2L32A

Solution structure of ubiquitin-like small archaeal modifier protein in haloferax volcanii
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
66
structure length
66
Chain Sequence
b'MNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 2
publication title solution structure of ubiquitin-like small archaeal modifier protein in Haloferax volcanii
rcsb
source organism Haloferax volcanii
molecule tags Protein binding
total genus 4
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.630 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2l32A00
2L32A 2LJIA
chains in the Genus database with same CATH superfamily
2J0JA 1VLBA 3HRDD 2LRWA 4RF0A 2DNFA 4FHKA 3WA0A 1JRUA 2FE8A 4LDTB 2NR2A 2CU1A 4P7IA 1XLNA 3KW5B 4NZLB 1FIQA 1QOAA 2ZPNA 1WXSA 4DHZE 1BT0A 4C4VB 1R4NI 4K3BA 5HHDG 3RN9C 1JALA 2LUMA 1PUTA 2QHOA 4HDQA 4BOSC 1QILA 2R2OA 3ALBA 3N9YC 4K7UA 4CHKA 1TKYA 2AQ1B 4A9AA 3BK2A 1DOXA 2AEHA 3UQBA 4M0WB 4XYCA 1J7AA 3BZDB 1WM3A 5G2NA 2CKHB 5HG2A 3MJ5A 4ASWC 2FCMA 3AEDB 1KFYB 3ZKJC 2K25A 3VQIA 2QJLA 1L4ZB 4ZDVA 4YTNB 2L52A 4I6LB 5G5HA 2KWUB 3DPDA 2AL3A 4NPNA 1F2RC 3LB8C 4LDTD 1OFFA 4JIOU 2N9LA 3EGRA 3GE3C 1FXAA 2V3SA 2KNBA 3DVGX 2R61A 1EF5A 3VVWB 1YIWA 1H4RA 1WX8A 2H89B 2Z0EB 4JPSA 3DWGC 4AOFA 4RCOA 1D3ZA 4MDKE 4B0EA 3L16A 4E3CA 2WXLA 4HLEA 3BINA 5IOIA 3BK1A 1FXIA 3N1YC 5EE1A 2EMTA 1FXTB 1Q5WB 2WXIA 1JWSD 2N9XA 3DDCB 2ZJDA 1AYFA 3EA6A 1V1PB 2IGHA 3N20C 4MEMA 2L00B 1I7HA 4CO7A 2KX3A 3I5JC 4YTPB 2N9KA 1UBIA 1WGYA 2JY6A 4K3CA 4WH4A 3GS2A 1V80A 2KO3A 3NY5A 3UIOB 3CSFA 1SSNA 4K7WA 2KACA 4EZJA 1QOGA 1C4PA 4ZRQA 4ANUA 1FPYA 1V5OA 2PLPA 4M00A 3R7QA 2RPVA 3C0RB 2KJHB 4W9LA 3U2SC 1RRBA 3KYCD 2IDYA 1CK1A 5BYRA 3VUYA 5I4DA 3QC8B 3Q8BA 2BKRB 2SEBD 4MGKE 2JXTA 3P4PB 4G0NB 5JXVA 1BXTA 1Y8RC 3KWLA 3T3OA 5MPOA 4BKGA 4IOIE 2J4XA 1C1YB 2WLBA 4MJSA 2BGFA 1V5TA 3DHHC 2CJOA 3NVWA 3DBHB 2HTME 1OQQA 2LVOA 5LNK1 4OVVA 4L1BA 1CJEA 2L3ZA 3VXWA 5D2MB 5BO4B 2KC2A 4N58A 1FCLA 2N7JA 5FKAC 5C3JB 4WWOA 1JROA 1VJKA 1K51A 1YNTE 3AE4B 4XGAB 3PV1A 4ANVA 3W9CB 3RI7C 4B95A 3FKYA 4C00A 4JWSC 2BQQA 1EU4A 1N62A 3UIPB 2J0KA 4A20A 2LUEA 3EUB2 3M95A 5FK9C 4GDKB 2KFJA 4KV2A 1WRIA 1HE8A 1CMXB 3AV8A 2KTRA 4GB9A 2I2YA 2KMCA 2QDFA 5JZEB 2LI5A 4ANXA 4HWIB 4DHJB 4I6NB 2XNAC 2D3AA 3L08A 1HTQA 1RYJA 4ACFA 2I1JA 1WMHB 2MBQA 3H7PB 3GE8C 1UBQA 3DBLB 2AQ3B 1UELA 4I6PA 2KWVB 2AX5A 1IP9A 3VTUA 4WQOB 3PZ8A 3RD2A 3U4EG 1PDXA 2ZW1A 1I4RA 4HPMB 1FRRA 3ZNHB 2Q5WD 3A9JA 4A55A 3DVGY 4HEA1 4NJ7A 1I4XA 2KDIA 3K9OB 5HKHA 3BYTB 1LXDA 1P3QU 1E6EB 1MG8A 4BAXA 1WJ6A 2N1WA 3PRZA 1SBBB 4FN2A 1C9FA 1NYRA 1F0ZA 1YQ3B 1MHXA 1K52A 2M8SA 4BKSA 2L7RA 3KH0A 2ACZB 4FBJB 2SAKA 2LGSA 1LM8B 5G5GA 2J52A 2CJNA 1J8CA 1V6EA 4RGTA 4TKNA 1R4MB 3RCZA 4JLCA 2QIEB 4DHJD 4KGSA 4KZCA 4B0MA 1WR6E 3ZXRA 3NJTA 1V8CA 1AN8A 4XDCA 2MBEA 3APCA 2IO1B 2WXFA 3ZNID 1IUEA 1JCKB 3Q69A 3L13A 4IC7B 3HK0A 2V0GA 1EO6A 1L7YA 1GUAB 3E9SA 4LNIA 1QF6A 3NZ3A 4MGIE 2DHZA 1T0SC 2NMQA 3I57A 4NQLB 2WXOA 3AB5A 1V81A 2DBYA 3JSVB 1WSPA 3H1UA 2UYZB 2D3GA 1KRHA 2RDBC 4WJPA 4PK1A 1VZ7A 3KUZA 1C4CA 1N60A 4MM3B 3RULA 5IN7A 1L6UA 2MP2B 2BF8B 5G55A 2WDTB 3Q3JA 2KT7A 2XK5A 4NJCA 3FILB 3Q6BA 3U7DA 1N6ZA 1YOVB 1ZXIA 1VR9A 2LVPA 4RFBA 1UH6A 1AWDA 4N9F4 2IJ0A 5DPRA 3ZO5B 2WGSA 2K6QA 3JVZX 1LQBA 2ZEQA 3O65B 2BB6A 1WX7A 2KDBA 3M3JA 3JW0X 2K9XA 2DYMA 4OVUA 2E3TA 2UWQA 3PLUA 2CHXA 4QAYA 1IBXB 4ZYNA 2KYWA 4FJZA 1E8ZA 3NHEB 1WM2A 1STEA 1YQ4B 1ZE3D 1V97A 4WWMA 4C4VA 4N59A 1YN4A 3EHVA 1K8RB 2BPSA 2K8BA 3HHMA 4BBNF 2ZVOA 3QARA 4KIKA 3VTWA 1D4BA 1VDVA 3AI5A 2RD0A 3BY4B 4BOZB 3VDZA 4GMVA 1SIJA 2DLBA 4OZBA 2JSVX 3OJ4B 2FUG1 1YJ1A 1V1OA 2B3AA 2G3QB 2FNJB 3WAPA 1FO4A 2L05A 2JRIB 1RAXA 4TQ1A 3V6CB 2O2VB 3TBLD 2HJ8A 1ZGUB 1WE7A 4MSMB 3VRAB 2BYTA 4EE2A 2LD9A 4II3B 3Q8AA 3RNBC 1EM7A 1UF0A 3MTNB 2ZZPB 1CQVA 1OTRB 2JUOA 2RDHA 4RNAA 2WXPA 3N1ZC 2C60A 1JWMD 1WXAA 4DDGD 2L32A 4AJWA 3IAM1 3HM6X 1GC6A 4P16A 3HIZA 2LGYA 5IO9A 4KGRA 3ZRCA 5CX3A 1WGRA 1AARA 1FNWA 4RM8A 1SF0A 4YWGG 2E6XA 4NAMA 3OLMD 3K9PB 5D7GA 1V1PA 1RLFA 4ZRJA 1ESFA 1UGJA 2G1EA 5AZGA 2KDEB 3AE7B 1WF9A 3ZNGC 5D6JB 2JWUA 3Q3OC 1JWAD 3E56A 4ARIA 5L95C 2LWPA 1EUVB 2O6VA 2PPHA 1IGCA 1XQQA 5BMIA 3ZXVA 1EF1A 1Q1OA 5E6PA 2KWDA 2ZNVB 1MPEA 5FR3A 2KLCA 4LNKA 1X1MA 3U8ZA 2VH1A 3L0WB 3NZSA 1ZDXA 2J0MA 2WXJA 2MQJA 2MHJA 2Y5PA 1F77A 3R7RA 3M62B 1ZW7A 3GB1A 2BVCA 3WALA 1T0QC 1KLUD 2CHZA 3W5VB 2X38A 1VZ8A 3AE6B 3KUCB 2MX2A 4GIVA 2INPE 1L5PA 4DQOC 2BS2B 3CMMB 4EFOA 2FBWB 2ONQA 1L2NA 5J17A 1ISNA 1PFDA 3V6EB 1A70A 1UGMA 1J19A 1ENFA 4FHJA 1D5MC 5EE0A 3W1YA 1ZOYB 2MH7A 4YT0B 2G4SA 3P4RB 2PTLA 4HKZE 1Z2MA 4ICVA 2N9EB 3RFZB 2N7EA 2CR5A 3SU8X 1GOZA 1OQRA 5BYSA 1BMLC 1JRPA 4RMAA 4XDDA 2IO2B 1UWXA 3MHSD 1D5XC 2ZCBA 5TR5A 3SFDB 4GDKA 3DHGC 2EKEC 4RH6A 2ZW0A 3BIID 1N61A 4TSSA 3KUDB 1I42A 2DAJA 2KFKA 3V61A 3AN1A 1WMHA 2PVGC 3AEAB 3H7PA 1VD2A 4HPLB 2LGDA 3VH4B 3X23A 2KXJA 1FMAD 1JW9D 2K22A 5IKCM 1JMLA 1TY0A 3L10B 3ZIMA 1YN3A 3KQ4A 1MI0A 4L23A 2PE6B 3IAS1 2L1AA 1RFAA 1K50A 1R4MI 2K8CA 1SXTA 2MLBA 4IM0A 4KX6B 1WE6A 4REZA 3TUOA 4F1SA 3M63B 4ZOHC 1WWTA 2INNE 4RGMA 2NVUI 3W1SA 4ARCA 3L4PA 5EE9A 5D3DA 1V2YA 3RNEC 3S2AA 4IM2A 1B1ZA 4AUQC 3RUIB 4EKUA 4PT5A 2BS3B 3WAMA 1WGGA 1QQRA 3T3NA 3RZFA 2NTTA 3ECIA 4E71A 3BYYB 2KQ4X 1U4AA 4GN1A 3VH3B 3I9V1 2PW9A 1NEKB 4US8A 1FRDA 1TGZB 4W9IA 3A1QA 2WXMA 4AJYB 4ZRPA 3ZDMC 2JT4B 3AE2B 1TS5A 4WIPA 1I4GA 1FD6A 2WXQA 2PMVA 4ANWA 1GB1A 5TSSA 2DZJA 1PGBA 1WGKA 3NVZA 2WP9B 4MH8A 2HJ1A 4ZHPA 1L4DB 2RR9A 4HK2A 5T8IA 2KVZA 2JF5A 2C7NB 2IGGA 2GBNA 4MM3A 1YN5A 2MP2A 1M94A 3TSSA 2NPTB 3APDA 4GDLB 5D94A 1J7BA 1P0RA 2N4FA 2INDC 4F7ZA 3KYDD 2BTEA 2KMMA 2WXKA 3FILA 4HPPA 3A9KB 3IBEA 4EEWA 1PGXA 2WYQA 1TT5B 4FJYA 3U30A 4ICUA 1WXQA 1XF5L 1L0YB 2LJ5A 1CZPA 1YX6B 3PT2B 4PS8A 1GG3A 5C2TB 3VR9B 4MELA 1R7SA 2ASQA 2BBCA 2KDMA 2QC8A 1J0GA 4YL8A 4LNFA 3IHPC 4USAA 3QK0A 2MSED 2XN9C 1UNSA 2MWSB 1IBXA 3LJ3A 3DBRB 3PRMB 3ENEA 3AU5A 1ZDVA 2XBBC 1SE3A 2K1FA 3PGEA 2UU7A 4M8NA 2PE9A 1YD8U 4EOYA 1NVID 4EZLA 4WAAA 1MG4A 1V86A 1WYGA 2AWTA 4FXCA 1HXYD 4S0RA 2KZRA 3V62A 4PYUA 3B08A 4GLSC 5BYQA 4AQ7A 1KJTA 4W9GA 4G11A 1VRAB 3UQAA 2WQYB 1R4NB 3AMZA 4OZAA 2V1YA 4GOCA 4KKJA 2Z8LA 3I63C 3I3TB 2L0TA 4LTUA 5J18A 2JRHA 3P63A 1DGJA 1E8WA 4NAWB 4HCNB 1HA5A 2KDFB 3H9DA 2C5LC 4KKIA 2OHFA 1T5XD 5D3IB 4A3PA 2OJRA 5E6NA 1ET9A 4HCPB 2W82A 4BVUC 1SE9A 2RMMA 4HVBA 2GLSA 2BYFA 2WXRA 1P7EA 3HVDA 1MHHE 3URYA 2PKOA 2OJWA 4URKA 4KDLB 4NNJB 4R3DA 3UI3A 1XCQL 1SE2A 2BWFA 4P6VF 2HD5B 1EWYC 3SDLC 4HJGE 1E0ZA 2IO3B 5AUIA 4YSYB 3O13A 2Z59B 4GSWA 5J2RA 2PEAA 4M8MA 2D3CA 4YTMB 1F9JA 3HUIA 2HTHA 1TTNA 4DK5A 5DCNA 1NENB 2BKFA 1XCTL 3EFCA 4IW0A 4LNOA 3UF8A 1WJ4A 2YLMA 2JX5A 1Y56A 3U7ZA 2KN4A 4OW0A 5LLIA 2JZPA 1JWUD 4W9DA 2NBVB 5LXHA 4HXDA 1IPGA 1J7CA 4UDUC 4DXGA 2IO0B 3SFEB 4XC2A 4BFRA 3H7SA 3EECA 1FNVA 1XEEA 2D11A 4TUUA 3P2BA 2W9NA 3N30A 5FR6A 1E7PB 1Q10A 3KWVA 3AXCA 1YX5B 1XLOA 3V3XA 1N5WA 1WZ3A 4IKGA 5AZHA 2FUHB 3BVMA 3J9CA 3W1SC 4ITKA 4WJOA 4G50A 2BYVE 4HKQA 3NUHB 5E6OA 3ZRFA 4DWFA 3VHTC 3NG0A 2AYOB 1ZKHA 2W3RA 1IYFA 1E7UA 4IM3A 4M0WA 3R8BA 2LJIA 1LFDA 1C3TA 3AE5B 1WYWB 3C19A 1S3SG 3UGBB 1GPXA 3QJZA 1WXVA 2PVOD 1XLQA 2WNMA 4XZ4A 2TSSA 4MACA 4P1CC 4YXDB 2IBIB 4JGHB 2N1VA 4RF1A 1S1QB 3PTFC 5EE3A 2IY0B 2KJRA 4JE3B 2K0PA 4W9JA 1FFVA 4JWUC 3PVLA 2EKIA 1E10A 2YEPF 2V4IB 1VCBA 3TEWA 1HEZE 2FCQA 4A3OA 3B2GA 2AL6A 3NS1A 4LJPB 4A6QA 3OG5A 3CWIA 3DOWA 4M01A 3TEYA 2WXGA 3KLSX 4PS3A 4MT5A 3RNFC 1WGHA 4IG7B 4A90A 3HVZA 2J42A 2V4LA 2DZKA 3T9LA 4PYZA 3BWUD 2Y3AA 1JQ4A 1N63A 3FC4A 3WIMA 2WU5B 3IFWB 4MSQB 4X57B 4W9HA 1KLGD 2ICIA 4BZAA 1FNUA 4CYEA 3DWMA 5C23A 1ZUD2 4YSZB 2YVCA 4C80A 1OEYJ 1KM7A 2A5UA 3Q8EA 2B76B 4HJKA 3ZTDA 2J7QB 4ZHOA 3PZ7A 3L17A 3Q3NC 4NY0A 5AUKA 1WGDA 3VFKA 5DPTA 1GAQB 3AULA 2MJ3A 2D2QA 1AW7A 2ZVNA 2GBJA 3PS6A 2KD0A 3AE1B 2IYDB 2N9PC 2CHWA 1N5XA 3DBHI 3AH7A 4OHJA 3TCAA 1ZPSA 2IZVB 2BWES 2KWCA 3GZNB 1C4AA 2DZMA 4J6IA 1XLPA 4IDIA 4BKSD 1EWCA 4IUMB 3MP9A 1OQYA 2PIAA 1YJIA 1OEYA 3A4SC 2XEWA 4W9CA 5JHBA 1FEHA 2NPTA 1H8CA 4GDLA 1T0RC 3ZNZB 4II2B 1FM0D 2LVQA 1I4HA 2LXAA 3C8YA 3A9KA 4GU2A 5GMVA 2FIFA 2LXCA 5LXIB 3R2IA 5EDSA 3NVYA 2JZZA 2C7HA 3APFA 4LLGM 2K8HA 3V60A 2WDRB 3Q14C 1I4PA 1MJDA 3ZW3A 3OWEB 3RMKC 1IGDA 4GXBA 4RM9A 3DBLI 2KQ7A 2C7MB 1P9DU 3TIXA 1XXGA 1ACCA 4EZKA 2JQRB 2M0XA 2QSDA 1MVKA 3Q8CA 4HDOA 2VZKB 4KIKB 4WURA 3P1MA 3GOEA 1EU3A 2IY1B 1Q0WB 2WXNA 3IT6B 3ONSA 2ZNVC 4TMAB 1SJED 2N0SB 1WZ0A 1NI2A 3IT4B 2GMIC 1V49A 4B9KA 3L54A 3DBSA 1B9RA 3ML9A 1DOYA 2C9WB 3TEZA 4TQ0A 1XD3B 2G45B 3AE8B 1UD7A 4NAWA 1TZOA 2WX1A 2WHIA 3B0AA 2A4ZA 5BMHA 3DQVA 4XWTA 2DENB 4DDID 1GC7A 2MJDA 4RGOS 2MCNB 2YEPB 4BKTA 1XT9B 4RGNA 2VZKD 3B9JA 1QKZA 3QQ8B 1P98A 3QAQA 2RGFA 3TMPB 3Q3MC 3H8HA 1QT9A 5AEKB 2QCZA 3VTVA 3IVFA 3QA8A 3RNCC 1QZEA 4AWJA 4E74A 3BVZA 1M4VA 3RYTA 5HFYA 3LYYA 4LK0M 3DCGA 2GB1A 4C7YA 5KHOA 2PJHA 3ZYYX 3DVNU 3WAOA 3PRPB 3B2FA 4W9FA 1HTOA 2CU3A 3AEEB 3RNAC 2V3NA 1WH3A 3X0WA 1L0XB 3PHWB 4W9KA 2K5PA 3BVGA 2EELA 5DPWA 1I4QA 2MEKA 3IXSA 3W5UB 2O6VB 2JXXA 1TS2A 3MC9A 4DXFA 3EC8A 3JSVA 3N32A 1TY2A 4MGZE 4AS1A 3DHIC 1GNUA 3V05A 1WY8A 2IGDA 4BBNC 1C77A 4O1NA 3SD5A 1TS4A 3A4RA 4L2YA 3Q2AC 1C76A 2D3BA 1ZP0B 3RT3B 4B6WA 2L76A 2K3UA 2HE7A 2INCC 1E5WA 5L83A 3QHTA 3PO0A 3WCQA 2G4DB 4C7ZA 1VZ6A 1KLVA 2LMCA 2KMAA 3R66C 4WJQA 1HZ5A 1PGAA 2RDGA 3LDZE 2BT6A 2O6VD 3AEBB 1T0YA 2V3PA 1KH0A 2K6DB 1HZ6A 2M56B 2IPKD 1YJJA 2LFIA 2D07B 2RSUA 2W54A 2R2QA 3AE9B 3ML8A 2FCSA 3TJPA 2MBOA 1RWSA 4K7SA 2LZ6A 5CHWA 2JPHA 2NCNA 4NQKE 4IWOA 3VR8B 2Z0DB 3AECB 3ZUNA 1F1HA 2NBWB 1QOFA 2X8XX 2GBKA 3SEBA 1UWMA 3TL5A 4C56C 1PYWD 3D32A 2BW2A 3R2TA 5JH5C 2KFKB 1WR1A 1E9MA 2D5GA 2QMTA 4DXAB 2DX5B 2KC1A 2O2VA 3RPFC 5AZFA 2L8JA 1TBEA 3MFGA 2WXHA 4WJNA 4WWNA 2NTSA 4ZRKA 3VAWA 3P4QB 2BYEA 2VRRB 4XE0A 2LGIA 1DYQA 2ON8A 3PREA 3NOBA 5JHAA 3CF6E 4WAFA 4MH0E 4KGTA 5GXGB 4NJ6A 2WX0A 3ETRA 4IWPA 3NRZA 3QIJA 3ZQ4A 4K1RB 2DYBA 5IAAC 2M0AA 3CSTA 2MW5A 3ZDTA 1T3QA 4K81A 2JYEA 3U52E 2GRIA 1E8XA 3QCAA 5DPSA 3LXFA 3FAHA 1NYQA 1TIFA 4FLHA 5BMGA 4EUTA 1Z5SB 3MC0B 3ZJTA 1YMHE 2KK8A 4KVGB 4KSLC 1TS3A 4F8CB 1E90A 2I1KA 4PS7A 4HROA 2QILA 4Q2JA 3GZNI 5KHQA 3OJ3A 3ZJVA 3ZGZA 3A1QB 1F2RI 1SE4A 3QWZB 2JVCA 2BS4B 5H8YE 4MGYE 3SR6A 2LEKA 2MRPA 3EFUA 3PLVA 1KTKA 1LO5D 1C79A 2ZCCA 3PSEB 4AP4C 4US9A 4CQNA 2FCNA 2M4NA 2WWZA 1WFYA 1P7FA 4FULA 2KVRA 1WRDB 3UINB 1G6JA 1XO3A 2I38A 1UUPA 4H2AA 2KANA 3WANA 4MJSB 2ZPYA 2D10A 4DHZB 1FCCC 3NZUA 2LHEA 4KSKC 4XWWA 2Y5CA 2Y5BB 1TZ1A 1UZXB 1C78A 2GBRA 3RZWC 4W9EA 2VH2A 4HRSA 2KKCA 1PQSA 4FJVB 1QLBB 1WIAA 2EMSA 3JYUA 1WJUA 2W55A 4N6EB 2L83A 2CS4A 1GB4A 1D5ZC 2M1MA 2OEDA 1NI3A 2KAJA 3N3KB 2MA9B 3VUWA 2DAFA 2HDEA 5IA7A 2LHDA 2H88B 2J53A 3P42A 5CHFA 3MC8A 2K39A 3AE3B 3ZLZA 3IG3A 2LGXA 1D6EC 1NBFC 4G3XB 2JYTA 1WX9A 2KJ6A 3N1XC 2KTRB 3W2DA 3P4SB 3SHQA 3A33B 1WXMA 3ABVB 4GGQA 3RNGC 2NBUA 2W3SA 1SB3C 1A5RA 3GP7A 5H92C 2WU2B 3AU4A 2REXA 1SGHA 2OOBB 4M02A 3ZTCA 1JWBD 1GJZA 3A9JB 4LJOB 4ZYSA 2MBBB 5CTRC 4LNNA 4D2KA 1QOBA 4WWPA 2M17A 5HI1A 1BUIC 1WJNA 2KHWB 2KLGA 1WI0A 1I35A 2GI9A 1V9JA 2GBMA 3ZVVA 3B1LX 2FAZA 3R3MA 1ZXHA 2KX0A 1TKEA 2JU6X 3PPAA 2FIDA 2KN5A 1ROEA 4S17A 1K53A 2MBHA 1KOTA 1SJHD 2KOXA 1OGWA 1ET6A 4WQMA 2WDVB 1YQBA 2AQ2B 4JL9A 2WS3B 3AM9A 4A8XC 2DWQA 2JZ3B 3MJWA 3MHZA 2JWZA 2G9HD 1P1AA 2DZIA 5E6JA 1L6VA 1NDDA 1RM6C 1RFKA 2NS5A 4DBGA 2LRUA 2MJEA 3Q8FA 4XX5A 3PZDA 4OVZA 2M19A 4JX1C 2DYOA 4FA6A 1SIFA 3VUXA 1TKGA 4LCDE 1L0VB 3KVFB 4IWQA 5C1ZA 1E7VA 2GOWA 2KTFA 3CIRB 4ZRIA 4KZ0A 3VRBB 1TYGB 3NS8A 2KQSA 1DOIA 1MFWA 3TEXA 4P1BC 2WDQB 2L0FA 3T8MA 4FADA 3AEFB 4J3OD 2BB5A 1E8YA 1LGRA 1T6BX 2N7DA 3AEGB 3ZJUA 1KF6B 3QX1A 1F52A 2QEJC 5CHVC 4YSXB 3OAWA 2LASA 3DVNV 3PHXB 2XK5B 3H6NA 1SEBD 4JQWC 3DBRI 1FFUA 4KDIC 3Q3FA 4TV3A 1TJEA 2V9HA 2RPQA 3NVVA 5IP4D 3HM3A 1HQRD 4OZCA
chains in the Genus database with same CATH topology
4OZBA 2JSVX 1MHHE 3URYA 2PKOA 2FUG1 1VLBA 1V1OA 3HRDD 1TY2A 4RF0A 2FE8A 4R3DA 3UI3A 1FO4A 1XCQL 4AS1A 1SE2A 4P6VF 1EWYC 4HJGE 4TQ1A 1E0ZA 1XLNA 4NZLB 5AUIA 3V05A 1FIQA 1QOAA 4YSYB 2IGDA 3O13A 1C77A 4O1NA 1TS4A 5HHDG 4L2YA 1JALA 2LUMA 1PUTA 4YTMB 1C76A 3HUIA 1ZP0B 1QILA 3N9YC 3VRAB 2BYTA 1NENB 4EE2A 1TKYA 1XCTL 2K3UA 2AQ1B 4A9AA 3BK2A 3Q8AA 1DOXA 1EM7A 1J7AA 3BZDB 2JX5A 3PO0A 1CQVA 2RDHA 3WCQA 4RNAA 5HG2A 2WXPA 4C7ZA 1JWMD 1VZ6A 2LMCA 3MJ5A 1Y56A 3U7ZA 2L32A 2KN4A 3IAM1 1HZ5A 1PGAA 3AEDB 4P16A 1KFYB 3VQIA 2QJLA 4KGRA 1L4ZB 4OW0A 2RDGA 2BT6A 2JZPA 1JWUD 1FNWA 3AEBB 1SF0A 4YTNB 4YWGG 2E6XA 4NAMA 2L52A 1J7CA 2V3PA 4UDUC 5G5HA 1KH0A 4DXGA 1HZ6A 2M56B 3SFEB 2IPKD 5D7GA 1YJJA 1V1PA 2LFIA 1ESFA 1UGJA 2G1EA 2W54A 1F2RC 1FNVA 1XEEA 3LB8C 3AE7B 3AE9B 1OFFA 2N9LA 3EGRA 1RWSA 1FXAA 2JWUA 2R61A 1E7PB 1JWAD 3E56A 1Q10A 3VR8B 3KWVA 4ARIA 2H89B 4JPSA 3DWGC 3AECB 1IGCA 4RCOA 1XLOA 3V3XA 4B0EA 1QOFA 1N5WA 2WXLA 3SEBA 5BMIA 1UWMA 4IKGA 3BK1A 2KWDA 1FXIA 3BVMA 3J9CA 4C56C 4ITKA 1PYWD 5EE1A 2BW2A 1MPEA 3R2TA 5FR3A 2WXIA 1JWSD 1E9MA 1ZDXA 4HKQA 2D5GA 2QMTA 3NUHB 1AYFA 3EA6A 2WXJA 3RPFC 2Y5PA 3MFGA 1F77A 1V1PB 2IGHA 2WXHA 3GB1A 1I7HA 2NTSA 3P4QB 1KLUD 4YTPB 4XE0A 2N9KA 2LGIA 1DYQA 2ON8A 4WH4A 2W3RA 3GS2A 3W5VB 2X38A 1VZ8A 3AE6B 4WAFA 1SSNA 4M0WA 3R8BA 2KACA 2LJIA 2INPE 1L5PA 4KGTA 5GXGB 1QOGA 1C4PA 2BS2B 3AE5B 4ZRQA 4DQOC 3ETRA 2FBWB 2PLPA 1GPXA 3NRZA 2ONQA 1PFDA 2RPVA 3ZQ4A 2PVOD 1A70A 1XLQA 2WNMA 3U2SC 1ENFA 2TSSA 4MACA 4YXDB 2IDYA 1CK1A 1D5MC 2M0AA 5EE0A 5BYRA 1T3QA 2JYEA 5I4DA 1ZOYB 2MH7A 4YT0B 3P4RB 3U52E 3Q8BA 4RF1A 2GRIA 2SEBD 2JXTA 2PTLA 3LXFA 3FAHA 5EE3A 1NYQA 3P4PB 5BMGA 4HKZE 3MC0B 4JE3B 2K0PA 5JXVA 1FFVA 4JWUC 1BXTA 3ZJTA 1YMHE 3RFZB 2EKIA 3KWLA 1E10A 2YEPF 1TS3A 3T3OA 2V4IB 1GOZA 1OQRA 3TEWA 5MPOA 4HROA 1HEZE 2QILA 4IOIE 5BYSA 1BMLC 2J4XA 4Q2JA 1JRPA 2WLBA 4XDDA 3B2GA 1UWXA 3NS1A 4A6QA 3ZJVA 1D5XC 3SFDB 3ZGZA 3CWIA 3TEYA 2WXGA 1F2RI 2CJOA 1SE4A 3KLSX 3NVWA 4MT5A 2HTME 1OQQA 2BS4B 4RH6A 2ZW0A 5H8YE 5LNK1 3BIID 4A90A 3SR6A 3HVZA 1N61A 2J42A 2LEKA 4L1BA 4TSSA 1CJEA 3BWUD 2Y3AA 1KTKA 1LO5D 1C79A 1JQ4A 1N63A 3AN1A 3FC4A 4N58A 1FCLA 2PVGC 3AEAB 2WU5B 4US9A 4CQNA 1P7FA 2N7JA 1KLGD 5FKAC 5C3JB 2ICIA 1FNUA 1FMAD 1JW9D 3DWMA 1JROA 2K22A 1XO3A 2I38A 1JMLA 1TY0A 1VJKA 1YN3A 1UUPA 1K51A 4H2AA 1ZUD2 3KQ4A 4YSZB 1MI0A 4C80A 4L23A 3IAS1 2L1AA 1YNTE 3AE4B 1FCCC 3W9CB 3Q8EA 1K50A 2B76B 4JWSC 2LHEA 4XWWA 4ZHOA 1EU4A 1N62A 2Y5CA 3PZ7A 3EUB2 1SXTA 5FK9C 4GDKB 4KX6B 1WRIA 5AUKA 1C78A 3AV8A 4REZA 2I2YA 3TUOA 1GAQB 4HRSA 4ZOHC 2MJ3A 2XNAC 1WWTA 1QLBB 1AW7A 2INNE 1RYJA 4RGMA 3W1SA 3AE1B 4ARCA 2W55A 1N5XA 3L4PA 4N6EB 5EE9A 2L83A 1GB4A 3AH7A 4OHJA 5D3DA 1D5ZC 1ZPSA 2OEDA 1NI3A 2KAJA 2AQ3B 1C4AA 2AX5A 1B1ZA 3PZ8A 2HDEA 2LHDA 3U4EG 4PT5A 2BS3B 1PDXA 2ZW1A 1I4RA 1XLPA 4IDIA 1FRRA 2H88B 2J53A 1EWCA 1QQRA 3P42A 2Q5WD 4A55A 3MP9A 3T3NA 2NTTA 2PIAA 4HEA1 1I4XA 3BYYB 1YJIA 3AE3B 2KQ4X 3BYTB 3I9V1 1D6EC 1FEHA 2PW9A 1E6EB 1NEKB 4US8A 1FRDA 2JYTA 2WXMA 1FM0D 1SBBB 4ZRPA 1I4HA 1C9FA 1NYRA 3AE2B 1F0ZA 3W2DA 1TS5A 3P4SB 4WIPA 1I4GA 3C8YA 1YQ3B 1FD6A 1MHXA 2WXQA 2PMVA 1K52A 3ABVB 1GB1A 2W3SA 1SB3C 5TSSA 2ACZB 3GP7A 2SAKA 1PGBA 3R2IA 5H92C 1WGKA 5G5GA 3NVZA 2J52A 2WP9B 2CJNA 4MH8A 2WU2B 3NVYA 4RGTA 4LLGM 4ZHPA 1JWBD 1L4DB 2WDRB 2QIEB 5T8IA 1I4PA 4KGSA 4ZYSA 4B0MA 3OWEB 1IGDA 4D2KA 2IGGA 1QOBA 1V8CA 1AN8A 4XDCA 5HI1A 1BUIC 1YN5A 3TSSA 2WXFA 1IUEA 1JCKB 4GDLB 2GI9A 3Q69A 1J7BA 2V0GA 1ZXHA 2BTEA 2KMMA 2WXKA 1XXGA 1ACCA 2JQRB 3FILA 1TKEA 2JU6X 2QSDA 1MVKA 1ROEA 3Q8CA 3E9SA 1K53A 1PGXA 2VZKB 4WURA 1SJHD 1WXQA 1QF6A 1XF5L 3NZ3A 3P1MA 1ET6A 4WQMA 1L0YB 1CZPA 1EU3A 2NMQA 5C2TB 2WDVB 3I57A 3VR9B 2WXOA 2WXNA 3AB5A 3IT6B 1R7SA 2KDMA 2AQ2B 2BBCA 2DBYA 4TMAB 1WSPA 1SJED 2N0SB 2WS3B 3AM9A 4A8XC 1KRHA 2DWQA 3IT4B 4USAA 3MHZA 1B9RA 1VZ7A 2G9HD 2XN9C 1DOYA 1UNSA 1C4CA 1N60A 1IBXA 4MM3B 3TEZA 5E6JA 1L6UA 1L6VA 4TQ0A 1RM6C 3AE8B 1RFKA 1TZOA 1ZDVA 1SE3A 2MJEA 3Q8FA 4OVZA 2M19A 4JX1C 2DYOA 4NJCA 3FILB 1ZXIA 1TKGA 1VR9A 4RFBA 1L0VB 1NVID 1AWDA 5BMHA 4XWTA 2IJ0A 1WYGA 4FXCA 2MJDA 1HXYD 4RGOS 2YEPB 3CIRB 3VRBB 2BB6A 4RGNA 4GLSC 1TYGB 5BYQA 4AQ7A 2K9XA 2DYMA 1VRAB 1DOIA 2WQYB 2VZKD 3B9JA 2E3TA 3AMZA 1QKZA 3TEXA 4OZAA 3H8HA 2WDQB 4KKJA 1QT9A 2Z8LA 3AEFB 4J3OD 2BB5A 1IBXB 4LTUA 1T6BX 3ZJUA 1DGJA 3AEGB 3P63A 1KF6B 4NAWB 2QEJC 1STEA 3BVZA 1M4VA 4YSXB 1YQ4B 1ZE3D 1V97A 5HFYA 4WWMA 1HA5A 3LYYA 4LK0M 2GB1A 4C7YA 4N59A 1YN4A 3ZYYX 1SEBD 4KKIA 3B2FA 2OHFA 1T5XD 5D3IB 2CU3A 3AEEB 1FFUA 2V3NA 1ET9A 1L0XB 1TJEA 1D4BA 2K5PA 1VDVA 2EELA 3BVGA 1I4QA 2MEKA 3IXSA 2W82A 3W5UB 1SIJA 2DLBA 2RMMA 3NVVA 1TS2A 4DXFA 1HQRD 4OZCA 2WXRA 1P7EA 3HVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L32 A;  2LJI A; 
#chains in the Genus database with same CATH topology
 2J0J A;  1VLB A;  3HRD D;  2LRW A;  4RF0 A;  2DNF A;  4FHK A;  3WA0 A;  1JRU A;  2FE8 A;  4LDT B;  2NR2 A;  2CU1 A;  4P7I A;  1XLN A;  3KW5 B;  4NZL B;  1FIQ A;  1QOA A;  2ZPN A;  1WXS A;  4DHZ E;  1BT0 A;  4C4V B;  1R4N I;  4K3B A;  5HHD G;  3RN9 C;  1JAL A;  2LUM A;  1PUT A;  2QHO A;  4HDQ A;  4BOS C;  1QIL A;  2R2O A;  3ALB A;  3N9Y C;  4K7U A;  4CHK A;  1TKY A;  2AQ1 B;  4A9A A;  3BK2 A;  1DOX A;  2AEH A;  3UQB A;  4M0W B;  4XYC A;  1J7A A;  3BZD B;  1WM3 A;  5G2N A;  2CKH B;  5HG2 A;  3MJ5 A;  4ASW C;  2FCM A;  3AED B;  1KFY B;  3ZKJ C;  2K25 A;  3VQI A;  2QJL A;  1L4Z B;  4ZDV A;  4YTN B;  2L52 A;  4I6L B;  5G5H A;  2KWU B;  3DPD A;  2AL3 A;  4NPN A;  1F2R C;  3LB8 C;  4LDT D;  1OFF A;  4JIO U;  2N9L A;  3EGR A;  3GE3 C;  1FXA A;  2V3S A;  2KNB A;  3DVG X;  2R61 A;  1EF5 A;  3VVW B;  1YIW A;  1H4R A;  1WX8 A;  2H89 B;  2Z0E B;  4JPS A;  3DWG C;  4AOF A;  4RCO A;  1D3Z A;  4MDK E;  4B0E A;  3L16 A;  4E3C A;  2WXL A;  4HLE A;  3BIN A;  5IOI A;  3BK1 A;  1FXI A;  3N1Y C;  5EE1 A;  2EMT A;  1FXT B;  1Q5W B;  2WXI A;  1JWS D;  2N9X A;  3DDC B;  2ZJD A;  1AYF A;  3EA6 A;  1V1P B;  2IGH A;  3N20 C;  4MEM A;  2L00 B;  1I7H A;  4CO7 A;  2KX3 A;  3I5J C;  4YTP B;  2N9K A;  1UBI A;  1WGY A;  2JY6 A;  4K3C A;  4WH4 A;  3GS2 A;  1V80 A;  2KO3 A;  3NY5 A;  3UIO B;  3CSF A;  1SSN A;  4K7W A;  2KAC A;  4EZJ A;  1QOG A;  1C4P A;  4ZRQ A;  4ANU A;  1FPY A;  1V5O A;  2PLP A;  4M00 A;  3R7Q A;  2RPV A;  3C0R B;  2KJH B;  4W9L A;  3U2S C;  1RRB A;  3KYC D;  2IDY A;  1CK1 A;  5BYR A;  3VUY A;  5I4D A;  3QC8 B;  3Q8B A;  2BKR B;  2SEB D;  4MGK E;  2JXT A;  3P4P B;  4G0N B;  5JXV A;  1BXT A;  1Y8R C;  3KWL A;  3T3O A;  5MPO A;  4BKG A;  4IOI E;  2J4X A;  1C1Y B;  2WLB A;  4MJS A;  2BGF A;  1V5T A;  3DHH C;  2CJO A;  3NVW A;  3DBH B;  2HTM E;  1OQQ A;  2LVO A;  5LNK 1;  4OVV A;  4L1B A;  1CJE A;  2L3Z A;  3VXW A;  5D2M B;  5BO4 B;  2KC2 A;  4N58 A;  1FCL A;  2N7J A;  5FKA C;  5C3J B;  4WWO A;  1JRO A;  1VJK A;  1K51 A;  1YNT E;  3AE4 B;  4XGA B;  3PV1 A;  4ANV A;  3W9C B;  3RI7 C;  4B95 A;  3FKY A;  4C00 A;  4JWS C;  2BQQ A;  1EU4 A;  1N62 A;  3UIP B;  2J0K A;  4A20 A;  2LUE A;  3EUB 2;  3M95 A;  5FK9 C;  4GDK B;  2KFJ A;  4KV2 A;  1WRI A;  1HE8 A;  1CMX B;  3AV8 A;  2KTR A;  4GB9 A;  2I2Y A;  2KMC A;  2QDF A;  5JZE B;  2LI5 A;  4ANX A;  4HWI B;  4DHJ B;  4I6N B;  2XNA C;  2D3A A;  3L08 A;  1HTQ A;  1RYJ A;  4ACF A;  2I1J A;  1WMH B;  2MBQ A;  3H7P B;  3GE8 C;  1UBQ A;  3DBL B;  2AQ3 B;  1UEL A;  4I6P A;  2KWV B;  2AX5 A;  1IP9 A;  3VTU A;  4WQO B;  3PZ8 A;  3RD2 A;  3U4E G;  1PDX A;  2ZW1 A;  1I4R A;  4HPM B;  1FRR A;  3ZNH B;  2Q5W D;  3A9J A;  4A55 A;  3DVG Y;  4HEA 1;  4NJ7 A;  1I4X A;  2KDI A;  3K9O B;  5HKH A;  3BYT B;  1LXD A;  1P3Q U;  1E6E B;  1MG8 A;  4BAX A;  1WJ6 A;  2N1W A;  3PRZ A;  1SBB B;  4FN2 A;  1C9F A;  1NYR A;  1F0Z A;  1YQ3 B;  1MHX A;  1K52 A;  2M8S A;  4BKS A;  2L7R A;  3KH0 A;  2ACZ B;  4FBJ B;  2SAK A;  2LGS A;  1LM8 B;  5G5G A;  2J52 A;  2CJN A;  1J8C A;  1V6E A;  4RGT A;  4TKN A;  1R4M B;  3RCZ A;  4JLC A;  2QIE B;  4DHJ D;  4KGS A;  4KZC A;  4B0M A;  1WR6 E;  3ZXR A;  3NJT A;  1V8C A;  1AN8 A;  4XDC A;  2MBE A;  3APC A;  2IO1 B;  2WXF A;  3ZNI D;  1IUE A;  1JCK B;  3Q69 A;  3L13 A;  4IC7 B;  3HK0 A;  2V0G A;  1EO6 A;  1L7Y A;  1GUA B;  3E9S A;  4LNI A;  1QF6 A;  3NZ3 A;  4MGI E;  2DHZ A;  1T0S C;  2NMQ A;  3I57 A;  4NQL B;  2WXO A;  3AB5 A;  1V81 A;  2DBY A;  3JSV B;  1WSP A;  3H1U A;  2UYZ B;  2D3G A;  1KRH A;  2RDB C;  4WJP A;  4PK1 A;  1VZ7 A;  3KUZ A;  1C4C A;  1N60 A;  4MM3 B;  3RUL A;  5IN7 A;  1L6U A;  2MP2 B;  2BF8 B;  5G55 A;  2WDT B;  3Q3J A;  2KT7 A;  2XK5 A;  4NJC A;  3FIL B;  3Q6B A;  3U7D A;  1N6Z A;  1YOV B;  1ZXI A;  1VR9 A;  2LVP A;  4RFB A;  1UH6 A;  1AWD A;  4N9F 4;  2IJ0 A;  5DPR A;  3ZO5 B;  2WGS A;  2K6Q A;  3JVZ X;  1LQB A;  2ZEQ A;  3O65 B;  2BB6 A;  1WX7 A;  2KDB A;  3M3J A;  3JW0 X;  2K9X A;  2DYM A;  4OVU A;  2E3T A;  2UWQ A;  3PLU A;  2CHX A;  4QAY A;  1IBX B;  4ZYN A;  2KYW A;  4FJZ A;  1E8Z A;  3NHE B;  1WM2 A;  1STE A;  1YQ4 B;  1ZE3 D;  1V97 A;  4WWM A;  4C4V A;  4N59 A;  1YN4 A;  3EHV A;  1K8R B;  2BPS A;  2K8B A;  3HHM A;  4BBN F;  2ZVO A;  3QAR A;  4KIK A;  3VTW A;  1D4B A;  1VDV A;  3AI5 A;  2RD0 A;  3BY4 B;  4BOZ B;  3VDZ A;  4GMV A;  1SIJ A;  2DLB A;  4OZB A;  2JSV X;  3OJ4 B;  2FUG 1;  1YJ1 A;  1V1O A;  2B3A A;  2G3Q B;  2FNJ B;  3WAP A;  1FO4 A;  2L05 A;  2JRI B;  1RAX A;  4TQ1 A;  3V6C B;  2O2V B;  3TBL D;  2HJ8 A;  1ZGU B;  1WE7 A;  4MSM B;  3VRA B;  2BYT A;  4EE2 A;  2LD9 A;  4II3 B;  3Q8A A;  3RNB C;  1EM7 A;  1UF0 A;  3MTN B;  2ZZP B;  1CQV A;  1OTR B;  2JUO A;  2RDH A;  4RNA A;  2WXP A;  3N1Z C;  2C60 A;  1JWM D;  1WXA A;  4DDG D;  2L32 A;  4AJW A;  3IAM 1;  3HM6 X;  1GC6 A;  4P16 A;  3HIZ A;  2LGY A;  5IO9 A;  4KGR A;  3ZRC A;  5CX3 A;  1WGR A;  1AAR A;  1FNW A;  4RM8 A;  1SF0 A;  4YWG G;  2E6X A;  4NAM A;  3OLM D;  3K9P B;  5D7G A;  1V1P A;  1RLF A;  4ZRJ A;  1ESF A;  1UGJ A;  2G1E A;  5AZG A;  2KDE B;  3AE7 B;  1WF9 A;  3ZNG C;  5D6J B;  2JWU A;  3Q3O C;  1JWA D;  3E56 A;  4ARI A;  5L95 C;  2LWP A;  1EUV B;  2O6V A;  2PPH A;  1IGC A;  1XQQ A;  5BMI A;  3ZXV A;  1EF1 A;  1Q1O A;  5E6P A;  2KWD A;  2ZNV B;  1MPE A;  5FR3 A;  2KLC A;  4LNK A;  1X1M A;  3U8Z A;  2VH1 A;  3L0W B;  3NZS A;  1ZDX A;  2J0M A;  2WXJ A;  2MQJ A;  2MHJ A;  2Y5P A;  1F77 A;  3R7R A;  3M62 B;  1ZW7 A;  3GB1 A;  2BVC A;  3WAL A;  1T0Q C;  1KLU D;  2CHZ A;  3W5V B;  2X38 A;  1VZ8 A;  3AE6 B;  3KUC B;  2MX2 A;  4GIV A;  2INP E;  1L5P A;  4DQO C;  2BS2 B;  3CMM B;  4EFO A;  2FBW B;  2ONQ A;  1L2N A;  5J17 A;  1ISN A;  1PFD A;  3V6E B;  1A70 A;  1UGM A;  1J19 A;  1ENF A;  4FHJ A;  1D5M C;  5EE0 A;  3W1Y A;  1ZOY B;  2MH7 A;  4YT0 B;  2G4S A;  3P4R B;  2PTL A;  4HKZ E;  1Z2M A;  4ICV A;  2N9E B;  3RFZ B;  2N7E A;  2CR5 A;  3SU8 X;  1GOZ A;  1OQR A;  5BYS A;  1BML C;  1JRP A;  4RMA A;  4XDD A;  2IO2 B;  1UWX A;  3MHS D;  1D5X C;  2ZCB A;  5TR5 A;  3SFD B;  4GDK A;  3DHG C;  2EKE C;  4RH6 A;  2ZW0 A;  3BII D;  1N61 A;  4TSS A;  3KUD B;  1I42 A;  2DAJ A;  2KFK A;  3V61 A;  3AN1 A;  1WMH A;  2PVG C;  3AEA B;  3H7P A;  1VD2 A;  4HPL B;  2LGD A;  3VH4 B;  3X23 A;  2KXJ A;  1FMA D;  1JW9 D;  2K22 A;  5IKC M;  1JML A;  1TY0 A;  3L10 B;  3ZIM A;  1YN3 A;  3KQ4 A;  1MI0 A;  4L23 A;  2PE6 B;  3IAS 1;  2L1A A;  1RFA A;  1K50 A;  1R4M I;  2K8C A;  1SXT A;  2MLB A;  4IM0 A;  4KX6 B;  1WE6 A;  4REZ A;  3TUO A;  4F1S A;  3M63 B;  4ZOH C;  1WWT A;  2INN E;  4RGM A;  2NVU I;  3W1S A;  4ARC A;  3L4P A;  5EE9 A;  5D3D A;  1V2Y A;  3RNE C;  3S2A A;  4IM2 A;  1B1Z A;  4AUQ C;  3RUI B;  4EKU A;  4PT5 A;  2BS3 B;  3WAM A;  1WGG A;  1QQR A;  3T3N A;  3RZF A;  2NTT A;  3ECI A;  4E71 A;  3BYY B;  2KQ4 X;  1U4A A;  4GN1 A;  3VH3 B;  3I9V 1;  2PW9 A;  1NEK B;  4US8 A;  1FRD A;  1TGZ B;  4W9I A;  3A1Q A;  2WXM A;  4AJY B;  4ZRP A;  3ZDM C;  2JT4 B;  3AE2 B;  1TS5 A;  4WIP A;  1I4G A;  1FD6 A;  2WXQ A;  2PMV A;  4ANW A;  1GB1 A;  5TSS A;  2DZJ A;  1PGB A;  1WGK A;  3NVZ A;  2WP9 B;  4MH8 A;  2HJ1 A;  4ZHP A;  1L4D B;  2RR9 A;  4HK2 A;  5T8I A;  2KVZ A;  2JF5 A;  2C7N B;  2IGG A;  2GBN A;  4MM3 A;  1YN5 A;  2MP2 A;  1M94 A;  3TSS A;  2NPT B;  3APD A;  4GDL B;  5D94 A;  1J7B A;  1P0R A;  2N4F A;  2IND C;  4F7Z A;  3KYD D;  2BTE A;  2KMM A;  2WXK A;  3FIL A;  4HPP A;  3A9K B;  3IBE A;  4EEW A;  1PGX A;  2WYQ A;  1TT5 B;  4FJY A;  3U30 A;  4ICU A;  1WXQ A;  1XF5 L;  1L0Y B;  2LJ5 A;  1CZP A;  1YX6 B;  3PT2 B;  4PS8 A;  1GG3 A;  5C2T B;  3VR9 B;  4MEL A;  1R7S A;  2ASQ A;  2BBC A;  2KDM A;  2QC8 A;  1J0G A;  4YL8 A;  4LNF A;  3IHP C;  4USA A;  3QK0 A;  2MSE D;  2XN9 C;  1UNS A;  2MWS B;  1IBX A;  3LJ3 A;  3DBR B;  3PRM B;  3ENE A;  3AU5 A;  1ZDV A;  2XBB C;  1SE3 A;  2K1F A;  3PGE A;  2UU7 A;  4M8N A;  2PE9 A;  1YD8 U;  4EOY A;  1NVI D;  4EZL A;  4WAA A;  1MG4 A;  1V86 A;  1WYG A;  2AWT A;  4FXC A;  1HXY D;  4S0R A;  2KZR A;  3V62 A;  4PYU A;  3B08 A;  4GLS C;  5BYQ A;  4AQ7 A;  1KJT A;  4W9G A;  4G11 A;  1VRA B;  3UQA A;  2WQY B;  1R4N B;  3AMZ A;  4OZA A;  2V1Y A;  4GOC A;  4KKJ A;  2Z8L A;  3I63 C;  3I3T B;  2L0T A;  4LTU A;  5J18 A;  2JRH A;  3P63 A;  1DGJ A;  1E8W A;  4NAW B;  4HCN B;  1HA5 A;  2KDF B;  3H9D A;  2C5L C;  4KKI A;  2OHF A;  1T5X D;  5D3I B;  4A3P A;  2OJR A;  5E6N A;  1ET9 A;  4HCP B;  2W82 A;  4BVU C;  1SE9 A;  2RMM A;  4HVB A;  2GLS A;  2BYF A;  2WXR A;  1P7E A;  3HVD A;  1MHH E;  3URY A;  2PKO A;  2OJW A;  4URK A;  4KDL B;  4NNJ B;  4R3D A;  3UI3 A;  1XCQ L;  1SE2 A;  2BWF A;  4P6V F;  2HD5 B;  1EWY C;  3SDL C;  4HJG E;  1E0Z A;  2IO3 B;  5AUI A;  4YSY B;  3O13 A;  2Z59 B;  4GSW A;  5J2R A;  2PEA A;  4M8M A;  2D3C A;  4YTM B;  1F9J A;  3HUI A;  2HTH A;  1TTN A;  4DK5 A;  5DCN A;  1NEN B;  2BKF A;  1XCT L;  3EFC A;  4IW0 A;  4LNO A;  3UF8 A;  1WJ4 A;  2YLM A;  2JX5 A;  1Y56 A;  3U7Z A;  2KN4 A;  4OW0 A;  5LLI A;  2JZP A;  1JWU D;  4W9D A;  2NBV B;  5LXH A;  4HXD A;  1IPG A;  1J7C A;  4UDU C;  4DXG A;  2IO0 B;  3SFE B;  4XC2 A;  4BFR A;  3H7S A;  3EEC A;  1FNV A;  1XEE A;  2D11 A;  4TUU A;  3P2B A;  2W9N A;  3N30 A;  5FR6 A;  1E7P B;  1Q10 A;  3KWV A;  3AXC A;  1YX5 B;  1XLO A;  3V3X A;  1N5W A;  1WZ3 A;  4IKG A;  5AZH A;  2FUH B;  3BVM A;  3J9C A;  3W1S C;  4ITK A;  4WJO A;  4G50 A;  2BYV E;  4HKQ A;  3NUH B;  5E6O A;  3ZRF A;  4DWF A;  3VHT C;  3NG0 A;  2AYO B;  1ZKH A;  2W3R A;  1IYF A;  1E7U A;  4IM3 A;  4M0W A;  3R8B A;  2LJI A;  1LFD A;  1C3T A;  3AE5 B;  1WYW B;  3C19 A;  1S3S G;  3UGB B;  1GPX A;  3QJZ A;  1WXV A;  2PVO D;  1XLQ A;  2WNM A;  4XZ4 A;  2TSS A;  4MAC A;  4P1C C;  4YXD B;  2IBI B;  4JGH B;  2N1V A;  4RF1 A;  1S1Q B;  3PTF C;  5EE3 A;  2IY0 B;  2KJR A;  4JE3 B;  2K0P A;  4W9J A;  1FFV A;  4JWU C;  3PVL A;  2EKI A;  1E10 A;  2YEP F;  2V4I B;  1VCB A;  3TEW A;  1HEZ E;  2FCQ A;  4A3O A;  3B2G A;  2AL6 A;  3NS1 A;  4LJP B;  4A6Q A;  3OG5 A;  3CWI A;  3DOW A;  4M01 A;  3TEY A;  2WXG A;  3KLS X;  4PS3 A;  4MT5 A;  3RNF C;  1WGH A;  4IG7 B;  4A90 A;  3HVZ A;  2J42 A;  2V4L A;  2DZK A;  3T9L A;  4PYZ A;  3BWU D;  2Y3A A;  1JQ4 A;  1N63 A;  3FC4 A;  3WIM A;  2WU5 B;  3IFW B;  4MSQ B;  4X57 B;  4W9H A;  1KLG D;  2ICI A;  4BZA A;  1FNU A;  4CYE A;  3DWM A;  5C23 A;  1ZUD 2;  4YSZ B;  2YVC A;  4C80 A;  1OEY J;  1KM7 A;  2A5U A;  3Q8E A;  2B76 B;  4HJK A;  3ZTD A;  2J7Q B;  4ZHO A;  3PZ7 A;  3L17 A;  3Q3N C;  4NY0 A;  5AUK A;  1WGD A;  3VFK A;  5DPT A;  1GAQ B;  3AUL A;  2MJ3 A;  2D2Q A;  1AW7 A;  2ZVN A;  2GBJ A;  3PS6 A;  2KD0 A;  3AE1 B;  2IYD B;  2N9P C;  2CHW A;  1N5X A;  3DBH I;  3AH7 A;  4OHJ A;  3TCA A;  1ZPS A;  2IZV B;  2BWE S;  2KWC A;  3GZN B;  1C4A A;  2DZM A;  4J6I A;  1XLP A;  4IDI A;  4BKS D;  1EWC A;  4IUM B;  3MP9 A;  1OQY A;  2PIA A;  1YJI A;  1OEY A;  3A4S C;  2XEW A;  4W9C A;  5JHB A;  1FEH A;  2NPT A;  1H8C A;  4GDL A;  1T0R C;  3ZNZ B;  4II2 B;  1FM0 D;  2LVQ A;  1I4H A;  2LXA A;  3C8Y A;  3A9K A;  4GU2 A;  5GMV A;  2FIF A;  2LXC A;  5LXI B;  3R2I A;  5EDS A;  3NVY A;  2JZZ A;  2C7H A;  3APF A;  4LLG M;  2K8H A;  3V60 A;  2WDR B;  3Q14 C;  1I4P A;  1MJD A;  3ZW3 A;  3OWE B;  3RMK C;  1IGD A;  4GXB A;  4RM9 A;  3DBL I;  2KQ7 A;  2C7M B;  1P9D U;  3TIX A;  1XXG A;  1ACC A;  4EZK A;  2JQR B;  2M0X A;  2QSD A;  1MVK A;  3Q8C A;  4HDO A;  2VZK B;  4KIK B;  4WUR A;  3P1M A;  3GOE A;  1EU3 A;  2IY1 B;  1Q0W B;  2WXN A;  3IT6 B;  3ONS A;  2ZNV C;  4TMA B;  1SJE D;  2N0S B;  1WZ0 A;  1NI2 A;  3IT4 B;  2GMI C;  1V49 A;  4B9K A;  3L54 A;  3DBS A;  1B9R A;  3ML9 A;  1DOY A;  2C9W B;  3TEZ A;  4TQ0 A;  1XD3 B;  2G45 B;  3AE8 B;  1UD7 A;  4NAW A;  1TZO A;  2WX1 A;  2WHI A;  3B0A A;  2A4Z A;  5BMH A;  3DQV A;  4XWT A;  2DEN B;  4DDI D;  1GC7 A;  2MJD A;  4RGO S;  2MCN B;  2YEP B;  4BKT A;  1XT9 B;  4RGN A;  2VZK D;  3B9J A;  1QKZ A;  3QQ8 B;  1P98 A;  3QAQ A;  2RGF A;  3TMP B;  3Q3M C;  3H8H A;  1QT9 A;  5AEK B;  2QCZ A;  3VTV A;  3IVF A;  3QA8 A;  3RNC C;  1QZE A;  4AWJ A;  4E74 A;  3BVZ A;  1M4V A;  3RYT A;  5HFY A;  3LYY A;  4LK0 M;  3DCG A;  2GB1 A;  4C7Y A;  5KHO A;  2PJH A;  3ZYY X;  3DVN U;  3WAO A;  3PRP B;  3B2F A;  4W9F A;  1HTO A;  2CU3 A;  3AEE B;  3RNA C;  2V3N A;  1WH3 A;  3X0W A;  1L0X B;  3PHW B;  4W9K A;  2K5P A;  3BVG A;  2EEL A;  5DPW A;  1I4Q A;  2MEK A;  3IXS A;  3W5U B;  2O6V B;  2JXX A;  1TS2 A;  3MC9 A;  4DXF A;  3EC8 A;  3JSV A;  3N32 A;  1TY2 A;  4MGZ E;  4AS1 A;  3DHI C;  1GNU A;  3V05 A;  1WY8 A;  2IGD A;  4BBN C;  1C77 A;  4O1N A;  3SD5 A;  1TS4 A;  3A4R A;  4L2Y A;  3Q2A C;  1C76 A;  2D3B A;  1ZP0 B;  3RT3 B;  4B6W A;  2L76 A;  2K3U A;  2HE7 A;  2INC C;  1E5W A;  5L83 A;  3QHT A;  3PO0 A;  3WCQ A;  2G4D B;  4C7Z A;  1VZ6 A;  1KLV A;  2LMC A;  2KMA A;  3R66 C;  4WJQ A;  1HZ5 A;  1PGA A;  2RDG A;  3LDZ E;  2BT6 A;  2O6V D;  3AEB B;  1T0Y A;  2V3P A;  1KH0 A;  2K6D B;  1HZ6 A;  2M56 B;  2IPK D;  1YJJ A;  2LFI A;  2D07 B;  2RSU A;  2W54 A;  2R2Q A;  3AE9 B;  3ML8 A;  2FCS A;  3TJP A;  2MBO A;  1RWS A;  4K7S A;  2LZ6 A;  5CHW A;  2JPH A;  2NCN A;  4NQK E;  4IWO A;  3VR8 B;  2Z0D B;  3AEC B;  3ZUN A;  1F1H A;  2NBW B;  1QOF A;  2X8X X;  2GBK A;  3SEB A;  1UWM A;  3TL5 A;  4C56 C;  1PYW D;  3D32 A;  2BW2 A;  3R2T A;  5JH5 C;  2KFK B;  1WR1 A;  1E9M A;  2D5G A;  2QMT A;  4DXA B;  2DX5 B;  2KC1 A;  2O2V A;  3RPF C;  5AZF A;  2L8J A;  1TBE A;  3MFG A;  2WXH A;  4WJN A;  4WWN A;  2NTS A;  4ZRK A;  3VAW A;  3P4Q B;  2BYE A;  2VRR B;  4XE0 A;  2LGI A;  1DYQ A;  2ON8 A;  3PRE A;  3NOB A;  5JHA A;  3CF6 E;  4WAF A;  4MH0 E;  4KGT A;  5GXG B;  4NJ6 A;  2WX0 A;  3ETR A;  4IWP A;  3NRZ A;  3QIJ A;  3ZQ4 A;  4K1R B;  2DYB A;  5IAA C;  2M0A A;  3CST A;  2MW5 A;  3ZDT A;  1T3Q A;  4K81 A;  2JYE A;  3U52 E;  2GRI A;  1E8X A;  3QCA A;  5DPS A;  3LXF A;  3FAH A;  1NYQ A;  1TIF A;  4FLH A;  5BMG A;  4EUT A;  1Z5S B;  3MC0 B;  3ZJT A;  1YMH E;  2KK8 A;  4KVG B;  4KSL C;  1TS3 A;  4F8C B;  1E90 A;  2I1K A;  4PS7 A;  4HRO A;  2QIL A;  4Q2J A;  3GZN I;  5KHQ A;  3OJ3 A;  3ZJV A;  3ZGZ A;  3A1Q B;  1F2R I;  1SE4 A;  3QWZ B;  2JVC A;  2BS4 B;  5H8Y E;  4MGY E;  3SR6 A;  2LEK A;  2MRP A;  3EFU A;  3PLV A;  1KTK A;  1LO5 D;  1C79 A;  2ZCC A;  3PSE B;  4AP4 C;  4US9 A;  4CQN A;  2FCN A;  2M4N A;  2WWZ A;  1WFY A;  1P7F A;  4FUL A;  2KVR A;  1WRD B;  3UIN B;  1G6J A;  1XO3 A;  2I38 A;  1UUP A;  4H2A A;  2KAN A;  3WAN A;  4MJS B;  2ZPY A;  2D10 A;  4DHZ B;  1FCC C;  3NZU A;  2LHE A;  4KSK C;  4XWW A;  2Y5C A;  2Y5B B;  1TZ1 A;  1UZX B;  1C78 A;  2GBR A;  3RZW C;  4W9E A;  2VH2 A;  4HRS A;  2KKC A;  1PQS A;  4FJV B;  1QLB B;  1WIA A;  2EMS A;  3JYU A;  1WJU A;  2W55 A;  4N6E B;  2L83 A;  2CS4 A;  1GB4 A;  1D5Z C;  2M1M A;  2OED A;  1NI3 A;  2KAJ A;  3N3K B;  2MA9 B;  3VUW A;  2DAF A;  2HDE A;  5IA7 A;  2LHD A;  2H88 B;  2J53 A;  3P42 A;  5CHF A;  3MC8 A;  2K39 A;  3AE3 B;  3ZLZ A;  3IG3 A;  2LGX A;  1D6E C;  1NBF C;  4G3X B;  2JYT A;  1WX9 A;  2KJ6 A;  3N1X C;  2KTR B;  3W2D A;  3P4S B;  3SHQ A;  3A33 B;  1WXM A;  3ABV B;  4GGQ A;  3RNG C;  2NBU A;  2W3S A;  1SB3 C;  1A5R A;  3GP7 A;  5H92 C;  2WU2 B;  3AU4 A;  2REX A;  1SGH A;  2OOB B;  4M02 A;  3ZTC A;  1JWB D;  1GJZ A;  3A9J B;  4LJO B;  4ZYS A;  2MBB B;  5CTR C;  4LNN A;  4D2K A;  1QOB A;  4WWP A;  2M17 A;  5HI1 A;  1BUI C;  1WJN A;  2KHW B;  2KLG A;  1WI0 A;  1I35 A;  2GI9 A;  1V9J A;  2GBM A;  3ZVV A;  3B1L X;  2FAZ A;  3R3M A;  1ZXH A;  2KX0 A;  1TKE A;  2JU6 X;  3PPA A;  2FID A;  2KN5 A;  1ROE A;  4S17 A;  1K53 A;  2MBH A;  1KOT A;  1SJH D;  2KOX A;  1OGW A;  1ET6 A;  4WQM A;  2WDV B;  1YQB A;  2AQ2 B;  4JL9 A;  2WS3 B;  3AM9 A;  4A8X C;  2DWQ A;  2JZ3 B;  3MJW A;  3MHZ A;  2JWZ A;  2G9H D;  1P1A A;  2DZI A;  5E6J A;  1L6V A;  1NDD A;  1RM6 C;  1RFK A;  2NS5 A;  4DBG A;  2LRU A;  2MJE A;  3Q8F A;  4XX5 A;  3PZD A;  4OVZ A;  2M19 A;  4JX1 C;  2DYO A;  4FA6 A;  1SIF A;  3VUX A;  1TKG A;  4LCD E;  1L0V B;  3KVF B;  4IWQ A;  5C1Z A;  1E7V A;  2GOW A;  2KTF A;  3CIR B;  4ZRI A;  4KZ0 A;  3VRB B;  1TYG B;  3NS8 A;  2KQS A;  1DOI A;  1MFW A;  3TEX A;  4P1B C;  2WDQ B;  2L0F A;  3T8M A;  4FAD A;  3AEF B;  4J3O D;  2BB5 A;  1E8Y A;  1LGR A;  1T6B X;  2N7D A;  3AEG B;  3ZJU A;  1KF6 B;  3QX1 A;  1F52 A;  2QEJ C;  5CHV C;  4YSX B;  3OAW A;  2LAS A;  3DVN V;  3PHX B;  2XK5 B;  3H6N A;  1SEB D;  4JQW C;  3DBR I;  1FFU A;  4KDI C;  3Q3F A;  4TV3 A;  1TJE A;  2V9H A;  2RPQ A;  3NVV A;  5IP4 D;  3HM3 A;  1HQR D;  4OZC A; 
#chains in the Genus database with same CATH homology
 4OZB A;  2JSV X;  1MHH E;  3URY A;  2PKO A;  2FUG 1;  1VLB A;  1V1O A;  3HRD D;  1TY2 A;  4RF0 A;  2FE8 A;  4R3D A;  3UI3 A;  1FO4 A;  1XCQ L;  4AS1 A;  1SE2 A;  4P6V F;  1EWY C;  4HJG E;  4TQ1 A;  1E0Z A;  1XLN A;  4NZL B;  5AUI A;  3V05 A;  1FIQ A;  1QOA A;  4YSY B;  2IGD A;  3O13 A;  1C77 A;  4O1N A;  1TS4 A;  5HHD G;  4L2Y A;  1JAL A;  2LUM A;  1PUT A;  4YTM B;  1C76 A;  3HUI A;  1ZP0 B;  1QIL A;  3N9Y C;  3VRA B;  2BYT A;  1NEN B;  4EE2 A;  1TKY A;  1XCT L;  2K3U A;  2AQ1 B;  4A9A A;  3BK2 A;  3Q8A A;  1DOX A;  1EM7 A;  1J7A A;  3BZD B;  2JX5 A;  3PO0 A;  1CQV A;  2RDH A;  3WCQ A;  4RNA A;  5HG2 A;  2WXP A;  4C7Z A;  1JWM D;  1VZ6 A;  2LMC A;  3MJ5 A;  1Y56 A;  3U7Z A;  2L32 A;  2KN4 A;  3IAM 1;  1HZ5 A;  1PGA A;  3AED B;  4P16 A;  1KFY B;  3VQI A;  2QJL A;  4KGR A;  1L4Z B;  4OW0 A;  2RDG A;  2BT6 A;  2JZP A;  1JWU D;  1FNW A;  3AEB B;  1SF0 A;  4YTN B;  4YWG G;  2E6X A;  4NAM A;  2L52 A;  1J7C A;  2V3P A;  4UDU C;  5G5H A;  1KH0 A;  4DXG A;  1HZ6 A;  2M56 B;  3SFE B;  2IPK D;  5D7G A;  1YJJ A;  1V1P A;  2LFI A;  1ESF A;  1UGJ A;  2G1E A;  2W54 A;  1F2R C;  1FNV A;  1XEE A;  3LB8 C;  3AE7 B;  3AE9 B;  1OFF A;  2N9L A;  3EGR A;  1RWS A;  1FXA A;  2JWU A;  2R61 A;  1E7P B;  1JWA D;  3E56 A;  1Q10 A;  3VR8 B;  3KWV A;  4ARI A;  2H89 B;  4JPS A;  3DWG C;  3AEC B;  1IGC A;  4RCO A;  1XLO A;  3V3X A;  4B0E A;  1QOF A;  1N5W A;  2WXL A;  3SEB A;  5BMI A;  1UWM A;  4IKG A;  3BK1 A;  2KWD A;  1FXI A;  3BVM A;  3J9C A;  4C56 C;  4ITK A;  1PYW D;  5EE1 A;  2BW2 A;  1MPE A;  3R2T A;  5FR3 A;  2WXI A;  1JWS D;  1E9M A;  1ZDX A;  4HKQ A;  2D5G A;  2QMT A;  3NUH B;  1AYF A;  3EA6 A;  2WXJ A;  3RPF C;  2Y5P A;  3MFG A;  1F77 A;  1V1P B;  2IGH A;  2WXH A;  3GB1 A;  1I7H A;  2NTS A;  3P4Q B;  1KLU D;  4YTP B;  4XE0 A;  2N9K A;  2LGI A;  1DYQ A;  2ON8 A;  4WH4 A;  2W3R A;  3GS2 A;  3W5V B;  2X38 A;  1VZ8 A;  3AE6 B;  4WAF A;  1SSN A;  4M0W A;  3R8B A;  2KAC A;  2LJI A;  2INP E;  1L5P A;  4KGT A;  5GXG B;  1QOG A;  1C4P A;  2BS2 B;  3AE5 B;  4ZRQ A;  4DQO C;  3ETR A;  2FBW B;  2PLP A;  1GPX A;  3NRZ A;  2ONQ A;  1PFD A;  2RPV A;  3ZQ4 A;  2PVO D;  1A70 A;  1XLQ A;  2WNM A;  3U2S C;  1ENF A;  2TSS A;  4MAC A;  4YXD B;  2IDY A;  1CK1 A;  1D5M C;  2M0A A;  5EE0 A;  5BYR A;  1T3Q A;  2JYE A;  5I4D A;  1ZOY B;  2MH7 A;  4YT0 B;  3P4R B;  3U52 E;  3Q8B A;  4RF1 A;  2GRI A;  2SEB D;  2JXT A;  2PTL A;  3LXF A;  3FAH A;  5EE3 A;  1NYQ A;  3P4P B;  5BMG A;  4HKZ E;  3MC0 B;  4JE3 B;  2K0P A;  5JXV A;  1FFV A;  4JWU C;  1BXT A;  3ZJT A;  1YMH E;  3RFZ B;  2EKI A;  3KWL A;  1E10 A;  2YEP F;  1TS3 A;  3T3O A;  2V4I B;  1GOZ A;  1OQR A;  3TEW A;  5MPO A;  4HRO A;  1HEZ E;  2QIL A;  4IOI E;  5BYS A;  1BML C;  2J4X A;  4Q2J A;  1JRP A;  2WLB A;  4XDD A;  3B2G A;  1UWX A;  3NS1 A;  4A6Q A;  3ZJV A;  1D5X C;  3SFD B;  3ZGZ A;  3CWI A;  3TEY A;  2WXG A;  1F2R I;  2CJO A;  1SE4 A;  3KLS X;  3NVW A;  4MT5 A;  2HTM E;  1OQQ A;  2BS4 B;  4RH6 A;  2ZW0 A;  5H8Y E;  5LNK 1;  3BII D;  4A90 A;  3SR6 A;  3HVZ A;  1N61 A;  2J42 A;  2LEK A;  4L1B A;  4TSS A;  1CJE A;  3BWU D;  2Y3A A;  1KTK A;  1LO5 D;  1C79 A;  1JQ4 A;  1N63 A;  3AN1 A;  3FC4 A;  4N58 A;  1FCL A;  2PVG C;  3AEA B;  2WU5 B;  4US9 A;  4CQN A;  1P7F A;  2N7J A;  1KLG D;  5FKA C;  5C3J B;  2ICI A;  1FNU A;  1FMA D;  1JW9 D;  3DWM A;  1JRO A;  2K22 A;  1XO3 A;  2I38 A;  1JML A;  1TY0 A;  1VJK A;  1YN3 A;  1UUP A;  1K51 A;  4H2A A;  1ZUD 2;  3KQ4 A;  4YSZ B;  1MI0 A;  4C80 A;  4L23 A;  3IAS 1;  2L1A A;  1YNT E;  3AE4 B;  1FCC C;  3W9C B;  3Q8E A;  1K50 A;  2B76 B;  4JWS C;  2LHE A;  4XWW A;  4ZHO A;  1EU4 A;  1N62 A;  2Y5C A;  3PZ7 A;  3EUB 2;  1SXT A;  5FK9 C;  4GDK B;  4KX6 B;  1WRI A;  5AUK A;  1C78 A;  3AV8 A;  4REZ A;  2I2Y A;  3TUO A;  1GAQ B;  4HRS A;  4ZOH C;  2MJ3 A;  2XNA C;  1WWT A;  1QLB B;  1AW7 A;  2INN E;  1RYJ A;  4RGM A;  3W1S A;  3AE1 B;  4ARC A;  2W55 A;  1N5X A;  3L4P A;  4N6E B;  5EE9 A;  2L83 A;  1GB4 A;  3AH7 A;  4OHJ A;  5D3D A;  1D5Z C;  1ZPS A;  2OED A;  1NI3 A;  2KAJ A;  2AQ3 B;  1C4A A;  2AX5 A;  1B1Z A;  3PZ8 A;  2HDE A;  2LHD A;  3U4E G;  4PT5 A;  2BS3 B;  1PDX A;  2ZW1 A;  1I4R A;  1XLP A;  4IDI A;  1FRR A;  2H88 B;  2J53 A;  1EWC A;  1QQR A;  3P42 A;  2Q5W D;  4A55 A;  3MP9 A;  3T3N A;  2NTT A;  2PIA A;  4HEA 1;  1I4X A;  3BYY B;  1YJI A;  3AE3 B;  2KQ4 X;  3BYT B;  3I9V 1;  1D6E C;  1FEH A;  2PW9 A;  1E6E B;  1NEK B;  4US8 A;  1FRD A;  2JYT A;  2WXM A;  1FM0 D;  1SBB B;  4ZRP A;  1I4H A;  1C9F A;  1NYR A;  3AE2 B;  1F0Z A;  3W2D A;  1TS5 A;  3P4S B;  4WIP A;  1I4G A;  3C8Y A;  1YQ3 B;  1FD6 A;  1MHX A;  2WXQ A;  2PMV A;  1K52 A;  3ABV B;  1GB1 A;  2W3S A;  1SB3 C;  5TSS A;  2ACZ B;  3GP7 A;  2SAK A;  1PGB A;  3R2I A;  5H92 C;  1WGK A;  5G5G A;  3NVZ A;  2J52 A;  2WP9 B;  2CJN A;  4MH8 A;  2WU2 B;  3NVY A;  4RGT A;  4LLG M;  4ZHP A;  1JWB D;  1L4D B;  2WDR B;  2QIE B;  5T8I A;  1I4P A;  4KGS A;  4ZYS A;  4B0M A;  3OWE B;  1IGD A;  4D2K A;  2IGG A;  1QOB A;  1V8C A;  1AN8 A;  4XDC A;  5HI1 A;  1BUI C;  1YN5 A;  3TSS A;  2WXF A;  1IUE A;  1JCK B;  4GDL B;  2GI9 A;  3Q69 A;  1J7B A;  2V0G A;  1ZXH A;  2BTE A;  2KMM A;  2WXK A;  1XXG A;  1ACC A;  2JQR B;  3FIL A;  1TKE A;  2JU6 X;  2QSD A;  1MVK A;  1ROE A;  3Q8C A;  3E9S A;  1K53 A;  1PGX A;  2VZK B;  4WUR A;  1SJH D;  1WXQ A;  1QF6 A;  1XF5 L;  3NZ3 A;  3P1M A;  1ET6 A;  4WQM A;  1L0Y B;  1CZP A;  1EU3 A;  2NMQ A;  5C2T B;  2WDV B;  3I57 A;  3VR9 B;  2WXO A;  2WXN A;  3AB5 A;  3IT6 B;  1R7S A;  2KDM A;  2AQ2 B;  2BBC A;  2DBY A;  4TMA B;  1WSP A;  1SJE D;  2N0S B;  2WS3 B;  3AM9 A;  4A8X C;  1KRH A;  2DWQ A;  3IT4 B;  4USA A;  3MHZ A;  1B9R A;  1VZ7 A;  2G9H D;  2XN9 C;  1DOY A;  1UNS A;  1C4C A;  1N60 A;  1IBX A;  4MM3 B;  3TEZ A;  5E6J A;  1L6U A;  1L6V A;  4TQ0 A;  1RM6 C;  3AE8 B;  1RFK A;  1TZO A;  1ZDV A;  1SE3 A;  2MJE A;  3Q8F A;  4OVZ A;  2M19 A;  4JX1 C;  2DYO A;  4NJC A;  3FIL B;  1ZXI A;  1TKG A;  1VR9 A;  4RFB A;  1L0V B;  1NVI D;  1AWD A;  5BMH A;  4XWT A;  2IJ0 A;  1WYG A;  4FXC A;  2MJD A;  1HXY D;  4RGO S;  2YEP B;  3CIR B;  3VRB B;  2BB6 A;  4RGN A;  4GLS C;  1TYG B;  5BYQ A;  4AQ7 A;  2K9X A;  2DYM A;  1VRA B;  1DOI A;  2WQY B;  2VZK D;  3B9J A;  2E3T A;  3AMZ A;  1QKZ A;  3TEX A;  4OZA A;  3H8H A;  2WDQ B;  4KKJ A;  1QT9 A;  2Z8L A;  3AEF B;  4J3O D;  2BB5 A;  1IBX B;  4LTU A;  1T6B X;  3ZJU A;  1DGJ A;  3AEG B;  3P63 A;  1KF6 B;  4NAW B;  2QEJ C;  1STE A;  3BVZ A;  1M4V A;  4YSX B;  1YQ4 B;  1ZE3 D;  1V97 A;  5HFY A;  4WWM A;  1HA5 A;  3LYY A;  4LK0 M;  2GB1 A;  4C7Y A;  4N59 A;  1YN4 A;  3ZYY X;  1SEB D;  4KKI A;  3B2F A;  2OHF A;  1T5X D;  5D3I B;  2CU3 A;  3AEE B;  1FFU A;  2V3N A;  1ET9 A;  1L0X B;  1TJE A;  1D4B A;  2K5P A;  1VDV A;  2EEL A;  3BVG A;  1I4Q A;  2MEK A;  3IXS A;  2W82 A;  3W5U B;  1SIJ A;  2DLB A;  2RMM A;  3NVV A;  1TS2 A;  4DXF A;  1HQR D;  4OZC A;  2WXR A;  1P7E A;  3HVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...