1T5XD

Hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Polymorphic Pocket at the P10 Position Contributes to Peptide Binding Specificity in Class II MHC Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 69
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1t5xD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1t5xD02
3BZDB 1CHPD 1TS4A 1JWSD 1SJED 1V1PA 3EA6A 4C56C 1BCPF 1RD9D 1TS5A 1ET6A 1S5BD 1XTCD 1RDPD 1RF2D 2XN9C 1I4QA 5ELCA 1M4VA 1EEFD 1JR0D 1GOZA 1D5ZC 1FNUA 2SEBD 2NTSA 1AN8A 1FGBD 5D3IB 4ZYSA 5FK9C 1L0XB 1JCKB 1LT4D 1CT1D 4K6LA 1AW7A 1MD2D 1UNSA 1BCPD 1EU3A 5I4DA 1PRTD 3O13A 1D5MC 1PTOC 1SE2A 1S5DD 3W2DA 1TS3A 1LLRD 1PTOF 4OHJA 3R8BA 1HTLD 4DXFA 1EWCA 1I4GA 3BVZA 1FNWA 2O2LD 1S5CD 3BVMA 1DJRD 2XRSD 1XXGA 4RH6A 1PTOH 1LTRD 1JQYD 3DWQA 2IPKD 2RDGA 4Z9CB 1I4HA 1B1ZA 4RGTA 5FKAC 1CQVA 1PTOD 2AQ3B 2IJ0A 1LT3D 5ELBA 1YN5A 1F77A 3DWAA 1DYQA 2Z8LA 1LT6D 1PYWD 2J4XA 1I4RA 2AQ1B 3TSSA 4O1NA 1FNVA 4RFBA 1RCVD 2G9HD 1I4PA 3BYYB 1G8ZD 1LTGD 3DWPA 4L6TB 1UUPA 3BYTB 1PRTF 3GP7A 1YN3A 1TY0A 1LTTD 1SJHD 1LTBD 4RHSA 2RDHA 1SBBB 2R61A 3MC0B 1STEA 1D6EC 3CHBD 3SEBA 2XRQD 3MFGA 2ICIA 1EEID 1LT5D 5ELDA 2NTTA 1LTAD 1JWUD 1JWMD 1BXTA 3R2IA 5TSSA 4BWGB 2QILA 1I4XA 5ELEA 1L0YB 1V1PB 3OWEB 1KTKA 2WV6D 1BCPB 1HXYD 1HQRD 1PRTB 1BCPC 1TY2A 1SE4A 4RGMA 5D3DA 3R2TA 1PRTC 4UDUC 1FD7D 1SXTA 1KLGD 1T5XD 1CK1A 1YN4A 2AQ2B 1ENFA 1ET9A 2CHBD 3KLSX 2XNAC 4DXGA 4RHRA 1KLUD 1V1OA 4TSSA 1TS2A 1D5XC 1LTID 3BVGA 1PTOB 1SEBD 4RCOA 3URYA 1B44D 4RGOS 1LTSD 4NZLB 1PZKD 3EFXD 5ELFA 4L63B 1S5FD 3V05A 1PZJD 1PZID 4RGNA 1LO5D 1S5ED 1QILA 1SE3A 2QEJC 1ESFA 1EFID 1EU4A 1CHQD 1HA5A 2TSSA
chains in the Genus database with same CATH superfamily
2WACA 3GE3C 1XQQA 3PRMB 2KHJA 2KQSA 1G2SA 3MAQA 1XTCD 4DUYQ 1R4NB 1D3ZA 1N34Q 1FVIA 3QWZB 4KGRA 2OT2A 1VD2A 3PQIA 4G11A 1R4MI 2L1AA 2V9HA 4IM2A 3SFDB 4HJ9A 2I07B 1AN8A 1YQBA 1Q81C 4HKQA 2KEDA 1A2TA 2BPSA 2SDFA 3G48A 1IBKL 4RA8A 1I50B 2B39A 4K6LA 2H1EA 1C4AA 1YJIA 3PO2B 1KAAA 4JWUC 2WNMA 4NPNA 4LDTD 3TEYA 5CC4A 3NK9A 2JVCA 1YJ9A 4CDEC 2BVCA 5M5WH 5JVG3 3L54A 1PTOC 1M90C 2VUMG 2X69A 2EY6A 5CTRC 1JMLA 1BR9A 2LFNA 4LWCA 4C7YA 1PTOF 3S1RH 4B9XA 1ZGUB 2KAJA 4M1UB 4KGTA 1EWCA 1YQ4B 2CCZA 3GTPB 4O2DA 2D3BA 2C7NB 3TEXA 1SMXA 1N36Q 1DOXA 1JOOA 2KVZA 1VF7A 1STBA 2WXPA 4EGVA 2IPKD 3UIPB 2HIVA 1STGA 1KNAA 2LGIA 2UU9Q 3ZKJC 1VQ8A 4EVOA 3H0GB 1FGUA 1F77A 1SYGA 1Y8NB 4H02A 2I5HA 2E2IB 3KQ4A 3QQ8B 2RKSA 2AWNA 1DGSA 1N63A 5C0XH 3J80E 1E0ZA 3FKYA 2NZ1D 1HTPA 4J3OD 2PE9A 5C4JH 2NCNA 4US8A 1LTGD 3DWPA 1EYGA 2FINB 5JAVA 1NBWA 4P16A 4YSYB 1NAPA 3GDEA 1CFMA 5I2YA 3TCAA 2N49A 2A5UA 2GI9A 4LK0M 4KHPQ 2NVXH 3ZJVA 3PUXA 3NRZA 4HIKA 1WX9A 2NBVB 4DV0Q 2KLCA 2L4NA 5GROA 1Q0WB 2LUEA 2BA0A 4FADA 2B2VC 1J7CA 5KRUA 1A62A 3HM6X 4HXDA 3CCLA 4GLSC 4KD4A 2K03A 2L76A 2HDLA 3KUDB 5GADC 2LGDA 1I4XA 4XE0A 2VQEQ 2N3SA 1V1PB 4DNTB 3NWTA 3HGBA 4DFAA 2B63G 1HR0L 1YD8U 3K9OB 4WJOA 3DHGC 1XWEA 3A33B 1YQ3B 4Y52H 3AU5A 4MTKA 4KSLC 1B9RA 3HKZE 4JI0Q 1C7YA 4IOAA 2QSDA 2HD5B 2ZJPA 1T5XD 1VS0A 1CK1A 4K6DA 1PYBA 4XZ4A 1YN4A 2J42A 2IO0B 1YEZA 3H3VI 1VQLA 4ZRIA 1TYGB 2WAQE 2B29A 4XIGS 3TJPA 3SGIA 4RHRA 4X57B 3VR5A 3QOLA 4TSSA 4PS8A 1DOLA 2GVAA 4HCPB 2HQLA 1TKYA 1FL0A 4CJ2C 1EOTA 1A0IA 1DCZA 3H0GG 2BKRB 1HNWQ 3AEGB 4FJVB 2O5JC 3TZDA 2HDMA 2D3AA 4JX1C 5JJLA 1WWTA 4A4IA 4WAAA 1LABA 3CD6A 3WIMA 4OO1I 1PDQA 4YHHL 1P7EA 2AHOB 2H4OA 3PZ8A 1WXVA 5DPWA 2MO1A 1WYDA 1EYDA 2DZMA 4EOYA 4QUCA 2BE5D 1KHIA 4JI4Q 3MXUA 2R7ZB 1J8CA 4OVVA 1LGRA 1KC8C 3FAHA 2LGYA 4ZRQA 5CV7A 2GA4B 1E0BA 4FP5D 4KKUA 4G4KA 4P71A 2QDBA 4L2YA 3TRZA 2N9KA 4CDCC 1WXSA 2JWUA 1STAA 1AW7A 3M4OB 2UXCL 1XTDA 3L16A 3GTMH 2LXAA 2MJDA 5I4DA 3ZLZA 2AUKA 2F4VL 5HHDG 1BBXC 4G3XB 3HK0A 1PH6A 1YOVB 3WCQA 1TS3A 1LLRD 1N5WA 4GXBA 2MPMA 2KVRA 4BS9A 1Q3LA 4DR7Q 4IUVA 3QC8B 3KW5B 3Q3JA 1XXGA 5HGTA 4JWSC 4RH6A 2AUJD 4USAA 1YNTE 4X3TA 5EE1A 2O2VA 1BUIC 2Z6KC 2JA6H 1SE9A 2QJLA 3QR8A 3PIOA 2A8VA 5DEHA 2PTLA 3RLOA 2RGFA 5FR6A 4DNRB 2KHSA 5AJ3Q 4DV6Q 1YN5A 3GB1A 1DOIA 4GOPB 2LEKA 1Y8RC 2MLBA 2PO4A 2CQOA 1CZPA 3AE4B 3OG5A 5AZHA 3IAM1 4DDID 3A74A 2KECA 2ZXRA 2KMMA 3GS2A 5IKCM 3AXCA 4P73A 4X66L 3RMKC 2NZHA 3HVDA 3SHLA 1K53A 4A3FB 4KY7A 3K5NA 1O7LA 2KK8A 3ZVVA 3SK5A 4L8JA 3C1EA 2KWUB 3Q8DA 2JA8B 4DAYB 3MC0B 4LFBQ 1TWAB 1XNRQ 1NBFC 1R7SA 2BBCA 3P63A 4ANUA 2LY7A 4IFDH 3ER0A 2KHWB 4DHZB 4FBJB 4OELB 5LL6X 2HJ8A 5ISRA 4BWGB 5EE9A 3CCRA 3E9IA 3B0AA 3EHVA 4BBNC 5E4XA 2PVOD 2F0GA 4L23A 5A2QL 2ZVNA 2LXKA 4BKTA 4LF5Q 2M00A 1IW7D 3G4SA 3RN9C 3VFKA 1IGCA 1GB1A 1OXXK 3KF8A 1T9HA 3S15B 3K6OA 2LWPA 2CKZB 1HZ5A 3K8AA 4DV1Q 3CCEA 3RZFA 2KACA 2N88A 2MP2B 4DR4L 1SSNA 4DAMA 4KZCA 1JOQA 2VQEL 2KFJA 4WIPA 2Z4HA 4DR3Q 2AQ2B 2Q2TA 1A5RA 4KKJA 5DPSA 3VXWA 5LL6S 3TDQA 2CH4A 1GG3A 4LNNA 2WP9B 2K04A 3J81j 3KLWA 3NVYA 2EYLA 2PCFB 1V5TA 4F8CB 2C60A 5HI1A 3ABVB 3QJYA 5LNK1 1B44D 1WTPA 2PEAA 2D9UA 4L5RC 2BB5A 5CHWA 2IY0B 2KTFA 2JE6I 1P3QU 1VR9A 4US9A 2K01A 5C4XB 3CCMA 3IRBA 1PZID 1TWHH 2A6EC 1GHJA 1X65A 4DR1L 4P7IA 1SLJA 2BWFA 3AFPA 3PCOB 3K58A 2JEBI 3EA6A 3OMCA 4L1BA 1HNWL 5JPNC 2F3IA 2YEPB 4R4IA 2XN9C 3AH7A 3Q3OC 2DN8A 2RCFA 4DK3C 4NAWB 2QMTA 1KRTA 2KNBA 1II3A 2XWJB 1GC7A 2BS2B 3DHIC 3V6EB 4MH8A 3KJOA 4A3KB 3MJWA 3QB3A 1EF5A 4H13C 1V86A 2WAQG 3FRPB 1QB5D 5FK9C 2W3RA 4X6AH 5HURA 3DHHC 1MSHA 3WA0A 4BOZB 2CW0C 4ZKBB 4W9DA 2DY8A 4KY6A 4EQOA 4A3CH 1IPGA 3EUB2 5IP4D 2MNAA 1A3VA 1LUZA 1PRTD 1S3OA 4ZRKA 2BYTA 3MTSA 3OOCA 5HFYA 1X6OA 1GHKA 4HLEA 2L5TA 3I4NG 4MZ9A 4N8FA 2EKEC 4BY7B 5DAUA 4W9LA 2QF7A 5FLXL 3IKJA 3T53B 2ASBA 2LRWA 4NQLB 3PO3G 2MA9B 1WD1A 1ZXTA 3GTPH 1WJJA 1G291 3DWQA 4Z9CB 4G0NB 3W1SA 2AQ3B 1YHBA 1KFYB 4JI6Q 3DVNV 4DUZL 3IT4B 1YJ1A 1I42A 1PYWD 1I4RA 1JB3A 5E1FA 3S1MB 5EJWA 2KVMA 2ZCCA 1F1HA 4RFBA 1UWMA 4HN7A 2HTHA 3I63C 3RULA 3I4MG 4MGKE 3FDTA 3AE1B 4IJLA 4C3HG 4ZKCB 1P7FA 1ZPSA 5IAAC 1VQBA 1GAQB 3AU7A 1SGHA 5HKHA 2PZTA 3TZUA 1R9TH 3UI2A 3VRBB 1MG8A 2NN6I 4DNIA 1K83B 3PMFA 4X3KA 5JJZA 3GTGH 2C7HA 2GOWA 1WXMA 2ENBA 1K8AC 4NKLA 3L2PA 4A3KG 5EKKA 2CU3A 2WHIA 3NS1A 2L83A 3NOBA 4IJHA 3W5VB 1LM0A 2EXDA 1VMCA 1GD7A 2BH2A 3L08A 3STBC 4E71A 4OWXB 1TWAH 1EQQA 1TWFH 4FF3A 1BBWA 4ZUIA 1UE5A 4DK1A 2KQ3A 5BMIA 1OEYJ 2K8HA 2OEDA 3WOEA 4XQNA 1YIWA 2YTYA 5GMVA 2M1MA 4ZAIA 2MW5A 3AQQA 1V1QA 2MQJA 4RMFA 3OW7A 3I7FA 2N7DA 3RUIB 2JN4A 1D7QA 3RNFC 2NWGA 3DBRB 3RNBC 1KLGD 4OW0A 3I73A 3W1SC 3KDFB 4YL8A 4JV5Q 5IODA 2CJOA 2C7MB 4IUPA 2K5QA 3TL5A 1IBKQ 3I4NB 1JWAD 3U7DA 1PH4A 1JALA 3KUCB 2EY2A 4JK1C 3VH4B 2Q2IA 1KL9A 1TS2A 1ILQA 1P16A 1WR6E 2F0DA 2IY1B 2FXQA 1ZXHA 2O4XA 3BVGA 3T56B 2NUCA 4JI8L 2VH2A 3VVWB 2UXBL 4FF2A 1N8RC 3GOEA 4DHJB 3ENEA 3VHTC 4AJWA 3A54A 3QIAA 4W9KA 3R7RA 3A0JA 1VQIA 1A63A 4IUNA 1UE1A 1L1OB 3IBEA 4TQ1A 2N9LA 4MGYE 1D4BA 3T3OA 3DPDA 2NVYH 4IZ8A 3TBLD 3I4MH 2F0UA 5J18A 2R92G 2WX1A 4B3SL 3DUZA 1IP9A 3I91A 3JAME 4DV6L 4QCLA 4QAYA 3TEHB 5IWAL 4A3DB 1UE6A 4C3HB 3A8IE 3VR4A 1WRDB 5CORA 3PS6A 4Q5VA 1HFNA 4QQBX 4IOCA 2Y3AA 1PA6A 3S2DB 3ZDTA 3P42A 5BO4B 1EQRA 3V60A 5KHQA 1WTHA 4YY3L 4GOPC 3OLMD 1OEYA 1BCPD 1EU3A 3K0YA 2V4IB 3EIVA 2N55A 1H9SA 5IYBH 1XLNA 2ZVOA 3UE1A 1MHXA 4ARCA 2DX5B 2K8CA 3KH0A 4NZLB 3B9JA 2WXHA 4WJNA 4OVUA 4EEWA 4V0BA 3U7ZA 4I6NB 1JICA 1XT9B 4QJFA 3BIID 1WFQA 4ZDVA 3RT3B 2M2LA 3RZDB 3NXWA 1K51A 3FVQA 3HS0C 4RGTA 4HDQA 4BFRA 1PTOD 2KWVB 4RWSC 3I55A 2KDIA 2JA9A 4WRDA 1PV4A 2J0MA 3DBSA 3EQLC 1DOKA 4JIOU 3AFQA 1Y8PB 2K6DB 2V3NA 4IPCA 3Q14C 4ICVA 2B2TC 1QG7A 2EQSA 1VCIA 4OONA 4PT5A 2B2WA 4PG3A 2R7FA 2WYQA 3MHZA 2OCEA 2XTIA 3D8GA 5J17A 4K1RB 4II3B 1LFDA 1TWGH 2VRRB 1NYQA 2PMVA 3V6CB 2N8NA 1Y56A 2MX2A 2Q8TA 1PVOA 1WJ4A 1R4PB 3MFGA 2CW0D 3TMEA 4C3HH 3P20A 1V2YA 3RNAC 5D65A 1HZBA 1B3AA 3Q8AA 3R2IA 1BXTA 1WGKA 3OTOL 4NXNL 2QILA 4HCEA 2KCCA 1ZP0B 2KDMA 4OXPA 2M4NA 2A73B 4XYCA 3V62A 3S14H 4GDKA 1KRSA 2IT1A 1ZOYB 2J0KA 2Y5BB 4RM8A 3NTKA 1TY2A 2W54A 3ML9A 2JJQA 2ASQA 5JHAA 4KIKA 1X54A 1KDCA 4RG1A 3FKIG 3MVVA 4OEMB 4A3DG 1DONA 3V2TA 1AEXA 3HOZH 1GXDC 5IP9G 2MRPA 4M00A 1BF4A 2PPBC 1I6HH 3PV0A 4NXML 1Q1EA 2VB2X 3JSVB 3IL8A 1Q8KA 3ZRCA 4XWWA 4MDKE 1ET9A 1ZW7A 1WCMH 5FJ8H 4YTNB 1VQ7A 2ZNVB 5K36H 1VJKA 5G5HA 1GUSA 5KGUA 3A4RA 4YWMA 3CKIB 1QNUA 2OHFA 1Z47A 1L2FA 5AZGA 3I90A 1C9FA 1F52A 3HOVH 4GDLB 1CKNA 1TBEA 1N9WA 1K50A 2F3VA 1E8ZA 3S1QB 2M8SA 4FXDA 4BBSH 5C4XH 3CMEA 1Q1OA 2M17A 1C3TA 2N0SB 2FHTA 2CS4A 4IM3A 3UQAA 2TSSA 4R8NA 3RR5A 3SHQA 1MHWC 2Q2UA 5D6JB 1V1PA 2G3QB 4I6PA 3TEWA 2F0WA 1V49A 2K75A 3PGEA 2YU9B 1KXLA 1EEFD 1VZ8A 3SK8A 1D5ZC 2DBYA 5BN4A 4B3MQ 4CDDC 4A3JB 5I2XA 2KJ6A 5CGKA 1AE3A 1IYUA 3T16A 3RN5A 2VS1A 1N60A 1E7VA 1GJZA 3K5OA 1C79A 2F0EA 4GU2A 1NY4A 1K9MC 4K0KL 4AQ7A 4RCNA 1OGWA 4C4VB 2GN5A 2E6XA 3L0OA 4GN4B 3O13A 3K5MA 2K6AA 2MSED 3ZDMC 3DM3A 1J19A 4ZHPA 3DLLA 1JRUA 2A1AA 2DYBA 3MEFA 4HSVA 3KYDD 1SF0A 2NN6G 3CRKC 4GLXA 3PLUA 4MJSA 4YY3Q 1AP0A 1HEZE 2WDTB 4DXFA 2JF5A 5IT9c 4RKLA 1JJCB 2GVBA 3FHWA 2KJXA 2HT1A 3HOVB 4DR6L 2I1KA 3WAPA 1FXAA 3I3TB 2OWOA 2IYDB 1SMYC 1OTRB 3K57A 2MBHA 4DK6C 4WJ3M 2JA5B 2G1EA 3BDOA 5COYA 4DUYL 1K0SA 1MFWA 1TGZB 5MPOA 2M9VA 2PMZE 3J80L 2FMCA 4HDOA 1R4MB 1XPRA 1WZ0A 2OQKA 3PHXB 1RHPA 1FNVA 3H7PB 4HK2A 4FN2A 1HFGA 3OMGA 5IYCH 4GOCA 4OZBA 4HIMA 1QZGA 2RSOA 2EVBA 3HKZB 1WE7A 4C2MH 1K52A 1B7YB 4WWNA 3DCGA 1EFWA 2NBFA 1RFKA 1IW7C 1QUQB 1SB3C 2BB6A 4MJSB 5HG2A 3NENA 1CM9A 3SR6A 4ANVA 1UZXB 2L1BA 3GTOB 1SFOH 4LF7L 2L9HA 2XRQD 3B6YA 3TS0A 3R66C 1C77A 2NVXB 4W9EA 3DVGX 2J0TD 3QO2A 3OHXC 5I9PA 2R92H 2DAFA 4NAMA 1V8CA 3AV8A 2WV6D 4F7ZA 2BA1A 3BINA 1HNZQ 1W6KA 1NI3A 4ZHOA 4EQPA 1NMGA 4BBSB 2KCMA 2MJEA 2KDBA 2EJFC 3BG3A 2O2VB 5M5YH 5TR5A 3RI7C 3BZKA 3PF4A 4M02A 2MCNB 1FD7D 1TR5A 4E6IA 1VQFA 5GAEC 2E2IH 1OXSC 4GOPA 4RMAA 3U4VA 2B63H 3TQYA 3P4RB 2A69C 1QUQA 5ELNA 1KH0A 2IBIB 3VDYA 3N1XC 1KLUD 4KZ0A 3H91A 1NE3A 4N6EB 1RAXA 3CCSA 1FIQA 2CR5A 1A3TA 1HNXQ 4B3RQ 2M19A 1PYSB 3S2AA 1LTSD 2INDC 3EFXD 3SXHA 4IFDJ 1I35A 3CCQA 4ASWC 2BTEA 3NELA 5M3MH 3EBEA 3JVZX 4FXGC 4NJ6A 4RGNA 1LO5D 2WXQA 4XQQA 1ESFA 1ISNA 1PFNA 1UF0A 1WE6A 1RRBA 1NENB 2L55A 1Q12A 3NS8A 3E0EA 1TS4A 4C56C 2PJHA 1AWDA 2BCOA 1M8AA 2IY5B 1YNJC 1BOSA 1M4VA 1XMOQ 3KF8B 4YCUA 2UUCQ 2B2UA 1E2VA 2NTSA 4AYBG 1KDAA 1TZ1A 3T3NA 4N9PA 1N32L 2F4IA 1K8OA 1L0XB 1JCKB 3DM1A 1CT1D 3HG9A 1XNQQ 1B2TA 2KT7A 2VH1A 3E56A 4JVZA 2WXJA 2F03A 1WZ3A 1MD2D 3ZXVA 3K0XA 3HOYB 1UNSA 1V8QA 2WGSA 2WXGA 2BGFA 2K9XA 1EM7A 1RM6C 3D0FA 4Y7NB 1YJNA 4X3SA 2PQAB 1H9JA 5C3EG 2DUDA 3GTJB 3PUWA 1RTNA 3NJTA 1WTWA 4U68A 1FRDA 4UPAA 1RODA 1J7AA 3ZJTA 3PSEB 2F1MA 2JU6X 1BQQT 2C9WB 2V1YA 4A3LG 3MJ5A 1Z2MA 2I5LX 5I6YA 2WP8J 3Q22A 2NVQH 2ES2A 2WAQB 2Q8IB 2DJGC 2FFKB 1YX5B 3RZWC 4PMBA 3ZXRA 1M1KC 1TWCH 4PZ7A 5IYDG 2F0MA 3MA2B 3R3OA 4KHPL 1PH2A 2MHVA 5DLQE 1XCQL 1XO3A 2F0LA 3TEZA 4K14A 3AEVA 3NWSA 1K73C 3TSSA 1EY6A 1ENCA 1N6ZA 1I4PA 3PZ7A 4YWGG 3HRDD 4B08A 3HIZA 3BYTB 2RSUA 1RWSA 5JXVA 1LTBD 3PUVA 3GTMB 1WX8A 3CIRB 2CFMA 3RD4A 4AS1A 1CJEA 1LACA 4W9HA 3VYSA 4JOIA 2A6ED 4WJQA 2DZJA 2B2VA 1QKZA 3KYHC 3D4WA 3TP5A 4KHZA 2HE7A 4MT5A 1OFFA 3APDA 5CMDA 5J39A 4TQUS 3G71A 3GD7A 4A3BG 5G5GA 2RQXA 5FLXc 1FJGQ 1V5OA 1U4MA 2VZKB 4KV2A 2OEOA 3SVMA 1HQRD 3CCUA 5C44G 3AULA 1A6XA 3ZTDA 3NQTA 1EIYB 3PO0A 1Q86C 4KI0A 4LF5L 3OJ3A 2LSSA 3D32A 2DWQA 4J6HA 3A1QA 3T4AC 4R1JA 4GNXB 2Y5PA 5EE3A 3J7YW 3IXSA 4LF4L 3I4LA 2H5XA 3RZOH 2IX3A 4KKSA 2R93G 2L00B 4CHKA 4KSKC 2KUMA 3W1YA 2RA4A 1VQDA 3FPUB 2K50A 2QCZA 4NQKE 5EQ0A 5IWAQ 3D4DA 1SEBD 4BKSD 4GB9A 1WM3A 2OOBB 4XX5A 2PI2E 1E24A 3KBXA 2SOBA 4QGUA 1I6VC 1WCMG 1X3EA 5FJ8G 2L7RA 1MI2A 1I5FA 3A9KB 3DMUA 3CCVA 4DV7Q 3AE6B 3IT6B 1ONLA 5IYBG 2PNRC 2KLGA 4JI5Q 1QILA 3DEPA 3HOXG 4DBGA 1A8VA 2JXXA 3HOYH 2A68D 1MHHE 1JWSD 1IKLA 2L32A 3ONAB 1ET6A 1J5EL 1HHVA 1RTOA 4L5SA 4O0AA 4HEDA 4C80A 4AWJA 1TQOA 3GTQH 1WGDA 3E5SA 1Z7TA 2SEBD 1WM2A 1F2RC 5M5XH 4K5XA 4R4OA 1DM0B 3OIPA 5D14A 3DBRI 4A3JH 2KKCA 4DR7L 2KTRA 1SSOA 4P6VF 1EY4A 4H7BA 3A9KA 1C1YB 2HHHQ 1D5MC 1C9OA 1MJCA 3H3VC 1SYEA 5EPLA 3Q8EA 1IKMA 1GUNA 2LVOA 2RSNA 3JC66 1I7HA 4AYBE 1WR1A 3CU7A 4DKAC 3ONSA 4FJYA 2L11A 3UDXA 3S1MH 5M3FG 4Y7NH 3ZO5B 2IX1A 4L5QA 1F2RI 3QCAA 2D5DA 1QOAA 1EIGA 1L1OA 3BVMA 1G51A 1O7IA 4ME5A 1YNND 4MIUA 3VYTA 2ZTDA 5FLMG 3L10B 4KJNA 4WWOA 2RDGA 3I4NH 4ZYNA 3NTHA 3P4PB 4X64L 5C44B 1SNOA 5CBAE 3ZJYC 4LF6Q 2DGYA 2QIEB 2D62A 5ELBA 2WXRA 4ZRJA 1H8CA 2JRIB 2J0JA 3HRZC 1L7YA 4JQWC 4A93G 4ID6A 1LXDA 1YIJA 2ZEQA 5CV4A 3W1GA 4ZRZA 2VQFL 1JB7A 5KIXA 4FYDA 3ERSX 1RYJA 1IL8A 3B2FA 3DEOA 1HJPA 1LV9A 3L4PA 3QHTA 1IBLQ 3VTWA 4H44C 1YNJD 3NTIA 5IY0A 5FR3A 1LTTD 2JXMB 5JH5C 4GMVA 1N5XA 1WTVA 2WXFA 4GSWA 2C5LC 4PNYA 2F0FA 3FP9A 3CWIA 1STEA 3CHBD 1U4PA 4OIJA 5DCNA 5BYSA 3GTOH 4ANXA 1E1TA 2KOLA 2MJ8A 4OIKA 4OO1H 3ITPA 4Q0FA 1GO3E 1NYRA 1UGJA 4IFDG 4WAFA 4C3IG 2ZXPA 3HOWB 3K7UC 1E8YA 4JV5L 1FFUA 3VR3A 4KX6B 1BCPB 1FRRA 4LLGM 3MHBA 2OTLA 3UIOB 1XCTL 2R7DA 4KTAA 4G7HC 2FUG1 2HJ1A 3QJZA 1SDFA 1PGBA 4BA2I 4JCVE 2KC1A 1QZEA 4UDUC 1PGXA 4KDIC 5LMNW 5CX3A 1HRJA 2JZZA 1GNUA 4JPSA 2NR2A 4PYZA 1QT9A 4OGQC 1U5KA 2A6HC 3CPWA 4IW0A 3VH3B 1GM5A 3KJPA 4FULA 2CHWA 3S2HH 2UYZB 2N9EB 3HVZA 4JGHB 4P1BC 3B08A 3OYYA 3M7NA 2JA6G 1ROEA 3H6NA 4JI1L 1Y1VH 4V190 1VQ6A 2IGHA 1CTMA 3DBLI 1IBMQ 3X23A 3TUOA 4K2KA 4AIMA 5DPRA 2LXJA 1W3SA 2F0OA 4OX9Q 2D3GA 1F9RA 3JAMi 4WQOB 2V3SA 4A3IH 1EY9A 3CXCA 4DR1Q 2G4SA 4AYBB 2WKDA 4ME3A 4GGQA 3KLRA 3ZIMA 1E3PA 4J6IA 4WWMA 5C4HA 2JYTA 3ALBA 4LCDE 4JI3Q 4HR7B 3GV6A 2UUAL 3KVFB 5BMGA 2D2CC 4IWPA 2PNHA 3NHEB 1B9MA 1RDPD 4NJ7A 5FO8B 2E76C 4RF1A 2MQHA 4HJ8A 2L05A 1FNUA 1VQMA 5AUIA 3TBIB 1J6QA 2ZJQA 2NVTH 2TMPA 1QOBA 4A3PA 1XPUA 1L4DB 1E1OA 4FXKC 1G91A 1WI5A 1F9JA 2I1JA 4JL9A 1FCCC 4MHEA 2JRHA 2R2OA 5G3LF 5NUCA 2XGTA 1WGYA 3WAOA 4GKJL 4A6QA 4DV1L 4LNKA 3S1NH 2B8FA 2RDFA 4PMWA 5I9OA 3Q24A 4A3GB 3LWEA 1PFDA 3I4OA 1WD0A 1B4OA 2ALYB 2W55A 1CKNB 3WANA 4OL7A 5FO7B 2FCQA 3SK6A 2F0JA 4K5VA 1I94Q 3ZJUA 3R8BA 5T1IA 2KFKA 1YHQA 3R7QA 2R92B 2CHZA 4C7ZA 1FNWA 1SAPA 1S5CD 1H9RA 1WTOA 2H89B 3CMAA 4C3IB 2NB0A 2WIIB 3EC8A 4WH4A 2IX0A 4HCSA 4MSMB 2V1CC 1H95A 2KBNA 1LT3D 2PLPA 3HOZB 1Z6HA 3T9LA 3A9JB 1I6HB 4G7ZC 5JOBA 3MZ5A 4FDBA 2VY3A 4LF8Q 4LNOA 3UDIA 1C8CA 4LNQA 2PMZB 3R3MA 4C1NK 1NUCA 2G9HD 2JY6A 1F2LA 4TKOB 2CQAA 1P0RA 3E9SA 2FJ2A 2K5VA 2GBMA 1EQVA 2E8GA 2GMIC 2J53A 4KKIA 2O6VB 4K81A 1WIAA 4XXEA 4LTUA 4EQNA 1X9NA 5GAHC 5EKIA 4CO7A 1S4ZA 5AJ3L 2FIDA 4R8IA 3CC2A 2ATWA 2L12A 1EY5A 2MP1A 4JI2Q 2JUOA 4LUVA 3IHPC 1YI2A 3NG0A 4JBKA 4LJZC 4DR6Q 2DYOA 2C5CA 1E5WA 4P1CC 1WGGA 3KUPA 5BN5A 1JJ2A 1UEAB 3KWLA 3N20C 4NJCA 2C35B 3RUZA 1E2ZA 4AJYB 4F1SA 1FYCA 3LB8C 3APCA 1V81A 3A9JA 2KYWA 3Q69A 4I7ZC 4JBWA 4IURA 4WORA 4HIDA 1EY8A 2QA4A 4ITKA 5IGDA 2R93B 4JE3B 1VCBA 2VNUD 2HHHL 2E2DC 1UGMA 1SYCA 4BKSA 2YTVA 3MXNA 1OTCA 4BY1H 4C3JH 5T1GA 2O6VA 2F0VA 3PHWB 5C4ZA 4GLVB 4B9WA 1VQHA 3S2HB 1IBXB 2KENA 1F2YA 2QGQA 4CKCA 4K7UA 5T8IA 4LF7Q 2NPTA 3HZXA 1VQEA 5KEEA 4DN4M 3V96A 2P5ZX 5F2DA 4DV5Q 3W1BA 1S40A 4BXXH 2JXTA 2YU9H 1ML0D 1L6UA 3Q8FA 4C00A 3N6RA 3HP3A 1A70A 3RNEC 5H1SE 1VDZA 2KEEA 2JQRB 2F0NA 3S1NB 1FXIA 4IKGA 5CHVC 3Q8CA 4YHHQ 2Q2HA 4M0WA 1EFID 4TUUA 3J7AV 3J81i 1F9SA 2W3SA 3S1QH 1HZAA 3BZCA 1SJED 3MXNB 1FXTB 3N1ZC 5IOCA 5CR3A 4JI6L 1S5BD 1FEHA 2UXBQ 2CJNA 4JW0A 5ELCA 1EWIA 2G4DB 3VRAB 3DVGY 1GUTA 1O7ZA 1YNNC 3U8ZA 4IN3A 3NVZA 2E5LQ 3I5JC 4I6LB 3SDZA 4C2MB 3J7A5 2BOSA 4HIOA 1NNXA 4X65L 1XMQQ 2IO3B 1NI2A 2YLMA 4NXMQ 1I3QH 1N61A 1R9TB 3F2CA 4LFAL 2BDNA 4EZLA 4DPGA 1ZYRC 5E6JA 3H7SA 3P75A 5JJIA 4JPBW 3CPFA 4UP9A 4OZCA 4IG7B 5IT9L 4GKJQ 3M3YH 3DBHB 3GTLB 3LJ3A 5LXIB 4K0KQ 4MGZE 2KC2A 3HFZB 3ND9A 2ICEC 3OTOQ 3QAQA 3M3JA 3AE5B 3JYUA 4GDKB 3AYHB 3RPFC 1CZWA 1NDDA 4HEA1 5IYDH 1XEEA 4TQ0A 1T0RC 3K80C 2G9DA 2Y0SE 1WI0A 1KM7A 3ERQA 1C4QA 3MXGA 1UBIA 3P1HA 1J7BA 3HOYG 4OWTB 4XWTA 3C3LA 4PK1A 2J4XA 2IO2B 1EWHA 2G5DA 4KN4C 3U50C 5DPTA 3SU8X 2K28A 3AM9A 1RCVD 3M63B 3Q6SA 5C3XA 3F2UA 3FKIH 2WU5B 4EUTA 2MFIA 3E3XA 1YN3A 4DUZQ 4AUQC 2D0PA 4J1MA 3U4EG 1H9MA 2I5MX 2J7QB 4EQ5A 4ALPA 4LF9Q 3IFTA 2XIWA 4AQYQ 4MH0E 4KVGB 1KABA 1ILPA 3GTQB 1JWUD 2N7JA 2F0IA 4PS7A 2LJ5A 5ELEA 5GAGC 2MUYA 5EE0A 2LUMA 1YJWA 4A3FH 1GVPA 3HEJA 4LW1A 2DENB 2DNFA 1PRTB 3EECA 1ASZA 2PVGC 1N33Q 1SIJA 1MBYA 1VQ9A 1KF6B 4MACA 3VDZA 2ZTEA 1FCLA 1VQGA 5EBCA 2EDGA 4HJAA 3VR6A 4A3BH 1XMQL 4BVUC 1TJEA 4ABNA 3HKZG 4HTHA 3U52E 1UE7A 3KF6A 1F9QA 3W5OA 5IE8A 4MNOA 3WWVA 3IAS1 4C4VA 2X6LA 1SN8A 4LFBL 3KUZA 2MBQA 5IT9E 2F0SA 4NP5A 4RCOA 5EPKA 4DV3Q 5KNDA 4BY7H 4JLCA 4E3CA 1BBUA 3SDLC 4A93H 2DLBA 4CGYB 1X3GA 2VW9A 3HOXB 1T6BX 2BKFA 1S5FD 4BY7G 3V05A 4A8XC 1VQAA 3RNCC 1Y14B 2CVRA 3J80i 1TXYA 3S15H 1EF1A 1SE3A 3QWNA 2FIFA 1Q90A 1AARA 2I38A 1T5EA 1JC7A 2EJMA 5IP9H 4X62L 1HR0W 4REZA 5GXGB 2K14A 1ZKHA 1RD9D 4YCVA 3RLFA 3TP8A 2LVPA 3AEBB 2L3ZA 3CF6E 1C78A 1HPCA 1K3RA 5LXHA 1DOYA 1JR0D 1GOZA 4B95A 4CJ1B 2YEPF 4B3TQ 4GIVA 4ZYSA 5J2RA 1JORA 1XD3B 1C4CA 1V43A 1TIFA 1EWYC 3AE8B 4MSQB 4J15A 1P8LA 1J9OA 1WCMB 3O65B 2VZKD 2FE8A 3JAML 4UHVA 2UXDQ 2Y5CA 4PV1C 1U4RA 3AEAB 2F4VQ 1PFMA 2YYZA 5CHFA 1HZ9A 2UXDL 3LXFA 1EUJA 2X8XX 5H92C 3CRLC 5DM63 4W9CA 4X65Q 1P98A 1HTLD 1BVSA 3HOWH 3BVZA 2GBRA 1YJJA 4IALA 4MEMA 2KJHB 1TWCB 1Y8OB 5JJKA 2PW5A 2PI2A 5K36G 1VLBA 2GBNA 2H88B 4BBNF 1DOMA 1FFVA 4MM3B 1LTRD 2LJIA 5CBEE 4CHTB 2RHSB 2MBBB 5FKAC 2UU7A 3EFCA 1SRUA 2Z4IA 4LJPB 3AEEB 3AECB 1QOHA 4NDXA 2IHFA 1KQSA 3N52A 3HOUG 3PO2G 2MHJA 2WKCA 4B3SQ 3MHSD 3P7JA 5A35A 4P75A 3F2DA 2GLSA 1EIFA 2Z0SA 1G8ZD 1AYFA 4TRDA 3OJ4B 4NY0A 2KN4A 2KTRB 2LMCB 1HZCA 2RF4A 1JE5A 1F9PA 5C2TB 1VQPA 2N7EA 2K32A 5AUKA 4XT3B 4DV3L 2ZPYA 4EE2A 4IPDA 1EIHA 1SIFA 4ZLTF 4GLAC 1IYVA 4M01A 2AWOA 1EZ8A 1UAPA 4MN3A 4KLKA 1G2TA 2ICIA 3SD5A 2LI5A 1WOCA 4YIJA 4LJOB 1FM0D 1LTAD 2L0CA 1OXVA 3OIQA 2BWES 2KZRA 5KYIA 3GZNI 4F88A 1MSGA 3C1FA 3S16H 4HCNB 4LUZA 2ZM6Q 2D07B 2AMCB 2MP2A 2KDFB 3NPPA 4K8IA 4RGMA 2GBJA 3JW0X 5IGBA 2J52A 1VF5C 2RVLA 1HA6A 1QLBB 5E6OA 2BT6A 2B2YC 1SXTA 3HUIA 4NAWA 4MGIE 4W9GA 3T1YL 2JA6B 4A3IG 4F8MA 2KMCA 5LLIA 4IWOA 4DAYA 2F0KA 4H0LC 1NSNS 4C1NI 2JA5H 4B3TL 1BMLC 3HOVG 1CMXB 1YZ6A 1N62A 3MP9A 2JPHA 1GB4A 3PIP3 3QIJA 1PTOB 2EJGC 4QMGA 5EPJA 4YCWA 5K5PA 1Q82C 3DWGC 4A9AA 3PO3H 3M62B 3ZNGC 4YTPB 1CUKA 2PW7A 3NZ3A 3VA7A 3M4PA 4X3UA 4X62Q 3Q3FA 1ZYRD 4KN7C 5BN3A 1X55A 3T1HQ 1RIPA 3KOJA 3J81E 2L0FA 4BKGA 3T1HL 1EU4A 2K22A 3VR8B 2W82A 2HQEA 3M85A 1E9MA 4RKBA 3M95A 1JRPA 3D4RA 1JW9D 4II2B 2ZJDA 2NYZD 3DHQA 1E6EB 3I8ZA 1PH5A 2F52A 4NW2A 2JA5G 2JA7B 2CWPA 4A3DH 1K8RB 4HMIA 1AE2A 5C3EH 1E7PB 1V9JA 1STNA 2N1WA 3VAWA 4P74A 3T1YQ 3GE8C 2NN6H 3JAMc 2R7ZG 1F0ZA 1SNMA 3EJIA 4DR4Q 1HUMA 2MGSA 1GUGA 4PZ8A 1L4ZB 2LVQA 1JT8A 3H15A 3P2BA 1N33L 1UWVA 3EVQA 5LMUL 3DBLB 4HMJA 3ZUNA 1S5DD 1YBYA 3LWUA 3W2DA 1HR0Q 2PYKA 2FNJB 2MJ3A 4D2KA 1CSPA 2VB3X 1PH9A 1K28A 1E8XA 2INNE 4A3MH 3MFYA 3A5ZB 4DDGD 2XK5B 2XRSD 3SFEB 2F0PA 2UUBQ 4JI7Q 3FMCA 1PH3A 4A3GG 4LF9L 1B53A 4DK0A 1CI3M 2IJ0A 4DR5Q 3GO5A 3I3CA 2JA8H 1EL0A 5IN7A 1VQOA 4N8X1 4ARIA 1GUOA 2UUAQ 4QY7A 3NVVA 2AQ1B 2K39A 1D1IA 3BDCA 3APFA 4KKTA 1IYFA 3DXJC 3BYYB 2EYOA 2WXOA 5C3JB 4LFCL 4UY8C 4R4CA 4A3IB 4BA1I 5D7GA 2KANA 4WJ4A 2KWDA 3PO2H 4W9IA 4K7WA 1TY0A 4M8NA 2XVSA 1E10A 4ILWA 1RKNA 5M9OA 1K3BC 4RHSA 2RDHA 4B9KA 1DD2A 4N58A 4DV5L 2VUMB 1TKEA 2W9NA 4JI1Q 4FVMA 3PV1A 4A3CG 3ND8A 2N9PC 2N4FA 1LT5D 1EY0A 1U4AA 1JWMD 4R3DA 4C3JG 3VUYA 1JROA 2RD0A 2FUHB 4G7OC 2MBEA 3OWEB 1HZ6A 3PF5A 4BAXA 5KNCA 3C46A 1XPOA 5M5YB 3ZQ4A 1VQKA 5IP7H 2K5DA 3QX1A 2ZW1A 3AE3B 2LS01 5LHY1 3S16B 1PRTC 4I65A 1EQTA 3CQZH 2ZM6L 3H0GH 3FC4A 4URKA 3AMZA 4Q2JA 2EY5A 2X38A 1D1KA 2BYEA 3D31A 1ZUD2 4EKUA 1WGHA 2HCCA 5J1ZA 1L5PA 2LGSA 2BDOA 4XYQA 1HQMC 2XEWA 4K8JA 4POFA 1PXUA 1L6VA 5C0XG 2K0PA 2KD0A 4KGSA 2K52A 4DHZE 3SR1A 3GZNB 2HTME 1WVLA 1N34L 1LM8B 5JHBA 1MGSA 2QDFA 4XTCS 1PZKD 3AB5A 4IFDI 2WXIA 4L63B 4P2CB 1H9SB 2JYOA 2R6GA 2B3AA 2ONQA 1MIUA 3H6MA 2V3PA 2LGXA 4QIWE 3B2GA 3CMMB 5C5LA 2MO0A 3QOJA 1QOGA 3Q3MC 2WLBA 4DV7L 1HA5A 5C4JB 5BR8L 2O6VD 2QKIC 1Y1VB 1RF2D 1YVCA 2K5WA 4KJOA 5CV9A 3NBHB 4YWLA 4LF6L 2K33A 1EUVB 2PW9A 4HPLB 4EFOA 3Q3NC 1R4NI 1PDXA 4DV2Q 2JSVX 1FO4A 3G6EA 3H9DA 1ACCA 1XLQA 4YWKA 1YX6B 3LYYA 2RBMA 3L9AX 1HCZA 4FNFA 2QC8A 3L3OC 1WFYA 2KQ4X 1WJ6A 1K8MA 5LMNL 2Y0SG 2A69D 2V4DA 3AE9B 4N59A 4JI0L 3J81c 2BYFA 1M94A 2KJRA 1Y69U 1VZ6A 3LNNA 3PGZA 2ZT9C 2KOXA 5CV6A 2WU2B 3A4SC 2ZW0A 3RNGC 1TTNA 1U0LA 2NVQB 4DV4L 1K0RA 1NTGA 1A3UA 4M0WB 2VL6A 2SNSA 3H94A 5I6WA 4J8QA 1HTOA 1PH8A 5C4XG 3J9CA 2B2YA 2N9XA 4HWIB 2VUMH 2OQ0A 1J5EQ 4C3IH 2A74C 2XSCA 1Q46A 1DYQA 1U9RA 1UH6A 1WF9A 3H8HA 5GQOA 2A5HA 3C2PA 4DR2L 5EDSA 2E74C 4O1NA 3RN2A 2B76B 4KIKB 3NEMA 1E22A 1HE8A 4BZAA 3HOXH 4HROA 5FLMH 1TIID 2FAZA 3VYUA 4OX9L 4A3OA 1F2MA 3M9BA 3HOZG 3JSVA 1RFAA 1K8GA 2FCSA 1Y1VG 2SNMA 3J7AF 3IG3A 1IBML 1AZPA 2UU9L 3RMHA 1UD7A 1WJNA 4BY1G 3FEWX 4IO9A 1WY8A 2DHZA 1D6EC 4YT0B 4JI7L 3UINB 1IXRA 4A20A 4CYEA 4IC7B 4R4TA 4DQOC 1P9DU 3AU4A 1PHJA 4KK7A 3L7ZC 3NQIA 1ICWA 4XT1B 1XYIA 1P1AA 2K1BA 4GDLA 5TSSA 3ZNHB 2JSOA 4QUFA 1SE8A 2BH8A 3A7AB 1O7YA 4ODGA 1O78A 5IGCA 1I94L 1XLOA 1VDVA 1HXYD 4AP4C 4K3BA 4JG2A 1QVGA 1JQ4A 4JC0A 2D11A 1BCPC 1SNDA 3CC4A 2EOTA 1SR3A 5CV5A 3I4MB 1UEBA 1WYGA 3H3VH 3PVLA 4W9FA 4A90A 1OQQA 4HKZE 3VYRA 4DA2A 4LFAQ 4DU9A 5M3FH 4IUTA 3WOFA 3X3NA 3U58A 5HGQA 2K25A 4UAIA 3AB9A 3E0JA 3ECIA 1ESRA 2XNAC 3KLSX 3CF5A 1SMYD 1C4PA 4EX5A 4GN3B 4LNFA 1BUVT 3OSOA 2INPE 3RZDH 4LAAA 2WXMA 1D5XC 1XMOL 4P72A 3I2ZA 3IVFA 1WTXA 3N1YC 1D2BA 2JZ3B 4TV3A 4MTNA 1WGRA 3N32A 4RGOS 1E7ZA 4UP7A 3S1RB 5AEKB 3P4SB 2K05A 2LASA 1EYCA 3P1MA 1IBLL 3K7AB 4BBRB 3Q23A 2K7VA 1BNZA 2Z6KA 1CKOA 2WB1B 2CH4W 2L0TA 2VQFQ 4DR2Q 4DGZA 2FCNA 2KMAA 1T0QC 2NVUI 3BZDB 3C0RB 1CHPD 2WXLA 1UBQA 4IPGA 3TP7A 1TS5A 2GB1A 3BJUA 4FF1A 4F7XA 1EO6A 3W9CB 4CQNA 2IWHA 2CU1A 1FGBD 4XDCA 3Q6BA 2RHQB 2LXCA 1LT4D 3PIPA 1Q7YC 4BY1B 3ZGZA 1SNCA 4HVBA 3TN2A 4DR3L 1SYDA 3NBIA 3RFZB 2KA7A 3OWFA 1JOKA 3HOWG 2D10A 1CKMA 5KHOA 1D8LA 1WTQA 2I46A 3UGBB 2EZVA 3W5UB 3SK4A 1O80A 2OF1A 1NJIC 2PIAA 2IHEA 3QG1A 3A8JE 1B50A 1E7UA 3H7PA 4QL5A 3LDZE 3HM3A 1YHAA 3PPAA 1SE2A 2D2QA 4GKKL 1QVCA 2WDRB 5C23A 3DBHI 1STHA 4HRSA 2NBUA 5LMNQ 2IDYA 4CKEA 5CV8A 4S17A 1TKGA 2O2LD 3QK0A 1DJRD 2DNCA 4XGAB 3BK2A 4IQZA 1ZDVA 4EZKA 5C44H 4FF4A 3KLSA 1DGJA 4HJ7A 1OQRA 1WXQA 2Z9HA 2LZ6A 3UE0A 3QA8A 3ULPA 2JQOA 2Z8LA 3EGRA 3KBGA 3TS2A 1KRHA 3AE7B 4X66Q 5IOIA 1QF6A 4BBRG 2L15A 1OXUA 3FILA 1VQ4A 2K8BA 2HIXA 5AZFA 1IBXA 3F8TA 3RYTA 1E90A 2I2YA 4L6TB 1UUPA 1WX7A 1TKWB 4H2AA 1I50H 2BF8B 4HAEA 1OXTA 5C0XJ 3M4YA 4A3LH 2CKHB 1SROA 1PQSA 3H1UA 1I3QB 4HJKA 1KDBA 2ID0A 1SBBB 1TU2B 4JI8Q 1PGAA 3UDFA 5E6NA 1MKHA 4PS3A 2JEAI 1FPYA 2OTJA 3N9YC 2OJRA 3S9WA 1IUEA 2ZZPB 1NVID 2KO3A 4EZJA 1E2WA 2DNEA 2KHIA 3ML8A 3KWVA 4K3CA 2K1FA 4IWQA 5JEAG 2ACZB 2ZPNA 4IUMB 2AL6A 1S72A 3NUHB 5JZEB 3A5UA 2JYEA 4LDTB 3GTJH 2K5HA 1LTLA 3K7AH 4BBRH 3DOWA 4PYUA 1J8IA 1NCVA 4G57A 2MBOA 3NZSA 4L5TA 5EGTA 5IGFA 1KNEA 3FILB 1BKBA 3BWUD 4IUQA 3J81L 3MWYW 2NZOA 5J3BA 2LD9A 5IO9A 3VA5A 2WX0A 3J80c 3TIXA 1L0WA 3RLNA 1FJGL 2UXCQ 1V80A 2O5IC 3ULJA 4KHVA 2B3GA 5D94A 2CHBD 3M4QA 2ON8A 5IP7G 3AEFB 3RZOB 4ICUA 5E3FA 3T13A 2LMCA 3UI3A 1FR3A 3S24A 2EYHA 2L52A 2WQYB 5BMHA 4N9TA 4KD3A 3D6CA 4RM9A 1PFBA 2M0XA 2QHOA 3CW2C 1BT0A 2WXKA 4WWPA 1ZXIA 2LHDA 2PPHA 3K81C 2V0GA 2PQAA 3KK7A 5IYCG 1VQCA 4A93B 1QJOA 1V9PA 4LF8L 1V6EA 2J7ZA 4WJWA 2DYMA 1OQYA 3EFUA 4DWFA 3A7LA 4XDXA 3C8YA 1I4QA 1V97A 2N1VA 5C5MA 4QF4A 4HJ5A 2DY7A 1BO0A 2EYFA 2AYOB 4B0EA 4E74A 5M3MG 3UQBA 1QVFA 3K9PB 3E6ZX 1WH3A 5FO9B 1IL2A 5DNFA 1KD1C 3RD2A 5FOBB 4CKBA 3EN2A 1B8AA 5IA7A 1W2BA 3AN1A 2K5NA 5C0XI 3X0WA 3M7GA 4JYAQ 1GUWA 2FCMA 1B3QA 2Z1CA 2ZNVC 5IGGA 4K7SA 4QIWB 2R2QA 2LFIA 4A75A 4GKKQ 2NMQA 2WWZA 4ZCKA 4FXCA 2YTXA 5LMUQ 2E2HH 2BW2A 2V4LA 2MWSB 3CP0A 1G6JA 2NVYB 3M4OH 1ZE3D 2F0QA 4A3MG 2JA8G 1KLVA 1AH9A 3ICEA 4CDFC 2JT4B 1TWFB 1I4GA 4GS3A 1WYWB 3PRZA 5E6PA 1QQRA 3ETRA 3NUCA 1NMFA 3BS1A 2JA7G 2KX0A 4XC2A 5AFWA 3I9V1 3QARA 1BDOA 1JQYD 4B6WA 1TZOA 1A2UA 1I4HA 1Z9FA 5ELOA 5C1ZA 3NY5A 3VTUA 1C76A 3V61A 1E8WA 2IL8A 1CA5A 3DWAA 2EELA 3Q8BA 3MEHA 2HD3A 3KFUA 1DZ1A 3U2SC 2Q8RE 1HUNA 3V3XA 1QE6A 3N30A 4U673 4UP8A 3KF6B 3MC8A 1ENAA 3VQIA 4FJZA 1EYAA 1VQJA 2QCPX 1PRTF 1TWHB 5KYLA 3GP7A 4NNJB 4DXAB 3A1QB 4GNXA 2KCTA 3HKSA 1JMCA 1WXAA 1S3SG 2F0TA 2DJFC 3U4ZA 1PH1A 2D3CA 3Q2AC 1Q5WB 2WINB 1ASYA 3SEBA 1QWYA 3T8MA 4A76A 2HCIA 2B63B 5L83A 1LQBA 2AKWB 2NTTA 3D6WA 1YITA 2M56B 2KX3A 1Q1BA 3LX0A 5IIFA 1Q10A 4M8MA 1CZGA 1GJXA 1L0YB 4FHKA 2XK5A 4OWWB 5A2QE 4F87A 3ZTCA 3M3YB 2R93H 2JZPA 1C48A 1SE4A 5D3DA 3BY4B 1F2ZA 2IZVB 4ZK9B 1SYBA 2B8GA 2F0HA 2PZUA 3F1ZA 1Z5SB 2PKOA 2CHXA 4RF0A 3G7LA 4NXNQ 3BK1A 2BQQA 4FLHA 2E5LL 1XNQL 2HDEA 3H09A 1N32Q 1GUAB 4O42A 3RCZA 2OXPA 2E2JB 4M8AA 4ZRPA 2DZKA 2C9OA 3KYCD 2BE5C 1EZ6A 3BDLA 4K2LA 1LTID 3T51B 2K6QA 1ZEQX 5E4WC 3X3MA 4AOFA 1H9KA 1L1OC 4LMQD 5ELFA 4A3MB 1MJDA 4S3SA 3F2BA 4TMAB 1AZQA 2E2HB 1VRAB 2FMMA 1PZJD 1EY7A 4JI5L 2QEJC 2ZCBA 4MM3A 5D2MB 1AFPA 2LHEA 4XYOA 4CJ0B 4YXDB 5L95C 3PIO3 2E75C 4CBVA 1U4LA 1A15A 1BCPF 4GN5A 5L37A 1CQFA 3DWMA 1HNXL 4B3RL 2M0AA 3MC9A 4X64Q 1T3QA 3VTVA 1MG4A 2A4ZA 1ZDXA 4XQJA 3PT2B 1T0YA 2B2TA 1CSQA 5D3IB 1G6ZA 5IGEA 2B2WC 4LF4Q 1WJUA 2EKIA 3A55A 2WS3B 1EOVA 4LUOA 1QCBD 3NP8A 1IHZA 4JBJA 3ZNZB 4PMCA 3GTKB 4GZYC 1WMHA 4BXXG 3FKIB 4HPPA 3HHMA 2EIFA 4PQXA 4A3GH 2A68C 1HNZL 2WDVB 2FBWB 4YTMB 2YVCA 4KMUC 4A3FG 2D0OA 1GPXA 3IFWB 3UF8A 4DF7A 1UWXA 3IFDA 1FMAD 3MTNB 3WALA 4QB4A 3CSFA 4RNAA 1KOTA 1ZKOA 1L2NA 2HUGA 3P4QB 1PTOH 3AI5A 3OPOA 1QZHA 3CC7A 5JPMC 2RMMA 1KIXA 1XLPA 3ULLA 1W6JA 3PREA 1KAWA 1C0AA 1RJTA 2Y0SB 2DZIA 5BR8Q 3NBHA 1VQNA 1GC6A 2WB1E 1WRIA 1B9NA 4I7AA 4JBMA 4LFCQ 3PTFC 1IYJB 1WMHB 2KCNA 1VZ7A 3K59A 3B1LX 1X3FA 2RDBC 3NHHA 2Z0DB 1X1MA 1OO9B 1X56A 4R4QA 1SJHD 1KJTA 1WSPA 3L13A 3TMPB 1Y1WB 5C3EB 1NEKB 2R61A 2OJWA 1LYLA 2A6HD 3N3KB 1PLFA 2YV5A 1RLFA 3Q0AA 3PUYA 2UUBL 3E9HA 2JWZA 2JK8A 1SNQA 1EEID 5ELDA 1ICFB 1S1QB 3BU2A 1CA6A 1PMRA 4WJPA 3NSWA 2WXNA 4ZOHC 3CQZB 1JWBD 4IDIA 2JP1A 4ACFA 2ZTCA 3L17A 2B2UC 2Q5WD 3WAMA 2EPBA 3LGJA 2R3ZA 2DAJA 3AE2B 2Z0EB 2LKVA 1R4QB 1QNKA 4APVA 2L8JA 2N78A 2BS3B 1YMHE 2D5GA 3PZDA 5E7NA 4JYAL 4IM0A 4S0RA 3U9OA 1PUTA 1STYA 3WDNA 1T0SC 2KXJA 1ENFA 2XBBC 4KDLB 3UDGA 1Q8IA 4FHJA 5G2NA 2QEXA 2E2JH 2EXZA 4A3EG 1SFOB 4NMZA 3K5LA 4AQYL 1IGDA 5CYUA 2UUCL 3VUXA 4DV0L 4A3EH 3URYA 3GTLH 2BS4B 2RPVA 4FA6A 3HOUB 5DM73 1K83H 4JI3L 3GTGB 2EY1A 1MJEA 5JEAJ 2RR9A 2VZAA 4C3JB 3C19A 1TVXA 4KY5A 2BYVE 5EBDA 1TT5B 5M3MB 2ZJRA 4GN1A 1CHQD 2NS5A 4BBSG 3MXPA 5JVH3 4A55A 1HH2P 2EE1A 3U9SA 2QDLA 2WDQB 1Y1WG 1FD6A 3W3AA 4K5WA 4DR5L 1MVKA 1IZ6A 4HPMB 5KNBA 1DXMA 5M5XB 2E3TA 2KQ7A 3A8KE 2K5PA 4DV4Q 2WB1G 1N36L 1SYFA 2RPQA 3ZNID 4DAVA 2IGGA 2PE6B 3RNUA 4GNXC 4MELA 2XWBB 3S17H 3TP6A 1B70B 5EAYA 3FPPA 1RL2A 4IOIE 2K3UA 1XJVA 1HTQA 1H4RA 2AEHA 1NR4A 3CSTA 4HJGE 5BYRA 4POGA 1JE4A 4IUUA 3AEDB 3GTKH 2MH7A 3PO3B 1X32A 3PLVA 4OVZA 1UELA 2REXA 2LRUA 4XDDA 5H8YE 4OHJA 1GKHA 3S2DH 4DK5A 5HY6A 1JJGA 2SAKA 3DDCB 3D3RA 1VMPA 3R93A 3I70A 3ZRFA 2Z59B 4B0MA 4A3EB 3CAMA 1PH7A 4DV2L 3IAYA 3NZUA 1B1ZA 1CQVA 1Y1WH 4TKNA 4BOSC 4DHJD 2AX5A 2AWTA 3GV3A 3VUWA 3KDFA 1LT6D 4OO1G 1X3QA 4HSPA 3GQBA 4WQMA 2F3WA 5G3LD 2K4KA 1QOFA 1G6PA 2UWQA 3DQVA 3STBD 2EMSA 1TT2A 1YNXA 3EROA 5FLXE 5G55A 1NR2A 4ANWA 3PSIA 2PZWA 2KFKB 3ZW3A 2Z6BA 4TVAB 2ZXOA 4YSXB 2A19A 2NPTB 4JOIC 5C6AA 5JEAH 4WFN3 4N9F4 3G6JB 5BYQA 3I56A 2NVTB 2EYJA 3NE5B 4ULLA 1MPEA 2MEKA 3PRPB 1KTKA 2EYPA 1MI0A 2QW7A 2VXWA 5M5WB 4W9JA 5J22A 4PZ6A 5M3FB 3DVNU 3OW2A 4IPHA 2EMTA 3U30A 4ZQ3A 2EYMA 3R2TA 3J7ZC 3ZYYX 3HOUH 2WFWA 3S14B 2GRIA 3CCJA 3VR2A 3L0WB 4WURA 2I0QA 3VR9B 1XX8A 3A56A 2KWCA 2X6GA 2GBKA 4LNIA 2KN5A 4LK1C 4DXGA 2JA7H 5C3WA 4A3KH 2IO1B 4B3ML 2IW3A 1V1OA 3I57A 1XNRL 4R9WA 2CWAA 4JI2L 4RAUC 3NVWA 3I72A 1WTRA 2JX5A 4NB3A 4G50A 1TWGB 4KV6A 2PQEA 3PUZA 4ZUJA 4JI4L 3AMUA 2AL3A 4NPSA 4DAPA 2G45B 1J0GA 1L0VB 2NBWB 4A3BB 4AH6A 3TREA 2R7ZH 1X3PA 1XF5L 2IGDA 4OZAA 3OAWA 4FO2A 4YSZB 1SNPA 1S5ED 2INCC 2KDEB 2RCNA 4A3JG 1VQ5A 1PFSA 5EKLA 3SE0A 3S17B
chains in the Genus database with same CATH topology
2WACA 1G2SA 3MAQA 1XTCD 4KGRA 2OT2A 2L1AA 3SFDB 2I07B 1AN8A 4HKQA 2KEDA 1A2TA 2SDFA 4RA8A 1I50B 2B39A 4K6LA 2H1EA 1C4AA 1YJIA 3PO2B 1KAAA 4JWUC 2WNMA 3TEYA 5CC4A 3NK9A 5JVG3 1PTOC 2X69A 2EY6A 1JMLA 1BR9A 2LFNA 4C7YA 1PTOF 4B9XA 2KAJA 4M1UB 4KGTA 1EWCA 1YQ4B 3GTPB 3TEXA 1JOOA 1VF7A 1STBA 2WXPA 4EGVA 2IPKD 1STGA 1KNAA 2LGIA 4EVOA 3H0GB 1F77A 1SYGA 1Y8NB 2E2IB 3KQ4A 2RKSA 2AWNA 1N63A 5C0XH 3J80E 1E0ZA 2NZ1D 1HTPA 4J3OD 4US8A 1LTGD 3DWPA 2FINB 5JAVA 4P16A 4YSYB 1NAPA 1CFMA 5I2YA 2GI9A 4LK0M 3ZJVA 3PUXA 3NRZA 2L4NA 2BA0A 2B2VC 1J7CA 5KRUA 4GLSC 4KD4A 2K03A 4XE0A 2HDLA 1I4XA 1V1PB 4DNTB 3NWTA 3HGBA 4DFAA 1XWEA 1YQ3B 1B9RA 2QSDA 1T5XD 1CK1A 4K6DA 1YN4A 2J42A 1TYGB 4XIGS 4RHRA 3VR5A 3QOLA 4TSSA 1DOLA 1TKYA 4CJ2C 1EOTA 1DCZA 3AEGB 2O5JC 3TZDA 2HDMA 4JX1C 1WWTA 1LABA 4OO1I 1PDQA 1P7EA 2H4OA 3PZ8A 1EYDA 4QUCA 2BE5D 2R7ZB 3MXUA 4ZRQA 3FAHA 5CV7A 2GA4B 1E0BA 4FP5D 4KKUA 4G4KA 2QDBA 4L2YA 2N9KA 2JWUA 1STAA 1AW7A 3M4OB 2MJDA 5I4DA 2AUKA 5HHDG 1BBXC 3WCQA 1TS3A 1LLRD 1N5WA 2MPMA 4BS9A 1Q3LA 4IUVA 1XXGA 5HGTA 4JWSC 4RH6A 2AUJD 4USAA 1YNTE 4X3TA 5EE1A 1BUIC 2QJLA 5DEHA 2PTLA 4DNRB 2KHSA 1YN5A 3GB1A 1DOIA 3AE4B 2LEKA 2PO4A 1CZPA 3IAM1 2KECA 2ZXRA 2KMMA 3GS2A 3HVDA 3SHLA 1K53A 4A3FB 4KY7A 3K5NA 1O7LA 3SK5A 4L8JA 3C1EA 2JA8B 3MC0B 1R7SA 1TWAB 3P63A 2BBCA 2LY7A 4IFDH 5LL6X 5EE9A 5ISRA 4BWGB 5E4XA 2PVOD 2F0GA 4L23A 5A2QL 2M00A 1IW7D 1GB1A 1IGCA 1OXXK 3KF8A 3S15B 3K6OA 1HZ5A 2KACA 2N88A 1SSNA 1JOQA 4WIPA 2Z4HA 2AQ2B 4KKJA 5LL6S 3TDQA 2WP9B 2K04A 3NVYA 2EYLA 2PCFB 5HI1A 3ABVB 3QJYA 5LNK1 1B44D 1WTPA 2D9UA 2BB5A 4US9A 2JE6I 1VR9A 2K01A 5C4XB 1PZID 2A6EC 1GHJA 3K58A 2JEBI 3EA6A 3OMCA 4L1BA 5JPNC 2YEPB 3AH7A 4NAWB 2XN9C 2DN8A 2QMTA 1II3A 2XWJB 2BS2B 4MH8A 4A3KB 3QB3A 4H13C 3FRPB 1QB5D 5FK9C 2W3RA 5HURA 1MSHA 2CW0C 4ZKBB 2DY8A 4KY6A 4EQOA 3EUB2 1A3VA 1PRTD 2BYTA 3MTSA 3OOCA 5HFYA 1GHKA 2L5TA 4BY7B 5DAUA 2QF7A 5FLXL 3IKJA 3T53B 1WD1A 1ZXTA 1G291 3DWQA 4Z9CB 3W1SA 2AQ3B 1KFYB 3IT4B 1PYWD 1I4RA 1JB3A 5E1FA 3S1MB 5EJWA 2KVMA 4RFBA 1UWMA 4HN7A 3FDTA 3AE1B 4C3HG 4ZKCB 1P7FA 1ZPSA 1GAQB 3AU7A 2PZTA 3TZUA 3UI2A 3VRBB 2NN6I 5JJZA 1K83B 3PMFA 4X3KA 2ENBA 4NKLA 2CU3A 5EKKA 3NS1A 2L83A 3W5VB 1VMCA 4FF3A 4ZUIA 4DK1A 2KQ3A 5BMIA 2OEDA 3WOEA 4XQNA 4ZAIA 3OW7A 2NWGA 1KLGD 4OW0A 3I73A 5IODA 2CJOA 4IUPA 2K5QA 3I4NB 1JWAD 1JALA 2EY2A 4JK1C 1TS2A 1ILQA 2F0DA 1ZXHA 2O4XA 3BVGA 3T56B 2NUCA 4YSZB 4FF2A 3A54A 3QIAA 4IUNA 4TQ1A 2N9LA 1D4BA 3T3OA 4IZ8A 2F0UA 3DUZA 3I91A 3JAME 4QCLA 4A3DB 4C3HB 3A8IE 3VR4A 5CORA 4Q5VA 1HFNA 2Y3AA 3S2DB 3P42A 1BCPD 1EU3A 3K0YA 2V4IB 2N55A 1H9SA 1XLNA 1MHXA 4ARCA 3B9JA 2WXHA 4V0BA 3U7ZA 1JICA 3BIID 2M2LA 3RZDB 3NXWA 1K51A 3FVQA 3HS0C 4RGTA 1PTOD 4RWSC 4WRDA 3EQLC 1DOKA 1Y8PB 2V3NA 2B2TC 1QG7A 1VCIA 4PT5A 2B2WA 3MHZA 3D8GA 1NYQA 2PMVA 1Y56A 2Q8TA 1R4PB 3MFGA 2CW0D 3TMEA 3P20A 5D65A 1B3AA 3Q8AA 3R2IA 1BXTA 1WGKA 2QILA 4HCEA 2KCCA 1ZP0B 2KDMA 2A73B 2IT1A 1ZOYB 3NTKA 1TY2A 2W54A 1DONA 1KDCA 3MVVA 3V2TA 1AEXA 1GXDC 1BF4A 2PPBC 3PV0A 1Q1EA 2VB2X 3IL8A 4XWWA 1ET9A 4YTNB 5G5HA 5K36H 1VJKA 1GUSA 5KGUA 3CKIB 1QNUA 2OHFA 1Z47A 3I90A 1C9FA 4GDLB 1K50A 2F3VA 3S1QB 4FXDA 2N0SB 2FHTA 4R8NA 2TSSA 1V1PA 3TEWA 2F0WA 2YU9B 1EEFD 1VZ8A 3SK8A 1D5ZC 2DBYA 5BN4A 4A3JB 5I2XA 5CGKA 3T16A 1IYUA 1N60A 3K5OA 1C79A 2F0EA 4AQ7A 4RCNA 2E6XA 3O13A 3K5MA 2K6AA 4ZHPA 4HSVA 1SF0A 2NN6G 3CRKC 1AP0A 1HEZE 4DXFA 4RKLA 2KJXA 3HOVB 1FXAA 1SMYC 3K57A 2JA5B 2G1EA 3BDOA 5COYA 5MPOA 2M9VA 3J80L 2FMCA 1RHPA 1FNVA 1HFGA 3OMGA 4OZBA 2RSOA 2EVBA 3HKZB 1K52A 2NBFA 1RFKA 1IW7C 1SB3C 2BB6A 5HG2A 1CM9A 3SR6A 2L1BA 3GTOB 2L9HA 2XRQD 1C77A 2NVXB 2J0TD 3QO2A 3OHXC 5I9PA 4NAMA 1V8CA 3AV8A 2WV6D 2BA1A 1NI3A 1W6KA 4ZHOA 4EQPA 4BBSB 2MJEA 2EJFC 3BG3A 1FD7D 1TR5A 4E6IA 1OXSC 3P4RB 2A69C 1KH0A 1KLUD 3H91A 4N6EB 1FIQA 1A3TA 2M19A 1LTSD 3EFXD 3SXHA 4IFDJ 2BTEA 4FXGC 4RGNA 1LO5D 2WXQA 4XQQA 1ESFA 1PFNA 1NENB 2L55A 1Q12A 1TS4A 4C56C 1AWDA 2BCOA 1M8AA 1YNJC 1BOSA 1M4VA 2B2UA 1E2VA 2NTSA 1KDAA 3T3NA 4N9PA 1K8OA 2F4IA 1L0XB 1JCKB 3DM1A 1CT1D 3HG9A 1B2TA 3E56A 2WXJA 2F03A 1MD2D 3HOYB 1UNSA 1V8QA 2WXGA 2K9XA 1EM7A 1RM6C 4Y7NB 4X3SA 1H9JA 3GTJB 3PUWA 1RTNA 1WTWA 4U68A 1FRDA 1RODA 1J7AA 3ZJTA 2F1MA 2JU6X 1BQQT 3MJ5A 5I6YA 2WP8J 3Q22A 2WAQB 2Q8IB 2FFKB 4PMBA 1XCQL 2F0MA 3MA2B 3R3OA 2MHVA 1XO3A 2F0LA 3TEZA 4K14A 3NWSA 3TSSA 1EY6A 1ENCA 1I4PA 3PZ7A 4YWGG 3HRDD 4B08A 3BYTB 1RWSA 5JXVA 1LTBD 3PUVA 3GTMB 3CIRB 3RD4A 4AS1A 1CJEA 1LACA 3VYSA 2A6ED 2B2VA 1QKZA 3D4WA 3TP5A 4KHZA 4MT5A 1OFFA 5CMDA 5J39A 4TQUS 5G5GA 3GD7A 2RQXA 1U4MA 2VZKB 2OEOA 3SVMA 1HQRD 1A6XA 3NQTA 3PO0A 4KI0A 2DWQA 4J6HA 3T4AC 5EE3A 2Y5PA 3J7YW 3IXSA 3I4LA 2IX3A 4KKSA 2KUMA 2RA4A 3FPUB 5EQ0A 3D4DA 1SEBD 4NZLB 3KBXA 2SOBA 1I6VC 3IT6B 1MI2A 3AE6B 3DMUA 1ONLA 2PNRC 1QILA 3DEPA 2A68D 1MHHE 1JWSD 1IKLA 2L32A 3ONAB 1ET6A 1HHVA 1RTOA 4C80A 4HEDA 1TQOA 3E5SA 1Z7TA 2SEBD 1F2RC 4K5XA 5D14A 1DM0B 3OIPA 1SSOA 4P6VF 1EY4A 4H7BA 1D5MC 3H3VC 1SYEA 5EPLA 3Q8EA 1IKMA 1GUNA 2RSNA 1I7HA 3CU7A 2L11A 2IX1A 1F2RI 2D5DA 1QOAA 1EIGA 3BVMA 4ME5A 1YNND 4MIUA 3VYTA 4KJNA 2RDGA 3NTHA 3P4PB 5C44B 1SNOA 5CBAE 2WXRA 2QIEB 2D62A 5ELBA 3HRZC 4ID6A 5CV4A 4ZRZA 5KIXA 4FYDA 1RYJA 1IL8A 3B2FA 3DEOA 1LV9A 3L4PA 4H44C 1YNJD 3NTIA 5FR3A 1LTTD 2JXMB 1N5XA 1WTVA 2WXFA 4PNYA 2F0FA 3CWIA 1STEA 3CHBD 1U4PA 4OIJA 5BYSA 2KOLA 2MJ8A 4OIKA 4OO1H 3ITPA 4Q0FA 1NYRA 1UGJA 4IFDG 4WAFA 4C3IG 2ZXPA 3HOWB 1FFUA 3VR3A 4KX6B 1BCPB 1FRRA 4LLGM 3MHBA 1XCTL 4KTAA 4G7HC 2FUG1 1SDFA 1PGBA 4BA2I 4UDUC 1PGXA 1HRJA 4JPSA 1QT9A 4OGQC 2A6HC 3HVZA 3M7NA 1ROEA 4V190 2IGHA 1CTMA 3TUOA 4K2KA 2F0OA 1F9RA 1EY9A 4AYBB 2WKDA 3KLRA 4WWMA 5C4HA 2JYTA 5BMGA 4HR7B 3GV6A 2D2CC 1B9MA 1RDPD 5FO8B 2E76C 4RF1A 1FNUA 5AUIA 3TBIB 2TMPA 1QOBA 1L4DB 4FXKC 1G91A 1FCCC 4MHEA 5G3LF 5NUCA 4A6QA 2B8FA 2RDFA 4PMWA 5I9OA 3Q24A 4A3GB 3LWEA 1PFDA 1WD0A 1B4OA 2W55A 4OL7A 5FO7B 3SK6A 2F0JA 4K5VA 3ZJUA 3R8BA 5T1IA 2R92B 4C7ZA 1FNWA 1WTOA 1SAPA 1S5CD 1H9RA 2H89B 4C3IB 2NB0A 2WIIB 4WH4A 2IX0A 4HCSA 1LT3D 2PLPA 3HOZB 1Z6HA 1I6HB 4G7ZC 5JOBA 3MZ5A 1C8CA 2PMZB 4C1NK 1NUCA 2G9HD 1F2LA 4TKOB 2CQAA 3E9SA 2FJ2A 2J53A 4KKIA 1EQVA 4XXEA 4LTUA 4EQNA 5EKIA 1S4ZA 4R8IA 2L12A 1EY5A 2MP1A 4LJZC 2DYOA 2C5CA 3KUPA 5BN5A 4NJCA 1UEAB 3KWLA 3RUZA 1E2ZA 1FYCA 3LB8C 3Q69A 4I7ZC 4JBWA 4IURA 4WORA 1EY8A 4ITKA 5IGDA 2R93B 4JE3B 2VNUD 2E2DC 1SYCA 3MXNA 5T1GA 2F0VA 5C4ZA 4B9WA 3S2HB 1IBXB 1F2YA 4CKCA 5T8IA 3HZXA 5KEEA 4DN4M 3V96A 5F2DA 2JXTA 1L6UA 1ML0D 3Q8FA 3N6RA 3HP3A 1A70A 2JQRB 1VDZA 2KEEA 2F0NA 3S1NB 1FXIA 4IKGA 3Q8CA 4M0WA 1EFID 3J7AV 2W3SA 1F9SA 1SJED 5IOCA 5CR3A 1FEHA 1S5BD 2CJNA 5ELCA 3VRAB 1GUTA 1O7ZA 1YNNC 4IN3A 3NVZA 3SDZA 4C2MB 2BOSA 1N61A 1R9TB 2BDNA 1ZYRC 5E6JA 3P75A 4OZCA 5IT9L 3GTLB 3ND9A 2ICEC 3AE5B 4GDKB 3RPFC 1CZWA 4HEA1 1XEEA 4TQ0A 2G9DA 3ERQA 1C4QA 3MXGA 3P1HA 1J7BA 4XWTA 3C3LA 2J4XA 1EWHA 4KN4C 2K28A 3AM9A 1RCVD 3Q6SA 5C3XA 3F2UA 2WU5B 1YN3A 4J1MA 3U4EG 1H9MA 3IFTA 2XIWA 1KABA 1ILPA 3GTQB 1JWUD 2N7JA 2F0IA 5ELEA 2MUYA 5EE0A 2LUMA 3HEJA 1PRTB 2PVGC 1SIJA 1MBYA 1KF6B 4MACA 1FCLA 5EBCA 2EDGA 3VR6A 1TJEA 4ABNA 4HTHA 3U52E 1F9QA 3IAS1 2X6LA 5IT9E 2F0SA 4NP5A 4RCOA 5EPKA 5KNDA 2DLBA 4CGYB 3HOXB 1T6BX 1S5FD 3V05A 4A8XC 2CVRA 1SE3A 3QWNA 1Q90A 2I38A 1T5EA 1JC7A 2EJMA 4REZA 5GXGB 1RD9D 3RLFA 3TP8A 3AEBB 1DOYA 1C78A 1HPCA 1JR0D 1GOZA 4CJ1B 2YEPF 4ZYSA 1JORA 1C4CA 1V43A 1EWYC 3AE8B 1J9OA 1WCMB 2VZKD 2FE8A 3JAML 2Y5CA 4PV1C 1U4RA 3AEAB 1PFMA 2YYZA 3LXFA 5H92C 3CRLC 5DM63 1HTLD 3BVZA 1YJJA 4IALA 1TWCB 1Y8OB 2PW5A 5K36G 1VLBA 2H88B 1DOMA 1FFVA 4MM3B 1LTRD 2LJIA 5CBEE 4CHTB 5FKAC 2Z4IA 3AEEB 3AECB 1QOHA 4NDXA 3N52A 2WKCA 3P7JA 5A35A 1AYFA 1G8ZD 4TRDA 2KN4A 2LMCB 5C2TB 1F9PA 2K32A 5AUKA 4XT3B 4EE2A 1EIHA 4ZLTF 1IYVA 2AWOA 1EZ8A 1UAPA 4MN3A 1G2TA 2ICIA 4YIJA 1FM0D 1LTAD 2L0CA 1OXVA 3OIQA 5KYIA 4F88A 1MSGA 3C1FA 3NPPA 4K8IA 4RGMA 5IGBA 2J52A 1VF5C 2RVLA 1HA6A 1QLBB 2BT6A 2B2YC 1SXTA 3HUIA 2JA6B 4F8MA 4DAYA 2F0KA 4H0LC 1NSNS 4C1NI 1BMLC 1N62A 3MP9A 1GB4A 3PIP3 1PTOB 2EJGC 4QMGA 5EPJA 5K5PA 3DWGC 4A9AA 4YTPB 2PW7A 3NZ3A 3VA7A 4X3UA 1ZYRD 4KN7C 5BN3A 3J81E 2K22A 1EU4A 3VR8B 2W82A 2HQEA 3M85A 1E9MA 4RKBA 1JRPA 3D4RA 1JW9D 2NYZD 3DHQA 1E6EB 3I8ZA 4NW2A 2JA7B 4HMIA 1E7PB 1STNA 2NN6H 1F0ZA 1SNMA 3EJIA 1HUMA 2MGSA 1GUGA 1L4ZB 3EVQA 4HMJA 1S5DD 3W2DA 3LWUA 2PYKA 2MJ3A 4D2KA 2VB3X 2INNE 3MFYA 2XRSD 3SFEB 2F0PA 3FMCA 1B53A 4DK0A 1CI3M 2IJ0A 1EL0A 3GO5A 3I3CA 4ARIA 1GUOA 3NVVA 2AQ1B 1D1IA 3BDCA 4KKTA 3DXJC 3BYYB 2EYOA 2WXOA 5C3JB 4A3IB 4BA1I 5D7GA 2KWDA 1TY0A 2XVSA 1E10A 4ILWA 1RKNA 5M9OA 4RHSA 2RDHA 1DD2A 4N58A 2VUMB 1TKEA 4FVMA 3ND8A 1LT5D 1EY0A 1JWMD 4R3DA 4C3JG 1JROA 4G7OC 3OWEB 1HZ6A 5KNCA 3C46A 5M5YB 3ZQ4A 2K5DA 2ZW1A 3AE3B 2LS01 5LHY1 3S16B 1PRTC 4I65A 1EQTA 3FC4A 3AMZA 4Q2JA 2EY5A 2X38A 1D1KA 3D31A 1ZUD2 2HCCA 5J1ZA 1L5PA 2BDOA 4XYQA 1HQMC 4K8JA 1L6VA 1PXUA 2K0PA 5C0XG 4KGSA 3SR1A 2HTME 1WVLA 1MGSA 4XTCS 1PZKD 3AB5A 4IFDI 2WXIA 1H9SB 4L63B 4P2CB 2JYOA 2R6GA 2ONQA 3H6MA 2V3PA 3B2GA 5C5LA 3QOJA 1QOGA 2WLBA 1HA5A 5C4JB 2QKIC 1Y1VB 1RF2D 2K5WA 4KJOA 5CV9A 2PW9A 2K33A 1PDXA 2JSVX 1FO4A 1ACCA 1XLQA 3LYYA 2RBMA 3L9AX 1HCZA 4FNFA 3L3OC 2KQ4X 1K8MA 2A69D 2V4DA 3AE9B 4N59A 1Y69U 1VZ6A 3LNNA 2ZT9C 5CV6A 2WU2B 2ZW0A 2NVQB 1A3UA 2SNSA 3H94A 5I6WA 4J8QA 3J9CA 2B2YA 2A74C 2XSCA 1U9RA 1DYQA 3H8HA 2A5HA 3C2PA 2E74C 4O1NA 2B76B 4HROA 1TIID 3VYUA 1F2MA 2SNMA 3J7AF 1AZPA 3RMHA 3FEWX 4YT0B 1D6EC 4DQOC 3L7ZC 4XT1B 3NQIA 1XYIA 1ICWA 4KK7A 2K1BA 5TSSA 4QUFA 2JSOA 3A7AB 1O7YA 4ODGA 1O78A 5IGCA 1XLOA 1VDVA 1HXYD 1JQ4A 1BCPC 1SNDA 2EOTA 5CV5A 3I4MB 1WYGA 4A90A 1OQQA 4HKZE 3VYRA 4DA2A 4DU9A 4IUTA 3WOFA 3X3NA 4UAIA 3AB9A 3E0JA 1ESRA 2XNAC 3KLSX 1SMYD 1C4PA 1BUVT 3OSOA 2INPE 4LAAA 2WXMA 1D5XC 1WTXA 1D2BA 4RGOS 3S1RB 3P4SB 2K05A 1EYCA 3P1MA 3K7AB 4BBRB 3Q23A 2K7VA 1BNZA 2WB1B 4DGZA 3BZDB 1CHPD 2WXLA 3TP7A 1TS5A 2GB1A 4FF1A 4F7XA 3W9CB 4CQNA 2IWHA 4XDCA 1FGBD 1LT4D 4BY1B 3ZGZA 1SNCA 3TN2A 1SYDA 3NBIA 3RFZB 2KA7A 1JOKA 3OWFA 1WTQA 2I46A 3W5UB 2EZVA 3SK4A 1O80A 2OF1A 2PIAA 3QG1A 3A8JE 1B50A 1SE2A 2WDRB 1STHA 4HRSA 2IDYA 4CKEA 5CV8A 1TKGA 2O2LD 1DJRD 2DNCA 3BK2A 4IQZA 1ZDVA 4FF4A 3KLSA 1DGJA 1OQRA 1WXQA 2Z8LA 3EGRA 3KBGA 1KRHA 3AE7B 1QF6A 1OXUA 3FILA 1IBXA 2I2YA 4L6TB 1UUPA 1TKWB 4H2AA 4HAEA 1OXTA 5C0XJ 3M4YA 1I3QB 1KDBA 2ID0A 1SBBB 1TU2B 1PGAA 2JEAI 3N9YC 3S9WA 1IUEA 1NVID 1E2WA 2DNEA 3KWVA 5JEAG 2ACZB 3NUHB 2JYEA 1DOXA 1J8IA 1NCVA 4G57A 5EGTA 5IGFA 1KNEA 3FILB 3BWUD 4IUQA 3J81L 3MWYW 3VA5A 2O5IC 4KHVA 2CHBD 2ON8A 3AEFB 3RZOB 5E3FA 3T13A 2LMCA 3UI3A 1FR3A 2EYHA 2L52A 2WQYB 5BMHA 4N9TA 4KD3A 3D6CA 1PFBA 2WXKA 2V0GA 1ZXIA 2LHDA 3KK7A 4A93B 1QJOA 2J7ZA 4WJWA 2DYMA 3A7LA 4XDXA 3C8YA 1I4QA 1V97A 5C5MA 4QF4A 2DY7A 1BO0A 2EYFA 4B0EA 3E6ZX 5FO9B 5DNFA 5FOBB 4CKBA 3AN1A 5C0XI 3M7GA 1GUWA 2Z1CA 5IGGA 4QIWB 2LFIA 4FXCA 2NMQA 2BW2A 2NVYB 1ZE3D 2F0QA 1TWFB 1I4GA 1QQRA 3ETRA 3NUCA 3BS1A 5AFWA 3I9V1 1BDOA 1JQYD 1TZOA 1A2UA 1I4HA 1C76A 2EELA 2IL8A 1CA5A 3DWAA 3Q8BA 3MEHA 1DZ1A 3U2SC 2Q8RE 1HUNA 3V3XA 1QE6A 4U673 3VQIA 1ENAA 1EYAA 2QCPX 1PRTF 1TWHB 5KYLA 3GP7A 2F0TA 2WINB 3SEBA 1QWYA 2HCIA 2B63B 2NTTA 3D6WA 2M56B 5IIFA 1Q1BA 3LX0A 1Q10A 1CZGA 1GJXA 1L0YB 5A2QE 4F87A 3M3YB 2JZPA 1C48A 1SE4A 5D3DA 1F2ZA 4ZK9B 1SYBA 2B8GA 2F0HA 2PZUA 2PKOA 4RF0A 3G7LA 3BK1A 2HDEA 3H09A 4O42A 2OXPA 2E2JB 4M8AA 4ZRPA 2C9OA 2BE5C 1EZ6A 3BDLA 4K2LA 1LTID 3T51B 1ZEQX 5E4WC 3X3MA 1H9KA 4LMQD 5ELFA 4A3MB 4TMAB 4S3SA 1AZQA 2E2HB 1VRAB 2FMMA 1PZJD 1EY7A 2QEJC 1AFPA 2LHEA 4XYOA 4CJ0B 4YXDB 3PIO3 2E75C 4CBVA 1U4LA 1A15A 1BCPF 1CQFA 3DWMA 2M0AA 1T3QA 1ZDXA 4XQJA 2B2TA 5D3IB 1G6ZA 5IGEA 2B2WC 2EKIA 3A55A 2WS3B 1QCBD 3NP8A 1IHZA 4PMCA 3GTKB 4GZYC 3FKIB 4PQXA 2WDVB 2A68C 2FBWB 4YTMB 4KMUC 1GPXA 4DF7A 1UWXA 3IFDA 1FMAD 4QB4A 4RNAA 1ZKOA 2HUGA 3P4QB 1PTOH 3OPOA 5JPMC 2RMMA 1XLPA 1W6JA 1RJTA 2Y0SB 3NBHA 1WRIA 1B9NA 2KCNA 1VZ7A 3K59A 3NHHA 1OO9B 1SJHD 1WSPA 1Y1WB 5C3EB 1NEKB 2R61A 2A6HD 1PLFA 3Q0AA 3PUYA 1SNQA 1EEID 5ELDA 1CA6A 1PMRA 3NSWA 2WXNA 4ZOHC 3CQZB 1JWBD 4IDIA 2JP1A 2B2UC 2Q5WD 2EPBA 3AE2B 2R3ZA 2LKVA 1R4QB 1QNKA 2BS3B 2D5GA 1YMHE 3U9OA 1PUTA 1STYA 3WDNA 1ENFA 1Q8IA 2EXZA 1SFOB 4NMZA 3K5LA 1IGDA 5CYUA 3URYA 2BS4B 2RPVA 3HOUB 5DM73 3GTGB 2EY1A 5JEAJ 4C3JB 1TVXA 4KY5A 5EBDA 5M3MB 1CHQD 3MXPA 5JVH3 4A55A 2EE1A 3U9SA 2WDQB 1FD6A 3W3AA 4K5WA 1MVKA 5KNBA 1DXMA 5M5XB 2E3TA 3A8KE 2K5PA 1SYFA 4DAVA 2IGGA 2XWBB 3TP6A 3FPPA 4IOIE 2K3UA 1NR4A 4HJGE 5BYRA 1JE4A 4IUUA 3AEDB 2MH7A 4XDDA 3PO3B 1X32A 5H8YE 4OVZA 4OHJA 2SAKA 3D3RA 1VMPA 3R93A 3I70A 4B0MA 4A3EB 3IAYA 1B1ZA 1CQVA 2AX5A 3GV3A 1LT6D 4OO1G 1X3QA 4HSPA 3GQBA 4WQMA 2F3WA 5G3LD 1QOFA