1KJTA

Crystal structure of the gaba(a) receptor associated protein, gabarap
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GABARAP
publication title Crystal structure of the GABA(A)-receptor-associated protein, GABARAP.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 37
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1kjtA00
3TMPB 3X0WA 1SIFA 3VHTC 1C3TA 2LGDA 2MSED 4AWJA 2JVCA 2K25A 4MJSB 2NR2A 5GMVA 4B9KA 4WJNA 4CO7A 4EOYA 2PJHA 4ZRJA 1J8CA 3RZFA 2BYVE 2IO1B 2D10A 2WX1A 1OGWA 4HVBA 1RFAA 2PE6B 4KIKB 3UQAA 4NJ6A 4PS8A 3RZWC 2CR5A 2KX0A 4MSMB 5G55A 3RYTA 2AYOB 2YLMA 3H7PB 3LDZE 1V86A 1WJ4A 4M8NA 2BWES 1WE7A 4TV3A 3VH4B 2DZIA 4FJYA 1LXDA 3KW5B 2ZVNA 2M17A 4WWNA 5KHOA 1VCBA 2M8SA 3DBHI 1XT9B 4HJKA 3MJWA 3IFWB 4GIVA 1LFDA 4G11A 2C60A 3SD5A 2NCNA 3H6NA 4NPNA 1WXVA 3VTWA 1Z2MA 5C23A 2LD9A 2JF5A 2N9XA 2ZVOA 1L7YA 1WZ3A 2D3GA 4BOSC 3SHQA 3ZDMC 2IBIB 4HPLB 5DCNA 1KLVA 2GBRA 2CU1A 2KD0A 4ANUA 3DVGX 4MGIE 4ICUA 1OEYJ 4B6WA 4ZDVA 3JSVA 1F9JA 1GNUA 2PPHA 5JHAA 3R7RA 3KYCD 3M62B 3ECIA 2MLBA 3L08A 4TKNA 3ZRCA 2L00B 1ISNA 1GG3A 2AL6A 2O6VB 2RGFA 3ZIMA 4DHJD 1WGGA 1JRUA 3NY5A 5E6OA 2UYZB 1GJZA 2B3AA 3IHPC 3ZNID 1WGHA 4HPMB 2L05A 2XK5A 2KJRA 3WAPA 5FR6A 5D2MB 1OEYA 1U4AA 1V5OA 4WJQA 1UGMA 4HDQA 3A9JB 4IW0A 3HM3A 4GDKA 2BYEA 5CX3A 3V61A 2MQJA 3PGEA 4P7IA 1LQBA 1V5TA 3A33B 2MX2A 2HE7A 1XQQA 5KHQA 1H8CA 3RUIB 1E8XA 5AZHA 2I1KA 2KDBA 1WM3A 2DAFA 2LASA 3IBEA 1I35A 4ZYNA 4K7WA 3JSVB 2KC2A 3KUDB 1QZEA 3VUYA 1D3ZA 4DHZE 1RRBA 1ZGUB 2FNJB 4ZRKA 1J19A 2GBMA 3Q3JA 4I6LB 2RSUA 2KMAA 2A4ZA 3ZLZA 1S3SG 2BKRB 3QA8A 3ALBA 3HHMA 2XK5B 4X57B 4IUMB 2GBJA 1PQSA 4MDKE 2V4LA 4DDID 2IY0B 2BPSA 3AI5A 4HLEA 3PS6A 4GDKB 2MBQA 3VH3B 3RULA 2PE9A 3QHTA 4A3PA 4PYZA 3A4RA 3QJZA 4DK5A 1Q1OA 1TBEA 1OTRB 4JIOU 3V6CB 3VXWA 4PYUA 3WAOA 2C7MB 1WGRA 3ZW3A 2M4NA 2QHOA 5JH5C 1E7UA 3L10B 1WR1A 1V2YA 3A4SC 3H7SA 2N1VA 2GBNA 2UWQA 2MCNB 2KTFA 2K8CA 1IYFA 2CS4A 2IYDB 1MG8A 2MBOA 3KH0A 3ZKJC 2G4DB 2MA9B 3KUCB 3PRMB 5J18A 2AWTA 2HJ8A 3EHVA 4GGQA 4OVUA 4XX5A 1WY8A 1J0GA 4KSKC 3V6EB 2M0XA 4GB9A 4BKTA 2C5LC 2FCNA 4GOCA 4LCDE 2WYQA 2JUOA 4I6NB 3WAMA 2L3ZA 3IVFA 1GUAB 4MEMA 3EECA 2JPHA 4E74A 5IAAC 4EKUA 2XEWA 2LJ5A 2G45B 3WIMA 3R7QA 3APFA 2KZRA 2REXA 3UF8A 2D2QA 1K8RB 4NY0A 2MWSB 2KHWB 4W9FA 3TCAA 3VTVA 4MELA 3P2BA 4II3B 5AZFA 1Q5WB 2O2VA 3N30A 3NOBA 5LXHA 2KJHB 2JWZA 4M0WB 3ML9A 1EF5A 2PEAA 3AU4A 2V3SA 4URKA 2I1JA 1I42A 1V49A 3UGBB 4B95A 5DPRA 3PRZA 2KMCA 1E90A 4IWOA 4WJOA 5EDSA 4HCNB 3OJ4B 1EO6A 2ASQA 2KLCA 4AJYB 2BYFA 3PHWB 2BKFA 3VUWA 2IO3B 2N1WA 4FN2A 4HXDA 5E6NA 5E6PA 2EKEC 2GOWA 2HD5B 2L0FA 4IC7B 2JZZA 3BINA 2LVOA 4HCPB 2KVRA 3CSTA 4G0NB 1E8WA 1ZW7A 1RAXA 4G50A 3QQ8B 2NBWB 2BF8B 5LLIA 4W9CA 2KFKA 3PRPB 2O2VB 1E7VA 4FHJA 3QARA 3QK0A 2JY6A 3H1UA 3T9LA 1TZ1A 2KWCA 2FCMA 3AU5A 3R66C 2LRWA 1WXSA 3I3TB 4N9F4 4EEWA 4E3CA 1V81A 1WGDA 3L13A 4KDIC 4W9KA 1FXTB 2NPTA 3C0RB 1P0RA 1WJ6A 2O6VD 3W1YA 2NBUA 2N7EA 5AZGA 3ZDTA 4GXBA 2Y5BB 4FULA 4LDTD 3B0AA 4BKGA 4WWOA 3S2AA 2J0JA 4GN1A 1WX7A 4JQWC 4TQ0A 4GDLA 2C7HA 3B1LX 4MGZE 4A20A 3PVLA 4WAAA 2WX0A 2NBVB 1NDDA 2KKCA 4NJ7A 3ZTCA 4NQLB 1R4MI 3GZNI 2GBKA 3DBLI 5TR5A 3OJ3A 2JRHA 2NVUI 3JYUA 1RLFA 4NNJB 3V62A 3PPAA 2IO0B 1WGYA 2J0MA 2LVPA 2MBHA 3DCGA 4DWFA 3CSFA 3WA0A 4BKSA 5HKHA 2RD0A 4FLHA 4KZCA 2DHZA 2MW5A 4J6IA 2KFKB 4KSLC 1YJ1A 3VUXA 1V80A 3A9KA 3N3KB 4HDOA 4ANVA 2FIFA 3M95A 1UBIA 3D32A 2FAZA 2FIDA 3W1SA 4FJVB 5L95C 2CKHB 2ZNVB 1WJNA 3L0WB 4FHKA 2KN5A 3QWZB 3WANA 2BGFA 3OAWA 1V9JA 4E71A 2LZ6A 2ZNVC 3ENEA 4NQKE 4ANXA 3PHXB 5AEKB 3PREA 2BWFA 2NS5A 4JGHB 4MGYE 4IM3A 1OQYA 5C1ZA 5IA7A 4KV2A 3VQIA 4GDLB 3WALA 3U30A 3GOEA 3AXCA 2IZVB 1XD3B 2CHWA 1V6EA 4JL9A 3NHEB 3JW0X 4NAWA 1Y8RC 2LWPA 3DPDA 1P98A 1YQBA 3CMMB 3PLUA 4DDGD 2ZEQA 3PZDA 4YL8A 3N32A 4TUUA 4MJSA 4BBNC 4KDLB 2L7RA 2WWZA 2OJRA 5G2NA 4IM2A 1P1AA 4WQOB 1IP9A 3DQVA 2EMTA 2LXAA 3DOWA 4W9DA 4DBGA 1KOTA 5DPSA 2EMSA 3T8MA 3ML8A 5BO4B 3HIZA 1E8YA 3R3MA 3KYDD 3NZSA 1Q0WB 3SDLC 4MM3A 5J17A 3NZUA 1NI2A 1WMHA 1L2NA 1E8ZA 1M94A 3IG3A 3HK0A 4WJPA 4EZKA 4KVGB 2JRIB 1YX6B 3RD2A 5D7GA 4JLCA 4BFRA 3AULA 3ZNGC 3VDZA 1SE9A 3PSEB 2R2QA 2AL3A 2KFJA 2YVCA 4IM0A 2KNBA 4GMVA 4DXAB 5J2RA 4W9JA 1WXAA 4MSQB 2JXXA 1WIAA 1KM7A 3K9OB 4IG7B 3MHSD 2G4SA 3EFUA 1EUVB 1HE8A 4RM9A 1NBFC 1YD8U 1BT0A 2GMIC 2MP2A 3APCA 3V60A 4AJWA 5DPWA 3ZRFA 4HWIB 4F7ZA 2K8HA 3EC8A 1WR6E 2C9WB 4XZ4A 4G3XB 2MRPA 1VD2A 5D94A 2ZZPB 1TTNA 2DENB 3DDCB 2DX5B 4BBNF 3VTUA 4XC2A 2O6VA 1A5RA 2L76A 1R4NI 1WE6A 3ZVVA 4EUTA 4F1SA 3RCZA 2HTHA 2ZJDA 2CHXA 1AARA 3KVFB 1WMHB 1WX8A 1WH3A 2LVQA 2RPQA 2M1MA 2FCQA 3MTNB 5CTRC 2XBBC 1H4RA 2KLGA 3JVZX 2KDEB 2N4FA 1WXMA 4TQ1A 3DBSA 2KC1A 5CHVC 3A9JA 3ZNHB 4IWPA 2G3QB 2ZPNA 2A5UA 1WI0A 2VRRB 3DBRI 4CHKA 4RM8A 4K1RB 4MGKE 3OLMD 2Z59B 4ZRIA 1X1MA 3U7DA 2R2OA 4II2B 2KDFB 2IO2B 3K9PB 1KJTA 2C7NB 4W9IA 4K7UA 1E5WA 1T0YA 4GSWA 2KTRA 4DHJB 3H9DA 1WFYA 3CF6E 1UBQA 2KDIA 2MP2B 1YIWA 2N9PC 5JHBA 1S1QB 1UD7A 1IPGA 1GC6A 4EZLA 3UIOB 2W9NA 3KUZA 1WX9A 2LRUA 2ZPYA 2LUEA 4F8CB 1G6JA 3TL5A 2K6QA 2KQ7A 3RT3B 4LDTB 2L0TA 5CHWA 4EZJA 4RMAA 3ZO5B 3A1QA 3L16A 2RR9A 1SGHA 2ZCCA 5L83A 4FJZA 4PS7A 4HK2A 2KK8A 4W9EA 3VAWA 2DYBA 3PT2B 3TJPA 3Q3FA 3DVNU 4FBJB 4AUQC 3TIXA 2KXJA 2DZJA 1UZXB 2LXCA 4PS3A 1WYWB 1EF1A 2L8JA 2LI5A 4AP4C 4LJOB 2KTRB 3QC8B 2K6DB 3B08A 4W9HA 2KANA 4CYEA 5LXIB 2WDTB 3PLVA 3VFKA 4FA6A 1YX5B 2NPTB 3DVNV 1ZKHA 4MH0E 2DZMA 2DZKA 3ONSA 3ZUNA 3PV1A 1GC7A 5CHFA 3U8ZA 4I6PA 4IWQA 4DHZB 2V1YA 3APDA 2K1FA 4FADA 1TGZB 4M8MA 2N9EB 2J0KA 4LJPB 3QIJA 2KO3A 3UQBA 2K39A 4ANWA 2OOBB 2LGYA 2FUHB 2DYMA 2KWVB 3A1QB 4GU2A 3HM6X 4K81A 1P3QU 2N7DA 3UIPB 1UELA 3M3JA 2DAJA 1LM8B 1Z5SB 2MBBB 4EFOA 2D07B 4WWPA 4KIKA 5JZEB 2KOXA 3A9KB 3O65B 4BOZB 3SU8X 1WM2A 4ICVA 5D6JB 2KQSA 3LJ3A 1P9DU 2DYOA 3H7PA 3NS8A 1CMXB 2MBEA 3UINB 3VVWB 4KZ0A 2CHZA 4W9GA 1C1YB 2KWUB 2K8BA 3L17A 3QX1A 3X23A 3W1SC 4BVUC 2IY1B 2Z0EB 3QCAA 4BKSD 1WRDB 3TBLD 5DPTA 2D11A 2KJ6A 3PTFC 3QAQA 2AEHA 1WF9A 4A3OA 3L54A 1WJUA 3ZTDA 2LGXA 2JT4B 1UH6A 3ZNZB 2Z0DB 4ASWC 2ZCBA 4OVVA 4AOFA 2J7QB 2JZ3B 4K7SA 3BY4B 2FCSA 3M63B 4NAWB 1WZ0A 2KX3A 3DVGY 4W9LA
chains in the Genus database with same CATH superfamily
1JCKB 5BMGA 2LGDA 2LHDA 1MPEA 2PJHA 1F52A 3RZFA 2WX1A 1OGWA 2L52A 1RFAA 4KIKB 3RZWC 4OZBA 3LDZE 1WJ4A 4TV3A 2DZIA 2MJDA 3MJWA 2D3CA 2C60A 4NPNA 1J7BA 3Q14C 2LD9A 2E3TA 1FNUA 3VRBB 1WZ3A 2D3GA 3SHQA 1T0SC 3RNFC 2GBRA 2K22A 3DVGX 3GS2A 4ZDVA 4IKGA 4TSSA 2AL6A 3ZIMA 3Q3OC 1WGGA 4RH6A 1K53A 3Q8AA 4HPMB 4USAA 4LLGM 3WAPA 4HROA 2AX5A 3HM3A 2MQJA 3PGEA 3LXFA 3Q6BA 2H89B 1XQQA 1XF5L 3RUIB 4A8XC 4XWTA 2KQ4X 4ZYNA 1L6VA 1VRAB 4RFBA 4M02A 1QZEA 3VUYA 1D4BA 1RRBA 1ZGUB 4HJGE 1L0XB 2KMAA 2BKRB 1RWSA 3ALBA 1C76A 4RGTA 2GBJA 4RF0A 1SXTA 5G5HA 1E6EB 4KGTA 1IUEA 2OHFA 2MBQA 2BBCA 2PE9A 4PYZA 3QJZA 1ZPSA 1N60A 1XLQA 3ZJTA 3ZW3A 3IAM1 4P16A 1V2YA 3H7SA 5EE3A 3ZKJC 3KUCB 2AWTA 2FBWB 4XX5A 1FXAA 4GB9A 4DXFA 1HZ6A 3WAMA 1GUAB 4MEMA 5IAAC 2WGSA 2XEWA 1XO3A 1UWXA 2REXA 3P63A 1K8RB 3TCAA 1I4QA 2MWSB 3VTVA 5AZFA 2O2VA 1F0ZA 3N30A 3NOBA 1SSNA 1N5XA 4M00A 3UGBB 1KLGD 4YTMB 1QOFA 5DPRA 3HVDA 2DLBA 1P7EA 3OJ4B 1EO6A 2KLCA 3PHWB 2BKFA 3VUWA 2HD5B 2BS3B 2BB5A 1FRDA 3BINA 4HCPB 1YN4A 2KVRA 3CSTA 1RAXA 2BF8B 2WXIA 1SJED 1F1HA 3PRPB 2BQQA 1TZ1A 3P4QB 2FCMA 1WXSA 3I3TB 4E3CA 4W9KA 1JWBD 3BVGA 4FULA 3S2AA 1TKEA 2PKOA 4MGZE 4XYCA 2KKCA 3ZTCA 4NJ7A 1ET6A 3BVMA 4NQLB 1R4MI 3GZNI 5TR5A 1KLUD 1RLFA 2N9LA 3WA0A 4BKSA 5HKHA 2MW5A 4EE2A 2BS2B 3AE2B 3AE3B 4ANVA 5BYSA 4REZA 4P1CC 4FJVB 5HG2A 2E6XA 1STEA 2BGFA 2NTTA 4LNIA 1PUTA 4ANXA 5AEKB 2BWFA 4IM3A 4GDLB 1L0VB 2Y5PA 3FKYA 4C7ZA 2IZVB 1XD3B 4XWWA 3CMMB 3PLUA 3PZDA 3N32A 3NS1A 4MJSA 2L7RA 1C4PA 3AB5A 2J53A 2LXAA 1ZP0B 5BO4B 5EE9A 3T3OA 1AN8A 2R61A 4ARCA 1E8ZA 3HK0A 2JRIB 5D7GA 4RGMA 3AEDB 1SE9A 3PSEB 5JXVA 2R2QA 2AL3A 2YVCA 2IGDA 1K51A 3RNGC 2V4IB 1WIAA 1V97A 2WXPA 3AE5B 3V05A 1TKGA 5BYRA 1C9FA 4AJWA 2MP2A 3APCA 1NYQA 5D94A 2DENB 2WXQA 1KFYB 3VTUA 4XC2A 2O6VA 1R4NI 4F1SA 3RCZA 1QT9A 2D5GA 1P7FA 4AS1A 2FCQA 2KLGA 2V3NA 5AUKA 2QIEB 3BVZA 2N4FA 3DHIC 2G3QB 1TJEA 3MC0B 4K1RB 1QOBA 4ZRPA 4ZRIA 2QJLA 1T0YA 3H9DA 2IGGA 2HTME 3BK1A 1UBQA 2AQ1B 3UIOB 2YEPB 4IDIA 3NZ3A 4P1BC 3URYA 2K6QA 2JXTA 2JU6X 2L0TA 1AWDA 3L16A 2IGHA 1JMLA 3KWLA 4W9EA 2DYBA 2DZJA 4PS3A 4OVZA 4AP4C 5I4DA 4LJOB 2KTRB 3QC8B 4W9HA 5LXIB 2WDTB 3PLVA 4MH0E 3ONSA 2DZKA 3ZUNA 4I6PA 2J4XA 4DHZB 2K1FA 5C3JB 1TGZB 3SR6A 4ARIA 2K39A 3AEGB 2FUHB 3HM6X 4XDCA 2D3BA 2W3SA 2N7DA 3M3JA 1AYFA 2DAJA 1CJEA 3BWUD 4KIKA 3SU8X 1WM2A 1TS3A 3UINB 3LJ3A 3Q8EA 1VJKA 4KZ0A 2CHZA 2MJ3A 3FC4A 4BVUC 3X23A 3W1SC 4K3CA 1ACCA 1ENFA 4MT5A 2AEHA 1WF9A 3EFCA 2MJEA 3ZTDA 2CJNA 1C77A 3ZNZB 3U2SC 4OVVA 2PTLA 1RYJA 4A6QA 2J7QB 2JZ3B 4KKIA 4K7SA 1XLNA 3E56A 2MSED 4AWJA 2K25A 4MJSB 1N61A 1I7HA 2BYVE 2IO1B 2WLBA 3UQAA 2CR5A 1VZ7A 3RYTA 2AYOB 3DHGC 1JW9D 1V86A 4M8NA 1FEHA 1WE7A 4NJCA 1LXDA 4LNFA 5C2TB 4MH8A 5KHOA 4YTPB 3DBHI 2M8SA 4HJKA 1MG4A 3IT6B 2GLSA 1C4CA 1Z2MA 1L7YA 1J7AA 4BOSC 3ZDMC 3Q8CA 1FM0D 2CU1A 4ANUA 4ICUA 1OEYJ 1UF0A 5JHAA 3R7RA 3ECIA 2L00B 2O6VB 2W54A 1Y56A 1GJZA 3IHPC 3ZNID 2JX5A 5FR6A 1U4AA 4LNKA 1XCTL 1UGMA 4IW0A 5CX3A 2VH1A 1SJHD 2ACZB 1H8CA 1E8XA 3U7ZA 2I1KA 1FPYA 3AE1B 3OWEB 4K7WA 3NUHB 3JSVB 1BXTA 1D3ZA 1BMLC 1IGCA 4I6LB 3Q3JA 2RSUA 3QA8A 1TT5B 1DOXA 1WWTA 3DHHC 4IUMB 1PQSA 4DDID 2M19A 3AI5A 2BPSA 3RNCC 4HLEA 3PS6A 3RULA 4A3PA 5HFYA 4ZRQA 1CK1A 2BW2A 4OW0A 2NMQA 3V6CB 3VXWA 1F2RI 1GB1A 5IN7A 2QILA 5JH5C 1WR1A 2PVGC 3A4SC 2N1VA 1UNSA 4N58A 2CS4A 2IYDB 2B76B 1MG8A 1SE4A 4ACFA 2OJWA 2MA9B 4OVUA 4KSKC 3V6EB 2M0XA 3ZYYX 2RDHA 2RDBC 4GOCA 2JUOA 4I6NB 2L3ZA 3IVFA 2PVOD 1FFUA 5E6JA 2KZRA 2D2QA 4NZLB 1I4XA 3P2BA 3CWIA 4II3B 5LXHA 2KJHB 3ML9A 1A70A 2PEAA 1OQRA 3AU4A 2I1JA 2JQRB 1SE2A 5FR3A 3DWMA 2KMCA 1E90A 2ONQA 4WJOA 4LK0M 2BYFA 4RGNA 3BYTB 2N1WA 1ZOYB 2GOWA 4C7YA 4JE3B 2LVOA 2KAJA 1TS5A 1E8WA 4ZHPA 4G50A 1F2RC 5LLIA 3QARA 3H1UA 2EELA 4RF1A 1WGDA 1PGBA 1FXTB 2NPTA 3W1YA 2O6VD 2D3AA 1ET9A 3Q3NC 3ZDTA 5EE1A 2INDC 4BZAA 4GXBA 4JQWC 4OZCA 4GDLA 2C7HA 4WAAA 2WX0A 4HEA1 3DBLI 4H2AA 2KMMA 4NNJB 4C4VB 4O1NA 3V62A 2LVPA 4CQNA 3CIRB 2YEPF 3SFDB 4FLHA 2KFKB 4KSLC 1V1OA 1RFKA 2FAZA 3W1SA 5L95C 1XEEA 2J42A 2KN5A 3QWZB 1N5WA 1V9JA 2LZ6A 2ZNVC 3ENEA 3ABVB 3PREA 1FCCC 2NS5A 4MGYE 5C1ZA 2G9HD 5IA7A 3WALA 3AXCA 2WNMA 1Y8RC 3DPDA 1N63A 4DDGD 2IPKD 2L32A 4TUUA 1P1AA 2JYEA 1SBBB 4DBGA 5DPSA 1VLBA 3KYDD 1Q0WB 3SDLC 5J17A 2NTSA 1L2NA 1ZDXA 4EZKA 2V3PA 3RD2A 3ZNGC 2ZW0A 2KNBA 1R4MB 3LB8C 3GZNB 4GMVA 4DXAB 5J2RA 3AE4B 4MSQB 4IG7B 2K5PA 1HE8A 4HWIB 2K8HA 1QQRA 1FNVA 1XXGA 1I4RA 1TTNA 2DX5B 4BBNF 1A5RA 2L76A 3ZVVA 3VR8B 3KVFB 1TY2A 1WMHB 5BMIA 4P6VF 2M1MA 5CTRC 3JVZX 2KDEB 1FXIA 3TEWA 1I4HA 2KC1A 5CHVC 2ZPNA 2A5UA 2VRRB 4CHKA 3DBRI 1L4DB 2Y5CA 4RM8A 2BTEA 3OLMD 4C00A 1X1MA 2IO2B 1KJTA 2C7NB 4W9IA 4K7UA 4GSWA 2KTRA 1WFYA 1GPXA 2KDIA 5JHBA 1NENB 1CZPA 1UD7A 1IPGA 1HTQA 2W9NA 4L1BA 3R2TA 1I4PA 4F8CB 1SE3A 3RN9C 4LDTB 4EZJA 4RMAA 2ON8A 2RR9A 2ZCCA 5L83A 3I5JC 4ZHOA 3TJPA 2KXJA 1QILA 1UZXB 3SEBA 2L8JA 2LGSA 2LI5A 4WQMA 2K6DB 1B9RA 3RNAC 4FA6A 2NPTB 4A55A 3NVYA 1ZKHA 1R4NB 3PV1A 5CHFA 4FADA 4B0MA 1LGRA 3RPFC 2OOBB 2QEJC 2W82A 2BVCA 2WQYB 1P3QU 3GE3C 4BAXA 5FKAC 1UELA 4EFOA 1Z5SB 2MBBB 4B0EA 1T3QA 4WWPA 3O65B 4KGSA 3NVVA 3AV8A 1NVID 2WS3B 1C1YB 3RI7C 2QMTA 1WRDB 5DPTA 2K0PA 3QAQA 2KJ6A 3L54A 3MJ5A 5BMHA 4ASWC 2ZCBA 3C19A 3M63B 1WZ0A 3ZJVA 3DVGY 2WXFA 3X0WA 1C3TA 3VR9B 2JVCA 2NR2A 5GMVA 4B9KA 4WJNA 1NYRA 4ZRJA 1T6BX 1J8CA 2LFIA 2D10A 3NVWA 4NJ6A 4MSMB 3L4PA 2YLMA 3H7PB 1DGJA 4YXDB 1FD6A 2BWES 2PMVA 1TIFA 4HRSA 5D3DA 1VCBA 3B2FA 1XT9B 4GIVA 1LFDA 4L23A 2NCNA 3H6NA 3VTWA 2JF5A 2AQ2B 2WXRA 2ZVOA 5DCNA 1KLVA 1F77A 4DXGA 4MGIE 3JSVA 2PPHA 2MH7A 2MLBA 3L08A 1ISNA 1GG3A 3BYYB 3I63C 1TS4A 5E6OA 2UYZB 2B3AA 2RDGA 3N1YC 2L05A 1SB3C 5D2MB 4XDDA 1V5OA 4WJQA 1YN3A 3P1MA 1HXYD 4P7IA 3A33B 3NRZA 2QC8A 2MX2A 3I9V1 2WXHA 5KHQA 5AZHA 1WM3A 2LASA 1I35A 5HI1A 2ICIA 2I2YA 2KC2A 3MFGA 4IOIE 1J19A 2GBMA 3B9JA 1HA5A 3ZLZA 1S3SG 3DBHB 2N7JA 3HHMA 2XK5B 2MHJA 4X57B 4MDKE 1K50A 1WXQA 4UDUC 2IY0B 2AQ3B 4GDKB 3EA6A 3OG5A 3VH3B 3LYYA 3QHTA 2V0GA 4MACA 4DK5A 1GB4A 4JIOU 1OTRB 3WAOA 2C7MB 1WGRA 2QHOA 3MC9A 3L10B 5IOIA 2UWQA 5EE0A 2KTFA 1IYFA 2INCC 2WXGA 1HQRD 3NJTA 3Q8FA 1UUPA 2MBOA 2WXKA 2G4DB 4KKJA 2HJ8A 3EHVA 4GGQA 4XGAB 1XLPA 1EWCA 3EGRA 4BKTA 2IJ0A 2FCNA 2G1EA 4LCDE 2WU5B 2J52A 2Y3AA 1VZ8A 2JPHA 4EKUA 3J9CA 1YJJA 2LJ5A 1JWAD 3R7QA 3APFA 1JALA 3UF8A 4W9FA 1XCQL 2EKIA 2KHWB 5LNK1 1Q5WB 1OFFA 1YNTE 2W3RA 2JWZA 4M0WB 1EF5A 4URKA 2V3SA 1I42A 1V49A 4B95A 1JWUD 3FILB 3PZ7A 4HCNB 1DOYA 2OEDA 2ASQA 4C56C 4FN2A 4HXDA 2EKEC 1V1PB 3MC8A 4IC7B 2JZZA 4C4VA 1NEKB 4G0NB 1ZW7A 2NBWB 2KFKA 4FHJA 3T9LA 4N6EB 2JY6A 1K52A 2KWCA 1L6UA 3AU5A 3RNBC 4C80A 3ZXRA 4KDIC 3Q2AC 1ZUD2 2L1AA 3TEXA 1N6ZA 1Q10A 2W55A 4YSXB 1ZE3D 2Y5BB 4BKGA 1WX7A 3RMKC 2NBVB 1NDDA 1SF0A 2GBKA 2JRHA 2NVUI 3JYUA 1EU3A 3PPAA 1WGYA 3NVZA 2DNFA 2RD0A 4KZCA 1YOVB 4J6IA 2BYTA 1YJ1A 3AE6B 3D32A 2FIDA 3N1XC 2CKHB 2K3UA 4J3OD 2ZNVB 1WJNA 1OQQA 1VZ6A 1GOZA 3WANA 3OAWA 4NQKE 3AEEB 4JPSA 1L0YB 1C79A 3N20C 4KV2A 3I57A 4OHJA 2CHWA 3NHEB 5BYQA 4AQ7A 2LWPA 2CU3A 2UU7A 1BUIC 5G5GA 2WXLA 4YL8A 4KDLB 2OJRA 5G2NA 4US9A 3W5UB 2N0SB 3DOWA 2EMSA 3B2GA 3ML8A 3HIZA 1E8YA 4N59A 1NI2A 1WMHA 1M94A 4WJPA 1YX6B 4JLCA 3W2DA 2KFJA 3DBLB 4US8A 1YJIA 2X8XX 1NBFC 4LNOA 2WXMA 1SEBD 1YD8U 1BT0A 1WSPA 3H8HA 3ZRFA 3GP7A 4XZ4A 2MRPA 2ZZPB 3DDCB 2QDFA 4EUTA 3AE7B 1HZ5A 4MM3B 3U52E 4M01A 1PGAA 2LVQA 1PDXA 3T3NA 2SAKA 2Z8LA 3DBSA 3A9JA 4GLSC 3IXSA 1ESFA 4MGKE 1EU4A 3HVZA 3GB1A 2R2OA 4II2B 2KDFB 4WH4A 3K9PB 1FIQA 5H92C 4DHJB 3KQ4A 1T5XD 3CF6E 3GE8C 2N9PC 1S1QB 2KVZA 3AE8B 1GC6A 4Q2JA 1T0RC 2WP9B 3KUZA 4L2YA 4R3DA 2ZPYA 1UWMA 1ZDVA 2LUEA 1UGJA 2XN9C 2INNE 3AM9A 5CHWA 1B1ZA 3KLSX 4JWUC 1N62A 4WWMA 4FJZA 1KH0A 4PS7A 4HK2A 2KK8A 3VAWA 4PK1A 1LO5D 3PO0A 3Q3FA 3DVNU 4AUQC 1QF6A 2LXCA 4NAMA 1WYWB 2PLPA 3P4RB 1QKZA 3B08A 4CYEA 2M0AA 3VFKA 1YX5B 4RNAA 2DZMA 4LNNA 4IWQA 2X38A 3APDA 2GI9A 4M8MA 2N9EB 2J0KA 4LJPB 2QCZA 1PGXA 1TZOA 1YQ3B 4GU2A 2KWVB 3A1QB 3DBRB 4YSZB 1LM8B 2WDRB 1MHXA 2SEBD 2WU2B 3N9YC 4ICVA 5D6JB 1E9MA 1P9DU 2DYOA 3H7PA 1TYGB 4W9GA 2K8BA 3L17A 4S0RA 2IY1B 3QCAA 3TEYA 3TBLD 2D11A 1AW7A 4JX1C 1I4GA 3BIID 5IO9A 1UH6A 2Z0DB 3O13A 3RFZB 4AOFA 2CJOA 3BY4B 2FCSA 2KX3A 3W5VB 2RMMA 3TMPB 1SIFA 3VHTC 3AEFB 4EOYA 4CO7A 3Q3MC 4HVBA 2PE6B 4PS8A 2KX0A 5G55A 4RGOS 5IP4D 2KN4A 2WHIA 1MFWA 2H88B 3VH4B 2HJ1A 4FJYA 3DWGC 3KW5B 2ZVNA 2M17A 4WWNA 2KWDA 1KRHA 3IFWB 4G11A 3SD5A 1WXVA 2VZKB 4DQOC 5C23A 3ZJUA 3NG0A 5D3IB 2N9XA 3P4PB 2IBIB 4HPLB 1ZXHA 2KD0A 2KYWA 4B6WA 1F9JA 1GNUA 2WDQB 3KWVA 3KYCD 2KACA 3M62B 3ZRCA 4TKNA 2RGFA 1HTOA 3BZDB 4DHJD 1JRUA 3NY5A 1ZXIA 1WGKA 1WGHA 2XK5A 2KJRA 1OEYA 2IDYA 2VH2A 3A9JB 4HDQA 4GDKA 2BYEA 3V61A 1RM6C 1LQBA 1V5TA 2HE7A 2I38A 1PYWD 3HRDD 2KDBA 1E0ZA 2DAFA 3IT4B 3IBEA 4RCOA 4S17A 3KUDB 3EUB2 4DHZE 2LMCA 2FNJB 3W9CB 1C4AA 4ZRKA 2A4ZA 3BK2A 1QLBB 3C8YA 1D6EC 1IGDA 1V8CA 2V4LA 3AMZA 1YMHE 2DWQA 1KF6B 3V3XA 4WIPA 3A4RA 1FMAD 2BT6A 1Q1OA 1TBEA 4PYUA 1ROEA 2M4NA 3Q69A 1E7UA 4WURA 1MVKA 4M0WA 4YT0B 2GBNA 2WXNA 2MCNB 2K8CA 1NI3A 3FILA 3KH0A 3SFEB 2WXOA 2LHEA 3PRMB 5J18A 1WY8A 1J0GA 2C5LC 2WYQA 1HEZE 1QOAA 1V1PA 3EECA 4E74A 2G45B 3WIMA 1MJDA 1TS2A 2XNAC 4NY0A 4MELA 4ZOHC 2JWUA 2TSSA 3P42A 3PRZA 4IWOA 5EDSA 3AEAB 2HDEA 1VR9A 4AJYB 2IO3B 5E6NA 5H8YE 5E6PA 2PIAA 2L0FA 4TMAB 2VZKD 2PW9A 2GB1A 1C78A 3QQ8B 2MEKA 4W9CA 2QSDA 3AECB 2O2VB 1E7VA 3QK0A 3U4EG 4EEWA 3R66C 2LRWA 4N9F4 3ZGZA 1V81A 3L13A 3ZQ4A 3Q8BA 3C0RB 5IKCM 1P0RA 1WJ6A 3TSSA 3FAHA 2NBUA 2N7EA 1EM7A 5T8IA 5AZGA 1T0QC 4LDTD 3B0AA 4WWOA 1D5XC 2J0JA 3PZ8A 4GN1A 3R8BA 4TQ0A 3B1LX 4A20A 1FO4A 3PVLA 1QOGA 2RPVA 1J7CA 3OJ3A 2IO0B 1IBXA 2J0MA 2MBHA 3DCGA 4DWFA 3VRAB 3CSFA 2DHZA 3N1ZC 5FK9C 1V80A 1GAQB 1FRRA 3A9KA 3N3KB 2FIFA 3M95A 4HDOA 3VUXA 1UBIA 1FCLA 3L0WB 4FHKA 4E71A 3PHXB 4JGHB 1OQYA 3RNEC 3VQIA 3U30A 2BB6A 3GOEA 3MHZA 1R7SA 4A9AA 1V6EA 4JL9A 5TSSA 1FFVA 3TUOA 3JW0X 4NAWA 1P98A 1WRIA 1CQVA 1YQBA 2ZEQA 2WWZA 4IM2A 4WQOB 1YN5A 1JWMD 1IP9A 3DQVA 2EMTA 3IAS1 4W9DA 1KOTA 4YSYB 1SIJA 2L83A 3T8MA 3TEZA 4WAFA 3R3MA 3NZSA 4MM3A 4D2KA 3NZUA 2LJIA 3IG3A 4KVGB 4BFRA 2BS4B 3AULA 3VDZA 1M4VA 4QAYA 2KT7A 4IM0A 1D5ZC 4KGRA 1DYQA 4W9JA 1WXAA 3AE9B 2JXXA 1MI0A 1KM7A 3K9OB 3MHSD 2G4SA 3EFUA 1EUVB 4RM9A 5AUIA 1JRPA 2GMIC 3V60A 5DPWA 4F7ZA 3EC8A 1WR6E 2C9WB 4G3XB 1VD2A 1VDVA 1JROA 1WE6A 2GRIA 4YTNB 2HTHA 2ZJDA 3UI3A 2CHXA 1AARA 1WX8A 1WH3A 2RPQA 3MTNB 2XBBC 1H4RA 1WXMA 4TQ1A 3ZNHB 1JQ4A 2M56B 3AEBB 4IWPA 1WI0A 3E9SA 2Z59B 2Q5WD 4PT5A 4HKQA 3U7DA 1L5PA 3WCQA 2DBYA 1D5MC 1E5WA 1JWSD 2V9HA 2MP2B 1YIWA 4EZLA 1WX9A 2LRUA 2WDVB 1E10A 2JSVX 3AN1A 4K3BA 4JWSC 2LEKA 4YWGG 2FUG1 1G6JA 3TL5A 4A90A 2KQ7A 3RT3B 3ZO5B 3MP9A 3A1QA 1SGHA 1WYGA 1L4ZB 4HPPA 3PT2B 4FBJB 3TIXA 2WXJA 4HKZE 1EF1A 4OZAA 4KX6B 5GXGB 2ZW1A 2KANA 2FE8A 3DVNV 2INPE 2JZPA 1GC7A 2LUMA 3U8ZA 1XLOA 3HUIA 2V1YA 2KDMA 3QIJA 2KO3A 3UQBA 3ETRA 3ZXVA 4ANWA 2LGYA 2DYMA 4K81A 1IBXB 3UIPB 5MPOA 1PFDA 2JYTA 4XE0A 4LTUA 3AH7A 2D07B 5JZEB 1YQ4B 2KOXA 3A9KB 4BOZB 2KQSA 4ITKA 3NS8A 3P4SB 1CMXB 2MBEA 3VVWB 2LGIA 3R2IA 1EWYC 1TY0A 2KWUB 3QX1A 1MHHE 2Z0EB 4BKSD 3PTFC 5HHDG 4A3OA 1WJUA 2LGXA 2JT4B 2N9KA 1FNWA 4ZYSA 1E7PB 4FXCA 4NAWB 2K9XA 1TKYA 4BBNC 1DOIA 1KTKA 4W9LA
chains in the Genus database with same CATH topology
3TMPB 3X0WA 1SIFA 3VHTC 1C3TA 2LGDA 2MSED 4AWJA 2JVCA 2K25A 4MJSB 2NR2A 5GMVA 4B9KA 4WJNA 4CO7A 4EOYA 2PJHA 4ZRJA 1J8CA 3RZFA 2BYVE 2IO1B 2D10A 2WX1A 1OGWA 4HVBA 1RFAA 2PE6B 4KIKB 3UQAA 4NJ6A 4PS8A 3RZWC 2CR5A 2KX0A 4MSMB 5G55A 3RYTA 2AYOB 2YLMA 3H7PB 3LDZE 1V86A 1WJ4A 4M8NA 2BWES 1WE7A 4TV3A 3VH4B 2DZIA 4FJYA 1LXDA 3KW5B 2ZVNA 2M17A 4WWNA 5KHOA 1VCBA 2M8SA 3DBHI 1XT9B 4HJKA 3MJWA 3IFWB 4GIVA 1LFDA 4G11A 2C60A 3SD5A 2NCNA 3H6NA 4NPNA 1WXVA 3VTWA 1Z2MA 5C23A 2LD9A 2JF5A 2N9XA 2ZVOA 1L7YA 1WZ3A 2D3GA 4BOSC 3SHQA 3ZDMC 2IBIB 4HPLB 5DCNA 1KLVA 2GBRA 2CU1A 2KD0A 4ANUA 3DVGX 4MGIE 4ICUA 1OEYJ 4B6WA 4ZDVA 3JSVA 1F9JA 1GNUA 2PPHA 5JHAA 3R7RA 3KYCD 3M62B 3ECIA 2MLBA 3L08A 4TKNA 3ZRCA 2L00B 1ISNA 1GG3A 2AL6A 2O6VB 2RGFA 3ZIMA 4DHJD 1WGGA 1JRUA 3NY5A 5E6OA 2UYZB 1GJZA 2B3AA 3IHPC 3ZNID 1WGHA 4HPMB 2L05A 2XK5A 2KJRA 3WAPA 5FR6A 5D2MB 1OEYA 1U4AA 1V5OA 4WJQA 1UGMA 4HDQA 3A9JB 4IW0A 3HM3A 4GDKA 2BYEA 5CX3A 3V61A 2MQJA 3PGEA 4P7IA 1LQBA 1V5TA 3A33B 2MX2A 2HE7A 1XQQA 5KHQA 1H8CA 3RUIB 1E8XA 5AZHA 2I1KA 2KDBA 1WM3A 2DAFA 2LASA 3IBEA 1I35A 4ZYNA 4K7WA 3JSVB 2KC2A 3KUDB 1QZEA 3VUYA 1D3ZA 4DHZE 1RRBA 1ZGUB 2FNJB 4ZRKA 1J19A 2GBMA 3Q3JA 4I6LB 2RSUA 2KMAA 2A4ZA 3ZLZA 1S3SG 2BKRB 3QA8A 3ALBA 3HHMA 2XK5B 4X57B 4IUMB 2GBJA 1PQSA 4MDKE 2V4LA 4DDID 2IY0B 2BPSA 3AI5A 4HLEA 3PS6A 4GDKB 2MBQA 3VH3B 3RULA 2PE9A 3QHTA 4A3PA 4PYZA 3A4RA 3QJZA 4DK5A 1Q1OA 1TBEA 1OTRB 4JIOU 3V6CB 3VXWA 4PYUA 3WAOA 2C7MB 1WGRA 3ZW3A 2M4NA 2QHOA 5JH5C 1E7UA 3L10B 1WR1A 1V2YA 3A4SC 3H7SA 2N1VA 2GBNA 2UWQA 2MCNB 2KTFA 2K8CA 1IYFA 2CS4A 2IYDB 1MG8A 2MBOA 3KH0A 3ZKJC 2G4DB 2MA9B 3KUCB 3PRMB 5J18A 2AWTA 2HJ8A 3EHVA 4GGQA 4OVUA 4XX5A 1WY8A 1J0GA 4KSKC 3V6EB 2M0XA 4GB9A 4BKTA 2C5LC 2FCNA 4GOCA 4LCDE 2WYQA 2JUOA 4I6NB 3WAMA 2L3ZA 3IVFA 1GUAB 4MEMA 3EECA 2JPHA 4E74A 5IAAC 4EKUA 2XEWA 2LJ5A 2G45B 3WIMA 3R7QA 3APFA 2KZRA 2REXA 3UF8A 2D2QA 1K8RB 4NY0A 2MWSB 2KHWB 4W9FA 3TCAA 3VTVA 4MELA 3P2BA 4II3B 5AZFA 1Q5WB 2O2VA 3N30A 3NOBA 5LXHA 2KJHB 2JWZA 4M0WB 3ML9A 1EF5A 2PEAA 3AU4A 2V3SA 4URKA 2I1JA 1I42A 1V49A 3UGBB 4B95A 5DPRA 3PRZA 2KMCA 1E90A 4IWOA 4WJOA 5EDSA 4HCNB 3OJ4B 1EO6A 2ASQA 2KLCA 4AJYB 2BYFA 3PHWB 2BKFA 3VUWA 2IO3B 2N1WA 4FN2A 4HXDA 5E6NA 5E6PA 2EKEC 2GOWA 2HD5B 2L0FA 4IC7B 2JZZA 3BINA 2LVOA 4HCPB 2KVRA 3CSTA 4G0NB 1E8WA 1ZW7A 1RAXA 4G50A 3QQ8B 2NBWB 2BF8B 5LLIA 4W9CA 2KFKA 3PRPB 2O2VB 1E7VA 4FHJA 3QARA 3QK0A 2JY6A 3H1UA 3T9LA 1TZ1A 2KWCA 2FCMA 3AU5A 3R66C 2LRWA 1WXSA 3I3TB 4N9F4 4EEWA 4E3CA 1V81A 1WGDA 3L13A 4KDIC 4W9KA 1FXTB 2NPTA 3C0RB 1P0RA 1WJ6A 2O6VD 3W1YA 2NBUA 2N7EA 5AZGA 3ZDTA 4GXBA 2Y5BB 4FULA 4LDTD 3B0AA 4BKGA 4WWOA 3S2AA 2J0JA 4GN1A 1WX7A 4JQWC 4TQ0A 4GDLA 2C7HA 3B1LX 4MGZE 4A20A 3PVLA 4WAAA 2WX0A 2NBVB 1NDDA 2KKCA 4NJ7A 3ZTCA 4NQLB 1R4MI 3GZNI 2GBKA 3DBLI 5TR5A 3OJ3A 2JRHA 2NVUI 3JYUA 1RLFA 4NNJB 3V62A 3PPAA 2IO0B 1WGYA 2J0MA 2LVPA 2MBHA 3DCGA 4DWFA 3CSFA 3WA0A 4BKSA 5HKHA 2RD0A 4FLHA 4KZCA 2DHZA 2MW5A 4J6IA 2KFKB 4KSLC 1YJ1A 3VUXA 1V80A 3A9KA 3N3KB 4HDOA 4ANVA 2FIFA 3M95A 1UBIA 3D32A 2FAZA 2FIDA 3W1SA 4FJVB 5L95C 2CKHB 2ZNVB 1WJNA 3L0WB 4FHKA 2KN5A 3QWZB 3WANA 2BGFA 3OAWA 1V9JA 4E71A 2LZ6A 2ZNVC 3ENEA 4NQKE 4ANXA 3PHXB 5AEKB 3PREA 2BWFA 2NS5A 4JGHB 4MGYE 4IM3A 1OQYA 5C1ZA 5IA7A 4KV2A 3VQIA 4GDLB 3WALA 3U30A 3GOEA 3AXCA 2IZVB 1XD3B 2CHWA 1V6EA 4JL9A 3NHEB 3JW0X 4NAWA 1Y8RC 2LWPA 3DPDA 1P98A 1YQBA 3CMMB 3PLUA 4DDGD 2ZEQA 3PZDA 4YL8A 3N32A 4TUUA 4MJSA 4BBNC 4KDLB 2L7RA 2WWZA 2OJRA 5G2NA 4IM2A 1P1AA 4WQOB 1IP9A 3DQVA 2EMTA 2LXAA 3DOWA 4W9DA 4DBGA 1KOTA 5DPSA 2EMSA 3T8MA 3ML8A 5BO4B 3HIZA 1E8YA 3R3MA 3KYDD 3NZSA 1Q0WB 3SDLC 4MM3A 5J17A 3NZUA 1NI2A 1WMHA 1L2NA 1E8ZA 1M94A 3IG3A 3HK0A 4WJPA 4EZKA 4KVGB 2JRIB 1YX6B 3RD2A 5D7GA 4JLCA 4BFRA 3AULA 3ZNGC 3VDZA 1SE9A 3PSEB 2R2QA 2AL3A 2KFJA 2YVCA 4IM0A 2KNBA 4GMVA 4DXAB 5J2RA 4W9JA 1WXAA 4MSQB 2JXXA 1WIAA 1KM7A 3K9OB 4IG7B 3MHSD 2G4SA 3EFUA 1EUVB 1HE8A 4RM9A 1NBFC 1YD8U 1BT0A 2GMIC 2MP2A 3APCA 3V60A 4AJWA 5DPWA 3ZRFA 4HWIB 4F7ZA 2K8HA 3EC8A 1WR6E 2C9WB 4XZ4A 4G3XB 2MRPA 1VD2A 5D94A 2ZZPB 1TTNA 2DENB 3DDCB 2DX5B 4BBNF 3VTUA 4XC2A 2O6VA 1A5RA 2L76A 1R4NI 1WE6A 3ZVVA 4EUTA 4F1SA 3RCZA 2HTHA 2ZJDA 2CHXA 1AARA 3KVFB 1WMHB 1WX8A 1WH3A 2LVQA 2RPQA 2M1MA 2FCQA 3MTNB 5CTRC 2XBBC 1H4RA 2KLGA 3JVZX 2KDEB 2N4FA 1WXMA 4TQ1A 3DBSA 2KC1A 5CHVC 3A9JA 3ZNHB 4IWPA 2G3QB 2ZPNA 2A5UA 1WI0A 2VRRB 3DBRI 4CHKA 4RM8A 4K1RB 4MGKE 3OLMD 2Z59B 4ZRIA 1X1MA 3U7DA 2R2OA 4II2B 2KDFB 2IO2B 3K9PB 1KJTA 2C7NB 4W9IA 4K7UA 1E5WA 1T0YA 4GSWA 2KTRA 4DHJB 3H9DA 1WFYA 3CF6E 1UBQA 2KDIA 2MP2B 1YIWA 2N9PC 5JHBA 1S1QB 1UD7A 1IPGA 1GC6A 4EZLA 3UIOB 2W9NA 3KUZA 1WX9A 2LRUA 2ZPYA 2LUEA 4F8CB 1G6JA 3TL5A 2K6QA 2KQ7A 3RT3B 4LDTB 2L0TA 5CHWA 4EZJA 4RMAA 3ZO5B 3A1QA 3L16A 2RR9A 1SGHA 2ZCCA 5L83A 4FJZA 4PS7A 4HK2A 2KK8A 4W9EA 3VAWA 2DYBA 3PT2B 3TJPA 3Q3FA 3DVNU 4FBJB 4AUQC 3TIXA 2KXJA 2DZJA 1UZXB 2LXCA 4PS3A 1WYWB 1EF1A 2L8JA 2LI5A 4AP4C 4LJOB 2KTRB 3QC8B 2K6DB 3B08A 4W9HA 2KANA 4CYEA 5LXIB 2WDTB 3PLVA 3VFKA 4FA6A 1YX5B 2NPTB 3DVNV 1ZKHA 4MH0E 2DZMA 2DZKA 3ONSA 3ZUNA 3PV1A 1GC7A 5CHFA 3U8ZA 4I6PA 4IWQA 4DHZB 2V1YA 3APDA 2K1FA 4FADA 1TGZB 4M8MA 2N9EB 2J0KA 4LJPB 3QIJA 2KO3A 3UQBA 2K39A 4ANWA 2OOBB 2LGYA 2FUHB 2DYMA 2KWVB 3A1QB 4GU2A 3HM6X 4K81A 1P3QU 2N7DA 3UIPB 1UELA 3M3JA 2DAJA 1LM8B 1Z5SB 2MBBB 4EFOA 2D07B 4WWPA 4KIKA 5JZEB 2KOXA 3A9KB 3O65B 4BOZB 3SU8X 1WM2A 4ICVA 5D6JB 2KQSA 3LJ3A 1P9DU 2DYOA 3H7PA 3NS8A 1CMXB 2MBEA 3UINB 3VVWB 4KZ0A 2CHZA 4W9GA 1C1YB 2KWUB 2K8BA 3L17A 3QX1A 3X23A 3W1SC 4BVUC 2IY1B 2Z0EB 3QCAA 4BKSD 1WRDB 3TBLD 5DPTA 2D11A 2KJ6A 3PTFC 3QAQA 2AEHA 1WF9A 4A3OA 3L54A 1WJUA 3ZTDA 2LGXA 2JT4B 1UH6A 3ZNZB 2Z0DB 4ASWC 2ZCBA 4OVVA 4AOFA 2J7QB 2JZ3B 4K7SA 3BY4B 2FCSA 3M63B 4NAWB 1WZ0A 2KX3A 3DVGY 4W9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TMP B;  3X0W A;  1SIF A;  3VHT C;  1C3T A;  2LGD A;  2MSE D;  4AWJ A;  2JVC A;  2K25 A;  4MJS B;  2NR2 A;  5GMV A;  4B9K A;  4WJN A;  4CO7 A;  4EOY A;  2PJH A;  4ZRJ A;  1J8C A;  3RZF A;  2BYV E;  2IO1 B;  2D10 A;  2WX1 A;  1OGW A;  4HVB A;  1RFA A;  2PE6 B;  4KIK B;  3UQA A;  4NJ6 A;  4PS8 A;  3RZW C;  2CR5 A;  2KX0 A;  4MSM B;  5G55 A;  3RYT A;  2AYO B;  2YLM A;  3H7P B;  3LDZ E;  1V86 A;  1WJ4 A;  4M8N A;  2BWE S;  1WE7 A;  4TV3 A;  3VH4 B;  2DZI A;  4FJY A;  1LXD A;  3KW5 B;  2ZVN A;  2M17 A;  4WWN A;  5KHO A;  1VCB A;  2M8S A;  3DBH I;  1XT9 B;  4HJK A;  3MJW A;  3IFW B;  4GIV A;  1LFD A;  4G11 A;  2C60 A;  3SD5 A;  2NCN A;  3H6N A;  4NPN A;  1WXV A;  3VTW A;  1Z2M A;  5C23 A;  2LD9 A;  2JF5 A;  2N9X A;  2ZVO A;  1L7Y A;  1WZ3 A;  2D3G A;  4BOS C;  3SHQ A;  3ZDM C;  2IBI B;  4HPL B;  5DCN A;  1KLV A;  2GBR A;  2CU1 A;  2KD0 A;  4ANU A;  3DVG X;  4MGI E;  4ICU A;  1OEY J;  4B6W A;  4ZDV A;  3JSV A;  1F9J A;  1GNU A;  2PPH A;  5JHA A;  3R7R A;  3KYC D;  3M62 B;  3ECI A;  2MLB A;  3L08 A;  4TKN A;  3ZRC A;  2L00 B;  1ISN A;  1GG3 A;  2AL6 A;  2O6V B;  2RGF A;  3ZIM A;  4DHJ D;  1WGG A;  1JRU A;  3NY5 A;  5E6O A;  2UYZ B;  1GJZ A;  2B3A A;  3IHP C;  3ZNI D;  1WGH A;  4HPM B;  2L05 A;  2XK5 A;  2KJR A;  3WAP A;  5FR6 A;  5D2M B;  1OEY A;  1U4A A;  1V5O A;  4WJQ A;  1UGM A;  4HDQ A;  3A9J B;  4IW0 A;  3HM3 A;  4GDK A;  2BYE A;  5CX3 A;  3V61 A;  2MQJ A;  3PGE A;  4P7I A;  1LQB A;  1V5T A;  3A33 B;  2MX2 A;  2HE7 A;  1XQQ A;  5KHQ A;  1H8C A;  3RUI B;  1E8X A;  5AZH A;  2I1K A;  2KDB A;  1WM3 A;  2DAF A;  2LAS A;  3IBE A;  1I35 A;  4ZYN A;  4K7W A;  3JSV B;  2KC2 A;  3KUD B;  1QZE A;  3VUY A;  1D3Z A;  4DHZ E;  1RRB A;  1ZGU B;  2FNJ B;  4ZRK A;  1J19 A;  2GBM A;  3Q3J A;  4I6L B;  2RSU A;  2KMA A;  2A4Z A;  3ZLZ A;  1S3S G;  2BKR B;  3QA8 A;  3ALB A;  3HHM A;  2XK5 B;  4X57 B;  4IUM B;  2GBJ A;  1PQS A;  4MDK E;  2V4L A;  4DDI D;  2IY0 B;  2BPS A;  3AI5 A;  4HLE A;  3PS6 A;  4GDK B;  2MBQ A;  3VH3 B;  3RUL A;  2PE9 A;  3QHT A;  4A3P A;  4PYZ A;  3A4R A;  3QJZ A;  4DK5 A;  1Q1O A;  1TBE A;  1OTR B;  4JIO U;  3V6C B;  3VXW A;  4PYU A;  3WAO A;  2C7M B;  1WGR A;  3ZW3 A;  2M4N A;  2QHO A;  5JH5 C;  1E7U A;  3L10 B;  1WR1 A;  1V2Y A;  3A4S C;  3H7S A;  2N1V A;  2GBN A;  2UWQ A;  2MCN B;  2KTF A;  2K8C A;  1IYF A;  2CS4 A;  2IYD B;  1MG8 A;  2MBO A;  3KH0 A;  3ZKJ C;  2G4D B;  2MA9 B;  3KUC B;  3PRM B;  5J18 A;  2AWT A;  2HJ8 A;  3EHV A;  4GGQ A;  4OVU A;  4XX5 A;  1WY8 A;  1J0G A;  4KSK C;  3V6E B;  2M0X A;  4GB9 A;  4BKT A;  2C5L C;  2FCN A;  4GOC A;  4LCD E;  2WYQ A;  2JUO A;  4I6N B;  3WAM A;  2L3Z A;  3IVF A;  1GUA B;  4MEM A;  3EEC A;  2JPH A;  4E74 A;  5IAA C;  4EKU A;  2XEW A;  2LJ5 A;  2G45 B;  3WIM A;  3R7Q A;  3APF A;  2KZR A;  2REX A;  3UF8 A;  2D2Q A;  1K8R B;  4NY0 A;  2MWS B;  2KHW B;  4W9F A;  3TCA A;  3VTV A;  4MEL A;  3P2B A;  4II3 B;  5AZF A;  1Q5W B;  2O2V A;  3N30 A;  3NOB A;  5LXH A;  2KJH B;  2JWZ A;  4M0W B;  3ML9 A;  1EF5 A;  2PEA A;  3AU4 A;  2V3S A;  4URK A;  2I1J A;  1I42 A;  1V49 A;  3UGB B;  4B95 A;  5DPR A;  3PRZ A;  2KMC A;  1E90 A;  4IWO A;  4WJO A;  5EDS A;  4HCN B;  3OJ4 B;  1EO6 A;  2ASQ A;  2KLC A;  4AJY B;  2BYF A;  3PHW B;  2BKF A;  3VUW A;  2IO3 B;  2N1W A;  4FN2 A;  4HXD A;  5E6N A;  5E6P A;  2EKE C;  2GOW A;  2HD5 B;  2L0F A;  4IC7 B;  2JZZ A;  3BIN A;  2LVO A;  4HCP B;  2KVR A;  3CST A;  4G0N B;  1E8W A;  1ZW7 A;  1RAX A;  4G50 A;  3QQ8 B;  2NBW B;  2BF8 B;  5LLI A;  4W9C A;  2KFK A;  3PRP B;  2O2V B;  1E7V A;  4FHJ A;  3QAR A;  3QK0 A;  2JY6 A;  3H1U A;  3T9L A;  1TZ1 A;  2KWC A;  2FCM A;  3AU5 A;  3R66 C;  2LRW A;  1WXS A;  3I3T B;  4N9F 4;  4EEW A;  4E3C A;  1V81 A;  1WGD A;  3L13 A;  4KDI C;  4W9K A;  1FXT B;  2NPT A;  3C0R B;  1P0R A;  1WJ6 A;  2O6V D;  3W1Y A;  2NBU A;  2N7E A;  5AZG A;  3ZDT A;  4GXB A;  2Y5B B;  4FUL A;  4LDT D;  3B0A A;  4BKG A;  4WWO A;  3S2A A;  2J0J A;  4GN1 A;  1WX7 A;  4JQW C;  4TQ0 A;  4GDL A;  2C7H A;  3B1L X;  4MGZ E;  4A20 A;  3PVL A;  4WAA A;  2WX0 A;  2NBV B;  1NDD A;  2KKC A;  4NJ7 A;  3ZTC A;  4NQL B;  1R4M I;  3GZN I;  2GBK A;  3DBL I;  5TR5 A;  3OJ3 A;  2JRH A;  2NVU I;  3JYU A;  1RLF A;  4NNJ B;  3V62 A;  3PPA A;  2IO0 B;  1WGY A;  2J0M A;  2LVP A;  2MBH A;  3DCG A;  4DWF A;  3CSF A;  3WA0 A;  4BKS A;  5HKH A;  2RD0 A;  4FLH A;  4KZC A;  2DHZ A;  2MW5 A;  4J6I A;  2KFK B;  4KSL C;  1YJ1 A;  3VUX A;  1V80 A;  3A9K A;  3N3K B;  4HDO A;  4ANV A;  2FIF A;  3M95 A;  1UBI A;  3D32 A;  2FAZ A;  2FID A;  3W1S A;  4FJV B;  5L95 C;  2CKH B;  2ZNV B;  1WJN A;  3L0W B;  4FHK A;  2KN5 A;  3QWZ B;  3WAN A;  2BGF A;  3OAW A;  1V9J A;  4E71 A;  2LZ6 A;  2ZNV C;  3ENE A;  4NQK E;  4ANX A;  3PHX B;  5AEK B;  3PRE A;  2BWF A;  2NS5 A;  4JGH B;  4MGY E;  4IM3 A;  1OQY A;  5C1Z A;  5IA7 A;  4KV2 A;  3VQI A;  4GDL B;  3WAL A;  3U30 A;  3GOE A;  3AXC A;  2IZV B;  1XD3 B;  2CHW A;  1V6E A;  4JL9 A;  3NHE B;  3JW0 X;  4NAW A;  1Y8R C;  2LWP A;  3DPD A;  1P98 A;  1YQB A;  3CMM B;  3PLU A;  4DDG D;  2ZEQ A;  3PZD A;  4YL8 A;  3N32 A;  4TUU A;  4MJS A;  4BBN C;  4KDL B;  2L7R A;  2WWZ A;  2OJR A;  5G2N A;  4IM2 A;  1P1A A;  4WQO B;  1IP9 A;  3DQV A;  2EMT A;  2LXA A;  3DOW A;  4W9D A;  4DBG A;  1KOT A;  5DPS A;  2EMS A;  3T8M A;  3ML8 A;  5BO4 B;  3HIZ A;  1E8Y A;  3R3M A;  3KYD D;  3NZS A;  1Q0W B;  3SDL C;  4MM3 A;  5J17 A;  3NZU A;  1NI2 A;  1WMH A;  1L2N A;  1E8Z A;  1M94 A;  3IG3 A;  3HK0 A;  4WJP A;  4EZK A;  4KVG B;  2JRI B;  1YX6 B;  3RD2 A;  5D7G A;  4JLC A;  4BFR A;  3AUL A;  3ZNG C;  3VDZ A;  1SE9 A;  3PSE B;  2R2Q A;  2AL3 A;  2KFJ A;  2YVC A;  4IM0 A;  2KNB A;  4GMV A;  4DXA B;  5J2R A;  4W9J A;  1WXA A;  4MSQ B;  2JXX A;  1WIA A;  1KM7 A;  3K9O B;  4IG7 B;  3MHS D;  2G4S A;  3EFU A;  1EUV B;  1HE8 A;  4RM9 A;  1NBF C;  1YD8 U;  1BT0 A;  2GMI C;  2MP2 A;  3APC A;  3V60 A;  4AJW A;  5DPW A;  3ZRF A;  4HWI B;  4F7Z A;  2K8H A;  3EC8 A;  1WR6 E;  2C9W B;  4XZ4 A;  4G3X B;  2MRP A;  1VD2 A;  5D94 A;  2ZZP B;  1TTN A;  2DEN B;  3DDC B;  2DX5 B;  4BBN F;  3VTU A;  4XC2 A;  2O6V A;  1A5R A;  2L76 A;  1R4N I;  1WE6 A;  3ZVV A;  4EUT A;  4F1S A;  3RCZ A;  2HTH A;  2ZJD A;  2CHX A;  1AAR A;  3KVF B;  1WMH B;  1WX8 A;  1WH3 A;  2LVQ A;  2RPQ A;  2M1M A;  2FCQ A;  3MTN B;  5CTR C;  2XBB C;  1H4R A;  2KLG A;  3JVZ X;  2KDE B;  2N4F A;  1WXM A;  4TQ1 A;  3DBS A;  2KC1 A;  5CHV C;  3A9J A;  3ZNH B;  4IWP A;  2G3Q B;  2ZPN A;  2A5U A;  1WI0 A;  2VRR B;  3DBR I;  4CHK A;  4RM8 A;  4K1R B;  4MGK E;  3OLM D;  2Z59 B;  4ZRI A;  1X1M A;  3U7D A;  2R2O A;  4II2 B;  2KDF B;  2IO2 B;  3K9P B;  1KJT A;  2C7N B;  4W9I A;  4K7U A;  1E5W A;  1T0Y A;  4GSW A;  2KTR A;  4DHJ B;  3H9D A;  1WFY A;  3CF6 E;  1UBQ A;  2KDI A;  2MP2 B;  1YIW A;  2N9P C;  5JHB A;  1S1Q B;  1UD7 A;  1IPG A;  1GC6 A;  4EZL A;  3UIO B;  2W9N A;  3KUZ A;  1WX9 A;  2LRU A;  2ZPY A;  2LUE A;  4F8C B;  1G6J A;  3TL5 A;  2K6Q A;  2KQ7 A;  3RT3 B;  4LDT B;  2L0T A;  5CHW A;  4EZJ A;  4RMA A;  3ZO5 B;  3A1Q A;  3L16 A;  2RR9 A;  1SGH A;  2ZCC A;  5L83 A;  4FJZ A;  4PS7 A;  4HK2 A;  2KK8 A;  4W9E A;  3VAW A;  2DYB A;  3PT2 B;  3TJP A;  3Q3F A;  3DVN U;  4FBJ B;  4AUQ C;  3TIX A;  2KXJ A;  2DZJ A;  1UZX B;  2LXC A;  4PS3 A;  1WYW B;  1EF1 A;  2L8J A;  2LI5 A;  4AP4 C;  4LJO B;  2KTR B;  3QC8 B;  2K6D B;  3B08 A;  4W9H A;  2KAN A;  4CYE A;  5LXI B;  2WDT B;  3PLV A;  3VFK A;  4FA6 A;  1YX5 B;  2NPT B;  3DVN V;  1ZKH A;  4MH0 E;  2DZM A;  2DZK A;  3ONS A;  3ZUN A;  3PV1 A;  1GC7 A;  5CHF A;  3U8Z A;  4I6P A;  4IWQ A;  4DHZ B;  2V1Y A;  3APD A;  2K1F A;  4FAD A;  1TGZ B;  4M8M A;  2N9E B;  2J0K A;  4LJP B;  3QIJ A;  2KO3 A;  3UQB A;  2K39 A;  4ANW A;  2OOB B;  2LGY A;  2FUH B;  2DYM A;  2KWV B;  3A1Q B;  4GU2 A;  3HM6 X;  4K81 A;  1P3Q U;  2N7D A;  3UIP B;  1UEL A;  3M3J A;  2DAJ A;  1LM8 B;  1Z5S B;  2MBB B;  4EFO A;  2D07 B;  4WWP A;  4KIK A;  5JZE B;  2KOX A;  3A9K B;  3O65 B;  4BOZ B;  3SU8 X;  1WM2 A;  4ICV A;  5D6J B;  2KQS A;  3LJ3 A;  1P9D U;  2DYO A;  3H7P A;  3NS8 A;  1CMX B;  2MBE A;  3UIN B;  3VVW B;  4KZ0 A;  2CHZ A;  4W9G A;  1C1Y B;  2KWU B;  2K8B A;  3L17 A;  3QX1 A;  3X23 A;  3W1S C;  4BVU C;  2IY1 B;  2Z0E B;  3QCA A;  4BKS D;  1WRD B;  3TBL D;  5DPT A;  2D11 A;  2KJ6 A;  3PTF C;  3QAQ A;  2AEH A;  1WF9 A;  4A3O A;  3L54 A;  1WJU A;  3ZTD A;  2LGX A;  2JT4 B;  1UH6 A;  3ZNZ B;  2Z0D B;  4ASW C;  2ZCB A;  4OVV A;  4AOF A;  2J7Q B;  2JZ3 B;  4K7S A;  3BY4 B;  2FCS A;  3M63 B;  4NAW B;  1WZ0 A;  2KX3 A;  3DVG Y;  4W9L A; 
#chains in the Genus database with same CATH topology
 1JCK B;  5BMG A;  2LGD A;  2LHD A;  1MPE A;  2PJH A;  1F52 A;  3RZF A;  2WX1 A;  1OGW A;  2L52 A;  1RFA A;  4KIK B;  3RZW C;  4OZB A;  3LDZ E;  1WJ4 A;  4TV3 A;  2DZI A;  2MJD A;  3MJW A;  2D3C A;  2C60 A;  4NPN A;  1J7B A;  3Q14 C;  2LD9 A;  2E3T A;  1FNU A;  3VRB B;  1WZ3 A;  2D3G A;  3SHQ A;  1T0S C;  3RNF C;  2GBR A;  2K22 A;  3DVG X;  3GS2 A;  4ZDV A;  4IKG A;  4TSS A;  2AL6 A;  3ZIM A;  3Q3O C;  1WGG A;  4RH6 A;  1K53 A;  3Q8A A;  4HPM B;  4USA A;  4LLG M;  3WAP A;  4HRO A;  2AX5 A;  3HM3 A;  2MQJ A;  3PGE A;  3LXF A;  3Q6B A;  2H89 B;  1XQQ A;  1XF5 L;  3RUI B;  4A8X C;  4XWT A;  2KQ4 X;  4ZYN A;  1L6V A;  1VRA B;  4RFB A;  4M02 A;  1QZE A;  3VUY A;  1D4B A;  1RRB A;  1ZGU B;  4HJG E;  1L0X B;  2KMA A;  2BKR B;  1RWS A;  3ALB A;  1C76 A;  4RGT A;  2GBJ A;  4RF0 A;  1SXT A;  5G5H A;  1E6E B;  4KGT A;  1IUE A;  2OHF A;  2MBQ A;  2BBC A;  2PE9 A;  4PYZ A;  3QJZ A;  1ZPS A;  1N60 A;  1XLQ A;  3ZJT A;  3ZW3 A;  3IAM 1;  4P16 A;  1V2Y A;  3H7S A;  5EE3 A;  3ZKJ C;  3KUC B;  2AWT A;  2FBW B;  4XX5 A;  1FXA A;  4GB9 A;  4DXF A;  1HZ6 A;  3WAM A;  1GUA B;  4MEM A;  5IAA C;  2WGS A;  2XEW A;  1XO3 A;  1UWX A;  2REX A;  3P63 A;  1K8R B;  3TCA A;  1I4Q A;  2MWS B;  3VTV A;  5AZF A;  2O2V A;  1F0Z A;  3N30 A;  3NOB A;  1SSN A;  1N5X A;  4M00 A;  3UGB B;  1KLG D;  4YTM B;  1QOF A;  5DPR A;  3HVD A;  2DLB A;  1P7E A;  3OJ4 B;  1EO6 A;  2KLC A;  3PHW B;  2BKF A;  3VUW A;  2HD5 B;  2BS3 B;  2BB5 A;  1FRD A;  3BIN A;  4HCP B;  1YN4 A;  2KVR A;  3CST A;  1RAX A;  2BF8 B;  2WXI A;  1SJE D;  1F1H A;  3PRP B;  2BQQ A;  1TZ1 A;  3P4Q B;  2FCM A;  1WXS A;  3I3T B;  4E3C A;  4W9K A;  1JWB D;  3BVG A;  4FUL A;  3S2A A;  1TKE A;  2PKO A;  4MGZ E;  4XYC A;  2KKC A;  3ZTC A;  4NJ7 A;  1ET6 A;  3BVM A;  4NQL B;  1R4M I;  3GZN I;  5TR5 A;  1KLU D;  1RLF A;  2N9L A;  3WA0 A;  4BKS A;  5HKH A;  2MW5 A;  4EE2 A;  2BS2 B;  3AE2 B;  3AE3 B;  4ANV A;  5BYS A;  4REZ A;  4P1C C;  4FJV B;  5HG2 A;  2E6X A;  1STE A;  2BGF A;  2NTT A;  4LNI A;  1PUT A;  4ANX A;  5AEK B;  2BWF A;  4IM3 A;  4GDL B;  1L0V B;  2Y5P A;  3FKY A;  4C7Z A;  2IZV B;  1XD3 B;  4XWW A;  3CMM B;  3PLU A;  3PZD A;  3N32 A;  3NS1 A;  4MJS A;  2L7R A;  1C4P A;  3AB5 A;  2J53 A;  2LXA A;  1ZP0 B;  5BO4 B;  5EE9 A;  3T3O A;  1AN8 A;  2R61 A;  4ARC A;  1E8Z A;  3HK0 A;  2JRI B;  5D7G A;  4RGM A;  3AED B;  1SE9 A;  3PSE B;  5JXV A;  2R2Q A;  2AL3 A;  2YVC A;  2IGD A;  1K51 A;  3RNG C;  2V4I B;  1WIA A;  1V97 A;  2WXP A;  3AE5 B;  3V05 A;  1TKG A;  5BYR A;  1C9F A;  4AJW A;  2MP2 A;  3APC A;  1NYQ A;  5D94 A;  2DEN B;  2WXQ A;  1KFY B;  3VTU A;  4XC2 A;  2O6V A;  1R4N I;  4F1S A;  3RCZ A;  1QT9 A;  2D5G A;  1P7F A;  4AS1 A;  2FCQ A;  2KLG A;  2V3N A;  5AUK A;  2QIE B;  3BVZ A;  2N4F A;  3DHI C;  2G3Q B;  1TJE A;  3MC0 B;  4K1R B;  1QOB A;  4ZRP A;  4ZRI A;  2QJL A;  1T0Y A;  3H9D A;  2IGG A;  2HTM E;  3BK1 A;  1UBQ A;  2AQ1 B;  3UIO B;  2YEP B;  4IDI A;  3NZ3 A;  4P1B C;  3URY A;  2K6Q A;  2JXT A;  2JU6 X;  2L0T A;  1AWD A;  3L16 A;  2IGH A;  1JML A;  3KWL A;  4W9E A;  2DYB A;  2DZJ A;  4PS3 A;  4OVZ A;  4AP4 C;  5I4D A;  4LJO B;  2KTR B;  3QC8 B;  4W9H A;  5LXI B;  2WDT B;  3PLV A;  4MH0 E;  3ONS A;  2DZK A;  3ZUN A;  4I6P A;  2J4X A;  4DHZ B;  2K1F A;  5C3J B;  1TGZ B;  3SR6 A;  4ARI A;  2K39 A;  3AEG B;  2FUH B;  3HM6 X;  4XDC A;  2D3B A;  2W3S A;  2N7D A;  3M3J A;  1AYF A;  2DAJ A;  1CJE A;  3BWU D;  4KIK A;  3SU8 X;  1WM2 A;  1TS3 A;  3UIN B;  3LJ3 A;  3Q8E A;  1VJK A;  4KZ0 A;  2CHZ A;  2MJ3 A;  3FC4 A;  4BVU C;  3X23 A;  3W1S C;  4K3C A;  1ACC A;  1ENF A;  4MT5 A;  2AEH A;  1WF9 A;  3EFC A;  2MJE A;  3ZTD A;  2CJN A;  1C77 A;  3ZNZ B;  3U2S C;  4OVV A;  2PTL A;  1RYJ A;  4A6Q A;  2J7Q B;  2JZ3 B;  4KKI A;  4K7S A;  1XLN A;  3E56 A;  2MSE D;  4AWJ A;  2K25 A;  4MJS B;  1N61 A;  1I7H A;  2BYV E;  2IO1 B;  2WLB A;  3UQA A;  2CR5 A;  1VZ7 A;  3RYT A;  2AYO B;  3DHG C;  1JW9 D;  1V86 A;  4M8N A;  1FEH A;  1WE7 A;  4NJC A;  1LXD A;  4LNF A;  5C2T B;  4MH8 A;  5KHO A;  4YTP B;  3DBH I;  2M8S A;  4HJK A;  1MG4 A;  3IT6 B;  2GLS A;  1C4C A;  1Z2M A;  1L7Y A;  1J7A A;  4BOS C;  3ZDM C;  3Q8C A;  1FM0 D;  2CU1 A;  4ANU A;  4ICU A;  1OEY J;  1UF0 A;  5JHA A;  3R7R A;  3ECI A;  2L00 B;  2O6V B;  2W54 A;  1Y56 A;  1GJZ A;  3IHP C;  3ZNI D;  2JX5 A;  5FR6 A;  1U4A A;  4LNK A;  1XCT L;  1UGM A;  4IW0 A;  5CX3 A;  2VH1 A;  1SJH D;  2ACZ B;  1H8C A;  1E8X A;  3U7Z A;  2I1K A;  1FPY A;  3AE1 B;  3OWE B;  4K7W A;  3NUH B;  3JSV B;  1BXT A;  1D3Z A;  1BML C;  1IGC A;  4I6L B;  3Q3J A;  2RSU A;  3QA8 A;  1TT5 B;  1DOX A;  1WWT A;  3DHH C;  4IUM B;  1PQS A;  4DDI D;  2M19 A;  3AI5 A;  2BPS A;  3RNC C;  4HLE A;  3PS6 A;  3RUL A;  4A3P A;  5HFY A;  4ZRQ A;  1CK1 A;  2BW2 A;  4OW0 A;  2NMQ A;  3V6C B;  3VXW A;  1F2R I;  1GB1 A;  5IN7 A;  2QIL A;  5JH5 C;  1WR1 A;  2PVG C;  3A4S C;  2N1V A;  1UNS A;  4N58 A;  2CS4 A;  2IYD B;  2B76 B;  1MG8 A;  1SE4 A;  4ACF A;  2OJW A;  2MA9 B;  4OVU A;  4KSK C;  3V6E B;  2M0X A;  3ZYY X;  2RDH A;  2RDB C;  4GOC A;  2JUO A;  4I6N B;  2L3Z A;  3IVF A;  2PVO D;  1FFU A;  5E6J A;  2KZR A;  2D2Q A;  4NZL B;  1I4X A;  3P2B A;  3CWI A;  4II3 B;  5LXH A;  2KJH B;  3ML9 A;  1A70 A;  2PEA A;  1OQR A;  3AU4 A;  2I1J A;  2JQR B;  1SE2 A;  5FR3 A;  3DWM A;  2KMC A;  1E90 A;  2ONQ A;  4WJO A;  4LK0 M;  2BYF A;  4RGN A;  3BYT B;  2N1W A;  1ZOY B;  2GOW A;  4C7Y A;  4JE3 B;  2LVO A;  2KAJ A;  1TS5 A;  1E8W A;  4ZHP A;  4G50 A;  1F2R C;  5LLI A;  3QAR A;  3H1U A;  2EEL A;  4RF1 A;  1WGD A;  1PGB A;  1FXT B;  2NPT A;  3W1Y A;  2O6V D;  2D3A A;  1ET9 A;  3Q3N C;  3ZDT A;  5EE1 A;  2IND C;  4BZA A;  4GXB A;  4JQW C;  4OZC A;  4GDL A;  2C7H A;  4WAA A;  2WX0 A;  4HEA 1;  3DBL I;  4H2A A;  2KMM A;  4NNJ B;  4C4V B;  4O1N A;  3V62 A;  2LVP A;  4CQN A;  3CIR B;  2YEP F;  3SFD B;  4FLH A;  2KFK B;  4KSL C;  1V1O A;  1RFK A;  2FAZ A;  3W1S A;  5L95 C;  1XEE A;  2J42 A;  2KN5 A;  3QWZ B;  1N5W A;  1V9J A;  2LZ6 A;  2ZNV C;  3ENE A;  3ABV B;  3PRE A;  1FCC C;  2NS5 A;  4MGY E;  5C1Z A;  2G9H D;  5IA7 A;  3WAL A;  3AXC A;  2WNM A;  1Y8R C;  3DPD A;  1N63 A;  4DDG D;  2IPK D;  2L32 A;  4TUU A;  1P1A A;  2JYE A;  1SBB B;  4DBG A;  5DPS A;  1VLB A;  3KYD D;  1Q0W B;  3SDL C;  5J17 A;  2NTS A;  1L2N A;  1ZDX A;  4EZK A;  2V3P A;  3RD2 A;  3ZNG C;  2ZW0 A;  2KNB A;  1R4M B;  3LB8 C;  3GZN B;  4GMV A;  4DXA B;  5J2R A;  3AE4 B;  4MSQ B;  4IG7 B;  2K5P A;  1HE8 A;  4HWI B;  2K8H A;  1QQR A;  1FNV A;  1XXG A;  1I4R A;  1TTN A;  2DX5 B;  4BBN F;  1A5R A;  2L76 A;  3ZVV A;  3VR8 B;  3KVF B;  1TY2 A;  1WMH B;  5BMI A;  4P6V F;  2M1M A;  5CTR C;  3JVZ X;  2KDE B;  1FXI A;  3TEW A;  1I4H A;  2KC1 A;  5CHV C;  2ZPN A;  2A5U A;  2VRR B;  4CHK A;  3DBR I;  1L4D B;  2Y5C A;  4RM8 A;  2BTE A;  3OLM D;  4C00 A;  1X1M A;  2IO2 B;  1KJT A;  2C7N B;  4W9I A;  4K7U A;  4GSW A;  2KTR A;  1WFY A;  1GPX A;  2KDI A;  5JHB A;  1NEN B;  1CZP A;  1UD7 A;  1IPG A;  1HTQ A;  2W9N A;  4L1B A;  3R2T A;  1I4P A;  4F8C B;  1SE3 A;  3RN9 C;  4LDT B;  4EZJ A;  4RMA A;  2ON8 A;  2RR9 A;  2ZCC A;  5L83 A;  3I5J C;  4ZHO A;  3TJP A;  2KXJ A;  1QIL A;  1UZX B;  3SEB A;  2L8J A;  2LGS A;  2LI5 A;  4WQM A;  2K6D B;  1B9R A;  3RNA C;  4FA6 A;  2NPT B;  4A55 A;  3NVY A;  1ZKH A;  1R4N B;  3PV1 A;  5CHF A;  4FAD A;  4B0M A;  1LGR A;  3RPF C;  2OOB B;  2QEJ C;  2W82 A;  2BVC A;  2WQY B;  1P3Q U;  3GE3 C;  4BAX A;  5FKA C;  1UEL A;  4EFO A;  1Z5S B;  2MBB B;  4B0E A;  1T3Q A;  4WWP A;  3O65 B;  4KGS A;  3NVV A;  3AV8 A;  1NVI D;  2WS3 B;  1C1Y B;  3RI7 C;  2QMT A;  1WRD B;  5DPT A;  2K0P A;  3QAQ A;  2KJ6 A;  3L54 A;  3MJ5 A;  5BMH A;  4ASW C;  2ZCB A;  3C19 A;  3M63 B;  1WZ0 A;  3ZJV A;  3DVG Y;  2WXF A;  3X0W A;  1C3T A;  3VR9 B;  2JVC A;  2NR2 A;  5GMV A;  4B9K A;  4WJN A;  1NYR A;  4ZRJ A;  1T6B X;  1J8C A;  2LFI A;  2D10 A;  3NVW A;  4NJ6 A;  4MSM B;  3L4P A;  2YLM A;  3H7P B;  1DGJ A;  4YXD B;  1FD6 A;  2BWE S;  2PMV A;  1TIF A;  4HRS A;  5D3D A;  1VCB A;  3B2F A;  1XT9 B;  4GIV A;  1LFD A;  4L23 A;  2NCN A;  3H6N A;  3VTW A;  2JF5 A;  2AQ2 B;  2WXR A;  2ZVO A;  5DCN A;  1KLV A;  1F77 A;  4DXG A;  4MGI E;  3JSV A;  2PPH A;  2MH7 A;  2MLB A;  3L08 A;  1ISN A;  1GG3 A;  3BYY B;  3I63 C;  1TS4 A;  5E6O A;  2UYZ B;  2B3A A;  2RDG A;  3N1Y C;  2L05 A;  1SB3 C;  5D2M B;  4XDD A;  1V5O A;  4WJQ A;  1YN3 A;  3P1M A;  1HXY D;  4P7I A;  3A33 B;  3NRZ A;  2QC8 A;  2MX2 A;  3I9V 1;  2WXH A;  5KHQ A;  5AZH A;  1WM3 A;  2LAS A;  1I35 A;  5HI1 A;  2ICI A;  2I2Y A;  2KC2 A;  3MFG A;  4IOI E;  1J19 A;  2GBM A;  3B9J A;  1HA5 A;  3ZLZ A;  1S3S G;  3DBH B;  2N7J A;  3HHM A;  2XK5 B;  2MHJ A;  4X57 B;  4MDK E;  1K50 A;  1WXQ A;  4UDU C;  2IY0 B;  2AQ3 B;  4GDK B;  3EA6 A;  3OG5 A;  3VH3 B;  3LYY A;  3QHT A;  2V0G A;  4MAC A;  4DK5 A;  1GB4 A;  4JIO U;  1OTR B;  3WAO A;  2C7M B;  1WGR A;  2QHO A;  3MC9 A;  3L10 B;  5IOI A;  2UWQ A;  5EE0 A;  2KTF A;  1IYF A;  2INC C;  2WXG A;  1HQR D;  3NJT A;  3Q8F A;  1UUP A;  2MBO A;  2WXK A;  2G4D B;  4KKJ A;  2HJ8 A;  3EHV A;  4GGQ A;  4XGA B;  1XLP A;  1EWC A;  3EGR A;  4BKT A;  2IJ0 A;  2FCN A;  2G1E A;  4LCD E;  2WU5 B;  2J52 A;  2Y3A A;  1VZ8 A;  2JPH A;  4EKU A;  3J9C A;  1YJJ A;  2LJ5 A;  1JWA D;  3R7Q A;  3APF A;  1JAL A;  3UF8 A;  4W9F A;  1XCQ L;  2EKI A;  2KHW B;  5LNK 1;  1Q5W B;  1OFF A;  1YNT E;  2W3R A;  2JWZ A;  4M0W B;  1EF5 A;  4URK A;  2V3S A;  1I42 A;  1V49 A;  4B95 A;  1JWU D;  3FIL B;  3PZ7 A;  4HCN B;  1DOY A;  2OED A;  2ASQ A;  4C56 C;  4FN2 A;  4HXD A;  2EKE C;  1V1P B;  3MC8 A;  4IC7 B;  2JZZ A;  4C4V A;  1NEK B;  4G0N B;  1ZW7 A;  2NBW B;  2KFK A;  4FHJ A;  3T9L A;  4N6E B;  2JY6 A;  1K52 A;  2KWC A;  1L6U A;  3AU5 A;  3RNB C;  4C80 A;  3ZXR A;  4KDI C;  3Q2A C;  1ZUD 2;  2L1A A;  3TEX A;  1N6Z A;  1Q10 A;  2W55 A;  4YSX B;  1ZE3 D;  2Y5B B;  4BKG A;  1WX7 A;  3RMK C;  2NBV B;  1NDD A;  1SF0 A;  2GBK A;  2JRH A;  2NVU I;  3JYU A;  1EU3 A;  3PPA A;  1WGY A;  3NVZ A;  2DNF A;  2RD0 A;  4KZC A;  1YOV B;  4J6I A;  2BYT A;  1YJ1 A;  3AE6 B;  3D32 A;  2FID A;  3N1X C;  2CKH B;  2K3U A;  4J3O D;  2ZNV B;  1WJN A;  1OQQ A;  1VZ6 A;  1GOZ A;  3WAN A;  3OAW A;  4NQK E;  3AEE B;  4JPS A;  1L0Y B;  1C79 A;  3N20 C;  4KV2 A;  3I57 A;  4OHJ A;  2CHW A;  3NHE B;  5BYQ A;  4AQ7 A;  2LWP A;  2CU3 A;  2UU7 A;  1BUI C;  5G5G A;  2WXL A;  4YL8 A;  4KDL B;  2OJR A;  5G2N A;  4US9 A;  3W5U B;  2N0S B;  3DOW A;  2EMS A;  3B2G A;  3ML8 A;  3HIZ A;  1E8Y A;  4N59 A;  1NI2 A;  1WMH A;  1M94 A;  4WJP A;  1YX6 B;  4JLC A;  3W2D A;  2KFJ A;  3DBL B;  4US8 A;  1YJI A;  2X8X X;  1NBF C;  4LNO A;  2WXM A;  1SEB D;  1YD8 U;  1BT0 A;  1WSP A;  3H8H A;  3ZRF A;  3GP7 A;  4XZ4 A;  2MRP A;  2ZZP B;  3DDC B;  2QDF A;  4EUT A;  3AE7 B;  1HZ5 A;  4MM3 B;  3U52 E;  4M01 A;  1PGA A;  2LVQ A;  1PDX A;  3T3N A;  2SAK A;  2Z8L A;  3DBS A;  3A9J A;  4GLS C;  3IXS A;  1ESF A;  4MGK E;  1EU4 A;  3HVZ A;  3GB1 A;  2R2O A;  4II2 B;  2KDF B;  4WH4 A;  3K9P B;  1FIQ A;  5H92 C;  4DHJ B;  3KQ4 A;  1T5X D;  3CF6 E;  3GE8 C;  2N9P C;  1S1Q B;  2KVZ A;  3AE8 B;  1GC6 A;  4Q2J A;  1T0R C;  2WP9 B;  3KUZ A;  4L2Y A;  4R3D A;  2ZPY A;  1UWM A;  1ZDV A;  2LUE A;  1UGJ A;  2XN9 C;  2INN E;  3AM9 A;  5CHW A;  1B1Z A;  3KLS X;  4JWU C;  1N62 A;  4WWM A;  4FJZ A;  1KH0 A;  4PS7 A;  4HK2 A;  2KK8 A;  3VAW A;  4PK1 A;  1LO5 D;  3PO0 A;  3Q3F A;  3DVN U;  4AUQ C;  1QF6 A;  2LXC A;  4NAM A;  1WYW B;  2PLP A;  3P4R B;  1QKZ A;  3B08 A;  4CYE A;  2M0A A;  3VFK A;  1YX5 B;  4RNA A;  2DZM A;  4LNN A;  4IWQ A;  2X38 A;  3APD A;  2GI9 A;  4M8M A;  2N9E B;  2J0K A;  4LJP B;  2QCZ A;  1PGX A;  1TZO A;  1YQ3 B;  4GU2 A;  2KWV B;  3A1Q B;  3DBR B;  4YSZ B;  1LM8 B;  2WDR B;  1MHX A;  2SEB D;  2WU2 B;  3N9Y C;  4ICV A;  5D6J B;  1E9M A;  1P9D U;  2DYO A;  3H7P A;  1TYG B;  4W9G A;  2K8B A;  3L17 A;  4S0R A;  2IY1 B;  3QCA A;  3TEY A;  3TBL D;  2D11 A;  1AW7 A;  4JX1 C;  1I4G A;  3BII D;  5IO9 A;  1UH6 A;  2Z0D B;  3O13 A;  3RFZ B;  4AOF A;  2CJO A;  3BY4 B;  2FCS A;  2KX3 A;  3W5V B;  2RMM A;  3TMP B;  1SIF A;  3VHT C;  3AEF B;  4EOY A;  4CO7 A;  3Q3M C;  4HVB A;  2PE6 B;  4PS8 A;  2KX0 A;  5G55 A;  4RGO S;  5IP4 D;  2KN4 A;  2WHI A;  1MFW A;  2H88 B;  3VH4 B;  2HJ1 A;  4FJY A;  3DWG C;  3KW5 B;  2ZVN A;  2M17 A;  4WWN A;  2KWD A;  1KRH A;  3IFW B;  4G11 A;  3SD5 A;  1WXV A;  2VZK B;  4DQO C;  5C23 A;  3ZJU A;  3NG0 A;  5D3I B;  2N9X A;  3P4P B;  2IBI B;  4HPL B;  1ZXH A;  2KD0 A;  2KYW A;  4B6W A;  1F9J A;  1GNU A;  2WDQ B;  3KWV A;  3KYC D;  2KAC A;  3M62 B;  3ZRC A;  4TKN A;  2RGF A;  1HTO A;  3BZD B;  4DHJ D;  1JRU A;  3NY5 A;  1ZXI A;  1WGK A;  1WGH A;  2XK5 A;  2KJR A;  1OEY A;  2IDY A;  2VH2 A;  3A9J B;  4HDQ A;  4GDK A;  2BYE A;  3V61 A;  1RM6 C;  1LQB A;  1V5T A;  2HE7 A;  2I38 A;  1PYW D;  3HRD D;  2KDB A;  1E0Z A;  2DAF A;  3IT4 B;  3IBE A;  4RCO A;  4S17 A;  3KUD B;  3EUB 2;  4DHZ E;  2LMC A;  2FNJ B;  3W9C B;  1C4A A;  4ZRK A;  2A4Z A;  3BK2 A;  1QLB B;  3C8Y A;  1D6E C;  1IGD A;  1V8C A;  2V4L A;  3AMZ A;  1YMH E;  2DWQ A;  1KF6 B;  3V3X A;  4WIP A;  3A4R A;  1FMA D;  2BT6 A;  1Q1O A;  1TBE A;  4PYU A;  1ROE A;  2M4N A;  3Q69 A;  1E7U A;  4WUR A;  1MVK A;  4M0W A;  4YT0 B;  2GBN A;  2WXN A;  2MCN B;  2K8C A;  1NI3 A;  3FIL A;  3KH0 A;  3SFE B;  2WXO A;  2LHE A;  3PRM B;  5J18 A;  1WY8 A;  1J0G A;  2C5L C;  2WYQ A;  1HEZ E;  1QOA A;  1V1P A;  3EEC A;  4E74 A;  2G45 B;  3WIM A;  1MJD A;  1TS2 A;  2XNA C;  4NY0 A;  4MEL A;  4ZOH C;  2JWU A;  2TSS A;  3P42 A;  3PRZ A;  4IWO A;  5EDS A;  3AEA B;  2HDE A;  1VR9 A;  4AJY B;  2IO3 B;  5E6N A;  5H8Y E;  5E6P A;  2PIA A;  2L0F A;  4TMA B;  2VZK D;  2PW9 A;  2GB1 A;  1C78 A;  3QQ8 B;  2MEK A;  4W9C A;  2QSD A;  3AEC B;  2O2V B;  1E7V A;  3QK0 A;  3U4E G;  4EEW A;  3R66 C;  2LRW A;  4N9F 4;  3ZGZ A;  1V81 A;  3L13 A;  3ZQ4 A;  3Q8B A;  3C0R B;  5IKC M;  1P0R A;  1WJ6 A;  3TSS A;  3FAH A;  2NBU A;  2N7E A;  1EM7 A;  5T8I A;  5AZG A;  1T0Q C;  4LDT D;  3B0A A;  4WWO A;  1D5X C;  2J0J A;  3PZ8 A;  4GN1 A;  3R8B A;  4TQ0 A;  3B1L X;  4A20 A;  1FO4 A;  3PVL A;  1QOG A;  2RPV A;  1J7C A;  3OJ3 A;  2IO0 B;  1IBX A;  2J0M A;  2MBH A;  3DCG A;  4DWF A;  3VRA B;  3CSF A;  2DHZ A;  3N1Z C;  5FK9 C;  1V80 A;  1GAQ B;  1FRR A;  3A9K A;  3N3K B;  2FIF A;  3M95 A;  4HDO A;  3VUX A;  1UBI A;  1FCL A;  3L0W B;  4FHK A;  4E71 A;  3PHX B;  4JGH B;  1OQY A;  3RNE C;  3VQI A;  3U30 A;  2BB6 A;  3GOE A;  3MHZ A;  1R7S A;  4A9A A;  1V6E A;  4JL9 A;  5TSS A;  1FFV A;  3TUO A;  3JW0 X;  4NAW A;  1P98 A;  1WRI A;  1CQV A;  1YQB A;  2ZEQ A;  2WWZ A;  4IM2 A;  4WQO B;  1YN5 A;  1JWM D;  1IP9 A;  3DQV A;  2EMT A;  3IAS 1;  4W9D A;  1KOT A;  4YSY B;  1SIJ A;  2L83 A;  3T8M A;  3TEZ A;  4WAF A;  3R3M A;  3NZS A;  4MM3 A;  4D2K A;  3NZU A;  2LJI A;  3IG3 A;  4KVG B;  4BFR A;  2BS4 B;  3AUL A;  3VDZ A;  1M4V A;  4QAY A;  2KT7 A;  4IM0 A;  1D5Z C;  4KGR A;  1DYQ A;  4W9J A;  1WXA A;  3AE9 B;  2JXX A;  1MI0 A;  1KM7 A;  3K9O B;  3MHS D;  2G4S A;  3EFU A;  1EUV B;  4RM9 A;  5AUI A;  1JRP A;  2GMI C;  3V60 A;  5DPW A;  4F7Z A;  3EC8 A;  1WR6 E;  2C9W B;  4G3X B;  1VD2 A;  1VDV A;  1JRO A;  1WE6 A;  2GRI A;  4YTN B;  2HTH A;  2ZJD A;  3UI3 A;  2CHX A;  1AAR A;  1WX8 A;  1WH3 A;  2RPQ A;  3MTN B;  2XBB C;  1H4R A;  1WXM A;  4TQ1 A;  3ZNH B;  1JQ4 A;  2M56 B;  3AEB B;  4IWP A;  1WI0 A;  3E9S A;  2Z59 B;  2Q5W D;  4PT5 A;  4HKQ A;  3U7D A;  1L5P A;  3WCQ A;  2DBY A;  1D5M C;  1E5W A;  1JWS D;  2V9H A;  2MP2 B;  1YIW A;  4EZL A;  1WX9 A;  2LRU A;  2WDV B;  1E10 A;  2JSV X;  3AN1 A;  4K3B A;  4JWS C;  2LEK A;  4YWG G;  2FUG 1;  1G6J A;  3TL5 A;  4A90 A;  2KQ7 A;  3RT3 B;  3ZO5 B;  3MP9 A;  3A1Q A;  1SGH A;  1WYG A;  1L4Z B;  4HPP A;  3PT2 B;  4FBJ B;  3TIX A;  2WXJ A;  4HKZ E;  1EF1 A;  4OZA A;  4KX6 B;  5GXG B;  2ZW1 A;  2KAN A;  2FE8 A;  3DVN V;  2INP E;  2JZP A;  1GC7 A;  2LUM A;  3U8Z A;  1XLO A;  3HUI A;  2V1Y A;  2KDM A;  3QIJ A;  2KO3 A;  3UQB A;  3ETR A;  3ZXV A;  4ANW A;  2LGY A;  2DYM A;  4K81 A;  1IBX B;  3UIP B;  5MPO A;  1PFD A;  2JYT A;  4XE0 A;  4LTU A;  3AH7 A;  2D07 B;  5JZE B;  1YQ4 B;  2KOX A;  3A9K B;  4BOZ B;  2KQS A;  4ITK A;  3NS8 A;  3P4S B;  1CMX B;  2MBE A;  3VVW B;  2LGI A;  3R2I A;  1EWY C;  1TY0 A;  2KWU B;  3QX1 A;  1MHH E;  2Z0E B;  4BKS D;  3PTF C;  5HHD G;  4A3O A;  1WJU A;  2LGX A;  2JT4 B;  2N9K A;  1FNW A;  4ZYS A;  1E7P B;  4FXC A;  4NAW B;  2K9X A;  1TKY A;  4BBN C;  1DOI A;  1KTK A;  4W9L A; 
#chains in the Genus database with same CATH homology
 3TMP B;  3X0W A;  1SIF A;  3VHT C;  1C3T A;  2LGD A;  2MSE D;  4AWJ A;  2JVC A;  2K25 A;  4MJS B;  2NR2 A;  5GMV A;  4B9K A;  4WJN A;  4CO7 A;  4EOY A;  2PJH A;  4ZRJ A;  1J8C A;  3RZF A;  2BYV E;  2IO1 B;  2D10 A;  2WX1 A;  1OGW A;  4HVB A;  1RFA A;  2PE6 B;  4KIK B;  3UQA A;  4NJ6 A;  4PS8 A;  3RZW C;  2CR5 A;  2KX0 A;  4MSM B;  5G55 A;  3RYT A;  2AYO B;  2YLM A;  3H7P B;  3LDZ E;  1V86 A;  1WJ4 A;  4M8N A;  2BWE S;  1WE7 A;  4TV3 A;  3VH4 B;  2DZI A;  4FJY A;  1LXD A;  3KW5 B;  2ZVN A;  2M17 A;  4WWN A;  5KHO A;  1VCB A;  2M8S A;  3DBH I;  1XT9 B;  4HJK A;  3MJW A;  3IFW B;  4GIV A;  1LFD A;  4G11 A;  2C60 A;  3SD5 A;  2NCN A;  3H6N A;  4NPN A;  1WXV A;  3VTW A;  1Z2M A;  5C23 A;  2LD9 A;  2JF5 A;  2N9X A;  2ZVO A;  1L7Y A;  1WZ3 A;  2D3G A;  4BOS C;  3SHQ A;  3ZDM C;  2IBI B;  4HPL B;  5DCN A;  1KLV A;  2GBR A;  2CU1 A;  2KD0 A;  4ANU A;  3DVG X;  4MGI E;  4ICU A;  1OEY J;  4B6W A;  4ZDV A;  3JSV A;  1F9J A;  1GNU A;  2PPH A;  5JHA A;  3R7R A;  3KYC D;  3M62 B;  3ECI A;  2MLB A;  3L08 A;  4TKN A;  3ZRC A;  2L00 B;  1ISN A;  1GG3 A;  2AL6 A;  2O6V B;  2RGF A;  3ZIM A;  4DHJ D;  1WGG A;  1JRU A;  3NY5 A;  5E6O A;  2UYZ B;  1GJZ A;  2B3A A;  3IHP C;  3ZNI D;  1WGH A;  4HPM B;  2L05 A;  2XK5 A;  2KJR A;  3WAP A;  5FR6 A;  5D2M B;  1OEY A;  1U4A A;  1V5O A;  4WJQ A;  1UGM A;  4HDQ A;  3A9J B;  4IW0 A;  3HM3 A;  4GDK A;  2BYE A;  5CX3 A;  3V61 A;  2MQJ A;  3PGE A;  4P7I A;  1LQB A;  1V5T A;  3A33 B;  2MX2 A;  2HE7 A;  1XQQ A;  5KHQ A;  1H8C A;  3RUI B;  1E8X A;  5AZH A;  2I1K A;  2KDB A;  1WM3 A;  2DAF A;  2LAS A;  3IBE A;  1I35 A;  4ZYN A;  4K7W A;  3JSV B;  2KC2 A;  3KUD B;  1QZE A;  3VUY A;  1D3Z A;  4DHZ E;  1RRB A;  1ZGU B;  2FNJ B;  4ZRK A;  1J19 A;  2GBM A;  3Q3J A;  4I6L B;  2RSU A;  2KMA A;  2A4Z A;  3ZLZ A;  1S3S G;  2BKR B;  3QA8 A;  3ALB A;  3HHM A;  2XK5 B;  4X57 B;  4IUM B;  2GBJ A;  1PQS A;  4MDK E;  2V4L A;  4DDI D;  2IY0 B;  2BPS A;  3AI5 A;  4HLE A;  3PS6 A;  4GDK B;  2MBQ A;  3VH3 B;  3RUL A;  2PE9 A;  3QHT A;  4A3P A;  4PYZ A;  3A4R A;  3QJZ A;  4DK5 A;  1Q1O A;  1TBE A;  1OTR B;  4JIO U;  3V6C B;  3VXW A;  4PYU A;  3WAO A;  2C7M B;  1WGR A;  3ZW3 A;  2M4N A;  2QHO A;  5JH5 C;  1E7U A;  3L10 B;  1WR1 A;  1V2Y A;  3A4S C;  3H7S A;  2N1V A;  2GBN A;  2UWQ A;  2MCN B;  2KTF A;  2K8C A;  1IYF A;  2CS4 A;  2IYD B;  1MG8 A;  2MBO A;  3KH0 A;  3ZKJ C;  2G4D B;  2MA9 B;  3KUC B;  3PRM B;  5J18 A;  2AWT A;  2HJ8 A;  3EHV A;  4GGQ A;  4OVU A;  4XX5 A;  1WY8 A;  1J0G A;  4KSK C;  3V6E B;  2M0X A;  4GB9 A;  4BKT A;  2C5L C;  2FCN A;  4GOC A;  4LCD E;  2WYQ A;  2JUO A;  4I6N B;  3WAM A;  2L3Z A;  3IVF A;  1GUA B;  4MEM A;  3EEC A;  2JPH A;  4E74 A;  5IAA C;  4EKU A;  2XEW A;  2LJ5 A;  2G45 B;  3WIM A;  3R7Q A;  3APF A;  2KZR A;  2REX A;  3UF8 A;  2D2Q A;  1K8R B;  4NY0 A;  2MWS B;  2KHW B;  4W9F A;  3TCA A;  3VTV A;  4MEL A;  3P2B A;  4II3 B;  5AZF A;  1Q5W B;  2O2V A;  3N30 A;  3NOB A;  5LXH A;  2KJH B;  2JWZ A;  4M0W B;  3ML9 A;  1EF5 A;  2PEA A;  3AU4 A;  2V3S A;  4URK A;  2I1J A;  1I42 A;  1V49 A;  3UGB B;  4B95 A;  5DPR A;  3PRZ A;  2KMC A;  1E90 A;  4IWO A;  4WJO A;  5EDS A;  4HCN B;  3OJ4 B;  1EO6 A;  2ASQ A;  2KLC A;  4AJY B;  2BYF A;  3PHW B;  2BKF A;  3VUW A;  2IO3 B;  2N1W A;  4FN2 A;  4HXD A;  5E6N A;  5E6P A;  2EKE C;  2GOW A;  2HD5 B;  2L0F A;  4IC7 B;  2JZZ A;  3BIN A;  2LVO A;  4HCP B;  2KVR A;  3CST A;  4G0N B;  1E8W A;  1ZW7 A;  1RAX A;  4G50 A;  3QQ8 B;  2NBW B;  2BF8 B;  5LLI A;  4W9C A;  2KFK A;  3PRP B;  2O2V B;  1E7V A;  4FHJ A;  3QAR A;  3QK0 A;  2JY6 A;  3H1U A;  3T9L A;  1TZ1 A;  2KWC A;  2FCM A;  3AU5 A;  3R66 C;  2LRW A;  1WXS A;  3I3T B;  4N9F 4;  4EEW A;  4E3C A;  1V81 A;  1WGD A;  3L13 A;  4KDI C;  4W9K A;  1FXT B;  2NPT A;  3C0R B;  1P0R A;  1WJ6 A;  2O6V D;  3W1Y A;  2NBU A;  2N7E A;  5AZG A;  3ZDT A;  4GXB A;  2Y5B B;  4FUL A;  4LDT D;  3B0A A;  4BKG A;  4WWO A;  3S2A A;  2J0J A;  4GN1 A;  1WX7 A;  4JQW C;  4TQ0 A;  4GDL A;  2C7H A;  3B1L X;  4MGZ E;  4A20 A;  3PVL A;  4WAA A;  2WX0 A;  2NBV B;  1NDD A;  2KKC A;  4NJ7 A;  3ZTC A;  4NQL B;  1R4M I;  3GZN I;  2GBK A;  3DBL I;  5TR5 A;  3OJ3 A;  2JRH A;  2NVU I;  3JYU A;  1RLF A;  4NNJ B;  3V62 A;  3PPA A;  2IO0 B;  1WGY A;  2J0M A;  2LVP A;  2MBH A;  3DCG A;  4DWF A;  3CSF A;  3WA0 A;  4BKS A;  5HKH A;  2RD0 A;  4FLH A;  4KZC A;  2DHZ A;  2MW5 A;  4J6I A;  2KFK B;  4KSL C;  1YJ1 A;  3VUX A;  1V80 A;  3A9K A;  3N3K B;  4HDO A;  4ANV A;  2FIF A;  3M95 A;  1UBI A;  3D32 A;  2FAZ A;  2FID A;  3W1S A;  4FJV B;  5L95 C;  2CKH B;  2ZNV B;  1WJN A;  3L0W B;  4FHK A;  2KN5 A;  3QWZ B;  3WAN A;  2BGF A;  3OAW A;  1V9J A;  4E71 A;  2LZ6 A;  2ZNV C;  3ENE A;  4NQK E;  4ANX A;  3PHX B;  5AEK B;  3PRE A;  2BWF A;  2NS5 A;  4JGH B;  4MGY E;  4IM3 A;  1OQY A;  5C1Z A;  5IA7 A;  4KV2 A;  3VQI A;  4GDL B;  3WAL A;  3U30 A;  3GOE A;  3AXC A;  2IZV B;  1XD3 B;  2CHW A;  1V6E A;  4JL9 A;  3NHE B;  3JW0 X;  4NAW A;  1Y8R C;  2LWP A;  3DPD A;  1P98 A;  1YQB A;  3CMM B;  3PLU A;  4DDG D;  2ZEQ A;  3PZD A;  4YL8 A;  3N32 A;  4TUU A;  4MJS A;  4BBN C;  4KDL B;  2L7R A;  2WWZ A;  2OJR A;  5G2N A;  4IM2 A;  1P1A A;  4WQO B;  1IP9 A;  3DQV A;  2EMT A;  2LXA A;  3DOW A;  4W9D A;  4DBG A;  1KOT A;  5DPS A;  2EMS A;  3T8M A;  3ML8 A;  5BO4 B;  3HIZ A;  1E8Y A;  3R3M A;  3KYD D;  3NZS A;  1Q0W B;  3SDL C;  4MM3 A;  5J17 A;  3NZU A;  1NI2 A;  1WMH A;  1L2N A;  1E8Z A;  1M94 A;  3IG3 A;  3HK0 A;  4WJP A;  4EZK A;  4KVG B;  2JRI B;  1YX6 B;  3RD2 A;  5D7G A;  4JLC A;  4BFR A;  3AUL A;  3ZNG C;  3VDZ A;  1SE9 A;  3PSE B;  2R2Q A;  2AL3 A;  2KFJ A;  2YVC A;  4IM0 A;  2KNB A;  4GMV A;  4DXA B;  5J2R A;  4W9J A;  1WXA A;  4MSQ B;  2JXX A;  1WIA A;  1KM7 A;  3K9O B;  4IG7 B;  3MHS D;  2G4S A;  3EFU A;  1EUV B;  1HE8 A;  4RM9 A;  1NBF C;  1YD8 U;  1BT0 A;  2GMI C;  2MP2 A;  3APC A;  3V60 A;  4AJW A;  5DPW A;  3ZRF A;  4HWI B;  4F7Z A;  2K8H A;  3EC8 A;  1WR6 E;  2C9W B;  4XZ4 A;  4G3X B;  2MRP A;  1VD2 A;  5D94 A;  2ZZP B;  1TTN A;  2DEN B;  3DDC B;  2DX5 B;  4BBN F;  3VTU A;  4XC2 A;  2O6V A;  1A5R A;  2L76 A;  1R4N I;  1WE6 A;  3ZVV A;  4EUT A;  4F1S A;  3RCZ A;  2HTH A;  2ZJD A;  2CHX A;  1AAR A;  3KVF B;  1WMH B;  1WX8 A;  1WH3 A;  2LVQ A;  2RPQ A;  2M1M A;  2FCQ A;  3MTN B;  5CTR C;  2XBB C;  1H4R A;  2KLG A;  3JVZ X;  2KDE B;  2N4F A;  1WXM A;  4TQ1 A;  3DBS A;  2KC1 A;  5CHV C;  3A9J A;  3ZNH B;  4IWP A;  2G3Q B;  2ZPN A;  2A5U A;  1WI0 A;  2VRR B;  3DBR I;  4CHK A;  4RM8 A;  4K1R B;  4MGK E;  3OLM D;  2Z59 B;  4ZRI A;  1X1M A;  3U7D A;  2R2O A;  4II2 B;  2KDF B;  2IO2 B;  3K9P B;  1KJT A;  2C7N B;  4W9I A;  4K7U A;  1E5W A;  1T0Y A;  4GSW A;  2KTR A;  4DHJ B;  3H9D A;  1WFY A;  3CF6 E;  1UBQ A;  2KDI A;  2MP2 B;  1YIW A;  2N9P C;  5JHB A;  1S1Q B;  1UD7 A;  1IPG A;  1GC6 A;  4EZL A;  3UIO B;  2W9N A;  3KUZ A;  1WX9 A;  2LRU A;  2ZPY A;  2LUE A;  4F8C B;  1G6J A;  3TL5 A;  2K6Q A;  2KQ7 A;  3RT3 B;  4LDT B;  2L0T A;  5CHW A;  4EZJ A;  4RMA A;  3ZO5 B;  3A1Q A;  3L16 A;  2RR9 A;  1SGH A;  2ZCC A;  5L83 A;  4FJZ A;  4PS7 A;  4HK2 A;  2KK8 A;  4W9E A;  3VAW A;  2DYB A;  3PT2 B;  3TJP A;  3Q3F A;  3DVN U;  4FBJ B;  4AUQ C;  3TIX A;  2KXJ A;  2DZJ A;  1UZX B;  2LXC A;  4PS3 A;  1WYW B;  1EF1 A;  2L8J A;  2LI5 A;  4AP4 C;  4LJO B;  2KTR B;  3QC8 B;  2K6D B;  3B08 A;  4W9H A;  2KAN A;  4CYE A;  5LXI B;  2WDT B;  3PLV A;  3VFK A;  4FA6 A;  1YX5 B;  2NPT B;  3DVN V;  1ZKH A;  4MH0 E;  2DZM A;  2DZK A;  3ONS A;  3ZUN A;  3PV1 A;  1GC7 A;  5CHF A;  3U8Z A;  4I6P A;  4IWQ A;  4DHZ B;  2V1Y A;  3APD A;  2K1F A;  4FAD A;  1TGZ B;  4M8M A;  2N9E B;  2J0K A;  4LJP B;  3QIJ A;  2KO3 A;  3UQB A;  2K39 A;  4ANW A;  2OOB B;  2LGY A;  2FUH B;  2DYM A;  2KWV B;  3A1Q B;  4GU2 A;  3HM6 X;  4K81 A;  1P3Q U;  2N7D A;  3UIP B;  1UEL A;  3M3J A;  2DAJ A;  1LM8 B;  1Z5S B;  2MBB B;  4EFO A;  2D07 B;  4WWP A;  4KIK A;  5JZE B;  2KOX A;  3A9K B;  3O65 B;  4BOZ B;  3SU8 X;  1WM2 A;  4ICV A;  5D6J B;  2KQS A;  3LJ3 A;  1P9D U;  2DYO A;  3H7P A;  3NS8 A;  1CMX B;  2MBE A;  3UIN B;  3VVW B;  4KZ0 A;  2CHZ A;  4W9G A;  1C1Y B;  2KWU B;  2K8B A;  3L17 A;  3QX1 A;  3X23 A;  3W1S C;  4BVU C;  2IY1 B;  2Z0E B;  3QCA A;  4BKS D;  1WRD B;  3TBL D;  5DPT A;  2D11 A;  2KJ6 A;  3PTF C;  3QAQ A;  2AEH A;  1WF9 A;  4A3O A;  3L54 A;  1WJU A;  3ZTD A;  2LGX A;  2JT4 B;  1UH6 A;  3ZNZ B;  2Z0D B;  4ASW C;  2ZCB A;  4OVV A;  4AOF A;  2J7Q B;  2JZ3 B;  4K7S A;  3BY4 B;  2FCS A;  3M63 B;  4NAW B;  1WZ0 A;  2KX3 A;  3DVG Y;  4W9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...