USAA 3KK7A 3HOZH 2EVBA 4GOPB 2AX5A 4NZLB 2XVSA 1JR0D 2IX1A 1YX5B 2UYZB 2WXLA 3JVZX 2RF4A 3TP6A 1ROEA 2PPBC 3P4SB 4GDKA 4OVVA 4P2CB 5FLMG 1VCBA 4C3HG 2Z8LA 3H0GG 1VQ7A 5KHQA 2GA4B 2WDTB 3OLMD 3E0JA 3BK1A 1WTHA 1AZQA 3W1YA 1EWIA 1GUTA 4BBRG 1JB7A 1YHQA 2LRWA 1A0IA 5C3EG 4A3DG 3A74A 5C4XG 3S17H 2RPVA 4WURA 4JI3L 1GUWA 3I3CA 2EYOA 5G5GA 3HRZC 2L9HA 2OCEA 3NTHA 2F4IA 4MT5A 3SGIA 2O5JC 4HSPA 1XQQA 2KQ7A 4L5SA 2B3AA 5M3MG 2B2WA 1UNSA 5EGTA 2A6EC 4HCSA 1HPCA 5E6OA 1LGRA 2K01A 1Q81C 4UP8A 4A3BH 4ZRZA 3AE9B 1PTOD 2F0PA 3HM6X 4EOYA 2YV5A 4A76A 1R4NB 3HKZB 1P8LA 1UZXB 1TIID 4NKLA 1V5OA 3NBHA 2X6LA 2UXCL 1VDZA 1LM8B 2F0KA 2N49A 1IBLL 2L4NA 4DHZB 4JYAQ 4NY0A 4CBVA 1J8IA 1TXYA 4DGZA 2J7ZA 3TMPB 1NCVA 1FGUA 1ZYRC 4PNYA 4AQYQ 2LRUA 5E7NA 1VQEA 3CC2A 4XYQA 3DOWA 4IM0A 4YWMA 4IUTA 2L55A 4NXMQ 1EOVA 4JI4L 3Q3OC 2DNCA 3PO2G 3NVYA 4AH6A 4BXXG 1HEZE 3C0RB 4MH8A 3GTQB 2FIFA 4LNKA 3TEYA 3D0FA 3HVDA 2JQRB 1S72A 5IGEA 2IGHA 1IZ6A 1WX8A 2KEEA 3VXWA 1V43A 2MEKA 1WXSA 1UBQA 4GOPA 1TVXA 3CKIB 5K36G 4MELA 5DCNA 2RDFA 3IAM1 3E0EA 3KFUA 3I9V1 2D62A 3S16B 1JOKA 3O65B 1YJWA 2JA8G 4BKGA 4DHZE 3KDFB 1X3FA 4DV6Q 4V190 1OFFA 1WGDA 3UIPB 1WI5A 2NVTB 2NBUA 4AP4C 4DR3Q 3I91A 3HOYB 1TS2A 4K5WA 3U4VA 2LVOA 3ZO5B 4A6QA 2HD3A 1WX9A 3DXJC 3RNGC 2LI5A 2D10A 2BH8A 1HZBA 4M00A 4WORA 2GB1A 3EHVA 4HVBA 4GSWA 1O78A 2TMPA 4ME3A 4URKA 5GQOA 1U9RA 2CKHB 1XLNA 4BKSD 2F0HA 2PNRC 2YTYA 3AB9A 4CDCC 2ZVOA 4A3LH 4FXCA 1I50H 2WDQB 5D3DA 2Z59B 2K32A 3CCEA 1E7UA 1MI0A 3RI7C 1L2NA 4HR7B 4K2LA 2RSNA 3B0AA 2NZ1D 3NHEB 5DM63 1PTOF 4B3RQ 3S1MB 1KIXA 2JEAI 1BCPB 3MEFA 2G1EA 1LYLA 3VYTA 5HHDG 3F8TA 1PRTD 4QMGA 3OTOQ 1IBKQ 1KDCA 1D1KA 4F87A 5LMNW 4DDID 3TEWA 2I2YA 2ONQA 2A68D 2IX0A 1HR0Q 4ICUA 2W3SA 3SDLC 2EIFA 3RFZB 2JA7H 4L5TA 1YNND 5G55A 2V3SA 1O80A 3MC8A 1KLUD 3RZDB 5M9OA 3WWVA 5LL6X 4IALA 1HFGA 4M02A 4Y7NH 4LF7L 2WLBA 1ET6A 1VD2A 1WH3A 3NELA 4RAUC 2FUG1 1YX6B 1WXQA 4HK2A 4JI0L 2PO4A 1OEYJ 1V9PA 2A1AA 5FK9C 2MNAA 2EY5A 4JCVE 4REZA 1VMPA 2MHVA 3J80c 2WXRA 3IKJA 3Q8CA 3T9LA 2A8VA 1YNXA 3MHZA 1WE7A 4AQ7A 4O0AA 4HAEA 3GTLH 1U5KA 3T1HL 2N9EB 4HLEA 3KDFA 1LTID 3DBHB 4HDOA 2BYTA 4DNTB 3ZGZA 2KHJA 2NBFA 4PYZA 3ZDMC 1XPRA 1PXUA 1UWXA 3MHBA 1DOXA 4DU9A 3C1FA 4F8MA 2F0VA 4FA6A 2LSSA 1YHBA 3AE4B 2BCOA 4A3PA 2PZWA 2WXOA 4WQMA 4KGTA 2VUMH 4Y52H 1E7PB 4Q2JA 1DOYA 3CMEA 1C4QA 2KO3A 2PE9A 4HWIB 2E75C 2ACZB 3ZNGC 4XXEA 1A8VA 2R61A 3OMGA 3EQLC 4YWKA 1E7VA 3ML9A 2KVMA 4ALPA 4J6HA 4NB3A 2WXQA 4C7ZA 1TWAB 5DPWA 4W9DA 1C3TA 3VR8B 2JSOA 3I4NG 4FBJB 4JI6L 3W1GA 1PH9A 4FXGC 3AEFB 2AYOB 1LTAD 3Q6SA 4BBSB 5JXVA 3UDIA 1FR3A 4DK0A 1T0YA 1PRTF 3QIAA 3OW2A 2RA4A 2PEAA 3ZJVA 3HZXA 3K5NA 4K6DA 2G4SA 4C1NK 1Q1OA 1KOTA 3AV8A 3JAMc 4ME5A 4HPLB 5H1SE 1LT3D 1EF5A 3MTSA 3C2PA 1KFYB 2Y5CA 5FLXc 3NVWA 3PF5A 3LDZE 2DY7A 4LF4L 3FKIH 5AEKB 3T3NA 4IWOA 1FRDA 4DDGD 3E56A 2ZXOA 2A5UA 4G3XB 1XXGA 5H92C 3VHTC 4NDXA 5HG2A 5KIXA 3GP7A 3UQBA 1XO3A 4EFOA 3W9CB 4YSXB 2M8SA 2R92B 2NVUI 2D11A 3C8YA 4JI8L 4OVUA 4A3MG 4BA2I 3SU8X 1RJTA 4JWSC 4DAMA 2F0QA 1KRHA 4A3EH 3TIXA 3PUXA 4AWJA 3HEJA 5EJWA 1SR3A 4JOIA 3TS0A 3PO0A 3U8ZA 4K7UA 4TQ0A 3KLSA 5F2DA 3GTGH 3S1QH 2VQFQ 1WF9A 1K8RB 4K3CA 3NRZA 2L8JA 3E9HA 1NYQA 1WGHA 2KFJA 2MRPA 1X55A 4K1RB 3CCLA 2FAZA 1EQTA 1FFVA 4XT3B 3IG3A 3BVMA 3M4OB 3B1LX 2F0JA 5ELDA 2QJLA 2G45B 4KHPQ 3KYDD 2EOTA 2NS5A 2NPTB 1WFQA 1GC7A 4O1NA 5J39A 3ICEA 3R2TA 4JI5Q 1SNOA 4TV3A 2G9DA 4EZLA 3S14B 1R4QB 3I5JC 2NVQH 3GTKH 2K75A 4QB4A 2AL3A 5EAYA 4AYBE 2KWUB 3DLLA 1BBUA 1TWCB 3AN1A 2EJGC 4DKAC 2M4NA 4NJ7A 4FO2A 4X65Q 4LJZC 2JZZA 4EZJA 2JA5H 3PSIA 4XTCS 4QJFA 1IKMA 2V9HA 5M5WB 4FNFA 2I1JA 4GN1A 3VUXA 2JEBI 2O2LD 4JVZA 1PUTA 3QHTA 4D2KA 3D3RA 4KJNA 3BIID 3A54A 5ELEA 1VQ8A 5LNK1 3AFQA 4C3JH 1B50A 4X62Q 1E7ZA 2KCCA 1QZEA 3A9KA 1LT5D 3R8BA 1EIGA 4ZQ3A 2L0CA 1NENB 3VFKA 2M19A 3WAMA 1Q86C 2L15A 4L5RC 1TIFA 3A7AB 4HN7A 5FOBB 2N8NA 3S1RH 1PA6A 2AUKA 1JT8A 1C77A 3FILB 4C4VB 5CGKA 2HT1A 4C80A 4RH6A 4A3IB 3J81c 4DV4Q 5IT9E 5IN7A 3PQIA 5LMNL 5DEHA 1SJED 2QW7A 1RL2A 3BVZA 2B63B 2UUAL 2K8CA 3PS6A 4LLGM 4I7ZC 5C6AA 5DPTA 1QVFA 4R1JA 4Z9CB 5T8IA 1NR4A 5EBCA 4AJWA 4H0LC 1G2TA 3AMUA 4A3GB 2MJDA 1LTSD 5I9PA 2WXJA 4YCWA 2M9VA 1IXRA 3NQTA 1C9OA 1B2TA 2M00A 4DR6Q 1TY2A 4F7XA 1NTGA 3OJ3A 4CKBA 3HOYG 2Q2TA 2D0PA 2OHFA 4TQ1A 3PO3B 1SEBD 2PE6B 2UU9L 4YY3Q 4H2AA 2OJRA 3QA8A 2BVCA 4KKSA 4PZ6A 3DBSA 4ZYNA 2N1VA 3PZ8A 1E8YA 4HJ8A 3I2ZA 4OX9Q 5I6WA 2GBMA 3S15B 2A6ED 1TKGA 2K8BA 1N36Q 3G6EA 2ZJPA 1Z2MA 2KVZA 3J81j 3MXGA 3TCAA 1MHHE 4DAPA 1I94L 2FCQA 3KW5B 3A8IE 2BGFA 1E0BA 4UHVA 3NUCA 4CYEA 3OYYA 3AE2B 3Q69A 3OAWA 3I4MB 3A5UA 2CS4A 1E24A 3GO5A 2CHWA 2OOBB 2W9NA 2KZRA 4ANWA 1AWDA 1MJDA 4KKJA 1ZYRD 1C1YB 4ZUJA 5I2XA 3K7UC 2F0TA 2K33A 4R9WA 2H5XA 3ZRFA 4PS8A 4A75A 1ZW7A 2WQYB 2WWZA 3CCQA 2WIIB 4C2MH 2AQ2B 4FXKC 5JEAJ 1KDAA 3QAQA 4C4VA 5BR8Q 3MXPA 4WRDA 2JA6H 1PQSA 4HXDA 4G0NB 2AWNA 3I55A 4KX6B 1TWGH 3PVLA 3PIP3 3EGRA 4W9CA 3U9SA 1EY6A 1ZGUB 3HOVG 3CIRB 4S3SA 1JALA 3ETRA 4GDLB 5G5HA 2A6HC 2F52A 5ELBA 5J1ZA 1WJ4A 2ZM6L 5BYRA 4IN3A 1M94A 5H8YE 1TJEA 5IKCM 1WTOA 5JJZA 3DQVA 5CBAE 3VDYA 2NN6I 2LGYA 2E5LQ 3PHWB 4JE3B 4B9KA 4MHEA 4DR4Q 1UUPA 4GN4B 1S3SG 2JQOA 3RMHA 3FKYA 5BYQA 1QOHA 2IL8A 2D3AA 2FMCA 3SK6A 3PZDA 3I57A 4RM9A 4AOFA 3R93A 3MC9A 5LLIA 4A3FH 1DGSA 1U4MA 2F0LA 2XEWA 1K83H 1Z47A 3FVQA 3VUYA 5IYBH 3AFPA 4LF5Q 3ZDTA 2INDC 1WCMB 1XD3B 3OIPA 2PVGC 2RD0A 4E6IA 3M62B 1UE6A 3K81C 4EQNA 1Y1VB 2LXJA 1LTBD 2KAJA 5C4JH 2HHHQ 1SB3C 1JJ2A 1I3QB 1A70A 2CWPA 1PH4A 3M7NA 2FCMA 2K28A 2NN6H 1HNWQ 1L4DB 4K5VA 3M9BA 4WJWA 2DLBA 1Y56A 2BS2B 1N62A 2MP1A 2SNSA 1JE4A 1AN8A 5C3EB 1VJKA 5C4XB 2K7VA 1PH5A 2E3TA 3M7GA 3CMMB 1WD1A 3N1YC 3CW2C 1EEFD 4EQPA 3DMUA 4BBSG 5JH5C 1S5BD 1CA6A 1YJIA 4ACFA 4DF7A 5M3MB 3KLSX 4NAWA 3U30A 2UXBQ 4FULA 1N34L 3Q8BA 4GU2A 3MFYA 3F2BA 1DOMA 3BU2A 1PZKD 4ARCA 1SYGA 3VRAB 1WGKA 2B2VC 2I07B 1L7YA 3S2HH 4JQWC 4MIUA 1UWMA 5EE9A 4LTUA 1IGCA 2GLSA 3R2IA 3L16A 4GDLA 1F52A 3T8MA 3MXNB 4RGTA 2GVBA 2EY2A 4NJ6A 1YQ4B 2KJ6A 1NE3A 4DV5L 2LASA 4S0RA 2Z9HA 4W9KA 2WFWA 1CFMA 2KWCA 2WXIA 2KLCA 1AEXA 1GXDC 4PV1C 2WDRB 2Q8RE 1O7LA 4KVGB 3ZUNA 3PO2B 1P0RA 4MGYE 4IUPA 1S5FD 2WXKA 5IP7G 4APVA 3HFZB 3EECA 1LTTD 3NBIA 1HUNA 3L10B 4NQKE 1HZ9A 3EN2A 4GZYC 1E2VA 3JW0X 3AECB 3S9WA 1STBA 4LDTD 2EYFA 4EQ5A 3TEZA 2R7DA 1L1OC 2NVYB 4IFDH 2KENA 3N1XC 1T6BX 3PGEA 3TREA 2FCNA 2B8FA 2NVXB 1CKOA 4XDCA 4R3DA 1KH0A 4JG2A 1N6ZA 1HH2P 1M4VA 2EYMA 4NMZA 1KAAA 1SN8A 4UAIA 2QEJC 1PGXA 2Z1CA 4ZRPA 4IWQA 5J2RA 4KV6A 4NXML 1D1IA 2B2TC 2INNE 4IOAA 5IIFA 3NOBA 2BQQA 4PS7A 5COYA 2L83A 1B70B 1QOFA 2DN8A 4GS3A 4YIJA 1XWEA 4LFAQ 4LFCL 2QEXA 4HPMB 1XTCD 2K5WA 3ZRCA 5DPRA 1GO3E 1R7SA 2G5DA 3UE1A 1SE2A 1C0AA 5IGDA 2K3UA 1CQFA 1PLFA 4HROA 2Y5PA 3AI5A 5EDSA 1FJGQ 2NR2A 3HOWH 1JROA 1B3AA 5M3FH 5C0XG 1EQQA 2KFKB 3R7QA 1UD7A 3J7AV 1DCZA 4DR3L 1N32L 1EO6A 1G8ZD 2ZPNA 5HGTA 3AE3B 2JRIB 3MA2B 3MXNA 2B2UC 5G3LD 3KVFB 2DJFC 3Q3JA 2ES2A 3RYTA 2WKDA 2XGTA 2VNUD 1MSHA 3SEBA 3F2UA 1VF7A 5E4WC 1XCTL 3AXCA 4A3IG 2F3WA 1FYCA 2Q2UA 2EJFC 4L8JA 4ABNA 2EDGA 3OW7A 4AJYB 2B63G 4DUYL 5C4ZA 5FKAC 2SDFA 2JU6X 4R8NA 4JV5Q 1S4ZA 5JEAH 2DZKA 1S40A 1L0XB 4A3GG 2RDHA 1B9NA 1WZ3A 2AEHA 3PV1A 2QC8A 1IL8A 3J80L 1RFAA 2DWQA 4LNOA 4M8AA 2HE7A 5C5MA 2JN4A 2B3GA 2E2JH 3PO3G 1IBKL 3IT4B 3V6EB 3IVFA 1HR0L 5IGBA 1N8RC 2HJ8A 2SEBD 2LXKA 3MTNB 4M0WB 5C23A 1IKLA 3UI2A 1QILA 1VDVA 3U4ZA 1EY0A 1QKZA 2L05A 5CV4A 1FD6A 4A93B 1W6JA 1ET9A 1FRRA 1WIAA 3ZW3A 1C79A 3MC0B 2CW0C 2EPBA 1E8ZA 2Z4IA 3MZ5A 4GNXC 3L54A 4DHJB 1MJCA 1FD7D 3PZ7A 1YN4A 3QARA 5IP9G 2YTVA 5CV6A 2WU2B 3PRPB 4MN3A 1VQIA 1SRUA 1J5EL 1GUNA 3N32A 1PV4A 4HIDA 4HJKA 4B3SQ 3I4MG 2UU7A 5IE8A 1TWHH 1N60A 4LJPB 1K50A 3RZFA 1R4PB 1EFID 1C4CA 2Y5BB 5CV9A 1ESRA 2L32A 5LMUL 2KFKA 1OXTA 1SMXA 4ODGA 4CKCA 2FHTA 1PH3A 2C60A 5DAUA 4BWGB 1WTRA 1VQ9A 2B76B 2V1YA 4OELB 1MG4A 2CJOA 5JJIA 1CK1A 2C5LC 3PHXB 3H8HA 3DVNV 2CQAA 2LHEA 2B39A 2K04A 2ZJQA 2PTLA 4G4KA 1VQDA 4RHRA 4KDLB 1H8CA 2N3SA 5CYUA 2B2YC 3IXSA 4R8IA 1TS5A 1CA5A 1KXLA 1K0SA 3NBHB 3JAML 3K5LA 4HJ5A 1AW7A 4BY1B 4OXPA 1EZ6A 4RHSA 3AEVA 1VCIA 2KD0A 5FLXL 2A5HA 5HY6A 1TWFH 1BVSA 2L1AA 2EZVA 2YU9H 1WTQA 3GZNB 1J6QA 2MBHA 2ON8A 1KLGD 2BYFA 1WTXA 1WM2A 3VUWA 3M4YA 4FLHA 2JXMB 4IM2A 1C78A 1TZOA 1YEZA 5C44B 4XIGS 1Y69U 1D2BA 1DOIA 2Y0SE 4HEDA 1YJNA 2R93G 5FR3A 3LXFA 1VZ6A 2ZW0A 1WCMG 4U68A 4N59A 3DVNU 1PYWD 4A3KB 2BH2A 3T13A 1Y1VG 2KTRB 2KWVB 3P4RB 4L2YA 3GTPH 2L0FA 4A3CG 4DPGA 2N88A 1GJXA 1FNWA 1EQRA 4K7WA 3CU7A 3RR5A 3PUVA 1O7ZA 4NNJB 3ONAB 1K53A 4FHKA 3RMKC 1PVOA 1PZJD 3L2PA 2K5HA 4BBNC 2F0WA 4YSZB 1H4RA 3J7A5 4UY8C 4W9GA 4X3UA 4WWMA 5CV7A 2R7ZH 1A2UA 1HTPA 4OEMB 1TT2A 2Q8TA 1VQMA 5ELOA 4TKOB 3R3OA 2WX1A 5TSSA 3J9CA 3WCQA 4EGVA 4FYDA 3GTJB 1NAPA 5IP4D 3TMEA 3N6RA 4MTKA 1JWBD 1H9RA 2MHJA 1EY4A 2F0FA 1IBMQ 4PMCA 3EVQA 1VQCA 2IDYA 2VZAA 3A55A 3V05A 1HZ5A 3RNEC 4ZHOA 1LXDA 2V1CC 5EPLA 3RN9C 1T0RC 3ULJA 5IWAQ 4LF9L 2SAKA 1X3EA 3BYTB 4K14A 4RM8A 4M8MA 4QUFA 2P5ZX 3CXCA 2A6HD 1ZUD2 3H7PB 4P16A 2A69C 1V97A 4G7HC 1P9DU 3FMCA 1OXVA 1XLPA 2N7EA 1NY4A 2RHSB 4A3JB 1E6EB 2RSUA 4XZ4A 1SNDA 2D2QA 4DQOC 1VF5C 2CHBD 3G48A 4OL7A 4KHPL 1V1PB 5C4HA 1NBFC 3T1YQ 4ITKA 4LFBQ 4B3TQ 1HNXQ 1VQJA 4N9PA 1STAA 4JI5L 5M5XB 3LX0A 1J7AA 3GTOB 4K2KA 2LVQA 3K58A 3VR5A 4IUVA 2R92H 4KZ0A 3J81L 1W3SA 1V8QA 5KNCA 4RWSC 3NY5A 3TBIB 2NYZD 1K8AC 1F2RC 3OHXC 4E74A 3A1QB 1TBEA 2LGSA 3Q8EA 4CHTB 4C3IB 5I2YA 1VR9A 2W82A 1TZ1A 2KTRA 2F0OA 4YCVA 1XT9B 1CMXB 3RNCC 3QWNA 2R2OA 2IT1A 1FMAD 2AKWB 1SYCA 2KDBA 1L6VA 1E1OA 2VXWA 3PIO3 3ALBA 2CKZB 2UXDQ 3WDNA 3Q3FA 4YL8A 1STGA 4EQOA 3S1NB 3K9PB 1WWTA 3VH4B 2PZTA 4HCNB 4LF6Q 5IO9A 4DV3L 1XMQQ 4M01A 1Y1WB 4YSYB 3K7AB 4OIJA 3VR3A 4BA1I 1EUVB 5A2QE 3FEWX 5JOBA 2RPQA 4DV4L 2CHZA 3D4WA 4LUZA 4O2DA 2X69A 1LT6D 5KRUA 2QDLA 1VQBA 1LTGD 1YN3A 2KX0A 3TN2A 2PLPA 2W3RA 3PLVA 1EQVA 2JPHA 3CQZH 4OO1G 2JSVX 1G91A 4IM3A 1SNCA 2I5LX 1TWCH 1PTOB 4B9WA 1WXMA 1CTMA 3I4LA 1Z6HA 5K5PA 4DV7Q 1H9SB 2KOXA 4H44C 2LFIA 3R3MA 1WJJA 4DR6L 4MJSB 2PZUA 5D6JB 3H7PA 3K5OA 4X3SA 4X57B 3NP8A 5FO7B 1N63A 1GD7A 4YY3L 3GTMH 1CM9A 4P1CC 4YTNB 1OXSC 5LXIB 1QB5D 2BB6A 3RPFC 4W9IA 4OVZA 2OTJA 1RRBA 1V1PA 4X6AH 2FCSA 3CSTA 1Q82C 4IZ8A 3DBLI 4FJVB 1IP9A 3HS0C 2F4VL 1RM6C 1SJHD 4MTNA 1II3A 2DAFA 3OOCA 4WWPA 1FXIA 1LTRD 2K6AA 2KMCA 4EKUA 1MI2A 1L2FA 1T5EA 5EE0A 2RKSA 2EYHA 2LJ5A 2BPSA 5CBEE 3A4RA 4EZKA 2K22A 1H9JA 1EU4A 4L6TB 1YNJC 2IGDA 3P1MA 1PMRA 1JWAD 1X1MA 1E2WA 3HOVB 3NG0A 3A1QA 1GM5A 1BXTA 1QF6A 4IW0A 2BBCA 3DHHC 1VQHA 2LXAA 1JE5A 1ENCA 2DYMA 3W1SC 2MJEA 2N0SB 4FXDA 4PMWA 1J0GA 1R4MI 4KGRA 1GPXA 4BY7H 2XTIA 3PIOA 2IW3A 1EY7A 4RMAA 4XYCA 3E3XA 3H94A 1GOZA 3KWVA 4RCNA 1UELA 3N9YC 2HDLA 3AEAB 4WJPA 3EFXD 2GN5A 4A93G 1LT4D 1E1TA 1K9MC 4HCEA 2SNMA 1H95A 3IT6B 5EKKA 4MGKE 4B0EA 3RZWC 2KANA 3HOXB 4DK3C 1XNRQ 1WSPA 2EMSA 4X64Q 4W9HA 2F0IA 2LKVA 2M56B 2K5NA 3LGJA 1JQ4A 1R9TH 5BYSA 1H9SA 4MJSA 3AE8B 4IJHA 4ANUA 2L1BA 2F0DA 3HOZB 1VZ8A 2BKFA 3Q2AC 3WA0A 1SFOH 4QAYA 3M85A 5EKLA 2K1FA 4CKEA 2N1WA 3RN5A 1K3BC 4ZRKA 1YI2A 2E2IB 2MUYA 4I6NB 4N6EB 1XNQQ 1GNUA 1FXTB 3SK5A 4HJAA 2IY1B 2R3ZA 1WTWA 3C1EA 1SIFA 3AEBB 5C5LA 1EY5A 3AQQA 3B9JA 4ZRJA 1A5RA 3S17B 1KDBA 5CHVC 2MSED 2VZKD 2WXHA 2LMCA 1MSGA 4BY1G 2ZT9C 5JAVA 1B44D 4BS9A 2Q5WD 4YHHL 3RUZA 4IDIA 2DYOA 1I42A 1TKEA 1D7QA 3A9KB 2QA4A 2BS4B 2XRQD 4MGZE 3PT2B 1ENAA 3Q8AA 2NMQA 5IYCH 2E2HH 1I4GA 3NWSA 2OWOA 2OTLA 4HKQA 3TSSA 4DFAA 1E8WA 2F0MA 3QOJA 5C44G 1UF0A 1JJCB 3V96A 3HOUG 1JB3A 4R4IA 1F2RI 3L7ZC 2BS3B 3BWUD 3NE5B 4RA8A 2UXBL 2A19A 4A3KG 4AYBB 2CW0D 1S3OA 1X3GA 2MX2A 3VA5A 1HTQA 4QIWE 1NI2A 2H89B 1UBIA 1VZ7A 4KGSA 5KNBA 3KLWA 4YWLA 1WFYA 2B2WC 2PMZE 5ELCA 3ZJYC 4NP5A 3TRZA 4LK0M 5D2MB 2EKIA 4BKSA 3PGZA 1TKYA 4JI3Q 3QJZA 5FLMH 3H6MA 4C3HH 3L17A 3H0GH 4Q0FA 1HCZA 2FBWB 3NJTA 1U4LA 5JPNC 1Q0WB 2CJNA 2DX5B 2K52A 2V4LA 3NVZA 3WAPA 1I6HH 4QL5A 3VYUA 4PMBA 4BBRH 2JT4B 1VQ6A 1DYQA 4MGIE 1SE3A 1IBXB 2V0GA 4WJOA 2NCNA 2PQEA 2IO0B 5C3EH 4A3DH 1F2YA 5C4XH 2YYZA 3DEPA 4JC0A 2HUGA 2MJ3A 1RHPA 3H3VC 3HHMA 3TBLD 4A3OA 5J17A 3S2DB 3W5OA 4KSKC 1G6JA 4FF4A 4KLKA 1EWCA 2RMMA 1SIJA 2X38A 1WTVA 3I72A 3UQAA 2CQOA 2DZIA 4DV0L 3M3YH 1P1AA 5JZEB 3EFCA 2LS01 5M3MH 1HQMC 2UXCQ 4F8CB 1IBLQ 2ZXRA 4MNOA 1P7FA 1PFSA 4FDBA 4BOZB 1ICFB 4DUZQ 4EVOA 2DAJA 2D07B 3OSOA 1BUVT 4HSVA 2L0TA 3PRZA 4UP9A 4A3JG 4FHJA 1QZHA 3RNAC 1PHJA 2BE5C 4ZKBB 3ND9A 4GOPC 2K39A 1YJ9A 1I50B 3RZOB 1V1QA 3KBXA 1KNAA 3IAYA 1WJUA 2J0KA 1WE6A 2DY8A 1JW9D 5CHWA 1C9FA 3E5SA 1YQ3B 4LFAL 4NPSA 2KOLA 2KN5A 4H02A 3URYA 4G7OC 3A8KE 4DXGA 2JZ3B 2KC1A 2KDEB 1A63A 4ULLA 2LUEA 4UPAA 2EYJA 4DR7Q 3P7JA 4K3BA 1Q1BA 3RLNA 3PO2H 1KL9A 4C3IG 1SE9A 1XPUA 4BXXH 4BKTA 4P74A 4DA2A 4NPNA 3MJ5A 2JA7B 3D8GA 1J8CA 3CPFA 4NJCA 4BFRA 1LFDA 2BOSA 1SNMA 2LY7A 4GN5A 4X66L 5FJ8G 1UGMA 3DBRI 1TU2B 3IFDA 2FJ2A 5K36H 4Y7NB 1DJRD 5JJLA 3UDXA 1KQSA 1XJVA 4K0KL 2NZHA 4IUUA 2JA8H 1Y1WG 4B3ML 2Z6KA 1Y8RC 5IT9c 3PRMB 1N33Q 3SK4A 5BMIA 3BZDB 1IBXA 2YEPB 2A73B 4IPCA 2VQEQ 2JUOA 1TR5A 3D4DA 3GTLB 2F0EA 4KMUC 1FNVA 4KDIC 5C1ZA 3Q24A 1WYDA 3J7ZC 1TQOA 1MIUA 2PNHA 5ELFA 1K8GA 3P42A 4KD4A 4KIKB 1OQYA 5L83A 1D6EC 3VYSA 3AEDB 2A69D 2MWSB 4LF8L 5CV8A 4PS3A 2XBBC 4KY5A 5I4DA 3V62A 1G291 4LNNA 5E6JA 5IYDG 2LFNA 3ULPA 2UUBL 5GAHC 3M3JA 1WJ6A 3PLUA 4OW0A 2WX0A 2VUMB 3APFA 4NQLB 2JE6I 4O42A 1D4BA 2JJQA 1IYUA 3AULA 1WOCA 4NAWB 4HMIA 3V2TA 2L5TA 4JI0Q 5D65A 3CC4A 4JI7L 4TVAB 3H6NA 4FVMA 1Y14B 4EX5A 4JI1L 4IJLA 4HTHA 1M8AA 1Y8OB 1HFNA 2K6QA 3K57A 2OJWA 4JWUC 4WAAA 1I35A 2EE1A 4WJ3M 3CCUA 3DVGY 2XRSD 1SYEA 1HR0W 4GKJL 1OXXK 3MXUA 3T1HQ 5KEEA 4DNIA 1JOOA 2UUCL 4B3SL 2KQ4X 4L23A 3TEXA 1GUOA 3FDTA 1K51A 3GQBA 1O7YA 2M0AA 4B95A 3X3MA 1UEAB 3ZNID 1X65A 4QF4A 1HNZQ 3A33B 1UH6A 3CF6E 4MSQB 1G51A 1ZXHA 4PZ7A 1K0RA 1CJEA 2WYQA 1QVCA 4K5XA 2N4FA 1BBWA 4BBNF 3E6ZX 4CDEC 2KTFA 4MH0E 4MSMB 4BZAA 4WFN3 3C46A 1F2LA 1LO5D 3FKIB 3FRPB 1VQPA 4CQNA 1Y8PB 2CR5A 2RGFA 5BN4A 2R93B 2JX5A 1VS0A 4C1NI 1BCPC 1CUKA 2D5DA 2GRIA 3G6JB 3BDCA 2OXPA 1FXAA 4B08A 1V86A 4OWXB 3VYRA 3HOXG 1D5ZC 3HG9A 2KMMA 5KGUA 1WZ0A 1FL0A 2BDNA 3P75A 4DXFA 3L9AX 1JICA 1Q8IA 1OQQA 1FCCC 2BB5A 2Z4HA 3QIJA 4KIKA 3U7DA 4C56C 3B6YA 4JI6Q 4P75A 2HTHA 5L95C 1ILQA 1PH8A 2EQSA 4A3EB 4OGQC 3HOZG 2WNMA 4DR5L 2DENB 2R2QA 2PKOA 3AU7A 4JIOU 2YVCA 4KZCA 1L0VB 4KHVA 2LWPA 3VA7A 3H3VI 3ITPA 4WQOB 3EFUA 1FIQA 2D3BA 2KDMA 1QUQB 2K0PA 3AE5B 2QHOA 1WMHB 1E3PA 3GTGB 3I4NH 3DWMA 3ZXRA 3GZNI 3Q8FA 1C4AA 1YMHE 5JPMC 1QVGA 4CDFC 1DZ1A 4DN4M 5GMVA 3QOLA 5EQ0A 4XQNA 2K14A 2D9UA 3U58A 2K9XA 4LF4Q 3PV0A 2ZW1A 2HQLA 1HE8A 3APDA 1YNJD 3A8JE 4POFA 1PFDA 2JWZA 2WP9B 4BAXA 2G4DB 2QF7A 4IUMB 1RTOA 4F1SA 2C7MB 3GTKB 2NVQB 4XQQA 2EY1A 2O6VD 5AFWA 3BZCA 3KJPA 4A3BG 3A9JA 1QNUA 4JOIC 4DV2Q 4JI8Q 3H3VH 2KDIA 2L52A 2NB0A 4FP5D 4JBMA 2JA5B 3V60A 1I7HA 3QK0A 1VRAB 3SFDB 5CTRC 1STYA 3RLFA 4K8JA 1SNPA 3MEHA 1YJJA 1UAPA 4ZLTF 1YOVB 3ER0A 5AZGA 3ULLA 4ASWC 3UGBB 2O5IC 2J42A 4HIKA 4KKUA 3W5UB 4AYBG 4C3JB 2ZNVB 4A3MH 5DPSA 4ZYSA 2WU5B 5GXGB 2AUJD 5IWAL 2NTTA 1B8AA 1P98A 2MBQA 1V8CA 3JSVA 2JYOA 1S5ED 4W9EA 1F9JA 3KF8A 1I6VC 1GHKA 2LGIA 3M63B 1I4QA 1WR6E 2X6GA 2IHEA 2PCFB 4OHJA 4JYAL 2F1MA 1R4NI 3VTVA 1S5CD 3M4QA 4AQYL 2IZVB 3P2BA 4LFBL 1V6EA 1HNXL 2GMIC 5CX3A 3NXWA 5EE1A 2KEDA 5DM73
chains in the Genus database with same CATH topology
3AEEB 4ZUIA 4XDDA 1QJOA 1S5DD 2WDVB 2MJ8A 1OXUA 2WV6D 5AUIA 3V3XA 3DHQA 4EE2A 2WXMA 4PQXA 1STNA 1KTKA 3OWFA 1JRPA 2HCIA 1B4OA 3QB3A 5C3JB 4GLSC 3SVMA 5A2QL 4J3OD 1CI3M 2NTSA 2V4DA 4KN4C 1A3UA 2QKIC 3DWQA 3ZQ4A 1QG7A 1RCVD 3T16A 4B0MA 3LWUA 1TYGB 4KKIA 3KBGA 4XDXA 1PFMA 2BA0A 3B2FA 2EXZA 4C2MB 3B2GA 1G2SA 4FF3A 4UDUC 4KKTA 1TWGB 2KWDA 5J22A 4L63B 1DD2A 2VB3X 2JWUA 3I90A 1YN5A 2J52A 5M5YB 2V3PA 5E1FA 1QLBB 5E3FA 2F03A 1F2ZA 1B1ZA 2MGSA 4A3FB 2NWGA 2L11A 1B9MA 4QUCA 2AQ1B 1NEKB 5C0XJ 3EUB2 2EYPA 2WXPA 1K83B 2BE5D 1BUIC 2K05A 4HEA1 5C4JB 1STHA 3SHLA 1BQQT 1JMLA 1I4XA 3OIQA 3K0YA 2Y0SB 4LMQD 4G7ZC 1AZPA 2F0GA 4RKLA 3EJIA 3I70A 3FPUB 3SDZA 1A15A 1I4RA 4Q5VA 5CV5A 1TY0A 3NSWA 3P1HA 4DK1A 4FF1A 4ZRQA 1E9MA 2E6XA 3CHBD 2BT6A 1CHPD 2FE8A 1SDFA 1Y8NB 1PFBA 3EA6A 4IUNA 2PW9A 3VRBB 3S2HB 1B53A 3D6CA 4WIPA 3HOUB 3AB5A 1DXMA 1SYFA 1GB1A 4MM3B 1NYRA 4PT5A 1MVKA 2INPE 1Q10A 4WH4A 1T3QA 2KACA 2BW2A 1SYDA 1XF5L 3T51B 2WXGA 1EOTA 2OEOA 1H9MA 1HXYD 1IUEA 4WAFA 2BA1A 5CC4A 2K1BA 1BO0A 3QO2A 2H88B 3P4PB 2BDOA 5EBDA 2DBYA 1QOGA 1BNZA 1LABA 1CZGA 2K03A 5CORA 1RODA 3T4AC 2WXFA 3BG3A 1PDXA 3AEGB 1NUCA 2XWBB 3LYYA 4IOIE 3W5VB 3NTIA 3BDLA 4RF1A 2PW5A 2TSSA 3H09A 1HQRD 1ZKOA 1EZ8A 2F0NA 2KCNA 3NVVA 3VR6A 1IYVA 1QOBA 3CRLC 3RD4A 1QT9A 2CU3A 2LHDA 1EYAA 1DOKA 1JCKB 3DUZA 2FFKB 4J8QA 1J7CA 2WINB 4XE0A 3T53B 3HOWB 4DNRB 1OO9B 5M3FB 4C3JG 3MVVA 3UI3A 1BCPD 2WACA 5FO9B 1FGBD 1GAQB 1HUMA 3BDOA 4LK1C 1F9QA 1C8CA 3VR4A 1K52A 2HCCA 1JWSD 4TMAB 2N7JA 2ZXPA 3U4EG 1IW7C 4OIKA 2KA7A 5IT9L 1BOSA 2WP8J 3NPPA 5C0XI 2V4IB 4XT1B 1FFUA 3TZDA 4XWWA 3Q22A 2WAQB 3GV6A 1SBBB 2E2JB 3VR2A 1XYIA 2J0TD 2WB1B 1OQRA 1XCQL 3K5MA 2F0SA 2H4OA 1E0ZA 1SAPA 2IWHA 1J9OA 4RFBA 2PIAA 3W2DA 4ZHPA 1BDOA 2KECA 3P63A 1TS4A 2WXNA 1ZXTA 5C0XH 1B9RA 2C5CA 2GI9A 1SNQA 4P6VF 1TWHB 5KNDA 2OF1A 4NW2A 2LMCB 1FM0D 4HMJA 2IPKD 1KABA 1X32A 3J80E 3AE1B 3X3NA 5BMGA 3CWIA 5LL6S 5BN3A 1EYDA 3J7AF 5FO8B 5BMHA 1AP0A 1QE6A 1BCPF 2F3VA 4ARIA 1H9KA 2EELA 2O4XA 1EWHA 2XIWA 4XQJA 2HDEA 3U9OA 2D5GA 4JBWA 2OT2A 2B8GA 3MP9A 1TWFB 2L12A 3KLRA 3EROA 1X3QA 2YU9B 1ACCA 1MGSA 4IKGA 1RF2D 1QNKA 2XNAC 3HVZA 3OWEB 2E2DC 1P7EA 3KWLA 1STEA 1BF4A 2EJMA 1FCLA 1NVID 1ML0D 1L6UA 3NS1A 3GTPB 3ABVB 2XWJB 1MBYA 3BK2A 1PRTB 4B9XA 1ZDXA 2NN6G 3T3OA 2QCPX 5BN5A 1WYGA 1RWSA 1JWMD 4RNAA 3JAME 4ZKCB 2R7ZB 3AMZA 4ZOHC 4QIWB 3WOFA 5FLXE 1EU3A 1X3PA 1V1OA 1ZP0B 1EIHA 1ILPA 2PMZB 5JVG3 1F9SA 1L0YB 2ENBA 2K5DA 3MAQA 1EL0A 1WRIA 1MD2D 4A3BB 3L3OC 2CVRA 3A7LA 4F88A 4A55A 2PMVA 4H7BA 4TRDA 5KYLA 4OZBA 1DOLA 2R6GA 1J7BA 4HRSA 3AE7B 1ZDVA 2KJXA 3TDQA 1DM0B 3SFEB 5IGGA 4M1UB 3I73A 2RVLA 1SYBA 3Q23A 1GB4A 5EKIA 1HTLD 1SMYC 2B2VA 4US9A 2ICIA 1XLQA 1VLBA 1PDQA 4NAMA 3DEOA 3DWAA 4IFDG 1EYCA 2QILA 2LEKA 1C4PA 3AM9A 5IGCA 4MACA 1SXTA 3W3AA 2WS3B 2DNEA 1HA6A 1JORA 2VZKB 1F9RA 1JC7A 1Q1EA 5ISRA 4RGOS 1ZXIA 1JOQA 3CQZB 3NZ3A 1IHZA 1ICWA 4KD3A 2N9LA 2A74C 3SXHA 1SSOA 4KY7A 3J81E 1NSNS 3D6WA 4KJOA 3SK8A 2I46A 5CR3A 3KQ4A 2N9KA 3GTMB 1YNTE 2B2TA 2KN4A 3AH7A 3IAS1 3SE0A 4HJGE 2K5PA 3P20A 2ICEC 5MPOA 1A3TA 2JP1A 4KI0A 4I65A 4OO1I 4U673 2K5QA 5JEAG 1FNUA 2LUMA 4A9AA 1ZE3D 1GUSA 2ID0A 4IFDJ 3BVGA 2B2UA 3U2SC 2JZPA 3NK9A 3O13A 4IUQA 3GS2A 4CGYB 4BY7B 1N61A 1U4PA 3OPOA 2C9OA 3LWEA 1DONA 2V3NA 1FEHA 4OO1H 3U7ZA 2LJIA 1L4ZB 2OEDA 3BS1A 3GB1A 4US8A 2XSCA 4FF2A 5C3WA 1Z7TA 3NHHA 1QWYA 3LB8C 1QOAA 1RD9D 2E74C 2YEPF 4ILWA 3TZUA 3U52E 1R9TB 2G9HD 5AUKA 3HGBA 2D2CC 4H13C 2QIEB 3PUZA 1D5XC 3P4QB 3VR9B 3IFTA 1SFOB 1RKNA 2EYLA 2MPMA 1DGJA 3A56A 2XN9C 1TKWB 1RTNA 3KUPA 3AE6B 1E10A 3HRDD 1XX8A 5HFYA 1CQVA 4CJ2C 2SOBA 1ESFA 1ZOYB 1A2TA 1CZPA 3FILA 1IW7D 1EWYC 1NI3A 1PTOC 1WTPA 2QMTA 3E9SA 3FAHA 1BMLC 1KF6B 4X3KA 4CJ1B 4ZK9B 1EEID 2RQXA 4AS1A 5LHY1 1HA5A 1L5PA 3DWGC 4N58A 1E2ZA 2RBMA 2E2HB 3OMCA 1W6KA 1NR2A 3NWTA 1G6ZA 5HURA 2B2YA 1XEEA 2E76C 2IJ0A 1QCBD 4J1MA 4DAVA 1PGBA 5HI1A 5EPJA 1PFNA 4KN7C 1RYJA 3S1QB 3NTKA 3J7YW 3C3LA 4HKZE 4RCOA 4C3HB 3H0GB 1RFKA 1I6HB 4BBRB 4YWGG 3L4PA 1LACA 4A3DB 2KQ3A 5D3IB 1MHXA 2JYEA 3M3YB 2FMMA 3TP5A 1TS3A 5IOCA 3FC4A 1GUGA 5DNFA 1ONLA 4TQUS 1F77A 3SR6A 4ZAIA 5IGFA 1AFPA 1EM7A 1K8OA 2H1EA 5E4XA 4ID6A 4IFDI 2W54A 3S1RB 1LV9A 2W55A 1PRTC 3GV3A 3ND8A 4N9TA 3TUOA 4JK1C 2A68C 3WOEA 5C3XA 5EPKA 1YNNC 1QQRA 4LAAA 3LNNA 1AYFA 1F9PA 1ZPSA 3Q0AA 1JQYD 1GHJA 1PZID 4X3TA 1A6XA 1Q3LA 1HRJA 1EY8A 3BYYB 2HQEA 2JA8B 2J53A 1C48A 4A90A 4OZCA 1LLRD 1IGDA 5NUCA 2F0UA 4V0BA 3PMFA 5A35A 1BBXC 5CMDA 3DWPA 1VMCA 2IGGA 3GD7A 3N52A 2JXTA 4YXDB 2IX3A 4C7YA 2Y3AA 3TP8A 4JX1C 3HP3A 1F2MA 3CRKC 5I6YA 3MWYW 1HZ6A 5I9OA 4OZAA 2Q8IB 5D14A 1BR9A 1CZWA 2KHSA 1SF0A 3TP7A 4QCLA 2EY6A 3T56B 1D5MC 3IL8A 3PUWA 3ZJUA 4L1BA 1U4RA 4K8IA 1ENFA 3QJYA 3ZYYX 1XLOA 1FO4A 1I4HA 1SMYD 2HTME 2JA6B 3NUHB 1JWUD 1KNEA 2QDBA 3D31A 3MFGA 1N5XA 4XWTA 3K6OA 2QSDA 2KUMA 1WVLA 3D4RA 1ZEQX 2JYTA 1EY9A 3QG1A 2FINB 5T1IA 4K6LA 2MH7A 1HHVA 2J4XA 1K8MA 3ERQA 5EE3A 3DM1A 5C2TB 2HDMA 1T5XD 2AWOA 2PW7A 2RSOA 4RGNA 3ZJTA 1CHQD 5IODA 1PTOH 4RKBA 4JPSA 1Q90A 3FPPA 4RF0A 2M2LA 1A3VA 2RDGA 1CT1D 5T1GA 4YT0B 2I38A 4YTPB 4RGMA 4GDKB 2N55A 3PUYA 3W1SA 4CJ0B 4YTMB 3G7LA 5KYIA 3VQIA 3SR1A 1SE4A 1C76A 4A8XC 2NUCA 1WD0A 4IURA 3I4NB 2AQ3B 1N5WA 1PGAA 1UGJA 2PYKA 1SSNA 3K59A 5JVH3 2PVOD 4KK7A 1I4PA 3H91A 1MPEA 5G3LF 3I8ZA 1Q12A 3HUIA 4DAYA 3NQIA 2WKCA 4IQZA 4KY6A 4G57A 2BTEA 5D7GA 2VB2X 1RDPD 4KHZA 4KTAA 4A3MB 4M0WA 4XYOA 4TSSA 4USAA 3KK7A 2EVBA 4NZLB 2AX5A 2XVSA 1JR0D 2IX1A 2WXLA 3TP6A 1ROEA 2PPBC 3P4SB 4P2CB 4C3HG 2Z8LA 2GA4B 3E0JA 3BK1A 1AZQA 1GUTA 2RPVA 4WURA 1GUWA 3I3CA 2EYOA 5G5GA 3HRZC 2L9HA 3NTHA 2F4IA 4MT5A 2O5JC 4HSPA 2B2WA 1UNSA 5EGTA 2A6EC 4HCSA 1HPCA 2K01A 4ZRZA 3AE9B 1PTOD 2F0PA 3HKZB 1TIID 4NKLA 3NBHA 2X6LA 1VDZA 2F0KA 2L4NA 4CBVA 1J8IA 4DGZA 2J7ZA 1NCVA 4PNYA 1ZYRC 4XYQA 4IUTA 2L55A 2DNCA 3NVYA 1HEZE 3TEYA 1F0ZA 4MH8A 3GTQB 3HVDA 2JQRB 2IGHA 5IGEA 2KEEA 1V43A 2MEKA 5K36G 1TVXA 3CKIB 2RDFA 3IAM1 3I9V1 2D62A 3S16B 1JOKA 1OFFA 4V190 2NVTB 3I91A 3HOYB 1TS2A 4K5WA 4A6QA 3DXJC 4WORA 2GB1A 1O78A 2TMPA 1U9RA 1XLNA 2F0HA 2PNRC 3AB9A 4FXCA 2WDQB 5D3DA 2K32A 1MI0A 4HR7B 4K2LA 2RSNA 2NZ1D 5DM63 1PTOF 3S1MB 2JEAI 1BCPB 2G1EA 5HHDG 3VYTA 1PRTD 4QMGA 1KDCA 1D1KA 4F87A 3TEWA 2I2YA 2ONQA 2A68D 2IX0A 2W3SA 3RFZB 1YNND 1O80A 1KLUD 3RZDB 5M9OA 5LL6X 4IALA 1HFGA 2WLBA 1ET6A 4RAUC 2FUG1 1WXQA 2PO4A 5FK9C 2EY5A 4REZA 1VMPA 2MHVA 2WXRA 3IKJA 3Q8CA 3MHZA 4AQ7A 4HAEA 1LTID 4DNTB 3ZGZA 2NBFA 1PXUA 1UWXA 3MHBA 1DOXA 4DU9A 3C1FA 4F8MA 2F0VA 3AE4B 2BCOA 2PZWA 2WXOA 4WQMA 4KGTA 1E7PB 4Q2JA 1DOYA 1C4QA 2E75C 2ACZB 4XXEA 2R61A 3OMGA 3EQLC 2KVMA 4J6HA 2WXQA 4C7ZA 1TWAB 3VR8B 2JSOA 4FXGC 3AEFB 1LTAD 3Q6SA 4BBSB 5JXVA 1FR3A 4DK0A 1PRTF 3QIAA 3ZJVA 2RA4A 3HZXA 3K5NA 4K6DA 4C1NK 3AV8A 4ME5A 1LT3D 3MTSA 3C2PA 1KFYB 2Y5CA 3NVWA 2DY7A 3T3NA 1FRDA 3E56A 2ZXOA 1XXGA 5H92C 4NDXA 5HG2A 5KIXA 3GP7A 1XO3A 4YSXB 3W9CB 2R92B 3C8YA 4BA2I 1RJTA 4JWSC 2F0QA 1KRHA 3PUXA 3HEJA 5EJWA 3PO0A 4TQ0A 3KLSA 5F2DA 3NRZA 1NYQA 1EQTA 1FFVA 4XT3B 3BVMA 3M4OB 2F0JA 5ELDA 2QJLA 2EOTA 4O1NA 5J39A 3R2TA 1SNOA 2G9DA 3S14B 1R4QB 4QB4A 1TWCB 3AN1A 2EJGC 4FO2A 4LJZC 4XTCS 1IKMA 5M5WB 4FNFA 2JEBI 2O2LD 1PUTA 4D2KA 3D3RA 4KJNA 3BIID 3A54A 5ELEA 5LNK1 1B50A 2KCCA 1LT5D 3R8BA 1EIGA 4ZQ3A 2L0CA 1NENB 2M19A 3A7AB 4HN7A 5FOBB 1C77A 2AUKA 3FILB 5CGKA 4C80A 4RH6A 4A3IB 5IT9E 5DEHA 1SJED 3BVZA 2B63B 4LLGM 4I7ZC 5C6AA 4Z9CB 5T8IA 1NR4A 5EBCA 4H0LC 1G2TA 3AMUA 4A3GB 2MJDA 1LTSD 5I9PA 2WXJA 2M9VA 3NQTA 1B2TA 2M00A 1TY2A 4F7XA 4CKBA 2OHFA 4TQ1A 3PO3B 1SEBD 4H2AA 4KKSA 3PZ8A 5I6WA 3S15B 2A6ED 1TKGA 3MXGA 1MHHE 4DAPA 3A8IE 1E0BA 3NUCA 3AE2B 3Q69A 3I4MB 3GO5A 1AWDA 4KKJA 1ZYRD 4ZUJA 5I2XA 2F0TA 2K33A 4R9WA 2WQYB 2WIIB 2AQ2B 4FXKC 5JEAJ 1KDAA 3MXPA 4WRDA 2AWNA 4KX6B 3PIP3 3EGRA 3U9SA 1EY6A 3CIRB 4S3SA 1JALA 3ETRA 4GDLB 5G5HA 2A6HC 5ELBA 5J1ZA 5BYRA 4IN3A 5H8YE 1TJEA 1WTOA 5JJZA 5CBAE 4JE3B 2NN6I 4MHEA 1UUPA 3RMHA 5BYQA 1QOHA 2IL8A 2FMCA 3SK6A 3I57A 3R93A 1U4MA 2F0LA 1Z47A 3FVQA 1WCMB 3OIPA 2PVGC 4E6IA 4EQNA 1Y1VB 1LTBD 2KAJA 1SB3C 1I3QB 1A70A 3M7NA 2K28A 2NN6H 1L4DB 4K5VA 4WJWA 2DLBA 1Y56A 2BS2B 1N62A 2MP1A 2SNSA 1JE4A 1AN8A 5C3EB 1VJKA 5C4XB 2K7VA 2E3TA 3M7GA 1WD1A 1EEFD 4EQPA 3DMUA 1S5BD 1CA6A 1YJIA 4DF7A 5M3MB 3KLSX 3Q8BA 3MFYA 1DOMA 4ARCA 1PZKD 1SYGA 3VRAB 1WGKA 2B2VC 2I07B 4MIUA 1UWMA 5EE9A 4LTUA 1IGCA 3R2IA 4RGTA 2EY2A 1YQ4B 2WXIA 1CFMA 1AEXA 1GXDC 4PV1C 2WDRB 2Q8RE 1O7LA 3PO2B 4IUPA 1S5FD 2WXKA 1LTTD 3NBIA 1HUNA 4GZYC 1E2VA 3AECB 3S9WA 1STBA 2EYFA 3TEZA 2NVYB 4IFDH 1T6BX 2B8FA 2NVXB 4XDCA 4R3DA 1KH0A 1M4VA 2EYMA 4NMZA 1KAAA 4UAIA 1PGXA 2QEJC 2Z1CA 4ZRPA 4KV6A 1D1IA 2B2TC 2INNE 5IIFA 5COYA 2L83A 1QOFA 2DN8A 4YIJA 1XWEA 1XTCD 2K5WA 1R7SA 1SE2A 5IGDA 2K3UA 1CQFA 1PLFA 4HROA 2Y5PA 1JROA 1B3AA 5C0XG 3J7AV 1DCZA 1G8ZD 5HGTA 3AE3B 3MA2B 3MXNA 2B2UC 5G3LD 2WKDA 2VNUD 1MSHA 3SEBA 3F2UA 1VF7A 5E4WC 1XCTL 2F3WA 1FYCA 2EJFC 4L8JA 4ABNA 2EDGA 3OW7A 5C4ZA 5FKAC 2SDFA 2JU6X 4R8NA 1S4ZA 5JEAH 1L0XB 2RDHA 1B9NA 1IL8A 3J80L 2DWQA 4M8AA 5C5MA 3IT4B 5IGBA 2SEBD 1IKLA 3UI2A 1QILA 1VDVA 1EY0A 1QKZA 5CV4A 1FD6A 4A93B 1W6JA 1ET9A 1FRRA 1C79A 3MC0B 2CW0C 2EPBA 2Z4IA 3MZ5A 1FD7D 3PZ7A 1YN4A 5CV6A 2WU2B 4MN3A 1GUNA 1N60A 1K50A 1R4PB 1EFID 1C4CA 5CV9A 1ESRA 2L32A 1OXTA 4ODGA 4CKCA 2FHTA 5DAUA 4BWGB 1WTRA 2B76B 2CJOA 1CK1A 3H8HA 2CQAA 2LHEA 2B39A 2K04A 2PTLA 4G4KA 4RHRA 5CYUA 2B2YC 3IXSA 4R8IA 1TS5A 1CA5A 3JAML 3K5LA 1AW7A 4BY1B 1EZ6A 4RHSA 1VCIA 5FLXL 2A5HA 2L1AA 2EZVA 1WTQA 2ON8A 1KLGD 1WTXA 3M4YA 2JXMB 1C78A 1TZOA 5C44B 4XIGS 1Y69U 1D2BA 1DOIA 4HEDA 5FR3A 3LXFA 1VZ6A 2ZW0A 4U68A 4N59A 1PYWD 4A3KB 4L2YA 3T13A 3P4RB 1GJXA 2N88A 1FNWA 3CU7A 3PUVA 1O7ZA 3ONAB 1K53A 1PZJD 2F0WA 4YSZB 4X3UA 4WWMA 5CV7A 1A2UA 1HTPA 1TT2A 2Q8TA 4TKOB 3R3OA 3J9CA 5TSSA 3WCQA 4EGVA 4FYDA 3GTJB 1NAPA 3TMEA 3N6RA 1JWBD 1H9RA 1EY4A 2F0FA 4PMCA 3EVQA 2IDYA 3A55A 3V05A 1HZ5A 4ZHOA 5EPLA 2SAKA 4K14A 3BYTB 4QUFA 1ZUD2 2A6HD 4P16A 2A69C 1V97A 4G7HC 3FMCA 1OXVA 1XLPA 4A3JB 1E6EB 4DQOC 1SNDA 1VF5C 2CHBD 4OL7A 1V1PB 5C4HA 4ITKA 4N9PA 1STAA 5M5XB 1J7AA 3LX0A 3GTOB 4K2KA 3K58A 3VR5A 4IUVA 3J81L 1V8QA 5KNCA 4RWSC 3TBIB 2NYZD 1F2RC 3OHXC 3Q8EA 4CHTB 4C3IB 5I2YA 1VR9A 2W82A 2F0OA 3QWNA 2IT1A 1FMAD 1SYCA 1L6VA 2VXWA 3PIO3 3WDNA 1STGA 4EQOA 3S1NB 1WWTA 2PZTA 1Y1WB 4YSYB 3K7AB 4OIJA 3VR3A 4BA1I 5A2QE 3FEWX 5JOBA 3D4WA 2X69A 1LT6D 5KRUA 2PLPA 1LTGD 1YN3A 3TN2A 2W3RA 1EQVA 4OO1G 2JSVX 1G91A 1SNCA 1PTOB 4B9WA 1CTMA 3I4LA 1Z6HA 5K5PA 2BYTA 1H9SB 4H44C 2LFIA 2PZUA 3K5OA 4X3SA 3NP8A 5FO7B 1N63A 1CM9A 4YTNB 1OXSC 1QB5D 2BB6A 3RPFC 4OVZA 1V1PA 4IZ8A 3HS0C 1RM6C 1SJHD 1II3A 3OOCA 1FXIA 1LTRD 2K6AA 1MI2A 1T5EA 5EE0A 2RKSA 2EYHA 5CBEE 2K22A 1H9JA 1EU4A 4L6TB 1YNJC 2IGDA 3P1MA 1PMRA 1JWAD 1E2WA 3HOVB 1QF6A 1BXTA 2BBCA 1ENCA 2DYMA 2MJEA 2N0SB 4FXDA 4PMWA 4KGRA 1GPXA 2IW3A 1EY7A 3H94A 1GOZA 3KWVA 4RCNA 3N9YC 2HDLA 3AEAB 3EFXD 1LT4D 4HCEA 2SNMA 3IT6B 5EKKA 4B0EA 3HOXB 1WSPA 2F0IA 2LKVA 2M56B 1JQ4A 5BYSA 1H9SA 3AE8B 2L1BA 2F0DA 3HOZB 1VZ8A 3M85A 5EKLA 4CKEA 2E2IB 2MUYA 4N6EB 3SK5A 2R3ZA 1WTWA 3C1EA 3AEBB 5C5LA 1EY5A 3B9JA 3S17B 1KDBA 2VZKD 2WXHA 2LMCA 1MSGA 2ZT9C 5JAVA 1B44D 4BS9A 2Q5WD 3RUZA 4IDIA 2DYOA 1TKEA 2BS4B 2XRQD 1ENAA 3Q8AA 2NMQA 1I4GA 3NWSA 4HKQA 3TSSA 4DFAA 2F0MA 3QOJA 3V96A 1JB3A 1F2RI 3L7ZC 2BS3B 3BWUD 3NE5B 4RA8A 4AYBB 2CW0D 3VA5A 2H89B 1VZ7A 4KGSA 5KNBA 2B2WC 5ELCA 4LK0M 4NP5A 2EKIA 1TKYA 3H6MA 4Q0FA 1HCZA 2FBWB 1U4LA 5JPNC 2CJNA 3NVZA 3VYUA 4PMBA 1DYQA 1SE3A 1IBXB 2V0GA 2PQEA 1F2YA 2YYZA 3DEPA 2HUGA 2MJ3A 1RHPA 3H3VC 3S2DB 4FF4A 1EWCA 2RMMA 1SIJA 2X38A 1WTVA 3I72A 2LS01 1HQMC 2ZXRA 1P7FA 4EVOA 3OSOA 1BUVT 4HSVA 2BE5C 4ZKBB 3ND9A 1I50B 3RZOB 3KBXA 1KNAA 3IAYA 2DY8A 1JW9D 1C9FA 3E5SA 1YQ3B 2KOLA 3URYA 4G7OC 3A8KE 4DXGA 4ULLA 2EYJA 3P7JA 1Q1BA 4C3IG 4DA2A 3MJ5A 2JA7B 3D8GA 4NJCA 2BOSA 1SNMA 2LY7A 1TU2B 3IFDA 2FJ2A 5K36H 4Y7NB 1DJRD 4IUUA 3SK4A 5BMIA 3BZDB 1IBXA 2YEPB 2A73B 1TR5A 3D4DA 3GTLB 2F0EA 4KMUC 1FNVA 3Q24A 1TQOA 5ELFA 3P42A 4KD4A 1D6EC 3VYSA 3AEDB 2A69D 5CV8A 4KY5A 5I4DA 1G291 5E6JA 2LFNA 4OW0A 2VUMB 1D4BA 2JE6I 4O42A 1IYUA 4NAWB 4HMIA 3V2TA 2L5TA 5D65A 4FVMA 4HTHA 1M8AA 1Y8OB 1HFNA 4JWUC 3K57A 2EE1A 2XRSD 1SYEA 1OXXK 3MXUA 5KEEA 2KQ4X 1JOOA 4L23A 3TEXA 1GUOA 3FDTA 1K51A 3GQBA 1O7YA 2M0AA 3X3MA 1UEAB 4QF4A 1ZXHA 1CJEA 4K5XA 3E6ZX 4WFN3 3C46A 1F2LA 1LO5D 3FKIB 3FRPB 4CQNA 1Y8PB 5BN4A 2R93B 2JX5A 4C1NI 1BCPC 2D5DA 2GRIA 3G6JB 3BDCA 2OXPA 1FXAA 4B08A 3VYRA 1D5ZC 3HG9A 2KMMA 5KGUA 2BDNA 3P75A 4DXFA 3L9AX 1JICA 1Q8IA 1OQQA 1FCCC 2BB5A 2Z4HA 4C56C 1ILQA 4A3EB 4OGQC 2WNMA 2PKOA 3AU7A 1L0VB 4KHVA 3VA7A 3ITPA 1FIQA 2KDMA 2K0PA 3AE5B 3DWMA