1KJTA

Crystal structure of the gaba(a) receptor associated protein, gabarap
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GABARAP
publication title Crystal structure of the GABA(A)-receptor-associated protein, GABARAP.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 37
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1kjtA00
1WXSA 2MBOA 4I6LB 1WJ6A 2NBWB 4GOCA 4AOFA 5EDSA 3OJ4B 4GN1A 3CSFA 4BKSA 1I35A 5IAAC 2EKEC 3RULA 1E8YA 2JPHA 1P3QU 1V9JA 2V3SA 2XBBC 5CHVC 2L0FA 4MJSA 2NS5A 4F7ZA 4G11A 1SIFA 4BBNF 3R66C 2IO1B 1YX6B 3KUCB 2KC2A 2IYDB 5G2NA 2IO0B 3Q3FA 3VXWA 4HDQA 1WGHA 5JZEB 3EFUA 3U30A 3AULA 1WYWB 2I1KA 3BY4B 2ASQA 2MCNB 1WX9A 4HPLB 2NVUI 3T9LA 3JYUA 1V49A 4WAAA 2KFKA 1V2YA 5AZGA 2KQSA 2V4LA 1F9JA 3TBLD 2G4DB 1A5RA 1KOTA 2BKRB 3V6EB 2GBKA 2ZJDA 4CYEA 4NPNA 5JHAA 4GXBA 3UQBA 3ZNHB 4ANVA 4LJOB 5E6OA 3JVZX 2XEWA 3JW0X 2KD0A 4NAWA 1ZGUB 2DX5B 4K7WA 4GDLB 4OVVA 1TZ1A 3H7SA 2PE9A 2NR2A 2A4ZA 1ZKHA 2GMIC 2MX2A 3ML8A 4CHKA 2KX0A 4LDTD 3WANA 3A33B 4KIKA 2PE6B 3HIZA 3DDCB 1NI2A 3AU4A 1P9DU 2K6QA 4IWOA 5DPRA 2Z0DB 5E6PA 1WJ4A 3A1QA 4BKTA 4E71A 2KMAA 1VD2A 4GB9A 2QHOA 3L54A 2XK5B 2N9XA 3KUDB 3PT2B 4PS7A 5TR5A 3ZVVA 2NBUA 3ZKJC 2KVRA 2NCNA 3B1LX 1WXVA 2D10A 3KUZA 2JVCA 1XD3B 3ZNID 1H4RA 1WXMA 2IZVB 2MRPA 1KJTA 4FJVB 4KSKC 3PZDA 4HK2A 5C1ZA 4FBJB 1WE7A 2JRHA 2MQJA 2D3GA 3BINA 3QQ8B 4EZJA 4B6WA 3DBLI 2BKFA 5L95C 1OTRB 3MJWA 5D2MB 2DZJA 4GU2A 3IVFA 4ZRJA 4EFOA 2C9WB 2EMTA 2FCQA 3TIXA 2LWPA 3B08A 2LUEA 2O2VA 3WAOA 2ZCCA 4KZ0A 1E8ZA 2AL6A 4IC7B 3QX1A 2FCNA 2LZ6A 2LGXA 3ZUNA 1IP9A 1V5TA 1J0GA 4MH0E 2KFJA 2RR9A 2BYFA 2JF5A 3DVNV 4BOZB 3KYCD 3V60A 2KMCA 2C7NB 3LJ3A 4G50A 3TL5A 4K7SA 2CHXA 2GBJA 2DHZA 1WI0A 3SHQA 1WF9A 1ISNA 3GZNI 1G6JA 3NZUA 3QC8B 3W1SA 1YX5B 2LJ5A 3ZDMC 4KDLB 3EC8A 1WGYA 4HDOA 2MWSB 2WWZA 1EF1A 2KO3A 3A9JB 1H8CA 1UGMA 1YQBA 2DENB 3HK0A 3ZRFA 3QHTA 4ZDVA 4HJKA 1OGWA 2CU1A 2LRUA 4DBGA 2KDBA 4W9FA 1GJZA 1EO6A 1XQQA 2MLBA 4KDIC 4W9HA 4X57B 2KQ7A 4WJNA 3X0WA 3UQAA 2FIDA 3RUIB 4WWOA 3VFKA 1UH6A 2KWUB 2K6DB 3APFA 3L10B 4WWNA 2PPHA 1E8XA 3APDA 4WWPA 1RLFA 1X1MA 4FA6A 2D2QA 1E90A 2EMSA 3O65B 4MSMB 3TCAA 2PJHA 5DPSA 1YD8U 3ENEA 3NS8A 2MP2B 2NPTA 1R4MI 3DPDA 2UYZB 2FUHB 2BF8B 2PEAA 3H7PB 4MGIE 4TQ1A 1R4NI 4A20A 1WX7A 4BBNC 2M17A 3A4RA 5JH5C 4G0NB 4JIOU 3RD2A 1WMHB 2HE7A 3V6CB 4B9KA 1EF5A 2BYEA 4F1SA 4ICVA 1E5WA 3R3MA 1C1YB 4I6NB 4JLCA 4YL8A 2MBBB 2ZVNA 1Q5WB 3TMPB 2ZNVC 1KLVA 4FLHA 1BT0A 1Q0WB 2N9EB 4K81A 3PPAA 3N30A 1UELA 4M8NA 3U7DA 4MGYE 2B3AA 3QK0A 2YVCA 2JXXA 3AI5A 2KNBA 3DBHI 4RM9A 4WQOB 1WFYA 3OLMD 3QA8A 3IBEA 1OQYA 2IY0B 3NY5A 1V86A 1Z5SB 5DCNA 3VVWB 2KLGA 2DAFA 1TBEA 3IHPC 4MELA 1WE6A 3UF8A 1D3ZA 4EKUA 1RRBA 3PRMB 4ANXA 3VHTC 2RSUA 2MA9B 2XK5A 3L17A 4WJQA 2FNJB 4DHJD 2LD9A 3EECA 1XT9B 2LI5A 3KW5B 3WA0A 2JY6A 2MBQA 4GSWA 4MJSB 2KLCA 2KOXA 2KJ6A 2GOWA 4W9JA 1SE9A 3RT3B 4GMVA 3TJPA 3PHXB 5J18A 1HE8A 2LASA 4W9GA 2M8SA 3ZNGC 3AU5A 4IM0A 2K8CA 5JHBA 3VAWA 2CHZA 1WY8A 4FHJA 3DOWA 1OEYA 3DVNU 4EZKA 5CHWA 3WIMA 2RD0A 2CS4A 4GDKB 3JSVA 3S2AA 1Z2MA 4DDGD 2D11A 3L13A 4AP4C 2O6VA 4RMAA 4HCPB 2Z59B 2WX0A 4BKSD 1RAXA 2V1YA 3SD5A 1CMXB 2RGFA 5D6JB 2LGYA 3ONSA 3DVGY 4NAWB 4B95A 1I42A 1LM8B 1YJ1A 2J0JA 2MBHA 3Q3JA 1UD7A 4W9KA 1UBQA 2KTRB 1WGRA 2K25A 3W1SC 4DHZB 3B0AA 5CTRC 1LXDA 3VUWA 4IW0A 1WGDA 1J8CA 1WJNA 2AL3A 2L0TA 3QIJA 2JWZA 4A3OA 2KJRA 4KIKB 1GUAB 2KHWB 2ZNVB 2HTHA 4HLEA 1WX8A 2LVOA 3L08A 2CKHB 4W9EA 1TTNA 4W9IA 2FIFA 5J2RA 2IBIB 2L76A 1AARA 2DYMA 4IUMB 2W9NA 3ECIA 5LXIB 4ZRKA 3VTVA 2R2QA 4W9LA 3R7RA 1E8WA 3WALA 2L00B 1WZ3A 3KVFB 3V62A 4CO7A 3HM6X 2K8HA 2MSED 4NNJB 2LXAA 1GC6A 2Z0EB 3APCA 2FCSA 3DQVA 3KYDD 3RZWC 2CR5A 4PYUA 4IG7B 5J17A 1J19A 4LCDE 3PHWB 4G3XB 2AWTA 2BYVE 1FXTB 1WR1A 3PREA 3C0RB 2JZ3B 5D94A 4KZCA 4K7UA 3I3TB 1L7YA 2BWFA 3PV1A 3QCAA 3ZIMA 2ZVOA 2ZCBA 1T0YA 4JGHB 3ZW3A 3IFWB 4EZLA 2MP2A 2G3QB 5E6NA 2N1WA 4PS8A 3ZDTA 1V81A 2O2VB 3ALBA 1IPGA 4MDKE 2GBNA 4IWPA 3P2BA 3ZTDA 4E3CA 4JQWC 1WMHA 2K1FA 4NJ6A 3SDLC 4NY0A 3VUXA 2JRIB 3PRPB 4I6PA 1WH3A 3UINB 5KHOA 4HPMB 2JUOA 4AWJA 2O6VD 2KX3A 1WM2A 1GC7A 2GBMA 2AYOB 3M62B 5G55A 4II2B 4F8CB 4XZ4A 4ZYNA 3X23A 2NBVB 3VUYA 1LFDA 4ZRIA 2KTFA 1GNUA 4XC2A 4EEWA 4LDTB 2LRWA 4DWFA 1E7VA 1P0RA 2G45B 4II3B 4ICUA 1WZ0A 2HJ8A 2VRRB 2KKCA 3MHSD 4HWIB 3R7QA 2LXCA 2ZEQA 2KWVB 1K8RB 3PLUA 4GDLA 3V61A 3UGBB 2L7RA 2KDEB 1L2NA 4IM2A 2C5LC 4PS3A 3RYTA 3HM3A 2UWQA 2OJRA 2BWES 4NQKE 3ZO5B 3A9KB 1JRUA 1V80A 4IWQA 3VH3B 3AXCA 3EHVA 1WM3A 2IY1B 2K39A 3RCZA 4DDID 5DPTA 3VTWA 2C7MB 3GOEA 1NDDA 4EUTA 5LLIA 4TKNA 4MGKE 2LGDA 3QWZB 1UBIA 4TV3A 2G4SA 3LDZE 5CHFA 1WJUA 2DZKA 4FHKA 4FJZA 3NHEB 4GDKA 1C3TA 2C7HA 2A5UA 2REXA 1QZEA 5DPWA 2KDIA 2R2OA 5FR6A 1V5OA 2NPTB 3DCGA 3RZFA 4E74A 1UZXB 2GBRA 2N7EA 3N3KB 2DYBA 4NJ7A 2LVPA 3IG3A 2WDTB 3CSTA 3T8MA 4URKA 4W9DA 2L3ZA 2K8BA 4IM3A 3MTNB 3VQIA 2C60A 1P98A 3VTUA 2ZZPB 3NOBA 4FADA 2KFKB 4FJYA 4WJOA 5AEKB 2L05A 2YLMA 3M3JA 2KTRA 2WYQA 3DVGX 1WIAA 3OAWA 3VH4B 2LVQA 5L83A 1WRDB 3D32A 1IYFA 2IO2B 2KWCA 4FULA 4EOYA 4OVUA 2CHWA 4ANWA 4DHZE 4BVUC 2DAJA 4N9F4 3A4SC 2KANA 3ZTCA 4DXAB 3CF6E 2RPQA 3HHMA 2KC1A 3QAQA 2IO3B 4A3PA 4FN2A 2I1JA 5D7GA 3QJZA 4MSQB 1WGGA 4JL9A 3ZNZB 1PQSA 1U4AA 2AEHA 4NQLB 3H9DA 4AJYB 5IA7A 1V6EA 4DK5A 1WXAA 1TGZB 3PRZA 4MEMA 3W1YA 4HXDA 4XX5A 4KV2A 2HD5B 3DBSA 4MGZE 1Q1OA 2KN5A 5CX3A 4M8MA 3NZSA 4AJWA 3ZLZA 4WJPA 4K1RB 3H6NA 3CMMB 2J0MA 3A1QB 3N32A 3ZRCA 1Y8RC 2M1MA 1P1AA 1VCBA 3A9JA 4HVBA 2MW5A 3JSVB 2DZMA 3DBRI 1MG8A 4LJPB 5AZFA 2N1VA 2O6VB 3PGEA 3PVLA 3KH0A 4BFRA 5AZHA 3ML9A 1SGHA 2N9PC 3H1UA 3K9OB 4P7IA 4BKGA 1ZW7A 2MBEA 4BOSC 3PLVA 2N7DA 3L16A 4HCNB 2DZIA 4RM8A 2BGFA 2OOBB 5HKHA 1KM7A 2BPSA 3VDZA 4TQ0A 3M63B 5KHQA 2DYOA 2ZPYA 4GGQA 4W9CA 1E7UA 2KJHB 1S3SG 2KXJA 1NBFC 3L0WB 5C23A 5GMVA 3M95A 3OJ3A 1LQBA 2FAZA 3H7PA 3WAMA 2FCMA 3PTFC 1GG3A 2J7QB 1M94A 3U8ZA 4ANUA 4KVGB 2J0KA 2JZZA 4AUQC 2WX1A 3K9PB 2KZRA 2ZPNA 3PS6A 4MM3A 2D07B 1YIWA 5BO4B 2KK8A 4GIVA 2M0XA 3WAPA 1OEYJ 5LXHA 3UIOB 2N4FA 4PYZA 3UIPB 1RFAA 4DHJB 2M4NA 2KDFB 4M0WB 4TUUA 1S1QB 1WR6E 3A9KA 2JT4B 3PSEB 4J6IA 1EUVB 3QARA 2L8JA 2Y5BB 4KSLC 4ASWC 3SU8X
chains in the Genus database with same CATH superfamily
3AEFB 2WLBA 3OJ4B 5MPOA 2E3TA 3RULA 2JPHA 5CHVC 5BYSA 1GB1A 3DHIC 4G11A 4F7ZA 3R66C 2IO1B 2WXKA 3KUCB 3Q3FA 3BK2A 1WGHA 1WYWB 2I1KA 5EE9A 2NVUI 4WAAA 3CWIA 1V2YA 3RNEC 2V4LA 1F9JA 1A5RA 2BKRB 1GAQB 1D5ZC 4LJOB 5E6OA 1SJED 2RDHA 3AEEB 3JVZX 4HPPA 2ON8A 1SSNA 4NAWA 1ZGUB 4K7WA 4ZHPA 3I5JC 1WWTA 2NR2A 1ZKHA 2MX2A 4CHKA 2CJNA 2KX0A 3A33B 4IWOA 2Z0DB 5E6PA 3A1QA 4GB9A 1UWXA 3KUDB 4PS7A 4ZOHC 3OWEB 2H89B 1K50A 2QILA 3ZNID 1WXMA 2IZVB 3AV8A 4BAXA 4TSSA 3Q3MC 2JRHA 2D3GA 3URYA 2CU3A 1JCKB 1OTRB 3RNGC 2DZJA 4GU2A 2C9WB 2EMTA 3TIXA 2RDGA 4JX1C 4IC7B 4UDUC 2LZ6A 1VLBA 2N7JA 2KFJA 2BYFA 2WXFA 3DVNV 4LLGM 1L4DB 2KAJA 3KYCD 4HEA1 5G5HA 1ROEA 2C7NB 3LJ3A 2CHXA 4LNFA 4YTNB 3IT6B 2DHZA 3CIRB 1WF9A 1ISNA 1KH0A 1G6JA 2WP9B 3W1SA 1VRAB 1YX5B 5BMIA 1WGYA 2WXRA 1KF6B 2Q5WD 3NVZA 1H8CA 2DENB 3HK0A 3ZRFA 4HJKA 4DBGA 2KDBA 2WS3B 2WXGA 1TS3A 3UQAA 2FIDA 3MC0B 1XLOA 3P4SB 4N6EB 2PPHA 4OZBA 1RLFA 4FA6A 1N63A 3NS8A 1I4GA 2E6XA 2ICIA 2UYZB 2WHIA 2FUHB 3H7PB 4MGIE 4A20A 1WX7A 5JH5C 1JWAD 1WMHB 4F1SA 3V6CB 1EF5A 1ZP0B 3DWMA 5EE1A 2ZNVC 1BT0A 3N30A 1UELA 2YVCA 2JXXA 3DBHI 1WFYA 4ARCA 3HRDD 3UI3A 5DCNA 1TBEA 1D3ZA 2V3NA 4XWTA 2XK5A 4DHJD 3V05A 3FILB 4REZA 1WSPA 2MBQA 3P42A 4MJSB 1K52A 5EE3A 4W9JA 3RT3B 4GMVA 1V1OA 3PHXB 3HUIA 5J18A 3DBLB 5IO9A 4S17A 4FHJA 4C00A 4ZYSA 3DOWA 1OEYA 4EZKA 5CHWA 1YNTE 4A6QA 3JSVA 3DWGC 1VJKA 2D11A 3L13A 4OZCA 1TYGB 1FNWA 2WU2B 1JROA 3ABVB 4BKSD 1IGCA 2V1YA 4OW0A 1FXIA 3ONSA 1VZ7A 4B95A 1LM8B 3Q3JA 3W1SC 3Q8BA 5CTRC 3B9JA 4A3OA 2PMVA 4KIKB 1GUAB 2KHWB 2KN4A 5H92C 2FBWB 1WX8A 2LVOA 2JSVX 2CKHB 5FR3A 1TTNA 2BB6A 2FIFA 2IBIB 1NEKB 1WZ3A 3DQVA 2MJEA 1HTOA 1C79A 1D6EC 2AWTA 3ZJTA 1FXTB 1WR1A 3PREA 3TSSA 1NVID 1R4MB 2ZW0A 3IFWB 1I4XA 4AQ7A 4S0RA 3P2BA 3ZTDA 1SEBD 1FRRA 4JQWC 2K1FA 1KFYB 1EU3A 1JMLA 3R8BA 4F8CB 4LNNA 2NTSA 4ZRIA 1TT5B 4DWFA 1P0RA 1WZ0A 3ZXRA 2HJ8A 2VRRB 3MHSD 2LEKA 3I63C 3V61A 3UGBB 2KDEB 1L2NA 4IM2A 3IAM1 5EE0A 1IBXA 2MJ3A 2OJRA 1MHXA 4IWQA 5BYQA 3VH3B 4DDID 2K39A 5DPTA 2C7MB 4OHJA 1NDDA 1UBIA 2G4SA 3ZJUA 1WJUA 4FJZA 3NHEB 2C7HA 2REXA 2BBCA 2NPTB 3RZFA 4E74A 1XCTL 4IOIE 5T8IA 4YSZB 3IG3A 2WDTB 1MHHE 3CSTA 4RGOS 1N62A 4IM3A 3MTNB 3NOBA 2KFKB 4FJYA 4WJOA 2L05A 2MEKA 3LXFA 2IGDA 2SAKA 3OAWA 4DXFA 4ARIA 4RGMA 4WQMA 1WRDB 3D32A 5L83A 4OVUA 2KANA 2WU5B 3QJZA 4MSQB 2NMQA 1PQSA 4NQLB 4AJYB 2V4IB 1WXAA 3PRZA 3W1YA 1JW9D 4M00A 4KGTA 2KN5A 1Q10A 3I9V1 1T0RC 2GB1A 4WJPA 3AE6B 3Q69A 4US8A 1FM0D 1RM6C 1Y8RC 2WXOA 3A9JA 4HVBA 5C3JB 2DZMA 2AQ3B 2GI9A 1FNUA 3DBRI 2L1AA 3PGEA 3PVLA 3W2DA 4P6VF 3ML9A 4LNKA 3RFZB 1JQ4A 2DZIA 2WXNA 4RM8A 2OOBB 5HKHA 3AN1A 1D5XC 5KHQA 3M63B 4WIPA 2KJHB 5GMVA 3AB5A 3OJ3A 3U7ZA 2FAZA 2WXLA 3PTFC 1I4HA 1M94A 4AUQC 3I57A 1L0YB 2WGSA 3PS6A 4MH8A 4HKZE 3UIPB 1RFAA 4DHJB 4TUUA 1K51A 1EUVB 1QKZA 2L8JA 4ASWC 4C7ZA 1RYJA 1WXSA 4I6LB 1B1ZA 4GOCA 1VZ6A 4BKSA 1I35A 2XBBC 2PVGC 2WNMA 2N9KA 2NS5A 2VH2A 1SIFA 2KC2A 2IYDB 3VXWA 3EFUA 2ASQA 2MCNB 3Q14C 1IUEA 1PFDA 3B2FA 1V49A 3JYUA 2KQSA 3TBLD 3Q8EA 3V6EB 2GBKA 2ZJDA 4NPNA 3VR9B 4HJGE 4JWUC 3ZNHB 4ANVA 3JW0X 3LB8C 2RPVA 2DX5B 2KYWA 4GDLB 4OVVA 1KRHA 3ETRA 2QCZA 2X38A 3ZQ4A 2GMIC 1SF0A 4LDTD 1I4QA 2PE6B 4KKIA 2RDBC 2D3AA 2AQ2B 4WAFA 3AU4A 1F1HA 2MHJA 4BKTA 3NVVA 4E71A 1VD2A 3BWUD 5E6JA 5TR5A 3ZVVA 1FCCC 2QMTA 3ZKJC 2NCNA 3B1LX 1WXVA 2DLBA 3DHHC 1H4RA 3R2IA 1KJTA 3PZDA 3U4EG 2INDC 5C1ZA 1WE7A 4EZJA 5G5GA 5IN7A 4B6WA 3N1YC 2W3RA 2L32A 4ZRJA 4EFOA 2LWPA 2LUEA 1QOFA 1PGAA 2ONQA 3QX1A 3ZUNA 2RR9A 1AW7A 4BOZB 4Q2JA 3AE1B 4HRSA 4A8XC 1WI0A 2GRIA 3Q8FA 4KDLB 4B0EA 1L6VA 4HDOA 2MWSB 3SR6A 1QT9A 1YQBA 4ZDVA 1GJZA 1EO6A 2MLBA 5BMGA 1K53A 4KDIC 2D3BA 3AE3B 4WJNA 1SB3C 3X0WA 3P4PB 4WWOA 1F2RI 1T0SC 2KWUB 2K6DB 4KKJA 3APFA 3TEZA 1E8XA 2JXTA 4C56C 4RH6A 3BVMA 2OJWA 2MJDA 2D2QA 3EA6A 1XF5L 2EMSA 3O65B 2PJHA 5IKCM 3DBHB 1FEHA 1FIQA 2JU6X 1VR9A 1R4NI 3A4RA 4G0NB 3RD2A 1CJEA 3NJTA 4P16A 3W5VB 2LGSA 1JALA 1Q5WB 3TMPB 3MC9A 1Q0WB 4K81A 4ZRPA 4PK1A 4RM9A 4WQOB 3OLMD 5HFYA 3IBEA 2WDVB 1Z5SB 2DAFA 1ZOYB 3W5UB 3PRMB 2RSUA 2PVOD 3P4RB 3L17A 4WJQA 2YEPF 2LD9A 3EECA 1XT9B 2JY6A 3LYYA 2HDEA 2KJ6A 1SE9A 1HE8A 2G1EA 2K8CA 3AE4B 3VAWA 1FRDA 2CHZA 4M01A 2D3CA 3DVNU 2RD0A 3IAS1 3RNBC 3AECB 1XCQL 2O6VA 1SE4A 2Z59B 4DXGA 2WX0A 1RAXA 3SD5A 4JWSC 5D6JB 3VRBB 1T3QA 3DVGY 4NAWB 1YJ1A 1BMLC 2J0JA 2MBHA 3VRAB 1MI0A 2KTRB 3GZNB 1YJIA 2K25A 3MP9A 1BUIC 1N5WA 4H2AA 1PDXA 1LXDA 3VUWA 2AL3A 1NENB 3SFEB 2ZNVB 4YXDB 1TY2A 1EWYC 4R3DA 1WRIA 2OEDA 5J2RA 2L76A 1C9FA 1NI3A 2PKOA 3VTVA 3R7RA 1E8WA 1KLGD 2L00B 4RF1A 1V97A 4RNAA 4CO7A 4NNJB 2MSED 3GS2A 2FCSA 4PYUA 4GLSC 5J17A 4G3XB 1TKEA 2BYVE 4ZRQA 2XNAC 3I3TB 1L7YA 3QCAA 3ZIMA 1DOIA 2ZVOA 1T0YA 1Y56A 2N1WA 2INNE 3ZGZA 1XLQA 1WMHA 1TS5A 1P7FA 1FNVA 1FFUA 1WM2A 1ZPSA 2AYOB 5G55A 1OQRA 4XC2A 4LDTB 2G45B 1ZXIA 2QIEB 1MVKA 2KWVB 3PLUA 3SFDB 2K5PA 5JXVA 4PS3A 3FILA 3HM3A 2UWQA 3ZO5B 3A9KB 3EHVA 1D4BA 3GOEA 4EUTA 1ET6A 4EE2A 4MGKE 2LGDA 3QWZB 1VZ8A 2NTTA 3NVWA 2LHEA 1YN3A 1HQRD 1MPEA 3OG5A 4XDDA 1C3TA 3KQ4A 5DPWA 2R2OA 1V5OA 2W3SA 3DCGA 2H88B 3Q8CA 3BVGA 2BTEA 4YTPB 4NZLB 2K8BA 3VQIA 3PZ8A 4D2KA 1A70A 3NZ3A 2WYQA 2LVQA 2V0GA 1IYFA 2JYEA 1KTKA 3CF6E 3DHGC 2IO3B 4A3PA 2I1JA 1VDVA 4JL9A 5IA7A 2AEHA 2KMMA 2Z8LA 1TGZB 2JQRB 4XX5A 5CX3A 4AJWA 3ZLZA 4YT0B 2KVZA 4ACFA 3IXSA 3CMMB 3N32A 1L0VB 3ZRCA 3JSVB 4AS1A 1DYQA 2N1VA 5BMHA 1HXYD 3KH0A 3PZ7A 5AZHA 3MJ5A 1SGHA 2N9PC 3K9OB 4BKGA 4BOSC 2MBEA 1CK1A 3AMZA 2BPSA 2BT6A 5FKAC 2JZPA 3VDZA 4TQ0A 2ZPYA 1S3SG 1NBFC 1HTQA 3J9CA 2J7QB 3U8ZA 4C4VA 2J0KA 2JZZA 3O13A 3N1XC 2WX1A 3N9YC 2ZPNA 3B2GA 4BZAA 3WAPA 1FD6A 4LK0M 5LXHA 2W54A 4M0WB 2JT4B 3GE3C 3QARA 2Y5BB 3AE9B 1WJ6A 5EDSA 4AOFA 5IP4D 4MT5A 1C77A 3CSFA 2X8XX 2EKEC 1DOYA 1UGJA 3FAHA 2L0FA 3V3XA 3P1MA 3VR8B 1YX6B 2INPE 4HDQA 5JZEB 4XDCA 1FMAD 2BB5A 3BY4B 3FKYA 1HA5A 2L83A 3T9LA 1SE3A 1E9MA 2KFKA 5HI1A 2G4DB 5JHAA 4GXBA 1YJJA 3AE2B 1DGJA 1C78A 2KD0A 1YOVB 2J4XA 1TZ1A 3H7SA 2A4ZA 5AUKA 3ML8A 1QF6A 2I38A 2K6QA 5DPRA 2PLPA 3W9CB 1MG4A 2KMAA 2QHOA 3PT2B 2G9HD 2KVRA 2V9HA 4WURA 2BW2A 4RGTA 4KSKC 1J7CA 3TEWA 1F77A 4FBJB 1TKYA 1L5PA 3NVYA 3QQ8B 3FC4A 3KWVA 3DBLI 1WGKA 1CQVA 5L95C 3MJWA 5D2MB 3N1ZC 4LNOA 1RFKA 3B08A 2O2VA 3AH7A 5HG2A 2ZCCA 1E8ZA 2AL6A 2FCNA 2J53A 1LGRA 1IP9A 1SBBB 4ITKA 1V5TA 1J0GA 4MH0E 5TSSA 3V60A 1TS2A 2KMCA 4G50A 2J52A 4K7SA 2GBJA 4KX6B 4K3CA 3NZUA 2LJ5A 3EC8A 3NRZA 1EF1A 2KO3A 5H8YE 3A9JB 4JPSA 1UGMA 3QHTA 1OGWA 2CU1A 2LRUA 2UU7A 4W9FA 1XEEA 1ZXHA 4W9HA 2CJOA 1AN8A 2VZKB 1TS4A 3RUIB 1YN4A 3VFKA 1UH6A 3BK1A 1N6ZA 3L10B 4WWNA 4WWPA 1V1PA 1X1MA 4US9A 4RCOA 3AEBB 4MSMB 5DPSA 3AEDB 3ENEA 1ZUD2 2KWDA 2MP2B 1R4MI 3DPDA 2BF8B 4CQNA 1NYQA 4JIOU 2HE7A 4B9KA 2BYEA 4ICVA 1E5WA 4YL8A 4I6NB 2MBBB 2ZVNA 1KLVA 4FLHA 2Y3AA 4RFBA 3U7DA 1L4ZB 4MGYE 2KNBA 4XWWA 1OQYA 1WYGA 3RN9C 1QOBA 3VVWB 3IHPC 4MELA 3SEBA 3UF8A 1WE6A 1RRBA 4ANXA 3AEGB 1F2RC 2MA9B 3AEAB 2LI5A 3WA0A 1N60A 4GSWA 1PYWD 5JHBA 4IM0A 1XLNA 1WY8A 1UF0A 2AX5A 4OZAA 3WIMA 2CS4A 2DBYA 2B76B 3TEYA 4GDKB 2WXIA 1Z2MA 4DDGD 1SE2A 4RMAA 1PGXA 1OFFA 1F0ZA 4XYCA 2FUG1 4MACA 2LGYA 2LJIA 1I42A 1C4AA 1UBQA 4DHZB 2RMMA 1J8CA 1WJNA 2L0TA 2JWZA 4OVZA 2KJRA 2HTHA 2PTLA 1B9RA 4HLEA 1UNSA 3L08A 4W9EA 2WXMA 3Q6BA 2IGHA 2DYMA 3RI7C 4IUMB 3ECIA 1FPYA 4RGNA 4HKQA 1HZ6A 3EUB2 4KGSA 3HM6X 2Z0EB 2WDRB 3RNAC 2CR5A 4IG7B 1J19A 4LCDE 3HVDA 3C0RB 2JZ3B 3T3OA 2JYTA 4KZCA 2L52A 3PV1A 2ZCBA 4LTUA 3N20C 3ZW3A 4EZLA 3T3NA 4PS8A 3ZDTA 1V81A 4LNIA 1IPGA 4IWPA 4E3CA 1D5MC 4NJ6A 4J3OD 3PRPB 1E10A 1I4RA 5KHOA 2KX3A 1GC7A 2GBMA 3M62B 2NBVB 1QILA 2Y5CA 3VUYA 3PO0A 2KTFA 4EEWA 2LRWA 4II3B 4HWIB 3R7QA 2LXCA 4MM3B 2ZEQA 2BVCA 2W55A 2C5LC 1E6EB 2XN9C 3AE8B 4NQKE 1V80A 1M4VA 1WM3A 3RCZA 3VTWA 3TEXA 3ZYYX 5LLIA 3BVZA 1DOXA 1C76A 3KLSX 4TV3A 3LDZE 5CHFA 1SIJA 4FHKA 2A5UA 1QZEA 2KDIA 5FR6A 3C19A 1YMHE 2GBRA 5LNK1 2N7EA 5GXGB 2DYBA 2L3ZA 3EFCA 2QJLA 1C4PA 3L4PA 3VTUA 2ZZPB 4FADA 1WXQA 1QOGA 1RWSA 2YLMA 3Q3OC 2HJ1A 2KTRA 3M3JA 3DVGX 1WIAA 3U2SC 2KWCA 1XXGA 4EOYA 3BIID 4ANWA 4DHZE 4BVUC 2DAJA 4DXAB 3QAQA 1L0XB 4L23A 3RNCC 2VH1A 1GB4A 2IPKD 4FN2A 4WWMA 1WGGA 5D3IB 3ZNZB 1AWDA 3AM9A 3H9DA 4DK5A 4MEMA 4HXDA 3GE8C 3DBSA 3NZSA 2ZW1A 1QLBB 3H6NA 2J0MA 3A1QB 1JWMD 2M1MA 1FFVA 1CZPA 1MG8A 2O6VB 1TZOA 2IGGA 4A9AA 2N0SB 3H1UA 2BYTA 1ZW7A 1E7PB 3PLVA 1T6BX 2YEPB 2KACA 2QC8A 3AE7B 3L16A 2BGFA 4YTMB 1KM7A 2K9XA 1AYFA 4NJCA 2Y5PA 2DYOA 4W9CA 1ENFA 1E7UA 2KXJA 1LQBA 2TSSA 3H7PA 3WAMA 4A55A 2GLSA 1GG3A 2PIAA 4ANUA 3HVZA 1YIWA 5BO4B 2M0XA 1TJEA 1OEYJ 3UIOB 2PW9A 4PYZA 2M4NA 1EWCA 2JWUA 3A9KA 1KLUD 1STEA 3PSEB 4J6IA 4KSLC 2MBOA 2NBWB 1T0QC 3P4QB 4GN1A 5IAAC 1E8YA 1P3QU 1V9JA 2V3SA 1JWUD 2WXHA 2MH7A 4MJSA 4BBNF 5G2NA 2IO0B 4NAMA 1UWMA 4DQOC 1P7EA 3U30A 3AULA 1E0ZA 4JE3B 1V8CA 1WX9A 4HPLB 1BXTA 5AZGA 4A90A 2VZKD 2WXPA 1KOTA 4CYEA 3UQBA 3RMKC 2XEWA 2LUMA 1TIFA 4O1NA 4C80A 2M56B 2PE9A 2LFIA 5C2TB 3WANA 4KIKA 1C4CA 3HIZA 3DDCB 1NI2A 1P9DU 1WJ4A 1HZ5A 1EU4A 3DBRB 3L54A 2XK5B 2N9XA 2NBUA 2D10A 2IDYA 3KUZA 2JVCA 1XD3B 2MRPA 1F52A 4FJVB 4HK2A 2MQJA 1IGDA 3BINA 1JWBD 4USAA 2BKFA 1JWSD 4XE0A 3GB1A 3IVFA 4L1BA 2M0AA 2FCQA 2LMCA 3MC8A 3WAOA 1N61A 4KZ0A 2LGXA 2KDMA 1XLPA 2JF5A 1FXAA 5IOIA 4IKGA 2DNFA 3E56A 4P1BC 3TL5A 2W82A 4N58A 4M0WA 3SHQA 1QQRA 3GZNI 2R61A 3QC8B 3IT4B 3ZDMC 4P1CC 1FO4A 2WWZA 1N5XA 2ACZB 1UUPA 1XQQA 4X57B 4M02A 2KQ7A 4KGRA 3NS1A 4WH4A 2INCC 3APDA 1E90A 3TCAA 1YQ4B 3ZJVA 1YD8U 2NPTA 1EM7A 1J7BA 2PEAA 4TQ1A 4BBNC 2M17A 4C4VB 3Q3NC 3R3MA 1C1YB 4JLCA 1SXTA 1FCLA 1GOZA 2N9EB 3PPAA 4M8NA 3C8YA 2B3AA 1JRPA 3QK0A 3AI5A 3QA8A 1YQ3B 2IY0B 3NY5A 1V86A 1I4PA 2KLGA 4EKUA 3VHTC 3BYYB 1NYRA 2FNJB 3KW5B 1IBXB 4L2YA 2KLCA 1R7SA 2KOXA 2GOWA 2HTME 2N9LA 3TJPA 4W9GA 2LASA 3ZNGC 2M8SA 3AU5A 3ZXVA 3S2AA 3BZDB 4AP4C 1J7AA 4HCPB 1CMXB 2RGFA 2BS2B 2DWQA 1L6UA 1UD7A 4W9KA 2EKIA 1WGRA 3B0AA 1ZDXA 1WGDA 4IW0A 4YWGG 1MFWA 3QIJA 1MJDA 2EELA 4W9IA 2D5GA 1AARA 2W9NA 5LXIB 4ZRKA 2R2QA 4W9LA 3P63A 3WALA 3EGRA 3KVFB 3V62A 2LHDA 4C7YA 2QSDA 2K8HA 2LXAA 1GC6A 3APCA 3RZWC 3KYDD 5FK9C 2LGIA 3PHWB 1SJHD 5D94A 4K7UA 3NG0A 2BWFA 1R4NB 2J42A 4QAYA 4JGHB 2MP2A 3H8HA 2G3QB 5E6NA 3RNFC 2O2VB 3ALBA 3Q2AC 4N59A 4MDKE 2GBNA 1OQQA 3SDLC 4NY0A 3VUXA 2JRIB 4I6PA 1ZDVA 2V3PA 1WH3A 3UINB 4B0MA 4HPMB 2JUOA 5HHDG 4AWJA 2O6VD 4II2B 2WQYB 4XZ4A 2BS4B 4ZYNA 3X23A 1XO3A 1LFDA 1ESFA 2KT7A 1GNUA 2BQQA 1E7VA 4ICUA 3MFGA 2KKCA 1ACCA 3MHZA 1K8RB 4GDLA 2L7RA 3KWLA 1ZE3D 3RYTA 2BWES 1JRUA 3AXCA 2IY1B 2I2YA 3U52E 2AQ1B 3Q8AA 4TKNA 2OHFA 4HROA 4IDIA 2KQ4X 2BS3B 5BYRA 3NUHB 1V1PB 2DZKA 4YSXB 4GDKA 1I7HA 4RF0A 3BYTB 2QDFA 1UZXB 3WCQA 3N3KB 2QEJC 1QOAA 4NJ7A 2LVPA 3T8MA 4URKA 4W9DA 2SEBD 2C60A 1P98A 5AEKB 3E9SA 3VH4B 2IJ0A 2IO2B 2K0PA 4FULA 2CHWA 5I4DA 4N9F4 3A4SC 3ZTCA 2RPQA 3HHMA 2KC1A 5AUIA 4ZHOA 5D7GA 1YN5A 1U4AA 1V6EA 3AE5B 4TMAB 4KV2A 2HD5B 4MGZE 1Q1OA 4M8MA 2JX5A 4K1RB 2M19A 2FE8A 4PT5A 1P1AA 1VCBA 2MW5A 1ET9A 1PGBA 4LJPB 5AZFA 1LO5D 1PUTA 4BFRA 1HEZE 4P7IA 2N7DA 4K3BA 3GP7A 4HCNB 4YSYB 4XGAB 4GGQA 3L0WB 5C23A 3M95A 3RPFC 2FCMA 4FXCA 2K3UA 4KVGB 2K22A 2WDQB 3K9PB 1GPXA 2KZRA 3TUOA 4MM3A 2D07B 2WXQA 2KK8A 4GIVA 3R2TA 1TY0A 1T5XD 2N4FA 2WXJA 1TKGA 2KDFB 1S1QB 1WR6E 5D3DA 3SU8X
chains in the Genus database with same CATH topology
1WXSA 2MBOA 4I6LB 1WJ6A 2NBWB 4GOCA 4AOFA 5EDSA 3OJ4B 4GN1A 3CSFA 4BKSA 1I35A 5IAAC 2EKEC 3RULA 1E8YA 2JPHA 1P3QU 1V9JA 2V3SA 2XBBC 5CHVC 2L0FA 4MJSA 2NS5A 4F7ZA 4G11A 1SIFA 4BBNF 3R66C 2IO1B 1YX6B 3KUCB 2KC2A 2IYDB 5G2NA 2IO0B 3Q3FA 3VXWA 4HDQA 1WGHA 5JZEB 3EFUA 3U30A 3AULA 1WYWB 2I1KA 3BY4B 2ASQA 2MCNB 1WX9A 4HPLB 2NVUI 3T9LA 3JYUA 1V49A 4WAAA 2KFKA 1V2YA 5AZGA 2KQSA 2V4LA 1F9JA 3TBLD 2G4DB 1A5RA 1KOTA 2BKRB 3V6EB 2GBKA 2ZJDA 4CYEA 4NPNA 5JHAA 4GXBA 3UQBA 3ZNHB 4ANVA 4LJOB 5E6OA 3JVZX 2XEWA 3JW0X 2KD0A 4NAWA 1ZGUB 2DX5B 4K7WA 4GDLB 4OVVA 1TZ1A 3H7SA 2PE9A 2NR2A 2A4ZA 1ZKHA 2GMIC 2MX2A 3ML8A 4CHKA 2KX0A 4LDTD 3WANA 3A33B 4KIKA 2PE6B 3HIZA 3DDCB 1NI2A 3AU4A 1P9DU 2K6QA 4IWOA 5DPRA 2Z0DB 5E6PA 1WJ4A 3A1QA 4BKTA 4E71A 2KMAA 1VD2A 4GB9A 2QHOA 3L54A 2XK5B 2N9XA 3KUDB 3PT2B 4PS7A 5TR5A 3ZVVA 2NBUA 3ZKJC 2KVRA 2NCNA 3B1LX 1WXVA 2D10A 3KUZA 2JVCA 1XD3B 3ZNID 1H4RA 1WXMA 2IZVB 2MRPA 1KJTA 4FJVB 4KSKC 3PZDA 4HK2A 5C1ZA 4FBJB 1WE7A 2JRHA 2MQJA 2D3GA 3BINA 3QQ8B 4EZJA 4B6WA 3DBLI 2BKFA 5L95C 1OTRB 3MJWA 5D2MB 2DZJA 4GU2A 3IVFA 4ZRJA 4EFOA 2C9WB 2EMTA 2FCQA 3TIXA 2LWPA 3B08A 2LUEA 2O2VA 3WAOA 2ZCCA 4KZ0A 1E8ZA 2AL6A 4IC7B 3QX1A 2FCNA 2LZ6A 2LGXA 3ZUNA 1IP9A 1V5TA 1J0GA 4MH0E 2KFJA 2RR9A 2BYFA 2JF5A 3DVNV 4BOZB 3KYCD 3V60A 2KMCA 2C7NB 3LJ3A 4G50A 3TL5A 4K7SA 2CHXA 2GBJA 2DHZA 1WI0A 3SHQA 1WF9A 1ISNA 3GZNI 1G6JA 3NZUA 3QC8B 3W1SA 1YX5B 2LJ5A 3ZDMC 4KDLB 3EC8A 1WGYA 4HDOA 2MWSB 2WWZA 1EF1A 2KO3A 3A9JB 1H8CA 1UGMA 1YQBA 2DENB 3HK0A 3ZRFA 3QHTA 4ZDVA 4HJKA 1OGWA 2CU1A 2LRUA 4DBGA 2KDBA 4W9FA 1GJZA 1EO6A 1XQQA 2MLBA 4KDIC 4W9HA 4X57B 2KQ7A 4WJNA 3X0WA 3UQAA 2FIDA 3RUIB 4WWOA 3VFKA 1UH6A 2KWUB 2K6DB 3APFA 3L10B 4WWNA 2PPHA 1E8XA 3APDA 4WWPA 1RLFA 1X1MA 4FA6A 2D2QA 1E90A 2EMSA 3O65B 4MSMB 3TCAA 2PJHA 5DPSA 1YD8U 3ENEA 3NS8A 2MP2B 2NPTA 1R4MI 3DPDA 2UYZB 2FUHB 2BF8B 2PEAA 3H7PB 4MGIE 4TQ1A 1R4NI 4A20A 1WX7A 4BBNC 2M17A 3A4RA 5JH5C 4G0NB 4JIOU 3RD2A 1WMHB 2HE7A 3V6CB 4B9KA 1EF5A 2BYEA 4F1SA 4ICVA 1E5WA 3R3MA 1C1YB 4I6NB 4JLCA 4YL8A 2MBBB 2ZVNA 1Q5WB 3TMPB 2ZNVC 1KLVA 4FLHA 1BT0A 1Q0WB 2N9EB 4K81A 3PPAA 3N30A 1UELA 4M8NA 3U7DA 4MGYE 2B3AA 3QK0A 2YVCA 2JXXA 3AI5A 2KNBA 3DBHI 4RM9A 4WQOB 1WFYA 3OLMD 3QA8A 3IBEA 1OQYA 2IY0B 3NY5A 1V86A 1Z5SB 5DCNA 3VVWB 2KLGA 2DAFA 1TBEA 3IHPC 4MELA 1WE6A 3UF8A 1D3ZA 4EKUA 1RRBA 3PRMB 4ANXA 3VHTC 2RSUA 2MA9B 2XK5A 3L17A 4WJQA 2FNJB 4DHJD 2LD9A 3EECA 1XT9B 2LI5A 3KW5B 3WA0A 2JY6A 2MBQA 4GSWA 4MJSB 2KLCA 2KOXA 2KJ6A 2GOWA 4W9JA 1SE9A 3RT3B 4GMVA 3TJPA 3PHXB 5J18A 1HE8A 2LASA 4W9GA 2M8SA 3ZNGC 3AU5A 4IM0A 2K8CA 5JHBA 3VAWA 2CHZA 1WY8A 4FHJA 3DOWA 1OEYA 3DVNU 4EZKA 5CHWA 3WIMA 2RD0A 2CS4A 4GDKB 3JSVA 3S2AA 1Z2MA 4DDGD 2D11A 3L13A 4AP4C 2O6VA 4RMAA 4HCPB 2Z59B 2WX0A 4BKSD 1RAXA 2V1YA 3SD5A 1CMXB 2RGFA 5D6JB 2LGYA 3ONSA 3DVGY 4NAWB 4B95A 1I42A 1LM8B 1YJ1A 2J0JA 2MBHA 3Q3JA 1UD7A 4W9KA 1UBQA 2KTRB 1WGRA 2K25A 3W1SC 4DHZB 3B0AA 5CTRC 1LXDA 3VUWA 4IW0A 1WGDA 1J8CA 1WJNA 2AL3A 2L0TA 3QIJA 2JWZA 4A3OA 2KJRA 4KIKB 1GUAB 2KHWB 2ZNVB 2HTHA 4HLEA 1WX8A 2LVOA 3L08A 2CKHB 4W9EA 1TTNA 4W9IA 2FIFA 5J2RA 2IBIB 2L76A 1AARA 2DYMA 4IUMB 2W9NA 3ECIA 5LXIB 4ZRKA 3VTVA 2R2QA 4W9LA 3R7RA 1E8WA 3WALA 2L00B 1WZ3A 3KVFB 3V62A 4CO7A 3HM6X 2K8HA 2MSED 4NNJB 2LXAA 1GC6A 2Z0EB 3APCA 2FCSA 3DQVA 3KYDD 3RZWC 2CR5A 4PYUA 4IG7B 5J17A 1J19A 4LCDE 3PHWB 4G3XB 2AWTA 2BYVE 1FXTB 1WR1A 3PREA 3C0RB 2JZ3B 5D94A 4KZCA 4K7UA 3I3TB 1L7YA 2BWFA 3PV1A 3QCAA 3ZIMA 2ZVOA 2ZCBA 1T0YA 4JGHB 3ZW3A 3IFWB 4EZLA 2MP2A 2G3QB 5E6NA 2N1WA 4PS8A 3ZDTA 1V81A 2O2VB 3ALBA 1IPGA 4MDKE 2GBNA 4IWPA 3P2BA 3ZTDA 4E3CA 4JQWC 1WMHA 2K1FA 4NJ6A 3SDLC 4NY0A 3VUXA 2JRIB 3PRPB 4I6PA 1WH3A 3UINB 5KHOA 4HPMB 2JUOA 4AWJA 2O6VD 2KX3A 1WM2A 1GC7A 2GBMA 2AYOB 3M62B 5G55A 4II2B 4F8CB 4XZ4A 4ZYNA 3X23A 2NBVB 3VUYA 1LFDA 4ZRIA 2KTFA 1GNUA 4XC2A 4EEWA 4LDTB 2LRWA 4DWFA 1E7VA 1P0RA 2G45B 4II3B 4ICUA 1WZ0A 2HJ8A 2VRRB 2KKCA 3MHSD 4HWIB 3R7QA 2LXCA 2ZEQA 2KWVB 1K8RB 3PLUA 4GDLA 3V61A 3UGBB 2L7RA 2KDEB 1L2NA 4IM2A 2C5LC 4PS3A 3RYTA 3HM3A 2UWQA 2OJRA 2BWES 4NQKE 3ZO5B 3A9KB 1JRUA 1V80A 4IWQA 3VH3B 3AXCA 3EHVA 1WM3A 2IY1B 2K39A 3RCZA 4DDID 5DPTA 3VTWA 2C7MB 3GOEA 1NDDA 4EUTA 5LLIA 4TKNA 4MGKE 2LGDA 3QWZB 1UBIA 4TV3A 2G4SA 3LDZE 5CHFA 1WJUA 2DZKA 4FHKA 4FJZA 3NHEB 4GDKA 1C3TA 2C7HA 2A5UA 2REXA 1QZEA 5DPWA 2KDIA 2R2OA 5FR6A 1V5OA 2NPTB 3DCGA 3RZFA 4E74A 1UZXB 2GBRA 2N7EA 3N3KB 2DYBA 4NJ7A 2LVPA 3IG3A 2WDTB 3CSTA 3T8MA 4URKA 4W9DA 2L3ZA 2K8BA 4IM3A 3MTNB 3VQIA 2C60A 1P98A 3VTUA 2ZZPB 3NOBA 4FADA 2KFKB 4FJYA 4WJOA 5AEKB 2L05A 2YLMA 3M3JA 2KTRA 2WYQA 3DVGX 1WIAA 3OAWA 3VH4B 2LVQA 5L83A 1WRDB 3D32A 1IYFA 2IO2B 2KWCA 4FULA 4EOYA 4OVUA 2CHWA 4ANWA 4DHZE 4BVUC 2DAJA 4N9F4 3A4SC 2KANA 3ZTCA 4DXAB 3CF6E 2RPQA 3HHMA 2KC1A 3QAQA 2IO3B 4A3PA 4FN2A 2I1JA 5D7GA 3QJZA 4MSQB 1WGGA 4JL9A 3ZNZB 1PQSA 1U4AA 2AEHA 4NQLB 3H9DA 4AJYB 5IA7A 1V6EA 4DK5A 1WXAA 1TGZB 3PRZA 4MEMA 3W1YA 4HXDA 4XX5A 4KV2A 2HD5B 3DBSA 4MGZE 1Q1OA 2KN5A 5CX3A 4M8MA 3NZSA 4AJWA 3ZLZA 4WJPA 4K1RB 3H6NA 3CMMB 2J0MA 3A1QB 3N32A 3ZRCA 1Y8RC 2M1MA 1P1AA 1VCBA 3A9JA 4HVBA 2MW5A 3JSVB 2DZMA 3DBRI 1MG8A 4LJPB 5AZFA 2N1VA 2O6VB 3PGEA 3PVLA 3KH0A 4BFRA 5AZHA 3ML9A 1SGHA 2N9PC 3H1UA 3K9OB 4P7IA 4BKGA 1ZW7A 2MBEA 4BOSC 3PLVA 2N7DA 3L16A 4HCNB 2DZIA 4RM8A 2BGFA 2OOBB 5HKHA 1KM7A 2BPSA 3VDZA 4TQ0A 3M63B 5KHQA 2DYOA 2ZPYA 4GGQA 4W9CA 1E7UA 2KJHB 1S3SG 2KXJA 1NBFC 3L0WB 5C23A 5GMVA 3M95A 3OJ3A 1LQBA 2FAZA 3H7PA 3WAMA 2FCMA 3PTFC 1GG3A 2J7QB 1M94A 3U8ZA 4ANUA 4KVGB 2J0KA 2JZZA 4AUQC 2WX1A 3K9PB 2KZRA 2ZPNA 3PS6A 4MM3A 2D07B 1YIWA 5BO4B 2KK8A 4GIVA 2M0XA 3WAPA 1OEYJ 5LXHA 3UIOB 2N4FA 4PYZA 3UIPB 1RFAA 4DHJB 2M4NA 2KDFB 4M0WB 4TUUA 1S1QB 1WR6E 3A9KA 2JT4B 3PSEB 4J6IA 1EUVB 3QARA 2L8JA 2Y5BB 4KSLC 4ASWC 3SU8X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXS A;  2MBO A;  4I6L B;  1WJ6 A;  2NBW B;  4GOC A;  4AOF A;  5EDS A;  3OJ4 B;  4GN1 A;  3CSF A;  4BKS A;  1I35 A;  5IAA C;  2EKE C;  3RUL A;  1E8Y A;  2JPH A;  1P3Q U;  1V9J A;  2V3S A;  2XBB C;  5CHV C;  2L0F A;  4MJS A;  2NS5 A;  4F7Z A;  4G11 A;  1SIF A;  4BBN F;  3R66 C;  2IO1 B;  1YX6 B;  3KUC B;  2KC2 A;  2IYD B;  5G2N A;  2IO0 B;  3Q3F A;  3VXW A;  4HDQ A;  1WGH A;  5JZE B;  3EFU A;  3U30 A;  3AUL A;  1WYW B;  2I1K A;  3BY4 B;  2ASQ A;  2MCN B;  1WX9 A;  4HPL B;  2NVU I;  3T9L A;  3JYU A;  1V49 A;  4WAA A;  2KFK A;  1V2Y A;  5AZG A;  2KQS A;  2V4L A;  1F9J A;  3TBL D;  2G4D B;  1A5R A;  1KOT A;  2BKR B;  3V6E B;  2GBK A;  2ZJD A;  4CYE A;  4NPN A;  5JHA A;  4GXB A;  3UQB A;  3ZNH B;  4ANV A;  4LJO B;  5E6O A;  3JVZ X;  2XEW A;  3JW0 X;  2KD0 A;  4NAW A;  1ZGU B;  2DX5 B;  4K7W A;  4GDL B;  4OVV A;  1TZ1 A;  3H7S A;  2PE9 A;  2NR2 A;  2A4Z A;  1ZKH A;  2GMI C;  2MX2 A;  3ML8 A;  4CHK A;  2KX0 A;  4LDT D;  3WAN A;  3A33 B;  4KIK A;  2PE6 B;  3HIZ A;  3DDC B;  1NI2 A;  3AU4 A;  1P9D U;  2K6Q A;  4IWO A;  5DPR A;  2Z0D B;  5E6P A;  1WJ4 A;  3A1Q A;  4BKT A;  4E71 A;  2KMA A;  1VD2 A;  4GB9 A;  2QHO A;  3L54 A;  2XK5 B;  2N9X A;  3KUD B;  3PT2 B;  4PS7 A;  5TR5 A;  3ZVV A;  2NBU A;  3ZKJ C;  2KVR A;  2NCN A;  3B1L X;  1WXV A;  2D10 A;  3KUZ A;  2JVC A;  1XD3 B;  3ZNI D;  1H4R A;  1WXM A;  2IZV B;  2MRP A;  1KJT A;  4FJV B;  4KSK C;  3PZD A;  4HK2 A;  5C1Z A;  4FBJ B;  1WE7 A;  2JRH A;  2MQJ A;  2D3G A;  3BIN A;  3QQ8 B;  4EZJ A;  4B6W A;  3DBL I;  2BKF A;  5L95 C;  1OTR B;  3MJW A;  5D2M B;  2DZJ A;  4GU2 A;  3IVF A;  4ZRJ A;  4EFO A;  2C9W B;  2EMT A;  2FCQ A;  3TIX A;  2LWP A;  3B08 A;  2LUE A;  2O2V A;  3WAO A;  2ZCC A;  4KZ0 A;  1E8Z A;  2AL6 A;  4IC7 B;  3QX1 A;  2FCN A;  2LZ6 A;  2LGX A;  3ZUN A;  1IP9 A;  1V5T A;  1J0G A;  4MH0 E;  2KFJ A;  2RR9 A;  2BYF A;  2JF5 A;  3DVN V;  4BOZ B;  3KYC D;  3V60 A;  2KMC A;  2C7N B;  3LJ3 A;  4G50 A;  3TL5 A;  4K7S A;  2CHX A;  2GBJ A;  2DHZ A;  1WI0 A;  3SHQ A;  1WF9 A;  1ISN A;  3GZN I;  1G6J A;  3NZU A;  3QC8 B;  3W1S A;  1YX5 B;  2LJ5 A;  3ZDM C;  4KDL B;  3EC8 A;  1WGY A;  4HDO A;  2MWS B;  2WWZ A;  1EF1 A;  2KO3 A;  3A9J B;  1H8C A;  1UGM A;  1YQB A;  2DEN B;  3HK0 A;  3ZRF A;  3QHT A;  4ZDV A;  4HJK A;  1OGW A;  2CU1 A;  2LRU A;  4DBG A;  2KDB A;  4W9F A;  1GJZ A;  1EO6 A;  1XQQ A;  2MLB A;  4KDI C;  4W9H A;  4X57 B;  2KQ7 A;  4WJN A;  3X0W A;  3UQA A;  2FID A;  3RUI B;  4WWO A;  3VFK A;  1UH6 A;  2KWU B;  2K6D B;  3APF A;  3L10 B;  4WWN A;  2PPH A;  1E8X A;  3APD A;  4WWP A;  1RLF A;  1X1M A;  4FA6 A;  2D2Q A;  1E90 A;  2EMS A;  3O65 B;  4MSM B;  3TCA A;  2PJH A;  5DPS A;  1YD8 U;  3ENE A;  3NS8 A;  2MP2 B;  2NPT A;  1R4M I;  3DPD A;  2UYZ B;  2FUH B;  2BF8 B;  2PEA A;  3H7P B;  4MGI E;  4TQ1 A;  1R4N I;  4A20 A;  1WX7 A;  4BBN C;  2M17 A;  3A4R A;  5JH5 C;  4G0N B;  4JIO U;  3RD2 A;  1WMH B;  2HE7 A;  3V6C B;  4B9K A;  1EF5 A;  2BYE A;  4F1S A;  4ICV A;  1E5W A;  3R3M A;  1C1Y B;  4I6N B;  4JLC A;  4YL8 A;  2MBB B;  2ZVN A;  1Q5W B;  3TMP B;  2ZNV C;  1KLV A;  4FLH A;  1BT0 A;  1Q0W B;  2N9E B;  4K81 A;  3PPA A;  3N30 A;  1UEL A;  4M8N A;  3U7D A;  4MGY E;  2B3A A;  3QK0 A;  2YVC A;  2JXX A;  3AI5 A;  2KNB A;  3DBH I;  4RM9 A;  4WQO B;  1WFY A;  3OLM D;  3QA8 A;  3IBE A;  1OQY A;  2IY0 B;  3NY5 A;  1V86 A;  1Z5S B;  5DCN A;  3VVW B;  2KLG A;  2DAF A;  1TBE A;  3IHP C;  4MEL A;  1WE6 A;  3UF8 A;  1D3Z A;  4EKU A;  1RRB A;  3PRM B;  4ANX A;  3VHT C;  2RSU A;  2MA9 B;  2XK5 A;  3L17 A;  4WJQ A;  2FNJ B;  4DHJ D;  2LD9 A;  3EEC A;  1XT9 B;  2LI5 A;  3KW5 B;  3WA0 A;  2JY6 A;  2MBQ A;  4GSW A;  4MJS B;  2KLC A;  2KOX A;  2KJ6 A;  2GOW A;  4W9J A;  1SE9 A;  3RT3 B;  4GMV A;  3TJP A;  3PHX B;  5J18 A;  1HE8 A;  2LAS A;  4W9G A;  2M8S A;  3ZNG C;  3AU5 A;  4IM0 A;  2K8C A;  5JHB A;  3VAW A;  2CHZ A;  1WY8 A;  4FHJ A;  3DOW A;  1OEY A;  3DVN U;  4EZK A;  5CHW A;  3WIM A;  2RD0 A;  2CS4 A;  4GDK B;  3JSV A;  3S2A A;  1Z2M A;  4DDG D;  2D11 A;  3L13 A;  4AP4 C;  2O6V A;  4RMA A;  4HCP B;  2Z59 B;  2WX0 A;  4BKS D;  1RAX A;  2V1Y A;  3SD5 A;  1CMX B;  2RGF A;  5D6J B;  2LGY A;  3ONS A;  3DVG Y;  4NAW B;  4B95 A;  1I42 A;  1LM8 B;  1YJ1 A;  2J0J A;  2MBH A;  3Q3J A;  1UD7 A;  4W9K A;  1UBQ A;  2KTR B;  1WGR A;  2K25 A;  3W1S C;  4DHZ B;  3B0A A;  5CTR C;  1LXD A;  3VUW A;  4IW0 A;  1WGD A;  1J8C A;  1WJN A;  2AL3 A;  2L0T A;  3QIJ A;  2JWZ A;  4A3O A;  2KJR A;  4KIK B;  1GUA B;  2KHW B;  2ZNV B;  2HTH A;  4HLE A;  1WX8 A;  2LVO A;  3L08 A;  2CKH B;  4W9E A;  1TTN A;  4W9I A;  2FIF A;  5J2R A;  2IBI B;  2L76 A;  1AAR A;  2DYM A;  4IUM B;  2W9N A;  3ECI A;  5LXI B;  4ZRK A;  3VTV A;  2R2Q A;  4W9L A;  3R7R A;  1E8W A;  3WAL A;  2L00 B;  1WZ3 A;  3KVF B;  3V62 A;  4CO7 A;  3HM6 X;  2K8H A;  2MSE D;  4NNJ B;  2LXA A;  1GC6 A;  2Z0E B;  3APC A;  2FCS A;  3DQV A;  3KYD D;  3RZW C;  2CR5 A;  4PYU A;  4IG7 B;  5J17 A;  1J19 A;  4LCD E;  3PHW B;  4G3X B;  2AWT A;  2BYV E;  1FXT B;  1WR1 A;  3PRE A;  3C0R B;  2JZ3 B;  5D94 A;  4KZC A;  4K7U A;  3I3T B;  1L7Y A;  2BWF A;  3PV1 A;  3QCA A;  3ZIM A;  2ZVO A;  2ZCB A;  1T0Y A;  4JGH B;  3ZW3 A;  3IFW B;  4EZL A;  2MP2 A;  2G3Q B;  5E6N A;  2N1W A;  4PS8 A;  3ZDT A;  1V81 A;  2O2V B;  3ALB A;  1IPG A;  4MDK E;  2GBN A;  4IWP A;  3P2B A;  3ZTD A;  4E3C A;  4JQW C;  1WMH A;  2K1F A;  4NJ6 A;  3SDL C;  4NY0 A;  3VUX A;  2JRI B;  3PRP B;  4I6P A;  1WH3 A;  3UIN B;  5KHO A;  4HPM B;  2JUO A;  4AWJ A;  2O6V D;  2KX3 A;  1WM2 A;  1GC7 A;  2GBM A;  2AYO B;  3M62 B;  5G55 A;  4II2 B;  4F8C B;  4XZ4 A;  4ZYN A;  3X23 A;  2NBV B;  3VUY A;  1LFD A;  4ZRI A;  2KTF A;  1GNU A;  4XC2 A;  4EEW A;  4LDT B;  2LRW A;  4DWF A;  1E7V A;  1P0R A;  2G45 B;  4II3 B;  4ICU A;  1WZ0 A;  2HJ8 A;  2VRR B;  2KKC A;  3MHS D;  4HWI B;  3R7Q A;  2LXC A;  2ZEQ A;  2KWV B;  1K8R B;  3PLU A;  4GDL A;  3V61 A;  3UGB B;  2L7R A;  2KDE B;  1L2N A;  4IM2 A;  2C5L C;  4PS3 A;  3RYT A;  3HM3 A;  2UWQ A;  2OJR A;  2BWE S;  4NQK E;  3ZO5 B;  3A9K B;  1JRU A;  1V80 A;  4IWQ A;  3VH3 B;  3AXC A;  3EHV A;  1WM3 A;  2IY1 B;  2K39 A;  3RCZ A;  4DDI D;  5DPT A;  3VTW A;  2C7M B;  3GOE A;  1NDD A;  4EUT A;  5LLI A;  4TKN A;  4MGK E;  2LGD A;  3QWZ B;  1UBI A;  4TV3 A;  2G4S A;  3LDZ E;  5CHF A;  1WJU A;  2DZK A;  4FHK A;  4FJZ A;  3NHE B;  4GDK A;  1C3T A;  2C7H A;  2A5U A;  2REX A;  1QZE A;  5DPW A;  2KDI A;  2R2O A;  5FR6 A;  1V5O A;  2NPT B;  3DCG A;  3RZF A;  4E74 A;  1UZX B;  2GBR A;  2N7E A;  3N3K B;  2DYB A;  4NJ7 A;  2LVP A;  3IG3 A;  2WDT B;  3CST A;  3T8M A;  4URK A;  4W9D A;  2L3Z A;  2K8B A;  4IM3 A;  3MTN B;  3VQI A;  2C60 A;  1P98 A;  3VTU A;  2ZZP B;  3NOB A;  4FAD A;  2KFK B;  4FJY A;  4WJO A;  5AEK B;  2L05 A;  2YLM A;  3M3J A;  2KTR A;  2WYQ A;  3DVG X;  1WIA A;  3OAW A;  3VH4 B;  2LVQ A;  5L83 A;  1WRD B;  3D32 A;  1IYF A;  2IO2 B;  2KWC A;  4FUL A;  4EOY A;  4OVU A;  2CHW A;  4ANW A;  4DHZ E;  4BVU C;  2DAJ A;  4N9F 4;  3A4S C;  2KAN A;  3ZTC A;  4DXA B;  3CF6 E;  2RPQ A;  3HHM A;  2KC1 A;  3QAQ A;  2IO3 B;  4A3P A;  4FN2 A;  2I1J A;  5D7G A;  3QJZ A;  4MSQ B;  1WGG A;  4JL9 A;  3ZNZ B;  1PQS A;  1U4A A;  2AEH A;  4NQL B;  3H9D A;  4AJY B;  5IA7 A;  1V6E A;  4DK5 A;  1WXA A;  1TGZ B;  3PRZ A;  4MEM A;  3W1Y A;  4HXD A;  4XX5 A;  4KV2 A;  2HD5 B;  3DBS A;  4MGZ E;  1Q1O A;  2KN5 A;  5CX3 A;  4M8M A;  3NZS A;  4AJW A;  3ZLZ A;  4WJP A;  4K1R B;  3H6N A;  3CMM B;  2J0M A;  3A1Q B;  3N32 A;  3ZRC A;  1Y8R C;  2M1M A;  1P1A A;  1VCB A;  3A9J A;  4HVB A;  2MW5 A;  3JSV B;  2DZM A;  3DBR I;  1MG8 A;  4LJP B;  5AZF A;  2N1V A;  2O6V B;  3PGE A;  3PVL A;  3KH0 A;  4BFR A;  5AZH A;  3ML9 A;  1SGH A;  2N9P C;  3H1U A;  3K9O B;  4P7I A;  4BKG A;  1ZW7 A;  2MBE A;  4BOS C;  3PLV A;  2N7D A;  3L16 A;  4HCN B;  2DZI A;  4RM8 A;  2BGF A;  2OOB B;  5HKH A;  1KM7 A;  2BPS A;  3VDZ A;  4TQ0 A;  3M63 B;  5KHQ A;  2DYO A;  2ZPY A;  4GGQ A;  4W9C A;  1E7U A;  2KJH B;  1S3S G;  2KXJ A;  1NBF C;  3L0W B;  5C23 A;  5GMV A;  3M95 A;  3OJ3 A;  1LQB A;  2FAZ A;  3H7P A;  3WAM A;  2FCM A;  3PTF C;  1GG3 A;  2J7Q B;  1M94 A;  3U8Z A;  4ANU A;  4KVG B;  2J0K A;  2JZZ A;  4AUQ C;  2WX1 A;  3K9P B;  2KZR A;  2ZPN A;  3PS6 A;  4MM3 A;  2D07 B;  1YIW A;  5BO4 B;  2KK8 A;  4GIV A;  2M0X A;  3WAP A;  1OEY J;  5LXH A;  3UIO B;  2N4F A;  4PYZ A;  3UIP B;  1RFA A;  4DHJ B;  2M4N A;  2KDF B;  4M0W B;  4TUU A;  1S1Q B;  1WR6 E;  3A9K A;  2JT4 B;  3PSE B;  4J6I A;  1EUV B;  3QAR A;  2L8J A;  2Y5B B;  4KSL C;  4ASW C;  3SU8 X; 
#chains in the Genus database with same CATH topology
 3AEF B;  2WLB A;  3OJ4 B;  5MPO A;  2E3T A;  3RUL A;  2JPH A;  5CHV C;  5BYS A;  1GB1 A;  3DHI C;  4G11 A;  4F7Z A;  3R66 C;  2IO1 B;  2WXK A;  3KUC B;  3Q3F A;  3BK2 A;  1WGH A;  1WYW B;  2I1K A;  5EE9 A;  2NVU I;  4WAA A;  3CWI A;  1V2Y A;  3RNE C;  2V4L A;  1F9J A;  1A5R A;  2BKR B;  1GAQ B;  1D5Z C;  4LJO B;  5E6O A;  1SJE D;  2RDH A;  3AEE B;  3JVZ X;  4HPP A;  2ON8 A;  1SSN A;  4NAW A;  1ZGU B;  4K7W A;  4ZHP A;  3I5J C;  1WWT A;  2NR2 A;  1ZKH A;  2MX2 A;  4CHK A;  2CJN A;  2KX0 A;  3A33 B;  4IWO A;  2Z0D B;  5E6P A;  3A1Q A;  4GB9 A;  1UWX A;  3KUD B;  4PS7 A;  4ZOH C;  3OWE B;  2H89 B;  1K50 A;  2QIL A;  3ZNI D;  1WXM A;  2IZV B;  3AV8 A;  4BAX A;  4TSS A;  3Q3M C;  2JRH A;  2D3G A;  3URY A;  2CU3 A;  1JCK B;  1OTR B;  3RNG C;  2DZJ A;  4GU2 A;  2C9W B;  2EMT A;  3TIX A;  2RDG A;  4JX1 C;  4IC7 B;  4UDU C;  2LZ6 A;  1VLB A;  2N7J A;  2KFJ A;  2BYF A;  2WXF A;  3DVN V;  4LLG M;  1L4D B;  2KAJ A;  3KYC D;  4HEA 1;  5G5H A;  1ROE A;  2C7N B;  3LJ3 A;  2CHX A;  4LNF A;  4YTN B;  3IT6 B;  2DHZ A;  3CIR B;  1WF9 A;  1ISN A;  1KH0 A;  1G6J A;  2WP9 B;  3W1S A;  1VRA B;  1YX5 B;  5BMI A;  1WGY A;  2WXR A;  1KF6 B;  2Q5W D;  3NVZ A;  1H8C A;  2DEN B;  3HK0 A;  3ZRF A;  4HJK A;  4DBG A;  2KDB A;  2WS3 B;  2WXG A;  1TS3 A;  3UQA A;  2FID A;  3MC0 B;  1XLO A;  3P4S B;  4N6E B;  2PPH A;  4OZB A;  1RLF A;  4FA6 A;  1N63 A;  3NS8 A;  1I4G A;  2E6X A;  2ICI A;  2UYZ B;  2WHI A;  2FUH B;  3H7P B;  4MGI E;  4A20 A;  1WX7 A;  5JH5 C;  1JWA D;  1WMH B;  4F1S A;  3V6C B;  1EF5 A;  1ZP0 B;  3DWM A;  5EE1 A;  2ZNV C;  1BT0 A;  3N30 A;  1UEL A;  2YVC A;  2JXX A;  3DBH I;  1WFY A;  4ARC A;  3HRD D;  3UI3 A;  5DCN A;  1TBE A;  1D3Z A;  2V3N A;  4XWT A;  2XK5 A;  4DHJ D;  3V05 A;  3FIL B;  4REZ A;  1WSP A;  2MBQ A;  3P42 A;  4MJS B;  1K52 A;  5EE3 A;  4W9J A;  3RT3 B;  4GMV A;  1V1O A;  3PHX B;  3HUI A;  5J18 A;  3DBL B;  5IO9 A;  4S17 A;  4FHJ A;  4C00 A;  4ZYS A;  3DOW A;  1OEY A;  4EZK A;  5CHW A;  1YNT E;  4A6Q A;  3JSV A;  3DWG C;  1VJK A;  2D11 A;  3L13 A;  4OZC A;  1TYG B;  1FNW A;  2WU2 B;  1JRO A;  3ABV B;  4BKS D;  1IGC A;  2V1Y A;  4OW0 A;  1FXI A;  3ONS A;  1VZ7 A;  4B95 A;  1LM8 B;  3Q3J A;  3W1S C;  3Q8B A;  5CTR C;  3B9J A;  4A3O A;  2PMV A;  4KIK B;  1GUA B;  2KHW B;  2KN4 A;  5H92 C;  2FBW B;  1WX8 A;  2LVO A;  2JSV X;  2CKH B;  5FR3 A;  1TTN A;  2BB6 A;  2FIF A;  2IBI B;  1NEK B;  1WZ3 A;  3DQV A;  2MJE A;  1HTO A;  1C79 A;  1D6E C;  2AWT A;  3ZJT A;  1FXT B;  1WR1 A;  3PRE A;  3TSS A;  1NVI D;  1R4M B;  2ZW0 A;  3IFW B;  1I4X A;  4AQ7 A;  4S0R A;  3P2B A;  3ZTD A;  1SEB D;  1FRR A;  4JQW C;  2K1F A;  1KFY B;  1EU3 A;  1JML A;  3R8B A;  4F8C B;  4LNN A;  2NTS A;  4ZRI A;  1TT5 B;  4DWF A;  1P0R A;  1WZ0 A;  3ZXR A;  2HJ8 A;  2VRR B;  3MHS D;  2LEK A;  3I63 C;  3V61 A;  3UGB B;  2KDE B;  1L2N A;  4IM2 A;  3IAM 1;  5EE0 A;  1IBX A;  2MJ3 A;  2OJR A;  1MHX A;  4IWQ A;  5BYQ A;  3VH3 B;  4DDI D;  2K39 A;  5DPT A;  2C7M B;  4OHJ A;  1NDD A;  1UBI A;  2G4S A;  3ZJU A;  1WJU A;  4FJZ A;  3NHE B;  2C7H A;  2REX A;  2BBC A;  2NPT B;  3RZF A;  4E74 A;  1XCT L;  4IOI E;  5T8I A;  4YSZ B;  3IG3 A;  2WDT B;  1MHH E;  3CST A;  4RGO S;  1N62 A;  4IM3 A;  3MTN B;  3NOB A;  2KFK B;  4FJY A;  4WJO A;  2L05 A;  2MEK A;  3LXF A;  2IGD A;  2SAK A;  3OAW A;  4DXF A;  4ARI A;  4RGM A;  4WQM A;  1WRD B;  3D32 A;  5L83 A;  4OVU A;  2KAN A;  2WU5 B;  3QJZ A;  4MSQ B;  2NMQ A;  1PQS A;  4NQL B;  4AJY B;  2V4I B;  1WXA A;  3PRZ A;  3W1Y A;  1JW9 D;  4M00 A;  4KGT A;  2KN5 A;  1Q10 A;  3I9V 1;  1T0R C;  2GB1 A;  4WJP A;  3AE6 B;  3Q69 A;  4US8 A;  1FM0 D;  1RM6 C;  1Y8R C;  2WXO A;  3A9J A;  4HVB A;  5C3J B;  2DZM A;  2AQ3 B;  2GI9 A;  1FNU A;  3DBR I;  2L1A A;  3PGE A;  3PVL A;  3W2D A;  4P6V F;  3ML9 A;  4LNK A;  3RFZ B;  1JQ4 A;  2DZI A;  2WXN A;  4RM8 A;  2OOB B;  5HKH A;  3AN1 A;  1D5X C;  5KHQ A;  3M63 B;  4WIP A;  2KJH B;  5GMV A;  3AB5 A;  3OJ3 A;  3U7Z A;  2FAZ A;  2WXL A;  3PTF C;  1I4H A;  1M94 A;  4AUQ C;  3I57 A;  1L0Y B;  2WGS A;  3PS6 A;  4MH8 A;  4HKZ E;  3UIP B;  1RFA A;  4DHJ B;  4TUU A;  1K51 A;  1EUV B;  1QKZ A;  2L8J A;  4ASW C;  4C7Z A;  1RYJ A;  1WXS A;  4I6L B;  1B1Z A;  4GOC A;  1VZ6 A;  4BKS A;  1I35 A;  2XBB C;  2PVG C;  2WNM A;  2N9K A;  2NS5 A;  2VH2 A;  1SIF A;  2KC2 A;  2IYD B;  3VXW A;  3EFU A;  2ASQ A;  2MCN B;  3Q14 C;  1IUE A;  1PFD A;  3B2F A;  1V49 A;  3JYU A;  2KQS A;  3TBL D;  3Q8E A;  3V6E B;  2GBK A;  2ZJD A;  4NPN A;  3VR9 B;  4HJG E;  4JWU C;  3ZNH B;  4ANV A;  3JW0 X;  3LB8 C;  2RPV A;  2DX5 B;  2KYW A;  4GDL B;  4OVV A;  1KRH A;  3ETR A;  2QCZ A;  2X38 A;  3ZQ4 A;  2GMI C;  1SF0 A;  4LDT D;  1I4Q A;  2PE6 B;  4KKI A;  2RDB C;  2D3A A;  2AQ2 B;  4WAF A;  3AU4 A;  1F1H A;  2MHJ A;  4BKT A;  3NVV A;  4E71 A;  1VD2 A;  3BWU D;  5E6J A;  5TR5 A;  3ZVV A;  1FCC C;  2QMT A;  3ZKJ C;  2NCN A;  3B1L X;  1WXV A;  2DLB A;  3DHH C;  1H4R A;  3R2I A;  1KJT A;  3PZD A;  3U4E G;  2IND C;  5C1Z A;  1WE7 A;  4EZJ A;  5G5G A;  5IN7 A;  4B6W A;  3N1Y C;  2W3R A;  2L32 A;  4ZRJ A;  4EFO A;  2LWP A;  2LUE A;  1QOF A;  1PGA A;  2ONQ A;  3QX1 A;  3ZUN A;  2RR9 A;  1AW7 A;  4BOZ B;  4Q2J A;  3AE1 B;  4HRS A;  4A8X C;  1WI0 A;  2GRI A;  3Q8F A;  4KDL B;  4B0E A;  1L6V A;  4HDO A;  2MWS B;  3SR6 A;  1QT9 A;  1YQB A;  4ZDV A;  1GJZ A;  1EO6 A;  2MLB A;  5BMG A;  1K53 A;  4KDI C;  2D3B A;  3AE3 B;  4WJN A;  1SB3 C;  3X0W A;  3P4P B;  4WWO A;  1F2R I;  1T0S C;  2KWU B;  2K6D B;  4KKJ A;  3APF A;  3TEZ A;  1E8X A;  2JXT A;  4C56 C;  4RH6 A;  3BVM A;  2OJW A;  2MJD A;  2D2Q A;  3EA6 A;  1XF5 L;  2EMS A;  3O65 B;  2PJH A;  5IKC M;  3DBH B;  1FEH A;  1FIQ A;  2JU6 X;  1VR9 A;  1R4N I;  3A4R A;  4G0N B;  3RD2 A;  1CJE A;  3NJT A;  4P16 A;  3W5V B;  2LGS A;  1JAL A;  1Q5W B;  3TMP B;  3MC9 A;  1Q0W B;  4K81 A;  4ZRP A;  4PK1 A;  4RM9 A;  4WQO B;  3OLM D;  5HFY A;  3IBE A;  2WDV B;  1Z5S B;  2DAF A;  1ZOY B;  3W5U B;  3PRM B;  2RSU A;  2PVO D;  3P4R B;  3L17 A;  4WJQ A;  2YEP F;  2LD9 A;  3EEC A;  1XT9 B;  2JY6 A;  3LYY A;  2HDE A;  2KJ6 A;  1SE9 A;  1HE8 A;  2G1E A;  2K8C A;  3AE4 B;  3VAW A;  1FRD A;  2CHZ A;  4M01 A;  2D3C A;  3DVN U;  2RD0 A;  3IAS 1;  3RNB C;  3AEC B;  1XCQ L;  2O6V A;  1SE4 A;  2Z59 B;  4DXG A;  2WX0 A;  1RAX A;  3SD5 A;  4JWS C;  5D6J B;  3VRB B;  1T3Q A;  3DVG Y;  4NAW B;  1YJ1 A;  1BML C;  2J0J A;  2MBH A;  3VRA B;  1MI0 A;  2KTR B;  3GZN B;  1YJI A;  2K25 A;  3MP9 A;  1BUI C;  1N5W A;  4H2A A;  1PDX A;  1LXD A;  3VUW A;  2AL3 A;  1NEN B;  3SFE B;  2ZNV B;  4YXD B;  1TY2 A;  1EWY C;  4R3D A;  1WRI A;  2OED A;  5J2R A;  2L76 A;  1C9F A;  1NI3 A;  2PKO A;  3VTV A;  3R7R A;  1E8W A;  1KLG D;  2L00 B;  4RF1 A;  1V97 A;  4RNA A;  4CO7 A;  4NNJ B;  2MSE D;  3GS2 A;  2FCS A;  4PYU A;  4GLS C;  5J17 A;  4G3X B;  1TKE A;  2BYV E;  4ZRQ A;  2XNA C;  3I3T B;  1L7Y A;  3QCA A;  3ZIM A;  1DOI A;  2ZVO A;  1T0Y A;  1Y56 A;  2N1W A;  2INN E;  3ZGZ A;  1XLQ A;  1WMH A;  1TS5 A;  1P7F A;  1FNV A;  1FFU A;  1WM2 A;  1ZPS A;  2AYO B;  5G55 A;  1OQR A;  4XC2 A;  4LDT B;  2G45 B;  1ZXI A;  2QIE B;  1MVK A;  2KWV B;  3PLU A;  3SFD B;  2K5P A;  5JXV A;  4PS3 A;  3FIL A;  3HM3 A;  2UWQ A;  3ZO5 B;  3A9K B;  3EHV A;  1D4B A;  3GOE A;  4EUT A;  1ET6 A;  4EE2 A;  4MGK E;  2LGD A;  3QWZ B;  1VZ8 A;  2NTT A;  3NVW A;  2LHE A;  1YN3 A;  1HQR D;  1MPE A;  3OG5 A;  4XDD A;  1C3T A;  3KQ4 A;  5DPW A;  2R2O A;  1V5O A;  2W3S A;  3DCG A;  2H88 B;  3Q8C A;  3BVG A;  2BTE A;  4YTP B;  4NZL B;  2K8B A;  3VQI A;  3PZ8 A;  4D2K A;  1A70 A;  3NZ3 A;  2WYQ A;  2LVQ A;  2V0G A;  1IYF A;  2JYE A;  1KTK A;  3CF6 E;  3DHG C;  2IO3 B;  4A3P A;  2I1J A;  1VDV A;  4JL9 A;  5IA7 A;  2AEH A;  2KMM A;  2Z8L A;  1TGZ B;  2JQR B;  4XX5 A;  5CX3 A;  4AJW A;  3ZLZ A;  4YT0 B;  2KVZ A;  4ACF A;  3IXS A;  3CMM B;  3N32 A;  1L0V B;  3ZRC A;  3JSV B;  4AS1 A;  1DYQ A;  2N1V A;  5BMH A;  1HXY D;  3KH0 A;  3PZ7 A;  5AZH A;  3MJ5 A;  1SGH A;  2N9P C;  3K9O B;  4BKG A;  4BOS C;  2MBE A;  1CK1 A;  3AMZ A;  2BPS A;  2BT6 A;  5FKA C;  2JZP A;  3VDZ A;  4TQ0 A;  2ZPY A;  1S3S G;  1NBF C;  1HTQ A;  3J9C A;  2J7Q B;  3U8Z A;  4C4V A;  2J0K A;  2JZZ A;  3O13 A;  3N1X C;  2WX1 A;  3N9Y C;  2ZPN A;  3B2G A;  4BZA A;  3WAP A;  1FD6 A;  4LK0 M;  5LXH A;  2W54 A;  4M0W B;  2JT4 B;  3GE3 C;  3QAR A;  2Y5B B;  3AE9 B;  1WJ6 A;  5EDS A;  4AOF A;  5IP4 D;  4MT5 A;  1C77 A;  3CSF A;  2X8X X;  2EKE C;  1DOY A;  1UGJ A;  3FAH A;  2L0F A;  3V3X A;  3P1M A;  3VR8 B;  1YX6 B;  2INP E;  4HDQ A;  5JZE B;  4XDC A;  1FMA D;  2BB5 A;  3BY4 B;  3FKY A;  1HA5 A;  2L83 A;  3T9L A;  1SE3 A;  1E9M A;  2KFK A;  5HI1 A;  2G4D B;  5JHA A;  4GXB A;  1YJJ A;  3AE2 B;  1DGJ A;  1C78 A;  2KD0 A;  1YOV B;  2J4X A;  1TZ1 A;  3H7S A;  2A4Z A;  5AUK A;  3ML8 A;  1QF6 A;  2I38 A;  2K6Q A;  5DPR A;  2PLP A;  3W9C B;  1MG4 A;  2KMA A;  2QHO A;  3PT2 B;  2G9H D;  2KVR A;  2V9H A;  4WUR A;  2BW2 A;  4RGT A;  4KSK C;  1J7C A;  3TEW A;  1F77 A;  4FBJ B;  1TKY A;  1L5P A;  3NVY A;  3QQ8 B;  3FC4 A;  3KWV A;  3DBL I;  1WGK A;  1CQV A;  5L95 C;  3MJW A;  5D2M B;  3N1Z C;  4LNO A;  1RFK A;  3B08 A;  2O2V A;  3AH7 A;  5HG2 A;  2ZCC A;  1E8Z A;  2AL6 A;  2FCN A;  2J53 A;  1LGR A;  1IP9 A;  1SBB B;  4ITK A;  1V5T A;  1J0G A;  4MH0 E;  5TSS A;  3V60 A;  1TS2 A;  2KMC A;  4G50 A;  2J52 A;  4K7S A;  2GBJ A;  4KX6 B;  4K3C A;  3NZU A;  2LJ5 A;  3EC8 A;  3NRZ A;  1EF1 A;  2KO3 A;  5H8Y E;  3A9J B;  4JPS A;  1UGM A;  3QHT A;  1OGW A;  2CU1 A;  2LRU A;  2UU7 A;  4W9F A;  1XEE A;  1ZXH A;  4W9H A;  2CJO A;  1AN8 A;  2VZK B;  1TS4 A;  3RUI B;  1YN4 A;  3VFK A;  1UH6 A;  3BK1 A;  1N6Z A;  3L10 B;  4WWN A;  4WWP A;  1V1P A;  1X1M A;  4US9 A;  4RCO A;  3AEB B;  4MSM B;  5DPS A;  3AED B;  3ENE A;  1ZUD 2;  2KWD A;  2MP2 B;  1R4M I;  3DPD A;  2BF8 B;  4CQN A;  1NYQ A;  4JIO U;  2HE7 A;  4B9K A;  2BYE A;  4ICV A;  1E5W A;  4YL8 A;  4I6N B;  2MBB B;  2ZVN A;  1KLV A;  4FLH A;  2Y3A A;  4RFB A;  3U7D A;  1L4Z B;  4MGY E;  2KNB A;  4XWW A;  1OQY A;  1WYG A;  3RN9 C;  1QOB A;  3VVW B;  3IHP C;  4MEL A;  3SEB A;  3UF8 A;  1WE6 A;  1RRB A;  4ANX A;  3AEG B;  1F2R C;  2MA9 B;  3AEA B;  2LI5 A;  3WA0 A;  1N60 A;  4GSW A;  1PYW D;  5JHB A;  4IM0 A;  1XLN A;  1WY8 A;  1UF0 A;  2AX5 A;  4OZA A;  3WIM A;  2CS4 A;  2DBY A;  2B76 B;  3TEY A;  4GDK B;  2WXI A;  1Z2M A;  4DDG D;  1SE2 A;  4RMA A;  1PGX A;  1OFF A;  1F0Z A;  4XYC A;  2FUG 1;  4MAC A;  2LGY A;  2LJI A;  1I42 A;  1C4A A;  1UBQ A;  4DHZ B;  2RMM A;  1J8C A;  1WJN A;  2L0T A;  2JWZ A;  4OVZ A;  2KJR A;  2HTH A;  2PTL A;  1B9R A;  4HLE A;  1UNS A;  3L08 A;  4W9E A;  2WXM A;  3Q6B A;  2IGH A;  2DYM A;  3RI7 C;  4IUM B;  3ECI A;  1FPY A;  4RGN A;  4HKQ A;  1HZ6 A;  3EUB 2;  4KGS A;  3HM6 X;  2Z0E B;  2WDR B;  3RNA C;  2CR5 A;  4IG7 B;  1J19 A;  4LCD E;  3HVD A;  3C0R B;  2JZ3 B;  3T3O A;  2JYT A;  4KZC A;  2L52 A;  3PV1 A;  2ZCB A;  4LTU A;  3N20 C;  3ZW3 A;  4EZL A;  3T3N A;  4PS8 A;  3ZDT A;  1V81 A;  4LNI A;  1IPG A;  4IWP A;  4E3C A;  1D5M C;  4NJ6 A;  4J3O D;  3PRP B;  1E10 A;  1I4R A;  5KHO A;  2KX3 A;  1GC7 A;  2GBM A;  3M62 B;  2NBV B;  1QIL A;  2Y5C A;  3VUY A;  3PO0 A;  2KTF A;  4EEW A;  2LRW A;  4II3 B;  4HWI B;  3R7Q A;  2LXC A;  4MM3 B;  2ZEQ A;  2BVC A;  2W55 A;  2C5L C;  1E6E B;  2XN9 C;  3AE8 B;  4NQK E;  1V80 A;  1M4V A;  1WM3 A;  3RCZ A;  3VTW A;  3TEX A;  3ZYY X;  5LLI A;  3BVZ A;  1DOX A;  1C76 A;  3KLS X;  4TV3 A;  3LDZ E;  5CHF A;  1SIJ A;  4FHK A;  2A5U A;  1QZE A;  2KDI A;  5FR6 A;  3C19 A;  1YMH E;  2GBR A;  5LNK 1;  2N7E A;  5GXG B;  2DYB A;  2L3Z A;  3EFC A;  2QJL A;  1C4P A;  3L4P A;  3VTU A;  2ZZP B;  4FAD A;  1WXQ A;  1QOG A;  1RWS A;  2YLM A;  3Q3O C;  2HJ1 A;  2KTR A;  3M3J A;  3DVG X;  1WIA A;  3U2S C;  2KWC A;  1XXG A;  4EOY A;  3BII D;  4ANW A;  4DHZ E;  4BVU C;  2DAJ A;  4DXA B;  3QAQ A;  1L0X B;  4L23 A;  3RNC C;  2VH1 A;  1GB4 A;  2IPK D;  4FN2 A;  4WWM A;  1WGG A;  5D3I B;  3ZNZ B;  1AWD A;  3AM9 A;  3H9D A;  4DK5 A;  4MEM A;  4HXD A;  3GE8 C;  3DBS A;  3NZS A;  2ZW1 A;  1QLB B;  3H6N A;  2J0M A;  3A1Q B;  1JWM D;  2M1M A;  1FFV A;  1CZP A;  1MG8 A;  2O6V B;  1TZO A;  2IGG A;  4A9A A;  2N0S B;  3H1U A;  2BYT A;  1ZW7 A;  1E7P B;  3PLV A;  1T6B X;  2YEP B;  2KAC A;  2QC8 A;  3AE7 B;  3L16 A;  2BGF A;  4YTM B;  1KM7 A;  2K9X A;  1AYF A;  4NJC A;  2Y5P A;  2DYO A;  4W9C A;  1ENF A;  1E7U A;  2KXJ A;  1LQB A;  2TSS A;  3H7P A;  3WAM A;  4A55 A;  2GLS A;  1GG3 A;  2PIA A;  4ANU A;  3HVZ A;  1YIW A;  5BO4 B;  2M0X A;  1TJE A;  1OEY J;  3UIO B;  2PW9 A;  4PYZ A;  2M4N A;  1EWC A;  2JWU A;  3A9K A;  1KLU D;  1STE A;  3PSE B;  4J6I A;  4KSL C;  2MBO A;  2NBW B;  1T0Q C;  3P4Q B;  4GN1 A;  5IAA C;  1E8Y A;  1P3Q U;  1V9J A;  2V3S A;  1JWU D;  2WXH A;  2MH7 A;  4MJS A;  4BBN F;  5G2N A;  2IO0 B;  4NAM A;  1UWM A;  4DQO C;  1P7E A;  3U30 A;  3AUL A;  1E0Z A;  4JE3 B;  1V8C A;  1WX9 A;  4HPL B;  1BXT A;  5AZG A;  4A90 A;  2VZK D;  2WXP A;  1KOT A;  4CYE A;  3UQB A;  3RMK C;  2XEW A;  2LUM A;  1TIF A;  4O1N A;  4C80 A;  2M56 B;  2PE9 A;  2LFI A;  5C2T B;  3WAN A;  4KIK A;  1C4C A;  3HIZ A;  3DDC B;  1NI2 A;  1P9D U;  1WJ4 A;  1HZ5 A;  1EU4 A;  3DBR B;  3L54 A;  2XK5 B;  2N9X A;  2NBU A;  2D10 A;  2IDY A;  3KUZ A;  2JVC A;  1XD3 B;  2MRP A;  1F52 A;  4FJV B;  4HK2 A;  2MQJ A;  1IGD A;  3BIN A;  1JWB D;  4USA A;  2BKF A;  1JWS D;  4XE0 A;  3GB1 A;  3IVF A;  4L1B A;  2M0A A;  2FCQ A;  2LMC A;  3MC8 A;  3WAO A;  1N61 A;  4KZ0 A;  2LGX A;  2KDM A;  1XLP A;  2JF5 A;  1FXA A;  5IOI A;  4IKG A;  2DNF A;  3E56 A;  4P1B C;  3TL5 A;  2W82 A;  4N58 A;  4M0W A;  3SHQ A;  1QQR A;  3GZN I;  2R61 A;  3QC8 B;  3IT4 B;  3ZDM C;  4P1C C;  1FO4 A;  2WWZ A;  1N5X A;  2ACZ B;  1UUP A;  1XQQ A;  4X57 B;  4M02 A;  2KQ7 A;  4KGR A;  3NS1 A;  4WH4 A;  2INC C;  3APD A;  1E90 A;  3TCA A;  1YQ4 B;  3ZJV A;  1YD8 U;  2NPT A;  1EM7 A;  1J7B A;  2PEA A;  4TQ1 A;  4BBN C;  2M17 A;  4C4V B;  3Q3N C;  3R3M A;  1C1Y B;  4JLC A;  1SXT A;  1FCL A;  1GOZ A;  2N9E B;  3PPA A;  4M8N A;  3C8Y A;  2B3A A;  1JRP A;  3QK0 A;  3AI5 A;  3QA8 A;  1YQ3 B;  2IY0 B;  3NY5 A;  1V86 A;  1I4P A;  2KLG A;  4EKU A;  3VHT C;  3BYY B;  1NYR A;  2FNJ B;  3KW5 B;  1IBX B;  4L2Y A;  2KLC A;  1R7S A;  2KOX A;  2GOW A;  2HTM E;  2N9L A;  3TJP A;  4W9G A;  2LAS A;  3ZNG C;  2M8S A;  3AU5 A;  3ZXV A;  3S2A A;  3BZD B;  4AP4 C;  1J7A A;  4HCP B;  1CMX B;  2RGF A;  2BS2 B;  2DWQ A;  1L6U A;  1UD7 A;  4W9K A;  2EKI A;  1WGR A;  3B0A A;  1ZDX A;  1WGD A;  4IW0 A;  4YWG G;  1MFW A;  3QIJ A;  1MJD A;  2EEL A;  4W9I A;  2D5G A;  1AAR A;  2W9N A;  5LXI B;  4ZRK A;  2R2Q A;  4W9L A;  3P63 A;  3WAL A;  3EGR A;  3KVF B;  3V62 A;  2LHD A;  4C7Y A;  2QSD A;  2K8H A;  2LXA A;  1GC6 A;  3APC A;  3RZW C;  3KYD D;  5FK9 C;  2LGI A;  3PHW B;  1SJH D;  5D94 A;  4K7U A;  3NG0 A;  2BWF A;  1R4N B;  2J42 A;  4QAY A;  4JGH B;  2MP2 A;  3H8H A;  2G3Q B;  5E6N A;  3RNF C;  2O2V B;  3ALB A;  3Q2A C;  4N59 A;  4MDK E;  2GBN A;  1OQQ A;  3SDL C;  4NY0 A;  3VUX A;  2JRI B;  4I6P A;  1ZDV A;  2V3P A;  1WH3 A;  3UIN B;  4B0M A;  4HPM B;  2JUO A;  5HHD G;  4AWJ A;  2O6V D;  4II2 B;  2WQY B;  4XZ4 A;  2BS4 B;  4ZYN A;  3X23 A;  1XO3 A;  1LFD A;  1ESF A;  2KT7 A;  1GNU A;  2BQQ A;  1E7V A;  4ICU A;  3MFG A;  2KKC A;  1ACC A;  3MHZ A;  1K8R B;  4GDL A;  2L7R A;  3KWL A;  1ZE3 D;  3RYT A;  2BWE S;  1JRU A;  3AXC A;  2IY1 B;  2I2Y A;  3U52 E;  2AQ1 B;  3Q8A A;  4TKN A;  2OHF A;  4HRO A;  4IDI A;  2KQ4 X;  2BS3 B;  5BYR A;  3NUH B;  1V1P B;  2DZK A;  4YSX B;  4GDK A;  1I7H A;  4RF0 A;  3BYT B;  2QDF A;  1UZX B;  3WCQ A;  3N3K B;  2QEJ C;  1QOA A;  4NJ7 A;  2LVP A;  3T8M A;  4URK A;  4W9D A;  2SEB D;  2C60 A;  1P98 A;  5AEK B;  3E9S A;  3VH4 B;  2IJ0 A;  2IO2 B;  2K0P A;  4FUL A;  2CHW A;  5I4D A;  4N9F 4;  3A4S C;  3ZTC A;  2RPQ A;  3HHM A;  2KC1 A;  5AUI A;  4ZHO A;  5D7G A;  1YN5 A;  1U4A A;  1V6E A;  3AE5 B;  4TMA B;  4KV2 A;  2HD5 B;  4MGZ E;  1Q1O A;  4M8M A;  2JX5 A;  4K1R B;  2M19 A;  2FE8 A;  4PT5 A;  1P1A A;  1VCB A;  2MW5 A;  1ET9 A;  1PGB A;  4LJP B;  5AZF A;  1LO5 D;  1PUT A;  4BFR A;  1HEZ E;  4P7I A;  2N7D A;  4K3B A;  3GP7 A;  4HCN B;  4YSY B;  4XGA B;  4GGQ A;  3L0W B;  5C23 A;  3M95 A;  3RPF C;  2FCM A;  4FXC A;  2K3U A;  4KVG B;  2K22 A;  2WDQ B;  3K9P B;  1GPX A;  2KZR A;  3TUO A;  4MM3 A;  2D07 B;  2WXQ A;  2KK8 A;  4GIV A;  3R2T A;  1TY0 A;  1T5X D;  2N4F A;  2WXJ A;  1TKG A;  2KDF B;  1S1Q B;  1WR6 E;  5D3D A;  3SU8 X; 
#chains in the Genus database with same CATH homology
 1WXS A;  2MBO A;  4I6L B;  1WJ6 A;  2NBW B;  4GOC A;  4AOF A;  5EDS A;  3OJ4 B;  4GN1 A;  3CSF A;  4BKS A;  1I35 A;  5IAA C;  2EKE C;  3RUL A;  1E8Y A;  2JPH A;  1P3Q U;  1V9J A;  2V3S A;  2XBB C;  5CHV C;  2L0F A;  4MJS A;  2NS5 A;  4F7Z A;  4G11 A;  1SIF A;  4BBN F;  3R66 C;  2IO1 B;  1YX6 B;  3KUC B;  2KC2 A;  2IYD B;  5G2N A;  2IO0 B;  3Q3F A;  3VXW A;  4HDQ A;  1WGH A;  5JZE B;  3EFU A;  3U30 A;  3AUL A;  1WYW B;  2I1K A;  3BY4 B;  2ASQ A;  2MCN B;  1WX9 A;  4HPL B;  2NVU I;  3T9L A;  3JYU A;  1V49 A;  4WAA A;  2KFK A;  1V2Y A;  5AZG A;  2KQS A;  2V4L A;  1F9J A;  3TBL D;  2G4D B;  1A5R A;  1KOT A;  2BKR B;  3V6E B;  2GBK A;  2ZJD A;  4CYE A;  4NPN A;  5JHA A;  4GXB A;  3UQB A;  3ZNH B;  4ANV A;  4LJO B;  5E6O A;  3JVZ X;  2XEW A;  3JW0 X;  2KD0 A;  4NAW A;  1ZGU B;  2DX5 B;  4K7W A;  4GDL B;  4OVV A;  1TZ1 A;  3H7S A;  2PE9 A;  2NR2 A;  2A4Z A;  1ZKH A;  2GMI C;  2MX2 A;  3ML8 A;  4CHK A;  2KX0 A;  4LDT D;  3WAN A;  3A33 B;  4KIK A;  2PE6 B;  3HIZ A;  3DDC B;  1NI2 A;  3AU4 A;  1P9D U;  2K6Q A;  4IWO A;  5DPR A;  2Z0D B;  5E6P A;  1WJ4 A;  3A1Q A;  4BKT A;  4E71 A;  2KMA A;  1VD2 A;  4GB9 A;  2QHO A;  3L54 A;  2XK5 B;  2N9X A;  3KUD B;  3PT2 B;  4PS7 A;  5TR5 A;  3ZVV A;  2NBU A;  3ZKJ C;  2KVR A;  2NCN A;  3B1L X;  1WXV A;  2D10 A;  3KUZ A;  2JVC A;  1XD3 B;  3ZNI D;  1H4R A;  1WXM A;  2IZV B;  2MRP A;  1KJT A;  4FJV B;  4KSK C;  3PZD A;  4HK2 A;  5C1Z A;  4FBJ B;  1WE7 A;  2JRH A;  2MQJ A;  2D3G A;  3BIN A;  3QQ8 B;  4EZJ A;  4B6W A;  3DBL I;  2BKF A;  5L95 C;  1OTR B;  3MJW A;  5D2M B;  2DZJ A;  4GU2 A;  3IVF A;  4ZRJ A;  4EFO A;  2C9W B;  2EMT A;  2FCQ A;  3TIX A;  2LWP A;  3B08 A;  2LUE A;  2O2V A;  3WAO A;  2ZCC A;  4KZ0 A;  1E8Z A;  2AL6 A;  4IC7 B;  3QX1 A;  2FCN A;  2LZ6 A;  2LGX A;  3ZUN A;  1IP9 A;  1V5T A;  1J0G A;  4MH0 E;  2KFJ A;  2RR9 A;  2BYF A;  2JF5 A;  3DVN V;  4BOZ B;  3KYC D;  3V60 A;  2KMC A;  2C7N B;  3LJ3 A;  4G50 A;  3TL5 A;  4K7S A;  2CHX A;  2GBJ A;  2DHZ A;  1WI0 A;  3SHQ A;  1WF9 A;  1ISN A;  3GZN I;  1G6J A;  3NZU A;  3QC8 B;  3W1S A;  1YX5 B;  2LJ5 A;  3ZDM C;  4KDL B;  3EC8 A;  1WGY A;  4HDO A;  2MWS B;  2WWZ A;  1EF1 A;  2KO3 A;  3A9J B;  1H8C A;  1UGM A;  1YQB A;  2DEN B;  3HK0 A;  3ZRF A;  3QHT A;  4ZDV A;  4HJK A;  1OGW A;  2CU1 A;  2LRU A;  4DBG A;  2KDB A;  4W9F A;  1GJZ A;  1EO6 A;  1XQQ A;  2MLB A;  4KDI C;  4W9H A;  4X57 B;  2KQ7 A;  4WJN A;  3X0W A;  3UQA A;  2FID A;  3RUI B;  4WWO A;  3VFK A;  1UH6 A;  2KWU B;  2K6D B;  3APF A;  3L10 B;  4WWN A;  2PPH A;  1E8X A;  3APD A;  4WWP A;  1RLF A;  1X1M A;  4FA6 A;  2D2Q A;  1E90 A;  2EMS A;  3O65 B;  4MSM B;  3TCA A;  2PJH A;  5DPS A;  1YD8 U;  3ENE A;  3NS8 A;  2MP2 B;  2NPT A;  1R4M I;  3DPD A;  2UYZ B;  2FUH B;  2BF8 B;  2PEA A;  3H7P B;  4MGI E;  4TQ1 A;  1R4N I;  4A20 A;  1WX7 A;  4BBN C;  2M17 A;  3A4R A;  5JH5 C;  4G0N B;  4JIO U;  3RD2 A;  1WMH B;  2HE7 A;  3V6C B;  4B9K A;  1EF5 A;  2BYE A;  4F1S A;  4ICV A;  1E5W A;  3R3M A;  1C1Y B;  4I6N B;  4JLC A;  4YL8 A;  2MBB B;  2ZVN A;  1Q5W B;  3TMP B;  2ZNV C;  1KLV A;  4FLH A;  1BT0 A;  1Q0W B;  2N9E B;  4K81 A;  3PPA A;  3N30 A;  1UEL A;  4M8N A;  3U7D A;  4MGY E;  2B3A A;  3QK0 A;  2YVC A;  2JXX A;  3AI5 A;  2KNB A;  3DBH I;  4RM9 A;  4WQO B;  1WFY A;  3OLM D;  3QA8 A;  3IBE A;  1OQY A;  2IY0 B;  3NY5 A;  1V86 A;  1Z5S B;  5DCN A;  3VVW B;  2KLG A;  2DAF A;  1TBE A;  3IHP C;  4MEL A;  1WE6 A;  3UF8 A;  1D3Z A;  4EKU A;  1RRB A;  3PRM B;  4ANX A;  3VHT C;  2RSU A;  2MA9 B;  2XK5 A;  3L17 A;  4WJQ A;  2FNJ B;  4DHJ D;  2LD9 A;  3EEC A;  1XT9 B;  2LI5 A;  3KW5 B;  3WA0 A;  2JY6 A;  2MBQ A;  4GSW A;  4MJS B;  2KLC A;  2KOX A;  2KJ6 A;  2GOW A;  4W9J A;  1SE9 A;  3RT3 B;  4GMV A;  3TJP A;  3PHX B;  5J18 A;  1HE8 A;  2LAS A;  4W9G A;  2M8S A;  3ZNG C;  3AU5 A;  4IM0 A;  2K8C A;  5JHB A;  3VAW A;  2CHZ A;  1WY8 A;  4FHJ A;  3DOW A;  1OEY A;  3DVN U;  4EZK A;  5CHW A;  3WIM A;  2RD0 A;  2CS4 A;  4GDK B;  3JSV A;  3S2A A;  1Z2M A;  4DDG D;  2D11 A;  3L13 A;  4AP4 C;  2O6V A;  4RMA A;  4HCP B;  2Z59 B;  2WX0 A;  4BKS D;  1RAX A;  2V1Y A;  3SD5 A;  1CMX B;  2RGF A;  5D6J B;  2LGY A;  3ONS A;  3DVG Y;  4NAW B;  4B95 A;  1I42 A;  1LM8 B;  1YJ1 A;  2J0J A;  2MBH A;  3Q3J A;  1UD7 A;  4W9K A;  1UBQ A;  2KTR B;  1WGR A;  2K25 A;  3W1S C;  4DHZ B;  3B0A A;  5CTR C;  1LXD A;  3VUW A;  4IW0 A;  1WGD A;  1J8C A;  1WJN A;  2AL3 A;  2L0T A;  3QIJ A;  2JWZ A;  4A3O A;  2KJR A;  4KIK B;  1GUA B;  2KHW B;  2ZNV B;  2HTH A;  4HLE A;  1WX8 A;  2LVO A;  3L08 A;  2CKH B;  4W9E A;  1TTN A;  4W9I A;  2FIF A;  5J2R A;  2IBI B;  2L76 A;  1AAR A;  2DYM A;  4IUM B;  2W9N A;  3ECI A;  5LXI B;  4ZRK A;  3VTV A;  2R2Q A;  4W9L A;  3R7R A;  1E8W A;  3WAL A;  2L00 B;  1WZ3 A;  3KVF B;  3V62 A;  4CO7 A;  3HM6 X;  2K8H A;  2MSE D;  4NNJ B;  2LXA A;  1GC6 A;  2Z0E B;  3APC A;  2FCS A;  3DQV A;  3KYD D;  3RZW C;  2CR5 A;  4PYU A;  4IG7 B;  5J17 A;  1J19 A;  4LCD E;  3PHW B;  4G3X B;  2AWT A;  2BYV E;  1FXT B;  1WR1 A;  3PRE A;  3C0R B;  2JZ3 B;  5D94 A;  4KZC A;  4K7U A;  3I3T B;  1L7Y A;  2BWF A;  3PV1 A;  3QCA A;  3ZIM A;  2ZVO A;  2ZCB A;  1T0Y A;  4JGH B;  3ZW3 A;  3IFW B;  4EZL A;  2MP2 A;  2G3Q B;  5E6N A;  2N1W A;  4PS8 A;  3ZDT A;  1V81 A;  2O2V B;  3ALB A;  1IPG A;  4MDK E;  2GBN A;  4IWP A;  3P2B A;  3ZTD A;  4E3C A;  4JQW C;  1WMH A;  2K1F A;  4NJ6 A;  3SDL C;  4NY0 A;  3VUX A;  2JRI B;  3PRP B;  4I6P A;  1WH3 A;  3UIN B;  5KHO A;  4HPM B;  2JUO A;  4AWJ A;  2O6V D;  2KX3 A;  1WM2 A;  1GC7 A;  2GBM A;  2AYO B;  3M62 B;  5G55 A;  4II2 B;  4F8C B;  4XZ4 A;  4ZYN A;  3X23 A;  2NBV B;  3VUY A;  1LFD A;  4ZRI A;  2KTF A;  1GNU A;  4XC2 A;  4EEW A;  4LDT B;  2LRW A;  4DWF A;  1E7V A;  1P0R A;  2G45 B;  4II3 B;  4ICU A;  1WZ0 A;  2HJ8 A;  2VRR B;  2KKC A;  3MHS D;  4HWI B;  3R7Q A;  2LXC A;  2ZEQ A;  2KWV B;  1K8R B;  3PLU A;  4GDL A;  3V61 A;  3UGB B;  2L7R A;  2KDE B;  1L2N A;  4IM2 A;  2C5L C;  4PS3 A;  3RYT A;  3HM3 A;  2UWQ A;  2OJR A;  2BWE S;  4NQK E;  3ZO5 B;  3A9K B;  1JRU A;  1V80 A;  4IWQ A;  3VH3 B;  3AXC A;  3EHV A;  1WM3 A;  2IY1 B;  2K39 A;  3RCZ A;  4DDI D;  5DPT A;  3VTW A;  2C7M B;  3GOE A;  1NDD A;  4EUT A;  5LLI A;  4TKN A;  4MGK E;  2LGD A;  3QWZ B;  1UBI A;  4TV3 A;  2G4S A;  3LDZ E;  5CHF A;  1WJU A;  2DZK A;  4FHK A;  4FJZ A;  3NHE B;  4GDK A;  1C3T A;  2C7H A;  2A5U A;  2REX A;  1QZE A;  5DPW A;  2KDI A;  2R2O A;  5FR6 A;  1V5O A;  2NPT B;  3DCG A;  3RZF A;  4E74 A;  1UZX B;  2GBR A;  2N7E A;  3N3K B;  2DYB A;  4NJ7 A;  2LVP A;  3IG3 A;  2WDT B;  3CST A;  3T8M A;  4URK A;  4W9D A;  2L3Z A;  2K8B A;  4IM3 A;  3MTN B;  3VQI A;  2C60 A;  1P98 A;  3VTU A;  2ZZP B;  3NOB A;  4FAD A;  2KFK B;  4FJY A;  4WJO A;  5AEK B;  2L05 A;  2YLM A;  3M3J A;  2KTR A;  2WYQ A;  3DVG X;  1WIA A;  3OAW A;  3VH4 B;  2LVQ A;  5L83 A;  1WRD B;  3D32 A;  1IYF A;  2IO2 B;  2KWC A;  4FUL A;  4EOY A;  4OVU A;  2CHW A;  4ANW A;  4DHZ E;  4BVU C;  2DAJ A;  4N9F 4;  3A4S C;  2KAN A;  3ZTC A;  4DXA B;  3CF6 E;  2RPQ A;  3HHM A;  2KC1 A;  3QAQ A;  2IO3 B;  4A3P A;  4FN2 A;  2I1J A;  5D7G A;  3QJZ A;  4MSQ B;  1WGG A;  4JL9 A;  3ZNZ B;  1PQS A;  1U4A A;  2AEH A;  4NQL B;  3H9D A;  4AJY B;  5IA7 A;  1V6E A;  4DK5 A;  1WXA A;  1TGZ B;  3PRZ A;  4MEM A;  3W1Y A;  4HXD A;  4XX5 A;  4KV2 A;  2HD5 B;  3DBS A;  4MGZ E;  1Q1O A;  2KN5 A;  5CX3 A;  4M8M A;  3NZS A;  4AJW A;  3ZLZ A;  4WJP A;  4K1R B;  3H6N A;  3CMM B;  2J0M A;  3A1Q B;  3N32 A;  3ZRC A;  1Y8R C;  2M1M A;  1P1A A;  1VCB A;  3A9J A;  4HVB A;  2MW5 A;  3JSV B;  2DZM A;  3DBR I;  1MG8 A;  4LJP B;  5AZF A;  2N1V A;  2O6V B;  3PGE A;  3PVL A;  3KH0 A;  4BFR A;  5AZH A;  3ML9 A;  1SGH A;  2N9P C;  3H1U A;  3K9O B;  4P7I A;  4BKG A;  1ZW7 A;  2MBE A;  4BOS C;  3PLV A;  2N7D A;  3L16 A;  4HCN B;  2DZI A;  4RM8 A;  2BGF A;  2OOB B;  5HKH A;  1KM7 A;  2BPS A;  3VDZ A;  4TQ0 A;  3M63 B;  5KHQ A;  2DYO A;  2ZPY A;  4GGQ A;  4W9C A;  1E7U A;  2KJH B;  1S3S G;  2KXJ A;  1NBF C;  3L0W B;  5C23 A;  5GMV A;  3M95 A;  3OJ3 A;  1LQB A;  2FAZ A;  3H7P A;  3WAM A;  2FCM A;  3PTF C;  1GG3 A;  2J7Q B;  1M94 A;  3U8Z A;  4ANU A;  4KVG B;  2J0K A;  2JZZ A;  4AUQ C;  2WX1 A;  3K9P B;  2KZR A;  2ZPN A;  3PS6 A;  4MM3 A;  2D07 B;  1YIW A;  5BO4 B;  2KK8 A;  4GIV A;  2M0X A;  3WAP A;  1OEY J;  5LXH A;  3UIO B;  2N4F A;  4PYZ A;  3UIP B;  1RFA A;  4DHJ B;  2M4N A;  2KDF B;  4M0W B;  4TUU A;  1S1Q B;  1WR6 E;  3A9K A;  2JT4 B;  3PSE B;  4J6I A;  1EUV B;  3QAR A;  2L8J A;  2Y5B B;  4KSL C;  4ASW C;  3SU8 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...