4PYUA

The conserved ubiquitin-like protein hub1 plays a critical role in splicing in human cells
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
GSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein 5
publication title The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/allergen
total genus 23
structure length 76
sequence length 76
chains with identical sequence B, G, K, O, S
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4pyuA00
2KK8A 1M94A 4TKNA 2G4DB 4MSQB 1RRBA 3BINA 3NOBA 4HDOA 3CMMB 2YLMA 3JYUA 4GGQA 2N9EB 3RYTA 3VHTC 2IZVB 3UGBB 2J7QB 1P3QU 2LJ5A 3A1QA 4JIOU 3VH3B 1WMHA 2GMIC 3PRMB 3DVNU 2CS4A 1WF9A 3S2AA 2K6QA 2KO3A 3VDZA 1WGYA 5D94A 4AP4C 1K8RB 4IUMB 4CO7A 2FAZA 4I6LB 3A4SC 2D10A 3IFWB 4HPLB 3SD5A 1IYFA 1OQYA 1WM2A 2KDIA 2O6VD 3QX1A 3DVNV 1WIAA 1V80A 1YX5B 2C7MB 4NAWA 3RT3B 4GXBA 3KYCD 2MBQA 3H7SA 1WJNA 4RMAA 5LXHA 4BVUC 1OEYJ 4F1SA 3V61A 1WFYA 1G6JA 1UBIA 1X1MA 4FJVB 2ZZPB 3DBRI 2AL3A 2L00B 3L13A 2K1FA 3JVZX 2MCNB 1XD3B 2KWCA 4BOZB 2O6VA 4W9JA 5JHAA 3VTVA 3NS8A 3KW5B 1WX7A 3ZRFA 2LRUA 4K81A 1Y8RC 2CHWA 3M63B 2KLCA 4WWOA 4MGIE 1D3ZA 2EMTA 4WWPA 3PPAA 3WALA 1KJTA 1YQBA 4HCPB 3RULA 4BFRA 3A9KA 4I6NB 1WI0A 3R7QA 2IO1B 4KDIC 4IG7B 1E8YA 3M62B 4GU2A 1LXDA 3L17A 1VD2A 2AEHA 3OLMD 3TIXA 2KJ6A 3L08A 4PYZA 1FXTB 3ZNHB 2FUHB 4MM3A 4DWFA 4EZLA 2M0XA 1H8CA 1WJUA 1E5WA 1OGWA 2OJRA 5AZFA 1WJ4A 3DBSA 1I35A 3L10B 4URKA 3VTWA 2M17A 2MBHA 5CHVC 3PZDA 2A5UA 2LWPA 4G0NB 4NNJB 4KZ0A 3AI5A 3WA0A 4FULA 3UQBA 1RFAA 2FCMA 2KWVB 3APFA 2AYOB 2MWSB 2RD0A 1E7VA 2KNBA 4MSMB 3TMPB 1MG8A 2NCNA 3NZUA 3PHXB 4AUQC 2RSUA 3A1QB 5CX3A 2C60A 2LD9A 1J19A 1WMHB 3QARA 2KJHB 4G11A 2C7NB 2JPHA 2KMCA 2RPQA 4MELA 4ZRKA 4MGYE 2GBKA 1WX8A 2DZMA 4MH0E 2ZEQA 4YL8A 4FA6A 1E8ZA 4BKGA 2W9NA 3VAWA 4FADA 4TUUA 4GDLA 4HWIB 1ZKHA 3RZWC 3U8ZA 2EKEC 1XQQA 1TGZB 5IA7A 2ZVNA 2C7HA 4NAWB 1YX6B 2MA9B 4LDTB 4PS3A 4IW0A 2XBBC 4W9CA 5CTRC 3ML9A 1J8CA 1YJ1A 1Q0WB 4W9EA 3ZKJC 3EHVA 5JHBA 2KVRA 2JT4B 4MGZE 4K7WA 4LCDE 3H1UA 4XC2A 4AJWA 4PS7A 1WM3A 3DCGA 2AWTA 5E6NA 3HK0A 1WXVA 2O6VB 4EFOA 4PYUA 2GBRA 3ZW3A 5L95C 3ML8A 1R4MI 1UELA 2DAJA 2MSED 2NBVB 2JY6A 2V1YA 4XX5A 4KSLC 3OAWA 4X57B 3ENEA 3C0RB 4W9KA 4LJOB 3A9KB 3V62A 1Z2MA 2RGFA 1H4RA 2MP2A 3EECA 3K9PB 4BBNF 3DVGY 1L2NA 3D32A 2FIDA 3QC8B 3KUZA 2D07B 4IC7B 3VXWA 3QA8A 5FR6A 2BYVE 4EUTA 2JUOA 4IWOA 2KDBA 3ZTCA 3ZLZA 4NJ6A 1TTNA 3DPDA 1L7YA 3ZRCA 2JZ3B 4OVUA 3KUCB 2AL6A 4ASWC 2JVCA 2LGXA 3VVWB 4ZDVA 2J0JA 4NJ7A 5DPTA 2KX0A 3CF6E 4AWJA 5AEKB 3OJ3A 5J18A 4FLHA 1GC6A 2L8JA 4DDID 4KV2A 3PLUA 2LASA 2BWFA 1WRDB 2PE9A 2KOXA 2DZIA 4LDTD 2QHOA 4KDLB 3ZNGC 3KYDD 4ZYNA 2DYMA 3Q3JA 5G2NA 3MTNB 2K8BA 2I1JA 1WJ6A 2NR2A 4KIKA 2DAFA 3BY4B 3PTFC 5G55A 3QWZB 4WWNA 4BBNC 3PRZA 2DHZA 1WXMA 3APCA 2CR5A 1Z5SB 3EFUA 4MJSA 2I1KA 4AJYB 3N3KB 4GDLB 2KWUB 4EZKA 1C1YB 2ZVOA 2D2QA 3PRPB 4BKTA 1KOTA 5JZEB 2CHZA 2LI5A 1UBQA 2O2VA 3QCAA 1WY8A 2G3QB 1RAXA 2D11A 5D7GA 4CYEA 1UD7A 2JWZA 3SHQA 1GG3A 3N30A 1OEYA 1NDDA 4B6WA 1IPGA 1EF1A 4K7UA 5DCNA 2DX5B 4J6IA 2UWQA 2A4ZA 4W9HA 3PREA 4NQLB 1WGRA 4G50A 2YVCA 4DBGA 2C5LC 2KDFB 3U7DA 3KH0A 3OJ4B 5C1ZA 1Q5WB 3T8MA 4ANVA 2J0KA 2BPSA 2K8HA 2Y5BB 2KXJA 3IVFA 2EMSA 2N1WA 3U30A 1TZ1A 2MP2B 3V60A 2HJ8A 4FHKA 4GMVA 2ZJDA 2J0MA 2MX2A 3A4RA 1LM8B 3PS6A 4B9KA 1V49A 4RM9A 3ZIMA 4KZCA 4EKUA 5J17A 1LQBA 1ZW7A 2KTRA 3WAMA 4WQOB 3ALBA 2LVOA 2MBEA 2N9XA 4JLCA 3M95A 4IWPA 2Z0DB 5CHFA 3JW0X 3W1YA 2ZNVB 3UF8A 2REXA 3AU4A 2GBNA 2L3ZA 4BOSC 3NHEB 4W9FA 3ZNID 3QIJA 4G3XB 1S1QB 3RD2A 2BWES 3AXCA 2IO2B 3B08A 4B95A 2IO0B 4TQ1A 4WJQA 5AZGA 2ZPYA 3W1SC 2MBBB 3IBEA 4E74A 2N7DA 4II2B 3TL5A 4LJPB 3PSEB 2WX1A 4TV3A 2G45B 5KHOA 3A9JA 1GJZA 3PLVA 2BF8B 1C3TA 1E7UA 2BKRB 2MBOA 4KIKB 4ZRJA 2KC1A 3QAQA 2JZZA 1WZ3A 3DDCB 1WR6E 2RR9A 3AULA 4MJSB 3JSVA 3UINB 2FIFA 4F8CB 2PE6B 2LXCA 2GBJA 2IBIB 3VFKA 4BKSD 2KD0A 1PQSA 2WX0A 4GSWA 1E8XA 4IWQA 3L16A 2R2OA 4ANUA 1UH6A 1I42A 2Z59B 3DOWA 2B3AA 1P9DU 2BYEA 5C23A 4DDGD 2XK5A 4OVVA 4GDKA 4W9DA 2Z0EB 3HHMA 4A3PA 5HKHA 1E8WA 3IHPC 4ICUA 4M0WB 4P7IA 3CSTA 4BKSA 3SDLC 1P0RA 2LXAA 4JQWC 1YIWA 3AU5A 1GC7A 2K39A 3V6EB 3RCZA 3M3JA 3MJWA 1IP9A 1T0YA 4DHZE 2K6DB 1WX9A 4JGHB 4FBJB 5GMVA 3R66C 4HJKA 1WYWB 4IM0A 1EF5A 4EEWA 4JL9A 2KKCA 4E71A 2KTRB 2JRHA 1NI2A 2JXXA 2HD5B 2IY0B 3HM6X 3DBHI 4W9IA 4DXAB 1WXAA 3UIOB 2KQSA 2FCSA 3VTUA 2DZKA 4NPNA 4HXDA 2DZJA 2N4FA 4FJZA 2K8CA 1BT0A 2M4NA 4ZRIA 3W1SA 1HE8A 4WAAA 1VCBA 2DENB 4M8NA 2L7RA 5AZHA 2OOBB 1WE6A 3A9JB 4W9GA 4W9LA 2KZRA 4EOYA 5LXIB 2IO3B 1A5RA 2HTHA 4DHJD 1E90A 1U4AA 4FN2A 1UZXB 3QQ8B 3R3MA 4FHJA 3CSFA 2KDEB 2MQJA 3SU8X 1GUAB 4HK2A 2KJRA 3JSVB 1NBFC 3TCAA 5JH5C 1SIFA 2NPTA 4WJPA 2BGFA 2NBUA 4RM8A 2CU1A 4I6PA 4TQ0A 3V6CB 1V2YA 3WAOA 3DVGX 4WJOA 1RLFA 4HLEA 2K25A 2CKHB 1WZ0A 1Q1OA 2XK5B 3P2BA 4GDKB 3VUYA 4E3CA 1AARA 2LGDA 3B0AA 2L0TA 5DPRA 2PPHA 4XZ4A 2FNJB 4WJNA 1ISNA 2WYQA 4DHZB 4FJYA 2BYFA 3LJ3A 5E6OA 3TBLD 1R4NI 2JRIB 3DQVA 4MEMA 1YD8U 2LVQA 3H7PA 3TJPA 3ZO5B 4NY0A 4ANWA 4II3B 3ONSA 4KVGB 4IM2A 1XT9B 1SGHA 2IY1B 3DBLI 4F7ZA 3PHWB 2WDTB 4GB9A 3NY5A 2GBMA 2NBWB 3UQAA 1EO6A 2PEAA 2M8SA 3A33B 3KUDB 1V9JA 2IYDB 2KQ7A 5CHWA 2LUEA 3NZSA 2ZCCA 1WGHA 4DK5A 2CHXA 1SE9A 2R2QA 2JF5A 4N9F4 2FCQA 4NQKE 4GN1A 2VRRB 2KN5A 2ZPNA 2DYBA 4HCNB 4A20A 2C9WB 3VQIA 1F9JA 4PS8A 1V5TA 4K7SA 3B1LX 1V81A 3HM3A 4CHKA 3O65B 1WXSA 3VUXA 2NVUI 2LRWA 2DYOA 3Q3FA 3R7RA 2KFKA 3IG3A 1WGGA 2V4LA 4IM3A 3QK0A 3MHSD 1ZGUB 3PV1A 4EZJA 2ZNVC 5L83A 2LGYA 3PT2B 4K1RB 4HVBA 3T9LA 5J2RA 2WWZA 2KMAA 1TBEA 2N7EA 3RZFA 3ZDMC 3H6NA 2NPTB 2O2VB 5DPSA 3ZTDA 3ZDTA 5IAAC 5EDSA 3K9OB 1LFDA 3L0WB 3X23A 2BKFA 1KM7A 2HE7A 2XEWA 3LDZE 2L76A 3WIMA 1WH3A 4DHJB 3PGEA 1S3SG 2UYZB 5BO4B 3WAPA 2MRPA 2MW5A 3QJZA 1EUVB 2KHWB 1P1AA 4GOCA 2V3SA 2M1MA 4A3OA 1KLVA 3EC8A 1WE7A 2ZCBA 1V5OA 2MLBA 2KC2A 4ICVA 4MDKE 1V86A 5KHQA 3H9DA 5DPWA 3PVLA 3ZUNA 2KFJA 1WR1A 3ZNZB 3N32A 1OTRB 3I3TB 3H7PB 4AOFA 3QHTA 1V6EA 1CMXB 1UGMA 3RUIB 2ASQA 1JRUA 1WGDA 2PJHA 2L0FA 3VH4B 2G4SA 4HPMB 2N1VA 4ANXA 5D2MB 3APDA 3WANA 3ECIA 3L54A 4M8MA 5E6PA 2NS5A 2FCNA 3VUWA 3KVFB 2D3GA 3GZNI 4GIVA 5D6JB 5LLIA 2L05A 2KANA 2KTFA 4HDQA 2KX3A 3UIPB 5TR5A 3X0WA 4MGKE 1GNUA 4KSKC 2N9PC 3ZVVA 2LVPA 1P98A 1J0GA 1QZEA 2KLGA 3GOEA 2GOWA 3HIZA 2KFKB 2LZ6A
chains in the Genus database with same CATH superfamily
1QLBB 4HROA 4TKNA 2G4DB 4HDOA 1FCCC 3RYTA 1TS5A 1XCQL 3UGBB 4RGOS 1L6UA 3DVNU 4YXDB 3RI7C 5BYSA 1F77A 4AP4C 2EKIA 3IFWB 1OQYA 2KDIA 1WIAA 2C7MB 4LTUA 3KYCD 2MBQA 3MC9A 4RMAA 5LXHA 3AMZA 4F1SA 2KACA 1FRRA 1WFYA 3V61A 2MJEA 1XEEA 1SB3C 1WYGA 4MACA 1XD3B 2KWCA 4BOZB 2KAJA 5JHAA 1WX7A 1Y8RC 5HG2A 4MGIE 1D3ZA 1ACCA 4I6NB 1WI0A 2K0PA 3ZJVA 1I4XA 3HUIA 4B0MA 4GU2A 1VD2A 2AEHA 3OLMD 2JXTA 2KJ6A 3L08A 3TIXA 4L2YA 1FXTB 4PYZA 2FUHB 4MM3A 4DWFA 1ZUD2 3NG0A 1OGWA 1KH0A 1RYJA 1I35A 3Q8FA 2MBHA 2VZKB 2A5UA 2FCMA 2R61A 2NCNA 3P4SB 2D3CA 5CX3A 2WLBA 3A1QB 5IP4D 1WMHB 2C7NB 3I5JC 4MELA 2RPQA 4MH0E 1WX8A 2ZEQA 3VAWA 1PYWD 3W9CB 4GDLA 4HWIB 3NUHB 1WRIA 1TGZB 1EWCA 2INDC 2H89B 4PS3A 2AQ3B 4W9CA 3ML9A 1J8CA 2W3RA 2WXOA 4W9EA 2X8XX 2KVRA 2JT4B 4H2AA 4M00A 3PO0A 4XC2A 4AJWA 4PS7A 2G9HD 2AWTA 5E6NA 3AE7B 2O6VB 4WAFA 4PYUA 3SFDB 1SIJA 4M01A 2MSED 2V1YA 1ET9A 3DBRB 1GAQB 3C0RB 4UDUC 3V62A 2MP2A 3OWEB 4EUTA 4IWOA 2EELA 1TTNA 2JZ3B 4R3DA 1YOVB 4OVUA 3KUCB 3DWMA 3KWLA 4JX1C 4ZDVA 1CQVA 1E6EB 5AEKB 4AWJA 4FLHA 2XN9C 3PLUA 3NRZA 3AN1A 2DZIA 2KWDA 5G2NA 3NJTA 2DAFA 2YEPF 3QWZB 4WWNA 1N60A 2I1KA 5HHDG 4EZKA 2D2QA 3PRPB 3TEWA 2K22A 1C79A 3GE3C 1WY8A 2JWZA 3FILA 3IT6B 1MHXA 4ACFA 1PUTA 1KF6B 4XYCA 1EF1A 1PGBA 4K7UA 5DCNA 3PREA 4NQLB 1WGRA 4M0WA 2YVCA 4DBGA 3U7DA 2MHJA 3KH0A 5C1ZA 3T8MA 4XDCA 2BPSA 2K8HA 2KXJA 1OQQA 2L32A 2UU7A 1UUPA 4GMVA 1LM8B 1V49A 3ZIMA 4RNAA 3WAMA 4JLCA 2N0SB 3W1YA 3UF8A 2GBNA 4G3XB 3RD2A 2QILA 2IO2B 2INPE 4B95A 2IO0B 3W1SC 4E74A 3KQ4A 4II2B 3TL5A 3PSEB 1GJZA 3RNBC 5JXVA 4ZRJA 2M56B 2KC1A 3QAQA 2RPVA 4NZLB 3UINB 4F8CB 1AYFA 1XLQA 2KD0A 1FNUA 4GSWA 2N9KA 1I42A 3FAHA 1DYQA 4DDGD 2N9LA 3FC4A 3IHPC 4WH4A 3CSTA 2LXAA 3AU5A 2DLBA 2VH1A 3V6EB 1A70A 1SJED 3LXFA 4HJKA 3HVDA 1HA5A 2SEBD 3TEXA 1EF5A 5FK9C 4LNIA 2JRHA 3IAM1 1R4NB 3DBHI 1WXAA 3UIOB 3CWIA 1UNSA 2JYEA 1M4VA 2WGSA 4FJZA 1BT0A 3E9SA 1VZ8A 3DBLB 3W1SA 1VCBA 2DENB 2KQ4X 1WE6A 4EOYA 1MPEA 3TUOA 2IO3B 3QQ8B 3R3MA 5HI1A 4LLGM 1P7EA 3WAOA 4WJOA 1RLFA 2D3BA 1TIFA 2LHDA 1Q1OA 4GDKB 3VUYA 4LNOA 1TY0A 2IJ0A 2L0TA 2PPHA 1DGJA 2FNJB 2IPKD 5TSSA 3AB5A 1ISNA 4DHZB 4FJYA 2D3AA 3DQVA 4MEMA 1YD8U 3C19A 5FR3A 3H7PA 4N6EB 4KVGB 1CZPA 1ZE3D 1SGHA 4GB9A 3NY5A 1JALA 3KUDB 3A33B 4ZRQA 2G1EA 3NZSA 1WGHA 4N9F4 2FCQA 3Q2AC 2VRRB 2ZPNA 2DYBA 4HCNB 4PS8A 1NENB 3B1LX 1V81A 4CHKA 2XNAC 1KLUD 1BMLC 1JRPA 2LRWA 3R7RA 5H92C 2BS2B 2ZNVC 1FFUA 4K1RB 4HVBA 4DQOC 1TBEA 1V8CA 2N7EA 3ZDMC 2NPTB 3RMKC 5IAAC 4LNKA 5EDSA 3ZGZA 1D5MC 1LFDA 1KM7A 2L76A 3VRBB 3Q14C 1TYGB 1YJIA 1P1AA 3RN9C 4A3OA 1WE7A 3AE4B 4ICVA 2KC2A 4MDKE 1HTOA 4RGMA 5DPWA 3PVLA 3ZNZB 1OTRB 3I3TB 3QHTA 3NZ3A 1CMXB 3V3XA 2PVGC 2W54A 2L0FA 3VH4B 2WXNA 5D2MB 3L54A 3DHGC 4M8MA 4ZYSA 3B9JA 3GZNI 2L05A 2KANA 4IKGA 4HDQA 2KX3A 3UIPB 2BBCA 4MGKE 1AWDA 5BMHA 3GOEA 2GOWA 1QOGA 1V1PB 2LZ6A 2KK8A 2B76B 3DHIC 4MSQB 2YLMA 2N9EB 2J7QB 3A1QA 1WMHA 3PRMB 2CS4A 4IOIE 2KO3A 3U52E 3VDZA 4HKQA 1K8RB 2BVCA 2FAZA 2D10A 1ET6A 4K3CA 3RT3B 1WJNA 2V3NA 1X1MA 3DBRI 2AL3A 2L00B 1MI0A 1BUIC 2WXFA 2O6VA 2BW2A 2LRUA 3Q3OC 1VZ7A 3BVZA 1N5XA 3WALA 1YQBA 3W5UB 3RNEC 4HPPA 4BFRA 1STEA 1TS4A 4IG7B 4KDIC 3ZJTA 1FIQA 1LXDA 1PDXA 1R4MB 1E5WA 2JQRB 3L10B 3VTWA 4DXGA 3PZDA 2LWPA 3AI5A 1RFAA 2KWVB 3APFA 2RD0A 2KNBA 2MJ3A 3TMPB 1WWTA 1MG8A 3ZXVA 3NZUA 3PHXB 3PZ8A 1F0ZA 4XGAB 2C60A 1J19A 4ZRPA 2JWUA 4G11A 3Q8CA 1E9MA 2KMCA 4O1NA 4ZRKA 4HEA1 5BMGA 4YL8A 2FBWB 3P42A 1ZKHA 1WGKA 4XWWA 3ZQ4A 3EGRA 2ZVNA 2C7HA 4NAWB 1YX6B 2MA9B 2XBBC 5E6JA 1Q0WB 2HTME 3ZKJC 4K7WA 1L0VB 1VZ6A 1WM3A 4L1BA 1UGJA 1WXVA 3AE6B 1ZDXA 2WXKA 3AEDB 3ZW3A 5L95C 2RDGA 2DAJA 2GB1A 4XX5A 4KSLC 3N9YC 4X57B 4W9KA 3A9KB 1V1OA 1Z2MA 2RGFA 2AX5A 3K9PB 4BBNF 4JWSC 2INNE 3QC8B 3P63A 2D07B 2KN4A 3VXWA 2BYVE 3ZLZA 4NJ6A 3ZRCA 3IXSA 3RNAC 4NJ7A 2KX0A 3Q8AA 5T8IA 2L8JA 1WRDB 3T3OA 2QHOA 4KDLB 3ZNGC 3Q3JA 3W2DA 3DWGC 2NR2A 3BY4B 3PRZA 2DHZA 1WXMA 1C1YB 1T0QC 5JZEB 2LI5A 5G5HA 2G3QB 1RAXA 5G5GA 1FCLA 4CYEA 1EWYC 3N30A 4J6IA 3RNCC 2C5LC 2KDFB 1F2RI 4WQMA 2QIEB 2W3SA 4RFBA 3BVGA 2J0KA 2EMSA 3U30A 2HJ8A 1C9FA 2Y5CA 2E6XA 2ZJDA 2D5GA 5IO9A 2LJIA 1SE3A 3PS6A 5J17A 3TEZA 5IKCM 1ZW7A 4WQOB 1JQ4A 2MJDA 4YSYB 2Z0DB 3JW0X 2ZNVB 2GI9A 3Q6BA 2K9XA 3ZNID 4A90A 2BWES 3AXCA 3B08A 4TQ1A 4WJQA 2ZPYA 2WXRA 2N7DA 4LJPB 4TV3A 1C3TA 1KRHA 1E7UA 2JZZA 1WR6E 4MJSB 2FIFA 1ESFA 2GBJA 2IBIB 3VFKA 1FEHA 4MH8A 1PQSA 2WX0A 1UH6A 2Z59B 4HKZE 1P9DU 2BYEA 5C23A 4K3BA 4OVVA 4GDKA 2HJ1A 3BYTB 4W9DA 3HHMA 4A3PA 5D3IB 4P7IA 1K53A 4JQWC 1FXIA 2WXJA 1C76A 5GMVA 1XF5L 1SBBB 2BS3B 2KTRB 2JXXA 4W9IA 1P7FA 2DZJA 5GXGB 2M4NA 2KDMA 4ZRIA 1B1ZA 2RMMA 2V4IB 4WAAA 2L7RA 5AZHA 4TSSA 4W9GA 1QILA 5LXIB 4A55A 1A5RA 1V97A 4FN2A 1U4AA 1UZXB 2MQJA 4XWTA 1GB1A 1KFYB 5JH5C 1SIFA 2NPTA 4RGTA 2BTEA 4LNNA 3NVVA 2WP9B 2CKHB 2L83A 4KKJA 1JCKB 2IGHA 1AARA 4A6QA 5E6OA 1IGDA 4OW0A 2WXQA 3BK2A 4YWGG 1SXTA 4NY0A 3HVZA 4RGNA 2Q5WD 2WDRB 3BVMA 2WDTB 2WHIA 2GBMA 2NBWB 1EO6A 3UI3A 2IYDB 3AECB 4D2KA 3I9V1 4DK5A 4NQKE 5FKAC 2KN5A 1QOFA 2C9WB 3VQIA 4K7SA 4RCOA 2DBYA 4HRSA 1WXSA 2DYOA 3Q3FA 1IBXB 1V1PA 3IG3A 2V4LA 2WNMA 2N7JA 2LGYA 2J4XA 2QSDA 5J2RA 2PVOD 2KMAA 3H6NA 3OG5A 4IDIA 3ZDTA 2I38A 1PFDA 1JWAD 4GLSC 4C00A 4DHJB 3O13A 1S3SG 2BS4B 2MW5A 3BZDB 4ITKA 2V3SA 3RNFC 1CJEA 1KLVA 3CIRB 1TS3A 3Q3MC 1V5OA 2MLBA 3AE8B 3R2TA 3EUB2 3N32A 3VR8B 5BYQA 1UGMA 2LHEA 3Q69A 3KLSX 1JRUA 1VLBA 4AQ7A 1RFKA 2N1VA 3WANA 4PK1A 4XE0A 2ZW0A 2WXPA 2NS5A 3KVFB 2D3GA 3NVYA 1XCTL 3AH7A 3AM9A 2W82A 5TR5A 3X0WA 1GNUA 4YTMB 1J0GA 1ENFA 3EA6A 2GLSA 1MG4A 4C7YA 3NOBA 3JYUA 3LYYA 1RM6C 2IZVB 1L5PA 2LJ5A 2GMIC 1WF9A 3U7ZA 2LGSA 3MC8A 4IUMB 4HPLB 3AV8A 1IYFA 1WM2A 2O6VD 1K51A 3DVNV 3B2GA 1YX5B 1V80A 4NAWA 2YEPB 4TMAB 4GXBA 2JX5A 3H7SA 4YT0B 2LMCA 2GRIA 1MFWA 1Y56A 2ZZPB 3L13A 3JVZX 2MCNB 4W9JA 2J53A 3NS8A 3KW5B 3ZRFA 2CHWA 3M63B 1I4GA 4WWPA 3PPAA 1FPYA 3A9KA 5BYRA 2LEKA 3SFEB 2JYTA 2IO1B 1E8YA 3L17A 1XXGA 1I7HA 1QF6A 3MP9A 4EZLA 2M0XA 4DXFA 2WU2B 2OJRA 5AZFA 1IUEA 4URKA 3P4RB 2M17A 4G0NB 4KZ0A 3UQBA 1JWUD 1E7VA 4MSMB 4US8A 2RSUA 2KJHB 1EM7A 4RH6A 2PMVA 3DHHC 4FA6A 1E8ZA 2W9NA 2LUMA 1QT9A 2KMMA 3U8ZA 5IOIA 5IA7A 3MC0B 4L23A 4RF1A 1UWMA 1B9RA 5CTRC 1JROA 1YJ1A 4WURA 5JHBA 5LNK1 2JSVX 3HRDD 3H1UA 1TKEA 5I4DA 3IT4B 3BIID 4EFOA 2NBVB 2JY6A 4JPSA 1ZDVA 3OAWA 3ENEA 2INCC 1GB4A 4ARIA 1D6EC 3KUZA 4IC7B 3QA8A 5FR6A 2QMTA 1KLGD 2WDQB 4MT5A 1C77A 2AL6A 4LNFA 4HJGE 2J0JA 2BYTA 1C4AA 5J18A 4DDID 4KV2A 2LASA 2BWFA 4LDTD 1N63A 2CJOA 3KYDD 4ZYNA 1SSNA 2K8BA 2I1JA 4BBNC 1SE2A 3APCA 2CR5A 1Z5SB 3EFUA 4MJSA 4AJYB 3N3KB 2KWUB 1VDVA 4J3OD 3QCAA 2O2VA 2D11A 2Y5PA 3R8BA 1HZ6A 3AEBB 1J7AA 3I57A 3T3NA 2DWQA 4W9HA 4G50A 1JW9D 1LGRA 3OJ4B 3NS1A 1Q5WB 4ANVA 3IVFA 3V60A 2J0MA 3A4RA 4WIPA 4B9KA 4RM9A 4EKUA 4KZCA 5EE9A 3P4QB 3U4EG 2KTRA 2QCZA 2LVOA 5CHFA 3AU4A 2DNFA 2L3ZA 3NHEB 4W9FA 1S1QB 4WWMA 2ZW1A 1RWSA 2IGGA 1ZXHA 5AZGA 4PT5A 2G45B 5KHOA 3DBHB 1VR9A 3PLVA 2KYWA 2MBOA 4KIKB 1TJEA 1YJJA 2RR9A 2LXCA 3J9CA 4ANUA 4IWQA 3L16A 1NVID 2E3TA 2W55A 3DOWA 2LFIA 3FKYA 3ZXRA 1QOBA 2J42A 1OFFA 5HKHA 1E8WA 4BKSA 3H8HA 1P0RA 1YIWA 4P16A 2K39A 1I4PA 2PLPA 3M3JA 1IP9A 1AN8A 1WX9A 4JGHB 4BZAA 1WXQA 1WYWB 4IM0A 4EEWA 4JL9A 3SR6A 1OQRA 2IDYA 2KKCA 4EE2A 1NI2A 4P6VF 4DXAB 1C4CA 2L52A 1NEKB 2FCSA 4NPNA 3V05A 4HXDA 2N4FA 2K8CA 3ABVB 2NMQA 1IBXA 4A8XC 3A9JB 4W9LA 1QQRA 1I4RA 2KZRA 2WDVB 3CSFA 2KJRA 3RNGC 3JSVB 3RFZB 3TCAA 4US9A 2BQQA 4WJPA 2PIAA 2NBUA 1V2YA 3AEAB 4HLEA 2XK5B 3P2BA 3ZYYX 1I4QA 5DPRA 4XZ4A 1PGAA 2Y3AA 2WYQA 3LJ3A 3TBLD 1R4NI 2JRIB 2H88B 1F1HA 3TJPA 3ZO5B 4ANWA 3AEFB 1XT9B 2V0GA 2IY1B 3DBLI 4F7ZA 3B2FA 3UQAA 3TEYA 2M8SA 1TS2A 1T6BX 1V9JA 2KQ7A 1EU4A 1YN5A 2Z8LA 4ZHOA 4C4VB 2JF5A 4A20A 1F9JA 1I4HA 2ONQA 3GE8C 3VUXA 3LB8C 4IM3A 3PV1A 5L83A 3PT2B 3GZNB 3T9LA 4YSZB 5EE3A 3RZFA 2O2VB 3ZTDA 3K9OB 2HE7A 2K5PA 3WIMA 3RPFC 3PGEA 1FRDA 3QJZA 2KHWB 4GOCA 2M1MA 1J7BA 3VRAB 5KHQA 3N1ZC 1JWSD 1V86A 2KFJA 2PW9A 4AOFA 1DOXA 2QDFA 1V6EA 2V9HA 3RUIB 2ASQA 1J7CA 4HPMB 4ANXA 2WXGA 3SEBA 3APDA 3GP7A 3ECIA 2FUG1 2RDHA 2FCNA 1GOZA 4FXCA 3VUWA 5D6JB 4M02A 4OZCA 1NYQA 4KSKC 3ZVVA 1P98A 1QZEA 2KLGA 2AQ2B 3Q8BA 2SAKA 3Q8EA 2CU1A 2KFKB 3BWUD 3MJ5A 4RF0A 1M94A 4KGRA 1RRBA 3BINA 3CMMB 4GGQA 3U2SC 1VJKA 3VHTC 1P3QU 4JIOU 3VH3B 1FNVA 3S2AA 1YQ3B 1NYRA 2K6QA 1WGYA 5D94A 5AUIA 3Q3NC 1L0XB 4CO7A 2AQ1B 2LGIA 5MPOA 1K50A 2QC8A 4I6LB 3A4SC 3SD5A 5HFYA 3QX1A 2QJLA 1XO3A 3AE2B 4BVUC 1OEYJ 1G6JA 1UBIA 3E56A 4C80A 4FJVB 2K1FA 1TKYA 2MEKA 1CK1A 1T0RC 3VTVA 4K81A 2KLCA 4WWOA 2EMTA 2WXMA 1KJTA 4HCPB 2WU5B 3RULA 3IAS1 1L0YB 3VR9B 3R7QA 3M62B 1VRAB 1E10A 3WCQA 3ZNHB 1XLPA 1N5WA 2PTLA 4ZOHC 1H8CA 1WJUA 1HTQA 2KVZA 1WJ4A 3DBSA 5CHVC 1PGXA 4NNJB 3WA0A 4FULA 2V3PA 1MHHE 3AE1B 2AYOB 2MWSB 1HQRD 4AUQC 2LD9A 3QARA 1BXTA 2JPHA 1N61A 4MGYE 2GBKA 2DZMA 2BB6A 1N6ZA 4BKGA 4FADA 4TUUA 3W5VB 3RZWC 2EKEC 1XQQA 1QOAA 4LDTB 4IW0A 3L4PA 3ETRA 5IN7A 2I2YA 4OZBA 3EHVA 4MGZE 4LCDE 4Q2JA 1FMAD 3R2IA 1LO5D 3DCGA 3HK0A 2WS3B 2GBRA 4KGSA 3ML8A 1R4MI 1UELA 2ON8A 1T0SC 2VZKD 1ROEA 4LJOB 1H4RA 3EECA 1L2NA 3DVGY 3D32A 5EE1A 2FIDA 5C3JB 4YTPB 4MM3B 2JUOA 2KDBA 3ZTCA 3DPDA 1L7YA 2NTSA 4P1BC 4ASWC 1UWXA 2JVCA 2LGXA 3VVWB 1ZOYB 1TT5B 5DPTA 3CF6E 3OJ3A 1GC6A 4C7ZA 4S17A 1FD6A 4N58A 2PE9A 2KOXA 1FXAA 1XLNA 2DYMA 3MTNB 1WJ6A 4KIKA 4ARCA 5G55A 2J52A 3PTFC 2M19A 2M0AA 1ZPSA 1YMHE 1L4DB 1F52A 4GDLB 2ZVOA 2FE8A 4BKTA 1MVKA 1KOTA 3BK1A 2CHZA 2KT7A 2L1AA 1UBQA 4KKIA 5H8YE 5D7GA 1UD7A 3N1XC 3SHQA 1GG3A 1SE4A 1OEYA 1NDDA 4B6WA 1ZP0B 1IPGA 2DX5B 2UWQA 2A4ZA 2CJNA 3URYA 3AE3B 3N1YC 2Y5BB 3P4PB 2N1WA 1TZ1A 4JE3B 2MP2B 2OJWA 4FHKA 3NVZA 2IGDA 2MX2A 1LQBA 3ALBA 2MBEA 2N9XA 3M95A 4NAMA 4IWPA 3PZ7A 5EE0A 1T5XD 2REXA 4KX6B 4BOSC 3QIJA 2MBBB 3IBEA 4S0RA 2WX1A 3A9JA 3C8YA 2BF8B 2BKRB 1SJHD 1XLOA 1WZ3A 1UF0A 2K3UA 3DDCB 1MJDA 3AULA 3JSVA 2PE6B 2ACZB 4OHJA 1GPXA 5AUKA 4BKSD 1E8XA 2R2OA 1DOIA 1C78A 2B3AA 3FILB 4QAYA 2XK5A 1Q10A 2Z0EB 3NVWA 4BAXA 1JWBD 1YN4A 4M0WB 4ICUA 3GS2A 3SDLC 4N59A 1GC7A 1T3QA 1E7PB 2RDBC 3RCZA 3MJWA 1T0YA 4DHZE 2K6DB 3GB1A 3MHZA 4FBJB 3I63C 3R66C 4E71A 5C2TB 4AS1A 2HD5B 2IY0B 3HM6X 4USAA 4C4VA 1FFVA 3AE5B 1TY2A 2KQSA 2HDEA 4OVZA 2BB5A 3VTUA 4LK0M 2DZKA 4NJCA 1R7SA 2ICIA 1HE8A 1FM0D 4M8NA 2WXIA 1EU3A 1NI3A 3TSSA 2OOBB 1TKGA 2HTHA 2JU6X 1E90A 4DHJD 1E0ZA 1FO4A 4FHJA 3SU8X 2KDEB 1GUAB 2WXHA 4HK2A 1HZ5A 1NBFC 4YSXB 2BGFA 4RM8A 2WQYB 4I6PA 4TQ0A 3V6CB 2NTTA 4A9AA 3DVGX 2K25A 1WZ0A 4E3CA 2JZPA 2LGDA 1YN3A 3B0AA 1N62A 3MFGA 3AE9B 2MH7A 5BMIA 1D5ZC 2BYFA 1SEBD 3AEEB 2LVQA 1HXYD 4B0EA 4II3B 3ONSA 4JWUC 4IM2A 3EFCA 3PHWB 2PEAA 4CQNA 5CHWA 2LUEA 1KTKA 2ZCCA 2CHXA 1SE9A 2R2QA 4P1CC 4GN1A 3KWVA 4OZAA 1V5TA 4C56C 3HM3A 2VH2A 3O65B 1TZOA 2NVUI 2OEDA 2BT6A 2PKOA 3P1MA 2KFKA 1AW7A 1WGGA 3QK0A 3MHSD 1ZGUB 4KGTA 4EZJA 4REZA 1HEZE 4YTNB 1L6VA 2WWZA 2OHFA 3AEGB 5D3DA 1D5XC 5DPSA 3L0WB 3X23A 2BKFA 3LDZE 2XEWA 1WH3A 2UYZB 5BO4B 2TSSA 3WAPA 2MRPA 1SF0A 3N20C 2CU3A 2WXLA 1EUVB 1WSPA 3EC8A 2ZCBA 2QEJC 3H9DA 3ZUNA 1WR1A 1JMLA 3H7PB 1QKZA 1K52A 1C4PA 1ZXIA 4ZHPA 1WGDA 2PJHA 2G4SA 4XDDA 1DOYA 5E6PA 1YNTE 1YQ4B 4GIVA 3ZJUA 1D4BA 5LLIA 3BYYB 2KTFA 1L4ZB 1F2RC 1JWMD 2N9PC 2LVPA 2X38A 1IGCA 1FNWA 3HIZA 4WJNA
chains in the Genus database with same CATH topology
2KK8A 1M94A 4TKNA 2G4DB 4MSQB 1RRBA 3BINA 3NOBA 4HDOA 3CMMB 2YLMA 3JYUA 4GGQA 2N9EB 3RYTA 3VHTC 2IZVB 3UGBB 2J7QB 1P3QU 2LJ5A 3A1QA 4JIOU 3VH3B 1WMHA 2GMIC 3PRMB 3DVNU 2CS4A 1WF9A 3S2AA 2K6QA 2KO3A 3VDZA 1WGYA 5D94A 4AP4C 1K8RB 4IUMB 4CO7A 2FAZA 4I6LB 3A4SC 2D10A 3IFWB 4HPLB 3SD5A 1IYFA 1OQYA 1WM2A 2KDIA 2O6VD 3QX1A 3DVNV 1WIAA 1V80A 1YX5B 2C7MB 4NAWA 3RT3B 4GXBA 3KYCD 2MBQA 3H7SA 1WJNA 4RMAA 5LXHA 4BVUC 1OEYJ 4F1SA 3V61A 1WFYA 1G6JA 1UBIA 1X1MA 4FJVB 2ZZPB 3DBRI 2AL3A 2L00B 3L13A 2K1FA 3JVZX 2MCNB 1XD3B 2KWCA 4BOZB 2O6VA 4W9JA 5JHAA 3VTVA 3NS8A 3KW5B 1WX7A 3ZRFA 2LRUA 4K81A 1Y8RC 2CHWA 3M63B 2KLCA 4WWOA 4MGIE 1D3ZA 2EMTA 4WWPA 3PPAA 3WALA 1KJTA 1YQBA 4HCPB 3RULA 4BFRA 3A9KA 4I6NB 1WI0A 3R7QA 2IO1B 4KDIC 4IG7B 1E8YA 3M62B 4GU2A 1LXDA 3L17A 1VD2A 2AEHA 3OLMD 3TIXA 2KJ6A 3L08A 4PYZA 1FXTB 3ZNHB 2FUHB 4MM3A 4DWFA 4EZLA 2M0XA 1H8CA 1WJUA 1E5WA 1OGWA 2OJRA 5AZFA 1WJ4A 3DBSA 1I35A 3L10B 4URKA 3VTWA 2M17A 2MBHA 5CHVC 3PZDA 2A5UA 2LWPA 4G0NB 4NNJB 4KZ0A 3AI5A 3WA0A 4FULA 3UQBA 1RFAA 2FCMA 2KWVB 3APFA 2AYOB 2MWSB 2RD0A 1E7VA 2KNBA 4MSMB 3TMPB 1MG8A 2NCNA 3NZUA 3PHXB 4AUQC 2RSUA 3A1QB 5CX3A 2C60A 2LD9A 1J19A 1WMHB 3QARA 2KJHB 4G11A 2C7NB 2JPHA 2KMCA 2RPQA 4MELA 4ZRKA 4MGYE 2GBKA 1WX8A 2DZMA 4MH0E 2ZEQA 4YL8A 4FA6A 1E8ZA 4BKGA 2W9NA 3VAWA 4FADA 4TUUA 4GDLA 4HWIB 1ZKHA 3RZWC 3U8ZA 2EKEC 1XQQA 1TGZB 5IA7A 2ZVNA 2C7HA 4NAWB 1YX6B 2MA9B 4LDTB 4PS3A 4IW0A 2XBBC 4W9CA 5CTRC 3ML9A 1J8CA 1YJ1A 1Q0WB 4W9EA 3ZKJC 3EHVA 5JHBA 2KVRA 2JT4B 4MGZE 4K7WA 4LCDE 3H1UA 4XC2A 4AJWA 4PS7A 1WM3A 3DCGA 2AWTA 5E6NA 3HK0A 1WXVA 2O6VB 4EFOA 4PYUA 2GBRA 3ZW3A 5L95C 3ML8A 1R4MI 1UELA 2DAJA 2MSED 2NBVB 2JY6A 2V1YA 4XX5A 4KSLC 3OAWA 4X57B 3ENEA 3C0RB 4W9KA 4LJOB 3A9KB 3V62A 1Z2MA 2RGFA 1H4RA 2MP2A 3EECA 3K9PB 4BBNF 3DVGY 1L2NA 3D32A 2FIDA 3QC8B 3KUZA 2D07B 4IC7B 3VXWA 3QA8A 5FR6A 2BYVE 4EUTA 2JUOA 4IWOA 2KDBA 3ZTCA 3ZLZA 4NJ6A 1TTNA 3DPDA 1L7YA 3ZRCA 2JZ3B 4OVUA 3KUCB 2AL6A 4ASWC 2JVCA 2LGXA 3VVWB 4ZDVA 2J0JA 4NJ7A 5DPTA 2KX0A 3CF6E 4AWJA 5AEKB 3OJ3A 5J18A 4FLHA 1GC6A 2L8JA 4DDID 4KV2A 3PLUA 2LASA 2BWFA 1WRDB 2PE9A 2KOXA 2DZIA 4LDTD 2QHOA 4KDLB 3ZNGC 3KYDD 4ZYNA 2DYMA 3Q3JA 5G2NA 3MTNB 2K8BA 2I1JA 1WJ6A 2NR2A 4KIKA 2DAFA 3BY4B 3PTFC 5G55A 3QWZB 4WWNA 4BBNC 3PRZA 2DHZA 1WXMA 3APCA 2CR5A 1Z5SB 3EFUA 4MJSA 2I1KA 4AJYB 3N3KB 4GDLB 2KWUB 4EZKA 1C1YB 2ZVOA 2D2QA 3PRPB 4BKTA 1KOTA 5JZEB 2CHZA 2LI5A 1UBQA 2O2VA 3QCAA 1WY8A 2G3QB 1RAXA 2D11A 5D7GA 4CYEA 1UD7A 2JWZA 3SHQA 1GG3A 3N30A 1OEYA 1NDDA 4B6WA 1IPGA 1EF1A 4K7UA 5DCNA 2DX5B 4J6IA 2UWQA 2A4ZA 4W9HA 3PREA 4NQLB 1WGRA 4G50A 2YVCA 4DBGA 2C5LC 2KDFB 3U7DA 3KH0A 3OJ4B 5C1ZA 1Q5WB 3T8MA 4ANVA 2J0KA 2BPSA 2K8HA 2Y5BB 2KXJA 3IVFA 2EMSA 2N1WA 3U30A 1TZ1A 2MP2B 3V60A 2HJ8A 4FHKA 4GMVA 2ZJDA 2J0MA 2MX2A 3A4RA 1LM8B 3PS6A 4B9KA 1V49A 4RM9A 3ZIMA 4KZCA 4EKUA 5J17A 1LQBA 1ZW7A 2KTRA 3WAMA 4WQOB 3ALBA 2LVOA 2MBEA 2N9XA 4JLCA 3M95A 4IWPA 2Z0DB 5CHFA 3JW0X 3W1YA 2ZNVB 3UF8A 2REXA 3AU4A 2GBNA 2L3ZA 4BOSC 3NHEB 4W9FA 3ZNID 3QIJA 4G3XB 1S1QB 3RD2A 2BWES 3AXCA 2IO2B 3B08A 4B95A 2IO0B 4TQ1A 4WJQA 5AZGA 2ZPYA 3W1SC 2MBBB 3IBEA 4E74A 2N7DA 4II2B 3TL5A 4LJPB 3PSEB 2WX1A 4TV3A 2G45B 5KHOA 3A9JA 1GJZA 3PLVA 2BF8B 1C3TA 1E7UA 2BKRB 2MBOA 4KIKB 4ZRJA 2KC1A 3QAQA 2JZZA 1WZ3A 3DDCB 1WR6E 2RR9A 3AULA 4MJSB 3JSVA 3UINB 2FIFA 4F8CB 2PE6B 2LXCA 2GBJA 2IBIB 3VFKA 4BKSD 2KD0A 1PQSA 2WX0A 4GSWA 1E8XA 4IWQA 3L16A 2R2OA 4ANUA 1UH6A 1I42A 2Z59B 3DOWA 2B3AA 1P9DU 2BYEA 5C23A 4DDGD 2XK5A 4OVVA 4GDKA 4W9DA 2Z0EB 3HHMA 4A3PA 5HKHA 1E8WA 3IHPC 4ICUA 4M0WB 4P7IA 3CSTA 4BKSA 3SDLC 1P0RA 2LXAA 4JQWC 1YIWA 3AU5A 1GC7A 2K39A 3V6EB 3RCZA 3M3JA 3MJWA 1IP9A 1T0YA 4DHZE 2K6DB 1WX9A 4JGHB 4FBJB 5GMVA 3R66C 4HJKA 1WYWB 4IM0A 1EF5A 4EEWA 4JL9A 2KKCA 4E71A 2KTRB 2JRHA 1NI2A 2JXXA 2HD5B 2IY0B 3HM6X 3DBHI 4W9IA 4DXAB 1WXAA 3UIOB 2KQSA 2FCSA 3VTUA 2DZKA 4NPNA 4HXDA 2DZJA 2N4FA 4FJZA 2K8CA 1BT0A 2M4NA 4ZRIA 3W1SA 1HE8A 4WAAA 1VCBA 2DENB 4M8NA 2L7RA 5AZHA 2OOBB 1WE6A 3A9JB 4W9GA 4W9LA 2KZRA 4EOYA 5LXIB 2IO3B 1A5RA 2HTHA 4DHJD 1E90A 1U4AA 4FN2A 1UZXB 3QQ8B 3R3MA 4FHJA 3CSFA 2KDEB 2MQJA 3SU8X 1GUAB 4HK2A 2KJRA 3JSVB 1NBFC 3TCAA 5JH5C 1SIFA 2NPTA 4WJPA 2BGFA 2NBUA 4RM8A 2CU1A 4I6PA 4TQ0A 3V6CB 1V2YA 3WAOA 3DVGX 4WJOA 1RLFA 4HLEA 2K25A 2CKHB 1WZ0A 1Q1OA 2XK5B 3P2BA 4GDKB 3VUYA 4E3CA 1AARA 2LGDA 3B0AA 2L0TA 5DPRA 2PPHA 4XZ4A 2FNJB 4WJNA 1ISNA 2WYQA 4DHZB 4FJYA 2BYFA 3LJ3A 5E6OA 3TBLD 1R4NI 2JRIB 3DQVA 4MEMA 1YD8U 2LVQA 3H7PA 3TJPA 3ZO5B 4NY0A 4ANWA 4II3B 3ONSA 4KVGB 4IM2A 1XT9B 1SGHA 2IY1B 3DBLI 4F7ZA 3PHWB 2WDTB 4GB9A 3NY5A 2GBMA 2NBWB 3UQAA 1EO6A 2PEAA 2M8SA 3A33B 3KUDB 1V9JA 2IYDB 2KQ7A 5CHWA 2LUEA 3NZSA 2ZCCA 1WGHA 4DK5A 2CHXA 1SE9A 2R2QA 2JF5A 4N9F4 2FCQA 4NQKE 4GN1A 2VRRB 2KN5A 2ZPNA 2DYBA 4HCNB 4A20A 2C9WB 3VQIA 1F9JA 4PS8A 1V5TA 4K7SA 3B1LX 1V81A 3HM3A 4CHKA 3O65B 1WXSA 3VUXA 2NVUI 2LRWA 2DYOA 3Q3FA 3R7RA 2KFKA 3IG3A 1WGGA 2V4LA 4IM3A 3QK0A 3MHSD 1ZGUB 3PV1A 4EZJA 2ZNVC 5L83A 2LGYA 3PT2B 4K1RB 4HVBA 3T9LA 5J2RA 2WWZA 2KMAA 1TBEA 2N7EA 3RZFA 3ZDMC 3H6NA 2NPTB 2O2VB 5DPSA 3ZTDA 3ZDTA 5IAAC 5EDSA 3K9OB 1LFDA 3L0WB 3X23A 2BKFA 1KM7A 2HE7A 2XEWA 3LDZE 2L76A 3WIMA 1WH3A 4DHJB 3PGEA 1S3SG 2UYZB 5BO4B 3WAPA 2MRPA 2MW5A 3QJZA 1EUVB 2KHWB 1P1AA 4GOCA 2V3SA 2M1MA 4A3OA 1KLVA 3EC8A 1WE7A 2ZCBA 1V5OA 2MLBA 2KC2A 4ICVA 4MDKE 1V86A 5KHQA 3H9DA 5DPWA 3PVLA 3ZUNA 2KFJA 1WR1A 3ZNZB 3N32A 1OTRB 3I3TB 3H7PB 4AOFA 3QHTA 1V6EA 1CMXB 1UGMA 3RUIB 2ASQA 1JRUA 1WGDA 2PJHA 2L0FA 3VH4B 2G4SA 4HPMB 2N1VA 4ANXA 5D2MB 3APDA 3WANA 3ECIA 3L54A 4M8MA 5E6PA 2NS5A 2FCNA 3VUWA 3KVFB 2D3GA 3GZNI 4GIVA 5D6JB 5LLIA 2L05A 2KANA 2KTFA 4HDQA 2KX3A 3UIPB 5TR5A 3X0WA 4MGKE 1GNUA 4KSKC 2N9PC 3ZVVA 2LVPA 1P98A 1J0GA 1QZEA 2KLGA 3GOEA 2GOWA 3HIZA 2KFKB 2LZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KK8 A;  1M94 A;  4TKN A;  2G4D B;  4MSQ B;  1RRB A;  3BIN A;  3NOB A;  4HDO A;  3CMM B;  2YLM A;  3JYU A;  4GGQ A;  2N9E B;  3RYT A;  3VHT C;  2IZV B;  3UGB B;  2J7Q B;  1P3Q U;  2LJ5 A;  3A1Q A;  4JIO U;  3VH3 B;  1WMH A;  2GMI C;  3PRM B;  3DVN U;  2CS4 A;  1WF9 A;  3S2A A;  2K6Q A;  2KO3 A;  3VDZ A;  1WGY A;  5D94 A;  4AP4 C;  1K8R B;  4IUM B;  4CO7 A;  2FAZ A;  4I6L B;  3A4S C;  2D10 A;  3IFW B;  4HPL B;  3SD5 A;  1IYF A;  1OQY A;  1WM2 A;  2KDI A;  2O6V D;  3QX1 A;  3DVN V;  1WIA A;  1V80 A;  1YX5 B;  2C7M B;  4NAW A;  3RT3 B;  4GXB A;  3KYC D;  2MBQ A;  3H7S A;  1WJN A;  4RMA A;  5LXH A;  4BVU C;  1OEY J;  4F1S A;  3V61 A;  1WFY A;  1G6J A;  1UBI A;  1X1M A;  4FJV B;  2ZZP B;  3DBR I;  2AL3 A;  2L00 B;  3L13 A;  2K1F A;  3JVZ X;  2MCN B;  1XD3 B;  2KWC A;  4BOZ B;  2O6V A;  4W9J A;  5JHA A;  3VTV A;  3NS8 A;  3KW5 B;  1WX7 A;  3ZRF A;  2LRU A;  4K81 A;  1Y8R C;  2CHW A;  3M63 B;  2KLC A;  4WWO A;  4MGI E;  1D3Z A;  2EMT A;  4WWP A;  3PPA A;  3WAL A;  1KJT A;  1YQB A;  4HCP B;  3RUL A;  4BFR A;  3A9K A;  4I6N B;  1WI0 A;  3R7Q A;  2IO1 B;  4KDI C;  4IG7 B;  1E8Y A;  3M62 B;  4GU2 A;  1LXD A;  3L17 A;  1VD2 A;  2AEH A;  3OLM D;  3TIX A;  2KJ6 A;  3L08 A;  4PYZ A;  1FXT B;  3ZNH B;  2FUH B;  4MM3 A;  4DWF A;  4EZL A;  2M0X A;  1H8C A;  1WJU A;  1E5W A;  1OGW A;  2OJR A;  5AZF A;  1WJ4 A;  3DBS A;  1I35 A;  3L10 B;  4URK A;  3VTW A;  2M17 A;  2MBH A;  5CHV C;  3PZD A;  2A5U A;  2LWP A;  4G0N B;  4NNJ B;  4KZ0 A;  3AI5 A;  3WA0 A;  4FUL A;  3UQB A;  1RFA A;  2FCM A;  2KWV B;  3APF A;  2AYO B;  2MWS B;  2RD0 A;  1E7V A;  2KNB A;  4MSM B;  3TMP B;  1MG8 A;  2NCN A;  3NZU A;  3PHX B;  4AUQ C;  2RSU A;  3A1Q B;  5CX3 A;  2C60 A;  2LD9 A;  1J19 A;  1WMH B;  3QAR A;  2KJH B;  4G11 A;  2C7N B;  2JPH A;  2KMC A;  2RPQ A;  4MEL A;  4ZRK A;  4MGY E;  2GBK A;  1WX8 A;  2DZM A;  4MH0 E;  2ZEQ A;  4YL8 A;  4FA6 A;  1E8Z A;  4BKG A;  2W9N A;  3VAW A;  4FAD A;  4TUU A;  4GDL A;  4HWI B;  1ZKH A;  3RZW C;  3U8Z A;  2EKE C;  1XQQ A;  1TGZ B;  5IA7 A;  2ZVN A;  2C7H A;  4NAW B;  1YX6 B;  2MA9 B;  4LDT B;  4PS3 A;  4IW0 A;  2XBB C;  4W9C A;  5CTR C;  3ML9 A;  1J8C A;  1YJ1 A;  1Q0W B;  4W9E A;  3ZKJ C;  3EHV A;  5JHB A;  2KVR A;  2JT4 B;  4MGZ E;  4K7W A;  4LCD E;  3H1U A;  4XC2 A;  4AJW A;  4PS7 A;  1WM3 A;  3DCG A;  2AWT A;  5E6N A;  3HK0 A;  1WXV A;  2O6V B;  4EFO A;  4PYU A;  2GBR A;  3ZW3 A;  5L95 C;  3ML8 A;  1R4M I;  1UEL A;  2DAJ A;  2MSE D;  2NBV B;  2JY6 A;  2V1Y A;  4XX5 A;  4KSL C;  3OAW A;  4X57 B;  3ENE A;  3C0R B;  4W9K A;  4LJO B;  3A9K B;  3V62 A;  1Z2M A;  2RGF A;  1H4R A;  2MP2 A;  3EEC A;  3K9P B;  4BBN F;  3DVG Y;  1L2N A;  3D32 A;  2FID A;  3QC8 B;  3KUZ A;  2D07 B;  4IC7 B;  3VXW A;  3QA8 A;  5FR6 A;  2BYV E;  4EUT A;  2JUO A;  4IWO A;  2KDB A;  3ZTC A;  3ZLZ A;  4NJ6 A;  1TTN A;  3DPD A;  1L7Y A;  3ZRC A;  2JZ3 B;  4OVU A;  3KUC B;  2AL6 A;  4ASW C;  2JVC A;  2LGX A;  3VVW B;  4ZDV A;  2J0J A;  4NJ7 A;  5DPT A;  2KX0 A;  3CF6 E;  4AWJ A;  5AEK B;  3OJ3 A;  5J18 A;  4FLH A;  1GC6 A;  2L8J A;  4DDI D;  4KV2 A;  3PLU A;  2LAS A;  2BWF A;  1WRD B;  2PE9 A;  2KOX A;  2DZI A;  4LDT D;  2QHO A;  4KDL B;  3ZNG C;  3KYD D;  4ZYN A;  2DYM A;  3Q3J A;  5G2N A;  3MTN B;  2K8B A;  2I1J A;  1WJ6 A;  2NR2 A;  4KIK A;  2DAF A;  3BY4 B;  3PTF C;  5G55 A;  3QWZ B;  4WWN A;  4BBN C;  3PRZ A;  2DHZ A;  1WXM A;  3APC A;  2CR5 A;  1Z5S B;  3EFU A;  4MJS A;  2I1K A;  4AJY B;  3N3K B;  4GDL B;  2KWU B;  4EZK A;  1C1Y B;  2ZVO A;  2D2Q A;  3PRP B;  4BKT A;  1KOT A;  5JZE B;  2CHZ A;  2LI5 A;  1UBQ A;  2O2V A;  3QCA A;  1WY8 A;  2G3Q B;  1RAX A;  2D11 A;  5D7G A;  4CYE A;  1UD7 A;  2JWZ A;  3SHQ A;  1GG3 A;  3N30 A;  1OEY A;  1NDD A;  4B6W A;  1IPG A;  1EF1 A;  4K7U A;  5DCN A;  2DX5 B;  4J6I A;  2UWQ A;  2A4Z A;  4W9H A;  3PRE A;  4NQL B;  1WGR A;  4G50 A;  2YVC A;  4DBG A;  2C5L C;  2KDF B;  3U7D A;  3KH0 A;  3OJ4 B;  5C1Z A;  1Q5W B;  3T8M A;  4ANV A;  2J0K A;  2BPS A;  2K8H A;  2Y5B B;  2KXJ A;  3IVF A;  2EMS A;  2N1W A;  3U30 A;  1TZ1 A;  2MP2 B;  3V60 A;  2HJ8 A;  4FHK A;  4GMV A;  2ZJD A;  2J0M A;  2MX2 A;  3A4R A;  1LM8 B;  3PS6 A;  4B9K A;  1V49 A;  4RM9 A;  3ZIM A;  4KZC A;  4EKU A;  5J17 A;  1LQB A;  1ZW7 A;  2KTR A;  3WAM A;  4WQO B;  3ALB A;  2LVO A;  2MBE A;  2N9X A;  4JLC A;  3M95 A;  4IWP A;  2Z0D B;  5CHF A;  3JW0 X;  3W1Y A;  2ZNV B;  3UF8 A;  2REX A;  3AU4 A;  2GBN A;  2L3Z A;  4BOS C;  3NHE B;  4W9F A;  3ZNI D;  3QIJ A;  4G3X B;  1S1Q B;  3RD2 A;  2BWE S;  3AXC A;  2IO2 B;  3B08 A;  4B95 A;  2IO0 B;  4TQ1 A;  4WJQ A;  5AZG A;  2ZPY A;  3W1S C;  2MBB B;  3IBE A;  4E74 A;  2N7D A;  4II2 B;  3TL5 A;  4LJP B;  3PSE B;  2WX1 A;  4TV3 A;  2G45 B;  5KHO A;  3A9J A;  1GJZ A;  3PLV A;  2BF8 B;  1C3T A;  1E7U A;  2BKR B;  2MBO A;  4KIK B;  4ZRJ A;  2KC1 A;  3QAQ A;  2JZZ A;  1WZ3 A;  3DDC B;  1WR6 E;  2RR9 A;  3AUL A;  4MJS B;  3JSV A;  3UIN B;  2FIF A;  4F8C B;  2PE6 B;  2LXC A;  2GBJ A;  2IBI B;  3VFK A;  4BKS D;  2KD0 A;  1PQS A;  2WX0 A;  4GSW A;  1E8X A;  4IWQ A;  3L16 A;  2R2O A;  4ANU A;  1UH6 A;  1I42 A;  2Z59 B;  3DOW A;  2B3A A;  1P9D U;  2BYE A;  5C23 A;  4DDG D;  2XK5 A;  4OVV A;  4GDK A;  4W9D A;  2Z0E B;  3HHM A;  4A3P A;  5HKH A;  1E8W A;  3IHP C;  4ICU A;  4M0W B;  4P7I A;  3CST A;  4BKS A;  3SDL C;  1P0R A;  2LXA A;  4JQW C;  1YIW A;  3AU5 A;  1GC7 A;  2K39 A;  3V6E B;  3RCZ A;  3M3J A;  3MJW A;  1IP9 A;  1T0Y A;  4DHZ E;  2K6D B;  1WX9 A;  4JGH B;  4FBJ B;  5GMV A;  3R66 C;  4HJK A;  1WYW B;  4IM0 A;  1EF5 A;  4EEW A;  4JL9 A;  2KKC A;  4E71 A;  2KTR B;  2JRH A;  1NI2 A;  2JXX A;  2HD5 B;  2IY0 B;  3HM6 X;  3DBH I;  4W9I A;  4DXA B;  1WXA A;  3UIO B;  2KQS A;  2FCS A;  3VTU A;  2DZK A;  4NPN A;  4HXD A;  2DZJ A;  2N4F A;  4FJZ A;  2K8C A;  1BT0 A;  2M4N A;  4ZRI A;  3W1S A;  1HE8 A;  4WAA A;  1VCB A;  2DEN B;  4M8N A;  2L7R A;  5AZH A;  2OOB B;  1WE6 A;  3A9J B;  4W9G A;  4W9L A;  2KZR A;  4EOY A;  5LXI B;  2IO3 B;  1A5R A;  2HTH A;  4DHJ D;  1E90 A;  1U4A A;  4FN2 A;  1UZX B;  3QQ8 B;  3R3M A;  4FHJ A;  3CSF A;  2KDE B;  2MQJ A;  3SU8 X;  1GUA B;  4HK2 A;  2KJR A;  3JSV B;  1NBF C;  3TCA A;  5JH5 C;  1SIF A;  2NPT A;  4WJP A;  2BGF A;  2NBU A;  4RM8 A;  2CU1 A;  4I6P A;  4TQ0 A;  3V6C B;  1V2Y A;  3WAO A;  3DVG X;  4WJO A;  1RLF A;  4HLE A;  2K25 A;  2CKH B;  1WZ0 A;  1Q1O A;  2XK5 B;  3P2B A;  4GDK B;  3VUY A;  4E3C A;  1AAR A;  2LGD A;  3B0A A;  2L0T A;  5DPR A;  2PPH A;  4XZ4 A;  2FNJ B;  4WJN A;  1ISN A;  2WYQ A;  4DHZ B;  4FJY A;  2BYF A;  3LJ3 A;  5E6O A;  3TBL D;  1R4N I;  2JRI B;  3DQV A;  4MEM A;  1YD8 U;  2LVQ A;  3H7P A;  3TJP A;  3ZO5 B;  4NY0 A;  4ANW A;  4II3 B;  3ONS A;  4KVG B;  4IM2 A;  1XT9 B;  1SGH A;  2IY1 B;  3DBL I;  4F7Z A;  3PHW B;  2WDT B;  4GB9 A;  3NY5 A;  2GBM A;  2NBW B;  3UQA A;  1EO6 A;  2PEA A;  2M8S A;  3A33 B;  3KUD B;  1V9J A;  2IYD B;  2KQ7 A;  5CHW A;  2LUE A;  3NZS A;  2ZCC A;  1WGH A;  4DK5 A;  2CHX A;  1SE9 A;  2R2Q A;  2JF5 A;  4N9F 4;  2FCQ A;  4NQK E;  4GN1 A;  2VRR B;  2KN5 A;  2ZPN A;  2DYB A;  4HCN B;  4A20 A;  2C9W B;  3VQI A;  1F9J A;  4PS8 A;  1V5T A;  4K7S A;  3B1L X;  1V81 A;  3HM3 A;  4CHK A;  3O65 B;  1WXS A;  3VUX A;  2NVU I;  2LRW A;  2DYO A;  3Q3F A;  3R7R A;  2KFK A;  3IG3 A;  1WGG A;  2V4L A;  4IM3 A;  3QK0 A;  3MHS D;  1ZGU B;  3PV1 A;  4EZJ A;  2ZNV C;  5L83 A;  2LGY A;  3PT2 B;  4K1R B;  4HVB A;  3T9L A;  5J2R A;  2WWZ A;  2KMA A;  1TBE A;  2N7E A;  3RZF A;  3ZDM C;  3H6N A;  2NPT B;  2O2V B;  5DPS A;  3ZTD A;  3ZDT A;  5IAA C;  5EDS A;  3K9O B;  1LFD A;  3L0W B;  3X23 A;  2BKF A;  1KM7 A;  2HE7 A;  2XEW A;  3LDZ E;  2L76 A;  3WIM A;  1WH3 A;  4DHJ B;  3PGE A;  1S3S G;  2UYZ B;  5BO4 B;  3WAP A;  2MRP A;  2MW5 A;  3QJZ A;  1EUV B;  2KHW B;  1P1A A;  4GOC A;  2V3S A;  2M1M A;  4A3O A;  1KLV A;  3EC8 A;  1WE7 A;  2ZCB A;  1V5O A;  2MLB A;  2KC2 A;  4ICV A;  4MDK E;  1V86 A;  5KHQ A;  3H9D A;  5DPW A;  3PVL A;  3ZUN A;  2KFJ A;  1WR1 A;  3ZNZ B;  3N32 A;  1OTR B;  3I3T B;  3H7P B;  4AOF A;  3QHT A;  1V6E A;  1CMX B;  1UGM A;  3RUI B;  2ASQ A;  1JRU A;  1WGD A;  2PJH A;  2L0F A;  3VH4 B;  2G4S A;  4HPM B;  2N1V A;  4ANX A;  5D2M B;  3APD A;  3WAN A;  3ECI A;  3L54 A;  4M8M A;  5E6P A;  2NS5 A;  2FCN A;  3VUW A;  3KVF B;  2D3G A;  3GZN I;  4GIV A;  5D6J B;  5LLI A;  2L05 A;  2KAN A;  2KTF A;  4HDQ A;  2KX3 A;  3UIP B;  5TR5 A;  3X0W A;  4MGK E;  1GNU A;  4KSK C;  2N9P C;  3ZVV A;  2LVP A;  1P98 A;  1J0G A;  1QZE A;  2KLG A;  3GOE A;  2GOW A;  3HIZ A;  2KFK B;  2LZ6 A; 
#chains in the Genus database with same CATH topology
 1QLB B;  4HRO A;  4TKN A;  2G4D B;  4HDO A;  1FCC C;  3RYT A;  1TS5 A;  1XCQ L;  3UGB B;  4RGO S;  1L6U A;  3DVN U;  4YXD B;  3RI7 C;  5BYS A;  1F77 A;  4AP4 C;  2EKI A;  3IFW B;  1OQY A;  2KDI A;  1WIA A;  2C7M B;  4LTU A;  3KYC D;  2MBQ A;  3MC9 A;  4RMA A;  5LXH A;  3AMZ A;  4F1S A;  2KAC A;  1FRR A;  1WFY A;  3V61 A;  2MJE A;  1XEE A;  1SB3 C;  1WYG A;  4MAC A;  1XD3 B;  2KWC A;  4BOZ B;  2KAJ A;  5JHA A;  1WX7 A;  1Y8R C;  5HG2 A;  4MGI E;  1D3Z A;  1ACC A;  4I6N B;  1WI0 A;  2K0P A;  3ZJV A;  1I4X A;  3HUI A;  4B0M A;  4GU2 A;  1VD2 A;  2AEH A;  3OLM D;  2JXT A;  2KJ6 A;  3L08 A;  3TIX A;  4L2Y A;  1FXT B;  4PYZ A;  2FUH B;  4MM3 A;  4DWF A;  1ZUD 2;  3NG0 A;  1OGW A;  1KH0 A;  1RYJ A;  1I35 A;  3Q8F A;  2MBH A;  2VZK B;  2A5U A;  2FCM A;  2R61 A;  2NCN A;  3P4S B;  2D3C A;  5CX3 A;  2WLB A;  3A1Q B;  5IP4 D;  1WMH B;  2C7N B;  3I5J C;  4MEL A;  2RPQ A;  4MH0 E;  1WX8 A;  2ZEQ A;  3VAW A;  1PYW D;  3W9C B;  4GDL A;  4HWI B;  3NUH B;  1WRI A;  1TGZ B;  1EWC A;  2IND C;  2H89 B;  4PS3 A;  2AQ3 B;  4W9C A;  3ML9 A;  1J8C A;  2W3R A;  2WXO A;  4W9E A;  2X8X X;  2KVR A;  2JT4 B;  4H2A A;  4M00 A;  3PO0 A;  4XC2 A;  4AJW A;  4PS7 A;  2G9H D;  2AWT A;  5E6N A;  3AE7 B;  2O6V B;  4WAF A;  4PYU A;  3SFD B;  1SIJ A;  4M01 A;  2MSE D;  2V1Y A;  1ET9 A;  3DBR B;  1GAQ B;  3C0R B;  4UDU C;  3V62 A;  2MP2 A;  3OWE B;  4EUT A;  4IWO A;  2EEL A;  1TTN A;  2JZ3 B;  4R3D A;  1YOV B;  4OVU A;  3KUC B;  3DWM A;  3KWL A;  4JX1 C;  4ZDV A;  1CQV A;  1E6E B;  5AEK B;  4AWJ A;  4FLH A;  2XN9 C;  3PLU A;  3NRZ A;  3AN1 A;  2DZI A;  2KWD A;  5G2N A;  3NJT A;  2DAF A;  2YEP F;  3QWZ B;  4WWN A;  1N60 A;  2I1K A;  5HHD G;  4EZK A;  2D2Q A;  3PRP B;  3TEW A;  2K22 A;  1C79 A;  3GE3 C;  1WY8 A;  2JWZ A;  3FIL A;  3IT6 B;  1MHX A;  4ACF A;  1PUT A;  1KF6 B;  4XYC A;  1EF1 A;  1PGB A;  4K7U A;  5DCN A;  3PRE A;  4NQL B;  1WGR A;  4M0W A;  2YVC A;  4DBG A;  3U7D A;  2MHJ A;  3KH0 A;  5C1Z A;  3T8M A;  4XDC A;  2BPS A;  2K8H A;  2KXJ A;  1OQQ A;  2L32 A;  2UU7 A;  1UUP A;  4GMV A;  1LM8 B;  1V49 A;  3ZIM A;  4RNA A;  3WAM A;  4JLC A;  2N0S B;  3W1Y A;  3UF8 A;  2GBN A;  4G3X B;  3RD2 A;  2QIL A;  2IO2 B;  2INP E;  4B95 A;  2IO0 B;  3W1S C;  4E74 A;  3KQ4 A;  4II2 B;  3TL5 A;  3PSE B;  1GJZ A;  3RNB C;  5JXV A;  4ZRJ A;  2M56 B;  2KC1 A;  3QAQ A;  2RPV A;  4NZL B;  3UIN B;  4F8C B;  1AYF A;  1XLQ A;  2KD0 A;  1FNU A;  4GSW A;  2N9K A;  1I42 A;  3FAH A;  1DYQ A;  4DDG D;  2N9L A;  3FC4 A;  3IHP C;  4WH4 A;  3CST A;  2LXA A;  3AU5 A;  2DLB A;  2VH1 A;  3V6E B;  1A70 A;  1SJE D;  3LXF A;  4HJK A;  3HVD A;  1HA5 A;  2SEB D;  3TEX A;  1EF5 A;  5FK9 C;  4LNI A;  2JRH A;  3IAM 1;  1R4N B;  3DBH I;  1WXA A;  3UIO B;  3CWI A;  1UNS A;  2JYE A;  1M4V A;  2WGS A;  4FJZ A;  1BT0 A;  3E9S A;  1VZ8 A;  3DBL B;  3W1S A;  1VCB A;  2DEN B;  2KQ4 X;  1WE6 A;  4EOY A;  1MPE A;  3TUO A;  2IO3 B;  3QQ8 B;  3R3M A;  5HI1 A;  4LLG M;  1P7E A;  3WAO A;  4WJO A;  1RLF A;  2D3B A;  1TIF A;  2LHD A;  1Q1O A;  4GDK B;  3VUY A;  4LNO A;  1TY0 A;  2IJ0 A;  2L0T A;  2PPH A;  1DGJ A;  2FNJ B;  2IPK D;  5TSS A;  3AB5 A;  1ISN A;  4DHZ B;  4FJY A;  2D3A A;  3DQV A;  4MEM A;  1YD8 U;  3C19 A;  5FR3 A;  3H7P A;  4N6E B;  4KVG B;  1CZP A;  1ZE3 D;  1SGH A;  4GB9 A;  3NY5 A;  1JAL A;  3KUD B;  3A33 B;  4ZRQ A;  2G1E A;  3NZS A;  1WGH A;  4N9F 4;  2FCQ A;  3Q2A C;  2VRR B;  2ZPN A;  2DYB A;  4HCN B;  4PS8 A;  1NEN B;  3B1L X;  1V81 A;  4CHK A;  2XNA C;  1KLU D;  1BML C;  1JRP A;  2LRW A;  3R7R A;  5H92 C;  2BS2 B;  2ZNV C;  1FFU A;  4K1R B;  4HVB A;  4DQO C;  1TBE A;  1V8C A;  2N7E A;  3ZDM C;  2NPT B;  3RMK C;  5IAA C;  4LNK A;  5EDS A;  3ZGZ A;  1D5M C;  1LFD A;  1KM7 A;  2L76 A;  3VRB B;  3Q14 C;  1TYG B;  1YJI A;  1P1A A;  3RN9 C;  4A3O A;  1WE7 A;  3AE4 B;  4ICV A;  2KC2 A;  4MDK E;  1HTO A;  4RGM A;  5DPW A;  3PVL A;  3ZNZ B;  1OTR B;  3I3T B;  3QHT A;  3NZ3 A;  1CMX B;  3V3X A;  2PVG C;  2W54 A;  2L0F A;  3VH4 B;  2WXN A;  5D2M B;  3L54 A;  3DHG C;  4M8M A;  4ZYS A;  3B9J A;  3GZN I;  2L05 A;  2KAN A;  4IKG A;  4HDQ A;  2KX3 A;  3UIP B;  2BBC A;  4MGK E;  1AWD A;  5BMH A;  3GOE A;  2GOW A;  1QOG A;  1V1P B;  2LZ6 A;  2KK8 A;  2B76 B;  3DHI C;  4MSQ B;  2YLM A;  2N9E B;  2J7Q B;  3A1Q A;  1WMH A;  3PRM B;  2CS4 A;  4IOI E;  2KO3 A;  3U52 E;  3VDZ A;  4HKQ A;  1K8R B;  2BVC A;  2FAZ A;  2D10 A;  1ET6 A;  4K3C A;  3RT3 B;  1WJN A;  2V3N A;  1X1M A;  3DBR I;  2AL3 A;  2L00 B;  1MI0 A;  1BUI C;  2WXF A;  2O6V A;  2BW2 A;  2LRU A;  3Q3O C;  1VZ7 A;  3BVZ A;  1N5X A;  3WAL A;  1YQB A;  3W5U B;  3RNE C;  4HPP A;  4BFR A;  1STE A;  1TS4 A;  4IG7 B;  4KDI C;  3ZJT A;  1FIQ A;  1LXD A;  1PDX A;  1R4M B;  1E5W A;  2JQR B;  3L10 B;  3VTW A;  4DXG A;  3PZD A;  2LWP A;  3AI5 A;  1RFA A;  2KWV B;  3APF A;  2RD0 A;  2KNB A;  2MJ3 A;  3TMP B;  1WWT A;  1MG8 A;  3ZXV A;  3NZU A;  3PHX B;  3PZ8 A;  1F0Z A;  4XGA B;  2C60 A;  1J19 A;  4ZRP A;  2JWU A;  4G11 A;  3Q8C A;  1E9M A;  2KMC A;  4O1N A;  4ZRK A;  4HEA 1;  5BMG A;  4YL8 A;  2FBW B;  3P42 A;  1ZKH A;  1WGK A;  4XWW A;  3ZQ4 A;  3EGR A;  2ZVN A;  2C7H A;  4NAW B;  1YX6 B;  2MA9 B;  2XBB C;  5E6J A;  1Q0W B;  2HTM E;  3ZKJ C;  4K7W A;  1L0V B;  1VZ6 A;  1WM3 A;  4L1B A;  1UGJ A;  1WXV A;  3AE6 B;  1ZDX A;  2WXK A;  3AED B;  3ZW3 A;  5L95 C;  2RDG A;  2DAJ A;  2GB1 A;  4XX5 A;  4KSL C;  3N9Y C;  4X57 B;  4W9K A;  3A9K B;  1V1O A;  1Z2M A;  2RGF A;  2AX5 A;  3K9P B;  4BBN F;  4JWS C;  2INN E;  3QC8 B;  3P63 A;  2D07 B;  2KN4 A;  3VXW A;  2BYV E;  3ZLZ A;  4NJ6 A;  3ZRC A;  3IXS A;  3RNA C;  4NJ7 A;  2KX0 A;  3Q8A A;  5T8I A;  2L8J A;  1WRD B;  3T3O A;  2QHO A;  4KDL B;  3ZNG C;  3Q3J A;  3W2D A;  3DWG C;  2NR2 A;  3BY4 B;  3PRZ A;  2DHZ A;  1WXM A;  1C1Y B;  1T0Q C;  5JZE B;  2LI5 A;  5G5H A;  2G3Q B;  1RAX A;  5G5G A;  1FCL A;  4CYE A;  1EWY C;  3N30 A;  4J6I A;  3RNC C;  2C5L C;  2KDF B;  1F2R I;  4WQM A;  2QIE B;  2W3S A;  4RFB A;  3BVG A;  2J0K A;  2EMS A;  3U30 A;  2HJ8 A;  1C9F A;  2Y5C A;  2E6X A;  2ZJD A;  2D5G A;  5IO9 A;  2LJI A;  1SE3 A;  3PS6 A;  5J17 A;  3TEZ A;  5IKC M;  1ZW7 A;  4WQO B;  1JQ4 A;  2MJD A;  4YSY B;  2Z0D B;  3JW0 X;  2ZNV B;  2GI9 A;  3Q6B A;  2K9X A;  3ZNI D;  4A90 A;  2BWE S;  3AXC A;  3B08 A;  4TQ1 A;  4WJQ A;  2ZPY A;  2WXR A;  2N7D A;  4LJP B;  4TV3 A;  1C3T A;  1KRH A;  1E7U A;  2JZZ A;  1WR6 E;  4MJS B;  2FIF A;  1ESF A;  2GBJ A;  2IBI B;  3VFK A;  1FEH A;  4MH8 A;  1PQS A;  2WX0 A;  1UH6 A;  2Z59 B;  4HKZ E;  1P9D U;  2BYE A;  5C23 A;  4K3B A;  4OVV A;  4GDK A;  2HJ1 A;  3BYT B;  4W9D A;  3HHM A;  4A3P A;  5D3I B;  4P7I A;  1K53 A;  4JQW C;  1FXI A;  2WXJ A;  1C76 A;  5GMV A;  1XF5 L;  1SBB B;  2BS3 B;  2KTR B;  2JXX A;  4W9I A;  1P7F A;  2DZJ A;  5GXG B;  2M4N A;  2KDM A;  4ZRI A;  1B1Z A;  2RMM A;  2V4I B;  4WAA A;  2L7R A;  5AZH A;  4TSS A;  4W9G A;  1QIL A;  5LXI B;  4A55 A;  1A5R A;  1V97 A;  4FN2 A;  1U4A A;  1UZX B;  2MQJ A;  4XWT A;  1GB1 A;  1KFY B;  5JH5 C;  1SIF A;  2NPT A;  4RGT A;  2BTE A;  4LNN A;  3NVV A;  2WP9 B;  2CKH B;  2L83 A;  4KKJ A;  1JCK B;  2IGH A;  1AAR A;  4A6Q A;  5E6O A;  1IGD A;  4OW0 A;  2WXQ A;  3BK2 A;  4YWG G;  1SXT A;  4NY0 A;  3HVZ A;  4RGN A;  2Q5W D;  2WDR B;  3BVM A;  2WDT B;  2WHI A;  2GBM A;  2NBW B;  1EO6 A;  3UI3 A;  2IYD B;  3AEC B;  4D2K A;  3I9V 1;  4DK5 A;  4NQK E;  5FKA C;  2KN5 A;  1QOF A;  2C9W B;  3VQI A;  4K7S A;  4RCO A;  2DBY A;  4HRS A;  1WXS A;  2DYO A;  3Q3F A;  1IBX B;  1V1P A;  3IG3 A;  2V4L A;  2WNM A;  2N7J A;  2LGY A;  2J4X A;  2QSD A;  5J2R A;  2PVO D;  2KMA A;  3H6N A;  3OG5 A;  4IDI A;  3ZDT A;  2I38 A;  1PFD A;  1JWA D;  4GLS C;  4C00 A;  4DHJ B;  3O13 A;  1S3S G;  2BS4 B;  2MW5 A;  3BZD B;  4ITK A;  2V3S A;  3RNF C;  1CJE A;  1KLV A;  3CIR B;  1TS3 A;  3Q3M C;  1V5O A;  2MLB A;  3AE8 B;  3R2T A;  3EUB 2;  3N32 A;  3VR8 B;  5BYQ A;  1UGM A;  2LHE A;  3Q69 A;  3KLS X;  1JRU A;  1VLB A;  4AQ7 A;  1RFK A;  2N1V A;  3WAN A;  4PK1 A;  4XE0 A;  2ZW0 A;  2WXP A;  2NS5 A;  3KVF B;  2D3G A;  3NVY A;  1XCT L;  3AH7 A;  3AM9 A;  2W82 A;  5TR5 A;  3X0W A;  1GNU A;  4YTM B;  1J0G A;  1ENF A;  3EA6 A;  2GLS A;  1MG4 A;  4C7Y A;  3NOB A;  3JYU A;  3LYY A;  1RM6 C;  2IZV B;  1L5P A;  2LJ5 A;  2GMI C;  1WF9 A;  3U7Z A;  2LGS A;  3MC8 A;  4IUM B;  4HPL B;  3AV8 A;  1IYF A;  1WM2 A;  2O6V D;  1K51 A;  3DVN V;  3B2G A;  1YX5 B;  1V80 A;  4NAW A;  2YEP B;  4TMA B;  4GXB A;  2JX5 A;  3H7S A;  4YT0 B;  2LMC A;  2GRI A;  1MFW A;  1Y56 A;  2ZZP B;  3L13 A;  3JVZ X;  2MCN B;  4W9J A;  2J53 A;  3NS8 A;  3KW5 B;  3ZRF A;  2CHW A;  3M63 B;  1I4G A;  4WWP A;  3PPA A;  1FPY A;  3A9K A;  5BYR A;  2LEK A;  3SFE B;  2JYT A;  2IO1 B;  1E8Y A;  3L17 A;  1XXG A;  1I7H A;  1QF6 A;  3MP9 A;  4EZL A;  2M0X A;  4DXF A;  2WU2 B;  2OJR A;  5AZF A;  1IUE A;  4URK A;  3P4R B;  2M17 A;  4G0N B;  4KZ0 A;  3UQB A;  1JWU D;  1E7V A;  4MSM B;  4US8 A;  2RSU A;  2KJH B;  1EM7 A;  4RH6 A;  2PMV A;  3DHH C;  4FA6 A;  1E8Z A;  2W9N A;  2LUM A;  1QT9 A;  2KMM A;  3U8Z A;  5IOI A;  5IA7 A;  3MC0 B;  4L23 A;  4RF1 A;  1UWM A;  1B9R A;  5CTR C;  1JRO A;  1YJ1 A;  4WUR A;  5JHB A;  5LNK 1;  2JSV X;  3HRD D;  3H1U A;  1TKE A;  5I4D A;  3IT4 B;  3BII D;  4EFO A;  2NBV B;  2JY6 A;  4JPS A;  1ZDV A;  3OAW A;  3ENE A;  2INC C;  1GB4 A;  4ARI A;  1D6E C;  3KUZ A;  4IC7 B;  3QA8 A;  5FR6 A;  2QMT A;  1KLG D;  2WDQ B;  4MT5 A;  1C77 A;  2AL6 A;  4LNF A;  4HJG E;  2J0J A;  2BYT A;  1C4A A;  5J18 A;  4DDI D;  4KV2 A;  2LAS A;  2BWF A;  4LDT D;  1N63 A;  2CJO A;  3KYD D;  4ZYN A;  1SSN A;  2K8B A;  2I1J A;  4BBN C;  1SE2 A;  3APC A;  2CR5 A;  1Z5S B;  3EFU A;  4MJS A;  4AJY B;  3N3K B;  2KWU B;  1VDV A;  4J3O D;  3QCA A;  2O2V A;  2D11 A;  2Y5P A;  3R8B A;  1HZ6 A;  3AEB B;  1J7A A;  3I57 A;  3T3N A;  2DWQ A;  4W9H A;  4G50 A;  1JW9 D;  1LGR A;  3OJ4 B;  3NS1 A;  1Q5W B;  4ANV A;  3IVF A;  3V60 A;  2J0M A;  3A4R A;  4WIP A;  4B9K A;  4RM9 A;  4EKU A;  4KZC A;  5EE9 A;  3P4Q B;  3U4E G;  2KTR A;  2QCZ A;  2LVO A;  5CHF A;  3AU4 A;  2DNF A;  2L3Z A;  3NHE B;  4W9F A;  1S1Q B;  4WWM A;  2ZW1 A;  1RWS A;  2IGG A;  1ZXH A;  5AZG A;  4PT5 A;  2G45 B;  5KHO A;  3DBH B;  1VR9 A;  3PLV A;  2KYW A;  2MBO A;  4KIK B;  1TJE A;  1YJJ A;  2RR9 A;  2LXC A;  3J9C A;  4ANU A;  4IWQ A;  3L16 A;  1NVI D;  2E3T A;  2W55 A;  3DOW A;  2LFI A;  3FKY A;  3ZXR A;  1QOB A;  2J42 A;  1OFF A;  5HKH A;  1E8W A;  4BKS A;  3H8H A;  1P0R A;  1YIW A;  4P16 A;  2K39 A;  1I4P A;  2PLP A;  3M3J A;  1IP9 A;  1AN8 A;  1WX9 A;  4JGH B;  4BZA A;  1WXQ A;  1WYW B;  4IM0 A;  4EEW A;  4JL9 A;  3SR6 A;  1OQR A;  2IDY A;  2KKC A;  4EE2 A;  1NI2 A;  4P6V F;  4DXA B;  1C4C A;  2L52 A;  1NEK B;  2FCS A;  4NPN A;  3V05 A;  4HXD A;  2N4F A;  2K8C A;  3ABV B;  2NMQ A;  1IBX A;  4A8X C;  3A9J B;  4W9L A;  1QQR A;  1I4R A;  2KZR A;  2WDV B;  3CSF A;  2KJR A;  3RNG C;  3JSV B;  3RFZ B;  3TCA A;  4US9 A;  2BQQ A;  4WJP A;  2PIA A;  2NBU A;  1V2Y A;  3AEA B;  4HLE A;  2XK5 B;  3P2B A;  3ZYY X;  1I4Q A;  5DPR A;  4XZ4 A;  1PGA A;  2Y3A A;  2WYQ A;  3LJ3 A;  3TBL D;  1R4N I;  2JRI B;  2H88 B;  1F1H A;  3TJP A;  3ZO5 B;  4ANW A;  3AEF B;  1XT9 B;  2V0G A;  2IY1 B;  3DBL I;  4F7Z A;  3B2F A;  3UQA A;  3TEY A;  2M8S A;  1TS2 A;  1T6B X;  1V9J A;  2KQ7 A;  1EU4 A;  1YN5 A;  2Z8L A;  4ZHO A;  4C4V B;  2JF5 A;  4A20 A;  1F9J A;  1I4H A;  2ONQ A;  3GE8 C;  3VUX A;  3LB8 C;  4IM3 A;  3PV1 A;  5L83 A;  3PT2 B;  3GZN B;  3T9L A;  4YSZ B;  5EE3 A;  3RZF A;  2O2V B;  3ZTD A;  3K9O B;  2HE7 A;  2K5P A;  3WIM A;  3RPF C;  3PGE A;  1FRD A;  3QJZ A;  2KHW B;  4GOC A;  2M1M A;  1J7B A;  3VRA B;  5KHQ A;  3N1Z C;  1JWS D;  1V86 A;  2KFJ A;  2PW9 A;  4AOF A;  1DOX A;  2QDF A;  1V6E A;  2V9H A;  3RUI B;  2ASQ A;  1J7C A;  4HPM B;  4ANX A;  2WXG A;  3SEB A;  3APD A;  3GP7 A;  3ECI A;  2FUG 1;  2RDH A;  2FCN A;  1GOZ A;  4FXC A;  3VUW A;  5D6J B;  4M02 A;  4OZC A;  1NYQ A;  4KSK C;  3ZVV A;  1P98 A;  1QZE A;  2KLG A;  2AQ2 B;  3Q8B A;  2SAK A;  3Q8E A;  2CU1 A;  2KFK B;  3BWU D;  3MJ5 A;  4RF0 A;  1M94 A;  4KGR A;  1RRB A;  3BIN A;  3CMM B;  4GGQ A;  3U2S C;  1VJK A;  3VHT C;  1P3Q U;  4JIO U;  3VH3 B;  1FNV A;  3S2A A;  1YQ3 B;  1NYR A;  2K6Q A;  1WGY A;  5D94 A;  5AUI A;  3Q3N C;  1L0X B;  4CO7 A;  2AQ1 B;  2LGI A;  5MPO A;  1K50 A;  2QC8 A;  4I6L B;  3A4S C;  3SD5 A;  5HFY A;  3QX1 A;  2QJL A;  1XO3 A;  3AE2 B;  4BVU C;  1OEY J;  1G6J A;  1UBI A;  3E56 A;  4C80 A;  4FJV B;  2K1F A;  1TKY A;  2MEK A;  1CK1 A;  1T0R C;  3VTV A;  4K81 A;  2KLC A;  4WWO A;  2EMT A;  2WXM A;  1KJT A;  4HCP B;  2WU5 B;  3RUL A;  3IAS 1;  1L0Y B;  3VR9 B;  3R7Q A;  3M62 B;  1VRA B;  1E10 A;  3WCQ A;  3ZNH B;  1XLP A;  1N5W A;  2PTL A;  4ZOH C;  1H8C A;  1WJU A;  1HTQ A;  2KVZ A;  1WJ4 A;  3DBS A;  5CHV C;  1PGX A;  4NNJ B;  3WA0 A;  4FUL A;  2V3P A;  1MHH E;  3AE1 B;  2AYO B;  2MWS B;  1HQR D;  4AUQ C;  2LD9 A;  3QAR A;  1BXT A;  2JPH A;  1N61 A;  4MGY E;  2GBK A;  2DZM A;  2BB6 A;  1N6Z A;  4BKG A;  4FAD A;  4TUU A;  3W5V B;  3RZW C;  2EKE C;  1XQQ A;  1QOA A;  4LDT B;  4IW0 A;  3L4P A;  3ETR A;  5IN7 A;  2I2Y A;  4OZB A;  3EHV A;  4MGZ E;  4LCD E;  4Q2J A;  1FMA D;  3R2I A;  1LO5 D;  3DCG A;  3HK0 A;  2WS3 B;  2GBR A;  4KGS A;  3ML8 A;  1R4M I;  1UEL A;  2ON8 A;  1T0S C;  2VZK D;  1ROE A;  4LJO B;  1H4R A;  3EEC A;  1L2N A;  3DVG Y;  3D32 A;  5EE1 A;  2FID A;  5C3J B;  4YTP B;  4MM3 B;  2JUO A;  2KDB A;  3ZTC A;  3DPD A;  1L7Y A;  2NTS A;  4P1B C;  4ASW C;  1UWX A;  2JVC A;  2LGX A;  3VVW B;  1ZOY B;  1TT5 B;  5DPT A;  3CF6 E;  3OJ3 A;  1GC6 A;  4C7Z A;  4S17 A;  1FD6 A;  4N58 A;  2PE9 A;  2KOX A;  1FXA A;  1XLN A;  2DYM A;  3MTN B;  1WJ6 A;  4KIK A;  4ARC A;  5G55 A;  2J52 A;  3PTF C;  2M19 A;  2M0A A;  1ZPS A;  1YMH E;  1L4D B;  1F52 A;  4GDL B;  2ZVO A;  2FE8 A;  4BKT A;  1MVK A;  1KOT A;  3BK1 A;  2CHZ A;  2KT7 A;  2L1A A;  1UBQ A;  4KKI A;  5H8Y E;  5D7G A;  1UD7 A;  3N1X C;  3SHQ A;  1GG3 A;  1SE4 A;  1OEY A;  1NDD A;  4B6W A;  1ZP0 B;  1IPG A;  2DX5 B;  2UWQ A;  2A4Z A;  2CJN A;  3URY A;  3AE3 B;  3N1Y C;  2Y5B B;  3P4P B;  2N1W A;  1TZ1 A;  4JE3 B;  2MP2 B;  2OJW A;  4FHK A;  3NVZ A;  2IGD A;  2MX2 A;  1LQB A;  3ALB A;  2MBE A;  2N9X A;  3M95 A;  4NAM A;  4IWP A;  3PZ7 A;  5EE0 A;  1T5X D;  2REX A;  4KX6 B;  4BOS C;  3QIJ A;  2MBB B;  3IBE A;  4S0R A;  2WX1 A;  3A9J A;  3C8Y A;  2BF8 B;  2BKR B;  1SJH D;  1XLO A;  1WZ3 A;  1UF0 A;  2K3U A;  3DDC B;  1MJD A;  3AUL A;  3JSV A;  2PE6 B;  2ACZ B;  4OHJ A;  1GPX A;  5AUK A;  4BKS D;  1E8X A;  2R2O A;  1DOI A;  1C78 A;  2B3A A;  3FIL B;  4QAY A;  2XK5 A;  1Q10 A;  2Z0E B;  3NVW A;  4BAX A;  1JWB D;  1YN4 A;  4M0W B;  4ICU A;  3GS2 A;  3SDL C;  4N59 A;  1GC7 A;  1T3Q A;  1E7P B;  2RDB C;  3RCZ A;  3MJW A;  1T0Y A;  4DHZ E;  2K6D B;  3GB1 A;  3MHZ A;  4FBJ B;  3I63 C;  3R66 C;  4E71 A;  5C2T B;  4AS1 A;  2HD5 B;  2IY0 B;  3HM6 X;  4USA A;  4C4V A;  1FFV A;  3AE5 B;  1TY2 A;  2KQS A;  2HDE A;  4OVZ A;  2BB5 A;  3VTU A;  4LK0 M;  2DZK A;  4NJC A;  1R7S A;  2ICI A;  1HE8 A;  1FM0 D;  4M8N A;  2WXI A;  1EU3 A;  1NI3 A;  3TSS A;  2OOB B;  1TKG A;  2HTH A;  2JU6 X;  1E90 A;  4DHJ D;  1E0Z A;  1FO4 A;  4FHJ A;  3SU8 X;  2KDE B;  1GUA B;  2WXH A;  4HK2 A;  1HZ5 A;  1NBF C;  4YSX B;  2BGF A;  4RM8 A;  2WQY B;  4I6P A;  4TQ0 A;  3V6C B;  2NTT A;  4A9A A;  3DVG X;  2K25 A;  1WZ0 A;  4E3C A;  2JZP A;  2LGD A;  1YN3 A;  3B0A A;  1N62 A;  3MFG A;  3AE9 B;  2MH7 A;  5BMI A;  1D5Z C;  2BYF A;  1SEB D;  3AEE B;  2LVQ A;  1HXY D;  4B0E A;  4II3 B;  3ONS A;  4JWU C;  4IM2 A;  3EFC A;  3PHW B;  2PEA A;  4CQN A;  5CHW A;  2LUE A;  1KTK A;  2ZCC A;  2CHX A;  1SE9 A;  2R2Q A;  4P1C C;  4GN1 A;  3KWV A;  4OZA A;  1V5T A;  4C56 C;  3HM3 A;  2VH2 A;  3O65 B;  1TZO A;  2NVU I;  2OED A;  2BT6 A;  2PKO A;  3P1M A;  2KFK A;  1AW7 A;  1WGG A;  3QK0 A;  3MHS D;  1ZGU B;  4KGT A;  4EZJ A;  4REZ A;  1HEZ E;  4YTN B;  1L6V A;  2WWZ A;  2OHF A;  3AEG B;  5D3D A;  1D5X C;  5DPS A;  3L0W B;  3X23 A;  2BKF A;  3LDZ E;  2XEW A;  1WH3 A;  2UYZ B;  5BO4 B;  2TSS A;  3WAP A;  2MRP A;  1SF0 A;  3N20 C;  2CU3 A;  2WXL A;  1EUV B;  1WSP A;  3EC8 A;  2ZCB A;  2QEJ C;  3H9D A;  3ZUN A;  1WR1 A;  1JML A;  3H7P B;  1QKZ A;  1K52 A;  1C4P A;  1ZXI A;  4ZHP A;  1WGD A;  2PJH A;  2G4S A;  4XDD A;  1DOY A;  5E6P A;  1YNT E;  1YQ4 B;  4GIV A;  3ZJU A;  1D4B A;  5LLI A;  3BYY B;  2KTF A;  1L4Z B;  1F2R C;  1JWM D;  2N9P C;  2LVP A;  2X38 A;  1IGC A;  1FNW A;  3HIZ A;  4WJN A; 
#chains in the Genus database with same CATH homology
 2KK8 A;  1M94 A;  4TKN A;  2G4D B;  4MSQ B;  1RRB A;  3BIN A;  3NOB A;  4HDO A;  3CMM B;  2YLM A;  3JYU A;  4GGQ A;  2N9E B;  3RYT A;  3VHT C;  2IZV B;  3UGB B;  2J7Q B;  1P3Q U;  2LJ5 A;  3A1Q A;  4JIO U;  3VH3 B;  1WMH A;  2GMI C;  3PRM B;  3DVN U;  2CS4 A;  1WF9 A;  3S2A A;  2K6Q A;  2KO3 A;  3VDZ A;  1WGY A;  5D94 A;  4AP4 C;  1K8R B;  4IUM B;  4CO7 A;  2FAZ A;  4I6L B;  3A4S C;  2D10 A;  3IFW B;  4HPL B;  3SD5 A;  1IYF A;  1OQY A;  1WM2 A;  2KDI A;  2O6V D;  3QX1 A;  3DVN V;  1WIA A;  1V80 A;  1YX5 B;  2C7M B;  4NAW A;  3RT3 B;  4GXB A;  3KYC D;  2MBQ A;  3H7S A;  1WJN A;  4RMA A;  5LXH A;  4BVU C;  1OEY J;  4F1S A;  3V61 A;  1WFY A;  1G6J A;  1UBI A;  1X1M A;  4FJV B;  2ZZP B;  3DBR I;  2AL3 A;  2L00 B;  3L13 A;  2K1F A;  3JVZ X;  2MCN B;  1XD3 B;  2KWC A;  4BOZ B;  2O6V A;  4W9J A;  5JHA A;  3VTV A;  3NS8 A;  3KW5 B;  1WX7 A;  3ZRF A;  2LRU A;  4K81 A;  1Y8R C;  2CHW A;  3M63 B;  2KLC A;  4WWO A;  4MGI E;  1D3Z A;  2EMT A;  4WWP A;  3PPA A;  3WAL A;  1KJT A;  1YQB A;  4HCP B;  3RUL A;  4BFR A;  3A9K A;  4I6N B;  1WI0 A;  3R7Q A;  2IO1 B;  4KDI C;  4IG7 B;  1E8Y A;  3M62 B;  4GU2 A;  1LXD A;  3L17 A;  1VD2 A;  2AEH A;  3OLM D;  3TIX A;  2KJ6 A;  3L08 A;  4PYZ A;  1FXT B;  3ZNH B;  2FUH B;  4MM3 A;  4DWF A;  4EZL A;  2M0X A;  1H8C A;  1WJU A;  1E5W A;  1OGW A;  2OJR A;  5AZF A;  1WJ4 A;  3DBS A;  1I35 A;  3L10 B;  4URK A;  3VTW A;  2M17 A;  2MBH A;  5CHV C;  3PZD A;  2A5U A;  2LWP A;  4G0N B;  4NNJ B;  4KZ0 A;  3AI5 A;  3WA0 A;  4FUL A;  3UQB A;  1RFA A;  2FCM A;  2KWV B;  3APF A;  2AYO B;  2MWS B;  2RD0 A;  1E7V A;  2KNB A;  4MSM B;  3TMP B;  1MG8 A;  2NCN A;  3NZU A;  3PHX B;  4AUQ C;  2RSU A;  3A1Q B;  5CX3 A;  2C60 A;  2LD9 A;  1J19 A;  1WMH B;  3QAR A;  2KJH B;  4G11 A;  2C7N B;  2JPH A;  2KMC A;  2RPQ A;  4MEL A;  4ZRK A;  4MGY E;  2GBK A;  1WX8 A;  2DZM A;  4MH0 E;  2ZEQ A;  4YL8 A;  4FA6 A;  1E8Z A;  4BKG A;  2W9N A;  3VAW A;  4FAD A;  4TUU A;  4GDL A;  4HWI B;  1ZKH A;  3RZW C;  3U8Z A;  2EKE C;  1XQQ A;  1TGZ B;  5IA7 A;  2ZVN A;  2C7H A;  4NAW B;  1YX6 B;  2MA9 B;  4LDT B;  4PS3 A;  4IW0 A;  2XBB C;  4W9C A;  5CTR C;  3ML9 A;  1J8C A;  1YJ1 A;  1Q0W B;  4W9E A;  3ZKJ C;  3EHV A;  5JHB A;  2KVR A;  2JT4 B;  4MGZ E;  4K7W A;  4LCD E;  3H1U A;  4XC2 A;  4AJW A;  4PS7 A;  1WM3 A;  3DCG A;  2AWT A;  5E6N A;  3HK0 A;  1WXV A;  2O6V B;  4EFO A;  4PYU A;  2GBR A;  3ZW3 A;  5L95 C;  3ML8 A;  1R4M I;  1UEL A;  2DAJ A;  2MSE D;  2NBV B;  2JY6 A;  2V1Y A;  4XX5 A;  4KSL C;  3OAW A;  4X57 B;  3ENE A;  3C0R B;  4W9K A;  4LJO B;  3A9K B;  3V62 A;  1Z2M A;  2RGF A;  1H4R A;  2MP2 A;  3EEC A;  3K9P B;  4BBN F;  3DVG Y;  1L2N A;  3D32 A;  2FID A;  3QC8 B;  3KUZ A;  2D07 B;  4IC7 B;  3VXW A;  3QA8 A;  5FR6 A;  2BYV E;  4EUT A;  2JUO A;  4IWO A;  2KDB A;  3ZTC A;  3ZLZ A;  4NJ6 A;  1TTN A;  3DPD A;  1L7Y A;  3ZRC A;  2JZ3 B;  4OVU A;  3KUC B;  2AL6 A;  4ASW C;  2JVC A;  2LGX A;  3VVW B;  4ZDV A;  2J0J A;  4NJ7 A;  5DPT A;  2KX0 A;  3CF6 E;  4AWJ A;  5AEK B;  3OJ3 A;  5J18 A;  4FLH A;  1GC6 A;  2L8J A;  4DDI D;  4KV2 A;  3PLU A;  2LAS A;  2BWF A;  1WRD B;  2PE9 A;  2KOX A;  2DZI A;  4LDT D;  2QHO A;  4KDL B;  3ZNG C;  3KYD D;  4ZYN A;  2DYM A;  3Q3J A;  5G2N A;  3MTN B;  2K8B A;  2I1J A;  1WJ6 A;  2NR2 A;  4KIK A;  2DAF A;  3BY4 B;  3PTF C;  5G55 A;  3QWZ B;  4WWN A;  4BBN C;  3PRZ A;  2DHZ A;  1WXM A;  3APC A;  2CR5 A;  1Z5S B;  3EFU A;  4MJS A;  2I1K A;  4AJY B;  3N3K B;  4GDL B;  2KWU B;  4EZK A;  1C1Y B;  2ZVO A;  2D2Q A;  3PRP B;  4BKT A;  1KOT A;  5JZE B;  2CHZ A;  2LI5 A;  1UBQ A;  2O2V A;  3QCA A;  1WY8 A;  2G3Q B;  1RAX A;  2D11 A;  5D7G A;  4CYE A;  1UD7 A;  2JWZ A;  3SHQ A;  1GG3 A;  3N30 A;  1OEY A;  1NDD A;  4B6W A;  1IPG A;  1EF1 A;  4K7U A;  5DCN A;  2DX5 B;  4J6I A;  2UWQ A;  2A4Z A;  4W9H A;  3PRE A;  4NQL B;  1WGR A;  4G50 A;  2YVC A;  4DBG A;  2C5L C;  2KDF B;  3U7D A;  3KH0 A;  3OJ4 B;  5C1Z A;  1Q5W B;  3T8M A;  4ANV A;  2J0K A;  2BPS A;  2K8H A;  2Y5B B;  2KXJ A;  3IVF A;  2EMS A;  2N1W A;  3U30 A;  1TZ1 A;  2MP2 B;  3V60 A;  2HJ8 A;  4FHK A;  4GMV A;  2ZJD A;  2J0M A;  2MX2 A;  3A4R A;  1LM8 B;  3PS6 A;  4B9K A;  1V49 A;  4RM9 A;  3ZIM A;  4KZC A;  4EKU A;  5J17 A;  1LQB A;  1ZW7 A;  2KTR A;  3WAM A;  4WQO B;  3ALB A;  2LVO A;  2MBE A;  2N9X A;  4JLC A;  3M95 A;  4IWP A;  2Z0D B;  5CHF A;  3JW0 X;  3W1Y A;  2ZNV B;  3UF8 A;  2REX A;  3AU4 A;  2GBN A;  2L3Z A;  4BOS C;  3NHE B;  4W9F A;  3ZNI D;  3QIJ A;  4G3X B;  1S1Q B;  3RD2 A;  2BWE S;  3AXC A;  2IO2 B;  3B08 A;  4B95 A;  2IO0 B;  4TQ1 A;  4WJQ A;  5AZG A;  2ZPY A;  3W1S C;  2MBB B;  3IBE A;  4E74 A;  2N7D A;  4II2 B;  3TL5 A;  4LJP B;  3PSE B;  2WX1 A;  4TV3 A;  2G45 B;  5KHO A;  3A9J A;  1GJZ A;  3PLV A;  2BF8 B;  1C3T A;  1E7U A;  2BKR B;  2MBO A;  4KIK B;  4ZRJ A;  2KC1 A;  3QAQ A;  2JZZ A;  1WZ3 A;  3DDC B;  1WR6 E;  2RR9 A;  3AUL A;  4MJS B;  3JSV A;  3UIN B;  2FIF A;  4F8C B;  2PE6 B;  2LXC A;  2GBJ A;  2IBI B;  3VFK A;  4BKS D;  2KD0 A;  1PQS A;  2WX0 A;  4GSW A;  1E8X A;  4IWQ A;  3L16 A;  2R2O A;  4ANU A;  1UH6 A;  1I42 A;  2Z59 B;  3DOW A;  2B3A A;  1P9D U;  2BYE A;  5C23 A;  4DDG D;  2XK5 A;  4OVV A;  4GDK A;  4W9D A;  2Z0E B;  3HHM A;  4A3P A;  5HKH A;  1E8W A;  3IHP C;  4ICU A;  4M0W B;  4P7I A;  3CST A;  4BKS A;  3SDL C;  1P0R A;  2LXA A;  4JQW C;  1YIW A;  3AU5 A;  1GC7 A;  2K39 A;  3V6E B;  3RCZ A;  3M3J A;  3MJW A;  1IP9 A;  1T0Y A;  4DHZ E;  2K6D B;  1WX9 A;  4JGH B;  4FBJ B;  5GMV A;  3R66 C;  4HJK A;  1WYW B;  4IM0 A;  1EF5 A;  4EEW A;  4JL9 A;  2KKC A;  4E71 A;  2KTR B;  2JRH A;  1NI2 A;  2JXX A;  2HD5 B;  2IY0 B;  3HM6 X;  3DBH I;  4W9I A;  4DXA B;  1WXA A;  3UIO B;  2KQS A;  2FCS A;  3VTU A;  2DZK A;  4NPN A;  4HXD A;  2DZJ A;  2N4F A;  4FJZ A;  2K8C A;  1BT0 A;  2M4N A;  4ZRI A;  3W1S A;  1HE8 A;  4WAA A;  1VCB A;  2DEN B;  4M8N A;  2L7R A;  5AZH A;  2OOB B;  1WE6 A;  3A9J B;  4W9G A;  4W9L A;  2KZR A;  4EOY A;  5LXI B;  2IO3 B;  1A5R A;  2HTH A;  4DHJ D;  1E90 A;  1U4A A;  4FN2 A;  1UZX B;  3QQ8 B;  3R3M A;  4FHJ A;  3CSF A;  2KDE B;  2MQJ A;  3SU8 X;  1GUA B;  4HK2 A;  2KJR A;  3JSV B;  1NBF C;  3TCA A;  5JH5 C;  1SIF A;  2NPT A;  4WJP A;  2BGF A;  2NBU A;  4RM8 A;  2CU1 A;  4I6P A;  4TQ0 A;  3V6C B;  1V2Y A;  3WAO A;  3DVG X;  4WJO A;  1RLF A;  4HLE A;  2K25 A;  2CKH B;  1WZ0 A;  1Q1O A;  2XK5 B;  3P2B A;  4GDK B;  3VUY A;  4E3C A;  1AAR A;  2LGD A;  3B0A A;  2L0T A;  5DPR A;  2PPH A;  4XZ4 A;  2FNJ B;  4WJN A;  1ISN A;  2WYQ A;  4DHZ B;  4FJY A;  2BYF A;  3LJ3 A;  5E6O A;  3TBL D;  1R4N I;  2JRI B;  3DQV A;  4MEM A;  1YD8 U;  2LVQ A;  3H7P A;  3TJP A;  3ZO5 B;  4NY0 A;  4ANW A;  4II3 B;  3ONS A;  4KVG B;  4IM2 A;  1XT9 B;  1SGH A;  2IY1 B;  3DBL I;  4F7Z A;  3PHW B;  2WDT B;  4GB9 A;  3NY5 A;  2GBM A;  2NBW B;  3UQA A;  1EO6 A;  2PEA A;  2M8S A;  3A33 B;  3KUD B;  1V9J A;  2IYD B;  2KQ7 A;  5CHW A;  2LUE A;  3NZS A;  2ZCC A;  1WGH A;  4DK5 A;  2CHX A;  1SE9 A;  2R2Q A;  2JF5 A;  4N9F 4;  2FCQ A;  4NQK E;  4GN1 A;  2VRR B;  2KN5 A;  2ZPN A;  2DYB A;  4HCN B;  4A20 A;  2C9W B;  3VQI A;  1F9J A;  4PS8 A;  1V5T A;  4K7S A;  3B1L X;  1V81 A;  3HM3 A;  4CHK A;  3O65 B;  1WXS A;  3VUX A;  2NVU I;  2LRW A;  2DYO A;  3Q3F A;  3R7R A;  2KFK A;  3IG3 A;  1WGG A;  2V4L A;  4IM3 A;  3QK0 A;  3MHS D;  1ZGU B;  3PV1 A;  4EZJ A;  2ZNV C;  5L83 A;  2LGY A;  3PT2 B;  4K1R B;  4HVB A;  3T9L A;  5J2R A;  2WWZ A;  2KMA A;  1TBE A;  2N7E A;  3RZF A;  3ZDM C;  3H6N A;  2NPT B;  2O2V B;  5DPS A;  3ZTD A;  3ZDT A;  5IAA C;  5EDS A;  3K9O B;  1LFD A;  3L0W B;  3X23 A;  2BKF A;  1KM7 A;  2HE7 A;  2XEW A;  3LDZ E;  2L76 A;  3WIM A;  1WH3 A;  4DHJ B;  3PGE A;  1S3S G;  2UYZ B;  5BO4 B;  3WAP A;  2MRP A;  2MW5 A;  3QJZ A;  1EUV B;  2KHW B;  1P1A A;  4GOC A;  2V3S A;  2M1M A;  4A3O A;  1KLV A;  3EC8 A;  1WE7 A;  2ZCB A;  1V5O A;  2MLB A;  2KC2 A;  4ICV A;  4MDK E;  1V86 A;  5KHQ A;  3H9D A;  5DPW A;  3PVL A;  3ZUN A;  2KFJ A;  1WR1 A;  3ZNZ B;  3N32 A;  1OTR B;  3I3T B;  3H7P B;  4AOF A;  3QHT A;  1V6E A;  1CMX B;  1UGM A;  3RUI B;  2ASQ A;  1JRU A;  1WGD A;  2PJH A;  2L0F A;  3VH4 B;  2G4S A;  4HPM B;  2N1V A;  4ANX A;  5D2M B;  3APD A;  3WAN A;  3ECI A;  3L54 A;  4M8M A;  5E6P A;  2NS5 A;  2FCN A;  3VUW A;  3KVF B;  2D3G A;  3GZN I;  4GIV A;  5D6J B;  5LLI A;  2L05 A;  2KAN A;  2KTF A;  4HDQ A;  2KX3 A;  3UIP B;  5TR5 A;  3X0W A;  4MGK E;  1GNU A;  4KSK C;  2N9P C;  3ZVV A;  2LVP A;  1P98 A;  1J0G A;  1QZE A;  2KLG A;  3GOE A;  2GOW A;  3HIZ A;  2KFK B;  2LZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...