2L32A

Solution structure of ubiquitin-like small archaeal modifier protein in haloferax volcanii
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
66
structure length
66
Chain Sequence
MNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 2
publication title solution structure of ubiquitin-like small archaeal modifier protein in Haloferax volcanii
rcsb
source organism Haloferax volcanii
molecule tags Protein binding
total genus 4
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.630 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2l32A00
2L32A 2LJIA
chains in the Genus database with same CATH superfamily
5JH5C 2KT7A 2G1EA 3B9JA 2L32A 2D10A 1QF6A 4CHKA 4II2B 2O2VB 3EUB2 1C4AA 4ITKA 2LXCA 1I4HA 2QDFA 2EELA 2AQ3B 4XYCA 2M8SA 5LLIA 2D3BA 5EE0A 3MFGA 1GC6A 3X23A 1C1YB 1C4PA 4HLEA 3VTVA 1SJED 2G3QB 2YEPF 3TSSA 3ML8A 1JWUD 4BKTA 3AB5A 1D6EC 1T3QA 3V61A 2VZKD 4G50A 2ICIA 2V0GA 5D3DA 2GMIC 4M8MA 1AYFA 3Q3FA 1V6EA 1EWCA 4H2AA 1F2RC 5CHVC 5DPWA 2J52A 4RF1A 1K52A 1EM7A 3N1YC 1SE3A 3D32A 4ZRQA 2NCNA 3PLVA 3WIMA 1V5OA 3IXSA 3ZNGC 3JYUA 3DQVA 5FR3A 5G55A 1E8YA 1L7YA 5EE9A 3APCA 1L0YB 2AQ2B 2JZPA 3RNEC 1D5ZC 1Q10A 2ZNVB 2JT4B 2GRIA 4GSWA 4M00A 2BF8B 4EZKA 4EZJA 3RNGC 3ZW3A 4LDTD 2K25A 2NBWB 4YXDB 2WDRB 3N32A 1HEZE 1WJUA 3SD5A 5AUKA 1TKEA 2QIEB 3SDLC 2LI5A 1ZW7A 2BQQA 3VTUA 4I6PA 3DOWA 2KTRB 1MI0A 3KYDD 2RSUA 3VR8B 4P1CC 1LFDA 2MHJA 2W54A 4MJSA 3I57A 1WR1A 5D6JB 3C0RB 4MEMA 3HVDA 1GG3A 3HM6X 2KN5A 2Y5BB 4WWOA 3BK1A 3IAS1 2JX5A 1SBBB 1OEYJ 3VDZA 2KDBA 2JRHA 2GBMA 4B0MA 1JMLA 2I1JA 2EMTA 4WWMA 3UI3A 2AL3A 2WU5B 4ZHOA 2MH7A 4N6EB 2DZJA 2LGXA 4JWSC 2JWUA 4EKUA 3APDA 2REXA 2M19A 3KQ4A 1TGZB 4FJVB 4C7ZA 4IDIA 1ZUD2 4E74A 2CU3A 1SXTA 4HWIB 1JRUA 2MCNB 2N7JA 5EE1A 3PZ7A 1YQ4B 1AWDA 2WU2B 1OEYA 5G2NA 4RNAA 5DPSA 1WXQA 1FFVA 2WXHA 3AE9B 1ESFA 1WMHB 5IOIA 4NJCA 5IA7A 4ICUA 2WS3B 1KTKA 2CHWA 3ZXVA 1WH3A 1QLBB 1NYRA 4IM2A 2KAJA 3BYYB 5FR6A 3N30A 3HK0A 4KDIC 3V60A 1QOBA 2Z0DB 4IM3A 1I7HA 1MJDA 1TZOA 2LJ5A 3R8BA 3RI7C 4MM3A 5C1ZA 1CMXB 1ZDVA 3WALA 3PV1A 1E90A 3VRAB 3M95A 1P7FA 4LNFA 4C4VA 4NY0A 4WWNA 2IY0B 3FKYA 3R66C 3RNFC 2V4LA 1H8CA 4ZDVA 1L4DB 2OJRA 1YQ3B 2N9PC 3ZQ4A 2KLGA 1IGCA 1XLOA 2N9KA 3T9LA 2WNMA 4NQKE 1T5XD 1YD8U 4ACFA 3RFZB 2DX5B 3PS6A 3GB1A 5TSSA 1DOXA 3NZUA 1IPGA 2PTLA 3NS1A 1MFWA 1ACCA 3RCZA 2NTTA 2L8JA 4GOCA 2Z0EB 3AXCA 1UWMA 3TCAA 2ONQA 3NS8A 3CIRB 3BYTB 3ZVVA 3EC8A 2XNAC 1V5TA 2WGSA 4PYUA 1YOVB 4WQMA 2G9HD 2WP9B 4RFBA 2NS5A 1XCQL 2JZ3B 4K81A 4TUUA 1EO6A 2KHWB 1VRAB 3R3MA 2BW2A 1D5MC 1N61A 4ANXA 3GZNB 1KH0A 1T0YA 3AEFB 3AU5A 1G6JA 2L0FA 1SIFA 3KUDB 4KIKA 4XZ4A 4K1RB 1QZEA 3DWGC 3RZFA 1P1AA 4DXGA 1D4BA 4GDLB 1ROEA 3IAM1 2J0MA 4IWOA 1WGHA 4F7ZA 3PRZA 4XWWA 5E6NA 1YIWA 4WQOB 3Q3OC 2PEAA 1K51A 3PZDA 4OZCA 3B2FA 1SGHA 3PLUA 2J42A 3ECIA 3P63A 4GDKA 2ZEQA 2KDMA 2A4ZA 1HQRD 2IBIB 3VUXA 2O6VB 2RDHA 3P4RB 1VJKA 2Z59B 2MSED 2LVOA 2ZNVC 2K8BA 2BKFA 1C79A 2BB6A 2WXFA 1CZPA 1CK1A 4L23A 3UQBA 2KFJA 2BPSA 2LUMA 3EECA 1VZ6A 2MW5A 1EF1A 4GDKB 2FUG1 5LXHA 1L0XB 5I4DA 3L17A 2C9WB 1KLUD 1E6EB 4ARIA 1GPXA 2ZW1A 2OEDA 2MBQA 1FNVA 4KZ0A 2D2QA 2DBYA 3H7SA 2VRRB 4RMAA 4ZYNA 1EU4A 3SFEB 4OW0A 4M01A 4FA6A 2ZPNA 2MJ3A 2KACA 4D2KA 1FFUA 2M0XA 3PVLA 1EWYC 3TUOA 2LGDA 4TQ0A 3UIPB 1FPYA 3VVWB 1VLBA 2MEKA 2Y5PA 5DPRA 1D5XC 1PGXA 2K1FA 4LNOA 4ANVA 4RH6A 2AWTA 2E6XA 2FCQA 3ETRA 3LDZE 3KH0A 3AE6B 2XN9C 1ZDXA 4N58A 3U2SC 3EFCA 3DBRB 2L0TA 3SEBA 2K39A 4DBGA 1NENB 1NYQA 3A9KB 4NAMA 2WXPA 5EE3A 4NQLB 2G4SA 3UF8A 2LJIA 1J7AA 2B3AA 3ZKJC 1S3SG 1KFYB 1RRBA 2XK5A 1FMAD 4HPPA 1E0ZA 1V81A 1E7VA 2K3UA 4NAWB 2HTHA 3A9JA 1XCTL 3T8MA 3NUHB 4LNIA 2WDQB 3HRDD 3WAPA 5LXIB 1OGWA 4TV3A 4AJYB 3VRBB 4HCPB 4TSSA 1F2RI 1I4RA 1TS3A 1FO4A 4B0EA 3CSFA 4URKA 3Q8EA 1MG4A 3KUZA 1UBIA 1JROA 1C4CA 4A6QA 3KWLA 1L6UA 1VDVA 5TR5A 4MH8A 4M02A 5C3JB 1ZOYB 1IGDA 4GGQA 4HKZE 1E8XA 4JPSA 2DAJA 3AU4A 4LK0M 4C7YA 2W3SA 2LRWA 1E9MA 1F1HA 4RF0A 4JX1C 5IAAC 1EUVB 2PLPA 2MA9B 2C60A 1UWXA 2MP2B 1D3ZA 3OWEB 2LASA 4S0RA 5JXVA 2DYOA 2V3PA 2MBOA 3DBLI 1ZKHA 3DBHB 4GB9A 3DVGY 4NPNA 3L10B 2KJRA 2MBBB 3AE1B 2ZZPB 3U7DA 2JYTA 1DGJA 3ALBA 2AQ1B 2O2VA 4PS7A 3MHSD 1R7SA 3U30A 1ZP0B 2BKRB 3KVFB 2KWCA 1N6ZA 2CJNA 2Y5CA 1MHXA 3KYCD 1JRPA 1QQRA 1TBEA 4G0NB 1KM7A 1I4XA 2KTFA 3W5UB 2JYEA 4KKJA 2DENB 4XDDA 1GB4A 2TSSA 4DHJB 1C77A 4XWTA 3VR9B 2WXJA 3AE8B 3P1MA 5HFYA 3NJTA 3ZDTA 2BWES 4BBNC 2MX2A 4AOFA 4HCNB 1SSNA 2W55A 1PGAA 3ZNZB 4F1SA 4US8A 2K22A 2RD0A 2YLMA 4KGRA 3VFKA 2BGFA 1LO5D 2C7HA 2CHZA 1GB1A 2BS3B 2G4DB 3AMZA 5CX3A 2KDFB 1JWSD 3LB8C 3K9OB 4BOSC 4ZRPA 1F9JA 3Q8BA 2HTME 2FCMA 1AN8A 4FJYA 1E8WA 4AWJA 2WXOA 5BMHA 3P4PB 1RLFA 2WX1A 1P3QU 2I1KA 3AEDB 3WCQA 3MHZA 2IDYA 5BMGA 3HVZA 4AUQC 1YJJA 3VXWA 2AEHA 1P7EA 1EF5A 4DHJD 5IKCM 2GB1A 3Q6BA 4QAYA 2KTRA 1WM2A 1HZ6A 3DVNU 4IKGA 2D3GA 1XLQA 2MJEA 4A90A 1R4NB 4WJQA 4ZRKA 3P42A 1TKYA 2HJ1A 2N7DA 1OQQA 1PGBA 2QSDA 2XEWA 2IGDA 1PYWD 4F8CB 4KSLC 3N1ZC 4EFOA 2GBKA 2BYTA 2FIFA 2KWUB 3DHIC 5MPOA 4MACA 3TJPA 2CKHB 1WGGA 5DCNA 1AARA 2IYDB 2NTSA 1I4PA 2BT6A 2W9NA 1VZ8A 3ZGZA 2XBBC 2KFKA 2JQRB 1J19A 3QA8A 2KN4A 1WY8A 2ZW0A 1LM8B 1IBXA 3U52E 3TEXA 3TEWA 5JHBA 4PS3A 1UELA 5AZFA 1WE6A 4LCDE 4YSXB 1P9DU 3RPFC 4EEWA 3GOEA 1QOGA 5CTRC 3Q69A 4ARCA 3AECB 2QJLA 2KFKB 3BWUD 4MSMB 2WDVB 3NVZA 1IBXB 2RMMA 3ZLZA 1XF5L 3IVFA 2X38A 4WJOA 2UU7A 4CO7A 1FD6A 2WLBA 4L2YA 4W9IA 1ZPSA 4IC7B 3KUCB 3IT4B 5BYSA 2MBHA 3QX1A 1WMHA 2KVRA 3L0WB 3PRPB 4IWQA 2WXKA 2KO3A 3NVYA 2ZCCA 1J0GA 4ZRJA 1N5XA 3ZJTA 2LFIA 1V2YA 1ZXHA 3VUYA 3NZ3A 2SEBD 4EZLA 2EKIA 1N62A 3AE3B 2PPHA 3A4RA 3WANA 2KD0A 5E6OA 2GI9A 2GBRA 4LNKA 2DAFA 2J4XA 4K7WA 4GXBA 3DPDA 3MC8A 3V62A 1RWSA 3T3OA 4RM8A 3BIID 2BB5A 3L4PA 3H9DA 2J7QB 2ZVNA 4XC2A 1WRIA 4DWFA 3QIJA 1XXGA 2DZIA 2LGSA 1TZ1A 1BXTA 2B76B 4YTMB 1WFYA 2M1MA 1WX7A 2L05A 3PRMB 1JWAD 2M17A 5KHQA 2KYWA 2CR5A 2H88B 1GOZA 2N9XA 3KW5B 3NOBA 2D07B 2GBNA 3AE5B 1EU3A 1K50A 1GAQB 2KKCA 2PW9A 5J2RA 4NJ6A 3RD2A 3QWZB 5AUIA 4II3B 3O13A 1WI0A 2WXMA 1ENFA 2M4NA 1YNTE 5FKAC 4PYZA 1V49A 3W5VB 2V9HA 1I42A 3FILA 2C5LC 2NPTA 3KWVA 3OJ4B 3OJ3A 4TQ1A 4B6WA 2KK8A 3ZJUA 1Q1OA 4A55A 2IJ0A 2KC2A 4NNJB 1HTOA 2N0SB 4Q2JA 2LD9A 4JGHB 1L5PA 4HVBA 2KZRA 1WGKA 3B1LX 4B9KA 2LHEA 4P16A 2NMQA 3A1QA 4GDLA 4HPMB 3N3KB 3ZRCA 4WURA 1WF9A 3FILB 4DK5A 2NPTB 5E6PA 3J9CA 3AEBB 3DCGA 5EDSA 3A4SC 3AE2B 3L54A 2WXQA 4MELA 2GLSA 2W3RA 5C2TB 2NBVB 1STEA 2QHOA 3OAWA 1GC7A 3JSVB 1WSPA 3IHPC 2INCC 3UGBB 2LXAA 2VH1A 1BMLC 2LVQA 2O6VA 3A1QB 4W9CA 3N1XC 2WDTB 1QOAA 4J3OD 3VAWA 2PMVA 1N5WA 1NDDA 3DVNV 2Z8LA 2WWZA 1NBFC 3P2BA 1J8CA 3ZDMC 1V1PB 2M56B 4RGNA 5IP4D 1MPEA 3K9PB 4E3CA 3M62B 3T3NA 2QC8A 2UWQA 4BVUC 1YQBA 1WXMA 4W9LA 1PQSA 2LWPA 3HUIA 3ZNID 1WXVA 3UIOB 3B0AA 2WXGA 1XLNA 5KHOA 3CWIA 1QOFA 1YN4A 2RDGA 3NG0A 3EFUA 4US9A 2WXRA 1XO3A 2BVCA 1IYFA 4YT0B 1WJ6A 1KRHA 2GOWA 4BKGA 3RULA 3BK2A 2QMTA 3N9YC 2I38A 3H7PB 1JQ4A 2N4FA 3PHWB 4PK1A 3FAHA 4GIVA 3QAQA 3ENEA 4AS1A 3MP9A 2OOBB 2EKEC 2L00B 5BO4B 3R7RA 4XGAB 2V4IB 3AM9A 1T0QC 3A9KA 1BT0A 4DXFA 2MQJA 1VR9A 3RNAC 2KC1A 3I3TB 3GS2A 1FRDA 3ABVB 2NBUA 3I5JC 4FJZA 1ET9A 3ONSA 5AEKB 2O6VD 4FHJA 5JHAA 2OHFA 3APFA 3V05A 1MHHE 1RAXA 4NAWA 2PJHA 1WJNA 1ET6A 4KX6B 2W82A 4FLHA 4XE0A 2K9XA 2D3CA 3PHXB 1WX8A 4RGTA 3IFWB 1FIQA 1V86A 5JZEB 1DYQA 4FHKA 3P4SB 5L95C 2BWFA 2L7RA 2K8CA 3WAOA 1CQVA 1J7CA 1TY2A 2G45B 3Q3JA 1E7PB 3GZNI 3LJ3A 1K8RB 3SR6A 5H8YE 3BINA 3EA6A 1HTQA 2LRUA 4A8XC 4W9HA 1JWBD 4J6IA 1K53A 3MC0B 2CU1A 3NVWA 2IGGA 1CJEA 2KQ7A 4YTPB 2LHDA 2RGFA 2WYQA 1SB3C 2WXNA 3NVVA 2AX5A 4FBJB 4DHZE 4BOZB 5D7GA 2K5PA 2MP2A 1WXSA 1YJIA 4W9DA 3VH4B 1C76A 4G3XB 4TKNA 3RN9C 3WAMA 5GXGB 4GMVA 3QC8B 2OJWA 2WX0A 1UZXB 1WZ0A 3SHQA 1XQQA 5D94A 2FBWB 1TTNA 4HJKA 2QILA 1R4MB 3TL5A 3X0WA 4EE2A 3W1YA 1WWTA 3P4QB 2IO0B 1FXTB 2ACZB 3CSTA 3V6EB 1F0ZA 1YMHE 5FK9C 2L52A 3NRZA 1SJHD 1Y56A 3VQIA 3NHEB 1T6BX 1T0SC 1XD3B 2JU6X 2MLBA 2CS4A 4M0WB 3Q3NC 3SU8X 4BKSA 2PKOA 3B2GA 3EGRA 4OVZA 1WGRA 3PO0A 3E56A 3VHTC 2ZJDA 2KANA 3VH3B 3RZWC 2J0JA 4WJPA 2YVCA 3W1SC 3S2AA 2N1VA 2VZKB 3RT3B 1JWMD 2V3SA 4HRSA 3LXFA 2IGHA 3DBRI 3DBSA 2MRPA 4A20A 3QQ8B 1YX5B 1PDXA 4YWGG 3DVGX 4MH0E 1YN5A 2KMCA 3BVGA 3AE4B 5L83A 4HKQA 2ON8A 3HIZA 1WGDA 2BYVE 3AEAB 2UYZB 2IO1B 4JIOU 1NI3A 3ZUNA 2JRIB 4G11A 3ZO5B 1NVID 4WAAA 1VD2A 3JW0X 4O1NA 4LDTB 2JUOA 5AZHA 1V9JA 3H8HA 2HDEA 1FXIA 2IPKD 2BTEA 4K3BA 3W2DA 3ZTDA 4BBNF 1OQRA 4RCOA 4WJNA 3VUWA 3M63B 1HZ5A 3BVZA 5BYQA 2X8XX 1L0VB 1C3TA 1KJTA 2FIDA 3QHTA 3BVMA 4MT5A 3W9CB 4HEA1 1V80A 1H4RA 3R2TA 4WWPA 1C78A 2VH2A 4BKSD 4GLSC 1TYGB 3V6CB 4IOIE 3U8ZA 1M94A 3RMKC 3R7QA 2Y3AA 2KDIA 1SIJA 1OTRB 1V1OA 1SEBD 3AH7A 1WX9A 3H6NA 1R4MI 1V97A 1X1MA 3OLMD 4CYEA 2BYFA 4ZOHC 3L13A 2R61A 2K6DB 2EMSA 3JVZX 3SFDB 1DOYA 4C56C 3DBHI 4HK2A 3TIXA 1F77A 4HROA 4RM9A 4UDUC 4ASWC 3ZRFA 1C9FA 3L16A 2JZZA 3LYYA 3HHMA 1KLVA 1WRDB 4FULA 4B95A 2E3TA 2LZ6A 2DHZA 3O65B 4K7UA 4L1BA 3AEGB 3IG3A 4EUTA 1FNWA 1HA5A 4WIPA 1U4AA 3ZNHB 4K3CA 5G5HA 4JWUC 2C7MB 3L08A 1QT9A 1RM6C 4K7SA 1TIFA 1S1QB 4OZBA 4FADA 2BS4B 2PVOD 5CHFA 1KOTA 3EHVA 3TEYA 1MG8A 1DOIA 1PUTA 1TJEA 1IP9A 1TS4A 1WXAA 4OHJA 2RDBC 3RNCC 4JQWC 4MSQB 2A5UA 5GMVA 1I35A 1UH6A 4YTNB 2V3NA 4IWPA 1SF0A 4TMAB 4HJGE 4MJSB 2DWQA 1L2NA 2L3ZA 2J0KA 2N7EA 2PE6B 3PZ8A 2KJ6A 1YN3A 4W9EA 1YJ1A 3URYA 5DPTA 1N63A 3Q8FA 4HDOA 3BZDB 1P0RA 2D11A 4IUMB 2WXLA 4AQ7A 4GU2A 2DZMA 2WHIA 2BYEA 1RFKA 1Q0WB 1ZXIA 3TEZA 4JLCA 4I6NB 1PFDA 1VCBA 2JVCA 1L6VA 3AN1A 3N20C 2LGYA 1TT5B 2PE9A 5CHWA 3VTWA 2V1YA 3WA0A 4C00A 1V8CA 3QCAA 4FN2A 4WAFA 3Q2AC 2MWSB 1R4NI 3CMMB 5LNK1 3DDCB 3V3XA 1UGMA 4A9AA 4PS8A 4DDID 1UF0A 1E10A 4AJWA 1WGYA 2MJDA 2CJOA 4MGZE 3UQAA 4ZRIA 3W1SA 4OVVA 1QILA 3QJZA 4DHZB 1M4VA 3B08A 3CF6E 1I4GA 4DDGD 5D2MB 3C19A 1XLPA 1WYWB 1FNUA 2M0AA 5HI1A 1UBQA 4DXAB 1WIAA 2KJHB 3DHGC 1FXAA 3Q8CA 4P7IA 3ZYYX 4MM3B 4KGSA 2IO3B 2K8HA 2JXTA 2Q5WD 1B1ZA 1YX6B 2GBJA 1Z5SB 4W9FA 2DNFA 4C4VB 2HE7A 4KV2A 3PGEA 2ZCBA 3GE8C 2DLBA 4LNNA 3DWMA 3JSVA 3MJWA 5H92C 3H1UA 5IO9A 5T8IA 2NVUI 3AI5A 4ICVA 2L1AA 1FM0D 1OQYA 1SE4A 2KVZA 1OFFA 4WH4A 4IW0A 5J18A 1L4ZB 1UUPA 1LQBA 1UNSA 1TY0A 2YEPB 4R3DA 1Z2MA 4KVGB 2KXJA 3QARA 3RUIB 5HKHA 4CQNA 1UD7A 2AYOB 4KSKC 3IBEA 1V1PA 4MGKE 2CHXA 1J7BA 1P98A 2ASQA 4IM0A 4LLGM 2LMCA 1IUEA 3PTFC 3MJ5A 3MC9A 4REZA 4N9F4 2DZKA 3HM3A 4BFRA 2KDEB 4BAXA 5J17A 3ZIMA 1FRRA 3FC4A 1HXYD 1WM3A 1ZE3D 3AE7B 3KLSX 4YL8A 4EOYA 3ML9A 1E8ZA 2C7NB 3ZTCA 2KNBA 1HE8A 2AL6A 2ZVOA 3RNBC 3H7PA 1A5RA 5HG2A 4KIKB 4ZHPA 3U7ZA 5BMIA 3BY4B 5G5GA 2INDC 4N59A 3R2IA 2DYBA 2KQ4X 4P1BC 1E5WA 2LVPA 2FE8A 1FEHA 4NJ7A 2N1WA 1WJ4A 4HPLB 2KMAA 4JE3B 4W9JA 2R2QA 2MBEA 1SE9A 4KGTA 4C80A 4YSYB 3NY5A 1QKZA 1WE7A 4BZAA 1JW9D 2LGIA 2IO2B 3DBLB 1N60A 2J53A 2IZVB 1TS2A 2R2OA 1Q5WB 4XX5A 3TMPB 4DQOC 4W9GA 2PVGC 2RPVA 3UINB 3NZSA 4E71A 1BUIC 4RGOS 5IN7A 1NEKB 1B9RA 1T0RC 2RR9A 1JCKB 2PIAA 3MTNB 1TKGA 1GJZA 4IG7B 1ZGUB 2JY6A 1FCLA 3ZJVA 3Q14C 1AW7A 2KX3A 4LTUA 2RPQA 4KZCA 2QEJC 2NR2A 2IY1B 2I2YA 2FCNA 4HDQA 1RFAA 3E9SA 2BBCA 2L83A 4NZLB 2LUEA 4S17A 3I9V1 4X57B 1ISNA 4JL9A 4LJPB 3AULA 3M3JA 4ZYSA 3PT2B 4KKIA 2JF5A 4XDCA 2HJ8A 2JWZA 3OG5A 1WZ3A 2KWDA 2WXIA 2H89B 4HXDA 2INPE 2KX0A 4RGMA 2D3AA 4W9KA 2K6QA 4MGYE 4MGIE 2JPHA 4OVUA 2FNJB 2N9LA 2JXXA 1FCCC 3RYTA 4MDKE 3Q8AA 2KWVB 2BS2B 3DHHC 2SAKA 1I4QA 2KMMA 1VZ7A 2K0PA 2XK5B 5AZGA 3GE3C 4ANUA 1LXDA 2DYMA 1GNUA 1XT9B 2FAZA 3QK0A 3I63C 3A9JB 3GP7A 4M0WA 3AEEB 4PT5A 4FXCA 1WR6E 2FCSA 4AP4C 5HHDG 1KLGD 2KOXA 3A33B 2WQYB 1JALA 5C23A 2LEKA 1LGRA 4A3OA 2HD5B 4OZAA 5BYRA 3TBLD 1F52A 1Y8RC 1SE2A 2QCZA 4A3PA 4GN1A 1TS5A 5D3IB 1UGJA 3IT6B 4ANWA 2INNE 4LJOB 2ZPYA 3C8YA 3Q3MC 1E7UA 2N9EB 4KDLB 4I6LB 2JSVX 4USAA 3ZXRA 1MVKA 4YSZB 4P6VF 1GUAB 1RYJA 4M8NA 1KF6B 2FUHB 5E6JA 2KQSA 2D5GA 2L76A 1XEEA 3PSEB 1WYGA 3PREA 3U4EG 3PPAA 1A70A 1NI2A 2KLCA 3AV8A
chains in the Genus database with same CATH topology
1DOIA 1PUTA 1TJEA 1D5XC 1PGXA 2IJ0A 2N0SB 1TS4A 4RH6A 4Q2JA 4OHJA 2E6XA 3ETRA 1L5PA 3AE6B 2XN9C 1WGKA 1ZDXA 2G1EA 4N58A 3B9JA 2LHEA 2L32A 4P16A 2NMQA 3U2SC 3SEBA 1QF6A 1NENB 1NYQA 4NAMA 4WURA 2WXPA 5EE3A 3EUB2 3FILB 4YTNB 2LJIA 2V3NA 3J9CA 3AEBB 1C4AA 4ITKA 1I4HA 1J7AA 1SF0A 3AE2B 2EELA 4HJGE 4TMAB 2WXQA 2AQ3B 1KFYB 5EE0A 3MFGA 2W3RA 5C2TB 2DWQA 1STEA 1FMAD 1C4PA 1E0ZA 1WSPA 1SJED 2K3UA 2YEPF 4NAWB 3TSSA 1BMLC 1JWUD 1XCTL 3PZ8A 3NUHB 3AB5A 1YN3A 2WDQB 1D6EC 1QOAA 3HRDD 4J3OD 1N63A 3Q8FA 1T3QA 2PMVA 2VZKD 2ICIA 3VRBB 1N5WA 2V0GA 3BZDB 5D3DA 4TSSA 2WXLA 4AQ7A 1AYFA 2Z8LA 1F2RI 1I4RA 1EWCA 1TS3A 4H2AA 1F2RC 1RFKA 1ZXIA 1V1PB 2M56B 1FO4A 3TEZA 4RGNA 2J52A 4B0EA 1MPEA 4RF1A 1K52A 1PFDA 1EM7A 3AN1A 1L6VA 1SE3A 3Q8EA 4ZRQA 3T3NA 3IXSA 1JROA 1C4CA 4A6QA 5FR3A 3KWLA 1L6UA 1V8CA 1VDVA 5EE9A 1L0YB 3HUIA 2AQ2B 4WAFA 2JZPA 5LNK1 4MH8A 5C3JB 1D5ZC 1ZOYB 1IGDA 4HKZE 3V3XA 4JPSA 2WXGA 4LK0M 1Q10A 4A9AA 4C7YA 1XLNA 2W3SA 2GRIA 3CWIA 1QOFA 1YN4A 2RDGA 1E10A 4US9A 1E9MA 2MJDA 2WXRA 1XO3A 4RF0A 2CJOA 4YT0B 4JX1C 1KRHA 2PLPA 3W1SA 1UWXA 3BK2A 1QILA 2QMTA 4YXDB 1M4VA 2WDRB 3N9YC 2I38A 3OWEB 1HEZE 5JXVA 1I4GA 2DYOA 2V3PA 5AUKA 1JQ4A 1TKEA 2QIEB 3FAHA 1XLPA 4AS1A 1FNUA 2M0AA 3MP9A 5HI1A 3AE1B 2V4IB 1FXAA 3AM9A 3Q8CA 1MI0A 2JYTA 1DGJA 3ZYYX 4MM3B 2AQ1B 4KGSA 3VR8B 4DXFA 1VR9A 1R7SA 2Q5WD 2JXTA 1B1ZA 3GS2A 1FRDA 3ABVB 1ZP0B 2W54A 1ET9A 3I57A 2OHFA 2CJNA 2Y5CA 1MHXA 1JRPA 1QQRA 2DLBA 3DWMA 5H92C 3V05A 3HVDA 5T8IA 1MHHE 1I4XA 2L1AA 3W5UB 1FM0D 1ET6A 1SE4A 4KX6B 2JYEA 3BK1A 4KKJA 1OFFA 4WH4A 3IAS1 2JX5A 1SBBB 1L4ZB 1UUPA 2W82A 4XDDA 2TSSA 1GB4A 1C77A 4XE0A 2K9XA 4XWTA 1UNSA 1TY0A 4RGTA 2YEPB 4B0MA 1JMLA 1FIQA 2WXJA 3AE8B 3P1MA 3VR9B 4R3DA 5HFYA 1DYQA 4WWMA 3UI3A 3P4SB 2WU5B 4ZHOA 2MH7A 4N6EB 4JWSC 1CQVA 4CQNA 2JWUA 1J7CA 1TY2A 1V1PA 2M19A 1E7PB 1SSNA 2W55A 1PGAA 3KQ4A 4C7ZA 4IDIA 1ZUD2 3SR6A 4US8A 2CU3A 2K22A 5H8YE 1J7BA 1SXTA 4KGRA 4LLGM 3EA6A 2LMCA 1IUEA 3MJ5A 1LO5D 4A8XC 1GB1A 4REZA 2BS3B 1JWBD 1K53A 3AMZA 3MC0B 2N7JA 5EE1A 1JWSD 3LB8C 3NVWA 3PZ7A 4ZRPA 2IGGA 1CJEA 1FRRA 3Q8BA 3FC4A 1YQ4B 2HTME 4YTPB 1HXYD 2LHDA 1ZE3D 3AE7B 1AWDA 2WU2B 3KLSX 1AN8A 4RNAA 1WXQA 1FFVA 1SB3C 2WXNA 3NVVA 2WXHA 2WXOA 2AX5A 3AE9B 5BMHA 3P4PB 1ESFA 3AEDB 3WCQA 3MHZA 4NJCA 2IDYA 5D7GA 2K5PA 2WS3B 1KTKA 1YJIA 1C76A 1QLBB 5BMGA 3HVZA 1NYRA 5GXGB 1YJJA 2KAJA 3BYYB 1P7EA 5HG2A 1QOBA 4ZHPA 2GB1A 3U7ZA 5BMIA 5G5GA 4N59A 3R2IA 1I7HA 1TZOA 2KQ4X 1HZ6A 2FBWB 3R8BA 2FE8A 2QILA 4IKGA 4A90A 1XLQA 2MJEA 1FEHA 1ZDVA 4EE2A 1WWTA 3P4QB 3P42A 1TKYA 2ACZB 4JE3B 1F0ZA 3VRAB 1YMHE 1OQQA 1PGBA 2QSDA 2IGDA 5FK9C 1P7FA 1PYWD 2L52A 3NRZA 1SJHD 2BYTA 1Y56A 3VQIA 1T6BX 5MPOA 2JU6X 4KGTA 4C80A 4MACA 4YSYB 1QKZA 1L4DB 1JW9D 2LGIA 1YQ3B 3ZQ4A 2NTSA 1I4PA 2BT6A 2PKOA 3B2GA 3EGRA 1VZ8A 3ZGZA 4OVZA 1N60A 1IGCA 2J53A 2JQRB 1TS2A 3PO0A 2KN4A 3E56A 4DQOC 2ZW0A 1XLOA 1IBXA 2PVGC 2N9KA 2RPVA 3U52E 3TEXA 3TEWA 2WNMA 1T5XD 1BUIC 4YSXB 2VZKB 3RFZB 4RGOS 1JWMD 3RPFC 4HRSA 3GB1A 5TSSA 1DOXA 1QOGA 1NEKB 1B9RA 2PTLA 3LXFA 3NS1A 2IGHA 1JCKB 2PIAA 3Q69A 1ACCA 4ARCA 2NTTA 1TKGA 3AECB 2QJLA 3BWUD 1FCLA 1PDXA 4YWGG 3ZJVA 1YN5A 1AW7A 3BVGA 1UWMA 2WDVB 3NVZA 4LTUA 1IBXB 3AE4B 2QEJC 2RMMA 2ONQA 1XF5L 2X38A 2I2YA 4HKQA 2ON8A 3CIRB 2BBCA 3E9SA 2L83A 4NZLB 3BYTB 2XNAC 1FD6A 3AEAB 2WLBA 4L2YA 3I9V1 1ZPSA 3IT4B 1NI3A 4WQMA 5BYSA 2G9HD 2WP9B 4RFBA 4ZYSA 1XCQL 4KKIA 2WXKA 4XDCA 3NVYA 1VRAB 1NVID 2BW2A 1D5MC 1N61A 1KH0A 1N5XA 3ZJTA 2KWDA 3AEFB 2WXIA 4O1NA 2H89B 3H8HA 2INPE 2HDEA 2LFIA 4RGMA 3DWGC 1FXIA 1ZXHA 2IPKD 4DXGA 2BTEA 3NZ3A 3W2DA 1D4BA 4GDLB 1ROEA 2SEBD 3IAM1 2EKIA 1OQRA 1N62A 3AE3B 4RCOA 2N9LA 4XWWA 1FCCC 1HZ5A 3BVZA 3Q8AA 5BYQA 2BS2B 1L0VB 2GI9A 2SAKA 1I4QA 1K51A 2KMMA 3BVMA 4MT5A 4OZCA 3W9CB 4HEA1 2J4XA 1VZ7A 3B2FA 3R2TA 1C78A 2K0PA 2J42A 3P63A 1RWSA 2KDMA 4GLSC 1TYGB 3T3OA 1HQRD 2DYMA 3BIID 4IOIE 2BB5A 3GP7A 3L4PA 2Y3AA 4M0WA 2RDHA 3P4RB 3AEEB 1SIJA 1VJKA 4PT5A 4FXCA 1WRIA 5HHDG 1KLGD 1V1OA 1SEBD 3AH7A 1C79A 2WQYB 1JALA 1XXGA 2BB6A 2LEKA 1V97A 2WXFA 1CZPA 1CK1A 4OZAA 4L23A 5BYRA 1BXTA 2B76B 4YTMB 4ZOHC 2R61A 2LUMA 1VZ6A 1SE2A 1JWAD 4GDKB 2H88B 2FUG1 1TS5A 5D3IB 3SFDB 1GOZA 1UGJA 1L0XB 4C56C 3IT6B 5I4DA 1DOYA 1KLUD 1E6EB 2INNE 4ARIA 1GPXA 3C8YA 2ZW1A 1F77A 4HROA 4UDUC 2OEDA 1C9FA 3AE5B 3LYYA 1FNVA 1EU3A 1K50A 1GAQB 2DBYA 2PW9A 2E3TA 1EU4A 2JSVX 3SFEB 4USAA 4OW0A 5AUIA 1MVKA 3O13A 4L1BA 4YSZB 4P6VF 3AEGB 2WXMA 1ENFA 1RYJA 1FNWA 1HA5A 1KF6B 1YNTE 2MJ3A 4WIPA 5FKAC 2KACA 5E6JA 4D2KA 1FFUA 2D5GA 5G5HA 3W5VB 4JWUC 1EWYC 1XEEA 3TUOA 1QT9A 3FILA 1RM6C 3KWVA 4TQ0A 1WYGA 4TQ1A 4OZBA 2BS4B 1VLBA 2PVOD 3U4EG 2MEKA 3ZJUA 1A70A 2Y5PA 3URYA 3TEYA 3AV8A 4A55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L32 A;  2LJI A; 
#chains in the Genus database with same CATH topology
 5JH5 C;  2KT7 A;  2G1E A;  3B9J A;  2L32 A;  2D10 A;  1QF6 A;  4CHK A;  4II2 B;  2O2V B;  3EUB 2;  1C4A A;  4ITK A;  2LXC A;  1I4H A;  2QDF A;  2EEL A;  2AQ3 B;  4XYC A;  2M8S A;  5LLI A;  2D3B A;  5EE0 A;  3MFG A;  1GC6 A;  3X23 A;  1C1Y B;  1C4P A;  4HLE A;  3VTV A;  1SJE D;  2G3Q B;  2YEP F;  3TSS A;  3ML8 A;  1JWU D;  4BKT A;  3AB5 A;  1D6E C;  1T3Q A;  3V61 A;  2VZK D;  4G50 A;  2ICI A;  2V0G A;  5D3D A;  2GMI C;  4M8M A;  1AYF A;  3Q3F A;  1V6E A;  1EWC A;  4H2A A;  1F2R C;  5CHV C;  5DPW A;  2J52 A;  4RF1 A;  1K52 A;  1EM7 A;  3N1Y C;  1SE3 A;  3D32 A;  4ZRQ A;  2NCN A;  3PLV A;  3WIM A;  1V5O A;  3IXS A;  3ZNG C;  3JYU A;  3DQV A;  5FR3 A;  5G55 A;  1E8Y A;  1L7Y A;  5EE9 A;  3APC A;  1L0Y B;  2AQ2 B;  2JZP A;  3RNE C;  1D5Z C;  1Q10 A;  2ZNV B;  2JT4 B;  2GRI A;  4GSW A;  4M00 A;  2BF8 B;  4EZK A;  4EZJ A;  3RNG C;  3ZW3 A;  4LDT D;  2K25 A;  2NBW B;  4YXD B;  2WDR B;  3N32 A;  1HEZ E;  1WJU A;  3SD5 A;  5AUK A;  1TKE A;  2QIE B;  3SDL C;  2LI5 A;  1ZW7 A;  2BQQ A;  3VTU A;  4I6P A;  3DOW A;  2KTR B;  1MI0 A;  3KYD D;  2RSU A;  3VR8 B;  4P1C C;  1LFD A;  2MHJ A;  2W54 A;  4MJS A;  3I57 A;  1WR1 A;  5D6J B;  3C0R B;  4MEM A;  3HVD A;  1GG3 A;  3HM6 X;  2KN5 A;  2Y5B B;  4WWO A;  3BK1 A;  3IAS 1;  2JX5 A;  1SBB B;  1OEY J;  3VDZ A;  2KDB A;  2JRH A;  2GBM A;  4B0M A;  1JML A;  2I1J A;  2EMT A;  4WWM A;  3UI3 A;  2AL3 A;  2WU5 B;  4ZHO A;  2MH7 A;  4N6E B;  2DZJ A;  2LGX A;  4JWS C;  2JWU A;  4EKU A;  3APD A;  2REX A;  2M19 A;  3KQ4 A;  1TGZ B;  4FJV B;  4C7Z A;  4IDI A;  1ZUD 2;  4E74 A;  2CU3 A;  1SXT A;  4HWI B;  1JRU A;  2MCN B;  2N7J A;  5EE1 A;  3PZ7 A;  1YQ4 B;  1AWD A;  2WU2 B;  1OEY A;  5G2N A;  4RNA A;  5DPS A;  1WXQ A;  1FFV A;  2WXH A;  3AE9 B;  1ESF A;  1WMH B;  5IOI A;  4NJC A;  5IA7 A;  4ICU A;  2WS3 B;  1KTK A;  2CHW A;  3ZXV A;  1WH3 A;  1QLB B;  1NYR A;  4IM2 A;  2KAJ A;  3BYY B;  5FR6 A;  3N30 A;  3HK0 A;  4KDI C;  3V60 A;  1QOB A;  2Z0D B;  4IM3 A;  1I7H A;  1MJD A;  1TZO A;  2LJ5 A;  3R8B A;  3RI7 C;  4MM3 A;  5C1Z A;  1CMX B;  1ZDV A;  3WAL A;  3PV1 A;  1E90 A;  3VRA B;  3M95 A;  1P7F A;  4LNF A;  4C4V A;  4NY0 A;  4WWN A;  2IY0 B;  3FKY A;  3R66 C;  3RNF C;  2V4L A;  1H8C A;  4ZDV A;  1L4D B;  2OJR A;  1YQ3 B;  2N9P C;  3ZQ4 A;  2KLG A;  1IGC A;  1XLO A;  2N9K A;  3T9L A;  2WNM A;  4NQK E;  1T5X D;  1YD8 U;  4ACF A;  3RFZ B;  2DX5 B;  3PS6 A;  3GB1 A;  5TSS A;  1DOX A;  3NZU A;  1IPG A;  2PTL A;  3NS1 A;  1MFW A;  1ACC A;  3RCZ A;  2NTT A;  2L8J A;  4GOC A;  2Z0E B;  3AXC A;  1UWM A;  3TCA A;  2ONQ A;  3NS8 A;  3CIR B;  3BYT B;  3ZVV A;  3EC8 A;  2XNA C;  1V5T A;  2WGS A;  4PYU A;  1YOV B;  4WQM A;  2G9H D;  2WP9 B;  4RFB A;  2NS5 A;  1XCQ L;  2JZ3 B;  4K81 A;  4TUU A;  1EO6 A;  2KHW B;  1VRA B;  3R3M A;  2BW2 A;  1D5M C;  1N61 A;  4ANX A;  3GZN B;  1KH0 A;  1T0Y A;  3AEF B;  3AU5 A;  1G6J A;  2L0F A;  1SIF A;  3KUD B;  4KIK A;  4XZ4 A;  4K1R B;  1QZE A;  3DWG C;  3RZF A;  1P1A A;  4DXG A;  1D4B A;  4GDL B;  1ROE A;  3IAM 1;  2J0M A;  4IWO A;  1WGH A;  4F7Z A;  3PRZ A;  4XWW A;  5E6N A;  1YIW A;  4WQO B;  3Q3O C;  2PEA A;  1K51 A;  3PZD A;  4OZC A;  3B2F A;  1SGH A;  3PLU A;  2J42 A;  3ECI A;  3P63 A;  4GDK A;  2ZEQ A;  2KDM A;  2A4Z A;  1HQR D;  2IBI B;  3VUX A;  2O6V B;  2RDH A;  3P4R B;  1VJK A;  2Z59 B;  2MSE D;  2LVO A;  2ZNV C;  2K8B A;  2BKF A;  1C79 A;  2BB6 A;  2WXF A;  1CZP A;  1CK1 A;  4L23 A;  3UQB A;  2KFJ A;  2BPS A;  2LUM A;  3EEC A;  1VZ6 A;  2MW5 A;  1EF1 A;  4GDK B;  2FUG 1;  5LXH A;  1L0X B;  5I4D A;  3L17 A;  2C9W B;  1KLU D;  1E6E B;  4ARI A;  1GPX A;  2ZW1 A;  2OED A;  2MBQ A;  1FNV A;  4KZ0 A;  2D2Q A;  2DBY A;  3H7S A;  2VRR B;  4RMA A;  4ZYN A;  1EU4 A;  3SFE B;  4OW0 A;  4M01 A;  4FA6 A;  2ZPN A;  2MJ3 A;  2KAC A;  4D2K A;  1FFU A;  2M0X A;  3PVL A;  1EWY C;  3TUO A;  2LGD A;  4TQ0 A;  3UIP B;  1FPY A;  3VVW B;  1VLB A;  2MEK A;  2Y5P A;  5DPR A;  1D5X C;  1PGX A;  2K1F A;  4LNO A;  4ANV A;  4RH6 A;  2AWT A;  2E6X A;  2FCQ A;  3ETR A;  3LDZ E;  3KH0 A;  3AE6 B;  2XN9 C;  1ZDX A;  4N58 A;  3U2S C;  3EFC A;  3DBR B;  2L0T A;  3SEB A;  2K39 A;  4DBG A;  1NEN B;  1NYQ A;  3A9K B;  4NAM A;  2WXP A;  5EE3 A;  4NQL B;  2G4S A;  3UF8 A;  2LJI A;  1J7A A;  2B3A A;  3ZKJ C;  1S3S G;  1KFY B;  1RRB A;  2XK5 A;  1FMA D;  4HPP A;  1E0Z A;  1V81 A;  1E7V A;  2K3U A;  4NAW B;  2HTH A;  3A9J A;  1XCT L;  3T8M A;  3NUH B;  4LNI A;  2WDQ B;  3HRD D;  3WAP A;  5LXI B;  1OGW A;  4TV3 A;  4AJY B;  3VRB B;  4HCP B;  4TSS A;  1F2R I;  1I4R A;  1TS3 A;  1FO4 A;  4B0E A;  3CSF A;  4URK A;  3Q8E A;  1MG4 A;  3KUZ A;  1UBI A;  1JRO A;  1C4C A;  4A6Q A;  3KWL A;  1L6U A;  1VDV A;  5TR5 A;  4MH8 A;  4M02 A;  5C3J B;  1ZOY B;  1IGD A;  4GGQ A;  4HKZ E;  1E8X A;  4JPS A;  2DAJ A;  3AU4 A;  4LK0 M;  4C7Y A;  2W3S A;  2LRW A;  1E9M A;  1F1H A;  4RF0 A;  4JX1 C;  5IAA C;  1EUV B;  2PLP A;  2MA9 B;  2C60 A;  1UWX A;  2MP2 B;  1D3Z A;  3OWE B;  2LAS A;  4S0R A;  5JXV A;  2DYO A;  2V3P A;  2MBO A;  3DBL I;  1ZKH A;  3DBH B;  4GB9 A;  3DVG Y;  4NPN A;  3L10 B;  2KJR A;  2MBB B;  3AE1 B;  2ZZP B;  3U7D A;  2JYT A;  1DGJ A;  3ALB A;  2AQ1 B;  2O2V A;  4PS7 A;  3MHS D;  1R7S A;  3U30 A;  1ZP0 B;  2BKR B;  3KVF B;  2KWC A;  1N6Z A;  2CJN A;  2Y5C A;  1MHX A;  3KYC D;  1JRP A;  1QQR A;  1TBE A;  4G0N B;  1KM7 A;  1I4X A;  2KTF A;  3W5U B;  2JYE A;  4KKJ A;  2DEN B;  4XDD A;  1GB4 A;  2TSS A;  4DHJ B;  1C77 A;  4XWT A;  3VR9 B;  2WXJ A;  3AE8 B;  3P1M A;  5HFY A;  3NJT A;  3ZDT A;  2BWE S;  4BBN C;  2MX2 A;  4AOF A;  4HCN B;  1SSN A;  2W55 A;  1PGA A;  3ZNZ B;  4F1S A;  4US8 A;  2K22 A;  2RD0 A;  2YLM A;  4KGR A;  3VFK A;  2BGF A;  1LO5 D;  2C7H A;  2CHZ A;  1GB1 A;  2BS3 B;  2G4D B;  3AMZ A;  5CX3 A;  2KDF B;  1JWS D;  3LB8 C;  3K9O B;  4BOS C;  4ZRP A;  1F9J A;  3Q8B A;  2HTM E;  2FCM A;  1AN8 A;  4FJY A;  1E8W A;  4AWJ A;  2WXO A;  5BMH A;  3P4P B;  1RLF A;  2WX1 A;  1P3Q U;  2I1K A;  3AED B;  3WCQ A;  3MHZ A;  2IDY A;  5BMG A;  3HVZ A;  4AUQ C;  1YJJ A;  3VXW A;  2AEH A;  1P7E A;  1EF5 A;  4DHJ D;  5IKC M;  2GB1 A;  3Q6B A;  4QAY A;  2KTR A;  1WM2 A;  1HZ6 A;  3DVN U;  4IKG A;  2D3G A;  1XLQ A;  2MJE A;  4A90 A;  1R4N B;  4WJQ A;  4ZRK A;  3P42 A;  1TKY A;  2HJ1 A;  2N7D A;  1OQQ A;  1PGB A;  2QSD A;  2XEW A;  2IGD A;  1PYW D;  4F8C B;  4KSL C;  3N1Z C;  4EFO A;  2GBK A;  2BYT A;  2FIF A;  2KWU B;  3DHI C;  5MPO A;  4MAC A;  3TJP A;  2CKH B;  1WGG A;  5DCN A;  1AAR A;  2IYD B;  2NTS A;  1I4P A;  2BT6 A;  2W9N A;  1VZ8 A;  3ZGZ A;  2XBB C;  2KFK A;  2JQR B;  1J19 A;  3QA8 A;  2KN4 A;  1WY8 A;  2ZW0 A;  1LM8 B;  1IBX A;  3U52 E;  3TEX A;  3TEW A;  5JHB A;  4PS3 A;  1UEL A;  5AZF A;  1WE6 A;  4LCD E;  4YSX B;  1P9D U;  3RPF C;  4EEW A;  3GOE A;  1QOG A;  5CTR C;  3Q69 A;  4ARC A;  3AEC B;  2QJL A;  2KFK B;  3BWU D;  4MSM B;  2WDV B;  3NVZ A;  1IBX B;  2RMM A;  3ZLZ A;  1XF5 L;  3IVF A;  2X38 A;  4WJO A;  2UU7 A;  4CO7 A;  1FD6 A;  2WLB A;  4L2Y A;  4W9I A;  1ZPS A;  4IC7 B;  3KUC B;  3IT4 B;  5BYS A;  2MBH A;  3QX1 A;  1WMH A;  2KVR A;  3L0W B;  3PRP B;  4IWQ A;  2WXK A;  2KO3 A;  3NVY A;  2ZCC A;  1J0G A;  4ZRJ A;  1N5X A;  3ZJT A;  2LFI A;  1V2Y A;  1ZXH A;  3VUY A;  3NZ3 A;  2SEB D;  4EZL A;  2EKI A;  1N62 A;  3AE3 B;  2PPH A;  3A4R A;  3WAN A;  2KD0 A;  5E6O A;  2GI9 A;  2GBR A;  4LNK A;  2DAF A;  2J4X A;  4K7W A;  4GXB A;  3DPD A;  3MC8 A;  3V62 A;  1RWS A;  3T3O A;  4RM8 A;  3BII D;  2BB5 A;  3L4P A;  3H9D A;  2J7Q B;  2ZVN A;  4XC2 A;  1WRI A;  4DWF A;  3QIJ A;  1XXG A;  2DZI A;  2LGS A;  1TZ1 A;  1BXT A;  2B76 B;  4YTM B;  1WFY A;  2M1M A;  1WX7 A;  2L05 A;  3PRM B;  1JWA D;  2M17 A;  5KHQ A;  2KYW A;  2CR5 A;  2H88 B;  1GOZ A;  2N9X A;  3KW5 B;  3NOB A;  2D07 B;  2GBN A;  3AE5 B;  1EU3 A;  1K50 A;  1GAQ B;  2KKC A;  2PW9 A;  5J2R A;  4NJ6 A;  3RD2 A;  3QWZ B;  5AUI A;  4II3 B;  3O13 A;  1WI0 A;  2WXM A;  1ENF A;  2M4N A;  1YNT E;  5FKA C;  4PYZ A;  1V49 A;  3W5V B;  2V9H A;  1I42 A;  3FIL A;  2C5L C;  2NPT A;  3KWV A;  3OJ4 B;  3OJ3 A;  4TQ1 A;  4B6W A;  2KK8 A;  3ZJU A;  1Q1O A;  4A55 A;  2IJ0 A;  2KC2 A;  4NNJ B;  1HTO A;  2N0S B;  4Q2J A;  2LD9 A;  4JGH B;  1L5P A;  4HVB A;  2KZR A;  1WGK A;  3B1L X;  4B9K A;  2LHE A;  4P16 A;  2NMQ A;  3A1Q A;  4GDL A;  4HPM B;  3N3K B;  3ZRC A;  4WUR A;  1WF9 A;  3FIL B;  4DK5 A;  2NPT B;  5E6P A;  3J9C A;  3AEB B;  3DCG A;  5EDS A;  3A4S C;  3AE2 B;  3L54 A;  2WXQ A;  4MEL A;  2GLS A;  2W3R A;  5C2T B;  2NBV B;  1STE A;  2QHO A;  3OAW A;  1GC7 A;  3JSV B;  1WSP A;  3IHP C;  2INC C;  3UGB B;  2LXA A;  2VH1 A;  1BML C;  2LVQ A;  2O6V A;  3A1Q B;  4W9C A;  3N1X C;  2WDT B;  1QOA A;  4J3O D;  3VAW A;  2PMV A;  1N5W A;  1NDD A;  3DVN V;  2Z8L A;  2WWZ A;  1NBF C;  3P2B A;  1J8C A;  3ZDM C;  1V1P B;  2M56 B;  4RGN A;  5IP4 D;  1MPE A;  3K9P B;  4E3C A;  3M62 B;  3T3N A;  2QC8 A;  2UWQ A;  4BVU C;  1YQB A;  1WXM A;  4W9L A;  1PQS A;  2LWP A;  3HUI A;  3ZNI D;  1WXV A;  3UIO B;  3B0A A;  2WXG A;  1XLN A;  5KHO A;  3CWI A;  1QOF A;  1YN4 A;  2RDG A;  3NG0 A;  3EFU A;  4US9 A;  2WXR A;  1XO3 A;  2BVC A;  1IYF A;  4YT0 B;  1WJ6 A;  1KRH A;  2GOW A;  4BKG A;  3RUL A;  3BK2 A;  2QMT A;  3N9Y C;  2I38 A;  3H7P B;  1JQ4 A;  2N4F A;  3PHW B;  4PK1 A;  3FAH A;  4GIV A;  3QAQ A;  3ENE A;  4AS1 A;  3MP9 A;  2OOB B;  2EKE C;  2L00 B;  5BO4 B;  3R7R A;  4XGA B;  2V4I B;  3AM9 A;  1T0Q C;  3A9K A;  1BT0 A;  4DXF A;  2MQJ A;  1VR9 A;  3RNA C;  2KC1 A;  3I3T B;  3GS2 A;  1FRD A;  3ABV B;  2NBU A;  3I5J C;  4FJZ A;  1ET9 A;  3ONS A;  5AEK B;  2O6V D;  4FHJ A;  5JHA A;  2OHF A;  3APF A;  3V05 A;  1MHH E;  1RAX A;  4NAW A;  2PJH A;  1WJN A;  1ET6 A;  4KX6 B;  2W82 A;  4FLH A;  4XE0 A;  2K9X A;  2D3C A;  3PHX B;  1WX8 A;  4RGT A;  3IFW B;  1FIQ A;  1V86 A;  5JZE B;  1DYQ A;  4FHK A;  3P4S B;  5L95 C;  2BWF A;  2L7R A;  2K8C A;  3WAO A;  1CQV A;  1J7C A;  1TY2 A;  2G45 B;  3Q3J A;  1E7P B;  3GZN I;  3LJ3 A;  1K8R B;  3SR6 A;  5H8Y E;  3BIN A;  3EA6 A;  1HTQ A;  2LRU A;  4A8X C;  4W9H A;  1JWB D;  4J6I A;  1K53 A;  3MC0 B;  2CU1 A;  3NVW A;  2IGG A;  1CJE A;  2KQ7 A;  4YTP B;  2LHD A;  2RGF A;  2WYQ A;  1SB3 C;  2WXN A;  3NVV A;  2AX5 A;  4FBJ B;  4DHZ E;  4BOZ B;  5D7G A;  2K5P A;  2MP2 A;  1WXS A;  1YJI A;  4W9D A;  3VH4 B;  1C76 A;  4G3X B;  4TKN A;  3RN9 C;  3WAM A;  5GXG B;  4GMV A;  3QC8 B;  2OJW A;  2WX0 A;  1UZX B;  1WZ0 A;  3SHQ A;  1XQQ A;  5D94 A;  2FBW B;  1TTN A;  4HJK A;  2QIL A;  1R4M B;  3TL5 A;  3X0W A;  4EE2 A;  3W1Y A;  1WWT A;  3P4Q B;  2IO0 B;  1FXT B;  2ACZ B;  3CST A;  3V6E B;  1F0Z A;  1YMH E;  5FK9 C;  2L52 A;  3NRZ A;  1SJH D;  1Y56 A;  3VQI A;  3NHE B;  1T6B X;  1T0S C;  1XD3 B;  2JU6 X;  2MLB A;  2CS4 A;  4M0W B;  3Q3N C;  3SU8 X;  4BKS A;  2PKO A;  3B2G A;  3EGR A;  4OVZ A;  1WGR A;  3PO0 A;  3E56 A;  3VHT C;  2ZJD A;  2KAN A;  3VH3 B;  3RZW C;  2J0J A;  4WJP A;  2YVC A;  3W1S C;  3S2A A;  2N1V A;  2VZK B;  3RT3 B;  1JWM D;  2V3S A;  4HRS A;  3LXF A;  2IGH A;  3DBR I;  3DBS A;  2MRP A;  4A20 A;  3QQ8 B;  1YX5 B;  1PDX A;  4YWG G;  3DVG X;  4MH0 E;  1YN5 A;  2KMC A;  3BVG A;  3AE4 B;  5L83 A;  4HKQ A;  2ON8 A;  3HIZ A;  1WGD A;  2BYV E;  3AEA B;  2UYZ B;  2IO1 B;  4JIO U;  1NI3 A;  3ZUN A;  2JRI B;  4G11 A;  3ZO5 B;  1NVI D;  4WAA A;  1VD2 A;  3JW0 X;  4O1N A;  4LDT B;  2JUO A;  5AZH A;  1V9J A;  3H8H A;  2HDE A;  1FXI A;  2IPK D;  2BTE A;  4K3B A;  3W2D A;  3ZTD A;  4BBN F;  1OQR A;  4RCO A;  4WJN A;  3VUW A;  3M63 B;  1HZ5 A;  3BVZ A;  5BYQ A;  2X8X X;  1L0V B;  1C3T A;  1KJT A;  2FID A;  3QHT A;  3BVM A;  4MT5 A;  3W9C B;  4HEA 1;  1V80 A;  1H4R A;  3R2T A;  4WWP A;  1C78 A;  2VH2 A;  4BKS D;  4GLS C;  1TYG B;  3V6C B;  4IOI E;  3U8Z A;  1M94 A;  3RMK C;  3R7Q A;  2Y3A A;  2KDI A;  1SIJ A;  1OTR B;  1V1O A;  1SEB D;  3AH7 A;  1WX9 A;  3H6N A;  1R4M I;  1V97 A;  1X1M A;  3OLM D;  4CYE A;  2BYF A;  4ZOH C;  3L13 A;  2R61 A;  2K6D B;  2EMS A;  3JVZ X;  3SFD B;  1DOY A;  4C56 C;  3DBH I;  4HK2 A;  3TIX A;  1F77 A;  4HRO A;  4RM9 A;  4UDU C;  4ASW C;  3ZRF A;  1C9F A;  3L16 A;  2JZZ A;  3LYY A;  3HHM A;  1KLV A;  1WRD B;  4FUL A;  4B95 A;  2E3T A;  2LZ6 A;  2DHZ A;  3O65 B;  4K7U A;  4L1B A;  3AEG B;  3IG3 A;  4EUT A;  1FNW A;  1HA5 A;  4WIP A;  1U4A A;  3ZNH B;  4K3C A;  5G5H A;  4JWU C;  2C7M B;  3L08 A;  1QT9 A;  1RM6 C;  4K7S A;  1TIF A;  1S1Q B;  4OZB A;  4FAD A;  2BS4 B;  2PVO D;  5CHF A;  1KOT A;  3EHV A;  3TEY A;  1MG8 A;  1DOI A;  1PUT A;  1TJE A;  1IP9 A;  1TS4 A;  1WXA A;  4OHJ A;  2RDB C;  3RNC C;  4JQW C;  4MSQ B;  2A5U A;  5GMV A;  1I35 A;  1UH6 A;  4YTN B;  2V3N A;  4IWP A;  1SF0 A;  4TMA B;  4HJG E;  4MJS B;  2DWQ A;  1L2N A;  2L3Z A;  2J0K A;  2N7E A;  2PE6 B;  3PZ8 A;  2KJ6 A;  1YN3 A;  4W9E A;  1YJ1 A;  3URY A;  5DPT A;  1N63 A;  3Q8F A;  4HDO A;  3BZD B;  1P0R A;  2D11 A;  4IUM B;  2WXL A;  4AQ7 A;  4GU2 A;  2DZM A;  2WHI A;  2BYE A;  1RFK A;  1Q0W B;  1ZXI A;  3TEZ A;  4JLC A;  4I6N B;  1PFD A;  1VCB A;  2JVC A;  1L6V A;  3AN1 A;  3N20 C;  2LGY A;  1TT5 B;  2PE9 A;  5CHW A;  3VTW A;  2V1Y A;  3WA0 A;  4C00 A;  1V8C A;  3QCA A;  4FN2 A;  4WAF A;  3Q2A C;  2MWS B;  1R4N I;  3CMM B;  5LNK 1;  3DDC B;  3V3X A;  1UGM A;  4A9A A;  4PS8 A;  4DDI D;  1UF0 A;  1E10 A;  4AJW A;  1WGY A;  2MJD A;  2CJO A;  4MGZ E;  3UQA A;  4ZRI A;  3W1S A;  4OVV A;  1QIL A;  3QJZ A;  4DHZ B;  1M4V A;  3B08 A;  3CF6 E;  1I4G A;  4DDG D;  5D2M B;  3C19 A;  1XLP A;  1WYW B;  1FNU A;  2M0A A;  5HI1 A;  1UBQ A;  4DXA B;  1WIA A;  2KJH B;  3DHG C;  1FXA A;  3Q8C A;  4P7I A;  3ZYY X;  4MM3 B;  4KGS A;  2IO3 B;  2K8H A;  2JXT A;  2Q5W D;  1B1Z A;  1YX6 B;  2GBJ A;  1Z5S B;  4W9F A;  2DNF A;  4C4V B;  2HE7 A;  4KV2 A;  3PGE A;  2ZCB A;  3GE8 C;  2DLB A;  4LNN A;  3DWM A;  3JSV A;  3MJW A;  5H92 C;  3H1U A;  5IO9 A;  5T8I A;  2NVU I;  3AI5 A;  4ICV A;  2L1A A;  1FM0 D;  1OQY A;  1SE4 A;  2KVZ A;  1OFF A;  4WH4 A;  4IW0 A;  5J18 A;  1L4Z B;  1UUP A;  1LQB A;  1UNS A;  1TY0 A;  2YEP B;  4R3D A;  1Z2M A;  4KVG B;  2KXJ A;  3QAR A;  3RUI B;  5HKH A;  4CQN A;  1UD7 A;  2AYO B;  4KSK C;  3IBE A;  1V1P A;  4MGK E;  2CHX A;  1J7B A;  1P98 A;  2ASQ A;  4IM0 A;  4LLG M;  2LMC A;  1IUE A;  3PTF C;  3MJ5 A;  3MC9 A;  4REZ A;  4N9F 4;  2DZK A;  3HM3 A;  4BFR A;  2KDE B;  4BAX A;  5J17 A;  3ZIM A;  1FRR A;  3FC4 A;  1HXY D;  1WM3 A;  1ZE3 D;  3AE7 B;  3KLS X;  4YL8 A;  4EOY A;  3ML9 A;  1E8Z A;  2C7N B;  3ZTC A;  2KNB A;  1HE8 A;  2AL6 A;  2ZVO A;  3RNB C;  3H7P A;  1A5R A;  5HG2 A;  4KIK B;  4ZHP A;  3U7Z A;  5BMI A;  3BY4 B;  5G5G A;  2IND C;  4N59 A;  3R2I A;  2DYB A;  2KQ4 X;  4P1B C;  1E5W A;  2LVP A;  2FE8 A;  1FEH A;  4NJ7 A;  2N1W A;  1WJ4 A;  4HPL B;  2KMA A;  4JE3 B;  4W9J A;  2R2Q A;  2MBE A;  1SE9 A;  4KGT A;  4C80 A;  4YSY B;  3NY5 A;  1QKZ A;  1WE7 A;  4BZA A;  1JW9 D;  2LGI A;  2IO2 B;  3DBL B;  1N60 A;  2J53 A;  2IZV B;  1TS2 A;  2R2O A;  1Q5W B;  4XX5 A;  3TMP B;  4DQO C;  4W9G A;  2PVG C;  2RPV A;  3UIN B;  3NZS A;  4E71 A;  1BUI C;  4RGO S;  5IN7 A;  1NEK B;  1B9R A;  1T0R C;  2RR9 A;  1JCK B;  2PIA A;  3MTN B;  1TKG A;  1GJZ A;  4IG7 B;  1ZGU B;  2JY6 A;  1FCL A;  3ZJV A;  3Q14 C;  1AW7 A;  2KX3 A;  4LTU A;  2RPQ A;  4KZC A;  2QEJ C;  2NR2 A;  2IY1 B;  2I2Y A;  2FCN A;  4HDQ A;  1RFA A;  3E9S A;  2BBC A;  2L83 A;  4NZL B;  2LUE A;  4S17 A;  3I9V 1;  4X57 B;  1ISN A;  4JL9 A;  4LJP B;  3AUL A;  3M3J A;  4ZYS A;  3PT2 B;  4KKI A;  2JF5 A;  4XDC A;  2HJ8 A;  2JWZ A;  3OG5 A;  1WZ3 A;  2KWD A;  2WXI A;  2H89 B;  4HXD A;  2INP E;  2KX0 A;  4RGM A;  2D3A A;  4W9K A;  2K6Q A;  4MGY E;  4MGI E;  2JPH A;  4OVU A;  2FNJ B;  2N9L A;  2JXX A;  1FCC C;  3RYT A;  4MDK E;  3Q8A A;  2KWV B;  2BS2 B;  3DHH C;  2SAK A;  1I4Q A;  2KMM A;  1VZ7 A;  2K0P A;  2XK5 B;  5AZG A;  3GE3 C;  4ANU A;  1LXD A;  2DYM A;  1GNU A;  1XT9 B;  2FAZ A;  3QK0 A;  3I63 C;  3A9J B;  3GP7 A;  4M0W A;  3AEE B;  4PT5 A;  4FXC A;  1WR6 E;  2FCS A;  4AP4 C;  5HHD G;  1KLG D;  2KOX A;  3A33 B;  2WQY B;  1JAL A;  5C23 A;  2LEK A;  1LGR A;  4A3O A;  2HD5 B;  4OZA A;  5BYR A;  3TBL D;  1F52 A;  1Y8R C;  1SE2 A;  2QCZ A;  4A3P A;  4GN1 A;  1TS5 A;  5D3I B;  1UGJ A;  3IT6 B;  4ANW A;  2INN E;  4LJO B;  2ZPY A;  3C8Y A;  3Q3M C;  1E7U A;  2N9E B;  4KDL B;  4I6L B;  2JSV X;  4USA A;  3ZXR A;  1MVK A;  4YSZ B;  4P6V F;  1GUA B;  1RYJ A;  4M8N A;  1KF6 B;  2FUH B;  5E6J A;  2KQS A;  2D5G A;  2L76 A;  1XEE A;  3PSE B;  1WYG A;  3PRE A;  3U4E G;  3PPA A;  1A70 A;  1NI2 A;  2KLC A;  3AV8 A; 
#chains in the Genus database with same CATH homology
 1DOI A;  1PUT A;  1TJE A;  1D5X C;  1PGX A;  2IJ0 A;  2N0S B;  1TS4 A;  4RH6 A;  4Q2J A;  4OHJ A;  2E6X A;  3ETR A;  1L5P A;  3AE6 B;  2XN9 C;  1WGK A;  1ZDX A;  2G1E A;  4N58 A;  3B9J A;  2LHE A;  2L32 A;  4P16 A;  2NMQ A;  3U2S C;  3SEB A;  1QF6 A;  1NEN B;  1NYQ A;  4NAM A;  4WUR A;  2WXP A;  5EE3 A;  3EUB 2;  3FIL B;  4YTN B;  2LJI A;  2V3N A;  3J9C A;  3AEB B;  1C4A A;  4ITK A;  1I4H A;  1J7A A;  1SF0 A;  3AE2 B;  2EEL A;  4HJG E;  4TMA B;  2WXQ A;  2AQ3 B;  1KFY B;  5EE0 A;  3MFG A;  2W3R A;  5C2T B;  2DWQ A;  1STE A;  1FMA D;  1C4P A;  1E0Z A;  1WSP A;  1SJE D;  2K3U A;  2YEP F;  4NAW B;  3TSS A;  1BML C;  1JWU D;  1XCT L;  3PZ8 A;  3NUH B;  3AB5 A;  1YN3 A;  2WDQ B;  1D6E C;  1QOA A;  3HRD D;  4J3O D;  1N63 A;  3Q8F A;  1T3Q A;  2PMV A;  2VZK D;  2ICI A;  3VRB B;  1N5W A;  2V0G A;  3BZD B;  5D3D A;  4TSS A;  2WXL A;  4AQ7 A;  1AYF A;  2Z8L A;  1F2R I;  1I4R A;  1EWC A;  1TS3 A;  4H2A A;  1F2R C;  1RFK A;  1ZXI A;  1V1P B;  2M56 B;  1FO4 A;  3TEZ A;  4RGN A;  2J52 A;  4B0E A;  1MPE A;  4RF1 A;  1K52 A;  1PFD A;  1EM7 A;  3AN1 A;  1L6V A;  1SE3 A;  3Q8E A;  4ZRQ A;  3T3N A;  3IXS A;  1JRO A;  1C4C A;  4A6Q A;  5FR3 A;  3KWL A;  1L6U A;  1V8C A;  1VDV A;  5EE9 A;  1L0Y B;  3HUI A;  2AQ2 B;  4WAF A;  2JZP A;  5LNK 1;  4MH8 A;  5C3J B;  1D5Z C;  1ZOY B;  1IGD A;  4HKZ E;  3V3X A;  4JPS A;  2WXG A;  4LK0 M;  1Q10 A;  4A9A A;  4C7Y A;  1XLN A;  2W3S A;  2GRI A;  3CWI A;  1QOF A;  1YN4 A;  2RDG A;  1E10 A;  4US9 A;  1E9M A;  2MJD A;  2WXR A;  1XO3 A;  4RF0 A;  2CJO A;  4YT0 B;  4JX1 C;  1KRH A;  2PLP A;  3W1S A;  1UWX A;  3BK2 A;  1QIL A;  2QMT A;  4YXD B;  1M4V A;  2WDR B;  3N9Y C;  2I38 A;  3OWE B;  1HEZ E;  5JXV A;  1I4G A;  2DYO A;  2V3P A;  5AUK A;  1JQ4 A;  1TKE A;  2QIE B;  3FAH A;  1XLP A;  4AS1 A;  1FNU A;  2M0A A;  3MP9 A;  5HI1 A;  3AE1 B;  2V4I B;  1FXA A;  3AM9 A;  3Q8C A;  1MI0 A;  2JYT A;  1DGJ A;  3ZYY X;  4MM3 B;  2AQ1 B;  4KGS A;  3VR8 B;  4DXF A;  1VR9 A;  1R7S A;  2Q5W D;  2JXT A;  1B1Z A;  3GS2 A;  1FRD A;  3ABV B;  1ZP0 B;  2W54 A;  1ET9 A;  3I57 A;  2OHF A;  2CJN A;  2Y5C A;  1MHX A;  1JRP A;  1QQR A;  2DLB A;  3DWM A;  5H92 C;  3V05 A;  3HVD A;  5T8I A;  1MHH E;  1I4X A;  2L1A A;  3W5U B;  1FM0 D;  1ET6 A;  1SE4 A;  4KX6 B;  2JYE A;  3BK1 A;  4KKJ A;  1OFF A;  4WH4 A;  3IAS 1;  2JX5 A;  1SBB B;  1L4Z B;  1UUP A;  2W82 A;  4XDD A;  2TSS A;  1GB4 A;  1C77 A;  4XE0 A;  2K9X A;  4XWT A;  1UNS A;  1TY0 A;  4RGT A;  2YEP B;  4B0M A;  1JML A;  1FIQ A;  2WXJ A;  3AE8 B;  3P1M A;  3VR9 B;  4R3D A;  5HFY A;  1DYQ A;  4WWM A;  3UI3 A;  3P4S B;  2WU5 B;  4ZHO A;  2MH7 A;  4N6E B;  4JWS C;  1CQV A;  4CQN A;  2JWU A;  1J7C A;  1TY2 A;  1V1P A;  2M19 A;  1E7P B;  1SSN A;  2W55 A;  1PGA A;  3KQ4 A;  4C7Z A;  4IDI A;  1ZUD 2;  3SR6 A;  4US8 A;  2CU3 A;  2K22 A;  5H8Y E;  1J7B A;  1SXT A;  4KGR A;  4LLG M;  3EA6 A;  2LMC A;  1IUE A;  3MJ5 A;  1LO5 D;  4A8X C;  1GB1 A;  4REZ A;  2BS3 B;  1JWB D;  1K53 A;  3AMZ A;  3MC0 B;  2N7J A;  5EE1 A;  1JWS D;  3LB8 C;  3NVW A;  3PZ7 A;  4ZRP A;  2IGG A;  1CJE A;  1FRR A;  3Q8B A;  3FC4 A;  1YQ4 B;  2HTM E;  4YTP B;  1HXY D;  2LHD A;  1ZE3 D;  3AE7 B;  1AWD A;  2WU2 B;  3KLS X;  1AN8 A;  4RNA A;  1WXQ A;  1FFV A;  1SB3 C;  2WXN A;  3NVV A;  2WXH A;  2WXO A;  2AX5 A;  3AE9 B;  5BMH A;  3P4P B;  1ESF A;  3AED B;  3WCQ A;  3MHZ A;  4NJC A;  2IDY A;  5D7G A;  2K5P A;  2WS3 B;  1KTK A;  1YJI A;  1C76 A;  1QLB B;  5BMG A;  3HVZ A;  1NYR A;  5GXG B;  1YJJ A;  2KAJ A;  3BYY B;  1P7E A;  5HG2 A;  1QOB A;  4ZHP A;  2GB1 A;  3U7Z A;  5BMI A;  5G5G A;  4N59 A;  3R2I A;  1I7H A;  1TZO A;  2KQ4 X;  1HZ6 A;  2FBW B;  3R8B A;  2FE8 A;  2QIL A;  4IKG A;  4A90 A;  1XLQ A;  2MJE A;  1FEH A;  1ZDV A;  4EE2 A;  1WWT A;  3P4Q B;  3P42 A;  1TKY A;  2ACZ B;  4JE3 B;  1F0Z A;  3VRA B;  1YMH E;  1OQQ A;  1PGB A;  2QSD A;  2IGD A;  5FK9 C;  1P7F A;  1PYW D;  2L52 A;  3NRZ A;  1SJH D;  2BYT A;  1Y56 A;  3VQI A;  1T6B X;  5MPO A;  2JU6 X;  4KGT A;  4C80 A;  4MAC A;  4YSY B;  1QKZ A;  1L4D B;  1JW9 D;  2LGI A;  1YQ3 B;  3ZQ4 A;  2NTS A;  1I4P A;  2BT6 A;  2PKO A;  3B2G A;  3EGR A;  1VZ8 A;  3ZGZ A;  4OVZ A;  1N60 A;  1IGC A;  2J53 A;  2JQR B;  1TS2 A;  3PO0 A;  2KN4 A;  3E56 A;  4DQO C;  2ZW0 A;  1XLO A;  1IBX A;  2PVG C;  2N9K A;  2RPV A;  3U52 E;  3TEX A;  3TEW A;  2WNM A;  1T5X D;  1BUI C;  4YSX B;  2VZK B;  3RFZ B;  4RGO S;  1JWM D;  3RPF C;  4HRS A;  3GB1 A;  5TSS A;  1DOX A;  1QOG A;  1NEK B;  1B9R A;  2PTL A;  3LXF A;  3NS1 A;  2IGH A;  1JCK B;  2PIA A;  3Q69 A;  1ACC A;  4ARC A;  2NTT A;  1TKG A;  3AEC B;  2QJL A;  3BWU D;  1FCL A;  1PDX A;  4YWG G;  3ZJV A;  1YN5 A;  1AW7 A;  3BVG A;  1UWM A;  2WDV B;  3NVZ A;  4LTU A;  1IBX B;  3AE4 B;  2QEJ C;  2RMM A;  2ONQ A;  1XF5 L;  2X38 A;  2I2Y A;  4HKQ A;  2ON8 A;  3CIR B;  2BBC A;  3E9S A;  2L83 A;  4NZL B;  3BYT B;  2XNA C;  1FD6 A;  3AEA B;  2WLB A;  4L2Y A;  3I9V 1;  1ZPS A;  3IT4 B;  1NI3 A;  4WQM A;  5BYS A;  2G9H D;  2WP9 B;  4RFB A;  4ZYS A;  1XCQ L;  4KKI A;  2WXK A;  4XDC A;  3NVY A;  1VRA B;  1NVI D;  2BW2 A;  1D5M C;  1N61 A;  1KH0 A;  1N5X A;  3ZJT A;  2KWD A;  3AEF B;  2WXI A;  4O1N A;  2H89 B;  3H8H A;  2INP E;  2HDE A;  2LFI A;  4RGM A;  3DWG C;  1FXI A;  1ZXH A;  2IPK D;  4DXG A;  2BTE A;  3NZ3 A;  3W2D A;  1D4B A;  4GDL B;  1ROE A;  2SEB D;  3IAM 1;  2EKI A;  1OQR A;  1N62 A;  3AE3 B;  4RCO A;  2N9L A;  4XWW A;  1FCC C;  1HZ5 A;  3BVZ A;  3Q8A A;  5BYQ A;  2BS2 B;  1L0V B;  2GI9 A;  2SAK A;  1I4Q A;  1K51 A;  2KMM A;  3BVM A;  4MT5 A;  4OZC A;  3W9C B;  4HEA 1;  2J4X A;  1VZ7 A;  3B2F A;  3R2T A;  1C78 A;  2K0P A;  2J42 A;  3P63 A;  1RWS A;  2KDM A;  4GLS C;  1TYG B;  3T3O A;  1HQR D;  2DYM A;  3BII D;  4IOI E;  2BB5 A;  3GP7 A;  3L4P A;  2Y3A A;  4M0W A;  2RDH A;  3P4R B;  3AEE B;  1SIJ A;  1VJK A;  4PT5 A;  4FXC A;  1WRI A;  5HHD G;  1KLG D;  1V1O A;  1SEB D;  3AH7 A;  1C79 A;  2WQY B;  1JAL A;  1XXG A;  2BB6 A;  2LEK A;  1V97 A;  2WXF A;  1CZP A;  1CK1 A;  4OZA A;  4L23 A;  5BYR A;  1BXT A;  2B76 B;  4YTM B;  4ZOH C;  2R61 A;  2LUM A;  1VZ6 A;  1SE2 A;  1JWA D;  4GDK B;  2H88 B;  2FUG 1;  1TS5 A;  5D3I B;  3SFD B;  1GOZ A;  1UGJ A;  1L0X B;  4C56 C;  3IT6 B;  5I4D A;  1DOY A;  1KLU D;  1E6E B;  2INN E;  4ARI A;  1GPX A;  3C8Y A;  2ZW1 A;  1F77 A;  4HRO A;  4UDU C;  2OED A;  1C9F A;  3AE5 B;  3LYY A;  1FNV A;  1EU3 A;  1K50 A;  1GAQ B;  2DBY A;  2PW9 A;  2E3T A;  1EU4 A;  2JSV X;  3SFE B;  4USA A;  4OW0 A;  5AUI A;  1MVK A;  3O13 A;  4L1B A;  4YSZ B;  4P6V F;  3AEG B;  2WXM A;  1ENF A;  1RYJ A;  1FNW A;  1HA5 A;  1KF6 B;  1YNT E;  2MJ3 A;  4WIP A;  5FKA C;  2KAC A;  5E6J A;  4D2K A;  1FFU A;  2D5G A;  5G5H A;  3W5V B;  4JWU C;  1EWY C;  1XEE A;  3TUO A;  1QT9 A;  3FIL A;  1RM6 C;  3KWV A;  4TQ0 A;  1WYG A;  4TQ1 A;  4OZB A;  2BS4 B;  1VLB A;  2PVO D;  3U4E G;  2MEK A;  3ZJU A;  1A70 A;  2Y5P A;  3URY A;  3TEY A;  3AV8 A;  4A55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...