1PGAA

Two crystal structures of the b1 immunoglobulin-binding domain of streptococcal protein g and comparison with nmr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin binding protein
molecule keywords PROTEIN G
publication title Two crystal structures of the B1 immunoglobulin-binding domain of streptococcal protein G and comparison with NMR.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1993-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgaA00
4HKZE 1FD6A 1XF5L 2LGIA 2IGDA 5JXVA 2PTLA 1K53A 4IOIE 4D2KA 5BMGA 2KDMA 1ZXHA 1MPEA 4KGSA 1IGCA 2QSDA 3MP9A 1PGXA 2N9KA 1F2RI 1YNTE 1KH0A 2QMTA 2KQ4X 4HJGE 1IBXB 1MHHE 2LHDA 1PGAA 1HZ5A 1F2RC 5HG2A 1XCQL 4MACA 5BMHA 2PLPA 2JZPA 1P7EA 2JXTA 2N9LA 1D4BA 2J53A 2LHEA 2GB1A 5HHDG 2KACA 4GLSC 2KWDA 2JWUA 2JSVX 1IBXA 2NMQA 1YMHE 1MHXA 1XCTL 2IGGA 2ONQA 2EELA 2OEDA 1FCLA 1JMLA 2ZW1A 2JU6X 4WH4A 5HFYA 1GB4A 1GB1A 4OZCA 1HZ6A 3FILB 5HI1A 1FCCC 2J52A 2I2YA 2RPVA 1K52A 4OZAA 2IGHA 1QKZA 3GB1A 1IGDA 2GI9A 2I38A 1P7FA 1EM7A 4KGTA 1UWXA 3FILA 1MVKA 2RMMA 4OZBA 1C9FA 1HEZE 2ON8A 1K51A 2N7JA 1MI0A 2KN4A 2K0PA 1PGBA 5BMIA 1Q10A 3V3XA 4IKGA 2LUMA 1K50A 2ZW0A 4KGRA 2PW9A 3UI3A
chains in the Genus database with same CATH superfamily
4A6QA 3SEBA 3IT6B 2WXMA 1XD3B 1D3ZA 1OEYA 4P1BC 2G1EA 3Q6BA 2HJ8A 1WMHB 2K22A 3CSFA 1YQ4B 3AH7A 2D3BA 1V49A 1QOAA 2W54A 3H7PB 3AE5B 4AS1A 2B3AA 2K9XA 4RM8A 2K6DB 2KANA 2L76A 3NY5A 4OHJA 2PEAA 2RD0A 1JW9D 1GJZA 1VRAB 2GMIC 3RT3B 3ZTCA 1P7EA 2JXTA 4BOSC 2V4IB 3R2IA 2BS3B 1UGJA 1C4PA 3DWGC 3SDLC 5EE1A 2JWUA 4M8MA 3DOWA 1V81A 2JU6X 1F1HA 1L5PA 2L0TA 2DYOA 1M94A 2DBYA 2O2VB 1EF1A 3VR8B 2KLCA 1VZ6A 3VR9B 2M0XA 3P63A 1HE8A 4MT5A 3B1LX 2IO0B 1YD8U 3U4EG 2XNAC 3QQ8B 2KC1A 3GP7A 1D6EC 4RFBA 1WE7A 4HEA1 4K3CA 4E71A 2HTHA 2BS4B 4JX1C 1XLQA 2V9HA 2L3ZA 3HVDA 1WJNA 2IO2B 3W5UB 2N7JA 1KLVA 4LTUA 2MP2A 2J7QB 2KDBA 3KW5B 4WAFA 3VAWA 4DHJB 1FMAD 4EZLA 4RH6A 3R3MA 3LDZE 2PTLA 2KJRA 4NZLB 1MG8A 3N32A 1QOGA 2WX0A 3PVLA 4XX5A 3RN9C 3WAPA 2QEJC 1X1MA 3PZ7A 3L0WB 1IGCA 2J4XA 3VVWB 2FCQA 4R3DA 1CMXB 1WXSA 2INCC 2INNE 3AE7B 3DHHC 3CSTA 1TZOA 2D2QA 2PE9A 2WWZA 3ZNID 4NNJB 1F2RC 3MHSD 2N1WA 1N5XA 4MJSA 4FHJA 1V8CA 2DENB 1YQBA 1NI2A 4XDCA 3OWEB 1V1PB 5HHDG 2KACA 4TSSA 1FFVA 2G3QB 2Y3AA 3JVZX 2JSVX 4E3CA 4M0WA 1C4CA 4ZHPA 2OEDA 1SXTA 2N4FA 2ZZPB 4GB9A 3RNCC 2K8BA 2WGSA 5H8YE 2C7HA 5FK9C 4YT0B 3RZFA 3ZW3A 1K8RB 5HI1A 4IWQA 3QJZA 1ZKHA 1WE6A 3VUYA 1ZUD2 2DAJA 4ANWA 2LI5A 1ZOYB 4EZJA 5L95C 1ZDVA 1T0YA 2MEKA 2JX5A 2AYOB 1UBQA 2JXXA 1SJHD 3AEEB 3DBRI 4BVUC 3RNGC 2VH2A 2L83A 1I4PA 2BF8B 3ML8A 4JLCA 3UIOB 2DLBA 2WYQA 3L13A 4HWIB 1L0VB 4N9F4 1FIQA 1UNSA 3PHWB 3V6EB 4ZRKA 1S3SG 1EU3A 2Y5CA 5IO9A 2RPQA 2JQRB 4K7SA 3WANA 3R2TA 3KVFB 2D10A 2C5LC 3VDZA 1ET9A 2L8JA 1NBFC 3EA6A 4GU2A 2KDEB 5AZFA 3TSSA 3VH3B 1VCBA 1ESFA 4YXDB 2KMAA 4FADA 2D5GA 1UF0A 4WWNA 3KUDB 4GDLA 4DHJD 4XDDA 3AI5A 2FIFA 3VXWA 4GLSC 3Q3MC 4KKIA 2L52A 5IA7A 2QILA 2UU7A 1ZGUB 4GXBA 1V2YA 2KO3A 2MH7A 1M4VA 4JWUC 4PS3A 2K3UA 2BT6A 5IN7A 3TIXA 2DZMA 3ENEA 1QZEA 3R66C 1RM6C 5LXIB 4NQKE 3UIPB 4GMVA 1TBEA 2D07B 1E8XA 4S0RA 4US9A 3ZYYX 1FRRA 3WCQA 1K52A 4PS7A 1QLBB 2KQSA 2A4ZA 1N62A 1ZDXA 1UELA 2N1VA 4W9LA 4B0EA 2GI9A 2E3TA 3RNAC 2LD9A 1N61A 3K9OB 4GGQA 1R4NI 3X23A 2LEKA 2G4DB 4A3OA 3FILA 4OVVA 2IY1B 1Z5SB 2KN4A 5DPSA 1D5MC 1TS5A 2HD5B 4YSXB 1I7HA 1GPXA 1MG4A 3W9CB 2REXA 1N60A 4F8CB 3DBLI 1CJEA 1YJIA 1HQRD 2K25A 4FHKA 2JZ3B 5BMGA 1TY2A 2KDMA 4WQMA 2MBQA 4YSZB 1ZW7A 1GC7A 4KGSA 4DK5A 2Q5WD 1UZXB 3SD5A 3PRZA 2WX1A 1LQBA 4DWFA 2ZVNA 1KLGD 3P2BA 1SGHA 3EECA 3KUCB 1ENFA 5CX3A 2KYWA 1YJ1A 3W1SC 3ZUNA 1L6UA 4K3BA 2X38A 3ZNZB 1UGMA 4IUMB 2J53A 2KZRA 2IPKD 3TL5A 3DBRB 3R7RA 1TYGB 2BKRB 3Q14C 1IBXA 4HCNB 1I4HA 2WDTB 4W9EA 4NAWA 4CYEA 2NVUI 2NBUA 1VZ7A 2EELA 4I6LB 2KOXA 5D6JB 3H7SA 5D2MB 1WX8A 2I1KA 3P4RB 1HA5A 2GRIA 1F9JA 4C56C 4JIOU 2OOBB 3NJTA 5D3IB 2JT4B 5DPRA 2I2YA 4C80A 3ZXVA 4WIPA 3J9CA 5IP4D 3BWUD 5CHVC 1HTQA 3RI7C 2HDEA 4G50A 4WWPA 1WZ0A 2D3CA 3GZNI 4NJCA 1SF0A 2KMMA 3PS6A 2M56B 2FE8A 4HK2A 4LDTB 1L0XB 3M95A 2Z59B 2BB6A 3BIID 2KC2A 4ZHOA 2ON8A 1E8ZA 3AEBB 2JYTA 2LUEA 4IC7B 1DOXA 3ZTDA 3DPDA 1YN4A 5EDSA 3P42A 3NS8A 1FD6A 2Y5PA 1WRDB 2ZVOA 3BVGA 4LNOA 5G5GA 1C1YB 4S17A 4EKUA 3WAOA 3T3OA 3AM9A 1KH0A 4W9JA 1CQVA 2OJWA 2DNFA 3NUHB 2KDFB 1KTKA 1WGKA 2EKIA 1YQ3B 3IXSA 1XQQA 5BMHA 2TSSA 4I6NB 2M4NA 3CMMB 3VTWA 3HRDD 4M00A 2WXNA 3QK0A 1E7UA 1J8CA 3TCAA 4C4VA 3A1QB 3Q8BA 2V4LA 2DAFA 3RNBC 4MH8A 3Q2AC 4FA6A 4KIKA 2MJEA 2LJIA 2WXFA 3U2SC 4ACFA 1GB4A 1G6JA 3H9DA 3DQVA 4FJYA 1QF6A 3TEYA 4HLEA 4AUQC 3PV1A 4WJQA 1S1QB 1FXIA 1C79A 4BAXA 2R2QA 1QKZA 5EE9A 3DBLB 3I63C 2M8SA 4JPSA 4MGZE 1SIJA 3QA8A 3DVGY 4RGOS 3N1XC 5C1ZA 2MHJA 2PIAA 2LZ6A 3R8BA 2INPE 3QAQA 2JPHA 2KX0A 2DZKA 2ZPNA 1K51A 4LNFA 3M63B 1OTRB 1RWSA 3VTUA 3ZIMA 2GBJA 1EU4A 1I4XA 2NR2A 1SIFA 3ZRFA 3MC0B 4D2KA 2VRRB 1WM3A 2HTME 2KTRB 5BYSA 2ZNVB 2JYEA 1EO6A 3T8MA 1NYRA 4W9FA 2INDC 2ASQA 5LNK1 1WIAA 2KWCA 3LJ3A 3IT4B 3RUIB 1OQYA 3HM6X 1ROEA 4DHZE 4ZRPA 1LGRA 2WHIA 2K5PA 4NJ6A 3U30A 2MBEA 4NY0A 1DOIA 2ZEQA 1J19A 1WGRA 2FCNA 1FEHA 3MTNB 3Q8AA 4KZCA 2AL3A 3A33B 1D4BA 4BKSD 1FXTB 2LHEA 3NS1A 2FCMA 2FAZA 3JSVA 3DBSA 3EC8A 4N58A 1P0RA 2KWDA 4ASWC 1F52A 4JL9A 1MHXA 4W9CA 4WJPA 4MGYE 1WF9A 2L00B 3EHVA 3JYUA 1L2NA 4ZYNA 4LNNA 1TGZB 3MJ5A 1UH6A 2E6XA 2PVOD 3I5JC 2Y5BB 4ITKA 5L83A 4GDKA 3ZO5B 2W82A 3RYTA 2WXLA 3ONSA 4MM3B 4HKQA 2QCZA 5MPOA 1WR1A 4HDOA 2UYZB 3ECIA 1V80A 3HUIA 1EM7A 2CHZA 3NVVA 4BZAA 2DYMA 1PUTA 1ZXIA 1WR6E 3AEGB 2XEWA 2I1JA 3DVGX 4LCDE 2WXOA 4MDKE 1JWUD 2H89B 3BK1A 4YTNB 1HEZE 4X57B 2CHXA 5GMVA 5DCNA 4HPPA 2LVOA 3PO0A 4A8XC 1UD7A 4J3OD 4B95A 1WGDA 4RGMA 1OFFA 4M8NA 5LLIA 2IGDA 4M01A 4ICVA 3AE4B 3E56A 5E6NA 4I6PA 2NCNA 4PK1A 3ALBA 2KLGA 3ZJVA 2KJ6A 3RPFC 1YNTE 4F1SA 3Q8FA 3AEDB 4NAMA 1SB3C 4HJGE 3RD2A 4DDID 4KSKC 1MHHE 1LM8B 2GOWA 4FJVB 5JH5C 3U7ZA 2XK5B 2JWZA 4TMAB 4P1CC 4REZA 3AB5A 4A20A 1E6EB 2V3PA 3OG5A 4LNIA 4Q2JA 4K7UA 3VQIA 2WXHA 4ARIA 2MWSB 3B0AA 3PZDA 4RF1A 3IAM1 4DDGD 3B2FA 5EE3A 3ML9A 2MJDA 1FXAA 5HFYA 2FBWB 2RDGA 2ZNVC 2CS4A 1WGGA 4HVBA 3A9KA 3P4SB 3PLUA 3ZLZA 3ETRA 1A5RA 2MBBB 3R7QA 3N1YC 4C7ZA 4OZAA 2IGHA 3GB1A 2BQQA 3L4PA 1QOBA 1IYFA 1RLFA 2I38A 2NPTA 1C76A 1KLUD 1TJEA 3C19A 5I4DA 3Q8EA 1MVKA 3PRPB 5J2RA 2KQ7A 4OZBA 1WX9A 4MSMB 3L08A 4AOFA 5G55A 2K0PA 4MH0E 1V9JA 2DX5B 5AEKB 3U52E 1E8YA 3ABVB 4ANUA 1Y8RC 1UBIA 1RFAA 4PYUA 1WSPA 3URYA 2LFIA 1ZE3D 4FBJB 1P3QU 2ACZB 2GBKA 3AMZA 1NYQA 2N9KA 2LGYA 1KRHA 2K8HA 2KWVB 4RM9A 2YEPB 5FKAC 3BZDB 3KWLA 1TS2A 2BW2A 5LXHA 1L4DB 2O6VB 3EFUA 1WJ4A 1D5ZC 3D32A 3B2GA 3QCAA 5DPWA 2M0AA 4RF0A 3H7PA 4II3B 4DXAB 4BFRA 3NVZA 5HKHA 1E8WA 1YMHE 1F0ZA 2ONQA 3DCGA 4YWGG 2LASA 3W1YA 3TBLD 3ZJTA 4XZ4A 1XT9B 2KFKB 3T9LA 1HZ6A 3AEAB 3O65B 3N3KB 1E5WA 2G4SA 2EKEC 1YX5B 1JRUA 3T3NA 2RPVA 4NJ7A 2D11A 3I3TB 2KFJA 2L0FA 3M62B 2FCSA 1FFUA 1B1ZA 4EEWA 2DZJA 1PFDA 3KLSX 4WJOA 1UWXA 2PMVA 3PGEA 2YEPF 2K39A 2IY0B 2O2VA 1FO4A 2L32A 2Z0EB 3DVNV 4P6VF 2MRPA 4W9GA 3ZKJC 4MELA 3A9JB 4AJYB 3DBHI 2LUMA 4KGRA 2QDFA 4KSLC 3Q69A 1XF5L 2JRHA 4URKA 2V3SA 5JXVA 2QIEB 3GOEA 5T8IA 4B6WA 3K9PB 5DPTA 3BYTB 3ZRCA 3N30A 2OHFA 3WIMA 2JY6A 2WQYB 3SR6A 5JZEB 3PHXB 1HXYD 2QMTA 2A5UA 1VR9A 2AQ2B 4ZRJA 2AQ1B 1Y56A 1PYWD 4EFOA 1R4MI 2KD0A 1SE4A 1WXVA 2QJLA 1XCQL 3AE2B 1IPGA 4ARCA 1KOTA 2B76B 4OVUA 4MGKE 4UDUC 2KAJA 2LJ5A 5IOIA 3MJWA 2JZZA 3JW0X 1V5TA 1U4AA 1XO3A 2NMQA 4YL8A 3IVFA 1XCTL 3SU8X 1FCLA 3FAHA 3APDA 4RMAA 1JWSD 3TEXA 1V1PA 3QARA 5GXGB 3PZ8A 4P16A 2H88B 1F77A 1FRDA 4JWSC 1BUIC 1IGDA 4ZRIA 2CU1A 2O6VD 4TKNA 3LB8C 1I35A 3SFEB 4AQ7A 1T0QC 4GSWA 3IHPC 4EUTA 1OQQA 3EFCA 2DYBA 1DYQA 2RMMA 4RGNA 3Q3OC 1JWAD 5E6PA 3NVWA 3NZ3A 2BVCA 3N9YC 3BVMA 5E6OA 1FM0D 1E90A 4IG7B 1Q1OA 4RNAA 3CIRB 1NEKB 2MCNB 1T0RC 1ET6A 3AE9B 3ZDTA 4DXGA 1ZPSA 3Q3JA 1VD2A 3C0RB 2BYTA 2LXAA 1PGXA 1TTNA 2MX2A 2YLMA 1KF6B 4GDKB 4A3PA 2V0GA 1FNVA 4RGTA 1FNWA 1Q5WB 4PS8A 5BO4B 3WAMA 4HXDA 1SJED 3N1ZC 3L17A 3BY4B 3BVZA 1JQ4A 1Q0WB 3BINA 4BBNF 3AEFB 2GB1A 1YIWA 2BWES 1AYFA 5AZGA 1D5XC 3HHMA 1SEBD 1VZ8A 2PVGC 3ZQ4A 1TS3A 4YTPB 3OLMD 3M3JA 2BYVE 2L7RA 2NTSA 2MP2B 3N20C 1VJKA 1R4NB 3AU4A 2KX3A 2J0JA 4OVZA 2JRIB 3Q3FA 4JQWC 5D3DA 4LK0M 2WXGA 2SEBD 4HROA 4JE3B 4AJWA 1C9FA 2FUG1 4LLGM 3W5VB 1MI0A 1QQRA 1H4RA 4J6IA 1PGBA 1XLOA 1AW7A 3IG3A 3LYYA 5C23A 1PQSA 3MC8A 3DHIC 3MFGA 4HDQA 4KKJA 1KFYB 4TV3A 2MJ3A 2JF5A 2L1AA 1P98A 1EF5A 1ZXHA 4MJSB 2QSDA 3ZXRA 2IYDB 2W9NA 4DXFA 4GIVA 4BBNC 1WXMA 4L23A 1NDDA 2NTTA 4XC2A 3QX1A 3KYCD 4XWWA 4M0WB 1KM7A 1ZP0B 3L54A 3V05A 2RGFA 1YN5A 2GBNA 1WI0A 2J42A 3L10B 1J0GA 2JZPA 2M19A 1SE2A 3FKYA 1TKYA 2KN5A 4FJZA 1SSNA 3AECB 3OJ3A 4NQLB 4LDTD 3DHGC 1GG3A 2JUOA 1JMLA 4KX6B 2ZW1A 2YVCA 2G9HD 3QWZB 4GOCA 3U7DA 3RFZB 2XBBC 2KXJA 1FCCC 2J52A 2CKHB 2WP9B 4IW0A 2WNMA 4MGIE 2M1MA 3GZNB 1RYJA 1Z2MA 2AL6A 2KVRA 3B08A 2K8CA 1N6ZA 2BS2B 4A9AA 2N7DA 3H8HA 2N7EA 1LXDA 3V60A 1YOVB 4ANVA 1WY8A 2D3AA 1VDVA 2WU2B 4EOYA 1V6EA 3OAWA 1B9RA 1H8CA 3RZWC 2QHOA 1N63A 3HM3A 2ZW0A 3U8ZA 5E6JA 2LGIA 2W55A 4XYCA 1SE3A 1XLPA 3I9V1 2IO1B 1L7YA 4IOIE 5AZHA 3VTVA 1OEYJ 1C78A 2KMCA 4HJKA 5J18A 2AQ3B 2CR5A 3WALA 4EZKA 4GDLB 3ZJUA 4BKSA 2RDHA 1WH3A 5CTRC 3PTFC 3C8YA 1XXGA 1BXTA 1PGAA 4G3XB 4M02A 1JWBD 2IZVB 2PPHA 1CK1A 2PLPA 1YJJA 4C7YA 3Q3NC 1IP9A 1V1OA 3QHTA 5BYQA 1SBBB 2WDVB 4C00A 3EGRA 4WURA 1E9MA 3NG0A 2AX5A 2Z8LA 4TQ0A 3HK0A 1DGJA 4O1NA 1TKGA 1FPYA 5JHBA 1L4ZB 4FXCA 5CHFA 4OZCA 1QOFA 3FILB 4TQ1A 2NBVB 4WWOA 2KNBA 1WWTA 1OQRA 1J7AA 4TUUA 2RR9A 3A1QA 3H6NA 4W9IA 2W3SA 4AWJA 2C9WB 4E74A 2MLBA 4BKGA 1I4GA 4IM0A 3MC9A 3CWIA 3E9SA 2VH1A 3SHQA 1QILA 3TEWA 2FNJB 5G5HA 2QC8A 4XGAB 3NRZA 3KQ4A 5JHAA 2WXPA 1Q10A 1V97A 4B0MA 4PYZA 4KDIC 3VHTC 2G45B 2WXQA 4KVGB 2PJHA 2BYFA 1TY0A 3VFKA 2R61A 2J0MA 2M17A 2C7NB 3S2AA 1MPEA 4B9KA 2Z0DB 1P1AA 2DZIA 4IDIA 3UF8A 3MP9A 1WYGA 2KVZA 1JROA 5KHOA 4F7ZA 1WJUA 2N9XA 3TMPB 2FIDA 2KQ4X 3P1MA 1IBXB 2EMTA 4NAWB 2ZCBA 1WXAA 1BT0A 2SAKA 4EE2A 4BOZB 2RDBC 3V62A 2KTRA 1HTOA 2N0SB 2N9LA 1C77A 1STEA 5FR3A 3NHEB 2KWUB 2ZJDA 4RCOA 2WLBA 2WDRB 2BYEA 3B9JA 2IO3B 2C7MB 1XEEA 2K6QA 3V61A 1MFWA 4CO7A 2VZKB 3LXFA 2IGGA 4IM3A 4KV2A 5D7GA 3PRMB 3IFWB 2V1YA 4DQOC 4HPLB 4WH4A 1J7CA 3AE1B 1GB1A 5TSSA 1LFDA 2KDIA 3AV8A 4USAA 5TR5A 1WMHA 1GOZA 2HE7A 2IBIB 4LJOB 5IAAC 3RNEC 4PT5A 2CHWA 3UQBA 5G2NA 2KJHB 1XLNA 3EUB2 1EWYC 3AU5A 1YN3A 2KT7A 3A4SC 4ZDVA 3GE3C 2BPSA 2MQJA 4MM3A 5BMIA 1AARA 4ICUA 3KUZA 1C4AA 1K50A 4IM2A 4QAYA 2KTFA 1UWMA 4ANXA 2PW9A 1WX7A 3KWVA 4HKZE 4XWTA 4ZYSA 2WS3B 2KK8A 5CHWA 4G0NB 4DHZB 4P7IA 3APCA 1JRPA 2L05A 3TUOA 1DOYA 4LJPB 3VH4B 2IJ0A 4C4VB 1R7SA 2LWPA 3Q8CA 3HIZA 4KIKB 1JWMD 1WYWB 4WQOB 1E7VA 4KZ0A 2J0KA 3AN1A 4CQNA 2IDYA 2LGXA 4G11A 4XE0A 1GAQB 1WGHA 4N59A 3DWMA 2AEHA 3TEZA 3IAS1 3HVZA 1T5XD 2XK5A 3IBEA 1I4RA 2X8XX 2C60A 3TJPA 4LNKA 1CZPA 4ZOHC 3AE8B 1V86A 3P4PB 1WM2A 2EMSA 5H92C 1TZ1A 1QT9A 2ZPYA 1P9DU 3V6CB 4K81A 1TIFA 3H1UA 1P7FA 2MA9B 4KGTA 2DWQA 2UWQA 3RULA 2WXIA 2FUHB 2KHWB 2CU3A 3ZVVA 2WXKA 1SE9A 3RCZA 3PPAA 3GE8C 1NI3A 2VZKD 2OJRA 4A55A 2V3NA 3VUXA 2DHZA 3KYDD 3O13A 3V3XA 5EE0A 3UQAA 2LMCA 3UI3A 4L2YA 2GLSA 1A70A 5AUKA 2N9PC 1K53A 3ZNHB 1L0YB 4AP4C 1GC6A 1AWDA 3NVYA 2WXJA 5D94A 1E0ZA 1F2RI 2PE6B 5IKCM 1VLBA 3JSVB 2HJ1A 1OGWA 2ZCCA 1EWCA 1WJ6A 3ZDMC 1PDXA 2LRUA 1HZ5A 2AWTA 4YTMB 4MEMA 3UINB 4MACA 2BTEA 1MJDA 1WRIA 1TT5B 3W1SA 3GS2A 1JCKB 1WFYA 4FLHA 1ACCA 3AULA 1TS4A 2K1FA 2RSUA 4WJNA 3RNFC 5KHQA 1YX6B 1WGYA 1NENB 2W3RA 3VRAB 2JVCA 1TKEA 3RMKC 1GUAB 1JALA 3FC4A 2O6VA 4IWOA 4N6EB 1V5OA 2GBRA 4DBGA 1E7PB 4W9DA 3BYYB 1T3QA 4GN1A 1J7BA 2MBOA 4FN2A 5FR6A 4ZRQA 2ICIA 2CJOA 1N5WA 3WA0A 1ISNA 3PT2B 2KFKA 3ZNGC 3ZGZA 4US8A 2D3GA 2NS5A 3PLVA 4CHKA 1L6VA 2LVPA 4HCPB 3AE3B 4K7WA 3VRBB 3DBHB 3KH0A 1RRBA 4W9KA 4JGHB 5BYRA 4II2B 1T0SC 4IKGA 2KKCA 1WZ3A 3AE6B 4HRSA 3AXCA 5J17A 1AN8A 4IWPA 4FULA 2LGDA 3I57A 4KDLB 3P4QB 1I4QA 2WDQB 3A9JA 1R4MB 1RFKA 2GBMA 5C3JB 2WXRA 2NBWB 4K1RB 3A4RA 2MSED 2BWFA 2LHDA 1KJTA 5HG2A 4L1BA 2BKFA 3QIJA 1WXQA 3A9KB 4MSQB 3NOBA 3PREA 3PSEB 2LVQA 4NPNA 3L16A 1T6BX 3SFDB 3MHZA 4OW0A 4H2AA 1I42A 4W9HA 1UUPA 2PKOA 3CF6E 2NPTB 2XN9C 4HPMB 3QC8B 3VUWA 2BGFA 1BMLC 1C3TA 2R2OA 3X0WA 1IUEA 2N9EB 3W2DA 3DVNU 1RAXA 1NVID 2MW5A 5C2TB 3NZSA 1EUVB 4YSYB 4WWMA 2CJNA 2BBCA 1GNUA 2LRWA 3OJ4B 1E10A 2WU5B 3APFA 3UGBB 1LO5D 3BK2A 4BKTA 4A90A 2LXCA 1FNUA 2BB5A 3DDCB 2LGSA 4WAAA 2MBHA 5AUIA 3NZUA
chains in the Genus database with same CATH topology
4A6QA 3SEBA 3IT6B 2WXMA 1XF5L 2WXQA 1FD6A 2Y5PA 5JXVA 1TY0A 2QIEB 5T8IA 2R61A 3BVGA 3BYTB 5G5GA 2G1EA 1MPEA 4IDIA 2K22A 1YQ4B 2OHFA 1WYGA 3MP9A 3AH7A 1JROA 3T3OA 2WQYB 1QOAA 3AM9A 1KH0A 2W54A 3SR6A 3AE5B 4AS1A 1HXYD 1CQVA 2KQ4X 2QMTA 1VR9A 3P1MA 2AQ2B 2AQ1B 2K9XA 1Y56A 1PYWD 1IBXB 3NUHB 4NAWB 1KTKA 1WGKA 4OHJA 1SE4A 2SAKA 2QJLA 2EKIA 1JW9D 1YQ3B 1VRAB 3IXSA 1XCQL 4EE2A 3AE2B 5BMHA 2TSSA 4ARCA 2N0SB 1P7EA 2JXTA 2N9LA 2V4IB 1C77A 3R2IA 3HRDD 1STEA 2WXNA 5FR3A 2B76B 4RCOA 2BS3B 1UGJA 4UDUC 1C4PA 2KAJA 2WLBA 2WDRB 3DWGC 3Q8BA 5EE1A 3B9JA 2JWUA 1XEEA 1XO3A 2NMQA 1XCTL 2VZKB 2IGGA 3LXFA 4MH8A 5D7GA 2MJEA 1FCLA 2LJIA 2WXFA 3FAHA 3U2SC 4DQOC 2JU6X 4WH4A 1J7CA 3AE1B 1L5PA 1GB4A 1GB1A 5TSSA 2DYOA 1JWSD 1QF6A 3TEYA 4USAA 3AV8A 2DBYA 3VR8B 3TEXA 1GOZA 1V1PA 1VZ6A 3VR9B 5GXGB 1FXIA 1C79A 3P63A 3PZ8A 4MT5A 1QKZA 4P16A 5EE9A 2H88B 1F77A 1FRDA 4JWSC 3U4EG 1BUIC 1IGDA 2XNAC 4PT5A 4JPSA 1SIJA 3GP7A 4RGOS 1D6EC 4RFBA 3LB8C 4HEA1 3SFEB 4AQ7A 2PIAA 1OQQA 3R8BA 1XLNA 2BS4B 4JX1C 2INPE 1DYQA 1XLQA 2RMMA 3EUB2 4RGNA 1EWYC 1JWAD 1YN3A 3HVDA 3NVWA 3NZ3A 3W5UB 1K51A 2N7JA 4LTUA 5BMIA 1RWSA 3N9YC 3BVMA 1FM0D 4WAFA 1C4AA 1FMAD 1K50A 1EU4A 4RNAA 1I4XA 4RH6A 3CIRB 1UWMA 1NEKB 2PW9A 3KWVA 4HKZE 4XWTA 1ET6A 2PTLA 4NZLB 4ZYSA 2WS3B 3AE9B 3MC0B 1QOGA 4D2KA 4DXGA 1ZPSA 2QEJC 3PZ7A 2HTME 1JRPA 2BYTA 3TUOA 5BYSA 1IGCA 1DOYA 2J4XA 2JYEA 1NYRA 1PGXA 1KF6B 4GDKB 4R3DA 3AE7B 2INNE 1FNVA 2V0GA 5LNK1 1TZOA 2IJ0A 3IT4B 1R7SA 4RGTA 1ROEA 4ZRPA 3Q8CA 1FNWA 2K5PA 1F2RC 1DOIA 1JWMD 1SJED 1FEHA 1N5XA 3AN1A 3Q8AA 4CQNA 3BVZA 1V8CA 1JQ4A 2IDYA 1D4BA 4XE0A 1GAQB 2LHEA 4XDCA 3OWEB 3NS1A 3AEFB 1V1PB 2GB1A 4N59A 5HHDG 3DWMA 2KACA 4TSSA 1FFVA 4N58A 3TEZA 2Y3AA 2KWDA 3IAS1 1AYFA 2JSVX 1D5XC 4M0WA 1C4CA 1MHXA 4ZHPA 3HVZA 2OEDA 1SXTA 1T5XD 1SEBD 1VZ8A 2PVGC 5H8YE 1I4RA 5FK9C 3ZQ4A 4YT0B 1TS3A 4YTPB 5HI1A 1CZPA 4ZOHC 3MJ5A 3AE8B 1ZUD2 2E6XA 3P4PB 2PVOD 4ITKA 1ZOYB 2NTSA 2W82A 5H92C 2WXLA 1ZDVA 1QT9A 2MEKA 4MM3B 2JX5A 4HKQA 5MPOA 1VJKA 4OVZA 1P7FA 1SJHD 3AEEB 3HUIA 5D3DA 4LK0M 1EM7A 3NVVA 4KGTA 2L83A 2WXGA 2DWQA 1PUTA 1ZXIA 2DYMA 1I4PA 2SEBD 4HROA 4JE3B 2WXIA 3AEGB 2WXOA 2CU3A 1JWUD 2H89B 2WXKA 3BK1A 4YTNB 1C9FA 1HEZE 2DLBA 2FUG1 4LLGM 3W5VB 3PO0A 1MI0A 1QQRA 1NI3A 4A8XC 2VZKD 1PGBA 4A55A 1XLOA 1L0VB 4J3OD 2V3NA 3O13A 4RGMA 3V3XA 1FIQA 1AW7A 1OFFA 1UNSA 3LYYA 5EE0A 2LMCA 3MFGA 3UI3A 1EU3A 2IGDA 4KKJA 2Y5CA 1KFYB 4L2YA 1A70A 5AUKA 3AE4B 2MJ3A 1K53A 2JQRB 1L0YB 2L1AA 3R2TA 3E56A 1ZXHA 1AWDA 3NVYA 2WXJA 1ET9A 2QSDA 3ZJVA 1E0ZA 3RPFC 3EA6A 1F2RI 1YNTE 3Q8FA 3AEDB 1VLBA 1SB3C 4NAMA 4DXFA 4HJGE 3TSSA 4L23A 1MHHE 1EWCA 2NTTA 1ESFA 4XWWA 1PDXA 1HZ5A 4YXDB 1ZP0B 4YTMB 3U7ZA 4TMAB 3V05A 4MACA 2BTEA 1YN5A 1WRIA 2D5GA 4REZA 3AB5A 1E6EB 2J42A 2V3PA 3W1SA 2JZPA 2M19A 1JCKB 1SE2A 3GS2A 1ACCA 4Q2JA 1TKYA 4XDDA 3VQIA 1TS4A 2WXHA 4ARIA 4GLSC 1SSNA 4KKIA 4RF1A 3IAM1 1NENB 2L52A 3AECB 2W3RA 3VRAB 2QILA 3B2FA 5EE3A 1TKEA 2MJDA 2MH7A 1FXAA 1JMLA 1M4VA 4JWUC 4KX6B 2ZW1A 1JALA 2G9HD 2K3UA 3FC4A 5HFYA 2FBWB 4N6EB 2RDGA 3RFZB 2BT6A 3P4SB 1FCCC 1E7PB 1RM6C 2J52A 3ETRA 3BYYB 1T3QA 2WP9B 1J7BA 2WNMA 4US9A 3ZYYX 4C7ZA 1FRRA 3WCQA 1K52A 4ZRQA 4OZAA 2IGHA 2ICIA 1QLBB 3GB1A 2CJOA 1RYJA 1N5WA 3L4PA 1QOBA 1N62A 1ZDXA 4B0EA 2GI9A 2E3TA 2I38A 1C76A 1KLUD 2BS2B 1N61A 4A9AA 1TJEA 3H8HA 5I4DA 2LEKA 3Q8EA 3FILA 3ZGZA 4US8A 1MVKA 1L6VA 1VDVA 2WU2B 3AE3B 4OZBA 3VRBB 2KN4A 1B9RA 2K0PA 1D5MC 1TS5A 5BYRA 4YSXB 4IKGA 1I7HA 1GPXA 1N63A 2ZW0A 3U52E 3W9CB 5E6JA 3ABVB 1N60A 2LGIA 2W55A 3AE6B 1CJEA 1SE3A 1XLPA 1YJIA 1HQRD 3I9V1 1WSPA 4HRSA 4IOIE 3URYA 2LFIA 5BMGA 1TY2A 2KDMA 1ZE3D 1C78A 1AN8A 4WQMA 4YSZB 3I57A 2AQ3B 4KGSA 3P4QB 2Q5WD 1I4QA 2ACZB 3AMZA 2WDQB 1NYQA 2N9KA 4GDLB 3ZJUA 1KRHA 2RDHA 1RFKA 5C3JB 2WXRA 1KLGD 3C8YA 2YEPB 1XXGA 5FKAC 2LHDA 3BZDB 1BXTA 1PGAA 3KWLA 1ENFA 1TS2A 2BW2A 1L4DB 5HG2A 4L1BA 1JWBD 1L6UA 1D5ZC 1WXQA 3B2GA 1CK1A 2PLPA 1YJJA 4C7YA 2X38A 2J53A 2M0AA 4RF0A 1T6BX 1V1OA 3SFDB 3MHZA 4OW0A 2IPKD 4H2AA 5BYQA 1SBBB 2WDVB 1TYGB 1UUPA 3EGRA 3NVZA 1E9MA 4WURA 1I4HA 1IBXA 2AX5A 2Z8LA 4TQ0A 1DGJA 2PKOA 4O1NA 1YMHE 1TKGA 1F0ZA 1VZ7A 2ONQA 2EELA 2XN9C 4YWGG 1L4ZB 4FXCA 3ZJTA 3P4RB 4OZCA 1BMLC 1HA5A 1QOFA 2GRIA 1HZ6A 3AEAB 3FILB 4TQ1A 4C56C 5D3IB 1IUEA 2I2YA 4C80A 4WIPA 3W2DA 3J9CA 1NVID 1WWTA 5C2TB 1OQRA 1J7AA 3BWUD 3T3NA 2RPVA 4YSYB 4WWMA 2HDEA 2CJNA 2BBCA 2W3SA 4NJCA 1FFUA 1B1ZA 1SF0A 2KMMA 1I4GA 3CWIA 2M56B 2FE8A 3E9SA 1PFDA 3KLSX 1QILA 1L0XB 3TEWA 1E10A 1UWXA 2PMVA 5G5HA 2YEPF 2WU5B 2BB6A 3BIID 1FO4A 2L32A 4ZHOA 1LO5D 4P6VF 3BK2A 3NRZA 4A90A 2ON8A 3KQ4A 1FNUA 3AEBB 2BB5A 2JYTA 1DOXA 2WXPA 1Q10A 1V97A 1YN4A 2LUMA 5AUIA 4KGRA 4B0MA 3Q69A 3P42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKZ E;  1FD6 A;  1XF5 L;  2LGI A;  2IGD A;  5JXV A;  2PTL A;  1K53 A;  4IOI E;  4D2K A;  5BMG A;  2KDM A;  1ZXH A;  1MPE A;  4KGS A;  1IGC A;  2QSD A;  3MP9 A;  1PGX A;  2N9K A;  1F2R I;  1YNT E;  1KH0 A;  2QMT A;  2KQ4 X;  4HJG E;  1IBX B;  1MHH E;  2LHD A;  1PGA A;  1HZ5 A;  1F2R C;  5HG2 A;  1XCQ L;  4MAC A;  5BMH A;  2PLP A;  2JZP A;  1P7E A;  2JXT A;  2N9L A;  1D4B A;  2J53 A;  2LHE A;  2GB1 A;  5HHD G;  2KAC A;  4GLS C;  2KWD A;  2JWU A;  2JSV X;  1IBX A;  2NMQ A;  1YMH E;  1MHX A;  1XCT L;  2IGG A;  2ONQ A;  2EEL A;  2OED A;  1FCL A;  1JML A;  2ZW1 A;  2JU6 X;  4WH4 A;  5HFY A;  1GB4 A;  1GB1 A;  4OZC A;  1HZ6 A;  3FIL B;  5HI1 A;  1FCC C;  2J52 A;  2I2Y A;  2RPV A;  1K52 A;  4OZA A;  2IGH A;  1QKZ A;  3GB1 A;  1IGD A;  2GI9 A;  2I38 A;  1P7F A;  1EM7 A;  4KGT A;  1UWX A;  3FIL A;  1MVK A;  2RMM A;  4OZB A;  1C9F A;  1HEZ E;  2ON8 A;  1K51 A;  2N7J A;  1MI0 A;  2KN4 A;  2K0P A;  1PGB A;  5BMI A;  1Q10 A;  3V3X A;  4IKG A;  2LUM A;  1K50 A;  2ZW0 A;  4KGR A;  2PW9 A;  3UI3 A; 
#chains in the Genus database with same CATH topology
 4A6Q A;  3SEB A;  3IT6 B;  2WXM A;  1XD3 B;  1D3Z A;  1OEY A;  4P1B C;  2G1E A;  3Q6B A;  2HJ8 A;  1WMH B;  2K22 A;  3CSF A;  1YQ4 B;  3AH7 A;  2D3B A;  1V49 A;  1QOA A;  2W54 A;  3H7P B;  3AE5 B;  4AS1 A;  2B3A A;  2K9X A;  4RM8 A;  2K6D B;  2KAN A;  2L76 A;  3NY5 A;  4OHJ A;  2PEA A;  2RD0 A;  1JW9 D;  1GJZ A;  1VRA B;  2GMI C;  3RT3 B;  3ZTC A;  1P7E A;  2JXT A;  4BOS C;  2V4I B;  3R2I A;  2BS3 B;  1UGJ A;  1C4P A;  3DWG C;  3SDL C;  5EE1 A;  2JWU A;  4M8M A;  3DOW A;  1V81 A;  2JU6 X;  1F1H A;  1L5P A;  2L0T A;  2DYO A;  1M94 A;  2DBY A;  2O2V B;  1EF1 A;  3VR8 B;  2KLC A;  1VZ6 A;  3VR9 B;  2M0X A;  3P63 A;  1HE8 A;  4MT5 A;  3B1L X;  2IO0 B;  1YD8 U;  3U4E G;  2XNA C;  3QQ8 B;  2KC1 A;  3GP7 A;  1D6E C;  4RFB A;  1WE7 A;  4HEA 1;  4K3C A;  4E71 A;  2HTH A;  2BS4 B;  4JX1 C;  1XLQ A;  2V9H A;  2L3Z A;  3HVD A;  1WJN A;  2IO2 B;  3W5U B;  2N7J A;  1KLV A;  4LTU A;  2MP2 A;  2J7Q B;  2KDB A;  3KW5 B;  4WAF A;  3VAW A;  4DHJ B;  1FMA D;  4EZL A;  4RH6 A;  3R3M A;  3LDZ E;  2PTL A;  2KJR A;  4NZL B;  1MG8 A;  3N32 A;  1QOG A;  2WX0 A;  3PVL A;  4XX5 A;  3RN9 C;  3WAP A;  2QEJ C;  1X1M A;  3PZ7 A;  3L0W B;  1IGC A;  2J4X A;  3VVW B;  2FCQ A;  4R3D A;  1CMX B;  1WXS A;  2INC C;  2INN E;  3AE7 B;  3DHH C;  3CST A;  1TZO A;  2D2Q A;  2PE9 A;  2WWZ A;  3ZNI D;  4NNJ B;  1F2R C;  3MHS D;  2N1W A;  1N5X A;  4MJS A;  4FHJ A;  1V8C A;  2DEN B;  1YQB A;  1NI2 A;  4XDC A;  3OWE B;  1V1P B;  5HHD G;  2KAC A;  4TSS A;  1FFV A;  2G3Q B;  2Y3A A;  3JVZ X;  2JSV X;  4E3C A;  4M0W A;  1C4C A;  4ZHP A;  2OED A;  1SXT A;  2N4F A;  2ZZP B;  4GB9 A;  3RNC C;  2K8B A;  2WGS A;  5H8Y E;  2C7H A;  5FK9 C;  4YT0 B;  3RZF A;  3ZW3 A;  1K8R B;  5HI1 A;  4IWQ A;  3QJZ A;  1ZKH A;  1WE6 A;  3VUY A;  1ZUD 2;  2DAJ A;  4ANW A;  2LI5 A;  1ZOY B;  4EZJ A;  5L95 C;  1ZDV A;  1T0Y A;  2MEK A;  2JX5 A;  2AYO B;  1UBQ A;  2JXX A;  1SJH D;  3AEE B;  3DBR I;  4BVU C;  3RNG C;  2VH2 A;  2L83 A;  1I4P A;  2BF8 B;  3ML8 A;  4JLC A;  3UIO B;  2DLB A;  2WYQ A;  3L13 A;  4HWI B;  1L0V B;  4N9F 4;  1FIQ A;  1UNS A;  3PHW B;  3V6E B;  4ZRK A;  1S3S G;  1EU3 A;  2Y5C A;  5IO9 A;  2RPQ A;  2JQR B;  4K7S A;  3WAN A;  3R2T A;  3KVF B;  2D10 A;  2C5L C;  3VDZ A;  1ET9 A;  2L8J A;  1NBF C;  3EA6 A;  4GU2 A;  2KDE B;  5AZF A;  3TSS A;  3VH3 B;  1VCB A;  1ESF A;  4YXD B;  2KMA A;  4FAD A;  2D5G A;  1UF0 A;  4WWN A;  3KUD B;  4GDL A;  4DHJ D;  4XDD A;  3AI5 A;  2FIF A;  3VXW A;  4GLS C;  3Q3M C;  4KKI A;  2L52 A;  5IA7 A;  2QIL A;  2UU7 A;  1ZGU B;  4GXB A;  1V2Y A;  2KO3 A;  2MH7 A;  1M4V A;  4JWU C;  4PS3 A;  2K3U A;  2BT6 A;  5IN7 A;  3TIX A;  2DZM A;  3ENE A;  1QZE A;  3R66 C;  1RM6 C;  5LXI B;  4NQK E;  3UIP B;  4GMV A;  1TBE A;  2D07 B;  1E8X A;  4S0R A;  4US9 A;  3ZYY X;  1FRR A;  3WCQ A;  1K52 A;  4PS7 A;  1QLB B;  2KQS A;  2A4Z A;  1N62 A;  1ZDX A;  1UEL A;  2N1V A;  4W9L A;  4B0E A;  2GI9 A;  2E3T A;  3RNA C;  2LD9 A;  1N61 A;  3K9O B;  4GGQ A;  1R4N I;  3X23 A;  2LEK A;  2G4D B;  4A3O A;  3FIL A;  4OVV A;  2IY1 B;  1Z5S B;  2KN4 A;  5DPS A;  1D5M C;  1TS5 A;  2HD5 B;  4YSX B;  1I7H A;  1GPX A;  1MG4 A;  3W9C B;  2REX A;  1N60 A;  4F8C B;  3DBL I;  1CJE A;  1YJI A;  1HQR D;  2K25 A;  4FHK A;  2JZ3 B;  5BMG A;  1TY2 A;  2KDM A;  4WQM A;  2MBQ A;  4YSZ B;  1ZW7 A;  1GC7 A;  4KGS A;  4DK5 A;  2Q5W D;  1UZX B;  3SD5 A;  3PRZ A;  2WX1 A;  1LQB A;  4DWF A;  2ZVN A;  1KLG D;  3P2B A;  1SGH A;  3EEC A;  3KUC B;  1ENF A;  5CX3 A;  2KYW A;  1YJ1 A;  3W1S C;  3ZUN A;  1L6U A;  4K3B A;  2X38 A;  3ZNZ B;  1UGM A;  4IUM B;  2J53 A;  2KZR A;  2IPK D;  3TL5 A;  3DBR B;  3R7R A;  1TYG B;  2BKR B;  3Q14 C;  1IBX A;  4HCN B;  1I4H A;  2WDT B;  4W9E A;  4NAW A;  4CYE A;  2NVU I;  2NBU A;  1VZ7 A;  2EEL A;  4I6L B;  2KOX A;  5D6J B;  3H7S A;  5D2M B;  1WX8 A;  2I1K A;  3P4R B;  1HA5 A;  2GRI A;  1F9J A;  4C56 C;  4JIO U;  2OOB B;  3NJT A;  5D3I B;  2JT4 B;  5DPR A;  2I2Y A;  4C80 A;  3ZXV A;  4WIP A;  3J9C A;  5IP4 D;  3BWU D;  5CHV C;  1HTQ A;  3RI7 C;  2HDE A;  4G50 A;  4WWP A;  1WZ0 A;  2D3C A;  3GZN I;  4NJC A;  1SF0 A;  2KMM A;  3PS6 A;  2M56 B;  2FE8 A;  4HK2 A;  4LDT B;  1L0X B;  3M95 A;  2Z59 B;  2BB6 A;  3BII D;  2KC2 A;  4ZHO A;  2ON8 A;  1E8Z A;  3AEB B;  2JYT A;  2LUE A;  4IC7 B;  1DOX A;  3ZTD A;  3DPD A;  1YN4 A;  5EDS A;  3P42 A;  3NS8 A;  1FD6 A;  2Y5P A;  1WRD B;  2ZVO A;  3BVG A;  4LNO A;  5G5G A;  1C1Y B;  4S17 A;  4EKU A;  3WAO A;  3T3O A;  3AM9 A;  1KH0 A;  4W9J A;  1CQV A;  2OJW A;  2DNF A;  3NUH B;  2KDF B;  1KTK A;  1WGK A;  2EKI A;  1YQ3 B;  3IXS A;  1XQQ A;  5BMH A;  2TSS A;  4I6N B;  2M4N A;  3CMM B;  3VTW A;  3HRD D;  4M00 A;  2WXN A;  3QK0 A;  1E7U A;  1J8C A;  3TCA A;  4C4V A;  3A1Q B;  3Q8B A;  2V4L A;  2DAF A;  3RNB C;  4MH8 A;  3Q2A C;  4FA6 A;  4KIK A;  2MJE A;  2LJI A;  2WXF A;  3U2S C;  4ACF A;  1GB4 A;  1G6J A;  3H9D A;  3DQV A;  4FJY A;  1QF6 A;  3TEY A;  4HLE A;  4AUQ C;  3PV1 A;  4WJQ A;  1S1Q B;  1FXI A;  1C79 A;  4BAX A;  2R2Q A;  1QKZ A;  5EE9 A;  3DBL B;  3I63 C;  2M8S A;  4JPS A;  4MGZ E;  1SIJ A;  3QA8 A;  3DVG Y;  4RGO S;  3N1X C;  5C1Z A;  2MHJ A;  2PIA A;  2LZ6 A;  3R8B A;  2INP E;  3QAQ A;  2JPH A;  2KX0 A;  2DZK A;  2ZPN A;  1K51 A;  4LNF A;  3M63 B;  1OTR B;  1RWS A;  3VTU A;  3ZIM A;  2GBJ A;  1EU4 A;  1I4X A;  2NR2 A;  1SIF A;  3ZRF A;  3MC0 B;  4D2K A;  2VRR B;  1WM3 A;  2HTM E;  2KTR B;  5BYS A;  2ZNV B;  2JYE A;  1EO6 A;  3T8M A;  1NYR A;  4W9F A;  2IND C;  2ASQ A;  5LNK 1;  1WIA A;  2KWC A;  3LJ3 A;  3IT4 B;  3RUI B;  1OQY A;  3HM6 X;  1ROE A;  4DHZ E;  4ZRP A;  1LGR A;  2WHI A;  2K5P A;  4NJ6 A;  3U30 A;  2MBE A;  4NY0 A;  1DOI A;  2ZEQ A;  1J19 A;  1WGR A;  2FCN A;  1FEH A;  3MTN B;  3Q8A A;  4KZC A;  2AL3 A;  3A33 B;  1D4B A;  4BKS D;  1FXT B;  2LHE A;  3NS1 A;  2FCM A;  2FAZ A;  3JSV A;  3DBS A;  3EC8 A;  4N58 A;  1P0R A;  2KWD A;  4ASW C;  1F52 A;  4JL9 A;  1MHX A;  4W9C A;  4WJP A;  4MGY E;  1WF9 A;  2L00 B;  3EHV A;  3JYU A;  1L2N A;  4ZYN A;  4LNN A;  1TGZ B;  3MJ5 A;  1UH6 A;  2E6X A;  2PVO D;  3I5J C;  2Y5B B;  4ITK A;  5L83 A;  4GDK A;  3ZO5 B;  2W82 A;  3RYT A;  2WXL A;  3ONS A;  4MM3 B;  4HKQ A;  2QCZ A;  5MPO A;  1WR1 A;  4HDO A;  2UYZ B;  3ECI A;  1V80 A;  3HUI A;  1EM7 A;  2CHZ A;  3NVV A;  4BZA A;  2DYM A;  1PUT A;  1ZXI A;  1WR6 E;  3AEG B;  2XEW A;  2I1J A;  3DVG X;  4LCD E;  2WXO A;  4MDK E;  1JWU D;  2H89 B;  3BK1 A;  4YTN B;  1HEZ E;  4X57 B;  2CHX A;  5GMV A;  5DCN A;  4HPP A;  2LVO A;  3PO0 A;  4A8X C;  1UD7 A;  4J3O D;  4B95 A;  1WGD A;  4RGM A;  1OFF A;  4M8N A;  5LLI A;  2IGD A;  4M01 A;  4ICV A;  3AE4 B;  3E56 A;  5E6N A;  4I6P A;  2NCN A;  4PK1 A;  3ALB A;  2KLG A;  3ZJV A;  2KJ6 A;  3RPF C;  1YNT E;  4F1S A;  3Q8F A;  3AED B;  4NAM A;  1SB3 C;  4HJG E;  3RD2 A;  4DDI D;  4KSK C;  1MHH E;  1LM8 B;  2GOW A;  4FJV B;  5JH5 C;  3U7Z A;  2XK5 B;  2JWZ A;  4TMA B;  4P1C C;  4REZ A;  3AB5 A;  4A20 A;  1E6E B;  2V3P A;  3OG5 A;  4LNI A;  4Q2J A;  4K7U A;  3VQI A;  2WXH A;  4ARI A;  2MWS B;  3B0A A;  3PZD A;  4RF1 A;  3IAM 1;  4DDG D;  3B2F A;  5EE3 A;  3ML9 A;  2MJD A;  1FXA A;  5HFY A;  2FBW B;  2RDG A;  2ZNV C;  2CS4 A;  1WGG A;  4HVB A;  3A9K A;  3P4S B;  3PLU A;  3ZLZ A;  3ETR A;  1A5R A;  2MBB B;  3R7Q A;  3N1Y C;  4C7Z A;  4OZA A;  2IGH A;  3GB1 A;  2BQQ A;  3L4P A;  1QOB A;  1IYF A;  1RLF A;  2I38 A;  2NPT A;  1C76 A;  1KLU D;  1TJE A;  3C19 A;  5I4D A;  3Q8E A;  1MVK A;  3PRP B;  5J2R A;  2KQ7 A;  4OZB A;  1WX9 A;  4MSM B;  3L08 A;  4AOF A;  5G55 A;  2K0P A;  4MH0 E;  1V9J A;  2DX5 B;  5AEK B;  3U52 E;  1E8Y A;  3ABV B;  4ANU A;  1Y8R C;  1UBI A;  1RFA A;  4PYU A;  1WSP A;  3URY A;  2LFI A;  1ZE3 D;  4FBJ B;  1P3Q U;  2ACZ B;  2GBK A;  3AMZ A;  1NYQ A;  2N9K A;  2LGY A;  1KRH A;  2K8H A;  2KWV B;  4RM9 A;  2YEP B;  5FKA C;  3BZD B;  3KWL A;  1TS2 A;  2BW2 A;  5LXH A;  1L4D B;  2O6V B;  3EFU A;  1WJ4 A;  1D5Z C;  3D32 A;  3B2G A;  3QCA A;  5DPW A;  2M0A A;  4RF0 A;  3H7P A;  4II3 B;  4DXA B;  4BFR A;  3NVZ A;  5HKH A;  1E8W A;  1YMH E;  1F0Z A;  2ONQ A;  3DCG A;  4YWG G;  2LAS A;  3W1Y A;  3TBL D;  3ZJT A;  4XZ4 A;  1XT9 B;  2KFK B;  3T9L A;  1HZ6 A;  3AEA B;  3O65 B;  3N3K B;  1E5W A;  2G4S A;  2EKE C;  1YX5 B;  1JRU A;  3T3N A;  2RPV A;  4NJ7 A;  2D11 A;  3I3T B;  2KFJ A;  2L0F A;  3M62 B;  2FCS A;  1FFU A;  1B1Z A;  4EEW A;  2DZJ A;  1PFD A;  3KLS X;  4WJO A;  1UWX A;  2PMV A;  3PGE A;  2YEP F;  2K39 A;  2IY0 B;  2O2V A;  1FO4 A;  2L32 A;  2Z0E B;  3DVN V;  4P6V F;  2MRP A;  4W9G A;  3ZKJ C;  4MEL A;  3A9J B;  4AJY B;  3DBH I;  2LUM A;  4KGR A;  2QDF A;  4KSL C;  3Q69 A;  1XF5 L;  2JRH A;  4URK A;  2V3S A;  5JXV A;  2QIE B;  3GOE A;  5T8I A;  4B6W A;  3K9P B;  5DPT A;  3BYT B;  3ZRC A;  3N30 A;  2OHF A;  3WIM A;  2JY6 A;  2WQY B;  3SR6 A;  5JZE B;  3PHX B;  1HXY D;  2QMT A;  2A5U A;  1VR9 A;  2AQ2 B;  4ZRJ A;  2AQ1 B;  1Y56 A;  1PYW D;  4EFO A;  1R4M I;  2KD0 A;  1SE4 A;  1WXV A;  2QJL A;  1XCQ L;  3AE2 B;  1IPG A;  4ARC A;  1KOT A;  2B76 B;  4OVU A;  4MGK E;  4UDU C;  2KAJ A;  2LJ5 A;  5IOI A;  3MJW A;  2JZZ A;  3JW0 X;  1V5T A;  1U4A A;  1XO3 A;  2NMQ A;  4YL8 A;  3IVF A;  1XCT L;  3SU8 X;  1FCL A;  3FAH A;  3APD A;  4RMA A;  1JWS D;  3TEX A;  1V1P A;  3QAR A;  5GXG B;  3PZ8 A;  4P16 A;  2H88 B;  1F77 A;  1FRD A;  4JWS C;  1BUI C;  1IGD A;  4ZRI A;  2CU1 A;  2O6V D;  4TKN A;  3LB8 C;  1I35 A;  3SFE B;  4AQ7 A;  1T0Q C;  4GSW A;  3IHP C;  4EUT A;  1OQQ A;  3EFC A;  2DYB A;  1DYQ A;  2RMM A;  4RGN A;  3Q3O C;  1JWA D;  5E6P A;  3NVW A;  3NZ3 A;  2BVC A;  3N9Y C;  3BVM A;  5E6O A;  1FM0 D;  1E90 A;  4IG7 B;  1Q1O A;  4RNA A;  3CIR B;  1NEK B;  2MCN B;  1T0R C;  1ET6 A;  3AE9 B;  3ZDT A;  4DXG A;  1ZPS A;  3Q3J A;  1VD2 A;  3C0R B;  2BYT A;  2LXA A;  1PGX A;  1TTN A;  2MX2 A;  2YLM A;  1KF6 B;  4GDK B;  4A3P A;  2V0G A;  1FNV A;  4RGT A;  1FNW A;  1Q5W B;  4PS8 A;  5BO4 B;  3WAM A;  4HXD A;  1SJE D;  3N1Z C;  3L17 A;  3BY4 B;  3BVZ A;  1JQ4 A;  1Q0W B;  3BIN A;  4BBN F;  3AEF B;  2GB1 A;  1YIW A;  2BWE S;  1AYF A;  5AZG A;  1D5X C;  3HHM A;  1SEB D;  1VZ8 A;  2PVG C;  3ZQ4 A;  1TS3 A;  4YTP B;  3OLM D;  3M3J A;  2BYV E;  2L7R A;  2NTS A;  2MP2 B;  3N20 C;  1VJK A;  1R4N B;  3AU4 A;  2KX3 A;  2J0J A;  4OVZ A;  2JRI B;  3Q3F A;  4JQW C;  5D3D A;  4LK0 M;  2WXG A;  2SEB D;  4HRO A;  4JE3 B;  4AJW A;  1C9F A;  2FUG 1;  4LLG M;  3W5V B;  1MI0 A;  1QQR A;  1H4R A;  4J6I A;  1PGB A;  1XLO A;  1AW7 A;  3IG3 A;  3LYY A;  5C23 A;  1PQS A;  3MC8 A;  3DHI C;  3MFG A;  4HDQ A;  4KKJ A;  1KFY B;  4TV3 A;  2MJ3 A;  2JF5 A;  2L1A A;  1P98 A;  1EF5 A;  1ZXH A;  4MJS B;  2QSD A;  3ZXR A;  2IYD B;  2W9N A;  4DXF A;  4GIV A;  4BBN C;  1WXM A;  4L23 A;  1NDD A;  2NTT A;  4XC2 A;  3QX1 A;  3KYC D;  4XWW A;  4M0W B;  1KM7 A;  1ZP0 B;  3L54 A;  3V05 A;  2RGF A;  1YN5 A;  2GBN A;  1WI0 A;  2J42 A;  3L10 B;  1J0G A;  2JZP A;  2M19 A;  1SE2 A;  3FKY A;  1TKY A;  2KN5 A;  4FJZ A;  1SSN A;  3AEC B;  3OJ3 A;  4NQL B;  4LDT D;  3DHG C;  1GG3 A;  2JUO A;  1JML A;  4KX6 B;  2ZW1 A;  2YVC A;  2G9H D;  3QWZ B;  4GOC A;  3U7D A;  3RFZ B;  2XBB C;  2KXJ A;  1FCC C;  2J52 A;  2CKH B;  2WP9 B;  4IW0 A;  2WNM A;  4MGI E;  2M1M A;  3GZN B;  1RYJ A;  1Z2M A;  2AL6 A;  2KVR A;  3B08 A;  2K8C A;  1N6Z A;  2BS2 B;  4A9A A;  2N7D A;  3H8H A;  2N7E A;  1LXD A;  3V60 A;  1YOV B;  4ANV A;  1WY8 A;  2D3A A;  1VDV A;  2WU2 B;  4EOY A;  1V6E A;  3OAW A;  1B9R A;  1H8C A;  3RZW C;  2QHO A;  1N63 A;  3HM3 A;  2ZW0 A;  3U8Z A;  5E6J A;  2LGI A;  2W55 A;  4XYC A;  1SE3 A;  1XLP A;  3I9V 1;  2IO1 B;  1L7Y A;  4IOI E;  5AZH A;  3VTV A;  1OEY J;  1C78 A;  2KMC A;  4HJK A;  5J18 A;  2AQ3 B;  2CR5 A;  3WAL A;  4EZK A;  4GDL B;  3ZJU A;  4BKS A;  2RDH A;  1WH3 A;  5CTR C;  3PTF C;  3C8Y A;  1XXG A;  1BXT A;  1PGA A;  4G3X B;  4M02 A;  1JWB D;  2IZV B;  2PPH A;  1CK1 A;  2PLP A;  1YJJ A;  4C7Y A;  3Q3N C;  1IP9 A;  1V1O A;  3QHT A;  5BYQ A;  1SBB B;  2WDV B;  4C00 A;  3EGR A;  4WUR A;  1E9M A;  3NG0 A;  2AX5 A;  2Z8L A;  4TQ0 A;  3HK0 A;  1DGJ A;  4O1N A;  1TKG A;  1FPY A;  5JHB A;  1L4Z B;  4FXC A;  5CHF A;  4OZC A;  1QOF A;  3FIL B;  4TQ1 A;  2NBV B;  4WWO A;  2KNB A;  1WWT A;  1OQR A;  1J7A A;  4TUU A;  2RR9 A;  3A1Q A;  3H6N A;  4W9I A;  2W3S A;  4AWJ A;  2C9W B;  4E74 A;  2MLB A;  4BKG A;  1I4G A;  4IM0 A;  3MC9 A;  3CWI A;  3E9S A;  2VH1 A;  3SHQ A;  1QIL A;  3TEW A;  2FNJ B;  5G5H A;  2QC8 A;  4XGA B;  3NRZ A;  3KQ4 A;  5JHA A;  2WXP A;  1Q10 A;  1V97 A;  4B0M A;  4PYZ A;  4KDI C;  3VHT C;  2G45 B;  2WXQ A;  4KVG B;  2PJH A;  2BYF A;  1TY0 A;  3VFK A;  2R61 A;  2J0M A;  2M17 A;  2C7N B;  3S2A A;  1MPE A;  4B9K A;  2Z0D B;  1P1A A;  2DZI A;  4IDI A;  3UF8 A;  3MP9 A;  1WYG A;  2KVZ A;  1JRO A;  5KHO A;  4F7Z A;  1WJU A;  2N9X A;  3TMP B;  2FID A;  2KQ4 X;  3P1M A;  1IBX B;  2EMT A;  4NAW B;  2ZCB A;  1WXA A;  1BT0 A;  2SAK A;  4EE2 A;  4BOZ B;  2RDB C;  3V62 A;  2KTR A;  1HTO A;  2N0S B;  2N9L A;  1C77 A;  1STE A;  5FR3 A;  3NHE B;  2KWU B;  2ZJD A;  4RCO A;  2WLB A;  2WDR B;  2BYE A;  3B9J A;  2IO3 B;  2C7M B;  1XEE A;  2K6Q A;  3V61 A;  1MFW A;  4CO7 A;  2VZK B;  3LXF A;  2IGG A;  4IM3 A;  4KV2 A;  5D7G A;  3PRM B;  3IFW B;  2V1Y A;  4DQO C;  4HPL B;  4WH4 A;  1J7C A;  3AE1 B;  1GB1 A;  5TSS A;  1LFD A;  2KDI A;  3AV8 A;  4USA A;  5TR5 A;  1WMH A;  1GOZ A;  2HE7 A;  2IBI B;  4LJO B;  5IAA C;  3RNE C;  4PT5 A;  2CHW A;  3UQB A;  5G2N A;  2KJH B;  1XLN A;  3EUB 2;  1EWY C;  3AU5 A;  1YN3 A;  2KT7 A;  3A4S C;  4ZDV A;  3GE3 C;  2BPS A;  2MQJ A;  4MM3 A;  5BMI A;  1AAR A;  4ICU A;  3KUZ A;  1C4A A;  1K50 A;  4IM2 A;  4QAY A;  2KTF A;  1UWM A;  4ANX A;  2PW9 A;  1WX7 A;  3KWV A;  4HKZ E;  4XWT A;  4ZYS A;  2WS3 B;  2KK8 A;  5CHW A;  4G0N B;  4DHZ B;  4P7I A;  3APC A;  1JRP A;  2L05 A;  3TUO A;  1DOY A;  4LJP B;  3VH4 B;  2IJ0 A;  4C4V B;  1R7S A;  2LWP A;  3Q8C A;  3HIZ A;  4KIK B;  1JWM D;  1WYW B;  4WQO B;  1E7V A;  4KZ0 A;  2J0K A;  3AN1 A;  4CQN A;  2IDY A;  2LGX A;  4G11 A;  4XE0 A;  1GAQ B;  1WGH A;  4N59 A;  3DWM A;  2AEH A;  3TEZ A;  3IAS 1;  3HVZ A;  1T5X D;  2XK5 A;  3IBE A;  1I4R A;  2X8X X;  2C60 A;  3TJP A;  4LNK A;  1CZP A;  4ZOH C;  3AE8 B;  1V86 A;  3P4P B;  1WM2 A;  2EMS A;  5H92 C;  1TZ1 A;  1QT9 A;  2ZPY A;  1P9D U;  3V6C B;  4K81 A;  1TIF A;  3H1U A;  1P7F A;  2MA9 B;  4KGT A;  2DWQ A;  2UWQ A;  3RUL A;  2WXI A;  2FUH B;  2KHW B;  2CU3 A;  3ZVV A;  2WXK A;  1SE9 A;  3RCZ A;  3PPA A;  3GE8 C;  1NI3 A;  2VZK D;  2OJR A;  4A55 A;  2V3N A;  3VUX A;  2DHZ A;  3KYD D;  3O13 A;  3V3X A;  5EE0 A;  3UQA A;  2LMC A;  3UI3 A;  4L2Y A;  2GLS A;  1A70 A;  5AUK A;  2N9P C;  1K53 A;  3ZNH B;  1L0Y B;  4AP4 C;  1GC6 A;  1AWD A;  3NVY A;  2WXJ A;  5D94 A;  1E0Z A;  1F2R I;  2PE6 B;  5IKC M;  1VLB A;  3JSV B;  2HJ1 A;  1OGW A;  2ZCC A;  1EWC A;  1WJ6 A;  3ZDM C;  1PDX A;  2LRU A;  1HZ5 A;  2AWT A;  4YTM B;  4MEM A;  3UIN B;  4MAC A;  2BTE A;  1MJD A;  1WRI A;  1TT5 B;  3W1S A;  3GS2 A;  1JCK B;  1WFY A;  4FLH A;  1ACC A;  3AUL A;  1TS4 A;  2K1F A;  2RSU A;  4WJN A;  3RNF C;  5KHQ A;  1YX6 B;  1WGY A;  1NEN B;  2W3R A;  3VRA B;  2JVC A;  1TKE A;  3RMK C;  1GUA B;  1JAL A;  3FC4 A;  2O6V A;  4IWO A;  4N6E B;  1V5O A;  2GBR A;  4DBG A;  1E7P B;  4W9D A;  3BYY B;  1T3Q A;  4GN1 A;  1J7B A;  2MBO A;  4FN2 A;  5FR6 A;  4ZRQ A;  2ICI A;  2CJO A;  1N5W A;  3WA0 A;  1ISN A;  3PT2 B;  2KFK A;  3ZNG C;  3ZGZ A;  4US8 A;  2D3G A;  2NS5 A;  3PLV A;  4CHK A;  1L6V A;  2LVP A;  4HCP B;  3AE3 B;  4K7W A;  3VRB B;  3DBH B;  3KH0 A;  1RRB A;  4W9K A;  4JGH B;  5BYR A;  4II2 B;  1T0S C;  4IKG A;  2KKC A;  1WZ3 A;  3AE6 B;  4HRS A;  3AXC A;  5J17 A;  1AN8 A;  4IWP A;  4FUL A;  2LGD A;  3I57 A;  4KDL B;  3P4Q B;  1I4Q A;  2WDQ B;  3A9J A;  1R4M B;  1RFK A;  2GBM A;  5C3J B;  2WXR A;  2NBW B;  4K1R B;  3A4R A;  2MSE D;  2BWF A;  2LHD A;  1KJT A;  5HG2 A;  4L1B A;  2BKF A;  3QIJ A;  1WXQ A;  3A9K B;  4MSQ B;  3NOB A;  3PRE A;  3PSE B;  2LVQ A;  4NPN A;  3L16 A;  1T6B X;  3SFD B;  3MHZ A;  4OW0 A;  4H2A A;  1I42 A;  4W9H A;  1UUP A;  2PKO A;  3CF6 E;  2NPT B;  2XN9 C;  4HPM B;  3QC8 B;  3VUW A;  2BGF A;  1BML C;  1C3T A;  2R2O A;  3X0W A;  1IUE A;  2N9E B;  3W2D A;  3DVN U;  1RAX A;  1NVI D;  2MW5 A;  5C2T B;  3NZS A;  1EUV B;  4YSY B;  4WWM A;  2CJN A;  2BBC A;  1GNU A;  2LRW A;  3OJ4 B;  1E10 A;  2WU5 B;  3APF A;  3UGB B;  1LO5 D;  3BK2 A;  4BKT A;  4A90 A;  2LXC A;  1FNU A;  2BB5 A;  3DDC B;  2LGS A;  4WAA A;  2MBH A;  5AUI A;  3NZU A; 
#chains in the Genus database with same CATH homology
 4A6Q A;  3SEB A;  3IT6 B;  2WXM A;  1XF5 L;  2WXQ A;  1FD6 A;  2Y5P A;  5JXV A;  1TY0 A;  2QIE B;  5T8I A;  2R61 A;  3BVG A;  3BYT B;  5G5G A;  2G1E A;  1MPE A;  4IDI A;  2K22 A;  1YQ4 B;  2OHF A;  1WYG A;  3MP9 A;  3AH7 A;  1JRO A;  3T3O A;  2WQY B;  1QOA A;  3AM9 A;  1KH0 A;  2W54 A;  3SR6 A;  3AE5 B;  4AS1 A;  1HXY D;  1CQV A;  2KQ4 X;  2QMT A;  1VR9 A;  3P1M A;  2AQ2 B;  2AQ1 B;  2K9X A;  1Y56 A;  1PYW D;  1IBX B;  3NUH B;  4NAW B;  1KTK A;  1WGK A;  4OHJ A;  1SE4 A;  2SAK A;  2QJL A;  2EKI A;  1JW9 D;  1YQ3 B;  1VRA B;  3IXS A;  1XCQ L;  4EE2 A;  3AE2 B;  5BMH A;  2TSS A;  4ARC A;  2N0S B;  1P7E A;  2JXT A;  2N9L A;  2V4I B;  1C77 A;  3R2I A;  3HRD D;  1STE A;  2WXN A;  5FR3 A;  2B76 B;  4RCO A;  2BS3 B;  1UGJ A;  4UDU C;  1C4P A;  2KAJ A;  2WLB A;  2WDR B;  3DWG C;  3Q8B A;  5EE1 A;  3B9J A;  2JWU A;  1XEE A;  1XO3 A;  2NMQ A;  1XCT L;  2VZK B;  2IGG A;  3LXF A;  4MH8 A;  5D7G A;  2MJE A;  1FCL A;  2LJI A;  2WXF A;  3FAH A;  3U2S C;  4DQO C;  2JU6 X;  4WH4 A;  1J7C A;  3AE1 B;  1L5P A;  1GB4 A;  1GB1 A;  5TSS A;  2DYO A;  1JWS D;  1QF6 A;  3TEY A;  4USA A;  3AV8 A;  2DBY A;  3VR8 B;  3TEX A;  1GOZ A;  1V1P A;  1VZ6 A;  3VR9 B;  5GXG B;  1FXI A;  1C79 A;  3P63 A;  3PZ8 A;  4MT5 A;  1QKZ A;  4P16 A;  5EE9 A;  2H88 B;  1F77 A;  1FRD A;  4JWS C;  3U4E G;  1BUI C;  1IGD A;  2XNA C;  4PT5 A;  4JPS A;  1SIJ A;  3GP7 A;  4RGO S;  1D6E C;  4RFB A;  3LB8 C;  4HEA 1;  3SFE B;  4AQ7 A;  2PIA A;  1OQQ A;  3R8B A;  1XLN A;  2BS4 B;  4JX1 C;  2INP E;  1DYQ A;  1XLQ A;  2RMM A;  3EUB 2;  4RGN A;  1EWY C;  1JWA D;  1YN3 A;  3HVD A;  3NVW A;  3NZ3 A;  3W5U B;  1K51 A;  2N7J A;  4LTU A;  5BMI A;  1RWS A;  3N9Y C;  3BVM A;  1FM0 D;  4WAF A;  1C4A A;  1FMA D;  1K50 A;  1EU4 A;  4RNA A;  1I4X A;  4RH6 A;  3CIR B;  1UWM A;  1NEK B;  2PW9 A;  3KWV A;  4HKZ E;  4XWT A;  1ET6 A;  2PTL A;  4NZL B;  4ZYS A;  2WS3 B;  3AE9 B;  3MC0 B;  1QOG A;  4D2K A;  4DXG A;  1ZPS A;  2QEJ C;  3PZ7 A;  2HTM E;  1JRP A;  2BYT A;  3TUO A;  5BYS A;  1IGC A;  1DOY A;  2J4X A;  2JYE A;  1NYR A;  1PGX A;  1KF6 B;  4GDK B;  4R3D A;  3AE7 B;  2INN E;  1FNV A;  2V0G A;  5LNK 1;  1TZO A;  2IJ0 A;  3IT4 B;  1R7S A;  4RGT A;  1ROE A;  4ZRP A;  3Q8C A;  1FNW A;  2K5P A;  1F2R C;  1DOI A;  1JWM D;  1SJE D;  1FEH A;  1N5X A;  3AN1 A;  3Q8A A;  4CQN A;  3BVZ A;  1V8C A;  1JQ4 A;  2IDY A;  1D4B A;  4XE0 A;  1GAQ B;  2LHE A;  4XDC A;  3OWE B;  3NS1 A;  3AEF B;  1V1P B;  2GB1 A;  4N59 A;  5HHD G;  3DWM A;  2KAC A;  4TSS A;  1FFV A;  4N58 A;  3TEZ A;  2Y3A A;  2KWD A;  3IAS 1;  1AYF A;  2JSV X;  1D5X C;  4M0W A;  1C4C A;  1MHX A;  4ZHP A;  3HVZ A;  2OED A;  1SXT A;  1T5X D;  1SEB D;  1VZ8 A;  2PVG C;  5H8Y E;  1I4R A;  5FK9 C;  3ZQ4 A;  4YT0 B;  1TS3 A;  4YTP B;  5HI1 A;  1CZP A;  4ZOH C;  3MJ5 A;  3AE8 B;  1ZUD 2;  2E6X A;  3P4P B;  2PVO D;  4ITK A;  1ZOY B;  2NTS A;  2W82 A;  5H92 C;  2WXL A;  1ZDV A;  1QT9 A;  2MEK A;  4MM3 B;  2JX5 A;  4HKQ A;  5MPO A;  1VJK A;  4OVZ A;  1P7F A;  1SJH D;  3AEE B;  3HUI A;  5D3D A;  4LK0 M;  1EM7 A;  3NVV A;  4KGT A;  2L83 A;  2WXG A;  2DWQ A;  1PUT A;  1ZXI A;  2DYM A;  1I4P A;  2SEB D;  4HRO A;  4JE3 B;  2WXI A;  3AEG B;  2WXO A;  2CU3 A;  1JWU D;  2H89 B;  2WXK A;  3BK1 A;  4YTN B;  1C9F A;  1HEZ E;  2DLB A;  2FUG 1;  4LLG M;  3W5V B;  3PO0 A;  1MI0 A;  1QQR A;  1NI3 A;  4A8X C;  2VZK D;  1PGB A;  4A55 A;  1XLO A;  1L0V B;  4J3O D;  2V3N A;  3O13 A;  4RGM A;  3V3X A;  1FIQ A;  1AW7 A;  1OFF A;  1UNS A;  3LYY A;  5EE0 A;  2LMC A;  3MFG A;  3UI3 A;  1EU3 A;  2IGD A;  4KKJ A;  2Y5C A;  1KFY B;  4L2Y A;  1A70 A;  5AUK A;  3AE4 B;  2MJ3 A;  1K53 A;  2JQR B;  1L0Y B;  2L1A A;  3R2T A;  3E56 A;  1ZXH A;  1AWD A;  3NVY A;  2WXJ A;  1ET9 A;  2QSD A;  3ZJV A;  1E0Z A;  3RPF C;  3EA6 A;  1F2R I;  1YNT E;  3Q8F A;  3AED B;  1VLB A;  1SB3 C;  4NAM A;  4DXF A;  4HJG E;  3TSS A;  4L23 A;  1MHH E;  1EWC A;  2NTT A;  1ESF A;  4XWW A;  1PDX A;  1HZ5 A;  4YXD B;  1ZP0 B;  4YTM B;  3U7Z A;  4TMA B;  3V05 A;  4MAC A;  2BTE A;  1YN5 A;  1WRI A;  2D5G A;  4REZ A;  3AB5 A;  1E6E B;  2J42 A;  2V3P A;  3W1S A;  2JZP A;  2M19 A;  1JCK B;  1SE2 A;  3GS2 A;  1ACC A;  4Q2J A;  1TKY A;  4XDD A;  3VQI A;  1TS4 A;  2WXH A;  4ARI A;  4GLS C;  1SSN A;  4KKI A;  4RF1 A;  3IAM 1;  1NEN B;  2L52 A;  3AEC B;  2W3R A;  3VRA B;  2QIL A;  3B2F A;  5EE3 A;  1TKE A;  2MJD A;  2MH7 A;  1FXA A;  1JML A;  1M4V A;  4JWU C;  4KX6 B;  2ZW1 A;  1JAL A;  2G9H D;  2K3U A;  3FC4 A;  5HFY A;  2FBW B;  4N6E B;  2RDG A;  3RFZ B;  2BT6 A;  3P4S B;  1FCC C;  1E7P B;  1RM6 C;  2J52 A;  3ETR A;  3BYY B;  1T3Q A;  2WP9 B;  1J7B A;  2WNM A;  4US9 A;  3ZYY X;  4C7Z A;  1FRR A;  3WCQ A;  1K52 A;  4ZRQ A;  4OZA A;  2IGH A;  2ICI A;  1QLB B;  3GB1 A;  2CJO A;  1RYJ A;  1N5W A;  3L4P A;  1QOB A;  1N62 A;  1ZDX A;  4B0E A;  2GI9 A;  2E3T A;  2I38 A;  1C76 A;  1KLU D;  2BS2 B;  1N61 A;  4A9A A;  1TJE A;  3H8H A;  5I4D A;  2LEK A;  3Q8E A;  3FIL A;  3ZGZ A;  4US8 A;  1MVK A;  1L6V A;  1VDV A;  2WU2 B;  3AE3 B;  4OZB A;  3VRB B;  2KN4 A;  1B9R A;  2K0P A;  1D5M C;  1TS5 A;  5BYR A;  4YSX B;  4IKG A;  1I7H A;  1GPX A;  1N63 A;  2ZW0 A;  3U52 E;  3W9C B;  5E6J A;  3ABV B;  1N60 A;  2LGI A;  2W55 A;  3AE6 B;  1CJE A;  1SE3 A;  1XLP A;  1YJI A;  1HQR D;  3I9V 1;  1WSP A;  4HRS A;  4IOI E;  3URY A;  2LFI A;  5BMG A;  1TY2 A;  2KDM A;  1ZE3 D;  1C78 A;  1AN8 A;  4WQM A;  4YSZ B;  3I57 A;  2AQ3 B;  4KGS A;  3P4Q B;  2Q5W D;  1I4Q A;  2ACZ B;  3AMZ A;  2WDQ B;  1NYQ A;  2N9K A;  4GDL B;  3ZJU A;  1KRH A;  2RDH A;  1RFK A;  5C3J B;  2WXR A;  1KLG D;  3C8Y A;  2YEP B;  1XXG A;  5FKA C;  2LHD A;  3BZD B;  1BXT A;  1PGA A;  3KWL A;  1ENF A;  1TS2 A;  2BW2 A;  1L4D B;  5HG2 A;  4L1B A;  1JWB D;  1L6U A;  1D5Z C;  1WXQ A;  3B2G A;  1CK1 A;  2PLP A;  1YJJ A;  4C7Y A;  2X38 A;  2J53 A;  2M0A A;  4RF0 A;  1T6B X;  1V1O A;  3SFD B;  3MHZ A;  4OW0 A;  2IPK D;  4H2A A;  5BYQ A;  1SBB B;  2WDV B;  1TYG B;  1UUP A;  3EGR A;  3NVZ A;  1E9M A;  4WUR A;  1I4H A;  1IBX A;  2AX5 A;  2Z8L A;  4TQ0 A;  1DGJ A;  2PKO A;  4O1N A;  1YMH E;  1TKG A;  1F0Z A;  1VZ7 A;  2ONQ A;  2EEL A;  2XN9 C;  4YWG G;  1L4Z B;  4FXC A;  3ZJT A;  3P4R B;  4OZC A;  1BML C;  1HA5 A;  1QOF A;  2GRI A;  1HZ6 A;  3AEA B;  3FIL B;  4TQ1 A;  4C56 C;  5D3I B;  1IUE A;  2I2Y A;  4C80 A;  4WIP A;  3W2D A;  3J9C A;  1NVI D;  1WWT A;  5C2T B;  1OQR A;  1J7A A;  3BWU D;  3T3N A;  2RPV A;  4YSY B;  4WWM A;  2HDE A;  2CJN A;  2BBC A;  2W3S A;  4NJC A;  1FFU A;  1B1Z A;  1SF0 A;  2KMM A;  1I4G A;  3CWI A;  2M56 B;  2FE8 A;  3E9S A;  1PFD A;  3KLS X;  1QIL A;  1L0X B;  3TEW A;  1E10 A;  1UWX A;  2PMV A;  5G5H A;  2YEP F;  2WU5 B;  2BB6 A;  3BII D;  1FO4 A;  2L32 A;  4ZHO A;  1LO5 D;  4P6V F;  3BK2 A;  3NRZ A;  4A90 A;  2ON8 A;  3KQ4 A;  1FNU A;  3AEB B;  2BB5 A;  2JYT A;  1DOX A;  2WXP A;  1Q10 A;  1V97 A;  1YN4 A;  2LUM A;  5AUI A;  4KGR A;  4B0M A;  3Q69 A;  3P42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...