1UWMA

Reduced ferredoxin 6 from rhodobacter capsulatus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AKIIFIEHNGTRHEVEAKPGLTVMEAARDNGVPGIDADCGGACACSTCHAYVDPAWVDKLPKALPTETDMIDFAYEPNPATSRLTCQIKVTSLLDGLVVHLPEKQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN VI
publication title Structure of a [2Fe-2S] Ferredoxin from Rhodobacter Capsulatus Likely Involved in Fe-S Cluster Biogenesis and Conformational Changes Observed Upon Reduction.
pubmed doi rcsb
source organism Rhodobacter capsulatus
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2004-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1uwmA00
3P1MA 2OHFA 2PKOA 1ZOYB 5H92C 1KFYB 1XLQA 5EE9A 3W9CB 1FRDA 3AE3B 4YTNB 2BS3B 1V8CA 3B2GA 3W5UB 4YSZB 1RM6C 4N59A 4WWMA 5G5GA 1JALA 1JROA 1NEKB 1QT9A 3AE1B 3AECB 5H8YE 1E10A 2BS2B 2CJNA 3AEDB 3P4QB 1E0ZA 3VRAB 1SIJA 4YSYB 3PO0A 1L0VB 1L5PA 3RPFC 3HVZA 1E9MA 3AM9A 2BT6A 2H89B 1XLPA 3VR8B 2WDQB 2WU2B 4ZHOA 2L83A 2M19A 1RWSA 2CU3A 3AV8A 4USAA 1DOXA 4HROA 3VR9B 2MH7A 2WS3B 1FXAA 1IUEA 4JWSC 1DGJA 2W55A 3SFEB 5C3JB 1E7PB 1ZXIA 2QJLA 1JRPA 2DWQA 2BS4B 3HUIA 4C7ZA 1ROEA 1FMAD 1PUTA 1JWAD 2EKIA 3AEAB 3FAHA 5G5HA 3AE9B 1J7AA 1N60A 2W3SA 2WQYB 3NVVA 4N6EB 1L6UA 1B9RA 1RFKA 2Q5WD 1NI3A 1YJJA 5AUIA 1QOFA 1E6EB 1JW9D 3BIID 1JQ4A 3P4RB 3VRBB 1A70A 2JQRB 3ABVB 3AE8B 5C2TB 2MJ3A 2WLBA 3P63A 1QF6A 1FM0D 4YTPB 1V97A 1YJIA 2K22A 4YXDB 2KMMA 1PFDA 1WXQA 2WDVB 2Y5CA 1L6VA 5AUKA 1NYRA 1WWTA 4C80A 1J7CA 2CJOA 1VDVA 1CJEA 1PDXA 1NENB 4WQMA 1FO4A 2JX5A 3NVYA 1GAQB 1ZUD2 1OQRA 3EUB2 3AEFB 2W3RA 1FRRA 1DOIA 1UWMA 2QIEB 1NVID 3AE4B 4IDIA 3WCQA 1ZP0B 2N0SB 4A9AA 2L52A 4LTUA 1FFUA 2FBWB 2KAJA 1FIQA 3NS1A 3CIRB 4JWUC 2PVOD 5EE0A 3LXFA 1AYFA 1TKEA 1TYGB 3AB5A 1R7SA 4ZOHC 4US8A 1CZPA 1QOGA 2ACZB 3W5VB 5MPOA 2DBYA 2H88B 4YT0B 2WP9B 2WU5B 4KX6B 1XO3A 3AE5B 1VLBA 3AEEB 3ETRA 1TJEA 4JX1C 1N5XA 1F0ZA 4ITKA 1N62A 1WYGA 2MJEA 1TKGA 2K5PA 1YQ3B 3AE7B 2M56B 3DWGC 3L4PA 3P4SB 2AX5A 3P4PB 3CWIA 1EWYC 3AE2B 3B9JA 4C7YA 4ZHPA 1JWBD 2HTME 3DWMA 3NRZA 2W54A 4N58A 1XLNA 1SF0A 1N61A 1T3QA 2E3TA 4HRSA 4FXCA 3B2FA 5GXGB 2MJDA 4YTMB 4P6VF 1J7BA 3SR6A 1FXIA 3NVWA 1SB3C 1TKYA 3AMZA 3SFDB 3AEGB 3HRDD 1DOYA 1XLOA 3KWLA 1RYJA 5EE3A 2B76B 2PIAA 3FC4A 1N5WA 1QOBA 1WRIA 2LEKA 1FFVA 1N63A 1AWDA 1WGKA 3AE6B 3AEBB 5EE1A 1OQQA 1YQ4B 4US9A 4YSXB 2G1EA 1I7HA 1QLBB 2K9XA 2WDRB 1OFFA 3ZYYX 1NYQA 3AN1A 1GPXA 1QOAA 1VJKA 2PVGC 3LB8C 3NVZA 3AH7A 1KRHA 1KF6B
chains in the Genus database with same CATH superfamily
1E5WA 3ZTDA 4WAAA 1EU3A 2A4ZA 1YN4A 2NMQA 2KQ4X 4KKIA 3IAM1 1QT9A 3H7PB 3K9PB 2GB1A 4YWGG 1ET6A 4MH0E 4E71A 4LK0M 3QX1A 2L8JA 1IGDA 3AI5A 1KLVA 2D3CA 2V4IB 3ZIMA 4W9FA 1SJHD 3H8HA 1J7AA 2KDFB 3SHQA 2Q5WD 3PZDA 1AW7A 1V1PB 1JW9D 3TMPB 2RSUA 1C9FA 2MSED 1R4MI 1YJIA 5KHQA 4CQNA 3M95A 5LLIA 3UIOB 2DLBA 2B3AA 2W3RA 3PHXB 4JL9A 3NZUA 2J42A 2FBWB 4GDKA 2KX3A 1CQVA 2C7MB 3Q3MC 1PGBA 2J0MA 4IWPA 1TZ1A 4BKSA 2ZPNA 1L4ZB 1MFWA 3QA8A 1B1ZA 1EF5A 4XYCA 5HG2A 4M0WB 3U52E 2C60A 2W54A 2WXLA 1STEA 2CKHB 3P2BA 4M02A 3H6NA 1I4RA 3RULA 3AMZA 3ZRCA 4MJSA 1RYJA 4W9KA 2J4XA 2K39A 2LEKA 1VZ8A 2IY0B 2G1EA 5D7GA 4NAWB 3LDZE 1QQRA 3PGEA 5CHVC 3KW5B 1IBXA 3A9KA 1WGGA 3U7DA 3TIXA 4OHJA 4BKGA 2MLBA 1EUVB 1WXMA 3U7ZA 3TUOA 1L0VB 4X57B 3RNGC 4A3PA 4RNAA 4REZA 4CHKA 4JLCA 3EGRA 4EFOA 3DVGY 2M19A 3U30A 4NQKE 2BWFA 4KVGB 2LHEA 4W9JA 2VRRB 3B08A 2WS3B 2LGIA 1T0SC 4I6PA 5C3JB 3PZ8A 1KJTA 2XBBC 2BB5A 1E7UA 3Q8BA 4JE3B 2AL6A 3AEAB 3AE9B 1GC7A 3T9LA 1L6UA 4EKUA 3QARA 3IT6B 5AUIA 4DXFA 5J18A 2KDBA 4DHZE 1FNVA 4XGAB 4LJPB 4HKQA 2NBUA 4ACFA 1XF5L 3L13A 1GAQB 1MPEA 4OZCA 2VZKB 1WX9A 1XCTL 1ZP0B 2L52A 4C4VB 1FIQA 1XXGA 1HZ5A 2MRPA 4IM3A 4G0NB 3UF8A 1D5XC 2I1KA 2M1MA 4P1BC 3W1SC 1N62A 2K5PA 4M8NA 1UGMA 2HTME 2L3ZA 2MBQA 1QILA 3SDLC 1C76A 2KYWA 3TJPA 2WXHA 1WXVA 2G4SA 2N9XA 5BYQA 2V1YA 2KVZA 4M8MA 3VVWB 4WQOB 1FFVA 2LRWA 1AWDA 3JSVA 1OQQA 2KKCA 3EECA 1YX6B 1PGXA 2AWTA 1ZOYB 1P0RA 2MQJA 2N1VA 4WWMA 5EDSA 4DHJB 3Q14C 1K8RB 1SGHA 3CSTA 2N9PC 2FCSA 3N32A 3A9JA 3UQAA 1MHHE 3HVZA 3ML9A 4XZ4A 3APFA 3RCZA 2L76A 3SU8X 2XNAC 3UQBA 2KDEB 3RFZB 2GOWA 3R2IA 3L10B 1IP9A 1GUAB 1JRPA 3ZNGC 3IBEA 1WGDA 1F52A 3NY5A 4HCNB 1K51A 4GB9A 2KDIA 1N60A 2J7QB 2W3SA 2LWPA 4I6LB 3DHGC 2FNJB 4HKZE 3BVGA 4RF1A 3EC8A 1L6VA 1NENB 1HZ6A 1JMLA 1NI2A 3IXSA 2ASQA 5DPSA 1NVID 5DCNA 1UD7A 2DZKA 2V3NA 2BVCA 3Q3FA 2IGGA 2PVOD 4US8A 2YLMA 4YT0B 2RPVA 3QK0A 1VLBA 4F8CB 1F2RC 2ZZPB 4A20A 2LI5A 1YQ3B 3W1YA 4FLHA 2KFKA 4EUTA 3AE2B 4M01A 2E3TA 4YTMB 4P6VF 2N9KA 5IP4D 2RGFA 3A4SC 3DOWA 3LJ3A 1PGAA 1ZXHA 2G3QB 1WE6A 5IO9A 2XK5B 4PS7A 1QOBA 2Z59B 4RGTA 4B9KA 5D3IB 5FKAC 2BTEA 3C8YA 1L0XB 3IHPC 1LM8B 3Q6BA 1K50A 4HDOA 2DNFA 4FN2A 4RGOS 3PHWB 4WWNA 1LXDA 3P1MA 3OJ3A 2JXXA 2GLSA 2RD0A 2REXA 3HM6X 3AECB 3AEDB 2KNBA 3ZLZA 2KN4A 3B0AA 1EO6A 1EU4A 2MP2B 1GB1A 3QIJA 3VR8B 2WXPA 2RDBC 4GDLB 3GB1A 2DZMA 2IBIB 3ZVVA 3SFEB 4MEMA 3ZJUA 2WWZA 2WX1A 4B0EA 2NBVB 2WXOA 2IY1B 2KX0A 1WM3A 2J0JA 4KV2A 1WIAA 3TL5A 2K8HA 4PS8A 1IGCA 1J0GA 2JZPA 3PRPB 3DBLI 3ZUNA 4JQWC 2OOBB 5IKCM 2G45B 2VZKD 2YEPF 1OQRA 1YOVB 5T8IA 4XDDA 2QIEB 3VUWA 5FK9C 1Y8RC 4NJ6A 1WRDB 1RAXA 1ZDVA 5G2NA 4RH6A 3I63C 2FUG1 3Q8CA 4TUUA 3B9JA 1EWYC 2NR2A 2ZJDA 2TSSA 4HRSA 1UBIA 2LXCA 2GBMA 2QILA 3PZ7A 4LNIA 1FXIA 2OJWA 2Z8LA 5AZFA 4AJYB 1PQSA 2WXMA 3GS2A 2QCZA 5EE3A 3ZJTA 2WNMA 1LGRA 1YN5A 2EMSA 5DPTA 4ANWA 2EKEC 4FJVB 2RDGA 4EE2A 4GMVA 2OHFA 3KLSX 1SBBB 4KKJA 3HK0A 5G5GA 3MC9A 4MGZE 1JWUD 2AQ3B 3ZXVA 1IYFA 3WAMA 1EF1A 3RPFC 2IDYA 2LGYA 5E6JA 2KWUB 2Y5PA 1XEEA 2GBJA 1CMXB 1MG4A 4RGNA 5BYRA 3GOEA 5AEKB 1JCKB 4AUQC 4HPMB 2BS4B 3ALBA 5HKHA 2CHZA 3Q69A 3NVVA 1V2YA 3ZW3A 2KD0A 1QOFA 2NTSA 2I38A 1I4GA 5TR5A 1YD8U 1TS5A 1FM0D 3M3JA 4RFBA 2I2YA 5AUKA 3TCAA 1FO4A 4BBNF 3VXWA 3TSSA 4FHJA 2ZNVC 1H8CA 3DVGX 2BF8B 1FFUA 1AARA 5HHDG 5JHAA 1NDDA 3W5VB 2H88B 2WU5B 1J19A 1SEBD 3AE5B 4ARCA 5TSSA 1U4AA 4JIOU 2KLGA 3GP7A 1TKGA 2KHWB 4IUMB 4C7YA 4ZHPA 4JPSA 1UBQA 3NRZA 1WYWB 3R3MA 4WIPA 2EMTA 2PJHA 2LD9A 1V49A 4HK2A 4G11A 1WF9A 4DHZB 2K25A 1ZDXA 4AQ7A 1I4PA 3H7PA 2K9XA 2D11A 3RNAC 4ARIA 2R2OA 5FR6A 4IW0A 1XCQL 5CHWA 2CHWA 5J17A 2PEAA 3T3NA 1SIJA 4LNNA 2D2QA 4S17A 2FAZA 3CMMB 2A5UA 2MWSB 1V1PA 1MI0A 1DOXA 2GBRA 4MT5A 2KMCA 3VH4B 2EKIA 2LMCA 1C79A 4RCOA 1WY8A 2BYVE 4K3CA 2KQSA 2NS5A 2XN9C 4GU2A 4KSKC 4YTPB 3QAQA 2JZZA 2INPE 4MGYE 1CJEA 3ZNZB 2X38A 1Q10A 1FCCC 3HHMA 3RUIB 3WCQA 5I4DA 4F1SA 4M0WA 4HLEA 5EE0A 4GSWA 4LCDE 3AB5A 1CZPA 2HTHA 3SD5A 4EOYA 1XQQA 4MM3B 1SIFA 4ZRKA 2RPQA 3L4PA 3CWIA 2QMTA 2Y3AA 4HWIB 3ZRFA 5BO4B 3B1LX 4D2KA 2FE8A 4HJKA 2KQ7A 4NAWA 3JVZX 4KGTA 5E6OA 3FC4A 2NVUI 2JU6X 4FHKA 1WGKA 1SXTA 2LVPA 3Q3JA 3BVZA 3LB8C 1WJUA 2KTRA 3QCAA 2PKOA 1KFYB 1XLQA 3AE3B 3B2GA 4O1NA 2W9NA 5G55A 3A1QB 3OG5A 1E10A 1E0ZA 3WIMA 1GB4A 1FNWA 4YSYB 3PO0A 2WXFA 1R4NB 2JF5A 2L83A 1RWSA 1T5XD 4JWSC 4ZRPA 1V80A 5D2MB 2LJ5A 2M4NA 2GBKA 1FMAD 3S2AA 2BKRB 2JUOA 1RFKA 1ESFA 1WGRA 3VRBB 2N4FA 2WXRA 2KTRB 1UWXA 1V97A 4C4VA 2O2VB 3K9OB 1PFDA 2KWDA 1SE9A 3RNEC 5BMHA 2LFIA 1KH0A 3L08A 2M17A 3BYTB 4ANXA 1DOIA 4A9AA 3R8BA 1ZPSA 2Z0EB 2K8BA 5IAAC 1TKEA 1TYGB 1Z2MA 2DBYA 3BY4B 3RNBC 1KM7A 2DENB 2L7RA 4WJOA 2MJEA 4IWQA 3WANA 3FILB 4HJGE 1FPYA 2Z0DB 4ICVA 5E6NA 1T3QA 2GBNA 1FCLA 3N1ZC 1WJNA 1BT0A 1SB3C 1JWSD 3R7RA 2PLPA 2WDTB 4FULA 3L54A 1WRIA 3AE6B 4PS3A 4YSXB 3ZYYX 2PVGC 2IO3B 2MBBB 3DBRI 2FUHB 1KRHA 4TQ0A 1P7EA 5H92C 2KACA 1HTQA 1V8CA 2WXIA 3MHSD 2QC8A 4ZRIA 4ICUA 3GE3C 2KOXA 3T3OA 3AM9A 4URKA 2H89B 5CX3A 4KZ0A 4A90A 3JW0X 2WU2B 4ZHOA 2INDC 2JXTA 2CU3A 1AN8A 1TZOA 4OVVA 2MA9B 1YNTE 3GZNI 3AU5A 1P9DU 1RLFA 3Q8EA 4TV3A 1R4MB 2IYDB 1P3QU 3KYDD 3WAPA 3TBLD 2HJ8A 5FR3A 4B6WA 2G4DB 4IKGA 1A70A 3KQ4A 4OW0A 3ZNHB 3P42A 2KWVB 4FBJB 2WHIA 1HQRD 2LRUA 1QF6A 1D5MC 1ZGUB 2LVQA 2ONQA 1WXQA 1NYRA 2KO3A 3VTWA 2CJOA 3RN9C 4ANVA 1TY0A 1V9JA 4IG7B 5D94A 3ZQ4A 1UNSA 4NQLB 1ZW7A 5CTRC 3AE4B 3FKYA 4S0RA 4LTUA 3D32A 2BYTA 2UYZB 3APCA 4TMAB 5MPOA 2M0AA 2DAJA 4KX6B 1XO3A 4LJOB 1UF0A 3MJWA 3I57A 4DQOC 2MCNB 3ZGZA 3P4SB 4L2YA 2M56B 3TEWA 2W82A 2WXNA 2XK5A 2INCC 3ML8A 4OZAA 2V3PA 2AQ1B 2KANA 4BZAA 3IVFA 4RGMA 2LASA 3KUDB 3L0WB 3N1YC 2B76B 1N5WA 1VZ7A 1T0RC 1X1MA 4ANUA 3SEBA 1C4CA 2RMMA 2M8SA 1QOAA 2PE6B 3NVZA 3AH7A 1V6EA 2MP2A 4W9HA 2MHJA 4GDLA 4NZLB 1MJDA 5D3DA 1JROA 4TQ1A 4K3BA 2IZVB 3AE1B 3GE8C 3MP9A 3VRAB 3N3KB 2K8CA 3DCGA 4RF0A 2JRIB 3E56A 3DQVA 4W9CA 2JRHA 3IG3A 2KJRA 1CK1A 3AV8A 4HROA 4DWFA 1S1QB 2WYQA 4HPPA 1WR6E 3RZFA 1WH3A 4W9EA 4C7ZA 4K7UA 1WE7A 3A33B 1MG8A 3AE8B 1J8CA 4OZBA 4TSSA 1WX7A 4IM0A 3R7QA 4LLGM 2WDVB 3MTNB 3L17A 2JWZA 1J7CA 1PDXA 3A4RA 3PREA 3I3TB 3WAOA 5JHBA 4E3CA 1EM7A 3NS1A 2KAJA 1NBFC 3M62B 2RDHA 5BMIA 1I4XA 4ZOHC 2N7EA 5LXHA 2KC1A 1F77A 4AP4C 1F9JA 3AE7B 1WR1A 2AX5A 4C56C 3HM3A 2NPTB 3DWMA 1SF0A 3DBHI 3NZSA 2WXJA 3B2FA 2J53A 4FA6A 1DOYA 1G6JA 3KWLA 1I4HA 1VZ6A 2LUMA 3U4EG 3RMKC 4GLSC 2WDRB 4WURA 3QQ8B 4KGSA 1FRDA 2AEHA 1OQYA 1HA5A 3RNFC 5KHOA 1L5PA 4W9IA 5GMVA 1FNUA 4OVUA 2SAKA 2D10A 1V81A 4USAA 4XWTA 1SE4A 2W55A 4ZRJA 1E7PB 3DHHC 2VH2A 2K6QA 1ROEA 3AU4A 4OVZA 4HCPB 3PPAA 4AWJA 2JYTA 5JXVA 1Q1OA 4G3XB 4BFRA 2D3AA 1TIFA 1WWTA 4EZJA 3QHTA 3EUB2 2D07B 3ZNID 2V3SA 2JVCA 4WJNA 4NNJB 1P98A 1FXTB 2KFJA 1VR9A 4WWOA 1OGWA 4LNFA 2C5LC 2ZCBA 2INNE 4WWPA 3W1SA 3MFGA 4BVUC 2CR5A 1XLNA 3HIZA 3UIPB 5GXGB 3PV1A 2IO0B 3U2SC 3SFDB 3R66C 1XLOA 1D5ZC 5JH5C 1SE3A 1N63A 2L0TA 1YQ4B 3N20C 2LVOA 2BQQA 2ZEQA 1V5OA 1VCBA 3DVNU 1YJ1A 3OLMD 1C78A 5EE9A 1TY2A 5AZHA 3UGBB 1FD6A 3ENEA 4MACA 2ZW0A 4LNOA 1KLGD 2LHDA 3NHEB 2L32A 3V6CB 3VR9B 3ZDMC 2MEKA 4II2B 3DBLB 3HUIA 5G5HA 1JWMD 3IAS1 5IOIA 1B9RA 1YJJA 4RMAA 3BIID 4PYUA 3TEXA 4KZCA 2WLBA 2JZ3B 2BGFA 1YX5B 3PLVA 1WMHB 1KTKA 4C00A 2K22A 1A5RA 1T0QC 1YN3A 4KSLC 4MGKE 2HDEA 4IWOA 3V05A 1ZUD2 4MM3A 3C19A 3EHVA 4BAXA 1OEYA 1I42A 1FEHA 3IT4B 3LXFA 1OTRB 4AS1A 2N9LA 3EFUA 1WZ0A 2ACZB 5C23A 4Q2JA 1I4QA 2GRIA 1TJEA 2KJHB 3QC8B 3VTUA 2IPKD 3U8ZA 4HEA1 3VAWA 5DPRA 2PPHA 2L05A 5HI1A 1GNUA 1WJ6A 4XE0A 4IOIE 3I5JC 3AEGB 4WJPA 2PIAA 2L00B 3O13A 4MELA 1S3SG 3V61A 3A1QA 3KYCD 1C77A 2DX5B 2WXKA 1OFFA 1PYWD 1NYQA 4A8XC 1VJKA 4J3OD 4DXGA 2L1AA 4P16A 2BS3B 4EZLA 3W5UB 1RM6C 3O65B 5J2RA 5CHFA 5H8YE 2BS2B 2CJNA 3DHIC 5LNK1 2WDQB 2AYOB 2JWUA 1BUIC 3ZJVA 2HJ1A 1FXAA 1SJED 1Q0WB 1ZXIA 2QJLA 4B0MA 2DWQA 2O2VA 2IO1B 2WQYB 3Q3NC 4YL8A 2ZW1A 1E7VA 1NI3A 1Q5WB 1E6EB 3VDZA 1C4PA 5AZGA 2O6VD 3BINA 1LO5D 4P7IA 4I6NB 3J9CA 1MVKA 3VUXA 2RR9A 2KVRA 3NG0A 2Y5CA 3VUYA 1KOTA 5L83A 3N9YC 1WGHA 3MJ5A 3Q3OC 3EA6A 3FILA 2JSVX 3T8MA 4WJQA 1UZXB 4MSMB 2SEBD 1KLUD 2WP9B 4HDQA 2NTTA 4FADA 4JX1C 1WYGA 1E8WA 4W9GA 4GDKB 1P7FA 3VHTC 4N58A 4ZYSA 2YVCA 4FXCA 2AQ2B 2MJDA 2N7JA 3SR6A 4G50A 2BYFA 3HRDD 4A6QA 1L7YA 1SSNA 3DDCB 1UELA 4MGIE 1EWCA 3Q8AA 1HE8A 3AEBB 1WJ4A 3OAWA 1E8XA 4US9A 1I7HA 3R2TA 4BBNC 3PRZA 3Q8FA 4MJSB 1KF6B 1XD3B 3ZKJC 2LJIA 4YSZB 2K0PA 2IGDA 2KN5A 1JALA 2BYEA 2D5GA 5HFYA 1IBXB 2BT6A 2QHOA 1BMLC 1XLPA 3A9KB 4W9DA 2N7DA 4WAFA 2DZIA 2MH7A 1Y56A 1IUEA 3URYA 2PTLA 2HD5B 2ZVNA 4B95A 4XWWA 2BBCA 2C9WB 4N6EB 1HTOA 1LQBA 1L0YB 3QJZA 3JYUA 4XC2A 2DHZA 2JQRB 1L2NA 4L23A 1ZE3D 4YXDB 5E6PA 2FCMA 1YQBA 5C1ZA 4LDTB 3H1UA 1HXYD 3NVYA 2X8XX 3AEFB 1FRRA 4L1BA 2NBWB 4CO7A 2DZJA 1TS3A 3RZWC 3ZTCA 3VH3B 1QKZA 3X0WA 3W2DA 4NPNA 4II3B 1N5XA 2ZCCA 4IC7B 2PW9A 1ET9A 2V9HA 3P4PB 2D3GA 2BWES 3L16A 3TEYA 1M4VA 1MHXA 2KDMA 3NZ3A 4PK1A 1V5TA 3V62A 3H9DA 1TKYA 2K1FA 2OJRA 4GIVA 2WX0A 2D3BA 3NS8A 2L0FA 3EFCA 4HPLB 2LGDA 1VD2A 2FCQA 2WXQA 1C3TA 4N9F4 3DBSA 1D6EC 2ZNVB 4MDKE 4K1RB 4ASWC 1ENFA 1C4AA 4JGHB 2MW5A 3E9SA 4A3OA 1ZKHA 4E74A 3W9CB 2IO2B 1IPGA 3N1XC 3BK2A 4A55A 2NCNA 1GC6A 3JSVB 3RYTA 4IM2A 3P4QB 3BZDB 4M00A 4KDLB 3MHZA 1I35A 3VQIA 3RT3B 5IA7A 4P1CC 1GJZA 1GOZA 3TEZA 2I1JA 3M63B 3C0RB 4BOSC 3ZDTA 3A9JB 3CSFA 1ISNA 3FAHA 4PYZA 3NUHB 4KIKA 4BOZB 2CHXA 2MJ3A 3BVMA 2R61A 4RM8A 1WSPA 3ECIA 3NOBA 4DBGA 4EZKA 5BYSA 1RFAA 2JPHA 4C80A 2MBEA 5L95C 4FJZA 1GG3A 1UWMA 1TS4A 2QSDA 3V60A 1WZ3A 1H4RA 2NPTA 1AYFA 1QOGA 2FCNA 5IN7A 4K7SA 2WGSA 1D4BA 3X23A 1K53A 4KDIC 1F1HA 1DYQA 3DWGC 4AOFA 1UGJA 4DDID 2KWCA 4BKSD 4WH4A 2JT4B 4KIKB 4TKNA 1J7BA 3NVWA 2OEDA 3DBRB 2HE7A 4R3DA 2KFKB 1TT5B 2GMIC 3KH0A 1LFDA 3ZXRA 5LXIB 3KUZA 2PE9A 4GN1A 4DDGD 1QZEA 3BYYB 3PRMB 2MBOA 4HXDA 4RM9A 2IGHA 4YTNB 2G9HD 2KJ6A 3GZNB 1NEKB 3KUCB 2IJ0A 4F7ZA 1ACCA 3N30A 4ZRQA 2YEPB 2CU1A 2C7HA 3ZO5B 3DVNV 5JZEB 3IFWB 3RD2A 5DPWA 2QDFA 2O6VA 4DXAB 2K6DB 3BK1A 5BMGA 3VFKA 1PUTA 1JWAD 1UUPA 1WI0A 3BWUD 2J52A 4NJCA 1D3ZA 3PSEB 3APDA 1TBEA 5C2TB 2KZRA 4LNKA 1YMHE 2BB6A 2UU7A 2V4LA 4W9LA 4LDTD 3RNCC 1WFYA 1VDVA 3WALA 1VRAB 2JX5A 3HVDA 2UWQA 1Z5SB 4IDIA 3V3XA 1TS2A 2N0SB 3Q2AC 2N9EB 2Y5BB 3CIRB 2FIDA 2LUEA 3WA0A 1T6BX 2DYBA 3ETRA 2O6VB 4FJYA 4HVBA 4NAMA 4NJ7A 1L4DB 1TGZB 2M0XA 2C7NB 4DHJD 1M94A 2PMVA 3QWZB 3NJTA 2JY6A 4GOCA 2KXJA 2MBHA 3KVFB 3UI3A 2BKFA 1HEZE 1WX8A 1V86A 4ZDVA 3AN1A 2ON8A 2LGSA 2FIFA 4ZYNA 3PVLA 2AL3A 4BKTA 1F2RI 3OWEB 4EEWA 2J0KA 2LGXA 4N59A 4DK5A 2DYMA 1OEYJ 1N6ZA 2N1WA 1E9MA 4QAYA 4NY0A 3I9V1 2KTFA 4PT5A 2KMAA 3PLUA 4J6IA 4MSQB 4XDCA 3V6EB 2CS4A 2DAFA 1DGJA 3LYYA 3MC8A 2MX2A 1K52A 2KT7A 1WMHA 5D6JB 1SE2A 3CF6E 4MH8A 2VH1A 4UDUC 1R4NI 3H7SA 3PS6A 3DPDA 1JQ4A 1WM2A 3P4RB 1T0YA 3ABVB 4H2AA 3P63A 2EELA 2KMMA 3PTFC 4WQMA 2E6XA 2QEJC 2KK8A 1YIWA 1V1OA 2WXGA 2GI9A 3MC0B 4AJWA 2JYEA 2BW2A 1C1YB 2R2QA 1E8ZA 4JWUC 3VTVA 2LXAA 4XX5A 1R7SA 3DBHB 2ZVOA 2V0GA 3AULA 1WXSA 2ICIA 2KC2A 3AEEB 4CYEA 4GXBA 3RI7C 1F0ZA 4ITKA 3UINB 2KLCA 3AXCA 4GGQA 3OJ4B 1BXTA 2XEWA 1JWBD 1RRBA 1JRUA 1N61A 1E90A 4K81A 2ZPYA 1TTNA 4KGRA 2K3UA 2BPSA 3PT2B 1E8YA 1P1AA 1WGYA 2DYOA 3ONSA 5EE1A 1GPXA 1QLBB 3KWVA 1UH6A 1WXAA 1XT9B 4K7WA 2LZ6A
chains in the Genus database with same CATH topology
2OHFA 1EU3A 1YN4A 2NMQA 4NZLB 2KQ4X 2LJIA 1SBBB 3KLSX 4KKJA 4KKIA 4YSZB 5D3DA 2K0PA 5G5GA 2IGDA 3IAM1 1JALA 1JROA 4TQ1A 1QT9A 1JWUD 2AQ3B 3AE1B 3MP9A 3VRAB 2D5GA 2GB1A 4YWGG 3RPFC 5HFYA 1ET6A 4RF0A 1IBXB 3E56A 2BT6A 1BMLC 1XLPA 2IDYA 4LK0M 5E6JA 1CK1A 2Y5PA 3AV8A 4WAFA 4HROA 1XEEA 2MH7A 1Y56A 1IUEA 1IGDA 2PTLA 4RGNA 5BYRA 3URYA 1JCKB 2V4IB 2BS4B 1SJHD 4C7ZA 3Q69A 4XWWA 2BBCA 3H8HA 1J7AA 4N6EB 3NVVA 1L0YB 2Q5WD 1AW7A 1V1PB 1QOFA 2NTSA 2I38A 1JW9D 1I4GA 1C9FA 2JQRB 3AE8B 4OZBA 1TS5A 4TSSA 1FM0D 4L23A 1ZE3D 1YJIA 4YXDB 4LLGM 4RFBA 2I2YA 2WDVB 5AUKA 4CQNA 1J7CA 1FO4A 1PDXA 1HXYD 3NVYA 2DLBA 3AEFB 2W3RA 3TSSA 1FRRA 4L1BA 1EM7A 2J42A 1FFUA 2FBWB 2KAJA 3NS1A 5HHDG 2RDHA 1TS3A 5BMIA 1I4XA 1CQVA 4ZOHC 1PGBA 1QKZA 3W5VB 2H88B 2WU5B 3W2DA 1SEBD 3AE5B 1F77A 4ARCA 5TSSA 1N5XA 1L4ZB 2PW9A 1B1ZA 3GP7A 1TKGA 1ET9A 3P4PB 3AE7B 3TEYA 5HG2A 2AX5A 4C56C 4C7YA 3U52E 4ZHPA 1M4VA 1MHXA 2KDMA 3NZ3A 4JPSA 3DWMA 3NRZA 2W54A 2WXLA 1STEA 1SF0A 4WIPA 2WXJA 3B2FA 2J53A 1I4RA 1TKYA 3AMZA 1DOYA 3KWLA 1RYJA 2J4XA 1I4HA 1ZDXA 4AQ7A 1I4PA 2LEKA 2WXQA 1VZ6A 1VZ8A 2LUMA 3U4EG 1D6EC 2G1EA 2K9XA 2WDRB 4GLSC 4ARIA 5D7GA 4NAWB 1QQRA 4WURA 1IBXA 1ENFA 1C4AA 3E9SA 4KGSA 3W9CB 1XCQL 1FRDA 3BK2A 4OHJA 1HA5A 4A55A 3T3NA 3P4QB 3U7ZA 1SIJA 3BZDB 3TUOA 1L0VB 1L5PA 3MHZA 4RNAA 4REZA 3VQIA 1FNUA 3EGRA 2SAKA 2M19A 1V1PA 1GOZA 1MI0A 4USAA 2LHEA 1DOXA 4XWTA 2WS3B 1SE4A 2LGIA 3TEZA 2W55A 5C3JB 1E7PB 4MT5A 3PZ8A 2BB5A 3Q8BA 1ROEA 4JE3B 2EKIA 2LMCA 3AEAB 3FAHA 3AE9B 3NUHB 1C79A 4OVZA 4RCOA 1L6UA 3IT6B 5AUIA 2JYTA 5JXVA 4DXFA 2XN9C 2MJ3A 3BVMA 2R61A 1WSPA 4YTPB 1FNVA 2INPE 5BYSA 1WWTA 4C80A 4HKQA 1XF5L 1CJEA 2X38A 1GAQB 1Q10A 3EUB2 1MPEA 1FCCC 4OZCA 2VZKB 1UWMA 1XCTL 1TS4A 3WCQA 1ZP0B 2QSDA 5I4DA 2L52A 4M0WA 1FIQA 1XXGA 1HZ5A 5EE0A 1AYFA 3AB5A 1CZPA 1QOGA 1D4BA 1D5XC 1VR9A 4MM3B 1K53A 1N62A 2K5PA 1DYQA 2INNE 3DWGC 3L4PA 3W1SA 3MFGA 3CWIA 2QMTA 1UGJA 2Y3AA 2HTME 1XLNA 4WH4A 1QILA 1C76A 5GXGB 4D2KA 2FE8A 1J7BA 2WXHA 3NVWA 2OEDA 3U2SC 5BYQA 3SFDB 4R3DA 1XLOA 4KGTA 1D5ZC 3FC4A 1SE3A 2JU6X 1FFVA 1N63A 1AWDA 1WGKA 1OQQA 1YQ4B 1SXTA 3BVZA 3LB8C 3BYYB 1C78A 1PGXA 2PKOA 1ZOYB 1KFYB 2IGHA 1XLQA 1TY2A 5EE9A 3AE3B 4YTNB 3B2GA 2G9HD 4O1NA 4WWMA 1FD6A 1NEKB 1E10A 4MACA 1E0ZA 2ZW0A 1KLGD 2IJ0A 1FNWA 1ACCA 3PO0A 4YSYB 1MHHE 1GB4A 3HVZA 2LHDA 4ZRQA 2YEPB 2WXFA 2XNAC 2L32A 2L83A 1RWSA 3RFZB 3R2IA 3VR9B 1T5XD 4JWSC 4ZRPA 2MEKA 1JRPA 3HUIA 3BK1A 5BMGA 5G5HA 1FMAD 1JWMD 1JWAD 1K51A 1PUTA 1UUPA 3IAS1 1N60A 2W3SA 3BWUD 2J52A 1RFKA 1B9RA 1ESFA 1YJJA 4NJCA 3BIID 3VRBB 3TEXA 5C2TB 2WLBA 1YMHE 4HKZE 2WXRA 2BB6A 1UWXA 1KTKA 1V97A 2K22A 1PFDA 3BVGA 2KWDA 1YN3A 4RF1A 5BMHA 1L6VA 2LFIA 1VDVA 2HDEA 1NENB 1HZ6A 1VRAB 2JX5A 3V05A 1KH0A 1JMLA 1ZUD2 3HVDA 3IXSA 3BYTB 1DOIA 4IDIA 3V3XA 1NVID 1TS2A 2N0SB 2V3NA 4A9AA 3R8BA 1FEHA 1ZPSA 2IGGA 3CIRB 2PVOD 3IT4B 3LXFA 1TKEA 1TYGB 4US8A 4AS1A 2N9LA 1T6BX 2ACZB 2DBYA 4YT0B 4Q2JA 2RPVA 1I4QA 1VLBA 2GRIA 3ETRA 1TJEA 2IPKD 4HEA1 1F2RC 4NAMA 2MJEA 1YQ3B 3AE2B 3FILB 4HJGE 1L4DB 5HI1A 1T3QA 2E3TA 1FCLA 4YTMB 4P6VF 2N9KA 2PMVA 1SB3C 4XE0A 4IOIE 1JWSD 3AEGB 2PLPA 1PGAA 1ZXHA 2PIAA 3O13A 3UI3A 1QOBA 4RGTA 1WRIA 1HEZE 3AE6B 5D3IB 5FKAC 2BTEA 3C8YA 1L0XB 4YSXB 1C77A 2WXKA 3ZYYX 1K50A 1OFFA 1NYQA 1PYWD 3AN1A 4A8XC 2ON8A 1VJKA 2PVGC 4J3OD 4RGOS 1KRHA 4DXGA 3P1MA 1P7EA 2L1AA 4TQ0A 4P16A 5H92C 2KACA 1F2RI 3OWEB 2BS3B 1V8CA 3W5UB 1RM6C 4N59A 2WXIA 5H8YE 3AECB 2DYMA 2BS2B 2CJNA 3AEDB 2KN4A 1EU4A 1E9MA 3T3OA 3AM9A 5LNK1 3I9V1 1GB1A 2H89B 3VR8B 4A90A 2WXPA 2WDQB 2WU2B 4GDLB 4PT5A 4ZHOA 2JWUA 2JXTA 3GB1A 2CU3A 4XDCA 1AN8A 1BUIC 1TZOA 3ZJVA 1YNTE 1FXAA 1SJED 1DGJA 3Q8EA 3LYYA 3SFEB 1ZXIA 1K52A 2QJLA 4B0MA 2DWQA 3ZJUA 1SE2A 4MH8A 4B0EA 2WQYB 4UDUC 2WXOA 5FR3A 2ZW1A 1NI3A 4IKGA 1E6EB 1C4PA 1JQ4A 3P4RB 1A70A 1LO5D 3ABVB 3KQ4A 4OW0A 3P42A 1IGCA 4H2AA 3P63A 2JZPA 1HQRD 3J9CA 1MVKA 1QF6A 1D5MC 2EELA 2KMMA 2ONQA 1WXQA 2Y5CA 1NYRA 2CJOA 4WQMA 2E6XA 2VZKD 3N9YC 2YEPF 1OQRA 1TY0A 2QEJC 3ZQ4A 1UNSA 5T8IA 4XDDA 1V1OA 2WXGA 2GI9A 3AE4B 2QIEB 3MC0B 3MJ5A 2JYEA 2BW2A 5FK9C 4LTUA 4JWUC 3EA6A 3FILA 2BYTA 2JSVX 1R7SA 2V0GA 4TMAB 5MPOA 2M0AA 2SEBD 1KLUD 2WP9B 2NTTA 4KX6B 1XO3A 2ICIA 4JX1C 3AEEB 1ZDVA 3I57A 4DQOC 4RH6A 1F0ZA 2FUG1 4ITKA 3ZGZA 1WYGA 3P4SB 4L2YA 2M56B 3TEWA 2W82A 3Q8CA 1BXTA 1EWYC 1P7FA 2WXNA 3B9JA 4GDKB 1JWBD 2TSSA 4N58A 4ZYSA 4OZAA 2V3PA 4HRSA 1N61A 2AQ1B 4FXCA 2AQ2B 2MJDA 2N7JA 2QILA 3PZ7A 3SR6A 1FXIA 2Z8LA 4RGMA 2WXMA 4KGRA 3HRDD 3GS2A 4A6QA 5EE3A 2K3UA 3ZJTA 2B76B 1SSNA 2WNMA 1N5WA 1VZ7A 1YN5A 1EWCA 3Q8AA 3AEBB 2DYOA 5EE1A 4US9A 3SEBA 1I7HA 1QLBB 1GPXA 1C4CA 2RMMA 3KWVA 3R2TA 2RDGA 1QOAA 4EE2A 3Q8FA 3NVZA 3AH7A 1KF6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1M A;  2OHF A;  2PKO A;  1ZOY B;  5H92 C;  1KFY B;  1XLQ A;  5EE9 A;  3W9C B;  1FRD A;  3AE3 B;  4YTN B;  2BS3 B;  1V8C A;  3B2G A;  3W5U B;  4YSZ B;  1RM6 C;  4N59 A;  4WWM A;  5G5G A;  1JAL A;  1JRO A;  1NEK B;  1QT9 A;  3AE1 B;  3AEC B;  5H8Y E;  1E10 A;  2BS2 B;  2CJN A;  3AED B;  3P4Q B;  1E0Z A;  3VRA B;  1SIJ A;  4YSY B;  3PO0 A;  1L0V B;  1L5P A;  3RPF C;  3HVZ A;  1E9M A;  3AM9 A;  2BT6 A;  2H89 B;  1XLP A;  3VR8 B;  2WDQ B;  2WU2 B;  4ZHO A;  2L83 A;  2M19 A;  1RWS A;  2CU3 A;  3AV8 A;  4USA A;  1DOX A;  4HRO A;  3VR9 B;  2MH7 A;  2WS3 B;  1FXA A;  1IUE A;  4JWS C;  1DGJ A;  2W55 A;  3SFE B;  5C3J B;  1E7P B;  1ZXI A;  2QJL A;  1JRP A;  2DWQ A;  2BS4 B;  3HUI A;  4C7Z A;  1ROE A;  1FMA D;  1PUT A;  1JWA D;  2EKI A;  3AEA B;  3FAH A;  5G5H A;  3AE9 B;  1J7A A;  1N60 A;  2W3S A;  2WQY B;  3NVV A;  4N6E B;  1L6U A;  1B9R A;  1RFK A;  2Q5W D;  1NI3 A;  1YJJ A;  5AUI A;  1QOF A;  1E6E B;  1JW9 D;  3BII D;  1JQ4 A;  3P4R B;  3VRB B;  1A70 A;  2JQR B;  3ABV B;  3AE8 B;  5C2T B;  2MJ3 A;  2WLB A;  3P63 A;  1QF6 A;  1FM0 D;  4YTP B;  1V97 A;  1YJI A;  2K22 A;  4YXD B;  2KMM A;  1PFD A;  1WXQ A;  2WDV B;  2Y5C A;  1L6V A;  5AUK A;  1NYR A;  1WWT A;  4C80 A;  1J7C A;  2CJO A;  1VDV A;  1CJE A;  1PDX A;  1NEN B;  4WQM A;  1FO4 A;  2JX5 A;  3NVY A;  1GAQ B;  1ZUD 2;  1OQR A;  3EUB 2;  3AEF B;  2W3R A;  1FRR A;  1DOI A;  1UWM A;  2QIE B;  1NVI D;  3AE4 B;  4IDI A;  3WCQ A;  1ZP0 B;  2N0S B;  4A9A A;  2L52 A;  4LTU A;  1FFU A;  2FBW B;  2KAJ A;  1FIQ A;  3NS1 A;  3CIR B;  4JWU C;  2PVO D;  5EE0 A;  3LXF A;  1AYF A;  1TKE A;  1TYG B;  3AB5 A;  1R7S A;  4ZOH C;  4US8 A;  1CZP A;  1QOG A;  2ACZ B;  3W5V B;  5MPO A;  2DBY A;  2H88 B;  4YT0 B;  2WP9 B;  2WU5 B;  4KX6 B;  1XO3 A;  3AE5 B;  1VLB A;  3AEE B;  3ETR A;  1TJE A;  4JX1 C;  1N5X A;  1F0Z A;  4ITK A;  1N62 A;  1WYG A;  2MJE A;  1TKG A;  2K5P A;  1YQ3 B;  3AE7 B;  2M56 B;  3DWG C;  3L4P A;  3P4S B;  2AX5 A;  3P4P B;  3CWI A;  1EWY C;  3AE2 B;  3B9J A;  4C7Y A;  4ZHP A;  1JWB D;  2HTM E;  3DWM A;  3NRZ A;  2W54 A;  4N58 A;  1XLN A;  1SF0 A;  1N61 A;  1T3Q A;  2E3T A;  4HRS A;  4FXC A;  3B2F A;  5GXG B;  2MJD A;  4YTM B;  4P6V F;  1J7B A;  3SR6 A;  1FXI A;  3NVW A;  1SB3 C;  1TKY A;  3AMZ A;  3SFD B;  3AEG B;  3HRD D;  1DOY A;  1XLO A;  3KWL A;  1RYJ A;  5EE3 A;  2B76 B;  2PIA A;  3FC4 A;  1N5W A;  1QOB A;  1WRI A;  2LEK A;  1FFV A;  1N63 A;  1AWD A;  1WGK A;  3AE6 B;  3AEB B;  5EE1 A;  1OQQ A;  1YQ4 B;  4US9 A;  4YSX B;  2G1E A;  1I7H A;  1QLB B;  2K9X A;  2WDR B;  1OFF A;  3ZYY X;  1NYQ A;  3AN1 A;  1GPX A;  1QOA A;  1VJK A;  2PVG C;  3LB8 C;  3NVZ A;  3AH7 A;  1KRH A;  1KF6 B; 
#chains in the Genus database with same CATH topology
 1E5W A;  3ZTD A;  4WAA A;  1EU3 A;  2A4Z A;  1YN4 A;  2NMQ A;  2KQ4 X;  4KKI A;  3IAM 1;  1QT9 A;  3H7P B;  3K9P B;  2GB1 A;  4YWG G;  1ET6 A;  4MH0 E;  4E71 A;  4LK0 M;  3QX1 A;  2L8J A;  1IGD A;  3AI5 A;  1KLV A;  2D3C A;  2V4I B;  3ZIM A;  4W9F A;  1SJH D;  3H8H A;  1J7A A;  2KDF B;  3SHQ A;  2Q5W D;  3PZD A;  1AW7 A;  1V1P B;  1JW9 D;  3TMP B;  2RSU A;  1C9F A;  2MSE D;  1R4M I;  1YJI A;  5KHQ A;  4CQN A;  3M95 A;  5LLI A;  3UIO B;  2DLB A;  2B3A A;  2W3R A;  3PHX B;  4JL9 A;  3NZU A;  2J42 A;  2FBW B;  4GDK A;  2KX3 A;  1CQV A;  2C7M B;  3Q3M C;  1PGB A;  2J0M A;  4IWP A;  1TZ1 A;  4BKS A;  2ZPN A;  1L4Z B;  1MFW A;  3QA8 A;  1B1Z A;  1EF5 A;  4XYC A;  5HG2 A;  4M0W B;  3U52 E;  2C60 A;  2W54 A;  2WXL A;  1STE A;  2CKH B;  3P2B A;  4M02 A;  3H6N A;  1I4R A;  3RUL A;  3AMZ A;  3ZRC A;  4MJS A;  1RYJ A;  4W9K A;  2J4X A;  2K39 A;  2LEK A;  1VZ8 A;  2IY0 B;  2G1E A;  5D7G A;  4NAW B;  3LDZ E;  1QQR A;  3PGE A;  5CHV C;  3KW5 B;  1IBX A;  3A9K A;  1WGG A;  3U7D A;  3TIX A;  4OHJ A;  4BKG A;  2MLB A;  1EUV B;  1WXM A;  3U7Z A;  3TUO A;  1L0V B;  4X57 B;  3RNG C;  4A3P A;  4RNA A;  4REZ A;  4CHK A;  4JLC A;  3EGR A;  4EFO A;  3DVG Y;  2M19 A;  3U30 A;  4NQK E;  2BWF A;  4KVG B;  2LHE A;  4W9J A;  2VRR B;  3B08 A;  2WS3 B;  2LGI A;  1T0S C;  4I6P A;  5C3J B;  3PZ8 A;  1KJT A;  2XBB C;  2BB5 A;  1E7U A;  3Q8B A;  4JE3 B;  2AL6 A;  3AEA B;  3AE9 B;  1GC7 A;  3T9L A;  1L6U A;  4EKU A;  3QAR A;  3IT6 B;  5AUI A;  4DXF A;  5J18 A;  2KDB A;  4DHZ E;  1FNV A;  4XGA B;  4LJP B;  4HKQ A;  2NBU A;  4ACF A;  1XF5 L;  3L13 A;  1GAQ B;  1MPE A;  4OZC A;  2VZK B;  1WX9 A;  1XCT L;  1ZP0 B;  2L52 A;  4C4V B;  1FIQ A;  1XXG A;  1HZ5 A;  2MRP A;  4IM3 A;  4G0N B;  3UF8 A;  1D5X C;  2I1K A;  2M1M A;  4P1B C;  3W1S C;  1N62 A;  2K5P A;  4M8N A;  1UGM A;  2HTM E;  2L3Z A;  2MBQ A;  1QIL A;  3SDL C;  1C76 A;  2KYW A;  3TJP A;  2WXH A;  1WXV A;  2G4S A;  2N9X A;  5BYQ A;  2V1Y A;  2KVZ A;  4M8M A;  3VVW B;  4WQO B;  1FFV A;  2LRW A;  1AWD A;  3JSV A;  1OQQ A;  2KKC A;  3EEC A;  1YX6 B;  1PGX A;  2AWT A;  1ZOY B;  1P0R A;  2MQJ A;  2N1V A;  4WWM A;  5EDS A;  4DHJ B;  3Q14 C;  1K8R B;  1SGH A;  3CST A;  2N9P C;  2FCS A;  3N32 A;  3A9J A;  3UQA A;  1MHH E;  3HVZ A;  3ML9 A;  4XZ4 A;  3APF A;  3RCZ A;  2L76 A;  3SU8 X;  2XNA C;  3UQB A;  2KDE B;  3RFZ B;  2GOW A;  3R2I A;  3L10 B;  1IP9 A;  1GUA B;  1JRP A;  3ZNG C;  3IBE A;  1WGD A;  1F52 A;  3NY5 A;  4HCN B;  1K51 A;  4GB9 A;  2KDI A;  1N60 A;  2J7Q B;  2W3S A;  2LWP A;  4I6L B;  3DHG C;  2FNJ B;  4HKZ E;  3BVG A;  4RF1 A;  3EC8 A;  1L6V A;  1NEN B;  1HZ6 A;  1JML A;  1NI2 A;  3IXS A;  2ASQ A;  5DPS A;  1NVI D;  5DCN A;  1UD7 A;  2DZK A;  2V3N A;  2BVC A;  3Q3F A;  2IGG A;  2PVO D;  4US8 A;  2YLM A;  4YT0 B;  2RPV A;  3QK0 A;  1VLB A;  4F8C B;  1F2R C;  2ZZP B;  4A20 A;  2LI5 A;  1YQ3 B;  3W1Y A;  4FLH A;  2KFK A;  4EUT A;  3AE2 B;  4M01 A;  2E3T A;  4YTM B;  4P6V F;  2N9K A;  5IP4 D;  2RGF A;  3A4S C;  3DOW A;  3LJ3 A;  1PGA A;  1ZXH A;  2G3Q B;  1WE6 A;  5IO9 A;  2XK5 B;  4PS7 A;  1QOB A;  2Z59 B;  4RGT A;  4B9K A;  5D3I B;  5FKA C;  2BTE A;  3C8Y A;  1L0X B;  3IHP C;  1LM8 B;  3Q6B A;  1K50 A;  4HDO A;  2DNF A;  4FN2 A;  4RGO S;  3PHW B;  4WWN A;  1LXD A;  3P1M A;  3OJ3 A;  2JXX A;  2GLS A;  2RD0 A;  2REX A;  3HM6 X;  3AEC B;  3AED B;  2KNB A;  3ZLZ A;  2KN4 A;  3B0A A;  1EO6 A;  1EU4 A;  2MP2 B;  1GB1 A;  3QIJ A;  3VR8 B;  2WXP A;  2RDB C;  4GDL B;  3GB1 A;  2DZM A;  2IBI B;  3ZVV A;  3SFE B;  4MEM A;  3ZJU A;  2WWZ A;  2WX1 A;  4B0E A;  2NBV B;  2WXO A;  2IY1 B;  2KX0 A;  1WM3 A;  2J0J A;  4KV2 A;  1WIA A;  3TL5 A;  2K8H A;  4PS8 A;  1IGC A;  1J0G A;  2JZP A;  3PRP B;  3DBL I;  3ZUN A;  4JQW C;  2OOB B;  5IKC M;  2G45 B;  2VZK D;  2YEP F;  1OQR A;  1YOV B;  5T8I A;  4XDD A;  2QIE B;  3VUW A;  5FK9 C;  1Y8R C;  4NJ6 A;  1WRD B;  1RAX A;  1ZDV A;  5G2N A;  4RH6 A;  3I63 C;  2FUG 1;  3Q8C A;  4TUU A;  3B9J A;  1EWY C;  2NR2 A;  2ZJD A;  2TSS A;  4HRS A;  1UBI A;  2LXC A;  2GBM A;  2QIL A;  3PZ7 A;  4LNI A;  1FXI A;  2OJW A;  2Z8L A;  5AZF A;  4AJY B;  1PQS A;  2WXM A;  3GS2 A;  2QCZ A;  5EE3 A;  3ZJT A;  2WNM A;  1LGR A;  1YN5 A;  2EMS A;  5DPT A;  4ANW A;  2EKE C;  4FJV B;  2RDG A;  4EE2 A;  4GMV A;  2OHF A;  3KLS X;  1SBB B;  4KKJ A;  3HK0 A;  5G5G A;  3MC9 A;  4MGZ E;  1JWU D;  2AQ3 B;  3ZXV A;  1IYF A;  3WAM A;  1EF1 A;  3RPF C;  2IDY A;  2LGY A;  5E6J A;  2KWU B;  2Y5P A;  1XEE A;  2GBJ A;  1CMX B;  1MG4 A;  4RGN A;  5BYR A;  3GOE A;  5AEK B;  1JCK B;  4AUQ C;  4HPM B;  2BS4 B;  3ALB A;  5HKH A;  2CHZ A;  3Q69 A;  3NVV A;  1V2Y A;  3ZW3 A;  2KD0 A;  1QOF A;  2NTS A;  2I38 A;  1I4G A;  5TR5 A;  1YD8 U;  1TS5 A;  1FM0 D;  3M3J A;  4RFB A;  2I2Y A;  5AUK A;  3TCA A;  1FO4 A;  4BBN F;  3VXW A;  3TSS A;  4FHJ A;  2ZNV C;  1H8C A;  3DVG X;  2BF8 B;  1FFU A;  1AAR A;  5HHD G;  5JHA A;  1NDD A;  3W5V B;  2H88 B;  2WU5 B;  1J19 A;  1SEB D;  3AE5 B;  4ARC A;  5TSS A;  1U4A A;  4JIO U;  2KLG A;  3GP7 A;  1TKG A;  2KHW B;  4IUM B;  4C7Y A;  4ZHP A;  4JPS A;  1UBQ A;  3NRZ A;  1WYW B;  3R3M A;  4WIP A;  2EMT A;  2PJH A;  2LD9 A;  1V49 A;  4HK2 A;  4G11 A;  1WF9 A;  4DHZ B;  2K25 A;  1ZDX A;  4AQ7 A;  1I4P A;  3H7P A;  2K9X A;  2D11 A;  3RNA C;  4ARI A;  2R2O A;  5FR6 A;  4IW0 A;  1XCQ L;  5CHW A;  2CHW A;  5J17 A;  2PEA A;  3T3N A;  1SIJ A;  4LNN A;  2D2Q A;  4S17 A;  2FAZ A;  3CMM B;  2A5U A;  2MWS B;  1V1P A;  1MI0 A;  1DOX A;  2GBR A;  4MT5 A;  2KMC A;  3VH4 B;  2EKI A;  2LMC A;  1C79 A;  4RCO A;  1WY8 A;  2BYV E;  4K3C A;  2KQS A;  2NS5 A;  2XN9 C;  4GU2 A;  4KSK C;  4YTP B;  3QAQ A;  2JZZ A;  2INP E;  4MGY E;  1CJE A;  3ZNZ B;  2X38 A;  1Q10 A;  1FCC C;  3HHM A;  3RUI B;  3WCQ A;  5I4D A;  4F1S A;  4M0W A;  4HLE A;  5EE0 A;  4GSW A;  4LCD E;  3AB5 A;  1CZP A;  2HTH A;  3SD5 A;  4EOY A;  1XQQ A;  4MM3 B;  1SIF A;  4ZRK A;  2RPQ A;  3L4P A;  3CWI A;  2QMT A;  2Y3A A;  4HWI B;  3ZRF A;  5BO4 B;  3B1L X;  4D2K A;  2FE8 A;  4HJK A;  2KQ7 A;  4NAW A;  3JVZ X;  4KGT A;  5E6O A;  3FC4 A;  2NVU I;  2JU6 X;  4FHK A;  1WGK A;  1SXT A;  2LVP A;  3Q3J A;  3BVZ A;  3LB8 C;  1WJU A;  2KTR A;  3QCA A;  2PKO A;  1KFY B;  1XLQ A;  3AE3 B;  3B2G A;  4O1N A;  2W9N A;  5G55 A;  3A1Q B;  3OG5 A;  1E10 A;  1E0Z A;  3WIM A;  1GB4 A;  1FNW A;  4YSY B;  3PO0 A;  2WXF A;  1R4N B;  2JF5 A;  2L83 A;  1RWS A;  1T5X D;  4JWS C;  4ZRP A;  1V80 A;  5D2M B;  2LJ5 A;  2M4N A;  2GBK A;  1FMA D;  3S2A A;  2BKR B;  2JUO A;  1RFK A;  1ESF A;  1WGR A;  3VRB B;  2N4F A;  2WXR A;  2KTR B;  1UWX A;  1V97 A;  4C4V A;  2O2V B;  3K9O B;  1PFD A;  2KWD A;  1SE9 A;  3RNE C;  5BMH A;  2LFI A;  1KH0 A;  3L08 A;  2M17 A;  3BYT B;  4ANX A;  1DOI A;  4A9A A;  3R8B A;  1ZPS A;  2Z0E B;  2K8B A;  5IAA C;  1TKE A;  1TYG B;  1Z2M A;  2DBY A;  3BY4 B;  3RNB C;  1KM7 A;  2DEN B;  2L7R A;  4WJO A;  2MJE A;  4IWQ A;  3WAN A;  3FIL B;  4HJG E;  1FPY A;  2Z0D B;  4ICV A;  5E6N A;  1T3Q A;  2GBN A;  1FCL A;  3N1Z C;  1WJN A;  1BT0 A;  1SB3 C;  1JWS D;  3R7R A;  2PLP A;  2WDT B;  4FUL A;  3L54 A;  1WRI A;  3AE6 B;  4PS3 A;  4YSX B;  3ZYY X;  2PVG C;  2IO3 B;  2MBB B;  3DBR I;  2FUH B;  1KRH A;  4TQ0 A;  1P7E A;  5H92 C;  2KAC A;  1HTQ A;  1V8C A;  2WXI A;  3MHS D;  2QC8 A;  4ZRI A;  4ICU A;  3GE3 C;  2KOX A;  3T3O A;  3AM9 A;  4URK A;  2H89 B;  5CX3 A;  4KZ0 A;  4A90 A;  3JW0 X;  2WU2 B;  4ZHO A;  2IND C;  2JXT A;  2CU3 A;  1AN8 A;  1TZO A;  4OVV A;  2MA9 B;  1YNT E;  3GZN I;  3AU5 A;  1P9D U;  1RLF A;  3Q8E A;  4TV3 A;  1R4M B;  2IYD B;  1P3Q U;  3KYD D;  3WAP A;  3TBL D;  2HJ8 A;  5FR3 A;  4B6W A;  2G4D B;  4IKG A;  1A70 A;  3KQ4 A;  4OW0 A;  3ZNH B;  3P42 A;  2KWV B;  4FBJ B;  2WHI A;  1HQR D;  2LRU A;  1QF6 A;  1D5M C;  1ZGU B;  2LVQ A;  2ONQ A;  1WXQ A;  1NYR A;  2KO3 A;  3VTW A;  2CJO A;  3RN9 C;  4ANV A;  1TY0 A;  1V9J A;  4IG7 B;  5D94 A;  3ZQ4 A;  1UNS A;  4NQL B;  1ZW7 A;  5CTR C;  3AE4 B;  3FKY A;  4S0R A;  4LTU A;  3D32 A;  2BYT A;  2UYZ B;  3APC A;  4TMA B;  5MPO A;  2M0A A;  2DAJ A;  4KX6 B;  1XO3 A;  4LJO B;  1UF0 A;  3MJW A;  3I57 A;  4DQO C;  2MCN B;  3ZGZ A;  3P4S B;  4L2Y A;  2M56 B;  3TEW A;  2W82 A;  2WXN A;  2XK5 A;  2INC C;  3ML8 A;  4OZA A;  2V3P A;  2AQ1 B;  2KAN A;  4BZA A;  3IVF A;  4RGM A;  2LAS A;  3KUD B;  3L0W B;  3N1Y C;  2B76 B;  1N5W A;  1VZ7 A;  1T0R C;  1X1M A;  4ANU A;  3SEB A;  1C4C A;  2RMM A;  2M8S A;  1QOA A;  2PE6 B;  3NVZ A;  3AH7 A;  1V6E A;  2MP2 A;  4W9H A;  2MHJ A;  4GDL A;  4NZL B;  1MJD A;  5D3D A;  1JRO A;  4TQ1 A;  4K3B A;  2IZV B;  3AE1 B;  3GE8 C;  3MP9 A;  3VRA B;  3N3K B;  2K8C A;  3DCG A;  4RF0 A;  2JRI B;  3E56 A;  3DQV A;  4W9C A;  2JRH A;  3IG3 A;  2KJR A;  1CK1 A;  3AV8 A;  4HRO A;  4DWF A;  1S1Q B;  2WYQ A;  4HPP A;  1WR6 E;  3RZF A;  1WH3 A;  4W9E A;  4C7Z A;  4K7U A;  1WE7 A;  3A33 B;  1MG8 A;  3AE8 B;  1J8C A;  4OZB A;  4TSS A;  1WX7 A;  4IM0 A;  3R7Q A;  4LLG M;  2WDV B;  3MTN B;  3L17 A;  2JWZ A;  1J7C A;  1PDX A;  3A4R A;  3PRE A;  3I3T B;  3WAO A;  5JHB A;  4E3C A;  1EM7 A;  3NS1 A;  2KAJ A;  1NBF C;  3M62 B;  2RDH A;  5BMI A;  1I4X A;  4ZOH C;  2N7E A;  5LXH A;  2KC1 A;  1F77 A;  4AP4 C;  1F9J A;  3AE7 B;  1WR1 A;  2AX5 A;  4C56 C;  3HM3 A;  2NPT B;  3DWM A;  1SF0 A;  3DBH I;  3NZS A;  2WXJ A;  3B2F A;  2J53 A;  4FA6 A;  1DOY A;  1G6J A;  3KWL A;  1I4H A;  1VZ6 A;  2LUM A;  3U4E G;  3RMK C;  4GLS C;  2WDR B;  4WUR A;  3QQ8 B;  4KGS A;  1FRD A;  2AEH A;  1OQY A;  1HA5 A;  3RNF C;  5KHO A;  1L5P A;  4W9I A;  5GMV A;  1FNU A;  4OVU A;  2SAK A;  2D10 A;  1V81 A;  4USA A;  4XWT A;  1SE4 A;  2W55 A;  4ZRJ A;  1E7P B;  3DHH C;  2VH2 A;  2K6Q A;  1ROE A;  3AU4 A;  4OVZ A;  4HCP B;  3PPA A;  4AWJ A;  2JYT A;  5JXV A;  1Q1O A;  4G3X B;  4BFR A;  2D3A A;  1TIF A;  1WWT A;  4EZJ A;  3QHT A;  3EUB 2;  2D07 B;  3ZNI D;  2V3S A;  2JVC A;  4WJN A;  4NNJ B;  1P98 A;  1FXT B;  2KFJ A;  1VR9 A;  4WWO A;  1OGW A;  4LNF A;  2C5L C;  2ZCB A;  2INN E;  4WWP A;  3W1S A;  3MFG A;  4BVU C;  2CR5 A;  1XLN A;  3HIZ A;  3UIP B;  5GXG B;  3PV1 A;  2IO0 B;  3U2S C;  3SFD B;  3R66 C;  1XLO A;  1D5Z C;  5JH5 C;  1SE3 A;  1N63 A;  2L0T A;  1YQ4 B;  3N20 C;  2LVO A;  2BQQ A;  2ZEQ A;  1V5O A;  1VCB A;  3DVN U;  1YJ1 A;  3OLM D;  1C78 A;  5EE9 A;  1TY2 A;  5AZH A;  3UGB B;  1FD6 A;  3ENE A;  4MAC A;  2ZW0 A;  4LNO A;  1KLG D;  2LHD A;  3NHE B;  2L32 A;  3V6C B;  3VR9 B;  3ZDM C;  2MEK A;  4II2 B;  3DBL B;  3HUI A;  5G5H A;  1JWM D;  3IAS 1;  5IOI A;  1B9R A;  1YJJ A;  4RMA A;  3BII D;  4PYU A;  3TEX A;  4KZC A;  2WLB A;  2JZ3 B;  2BGF A;  1YX5 B;  3PLV A;  1WMH B;  1KTK A;  4C00 A;  2K22 A;  1A5R A;  1T0Q C;  1YN3 A;  4KSL C;  4MGK E;  2HDE A;  4IWO A;  3V05 A;  1ZUD 2;  4MM3 A;  3C19 A;  3EHV A;  4BAX A;  1OEY A;  1I42 A;  1FEH A;  3IT4 B;  3LXF A;  1OTR B;  4AS1 A;  2N9L A;  3EFU A;  1WZ0 A;  2ACZ B;  5C23 A;  4Q2J A;  1I4Q A;  2GRI A;  1TJE A;  2KJH B;  3QC8 B;  3VTU A;  2IPK D;  3U8Z A;  4HEA 1;  3VAW A;  5DPR A;  2PPH A;  2L05 A;  5HI1 A;  1GNU A;  1WJ6 A;  4XE0 A;  4IOI E;  3I5J C;  3AEG B;  4WJP A;  2PIA A;  2L00 B;  3O13 A;  4MEL A;  1S3S G;  3V61 A;  3A1Q A;  3KYC D;  1C77 A;  2DX5 B;  2WXK A;  1OFF A;  1PYW D;  1NYQ A;  4A8X C;  1VJK A;  4J3O D;  4DXG A;  2L1A A;  4P16 A;  2BS3 B;  4EZL A;  3W5U B;  1RM6 C;  3O65 B;  5J2R A;  5CHF A;  5H8Y E;  2BS2 B;  2CJN A;  3DHI C;  5LNK 1;  2WDQ B;  2AYO B;  2JWU A;  1BUI C;  3ZJV A;  2HJ1 A;  1FXA A;  1SJE D;  1Q0W B;  1ZXI A;  2QJL A;  4B0M A;  2DWQ A;  2O2V A;  2IO1 B;  2WQY B;  3Q3N C;  4YL8 A;  2ZW1 A;  1E7V A;  1NI3 A;  1Q5W B;  1E6E B;  3VDZ A;  1C4P A;  5AZG A;  2O6V D;  3BIN A;  1LO5 D;  4P7I A;  4I6N B;  3J9C A;  1MVK A;  3VUX A;  2RR9 A;  2KVR A;  3NG0 A;  2Y5C A;  3VUY A;  1KOT A;  5L83 A;  3N9Y C;  1WGH A;  3MJ5 A;  3Q3O C;  3EA6 A;  3FIL A;  2JSV X;  3T8M A;  4WJQ A;  1UZX B;  4MSM B;  2SEB D;  1KLU D;  2WP9 B;  4HDQ A;  2NTT A;  4FAD A;  4JX1 C;  1WYG A;  1E8W A;  4W9G A;  4GDK B;  1P7F A;  3VHT C;  4N58 A;  4ZYS A;  2YVC A;  4FXC A;  2AQ2 B;  2MJD A;  2N7J A;  3SR6 A;  4G50 A;  2BYF A;  3HRD D;  4A6Q A;  1L7Y A;  1SSN A;  3DDC B;  1UEL A;  4MGI E;  1EWC A;  3Q8A A;  1HE8 A;  3AEB B;  1WJ4 A;  3OAW A;  1E8X A;  4US9 A;  1I7H A;  3R2T A;  4BBN C;  3PRZ A;  3Q8F A;  4MJS B;  1KF6 B;  1XD3 B;  3ZKJ C;  2LJI A;  4YSZ B;  2K0P A;  2IGD A;  2KN5 A;  1JAL A;  2BYE A;  2D5G A;  5HFY A;  1IBX B;  2BT6 A;  2QHO A;  1BML C;  1XLP A;  3A9K B;  4W9D A;  2N7D A;  4WAF A;  2DZI A;  2MH7 A;  1Y56 A;  1IUE A;  3URY A;  2PTL A;  2HD5 B;  2ZVN A;  4B95 A;  4XWW A;  2BBC A;  2C9W B;  4N6E B;  1HTO A;  1LQB A;  1L0Y B;  3QJZ A;  3JYU A;  4XC2 A;  2DHZ A;  2JQR B;  1L2N A;  4L23 A;  1ZE3 D;  4YXD B;  5E6P A;  2FCM A;  1YQB A;  5C1Z A;  4LDT B;  3H1U A;  1HXY D;  3NVY A;  2X8X X;  3AEF B;  1FRR A;  4L1B A;  2NBW B;  4CO7 A;  2DZJ A;  1TS3 A;  3RZW C;  3ZTC A;  3VH3 B;  1QKZ A;  3X0W A;  3W2D A;  4NPN A;  4II3 B;  1N5X A;  2ZCC A;  4IC7 B;  2PW9 A;  1ET9 A;  2V9H A;  3P4P B;  2D3G A;  2BWE S;  3L16 A;  3TEY A;  1M4V A;  1MHX A;  2KDM A;  3NZ3 A;  4PK1 A;  1V5T A;  3V62 A;  3H9D A;  1TKY A;  2K1F A;  2OJR A;  4GIV A;  2WX0 A;  2D3B A;  3NS8 A;  2L0F A;  3EFC A;  4HPL B;  2LGD A;  1VD2 A;  2FCQ A;  2WXQ A;  1C3T A;  4N9F 4;  3DBS A;  1D6E C;  2ZNV B;  4MDK E;  4K1R B;  4ASW C;  1ENF A;  1C4A A;  4JGH B;  2MW5 A;  3E9S A;  4A3O A;  1ZKH A;  4E74 A;  3W9C B;  2IO2 B;  1IPG A;  3N1X C;  3BK2 A;  4A55 A;  2NCN A;  1GC6 A;  3JSV B;  3RYT A;  4IM2 A;  3P4Q B;  3BZD B;  4M00 A;  4KDL B;  3MHZ A;  1I35 A;  3VQI A;  3RT3 B;  5IA7 A;  4P1C C;  1GJZ A;  1GOZ A;  3TEZ A;  2I1J A;  3M63 B;  3C0R B;  4BOS C;  3ZDT A;  3A9J B;  3CSF A;  1ISN A;  3FAH A;  4PYZ A;  3NUH B;  4KIK A;  4BOZ B;  2CHX A;  2MJ3 A;  3BVM A;  2R61 A;  4RM8 A;  1WSP A;  3ECI A;  3NOB A;  4DBG A;  4EZK A;  5BYS A;  1RFA A;  2JPH A;  4C80 A;  2MBE A;  5L95 C;  4FJZ A;  1GG3 A;  1UWM A;  1TS4 A;  2QSD A;  3V60 A;  1WZ3 A;  1H4R A;  2NPT A;  1AYF A;  1QOG A;  2FCN A;  5IN7 A;  4K7S A;  2WGS A;  1D4B A;  3X23 A;  1K53 A;  4KDI C;  1F1H A;  1DYQ A;  3DWG C;  4AOF A;  1UGJ A;  4DDI D;  2KWC A;  4BKS D;  4WH4 A;  2JT4 B;  4KIK B;  4TKN A;  1J7B A;  3NVW A;  2OED A;  3DBR B;  2HE7 A;  4R3D A;  2KFK B;  1TT5 B;  2GMI C;  3KH0 A;  1LFD A;  3ZXR A;  5LXI B;  3KUZ A;  2PE9 A;  4GN1 A;  4DDG D;  1QZE A;  3BYY B;  3PRM B;  2MBO A;  4HXD A;  4RM9 A;  2IGH A;  4YTN B;  2G9H D;  2KJ6 A;  3GZN B;  1NEK B;  3KUC B;  2IJ0 A;  4F7Z A;  1ACC A;  3N30 A;  4ZRQ A;  2YEP B;  2CU1 A;  2C7H A;  3ZO5 B;  3DVN V;  5JZE B;  3IFW B;  3RD2 A;  5DPW A;  2QDF A;  2O6V A;  4DXA B;  2K6D B;  3BK1 A;  5BMG A;  3VFK A;  1PUT A;  1JWA D;  1UUP A;  1WI0 A;  3BWU D;  2J52 A;  4NJC A;  1D3Z A;  3PSE B;  3APD A;  1TBE A;  5C2T B;  2KZR A;  4LNK A;  1YMH E;  2BB6 A;  2UU7 A;  2V4L A;  4W9L A;  4LDT D;  3RNC C;  1WFY A;  1VDV A;  3WAL A;  1VRA B;  2JX5 A;  3HVD A;  2UWQ A;  1Z5S B;  4IDI A;  3V3X A;  1TS2 A;  2N0S B;  3Q2A C;  2N9E B;  2Y5B B;  3CIR B;  2FID A;  2LUE A;  3WA0 A;  1T6B X;  2DYB A;  3ETR A;  2O6V B;  4FJY A;  4HVB A;  4NAM A;  4NJ7 A;  1L4D B;  1TGZ B;  2M0X A;  2C7N B;  4DHJ D;  1M94 A;  2PMV A;  3QWZ B;  3NJT A;  2JY6 A;  4GOC A;  2KXJ A;  2MBH A;  3KVF B;  3UI3 A;  2BKF A;  1HEZ E;  1WX8 A;  1V86 A;  4ZDV A;  3AN1 A;  2ON8 A;  2LGS A;  2FIF A;  4ZYN A;  3PVL A;  2AL3 A;  4BKT A;  1F2R I;  3OWE B;  4EEW A;  2J0K A;  2LGX A;  4N59 A;  4DK5 A;  2DYM A;  1OEY J;  1N6Z A;  2N1W A;  1E9M A;  4QAY A;  4NY0 A;  3I9V 1;  2KTF A;  4PT5 A;  2KMA A;  3PLU A;  4J6I A;  4MSQ B;  4XDC A;  3V6E B;  2CS4 A;  2DAF A;  1DGJ A;  3LYY A;  3MC8 A;  2MX2 A;  1K52 A;  2KT7 A;  1WMH A;  5D6J B;  1SE2 A;  3CF6 E;  4MH8 A;  2VH1 A;  4UDU C;  1R4N I;  3H7S A;  3PS6 A;  3DPD A;  1JQ4 A;  1WM2 A;  3P4R B;  1T0Y A;  3ABV B;  4H2A A;  3P63 A;  2EEL A;  2KMM A;  3PTF C;  4WQM A;  2E6X A;  2QEJ C;  2KK8 A;  1YIW A;  1V1O A;  2WXG A;  2GI9 A;  3MC0 B;  4AJW A;  2JYE A;  2BW2 A;  1C1Y B;  2R2Q A;  1E8Z A;  4JWU C;  3VTV A;  2LXA A;  4XX5 A;  1R7S A;  3DBH B;  2ZVO A;  2V0G A;  3AUL A;  1WXS A;  2ICI A;  2KC2 A;  3AEE B;  4CYE A;  4GXB A;  3RI7 C;  1F0Z A;  4ITK A;  3UIN B;  2KLC A;  3AXC A;  4GGQ A;  3OJ4 B;  1BXT A;  2XEW A;  1JWB D;  1RRB A;  1JRU A;  1N61 A;  1E90 A;  4K81 A;  2ZPY A;  1TTN A;  4KGR A;  2K3U A;  2BPS A;  3PT2 B;  1E8Y A;  1P1A A;  1WGY A;  2DYO A;  3ONS A;  5EE1 A;  1GPX A;  1QLB B;  3KWV A;  1UH6 A;  1WXA A;  1XT9 B;  4K7W A;  2LZ6 A; 
#chains in the Genus database with same CATH homology
 2OHF A;  1EU3 A;  1YN4 A;  2NMQ A;  4NZL B;  2KQ4 X;  2LJI A;  1SBB B;  3KLS X;  4KKJ A;  4KKI A;  4YSZ B;  5D3D A;  2K0P A;  5G5G A;  2IGD A;  3IAM 1;  1JAL A;  1JRO A;  4TQ1 A;  1QT9 A;  1JWU D;  2AQ3 B;  3AE1 B;  3MP9 A;  3VRA B;  2D5G A;  2GB1 A;  4YWG G;  3RPF C;  5HFY A;  1ET6 A;  4RF0 A;  1IBX B;  3E56 A;  2BT6 A;  1BML C;  1XLP A;  2IDY A;  4LK0 M;  5E6J A;  1CK1 A;  2Y5P A;  3AV8 A;  4WAF A;  4HRO A;  1XEE A;  2MH7 A;  1Y56 A;  1IUE A;  1IGD A;  2PTL A;  4RGN A;  5BYR A;  3URY A;  1JCK B;  2V4I B;  2BS4 B;  1SJH D;  4C7Z A;  3Q69 A;  4XWW A;  2BBC A;  3H8H A;  1J7A A;  4N6E B;  3NVV A;  1L0Y B;  2Q5W D;  1AW7 A;  1V1P B;  1QOF A;  2NTS A;  2I38 A;  1JW9 D;  1I4G A;  1C9F A;  2JQR B;  3AE8 B;  4OZB A;  1TS5 A;  4TSS A;  1FM0 D;  4L23 A;  1ZE3 D;  1YJI A;  4YXD B;  4LLG M;  4RFB A;  2I2Y A;  2WDV B;  5AUK A;  4CQN A;  1J7C A;  1FO4 A;  1PDX A;  1HXY D;  3NVY A;  2DLB A;  3AEF B;  2W3R A;  3TSS A;  1FRR A;  4L1B A;  1EM7 A;  2J42 A;  1FFU A;  2FBW B;  2KAJ A;  3NS1 A;  5HHD G;  2RDH A;  1TS3 A;  5BMI A;  1I4X A;  1CQV A;  4ZOH C;  1PGB A;  1QKZ A;  3W5V B;  2H88 B;  2WU5 B;  3W2D A;  1SEB D;  3AE5 B;  1F77 A;  4ARC A;  5TSS A;  1N5X A;  1L4Z B;  2PW9 A;  1B1Z A;  3GP7 A;  1TKG A;  1ET9 A;  3P4P B;  3AE7 B;  3TEY A;  5HG2 A;  2AX5 A;  4C56 C;  4C7Y A;  3U52 E;  4ZHP A;  1M4V A;  1MHX A;  2KDM A;  3NZ3 A;  4JPS A;  3DWM A;  3NRZ A;  2W54 A;  2WXL A;  1STE A;  1SF0 A;  4WIP A;  2WXJ A;  3B2F A;  2J53 A;  1I4R A;  1TKY A;  3AMZ A;  1DOY A;  3KWL A;  1RYJ A;  2J4X A;  1I4H A;  1ZDX A;  4AQ7 A;  1I4P A;  2LEK A;  2WXQ A;  1VZ6 A;  1VZ8 A;  2LUM A;  3U4E G;  1D6E C;  2G1E A;  2K9X A;  2WDR B;  4GLS C;  4ARI A;  5D7G A;  4NAW B;  1QQR A;  4WUR A;  1IBX A;  1ENF A;  1C4A A;  3E9S A;  4KGS A;  3W9C B;  1XCQ L;  1FRD A;  3BK2 A;  4OHJ A;  1HA5 A;  4A55 A;  3T3N A;  3P4Q B;  3U7Z A;  1SIJ A;  3BZD B;  3TUO A;  1L0V B;  1L5P A;  3MHZ A;  4RNA A;  4REZ A;  3VQI A;  1FNU A;  3EGR A;  2SAK A;  2M19 A;  1V1P A;  1GOZ A;  1MI0 A;  4USA A;  2LHE A;  1DOX A;  4XWT A;  2WS3 B;  1SE4 A;  2LGI A;  3TEZ A;  2W55 A;  5C3J B;  1E7P B;  4MT5 A;  3PZ8 A;  2BB5 A;  3Q8B A;  1ROE A;  4JE3 B;  2EKI A;  2LMC A;  3AEA B;  3FAH A;  3AE9 B;  3NUH B;  1C79 A;  4OVZ A;  4RCO A;  1L6U A;  3IT6 B;  5AUI A;  2JYT A;  5JXV A;  4DXF A;  2XN9 C;  2MJ3 A;  3BVM A;  2R61 A;  1WSP A;  4YTP B;  1FNV A;  2INP E;  5BYS A;  1WWT A;  4C80 A;  4HKQ A;  1XF5 L;  1CJE A;  2X38 A;  1GAQ B;  1Q10 A;  3EUB 2;  1MPE A;  1FCC C;  4OZC A;  2VZK B;  1UWM A;  1XCT L;  1TS4 A;  3WCQ A;  1ZP0 B;  2QSD A;  5I4D A;  2L52 A;  4M0W A;  1FIQ A;  1XXG A;  1HZ5 A;  5EE0 A;  1AYF A;  3AB5 A;  1CZP A;  1QOG A;  1D4B A;  1D5X C;  1VR9 A;  4MM3 B;  1K53 A;  1N62 A;  2K5P A;  1DYQ A;  2INN E;  3DWG C;  3L4P A;  3W1S A;  3MFG A;  3CWI A;  2QMT A;  1UGJ A;  2Y3A A;  2HTM E;  1XLN A;  4WH4 A;  1QIL A;  1C76 A;  5GXG B;  4D2K A;  2FE8 A;  1J7B A;  2WXH A;  3NVW A;  2OED A;  3U2S C;  5BYQ A;  3SFD B;  4R3D A;  1XLO A;  4KGT A;  1D5Z C;  3FC4 A;  1SE3 A;  2JU6 X;  1FFV A;  1N63 A;  1AWD A;  1WGK A;  1OQQ A;  1YQ4 B;  1SXT A;  3BVZ A;  3LB8 C;  3BYY B;  1C78 A;  1PGX A;  2PKO A;  1ZOY B;  1KFY B;  2IGH A;  1XLQ A;  1TY2 A;  5EE9 A;  3AE3 B;  4YTN B;  3B2G A;  2G9H D;  4O1N A;  4WWM A;  1FD6 A;  1NEK B;  1E10 A;  4MAC A;  1E0Z A;  2ZW0 A;  1KLG D;  2IJ0 A;  1FNW A;  1ACC A;  3PO0 A;  4YSY B;  1MHH E;  1GB4 A;  3HVZ A;  2LHD A;  4ZRQ A;  2YEP B;  2WXF A;  2XNA C;  2L32 A;  2L83 A;  1RWS A;  3RFZ B;  3R2I A;  3VR9 B;  1T5X D;  4JWS C;  4ZRP A;  2MEK A;  1JRP A;  3HUI A;  3BK1 A;  5BMG A;  5G5H A;  1FMA D;  1JWM D;  1JWA D;  1K51 A;  1PUT A;  1UUP A;  3IAS 1;  1N60 A;  2W3S A;  3BWU D;  2J52 A;  1RFK A;  1B9R A;  1ESF A;  1YJJ A;  4NJC A;  3BII D;  3VRB B;  3TEX A;  5C2T B;  2WLB A;  1YMH E;  4HKZ E;  2WXR A;  2BB6 A;  1UWX A;  1KTK A;  1V97 A;  2K22 A;  1PFD A;  3BVG A;  2KWD A;  1YN3 A;  4RF1 A;  5BMH A;  1L6V A;  2LFI A;  1VDV A;  2HDE A;  1NEN B;  1HZ6 A;  1VRA B;  2JX5 A;  3V05 A;  1KH0 A;  1JML A;  1ZUD 2;  3HVD A;  3IXS A;  3BYT B;  1DOI A;  4IDI A;  3V3X A;  1NVI D;  1TS2 A;  2N0S B;  2V3N A;  4A9A A;  3R8B A;  1FEH A;  1ZPS A;  2IGG A;  3CIR B;  2PVO D;  3IT4 B;  3LXF A;  1TKE A;  1TYG B;  4US8 A;  4AS1 A;  2N9L A;  1T6B X;  2ACZ B;  2DBY A;  4YT0 B;  4Q2J A;  2RPV A;  1I4Q A;  1VLB A;  2GRI A;  3ETR A;  1TJE A;  2IPK D;  4HEA 1;  1F2R C;  4NAM A;  2MJE A;  1YQ3 B;  3AE2 B;  3FIL B;  4HJG E;  1L4D B;  5HI1 A;  1T3Q A;  2E3T A;  1FCL A;  4YTM B;  4P6V F;  2N9K A;  2PMV A;  1SB3 C;  4XE0 A;  4IOI E;  1JWS D;  3AEG B;  2PLP A;  1PGA A;  1ZXH A;  2PIA A;  3O13 A;  3UI3 A;  1QOB A;  4RGT A;  1WRI A;  1HEZ E;  3AE6 B;  5D3I B;  5FKA C;  2BTE A;  3C8Y A;  1L0X B;  4YSX B;  1C77 A;  2WXK A;  3ZYY X;  1K50 A;  1OFF A;  1NYQ A;  1PYW D;  3AN1 A;  4A8X C;  2ON8 A;  1VJK A;  2PVG C;  4J3O D;  4RGO S;  1KRH A;  4DXG A;  3P1M A;  1P7E A;  2L1A A;  4TQ0 A;  4P16 A;  5H92 C;  2KAC A;  1F2R I;  3OWE B;  2BS3 B;  1V8C A;  3W5U B;  1RM6 C;  4N59 A;  2WXI A;  5H8Y E;  3AEC B;  2DYM A;  2BS2 B;  2CJN A;  3AED B;  2KN4 A;  1EU4 A;  1E9M A;  3T3O A;  3AM9 A;  5LNK 1;  3I9V 1;  1GB1 A;  2H89 B;  3VR8 B;  4A90 A;  2WXP A;  2WDQ B;  2WU2 B;  4GDL B;  4PT5 A;  4ZHO A;  2JWU A;  2JXT A;  3GB1 A;  2CU3 A;  4XDC A;  1AN8 A;  1BUI C;  1TZO A;  3ZJV A;  1YNT E;  1FXA A;  1SJE D;  1DGJ A;  3Q8E A;  3LYY A;  3SFE B;  1ZXI A;  1K52 A;  2QJL A;  4B0M A;  2DWQ A;  3ZJU A;  1SE2 A;  4MH8 A;  4B0E A;  2WQY B;  4UDU C;  2WXO A;  5FR3 A;  2ZW1 A;  1NI3 A;  4IKG A;  1E6E B;  1C4P A;  1JQ4 A;  3P4R B;  1A70 A;  1LO5 D;  3ABV B;  3KQ4 A;  4OW0 A;  3P42 A;  1IGC A;  4H2A A;  3P63 A;  2JZP A;  1HQR D;  3J9C A;  1MVK A;  1QF6 A;  1D5M C;  2EEL A;  2KMM A;  2ONQ A;  1WXQ A;  2Y5C A;  1NYR A;  2CJO A;  4WQM A;  2E6X A;  2VZK D;  3N9Y C;  2YEP F;  1OQR A;  1TY0 A;  2QEJ C;  3ZQ4 A;  1UNS A;  5T8I A;  4XDD A;  1V1O A;  2WXG A;  2GI9 A;  3AE4 B;  2QIE B;  3MC0 B;  3MJ5 A;  2JYE A;  2BW2 A;  5FK9 C;  4LTU A;  4JWU C;  3EA6 A;  3FIL A;  2BYT A;  2JSV X;  1R7S A;  2V0G A;  4TMA B;  5MPO A;  2M0A A;  2SEB D;  1KLU D;  2WP9 B;  2NTT A;  4KX6 B;  1XO3 A;  2ICI A;  4JX1 C;  3AEE B;  1ZDV A;  3I57 A;  4DQO C;  4RH6 A;  1F0Z A;  2FUG 1;  4ITK A;  3ZGZ A;  1WYG A;  3P4S B;  4L2Y A;  2M56 B;  3TEW A;  2W82 A;  3Q8C A;  1BXT A;  1EWY C;  1P7F A;  2WXN A;  3B9J A;  4GDK B;  1JWB D;  2TSS A;  4N58 A;  4ZYS A;  4OZA A;  2V3P A;  4HRS A;  1N61 A;  2AQ1 B;  4FXC A;  2AQ2 B;  2MJD A;  2N7J A;  2QIL A;  3PZ7 A;  3SR6 A;  1FXI A;  2Z8L A;  4RGM A;  2WXM A;  4KGR A;  3HRD D;  3GS2 A;  4A6Q A;  5EE3 A;  2K3U A;  3ZJT A;  2B76 B;  1SSN A;  2WNM A;  1N5W A;  1VZ7 A;  1YN5 A;  1EWC A;  3Q8A A;  3AEB B;  2DYO A;  5EE1 A;  4US9 A;  3SEB A;  1I7H A;  1QLB B;  1GPX A;  1C4C A;  2RMM A;  3KWV A;  3R2T A;  2RDG A;  1QOA A;  4EE2 A;  3Q8F A;  3NVZ A;  3AH7 A;  1KF6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...