1UWMA

Reduced ferredoxin 6 from rhodobacter capsulatus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AKIIFIEHNGTRHEVEAKPGLTVMEAARDNGVPGIDADCGGACACSTCHAYVDPAWVDKLPKALPTETDMIDFAYEPNPATSRLTCQIKVTSLLDGLVVHLPEKQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a [2Fe-2S] Ferredoxin from Rhodobacter Capsulatus Likely Involved in Fe-S Cluster Biogenesis and Conformational Changes Observed Upon Reduction.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Electron transport
molecule keywords FERREDOXIN VI
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2004-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1uwmA00
3B9JA 3P4QB 3ABVB 1WXQA 1YQ4B 1FO4A 1PDXA 4US9A 4YTPB 1DOYA 3VRBB 1JQ4A 1OFFA 3AE8B 1VLBA 4N6EB 2MJEA 3AEFB 3L4PA 1TJEA 1EWYC 3B2FA 3P1MA 4FXCA 2OHFA 1L5PA 2PIAA 2WU2B 1N5XA 1TKYA 1NVID 1XLPA 3AB5A 3AE5B 3P4SB 5EE1A 2H89B 1ZP0B 3BIID 3HVZA 2KMMA 2MH7A 1L0VB 5GXGB 3AEEB 1XLQA 1XO3A 1YJIA 3AE9B 4C7YA 2AX5A 3AEDB 3W5VB 1RFKA 4YXDB 5EE9A 2H88B 1ZXIA 2WP9B 3AE3B 5H8YE 2Q5WD 2DBYA 2Y5CA 2PKOA 2WLBA 3DWGC 2MJ3A 3AV8A 4YSXB 2BS3B 1VDVA 5C3JB 3P4RB 3VR8B 3NVYA 3SR6A 1JRPA 5H92C 1E0ZA 3HUIA 1JROA 1AYFA 1F0ZA 4IDIA 1VJKA 1L6VA 2W54A 3NVVA 5AUKA 4JWUC 2BS2B 1WYGA 2N0SB 2E3TA 4JX1C 4LTUA 5C2TB 1N61A 2W3RA 2DWQA 1FRDA 1ROEA 1DOIA 3ETRA 3FAHA 1SIJA 1WWTA 3AE6B 1RWSA 3VRAB 5MPOA 1FFUA 1FFVA 4US8A 1NYRA 5EE0A 1J7AA 2K9XA 4JWSC 4KX6B 1GAQB 1XLOA 1GPXA 2L83A 3PO0A 4HRSA 3LB8C 1QF6A 3WCQA 1WRIA 2WQYB 2LEKA 1N62A 2WS3B 3AE2B 4WWMA 2WDQB 1A70A 3W9CB 2L52A 1NEKB 1KFYB 1QOBA 2PVOD 4N58A 2CU3A 1I7HA 3AE1B 1ZUD2 1FIQA 3NS1A 1FMAD 2WDVB 1FXAA 1QOAA 3ZYYX 3CWIA 3AEBB 3P63A 5EE3A 3RPFC 2MJDA 2WU5B 1TYGB 1N60A 3KWLA 3LXFA 3NVWA 1R7SA 4WQMA 5G5GA 3CIRB 2W3SA 1J7BA 1FM0D 4C7ZA 3HRDD 3SFEB 4HROA 1QOGA 1E10A 1DOXA 2M19A 4N59A 4YT0B 2JQRB 1KRHA 5AUIA 3AMZA 1JALA 1QT9A 1N63A 2FBWB 3VR9B 2CJNA 1E6EB 1KF6B 3P4PB 1TKEA 1SF0A 1RYJA 1UWMA 2PVGC 1QLBB 2K5PA 1WGKA 4C80A 1B9RA 3NVZA 3AN1A 1TKGA 1JWBD 2B76B 1IUEA 1T3QA 3DWMA 1J7CA 3AECB 4YSYB 2K22A 3AEAB 4P6VF 3NRZA 1PUTA 2JX5A 2G1EA 4ITKA 3W5UB 1L6UA 5G5HA 1PFDA 3FC4A 2QIEB 1CJEA 1DGJA 3AM9A 1N5WA 1V8CA 2M56B 1V97A 3AE4B 4ZHOA 1YQ3B 1NI3A 3EUB2 1OQQA 4YTMB 1E9MA 1JWAD 2CJOA 1RM6C 2KAJA 1ZOYB 2BT6A 3AEGB 2HTME 2WDRB 1CZPA 2BS4B 1OQRA 1YJJA 1QOFA 1AWDA 1NYQA 1FXIA 4ZOHC 1SB3C 2QJLA 3SFDB 1FRRA 3B2GA 2EKIA 4ZHPA 2ACZB 3AE7B 1NENB 1JW9D 4USAA 1E7PB 4YTNB 3AH7A 4A9AA 1XLNA 2W55A 4YSZB
chains in the Genus database with same CATH superfamily
2NBVB 4MM3B 2MWSB 3CSTA 1SGHA 1V6EA 1WGYA 5IKCM 5TSSA 2WDTB 3B2FA 4FXCA 2C7MB 3I63C 2GBNA 3HVZA 1V1OA 2K6QA 2KFKA 3ZLZA 3RNGC 2KMAA 4OHJA 3N30A 1SJED 1YX5B 5JZEB 4MH8A 1R4MB 4EEWA 2ZW0A 2JRIB 3FILB 2AQ2B 3VRAB 1ZW7A 4FHKA 4LNIA 2LI5A 4E71A 4JWSC 2KQSA 4GLSC 2HDEA 4KVGB 4M00A 4WIPA 3B1LX 2N9KA 4B9KA 1FIQA 3IAM1 5L95C 2VZKB 4ARIA 3P63A 4R3DA 2INNE 1WH3A 4MSQB 3ZJTA 1KLVA 4M8MA 2QHOA 2A5UA 2BQQA 1KRHA 3RULA 3OLMD 2L1AA 1RYJA 5AZGA 4BKSD 4C80A 4GDKA 3DWMA 5IOIA 4MEMA 2GBJA 4BOSC 3ZKJC 5AZHA 3LDZE 1PFDA 2L0TA 3FKYA 3Q69A 1WJNA 2GOWA 2L0FA 4HK2A 3AXCA 2KX0A 1GC7A 1JWAD 2KX3A 4MDKE 2HTME 4B0MA 4OZCA 2AYOB 3BK2A 2JWUA 1WGGA 1ZKHA 1GUAB 3R3MA 1EUVB 3DBHI 4GGQA 4TQ0A 4RM8A 1N6ZA 5LLIA 5GMVA 1AARA 1YQ4B 4G0NB 2IGGA 3ZXVA 4W9IA 1KOTA 2D10A 3AE5B 1N5XA 1K50A 5FK9C 1F1HA 3BIID 4XGAB 4DXAB 1HTOA 5D94A 1TZOA 3IHPC 2KMCA 1CQVA 2WX1A 4TV3A 3JSVA 2MSED 3NVYA 3KVFB 3RYTA 4IM0A 4FLHA 3HUIA 1D5ZC 3L17A 3AU4A 2NVUI 3AE6B 3RMKC 2IPKD 3ZNGC 1QF6A 4CHKA 1R4NI 3AE2B 2WDQB 4F8CB 1WYWB 2IGDA 5JH5C 3B08A 4FJZA 4ZRKA 1PGAA 3Q8CA 4BZAA 4PS8A 3AU5A 2KYWA 3CSFA 3H6NA 4PT5A 4A3PA 2CKHB 1MFWA 3R8BA 1E10A 1P3QU 2BKFA 3ZNZB 2K5PA 1WGKA 2K8HA 3NVZA 4KIKA 1Q0WB 3EFUA 3Q3MC 2J0KA 2UYZB 1PUTA 1UF0A 3IT6B 1Z2MA 2FAZA 2L7RA 1TS3A 3L16A 1WX8A 4MH0E 2Y3AA 5BMGA 1C4CA 2L76A 2GB1A 4ZHPA 3KW5B 4K3CA 3PSEB 4YSZB 4BFRA 1WM2A 1TTNA 1LQBA 3QCAA 1C4AA 3N1ZC 1J19A 1XT9B 4ARCA 2MBHA 3U30A 1WIAA 4NY0A 3WIMA 3TEYA 3UGBB 1IP9A 2LASA 1OTRB 3TJPA 3SD5A 4YSXB 4JGHB 2VH2A 4RMAA 4PS3A 1OGWA 2KFKB 3W1SC 4RFBA 4JX1C 2I1JA 4HKZE 3P2BA 2IBIB 1KLUD 4GDLA 2MW5A 3OAWA 3U7DA 2L83A 3PO0A 2M8SA 5D3IB 1MI0A 3Q3JA 2PPHA 4N58A 2BWES 5CHVC 2J4XA 2FUG1 1YD8U 3LXFA 3WAOA 1QQRA 2INDC 4WQMA 2D3AA 1XXGA 1ZDVA 2K0PA 4E74A 1RRBA 3DVNU 2DAJA 2N9EB 5CTRC 4YT0B 1F77A 3HK0A 3P4PB 3DBLI 4HLEA 2O6VA 3QIJA 3I9V1 2WXNA 2D3CA 3IXSA 3Q3FA 4ITKA 4NAMA 2PE6B 3URYA 3AE4B 1YQBA 1TS5A 2N1WA 1L7YA 1ZOYB 2BT6A 4AJYB 4I6NB 2WXHA 4LK0M 2QC8A 5AEKB 1SB3C 3B2GA 3U2SC 2LXAA 1WGDA 2RSUA 2QDFA 1WX9A 1XLNA 4DK5A 1Z5SB 4LDTB 1PDXA 4A8XC 3VH4B 2KACA 3QARA 4ANVA 4XWWA 2JXXA 5CX3A 1L5PA 2WU2B 4YTPB 1UH6A 4XWTA 3W5VB 5DPTA 2MRPA 1IBXA 4GB9A 3UIPB 4JL9A 4FBJB 4RGMA 3VTUA 2MJ3A 4FULA 4IWPA 3A1QB 2BF8B 4AS1A 4XDDA 2PLPA 4GMVA 2JF5A 3R7RA 1T0QC 2M0AA 2KLCA 1F9JA 3JSVB 3PZ7A 5EE0A 4HXDA 1XLOA 4BOZB 3LB8C 3CMMB 3A9JB 2WS3B 1T0YA 3QJZA 2CR5A 3DQVA 3W1YA 3EC8A 1VD2A 4W9FA 2KWVB 2NMQA 4P1CC 1N60A 3V05A 3PTFC 3VFKA 3RD2A 4C7ZA 4DXFA 3HRDD 3OJ3A 2A4ZA 3A9KB 3VR9B 4GIVA 2M1MA 2DENB 4GDKB 1B9RA 2KTRA 2W82A 4X57B 2BYTA 3DBSA 2RPQA 2Z59B 3VXWA 4FN2A 1YX6B 4XE0A 1E9MA 1LXDA 5T8IA 4KKJA 2K6DB 3RI7C 3A4SC 1NBFC 1NYQA 1FRRA 3A9JA 1E7VA 1NDDA 1I35A 4F7ZA 4RF0A 1CK1A 2JVCA 2XK5A 4AUQC 1DOYA 4DQOC 1WGHA 3RNBC 1TY2A 1NVID 2KANA 3VUXA 1C79A 2N7EA 4OVUA 2FCNA 3VTVA 1XLQA 1YJIA 4B0EA 4C7YA 3IVFA 1B1ZA 4BKGA 4YXDB 1HQRD 1SSNA 2LVOA 1OEYJ 2C9WB 1WMHA 1ZPSA 4M02A 2WXGA 3VVWB 4GN1A 3PREA 1L6VA 3R2IA 5KHOA 1LO5D 2V1YA 4RGTA 5MPOA 1EM7A 2LGIA 4LDTD 2K8CA 4P16A 4HDOA 3SU8X 1PYWD 4P7IA 3HIZA 4EE2A 2CHZA 1N62A 2V4IB 3KUZA 1WJ6A 2ON8A 4II2B 3H1UA 1I7HA 3Q8EA 1V1PA 3EFCA 4NZLB 1V9JA 4IW0A 4ACFA 1WX7A 1C78A 3N9YC 3BK1A 5HI1A 1IPGA 4WURA 1HTQA 3BZDB 2KN4A 1M94A 2KLGA 2MA9B 1QT9A 3Q8AA 4IG7B 4RF1A 4KIKB 2PEAA 2WX0A 3V6EB 4BBNC 3VDZA 1Q5WB 2LVQA 3ZTDA 1HXYD 2OEDA 4CO7A 5E6PA 2AL3A 3MHZA 1V97A 4QAYA 3PLUA 3Q8FA 4II3B 3RZFA 3V3XA 3ENEA 4LCDE 3TIXA 2IO1B 3GZNI 3AEGB 2WDRB 4HEA1 3Q6BA 2WXMA 3SEBA 1H8CA 1EF5A 3TEWA 3ZIMA 3OG5A 1V1PB 4IWOA 1G6JA 5HFYA 2MJEA 2MHJA 1UD7A 1BUIC 5DPSA 3V61A 1F52A 3P42A 2AX5A 4MM3A 5J2RA 2Q5WD 1EWCA 2Y5CA 1YJ1A 4W9DA 2PKOA 5C3JB 3L13A 2O2VB 3N1YC 1TY0A 2J0MA 1VJKA 4JWUC 1VCBA 3UQAA 3MC0B 2DWQA 5TR5A 1R4NB 1TIFA 3KQ4A 2D3GA 4IM3A 2YEPF 2J0JA 1HE8A 2LGSA 2Y5BB 4ANXA 1J0GA 1P0RA 4DDGD 2L52A 4DXGA 4TKNA 3IG3A 2HD5B 4BKTA 1FXAA 2K1FA 3RPFC 5EE3A 3VUWA 2C7HA 2BKRB 4IKGA 3DVGY 1I4HA 4TQ1A 2JQRB 3ZNHB 1FNVA 1E6EB 1FCCC 1UWMA 2TSSA 2HJ8A 3L10B 5DCNA 2LMCA 2KC2A 2JUOA 2G1EA 2J42A 3HM6X 3N32A 2K3UA 3N20C 2KT7A 1YQ3B 2L32A 4CQNA 3APCA 5CHFA 5I4DA 3DOWA 4ZOHC 1HA5A 1IYFA 1P7FA 2BYFA 1L4DB 1JW9D 3M3JA 1E7PB 1FXTB 1P7EA 2BYVE 3R2TA 1L0XB 1E8XA 1GB1A 2KNBA 3P4QB 1Y8RC 2V4LA 4IWQA 2KQ4X 2MLBA 5HKHA 3TEXA 3ZO5B 2ZJDA 3L4PA 2KDFB 1XF5L 5J18A 2D2QA 3EHVA 3P4SB 3V62A 2DAFA 3EGRA 4RM9A 4GSWA 1ACCA 5GXGB 3AEDB 4S0RA 2KTRB 1ZE3D 2DBYA 4XZ4A 2JYEA 1VDVA 2LGXA 4W9JA 2WXLA 2IO2B 4C4VA 4MSMB 2LGDA 3NVVA 4LTUA 5IA7A 4NPNA 1WWTA 4RGOS 3ZW3A 1ZGUB 1FPYA 1ET9A 1KH0A 3ZTCA 1TZ1A 3BYTB 3MHSD 2N1VA 2VZKD 3ML9A 1E5WA 2WXRA 4WJPA 2PVOD 4KSLC 3KYDD 1XCQL 1GG3A 4AJWA 5G5GA 2SAKA 4DDID 5D7GA 1WY8A 3QK0A 1J7BA 5L83A 3JW0X 4K7UA 1DYQA 2PE9A 1D5MC 1PGBA 4N59A 5AUIA 1N63A 1Y56A 2IJ0A 2ZCBA 1TGZB 2MX2A 1T3QA 3AECB 3AEAB 2KZRA 2FCQA 3W5UB 5D6JB 1DGJA 1WE7A 1H4RA 1MPEA 5BMHA 1V80A 1UWXA 1SE3A 4YTMB 2RR9A 4O1NA 2GBRA 4LNFA 3PHWB 2NBUA 4A9AA 2X38A 2OJWA 4OVVA 3Q14C 3GE3C 2Z0DB 2BYEA 1VLBA 2IO0B 4NQLB 1VZ7A 3UF8A 4NNJB 1WGRA 1E8ZA 2RDBC 2V9HA 4KDLB 3ZGZA 2RMMA 3DHIC 3R7QA 3P4RB 3DBRI 2R2OA 5H92C 2WXPA 1JROA 4TUUA 4A3OA 1K8RB 1FD6A 2B3AA 2E3TA 5IAAC 1N61A 3FAHA 2JY6A 2LHEA 1TS2A 2KK8A 3ZVVA 3E56A 4A90A 2D11A 2G9HD 1WRIA 4C4VB 1UELA 2LRUA 3I57A 3VUYA 2DZKA 1NEKB 4JQWC 2J53A 4RGNA 1L0YB 2CU3A 3MJWA 4KZ0A 4KGRA 3AI5A 2MJDA 1QILA 1R7SA 4Q2JA 2K39A 3QC8B 2WXFA 4EZKA 2GMIC 1JALA 2FBWB 1LM8B 2NCNA 4JPSA 3PRPB 1MHHE 4HVBA 4GU2A 4L2YA 1IUEA 4KDIC 4BKSA 4RCOA 3EA6A 3K9PB 1SBBB 2EKEC 4ZHOA 2NTTA 2N9PC 2L8JA 4B95A 1WXSA 2AEHA 1YNTE 4G3XB 1YJJA 4B6WA 1KTKA 5BO4B 4ZRIA 1NENB 4REZA 3PRMB 3KUDB 4PS7A 4ZYNA 4FHJA 2V3SA 2H89B 3I5JC 4AWJA 2DLBA 2FCMA 2KHWB 3AEEB 1XO3A 3PT2B 2OOBB 2H88B 5H8YE 4WJOA 4OVZA 5LXIB 4MGIE 2W9NA 1ESFA 4DWFA 4EOYA 1E0ZA 4W9HA 1GNUA 2ONQA 1WRDB 1FCLA 1FRDA 2KJHB 3MTNB 2JZ3B 4EUTA 3KLSX 4PK1A 1E8WA 3DHGC 3DBLB 5JXVA 2KWCA 3RNAC 2KVRA 1KFYB 1QOBA 2RPVA 3HM3A 3IBEA 4IC7B 3WAMA 1JWUD 3WANA 2FCSA 1QKZA 3KWLA 4M01A 3CIRB 1OEYA 4NQKE 2I2YA 1Q10A 4DHJD 3A33B 1TT5B 2DZJA 2KDBA 1UUPA 3H9DA 1KF6B 4LNOA 4NAWB 4NAWA 2GLSA 2DYBA 2B76B 3ZQ4A 2FUHB 2YEPB 1M4VA 4HDQA 4CYEA 1L6UA 2D5GA 2IY1B 4WQOB 4NJ7A 5C23A 1WI0A 2KAJA 1C4PA 1CZPA 1QOFA 2QJLA 2BB5A 2ACZB 1YIWA 2FIDA 3ABVB 1WXQA 4NJ6A 4RH6A 5D2MB 4HKQA 2BPSA 3P1MA 2GBKA 1T0RC 1XLPA 2CHXA 2QEJC 3NZ3A 1L0VB 3AE9B 2C5LC 2BGFA 4RNAA 5EE9A 4I6PA 4E3CA 1I4PA 2MBOA 2WLBA 4DBGA 3AV8A 4XYCA 2RD0A 3VR8B 1YMHE 1WXAA 2MBEA 2MP2A 2O6VB 3VTWA 1P9DU 4FA6A 3ZDTA 1WF9A 2WGSA 2LHDA 2LXCA 1LFDA 4MACA 2LVPA 1GPXA 3ML8A 2UWQA 2LRWA 3WCQA 2WQYB 1A70A 1RLFA 2NS5A 4D2KA 3SHQA 2V0GA 3NZSA 5G55A 3NHEB 2ASQA 2Y5PA 2DYMA 3ALBA 4LJPB 1QOAA 3PGEA 1E90A 3AEBB 1LGRA 3ZNID 3DPDA 4W9EA 2W3SA 1SE4A 3M95A 4ICUA 3SFEB 1DOXA 2MQJA 1V49A 3BYYB 1TKEA 2NBWB 3DVNV 3GZNB 1VR9A 2N7DA 1J7CA 3KYCD 4P6VF 1E7UA 4JE3B 1C77A 1HEZE 2QILA 3DBRB 5G5HA 1UBQA 3DVGX 2CS4A 2LZ6A 4MGYE 2C7NB 4M8NA 2CJOA 3CF6E 1V5OA 3DHHC 2BS4B 1I4GA 1WSPA 4DHJB 1AW7A 2OJRA 2FIFA 2L3ZA 2NPTB 3MJ5A 1WM3A 2BTEA 3PVLA 5FR3A 1PGXA 4KKIA 4ASWC 3AE8B 3NY5A 2XBBC 3IAS1 1R4MI 3K9OB 2BVCA 2LUEA 2XEWA 4K3BA 3C0RB 1ZP0B 3H7SA 3UQBA 1F2RC 3BINA 1UNSA 2KVZA 4ZRPA 1MG8A 2IDYA 3AE3B 4L1BA 2AWTA 2RDHA 2J7QB 1J8CA 1JRPA 1EO6A 1F0ZA 2LWPA 4IDIA 1SJHD 5AUKA 1WYGA 2DZIA 1FFUA 3ZRFA 2BBCA 4KX6B 1VZ8A 3UIOB 2LJ5A 5HG2A 4HCNB 1SIFA 2XNAC 4ANUA 4WWMA 2EMSA 4J3OD 2R2QA 1WXVA 1K52A 4XX5A 1YN4A 1ZUD2 3QA8A 4ANWA 5LXHA 2WDVB 1TS4A 4XDCA 1KM7A 3PLVA 2R61A 2WU5B 4AQ7A 3T3OA 3RUIB 5IN7A 4WAFA 3V6CB 2JU6X 1STEA 1F2RI 3PV1A 3O13A 4HJGE 1JWBD 2REXA 1QZEA 4YSYB 1D5XC 2N7JA 4MT5A 1V81A 4EKUA 3J9CA 1XEEA 4WJNA 1T0SC 3HHMA 4AOFA 3C19A 2KJRA 4YWGG 3S2AA 3RNFC 1KLGD 2M4NA 5EDSA 2EMTA 1OQRA 3WALA 3SFDB 1WE6A 1IGCA 3WAPA 2NTSA 2G4SA 1WXMA 1I42A 1BMLC 2BW2A 4UDUC 1TBEA 1L2NA 2IY0B 2IZVB 1EWYC 2DYOA 2N4FA 2OHFA 5EE1A 5JHBA 2JWZA 4HCPB 1IGDA 4EZJA 2AL6A 1RFKA 2M0XA 4NJCA 1UGJA 2VH1A 3PZDA 3U8ZA 4M0WA 4K81A 1PQSA 5G2NA 1ZDXA 2IO3B 1V2YA 3SR6A 3OJ4B 5C2TB 3ETRA 1GC6A 1ROEA 3VHTC 1FFVA 2KXJA 2RDGA 2KJ6A 5FKAC 1D3ZA 1P1AA 5HHDG 4LNKA 5BYQA 2M17A 3A4RA 1WMHB 4W9LA 3B0AA 1T5XD 1FMAD 2I1KA 3ZYYX 2Z8LA 1C76A 2KFJA 1YN5A 4OZAA 2L05A 4J6IA 1VZ6A 2JXTA 3AMZA 1GOZA 5BMIA 1XD3B 3VAWA 3TUOA 3Q2AC 1HZ6A 5IO9A 3N1XC 5DPWA 4AP4C 4KGSA 2K22A 3E9SA 4KV2A 2JX5A 5AZFA 2JRHA 1YN3A 3LYYA 2QIEB 1CJEA 3AM9A 3EUB2 4KGTA 4OW0A 3UI3A 3RT3B 4MJSA 2ZW1A 1AWDA 4LJOB 4MJSB 2GRIA 4MELA 3AH7A 2DZMA 2WNMA 2HE7A 2K8BA 3GE8C 3A9KA 2LD9A 1TJEA 3RFZB 4KSKC 2D07B 2PIAA 1D6EC 1S3SG 4TSSA 2G3QB 3NZUA 3DDCB 3FILA 4JIOU 3BWUD 3L08A 3QWZB 2KKCA 4TMAB 2PW9A 4A20A 1I4QA 5LNK1 2KN5A 3PZ8A 4HJKA 1XCTL 2W54A 4K1RB 2N0SB 3PPAA 5E6JA 4KZCA 2W3RA 2INCC 3TL5A 4WWNA 2WXIA 1KJTA 2BWFA 3GS2A 5BYSA 1EU3A 4EFOA 4C00A 2J52A 2MCNB 3W9CB 4C56C 4ZRQA 1RAXA 4URKA 3O65B 3T3NA 1WFYA 3NS8A 1JRUA 1K53A 5J17A 3CWIA 2V3NA 3APDA 3BY4B 4A55A 3UINB 3U52E 4GDLB 1FM0D 3APFA 3A1QA 2SEBD 1NI2A 2CHWA 1SF0A 2PVGC 1QLBB 2KWDA 3GB1A 2ZEQA 1MVKA 2LFIA 2CU1A 1D4BA 2V3PA 4IM2A 3RNEC 2YLMA 3RCZA 2XK5B 4A6QA 4S17A 1FNUA 3FC4A 4WWPA 4ZRJA 2M56B 4F1SA 1OQQA 3W2DA 3H8HA 4K7SA 2D3BA 4ZDVA 4HPPA 4FJVB 2G4DB 2EKIA 3JYUA 3MFGA 3TMPB 1BT0A 3L54A 3B9JA 4IOIE 1FO4A 2QCZA 1OFFA 4N6EB 2MBQA 2K25A 1HZ5A 2ZVOA 3ZDMC 1SEBD 2WXOA 1WJUA 3TSSA 2MH7A 3GP7A 2E6XA 2MEKA 2X8XX 2ZNVB 3JVZX 3U4EG 2WYQA 1ISNA 1JMLA 2NR2A 3X0WA 2HJ1A 1SE2A 1WR6E 1AN8A 3AULA 4LNNA 2PTLA 3DCGA 3QHTA 1SIJA 2KDMA 4WWOA 3ZXRA 1NYRA 4WJQA 1JWSD 3VH3B 3BVZA 3SDLC 2IYDB 3OWEB 3BVGA 4MGZE 1WZ3A 1TYGB 3NVWA 3D32A 3TCAA 2JZPA 2ZVNA 2HTHA 1FEHA 4W9GA 3IT4B 1MG4A 2FNJB 4W9CA 1C1YB 4M0WB 5C1ZA 1C9FA 3AN1A 4HPMB 2ZZPB 4DHZE 2C60A 1YOVB 2MBBB 3KH0A 5CHWA 4P1BC 3TBLD 1EF1A 1WR1A 2WWZA 1I4XA 2ZPNA 3LJ3A 5E6NA 3TEZA 2GBMA 3Q8BA 2L00B 2RGFA 2QMTA 1FXIA 3Q3OC 2QSDA 3MC9A 1SE9A 4USAA 3ZRCA 1WZ0A 2W55A 4HPLB 4DHZB 3VRBB 4IUMB 1JQ4A 2INPE 3AEFB 2ICIA 2FE8A 3DBHB 3AB5A 2DHZA 3ZJUA 2VRRB 4H2AA 3C8YA 2EELA 1L4ZB 1T6BX 2KTFA 3H7PB 5FR6A 2AQ3B 2DX5B 3T9LA 4FJYA 3IFWB 1RFAA 1EU4A 2Z0EB 1I4RA 2JPHA 1UZXB 3PS6A 2ZCCA 1DOIA 1FNWA 1OQYA 1UBIA 1RWSA 3RNCC 4US8A 4OZBA 1GAQB 3U7ZA 2WHIA 4BVUC 3KWVA 4BBNF 3Q3NC 1Q1OA 2GI9A 2PMVA 1JCKB 3ZJVA 3L0WB 1S1QB 2I38A 2YVCA 3AE1B 2KOXA 2JSVX 3NS1A 4ZYSA 3RZWC 4HWIB 5E6OA 2ZNVC 4MGKE 2LGYA 3W1SA 3NUHB 2WXQA 3R66C 1QOGA 2O2VA 4XC2A 1SXTA 2KWUB 2XN9C 2JT4B 3EECA 4YL8A 1TKGA 5D3DA 1ENFA 2KDIA 5DPRA 4ICVA 3X23A 4FADA 3BVMA 1P98A 1N5WA 1CMXB 2IGHA 1NI3A 2WXJA 5IP4D 1RM6C 3NG0A 3GOEA 3RN9C 1GJZA 4I6LB 1MJDA 3PRZA 4YTNB 3MC8A 1E8YA 3ECIA 2UU7A 1MHXA 4US9A 4JLCA 5JHAA 2LJIA 4EZLA 2BB6A 1TKYA 3PHXB 4N9F4 2KMMA 4PYZA 1ZXHA 4L23A 3ZUNA 2WP9B 1ZXIA 3V60A 1ET6A 1GB4A 3DWGC 2BS3B 4GOCA 2O6VD 2KC1A 2N9XA 1AYFA 1C3TA 3N3KB 3NJTA 2BS2B 3WA0A 3H7PA 1JWMD 4BAXA 1J7AA 2K9XA 4HRSA 1VRAB 4G11A 2LEKA 2DNFA 1WJ4A 2KO3A 2N9LA 3QAQA 4K7WA 3NOBA 2KD0A 5BYRA 2PJHA 4LLGM 3HVDA 3QX1A 1XQQA 2G45B 1BXTA 3M63B 1IBXB 3KUCB 3I3TB 3T8MA 1V5TA 4HROA 2JZZA 2M19A 4PYUA 5KHQA 1UGMA 2CJNA 3ONSA 1K51A 3VQIA 4G50A 2NPTA 1U4AA 3M62B 4WAAA 3NRZA 1A5RA 1V8CA 2KQ7A 4W9KA 2WXKA 4WH4A 4GXBA 2MP2B 2AQ1B 3MP9A 2ZPYA 1X1MA 3QQ8B 1V86A 3AE7B 2JYTA 2KDEB 2LUMA
chains in the Genus database with same CATH topology
1DOYA 4MM3B 4DQOC 5TSSA 1TJEA 1TY2A 3B2FA 3RFZB 4FXCA 2PIAA 1D6EC 1NVID 4TSSA 2H89B 3HVZA 3FILA 2DLBA 1C79A 3BWUD 4B0EA 3AEEB 1XLQA 1XO3A 1YJIA 4C7YA 1B1ZA 1V1OA 4YXDB 1HQRD 4REZA 4TMAB 1SSNA 2H88B 2PW9A 4OHJA 5H8YE 1SJED 4OVZA 1I4QA 5LNK1 1ZPSA 2WXGA 4MH8A 1ESFA 2ZW0A 3PZ8A 1E0ZA 3FILB 1XCTL 1L6VA 2W54A 3R2IA 2AQ2B 2N0SB 1LO5D 2ONQA 4RGTA 2W3RA 5E6JA 1FCLA 1FRDA 5MPOA 2LGIA 1EM7A 3VRAB 2WXIA 4P16A 3KLSX 1PYWD 3GS2A 5BYSA 1EU3A 4JWSC 4GLSC 2J52A 4EE2A 2HDEA 1N62A 2V4IB 5JXVA 4WIPA 3W9CB 4C56C 2ON8A 4ZRQA 1KFYB 1QOBA 2N9KA 3T3NA 1I7HA 3Q8EA 1V1PA 1FIQA 2RPVA 3IAM1 1K53A 4NZLB 2VZKB 4ARIA 1JWUD 1C78A 3CWIA 3N9YC 2V3NA 3BK1A 3P63A 4R3DA 2INNE 1QKZA 5HI1A 3KWLA 4WURA 4A55A 3CIRB 3U52E 3BZDB 4GDLB 1FM0D 2I2YA 1Q10A 3ZJTA 2KN4A 2SEBD 1KRHA 1QT9A 1UUPA 3Q8AA 1KF6B 4NAWB 2L1AA 1SF0A 1RYJA 2PVGC 1QLBB 4RF1A 2KWDA 3GB1A 4C80A 1MVKA 2LFIA 1D4BA 2B76B 3ZQ4A 3DWMA 2V3PA 2YEPB 4A6QA 1M4VA 1HXYD 1L6UA 2D5GA 1FNUA 2OEDA 1PFDA 3FC4A 3Q69A 3MHZA 2M56B 1V97A 3Q8FA 1OQQA 3W2DA 3V3XA 1JWAD 2KAJA 3AEGB 3H8HA 2HTME 4B0MA 1C4PA 4OZCA 2WDRB 4HEA1 1CZPA 1QOFA 3BK2A 2JWUA 2QJLA 2BB5A 2WXMA 3SEBA 2EKIA 3MFGA 2ACZB 4TQ0A 3TEWA 3B9JA 4IOIE 1V1PB 1WXQA 1YQ4B 3ABVB 1FO4A 4RH6A 2IGGA 5HFYA 1OFFA 4N6EB 2MJEA 4HKQA 3P1MA 1HZ5A 3AE5B 1N5XA 1XLPA 1SEBD 1K50A 2QEJC 5FK9C 1BUIC 2WXOA 3BIID 3NZ3A 3TSSA 2MH7A 1L0VB 3P42A 3AE9B 1TZOA 2AX5A 3GP7A 4RNAA 5EE9A 2E6XA 2MEKA 1I4PA 2Q5WD 1EWCA 3U4EG 2Y5CA 2PKOA 1CQVA 2WLBA 1JMLA 5C3JB 3AV8A 1SE2A 3VR8B 1AN8A 1YMHE 3NVYA 1TY0A 3HUIA 1D5ZC 1VJKA 4JWUC 2PTLA 3MC0B 2DWQA 1SIJA 2KDMA 2LHDA 3AE6B 4MACA 3KQ4A 2YEPF 2IPKD 1NYRA 1GPXA 1JWSD 1QF6A 3WCQA 2WQYB 3AE2B 2WDQB 1A70A 2L52A 4D2KA 2V0GA 3BVZA 4DXGA 2Y5PA 2IGDA 2DYMA 1FXAA 3OWEB 3BVGA 1QOAA 1PGAA 3Q8CA 3AEBB 3RPFC 5EE3A 4PT5A 1TYGB 3NVWA 2JZPA 2W3SA 1SE4A 4IKGA 3R8BA 3SFEB 1FEHA 1E10A 1DOXA 1I4HA 3IT4B 2JQRB 4TQ1A 1FNVA 3BYYB 1E6EB 1TKEA 1FCCC 1UWMA 2K5PA 2TSSA 1WGKA 1VR9A 3NVZA 1C9FA 3AN1A 1J7CA 2LMCA 4P6VF 4JE3B 1C77A 1PUTA 1HEZE 2QILA 2G1EA 2J42A 3IT6B 5G5HA 2K3UA 1TS3A 4CQNA 1YQ3B 2L32A 1I4XA 2CJOA 3TEZA 2Y3AA 3Q8BA 5BMGA 5I4DA 2BS4B 1I4GA 1C4CA 1WSPA 2QMTA 1AW7A 1FXIA 4ZOHC 1HA5A 2QSDA 2GB1A 1P7FA 4ZHPA 1L4DB 3MJ5A 1JW9D 4USAA 1E7PB 1P7EA 2BTEA 3R2TA 2W55A 4YSZB 5FR3A 1L0XB 1PGXA 1GB1A 3P4QB 4KKIA 2KQ4X 1C4AA 3TEXA 3VRBB 1JQ4A 2INPE 3AE8B 4ARCA 3AEFB 3L4PA 3IAS1 1XF5L 2ICIA 2FE8A 3AB5A 3P4SB 3EGRA 3ZJUA 3TEYA 1ZP0B 1F2RC 4H2AA 3C8YA 1ACCA 1UNSA 2EELA 5GXGB 1L4ZB 1T6BX 3AEDB 4ZRPA 2IDYA 2AQ3B 1ZE3D 3AE3B 2DBYA 4L1BA 2JYEA 4YSXB 1VDVA 2RDHA 1JRPA 2WXLA 1EU4A 1F0ZA 4IDIA 1SJHD 1I4RA 3NVVA 5AUKA 4RFBA 1WYGA 4LTUA 4JX1C 4HKZE 1DOIA 1FNWA 1WWTA 4RGOS 1RWSA 1FFUA 1KLUD 4US8A 2BBCA 4KX6B 4OZBA 1GAQB 3U7ZA 1ET9A 1VZ8A 2L83A 3KWVA 3PO0A 5D3IB 5HG2A 1KH0A 2XNAC 3BYTB 1MI0A 2GI9A 2PMVA 4WWMA 4J3OD 2VZKD 1JCKB 2WXRA 1K52A 3ZJVA 2PVOD 2I38A 4N58A 3AE1B 1YN4A 1ZUD2 2JSVX 1XCQL 3NS1A 2WDVB 1TS4A 2J4XA 4XDCA 4ZYSA 2FUG1 2R61A 2WU5B 4AQ7A 3LXFA 5G5GA 1QQRA 2SAKA 4WQMA 3W1SA 1XXGA 1ZDVA 2K0PA 5D7GA 3T3OA 3NUHB 1J7BA 2WXQA 1QOGA 1DYQA 4WAFA 2JU6X 1D5MC 1PGBA 1SXTA 4N59A 4YT0B 5AUIA 2XN9C 1N63A 1Y56A 1F77A 2IJ0A 3P4PB 1STEA 1F2RI 3I9V1 2WXNA 3O13A 1TKGA 1JWBD 4HJGE 1T3QA 5D3DA 3IXSA 3AECB 4YSYB 1ENFA 1D5XC 3AEAB 2N7JA 4MT5A 4ITKA 3W5UB 3J9CA 1XEEA 4NAMA 3BVMA 3URYA 1DGJA 2IGHA 1N5WA 1MPEA 3AE4B 5BMHA 1TS5A 1UWXA 1NI3A 1SE3A 4YTMB 2WXJA 4YWGG 1RM6C 1ZOYB 2BT6A 1KLGD 2WXHA 1OQRA 4LK0M 4O1NA 3SFDB 1SB3C 1IGCA 3B2GA 3U2SC 4A9AA 4YTNB 2X38A 1XLNA 2NTSA 1MHXA 1PDXA 4US9A 4A8XC 1BMLC 2BW2A 1VLBA 2KACA 4UDUC 4XWWA 1EWYC 2LJIA 2BB6A 1VZ7A 2DYOA 2OHFA 1L5PA 2WU2B 4YTPB 1TKYA 5EE1A 1IGDA 2KMMA 4XWTA 3W5VB 1RFKA 1ZXHA 4L23A 2WP9B 1ZXIA 3ZGZA 1IBXA 2RMMA 4NJCA 1UGJA 1ET6A 4RGMA 1GB4A 4M0WA 3DWGC 2MJ3A 2BS3B 3P4RB 3SR6A 1ZDXA 5H92C 2WXPA 1JROA 1AYFA 4AS1A 4XDDA 2PLPA 1FD6A 2BS2B 5C2TB 2E3TA 1N61A 2M0AA 1ROEA 3ETRA 3FAHA 2LHEA 1JWMD 1TS2A 1FFVA 2RDGA 3PZ7A 5EE0A 1J7AA 2K9XA 5FKAC 1XLOA 4HRSA 3E56A 1VRAB 3LB8C 4A90A 2G9HD 1WRIA 3I57A 2LEKA 2WS3B 5HHDG 5BYQA 1NEKB 2J53A 2N9LA 4RGNA 1L0YB 2CU3A 5BYRA 1T5XD 4LLGM 4KGRA 1FMAD 3HVDA 3ZYYX 2Z8LA 1C76A 1YN5A 2MJDA 1BXTA 2NMQA 4OZAA 1N60A 1QILA 1R7SA 3V05A 4Q2JA 1IBXB 4C7ZA 4DXFA 3HRDD 1VZ6A 4HROA 2WXFA 2JXTA 2M19A 3VR9B 3AMZA 1JALA 1GOZA 2FBWB 5BMIA 2CJNA 3TUOA 1K51A 1HZ6A 3VQIA 4JPSA 4GDKB 1B9RA 2W82A 1MHHE 4L2YA 1IUEA 4KGSA 2BYTA 2K22A 3E9SA 3NRZA 2JX5A 4RCOA 3EA6A 1SBBB 1YN3A 3LYYA 2QIEB 1CJEA 3AM9A 1V8CA 4ZHOA 3EUB2 4KGTA 4XE0A 1E9MA 2WXKA 2NTTA 4WH4A 5T8IA 4OW0A 2AQ1B 4KKJA 1YNTE 3UI3A 3MP9A 1YJJA 2ZW1A 1AWDA 1NYQA 1FRRA 1KTKA 2GRIA 3AE7B 1NENB 2JYTA 3AH7A 2LUMA 4RF0A 2WNMA 1CK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9J A;  3P4Q B;  3ABV B;  1WXQ A;  1YQ4 B;  1FO4 A;  1PDX A;  4US9 A;  4YTP B;  1DOY A;  3VRB B;  1JQ4 A;  1OFF A;  3AE8 B;  1VLB A;  4N6E B;  2MJE A;  3AEF B;  3L4P A;  1TJE A;  1EWY C;  3B2F A;  3P1M A;  4FXC A;  2OHF A;  1L5P A;  2PIA A;  2WU2 B;  1N5X A;  1TKY A;  1NVI D;  1XLP A;  3AB5 A;  3AE5 B;  3P4S B;  5EE1 A;  2H89 B;  1ZP0 B;  3BII D;  3HVZ A;  2KMM A;  2MH7 A;  1L0V B;  5GXG B;  3AEE B;  1XLQ A;  1XO3 A;  1YJI A;  3AE9 B;  4C7Y A;  2AX5 A;  3AED B;  3W5V B;  1RFK A;  4YXD B;  5EE9 A;  2H88 B;  1ZXI A;  2WP9 B;  3AE3 B;  5H8Y E;  2Q5W D;  2DBY A;  2Y5C A;  2PKO A;  2WLB A;  3DWG C;  2MJ3 A;  3AV8 A;  4YSX B;  2BS3 B;  1VDV A;  5C3J B;  3P4R B;  3VR8 B;  3NVY A;  3SR6 A;  1JRP A;  5H92 C;  1E0Z A;  3HUI A;  1JRO A;  1AYF A;  1F0Z A;  4IDI A;  1VJK A;  1L6V A;  2W54 A;  3NVV A;  5AUK A;  4JWU C;  2BS2 B;  1WYG A;  2N0S B;  2E3T A;  4JX1 C;  4LTU A;  5C2T B;  1N61 A;  2W3R A;  2DWQ A;  1FRD A;  1ROE A;  1DOI A;  3ETR A;  3FAH A;  1SIJ A;  1WWT A;  3AE6 B;  1RWS A;  3VRA B;  5MPO A;  1FFU A;  1FFV A;  4US8 A;  1NYR A;  5EE0 A;  1J7A A;  2K9X A;  4JWS C;  4KX6 B;  1GAQ B;  1XLO A;  1GPX A;  2L83 A;  3PO0 A;  4HRS A;  3LB8 C;  1QF6 A;  3WCQ A;  1WRI A;  2WQY B;  2LEK A;  1N62 A;  2WS3 B;  3AE2 B;  4WWM A;  2WDQ B;  1A70 A;  3W9C B;  2L52 A;  1NEK B;  1KFY B;  1QOB A;  2PVO D;  4N58 A;  2CU3 A;  1I7H A;  3AE1 B;  1ZUD 2;  1FIQ A;  3NS1 A;  1FMA D;  2WDV B;  1FXA A;  1QOA A;  3ZYY X;  3CWI A;  3AEB B;  3P63 A;  5EE3 A;  3RPF C;  2MJD A;  2WU5 B;  1TYG B;  1N60 A;  3KWL A;  3LXF A;  3NVW A;  1R7S A;  4WQM A;  5G5G A;  3CIR B;  2W3S A;  1J7B A;  1FM0 D;  4C7Z A;  3HRD D;  3SFE B;  4HRO A;  1QOG A;  1E10 A;  1DOX A;  2M19 A;  4N59 A;  4YT0 B;  2JQR B;  1KRH A;  5AUI A;  3AMZ A;  1JAL A;  1QT9 A;  1N63 A;  2FBW B;  3VR9 B;  2CJN A;  1E6E B;  1KF6 B;  3P4P B;  1TKE A;  1SF0 A;  1RYJ A;  1UWM A;  2PVG C;  1QLB B;  2K5P A;  1WGK A;  4C80 A;  1B9R A;  3NVZ A;  3AN1 A;  1TKG A;  1JWB D;  2B76 B;  1IUE A;  1T3Q A;  3DWM A;  1J7C A;  3AEC B;  4YSY B;  2K22 A;  3AEA B;  4P6V F;  3NRZ A;  1PUT A;  2JX5 A;  2G1E A;  4ITK A;  3W5U B;  1L6U A;  5G5H A;  1PFD A;  3FC4 A;  2QIE B;  1CJE A;  1DGJ A;  3AM9 A;  1N5W A;  1V8C A;  2M56 B;  1V97 A;  3AE4 B;  4ZHO A;  1YQ3 B;  1NI3 A;  3EUB 2;  1OQQ A;  4YTM B;  1E9M A;  1JWA D;  2CJO A;  1RM6 C;  2KAJ A;  1ZOY B;  2BT6 A;  3AEG B;  2HTM E;  2WDR B;  1CZP A;  2BS4 B;  1OQR A;  1YJJ A;  1QOF A;  1AWD A;  1NYQ A;  1FXI A;  4ZOH C;  1SB3 C;  2QJL A;  3SFD B;  1FRR A;  3B2G A;  2EKI A;  4ZHP A;  2ACZ B;  3AE7 B;  1NEN B;  1JW9 D;  4USA A;  1E7P B;  4YTN B;  3AH7 A;  4A9A A;  1XLN A;  2W55 A;  4YSZ B; 
#chains in the Genus database with same CATH topology
 2NBV B;  4MM3 B;  2MWS B;  3CST A;  1SGH A;  1V6E A;  1WGY A;  5IKC M;  5TSS A;  2WDT B;  3B2F A;  4FXC A;  2C7M B;  3I63 C;  2GBN A;  3HVZ A;  1V1O A;  2K6Q A;  2KFK A;  3ZLZ A;  3RNG C;  2KMA A;  4OHJ A;  3N30 A;  1SJE D;  1YX5 B;  5JZE B;  4MH8 A;  1R4M B;  4EEW A;  2ZW0 A;  2JRI B;  3FIL B;  2AQ2 B;  3VRA B;  1ZW7 A;  4FHK A;  4LNI A;  2LI5 A;  4E71 A;  4JWS C;  2KQS A;  4GLS C;  2HDE A;  4KVG B;  4M00 A;  4WIP A;  3B1L X;  2N9K A;  4B9K A;  1FIQ A;  3IAM 1;  5L95 C;  2VZK B;  4ARI A;  3P63 A;  4R3D A;  2INN E;  1WH3 A;  4MSQ B;  3ZJT A;  1KLV A;  4M8M A;  2QHO A;  2A5U A;  2BQQ A;  1KRH A;  3RUL A;  3OLM D;  2L1A A;  1RYJ A;  5AZG A;  4BKS D;  4C80 A;  4GDK A;  3DWM A;  5IOI A;  4MEM A;  2GBJ A;  4BOS C;  3ZKJ C;  5AZH A;  3LDZ E;  1PFD A;  2L0T A;  3FKY A;  3Q69 A;  1WJN A;  2GOW A;  2L0F A;  4HK2 A;  3AXC A;  2KX0 A;  1GC7 A;  1JWA D;  2KX3 A;  4MDK E;  2HTM E;  4B0M A;  4OZC A;  2AYO B;  3BK2 A;  2JWU A;  1WGG A;  1ZKH A;  1GUA B;  3R3M A;  1EUV B;  3DBH I;  4GGQ A;  4TQ0 A;  4RM8 A;  1N6Z A;  5LLI A;  5GMV A;  1AAR A;  1YQ4 B;  4G0N B;  2IGG A;  3ZXV A;  4W9I A;  1KOT A;  2D10 A;  3AE5 B;  1N5X A;  1K50 A;  5FK9 C;  1F1H A;  3BII D;  4XGA B;  4DXA B;  1HTO A;  5D94 A;  1TZO A;  3IHP C;  2KMC A;  1CQV A;  2WX1 A;  4TV3 A;  3JSV A;  2MSE D;  3NVY A;  3KVF B;  3RYT A;  4IM0 A;  4FLH A;  3HUI A;  1D5Z C;  3L17 A;  3AU4 A;  2NVU I;  3AE6 B;  3RMK C;  2IPK D;  3ZNG C;  1QF6 A;  4CHK A;  1R4N I;  3AE2 B;  2WDQ B;  4F8C B;  1WYW B;  2IGD A;  5JH5 C;  3B08 A;  4FJZ A;  4ZRK A;  1PGA A;  3Q8C A;  4BZA A;  4PS8 A;  3AU5 A;  2KYW A;  3CSF A;  3H6N A;  4PT5 A;  4A3P A;  2CKH B;  1MFW A;  3R8B A;  1E10 A;  1P3Q U;  2BKF A;  3ZNZ B;  2K5P A;  1WGK A;  2K8H A;  3NVZ A;  4KIK A;  1Q0W B;  3EFU A;  3Q3M C;  2J0K A;  2UYZ B;  1PUT A;  1UF0 A;  3IT6 B;  1Z2M A;  2FAZ A;  2L7R A;  1TS3 A;  3L16 A;  1WX8 A;  4MH0 E;  2Y3A A;  5BMG A;  1C4C A;  2L76 A;  2GB1 A;  4ZHP A;  3KW5 B;  4K3C A;  3PSE B;  4YSZ B;  4BFR A;  1WM2 A;  1TTN A;  1LQB A;  3QCA A;  1C4A A;  3N1Z C;  1J19 A;  1XT9 B;  4ARC A;  2MBH A;  3U30 A;  1WIA A;  4NY0 A;  3WIM A;  3TEY A;  3UGB B;  1IP9 A;  2LAS A;  1OTR B;  3TJP A;  3SD5 A;  4YSX B;  4JGH B;  2VH2 A;  4RMA A;  4PS3 A;  1OGW A;  2KFK B;  3W1S C;  4RFB A;  4JX1 C;  2I1J A;  4HKZ E;  3P2B A;  2IBI B;  1KLU D;  4GDL A;  2MW5 A;  3OAW A;  3U7D A;  2L83 A;  3PO0 A;  2M8S A;  5D3I B;  1MI0 A;  3Q3J A;  2PPH A;  4N58 A;  2BWE S;  5CHV C;  2J4X A;  2FUG 1;  1YD8 U;  3LXF A;  3WAO A;  1QQR A;  2IND C;  4WQM A;  2D3A A;  1XXG A;  1ZDV A;  2K0P A;  4E74 A;  1RRB A;  3DVN U;  2DAJ A;  2N9E B;  5CTR C;  4YT0 B;  1F77 A;  3HK0 A;  3P4P B;  3DBL I;  4HLE A;  2O6V A;  3QIJ A;  3I9V 1;  2WXN A;  2D3C A;  3IXS A;  3Q3F A;  4ITK A;  4NAM A;  2PE6 B;  3URY A;  3AE4 B;  1YQB A;  1TS5 A;  2N1W A;  1L7Y A;  1ZOY B;  2BT6 A;  4AJY B;  4I6N B;  2WXH A;  4LK0 M;  2QC8 A;  5AEK B;  1SB3 C;  3B2G A;  3U2S C;  2LXA A;  1WGD A;  2RSU A;  2QDF A;  1WX9 A;  1XLN A;  4DK5 A;  1Z5S B;  4LDT B;  1PDX A;  4A8X C;  3VH4 B;  2KAC A;  3QAR A;  4ANV A;  4XWW A;  2JXX A;  5CX3 A;  1L5P A;  2WU2 B;  4YTP B;  1UH6 A;  4XWT A;  3W5V B;  5DPT A;  2MRP A;  1IBX A;  4GB9 A;  3UIP B;  4JL9 A;  4FBJ B;  4RGM A;  3VTU A;  2MJ3 A;  4FUL A;  4IWP A;  3A1Q B;  2BF8 B;  4AS1 A;  4XDD A;  2PLP A;  4GMV A;  2JF5 A;  3R7R A;  1T0Q C;  2M0A A;  2KLC A;  1F9J A;  3JSV B;  3PZ7 A;  5EE0 A;  4HXD A;  1XLO A;  4BOZ B;  3LB8 C;  3CMM B;  3A9J B;  2WS3 B;  1T0Y A;  3QJZ A;  2CR5 A;  3DQV A;  3W1Y A;  3EC8 A;  1VD2 A;  4W9F A;  2KWV B;  2NMQ A;  4P1C C;  1N60 A;  3V05 A;  3PTF C;  3VFK A;  3RD2 A;  4C7Z A;  4DXF A;  3HRD D;  3OJ3 A;  2A4Z A;  3A9K B;  3VR9 B;  4GIV A;  2M1M A;  2DEN B;  4GDK B;  1B9R A;  2KTR A;  2W82 A;  4X57 B;  2BYT A;  3DBS A;  2RPQ A;  2Z59 B;  3VXW A;  4FN2 A;  1YX6 B;  4XE0 A;  1E9M A;  1LXD A;  5T8I A;  4KKJ A;  2K6D B;  3RI7 C;  3A4S C;  1NBF C;  1NYQ A;  1FRR A;  3A9J A;  1E7V A;  1NDD A;  1I35 A;  4F7Z A;  4RF0 A;  1CK1 A;  2JVC A;  2XK5 A;  4AUQ C;  1DOY A;  4DQO C;  1WGH A;  3RNB C;  1TY2 A;  1NVI D;  2KAN A;  3VUX A;  1C79 A;  2N7E A;  4OVU A;  2FCN A;  3VTV A;  1XLQ A;  1YJI A;  4B0E A;  4C7Y A;  3IVF A;  1B1Z A;  4BKG A;  4YXD B;  1HQR D;  1SSN A;  2LVO A;  1OEY J;  2C9W B;  1WMH A;  1ZPS A;  4M02 A;  2WXG A;  3VVW B;  4GN1 A;  3PRE A;  1L6V A;  3R2I A;  5KHO A;  1LO5 D;  2V1Y A;  4RGT A;  5MPO A;  1EM7 A;  2LGI A;  4LDT D;  2K8C A;  4P16 A;  4HDO A;  3SU8 X;  1PYW D;  4P7I A;  3HIZ A;  4EE2 A;  2CHZ A;  1N62 A;  2V4I B;  3KUZ A;  1WJ6 A;  2ON8 A;  4II2 B;  3H1U A;  1I7H A;  3Q8E A;  1V1P A;  3EFC A;  4NZL B;  1V9J A;  4IW0 A;  4ACF A;  1WX7 A;  1C78 A;  3N9Y C;  3BK1 A;  5HI1 A;  1IPG A;  4WUR A;  1HTQ A;  3BZD B;  2KN4 A;  1M94 A;  2KLG A;  2MA9 B;  1QT9 A;  3Q8A A;  4IG7 B;  4RF1 A;  4KIK B;  2PEA A;  2WX0 A;  3V6E B;  4BBN C;  3VDZ A;  1Q5W B;  2LVQ A;  3ZTD A;  1HXY D;  2OED A;  4CO7 A;  5E6P A;  2AL3 A;  3MHZ A;  1V97 A;  4QAY A;  3PLU A;  3Q8F A;  4II3 B;  3RZF A;  3V3X A;  3ENE A;  4LCD E;  3TIX A;  2IO1 B;  3GZN I;  3AEG B;  2WDR B;  4HEA 1;  3Q6B A;  2WXM A;  3SEB A;  1H8C A;  1EF5 A;  3TEW A;  3ZIM A;  3OG5 A;  1V1P B;  4IWO A;  1G6J A;  5HFY A;  2MJE A;  2MHJ A;  1UD7 A;  1BUI C;  5DPS A;  3V61 A;  1F52 A;  3P42 A;  2AX5 A;  4MM3 A;  5J2R A;  2Q5W D;  1EWC A;  2Y5C A;  1YJ1 A;  4W9D A;  2PKO A;  5C3J B;  3L13 A;  2O2V B;  3N1Y C;  1TY0 A;  2J0M A;  1VJK A;  4JWU C;  1VCB A;  3UQA A;  3MC0 B;  2DWQ A;  5TR5 A;  1R4N B;  1TIF A;  3KQ4 A;  2D3G A;  4IM3 A;  2YEP F;  2J0J A;  1HE8 A;  2LGS A;  2Y5B B;  4ANX A;  1J0G A;  1P0R A;  4DDG D;  2L52 A;  4DXG A;  4TKN A;  3IG3 A;  2HD5 B;  4BKT A;  1FXA A;  2K1F A;  3RPF C;  5EE3 A;  3VUW A;  2C7H A;  2BKR B;  4IKG A;  3DVG Y;  1I4H A;  4TQ1 A;  2JQR B;  3ZNH B;  1FNV A;  1E6E B;  1FCC C;  1UWM A;  2TSS A;  2HJ8 A;  3L10 B;  5DCN A;  2LMC A;  2KC2 A;  2JUO A;  2G1E A;  2J42 A;  3HM6 X;  3N32 A;  2K3U A;  3N20 C;  2KT7 A;  1YQ3 B;  2L32 A;  4CQN A;  3APC A;  5CHF A;  5I4D A;  3DOW A;  4ZOH C;  1HA5 A;  1IYF A;  1P7F A;  2BYF A;  1L4D B;  1JW9 D;  3M3J A;  1E7P B;  1FXT B;  1P7E A;  2BYV E;  3R2T A;  1L0X B;  1E8X A;  1GB1 A;  2KNB A;  3P4Q B;  1Y8R C;  2V4L A;  4IWQ A;  2KQ4 X;  2MLB A;  5HKH A;  3TEX A;  3ZO5 B;  2ZJD A;  3L4P A;  2KDF B;  1XF5 L;  5J18 A;  2D2Q A;  3EHV A;  3P4S B;  3V62 A;  2DAF A;  3EGR A;  4RM9 A;  4GSW A;  1ACC A;  5GXG B;  3AED B;  4S0R A;  2KTR B;  1ZE3 D;  2DBY A;  4XZ4 A;  2JYE A;  1VDV A;  2LGX A;  4W9J A;  2WXL A;  2IO2 B;  4C4V A;  4MSM B;  2LGD A;  3NVV A;  4LTU A;  5IA7 A;  4NPN A;  1WWT A;  4RGO S;  3ZW3 A;  1ZGU B;  1FPY A;  1ET9 A;  1KH0 A;  3ZTC A;  1TZ1 A;  3BYT B;  3MHS D;  2N1V A;  2VZK D;  3ML9 A;  1E5W A;  2WXR A;  4WJP A;  2PVO D;  4KSL C;  3KYD D;  1XCQ L;  1GG3 A;  4AJW A;  5G5G A;  2SAK A;  4DDI D;  5D7G A;  1WY8 A;  3QK0 A;  1J7B A;  5L83 A;  3JW0 X;  4K7U A;  1DYQ A;  2PE9 A;  1D5M C;  1PGB A;  4N59 A;  5AUI A;  1N63 A;  1Y56 A;  2IJ0 A;  2ZCB A;  1TGZ B;  2MX2 A;  1T3Q A;  3AEC B;  3AEA B;  2KZR A;  2FCQ A;  3W5U B;  5D6J B;  1DGJ A;  1WE7 A;  1H4R A;  1MPE A;  5BMH A;  1V80 A;  1UWX A;  1SE3 A;  4YTM B;  2RR9 A;  4O1N A;  2GBR A;  4LNF A;  3PHW B;  2NBU A;  4A9A A;  2X38 A;  2OJW A;  4OVV A;  3Q14 C;  3GE3 C;  2Z0D B;  2BYE A;  1VLB A;  2IO0 B;  4NQL B;  1VZ7 A;  3UF8 A;  4NNJ B;  1WGR A;  1E8Z A;  2RDB C;  2V9H A;  4KDL B;  3ZGZ A;  2RMM A;  3DHI C;  3R7Q A;  3P4R B;  3DBR I;  2R2O A;  5H92 C;  2WXP A;  1JRO A;  4TUU A;  4A3O A;  1K8R B;  1FD6 A;  2B3A A;  2E3T A;  5IAA C;  1N61 A;  3FAH A;  2JY6 A;  2LHE A;  1TS2 A;  2KK8 A;  3ZVV A;  3E56 A;  4A90 A;  2D11 A;  2G9H D;  1WRI A;  4C4V B;  1UEL A;  2LRU A;  3I57 A;  3VUY A;  2DZK A;  1NEK B;  4JQW C;  2J53 A;  4RGN A;  1L0Y B;  2CU3 A;  3MJW A;  4KZ0 A;  4KGR A;  3AI5 A;  2MJD A;  1QIL A;  1R7S A;  4Q2J A;  2K39 A;  3QC8 B;  2WXF A;  4EZK A;  2GMI C;  1JAL A;  2FBW B;  1LM8 B;  2NCN A;  4JPS A;  3PRP B;  1MHH E;  4HVB A;  4GU2 A;  4L2Y A;  1IUE A;  4KDI C;  4BKS A;  4RCO A;  3EA6 A;  3K9P B;  1SBB B;  2EKE C;  4ZHO A;  2NTT A;  2N9P C;  2L8J A;  4B95 A;  1WXS A;  2AEH A;  1YNT E;  4G3X B;  1YJJ A;  4B6W A;  1KTK A;  5BO4 B;  4ZRI A;  1NEN B;  4REZ A;  3PRM B;  3KUD B;  4PS7 A;  4ZYN A;  4FHJ A;  2V3S A;  2H89 B;  3I5J C;  4AWJ A;  2DLB A;  2FCM A;  2KHW B;  3AEE B;  1XO3 A;  3PT2 B;  2OOB B;  2H88 B;  5H8Y E;  4WJO A;  4OVZ A;  5LXI B;  4MGI E;  2W9N A;  1ESF A;  4DWF A;  4EOY A;  1E0Z A;  4W9H A;  1GNU A;  2ONQ A;  1WRD B;  1FCL A;  1FRD A;  2KJH B;  3MTN B;  2JZ3 B;  4EUT A;  3KLS X;  4PK1 A;  1E8W A;  3DHG C;  3DBL B;  5JXV A;  2KWC A;  3RNA C;  2KVR A;  1KFY B;  1QOB A;  2RPV A;  3HM3 A;  3IBE A;  4IC7 B;  3WAM A;  1JWU D;  3WAN A;  2FCS A;  1QKZ A;  3KWL A;  4M01 A;  3CIR B;  1OEY A;  4NQK E;  2I2Y A;  1Q10 A;  4DHJ D;  3A33 B;  1TT5 B;  2DZJ A;  2KDB A;  1UUP A;  3H9D A;  1KF6 B;  4LNO A;  4NAW B;  4NAW A;  2GLS A;  2DYB A;  2B76 B;  3ZQ4 A;  2FUH B;  2YEP B;  1M4V A;  4HDQ A;  4CYE A;  1L6U A;  2D5G A;  2IY1 B;  4WQO B;  4NJ7 A;  5C23 A;  1WI0 A;  2KAJ A;  1C4P A;  1CZP A;  1QOF A;  2QJL A;  2BB5 A;  2ACZ B;  1YIW A;  2FID A;  3ABV B;  1WXQ A;  4NJ6 A;  4RH6 A;  5D2M B;  4HKQ A;  2BPS A;  3P1M A;  2GBK A;  1T0R C;  1XLP A;  2CHX A;  2QEJ C;  3NZ3 A;  1L0V B;  3AE9 B;  2C5L C;  2BGF A;  4RNA A;  5EE9 A;  4I6P A;  4E3C A;  1I4P A;  2MBO A;  2WLB A;  4DBG A;  3AV8 A;  4XYC A;  2RD0 A;  3VR8 B;  1YMH E;  1WXA A;  2MBE A;  2MP2 A;  2O6V B;  3VTW A;  1P9D U;  4FA6 A;  3ZDT A;  1WF9 A;  2WGS A;  2LHD A;  2LXC A;  1LFD A;  4MAC A;  2LVP A;  1GPX A;  3ML8 A;  2UWQ A;  2LRW A;  3WCQ A;  2WQY B;  1A70 A;  1RLF A;  2NS5 A;  4D2K A;  3SHQ A;  2V0G A;  3NZS A;  5G55 A;  3NHE B;  2ASQ A;  2Y5P A;  2DYM A;  3ALB A;  4LJP B;  1QOA A;  3PGE A;  1E90 A;  3AEB B;  1LGR A;  3ZNI D;  3DPD A;  4W9E A;  2W3S A;  1SE4 A;  3M95 A;  4ICU A;  3SFE B;  1DOX A;  2MQJ A;  1V49 A;  3BYY B;  1TKE A;  2NBW B;  3DVN V;  3GZN B;  1VR9 A;  2N7D A;  1J7C A;  3KYC D;  4P6V F;  1E7U A;  4JE3 B;  1C77 A;  1HEZ E;  2QIL A;  3DBR B;  5G5H A;  1UBQ A;  3DVG X;  2CS4 A;  2LZ6 A;  4MGY E;  2C7N B;  4M8N A;  2CJO A;  3CF6 E;  1V5O A;  3DHH C;  2BS4 B;  1I4G A;  1WSP A;  4DHJ B;  1AW7 A;  2OJR A;  2FIF A;  2L3Z A;  2NPT B;  3MJ5 A;  1WM3 A;  2BTE A;  3PVL A;  5FR3 A;  1PGX A;  4KKI A;  4ASW C;  3AE8 B;  3NY5 A;  2XBB C;  3IAS 1;  1R4M I;  3K9O B;  2BVC A;  2LUE A;  2XEW A;  4K3B A;  3C0R B;  1ZP0 B;  3H7S A;  3UQB A;  1F2R C;  3BIN A;  1UNS A;  2KVZ A;  4ZRP A;  1MG8 A;  2IDY A;  3AE3 B;  4L1B A;  2AWT A;  2RDH A;  2J7Q B;  1J8C A;  1JRP A;  1EO6 A;  1F0Z A;  2LWP A;  4IDI A;  1SJH D;  5AUK A;  1WYG A;  2DZI A;  1FFU A;  3ZRF A;  2BBC A;  4KX6 B;  1VZ8 A;  3UIO B;  2LJ5 A;  5HG2 A;  4HCN B;  1SIF A;  2XNA C;  4ANU A;  4WWM A;  2EMS A;  4J3O D;  2R2Q A;  1WXV A;  1K52 A;  4XX5 A;  1YN4 A;  1ZUD 2;  3QA8 A;  4ANW A;  5LXH A;  2WDV B;  1TS4 A;  4XDC A;  1KM7 A;  3PLV A;  2R61 A;  2WU5 B;  4AQ7 A;  3T3O A;  3RUI B;  5IN7 A;  4WAF A;  3V6C B;  2JU6 X;  1STE A;  1F2R I;  3PV1 A;  3O13 A;  4HJG E;  1JWB D;  2REX A;  1QZE A;  4YSY B;  1D5X C;  2N7J A;  4MT5 A;  1V81 A;  4EKU A;  3J9C A;  1XEE A;  4WJN A;  1T0S C;  3HHM A;  4AOF A;  3C19 A;  2KJR A;  4YWG G;  3S2A A;  3RNF C;  1KLG D;  2M4N A;  5EDS A;  2EMT A;  1OQR A;  3WAL A;  3SFD B;  1WE6 A;  1IGC A;  3WAP A;  2NTS A;  2G4S A;  1WXM A;  1I42 A;  1BML C;  2BW2 A;  4UDU C;  1TBE A;  1L2N A;  2IY0 B;  2IZV B;  1EWY C;  2DYO A;  2N4F A;  2OHF A;  5EE1 A;  5JHB A;  2JWZ A;  4HCP B;  1IGD A;  4EZJ A;  2AL6 A;  1RFK A;  2M0X A;  4NJC A;  1UGJ A;  2VH1 A;  3PZD A;  3U8Z A;  4M0W A;  4K81 A;  1PQS A;  5G2N A;  1ZDX A;  2IO3 B;  1V2Y A;  3SR6 A;  3OJ4 B;  5C2T B;  3ETR A;  1GC6 A;  1ROE A;  3VHT C;  1FFV A;  2KXJ A;  2RDG A;  2KJ6 A;  5FKA C;  1D3Z A;  1P1A A;  5HHD G;  4LNK A;  5BYQ A;  2M17 A;  3A4R A;  1WMH B;  4W9L A;  3B0A A;  1T5X D;  1FMA D;  2I1K A;  3ZYY X;  2Z8L A;  1C76 A;  2KFJ A;  1YN5 A;  4OZA A;  2L05 A;  4J6I A;  1VZ6 A;  2JXT A;  3AMZ A;  1GOZ A;  5BMI A;  1XD3 B;  3VAW A;  3TUO A;  3Q2A C;  1HZ6 A;  5IO9 A;  3N1X C;  5DPW A;  4AP4 C;  4KGS A;  2K22 A;  3E9S A;  4KV2 A;  2JX5 A;  5AZF A;  2JRH A;  1YN3 A;  3LYY A;  2QIE B;  1CJE A;  3AM9 A;  3EUB 2;  4KGT A;  4OW0 A;  3UI3 A;  3RT3 B;  4MJS A;  2ZW1 A;  1AWD A;  4LJO B;  4MJS B;  2GRI A;  4MEL A;  3AH7 A;  2DZM A;  2WNM A;  2HE7 A;  2K8B A;  3GE8 C;  3A9K A;  2LD9 A;  1TJE A;  3RFZ B;  4KSK C;  2D07 B;  2PIA A;  1D6E C;  1S3S G;  4TSS A;  2G3Q B;  3NZU A;  3DDC B;  3FIL A;  4JIO U;  3BWU D;  3L08 A;  3QWZ B;  2KKC A;  4TMA B;  2PW9 A;  4A20 A;  1I4Q A;  5LNK 1;  2KN5 A;  3PZ8 A;  4HJK A;  1XCT L;  2W54 A;  4K1R B;  2N0S B;  3PPA A;  5E6J A;  4KZC A;  2W3R A;  2INC C;  3TL5 A;  4WWN A;  2WXI A;  1KJT A;  2BWF A;  3GS2 A;  5BYS A;  1EU3 A;  4EFO A;  4C00 A;  2J52 A;  2MCN B;  3W9C B;  4C56 C;  4ZRQ A;  1RAX A;  4URK A;  3O65 B;  3T3N A;  1WFY A;  3NS8 A;  1JRU A;  1K53 A;  5J17 A;  3CWI A;  2V3N A;  3APD A;  3BY4 B;  4A55 A;  3UIN B;  3U52 E;  4GDL B;  1FM0 D;  3APF A;  3A1Q A;  2SEB D;  1NI2 A;  2CHW A;  1SF0 A;  2PVG C;  1QLB B;  2KWD A;  3GB1 A;  2ZEQ A;  1MVK A;  2LFI A;  2CU1 A;  1D4B A;  2V3P A;  4IM2 A;  3RNE C;  2YLM A;  3RCZ A;  2XK5 B;  4A6Q A;  4S17 A;  1FNU A;  3FC4 A;  4WWP A;  4ZRJ A;  2M56 B;  4F1S A;  1OQQ A;  3W2D A;  3H8H A;  4K7S A;  2D3B A;  4ZDV A;  4HPP A;  4FJV B;  2G4D B;  2EKI A;  3JYU A;  3MFG A;  3TMP B;  1BT0 A;  3L54 A;  3B9J A;  4IOI E;  1FO4 A;  2QCZ A;  1OFF A;  4N6E B;  2MBQ A;  2K25 A;  1HZ5 A;  2ZVO A;  3ZDM C;  1SEB D;  2WXO A;  1WJU A;  3TSS A;  2MH7 A;  3GP7 A;  2E6X A;  2MEK A;  2X8X X;  2ZNV B;  3JVZ X;  3U4E G;  2WYQ A;  1ISN A;  1JML A;  2NR2 A;  3X0W A;  2HJ1 A;  1SE2 A;  1WR6 E;  1AN8 A;  3AUL A;  4LNN A;  2PTL A;  3DCG A;  3QHT A;  1SIJ A;  2KDM A;  4WWO A;  3ZXR A;  1NYR A;  4WJQ A;  1JWS D;  3VH3 B;  3BVZ A;  3SDL C;  2IYD B;  3OWE B;  3BVG A;  4MGZ E;  1WZ3 A;  1TYG B;  3NVW A;  3D32 A;  3TCA A;  2JZP A;  2ZVN A;  2HTH A;  1FEH A;  4W9G A;  3IT4 B;  1MG4 A;  2FNJ B;  4W9C A;  1C1Y B;  4M0W B;  5C1Z A;  1C9F A;  3AN1 A;  4HPM B;  2ZZP B;  4DHZ E;  2C60 A;  1YOV B;  2MBB B;  3KH0 A;  5CHW A;  4P1B C;  3TBL D;  1EF1 A;  1WR1 A;  2WWZ A;  1I4X A;  2ZPN A;  3LJ3 A;  5E6N A;  3TEZ A;  2GBM A;  3Q8B A;  2L00 B;  2RGF A;  2QMT A;  1FXI A;  3Q3O C;  2QSD A;  3MC9 A;  1SE9 A;  4USA A;  3ZRC A;  1WZ0 A;  2W55 A;  4HPL B;  4DHZ B;  3VRB B;  4IUM B;  1JQ4 A;  2INP E;  3AEF B;  2ICI A;  2FE8 A;  3DBH B;  3AB5 A;  2DHZ A;  3ZJU A;  2VRR B;  4H2A A;  3C8Y A;  2EEL A;  1L4Z B;  1T6B X;  2KTF A;  3H7P B;  5FR6 A;  2AQ3 B;  2DX5 B;  3T9L A;  4FJY A;  3IFW B;  1RFA A;  1EU4 A;  2Z0E B;  1I4R A;  2JPH A;  1UZX B;  3PS6 A;  2ZCC A;  1DOI A;  1FNW A;  1OQY A;  1UBI A;  1RWS A;  3RNC C;  4US8 A;  4OZB A;  1GAQ B;  3U7Z A;  2WHI A;  4BVU C;  3KWV A;  4BBN F;  3Q3N C;  1Q1O A;  2GI9 A;  2PMV A;  1JCK B;  3ZJV A;  3L0W B;  1S1Q B;  2I38 A;  2YVC A;  3AE1 B;  2KOX A;  2JSV X;  3NS1 A;  4ZYS A;  3RZW C;  4HWI B;  5E6O A;  2ZNV C;  4MGK E;  2LGY A;  3W1S A;  3NUH B;  2WXQ A;  3R66 C;  1QOG A;  2O2V A;  4XC2 A;  1SXT A;  2KWU B;  2XN9 C;  2JT4 B;  3EEC A;  4YL8 A;  1TKG A;  5D3D A;  1ENF A;  2KDI A;  5DPR A;  4ICV A;  3X23 A;  4FAD A;  3BVM A;  1P98 A;  1N5W A;  1CMX B;  2IGH A;  1NI3 A;  2WXJ A;  5IP4 D;  1RM6 C;  3NG0 A;  3GOE A;  3RN9 C;  1GJZ A;  4I6L B;  1MJD A;  3PRZ A;  4YTN B;  3MC8 A;  1E8Y A;  3ECI A;  2UU7 A;  1MHX A;  4US9 A;  4JLC A;  5JHA A;  2LJI A;  4EZL A;  2BB6 A;  1TKY A;  3PHX B;  4N9F 4;  2KMM A;  4PYZ A;  1ZXH A;  4L23 A;  3ZUN A;  2WP9 B;  1ZXI A;  3V60 A;  1ET6 A;  1GB4 A;  3DWG C;  2BS3 B;  4GOC A;  2O6V D;  2KC1 A;  2N9X A;  1AYF A;  1C3T A;  3N3K B;  3NJT A;  2BS2 B;  3WA0 A;  3H7P A;  1JWM D;  4BAX A;  1J7A A;  2K9X A;  4HRS A;  1VRA B;  4G11 A;  2LEK A;  2DNF A;  1WJ4 A;  2KO3 A;  2N9L A;  3QAQ A;  4K7W A;  3NOB A;  2KD0 A;  5BYR A;  2PJH A;  4LLG M;  3HVD A;  3QX1 A;  1XQQ A;  2G45 B;  1BXT A;  3M63 B;  1IBX B;  3KUC B;  3I3T B;  3T8M A;  1V5T A;  4HRO A;  2JZZ A;  2M19 A;  4PYU A;  5KHQ A;  1UGM A;  2CJN A;  3ONS A;  1K51 A;  3VQI A;  4G50 A;  2NPT A;  1U4A A;  3M62 B;  4WAA A;  3NRZ A;  1A5R A;  1V8C A;  2KQ7 A;  4W9K A;  2WXK A;  4WH4 A;  4GXB A;  2MP2 B;  2AQ1 B;  3MP9 A;  2ZPY A;  1X1M A;  3QQ8 B;  1V86 A;  3AE7 B;  2JYT A;  2KDE B;  2LUM A; 
#chains in the Genus database with same CATH homology
 1DOY A;  4MM3 B;  4DQO C;  5TSS A;  1TJE A;  1TY2 A;  3B2F A;  3RFZ B;  4FXC A;  2PIA A;  1D6E C;  1NVI D;  4TSS A;  2H89 B;  3HVZ A;  3FIL A;  2DLB A;  1C79 A;  3BWU D;  4B0E A;  3AEE B;  1XLQ A;  1XO3 A;  1YJI A;  4C7Y A;  1B1Z A;  1V1O A;  4YXD B;  1HQR D;  4REZ A;  4TMA B;  1SSN A;  2H88 B;  2PW9 A;  4OHJ A;  5H8Y E;  1SJE D;  4OVZ A;  1I4Q A;  5LNK 1;  1ZPS A;  2WXG A;  4MH8 A;  1ESF A;  2ZW0 A;  3PZ8 A;  1E0Z A;  3FIL B;  1XCT L;  1L6V A;  2W54 A;  3R2I A;  2AQ2 B;  2N0S B;  1LO5 D;  2ONQ A;  4RGT A;  2W3R A;  5E6J A;  1FCL A;  1FRD A;  5MPO A;  2LGI A;  1EM7 A;  3VRA B;  2WXI A;  4P16 A;  3KLS X;  1PYW D;  3GS2 A;  5BYS A;  1EU3 A;  4JWS C;  4GLS C;  2J52 A;  4EE2 A;  2HDE A;  1N62 A;  2V4I B;  5JXV A;  4WIP A;  3W9C B;  4C56 C;  2ON8 A;  4ZRQ A;  1KFY B;  1QOB A;  2N9K A;  3T3N A;  1I7H A;  3Q8E A;  1V1P A;  1FIQ A;  2RPV A;  3IAM 1;  1K53 A;  4NZL B;  2VZK B;  4ARI A;  1JWU D;  1C78 A;  3CWI A;  3N9Y C;  2V3N A;  3BK1 A;  3P63 A;  4R3D A;  2INN E;  1QKZ A;  5HI1 A;  3KWL A;  4WUR A;  4A55 A;  3CIR B;  3U52 E;  3BZD B;  4GDL B;  1FM0 D;  2I2Y A;  1Q10 A;  3ZJT A;  2KN4 A;  2SEB D;  1KRH A;  1QT9 A;  1UUP A;  3Q8A A;  1KF6 B;  4NAW B;  2L1A A;  1SF0 A;  1RYJ A;  2PVG C;  1QLB B;  4RF1 A;  2KWD A;  3GB1 A;  4C80 A;  1MVK A;  2LFI A;  1D4B A;  2B76 B;  3ZQ4 A;  3DWM A;  2V3P A;  2YEP B;  4A6Q A;  1M4V A;  1HXY D;  1L6U A;  2D5G A;  1FNU A;  2OED A;  1PFD A;  3FC4 A;  3Q69 A;  3MHZ A;  2M56 B;  1V97 A;  3Q8F A;  1OQQ A;  3W2D A;  3V3X A;  1JWA D;  2KAJ A;  3AEG B;  3H8H A;  2HTM E;  4B0M A;  1C4P A;  4OZC A;  2WDR B;  4HEA 1;  1CZP A;  1QOF A;  3BK2 A;  2JWU A;  2QJL A;  2BB5 A;  2WXM A;  3SEB A;  2EKI A;  3MFG A;  2ACZ B;  4TQ0 A;  3TEW A;  3B9J A;  4IOI E;  1V1P B;  1WXQ A;  1YQ4 B;  3ABV B;  1FO4 A;  4RH6 A;  2IGG A;  5HFY A;  1OFF A;  4N6E B;  2MJE A;  4HKQ A;  3P1M A;  1HZ5 A;  3AE5 B;  1N5X A;  1XLP A;  1SEB D;  1K50 A;  2QEJ C;  5FK9 C;  1BUI C;  2WXO A;  3BII D;  3NZ3 A;  3TSS A;  2MH7 A;  1L0V B;  3P42 A;  3AE9 B;  1TZO A;  2AX5 A;  3GP7 A;  4RNA A;  5EE9 A;  2E6X A;  2MEK A;  1I4P A;  2Q5W D;  1EWC A;  3U4E G;  2Y5C A;  2PKO A;  1CQV A;  2WLB A;  1JML A;  5C3J B;  3AV8 A;  1SE2 A;  3VR8 B;  1AN8 A;  1YMH E;  3NVY A;  1TY0 A;  3HUI A;  1D5Z C;  1VJK A;  4JWU C;  2PTL A;  3MC0 B;  2DWQ A;  1SIJ A;  2KDM A;  2LHD A;  3AE6 B;  4MAC A;  3KQ4 A;  2YEP F;  2IPK D;  1NYR A;  1GPX A;  1JWS D;  1QF6 A;  3WCQ A;  2WQY B;  3AE2 B;  2WDQ B;  1A70 A;  2L52 A;  4D2K A;  2V0G A;  3BVZ A;  4DXG A;  2Y5P A;  2IGD A;  2DYM A;  1FXA A;  3OWE B;  3BVG A;  1QOA A;  1PGA A;  3Q8C A;  3AEB B;  3RPF C;  5EE3 A;  4PT5 A;  1TYG B;  3NVW A;  2JZP A;  2W3S A;  1SE4 A;  4IKG A;  3R8B A;  3SFE B;  1FEH A;  1E10 A;  1DOX A;  1I4H A;  3IT4 B;  2JQR B;  4TQ1 A;  1FNV A;  3BYY B;  1E6E B;  1TKE A;  1FCC C;  1UWM A;  2K5P A;  2TSS A;  1WGK A;  1VR9 A;  3NVZ A;  1C9F A;  3AN1 A;  1J7C A;  2LMC A;  4P6V F;  4JE3 B;  1C77 A;  1PUT A;  1HEZ E;  2QIL A;  2G1E A;  2J42 A;  3IT6 B;  5G5H A;  2K3U A;  1TS3 A;  4CQN A;  1YQ3 B;  2L32 A;  1I4X A;  2CJO A;  3TEZ A;  2Y3A A;  3Q8B A;  5BMG A;  5I4D A;  2BS4 B;  1I4G A;  1C4C A;  1WSP A;  2QMT A;  1AW7 A;  1FXI A;  4ZOH C;  1HA5 A;  2QSD A;  2GB1 A;  1P7F A;  4ZHP A;  1L4D B;  3MJ5 A;  1JW9 D;  4USA A;  1E7P B;  1P7E A;  2BTE A;  3R2T A;  2W55 A;  4YSZ B;  5FR3 A;  1L0X B;  1PGX A;  1GB1 A;  3P4Q B;  4KKI A;  2KQ4 X;  1C4A A;  3TEX A;  3VRB B;  1JQ4 A;  2INP E;  3AE8 B;  4ARC A;  3AEF B;  3L4P A;  3IAS 1;  1XF5 L;  2ICI A;  2FE8 A;  3AB5 A;  3P4S B;  3EGR A;  3ZJU A;  3TEY A;  1ZP0 B;  1F2R C;  4H2A A;  3C8Y A;  1ACC A;  1UNS A;  2EEL A;  5GXG B;  1L4Z B;  1T6B X;  3AED B;  4ZRP A;  2IDY A;  2AQ3 B;  1ZE3 D;  3AE3 B;  2DBY A;  4L1B A;  2JYE A;  4YSX B;  1VDV A;  2RDH A;  1JRP A;  2WXL A;  1EU4 A;  1F0Z A;  4IDI A;  1SJH D;  1I4R A;  3NVV A;  5AUK A;  4RFB A;  1WYG A;  4LTU A;  4JX1 C;  4HKZ E;  1DOI A;  1FNW A;  1WWT A;  4RGO S;  1RWS A;  1FFU A;  1KLU D;  4US8 A;  2BBC A;  4KX6 B;  4OZB A;  1GAQ B;  3U7Z A;  1ET9 A;  1VZ8 A;  2L83 A;  3KWV A;  3PO0 A;  5D3I B;  5HG2 A;  1KH0 A;  2XNA C;  3BYT B;  1MI0 A;  2GI9 A;  2PMV A;  4WWM A;  4J3O D;  2VZK D;  1JCK B;  2WXR A;  1K52 A;  3ZJV A;  2PVO D;  2I38 A;  4N58 A;  3AE1 B;  1YN4 A;  1ZUD 2;  2JSV X;  1XCQ L;  3NS1 A;  2WDV B;  1TS4 A;  2J4X A;  4XDC A;  4ZYS A;  2FUG 1;  2R61 A;  2WU5 B;  4AQ7 A;  3LXF A;  5G5G A;  1QQR A;  2SAK A;  4WQM A;  3W1S A;  1XXG A;  1ZDV A;  2K0P A;  5D7G A;  3T3O A;  3NUH B;  1J7B A;  2WXQ A;  1QOG A;  1DYQ A;  4WAF A;  2JU6 X;  1D5M C;  1PGB A;  1SXT A;  4N59 A;  4YT0 B;  5AUI A;  2XN9 C;  1N63 A;  1Y56 A;  1F77 A;  2IJ0 A;  3P4P B;  1STE A;  1F2R I;  3I9V 1;  2WXN A;  3O13 A;  1TKG A;  1JWB D;  4HJG E;  1T3Q A;  5D3D A;  3IXS A;  3AEC B;  4YSY B;  1ENF A;  1D5X C;  3AEA B;  2N7J A;  4MT5 A;  4ITK A;  3W5U B;  3J9C A;  1XEE A;  4NAM A;  3BVM A;  3URY A;  1DGJ A;  2IGH A;  1N5W A;  1MPE A;  3AE4 B;  5BMH A;  1TS5 A;  1UWX A;  1NI3 A;  1SE3 A;  4YTM B;  2WXJ A;  4YWG G;  1RM6 C;  1ZOY B;  2BT6 A;  1KLG D;  2WXH A;  1OQR A;  4LK0 M;  4O1N A;  3SFD B;  1SB3 C;  1IGC A;  3B2G A;  3U2S C;  4A9A A;  4YTN B;  2X38 A;  1XLN A;  2NTS A;  1MHX A;  1PDX A;  4US9 A;  4A8X C;  1BML C;  2BW2 A;  1VLB A;  2KAC A;  4UDU C;  4XWW A;  1EWY C;  2LJI A;  2BB6 A;  1VZ7 A;  2DYO A;  2OHF A;  1L5P A;  2WU2 B;  4YTP B;  1TKY A;  5EE1 A;  1IGD A;  2KMM A;  4XWT A;  3W5V B;  1RFK A;  1ZXH A;  4L23 A;  2WP9 B;  1ZXI A;  3ZGZ A;  1IBX A;  2RMM A;  4NJC A;  1UGJ A;  1ET6 A;  4RGM A;  1GB4 A;  4M0W A;  3DWG C;  2MJ3 A;  2BS3 B;  3P4R B;  3SR6 A;  1ZDX A;  5H92 C;  2WXP A;  1JRO A;  1AYF A;  4AS1 A;  4XDD A;  2PLP A;  1FD6 A;  2BS2 B;  5C2T B;  2E3T A;  1N61 A;  2M0A A;  1ROE A;  3ETR A;  3FAH A;  2LHE A;  1JWM D;  1TS2 A;  1FFV A;  2RDG A;  3PZ7 A;  5EE0 A;  1J7A A;  2K9X A;  5FKA C;  1XLO A;  4HRS A;  3E56 A;  1VRA B;  3LB8 C;  4A90 A;  2G9H D;  1WRI A;  3I57 A;  2LEK A;  2WS3 B;  5HHD G;  5BYQ A;  1NEK B;  2J53 A;  2N9L A;  4RGN A;  1L0Y B;  2CU3 A;  5BYR A;  1T5X D;  4LLG M;  4KGR A;  1FMA D;  3HVD A;  3ZYY X;  2Z8L A;  1C76 A;  1YN5 A;  2MJD A;  1BXT A;  2NMQ A;  4OZA A;  1N60 A;  1QIL A;  1R7S A;  3V05 A;  4Q2J A;  1IBX B;  4C7Z A;  4DXF A;  3HRD D;  1VZ6 A;  4HRO A;  2WXF A;  2JXT A;  2M19 A;  3VR9 B;  3AMZ A;  1JAL A;  1GOZ A;  2FBW B;  5BMI A;  2CJN A;  3TUO A;  1K51 A;  1HZ6 A;  3VQI A;  4JPS A;  4GDK B;  1B9R A;  2W82 A;  1MHH E;  4L2Y A;  1IUE A;  4KGS A;  2BYT A;  2K22 A;  3E9S A;  3NRZ A;  2JX5 A;  4RCO A;  3EA6 A;  1SBB B;  1YN3 A;  3LYY A;  2QIE B;  1CJE A;  3AM9 A;  1V8C A;  4ZHO A;  3EUB 2;  4KGT A;  4XE0 A;  1E9M A;  2WXK A;  2NTT A;  4WH4 A;  5T8I A;  4OW0 A;  2AQ1 B;  4KKJ A;  1YNT E;  3UI3 A;  3MP9 A;  1YJJ A;  2ZW1 A;  1AWD A;  1NYQ A;  1FRR A;  1KTK A;  2GRI A;  3AE7 B;  1NEN B;  2JYT A;  3AH7 A;  2LUM A;  4RF0 A;  2WNM A;  1CK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...