4PYUA

The conserved ubiquitin-like protein hub1 plays a critical role in splicing in human cells
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
GSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/allergen
molecule keywords Ubiquitin-like protein 5
total genus 23
structure length 76
sequence length 76
chains with identical sequence B, G, K, O, S
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4pyuA00
4JLCA 2XK5A 3EHVA 1E8YA 4NAWB 2D07B 4RMAA 3CSFA 3OJ3A 4ICVA 2L3ZA 3WANA 2BYVE 2KWVB 3SDLC 3B1LX 4EOYA 2K8HA 4GSWA 1PQSA 1WIAA 3A9JA 4W9JA 2ZJDA 2GMIC 3ZDMC 4YL8A 2N9EB 3W1YA 2UYZB 3QWZB 4EUTA 4DHJD 2EKEC 4I6NB 2LWPA 3OJ4B 5CTRC 4CO7A 1E8ZA 2KZRA 4G0NB 2WYQA 4RM8A 4WWPA 3TMPB 1LFDA 2J7QB 2JT4B 3L10B 3LJ3A 1WXVA 1WXSA 3DVGX 2DENB 2KJHB 5AZFA 1E7VA 3VH4B 5IA7A 4MELA 3SD5A 4HDQA 3A1QB 4OVVA 4IWPA 4IM0A 1G6JA 1YQBA 3CF6E 4HVBA 4ANVA 1EUVB 1OEYA 5D6JB 2GBNA 3H7SA 4FHJA 2IO0B 3VQIA 2MQJA 4MH0E 2B3AA 4BKSA 1NI2A 1WJUA 3UIPB 3U8ZA 2PE6B 3RCZA 3DQVA 2KLCA 1TTNA 4AOFA 2DAFA 4GU2A 2HJ8A 2DYBA 2A4ZA 4E74A 2ZCBA 2LRWA 2WX1A 2K8BA 2PEAA 2MRPA 1K8RB 4B6WA 3KUDB 3PLUA 4BKTA 1R4MI 1MG8A 1S3SG 2MBEA 1S1QB 3DOWA 4W9IA 5D2MB 3A1QA 4WAAA 3ZNGC 2CHXA 4MGYE 5FR6A 4W9GA 3RULA 1GJZA 2RGFA 2ASQA 2R2OA 3VTWA 4JIOU 1YJ1A 3ZIMA 4LJOB 3L54A 4PS7A 3IVFA 3PLVA 4G50A 4A3PA 2LVQA 4JGHB 1VD2A 3X0WA 2KNBA 3PHXB 4ANUA 3QCAA 1GC7A 4MDKE 3CSTA 4IW0A 2FCSA 1WYWB 3ZKJC 4LDTD 1P1AA 4WQOB 4X57B 4WJPA 3ALBA 3RUIB 2G45B 3JW0X 2MLBA 1GG3A 1Q5WB 2IO3B 4K7UA 5AEKB 1GNUA 2BGFA 3KYCD 3QQ8B 2MP2A 2KMAA 3ZVVA 3H9DA 3L13A 4LJPB 4KZCA 1J8CA 3HM3A 2KLGA 3L0WB 4IC7B 5JH5C 4NPNA 3ZDTA 1WZ3A 2FIDA 3TIXA 2JRIB 3QK0A 1WJ6A 4DHZB 4M8NA 2AEHA 4XZ4A 4DHZE 1Z2MA 2BF8B 2IZVB 2R2QA 5IAAC 3RD2A 3ZNHB 1XD3B 4EEWA 2O6VD 4MM3A 4B9KA 2L0FA 2I1KA 3VHTC 3O65B 4FN2A 1YX6B 2JY6A 3VUYA 2FUHB 2KN5A 3Q3JA 3KYDD 4GGQA 3AXCA 4K7WA 2LUEA 4PYZA 3BINA 4BFRA 2CKHB 3TL5A 4A20A 4HXDA 3DVGY 2KO3A 3ONSA 4E3CA 2KTRA 5E6PA 4GDLA 2YLMA 4J6IA 3WAMA 4K81A 2LGYA 2LVPA 4TQ0A 1TZ1A 4WWOA 3SHQA 3QC8B 3TCAA 1OTRB 3ZNID 4DDGD 2KWUB 2GBJA 1UZXB 4BVUC 3RZFA 4M8MA 3N32A 1T0YA 1UBIA 4K7SA 1V5OA 2O6VB 3DVNU 2J0JA 3AU4A 3MJWA 2BWFA 1AARA 4HPMB 3CMMB 4W9FA 4AP4C 4N9F4 2DAJA 2PJHA 2AL3A 2IBIB 3PRZA 2UWQA 4NJ6A 3HIZA 3PRPB 2MWSB 2FCNA 4AJWA 2DYMA 4ZRKA 2NBUA 4TKNA 1WM2A 2ZCCA 3ZLZA 3NS8A 2C9WB 2KX0A 4NJ7A 2IY1B 2FIFA 1YX5B 5LXIB 1YIWA 2AL6A 4DBGA 1E8XA 2LXCA 2HE7A 3QX1A 4URKA 4GDKA 2HD5B 1WJ4A 3ECIA 2ZVOA 2ZZPB 2NVUI 2GBMA 2IO2B 2KFKA 1E90A 3QIJA 3MHSD 2ZNVB 3OAWA 4CYEA 4HCNB 4EZKA 5LXHA 4IUMB 3AI5A 2MBBB 5AZHA 1V9JA 1P0RA 2V4LA 3EFUA 2JZZA 2MW5A 3ENEA 3KUZA 3ZTDA 5D94A 1KM7A 1YD8U 2BPSA 3PSEB 4HCPB 2D3GA 3C0RB 3V60A 5J17A 1P3QU 3VH3B 4GOCA 2EMSA 5JHAA 3ZTCA 2RSUA 1J19A 2KC2A 1ZGUB 3A9JB 3HM6X 4MGIE 2DZMA 4NY0A 1SE9A 3M95A 3V61A 3WIMA 1WM3A 3RYTA 1ZKHA 1XT9B 1Z5SB 2N4FA 1U4AA 5CHVC 1Y8RC 5CX3A 3ZNZB 2KDFB 2MSED 5L95C 3UQAA 2DZJA 2M0XA 4HWIB 1WXAA 2KX3A 3NHEB 2LVOA 3TBLD 1WF9A 3VUXA 4FA6A 4II3B 2M17A 2MBQA 3W1SC 5D7GA 2LXAA 3Q3FA 5G2NA 4LDTB 2K1FA 2RR9A 1V80A 3PZDA 5BO4B 4EFOA 1WH3A 1Q0WB 2FAZA 3W1SA 3IG3A 4WJQA 1WZ0A 1FXTB 3WALA 2Y5BB 2L00B 1WXMA 2C5LC 3A4SC 4G11A 3ZUNA 2JRHA 1WX8A 4IM3A 2KANA 2NR2A 3HK0A 3IHPC 4HLEA 2WDTB 2KC1A 3H6NA 1RAXA 2CR5A 5L83A 4KSKC 3KUCB 2BYFA 2N7EA 3NY5A 2LGXA 4F8CB 2I1JA 1V49A 3LDZE 4MGZE 3IBEA 4IG7B 2OOBB 1LM8B 2XEWA 1EF5A 2G4DB 3N3KB 2RPQA 2M8SA 4MEMA 5CHWA 3DDCB 3JVZX 2IY0B 2JZ3B 3R66C 1V6EA 1UELA 2FCMA 2D11A 3U30A 3PT2B 3S2AA 2O2VA 4AUQC 4ANWA 5EDSA 5CHFA 1JRUA 1BT0A 1C1YB 1WMHB 3A9KA 2AYOB 2MP2B 4GIVA 4KDIC 4PS8A 2KKCA 4W9CA 3PHWB 2DYOA 1M94A 2ZEQA 3UQBA 3PRMB 3U7DA 2KDEB 2KOXA 3T9LA 3VTVA 5TR5A 3L17A 1GC6A 4HPLB 3VUWA 2QHOA 3PTFC 5KHOA 5JZEB 2HTHA 1H8CA 2MBOA 3B08A 4KSLC 4RM9A 2M1MA 2JPHA 3PV1A 1GUAB 3DBRI 3UIOB 2IO1B 1EO6A 3ZO5B 5E6NA 3KW5B 3ZRFA 2LZ6A 4XC2A 3APDA 4K1RB 1I35A 4PYUA 1KJTA 2KJ6A 3GOEA 1NDDA 2K39A 1EF1A 3V6CB 3PS6A 1WY8A 2L0TA 4BBNC 3ML8A 3OLMD 1NBFC 1TGZB 3UGBB 2NCNA 1WRDB 3ML9A 1WX7A 3GZNI 2C7MB 2Z0EB 3DBSA 4LCDE 3HHMA 1XQQA 2KWCA 2LRUA 3V6EB 4DWFA 4GDLB 1OGWA 4JQWC 1WR6E 4W9EA 5E6OA 1RLFA 4FBJB 4FHKA 3QARA 2VRRB 3RZWC 1L7YA 2NS5A 2REXA 1VCBA 3SU8X 1OEYJ 1E7UA 4GB9A 2RD0A 4IWQA 2KTFA 4IM2A 2KDBA 3VAWA 1WMHA 2FCQA 3A9KB 4BOZB 4ZDVA 5DPWA 3VFKA 2JXXA 3QJZA 3R3MA 4CHKA 4P7IA 2KVRA 4W9DA 2MA9B 4TV3A 3WAOA 5J2RA 3WAPA 3DBHI 2KHWB 2W9NA 4FJVB 3QA8A 5HKHA 2M4NA 1HE8A 2N9PC 1LXDA 4II2B 1SIFA 3R7QA 2J0MA 4EZLA 2L7RA 4MSMB 2N1VA 1J0GA 2PE9A 2KTRB 4OVUA 3IFWB 1H4RA 2ZPNA 3BY4B 3VTUA 2KQSA 2EMTA 2LD9A 2A5UA 2JF5A 2K6DB 3A4RA 4HDOA 3ZW3A 3VDZA 2CHWA 4KZ0A 4F7ZA 2Z0DB 2ZVNA 3H1UA 4KIKA 2N1WA 3A33B 5DPSA 2KJRA 2CS4A 4TUUA 2XBBC 2KD0A 4WWNA 5C23A 3R7RA 3DPDA 4EZJA 1V81A 1ISNA 3D32A 4WJNA 3PVLA 4MGKE 5C1ZA 1WGRA 3NZSA 1IPGA 2GBRA 2NPTA 3KH0A 4FJYA 1UH6A 4KV2A 4B95A 2NBVB 4PS3A 1V86A 5LLIA 5KHQA 3N30A 2KQ7A 4DHJB 4A3OA 2KXJA 4M0WB 3DCGA 3TJPA 2K25A 2CHZA 1WGGA 2KMCA 3V62A 3NOBA 1TBEA 4NNJB 2DZIA 2MBHA 5DPTA 3PREA 2L76A 2G4SA 4ZRJA 3ZRCA 3I3TB 2WWZA 4EKUA 4MSQB 3M3JA 3UINB 3RT3B 4BOSC 2LJ5A 3H7PB 3L08A 2BWES 3P2BA 2JVCA 4NAWA 3VVWB 1WR1A 1I42A 2IYDB 1R4NI 4FULA 4W9KA 3M63B 3DBLI 3EC8A 5G55A 1A5RA 2MX2A 2J0KA 2WX0A 2C60A 4NQKE 1WGDA 2OJRA 4W9LA 3UF8A 1WE6A 3L16A 3QAQA 4DK5A 2JWZA 3PPAA 1E5WA 3PGEA 1IP9A 1P98A 3JSVB 4GXBA 1SGHA 1LQBA 2GBKA 1KOTA 1OQYA 4DXAB 2D2QA 2BKRB 5JHBA 2L05A 3H7PA 2FNJB 2MCNB 1QZEA 4HJKA 2PPHA 4KDLB 4KVGB 2AWTA 2KDIA 2LGDA 4KIKB 4WJOA 3M62B 4BBNF 1WFYA 4ZRIA 1WI0A 2XK5B 3T8MA 3VXWA 1WE7A 2K6QA 1RFAA 2O2VB 1WX9A 4GMVA 2CU1A 3QHTA 4XX5A 1X1MA 1RRBA 3X23A 1IYFA 2KFJA 4F1SA 3AULA 4AJYB 4DDID 3EECA 2BYEA 2NPTB 3AU5A 2V1YA 3JSVA 5DCNA 3B0AA 4BKGA 4MJSB 1D3ZA 4IWOA 4W9HA 2L8JA 2GOWA 1F9JA 4ASWC 2N7DA 4HK2A 2ZNVC 4I6LB 2KK8A 2JUOA 3K9OB 5GMVA 1Q1OA 3APCA 3NZUA 2C7HA 3K9PB 4G3XB 4GDKB 4NQLB 3APFA 5DPRA 2BKFA 2DX5B 1WGYA 1KLVA 4TQ1A 2Z59B 1V5TA 2LI5A 2V3SA 2DHZA 3MTNB 2YVCA 3DVNV 2G3QB 4ICUA 2N9XA 3JYUA 5J18A 2NBWB 4FADA 2DZKA 1UD7A 3KVFB 1P9DU 2O6VA 4FLHA 2D10A 4MJSA 4JL9A 2K8CA 1UBQA 4E71A 1L2NA 3WA0A 1UGMA 1WJNA 4BKSD 1CMXB 1WGHA 4ANXA 5AZGA 2KFKB 4GN1A 4AWJA 4I6PA 1V2YA 1ZW7A 2C7NB 4ZYNA 2LASA 4FJZA 2ZPYA 1E8WA 1C3TA
chains in the Genus database with same CATH superfamily
3EHVA 2PVOD 4NAWB 3CSFA 3OJ3A 4ICVA 4GSWA 3A9JA 3KWVA 2GMIC 4EUTA 2EKEC 4I6NB 5CTRC 1MG4A 5HI1A 4AQ7A 1EWYC 2J7QB 3L10B 1TKYA 3LJ3A 2WP9B 3DVGX 2DENB 5AZFA 3SD5A 1M4VA 4OVVA 4IM0A 2WU5B 4USAA 4HVBA 1OEYA 2GBNA 4FHJA 2VH1A 3EGRA 1T3QA 4LNOA 2KLCA 1TY2A 2DAFA 1SB3C 2INNE 4E74A 2LRWA 2WX1A 2GLSA 1K8RB 3DOWA 2BYTA 2BT6A 3ZNGC 2CHXA 1JWSD 3VTWA 1YJ1A 4PS7A 1ZDVA 4B0EA 4A3PA 4ANUA 1FPYA 4LLGM 3B2FA 3PHXB 3X0WA 3T3OA 3QCAA 1GC7A 3ZKJC 1KF6B 3AE5B 1EU4A 1JWAD 2G45B 4N58A 5FKAC 3RNCC 3KYCD 3QQ8B 3U2SC 2KMAA 3DWGC 3ZVVA 4LJPB 4KZCA 1J8CA 3RI7C 3L0WB 4NPNA 1QT9A 2FIDA 1K50A 2JRIB 1EM7A 3QK0A 1GOZA 2BF8B 3Q3MC 2R2QA 3ZNHB 4MM3A 3PZ7A 2JY6A 3KYDD 1ET9A 5H92C 3Q8CA 3BINA 2PW9A 2E3TA 3TL5A 4AS1A 1OQQA 3WAMA 4J6IA 4TQ0A 1FNWA 1VJKA 1C9FA 2JQRB 1UZXB 4ARIA 2LJIA 3OWEB 4P6VF 3N32A 1DOYA 1UBIA 2NMQA 2K3UA 2O6VB 4W9FA 3CMMB 4N6EB 2PJHA 1T0QC 2IBIB 3PRZA 4NJ6A 2WXPA 2FCNA 4ZRKA 2NBUA 3ZLZA 3AE2B 3EUB2 2IY1B 2FIFA 1I4HA 4Q2JA 4EE2A 2LXCA 3IAM1 2V0GA 2WS3B 1C79A 3NUHB 2NVUI 2GBMA 2KFKA 2ZNVB 4CYEA 3NVYA 4EZKA 1F77A 5LXHA 3NZ3A 1SIJA 2X8XX 2VH2A 1PDXA 4HROA 3P4QB 1V9JA 1P0RA 4GLSC 3KUZA 1YJIA 1PGAA 4MH8A 3ZTDA 1YD8U 1SXTA 1ZP0B 1F52A 1P3QU 3DBLB 3VH3B 2JZPA 2EMSA 1SE2A 3A9JB 3HM6X 2DZMA 4XGAB 4HEA1 4O1NA 4REZA 3WIMA 1SEBD 5BYRA 2RDHA 3RYTA 1J7BA 2N4FA 2I38A 4RH6A 2PMVA 1WXAA 2KX3A 4C4VB 3TBLD 3VUXA 2MBQA 2QDFA 3AH7A 2K1FA 5C3JB 1V80A 2HJ1A 4EFOA 2Q5WD 3DWMA 3W1SA 4L2YA 4WJQA 4OZCA 1WXMA 3A4SC 2NR2A 3H6NA 1JCKB 2BYFA 2V4IB 4YSYB 4MGZE 3I5JC 1QILA 3MJ5A 1LM8B 1EF5A 2RPQA 2M8SA 2IGHA 1ZXIA 2IY0B 3NRZA 1K51A 5CHFA 1JRUA 1C1YB 3B9JA 4KDIC 4GIVA 2KN4A 3PHWB 2RPVA 1N63A 2KDEB 1YN5A 1ROEA 5AUKA 1KLUD 2IJ0A 2MBOA 3B08A 2PTLA 3KQ4A 2KT7A 3KW5B 3GS2A 3AN1A 4RFBA 3APDA 3UI3A 3GOEA 2K39A 1EF1A 4BBNC 1AWDA 1WRDB 3ML9A 2KWCA 2LRUA 1V8CA 5E6OA 2D5GA 4XYCA 4UDUC 3RZWC 1Q10A 1L7YA 2REXA 1VCBA 1FRDA 3VAWA 2KTFA 2FCQA 3BYYB 1I7HA 2LHDA 4M0WA 2JXXA 5T8IA 1F1HA 4MM3B 1YJJA 2MA9B 3WAOA 1PYWD 2W9NA 1T0SC 5HKHA 4KGRA 2N9PC 2ZW1A 4NJCA 4OZAA 2GB1A 4MSMB 2CJOA 3BIID 2PE9A 4IKGA 4OVUA 1TKEA 2WXLA 3FC4A 4HDOA 4KZ0A 2CS4A 4TUUA 2KD0A 1V81A 4TSSA 5C1ZA 1YN4A 3GE8C 3KH0A 1T6BX 2KQ7A 1UWMA 3LB8C 3DCGA 3V62A 1WGGA 3NOBA 1TBEA 3W5UB 2L76A 5IO9A 5G5HA 2K22A 2WWZA 4EKUA 4BOSC 1N5WA 4HJGE 3H7PB 4YT0B 1LO5D 2IYDB 3CWIA 4FULA 4W9KA 3AEDB 2K0PA 4NQKE 3L16A 4RF0A 1DYQA 1E5WA 4JPSA 1P98A 1HTQA 1SGHA 3BVGA 5IOIA 1OQYA 1ZPSA 4XE0A 2KQ4X 2L05A 2D3CA 2FNJB 4CQNA 2MCNB 2AWTA 3R2IA 2LGDA 1L0YB 3T8MA 1WE7A 2O2VB 1WX9A 4RGTA 3X23A 3AE6B 2BYEA 2NPTB 2V1YA 3FKYA 3JSVA 5DCNA 4BKGA 1D3ZA 4M00A 2GOWA 1F9JA 1FMAD 4ASWC 3C8YA 2CJNA 1B1ZA 1Q1OA 1A70A 3APFA 1SE3A 2DX5B 2LI5A 3MTNB 2DHZA 4ITKA 4YSZB 2G3QB 4LNKA 3LYYA 1L6UA 3KVFB 4JL9A 4E71A 1UBQA 3WA0A 5BYQA 4BKSD 5IP4D 2YEPB 5AZGA 1AYFA 2C7NB 4ZYNA 2ZPYA 4JX1C 1D5ZC 3AMZA 3Q2AC 1DGJA 2D07B 3SDLC 3B1LX 2WHIA 1WIAA 2CU3A 1DOXA 1FD6A 1YNTE 3W1YA 2UYZB 3NG0A 3QWZB 2AQ3B 4DHJD 2LWPA 2BBCA 2N9KA 1E8ZA 4QAYA 4G0NB 2WYQA 3TMPB 2JT4B 3L4PA 2KDMA 2GRIA 1R4MB 2KJHB 1E7VA 3VH4B 2Z8LA 5IA7A 1N6ZA 4HDQA 3A1QB 1YQBA 4OHJA 3FAHA 2INDC 2B3AA 4ACFA 2PE6B 2WQYB 3I63C 3RCZA 3N1XC 1TTNA 3ZGZA 2HJ8A 2ZCBA 2PEAA 4IOIE 4B6WA 3PLUA 4BKTA 1R4MI 1MG8A 1S3SG 2MBEA 4ARCA 2DWQA 5D2MB 2WXRA 3A1QA 2PLPA 1R4NB 2WLBA 4W9GA 2WDQB 2V3PA 4IDIA 2J4XA 2RGFA 2ASQA 5EE0A 3ZIMA 4J3OD 3L54A 3AB5A 3PLVA 4JGHB 1VD2A 2KNBA 1MHXA 4MDKE 4NAMA 1VLBA 4LDTD 1P1AA 1C77A 3JW0X 1GG3A 1Q5WB 1UUPA 1GNUA 2MP2A 3HM3A 1TT5B 3RNBC 3SFDB 5JH5C 3ZDTA 4A90A 1T0RC 3TEYA 4M8NA 2AEHA 4DHZE 1Z2MA 3SR6A 3W9CB 1C4CA 1XD3B 2O6VD 4B9KA 2L0FA 2I1KA 1UWXA 4FN2A 3HRDD 3DHHC 2FUHB 3Q3JA 4K7WA 4PYZA 1FM0D 2CKHB 4A20A 2KO3A 4E3CA 1GB1A 3ZYYX 4K81A 2LVPA 1TZ1A 3SHQA 3TCAA 1OTRB 2KWUB 1TZOA 3Q6BA 4K7SA 3DVNU 2J0JA 3AU4A 3MJWA 1AARA 1Y56A 2PKOA 2BVCA 4N9F4 1T5XD 2DAJA 4A55A 1FO4A 5HG2A 2WNMA 1RYJA 5D3IB 2DYMA 2WXOA 1WM2A 2ZCCA 3IXSA 2KX0A 1YIWA 4DBGA 1E8XA 2HE7A 1P7EA 2MJEA 1E90A 3MHSD 1HA5A 1JMLA 3AI5A 1NEKB 2TSSA 2QSDA 2JZZA 4ZRQA 2MW5A 4HCPB 5IKCM 2WXJA 4GOCA 3AEBB 1J19A 3V61A 3M95A 1WM3A 2QCZA 1XT9B 1Z5SB 2KDFB 5L95C 3N9YC 5H8YE 2M0XA 3TSSA 1FRRA 1N60A 2ONQA 5LNK1 1WF9A 2V3NA 1EWCA 4II3B 2M17A 3NJTA 5G2NA 4LTUA 1CZPA 3PZDA 1WH3A 2FAZA 4DQOC 1XLQA 5EE3A 1WZ0A 2DLBA 2JX5A 2L00B 3Q8EA 4OW0A 2WDTB 3KUCB 2LGXA 4F8CB 4XWWA 1I4RA 4P1BC 3IBEA 2G4DB 3N3KB 1SBBB 4MEMA 4WWMA 1PUTA 3JVZX 2JZ3B 3U30A 2FCMA 2D11A 2BS2B 4WQMA 4ANWA 1XLOA 4YTPB 2AYOB 2MP2B 1FNVA 2KKCA 2DYOA 1M94A 2ZEQA 3VTVA 1YMHE 5TR5A 4HPLB 2QC8A 3R8BA 3IT4B 2IO1B 5E6NA 4XC2A 1SJHD 2H88B 1I35A 4PYUA 3V6CB 3PS6A 1TIFA 2E6XA 2L0TA 3ML8A 2YEPF 3DHGC 2C7MB 1XQQA 3ETRA 4DWFA 1OGWA 4W9EA 4FHKA 3SU8X 1OEYJ 4GB9A 4WIPA 1UNSA 2OHFA 4ZDVA 3RMKC 1NYRA 4CHKA 1OFFA 4W9DA 1JQ4A 1FXAA 2Y5CA 2KMMA 3QA8A 1ZUD2 1F2RC 3AEAB 4II2B 1SIFA 4EZLA 2J0MA 1D4BA 1ESFA 1B9RA 3EA6A 3I9V1 3GP7A 3ZW3A 1CJEA 2WXFA 2ZVNA 5GXGB 3H1UA 4P1CC 5DPSA 2KJRA 2XBBC 4WWNA 5C23A 2R61A 4BAXA 1ISNA 3PVLA 3NZSA 2GBRA 4KGTA 4B95A 5LLIA 1TS3A 5KHQA 4DHJB 4A3OA 4M0WB 1J7CA 2CHZA 1SE4A 4NNJB 4RNAA 2WU2B 4M01A 1PFDA 4MSQB 2G1EA 1K53A 3M3JA 1QLBB 4ZRPA 4A6QA 2LJ5A 3AEFB 2IGDA 4NAWA 4H2AA 3IT6B 1A5RA 2C60A 4C56C 1WGDA 2OJRA 3UF8A 1WE6A 3QAQA 1IP9A 3MP9A 4JWUC 4DXAB 2BKRB 3W2DA 1QZEA 4KDLB 2FE8A 2KDIA 4WJOA 3M62B 2XK5B 3VXWA 5EE9A 1RFAA 4GMVA 3VR8B 3QHTA 2KFJA 3AULA 4DDID 3EECA 2W55A 4A9AA 1IGDA 1WGKA 3B0AA 4MJSB 4IWOA 2L8JA 3APCA 4WH4A 5DPRA 1XXGA 2INPE 3ZXRA 1WGYA 1V5TA 1IUEA 3AEEB 2N9XA 1ZOYB 2JSVX 3BVMA 1P9DU 1RM6C 1L2NA 4MJSA 1V1PA 1CMXB 1WGHA 4ANXA 4GN1A 4K3BA 1ZW7A 4FJZA 2QEJC 1I4PA 1STEA 4JLCA 2XK5A 1DOIA 1E8YA 4RMAA 3WANA 2KWVB 4EOYA 3ZDMC 3TEZA 4YL8A 3OJ4B 2WXIA 3NVVA 3HUIA 4WWPA 1LFDA 3DBRB 3U52E 1WWTA 3P1MA 3N1YC 4IWPA 1G6JA 3CF6E 3P4PB 1JRPA 2MQJA 2N7JA 1NI2A 1WJUA 3U8ZA 3CIRB 3DQVA 4B0MA 2LFIA 4GU2A 5TSSA 1BMLC 2K8BA 1C78A 2BS3B 2MRPA 1L4DB 3KUDB 4K3CA 1TS4A 4WAAA 3TEWA 5FR6A 3RULA 1GJZA 3IAS1 2R2OA 1E10A 4LJOB 4G50A 4US8A 1V1OA 2ICIA 1VDVA 3E56A 2FCSA 1WYWB 4WQOB 4WJPA 3ALBA 1L6VA 2MLBA 3AE8B 1MFWA 3L13A 1VRAB 4IC7B 3TIXA 1J7AA 4DHZB 1AN8A 2IZVB 5IAAC 2WXMA 1YQ3B 4EEWA 3VHTC 1QOFA 3O65B 1XLPA 3VUYA 4GGQA 2XNAC 3AXCA 2J52A 4S17A 3N20C 2LUEA 4NZLB 2IGGA 4PK1A 2K5PA 5E6PA 4GDLA 2YLMA 2LGYA 3QC8B 4DDGD 3RZFA 1FCLA 2RDBC 1RWSA 2AX5A 2WXNA 2BWFA 2DBYA 2AL3A 1L0XB 2MWSB 4AJWA 2N0SB 2MEKA 4YTNB 2L52A 2XN9C 3QX1A 4GDKA 1WJ4A 1SF0A 2ZZPB 3HVDA 2IO2B 3P63A 4YTMB 4IUMB 2MBBB 3RFZB 2V4LA 1NVID 3EFUA 3P4SB 5D94A 3WCQA 3PSEB 4TMAB 2D3GA 3V60A 2KVZA 3TEXA 5HFYA 4MGIE 2M0AA 3SEBA 2KAJA 5CHVC 3ZNZB 1U4AA 5CX3A 1Y8RC 4RF1A 1JROA 2MSED 2DZJA 1C4AA 5BMIA 2OJWA 1E6EB 5BMHA 3W1SC 2LXAA 1YOVB 1BXTA 1LGRA 1SSNA 5BO4B 2QILA 2WXGA 1FXTB 2B76B 4IM3A 2KANA 3HK0A 2KC1A 1MJDA 1RAXA 4KSKC 2WDVB 4WAFA 1V49A 3LDZE 4IG7B 1WYGA 2H89B 1XCQL 2J53A 4C4VA 3R66C 1V6EA 4HKZE 3VRAB 3PT2B 3OG5A 1BT0A 1WMHB 3A9KA 4PS8A 4KKIA 4W9CA 2M56B 1K52A 3UQBA 1E7PB 1KRHA 5FK9C 1MVKA 4R3DA 2LUMA 3L17A 1GC6A 3VUWA 2QHOA 5JZEB 2HTHA 1H8CA 1NENB 2M1MA 1SJED 2HDEA 3UIOB 1EO6A 2LZ6A 4US9A 4C7YA 4XWTA 4OVZA 2KJ6A 2L1AA 2WGSA 2BB5A 3UGBB 2OEDA 2M19A 3B2GA 1AW7A 4KKJA 4GDLB 4JQWC 1TJEA 1RLFA 2EKIA 2FUG1 3ZXVA 3QARA 2EELA 3LXFA 1FFVA 1KH0A 4IWQA 4IM2A 3Q69A 1WMHA 3A9KB 3RN9C 4BOZB 5DPWA 3QJZA 3R3MA 2KVRA 2QMTA 4TV3A 5J2RA 2MHJA 3WAPA 3DBHI 2BTEA 1HE8A 1N62A 3DHIC 1LXDA 1F2RI 2PIAA 4RCOA 2L7RA 2N1VA 1J0GA 1HEZE 3T3NA 1H4RA 1JWBD 3U7ZA 2EMTA 2A5UA 2K6DB 4F7ZA 2Z0DB 3U4EG 3N1ZC 2D3BA 2N1WA 4LNIA 3J9CA 4EZJA 3DPDA 4HRSA 5E6JA 2JWUA 3E9SA 4WJNA 1WGRA 1IPGA 4FJYA 4PS3A 5FR3A 3N30A 4BZAA 2KXJA 3P4RB 2KMCA 2DZIA 1TKGA 2UU7A 4ZRJA 3ZRCA 4KGSA 3I3TB 1PGXA 1QOAA 3L08A 2JYEA 2BWES 3P2BA 2JVCA 1I42A 3AE4B 3DBLI 3EC8A 1TS2A 5G55A 2LGIA 3Q14C 4LNFA 4DK5A 2JWZA 1HTOA 3PGEA 3JSVB 2RMMA 3BZDB 1JWUD 2GBKA 1VZ6A 1VZ8A 4PT5A 5JHBA 2PPHA 4KIKB 4C00A 3RPFC 4ZRIA 1D6EC 3BWUD 3RNEC 1RFKA 1X1MA 1RRBA 1WXQA 2QJLA 3BK2A 1CK1A 3MFGA 1IGCA 4W9HA 2IPKD 5BMGA 1I4GA 2N7DA 5BYSA 2ZNVC 4I6LB 3K9OB 2JUOA 3HVZA 5GMVA 4DXFA 2C7HA 4GDKB 4NQLB 4G3XB 3K9PB 1FIQA 1L0VB 4TQ1A 2Z59B 3DVNV 4ICUA 3JYUA 3Q3NC 2NBWB 1QKZA 1TS5A 2VZKD 1UD7A 2O6VA 2K8CA 1UGMA 1WJNA 3AM9A 4YWGG 2KFKB 4I6PA 2LASA 1E8WA 1C3TA 3GB1A 4ZYSA 1I4XA 2L83A 2L3ZA 2BYVE 2K8HA 1HZ5A 1JALA 1PQSA 3DBHB 4W9JA 2ZJDA 4YXDB 2K9XA 2N9EB 3VR9B 4CO7A 1I4QA 4WURA 2KZRA 4RM8A 1C4PA 1YQ4B 1WXVA 1WXSA 1V1PB 2SAKA 4MELA 4JE3B 1QQRA 3AE9B 3W5VB 3MC8A 3AE3B 5AUIA 1E0ZA 4ANVA 1EUVB 1QOBA 5D6JB 2AQ1B 2Y5PA 3H7SA 2IO0B 3VQIA 4MH0E 4BKSA 3UIPB 2LGSA 2DNFA 4AOFA 2DYBA 2A4ZA 4RGOS 2NTSA 1KTKA 1S1QB 3Q3OC 4W9IA 1XF5L 4MGYE 2BS4B 2WXQA 1FNUA 4JIOU 4C80A 4ZOHC 3IVFA 2LVQA 3CSTA 4IW0A 3ZJVA 4X57B 3RUIB 4D2KA 2IO3B 3BK1A 4K7UA 5AEKB 2BGFA 2VZKB 3H9DA 3I57A 2KLGA 1FCCC 1XEEA 1WZ3A 1TY0A 4ZHOA 1WJ6A 4XZ4A 2JYTA 3RD2A 3EFCA 1KFYB 1YX6B 2KN5A 1TYGB 4DXGA 1PGBA 4BFRA 4P16A 4HXDA 2ACZB 3DVGY 3ONSA 2KTRA 4LK0M 5MPOA 2ZW0A 4WWOA 3H8HA 3ZNID 2GBJA 4RGNA 4BVUC 2PVGC 3V3XA 4M8MA 3NS1A 4JWSC 1T0YA 2ON8A 1V5OA 2L32A 2HTME 4HPMB 2MJ3A 4AP4C 1F0ZA 2UWQA 2D3AA 3HIZA 3PRPB 1UF0A 3Q8BA 4FXCA 4TKNA 2SEBD 3NS8A 2C9WB 3AEGB 4NJ7A 1YX5B 5LXIB 2KWDA 2AL6A 3Q8FA 1ACCA 3URYA 1ZDXA 2J42A 4URKA 2HD5B 3ECIA 2ZVOA 1D5MC 3AE1B 2MJDA 2NTTA 3QIJA 2WDRB 3OAWA 4HCNB 1IBXB 3GE3C 5AZHA 1E9MA 3ENEA 1WSPA 2W54A 1KM7A 5HHDG 2BPSA 3C0RB 4YSXB 1ZXHA 5J17A 1CQVA 5JHAA 3ZTCA 2RSUA 2KC2A 1ZGUB 1ET6A 4NY0A 1SE9A 1ZKHA 3UQAA 3BYTB 4HWIB 5C2TB 3NHEB 2I2YA 2LVOA 3O13A 1ENFA 2RDGA 4FA6A 5G5GA 5D7GA 3Q3FA 4LDTB 2BQQA 2RR9A 1NYQA 3VRBB 1Q0WB 4MT5A 3IG3A 3WALA 2Y5BB 3V05A 2C5LC 4G11A 3ZUNA 2JRHA 1WX8A 1N61A 1MPEA 3IHPC 4HLEA 3PO0A 2CR5A 5L83A 4ZHPA 1XCTL 2N7EA 3NY5A 2I1JA 1MHHE 3KLSX 2OOBB 2XEWA 5CHWA 3DDCB 2MH7A 1UELA 3S2AA 2O2VA 4AUQC 5EDSA 3NVWA 3ZJUA 3T9LA 3Q8AA 1XO3A 2BW2A 1L4ZB 2JU6X 1HQRD 3TUOA 1MI0A 4LNNA 3PRMB 3U7DA 2KOXA 5I4DA 3FILB 2LEKA 3PTFC 5KHOA 4KSLC 4RM9A 2JPHA 3PV1A 1GUAB 3DBRI 3ZO5B 3ZRFA 3BVZA 4K1RB 4XDDA 1KJTA 1NDDA 5EE1A 2BB6A 3SFEB 1WY8A 4KX6B 3OLMD 1NBFC 1TGZB 2NCNA 1GPXA 1WX7A 3GZNI 3GZNB 2Z0EB 3DBSA 4LCDE 3HHMA 3V6EB 1XLNA 1WR6E 4FBJB 1HXYD 2VRRB 1N5XA 2NS5A 3C19A 1E7UA 2RD0A 1GAQB 2KDBA 1OQRA 4RGMA 3VFKA 1KLGD 4P7IA 2V9HA 2N9LA 4N59A 1R7SA 4M02A 3MHZA 1FEHA 2WXKA 2KHWB 3P42A 4FJVB 2M4NA 3NVZA 3R7QA 2KYWA 4XDCA 1EU3A 2JXTA 2KTRB 2LHEA 2LMCA 3PZ8A 3IFWB 2ZPNA 3BY4B 3VTUA 4C7ZA 2KQSA 2LD9A 2JF5A 3A4RA 3VDZA 2CHWA 5IN7A 1BUIC 4KIKA 2INCC 2QIEB 3A33B 1FFUA 4HPPA 3ZQ4A 3R7RA 2W3SA 3D32A 4MGKE 1WRIA 2NPTA 1UH6A 4KV2A 2NBVB 1V86A 1IBXA 3TJPA 2K25A 1L5PA 4L23A 3RNAC 2MBHA 5DPTA 3PREA 1JW9D 2KACA 2G4SA 1HZ6A 1C76A 3UINB 1YN3A 3RT3B 5JXVA 1P7FA 2FBWB 3AV8A 3VVWB 1WR1A 1R4NI 1QOGA 1UGJA 3M63B 3ABVB 2MX2A 2J0KA 2WX0A 1FXIA 4W9LA 3PPAA 4HKQA 3RNGC 4GXBA 1LQBA 1JWMD 1KOTA 3R2TA 1VZ7A 2D2QA 2Y3AA 3H7PA 1QF6A 3AE7B 4KVGB 4HJKA 2W3RA 2X38A 2AQ2B 3AECB 5D3DA 4BBNF 1WFYA 1WI0A 2K6QA 2CU1A 4XX5A 3ZJTA 1IYFA 4F1SA 4AJYB 3AU5A 3KWLA 4L1BA 1NI3A 2GI9A 1GB4A 4OZBA 4HK2A 2W82A 2KK8A 3MC0B 3NZUA 1V97A 2BKFA 2G9HD 1KLVA 4S0RA 3FILA 2V3SA 2YVCA 5J18A 4MACA 4FADA 2DZKA 4FLHA 2D10A 4A8XC 3RNFC 1ZE3D 1D5XC 4AWJA 2WXHA 1V2YA 3MC9A 2IDYA 1VR9A
chains in the Genus database with same CATH topology
4JLCA 2XK5A 3EHVA 1E8YA 4NAWB 2D07B 4RMAA 3CSFA 3OJ3A 4ICVA 2L3ZA 3WANA 2BYVE 2KWVB 3SDLC 3B1LX 4EOYA 2K8HA 4GSWA 1PQSA 1WIAA 3A9JA 4W9JA 2ZJDA 2GMIC 3ZDMC 4YL8A 2N9EB 3W1YA 2UYZB 3QWZB 4EUTA 4DHJD 2EKEC 4I6NB 2LWPA 3OJ4B 5CTRC 4CO7A 1E8ZA 2KZRA 4G0NB 2WYQA 4RM8A 4WWPA 3TMPB 1LFDA 2J7QB 2JT4B 3L10B 3LJ3A 1WXVA 1WXSA 3DVGX 2DENB 2KJHB 5AZFA 1E7VA 3VH4B 5IA7A 4MELA 3SD5A 4HDQA 3A1QB 4OVVA 4IWPA 4IM0A 1G6JA 1YQBA 3CF6E 4HVBA 4ANVA 1EUVB 1OEYA 5D6JB 2GBNA 3H7SA 4FHJA 2IO0B 3VQIA 2MQJA 4MH0E 2B3AA 4BKSA 1NI2A 1WJUA 3UIPB 3U8ZA 2PE6B 3RCZA 3DQVA 2KLCA 1TTNA 4AOFA 2DAFA 4GU2A 2HJ8A 2DYBA 2A4ZA 4E74A 2ZCBA 2LRWA 2WX1A 2K8BA 2PEAA 2MRPA 1K8RB 4B6WA 3KUDB 3PLUA 4BKTA 1R4MI 1MG8A 1S3SG 2MBEA 1S1QB 3DOWA 4W9IA 5D2MB 3A1QA 4WAAA 3ZNGC 2CHXA 4MGYE 5FR6A 4W9GA 3RULA 1GJZA 2RGFA 2ASQA 2R2OA 3VTWA 4JIOU 1YJ1A 3ZIMA 4LJOB 3L54A 4PS7A 3IVFA 3PLVA 4G50A 4A3PA 2LVQA 4JGHB 1VD2A 3X0WA 2KNBA 3PHXB 4ANUA 3QCAA 1GC7A 4MDKE 3CSTA 4IW0A 2FCSA 1WYWB 3ZKJC 4LDTD 1P1AA 4WQOB 4X57B 4WJPA 3ALBA 3RUIB 2G45B 3JW0X 2MLBA 1GG3A 1Q5WB 2IO3B 4K7UA 5AEKB 1GNUA 2BGFA 3KYCD 3QQ8B 2MP2A 2KMAA 3ZVVA 3H9DA 3L13A 4LJPB 4KZCA 1J8CA 3HM3A 2KLGA 3L0WB 4IC7B 5JH5C 4NPNA 3ZDTA 1WZ3A 2FIDA 3TIXA 2JRIB 3QK0A 1WJ6A 4DHZB 4M8NA 2AEHA 4XZ4A 4DHZE 1Z2MA 2BF8B 2IZVB 2R2QA 5IAAC 3RD2A 3ZNHB 1XD3B 4EEWA 2O6VD 4MM3A 4B9KA 2L0FA 2I1KA 3VHTC 3O65B 4FN2A 1YX6B 2JY6A 3VUYA 2FUHB 2KN5A 3Q3JA 3KYDD 4GGQA 3AXCA 4K7WA 2LUEA 4PYZA 3BINA 4BFRA 2CKHB 3TL5A 4A20A 4HXDA 3DVGY 2KO3A 3ONSA 4E3CA 2KTRA 5E6PA 4GDLA 2YLMA 4J6IA 3WAMA 4K81A 2LGYA 2LVPA 4TQ0A 1TZ1A 4WWOA 3SHQA 3QC8B 3TCAA 1OTRB 3ZNID 4DDGD 2KWUB 2GBJA 1UZXB 4BVUC 3RZFA 4M8MA 3N32A 1T0YA 1UBIA 4K7SA 1V5OA 2O6VB 3DVNU 2J0JA 3AU4A 3MJWA 2BWFA 1AARA 4HPMB 3CMMB 4W9FA 4AP4C 4N9F4 2DAJA 2PJHA 2AL3A 2IBIB 3PRZA 2UWQA 4NJ6A 3HIZA 3PRPB 2MWSB 2FCNA 4AJWA 2DYMA 4ZRKA 2NBUA 4TKNA 1WM2A 2ZCCA 3ZLZA 3NS8A 2C9WB 2KX0A 4NJ7A 2IY1B 2FIFA 1YX5B 5LXIB 1YIWA 2AL6A 4DBGA 1E8XA 2LXCA 2HE7A 3QX1A 4URKA 4GDKA 2HD5B 1WJ4A 3ECIA 2ZVOA 2ZZPB 2NVUI 2GBMA 2IO2B 2KFKA 1E90A 3QIJA 3MHSD 2ZNVB 3OAWA 4CYEA 4HCNB 4EZKA 5LXHA 4IUMB 3AI5A 2MBBB 5AZHA 1V9JA 1P0RA 2V4LA 3EFUA 2JZZA 2MW5A 3ENEA 3KUZA 3ZTDA 5D94A 1KM7A 1YD8U 2BPSA 3PSEB 4HCPB 2D3GA 3C0RB 3V60A 5J17A 1P3QU 3VH3B 4GOCA 2EMSA 5JHAA 3ZTCA 2RSUA 1J19A 2KC2A 1ZGUB 3A9JB 3HM6X 4MGIE 2DZMA 4NY0A 1SE9A 3M95A 3V61A 3WIMA 1WM3A 3RYTA 1ZKHA 1XT9B 1Z5SB 2N4FA 1U4AA 5CHVC 1Y8RC 5CX3A 3ZNZB 2KDFB 2MSED 5L95C 3UQAA 2DZJA 2M0XA 4HWIB 1WXAA 2KX3A 3NHEB 2LVOA 3TBLD 1WF9A 3VUXA 4FA6A 4II3B 2M17A 2MBQA 3W1SC 5D7GA 2LXAA 3Q3FA 5G2NA 4LDTB 2K1FA 2RR9A 1V80A 3PZDA 5BO4B 4EFOA 1WH3A 1Q0WB 2FAZA 3W1SA 3IG3A 4WJQA 1WZ0A 1FXTB 3WALA 2Y5BB 2L00B 1WXMA 2C5LC 3A4SC 4G11A 3ZUNA 2JRHA 1WX8A 4IM3A 2KANA 2NR2A 3HK0A 3IHPC 4HLEA 2WDTB 2KC1A 3H6NA 1RAXA 2CR5A 5L83A 4KSKC 3KUCB 2BYFA 2N7EA 3NY5A 2LGXA 4F8CB 2I1JA 1V49A 3LDZE 4MGZE 3IBEA 4IG7B 2OOBB 1LM8B 2XEWA 1EF5A 2G4DB 3N3KB 2RPQA 2M8SA 4MEMA 5CHWA 3DDCB 3JVZX 2IY0B 2JZ3B 3R66C 1V6EA 1UELA 2FCMA 2D11A 3U30A 3PT2B 3S2AA 2O2VA 4AUQC 4ANWA 5EDSA 5CHFA 1JRUA 1BT0A 1C1YB 1WMHB 3A9KA 2AYOB 2MP2B 4GIVA 4KDIC 4PS8A 2KKCA 4W9CA 3PHWB 2DYOA 1M94A 2ZEQA 3UQBA 3PRMB 3U7DA 2KDEB 2KOXA 3T9LA 3VTVA 5TR5A 3L17A 1GC6A 4HPLB 3VUWA 2QHOA 3PTFC 5KHOA 5JZEB 2HTHA 1H8CA 2MBOA 3B08A 4KSLC 4RM9A 2M1MA 2JPHA 3PV1A 1GUAB 3DBRI 3UIOB 2IO1B 1EO6A 3ZO5B 5E6NA 3KW5B 3ZRFA 2LZ6A 4XC2A 3APDA 4K1RB 1I35A 4PYUA 1KJTA 2KJ6A 3GOEA 1NDDA 2K39A 1EF1A 3V6CB 3PS6A 1WY8A 2L0TA 4BBNC 3ML8A 3OLMD 1NBFC 1TGZB 3UGBB 2NCNA 1WRDB 3ML9A 1WX7A 3GZNI 2C7MB 2Z0EB 3DBSA 4LCDE 3HHMA 1XQQA 2KWCA 2LRUA 3V6EB 4DWFA 4GDLB 1OGWA 4JQWC 1WR6E 4W9EA 5E6OA 1RLFA 4FBJB 4FHKA 3QARA 2VRRB 3RZWC 1L7YA 2NS5A 2REXA 1VCBA 3SU8X 1OEYJ 1E7UA 4GB9A 2RD0A 4IWQA 2KTFA 4IM2A 2KDBA 3VAWA 1WMHA 2FCQA 3A9KB 4BOZB 4ZDVA 5DPWA 3VFKA 2JXXA 3QJZA 3R3MA 4CHKA 4P7IA 2KVRA 4W9DA 2MA9B 4TV3A 3WAOA 5J2RA 3WAPA 3DBHI 2KHWB 2W9NA 4FJVB 3QA8A 5HKHA 2M4NA 1HE8A 2N9PC 1LXDA 4II2B 1SIFA 3R7QA 2J0MA 4EZLA 2L7RA 4MSMB 2N1VA 1J0GA 2PE9A 2KTRB 4OVUA 3IFWB 1H4RA 2ZPNA 3BY4B 3VTUA 2KQSA 2EMTA 2LD9A 2A5UA 2JF5A 2K6DB 3A4RA 4HDOA 3ZW3A 3VDZA 2CHWA 4KZ0A 4F7ZA 2Z0DB 2ZVNA 3H1UA 4KIKA 2N1WA 3A33B 5DPSA 2KJRA 2CS4A 4TUUA 2XBBC 2KD0A 4WWNA 5C23A 3R7RA 3DPDA 4EZJA 1V81A 1ISNA 3D32A 4WJNA 3PVLA 4MGKE 5C1ZA 1WGRA 3NZSA 1IPGA 2GBRA 2NPTA 3KH0A 4FJYA 1UH6A 4KV2A 4B95A 2NBVB 4PS3A 1V86A 5LLIA 5KHQA 3N30A 2KQ7A 4DHJB 4A3OA 2KXJA 4M0WB 3DCGA 3TJPA 2K25A 2CHZA 1WGGA 2KMCA 3V62A 3NOBA 1TBEA 4NNJB 2DZIA 2MBHA 5DPTA 3PREA 2L76A 2G4SA 4ZRJA 3ZRCA 3I3TB 2WWZA 4EKUA 4MSQB 3M3JA 3UINB 3RT3B 4BOSC 2LJ5A 3H7PB 3L08A 2BWES 3P2BA 2JVCA 4NAWA 3VVWB 1WR1A 1I42A 2IYDB 1R4NI 4FULA 4W9KA 3M63B 3DBLI 3EC8A 5G55A 1A5RA 2MX2A 2J0KA 2WX0A 2C60A 4NQKE 1WGDA 2OJRA 4W9LA 3UF8A 1WE6A 3L16A 3QAQA 4DK5A 2JWZA 3PPAA 1E5WA 3PGEA 1IP9A 1P98A 3JSVB 4GXBA 1SGHA 1LQBA 2GBKA 1KOTA 1OQYA 4DXAB 2D2QA 2BKRB 5JHBA 2L05A 3H7PA 2FNJB 2MCNB 1QZEA 4HJKA 2PPHA 4KDLB 4KVGB 2AWTA 2KDIA 2LGDA 4KIKB 4WJOA 3M62B 4BBNF 1WFYA 4ZRIA 1WI0A 2XK5B 3T8MA 3VXWA 1WE7A 2K6QA 1RFAA 2O2VB 1WX9A 4GMVA 2CU1A 3QHTA 4XX5A 1X1MA 1RRBA 3X23A 1IYFA 2KFJA 4F1SA 3AULA 4AJYB 4DDID 3EECA 2BYEA 2NPTB 3AU5A 2V1YA 3JSVA 5DCNA 3B0AA 4BKGA 4MJSB 1D3ZA 4IWOA 4W9HA 2L8JA 2GOWA 1F9JA 4ASWC 2N7DA 4HK2A 2ZNVC 4I6LB 2KK8A 2JUOA 3K9OB 5GMVA 1Q1OA 3APCA 3NZUA 2C7HA 3K9PB 4G3XB 4GDKB 4NQLB 3APFA 5DPRA 2BKFA 2DX5B 1WGYA 1KLVA 4TQ1A 2Z59B 1V5TA 2LI5A 2V3SA 2DHZA 3MTNB 2YVCA 3DVNV 2G3QB 4ICUA 2N9XA 3JYUA 5J18A 2NBWB 4FADA 2DZKA 1UD7A 3KVFB 1P9DU 2O6VA 4FLHA 2D10A 4MJSA 4JL9A 2K8CA 1UBQA 4E71A 1L2NA 3WA0A 1UGMA 1WJNA 4BKSD 1CMXB 1WGHA 4ANXA 5AZGA 2KFKB 4GN1A 4AWJA 4I6PA 1V2YA 1ZW7A 2C7NB 4ZYNA 2LASA 4FJZA 2ZPYA 1E8WA 1C3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLC A;  2XK5 A;  3EHV A;  1E8Y A;  4NAW B;  2D07 B;  4RMA A;  3CSF A;  3OJ3 A;  4ICV A;  2L3Z A;  3WAN A;  2BYV E;  2KWV B;  3SDL C;  3B1L X;  4EOY A;  2K8H A;  4GSW A;  1PQS A;  1WIA A;  3A9J A;  4W9J A;  2ZJD A;  2GMI C;  3ZDM C;  4YL8 A;  2N9E B;  3W1Y A;  2UYZ B;  3QWZ B;  4EUT A;  4DHJ D;  2EKE C;  4I6N B;  2LWP A;  3OJ4 B;  5CTR C;  4CO7 A;  1E8Z A;  2KZR A;  4G0N B;  2WYQ A;  4RM8 A;  4WWP A;  3TMP B;  1LFD A;  2J7Q B;  2JT4 B;  3L10 B;  3LJ3 A;  1WXV A;  1WXS A;  3DVG X;  2DEN B;  2KJH B;  5AZF A;  1E7V A;  3VH4 B;  5IA7 A;  4MEL A;  3SD5 A;  4HDQ A;  3A1Q B;  4OVV A;  4IWP A;  4IM0 A;  1G6J A;  1YQB A;  3CF6 E;  4HVB A;  4ANV A;  1EUV B;  1OEY A;  5D6J B;  2GBN A;  3H7S A;  4FHJ A;  2IO0 B;  3VQI A;  2MQJ A;  4MH0 E;  2B3A A;  4BKS A;  1NI2 A;  1WJU A;  3UIP B;  3U8Z A;  2PE6 B;  3RCZ A;  3DQV A;  2KLC A;  1TTN A;  4AOF A;  2DAF A;  4GU2 A;  2HJ8 A;  2DYB A;  2A4Z A;  4E74 A;  2ZCB A;  2LRW A;  2WX1 A;  2K8B A;  2PEA A;  2MRP A;  1K8R B;  4B6W A;  3KUD B;  3PLU A;  4BKT A;  1R4M I;  1MG8 A;  1S3S G;  2MBE A;  1S1Q B;  3DOW A;  4W9I A;  5D2M B;  3A1Q A;  4WAA A;  3ZNG C;  2CHX A;  4MGY E;  5FR6 A;  4W9G A;  3RUL A;  1GJZ A;  2RGF A;  2ASQ A;  2R2O A;  3VTW A;  4JIO U;  1YJ1 A;  3ZIM A;  4LJO B;  3L54 A;  4PS7 A;  3IVF A;  3PLV A;  4G50 A;  4A3P A;  2LVQ A;  4JGH B;  1VD2 A;  3X0W A;  2KNB A;  3PHX B;  4ANU A;  3QCA A;  1GC7 A;  4MDK E;  3CST A;  4IW0 A;  2FCS A;  1WYW B;  3ZKJ C;  4LDT D;  1P1A A;  4WQO B;  4X57 B;  4WJP A;  3ALB A;  3RUI B;  2G45 B;  3JW0 X;  2MLB A;  1GG3 A;  1Q5W B;  2IO3 B;  4K7U A;  5AEK B;  1GNU A;  2BGF A;  3KYC D;  3QQ8 B;  2MP2 A;  2KMA A;  3ZVV A;  3H9D A;  3L13 A;  4LJP B;  4KZC A;  1J8C A;  3HM3 A;  2KLG A;  3L0W B;  4IC7 B;  5JH5 C;  4NPN A;  3ZDT A;  1WZ3 A;  2FID A;  3TIX A;  2JRI B;  3QK0 A;  1WJ6 A;  4DHZ B;  4M8N A;  2AEH A;  4XZ4 A;  4DHZ E;  1Z2M A;  2BF8 B;  2IZV B;  2R2Q A;  5IAA C;  3RD2 A;  3ZNH B;  1XD3 B;  4EEW A;  2O6V D;  4MM3 A;  4B9K A;  2L0F A;  2I1K A;  3VHT C;  3O65 B;  4FN2 A;  1YX6 B;  2JY6 A;  3VUY A;  2FUH B;  2KN5 A;  3Q3J A;  3KYD D;  4GGQ A;  3AXC A;  4K7W A;  2LUE A;  4PYZ A;  3BIN A;  4BFR A;  2CKH B;  3TL5 A;  4A20 A;  4HXD A;  3DVG Y;  2KO3 A;  3ONS A;  4E3C A;  2KTR A;  5E6P A;  4GDL A;  2YLM A;  4J6I A;  3WAM A;  4K81 A;  2LGY A;  2LVP A;  4TQ0 A;  1TZ1 A;  4WWO A;  3SHQ A;  3QC8 B;  3TCA A;  1OTR B;  3ZNI D;  4DDG D;  2KWU B;  2GBJ A;  1UZX B;  4BVU C;  3RZF A;  4M8M A;  3N32 A;  1T0Y A;  1UBI A;  4K7S A;  1V5O A;  2O6V B;  3DVN U;  2J0J A;  3AU4 A;  3MJW A;  2BWF A;  1AAR A;  4HPM B;  3CMM B;  4W9F A;  4AP4 C;  4N9F 4;  2DAJ A;  2PJH A;  2AL3 A;  2IBI B;  3PRZ A;  2UWQ A;  4NJ6 A;  3HIZ A;  3PRP B;  2MWS B;  2FCN A;  4AJW A;  2DYM A;  4ZRK A;  2NBU A;  4TKN A;  1WM2 A;  2ZCC A;  3ZLZ A;  3NS8 A;  2C9W B;  2KX0 A;  4NJ7 A;  2IY1 B;  2FIF A;  1YX5 B;  5LXI B;  1YIW A;  2AL6 A;  4DBG A;  1E8X A;  2LXC A;  2HE7 A;  3QX1 A;  4URK A;  4GDK A;  2HD5 B;  1WJ4 A;  3ECI A;  2ZVO A;  2ZZP B;  2NVU I;  2GBM A;  2IO2 B;  2KFK A;  1E90 A;  3QIJ A;  3MHS D;  2ZNV B;  3OAW A;  4CYE A;  4HCN B;  4EZK A;  5LXH A;  4IUM B;  3AI5 A;  2MBB B;  5AZH A;  1V9J A;  1P0R A;  2V4L A;  3EFU A;  2JZZ A;  2MW5 A;  3ENE A;  3KUZ A;  3ZTD A;  5D94 A;  1KM7 A;  1YD8 U;  2BPS A;  3PSE B;  4HCP B;  2D3G A;  3C0R B;  3V60 A;  5J17 A;  1P3Q U;  3VH3 B;  4GOC A;  2EMS A;  5JHA A;  3ZTC A;  2RSU A;  1J19 A;  2KC2 A;  1ZGU B;  3A9J B;  3HM6 X;  4MGI E;  2DZM A;  4NY0 A;  1SE9 A;  3M95 A;  3V61 A;  3WIM A;  1WM3 A;  3RYT A;  1ZKH A;  1XT9 B;  1Z5S B;  2N4F A;  1U4A A;  5CHV C;  1Y8R C;  5CX3 A;  3ZNZ B;  2KDF B;  2MSE D;  5L95 C;  3UQA A;  2DZJ A;  2M0X A;  4HWI B;  1WXA A;  2KX3 A;  3NHE B;  2LVO A;  3TBL D;  1WF9 A;  3VUX A;  4FA6 A;  4II3 B;  2M17 A;  2MBQ A;  3W1S C;  5D7G A;  2LXA A;  3Q3F A;  5G2N A;  4LDT B;  2K1F A;  2RR9 A;  1V80 A;  3PZD A;  5BO4 B;  4EFO A;  1WH3 A;  1Q0W B;  2FAZ A;  3W1S A;  3IG3 A;  4WJQ A;  1WZ0 A;  1FXT B;  3WAL A;  2Y5B B;  2L00 B;  1WXM A;  2C5L C;  3A4S C;  4G11 A;  3ZUN A;  2JRH A;  1WX8 A;  4IM3 A;  2KAN A;  2NR2 A;  3HK0 A;  3IHP C;  4HLE A;  2WDT B;  2KC1 A;  3H6N A;  1RAX A;  2CR5 A;  5L83 A;  4KSK C;  3KUC B;  2BYF A;  2N7E A;  3NY5 A;  2LGX A;  4F8C B;  2I1J A;  1V49 A;  3LDZ E;  4MGZ E;  3IBE A;  4IG7 B;  2OOB B;  1LM8 B;  2XEW A;  1EF5 A;  2G4D B;  3N3K B;  2RPQ A;  2M8S A;  4MEM A;  5CHW A;  3DDC B;  3JVZ X;  2IY0 B;  2JZ3 B;  3R66 C;  1V6E A;  1UEL A;  2FCM A;  2D11 A;  3U30 A;  3PT2 B;  3S2A A;  2O2V A;  4AUQ C;  4ANW A;  5EDS A;  5CHF A;  1JRU A;  1BT0 A;  1C1Y B;  1WMH B;  3A9K A;  2AYO B;  2MP2 B;  4GIV A;  4KDI C;  4PS8 A;  2KKC A;  4W9C A;  3PHW B;  2DYO A;  1M94 A;  2ZEQ A;  3UQB A;  3PRM B;  3U7D A;  2KDE B;  2KOX A;  3T9L A;  3VTV A;  5TR5 A;  3L17 A;  1GC6 A;  4HPL B;  3VUW A;  2QHO A;  3PTF C;  5KHO A;  5JZE B;  2HTH A;  1H8C A;  2MBO A;  3B08 A;  4KSL C;  4RM9 A;  2M1M A;  2JPH A;  3PV1 A;  1GUA B;  3DBR I;  3UIO B;  2IO1 B;  1EO6 A;  3ZO5 B;  5E6N A;  3KW5 B;  3ZRF A;  2LZ6 A;  4XC2 A;  3APD A;  4K1R B;  1I35 A;  4PYU A;  1KJT A;  2KJ6 A;  3GOE A;  1NDD A;  2K39 A;  1EF1 A;  3V6C B;  3PS6 A;  1WY8 A;  2L0T A;  4BBN C;  3ML8 A;  3OLM D;  1NBF C;  1TGZ B;  3UGB B;  2NCN A;  1WRD B;  3ML9 A;  1WX7 A;  3GZN I;  2C7M B;  2Z0E B;  3DBS A;  4LCD E;  3HHM A;  1XQQ A;  2KWC A;  2LRU A;  3V6E B;  4DWF A;  4GDL B;  1OGW A;  4JQW C;  1WR6 E;  4W9E A;  5E6O A;  1RLF A;  4FBJ B;  4FHK A;  3QAR A;  2VRR B;  3RZW C;  1L7Y A;  2NS5 A;  2REX A;  1VCB A;  3SU8 X;  1OEY J;  1E7U A;  4GB9 A;  2RD0 A;  4IWQ A;  2KTF A;  4IM2 A;  2KDB A;  3VAW A;  1WMH A;  2FCQ A;  3A9K B;  4BOZ B;  4ZDV A;  5DPW A;  3VFK A;  2JXX A;  3QJZ A;  3R3M A;  4CHK A;  4P7I A;  2KVR A;  4W9D A;  2MA9 B;  4TV3 A;  3WAO A;  5J2R A;  3WAP A;  3DBH I;  2KHW B;  2W9N A;  4FJV B;  3QA8 A;  5HKH A;  2M4N A;  1HE8 A;  2N9P C;  1LXD A;  4II2 B;  1SIF A;  3R7Q A;  2J0M A;  4EZL A;  2L7R A;  4MSM B;  2N1V A;  1J0G A;  2PE9 A;  2KTR B;  4OVU A;  3IFW B;  1H4R A;  2ZPN A;  3BY4 B;  3VTU A;  2KQS A;  2EMT A;  2LD9 A;  2A5U A;  2JF5 A;  2K6D B;  3A4R A;  4HDO A;  3ZW3 A;  3VDZ A;  2CHW A;  4KZ0 A;  4F7Z A;  2Z0D B;  2ZVN A;  3H1U A;  4KIK A;  2N1W A;  3A33 B;  5DPS A;  2KJR A;  2CS4 A;  4TUU A;  2XBB C;  2KD0 A;  4WWN A;  5C23 A;  3R7R A;  3DPD A;  4EZJ A;  1V81 A;  1ISN A;  3D32 A;  4WJN A;  3PVL A;  4MGK E;  5C1Z A;  1WGR A;  3NZS A;  1IPG A;  2GBR A;  2NPT A;  3KH0 A;  4FJY A;  1UH6 A;  4KV2 A;  4B95 A;  2NBV B;  4PS3 A;  1V86 A;  5LLI A;  5KHQ A;  3N30 A;  2KQ7 A;  4DHJ B;  4A3O A;  2KXJ A;  4M0W B;  3DCG A;  3TJP A;  2K25 A;  2CHZ A;  1WGG A;  2KMC A;  3V62 A;  3NOB A;  1TBE A;  4NNJ B;  2DZI A;  2MBH A;  5DPT A;  3PRE A;  2L76 A;  2G4S A;  4ZRJ A;  3ZRC A;  3I3T B;  2WWZ A;  4EKU A;  4MSQ B;  3M3J A;  3UIN B;  3RT3 B;  4BOS C;  2LJ5 A;  3H7P B;  3L08 A;  2BWE S;  3P2B A;  2JVC A;  4NAW A;  3VVW B;  1WR1 A;  1I42 A;  2IYD B;  1R4N I;  4FUL A;  4W9K A;  3M63 B;  3DBL I;  3EC8 A;  5G55 A;  1A5R A;  2MX2 A;  2J0K A;  2WX0 A;  2C60 A;  4NQK E;  1WGD A;  2OJR A;  4W9L A;  3UF8 A;  1WE6 A;  3L16 A;  3QAQ A;  4DK5 A;  2JWZ A;  3PPA A;  1E5W A;  3PGE A;  1IP9 A;  1P98 A;  3JSV B;  4GXB A;  1SGH A;  1LQB A;  2GBK A;  1KOT A;  1OQY A;  4DXA B;  2D2Q A;  2BKR B;  5JHB A;  2L05 A;  3H7P A;  2FNJ B;  2MCN B;  1QZE A;  4HJK A;  2PPH A;  4KDL B;  4KVG B;  2AWT A;  2KDI A;  2LGD A;  4KIK B;  4WJO A;  3M62 B;  4BBN F;  1WFY A;  4ZRI A;  1WI0 A;  2XK5 B;  3T8M A;  3VXW A;  1WE7 A;  2K6Q A;  1RFA A;  2O2V B;  1WX9 A;  4GMV A;  2CU1 A;  3QHT A;  4XX5 A;  1X1M A;  1RRB A;  3X23 A;  1IYF A;  2KFJ A;  4F1S A;  3AUL A;  4AJY B;  4DDI D;  3EEC A;  2BYE A;  2NPT B;  3AU5 A;  2V1Y A;  3JSV A;  5DCN A;  3B0A A;  4BKG A;  4MJS B;  1D3Z A;  4IWO A;  4W9H A;  2L8J A;  2GOW A;  1F9J A;  4ASW C;  2N7D A;  4HK2 A;  2ZNV C;  4I6L B;  2KK8 A;  2JUO A;  3K9O B;  5GMV A;  1Q1O A;  3APC A;  3NZU A;  2C7H A;  3K9P B;  4G3X B;  4GDK B;  4NQL B;  3APF A;  5DPR A;  2BKF A;  2DX5 B;  1WGY A;  1KLV A;  4TQ1 A;  2Z59 B;  1V5T A;  2LI5 A;  2V3S A;  2DHZ A;  3MTN B;  2YVC A;  3DVN V;  2G3Q B;  4ICU A;  2N9X A;  3JYU A;  5J18 A;  2NBW B;  4FAD A;  2DZK A;  1UD7 A;  3KVF B;  1P9D U;  2O6V A;  4FLH A;  2D10 A;  4MJS A;  4JL9 A;  2K8C A;  1UBQ A;  4E71 A;  1L2N A;  3WA0 A;  1UGM A;  1WJN A;  4BKS D;  1CMX B;  1WGH A;  4ANX A;  5AZG A;  2KFK B;  4GN1 A;  4AWJ A;  4I6P A;  1V2Y A;  1ZW7 A;  2C7N B;  4ZYN A;  2LAS A;  4FJZ A;  2ZPY A;  1E8W A;  1C3T A; 
#chains in the Genus database with same CATH topology
 3EHV A;  2PVO D;  4NAW B;  3CSF A;  3OJ3 A;  4ICV A;  4GSW A;  3A9J A;  3KWV A;  2GMI C;  4EUT A;  2EKE C;  4I6N B;  5CTR C;  1MG4 A;  5HI1 A;  4AQ7 A;  1EWY C;  2J7Q B;  3L10 B;  1TKY A;  3LJ3 A;  2WP9 B;  3DVG X;  2DEN B;  5AZF A;  3SD5 A;  1M4V A;  4OVV A;  4IM0 A;  2WU5 B;  4USA A;  4HVB A;  1OEY A;  2GBN A;  4FHJ A;  2VH1 A;  3EGR A;  1T3Q A;  4LNO A;  2KLC A;  1TY2 A;  2DAF A;  1SB3 C;  2INN E;  4E74 A;  2LRW A;  2WX1 A;  2GLS A;  1K8R B;  3DOW A;  2BYT A;  2BT6 A;  3ZNG C;  2CHX A;  1JWS D;  3VTW A;  1YJ1 A;  4PS7 A;  1ZDV A;  4B0E A;  4A3P A;  4ANU A;  1FPY A;  4LLG M;  3B2F A;  3PHX B;  3X0W A;  3T3O A;  3QCA A;  1GC7 A;  3ZKJ C;  1KF6 B;  3AE5 B;  1EU4 A;  1JWA D;  2G45 B;  4N58 A;  5FKA C;  3RNC C;  3KYC D;  3QQ8 B;  3U2S C;  2KMA A;  3DWG C;  3ZVV A;  4LJP B;  4KZC A;  1J8C A;  3RI7 C;  3L0W B;  4NPN A;  1QT9 A;  2FID A;  1K50 A;  2JRI B;  1EM7 A;  3QK0 A;  1GOZ A;  2BF8 B;  3Q3M C;  2R2Q A;  3ZNH B;  4MM3 A;  3PZ7 A;  2JY6 A;  3KYD D;  1ET9 A;  5H92 C;  3Q8C A;  3BIN A;  2PW9 A;  2E3T A;  3TL5 A;  4AS1 A;  1OQQ A;  3WAM A;  4J6I A;  4TQ0 A;  1FNW A;  1VJK A;  1C9F A;  2JQR B;  1UZX B;  4ARI A;  2LJI A;  3OWE B;  4P6V F;  3N32 A;  1DOY A;  1UBI A;  2NMQ A;  2K3U A;  2O6V B;  4W9F A;  3CMM B;  4N6E B;  2PJH A;  1T0Q C;  2IBI B;  3PRZ A;  4NJ6 A;  2WXP A;  2FCN A;  4ZRK A;  2NBU A;  3ZLZ A;  3AE2 B;  3EUB 2;  2IY1 B;  2FIF A;  1I4H A;  4Q2J A;  4EE2 A;  2LXC A;  3IAM 1;  2V0G A;  2WS3 B;  1C79 A;  3NUH B;  2NVU I;  2GBM A;  2KFK A;  2ZNV B;  4CYE A;  3NVY A;  4EZK A;  1F77 A;  5LXH A;  3NZ3 A;  1SIJ A;  2X8X X;  2VH2 A;  1PDX A;  4HRO A;  3P4Q B;  1V9J A;  1P0R A;  4GLS C;  3KUZ A;  1YJI A;  1PGA A;  4MH8 A;  3ZTD A;  1YD8 U;  1SXT A;  1ZP0 B;  1F52 A;  1P3Q U;  3DBL B;  3VH3 B;  2JZP A;  2EMS A;  1SE2 A;  3A9J B;  3HM6 X;  2DZM A;  4XGA B;  4HEA 1;  4O1N A;  4REZ A;  3WIM A;  1SEB D;  5BYR A;  2RDH A;  3RYT A;  1J7B A;  2N4F A;  2I38 A;  4RH6 A;  2PMV A;  1WXA A;  2KX3 A;  4C4V B;  3TBL D;  3VUX A;  2MBQ A;  2QDF A;  3AH7 A;  2K1F A;  5C3J B;  1V80 A;  2HJ1 A;  4EFO A;  2Q5W D;  3DWM A;  3W1S A;  4L2Y A;  4WJQ A;  4OZC A;  1WXM A;  3A4S C;  2NR2 A;  3H6N A;  1JCK B;  2BYF A;  2V4I B;  4YSY B;  4MGZ E;  3I5J C;  1QIL A;  3MJ5 A;  1LM8 B;  1EF5 A;  2RPQ A;  2M8S A;  2IGH A;  1ZXI A;  2IY0 B;  3NRZ A;  1K51 A;  5CHF A;  1JRU A;  1C1Y B;  3B9J A;  4KDI C;  4GIV A;  2KN4 A;  3PHW B;  2RPV A;  1N63 A;  2KDE B;  1YN5 A;  1ROE A;  5AUK A;  1KLU D;  2IJ0 A;  2MBO A;  3B08 A;  2PTL A;  3KQ4 A;  2KT7 A;  3KW5 B;  3GS2 A;  3AN1 A;  4RFB A;  3APD A;  3UI3 A;  3GOE A;  2K39 A;  1EF1 A;  4BBN C;  1AWD A;  1WRD B;  3ML9 A;  2KWC A;  2LRU A;  1V8C A;  5E6O A;  2D5G A;  4XYC A;  4UDU C;  3RZW C;  1Q10 A;  1L7Y A;  2REX A;  1VCB A;  1FRD A;  3VAW A;  2KTF A;  2FCQ A;  3BYY B;  1I7H A;  2LHD A;  4M0W A;  2JXX A;  5T8I A;  1F1H A;  4MM3 B;  1YJJ A;  2MA9 B;  3WAO A;  1PYW D;  2W9N A;  1T0S C;  5HKH A;  4KGR A;  2N9P C;  2ZW1 A;  4NJC A;  4OZA A;  2GB1 A;  4MSM B;  2CJO A;  3BII D;  2PE9 A;  4IKG A;  4OVU A;  1TKE A;  2WXL A;  3FC4 A;  4HDO A;  4KZ0 A;  2CS4 A;  4TUU A;  2KD0 A;  1V81 A;  4TSS A;  5C1Z A;  1YN4 A;  3GE8 C;  3KH0 A;  1T6B X;  2KQ7 A;  1UWM A;  3LB8 C;  3DCG A;  3V62 A;  1WGG A;  3NOB A;  1TBE A;  3W5U B;  2L76 A;  5IO9 A;  5G5H A;  2K22 A;  2WWZ A;  4EKU A;  4BOS C;  1N5W A;  4HJG E;  3H7P B;  4YT0 B;  1LO5 D;  2IYD B;  3CWI A;  4FUL A;  4W9K A;  3AED B;  2K0P A;  4NQK E;  3L16 A;  4RF0 A;  1DYQ A;  1E5W A;  4JPS A;  1P98 A;  1HTQ A;  1SGH A;  3BVG A;  5IOI A;  1OQY A;  1ZPS A;  4XE0 A;  2KQ4 X;  2L05 A;  2D3C A;  2FNJ B;  4CQN A;  2MCN B;  2AWT A;  3R2I A;  2LGD A;  1L0Y B;  3T8M A;  1WE7 A;  2O2V B;  1WX9 A;  4RGT A;  3X23 A;  3AE6 B;  2BYE A;  2NPT B;  2V1Y A;  3FKY A;  3JSV A;  5DCN A;  4BKG A;  1D3Z A;  4M00 A;  2GOW A;  1F9J A;  1FMA D;  4ASW C;  3C8Y A;  2CJN A;  1B1Z A;  1Q1O A;  1A70 A;  3APF A;  1SE3 A;  2DX5 B;  2LI5 A;  3MTN B;  2DHZ A;  4ITK A;  4YSZ B;  2G3Q B;  4LNK A;  3LYY A;  1L6U A;  3KVF B;  4JL9 A;  4E71 A;  1UBQ A;  3WA0 A;  5BYQ A;  4BKS D;  5IP4 D;  2YEP B;  5AZG A;  1AYF A;  2C7N B;  4ZYN A;  2ZPY A;  4JX1 C;  1D5Z C;  3AMZ A;  3Q2A C;  1DGJ A;  2D07 B;  3SDL C;  3B1L X;  2WHI A;  1WIA A;  2CU3 A;  1DOX A;  1FD6 A;  1YNT E;  3W1Y A;  2UYZ B;  3NG0 A;  3QWZ B;  2AQ3 B;  4DHJ D;  2LWP A;  2BBC A;  2N9K A;  1E8Z A;  4QAY A;  4G0N B;  2WYQ A;  3TMP B;  2JT4 B;  3L4P A;  2KDM A;  2GRI A;  1R4M B;  2KJH B;  1E7V A;  3VH4 B;  2Z8L A;  5IA7 A;  1N6Z A;  4HDQ A;  3A1Q B;  1YQB A;  4OHJ A;  3FAH A;  2IND C;  2B3A A;  4ACF A;  2PE6 B;  2WQY B;  3I63 C;  3RCZ A;  3N1X C;  1TTN A;  3ZGZ A;  2HJ8 A;  2ZCB A;  2PEA A;  4IOI E;  4B6W A;  3PLU A;  4BKT A;  1R4M I;  1MG8 A;  1S3S G;  2MBE A;  4ARC A;  2DWQ A;  5D2M B;  2WXR A;  3A1Q A;  2PLP A;  1R4N B;  2WLB A;  4W9G A;  2WDQ B;  2V3P A;  4IDI A;  2J4X A;  2RGF A;  2ASQ A;  5EE0 A;  3ZIM A;  4J3O D;  3L54 A;  3AB5 A;  3PLV A;  4JGH B;  1VD2 A;  2KNB A;  1MHX A;  4MDK E;  4NAM A;  1VLB A;  4LDT D;  1P1A A;  1C77 A;  3JW0 X;  1GG3 A;  1Q5W B;  1UUP A;  1GNU A;  2MP2 A;  3HM3 A;  1TT5 B;  3RNB C;  3SFD B;  5JH5 C;  3ZDT A;  4A90 A;  1T0R C;  3TEY A;  4M8N A;  2AEH A;  4DHZ E;  1Z2M A;  3SR6 A;  3W9C B;  1C4C A;  1XD3 B;  2O6V D;  4B9K A;  2L0F A;  2I1K A;  1UWX A;  4FN2 A;  3HRD D;  3DHH C;  2FUH B;  3Q3J A;  4K7W A;  4PYZ A;  1FM0 D;  2CKH B;  4A20 A;  2KO3 A;  4E3C A;  1GB1 A;  3ZYY X;  4K81 A;  2LVP A;  1TZ1 A;  3SHQ A;  3TCA A;  1OTR B;  2KWU B;  1TZO A;  3Q6B A;  4K7S A;  3DVN U;  2J0J A;  3AU4 A;  3MJW A;  1AAR A;  1Y56 A;  2PKO A;  2BVC A;  4N9F 4;  1T5X D;  2DAJ A;  4A55 A;  1FO4 A;  5HG2 A;  2WNM A;  1RYJ A;  5D3I B;  2DYM A;  2WXO A;  1WM2 A;  2ZCC A;  3IXS A;  2KX0 A;  1YIW A;  4DBG A;  1E8X A;  2HE7 A;  1P7E A;  2MJE A;  1E90 A;  3MHS D;  1HA5 A;  1JML A;  3AI5 A;  1NEK B;  2TSS A;  2QSD A;  2JZZ A;  4ZRQ A;  2MW5 A;  4HCP B;  5IKC M;  2WXJ A;  4GOC A;  3AEB B;  1J19 A;  3V61 A;  3M95 A;  1WM3 A;  2QCZ A;  1XT9 B;  1Z5S B;  2KDF B;  5L95 C;  3N9Y C;  5H8Y E;  2M0X A;  3TSS A;  1FRR A;  1N60 A;  2ONQ A;  5LNK 1;  1WF9 A;  2V3N A;  1EWC A;  4II3 B;  2M17 A;  3NJT A;  5G2N A;  4LTU A;  1CZP A;  3PZD A;  1WH3 A;  2FAZ A;  4DQO C;  1XLQ A;  5EE3 A;  1WZ0 A;  2DLB A;  2JX5 A;  2L00 B;  3Q8E A;  4OW0 A;  2WDT B;  3KUC B;  2LGX A;  4F8C B;  4XWW A;  1I4R A;  4P1B C;  3IBE A;  2G4D B;  3N3K B;  1SBB B;  4MEM A;  4WWM A;  1PUT A;  3JVZ X;  2JZ3 B;  3U30 A;  2FCM A;  2D11 A;  2BS2 B;  4WQM A;  4ANW A;  1XLO A;  4YTP B;  2AYO B;  2MP2 B;  1FNV A;  2KKC A;  2DYO A;  1M94 A;  2ZEQ A;  3VTV A;  1YMH E;  5TR5 A;  4HPL B;  2QC8 A;  3R8B A;  3IT4 B;  2IO1 B;  5E6N A;  4XC2 A;  1SJH D;  2H88 B;  1I35 A;  4PYU A;  3V6C B;  3PS6 A;  1TIF A;  2E6X A;  2L0T A;  3ML8 A;  2YEP F;  3DHG C;  2C7M B;  1XQQ A;  3ETR A;  4DWF A;  1OGW A;  4W9E A;  4FHK A;  3SU8 X;  1OEY J;  4GB9 A;  4WIP A;  1UNS A;  2OHF A;  4ZDV A;  3RMK C;  1NYR A;  4CHK A;  1OFF A;  4W9D A;  1JQ4 A;  1FXA A;  2Y5C A;  2KMM A;  3QA8 A;  1ZUD 2;  1F2R C;  3AEA B;  4II2 B;  1SIF A;  4EZL A;  2J0M A;  1D4B A;  1ESF A;  1B9R A;  3EA6 A;  3I9V 1;  3GP7 A;  3ZW3 A;  1CJE A;  2WXF A;  2ZVN A;  5GXG B;  3H1U A;  4P1C C;  5DPS A;  2KJR A;  2XBB C;  4WWN A;  5C23 A;  2R61 A;  4BAX A;  1ISN A;  3PVL A;  3NZS A;  2GBR A;  4KGT A;  4B95 A;  5LLI A;  1TS3 A;  5KHQ A;  4DHJ B;  4A3O A;  4M0W B;  1J7C A;  2CHZ A;  1SE4 A;  4NNJ B;  4RNA A;  2WU2 B;  4M01 A;  1PFD A;  4MSQ B;  2G1E A;  1K53 A;  3M3J A;  1QLB B;  4ZRP A;  4A6Q A;  2LJ5 A;  3AEF B;  2IGD A;  4NAW A;  4H2A A;  3IT6 B;  1A5R A;  2C60 A;  4C56 C;  1WGD A;  2OJR A;  3UF8 A;  1WE6 A;  3QAQ A;  1IP9 A;  3MP9 A;  4JWU C;  4DXA B;  2BKR B;  3W2D A;  1QZE A;  4KDL B;  2FE8 A;  2KDI A;  4WJO A;  3M62 B;  2XK5 B;  3VXW A;  5EE9 A;  1RFA A;  4GMV A;  3VR8 B;  3QHT A;  2KFJ A;  3AUL A;  4DDI D;  3EEC A;  2W55 A;  4A9A A;  1IGD A;  1WGK A;  3B0A A;  4MJS B;  4IWO A;  2L8J A;  3APC A;  4WH4 A;  5DPR A;  1XXG A;  2INP E;  3ZXR A;  1WGY A;  1V5T A;  1IUE A;  3AEE B;  2N9X A;  1ZOY B;  2JSV X;  3BVM A;  1P9D U;  1RM6 C;  1L2N A;  4MJS A;  1V1P A;  1CMX B;  1WGH A;  4ANX A;  4GN1 A;  4K3B A;  1ZW7 A;  4FJZ A;  2QEJ C;  1I4P A;  1STE A;  4JLC A;  2XK5 A;  1DOI A;  1E8Y A;  4RMA A;  3WAN A;  2KWV B;  4EOY A;  3ZDM C;  3TEZ A;  4YL8 A;  3OJ4 B;  2WXI A;  3NVV A;  3HUI A;  4WWP A;  1LFD A;  3DBR B;  3U52 E;  1WWT A;  3P1M A;  3N1Y C;  4IWP A;  1G6J A;  3CF6 E;  3P4P B;  1JRP A;  2MQJ A;  2N7J A;  1NI2 A;  1WJU A;  3U8Z A;  3CIR B;  3DQV A;  4B0M A;  2LFI A;  4GU2 A;  5TSS A;  1BML C;  2K8B A;  1C78 A;  2BS3 B;  2MRP A;  1L4D B;  3KUD B;  4K3C A;  1TS4 A;  4WAA A;  3TEW A;  5FR6 A;  3RUL A;  1GJZ A;  3IAS 1;  2R2O A;  1E10 A;  4LJO B;  4G50 A;  4US8 A;  1V1O A;  2ICI A;  1VDV A;  3E56 A;  2FCS A;  1WYW B;  4WQO B;  4WJP A;  3ALB A;  1L6V A;  2MLB A;  3AE8 B;  1MFW A;  3L13 A;  1VRA B;  4IC7 B;  3TIX A;  1J7A A;  4DHZ B;  1AN8 A;  2IZV B;  5IAA C;  2WXM A;  1YQ3 B;  4EEW A;  3VHT C;  1QOF A;  3O65 B;  1XLP A;  3VUY A;  4GGQ A;  2XNA C;  3AXC A;  2J52 A;  4S17 A;  3N20 C;  2LUE A;  4NZL B;  2IGG A;  4PK1 A;  2K5P A;  5E6P A;  4GDL A;  2YLM A;  2LGY A;  3QC8 B;  4DDG D;  3RZF A;  1FCL A;  2RDB C;  1RWS A;  2AX5 A;  2WXN A;  2BWF A;  2DBY A;  2AL3 A;  1L0X B;  2MWS B;  4AJW A;  2N0S B;  2MEK A;  4YTN B;  2L52 A;  2XN9 C;  3QX1 A;  4GDK A;  1WJ4 A;  1SF0 A;  2ZZP B;  3HVD A;  2IO2 B;  3P63 A;  4YTM B;  4IUM B;  2MBB B;  3RFZ B;  2V4L A;  1NVI D;  3EFU A;  3P4S B;  5D94 A;  3WCQ A;  3PSE B;  4TMA B;  2D3G A;  3V60 A;  2KVZ A;  3TEX A;  5HFY A;  4MGI E;  2M0A A;  3SEB A;  2KAJ A;  5CHV C;  3ZNZ B;  1U4A A;  5CX3 A;  1Y8R C;  4RF1 A;  1JRO A;  2MSE D;  2DZJ A;  1C4A A;  5BMI A;  2OJW A;  1E6E B;  5BMH A;  3W1S C;  2LXA A;  1YOV B;  1BXT A;  1LGR A;  1SSN A;  5BO4 B;  2QIL A;  2WXG A;  1FXT B;  2B76 B;  4IM3 A;  2KAN A;  3HK0 A;  2KC1 A;  1MJD A;  1RAX A;  4KSK C;  2WDV B;  4WAF A;  1V49 A;  3LDZ E;  4IG7 B;  1WYG A;  2H89 B;  1XCQ L;  2J53 A;  4C4V A;  3R66 C;  1V6E A;  4HKZ E;  3VRA B;  3PT2 B;  3OG5 A;  1BT0 A;  1WMH B;  3A9K A;  4PS8 A;  4KKI A;  4W9C A;  2M56 B;  1K52 A;  3UQB A;  1E7P B;  1KRH A;  5FK9 C;  1MVK A;  4R3D A;  2LUM A;  3L17 A;  1GC6 A;  3VUW A;  2QHO A;  5JZE B;  2HTH A;  1H8C A;  1NEN B;  2M1M A;  1SJE D;  2HDE A;  3UIO B;  1EO6 A;  2LZ6 A;  4US9 A;  4C7Y A;  4XWT A;  4OVZ A;  2KJ6 A;  2L1A A;  2WGS A;  2BB5 A;  3UGB B;  2OED A;  2M19 A;  3B2G A;  1AW7 A;  4KKJ A;  4GDL B;  4JQW C;  1TJE A;  1RLF A;  2EKI A;  2FUG 1;  3ZXV A;  3QAR A;  2EEL A;  3LXF A;  1FFV A;  1KH0 A;  4IWQ A;  4IM2 A;  3Q69 A;  1WMH A;  3A9K B;  3RN9 C;  4BOZ B;  5DPW A;  3QJZ A;  3R3M A;  2KVR A;  2QMT A;  4TV3 A;  5J2R A;  2MHJ A;  3WAP A;  3DBH I;  2BTE A;  1HE8 A;  1N62 A;  3DHI C;  1LXD A;  1F2R I;  2PIA A;  4RCO A;  2L7R A;  2N1V A;  1J0G A;  1HEZ E;  3T3N A;  1H4R A;  1JWB D;  3U7Z A;  2EMT A;  2A5U A;  2K6D B;  4F7Z A;  2Z0D B;  3U4E G;  3N1Z C;  2D3B A;  2N1W A;  4LNI A;  3J9C A;  4EZJ A;  3DPD A;  4HRS A;  5E6J A;  2JWU A;  3E9S A;  4WJN A;  1WGR A;  1IPG A;  4FJY A;  4PS3 A;  5FR3 A;  3N30 A;  4BZA A;  2KXJ A;  3P4R B;  2KMC A;  2DZI A;  1TKG A;  2UU7 A;  4ZRJ A;  3ZRC A;  4KGS A;  3I3T B;  1PGX A;  1QOA A;  3L08 A;  2JYE A;  2BWE S;  3P2B A;  2JVC A;  1I42 A;  3AE4 B;  3DBL I;  3EC8 A;  1TS2 A;  5G55 A;  2LGI A;  3Q14 C;  4LNF A;  4DK5 A;  2JWZ A;  1HTO A;  3PGE A;  3JSV B;  2RMM A;  3BZD B;  1JWU D;  2GBK A;  1VZ6 A;  1VZ8 A;  4PT5 A;  5JHB A;  2PPH A;  4KIK B;  4C00 A;  3RPF C;  4ZRI A;  1D6E C;  3BWU D;  3RNE C;  1RFK A;  1X1M A;  1RRB A;  1WXQ A;  2QJL A;  3BK2 A;  1CK1 A;  3MFG A;  1IGC A;  4W9H A;  2IPK D;  5BMG A;  1I4G A;  2N7D A;  5BYS A;  2ZNV C;  4I6L B;  3K9O B;  2JUO A;  3HVZ A;  5GMV A;  4DXF A;  2C7H A;  4GDK B;  4NQL B;  4G3X B;  3K9P B;  1FIQ A;  1L0V B;  4TQ1 A;  2Z59 B;  3DVN V;  4ICU A;  3JYU A;  3Q3N C;  2NBW B;  1QKZ A;  1TS5 A;  2VZK D;  1UD7 A;  2O6V A;  2K8C A;  1UGM A;  1WJN A;  3AM9 A;  4YWG G;  2KFK B;  4I6P A;  2LAS A;  1E8W A;  1C3T A;  3GB1 A;  4ZYS A;  1I4X A;  2L83 A;  2L3Z A;  2BYV E;  2K8H A;  1HZ5 A;  1JAL A;  1PQS A;  3DBH B;  4W9J A;  2ZJD A;  4YXD B;  2K9X A;  2N9E B;  3VR9 B;  4CO7 A;  1I4Q A;  4WUR A;  2KZR A;  4RM8 A;  1C4P A;  1YQ4 B;  1WXV A;  1WXS A;  1V1P B;  2SAK A;  4MEL A;  4JE3 B;  1QQR A;  3AE9 B;  3W5V B;  3MC8 A;  3AE3 B;  5AUI A;  1E0Z A;  4ANV A;  1EUV B;  1QOB A;  5D6J B;  2AQ1 B;  2Y5P A;  3H7S A;  2IO0 B;  3VQI A;  4MH0 E;  4BKS A;  3UIP B;  2LGS A;  2DNF A;  4AOF A;  2DYB A;  2A4Z A;  4RGO S;  2NTS A;  1KTK A;  1S1Q B;  3Q3O C;  4W9I A;  1XF5 L;  4MGY E;  2BS4 B;  2WXQ A;  1FNU A;  4JIO U;  4C80 A;  4ZOH C;  3IVF A;  2LVQ A;  3CST A;  4IW0 A;  3ZJV A;  4X57 B;  3RUI B;  4D2K A;  2IO3 B;  3BK1 A;  4K7U A;  5AEK B;  2BGF A;  2VZK B;  3H9D A;  3I57 A;  2KLG A;  1FCC C;  1XEE A;  1WZ3 A;  1TY0 A;  4ZHO A;  1WJ6 A;  4XZ4 A;  2JYT A;  3RD2 A;  3EFC A;  1KFY B;  1YX6 B;  2KN5 A;  1TYG B;  4DXG A;  1PGB A;  4BFR A;  4P16 A;  4HXD A;  2ACZ B;  3DVG Y;  3ONS A;  2KTR A;  4LK0 M;  5MPO A;  2ZW0 A;  4WWO A;  3H8H A;  3ZNI D;  2GBJ A;  4RGN A;  4BVU C;  2PVG C;  3V3X A;  4M8M A;  3NS1 A;  4JWS C;  1T0Y A;  2ON8 A;  1V5O A;  2L32 A;  2HTM E;  4HPM B;  2MJ3 A;  4AP4 C;  1F0Z A;  2UWQ A;  2D3A A;  3HIZ A;  3PRP B;  1UF0 A;  3Q8B A;  4FXC A;  4TKN A;  2SEB D;  3NS8 A;  2C9W B;  3AEG B;  4NJ7 A;  1YX5 B;  5LXI B;  2KWD A;  2AL6 A;  3Q8F A;  1ACC A;  3URY A;  1ZDX A;  2J42 A;  4URK A;  2HD5 B;  3ECI A;  2ZVO A;  1D5M C;  3AE1 B;  2MJD A;  2NTT A;  3QIJ A;  2WDR B;  3OAW A;  4HCN B;  1IBX B;  3GE3 C;  5AZH A;  1E9M A;  3ENE A;  1WSP A;  2W54 A;  1KM7 A;  5HHD G;  2BPS A;  3C0R B;  4YSX B;  1ZXH A;  5J17 A;  1CQV A;  5JHA A;  3ZTC A;  2RSU A;  2KC2 A;  1ZGU B;  1ET6 A;  4NY0 A;  1SE9 A;  1ZKH A;  3UQA A;  3BYT B;  4HWI B;  5C2T B;  3NHE B;  2I2Y A;  2LVO A;  3O13 A;  1ENF A;  2RDG A;  4FA6 A;  5G5G A;  5D7G A;  3Q3F A;  4LDT B;  2BQQ A;  2RR9 A;  1NYQ A;  3VRB B;  1Q0W B;  4MT5 A;  3IG3 A;  3WAL A;  2Y5B B;  3V05 A;  2C5L C;  4G11 A;  3ZUN A;  2JRH A;  1WX8 A;  1N61 A;  1MPE A;  3IHP C;  4HLE A;  3PO0 A;  2CR5 A;  5L83 A;  4ZHP A;  1XCT L;  2N7E A;  3NY5 A;  2I1J A;  1MHH E;  3KLS X;  2OOB B;  2XEW A;  5CHW A;  3DDC B;  2MH7 A;  1UEL A;  3S2A A;  2O2V A;  4AUQ C;  5EDS A;  3NVW A;  3ZJU A;  3T9L A;  3Q8A A;  1XO3 A;  2BW2 A;  1L4Z B;  2JU6 X;  1HQR D;  3TUO A;  1MI0 A;  4LNN A;  3PRM B;  3U7D A;  2KOX A;  5I4D A;  3FIL B;  2LEK A;  3PTF C;  5KHO A;  4KSL C;  4RM9 A;  2JPH A;  3PV1 A;  1GUA B;  3DBR I;  3ZO5 B;  3ZRF A;  3BVZ A;  4K1R B;  4XDD A;  1KJT A;  1NDD A;  5EE1 A;  2BB6 A;  3SFE B;  1WY8 A;  4KX6 B;  3OLM D;  1NBF C;  1TGZ B;  2NCN A;  1GPX A;  1WX7 A;  3GZN I;  3GZN B;  2Z0E B;  3DBS A;  4LCD E;  3HHM A;  3V6E B;  1XLN A;  1WR6 E;  4FBJ B;  1HXY D;  2VRR B;  1N5X A;  2NS5 A;  3C19 A;  1E7U A;  2RD0 A;  1GAQ B;  2KDB A;  1OQR A;  4RGM A;  3VFK A;  1KLG D;  4P7I A;  2V9H A;  2N9L A;  4N59 A;  1R7S A;  4M02 A;  3MHZ A;  1FEH A;  2WXK A;  2KHW B;  3P42 A;  4FJV B;  2M4N A;  3NVZ A;  3R7Q A;  2KYW A;  4XDC A;  1EU3 A;  2JXT A;  2KTR B;  2LHE A;  2LMC A;  3PZ8 A;  3IFW B;  2ZPN A;  3BY4 B;  3VTU A;  4C7Z A;  2KQS A;  2LD9 A;  2JF5 A;  3A4R A;  3VDZ A;  2CHW A;  5IN7 A;  1BUI C;  4KIK A;  2INC C;  2QIE B;  3A33 B;  1FFU A;  4HPP A;  3ZQ4 A;  3R7R A;  2W3S A;  3D32 A;  4MGK E;  1WRI A;  2NPT A;  1UH6 A;  4KV2 A;  2NBV B;  1V86 A;  1IBX A;  3TJP A;  2K25 A;  1L5P A;  4L23 A;  3RNA C;  2MBH A;  5DPT A;  3PRE A;  1JW9 D;  2KAC A;  2G4S A;  1HZ6 A;  1C76 A;  3UIN B;  1YN3 A;  3RT3 B;  5JXV A;  1P7F A;  2FBW B;  3AV8 A;  3VVW B;  1WR1 A;  1R4N I;  1QOG A;  1UGJ A;  3M63 B;  3ABV B;  2MX2 A;  2J0K A;  2WX0 A;  1FXI A;  4W9L A;  3PPA A;  4HKQ A;  3RNG C;  4GXB A;  1LQB A;  1JWM D;  1KOT A;  3R2T A;  1VZ7 A;  2D2Q A;  2Y3A A;  3H7P A;  1QF6 A;  3AE7 B;  4KVG B;  4HJK A;  2W3R A;  2X38 A;  2AQ2 B;  3AEC B;  5D3D A;  4BBN F;  1WFY A;  1WI0 A;  2K6Q A;  2CU1 A;  4XX5 A;  3ZJT A;  1IYF A;  4F1S A;  4AJY B;  3AU5 A;  3KWL A;  4L1B A;  1NI3 A;  2GI9 A;  1GB4 A;  4OZB A;  4HK2 A;  2W82 A;  2KK8 A;  3MC0 B;  3NZU A;  1V97 A;  2BKF A;  2G9H D;  1KLV A;  4S0R A;  3FIL A;  2V3S A;  2YVC A;  5J18 A;  4MAC A;  4FAD A;  2DZK A;  4FLH A;  2D10 A;  4A8X C;  3RNF C;  1ZE3 D;  1D5X C;  4AWJ A;  2WXH A;  1V2Y A;  3MC9 A;  2IDY A;  1VR9 A; 
#chains in the Genus database with same CATH homology
 4JLC A;  2XK5 A;  3EHV A;  1E8Y A;  4NAW B;  2D07 B;  4RMA A;  3CSF A;  3OJ3 A;  4ICV A;  2L3Z A;  3WAN A;  2BYV E;  2KWV B;  3SDL C;  3B1L X;  4EOY A;  2K8H A;  4GSW A;  1PQS A;  1WIA A;  3A9J A;  4W9J A;  2ZJD A;  2GMI C;  3ZDM C;  4YL8 A;  2N9E B;  3W1Y A;  2UYZ B;  3QWZ B;  4EUT A;  4DHJ D;  2EKE C;  4I6N B;  2LWP A;  3OJ4 B;  5CTR C;  4CO7 A;  1E8Z A;  2KZR A;  4G0N B;  2WYQ A;  4RM8 A;  4WWP A;  3TMP B;  1LFD A;  2J7Q B;  2JT4 B;  3L10 B;  3LJ3 A;  1WXV A;  1WXS A;  3DVG X;  2DEN B;  2KJH B;  5AZF A;  1E7V A;  3VH4 B;  5IA7 A;  4MEL A;  3SD5 A;  4HDQ A;  3A1Q B;  4OVV A;  4IWP A;  4IM0 A;  1G6J A;  1YQB A;  3CF6 E;  4HVB A;  4ANV A;  1EUV B;  1OEY A;  5D6J B;  2GBN A;  3H7S A;  4FHJ A;  2IO0 B;  3VQI A;  2MQJ A;  4MH0 E;  2B3A A;  4BKS A;  1NI2 A;  1WJU A;  3UIP B;  3U8Z A;  2PE6 B;  3RCZ A;  3DQV A;  2KLC A;  1TTN A;  4AOF A;  2DAF A;  4GU2 A;  2HJ8 A;  2DYB A;  2A4Z A;  4E74 A;  2ZCB A;  2LRW A;  2WX1 A;  2K8B A;  2PEA A;  2MRP A;  1K8R B;  4B6W A;  3KUD B;  3PLU A;  4BKT A;  1R4M I;  1MG8 A;  1S3S G;  2MBE A;  1S1Q B;  3DOW A;  4W9I A;  5D2M B;  3A1Q A;  4WAA A;  3ZNG C;  2CHX A;  4MGY E;  5FR6 A;  4W9G A;  3RUL A;  1GJZ A;  2RGF A;  2ASQ A;  2R2O A;  3VTW A;  4JIO U;  1YJ1 A;  3ZIM A;  4LJO B;  3L54 A;  4PS7 A;  3IVF A;  3PLV A;  4G50 A;  4A3P A;  2LVQ A;  4JGH B;  1VD2 A;  3X0W A;  2KNB A;  3PHX B;  4ANU A;  3QCA A;  1GC7 A;  4MDK E;  3CST A;  4IW0 A;  2FCS A;  1WYW B;  3ZKJ C;  4LDT D;  1P1A A;  4WQO B;  4X57 B;  4WJP A;  3ALB A;  3RUI B;  2G45 B;  3JW0 X;  2MLB A;  1GG3 A;  1Q5W B;  2IO3 B;  4K7U A;  5AEK B;  1GNU A;  2BGF A;  3KYC D;  3QQ8 B;  2MP2 A;  2KMA A;  3ZVV A;  3H9D A;  3L13 A;  4LJP B;  4KZC A;  1J8C A;  3HM3 A;  2KLG A;  3L0W B;  4IC7 B;  5JH5 C;  4NPN A;  3ZDT A;  1WZ3 A;  2FID A;  3TIX A;  2JRI B;  3QK0 A;  1WJ6 A;  4DHZ B;  4M8N A;  2AEH A;  4XZ4 A;  4DHZ E;  1Z2M A;  2BF8 B;  2IZV B;  2R2Q A;  5IAA C;  3RD2 A;  3ZNH B;  1XD3 B;  4EEW A;  2O6V D;  4MM3 A;  4B9K A;  2L0F A;  2I1K A;  3VHT C;  3O65 B;  4FN2 A;  1YX6 B;  2JY6 A;  3VUY A;  2FUH B;  2KN5 A;  3Q3J A;  3KYD D;  4GGQ A;  3AXC A;  4K7W A;  2LUE A;  4PYZ A;  3BIN A;  4BFR A;  2CKH B;  3TL5 A;  4A20 A;  4HXD A;  3DVG Y;  2KO3 A;  3ONS A;  4E3C A;  2KTR A;  5E6P A;  4GDL A;  2YLM A;  4J6I A;  3WAM A;  4K81 A;  2LGY A;  2LVP A;  4TQ0 A;  1TZ1 A;  4WWO A;  3SHQ A;  3QC8 B;  3TCA A;  1OTR B;  3ZNI D;  4DDG D;  2KWU B;  2GBJ A;  1UZX B;  4BVU C;  3RZF A;  4M8M A;  3N32 A;  1T0Y A;  1UBI A;  4K7S A;  1V5O A;  2O6V B;  3DVN U;  2J0J A;  3AU4 A;  3MJW A;  2BWF A;  1AAR A;  4HPM B;  3CMM B;  4W9F A;  4AP4 C;  4N9F 4;  2DAJ A;  2PJH A;  2AL3 A;  2IBI B;  3PRZ A;  2UWQ A;  4NJ6 A;  3HIZ A;  3PRP B;  2MWS B;  2FCN A;  4AJW A;  2DYM A;  4ZRK A;  2NBU A;  4TKN A;  1WM2 A;  2ZCC A;  3ZLZ A;  3NS8 A;  2C9W B;  2KX0 A;  4NJ7 A;  2IY1 B;  2FIF A;  1YX5 B;  5LXI B;  1YIW A;  2AL6 A;  4DBG A;  1E8X A;  2LXC A;  2HE7 A;  3QX1 A;  4URK A;  4GDK A;  2HD5 B;  1WJ4 A;  3ECI A;  2ZVO A;  2ZZP B;  2NVU I;  2GBM A;  2IO2 B;  2KFK A;  1E90 A;  3QIJ A;  3MHS D;  2ZNV B;  3OAW A;  4CYE A;  4HCN B;  4EZK A;  5LXH A;  4IUM B;  3AI5 A;  2MBB B;  5AZH A;  1V9J A;  1P0R A;  2V4L A;  3EFU A;  2JZZ A;  2MW5 A;  3ENE A;  3KUZ A;  3ZTD A;  5D94 A;  1KM7 A;  1YD8 U;  2BPS A;  3PSE B;  4HCP B;  2D3G A;  3C0R B;  3V60 A;  5J17 A;  1P3Q U;  3VH3 B;  4GOC A;  2EMS A;  5JHA A;  3ZTC A;  2RSU A;  1J19 A;  2KC2 A;  1ZGU B;  3A9J B;  3HM6 X;  4MGI E;  2DZM A;  4NY0 A;  1SE9 A;  3M95 A;  3V61 A;  3WIM A;  1WM3 A;  3RYT A;  1ZKH A;  1XT9 B;  1Z5S B;  2N4F A;  1U4A A;  5CHV C;  1Y8R C;  5CX3 A;  3ZNZ B;  2KDF B;  2MSE D;  5L95 C;  3UQA A;  2DZJ A;  2M0X A;  4HWI B;  1WXA A;  2KX3 A;  3NHE B;  2LVO A;  3TBL D;  1WF9 A;  3VUX A;  4FA6 A;  4II3 B;  2M17 A;  2MBQ A;  3W1S C;  5D7G A;  2LXA A;  3Q3F A;  5G2N A;  4LDT B;  2K1F A;  2RR9 A;  1V80 A;  3PZD A;  5BO4 B;  4EFO A;  1WH3 A;  1Q0W B;  2FAZ A;  3W1S A;  3IG3 A;  4WJQ A;  1WZ0 A;  1FXT B;  3WAL A;  2Y5B B;  2L00 B;  1WXM A;  2C5L C;  3A4S C;  4G11 A;  3ZUN A;  2JRH A;  1WX8 A;  4IM3 A;  2KAN A;  2NR2 A;  3HK0 A;  3IHP C;  4HLE A;  2WDT B;  2KC1 A;  3H6N A;  1RAX A;  2CR5 A;  5L83 A;  4KSK C;  3KUC B;  2BYF A;  2N7E A;  3NY5 A;  2LGX A;  4F8C B;  2I1J A;  1V49 A;  3LDZ E;  4MGZ E;  3IBE A;  4IG7 B;  2OOB B;  1LM8 B;  2XEW A;  1EF5 A;  2G4D B;  3N3K B;  2RPQ A;  2M8S A;  4MEM A;  5CHW A;  3DDC B;  3JVZ X;  2IY0 B;  2JZ3 B;  3R66 C;  1V6E A;  1UEL A;  2FCM A;  2D11 A;  3U30 A;  3PT2 B;  3S2A A;  2O2V A;  4AUQ C;  4ANW A;  5EDS A;  5CHF A;  1JRU A;  1BT0 A;  1C1Y B;  1WMH B;  3A9K A;  2AYO B;  2MP2 B;  4GIV A;  4KDI C;  4PS8 A;  2KKC A;  4W9C A;  3PHW B;  2DYO A;  1M94 A;  2ZEQ A;  3UQB A;  3PRM B;  3U7D A;  2KDE B;  2KOX A;  3T9L A;  3VTV A;  5TR5 A;  3L17 A;  1GC6 A;  4HPL B;  3VUW A;  2QHO A;  3PTF C;  5KHO A;  5JZE B;  2HTH A;  1H8C A;  2MBO A;  3B08 A;  4KSL C;  4RM9 A;  2M1M A;  2JPH A;  3PV1 A;  1GUA B;  3DBR I;  3UIO B;  2IO1 B;  1EO6 A;  3ZO5 B;  5E6N A;  3KW5 B;  3ZRF A;  2LZ6 A;  4XC2 A;  3APD A;  4K1R B;  1I35 A;  4PYU A;  1KJT A;  2KJ6 A;  3GOE A;  1NDD A;  2K39 A;  1EF1 A;  3V6C B;  3PS6 A;  1WY8 A;  2L0T A;  4BBN C;  3ML8 A;  3OLM D;  1NBF C;  1TGZ B;  3UGB B;  2NCN A;  1WRD B;  3ML9 A;  1WX7 A;  3GZN I;  2C7M B;  2Z0E B;  3DBS A;  4LCD E;  3HHM A;  1XQQ A;  2KWC A;  2LRU A;  3V6E B;  4DWF A;  4GDL B;  1OGW A;  4JQW C;  1WR6 E;  4W9E A;  5E6O A;  1RLF A;  4FBJ B;  4FHK A;  3QAR A;  2VRR B;  3RZW C;  1L7Y A;  2NS5 A;  2REX A;  1VCB A;  3SU8 X;  1OEY J;  1E7U A;  4GB9 A;  2RD0 A;  4IWQ A;  2KTF A;  4IM2 A;  2KDB A;  3VAW A;  1WMH A;  2FCQ A;  3A9K B;  4BOZ B;  4ZDV A;  5DPW A;  3VFK A;  2JXX A;  3QJZ A;  3R3M A;  4CHK A;  4P7I A;  2KVR A;  4W9D A;  2MA9 B;  4TV3 A;  3WAO A;  5J2R A;  3WAP A;  3DBH I;  2KHW B;  2W9N A;  4FJV B;  3QA8 A;  5HKH A;  2M4N A;  1HE8 A;  2N9P C;  1LXD A;  4II2 B;  1SIF A;  3R7Q A;  2J0M A;  4EZL A;  2L7R A;  4MSM B;  2N1V A;  1J0G A;  2PE9 A;  2KTR B;  4OVU A;  3IFW B;  1H4R A;  2ZPN A;  3BY4 B;  3VTU A;  2KQS A;  2EMT A;  2LD9 A;  2A5U A;  2JF5 A;  2K6D B;  3A4R A;  4HDO A;  3ZW3 A;  3VDZ A;  2CHW A;  4KZ0 A;  4F7Z A;  2Z0D B;  2ZVN A;  3H1U A;  4KIK A;  2N1W A;  3A33 B;  5DPS A;  2KJR A;  2CS4 A;  4TUU A;  2XBB C;  2KD0 A;  4WWN A;  5C23 A;  3R7R A;  3DPD A;  4EZJ A;  1V81 A;  1ISN A;  3D32 A;  4WJN A;  3PVL A;  4MGK E;  5C1Z A;  1WGR A;  3NZS A;  1IPG A;  2GBR A;  2NPT A;  3KH0 A;  4FJY A;  1UH6 A;  4KV2 A;  4B95 A;  2NBV B;  4PS3 A;  1V86 A;  5LLI A;  5KHQ A;  3N30 A;  2KQ7 A;  4DHJ B;  4A3O A;  2KXJ A;  4M0W B;  3DCG A;  3TJP A;  2K25 A;  2CHZ A;  1WGG A;  2KMC A;  3V62 A;  3NOB A;  1TBE A;  4NNJ B;  2DZI A;  2MBH A;  5DPT A;  3PRE A;  2L76 A;  2G4S A;  4ZRJ A;  3ZRC A;  3I3T B;  2WWZ A;  4EKU A;  4MSQ B;  3M3J A;  3UIN B;  3RT3 B;  4BOS C;  2LJ5 A;  3H7P B;  3L08 A;  2BWE S;  3P2B A;  2JVC A;  4NAW A;  3VVW B;  1WR1 A;  1I42 A;  2IYD B;  1R4N I;  4FUL A;  4W9K A;  3M63 B;  3DBL I;  3EC8 A;  5G55 A;  1A5R A;  2MX2 A;  2J0K A;  2WX0 A;  2C60 A;  4NQK E;  1WGD A;  2OJR A;  4W9L A;  3UF8 A;  1WE6 A;  3L16 A;  3QAQ A;  4DK5 A;  2JWZ A;  3PPA A;  1E5W A;  3PGE A;  1IP9 A;  1P98 A;  3JSV B;  4GXB A;  1SGH A;  1LQB A;  2GBK A;  1KOT A;  1OQY A;  4DXA B;  2D2Q A;  2BKR B;  5JHB A;  2L05 A;  3H7P A;  2FNJ B;  2MCN B;  1QZE A;  4HJK A;  2PPH A;  4KDL B;  4KVG B;  2AWT A;  2KDI A;  2LGD A;  4KIK B;  4WJO A;  3M62 B;  4BBN F;  1WFY A;  4ZRI A;  1WI0 A;  2XK5 B;  3T8M A;  3VXW A;  1WE7 A;  2K6Q A;  1RFA A;  2O2V B;  1WX9 A;  4GMV A;  2CU1 A;  3QHT A;  4XX5 A;  1X1M A;  1RRB A;  3X23 A;  1IYF A;  2KFJ A;  4F1S A;  3AUL A;  4AJY B;  4DDI D;  3EEC A;  2BYE A;  2NPT B;  3AU5 A;  2V1Y A;  3JSV A;  5DCN A;  3B0A A;  4BKG A;  4MJS B;  1D3Z A;  4IWO A;  4W9H A;  2L8J A;  2GOW A;  1F9J A;  4ASW C;  2N7D A;  4HK2 A;  2ZNV C;  4I6L B;  2KK8 A;  2JUO A;  3K9O B;  5GMV A;  1Q1O A;  3APC A;  3NZU A;  2C7H A;  3K9P B;  4G3X B;  4GDK B;  4NQL B;  3APF A;  5DPR A;  2BKF A;  2DX5 B;  1WGY A;  1KLV A;  4TQ1 A;  2Z59 B;  1V5T A;  2LI5 A;  2V3S A;  2DHZ A;  3MTN B;  2YVC A;  3DVN V;  2G3Q B;  4ICU A;  2N9X A;  3JYU A;  5J18 A;  2NBW B;  4FAD A;  2DZK A;  1UD7 A;  3KVF B;  1P9D U;  2O6V A;  4FLH A;  2D10 A;  4MJS A;  4JL9 A;  2K8C A;  1UBQ A;  4E71 A;  1L2N A;  3WA0 A;  1UGM A;  1WJN A;  4BKS D;  1CMX B;  1WGH A;  4ANX A;  5AZG A;  2KFK B;  4GN1 A;  4AWJ A;  4I6P A;  1V2Y A;  1ZW7 A;  2C7N B;  4ZYN A;  2LAS A;  4FJZ A;  2ZPY A;  1E8W A;  1C3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...