4PYUA

The conserved ubiquitin-like protein hub1 plays a critical role in splicing in human cells
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
GSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/allergen
molecule keywords Ubiquitin-like protein 5
total genus 23
structure length 76
sequence length 76
chains with identical sequence B, G, K, O, S
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4pyuA00
1Q0WB 4NAWA 2PE6B 4FULA 3H9DA 4EEWA 3EECA 5CHFA 4ANVA 1XD3B 4BKTA 1WJNA 4M8MA 5L95C 2IO3B 4X57B 4TQ1A 2C7NB 4B95A 3AI5A 3V61A 3PVLA 3OJ4B 2LVPA 5C23A 3PLUA 3I3TB 3HM6X 1GJZA 2BYEA 2RGFA 2ZVOA 4XC2A 3R66C 4HCNB 4IC7B 4RMAA 4NQKE 1F9JA 1EF1A 2LXAA 4K81A 4BBNC 2ASQA 2VRRB 1WGRA 3VTWA 4DHJD 3PSEB 4G11A 2NR2A 1WJUA 3R3MA 2KVRA 1S1QB 4KIKA 3QX1A 4G50A 4ANUA 3L13A 4RM9A 2O2VA 1WXMA 3D32A 1V49A 2K8BA 3AULA 4ZYNA 5DPRA 2DAFA 5DCNA 1TTNA 4MJSB 1JRUA 4IWQA 4KIKB 1WIAA 2ZPNA 2PEAA 1WMHB 2OJRA 1ZW7A 4N9F4 1P1AA 1YIWA 4CHKA 3HM3A 3B1LX 1V5TA 2CHZA 3IVFA 3QA8A 1OQYA 4HJKA 3WAOA 1LQBA 1Z5SB 2ZEQA 4LDTB 3M63B 1R4NI 2DZKA 1I35A 3RZWC 4PYUA 2KX0A 3L10B 1UD7A 2JZZA 4IM0A 2MX2A 2LJ5A 3QQ8B 1NI2A 1Z2MA 3PHXB 3KYDD 4KSLC 2WX0A 3PS6A 2D07B 5E6OA 3U30A 3UINB 4TKNA 1V80A 3IBEA 1VCBA 3NZUA 3PRMB 2N7EA 2ZCCA 1LFDA 2MBEA 4FHJA 4B6WA 2MRPA 1H4RA 2ZJDA 2IY1B 2LD9A 3PTFC 3ZTDA 1YJ1A 3ALBA 1ZKHA 4HPMB 3U8ZA 4AOFA 3VH3B 3ZLZA 5FR6A 4ANWA 2GBJA 2HD5B 1WRDB 2N9EB 2JPHA 2KKCA 1UGMA 2G45B 2O6VD 3AXCA 2XBBC 1RLFA 4W9IA 3A4RA 2LZ6A 1OEYJ 2IO2B 1J0GA 3EC8A 4WQOB 4KZ0A 1WMHA 1E8YA 3M62B 1P98A 2ZNVC 2JRHA 3QIJA 1E90A 4BKSA 4RM8A 2FCQA 3JSVB 3EFUA 5J18A 2M1MA 4II2B 4OVUA 1KJTA 2GBNA 5C1ZA 2NVUI 4G0NB 2JZ3B 2FUHB 1Q5WB 3ECIA 2LI5A 2KXJA 3L08A 1BT0A 2FNJB 2NBVB 5CX3A 3RULA 4BOSC 1S3SG 4JGHB 2J0JA 2BYVE 3UIOB 3CF6E 2BKRB 4MDKE 3GOEA 4AUQC 4IW0A 5L83A 1V2YA 3DVNU 3R7QA 2KK8A 3LJ3A 3PV1A 4GN1A 5D94A 1RAXA 2MBQA 3B0AA 2MA9B 2WWZA 2LGYA 2M17A 1WZ0A 3PLVA 3DVNV 3A1QA 2AYOB 2KMCA 4HDOA 3V6EB 4BBNF 4DBGA 2LXCA 3RCZA 3RYTA 1J8CA 3TBLD 2CHWA 3VAWA 3WANA 3VQIA 2KX3A 1XT9B 1WY8A 1VD2A 3VXWA 4HVBA 2ZNVB 4II3B 2KHWB 3AU4A 2J0MA 3H6NA 3NOBA 4I6LB 2K8CA 1IYFA 2WDTB 4CYEA 4DWFA 4BKGA 1V81A 4MSQB 2L0FA 4I6NB 4HLEA 5JHBA 1U4AA 2R2OA 2KQ7A 3V62A 3A4SC 4EUTA 4IWPA 4BFRA 3OJ3A 2IZVB 2CU1A 4J6IA 1TBEA 3ZDTA 1I42A 3VUYA 4W9DA 2MQJA 3RD2A 2V3SA 1ISNA 1H8CA 1NDDA 2JF5A 2KTRA 2J7QB 4FJZA 1R4MI 2KTFA 1OGWA 2N9XA 2I1KA 2ZCBA 2KTRB 3O65B 2L0TA 1WE7A 3NZSA 4BOZB 2K8HA 3X23A 3W1SC 2JWZA 1P3QU 1X1MA 2W9NA 2MP2B 1SE9A 3W1SA 3WAPA 3VDZA 3PPAA 2EKEC 1SGHA 3QWZB 3ZKJC 3HIZA 5AZHA 2KLCA 2KQSA 1YD8U 3IG3A 5J17A 5JHAA 5KHOA 1FXTB 2GBKA 2EMSA 2LGDA 2V4LA 3MTNB 5TR5A 3VTUA 3ML8A 1TZ1A 2AWTA 5LXHA 3ML9A 2JT4B 2HJ8A 4GIVA 2JRIB 1WR1A 4GDLA 4AJYB 3ZVVA 4IM2A 2Z0DB 3VTVA 3SHQA 5EDSA 3NY5A 3Q3FA 5D6JB 4DHZB 1WE6A 2IBIB 4TV3A 4EOYA 5HKHA 2JY6A 3WAMA 2REXA 3DCGA 1UH6A 1WX8A 2FCSA 2FCNA 2XK5B 2BGFA 3ZIMA 1EO6A 4MM3A 5LXIB 2L05A 2KNBA 1WGDA 3RT3B 4BKSD 4AJWA 4HDQA 3KYCD 4W9GA 1WM2A 1WM3A 1E7VA 3DPDA 4LJPB 5G2NA 2KWVB 4WJQA 2DZMA 2G3QB 5DPWA 1D3ZA 1Q1OA 5LLIA 4MSMB 1CMXB 2DHZA 4FHKA 1XQQA 2GMIC 3WALA 1MG8A 2YVCA 4FJVB 2KD0A 1WI0A 4WWPA 2KJRA 2BYFA 2WX1A 4HPLB 4NJ6A 2JVCA 4I6PA 4KDIC 2EMTA 3DVGY 3VUXA 1YX5B 2PJHA 1WJ4A 2NCNA 1WGGA 4F8CB 3LDZE 3PT2B 4PYZA 1UBQA 4JQWC 4KZCA 4IM3A 2KDIA 3KW5B 2ZVNA 4MGIE 4ZRJA 2R2QA 2CKHB 3JSVA 2M8SA 2BPSA 4MJSA 1WGYA 4W9LA 4FBJB 3V6CB 4GU2A 4GOCA 3PHWB 4GMVA 4WWOA 2ZPYA 1GC7A 4EKUA 2MBBB 3MJWA 4HCPB 1WXSA 3IHPC 3APCA 2A4ZA 2MSED 4KDLB 4NAWB 3APDA 1WR6E 4HK2A 3JVZX 2D3GA 5CHWA 1WX7A 4WAAA 3TMPB 5AZGA 4ZDVA 1YQBA 1E7UA 2GBRA 2MW5A 2KFJA 1AARA 3VUWA 2OOBB 3PRZA 3VVWB 3QCAA 4A3OA 2DYBA 4EZLA 2M0XA 1NBFC 1P0RA 1WJ6A 3UIPB 4K7UA 3ZDMC 1UBIA 4E74A 3A9JA 3JW0X 2L00B 2J0KA 3DBHI 3DOWA 4WWNA 1RFAA 2KWUB 3DBLI 4HWIB 4GSWA 2GBMA 1V9JA 2NBWB 2HE7A 2KFKB 4GGQA 2JUOA 3KH0A 4XX5A 4W9FA 4GDLB 2N4FA 5JH5C 3N3KB 1C3TA 3CSFA 2IO1B 3S2AA 1E8ZA 3H7PA 2KJHB 3V60A 3W1YA 1IP9A 2KOXA 1L2NA 4GDKA 3DBSA 5BO4B 3ZRFA 2KJ6A 3X0WA 3PGEA 3UGBB 4CO7A 2GOWA 4DHJB 2CHXA 2NBUA 2AL6A 2PPHA 5J2RA 1WXVA 4IWOA 1PQSA 2LASA 3CSTA 4TQ0A 2AEHA 1YX6B 3P2BA 4FADA 2C60A 3N30A 3H1UA 4K1RB 5CTRC 2K39A 3VFKA 4LJOB 4FJYA 4W9CA 1LXDA 3KUCB 1T0YA 1KLVA 2MBOA 4DDID 4JIOU 3PZDA 5IAAC 2IO0B 3ONSA 1E8WA 2NPTB 1V86A 3UQAA 1WXAA 3A9JB 2I1JA 1HE8A 1WFYA 5CHVC 2KC1A 1SIFA 4URKA 4G3XB 3BY4B 1K8RB 2V1YA 4E3CA 4F7ZA 4P7IA 2WYQA 3MHSD 2N7DA 3ZNHB 4DDGD 2KDBA 2C7MB 2KDEB 4WJNA 2L7RA 2XEWA 3ZUNA 2DYOA 1KM7A 4TUUA 4M0WB 2YLMA 3L17A 3ZTCA 5D7GA 3L0WB 3H7PB 5JZEB 1E5WA 3C0RB 4LCDE 4PS7A 5DPTA 2JXXA 4NY0A 5KHQA 1M94A 2KDFB 3QJZA 2BKFA 2RSUA 5D2MB 3A33B 4F1SA 3KVFB 3L54A 1L7YA 5AZFA 3TIXA 2RD0A 2O6VB 3SDLC 2KN5A 3QK0A 3T8MA 2HTHA 1WF9A 2ZZPB 2FAZA 3DDCB 3M3JA 4HXDA 1OTRB 5G55A 1Y8RC 2O2VB 4KVGB 4MGZE 3QAQA 4K7SA 4MH0E 4ZRKA 3UF8A 2UYZB 4A20A 2MWSB 2KC2A 2QHOA 3K9OB 4DHZE 2DX5B 4NNJB 1A5RA 3A1QB 4GB9A 4PS3A 1V5OA 2L8JA 3GZNI 4DXAB 1UZXB 2MBHA 4DK5A 1GG3A 2LRUA 3DVGX 2KO3A 4W9KA 1ZGUB 2RPQA 5E6NA 1QZEA 2C9WB 4MGYE 3UQBA 4A3PA 3M95A 3SU8X 1WZ3A 4FLHA 4JLCA 4WJPA 3HHMA 3OAWA 4NQLB 4MEMA 4ANXA 3ZO5B 5GMVA 4E71A 3SD5A 4IG7B 2K25A 3AU5A 2G4SA 2C7HA 3ZNID 2LWPA 2A5UA 1RRBA 1IPGA 2N1VA 2K6QA 2Z59B 3ZRCA 3QHTA 3EHVA 4NPNA 3RUIB 1UELA 2DZJA 4KSKC 4W9EA 3APFA 3CMMB 2DAJA 3H7SA 1EUVB 4ZRIA 4BVUC 2Y5BB 2DENB 3IFWB 4FN2A 3ZNGC 4AP4C 3DBRI 3ZNZB 2L76A 1LM8B 2KFKA 1V6EA 1C1YB 3T9LA 3PREA 2CR5A 2KMAA 4K7WA 5AEKB 2C5LC 4M8NA 2AL3A 2Z0EB 3N32A 3KUZA 3BINA 2B3AA 3ZW3A 5IA7A 5DPSA 2LRWA 4YL8A 3DQVA 2MLBA 4AWJA 2IYDB 3NHEB 4GDKB 4EZKA 4LDTD 4ICVA 2NS5A 2K1FA 2LUEA 3HK0A 2IY0B 2CS4A 3A9KA 3Q3JA 4ICUA 1OEYA 3JYUA 1WH3A 1GUAB 3ENEA 4IUMB 3U7DA 2MCNB 1EF5A 2FIFA 2XK5A 1WYWB 3L16A 2D2QA 5E6PA 3K9PB 4FA6A 4W9JA 3A9KB 3B08A 4B9KA 1J19A 4KV2A 3QC8B 2LGXA 3KUDB 1G6JA 2BF8B 2G4DB 2KLGA 3QARA 3WIMA 2N1WA 4XZ4A 1GC6A 3TJPA 2DYMA 2O6VA 2NPTA 4OVVA 4WJOA 2LVQA 2BWFA 2MP2A 3VH4B 1WX9A 4ASWC 2PE9A 2UWQA 1TGZB 3RZFA 2N9PC 4GXBA 4NJ7A 2D10A 2L3ZA 4MELA 2BWES 3OLMD 4JL9A 3NS8A 2DZIA 3WA0A 3TCAA 1E8XA 4EZJA 1KOTA 4EFOA 4MGKE 2D11A 1WGHA 1GNUA 3PRPB 4PS8A 2FCMA 4W9HA 2KZRA 1P9DU 2M4NA 2KANA 2RR9A 3R7RA 2LVOA 2FIDA 2K6DB 2KWCA 3VHTC 3TL5A
chains in the Genus database with same CATH superfamily
1EWCA 1PGBA 3SFDB 2GB1A 1SJED 4M8MA 4TQ1A 3V61A 1F1HA 2WP9B 3ZJUA 3I3TB 1GJZA 2ZVOA 1XLQA 2CJNA 3MC0B 2VZKB 4K81A 1L0XB 1GPXA 2ASQA 2BS3B 4KIKA 4RM9A 4QAYA 4ZYNA 1IGDA 4IWQA 1WMHB 3HM3A 1V5TA 3IVFA 3WAOA 2ZEQA 4UDUC 1CK1A 4LDTB 3Q14C 3RZWC 2R61A 1RFKA 4IM0A 4KSLC 3U30A 2EELA 3B9JA 3ZXVA 3NVWA 4B6WA 3PTFC 1YJ1A 3VH3B 5FR6A 2GBJA 2N9LA 1WRDB 2G45B 1QOAA 3DBRB 2MJ3A 2LZ6A 1UGJA 1SSNA 2IO2B 3M62B 4BKSA 4RM8A 1UWXA 4JWUC 3B2FA 5IKCM 2WXMA 1TIFA 2WXHA 3W9CB 4G0NB 2FUHB 1Q5WB 3BZDB 2PIAA 2N9KA 2NBVB 5CX3A 3GP7A 3NZ3A 1N5WA 2BYVE 2BKRB 4MDKE 3GOEA 4AUQC 4IW0A 3DVNU 4RGTA 2MA9B 3DVNV 1C77A 1FMAD 3RYTA 2CHWA 4XGAB 1WY8A 1VD2A 1PGXA 2J0MA 3H6NA 1IYFA 2BW2A 3NG0A 2WDRB 4BKGA 2L0FA 4I6NB 1U4AA 3WCQA 2PKOA 3RD2A 3PO0A 3BYYB 1SE3A 2LGIA 4HROA 3ZJTA 1FIQA 3NZSA 2JSVX 1ZE3D 2JWZA 1X1MA 2W9NA 1FRRA 2BS2B 4KGSA 2FBWB 2EKEC 3QWZB 3ZKJC 3IG3A 1YD8U 5TSSA 2EMSA 5LXHA 2JRIB 3ZVVA 3VTVA 3MC8A 4EOYA 5HKHA 2BBCA 3IAM1 1UH6A 2FCSA 2FCNA 2WDVB 1EO6A 1T6BX 4IDIA 1C76A 1PYWD 3RT3B 4AJWA 2H89B 2K3UA 1WM3A 3DPDA 2HJ1A 1J7AA 3E56A 5G2NA 2KYWA 5G5HA 2G3QB 3R2TA 1N61A 5EE0A 2YVCA 4WWPA 2WX1A 2VH1A 3W5UB 4ITKA 2EMTA 1MFWA 2DLBA 1UBQA 1GOZA 4IM3A 1E10A 5HI1A 3T3OA 2VH2A 1RYJA 3AE9B 3JSVA 2BPSA 2WQYB 1FNUA 4FBJB 3AE5B 1ZP0B 4GMVA 2ZPYA 2MBBB 3MJWA 2CJOA 1SBBB 3IHPC 2JYTA 3RNBC 3APDA 1RWSA 2W3RA 3JVZX 2GBRA 2OOBB 2QJLA 3NJTA 3PRZA 1ZXIA 4A3OA 4EZLA 1SB3C 1NBFC 4K7UA 3EUB2 2BB6A 3AECB 3RI7C 3A9JA 3JW0X 1NEKB 3DBHI 2WXLA 4DQOC 4GSWA 2GBMA 2NBWB 3J9CA 4YSZB 5AUKA 5BYSA 2JUOA 3KH0A 1L0VB 1FFVA 1HTOA 2N4FA 5JH5C 4M0WA 1C3TA 1L2NA 3W1YA 2GOWA 4DHJB 1L5PA 1ZDXA 3AE2B 1WXVA 2W3SA 3RN9C 1JWUD 2PMVA 1XLPA 2AEHA 3P2BA 1KLUD 2C60A 1LXDA 2MBOA 2NPTB 1WRIA 3A9JB 3P1MA 1HE8A 2KC1A 4URKA 2LGSA 4G3XB 1K8RB 2V1YA 4E3CA 2PTLA 2SEBD 2L7RA 4N59A 1FNVA 2Y5PA 3ZUNA 3H7PB 5T8IA 5JZEB 4LCDE 2KDFB 3Q3NC 4D2KA 1T0RC 5HFYA 3TIXA 2EKIA 3QK0A 3DDCB 2D5GA 2W55A 3UF8A 3IAS1 4RH6A 2MWSB 2QMTA 4NNJB 1PDXA 4GLSC 1FM0D 5C2TB 1L4DB 2MBHA 4C4VA 4M01A 2KO3A 4WAFA 1QZEA 2C9WB 4MGYE 3N1XC 1JALA 1F2RI 4NQLB 5GMVA 3SD5A 2BTEA 1V1PB 4IG7B 2K25A 1EU4A 3KWLA 1QOBA 1IPGA 2N1VA 2Z59B 2PW9A 2IGGA 3ZRCA 4NPNA 2DZJA 4MH8A 1JW9D 3IFWB 4AP4C 3DBRI 4A8XC 3P4SB 2Y3AA 2OJWA 4RNAA 3T9LA 1UUPA 2I2YA 1V1OA 3BINA 1DYQA 2B3AA 1T0QC 3CIRB 4N58A 3DQVA 2MLBA 4AWJA 2IYDB 3NHEB 1T3QA 4LDTD 1I4XA 4KKIA 2CS4A 1WH3A 1GUAB 4IUMB 3U7DA 2WXNA 3AE3B 2QSDA 3A9KB 2WXOA 4KV2A 4WH4A 3QC8B 5BYRA 2LGXA 2BF8B 2G4DB 2KLGA 3GB1A 3HVDA 3QARA 3RNGC 4XZ4A 5C3JB 1GC6A 1V8CA 2PVGC 4WJOA 2QC8A 4ASWC 2PE9A 2LEKA 1DOXA 1EU3A 3TCAA 4EZJA 5BYQA 4MGKE 1XF5L 2D11A 1GNUA 1T5XD 1YOVB 3MHZA 1C4AA 2K6DB 3VHTC 2RDHA 4FULA 3H9DA 3EECA 4ANVA 4BKTA 1WJNA 4X57B 3AI5A 3OJ4B 5C23A 3VR8B 2N0SB 3AN1A 2BYEA 4HCNB 4IC7B 4RMAA 1F9JA 1EF1A 1XCTL 4DHJD 1B1ZA 1WGRA 1ZPSA 3C8YA 1AYFA 4J3OD 3QX1A 4ANUA 3L13A 2O2VA 3D32A 2K8BA 1YMHE 2UU7A 4WWMA 1WIAA 2PEAA 1YIWA 3Q8EA 1GB1A 2E3TA 1TS3A 3T3NA 3M63B 4PYUA 1UD7A 2JZZA 2MX2A 1Z2MA 3AMZA 2TSSA 1XO3A 1GB4A 3NUHB 5E6OA 5I4DA 3NZUA 3PRMB 3RFZB 2WXJA 2MBEA 4FHJA 1H4RA 2ZJDA 1XLNA 3TEZA 3ZLZA 2HD5B 2JPHA 1ENFA 1UGMA 2KKCA 2O6VD 3AXCA 1RLFA 2K22A 4W9IA 4US8A 1TZOA 1WMHA 1E8YA 1HXYD 4LNIA 2FCQA 2KN4A 2MHJA 4II2B 4OVUA 1KJTA 2GBNA 4WURA 3V3XA 3R8BA 3U2SC 3ECIA 2LI5A 2L52A 3GZNB 1CZPA 2Z8LA 1C4CA 3CF6E 1L0YB 3R7QA 3LJ3A 3PV1A 1QILA 4EE2A 5D94A 4MT5A 2VZKD 1WZ0A 3MC9A 4A55A 4HDOA 4DBGA 3BVMA 1F77A 2RMMA 3RCZA 3VAWA 3WANA 3IXSA 1XT9B 2MJEA 2ACZB 2K8CA 3P63A 4CYEA 1V81A 1DOYA 3FAHA 3A4SC 3AEBB 3V62A 4BFRA 3OJ3A 2IZVB 1TBEA 3ZDTA 2NMQA 1H8CA 2D3AA 2K0PA 1N5XA 4RGMA 2J7QB 3Q69A 3R2IA 2N9XA 1JWBD 2ZCBA 3O65B 2L0TA 2LUMA 4BOZB 2K8HA 3X23A 3W1SC 1P3QU 1SE9A 3W1SA 3WAPA 3VDZA 3HIZA 2X38A 5J17A 5KHOA 2V4LA 2GBKA 3MTNB 4JX1C 5TR5A 3VTUA 4ANWA 2AWTA 4Q2JA 4XWWA 1WR1A 4IM2A 4A90A 2OEDA 2KWDA 4H2AA 5D6JB 2QCZA 3WAMA 3DCGA 1WX8A 4C56C 1YN3A 3N1ZC 3VRBB 4C80A 1TYGB 1TY2A 4HDQA 1WM2A 2M56B 4HJGE 4LJPB 2BT6A 2KWVB 1Q1OA 3EFCA 4FHKA 2GMIC 3WALA 2KD0A 1WI0A 3VR9B 2JVCA 2MH7A 2KMMA 2I38A 3PT2B 4JQWC 3P4QB 2KDIA 3KW5B 2ZVNA 4MJSA 3Q3OC 1WGYA 4W9LA 4GU2A 4GOCA 3UI3A 4WWOA 2INPE 2AQ1B 4YXDB 2LMCA 2A4ZA 2MSED 2JZPA 1K50A 1WR6E 2WXIA 5CHWA 3TMPB 5AZGA 3I63C 1E7UA 2KFJA 1F2RC 1CQVA 2GI9A 2DYBA 1CJEA 1JWMD 4LLGM 2M0XA 3ETRA 4LNKA 1UBIA 2J4XA 1E7PB 2L00B 2J0KA 3DOWA 4WWNA 2BQQA 4HWIB 1V9JA 2AX5A 1JQ4A 4GGQA 4W9FA 4GDLB 3RNAC 1HEZE 2IO1B 3S2AA 3H7PA 2KJHB 1IP9A 1N60A 2KOXA 2KJ6A 2DBYA 4CO7A 2CHXA 3ABVB 1ESFA 2NBUA 3AEFB 4JPSA 4IWOA 4TQ0A 1MHHE 1YX6B 1WXQA 1YJIA 4K1RB 2K39A 4L2YA 3VFKA 5EE1A 1T0YA 4DDID 5IAAC 2IO0B 3BY4B 4NJCA 1JRPA 4P6VF 4P7IA 3MHSD 3ZNHB 4DXGA 2KDBA 1TS5A 4A6QA 2LFIA 5D3DA 1KM7A 4TUUA 3RNEC 4M0WB 4YTNB 1MHXA 3C0RB 2BYTA 5DPTA 2JXXA 4NY0A 1XCQL 3ZYYX 4ZRPA 3QJZA 1TKYA 5IO9A 3A33B 4F1SA 2PVOD 4LNFA 1MPEA 3BIID 1JWAD 1L7YA 4MM3B 2O6VB 3SDLC 2KN5A 1C79A 4RF0A 1C9FA 2N7JA 2JQRB 5G55A 2O2VB 4MGZE 1WWTA 3QAQA 4K7SA 4ZRKA 1HZ6A 1N6ZA 3AE8B 4A20A 2IJ0A 2KC2A 1A5RA 5HG2A 1V5OA 2OHFA 3GZNI 4DXAB 1GG3A 1NYRA 1JWSD 2INDC 1YJJA 5E6NA 3BK1A 3M95A 3SU8X 4WJPA 1WZ3A 1VJKA 3ZO5B 5BMGA 5IN7A 1RRBA 4KGTA 4ACFA 1LO5D 1UELA 2IGHA 4KSKC 4W9EA 3APFA 3CMMB 3B2GA 4AS1A 3ZNZB 1IBXA 2ICIA 3AE6B 2CR5A 4M00A 2C5LC 3AV8A 4LTUA 3N32A 3BVGA 3ZW3A 2WXFA 4ICVA 2K1FA 3JYUA 1WYWB 4FA6A 3U4EG 2KT7A 1J19A 3KUDB 3AB5A 3Q3MC 3WIMA 2N1WA 2DYMA 2O6VA 1FEHA 1AWDA 4OVVA 2LVQA 1PUTA 2BWFA 3VH4B 1WX9A 4HKQA 2N9PC 4LNNA 2L3ZA 4MELA 3NS8A 3FILB 3WA0A 1MG4A 1E8XA 1LGRA 1WGHA 1P9DU 1UF0A 2KANA 1D5XC 3GS2A 5FKAC 1ACCA 2LVOA 1SJHD 1VZ6A 2WLBA 4C00A 1C78A 4IKGA 3PZ8A 1Q0WB 2PE6B 5CHFA 4PK1A 5L95C 2C7NB 4B95A 3PVLA 2FUG1 4JWSC 1FCLA 3HM6X 2RGFA 4XC2A 3R66C 4KX6B 1FCCC 4USAA 3VTWA 2D3BA 3PSEB 4G11A 1WJUA 3R3MA 1S1QB 4G50A 1WXMA 1OQQA 3RMKC 2IPKD 5DCNA 4MJSB 1JRUA 4KIKB 2ZPNA 2OJRA 4RF1A 1ET6A 1P1AA 3B1LX 2CHZA 2E6XA 1OQYA 2WNMA 1R4NI 2QEJC 1V1PA 2LJ5A 1NI2A 3KYDD 3TUOA 3PS6A 1QQRA 1YN4A 2D07B 4TKNA 1V80A 1KFYB 3IBEA 2ZCCA 2WDQB 1LFDA 3SEBA 2MRPA 2QDFA 2IY1B 3ZTDA 4AOFA 3ALBA 2AQ3B 3Q2AC 3U8ZA 3E9SA 3RNCC 3Q8AA 3ZGZA 1TJEA 3EC8A 4WQOB 1IUEA 1P98A 2QIEB 5D3IB 2ZNVC 2JRHA 1C4PA 5JXVA 1D5MC 3EGRA 3JSVB 1IBXB 3EFUA 4ARCA 1I4QA 1QOGA 2NVUI 3Q6BA 2KXJA 2MJDA 3L08A 3L4PA 3NVZA 2FNJB 1S3SG 2J53A 5L83A 1V2YA 2MBQA 2WWZA 2M17A 3V6EB 3PLVA 2AYOB 3AEAB 1J8CA 1F0ZA 3VQIA 2KX3A 3VXWA 2LHDA 2ZNVB 4II3B 2KHWB 3AU4A 5AUIA 4DWFA 3URYA 4MSQB 5JHBA 2KQ7A 3ZXRA 2J52A 1KH0A 2CU1A 4J6IA 3DHIC 1I42A 2MQJA 1YNTE 2V3SA 1ISNA 4P1BC 3N9YC 1R4MI 1OGWA 1UWMA 4OHJA 1KF6B 3GE8C 3P42A 2PLPA 4YWGG 1XEEA 4PT5A 3PPAA 5AZHA 1YQ3B 5JHAA 1FXTB 2LGDA 5BMHA 2JT4B 4GIVA 4AJYB 1VR9A 2Z0DB 3SHQA 4TMAB 4B0EA 4DHZB 1WE6A 1R7SA 4ZOHC 3MJ5A 5IOIA 2FE8A 5LXIB 1JMLA 1WGDA 1FPYA 3OG5A 3HRDD 1VDVA 1E7VA 1NVID 4TSSA 1ZUD2 4WJQA 1PFDA 4YSXB 5DPWA 5LLIA 3I9V1 4MSMB 2DHZA 4AQ7A 3NRZA 4FJVB 2KJRA 4HPLB 4RCOA 4I6PA 2CU3A 3DVGY 2NCNA 1WGGA 3SFEB 2INNE 2NTSA 4MGIE 4ZRJA 1L6UA 2V3PA 2CKHB 1YN5A 2M8SA 1T0SC 2G9HD 4XYCA 4IOIE 1FD6A 4HCPB 1WXSA 3APCA 2AQ2B 4KDLB 4HK2A 3EA6A 2D3GA 4WAAA 3LB8C 4US9A 1TT5B 5HHDG 3VVWB 4L1BA 2DNFA 3Q8CA 4XWTA 1WJ6A 3UIPB 1RM6C 3ZDMC 2X8XX 1XLOA 1RFAA 3DBLI 1MJDA 4XX5A 4ZHPA 3W2DA 3N3KB 1E8ZA 3V60A 4GDKA 5H8YE 4OW0A 2AL6A 2PPHA 1PQSA 2LASA 1I4GA 3H8HA 4FADA 3N30A 1Q10A 1E6EB 2J42A 4K3BA 1BUIC 3KUCB 4JIOU 3PZDA 3ONSA 1E8WA 4YTPB 3UQAA 1WYGA 1OQRA 1SIFA 1FFUA 2RDBC 2WYQA 3N20C 3OWEB 1ZOYB 4WJNA 1KLGD 1NI3A 2DYOA 3SR6A 3ZTCA 5D7GA 4N6EB 4C7ZA 3L0WB 5EE3A 1E5WA 4PS7A 5KHQA 2RSUA 4P1CC 3KVFB 3NVVA 1N62A 5AZFA 2RD0A 3T8MA 1K51A 1VZ8A 2ZZPB 1HTQA 2HDEA 4K3CA 4DHZE 2DX5B 3A1QB 4GB9A 1FRDA 1VRAB 1ET9A 3PZ7A 1UNSA 1SE2A 3DVGX 3FILA 4JE3B 3AEDB 4W9KA 3UQBA 4REZA 2ONQA 4A3PA 1HZ5A 4FLHA 3KLSX 3OAWA 3MFGA 4E71A 3IT6B 2B76B 3ZNID 2V4IB 3QHTA 4CQNA 3EHVA 3RUIB 3KWVA 3H7SA 1EUVB 4XE0A 4BVUC 2Y5BB 4FN2A 1K52A 1LM8B 1V6EA 3P4PB 2KMAA 4ZHOA 4M8NA 3NS1A 3CWIA 3KUZA 4C4VB 1BMLC 5IA7A 2LRWA 4YL8A 1J7CA 4GDKB 4OVZA 3A9KA 3Q3JA 3V05A 3ENEA 1EF5A 3L16A 2WXKA 4W9JA 5FK9C 2UWQA 3RZFA 4GXBA 4NJ7A 2D10A 3TSSA 2BWES 2IGDA 2Q5WD 4EFOA 4WIPA 3PRPB 4PS8A 2W54A 2KZRA 1QKZA 2RR9A 4DXFA 2G1EA 4S0RA 3TL5A 3I5JC 1FO4A 2W82A 4NAWA 3GE3C 4EEWA 1XD3B 4M02A 2IO3B 4LK0M 3BK2A 1TY0A 2LVPA 3PLUA 5FR3A 2WGSA 2V0GA 1QF6A 1YQ4B 4HEA1 4NQKE 2LXAA 4BBNC 2XN9C 2VRRB 2K5PA 3KQ4A 3RPFC 2NR2A 3BWUD 1ZXHA 2KVRA 3U52E 1MI0A 1V49A 3AULA 5DPRA 1NENB 2DAFA 4BZAA 1TTNA 2LJIA 1JCKB 1ZW7A 4N9F4 1OFFA 4CHKA 5EE9A 1N63A 3QA8A 4HJKA 1LQBA 1Z5SB 1ROEA 2DZKA 1I35A 2KX0A 3L10B 3DBHB 2L1AA 2WHIA 3P4RB 4HPPA 1V97A 3PHXB 3QQ8B 1D6EC 3U7ZA 2HTME 2WX0A 1BXTA 3UINB 1KLVA 2ZW0A 1VCBA 2N7EA 4P16A 2LD9A 1ZKHA 4HPMB 2N9EB 2H88B 1VZ7A 2XBBC 1DGJA 1HA5A 1R4MB 3A4RA 1M4VA 1E0ZA 1STEA 1OEYJ 1J0GA 3DHHC 1L6VA 2WXGA 4KZ0A 5MPOA 1E9MA 3AE1B 3QIJA 1E90A 3BVZA 5E6JA 5J18A 2M1MA 5C1ZA 2JZ3B 1AN8A 3DWMA 1FNWA 1BT0A 3O13A 3RULA 4BOSC 4JGHB 2J0JA 3UIOB 1HQRD 3AH7A 2KK8A 4YSYB 4GN1A 1B9RA 1RAXA 4NZLB 3B0AA 2LGYA 3A1QA 2KMCA 4KGRA 4BBNF 2LXCA 3TBLD 4FXCA 4HVBA 1TS4A 4I6LB 3NOBA 1I4RA 2WDTB 4HLEA 2R2OA 1D5ZC 4EUTA 4IWPA 3VUYA 4W9DA 1I7HA 2JYEA 3BYTB 2IDYA 1NDDA 2JF5A 2KTRA 3MP9A 2BB5A 1WGKA 3DHGC 3HVZA 4FJZA 2KTFA 3TEWA 2GLSA 4ZYSA 2I1KA 1DOIA 2KTRB 2BS4B 1WE7A 1ZDVA 1P7EA 1P7FA 2MP2B 2SAKA 1SGHA 3C19A 3Q8FA 2KLCA 2INCC 2KQSA 3Q8BA 3ML8A 1TZ1A 3ML9A 2ON8A 2HJ8A 4GDLA 2RDGA 5EDSA 3NY5A 3Q3FA 2IBIB 4TV3A 1FXAA 2JY6A 1AW7A 2REXA 2XK5B 2BGFA 3ZIMA 1EM7A 4MM3A 2L05A 2KNBA 4BKSD 3KYCD 4W9GA 3HUIA 4R3DA 1R4NB 2DZMA 1EWYC 5LNK1 1D3ZA 2WU2B 3LXFA 1CMXB 1XQQA 1MG8A 1JROA 2BYFA 4NJ6A 4KDIC 4O1NA 1K53A 2WS3B 3VUXA 1YX5B 2PJHA 3ZJVA 1WJ4A 4F8CB 3LDZE 4PYZA 1SEBD 4KZCA 2R2QA 1TKGA 3V6CB 1FXIA 3PHWB 1SIJA 1Y56A 4KKJA 4XDDA 1GC7A 2DWQA 4EKUA 4OZAA 4NAWB 1WX7A 4ZDVA 1YQBA 5IP4D 2KAJA 2MW5A 1AARA 3VUWA 1WSPA 1VLBA 3QCAA 4LNOA 1P0RA 4C7YA 4E74A 1KTKA 3AEGB 2KWUB 2WXRA 2HE7A 1A70A 2KFKB 2RPVA 3FKYA 1D4BA 3RNFC 1PGAA 3NVYA 3CSFA 1SE4A 2L32A 3DBSA 5BO4B 3ZRFA 5BMIA 3X0WA 3PGEA 3UGBB 1SXTA 5J2RA 4YT0B 3CSTA 4OZCA 2BVCA 3H1UA 5CTRC 4LJOB 4FJYA 4W9CA 1XXGA 3FC4A 1V86A 1WXAA 2I1JA 1WFYA 5CHVC 1IGCA 3TEXA 4F7ZA 2N7DA 4DDGD 2M19A 2C7MB 2KDEB 2NTTA 2XEWA 2D3CA 2YLMA 3L17A 4BAXA 2ZW1A 1M94A 2MEKA 3LYYA 4S17A 3N1YC 2BKFA 3DWGC 2V9HA 5D2MB 4RFBA 3ZQ4A 2LHEA 3L54A 4WQMA 3AE7B 3DBLB 2HTHA 1WF9A 1I4PA 2FAZA 4XDCA 2XNAC 3M3JA 4HXDA 1OTRB 1Y8RC 4KVGB 2JWUA 2JXTA 1TS2A 3VRAB 4MH0E 1KRHA 1SF0A 2UYZB 1F52A 2QHOA 3K9OB 2KQ4X 4PS3A 2L8JA 2KACA 1UZXB 4L23A 4NAMA 4DK5A 2LRUA 4ARIA 2GRIA 4OZBA 2WXPA 4ZRQA 1ZGUB 2RPQA 2KDMA 4JLCA 5G5GA 4ANXA 3HHMA 4MEMA 4HKZE 2WU5B 4MACA 3AU5A 2G4SA 2C7HA 2LWPA 1QT9A 2A5UA 2YEPF 1J7BA 2K6QA 4RGNA 4RGOS 1NYQA 2DAJA 4ZRIA 2DENB 2M0AA 3ZNGC 2L76A 5H92C 1MVKA 2KFKA 2Y5CA 1C1YB 2QILA 3PREA 5AEKB 4K7WA 3IT4B 4A9AA 2V3NA 2AL3A 2Z0EB 3TEYA 2KVZA 1QOFA 1TKEA 3AEEB 5DPSA 4YTMB 3W5VB 4EZKA 2NS5A 2LUEA 3HK0A 2IY0B 2JU6X 4ICUA 1OEYA 5GXGB 4HRSA 2MCNB 2FIFA 2XK5A 3AM9A 5E6PA 2D2QA 3K9PB 3B08A 4B9KA 1G6JA 2WXQA 3TJPA 2NPTA 2JX5A 2MP2A 2K9XA 1TGZB 1L4ZB 3OLMD 4B0MA 4JL9A 2YEPB 2DZIA 1KOTA 3I57A 2L83A 1GAQB 2FCMA 4W9HA 2M4NA 1QLBB 3R7RA 1I4HA 2FIDA 2KWCA 3AE4B
chains in the Genus database with same CATH topology
1Q0WB 4NAWA 2PE6B 4FULA 3H9DA 4EEWA 3EECA 5CHFA 4ANVA 1XD3B 4BKTA 1WJNA 4M8MA 5L95C 2IO3B 4X57B 4TQ1A 2C7NB 4B95A 3AI5A 3V61A 3PVLA 3OJ4B 2LVPA 5C23A 3PLUA 3I3TB 3HM6X 1GJZA 2BYEA 2RGFA 2ZVOA 4XC2A 3R66C 4HCNB 4IC7B 4RMAA 4NQKE 1F9JA 1EF1A 2LXAA 4K81A 4BBNC 2ASQA 2VRRB 1WGRA 3VTWA 4DHJD 3PSEB 4G11A 2NR2A 1WJUA 3R3MA 2KVRA 1S1QB 4KIKA 3QX1A 4G50A 4ANUA 3L13A 4RM9A 2O2VA 1WXMA 3D32A 1V49A 2K8BA 3AULA 4ZYNA 5DPRA 2DAFA 5DCNA 1TTNA 4MJSB 1JRUA 4IWQA 4KIKB 1WIAA 2ZPNA 2PEAA 1WMHB 2OJRA 1ZW7A 4N9F4 1P1AA 1YIWA 4CHKA 3HM3A 3B1LX 1V5TA 2CHZA 3IVFA 3QA8A 1OQYA 4HJKA 3WAOA 1LQBA 1Z5SB 2ZEQA 4LDTB 3M63B 1R4NI 2DZKA 1I35A 3RZWC 4PYUA 2KX0A 3L10B 1UD7A 2JZZA 4IM0A 2MX2A 2LJ5A 3QQ8B 1NI2A 1Z2MA 3PHXB 3KYDD 4KSLC 2WX0A 3PS6A 2D07B 5E6OA 3U30A 3UINB 4TKNA 1V80A 3IBEA 1VCBA 3NZUA 3PRMB 2N7EA 2ZCCA 1LFDA 2MBEA 4FHJA 4B6WA 2MRPA 1H4RA 2ZJDA 2IY1B 2LD9A 3PTFC 3ZTDA 1YJ1A 3ALBA 1ZKHA 4HPMB 3U8ZA 4AOFA 3VH3B 3ZLZA 5FR6A 4ANWA 2GBJA 2HD5B 1WRDB 2N9EB 2JPHA 2KKCA 1UGMA 2G45B 2O6VD 3AXCA 2XBBC 1RLFA 4W9IA 3A4RA 2LZ6A 1OEYJ 2IO2B 1J0GA 3EC8A 4WQOB 4KZ0A 1WMHA 1E8YA 3M62B 1P98A 2ZNVC 2JRHA 3QIJA 1E90A 4BKSA 4RM8A 2FCQA 3JSVB 3EFUA 5J18A 2M1MA 4II2B 4OVUA 1KJTA 2GBNA 5C1ZA 2NVUI 4G0NB 2JZ3B 2FUHB 1Q5WB 3ECIA 2LI5A 2KXJA 3L08A 1BT0A 2FNJB 2NBVB 5CX3A 3RULA 4BOSC 1S3SG 4JGHB 2J0JA 2BYVE 3UIOB 3CF6E 2BKRB 4MDKE 3GOEA 4AUQC 4IW0A 5L83A 1V2YA 3DVNU 3R7QA 2KK8A 3LJ3A 3PV1A 4GN1A 5D94A 1RAXA 2MBQA 3B0AA 2MA9B 2WWZA 2LGYA 2M17A 1WZ0A 3PLVA 3DVNV 3A1QA 2AYOB 2KMCA 4HDOA 3V6EB 4BBNF 4DBGA 2LXCA 3RCZA 3RYTA 1J8CA 3TBLD 2CHWA 3VAWA 3WANA 3VQIA 2KX3A 1XT9B 1WY8A 1VD2A 3VXWA 4HVBA 2ZNVB 4II3B 2KHWB 3AU4A 2J0MA 3H6NA 3NOBA 4I6LB 2K8CA 1IYFA 2WDTB 4CYEA 4DWFA 4BKGA 1V81A 4MSQB 2L0FA 4I6NB 4HLEA 5JHBA 1U4AA 2R2OA 2KQ7A 3V62A 3A4SC 4EUTA 4IWPA 4BFRA 3OJ3A 2IZVB 2CU1A 4J6IA 1TBEA 3ZDTA 1I42A 3VUYA 4W9DA 2MQJA 3RD2A 2V3SA 1ISNA 1H8CA 1NDDA 2JF5A 2KTRA 2J7QB 4FJZA 1R4MI 2KTFA 1OGWA 2N9XA 2I1KA 2ZCBA 2KTRB 3O65B 2L0TA 1WE7A 3NZSA 4BOZB 2K8HA 3X23A 3W1SC 2JWZA 1P3QU 1X1MA 2W9NA 2MP2B 1SE9A 3W1SA 3WAPA 3VDZA 3PPAA 2EKEC 1SGHA 3QWZB 3ZKJC 3HIZA 5AZHA 2KLCA 2KQSA 1YD8U 3IG3A 5J17A 5JHAA 5KHOA 1FXTB 2GBKA 2EMSA 2LGDA 2V4LA 3MTNB 5TR5A 3VTUA 3ML8A 1TZ1A 2AWTA 5LXHA 3ML9A 2JT4B 2HJ8A 4GIVA 2JRIB 1WR1A 4GDLA 4AJYB 3ZVVA 4IM2A 2Z0DB 3VTVA 3SHQA 5EDSA 3NY5A 3Q3FA 5D6JB 4DHZB 1WE6A 2IBIB 4TV3A 4EOYA 5HKHA 2JY6A 3WAMA 2REXA 3DCGA 1UH6A 1WX8A 2FCSA 2FCNA 2XK5B 2BGFA 3ZIMA 1EO6A 4MM3A 5LXIB 2L05A 2KNBA 1WGDA 3RT3B 4BKSD 4AJWA 4HDQA 3KYCD 4W9GA 1WM2A 1WM3A 1E7VA 3DPDA 4LJPB 5G2NA 2KWVB 4WJQA 2DZMA 2G3QB 5DPWA 1D3ZA 1Q1OA 5LLIA 4MSMB 1CMXB 2DHZA 4FHKA 1XQQA 2GMIC 3WALA 1MG8A 2YVCA 4FJVB 2KD0A 1WI0A 4WWPA 2KJRA 2BYFA 2WX1A 4HPLB 4NJ6A 2JVCA 4I6PA 4KDIC 2EMTA 3DVGY 3VUXA 1YX5B 2PJHA 1WJ4A 2NCNA 1WGGA 4F8CB 3LDZE 3PT2B 4PYZA 1UBQA 4JQWC 4KZCA 4IM3A 2KDIA 3KW5B 2ZVNA 4MGIE 4ZRJA 2R2QA 2CKHB 3JSVA 2M8SA 2BPSA 4MJSA 1WGYA 4W9LA 4FBJB 3V6CB 4GU2A 4GOCA 3PHWB 4GMVA 4WWOA 2ZPYA 1GC7A 4EKUA 2MBBB 3MJWA 4HCPB 1WXSA 3IHPC 3APCA 2A4ZA 2MSED 4KDLB 4NAWB 3APDA 1WR6E 4HK2A 3JVZX 2D3GA 5CHWA 1WX7A 4WAAA 3TMPB 5AZGA 4ZDVA 1YQBA 1E7UA 2GBRA 2MW5A 2KFJA 1AARA 3VUWA 2OOBB 3PRZA 3VVWB 3QCAA 4A3OA 2DYBA 4EZLA 2M0XA 1NBFC 1P0RA 1WJ6A 3UIPB 4K7UA 3ZDMC 1UBIA 4E74A 3A9JA 3JW0X 2L00B 2J0KA 3DBHI 3DOWA 4WWNA 1RFAA 2KWUB 3DBLI 4HWIB 4GSWA 2GBMA 1V9JA 2NBWB 2HE7A 2KFKB 4GGQA 2JUOA 3KH0A 4XX5A 4W9FA 4GDLB 2N4FA 5JH5C 3N3KB 1C3TA 3CSFA 2IO1B 3S2AA 1E8ZA 3H7PA 2KJHB 3V60A 3W1YA 1IP9A 2KOXA 1L2NA 4GDKA 3DBSA 5BO4B 3ZRFA 2KJ6A 3X0WA 3PGEA 3UGBB 4CO7A 2GOWA 4DHJB 2CHXA 2NBUA 2AL6A 2PPHA 5J2RA 1WXVA 4IWOA 1PQSA 2LASA 3CSTA 4TQ0A 2AEHA 1YX6B 3P2BA 4FADA 2C60A 3N30A 3H1UA 4K1RB 5CTRC 2K39A 3VFKA 4LJOB 4FJYA 4W9CA 1LXDA 3KUCB 1T0YA 1KLVA 2MBOA 4DDID 4JIOU 3PZDA 5IAAC 2IO0B 3ONSA 1E8WA 2NPTB 1V86A 3UQAA 1WXAA 3A9JB 2I1JA 1HE8A 1WFYA 5CHVC 2KC1A 1SIFA 4URKA 4G3XB 3BY4B 1K8RB 2V1YA 4E3CA 4F7ZA 4P7IA 2WYQA 3MHSD 2N7DA 3ZNHB 4DDGD 2KDBA 2C7MB 2KDEB 4WJNA 2L7RA 2XEWA 3ZUNA 2DYOA 1KM7A 4TUUA 4M0WB 2YLMA 3L17A 3ZTCA 5D7GA 3L0WB 3H7PB 5JZEB 1E5WA 3C0RB 4LCDE 4PS7A 5DPTA 2JXXA 4NY0A 5KHQA 1M94A 2KDFB 3QJZA 2BKFA 2RSUA 5D2MB 3A33B 4F1SA 3KVFB 3L54A 1L7YA 5AZFA 3TIXA 2RD0A 2O6VB 3SDLC 2KN5A 3QK0A 3T8MA 2HTHA 1WF9A 2ZZPB 2FAZA 3DDCB 3M3JA 4HXDA 1OTRB 5G55A 1Y8RC 2O2VB 4KVGB 4MGZE 3QAQA 4K7SA 4MH0E 4ZRKA 3UF8A 2UYZB 4A20A 2MWSB 2KC2A 2QHOA 3K9OB 4DHZE 2DX5B 4NNJB 1A5RA 3A1QB 4GB9A 4PS3A 1V5OA 2L8JA 3GZNI 4DXAB 1UZXB 2MBHA 4DK5A 1GG3A 2LRUA 3DVGX 2KO3A 4W9KA 1ZGUB 2RPQA 5E6NA 1QZEA 2C9WB 4MGYE 3UQBA 4A3PA 3M95A 3SU8X 1WZ3A 4FLHA 4JLCA 4WJPA 3HHMA 3OAWA 4NQLB 4MEMA 4ANXA 3ZO5B 5GMVA 4E71A 3SD5A 4IG7B 2K25A 3AU5A 2G4SA 2C7HA 3ZNID 2LWPA 2A5UA 1RRBA 1IPGA 2N1VA 2K6QA 2Z59B 3ZRCA 3QHTA 3EHVA 4NPNA 3RUIB 1UELA 2DZJA 4KSKC 4W9EA 3APFA 3CMMB 2DAJA 3H7SA 1EUVB 4ZRIA 4BVUC 2Y5BB 2DENB 3IFWB 4FN2A 3ZNGC 4AP4C 3DBRI 3ZNZB 2L76A 1LM8B 2KFKA 1V6EA 1C1YB 3T9LA 3PREA 2CR5A 2KMAA 4K7WA 5AEKB 2C5LC 4M8NA 2AL3A 2Z0EB 3N32A 3KUZA 3BINA 2B3AA 3ZW3A 5IA7A 5DPSA 2LRWA 4YL8A 3DQVA 2MLBA 4AWJA 2IYDB 3NHEB 4GDKB 4EZKA 4LDTD 4ICVA 2NS5A 2K1FA 2LUEA 3HK0A 2IY0B 2CS4A 3A9KA 3Q3JA 4ICUA 1OEYA 3JYUA 1WH3A 1GUAB 3ENEA 4IUMB 3U7DA 2MCNB 1EF5A 2FIFA 2XK5A 1WYWB 3L16A 2D2QA 5E6PA 3K9PB 4FA6A 4W9JA 3A9KB 3B08A 4B9KA 1J19A 4KV2A 3QC8B 2LGXA 3KUDB 1G6JA 2BF8B 2G4DB 2KLGA 3QARA 3WIMA 2N1WA 4XZ4A 1GC6A 3TJPA 2DYMA 2O6VA 2NPTA 4OVVA 4WJOA 2LVQA 2BWFA 2MP2A 3VH4B 1WX9A 4ASWC 2PE9A 2UWQA 1TGZB 3RZFA 2N9PC 4GXBA 4NJ7A 2D10A 2L3ZA 4MELA 2BWES 3OLMD 4JL9A 3NS8A 2DZIA 3WA0A 3TCAA 1E8XA 4EZJA 1KOTA 4EFOA 4MGKE 2D11A 1WGHA 1GNUA 3PRPB 4PS8A 2FCMA 4W9HA 2KZRA 1P9DU 2M4NA 2KANA 2RR9A 3R7RA 2LVOA 2FIDA 2K6DB 2KWCA 3VHTC 3TL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0W B;  4NAW A;  2PE6 B;  4FUL A;  3H9D A;  4EEW A;  3EEC A;  5CHF A;  4ANV A;  1XD3 B;  4BKT A;  1WJN A;  4M8M A;  5L95 C;  2IO3 B;  4X57 B;  4TQ1 A;  2C7N B;  4B95 A;  3AI5 A;  3V61 A;  3PVL A;  3OJ4 B;  2LVP A;  5C23 A;  3PLU A;  3I3T B;  3HM6 X;  1GJZ A;  2BYE A;  2RGF A;  2ZVO A;  4XC2 A;  3R66 C;  4HCN B;  4IC7 B;  4RMA A;  4NQK E;  1F9J A;  1EF1 A;  2LXA A;  4K81 A;  4BBN C;  2ASQ A;  2VRR B;  1WGR A;  3VTW A;  4DHJ D;  3PSE B;  4G11 A;  2NR2 A;  1WJU A;  3R3M A;  2KVR A;  1S1Q B;  4KIK A;  3QX1 A;  4G50 A;  4ANU A;  3L13 A;  4RM9 A;  2O2V A;  1WXM A;  3D32 A;  1V49 A;  2K8B A;  3AUL A;  4ZYN A;  5DPR A;  2DAF A;  5DCN A;  1TTN A;  4MJS B;  1JRU A;  4IWQ A;  4KIK B;  1WIA A;  2ZPN A;  2PEA A;  1WMH B;  2OJR A;  1ZW7 A;  4N9F 4;  1P1A A;  1YIW A;  4CHK A;  3HM3 A;  3B1L X;  1V5T A;  2CHZ A;  3IVF A;  3QA8 A;  1OQY A;  4HJK A;  3WAO A;  1LQB A;  1Z5S B;  2ZEQ A;  4LDT B;  3M63 B;  1R4N I;  2DZK A;  1I35 A;  3RZW C;  4PYU A;  2KX0 A;  3L10 B;  1UD7 A;  2JZZ A;  4IM0 A;  2MX2 A;  2LJ5 A;  3QQ8 B;  1NI2 A;  1Z2M A;  3PHX B;  3KYD D;  4KSL C;  2WX0 A;  3PS6 A;  2D07 B;  5E6O A;  3U30 A;  3UIN B;  4TKN A;  1V80 A;  3IBE A;  1VCB A;  3NZU A;  3PRM B;  2N7E A;  2ZCC A;  1LFD A;  2MBE A;  4FHJ A;  4B6W A;  2MRP A;  1H4R A;  2ZJD A;  2IY1 B;  2LD9 A;  3PTF C;  3ZTD A;  1YJ1 A;  3ALB A;  1ZKH A;  4HPM B;  3U8Z A;  4AOF A;  3VH3 B;  3ZLZ A;  5FR6 A;  4ANW A;  2GBJ A;  2HD5 B;  1WRD B;  2N9E B;  2JPH A;  2KKC A;  1UGM A;  2G45 B;  2O6V D;  3AXC A;  2XBB C;  1RLF A;  4W9I A;  3A4R A;  2LZ6 A;  1OEY J;  2IO2 B;  1J0G A;  3EC8 A;  4WQO B;  4KZ0 A;  1WMH A;  1E8Y A;  3M62 B;  1P98 A;  2ZNV C;  2JRH A;  3QIJ A;  1E90 A;  4BKS A;  4RM8 A;  2FCQ A;  3JSV B;  3EFU A;  5J18 A;  2M1M A;  4II2 B;  4OVU A;  1KJT A;  2GBN A;  5C1Z A;  2NVU I;  4G0N B;  2JZ3 B;  2FUH B;  1Q5W B;  3ECI A;  2LI5 A;  2KXJ A;  3L08 A;  1BT0 A;  2FNJ B;  2NBV B;  5CX3 A;  3RUL A;  4BOS C;  1S3S G;  4JGH B;  2J0J A;  2BYV E;  3UIO B;  3CF6 E;  2BKR B;  4MDK E;  3GOE A;  4AUQ C;  4IW0 A;  5L83 A;  1V2Y A;  3DVN U;  3R7Q A;  2KK8 A;  3LJ3 A;  3PV1 A;  4GN1 A;  5D94 A;  1RAX A;  2MBQ A;  3B0A A;  2MA9 B;  2WWZ A;  2LGY A;  2M17 A;  1WZ0 A;  3PLV A;  3DVN V;  3A1Q A;  2AYO B;  2KMC A;  4HDO A;  3V6E B;  4BBN F;  4DBG A;  2LXC A;  3RCZ A;  3RYT A;  1J8C A;  3TBL D;  2CHW A;  3VAW A;  3WAN A;  3VQI A;  2KX3 A;  1XT9 B;  1WY8 A;  1VD2 A;  3VXW A;  4HVB A;  2ZNV B;  4II3 B;  2KHW B;  3AU4 A;  2J0M A;  3H6N A;  3NOB A;  4I6L B;  2K8C A;  1IYF A;  2WDT B;  4CYE A;  4DWF A;  4BKG A;  1V81 A;  4MSQ B;  2L0F A;  4I6N B;  4HLE A;  5JHB A;  1U4A A;  2R2O A;  2KQ7 A;  3V62 A;  3A4S C;  4EUT A;  4IWP A;  4BFR A;  3OJ3 A;  2IZV B;  2CU1 A;  4J6I A;  1TBE A;  3ZDT A;  1I42 A;  3VUY A;  4W9D A;  2MQJ A;  3RD2 A;  2V3S A;  1ISN A;  1H8C A;  1NDD A;  2JF5 A;  2KTR A;  2J7Q B;  4FJZ A;  1R4M I;  2KTF A;  1OGW A;  2N9X A;  2I1K A;  2ZCB A;  2KTR B;  3O65 B;  2L0T A;  1WE7 A;  3NZS A;  4BOZ B;  2K8H A;  3X23 A;  3W1S C;  2JWZ A;  1P3Q U;  1X1M A;  2W9N A;  2MP2 B;  1SE9 A;  3W1S A;  3WAP A;  3VDZ A;  3PPA A;  2EKE C;  1SGH A;  3QWZ B;  3ZKJ C;  3HIZ A;  5AZH A;  2KLC A;  2KQS A;  1YD8 U;  3IG3 A;  5J17 A;  5JHA A;  5KHO A;  1FXT B;  2GBK A;  2EMS A;  2LGD A;  2V4L A;  3MTN B;  5TR5 A;  3VTU A;  3ML8 A;  1TZ1 A;  2AWT A;  5LXH A;  3ML9 A;  2JT4 B;  2HJ8 A;  4GIV A;  2JRI B;  1WR1 A;  4GDL A;  4AJY B;  3ZVV A;  4IM2 A;  2Z0D B;  3VTV A;  3SHQ A;  5EDS A;  3NY5 A;  3Q3F A;  5D6J B;  4DHZ B;  1WE6 A;  2IBI B;  4TV3 A;  4EOY A;  5HKH A;  2JY6 A;  3WAM A;  2REX A;  3DCG A;  1UH6 A;  1WX8 A;  2FCS A;  2FCN A;  2XK5 B;  2BGF A;  3ZIM A;  1EO6 A;  4MM3 A;  5LXI B;  2L05 A;  2KNB A;  1WGD A;  3RT3 B;  4BKS D;  4AJW A;  4HDQ A;  3KYC D;  4W9G A;  1WM2 A;  1WM3 A;  1E7V A;  3DPD A;  4LJP B;  5G2N A;  2KWV B;  4WJQ A;  2DZM A;  2G3Q B;  5DPW A;  1D3Z A;  1Q1O A;  5LLI A;  4MSM B;  1CMX B;  2DHZ A;  4FHK A;  1XQQ A;  2GMI C;  3WAL A;  1MG8 A;  2YVC A;  4FJV B;  2KD0 A;  1WI0 A;  4WWP A;  2KJR A;  2BYF A;  2WX1 A;  4HPL B;  4NJ6 A;  2JVC A;  4I6P A;  4KDI C;  2EMT A;  3DVG Y;  3VUX A;  1YX5 B;  2PJH A;  1WJ4 A;  2NCN A;  1WGG A;  4F8C B;  3LDZ E;  3PT2 B;  4PYZ A;  1UBQ A;  4JQW C;  4KZC A;  4IM3 A;  2KDI A;  3KW5 B;  2ZVN A;  4MGI E;  4ZRJ A;  2R2Q A;  2CKH B;  3JSV A;  2M8S A;  2BPS A;  4MJS A;  1WGY A;  4W9L A;  4FBJ B;  3V6C B;  4GU2 A;  4GOC A;  3PHW B;  4GMV A;  4WWO A;  2ZPY A;  1GC7 A;  4EKU A;  2MBB B;  3MJW A;  4HCP B;  1WXS A;  3IHP C;  3APC A;  2A4Z A;  2MSE D;  4KDL B;  4NAW B;  3APD A;  1WR6 E;  4HK2 A;  3JVZ X;  2D3G A;  5CHW A;  1WX7 A;  4WAA A;  3TMP B;  5AZG A;  4ZDV A;  1YQB A;  1E7U A;  2GBR A;  2MW5 A;  2KFJ A;  1AAR A;  3VUW A;  2OOB B;  3PRZ A;  3VVW B;  3QCA A;  4A3O A;  2DYB A;  4EZL A;  2M0X A;  1NBF C;  1P0R A;  1WJ6 A;  3UIP B;  4K7U A;  3ZDM C;  1UBI A;  4E74 A;  3A9J A;  3JW0 X;  2L00 B;  2J0K A;  3DBH I;  3DOW A;  4WWN A;  1RFA A;  2KWU B;  3DBL I;  4HWI B;  4GSW A;  2GBM A;  1V9J A;  2NBW B;  2HE7 A;  2KFK B;  4GGQ A;  2JUO A;  3KH0 A;  4XX5 A;  4W9F A;  4GDL B;  2N4F A;  5JH5 C;  3N3K B;  1C3T A;  3CSF A;  2IO1 B;  3S2A A;  1E8Z A;  3H7P A;  2KJH B;  3V60 A;  3W1Y A;  1IP9 A;  2KOX A;  1L2N A;  4GDK A;  3DBS A;  5BO4 B;  3ZRF A;  2KJ6 A;  3X0W A;  3PGE A;  3UGB B;  4CO7 A;  2GOW A;  4DHJ B;  2CHX A;  2NBU A;  2AL6 A;  2PPH A;  5J2R A;  1WXV A;  4IWO A;  1PQS A;  2LAS A;  3CST A;  4TQ0 A;  2AEH A;  1YX6 B;  3P2B A;  4FAD A;  2C60 A;  3N30 A;  3H1U A;  4K1R B;  5CTR C;  2K39 A;  3VFK A;  4LJO B;  4FJY A;  4W9C A;  1LXD A;  3KUC B;  1T0Y A;  1KLV A;  2MBO A;  4DDI D;  4JIO U;  3PZD A;  5IAA C;  2IO0 B;  3ONS A;  1E8W A;  2NPT B;  1V86 A;  3UQA A;  1WXA A;  3A9J B;  2I1J A;  1HE8 A;  1WFY A;  5CHV C;  2KC1 A;  1SIF A;  4URK A;  4G3X B;  3BY4 B;  1K8R B;  2V1Y A;  4E3C A;  4F7Z A;  4P7I A;  2WYQ A;  3MHS D;  2N7D A;  3ZNH B;  4DDG D;  2KDB A;  2C7M B;  2KDE B;  4WJN A;  2L7R A;  2XEW A;  3ZUN A;  2DYO A;  1KM7 A;  4TUU A;  4M0W B;  2YLM A;  3L17 A;  3ZTC A;  5D7G A;  3L0W B;  3H7P B;  5JZE B;  1E5W A;  3C0R B;  4LCD E;  4PS7 A;  5DPT A;  2JXX A;  4NY0 A;  5KHQ A;  1M94 A;  2KDF B;  3QJZ A;  2BKF A;  2RSU A;  5D2M B;  3A33 B;  4F1S A;  3KVF B;  3L54 A;  1L7Y A;  5AZF A;  3TIX A;  2RD0 A;  2O6V B;  3SDL C;  2KN5 A;  3QK0 A;  3T8M A;  2HTH A;  1WF9 A;  2ZZP B;  2FAZ A;  3DDC B;  3M3J A;  4HXD A;  1OTR B;  5G55 A;  1Y8R C;  2O2V B;  4KVG B;  4MGZ E;  3QAQ A;  4K7S A;  4MH0 E;  4ZRK A;  3UF8 A;  2UYZ B;  4A20 A;  2MWS B;  2KC2 A;  2QHO A;  3K9O B;  4DHZ E;  2DX5 B;  4NNJ B;  1A5R A;  3A1Q B;  4GB9 A;  4PS3 A;  1V5O A;  2L8J A;  3GZN I;  4DXA B;  1UZX B;  2MBH A;  4DK5 A;  1GG3 A;  2LRU A;  3DVG X;  2KO3 A;  4W9K A;  1ZGU B;  2RPQ A;  5E6N A;  1QZE A;  2C9W B;  4MGY E;  3UQB A;  4A3P A;  3M95 A;  3SU8 X;  1WZ3 A;  4FLH A;  4JLC A;  4WJP A;  3HHM A;  3OAW A;  4NQL B;  4MEM A;  4ANX A;  3ZO5 B;  5GMV A;  4E71 A;  3SD5 A;  4IG7 B;  2K25 A;  3AU5 A;  2G4S A;  2C7H A;  3ZNI D;  2LWP A;  2A5U A;  1RRB A;  1IPG A;  2N1V A;  2K6Q A;  2Z59 B;  3ZRC A;  3QHT A;  3EHV A;  4NPN A;  3RUI B;  1UEL A;  2DZJ A;  4KSK C;  4W9E A;  3APF A;  3CMM B;  2DAJ A;  3H7S A;  1EUV B;  4ZRI A;  4BVU C;  2Y5B B;  2DEN B;  3IFW B;  4FN2 A;  3ZNG C;  4AP4 C;  3DBR I;  3ZNZ B;  2L76 A;  1LM8 B;  2KFK A;  1V6E A;  1C1Y B;  3T9L A;  3PRE A;  2CR5 A;  2KMA A;  4K7W A;  5AEK B;  2C5L C;  4M8N A;  2AL3 A;  2Z0E B;  3N32 A;  3KUZ A;  3BIN A;  2B3A A;  3ZW3 A;  5IA7 A;  5DPS A;  2LRW A;  4YL8 A;  3DQV A;  2MLB A;  4AWJ A;  2IYD B;  3NHE B;  4GDK B;  4EZK A;  4LDT D;  4ICV A;  2NS5 A;  2K1F A;  2LUE A;  3HK0 A;  2IY0 B;  2CS4 A;  3A9K A;  3Q3J A;  4ICU A;  1OEY A;  3JYU A;  1WH3 A;  1GUA B;  3ENE A;  4IUM B;  3U7D A;  2MCN B;  1EF5 A;  2FIF A;  2XK5 A;  1WYW B;  3L16 A;  2D2Q A;  5E6P A;  3K9P B;  4FA6 A;  4W9J A;  3A9K B;  3B08 A;  4B9K A;  1J19 A;  4KV2 A;  3QC8 B;  2LGX A;  3KUD B;  1G6J A;  2BF8 B;  2G4D B;  2KLG A;  3QAR A;  3WIM A;  2N1W A;  4XZ4 A;  1GC6 A;  3TJP A;  2DYM A;  2O6V A;  2NPT A;  4OVV A;  4WJO A;  2LVQ A;  2BWF A;  2MP2 A;  3VH4 B;  1WX9 A;  4ASW C;  2PE9 A;  2UWQ A;  1TGZ B;  3RZF A;  2N9P C;  4GXB A;  4NJ7 A;  2D10 A;  2L3Z A;  4MEL A;  2BWE S;  3OLM D;  4JL9 A;  3NS8 A;  2DZI A;  3WA0 A;  3TCA A;  1E8X A;  4EZJ A;  1KOT A;  4EFO A;  4MGK E;  2D11 A;  1WGH A;  1GNU A;  3PRP B;  4PS8 A;  2FCM A;  4W9H A;  2KZR A;  1P9D U;  2M4N A;  2KAN A;  2RR9 A;  3R7R A;  2LVO A;  2FID A;  2K6D B;  2KWC A;  3VHT C;  3TL5 A; 
#chains in the Genus database with same CATH topology
 1EWC A;  1PGB A;  3SFD B;  2GB1 A;  1SJE D;  4M8M A;  4TQ1 A;  3V61 A;  1F1H A;  2WP9 B;  3ZJU A;  3I3T B;  1GJZ A;  2ZVO A;  1XLQ A;  2CJN A;  3MC0 B;  2VZK B;  4K81 A;  1L0X B;  1GPX A;  2ASQ A;  2BS3 B;  4KIK A;  4RM9 A;  4QAY A;  4ZYN A;  1IGD A;  4IWQ A;  1WMH B;  3HM3 A;  1V5T A;  3IVF A;  3WAO A;  2ZEQ A;  4UDU C;  1CK1 A;  4LDT B;  3Q14 C;  3RZW C;  2R61 A;  1RFK A;  4IM0 A;  4KSL C;  3U30 A;  2EEL A;  3B9J A;  3ZXV A;  3NVW A;  4B6W A;  3PTF C;  1YJ1 A;  3VH3 B;  5FR6 A;  2GBJ A;  2N9L A;  1WRD B;  2G45 B;  1QOA A;  3DBR B;  2MJ3 A;  2LZ6 A;  1UGJ A;  1SSN A;  2IO2 B;  3M62 B;  4BKS A;  4RM8 A;  1UWX A;  4JWU C;  3B2F A;  5IKC M;  2WXM A;  1TIF A;  2WXH A;  3W9C B;  4G0N B;  2FUH B;  1Q5W B;  3BZD B;  2PIA A;  2N9K A;  2NBV B;  5CX3 A;  3GP7 A;  3NZ3 A;  1N5W A;  2BYV E;  2BKR B;  4MDK E;  3GOE A;  4AUQ C;  4IW0 A;  3DVN U;  4RGT A;  2MA9 B;  3DVN V;  1C77 A;  1FMA D;  3RYT A;  2CHW A;  4XGA B;  1WY8 A;  1VD2 A;  1PGX A;  2J0M A;  3H6N A;  1IYF A;  2BW2 A;  3NG0 A;  2WDR B;  4BKG A;  2L0F A;  4I6N B;  1U4A A;  3WCQ A;  2PKO A;  3RD2 A;  3PO0 A;  3BYY B;  1SE3 A;  2LGI A;  4HRO A;  3ZJT A;  1FIQ A;  3NZS A;  2JSV X;  1ZE3 D;  2JWZ A;  1X1M A;  2W9N A;  1FRR A;  2BS2 B;  4KGS A;  2FBW B;  2EKE C;  3QWZ B;  3ZKJ C;  3IG3 A;  1YD8 U;  5TSS A;  2EMS A;  5LXH A;  2JRI B;  3ZVV A;  3VTV A;  3MC8 A;  4EOY A;  5HKH A;  2BBC A;  3IAM 1;  1UH6 A;  2FCS A;  2FCN A;  2WDV B;  1EO6 A;  1T6B X;  4IDI A;  1C76 A;  1PYW D;  3RT3 B;  4AJW A;  2H89 B;  2K3U A;  1WM3 A;  3DPD A;  2HJ1 A;  1J7A A;  3E56 A;  5G2N A;  2KYW A;  5G5H A;  2G3Q B;  3R2T A;  1N61 A;  5EE0 A;  2YVC A;  4WWP A;  2WX1 A;  2VH1 A;  3W5U B;  4ITK A;  2EMT A;  1MFW A;  2DLB A;  1UBQ A;  1GOZ A;  4IM3 A;  1E10 A;  5HI1 A;  3T3O A;  2VH2 A;  1RYJ A;  3AE9 B;  3JSV A;  2BPS A;  2WQY B;  1FNU A;  4FBJ B;  3AE5 B;  1ZP0 B;  4GMV A;  2ZPY A;  2MBB B;  3MJW A;  2CJO A;  1SBB B;  3IHP C;  2JYT A;  3RNB C;  3APD A;  1RWS A;  2W3R A;  3JVZ X;  2GBR A;  2OOB B;  2QJL A;  3NJT A;  3PRZ A;  1ZXI A;  4A3O A;  4EZL A;  1SB3 C;  1NBF C;  4K7U A;  3EUB 2;  2BB6 A;  3AEC B;  3RI7 C;  3A9J A;  3JW0 X;  1NEK B;  3DBH I;  2WXL A;  4DQO C;  4GSW A;  2GBM A;  2NBW B;  3J9C A;  4YSZ B;  5AUK A;  5BYS A;  2JUO A;  3KH0 A;  1L0V B;  1FFV A;  1HTO A;  2N4F A;  5JH5 C;  4M0W A;  1C3T A;  1L2N A;  3W1Y A;  2GOW A;  4DHJ B;  1L5P A;  1ZDX A;  3AE2 B;  1WXV A;  2W3S A;  3RN9 C;  1JWU D;  2PMV A;  1XLP A;  2AEH A;  3P2B A;  1KLU D;  2C60 A;  1LXD A;  2MBO A;  2NPT B;  1WRI A;  3A9J B;  3P1M A;  1HE8 A;  2KC1 A;  4URK A;  2LGS A;  4G3X B;  1K8R B;  2V1Y A;  4E3C A;  2PTL A;  2SEB D;  2L7R A;  4N59 A;  1FNV A;  2Y5P A;  3ZUN A;  3H7P B;  5T8I A;  5JZE B;  4LCD E;  2KDF B;  3Q3N C;  4D2K A;  1T0R C;  5HFY A;  3TIX A;  2EKI A;  3QK0 A;  3DDC B;  2D5G A;  2W55 A;  3UF8 A;  3IAS 1;  4RH6 A;  2MWS B;  2QMT A;  4NNJ B;  1PDX A;  4GLS C;  1FM0 D;  5C2T B;  1L4D B;  2MBH A;  4C4V A;  4M01 A;  2KO3 A;  4WAF A;  1QZE A;  2C9W B;  4MGY E;  3N1X C;  1JAL A;  1F2R I;  4NQL B;  5GMV A;  3SD5 A;  2BTE A;  1V1P B;  4IG7 B;  2K25 A;  1EU4 A;  3KWL A;  1QOB A;  1IPG A;  2N1V A;  2Z59 B;  2PW9 A;  2IGG A;  3ZRC A;  4NPN A;  2DZJ A;  4MH8 A;  1JW9 D;  3IFW B;  4AP4 C;  3DBR I;  4A8X C;  3P4S B;  2Y3A A;  2OJW A;  4RNA A;  3T9L A;  1UUP A;  2I2Y A;  1V1O A;  3BIN A;  1DYQ A;  2B3A A;  1T0Q C;  3CIR B;  4N58 A;  3DQV A;  2MLB A;  4AWJ A;  2IYD B;  3NHE B;  1T3Q A;  4LDT D;  1I4X A;  4KKI A;  2CS4 A;  1WH3 A;  1GUA B;  4IUM B;  3U7D A;  2WXN A;  3AE3 B;  2QSD A;  3A9K B;  2WXO A;  4KV2 A;  4WH4 A;  3QC8 B;  5BYR A;  2LGX A;  2BF8 B;  2G4D B;  2KLG A;  3GB1 A;  3HVD A;  3QAR A;  3RNG C;  4XZ4 A;  5C3J B;  1GC6 A;  1V8C A;  2PVG C;  4WJO A;  2QC8 A;  4ASW C;  2PE9 A;  2LEK A;  1DOX A;  1EU3 A;  3TCA A;  4EZJ A;  5BYQ A;  4MGK E;  1XF5 L;  2D11 A;  1GNU A;  1T5X D;  1YOV B;  3MHZ A;  1C4A A;  2K6D B;  3VHT C;  2RDH A;  4FUL A;  3H9D A;  3EEC A;  4ANV A;  4BKT A;  1WJN A;  4X57 B;  3AI5 A;  3OJ4 B;  5C23 A;  3VR8 B;  2N0S B;  3AN1 A;  2BYE A;  4HCN B;  4IC7 B;  4RMA A;  1F9J A;  1EF1 A;  1XCT L;  4DHJ D;  1B1Z A;  1WGR A;  1ZPS A;  3C8Y A;  1AYF A;  4J3O D;  3QX1 A;  4ANU A;  3L13 A;  2O2V A;  3D32 A;  2K8B A;  1YMH E;  2UU7 A;  4WWM A;  1WIA A;  2PEA A;  1YIW A;  3Q8E A;  1GB1 A;  2E3T A;  1TS3 A;  3T3N A;  3M63 B;  4PYU A;  1UD7 A;  2JZZ A;  2MX2 A;  1Z2M A;  3AMZ A;  2TSS A;  1XO3 A;  1GB4 A;  3NUH B;  5E6O A;  5I4D A;  3NZU A;  3PRM B;  3RFZ B;  2WXJ A;  2MBE A;  4FHJ A;  1H4R A;  2ZJD A;  1XLN A;  3TEZ A;  3ZLZ A;  2HD5 B;  2JPH A;  1ENF A;  1UGM A;  2KKC A;  2O6V D;  3AXC A;  1RLF A;  2K22 A;  4W9I A;  4US8 A;  1TZO A;  1WMH A;  1E8Y A;  1HXY D;  4LNI A;  2FCQ A;  2KN4 A;  2MHJ A;  4II2 B;  4OVU A;  1KJT A;  2GBN A;  4WUR A;  3V3X A;  3R8B A;  3U2S C;  3ECI A;  2LI5 A;  2L52 A;  3GZN B;  1CZP A;  2Z8L A;  1C4C A;  3CF6 E;  1L0Y B;  3R7Q A;  3LJ3 A;  3PV1 A;  1QIL A;  4EE2 A;  5D94 A;  4MT5 A;  2VZK D;  1WZ0 A;  3MC9 A;  4A55 A;  4HDO A;  4DBG A;  3BVM A;  1F77 A;  2RMM A;  3RCZ A;  3VAW A;  3WAN A;  3IXS A;  1XT9 B;  2MJE A;  2ACZ B;  2K8C A;  3P63 A;  4CYE A;  1V81 A;  1DOY A;  3FAH A;  3A4S C;  3AEB B;  3V62 A;  4BFR A;  3OJ3 A;  2IZV B;  1TBE A;  3ZDT A;  2NMQ A;  1H8C A;  2D3A A;  2K0P A;  1N5X A;  4RGM A;  2J7Q B;  3Q69 A;  3R2I A;  2N9X A;  1JWB D;  2ZCB A;  3O65 B;  2L0T A;  2LUM A;  4BOZ B;  2K8H A;  3X23 A;  3W1S C;  1P3Q U;  1SE9 A;  3W1S A;  3WAP A;  3VDZ A;  3HIZ A;  2X38 A;  5J17 A;  5KHO A;  2V4L A;  2GBK A;  3MTN B;  4JX1 C;  5TR5 A;  3VTU A;  4ANW A;  2AWT A;  4Q2J A;  4XWW A;  1WR1 A;  4IM2 A;  4A90 A;  2OED A;  2KWD A;  4H2A A;  5D6J B;  2QCZ A;  3WAM A;  3DCG A;  1WX8 A;  4C56 C;  1YN3 A;  3N1Z C;  3VRB B;  4C80 A;  1TYG B;  1TY2 A;  4HDQ A;  1WM2 A;  2M56 B;  4HJG E;  4LJP B;  2BT6 A;  2KWV B;  1Q1O A;  3EFC A;  4FHK A;  2GMI C;  3WAL A;  2KD0 A;  1WI0 A;  3VR9 B;  2JVC A;  2MH7 A;  2KMM A;  2I38 A;  3PT2 B;  4JQW C;  3P4Q B;  2KDI A;  3KW5 B;  2ZVN A;  4MJS A;  3Q3O C;  1WGY A;  4W9L A;  4GU2 A;  4GOC A;  3UI3 A;  4WWO A;  2INP E;  2AQ1 B;  4YXD B;  2LMC A;  2A4Z A;  2MSE D;  2JZP A;  1K50 A;  1WR6 E;  2WXI A;  5CHW A;  3TMP B;  5AZG A;  3I63 C;  1E7U A;  2KFJ A;  1F2R C;  1CQV A;  2GI9 A;  2DYB A;  1CJE A;  1JWM D;  4LLG M;  2M0X A;  3ETR A;  4LNK A;  1UBI A;  2J4X A;  1E7P B;  2L00 B;  2J0K A;  3DOW A;  4WWN A;  2BQQ A;  4HWI B;  1V9J A;  2AX5 A;  1JQ4 A;  4GGQ A;  4W9F A;  4GDL B;  3RNA C;  1HEZ E;  2IO1 B;  3S2A A;  3H7P A;  2KJH B;  1IP9 A;  1N60 A;  2KOX A;  2KJ6 A;  2DBY A;  4CO7 A;  2CHX A;  3ABV B;  1ESF A;  2NBU A;  3AEF B;  4JPS A;  4IWO A;  4TQ0 A;  1MHH E;  1YX6 B;  1WXQ A;  1YJI A;  4K1R B;  2K39 A;  4L2Y A;  3VFK A;  5EE1 A;  1T0Y A;  4DDI D;  5IAA C;  2IO0 B;  3BY4 B;  4NJC A;  1JRP A;  4P6V F;  4P7I A;  3MHS D;  3ZNH B;  4DXG A;  2KDB A;  1TS5 A;  4A6Q A;  2LFI A;  5D3D A;  1KM7 A;  4TUU A;  3RNE C;  4M0W B;  4YTN B;  1MHX A;  3C0R B;  2BYT A;  5DPT A;  2JXX A;  4NY0 A;  1XCQ L;  3ZYY X;  4ZRP A;  3QJZ A;  1TKY A;  5IO9 A;  3A33 B;  4F1S A;  2PVO D;  4LNF A;  1MPE A;  3BII D;  1JWA D;  1L7Y A;  4MM3 B;  2O6V B;  3SDL C;  2KN5 A;  1C79 A;  4RF0 A;  1C9F A;  2N7J A;  2JQR B;  5G55 A;  2O2V B;  4MGZ E;  1WWT A;  3QAQ A;  4K7S A;  4ZRK A;  1HZ6 A;  1N6Z A;  3AE8 B;  4A20 A;  2IJ0 A;  2KC2 A;  1A5R A;  5HG2 A;  1V5O A;  2OHF A;  3GZN I;  4DXA B;  1GG3 A;  1NYR A;  1JWS D;  2IND C;  1YJJ A;  5E6N A;  3BK1 A;  3M95 A;  3SU8 X;  4WJP A;  1WZ3 A;  1VJK A;  3ZO5 B;  5BMG A;  5IN7 A;  1RRB A;  4KGT A;  4ACF A;  1LO5 D;  1UEL A;  2IGH A;  4KSK C;  4W9E A;  3APF A;  3CMM B;  3B2G A;  4AS1 A;  3ZNZ B;  1IBX A;  2ICI A;  3AE6 B;  2CR5 A;  4M00 A;  2C5L C;  3AV8 A;  4LTU A;  3N32 A;  3BVG A;  3ZW3 A;  2WXF A;  4ICV A;  2K1F A;  3JYU A;  1WYW B;  4FA6 A;  3U4E G;  2KT7 A;  1J19 A;  3KUD B;  3AB5 A;  3Q3M C;  3WIM A;  2N1W A;  2DYM A;  2O6V A;  1FEH A;  1AWD A;  4OVV A;  2LVQ A;  1PUT A;  2BWF A;  3VH4 B;  1WX9 A;  4HKQ A;  2N9P C;  4LNN A;  2L3Z A;  4MEL A;  3NS8 A;  3FIL B;  3WA0 A;  1MG4 A;  1E8X A;  1LGR A;  1WGH A;  1P9D U;  1UF0 A;  2KAN A;  1D5X C;  3GS2 A;  5FKA C;  1ACC A;  2LVO A;  1SJH D;  1VZ6 A;  2WLB A;  4C00 A;  1C78 A;  4IKG A;  3PZ8 A;  1Q0W B;  2PE6 B;  5CHF A;  4PK1 A;  5L95 C;  2C7N B;  4B95 A;  3PVL A;  2FUG 1;  4JWS C;  1FCL A;  3HM6 X;  2RGF A;  4XC2 A;  3R66 C;  4KX6 B;  1FCC C;  4USA A;  3VTW A;  2D3B A;  3PSE B;  4G11 A;  1WJU A;  3R3M A;  1S1Q B;  4G50 A;  1WXM A;  1OQQ A;  3RMK C;  2IPK D;  5DCN A;  4MJS B;  1JRU A;  4KIK B;  2ZPN A;  2OJR A;  4RF1 A;  1ET6 A;  1P1A A;  3B1L X;  2CHZ A;  2E6X A;  1OQY A;  2WNM A;  1R4N I;  2QEJ C;  1V1P A;  2LJ5 A;  1NI2 A;  3KYD D;  3TUO A;  3PS6 A;  1QQR A;  1YN4 A;  2D07 B;  4TKN A;  1V80 A;  1KFY B;  3IBE A;  2ZCC A;  2WDQ B;  1LFD A;  3SEB A;  2MRP A;  2QDF A;  2IY1 B;  3ZTD A;  4AOF A;  3ALB A;  2AQ3 B;  3Q2A C;  3U8Z A;  3E9S A;  3RNC C;  3Q8A A;  3ZGZ A;  1TJE A;  3EC8 A;  4WQO B;  1IUE A;  1P98 A;  2QIE B;  5D3I B;  2ZNV C;  2JRH A;  1C4P A;  5JXV A;  1D5M C;  3EGR A;  3JSV B;  1IBX B;  3EFU A;  4ARC A;  1I4Q A;  1QOG A;  2NVU I;  3Q6B A;  2KXJ A;  2MJD A;  3L08 A;  3L4P A;  3NVZ A;  2FNJ B;  1S3S G;  2J53 A;  5L83 A;  1V2Y A;  2MBQ A;  2WWZ A;  2M17 A;  3V6E B;  3PLV A;  2AYO B;  3AEA B;  1J8C A;  1F0Z A;  3VQI A;  2KX3 A;  3VXW A;  2LHD A;  2ZNV B;  4II3 B;  2KHW B;  3AU4 A;  5AUI A;  4DWF A;  3URY A;  4MSQ B;  5JHB A;  2KQ7 A;  3ZXR A;  2J52 A;  1KH0 A;  2CU1 A;  4J6I A;  3DHI C;  1I42 A;  2MQJ A;  1YNT E;  2V3S A;  1ISN A;  4P1B C;  3N9Y C;  1R4M I;  1OGW A;  1UWM A;  4OHJ A;  1KF6 B;  3GE8 C;  3P42 A;  2PLP A;  4YWG G;  1XEE A;  4PT5 A;  3PPA A;  5AZH A;  1YQ3 B;  5JHA A;  1FXT B;  2LGD A;  5BMH A;  2JT4 B;  4GIV A;  4AJY B;  1VR9 A;  2Z0D B;  3SHQ A;  4TMA B;  4B0E A;  4DHZ B;  1WE6 A;  1R7S A;  4ZOH C;  3MJ5 A;  5IOI A;  2FE8 A;  5LXI B;  1JML A;  1WGD A;  1FPY A;  3OG5 A;  3HRD D;  1VDV A;  1E7V A;  1NVI D;  4TSS A;  1ZUD 2;  4WJQ A;  1PFD A;  4YSX B;  5DPW A;  5LLI A;  3I9V 1;  4MSM B;  2DHZ A;  4AQ7 A;  3NRZ A;  4FJV B;  2KJR A;  4HPL B;  4RCO A;  4I6P A;  2CU3 A;  3DVG Y;  2NCN A;  1WGG A;  3SFE B;  2INN E;  2NTS A;  4MGI E;  4ZRJ A;  1L6U A;  2V3P A;  2CKH B;  1YN5 A;  2M8S A;  1T0S C;  2G9H D;  4XYC A;  4IOI E;  1FD6 A;  4HCP B;  1WXS A;  3APC A;  2AQ2 B;  4KDL B;  4HK2 A;  3EA6 A;  2D3G A;  4WAA A;  3LB8 C;  4US9 A;  1TT5 B;  5HHD G;  3VVW B;  4L1B A;  2DNF A;  3Q8C A;  4XWT A;  1WJ6 A;  3UIP B;  1RM6 C;  3ZDM C;  2X8X X;  1XLO A;  1RFA A;  3DBL I;  1MJD A;  4XX5 A;  4ZHP A;  3W2D A;  3N3K B;  1E8Z A;  3V60 A;  4GDK A;  5H8Y E;  4OW0 A;  2AL6 A;  2PPH A;  1PQS A;  2LAS A;  1I4G A;  3H8H A;  4FAD A;  3N30 A;  1Q10 A;  1E6E B;  2J42 A;  4K3B A;  1BUI C;  3KUC B;  4JIO U;  3PZD A;  3ONS A;  1E8W A;  4YTP B;  3UQA A;  1WYG A;  1OQR A;  1SIF A;  1FFU A;  2RDB C;  2WYQ A;  3N20 C;  3OWE B;  1ZOY B;  4WJN A;  1KLG D;  1NI3 A;  2DYO A;  3SR6 A;  3ZTC A;  5D7G A;  4N6E B;  4C7Z A;  3L0W B;  5EE3 A;  1E5W A;  4PS7 A;  5KHQ A;  2RSU A;  4P1C C;  3KVF B;  3NVV A;  1N62 A;  5AZF A;  2RD0 A;  3T8M A;  1K51 A;  1VZ8 A;  2ZZP B;  1HTQ A;  2HDE A;  4K3C A;  4DHZ E;  2DX5 B;  3A1Q B;  4GB9 A;  1FRD A;  1VRA B;  1ET9 A;  3PZ7 A;  1UNS A;  1SE2 A;  3DVG X;  3FIL A;  4JE3 B;  3AED B;  4W9K A;  3UQB A;  4REZ A;  2ONQ A;  4A3P A;  1HZ5 A;  4FLH A;  3KLS X;  3OAW A;  3MFG A;  4E71 A;  3IT6 B;  2B76 B;  3ZNI D;  2V4I B;  3QHT A;  4CQN A;  3EHV A;  3RUI B;  3KWV A;  3H7S A;  1EUV B;  4XE0 A;  4BVU C;  2Y5B B;  4FN2 A;  1K52 A;  1LM8 B;  1V6E A;  3P4P B;  2KMA A;  4ZHO A;  4M8N A;  3NS1 A;  3CWI A;  3KUZ A;  4C4V B;  1BML C;  5IA7 A;  2LRW A;  4YL8 A;  1J7C A;  4GDK B;  4OVZ A;  3A9K A;  3Q3J A;  3V05 A;  3ENE A;  1EF5 A;  3L16 A;  2WXK A;  4W9J A;  5FK9 C;  2UWQ A;  3RZF A;  4GXB A;  4NJ7 A;  2D10 A;  3TSS A;  2BWE S;  2IGD A;  2Q5W D;  4EFO A;  4WIP A;  3PRP B;  4PS8 A;  2W54 A;  2KZR A;  1QKZ A;  2RR9 A;  4DXF A;  2G1E A;  4S0R A;  3TL5 A;  3I5J C;  1FO4 A;  2W82 A;  4NAW A;  3GE3 C;  4EEW A;  1XD3 B;  4M02 A;  2IO3 B;  4LK0 M;  3BK2 A;  1TY0 A;  2LVP A;  3PLU A;  5FR3 A;  2WGS A;  2V0G A;  1QF6 A;  1YQ4 B;  4HEA 1;  4NQK E;  2LXA A;  4BBN C;  2XN9 C;  2VRR B;  2K5P A;  3KQ4 A;  3RPF C;  2NR2 A;  3BWU D;  1ZXH A;  2KVR A;  3U52 E;  1MI0 A;  1V49 A;  3AUL A;  5DPR A;  1NEN B;  2DAF A;  4BZA A;  1TTN A;  2LJI A;  1JCK B;  1ZW7 A;  4N9F 4;  1OFF A;  4CHK A;  5EE9 A;  1N63 A;  3QA8 A;  4HJK A;  1LQB A;  1Z5S B;  1ROE A;  2DZK A;  1I35 A;  2KX0 A;  3L10 B;  3DBH B;  2L1A A;  2WHI A;  3P4R B;  4HPP A;  1V97 A;  3PHX B;  3QQ8 B;  1D6E C;  3U7Z A;  2HTM E;  2WX0 A;  1BXT A;  3UIN B;  1KLV A;  2ZW0 A;  1VCB A;  2N7E A;  4P16 A;  2LD9 A;  1ZKH A;  4HPM B;  2N9E B;  2H88 B;  1VZ7 A;  2XBB C;  1DGJ A;  1HA5 A;  1R4M B;  3A4R A;  1M4V A;  1E0Z A;  1STE A;  1OEY J;  1J0G A;  3DHH C;  1L6V A;  2WXG A;  4KZ0 A;  5MPO A;  1E9M A;  3AE1 B;  3QIJ A;  1E90 A;  3BVZ A;  5E6J A;  5J18 A;  2M1M A;  5C1Z A;  2JZ3 B;  1AN8 A;  3DWM A;  1FNW A;  1BT0 A;  3O13 A;  3RUL A;  4BOS C;  4JGH B;  2J0J A;  3UIO B;  1HQR D;  3AH7 A;  2KK8 A;  4YSY B;  4GN1 A;  1B9R A;  1RAX A;  4NZL B;  3B0A A;  2LGY A;  3A1Q A;  2KMC A;  4KGR A;  4BBN F;  2LXC A;  3TBL D;  4FXC A;  4HVB A;  1TS4 A;  4I6L B;  3NOB A;  1I4R A;  2WDT B;  4HLE A;  2R2O A;  1D5Z C;  4EUT A;  4IWP A;  3VUY A;  4W9D A;  1I7H A;  2JYE A;  3BYT B;  2IDY A;  1NDD A;  2JF5 A;  2KTR A;  3MP9 A;  2BB5 A;  1WGK A;  3DHG C;  3HVZ A;  4FJZ A;  2KTF A;  3TEW A;  2GLS A;  4ZYS A;  2I1K A;  1DOI A;  2KTR B;  2BS4 B;  1WE7 A;  1ZDV A;  1P7E A;  1P7F A;  2MP2 B;  2SAK A;  1SGH A;  3C19 A;  3Q8F A;  2KLC A;  2INC C;  2KQS A;  3Q8B A;  3ML8 A;  1TZ1 A;  3ML9 A;  2ON8 A;  2HJ8 A;  4GDL A;  2RDG A;  5EDS A;  3NY5 A;  3Q3F A;  2IBI B;  4TV3 A;  1FXA A;  2JY6 A;  1AW7 A;  2REX A;  2XK5 B;  2BGF A;  3ZIM A;  1EM7 A;  4MM3 A;  2L05 A;  2KNB A;  4BKS D;  3KYC D;  4W9G A;  3HUI A;  4R3D A;  1R4N B;  2DZM A;  1EWY C;  5LNK 1;  1D3Z A;  2WU2 B;  3LXF A;  1CMX B;  1XQQ A;  1MG8 A;  1JRO A;  2BYF A;  4NJ6 A;  4KDI C;  4O1N A;  1K53 A;  2WS3 B;  3VUX A;  1YX5 B;  2PJH A;  3ZJV A;  1WJ4 A;  4F8C B;  3LDZ E;  4PYZ A;  1SEB D;  4KZC A;  2R2Q A;  1TKG A;  3V6C B;  1FXI A;  3PHW B;  1SIJ A;  1Y56 A;  4KKJ A;  4XDD A;  1GC7 A;  2DWQ A;  4EKU A;  4OZA A;  4NAW B;  1WX7 A;  4ZDV A;  1YQB A;  5IP4 D;  2KAJ A;  2MW5 A;  1AAR A;  3VUW A;  1WSP A;  1VLB A;  3QCA A;  4LNO A;  1P0R A;  4C7Y A;  4E74 A;  1KTK A;  3AEG B;  2KWU B;  2WXR A;  2HE7 A;  1A70 A;  2KFK B;  2RPV A;  3FKY A;  1D4B A;  3RNF C;  1PGA A;  3NVY A;  3CSF A;  1SE4 A;  2L32 A;  3DBS A;  5BO4 B;  3ZRF A;  5BMI A;  3X0W A;  3PGE A;  3UGB B;  1SXT A;  5J2R A;  4YT0 B;  3CST A;  4OZC A;  2BVC A;  3H1U A;  5CTR C;  4LJO B;  4FJY A;  4W9C A;  1XXG A;  3FC4 A;  1V86 A;  1WXA A;  2I1J A;  1WFY A;  5CHV C;  1IGC A;  3TEX A;  4F7Z A;  2N7D A;  4DDG D;  2M19 A;  2C7M B;  2KDE B;  2NTT A;  2XEW A;  2D3C A;  2YLM A;  3L17 A;  4BAX A;  2ZW1 A;  1M94 A;  2MEK A;  3LYY A;  4S17 A;  3N1Y C;  2BKF A;  3DWG C;  2V9H A;  5D2M B;  4RFB A;  3ZQ4 A;  2LHE A;  3L54 A;  4WQM A;  3AE7 B;  3DBL B;  2HTH A;  1WF9 A;  1I4P A;  2FAZ A;  4XDC A;  2XNA C;  3M3J A;  4HXD A;  1OTR B;  1Y8R C;  4KVG B;  2JWU A;  2JXT A;  1TS2 A;  3VRA B;  4MH0 E;  1KRH A;  1SF0 A;  2UYZ B;  1F52 A;  2QHO A;  3K9O B;  2KQ4 X;  4PS3 A;  2L8J A;  2KAC A;  1UZX B;  4L23 A;  4NAM A;  4DK5 A;  2LRU A;  4ARI A;  2GRI A;  4OZB A;  2WXP A;  4ZRQ A;  1ZGU B;  2RPQ A;  2KDM A;  4JLC A;  5G5G A;  4ANX A;  3HHM A;  4MEM A;  4HKZ E;  2WU5 B;  4MAC A;  3AU5 A;  2G4S A;  2C7H A;  2LWP A;  1QT9 A;  2A5U A;  2YEP F;  1J7B A;  2K6Q A;  4RGN A;  4RGO S;  1NYQ A;  2DAJ A;  4ZRI A;  2DEN B;  2M0A A;  3ZNG C;  2L76 A;  5H92 C;  1MVK A;  2KFK A;  2Y5C A;  1C1Y B;  2QIL A;  3PRE A;  5AEK B;  4K7W A;  3IT4 B;  4A9A A;  2V3N A;  2AL3 A;  2Z0E B;  3TEY A;  2KVZ A;  1QOF A;  1TKE A;  3AEE B;  5DPS A;  4YTM B;  3W5V B;  4EZK A;  2NS5 A;  2LUE A;  3HK0 A;  2IY0 B;  2JU6 X;  4ICU A;  1OEY A;  5GXG B;  4HRS A;  2MCN B;  2FIF A;  2XK5 A;  3AM9 A;  5E6P A;  2D2Q A;  3K9P B;  3B08 A;  4B9K A;  1G6J A;  2WXQ A;  3TJP A;  2NPT A;  2JX5 A;  2MP2 A;  2K9X A;  1TGZ B;  1L4Z B;  3OLM D;  4B0M A;  4JL9 A;  2YEP B;  2DZI A;  1KOT A;  3I57 A;  2L83 A;  1GAQ B;  2FCM A;  4W9H A;  2M4N A;  1QLB B;  3R7R A;  1I4H A;  2FID A;  2KWC A;  3AE4 B; 
#chains in the Genus database with same CATH homology
 1Q0W B;  4NAW A;  2PE6 B;  4FUL A;  3H9D A;  4EEW A;  3EEC A;  5CHF A;  4ANV A;  1XD3 B;  4BKT A;  1WJN A;  4M8M A;  5L95 C;  2IO3 B;  4X57 B;  4TQ1 A;  2C7N B;  4B95 A;  3AI5 A;  3V61 A;  3PVL A;  3OJ4 B;  2LVP A;  5C23 A;  3PLU A;  3I3T B;  3HM6 X;  1GJZ A;  2BYE A;  2RGF A;  2ZVO A;  4XC2 A;  3R66 C;  4HCN B;  4IC7 B;  4RMA A;  4NQK E;  1F9J A;  1EF1 A;  2LXA A;  4K81 A;  4BBN C;  2ASQ A;  2VRR B;  1WGR A;  3VTW A;  4DHJ D;  3PSE B;  4G11 A;  2NR2 A;  1WJU A;  3R3M A;  2KVR A;  1S1Q B;  4KIK A;  3QX1 A;  4G50 A;  4ANU A;  3L13 A;  4RM9 A;  2O2V A;  1WXM A;  3D32 A;  1V49 A;  2K8B A;  3AUL A;  4ZYN A;  5DPR A;  2DAF A;  5DCN A;  1TTN A;  4MJS B;  1JRU A;  4IWQ A;  4KIK B;  1WIA A;  2ZPN A;  2PEA A;  1WMH B;  2OJR A;  1ZW7 A;  4N9F 4;  1P1A A;  1YIW A;  4CHK A;  3HM3 A;  3B1L X;  1V5T A;  2CHZ A;  3IVF A;  3QA8 A;  1OQY A;  4HJK A;  3WAO A;  1LQB A;  1Z5S B;  2ZEQ A;  4LDT B;  3M63 B;  1R4N I;  2DZK A;  1I35 A;  3RZW C;  4PYU A;  2KX0 A;  3L10 B;  1UD7 A;  2JZZ A;  4IM0 A;  2MX2 A;  2LJ5 A;  3QQ8 B;  1NI2 A;  1Z2M A;  3PHX B;  3KYD D;  4KSL C;  2WX0 A;  3PS6 A;  2D07 B;  5E6O A;  3U30 A;  3UIN B;  4TKN A;  1V80 A;  3IBE A;  1VCB A;  3NZU A;  3PRM B;  2N7E A;  2ZCC A;  1LFD A;  2MBE A;  4FHJ A;  4B6W A;  2MRP A;  1H4R A;  2ZJD A;  2IY1 B;  2LD9 A;  3PTF C;  3ZTD A;  1YJ1 A;  3ALB A;  1ZKH A;  4HPM B;  3U8Z A;  4AOF A;  3VH3 B;  3ZLZ A;  5FR6 A;  4ANW A;  2GBJ A;  2HD5 B;  1WRD B;  2N9E B;  2JPH A;  2KKC A;  1UGM A;  2G45 B;  2O6V D;  3AXC A;  2XBB C;  1RLF A;  4W9I A;  3A4R A;  2LZ6 A;  1OEY J;  2IO2 B;  1J0G A;  3EC8 A;  4WQO B;  4KZ0 A;  1WMH A;  1E8Y A;  3M62 B;  1P98 A;  2ZNV C;  2JRH A;  3QIJ A;  1E90 A;  4BKS A;  4RM8 A;  2FCQ A;  3JSV B;  3EFU A;  5J18 A;  2M1M A;  4II2 B;  4OVU A;  1KJT A;  2GBN A;  5C1Z A;  2NVU I;  4G0N B;  2JZ3 B;  2FUH B;  1Q5W B;  3ECI A;  2LI5 A;  2KXJ A;  3L08 A;  1BT0 A;  2FNJ B;  2NBV B;  5CX3 A;  3RUL A;  4BOS C;  1S3S G;  4JGH B;  2J0J A;  2BYV E;  3UIO B;  3CF6 E;  2BKR B;  4MDK E;  3GOE A;  4AUQ C;  4IW0 A;  5L83 A;  1V2Y A;  3DVN U;  3R7Q A;  2KK8 A;  3LJ3 A;  3PV1 A;  4GN1 A;  5D94 A;  1RAX A;  2MBQ A;  3B0A A;  2MA9 B;  2WWZ A;  2LGY A;  2M17 A;  1WZ0 A;  3PLV A;  3DVN V;  3A1Q A;  2AYO B;  2KMC A;  4HDO A;  3V6E B;  4BBN F;  4DBG A;  2LXC A;  3RCZ A;  3RYT A;  1J8C A;  3TBL D;  2CHW A;  3VAW A;  3WAN A;  3VQI A;  2KX3 A;  1XT9 B;  1WY8 A;  1VD2 A;  3VXW A;  4HVB A;  2ZNV B;  4II3 B;  2KHW B;  3AU4 A;  2J0M A;  3H6N A;  3NOB A;  4I6L B;  2K8C A;  1IYF A;  2WDT B;  4CYE A;  4DWF A;  4BKG A;  1V81 A;  4MSQ B;  2L0F A;  4I6N B;  4HLE A;  5JHB A;  1U4A A;  2R2O A;  2KQ7 A;  3V62 A;  3A4S C;  4EUT A;  4IWP A;  4BFR A;  3OJ3 A;  2IZV B;  2CU1 A;  4J6I A;  1TBE A;  3ZDT A;  1I42 A;  3VUY A;  4W9D A;  2MQJ A;  3RD2 A;  2V3S A;  1ISN A;  1H8C A;  1NDD A;  2JF5 A;  2KTR A;  2J7Q B;  4FJZ A;  1R4M I;  2KTF A;  1OGW A;  2N9X A;  2I1K A;  2ZCB A;  2KTR B;  3O65 B;  2L0T A;  1WE7 A;  3NZS A;  4BOZ B;  2K8H A;  3X23 A;  3W1S C;  2JWZ A;  1P3Q U;  1X1M A;  2W9N A;  2MP2 B;  1SE9 A;  3W1S A;  3WAP A;  3VDZ A;  3PPA A;  2EKE C;  1SGH A;  3QWZ B;  3ZKJ C;  3HIZ A;  5AZH A;  2KLC A;  2KQS A;  1YD8 U;  3IG3 A;  5J17 A;  5JHA A;  5KHO A;  1FXT B;  2GBK A;  2EMS A;  2LGD A;  2V4L A;  3MTN B;  5TR5 A;  3VTU A;  3ML8 A;  1TZ1 A;  2AWT A;  5LXH A;  3ML9 A;  2JT4 B;  2HJ8 A;  4GIV A;  2JRI B;  1WR1 A;  4GDL A;  4AJY B;  3ZVV A;  4IM2 A;  2Z0D B;  3VTV A;  3SHQ A;  5EDS A;  3NY5 A;  3Q3F A;  5D6J B;  4DHZ B;  1WE6 A;  2IBI B;  4TV3 A;  4EOY A;  5HKH A;  2JY6 A;  3WAM A;  2REX A;  3DCG A;  1UH6 A;  1WX8 A;  2FCS A;  2FCN A;  2XK5 B;  2BGF A;  3ZIM A;  1EO6 A;  4MM3 A;  5LXI B;  2L05 A;  2KNB A;  1WGD A;  3RT3 B;  4BKS D;  4AJW A;  4HDQ A;  3KYC D;  4W9G A;  1WM2 A;  1WM3 A;  1E7V A;  3DPD A;  4LJP B;  5G2N A;  2KWV B;  4WJQ A;  2DZM A;  2G3Q B;  5DPW A;  1D3Z A;  1Q1O A;  5LLI A;  4MSM B;  1CMX B;  2DHZ A;  4FHK A;  1XQQ A;  2GMI C;  3WAL A;  1MG8 A;  2YVC A;  4FJV B;  2KD0 A;  1WI0 A;  4WWP A;  2KJR A;  2BYF A;  2WX1 A;  4HPL B;  4NJ6 A;  2JVC A;  4I6P A;  4KDI C;  2EMT A;  3DVG Y;  3VUX A;  1YX5 B;  2PJH A;  1WJ4 A;  2NCN A;  1WGG A;  4F8C B;  3LDZ E;  3PT2 B;  4PYZ A;  1UBQ A;  4JQW C;  4KZC A;  4IM3 A;  2KDI A;  3KW5 B;  2ZVN A;  4MGI E;  4ZRJ A;  2R2Q A;  2CKH B;  3JSV A;  2M8S A;  2BPS A;  4MJS A;  1WGY A;  4W9L A;  4FBJ B;  3V6C B;  4GU2 A;  4GOC A;  3PHW B;  4GMV A;  4WWO A;  2ZPY A;  1GC7 A;  4EKU A;  2MBB B;  3MJW A;  4HCP B;  1WXS A;  3IHP C;  3APC A;  2A4Z A;  2MSE D;  4KDL B;  4NAW B;  3APD A;  1WR6 E;  4HK2 A;  3JVZ X;  2D3G A;  5CHW A;  1WX7 A;  4WAA A;  3TMP B;  5AZG A;  4ZDV A;  1YQB A;  1E7U A;  2GBR A;  2MW5 A;  2KFJ A;  1AAR A;  3VUW A;  2OOB B;  3PRZ A;  3VVW B;  3QCA A;  4A3O A;  2DYB A;  4EZL A;  2M0X A;  1NBF C;  1P0R A;  1WJ6 A;  3UIP B;  4K7U A;  3ZDM C;  1UBI A;  4E74 A;  3A9J A;  3JW0 X;  2L00 B;  2J0K A;  3DBH I;  3DOW A;  4WWN A;  1RFA A;  2KWU B;  3DBL I;  4HWI B;  4GSW A;  2GBM A;  1V9J A;  2NBW B;  2HE7 A;  2KFK B;  4GGQ A;  2JUO A;  3KH0 A;  4XX5 A;  4W9F A;  4GDL B;  2N4F A;  5JH5 C;  3N3K B;  1C3T A;  3CSF A;  2IO1 B;  3S2A A;  1E8Z A;  3H7P A;  2KJH B;  3V60 A;  3W1Y A;  1IP9 A;  2KOX A;  1L2N A;  4GDK A;  3DBS A;  5BO4 B;  3ZRF A;  2KJ6 A;  3X0W A;  3PGE A;  3UGB B;  4CO7 A;  2GOW A;  4DHJ B;  2CHX A;  2NBU A;  2AL6 A;  2PPH A;  5J2R A;  1WXV A;  4IWO A;  1PQS A;  2LAS A;  3CST A;  4TQ0 A;  2AEH A;  1YX6 B;  3P2B A;  4FAD A;  2C60 A;  3N30 A;  3H1U A;  4K1R B;  5CTR C;  2K39 A;  3VFK A;  4LJO B;  4FJY A;  4W9C A;  1LXD A;  3KUC B;  1T0Y A;  1KLV A;  2MBO A;  4DDI D;  4JIO U;  3PZD A;  5IAA C;  2IO0 B;  3ONS A;  1E8W A;  2NPT B;  1V86 A;  3UQA A;  1WXA A;  3A9J B;  2I1J A;  1HE8 A;  1WFY A;  5CHV C;  2KC1 A;  1SIF A;  4URK A;  4G3X B;  3BY4 B;  1K8R B;  2V1Y A;  4E3C A;  4F7Z A;  4P7I A;  2WYQ A;  3MHS D;  2N7D A;  3ZNH B;  4DDG D;  2KDB A;  2C7M B;  2KDE B;  4WJN A;  2L7R A;  2XEW A;  3ZUN A;  2DYO A;  1KM7 A;  4TUU A;  4M0W B;  2YLM A;  3L17 A;  3ZTC A;  5D7G A;  3L0W B;  3H7P B;  5JZE B;  1E5W A;  3C0R B;  4LCD E;  4PS7 A;  5DPT A;  2JXX A;  4NY0 A;  5KHQ A;  1M94 A;  2KDF B;  3QJZ A;  2BKF A;  2RSU A;  5D2M B;  3A33 B;  4F1S A;  3KVF B;  3L54 A;  1L7Y A;  5AZF A;  3TIX A;  2RD0 A;  2O6V B;  3SDL C;  2KN5 A;  3QK0 A;  3T8M A;  2HTH A;  1WF9 A;  2ZZP B;  2FAZ A;  3DDC B;  3M3J A;  4HXD A;  1OTR B;  5G55 A;  1Y8R C;  2O2V B;  4KVG B;  4MGZ E;  3QAQ A;  4K7S A;  4MH0 E;  4ZRK A;  3UF8 A;  2UYZ B;  4A20 A;  2MWS B;  2KC2 A;  2QHO A;  3K9O B;  4DHZ E;  2DX5 B;  4NNJ B;  1A5R A;  3A1Q B;  4GB9 A;  4PS3 A;  1V5O A;  2L8J A;  3GZN I;  4DXA B;  1UZX B;  2MBH A;  4DK5 A;  1GG3 A;  2LRU A;  3DVG X;  2KO3 A;  4W9K A;  1ZGU B;  2RPQ A;  5E6N A;  1QZE A;  2C9W B;  4MGY E;  3UQB A;  4A3P A;  3M95 A;  3SU8 X;  1WZ3 A;  4FLH A;  4JLC A;  4WJP A;  3HHM A;  3OAW A;  4NQL B;  4MEM A;  4ANX A;  3ZO5 B;  5GMV A;  4E71 A;  3SD5 A;  4IG7 B;  2K25 A;  3AU5 A;  2G4S A;  2C7H A;  3ZNI D;  2LWP A;  2A5U A;  1RRB A;  1IPG A;  2N1V A;  2K6Q A;  2Z59 B;  3ZRC A;  3QHT A;  3EHV A;  4NPN A;  3RUI B;  1UEL A;  2DZJ A;  4KSK C;  4W9E A;  3APF A;  3CMM B;  2DAJ A;  3H7S A;  1EUV B;  4ZRI A;  4BVU C;  2Y5B B;  2DEN B;  3IFW B;  4FN2 A;  3ZNG C;  4AP4 C;  3DBR I;  3ZNZ B;  2L76 A;  1LM8 B;  2KFK A;  1V6E A;  1C1Y B;  3T9L A;  3PRE A;  2CR5 A;  2KMA A;  4K7W A;  5AEK B;  2C5L C;  4M8N A;  2AL3 A;  2Z0E B;  3N32 A;  3KUZ A;  3BIN A;  2B3A A;  3ZW3 A;  5IA7 A;  5DPS A;  2LRW A;  4YL8 A;  3DQV A;  2MLB A;  4AWJ A;  2IYD B;  3NHE B;  4GDK B;  4EZK A;  4LDT D;  4ICV A;  2NS5 A;  2K1F A;  2LUE A;  3HK0 A;  2IY0 B;  2CS4 A;  3A9K A;  3Q3J A;  4ICU A;  1OEY A;  3JYU A;  1WH3 A;  1GUA B;  3ENE A;  4IUM B;  3U7D A;  2MCN B;  1EF5 A;  2FIF A;  2XK5 A;  1WYW B;  3L16 A;  2D2Q A;  5E6P A;  3K9P B;  4FA6 A;  4W9J A;  3A9K B;  3B08 A;  4B9K A;  1J19 A;  4KV2 A;  3QC8 B;  2LGX A;  3KUD B;  1G6J A;  2BF8 B;  2G4D B;  2KLG A;  3QAR A;  3WIM A;  2N1W A;  4XZ4 A;  1GC6 A;  3TJP A;  2DYM A;  2O6V A;  2NPT A;  4OVV A;  4WJO A;  2LVQ A;  2BWF A;  2MP2 A;  3VH4 B;  1WX9 A;  4ASW C;  2PE9 A;  2UWQ A;  1TGZ B;  3RZF A;  2N9P C;  4GXB A;  4NJ7 A;  2D10 A;  2L3Z A;  4MEL A;  2BWE S;  3OLM D;  4JL9 A;  3NS8 A;  2DZI A;  3WA0 A;  3TCA A;  1E8X A;  4EZJ A;  1KOT A;  4EFO A;  4MGK E;  2D11 A;  1WGH A;  1GNU A;  3PRP B;  4PS8 A;  2FCM A;  4W9H A;  2KZR A;  1P9D U;  2M4N A;  2KAN A;  2RR9 A;  3R7R A;  2LVO A;  2FID A;  2K6D B;  2KWC A;  3VHT C;  3TL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...