1T5XD

Hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
230
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A Polymorphic Pocket at the P10 Position Contributes to Peptide Binding Specificity in Class II MHC Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 69
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1t5xD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1t5xD02
1D5MC 1BCPF 1T5XD 3BVGA 4L6TB 1TS4A 5FK9C 1I4HA 4ZYSA 4NZLB 1KLUD 1SJED 4RGNA 1KLGD 1YN3A 1B44D 1JCKB 1EEID 1FNUA 2XN9C 1HXYD 1XTCD 1S5FD 3SEBA 4RCOA 1LT4D 1HQRD 1FNWA 4RH6A 1S5ED 1JWUD 2RDGA 2SEBD 4O1NA 5ELDA 3TSSA 1L0XB 2J4XA 1STEA 3BVMA 3DWQA 1FNVA 2XNAC 1TS5A 1S5BD 1D5ZC 2R61A 2XRSD 1SE3A 1DJRD 5D3IB 1RF2D 1SEBD 1KTKA 3DWAA 1D6EC 1I4RA 4RGTA 1PTOB 1I4QA 4BWGB 1DYQA 1CT1D 1TS2A 2RDHA 2NTTA 3W2DA 1YN5A 4K6LA 3KLSX 1LTRD 3R8BA 1CHQD 1RD9D 4C56C 4Z9CB 1FGBD 5I4DA 1RCVD 2Z8LA 4DXGA 1EWCA 3BYTB 1PZJD 1G8ZD 1LO5D 1PTOC 1PRTB 1GOZA 4RHRA 1PTOH 1JQYD 3V05A 1SJHD 4RGOS 1SE4A 1V1PA 1LLRD 2G9HD 1CHPD 1LT5D 1ESFA 1BCPB 1PRTC 1PTOD 2TSSA 3EA6A 1EU4A 1UUPA 1EFID 2AQ3B 1HTLD 3MC0B 1YN4A 1ENFA 1LTBD 2QILA 5ELBA 1LTSD 1V1PB 1AW7A 3EFXD 4RFBA 1LT6D 1BCPC 1PYWD 5ELCA 1FD7D 1SXTA 1EU3A 1I4PA 2IJ0A 5TSSA 1PRTD 3R2TA 1HA5A 1LTGD 1RDPD 1UNSA 1PZKD 1F77A 1TS3A 1I4XA 4OHJA 2ICIA 1EEFD 1LTTD 4RHSA 1BCPD 5ELEA 1I4GA 4DXFA 1V1OA 1CK1A 1ET6A 1S5DD 3CHBD 1S5CD 3BVZA 5ELFA 1ET9A 1CQVA 3GP7A 1XXGA 2QEJC 1AN8A 3O13A 2CHBD 1PTOF 1TY0A 3MFGA 2NTSA 2AQ2B 1M4VA 1LTID 1JWMD 3BYYB 1LT3D 1LTAD 4RGMA 4TSSA 2IPKD 3URYA 2AQ1B 1B1ZA 1JWSD 4UDUC 5D3DA 1JR0D 2WV6D 1PRTF 4L63B 5FKAC 1TY2A 3R2IA 1D5XC 2XRQD 1PZID 1SE2A 3OWEB 2O2LD 1L0YB 1SBBB 1QILA 3BZDB 1MD2D 1BXTA 3DWPA
chains in the Genus database with same CATH superfamily
2ATWA 4L6TB 3R7RA 4KKUA 1J6QA 1NMGA 4DAVA 4BBSG 3RULA 4N9TA 5IP9G 1JCKB 2DZMA 3ZUNA 1HXYD 5JJZA 2QJLA 3DXJC 1GM5A 5CMDA 1HTOA 4LW1A 1ILPA 2M2LA 5GROA 4G0NB 3KLRA 3IVFA 4XDCA 2FUG1 1HZ6A 4A3CG 2KC1A 2RDGA 5H92C 2LI5A 5HY6A 5C4XH 1JICA 1H9KA 1SFOH 4XDDA 4L5RC 4EZLA 2N8NA 3ZXRA 2WXHA 2JRIB 1HTPA 3MC9A 1TS5A 3PRPB 1WJ6A 2WINB 3PSIA 4C3JG 3H0GH 3IFWB 1SE3A 1VRAB 4YSXB 1ICFB 2BE5D 3PGEA 1XQQA 2DNEA 1CJEA 3V3XA 2BS3B 4O42A 2W82A 1A63A 1D6EC 1JROA 3AE8B 1NR4A 1SNPA 5KHQA 1PA6A 4LF9Q 3P1MA 5AZFA 4P72A 4F1SA 4C1NI 2OEDA 1I50B 3QR8A 1FRRA 3VUYA 3OYYA 4IFDJ 3RD2A 3AM9A 1R9TB 3Q8DA 1UZXB 2ZZPB 5M5YH 4OWXB 1TWFH 2KKCA 2A73B 2KWDA 1I6VC 3ULLA 1XLQA 2ES2A 1RYJA 4B9XA 2NN6H 2WKCA 2HJ1A 3AEFB 3WDNA 1T0SC 2K33A 4QUCA 4C7ZA 2DLBA 2K04A 4DDGD 3KK7A 2UUCQ 4W9KA 3AQQA 2XK5A 4P71A 3DCGA 3N30A 1B70B 2NYZD 2K5QA 1Z6HA 2DJGC 1XMQQ 3ERQA 2TSSA 3NTIA 4G3XB 2NVUI 5G5GA 2CQAA 3D8GA 2BW2A 4ANWA 2LD9A 1EUJA 2DWQA 2RQXA 1UEAB 4V0BA 3MA2B 1WXQA 1JJGA 2I38A 4BBSH 4QY7A 1E2WA 4DK6C 2BB5A 5EDSA 1LGRA 2K8BA 4WJPA 5IGFA 5IP9H 2RR9A 1ZYRC 3QARA 3A9KA 3ZRFA 4A20A 4FA6A 4ABNA 1O7YA 1TT2A 1TWHH 3I3CA 2C60A 4DQOC 3IBEA 2WXMA 4IZ8A 1E5WA 2V3NA 2V4LA 1HZCA 1D1KA 2ICIA 1FM0D 4A3CH 3FRPB 1VJKA 5LMNL 5ELEA 1V2YA 4JWSC 4LNKA 4WWMA 1FR3A 4C80A 2K39A 2UXDQ 4KJNA 2IO0B 2NMQA 3G71A 1TKWB 3AU7A 1HFGA 2VQEQ 1ACCA 2N1VA 1D4BA 4AQYL 2R93G 1PHJA 2AQ2B 3JSVB 4PYZA 4C3JH 4B3RL 3HRZC 1XF5L 1E24A 1JWMD 3N6RA 4LFBQ 2C9WB 3VTUA 2E74C 3JW0X 3LJ3A 1NY4A 3L7ZC 1WZ3A 3CWIA 1JWSD 4UDUC 3E56A 4QAYA 4LFAL 1SYBA 2LEKA 4WH4A 1TY2A 2SNMA 1S72A 2PVOD 2YLMA 3VTVA 4IOIE 5JPMC 3I4NB 5IN7A 2ZW1A 4OO1H 1T3QA 4MDKE 3HOXG 1BMLC 3UF8A 2ONQA 2OQKA 1QOGA 3PT2B 2A74C 3BVGA 1R7SA 1WFQA 3S2HB 4CGYB 5ELNA 4KN4C 3MFYA 2HIXA 2Y0SB 3KOJA 2ZPYA 4HK2A 5AZHA 1XTCD 4ME5A 1TYGB 1R4NI 1L6VA 2N9KA 4OONA 2J42A 3AE2B 1OO9B 1TQOA 2RGFA 4WJ4A 4FJZA 2VY3A 5ELDA 4DNTB 1C1YB 1ZXHA 2GVBA 2WB1G 4XIGS 4FF3A 1BNZA 5M5XB 4DGZA 5HGTA 1IBKL 1FPYA 1V9JA 4HRSA 1SRUA 3QCAA 4AWJA 2R3ZA 2XNAC 3NBHB 3PMFA 2F3WA 2EELA 3H91A 1HNWL 2KYWA 3P63A 3NZUA 1X3GA 3PRMB 1MIUA 2SOBA 4FF2A 3GTLB 3GZNB 2PIAA 3P2BA 3AN1A 1K8GA 2UUBQ 1B9RA 4OIKA 1GHKA 4YSZB 1A8VA 1NI3A 2CKHB 3CCRA 5BR8L 1XPOA 1EY9A 3BK1A 3Q14C 2OEOA 2HIVA 2E2JB 2INNE 2MP1A 2BH8A 2F3VA 3DMUA 3OW7A 3R93A 2D07B 2GBRA 2KQ4X 2G9DA 3GTGH 2MBEA 1J7BA 4FXKC 3PIPA 1C4AA 5M3FG 1EYAA 3L17A 5C0XI 3RN5A 3ZW3A 3M4OB 3J81c 1E9MA 2Q5WD 1KDAA 2MQHA 1E7PB 2FXQA 4R4CA 2B8FA 1A5RA 3A9JA 5LXIB 1ENCA 1V1PA 1VMCA 3M4PA 5LLIA 1OXSC 3KUZA 4OO1I 1TZOA 2E5LQ 4REZA 4GNXC 2BKRB 2F0NA 4YL8A 2N7DA 1XNQL 2JYEA 1JALA 2KLGA 3P75A 1H9SB 2N1WA 3HOXH 1V8CA 1ENFA 1TJEA 2E6XA 3K9PB 1ZKHA 3ZLZA 2OTJA 2M0AA 1PYWD 3GV3A 1PH2A 4YWMA 5T1IA 1AH9A 2LGYA 5CHFA 3BY4B 4F7ZA 4KMUC 4OHJA 3T4AC 2MJ3A 2LJ5A 1UGJA 4LCDE 5AUKA 1ZDVA 2M56B 2FBWB 1DOKA 4YWGG 2MW5A 1M94A 4V190 2LMCA 4AJWA 2A6HD 1BUVT 1XXGA 3KLWA 4EVOA 5C0XJ 1K53A 1N5WA 1N61A 2CHBD 4HMIA 3E0JA 3QQ8B 4EX5A 2K1BA 2LZ6A 2N9PC 3RYTA 4EQ5A 1WTQA 2ZCCA 4IKGA 1Q90A 3VR4A 3X23A 3D6WA 2UUCL 2RSUA 5HI1A 1SNCA 3X3MA 4MSQB 3WWVA 1Q1BA 1I35A 3NJTA 4DR1L 4R3DA 1MSHA 1XMQL 4F8MA 3DLLA 3A5ZB 4GDLB 1L1OA 3K57A 1Q82C 4BBRG 4BY7B 1TWAB 4P1CC 5JZEB 1PZID 4YSYB 4HCSA 2Q2HA 3CPWA 4CHTB 3L2PA 2L15A 3ETRA 1GAQB 5LHY1 1IL8A 4W9JA 4K5WA 5IP4D 1Q46A 4G50A 1B44D 2EIFA 3F2UA 4A3FG 1NBFC 4HWIB 4QF4A 3SEBA 2QDFA 2BA1A 1RKNA 1EYGA 4A3LG 3S17B 4ZLTF 3GB1A 3HRDD 4WJQA 3S1QB 1KRHA 2NZOA 2PLPA 3NG0A 3RLNA 4US9A 5CHVC 4A3OA 2UXDL 4O1NA 1V5TA 4GN1A 1Z5SB 2KOLA 2UU7A 5FLXL 1XT9B 1GUTA 3ZDMC 3LNNA 1HUMA 1KABA 3ZGZA 2PNHA 2L9HA 3A1QB 2Z6KC 4HIDA 3UI2A 2V4IB 4A55A 2DJFC 5EKKA 3Q0AA 3GTPH 4LFBL 4LNFA 3HKZG 3ZO5B 4ZCKA 1F2MA 3ML9A 1MPEA 3PPAA 5E4XA 2O6VD 2EZVA 4PZ6A 1J19A 1TS2A 2IW3A 2RDHA 4YIJA 1V80A 3PZDA 2EY5A 2CWPA 4WJNA 1Q81C 1FD6A 1Y1VH 2ZXRA 4TKOB 1TGZB 1H9RA 2WP9B 4LK0M 3VVWB 2DHZA 2ZW0A 1IBLL 3RLFA 4U673 3AE3B 2FFKB 3IRBA 3OW2A 3PZ8A 1GUOA 2J0KA 4RGOS 3C3LA 5BYSA 4IUQA 1X1MA 3HP3A 1CHPD 2R92G 1ESFA 2EJFC 1TIFA 3OG5A 3QK0A 3SK5A 4DK0A 4BBRH 1GJXA 1S3SG 4WWNA 3B2FA 2KVRA 3KUCB 2MLBA 2WP8J 2I1JA 2RF4A 2CKZB 1JJCB 2EYJA 4X6AH 2AMCB 4C2MB 4FYDA 1YNTE 1FD7D 4PK1A 3W1SA 1NE3A 1EF5A 2WXPA 4TRDA 3GV6A 1LTGD 1K52A 4IUPA 3H7SA 1Q8IA 2K32A 4A3FH 1GUGA 1NSNS 4BVUC 4YCWA 5LMUQ 2H88B 1K8OA 3Q8BA 5FLXE 2UUBL 4A3LH 2L4NA 2ICEC 1PH3A 2D5GA 2E75C 2M9VA 1FMAD 5AFWA 5CGKA 2F52A 2C5CA 1CK1A 1ET6A 2WXGA 4JPSA 1KL9A 3TBIB 2MRPA 2PE6B 2JYOA 1OQQA 4LF5Q 5ELOA 1ZDXA 2L00B 2F0OA 5IP7G 1K0SA 1QT9A 5JJIA 2NTSA 2JWZA 2O6VB 3CSFA 2JX5A 2ZT9C 3RR5A 1LM0A 2N55A 3I91A 3PUWA 4MZ9A 5H8YE 1Q86C 4JI4Q 4LF7Q 2B63G 3G7LA 2BKFA 3OJ4B 3BG3A 5FR3A 2OF1A 3SK4A 4MGKE 4NQLB 3M4QA 3QWNA 4HSPA 4A3JB 3D3RA 2K3UA 4Y7NB 2E5LL 4KD4A 3TN2A 5A35A 1XYIA 2PI2E 2WS3B 4P1BC 2KECA 4DWFA 2XRQD 1UBQA 4B6WA 4HDQA 1YJ1A 5IGDA 2K9XA 5JVG3 4X64L 4GSWA 3HOZG 1BXTA 3GQBA 2EKEC 1EY4A 1U4AA 2WXJA 1X3QA 3AE6B 1F2RC 4KDIC 3UDXA 4WFN3 1N63A 5AZGA 4S3SA 1C9OA 3A9KB 4NW2A 2EXDA 3X0WA 3WA0A 3UQBA 5EQ0A 1RODA 1MJCA 2R92H 5IE8A 2AKWB 1GJZA 4BA1I 4C3HH 4IO9A 3U9SA 1AYFA 3W1SC 5I9PA 5JEAJ 1WVLA 4DBGA 1XLNA 3Q24A 2WNMA 4FP5D 5C3EG 3CF6E 5E6OA 2J4XA 5KNCA 2F0MA 4G7OC 3I2ZA 1STEA 1RJTA 1EY6A 3DBLI 1WM2A 2KJRA 4R4QA 5CHWA 2JRHA 1LTLA 4KTAA 1EY7A 4ZRIA 1SEBD 1X54A 3OLMD 4KX6B 3T1HQ 4APVA 1XPRA 2L0FA 3NEMA 2NCNA 5AUIA 1IKMA 1P7FA 1C76A 3PO0A 1DYQA 2J53A 1VF5C 3UI3A 1WFYA 2BH2A 2A69C 2JU6X 1B50A 4HPMB 4POGA 2GBNA 2WX0A 3ZNZB 1E8ZA 1HFNA 4B95A 1HNZQ 5IP7H 4LDTD 1ML0D 3OMGA 3BYTB 3U4VA 1P1AA 4GNXB 2KOXA 3AE7B 5IGCA 2B63H 1ONLA 2WXFA 5M3MG 4UP9A 1VQ4A 1WXSA 2G9HD 4MNOA 1SGHA 2GMIC 4HJ7A 2WXNA 1R9TH 1SB3C 1SNOA 1YNJD 1FCCC 1EYCA 4R9WA 2JVCA 3M3JA 5KRUA 2GB1A 4GGQA 2MJEA 1PYBA 5E7NA 1EU4A 1U9RA 3AFQA 4DAPA 2MFIA 3Q8CA 3UINB 3QO2A 2JY6A 1L6UA 3A74A 4NJ6A 3TEZA 3HOZH 1C4PA 1LTSD 2K5VA 1IXRA 4RFBA 3I9V1 5BYRA 2Y0SG 1BCPC 3VYUA 1FGUA 4ANUA 1SXTA 2DZIA 4QMGA 3NENA 4WORA 1Q1OA 2RMMA 1GUAB 3FAHA 5JXVA 4A3KB 3ECIA 4F88A 1DOMA 4W9FA 3M4YA 3PUZA 2B2VA 5FR6A 3TZDA 3JSVA 3DWGC 4HIOA 1NI2A 5C2TB 1WGYA 4FBJB 4I65A 1VQPA 3DWMA 5C3EH 4C3IG 3I4MB 5EBDA 1WXAA 1ET9A 2R7FA 2Q2UA 2E76C 4DR6Q 2FCSA 2WACA 1K28A 3JYUA 1Y1WB 1LTID 4HEDA 1FXIA 4QGUA 4LFCQ 2QGQA 4FULA 3T8MA 3WCQA 1HRJA 3ZJTA 3OMCA 1YJ9A 5J39A 4B3SL 3Q3OC 4EQNA 5DCNA 4CJ0B 2NVQB 2IX1A 2WHIA 4OZBA 5FKAC 1QB5D 2SDFA 1E22A 1FXTB 4RAUC 2L32A 1SE2A 4OL7A 4ZKBB 5M9OA 3CMAA 1AZQA 3RT3B 5K36G 4BKSD 3RUZA 1I7HA 2L3ZA 3DWPA 1BCPF 3MHSD 4OXPA 4OWWB 2JT4B 2ZTEA 4N8X1 3TZUA 5M3MH 2MCNB 1CZGA 1V97A 1KIXA 2NZ1D 4IM3A 1W2BA 3NBHA 2VQFQ 3K7AB 3HEJA 1HR0Q 2WXIA 3HZXA 3RNGC 3H6MA 3Q2AC 2WFWA 3VDZA 2QDBA 4PS3A 4YTPB 2D10A 1VQ5A 1VMPA 4DDID 4IFDG 1JWUD 4XT1B 4G57A 3RFZB 2BE5C 4MIUA 2VRRB 1X9NA 2LMCB 2EYMA 2OHFA 3M3YB 4OZAA 2QCZA 4A3IG 3K8AA 4LF5L 1MFWA 4FLHA 3G4SA 4DR4L 2WAQE 3I3TB 2HCIA 1MHWC 1BT0A 1SSNA 1U4RA 1L5PA 3PREA 5HKHA 3NVYA 3CP0A 3DHHC 4LF7L 3DPDA 1D5ZC 5JHBA 2E2HH 4OW0A 3S24A 1DZ1A 4RNAA 1QZGA 1RF2D 2HDEA 4B3MQ 3CAMA 4IQZA 2LGXA 4KZCA 1I4QA 3FPUB 4DU9A 1VCBA 4BAXA 4ICVA 2M0XA 3CC7A 2NVXB 1AEXA 4K6LA 3U4ZA 3T13A 3KJPA 3A8JE 2CJNA 4QQBX 5LL6X 4IC7B 3AE5B 1IBML 2YU9B 4ZDVA 2IGDA 3TQYA 2M8SA 5AJ3Q 2HCCA 4FF4A 1H9SA 2GBKA 2R2OA 4OVUA 3GTQH 4WURA 2IWHA 2L8JA 1ZE3D 1C4QA 1K8MA 1RTNA 2E2JH 4LF8L 1XNRL 2LASA 1WD0A 1PTOD 4US8A 2WWZA 2MBHA 3C2PA 3FEWX 2MHJA 2PJHA 3ER0A 3MEHA 4ZQ3A 5K36H 1FXAA 2V9HA 3SHLA 3HGBA 2MSED 1YN4A 4K6DA 4KKSA 3BU2A 2F0PA 5LMNQ 2FHTA 1WSPA 4R4TA 1WR1A 4DUYQ 4LLGM 4B08A 3KYHC 3ZJYC 5BMGA 2M1MA 2EMTA 1VQMA 3GTKB 4J6HA 1NNXA 1P16A 4QJFA 3HOUB 2AL3A 5T1GA 5D65A 1F77A 4POFA 2M17A 1CA5A 4W9GA 4WRDA 4HEA1 2MGSA 4ZRKA 5J2RA 2KUMA 2X6GA 1WRIA 1Y69U 2JA5G 4IFDH 1JJ2A 2I1KA 2KMAA 3E3XA 1V1OA 3I7FA 4KKJA 4A3IH 1OXUA 5D14A 1Q0WB 3CRLC 3L10B 1TY0A 1TWGH 5IGEA 1YMHE 3DBLB 1ILQA 3IKJA 4OEMB 1VQEA 1TR5A 3TDQA 3F2CA 4IW0A 2QEXA 1K51A 1WH3A 1LTAD 4ZUJA 5IYBG 4X57B 3GTOH 4DK5A 4KD3A 2Z6BA 4IPHA 4MGYE 2FJ2A 4A3DB 1VQGA 2XVSA 4QL5A 4DPGA 4DHZE 3GTMH 4F7XA 3H0GG 4A3EB 1EWYC 5C3XA 1JB3A 3GZNI 3KLSA 1IUEA 1E2ZA 5EPJA 5JVH3 1MD2D 2N7JA 5EE1A 1P0RA 1PH4A 2JP1A 4FHJA 1A0IA 1UAPA 2VXWA 3I72A 2K6QA 5EE3A 1KLUD 4JG2A 2L0TA 4RF0A 1YN3A 4EQPA 1WOCA 1E7VA 3HOYB 2VNUD 5IODA 1E8YA 1VZ7A 4O2DA 1TWAH 2B3GA 3CCJA 1OGWA 4RCOA 4HJGE 1LT4D 1IGDA 1A3TA 1TT5B 5IA7A 4URKA 3NOBA 1PH8A 2IYDB 4RMAA 3DEOA 4DN4M 3E9SA 1YNND 3H7PA 3D6CA 4DV7L 2ON8A 3MJWA 1T0QC 4DR6L 1C4CA 1S4ZA 2M4NA 3PO2G 5DAUA 4LK1C 4QCLA 1JRPA 5AEKB 4K5VA 1WY8A 1WJUA 1X55A 1EY8A 3H15A 2JZ3B 4LFCL 5FO7B 2LKVA 5DEHA 1SLJA 2QC8A 3S17H 2B2TA 2D3AA 3NK9A 1F2ZA 2KVZA 3GO5A 4IPGA 3NZ3A 1PGAA 1J8CA 4CJ2C 1KDCA 4BWGB 2JA5H 1QCBD 4DV0Q 3W3AA 2OWOA 2QDLA 4A90A 4LJOB 1LTRD 4A8XC 1YHAA 4KV6A 4EQOA 4UPAA 3J80c 2NVTB 2LUMA 3CRKC 1NEKB 1HPCA 4FADA 1GUWA 1UWXA 2PO4A 1XNQQ 4AIMA 3OSOA 1CMXB 1SYDA 4DNIA 4IM0A 3T3OA 3NY5A 2RA4A 5IYBH 1PV4A 1EYDA 2KD0A 3UDIA 1U4LA 3PCOB 3SK8A 3U50C 3E9IA 3SHQA 2VQFL 1HR0L 4AS1A 1KC8C 3UE1A 3SVMA 1BCPB 2INDC 2X38A 2JA7G 2KCNA 3EA6A 4FXCA 1GC6A 1EIGA 5J17A 1RL2A 1V9PA 5KNBA 2KDBA 5C0XG 2RDBC 3N1XC 4LJZC 2CHXA 4BFRA 2IJ0A 1WTXA 5JJKA 3LGJA 4CDFC 3FKIG 4NAMA 4MHEA 4BY1G 4OO1G 4BBNC 4MACA 5GAGC 4C4VA 5BN5A 2ZVNA 4JI7Q 5J1ZA 2XWBB 2O6VA 4B3ML 2WX1A 4WQOB 1U4PA 1QVFA 2OTLA 2WDQB 1A62A 1LTTD 2IX3A 2WAQB 2ZTCA 2K52A 1HTQA 4G7HC 3NUHB 3S1RH 1GNUA 1HR0W 2Z0DB 2B2TC 3MC8A 3MAQA 3BVZA 4DR1Q 1Q10A 4K3CA 3RZWC 4KSKC 2VS1A 4EKUA 5HURA 3BK2A 3RI7C 3TP8A 3MWYW 3PO2H 2PQAB 3RPFC 4HJAA 1L0VB 3AECB 2Z1CA 3K6OA 2KX3A 5AJ3L 1WGDA 2Q2TA 2EOTA 1YNXA 2UWQA 4JI8L 3I4OA 4TSSA 2ASBA 3NHHA 4RWSC 4XTCS 5EKLA 2J0TD 1QOFA 2WXOA 1STGA 3QB3A 3IFTA 4NXMQ 2K22A 3R2IA 4L8JA 2X69A 4O0AA 3D0FA 1EIHA 3NVWA 4K7UA 2WU5B 1HZAA 3GTJB 2O2LD 2Y5BB 1Z2MA 3HM6X 1TWCB 4YY3Q 3P4QB 4M02A 2L76A 3CC2A 4AJYB 4DKAC 1Y8OB 4KI0A 2MNAA 4JI2Q 4LNOA 2DN8A 2R7ZB 4DUYL 2RPQA 3AMZA 4DR5L 2LHEA 2VUMB 4JVZA 3K7UC 1IYFA 2F0TA 3A8KE 4WJWA 4GLSC 4BBNF 5JH5C 1F9RA 4N9F4 2N49A 1SR3A 1XCTL 4HVBA 3UQAA 2MUYA 3IAM1 4GDKA 3HKSA 5EGTA 4A93B 4K81A 3W1YA 2JA7H 1HCZA 2M19A 5E3FA 4FN2A 2F0IA 4NDXA 3W1GA 2MQJA 4YT0B 2CVRA 2MBOA 5C0XH 1DXMA 3BDCA 4GXBA 5L37A 5JOBA 1QF6A 1J5EQ 3FVQA 1QNKA 2EY1A 4G4KA 4F87A 5IGBA 3UGBB 3CCQA 1WIAA 2F4IA 4A3MG 4A3KG 3HOVB 3WOFA 4HR7B 1RM6C 3CCMA 3FKIH 4BY1H 1S5BD 2ZNVC 1A70A 4LUVA 4X65Q 5LMNW 2ZJQA 3AEGB 2KK8A 2CJOA 3SDLC 4GNXA 1STYA 1IBLQ 2ENBA 4AYBE 3I4MG 3S15B 2GN5A 1MHHE 4OVZA 4M0WB 1Y56A 4J6IA 4JGHB 4HJ8A 4ZRPA 4YWKA 2JZZA 4P74A 4DV6L 2YEPF 3TRZA 4ULLA 2LFIA 1O7ZA 4C56C 1FRDA 2D0OA 4XWWA 2JN4A 3A54A 3EQLC 1G8ZD 2Y5CA 2E8GA 3HHMA 1AARA 3KWVA 3ZIMA 4P75A 5G3LD 1WE7A 3TJPA 4DHZB 3B9JA 3R3MA 2BDNA 2K5NA 1PFNA 2KC2A 3DM1A 3M62B 2ALYB 2EYOA 1K9MC 2L5TA 4JBJA 1GB4A 2W9NA 5IYCH 1SNQA 1HEZE 4KLKA 3R3OA 1QKZA 3IFDA 1YI2A 2AX5A 2LXCA 1RFKA 1OEYA 4QIWE 3PRZA 3KW5B 3L13A 3QWZB 4TKNA 4LNQA 3AE9B 5CV7A 4ZK9B 1FYCA 1GD7A 2G4SA 4J1MA 4CYEA 2Z4HA 3M9BA 1WTPA 4XC2A 1J8IA 1XTDA 2YTXA 3APCA 2VZKD 1F9SA 1VS0A 2VL6A 5C6AA 2L7RA 2JA6B 3PUXA 4DV0L 3ML8A 4XWTA 3NVZA 5E6JA 4OX9L 3J81L 1JRUA 1I4GA 1EM7A 1NR2A 3PTFC 1RTOA 4FVMA 4PZ7A 4R4OA 3VH4B 2B76B 2KX0A 3N32A 1V43A 1IL2A 1V6EA 4A3KH 4A3MH 2HJ8A 4EUTA 3MFGA 3A5UA 4K8IA 3OJ3A 1MJEA 4DR2L 3BWUD 3H1UA 5FJ8G 4HN7A 4X64Q 3P4SB 1JWBD 3DOWA 3DBSA 4MM3B 1YZ6A 5CR3A 4RKBA 1JORA 2KDMA 3I4MH 2OXPA 1N36L 2H89B 3PO3G 1G51A 5JEAG 2HUGA 4X3UA 1Q5WB 2NUCA 3RZOH 5HFYA 5DPSA 3BZKA 1Y1WH 1UGMA 3OWEB 5C1ZA 1GKHA 2Z6KA 3EROA 2JF5A 3VXWA 1PXUA 1D5MC 2F03A 4NNJB 1Y1VG 4ZYSA 2BGFA 2NVQH 2RDFA 5C3WA 1FNUA 2P5ZX 4ARCA 3IG3A 2WDVB 1FO4A 1X56A 4JI7L 2WGSA 1S5FD 3S14B 4HAEA 1C48A 3MXUA 5EAYA 1YVCA 1NJIC 3W5UB 1KFYB 4MSMB 4GN3B 1VQ7A 4P2CB 1ZEQX 4IUMB 1X65A 3FPPA 1G91A 2PEAA 1OTCA 3BVMA 3DWQA 2NB0A 1FNVA 1SMXA 2KEEA 1T6BX 2BYFA 3WANA 1IZ6A 2V3SA 1D1IA 3S2DH 2IX0A 1WX7A 3K7AH 2C5LC 4I6NB 3J81E 2EKIA 4A3BB 3L08A 1WJJA 1B7YB 4CDDC 3NTKA 2F1MA 3PHWB 1I3QB 2GOWA 4ARIA 1XJVA 3AE4B 4OGQC 4NXML 2PI2A 4GN5A 1KRSA 3W2DA 2H5XA 1F1HA 2Z4IA 4IN3A 4YY3L 3V62A 2RHQB 1YNJC 4JI2L 4PG3A 5FJ8H 5CX3A 4WWPA 2K28A 1GOZA 4IUUA 4XDXA 1IW7C 1BBUA 1YJNA 2NVYH 1QZEA 2NVXH 1DM0B 4R4IA 4A3EG 2Q8RE 2F0FA 3PO3H 3AB5A 5JEAH 2LRWA 4CBVA 2DZJA 2QCPX 1OQYA 3AEAB 2LVPA 2AL6A 3FILB 3H8HA 2NBUA 5JJLA 2XBBC 3H7PB 2I2YA 3PLUA 3HOWG 1J5EL 3T51B 2DENB 3RNCC 1LTBD 1WYWB 1B2TA 2L1BA 3EIVA 3EFXD 2G3QB 5FLXc 1JB7A 2N0SB 3KUDB 1I4PA 3ENEA 3CCEA 1QQRA 1RAXA 1B53A 4X65L 4ZHPA 1B3QA 3PSEB 2FUHB 3ITPA 1SNMA 2GA4B 1PFBA 2MO0A 1F0ZA 1S1QB 4N58A 1NENB 1OEYJ 2NPTB 3AV8A 3P7JA 3F2DA 3KYCD 4B3SQ 4HLEA 4KN7C 3M95A 2MJ8A 5C4XB 1STBA 4C3HG 1VQLA 3O13A 4HJKA 3HOUH 2ASQA 5C3JB 5LXHA 2N88A 4H0LC 1MI2A 1NUCA 4PQXA 4CDCC 4ZRQA 1KLVA 2HHHL 1JOKA 4AYBB 1G2TA 1II3A 5L95C 2WB1E 3BYYB 2LVOA 3QAQA 1CKNA 1WX8A 2YEPB 4K7WA 4A3GB 3J7AF 2MEKA 3NTHA 1JE4A 4K1RB 3U52E 3OPOA 4N6EB 1SROA 2DGYA 4KGTA 2PCFB 2XTIA 4R1JA 4JQWC 3AH7A 3S16B 4DF7A 3I73A 4DFAA 5I6WA 1VQJA 1KNEA 5M5YB 3BZDB 3Q22A 1TWFB 1JOOA 2VB3X 3FHWA 1ZGUB 4KK7A 4XQJA 2IO2B 2J0JA 3KQ4A 4EFOA 3MP9A 2PW9A 1IP9A 2HD3A 2L05A 1QOBA 2DX5B 4C4VB 2K05A 2XN9C 3CQZH 4A3EH 4DR4Q 2MWSB 2WXLA 3QJYA 4J8QA 2MX2A 4QIWB 5FLMG 3KF8B 1HQRD 2WIIB 3DDCB 4RCNA 1VDVA 5BYQA 3O65B 1S5ED 2UYZB 2ZNVB 1Q7YC 3HOWH 2KMMA 4FNFA 1BO0A 3W1BA 4NAWB 2ID0A 2JXXA 3L4PA 3JAML 3NE5B 1GHJA 3IT6B 4BBSB 5G5HA 4UAIA 1KHIA 5TR5A 4KDLB 1HQMC 4HKZE 2B2YC 3RN2A 2W54A 1IBMQ 3OOCA 4L5QA 1VQIA 1YHBA 4RG1A 1KTKA 4IURA 3BZCA 1EZ6A 4IUTA 3I55A 4KKTA 4II3B 2FE8A 5GMVA 4PMBA 5LNK1 3TMPB 4QB4A 3CCUA 3RN9C 2DNCA 1H9JA 1VLBA 1WI0A 1IBXB 1AE2A 4LF8Q 1OQRA 4IDIA 1FGBD 1V8QA 2QKIC 1VQ8A 1E8XA 1XO3A 2J0MA 1XNRQ 1TTNA 1EWCA 2KJ6A 2IO1B 1J7AA 4P6VF 1PTOC 4MGZE 4DHJD 4GOCA 4C3JB 2OCEA 2IBIB 4JI5Q 4N59A 3V61A 5KNDA 4KY7A 3NHEB 1SJHD 1WJ4A 1XLPA 4FHKA 4C1NK 4GDKB 3T53B 4DR3Q 1LLRD 1YQBA 2ACZB 2LSSA 3WAOA 1XEEA 4YHHQ 2JSVX 5CV9A 2AUKA 1WGGA 1YX6B 2NBWB 1CA6A 4GU2A 2WDTB 4FXGC 1L0WA 1LACA 1K8AC 4GKKQ 3Q23A 3MC0B 5BN4A 1F2RI 4GN4B 3RZDB 3S2AA 1PH5A 4PMWA 4XYQA 1RLFA 4X62L 2N78A 1Y8PB 4KHZA 5TSSA 4S17A 1PRTD 1ESRA 3J81i 3R2TA 4KGRA 1CFMA 4A75A 3A4RA 2CFMA 3DBHB 1UNSA 5I2XA 1DONA 3FKYA 2PQAA 2VW9A 1JOQA 5FLMH 3JAME 1HNXQ 1WXMA 4YTNB 2V1YA 1QG7A 3PQIA 4M01A 1I50H 3TS0A 2NBFA 2MBQA 3PF5A 1PGXA 2FMMA 2O5IC 3M7NA 3VYSA 3I4NG 1HE8A 2LVQA 5GAEC 1PTOF 1TIID 1VZ8A 1QJOA 4JOIA 3UE0A 1M4VA 5K5PA 3AEVA 2K0PA 1QLBB 4KGSA 1Y8RC 3ABVB 1GG3A 2EJMA 3H3VC 2SNSA 1H95A 1NMFA 2MA9B 3A4SC 2BYVE 2PE9A 4P73A 2LGIA 3QHTA 3PVLA 1TU2B 2K7VA 2K5WA 1JR0D 3HKZE 1YITA 1J7CA 1ZP0B 4WAAA 1LM8B 1WX9A 3CW2C 2ZTDA 1STNA 3B08A 2K50A 1DD2A 2DNFA 1VD2A 2F0VA 2INCC 2E2IB 1X3FA 2F0DA 5DNFA 1IYVA 1R4MB 3K81C 1J0GA 1NYRA 3A56A 3GTGB 4DK3C 3N1YC 1R4QB 2R93B 1SYGA 4PMCA 2DYBA 1T5XD 5J18A 2LXKA 3P4PB 1TS4A 2YYZA 1MBYA 4UP7A 2MPMA 4DV7Q 1YNNC 2A6ED 2K14A 1UE5A 5FOBB 4NPNA 1TXYA 3ZJVA 2L11A 3MXNB 4ALPA 1S40A 1HHVA 1N6ZA 4M8MA 4E74A 2KHJA 3DM3A 2KQ3A 3SFDB 4Q5VA 2K5HA 4X3SA 2JEBI 1SF0A 5IT9c 3GE8C 2SEBD 1KRTA 4ME3A 2R7ZH 3H3VI 1YX5B 3MJ5A 2VUMH 4LDTB 3HOXB 2K6AA 5M5WB 2AHOB 3HS0C 4M0WA 1K3RA 1PH6A 1ASYA 3J7A5 4XE0A 3KUPA 3A33B 2GI9A 2FCNA 1WE6A 1O80A 1VR9A 4TQ0A 4GS3A 3J9CA 1L2FA 3T16A 3KFUA 1NTGA 3PF4A 1WMHB 2PW5A 1WRDB 5L83A 4H13C 4JOIC 1Z9FA 1CT1D 3W5OA 1LYLA 3MVVA 3NXWA 3QG1A 2L1AA 4YCUA 5ISRA 1T9HA 1YN5A 1WJNA 4OWTB 1WYDA 5CV6A 3E6ZX 4QUFA 1GB1A 2WB1B 2JPHA 3I4NH 4K2LA 4Z9CB 2UUAQ 5E6PA 1IPGA 2KENA 2PYKA 2KHWB 3UIPB 2RSOA 3T56B 1P98A 1T0YA 1WR6E 3W9CB 3S2HH 1EFWA 3V05A 3S15H 4ZAIA 3TEHB 4TQUS 1WD1A 2K5PA 3A0JA 2CQOA 5LL6S 4NMZA 1WGKA 1LT5D 1BR9A 3EJIA 3TMEA 2JA8B 1JC7A 4ZYNA 2WYQA 1YJWA 3ZNGC 1GUNA 1KAAA 4F8CB 2EPBA 2BB6A 4RKLA 3KBGA 4IJHA 2Q8IB 5M3FB 1N34L 3HG9A 5M5XH 1HA6A 1JE5A 4JPBW 4JK1C 3RLOA 3B1LX 3I56A 2C7HA 3K59A 2KACA 2IT1A 4W9EA 3RNEC 2E2DC 1DGJA 2QHOA 1E8WA 2D3GA 3U2SC 1RDPD 3MEFA 3K9OB 1PFSA 4KZ0A 4IOAA 4XZ4A 3EBEA 4EEWA 4CO7A 2F0QA 3GTLH 1C79A 4A9AA 2JXTA 3A8IE 1U0LA 1SE9A 3FMCA 4JI8Q 5IWAQ 4MM3A 5J22A 4AH6A 2QW7A 1N33L 4Y52H 4KV2A 4BY7G 1MSGA 2A8VA 1NAPA 2D5DA 3LWEA 2HE7A 1AN8A 1DCZA 2GLSA 1V1QA 1WGRA 4IWQA 2X8XX 5DM73 4JI1L 3OTOQ 2DY7A 4KY6A 3M4OH 1N62A 2O4XA 4JI5L 2JE6I 3GTPB 2KWUB 5J3BA 2NBVB 3RMHA 1KD1C 4DR3L 1HZBA 4MJSB 4A76A 2IPKD 2BT6A 4B0MA 2AQ1B 4DR5Q 1JMLA 4YHHL 1NVID 4L63B 3J81j 2D3CA 1TZ1A 2B2WA 1ZXIA 1P8LA 3V96A 3UIOB 4GKKL 3VRBB 5DPRA 1KQSA 5CV8A 1SBBB 3EUB2 4MGIE 2EJGC 4AOFA 2W3RA 5DLQE 1HJPA 1G6PA 2D3BA 4NY0A 1AP0A 3VTWA 4HXDA 5KYIA 4II2B 2KVMA 3HFZB 4K0KQ 3JAMi 1HNXL 1NYQA 3DVGX 4GKJQ 2KDFB 1VQCA 3A7AB 4CKCA 2JQOA 3ND9A 1YIWA 2IY5B 5EE9A 3Q69A 2MP2A 3L9AX 4RM8A 4NJCA 3VA5A 2N9LA 4FO2A 1L0XB 5C5MA 2KAJA 4IG7B 2KZRA 1OXTA 4B3TQ 4DV6Q 1BF4A 3OWFA 4M00A 4FF1A 4A4IA 1GPXA 3S14H 1CKNB 5HG2A 2GVAA 4BOZB 2R61A 3WOEA 2EDGA 3NZSA 3VYTA 4A3FB 3NS8A 2KJXA 5IIFA 2A68D 3AYHB 4WJ3M 1YQ4B 2KNBA 1TBEA 5GXGB 3ZVVA 1PTOB 2BYEA 4JWUC 1Z47A 4I6PA 3GS2A 5IY0A 2Y3AA 2CU3A 2NTTA 1EOVA 1O78A 4BY7H 2V4DA 2VH1A 2WDRB 1E90A 1RIPA 1RCVD 4DA2A 1LABA 4A3BH 3C0RB 3EVQA 3DBRB 3M63B 1NDDA 1PZJD 3TIXA 2A19A 3V6CB 5DPWA 2QSDA 2A5UA 1DOLA 1UEBA 2XSCA 3FILA 4JIOU 2B2WC 2K01A 3HKZB 1OFFA 1V49A 1JQYD 4P7IA 3QOLA 1KOTA 3JC66 3BS1A 2N9EB 2YV5A 4OZCA 2PZTA 3ND8A 2CS4A 3RZFA 1FCLA 2REXA 3SDZA 3T3NA 1M8AA 3G6JB 2XIWA 3STBD 4FJYA 4L2YA 3S1QH 4DAYA 2V3PA 1D2BA 3NWSA 3DHIC 1S3OA 2LRUA 2K6DB 3TEXA 4X3KA 3RCZA 5ELBA 4OX9Q 1PUTA 2NPTA 4MTNA 1TVXA 3APFA 3U7DA 1SMYD 3S1NB 3ICEA 3L16A 5H1SE 1LUZA 3D4WA 1HA5A 4KKIA 2RHSB 3PV1A 4WQMA 3K80C 3P20A 1B3AA 3J80L 4HCPB 3TBLD 3DVGY 1STAA 1QOHA 3I8ZA 1I5FA 4JBMA 4DR2Q 2IO3B 4FJVB 2K03A 5G3LF 4A3JG 2FIDA 1BKBA 1I94Q 1EEFD 3V60A 1JQ4A 1BUIC 2KLCA 2G5DA 4CKEA 3CCLA 4H44C 1N36Q 3P4RB 2UUAL 1HH2P 2RKSA 3VR5A 5C4JB 2QEJC 2BF8B 3Q3MC 3VH3B 4G11A 2K4KA 2ZCBA 4MTKA 4A6QA 1A2TA 2K8CA 3RUIB 4TMAB 3MHZA 4LMQD 3AE1B 4H7BA 3N9YC 2IHFA 3CXCA 3AB9A 4JI6L 3D32A 5BMIA 1F9PA 4HCEA 1WTVA 3OHXC 3N1ZC 2K1FA 3KDFB 2WV6D 3T9LA 2RCNA 5I6YA 1C0AA 2CU1A 2KMCA 2A6HC 3SU8X 3NVVA 1XX8A 4JLCA 2BVCA 5COYA 1YIJA 4DXAB 4DV4Q 5D94A 1JWAD 4OIJA 3CF5A 3KF8A 1STHA 3TP7A 5CBAE 2BWES 2FAZA 4A3GH 2GBMA 2CCZA 2O2VB 1U4MA 3ONSA 4PT5A 1XCQL 1H8CA 4C2MH 2B63B 1I6HB 3NUCA 2KCMA 4NAWA 3VFKA 3VR3A 1KLGD 1QUQB 3MZ5A 4X3TA 3VYRA 5KGUA 2UXBQ 1MG8A 2EY2A 3S16H 1V86A 4XYCA 2IGHA 1EWIA 2BQQA 1WYGA 2PMVA 2BA0A 3ULJA 1KXLA 2Q8TA 2HQLA 5IWAL 3D31A 2PPHA 1LXDA 4M1UB 1EUVB 1C7YA 2XEWA 2PZUA 3AEBB 4XX5A 3TCAA 2QMTA 4ANVA 1DGSA 3J80E 3HOZB 2CW0D 2GBJA 2I07B 4M8NA 5IYCG 3APDA 4IUNA 1ZW7A 3K5NA 4GIVA 2OOBB 1F2YA 3OTOL 3LDZE 3DHGC 1IBXA 1QVCA 1VQ6A 2AYOB 5A2QL 3LB8C 2XRSD 1DJRD 1SIJA 1P9DU 3TP5A 3AMUA 2KTRB 3P42A 5EE0A 2Q2IA 1QNUA 3V2TA 4A3JH 4RGTA 4Y7NH 1F52A 4ANXA 4PZ8A 1TKGA 4BXXG 2JK8A 2ZXOA 2KEDA 5C3EB 1MKHA 3R8BA 5KIXA 3H94A 4LTUA 5EPLA 1PVOA 1ASZA 2H4OA 2Z8LA 2AUJD 1XMOL 2NR2A 2B8GA 4DUZL 4DV5Q 3B2GA 4GMVA 3I63C 3TP6A 1FVIA 3MHBA 2D9UA 2OJWA 2HQEA 4K0KL 2I5LX 4GKJL 2EVBA 3DEPA 2JA9A 3PV0A 5CORA 2F4VQ 2CHWA 4WAFA 1EZ8A 1N60A 4KHPL 1SYCA 2AWOA 1EFID 5CV5A 4D2KA 1HTLD 2RVLA 3ONAB 1A6XA 3CU7A 1A3VA 2Z59B 3F2BA 1VQ9A 3U30A 4B3TL 1AW7A 4GLVB 2FCQA 5C5LA 4BOSC 3CD6A 2BYTA 1GXDC 4DV2Q 1Y1WG 5M3MB 4NJ7A 2CWAA 3R7QA 2CHZA 1WXVA 2JZPA 2I5HA 1EWHA 2HHHQ 3B0AA 1I4XA 2NN6I 4KY5A 2INPE 4PNYA 5D7GA 4AQ7A 3S1MB 5JAVA 1NCVA 3RZDH 1CUKA 1EO6A 3CMMB 3L3OC 1BBXC 1N32Q 2MJDA 4UY8C 5A2QE 1S5CD 2ZVOA 1Z7TA 4JBWA 1K3BC 3CCVA 5D2MB 4BZAA 3CCSA 2JEAI 1EQQA 1N8RC 1G2SA 1VQKA 2WXKA 4GLXA 3U4EG 3ZYYX 2E2HB 1VDZA 1UF0A 4JC0A 5GADC 3WIMA 3NQIA 4I7ZC 3QIAA 1N5XA 2HTHA 2PMZE 1WTHA 2QF7A 2NZHA 4ZHOA 2JJQA 2KO3A 1EIYB 2V0GA 4BXXH 4JV5Q 2HD5B 2N9XA 2IL8A 4NKLA 4C3IB 4BKGA 1WCMB 4S0RA 3KBXA 3MXNA 3C19A 4N8FA 3DQVA 4YWLA 1KDBA 1Q12A 2YTVA 1EIFA 1X32A 2XWJB 5F2DA 3I5JC 2FIFA 3PHXB 3U8ZA 4E3CA 1RFAA 4K7SA 2I5MX 1TKEA 2SAKA 3G48A 4J3OD 5E6NA 1UWMA 1E10A 2OT2A 3GTQB 1SSOA 4RA8A 3F1ZA 2JA8G 3LYYA 1YD8U 1UE6A 1KH0A 2E2IH 1DOXA 1IGCA 1I94L 4RM9A 4JX1C 4RH6A 2R93H 2EYLA 3HM3A 3VDYA 1MI0A 1XD3B 2E3TA 4RF1A 1DOIA 2WXRA 2AWNA 1WMHA 1P7EA 2PKOA 3TSSA 5C44B 3FP9A 3H9DA 1PLFA 3GE3C 3ZNID 2WLBA 1Q3LA 4ZUIA 1XPUA 3TEWA 1F9QA 2LFNA 2KN5A 1K83B 1BBWA 2RCFA 4ID6A 1FL0A 3OIQA 2WQYB 2K8HA 2LGDA 4GLAC 2YTYA 3IT4B 1D8LA 3TL5A 3DHQA 2BS2B 1VCIA 5M5WH 2LGSA 3W5VB 3RD4A 3DBHI 4AP4C 2C35B 1CQFA 1ZPSA 2XGTA 3VQIA 1B8AA 1VQHA 1SYFA 4A3IB 4I6LB 4MN3A 4DV4L 3A55A 3BJUA 1YJJA 2M00A 5I4DA 1EOTA 1ZOYB 1FJGQ 1Q1EA 3S9WA 5NUCA 1QVGA 1TWGB 4DK1A 1JW9D 2LJIA 3CMEA 1SYEA 2F0HA 2F0UA 2KFKB 2HT1A 3SFEB 4LF9L 1C9FA 2UXBL 3RNUA 3GTOB 2N4FA 1VQDA 1F9JA 5E4WC 3SR1A 3HOUG 3ULPA 2HDLA 3PUYA 4X62Q 2VZKB 1Y8NB 3DVNV 4WWOA 2KT7A 1RHPA 1MVKA 1D3ZA 3GTMB 1YOVB 1PRTC 1CSQA 2MP2B 3VR8B 3IXSA 3V6EB 3KVFB 2G4DB 4HPPA 4IUVA 3M3YH 3J80i 1C77A 1RRBA 2N7EA 1VF7A 4W9LA 3P1HA 4UP8A 1UWVA 1LT6D 4LF4Q 2JQRB 5ELCA 4GZYC 4BKSA 1EU3A 1R4MI 3AI5A 2BWFA 1ENAA 2KHSA 4K8JA 2JA8H 2J7QB 1B9MA 2A1AA 2W55A 1VQFA 2UU9Q 3KF6A 3CC4A 1W3SA 3IL8A 4A3DG 2UXCQ 1X3EA 5M3FH 1PMRA 2AEHA 2KBNA 2ZPNA 1FFUA 2BBCA 3TREA 4XQQA 1S5DD 4MJSA 4DV3Q 1NBWA 1ZYRD 2LXAA 1WWTA 2KFJA 1YJIA 3GP7A 2F0SA 1GC7A 3I57A 3ZRCA 2KTFA 2DUDA 3NBIA 2YU9H 3NSWA 1H4RA 3VUXA 3AEEB 4DV5L 1L2NA 1PDQA 3VA7A 4BKTA 4X66Q 4K5XA 2QA4A 3TS2A 1LQBA 4JCVE 3MTSA 3TEYA 2KN4A 1M1KC 3HOYG 2EY6A 2B29A 2ZJPA 3AXCA 1G6JA 3EFUA 1BOSA 2VQEL 2JA5B 2F4VL 1PRTF 3E0EA 4MEMA 4DAYB 3Q8EA 1YQ3B 5IAAC 3BDOA 2G45B 3IAYA 2A6EC 4JI3Q 2EMSA 2CH4A 1YHQA 2D11A 4IPCA 1L0YB 4IWOA 1EY0A 2V1CC 4WIPA 5FO8B 3CSTA 2B2YA 1I4HA 4DV2L 4MH8A 4ACFA 3CIRB 2ZM6Q 1SFOB 4ZKCB 3GTKH 4KJOA 4LUOA 4EZJA 1IHZA 1YBYA 4DR7Q 3Q3FA 1CZWA 1A15A 3HUIA 3SK6A 1CM9A 1T0RC 1WTOA 4ZRJA 1DOYA 3H0GB 2F0GA 3X3NA 2WU2B 3E9HA 1N32L 1L1OC 3T1YQ 3DUZA 3I4LA 5EPKA 4L5TA 1HZ9A 4E71A 2RSNA 2GRIA 1C3TA 1T5EA 1W6JA 1RWSA 2RD0A 2FCMA 2O5JC 3SGIA 4A3DH 4LAAA 1I4RA 4JV5L 2DYOA 5IKCM 1E7ZA 2LXJA 2IDYA 2LUEA 2BOSA 4GOPA 3S1RB 3EFCA 3KLSX 2IGGA 1CHQD 1RD9D 5KEEA 4R8NA 1VQOA 1K73C 1EF1A 1UD7A 5DPTA 4HMJA 5CYUA 3PO2B 2PQEA 1HUNA 1LO5D 2PMZB 5I9OA 5KYLA 4ZOHC 1R4PB 1R4NB 5MPOA 1AFPA 2NS5A 4KIKA 1PTOH 4LWCA 3ERSX 1N34Q 5JHAA 1LFDA 3K5LA 1K8RB 4K14A 4NXNQ 3K0YA 3HOYH 1A2UA 2Y5PA 1WF9A 4HKQA 1JT8A 1B4OA 3HVDA 3RNFC 4PS8A 3NRZA 1TWHB 4XT3B 5G55A 2A5HA 1XLOA 1UUPA 2WAQG 4JE3B 4FDBA 2CH4W 4H2AA 2DY8A 3VUWA 1SNDA 3G6EA 2KQ7A 2LY7A 3IAS1 3J7AV 1L4DB 4C7YA 5HGQA 1XWEA 1N33Q 3JAMc 2XK5B 2FNJB 4J15A 4NB3A 4XYOA 2K25A 3NP8A 5IO9A 1D7QA 2EYHA 3PZ7A 2EYFA 1CTMA 3NPPA 1PZKD 2F0WA 3ZXVA 1X6OA 2F3IA 3L0WB 3KWLA 1OTRB 4JI1Q 1WTRA 4DNRB 2JA7B 2F0LA 1UE1A 3SD5A 2B39A 2KQSA 1C8CA 3EN2A 1IYJB 4ITKA 4NQKE 3PIO3 1PH9A 3S1NH 2NVTH 3VR9B 1CQVA 3KDFA 1CZPA 1FJGL 2KANA 4CDEC 4H02A 1WGHA 3QC8B 2NWGA 2R2QA 3OIPA 4B9WA 3FKIB 2R7ZG 3K5OA 4BY1B 1K50A 4GOPC 3ZDTA 2X6LA 2VUMG 3ZKJC 5KHOA 3OAWA 5JPNC 2O2VA 4ICUA 4YTMB 1QZHA 3LX0A 1E6EB 4JBKA 3URYA 1PH1A 2KDIA 3H3VH 1B1ZA 2KXJA 5E1FA 2DZKA 4TV3A 4A93G 4W9DA 3MXGA 5C4JH 3FDTA 1QUQA 1E7UA 2BS4B 1EQRA 3M7GA 4HPLB 1OXVA 1QWYA 1PGBA 1G6ZA 4HJ5A 4JL9A 4FXDA 2L55A 2PNRC 2KDEB 1VZ6A 4K3BA 2YVCA 2RBMA 2C9OA 1H9MA 2PTLA 1ZUD2 2DAJA 4LF4L 3EC8A 2OJRA 1E1OA 5FK9C 2D2QA 3HOVG 4MH0E 4NZLB 4RGNA 5EJWA 3LWUA 4JI0Q 3DBRI 4AUQC 1SN8A 2QIEB 3U7ZA 2KHIA 4YCVA 2UU9L 2Z0SA 4TQ1A 2F0KA 2Z9HA 2UXCL 1BDOA 1J9OA 3IHPC 1FFVA 2TMPA 4EGVA 3AULA 5G2NA 4W9IA 1V81A 3MTNB 3J7YW 1PFMA 1EL0A 2KTRA 4DV3L 1PH7A 1I6HH 3PS6A 2A68C 1ISNA 2DAFA 5IOCA 3R66C 3J7ZC 2C7NB 5T8IA 4DHJB 4B9KA 1UELA 2VB2X 3D4DA 4JW0A 2DBYA 2L52A 3EECA 4X66L 3ALBA 1WM3A 3QA8A 1KF6B 4DAMA 1IW7D 3Q6SA 1GUSA 2EXZA 2L12A 4TVAB 4JYAQ 2HTME 4JI3L 4E6IA 1VQBA 2AWTA 4W9HA 1ICWA 3VHTC 3GTJH 4LF6Q 2Z0EB 5I2YA 1TWCH 3JVZX 3C8YA 4N9PA 4Q0FA 2BPSA 3BIID 2H1EA 3VRAB 3STBC 4A3MB 1L7YA 4IALA 4LUZA 1PRTB 2EE1A 4DV1Q 1E3PA 5IT9L 1UE7A 2ZM6L 2IZVB 3HIZA 1WI5A 4CKBA 1PFDA 2W3SA 4DR7L 1SE8A 3C1FA 3QJZA 2N3SA 1G291 1SMYC 1WCMG 4A93H 4Q2JA 3QOJA 1K0RA 4PS7A 2JA6G 3L0OA 1Q8KA 4UHVA 1U5KA 3RZOB 3KYDD 3SXHA 1HZ5A 2C7MB 1A3UA 1ZKOA 3AFPA 1AWDA 3T1YL 4HROA 3B6YA 3ZTCA 3A7LA 3C1EA 1C78A 2QILA 3PGZA 5BN3A 2KWVB 1X3PA 1UBIA 3A9JB 1V1PB 3D4RA 3ZJUA 4HTHA 3U58A 2BCOA 3HOVH 2K75A 2KJHB 3H6NA 1QOAA 2ZJDA 2KCCA 2WKDA 1EY5A 4TUUA 4IOCA 4C00A 3RNBC 3I90A 1I42A 2HDMA 5C4HA 5CC4A 4XQNA 1SIFA 3TUOA 2PVGC 4HDOA 3VAWA 3N52A 4RHSA 1PYSB 5C44G 4HIKA 1FEHA 1MG4A 4JI6Q 2JYTA 4W9CA 2D0PA 5EBCA 2JWUA 3KJOA 5ELFA 3SE0A 2ZJRA 5GQOA 1CKOA 1GVPA 1BQQT 3GD7A 1L4ZB 3BDLA 2ZEQA 5LMUL 2EQSA 2FMCA 2JUOA 5CBEE 3K5MA 3S2DB 5DM63 1N9WA 4L1BA 1VQNA 3C46A 1CKMA 4NXNL 1F2LA 3VR6A 3S1MH 2DYMA 3N20C 2F0EA 4L23A 2PPBC 4G7ZC 1IKLA 2EYPA 2CR5A 2B2VC 1SDFA 4BS9A 1D5XC 5IT9E 1B9NA 3AEDB 2LHDA 2D62A 5IOIA 3E5SA 4JI4L 3CPFA 1FIQA 3NELA 4ILWA 3AU4A 1PQSA 3WALA 1EQTA 4PYUA 3Q8FA 1MGSA 1EQVA 1LV9A 2J52A 1JMCA 2VH2A 4CHKA 1SJED 1WTWA 3NQTA 4ZRZA 1L1OB 1EEID 4A3BG 2CW0C 2NVYB 2L83A 4C3IH 3UDFA 1WZ0A 1E2VA 1WCMH 2D2CC 3KF6B 4LJPB 4HIMA 3PO3B 4I7AA 2I0QA 3Q3JA 4EOYA 4EZKA 2JA6H 2MBBB 1FNWA 4BA2I 3HVZA 3N3KB 3SR6A 4NP5A 5CTRC 3U9OA 4USAA 3GOEA 1KAWA 4IWPA 2IY0B 2R6GA 4HJ9A 3BINA 3HK0A 3GDEA 1IYUA 3F8TA 5GAHC 1Y1VB 3PLVA 4XGAB 5IYDG 3WAPA 2KCTA 1M90C 1ROEA 3NWTA 2B2UA 5D3IB 1PDXA 1CI3M 1XMOQ 2IY1B 2KWCA 2PZWA 3DWAA 3K0XA 4DUZQ 2VZAA 3UDGA 3K58A 2FINB 2KFKA 1BVSA 5C44H 5C23A 3L54A 4YXDB 2JXMB 5FO9B 1SAPA 4ODGA 3QX1A 1K83H 4ASWC 3ZQ4A 1O7IA 2IHEA 4BBRB 4DXGA 5BMHA 4KHPQ 4AQYQ 1ZXTA 3T1HL 3RNAC 5BO4B 2JSOA 4B3RQ 4RHRA 1W6KA 3I70A 4JI0L 2A69D 4KSLC 4IPDA 4PV1C 2WXQA 1SE4A 5IGGA 4HSVA 3CKIB 3AU5A 3MXPA 4LFAQ 1HNZL 4IM2A 1GO3E 3EHVA 2LS01 4L5SA 2Y0SE 3PIOA 4GDLA 5D6JB 2AQ3B 5HHDG 1O7LA 5C4ZA 2L0CA 4KHVA 1V5OA 2RPVA 5C4XG 2LWPA 2G1EA 1AE3A 2OQ0A 3PIP3 3ZTDA 4HCNB 3FC4A 2MO1A 4RMFA 1QE6A 2K5DA 1E1TA 4AYBG 2ZXPA 3DVNU 4GB9A 3CQZB 2B3AA 4MELA 4A3GG 4B0EA 4CJ1B 1TS3A 2PW7A 5CV4A 1I3QH 1YEZA 2F0JA 1P3QU 3NS1A 4P16A 4JYAL 1TKYA 2MH7A 4U68A 4LNNA 3Q8AA 1BCPD 4GOPB 3WAMA 4OELB 4DXFA 3H09A 1E0BA 2B2UC 4XXEA 3HOWB 3CHBD 4CQNA 2R7DA 4LF6L 3EGRA 4EE2A 1MHXA 1CSPA 2BDOA 4A3PA 2KA7A 1IBKQ 5IYDH 4LNIA 3A1QA 4DV1L 4KIKB 2BTEA 4K2KA 2A4ZA 4WJOA 1UH6A 1LT3D 1HNWQ 2NN6G 1KNAA 1E0ZA 4RGMA 3ZNHB 4NPSA 3KH0A 3RMKC 5EKIA 5D3DA 4KVGB 3Q3NC 1KM7A 2I46A 3LXFA 3QIJA 5BR8Q 3PUVA 2R92B 1OXXK 4R8IA 1AZPA 2J7ZA 3Q6BA 3M85A 1MJDA 4C3HB 2MHVA 4IJLA 1QILA 1VQAA 1KJTA 4M8AA 4IFDI 4MT5A 3VR2A 1Y14B 4OVVA
chains in the Genus database with same CATH topology
4L6TB 4KKUA 4DAVA 4N9TA 1JCKB 1HXYD 5JJZA 2QJLA 3DXJC 5CMDA 1ILPA 2M2LA 3KLRA 4XDCA 2FUG1 1HZ6A 2RDGA 5H92C 1JICA 1H9KA 4XDDA 2WXHA 1HTPA 1TS5A 2WINB 4C3JG 1SE3A 1VRAB 4YSXB 2BE5D 2DNEA 1CJEA 3V3XA 2BS3B 4O42A 2W82A 1D6EC 1JROA 3AE8B 1NR4A 1SNPA 3P1MA 4C1NI 2OEDA 1I50B 1FRRA 4IFDJ 1R9TB 2A73B 2KWDA 1I6VC 1XLQA 1RYJA 4B9XA 2NN6H 2WKCA 3AEFB 3WDNA 4C7ZA 2K33A 4QUCA 2DLBA 2K04A 3KK7A 2NYZD 2K5QA 1Z6HA 3ERQA 2TSSA 3NTIA 5G5GA 2CQAA 3D8GA 2BW2A 2DWQA 2RQXA 1UEAB 4V0BA 3MA2B 1WXQA 2I38A 1E2WA 2BB5A 5IGFA 1ZYRC 4ABNA 1O7YA 1TT2A 3I3CA 4DQOC 2WXMA 4IZ8A 2V3NA 1D1KA 2ICIA 1FM0D 3FRPB 1VJKA 5ELEA 4JWSC 4WWMA 1FR3A 4C80A 4KJNA 2NMQA 1ACCA 1TKWB 3AU7A 1HFGA 1D4BA 2AQ2B 3HRZC 1XF5L 1JWMD 3N6RA 2E74C 3L7ZC 3CWIA 1JWSD 4UDUC 3E56A 1SYBA 2LEKA 4WH4A 1TY2A 2SNMA 2PVOD 4IOIE 5JPMC 3I4NB 2ZW1A 4OO1H 1T3QA 1BMLC 2ONQA 1QOGA 2A74C 3BVGA 1R7SA 3S2HB 4CGYB 4KN4C 3MFYA 2Y0SB 1XTCD 4ME5A 1TYGB 1L6VA 2N9KA 2J42A 3AE2B 1OO9B 1TQOA 5ELDA 4DNTB 1ZXHA 4XIGS 4FF3A 1BNZA 5M5XB 4DGZA 5HGTA 4HRSA 2R3ZA 2XNAC 3PMFA 2F3WA 2EELA 3H91A 3P63A 2SOBA 4FF2A 3GTLB 2PIAA 3AN1A 4OIKA 1GHKA 4YSZB 1NI3A 1EY9A 3BK1A 2OEOA 2E2JB 2INNE 2MP1A 2F3VA 3DMUA 3OW7A 3R93A 2KQ4X 2G9DA 1J7BA 4FXKC 1C4AA 1EYAA 5C0XI 3M4OB 1E9MA 2Q5WD 1KDAA 1E7PB 2B8FA 1ENCA 1V1PA 1VMCA 1OXSC 4OO1I 1TZOA 4REZA 2F0NA 2JYEA 1JALA 3P75A 1H9SB 1V8CA 1ENFA 1TJEA 2E6XA 2M0AA 1PYWD 3GV3A 5T1IA 4KMUC 4OHJA 3T4AC 2MJ3A 1UGJA 5AUKA 1ZDVA 2M56B 2FBWB 1DOKA 4YWGG 2LMCA 4V190 2A6HD 1BUVT 1XXGA 4EVOA 5C0XJ 1K53A 1N61A 1N5WA 2CHBD 4HMIA 3E0JA 2K1BA 1WTQA 4IKGA 1Q90A 3VR4A 3D6WA 5HI1A 1SNCA 3X3MA 1Q1BA 4R3DA 1MSHA 4F8MA 4GDLB 3K57A 4BY7B 1TWAB 1PZID 4YSYB 4HCSA 4CHTB 3ETRA 1GAQB 5LHY1 1IL8A 4K5WA 1B44D 3F2UA 4QF4A 3SEBA 2BA1A 1RKNA 3S17B 4ZLTF 3GB1A 3HRDD 4US9A 3S1QB 1KRHA 2PLPA 4O1NA 2KOLA 5FLXL 1GUTA 3LNNA 1HUMA 1KABA 3ZGZA 2L9HA 3UI2A 2V4IB 4A55A 5EKKA 3Q0AA 1F2MA 1MPEA 5E4XA 2EZVA 1TS2A 2IW3A 2RDHA 4YIJA 2EY5A 1FD6A 4TKOB 2ZXRA 1H9RA 2WP9B 4LK0M 2ZW0A 3RLFA 4U673 3AE3B 2FFKB 3PZ8A 1GUOA 4RGOS 3C3LA 5BYSA 4IUQA 3HP3A 1CHPD 1ESFA 2EJFC 3SK5A 4DK0A 1GJXA 3B2FA 2WP8J 2EYJA 4C2MB 4FYDA 1YNTE 1FD7D 3W1SA 2WXPA 4TRDA 3GV6A 1LTGD 1K52A 4IUPA 1Q8IA 2K32A 1GUGA 1NSNS 2H88B 1K8OA 3Q8BA 5FLXE 2L4NA 2ICEC 2D5GA 2E75C 2M9VA 1FMAD 5AFWA 5CGKA 4JPSA 2C5CA 1CK1A 1ET6A 2WXGA 3TBIB 2JYOA 1OQQA 1ZDXA 2F0OA 1QT9A 2NTSA 2JX5A 2ZT9C 5H8YE 2N55A 3I91A 3PUWA 3G7LA 5FR3A 3BG3A 2OF1A 3SK4A 3QWNA 4HSPA 4A3JB 3D3RA 2K3UA 4Y7NB 4KD4A 3TN2A 5A35A 1XYIA 2WS3B 2KECA 2XRQD 5IGDA 2K9XA 5JVG3 1BXTA 3GQBA 1EY4A 2WXJA 1X3QA 3AE6B 1F2RC 4WFN3 1N63A 4S3SA 4NW2A 5EQ0A 1RODA 4BA1I 3U9SA 1AYFA 5I9PA 5JEAJ 1WVLA 1XLNA 3Q24A 2WNMA 4FP5D 2J4XA 5KNCA 2F0MA 4G7OC 1STEA 1RJTA 1EY6A 4KTAA 1EY7A 1SEBD 4KX6B 5AUIA 1IKMA 1P7FA 1C76A 3PO0A 1DYQA 2J53A 1VF5C 3UI3A 2A69C 2JU6X 1B50A 1HFNA 1ML0D 3OMGA 3BYTB 3AE7B 5IGCA 1ONLA 2WXFA 2G9HD 2WXNA 1SB3C 1SNOA 1YNJD 1FCCC 1EYCA 4R9WA 5KRUA 2GB1A 2MJEA 1EU4A 1U9RA 4DAPA 3Q8CA 3QO2A 1L6UA 3TEZA 1C4PA 1LTSD 4RFBA 3I9V1 5BYRA 1BCPC 3VYUA 1SXTA 4QMGA 4WORA 2RMMA 3FAHA 5JXVA 4A3KB 4F88A 1DOMA 3M4YA 3PUZA 2B2VA 3TZDA 3DWGC 5C2TB 4I65A 3DWMA 3I4MB 4C3IG 5EBDA 1ET9A 2E76C 2WACA 1Y1WB 1LTID 4HEDA 1FXIA 3WCQA 1HRJA 3ZJTA 3OMCA 5J39A 4EQNA 4CJ0B 2NVQB 2IX1A 4OZBA 5FKAC 1QB5D 2SDFA 4RAUC 2L32A 1SE2A 4OL7A 4ZKBB 5M9OA 1AZQA 5K36G 3RUZA 1I7HA 3DWPA 1BCPF 3TZUA 1CZGA 1V97A 2NZ1D 3NBHA 3K7AB 3HEJA 2WXIA 3HZXA 3H6MA 2QDBA 4YTPB 3RFZB 1VMPA 4IFDG 1JWUD 4XT1B 4G57A 2BE5C 4MIUA 2LMCB 2EYMA 2OHFA 3M3YB 4OZAA 2HCIA 1SSNA 1U4RA 1L5PA 3NVYA 1D5ZC 4OW0A 1DZ1A 4RNAA 1RF2D 2HDEA 4IQZA 1I4QA 3FPUB 4DU9A 2NVXB 1AEXA 4K6LA 3T13A 3A8JE 2CJNA 5LL6X 3AE5B 2YU9B 2IGDA 2HCCA 4FF4A 1H9SA 4WURA 2IWHA 1ZE3D 1C4QA 1K8MA 1RTNA 1WD0A 1PTOD 3C2PA 3FEWX 3MEHA 4ZQ3A 5K36H 1FXAA 3SHLA 3HGBA 1YN4A 4K6DA 4KKSA 1WSPA 2F0PA 2FHTA 4LLGM 4B08A 5BMGA 3GTKB 4J6HA 3HOUB 5T1GA 5D65A 1F77A 1CA5A 4WRDA 4HEA1 2MGSA 2KUMA 2X6GA 1WRIA 1Y69U 4IFDH 1V1OA 4KKJA 1OXUA 5D14A 3CRLC 1TY0A 5IGEA 1YMHE 1ILQA 3IKJA 3TDQA 1TR5A 1K51A 1LTAD 4ZUJA 4KD3A 2FJ2A 4A3DB 2XVSA 4F7XA 4A3EB 1EWYC 5C3XA 1JB3A 3KLSA 1IUEA 1E2ZA 5EPJA 5JVH3 1MD2D 2N7JA 5EE1A 2JP1A 1UAPA 2VXWA 3I72A 5EE3A 1KLUD 4RF0A 1YN3A 4EQPA 1VZ7A 3HOYB 2VNUD 5IODA 4HJGE 4RCOA 1LT4D 1IGDA 1A3TA 3DEOA 4DN4M 3E9SA 1YNND 3D6CA 2ON8A 1C4CA 1S4ZA 4QCLA 5DAUA 4LK1C 1JRPA 4K5VA 1EY8A 5FO7B 2LKVA 5DEHA 2B2TA 3NK9A 1F2ZA 3GO5A 3NZ3A 1PGAA 4CJ2C 1KDCA 4BWGB 1QCBD 3W3AA 4A90A 1LTRD 4A8XC 4EQOA 4KV6A 2NVTB 2LUMA 3CRKC 1NEKB 1HPCA 1GUWA 1UWXA 2PO4A 3OSOA 1SYDA 3T3OA 2RA4A 1EYDA 1U4LA 3SK8A 4AS1A 3SVMA 1BCPB 2X38A 2KCNA 3EA6A 4FXCA 1EIGA 5KNBA 5C0XG 4LJZC 2IJ0A 1WTXA 4NAMA 4MHEA 4OO1G 4MACA 5BN5A 5J1ZA 2XWBB 1U4PA 2WDQB 1LTTD 2IX3A 2WAQB 4G7HC 3NUHB 4N6EB 2B2TC 3MAQA 3BVZA 1Q10A 5HURA 3BK2A 3TP8A 3MWYW 3RPFC 1L0VB 3AECB 2Z1CA 3K6OA 2EOTA 4TSSA 3NHHA 4RWSC 4XTCS 5EKLA 2J0TD 1QOFA 2WXOA 1STGA 3QB3A 3IFTA 2K22A 3R2IA 4L8JA 2X69A 1EIHA 3NVWA 2WU5B 3GTJB 2O2LD 1TWCB 3P4QB 1Y8OB 4KI0A 2DN8A 2R7ZB 3AMZA 2LHEA 2VUMB 2F0TA 3A8KE 4WJWA 4GLSC 1F9RA 1XCTL 2MUYA 3IAM1 5EGTA 4A93B 1HCZA 2M19A 5E3FA 2F0IA 4NDXA 4YT0B 2CVRA 5C0XH 1DXMA 3BDCA 5JOBA 1QF6A 3FVQA 1QNKA 2EY1A 4G4KA 4F87A 5IGBA 2F4IA 3HOVB 3WOFA 4HR7B 1RM6C 1S5BD 1A70A 3AEGB 2CJOA 1STYA 1MHHE 2ENBA 4OVZA 3S15B 1Y56A 4ZRPA 2YEPF 4ULLA 2LFIA 1O7ZA 4C56C 1FRDA 4XWWA 3A54A 3EQLC 1G8ZD 2Y5CA 3KWVA 5G3LD 3B9JA 2BDNA 1PFNA 3DM1A 2EYOA 2L5TA 1GB4A 1SNQA 1HEZE 3R3OA 1QKZA 3IFDA 2AX5A 1RFKA 3AE9B 5CV7A 4ZK9B 1FYCA 4J1MA 2Z4HA 1WTPA 1J8IA 2VZKD 1F9SA 5C6AA 2JA6B 3PUXA 4XWTA 5E6JA 3NVZA 3J81L 1I4GA 1EM7A 1NR2A 1RTOA 4FVMA 2B76B 1V43A 3MFGA 4K8IA 3BWUD 4HN7A 3P4SB 1JWBD 4MM3B 5CR3A 1JORA 4RKBA 2KDMA 2OXPA 2H89B 5JEAG 2HUGA 4X3UA 2NUCA 5HFYA 3OWEB 3EROA 1PXUA 1D5MC 2F03A 4ZYSA 2RDFA 5C3WA 1FNUA 4ARCA 2WDVB 1FO4A 1S5FD 3S14B 4HAEA 1C48A 3MXUA 3W5UB 1KFYB 4P2CB 1ZEQX 3FPPA 1G91A 3BVMA 3DWQA 2NB0A 1FNVA 1T6BX 2KEEA 1D1IA 2IX0A 3J81E 2EKIA 4A3BB 3NTKA 2F1MA 1I3QB 4ARIA 3AE4B 4OGQC 3W2DA 2Z4IA 4IN3A 1YNJC 2K28A 1GOZA 4IUUA 4XDXA 1IW7C 1DM0B 2Q8RE 2F0FA 3AB5A 5JEAH 4CBVA 2QCPX 3AEAB 3FILB 3H8HA 2I2YA 3T51B 1LTBD 1B2TA 2L1BA 3EFXD 2N0SB 1I4PA 1QQRA 1B53A 4ZHPA 3ITPA 1SNMA 2GA4B 1PFBA 1F0ZA 4N58A 1NENB 3AV8A 3P7JA 4KN7C 2MJ8A 5C4XB 1STBA 4C3HG 3O13A 5C3JB 2N88A 4H0LC 1MI2A 1NUCA 4PQXA 4ZRQA 1JOKA 4AYBB 1G2TA 1II3A 3BYYB 2YEPB 4A3GB 3J7AF 2MEKA 3NTHA 1JE4A 3U52E 3OPOA 4KGTA 2PCFB 3AH7A 3S16B 4DF7A 3I73A 4DFAA 5I6WA 1KNEA 5M5YB 3BZDB 3Q22A 1TWFB 1JOOA 2VB3X 4KK7A 4XQJA 3KQ4A 3MP9A 2PW9A 1QOBA 2K05A 2XN9C 2WXLA 3QJYA 4J8QA 4QIWB 1HQRD 2WIIB 5BYQA 4RCNA 1VDVA 1S5ED 2KMMA 4FNFA 1BO0A 4NAWB 2ID0A 3L4PA 3JAML 3NE5B 1GHJA 3IT6B 4BBSB 5G5HA 4UAIA 1HQMC 4HKZE 2B2YC 2W54A 3OOCA 1KTKA 4IURA 1EZ6A 4IUTA 4KKTA 2FE8A 4PMBA 5LNK1 4QB4A 2DNCA 1H9JA 1VLBA 1IBXB 4IDIA 1OQRA 1FGBD 1V8QA 2QKIC 1XO3A 1EWCA 4P6VF 1J7AA 1PTOC 4C3JB 4N59A 5KNDA 4KY7A 1SJHD 1XLPA 4C1NK 4GDKB 3T53B 1LLRD 2ACZB 1XEEA 2JSVX 5CV9A 2AUKA 1CA6A 4FXGC 1LACA 3Q23A 3MC0B 5BN4A 1F2RI 3RZDB 4PMWA 4XYQA 1Y8PB 4KHZA 5TSSA 1PRTD 1ESRA 4KGRA 3R2TA 1CFMA 1UNSA 5I2XA 1DONA 1JOQA 3JAME 4YTNB 1QG7A 2NBFA 1PGXA 2FMMA 2O5IC 3M7NA 3VYSA 1PTOF 1TIID 1VZ8A 1QJOA 5K5PA 4KGSA 1M4VA 1B9RA 2K0PA 1QLBB 3ABVB 2EJMA 3H3VC 2SNSA 2LGIA 1TU2B 2K7VA 2K5WA 1JR0D 1J7CA 1ZP0B 1STNA 1DD2A 2F0VA 2E2IB 2F0DA 5DNFA 1IYVA 1NYRA 3A56A 3GTGB 1R4QB 2R93B 1SYGA 4PMCA 1T5XD 3P4PB 1TS4A 2YYZA 1MBYA 2MPMA 1YNNC 2A6ED 3ZJVA 5FOBB 2L11A 1HHVA 2KQ3A 3SFDB 4Q5VA 4X3SA 2JEBI 1SF0A 2SEBD 3MJ5A 3HOXB 2K6AA 5M5WB 3HS0C 4M0WA 4XE0A 3KUPA 2GI9A 1O80A 1VR9A 4TQ0A 3J9CA 3T16A 2PW5A 4H13C 1CT1D 3AM9A 3QG1A 3MVVA 3NXWA 2L1AA 5ISRA 1GB1A 1YN5A 5CV6A 3E6ZX 4QUFA 2WB1B 4K2LA 4Z9CB 2PYKA 2RSOA 3T56B 3W9CB 3V05A 4ZAIA 4TQUS 1WD1A 2K5PA 5LL6S 4NMZA 1WGKA 1LT5D 1BR9A 3EJIA 3TMEA 2JA8B 1JC7A 1GUNA 1KAAA 2EPBA 2BB6A 4RKLA 3KBGA 2Q8IB 5M3FB 3HG9A 1HA6A 4JK1C 3K59A 2KACA 2IT1A 2E2DC 1DGJA 3U2SC 1RDPD 2F0QA 1C79A 4A9AA 2JXTA 3A8IE 3FMCA 5J22A 1MSGA 1NAPA 2D5DA 3LWEA 1AN8A 1DCZA 5DM73 2DY7A 4KY6A 1N62A 2O4XA 3GTPB 2JE6I 3RMHA 2BT6A 2IPKD 4B0MA 2AQ1B 1JMLA 1NVID 4L63B 2B2WA 1ZXIA 3V96A 3VRBB 5CV8A 1SBBB 3EUB2 2EJGC 2W3RA 1AP0A 5KYIA 2KVMA 1NYQA 3A7AB 4CKCA 3ND9A 5EE9A 3Q69A 3L9AX 4NJCA 3VA5A 2N9LA 4FO2A 1L0XB 5C5MA 2KAJA 1OXTA 1BF4A 3OWFA 4FF1A 1GPXA 5HG2A 2R61A 3WOEA 2EDGA 3VYTA 4A3FB 2KJXA 5IIFA 2A68D 1YQ4B 5GXGB 1PTOB 4JWUC 1Z47A 3GS2A 2Y3AA 2CU3A 2NTTA 1O78A 2V4DA 2WDRB 4DA2A 1RCVD 1LABA 3EVQA 1PZJD 2QSDA 1DOLA 2XSCA 3FILA 2B2WC 2K01A 3HKZB 1OFFA 1JQYD 3QOLA 3BS1A 4OZCA 2PZTA 3ND8A 1FCLA 3SDZA 3T3NA 1M8AA 3G6JB 2XIWA 4L2YA 4DAYA 2V3PA 1D2BA 3NWSA 3TEXA 4X3KA 5ELBA 1PUTA 1TVXA 1SMYD 3S1NB 3D4WA 1HA5A 4KKIA 4WQMA 1B3AA 3P20A 3J80L 1STAA 1QOHA 3I8ZA 2K03A 5G3LF 1EEFD 1JQ4A 1BUIC 4CKEA 4H44C 3P4RB 2RKSA 3VR5A 5C4JB 2QEJC 4A6QA 1A2TA 4TMAB 3MHZA 4LMQD 3AE1B 4H7BA 3N9YC 3AB9A 5BMIA 1F9PA 4HCEA 1WTVA 3OHXC 2WV6D 5I6YA 2A6HC 3NVVA 1XX8A 5COYA 1JWAD 4OIJA 3KF8A 1STHA 3TP7A 5CBAE 1U4MA 4PT5A 1XCQL 2B63B 1I6HB 3NUCA 3VR3A 1KLGD 3MZ5A 5KGUA 4X3TA 3VYRA 2EY2A 2IGHA 1WYGA 2PMVA 2BA0A 2Q8TA 3D31A 4M1UB 2PZUA 3AEBB 2QMTA 3HOZB 3J80E 2CW0D 2I07B 4IUNA 3K5NA 1F2YA 1IBXA 5A2QL 3LB8C 2XRSD 1DJRD 1SIJA 3TP5A 3AMUA 3P42A 5EE0A 1QNUA 3V2TA 4RGTA 1TKGA 2ZXOA 2KEDA 5C3EB 3R8BA 5KIXA 3H94A 4LTUA 5EPLA 2H4OA 2Z8LA 2AUJD 2B8GA 3B2GA 3TP6A 3MHBA 2D9UA 2HQEA 2EVBA 3DEPA 3PV0A 5CORA 4WAFA 1EZ8A 1N60A 1SYCA 2AWOA 1EFID 5CV5A 4D2KA 1HTLD 2RVLA 3ONAB 1A6XA 3CU7A 1A3VA 1AW7A 5C5LA 2BYTA 1GXDC 5M3MB 2JZPA 1EWHA 1I4XA 2NN6I 4KY5A 2INPE 4PNYA 4AQ7A 3S1MB 5JAVA 1NCVA 3L3OC 1BBXC 2MJDA 5A2QE 1S5CD 1Z7TA 4JBWA 2JEAI 1G2SA 2WXKA 3U4EG 3ZYYX 2E2HB 1VDZA 3NQIA 4I7ZC 3QIAA 1N5XA 2QF7A 4ZHOA 2V0GA 2IL8A 4NKLA 4C3IB 1WCMB 3KBXA 3MXNA 1KDBA 1Q12A 5F2DA 1X32A 2XWJB 1TKEA 2SAKA 4J3OD 1UWMA 1E10A 2OT2A 3GTQB 1SSOA 4RA8A 3LYYA 1KH0A 1DOXA 1IGCA 4JX1C 4RH6A 2EYLA 1MI0A 4RF1A 2E3TA 1DOIA 2WXRA 2AWNA 1P7EA 2PKOA 3TSSA 5C44B 1PLFA 2WLBA 1Q3LA 4ZUIA 3TEWA 1F9QA 2LFNA 1K83B 4ID6A 3OIQA 2WQYB 3IT4B 3DHQA 2BS2B 1VCIA 3W5VB 3RD4A 1CQFA 1ZPSA 3VQIA 4A3IB 1SYFA 4MN3A 3A55A 1YJJA 2M00A 5I4DA 1EOTA 1ZOYB 1Q1EA 3S9WA 5NUCA 1JW9D 1TWGB 4DK1A 2LJIA 1SYEA 2F0HA 2F0UA 3SFEB 1C9FA 3GTOB 5D7GA 2VZKB 5E4WC 3SR1A 2HDLA 3PUYA 1Y8NB 1RHPA 1MVKA 3GTMB 1PRTC 3VR8B 3IXSA 4IUVA 1C77A 1VF7A 3P1HA 2JQRB 1LT6D 5ELCA 4GZYC 1EU3A 1ENAA 2KHSA 4K8JA 1B9MA 2W55A 3IL8A 1PMRA 1FFUA 2BBCA 4XQQA 1S5DD 1ZYRD 1WWTA 1YJIA 3GP7A 2F0SA 3I57A 3NBIA 3NSWA 3AEEB 1PDQA 3VA7A 4K5XA 3MTSA 3TEYA 2KN4A 2EY6A 1BOSA 2JA5B 1PRTF 3Q8EA 1YQ3B 3BDOA 3IAYA 2A6EC 1L0YB 1EY0A 4WIPA 5FO8B 2B2YA 1I4HA 4MH8A 3CIRB 1SFOB 4ZKCB 4KJOA 1IHZA 1CZWA 1A15A 3HUIA 3SK6A 1CM9A 1WTOA 1DOYA 3H0GB 2F0GA 3X3NA 2WU2B 3DUZA 3I4LA 5EPKA 2RSNA 2GRIA 1T5EA 1W6JA 1RWSA 2O5JC 4LAAA 1I4RA 2DYOA 2IDYA 2BOSA 3S1RB 3KLSX 2IGGA 1CHQD 1RD9D 5KEEA 4R8NA 4HMJA 5CYUA 3PO2B 2PQEA 1HUNA 1LO5D 2PMZB 5I9OA 5KYLA 4ZOHC 1R4PB 5MPOA 1AFPA 1PTOH 3K5LA 4K14A 3K0YA 1A2UA 2Y5PA 4HKQA 1B4OA 3HVDA 3NRZA 1TWHB 4XT3B 2A5HA 1XLOA 1UUPA 4JE3B 4H2AA 2DY8A 1SNDA 2LY7A 3IAS1 3J7AV 1L4DB 4C7YA 1XWEA 4XYOA 3NP8A 2EYHA 3PZ7A 2EYFA 1CTMA 3NPPA 1PZKD 2F0WA 3KWLA 1WTRA 4DNRB 2JA7B 2F0LA 2B39A 1C8CA 4ITKA 3PIO3 3VR9B 1CQVA 1CZPA 2NWGA 3OIPA 4B9WA 3FKIB 3K5OA 4BY1B 1K50A 2X6LA 5JPNC 4YTMB 1E6EB 3LX0A 3URYA 1B1ZA 5E1FA 3MXGA 3FDTA 2BS4B 3M7GA 1OXVA 1QWYA 1PGBA 1G6ZA 4FXDA 2L55A 2PNRC 1VZ6A 2RBMA 2C9OA 1H9MA 2PTLA 1ZUD2 5FK9C 4NZLB 4RGNA 5EJWA 3LWUA 2QIEB 3U7ZA 4TQ1A 2F0KA 1BDOA 1J9OA 1FFVA 2TMPA 4EGVA 3J7YW 1PFMA 1EL0A 2A68C 5IOCA 5T8IA 2VB2X 3D4DA 2DBYA 2L52A 1KF6B 1IW7D 3Q6SA 1GUSA 2EXZA 2L12A 2HTME 4E6IA 1ICWA 5I2YA 3C8YA 4N9PA 4Q0FA 3BIID 3VRAB 2H1EA 4A3MB 4IALA 1PRTB 2EE1A 5IT9L 4CKBA 2W3SA 1PFDA 3C1FA 1G291 1SMYC 4Q2JA 3QOJA 3RZOB 3SXHA 1HZ5A 1A3UA 1ZKOA 1AWDA 4HROA 3A7LA 3C1EA 1C78A 2QILA 5BN3A 1X3PA 1V1PB 3D4RA 3ZJUA 4HTHA 2BCOA 4US8A 1QOAA 2KCCA 2WKDA 1EY5A 3I90A 2HDMA 5C4HA 5CC4A 4XQNA 3TUOA 2PVGC 3N52A 4RHSA 1FEHA 2JYTA 5EBCA 2JWUA 5ELFA 3SE0A 3GD7A 1BQQT 1L4ZB 3BDLA 2FMCA 5CBEE 3K5MA 3S2DB 5DM63 4L1BA 3C46A 3VR6A 1F2LA 2DYMA 2F0EA 4L23A 2PPBC 4G7ZC 1IKLA 2EYPA 2B2VC 1SDFA 4BS9A 1D5XC 5IT9E 1B9NA 3AEDB 2LHDA 2D62A 3E5SA 1FIQA 4ILWA 1EQTA 3Q8FA 1MGSA 1EQVA 1LV9A 2J52A 1SJED 1WTWA 3NQTA 4ZRZA 1EEID 2CW0C 2NVYB 2L83A 1E2VA 2D2CC 3PO3B 3HVZA 1FNWA 4BA2I 3SR6A 4NP5A 3U9OA 4USAA 2R6GA 1IYUA 1Y1VB 1ROEA 3NWTA 2B2UA 5D3IB 1PDXA 1CI3M 2PZWA 3DWAA 3K58A 2FINB 4YXDB 2JXMB 5FO9B 1SAPA 4ODGA 3ZQ4A 5BMHA 4BBRB 4DXGA 1ZXTA 2JSOA 4RHRA 1W6KA 3I70A 2A69D 4PV1C 2WXQA 1SE4A 5IGGA 4HSVA