2L32A

Solution structure of ubiquitin-like small archaeal modifier protein in haloferax volcanii
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
66
structure length
66
Chain Sequence
MNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title solution structure of ubiquitin-like small archaeal modifier protein in Haloferax volcanii
rcsb
source organism Haloferax volcanii
molecule tags Protein binding
molecule keywords Small archaeal modifier protein 2
total genus 4
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.630 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2l32A00
2LJIA 2L32A
chains in the Genus database with same CATH superfamily
4USAA 2FUHB 3GP7A 5GXGB 3VVWB 3MHZA 2A4ZA 2INCC 5BYSA 1J7AA 1L0VB 1VJKA 3JSVA 1HA5A 1XCQL 1JRPA 3B9JA 3UQAA 4KGSA 2B76B 1TGZB 3ZQ4A 2MQJA 3L10B 4K7SA 3A9JB 5JHAA 2K0PA 2GBJA 1GNUA 4XYCA 3CWIA 3IAS1 2CR5A 3W1YA 1N63A 4AS1A 4KIKA 1WZ3A 2WXKA 1X1MA 4GB9A 2KC1A 2K22A 2RPQA 5GMVA 1HQRD 1U4AA 1UGMA 3SFDB 4HPLB 4G50A 1Y8RC 2BQQA 1SIJA 3N1YC 3M3JA 3MHSD 2MSED 3TEWA 2BWES 2K25A 4GOCA 5E6JA 4HWIB 5IOIA 2J0JA 2HD5B 2ZCCA 2O2VA 1C76A 2IO3B 1R4NB 4BFRA 5EE3A 1FO4A 3AULA 1YQ4B 3N1XC 2KFJA 3P4RB 2ZNVC 2BS3B 1MJDA 4YT0B 2TSSA 1C3TA 4ZHPA 2MP2B 4XDCA 4ANXA 4E74A 1NDDA 3IT6B 1WWTA 2FCMA 4LDTD 2JWUA 3ZJVA 2W9NA 3MFGA 1YOVB 4FJZA 2ZPNA 2KNBA 2Y3AA 3QHTA 3AE1B 3CF6E 2EKEC 1PGBA 2C5LC 1HTOA 1E90A 3QC8B 2BTEA 2BF8B 4WWOA 4GDLB 1WX9A 1WXQA 2QEJC 4W9KA 1TS3A 2WHIA 5AZHA 2N7JA 1ZOYB 3HRDD 1NI2A 2BKRB 2ACZB 2DZIA 5JH5C 1P3QU 3PZ8A 1D5XC 2WGSA 1WYGA 1F52A 1J19A 1K53A 3CSFA 2FUG1 2BS2B 1V49A 2H89B 5JHBA 5BYRA 1J7CA 2MW5A 4NAWB 2GBRA 2DX5B 2OOBB 4C7ZA 3ZVVA 1T6BX 4CYEA 3KVFB 2RDHA 2XBBC 1UBIA 2JVCA 3DBHI 3KUZA 3PHWB 4X57B 1ROEA 2N7EA 3AE9B 4M0WA 2OEDA 3AE4B 3DBHB 3R2TA 1T0RC 3ZW3A 4DBGA 1KRHA 4ZRIA 3N9YC 4WAAA 3CIRB 1TY2A 3ZJTA 4ACFA 3DWGC 3I3TB 1V97A 3NVZA 1L2NA 3ETRA 4KSKC 2ZW1A 4W9DA 1JROA 2NBWB 1UWMA 1E6EB 4WWNA 2N1WA 2BBCA 1TZOA 3Q69A 4WQOB 4MGKE 2G4SA 4JPSA 1NENB 1WR1A 2V4IB 2MLBA 3AEBB 4A55A 2NBUA 3BYTB 3GE3C 4YWGG 3CSTA 3R66C 1VD2A 2YEPF 3SEBA 2D2QA 3PGEA 3VXWA 4B9KA 2KQ7A 3AI5A 1UWXA 4HDQA 3AU5A 3P4PB 4IDIA 1LM8B 1KFYB 4NQLB 1GB1A 4RM9A 1SBBB 2FIFA 3HM3A 1TS2A 4EZJA 2C7MB 3URYA 1TBEA 1YJIA 1J7BA 1E8YA 1MPEA 2L76A 1UGJA 2KJHB 4OVUA 1SJED 1ZE3D 4ICUA 2WP9B 3NG0A 4ZOHC 1EWCA 2EMSA 2D3AA 2JZ3B 3FILB 4GDKB 2JXTA 1ZXIA 3O13A 2L1AA 1OQYA 5JXVA 1N62A 1C9FA 2UYZB 2WX1A 4ICVA 2G9HD 1TZ1A 3ZLZA 1CZPA 2L83A 2WXIA 2J4XA 3PRMB 4A9AA 2WDVB 2DZJA 2HJ8A 2OJRA 1XT9B 3K9PB 1T0YA 1FCLA 1FM0D 3N30A 1WY8A 3EHVA 3IAM1 4IUMB 4LNFA 2KO3A 3Q8CA 3U8ZA 3APDA 4MH0E 4M00A 4S17A 2FCNA 3N20C 4TKNA 1N61A 4MH8A 2KTRB 1V1PA 3N3KB 2QHOA 2XNAC 1WM2A 3ZUNA 2G3QB 4JX1C 4NJ6A 1XEEA 2MHJA 4L23A 1OEYJ 3DBRB 3HM6X 1DGJA 1IUEA 4NNJB 3UGBB 4JE3B 1CK1A 2GI9A 4WJQA 1B9RA 2HTME 1QLBB 2ZPYA 3TUOA 2MEKA 5E6NA 5DCNA 2CS4A 1R4MI 1YN5A 3Q14C 3PS6A 4P16A 3SR6A 2KLGA 2KOXA 3MJWA 1RRBA 4KZCA 3GOEA 2R61A 1V1PB 5FK9C 1AARA 1FIQA 2SAKA 2KWDA 4CHKA 1NYRA 2MWSB 4FN2A 1P0RA 2G1EA 4LNOA 3Q8AA 3SD5A 2L0TA 2QCZA 2H88B 3SU8X 4K3BA 3M62B 3DBLI 1H8CA 2M19A 4RGTA 1WE6A 4BBNC 2O2VB 2K1FA 3V3XA 1OEYA 3R7RA 2VH1A 1GOZA 5CHWA 1FD6A 4YTNB 2CJOA 2INPE 4GSWA 4FBJB 1RAXA 2DHZA 4GDKA 2NPTB 1JWBD 3GB1A 3U30A 1IP9A 3QA8A 4RFBA 1QOBA 3PPAA 1C4CA 1L0YB 2N9LA 3EGRA 2LXCA 1JRUA 1N60A 3ENEA 1NVID 3A9KA 2LHEA 3P2BA 4PYUA 5LNK1 4BKSA 4WWMA 3DVGY 4G0NB 3AE6B 1S3SG 3APFA 4IKGA 1YQBA 2WXHA 2KACA 4M02A 2C60A 3PT2B 2V0GA 3IVFA 4N9F4 1KOTA 3NY5A 2M4NA 4K3CA 3NUHB 1JWAD 1FRDA 2KDIA 2KANA 3L08A 4IG7B 1WRIA 3U7DA 5FR3A 1UZXB 2GBMA 4ZRKA 4P7IA 4ZHOA 2WXPA 4DXFA 3IBEA 3QCAA 5C2TB 2HJ1A 2WXJA 3IFWB 1I4GA 2NS5A 4IC7B 3NRZA 2RR9A 1I4QA 2PW9A 2E3TA 3BY4B 4KKJA 4OHJA 1ZDXA 2NCNA 2ICIA 3ZDTA 4BOZB 4R3DA 4DDGD 2W3RA 3Q8BA 3U52E 3X23A 5HG2A 4EFOA 3NS1A 1FNVA 3PSEB 3AE8B 2LZ6A 3JSVB 3AEAB 5G2NA 1WJ6A 4TMAB 1TY0A 3WIMA 3W9CB 4PS3A 1K51A 3TSSA 2A5UA 3M63B 3PLVA 2GMIC 2KDMA 1UUPA 2R2OA 4P1BC 1C4PA 1Y56A 2KKCA 1V2YA 3VUYA 3PV1A 4XZ4A 3RCZA 1PQSA 1XF5L 3RNGC 1WMHA 2QDFA 1Z2MA 1JQ4A 5EE0A 1EU3A 2WXOA 2QILA 2IO2B 3EFUA 2G4DB 1FNUA 5HFYA 3ZDMC 3WA0A 4NAWA 4K7UA 5MPOA 3NVYA 2BGFA 2CJNA 3VQIA 1ZPSA 3I57A 3BK2A 3DHHC 1DOIA 3AE2B 4RM8A 1Z5SB 2I1JA 1E8WA 3OLMD 2PE9A 2ONQA 3Q8EA 4L1BA 1T5XD 2GB1A 3RNFC 4MGIE 4B95A 1P7EA 1ZP0B 3RNCC 3PLUA 2W54A 3P4SB 3Q3NC 2CHXA 2DLBA 2RDBC 3N32A 2NBVB 2PLPA 4EEWA 2M56B 3AE3B 2N1VA 1WYWB 2V9HA 2BT6A 2GBKA 4MT5A 1JW9D 2KTRA 1C1YB 5C3JB 2AQ1B 4OW0A 1SXTA 2WXLA 3RNEC 4A3OA 3IT4B 1CJEA 4JLCA 2RSUA 4ASWC 3QJZA 5CTRC 3KWVA 1JWMD 4NZLB 4TV3A 4XE0A 2IGDA 1WE7A 4KDLB 4YTPB 1I35A 3VRBB 4JGHB 1BMLC 4RGMA 4HKQA 1AW7A 1IGCA 2MX2A 4ARCA 4W9HA 2PMVA 4B0EA 3PVLA 3H6NA 3NVWA 4GGQA 3PHXB 2DWQA 3TEYA 1GB4A 1KM7A 3QIJA 3Q3FA 3QWZB 1SE2A 1QKZA 1YQ3B 3MC0B 2FNJB 2NVUI 3RMKC 4M8NA 1WFYA 3GS2A 2WDRB 1F9JA 3Q3JA 3C0RB 1TIFA 2MCNB 3Q3MC 2WDQB 2ZNVB 2IZVB 1WJ4A 3FAHA 1EM7A 3NHEB 1LXDA 4NJCA 4FJYA 1EF5A 1R4NI 1WXSA 4HVBA 1H4RA 1ZXHA 3BK1A 1F77A 4EUTA 4F7ZA 1IPGA 4ZRQA 2HTHA 2JSVX 4ITKA 1KF6B 2BS4B 2KT7A 4G3XB 4WJNA 4LNIA 3VDZA 2FE8A 3NOBA 3PZDA 2KFKB 2UU7A 3DOWA 3A33B 3ONSA 1R4MB 1WH3A 1WGGA 2WX0A 5LLIA 3W2DA 1AN8A 1WRDB 2MBQA 3KYDD 1ESFA 2KLCA 2WXRA 2NMQA 1Q10A 3QK0A 2DAFA 2RD0A 4RNAA 1TYGB 2JQRB 2YLMA 2LGSA 3SFEB 5KHOA 4NAMA 1F2RC 1YN4A 1M4VA 4PS8A 3VAWA 4HK2A 4HJGE 2JWZA 2EELA 5DPSA 1HEZE 1A70A 1WGDA 2XK5A 1L0XB 3AMZA 4KSLC 2AQ3B 3VH3B 1J0GA 3ZNZB 2J0MA 2K6DB 2LI5A 3DPDA 4ZYNA 1JWUD 4W9JA 4BKTA 1HZ6A 4FJVB 1BT0A 3A1QA 1V5OA 1YX6B 2LJ5A 1MFWA 2JT4B 2IY0B 2DAJA 3H8HA 1OFFA 2IGHA 4BAXA 3VR8B 2KFKA 1E9MA 3RI7C 1QILA 2WU2B 2DYMA 2KN4A 2WXMA 4XC2A 1STEA 1VDVA 4AUQC 1LO5D 2LUMA 1NI3A 3TL5A 3HK0A 5FR6A 4BKSD 3ZTDA 2M1MA 3ZNHB 4GDLA 1YX5B 1VRAB 3T8MA 1EO6A 3A4RA 2BW2A 4IM2A 4US8A 3RULA 3WANA 1UH6A 3BINA 4MM3B 1XLNA 1ZDVA 2PEAA 2RGFA 3QARA 2ZVOA 2N7DA 4FADA 3KH0A 3ZO5B 5AUIA 1WGKA 3IHPC 1XD3B 4KIKB 1SIFA 5G5HA 3HHMA 2G45B 4OZAA 3AEEB 5D2MB 1D4BA 4P6VF 1YIWA 4KDIC 4BOSC 4C56C 1XLPA 3I5JC 4N58A 2KQ4X 2JZZA 2BYVE 1SE4A 1MVKA 1JWSD 2X8XX 4G11A 1V9JA 2KMCA 4HPPA 3WAOA 3AN1A 4RMAA 3DDCB 4MJSB 2D3CA 1HE8A 5D3IB 1F1HA 3OG5A 1RFAA 1BXTA 2D3GA 2JZPA 3BVGA 1QZEA 1OTRB 4QAYA 1ZKHA 2LFIA 5L83A 5G55A 2KAJA 2DBYA 2KK8A 2KVZA 3OAWA 4YSXB 2N9XA 3P4QB 3DBSA 1CQVA 2LRUA 1FMAD 4WWPA 4B0MA 4HKZE 4DDID 5I4DA 3A1QB 5G5GA 3PZ7A 2AEHA 2AYOB 3J9CA 4BVUC 1I4PA 2WYQA 5T8IA 3H7PA 1TTNA 2KDBA 3GE8C 3B08A 1E7VA 2N0SB 2K39A 2RMMA 1HXYD 4YSYB 5BMIA 2LJIA 2W82A 2NTSA 4L2YA 4GIVA 5IO9A 1FRRA 3BYYB 1EUVB 1WGYA 2ZEQA 3TEZA 2O6VB 5D7GA 1EU4A 3DVNU 1OQQA 1E10A 5D3DA 1WGRA 5IA7A 3QAQA 3W1SC 4HLEA 2D10A 1SGHA 2FCSA 2FIDA 3DBLB 1WF9A 3O65B 4DXAB 3UINB 3W5VB 4OVZA 4WH4A 2JPHA 5JZEB 2ZZPB 3AU4A 3OWEB 4II3B 3FILA 3ZNID 1XLOA 2O6VA 2Z59B 5L95C 5D6JB 4RGNA 4W9EA 3UF8A 1EF1A 3CMMB 4DWFA 2LWPA 3H7SA 1L6VA 2WLBA 3I63C 3JVZX 5EE9A 2KDEB 2W55A 4WJPA 2QIEB 2K5PA 4A6QA 1FPYA 2YVCA 3B0AA 2DYOA 1JALA 4PT5A 2BPSA 3Q3OC 2BVCA 2GOWA 4K81A 3C19A 4WAFA 1K50A 1ZUD2 1K52A 1YN3A 2J53A 4K1RB 4OZBA 2V3SA 1LFDA 1I7HA 2I2YA 2KD0A 2PPHA 1SE9A 2KWCA 3PRZA 4NJ7A 2INNE 2GRIA 2EMTA 1WX7A 1IYFA 1FFUA 1KJTA 3AXCA 4C80A 3ML9A 3NVVA 1YJ1A 2M0AA 3NZUA 2N9EB 4CO7A 2QMTA 2KZRA 2REXA 1VZ7A 2D5GA 4AOFA 3ZJUA 3EC8A 4A8XC 2KJ6A 4LJOB 2Y5BB 4DXGA 4FA6A 5J2RA 4KZ0A 1BUIC 4IWQA 1D5MC 4A90A 1E0ZA 4HCPB 3D32A 2MH7A 4MJSA 4EE2A 4HXDA 2ASQA 3MP9A 2L05A 1ISNA 4M01A 1FNWA 2K8HA 5C1ZA 2KWVB 5IN7A 3LDZE 3VTWA 2I1KA 2JXXA 4KX6B 3DQVA 3V61A 1NBFC 3ML8A 2K6QA 3Q6BA 3C8YA 3DHGC 2E6XA 2WNMA 4J6IA 5KHQA 1WJUA 1M94A 3OJ4B 4FHKA 2HDEA 2GBNA 3JYUA 1UD7A 4K7WA 1IGDA 1TKEA 5HHDG 3HUIA 2LGXA 2FCQA 3RNAC 1G6JA 1P98A 3WAMA 4YXDB 1XO3A 1N5WA 1TT5B 3T9LA 4TQ1A 4GMVA 1S1QB 2J0KA 3TCAA 4LK0M 4IM3A 3NZ3A 3AM9A 4DHJB 3VRAB 5J18A 3KW5B 1IBXB 3HVZA 1KH0A 4A20A 1E7UA 1E7PB 3A9KB 2KMAA 3AV8A 1VR9A 1I4XA 2BKFA 2LHDA 2QC8A 3E9SA 2LXAA 3AEDB 2EKIA 1AWDA 3AE7B 3R8BA 3RD2A 4KKIA 2V4LA 3JW0X 2BB5A 3EECA 2N4FA 1ET6A 4HCNB 1SB3C 5BYQA 1QOGA 4TQ0A 3TIXA 4E3CA 3RUIB 1GC7A 5H92C 2Z0DB 1KLGD 4C4VB 1K8RB 4I6NB 2DZKA 3VR9B 2M17A 2GLSA 2CHWA 3B2GA 1C78A 1CMXB 2XN9C 1FEHA 2PE6B 5TSSA 1MG8A 2MBOA 1YD8U 1WMHB 3ZXRA 4RCOA 1UELA 5H8YE 1TKYA 2MJ3A 4NPNA 4BKGA 3H7PB 2M0XA 2J42A 3AECB 2IJ0A 2LVPA 3UQBA 2WXFA 2Y5PA 3A4SC 1KTKA 3V6CB 5C23A 5HI1A 2AL6A 1GAQB 3MC9A 3U4EG 3DBRI 2X38A 4B6WA 3T3OA 2R2QA 4FLHA 1V8CA 3AE5B 2D11A 3KWLA 2LGIA 1F2RI 2KHWB 2KYWA 4RF0A 3AEFB 1Q0WB 3KYCD 4KGTA 2DNFA 2LD9A 1D6EC 3T3NA 3ABVB 1WJNA 2LUEA 3DVNV 2LGYA 1JCKB 3LXFA 1MG4A 5HKHA 3RYTA 1I42A 3FKYA 1P7FA 1FCCC 2IO1B 4WJOA 3PRPB 1WZ0A 4HRSA 3S2AA 4KV2A 1FXIA 3WALA 4HDOA 2CKHB 2KMMA 1ET9A 2DYBA 4LDTB 1N6ZA 1GC6A 3RPFC 1VLBA 2V3NA 4ZRJA 1NEKB 3VFKA 3RZFA 2JYEA 3AEGB 1V80A 1YMHE 3P63A 2LASA 3RT3B 2K9XA 1WI0A 3VUXA 4W9LA 4JL9A 2MBEA 4URKA 4A3PA 2Z0EB 2LRWA 1J8CA 4GU2A 4MM3A 2CU3A 3VTVA 2AWTA 3M95A 4FHJA 1I4HA 4FULA 5LXIB 3WAPA 1YJJA 2NR2A 2KTFA 4E71A 1DYQA 4DQOC 2MBBB 2JY6A 4N59A 3ZGZA 5AEKB 2MP2A 3A9JA 3QQ8B 2KQSA 2RPVA 2L3ZA 5IAAC 3QX1A 2B3AA 1WXVA 1FFVA 3EA6A 4JWUC 4C4VA 3TBLD 1WM3A 4ZDVA 3KUDB 1L4ZB 3UI3A 4XX5A 1T3QA 2BYEA 5D94A 5E6PA 1GG3A 1QOFA 4IWPA 2NTTA 4C00A 1PYWD 4NQKE 2SEBD 1D5ZC 4DHZE 4XWTA 1RM6C 3R2IA 3RFZB 2KWUB 2N9KA 5DPTA 2WXQA 2LGDA 4MGYE 4W9GA 5CHVC 4PS7A 3BVMA 2BB6A 1TS4A 1V5TA 1E8XA 2KC2A 3L54A 3HIZA 4AJYB 2JUOA 1SSNA 3B1LX 1NYQA 4W9IA 4GN1A 4M0WB 1L4DB 3PTFC 1GPXA 4IM0A 1WXMA 1P1AA 2C9WB 4REZA 3DVGX 2Q5WD 4HEA1 4S0RA 5TR5A 3H9DA 1SJHD 4H2AA 4I6PA 3U2SC 3N1ZC 1LGRA 1RLFA 1WXAA 4YSZB 1L7YA 4HPMB 1DOXA 3VUWA 1LQBA 3V60A 2UWQA 1KLVA 2MBHA 3L4PA 4Q2JA 5IKCM 4MEMA 1ZGUB 4LLGM 2CU1A 3GZNI 4LJPB 1JMLA 5CX3A 1T0SC 4II2B 5E6OA 4CQNA 1V81A 3GZNB 4RF1A 3TJPA 2LVOA 3LYYA 2ZCBA 3FC4A 3VHTC 3ZNGC 2PIAA 3W1SA 1T0QC 3Q2AC 4GLSC 1VZ8A 3OJ3A 1L5PA 4WIPA 4AWJA 2L52A 4IWOA 2O6VD 4MSMB 2INDC 4ARIA 4W9CA 1ENFA 3X0WA 1A5RA 5DPRA 4ANUA 1P9DU 4JWSC 3EFCA 2QSDA 3BIID 1B1ZA 1WSPA 2BYFA 1E5WA 5IP4D 1QOAA 2L7RA 3ECIA 4KGRA 4FXCA 2W3SA 1TS5A 1PUTA 1PDXA 2WQYB 3L0WB 3Q8FA 4AQ7A 4JQWC 2WXGA 1MHXA 2RDGA 3MTNB 3U7ZA 2JRIB 2IDYA 3VH4B 1DOYA 4GXBA 4EZLA 1XLQA 1PFDA 1OGWA 2C7HA 1WGHA 1I4RA 3ZIMA 1VCBA 1L6UA 1OQRA 5J17A 3NS8A 4IOIE 2L00B 4MSQB 2VH2A 3MC8A 3L17A 4LNNA 4ANVA 3IG3A 2JF5A 1IBXA 1R7SA 2JRHA 2AL3A 3BVZA 2VRRB 3AB5A 5BO4B 2Z8LA 1PGXA 1XCTL 1UBQA 2K8CA 4JIOU 4P1CC 3B2FA 2FAZA 4XWWA 3PO0A 2FBWB 2WS3B 2J7QB 4YTMB 3HVDA 3ZXVA 2LVQA 2VZKB 4RH6A 2KXJA 1SF0A 2MRPA 3ZKJC 1YNTE 1VZ6A 5LXHA 4XGAB 1XQQA 2LMCA 2IBIB 2V1YA 2IYDB 1ZW7A 4HJKA 3P1MA 4DHZB 3R3MA 4EKUA 1E8ZA 2KX3A 3DCGA 3RN9C 2IO0B 4US9A 2KJRA 4W9FA 2XEWA 2CHZA 4LCDE 2JX5A 4EZKA 1Q1OA 2PJHA 4BBNF 3KQ4A 3IXSA 4O1NA 4RGOS 3ALBA 4YL8A 4TSSA 2KVRA 3W5UB 3NJTA 2DENB 3P42A 1GUAB 3KLSX 5AZGA 5BMHA 2Y5CA 4WURA 4AP4C 1PGAA 4XDDA 1ACCA 3UIPB 3ZRCA 2VZKD 4J3OD 4MGZE 3RZWC 5CHFA 5EE1A 4OZCA 4F8CB 2BWFA 4WQMA 1MI0A 2OJWA 2WWZA 4D2KA 4KVGB 2L32A 2N9PC 3SDLC 3UIOB 3SHQA 1UNSA 4NY0A 3ZYYX 2MJEA 5FKAC 3DHIC 3BZDB 4HROA 3I9V1 1SEBD 3WCQA 2J52A 1XXGA 3LJ3A 1TKGA 1QQRA 2AQ2B 5AZFA 5DPWA 4MACA 3L16A 1V86A 1QF6A 1EWYC 2WXNA 3PREA 3ZTCA 2MJDA 3VTUA 3KUCB 3LB8C 1UF0A 2M8SA 2K3UA 3NZSA 1WR6E 4IW0A 5BMGA 4I6LB 1Q5WB 4C7YA 4EOYA 2WDTB 1C79A 2L0FA 2D3BA 1RYJA 1GJZA 2ZVNA 2ZJDA 4TUUA 2NPTA 3R7QA 4LTUA 1V1OA 4MDKE 2V3PA 4LNKA 4AJWA 1FXTB 1V6EA 4N6EB 2WU5B 2YEPB 3V62A 1KLUD 4UDUC 1F0ZA 3MJ5A 3ZRFA 4PYZA 1SE3A 1HTQA 2IGGA 2KX0A 2DZMA 1N5XA 1WX8A 2KDFB 1TJEA 2PVOD 1C77A 2I38A 2PVGC 4ANWA 2BYTA 5AUKA 4M8MA 2IPKD 2ON8A 5EDSA 3K9OB 2AX5A 2LEKA 3TEXA 4DHJD 4ZYSA 4PK1A 3APCA 3BWUD 2HE7A 3V05A 1RWSA 4F1SA 1FXAA 2D07B 2MA9B 4OVVA 3E56A 2PTLA 4MELA 3H1UA 3TMPB 1D3ZA 3L13A 1HZ5A 4ZRPA 2XK5B 3V6EB 1QT9A 3DWMA 3EUB2 2C7NB 3RNBC 1C4AA 1AYFA 2ZW0A 2JU6X 2KN5A 1RFKA 1MHHE 3AH7A 4DK5A 1WIAA 2K8BA 2L8JA 2QJLA 2JYTA 2OHFA 2PKOA 2IY1B 4BZAA
chains in the Genus database with same CATH topology
4USAA 5T8IA 1D5ZC 1WRIA 4XWTA 1RM6C 3GP7A 5GXGB 5FR3A 3R2IA 3MHZA 4ZHOA 3RFZB 2WXPA 5BYSA 1J7AA 2N0SB 2N9KA 4DXFA 2RMMA 1L0VB 5C2TB 1HXYD 2WXQA 4YSYB 5BMIA 1VJKA 2LJIA 2WXJA 1HA5A 1I4GA 1JRPA 1XCQL 2W82A 3B9JA 2NTSA 4KGSA 3NRZA 3BVMA 2B76B 4L2YA 2BB6A 1I4QA 1TS4A 1FRRA 2E3TA 2PW9A 4KKJA 4OHJA 3BYYB 3ZQ4A 1ZDXA 2ICIA 4R3DA 3TEZA 2W3RA 2K0PA 3Q8BA 5D7GA 1EU4A 1SSNA 3U52E 1OQQA 1NYQA 1E10A 5D3DA 5HG2A 3CWIA 1L4DB 3NS1A 1GPXA 3IAS1 1FNVA 3AE8B 1N63A 4AS1A 3AEAB 4REZA 2Q5WD 2WXKA 4HEA1 4TMAB 1TY0A 1SJHD 2K22A 4H2AA 3W5VB 3W9CB 1HQRD 1K51A 3U2SC 3TSSA 4OVZA 4WH4A 3SFDB 2KDMA 3OWEB 1SIJA 4YSZB 3FILA 1UUPA 1XLOA 3TEWA 1C4PA 1Y56A 1DOXA 5E6JA 1XF5L 4RGNA 3L4PA 4Q2JA 1JQ4A 1C76A 5EE0A 1EU3A 1L6VA 2WLBA 2WXOA 2QILA 4LLGM 5EE3A 5EE9A 1FO4A 1FNUA 2W55A 5HFYA 1YQ4B 2QIEB 3P4RB 5MPOA 1JMLA 2BS3B 2K5PA 3NVYA 4A6QA 2DYOA 4CQNA 4YT0B 2TSSA 1JALA 4RF1A 2CJNA 4PT5A 3VQIA 4ZHPA 3LYYA 1ZPSA 3I57A 3BK2A 4XDCA 1DOIA 3IT6B 3AE2B 3FC4A 1WWTA 4WAFA 1K50A 2JWUA 2PIAA 1ZUD2 1K52A 3ZJVA 1YN3A 2J53A 4OZBA 3W1SA 3MFGA 2ONQA 3Q8EA 4GLSC 1I7HA 4L1BA 1T5XD 2I2YA 1VZ8A 2GB1A 1L5PA 1P7EA 1ZP0B 4WIPA 2W54A 2Y3AA 2INNE 2GRIA 3AE1B 3P4SB 1PGBA 1FFUA 2BTEA 2L52A 2DLBA 4C80A 4GDLB 3NVVA 2M0AA 1WXQA 2QEJC 2PLPA 4ARIA 1TS3A 2M56B 1ENFA 3AE3B 2N7JA 1ZOYB 3HRDD 2BT6A 2QMTA 4JWSC 2QSDA 3BIID 1JW9D 4MT5A 1VZ7A 2ACZB 1B1ZA 1WSPA 2D5GA 5C3JB 4A8XC 3ZJUA 2AQ1B 1QOAA 1SXTA 4KGRA 4OW0A 3PZ8A 2WXLA 2W3SA 4FXCA 1TS5A 1D5XC 1PUTA 1WYGA 1PDXA 2WQYB 3IT4B 4DXGA 1K53A 2FUG1 1BUIC 1CJEA 2BS2B 3Q8FA 1D5MC 4AQ7A 2WXGA 4A90A 1MHXA 2RDGA 2H89B 3KWVA 3U7ZA 1JWMD 1E0ZA 4NZLB 2IDYA 4XE0A 5BYRA 2IGDA 1DOYA 1J7CA 2MH7A 4YTPB 4EE2A 4NAWB 3VRBB 1XLQA 1BMLC 4RGMA 3MP9A 4HKQA 1AW7A 1IGCA 1PFDA 1FNWA 4ARCA 1I4RA 2PMVA 4C7ZA 4B0EA 3NVWA 1T6BX 2DWQA 3TEYA 4KX6B 1GB4A 1L6UA 1OQRA 1SE2A 4IOIE 2RDHA 1QKZA 3C8YA 2E6XA 2WNMA 1YQ3B 1ROEA 3AE9B 4M0WA 2OEDA 3MC0B 1IBXA 3AE4B 3R2TA 2HDEA 1R7SA 3BVZA 3AB5A 1KRHA 1IGDA 3GS2A 2Z8LA 1TKEA 5HHDG 1PGXA 1XCTL 2WDRB 3N9YC 3HUIA 3CIRB 1TY2A 3B2FA 3ZJTA 2WDQB 1XO3A 4YXDB 1N5WA 3DWGC 3FAHA 4XWWA 1EM7A 1V97A 3PO0A 3NVZA 4TQ1A 2FBWB 3ETRA 4NJCA 2WS3B 2ZW1A 4YTMB 3HVDA 1JROA 2VZKB 4RH6A 1UWMA 1E6EB 1ZXHA 3BK1A 1F77A 4LK0M 1SF0A 3AM9A 3NZ3A 3VRAB 1YNTE 4ZRQA 1IBXB 1VZ6A 3HVZA 2BBCA 2JSVX 1TZOA 3Q69A 2LMCA 1KH0A 1KF6B 4ITKA 1E7PB 2BS4B 4JPSA 3AV8A 1NENB 1VR9A 2V4IB 3P1MA 1I4XA 3AEBB 2FE8A 4A55A 3BYTB 4YWGG 2LHDA 3E9SA 3AEDB 2EKIA 2YEPF 1AWDA 3SEBA 3AE7B 3R8BA 1UWXA 4US9A 4KKIA 2BB5A 3W2DA 1AN8A 3P4PB 4IDIA 1KFYB 2JX5A 1ET6A 1SB3C 1GB1A 5BYQA 1ESFA 1SBBB 1QOGA 4TQ0A 3KQ4A 2WXRA 1TS2A 2NMQA 1Q10A 3IXSA 4RNAA 1TYGB 4O1NA 3URYA 2JQRB 4RGOS 1YJIA 4TSSA 1J7BA 3W5UB 1MPEA 5H92C 3SFEB 1UGJA 3P42A 1KLGD 4NAMA 1F2RC 1YN4A 1M4VA 3KLSX 1SJED 5BMHA 2Y5CA 4HJGE 4WURA 1ZE3D 3VR9B 2EELA 2WP9B 1HEZE 1PGAA 4XDDA 1ACCA 4ZOHC 1A70A 3B2GA 1C78A 1EWCA 1L0XB 2XN9C 1FEHA 3AMZA 3FILB 2VZKD 4GDKB 2JXTA 4J3OD 1ZXIA 2AQ3B 2L1AA 3O13A 5TSSA 5EE1A 5JXVA 1N62A 4OZCA 1JWUD 1C9FA 1HZ6A 4WQMA 1MI0A 4RCOA 2G9HD 5H8YE 4D2KA 1TKYA 1CZPA 2MJ3A 2L32A 2L83A 2WXIA 1UNSA 2J42A 3ZYYX 3AECB 2MJEA 2J4XA 4A9AA 2WDVB 2IJ0A 5FKAC 3BZDB 4HROA 3H8HA 1FCLA 1FM0D 1OFFA 2IGHA 3I9V1 1SEBD 3WCQA 3IAM1 3VR8B 2WXFA 2J52A 2Y5PA 1E9MA 3Q8CA 1XXGA 1QILA 1TKGA 2WU2B 1QQRA 1KTKA 2AQ2B 2DYMA 2KN4A 5HI1A 2WXMA 1GAQB 1N61A 4MACA 4MH8A 1QF6A 1V1PA 1EWYC 3U4EG 1STEA 1VDVA 1LO5D 2XNAC 2WXNA 2LUMA 1NI3A 2X38A 3T3OA 4JX1C 2MJDA 1V8CA 3AE5B 1XEEA 3LB8C 4L23A 3KWLA 2LGIA 2K3UA 1F2RI 1DGJA 1IUEA 5BMGA 1VRAB 4C7YA 4JE3B 2BW2A 4RF0A 1CK1A 2GI9A 3AEFB 1C79A 4US8A 1B9RA 2HTME 4KGTA 1QLBB 1D6EC 3T3NA 3ABVB 3TUOA 1RYJA 2MEKA 4MM3B 1JCKB 1XLNA 1YN5A 3LXFA 1ZDVA 4P16A 3SR6A 4LTUA 1V1OA 1P7FA 1FCCC 5AUIA 2V3PA 2R61A 1V1PB 1WGKA 4HRSA 5FK9C 1FIQA 2SAKA 2KWDA 4N6EB 2WU5B 1NYRA 2YEPB 1FXIA 2G1EA 3Q8AA 1KLUD 4UDUC 2KMMA 1ET9A 5G5HA 3MJ5A 1F0ZA 4OZAA 3AEEB 1SE3A 2H88B 3RPFC 1VLBA 1D4BA 2V3NA 2IGGA 4P6VF 1N5XA 4C56C 1NEKB 1XLPA 2M19A 4RGTA 2JYEA 4N58A 3AEGB 1TJEA 1YMHE 2PVOD 2KQ4X 3V3XA 1C77A 3P63A 1GOZA 2I38A 1SE4A 2K9XA 2PVGC 1FD6A 4YTNB 1MVKA 2BYTA 2CJOA 1JWSD 2INPE 5AUKA 2IPKD 2ON8A 2AX5A 2LEKA 3TEXA 3AN1A 4ZYSA 2CU3A 1JWBD 3GB1A 3BWUD 4RFBA 1QOBA 1C4CA 3V05A 5D3IB 1RWSA 1I4HA 1L0YB 1FXAA 2N9LA 3EGRA 1YJJA 3E56A 2PTLA 1N60A 1DYQA 1NVID 4DQOC 1BXTA 2LHEA 2JZPA 3BVGA 4N59A 2LFIA 5LNK1 1HZ5A 2KAJA 2DBYA 4ZRPA 3ZGZA 4WWMA 1QT9A 3AE6B 3DWMA 4YSXB 3P4QB 2RPVA 1CQVA 3EUB2 4IKGA 3EA6A 1FFVA 1FMAD 4JWUC 1C4AA 4B0MA 1AYFA 4HKZE 2ZW0A 2JU6X 1RFKA 2WXHA 1L4ZB 1MHHE 2KACA 3AH7A 5I4DA 2V0GA 3UI3A 1T3QA 2QJLA 5G5GA 2JYTA 3PZ7A 3NUHB 1QOFA 1JWAD 2OHFA 1FRDA 2PKOA 3J9CA 1I4PA 2NTTA 1PYWD 2SEBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJI A;  2L32 A; 
#chains in the Genus database with same CATH topology
 4USA A;  2FUH B;  3GP7 A;  5GXG B;  3VVW B;  3MHZ A;  2A4Z A;  2INC C;  5BYS A;  1J7A A;  1L0V B;  1VJK A;  3JSV A;  1HA5 A;  1XCQ L;  1JRP A;  3B9J A;  3UQA A;  4KGS A;  2B76 B;  1TGZ B;  3ZQ4 A;  2MQJ A;  3L10 B;  4K7S A;  3A9J B;  5JHA A;  2K0P A;  2GBJ A;  1GNU A;  4XYC A;  3CWI A;  3IAS 1;  2CR5 A;  3W1Y A;  1N63 A;  4AS1 A;  4KIK A;  1WZ3 A;  2WXK A;  1X1M A;  4GB9 A;  2KC1 A;  2K22 A;  2RPQ A;  5GMV A;  1HQR D;  1U4A A;  1UGM A;  3SFD B;  4HPL B;  4G50 A;  1Y8R C;  2BQQ A;  1SIJ A;  3N1Y C;  3M3J A;  3MHS D;  2MSE D;  3TEW A;  2BWE S;  2K25 A;  4GOC A;  5E6J A;  4HWI B;  5IOI A;  2J0J A;  2HD5 B;  2ZCC A;  2O2V A;  1C76 A;  2IO3 B;  1R4N B;  4BFR A;  5EE3 A;  1FO4 A;  3AUL A;  1YQ4 B;  3N1X C;  2KFJ A;  3P4R B;  2ZNV C;  2BS3 B;  1MJD A;  4YT0 B;  2TSS A;  1C3T A;  4ZHP A;  2MP2 B;  4XDC A;  4ANX A;  4E74 A;  1NDD A;  3IT6 B;  1WWT A;  2FCM A;  4LDT D;  2JWU A;  3ZJV A;  2W9N A;  3MFG A;  1YOV B;  4FJZ A;  2ZPN A;  2KNB A;  2Y3A A;  3QHT A;  3AE1 B;  3CF6 E;  2EKE C;  1PGB A;  2C5L C;  1HTO A;  1E90 A;  3QC8 B;  2BTE A;  2BF8 B;  4WWO A;  4GDL B;  1WX9 A;  1WXQ A;  2QEJ C;  4W9K A;  1TS3 A;  2WHI A;  5AZH A;  2N7J A;  1ZOY B;  3HRD D;  1NI2 A;  2BKR B;  2ACZ B;  2DZI A;  5JH5 C;  1P3Q U;  3PZ8 A;  1D5X C;  2WGS A;  1WYG A;  1F52 A;  1J19 A;  1K53 A;  3CSF A;  2FUG 1;  2BS2 B;  1V49 A;  2H89 B;  5JHB A;  5BYR A;  1J7C A;  2MW5 A;  4NAW B;  2GBR A;  2DX5 B;  2OOB B;  4C7Z A;  3ZVV A;  1T6B X;  4CYE A;  3KVF B;  2RDH A;  2XBB C;  1UBI A;  2JVC A;  3DBH I;  3KUZ A;  3PHW B;  4X57 B;  1ROE A;  2N7E A;  3AE9 B;  4M0W A;  2OED A;  3AE4 B;  3DBH B;  3R2T A;  1T0R C;  3ZW3 A;  4DBG A;  1KRH A;  4ZRI A;  3N9Y C;  4WAA A;  3CIR B;  1TY2 A;  3ZJT A;  4ACF A;  3DWG C;  3I3T B;  1V97 A;  3NVZ A;  1L2N A;  3ETR A;  4KSK C;  2ZW1 A;  4W9D A;  1JRO A;  2NBW B;  1UWM A;  1E6E B;  4WWN A;  2N1W A;  2BBC A;  1TZO A;  3Q69 A;  4WQO B;  4MGK E;  2G4S A;  4JPS A;  1NEN B;  1WR1 A;  2V4I B;  2MLB A;  3AEB B;  4A55 A;  2NBU A;  3BYT B;  3GE3 C;  4YWG G;  3CST A;  3R66 C;  1VD2 A;  2YEP F;  3SEB A;  2D2Q A;  3PGE A;  3VXW A;  4B9K A;  2KQ7 A;  3AI5 A;  1UWX A;  4HDQ A;  3AU5 A;  3P4P B;  4IDI A;  1LM8 B;  1KFY B;  4NQL B;  1GB1 A;  4RM9 A;  1SBB B;  2FIF A;  3HM3 A;  1TS2 A;  4EZJ A;  2C7M B;  3URY A;  1TBE A;  1YJI A;  1J7B A;  1E8Y A;  1MPE A;  2L76 A;  1UGJ A;  2KJH B;  4OVU A;  1SJE D;  1ZE3 D;  4ICU A;  2WP9 B;  3NG0 A;  4ZOH C;  1EWC A;  2EMS A;  2D3A A;  2JZ3 B;  3FIL B;  4GDK B;  2JXT A;  1ZXI A;  3O13 A;  2L1A A;  1OQY A;  5JXV A;  1N62 A;  1C9F A;  2UYZ B;  2WX1 A;  4ICV A;  2G9H D;  1TZ1 A;  3ZLZ A;  1CZP A;  2L83 A;  2WXI A;  2J4X A;  3PRM B;  4A9A A;  2WDV B;  2DZJ A;  2HJ8 A;  2OJR A;  1XT9 B;  3K9P B;  1T0Y A;  1FCL A;  1FM0 D;  3N30 A;  1WY8 A;  3EHV A;  3IAM 1;  4IUM B;  4LNF A;  2KO3 A;  3Q8C A;  3U8Z A;  3APD A;  4MH0 E;  4M00 A;  4S17 A;  2FCN A;  3N20 C;  4TKN A;  1N61 A;  4MH8 A;  2KTR B;  1V1P A;  3N3K B;  2QHO A;  2XNA C;  1WM2 A;  3ZUN A;  2G3Q B;  4JX1 C;  4NJ6 A;  1XEE A;  2MHJ A;  4L23 A;  1OEY J;  3DBR B;  3HM6 X;  1DGJ A;  1IUE A;  4NNJ B;  3UGB B;  4JE3 B;  1CK1 A;  2GI9 A;  4WJQ A;  1B9R A;  2HTM E;  1QLB B;  2ZPY A;  3TUO A;  2MEK A;  5E6N A;  5DCN A;  2CS4 A;  1R4M I;  1YN5 A;  3Q14 C;  3PS6 A;  4P16 A;  3SR6 A;  2KLG A;  2KOX A;  3MJW A;  1RRB A;  4KZC A;  3GOE A;  2R61 A;  1V1P B;  5FK9 C;  1AAR A;  1FIQ A;  2SAK A;  2KWD A;  4CHK A;  1NYR A;  2MWS B;  4FN2 A;  1P0R A;  2G1E A;  4LNO A;  3Q8A A;  3SD5 A;  2L0T A;  2QCZ A;  2H88 B;  3SU8 X;  4K3B A;  3M62 B;  3DBL I;  1H8C A;  2M19 A;  4RGT A;  1WE6 A;  4BBN C;  2O2V B;  2K1F A;  3V3X A;  1OEY A;  3R7R A;  2VH1 A;  1GOZ A;  5CHW A;  1FD6 A;  4YTN B;  2CJO A;  2INP E;  4GSW A;  4FBJ B;  1RAX A;  2DHZ A;  4GDK A;  2NPT B;  1JWB D;  3GB1 A;  3U30 A;  1IP9 A;  3QA8 A;  4RFB A;  1QOB A;  3PPA A;  1C4C A;  1L0Y B;  2N9L A;  3EGR A;  2LXC A;  1JRU A;  1N60 A;  3ENE A;  1NVI D;  3A9K A;  2LHE A;  3P2B A;  4PYU A;  5LNK 1;  4BKS A;  4WWM A;  3DVG Y;  4G0N B;  3AE6 B;  1S3S G;  3APF A;  4IKG A;  1YQB A;  2WXH A;  2KAC A;  4M02 A;  2C60 A;  3PT2 B;  2V0G A;  3IVF A;  4N9F 4;  1KOT A;  3NY5 A;  2M4N A;  4K3C A;  3NUH B;  1JWA D;  1FRD A;  2KDI A;  2KAN A;  3L08 A;  4IG7 B;  1WRI A;  3U7D A;  5FR3 A;  1UZX B;  2GBM A;  4ZRK A;  4P7I A;  4ZHO A;  2WXP A;  4DXF A;  3IBE A;  3QCA A;  5C2T B;  2HJ1 A;  2WXJ A;  3IFW B;  1I4G A;  2NS5 A;  4IC7 B;  3NRZ A;  2RR9 A;  1I4Q A;  2PW9 A;  2E3T A;  3BY4 B;  4KKJ A;  4OHJ A;  1ZDX A;  2NCN A;  2ICI A;  3ZDT A;  4BOZ B;  4R3D A;  4DDG D;  2W3R A;  3Q8B A;  3U52 E;  3X23 A;  5HG2 A;  4EFO A;  3NS1 A;  1FNV A;  3PSE B;  3AE8 B;  2LZ6 A;  3JSV B;  3AEA B;  5G2N A;  1WJ6 A;  4TMA B;  1TY0 A;  3WIM A;  3W9C B;  4PS3 A;  1K51 A;  3TSS A;  2A5U A;  3M63 B;  3PLV A;  2GMI C;  2KDM A;  1UUP A;  2R2O A;  4P1B C;  1C4P A;  1Y56 A;  2KKC A;  1V2Y A;  3VUY A;  3PV1 A;  4XZ4 A;  3RCZ A;  1PQS A;  1XF5 L;  3RNG C;  1WMH A;  2QDF A;  1Z2M A;  1JQ4 A;  5EE0 A;  1EU3 A;  2WXO A;  2QIL A;  2IO2 B;  3EFU A;  2G4D B;  1FNU A;  5HFY A;  3ZDM C;  3WA0 A;  4NAW A;  4K7U A;  5MPO A;  3NVY A;  2BGF A;  2CJN A;  3VQI A;  1ZPS A;  3I57 A;  3BK2 A;  3DHH C;  1DOI A;  3AE2 B;  4RM8 A;  1Z5S B;  2I1J A;  1E8W A;  3OLM D;  2PE9 A;  2ONQ A;  3Q8E A;  4L1B A;  1T5X D;  2GB1 A;  3RNF C;  4MGI E;  4B95 A;  1P7E A;  1ZP0 B;  3RNC C;  3PLU A;  2W54 A;  3P4S B;  3Q3N C;  2CHX A;  2DLB A;  2RDB C;  3N32 A;  2NBV B;  2PLP A;  4EEW A;  2M56 B;  3AE3 B;  2N1V A;  1WYW B;  2V9H A;  2BT6 A;  2GBK A;  4MT5 A;  1JW9 D;  2KTR A;  1C1Y B;  5C3J B;  2AQ1 B;  4OW0 A;  1SXT A;  2WXL A;  3RNE C;  4A3O A;  3IT4 B;  1CJE A;  4JLC A;  2RSU A;  4ASW C;  3QJZ A;  5CTR C;  3KWV A;  1JWM D;  4NZL B;  4TV3 A;  4XE0 A;  2IGD A;  1WE7 A;  4KDL B;  4YTP B;  1I35 A;  3VRB B;  4JGH B;  1BML C;  4RGM A;  4HKQ A;  1AW7 A;  1IGC A;  2MX2 A;  4ARC A;  4W9H A;  2PMV A;  4B0E A;  3PVL A;  3H6N A;  3NVW A;  4GGQ A;  3PHX B;  2DWQ A;  3TEY A;  1GB4 A;  1KM7 A;  3QIJ A;  3Q3F A;  3QWZ B;  1SE2 A;  1QKZ A;  1YQ3 B;  3MC0 B;  2FNJ B;  2NVU I;  3RMK C;  4M8N A;  1WFY A;  3GS2 A;  2WDR B;  1F9J A;  3Q3J A;  3C0R B;  1TIF A;  2MCN B;  3Q3M C;  2WDQ B;  2ZNV B;  2IZV B;  1WJ4 A;  3FAH A;  1EM7 A;  3NHE B;  1LXD A;  4NJC A;  4FJY A;  1EF5 A;  1R4N I;  1WXS A;  4HVB A;  1H4R A;  1ZXH A;  3BK1 A;  1F77 A;  4EUT A;  4F7Z A;  1IPG A;  4ZRQ A;  2HTH A;  2JSV X;  4ITK A;  1KF6 B;  2BS4 B;  2KT7 A;  4G3X B;  4WJN A;  4LNI A;  3VDZ A;  2FE8 A;  3NOB A;  3PZD A;  2KFK B;  2UU7 A;  3DOW A;  3A33 B;  3ONS A;  1R4M B;  1WH3 A;  1WGG A;  2WX0 A;  5LLI A;  3W2D A;  1AN8 A;  1WRD B;  2MBQ A;  3KYD D;  1ESF A;  2KLC A;  2WXR A;  2NMQ A;  1Q10 A;  3QK0 A;  2DAF A;  2RD0 A;  4RNA A;  1TYG B;  2JQR B;  2YLM A;  2LGS A;  3SFE B;  5KHO A;  4NAM A;  1F2R C;  1YN4 A;  1M4V A;  4PS8 A;  3VAW A;  4HK2 A;  4HJG E;  2JWZ A;  2EEL A;  5DPS A;  1HEZ E;  1A70 A;  1WGD A;  2XK5 A;  1L0X B;  3AMZ A;  4KSL C;  2AQ3 B;  3VH3 B;  1J0G A;  3ZNZ B;  2J0M A;  2K6D B;  2LI5 A;  3DPD A;  4ZYN A;  1JWU D;  4W9J A;  4BKT A;  1HZ6 A;  4FJV B;  1BT0 A;  3A1Q A;  1V5O A;  1YX6 B;  2LJ5 A;  1MFW A;  2JT4 B;  2IY0 B;  2DAJ A;  3H8H A;  1OFF A;  2IGH A;  4BAX A;  3VR8 B;  2KFK A;  1E9M A;  3RI7 C;  1QIL A;  2WU2 B;  2DYM A;  2KN4 A;  2WXM A;  4XC2 A;  1STE A;  1VDV A;  4AUQ C;  1LO5 D;  2LUM A;  1NI3 A;  3TL5 A;  3HK0 A;  5FR6 A;  4BKS D;  3ZTD A;  2M1M A;  3ZNH B;  4GDL A;  1YX5 B;  1VRA B;  3T8M A;  1EO6 A;  3A4R A;  2BW2 A;  4IM2 A;  4US8 A;  3RUL A;  3WAN A;  1UH6 A;  3BIN A;  4MM3 B;  1XLN A;  1ZDV A;  2PEA A;  2RGF A;  3QAR A;  2ZVO A;  2N7D A;  4FAD A;  3KH0 A;  3ZO5 B;  5AUI A;  1WGK A;  3IHP C;  1XD3 B;  4KIK B;  1SIF A;  5G5H A;  3HHM A;  2G45 B;  4OZA A;  3AEE B;  5D2M B;  1D4B A;  4P6V F;  1YIW A;  4KDI C;  4BOS C;  4C56 C;  1XLP A;  3I5J C;  4N58 A;  2KQ4 X;  2JZZ A;  2BYV E;  1SE4 A;  1MVK A;  1JWS D;  2X8X X;  4G11 A;  1V9J A;  2KMC A;  4HPP A;  3WAO A;  3AN1 A;  4RMA A;  3DDC B;  4MJS B;  2D3C A;  1HE8 A;  5D3I B;  1F1H A;  3OG5 A;  1RFA A;  1BXT A;  2D3G A;  2JZP A;  3BVG A;  1QZE A;  1OTR B;  4QAY A;  1ZKH A;  2LFI A;  5L83 A;  5G55 A;  2KAJ A;  2DBY A;  2KK8 A;  2KVZ A;  3OAW A;  4YSX B;  2N9X A;  3P4Q B;  3DBS A;  1CQV A;  2LRU A;  1FMA D;  4WWP A;  4B0M A;  4HKZ E;  4DDI D;  5I4D A;  3A1Q B;  5G5G A;  3PZ7 A;  2AEH A;  2AYO B;  3J9C A;  4BVU C;  1I4P A;  2WYQ A;  5T8I A;  3H7P A;  1TTN A;  2KDB A;  3GE8 C;  3B08 A;  1E7V A;  2N0S B;  2K39 A;  2RMM A;  1HXY D;  4YSY B;  5BMI A;  2LJI A;  2W82 A;  2NTS A;  4L2Y A;  4GIV A;  5IO9 A;  1FRR A;  3BYY B;  1EUV B;  1WGY A;  2ZEQ A;  3TEZ A;  2O6V B;  5D7G A;  1EU4 A;  3DVN U;  1OQQ A;  1E10 A;  5D3D A;  1WGR A;  5IA7 A;  3QAQ A;  3W1S C;  4HLE A;  2D10 A;  1SGH A;  2FCS A;  2FID A;  3DBL B;  1WF9 A;  3O65 B;  4DXA B;  3UIN B;  3W5V B;  4OVZ A;  4WH4 A;  2JPH A;  5JZE B;  2ZZP B;  3AU4 A;  3OWE B;  4II3 B;  3FIL A;  3ZNI D;  1XLO A;  2O6V A;  2Z59 B;  5L95 C;  5D6J B;  4RGN A;  4W9E A;  3UF8 A;  1EF1 A;  3CMM B;  4DWF A;  2LWP A;  3H7S A;  1L6V A;  2WLB A;  3I63 C;  3JVZ X;  5EE9 A;  2KDE B;  2W55 A;  4WJP A;  2QIE B;  2K5P A;  4A6Q A;  1FPY A;  2YVC A;  3B0A A;  2DYO A;  1JAL A;  4PT5 A;  2BPS A;  3Q3O C;  2BVC A;  2GOW A;  4K81 A;  3C19 A;  4WAF A;  1K50 A;  1ZUD 2;  1K52 A;  1YN3 A;  2J53 A;  4K1R B;  4OZB A;  2V3S A;  1LFD A;  1I7H A;  2I2Y A;  2KD0 A;  2PPH A;  1SE9 A;  2KWC A;  3PRZ A;  4NJ7 A;  2INN E;  2GRI A;  2EMT A;  1WX7 A;  1IYF A;  1FFU A;  1KJT A;  3AXC A;  4C80 A;  3ML9 A;  3NVV A;  1YJ1 A;  2M0A A;  3NZU A;  2N9E B;  4CO7 A;  2QMT A;  2KZR A;  2REX A;  1VZ7 A;  2D5G A;  4AOF A;  3ZJU A;  3EC8 A;  4A8X C;  2KJ6 A;  4LJO B;  2Y5B B;  4DXG A;  4FA6 A;  5J2R A;  4KZ0 A;  1BUI C;  4IWQ A;  1D5M C;  4A90 A;  1E0Z A;  4HCP B;  3D32 A;  2MH7 A;  4MJS A;  4EE2 A;  4HXD A;  2ASQ A;  3MP9 A;  2L05 A;  1ISN A;  4M01 A;  1FNW A;  2K8H A;  5C1Z A;  2KWV B;  5IN7 A;  3LDZ E;  3VTW A;  2I1K A;  2JXX A;  4KX6 B;  3DQV A;  3V61 A;  1NBF C;  3ML8 A;  2K6Q A;  3Q6B A;  3C8Y A;  3DHG C;  2E6X A;  2WNM A;  4J6I A;  5KHQ A;  1WJU A;  1M94 A;  3OJ4 B;  4FHK A;  2HDE A;  2GBN A;  3JYU A;  1UD7 A;  4K7W A;  1IGD A;  1TKE A;  5HHD G;  3HUI A;  2LGX A;  2FCQ A;  3RNA C;  1G6J A;  1P98 A;  3WAM A;  4YXD B;  1XO3 A;  1N5W A;  1TT5 B;  3T9L A;  4TQ1 A;  4GMV A;  1S1Q B;  2J0K A;  3TCA A;  4LK0 M;  4IM3 A;  3NZ3 A;  3AM9 A;  4DHJ B;  3VRA B;  5J18 A;  3KW5 B;  1IBX B;  3HVZ A;  1KH0 A;  4A20 A;  1E7U A;  1E7P B;  3A9K B;  2KMA A;  3AV8 A;  1VR9 A;  1I4X A;  2BKF A;  2LHD A;  2QC8 A;  3E9S A;  2LXA A;  3AED B;  2EKI A;  1AWD A;  3AE7 B;  3R8B A;  3RD2 A;  4KKI A;  2V4L A;  3JW0 X;  2BB5 A;  3EEC A;  2N4F A;  1ET6 A;  4HCN B;  1SB3 C;  5BYQ A;  1QOG A;  4TQ0 A;  3TIX A;  4E3C A;  3RUI B;  1GC7 A;  5H92 C;  2Z0D B;  1KLG D;  4C4V B;  1K8R B;  4I6N B;  2DZK A;  3VR9 B;  2M17 A;  2GLS A;  2CHW A;  3B2G A;  1C78 A;  1CMX B;  2XN9 C;  1FEH A;  2PE6 B;  5TSS A;  1MG8 A;  2MBO A;  1YD8 U;  1WMH B;  3ZXR A;  4RCO A;  1UEL A;  5H8Y E;  1TKY A;  2MJ3 A;  4NPN A;  4BKG A;  3H7P B;  2M0X A;  2J42 A;  3AEC B;  2IJ0 A;  2LVP A;  3UQB A;  2WXF A;  2Y5P A;  3A4S C;  1KTK A;  3V6C B;  5C23 A;  5HI1 A;  2AL6 A;  1GAQ B;  3MC9 A;  3U4E G;  3DBR I;  2X38 A;  4B6W A;  3T3O A;  2R2Q A;  4FLH A;  1V8C A;  3AE5 B;  2D11 A;  3KWL A;  2LGI A;  1F2R I;  2KHW B;  2KYW A;  4RF0 A;  3AEF B;  1Q0W B;  3KYC D;  4KGT A;  2DNF A;  2LD9 A;  1D6E C;  3T3N A;  3ABV B;  1WJN A;  2LUE A;  3DVN V;  2LGY A;  1JCK B;  3LXF A;  1MG4 A;  5HKH A;  3RYT A;  1I42 A;  3FKY A;  1P7F A;  1FCC C;  2IO1 B;  4WJO A;  3PRP B;  1WZ0 A;  4HRS A;  3S2A A;  4KV2 A;  1FXI A;  3WAL A;  4HDO A;  2CKH B;  2KMM A;  1ET9 A;  2DYB A;  4LDT B;  1N6Z A;  1GC6 A;  3RPF C;  1VLB A;  2V3N A;  4ZRJ A;  1NEK B;  3VFK A;  3RZF A;  2JYE A;  3AEG B;  1V80 A;  1YMH E;  3P63 A;  2LAS A;  3RT3 B;  2K9X A;  1WI0 A;  3VUX A;  4W9L A;  4JL9 A;  2MBE A;  4URK A;  4A3P A;  2Z0E B;  2LRW A;  1J8C A;  4GU2 A;  4MM3 A;  2CU3 A;  3VTV A;  2AWT A;  3M95 A;  4FHJ A;  1I4H A;  4FUL A;  5LXI B;  3WAP A;  1YJJ A;  2NR2 A;  2KTF A;  4E71 A;  1DYQ A;  4DQO C;  2MBB B;  2JY6 A;  4N59 A;  3ZGZ A;  5AEK B;  2MP2 A;  3A9J A;  3QQ8 B;  2KQS A;  2RPV A;  2L3Z A;  5IAA C;  3QX1 A;  2B3A A;  1WXV A;  1FFV A;  3EA6 A;  4JWU C;  4C4V A;  3TBL D;  1WM3 A;  4ZDV A;  3KUD B;  1L4Z B;  3UI3 A;  4XX5 A;  1T3Q A;  2BYE A;  5D94 A;  5E6P A;  1GG3 A;  1QOF A;  4IWP A;  2NTT A;  4C00 A;  1PYW D;  4NQK E;  2SEB D;  1D5Z C;  4DHZ E;  4XWT A;  1RM6 C;  3R2I A;  3RFZ B;  2KWU B;  2N9K A;  5DPT A;  2WXQ A;  2LGD A;  4MGY E;  4W9G A;  5CHV C;  4PS7 A;  3BVM A;  2BB6 A;  1TS4 A;  1V5T A;  1E8X A;  2KC2 A;  3L54 A;  3HIZ A;  4AJY B;  2JUO A;  1SSN A;  3B1L X;  1NYQ A;  4W9I A;  4GN1 A;  4M0W B;  1L4D B;  3PTF C;  1GPX A;  4IM0 A;  1WXM A;  1P1A A;  2C9W B;  4REZ A;  3DVG X;  2Q5W D;  4HEA 1;  4S0R A;  5TR5 A;  3H9D A;  1SJH D;  4H2A A;  4I6P A;  3U2S C;  3N1Z C;  1LGR A;  1RLF A;  1WXA A;  4YSZ B;  1L7Y A;  4HPM B;  1DOX A;  3VUW A;  1LQB A;  3V60 A;  2UWQ A;  1KLV A;  2MBH A;  3L4P A;  4Q2J A;  5IKC M;  4MEM A;  1ZGU B;  4LLG M;  2CU1 A;  3GZN I;  4LJP B;  1JML A;  5CX3 A;  1T0S C;  4II2 B;  5E6O A;  4CQN A;  1V81 A;  3GZN B;  4RF1 A;  3TJP A;  2LVO A;  3LYY A;  2ZCB A;  3FC4 A;  3VHT C;  3ZNG C;  2PIA A;  3W1S A;  1T0Q C;  3Q2A C;  4GLS C;  1VZ8 A;  3OJ3 A;  1L5P A;  4WIP A;  4AWJ A;  2L52 A;  4IWO A;  2O6V D;  4MSM B;  2IND C;  4ARI A;  4W9C A;  1ENF A;  3X0W A;  1A5R A;  5DPR A;  4ANU A;  1P9D U;  4JWS C;  3EFC A;  2QSD A;  3BII D;  1B1Z A;  1WSP A;  2BYF A;  1E5W A;  5IP4 D;  1QOA A;  2L7R A;  3ECI A;  4KGR A;  4FXC A;  2W3S A;  1TS5 A;  1PUT A;  1PDX A;  2WQY B;  3L0W B;  3Q8F A;  4AQ7 A;  4JQW C;  2WXG A;  1MHX A;  2RDG A;  3MTN B;  3U7Z A;  2JRI B;  2IDY A;  3VH4 B;  1DOY A;  4GXB A;  4EZL A;  1XLQ A;  1PFD A;  1OGW A;  2C7H A;  1WGH A;  1I4R A;  3ZIM A;  1VCB A;  1L6U A;  1OQR A;  5J17 A;  3NS8 A;  4IOI E;  2L00 B;  4MSQ B;  2VH2 A;  3MC8 A;  3L17 A;  4LNN A;  4ANV A;  3IG3 A;  2JF5 A;  1IBX A;  1R7S A;  2JRH A;  2AL3 A;  3BVZ A;  2VRR B;  3AB5 A;  5BO4 B;  2Z8L A;  1PGX A;  1XCT L;  1UBQ A;  2K8C A;  4JIO U;  4P1C C;  3B2F A;  2FAZ A;  4XWW A;  3PO0 A;  2FBW B;  2WS3 B;  2J7Q B;  4YTM B;  3HVD A;  3ZXV A;  2LVQ A;  2VZK B;  4RH6 A;  2KXJ A;  1SF0 A;  2MRP A;  3ZKJ C;  1YNT E;  1VZ6 A;  5LXH A;  4XGA B;  1XQQ A;  2LMC A;  2IBI B;  2V1Y A;  2IYD B;  1ZW7 A;  4HJK A;  3P1M A;  4DHZ B;  3R3M A;  4EKU A;  1E8Z A;  2KX3 A;  3DCG A;  3RN9 C;  2IO0 B;  4US9 A;  2KJR A;  4W9F A;  2XEW A;  2CHZ A;  4LCD E;  2JX5 A;  4EZK A;  1Q1O A;  2PJH A;  4BBN F;  3KQ4 A;  3IXS A;  4O1N A;  4RGO S;  3ALB A;  4YL8 A;  4TSS A;  2KVR A;  3W5U B;  3NJT A;  2DEN B;  3P42 A;  1GUA B;  3KLS X;  5AZG A;  5BMH A;  2Y5C A;  4WUR A;  4AP4 C;  1PGA A;  4XDD A;  1ACC A;  3UIP B;  3ZRC A;  2VZK D;  4J3O D;  4MGZ E;  3RZW C;  5CHF A;  5EE1 A;  4OZC A;  4F8C B;  2BWF A;  4WQM A;  1MI0 A;  2OJW A;  2WWZ A;  4D2K A;  4KVG B;  2L32 A;  2N9P C;  3SDL C;  3UIO B;  3SHQ A;  1UNS A;  4NY0 A;  3ZYY X;  2MJE A;  5FKA C;  3DHI C;  3BZD B;  4HRO A;  3I9V 1;  1SEB D;  3WCQ A;  2J52 A;  1XXG A;  3LJ3 A;  1TKG A;  1QQR A;  2AQ2 B;  5AZF A;  5DPW A;  4MAC A;  3L16 A;  1V86 A;  1QF6 A;  1EWY C;  2WXN A;  3PRE A;  3ZTC A;  2MJD A;  3VTU A;  3KUC B;  3LB8 C;  1UF0 A;  2M8S A;  2K3U A;  3NZS A;  1WR6 E;  4IW0 A;  5BMG A;  4I6L B;  1Q5W B;  4C7Y A;  4EOY A;  2WDT B;  1C79 A;  2L0F A;  2D3B A;  1RYJ A;  1GJZ A;  2ZVN A;  2ZJD A;  4TUU A;  2NPT A;  3R7Q A;  4LTU A;  1V1O A;  4MDK E;  2V3P A;  4LNK A;  4AJW A;  1FXT B;  1V6E A;  4N6E B;  2WU5 B;  2YEP B;  3V62 A;  1KLU D;  4UDU C;  1F0Z A;  3MJ5 A;  3ZRF A;  4PYZ A;  1SE3 A;  1HTQ A;  2IGG A;  2KX0 A;  2DZM A;  1N5X A;  1WX8 A;  2KDF B;  1TJE A;  2PVO D;  1C77 A;  2I38 A;  2PVG C;  4ANW A;  2BYT A;  5AUK A;  4M8M A;  2IPK D;  2ON8 A;  5EDS A;  3K9O B;  2AX5 A;  2LEK A;  3TEX A;  4DHJ D;  4ZYS A;  4PK1 A;  3APC A;  3BWU D;  2HE7 A;  3V05 A;  1RWS A;  4F1S A;  1FXA A;  2D07 B;  2MA9 B;  4OVV A;  3E56 A;  2PTL A;  4MEL A;  3H1U A;  3TMP B;  1D3Z A;  3L13 A;  1HZ5 A;  4ZRP A;  2XK5 B;  3V6E B;  1QT9 A;  3DWM A;  3EUB 2;  2C7N B;  3RNB C;  1C4A A;  1AYF A;  2ZW0 A;  2JU6 X;  2KN5 A;  1RFK A;  1MHH E;  3AH7 A;  4DK5 A;  1WIA A;  2K8B A;  2L8J A;  2QJL A;  2JYT A;  2OHF A;  2PKO A;  2IY1 B;  4BZA A; 
#chains in the Genus database with same CATH homology
 4USA A;  5T8I A;  1D5Z C;  1WRI A;  4XWT A;  1RM6 C;  3GP7 A;  5GXG B;  5FR3 A;  3R2I A;  3MHZ A;  4ZHO A;  3RFZ B;  2WXP A;  5BYS A;  1J7A A;  2N0S B;  2N9K A;  4DXF A;  2RMM A;  1L0V B;  5C2T B;  1HXY D;  2WXQ A;  4YSY B;  5BMI A;  1VJK A;  2LJI A;  2WXJ A;  1HA5 A;  1I4G A;  1JRP A;  1XCQ L;  2W82 A;  3B9J A;  2NTS A;  4KGS A;  3NRZ A;  3BVM A;  2B76 B;  4L2Y A;  2BB6 A;  1I4Q A;  1TS4 A;  1FRR A;  2E3T A;  2PW9 A;  4KKJ A;  4OHJ A;  3BYY B;  3ZQ4 A;  1ZDX A;  2ICI A;  4R3D A;  3TEZ A;  2W3R A;  2K0P A;  3Q8B A;  5D7G A;  1EU4 A;  1SSN A;  3U52 E;  1OQQ A;  1NYQ A;  1E10 A;  5D3D A;  5HG2 A;  3CWI A;  1L4D B;  3NS1 A;  1GPX A;  3IAS 1;  1FNV A;  3AE8 B;  1N63 A;  4AS1 A;  3AEA B;  4REZ A;  2Q5W D;  2WXK A;  4HEA 1;  4TMA B;  1TY0 A;  1SJH D;  2K22 A;  4H2A A;  3W5V B;  3W9C B;  1HQR D;  1K51 A;  3U2S C;  3TSS A;  4OVZ A;  4WH4 A;  3SFD B;  2KDM A;  3OWE B;  1SIJ A;  4YSZ B;  3FIL A;  1UUP A;  1XLO A;  3TEW A;  1C4P A;  1Y56 A;  1DOX A;  5E6J A;  1XF5 L;  4RGN A;  3L4P A;  4Q2J A;  1JQ4 A;  1C76 A;  5EE0 A;  1EU3 A;  1L6V A;  2WLB A;  2WXO A;  2QIL A;  4LLG M;  5EE3 A;  5EE9 A;  1FO4 A;  1FNU A;  2W55 A;  5HFY A;  1YQ4 B;  2QIE B;  3P4R B;  5MPO A;  1JML A;  2BS3 B;  2K5P A;  3NVY A;  4A6Q A;  2DYO A;  4CQN A;  4YT0 B;  2TSS A;  1JAL A;  4RF1 A;  2CJN A;  4PT5 A;  3VQI A;  4ZHP A;  3LYY A;  1ZPS A;  3I57 A;  3BK2 A;  4XDC A;  1DOI A;  3IT6 B;  3AE2 B;  3FC4 A;  1WWT A;  4WAF A;  1K50 A;  2JWU A;  2PIA A;  1ZUD 2;  1K52 A;  3ZJV A;  1YN3 A;  2J53 A;  4OZB A;  3W1S A;  3MFG A;  2ONQ A;  3Q8E A;  4GLS C;  1I7H A;  4L1B A;  1T5X D;  2I2Y A;  1VZ8 A;  2GB1 A;  1L5P A;  1P7E A;  1ZP0 B;  4WIP A;  2W54 A;  2Y3A A;  2INN E;  2GRI A;  3AE1 B;  3P4S B;  1PGB A;  1FFU A;  2BTE A;  2L52 A;  2DLB A;  4C80 A;  4GDL B;  3NVV A;  2M0A A;  1WXQ A;  2QEJ C;  2PLP A;  4ARI A;  1TS3 A;  2M56 B;  1ENF A;  3AE3 B;  2N7J A;  1ZOY B;  3HRD D;  2BT6 A;  2QMT A;  4JWS C;  2QSD A;  3BII D;  1JW9 D;  4MT5 A;  1VZ7 A;  2ACZ B;  1B1Z A;  1WSP A;  2D5G A;  5C3J B;  4A8X C;  3ZJU A;  2AQ1 B;  1QOA A;  1SXT A;  4KGR A;  4OW0 A;  3PZ8 A;  2WXL A;  2W3S A;  4FXC A;  1TS5 A;  1D5X C;  1PUT A;  1WYG A;  1PDX A;  2WQY B;  3IT4 B;  4DXG A;  1K53 A;  2FUG 1;  1BUI C;  1CJE A;  2BS2 B;  3Q8F A;  1D5M C;  4AQ7 A;  2WXG A;  4A90 A;  1MHX A;  2RDG A;  2H89 B;  3KWV A;  3U7Z A;  1JWM D;  1E0Z A;  4NZL B;  2IDY A;  4XE0 A;  5BYR A;  2IGD A;  1DOY A;  1J7C A;  2MH7 A;  4YTP B;  4EE2 A;  4NAW B;  3VRB B;  1XLQ A;  1BML C;  4RGM A;  3MP9 A;  4HKQ A;  1AW7 A;  1IGC A;  1PFD A;  1FNW A;  4ARC A;  1I4R A;  2PMV A;  4C7Z A;  4B0E A;  3NVW A;  1T6B X;  2DWQ A;  3TEY A;  4KX6 B;  1GB4 A;  1L6U A;  1OQR A;  1SE2 A;  4IOI E;  2RDH A;  1QKZ A;  3C8Y A;  2E6X A;  2WNM A;  1YQ3 B;  1ROE A;  3AE9 B;  4M0W A;  2OED A;  3MC0 B;  1IBX A;  3AE4 B;  3R2T A;  2HDE A;  1R7S A;  3BVZ A;  3AB5 A;  1KRH A;  1IGD A;  3GS2 A;  2Z8L A;  1TKE A;  5HHD G;  1PGX A;  1XCT L;  2WDR B;  3N9Y C;  3HUI A;  3CIR B;  1TY2 A;  3B2F A;  3ZJT A;  2WDQ B;  1XO3 A;  4YXD B;  1N5W A;  3DWG C;  3FAH A;  4XWW A;  1EM7 A;  1V97 A;  3PO0 A;  3NVZ A;  4TQ1 A;  2FBW B;  3ETR A;  4NJC A;  2WS3 B;  2ZW1 A;  4YTM B;  3HVD A;  1JRO A;  2VZK B;  4RH6 A;  1UWM A;  1E6E B;  1ZXH A;  3BK1 A;  1F77 A;  4LK0 M;  1SF0 A;  3AM9 A;  3NZ3 A;  3VRA B;  1YNT E;  4ZRQ A;  1IBX B;  1VZ6 A;  3HVZ A;  2BBC A;  2JSV X;  1TZO A;  3Q69 A;  2LMC A;  1KH0 A;  1KF6 B;  4ITK A;  1E7P B;  2BS4 B;  4JPS A;  3AV8 A;  1NEN B;  1VR9 A;  2V4I B;  3P1M A;  1I4X A;  3AEB B;  2FE8 A;  4A55 A;  3BYT B;  4YWG G;  2LHD A;  3E9S A;  3AED B;  2EKI A;  2YEP F;  1AWD A;  3SEB A;  3AE7 B;  3R8B A;  1UWX A;  4US9 A;  4KKI A;  2BB5 A;  3W2D A;  1AN8 A;  3P4P B;  4IDI A;  1KFY B;  2JX5 A;  1ET6 A;  1SB3 C;  1GB1 A;  5BYQ A;  1ESF A;  1SBB B;  1QOG A;  4TQ0 A;  3KQ4 A;  2WXR A;  1TS2 A;  2NMQ A;  1Q10 A;  3IXS A;  4RNA A;  1TYG B;  4O1N A;  3URY A;  2JQR B;  4RGO S;  1YJI A;  4TSS A;  1J7B A;  3W5U B;  1MPE A;  5H92 C;  3SFE B;  1UGJ A;  3P42 A;  1KLG D;  4NAM A;  1F2R C;  1YN4 A;  1M4V A;  3KLS X;  1SJE D;  5BMH A;  2Y5C A;  4HJG E;  4WUR A;  1ZE3 D;  3VR9 B;  2EEL A;  2WP9 B;  1HEZ E;  1PGA A;  4XDD A;  1ACC A;  4ZOH C;  1A70 A;  3B2G A;  1C78 A;  1EWC A;  1L0X B;  2XN9 C;  1FEH A;  3AMZ A;  3FIL B;  2VZK D;  4GDK B;  2JXT A;  4J3O D;  1ZXI A;  2AQ3 B;  2L1A A;  3O13 A;  5TSS A;  5EE1 A;  5JXV A;  1N62 A;  4OZC A;  1JWU D;  1C9F A;  1HZ6 A;  4WQM A;  1MI0 A;  4RCO A;  2G9H D;  5H8Y E;  4D2K A;  1TKY A;  1CZP A;  2MJ3 A;  2L32 A;  2L83 A;  2WXI A;  1UNS A;  2J42 A;  3ZYY X;  3AEC B;  2MJE A;  2J4X A;  4A9A A;  2WDV B;  2IJ0 A;  5FKA C;  3BZD B;  4HRO A;  3H8H A;  1FCL A;  1FM0 D;  1OFF A;  2IGH A;  3I9V 1;  1SEB D;  3WCQ A;  3IAM 1;  3VR8 B;  2WXF A;  2J52 A;  2Y5P A;  1E9M A;  3Q8C A;  1XXG A;  1QIL A;  1TKG A;  2WU2 B;  1QQR A;  1KTK A;  2AQ2 B;  2DYM A;  2KN4 A;  5HI1 A;  2WXM A;  1GAQ B;  1N61 A;  4MAC A;  4MH8 A;  1QF6 A;  1V1P A;  1EWY C;  3U4E G;  1STE A;  1VDV A;  1LO5 D;  2XNA C;  2WXN A;  2LUM A;  1NI3 A;  2X38 A;  3T3O A;  4JX1 C;  2MJD A;  1V8C A;  3AE5 B;  1XEE A;  3LB8 C;  4L23 A;  3KWL A;  2LGI A;  2K3U A;  1F2R I;  1DGJ A;  1IUE A;  5BMG A;  1VRA B;  4C7Y A;  4JE3 B;  2BW2 A;  4RF0 A;  1CK1 A;  2GI9 A;  3AEF B;  1C79 A;  4US8 A;  1B9R A;  2HTM E;  4KGT A;  1QLB B;  1D6E C;  3T3N A;  3ABV B;  3TUO A;  1RYJ A;  2MEK A;  4MM3 B;  1JCK B;  1XLN A;  1YN5 A;  3LXF A;  1ZDV A;  4P16 A;  3SR6 A;  4LTU A;  1V1O A;  1P7F A;  1FCC C;  5AUI A;  2V3P A;  2R61 A;  1V1P B;  1WGK A;  4HRS A;  5FK9 C;  1FIQ A;  2SAK A;  2KWD A;  4N6E B;  2WU5 B;  1NYR A;  2YEP B;  1FXI A;  2G1E A;  3Q8A A;  1KLU D;  4UDU C;  2KMM A;  1ET9 A;  5G5H A;  3MJ5 A;  1F0Z A;  4OZA A;  3AEE B;  1SE3 A;  2H88 B;  3RPF C;  1VLB A;  1D4B A;  2V3N A;  2IGG A;  4P6V F;  1N5X A;  4C56 C;  1NEK B;  1XLP A;  2M19 A;  4RGT A;  2JYE A;  4N58 A;  3AEG B;  1TJE A;  1YMH E;  2PVO D;  2KQ4 X;  3V3X A;  1C77 A;  3P63 A;  1GOZ A;  2I38 A;  1SE4 A;  2K9X A;  2PVG C;  1FD6 A;  4YTN B;  1MVK A;  2BYT A;  2CJO A;  1JWS D;  2INP E;  5AUK A;  2IPK D;  2ON8 A;  2AX5 A;  2LEK A;  3TEX A;  3AN1 A;  4ZYS A;  2CU3 A;  1JWB D;  3GB1 A;  3BWU D;  4RFB A;  1QOB A;  1C4C A;  3V05 A;  5D3I B;  1RWS A;  1I4H A;  1L0Y B;  1FXA A;  2N9L A;  3EGR A;  1YJJ A;  3E56 A;  2PTL A;  1N60 A;  1DYQ A;  1NVI D;  4DQO C;  1BXT A;  2LHE A;  2JZP A;  3BVG A;  4N59 A;  2LFI A;  5LNK 1;  1HZ5 A;  2KAJ A;  2DBY A;  4ZRP A;  3ZGZ A;  4WWM A;  1QT9 A;  3AE6 B;  3DWM A;  4YSX B;  3P4Q B;  2RPV A;  1CQV A;  3EUB 2;  4IKG A;  3EA6 A;  1FFV A;  1FMA D;  4JWU C;  1C4A A;  4B0M A;  1AYF A;  4HKZ E;  2ZW0 A;  2JU6 X;  1RFK A;  2WXH A;  1L4Z B;  1MHH E;  2KAC A;  3AH7 A;  5I4D A;  2V0G A;  3UI3 A;  1T3Q A;  2QJL A;  5G5G A;  2JYT A;  3PZ7 A;  3NUH B;  1QOF A;  1JWA D;  2OHF A;  1FRD A;  2PKO A;  3J9C A;  1I4P A;  2NTT A;  1PYW D;  2SEB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...