1KJTA

Crystal structure of the gaba(a) receptor associated protein, gabarap
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
b'MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GABARAP
molecule tags Transport protein
source organism Rattus norvegicus
publication title Crystal structure of the GABA(A)-receptor-associated protein, GABARAP.
pubmed doi rcsb
total genus 37
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1kjtA00
3PV1A 1V2YA 4W9KA 2WX0A 3NHEB 4FJYA 2LD9A 4YL8A 3U8ZA 1WX9A 1WM2A 4TUUA 4FBJB 1XT9B 4I6LB 3ZTCA 4CYEA 4DHJD 5AZGA 1GG3A 5EDSA 3H6NA 2DENB 2AWTA 1VCBA 4DDID 2K1FA 3PRZA 2PE6B 3APCA 4KIKA 3ZNID 2MW5A 5D6JB 4ZRIA 2CHZA 3BY4B 2KJ6A 3KW5B 3NZSA 3ZRFA 2HJ8A 4NNJB 3JVZX 3CSTA 2MA9B 4MH0E 2EMSA 4IWPA 4KSKC 3CF6E 2ZZPB 1QZEA 4ICUA 4E3CA 4IM3A 3KVFB 2NBUA 3A1QA 4B6WA 2BYVE 2NR2A 2KJHB 2FAZA 4GMVA 3VH3B 4EUTA 2LVOA 2C60A 3L17A 3KH0A 1AARA 4GSWA 1EF5A 3K9PB 1M94A 4W9FA 1ISNA 4JLCA 2M17A 4CHKA 1WR1A 2CHWA 2O2VA 4GDKA 3VVWB 1R4MI 4FA6A 2WX1A 2QHOA 3MHSD 2GBNA 3PREA 3HHMA 4GDLB 3PS6A 4GDKB 1TTNA 5IAAC 2KANA 4FN2A 2O6VB 1GUAB 1UZXB 2AYOB 5DPTA 3TL5A 4A3OA 1UD7A 2BPSA 2ZEQA 3TMPB 2KMCA 2MSED 2CU1A 3B1LX 2GBMA 1V81A 2KN5A 3APFA 4ZYNA 1YIWA 2O6VA 4FADA 2MCNB 4PYZA 2HE7A 2NPTB 2D10A 2YLMA 2ZJDA 4FLHA 4GOCA 3A9JB 3IVFA 1WE7A 3PRMB 3A9KB 3EECA 5KHQA 3ZLZA 3ZW3A 4RM8A 3H9DA 3RCZA 2O2VB 3QK0A 4LJOB 1S3SG 1WXAA 4ICVA 4G0NB 3P2BA 5CHWA 4TV3A 3A9KA 1K8RB 1KLVA 2PEAA 3IBEA 4WJPA 4JIOU 5JZEB 2NBVB 1EF1A 2RR9A 2KDEB 3L10B 4G50A 1WGGA 5JHAA 2MBEA 4OVVA 3MTNB 4K7SA 4W9GA 1TGZB 4ANUA 3A4SC 1KJTA 5D94A 1UH6A 2KDFB 4MEMA 2BWFA 3Q3JA 3VTUA 2WWZA 4NJ7A 2N1WA 2D11A 3QWZB 4LDTB 4NQLB 4WQOB 4TQ0A 1P9DU 1WXMA 1PQSA 2M8SA 2YVCA 1WXVA 3DBSA 4HPLB 2J0KA 2DYMA 1OTRB 2KWVB 5LXIB 4W9CA 4GXBA 3DVGX 4K1RB 1V5TA 1YX5B 3M95A 2NBWB 1Z2MA 5FR6A 3PHWB 4BKGA 3VAWA 2L8JA 3AXCA 3PPAA 2R2QA 3NY5A 1KM7A 4KZ0A 5C23A 1E8ZA 4FJZA 3ZTDA 2DYBA 2M1MA 4FHKA 4AP4C 1IP9A 2FIDA 4ASWC 1SGHA 3CMMB 3VHTC 4KSLC 3SDLC 3L0WB 2IBIB 1OQYA 2RD0A 2L3ZA 1GC7A 3TBLD 3VDZA 3ZVVA 1I35A 3A4RA 3M3JA 4BKTA 2BYFA 3B08A 2MLBA 1E7UA 1WF9A 2LVPA 4DXAB 2HTHA 1GNUA 1WGRA 3ZDMC 3UIOB 4EZLA 2G45B 2K8HA 3BINA 2ZCBA 2C7MB 1VD2A 3PTFC 4KZCA 2A4ZA 2Z0EB 1YX6B 4IWQA 1FXTB 2L76A 3VH4B 3UQAA 2KMAA 2KTFA 4BVUC 2LGDA 1Q0WB 3ML8A 3JSVA 3V61A 2L00B 4KVGB 2EKEC 4WWPA 2K8BA 3DVNV 3VTVA 3RULA 2KLCA 4M0WB 3V60A 1XQQA 2BF8B 2O6VD 3M62B 2BKRB 2IZVB 2MRPA 1E5WA 4IWOA 3LJ3A 3I3TB 2IO0B 2KOXA 2DHZA 3OJ3A 4WWOA 2DZMA 5G55A 2MBBB 1WIAA 1P98A 4F1SA 1YD8U 2FUHB 3L08A 1WMHB 3TCAA 2CS4A 2ZVNA 1L7YA 3Q3FA 2DAJA 2WDTB 1V6EA 3C0RB 3M63B 4AWJA 2LRWA 5E6PA 4AJWA 2DAFA 4XX5A 3U30A 2LGXA 2OOBB 1V5OA 4GU2A 4ANVA 1E8YA 1NI2A 2GBRA 1E8WA 4W9JA 3N32A 3TJPA 3JW0X 3A9JA 3APDA 4DHZE 2KTRA 1MG8A 3PLUA 3DBRI 2L05A 4II3B 3R7RA 3EFUA 3VFKA 4NY0A 2LJ5A 4A3PA 2JZZA 2KX0A 3DOWA 2J7QB 1UBQA 5DCNA 2ZNVB 4DHZB 4FULA 3DDCB 1E8XA 1WMHA 5JH5C 1WXSA 3PSEB 3UF8A 3KYDD 3UGBB 2KFKB 3WAPA 1H4RA 2FNJB 2BGFA 4II2B 2FCNA 2MX2A 2BWES 2JZ3B 3H7PB 3KUCB 4RMAA 3X23A 3PVLA 3V62A 3O65B 3IHPC 2XEWA 3NOBA 2DZKA 3QIJA 3ZRCA 4J6IA 1WM3A 2BYEA 2KKCA 2KVRA 3OAWA 3PGEA 4GN1A 4MJSB 2JRIB 4W9EA 2KD0A 1WGHA 3HIZA 4A20A 2JY6A 2FCQA 4WWNA 4TQ1A 2MP2B 3ZIMA 3RZWC 3IFWB 1V86A 2W9NA 4GIVA 4DDGD 3RUIB 1Q1OA 1SE9A 2M0XA 3UIPB 4MSQB 2AL6A 5CHVC 1WH3A 3ONSA 3PT2B 3ALBA 4DBGA 3KUZA 5LXHA 4MSMB 2KO3A 3R3MA 4LDTD 3W1SA 3X0WA 2DZJA 4K7UA 1F9JA 4XZ4A 2LGYA 4OVUA 1WJ4A 4GGQA 3PLVA 3DCGA 3QHTA 4GB9A 5DPSA 1SIFA 4NQKE 3HM3A 5J2RA 4W9HA 2LZ6A 3R7QA 3ZNGC 3QA8A 4MJSA 2K6DB 2C7NB 4TKNA 2N7DA 4F7ZA 1LFDA 4HPMB 1GC6A 3RT3B 2MP2A 1UBIA 4B95A 1RFAA 2PPHA 4FHJA 2C7HA 1JRUA 3VQIA 3OLMD 2JXXA 2JRHA 3WIMA 2M4NA 3LDZE 2MBOA 3EHVA 3VUWA 2XBBC 4HJKA 5IA7A 4WJOA 2K8CA 4IC7B 2KDBA 4G3XB 4KDLB 1GJZA 3GZNI 3QJZA 3W1YA 4B9KA 1L2NA 2OJRA 1G6JA 1EUVB 1WYWB 2R2OA 5TR5A 2G4SA 2NPTA 4EZKA 3TIXA 2KK8A 4BKSA 1WR6E 3SU8X 5L95C 1OGWA 2NCNA 2JT4B 2ZNVC 4HLEA 4DK5A 1U4AA 2CHXA 3QQ8B 4AJYB 2LUEA 2A5UA 2LASA 3N3KB 1R4NI 1KOTA 4JL9A 4KV2A 1NDDA 5GMVA 5G2NA 4MELA 4AOFA 4ZDVA 1NBFC 3QX1A 4HWIB 4LCDE 4AUQC 1WI0A 3RD2A 4ZRKA 4DHJB 1CMXB 3W1SC 4WJQA 1WJNA 2B3AA 2J0MA 4BKSD 1C1YB 1WFYA 3IG3A 3ZNHB 3T9LA 3DBHI 4IUMB 3ZO5B 4M8MA 1I42A 2FCSA 3AU4A 2KFKA 3VUXA 3WALA 3CSFA 2PJHA 2D3GA 2JF5A 3UQBA 3QAQA 2KWCA 3ML9A 5JHBA 4I6PA 4I6NB 3AI5A 3WANA 2DZIA 1OEYA 2FCMA 4HVBA 2KXJA 4URKA 2FIFA 4BFRA 4BOSC 5E6OA 2KHWB 2MWSB 1D3ZA 2MBQA 2BKFA 2DYOA 2REXA 2N7EA 3N30A 2GBKA 1TBEA 4HCNB 1YQBA 2AEHA 1LM8B 3DQVA 4XC2A 3NZUA 2CR5A 2UWQA 4NAWB 2Y5BB 2IO1B 3RYTA 4MGZE 2IY1B 2PE9A 3ZUNA 1E7VA 4WAAA 2LVQA 3R66C 2GOWA 2ZVOA 3ZKJC 3GOEA 3KYCD 4MM3A 2I1KA 2LWPA 5DPRA 4DWFA 4EOYA 4G11A 2G4DB 4LJPB 2UYZB 4EKUA 3WAOA 1LXDA 3ECIA 3KUDB 4N9F4 1Q5WB 2VRRB 2JWZA 1BT0A 3DVNU 1UELA 2RPQA 1P1AA 1P0RA 3L54A 4PS3A 3DBLI 4MDKE 2K25A 5KHOA 3D32A 1IPGA 3K9OB 3NS8A 1WX8A 1LQBA 2LRUA 4IM2A 4KIKB 2KLGA 4W9DA 1WY8A 2KDIA 2L7RA 2AL3A 4W9IA 3S2AA 3VUYA 5AEKB 1J0GA 1V9JA 3ENEA 4HDOA 1S1QB 5AZFA 2LXCA 1UGMA 2KWUB 3VXWA 3PZDA 2ZPNA 2JUOA 2HD5B 2GMIC 2I1JA 4E74A 4ZRJA 2V1YA 1J19A 1WRDB 1IYFA 3PRPB 2D2QA 2KZRA 4PYUA 2GBJA 5D7GA 1X1MA 3JSVB 1XD3B 2IYDB 2L0TA 4MGYE 3QCAA 3QC8B 1T0YA 3V6CB 2XK5B 1WZ0A 2MQJA 4IW0A 3A1QB 3H1UA 1E90A 1ZW7A 3JYUA 2LXAA 1OEYJ 4GDLA 2DX5B 2NVUI 1YJ1A 2ZPYA 3HK0A 2IO3B 2V3SA 1WE6A 2K39A 5C1ZA 4HK2A 3QARA 1EO6A 5DPWA 1J8CA 4CO7A 1H8CA 4MGIE 2ZCCA 4IM0A 2KNBA 2IO2B 3EC8A 2KX3A 1V49A 1A5RA 2K6QA 4HDQA 4NPNA 2C5LC 2RGFA 1RLFA 4X57B 2C9WB 2J0JA 3ZNZB 2KQ7A 3B0AA 5HKHA 2XK5A 2L0FA 2KFJA 5AZHA 4HCPB 5E6NA 4F8CB 3SD5A 2LI5A 5J18A 3DPDA 2EMTA 2KJRA 2KC2A 3H7SA 2N1VA 5BO4B 3AULA 4MGKE 3RZFA 4BOZB 4NAWA 1WGYA 1WGDA 1Z5SB 2WYQA 4RM9A 4K81A 4HXDA 3MJWA 4JQWC 4EEWA 3WAMA 2KTRB 3L13A 2ASQA 5D2MB 2N9XA 3DVGY 1V80A 1RAXA 3A33B 2KQSA 3ZDTA 3L16A 4EZJA 4JGHB 3UINB 4FJVB 3U7DA 1WZ3A 4ANWA 3T8MA 1RRBA 3WA0A 5CTRC 4PS7A 5J17A 1Y8RC 2CKHB 2D07B 5CHFA 1C3TA 2Z59B 2N9EB 1WJUA 4PS8A 4IG7B 4NJ6A 3H7PA 2N9PC 1ZKHA 1ZGUB 2N4FA 4E71A 4KDIC 4K7WA 4W9LA 1TZ1A 5CX3A 3VTWA 1WJ6A 5LLIA 4BBNF 4EFOA 2KC1A 2RSUA 2MBHA 4P7IA 3V6EB 1P3QU 5L83A 3SHQA 2JPHA 4ANXA 4WJNA 3OJ4B 1WX7A 4BBNC 2G3QB 3PHXB 4M8NA 1HE8A 2V4LA 2IY0B 2Z0DB 2NS5A 2JVCA 3HM6X 3AU5A
chains in the Genus database with same CATH superfamily
1VJKA 4W9KA 4YL8A 3NHEB 3U8ZA 2LD9A 2KQ4X 3Q8EA 4FBJB 4OVZA 1SB3C 1GG3A 2G9HD 2AWTA 4M02A 1FCCC 2K1FA 2UU7A 4LNKA 2MH7A 3BY4B 4DQOC 3GP7A 3JVZX 3CSTA 1TYGB 2EMSA 4IWPA 3GB1A 2Z8LA 2LMCA 4IDIA 1F1HA 3P4QB 3KQ4A 2WQYB 2LVOA 3CWIA 2WXPA 3ZJTA 1ISNA 3Q8BA 4JLCA 5I4DA 4CHKA 2WNMA 3BIID 1F0ZA 3PREA 4A6QA 4GDLB 5IAAC 2KANA 1I4QA 1UZXB 2AYOB 1MG4A 4A3OA 2KMCA 2MSED 2GBMA 4FADA 2YLMA 4GOCA 4NJCA 3A9JB 2CU3A 3HRDD 5KHQA 3ZLZA 3ZW3A 4RM8A 3RCZA 2O2VB 1FRDA 3L4PA 1K8RB 1VZ8A 1KLVA 4JWUC 3GZNB 2RR9A 1E0ZA 2W55A 4G50A 4K7SA 4W9GA 1TGZB 2KDFB 3IAS1 3Q3JA 4TQ0A 2D11A 4NQLB 2YVCA 1YX5B 5FR6A 3KWLA 3DWGC 3VAWA 3MFGA 2L8JA 2R2QA 3NY5A 1JWSD 4LLGM 1E8ZA 4FJZA 2BW2A 1L6UA 3DHGC 3NVYA 1HTQA 5IKCM 2M1MA 2JSVX 4KSLC 3N20C 1OQYA 1GC7A 3TBLD 3ZVVA 2OHFA 3B08A 2MLBA 4ARIA 1WF9A 1PGXA 4NAMA 1ESFA 2C7MB 2A4ZA 1CJEA 1YX6B 2JXTA 2Z0EB 3VH4B 2D3AA 3UQAA 2D3BA 2NMQA 1Q0WB 3P4SB 3ML8A 4M0WA 5IOIA 2EKEC 1K53A 2KLCA 1EU4A 4M0WB 3V60A 1XQQA 1L0YB 1V1OA 2BKRB 1R4MB 3I3TB 2IO0B 2KOXA 2LGIA 1V6EA 4AWJA 2DAFA 3U30A 2OOBB 4GU2A 2VH1A 3N32A 3JW0X 1E10A 3Q8FA 1QT9A 2PW9A 2MJDA 3DBRI 3OG5A 1MHHE 1ET6A 2JZZA 2J7QB 1I7HA 2V9HA 4DHZB 3FILB 4RNAA 2ICIA 2BGFA 2DBYA 2FCNA 2MX2A 1YOVB 2JQRB 3O65B 2WXJA 3NOBA 1WM3A 4GN1A 1JALA 2JRIB 1WGHA 3HIZA 4M00A 4A20A 2PLPA 3AN1A 4TQ1A 2MP2B 3IFWB 3RNAC 2W9NA 4GIVA 4DDGD 3RUIB 3NVVA 2AL6A 4JX1C 2KO3A 3R3MA 2DZJA 1XEEA 4XZ4A 4GB9A 5DPSA 1VDVA 4NQKE 2GB1A 2WXQA 5E6JA 3SFDB 4W9HA 1T3QA 3AEGB 3ETRA 1WYGA 1UBIA 4FHJA 2K5PA 1JRUA 2JXXA 4WAFA 3WIMA 1PFDA 2XBBC 2K8CA 4G3XB 3GZNI 4B9KA 1WYWB 3IXSA 5TR5A 4EZKA 3SU8X 2QCZA 1OGWA 2ZNVC 1I4GA 1KLGD 1ZE3D 2LUEA 3FAHA 4AJYB 1R4NI 2B76B 4KKIA 5GMVA 3ZJVA 4LCDE 1WI0A 4P16A 1CMXB 1WJNA 1VLBA 3IG3A 3ZNHB 3U52E 3KWVA 4M8MA 3VUXA 2QMTA 4KGTA 5HHDG 4I6NB 1UF0A 1OEYA 2FCMA 4URKA 2FIFA 5E6OA 1VR9A 2MBQA 3N30A 1YQBA 2LEKA 1LM8B 4XDCA 5D3DA 3TEWA 3NZUA 2CR5A 3AEDB 3RYTA 2IY1B 3ZKJC 3GOEA 3PZ7A 2I1KA 4DWFA 2UYZB 1TS5A 4EKUA 1V97A 3ECIA 2JWZA 3AE7B 3N9YC 1CQVA 1T0RC 3L54A 4PS3A 5KHOA 3K9OB 3NS8A 1MVKA 2KLGA 1WY8A 1NYRA 2KDIA 1T0SC 2LXCA 5EE9A 2JUOA 1T6BX 3IT4B 5C3JB 2I1JA 1YN3A 4ZRJA 1RM6C 3I57A 3RPFC 2RPVA 3JSVB 3T3NA 2L0TA 1V8CA 1V1PA 4N59A 2WHIA 4IW0A 1AWDA 1HXYD 2IGHA 1UGJA 2BB5A 2WXHA 1YJ1A 1ROEA 2ZPYA 4YTNB 1R4NB 1WE6A 1EO6A 3AE8B 5IO9A 1J8CA 4JPSA 1QOAA 4CO7A 1N5WA 2KNBA 4KGRA 4HDQA 1RLFA 4X57B 2KQ7A 5HKHA 2G1EA 1MHXA 2DLBA 3EA6A 2N9LA 5E6NA 4F8CB 1I4PA 2LI5A 3I9V1 3DPDA 2EMTA 2K0PA 2KC2A 1SF0A 4RM9A 4NAWA 1FIQA 1XF5L 2WYQA 4K81A 1DYQA 3Q3NC 4EEWA 2KTRB 2Y5CA 2ASQA 2WXFA 3NJTA 3IT6B 3DVGY 4ZHPA 3A33B 2J53A 4JGHB 1M4VA 3AEAB 4ANWA 3T8MA 3TEYA 4O1NA 4REZA 5CTRC 2D07B 5CHFA 1PGAA 2N9EB 1WJUA 4IG7B 2LFIA 2KVZA 2WU2B 1WJ6A 4WURA 2KC1A 3V6EB 1MJDA 1JW9D 1RFKA 2JX5A 3SHQA 2JPHA 1EWCA 2Z0DB 3Q3MC 4JWSC 1GB1A 4B0EA 1V2YA 4US9A 2JU6X 2WX0A 2E3TA 1F2RI 3ZTCA 2AX5A 2ZW0A 3U2SC 1VCBA 3PRZA 3APCA 4KIKA 1ET9A 5D6JB 3P4RB 1K52A 3I5JC 2HJ8A 4NNJB 2RDGA 1TJEA 1QZEA 1FM0D 3FKYA 4B6WA 2BYVE 2NR2A 1K50A 4GMVA 3VH3B 2KACA 1QLBB 3NRZA 3K9PB 1M94A 2M17A 1WR1A 4GDKA 1R4MI 2EELA 1NI3A 2QHOA 3Q8AA 1N62A 2BQQA 4GDKB 3U7ZA 2N0SB 5H92C 1JWAD 2ZEQA 2CU1A 1N6ZA 2O6VA 2BBCA 2HE7A 4ZOHC 2BS3B 3A9KB 3EECA 3BVGA 3RNBC 1JWMD 3QK0A 4ICVA 4YWGG 3P2BA 3AE1B 1F2RC 2PEAA 2J52A 5JZEB 4H2AA 3B2FA 2GI9A 1KJTA 1UH6A 4MEMA 2WWZA 4NJ7A 2N1WA 3QWZB 4LDTB 1GB4A 2DYMA 1OTRB 2KWVB 2W3SA 5BYRA 1KF6B 3TUOA 4BKGA 3EFCA 3AXCA 1KM7A 4KZ0A 5C23A 2J42A 1T0QC 3ZTDA 2DYBA 4AP4C 4FHKA 3GE8C 1IP9A 1J7CA 3CMMB 1N5XA 2IBIB 3W5VB 4WQMA 1I35A 3A4RA 3M3JA 2BYFA 1E7UA 3PO0A 2G45B 2K8HA 3TEXA 3BINA 2ZCBA 1V1PB 1VD2A 3PTFC 4KZCA 2L76A 1HEZE 2KTFA 2LGDA 4TMAB 1IGDA 5HG2A 1TY2A 3M62B 4L1BA 1E5WA 4A8XC 2DHZA 4WWOA 2VH2A 2MBBB 1TS2A 2W82A 4F1SA 1YD8U 4AQ7A 3CIRB 4C7YA 3SEBA 1EWYC 5GXGB 1L0VB 3MHZA 4AJWA 2LGXA 4ANVA 4W9JA 3APDA 4DHZE 2KTRA 4II3B 3R7RA 3EFUA 2LJ5A 2IJ0A 5DCNA 2ZNVB 4MM3B 2BYTA 3DDCB 1E8XA 3UF8A 3TSSA 4II2B 2JZ3B 3Q8CA 2TSSA 3IHPC 2XEWA 5FR3A 4J6IA 3ZXVA 3RNGC 2KKCA 3OAWA 1R7SA 4MH8A 4HEA1 1V86A 1JQ4A 1Q1OA 1SE9A 2M0XA 3UIPB 5CHVC 3PT2B 4DBGA 5LXHA 3KUZA 4MSMB 4LDTD 1NENB 3X0WA 1F9JA 3NUHB 2LGYA 4OVUA 1WJ4A 3LYYA 1SIFA 2D3CA 3HM3A 3ZXRA 1HA5A 3R7QA 2C7NB 1CK1A 4F7ZA 4B95A 3W9CB 4XWWA 2PPHA 1VZ7A 1TS4A 3OLMD 2M4NA 3VUWA 4DXFA 1XLOA 4HJKA 3VR9B 5G5HA 2WXNA 3QJZA 3W1YA 3RNEC 3BWUD 2R2OA 2CJOA 1N60A 2KK8A 2NCNA 4HLEA 1U4AA 4AOFA 5G2NA 4ZDVA 2LHEA 3RD2A 3W1SC 2WDRB 4BKSD 2WU5B 5BYSA 2VZKB 1OQQA 3U4EG 3ZO5B 3AU4A 3WALA 2JF5A 5JXVA 3QAQA 4XE0A 3ML9A 3RFZB 4I6PA 2DZIA 2KHWB 1YNTE 2SAKA 2N7EA 4HCNB 1I4HA 2FUG1 2IDYA 1B1ZA 1P7EA 4NAWB 2IO1B 4MGZE 4YT0B 3RNCC 2LVQA 2WXIA 2GOWA 4MM3A 5DPRA 1D5MC 2WXGA 4G11A 2G4DB 2GLSA 1LXDA 4N9F4 1P1AA 2KAJA 4AS1A 2LGSA 1JMLA 3DBLI 3D32A 1LQBA 3W5UB 3NZ3A 4W9IA 4YTPB 2KMMA 5AEKB 2EKIA 1J0GA 1S1QB 5AZFA 3VXWA 3PZDA 2HD5B 2QJLA 2GMIC 2V1YA 4KGSA 2QSDA 3PRPB 2KZRA 2QC8A 5H8YE 2IYDB 1QF6A 3ABVB 3QCAA 1T0YA 5BMIA 3H1UA 3Q69A 1OEYJ 4GDLA 2DX5B 2K39A 3QARA 1FNVA 4OW0A 1ZDVA 3E56A 2K3UA 1IBXA 4WH4A 4OZBA 2HTME 2NTTA 4HCPB 3BVZA 5MPOA 1JROA 4OHJA 2N1VA 2AQ3B 2NTSA 3AULA 3T3OA 1WGYA 4K3BA 1WGDA 1I4RA 4HXDA 4K3CA 3MC9A 2N7JA 5D2MB 3ZJUA 3ZDTA 2FBWB 4EZJA 4ZHOA 4L2YA 3SFEB 1KTKA 1WZ3A 1C4CA 4PS7A 3O13A 5J17A 1Y8RC 1TIFA 1C3TA 2KDMA 5HI1A 4NJ6A 3H7PA 1ZUD2 2N9PC 5BYQA 1E6EB 4E71A 4K7WA 4W9LA 1TZ1A 3UI3A 3VR8B 4BBNF 1FNWA 1C9FA 1GOZA 4P7IA 2W54A 1P3QU 2INDC 4WJNA 1WX7A 2G3QB 4EE2A 1SE2A 2NS5A 1KLUD 1YMHE 1ZXHA 4FJYA 1XLPA 1WX9A 1WM2A 4TUUA 1ENFA 2KN4A 4CYEA 5EDSA 4PK1A 3H6NA 2INCC 4DDID 1XLNA 2PE6B 3ZNID 4BZAA 4DXGA 3ZRFA 3NZSA 1LO5D 1B9RA 4C56C 3AECB 2MA9B 2PIAA 3HUIA 4MH0E 1YQ4B 4KSKC 2V0GA 2ZZPB 4QAYA 1BUIC 4XDDA 1D5ZC 2KJHB 1Y56A 2FAZA 2C60A 4P1CC 4YSXB 3KH0A 3AE9B 4C00A 4C7ZA 2WX1A 3NVWA 3PS6A 1TTNA 1RYJA 2HJ1A 3P42A 5DPTA 3IAM1 3R8BA 1UD7A 2BPSA 4WWMA 3B1LX 2KN5A 4ZYNA 4ITKA 2INNE 2IPKD 3BZDB 1SE3A 1WE7A 4S17A 4LNNA 1C4PA 4LJOB 5CHWA 4TV3A 3IBEA 4N6EB 3Q2AC 2PTLA 1EF1A 1MFWA 3L10B 5HFYA 5JHAA 2MBEA 4OVVA 4RGOS 1N63A 5D94A 2ACZB 4J3OD 1P7FA 4WQOB 2BS4B 1P9DU 3TEZA 1PQSA 2WGSA 1WXVA 3DBSA 3R2TA 3PZ8A 4W9CA 1V5TA 3N1XC 2NBWB 1Z2MA 5BMGA 2YEPB 4RF0A 3PPAA 3H8HA 1FO4A 1C76A 2D5GA 2I2YA 2M56B 3SDLC 3HVZA 4RGTA 2L3ZA 2AQ2B 3VDZA 4BKTA 2LVPA 4DXAB 2QEJC 2DWQA 2HTHA 1GNUA 1WGRA 3ZDMC 1BXTA 4YXDB 3WCQA 2PVGC 1JWBD 2KMAA 4BVUC 3JSVA 3MJ5A 4WWPA 3DVNV 3VTVA 2L1AA 3OWEB 2KT7A 1LGRA 4HKQA 2Q5WD 2O6VD 2JYEA 2FE8A 4IWOA 1SSNA 2L83A 3OJ3A 3DBLB 1MPEA 3GS2A 3TCAA 1AYFA 2ZVNA 3Q3FA 2DAJA 2WDTB 3M63B 4A9AA 2LRWA 5E6PA 4XX5A 4BAXA 1V5OA 2DNFA 1E8YA 1NI2A 1XXGA 3ZYYX 2GBRA 1E8WA 4N58A 3TJPA 4C4VB 1FPYA 2GRIA 3PLUA 3VFKA 2M19A 1ZPSA 2WDQB 1L6VA 2KX0A 3DOWA 1UBQA 1QILA 4FULA 1WMHA 1AN8A 1EM7A 2KFKB 2QILA 2QIEB 1QQRA 4RMAA 3H7PB 3KUCB 2RDBC 2SEBD 3QIJA 1T5XD 2BYEA 1L5PA 4MJSB 2ON8A 4W9EA 4WWNA 2FCQA 1TKGA 3RZWC 3DHHC 4MSQB 1WH3A 2X38A 3W1SA 1WSPA 3R2IA 4K7UA 3PLVA 3QHTA 4ZRPA 5J2RA 3N1ZC 2K6DB 1HZ6A 2N7DA 1LFDA 1RWSA 4HPMB 3RT3B 2KWDA 1J7AA 2C7HA 2OEDA 2JRHA 4LNIA 2MBOA 3EHVA 1DOXA 4UDUC 4RFBA 2YEPF 4IC7B 4KDLB 1GJZA 1L2NA 1NYQA 4HPPA 2CJNA 1EUVB 1HZ5A 2G4SA 3TIXA 4BKSA 3DHIC 5L95C 3QQ8B 4RGNA 2A5UA 2LASA 3N3KB 3NS1A 4FXCA 4HROA 1NDDA 4MELA 1BMLC 2N9KA 1NBFC 4HWIB 4WJQA 1DOYA 1NVID 3T9LA 3DBHI 1I42A 2FCSA 1STEA 4P6VF 5AUIA 2PJHA 2D3GA 2KYWA 2KWCA 5JHBA 3WANA 3RMKC 4HVBA 1FXIA 4BOSC 1VRAB 2BKFA 4RH6A 2GBKA 1TBEA 1ZOYB 2WP9B 2AEHA 4XC2A 2UWQA 2Y5BB 3AE6B 5IP4D 3ZUNA 1E7VA 4WAAA 3R66C 4RGMA 1IGCA 1KRHA 3MC0B 3KYCD 2LWPA 4EOYA 4MT5A 3NG0A 4LJPB 3ZQ4A 2VRRB 3AEBB 1JRPA 4P1BC 1P0RA 4MDKE 1IPGA 3AMZA 4ACFA 2JYTA 4KIKB 2LRUA 2HDEA 4W9DA 1D4BA 3S2AA 3VUYA 1SJED 4HDOA 2MJEA 3DBHB 1VZ6A 2BVCA 1FCLA 4RCOA 1WRDB 4GLSC 1ZXIA 5D7GA 1X1MA 1GAQB 3QC8B 3V6CB 1E90A 1ZW7A 3MC8A 2MJ3A 3HK0A 2IO3B 1FXAA 4HK2A 2ONQA 5IN7A 5BMHA 2ZCCA 4YSZB 2IO2B 4US8A 3MP9A 3EC8A 4KX6B 4NPNA 2RGFA 1PDXA 2C9WB 2J0JA 3EUB2 2PVOD 2XK5A 2RMMA 1XLQA 2KFJA 3DBRB 3SD5A 5J18A 2KJRA 5BO4B 1C79A 4MGKE 3RZFA 3C8YA 4BOZB 1Z5SB 3MJWA 3WAMA 3L13A 1V80A 1XO3A 2KQSA 3L16A 3UINB 1IBXB 1RRBA 3WA0A 4IOIE 1F52A 4PS8A 2R61A 1SEBD 2AQ1B 3RNFC 2QDFA 1ZGUB 2N4FA 1IUEA 4KDIC 3P63A 1JCKB 5CX3A 3VTWA 5LLIA 4EFOA 3AE3B 2L32A 2MBHA 2RSUA 3OJ4B 1L4DB 3URYA 4BBNC 3PHXB 4M8NA 1HE8A 2IY0B 4HRSA 3HM6X 3PV1A 5EE3A 1WXQA 1XT9B 4I6LB 4DHJD 5AZGA 3AEEB 2DENB 1YJJA 4KKJA 5G5GA 2MW5A 4MACA 4ZRIA 2CHZA 3KW5B 2KJ6A 3CF6E 4ICUA 4E3CA 3KLSX 2WXKA 4IM3A 3KVFB 2NBUA 3A1QA 1WGKA 4EUTA 1SE4A 2INPE 4S0RA 3L17A 3Q6BA 1TKYA 1AARA 4GSWA 1EF5A 4W9FA 2CHWA 2O2VA 3VVWB 4FA6A 3MHSD 2GBNA 3HHMA 4HKZE 4FN2A 2O6VB 1GUAB 3TL5A 2OJWA 1TZOA 1QOBA 3TMPB 1N61A 3BK1A 4D2KA 4LK0M 1V81A 3APFA 5C2TB 1YIWA 2MCNB 4PYZA 4PT5A 2NPTB 3AE5B 3LXFA 2D10A 1UWXA 2ZJDA 4C4VA 4FLHA 1DGJA 3IVFA 3PRMB 2PKOA 2W3RA 3H9DA 4A55A 1C78A 1S3SG 1WXAA 4G0NB 2V3PA 3A9KA 4WJPA 4JIOU 2NBVB 2KDEB 3AM9A 1WGGA 3MTNB 4ANUA 2K22A 3A4SC 3VRBB 4B0MA 2BWFA 3VTUA 4CQNA 1KH0A 1D6EC 1WXMA 2M8SA 4HPLB 2J0KA 3FILA 5LXIB 3AE4B 4GXBA 3DVGX 4K1RB 1HTOA 3M95A 3PHWB 3DWMA 2Y5PA 1YQ3B 3B2GA 2WDVB 2FIDA 4ASWC 1SGHA 1TT5B 3VHTC 3L0WB 2RD0A 1F77A 3E9SA 1C77A 5FKAC 3UIOB 4EZLA 1QOFA 2WXRA 2XNAC 4IWQA 5EE0A 1E9MA 1FXTB 1A70A 5TSSA 1FFUA 2H89B 3V61A 2L00B 4KVGB 2K8BA 4XGAB 1QOGA 3RULA 2X8XX 2LUMA 2BF8B 4WIPA 2IZVB 2MRPA 4LNOA 1XCTL 3LJ3A 4R3DA 2DZMA 5G55A 1WIAA 3BVMA 4M01A 4ARCA 1P98A 3V3XA 3AE2B 3LB8C 2FUHB 3L08A 1WMHB 4YTMB 2CS4A 1L7YA 1AW7A 3C0RB 1WRIA 1PYWD 3I63C 4A90A 3A9JA 1MG8A 2L05A 5FK9C 4NY0A 3ZGZA 4A3PA 3Q14C 2VZKD 5JH5C 1WXSA 3PSEB 2BS2B 3WAPA 3KYDD 3UGBB 2BTEA 1H4RA 1I4XA 2FNJB 3NVZA 2BWES 3AH7A 3X23A 3SR6A 3PVLA 5AUKA 3V62A 2DZKA 3ZRCA 2KVRA 3PGEA 2KD0A 4USAA 2JY6A 4TSSA 3ZIMA 2LJIA 2Y3AA 3AEFB 3ONSA 3ALBA 1L4ZB 1JWUD 1YN5A 4GGQA 3J9CA 3DCGA 4Q2JA 1DOIA 1XCQL 1FNUA 2LZ6A 3ZNGC 3QA8A 4MJSA 4TKNA 1EU3A 1GC6A 2WLBA 2MP2A 2WXLA 2MEKA 1ZDXA 2JWUA 1RFAA 1FFVA 3VQIA 2BB6A 4JE3B 1GPXA 1HQRD 1TS3A 3LDZE 1YJIA 5IA7A 4WJOA 2KDBA 2OJRA 1G6JA 2NPTA 2PMVA 4HJGE 5LNK1 1L0XB 1WR6E 1ZP0B 1CZPA 4OZAA 2JT4B 4XYCA 4DK5A 2CHXA 4IKGA 4NZLB 1KOTA 4JL9A 4KV2A 4XWTA 3QX1A 4AUQC 4ZYSA 4ZRKA 4DHJB 2J0MA 2B3AA 1C1YB 3EGRA 1WFYA 1SXTA 1FD6A 1MI0A 4IUMB 4RF1A 2XN9C 2KFKA 3CSFA 1TKEA 3BYYB 3UQBA 3AI5A 2KXJA 2J4XA 4BFRA 2MWSB 1D3ZA 2DYOA 2REXA 2IGDA 3Q3OC 1FEHA 3DQVA 2I38A 2H88B 2WXOA 2PE9A 2M0AA 1UWMA 2LHDA 4YSYB 2ZVOA 1WWTA 2MHJA 3B9JA 3WAOA 1ACCA 3KUDB 1Q5WB 3DVNU 1BT0A 1PUTA 1UELA 2RPQA 3AB5A 2K25A 3P4PB 1WX8A 4IM2A 3V05A 2L7RA 2AL3A 1C4AA 2BT6A 1V9JA 3ENEA 4LTUA 3VRAB 1UGMA 2JZPA 2KWUB 2L52A 2ZPNA 1J7BA 3RN9C 4E74A 1FMAD 1J19A 1IYFA 2ZW1A 2D2QA 2WXMA 4ZRQA 3AV8A 4PYUA 2GBJA 1XD3B 1E7PB 1UNSA 4MGYE 2K9XA 1SBBB 3C19A 2XK5B 1WZ0A 2MQJA 3A1QB 3JYUA 2LXAA 2NVUI 3W2DA 1K51A 2V3SA 1QKZA 1KFYB 3FC4A 5C1ZA 5DPWA 1Q10A 1H8CA 4MGIE 4IM0A 3BK2A 2IGGA 3RI7C 1A5RA 2KX3A 1V49A 2K6QA 2C5LC 2WS3B 3ZNZB 3B0AA 1SIJA 2L0FA 3N1YC 2V4IB 5AZHA 1UUPA 2E6XA 3GE3C 3H7SA 2RDHA 5T8IA 4L23A 2V3NA 5EE1A 4JQWC 2N9XA 3HVDA 1RAXA 4C80A 1D5XC 4FJVB 3U7DA 1YN4A 2CKHB 2Z59B 4LNFA 1OFFA 1SJHD 5D3IB 1FRRA 1ZKHA 1OQRA 1PGBA 4OZCA 5L83A 4ANXA 1NEKB 3BYTB 3P1MA 2V4LA 1TY0A 2JVCA 3AU5A
chains in the Genus database with same CATH topology
3PV1A 1V2YA 4W9KA 2WX0A 3NHEB 4FJYA 2LD9A 4YL8A 3U8ZA 1WX9A 1WM2A 4TUUA 4FBJB 1XT9B 4I6LB 3ZTCA 4CYEA 4DHJD 5AZGA 1GG3A 5EDSA 3H6NA 2DENB 2AWTA 1VCBA 4DDID 2K1FA 3PRZA 2PE6B 3APCA 4KIKA 3ZNID 2MW5A 5D6JB 4ZRIA 2CHZA 3BY4B 2KJ6A 3KW5B 3NZSA 3ZRFA 2HJ8A 4NNJB 3JVZX 3CSTA 2MA9B 4MH0E 2EMSA 4IWPA 4KSKC 3CF6E 2ZZPB 1QZEA 4ICUA 4E3CA 4IM3A 3KVFB 2NBUA 3A1QA 4B6WA 2BYVE 2NR2A 2KJHB 2FAZA 4GMVA 3VH3B 4EUTA 2LVOA 2C60A 3L17A 3KH0A 1AARA 4GSWA 1EF5A 3K9PB 1M94A 4W9FA 1ISNA 4JLCA 2M17A 4CHKA 1WR1A 2CHWA 2O2VA 4GDKA 3VVWB 1R4MI 4FA6A 2WX1A 2QHOA 3MHSD 2GBNA 3PREA 3HHMA 4GDLB 3PS6A 4GDKB 1TTNA 5IAAC 2KANA 4FN2A 2O6VB 1GUAB 1UZXB 2AYOB 5DPTA 3TL5A 4A3OA 1UD7A 2BPSA 2ZEQA 3TMPB 2KMCA 2MSED 2CU1A 3B1LX 2GBMA 1V81A 2KN5A 3APFA 4ZYNA 1YIWA 2O6VA 4FADA 2MCNB 4PYZA 2HE7A 2NPTB 2D10A 2YLMA 2ZJDA 4FLHA 4GOCA 3A9JB 3IVFA 1WE7A 3PRMB 3A9KB 3EECA 5KHQA 3ZLZA 3ZW3A 4RM8A 3H9DA 3RCZA 2O2VB 3QK0A 4LJOB 1S3SG 1WXAA 4ICVA 4G0NB 3P2BA 5CHWA 4TV3A 3A9KA 1K8RB 1KLVA 2PEAA 3IBEA 4WJPA 4JIOU 5JZEB 2NBVB 1EF1A 2RR9A 2KDEB 3L10B 4G50A 1WGGA 5JHAA 2MBEA 4OVVA 3MTNB 4K7SA 4W9GA 1TGZB 4ANUA 3A4SC 1KJTA 5D94A 1UH6A 2KDFB 4MEMA 2BWFA 3Q3JA 3VTUA 2WWZA 4NJ7A 2N1WA 2D11A 3QWZB 4LDTB 4NQLB 4WQOB 4TQ0A 1P9DU 1WXMA 1PQSA 2M8SA 2YVCA 1WXVA 3DBSA 4HPLB 2J0KA 2DYMA 1OTRB 2KWVB 5LXIB 4W9CA 4GXBA 3DVGX 4K1RB 1V5TA 1YX5B 3M95A 2NBWB 1Z2MA 5FR6A 3PHWB 4BKGA 3VAWA 2L8JA 3AXCA 3PPAA 2R2QA 3NY5A 1KM7A 4KZ0A 5C23A 1E8ZA 4FJZA 3ZTDA 2DYBA 2M1MA 4FHKA 4AP4C 1IP9A 2FIDA 4ASWC 1SGHA 3CMMB 3VHTC 4KSLC 3SDLC 3L0WB 2IBIB 1OQYA 2RD0A 2L3ZA 1GC7A 3TBLD 3VDZA 3ZVVA 1I35A 3A4RA 3M3JA 4BKTA 2BYFA 3B08A 2MLBA 1E7UA 1WF9A 2LVPA 4DXAB 2HTHA 1GNUA 1WGRA 3ZDMC 3UIOB 4EZLA 2G45B 2K8HA 3BINA 2ZCBA 2C7MB 1VD2A 3PTFC 4KZCA 2A4ZA 2Z0EB 1YX6B 4IWQA 1FXTB 2L76A 3VH4B 3UQAA 2KMAA 2KTFA 4BVUC 2LGDA 1Q0WB 3ML8A 3JSVA 3V61A 2L00B 4KVGB 2EKEC 4WWPA 2K8BA 3DVNV 3VTVA 3RULA 2KLCA 4M0WB 3V60A 1XQQA 2BF8B 2O6VD 3M62B 2BKRB 2IZVB 2MRPA 1E5WA 4IWOA 3LJ3A 3I3TB 2IO0B 2KOXA 2DHZA 3OJ3A 4WWOA 2DZMA 5G55A 2MBBB 1WIAA 1P98A 4F1SA 1YD8U 2FUHB 3L08A 1WMHB 3TCAA 2CS4A 2ZVNA 1L7YA 3Q3FA 2DAJA 2WDTB 1V6EA 3C0RB 3M63B 4AWJA 2LRWA 5E6PA 4AJWA 2DAFA 4XX5A 3U30A 2LGXA 2OOBB 1V5OA 4GU2A 4ANVA 1E8YA 1NI2A 2GBRA 1E8WA 4W9JA 3N32A 3TJPA 3JW0X 3A9JA 3APDA 4DHZE 2KTRA 1MG8A 3PLUA 3DBRI 2L05A 4II3B 3R7RA 3EFUA 3VFKA 4NY0A 2LJ5A 4A3PA 2JZZA 2KX0A 3DOWA 2J7QB 1UBQA 5DCNA 2ZNVB 4DHZB 4FULA 3DDCB 1E8XA 1WMHA 5JH5C 1WXSA 3PSEB 3UF8A 3KYDD 3UGBB 2KFKB 3WAPA 1H4RA 2FNJB 2BGFA 4II2B 2FCNA 2MX2A 2BWES 2JZ3B 3H7PB 3KUCB 4RMAA 3X23A 3PVLA 3V62A 3O65B 3IHPC 2XEWA 3NOBA 2DZKA 3QIJA 3ZRCA 4J6IA 1WM3A 2BYEA 2KKCA 2KVRA 3OAWA 3PGEA 4GN1A 4MJSB 2JRIB 4W9EA 2KD0A 1WGHA 3HIZA 4A20A 2JY6A 2FCQA 4WWNA 4TQ1A 2MP2B 3ZIMA 3RZWC 3IFWB 1V86A 2W9NA 4GIVA 4DDGD 3RUIB 1Q1OA 1SE9A 2M0XA 3UIPB 4MSQB 2AL6A 5CHVC 1WH3A 3ONSA 3PT2B 3ALBA 4DBGA 3KUZA 5LXHA 4MSMB 2KO3A 3R3MA 4LDTD 3W1SA 3X0WA 2DZJA 4K7UA 1F9JA 4XZ4A 2LGYA 4OVUA 1WJ4A 4GGQA 3PLVA 3DCGA 3QHTA 4GB9A 5DPSA 1SIFA 4NQKE 3HM3A 5J2RA 4W9HA 2LZ6A 3R7QA 3ZNGC 3QA8A 4MJSA 2K6DB 2C7NB 4TKNA 2N7DA 4F7ZA 1LFDA 4HPMB 1GC6A 3RT3B 2MP2A 1UBIA 4B95A 1RFAA 2PPHA 4FHJA 2C7HA 1JRUA 3VQIA 3OLMD 2JXXA 2JRHA 3WIMA 2M4NA 3LDZE 2MBOA 3EHVA 3VUWA 2XBBC 4HJKA 5IA7A 4WJOA 2K8CA 4IC7B 2KDBA 4G3XB 4KDLB 1GJZA 3GZNI 3QJZA 3W1YA 4B9KA 1L2NA 2OJRA 1G6JA 1EUVB 1WYWB 2R2OA 5TR5A 2G4SA 2NPTA 4EZKA 3TIXA 2KK8A 4BKSA 1WR6E 3SU8X 5L95C 1OGWA 2NCNA 2JT4B 2ZNVC 4HLEA 4DK5A 1U4AA 2CHXA 3QQ8B 4AJYB 2LUEA 2A5UA 2LASA 3N3KB 1R4NI 1KOTA 4JL9A 4KV2A 1NDDA 5GMVA 5G2NA 4MELA 4AOFA 4ZDVA 1NBFC 3QX1A 4HWIB 4LCDE 4AUQC 1WI0A 3RD2A 4ZRKA 4DHJB 1CMXB 3W1SC 4WJQA 1WJNA 2B3AA 2J0MA 4BKSD 1C1YB 1WFYA 3IG3A 3ZNHB 3T9LA 3DBHI 4IUMB 3ZO5B 4M8MA 1I42A 2FCSA 3AU4A 2KFKA 3VUXA 3WALA 3CSFA 2PJHA 2D3GA 2JF5A 3UQBA 3QAQA 2KWCA 3ML9A 5JHBA 4I6PA 4I6NB 3AI5A 3WANA 2DZIA 1OEYA 2FCMA 4HVBA 2KXJA 4URKA 2FIFA 4BFRA 4BOSC 5E6OA 2KHWB 2MWSB 1D3ZA 2MBQA 2BKFA 2DYOA 2REXA 2N7EA 3N30A 2GBKA 1TBEA 4HCNB 1YQBA 2AEHA 1LM8B 3DQVA 4XC2A 3NZUA 2CR5A 2UWQA 4NAWB 2Y5BB 2IO1B 3RYTA 4MGZE 2IY1B 2PE9A 3ZUNA 1E7VA 4WAAA 2LVQA 3R66C 2GOWA 2ZVOA 3ZKJC 3GOEA 3KYCD 4MM3A 2I1KA 2LWPA 5DPRA 4DWFA 4EOYA 4G11A 2G4DB 4LJPB 2UYZB 4EKUA 3WAOA 1LXDA 3ECIA 3KUDB 4N9F4 1Q5WB 2VRRB 2JWZA 1BT0A 3DVNU 1UELA 2RPQA 1P1AA 1P0RA 3L54A 4PS3A 3DBLI 4MDKE 2K25A 5KHOA 3D32A 1IPGA 3K9OB 3NS8A 1WX8A 1LQBA 2LRUA 4IM2A 4KIKB 2KLGA 4W9DA 1WY8A 2KDIA 2L7RA 2AL3A 4W9IA 3S2AA 3VUYA 5AEKB 1J0GA 1V9JA 3ENEA 4HDOA 1S1QB 5AZFA 2LXCA 1UGMA 2KWUB 3VXWA 3PZDA 2ZPNA 2JUOA 2HD5B 2GMIC 2I1JA 4E74A 4ZRJA 2V1YA 1J19A 1WRDB 1IYFA 3PRPB 2D2QA 2KZRA 4PYUA 2GBJA 5D7GA 1X1MA 3JSVB 1XD3B 2IYDB 2L0TA 4MGYE 3QCAA 3QC8B 1T0YA 3V6CB 2XK5B 1WZ0A 2MQJA 4IW0A 3A1QB 3H1UA 1E90A 1ZW7A 3JYUA 2LXAA 1OEYJ 4GDLA 2DX5B 2NVUI 1YJ1A 2ZPYA 3HK0A 2IO3B 2V3SA 1WE6A 2K39A 5C1ZA 4HK2A 3QARA 1EO6A 5DPWA 1J8CA 4CO7A 1H8CA 4MGIE 2ZCCA 4IM0A 2KNBA 2IO2B 3EC8A 2KX3A 1V49A 1A5RA 2K6QA 4HDQA 4NPNA 2C5LC 2RGFA 1RLFA 4X57B 2C9WB 2J0JA 3ZNZB 2KQ7A 3B0AA 5HKHA 2XK5A 2L0FA 2KFJA 5AZHA 4HCPB 5E6NA 4F8CB 3SD5A 2LI5A 5J18A 3DPDA 2EMTA 2KJRA 2KC2A 3H7SA 2N1VA 5BO4B 3AULA 4MGKE 3RZFA 4BOZB 4NAWA 1WGYA 1WGDA 1Z5SB 2WYQA 4RM9A 4K81A 4HXDA 3MJWA 4JQWC 4EEWA 3WAMA 2KTRB 3L13A 2ASQA 5D2MB 2N9XA 3DVGY 1V80A 1RAXA 3A33B 2KQSA 3ZDTA 3L16A 4EZJA 4JGHB 3UINB 4FJVB 3U7DA 1WZ3A 4ANWA 3T8MA 1RRBA 3WA0A 5CTRC 4PS7A 5J17A 1Y8RC 2CKHB 2D07B 5CHFA 1C3TA 2Z59B 2N9EB 1WJUA 4PS8A 4IG7B 4NJ6A 3H7PA 2N9PC 1ZKHA 1ZGUB 2N4FA 4E71A 4KDIC 4K7WA 4W9LA 1TZ1A 5CX3A 3VTWA 1WJ6A 5LLIA 4BBNF 4EFOA 2KC1A 2RSUA 2MBHA 4P7IA 3V6EB 1P3QU 5L83A 3SHQA 2JPHA 4ANXA 4WJNA 3OJ4B 1WX7A 4BBNC 2G3QB 3PHXB 4M8NA 1HE8A 2V4LA 2IY0B 2Z0DB 2NS5A 2JVCA 3HM6X 3AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV1 A;  1V2Y A;  4W9K A;  2WX0 A;  3NHE B;  4FJY A;  2LD9 A;  4YL8 A;  3U8Z A;  1WX9 A;  1WM2 A;  4TUU A;  4FBJ B;  1XT9 B;  4I6L B;  3ZTC A;  4CYE A;  4DHJ D;  5AZG A;  1GG3 A;  5EDS A;  3H6N A;  2DEN B;  2AWT A;  1VCB A;  4DDI D;  2K1F A;  3PRZ A;  2PE6 B;  3APC A;  4KIK A;  3ZNI D;  2MW5 A;  5D6J B;  4ZRI A;  2CHZ A;  3BY4 B;  2KJ6 A;  3KW5 B;  3NZS A;  3ZRF A;  2HJ8 A;  4NNJ B;  3JVZ X;  3CST A;  2MA9 B;  4MH0 E;  2EMS A;  4IWP A;  4KSK C;  3CF6 E;  2ZZP B;  1QZE A;  4ICU A;  4E3C A;  4IM3 A;  3KVF B;  2NBU A;  3A1Q A;  4B6W A;  2BYV E;  2NR2 A;  2KJH B;  2FAZ A;  4GMV A;  3VH3 B;  4EUT A;  2LVO A;  2C60 A;  3L17 A;  3KH0 A;  1AAR A;  4GSW A;  1EF5 A;  3K9P B;  1M94 A;  4W9F A;  1ISN A;  4JLC A;  2M17 A;  4CHK A;  1WR1 A;  2CHW A;  2O2V A;  4GDK A;  3VVW B;  1R4M I;  4FA6 A;  2WX1 A;  2QHO A;  3MHS D;  2GBN A;  3PRE A;  3HHM A;  4GDL B;  3PS6 A;  4GDK B;  1TTN A;  5IAA C;  2KAN A;  4FN2 A;  2O6V B;  1GUA B;  1UZX B;  2AYO B;  5DPT A;  3TL5 A;  4A3O A;  1UD7 A;  2BPS A;  2ZEQ A;  3TMP B;  2KMC A;  2MSE D;  2CU1 A;  3B1L X;  2GBM A;  1V81 A;  2KN5 A;  3APF A;  4ZYN A;  1YIW A;  2O6V A;  4FAD A;  2MCN B;  4PYZ A;  2HE7 A;  2NPT B;  2D10 A;  2YLM A;  2ZJD A;  4FLH A;  4GOC A;  3A9J B;  3IVF A;  1WE7 A;  3PRM B;  3A9K B;  3EEC A;  5KHQ A;  3ZLZ A;  3ZW3 A;  4RM8 A;  3H9D A;  3RCZ A;  2O2V B;  3QK0 A;  4LJO B;  1S3S G;  1WXA A;  4ICV A;  4G0N B;  3P2B A;  5CHW A;  4TV3 A;  3A9K A;  1K8R B;  1KLV A;  2PEA A;  3IBE A;  4WJP A;  4JIO U;  5JZE B;  2NBV B;  1EF1 A;  2RR9 A;  2KDE B;  3L10 B;  4G50 A;  1WGG A;  5JHA A;  2MBE A;  4OVV A;  3MTN B;  4K7S A;  4W9G A;  1TGZ B;  4ANU A;  3A4S C;  1KJT A;  5D94 A;  1UH6 A;  2KDF B;  4MEM A;  2BWF A;  3Q3J A;  3VTU A;  2WWZ A;  4NJ7 A;  2N1W A;  2D11 A;  3QWZ B;  4LDT B;  4NQL B;  4WQO B;  4TQ0 A;  1P9D U;  1WXM A;  1PQS A;  2M8S A;  2YVC A;  1WXV A;  3DBS A;  4HPL B;  2J0K A;  2DYM A;  1OTR B;  2KWV B;  5LXI B;  4W9C A;  4GXB A;  3DVG X;  4K1R B;  1V5T A;  1YX5 B;  3M95 A;  2NBW B;  1Z2M A;  5FR6 A;  3PHW B;  4BKG A;  3VAW A;  2L8J A;  3AXC A;  3PPA A;  2R2Q A;  3NY5 A;  1KM7 A;  4KZ0 A;  5C23 A;  1E8Z A;  4FJZ A;  3ZTD A;  2DYB A;  2M1M A;  4FHK A;  4AP4 C;  1IP9 A;  2FID A;  4ASW C;  1SGH A;  3CMM B;  3VHT C;  4KSL C;  3SDL C;  3L0W B;  2IBI B;  1OQY A;  2RD0 A;  2L3Z A;  1GC7 A;  3TBL D;  3VDZ A;  3ZVV A;  1I35 A;  3A4R A;  3M3J A;  4BKT A;  2BYF A;  3B08 A;  2MLB A;  1E7U A;  1WF9 A;  2LVP A;  4DXA B;  2HTH A;  1GNU A;  1WGR A;  3ZDM C;  3UIO B;  4EZL A;  2G45 B;  2K8H A;  3BIN A;  2ZCB A;  2C7M B;  1VD2 A;  3PTF C;  4KZC A;  2A4Z A;  2Z0E B;  1YX6 B;  4IWQ A;  1FXT B;  2L76 A;  3VH4 B;  3UQA A;  2KMA A;  2KTF A;  4BVU C;  2LGD A;  1Q0W B;  3ML8 A;  3JSV A;  3V61 A;  2L00 B;  4KVG B;  2EKE C;  4WWP A;  2K8B A;  3DVN V;  3VTV A;  3RUL A;  2KLC A;  4M0W B;  3V60 A;  1XQQ A;  2BF8 B;  2O6V D;  3M62 B;  2BKR B;  2IZV B;  2MRP A;  1E5W A;  4IWO A;  3LJ3 A;  3I3T B;  2IO0 B;  2KOX A;  2DHZ A;  3OJ3 A;  4WWO A;  2DZM A;  5G55 A;  2MBB B;  1WIA A;  1P98 A;  4F1S A;  1YD8 U;  2FUH B;  3L08 A;  1WMH B;  3TCA A;  2CS4 A;  2ZVN A;  1L7Y A;  3Q3F A;  2DAJ A;  2WDT B;  1V6E A;  3C0R B;  3M63 B;  4AWJ A;  2LRW A;  5E6P A;  4AJW A;  2DAF A;  4XX5 A;  3U30 A;  2LGX A;  2OOB B;  1V5O A;  4GU2 A;  4ANV A;  1E8Y A;  1NI2 A;  2GBR A;  1E8W A;  4W9J A;  3N32 A;  3TJP A;  3JW0 X;  3A9J A;  3APD A;  4DHZ E;  2KTR A;  1MG8 A;  3PLU A;  3DBR I;  2L05 A;  4II3 B;  3R7R A;  3EFU A;  3VFK A;  4NY0 A;  2LJ5 A;  4A3P A;  2JZZ A;  2KX0 A;  3DOW A;  2J7Q B;  1UBQ A;  5DCN A;  2ZNV B;  4DHZ B;  4FUL A;  3DDC B;  1E8X A;  1WMH A;  5JH5 C;  1WXS A;  3PSE B;  3UF8 A;  3KYD D;  3UGB B;  2KFK B;  3WAP A;  1H4R A;  2FNJ B;  2BGF A;  4II2 B;  2FCN A;  2MX2 A;  2BWE S;  2JZ3 B;  3H7P B;  3KUC B;  4RMA A;  3X23 A;  3PVL A;  3V62 A;  3O65 B;  3IHP C;  2XEW A;  3NOB A;  2DZK A;  3QIJ A;  3ZRC A;  4J6I A;  1WM3 A;  2BYE A;  2KKC A;  2KVR A;  3OAW A;  3PGE A;  4GN1 A;  4MJS B;  2JRI B;  4W9E A;  2KD0 A;  1WGH A;  3HIZ A;  4A20 A;  2JY6 A;  2FCQ A;  4WWN A;  4TQ1 A;  2MP2 B;  3ZIM A;  3RZW C;  3IFW B;  1V86 A;  2W9N A;  4GIV A;  4DDG D;  3RUI B;  1Q1O A;  1SE9 A;  2M0X A;  3UIP B;  4MSQ B;  2AL6 A;  5CHV C;  1WH3 A;  3ONS A;  3PT2 B;  3ALB A;  4DBG A;  3KUZ A;  5LXH A;  4MSM B;  2KO3 A;  3R3M A;  4LDT D;  3W1S A;  3X0W A;  2DZJ A;  4K7U A;  1F9J A;  4XZ4 A;  2LGY A;  4OVU A;  1WJ4 A;  4GGQ A;  3PLV A;  3DCG A;  3QHT A;  4GB9 A;  5DPS A;  1SIF A;  4NQK E;  3HM3 A;  5J2R A;  4W9H A;  2LZ6 A;  3R7Q A;  3ZNG C;  3QA8 A;  4MJS A;  2K6D B;  2C7N B;  4TKN A;  2N7D A;  4F7Z A;  1LFD A;  4HPM B;  1GC6 A;  3RT3 B;  2MP2 A;  1UBI A;  4B95 A;  1RFA A;  2PPH A;  4FHJ A;  2C7H A;  1JRU A;  3VQI A;  3OLM D;  2JXX A;  2JRH A;  3WIM A;  2M4N A;  3LDZ E;  2MBO A;  3EHV A;  3VUW A;  2XBB C;  4HJK A;  5IA7 A;  4WJO A;  2K8C A;  4IC7 B;  2KDB A;  4G3X B;  4KDL B;  1GJZ A;  3GZN I;  3QJZ A;  3W1Y A;  4B9K A;  1L2N A;  2OJR A;  1G6J A;  1EUV B;  1WYW B;  2R2O A;  5TR5 A;  2G4S A;  2NPT A;  4EZK A;  3TIX A;  2KK8 A;  4BKS A;  1WR6 E;  3SU8 X;  5L95 C;  1OGW A;  2NCN A;  2JT4 B;  2ZNV C;  4HLE A;  4DK5 A;  1U4A A;  2CHX A;  3QQ8 B;  4AJY B;  2LUE A;  2A5U A;  2LAS A;  3N3K B;  1R4N I;  1KOT A;  4JL9 A;  4KV2 A;  1NDD A;  5GMV A;  5G2N A;  4MEL A;  4AOF A;  4ZDV A;  1NBF C;  3QX1 A;  4HWI B;  4LCD E;  4AUQ C;  1WI0 A;  3RD2 A;  4ZRK A;  4DHJ B;  1CMX B;  3W1S C;  4WJQ A;  1WJN A;  2B3A A;  2J0M A;  4BKS D;  1C1Y B;  1WFY A;  3IG3 A;  3ZNH B;  3T9L A;  3DBH I;  4IUM B;  3ZO5 B;  4M8M A;  1I42 A;  2FCS A;  3AU4 A;  2KFK A;  3VUX A;  3WAL A;  3CSF A;  2PJH A;  2D3G A;  2JF5 A;  3UQB A;  3QAQ A;  2KWC A;  3ML9 A;  5JHB A;  4I6P A;  4I6N B;  3AI5 A;  3WAN A;  2DZI A;  1OEY A;  2FCM A;  4HVB A;  2KXJ A;  4URK A;  2FIF A;  4BFR A;  4BOS C;  5E6O A;  2KHW B;  2MWS B;  1D3Z A;  2MBQ A;  2BKF A;  2DYO A;  2REX A;  2N7E A;  3N30 A;  2GBK A;  1TBE A;  4HCN B;  1YQB A;  2AEH A;  1LM8 B;  3DQV A;  4XC2 A;  3NZU A;  2CR5 A;  2UWQ A;  4NAW B;  2Y5B B;  2IO1 B;  3RYT A;  4MGZ E;  2IY1 B;  2PE9 A;  3ZUN A;  1E7V A;  4WAA A;  2LVQ A;  3R66 C;  2GOW A;  2ZVO A;  3ZKJ C;  3GOE A;  3KYC D;  4MM3 A;  2I1K A;  2LWP A;  5DPR A;  4DWF A;  4EOY A;  4G11 A;  2G4D B;  4LJP B;  2UYZ B;  4EKU A;  3WAO A;  1LXD A;  3ECI A;  3KUD B;  4N9F 4;  1Q5W B;  2VRR B;  2JWZ A;  1BT0 A;  3DVN U;  1UEL A;  2RPQ A;  1P1A A;  1P0R A;  3L54 A;  4PS3 A;  3DBL I;  4MDK E;  2K25 A;  5KHO A;  3D32 A;  1IPG A;  3K9O B;  3NS8 A;  1WX8 A;  1LQB A;  2LRU A;  4IM2 A;  4KIK B;  2KLG A;  4W9D A;  1WY8 A;  2KDI A;  2L7R A;  2AL3 A;  4W9I A;  3S2A A;  3VUY A;  5AEK B;  1J0G A;  1V9J A;  3ENE A;  4HDO A;  1S1Q B;  5AZF A;  2LXC A;  1UGM A;  2KWU B;  3VXW A;  3PZD A;  2ZPN A;  2JUO A;  2HD5 B;  2GMI C;  2I1J A;  4E74 A;  4ZRJ A;  2V1Y A;  1J19 A;  1WRD B;  1IYF A;  3PRP B;  2D2Q A;  2KZR A;  4PYU A;  2GBJ A;  5D7G A;  1X1M A;  3JSV B;  1XD3 B;  2IYD B;  2L0T A;  4MGY E;  3QCA A;  3QC8 B;  1T0Y A;  3V6C B;  2XK5 B;  1WZ0 A;  2MQJ A;  4IW0 A;  3A1Q B;  3H1U A;  1E90 A;  1ZW7 A;  3JYU A;  2LXA A;  1OEY J;  4GDL A;  2DX5 B;  2NVU I;  1YJ1 A;  2ZPY A;  3HK0 A;  2IO3 B;  2V3S A;  1WE6 A;  2K39 A;  5C1Z A;  4HK2 A;  3QAR A;  1EO6 A;  5DPW A;  1J8C A;  4CO7 A;  1H8C A;  4MGI E;  2ZCC A;  4IM0 A;  2KNB A;  2IO2 B;  3EC8 A;  2KX3 A;  1V49 A;  1A5R A;  2K6Q A;  4HDQ A;  4NPN A;  2C5L C;  2RGF A;  1RLF A;  4X57 B;  2C9W B;  2J0J A;  3ZNZ B;  2KQ7 A;  3B0A A;  5HKH A;  2XK5 A;  2L0F A;  2KFJ A;  5AZH A;  4HCP B;  5E6N A;  4F8C B;  3SD5 A;  2LI5 A;  5J18 A;  3DPD A;  2EMT A;  2KJR A;  2KC2 A;  3H7S A;  2N1V A;  5BO4 B;  3AUL A;  4MGK E;  3RZF A;  4BOZ B;  4NAW A;  1WGY A;  1WGD A;  1Z5S B;  2WYQ A;  4RM9 A;  4K81 A;  4HXD A;  3MJW A;  4JQW C;  4EEW A;  3WAM A;  2KTR B;  3L13 A;  2ASQ A;  5D2M B;  2N9X A;  3DVG Y;  1V80 A;  1RAX A;  3A33 B;  2KQS A;  3ZDT A;  3L16 A;  4EZJ A;  4JGH B;  3UIN B;  4FJV B;  3U7D A;  1WZ3 A;  4ANW A;  3T8M A;  1RRB A;  3WA0 A;  5CTR C;  4PS7 A;  5J17 A;  1Y8R C;  2CKH B;  2D07 B;  5CHF A;  1C3T A;  2Z59 B;  2N9E B;  1WJU A;  4PS8 A;  4IG7 B;  4NJ6 A;  3H7P A;  2N9P C;  1ZKH A;  1ZGU B;  2N4F A;  4E71 A;  4KDI C;  4K7W A;  4W9L A;  1TZ1 A;  5CX3 A;  3VTW A;  1WJ6 A;  5LLI A;  4BBN F;  4EFO A;  2KC1 A;  2RSU A;  2MBH A;  4P7I A;  3V6E B;  1P3Q U;  5L83 A;  3SHQ A;  2JPH A;  4ANX A;  4WJN A;  3OJ4 B;  1WX7 A;  4BBN C;  2G3Q B;  3PHX B;  4M8N A;  1HE8 A;  2V4L A;  2IY0 B;  2Z0D B;  2NS5 A;  2JVC A;  3HM6 X;  3AU5 A; 
#chains in the Genus database with same CATH topology
 1VJK A;  4W9K A;  4YL8 A;  3NHE B;  3U8Z A;  2LD9 A;  2KQ4 X;  3Q8E A;  4FBJ B;  4OVZ A;  1SB3 C;  1GG3 A;  2G9H D;  2AWT A;  4M02 A;  1FCC C;  2K1F A;  2UU7 A;  4LNK A;  2MH7 A;  3BY4 B;  4DQO C;  3GP7 A;  3JVZ X;  3CST A;  1TYG B;  2EMS A;  4IWP A;  3GB1 A;  2Z8L A;  2LMC A;  4IDI A;  1F1H A;  3P4Q B;  3KQ4 A;  2WQY B;  2LVO A;  3CWI A;  2WXP A;  3ZJT A;  1ISN A;  3Q8B A;  4JLC A;  5I4D A;  4CHK A;  2WNM A;  3BII D;  1F0Z A;  3PRE A;  4A6Q A;  4GDL B;  5IAA C;  2KAN A;  1I4Q A;  1UZX B;  2AYO B;  1MG4 A;  4A3O A;  2KMC A;  2MSE D;  2GBM A;  4FAD A;  2YLM A;  4GOC A;  4NJC A;  3A9J B;  2CU3 A;  3HRD D;  5KHQ A;  3ZLZ A;  3ZW3 A;  4RM8 A;  3RCZ A;  2O2V B;  1FRD A;  3L4P A;  1K8R B;  1VZ8 A;  1KLV A;  4JWU C;  3GZN B;  2RR9 A;  1E0Z A;  2W55 A;  4G50 A;  4K7S A;  4W9G A;  1TGZ B;  2KDF B;  3IAS 1;  3Q3J A;  4TQ0 A;  2D11 A;  4NQL B;  2YVC A;  1YX5 B;  5FR6 A;  3KWL A;  3DWG C;  3VAW A;  3MFG A;  2L8J A;  2R2Q A;  3NY5 A;  1JWS D;  4LLG M;  1E8Z A;  4FJZ A;  2BW2 A;  1L6U A;  3DHG C;  3NVY A;  1HTQ A;  5IKC M;  2M1M A;  2JSV X;  4KSL C;  3N20 C;  1OQY A;  1GC7 A;  3TBL D;  3ZVV A;  2OHF A;  3B08 A;  2MLB A;  4ARI A;  1WF9 A;  1PGX A;  4NAM A;  1ESF A;  2C7M B;  2A4Z A;  1CJE A;  1YX6 B;  2JXT A;  2Z0E B;  3VH4 B;  2D3A A;  3UQA A;  2D3B A;  2NMQ A;  1Q0W B;  3P4S B;  3ML8 A;  4M0W A;  5IOI A;  2EKE C;  1K53 A;  2KLC A;  1EU4 A;  4M0W B;  3V60 A;  1XQQ A;  1L0Y B;  1V1O A;  2BKR B;  1R4M B;  3I3T B;  2IO0 B;  2KOX A;  2LGI A;  1V6E A;  4AWJ A;  2DAF A;  3U30 A;  2OOB B;  4GU2 A;  2VH1 A;  3N32 A;  3JW0 X;  1E10 A;  3Q8F A;  1QT9 A;  2PW9 A;  2MJD A;  3DBR I;  3OG5 A;  1MHH E;  1ET6 A;  2JZZ A;  2J7Q B;  1I7H A;  2V9H A;  4DHZ B;  3FIL B;  4RNA A;  2ICI A;  2BGF A;  2DBY A;  2FCN A;  2MX2 A;  1YOV B;  2JQR B;  3O65 B;  2WXJ A;  3NOB A;  1WM3 A;  4GN1 A;  1JAL A;  2JRI B;  1WGH A;  3HIZ A;  4M00 A;  4A20 A;  2PLP A;  3AN1 A;  4TQ1 A;  2MP2 B;  3IFW B;  3RNA C;  2W9N A;  4GIV A;  4DDG D;  3RUI B;  3NVV A;  2AL6 A;  4JX1 C;  2KO3 A;  3R3M A;  2DZJ A;  1XEE A;  4XZ4 A;  4GB9 A;  5DPS A;  1VDV A;  4NQK E;  2GB1 A;  2WXQ A;  5E6J A;  3SFD B;  4W9H A;  1T3Q A;  3AEG B;  3ETR A;  1WYG A;  1UBI A;  4FHJ A;  2K5P A;  1JRU A;  2JXX A;  4WAF A;  3WIM A;  1PFD A;  2XBB C;  2K8C A;  4G3X B;  3GZN I;  4B9K A;  1WYW B;  3IXS A;  5TR5 A;  4EZK A;  3SU8 X;  2QCZ A;  1OGW A;  2ZNV C;  1I4G A;  1KLG D;  1ZE3 D;  2LUE A;  3FAH A;  4AJY B;  1R4N I;  2B76 B;  4KKI A;  5GMV A;  3ZJV A;  4LCD E;  1WI0 A;  4P16 A;  1CMX B;  1WJN A;  1VLB A;  3IG3 A;  3ZNH B;  3U52 E;  3KWV A;  4M8M A;  3VUX A;  2QMT A;  4KGT A;  5HHD G;  4I6N B;  1UF0 A;  1OEY A;  2FCM A;  4URK A;  2FIF A;  5E6O A;  1VR9 A;  2MBQ A;  3N30 A;  1YQB A;  2LEK A;  1LM8 B;  4XDC A;  5D3D A;  3TEW A;  3NZU A;  2CR5 A;  3AED B;  3RYT A;  2IY1 B;  3ZKJ C;  3GOE A;  3PZ7 A;  2I1K A;  4DWF A;  2UYZ B;  1TS5 A;  4EKU A;  1V97 A;  3ECI A;  2JWZ A;  3AE7 B;  3N9Y C;  1CQV A;  1T0R C;  3L54 A;  4PS3 A;  5KHO A;  3K9O B;  3NS8 A;  1MVK A;  2KLG A;  1WY8 A;  1NYR A;  2KDI A;  1T0S C;  2LXC A;  5EE9 A;  2JUO A;  1T6B X;  3IT4 B;  5C3J B;  2I1J A;  1YN3 A;  4ZRJ A;  1RM6 C;  3I57 A;  3RPF C;  2RPV A;  3JSV B;  3T3N A;  2L0T A;  1V8C A;  1V1P A;  4N59 A;  2WHI A;  4IW0 A;  1AWD A;  1HXY D;  2IGH A;  1UGJ A;  2BB5 A;  2WXH A;  1YJ1 A;  1ROE A;  2ZPY A;  4YTN B;  1R4N B;  1WE6 A;  1EO6 A;  3AE8 B;  5IO9 A;  1J8C A;  4JPS A;  1QOA A;  4CO7 A;  1N5W A;  2KNB A;  4KGR A;  4HDQ A;  1RLF A;  4X57 B;  2KQ7 A;  5HKH A;  2G1E A;  1MHX A;  2DLB A;  3EA6 A;  2N9L A;  5E6N A;  4F8C B;  1I4P A;  2LI5 A;  3I9V 1;  3DPD A;  2EMT A;  2K0P A;  2KC2 A;  1SF0 A;  4RM9 A;  4NAW A;  1FIQ A;  1XF5 L;  2WYQ A;  4K81 A;  1DYQ A;  3Q3N C;  4EEW A;  2KTR B;  2Y5C A;  2ASQ A;  2WXF A;  3NJT A;  3IT6 B;  3DVG Y;  4ZHP A;  3A33 B;  2J53 A;  4JGH B;  1M4V A;  3AEA B;  4ANW A;  3T8M A;  3TEY A;  4O1N A;  4REZ A;  5CTR C;  2D07 B;  5CHF A;  1PGA A;  2N9E B;  1WJU A;  4IG7 B;  2LFI A;  2KVZ A;  2WU2 B;  1WJ6 A;  4WUR A;  2KC1 A;  3V6E B;  1MJD A;  1JW9 D;  1RFK A;  2JX5 A;  3SHQ A;  2JPH A;  1EWC A;  2Z0D B;  3Q3M C;  4JWS C;  1GB1 A;  4B0E A;  1V2Y A;  4US9 A;  2JU6 X;  2WX0 A;  2E3T A;  1F2R I;  3ZTC A;  2AX5 A;  2ZW0 A;  3U2S C;  1VCB A;  3PRZ A;  3APC A;  4KIK A;  1ET9 A;  5D6J B;  3P4R B;  1K52 A;  3I5J C;  2HJ8 A;  4NNJ B;  2RDG A;  1TJE A;  1QZE A;  1FM0 D;  3FKY A;  4B6W A;  2BYV E;  2NR2 A;  1K50 A;  4GMV A;  3VH3 B;  2KAC A;  1QLB B;  3NRZ A;  3K9P B;  1M94 A;  2M17 A;  1WR1 A;  4GDK A;  1R4M I;  2EEL A;  1NI3 A;  2QHO A;  3Q8A A;  1N62 A;  2BQQ A;  4GDK B;  3U7Z A;  2N0S B;  5H92 C;  1JWA D;  2ZEQ A;  2CU1 A;  1N6Z A;  2O6V A;  2BBC A;  2HE7 A;  4ZOH C;  2BS3 B;  3A9K B;  3EEC A;  3BVG A;  3RNB C;  1JWM D;  3QK0 A;  4ICV A;  4YWG G;  3P2B A;  3AE1 B;  1F2R C;  2PEA A;  2J52 A;  5JZE B;  4H2A A;  3B2F A;  2GI9 A;  1KJT A;  1UH6 A;  4MEM A;  2WWZ A;  4NJ7 A;  2N1W A;  3QWZ B;  4LDT B;  1GB4 A;  2DYM A;  1OTR B;  2KWV B;  2W3S A;  5BYR A;  1KF6 B;  3TUO A;  4BKG A;  3EFC A;  3AXC A;  1KM7 A;  4KZ0 A;  5C23 A;  2J42 A;  1T0Q C;  3ZTD A;  2DYB A;  4AP4 C;  4FHK A;  3GE8 C;  1IP9 A;  1J7C A;  3CMM B;  1N5X A;  2IBI B;  3W5V B;  4WQM A;  1I35 A;  3A4R A;  3M3J A;  2BYF A;  1E7U A;  3PO0 A;  2G45 B;  2K8H A;  3TEX A;  3BIN A;  2ZCB A;  1V1P B;  1VD2 A;  3PTF C;  4KZC A;  2L76 A;  1HEZ E;  2KTF A;  2LGD A;  4TMA B;  1IGD A;  5HG2 A;  1TY2 A;  3M62 B;  4L1B A;  1E5W A;  4A8X C;  2DHZ A;  4WWO A;  2VH2 A;  2MBB B;  1TS2 A;  2W82 A;  4F1S A;  1YD8 U;  4AQ7 A;  3CIR B;  4C7Y A;  3SEB A;  1EWY C;  5GXG B;  1L0V B;  3MHZ A;  4AJW A;  2LGX A;  4ANV A;  4W9J A;  3APD A;  4DHZ E;  2KTR A;  4II3 B;  3R7R A;  3EFU A;  2LJ5 A;  2IJ0 A;  5DCN A;  2ZNV B;  4MM3 B;  2BYT A;  3DDC B;  1E8X A;  3UF8 A;  3TSS A;  4II2 B;  2JZ3 B;  3Q8C A;  2TSS A;  3IHP C;  2XEW A;  5FR3 A;  4J6I A;  3ZXV A;  3RNG C;  2KKC A;  3OAW A;  1R7S A;  4MH8 A;  4HEA 1;  1V86 A;  1JQ4 A;  1Q1O A;  1SE9 A;  2M0X A;  3UIP B;  5CHV C;  3PT2 B;  4DBG A;  5LXH A;  3KUZ A;  4MSM B;  4LDT D;  1NEN B;  3X0W A;  1F9J A;  3NUH B;  2LGY A;  4OVU A;  1WJ4 A;  3LYY A;  1SIF A;  2D3C A;  3HM3 A;  3ZXR A;  1HA5 A;  3R7Q A;  2C7N B;  1CK1 A;  4F7Z A;  4B95 A;  3W9C B;  4XWW A;  2PPH A;  1VZ7 A;  1TS4 A;  3OLM D;  2M4N A;  3VUW A;  4DXF A;  1XLO A;  4HJK A;  3VR9 B;  5G5H A;  2WXN A;  3QJZ A;  3W1Y A;  3RNE C;  3BWU D;  2R2O A;  2CJO A;  1N60 A;  2KK8 A;  2NCN A;  4HLE A;  1U4A A;  4AOF A;  5G2N A;  4ZDV A;  2LHE A;  3RD2 A;  3W1S C;  2WDR B;  4BKS D;  2WU5 B;  5BYS A;  2VZK B;  1OQQ A;  3U4E G;  3ZO5 B;  3AU4 A;  3WAL A;  2JF5 A;  5JXV A;  3QAQ A;  4XE0 A;  3ML9 A;  3RFZ B;  4I6P A;  2DZI A;  2KHW B;  1YNT E;  2SAK A;  2N7E A;  4HCN B;  1I4H A;  2FUG 1;  2IDY A;  1B1Z A;  1P7E A;  4NAW B;  2IO1 B;  4MGZ E;  4YT0 B;  3RNC C;  2LVQ A;  2WXI A;  2GOW A;  4MM3 A;  5DPR A;  1D5M C;  2WXG A;  4G11 A;  2G4D B;  2GLS A;  1LXD A;  4N9F 4;  1P1A A;  2KAJ A;  4AS1 A;  2LGS A;  1JML A;  3DBL I;  3D32 A;  1LQB A;  3W5U B;  3NZ3 A;  4W9I A;  4YTP B;  2KMM A;  5AEK B;  2EKI A;  1J0G A;  1S1Q B;  5AZF A;  3VXW A;  3PZD A;  2HD5 B;  2QJL A;  2GMI C;  2V1Y A;  4KGS A;  2QSD A;  3PRP B;  2KZR A;  2QC8 A;  5H8Y E;  2IYD B;  1QF6 A;  3ABV B;  3QCA A;  1T0Y A;  5BMI A;  3H1U A;  3Q69 A;  1OEY J;  4GDL A;  2DX5 B;  2K39 A;  3QAR A;  1FNV A;  4OW0 A;  1ZDV A;  3E56 A;  2K3U A;  1IBX A;  4WH4 A;  4OZB A;  2HTM E;  2NTT A;  4HCP B;  3BVZ A;  5MPO A;  1JRO A;  4OHJ A;  2N1V A;  2AQ3 B;  2NTS A;  3AUL A;  3T3O A;  1WGY A;  4K3B A;  1WGD A;  1I4R A;  4HXD A;  4K3C A;  3MC9 A;  2N7J A;  5D2M B;  3ZJU A;  3ZDT A;  2FBW B;  4EZJ A;  4ZHO A;  4L2Y A;  3SFE B;  1KTK A;  1WZ3 A;  1C4C A;  4PS7 A;  3O13 A;  5J17 A;  1Y8R C;  1TIF A;  1C3T A;  2KDM A;  5HI1 A;  4NJ6 A;  3H7P A;  1ZUD 2;  2N9P C;  5BYQ A;  1E6E B;  4E71 A;  4K7W A;  4W9L A;  1TZ1 A;  3UI3 A;  3VR8 B;  4BBN F;  1FNW A;  1C9F A;  1GOZ A;  4P7I A;  2W54 A;  1P3Q U;  2IND C;  4WJN A;  1WX7 A;  2G3Q B;  4EE2 A;  1SE2 A;  2NS5 A;  1KLU D;  1YMH E;  1ZXH A;  4FJY A;  1XLP A;  1WX9 A;  1WM2 A;  4TUU A;  1ENF A;  2KN4 A;  4CYE A;  5EDS A;  4PK1 A;  3H6N A;  2INC C;  4DDI D;  1XLN A;  2PE6 B;  3ZNI D;  4BZA A;  4DXG A;  3ZRF A;  3NZS A;  1LO5 D;  1B9R A;  4C56 C;  3AEC B;  2MA9 B;  2PIA A;  3HUI A;  4MH0 E;  1YQ4 B;  4KSK C;  2V0G A;  2ZZP B;  4QAY A;  1BUI C;  4XDD A;  1D5Z C;  2KJH B;  1Y56 A;  2FAZ A;  2C60 A;  4P1C C;  4YSX B;  3KH0 A;  3AE9 B;  4C00 A;  4C7Z A;  2WX1 A;  3NVW A;  3PS6 A;  1TTN A;  1RYJ A;  2HJ1 A;  3P42 A;  5DPT A;  3IAM 1;  3R8B A;  1UD7 A;  2BPS A;  4WWM A;  3B1L X;  2KN5 A;  4ZYN A;  4ITK A;  2INN E;  2IPK D;  3BZD B;  1SE3 A;  1WE7 A;  4S17 A;  4LNN A;  1C4P A;  4LJO B;  5CHW A;  4TV3 A;  3IBE A;  4N6E B;  3Q2A C;  2PTL A;  1EF1 A;  1MFW A;  3L10 B;  5HFY A;  5JHA A;  2MBE A;  4OVV A;  4RGO S;  1N63 A;  5D94 A;  2ACZ B;  4J3O D;  1P7F A;  4WQO B;  2BS4 B;  1P9D U;  3TEZ A;  1PQS A;  2WGS A;  1WXV A;  3DBS A;  3R2T A;  3PZ8 A;  4W9C A;  1V5T A;  3N1X C;  2NBW B;  1Z2M A;  5BMG A;  2YEP B;  4RF0 A;  3PPA A;  3H8H A;  1FO4 A;  1C76 A;  2D5G A;  2I2Y A;  2M56 B;  3SDL C;  3HVZ A;  4RGT A;  2L3Z A;  2AQ2 B;  3VDZ A;  4BKT A;  2LVP A;  4DXA B;  2QEJ C;  2DWQ A;  2HTH A;  1GNU A;  1WGR A;  3ZDM C;  1BXT A;  4YXD B;  3WCQ A;  2PVG C;  1JWB D;  2KMA A;  4BVU C;  3JSV A;  3MJ5 A;  4WWP A;  3DVN V;  3VTV A;  2L1A A;  3OWE B;  2KT7 A;  1LGR A;  4HKQ A;  2Q5W D;  2O6V D;  2JYE A;  2FE8 A;  4IWO A;  1SSN A;  2L83 A;  3OJ3 A;  3DBL B;  1MPE A;  3GS2 A;  3TCA A;  1AYF A;  2ZVN A;  3Q3F A;  2DAJ A;  2WDT B;  3M63 B;  4A9A A;  2LRW A;  5E6P A;  4XX5 A;  4BAX A;  1V5O A;  2DNF A;  1E8Y A;  1NI2 A;  1XXG A;  3ZYY X;  2GBR A;  1E8W A;  4N58 A;  3TJP A;  4C4V B;  1FPY A;  2GRI A;  3PLU A;  3VFK A;  2M19 A;  1ZPS A;  2WDQ B;  1L6V A;  2KX0 A;  3DOW A;  1UBQ A;  1QIL A;  4FUL A;  1WMH A;  1AN8 A;  1EM7 A;  2KFK B;  2QIL A;  2QIE B;  1QQR A;  4RMA A;  3H7P B;  3KUC B;  2RDB C;  2SEB D;  3QIJ A;  1T5X D;  2BYE A;  1L5P A;  4MJS B;  2ON8 A;  4W9E A;  4WWN A;  2FCQ A;  1TKG A;  3RZW C;  3DHH C;  4MSQ B;  1WH3 A;  2X38 A;  3W1S A;  1WSP A;  3R2I A;  4K7U A;  3PLV A;  3QHT A;  4ZRP A;  5J2R A;  3N1Z C;  2K6D B;  1HZ6 A;  2N7D A;  1LFD A;  1RWS A;  4HPM B;  3RT3 B;  2KWD A;  1J7A A;  2C7H A;  2OED A;  2JRH A;  4LNI A;  2MBO A;  3EHV A;  1DOX A;  4UDU C;  4RFB A;  2YEP F;  4IC7 B;  4KDL B;  1GJZ A;  1L2N A;  1NYQ A;  4HPP A;  2CJN A;  1EUV B;  1HZ5 A;  2G4S A;  3TIX A;  4BKS A;  3DHI C;  5L95 C;  3QQ8 B;  4RGN A;  2A5U A;  2LAS A;  3N3K B;  3NS1 A;  4FXC A;  4HRO A;  1NDD A;  4MEL A;  1BML C;  2N9K A;  1NBF C;  4HWI B;  4WJQ A;  1DOY A;  1NVI D;  3T9L A;  3DBH I;  1I42 A;  2FCS A;  1STE A;  4P6V F;  5AUI A;  2PJH A;  2D3G A;  2KYW A;  2KWC A;  5JHB A;  3WAN A;  3RMK C;  4HVB A;  1FXI A;  4BOS C;  1VRA B;  2BKF A;  4RH6 A;  2GBK A;  1TBE A;  1ZOY B;  2WP9 B;  2AEH A;  4XC2 A;  2UWQ A;  2Y5B B;  3AE6 B;  5IP4 D;  3ZUN A;  1E7V A;  4WAA A;  3R66 C;  4RGM A;  1IGC A;  1KRH A;  3MC0 B;  3KYC D;  2LWP A;  4EOY A;  4MT5 A;  3NG0 A;  4LJP B;  3ZQ4 A;  2VRR B;  3AEB B;  1JRP A;  4P1B C;  1P0R A;  4MDK E;  1IPG A;  3AMZ A;  4ACF A;  2JYT A;  4KIK B;  2LRU A;  2HDE A;  4W9D A;  1D4B A;  3S2A A;  3VUY A;  1SJE D;  4HDO A;  2MJE A;  3DBH B;  1VZ6 A;  2BVC A;  1FCL A;  4RCO A;  1WRD B;  4GLS C;  1ZXI A;  5D7G A;  1X1M A;  1GAQ B;  3QC8 B;  3V6C B;  1E90 A;  1ZW7 A;  3MC8 A;  2MJ3 A;  3HK0 A;  2IO3 B;  1FXA A;  4HK2 A;  2ONQ A;  5IN7 A;  5BMH A;  2ZCC A;  4YSZ B;  2IO2 B;  4US8 A;  3MP9 A;  3EC8 A;  4KX6 B;  4NPN A;  2RGF A;  1PDX A;  2C9W B;  2J0J A;  3EUB 2;  2PVO D;  2XK5 A;  2RMM A;  1XLQ A;  2KFJ A;  3DBR B;  3SD5 A;  5J18 A;  2KJR A;  5BO4 B;  1C79 A;  4MGK E;  3RZF A;  3C8Y A;  4BOZ B;  1Z5S B;  3MJW A;  3WAM A;  3L13 A;  1V80 A;  1XO3 A;  2KQS A;  3L16 A;  3UIN B;  1IBX B;  1RRB A;  3WA0 A;  4IOI E;  1F52 A;  4PS8 A;  2R61 A;  1SEB D;  2AQ1 B;  3RNF C;  2QDF A;  1ZGU B;  2N4F A;  1IUE A;  4KDI C;  3P63 A;  1JCK B;  5CX3 A;  3VTW A;  5LLI A;  4EFO A;  3AE3 B;  2L32 A;  2MBH A;  2RSU A;  3OJ4 B;  1L4D B;  3URY A;  4BBN C;  3PHX B;  4M8N A;  1HE8 A;  2IY0 B;  4HRS A;  3HM6 X;  3PV1 A;  5EE3 A;  1WXQ A;  1XT9 B;  4I6L B;  4DHJ D;  5AZG A;  3AEE B;  2DEN B;  1YJJ A;  4KKJ A;  5G5G A;  2MW5 A;  4MAC A;  4ZRI A;  2CHZ A;  3KW5 B;  2KJ6 A;  3CF6 E;  4ICU A;  4E3C A;  3KLS X;  2WXK A;  4IM3 A;  3KVF B;  2NBU A;  3A1Q A;  1WGK A;  4EUT A;  1SE4 A;  2INP E;  4S0R A;  3L17 A;  3Q6B A;  1TKY A;  1AAR A;  4GSW A;  1EF5 A;  4W9F A;  2CHW A;  2O2V A;  3VVW B;  4FA6 A;  3MHS D;  2GBN A;  3HHM A;  4HKZ E;  4FN2 A;  2O6V B;  1GUA B;  3TL5 A;  2OJW A;  1TZO A;  1QOB A;  3TMP B;  1N61 A;  3BK1 A;  4D2K A;  4LK0 M;  1V81 A;  3APF A;  5C2T B;  1YIW A;  2MCN B;  4PYZ A;  4PT5 A;  2NPT B;  3AE5 B;  3LXF A;  2D10 A;  1UWX A;  2ZJD A;  4C4V A;  4FLH A;  1DGJ A;  3IVF A;  3PRM B;  2PKO A;  2W3R A;  3H9D A;  4A55 A;  1C78 A;  1S3S G;  1WXA A;  4G0N B;  2V3P A;  3A9K A;  4WJP A;  4JIO U;  2NBV B;  2KDE B;  3AM9 A;  1WGG A;  3MTN B;  4ANU A;  2K22 A;  3A4S C;  3VRB B;  4B0M A;  2BWF A;  3VTU A;  4CQN A;  1KH0 A;  1D6E C;  1WXM A;  2M8S A;  4HPL B;  2J0K A;  3FIL A;  5LXI B;  3AE4 B;  4GXB A;  3DVG X;  4K1R B;  1HTO A;  3M95 A;  3PHW B;  3DWM A;  2Y5P A;  1YQ3 B;  3B2G A;  2WDV B;  2FID A;  4ASW C;  1SGH A;  1TT5 B;  3VHT C;  3L0W B;  2RD0 A;  1F77 A;  3E9S A;  1C77 A;  5FKA C;  3UIO B;  4EZL A;  1QOF A;  2WXR A;  2XNA C;  4IWQ A;  5EE0 A;  1E9M A;  1FXT B;  1A70 A;  5TSS A;  1FFU A;  2H89 B;  3V61 A;  2L00 B;  4KVG B;  2K8B A;  4XGA B;  1QOG A;  3RUL A;  2X8X X;  2LUM A;  2BF8 B;  4WIP A;  2IZV B;  2MRP A;  4LNO A;  1XCT L;  3LJ3 A;  4R3D A;  2DZM A;  5G55 A;  1WIA A;  3BVM A;  4M01 A;  4ARC A;  1P98 A;  3V3X A;  3AE2 B;  3LB8 C;  2FUH B;  3L08 A;  1WMH B;  4YTM B;  2CS4 A;  1L7Y A;  1AW7 A;  3C0R B;  1WRI A;  1PYW D;  3I63 C;  4A90 A;  3A9J A;  1MG8 A;  2L05 A;  5FK9 C;  4NY0 A;  3ZGZ A;  4A3P A;  3Q14 C;  2VZK D;  5JH5 C;  1WXS A;  3PSE B;  2BS2 B;  3WAP A;  3KYD D;  3UGB B;  2BTE A;  1H4R A;  1I4X A;  2FNJ B;  3NVZ A;  2BWE S;  3AH7 A;  3X23 A;  3SR6 A;  3PVL A;  5AUK A;  3V62 A;  2DZK A;  3ZRC A;  2KVR A;  3PGE A;  2KD0 A;  4USA A;  2JY6 A;  4TSS A;  3ZIM A;  2LJI A;  2Y3A A;  3AEF B;  3ONS A;  3ALB A;  1L4Z B;  1JWU D;  1YN5 A;  4GGQ A;  3J9C A;  3DCG A;  4Q2J A;  1DOI A;  1XCQ L;  1FNU A;  2LZ6 A;  3ZNG C;  3QA8 A;  4MJS A;  4TKN A;  1EU3 A;  1GC6 A;  2WLB A;  2MP2 A;  2WXL A;  2MEK A;  1ZDX A;  2JWU A;  1RFA A;  1FFV A;  3VQI A;  2BB6 A;  4JE3 B;  1GPX A;  1HQR D;  1TS3 A;  3LDZ E;  1YJI A;  5IA7 A;  4WJO A;  2KDB A;  2OJR A;  1G6J A;  2NPT A;  2PMV A;  4HJG E;  5LNK 1;  1L0X B;  1WR6 E;  1ZP0 B;  1CZP A;  4OZA A;  2JT4 B;  4XYC A;  4DK5 A;  2CHX A;  4IKG A;  4NZL B;  1KOT A;  4JL9 A;  4KV2 A;  4XWT A;  3QX1 A;  4AUQ C;  4ZYS A;  4ZRK A;  4DHJ B;  2J0M A;  2B3A A;  1C1Y B;  3EGR A;  1WFY A;  1SXT A;  1FD6 A;  1MI0 A;  4IUM B;  4RF1 A;  2XN9 C;  2KFK A;  3CSF A;  1TKE A;  3BYY B;  3UQB A;  3AI5 A;  2KXJ A;  2J4X A;  4BFR A;  2MWS B;  1D3Z A;  2DYO A;  2REX A;  2IGD A;  3Q3O C;  1FEH A;  3DQV A;  2I38 A;  2H88 B;  2WXO A;  2PE9 A;  2M0A A;  1UWM A;  2LHD A;  4YSY B;  2ZVO A;  1WWT A;  2MHJ A;  3B9J A;  3WAO A;  1ACC A;  3KUD B;  1Q5W B;  3DVN U;  1BT0 A;  1PUT A;  1UEL A;  2RPQ A;  3AB5 A;  2K25 A;  3P4P B;  1WX8 A;  4IM2 A;  3V05 A;  2L7R A;  2AL3 A;  1C4A A;  2BT6 A;  1V9J A;  3ENE A;  4LTU A;  3VRA B;  1UGM A;  2JZP A;  2KWU B;  2L52 A;  2ZPN A;  1J7B A;  3RN9 C;  4E74 A;  1FMA D;  1J19 A;  1IYF A;  2ZW1 A;  2D2Q A;  2WXM A;  4ZRQ A;  3AV8 A;  4PYU A;  2GBJ A;  1XD3 B;  1E7P B;  1UNS A;  4MGY E;  2K9X A;  1SBB B;  3C19 A;  2XK5 B;  1WZ0 A;  2MQJ A;  3A1Q B;  3JYU A;  2LXA A;  2NVU I;  3W2D A;  1K51 A;  2V3S A;  1QKZ A;  1KFY B;  3FC4 A;  5C1Z A;  5DPW A;  1Q10 A;  1H8C A;  4MGI E;  4IM0 A;  3BK2 A;  2IGG A;  3RI7 C;  1A5R A;  2KX3 A;  1V49 A;  2K6Q A;  2C5L C;  2WS3 B;  3ZNZ B;  3B0A A;  1SIJ A;  2L0F A;  3N1Y C;  2V4I B;  5AZH A;  1UUP A;  2E6X A;  3GE3 C;  3H7S A;  2RDH A;  5T8I A;  4L23 A;  2V3N A;  5EE1 A;  4JQW C;  2N9X A;  3HVD A;  1RAX A;  4C80 A;  1D5X C;  4FJV B;  3U7D A;  1YN4 A;  2CKH B;  2Z59 B;  4LNF A;  1OFF A;  1SJH D;  5D3I B;  1FRR A;  1ZKH A;  1OQR A;  1PGB A;  4OZC A;  5L83 A;  4ANX A;  1NEK B;  3BYT B;  3P1M A;  2V4L A;  1TY0 A;  2JVC A;  3AU5 A; 
#chains in the Genus database with same CATH homology
 3PV1 A;  1V2Y A;  4W9K A;  2WX0 A;  3NHE B;  4FJY A;  2LD9 A;  4YL8 A;  3U8Z A;  1WX9 A;  1WM2 A;  4TUU A;  4FBJ B;  1XT9 B;  4I6L B;  3ZTC A;  4CYE A;  4DHJ D;  5AZG A;  1GG3 A;  5EDS A;  3H6N A;  2DEN B;  2AWT A;  1VCB A;  4DDI D;  2K1F A;  3PRZ A;  2PE6 B;  3APC A;  4KIK A;  3ZNI D;  2MW5 A;  5D6J B;  4ZRI A;  2CHZ A;  3BY4 B;  2KJ6 A;  3KW5 B;  3NZS A;  3ZRF A;  2HJ8 A;  4NNJ B;  3JVZ X;  3CST A;  2MA9 B;  4MH0 E;  2EMS A;  4IWP A;  4KSK C;  3CF6 E;  2ZZP B;  1QZE A;  4ICU A;  4E3C A;  4IM3 A;  3KVF B;  2NBU A;  3A1Q A;  4B6W A;  2BYV E;  2NR2 A;  2KJH B;  2FAZ A;  4GMV A;  3VH3 B;  4EUT A;  2LVO A;  2C60 A;  3L17 A;  3KH0 A;  1AAR A;  4GSW A;  1EF5 A;  3K9P B;  1M94 A;  4W9F A;  1ISN A;  4JLC A;  2M17 A;  4CHK A;  1WR1 A;  2CHW A;  2O2V A;  4GDK A;  3VVW B;  1R4M I;  4FA6 A;  2WX1 A;  2QHO A;  3MHS D;  2GBN A;  3PRE A;  3HHM A;  4GDL B;  3PS6 A;  4GDK B;  1TTN A;  5IAA C;  2KAN A;  4FN2 A;  2O6V B;  1GUA B;  1UZX B;  2AYO B;  5DPT A;  3TL5 A;  4A3O A;  1UD7 A;  2BPS A;  2ZEQ A;  3TMP B;  2KMC A;  2MSE D;  2CU1 A;  3B1L X;  2GBM A;  1V81 A;  2KN5 A;  3APF A;  4ZYN A;  1YIW A;  2O6V A;  4FAD A;  2MCN B;  4PYZ A;  2HE7 A;  2NPT B;  2D10 A;  2YLM A;  2ZJD A;  4FLH A;  4GOC A;  3A9J B;  3IVF A;  1WE7 A;  3PRM B;  3A9K B;  3EEC A;  5KHQ A;  3ZLZ A;  3ZW3 A;  4RM8 A;  3H9D A;  3RCZ A;  2O2V B;  3QK0 A;  4LJO B;  1S3S G;  1WXA A;  4ICV A;  4G0N B;  3P2B A;  5CHW A;  4TV3 A;  3A9K A;  1K8R B;  1KLV A;  2PEA A;  3IBE A;  4WJP A;  4JIO U;  5JZE B;  2NBV B;  1EF1 A;  2RR9 A;  2KDE B;  3L10 B;  4G50 A;  1WGG A;  5JHA A;  2MBE A;  4OVV A;  3MTN B;  4K7S A;  4W9G A;  1TGZ B;  4ANU A;  3A4S C;  1KJT A;  5D94 A;  1UH6 A;  2KDF B;  4MEM A;  2BWF A;  3Q3J A;  3VTU A;  2WWZ A;  4NJ7 A;  2N1W A;  2D11 A;  3QWZ B;  4LDT B;  4NQL B;  4WQO B;  4TQ0 A;  1P9D U;  1WXM A;  1PQS A;  2M8S A;  2YVC A;  1WXV A;  3DBS A;  4HPL B;  2J0K A;  2DYM A;  1OTR B;  2KWV B;  5LXI B;  4W9C A;  4GXB A;  3DVG X;  4K1R B;  1V5T A;  1YX5 B;  3M95 A;  2NBW B;  1Z2M A;  5FR6 A;  3PHW B;  4BKG A;  3VAW A;  2L8J A;  3AXC A;  3PPA A;  2R2Q A;  3NY5 A;  1KM7 A;  4KZ0 A;  5C23 A;  1E8Z A;  4FJZ A;  3ZTD A;  2DYB A;  2M1M A;  4FHK A;  4AP4 C;  1IP9 A;  2FID A;  4ASW C;  1SGH A;  3CMM B;  3VHT C;  4KSL C;  3SDL C;  3L0W B;  2IBI B;  1OQY A;  2RD0 A;  2L3Z A;  1GC7 A;  3TBL D;  3VDZ A;  3ZVV A;  1I35 A;  3A4R A;  3M3J A;  4BKT A;  2BYF A;  3B08 A;  2MLB A;  1E7U A;  1WF9 A;  2LVP A;  4DXA B;  2HTH A;  1GNU A;  1WGR A;  3ZDM C;  3UIO B;  4EZL A;  2G45 B;  2K8H A;  3BIN A;  2ZCB A;  2C7M B;  1VD2 A;  3PTF C;  4KZC A;  2A4Z A;  2Z0E B;  1YX6 B;  4IWQ A;  1FXT B;  2L76 A;  3VH4 B;  3UQA A;  2KMA A;  2KTF A;  4BVU C;  2LGD A;  1Q0W B;  3ML8 A;  3JSV A;  3V61 A;  2L00 B;  4KVG B;  2EKE C;  4WWP A;  2K8B A;  3DVN V;  3VTV A;  3RUL A;  2KLC A;  4M0W B;  3V60 A;  1XQQ A;  2BF8 B;  2O6V D;  3M62 B;  2BKR B;  2IZV B;  2MRP A;  1E5W A;  4IWO A;  3LJ3 A;  3I3T B;  2IO0 B;  2KOX A;  2DHZ A;  3OJ3 A;  4WWO A;  2DZM A;  5G55 A;  2MBB B;  1WIA A;  1P98 A;  4F1S A;  1YD8 U;  2FUH B;  3L08 A;  1WMH B;  3TCA A;  2CS4 A;  2ZVN A;  1L7Y A;  3Q3F A;  2DAJ A;  2WDT B;  1V6E A;  3C0R B;  3M63 B;  4AWJ A;  2LRW A;  5E6P A;  4AJW A;  2DAF A;  4XX5 A;  3U30 A;  2LGX A;  2OOB B;  1V5O A;  4GU2 A;  4ANV A;  1E8Y A;  1NI2 A;  2GBR A;  1E8W A;  4W9J A;  3N32 A;  3TJP A;  3JW0 X;  3A9J A;  3APD A;  4DHZ E;  2KTR A;  1MG8 A;  3PLU A;  3DBR I;  2L05 A;  4II3 B;  3R7R A;  3EFU A;  3VFK A;  4NY0 A;  2LJ5 A;  4A3P A;  2JZZ A;  2KX0 A;  3DOW A;  2J7Q B;  1UBQ A;  5DCN A;  2ZNV B;  4DHZ B;  4FUL A;  3DDC B;  1E8X A;  1WMH A;  5JH5 C;  1WXS A;  3PSE B;  3UF8 A;  3KYD D;  3UGB B;  2KFK B;  3WAP A;  1H4R A;  2FNJ B;  2BGF A;  4II2 B;  2FCN A;  2MX2 A;  2BWE S;  2JZ3 B;  3H7P B;  3KUC B;  4RMA A;  3X23 A;  3PVL A;  3V62 A;  3O65 B;  3IHP C;  2XEW A;  3NOB A;  2DZK A;  3QIJ A;  3ZRC A;  4J6I A;  1WM3 A;  2BYE A;  2KKC A;  2KVR A;  3OAW A;  3PGE A;  4GN1 A;  4MJS B;  2JRI B;  4W9E A;  2KD0 A;  1WGH A;  3HIZ A;  4A20 A;  2JY6 A;  2FCQ A;  4WWN A;  4TQ1 A;  2MP2 B;  3ZIM A;  3RZW C;  3IFW B;  1V86 A;  2W9N A;  4GIV A;  4DDG D;  3RUI B;  1Q1O A;  1SE9 A;  2M0X A;  3UIP B;  4MSQ B;  2AL6 A;  5CHV C;  1WH3 A;  3ONS A;  3PT2 B;  3ALB A;  4DBG A;  3KUZ A;  5LXH A;  4MSM B;  2KO3 A;  3R3M A;  4LDT D;  3W1S A;  3X0W A;  2DZJ A;  4K7U A;  1F9J A;  4XZ4 A;  2LGY A;  4OVU A;  1WJ4 A;  4GGQ A;  3PLV A;  3DCG A;  3QHT A;  4GB9 A;  5DPS A;  1SIF A;  4NQK E;  3HM3 A;  5J2R A;  4W9H A;  2LZ6 A;  3R7Q A;  3ZNG C;  3QA8 A;  4MJS A;  2K6D B;  2C7N B;  4TKN A;  2N7D A;  4F7Z A;  1LFD A;  4HPM B;  1GC6 A;  3RT3 B;  2MP2 A;  1UBI A;  4B95 A;  1RFA A;  2PPH A;  4FHJ A;  2C7H A;  1JRU A;  3VQI A;  3OLM D;  2JXX A;  2JRH A;  3WIM A;  2M4N A;  3LDZ E;  2MBO A;  3EHV A;  3VUW A;  2XBB C;  4HJK A;  5IA7 A;  4WJO A;  2K8C A;  4IC7 B;  2KDB A;  4G3X B;  4KDL B;  1GJZ A;  3GZN I;  3QJZ A;  3W1Y A;  4B9K A;  1L2N A;  2OJR A;  1G6J A;  1EUV B;  1WYW B;  2R2O A;  5TR5 A;  2G4S A;  2NPT A;  4EZK A;  3TIX A;  2KK8 A;  4BKS A;  1WR6 E;  3SU8 X;  5L95 C;  1OGW A;  2NCN A;  2JT4 B;  2ZNV C;  4HLE A;  4DK5 A;  1U4A A;  2CHX A;  3QQ8 B;  4AJY B;  2LUE A;  2A5U A;  2LAS A;  3N3K B;  1R4N I;  1KOT A;  4JL9 A;  4KV2 A;  1NDD A;  5GMV A;  5G2N A;  4MEL A;  4AOF A;  4ZDV A;  1NBF C;  3QX1 A;  4HWI B;  4LCD E;  4AUQ C;  1WI0 A;  3RD2 A;  4ZRK A;  4DHJ B;  1CMX B;  3W1S C;  4WJQ A;  1WJN A;  2B3A A;  2J0M A;  4BKS D;  1C1Y B;  1WFY A;  3IG3 A;  3ZNH B;  3T9L A;  3DBH I;  4IUM B;  3ZO5 B;  4M8M A;  1I42 A;  2FCS A;  3AU4 A;  2KFK A;  3VUX A;  3WAL A;  3CSF A;  2PJH A;  2D3G A;  2JF5 A;  3UQB A;  3QAQ A;  2KWC A;  3ML9 A;  5JHB A;  4I6P A;  4I6N B;  3AI5 A;  3WAN A;  2DZI A;  1OEY A;  2FCM A;  4HVB A;  2KXJ A;  4URK A;  2FIF A;  4BFR A;  4BOS C;  5E6O A;  2KHW B;  2MWS B;  1D3Z A;  2MBQ A;  2BKF A;  2DYO A;  2REX A;  2N7E A;  3N30 A;  2GBK A;  1TBE A;  4HCN B;  1YQB A;  2AEH A;  1LM8 B;  3DQV A;  4XC2 A;  3NZU A;  2CR5 A;  2UWQ A;  4NAW B;  2Y5B B;  2IO1 B;  3RYT A;  4MGZ E;  2IY1 B;  2PE9 A;  3ZUN A;  1E7V A;  4WAA A;  2LVQ A;  3R66 C;  2GOW A;  2ZVO A;  3ZKJ C;  3GOE A;  3KYC D;  4MM3 A;  2I1K A;  2LWP A;  5DPR A;  4DWF A;  4EOY A;  4G11 A;  2G4D B;  4LJP B;  2UYZ B;  4EKU A;  3WAO A;  1LXD A;  3ECI A;  3KUD B;  4N9F 4;  1Q5W B;  2VRR B;  2JWZ A;  1BT0 A;  3DVN U;  1UEL A;  2RPQ A;  1P1A A;  1P0R A;  3L54 A;  4PS3 A;  3DBL I;  4MDK E;  2K25 A;  5KHO A;  3D32 A;  1IPG A;  3K9O B;  3NS8 A;  1WX8 A;  1LQB A;  2LRU A;  4IM2 A;  4KIK B;  2KLG A;  4W9D A;  1WY8 A;  2KDI A;  2L7R A;  2AL3 A;  4W9I A;  3S2A A;  3VUY A;  5AEK B;  1J0G A;  1V9J A;  3ENE A;  4HDO A;  1S1Q B;  5AZF A;  2LXC A;  1UGM A;  2KWU B;  3VXW A;  3PZD A;  2ZPN A;  2JUO A;  2HD5 B;  2GMI C;  2I1J A;  4E74 A;  4ZRJ A;  2V1Y A;  1J19 A;  1WRD B;  1IYF A;  3PRP B;  2D2Q A;  2KZR A;  4PYU A;  2GBJ A;  5D7G A;  1X1M A;  3JSV B;  1XD3 B;  2IYD B;  2L0T A;  4MGY E;  3QCA A;  3QC8 B;  1T0Y A;  3V6C B;  2XK5 B;  1WZ0 A;  2MQJ A;  4IW0 A;  3A1Q B;  3H1U A;  1E90 A;  1ZW7 A;  3JYU A;  2LXA A;  1OEY J;  4GDL A;  2DX5 B;  2NVU I;  1YJ1 A;  2ZPY A;  3HK0 A;  2IO3 B;  2V3S A;  1WE6 A;  2K39 A;  5C1Z A;  4HK2 A;  3QAR A;  1EO6 A;  5DPW A;  1J8C A;  4CO7 A;  1H8C A;  4MGI E;  2ZCC A;  4IM0 A;  2KNB A;  2IO2 B;  3EC8 A;  2KX3 A;  1V49 A;  1A5R A;  2K6Q A;  4HDQ A;  4NPN A;  2C5L C;  2RGF A;  1RLF A;  4X57 B;  2C9W B;  2J0J A;  3ZNZ B;  2KQ7 A;  3B0A A;  5HKH A;  2XK5 A;  2L0F A;  2KFJ A;  5AZH A;  4HCP B;  5E6N A;  4F8C B;  3SD5 A;  2LI5 A;  5J18 A;  3DPD A;  2EMT A;  2KJR A;  2KC2 A;  3H7S A;  2N1V A;  5BO4 B;  3AUL A;  4MGK E;  3RZF A;  4BOZ B;  4NAW A;  1WGY A;  1WGD A;  1Z5S B;  2WYQ A;  4RM9 A;  4K81 A;  4HXD A;  3MJW A;  4JQW C;  4EEW A;  3WAM A;  2KTR B;  3L13 A;  2ASQ A;  5D2M B;  2N9X A;  3DVG Y;  1V80 A;  1RAX A;  3A33 B;  2KQS A;  3ZDT A;  3L16 A;  4EZJ A;  4JGH B;  3UIN B;  4FJV B;  3U7D A;  1WZ3 A;  4ANW A;  3T8M A;  1RRB A;  3WA0 A;  5CTR C;  4PS7 A;  5J17 A;  1Y8R C;  2CKH B;  2D07 B;  5CHF A;  1C3T A;  2Z59 B;  2N9E B;  1WJU A;  4PS8 A;  4IG7 B;  4NJ6 A;  3H7P A;  2N9P C;  1ZKH A;  1ZGU B;  2N4F A;  4E71 A;  4KDI C;  4K7W A;  4W9L A;  1TZ1 A;  5CX3 A;  3VTW A;  1WJ6 A;  5LLI A;  4BBN F;  4EFO A;  2KC1 A;  2RSU A;  2MBH A;  4P7I A;  3V6E B;  1P3Q U;  5L83 A;  3SHQ A;  2JPH A;  4ANX A;  4WJN A;  3OJ4 B;  1WX7 A;  4BBN C;  2G3Q B;  3PHX B;  4M8N A;  1HE8 A;  2V4L A;  2IY0 B;  2Z0D B;  2NS5 A;  2JVC A;  3HM6 X;  3AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...