2L32A

Solution structure of ubiquitin-like small archaeal modifier protein in haloferax volcanii
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
66
structure length
66
Chain Sequence
MNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Small archaeal modifier protein 2
publication title solution structure of ubiquitin-like small archaeal modifier protein in Haloferax volcanii
rcsb
source organism Haloferax volcanii
total genus 4
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.630 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2l32A00
2LJIA 2L32A
chains in the Genus database with same CATH superfamily
1C4AA 4HCPB 2CR5A 1XCTL 4MJSB 3SU8X 2I38A 1JROA 2KFJA 2M8SA 2KDMA 5IKCM 4EKUA 4ICUA 1WXAA 2WS3B 2DLBA 2L3ZA 3N3KB 3NVYA 1IPGA 2MJEA 1RLFA 1FFUA 1MHHE 2BVCA 4YL8A 3AE7B 3MP9A 3DBRI 3BIID 5L83A 5TR5A 3VR8B 3KVFB 1WX9A 3M95A 2JZ3B 4FJVB 3UIPB 4ZOHC 3Q8AA 3UI3A 4JPSA 1TKGA 3RNBC 1E8XA 2DENB 2PE6B 2C9WB 2Y5CA 1QILA 1E9MA 2CKHB 2XEWA 1V97A 1FRRA 2IZVB 2Z8LA 1ZDXA 2G45B 3VVWB 2NBWB 5IP4D 1D3ZA 4P16A 2I1KA 4OZCA 3H9DA 1WWTA 1T6BX 3PZ8A 1WGDA 1MPEA 1FXIA 3UGBB 2JU6X 3EECA 4G3XB 4KDLB 2M4NA 4MM3B 2ASQA 2LI5A 1TGZB 2DWQA 3IXSA 3QHTA 1P0RA 2NVUI 4WQOB 1JCKB 3WALA 3A1QB 2TSSA 1WR1A 2CU3A 3KUDB 2KVRA 1P3QU 2BB6A 1ACCA 2OEDA 3M63B 4LLGM 4OVVA 2JWUA 1D4BA 3OJ3A 3H7SA 2MW5A 3PLUA 2HTME 4BVUC 1A5RA 4MH0E 1EWYC 1SJHD 3QWZB 5AUKA 4O1NA 5D7GA 1UH6A 4K3CA 4KIKB 2GRIA 1I42A 4IWPA 4W9KA 2KVZA 2IPKD 1FCCC 3UF8A 5D3DA 2FUHB 4PYZA 2FNJB 2NS5A 1FRDA 2ZNVB 1LM8B 1JWAD 4REZA 1E7UA 1M4VA 3N9YC 3NS1A 3ZJVA 2WXQA 1YD8U 2KJRA 2ZZPB 2L83A 1OTRB 3LB8C 3T8MA 4A3OA 1ISNA 3FILA 3UIOB 4YXDB 3Q14C 1FFVA 1NVID 4GGQA 3NUHB 3PS6A 4R3DA 4IDIA 3A9JA 3PT2B 2KQ4X 2JQRB 3Q6BA 4F1SA 1WJNA 2GBMA 4GIVA 3WANA 1A70A 4XX5A 3B2FA 1JMLA 2L32A 4TMAB 1VZ8A 4M00A 3T3NA 4K1RB 3JYUA 3DBHB 3DHGC 2KKCA 3TEZA 4GLSC 4NQKE 4BKTA 4W9IA 2KLCA 3ZTCA 3AE5B 2ZVOA 4A8XC 4AJYB 2BF8B 4PYUA 3ZNGC 5KHOA 5H92C 2QCZA 3N1YC 1L5PA 2Z59B 3V3XA 2WU2B 2LXAA 1J7CA 1TY2A 1ZUD2 1R4NB 3PRMB 3P4QB 1I4GA 2LVOA 1VDVA 3KYCD 2ZPNA 4MACA 1ZKHA 4PT5A 3IAS1 3HHMA 1WRDB 2VZKD 4N59A 2JVCA 3VFKA 4YTMB 2KWDA 1XLNA 3PSEB 3C19A 1L6UA 1N60A 3DHIC 3RN9C 1T0RC 3Q8FA 1G6JA 4DXGA 2WNMA 3M62B 2BKFA 3R2TA 3MHSD 3IVFA 2R2OA 1ET6A 1CJEA 2EKIA 4AWJA 1L0YB 5AZHA 1FIQA 5CHWA 1T3QA 3MC8A 4II3B 5AUIA 4A20A 1V81A 3QK0A 4RGTA 3DBLI 4ZRPA 3EHVA 2H88B 2D3BA 2OJWA 2IGDA 3PVLA 4LDTD 3KUCB 2BWFA 4P1BC 1HXYD 1K51A 2QEJC 1Q0WB 2FCMA 2SAKA 4F7ZA 3JVZX 1J8CA 3OJ4B 5BYRA 1P7FA 1SXTA 3PZDA 2HJ1A 2JY6A 3M3JA 2INNE 2KT7A 2ZVNA 2K5PA 4N58A 1WXMA 2CJOA 3WCQA 1E0ZA 5EE1A 4IM3A 2WWZA 3AEBB 2WXMA 2HDEA 4YTNB 3L4PA 3A33B 4ZRJA 5EE0A 1N6ZA 2BW2A 4IUMB 2NMQA 2XK5A 1N61A 2V3SA 2W55A 3PO0A 2D2QA 5T8IA 2B76B 2MP2B 2KC2A 4GOCA 3URYA 1FPYA 4JWUC 2KWVB 4MM3A 1YQ3B 4US9A 2N9PC 5GMVA 1OEYA 2MBOA 3AE8B 1RAXA 3OLMD 3GS2A 1GUAB 3A1QA 3SDLC 2BTEA 2V3NA 4W9HA 5IOIA 2V0GA 1MG4A 4K81A 1N63A 1L7YA 1PFDA 4KGRA 2W3RA 3E9SA 4AP4C 4EZKA 4NQLB 1EWCA 2O2VB 3P4RB 3APFA 1KFYB 2NBUA 1JWMD 2BYTA 2KD0A 4JIOU 4LNIA 4QAYA 2WXRA 1WJUA 4G0NB 2GLSA 1ZPSA 3DVNV 4B9KA 2GB1A 1Q10A 2QDFA 1ZE3D 5J17A 4RM8A 3OWEB 1UELA 3GZNI 1RFAA 1UBIA 3KQ4A 2WGSA 4WAAA 3V6CB 3VUYA 3ML8A 4DK5A 3KUZA 1UNSA 4YT0B 4HXDA 4LJPB 2IGHA 3W9CB 4G11A 3AE9B 1I35A 1KLVA 4B0EA 4BKGA 4MGIE 4JQWC 3TUOA 4NJ6A 1WE7A 1HEZE 2WDTB 1RRBA 2M0AA 3L0WB 3NZ3A 5KHQA 4DHJB 3H1UA 1WH3A 2O6VD 3QA8A 2NR2A 2RR9A 4I6NB 2ZPYA 4A90A 3VTVA 2LVQA 2JZPA 5BMHA 1V1PA 1T0QC 4FJYA 2BS3B 1UWXA 4FHJA 4BBNC 1QLBB 4ARIA 4BOSC 1V80A 1D5MC 1YQ4B 4XZ4A 3B08A 3ONSA 2IO2B 4M01A 2KJHB 4G50A 4IKGA 1WXVA 3AB5A 1WRIA 1VZ7A 1AYFA 3E56A 1WZ0A 1F2RC 2WXHA 3LYYA 3ZNZB 3D32A 4EE2A 3AXCA 2KNBA 3ECIA 1XCQL 1UF0A 1Y56A 4ANXA 4MGZE 4LNFA 5JHBA 1F77A 4WJOA 3IBEA 4P7IA 1F0ZA 3AE6B 3GOEA 2INPE 3L13A 4HLEA 1X1MA 1NEKB 4ZHOA 3VTUA 3P63A 1CZPA 4KZ0A 3L54A 3RMKC 3TMPB 4RM9A 2CHZA 3FILB 1P9DU 2DX5B 1LO5D 5G5GA 3UINB 2QMTA 4XYCA 1ROEA 1WSPA 4K7WA 4TV3A 3AM9A 2DZKA 2EELA 4BOZB 5LXIB 4NPNA 1GC6A 2L7RA 2PMVA 1EF5A 1WXSA 1OFFA 4PS8A 3LDZE 4PK1A 2Z0EB 1V86A 1OQYA 2RDBC 4WWNA 3DBSA 2BS2B 2C5LC 4ZRQA 3TSSA 2E6XA 2BYFA 5D3IB 1MFWA 2A5UA 4DBGA 4YTPB 1S1QB 2FCNA 2K8HA 1J7BA 1E8ZA 1GOZA 1QOFA 2QILA 4W9LA 5G55A 5HKHA 2QIEB 2KFKB 4WAFA 1YNTE 5JH5C 2WDVB 3QAQA 1SE2A 1KRHA 2R2QA 1UBQA 1XLQA 1OQRA 1B1ZA 4WQMA 5JHAA 5IA7A 4IM0A 1C76A 4ICVA 4AUQC 1KM7A 2JWZA 2LHEA 3ZJTA 2AYOB 4M02A 3O65B 4URKA 1E90A 2O2VA 4IM2A 2VH2A 1GB1A 3N1XC 2ACZB 3AEFB 3RCZA 1WMHA 2LUMA 3EFUA 5HI1A 2JRIB 2VH1A 3AE1B 3I3TB 1KF6B 2QJLA 3FKYA 1WR6E 2KHWB 3AE4B 4W9DA 3W2DA 1OEYJ 2G9HD 3VTWA 3ZXRA 2KQ7A 3H7PA 1RYJA 4KSLC 4IW0A 1EM7A 2W3SA 2BPSA 4M0WB 1SE9A 2V3PA 3APCA 3EFCA 4EUTA 2RDGA 3WAPA 4ZDVA 2XK5B 4C56C 5HG2A 3ZKJC 5CHFA 3AEAB 5E6NA 3C8YA 3B1LX 2PEAA 2IGGA 2FE8A 1P1AA 4N9F4 1QOBA 4TKNA 1BMLC 4M8MA 1OQQA 2HJ8A 5JZEB 2G4SA 1ZP0B 2MQJA 3B2GA 3HM6X 3W1SC 5FR6A 1SBBB 3U52E 4E3CA 2FBWB 1GAQB 4JL9A 2Y5PA 3V60A 3BK1A 2NCNA 3IT4B 1PQSA 2M0XA 3RI7C 1PGXA 1KLUD 1VR9A 2JRHA 2ZEQA 3RPFC 3L17A 2LJIA 4IOIE 4XE0A 1AW7A 3TEXA 3MTNB 4L23A 1D5XC 4YSYB 1R4MI 1WJ6A 3MHZA 4RF1A 2LGSA 4OW0A 3I5JC 4JLCA 2ONQA 2MBQA 1L2NA 3CMMB 4IWQA 2LVPA 4RH6A 1N5WA 2L0TA 3HVZA 5DPRA 3N1ZC 3V62A 1FNWA 2BYVE 2WYQA 3U4EG 1AN8A 2C7HA 4YWGG 4J3OD 1PUTA 4TSSA 1RWSA 1BXTA 1DOIA 2QHOA 3RUIB 2AEHA 1TYGB 4WWMA 1HZ5A 2GBJA 4C4VB 4GMVA 3AEDB 1S3SG 3DBHI 3TEYA 1ET9A 4A3PA 2JPHA 1V1PB 5G2NA 2RGFA 3W1YA 3P42A 4C7ZA 1V49A 1GG3A 2ZCCA 2D11A 2BWES 4HKZE 4KVGB 1BT0A 3N32A 2KK8A 3RNCC 1ZDVA 4TUUA 1C4CA 2C7NB 2KFKA 2IY0B 1DOYA 2HD5B 1PYWD 3P4SB 5G5HA 5C2TB 2AQ3B 4EOYA 4F8CB 2D3GA 3L08A 2K39A 3QC8B 2M56B 2KTFA 2GMIC 2H89B 1QKZA 2MA9B 1DYQA 2KX0A 3VXWA 1C1YB 2IJ0A 3WAMA 1TKEA 1MHXA 3QCAA 3DQVA 3IHPC 1FEHA 5IN7A 2JT4B 3KLSX 2E3TA 2DYBA 2QSDA 3VHTC 3C0RB 3BINA 3R2IA 3HM3A 3DBLB 1N5XA 2OJRA 2UU7A 4PS7A 2J0JA 2BYEA 2MBBB 2MH7A 4HROA 2JXXA 4XDDA 5CHVC 1QOAA 4BAXA 2J4XA 2FCSA 2FIFA 1I4RA 4B0MA 1I4XA 3H6NA 4B6WA 1V8CA 1F52A 2RPQA 1SIFA 1C4PA 1QZEA 1STEA 4K3BA 2INCC 3AE3B 2LMCA 5LLIA 1ZOYB 4OVZA 2IO3B 2N9EB 3RULA 1MJDA 2PIAA 3W1SA 1SJED 3Q8EA 5E6JA 4ACFA 3ZIMA 1KH0A 2RMMA 1E7PB 3R66C 4M0WA 2LJ5A 1K8RB 3PRPB 4MT5A 5HHDG 2L00B 3ZDTA 5DPWA 3ABVB 1L0XB 1V2YA 1MI0A 4ZYSA 2KDEB 3DVGX 1EUVB 1DGJA 3X23A 4OVUA 2JYEA 3JSVA 2WXLA 1IUEA 1TZOA 5CTRC 2N9XA 1NENB 2K25A 1I7HA 4A6QA 1YJ1A 3BK2A 5L95C 2WDRB 1KLGD 2MJ3A 2O6VA 2QC8A 1JWBD 1HA5A 1RM6C 1Z5SB 2AX5A 2N0SB 2KJ6A 3ZXVA 1FNUA 2DYMA 1JQ4A 3Q8CA 1WMHB 1VRAB 3KYDD 1HTOA 3ZUNA 4WIPA 4GDKA 2IY1B 2B3AA 4HJGE 1TTNA 3EA6A 3I57A 4KSKC 3NRZA 4JGHB 1YX5B 4LK0M 1E8YA 4GB9A 4AOFA 2Q5WD 4BKSA 3KWLA 3DCGA 2FAZA 3V61A 3CWIA 3ZRCA 3H7PB 2OOBB 3I63C 3JW0X 3AV8A 3IT6B 1NBFC 3O13A 3R8BA 2L76A 3FC4A 4DDID 3AN1A 3CF6E 2WXIA 1TS2A 2MRPA 2D10A 4C4VA 1TY0A 2AWTA 2MEKA 2JXTA 1DOXA 4HKQA 1UUPA 2NTSA 2MLBA 2CU1A 4K7UA 3EGRA 2J42A 4ANVA 1XO3A 4WH4A 3P2BA 4BZAA 4DQOC 3TJPA 2YVCA 3MJWA 3PHXB 1L0VB 3T9LA 2CJNA 1FM0D 3ZQ4A 5BMIA 3PRZA 1C9FA 4HPLB 2W9NA 1D5ZC 3PZ7A 1WYWB 1FXAA 1FD6A 2LGDA 2ZJDA 1J19A 2MJDA 3MJ5A 5AEKB 3L16A 3KW5B 4E74A 5E6OA 2K3UA 2L8JA 2K8CA 3QX1A 1JWSD 2VZKB 2W82A 2KWUB 4WJPA 2KAJA 2BBCA 3BZDB 3CSTA 1C78A 1AWDA 3GE3C 1J0GA 2J0MA 1Y8RC 3VAWA 1L4DB 2KDIA 1KJTA 2WDQB 2ZW1A 2VRRB 1EU4A 5DPTA 3FAHA 4KKJA 2RPVA 2KYWA 2WLBA 3Q3OC 2IO1B 2YEPF 1V6EA 5JXVA 3TBLD 4IWOA 2KN4A 4LDTB 2LUEA 1WYGA 3UQAA 4KX6B 3ZVVA 5I4DA 1XXGA 3BVZA 4AQ7A 2LRWA 2LGYA 4KGTA 2JUOA 2N1VA 2GI9A 4NY0A 2WXKA 5BYQA 5EE9A 1TT5B 3CIRB 4GN1A 3SEBA 3RNGC 2MHJA 4RGOS 2KMCA 1C77A 4US8A 5BMGA 1YMHE 4FN2A 3AEEB 4LTUA 3R7QA 3ZDMC 1I4QA 2L52A 4X57B 2K22A 3ZO5B 1IYFA 2LRUA 2RDHA 4DHZB 3QIJA 1ZXIA 1JWUD 1HTQA 4HEA1 2AL3A 4B95A 1GC7A 3BY4B 3ZRFA 1H4RA 5FK9C 3VQIA 1SB3C 1SSNA 3KWVA 1T0YA 4DXAB 2WP9B 1P7EA 3A4RA 2RD0A 1UD7A 1TJEA 4NJCA 2KACA 1WZ3A 3NS8A 2K8BA 1XQQA 1HE8A 3DVNU 3B0AA 4XWTA 1WGKA 1CMXB 4CO7A 3VUWA 3ZW3A 1EU3A 3HRDD 3NZUA 3DDCB 4HCNB 4UDUC 2LZ6A 3SD5A 3VRBB 3RZWC 3U7DA 2AQ2B 4WWOA 1YOVB 3ENEA 2WXJA 1MG8A 3SR6A 3AMZA 1JRUA 5GXGB 3BWUD 4GU2A 3TL5A 4MSQB 3Q2AC 2KO3A 1KOTA 1VD2A 3H8HA 2MCNB 4RGNA 1GB4A 5BO4B 5HFYA 5IO9A 4EEWA 2PW9A 1F1HA 3NHEB 4MGKE 4W9EA 3ZLZA 2JZZA 3Q3MC 3W5VB 2DZIA 2D07B 2PPHA 4WWPA 2GBRA 3DBRB 1TIFA 3ZNID 2LXCA 2JSVX 4RNAA 5D6JB 2LASA 4HK2A 4OHJA 1FNVA 4C80A 3TIXA 2KWCA 3SHQA 4ZRKA 4FXCA 2Z0DB 4OZBA 4L1BA 1ZGUB 2AQ1B 4YSXB 2KZRA 1WJ4A 1TS3A 3DWMA 3PGEA 1YX6B 1WXQA 4HVBA 1SIJA 1YN5A 3JSVB 4TQ1A 1Q1OA 1R7SA 3L10B 2ICIA 2AL6A 2JYTA 3IAM1 4IG7B 3ZYYX 4HDOA 2LWPA 2MWSB 2WXPA 3AULA 2FUG1 3P1MA 4I6PA 2O6VB 5DPSA 2BS4B 4AS1A 3RNAC 3IG3A 5C1ZA 3R3MA 1SE4A 3NJTA 2JX5A 2DAFA 3HVDA 2W54A 4CHKA 4LNKA 4WURA 2GOWA 1I4HA 4RGMA 1WM3A 5J18A 3PHWB 1LFDA 1H8CA 4GDKB 4RFBA 3NVWA 3Q8BA 4W9GA 3ALBA 4DHZE 2KQSA 2L1AA 3A9KB 3V6EB 2WXOA 1WFYA 1TKYA 3RNEC 3LXFA 1L4ZB 1WGYA 3VH3B 1GNUA 4J6IA 2KDFB 1R4MB 3AEGB 2K9XA 4JX1C 2K6DB 3S2AA 5C23A 1IGDA 2IYDB 2KLGA 3P4PB 1SEBD 3OG5A 2DAJA 2KTRA 2I1JA 2N9LA 1XLPA 2XNAC 1WGHA 1QQRA 2UWQA 1YN3A 1ZXHA 1XEEA 3I9V1 4DHJD 3A4SC 2J0KA 4OZAA 1V5OA 4P6VF 3U7ZA 2DYOA 3UQBA 3NVVA 4JE3B 2LHDA 1XD3B 4W9FA 3VH4B 1IGCA 2DNFA 1JALA 1NYRA 5CX3A 2G1EA 1E7VA 1WE6A 4DWFA 3AI5A 3SFEB 2WXGA 3TCAA 4GXBA 1IBXA 4HJKA 3PREA 4H2AA 4ZYNA 2DHZA 2JF5A 3APDA 5BYSA 2M1MA 4ZRIA 3DOWA 4D2KA 3GE8C 4FLHA 5D2MB 1J7AA 1TS4A 2N1WA 4LNNA 4GDLB 4KZCA 1R4NI 2WXFA 1ESFA 1FMAD 4PS3A 2ZNVC 4WJQA 2PTLA 4CQNA 1Q5WB 2R61A 2EKEC 1FCLA 4MGYE 2PE9A 1CQVA 1WGRA 3LJ3A 3IFWB 2G4DB 4HRSA 1NI2A 1D6EC 1WM2A 4ARCA 1N62A 3AECB 2CHWA 3HIZA 2KMAA 2N7DA 4BFRA 3AU5A 3U2SC 2MBEA 4KKIA 3GB1A 2G3QB 4LNOA 3RFZB 4FJZA 2NPTB 1F9JA 4NAWB 3PTFC 3VUXA 1TBEA 1PGBA 2CHXA 2PLPA 4NZLB 4TQ0A 1IP9A 4MSMB 1GPXA 1FXTB 1P98A 1E8WA 1YJJA 2KC1A 1JRPA 1RFKA 2C7MB 3N20C 2L0FA 4MJSA 1XF5L 2D3AA 2BQQA 4EZLA 4II2B 4S17A 3BYTB 1PDXA 3WA0A 2EMSA 2REXA 2D3CA 2V4IB 5H8YE 4USAA 4IC7B 3NZSA 3ZGZA 3HK0A 1B9RA 2RSUA 4ANWA 5FR3A 1QF6A 1I4PA 1VZ6A 4XDCA 2KDBA 2K1FA 5C3JB 3VDZA 2EMTA 5D94A 3TEWA 3MC0B 2KN5A 4JWSC 1YN4A 4A9AA 3RD2A 4HDQA 2K0PA 2N4FA 1L6VA 1WIAA 4KGSA 1XT9B 2DZMA 4ZHPA 2L05A 2FIDA 1JW9D 3B9JA 3J9CA 3U8ZA 1M94A 3Q69A 4FULA 2WXNA 2LD9A 3CSFA 2MBHA 4NAMA 1VLBA 5AZFA 3DHHC 1NYQA 1ZW7A 3PLVA 1WX7A 2WX1A 4AJWA 4A55A 4M8NA 5E6PA 1QT9A 2KXJA 2MX2A 4LJOB 4FADA 3RYTA 3ZJUA 3MC9A 1E10A 5LNK1 4W9JA 4RCOA 3AU4A 1WY8A 1T5XD 4DXFA 3PV1A 3A9KA 1ENFA 2XN9C 1T0SC 2KOXA 1BUIC 1U4AA 2GBKA 2V1YA 2WHIA 4Q2JA 1Z2MA 2YEPB 2IBIB 4KIKA 2K6QA 2N7JA 2CS4A 1CK1A 2I2YA 3PPAA 4ASWC 3GZNB 3Q3FA 4K7SA 2YLMA 1QOGA 1LXDA 2ZCBA 4WJNA 2XBBC 3AH7A 2PVGC 2HE7A 5J2RA 4HPPA 2A4ZA 2INDC 4C00A 1E6EB 1PGAA 2DBYA 3K9PB 2DZJA 2KX3A 4YSZB 2BGFA 1XLOA 3ZNHB 3NOBA 2J52A 2SEBD 1SF0A 2C60A 4GSWA 1F2RI 1K52A 4MH8A 4DDGD 3T3OA 4MEMA 3RZFA 5MPOA 2V9HA 3EUB2 2MSED 2PVOD 4E71A 4MELA 2IDYA 3OAWA 4EFOA 3QJZA 1K53A 4KDIC 4GDLA 1V1OA 4P1CC 2FCQA 3WIMA 1MVKA 1V9JA 4XWWA 3X0WA 1WI0A 2NBVB 2N7EA 2M17A 1UGJA 2ON8A 4NNJB 3KH0A 3GP7A 3ETRA 3HUIA 4HWIB 1UWMA 1C79A 4FA6A 2WX0A 4LCDE 4ITKA 1V5TA 1TS5A 1TZ1A 3Q3JA 2BB5A 4L2YA 1GJZA 2NPTA 2OHFA 1HZ6A 4NAWA 2PKOA 2ZW0A 5TSSA 2WU5B 1E5WA 4BKSD 1VJKA 3DWGC 5EE3A 2M19A 1HQRD 3NG0A 3R7RA 3WAOA 3V05A 3MFGA 2KTRB 3QARA 2PJHA 4I6LB 4ANUA 2LEKA 2D5GA 4S0RA 2J53A 4C7YA 4RMAA 3SFDB 4MDKE 3W5UB 3NY5A 4N6EB 1YJIA 4RF0A 3Q3NC 4XC2A 2N9KA 2Y3AA 5DCNA 4BBNF 1WF9A 4NJ7A 1SGHA 1WX8A 2X38A 1EO6A 3A9JB 2UYZB 3VR9B 5AZGA 2J7QB 2LGXA 1IBXB 2LGIA 3AE2B 1K50A 3VRAB 4HPMB 4KV2A 4EZJA 1NDDA 2NTTA 3U30A 1OGWA 3BYYB 1KTKA 4FHKA 1C3TA 1EF1A 1VCBA 1UZXB 3NVZA 3BVMA 2BT6A 2LFIA 2WQYB 1LQBA 1NI3A 2V4LA 2BKRB 5LXHA 4W9CA 1UGMA 3DPDA 3N30A 4CYEA 2MP2A 2KANA 1FO4A 5EDSA 3K9OB 4FBJB 3ZTDA 3BVGA 3ML9A 5IAAC 3RT3B 1WGGA 2GBNA 2Y5BB 2KMMA 5FKAC 3RNFC 1SE3A 1AARA 1LGRA 3EC8A 1YIWA 2X8XX 2IO0B 3QQ8B 1YQBA 3DVGY 4XGAB 2HTHA
chains in the Genus database with same CATH topology
1C4AA 1QQRA 3ABVB 1YN3A 1L0XB 1ZXHA 4IKGA 1XCTL 3AB5A 1WRIA 1XEEA 3I9V1 2I38A 1JROA 1MI0A 4ZYSA 4OZAA 4P6VF 3U7ZA 2DYOA 2KDMA 1VZ7A 1AYFA 1DGJA 3E56A 3NVVA 4JE3B 1F2RC 2WXHA 2WS3B 2LHDA 3LYYA 4EE2A 2DLBA 2JYEA 2WXLA 1IGCA 1IUEA 1TZOA 1JALA 1NYRA 3NVYA 2G1EA 1NENB 2MJEA 1I7HA 1XCQL 3SFEB 4A6QA 2WXGA 1IBXA 1Y56A 1FFUA 1MHHE 3BK2A 4H2AA 3AE7B 3MP9A 2WDRB 1F77A 1KLGD 5BYSA 2MJ3A 4D2KA 3BIID 3VR8B 1J7AA 1TS4A 4GDLB 1F0ZA 3AE6B 2INPE 1JWBD 1HA5A 2WXFA 1RM6C 4ZOHC 1ESFA 1FMAD 1NEKB 2AX5A 3Q8AA 4ZHOA 3UI3A 4JPSA 3P63A 2N0SB 1CZPA 1TKGA 2PTLA 4CQNA 2R61A 1FNUA 2DYMA 1JQ4A 1FCLA 3FILB 3Q8CA 1CQVA 2Y5CA 1LO5D 1E9MA 1QILA 5G5GA 1VRAB 1V97A 1FRRA 2QMTA 4WIPA 4HRSA 2Z8LA 1ROEA 1ZDXA 1D6EC 4HJGE 4ARCA 3EA6A 1N62A 3I57A 1WSPA 4P16A 3AECB 3AM9A 4OZCA 2EELA 1WWTA 1T6BX 3NRZA 3PZ8A 1MPEA 3U2SC 1FXIA 2PMVA 4KKIA 2JU6X 3GB1A 4LK0M 3RFZB 1OFFA 2Q5WD 3KWLA 4NAWB 4MM3B 3CWIA 2DWQA 3IXSA 1PGBA 1JCKB 2BS2B 2PLPA 4NZLB 4TQ0A 4ZRQA 1GPXA 2TSSA 3TSSA 2CU3A 1YJJA 2E6XA 1JRPA 1RFKA 3AV8A 3IT6B 2BB6A 5D3IB 1ACCA 3O13A 1XF5L 3R8BA 2OEDA 3FC4A 4LLGM 4YTPB 3AN1A 2JWUA 2WXIA 1TS2A 1D4BA 1J7BA 3BYTB 1GOZA 1QOFA 1PDXA 2QILA 2QIEB 4WAFA 2HTME 1YNTE 1TY0A 2V4IB 5H8YE 4USAA 1EWYC 1SJHD 2MEKA 2WDVB 5AUKA 1SE2A 2JXTA 1KRHA 4O1NA 5D7GA 1DOXA 4HKQA 1UUPA 2GRIA 2NTSA 3ZGZA 1B9RA 2IPKD 1XLQA 1FCCC 1OQRA 3EGRA 1B1ZA 2J42A 4WQMA 5D3DA 5FR3A 1QF6A 1XO3A 4WH4A 1I4PA 1VZ6A 4XDCA 1C76A 1FRDA 5C3JB 4DQOC 1JWAD 4REZA 1L0VB 2CJNA 3TEWA 1FM0D 3ZQ4A 1M4VA 5BMIA 3MC0B 2LHEA 3N9YC 3ZJTA 1C9FA 1D5ZC 3NS1A 3PZ7A 3ZJVA 2WXQA 4JWSC 3LB8C 1YN4A 2L83A 4A9AA 1FXAA 1FD6A 1GB1A 2K0PA 3FILA 2MJDA 2ACZB 3AEFB 2LUMA 3MJ5A 1L6VA 5HI1A 4KGSA 2K3UA 4YXDB 1FFVA 1NVID 4ZHPA 1JW9D 3NUHB 3B9JA 3AE1B 3J9CA 4R3DA 4IDIA 1JWSD 2VZKB 2KQ4X 2W82A 1KF6B 3Q69A 2JQRB 2QJLA 2WXNA 1A70A 2KAJA 2BBCA 3B2FA 1JMLA 2L32A 3BZDB 4NAMA 4TMAB 1VLBA 1VZ8A 1C78A 1AWDA 3T3NA 3AE4B 1L4DB 1NYQA 3TEZA 4GLSC 3W2DA 2G9HD 2WDQB 4A55A 2ZW1A 3AE5B 1QT9A 4A8XC 1EU4A 5H92C 1L5PA 1RYJA 3FAHA 3V3XA 2WU2B 1EM7A 4KKJA 1J7CA 1TY2A 1ZUD2 2W3SA 2RPVA 3ZJUA 1E10A 3P4QB 1I4GA 5LNK1 2WLBA 1VDVA 4MACA 4RCOA 4PT5A 2YEPF 2V3PA 2N9LA 3IAS1 5JXVA 1T5XD 2RDGA 4N59A 2VZKD 2KN4A 4DXFA 4C56C 4YTMB 2KWDA 1XLNA 1WYGA 4KX6B 5HG2A 1L6UA 1ENFA 1N60A 2XN9C 5I4DA 1XXGA 3BVZA 3Q8FA 4AQ7A 4KGTA 1BUIC 3AEAB 2GI9A 4Q2JA 3C8YA 4DXGA 2WNMA 2YEPB 2WXKA 5BYQA 2IGGA 2N7JA 5EE9A 2FE8A 1CK1A 3CIRB 1QOBA 3R2TA 2I2YA 1BMLC 3SEBA 1ET6A 4RGOS 1CJEA 1QOGA 2EKIA 1C77A 4US8A 1OQQA 5BMGA 1L0YB 1YMHE 1FIQA 1T3QA 3AEEB 1ZP0B 5AUIA 4LTUA 3B2GA 4RGTA 3AH7A 1I4QA 2PVGC 1SBBB 2L52A 3U52E 4ZRPA 2K22A 2FBWB 2H88B 1E6EB 1PGAA 2RDHA 1GAQB 2DBYA 2IGDA 1ZXIA 1JWUD 2Y5PA 4HEA1 3BK1A 1HXYD 1K51A 2QEJC 3IT4B 4YSZB 5FK9C 3VQIA 1XLOA 1SB3C 1SSNA 2SAKA 2J52A 2SEBD 1SF0A 3KWVA 1F2RI 1PGXA 1K52A 5BYRA 4MH8A 1KLUD 1P7FA 2WP9B 1P7EA 1SXTA 3T3OA 1VR9A 3RPFC 5MPOA 3EUB2 1TJEA 2LJIA 4IOIE 4NJCA 4XE0A 2KACA 1AW7A 2INNE 3TEXA 2PVOD 4L23A 4XWTA 2K5PA 2IDYA 1D5XC 1WGKA 4YSYB 4N58A 1K53A 3MHZA 4RF1A 1V1OA 1EU3A 4OW0A 3WCQA 2CJOA 1E0ZA 3HRDD 1MVKA 4UDUC 5EE1A 4XWWA 3VRBB 3AEBB 2WXMA 2AQ2B 2HDEA 4YTNB 2WXJA 1UGJA 2ON8A 3L4PA 3GP7A 3SR6A 3AMZA 5EE0A 2ONQA 5GXGB 3ETRA 2BW2A 3BWUD 3HUIA 4RH6A 1N5WA 1UWMA 1C79A 3HVZA 2NMQA 1N61A 1FNWA 4ITKA 3U4EG 2W55A 3PO0A 1AN8A 5T8IA 2B76B 4YWGG 1TS5A 3H8HA 4J3OD 2BB5A 4RGNA 1PUTA 4L2YA 1GB4A 4TSSA 1RWSA 1BXTA 3URYA 5HFYA 1DOIA 2PW9A 2OHFA 1TYGB 1HZ6A 4WWMA 4JWUC 1HZ5A 2PKOA 2ZW0A 3W5VB 1YQ3B 4US9A 2WU5B 5TSSA 3AEDB 1VJKA 3AE8B 3DWGC 5EE3A 2M19A 3GS2A 3TEYA 1ET9A 1HQRD 2JSVX 4RNAA 2BTEA 3V05A 1V1PB 3MFGA 3P42A 2V3NA 4C7ZA 2LEKA 4OHJA 1FNVA 2D5GA 4C80A 2J53A 4C7YA 2V0GA 1N63A 3SFDB 4HKZE 4FXCA 4OZBA 3W5UB 4L1BA 1ZDVA 1C4CA 1PFDA 1DOYA 4N6EB 1YJIA 2AQ1B 2W3RA 3E9SA 4KGRA 4RF0A 4YSXB 1PYWD 3P4SB 1EWCA 1TS3A 3P4RB 5G5HA 5C2TB 2AQ3B 3DWMA 1KFYB 2N9KA 2Y3AA 2M56B 1WXQA 1SIJA 1YN5A 1JWMD 2H89B 1QKZA 2BYTA 4TQ1A 1DYQA 2WXRA 1ZPSA 1R7SA 2X38A 2IJ0A 1TKEA 1MHXA 3VR9B 2ICIA 2GB1A 1Q10A 1FEHA 2JYTA 3IAM1 1IBXB 2LGIA 3AE2B 3ZYYX 1ZE3D 2WXPA 1K50A 3VRAB 3OWEB 2FUG1 3KLSX 3P1MA 3KQ4A 2BS4B 4AS1A 2E3TA 2QSDA 2NTTA 1SE4A 2JX5A 3BYYB 3R2IA 1KTKA 1N5XA 3HVDA 2W54A 1UNSA 4YT0B 2MH7A 4HROA 2IGHA 4XDDA 3W9CB 3NVZA 4WURA 1QOAA 3AE9B 2BT6A 3BVMA 2J4XA 2LFIA 2WQYB 1I4RA 1NI3A 4B0EA 4B0MA 1I4XA 1I4HA 4RGMA 3TUOA 1V8CA 1C4PA 1HEZE 1STEA 4GDKB 3AE3B 2M0AA 3NZ3A 4RFBA 2LMCA 1FO4A 3NVWA 3Q8BA 1ZOYB 4OVZA 2L1AA 3BVGA 2WXOA 1TKYA 3LXFA 1L4ZB 2PIAA 3W1SA 3AEGB 1SJED 2K9XA 3Q8EA 4JX1C 5E6JA 1IGDA 3P4PB 4A90A 1KH0A 2KMMA 1SEBD 2JZPA 2RMMA 1V1PA 5BMHA 5FKAC 1E7PB 2BS3B 1SE3A 1UWXA 1QLBB 4ARIA 4M0WA 1D5MC 1YQ4B 4MT5A 5HHDG 1XLPA 2XNAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJI A;  2L32 A; 
#chains in the Genus database with same CATH topology
 1C4A A;  4HCP B;  2CR5 A;  1XCT L;  4MJS B;  3SU8 X;  2I38 A;  1JRO A;  2KFJ A;  2M8S A;  2KDM A;  5IKC M;  4EKU A;  4ICU A;  1WXA A;  2WS3 B;  2DLB A;  2L3Z A;  3N3K B;  3NVY A;  1IPG A;  2MJE A;  1RLF A;  1FFU A;  1MHH E;  2BVC A;  4YL8 A;  3AE7 B;  3MP9 A;  3DBR I;  3BII D;  5L83 A;  5TR5 A;  3VR8 B;  3KVF B;  1WX9 A;  3M95 A;  2JZ3 B;  4FJV B;  3UIP B;  4ZOH C;  3Q8A A;  3UI3 A;  4JPS A;  1TKG A;  3RNB C;  1E8X A;  2DEN B;  2PE6 B;  2C9W B;  2Y5C A;  1QIL A;  1E9M A;  2CKH B;  2XEW A;  1V97 A;  1FRR A;  2IZV B;  2Z8L A;  1ZDX A;  2G45 B;  3VVW B;  2NBW B;  5IP4 D;  1D3Z A;  4P16 A;  2I1K A;  4OZC A;  3H9D A;  1WWT A;  1T6B X;  3PZ8 A;  1WGD A;  1MPE A;  1FXI A;  3UGB B;  2JU6 X;  3EEC A;  4G3X B;  4KDL B;  2M4N A;  4MM3 B;  2ASQ A;  2LI5 A;  1TGZ B;  2DWQ A;  3IXS A;  3QHT A;  1P0R A;  2NVU I;  4WQO B;  1JCK B;  3WAL A;  3A1Q B;  2TSS A;  1WR1 A;  2CU3 A;  3KUD B;  2KVR A;  1P3Q U;  2BB6 A;  1ACC A;  2OED A;  3M63 B;  4LLG M;  4OVV A;  2JWU A;  1D4B A;  3OJ3 A;  3H7S A;  2MW5 A;  3PLU A;  2HTM E;  4BVU C;  1A5R A;  4MH0 E;  1EWY C;  1SJH D;  3QWZ B;  5AUK A;  4O1N A;  5D7G A;  1UH6 A;  4K3C A;  4KIK B;  2GRI A;  1I42 A;  4IWP A;  4W9K A;  2KVZ A;  2IPK D;  1FCC C;  3UF8 A;  5D3D A;  2FUH B;  4PYZ A;  2FNJ B;  2NS5 A;  1FRD A;  2ZNV B;  1LM8 B;  1JWA D;  4REZ A;  1E7U A;  1M4V A;  3N9Y C;  3NS1 A;  3ZJV A;  2WXQ A;  1YD8 U;  2KJR A;  2ZZP B;  2L83 A;  1OTR B;  3LB8 C;  3T8M A;  4A3O A;  1ISN A;  3FIL A;  3UIO B;  4YXD B;  3Q14 C;  1FFV A;  1NVI D;  4GGQ A;  3NUH B;  3PS6 A;  4R3D A;  4IDI A;  3A9J A;  3PT2 B;  2KQ4 X;  2JQR B;  3Q6B A;  4F1S A;  1WJN A;  2GBM A;  4GIV A;  3WAN A;  1A70 A;  4XX5 A;  3B2F A;  1JML A;  2L32 A;  4TMA B;  1VZ8 A;  4M00 A;  3T3N A;  4K1R B;  3JYU A;  3DBH B;  3DHG C;  2KKC A;  3TEZ A;  4GLS C;  4NQK E;  4BKT A;  4W9I A;  2KLC A;  3ZTC A;  3AE5 B;  2ZVO A;  4A8X C;  4AJY B;  2BF8 B;  4PYU A;  3ZNG C;  5KHO A;  5H92 C;  2QCZ A;  3N1Y C;  1L5P A;  2Z59 B;  3V3X A;  2WU2 B;  2LXA A;  1J7C A;  1TY2 A;  1ZUD 2;  1R4N B;  3PRM B;  3P4Q B;  1I4G A;  2LVO A;  1VDV A;  3KYC D;  2ZPN A;  4MAC A;  1ZKH A;  4PT5 A;  3IAS 1;  3HHM A;  1WRD B;  2VZK D;  4N59 A;  2JVC A;  3VFK A;  4YTM B;  2KWD A;  1XLN A;  3PSE B;  3C19 A;  1L6U A;  1N60 A;  3DHI C;  3RN9 C;  1T0R C;  3Q8F A;  1G6J A;  4DXG A;  2WNM A;  3M62 B;  2BKF A;  3R2T A;  3MHS D;  3IVF A;  2R2O A;  1ET6 A;  1CJE A;  2EKI A;  4AWJ A;  1L0Y B;  5AZH A;  1FIQ A;  5CHW A;  1T3Q A;  3MC8 A;  4II3 B;  5AUI A;  4A20 A;  1V81 A;  3QK0 A;  4RGT A;  3DBL I;  4ZRP A;  3EHV A;  2H88 B;  2D3B A;  2OJW A;  2IGD A;  3PVL A;  4LDT D;  3KUC B;  2BWF A;  4P1B C;  1HXY D;  1K51 A;  2QEJ C;  1Q0W B;  2FCM A;  2SAK A;  4F7Z A;  3JVZ X;  1J8C A;  3OJ4 B;  5BYR A;  1P7F A;  1SXT A;  3PZD A;  2HJ1 A;  2JY6 A;  3M3J A;  2INN E;  2KT7 A;  2ZVN A;  2K5P A;  4N58 A;  1WXM A;  2CJO A;  3WCQ A;  1E0Z A;  5EE1 A;  4IM3 A;  2WWZ A;  3AEB B;  2WXM A;  2HDE A;  4YTN B;  3L4P A;  3A33 B;  4ZRJ A;  5EE0 A;  1N6Z A;  2BW2 A;  4IUM B;  2NMQ A;  2XK5 A;  1N61 A;  2V3S A;  2W55 A;  3PO0 A;  2D2Q A;  5T8I A;  2B76 B;  2MP2 B;  2KC2 A;  4GOC A;  3URY A;  1FPY A;  4JWU C;  2KWV B;  4MM3 A;  1YQ3 B;  4US9 A;  2N9P C;  5GMV A;  1OEY A;  2MBO A;  3AE8 B;  1RAX A;  3OLM D;  3GS2 A;  1GUA B;  3A1Q A;  3SDL C;  2BTE A;  2V3N A;  4W9H A;  5IOI A;  2V0G A;  1MG4 A;  4K81 A;  1N63 A;  1L7Y A;  1PFD A;  4KGR A;  2W3R A;  3E9S A;  4AP4 C;  4EZK A;  4NQL B;  1EWC A;  2O2V B;  3P4R B;  3APF A;  1KFY B;  2NBU A;  1JWM D;  2BYT A;  2KD0 A;  4JIO U;  4LNI A;  4QAY A;  2WXR A;  1WJU A;  4G0N B;  2GLS A;  1ZPS A;  3DVN V;  4B9K A;  2GB1 A;  1Q10 A;  2QDF A;  1ZE3 D;  5J17 A;  4RM8 A;  3OWE B;  1UEL A;  3GZN I;  1RFA A;  1UBI A;  3KQ4 A;  2WGS A;  4WAA A;  3V6C B;  3VUY A;  3ML8 A;  4DK5 A;  3KUZ A;  1UNS A;  4YT0 B;  4HXD A;  4LJP B;  2IGH A;  3W9C B;  4G11 A;  3AE9 B;  1I35 A;  1KLV A;  4B0E A;  4BKG A;  4MGI E;  4JQW C;  3TUO A;  4NJ6 A;  1WE7 A;  1HEZ E;  2WDT B;  1RRB A;  2M0A A;  3L0W B;  3NZ3 A;  5KHQ A;  4DHJ B;  3H1U A;  1WH3 A;  2O6V D;  3QA8 A;  2NR2 A;  2RR9 A;  4I6N B;  2ZPY A;  4A90 A;  3VTV A;  2LVQ A;  2JZP A;  5BMH A;  1V1P A;  1T0Q C;  4FJY A;  2BS3 B;  1UWX A;  4FHJ A;  4BBN C;  1QLB B;  4ARI A;  4BOS C;  1V80 A;  1D5M C;  1YQ4 B;  4XZ4 A;  3B08 A;  3ONS A;  2IO2 B;  4M01 A;  2KJH B;  4G50 A;  4IKG A;  1WXV A;  3AB5 A;  1WRI A;  1VZ7 A;  1AYF A;  3E56 A;  1WZ0 A;  1F2R C;  2WXH A;  3LYY A;  3ZNZ B;  3D32 A;  4EE2 A;  3AXC A;  2KNB A;  3ECI A;  1XCQ L;  1UF0 A;  1Y56 A;  4ANX A;  4MGZ E;  4LNF A;  5JHB A;  1F77 A;  4WJO A;  3IBE A;  4P7I A;  1F0Z A;  3AE6 B;  3GOE A;  2INP E;  3L13 A;  4HLE A;  1X1M A;  1NEK B;  4ZHO A;  3VTU A;  3P63 A;  1CZP A;  4KZ0 A;  3L54 A;  3RMK C;  3TMP B;  4RM9 A;  2CHZ A;  3FIL B;  1P9D U;  2DX5 B;  1LO5 D;  5G5G A;  3UIN B;  2QMT A;  4XYC A;  1ROE A;  1WSP A;  4K7W A;  4TV3 A;  3AM9 A;  2DZK A;  2EEL A;  4BOZ B;  5LXI B;  4NPN A;  1GC6 A;  2L7R A;  2PMV A;  1EF5 A;  1WXS A;  1OFF A;  4PS8 A;  3LDZ E;  4PK1 A;  2Z0E B;  1V86 A;  1OQY A;  2RDB C;  4WWN A;  3DBS A;  2BS2 B;  2C5L C;  4ZRQ A;  3TSS A;  2E6X A;  2BYF A;  5D3I B;  1MFW A;  2A5U A;  4DBG A;  4YTP B;  1S1Q B;  2FCN A;  2K8H A;  1J7B A;  1E8Z A;  1GOZ A;  1QOF A;  2QIL A;  4W9L A;  5G55 A;  5HKH A;  2QIE B;  2KFK B;  4WAF A;  1YNT E;  5JH5 C;  2WDV B;  3QAQ A;  1SE2 A;  1KRH A;  2R2Q A;  1UBQ A;  1XLQ A;  1OQR A;  1B1Z A;  4WQM A;  5JHA A;  5IA7 A;  4IM0 A;  1C76 A;  4ICV A;  4AUQ C;  1KM7 A;  2JWZ A;  2LHE A;  3ZJT A;  2AYO B;  4M02 A;  3O65 B;  4URK A;  1E90 A;  2O2V A;  4IM2 A;  2VH2 A;  1GB1 A;  3N1X C;  2ACZ B;  3AEF B;  3RCZ A;  1WMH A;  2LUM A;  3EFU A;  5HI1 A;  2JRI B;  2VH1 A;  3AE1 B;  3I3T B;  1KF6 B;  2QJL A;  3FKY A;  1WR6 E;  2KHW B;  3AE4 B;  4W9D A;  3W2D A;  1OEY J;  2G9H D;  3VTW A;  3ZXR A;  2KQ7 A;  3H7P A;  1RYJ A;  4KSL C;  4IW0 A;  1EM7 A;  2W3S A;  2BPS A;  4M0W B;  1SE9 A;  2V3P A;  3APC A;  3EFC A;  4EUT A;  2RDG A;  3WAP A;  4ZDV A;  2XK5 B;  4C56 C;  5HG2 A;  3ZKJ C;  5CHF A;  3AEA B;  5E6N A;  3C8Y A;  3B1L X;  2PEA A;  2IGG A;  2FE8 A;  1P1A A;  4N9F 4;  1QOB A;  4TKN A;  1BML C;  4M8M A;  1OQQ A;  2HJ8 A;  5JZE B;  2G4S A;  1ZP0 B;  2MQJ A;  3B2G A;  3HM6 X;  3W1S C;  5FR6 A;  1SBB B;  3U52 E;  4E3C A;  2FBW B;  1GAQ B;  4JL9 A;  2Y5P A;  3V60 A;  3BK1 A;  2NCN A;  3IT4 B;  1PQS A;  2M0X A;  3RI7 C;  1PGX A;  1KLU D;  1VR9 A;  2JRH A;  2ZEQ A;  3RPF C;  3L17 A;  2LJI A;  4IOI E;  4XE0 A;  1AW7 A;  3TEX A;  3MTN B;  4L23 A;  1D5X C;  4YSY B;  1R4M I;  1WJ6 A;  3MHZ A;  4RF1 A;  2LGS A;  4OW0 A;  3I5J C;  4JLC A;  2ONQ A;  2MBQ A;  1L2N A;  3CMM B;  4IWQ A;  2LVP A;  4RH6 A;  1N5W A;  2L0T A;  3HVZ A;  5DPR A;  3N1Z C;  3V62 A;  1FNW A;  2BYV E;  2WYQ A;  3U4E G;  1AN8 A;  2C7H A;  4YWG G;  4J3O D;  1PUT A;  4TSS A;  1RWS A;  1BXT A;  1DOI A;  2QHO A;  3RUI B;  2AEH A;  1TYG B;  4WWM A;  1HZ5 A;  2GBJ A;  4C4V B;  4GMV A;  3AED B;  1S3S G;  3DBH I;  3TEY A;  1ET9 A;  4A3P A;  2JPH A;  1V1P B;  5G2N A;  2RGF A;  3W1Y A;  3P42 A;  4C7Z A;  1V49 A;  1GG3 A;  2ZCC A;  2D11 A;  2BWE S;  4HKZ E;  4KVG B;  1BT0 A;  3N32 A;  2KK8 A;  3RNC C;  1ZDV A;  4TUU A;  1C4C A;  2C7N B;  2KFK A;  2IY0 B;  1DOY A;  2HD5 B;  1PYW D;  3P4S B;  5G5H A;  5C2T B;  2AQ3 B;  4EOY A;  4F8C B;  2D3G A;  3L08 A;  2K39 A;  3QC8 B;  2M56 B;  2KTF A;  2GMI C;  2H89 B;  1QKZ A;  2MA9 B;  1DYQ A;  2KX0 A;  3VXW A;  1C1Y B;  2IJ0 A;  3WAM A;  1TKE A;  1MHX A;  3QCA A;  3DQV A;  3IHP C;  1FEH A;  5IN7 A;  2JT4 B;  3KLS X;  2E3T A;  2DYB A;  2QSD A;  3VHT C;  3C0R B;  3BIN A;  3R2I A;  3HM3 A;  3DBL B;  1N5X A;  2OJR A;  2UU7 A;  4PS7 A;  2J0J A;  2BYE A;  2MBB B;  2MH7 A;  4HRO A;  2JXX A;  4XDD A;  5CHV C;  1QOA A;  4BAX A;  2J4X A;  2FCS A;  2FIF A;  1I4R A;  4B0M A;  1I4X A;  3H6N A;  4B6W A;  1V8C A;  1F52 A;  2RPQ A;  1SIF A;  1C4P A;  1QZE A;  1STE A;  4K3B A;  2INC C;  3AE3 B;  2LMC A;  5LLI A;  1ZOY B;  4OVZ A;  2IO3 B;  2N9E B;  3RUL A;  1MJD A;  2PIA A;  3W1S A;  1SJE D;  3Q8E A;  5E6J A;  4ACF A;  3ZIM A;  1KH0 A;  2RMM A;  1E7P B;  3R66 C;  4M0W A;  2LJ5 A;  1K8R B;  3PRP B;  4MT5 A;  5HHD G;  2L00 B;  3ZDT A;  5DPW A;  3ABV B;  1L0X B;  1V2Y A;  1MI0 A;  4ZYS A;  2KDE B;  3DVG X;  1EUV B;  1DGJ A;  3X23 A;  4OVU A;  2JYE A;  3JSV A;  2WXL A;  1IUE A;  1TZO A;  5CTR C;  2N9X A;  1NEN B;  2K25 A;  1I7H A;  4A6Q A;  1YJ1 A;  3BK2 A;  5L95 C;  2WDR B;  1KLG D;  2MJ3 A;  2O6V A;  2QC8 A;  1JWB D;  1HA5 A;  1RM6 C;  1Z5S B;  2AX5 A;  2N0S B;  2KJ6 A;  3ZXV A;  1FNU A;  2DYM A;  1JQ4 A;  3Q8C A;  1WMH B;  1VRA B;  3KYD D;  1HTO A;  3ZUN A;  4WIP A;  4GDK A;  2IY1 B;  2B3A A;  4HJG E;  1TTN A;  3EA6 A;  3I57 A;  4KSK C;  3NRZ A;  4JGH B;  1YX5 B;  4LK0 M;  1E8Y A;  4GB9 A;  4AOF A;  2Q5W D;  4BKS A;  3KWL A;  3DCG A;  2FAZ A;  3V61 A;  3CWI A;  3ZRC A;  3H7P B;  2OOB B;  3I63 C;  3JW0 X;  3AV8 A;  3IT6 B;  1NBF C;  3O13 A;  3R8B A;  2L76 A;  3FC4 A;  4DDI D;  3AN1 A;  3CF6 E;  2WXI A;  1TS2 A;  2MRP A;  2D10 A;  4C4V A;  1TY0 A;  2AWT A;  2MEK A;  2JXT A;  1DOX A;  4HKQ A;  1UUP A;  2NTS A;  2MLB A;  2CU1 A;  4K7U A;  3EGR A;  2J42 A;  4ANV A;  1XO3 A;  4WH4 A;  3P2B A;  4BZA A;  4DQO C;  3TJP A;  2YVC A;  3MJW A;  3PHX B;  1L0V B;  3T9L A;  2CJN A;  1FM0 D;  3ZQ4 A;  5BMI A;  3PRZ A;  1C9F A;  4HPL B;  2W9N A;  1D5Z C;  3PZ7 A;  1WYW B;  1FXA A;  1FD6 A;  2LGD A;  2ZJD A;  1J19 A;  2MJD A;  3MJ5 A;  5AEK B;  3L16 A;  3KW5 B;  4E74 A;  5E6O A;  2K3U A;  2L8J A;  2K8C A;  3QX1 A;  1JWS D;  2VZK B;  2W82 A;  2KWU B;  4WJP A;  2KAJ A;  2BBC A;  3BZD B;  3CST A;  1C78 A;  1AWD A;  3GE3 C;  1J0G A;  2J0M A;  1Y8R C;  3VAW A;  1L4D B;  2KDI A;  1KJT A;  2WDQ B;  2ZW1 A;  2VRR B;  1EU4 A;  5DPT A;  3FAH A;  4KKJ A;  2RPV A;  2KYW A;  2WLB A;  3Q3O C;  2IO1 B;  2YEP F;  1V6E A;  5JXV A;  3TBL D;  4IWO A;  2KN4 A;  4LDT B;  2LUE A;  1WYG A;  3UQA A;  4KX6 B;  3ZVV A;  5I4D A;  1XXG A;  3BVZ A;  4AQ7 A;  2LRW A;  2LGY A;  4KGT A;  2JUO A;  2N1V A;  2GI9 A;  4NY0 A;  2WXK A;  5BYQ A;  5EE9 A;  1TT5 B;  3CIR B;  4GN1 A;  3SEB A;  3RNG C;  2MHJ A;  4RGO S;  2KMC A;  1C77 A;  4US8 A;  5BMG A;  1YMH E;  4FN2 A;  3AEE B;  4LTU A;  3R7Q A;  3ZDM C;  1I4Q A;  2L52 A;  4X57 B;  2K22 A;  3ZO5 B;  1IYF A;  2LRU A;  2RDH A;  4DHZ B;  3QIJ A;  1ZXI A;  1JWU D;  1HTQ A;  4HEA 1;  2AL3 A;  4B95 A;  1GC7 A;  3BY4 B;  3ZRF A;  1H4R A;  5FK9 C;  3VQI A;  1SB3 C;  1SSN A;  3KWV A;  1T0Y A;  4DXA B;  2WP9 B;  1P7E A;  3A4R A;  2RD0 A;  1UD7 A;  1TJE A;  4NJC A;  2KAC A;  1WZ3 A;  3NS8 A;  2K8B A;  1XQQ A;  1HE8 A;  3DVN U;  3B0A A;  4XWT A;  1WGK A;  1CMX B;  4CO7 A;  3VUW A;  3ZW3 A;  1EU3 A;  3HRD D;  3NZU A;  3DDC B;  4HCN B;  4UDU C;  2LZ6 A;  3SD5 A;  3VRB B;  3RZW C;  3U7D A;  2AQ2 B;  4WWO A;  1YOV B;  3ENE A;  2WXJ A;  1MG8 A;  3SR6 A;  3AMZ A;  1JRU A;  5GXG B;  3BWU D;  4GU2 A;  3TL5 A;  4MSQ B;  3Q2A C;  2KO3 A;  1KOT A;  1VD2 A;  3H8H A;  2MCN B;  4RGN A;  1GB4 A;  5BO4 B;  5HFY A;  5IO9 A;  4EEW A;  2PW9 A;  1F1H A;  3NHE B;  4MGK E;  4W9E A;  3ZLZ A;  2JZZ A;  3Q3M C;  3W5V B;  2DZI A;  2D07 B;  2PPH A;  4WWP A;  2GBR A;  3DBR B;  1TIF A;  3ZNI D;  2LXC A;  2JSV X;  4RNA A;  5D6J B;  2LAS A;  4HK2 A;  4OHJ A;  1FNV A;  4C80 A;  3TIX A;  2KWC A;  3SHQ A;  4ZRK A;  4FXC A;  2Z0D B;  4OZB A;  4L1B A;  1ZGU B;  2AQ1 B;  4YSX B;  2KZR A;  1WJ4 A;  1TS3 A;  3DWM A;  3PGE A;  1YX6 B;  1WXQ A;  4HVB A;  1SIJ A;  1YN5 A;  3JSV B;  4TQ1 A;  1Q1O A;  1R7S A;  3L10 B;  2ICI A;  2AL6 A;  2JYT A;  3IAM 1;  4IG7 B;  3ZYY X;  4HDO A;  2LWP A;  2MWS B;  2WXP A;  3AUL A;  2FUG 1;  3P1M A;  4I6P A;  2O6V B;  5DPS A;  2BS4 B;  4AS1 A;  3RNA C;  3IG3 A;  5C1Z A;  3R3M A;  1SE4 A;  3NJT A;  2JX5 A;  2DAF A;  3HVD A;  2W54 A;  4CHK A;  4LNK A;  4WUR A;  2GOW A;  1I4H A;  4RGM A;  1WM3 A;  5J18 A;  3PHW B;  1LFD A;  1H8C A;  4GDK B;  4RFB A;  3NVW A;  3Q8B A;  4W9G A;  3ALB A;  4DHZ E;  2KQS A;  2L1A A;  3A9K B;  3V6E B;  2WXO A;  1WFY A;  1TKY A;  3RNE C;  3LXF A;  1L4Z B;  1WGY A;  3VH3 B;  1GNU A;  4J6I A;  2KDF B;  1R4M B;  3AEG B;  2K9X A;  4JX1 C;  2K6D B;  3S2A A;  5C23 A;  1IGD A;  2IYD B;  2KLG A;  3P4P B;  1SEB D;  3OG5 A;  2DAJ A;  2KTR A;  2I1J A;  2N9L A;  1XLP A;  2XNA C;  1WGH A;  1QQR A;  2UWQ A;  1YN3 A;  1ZXH A;  1XEE A;  3I9V 1;  4DHJ D;  3A4S C;  2J0K A;  4OZA A;  1V5O A;  4P6V F;  3U7Z A;  2DYO A;  3UQB A;  3NVV A;  4JE3 B;  2LHD A;  1XD3 B;  4W9F A;  3VH4 B;  1IGC A;  2DNF A;  1JAL A;  1NYR A;  5CX3 A;  2G1E A;  1E7V A;  1WE6 A;  4DWF A;  3AI5 A;  3SFE B;  2WXG A;  3TCA A;  4GXB A;  1IBX A;  4HJK A;  3PRE A;  4H2A A;  4ZYN A;  2DHZ A;  2JF5 A;  3APD A;  5BYS A;  2M1M A;  4ZRI A;  3DOW A;  4D2K A;  3GE8 C;  4FLH A;  5D2M B;  1J7A A;  1TS4 A;  2N1W A;  4LNN A;  4GDL B;  4KZC A;  1R4N I;  2WXF A;  1ESF A;  1FMA D;  4PS3 A;  2ZNV C;  4WJQ A;  2PTL A;  4CQN A;  1Q5W B;  2R61 A;  2EKE C;  1FCL A;  4MGY E;  2PE9 A;  1CQV A;  1WGR A;  3LJ3 A;  3IFW B;  2G4D B;  4HRS A;  1NI2 A;  1D6E C;  1WM2 A;  4ARC A;  1N62 A;  3AEC B;  2CHW A;  3HIZ A;  2KMA A;  2N7D A;  4BFR A;  3AU5 A;  3U2S C;  2MBE A;  4KKI A;  3GB1 A;  2G3Q B;  4LNO A;  3RFZ B;  4FJZ A;  2NPT B;  1F9J A;  4NAW B;  3PTF C;  3VUX A;  1TBE A;  1PGB A;  2CHX A;  2PLP A;  4NZL B;  4TQ0 A;  1IP9 A;  4MSM B;  1GPX A;  1FXT B;  1P98 A;  1E8W A;  1YJJ A;  2KC1 A;  1JRP A;  1RFK A;  2C7M B;  3N20 C;  2L0F A;  4MJS A;  1XF5 L;  2D3A A;  2BQQ A;  4EZL A;  4II2 B;  4S17 A;  3BYT B;  1PDX A;  3WA0 A;  2EMS A;  2REX A;  2D3C A;  2V4I B;  5H8Y E;  4USA A;  4IC7 B;  3NZS A;  3ZGZ A;  3HK0 A;  1B9R A;  2RSU A;  4ANW A;  5FR3 A;  1QF6 A;  1I4P A;  1VZ6 A;  4XDC A;  2KDB A;  2K1F A;  5C3J B;  3VDZ A;  2EMT A;  5D94 A;  3TEW A;  3MC0 B;  2KN5 A;  4JWS C;  1YN4 A;  4A9A A;  3RD2 A;  4HDQ A;  2K0P A;  2N4F A;  1L6V A;  1WIA A;  4KGS A;  1XT9 B;  2DZM A;  4ZHP A;  2L05 A;  2FID A;  1JW9 D;  3B9J A;  3J9C A;  3U8Z A;  1M94 A;  3Q69 A;  4FUL A;  2WXN A;  2LD9 A;  3CSF A;  2MBH A;  4NAM A;  1VLB A;  5AZF A;  3DHH C;  1NYQ A;  1ZW7 A;  3PLV A;  1WX7 A;  2WX1 A;  4AJW A;  4A55 A;  4M8N A;  5E6P A;  1QT9 A;  2KXJ A;  2MX2 A;  4LJO B;  4FAD A;  3RYT A;  3ZJU A;  3MC9 A;  1E10 A;  5LNK 1;  4W9J A;  4RCO A;  3AU4 A;  1WY8 A;  1T5X D;  4DXF A;  3PV1 A;  3A9K A;  1ENF A;  2XN9 C;  1T0S C;  2KOX A;  1BUI C;  1U4A A;  2GBK A;  2V1Y A;  2WHI A;  4Q2J A;  1Z2M A;  2YEP B;  2IBI B;  4KIK A;  2K6Q A;  2N7J A;  2CS4 A;  1CK1 A;  2I2Y A;  3PPA A;  4ASW C;  3GZN B;  3Q3F A;  4K7S A;  2YLM A;  1QOG A;  1LXD A;  2ZCB A;  4WJN A;  2XBB C;  3AH7 A;  2PVG C;  2HE7 A;  5J2R A;  4HPP A;  2A4Z A;  2IND C;  4C00 A;  1E6E B;  1PGA A;  2DBY A;  3K9P B;  2DZJ A;  2KX3 A;  4YSZ B;  2BGF A;  1XLO A;  3ZNH B;  3NOB A;  2J52 A;  2SEB D;  1SF0 A;  2C60 A;  4GSW A;  1F2R I;  1K52 A;  4MH8 A;  4DDG D;  3T3O A;  4MEM A;  3RZF A;  5MPO A;  2V9H A;  3EUB 2;  2MSE D;  2PVO D;  4E71 A;  4MEL A;  2IDY A;  3OAW A;  4EFO A;  3QJZ A;  1K53 A;  4KDI C;  4GDL A;  1V1O A;  4P1C C;  2FCQ A;  3WIM A;  1MVK A;  1V9J A;  4XWW A;  3X0W A;  1WI0 A;  2NBV B;  2N7E A;  2M17 A;  1UGJ A;  2ON8 A;  4NNJ B;  3KH0 A;  3GP7 A;  3ETR A;  3HUI A;  4HWI B;  1UWM A;  1C79 A;  4FA6 A;  2WX0 A;  4LCD E;  4ITK A;  1V5T A;  1TS5 A;  1TZ1 A;  3Q3J A;  2BB5 A;  4L2Y A;  1GJZ A;  2NPT A;  2OHF A;  1HZ6 A;  4NAW A;  2PKO A;  2ZW0 A;  5TSS A;  2WU5 B;  1E5W A;  4BKS D;  1VJK A;  3DWG C;  5EE3 A;  2M19 A;  1HQR D;  3NG0 A;  3R7R A;  3WAO A;  3V05 A;  3MFG A;  2KTR B;  3QAR A;  2PJH A;  4I6L B;  4ANU A;  2LEK A;  2D5G A;  4S0R A;  2J53 A;  4C7Y A;  4RMA A;  3SFD B;  4MDK E;  3W5U B;  3NY5 A;  4N6E B;  1YJI A;  4RF0 A;  3Q3N C;  4XC2 A;  2N9K A;  2Y3A A;  5DCN A;  4BBN F;  1WF9 A;  4NJ7 A;  1SGH A;  1WX8 A;  2X38 A;  1EO6 A;  3A9J B;  2UYZ B;  3VR9 B;  5AZG A;  2J7Q B;  2LGX A;  1IBX B;  2LGI A;  3AE2 B;  1K50 A;  3VRA B;  4HPM B;  4KV2 A;  4EZJ A;  1NDD A;  2NTT A;  3U30 A;  1OGW A;  3BYY B;  1KTK A;  4FHK A;  1C3T A;  1EF1 A;  1VCB A;  1UZX B;  3NVZ A;  3BVM A;  2BT6 A;  2LFI A;  2WQY B;  1LQB A;  1NI3 A;  2V4L A;  2BKR B;  5LXH A;  4W9C A;  1UGM A;  3DPD A;  3N30 A;  4CYE A;  2MP2 A;  2KAN A;  1FO4 A;  5EDS A;  3K9O B;  4FBJ B;  3ZTD A;  3BVG A;  3ML9 A;  5IAA C;  3RT3 B;  1WGG A;  2GBN A;  2Y5B B;  2KMM A;  5FKA C;  3RNF C;  1SE3 A;  1AAR A;  1LGR A;  3EC8 A;  1YIW A;  2X8X X;  2IO0 B;  3QQ8 B;  1YQB A;  3DVG Y;  4XGA B;  2HTH A; 
#chains in the Genus database with same CATH homology
 1C4A A;  1QQR A;  3ABV B;  1YN3 A;  1L0X B;  1ZXH A;  4IKG A;  1XCT L;  3AB5 A;  1WRI A;  1XEE A;  3I9V 1;  2I38 A;  1JRO A;  1MI0 A;  4ZYS A;  4OZA A;  4P6V F;  3U7Z A;  2DYO A;  2KDM A;  1VZ7 A;  1AYF A;  1DGJ A;  3E56 A;  3NVV A;  4JE3 B;  1F2R C;  2WXH A;  2WS3 B;  2LHD A;  3LYY A;  4EE2 A;  2DLB A;  2JYE A;  2WXL A;  1IGC A;  1IUE A;  1TZO A;  1JAL A;  1NYR A;  3NVY A;  2G1E A;  1NEN B;  2MJE A;  1I7H A;  1XCQ L;  3SFE B;  4A6Q A;  2WXG A;  1IBX A;  1Y56 A;  1FFU A;  1MHH E;  3BK2 A;  4H2A A;  3AE7 B;  3MP9 A;  2WDR B;  1F77 A;  1KLG D;  5BYS A;  2MJ3 A;  4D2K A;  3BII D;  3VR8 B;  1J7A A;  1TS4 A;  4GDL B;  1F0Z A;  3AE6 B;  2INP E;  1JWB D;  1HA5 A;  2WXF A;  1RM6 C;  4ZOH C;  1ESF A;  1FMA D;  1NEK B;  2AX5 A;  3Q8A A;  4ZHO A;  3UI3 A;  4JPS A;  3P63 A;  2N0S B;  1CZP A;  1TKG A;  2PTL A;  4CQN A;  2R61 A;  1FNU A;  2DYM A;  1JQ4 A;  1FCL A;  3FIL B;  3Q8C A;  1CQV A;  2Y5C A;  1LO5 D;  1E9M A;  1QIL A;  5G5G A;  1VRA B;  1V97 A;  1FRR A;  2QMT A;  4WIP A;  4HRS A;  2Z8L A;  1ROE A;  1ZDX A;  1D6E C;  4HJG E;  4ARC A;  3EA6 A;  1N62 A;  3I57 A;  1WSP A;  4P16 A;  3AEC B;  3AM9 A;  4OZC A;  2EEL A;  1WWT A;  1T6B X;  3NRZ A;  3PZ8 A;  1MPE A;  3U2S C;  1FXI A;  2PMV A;  4KKI A;  2JU6 X;  3GB1 A;  4LK0 M;  3RFZ B;  1OFF A;  2Q5W D;  3KWL A;  4NAW B;  4MM3 B;  3CWI A;  2DWQ A;  3IXS A;  1PGB A;  1JCK B;  2BS2 B;  2PLP A;  4NZL B;  4TQ0 A;  4ZRQ A;  1GPX A;  2TSS A;  3TSS A;  2CU3 A;  1YJJ A;  2E6X A;  1JRP A;  1RFK A;  3AV8 A;  3IT6 B;  2BB6 A;  5D3I B;  1ACC A;  3O13 A;  1XF5 L;  3R8B A;  2OED A;  3FC4 A;  4LLG M;  4YTP B;  3AN1 A;  2JWU A;  2WXI A;  1TS2 A;  1D4B A;  1J7B A;  3BYT B;  1GOZ A;  1QOF A;  1PDX A;  2QIL A;  2QIE B;  4WAF A;  2HTM E;  1YNT E;  1TY0 A;  2V4I B;  5H8Y E;  4USA A;  1EWY C;  1SJH D;  2MEK A;  2WDV B;  5AUK A;  1SE2 A;  2JXT A;  1KRH A;  4O1N A;  5D7G A;  1DOX A;  4HKQ A;  1UUP A;  2GRI A;  2NTS A;  3ZGZ A;  1B9R A;  2IPK D;  1XLQ A;  1FCC C;  1OQR A;  3EGR A;  1B1Z A;  2J42 A;  4WQM A;  5D3D A;  5FR3 A;  1QF6 A;  1XO3 A;  4WH4 A;  1I4P A;  1VZ6 A;  4XDC A;  1C76 A;  1FRD A;  5C3J B;  4DQO C;  1JWA D;  4REZ A;  1L0V B;  2CJN A;  3TEW A;  1FM0 D;  3ZQ4 A;  1M4V A;  5BMI A;  3MC0 B;  2LHE A;  3N9Y C;  3ZJT A;  1C9F A;  1D5Z C;  3NS1 A;  3PZ7 A;  3ZJV A;  2WXQ A;  4JWS C;  3LB8 C;  1YN4 A;  2L83 A;  4A9A A;  1FXA A;  1FD6 A;  1GB1 A;  2K0P A;  3FIL A;  2MJD A;  2ACZ B;  3AEF B;  2LUM A;  3MJ5 A;  1L6V A;  5HI1 A;  4KGS A;  2K3U A;  4YXD B;  1FFV A;  1NVI D;  4ZHP A;  1JW9 D;  3NUH B;  3B9J A;  3AE1 B;  3J9C A;  4R3D A;  4IDI A;  1JWS D;  2VZK B;  2KQ4 X;  2W82 A;  1KF6 B;  3Q69 A;  2JQR B;  2QJL A;  2WXN A;  1A70 A;  2KAJ A;  2BBC A;  3B2F A;  1JML A;  2L32 A;  3BZD B;  4NAM A;  4TMA B;  1VLB A;  1VZ8 A;  1C78 A;  1AWD A;  3T3N A;  3AE4 B;  1L4D B;  1NYQ A;  3TEZ A;  4GLS C;  3W2D A;  2G9H D;  2WDQ B;  4A55 A;  2ZW1 A;  3AE5 B;  1QT9 A;  4A8X C;  1EU4 A;  5H92 C;  1L5P A;  1RYJ A;  3FAH A;  3V3X A;  2WU2 B;  1EM7 A;  4KKJ A;  1J7C A;  1TY2 A;  1ZUD 2;  2W3S A;  2RPV A;  3ZJU A;  1E10 A;  3P4Q B;  1I4G A;  5LNK 1;  2WLB A;  1VDV A;  4MAC A;  4RCO A;  4PT5 A;  2YEP F;  2V3P A;  2N9L A;  3IAS 1;  5JXV A;  1T5X D;  2RDG A;  4N59 A;  2VZK D;  2KN4 A;  4DXF A;  4C56 C;  4YTM B;  2KWD A;  1XLN A;  1WYG A;  4KX6 B;  5HG2 A;  1L6U A;  1ENF A;  1N60 A;  2XN9 C;  5I4D A;  1XXG A;  3BVZ A;  3Q8F A;  4AQ7 A;  4KGT A;  1BUI C;  3AEA B;  2GI9 A;  4Q2J A;  3C8Y A;  4DXG A;  2WNM A;  2YEP B;  2WXK A;  5BYQ A;  2IGG A;  2N7J A;  5EE9 A;  2FE8 A;  1CK1 A;  3CIR B;  1QOB A;  3R2T A;  2I2Y A;  1BML C;  3SEB A;  1ET6 A;  4RGO S;  1CJE A;  1QOG A;  2EKI A;  1C77 A;  4US8 A;  1OQQ A;  5BMG A;  1L0Y B;  1YMH E;  1FIQ A;  1T3Q A;  3AEE B;  1ZP0 B;  5AUI A;  4LTU A;  3B2G A;  4RGT A;  3AH7 A;  1I4Q A;  2PVG C;  1SBB B;  2L52 A;  3U52 E;  4ZRP A;  2K22 A;  2FBW B;  2H88 B;  1E6E B;  1PGA A;  2RDH A;  1GAQ B;  2DBY A;  2IGD A;  1ZXI A;  1JWU D;  2Y5P A;  4HEA 1;  3BK1 A;  1HXY D;  1K51 A;  2QEJ C;  3IT4 B;  4YSZ B;  5FK9 C;  3VQI A;  1XLO A;  1SB3 C;  1SSN A;  2SAK A;  2J52 A;  2SEB D;  1SF0 A;  3KWV A;  1F2R I;  1PGX A;  1K52 A;  5BYR A;  4MH8 A;  1KLU D;  1P7F A;  2WP9 B;  1P7E A;  1SXT A;  3T3O A;  1VR9 A;  3RPF C;  5MPO A;  3EUB 2;  1TJE A;  2LJI A;  4IOI E;  4NJC A;  4XE0 A;  2KAC A;  1AW7 A;  2INN E;  3TEX A;  2PVO D;  4L23 A;  4XWT A;  2K5P A;  2IDY A;  1D5X C;  1WGK A;  4YSY B;  4N58 A;  1K53 A;  3MHZ A;  4RF1 A;  1V1O A;  1EU3 A;  4OW0 A;  3WCQ A;  2CJO A;  1E0Z A;  3HRD D;  1MVK A;  4UDU C;  5EE1 A;  4XWW A;  3VRB B;  3AEB B;  2WXM A;  2AQ2 B;  2HDE A;  4YTN B;  2WXJ A;  1UGJ A;  2ON8 A;  3L4P A;  3GP7 A;  3SR6 A;  3AMZ A;  5EE0 A;  2ONQ A;  5GXG B;  3ETR A;  2BW2 A;  3BWU D;  3HUI A;  4RH6 A;  1N5W A;  1UWM A;  1C79 A;  3HVZ A;  2NMQ A;  1N61 A;  1FNW A;  4ITK A;  3U4E G;  2W55 A;  3PO0 A;  1AN8 A;  5T8I A;  2B76 B;  4YWG G;  1TS5 A;  3H8H A;  4J3O D;  2BB5 A;  4RGN A;  1PUT A;  4L2Y A;  1GB4 A;  4TSS A;  1RWS A;  1BXT A;  3URY A;  5HFY A;  1DOI A;  2PW9 A;  2OHF A;  1TYG B;  1HZ6 A;  4WWM A;  4JWU C;  1HZ5 A;  2PKO A;  2ZW0 A;  3W5V B;  1YQ3 B;  4US9 A;  2WU5 B;  5TSS A;  3AED B;  1VJK A;  3AE8 B;  3DWG C;  5EE3 A;  2M19 A;  3GS2 A;  3TEY A;  1ET9 A;  1HQR D;  2JSV X;  4RNA A;  2BTE A;  3V05 A;  1V1P B;  3MFG A;  3P42 A;  2V3N A;  4C7Z A;  2LEK A;  4OHJ A;  1FNV A;  2D5G A;  4C80 A;  2J53 A;  4C7Y A;  2V0G A;  1N63 A;  3SFD B;  4HKZ E;  4FXC A;  4OZB A;  3W5U B;  4L1B A;  1ZDV A;  1C4C A;  1PFD A;  1DOY A;  4N6E B;  1YJI A;  2AQ1 B;  2W3R A;  3E9S A;  4KGR A;  4RF0 A;  4YSX B;  1PYW D;  3P4S B;  1EWC A;  1TS3 A;  3P4R B;  5G5H A;  5C2T B;  2AQ3 B;  3DWM A;  1KFY B;  2N9K A;  2Y3A A;  2M56 B;  1WXQ A;  1SIJ A;  1YN5 A;  1JWM D;  2H89 B;  1QKZ A;  2BYT A;  4TQ1 A;  1DYQ A;  2WXR A;  1ZPS A;  1R7S A;  2X38 A;  2IJ0 A;  1TKE A;  1MHX A;  3VR9 B;  2ICI A;  2GB1 A;  1Q10 A;  1FEH A;  2JYT A;  3IAM 1;  1IBX B;  2LGI A;  3AE2 B;  3ZYY X;  1ZE3 D;  2WXP A;  1K50 A;  3VRA B;  3OWE B;  2FUG 1;  3KLS X;  3P1M A;  3KQ4 A;  2BS4 B;  4AS1 A;  2E3T A;  2QSD A;  2NTT A;  1SE4 A;  2JX5 A;  3BYY B;  3R2I A;  1KTK A;  1N5X A;  3HVD A;  2W54 A;  1UNS A;  4YT0 B;  2MH7 A;  4HRO A;  2IGH A;  4XDD A;  3W9C B;  3NVZ A;  4WUR A;  1QOA A;  3AE9 B;  2BT6 A;  3BVM A;  2J4X A;  2LFI A;  2WQY B;  1I4R A;  1NI3 A;  4B0E A;  4B0M A;  1I4X A;  1I4H A;  4RGM A;  3TUO A;  1V8C A;  1C4P A;  1HEZ E;  1STE A;  4GDK B;  3AE3 B;  2M0A A;  3NZ3 A;  4RFB A;  2LMC A;  1FO4 A;  3NVW A;  3Q8B A;  1ZOY B;  4OVZ A;  2L1A A;  3BVG A;  2WXO A;  1TKY A;  3LXF A;  1L4Z B;  2PIA A;  3W1S A;  3AEG B;  1SJE D;  2K9X A;  3Q8E A;  4JX1 C;  5E6J A;  1IGD A;  3P4P B;  4A90 A;  1KH0 A;  2KMM A;  1SEB D;  2JZP A;  2RMM A;  1V1P A;  5BMH A;  5FKA C;  1E7P B;  2BS3 B;  1SE3 A;  1UWX A;  1QLB B;  4ARI A;  4M0W A;  1D5M C;  1YQ4 B;  4MT5 A;  5HHD G;  1XLP A;  2XNA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...