1PGAA

Two crystal structures of the b1 immunoglobulin-binding domain of streptococcal protein g and comparison with nmr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two crystal structures of the B1 immunoglobulin-binding domain of streptococcal protein G and comparison with NMR.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
molecule tags Immunoglobulin binding protein
molecule keywords PROTEIN G
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1993-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgaA00
2LUMA 2J53A 2JWUA 3V3XA 1MHHE 2RMMA 2N7JA 1MI0A 2QSDA 2LHDA 2ZW1A 1P7FA 5HG2A 1MVKA 1PGXA 4HJGE 4OZAA 2J52A 2JXTA 1IGDA 1PGBA 2LHEA 2QMTA 1EM7A 1YNTE 2IGHA 2KWDA 2GI9A 4OZBA 5HI1A 5HFYA 2JSVX 4KGSA 4GLSC 3GB1A 5JXVA 1P7EA 1F2RI 1K53A 1UWXA 2K0PA 1F2RC 2N9KA 4IOIE 1GB4A 3FILA 1IBXB 1XCQL 2KQ4X 2N9LA 3FILB 1IBXA 4OZCA 4WH4A 4KGTA 1FCCC 1D4BA 2I2YA 2KN4A 1YMHE 2KACA 1ZXHA 1K50A 1C9FA 1HZ5A 4D2KA 5BMIA 1FD6A 1K51A 2EELA 4MACA 4HKZE 5BMHA 4KGRA 1Q10A 2IGGA 1KH0A 2LGIA 5HHDG 1PGAA 1HZ6A 2I38A 2IGDA 2JU6X 2ZW0A 1MPEA 2RPVA 2ONQA 1IGCA 1GB1A 1HEZE 1K52A 3MP9A 5BMGA 2PW9A 1XF5L 4IKGA 1JMLA 1XCTL 2GB1A 2JZPA 1MHXA 2ON8A 2PLPA 2NMQA 2KDMA 3UI3A 2OEDA 2PTLA 1FCLA 1QKZA
chains in the Genus database with same CATH superfamily
3OAWA 4WJPA 3A4SC 5H8YE 2JY6A 2ZVNA 4LJPB 2WXRA 1T0QC 4J6IA 4XZ4A 1VZ7A 2HJ1A 3KUCB 3LXFA 3V6CB 2KD0A 4ANVA 1R7SA 1WXMA 2D10A 3KUDB 2GBJA 3TBLD 2IO2B 4NJ7A 3TSSA 5TR5A 4PS8A 1DYQA 2M56B 2LFIA 2NS5A 1UWXA 2CJNA 3DBHB 2V3SA 1AWDA 3O13A 1UBIA 2LEKA 1WJ6A 2L32A 4O1NA 5D2MB 4HPLB 1VZ6A 1C79A 1PUTA 1RRBA 1ZDVA 1WYWB 3U7ZA 2CHZA 2IDYA 2HJ8A 2WWZA 3ML9A 1ZPSA 4K1RB 1WR6E 1K51A 2HE7A 1C1YB 3RNCC 2ZZPB 3AU4A 2FCQA 4RMAA 3MC8A 1ZDXA 1WE6A 4MSMB 2WDVB 1FO4A 2KJHB 3AU5A 3I9V1 2BKFA 2LXAA 3P4QB 1WRIA 3UQAA 4GU2A 3M95A 5E6OA 5G5HA 2R2OA 4F8CB 2CR5A 4M01A 2CU3A 1ZKHA 3ZRFA 3C0RB 3X23A 5LXHA 1EU4A 1V6EA 3Q2AC 1I4GA 2FUG1 5H92C 1OQRA 2Z8LA 2NMQA 1SGHA 2KDMA 4ZYNA 5L83A 1KLVA 4S17A 1OFFA 1NI3A 4C4VA 4HVBA 2WU5B 4FN2A 3TIXA 1U4AA 2W55A 1BMLC 2NTSA 3QK0A 3PV1A 3QAQA 5CTRC 4MGKE 4OVVA 1JALA 2INCC 2UYZB 4W9JA 2GOWA 1SIJA 5D6JB 2L00B 4RF1A 5EE0A 3R7RA 1I4QA 2K6QA 3W1SA 1F2RI 3B0AA 3A9KB 2JZ3B 1I4XA 1UF0A 3R7QA 3RNGC 1GNUA 1RAXA 4AWJA 3PRZA 1RYJA 1UGJA 3B08A 3ZIMA 2KACA 2DZJA 4MM3A 3RNBC 3AE4B 1UWMA 4A3OA 1YQ4B 1WGKA 5IKCM 3Q3JA 3ABVB 4GDKB 4YSYB 4PT5A 3Q3OC 1OTRB 3NZ3A 2QJLA 2DZMA 1P0RA 3OG5A 4ARIA 2L83A 3RD2A 2I38A 1XEEA 1KOTA 4GDLA 2NTTA 4ZDVA 2YEPB 3GE8C 2BWES 2XEWA 3KUZA 3AH7A 3AE6B 1T5XD 1OEYA 4BFRA 1X1MA 1UZXB 1E8XA 1SJHD 1HTOA 2RGFA 2LGYA 3D32A 1WJNA 3H9DA 3U4EG 2OJWA 3N1YC 3RN9C 5FKAC 1F52A 1FMAD 3RNFC 2KVZA 3PLVA 2KDEB 3TEZA 2LASA 3I57A 4FBJB 1YX6B 2JWUA 3BVGA 2L1AA 2RMMA 3NS8A 3DHIC 4TQ0A 3Q8CA 3AB5A 1Q5WB 5DPSA 2M4NA 3VH4B 1TT5B 5AUKA 3RNAC 2O6VA 2ZCBA 1TJEA 1PGXA 4HJGE 1TS5A 4MELA 1V9JA 3C19A 4RFBA 4PS7A 1D5XC 2J7QB 4EFOA 4YXDB 5DCNA 1FRRA 4ZRJA 1ZGUB 1A5RA 4BVUC 4RGOS 2N9LA 1UD7A 2IY1B 1HXYD 4RGNA 4W9LA 4DK5A 2BQQA 1AYFA 3APDA 1RM6C 1R4NB 5MPOA 1C4AA 3PHXB 3IXSA 2NVUI 2FBWB 2V4IB 5G2NA 3WAPA 4N9F4 2LGIA 3UGBB 2WXOA 3R3MA 2RR9A 1WJ4A 4N59A 1N61A 2BW2A 2WXFA 3AEAB 1L6UA 3I5JC 2LVQA 1GB1A 4HDQA 1HEZE 4WWMA 3DBSA 3CSTA 1QLBB 2MW5A 2PMVA 3JSVA 3MJ5A 1FFUA 1MHXA 2L8JA 3AE1B 4LNIA 4XDCA 1UBQA 4IDIA 3VR8B 2MHJA 3QJZA 4B6WA 4JLCA 3DBLB 1M94A 3CMMB 4GDKA 1R4MI 1WYGA 3CIRB 4K7SA 3T3NA 1GC6A 4II2B 1ROEA 1BT0A 2JQRB 4EZLA 3Q3NC 1LQBA 2PIAA 1E90A 4MM3B 3DHGC 5GXGB 1TBEA 2KJ6A 4GXBA 1N60A 2VH2A 2W54A 2J52A 1F1HA 4IG7B 1KLGD 4P16A 3RMKC 3VVWB 4CHKA 4CQNA 3U7DA 2WDRB 1ZW7A 4NJCA 3ZTCA 3A4RA 1WGGA 4WWPA 3DPDA 2G9HD 5TSSA 3NJTA 4ASWC 3PLUA 3PHWB 3NVZA 2K0PA 3B2FA 4NQKE 1V5OA 2JT4B 4NAMA 2PJHA 1YJ1A 4G3XB 2D2QA 4RF0A 2K1FA 1HA5A 3OWEB 2PKOA 2PVGC 1J8CA 4MSQB 3DVGX 4XWTA 2L05A 1D5ZC 2M0AA 1SBBB 5D3DA 4YSZB 1JROA 4W9FA 2GRIA 1WX7A 3DDCB 2BWFA 1KF6B 3ZQ4A 1IP9A 4OW0A 4LNKA 2AL6A 4JPSA 1TGZB 1PGAA 3ZJTA 3ZJVA 3HHMA 4A8XC 2LRUA 1TS4A 2IGDA 2JU6X 4E3CA 4DXGA 4KIKB 3ENEA 1N62A 1IGCA 3SR6A 4URKA 2RDGA 3TEYA 2KVRA 3PZ8A 2JZZA 3DOWA 2IYDB 3BINA 4IKGA 2RDBC 2HDEA 3QIJA 1WSPA 3T8MA 4JX1C 1V8CA 3SD5A 4ZRKA 3M3JA 4KSLC 2PLPA 3AULA 1SE2A 1FCLA 1BUIC 2H88B 1N6ZA 3P4RB 1S1QB 1ZUD2 4RNAA 2KDIA 2N7JA 3KH0A 1QOBA 4C00A 1NBFC 5IA7A 4MH8A 3VDZA 2R2QA 3OJ3A 2IPKD 3EECA 3APCA 3L08A 4IWPA 4KDLB 2K8BA 3VRBB 2C7NB 1K53A 2MP2A 4IM3A 2AQ3B 3ZNZB 1IBXB 2MBBB 3FILB 1J7AA 3AEDB 4FJVB 4X57B 3AE7B 2M19A 5C23A 5KHOA 3B2GA 3PRMB 1BXTA 1FXIA 1LFDA 2MRPA 2KDBA 4KKJA 2ZPNA 1YJJA 2KXJA 2NBVB 3V62A 4CYEA 2G4DB 1DOIA 1V1PA 4F7ZA 3VTUA 1HZ6A 2KANA 3DWGC 1GC7A 4WAFA 4BKSA 3Q8AA 2CJOA 1WY8A 1Q1OA 1MPEA 2A4ZA 4JWSC 2FE8A 5AZGA 4M02A 3NUHB 1TY2A 4RM8A 4MDKE 3BVMA 2C5LC 3IAS1 4KVGB 2ON8A 2N1VA 1CK1A 2M8SA 4M8MA 3WALA 3V60A 4B0EA 1T3QA 2OEDA 2PEAA 2WLBA 3EA6A 1N5XA 2WDTB 3N1ZC 2PE9A 4DDID 5AZFA 3UQBA 4L23A 1N63A 2XK5A 4FLHA 2LUMA 2J53A 2L0TA 3PZDA 1JRPA 1Y56A 3BWUD 2E6XA 2FCMA 1MI0A 4HPPA 2KWCA 4EZKA 3RYTA 3ETRA 3IVFA 3APFA 1NI2A 2ACZB 3ZXVA 3PRPB 1QILA 4A3PA 2QMTA 1VR9A 5I4DA 4L1BA 1F0ZA 3ZUNA 1GG3A 4II3B 1Z5SB 3A9JB 4WIPA 3DHHC 4HROA 1NENB 2WHIA 4HWIB 4KKIA 1WZ3A 2VRRB 4LNFA 1E7VA 3UF8A 4E71A 2SEBD 3QCAA 2O6VD 5G5GA 3LJ3A 1JWBD 2BT6A 4YWGG 1FD6A 1PQSA 4KZCA 3IG3A 3B9JA 1E6EB 2LMCA 4LDTB 1EU3A 3K9OB 4FJZA 2MX2A 4MGZE 4ZRIA 3MHZA 1L4ZB 3O65B 2DYBA 2DZKA 2OJRA 3LYYA 2BB6A 1FNWA 4US8A 4XE0A 4K81A 2GBKA 3TCAA 4XC2A 3L13A 1B9RA 1P9DU 2IO0B 2K5PA 4NQLB 2AL3A 1WM2A 3A1QB 2JZPA 2FIFA 2VZKB 1SSNA 3GZNI 3NZUA 3ZKJC 4XGAB 4YTPB 2MBQA 5J2RA 3VAWA 3IAM1 4P7IA 2PPHA 5JH5C 2BS2B 1WF9A 2GMIC 3VHTC 2XK5B 1I4PA 1CZPA 4M0WA 2XNAC 1GJZA 5DPRA 2J42A 4XDDA 2MCNB 2WU2B 2MEKA 4W9GA 1D6EC 1E8ZA 3AEFB 3MFGA 2LUEA 2N7DA 2BTEA 2MQJA 3TEWA 1ENFA 4KGSA 2CU1A 3EFCA 3GB1A 3KYDD 1WH3A 1WGDA 2KOXA 1F2RC 1I4HA 1LO5D 1UGMA 3QC8B 2KQ4X 1WGRA 4OZCA 1N5WA 1JCKB 3CSFA 3AEGB 2N1WA 5C3JB 2KN4A 4G11A 1K50A 1VCBA 3N3KB 1E8YA 3A9JA 5CHWA 2YEPF 5BMHA 2RSUA 4BKGA 2Z0EB 3IT4B 4KGRA 1FXAA 3AE3B 1PYWD 5D94A 1H4RA 4QAYA 3ZTDA 5AEKB 4LJOB 2KN5A 3BIID 2LZ6A 1FXTB 1VRAB 2ZW0A 3N9YC 3VXWA 4YTNB 2BYFA 4W9IA 1WR1A 2CHWA 5D3IB 5IP4D 1WX8A 4FA6A 3L0WB 4FULA 2BKRB 2NR2A 2R61A 1JMLA 1YJIA 4LDTD 4XYCA 5JHBA 2ZCCA 5AZHA 2GBRA 2V9HA 4KX6B 3NVYA 3IT6B 1OQQA 2B3AA 2K25A 2LGSA 3DBRI 2DENB 2INNE 4K3BA 1FNUA 1HE8A 1QKZA 1MJDA 2WXGA 5C2TB 1WXQA 1V81A 3FKYA 3VFKA 1TS3A 3ZLZA 3AE8B 1QF6A 1YN3A 2KTFA 2ZNVC 4DHJB 2RDHA 3U8ZA 3NG0A 2Y5PA 4PK1A 3SEBA 1DOYA 4GOCA 3VQIA 2AYOB 1YNTE 1Y8RC 2I1KA 3AEEB 2KWDA 3PPAA 3V6EB 4WJNA 3QARA 3OLMD 1QOAA 2J4XA 2QIEB 2M1MA 4MGIE 4RM9A 4HDOA 3C8YA 3OJ4B 1EO6A 2KK8A 3MC9A 1E8WA 3JYUA 2LWPA 2DAJA 3KVFB 1RWSA 4ZRPA 3ZO5B 3AE9B 1OGWA 1ZXHA 3TL5A 1IPGA 4IC7B 2JYTA 1PFDA 3QX1A 4MJSA 1Q10A 2WXLA 5BYQA 2INPE 4N6EB 5EE3A 4WQOB 3NHEB 2I1JA 1ET6A 3DVNU 1STEA 3ZJUA 1L7YA 1VLBA 1ZOYB 4OHJA 3NY5A 2ONQA 4REZA 3MP9A 1K52A 2CS4A 2WXHA 3H6NA 2KC2A 1XF5L 1B1ZA 2AQ2B 3ZYYX 3WIMA 4DWFA 2C7HA 3NS1A 2G4SA 2W82A 3JW0X 4KDIC 2DLBA 4IUMB 2DYMA 5EDSA 2BF8B 3H7PB 2WGSA 1KJTA 4ANWA 3VTWA 3NZSA 4LK0M 2DNFA 4AP4C 4W9HA 1CJEA 1JW9D 2ZEQA 1WXAA 4OZAA 4LNOA 1RFKA 1V2YA 1WE7A 1TKYA 1WI0A 2D3CA 2LI5A 2V3NA 2A5UA 4GLSC 2EMSA 2L0FA 4EUTA 5JXVA 1P7EA 4TKNA 3W1YA 2AWTA 2XBBC 3GP7A 4YSXB 2WXPA 3AE2B 2ZJDA 1FFVA 3W5UB 3RFZB 1YIWA 1OEYJ 2VH1A 3X0WA 3N32A 1XLQA 3R66C 4DXAB 2IO1B 3PS6A 3R2IA 3V05A 2V3PA 3H8HA 4HKZE 4TV3A 3KWLA 2LXCA 3EFUA 1SB3C 5BYSA 2IGGA 4NAWB 2HD5B 3QWZB 4FHJA 4A6QA 4IWOA 1I7HA 1NYRA 3DQVA 1F9JA 3H7PA 4US9A 2MBEA 4C7ZA 4TUUA 2GLSA 2RD0A 2RPQA 2BYEA 3SDLC 3CWIA 2WP9B 2WS3B 1JWUD 5FR3A 3BY4B 5BYRA 5JHAA 4JQWC 1GUAB 2BBCA 1TKGA 1Z2MA 1SF0A 4PS3A 1XQQA 2FCSA 1WXSA 1ZP0B 1WGYA 2Z59B 5C1ZA 2REXA 2L7RA 4HKQA 2QILA 3K9PB 4GGQA 4A55A 3FC4A 3MHSD 4J3OD 4MJSB 4M0WB 2GI9A 1L0XB 2WX0A 4OZBA 4NPNA 5IAAC 1E7PB 4BKSD 1QQRA 2BYVE 2B76B 1MG8A 2V4LA 3AV8A 4ACFA 3AMZA 4BAXA 3KWVA 2N9EB 3GS2A 2JX5A 4NNJB 2N4FA 4L2YA 4W9EA 4P1BC 2DAFA 3JVZX 3DVGY 4AS1A 3LDZE 1MG4A 2K22A 3DVNV 3WAOA 4HCPB 1YD8U 4MH0E 2NBWB 2UWQA 2VZKD 3BK2A 4KV2A 1FPYA 3DBHI 1XT9B 4CO7A 4FJYA 3NRZA 2O2VA 4OVUA 4HEA1 1C78A 4YL8A 3BZDB 4NAWA 4KIKA 2X8XX 3Q6BA 5IO9A 2DHZA 4HPMB 5G55A 4NY0A 1RLFA 3V61A 2LGDA 4XX5A 3P42A 1SEBD 3EUB2 4GIVA 4OVZA 4PYUA 4GSWA 3DCGA 1D3ZA 3I63C 1E7UA 3U2SC 2MJDA 3QQ8B 4FXCA 4IM0A 3E9SA 1FNVA 2JRIB 4MEMA 1XXGA 3AE5B 1OQYA 1TZOA 1NDDA 1ZE3D 4MT5A 5D7GA 2JWZA 4BOZB 4NJ6A 2CHXA 2D07B 1MVKA 2WXKA 2TSSA 4JL9A 2O2VB 1IGDA 3RULA 1YQ3B 3EGRA 3IFWB 1CMXB 5HFYA 2WNMA 5CX3A 3PSEB 4UDUC 4BKTA 3Q14C 2V1YA 2K6DB 1IYFA 2NPTA 2D11A 1S3SG 2N9KA 2LVOA 2DBYA 2WXMA 2C7MB 4JWUC 1KFYB 3HVZA 3VRAB 2MLBA 3A9KA 2EELA 1RFAA 2JUOA 5AUIA 3VUYA 1WZ0A 1GAQB 1Q0WB 2KMAA 3AECB 3VUXA 4LLGM 1L2NA 4PYZA 3ZNID 5LNK1 3Q8FA 1V97A 3U52E 2KYWA 2SAKA 1V1PB 2EKIA 3BYYB 2JVCA 3IBEA 1P1AA 2WXNA 4BBNC 2XN9C 4GB9A 2HTME 4N58A 1VDVA 3PGEA 2JF5A 3AN1A 3Q3MC 2K3UA 2WX1A 3W9CB 4JIOU 4RGMA 4NZLB 1GOZA 1J7BA 4HK2A 4K7UA 3A1QA 4ZRQA 1T0SC 3KW5B 3BVZA 4HRSA 3RNEC 3SHQA 2N0SB 1CQVA 3W2DA 2PTLA 3W1SC 4AOFA 4ANUA 1C4CA 2KX0A 3V3XA 5FK9C 3RCZA 1T0RC 2W3RA 3ZDTA 4DBGA 2EMTA 2QSDA 3L17A 4DXFA 1NEKB 1ZXIA 4DDGD 2JXTA 4BZAA 1J0GA 2IGHA 4WWOA 3UIPB 1P98A 4HJKA 1UELA 3ONSA 3URYA 4WJQA 3PO0A 3DBRB 2AEHA 3KYCD 1A70A 3ZNHB 3RUIB 4FADA 1XCQL 2N7EA 4W9CA 3M63B 3A33B 4H2AA 1YOVB 1AARA 2N9XA 5JZEB 1G6JA 2D5GA 3T3OA 4EEWA 1HTQA 2CKHB 1WJUA 2Y5CA 1WM3A 3U30A 2C60A 4P1CC 5EE1A 3EHVA 4C56C 5HHDG 1LM8B 1SXTA 4ICVA 4ITKA 4GDLB 1GPXA 4YT0B 1VD2A 1DGJA 1TIFA 4DQOC 2RPVA 2LVPA 4Q2JA 2YVCA 4I6PA 3ZW3A 5IOIA 3RT3B 4F1SA 1TTNA 1SJED 2ZPYA 1C4PA 2V0GA 3N1XC 1I42A 3P63A 1D5MC 4IW0A 3PT2B 3AEBB 3UIOB 5E6PA 2QEJC 2MH7A 1L4DB 2KQ7A 2L3ZA 4GN1A 1MFWA 1V49A 3GOEA 1EWCA 3TMPB 3RPFC 2KQSA 3TJPA 1E10A 2MJEA 1C77A 1JWMD 4ANXA 3PVLA 2GBNA 2MSED 4R3DA 3SFEB 2LJ5A 4P6VF 1E5WA 1P7FA 4IM2A 4W9DA 2FUHB 1HQRD 5GMVA 4JE3B 1EWYC 2DYOA 3ZRCA 1EM7A 4RH6A 4ICUA 1QT9A 3M62B 2QC8A 3HK0A 1AW7A 4KZ0A 3HIZA 2MWSB 2J0KA 1SIFA 3RI7C 4JGHB 4WURA 3FILA 1FIQA 1VJKA 2FCNA 1IBXA 4WH4A 3Q69A 5LXIB 4KGTA 2AQ1B 4A90A 1FCCC 3JSVB 1D4BA 1V86A 2K8CA 3TEXA 2KFJA 1YMHE 3GE3C 2N9PC 3P2BA 2BS4B 3S2AA 4HXDA 3ZVVA 1M4VA 2L52A 5KHQA 3Q8EA 2BGFA 2AX5A 4AJWA 1JWSD 3VTVA 4ZYSA 2DWQA 1VZ8A 2O6VB 3LB8C 5FR6A 3MTNB 2KKCA 3VUWA 4MGYE 4EZJA 3EC8A 2ZNVB 5J18A 4DHZE 2KMMA 1J19A 2PE6B 5CHVC 1SE9A 3AM9A 4ARCA 2NBUA 4BBNF 3L16A 2DX5B 3WANA 4A9AA 4G50A 2C9WB 2QHOA 3TUOA 1UNSA 1EF5A 2MJ3A 1E0ZA 1ET9A 2WQYB 2KDFB 2WXIA 1YN5A 2LHDA 1UH6A 1XLNA 3NVVA 4B95A 1C76A 3DWMA 2KZRA 2WXQA 1EUVB 2D3BA 3R8BA 2LHEA 1WIAA 4LNNA 1WGHA 2IO3B 3NVWA 1TY0A 5HI1A 4DHJD 1XLPA 4AUQC 3SU8X 2Z0DB 1WX9A 4IOIE 2G1EA 4G0NB 4WAAA 5DPTA 4EKUA 4I6LB 2KTRA 3E56A 4M8NA 2M0XA 5HKHA 3FAHA 1JWAD 4E74A 1TKEA 4WQMA 1V80A 3HRDD 4HCNB 2KTRB 2LGXA 3N30A 2IZVB 1KM7A 1KH0A 3B1LX 1WFYA 1R4MB 4LCDE 5LLIA 1WWTA 2NPTB 2W9NA 1AN8A 2K39A 3WAMA 3AI5A 2JRHA 2FIDA 4FHKA 1ACCA 2KX3A 2WXJA 2GBMA 4BOSC 1I35A 1IUEA 3PZ7A 1XCTL 2KT7A 1FEHA 1LGRA 4K7WA 3SFDB 4K3CA 5DPWA 2ASQA 3VR9B 2QCZA 3UI3A 4GMVA 1LXDA 3ZNGC 3L10B 3ZGZA 2MBOA 1TZ1A 2OOBB 2KMCA 4C80A 1V5TA 1SE4A 5J17A 3MJWA 2LRWA 4AJYB 1QOFA 1PGBA 2WYQA 1H8CA 2WDQB 1TS2A 4LTUA 1L0YB 3PTFC 3AXCA 2JSVX 5BO4B 4A20A 5T8IA 1L6VA 1T6BX 2FNJB 1QOGA 3QHTA 2G3QB 3P1MA 3VH3B 4WJOA 1GB4A 3QA8A 1JQ4A 2KAJA 4TSSA 5IN7A 4XWWA 2H89B 2I2YA 2M17A 1UUPA 4HLEA 5BMIA 1KLUD 1WXVA 3GZNB 4DHZB 4MACA 3R2TA 1DOXA 3I3TB 4ZHPA 2BS3B 2ICIA 2JYEA 2IBIB 3H1UA 4KSKC 2DZIA 3Q3FA 3MC0B 2KC1A 5E6NA 2FAZA 4I6NB 3N20C 2X38A 4IWQA 3IHPC 3L4PA 2MBHA 1WRDB 1K8RB 3ML8A 2L76A 2KO3A 1L0VB 3ZXRA 2MP2B 2ZVOA 2EKEC 2Y5BB 5BMGA 1KRHA 2D3AA 1XO3A 5L95C 1T0YA 2JPHA 2BYTA 3NOBA 3HM6X 3WCQA 2G45B 4S0RA 2HTHA 2IY0B 1QZEA 1YQBA 3HM3A 2PVOD 2E3TA 3CF6E 1I4RA 2KLGA 1F77A 2W3SA 3DBLI 3P4SB 3J9CA 1MHHE 1PDXA 1NVID 2D3GA 2ZW1A 4TQ1A 5HG2A 1R4NI 4C7YA 4RCOA 3KLSX 2K8HA 2NCNA 2QDFA 1YN4A 2OHFA 4W9KA 2KNBA 2MA9B 3BK1A 3ECIA 4TMAB 1C3TA 2J0MA 4YTMB 1P3QU 3Q8BA 1EF1A 3RZWC 2J0JA 1V1OA 3BYTB 1FRDA 5E6JA 3T9LA 2YLMA 5CHFA 1ISNA 1ESFA 1FM0D 1SE3A 2BPSA 1C9FA 2LJIA 1HZ5A 4D2KA 2KHWB 2Q5WD 3W5VB 2KFKA 1WMHB 1KTKA 4M00A 3WA0A 4EOYA 4WWNA 2UU7A 2KLCA 1XD3B 2LD9A 3HVDA 1TYGB 2JXXA 3L54A 1WMHA 2K9XA 2KFKB 1JRUA 1J7CA 4ZOHC 5EE9A 3PREA 2KWVB 4C4VB 1YX5B 2IJ0A 2PW9A 3HUIA 4RGTA 1NYQA 2BB5A 3RZFA 1E9MA 3ALBA 4B0MA 2KJRA 1L5PA 3H7SA 3KQ4A 2KWUB 2GB1A 3UINB 4B9KA 4USAA 4ZHOA 1XLOA 4AQ7A 2Y3AA 3ZDMC 4EE2A 2BVCA 2INDC 3P4PB
chains in the Genus database with same CATH topology
3P4RB 1C77A 1ZUD2 1JWMD 4LK0M 4RNAA 5H8YE 2N7JA 4R3DA 3SFEB 4P6VF 1QOBA 2WXRA 1P7FA 1CJEA 1JW9D 1VZ7A 4OZAA 3LXFA 1HQRD 1RFKA 4JE3B 1R7SA 1EWYC 2DYOA 1TKYA 4MH8A 1EM7A 4RH6A 1QT9A 2IPKD 1AW7A 2V3NA 3TSSA 4GLSC 3VRBB 5JXVA 1DYQA 1P7EA 2M56B 1K53A 2LFIA 1UWXA 2CJNA 4YSXB 3GP7A 1AWDA 2AQ3B 2WXPA 3AE2B 3O13A 2LEKA 4WURA 3FILA 1FIQA 1IBXB 1VJKA 1FFVA 2L32A 4O1NA 3FILB 1J7AA 1VZ6A 4WH4A 1IBXA 1C79A 3Q69A 3AEDB 1PUTA 1ZDVA 4KGTA 2AQ1B 3W5UB 3U7ZA 1FCCC 4A90A 3RFZB 3AE7B 2M19A 2IDYA 1D4BA 3TEXA 1YMHE 3B2GA 1ZPSA 1XLQA 1FXIA 1BXTA 4KKJA 1YJJA 1K51A 3R2IA 3V05A 2V3PA 3H8HA 4HKZE 3KWLA 2BS4B 1ZDXA 1DOIA 2WDVB 1M4VA 1FO4A 1SB3C 1V1PA 5BYSA 2L52A 2IGGA 4NAWB 3I9V1 1HZ6A 3Q8EA 3DWGC 2AX5A 3P4QB 4WAFA 3Q8AA 1WRIA 2CJOA 1JWSD 4A6QA 4ZYSA 1MPEA 2DWQA 1I7HA 1VZ8A 1NYRA 3LB8C 4JWSC 2FE8A 4US9A 3NUHB 5G5HA 1TY2A 4C7ZA 2KMMA 2CU3A 3BVMA 3IAS1 1EU4A 5H92C 1I4GA 2FUG1 2ON8A 1OQRA 3CWIA 3AM9A 4ARCA 2WP9B 2WS3B 1CK1A 1JWUD 5FR3A 2Z8LA 4B0EA 2NMQA 1T3QA 2KDMA 5BYRA 2OEDA 2WLBA 3EA6A 1N5XA 4A9AA 2BBCA 1OFFA 1TKGA 1NI3A 3P4PB 1SF0A 1N63A 4L23A 2WU5B 3TUOA 2LUMA 1UNSA 1ZP0B 2J53A 2MJ3A 1JRPA 1Y56A 3BWUD 2E6XA 1MI0A 1E0ZA 1ET9A 2WQYB 2WXIA 1YN5A 2LHDA 2W55A 3ETRA 1BMLC 1XLNA 4HKQA 2NTSA 2QILA 3NVVA 2ACZB 1C76A 4A55A 1QILA 3DWMA 3FC4A 4J3OD 2WXQA 1JALA 3R8BA 2QMTA 2LHEA 1VR9A 1SIJA 2GI9A 5I4DA 1L0XB 4L1BA 4OZBA 3NVWA 1TY0A 5HI1A 1F0ZA 1E7PB 1XLPA 4RF1A 5EE0A 1QQRA 1I4QA 2B76B 3W1SA 1F2RI 3AV8A 3AMZA 3KWVA 3GS2A 2JX5A 4WIPA 1I4XA 4HROA 4IOIE 2G1EA 1NENB 4KKIA 4L2YA 1RYJA 3E56A 2SEBD 4AS1A 1UGJA 2K22A 2KACA 3FAHA 5G5GA 1JWAD 1JWBD 2BT6A 4YWGG 1FD6A 1TKEA 4WQMA 2VZKD 3AE4B 1UWMA 1YQ4B 3BK2A 1WGKA 3B9JA 1E6EB 3HRDD 3ABVB 4GDKB 4YSYB 4PT5A 2LMCA 3NRZA 3NZ3A 2QJLA 1EU3A 4HEA1 1C78A 3BZDB 1KH0A 4ARIA 2L83A 3MHZA 1L4ZB 2I38A 1XEEA 1WWTA 2NTTA 2YEPB 1AN8A 3LYYA 2BB6A 3AH7A 1FNWA 3AE6B 4US8A 4XE0A 1T5XD 1ACCA 1B9RA 3P42A 1SEBD 2WXJA 2K5PA 3EUB2 1SJHD 1IUEA 4OVZA 3PZ7A 1XCTL 2JZPA 2VZKB 1SSNA 3U4EG 1FEHA 3U2SC 4YTPB 3SFDB 3VR9B 5FKAC 2MJDA 3UI3A 4FXCA 3IAM1 3E9SA 1FMAD 1FNVA 2BS2B 1XXGA 3TEZA 3I57A 3ZGZA 3AE5B 1I4PA 2JWUA 1TZOA 2L1AA 2RMMA 3BVGA 5D7GA 1ZE3D 1CZPA 4M0WA 4MT5A 4TQ0A 2XNAC 3Q8CA 3AB5A 2J42A 4XDDA 1MVKA 5AUKA 1TJEA 2WU2B 2MEKA 2TSSA 2WXKA 1PGXA 4HJGE 4C80A 1D6EC 1SE4A 1TS5A 3AEFB 1QOFA 3MFGA 1IGDA 1PGBA 1YQ3B 2WDQB 1TS2A 3EGRA 2BTEA 3TEWA 4LTUA 1L0YB 4RFBA 1ENFA 5HFYA 1D5XC 2JSVX 2WNMA 4YXDB 1FRRA 4KGSA 5T8IA 1L6VA 1T6BX 3GB1A 4UDUC 1QOGA 1F2RC 1I4HA 1LO5D 2N9KA 3P1MA 2DBYA 2WXMA 1GB4A 2KQ4X 4JWUC 2KAJA 4RGOS 1JQ4A 2N9LA 4OZCA 1KFYB 4TSSA 3HVZA 3VRAB 4XWWA 1HXYD 2H89B 4RGNA 1N5WA 1JCKB 2I2YA 3AEGB 5C3JB 2KN4A 1RM6C 1UUPA 1K50A 5MPOA 1C4AA 5BMIA 1KLUD 2EELA 5AUIA 4MACA 3R2TA 1DOXA 3IXSA 2FBWB 2YEPF 5BMHA 2V4IB 1GAQB 3AECB 3IT4B 4ZHPA 4KGRA 2BS3B 4LLGM 1FXAA 3AE3B 1PYWD 5LNK1 2ICIA 2JYEA 3Q8FA 2LGIA 1V97A 3MC0B 3U52E 3BIID 2WXOA 2SAKA 1V1PB 2EKIA 3BYYB 1VRAB 2ZW0A 2WXNA 3N9YC 4N59A 1N61A 2X38A 2XN9C 2BW2A 2HTME 4YTNB 3L4PA 4N58A 2WXFA 1VDVA 3AEAB 1L6UA 1L0VB 1GB1A 1HEZE 5D3IB 4WWMA 3AN1A 5BMGA 1KRHA 1QLBB 2PMVA 1XO3A 2K3UA 3W9CB 2R61A 1JMLA 4RGMA 1YJIA 3MJ5A 4NZLB 2BYTA 1GOZA 1J7BA 1FFUA 1MHXA 4KX6B 3NVYA 3WCQA 3IT6B 1OQQA 3AE1B 4ZRQA 4XDCA 3BVZA 4HRSA 2PVOD 4IDIA 3VR8B 2N0SB 1CQVA 3W2DA 2PTLA 2INNE 2E3TA 1I4RA 2W3SA 1F77A 1FNUA 1QKZA 2WXGA 3P4SB 1C4CA 3J9CA 5C2TB 1WYGA 3CIRB 1MHHE 5FK9C 3V3XA 1PDXA 1WXQA 3T3NA 1TS3A 2W3RA 1ROEA 2JQRB 2QSDA 3AE8B 1QF6A 1YN3A 1NVID 2PIAA 2ZW1A 4TQ1A 4DXFA 5HG2A 1NEKB 4MM3B 5GXGB 2RDHA 1N60A 2W54A 4C7YA 1ZXIA 2J52A 4RCOA 3KLSX 2JXTA 2Y5PA 3SEBA 1KLGD 1DOYA 4P16A 3VQIA 1YN4A 2OHFA 1YNTE 2IGHA 3AEEB 2KWDA 4CQNA 2WDRB 4NJCA 3URYA 3BK1A 4TMAB 1QOAA 2G9HD 5TSSA 2J4XA 2QIEB 3PO0A 4YTMB 3Q8BA 3C8YA 1A70A 2K0PA 3B2FA 3NVZA 1V1OA 3BYTB 4NAMA 1FRDA 1XCQL 5E6JA 4RF0A 1HA5A 3OWEB 2PKOA 4H2AA 2PVGC 1RWSA 4ZRPA 3AE9B 1ESFA 1FM0D 1SE3A 2D5GA 3T3OA 1ZXHA 4XWTA 1C9FA 2LJIA 1HZ5A 1D5ZC 4D2KA 2M0AA 1SBBB 2Q5WD 3W5VB 5D3DA 4YSZB 2JYTA 2Y5CA 1JROA 1KTKA 2GRIA 1KF6B 3ZQ4A 4OW0A 1PFDA 1Q10A 4JPSA 5EE1A 4C56C 2WXLA 5HHDG 1PGAA 1SXTA 5BYQA 3HVDA 2INPE 4N6EB 5EE3A 1TYGB 4ITKA 3ZJVA 4GDLB 3ZJTA 4A8XC 1GPXA 4YT0B 1TS4A 2IGDA 2JU6X 1ET6A 1DGJA 4DXGA 1STEA 3ZJUA 4DQOC 1VLBA 1ZOYB 2RPVA 1N62A 4OHJA 2K9XA 4Q2JA 1IGCA 2ONQA 3SR6A 2RDGA 1J7CA 4ZOHC 3TEYA 5EE9A 1K52A 3MP9A 1SJED 3PZ8A 2WXHA 4REZA 2IJ0A 2PW9A 3HUIA 1C4PA 1B1ZA 1XF5L 1NYQA 2BB5A 4RGTA 2AQ2B 2V0GA 4IKGA 3P63A 3ZYYX 1D5MC 1E9MA 2HDEA 4B0MA 3NS1A 1L5PA 1WSPA 2W82A 3KQ4A 4JX1C 3AEBB 1V8CA 2GB1A 2QEJC 2MH7A 4USAA 1L4DB 2DLBA 4ZHOA 2PLPA 2DYMA 1SE2A 1XLOA 4AQ7A 2Y3AA 4EE2A 1EWCA 3RPFC 1FCLA 1BUIC 1E10A 2H88B 1AYFA 2MJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUM A;  2J53 A;  2JWU A;  3V3X A;  1MHH E;  2RMM A;  2N7J A;  1MI0 A;  2QSD A;  2LHD A;  2ZW1 A;  1P7F A;  5HG2 A;  1MVK A;  1PGX A;  4HJG E;  4OZA A;  2J52 A;  2JXT A;  1IGD A;  1PGB A;  2LHE A;  2QMT A;  1EM7 A;  1YNT E;  2IGH A;  2KWD A;  2GI9 A;  4OZB A;  5HI1 A;  5HFY A;  2JSV X;  4KGS A;  4GLS C;  3GB1 A;  5JXV A;  1P7E A;  1F2R I;  1K53 A;  1UWX A;  2K0P A;  1F2R C;  2N9K A;  4IOI E;  1GB4 A;  3FIL A;  1IBX B;  1XCQ L;  2KQ4 X;  2N9L A;  3FIL B;  1IBX A;  4OZC A;  4WH4 A;  4KGT A;  1FCC C;  1D4B A;  2I2Y A;  2KN4 A;  1YMH E;  2KAC A;  1ZXH A;  1K50 A;  1C9F A;  1HZ5 A;  4D2K A;  5BMI A;  1FD6 A;  1K51 A;  2EEL A;  4MAC A;  4HKZ E;  5BMH A;  4KGR A;  1Q10 A;  2IGG A;  1KH0 A;  2LGI A;  5HHD G;  1PGA A;  1HZ6 A;  2I38 A;  2IGD A;  2JU6 X;  2ZW0 A;  1MPE A;  2RPV A;  2ONQ A;  1IGC A;  1GB1 A;  1HEZ E;  1K52 A;  3MP9 A;  5BMG A;  2PW9 A;  1XF5 L;  4IKG A;  1JML A;  1XCT L;  2GB1 A;  2JZP A;  1MHX A;  2ON8 A;  2PLP A;  2NMQ A;  2KDM A;  3UI3 A;  2OED A;  2PTL A;  1FCL A;  1QKZ A; 
#chains in the Genus database with same CATH topology
 3OAW A;  4WJP A;  3A4S C;  5H8Y E;  2JY6 A;  2ZVN A;  4LJP B;  2WXR A;  1T0Q C;  4J6I A;  4XZ4 A;  1VZ7 A;  2HJ1 A;  3KUC B;  3LXF A;  3V6C B;  2KD0 A;  4ANV A;  1R7S A;  1WXM A;  2D10 A;  3KUD B;  2GBJ A;  3TBL D;  2IO2 B;  4NJ7 A;  3TSS A;  5TR5 A;  4PS8 A;  1DYQ A;  2M56 B;  2LFI A;  2NS5 A;  1UWX A;  2CJN A;  3DBH B;  2V3S A;  1AWD A;  3O13 A;  1UBI A;  2LEK A;  1WJ6 A;  2L32 A;  4O1N A;  5D2M B;  4HPL B;  1VZ6 A;  1C79 A;  1PUT A;  1RRB A;  1ZDV A;  1WYW B;  3U7Z A;  2CHZ A;  2IDY A;  2HJ8 A;  2WWZ A;  3ML9 A;  1ZPS A;  4K1R B;  1WR6 E;  1K51 A;  2HE7 A;  1C1Y B;  3RNC C;  2ZZP B;  3AU4 A;  2FCQ A;  4RMA A;  3MC8 A;  1ZDX A;  1WE6 A;  4MSM B;  2WDV B;  1FO4 A;  2KJH B;  3AU5 A;  3I9V 1;  2BKF A;  2LXA A;  3P4Q B;  1WRI A;  3UQA A;  4GU2 A;  3M95 A;  5E6O A;  5G5H A;  2R2O A;  4F8C B;  2CR5 A;  4M01 A;  2CU3 A;  1ZKH A;  3ZRF A;  3C0R B;  3X23 A;  5LXH A;  1EU4 A;  1V6E A;  3Q2A C;  1I4G A;  2FUG 1;  5H92 C;  1OQR A;  2Z8L A;  2NMQ A;  1SGH A;  2KDM A;  4ZYN A;  5L83 A;  1KLV A;  4S17 A;  1OFF A;  1NI3 A;  4C4V A;  4HVB A;  2WU5 B;  4FN2 A;  3TIX A;  1U4A A;  2W55 A;  1BML C;  2NTS A;  3QK0 A;  3PV1 A;  3QAQ A;  5CTR C;  4MGK E;  4OVV A;  1JAL A;  2INC C;  2UYZ B;  4W9J A;  2GOW A;  1SIJ A;  5D6J B;  2L00 B;  4RF1 A;  5EE0 A;  3R7R A;  1I4Q A;  2K6Q A;  3W1S A;  1F2R I;  3B0A A;  3A9K B;  2JZ3 B;  1I4X A;  1UF0 A;  3R7Q A;  3RNG C;  1GNU A;  1RAX A;  4AWJ A;  3PRZ A;  1RYJ A;  1UGJ A;  3B08 A;  3ZIM A;  2KAC A;  2DZJ A;  4MM3 A;  3RNB C;  3AE4 B;  1UWM A;  4A3O A;  1YQ4 B;  1WGK A;  5IKC M;  3Q3J A;  3ABV B;  4GDK B;  4YSY B;  4PT5 A;  3Q3O C;  1OTR B;  3NZ3 A;  2QJL A;  2DZM A;  1P0R A;  3OG5 A;  4ARI A;  2L83 A;  3RD2 A;  2I38 A;  1XEE A;  1KOT A;  4GDL A;  2NTT A;  4ZDV A;  2YEP B;  3GE8 C;  2BWE S;  2XEW A;  3KUZ A;  3AH7 A;  3AE6 B;  1T5X D;  1OEY A;  4BFR A;  1X1M A;  1UZX B;  1E8X A;  1SJH D;  1HTO A;  2RGF A;  2LGY A;  3D32 A;  1WJN A;  3H9D A;  3U4E G;  2OJW A;  3N1Y C;  3RN9 C;  5FKA C;  1F52 A;  1FMA D;  3RNF C;  2KVZ A;  3PLV A;  2KDE B;  3TEZ A;  2LAS A;  3I57 A;  4FBJ B;  1YX6 B;  2JWU A;  3BVG A;  2L1A A;  2RMM A;  3NS8 A;  3DHI C;  4TQ0 A;  3Q8C A;  3AB5 A;  1Q5W B;  5DPS A;  2M4N A;  3VH4 B;  1TT5 B;  5AUK A;  3RNA C;  2O6V A;  2ZCB A;  1TJE A;  1PGX A;  4HJG E;  1TS5 A;  4MEL A;  1V9J A;  3C19 A;  4RFB A;  4PS7 A;  1D5X C;  2J7Q B;  4EFO A;  4YXD B;  5DCN A;  1FRR A;  4ZRJ A;  1ZGU B;  1A5R A;  4BVU C;  4RGO S;  2N9L A;  1UD7 A;  2IY1 B;  1HXY D;  4RGN A;  4W9L A;  4DK5 A;  2BQQ A;  1AYF A;  3APD A;  1RM6 C;  1R4N B;  5MPO A;  1C4A A;  3PHX B;  3IXS A;  2NVU I;  2FBW B;  2V4I B;  5G2N A;  3WAP A;  4N9F 4;  2LGI A;  3UGB B;  2WXO A;  3R3M A;  2RR9 A;  1WJ4 A;  4N59 A;  1N61 A;  2BW2 A;  2WXF A;  3AEA B;  1L6U A;  3I5J C;  2LVQ A;  1GB1 A;  4HDQ A;  1HEZ E;  4WWM A;  3DBS A;  3CST A;  1QLB B;  2MW5 A;  2PMV A;  3JSV A;  3MJ5 A;  1FFU A;  1MHX A;  2L8J A;  3AE1 B;  4LNI A;  4XDC A;  1UBQ A;  4IDI A;  3VR8 B;  2MHJ A;  3QJZ A;  4B6W A;  4JLC A;  3DBL B;  1M94 A;  3CMM B;  4GDK A;  1R4M I;  1WYG A;  3CIR B;  4K7S A;  3T3N A;  1GC6 A;  4II2 B;  1ROE A;  1BT0 A;  2JQR B;  4EZL A;  3Q3N C;  1LQB A;  2PIA A;  1E90 A;  4MM3 B;  3DHG C;  5GXG B;  1TBE A;  2KJ6 A;  4GXB A;  1N60 A;  2VH2 A;  2W54 A;  2J52 A;  1F1H A;  4IG7 B;  1KLG D;  4P16 A;  3RMK C;  3VVW B;  4CHK A;  4CQN A;  3U7D A;  2WDR B;  1ZW7 A;  4NJC A;  3ZTC A;  3A4R A;  1WGG A;  4WWP A;  3DPD A;  2G9H D;  5TSS A;  3NJT A;  4ASW C;  3PLU A;  3PHW B;  3NVZ A;  2K0P A;  3B2F A;  4NQK E;  1V5O A;  2JT4 B;  4NAM A;  2PJH A;  1YJ1 A;  4G3X B;  2D2Q A;  4RF0 A;  2K1F A;  1HA5 A;  3OWE B;  2PKO A;  2PVG C;  1J8C A;  4MSQ B;  3DVG X;  4XWT A;  2L05 A;  1D5Z C;  2M0A A;  1SBB B;  5D3D A;  4YSZ B;  1JRO A;  4W9F A;  2GRI A;  1WX7 A;  3DDC B;  2BWF A;  1KF6 B;  3ZQ4 A;  1IP9 A;  4OW0 A;  4LNK A;  2AL6 A;  4JPS A;  1TGZ B;  1PGA A;  3ZJT A;  3ZJV A;  3HHM A;  4A8X C;  2LRU A;  1TS4 A;  2IGD A;  2JU6 X;  4E3C A;  4DXG A;  4KIK B;  3ENE A;  1N62 A;  1IGC A;  3SR6 A;  4URK A;  2RDG A;  3TEY A;  2KVR A;  3PZ8 A;  2JZZ A;  3DOW A;  2IYD B;  3BIN A;  4IKG A;  2RDB C;  2HDE A;  3QIJ A;  1WSP A;  3T8M A;  4JX1 C;  1V8C A;  3SD5 A;  4ZRK A;  3M3J A;  4KSL C;  2PLP A;  3AUL A;  1SE2 A;  1FCL A;  1BUI C;  2H88 B;  1N6Z A;  3P4R B;  1S1Q B;  1ZUD 2;  4RNA A;  2KDI A;  2N7J A;  3KH0 A;  1QOB A;  4C00 A;  1NBF C;  5IA7 A;  4MH8 A;  3VDZ A;  2R2Q A;  3OJ3 A;  2IPK D;  3EEC A;  3APC A;  3L08 A;  4IWP A;  4KDL B;  2K8B A;  3VRB B;  2C7N B;  1K53 A;  2MP2 A;  4IM3 A;  2AQ3 B;  3ZNZ B;  1IBX B;  2MBB B;  3FIL B;  1J7A A;  3AED B;  4FJV B;  4X57 B;  3AE7 B;  2M19 A;  5C23 A;  5KHO A;  3B2G A;  3PRM B;  1BXT A;  1FXI A;  1LFD A;  2MRP A;  2KDB A;  4KKJ A;  2ZPN A;  1YJJ A;  2KXJ A;  2NBV B;  3V62 A;  4CYE A;  2G4D B;  1DOI A;  1V1P A;  4F7Z A;  3VTU A;  1HZ6 A;  2KAN A;  3DWG C;  1GC7 A;  4WAF A;  4BKS A;  3Q8A A;  2CJO A;  1WY8 A;  1Q1O A;  1MPE A;  2A4Z A;  4JWS C;  2FE8 A;  5AZG A;  4M02 A;  3NUH B;  1TY2 A;  4RM8 A;  4MDK E;  3BVM A;  2C5L C;  3IAS 1;  4KVG B;  2ON8 A;  2N1V A;  1CK1 A;  2M8S A;  4M8M A;  3WAL A;  3V60 A;  4B0E A;  1T3Q A;  2OED A;  2PEA A;  2WLB A;  3EA6 A;  1N5X A;  2WDT B;  3N1Z C;  2PE9 A;  4DDI D;  5AZF A;  3UQB A;  4L23 A;  1N63 A;  2XK5 A;  4FLH A;  2LUM A;  2J53 A;  2L0T A;  3PZD A;  1JRP A;  1Y56 A;  3BWU D;  2E6X A;  2FCM A;  1MI0 A;  4HPP A;  2KWC A;  4EZK A;  3RYT A;  3ETR A;  3IVF A;  3APF A;  1NI2 A;  2ACZ B;  3ZXV A;  3PRP B;  1QIL A;  4A3P A;  2QMT A;  1VR9 A;  5I4D A;  4L1B A;  1F0Z A;  3ZUN A;  1GG3 A;  4II3 B;  1Z5S B;  3A9J B;  4WIP A;  3DHH C;  4HRO A;  1NEN B;  2WHI A;  4HWI B;  4KKI A;  1WZ3 A;  2VRR B;  4LNF A;  1E7V A;  3UF8 A;  4E71 A;  2SEB D;  3QCA A;  2O6V D;  5G5G A;  3LJ3 A;  1JWB D;  2BT6 A;  4YWG G;  1FD6 A;  1PQS A;  4KZC A;  3IG3 A;  3B9J A;  1E6E B;  2LMC A;  4LDT B;  1EU3 A;  3K9O B;  4FJZ A;  2MX2 A;  4MGZ E;  4ZRI A;  3MHZ A;  1L4Z B;  3O65 B;  2DYB A;  2DZK A;  2OJR A;  3LYY A;  2BB6 A;  1FNW A;  4US8 A;  4XE0 A;  4K81 A;  2GBK A;  3TCA A;  4XC2 A;  3L13 A;  1B9R A;  1P9D U;  2IO0 B;  2K5P A;  4NQL B;  2AL3 A;  1WM2 A;  3A1Q B;  2JZP A;  2FIF A;  2VZK B;  1SSN A;  3GZN I;  3NZU A;  3ZKJ C;  4XGA B;  4YTP B;  2MBQ A;  5J2R A;  3VAW A;  3IAM 1;  4P7I A;  2PPH A;  5JH5 C;  2BS2 B;  1WF9 A;  2GMI C;  3VHT C;  2XK5 B;  1I4P A;  1CZP A;  4M0W A;  2XNA C;  1GJZ A;  5DPR A;  2J42 A;  4XDD A;  2MCN B;  2WU2 B;  2MEK A;  4W9G A;  1D6E C;  1E8Z A;  3AEF B;  3MFG A;  2LUE A;  2N7D A;  2BTE A;  2MQJ A;  3TEW A;  1ENF A;  4KGS A;  2CU1 A;  3EFC A;  3GB1 A;  3KYD D;  1WH3 A;  1WGD A;  2KOX A;  1F2R C;  1I4H A;  1LO5 D;  1UGM A;  3QC8 B;  2KQ4 X;  1WGR A;  4OZC A;  1N5W A;  1JCK B;  3CSF A;  3AEG B;  2N1W A;  5C3J B;  2KN4 A;  4G11 A;  1K50 A;  1VCB A;  3N3K B;  1E8Y A;  3A9J A;  5CHW A;  2YEP F;  5BMH A;  2RSU A;  4BKG A;  2Z0E B;  3IT4 B;  4KGR A;  1FXA A;  3AE3 B;  1PYW D;  5D94 A;  1H4R A;  4QAY A;  3ZTD A;  5AEK B;  4LJO B;  2KN5 A;  3BII D;  2LZ6 A;  1FXT B;  1VRA B;  2ZW0 A;  3N9Y C;  3VXW A;  4YTN B;  2BYF A;  4W9I A;  1WR1 A;  2CHW A;  5D3I B;  5IP4 D;  1WX8 A;  4FA6 A;  3L0W B;  4FUL A;  2BKR B;  2NR2 A;  2R61 A;  1JML A;  1YJI A;  4LDT D;  4XYC A;  5JHB A;  2ZCC A;  5AZH A;  2GBR A;  2V9H A;  4KX6 B;  3NVY A;  3IT6 B;  1OQQ A;  2B3A A;  2K25 A;  2LGS A;  3DBR I;  2DEN B;  2INN E;  4K3B A;  1FNU A;  1HE8 A;  1QKZ A;  1MJD A;  2WXG A;  5C2T B;  1WXQ A;  1V81 A;  3FKY A;  3VFK A;  1TS3 A;  3ZLZ A;  3AE8 B;  1QF6 A;  1YN3 A;  2KTF A;  2ZNV C;  4DHJ B;  2RDH A;  3U8Z A;  3NG0 A;  2Y5P A;  4PK1 A;  3SEB A;  1DOY A;  4GOC A;  3VQI A;  2AYO B;  1YNT E;  1Y8R C;  2I1K A;  3AEE B;  2KWD A;  3PPA A;  3V6E B;  4WJN A;  3QAR A;  3OLM D;  1QOA A;  2J4X A;  2QIE B;  2M1M A;  4MGI E;  4RM9 A;  4HDO A;  3C8Y A;  3OJ4 B;  1EO6 A;  2KK8 A;  3MC9 A;  1E8W A;  3JYU A;  2LWP A;  2DAJ A;  3KVF B;  1RWS A;  4ZRP A;  3ZO5 B;  3AE9 B;  1OGW A;  1ZXH A;  3TL5 A;  1IPG A;  4IC7 B;  2JYT A;  1PFD A;  3QX1 A;  4MJS A;  1Q10 A;  2WXL A;  5BYQ A;  2INP E;  4N6E B;  5EE3 A;  4WQO B;  3NHE B;  2I1J A;  1ET6 A;  3DVN U;  1STE A;  3ZJU A;  1L7Y A;  1VLB A;  1ZOY B;  4OHJ A;  3NY5 A;  2ONQ A;  4REZ A;  3MP9 A;  1K52 A;  2CS4 A;  2WXH A;  3H6N A;  2KC2 A;  1XF5 L;  1B1Z A;  2AQ2 B;  3ZYY X;  3WIM A;  4DWF A;  2C7H A;  3NS1 A;  2G4S A;  2W82 A;  3JW0 X;  4KDI C;  2DLB A;  4IUM B;  2DYM A;  5EDS A;  2BF8 B;  3H7P B;  2WGS A;  1KJT A;  4ANW A;  3VTW A;  3NZS A;  4LK0 M;  2DNF A;  4AP4 C;  4W9H A;  1CJE A;  1JW9 D;  2ZEQ A;  1WXA A;  4OZA A;  4LNO A;  1RFK A;  1V2Y A;  1WE7 A;  1TKY A;  1WI0 A;  2D3C A;  2LI5 A;  2V3N A;  2A5U A;  4GLS C;  2EMS A;  2L0F A;  4EUT A;  5JXV A;  1P7E A;  4TKN A;  3W1Y A;  2AWT A;  2XBB C;  3GP7 A;  4YSX B;  2WXP A;  3AE2 B;  2ZJD A;  1FFV A;  3W5U B;  3RFZ B;  1YIW A;  1OEY J;  2VH1 A;  3X0W A;  3N32 A;  1XLQ A;  3R66 C;  4DXA B;  2IO1 B;  3PS6 A;  3R2I A;  3V05 A;  2V3P A;  3H8H A;  4HKZ E;  4TV3 A;  3KWL A;  2LXC A;  3EFU A;  1SB3 C;  5BYS A;  2IGG A;  4NAW B;  2HD5 B;  3QWZ B;  4FHJ A;  4A6Q A;  4IWO A;  1I7H A;  1NYR A;  3DQV A;  1F9J A;  3H7P A;  4US9 A;  2MBE A;  4C7Z A;  4TUU A;  2GLS A;  2RD0 A;  2RPQ A;  2BYE A;  3SDL C;  3CWI A;  2WP9 B;  2WS3 B;  1JWU D;  5FR3 A;  3BY4 B;  5BYR A;  5JHA A;  4JQW C;  1GUA B;  2BBC A;  1TKG A;  1Z2M A;  1SF0 A;  4PS3 A;  1XQQ A;  2FCS A;  1WXS A;  1ZP0 B;  1WGY A;  2Z59 B;  5C1Z A;  2REX A;  2L7R A;  4HKQ A;  2QIL A;  3K9P B;  4GGQ A;  4A55 A;  3FC4 A;  3MHS D;  4J3O D;  4MJS B;  4M0W B;  2GI9 A;  1L0X B;  2WX0 A;  4OZB A;  4NPN A;  5IAA C;  1E7P B;  4BKS D;  1QQR A;  2BYV E;  2B76 B;  1MG8 A;  2V4L A;  3AV8 A;  4ACF A;  3AMZ A;  4BAX A;  3KWV A;  2N9E B;  3GS2 A;  2JX5 A;  4NNJ B;  2N4F A;  4L2Y A;  4W9E A;  4P1B C;  2DAF A;  3JVZ X;  3DVG Y;  4AS1 A;  3LDZ E;  1MG4 A;  2K22 A;  3DVN V;  3WAO A;  4HCP B;  1YD8 U;  4MH0 E;  2NBW B;  2UWQ A;  2VZK D;  3BK2 A;  4KV2 A;  1FPY A;  3DBH I;  1XT9 B;  4CO7 A;  4FJY A;  3NRZ A;  2O2V A;  4OVU A;  4HEA 1;  1C78 A;  4YL8 A;  3BZD B;  4NAW A;  4KIK A;  2X8X X;  3Q6B A;  5IO9 A;  2DHZ A;  4HPM B;  5G55 A;  4NY0 A;  1RLF A;  3V61 A;  2LGD A;  4XX5 A;  3P42 A;  1SEB D;  3EUB 2;  4GIV A;  4OVZ A;  4PYU A;  4GSW A;  3DCG A;  1D3Z A;  3I63 C;  1E7U A;  3U2S C;  2MJD A;  3QQ8 B;  4FXC A;  4IM0 A;  3E9S A;  1FNV A;  2JRI B;  4MEM A;  1XXG A;  3AE5 B;  1OQY A;  1TZO A;  1NDD A;  1ZE3 D;  4MT5 A;  5D7G A;  2JWZ A;  4BOZ B;  4NJ6 A;  2CHX A;  2D07 B;  1MVK A;  2WXK A;  2TSS A;  4JL9 A;  2O2V B;  1IGD A;  3RUL A;  1YQ3 B;  3EGR A;  3IFW B;  1CMX B;  5HFY A;  2WNM A;  5CX3 A;  3PSE B;  4UDU C;  4BKT A;  3Q14 C;  2V1Y A;  2K6D B;  1IYF A;  2NPT A;  2D11 A;  1S3S G;  2N9K A;  2LVO A;  2DBY A;  2WXM A;  2C7M B;  4JWU C;  1KFY B;  3HVZ A;  3VRA B;  2MLB A;  3A9K A;  2EEL A;  1RFA A;  2JUO A;  5AUI A;  3VUY A;  1WZ0 A;  1GAQ B;  1Q0W B;  2KMA A;  3AEC B;  3VUX A;  4LLG M;  1L2N A;  4PYZ A;  3ZNI D;  5LNK 1;  3Q8F A;  1V97 A;  3U52 E;  2KYW A;  2SAK A;  1V1P B;  2EKI A;  3BYY B;  2JVC A;  3IBE A;  1P1A A;  2WXN A;  4BBN C;  2XN9 C;  4GB9 A;  2HTM E;  4N58 A;  1VDV A;  3PGE A;  2JF5 A;  3AN1 A;  3Q3M C;  2K3U A;  2WX1 A;  3W9C B;  4JIO U;  4RGM A;  4NZL B;  1GOZ A;  1J7B A;  4HK2 A;  4K7U A;  3A1Q A;  4ZRQ A;  1T0S C;  3KW5 B;  3BVZ A;  4HRS A;  3RNE C;  3SHQ A;  2N0S B;  1CQV A;  3W2D A;  2PTL A;  3W1S C;  4AOF A;  4ANU A;  1C4C A;  2KX0 A;  3V3X A;  5FK9 C;  3RCZ A;  1T0R C;  2W3R A;  3ZDT A;  4DBG A;  2EMT A;  2QSD A;  3L17 A;  4DXF A;  1NEK B;  1ZXI A;  4DDG D;  2JXT A;  4BZA A;  1J0G A;  2IGH A;  4WWO A;  3UIP B;  1P98 A;  4HJK A;  1UEL A;  3ONS A;  3URY A;  4WJQ A;  3PO0 A;  3DBR B;  2AEH A;  3KYC D;  1A70 A;  3ZNH B;  3RUI B;  4FAD A;  1XCQ L;  2N7E A;  4W9C A;  3M63 B;  3A33 B;  4H2A A;  1YOV B;  1AAR A;  2N9X A;  5JZE B;  1G6J A;  2D5G A;  3T3O A;  4EEW A;  1HTQ A;  2CKH B;  1WJU A;  2Y5C A;  1WM3 A;  3U30 A;  2C60 A;  4P1C C;  5EE1 A;  3EHV A;  4C56 C;  5HHD G;  1LM8 B;  1SXT A;  4ICV A;  4ITK A;  4GDL B;  1GPX A;  4YT0 B;  1VD2 A;  1DGJ A;  1TIF A;  4DQO C;  2RPV A;  2LVP A;  4Q2J A;  2YVC A;  4I6P A;  3ZW3 A;  5IOI A;  3RT3 B;  4F1S A;  1TTN A;  1SJE D;  2ZPY A;  1C4P A;  2V0G A;  3N1X C;  1I42 A;  3P63 A;  1D5M C;  4IW0 A;  3PT2 B;  3AEB B;  3UIO B;  5E6P A;  2QEJ C;  2MH7 A;  1L4D B;  2KQ7 A;  2L3Z A;  4GN1 A;  1MFW A;  1V49 A;  3GOE A;  1EWC A;  3TMP B;  3RPF C;  2KQS A;  3TJP A;  1E10 A;  2MJE A;  1C77 A;  1JWM D;  4ANX A;  3PVL A;  2GBN A;  2MSE D;  4R3D A;  3SFE B;  2LJ5 A;  4P6V F;  1E5W A;  1P7F A;  4IM2 A;  4W9D A;  2FUH B;  1HQR D;  5GMV A;  4JE3 B;  1EWY C;  2DYO A;  3ZRC A;  1EM7 A;  4RH6 A;  4ICU A;  1QT9 A;  3M62 B;  2QC8 A;  3HK0 A;  1AW7 A;  4KZ0 A;  3HIZ A;  2MWS B;  2J0K A;  1SIF A;  3RI7 C;  4JGH B;  4WUR A;  3FIL A;  1FIQ A;  1VJK A;  2FCN A;  1IBX A;  4WH4 A;  3Q69 A;  5LXI B;  4KGT A;  2AQ1 B;  4A90 A;  1FCC C;  3JSV B;  1D4B A;  1V86 A;  2K8C A;  3TEX A;  2KFJ A;  1YMH E;  3GE3 C;  2N9P C;  3P2B A;  2BS4 B;  3S2A A;  4HXD A;  3ZVV A;  1M4V A;  2L52 A;  5KHQ A;  3Q8E A;  2BGF A;  2AX5 A;  4AJW A;  1JWS D;  3VTV A;  4ZYS A;  2DWQ A;  1VZ8 A;  2O6V B;  3LB8 C;  5FR6 A;  3MTN B;  2KKC A;  3VUW A;  4MGY E;  4EZJ A;  3EC8 A;  2ZNV B;  5J18 A;  4DHZ E;  2KMM A;  1J19 A;  2PE6 B;  5CHV C;  1SE9 A;  3AM9 A;  4ARC A;  2NBU A;  4BBN F;  3L16 A;  2DX5 B;  3WAN A;  4A9A A;  4G50 A;  2C9W B;  2QHO A;  3TUO A;  1UNS A;  1EF5 A;  2MJ3 A;  1E0Z A;  1ET9 A;  2WQY B;  2KDF B;  2WXI A;  1YN5 A;  2LHD A;  1UH6 A;  1XLN A;  3NVV A;  4B95 A;  1C76 A;  3DWM A;  2KZR A;  2WXQ A;  1EUV B;  2D3B A;  3R8B A;  2LHE A;  1WIA A;  4LNN A;  1WGH A;  2IO3 B;  3NVW A;  1TY0 A;  5HI1 A;  4DHJ D;  1XLP A;  4AUQ C;  3SU8 X;  2Z0D B;  1WX9 A;  4IOI E;  2G1E A;  4G0N B;  4WAA A;  5DPT A;  4EKU A;  4I6L B;  2KTR A;  3E56 A;  4M8N A;  2M0X A;  5HKH A;  3FAH A;  1JWA D;  4E74 A;  1TKE A;  4WQM A;  1V80 A;  3HRD D;  4HCN B;  2KTR B;  2LGX A;  3N30 A;  2IZV B;  1KM7 A;  1KH0 A;  3B1L X;  1WFY A;  1R4M B;  4LCD E;  5LLI A;  1WWT A;  2NPT B;  2W9N A;  1AN8 A;  2K39 A;  3WAM A;  3AI5 A;  2JRH A;  2FID A;  4FHK A;  1ACC A;  2KX3 A;  2WXJ A;  2GBM A;  4BOS C;  1I35 A;  1IUE A;  3PZ7 A;  1XCT L;  2KT7 A;  1FEH A;  1LGR A;  4K7W A;  3SFD B;  4K3C A;  5DPW A;  2ASQ A;  3VR9 B;  2QCZ A;  3UI3 A;  4GMV A;  1LXD A;  3ZNG C;  3L10 B;  3ZGZ A;  2MBO A;  1TZ1 A;  2OOB B;  2KMC A;  4C80 A;  1V5T A;  1SE4 A;  5J17 A;  3MJW A;  2LRW A;  4AJY B;  1QOF A;  1PGB A;  2WYQ A;  1H8C A;  2WDQ B;  1TS2 A;  4LTU A;  1L0Y B;  3PTF C;  3AXC A;  2JSV X;  5BO4 B;  4A20 A;  5T8I A;  1L6V A;  1T6B X;  2FNJ B;  1QOG A;  3QHT A;  2G3Q B;  3P1M A;  3VH3 B;  4WJO A;  1GB4 A;  3QA8 A;  1JQ4 A;  2KAJ A;  4TSS A;  5IN7 A;  4XWW A;  2H89 B;  2I2Y A;  2M17 A;  1UUP A;  4HLE A;  5BMI A;  1KLU D;  1WXV A;  3GZN B;  4DHZ B;  4MAC A;  3R2T A;  1DOX A;  3I3T B;  4ZHP A;  2BS3 B;  2ICI A;  2JYE A;  2IBI B;  3H1U A;  4KSK C;  2DZI A;  3Q3F A;  3MC0 B;  2KC1 A;  5E6N A;  2FAZ A;  4I6N B;  3N20 C;  2X38 A;  4IWQ A;  3IHP C;  3L4P A;  2MBH A;  1WRD B;  1K8R B;  3ML8 A;  2L76 A;  2KO3 A;  1L0V B;  3ZXR A;  2MP2 B;  2ZVO A;  2EKE C;  2Y5B B;  5BMG A;  1KRH A;  2D3A A;  1XO3 A;  5L95 C;  1T0Y A;  2JPH A;  2BYT A;  3NOB A;  3HM6 X;  3WCQ A;  2G45 B;  4S0R A;  2HTH A;  2IY0 B;  1QZE A;  1YQB A;  3HM3 A;  2PVO D;  2E3T A;  3CF6 E;  1I4R A;  2KLG A;  1F77 A;  2W3S A;  3DBL I;  3P4S B;  3J9C A;  1MHH E;  1PDX A;  1NVI D;  2D3G A;  2ZW1 A;  4TQ1 A;  5HG2 A;  1R4N I;  4C7Y A;  4RCO A;  3KLS X;  2K8H A;  2NCN A;  2QDF A;  1YN4 A;  2OHF A;  4W9K A;  2KNB A;  2MA9 B;  3BK1 A;  3ECI A;  4TMA B;  1C3T A;  2J0M A;  4YTM B;  1P3Q U;  3Q8B A;  1EF1 A;  3RZW C;  2J0J A;  1V1O A;  3BYT B;  1FRD A;  5E6J A;  3T9L A;  2YLM A;  5CHF A;  1ISN A;  1ESF A;  1FM0 D;  1SE3 A;  2BPS A;  1C9F A;  2LJI A;  1HZ5 A;  4D2K A;  2KHW B;  2Q5W D;  3W5V B;  2KFK A;  1WMH B;  1KTK A;  4M00 A;  3WA0 A;  4EOY A;  4WWN A;  2UU7 A;  2KLC A;  1XD3 B;  2LD9 A;  3HVD A;  1TYG B;  2JXX A;  3L54 A;  1WMH A;  2K9X A;  2KFK B;  1JRU A;  1J7C A;  4ZOH C;  5EE9 A;  3PRE A;  2KWV B;  4C4V B;  1YX5 B;  2IJ0 A;  2PW9 A;  3HUI A;  4RGT A;  1NYQ A;  2BB5 A;  3RZF A;  1E9M A;  3ALB A;  4B0M A;  2KJR A;  1L5P A;  3H7S A;  3KQ4 A;  2KWU B;  2GB1 A;  3UIN B;  4B9K A;  4USA A;  4ZHO A;  1XLO A;  4AQ7 A;  2Y3A A;  3ZDM C;  4EE2 A;  2BVC A;  2IND C;  3P4P B; 
#chains in the Genus database with same CATH homology
 3P4R B;  1C77 A;  1ZUD 2;  1JWM D;  4LK0 M;  4RNA A;  5H8Y E;  2N7J A;  4R3D A;  3SFE B;  4P6V F;  1QOB A;  2WXR A;  1P7F A;  1CJE A;  1JW9 D;  1VZ7 A;  4OZA A;  3LXF A;  1HQR D;  1RFK A;  4JE3 B;  1R7S A;  1EWY C;  2DYO A;  1TKY A;  4MH8 A;  1EM7 A;  4RH6 A;  1QT9 A;  2IPK D;  1AW7 A;  2V3N A;  3TSS A;  4GLS C;  3VRB B;  5JXV A;  1DYQ A;  1P7E A;  2M56 B;  1K53 A;  2LFI A;  1UWX A;  2CJN A;  4YSX B;  3GP7 A;  1AWD A;  2AQ3 B;  2WXP A;  3AE2 B;  3O13 A;  2LEK A;  4WUR A;  3FIL A;  1FIQ A;  1IBX B;  1VJK A;  1FFV A;  2L32 A;  4O1N A;  3FIL B;  1J7A A;  1VZ6 A;  4WH4 A;  1IBX A;  1C79 A;  3Q69 A;  3AED B;  1PUT A;  1ZDV A;  4KGT A;  2AQ1 B;  3W5U B;  3U7Z A;  1FCC C;  4A90 A;  3RFZ B;  3AE7 B;  2M19 A;  2IDY A;  1D4B A;  3TEX A;  1YMH E;  3B2G A;  1ZPS A;  1XLQ A;  1FXI A;  1BXT A;  4KKJ A;  1YJJ A;  1K51 A;  3R2I A;  3V05 A;  2V3P A;  3H8H A;  4HKZ E;  3KWL A;  2BS4 B;  1ZDX A;  1DOI A;  2WDV B;  1M4V A;  1FO4 A;  1SB3 C;  1V1P A;  5BYS A;  2L52 A;  2IGG A;  4NAW B;  3I9V 1;  1HZ6 A;  3Q8E A;  3DWG C;  2AX5 A;  3P4Q B;  4WAF A;  3Q8A A;  1WRI A;  2CJO A;  1JWS D;  4A6Q A;  4ZYS A;  1MPE A;  2DWQ A;  1I7H A;  1VZ8 A;  1NYR A;  3LB8 C;  4JWS C;  2FE8 A;  4US9 A;  3NUH B;  5G5H A;  1TY2 A;  4C7Z A;  2KMM A;  2CU3 A;  3BVM A;  3IAS 1;  1EU4 A;  5H92 C;  1I4G A;  2FUG 1;  2ON8 A;  1OQR A;  3CWI A;  3AM9 A;  4ARC A;  2WP9 B;  2WS3 B;  1CK1 A;  1JWU D;  5FR3 A;  2Z8L A;  4B0E A;  2NMQ A;  1T3Q A;  2KDM A;  5BYR A;  2OED A;  2WLB A;  3EA6 A;  1N5X A;  4A9A A;  2BBC A;  1OFF A;  1TKG A;  1NI3 A;  3P4P B;  1SF0 A;  1N63 A;  4L23 A;  2WU5 B;  3TUO A;  2LUM A;  1UNS A;  1ZP0 B;  2J53 A;  2MJ3 A;  1JRP A;  1Y56 A;  3BWU D;  2E6X A;  1MI0 A;  1E0Z A;  1ET9 A;  2WQY B;  2WXI A;  1YN5 A;  2LHD A;  2W55 A;  3ETR A;  1BML C;  1XLN A;  4HKQ A;  2NTS A;  2QIL A;  3NVV A;  2ACZ B;  1C76 A;  4A55 A;  1QIL A;  3DWM A;  3FC4 A;  4J3O D;  2WXQ A;  1JAL A;  3R8B A;  2QMT A;  2LHE A;  1VR9 A;  1SIJ A;  2GI9 A;  5I4D A;  1L0X B;  4L1B A;  4OZB A;  3NVW A;  1TY0 A;  5HI1 A;  1F0Z A;  1E7P B;  1XLP A;  4RF1 A;  5EE0 A;  1QQR A;  1I4Q A;  2B76 B;  3W1S A;  1F2R I;  3AV8 A;  3AMZ A;  3KWV A;  3GS2 A;  2JX5 A;  4WIP A;  1I4X A;  4HRO A;  4IOI E;  2G1E A;  1NEN B;  4KKI A;  4L2Y A;  1RYJ A;  3E56 A;  2SEB D;  4AS1 A;  1UGJ A;  2K22 A;  2KAC A;  3FAH A;  5G5G A;  1JWA D;  1JWB D;  2BT6 A;  4YWG G;  1FD6 A;  1TKE A;  4WQM A;  2VZK D;  3AE4 B;  1UWM A;  1YQ4 B;  3BK2 A;  1WGK A;  3B9J A;  1E6E B;  3HRD D;  3ABV B;  4GDK B;  4YSY B;  4PT5 A;  2LMC A;  3NRZ A;  3NZ3 A;  2QJL A;  1EU3 A;  4HEA 1;  1C78 A;  3BZD B;  1KH0 A;  4ARI A;  2L83 A;  3MHZ A;  1L4Z B;  2I38 A;  1XEE A;  1WWT A;  2NTT A;  2YEP B;  1AN8 A;  3LYY A;  2BB6 A;  3AH7 A;  1FNW A;  3AE6 B;  4US8 A;  4XE0 A;  1T5X D;  1ACC A;  1B9R A;  3P42 A;  1SEB D;  2WXJ A;  2K5P A;  3EUB 2;  1SJH D;  1IUE A;  4OVZ A;  3PZ7 A;  1XCT L;  2JZP A;  2VZK B;  1SSN A;  3U4E G;  1FEH A;  3U2S C;  4YTP B;  3SFD B;  3VR9 B;  5FKA C;  2MJD A;  3UI3 A;  4FXC A;  3IAM 1;  3E9S A;  1FMA D;  1FNV A;  2BS2 B;  1XXG A;  3TEZ A;  3I57 A;  3ZGZ A;  3AE5 B;  1I4P A;  2JWU A;  1TZO A;  2L1A A;  2RMM A;  3BVG A;  5D7G A;  1ZE3 D;  1CZP A;  4M0W A;  4MT5 A;  4TQ0 A;  2XNA C;  3Q8C A;  3AB5 A;  2J42 A;  4XDD A;  1MVK A;  5AUK A;  1TJE A;  2WU2 B;  2MEK A;  2TSS A;  2WXK A;  1PGX A;  4HJG E;  4C80 A;  1D6E C;  1SE4 A;  1TS5 A;  3AEF B;  1QOF A;  3MFG A;  1IGD A;  1PGB A;  1YQ3 B;  2WDQ B;  1TS2 A;  3EGR A;  2BTE A;  3TEW A;  4LTU A;  1L0Y B;  4RFB A;  1ENF A;  5HFY A;  1D5X C;  2JSV X;  2WNM A;  4YXD B;  1FRR A;  4KGS A;  5T8I A;  1L6V A;  1T6B X;  3GB1 A;  4UDU C;  1QOG A;  1F2R C;  1I4H A;  1LO5 D;  2N9K A;  3P1M A;  2DBY A;  2WXM A;  1GB4 A;  2KQ4 X;  4JWU C;  2KAJ A;  4RGO S;  1JQ4 A;  2N9L A;  4OZC A;  1KFY B;  4TSS A;  3HVZ A;  3VRA B;  4XWW A;  1HXY D;  2H89 B;  4RGN A;  1N5W A;  1JCK B;  2I2Y A;  3AEG B;  5C3J B;  2KN4 A;  1RM6 C;  1UUP A;  1K50 A;  5MPO A;  1C4A A;  5BMI A;  1KLU D;  2EEL A;  5AUI A;  4MAC A;  3R2T A;  1DOX A;  3IXS A;  2FBW B;  2YEP F;  5BMH A;  2V4I B;  1GAQ B;  3AEC B;  3IT4 B;  4ZHP A;  4KGR A;  2BS3 B;  4LLG M;  1FXA A;  3AE3 B;  1PYW D;  5LNK 1;  2ICI A;  2JYE A;  3Q8F A;  2LGI A;  1V97 A;  3MC0 B;  3U52 E;  3BII D;  2WXO A;  2SAK A;  1V1P B;  2EKI A;  3BYY B;  1VRA B;  2ZW0 A;  2WXN A;  3N9Y C;  4N59 A;  1N61 A;  2X38 A;  2XN9 C;  2BW2 A;  2HTM E;  4YTN B;  3L4P A;  4N58 A;  2WXF A;  1VDV A;  3AEA B;  1L6U A;  1L0V B;  1GB1 A;  1HEZ E;  5D3I B;  4WWM A;  3AN1 A;  5BMG A;  1KRH A;  1QLB B;  2PMV A;  1XO3 A;  2K3U A;  3W9C B;  2R61 A;  1JML A;  4RGM A;  1YJI A;  3MJ5 A;  4NZL B;  2BYT A;  1GOZ A;  1J7B A;  1FFU A;  1MHX A;  4KX6 B;  3NVY A;  3WCQ A;  3IT6 B;  1OQQ A;  3AE1 B;  4ZRQ A;  4XDC A;  3BVZ A;  4HRS A;  2PVO D;  4IDI A;  3VR8 B;  2N0S B;  1CQV A;  3W2D A;  2PTL A;  2INN E;  2E3T A;  1I4R A;  2W3S A;  1F77 A;  1FNU A;  1QKZ A;  2WXG A;  3P4S B;  1C4C A;  3J9C A;  5C2T B;  1WYG A;  3CIR B;  1MHH E;  5FK9 C;  3V3X A;  1PDX A;  1WXQ A;  3T3N A;  1TS3 A;  2W3R A;  1ROE A;  2JQR B;  2QSD A;  3AE8 B;  1QF6 A;  1YN3 A;  1NVI D;  2PIA A;  2ZW1 A;  4TQ1 A;  4DXF A;  5HG2 A;  1NEK B;  4MM3 B;  5GXG B;  2RDH A;  1N60 A;  2W54 A;  4C7Y A;  1ZXI A;  2J52 A;  4RCO A;  3KLS X;  2JXT A;  2Y5P A;  3SEB A;  1KLG D;  1DOY A;  4P16 A;  3VQI A;  1YN4 A;  2OHF A;  1YNT E;  2IGH A;  3AEE B;  2KWD A;  4CQN A;  2WDR B;  4NJC A;  3URY A;  3BK1 A;  4TMA B;  1QOA A;  2G9H D;  5TSS A;  2J4X A;  2QIE B;  3PO0 A;  4YTM B;  3Q8B A;  3C8Y A;  1A70 A;  2K0P A;  3B2F A;  3NVZ A;  1V1O A;  3BYT B;  4NAM A;  1FRD A;  1XCQ L;  5E6J A;  4RF0 A;  1HA5 A;  3OWE B;  2PKO A;  4H2A A;  2PVG C;  1RWS A;  4ZRP A;  3AE9 B;  1ESF A;  1FM0 D;  1SE3 A;  2D5G A;  3T3O A;  1ZXH A;  4XWT A;  1C9F A;  2LJI A;  1HZ5 A;  1D5Z C;  4D2K A;  2M0A A;  1SBB B;  2Q5W D;  3W5V B;  5D3D A;  4YSZ B;  2JYT A;  2Y5C A;  1JRO A;  1KTK A;  2GRI A;  1KF6 B;  3ZQ4 A;  4OW0 A;  1PFD A;  1Q10 A;  4JPS A;  5EE1 A;  4C56 C;  2WXL A;  5HHD G;  1PGA A;  1SXT A;  5BYQ A;  3HVD A;  2INP E;  4N6E B;  5EE3 A;  1TYG B;  4ITK A;  3ZJV A;  4GDL B;  3ZJT A;  4A8X C;  1GPX A;  4YT0 B;  1TS4 A;  2IGD A;  2JU6 X;  1ET6 A;  1DGJ A;  4DXG A;  1STE A;  3ZJU A;  4DQO C;  1VLB A;  1ZOY B;  2RPV A;  1N62 A;  4OHJ A;  2K9X A;  4Q2J A;  1IGC A;  2ONQ A;  3SR6 A;  2RDG A;  1J7C A;  4ZOH C;  3TEY A;  5EE9 A;  1K52 A;  3MP9 A;  1SJE D;  3PZ8 A;  2WXH A;  4REZ A;  2IJ0 A;  2PW9 A;  3HUI A;  1C4P A;  1B1Z A;  1XF5 L;  1NYQ A;  2BB5 A;  4RGT A;  2AQ2 B;  2V0G A;  4IKG A;  3P63 A;  3ZYY X;  1D5M C;  1E9M A;  2HDE A;  4B0M A;  3NS1 A;  1L5P A;  1WSP A;  2W82 A;  3KQ4 A;  4JX1 C;  3AEB B;  1V8C A;  2GB1 A;  2QEJ C;  2MH7 A;  4USA A;  1L4D B;  2DLB A;  4ZHO A;  2PLP A;  2DYM A;  1SE2 A;  1XLO A;  4AQ7 A;  2Y3A A;  4EE2 A;  1EWC A;  3RPF C;  1FCL A;  1BUI C;  1E10 A;  2H88 B;  1AYF A;  2MJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...