4PYUA

The conserved ubiquitin-like protein hub1 plays a critical role in splicing in human cells
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
GSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/allergen
molecule keywords Ubiquitin-like protein 5
publication title The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 76
sequence length 76
chains with identical sequence B, G, K, O, S
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4pyuA00
3CSTA 4A20A 4MJSA 2DAFA 3RYTA 2XBBC 1YD8U 3APDA 1Q1OA 5D94A 4K7WA 3VH4B 3ZNHB 1C1YB 3QARA 3KYCD 3PSEB 2DZIA 3AU5A 2GMIC 3TIXA 3EC8A 4ANUA 3KVFB 4HJKA 1FXTB 2J0MA 2K25A 2R2QA 3ZRFA 4NAWB 4ZYNA 1RLFA 2KKCA 3H7PA 4WQOB 3P2BA 1WH3A 2KJRA 1KLVA 2RGFA 4EEWA 2MSED 2BYFA 5FR6A 2KTFA 2MX2A 1YJ1A 4RMAA 3SHQA 2WDTB 4HDOA 1V80A 3DVGY 3N30A 1WJUA 3KW5B 2OJRA 1Q5WB 2GBMA 2QHOA 2ZVOA 3KUZA 3PHXB 3PLUA 4W9JA 4GGQA 4FULA 1WI0A 1YQBA 1AARA 3H6NA 1P9DU 2DYMA 3ZNZB 2DZJA 3L17A 5IA7A 3ZTCA 2N9PC 3DQVA 2DX5B 3ENEA 3R7QA 4ZDVA 2A5UA 2FNJB 4FJYA 2MBBB 2LXCA 3CMMB 3L0WB 2WWZA 4J6IA 1P1AA 2IBIB 3SU8X 2LVPA 3A9KB 4KDIC 4IC7B 5L95C 5KHOA 1D3ZA 2KHWB 4HPLB 3RT3B 1L2NA 3PRPB 4BKTA 2LRWA 4JL9A 1MG8A 3Q3JA 4BBNC 4P7IA 4AJWA 3PLVA 3AXCA 4W9LA 3QA8A 4DHJB 2CHWA 1EF5A 2O6VD 3ECIA 4K1RB 3VFKA 3ZNID 2MBHA 2HD5B 2GOWA 4GSWA 3CF6E 2IO1B 1UH6A 2CS4A 2Z59B 5LLIA 3ZUNA 2PE9A 2I1JA 3VUXA 3I3TB 4W9GA 4A3OA 2IYDB 1WX9A 2DENB 4K7SA 1GG3A 4NAWA 3ZTDA 4RM8A 1WFYA 3A4RA 3VQIA 2KWCA 4BOSC 5CX3A 2YVCA 3PGEA 2M0XA 4FHKA 3M62B 3QJZA 3X23A 4ZRKA 4OVUA 1WXAA 4W9EA 4KIKB 4DK5A 4BFRA 1UZXB 1SIFA 2N1VA 2BWFA 4W9DA 4AWJA 1LXDA 3A1QB 4DDID 3X0WA 3VHTC 1TBEA 4FN2A 3VUYA 4XZ4A 4BOZB 2ZNVB 1V6EA 2BWES 5AZFA 4HVBA 4HWIB 2KC1A 4EKUA 1WF9A 3HIZA 3DDCB 3H1UA 3OJ3A 3V6EB 2CHZA 2NCNA 5JHAA 5IAAC 3RZFA 2K6DB 2RR9A 2PJHA 2BYEA 3KUCB 3IHPC 4LDTB 5AEKB 3HM3A 3RUIB 5BO4B 3A9KA 4ANWA 3H7SA 4JLCA 3WA0A 3NZUA 2JVCA 5DPTA 2KLGA 4GU2A 3QK0A 4EOYA 4M0WB 2BKRB 3PS6A 4WJQA 2B3AA 2L3ZA 3ML8A 1F9JA 2ZEQA 4HPMB 1ZKHA 1WMHB 2MWSB 2JZ3B 3IG3A 5D2MB 2O2VB 4OVVA 1RRBA 1WZ3A 3NS8A 2MP2B 3R3MA 4YL8A 1EUVB 2NS5A 2NPTB 2L0FA 1ZGUB 1E7UA 2KTRB 2NBVB 4KVGB 3VTVA 1WE7A 4NJ7A 1HE8A 5JH5C 4DHJD 1G6JA 2KD0A 1H4RA 2FAZA 3PVLA 2KJHB 2KX0A 2J0KA 2Z0EB 3B08A 3PHWB 3PZDA 3PV1A 5J17A 2OOBB 2M17A 2K8HA 2GBNA 4IG7B 4XX5A 3WIMA 1TGZB 2KC2A 2DYBA 4G50A 1NDDA 2HTHA 4MSMB 4RM9A 3IBEA 3EFUA 5TR5A 4KIKA 3NHEB 2IZVB 2L00B 4G3XB 2KO3A 2NBWB 1H8CA 3A1QA 3D32A 4II3B 3QQ8B 3BINA 4G0NB 4LCDE 4X57B 3L10B 4W9CA 4MGKE 2KJ6A 2IY1B 3DVGX 1V49A 4MEMA 2CU1A 4EFOA 5C1ZA 2AL3A 3UQBA 2K6QA 3W1SA 4TUUA 1T0YA 2KXJA 2AEHA 1JRUA 2N7EA 2ZNVC 5E6PA 3T9LA 1Y8RC 4A3PA 4I6LB 3ZLZA 2MCNB 2K1FA 4HK2A 4NY0A 1UBQA 4WJOA 5HKHA 4PYZA 1KOTA 3W1SC 2LGXA 2KZRA 2I1KA 3AU4A 2FCSA 3JSVB 4W9HA 1V86A 3N32A 1WX7A 4M8MA 1S3SG 1V9JA 4GXBA 2LD9A 2LASA 3U30A 1WMHA 3JW0X 1LM8B 2V1YA 2O2VA 4HXDA 4N9F4 3VDZA 4W9IA 4AJYB 2FCMA 2MP2A 3DCGA 1WXVA 3M3JA 4AUQC 3QHTA 1OGWA 1WGHA 1NI2A 2NPTA 3ZW3A 1R4NI 2XEWA 1C3TA 4DXAB 4NPNA 2KTRA 2NVUI 2YLMA 2JRHA 2L76A 4F1SA 2XK5B 4AOFA 3PRMB 1V81A 1WGGA 2FIDA 1WGYA 1KM7A 3TMPB 3UINB 2ZVNA 3R7RA 2N1WA 2BKFA 2KOXA 4KSLC 1ZW7A 5DCNA 2LVOA 3PT2B 3SD5A 1IP9A 3Q3FA 4WJPA 1WIAA 3IFWB 4IWPA 1QZEA 2DHZA 2KMCA 3S2AA 2L7RA 1WJ6A 4MELA 2C60A 1E8ZA 3HHMA 2WX0A 3PTFC 2GBRA 2LGYA 1P0RA 4HLEA 4HCNB 3UGBB 3M63B 5D7GA 5CHVC 1E8XA 1XT9B 3L54A 2M1MA 2EMTA 1TZ1A 3TL5A 2C5LC 3UF8A 4KV2A 1GJZA 1GUAB 4XC2A 2ZCBA 3ZDMC 4EZJA 3M95A 4E71A 3IVFA 1WM3A 4E74A 2JF5A 3JSVA 4MSQB 1J19A 1WGDA 2FUHB 3VVWB 3A33B 2ZPYA 4WJNA 4TKNA 2AYOB 2PE6B 2R2OA 1S1QB 2MQJA 3EECA 3VTUA 3ZRCA 4IUMB 1A5RA 2RD0A 2KQSA 2MA9B 3RCZA 2LI5A 1R4MI 1WYWB 2M8SA 2KDFB 2D2QA 2JZZA 2KX3A 1OEYA 2KFJA 3QAQA 2MRPA 4MH0E 2XK5A 2HE7A 4IW0A 4MDKE 4BKGA 3ZNGC 2LXAA 3APFA 3R66C 3NZSA 2DZKA 2EMSA 2KWVB 5DPWA 5DPRA 5E6OA 3TBLD 2ZPNA 3O65B 2G4SA 1V2YA 4LJPB 2LGDA 4ANVA 2N9EB 2C7MB 2BF8B 3ONSA 3ZDTA 2UWQA 4DWFA 5LXHA 1WGRA 3B0AA 2L0TA 2JUOA 2FCQA 1E8WA 2K8CA 4F7ZA 4K7UA 2K8BA 2KDEB 2D07B 3H9DA 1SGHA 4GDLB 4PS8A 1TTNA 3AI5A 4TQ1A 2O6VB 1IYFA 4B6WA 1RFAA 3VXWA 4GB9A 3VH3B 2DYOA 1WR6E 2JT4B 4FLHA 4PYUA 2KANA 2ZZPB 4EZLA 1CMXB 3BY4B 1E8YA 3A9JB 2MBQA 2IY0B 1U4AA 4ICVA 1WZ0A 2BYVE 4EUTA 1E90A 4FJZA 3RZWC 5JHBA 4KDLB 2NR2A 5C23A 5G55A 2LRUA 4KZ0A 1V5OA 1LQBA 1YX6B 2C9WB 3GZNI 3KH0A 2D10A 1YIWA 4DDGD 1BT0A 2D11A 3QC8B 2D3GA 4W9KA 2J7QB 2Z0DB 4E3CA 4K81A 4NQLB 2L8JA 4G11A 1WXMA 4F8CB 2N9XA 1Z2MA 1J8CA 3K9PB 3NOBA 1RAXA 2EKEC 1WR1A 2JPHA 1EF1A 1VD2A 2LVQA 4I6PA 4II2B 3TCAA 5LXIB 1GC6A 1UBIA 4KZCA 4I6NB 3NY5A 4MM3A 4HCPB 3WAMA 2KDBA 2G45B 2KNBA 1ISNA 3KUDB 4LDTD 4W9FA 3SDLC 3TJPA 1OQYA 1E7VA 2M4NA 4GN1A 2DAJA 1XD3B 3PREA 5DPSA 1WM2A 2VRRB 2ZCCA 2UYZB 2MBOA 4JIOU 4GMVA 2KDIA 2WYQA 2PPHA 3DBRI 3OLMD 3UIPB 4WWOA 4M8NA 3WAOA 2KN5A 2CHXA 5CTRC 2KLCA 3LJ3A 2DZMA 2MW5A 2MBEA 4FBJB 4CHKA 4BKSA 1PQSA 2LZ6A 4FA6A 4LJOB 2KMAA 3QWZB 3T8MA 3DBLI 4GDLA 4FJVB 1LFDA 2AWTA 4ICUA 2O6VA 3HK0A 3APCA 2IO3B 1XQQA 2PEAA 3PRZA 4DBGA 1I35A 1J0GA 4TV3A 3RULA 5E6NA 4GDKB 3VUWA 4CO7A 2RPQA 5D6JB 5J18A 3ML9A 3OAWA 4BKSD 2C7NB 3A9JA 4ZRJA 3ZIMA 2G4DB 2KK8A 2WX1A 3JVZX 4NJ6A 1WY8A 5GMVA 1K8RB 1Q0WB 1SE9A 4MGIE 4DHZE 2LJ5A 4PS3A 2GBKA 3VTWA 2AL6A 1WE6A 2HJ8A 2LWPA 4EZKA 2Y5BB 1I42A 2JRIB 3LDZE 1P98A 1KJTA 2KFKB 3QCAA 3RD2A 4B95A 3L16A 3ALBA 5AZHA 2W9NA 4URKA 5JZEB 4KSKC 5CHFA 3DOWA 4JQWC 1OEYJ 1L7YA 3L08A 4FHJA 4PS7A 4BVUC 3PPAA 4IWQA 1E5WA 1UELA 2CR5A 3B1LX 2JY6A 3ZVVA 3U7DA 4MJSB 1OTRB 3VAWA 3DVNV 1YX5B 1WJ4A 4ANXA 2V3SA 2ASQA 2JXXA 2MLBA 2GBJA 1EO6A 3DBHI 3DVNU 4MGYE 2FIFA 4IM2A 5EDSA 3QIJA 2BPSA 4DHZB 4TQ0A 3WAPA 2FCNA 3H7PB 1UGMA 1WXSA 3AULA 5L83A 4IM0A 2N7DA 2BGFA 4GIVA 4MGZE 3MHSD 4IWOA 3V60A 5AZGA 2KWUB 1X1MA 1GNUA 2REXA 3C0RB 1NBFC 2IO0B 3DBSA 3L13A 4NNJB 5CHWA 4ZRIA 1Z5SB 2KQ7A 4NQKE 2LUEA 3MJWA 2KVRA 2JWZA 4JGHB 2N4FA 3K9OB 3KYDD 1WRDB 4IM3A 1GC7A 4WWPA 2NBUA 3N3KB 3UIOB 1WJNA 5G2NA 3U8ZA 4AP4C 2RSUA 2C7HA 3EHVA 4GDKA 2IO2B 3ZKJC 3DPDA 2K39A 3A4SC 3HM6X 4WWNA 2L05A 4CYEA 3GOEA 3QX1A 3V62A 1WX8A 1M94A 4WAAA 4FADA 3CSFA 4GOCA 4HDQA 2ZJDA 5J2RA 3WANA 3OJ4B 2V4LA 3MTNB 3V6CB 1IPGA 2KFKA 3WALA 2J0JA 3JYUA 3W1YA 1UD7A 2A4ZA 3UQAA 5KHQA 1VCBA 1V5TA 4ASWC 4BBNF 1P3QU 4B9KA 2CKHB 3ZO5B 3V61A 2G3QB
chains in the Genus database with same CATH superfamily
3PZ7A 3CSTA 4A20A 1YD8U 2WHIA 4R3DA 1Q1OA 4K7WA 3QARA 2WXGA 3KYCD 2WXOA 3PSEB 3AU5A 3TIXA 3KVFB 3HRDD 3P2BA 1T0RC 2K22A 5BMIA 2KTFA 1YJ1A 4HDOA 1V80A 3N30A 3NRZA 1WJUA 2OJRA 3PLUA 1MJDA 3PZ8A 1FD6A 2DYMA 1UWMA 3ENEA 4ZDVA 5G5GA 2IJ0A 2R61A 3FILA 4RFBA 3L4PA 1I4XA 3SU8X 2LVPA 3W5UB 5L95C 1L2NA 2LRWA 4JL9A 2JXTA 3PLVA 3AXCA 2M0AA 4A55A 4W9LA 4DHJB 1EF5A 4US8A 1MHHE 3VFKA 3ZNID 1FXAA 4REZA 1YJIA 2CS4A 5LLIA 5FK9C 4XWWA 4A3OA 2IYDB 1F77A 3I5JC 1HZ5A 4NAWA 1IUEA 4YSZB 2PVOD 3QJZA 4ZRKA 4W9EA 4DK5A 4BFRA 4RGOS 1C4AA 3X0WA 4BOZB 5AZFA 4HVBA 4ZRPA 1M4VA 3H1UA 2NCNA 3NVWA 3RZFA 2RR9A 3KUCB 3BIID 2W3SA 3A9KA 3Q2AC 1OQQA 3NZUA 5DPTA 3QK0A 2VZKD 2BKRB 3Q6BA 2L3ZA 2AQ3B 2W82A 3IG3A 1JW9D 1R4MB 1F2RI 1SB3C 1KLUD 3RNGC 2NS5A 1V8CA 4LNFA 2KTRB 4NJ7A 2FAZA 1PYWD 2L1AA 3PV1A 5J17A 4HPPA 4YXDB 4IG7B 4XX5A 2DYBA 1NDDA 3EGRA 2HTHA 4MSMB 2WXHA 3SFDB 2AQ1B 2KO3A 3HVDA 2NBWB 4LCDE 3L10B 2AL3A 3RFZB 3E9SA 3UQBA 4RGTA 2KXJA 1JRUA 2W55A 3T9LA 4L2YA 4XGAB 4A3PA 1JCKB 2K1FA 4BZAA 5LNK1 2LGXA 1CZPA 4M0WA 3JSVB 5FR3A 5EE3A 1WMHA 2DNFA 2V1YA 2HJ1A 4N9F4 2WP9B 2KQ4X 2MP2A 1WXVA 4HKZE 5D3DA 3QHTA 2NPTA 1BUIC 2XEWA 4P6VF 3ABVB 2NVUI 2JRHA 2L76A 4F1SA 4AOFA 1N62A 2FIDA 2LHEA 2ZVNA 2BKFA 1ZW7A 5DCNA 3Q3FA 1FPYA 1FO4A 4PT5A 2DHZA 3P4PB 3Q3MC 2V4IB 3BVZA 4ZHPA 4HLEA 5I4DA 4IDIA 5CHVC 1MHXA 2EMTA 3MC0B 1TJEA 3Q3NC 3N1XC 4JE3B 3M95A 4KGTA 3IVFA 2JF5A 1JWMD 1J19A 2WQYB 4K3CA 1SF0A 4TKNA 2MQJA 3ZRCA 3TUOA 1A5RA 4LTUA 2LI5A 1WYWB 2RDHA 2D2QA 4MM3B 1JQ4A 3BWUD 3QAQA 1L0VB 2XK5A 1JWBD 3ZNGC 1D4BA 3APFA 5DPRA 4N6EB 3AECB 3ZQ4A 3P4SB 2ZW1A 1ET9A 1E9MA 3ZDTA 2UWQA 1MPEA 1WGRA 2GI9A 2FCQA 1VZ8A 2K8CA 4PS8A 2D5GA 3C19A 1ZDVA 2DYOA 2JT4B 3P4QB 1DOIA 2ZZPB 3VR8B 1E0ZA 2XNAC 2IY0B 1YN5A 4MT5A 1E90A 2ONQA 5JHBA 5C23A 1LQBA 3KH0A 1K52A 1PGBA 2J7QB 2Z0DB 1D6EC 1WXMA 2JYEA 3NOBA 5C3JB 1YMHE 1RAXA 1WYGA 1WR1A 1EF1A 2B76B 2LVQA 5LXIB 2E6XA 1ZOYB 2KDBA 2MEKA 1D5XC 2X38A 3TJPA 1OQYA 3AV8A 1T3QA 3PREA 1WM2A 1C9FA 4C4VA 2IPKD 2KDIA 4C7ZA 2PPHA 3DBRI 1MFWA 1J7CA 4M8NA 3WAOA 3P1MA 2FUG1 2INPE 2VZKB 1JALA 4FBJB 4LLGM 1PQSA 2LZ6A 4LJOB 3QWZB 4FJVB 1LFDA 2AWTA 3APCA 2IO3B 2PEAA 1V1PA 1I35A 3DBLB 2H89B 3OAWA 3IAS1 4ZRJA 3ZIMA 4IKGA 2BB5A 2KK8A 1VZ6A 4MGIE 2KDMA 1WE6A 2HJ8A 5AUKA 2JRIB 2BB6A 2GLSA 5JZEB 4KSKC 5CHFA 4FHJA 4ZHOA 2FE8A 4PS7A 3ZGZA 1E5WA 2CR5A 3U52E 3MC9A 3DVNV 3UI3A 4ANXA 5JXVA 2V3SA 1F52A 2JXXA 1RFKA 3RNBC 2BPSA 4DHZB 3WAPA 4DQOC 4KGSA 1WXSA 5L83A 4IWOA 5AZGA 1SIJA 1GNUA 2REXA 3L13A 5CHWA 4XDCA 2KQ7A 1TY2A 2GB1A 3MJWA 3MHZA 2KVRA 3K9OB 2RDBC 1GC7A 4WWPA 2NBUA 4D2KA 1WJNA 4GDKA 2BQQA 2QCZA 3ZKJC 1VJKA 2K39A 1UNSA 4CYEA 3V62A 3NVVA 2QILA 1WX8A 1IGDA 1JROA 5J2RA 1HQRD 1QOFA 2DLBA 2K3UA 2LUMA 3JYUA 1WSPA 3Q8BA 3UQAA 4ASWC 4BBNF 4C56C 2QMTA 3V61A 3LB8C 3FC4A 2DAFA 4MJSA 5BYQA 3RYTA 5D94A 3ZNHB 3VH4B 1SE4A 2DZIA 2WDRB 5H8YE 2J0MA 1RYJA 3AEEB 2K25A 2R2QA 2N9KA 2WXMA 4ZYNA 2KKCA 3RNAC 3ZRFA 4QAYA 3I9V1 2MSED 4EEWA 3AEGB 5FR6A 3P63A 3SHQA 1Q5WB 1P9DU 3ZNZB 5IA7A 2DX5B 3R7QA 2A5UA 3FAHA 2FNJB 2MBBB 1CQVA 2LXCA 2KVZA 3CMMB 4J6IA 1HTQA 2DWQA 2IBIB 2WLBA 1NYQA 2JU6X 4BBNC 4P7IA 2CHWA 2O6VD 1R4NB 1MVKA 2J53A 2MBHA 3N9YC 2KAJA 1ZXIA 1WX9A 4K7SA 3AE8B 4RM8A 5BMGA 3RN9C 1SJHD 3A4RA 3EUB2 2YVCA 2QJLA 2M0XA 4FHKA 5IO9A 5G5HA 4ARIA 4KIKB 3Q3OC 1D5ZC 1SIFA 5H92C 2OEDA 3A1QB 4H2AA 3VHTC 1TBEA 1GB1A 3VUYA 4XZ4A 3GE3C 1NENB 4YSXB 4K3BA 4EKUA 2KC1A 3OJ3A 2BYTA 5IAAC 2K6DB 2V3PA 2BYEA 5AEKB 5BO4B 3KQ4A 2JVCA 3VRBB 4WJQA 2B3AA 2JYTA 3ZJUA 4TMAB 3LYYA 2O2VB 1RRBA 1WZ3A 3ZXVA 2LEKA 3NG0A 1A70A 1EUVB 1MG4A 3VTVA 4KVGB 1G6JA 4OZBA 2WXFA 3AN1A 3NZ3A 3PVLA 4P16A 2J0KA 2JQRB 2M17A 4WAFA 1TGZB 3IBEA 1SXTA 1ZUD2 5TR5A 2IZVB 2L00B 4G3XB 2L52A 1STEA 3D32A 3QQ8B 3DHGC 1AWDA 4ZRQA 5C1ZA 2K6QA 3W1SA 3AE7B 2AEHA 2J4XA 1BXTA 1QQRA 2EELA 2ACZB 4XDDA 3GZNB 4NY0A 5T8IA 5HKHA 2KZRA 2I1KA 3AB5A 3P4RB 1IGCA 1WX7A 3AEBB 1SSNA 2LD9A 2LASA 5E6JA 3JW0X 1FNVA 3VDZA 2FCMA 4RH6A 3GE8C 3ZW3A 1K53A 2JWUA 1C3TA 3NS1A 2KTRA 2FBWB 2YLMA 4DXGA 3PRMB 2Y3AA 1WGGA 1FCCC 1KM7A 3UINB 1IP9A 3MFGA 2WS3B 2W3RA 3KWLA 2E3TA 3GP7A 2WU5B 2WXIA 5D3IB 3UGBB 5D7GA 1XT9B 4RGMA 3RMKC 1XLQA 3TL5A 1GJZA 1GUAB 4XC2A 4NZLB 4E71A 2BS2B 3JSVA 4MSQB 3ZYYX 1WGDA 1XXGA 3VVWB 4YWGG 4WJNA 1K50A 1ET6A 1TT5B 1PFDA 4IUMB 1OQRA 2KQSA 1VR9A 1TKEA 4GLSC 2ICIA 3Q8FA 2HE7A 4MDKE 4BKGA 3TSSA 2LXAA 1TIFA 2Y5CA 3P42A 3O65B 2G4SA 2EKIA 1MI0A 1V2YA 4WIPA 1SBBB 1ESFA 1TKGA 4RCOA 1TS2A 2L0TA 3FILB 3VR9B 2K8BA 1T6BX 1EWYC 3OWEB 2D07B 1SGHA 3N1ZC 4M01A 2O6VB 4B6WA 3VXWA 5EE0A 1XCTL 3VH3B 1WR6E 2KANA 1CMXB 1UWXA 1E8YA 1KF6B 3A9JB 2MBQA 1QILA 4ICVA 1WGKA 1V97A 3RZWC 1L6UA 2KMMA 1QF6A 1XCQL 5G55A 2C9WB 3R2IA 1NYRA 2D10A 5TSSA 1YIWA 1BT0A 4E3CA 4A6QA 4G11A 2HDEA 2CJOA 2N9XA 1Z2MA 1XLNA 3K9PB 2INNE 2JPHA 4II2B 3TCAA 3TEXA 4I6NB 3AE2B 4HEA1 4MM3A 4HCPB 2G45B 2KNBA 4LDTD 2K9XA 3SDLC 1SJED 4GN1A 2DAJA 1XD3B 2WXRA 2MBOA 2ON8A 3CIRB 4ZOHC 4C7YA 2ZW0A 2KN5A 2CHXA 4CHKA 4BKSA 3MC8A 3DBLI 4DBGA 4US9A 2G9HD 4TSSA 1KTKA 2QEJC 2RPQA 1DGJA 5J18A 2WX1A 4RGNA 1WY8A 5GMVA 1SE9A 2N9LA 1LGRA 3B2FA 3VTWA 4YSYB 3LDZE 1P98A 4B95A 3L16A 1C4CA 5AZHA 4URKA 1N61A 3DOWA 4JQWC 1L7YA 3B1LX 2JY6A 2PIAA 3U7DA 2AQ2B 1FMAD 1YX5B 1WJ4A 1PGAA 4RNAA 1FFVA 5IP4D 2GBJA 1EO6A 5EDSA 1AN8A 1GB4A 4TQ0A 2FCNA 3H7PB 1UGMA 3DBHB 1FIQA 3AULA 4MGZE 2KWUB 3C0RB 1NBFC 3W5VB 3KWVA 4NQKE 3HUIA 4JGHB 1ACCA 2JZPA 4IM3A 4HROA 5G2NA 2RSUA 1K51A 2C7HA 3EHVA 2IO2B 2Q5WD 3HM6X 2L05A 5IKCM 4LNIA 3ZXRA 2BBCA 1M94A 1TS4A 1XEEA 4FADA 3CSFA 4GOCA 4HDQA 3MTNB 1E6EB 2J0JA 2IDYA 1V1OA 4B0EA 1P7FA 2A4ZA 1VCBA 2YEPF 2CKHB 3ZO5B 3BZDB 4OHJA 2XBBC 3APDA 1C1YB 1KH0A 3BK1A 3SR6A 1L0YB 1I4HA 3N1YC 1RLFA 4WQOB 4ITKA 1KLVA 1FCLA 2RGFA 2BVCA 4C80A 2J42A 2WDTB 4KX6B 3DVGY 4WURA 2GBMA 3KUZA 4W9JA 1GAQB 3R8BA 4GGQA 1R7SA 4NJCA 1AARA 3H6NA 3T3NA 3L17A 3ZTCA 1J7AA 1I4PA 4FJYA 1C79A 1HZ6A 1I4GA 2WWZA 3N20C 4NAMA 3FKYA 4IC7B 5KHOA 1D3ZA 2PKOA 2KHWB 3ZJVA 1MG8A 3Q3JA 3Q8CA 2PW9A 5HI1A 3ECIA 4K1RB 2WDQB 2HD5B 4M02A 4AS1A 1VZ7A 2NMQA 2LGIA 2H88B 4W9GA 1GG3A 3OG5A 4OVZA 3URYA 1WFYA 3VQIA 2KWCA 5CX3A 3PGEA 3X23A 1TYGB 1WXAA 1C78A 1UZXB 1UF0A 2N1VA 2BWFA 4AWJA 1LXDA 4IOIE 4FN2A 1SE2A 4HWIB 1YN4A 4M00A 1WF9A 3HIZA 3DDCB 1RWSA 1QLBB 2AX5A 4O1NA 3BVMA 1JMLA 3IHPC 4LDTB 3HM3A 3RUIB 2KT7A 1XO3A 4ANWA 4JLCA 3WA0A 1VLBA 4GU2A 4KKJA 4EOYA 3PS6A 2NTSA 1VDVA 2ZEQA 1ZKHA 2WXLA 2MWSB 3NS8A 2INDC 3W2DA 2L0FA 1E7UA 5MPOA 1WE7A 1HE8A 4DHJD 2KD0A 2KJHB 2KX0A 3IXSA 3PZDA 1N60A 4YT0B 2OOBB 2K8HA 2GBNA 3WIMA 2KC2A 2I2YA 1WXQA 4KIKA 1C4PA 1H8CA 3A1QA 1HEZE 4G0NB 4W9CA 2KJ6A 2IY1B 3DVGX 4MEMA 4EFOA 2WU2B 4TUUA 1T0YA 2N7EA 2ZNVC 5E6PA 1Y8RC 4I6LB 3ZLZA 2MCNB 4HK2A 1QOBA 4KKIA 3AU4A 2FCSA 3N32A 1S3SG 3RI7C 1C77A 2O2VA 4W9IA 4AJYB 1JRPA 3M3JA 1NI2A 3Q69A 3DWMA 1FNWA 4DXAB 4NPNA 3NJTA 2J52A 1V81A 3TMPB 3DBRB 2MJDA 3R7RA 1F2RC 4KSLC 2LVOA 3PT2B 3SD5A 2PTLA 4WJPA 1WIAA 4P1CC 2KMCA 1NEKB 4MELA 2DBYA 1QOAA 3LXFA 3HHMA 3PTFC 2LGYA 2TSSA 2V3NA 1E8XA 1IBXB 1YNTE 1TZ1A 3AEDB 4LNNA 2C5LC 1Y56A 1WM3A 1YN3A 4E74A 4USAA 4JPSA 4CQNA 1TY0A 2ZPYA 4N59A 2CJNA 3VTUA 1DOXA 2RD0A 4ZYSA 1N5XA 5AUIA 1R4MI 3IAM1 3RPFC 2BTEA 2KDFB 1OEYA 2KFJA 4MH0E 2MRPA 3B2GA 2CU3A 3R66C 3NZSA 2KWVB 5DPWA 3AE3B 2OJWA 2ZPNA 1FNUA 4RF1A 1OFFA 2LGDA 4LJPB 4ANVA 2LJIA 2N9EB 3RNFC 2C7MB 2VH2A 3ONSA 5LXHA 3B0AA 2JUOA 2IGHA 1JWUD 4K7UA 4GDLB 3H9DA 1TTNA 1RFAA 4GB9A 4PYUA 4FLHA 3C8YA 4ARCA 4B0MA 4HRSA 1JWAD 3GS2A 4FJZA 3AH7A 2NR2A 1YX6B 4W9KA 1UGJA 4K81A 2L8JA 1YQ4B 1QT9A 2EKEC 2RPVA 2OHFA 1GC6A 1FFUA 1UBIA 3NY5A 3WAMA 1PGXA 4HJGE 4W9FA 2QIEB 2VRRB 1L4ZB 4JIOU 4GMVA 4A90A 3PO0A 1ZDXA 2WXKA 3UIPB 3OLMD 4WWOA 2KLCA 2DZMA 2MW5A 2MBEA 4FA6A 1PUTA 1KFYB 2KMAA 3T8MA 1FRDA 1TKYA 2O6VA 3HK0A 1XQQA 3PRZA 4TV3A 5E6NA 1FRRA 1KLGD 3VUWA 5D6JB 4XYCA 3ML9A 4BKSD 2C7NB 3A9JA 3Q8EA 4AQ7A 2G4DB 4NJ6A 4OW0A 1K8RB 3W9CB 4XE0A 3I57A 2Y5BB 3MP9A 1I42A 3QCAA 2KFKB 1KJTA 3RD2A 1E10A 4L23A 1T0SC 2KYWA 4BVUC 3PPAA 3ZVVA 3V3XA 1OTRB 4S0RA 3SEBA 3VAWA 1L0XB 2ASQA 2WXNA 2JSVX 3DBHI 3RNEC 3DVNU 4MGYE 4IM2A 3QIJA 3EA6A 1WRIA 4IM0A 3V60A 3MHSD 1X1MA 1B1ZA 2IGGA 3BYYB 2IO0B 4NNJB 3IT4B 4P1BC 2XN9C 2LUEA 2JWZA 2N4FA 3KYDD 3VRAB 4WH4A 1N6ZA 3N3KB 4J3OD 3U8ZA 2WXQA 3DPDA 3TEZA 4WWNA 3QX1A 2YEPB 4N58A 1LO5D 2KWDA 2SEBD 3DWGC 2BW2A 5HG2A 1UD7A 1ZP0B 5KHQA 1L6VA 1V5TA 3V05A 4B9KA 1PDXA 2G3QB 1KRHA 3EFCA 3E56A 2GMIC 3O13A 3EC8A 2SAKA 3AEAB 4ANUA 4OZCA 4HJKA 1FXTB 2VH1A 4NAWB 3H7PA 2G1EA 1WH3A 2KJRA 2BYFA 4L1BA 2MX2A 4RMAA 3AE1B 3HVZA 1ZXHA 3KW5B 2QHOA 2ZVOA 4EZLA 3PHXB 1DYQA 4FULA 1WI0A 1YQBA 4WWMA 1L5PA 2DZJA 2WDVB 2N9PC 3DQVA 1CK1A 3L0WB 1P1AA 3A9KB 4KDIC 2WXPA 4MH8A 4HPLB 3RT3B 3PRPB 4BKTA 1D5MC 4AJWA 3AEFB 3QA8A 4PK1A 5BYSA 1UUPA 4A9AA 2GOWA 4GSWA 3CF6E 2IO1B 1UH6A 2Z59B 3ZUNA 3TEWA 2PE9A 2I1JA 3VUXA 2MHJA 3I3TB 1AYFA 4S17A 2DENB 3ZTDA 2UU7A 4YTNB 4BOSC 3M62B 4OVUA 4EE2A 2IGDA 4W9DA 2N7JA 4DDID 2I38A 4LNKA 1DOYA 2ZNVB 2K0PA 1V6EA 2BWES 4LNOA 3MJ5A 3V6EB 4JWSC 2CHZA 2LFIA 5JHAA 1FEHA 2PJHA 2JX5A 3H7SA 2L83A 4ACFA 2KLGA 2NTTA 4M0WB 5BYRA 1FM0D 1F0ZA 3ML8A 1F9JA 4HPMB 1WMHB 2JZ3B 3AE6B 5D2MB 4OVVA 2K5PA 2KN4A 2MP2B 3R3MA 1FXIA 4YL8A 2NPTB 3Q14C 1ZGUB 3RNCC 2NBVB 5JH5C 1H4RA 2Z0EB 5HFYA 3B08A 3PHWB 4DXFA 2WNMA 2HTME 4XWTA 4G50A 4RM9A 1P7EA 3EFUA 2D3AA 3NHEB 2LHDA 4II3B 3BINA 4X57B 5FKAC 4MGKE 1V49A 2CU1A 1ENFA 1AW7A 3NUHB 1NI3A 1E7PB 1YJJA 1UBQA 1HA5A 4WJOA 4PYZA 1TS5A 3W1SC 3SFEB 1KOTA 1YOVB 1JWSD 4OZAA 4W9HA 3AE5B 1V86A 4M8MA 1V9JA 4GXBA 2QDFA 1B9RA 3U30A 1LM8B 4HXDA 1F1HA 1N63A 3DHIC 3DCGA 4AUQC 1QOGA 1OGWA 1WGHA 4BAXA 1R4NI 1XLOA 4MACA 2XK5B 1SEBD 1WGYA 1QKZA 5IN7A 2N1WA 2KOXA 1EU3A 2Z8LA 2GRIA 2QC8A 3IFWB 4IWPA 1QZEA 4HKQA 3S2AA 1WJ6A 2L7RA 5HHDG 2C60A 1E8ZA 5IOIA 2INCC 2WX0A 2GBRA 3BK2A 1P0RA 3ZJTA 4UDUC 1GPXA 3NVZA 4HCNB 3M63B 2X8XX 3L54A 2M1MA 2PVGC 3U2SC 3UF8A 4KV2A 2ZCBA 3ZDMC 4EZJA 2RMMA 1ROEA 1XF5L 2FUHB 3A33B 3I63C 2L32A 3KLSX 4A8XC 2BS4B 2AYOB 2PE6B 2R2OA 1S1QB 1T0QC 3EECA 2QSDA 2MA9B 3RCZA 4C00A 2LMCA 1SE3A 3R2TA 2M8SA 2JZZA 2KX3A 4IW0A 2DZKA 2EMSA 3CWIA 5EE1A 5E6OA 3TBLD 4C4VB 1Q10A 2BF8B 4JX1C 1I4RA 1ZPSA 4DWFA 2PMVA 1E8WA 4F7ZA 2KDEB 4F8CB 1IYFA 3AI5A 4TQ1A 1V1PB 1IBXA 1L4DB 1TS3A 3BY4B 4Q2JA 1C76A 1U4AA 1TZOA 1WZ0A 2BYVE 2PLPA 4EUTA 4KDLB 2LRUA 4KZ0A 1V5OA 3U7ZA 3GZNI 2LGSA 4DDGD 2D11A 3QC8B 2D3GA 1HXYD 4NQLB 4YTPB 1J8CA 3WCQA 2KACA 1RM6C 1VD2A 4I6PA 4KZCA 1NVID 3BVGA 1ISNA 3KUDB 4LK0M 1E7VA 3NVYA 3TEYA 2M4NA 5DPSA 2ZCCA 3ETRA 2UYZB 3T3OA 2D3BA 3H8HA 1BMLC 2WYQA 1ZE3D 5CTRC 2V0GA 3LJ3A 2M56B 1XLPA 3AMZA 3B9JA 4GDLA 4ICUA 1I7HA 5BMHA 1J0GA 3RULA 3Q8AA 4GDKB 1T5XD 4CO7A 2MJ3A 1HTOA 3JVZX 1Q0WB 4DHZE 2LJ5A 4PS3A 2GBKA 4WQMA 2AL6A 2LWPA 4EZKA 4RF0A 3U4EG 3ALBA 2W54A 2W9NA 1I4QA 3GB1A 1OEYJ 3L08A 2V9HA 4IWQA 1EU4A 1UELA 2M19A 4MJSB 3AE4B 3J9CA 1EM7A 2BT6A 1N5WA 3BYTB 2MLBA 4YTMB 1J7BA 2FIFA 2RDGA 2N0SB 1YQ3B 2D3CA 2WGSA 5C2TB 2N7DA 2BGFA 4GIVA 1VRAB 3DBSA 3DHHC 4ZRIA 1Z5SB 4KGRA 1GOZA 1WRDB 2MH7A 3UIOB 3AE9B 5EE9A 1CJEA 4AP4C 4FXCA 3AM9A 3A4SC 3GOEA 4WAAA 4JWUC 5GXGB 2WXJA 2MJEA 2ZJDA 1EWCA 3WANA 3OJ4B 2V4LA 3V6CB 1IPGA 2KFKA 3WALA 3W1YA 2BS3B 1P3QU 1WWTA 3IT6B 2Y5PA
chains in the Genus database with same CATH topology
3CSTA 4A20A 4MJSA 2DAFA 3RYTA 2XBBC 1YD8U 3APDA 1Q1OA 5D94A 4K7WA 3VH4B 3ZNHB 1C1YB 3QARA 3KYCD 3PSEB 2DZIA 3AU5A 2GMIC 3TIXA 3EC8A 4ANUA 3KVFB 4HJKA 1FXTB 2J0MA 2K25A 2R2QA 3ZRFA 4NAWB 4ZYNA 1RLFA 2KKCA 3H7PA 4WQOB 3P2BA 1WH3A 2KJRA 1KLVA 2RGFA 4EEWA 2MSED 2BYFA 5FR6A 2KTFA 2MX2A 1YJ1A 4RMAA 3SHQA 2WDTB 4HDOA 1V80A 3DVGY 3N30A 1WJUA 3KW5B 2OJRA 1Q5WB 2GBMA 2QHOA 2ZVOA 3KUZA 3PHXB 3PLUA 4W9JA 4GGQA 4FULA 1WI0A 1YQBA 1AARA 3H6NA 1P9DU 2DYMA 3ZNZB 2DZJA 3L17A 5IA7A 3ZTCA 2N9PC 3DQVA 2DX5B 3ENEA 3R7QA 4ZDVA 2A5UA 2FNJB 4FJYA 2MBBB 2LXCA 3CMMB 3L0WB 2WWZA 4J6IA 1P1AA 2IBIB 3SU8X 2LVPA 3A9KB 4KDIC 4IC7B 5L95C 5KHOA 1D3ZA 2KHWB 4HPLB 3RT3B 1L2NA 3PRPB 4BKTA 2LRWA 4JL9A 1MG8A 3Q3JA 4BBNC 4P7IA 4AJWA 3PLVA 3AXCA 4W9LA 3QA8A 4DHJB 2CHWA 1EF5A 2O6VD 3ECIA 4K1RB 3VFKA 3ZNID 2MBHA 2HD5B 2GOWA 4GSWA 3CF6E 2IO1B 1UH6A 2CS4A 2Z59B 5LLIA 3ZUNA 2PE9A 2I1JA 3VUXA 3I3TB 4W9GA 4A3OA 2IYDB 1WX9A 2DENB 4K7SA 1GG3A 4NAWA 3ZTDA 4RM8A 1WFYA 3A4RA 3VQIA 2KWCA 4BOSC 5CX3A 2YVCA 3PGEA 2M0XA 4FHKA 3M62B 3QJZA 3X23A 4ZRKA 4OVUA 1WXAA 4W9EA 4KIKB 4DK5A 4BFRA 1UZXB 1SIFA 2N1VA 2BWFA 4W9DA 4AWJA 1LXDA 3A1QB 4DDID 3X0WA 3VHTC 1TBEA 4FN2A 3VUYA 4XZ4A 4BOZB 2ZNVB 1V6EA 2BWES 5AZFA 4HVBA 4HWIB 2KC1A 4EKUA 1WF9A 3HIZA 3DDCB 3H1UA 3OJ3A 3V6EB 2CHZA 2NCNA 5JHAA 5IAAC 3RZFA 2K6DB 2RR9A 2PJHA 2BYEA 3KUCB 3IHPC 4LDTB 5AEKB 3HM3A 3RUIB 5BO4B 3A9KA 4ANWA 3H7SA 4JLCA 3WA0A 3NZUA 2JVCA 5DPTA 2KLGA 4GU2A 3QK0A 4EOYA 4M0WB 2BKRB 3PS6A 4WJQA 2B3AA 2L3ZA 3ML8A 1F9JA 2ZEQA 4HPMB 1ZKHA 1WMHB 2MWSB 2JZ3B 3IG3A 5D2MB 2O2VB 4OVVA 1RRBA 1WZ3A 3NS8A 2MP2B 3R3MA 4YL8A 1EUVB 2NS5A 2NPTB 2L0FA 1ZGUB 1E7UA 2KTRB 2NBVB 4KVGB 3VTVA 1WE7A 4NJ7A 1HE8A 5JH5C 4DHJD 1G6JA 2KD0A 1H4RA 2FAZA 3PVLA 2KJHB 2KX0A 2J0KA 2Z0EB 3B08A 3PHWB 3PZDA 3PV1A 5J17A 2OOBB 2M17A 2K8HA 2GBNA 4IG7B 4XX5A 3WIMA 1TGZB 2KC2A 2DYBA 4G50A 1NDDA 2HTHA 4MSMB 4RM9A 3IBEA 3EFUA 5TR5A 4KIKA 3NHEB 2IZVB 2L00B 4G3XB 2KO3A 2NBWB 1H8CA 3A1QA 3D32A 4II3B 3QQ8B 3BINA 4G0NB 4LCDE 4X57B 3L10B 4W9CA 4MGKE 2KJ6A 2IY1B 3DVGX 1V49A 4MEMA 2CU1A 4EFOA 5C1ZA 2AL3A 3UQBA 2K6QA 3W1SA 4TUUA 1T0YA 2KXJA 2AEHA 1JRUA 2N7EA 2ZNVC 5E6PA 3T9LA 1Y8RC 4A3PA 4I6LB 3ZLZA 2MCNB 2K1FA 4HK2A 4NY0A 1UBQA 4WJOA 5HKHA 4PYZA 1KOTA 3W1SC 2LGXA 2KZRA 2I1KA 3AU4A 2FCSA 3JSVB 4W9HA 1V86A 3N32A 1WX7A 4M8MA 1S3SG 1V9JA 4GXBA 2LD9A 2LASA 3U30A 1WMHA 3JW0X 1LM8B 2V1YA 2O2VA 4HXDA 4N9F4 3VDZA 4W9IA 4AJYB 2FCMA 2MP2A 3DCGA 1WXVA 3M3JA 4AUQC 3QHTA 1OGWA 1WGHA 1NI2A 2NPTA 3ZW3A 1R4NI 2XEWA 1C3TA 4DXAB 4NPNA 2KTRA 2NVUI 2YLMA 2JRHA 2L76A 4F1SA 2XK5B 4AOFA 3PRMB 1V81A 1WGGA 2FIDA 1WGYA 1KM7A 3TMPB 3UINB 2ZVNA 3R7RA 2N1WA 2BKFA 2KOXA 4KSLC 1ZW7A 5DCNA 2LVOA 3PT2B 3SD5A 1IP9A 3Q3FA 4WJPA 1WIAA 3IFWB 4IWPA 1QZEA 2DHZA 2KMCA 3S2AA 2L7RA 1WJ6A 4MELA 2C60A 1E8ZA 3HHMA 2WX0A 3PTFC 2GBRA 2LGYA 1P0RA 4HLEA 4HCNB 3UGBB 3M63B 5D7GA 5CHVC 1E8XA 1XT9B 3L54A 2M1MA 2EMTA 1TZ1A 3TL5A 2C5LC 3UF8A 4KV2A 1GJZA 1GUAB 4XC2A 2ZCBA 3ZDMC 4EZJA 3M95A 4E71A 3IVFA 1WM3A 4E74A 2JF5A 3JSVA 4MSQB 1J19A 1WGDA 2FUHB 3VVWB 3A33B 2ZPYA 4WJNA 4TKNA 2AYOB 2PE6B 2R2OA 1S1QB 2MQJA 3EECA 3VTUA 3ZRCA 4IUMB 1A5RA 2RD0A 2KQSA 2MA9B 3RCZA 2LI5A 1R4MI 1WYWB 2M8SA 2KDFB 2D2QA 2JZZA 2KX3A 1OEYA 2KFJA 3QAQA 2MRPA 4MH0E 2XK5A 2HE7A 4IW0A 4MDKE 4BKGA 3ZNGC 2LXAA 3APFA 3R66C 3NZSA 2DZKA 2EMSA 2KWVB 5DPWA 5DPRA 5E6OA 3TBLD 2ZPNA 3O65B 2G4SA 1V2YA 4LJPB 2LGDA 4ANVA 2N9EB 2C7MB 2BF8B 3ONSA 3ZDTA 2UWQA 4DWFA 5LXHA 1WGRA 3B0AA 2L0TA 2JUOA 2FCQA 1E8WA 2K8CA 4F7ZA 4K7UA 2K8BA 2KDEB 2D07B 3H9DA 1SGHA 4GDLB 4PS8A 1TTNA 3AI5A 4TQ1A 2O6VB 1IYFA 4B6WA 1RFAA 3VXWA 4GB9A 3VH3B 2DYOA 1WR6E 2JT4B 4FLHA 4PYUA 2KANA 2ZZPB 4EZLA 1CMXB 3BY4B 1E8YA 3A9JB 2MBQA 2IY0B 1U4AA 4ICVA 1WZ0A 2BYVE 4EUTA 1E90A 4FJZA 3RZWC 5JHBA 4KDLB 2NR2A 5C23A 5G55A 2LRUA 4KZ0A 1V5OA 1LQBA 1YX6B 2C9WB 3GZNI 3KH0A 2D10A 1YIWA 4DDGD 1BT0A 2D11A 3QC8B 2D3GA 4W9KA 2J7QB 2Z0DB 4E3CA 4K81A 4NQLB 2L8JA 4G11A 1WXMA 4F8CB 2N9XA 1Z2MA 1J8CA 3K9PB 3NOBA 1RAXA 2EKEC 1WR1A 2JPHA 1EF1A 1VD2A 2LVQA 4I6PA 4II2B 3TCAA 5LXIB 1GC6A 1UBIA 4KZCA 4I6NB 3NY5A 4MM3A 4HCPB 3WAMA 2KDBA 2G45B 2KNBA 1ISNA 3KUDB 4LDTD 4W9FA 3SDLC 3TJPA 1OQYA 1E7VA 2M4NA 4GN1A 2DAJA 1XD3B 3PREA 5DPSA 1WM2A 2VRRB 2ZCCA 2UYZB 2MBOA 4JIOU 4GMVA 2KDIA 2WYQA 2PPHA 3DBRI 3OLMD 3UIPB 4WWOA 4M8NA 3WAOA 2KN5A 2CHXA 5CTRC 2KLCA 3LJ3A 2DZMA 2MW5A 2MBEA 4FBJB 4CHKA 4BKSA 1PQSA 2LZ6A 4FA6A 4LJOB 2KMAA 3QWZB 3T8MA 3DBLI 4GDLA 4FJVB 1LFDA 2AWTA 4ICUA 2O6VA 3HK0A 3APCA 2IO3B 1XQQA 2PEAA 3PRZA 4DBGA 1I35A 1J0GA 4TV3A 3RULA 5E6NA 4GDKB 3VUWA 4CO7A 2RPQA 5D6JB 5J18A 3ML9A 3OAWA 4BKSD 2C7NB 3A9JA 4ZRJA 3ZIMA 2G4DB 2KK8A 2WX1A 3JVZX 4NJ6A 1WY8A 5GMVA 1K8RB 1Q0WB 1SE9A 4MGIE 4DHZE 2LJ5A 4PS3A 2GBKA 3VTWA 2AL6A 1WE6A 2HJ8A 2LWPA 4EZKA 2Y5BB 1I42A 2JRIB 3LDZE 1P98A 1KJTA 2KFKB 3QCAA 3RD2A 4B95A 3L16A 3ALBA 5AZHA 2W9NA 4URKA 5JZEB 4KSKC 5CHFA 3DOWA 4JQWC 1OEYJ 1L7YA 3L08A 4FHJA 4PS7A 4BVUC 3PPAA 4IWQA 1E5WA 1UELA 2CR5A 3B1LX 2JY6A 3ZVVA 3U7DA 4MJSB 1OTRB 3VAWA 3DVNV 1YX5B 1WJ4A 4ANXA 2V3SA 2ASQA 2JXXA 2MLBA 2GBJA 1EO6A 3DBHI 3DVNU 4MGYE 2FIFA 4IM2A 5EDSA 3QIJA 2BPSA 4DHZB 4TQ0A 3WAPA 2FCNA 3H7PB 1UGMA 1WXSA 3AULA 5L83A 4IM0A 2N7DA 2BGFA 4GIVA 4MGZE 3MHSD 4IWOA 3V60A 5AZGA 2KWUB 1X1MA 1GNUA 2REXA 3C0RB 1NBFC 2IO0B 3DBSA 3L13A 4NNJB 5CHWA 4ZRIA 1Z5SB 2KQ7A 4NQKE 2LUEA 3MJWA 2KVRA 2JWZA 4JGHB 2N4FA 3K9OB 3KYDD 1WRDB 4IM3A 1GC7A 4WWPA 2NBUA 3N3KB 3UIOB 1WJNA 5G2NA 3U8ZA 4AP4C 2RSUA 2C7HA 3EHVA 4GDKA 2IO2B 3ZKJC 3DPDA 2K39A 3A4SC 3HM6X 4WWNA 2L05A 4CYEA 3GOEA 3QX1A 3V62A 1WX8A 1M94A 4WAAA 4FADA 3CSFA 4GOCA 4HDQA 2ZJDA 5J2RA 3WANA 3OJ4B 2V4LA 3MTNB 3V6CB 1IPGA 2KFKA 3WALA 2J0JA 3JYUA 3W1YA 1UD7A 2A4ZA 3UQAA 5KHQA 1VCBA 1V5TA 4ASWC 4BBNF 1P3QU 4B9KA 2CKHB 3ZO5B 3V61A 2G3QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CST A;  4A20 A;  4MJS A;  2DAF A;  3RYT A;  2XBB C;  1YD8 U;  3APD A;  1Q1O A;  5D94 A;  4K7W A;  3VH4 B;  3ZNH B;  1C1Y B;  3QAR A;  3KYC D;  3PSE B;  2DZI A;  3AU5 A;  2GMI C;  3TIX A;  3EC8 A;  4ANU A;  3KVF B;  4HJK A;  1FXT B;  2J0M A;  2K25 A;  2R2Q A;  3ZRF A;  4NAW B;  4ZYN A;  1RLF A;  2KKC A;  3H7P A;  4WQO B;  3P2B A;  1WH3 A;  2KJR A;  1KLV A;  2RGF A;  4EEW A;  2MSE D;  2BYF A;  5FR6 A;  2KTF A;  2MX2 A;  1YJ1 A;  4RMA A;  3SHQ A;  2WDT B;  4HDO A;  1V80 A;  3DVG Y;  3N30 A;  1WJU A;  3KW5 B;  2OJR A;  1Q5W B;  2GBM A;  2QHO A;  2ZVO A;  3KUZ A;  3PHX B;  3PLU A;  4W9J A;  4GGQ A;  4FUL A;  1WI0 A;  1YQB A;  1AAR A;  3H6N A;  1P9D U;  2DYM A;  3ZNZ B;  2DZJ A;  3L17 A;  5IA7 A;  3ZTC A;  2N9P C;  3DQV A;  2DX5 B;  3ENE A;  3R7Q A;  4ZDV A;  2A5U A;  2FNJ B;  4FJY A;  2MBB B;  2LXC A;  3CMM B;  3L0W B;  2WWZ A;  4J6I A;  1P1A A;  2IBI B;  3SU8 X;  2LVP A;  3A9K B;  4KDI C;  4IC7 B;  5L95 C;  5KHO A;  1D3Z A;  2KHW B;  4HPL B;  3RT3 B;  1L2N A;  3PRP B;  4BKT A;  2LRW A;  4JL9 A;  1MG8 A;  3Q3J A;  4BBN C;  4P7I A;  4AJW A;  3PLV A;  3AXC A;  4W9L A;  3QA8 A;  4DHJ B;  2CHW A;  1EF5 A;  2O6V D;  3ECI A;  4K1R B;  3VFK A;  3ZNI D;  2MBH A;  2HD5 B;  2GOW A;  4GSW A;  3CF6 E;  2IO1 B;  1UH6 A;  2CS4 A;  2Z59 B;  5LLI A;  3ZUN A;  2PE9 A;  2I1J A;  3VUX A;  3I3T B;  4W9G A;  4A3O A;  2IYD B;  1WX9 A;  2DEN B;  4K7S A;  1GG3 A;  4NAW A;  3ZTD A;  4RM8 A;  1WFY A;  3A4R A;  3VQI A;  2KWC A;  4BOS C;  5CX3 A;  2YVC A;  3PGE A;  2M0X A;  4FHK A;  3M62 B;  3QJZ A;  3X23 A;  4ZRK A;  4OVU A;  1WXA A;  4W9E A;  4KIK B;  4DK5 A;  4BFR A;  1UZX B;  1SIF A;  2N1V A;  2BWF A;  4W9D A;  4AWJ A;  1LXD A;  3A1Q B;  4DDI D;  3X0W A;  3VHT C;  1TBE A;  4FN2 A;  3VUY A;  4XZ4 A;  4BOZ B;  2ZNV B;  1V6E A;  2BWE S;  5AZF A;  4HVB A;  4HWI B;  2KC1 A;  4EKU A;  1WF9 A;  3HIZ A;  3DDC B;  3H1U A;  3OJ3 A;  3V6E B;  2CHZ A;  2NCN A;  5JHA A;  5IAA C;  3RZF A;  2K6D B;  2RR9 A;  2PJH A;  2BYE A;  3KUC B;  3IHP C;  4LDT B;  5AEK B;  3HM3 A;  3RUI B;  5BO4 B;  3A9K A;  4ANW A;  3H7S A;  4JLC A;  3WA0 A;  3NZU A;  2JVC A;  5DPT A;  2KLG A;  4GU2 A;  3QK0 A;  4EOY A;  4M0W B;  2BKR B;  3PS6 A;  4WJQ A;  2B3A A;  2L3Z A;  3ML8 A;  1F9J A;  2ZEQ A;  4HPM B;  1ZKH A;  1WMH B;  2MWS B;  2JZ3 B;  3IG3 A;  5D2M B;  2O2V B;  4OVV A;  1RRB A;  1WZ3 A;  3NS8 A;  2MP2 B;  3R3M A;  4YL8 A;  1EUV B;  2NS5 A;  2NPT B;  2L0F A;  1ZGU B;  1E7U A;  2KTR B;  2NBV B;  4KVG B;  3VTV A;  1WE7 A;  4NJ7 A;  1HE8 A;  5JH5 C;  4DHJ D;  1G6J A;  2KD0 A;  1H4R A;  2FAZ A;  3PVL A;  2KJH B;  2KX0 A;  2J0K A;  2Z0E B;  3B08 A;  3PHW B;  3PZD A;  3PV1 A;  5J17 A;  2OOB B;  2M17 A;  2K8H A;  2GBN A;  4IG7 B;  4XX5 A;  3WIM A;  1TGZ B;  2KC2 A;  2DYB A;  4G50 A;  1NDD A;  2HTH A;  4MSM B;  4RM9 A;  3IBE A;  3EFU A;  5TR5 A;  4KIK A;  3NHE B;  2IZV B;  2L00 B;  4G3X B;  2KO3 A;  2NBW B;  1H8C A;  3A1Q A;  3D32 A;  4II3 B;  3QQ8 B;  3BIN A;  4G0N B;  4LCD E;  4X57 B;  3L10 B;  4W9C A;  4MGK E;  2KJ6 A;  2IY1 B;  3DVG X;  1V49 A;  4MEM A;  2CU1 A;  4EFO A;  5C1Z A;  2AL3 A;  3UQB A;  2K6Q A;  3W1S A;  4TUU A;  1T0Y A;  2KXJ A;  2AEH A;  1JRU A;  2N7E A;  2ZNV C;  5E6P A;  3T9L A;  1Y8R C;  4A3P A;  4I6L B;  3ZLZ A;  2MCN B;  2K1F A;  4HK2 A;  4NY0 A;  1UBQ A;  4WJO A;  5HKH A;  4PYZ A;  1KOT A;  3W1S C;  2LGX A;  2KZR A;  2I1K A;  3AU4 A;  2FCS A;  3JSV B;  4W9H A;  1V86 A;  3N32 A;  1WX7 A;  4M8M A;  1S3S G;  1V9J A;  4GXB A;  2LD9 A;  2LAS A;  3U30 A;  1WMH A;  3JW0 X;  1LM8 B;  2V1Y A;  2O2V A;  4HXD A;  4N9F 4;  3VDZ A;  4W9I A;  4AJY B;  2FCM A;  2MP2 A;  3DCG A;  1WXV A;  3M3J A;  4AUQ C;  3QHT A;  1OGW A;  1WGH A;  1NI2 A;  2NPT A;  3ZW3 A;  1R4N I;  2XEW A;  1C3T A;  4DXA B;  4NPN A;  2KTR A;  2NVU I;  2YLM A;  2JRH A;  2L76 A;  4F1S A;  2XK5 B;  4AOF A;  3PRM B;  1V81 A;  1WGG A;  2FID A;  1WGY A;  1KM7 A;  3TMP B;  3UIN B;  2ZVN A;  3R7R A;  2N1W A;  2BKF A;  2KOX A;  4KSL C;  1ZW7 A;  5DCN A;  2LVO A;  3PT2 B;  3SD5 A;  1IP9 A;  3Q3F A;  4WJP A;  1WIA A;  3IFW B;  4IWP A;  1QZE A;  2DHZ A;  2KMC A;  3S2A A;  2L7R A;  1WJ6 A;  4MEL A;  2C60 A;  1E8Z A;  3HHM A;  2WX0 A;  3PTF C;  2GBR A;  2LGY A;  1P0R A;  4HLE A;  4HCN B;  3UGB B;  3M63 B;  5D7G A;  5CHV C;  1E8X A;  1XT9 B;  3L54 A;  2M1M A;  2EMT A;  1TZ1 A;  3TL5 A;  2C5L C;  3UF8 A;  4KV2 A;  1GJZ A;  1GUA B;  4XC2 A;  2ZCB A;  3ZDM C;  4EZJ A;  3M95 A;  4E71 A;  3IVF A;  1WM3 A;  4E74 A;  2JF5 A;  3JSV A;  4MSQ B;  1J19 A;  1WGD A;  2FUH B;  3VVW B;  3A33 B;  2ZPY A;  4WJN A;  4TKN A;  2AYO B;  2PE6 B;  2R2O A;  1S1Q B;  2MQJ A;  3EEC A;  3VTU A;  3ZRC A;  4IUM B;  1A5R A;  2RD0 A;  2KQS A;  2MA9 B;  3RCZ A;  2LI5 A;  1R4M I;  1WYW B;  2M8S A;  2KDF B;  2D2Q A;  2JZZ A;  2KX3 A;  1OEY A;  2KFJ A;  3QAQ A;  2MRP A;  4MH0 E;  2XK5 A;  2HE7 A;  4IW0 A;  4MDK E;  4BKG A;  3ZNG C;  2LXA A;  3APF A;  3R66 C;  3NZS A;  2DZK A;  2EMS A;  2KWV B;  5DPW A;  5DPR A;  5E6O A;  3TBL D;  2ZPN A;  3O65 B;  2G4S A;  1V2Y A;  4LJP B;  2LGD A;  4ANV A;  2N9E B;  2C7M B;  2BF8 B;  3ONS A;  3ZDT A;  2UWQ A;  4DWF A;  5LXH A;  1WGR A;  3B0A A;  2L0T A;  2JUO A;  2FCQ A;  1E8W A;  2K8C A;  4F7Z A;  4K7U A;  2K8B A;  2KDE B;  2D07 B;  3H9D A;  1SGH A;  4GDL B;  4PS8 A;  1TTN A;  3AI5 A;  4TQ1 A;  2O6V B;  1IYF A;  4B6W A;  1RFA A;  3VXW A;  4GB9 A;  3VH3 B;  2DYO A;  1WR6 E;  2JT4 B;  4FLH A;  4PYU A;  2KAN A;  2ZZP B;  4EZL A;  1CMX B;  3BY4 B;  1E8Y A;  3A9J B;  2MBQ A;  2IY0 B;  1U4A A;  4ICV A;  1WZ0 A;  2BYV E;  4EUT A;  1E90 A;  4FJZ A;  3RZW C;  5JHB A;  4KDL B;  2NR2 A;  5C23 A;  5G55 A;  2LRU A;  4KZ0 A;  1V5O A;  1LQB A;  1YX6 B;  2C9W B;  3GZN I;  3KH0 A;  2D10 A;  1YIW A;  4DDG D;  1BT0 A;  2D11 A;  3QC8 B;  2D3G A;  4W9K A;  2J7Q B;  2Z0D B;  4E3C A;  4K81 A;  4NQL B;  2L8J A;  4G11 A;  1WXM A;  4F8C B;  2N9X A;  1Z2M A;  1J8C A;  3K9P B;  3NOB A;  1RAX A;  2EKE C;  1WR1 A;  2JPH A;  1EF1 A;  1VD2 A;  2LVQ A;  4I6P A;  4II2 B;  3TCA A;  5LXI B;  1GC6 A;  1UBI A;  4KZC A;  4I6N B;  3NY5 A;  4MM3 A;  4HCP B;  3WAM A;  2KDB A;  2G45 B;  2KNB A;  1ISN A;  3KUD B;  4LDT D;  4W9F A;  3SDL C;  3TJP A;  1OQY A;  1E7V A;  2M4N A;  4GN1 A;  2DAJ A;  1XD3 B;  3PRE A;  5DPS A;  1WM2 A;  2VRR B;  2ZCC A;  2UYZ B;  2MBO A;  4JIO U;  4GMV A;  2KDI A;  2WYQ A;  2PPH A;  3DBR I;  3OLM D;  3UIP B;  4WWO A;  4M8N A;  3WAO A;  2KN5 A;  2CHX A;  5CTR C;  2KLC A;  3LJ3 A;  2DZM A;  2MW5 A;  2MBE A;  4FBJ B;  4CHK A;  4BKS A;  1PQS A;  2LZ6 A;  4FA6 A;  4LJO B;  2KMA A;  3QWZ B;  3T8M A;  3DBL I;  4GDL A;  4FJV B;  1LFD A;  2AWT A;  4ICU A;  2O6V A;  3HK0 A;  3APC A;  2IO3 B;  1XQQ A;  2PEA A;  3PRZ A;  4DBG A;  1I35 A;  1J0G A;  4TV3 A;  3RUL A;  5E6N A;  4GDK B;  3VUW A;  4CO7 A;  2RPQ A;  5D6J B;  5J18 A;  3ML9 A;  3OAW A;  4BKS D;  2C7N B;  3A9J A;  4ZRJ A;  3ZIM A;  2G4D B;  2KK8 A;  2WX1 A;  3JVZ X;  4NJ6 A;  1WY8 A;  5GMV A;  1K8R B;  1Q0W B;  1SE9 A;  4MGI E;  4DHZ E;  2LJ5 A;  4PS3 A;  2GBK A;  3VTW A;  2AL6 A;  1WE6 A;  2HJ8 A;  2LWP A;  4EZK A;  2Y5B B;  1I42 A;  2JRI B;  3LDZ E;  1P98 A;  1KJT A;  2KFK B;  3QCA A;  3RD2 A;  4B95 A;  3L16 A;  3ALB A;  5AZH A;  2W9N A;  4URK A;  5JZE B;  4KSK C;  5CHF A;  3DOW A;  4JQW C;  1OEY J;  1L7Y A;  3L08 A;  4FHJ A;  4PS7 A;  4BVU C;  3PPA A;  4IWQ A;  1E5W A;  1UEL A;  2CR5 A;  3B1L X;  2JY6 A;  3ZVV A;  3U7D A;  4MJS B;  1OTR B;  3VAW A;  3DVN V;  1YX5 B;  1WJ4 A;  4ANX A;  2V3S A;  2ASQ A;  2JXX A;  2MLB A;  2GBJ A;  1EO6 A;  3DBH I;  3DVN U;  4MGY E;  2FIF A;  4IM2 A;  5EDS A;  3QIJ A;  2BPS A;  4DHZ B;  4TQ0 A;  3WAP A;  2FCN A;  3H7P B;  1UGM A;  1WXS A;  3AUL A;  5L83 A;  4IM0 A;  2N7D A;  2BGF A;  4GIV A;  4MGZ E;  3MHS D;  4IWO A;  3V60 A;  5AZG A;  2KWU B;  1X1M A;  1GNU A;  2REX A;  3C0R B;  1NBF C;  2IO0 B;  3DBS A;  3L13 A;  4NNJ B;  5CHW A;  4ZRI A;  1Z5S B;  2KQ7 A;  4NQK E;  2LUE A;  3MJW A;  2KVR A;  2JWZ A;  4JGH B;  2N4F A;  3K9O B;  3KYD D;  1WRD B;  4IM3 A;  1GC7 A;  4WWP A;  2NBU A;  3N3K B;  3UIO B;  1WJN A;  5G2N A;  3U8Z A;  4AP4 C;  2RSU A;  2C7H A;  3EHV A;  4GDK A;  2IO2 B;  3ZKJ C;  3DPD A;  2K39 A;  3A4S C;  3HM6 X;  4WWN A;  2L05 A;  4CYE A;  3GOE A;  3QX1 A;  3V62 A;  1WX8 A;  1M94 A;  4WAA A;  4FAD A;  3CSF A;  4GOC A;  4HDQ A;  2ZJD A;  5J2R A;  3WAN A;  3OJ4 B;  2V4L A;  3MTN B;  3V6C B;  1IPG A;  2KFK A;  3WAL A;  2J0J A;  3JYU A;  3W1Y A;  1UD7 A;  2A4Z A;  3UQA A;  5KHQ A;  1VCB A;  1V5T A;  4ASW C;  4BBN F;  1P3Q U;  4B9K A;  2CKH B;  3ZO5 B;  3V61 A;  2G3Q B; 
#chains in the Genus database with same CATH topology
 3PZ7 A;  3CST A;  4A20 A;  1YD8 U;  2WHI A;  4R3D A;  1Q1O A;  4K7W A;  3QAR A;  2WXG A;  3KYC D;  2WXO A;  3PSE B;  3AU5 A;  3TIX A;  3KVF B;  3HRD D;  3P2B A;  1T0R C;  2K22 A;  5BMI A;  2KTF A;  1YJ1 A;  4HDO A;  1V80 A;  3N30 A;  3NRZ A;  1WJU A;  2OJR A;  3PLU A;  1MJD A;  3PZ8 A;  1FD6 A;  2DYM A;  1UWM A;  3ENE A;  4ZDV A;  5G5G A;  2IJ0 A;  2R61 A;  3FIL A;  4RFB A;  3L4P A;  1I4X A;  3SU8 X;  2LVP A;  3W5U B;  5L95 C;  1L2N A;  2LRW A;  4JL9 A;  2JXT A;  3PLV A;  3AXC A;  2M0A A;  4A55 A;  4W9L A;  4DHJ B;  1EF5 A;  4US8 A;  1MHH E;  3VFK A;  3ZNI D;  1FXA A;  4REZ A;  1YJI A;  2CS4 A;  5LLI A;  5FK9 C;  4XWW A;  4A3O A;  2IYD B;  1F77 A;  3I5J C;  1HZ5 A;  4NAW A;  1IUE A;  4YSZ B;  2PVO D;  3QJZ A;  4ZRK A;  4W9E A;  4DK5 A;  4BFR A;  4RGO S;  1C4A A;  3X0W A;  4BOZ B;  5AZF A;  4HVB A;  4ZRP A;  1M4V A;  3H1U A;  2NCN A;  3NVW A;  3RZF A;  2RR9 A;  3KUC B;  3BII D;  2W3S A;  3A9K A;  3Q2A C;  1OQQ A;  3NZU A;  5DPT A;  3QK0 A;  2VZK D;  2BKR B;  3Q6B A;  2L3Z A;  2AQ3 B;  2W82 A;  3IG3 A;  1JW9 D;  1R4M B;  1F2R I;  1SB3 C;  1KLU D;  3RNG C;  2NS5 A;  1V8C A;  4LNF A;  2KTR B;  4NJ7 A;  2FAZ A;  1PYW D;  2L1A A;  3PV1 A;  5J17 A;  4HPP A;  4YXD B;  4IG7 B;  4XX5 A;  2DYB A;  1NDD A;  3EGR A;  2HTH A;  4MSM B;  2WXH A;  3SFD B;  2AQ1 B;  2KO3 A;  3HVD A;  2NBW B;  4LCD E;  3L10 B;  2AL3 A;  3RFZ B;  3E9S A;  3UQB A;  4RGT A;  2KXJ A;  1JRU A;  2W55 A;  3T9L A;  4L2Y A;  4XGA B;  4A3P A;  1JCK B;  2K1F A;  4BZA A;  5LNK 1;  2LGX A;  1CZP A;  4M0W A;  3JSV B;  5FR3 A;  5EE3 A;  1WMH A;  2DNF A;  2V1Y A;  2HJ1 A;  4N9F 4;  2WP9 B;  2KQ4 X;  2MP2 A;  1WXV A;  4HKZ E;  5D3D A;  3QHT A;  2NPT A;  1BUI C;  2XEW A;  4P6V F;  3ABV B;  2NVU I;  2JRH A;  2L76 A;  4F1S A;  4AOF A;  1N62 A;  2FID A;  2LHE A;  2ZVN A;  2BKF A;  1ZW7 A;  5DCN A;  3Q3F A;  1FPY A;  1FO4 A;  4PT5 A;  2DHZ A;  3P4P B;  3Q3M C;  2V4I B;  3BVZ A;  4ZHP A;  4HLE A;  5I4D A;  4IDI A;  5CHV C;  1MHX A;  2EMT A;  3MC0 B;  1TJE A;  3Q3N C;  3N1X C;  4JE3 B;  3M95 A;  4KGT A;  3IVF A;  2JF5 A;  1JWM D;  1J19 A;  2WQY B;  4K3C A;  1SF0 A;  4TKN A;  2MQJ A;  3ZRC A;  3TUO A;  1A5R A;  4LTU A;  2LI5 A;  1WYW B;  2RDH A;  2D2Q A;  4MM3 B;  1JQ4 A;  3BWU D;  3QAQ A;  1L0V B;  2XK5 A;  1JWB D;  3ZNG C;  1D4B A;  3APF A;  5DPR A;  4N6E B;  3AEC B;  3ZQ4 A;  3P4S B;  2ZW1 A;  1ET9 A;  1E9M A;  3ZDT A;  2UWQ A;  1MPE A;  1WGR A;  2GI9 A;  2FCQ A;  1VZ8 A;  2K8C A;  4PS8 A;  2D5G A;  3C19 A;  1ZDV A;  2DYO A;  2JT4 B;  3P4Q B;  1DOI A;  2ZZP B;  3VR8 B;  1E0Z A;  2XNA C;  2IY0 B;  1YN5 A;  4MT5 A;  1E90 A;  2ONQ A;  5JHB A;  5C23 A;  1LQB A;  3KH0 A;  1K52 A;  1PGB A;  2J7Q B;  2Z0D B;  1D6E C;  1WXM A;  2JYE A;  3NOB A;  5C3J B;  1YMH E;  1RAX A;  1WYG A;  1WR1 A;  1EF1 A;  2B76 B;  2LVQ A;  5LXI B;  2E6X A;  1ZOY B;  2KDB A;  2MEK A;  1D5X C;  2X38 A;  3TJP A;  1OQY A;  3AV8 A;  1T3Q A;  3PRE A;  1WM2 A;  1C9F A;  4C4V A;  2IPK D;  2KDI A;  4C7Z A;  2PPH A;  3DBR I;  1MFW A;  1J7C A;  4M8N A;  3WAO A;  3P1M A;  2FUG 1;  2INP E;  2VZK B;  1JAL A;  4FBJ B;  4LLG M;  1PQS A;  2LZ6 A;  4LJO B;  3QWZ B;  4FJV B;  1LFD A;  2AWT A;  3APC A;  2IO3 B;  2PEA A;  1V1P A;  1I35 A;  3DBL B;  2H89 B;  3OAW A;  3IAS 1;  4ZRJ A;  3ZIM A;  4IKG A;  2BB5 A;  2KK8 A;  1VZ6 A;  4MGI E;  2KDM A;  1WE6 A;  2HJ8 A;  5AUK A;  2JRI B;  2BB6 A;  2GLS A;  5JZE B;  4KSK C;  5CHF A;  4FHJ A;  4ZHO A;  2FE8 A;  4PS7 A;  3ZGZ A;  1E5W A;  2CR5 A;  3U52 E;  3MC9 A;  3DVN V;  3UI3 A;  4ANX A;  5JXV A;  2V3S A;  1F52 A;  2JXX A;  1RFK A;  3RNB C;  2BPS A;  4DHZ B;  3WAP A;  4DQO C;  4KGS A;  1WXS A;  5L83 A;  4IWO A;  5AZG A;  1SIJ A;  1GNU A;  2REX A;  3L13 A;  5CHW A;  4XDC A;  2KQ7 A;  1TY2 A;  2GB1 A;  3MJW A;  3MHZ A;  2KVR A;  3K9O B;  2RDB C;  1GC7 A;  4WWP A;  2NBU A;  4D2K A;  1WJN A;  4GDK A;  2BQQ A;  2QCZ A;  3ZKJ C;  1VJK A;  2K39 A;  1UNS A;  4CYE A;  3V62 A;  3NVV A;  2QIL A;  1WX8 A;  1IGD A;  1JRO A;  5J2R A;  1HQR D;  1QOF A;  2DLB A;  2K3U A;  2LUM A;  3JYU A;  1WSP A;  3Q8B A;  3UQA A;  4ASW C;  4BBN F;  4C56 C;  2QMT A;  3V61 A;  3LB8 C;  3FC4 A;  2DAF A;  4MJS A;  5BYQ A;  3RYT A;  5D94 A;  3ZNH B;  3VH4 B;  1SE4 A;  2DZI A;  2WDR B;  5H8Y E;  2J0M A;  1RYJ A;  3AEE B;  2K25 A;  2R2Q A;  2N9K A;  2WXM A;  4ZYN A;  2KKC A;  3RNA C;  3ZRF A;  4QAY A;  3I9V 1;  2MSE D;  4EEW A;  3AEG B;  5FR6 A;  3P63 A;  3SHQ A;  1Q5W B;  1P9D U;  3ZNZ B;  5IA7 A;  2DX5 B;  3R7Q A;  2A5U A;  3FAH A;  2FNJ B;  2MBB B;  1CQV A;  2LXC A;  2KVZ A;  3CMM B;  4J6I A;  1HTQ A;  2DWQ A;  2IBI B;  2WLB A;  1NYQ A;  2JU6 X;  4BBN C;  4P7I A;  2CHW A;  2O6V D;  1R4N B;  1MVK A;  2J53 A;  2MBH A;  3N9Y C;  2KAJ A;  1ZXI A;  1WX9 A;  4K7S A;  3AE8 B;  4RM8 A;  5BMG A;  3RN9 C;  1SJH D;  3A4R A;  3EUB 2;  2YVC A;  2QJL A;  2M0X A;  4FHK A;  5IO9 A;  5G5H A;  4ARI A;  4KIK B;  3Q3O C;  1D5Z C;  1SIF A;  5H92 C;  2OED A;  3A1Q B;  4H2A A;  3VHT C;  1TBE A;  1GB1 A;  3VUY A;  4XZ4 A;  3GE3 C;  1NEN B;  4YSX B;  4K3B A;  4EKU A;  2KC1 A;  3OJ3 A;  2BYT A;  5IAA C;  2K6D B;  2V3P A;  2BYE A;  5AEK B;  5BO4 B;  3KQ4 A;  2JVC A;  3VRB B;  4WJQ A;  2B3A A;  2JYT A;  3ZJU A;  4TMA B;  3LYY A;  2O2V B;  1RRB A;  1WZ3 A;  3ZXV A;  2LEK A;  3NG0 A;  1A70 A;  1EUV B;  1MG4 A;  3VTV A;  4KVG B;  1G6J A;  4OZB A;  2WXF A;  3AN1 A;  3NZ3 A;  3PVL A;  4P16 A;  2J0K A;  2JQR B;  2M17 A;  4WAF A;  1TGZ B;  3IBE A;  1SXT A;  1ZUD 2;  5TR5 A;  2IZV B;  2L00 B;  4G3X B;  2L52 A;  1STE A;  3D32 A;  3QQ8 B;  3DHG C;  1AWD A;  4ZRQ A;  5C1Z A;  2K6Q A;  3W1S A;  3AE7 B;  2AEH A;  2J4X A;  1BXT A;  1QQR A;  2EEL A;  2ACZ B;  4XDD A;  3GZN B;  4NY0 A;  5T8I A;  5HKH A;  2KZR A;  2I1K A;  3AB5 A;  3P4R B;  1IGC A;  1WX7 A;  3AEB B;  1SSN A;  2LD9 A;  2LAS A;  5E6J A;  3JW0 X;  1FNV A;  3VDZ A;  2FCM A;  4RH6 A;  3GE8 C;  3ZW3 A;  1K53 A;  2JWU A;  1C3T A;  3NS1 A;  2KTR A;  2FBW B;  2YLM A;  4DXG A;  3PRM B;  2Y3A A;  1WGG A;  1FCC C;  1KM7 A;  3UIN B;  1IP9 A;  3MFG A;  2WS3 B;  2W3R A;  3KWL A;  2E3T A;  3GP7 A;  2WU5 B;  2WXI A;  5D3I B;  3UGB B;  5D7G A;  1XT9 B;  4RGM A;  3RMK C;  1XLQ A;  3TL5 A;  1GJZ A;  1GUA B;  4XC2 A;  4NZL B;  4E71 A;  2BS2 B;  3JSV A;  4MSQ B;  3ZYY X;  1WGD A;  1XXG A;  3VVW B;  4YWG G;  4WJN A;  1K50 A;  1ET6 A;  1TT5 B;  1PFD A;  4IUM B;  1OQR A;  2KQS A;  1VR9 A;  1TKE A;  4GLS C;  2ICI A;  3Q8F A;  2HE7 A;  4MDK E;  4BKG A;  3TSS A;  2LXA A;  1TIF A;  2Y5C A;  3P42 A;  3O65 B;  2G4S A;  2EKI A;  1MI0 A;  1V2Y A;  4WIP A;  1SBB B;  1ESF A;  1TKG A;  4RCO A;  1TS2 A;  2L0T A;  3FIL B;  3VR9 B;  2K8B A;  1T6B X;  1EWY C;  3OWE B;  2D07 B;  1SGH A;  3N1Z C;  4M01 A;  2O6V B;  4B6W A;  3VXW A;  5EE0 A;  1XCT L;  3VH3 B;  1WR6 E;  2KAN A;  1CMX B;  1UWX A;  1E8Y A;  1KF6 B;  3A9J B;  2MBQ A;  1QIL A;  4ICV A;  1WGK A;  1V97 A;  3RZW C;  1L6U A;  2KMM A;  1QF6 A;  1XCQ L;  5G55 A;  2C9W B;  3R2I A;  1NYR A;  2D10 A;  5TSS A;  1YIW A;  1BT0 A;  4E3C A;  4A6Q A;  4G11 A;  2HDE A;  2CJO A;  2N9X A;  1Z2M A;  1XLN A;  3K9P B;  2INN E;  2JPH A;  4II2 B;  3TCA A;  3TEX A;  4I6N B;  3AE2 B;  4HEA 1;  4MM3 A;  4HCP B;  2G45 B;  2KNB A;  4LDT D;  2K9X A;  3SDL C;  1SJE D;  4GN1 A;  2DAJ A;  1XD3 B;  2WXR A;  2MBO A;  2ON8 A;  3CIR B;  4ZOH C;  4C7Y A;  2ZW0 A;  2KN5 A;  2CHX A;  4CHK A;  4BKS A;  3MC8 A;  3DBL I;  4DBG A;  4US9 A;  2G9H D;  4TSS A;  1KTK A;  2QEJ C;  2RPQ A;  1DGJ A;  5J18 A;  2WX1 A;  4RGN A;  1WY8 A;  5GMV A;  1SE9 A;  2N9L A;  1LGR A;  3B2F A;  3VTW A;  4YSY B;  3LDZ E;  1P98 A;  4B95 A;  3L16 A;  1C4C A;  5AZH A;  4URK A;  1N61 A;  3DOW A;  4JQW C;  1L7Y A;  3B1L X;  2JY6 A;  2PIA A;  3U7D A;  2AQ2 B;  1FMA D;  1YX5 B;  1WJ4 A;  1PGA A;  4RNA A;  1FFV A;  5IP4 D;  2GBJ A;  1EO6 A;  5EDS A;  1AN8 A;  1GB4 A;  4TQ0 A;  2FCN A;  3H7P B;  1UGM A;  3DBH B;  1FIQ A;  3AUL A;  4MGZ E;  2KWU B;  3C0R B;  1NBF C;  3W5V B;  3KWV A;  4NQK E;  3HUI A;  4JGH B;  1ACC A;  2JZP A;  4IM3 A;  4HRO A;  5G2N A;  2RSU A;  1K51 A;  2C7H A;  3EHV A;  2IO2 B;  2Q5W D;  3HM6 X;  2L05 A;  5IKC M;  4LNI A;  3ZXR A;  2BBC A;  1M94 A;  1TS4 A;  1XEE A;  4FAD A;  3CSF A;  4GOC A;  4HDQ A;  3MTN B;  1E6E B;  2J0J A;  2IDY A;  1V1O A;  4B0E A;  1P7F A;  2A4Z A;  1VCB A;  2YEP F;  2CKH B;  3ZO5 B;  3BZD B;  4OHJ A;  2XBB C;  3APD A;  1C1Y B;  1KH0 A;  3BK1 A;  3SR6 A;  1L0Y B;  1I4H A;  3N1Y C;  1RLF A;  4WQO B;  4ITK A;  1KLV A;  1FCL A;  2RGF A;  2BVC A;  4C80 A;  2J42 A;  2WDT B;  4KX6 B;  3DVG Y;  4WUR A;  2GBM A;  3KUZ A;  4W9J A;  1GAQ B;  3R8B A;  4GGQ A;  1R7S A;  4NJC A;  1AAR A;  3H6N A;  3T3N A;  3L17 A;  3ZTC A;  1J7A A;  1I4P A;  4FJY A;  1C79 A;  1HZ6 A;  1I4G A;  2WWZ A;  3N20 C;  4NAM A;  3FKY A;  4IC7 B;  5KHO A;  1D3Z A;  2PKO A;  2KHW B;  3ZJV A;  1MG8 A;  3Q3J A;  3Q8C A;  2PW9 A;  5HI1 A;  3ECI A;  4K1R B;  2WDQ B;  2HD5 B;  4M02 A;  4AS1 A;  1VZ7 A;  2NMQ A;  2LGI A;  2H88 B;  4W9G A;  1GG3 A;  3OG5 A;  4OVZ A;  3URY A;  1WFY A;  3VQI A;  2KWC A;  5CX3 A;  3PGE A;  3X23 A;  1TYG B;  1WXA A;  1C78 A;  1UZX B;  1UF0 A;  2N1V A;  2BWF A;  4AWJ A;  1LXD A;  4IOI E;  4FN2 A;  1SE2 A;  4HWI B;  1YN4 A;  4M00 A;  1WF9 A;  3HIZ A;  3DDC B;  1RWS A;  1QLB B;  2AX5 A;  4O1N A;  3BVM A;  1JML A;  3IHP C;  4LDT B;  3HM3 A;  3RUI B;  2KT7 A;  1XO3 A;  4ANW A;  4JLC A;  3WA0 A;  1VLB A;  4GU2 A;  4KKJ A;  4EOY A;  3PS6 A;  2NTS A;  1VDV A;  2ZEQ A;  1ZKH A;  2WXL A;  2MWS B;  3NS8 A;  2IND C;  3W2D A;  2L0F A;  1E7U A;  5MPO A;  1WE7 A;  1HE8 A;  4DHJ D;  2KD0 A;  2KJH B;  2KX0 A;  3IXS A;  3PZD A;  1N60 A;  4YT0 B;  2OOB B;  2K8H A;  2GBN A;  3WIM A;  2KC2 A;  2I2Y A;  1WXQ A;  4KIK A;  1C4P A;  1H8C A;  3A1Q A;  1HEZ E;  4G0N B;  4W9C A;  2KJ6 A;  2IY1 B;  3DVG X;  4MEM A;  4EFO A;  2WU2 B;  4TUU A;  1T0Y A;  2N7E A;  2ZNV C;  5E6P A;  1Y8R C;  4I6L B;  3ZLZ A;  2MCN B;  4HK2 A;  1QOB A;  4KKI A;  3AU4 A;  2FCS A;  3N32 A;  1S3S G;  3RI7 C;  1C77 A;  2O2V A;  4W9I A;  4AJY B;  1JRP A;  3M3J A;  1NI2 A;  3Q69 A;  3DWM A;  1FNW A;  4DXA B;  4NPN A;  3NJT A;  2J52 A;  1V81 A;  3TMP B;  3DBR B;  2MJD A;  3R7R A;  1F2R C;  4KSL C;  2LVO A;  3PT2 B;  3SD5 A;  2PTL A;  4WJP A;  1WIA A;  4P1C C;  2KMC A;  1NEK B;  4MEL A;  2DBY A;  1QOA A;  3LXF A;  3HHM A;  3PTF C;  2LGY A;  2TSS A;  2V3N A;  1E8X A;  1IBX B;  1YNT E;  1TZ1 A;  3AED B;  4LNN A;  2C5L C;  1Y56 A;  1WM3 A;  1YN3 A;  4E74 A;  4USA A;  4JPS A;  4CQN A;  1TY0 A;  2ZPY A;  4N59 A;  2CJN A;  3VTU A;  1DOX A;  2RD0 A;  4ZYS A;  1N5X A;  5AUI A;  1R4M I;  3IAM 1;  3RPF C;  2BTE A;  2KDF B;  1OEY A;  2KFJ A;  4MH0 E;  2MRP A;  3B2G A;  2CU3 A;  3R66 C;  3NZS A;  2KWV B;  5DPW A;  3AE3 B;  2OJW A;  2ZPN A;  1FNU A;  4RF1 A;  1OFF A;  2LGD A;  4LJP B;  4ANV A;  2LJI A;  2N9E B;  3RNF C;  2C7M B;  2VH2 A;  3ONS A;  5LXH A;  3B0A A;  2JUO A;  2IGH A;  1JWU D;  4K7U A;  4GDL B;  3H9D A;  1TTN A;  1RFA A;  4GB9 A;  4PYU A;  4FLH A;  3C8Y A;  4ARC A;  4B0M A;  4HRS A;  1JWA D;  3GS2 A;  4FJZ A;  3AH7 A;  2NR2 A;  1YX6 B;  4W9K A;  1UGJ A;  4K81 A;  2L8J A;  1YQ4 B;  1QT9 A;  2EKE C;  2RPV A;  2OHF A;  1GC6 A;  1FFU A;  1UBI A;  3NY5 A;  3WAM A;  1PGX A;  4HJG E;  4W9F A;  2QIE B;  2VRR B;  1L4Z B;  4JIO U;  4GMV A;  4A90 A;  3PO0 A;  1ZDX A;  2WXK A;  3UIP B;  3OLM D;  4WWO A;  2KLC A;  2DZM A;  2MW5 A;  2MBE A;  4FA6 A;  1PUT A;  1KFY B;  2KMA A;  3T8M A;  1FRD A;  1TKY A;  2O6V A;  3HK0 A;  1XQQ A;  3PRZ A;  4TV3 A;  5E6N A;  1FRR A;  1KLG D;  3VUW A;  5D6J B;  4XYC A;  3ML9 A;  4BKS D;  2C7N B;  3A9J A;  3Q8E A;  4AQ7 A;  2G4D B;  4NJ6 A;  4OW0 A;  1K8R B;  3W9C B;  4XE0 A;  3I57 A;  2Y5B B;  3MP9 A;  1I42 A;  3QCA A;  2KFK B;  1KJT A;  3RD2 A;  1E10 A;  4L23 A;  1T0S C;  2KYW A;  4BVU C;  3PPA A;  3ZVV A;  3V3X A;  1OTR B;  4S0R A;  3SEB A;  3VAW A;  1L0X B;  2ASQ A;  2WXN A;  2JSV X;  3DBH I;  3RNE C;  3DVN U;  4MGY E;  4IM2 A;  3QIJ A;  3EA6 A;  1WRI A;  4IM0 A;  3V60 A;  3MHS D;  1X1M A;  1B1Z A;  2IGG A;  3BYY B;  2IO0 B;  4NNJ B;  3IT4 B;  4P1B C;  2XN9 C;  2LUE A;  2JWZ A;  2N4F A;  3KYD D;  3VRA B;  4WH4 A;  1N6Z A;  3N3K B;  4J3O D;  3U8Z A;  2WXQ A;  3DPD A;  3TEZ A;  4WWN A;  3QX1 A;  2YEP B;  4N58 A;  1LO5 D;  2KWD A;  2SEB D;  3DWG C;  2BW2 A;  5HG2 A;  1UD7 A;  1ZP0 B;  5KHQ A;  1L6V A;  1V5T A;  3V05 A;  4B9K A;  1PDX A;  2G3Q B;  1KRH A;  3EFC A;  3E56 A;  2GMI C;  3O13 A;  3EC8 A;  2SAK A;  3AEA B;  4ANU A;  4OZC A;  4HJK A;  1FXT B;  2VH1 A;  4NAW B;  3H7P A;  2G1E A;  1WH3 A;  2KJR A;  2BYF A;  4L1B A;  2MX2 A;  4RMA A;  3AE1 B;  3HVZ A;  1ZXH A;  3KW5 B;  2QHO A;  2ZVO A;  4EZL A;  3PHX B;  1DYQ A;  4FUL A;  1WI0 A;  1YQB A;  4WWM A;  1L5P A;  2DZJ A;  2WDV B;  2N9P C;  3DQV A;  1CK1 A;  3L0W B;  1P1A A;  3A9K B;  4KDI C;  2WXP A;  4MH8 A;  4HPL B;  3RT3 B;  3PRP B;  4BKT A;  1D5M C;  4AJW A;  3AEF B;  3QA8 A;  4PK1 A;  5BYS A;  1UUP A;  4A9A A;  2GOW A;  4GSW A;  3CF6 E;  2IO1 B;  1UH6 A;  2Z59 B;  3ZUN A;  3TEW A;  2PE9 A;  2I1J A;  3VUX A;  2MHJ A;  3I3T B;  1AYF A;  4S17 A;  2DEN B;  3ZTD A;  2UU7 A;  4YTN B;  4BOS C;  3M62 B;  4OVU A;  4EE2 A;  2IGD A;  4W9D A;  2N7J A;  4DDI D;  2I38 A;  4LNK A;  1DOY A;  2ZNV B;  2K0P A;  1V6E A;  2BWE S;  4LNO A;  3MJ5 A;  3V6E B;  4JWS C;  2CHZ A;  2LFI A;  5JHA A;  1FEH A;  2PJH A;  2JX5 A;  3H7S A;  2L83 A;  4ACF A;  2KLG A;  2NTT A;  4M0W B;  5BYR A;  1FM0 D;  1F0Z A;  3ML8 A;  1F9J A;  4HPM B;  1WMH B;  2JZ3 B;  3AE6 B;  5D2M B;  4OVV A;  2K5P A;  2KN4 A;  2MP2 B;  3R3M A;  1FXI A;  4YL8 A;  2NPT B;  3Q14 C;  1ZGU B;  3RNC C;  2NBV B;  5JH5 C;  1H4R A;  2Z0E B;  5HFY A;  3B08 A;  3PHW B;  4DXF A;  2WNM A;  2HTM E;  4XWT A;  4G50 A;  4RM9 A;  1P7E A;  3EFU A;  2D3A A;  3NHE B;  2LHD A;  4II3 B;  3BIN A;  4X57 B;  5FKA C;  4MGK E;  1V49 A;  2CU1 A;  1ENF A;  1AW7 A;  3NUH B;  1NI3 A;  1E7P B;  1YJJ A;  1UBQ A;  1HA5 A;  4WJO A;  4PYZ A;  1TS5 A;  3W1S C;  3SFE B;  1KOT A;  1YOV B;  1JWS D;  4OZA A;  4W9H A;  3AE5 B;  1V86 A;  4M8M A;  1V9J A;  4GXB A;  2QDF A;  1B9R A;  3U30 A;  1LM8 B;  4HXD A;  1F1H A;  1N63 A;  3DHI C;  3DCG A;  4AUQ C;  1QOG A;  1OGW A;  1WGH A;  4BAX A;  1R4N I;  1XLO A;  4MAC A;  2XK5 B;  1SEB D;  1WGY A;  1QKZ A;  5IN7 A;  2N1W A;  2KOX A;  1EU3 A;  2Z8L A;  2GRI A;  2QC8 A;  3IFW B;  4IWP A;  1QZE A;  4HKQ A;  3S2A A;  1WJ6 A;  2L7R A;  5HHD G;  2C60 A;  1E8Z A;  5IOI A;  2INC C;  2WX0 A;  2GBR A;  3BK2 A;  1P0R A;  3ZJT A;  4UDU C;  1GPX A;  3NVZ A;  4HCN B;  3M63 B;  2X8X X;  3L54 A;  2M1M A;  2PVG C;  3U2S C;  3UF8 A;  4KV2 A;  2ZCB A;  3ZDM C;  4EZJ A;  2RMM A;  1ROE A;  1XF5 L;  2FUH B;  3A33 B;  3I63 C;  2L32 A;  3KLS X;  4A8X C;  2BS4 B;  2AYO B;  2PE6 B;  2R2O A;  1S1Q B;  1T0Q C;  3EEC A;  2QSD A;  2MA9 B;  3RCZ A;  4C00 A;  2LMC A;  1SE3 A;  3R2T A;  2M8S A;  2JZZ A;  2KX3 A;  4IW0 A;  2DZK A;  2EMS A;  3CWI A;  5EE1 A;  5E6O A;  3TBL D;  4C4V B;  1Q10 A;  2BF8 B;  4JX1 C;  1I4R A;  1ZPS A;  4DWF A;  2PMV A;  1E8W A;  4F7Z A;  2KDE B;  4F8C B;  1IYF A;  3AI5 A;  4TQ1 A;  1V1P B;  1IBX A;  1L4D B;  1TS3 A;  3BY4 B;  4Q2J A;  1C76 A;  1U4A A;  1TZO A;  1WZ0 A;  2BYV E;  2PLP A;  4EUT A;  4KDL B;  2LRU A;  4KZ0 A;  1V5O A;  3U7Z A;  3GZN I;  2LGS A;  4DDG D;  2D11 A;  3QC8 B;  2D3G A;  1HXY D;  4NQL B;  4YTP B;  1J8C A;  3WCQ A;  2KAC A;  1RM6 C;  1VD2 A;  4I6P A;  4KZC A;  1NVI D;  3BVG A;  1ISN A;  3KUD B;  4LK0 M;  1E7V A;  3NVY A;  3TEY A;  2M4N A;  5DPS A;  2ZCC A;  3ETR A;  2UYZ B;  3T3O A;  2D3B A;  3H8H A;  1BML C;  2WYQ A;  1ZE3 D;  5CTR C;  2V0G A;  3LJ3 A;  2M56 B;  1XLP A;  3AMZ A;  3B9J A;  4GDL A;  4ICU A;  1I7H A;  5BMH A;  1J0G A;  3RUL A;  3Q8A A;  4GDK B;  1T5X D;  4CO7 A;  2MJ3 A;  1HTO A;  3JVZ X;  1Q0W B;  4DHZ E;  2LJ5 A;  4PS3 A;  2GBK A;  4WQM A;  2AL6 A;  2LWP A;  4EZK A;  4RF0 A;  3U4E G;  3ALB A;  2W54 A;  2W9N A;  1I4Q A;  3GB1 A;  1OEY J;  3L08 A;  2V9H A;  4IWQ A;  1EU4 A;  1UEL A;  2M19 A;  4MJS B;  3AE4 B;  3J9C A;  1EM7 A;  2BT6 A;  1N5W A;  3BYT B;  2MLB A;  4YTM B;  1J7B A;  2FIF A;  2RDG A;  2N0S B;  1YQ3 B;  2D3C A;  2WGS A;  5C2T B;  2N7D A;  2BGF A;  4GIV A;  1VRA B;  3DBS A;  3DHH C;  4ZRI A;  1Z5S B;  4KGR A;  1GOZ A;  1WRD B;  2MH7 A;  3UIO B;  3AE9 B;  5EE9 A;  1CJE A;  4AP4 C;  4FXC A;  3AM9 A;  3A4S C;  3GOE A;  4WAA A;  4JWU C;  5GXG B;  2WXJ A;  2MJE A;  2ZJD A;  1EWC A;  3WAN A;  3OJ4 B;  2V4L A;  3V6C B;  1IPG A;  2KFK A;  3WAL A;  3W1Y A;  2BS3 B;  1P3Q U;  1WWT A;  3IT6 B;  2Y5P A; 
#chains in the Genus database with same CATH homology
 3CST A;  4A20 A;  4MJS A;  2DAF A;  3RYT A;  2XBB C;  1YD8 U;  3APD A;  1Q1O A;  5D94 A;  4K7W A;  3VH4 B;  3ZNH B;  1C1Y B;  3QAR A;  3KYC D;  3PSE B;  2DZI A;  3AU5 A;  2GMI C;  3TIX A;  3EC8 A;  4ANU A;  3KVF B;  4HJK A;  1FXT B;  2J0M A;  2K25 A;  2R2Q A;  3ZRF A;  4NAW B;  4ZYN A;  1RLF A;  2KKC A;  3H7P A;  4WQO B;  3P2B A;  1WH3 A;  2KJR A;  1KLV A;  2RGF A;  4EEW A;  2MSE D;  2BYF A;  5FR6 A;  2KTF A;  2MX2 A;  1YJ1 A;  4RMA A;  3SHQ A;  2WDT B;  4HDO A;  1V80 A;  3DVG Y;  3N30 A;  1WJU A;  3KW5 B;  2OJR A;  1Q5W B;  2GBM A;  2QHO A;  2ZVO A;  3KUZ A;  3PHX B;  3PLU A;  4W9J A;  4GGQ A;  4FUL A;  1WI0 A;  1YQB A;  1AAR A;  3H6N A;  1P9D U;  2DYM A;  3ZNZ B;  2DZJ A;  3L17 A;  5IA7 A;  3ZTC A;  2N9P C;  3DQV A;  2DX5 B;  3ENE A;  3R7Q A;  4ZDV A;  2A5U A;  2FNJ B;  4FJY A;  2MBB B;  2LXC A;  3CMM B;  3L0W B;  2WWZ A;  4J6I A;  1P1A A;  2IBI B;  3SU8 X;  2LVP A;  3A9K B;  4KDI C;  4IC7 B;  5L95 C;  5KHO A;  1D3Z A;  2KHW B;  4HPL B;  3RT3 B;  1L2N A;  3PRP B;  4BKT A;  2LRW A;  4JL9 A;  1MG8 A;  3Q3J A;  4BBN C;  4P7I A;  4AJW A;  3PLV A;  3AXC A;  4W9L A;  3QA8 A;  4DHJ B;  2CHW A;  1EF5 A;  2O6V D;  3ECI A;  4K1R B;  3VFK A;  3ZNI D;  2MBH A;  2HD5 B;  2GOW A;  4GSW A;  3CF6 E;  2IO1 B;  1UH6 A;  2CS4 A;  2Z59 B;  5LLI A;  3ZUN A;  2PE9 A;  2I1J A;  3VUX A;  3I3T B;  4W9G A;  4A3O A;  2IYD B;  1WX9 A;  2DEN B;  4K7S A;  1GG3 A;  4NAW A;  3ZTD A;  4RM8 A;  1WFY A;  3A4R A;  3VQI A;  2KWC A;  4BOS C;  5CX3 A;  2YVC A;  3PGE A;  2M0X A;  4FHK A;  3M62 B;  3QJZ A;  3X23 A;  4ZRK A;  4OVU A;  1WXA A;  4W9E A;  4KIK B;  4DK5 A;  4BFR A;  1UZX B;  1SIF A;  2N1V A;  2BWF A;  4W9D A;  4AWJ A;  1LXD A;  3A1Q B;  4DDI D;  3X0W A;  3VHT C;  1TBE A;  4FN2 A;  3VUY A;  4XZ4 A;  4BOZ B;  2ZNV B;  1V6E A;  2BWE S;  5AZF A;  4HVB A;  4HWI B;  2KC1 A;  4EKU A;  1WF9 A;  3HIZ A;  3DDC B;  3H1U A;  3OJ3 A;  3V6E B;  2CHZ A;  2NCN A;  5JHA A;  5IAA C;  3RZF A;  2K6D B;  2RR9 A;  2PJH A;  2BYE A;  3KUC B;  3IHP C;  4LDT B;  5AEK B;  3HM3 A;  3RUI B;  5BO4 B;  3A9K A;  4ANW A;  3H7S A;  4JLC A;  3WA0 A;  3NZU A;  2JVC A;  5DPT A;  2KLG A;  4GU2 A;  3QK0 A;  4EOY A;  4M0W B;  2BKR B;  3PS6 A;  4WJQ A;  2B3A A;  2L3Z A;  3ML8 A;  1F9J A;  2ZEQ A;  4HPM B;  1ZKH A;  1WMH B;  2MWS B;  2JZ3 B;  3IG3 A;  5D2M B;  2O2V B;  4OVV A;  1RRB A;  1WZ3 A;  3NS8 A;  2MP2 B;  3R3M A;  4YL8 A;  1EUV B;  2NS5 A;  2NPT B;  2L0F A;  1ZGU B;  1E7U A;  2KTR B;  2NBV B;  4KVG B;  3VTV A;  1WE7 A;  4NJ7 A;  1HE8 A;  5JH5 C;  4DHJ D;  1G6J A;  2KD0 A;  1H4R A;  2FAZ A;  3PVL A;  2KJH B;  2KX0 A;  2J0K A;  2Z0E B;  3B08 A;  3PHW B;  3PZD A;  3PV1 A;  5J17 A;  2OOB B;  2M17 A;  2K8H A;  2GBN A;  4IG7 B;  4XX5 A;  3WIM A;  1TGZ B;  2KC2 A;  2DYB A;  4G50 A;  1NDD A;  2HTH A;  4MSM B;  4RM9 A;  3IBE A;  3EFU A;  5TR5 A;  4KIK A;  3NHE B;  2IZV B;  2L00 B;  4G3X B;  2KO3 A;  2NBW B;  1H8C A;  3A1Q A;  3D32 A;  4II3 B;  3QQ8 B;  3BIN A;  4G0N B;  4LCD E;  4X57 B;  3L10 B;  4W9C A;  4MGK E;  2KJ6 A;  2IY1 B;  3DVG X;  1V49 A;  4MEM A;  2CU1 A;  4EFO A;  5C1Z A;  2AL3 A;  3UQB A;  2K6Q A;  3W1S A;  4TUU A;  1T0Y A;  2KXJ A;  2AEH A;  1JRU A;  2N7E A;  2ZNV C;  5E6P A;  3T9L A;  1Y8R C;  4A3P A;  4I6L B;  3ZLZ A;  2MCN B;  2K1F A;  4HK2 A;  4NY0 A;  1UBQ A;  4WJO A;  5HKH A;  4PYZ A;  1KOT A;  3W1S C;  2LGX A;  2KZR A;  2I1K A;  3AU4 A;  2FCS A;  3JSV B;  4W9H A;  1V86 A;  3N32 A;  1WX7 A;  4M8M A;  1S3S G;  1V9J A;  4GXB A;  2LD9 A;  2LAS A;  3U30 A;  1WMH A;  3JW0 X;  1LM8 B;  2V1Y A;  2O2V A;  4HXD A;  4N9F 4;  3VDZ A;  4W9I A;  4AJY B;  2FCM A;  2MP2 A;  3DCG A;  1WXV A;  3M3J A;  4AUQ C;  3QHT A;  1OGW A;  1WGH A;  1NI2 A;  2NPT A;  3ZW3 A;  1R4N I;  2XEW A;  1C3T A;  4DXA B;  4NPN A;  2KTR A;  2NVU I;  2YLM A;  2JRH A;  2L76 A;  4F1S A;  2XK5 B;  4AOF A;  3PRM B;  1V81 A;  1WGG A;  2FID A;  1WGY A;  1KM7 A;  3TMP B;  3UIN B;  2ZVN A;  3R7R A;  2N1W A;  2BKF A;  2KOX A;  4KSL C;  1ZW7 A;  5DCN A;  2LVO A;  3PT2 B;  3SD5 A;  1IP9 A;  3Q3F A;  4WJP A;  1WIA A;  3IFW B;  4IWP A;  1QZE A;  2DHZ A;  2KMC A;  3S2A A;  2L7R A;  1WJ6 A;  4MEL A;  2C60 A;  1E8Z A;  3HHM A;  2WX0 A;  3PTF C;  2GBR A;  2LGY A;  1P0R A;  4HLE A;  4HCN B;  3UGB B;  3M63 B;  5D7G A;  5CHV C;  1E8X A;  1XT9 B;  3L54 A;  2M1M A;  2EMT A;  1TZ1 A;  3TL5 A;  2C5L C;  3UF8 A;  4KV2 A;  1GJZ A;  1GUA B;  4XC2 A;  2ZCB A;  3ZDM C;  4EZJ A;  3M95 A;  4E71 A;  3IVF A;  1WM3 A;  4E74 A;  2JF5 A;  3JSV A;  4MSQ B;  1J19 A;  1WGD A;  2FUH B;  3VVW B;  3A33 B;  2ZPY A;  4WJN A;  4TKN A;  2AYO B;  2PE6 B;  2R2O A;  1S1Q B;  2MQJ A;  3EEC A;  3VTU A;  3ZRC A;  4IUM B;  1A5R A;  2RD0 A;  2KQS A;  2MA9 B;  3RCZ A;  2LI5 A;  1R4M I;  1WYW B;  2M8S A;  2KDF B;  2D2Q A;  2JZZ A;  2KX3 A;  1OEY A;  2KFJ A;  3QAQ A;  2MRP A;  4MH0 E;  2XK5 A;  2HE7 A;  4IW0 A;  4MDK E;  4BKG A;  3ZNG C;  2LXA A;  3APF A;  3R66 C;  3NZS A;  2DZK A;  2EMS A;  2KWV B;  5DPW A;  5DPR A;  5E6O A;  3TBL D;  2ZPN A;  3O65 B;  2G4S A;  1V2Y A;  4LJP B;  2LGD A;  4ANV A;  2N9E B;  2C7M B;  2BF8 B;  3ONS A;  3ZDT A;  2UWQ A;  4DWF A;  5LXH A;  1WGR A;  3B0A A;  2L0T A;  2JUO A;  2FCQ A;  1E8W A;  2K8C A;  4F7Z A;  4K7U A;  2K8B A;  2KDE B;  2D07 B;  3H9D A;  1SGH A;  4GDL B;  4PS8 A;  1TTN A;  3AI5 A;  4TQ1 A;  2O6V B;  1IYF A;  4B6W A;  1RFA A;  3VXW A;  4GB9 A;  3VH3 B;  2DYO A;  1WR6 E;  2JT4 B;  4FLH A;  4PYU A;  2KAN A;  2ZZP B;  4EZL A;  1CMX B;  3BY4 B;  1E8Y A;  3A9J B;  2MBQ A;  2IY0 B;  1U4A A;  4ICV A;  1WZ0 A;  2BYV E;  4EUT A;  1E90 A;  4FJZ A;  3RZW C;  5JHB A;  4KDL B;  2NR2 A;  5C23 A;  5G55 A;  2LRU A;  4KZ0 A;  1V5O A;  1LQB A;  1YX6 B;  2C9W B;  3GZN I;  3KH0 A;  2D10 A;  1YIW A;  4DDG D;  1BT0 A;  2D11 A;  3QC8 B;  2D3G A;  4W9K A;  2J7Q B;  2Z0D B;  4E3C A;  4K81 A;  4NQL B;  2L8J A;  4G11 A;  1WXM A;  4F8C B;  2N9X A;  1Z2M A;  1J8C A;  3K9P B;  3NOB A;  1RAX A;  2EKE C;  1WR1 A;  2JPH A;  1EF1 A;  1VD2 A;  2LVQ A;  4I6P A;  4II2 B;  3TCA A;  5LXI B;  1GC6 A;  1UBI A;  4KZC A;  4I6N B;  3NY5 A;  4MM3 A;  4HCP B;  3WAM A;  2KDB A;  2G45 B;  2KNB A;  1ISN A;  3KUD B;  4LDT D;  4W9F A;  3SDL C;  3TJP A;  1OQY A;  1E7V A;  2M4N A;  4GN1 A;  2DAJ A;  1XD3 B;  3PRE A;  5DPS A;  1WM2 A;  2VRR B;  2ZCC A;  2UYZ B;  2MBO A;  4JIO U;  4GMV A;  2KDI A;  2WYQ A;  2PPH A;  3DBR I;  3OLM D;  3UIP B;  4WWO A;  4M8N A;  3WAO A;  2KN5 A;  2CHX A;  5CTR C;  2KLC A;  3LJ3 A;  2DZM A;  2MW5 A;  2MBE A;  4FBJ B;  4CHK A;  4BKS A;  1PQS A;  2LZ6 A;  4FA6 A;  4LJO B;  2KMA A;  3QWZ B;  3T8M A;  3DBL I;  4GDL A;  4FJV B;  1LFD A;  2AWT A;  4ICU A;  2O6V A;  3HK0 A;  3APC A;  2IO3 B;  1XQQ A;  2PEA A;  3PRZ A;  4DBG A;  1I35 A;  1J0G A;  4TV3 A;  3RUL A;  5E6N A;  4GDK B;  3VUW A;  4CO7 A;  2RPQ A;  5D6J B;  5J18 A;  3ML9 A;  3OAW A;  4BKS D;  2C7N B;  3A9J A;  4ZRJ A;  3ZIM A;  2G4D B;  2KK8 A;  2WX1 A;  3JVZ X;  4NJ6 A;  1WY8 A;  5GMV A;  1K8R B;  1Q0W B;  1SE9 A;  4MGI E;  4DHZ E;  2LJ5 A;  4PS3 A;  2GBK A;  3VTW A;  2AL6 A;  1WE6 A;  2HJ8 A;  2LWP A;  4EZK A;  2Y5B B;  1I42 A;  2JRI B;  3LDZ E;  1P98 A;  1KJT A;  2KFK B;  3QCA A;  3RD2 A;  4B95 A;  3L16 A;  3ALB A;  5AZH A;  2W9N A;  4URK A;  5JZE B;  4KSK C;  5CHF A;  3DOW A;  4JQW C;  1OEY J;  1L7Y A;  3L08 A;  4FHJ A;  4PS7 A;  4BVU C;  3PPA A;  4IWQ A;  1E5W A;  1UEL A;  2CR5 A;  3B1L X;  2JY6 A;  3ZVV A;  3U7D A;  4MJS B;  1OTR B;  3VAW A;  3DVN V;  1YX5 B;  1WJ4 A;  4ANX A;  2V3S A;  2ASQ A;  2JXX A;  2MLB A;  2GBJ A;  1EO6 A;  3DBH I;  3DVN U;  4MGY E;  2FIF A;  4IM2 A;  5EDS A;  3QIJ A;  2BPS A;  4DHZ B;  4TQ0 A;  3WAP A;  2FCN A;  3H7P B;  1UGM A;  1WXS A;  3AUL A;  5L83 A;  4IM0 A;  2N7D A;  2BGF A;  4GIV A;  4MGZ E;  3MHS D;  4IWO A;  3V60 A;  5AZG A;  2KWU B;  1X1M A;  1GNU A;  2REX A;  3C0R B;  1NBF C;  2IO0 B;  3DBS A;  3L13 A;  4NNJ B;  5CHW A;  4ZRI A;  1Z5S B;  2KQ7 A;  4NQK E;  2LUE A;  3MJW A;  2KVR A;  2JWZ A;  4JGH B;  2N4F A;  3K9O B;  3KYD D;  1WRD B;  4IM3 A;  1GC7 A;  4WWP A;  2NBU A;  3N3K B;  3UIO B;  1WJN A;  5G2N A;  3U8Z A;  4AP4 C;  2RSU A;  2C7H A;  3EHV A;  4GDK A;  2IO2 B;  3ZKJ C;  3DPD A;  2K39 A;  3A4S C;  3HM6 X;  4WWN A;  2L05 A;  4CYE A;  3GOE A;  3QX1 A;  3V62 A;  1WX8 A;  1M94 A;  4WAA A;  4FAD A;  3CSF A;  4GOC A;  4HDQ A;  2ZJD A;  5J2R A;  3WAN A;  3OJ4 B;  2V4L A;  3MTN B;  3V6C B;  1IPG A;  2KFK A;  3WAL A;  2J0J A;  3JYU A;  3W1Y A;  1UD7 A;  2A4Z A;  3UQA A;  5KHQ A;  1VCB A;  1V5T A;  4ASW C;  4BBN F;  1P3Q U;  4B9K A;  2CKH B;  3ZO5 B;  3V61 A;  2G3Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...