1T5XD

Hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A Polymorphic Pocket at the P10 Position Contributes to Peptide Binding Specificity in Class II MHC Proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1t5xD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1t5xD02
1KLUD 1LT6D 1PZKD 1RF2D 1CT1D 1XXGA 3TSSA 3BVZA 4DXFA 3GP7A 1L0YB 1JWUD 2IPKD 1S5FD 1TY0A 5ELCA 1FNVA 3BVMA 1TS3A 3MC0B 3W2DA 2SEBD 1HQRD 5FK9C 4RGNA 2RDGA 1CQVA 3BZDB 4OHJA 1RCVD 3BYTB 1BCPB 1EWCA 2IJ0A 4RHSA 1PTOD 1PTOC 2NTSA 1CK1A 1PTOF 2RDHA 1LTSD 4RGMA 3R2TA 4TSSA 1YN3A 1TS4A 2J4XA 1STEA 1XTCD 1I4HA 1BXTA 1LTBD 3DWPA 1SEBD 1PRTB 1V1PA 1I4RA 1TS2A 2TSSA 1ET6A 1SJHD 2XNAC 1SXTA 1FGBD 1LTRD 1SE3A 4RHRA 1I4GA 5ELBA 1S5ED 1I4XA 1AW7A 1YN4A 1B1ZA 1S5CD 2AQ1B 1EFID 1KLGD 1HTLD 2QILA 4O1NA 1LTID 3KLSX 5D3DA 1JR0D 1LLRD 1V1OA 5ELDA 1YN5A 3EFXD 1FD7D 2AQ3B 3MFGA 4RGTA 1EEFD 1QILA 1PZID 1LTGD 2CHBD 4C56C 1DYQA 4BWGB 3OWEB 1CHQD 3SEBA 1D5XC 5FKAC 1LT4D 5ELFA 1FNWA 1EEID 3V05A 2WV6D 1AN8A 4DXGA 2G9HD 1PYWD 4L6TB 3R8BA 1DJRD 1PTOB 1I4QA 1RDPD 4UDUC 1RD9D 1JWMD 1S5DD 1PTOH 1D5ZC 2XRSD 1G8ZD 1LTTD 1TS5A 1LTAD 2AQ2B 1BCPD 1T5XD 5D3IB 1BCPC 2NTTA 1EU4A 1BCPF 1I4PA 1SBBB 1ET9A 1MD2D 2Z8LA 3EA6A 1LT5D 1D5MC 1B44D 1UUPA 1UNSA 1SE4A 4RGOS 1HXYD 1KTKA 5I4DA 4RFBA 4RCOA 1HA5A 4Z9CB 1LO5D 4ZYSA 1JQYD 1JWSD 2ICIA 3R2IA 2R61A 1PZJD 1JCKB 1PRTD 4L63B 1PRTC 4K6LA 1PRTF 3BYYB 4NZLB 1FNUA 3BVGA 1ENFA 1S5BD 3CHBD 3DWAA 2QEJC 1F77A 5TSSA 3URYA 1ESFA 1SE2A 1L0XB 3DWQA 4RH6A 2O2LD 1GOZA 1LT3D 1TY2A 1EU3A 2XRQD 5ELEA 1M4VA 3O13A 1D6EC 1CHPD 1V1PB 2XN9C 1SJED
chains in the Genus database with same CATH superfamily
4EFOA 2N7JA 5J1ZA 2WXPA 3GQBA 1KIXA 5JJIA 2YEPF 2EXZA 1T5EA 2C7HA 2RVLA 4I6PA 2B63H 1LTLA 2A6HD 1FXTB 2Y5CA 3C46A 1L7YA 3BZKA 3ULPA 1GO3E 3CP0A 4FXKC 1C4AA 3ZKJC 1WVLA 4DV6Q 2IO0B 1XNQL 4XXEA 1VQEA 4HRSA 1MJEA 1XT9B 2KWDA 1DD2A 2QKIC 2WKDA 4HIDA 4B3SL 4DQOC 5J39A 1GUAB 2JZPA 4ICUA 5BYSA 1N36Q 3ZRFA 4GS3A 4DR7Q 1Q7YC 2HE7A 4IJHA 3FRPB 2EY1A 1WE6A 2MRPA 3KUCB 1TS4A 2KECA 3R93A 1C79A 1STEA 3D6CA 3HRDD 3M63B 3HOXG 5JVG3 3A4RA 2J7ZA 4L5TA 5D94A 2DZKA 1XX8A 4OELB 3DWGC 1FGBD 1SE3A 2KCNA 4FDBA 4KJNA 1WXSA 2M1MA 3ZDMC 3AEEB 4OX9L 4HEA1 1TYGB 3TZUA 1Q10A 5T1GA 3I91A 1JMCA 4NXML 2Q2IA 3GTKH 2FBWB 2ZZPB 4DV2Q 3KDFA 2QILA 4X3SA 2BYEA 5HGQA 3S1QH 1KFYB 1LTID 4GIVA 4WAAA 1EIFA 1MSGA 2LXJA 4QF4A 3KWVA 2CHZA 1B8AA 1FGUA 1PVOA 4JI2Q 2LXCA 3I57A 4XYCA 3W1SA 3CQZB 4BBSB 4M8AA 1T0RC 3SDZA 2WXKA 4M02A 3GTJB 1FD6A 4MEMA 1SROA 3PUYA 2PKOA 1B9NA 2XIWA 2REXA 3RCZA 3PO2G 3P75A 4GDLB 5IWAL 3I7FA 4GOCA 3PUVA 1JE5A 3AB5A 1YNNC 3ULLA 1X3PA 3SGIA 3PZ7A 1AN8A 2G9HD 5ELNA 5IYCG 1HZ5A 2G1EA 2JSVX 3DBHB 4G7HC 1VQKA 1P3QU 1WYWB 3VDYA 3PF5A 1IW7D 1J8IA 3L10B 2MJ3A 1K3RA 2E74C 1X3GA 2F0QA 2Q8TA 1E3PA 2KMMA 3QA8A 2OXPA 3ZJVA 3HHMA 3LXFA 5J2RA 1M90C 2EYMA 2NTTA 4FJZA 2NBVB 1YJ1A 2EKIA 3CU7A 4HMJA 1OQRA 1ONLA 1UNSA 2R6GA 3J80c 4JI0Q 2L32A 2F0VA 3SK8A 1MI0A 2LVPA 3T53B 1XCTL 1U4PA 3WA0A 1ASYA 2DNFA 1PH7A 1ROEA 5GAGC 1EQVA 4JI5Q 4K6LA 4KHZA 1UD7A 2BYTA 1FJGL 2G4SA 3H7PB 3G71A 3QHTA 3UDGA 4US9A 1BO0A 2E75C 2CW0D 1WJNA 4JVZA 3VA7A 4KX6B 5HHDG 1EOTA 3NTKA 4HJGE 5CV8A 4YY3Q 2V1CC 1AEXA 3TMPB 1JJ2A 3ICEA 3SHQA 5IODA 2JXMB 4RKLA 1GOZA 4NQLB 4CQNA 2PPHA 1BF4A 3AE6B 1UE6A 5IY0A 2XRQD 1DOXA 4Y7NB 4JBJA 2NZHA 3I72A 2XN9C 5CV9A 3ZJUA 3NXWA 3AE1B 1PZKD 2I1KA 4ZRJA 1E8ZA 1R4NB 5C3EB 2NBFA 2IPKD 4ZLTF 2D3CA 1P98A 4MGZE 2VH1A 4NAWA 5G2NA 5L83A 4R9WA 3DOWA 2LHDA 1QB5D 4OWXB 1QVFA 2V4IB 4FHKA 2L4NA 4C3HG 2D9UA 4KD3A 3SE0A 1TKEA 4MM3B 2RHSB 3RNAC 3L0WB 3CCJA 4OHJA 2A69D 1Y1WB 1GD7A 4B0EA 2IJ0A 2DZJA 1WH3A 3ZTDA 3HOUG 3GD7A 1YX6B 4JK1C 1U9RA 2B2TA 1UEBA 4DV0L 3H15A 2KDFB 2R7FA 1BVSA 5JEAH 4DK6C 4IUUA 2NBUA 3VR4A 5DNFA 4LDTD 3MEHA 1OXSC 1IKMA 4A3EH 4RWSC 1C0AA 4C2MH 1GAQB 2I5LX 2PZWA 2Q2HA 3FHWA 1RRBA 2ONQA 3L54A 3NQIA 2XNAC 2KOXA 1VS0A 4H13C 1KAWA 4ZUIA 1WTVA 3GTMB 1LM8B 3K7AH 2EMTA 2IX0A 3M3JA 1BKBA 4WH4A 4E74A 2FINB 5C2TB 1XF5L 3TS2A 4IN3A 4KY7A 3L08A 5C4HA 1HH2P 1V1OA 1YMHE 1YJNA 2V3SA 3M7GA 4A3DB 2N4FA 2W82A 4F1SA 4LFBL 2C35B 2B2TC 4K5XA 4JIOU 4BY1B 1MSHA 1WXQA 4QAYA 1CJEA 5ISRA 1H9KA 3NS1A 2KCCA 1A0IA 2Y0SE 4KN7C 3SEBA 4K0KQ 2WB1G 1SMXA 3TP8A 4DV7L 3HOUB 1HR0W 1IL2A 1VLBA 1QF6A 2KAJA 2BKRB 3KBGA 5CC4A 4J15A 2Z9HA 2E5LQ 2IY5B 5DLQE 4MSQB 1SF0A 2GA4B 1F0ZA 4HWIB 4C1NI 5M5XH 4OO1H 1MHHE 2MUYA 3V60A 3TCAA 3Q69A 4P74A 4PZ8A 4R4CA 2VNUD 3OMGA 2L55A 2DYOA 2EZVA 1EU4A 2FFKB 2N8NA 1V2YA 2BDNA 1ZW7A 4BY7G 2UU7A 4JI8Q 1D5MC 4BKSA 2CH4A 3S1MH 3ONSA 5EE1A 3PSIA 4L8JA 3AE9B 3D32A 2BVCA 4ZYNA 3GOEA 4FJYA 4W9LA 2FCQA 3HM6X 3R2IA 3AEGB 3M9BA 4ZKBB 3U7DA 1VQ6A 1HTOA 4C3IH 5IYDG 1HNXQ 2AYOB 2TMPA 2Z0EB 1FNUA 4WJQA 4X57B 5AUKA 3W5UB 1RAXA 3A9JA 4TQ1A 3VXWA 2G45B 2E2JH 1Q5WB 4FF4A 2WGSA 1NI3A 5L95C 4DAPA 3J81c 2NVQB 1FVIA 5EBDA 3AU7A 3OHXC 1HR0Q 4DBGA 5J18A 3A8JE 3RLOA 5M3FH 4GNXA 1LFDA 3OPOA 3H3VH 3GTLB 1UWMA 3C1FA 3GP7A 3BY4B 4NJ7A 3F2UA 3NBIA 4K5WA 5KYLA 2INCC 4HAEA 1S5FD 1TY0A 2X6LA 3RD2A 3E9SA 3GTPH 1KD1C 1GB4A 1W6KA 2MQJA 4W9HA 4O42A 3STBD 4BY7B 1CQVA 1CSPA 4DAYA 1OQQA 4TQ0A 3DM3A 4W9IA 3T3NA 3MHSD 1BCPB 3HOVG 2OHFA 3DDCB 1BBWA 1NY4A 2N9LA 3RNBC 1PTOD 1HTQA 1C78A 4GDKB 3T1HL 3S14B 1I50H 4A93G 2F4VQ 4JPSA 4XDXA 3A56A 2F0PA 3H94A 3DEOA 4RGMA 3T56B 1OXTA 2ZXOA 4NJCA 3FVQA 4HSPA 1XTCD 5JJLA 3RUIB 2VQFQ 5JJZA 2BKFA 4KDLB 4NKLA 1SEBD 2F0OA 3KUPA 3C1EA 2JA5B 2MPMA 4YHHQ 4JI7Q 2JA6B 1B70B 1CTMA 1ZPSA 1F2RI 2KANA 4H2AA 3NSWA 4DR6L 4A3PA 4N9TA 4NPNA 1QZHA 3L13A 1AW7A 3SK6A 2DYMA 3NY5A 1RJTA 3CF6E 3JSVB 3NHEB 4FXCA 1ZEQX 5E6PA 2LUEA 2WXLA 1VQFA 4A3JH 3S16H 4DUZQ 2FJ2A 4WJ4A 2A19A 3EFUA 1KXLA 1RFAA 2UUCL 2D2QA 2RDBC 1XNRL 4CDEC 2LZ6A 2MFIA 3PIPA 1SNCA 3MXUA 4M1UB 2JU6X 2DX5B 4BOZB 3R7RA 1L1OA 3OOCA 2K5DA 3ZJTA 3FILB 4LFCL 5GADC 4K1RB 3DBRI 3J7AF 3HOYH 2BWES 1YIJA 4A3BG 1D5XC 4DK3C 1AP0A 2FCNA 2Z1CA 1LXDA 4WWOA 1EYCA 4B95A 1TWCH 3SK4A 2DUDA 4CDFC 4ZHPA 4C1NK 2NVXB 5C3JB 3Q3JA 1E7VA 3QIJA 3BWUD 1PDXA 2UWQA 2K50A 1IUEA 2XWJB 1NR2A 1JICA 3M3YH 4AQYL 1VF5C 5C5LA 1N33Q 2FCSA 3HOWG 3MXGA 3T1YQ 1IBLL 1I3QB 1FFUA 4A76A 2B29A 4IKGA 1IBKQ 2QGQA 4PMBA 1S72A 2KHIA 3TS0A 1V81A 4ALPA 3EA6A 5JXVA 2K52A 1ZOYB 1IYVA 1L1OC 1G91A 1SE8A 1NI2A 3DVNU 1HZ9A 3IVFA 4NXNQ 2YTVA 3ITPA 3AE4B 2R61A 2R7ZG 1MHXA 4LF8L 4IALA 3T4AC 3U4VA 2WXIA 3SK5A 2F0GA 1S5BD 3UGBB 5EBCA 1SB3C 2WINB 3VTUA 4A3BB 2B2YC 2NPTA 1L0WA 1TXYA 2VXWA 4URKA 2R92H 3ZVVA 2LRWA 3E0JA 4EQPA 4DNTB 4B3RQ 2QIEB 3DBHI 3ZQ4A 4A6QA 3U58A 5KRUA 2LUMA 1N5WA 1N60A 2F0UA 2N49A 5ELEA 4DR2Q 4KKSA 3TN2A 1B3AA 3EGRA 4P1BC 2JA8B 3GTOH 2OJRA 1CT1D 3NVWA 4PYUA 3BVZA 3RMKC 3OTOL 3HRZC 4A3IG 2Z6KA 4FF1A 1WD0A 3T3OA 1Q12A 3I9V1 2ZNVC 3CKIB 1RODA 2G9DA 3A5UA 2A68D 1WJ4A 1HEZE 3AE5B 2PVGC 2VRRB 3G48A 1VQLA 4JI4Q 4DV5Q 1U4AA 2Y0SB 4X66Q 3CF5A 2L83A 4LF6L 3T9LA 2WXQA 2E2DC 4CJ2C 3N9YC 3IG3A 3A7AB 3RLFA 2MBOA 4LF7L 2R7ZB 4KY6A 3WANA 4B6WA 1O80A 3L9AX 5C1ZA 4IUTA 4UP7A 1XLQA 2AWNA 4A20A 2L7RA 2B8FA 3S15H 2WWZA 3JAMc 1Z7TA 2XWBB 3RZDB 1PRTB 2WU2B 1I4RA 1TS2A 2TSSA 2GBMA 2H4OA 3HG9A 2A5UA 2BB5A 2JZZA 2CR5A 3HGBA 3QC8B 3RN2A 3V2TA 1JJCB 3K8AA 3L3OC 5ELBA 2Z6KC 4DHZE 1MGSA 3NS8A 2NVTB 2L05A 2RKSA 1YZ6A 1ZYRD 1QNKA 2DHZA 2WP9B 4ARCA 1HTLD 5K36G 1VQIA 4KN4C 2Q8IB 1HZ6A 1XMQQ 1N61A 4IWOA 4TUUA 4JLCA 2K28A 2C5CA 4A3IB 4GXBA 1I6HB 1NSNS 4KV6A 1ZXIA 1SIJA 4YCUA 5KNDA 3H0GG 4LK1C 3VFKA 2JN4A 3MHZA 2PMVA 1Q8IA 4O0AA 1F9QA 1XLPA 1R7SA 1KRSA 1AFPA 2VB2X 3NHHA 5C4ZA 4DV3L 4HJ8A 3F1ZA 2NVYB 1NJIC 2I5HA 1WTWA 4KHPQ 1PUTA 2N7EA 5CGKA 2JEAI 4HJ9A 4GDLA 3NG0A 1SLJA 4A3GH 3AN1A 3PREA 4HKQA 2RSNA 3UI3A 1KAAA 3U4ZA 1V8CA 5IO9A 1L4ZB 4UDUC 3S2DB 3ZNID 1BQQT 1WR6E 1JWMD 2FMCA 3EJIA 3KQ4A 3OIQA 4RM8A 3CSTA 3MXNB 3PGZA 3B9JA 5C4JH 4EOYA 5D3IB 2SDFA 2ES2A 3LX0A 3RULA 3UF8A 3UIPB 1TWGB 2VS1A 1YHAA 3A54A 4HMIA 4DV6L 1CSQA 3KWLA 4WJOA 3WAPA 3Q23A 1B44D 1PA6A 1JRUA 4PYZA 5C0XH 1J6QA 5G3LD 1K52A 3B1LX 1GJZA 1N36L 3HEJA 4DR7L 1NUCA 1EOVA 2ZCCA 5CV4A 4A3FG 4N59A 1SNQA 2IGDA 1GPXA 3T51B 4BBRB 2N1WA 4LW1A 2VZKD 1E22A 2JQRB 4NZLB 4NB3A 5CTRC 2MQHA 2MJEA 2LMCB 4Q0FA 3H7PA 4R1JA 5JOBA 3U9SA 1R9TH 2H88B 5AZHA 4AYBE 5TSSA 1A3VA 3URYA 3D8GA 1VZ6A 4QGUA 4P75A 2ZJRA 1PYBA 1ZDXA 3RI7C 4ZHOA 1NTGA 4YXDB 4JPBW 4DV2L 1FMAD 4HCPB 4KDIC 3V3XA 3UIOB 1D6EC 3FKIB 4TRDA 2KX0A 4UHVA 3Q8DA 3PS6A 5COYA 4JI2L 1IP9A 4B9WA 3KLWA 4PG3A 1ISNA 2WIIB 2GMIC 1ACCA 3L2PA 4S3SA 1G6ZA 4LNOA 4FP5D 3CRKC 2OWOA 4BAXA 3VYRA 4GLVB 1K8AC 1UH6A 2MHVA 3U4EG 4MHEA 1WX8A 3DBLI 3QK0A 1RKNA 4IOIE 4ILWA 1EWCA 4PZ7A 4MDKE 4NQKE 1WXMA 2ZTDA 2WS3B 5BN5A 5C4XG 3S24A 4REZA 2IX1A 2ZVOA 3SU8X 1BXTA 2I1JA 2FAZA 3CPFA 1N6ZA 4JE3B 3Q6SA 3IHPC 4A75A 2JE6I 1CI3M 4K2KA 1ZKHA 3W1YA 4R8IA 1Y1VG 4JCVE 1CKMA 2UUAQ 1GHKA 1WJ6A 3RR5A 3AB9A 2KJRA 4TKNA 1S3SG 1XYIA 4JI0L 1ZDVA 2WXHA 2IDYA 1Y8OB 3UE1A 1KF6B 2P5ZX 1X3EA 3J7ZC 3AMZA 5H1SE 3PZ8A 3IL8A 4JI5L 4B9KA 2F0HA 4GN4B 4PS8A 3I8ZA 4EQ5A 1YIWA 4CDCC 2PNRC 4QJFA 3CCRA 1XPRA 3IRBA 1V49A 2KQSA 3N32A 2JWZA 1MBYA 3I90A 2CHBD 3PF4A 4YY3L 2J0JA 5IA7A 3S1RH 2PW7A 2Q5WD 1NCVA 4ME5A 3QQ8B 1VQ5A 5JZEB 2E6XA 1B3QA 5BMGA 1EUVB 2MP2B 1OXXK 1C48A 4GLXA 3NZUA 4OZCA 1YNND 5EKIA 5GMVA 1WGGA 1BR9A 5E4WC 4MH8A 5FLMH 5C44G 2JA7H 1I4QA 3G6JB 1EWYC 2KEDA 3MFYA 2KX3A 1OTRB 3NZSA 1RD9D 1SYDA 1GB1A 4XQNA 1IKLA 1YD8U 3VR2A 3NWTA 4LDTB 3I4MH 3VUWA 2AQ2B 3E56A 3A7LA 1JB3A 4C3JG 1AZPA 2W3SA 3ABVB 3EIVA 2NWGA 4TVAB 3N1YC 3NVZA 3Q3NC 1HPCA 3E9IA 3R66C 1H9RA 4DDGD 1E8WA 1CUKA 1E7PB 3NBHA 2B63B 2MLBA 1EF1A 5D7GA 1FYCA 4QMGA 4ABNA 1LO5D 2WQYB 4HDQA 4KVGB 4BVUC 2F0FA 2KDBA 4HR7B 3PO3H 1VQ7A 5JHAA 4C7ZA 4ZRPA 1JOQA 3FC4A 3S1NH 1TWFH 1VQDA 3KLRA 2YV5A 1YVCA 4G4KA 3Q6BA 3I3TB 1WJJA 2KQ3A 3SR1A 1V5TA 3J7AV 4DHZB 1F9JA 4EZJA 3WWVA 2ENBA 3HKZG 2AX5A 3Q8EA 5LMUQ 1WE7A 1HQMC 2NCNA 4XT1B 4KKTA 3LB8C 2XK5A 5C44B 3K9PB 4XIGS 3K59A 1KABA 2WAQE 2K5QA 4K14A 3CMEA 3GTKB 5ELCA 4A3KH 3S1QB 2PI2E 4MT5A 4C3JB 1O7ZA 3CD6A 2GVBA 4KY5A 4ULLA 2ZVNA 5GROA 2VUMH 2IT1A 5CV5A 1X3FA 2JWUA 3L7ZC 2MEKA 2A73B 3BZDB 1K9MC 4K0KL 1JMLA 2N9PC 3BYTB 1NMFA 2WDVB 3DMUA 1EWIA 2JEBI 4MIUA 2B39A 4YSXB 2KHSA 3ZLZA 4GDKA 3ECIA 2E5LL 5IP7G 1TBEA 2CJNA 3R2TA 4DGZA 1STAA 4BA1I 4A3LH 4BOSC 4R4TA 3X3MA 2I38A 3U2SC 2K6AA 2D3AA 5E4XA 2PW5A 4JC0A 1QOAA 2JYOA 2D07B 2ZW0A 5I9OA 1VQMA 1C9FA 1DCZA 2LEKA 2D62A 4EQOA 3F2BA 1P7EA 4BBSG 4RKBA 5HI1A 3HKZB 1JOKA 4LFAQ 4JI8L 4LF9Q 4RMAA 2R93H 3TP7A 3KVFB 1SSOA 1JT8A 3HZXA 3Q22A 1CKNB 5IOCA 2ICEC 2M8SA 3A9KB 5G5GA 4PMWA 4J3OD 4XX5A 3EC8A 3WDNA 2EY6A 3K7UC 2W54A 2LGIA 2N55A 3MFGA 3DBRB 1GJXA 1T6BX 1HNXL 2KDEB 2JPHA 4AYBB 5M3MH 4C56C 2B2WC 2O2VA 1K53A 5CYUA 1YHQA 4II3B 3OWEB 4W9JA 5NUCA 2M19A 3FILA 2A1AA 2OEDA 1V1QA 1QLBB 1X6OA 4IG7B 2DAFA 5E1FA 1HR0L 2K8BA 3UQBA 3R3MA 5C6AA 5J17A 1E2WA 1VQHA 2H5XA 2PQAB 1E6EB 4M8NA 1A62A 1PTOB 2F0EA 1LV9A 2MWSB 2NS5A 1RDPD 3TBIB 3CSFA 2WXGA 5HG2A 5I2XA 4EEWA 1A3TA 1A63A 3MWYW 2F3WA 3GTGH 1BBUA 1SNMA 1UF0A 5IP9H 2GN5A 4HJAA 2MO1A 2ACZB 4RF1A 3Q8FA 4X62Q 1UBQA 1SBBB 2IHEA 1ET9A 4X65Q 1K73C 1F9PA 1LT5D 4RCNA 5JEAJ 1YJWA 3KF8B 4RGOS 3M95A 2BH8A 4KKIA 2DJFC 2V0GA 2F4VL 2MH7A 2CU1A 4IDIA 1WMHA 5EDSA 1WRIA 4JI6Q 5AZGA 2UXCQ 1A2UA 1D4BA 4DDID 1UE7A 2EIFA 2NN6I 3QWZB 4WJWA 3BYYB 4XT3B 3F2DA 2VQFL 4IFDH 1PDQA 4W9KA 2HQEA 4KD4A 4JI7L 3NPPA 4YHHL 4WQMA 1EZ8A 2BWFA 2N7DA 3E0EA 1A70A 3C0RB 1SE2A 5C3EG 3TEXA 5EQ0A 3KUDB 4C2MB 3EQLC 1FPYA 1SNPA 4WWPA 2YTYA 1IYJB 2JX5A 1SRUA 4DUZL 4KSKC 2KC2A 2LFIA 1Z6HA 2PO4A 3OWFA 2L0TA 3BK2A 3RNCC 3K7AB 1WWTA 2NUCA 1Y1WG 3I4NG 1WGKA 4TKOB 2ASQA 5CMDA 5GAEC 4OWWB 4ZCKA 3VVWB 4EZKA 1W3SA 2EPBA 3ALBA 3H9DA 3LGJA 2D3BA 4XQJA 2BOSA 2KTRB 4RGNA 3P4PB 4W9FA 5IYBG 3ZO5B 4OXPA 2G3QB 1DOKA 3EFCA 1SDFA 4IUPA 4JBWA 1WJUA 1DZ1A 2WKCA 2UUBQ 2LGYA 3PMFA 1OEYJ 4XWTA 1I35A 5HKHA 1Z47A 4F7ZA 1SGHA 3O65B 4L23A 3P2BA 1QUQB 4UPAA 5M5WB 4G0NB 4IUMB 5C23A 2J4XA 1XQQA 2KMCA 2QJLA 1N33L 1HUMA 4IQZA 4MJSB 1SYGA 3T1YL 5IT9c 4IPDA 3WOFA 1KRHA 4LUOA 2QHOA 2JYEA 1D2BA 2L76A 3WIMA 4R3DA 1IBKL 3B2FA 3CCMA 4OZBA 4A3DG 4J8QA 1EY8A 2L1BA 2CS4A 2N1VA 3FKYA 4PS7A 1NNXA 3EROA 1GUSA 3QOJA 3U50C 5M5YH 5M5XB 1UZXB 3HIZA 2WU5B 3KYDD 3SDLC 5IKCM 1RM6C 3K6OA 1ZKOA 4BY1G 2Z4HA 2RQXA 4X3UA 1VQ9A 2KJ6A 4NXNL 5T8IA 3I4NB 1GUWA 5E7NA 2UXBQ 2LSSA 3PIOA 2LGSA 1PFSA 3OJ3A 4HCEA 3S1MB 3OG5A 4YTNB 3P4SB 4F88A 1PZID 4XYOA 4I7AA 4H02A 3D4WA 2Z0DB 4LNKA 1VQPA 2D11A 4JOIA 3GTJH 2PEAA 4JWUC 1N32Q 4B3RL 3DVGY 4DK0A 4X64Q 1WTXA 1JE4A 1NENB 1VDZA 2DWQA 2AUKA 4LJZC 4WRDA 2WV6D 4DR2L 3LWUA 3I73A 2WAQB 2E2JB 1SE9A 3APDA 3JW0X 2W9NA 2RSUA 4A4IA 3RZOH 2BPSA 4L2YA 4FXGC 3RNEC 2W55A 3H09A 3BDCA 1L4DB 3NE5B 4KKUA 3HOXH 1TS5A 2K5HA 4JI4L 4DV5L 4X66L 2E2IH 1FCLA 2V4LA 1BCPF 3NELA 1KLVA 2KHJA 3D4DA 4KTAA 1GXDC 4CGYB 3P1MA 2VQEQ 4ZRQA 1KTKA 2RCNA 1BBXC 3KF6A 4BFRA 3MTSA 3CCLA 5CV7A 4D2KA 2ZT9C 5LMNW 4LAAA 1UE5A 3VH3B 1II3A 4DN4M 4JOIC 1J19A 1EY5A 2BBCA 2NVUI 1L2NA 1PZJD 1TTNA 4JV5Q 1YJIA 3DVNV 2F0IA 2OOBB 1C1YB 2HHHQ 3AECB 1K8MA 3OJ4B 2IGGA 1MG4A 4HCNB 1U5KA 1ENFA 1I50B 2K5WA 4KI0A 3BK1A 2IO2B 4CKBA 4G7OC 2LMCA 5AUIA 4MACA 5DPWA 2E2HH 4NAMA 3DWQA 1I94Q 2EYHA 4RH6A 2L5TA 4AJYB 3V6CB 1J9OA 2ZTCA 1D1IA 3OSOA 3PO2H 3S17H 4OIKA 2F3VA 4MH0E 1G291 3O13A 4GN5A 1V1PB 1XMQL 5EGTA 4MSMB 4WURA 3MJ5A 3TBLD 1QVGA 2H89B 2B2VA 5IYCH 2AKWB 1LACA 3TSSA 4DNRB 1VZ8A 3DQVA 2OQKA 2KCTA 4MELA 3DBLB 4FA6A 4WAFA 5FJ8G 4K6DA 1TS3A 4A3JB 1N34Q 1G6PA 3RNUA 3S16B 2KKCA 3AE2B 3EHVA 4KK7A 3PLUA 1KNAA 3P7JA 2KD0A 3CC7A 5EPKA 3MAQA 4GOPB 4KHPL 2CU3A 2PMZE 1C8CA 5FOBB 2MSED 3AE8B 3P1HA 2LS01 1VCBA 2EKEC 4I7ZC 2JA5G 2R2OA 2JA6G 3AV8A 3GTQH 2VH2A 4FLHA 1CK1A 4MTNA 5LMNQ 4LWCA 1H9SB 1IBXA 4USAA 1IXRA 4DR3Q 1YN3A 4IWQA 2IHFA 1H8CA 2PW9A 4FXDA 1HFNA 1TWCB 2L9HA 2RGFA 2NMQA 1F1HA 3RD4A 5ELOA 1ET6A 2VZKB 1XPUA 1FO4A 3BJUA 1HRJA 4C4VB 3P4QB 1I4GA 2N88A 1I4XA 2KYWA 3M3YB 2MW5A 2ATWA 5FO7B 4HPLB 5T1IA 2ZXRA 3I5JC 1Y14B 3AULA 4A3CG 3AYHB 1LLRD 1WTHA 3I2ZA 4KZ0A 2DYBA 3FPUB 3SFEB 3IT6B 2GOWA 2Z0SA 4OZAA 2XTIA 5FO8B 3NJTA 1ZUD2 4XE0A 4KJOA 3MC9A 3SVMA 3W5OA 3QOLA 4IC7B 1E0ZA 3TIXA 2KK8A 3UI2A 2IY1B 4KIKB 1IGDA 3C3LA 3HOZG 1HE8A 4C3HH 2D3GA 4DF7A 4AH6A 4GNXC 2GBRA 2OJWA 1EIGA 4GN3B 2DBYA 4GB9A 1KDBA 1XLOA 3CCVA 3MP9A 2D0OA 2MP2A 1YQBA 3NZ3A 2BCOA 3RPFC 1TR5A 4EZLA 3HOUH 2RBMA 4FN2A 2BA0A 3VR8B 2WXJA 2WFWA 1CZPA 1K0SA 1OXUA 1X1MA 3A0JA 4DWFA 2LXAA 1S5DD 2G5DA 1D5ZC 3EN2A 4F87A 1EY9A 3A33B 2ZTEA 2K5NA 2CWPA 3PO0A 1B9MA 2AWOA 2IWHA 1G2SA 1J5EQ 3J80L 2BGFA 1EIYB 2DENB 1HXYD 5I4DA 3M85A 4RFBA 2FHTA 1BT0A 1ILQA 2K1BA 1JJGA 1EM7A 1XD3B 4HIOA 2K3UA 1MVKA 1E10A 2CVRA 2K32A 4XQQA 2RF4A 1S4ZA 5KNCA 5CBAE 5CHFA 1PRTF 5CHWA 4HPMB 4M00A 1MFWA 5LXIB 3IFTA 2KJXA 1HZBA 3CHBD 4BS9A 4ZKCB 2JA8G 2KVZA 1EUJA 5LHY1 3HOZB 3LYYA 1K51A 2UUAL 3PV0A 3AQQA 3S2HB 2X8XX 4G50A 5E6OA 3PTFC 1WCMG 3EVQA 1YEZA 1TY2A 4YT0B 3VA5A 2K39A 4DV4Q 2NVQH 1EO6A 2Y0SG 1SAPA 2GVAA 1L0VB 5D6JB 5IAAC 3J80E 4JGHB 3MTNB 2O6VD 3MA2B 4ZQ3A 4RAUC 1P1AA 2B3GA 4EKUA 2BDOA 3GTLH 2G4DB 2D5DA 2BH2A 2L52A 5DM63 4DXAB 4RA8A 1WX9A 3W5VB 5I9PA 4FHJA 4S0RA 1RIPA 2BA1A 3E9HA 5H8YE 2I2YA 4BY7H 1PGXA 1F2LA 4RHSA 2WX1A 3A1QB 1QCBD 2NTSA 2N0SB 4F8MA 4II2B 3CXCA 2EY5A 3R3OA 1FXAA 1HCZA 2N9XA 4XWWA 1K83H 3S14H 1VJKA 3PVLA 1TWHB 1LTBD 2F0KA 1Z5SB 2CJOA 3I4OA 3VTWA 3J81j 1E2ZA 5IYDH 3AEDB 3TREA 5DAUA 2IZVB 3QO2A 5C0XJ 5E6JA 1UWXA 4IPHA 1SMYC 4CKCA 1WCMB 3ZYYX 1NBWA 1PXUA 2PPBC 1TWAH 2HDMA 3KK7A 1VDVA 5D65A 1S5CD 2AQ1B 3CCUA 1YNTE 1CZGA 4QCLA 1FCCC 3HUIA 4AUQC 2NN6G 4PS3A 3ER0A 1JR0D 5C4JB 3EFXD 4JX1C 2EYPA 3H7SA 3H6MA 2QF7A 3A9KA 1JW9D 4PMCA 1VZ7A 3GZNB 3RLNA 5KGUA 2GBJA 5BYQA 2UXDQ 2KTFA 4IM3A 1ICWA 1EQTA 3PZDA 3ZRCA 1F2YA 1U4LA 4PQXA 3BDLA 3L4PA 2KFJA 2F0MA 1C3TA 4LF5Q 2YU9H 4J6HA 4OVVA 4OL7A 4BZAA 2KBNA 2XSCA 2LJIA 1R4QB 3M4PA 5LMUL 3MEFA 4BXXG 3HOVH 1AARA 4ZRZA 3TEHB 1R9TB 3TL5A 3E5SA 3G6EA 4M0WB 4A93H 1PQSA 1U4MA 4G57A 2PQAA 3CAMA 2PLPA 5JPMC 3CC2A 1RWSA 2NVXH 3GDEA 3LJ3A 2MBBB 1QOFA 2WDRB 5D2MB 1G8ZD 3MHBA 2HCCA 4OO1I 1YNJC 1YITA 2F3IA 5FO9B 1O78A 1T5XD 2DY7A 1PFNA 2QDBA 2PMZB 4BBRG 4R4IA 4DFAA 4JBMA 2LVQA 2EYOA 4DAVA 1UWVA 1WTOA 2MJ8A 5HFYA 2DLBA 2FIFA 4NAWB 1D7QA 1PLFA 1V8QA 2PJHA 5J3BA 2JVCA 4K8JA 3I4LA 4DA2A 1SFOB 4LJOB 1J7BA 2ICIA 1Q46A 1P7FA 1EQQA 5CHVC 1Q1BA 4JI3Q 4N9F4 3A55A 3I3CA 4EQNA 2W3RA 2CH4W 1CM9A 4HCSA 3FKIG 3D4RA 1WI5A 4APVA 3IXSA 1FL0A 4WJPA 2K03A 1T0QC 3I70A 1L0XB 1YBYA 3J81L 4LFAL 2D10A 3PRPB 4LF9L 2C7NB 2F1MA 5JPNC 4A3BH 2Y5BB 3RNFC 4G7ZC 5F2DA 1HA6A 1WR1A 1V6EA 3ZXRA 2HTME 2LXKA 4X6AH 4DR1Q 3PUXA 1AWDA 1L6VA 1M94A 2KN4A 4ZDVA 1DM0B 1RF2D 3CWIA 4OW0A 1T9HA 3U30A 2EOTA 2MO0A 1TKGA 2GI9A 4LK0M 3VQIA 4CHKA 3TQYA 1NBFC 3H3VI 3U52E 2KNBA 3QR8A 5CBEE 4IURA 4JI1Q 3W2DA 1VQAA 2SEBD 3HOWH 1KNEA 1WM2A 3HVDA 4V0BA 4J1MA 3K5NA 1FFVA 1WX7A 1F2MA 3BG3A 1R4MI 1I42A 2OTLA 1BDOA 3Q14C 4G11A 3VR5A 2L0FA 1ENAA 3K0YA 5AJ3Q 1WFQA 1RHPA 4QL5A 2V4DA 1WGDA 1X55A 3J81E 1W6JA 4B3TQ 1TT2A 4I6LB 2R7ZH 4X3TA 2EDGA 4KGSA 1X9NA 1QOGA 2IL8A 1J8CA 4N8FA 4POFA 3BU2A 3V61A 1RTOA 4QUCA 1HHVA 5DEHA 2J42A 3IFWB 2Q2UA 2JSOA 1HUNA 1SJHD 2FIDA 4RHRA 3ZNZB 2HIVA 2A74C 4FBJB 4X62L 2F0DA 1JORA 3CIRB 1S5ED 4N6EB 4X65L 1NE3A 3Q0AA 1YN4A 1EWHA 1QOBA 4IUQA 4DNIA 1K50A 1A2TA 2NVTH 3BIID 1SNOA 1X54A 3I4MB 1YN5A 4K2LA 2J52A 4LNFA 4MM3A 5JH5C 4JI6L 2DNCA 2UXCL 1T0SC 1WRDB 3W1SC 4FJVB 1JROA 2E8GA 4BA2I 1XMOQ 4A3IH 2KO3A 4HJ5A 2O5JC 3F8TA 1J7AA 5IGCA 4JBKA 3KOJA 5BR8Q 4CHTB 1N63A 3AE3B 2PVOD 1STNA 4A3MG 1GG3A 2KACA 3PO3B 2VZAA 3J7YW 2HD3A 3X3NA 2LKVA 2MA9B 3S1NB 2LI5A 2KDIA 5ELFA 1HZAA 4PT5A 1TVXA 5C3WA 1XEEA 3V05A 4Q5VA 1RLFA 4ZRKA 5FR6A 4P7IA 4GLAC 1XO3A 1YX5B 5EPJA 1CA6A 2HTHA 3R8BA 2WYQA 2A6EC 3ND9A 4LNNA 5EKKA 2B2UA 4WORA 3N1ZC 1Q86C 2B63G 3ZW3A 2VB3X 3TP5A 4YWMA 4IO9A 4LJPB 4GKKQ 2NZ1D 2IO1B 4XDCA 2ZM6Q 1SYEA 3ZUNA 1JB7A 1UAPA 2OF1A 3D3RA 1SYFA 2YTXA 3L0OA 1K8GA 3M4OH 5EE9A 4IUNA 4DR5Q 4A3OA 3J80i 1A3UA 2UUBL 1YQ4B 4WFN3 1H9MA 4ZYSA 2LHEA 1JWSD 5K36H 1YI2A 1WXAA 3PPAA 4A55A 1DOYA 4ASWC 3N3KB 4UP9A 3VRBB 4K3BA 2A68C 2EELA 4DAYB 3X0WA 3JVZX 1NYRA 2CHWA 2B8GA 3V6EB 2HUGA 2ZJPA 1BMLC 2KFKB 4GSWA 1Y56A 4A3MB 3K5OA 1KC8C 3RFZB 3UDIA 1F77A 4O2DA 3H0GH 5LL6X 1ZE3D 4H0LC 3DEPA 2BS3B 2RD0A 4E6IA 1HNWQ 2WP8J 2QDFA 2BTEA 3FP9A 2KMAA 3DHGC 1CFMA 2WLBA 3IAYA 1V9JA 1MD2D 3CC4A 1SJED 3TP6A 4GU2A 2UXBL 5J22A 1T0YA 3GE8C 2N9KA 4FYDA 2R93B 1WF9A 2RCFA 3WAOA 1VQOA 4L5QA 2PZUA 3BVMA 2RMMA 2RPQA 1MHWC 1QJOA 3G7LA 4W9GA 1MJCA 3PV1A 1ICFB 2KA7A 4I65A 2RDGA 2CFMA 1N32L 4X64L 1STGA 3W3AA 2A8VA 3IAM1 3M4QA 4RF0A 4AS1A 5M3MB 1UE1A 4JL9A 3U9OA 1L1OB 2HDEA 1PTOF 3PLVA 1ZXTA 4V190 3DPDA 4A3FH 3NQTA 3JAML 2F03A 2WHIA 1WGYA 4ME3A 1VQGA 1YOVB 4N8X1 4DUYQ 4KZCA 3NVVA 1GUTA 3DLLA 2DZMA 2IO3B 3RUZA 1WI0A 1SXTA 3RN9C 1E24A 1IBMQ 3K5LA 1PH5A 1GNUA 4C4VA 1F9SA 1QE6A 4KHVA 4JG2A 1EY7A 3VYTA 1VMCA 4B3MQ 2J7QB 3N1XC 4HDOA 1KHIA 1IL8A 4AYBG 2VQEL 1EF5A 3OW2A 4FVMA 4O1NA 3AEVA 1G51A 4IFDJ 1H4RA 2MHJA 5ELDA 2XBBC 1MPEA 4DK5A 3GB1A 4CO7A 4JV5L 1CMXB 1JALA 4TV3A 2HHHL 3KYHC 4FO2A 3VH4B 1E0BA 1WGRA 3L17A 1MJDA 4YSYB 3UQAA 3B6YA 1LUZA 1PGAA 2QA4A 1GVPA 1P16A 1XWEA 3ONAB 1A8VA 2BS2B 1I94L 3JAME 2Y3AA 1QOHA 3NK9A 2YVCA 2ZNVB 1TZ1A 2PNHA 4KIKA 1ZGUB 3IKJA 1B9RA 1HZCA 1LT4D 3WOEA 3VR9B 2AWTA 4XGAB 3PSEB 3RT3B 2JP1A 1B50A 2KWVB 4U68A 3B0AA 3VAWA 2UU9Q 3K9OB 2WXFA 1PYWD 5C4XH 4R4OA 2M17A 5AZFA 2LJ5A 1GUNA 4NMZA 3AMUA 2NPTB 3JSVA 4YWGG 4E71A 1DOMA 2C5LC 1EQRA 1N34L 3MZ5A 3P42A 1NEKB 2JXTA 1JWAD 1K8RB 3TUOA 3E6ZX 4KLKA 1EFWA 4DPGA 1O7IA 1BCPC 1RL2A 2HQLA 1A5RA 2Z8LA 1Y1VH 4F7XA 3LDZE 2C9OA 2MCNB 2QC8A 3GZNI 4CJ1B 5LMNL 1J0GA 5JEAG 4HXDA 2F4IA 5C0XI 4DR3L 1GC6A 4YTPB 1K3BC 4MZ9A 4A3EG 1HNZQ 3RYTA 4DHJD 2NBWB 2NB0A 3QJYA 2VL6A 1B2TA 1E1OA 4HIKA 1FXIA 4HIMA 3PHXB 1WGHA 3ZNHB 1XJVA 1L5PA 4GZYC 3HK0A 2FMMA 4BKGA 1KDCA 4MGKE 3A8IE 1XTDA 4DK1A 1OXVA 5TR5A 3J81i 1Q1EA 3U7ZA 2L3ZA 1O7YA 1Y8NB 1UBIA 1CHPD 1TZOA 2K8CA 4QQBX 1DXMA 4L1BA 5IGGA 5C44H 4YCVA 2XGTA 3PIP3 5M5YB 1H9JA 2PE6B 3RZFA 2LGDA 3BS1A 2KZRA 2EE1A 4ANWA 2WB1E 3Q3FA 4H7BA 2HJ8A 2KHWB 3AEBB 1HTPA 4GKJQ 2QW7A 3DVGX 1DOIA 3T8MA 4C3JH 4HN7A 4ACFA 1ENCA 1E8XA 4XDDA 2KCMA 4HTHA 1PH6A 1AE3A 3A1QA 2MBQA 4F8CB 3F2CA 5DPSA 4ANXA 5LL6S 4Q2JA 4A3EB 5LLIA 1C4QA 3TEYA 4OO1G 1JC7A 3VR3A 1WY8A 3AH7A 5EE3A 3VRAB 5KIXA 2CWAA 4HPPA 1AE2A 3CMAA 1C4CA 4BKSD 1SYBA 2K22A 1ZP0B 3I55A 4KV2A 2PE9A 2KJHB 4BBNF 1Y8PB 1J5EL 5IN7A 1V43A 3RZOB 3H1UA 2JRHA 2K1FA 1KRTA 3TEZA 2Q8RE 4K81A 4CKEA 3HOXB 3MJWA 2INNE 4DR4Q 5IGEA 4H44C 2SAKA 2E2IB 3FPPA 2QSDA 1ML0D 1E8YA 4A8XC 4IM0A 1I7HA 4C3IG 4RGTA 1PH2A 3Q2AC 4RM9A 4P6VF 2MP1A 2QMTA 3N6RA 4HEDA 2YEPB 1IHZA 2DJGC 2H1EA 1CQFA 1LTGD 2R7DA 4P72A 3VR6A 5IE8A 2O6VB 3APCA 2WAQG 2RA4A 3OIPA 4C00A 2M4NA 3SXHA 3TEWA 3AU5A 3C19A 5FKAC 3PT2B 1WD1A 3N52A 4JYAQ 2LVOA 4R8NA 5EAYA 5M3FG 5LNK1 3S2AA 4DV4L 2YLMA 1GUGA 1EYAA 1X32A 3DXJC 2WDQB 2ZEQA 2FE8A 3DHIC 2E2HB 4L6TB 3SHLA 4P73A 4YL8A 3KLSA 2GBKA 1PH3A 4M0WA 3CRLC 5IP7H 4NDXA 2MNAA 3PO2B 1PTOH 3S17B 4CJ0B 1IYFA 2GRIA 1B53A 2EJFC 4IPCA 1Q0WB 2KWUB 5DCNA 2BQQA 3HM3A 3GV3A 2BYFA 2L8JA 2BE5C 4DV1Q 2ON8A 3DCGA 5GXGB 1PHJA 2HDLA 3CQZH 5JVH3 4BBSH 2K7VA 3P4RB 1VR9A 5IGDA 1NAPA 4TMAB 3IT4B 5G3LF 2J0TD 2KLCA 3ERQA 5D14A 3ERSX 4IJLA 4NW2A 4C3IB 5FLXc 2J53A 2ZPYA 4HJKA 4L63B 1PRTC 2JRIB 3AEFB 4FF3A 2J0MA 3GTQB 3BVGA 1WIAA 1S40A 3DWAA 3AU4A 4K5VA 3FAHA 3JYUA 2CCZA 2ZXPA 2WDTB 5BMHA 1WZ0A 2IW3A 3LWEA 2JT4B 1VQCA 4US8A 3P20A 1QT9A 4HSVA 5M3FB 4XTCS 3NENA 2SNSA 4A3JG 1EU3A 3MXNA 2L1AA 4UAIA 1AZQA 2ASBA 3AI5A 3Q8BA 4HLEA 3NTHA 1KLUD 1LT6D 2QDLA 1XXGA 5GAHC 1E5WA 1SR3A 2KEEA 3GTPB 1A6XA 2FUHB 1L0YB 2DN8A 2UXDL 4WJ3M 1JWUD 1QKZA 3KUZA 1K8OA 5G5HA 3VUYA 1LM0A 1R4MB 3NP8A 3IAS1 4FULA 2BYVE 3PRZA 2A6HC 3AE7B 1OGWA 1HQRD 5FK9C 3HKSA 3W1BA 4LF5L 3HOYG 2JA9A 2KQ4X 2LRUA 3PGEA 4JWSC 2OQ0A 2Q2TA 3J7A5 2CKHB 2BS4B 1E90A 1RFKA 1WOCA 2ZJQA 2D5GA 1IPGA 3Q3MC 4GLSC 4ZAIA 2KVRA 2IY0B 2RDHA 3OMCA 4P16A 3WAMA 4C3HB 2C60A 5BO4B 4ODGA 2K5VA 3JAMi 2HIXA 4LF4Q 5M5WH 3DWPA 1G6JA 4Y7NH 5BYRA 4QUFA 4EX5A 1LTRD 1OO9B 1WTRA 1SMYD 4ITKA 2KLGA 3PHWB 3ZDTA 1LABA 3K81C 5FR3A 5C3EH 4NPSA 1SSNA 4HROA 4MGYE 5DPTA 4JQWC 4K3CA 1KH0A 4K7UA 5D3DA 3KLSX 3R7QA 2DZIA 1BOSA 1C9OA 5GQOA 2KDMA 2BF8B 3Q8CA 1FD7D 3AFPA 3H91A 3FMCA 4R4QA 1VQ4A 2AQ3B 4JI3L 2I0QA 1QG7A 2I07B 2N3SA 1KOTA 1Y1WH 3I4NH 1EEFD 4A90A 2DGYA 4K7WA 4Y52H 3HOYB 1DYQA 3NBHB 4LNIA 1D3ZA 3ZNGC 2FUG1 3G4SA 2PQEA 2R92G 3UDFA 2MBEA 4WIPA 2EJMA 4GN1A 4C7YA 5IYBH 2QCPX 1GHJA 1XNQQ 3ZJYC 2L0CA 2B2VC 3LNNA 4QY7A 2HT1A 4B3SQ 3KBXA 1VRAB 2F0WA 5HY6A 4DR1L 1VF7A 4BKTA 1QNUA 1SNDA 2EYFA 3HS0C 4DXGA 2L00B 4CBVA 1R4PB 1DJRD 3GTMH 2M0AA 2EVBA 1L2FA 1M1KC 2N9EB 2CKZB 1JWBD 1IW7C 2M9VA 5E3FA 2Z6BA 1EYDA 2WB1B 4LLGM 3OYYA 4AQ7A 3I56A 1C76A 4JI1L 1YNJD 2XVSA 4QB4A 1Z9FA 4K8IA 4B08A 2XK5B 5A35A 4M01A 1Q82C 1U4RA 4OX9Q 4NNJB 2D2CC 4A3DH 1EY4A 1N9WA 1V86A 4KSLC 1IYUA 4NXMQ 3AEAB 2K04A 3WCQA 3A4SC 1M8AA 5AJ3L 3ND8A 3QCAA 2D0PA 4DKAC 4BY1H 4B3TL 2JF5A 1JCKB 3QARA 1EY0A 2F0TA 2WXOA 2RR9A 5IP4D 3SR6A 2AEHA 3AFQA 2L15A 1W2BA 2CW0C 2M2LA 1WXVA 2B76B 3ULJA 4IFDI 2KFKA 1PFDA 2R92B 4WJNA 5BMIA 1XLNA 1K83B 4YWKA 4ZK9B 1ESRA 3QB3A 1V97A 1FR3A 3DWMA 5IWAQ 2FXQA 5IOIA 3GTOB 3OW7A 2IX3A 1VQJA 4UY8C 4TQUS 3TMEA 4LUZA 3W1GA 2GLSA 2V9HA 1D1KA 5C3XA 3N20C 1TWAB 4L5SA 1XMOL 4EUTA 4HK2A 3CMMB 4ZOHC 3DM1A 4DU9A 5BR8L 5KNBA 2HJ1A 2RHQB 1N5XA 5MPOA 1KQSA 2LY7A 1O7LA 1S1QB 2A5HA 3BINA 2A69C 4A3GG 4CYEA 3QAQA 1KDAA 1MIUA 2A4ZA 3NUHB 2K8HA 1CZWA 2KOLA 2KXJA 4OGQC 2O4XA 1Z2MA 2O2VB 3S15B 2KN5A 2QCZA 3K5MA 2YU9B 3DBSA 2DNEA 4TSSA 5JHBA 1U0LA 3TRZA 1I4HA 5JJKA 1FJGQ 5IT9L 1Y8RC 3RZWC 1F9RA 2SNMA 3HOVB 1N8RC 4GKKL 1TT5B 3GO5A 3HFZB 4A93B 2ZM6L 3CCSA 1E2VA 2C7MB 2JK8A 2V3PA 1NMGA 4UP8A 4DR5L 3NRZA 3KDFB 5C0XG 2PYKA 4GMVA 2K6DB 2ALYB 1EFID 1OTCA 2B2YA 4PV1C 3HVZA 2E76C 1E1TA 4YIJA 3NUCA 3KJPA 3C8YA 3RNGC 2CHXA 1V9PA 4WQOB 1X56A 1YQ3B 1RYJA 1QILA 1QQRA 2ZJDA 4P1CC 1NR4A 2WXNA 1PGBA 2K33A 1VD2A 5FJ8H 1Q8KA 1P9DU 1TGZB 1YJ9A 2EMSA 2V1YA 1B7YB 1WMHB 3ML8A 3VHTC 3VYUA 5C5MA 3ENEA 2KVMA 3A5ZB 5FLXL 5IT9E 4A3GB 1HNWL 1T3QA 3H6NA 2JY6A 3W9CB 4X3KA 1FNWA 5EKLA 2F0SA 4I6NB 3SFDB 1VQ8A 2JA5H 2JA6H 4DV0Q 2EY2A 2I5MX 1C4PA 2A6ED 3K80C 1TQOA 2AL6A 2QEXA 2E3TA 1EZ6A 4WWNA 5IIFA 4AP4C 2XRSD 1KL9A 1FIQA 1CKNA 4POGA 3CCEA 4LCDE 1P0RA 5I6YA 2ID0A 2DAJA 2SOBA 2HCIA 2K5PA 1UUPA 3M62B 4OONA 1SE4A 3M7NA 1IGCA 4U673 4RCOA 1HA5A 1SIFA 2MJDA 2ZPNA 3HOWB 1F2RC 4ARIA 2K01A 3TJPA 2V3NA 3KJOA 2OEOA 4A3CH 2F0LA 1TU2B 4K7SA 2LFNA 5FLXE 3FDTA 1STBA 4QIWE 2K14A 4LFBQ 1E9MA 1LQBA 3KYCD 1NVID 4DUYL 3S9WA 1I6VC 1MKHA 5L37A 1PH1A 2ZCBA 4XC2A 1TIID 1IBML 3AM9A 3MVVA 3T13A 2Y5PA 3QIAA 5KEEA 2X6GA 1WSPA 3Q3OC 4B3ML 4PNYA 3KW5B 3HOZH 2GB1A 4DV7Q 4AOFA 3GV6A 3PUWA 3S2HH 2KWCA 5KHOA 1EL0A 4N9PA 5EPLA 3V62A 1I3QH 2X69A 2WNMA 5IGFA 4ANUA 4LMQD 4DXFA 4EVOA 1XCQL 5H92C 3KF8A 1PFMA 2KENA 4S17A 4YTMB 3PCOB 1YJJA 3KH0A 2EQSA 2C9WB 2KT7A 3OLMD 1S3OA 1HFGA 2EYJA 5HGTA 3OAWA 3NWSA 1R4NI 1EY6A 3STBC 4EGVA 1X65A 2M0XA 1CKOA 2XEWA 4IPGA 4B9XA 1PV4A 1PTOC 3DUZA 5HURA 3IBEA 2UU9L 5FLMG 3T16A 1OQYA 3FEWX 2JA7G 1YHBA 1LTSD 1QWYA 4GGQA 2GBNA 1Q3LA 1JRPA 4W9EA 3K0XA 4NJ6A 5AEKB 1QVCA 1QZEA 4HKZE 5KHQA 4DAMA 3I4MG 2VW9A 1TWHH 4DHJB 3VTVA 3SD5A 4CDDC 3KFUA 2JA8H 1YNXA 2LWPA 4G3XB 3QWNA 1TJEA 1A15A 1B1ZA 2HD5B 1TKYA 1WCMH 1LYLA 1GM5A 1KLGD 2KTRA 3P63A 3PO3G 4ANVA 3APFA 2BT6A 4OWTB 3M4OB 1HNZL 3I63C 4KGRA 3H8HA 5CX3A 4P2CB 3S1RB 2NYZD 3M4YA 1STYA 5EE0A 4PK1A 3HKZE 3QG1A 3KF6B 1DGJA 3Q8AA 2K0PA 3RMHA 1OFFA 1E7UA 2O6VA 1QUQA 1C77A 5EJWA 1KJTA 4ZUJA 4KKJA 4LTUA 2YYZA 3PUZA 3B2GA 1UGJA 4MJSA 1AYFA 2CQAA 3RZDH 1Q81C 1B4OA 2Z59B 4MGIE 1EEID 2JA7B 1MG8A 1D8LA 2WX0A 3T1HQ 3NVYA 4ZRIA 4FADA 5CR3A 3Q24A 3H0GB 3C2PA 1V80A 2ZW1A 1OEYA 4NP5A 3D0FA 4YCWA 1DONA 1GC7A 4A3KG 4PZ6A 1NYQA 5DPRA 1I5FA 2F0NA 2VUMG 3E3XA 4KGTA 1BCPD 4GKJL 4DR6Q 1WZ3A 2AUJD 1I6HH 3X23A 1I4PA 1F52A 2OTJA 2FCMA 1FRDA 4OVUA 1PMRA 4LNQA 3GS2A 1FM0D 2R3ZA 4Z9CB 1PH8A 1F2ZA 5LXHA 2L11A 3N30A 1JQYD 3ZTCA 2NN6H 1TWFB 4A3LG 4OEMB 1UELA 4M8MA 2JQOA 3DHQA 1SFOH 1AH9A 2UUCQ 2KUMA 2NVYH 3NOBA 1XNRQ 5BN3A 2RSOA 1LGRA 1ILPA 3U8ZA 1G2TA 1VQNA 2K4KA 3BZCA 3A9JB 3ML9A 4MN3A 1VMPA 2QEJC 2K25A 3L16A 3ZGZA 1ESFA 4A3FB 4LFCQ 1EIHA 2NR2A 1SYCA 3TDQA 1IBXB 2R93G 1RTNA 3S2DH 1UGMA 2PI2A 4YWLA 2WACA 1VQBA 3K58A 2L12A 2EJGC 4GNXB 1Q1OA 1JQ4A 4DR4L 2INPE 2RPVA 4BXXH 4IWPA 2RDFA 2VY3A 3MXPA 2IGHA 4HVBA 1STHA 2EXDA 4HJ7A 4RNAA 2IYDB 1PH4A 3PIO3 1TWGH 4A3KB 1WTQA 3PQIA 4AQYQ 1K28A 4NY0A 5M3MG 1DGSA 1FNVA 5JAVA 2VUMB 2BW2A 1Q90A 1IBLQ 3MC0B 3AXCA 4L5RC 4W9CA 2AMCB 5K5PA 3ZIMA 2IBIB 2K6QA 1IZ6A 1MI2A 3CPWA 3A8KE 2M56B 4BBRH 1RCVD 2K75A 1K0RA 4JYAL 4MTKA 4WWMA 1VCIA 4EE2A 4YSZB 2B2UC 5M9OA 1TKWB 3QX1A 3D31A 4LF8Q 3IFDA 1L6UA 2MBHA 2OCEA 2PTLA 1NDDA 1GUOA 3DHHC 4IUVA 5I2YA 1V5OA 4N58A 5IP9G 3B08A 5CV6A 1V1PA 2LD9A 1X3QA 3H3VC 4MNOA 3FKIH 5C4XB 1WM3A 4BBNC 2INDC 3GE3C 1E7ZA 5CORA 1QZGA 4DV1L 2LASA 2JUOA 1BUVT 2N78A 4E3CA 1ZYRC 4FNFA 4JW0A 3RN5A 2R2QA 3VUXA 1SN8A 3EUB2 3PRMB 2MGSA 5BN4A 4IW0A 3WALA 2WXRA 2KC1A 2PZTA 4GOPA 1ASZA 3QJZA 4RMFA 4QIWB 3J9CA 1Y1VB 4IFDG 1PYSB 3OTOQ 3V96A 3CCQA 1ZXHA 3VYSA 1TIFA 1CA5A 4RG1A 3HP3A 4AIMA 1H9SA 4P71A 5DM73 4BWGB 3ZXVA 2F0JA 4B0MA 5A2QL 4XYQA 1CHQD 4LF6Q 4IOAA 1UEAB 3EECA 2AHOB 2PCFB 4XZ4A 2LGXA 1WYDA 4LF7Q 1PH9A 1J7CA 2NZOA 1H95A 2JXXA 1WTPA 4IZ8A 3GTGB 4AWJA 4ICVA 4C80A 2AL3A 2K05A 1FRRA 1KM7A 2JYTA 4W9DA 1P8LA 3UE0A 1DOLA 5AFWA 1XPOA 4IM2A 5IGBA 1LTTD 1JOOA 3EBEA 4J6IA 5G55A 4GOPC 1LTAD 2F52A 3MC8A 3NTIA 4OIJA 2B3AA 2K9XA 2BE5D 5I6WA 3K57A 2WXMA 1Y69U 3CW2C 2I46A 2MX2A 2FNJB 3NEMA 2UYZB 2OT2A 5A2QE 1WFYA 3JC66 1GKHA 2DY8A 4AJWA 1PRTD 4LUVA 2PIAA 3A74A 3D6WA 4FF2A 2J0KA 4LF4L 2JZ3B 4KMUC 4IOCA 5E6NA 4A9AA 1N62A 3UINB 3TZDA 5KYIA 2M00A 1BUIC 4OVZA 1EYGA 4A3MH 2O5IC 4DV3Q 3BDOA 2O2LD 3ETRA 4ID6A 2B2WA 2BB6A 1WYGA 1HJPA 3VDZA 1LT3D 2JJQA 3UDXA 2Z4IA 2X38A 2EYLA 1M4VA 2KQ7A 1PFBA 2CQOA 1BNZA 1FEHA 1C7YA
chains in the Genus database with same CATH topology
2N7JA 5J1ZA 2WXPA 3GQBA 2YEPF 2EXZA 1T5EA 2RVLA 2A6HD 2Y5CA 3C46A 4FXKC 1C4AA 1WVLA 4XXEA 4HRSA 2KWDA 1DD2A 2QKIC 2WKDA 4DQOC 5BYSA 5J39A 2JZPA 3FRPB 2EY1A 1TS4A 2KECA 3R93A 1C79A 1STEA 3D6CA 3HRDD 5JVG3 2J7ZA 1XX8A 3DWGC 1FGBD 1SE3A 2KCNA 4KJNA 3AEEB 4HEA1 1TYGB 3TZUA 1Q10A 5T1GA 3I91A 2FBWB 2QILA 4X3SA 1KFYB 1LTID 1MSGA 4QF4A 3KWVA 3I57A 3CQZB 4BBSB 4M8AA 3SDZA 2WXKA 3GTJB 1FD6A 3PUYA 2PKOA 1B9NA 2XIWA 3P75A 4GDLB 3PUVA 3AB5A 1YNNC 1X3PA 3PZ7A 1AN8A 2G9HD 1HZ5A 2G1EA 2JSVX 4G7HC 1IW7D 1J8IA 2MJ3A 2E74C 2F0QA 2Q8TA 2KMMA 2OXPA 3ZJVA 3LXFA 2EYMA 2NTTA 2EKIA 3CU7A 4HMJA 1OQRA 1ONLA 1UNSA 2R6GA 2L32A 2F0VA 3SK8A 1MI0A 3T53B 1XCTL 1U4PA 1ROEA 1EQVA 2BYTA 4K6LA 4KHZA 4US9A 1BO0A 2E75C 2CW0D 3VA7A 4KX6B 5HHDG 1EOTA 3NTKA 4HJGE 5CV8A 1AEXA 5IODA 2JXMB 4RKLA 1GOZA 4CQNA 1BF4A 3AE6B 2XRQD 1DOXA 4Y7NB 3I72A 2XN9C 5CV9A 3ZJUA 3NXWA 3AE1B 1PZKD 5C3EB 2NBFA 2IPKD 4ZLTF 4R9WA 2LHDA 1QB5D 2V4IB 2L4NA 4C3HG 2D9UA 4KD3A 3SE0A 1TKEA 4MM3B 4OHJA 2A69D 1Y1WB 4B0EA 2IJ0A 3GD7A 4JK1C 1U9RA 2B2TA 5JEAH 4IUUA 3VR4A 5DNFA 3MEHA 1OXSC 1IKMA 4RWSC 1GAQB 2PZWA 2ONQA 3NQIA 2XNAC 4H13C 4ZUIA 1WTVA 3GTMB 2IX0A 4WH4A 2FINB 5C2TB 1XF5L 4IN3A 4KY7A 5C4HA 1V1OA 1YMHE 2W82A 3M7GA 4A3DB 2B2TC 4K5XA 4BY1B 1MSHA 1WXQA 1CJEA 5ISRA 1H9KA 3NS1A 2KCCA 4KN7C 3SEBA 3TP8A 3HOUB 1VLBA 1QF6A 2KAJA 3KBGA 5CC4A 1SF0A 2GA4B 1F0ZA 4C1NI 4OO1H 1MHHE 2MUYA 3Q69A 2VNUD 3OMGA 2L55A 2DYOA 2EZVA 1EU4A 2FFKB 2BDNA 1D5MC 5EE1A 4L8JA 3AE9B 3R2IA 3AEGB 4ZKBB 3W5UB 2TMPA 5AUKA 1FNUA 4TQ1A 4FF4A 1NI3A 4DAPA 2NVQB 5EBDA 3AU7A 3OHXC 3A8JE 3OPOA 1UWMA 3GTLB 3C1FA 3GP7A 3F2UA 3NBIA 4K5WA 5KYLA 4HAEA 1S5FD 1TY0A 2X6LA 3E9SA 1GB4A 1W6KA 4O42A 1OQQA 4BY7B 1CQVA 4TQ0A 4DAYA 3T3NA 1BCPB 2OHFA 2N9LA 1PTOD 1C78A 4GDKB 3S14B 4JPSA 4XDXA 3T56B 2F0PA 3A56A 3DEOA 3H94A 4RGMA 1OXTA 2ZXOA 4NJCA 3FVQA 4HSPA 1XTCD 5JJZA 4NKLA 1SEBD 2F0OA 3KUPA 3C1EA 2JA5B 2MPMA 2JA6B 2QMTA 1ZPSA 1CTMA 1F2RI 4H2AA 3NSWA 4N9TA 1AW7A 3SK6A 2DYMA 1RJTA 4FXCA 1ZEQX 2WXLA 2FJ2A 1SNCA 3MXUA 4M1UB 2JU6X 3OOCA 2K5DA 3ZJTA 3FILB 3J7AF 1D5XC 1AP0A 2Z1CA 1EYCA 3SK4A 4ZHPA 4C1NK 2NVXB 5C3JB 3BWUD 1PDXA 1IUEA 2XWJB 1NR2A 1JICA 1VF5C 5C5LA 3MXGA 1I3QB 1FFUA 4IKGA 4PMBA 3EA6A 5JXVA 1ZOYB 1IYVA 1G91A 3ITPA 3AE4B 2R61A 1MHXA 4IALA 3T4AC 2WXIA 3SK5A 2F0GA 1S5BD 5EBCA 1SB3C 2WINB 4A3BB 2B2YC 2VXWA 3E0JA 4EQPA 4DNTB 2QIEB 3ZQ4A 4A6QA 5KRUA 2LUMA 1N5WA 1N60A 2F0UA 5ELEA 3EGRA 4KKSA 3TN2A 1B3AA 2JA8B 1CT1D 3NVWA 3BVZA 3HRZC 4FF1A 1WD0A 3T3OA 1Q12A 3I9V1 3CKIB 1RODA 2G9DA 3AE5B 2A68D 1HEZE 2PVGC 2Y0SB 2L83A 2WXQA 2E2DC 4CJ2C 3N9YC 3A7AB 3RLFA 2R7ZB 4KY6A 1O80A 3L9AX 4IUTA 1XLQA 2AWNA 2B8FA 1Z7TA 2XWBB 3RZDB 1PRTB 2WU2B 1I4RA 1TS2A 2TSSA 2H4OA 3HG9A 2BB5A 3HGBA 3V2TA 3L3OC 5ELBA 1MGSA 2NVTB 2RKSA 1ZYRD 1QNKA 2WP9B 1HTLD 5K36G 4KN4C 2Q8IB 1HZ6A 1N61A 2K28A 2C5CA 4A3IB 1I6HB 1NSNS 4KV6A 1ZXIA 1SIJA 5KNDA 4LK1C 3MHZA 2PMVA 1Q8IA 1F9QA 1XLPA 1R7SA 1AFPA 2VB2X 3NHHA 5C4ZA 2NVYB 1WTWA 1PUTA 5CGKA 2JEAI 3AN1A 4HKQA 2RSNA 3UI3A 1KAAA 1V8CA 1L4ZB 4UDUC 3S2DB 1BQQT 1JWMD 2FMCA 3EJIA 3KQ4A 3OIQA 3B9JA 5D3IB 2SDFA 3LX0A 1TWGB 4HMIA 3A54A 3KWLA 3Q23A 1B44D 5C0XH 1K52A 5G3LD 3HEJA 1NUCA 5CV4A 4N59A 1SNQA 2IGDA 1GPXA 3T51B 4BBRB 2VZKD 2JQRB 4NZLB 3W1SA 2MJEA 2LMCB 4Q0FA 5JOBA 3U9SA 2H88B 5TSSA 1A3VA 3URYA 3D8GA 1VZ6A 1ZDXA 4ZHOA 4YXDB 1FMAD 3V3XA 1D6EC 3FKIB 4TRDA 5COYA 4B9WA 2WIIB 1ACCA 4S3SA 1G6ZA 4FP5D 3CRKC 3VYRA 2MHVA 3U4EG 4MHEA 4IOIE 1RKNA 4ILWA 1EWCA 2WS3B 5BN5A 4REZA 2IX1A 1BXTA 4JE3B 3Q6SA 2JE6I 1CI3M 4K2KA 4R8IA 1GHKA 3AB9A 1XYIA 1ZDVA 2WXHA 2IDYA 1Y8OB 1KF6B 3AMZA 3PZ8A 3IL8A 2F0HA 3I8ZA 2PNRC 1MBYA 3I90A 2CHBD 2PW7A 2Q5WD 1NCVA 4ME5A 2E6XA 5BMGA 1OXXK 1C48A 4OZCA 1YNND 5EKIA 1BR9A 5E4WC 4MH8A 1I4QA 3G6JB 1EWYC 2KEDA 3MFYA 1RD9D 1SYDA 1GB1A 4XQNA 1IKLA 3VR2A 3NWTA 2AQ2B 3E56A 3A7LA 1JB3A 4C3JG 1AZPA 2W3SA 3ABVB 2NWGA 3NVZA 1HPCA 1H9RA 1E7PB 3NBHA 2B63B 5D7GA 1FYCA 4QMGA 4ABNA 1LO5D 2WQYB 2F0FA 4HR7B 4C7ZA 4ZRPA 1JOQA 3FC4A 3KLRA 4G4KA 2KQ3A 3SR1A 3J7AV 2ENBA 2AX5A 1HQMC 4XT1B 4KKTA 3LB8C 5C44B 4XIGS 3K59A 1KABA 2K5QA 4K14A 3GTKB 5ELCA 3S1QB 4MT5A 4C3JB 1O7ZA 4ULLA 4KY5A 2IT1A 5CV5A 2JWUA 3L7ZC 2MEKA 2A73B 3BZDB 1JMLA 3BYTB 2WDVB 3DMUA 2JEBI 4MIUA 2B39A 4YSXB 2KHSA 2CJNA 3R2TA 4DGZA 1STAA 4BA1I 3X3MA 2I38A 3U2SC 2K6AA 5E4XA 2PW5A 1QOAA 2JYOA 2ZW0A 5I9OA 1C9FA 1DCZA 2LEKA 2D62A 4EQOA 1P7EA 5HI1A 4RKBA 3HKZB 1JOKA 3TP7A 1SSOA 3HZXA 3Q22A 5IOCA 2ICEC 5G5GA 4PMWA 4J3OD 3WDNA 2EY6A 2W54A 2LGIA 2N55A 3MFGA 1GJXA 1T6BX 4AYBB 4C56C 2B2WC 1K53A 5CYUA 3OWEB 5NUCA 2M19A 3FILA 2OEDA 1QLBB 5E1FA 5C6AA 1E2WA 1E6EB 1PTOB 2F0EA 1LV9A 1RDPD 3TBIB 5HG2A 2WXGA 5I2XA 1A3TA 3MWYW 2F3WA 1SNMA 4RF1A 2ACZB 3Q8FA 1SBBB 1ET9A 1F9PA 1LT5D 4RCNA 5JEAJ 4RGOS 4KKIA 2V0GA 2MH7A 4IDIA 1WRIA 1D4BA 1A2UA 2NN6I 4WJWA 3BYYB 4XT3B 4IFDH 1PDQA 2HQEA 4KD4A 3NPPA 4WQMA 1EZ8A 1A70A 1SE2A 3TEXA 5EQ0A 4C2MB 3EQLC 1SNPA 2JX5A 2LFIA 1Z6HA 2PO4A 3OWFA 3BK2A 3K7AB 1WWTA 2NUCA 1WGKA 4TKOB 5CMDA 2EPBA 4XQJA 2BOSA 3P4PB 4RGNA 1DOKA 1SDFA 4IUPA 4JBWA 1DZ1A 2WKCA 3PMFA 4XWTA 1Z47A 4L23A 5M5WB 2J4XA 2QJLA 1HUMA 4IQZA 1SYGA 3WOFA 1KRHA 2JYEA 1D2BA 4R3DA 3B2FA 4OZBA 4J8QA 1EY8A 2L1BA 3QOJA 3EROA 1GUSA 4ARCA 5M5XB 2WU5B 1RM6C 3K6OA 1ZKOA 2Z4HA 2RQXA 4X3UA 5T8IA 3I4NB 1GUWA 4HCEA 3S1MB 4YTNB 3P4SB 4F88A 1PZID 4XYOA 3D4WA 4JWUC 4DK0A 1WTXA 1NENB 1JE4A 1VDZA 2DWQA 2AUKA 4LJZC 4WRDA 2WV6D 3LWUA 3I73A 2WAQB 2E2JB 4L2YA 4FXGC 2W55A 3H09A 3BDCA 1L4DB 3NE5B 4KKUA 1TS5A 1FCLA 1BCPF 3D4DA 4KTAA 1GXDC 4CGYB 3P1MA 4ZRQA 1KTKA 1BBXC 3MTSA 5CV7A 2ZT9C 4LAAA 1II3A 4DN4M 2BBCA 1EY5A 1PZJD 1YJIA 2F0IA 3AECB 1K8MA 2IGGA 1ENFA 1I50B 2K5WA 4KI0A 3BK1A 4CKBA 4G7OC 2LMCA 5AUIA 4MACA 4NAMA 3DWQA 2EYHA 4RH6A 2L5TA 1J9OA 1D1IA 3OSOA 4OIKA 2F3VA 1G291 3O13A 1V1PB 5EGTA 4WURA 3MJ5A 2H89B 2B2VA 3TSSA 1LACA 4DNRB 1VZ8A 4WAFA 4K6DA 1TS3A 4A3JB 3AE2B 3S16B 4KK7A 1KNAA 3P7JA 5EPKA 3MAQA 2CU3A 1C8CA 5FOBB 3AE8B 3P1HA 2LS01 4I7ZC 3AV8A 1CK1A 1H9SB 1IBXA 4USAA 1YN3A 2PW9A 4FXDA 1HFNA 1TWCB 2L9HA 2NMQA 3RD4A 1ET6A 2VZKB 1FO4A 1HRJA 3P4QB 1I4GA 2N88A 1I4XA 3M3YB 5FO7B 5T1IA 2ZXRA 1LLRD 3FPUB 3SFEB 3IT6B 4OZAA 5FO8B 1ZUD2 4XE0A 4KJOA 3SVMA 3QOLA 1E0ZA 3UI2A 1IGDA 3C3LA 4DF7A 1EIGA 2DBYA 1KDBA 1XLOA 3MP9A 3NZ3A 2BCOA 3RPFC 1TR5A 2RBMA 2BA0A 3VR8B 2WXJA 1CZPA 1OXUA 1S5DD 1D5ZC 4F87A 1EY9A 3PO0A 1B9MA 2AWOA 2IWHA 1G2SA 3J80L 1HXYD 5I4DA 3M85A 4RFBA 2FHTA 1ILQA 2K1BA 1EM7A 2K3UA 1MVKA 1E10A 2CVRA 2K32A 4XQQA 1S4ZA 5KNCA 5CBAE 1PRTF 3IFTA 2KJXA 3CHBD 4BS9A 4ZKCB 5LHY1 3HOZB 3LYYA 1K51A 3S2HB 3PV0A 3EVQA 1TY2A 4YT0B 3VA5A 1SAPA 1L0VB 3J80E 3MA2B 4ZQ3A 4RAUC 2BDOA 2D5DA 2L52A 5DM63 4RA8A 3W5VB 5I9PA 2I2YA 2BA1A 5H8YE 1PGXA 1F2LA 4RHSA 1QCBD 2NTSA 2N0SB 4F8MA 2EY5A 3R3OA 1FXAA 1HCZA 4XWWA 1VJKA 1TWHB 1LTBD 2F0KA 2CJOA 1E2ZA 3AEDB 5DAUA 3QO2A 5C0XJ 5E6JA 1UWXA 1SMYC 4CKCA 1WCMB 3ZYYX 1PXUA 2PPBC 3KK7A 2HDMA 1VDVA 5D65A 1S5CD 2AQ1B 1YNTE 1CZGA 4QCLA 1FCCC 3HUIA 2NN6G 1JR0D 5C4JB 3EFXD 4JX1C 2EYPA 3H6MA 2QF7A 1JW9D 4PMCA 1VZ7A 5KGUA 5BYQA 1ICWA 1EQTA 1F2YA 1U4LA 4PQXA 3BDLA 3L4PA 2F0MA 4J6HA 4OL7A 2XSCA 2LJIA 1R4QB 4ZRZA 1R9TB 3E5SA 1U4MA 4G57A 2PLPA 5JPMC 1RWSA 1QOFA 2WDRB 1G8ZD 3MHBA 2HCCA 4OO1I 1YNJC 5FO9B 1O78A 1T5XD 2DY7A 1PFNA 2QDBA 2PMZB 4DFAA 2EYOA 4DAVA 1WTOA 2MJ8A 5HFYA 2DLBA 4NAWB 1PLFA 1V8QA 4K8JA 3I4LA 4DA2A 1SFOB 1J7BA 2ICIA 1P7FA 1Q1BA 3A55A 3I3CA 4EQNA 2W3RA 1CM9A 4HCSA 3D4RA 3IXSA 2K03A 3I70A 1L0XB 3J81L 2F1MA 5JPNC 4G7ZC 5F2DA 1HA6A 2HTME 1AWDA 2KN4A 3PUXA 1L6VA 1DM0B 1RF2D 3CWIA 4OW0A 3VQIA 2EOTA 1TKGA 2GI9A 4LK0M 3U52E 5CBEE 4IURA 3W2DA 2SEBD 1KNEA 3HVDA 4V0BA 4J1MA 3K5NA 1FFVA 1F2MA 3BG3A 1BDOA 3VR5A 1ENAA 3K0YA 1RHPA 2V4DA 3J81E 1W6JA 1TT2A 4X3TA 2EDGA 4KGSA 1QOGA 2IL8A 1RTOA 4QUCA 1HHVA 5DEHA 2J42A 1HUNA 2JSOA 1SJHD 4RHRA 2A74C 1JORA 2F0DA 3CIRB 4N6EB 1S5ED 3Q0AA 1YN4A 1EWHA 1QOBA 4IUQA 1K50A 1A2TA 3BIID 1SNOA 3I4MB 1YN5A 4K2LA 2J52A 2DNCA 1JROA 4BA2I 2O5JC 1J7AA 5IGCA 1N63A 4CHTB 3AE3B 2PVOD 1STNA 2KACA 3PO3B 3J7YW 3X3NA 2LKVA 3S1NB 5ELFA 4PT5A 1TVXA 5C3WA 1XEEA 3V05A 4Q5VA 1XO3A 5EPJA 1CA6A 3R8BA 2A6EC 3ND9A 5EKKA 2B2UA 4WORA 2VB3X 3TP5A 2NZ1D 4XDCA 1SYEA 1UAPA 2OF1A 3D3RA 1SYFA 5EE9A 4IUNA 1A3UA 1YQ4B 4WFN3 1H9MA 4ZYSA 2LHEA 1JWSD 5K36H 4A55A 1DOYA 3VRBB 2A68C 2EELA 1NYRA 2B8GA 2HUGA 1BMLC 1Y56A 4A3MB 3K5OA 3RFZB 1F77A 5LL6X 1ZE3D 4H0LC 3DEPA 2BS3B 4E6IA 2WP8J 2BTEA 1CFMA 2WLBA 3IAYA 1MD2D 1SJED 3TP6A 5J22A 2N9KA 4FYDA 2R93B 2PZUA 3BVMA 2RMMA 1QJOA 3G7LA 2KA7A 4I65A 2RDGA 1STGA 3W3AA 3IAM1 4RF0A 4AS1A 5M3MB 3U9OA 2HDEA 1PTOF 1ZXTA 4V190 3NQTA 3JAML 2F03A 3NVVA 1GUTA 3RUZA 1SXTA 3K5LA 1F9SA 1QE6A 4KHVA 1EY7A 3VYTA 1VMCA 1IL8A 4FVMA 4O1NA 4IFDJ 5ELDA 1MPEA 3GB1A 1JALA 4FO2A 1E0BA 4YSYB 1PGAA 1XWEA 3ONAB 2Y3AA 2BS2B 3JAME 1QOHA 3NK9A 3IKJA 1B9RA 1LT4D 3WOEA 3VR9B 2JP1A 1B50A 4U68A 2WXFA 1PYWD 4YWGG 1GUNA 4NMZA 3AMUA 1DOMA 3MZ5A 3P42A 1NEKB 2JXTA 1JWAD 3TUOA 3E6ZX 1BCPC 2Z8LA 4F7XA 2C9OA 4CJ1B 5JEAG 2F4IA 5C0XI 4YTPB 2NB0A 3QJYA 1B2TA 1FXIA 1L5PA 4GZYC 2FMMA 1KDCA 3A8IE 4DK1A 1OXVA 1Q1EA 3U7ZA 1O7YA 1Y8NB 1CHPD 1TZOA 4L1BA 1DXMA 5IGGA 5M5YB 3PIP3 1H9JA 3BS1A 2EE1A 4H7BA 3AEBB 1HTPA 1DOIA 4HN7A 1ENCA 4XDDA 4HTHA 5LL6S 4Q2JA 4A3EB 1C4QA 3TEYA 4OO1G 1JC7A 3VR3A 3AH7A 5EE3A 3VRAB 5KIXA 1C4CA 1SYBA 2K22A 1ZP0B 1Y8PB 1V43A 3RZOB 3TEZA 2Q8RE 4CKEA 3HOXB 2INNE 5IGEA 4H44C 2SAKA 2E2IB 3FPPA 2QSDA 1ML0D 4A8XC 1I7HA 4C3IG 4RGTA 4P6VF 2MP1A 2YEPB 3N6RA 4HEDA 1IHZA 2H1EA 1CQFA 1LTGD 3VR6A 2RA4A 3OIPA 3SXHA 3TEWA 5FKAC 1WD1A 3N52A 4R8NA 5LNK1 1GUGA 1EYAA 1X32A 3DXJC 2WDQB 2FE8A 2E2HB 4L6TB 3SHLA 3KLSA 4M0WA 3CRLC 4NDXA 3PO2B 1PTOH 3S17B 4CJ0B 2GRIA 1B53A 2EJFC 3GV3A 2BE5C 2ON8A 5GXGB 2HDLA 5JVH3 2K7VA 3P4RB 1VR9A 5IGDA 1NAPA 4TMAB 3IT4B 5G3LF 2J0TD 3ERQA 5D14A 4C3IB 4NW2A 2J53A 4L63B 1PRTC 3AEFB 4FF3A 3GTQB 3BVGA 3DWAA 3FAHA 4K5VA 2ZXPA 5BMHA 2IW3A 3LWEA 4US8A 3P20A 1QT9A 4HSVA 5M3FB 4XTCS 2SNSA 1EU3A 3MXNA 2L1AA 4UAIA 1AZQA 3Q8BA 3NTHA 1KLUD 1LT6D 1XXGA 3Q8EA 2KEEA 3GTPB 1A6XA 1L0YB 2DN8A 1QKZA 1JWUD 5G5HA 1K8OA 3NP8A 3IAS1 2A6HC 3AE7B 1HQRD 5FK9C 2KQ4X 4JWSC 2BS4B 1RFKA 2D5GA 4GLSC 4ZAIA 2RDHA 3OMCA 4P16A 4C3HB 4ODGA 3DWPA 5BYRA 4QUFA 1LTRD 1OO9B 1WTRA 1SMYD 4ITKA 1LABA 5FR3A 1SSNA 4HROA 1KH0A 5D3DA 3KLSX 1BOSA 2KDMA 3Q8CA 1FD7D 3H91A 3FMCA 2AQ3B 1QG7A 2I07B 1EEFD 4A90A 3HOYB 1DYQA 2FUG1 2PQEA 4WIPA 2EJMA 4C7YA 2QCPX 1GHJA 2L0CA 2B2VC 3LNNA 3KBXA 1VRAB 2F0WA 4D2KA 1VF7A 1QNUA 1SNDA 2EYFA 3HS0C 4DXGA 4CBVA 1R4PB 1DJRD 2M0AA 2EVBA 1JWBD 1IW7C 2M9VA 5E3FA 4AQ7A 1EYDA 2WB1B 4LLGM 1C76A 1YNJD 2XVSA 4QB4A 4K8IA 4B08A 5A35A 1U4RA 2D2CC 1EY4A 1IYUA 3AEAB 2K04A 3WCQA 1M8AA 3ND8A 1JCKB 1EY0A 2F0TA 2WXOA 3SR6A 2CW0C 2M2LA 2B76B 4IFDI 5BMIA 1PFDA 2R92B 1XLNA 1K83B 4ZK9B 1ESRA 3QB3A 1V97A 1FR3A 3DWMA 3GTOB 3OW7A 2IX3A 4TQUS 3TMEA 1D1KA 5C3XA 1TWAB 4ZOHC 3DM1A 4DU9A 5KNBA 1N5XA 5MPOA 2LY7A 1O7LA 2A5HA 2A69C 1KDAA 3NUHB 1CZWA 2KOLA 4OGQC 2O4XA 3S15B 3K5MA 2YU9B 2DNEA 4TSSA 1I4HA 5IT9L 1F9RA 2SNMA 3HOVB 3GO5A 4A93B 1E2VA 2V3PA 3NRZA 5C0XG 2PYKA 1EFID 2B2YA 4PV1C 3HVZA 2E76C 4YIJA 3NUCA 3C8YA 1YQ3B 1RYJA 1QILA 1QQRA 1NR4A 2WXNA 1PGBA 2K33A 3VYUA 5C5MA 2KVMA 5FLXL 4A3GB 5IT9E 1T3QA 3W9CB 4X3KA 1FNWA 5EKLA 2F0SA 3SFDB 2EY2A 1C4PA 2A6ED 1TQOA 2E3TA 1EZ6A 5IIFA 2XRSD 1FIQA 5I6YA 2ID0A 2SOBA 2HCIA 2K5PA 1UUPA 1SE4A 3M7NA 1IGCA 4U673 4RCOA 1HA5A 2MJDA 4ARIA 3HOWB 1F2RC 2K01A 2V3NA 2OEOA 2F0LA 1TU2B 2LFNA 5FLXE 3FDTA 1STBA 1E9MA 1NVID 3S9WA 1I6VC 1TIID 3AM9A 3MVVA 3T13A 2Y5PA 3QIAA 5KEEA 2X6GA 1WSPA 4PNYA 2GB1A 3GV6A 3PUWA 1EL0A 4N9PA 5EPLA 2X69A 2WNMA 5IGFA 4LMQD 4DXFA 4EVOA 1XCQL 5H92C 3KF8A 1PFMA 4YTMB 1YJJA 1HFGA 2EYJA 5HGTA 3NWSA 1EY6A 4EGVA 4B9XA 1PTOC 3DUZA 5HURA 3T16A 3FEWX 1LTSD 1QWYA 1Q3LA 1JRPA 4HKZE 3QWNA 1TJEA 1A15A 1B1ZA 1TKYA 1KLGD 3P63A 2BT6A 3M4OB 4KGRA 3H8HA 4P2CB 3S1RB 2NYZD 3M4YA 1STYA 5EE0A 3QG1A 1DGJA 3Q8AA 2K0PA 3RMHA 1OFFA 1C77A 5EJWA 4ZUJA 4KKJA 4LTUA 2YYZA 3PUZA 3B2GA 1UGJA 1AYFA 2CQAA 1B4OA 1EEID 2JA7B 3NVYA 5CR3A 3Q24A 3H0GB 3C2PA 2ZW1A 4NP5A 1DONA 1NYQA 2F0NA 4KGTA 1BCPD 2AUJD 1I4PA 1FRDA 1PMRA 3GS2A 1FM0D 2R3ZA 4Z9CB 1F2ZA 2L11A 1JQYD 2NN6H 1TWFB 3DHQA 2KUMA 5BN3A 2RSOA 1ILPA 1G2TA 4MN3A 1VMPA 2QEJC 3ZGZA 1ESFA 4A3FB 1EIHA 1IBXB 1SYCA 3TDQA 1RTNA 2WACA 3K58A 2L12A 2EJGC 1JQ4A 2INPE 2RPVA 2RDFA 3MXPA 2IGHA 1STHA 4RNAA 3PIO3 4A3KB 1WTQA 1FNVA 5JAVA 2VUMB 2BW2A 1Q90A 3MC0B 5K5PA 1MI2A 3A8KE 2M56B 1RCVD 4WWMA 1VCIA 4EE2A 4YSZB 2B2UC 5M9OA 1TKWB 3D31A 3IFDA 1L6UA 2PTLA 1GUOA 4IUVA 5I2YA 4N58A 5CV6A 1V1PA 1X3QA 3H3VC 5C4XB 5CORA 1BUVT 1ZYRC 4FNFA 3EUB2 2MGSA 5BN4A 2WXRA 2PZTA 4QIWB 3J9CA 1Y1VB 4IFDG 3V96A