1PGAA

Two crystal structures of the b1 immunoglobulin-binding domain of streptococcal protein g and comparison with nmr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title Two crystal structures of the B1 immunoglobulin-binding domain of streptococcal protein G and comparison with NMR.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
molecule tags Immunoglobulin binding protein
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1993-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgaA00
1GB1A 2ZW1A 2JXTA 2JWUA 2OEDA 1Q10A 1FCCC 3UI3A 1ZXHA 1P7FA 1XCTL 2QMTA 4MACA 2KN4A 4GLSC 4KGRA 2JU6X 1F2RC 1KH0A 4IOIE 2LHDA 2KQ4X 2J52A 5HG2A 4HKZE 1MVKA 2JZPA 2LHEA 5BMHA 2KWDA 1MHHE 1PGBA 4OZAA 2NMQA 2EELA 1C9FA 1PGAA 2GB1A 1IGDA 2QSDA 1GB4A 2IGGA 4OZBA 2PTLA 1K51A 2KACA 5HFYA 3GB1A 5JXVA 1YNTE 2PLPA 2LGIA 1F2RI 2GI9A 1YMHE 1IBXA 2K0PA 1HZ6A 2JSVX 2ONQA 1XF5L 1JMLA 2I38A 2N9KA 3MP9A 1EM7A 4OZCA 2N7JA 5HHDG 4IKGA 3FILA 1FCLA 1IBXB 1MHXA 1K52A 1P7EA 2RMMA 5BMGA 4HJGE 2IGDA 2N9LA 4KGTA 2RPVA 1D4BA 2I2YA 2LUMA 1HEZE 1MPEA 2KDMA 1MI0A 2ON8A 4D2KA 3FILB 3V3XA 1UWXA 2J53A 4WH4A 1IGCA 1K50A 1XCQL 2PW9A 1PGXA 4KGSA 1QKZA 5HI1A 2IGHA 1HZ5A 5BMIA 1K53A 2ZW0A 1FD6A
chains in the Genus database with same CATH superfamily
3Q3FA 4EE2A 2IYDB 2G3QB 1V80A 3VAWA 2WDRB 2HE7A 3DDCB 2REXA 1SGHA 2FCNA 4JGHB 3PV1A 2NPTB 3AI5A 2KQ4X 3X23A 3NZSA 3NG0A 1AW7A 2HJ1A 2ZNVC 4DXGA 1C1YB 2HD5B 1HXYD 1FMAD 1T6BX 1L2NA 4EZLA 4LDTD 2MH7A 1XXGA 2JPHA 1V8CA 4K81A 3B2GA 2N4FA 1FXIA 1I4GA 2JVCA 3TUOA 1VCBA 1V1OA 2VZKD 1WE7A 3A9KA 4GN1A 2NBUA 5BO4B 4P7IA 1A70A 2W3RA 1PFDA 1RWSA 5KHQA 3AE6B 2D07B 3DWMA 2N9EB 3W9CB 2IO2B 4NQLB 1HE8A 1V5TA 4OVZA 1K8RB 4BOZB 4FBJB 3DBRI 3ML9A 2V1YA 2WXNA 2L05A 1VLBA 4A3PA 3APFA 3AE4B 3WAMA 3AE9B 1HEZE 4HRSA 3PZ8A 4YSZB 2LD9A 4ARIA 3T9LA 3PLVA 3Q3NC 2D10A 2D3GA 1ZE3D 1UBIA 2ASQA 4J3OD 4N6EB 3ZJTA 5GMVA 2I1JA 1UWXA 5D3DA 2JY6A 4LNFA 1ZDVA 1FO4A 1V1PB 3UF8A 1YN5A 1E7PB 1E9MA 2DHZA 2LGXA 2RDGA 3QJZA 3IXSA 2IDYA 4KKJA 4FADA 2K8HA 2FIDA 2JQRB 3QCAA 1WGGA 1WRIA 4RGOS 3DWGC 4K3CA 4K1RB 3Q3OC 1NI2A 1Y56A 2WXPA 4WQMA 1MVKA 4M00A 5LLIA 3ZNHB 1J0GA 4W9CA 1JWSD 3AU4A 2NR2A 2GB1A 4DDGD 1IGDA 2O2VA 2WXFA 4DHZE 3K9PB 3I5JC 3W1SC 1NVID 4IM3A 2ZVNA 1UH6A 3Q8FA 1T0YA 1AN8A 2M4NA 2Z0DB 4JWUC 2LGIA 2KANA 5TSSA 1J7CA 1JALA 1HZ6A 3VUWA 1YJJA 3DBHB 4RNAA 3KWVA 5EE9A 4MJSB 1ZP0B 2MX2A 1VR9A 1UUPA 3L54A 4WJQA 1FPYA 2C7HA 2BYFA 1IBXB 5LXIB 3J9CA 4S17A 1FFUA 2CR5A 2M0XA 2LJIA 2RPVA 2K22A 3HK0A 2V0GA 2KN5A 1T3QA 4NY0A 3PS6A 1E90A 3NJTA 4D2KA 3L17A 3RT3B 2C60A 3P63A 4M0WB 3VQIA 1J19A 4YXDB 1WGRA 4I6NB 5L83A 3IVFA 2K25A 3AE7B 2JT4B 2K6DB 1RM6C 5BMIA 2JUOA 2INDC 4MGZE 2BKFA 2LZ6A 2LVOA 2WWZA 3PZDA 4HLEA 1XEEA 1ZXHA 1LGRA 2GBMA 1FNWA 4HWIB 2K6QA 3TMPB 4JIOU 1ROEA 1SE4A 3CMMB 5D94A 2LHDA 2C5LC 4GIVA 2DBYA 2H89B 3Q3JA 2IO3B 1H4RA 2J0KA 2WXJA 3ZLZA 2YEPF 2WDVB 3QA8A 3MFGA 2KMMA 3PSEB 2N1WA 3M95A 2N7DA 2KVZA 1YJIA 2G4DB 2ZCBA 2ZPNA 3DVNV 3ZXRA 3L08A 1F77A 2KLCA 4E3CA 3BZDB 5HFYA 1QLBB 2KJ6A 1SE9A 4MDKE 4REZA 2AQ1B 4HROA 3IBEA 3AE1B 3M62B 2N7JA 3MJWA 2Q5WD 1XLPA 3A9KB 3DCGA 1YX6B 3V62A 1P7EA 4L2YA 4HJGE 1WY8A 2CJNA 2N9LA 4MH0E 1D4BA 1EUVB 1RRBA 4BVUC 2KD0A 2WYQA 4GDKB 1UWMA 2SEBD 3SDLC 3DVNU 2J53A 4XC2A 2RGFA 2FBWB 1XCQL 2BYVE 3A1QA 3R3MA 1KM7A 1DGJA 2AWTA 1T5XD 3D32A 4N59A 3UQAA 3KUDB 4G50A 4NJ7A 2MBEA 4ICUA 3W5VB 3ECIA 2DYBA 2LFIA 1GUAB 2ZZPB 1CMXB 1GC7A 1D6EC 3Q8EA 3SFDB 3Q69A 1TKGA 3DBRB 1E8ZA 5BMHA 3NRZA 1JRPA 2FCMA 2C7NB 2MCNB 1LM8B 3LJ3A 2GBRA 4WWNA 3ETRA 4F7ZA 3VR8B 5AZFA 3Q8CA 4BFRA 2N7EA 3ZRCA 2CKHB 2MBQA 4EZKA 2JYTA 3IFWB 3RNAC 1PDXA 3N1XC 4ANUA 1WMHA 5JZEB 2O2VB 5E6OA 3K9OB 4W9IA 1WYGA 4TQ1A 1L0XB 1VJKA 1QZEA 5EE1A 2JZZA 1GAQB 1WRDB 1S3SG 3BYYB 1WF9A 1FXAA 2QDFA 2WLBA 1WGDA 3ZDTA 2J0MA 2IBIB 1L5PA 5DPSA 5IP4D 4FJZA 2A5UA 2BKRB 2WXGA 1KLUD 3AM9A 4N58A 2E3TA 3AE8B 1QKZA 2UYZB 4DHJB 1EWCA 3VFKA 5J2RA 4C00A 1TS4A 2W82A 2INPE 3P4QB 4PS8A 1VZ7A 4MH8A 3CSTA 4RCOA 4YL8A 2AEHA 4OVUA 2ZJDA 3RULA 1M94A 2PJHA 4NJCA 4LNNA 4W9DA 1I4QA 3T3OA 2WDTB 2IY0B 3U52E 2D11A 4A6QA 4MGKE 3MHZA 2KWDA 5AZHA 4YT0B 2V9HA 4JQWC 1PGBA 1YN3A 4OZAA 1WFYA 2M8SA 3DBHI 1EF1A 4RM9A 3RPFC 1SJED 2V4IB 3AXCA 4PK1A 3BY4B 2WXHA 4K7UA 4C80A 2OOBB 2RDHA 4W9EA 3AE3B 1F2RI 4Q2JA 4R3DA 3ZO5B 2MA9B 2V4LA 3N30A 4NAWA 4LJOB 3DVGX 2K8CA 2WX1A 1ESFA 1JWUD 4DBGA 2MBBB 2AYOB 3DQVA 3PRPB 1XLQA 2MQJA 1WJUA 3RYTA 3H7PB 2C7MB 2L83A 2DENB 1UZXB 3W2DA 1KTKA 3U2SC 1TS3A 5LXHA 3ABVB 1WWTA 2MEKA 1WR1A 2ON8A 4GXBA 1WSPA 4H2AA 1U4AA 1Z2MA 1V97A 3VRAB 2M17A 1ZDXA 2KMAA 4AOFA 1SXTA 5DCNA 1YX5B 1GOZA 2YEPB 4M0WA 2WXMA 2KDIA 3DBLI 1AYFA 3OLMD 4HCPB 3APDA 3SHQA 1HTOA 3AE2B 4XDCA 2O6VB 3A9JA 2JXTA 2XN9C 1SE2A 3UI3A 1XD3B 3DBSA 4MACA 5C3JB 3AECB 4MGYE 1D5ZC 1D5XC 2DWQA 4FJVB 2BS3B 3Q14C 4GU2A 2J52A 2KYWA 1TS5A 3TJPA 5IKCM 2JRHA 1KFYB 1WXSA 1YJ1A 2EELA 4YTMB 3GZNI 5AUKA 1WX8A 4IM2A 3KUCB 3R2IA 1YOVB 5CTRC 1CK1A 4EEWA 1GG3A 3URYA 4YWGG 4MSMB 1BT0A 1VZ6A 2KACA 2AQ3B 2KNBA 4TKNA 5JXVA 4LCDE 3RNFC 4JE3B 2AL3A 4J6IA 3B9JA 3H8HA 1WM3A 3RNBC 2KJRA 1J7AA 3PREA 4F8CB 2L0TA 2BS4B 1WMHB 5IOIA 3B1LX 1UGJA 4ARCA 2JXXA 2VH2A 4ZYSA 4W9FA 4IG7B 3KVFB 2NTSA 2M1MA 1FFVA 5EE0A 3O13A 1CZPA 3TBLD 4A20A 2L52A 4FULA 1N61A 1YIWA 2JX5A 3Q8BA 4EOYA 1KJTA 4KDIC 4GDKA 3U8ZA 2K8BA 2CJOA 5C23A 1IGCA 2BW2A 5HI1A 2YVCA 4QAYA 1R7SA 4USAA 3TEYA 1T0RC 2ZW1A 3H9DA 1E8WA 2D2QA 1KRHA 2UWQA 2JWUA 2OEDA 3KW5B 2KVRA 3RN9C 2KJHB 4XE0A 3ZIMA 5MPOA 3JVZX 2JU6X 4MM3B 3H6NA 2D3CA 3BIID 4UDUC 4NNJB 3RZFA 4G3XB 2XBBC 1WH3A 1T0SC 1OEYJ 2E6XA 1GC6A 4WAAA 4CYEA 1TY2A 3EHVA 1TYGB 3NHEB 2KMCA 3R7RA 2KWUB 1RLFA 1V6EA 3QARA 2BF8B 2IGGA 4EZJA 4OZBA 1FNVA 2WXRA 4CHKA 3R7QA 4HPPA 2PPHA 3CWIA 4XYCA 5IA7A 3OJ3A 2V3PA 2JF5A 3EECA 3PRZA 1YMHE 2J4XA 2WHIA 5D7GA 4IW0A 1OQRA 2JSVX 1TY0A 2EKEC 1JMLA 3N1ZC 5G5HA 1AWDA 1I4RA 3WAOA 1UGMA 4E74A 3A4SC 3L16A 4JL9A 5HHDG 2SAKA 4FXCA 1N5WA 2CHZA 1MHXA 2LRWA 2Y5BB 5GXGB 1G6JA 4NAWB 1SSNA 2IGDA 5EE3A 4ZYNA 3UIPB 3GS2A 2L7RA 1E8XA 2N9PC 1WX7A 1R4NI 2I2YA 2OJWA 1Q0WB 4OW0A 3Q6BA 4AUQC 4TSSA 2LGSA 1DOYA 4BBNC 2PVOD 2TSSA 2OJRA 2MRPA 2IGHA 3KLSX 4DDID 1GNUA 2B76B 3RI7C 1OEYA 1FD6A 3AV8A 3L13A 1WXQA 1F9JA 2LRUA 4IDIA 1L7YA 4IWOA 2QILA 4II3B 4B0EA 2BWES 2K39A 2KTRA 1XLOA 1A5RA 4IOIE 2AX5A 4XDDA 4HKZE 1YQ4B 2JZPA 4EFOA 3A9JB 2LASA 3VH3B 3NY5A 2Z8LA 2MWSB 1MHHE 2M19A 3RMKC 3DPDA 5DPWA 1TKYA 2WS3B 1Q1OA 4K7SA 2YLMA 1DOIA 3QAQA 1OGWA 3OJ4B 4WAFA 3GB1A 4P6VF 2KZRA 3DBLB 4A55A 3ZNGC 3AEAB 1IYFA 3HM6X 4EUTA 3MP9A 2NTTA 2QC8A 4M8NA 2KC1A 4K3BA 3AE5B 2KHWB 4IWPA 3ZTDA 5BMGA 3GE8C 1RAXA 1MJDA 3ZKJC 1PUTA 1LO5D 3GZNB 3IT4B 2QEJC 3H7PA 2QIEB 4AJYB 3FC4A 4M01A 2QCZA 2PE9A 2KFJA 1C76A 3BVGA 3HRDD 3FKYA 4K7WA 3CIRB 1TGZB 1HZ5A 3GP7A 2L00B 4HJKA 3EGRA 1UELA 1K53A 2ZW0A 2JZ3B 4FN2A 1FRRA 2HJ8A 2FE8A 3BYTB 3MJ5A 1HA5A 3ZQ4A 2FUHB 2LEKA 2O6VA 3N1YC 4YTNB 1NI3A 4IWQA 1J8CA 3MC9A 4HEA1 1V2YA 2KK8A 3EC8A 5H8YE 2CU3A 4MGIE 1HTQA 2N1VA 2GLSA 4YTPB 2MJEA 3EFUA 3N3KB 2LVPA 2QSDA 4KSKC 3TEXA 2PMVA 5E6JA 1DYQA 1OQQA 2D3AA 3PHWB 1YQBA 2QHOA 1WZ0A 2KDFB 2MP2B 2L3ZA 4KVGB 1UF0A 4P1CC 3ZJUA 1UD7A 4BOSC 2GI9A 4ANXA 3AEGB 1BUIC 3HIZA 4OZCA 2ZVOA 4IKGA 1ZOYB 4DK5A 4YSYB 3KYDD 3FILA 1E7UA 4WWMA 2CS4A 3KH0A 4C7ZA 5G55A 2M0AA 2W54A 2BWFA 2LI5A 4ITKA 5CX3A 1WGKA 2IPKD 2LUMA 3JSVB 4ZHPA 3BVMA 1VZ8A 1L4ZB 4ZDVA 1ACCA 3DHIC 4ZRKA 3SU8X 4LNKA 3VUYA 1PGXA 3FAHA 4ICVA 4IM0A 1I35A 4JLCA 1WJ6A 4NQKE 1EF5A 3WA0A 4KDLB 3IAM1 2ZNVB 1V81A 4RF1A 4JX1C 3R8BA 1F1HA 4G11A 4BKGA 5JHBA 4BKSA 1P1AA 2C9WB 4HDQA 3M3JA 4NAMA 2G1EA 4G0NB 1WM2A 2HDEA 3ZVVA 4DQOC 2X38A 3UIOB 4MM3A 4URKA 1R4NB 4AQ7A 4C56C 1B9RA 2IJ0A 3DHGC 3ZW3A 4FA6A 1LFDA 3V05A 2KTRB 1WJNA 1SEBD 4XX5A 1X1MA 5KHOA 1TBEA 3I9V1 1NENB 1I7HA 3VRBB 4WIPA 1YNTE 2PLPA 3OG5A 4EKUA 1WGYA 2GBKA 1QQRA 1TZOA 4KZ0A 3TEWA 1XF5L 3RNGC 2BYTA 4B6WA 2ICIA 4HK2A 2JYEA 2G4SA 1TJEA 2K3UA 4WJNA 1C79A 1T0QC 4ZRIA 3NS8A 3M63B 2KX0A 4DHJD 3L0WB 3TCAA 2V3SA 4PYZA 3H7SA 2DYOA 2J7QB 1OTRB 2L32A 2X8XX 3Q3MC 3ZYYX 3CF6E 3GOEA 1C77A 2ZCCA 2MJ3A 2R61A 4B9KA 3QHTA 3KWLA 2BQQA 4OVVA 3WCQA 2INCC 1C78A 5EDSA 3PTFC 1JQ4A 3HUIA 1WE6A 4CO7A 5DPTA 2WX0A 1B1ZA 4ANWA 1SF0A 2EMTA 2BPSA 1WXAA 2KC2A 1ZXIA 3ZJVA 4RGMA 4DWFA 1RFAA 4HDOA 4ZRPA 1KOTA 1XCTL 3OAWA 4GLSC 1FEHA 2WXKA 2N9XA 3P4PB 3N9YC 3RFZB 3V61A 3P4RB 3IAS1 4KIKB 3QWZB 2J0JA 2QJLA 4S0RA 3I3TB 3AH7A 4XZ4A 4BZAA 2LMCA 3P42A 5TR5A 3KYCD 3SD5A 2EMSA 4PT5A 1QOFA 1UBQA 4CQNA 4WQOB 1K51A 3R66C 2LJ5A 3U4EG 3WALA 3AN1A 3PRMB 1Y8RC 3T8MA 1BMLC 2MJDA 2LXAA 3NVYA 1QF6A 1P9DU 4B95A 2WGSA 3KQ4A 1R4MI 3APCA 4KKIA 4NPNA 4LDTB 4TMAB 1QILA 3C8YA 2RMMA 2ACZB 2O6VD 3E9SA 4RFBA 4FHJA 4L1BA 4KGTA 2R2OA 4A90A 1D3ZA 4A8XC 1H8CA 2VZKB 3T3NA 4WWPA 1MI0A 5C1ZA 3UQBA 1AARA 2MSED 3FILB 2G9HD 1E0ZA 2AQ2B 2PKOA 4HCNB 2VRRB 3V60A 1L4DB 4AWJA 4C7YA 1I4XA 1LXDA 1K50A 4IC7B 4KGSA 1F0ZA 1MG4A 4BAXA 1CQVA 2FCQA 3HM3A 3L10B 1TTNA 4FHKA 1D5MC 4ACFA 3SEBA 5BYRA 4GSWA 1GB1A 3AMZA 1GPXA 2XNAC 3BK1A 2RD0A 3PGEA 2A4ZA 1P7FA 2L8JA 1ISNA 1Q5WB 3X0WA 1ZKHA 2XEWA 1TIFA 1QT9A 2WXIA 3PVLA 5FK9C 4GMVA 2GMIC 3EUB2 4E71A 1QOBA 1L0VB 1UNSA 2Z59B 3NS1A 5IO9A 4AS1A 3AU5A 3QK0A 3JYUA 2WXOA 3AEDB 1E8YA 4XWTA 3ZNZB 4RF0A 4ZRQA 1GB4A 4LJPB 3WIMA 5T8IA 2FIFA 2WXLA 3ZRFA 2MHJA 1F52A 3S2AA 4US8A 1SBBB 3VUXA 1OFFA 2KX3A 2K9XA 3N20C 3ZTCA 2LUEA 5JH5C 3AEEB 2DAFA 3OWEB 4ANVA 2MP2A 1JW9D 1VD2A 3V6EB 4WJOA 1YD8U 3CSFA 1SIFA 4W9GA 4LK0M 5E6NA 3A4RA 1JCKB 2MBOA 1C4CA 1VDVA 3ALBA 5G5GA 1PQSA 3NVVA 3MC8A 4B0MA 2ZPYA 4BKSD 1Z5SB 2LGYA 4I6PA 4ZHOA 1LQBA 1MPEA 2FCSA 2IO0B 2FAZA 4DXFA 3I57A 1E7VA 3VTWA 1MFWA 3JSVA 4OHJA 5J18A 2PW9A 5D2MB 3JW0X 4W9LA 2MW5A 3EA6A 1M4VA 3NUHB 2CU1A 2H88B 3LB8C 5LNK1 3VTVA 5DPRA 1WX9A 2QMTA 2IO1B 4P16A 4WWOA 4KGRA 1L6UA 1KH0A 1XQQA 3BVZA 2BB5A 2Z0EB 4X57B 3NZ3A 4HKQA 1TZ1A 2RSUA 1WI0A 2W55A 2M56B 1EWYC 1QOAA 2DYMA 1DOXA 3RUIB 2UU7A 3U30A 3RZWC 3PZ7A 3P2BA 3C19A 1E6EB 4FJYA 3UGBB 2WNMA 4HXDA 4KV2A 2KOXA 1N6ZA 2KWVB 4RGNA 2I1KA 2KT7A 3LXFA 3NVWA 1C4AA 1L6VA 5AUIA 2KQ7A 3BK2A 4DHZB 2D5GA 4M8MA 2ZEQA 3W5UB 3UINB 4GDLA 1EM7A 5BYSA 5IN7A 3VXWA 2L0FA 2KQSA 1FCLA 2KFKA 2JRIB 4GOCA 5H92C 3AULA 4F1SA 1MG8A 4PS7A 1TKEA 3PHXB 2NCNA 3VR9B 1SB3C 4AP4C 2KDMA 3V6CB 4XWWA 1QOGA 3NZUA 4AJWA 3DOWA 1I4HA 3VDZA 2DX5B 1PYWD 4WH4A 3SR6A 1ZGUB 1FXTB 4KSLC 2KAJA 2K5PA 3R2TA 2PEAA 5E6PA 1TT5B 4I6LB 1C4PA 2CHXA 3ZXVA 3Q8AA 2XK5A 2HTHA 3N32A 1Q10A 4M02A 4BBNF 1IPGA 1R4MB 1WJ4A 5J17A 5D6JB 5IAAC 1C3TA 4FLHA 1E5WA 1I42A 3O65B 5HG2A 1ZW7A 2KDEB 4W9JA 4RH6A 2R2QA 2Y5CA 2DNFA 3W1SA 1XLNA 2IZVB 2NMQA 2DZIA 1FNUA 3I63C 5CHFA 1P98A 2GOWA 4US9A 1ENFA 1J7BA 2RDBC 4KIKA 5D3IB 5G2NA 2PVGC 1BXTA 3HHMA 2BGFA 2MLBA 2PTLA 2KWCA 3MHSD 3VHTC 3DVGY 5BYQA 1I4PA 4C4VA 1N63A 3TEZA 4KX6B 2K0PA 2JWZA 2Y5PA 2AL6A 2LVQA 3RNCC 4A9AA 4MT5A 4TUUA 2BB6A 2IY1B 2I38A 3ML8A 1KF6B 3LYYA 1L0YB 2EKIA 2KKCA 1CJEA 3WAPA 4JWSC 2DAJA 4TQ0A 3NOBA 3P1MA 5FR3A 2MBHA 1S1QB 1K52A 3QQ8B 4RMAA 1FM0D 2GRIA 4RM8A 1ET9A 4PYUA 3QIJA 3QC8B 1JWAD 1XO3A 3B0AA 1EU4A 3B2FA 3ZUNA 3U7DA 1V9JA 2FNJB 4ZOHC 4ASWC 1KLGD 4DXAB 1WIAA 2RR9A 4KZCA 2NPTA 2Y3AA 3H1UA 1V49A 3TSSA 3PPAA 1FCCC 3DHHC 1TS2A 4N9F4 2J42A 1FIQA 1YQ3B 2NS5A 2NBWB 2KN4A 1V86A 1WXMA 1F2RC 5AZGA 1SJHD 1XT9B 5FKAC 3TIXA 3IT6B 1FRDA 1P0RA 1VRAB 1WGHA 2LHEA 2LWPA 3P4SB 3RNEC 3IHPC 4YSXB 2WXQA 1NBFC 2W3SA 1IP9A 2BTEA 3HVDA 4PS3A 3PO0A 3MC0B 5JHAA 1EU3A 5AEKB 1WR6E 4GB9A 4LNIA 2L1AA 4MSQB 1NEKB 4JPSA 4A3OA 4W9HA 3TL5A 5I4DA 1E10A 3VVWB 1IUEA 1RYJA 2RPQA 2HTME 3ENEA 2K1FA 2DZKA 1ET6A 2DZMA 2WDQB 3ZDMC 5L95C 3MTNB 4LNOA 3RD2A 5CHVC 1V1PA 4GDLB 3L4PA 2FUG1 4W9KA 4L23A 1JWBD 2G45B 4GGQA 2KFKB 4XGAB 3HVZA 3KUZA 3V3XA 1GJZA 3BWUD 3RCZA 1YN4A 4ZRJA 3QX1A 3AEBB 2NBVB 3SFEB 2INNE 3ONSA 4MELA 1RFKA 4WJPA 2GBNA 2V3NA 4TV3A 4P1BC 2OHFA 4IUMB 5C2TB 1OQYA 2CHWA 2KO3A 3ZNID 1JROA 4MEMA 1STEA 2XK5B 5CHWA 2VH1A 2N0SB 1HQRD 1SE3A 1EO6A 1C9FA 1PGAA 4HPLB 4BKTA 4WURA 3IG3A 3BINA 4HPMB 4MJSA 3B08A 3W1YA 2PIAA 4LLGM 1ZPSA 3Q2AC 2KTFA 3U7ZA 1WZ3A 2BYEA 4O1NA 2PE6B 2B3AA 2NVUI 3WANA 2GBJA 1N60A 5HKHA 1IBXA 1SIJA 2WU2B 2ONQA 5FR6A 2KDBA 3PT2B 2BS2B 2N9KA 4II2B 2L76A 2WQYB 2WU5B 3A33B 3PLUA 1ZUD2 4C4VB 2BBCA 3GE3C 1NYRA 3AEFB 4NZLB 4RGTA 3ZGZA 2WP9B 2DZJA 1P3QU 3VTUA 1WXVA 1N62A 3NVZA 2LXCA 4LTUA 4HVBA 3LDZE 1NYQA 3A1QB 2BVCA 2KLGA 2LGDA 1V5OA 1NDDA 2W9NA 4NJ6A 1JRUA 2BT6A 2DLBA 3C0RB 3VH4B 2D3BA 2KXJA 1WYWB 3AB5A 3E56A 1N5XA 1KLVA 1JWMD 3EFCA
chains in the Genus database with same CATH topology
1M4VA 3NUHB 4RCOA 4EE2A 2H88B 3LB8C 2FE8A 3BYTB 5LNK1 2WDRB 3MJ5A 1HA5A 3ZQ4A 2LEKA 2QMTA 4NJCA 4P16A 4KGRA 4YTNB 1NI3A 1L6UA 1I4QA 1KH0A 3BVZA 3T3OA 2KQ4X 4HEA1 5H8YE 3U52E 2BB5A 2CU3A 4A6QA 1AW7A 3NZ3A 3MHZA 4HKQA 2KWDA 4DXGA 2W55A 4YT0B 4YTPB 1PGBA 2M56B 1EWYC 1QOAA 1YN3A 2DYMA 2MJEA 4OZAA 1HXYD 1DOXA 1FMAD 1T6BX 3PZ7A 2MH7A 1XXGA 3RPFC 2QSDA 3TEXA 1SJED 1E6EB 2PMVA 2V4IB 2WXHA 1V8CA 2WNMA 5E6JA 1DYQA 1OQQA 3B2GA 4C80A 4RGNA 1FXIA 1I4GA 3LXFA 3TUOA 1V1OA 2RDHA 2VZKD 3AE3B 3ZJUA 3NVWA 1F2RI 1C4AA 4Q2JA 4R3DA 2GI9A 1L6VA 5AUIA 3AEGB 1BUIC 3BK2A 2D5GA 3W5UB 1A70A 2W3RA 1PFDA 1RWSA 1EM7A 3AE6B 4OZCA 1ESFA 1JWUD 5BYSA 3DWMA 3W9CB 4IKGA 1ZOYB 4YSYB 3FILA 1FCLA 4WWMA 4OVZA 1XLQA 4C7ZA 2M0AA 2W54A 5H92C 2WXNA 1VLBA 4ITKA 2L83A 1TKEA 1WGKA 3AE4B 3VR9B 3W2DA 2IPKD 2LUMA 1SB3C 1HEZE 3AE9B 1KTKA 4HRSA 3PZ8A 1TS3A 3U2SC 4YSZB 2KDMA 4XWWA 3ABVB 1WWTA 2MEKA 4ARIA 1QOGA 2ON8A 1ZE3D 4ZHPA 4J3OD 4N6EB 3ZJTA 3BVMA 1VZ8A 1WSPA 4H2AA 1I4HA 1UWXA 5D3DA 1L4ZB 1V97A 3VRAB 1ACCA 1PYWD 1ZDXA 1ZDVA 4WH4A 3SR6A 1FO4A 1V1PB 1PGXA 1SXTA 3FAHA 1YN5A 1GOZA 2YEPB 1E7PB 1E9MA 2KAJA 2WXMA 2K5PA 4M0WA 3R2TA 2RDGA 3IXSA 2IDYA 4KKJA 1AYFA 1C4PA 2JQRB 3AE2B 4XDCA 2JXTA 3IAM1 3Q8AA 2XN9C 1WRIA 1SE2A 1Q10A 4RF1A 4RGOS 3UI3A 4JX1C 3R8BA 3DWGC 4MACA 5C3JB 3AECB 1D5ZC 1D5XC 2DWQA 2BS3B 4NAMA 2G1EA 1Y56A 2WXPA 4WQMA 2J52A 5HG2A 2HDEA 4DQOC 2X38A 1MVKA 1TS5A 4RH6A 1KFYB 2Y5CA 1JWSD 3W1SA 1XLNA 4AQ7A 2NMQA 2EELA 4C56C 4YTMB 2IJ0A 1FNUA 1B9RA 5AUKA 2GB1A 4US9A 1IGDA 3V05A 2WXFA 1ENFA 1J7BA 3R2IA 5D3IB 1SEBD 1NVID 1CK1A 2PVGC 1BXTA 3URYA 2PTLA 4YWGG 3I9V1 3Q8FA 1NENB 1I7HA 1AN8A 4WIPA 3VRBB 1VZ6A 5BYQA 2KACA 2AQ3B 1YNTE 1I4PA 2PLPA 5JXVA 4JWUC 2LGIA 1N63A 3TEZA 5TSSA 1J7CA 1QQRA 1JALA 4KX6B 4JE3B 2K0PA 2Y5PA 1HZ6A 1TZOA 3TEWA 1XF5L 4A9AA 3B9JA 1YJJA 4MT5A 2BYTA 2BB6A 2I38A 3H8HA 4RNAA 3KWVA 2ICIA 5EE9A 1KF6B 1ZP0B 2JYEA 2K3UA 1L0YB 1TJEA 3LYYA 1J7AA 2EKIA 1C79A 1VR9A 1CJEA 1UUPA 4JWSC 4TQ0A 3P1MA 2BS4B 5FR3A 1UGJA 4ARCA 1IBXB 3J9CA 1K52A 4ZYSA 1FFUA 2DYOA 2NTSA 2L32A 3ZYYX 2LJIA 1FFVA 2K22A 2RPVA 5EE0A 3O13A 2V0GA 1T3QA 1FM0D 2GRIA 1CZPA 1C77A 1ET9A 2MJ3A 2L52A 2R61A 4D2KA 1JWAD 1N61A 1XO3A 3KWLA 2JX5A 3WCQA 1EU4A 3Q8BA 3P63A 1C78A 1JQ4A 3HUIA 3VQIA 2CJOA 1IGCA 3B2FA 2BW2A 4YXDB 4ZOHC 1B1ZA 5HI1A 1KLGD 1SF0A 1R7SA 3AE7B 1RM6C 4USAA 5BMIA 3TEYA 2Y3AA 2ZW1A 1ZXIA 1KRHA 3TSSA 1XEEA 2JWUA 4RGMA 3ZJVA 2OEDA 1FCCC 4XE0A 1ZXHA 1TS2A 5MPOA 2J42A 1FIQA 1YQ3B 1XCTL 4ZRPA 1FNWA 2KN4A 4GLSC 1FEHA 1ROEA 2JU6X 4MM3B 1F2RC 1SJHD 1SE4A 2WXKA 3BIID 4UDUC 3P4PB 3N9YC 5FKAC 2LHDA 3RFZB 3IT6B 1FRDA 2DBYA 1VRAB 2H89B 2LHEA 3IAS1 3P4RB 3P4SB 2E6XA 2QJLA 2WXJA 4YSXB 1TY2A 2WXQA 2YEPF 2WDVB 3AH7A 3MFGA 2KMMA 1TYGB 2W3SA 2LMCA 3P42A 1YJIA 2BTEA 2IGGA 4OZBA 1FNVA 2WXRA 1QOFA 4PT5A 1F77A 3HVDA 3BZDB 3PO0A 4CQNA 3CWIA 3MC0B 1K51A 5HFYA 3U4EG 1QLBB 1EU3A 2V3PA 3AN1A 2L1AA 1YMHE 2J4XA 5D7GA 1OQRA 2JSVX 1TY0A 1BMLC 2MJDA 4REZA 3NVYA 2AQ1B 1JMLA 1NEKB 4JPSA 1QF6A 5G5HA 5I4DA 4HROA 1E10A 1AWDA 1I4RA 3AE1B 1IUEA 3KQ4A 2N7JA 1RYJA 2HTME 4KKIA 5HHDG 2Q5WD 1XLPA 4TMAB 2SAKA 4FXCA 1QILA 1ET6A 2WDQB 3C8YA 1N5WA 1MHXA 1P7EA 2RMMA 4L2YA 5GXGB 4NAWB 4HJGE 1SSNA 2ACZB 2IGDA 5EE3A 3E9SA 4RFBA 1V1PA 2CJNA 2N9LA 3GS2A 3L4PA 2FUG1 4GDLB 4KGTA 4L1BA 4A90A 1D4BA 4A8XC 2I2YA 4L23A 2VZKB 3T3NA 1JWBD 4GDKB 1MI0A 1UWMA 2SEBD 3FILB 2G9HD 1E0ZA 4OW0A 2AQ2B 2PKOA 3HVZA 4TSSA 3V3XA 3BWUD 2J53A 1L4DB 4C7YA 1DOYA 1YN4A 1I4XA 2FBWB 1XCQL 1K50A 2PVOD 2TSSA 4KGSA 1F0ZA 3AEBB 2IGHA 1CQVA 3KLSX 2B76B 1D5MC 3SEBA 3SFEB 1FD6A 5BYRA 2INNE 3AV8A 3AMZA 1GB1A 1WXQA 1GPXA 2XNAC 4IDIA 1RFKA 2V3NA 3BK1A 1DGJA 2QILA 1T5XD 4N59A 1P7FA 4B0EA 2OHFA 5C2TB 3W5VB 2LFIA 1XLOA 4IOIE 1D6EC 3Q8EA 3SFDB 1QT9A 2WXIA 3Q69A 2AX5A 1TKGA 1JROA 4HKZE 4XDDA 5FK9C 1YQ4B 3EUB2 1QOBA 1L0VB 1UNSA 2JZPA 3NS1A 5BMHA 4AS1A 3NRZA 1JRPA 1STEA 2Z8LA 1MHHE 2M19A 2WXOA 3AEDB 2N0SB 1HQRD 1SE3A 1C9FA 1PGAA 3ETRA 1TKYA 2WS3B 4XWTA 3VR8B 4WURA 4RF0A 4ZRQA 1GB4A 3Q8CA 5T8IA 2WXLA 1DOIA 4WAFA 2JYTA 4US8A 1SBBB 1PDXA 2PIAA 4LLGM 3GB1A 1ZPSA 1OFFA 4P6VF 2K9XA 3U7ZA 4O1NA 1N60A 3AEEB 3OWEB 1IBXA 1SIJA 2WU2B 2ONQA 4A55A 1JW9D 1WYGA 3AEAB 2BS2B 2N9KA 4TQ1A 1L0XB 1VJKA 3MP9A 2NTTA 2WQYB 4LK0M 2WU5B 5EE1A 3AE5B 1JCKB 1ZUD2 1C4CA 1VDVA 2BBCA 1GAQB 3BYYB 5G5GA 3NVVA 1NYRA 3AEFB 4NZLB 1FXAA 4RGTA 2WLBA 4B0MA 3ZGZA 2WP9B 5BMGA 1N62A 4ZHOA 1L5PA 1MPEA 1LO5D 1PUTA 3IT4B 3NVZA 2QEJC 2WXGA 4LTUA 4DXFA 1KLUD 3AM9A 3I57A 2QIEB 3FC4A 4N58A 1NYQA 1C76A 2E3TA 4OHJA 3BVGA 2PW9A 3AE8B 3HRDD 1QKZA 2BT6A 2DLBA 3CIRB 1EWCA 1HZ5A 1TS4A 2W82A 3AB5A 3E56A 1N5XA 3GP7A 2INPE 3P4QB 1VZ7A 1JWMD 4MH8A 3EGRA 1K53A 2ZW0A 3EA6A 1FRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GB1 A;  2ZW1 A;  2JXT A;  2JWU A;  2OED A;  1Q10 A;  1FCC C;  3UI3 A;  1ZXH A;  1P7F A;  1XCT L;  2QMT A;  4MAC A;  2KN4 A;  4GLS C;  4KGR A;  2JU6 X;  1F2R C;  1KH0 A;  4IOI E;  2LHD A;  2KQ4 X;  2J52 A;  5HG2 A;  4HKZ E;  1MVK A;  2JZP A;  2LHE A;  5BMH A;  2KWD A;  1MHH E;  1PGB A;  4OZA A;  2NMQ A;  2EEL A;  1C9F A;  1PGA A;  2GB1 A;  1IGD A;  2QSD A;  1GB4 A;  2IGG A;  4OZB A;  2PTL A;  1K51 A;  2KAC A;  5HFY A;  3GB1 A;  5JXV A;  1YNT E;  2PLP A;  2LGI A;  1F2R I;  2GI9 A;  1YMH E;  1IBX A;  2K0P A;  1HZ6 A;  2JSV X;  2ONQ A;  1XF5 L;  1JML A;  2I38 A;  2N9K A;  3MP9 A;  1EM7 A;  4OZC A;  2N7J A;  5HHD G;  4IKG A;  3FIL A;  1FCL A;  1IBX B;  1MHX A;  1K52 A;  1P7E A;  2RMM A;  5BMG A;  4HJG E;  2IGD A;  2N9L A;  4KGT A;  2RPV A;  1D4B A;  2I2Y A;  2LUM A;  1HEZ E;  1MPE A;  2KDM A;  1MI0 A;  2ON8 A;  4D2K A;  3FIL B;  3V3X A;  1UWX A;  2J53 A;  4WH4 A;  1IGC A;  1K50 A;  1XCQ L;  2PW9 A;  1PGX A;  4KGS A;  1QKZ A;  5HI1 A;  2IGH A;  1HZ5 A;  5BMI A;  1K53 A;  2ZW0 A;  1FD6 A; 
#chains in the Genus database with same CATH topology
 3Q3F A;  4EE2 A;  2IYD B;  2G3Q B;  1V80 A;  3VAW A;  2WDR B;  2HE7 A;  3DDC B;  2REX A;  1SGH A;  2FCN A;  4JGH B;  3PV1 A;  2NPT B;  3AI5 A;  2KQ4 X;  3X23 A;  3NZS A;  3NG0 A;  1AW7 A;  2HJ1 A;  2ZNV C;  4DXG A;  1C1Y B;  2HD5 B;  1HXY D;  1FMA D;  1T6B X;  1L2N A;  4EZL A;  4LDT D;  2MH7 A;  1XXG A;  2JPH A;  1V8C A;  4K81 A;  3B2G A;  2N4F A;  1FXI A;  1I4G A;  2JVC A;  3TUO A;  1VCB A;  1V1O A;  2VZK D;  1WE7 A;  3A9K A;  4GN1 A;  2NBU A;  5BO4 B;  4P7I A;  1A70 A;  2W3R A;  1PFD A;  1RWS A;  5KHQ A;  3AE6 B;  2D07 B;  3DWM A;  2N9E B;  3W9C B;  2IO2 B;  4NQL B;  1HE8 A;  1V5T A;  4OVZ A;  1K8R B;  4BOZ B;  4FBJ B;  3DBR I;  3ML9 A;  2V1Y A;  2WXN A;  2L05 A;  1VLB A;  4A3P A;  3APF A;  3AE4 B;  3WAM A;  3AE9 B;  1HEZ E;  4HRS A;  3PZ8 A;  4YSZ B;  2LD9 A;  4ARI A;  3T9L A;  3PLV A;  3Q3N C;  2D10 A;  2D3G A;  1ZE3 D;  1UBI A;  2ASQ A;  4J3O D;  4N6E B;  3ZJT A;  5GMV A;  2I1J A;  1UWX A;  5D3D A;  2JY6 A;  4LNF A;  1ZDV A;  1FO4 A;  1V1P B;  3UF8 A;  1YN5 A;  1E7P B;  1E9M A;  2DHZ A;  2LGX A;  2RDG A;  3QJZ A;  3IXS A;  2IDY A;  4KKJ A;  4FAD A;  2K8H A;  2FID A;  2JQR B;  3QCA A;  1WGG A;  1WRI A;  4RGO S;  3DWG C;  4K3C A;  4K1R B;  3Q3O C;  1NI2 A;  1Y56 A;  2WXP A;  4WQM A;  1MVK A;  4M00 A;  5LLI A;  3ZNH B;  1J0G A;  4W9C A;  1JWS D;  3AU4 A;  2NR2 A;  2GB1 A;  4DDG D;  1IGD A;  2O2V A;  2WXF A;  4DHZ E;  3K9P B;  3I5J C;  3W1S C;  1NVI D;  4IM3 A;  2ZVN A;  1UH6 A;  3Q8F A;  1T0Y A;  1AN8 A;  2M4N A;  2Z0D B;  4JWU C;  2LGI A;  2KAN A;  5TSS A;  1J7C A;  1JAL A;  1HZ6 A;  3VUW A;  1YJJ A;  3DBH B;  4RNA A;  3KWV A;  5EE9 A;  4MJS B;  1ZP0 B;  2MX2 A;  1VR9 A;  1UUP A;  3L54 A;  4WJQ A;  1FPY A;  2C7H A;  2BYF A;  1IBX B;  5LXI B;  3J9C A;  4S17 A;  1FFU A;  2CR5 A;  2M0X A;  2LJI A;  2RPV A;  2K22 A;  3HK0 A;  2V0G A;  2KN5 A;  1T3Q A;  4NY0 A;  3PS6 A;  1E90 A;  3NJT A;  4D2K A;  3L17 A;  3RT3 B;  2C60 A;  3P63 A;  4M0W B;  3VQI A;  1J19 A;  4YXD B;  1WGR A;  4I6N B;  5L83 A;  3IVF A;  2K25 A;  3AE7 B;  2JT4 B;  2K6D B;  1RM6 C;  5BMI A;  2JUO A;  2IND C;  4MGZ E;  2BKF A;  2LZ6 A;  2LVO A;  2WWZ A;  3PZD A;  4HLE A;  1XEE A;  1ZXH A;  1LGR A;  2GBM A;  1FNW A;  4HWI B;  2K6Q A;  3TMP B;  4JIO U;  1ROE A;  1SE4 A;  3CMM B;  5D94 A;  2LHD A;  2C5L C;  4GIV A;  2DBY A;  2H89 B;  3Q3J A;  2IO3 B;  1H4R A;  2J0K A;  2WXJ A;  3ZLZ A;  2YEP F;  2WDV B;  3QA8 A;  3MFG A;  2KMM A;  3PSE B;  2N1W A;  3M95 A;  2N7D A;  2KVZ A;  1YJI A;  2G4D B;  2ZCB A;  2ZPN A;  3DVN V;  3ZXR A;  3L08 A;  1F77 A;  2KLC A;  4E3C A;  3BZD B;  5HFY A;  1QLB B;  2KJ6 A;  1SE9 A;  4MDK E;  4REZ A;  2AQ1 B;  4HRO A;  3IBE A;  3AE1 B;  3M62 B;  2N7J A;  3MJW A;  2Q5W D;  1XLP A;  3A9K B;  3DCG A;  1YX6 B;  3V62 A;  1P7E A;  4L2Y A;  4HJG E;  1WY8 A;  2CJN A;  2N9L A;  4MH0 E;  1D4B A;  1EUV B;  1RRB A;  4BVU C;  2KD0 A;  2WYQ A;  4GDK B;  1UWM A;  2SEB D;  3SDL C;  3DVN U;  2J53 A;  4XC2 A;  2RGF A;  2FBW B;  1XCQ L;  2BYV E;  3A1Q A;  3R3M A;  1KM7 A;  1DGJ A;  2AWT A;  1T5X D;  3D32 A;  4N59 A;  3UQA A;  3KUD B;  4G50 A;  4NJ7 A;  2MBE A;  4ICU A;  3W5V B;  3ECI A;  2DYB A;  2LFI A;  1GUA B;  2ZZP B;  1CMX B;  1GC7 A;  1D6E C;  3Q8E A;  3SFD B;  3Q69 A;  1TKG A;  3DBR B;  1E8Z A;  5BMH A;  3NRZ A;  1JRP A;  2FCM A;  2C7N B;  2MCN B;  1LM8 B;  3LJ3 A;  2GBR A;  4WWN A;  3ETR A;  4F7Z A;  3VR8 B;  5AZF A;  3Q8C A;  4BFR A;  2N7E A;  3ZRC A;  2CKH B;  2MBQ A;  4EZK A;  2JYT A;  3IFW B;  3RNA C;  1PDX A;  3N1X C;  4ANU A;  1WMH A;  5JZE B;  2O2V B;  5E6O A;  3K9O B;  4W9I A;  1WYG A;  4TQ1 A;  1L0X B;  1VJK A;  1QZE A;  5EE1 A;  2JZZ A;  1GAQ B;  1WRD B;  1S3S G;  3BYY B;  1WF9 A;  1FXA A;  2QDF A;  2WLB A;  1WGD A;  3ZDT A;  2J0M A;  2IBI B;  1L5P A;  5DPS A;  5IP4 D;  4FJZ A;  2A5U A;  2BKR B;  2WXG A;  1KLU D;  3AM9 A;  4N58 A;  2E3T A;  3AE8 B;  1QKZ A;  2UYZ B;  4DHJ B;  1EWC A;  3VFK A;  5J2R A;  4C00 A;  1TS4 A;  2W82 A;  2INP E;  3P4Q B;  4PS8 A;  1VZ7 A;  4MH8 A;  3CST A;  4RCO A;  4YL8 A;  2AEH A;  4OVU A;  2ZJD A;  3RUL A;  1M94 A;  2PJH A;  4NJC A;  4LNN A;  4W9D A;  1I4Q A;  3T3O A;  2WDT B;  2IY0 B;  3U52 E;  2D11 A;  4A6Q A;  4MGK E;  3MHZ A;  2KWD A;  5AZH A;  4YT0 B;  2V9H A;  4JQW C;  1PGB A;  1YN3 A;  4OZA A;  1WFY A;  2M8S A;  3DBH I;  1EF1 A;  4RM9 A;  3RPF C;  1SJE D;  2V4I B;  3AXC A;  4PK1 A;  3BY4 B;  2WXH A;  4K7U A;  4C80 A;  2OOB B;  2RDH A;  4W9E A;  3AE3 B;  1F2R I;  4Q2J A;  4R3D A;  3ZO5 B;  2MA9 B;  2V4L A;  3N30 A;  4NAW A;  4LJO B;  3DVG X;  2K8C A;  2WX1 A;  1ESF A;  1JWU D;  4DBG A;  2MBB B;  2AYO B;  3DQV A;  3PRP B;  1XLQ A;  2MQJ A;  1WJU A;  3RYT A;  3H7P B;  2C7M B;  2L83 A;  2DEN B;  1UZX B;  3W2D A;  1KTK A;  3U2S C;  1TS3 A;  5LXH A;  3ABV B;  1WWT A;  2MEK A;  1WR1 A;  2ON8 A;  4GXB A;  1WSP A;  4H2A A;  1U4A A;  1Z2M A;  1V97 A;  3VRA B;  2M17 A;  1ZDX A;  2KMA A;  4AOF A;  1SXT A;  5DCN A;  1YX5 B;  1GOZ A;  2YEP B;  4M0W A;  2WXM A;  2KDI A;  3DBL I;  1AYF A;  3OLM D;  4HCP B;  3APD A;  3SHQ A;  1HTO A;  3AE2 B;  4XDC A;  2O6V B;  3A9J A;  2JXT A;  2XN9 C;  1SE2 A;  3UI3 A;  1XD3 B;  3DBS A;  4MAC A;  5C3J B;  3AEC B;  4MGY E;  1D5Z C;  1D5X C;  2DWQ A;  4FJV B;  2BS3 B;  3Q14 C;  4GU2 A;  2J52 A;  2KYW A;  1TS5 A;  3TJP A;  5IKC M;  2JRH A;  1KFY B;  1WXS A;  1YJ1 A;  2EEL A;  4YTM B;  3GZN I;  5AUK A;  1WX8 A;  4IM2 A;  3KUC B;  3R2I A;  1YOV B;  5CTR C;  1CK1 A;  4EEW A;  1GG3 A;  3URY A;  4YWG G;  4MSM B;  1BT0 A;  1VZ6 A;  2KAC A;  2AQ3 B;  2KNB A;  4TKN A;  5JXV A;  4LCD E;  3RNF C;  4JE3 B;  2AL3 A;  4J6I A;  3B9J A;  3H8H A;  1WM3 A;  3RNB C;  2KJR A;  1J7A A;  3PRE A;  4F8C B;  2L0T A;  2BS4 B;  1WMH B;  5IOI A;  3B1L X;  1UGJ A;  4ARC A;  2JXX A;  2VH2 A;  4ZYS A;  4W9F A;  4IG7 B;  3KVF B;  2NTS A;  2M1M A;  1FFV A;  5EE0 A;  3O13 A;  1CZP A;  3TBL D;  4A20 A;  2L52 A;  4FUL A;  1N61 A;  1YIW A;  2JX5 A;  3Q8B A;  4EOY A;  1KJT A;  4KDI C;  4GDK A;  3U8Z A;  2K8B A;  2CJO A;  5C23 A;  1IGC A;  2BW2 A;  5HI1 A;  2YVC A;  4QAY A;  1R7S A;  4USA A;  3TEY A;  1T0R C;  2ZW1 A;  3H9D A;  1E8W A;  2D2Q A;  1KRH A;  2UWQ A;  2JWU A;  2OED A;  3KW5 B;  2KVR A;  3RN9 C;  2KJH B;  4XE0 A;  3ZIM A;  5MPO A;  3JVZ X;  2JU6 X;  4MM3 B;  3H6N A;  2D3C A;  3BII D;  4UDU C;  4NNJ B;  3RZF A;  4G3X B;  2XBB C;  1WH3 A;  1T0S C;  1OEY J;  2E6X A;  1GC6 A;  4WAA A;  4CYE A;  1TY2 A;  3EHV A;  1TYG B;  3NHE B;  2KMC A;  3R7R A;  2KWU B;  1RLF A;  1V6E A;  3QAR A;  2BF8 B;  2IGG A;  4EZJ A;  4OZB A;  1FNV A;  2WXR A;  4CHK A;  3R7Q A;  4HPP A;  2PPH A;  3CWI A;  4XYC A;  5IA7 A;  3OJ3 A;  2V3P A;  2JF5 A;  3EEC A;  3PRZ A;  1YMH E;  2J4X A;  2WHI A;  5D7G A;  4IW0 A;  1OQR A;  2JSV X;  1TY0 A;  2EKE C;  1JML A;  3N1Z C;  5G5H A;  1AWD A;  1I4R A;  3WAO A;  1UGM A;  4E74 A;  3A4S C;  3L16 A;  4JL9 A;  5HHD G;  2SAK A;  4FXC A;  1N5W A;  2CHZ A;  1MHX A;  2LRW A;  2Y5B B;  5GXG B;  1G6J A;  4NAW B;  1SSN A;  2IGD A;  5EE3 A;  4ZYN A;  3UIP B;  3GS2 A;  2L7R A;  1E8X A;  2N9P C;  1WX7 A;  1R4N I;  2I2Y A;  2OJW A;  1Q0W B;  4OW0 A;  3Q6B A;  4AUQ C;  4TSS A;  2LGS A;  1DOY A;  4BBN C;  2PVO D;  2TSS A;  2OJR A;  2MRP A;  2IGH A;  3KLS X;  4DDI D;  1GNU A;  2B76 B;  3RI7 C;  1OEY A;  1FD6 A;  3AV8 A;  3L13 A;  1WXQ A;  1F9J A;  2LRU A;  4IDI A;  1L7Y A;  4IWO A;  2QIL A;  4II3 B;  4B0E A;  2BWE S;  2K39 A;  2KTR A;  1XLO A;  1A5R A;  4IOI E;  2AX5 A;  4XDD A;  4HKZ E;  1YQ4 B;  2JZP A;  4EFO A;  3A9J B;  2LAS A;  3VH3 B;  3NY5 A;  2Z8L A;  2MWS B;  1MHH E;  2M19 A;  3RMK C;  3DPD A;  5DPW A;  1TKY A;  2WS3 B;  1Q1O A;  4K7S A;  2YLM A;  1DOI A;  3QAQ A;  1OGW A;  3OJ4 B;  4WAF A;  3GB1 A;  4P6V F;  2KZR A;  3DBL B;  4A55 A;  3ZNG C;  3AEA B;  1IYF A;  3HM6 X;  4EUT A;  3MP9 A;  2NTT A;  2QC8 A;  4M8N A;  2KC1 A;  4K3B A;  3AE5 B;  2KHW B;  4IWP A;  3ZTD A;  5BMG A;  3GE8 C;  1RAX A;  1MJD A;  3ZKJ C;  1PUT A;  1LO5 D;  3GZN B;  3IT4 B;  2QEJ C;  3H7P A;  2QIE B;  4AJY B;  3FC4 A;  4M01 A;  2QCZ A;  2PE9 A;  2KFJ A;  1C76 A;  3BVG A;  3HRD D;  3FKY A;  4K7W A;  3CIR B;  1TGZ B;  1HZ5 A;  3GP7 A;  2L00 B;  4HJK A;  3EGR A;  1UEL A;  1K53 A;  2ZW0 A;  2JZ3 B;  4FN2 A;  1FRR A;  2HJ8 A;  2FE8 A;  3BYT B;  3MJ5 A;  1HA5 A;  3ZQ4 A;  2FUH B;  2LEK A;  2O6V A;  3N1Y C;  4YTN B;  1NI3 A;  4IWQ A;  1J8C A;  3MC9 A;  4HEA 1;  1V2Y A;  2KK8 A;  3EC8 A;  5H8Y E;  2CU3 A;  4MGI E;  1HTQ A;  2N1V A;  2GLS A;  4YTP B;  2MJE A;  3EFU A;  3N3K B;  2LVP A;  2QSD A;  4KSK C;  3TEX A;  2PMV A;  5E6J A;  1DYQ A;  1OQQ A;  2D3A A;  3PHW B;  1YQB A;  2QHO A;  1WZ0 A;  2KDF B;  2MP2 B;  2L3Z A;  4KVG B;  1UF0 A;  4P1C C;  3ZJU A;  1UD7 A;  4BOS C;  2GI9 A;  4ANX A;  3AEG B;  1BUI C;  3HIZ A;  4OZC A;  2ZVO A;  4IKG A;  1ZOY B;  4DK5 A;  4YSY B;  3KYD D;  3FIL A;  1E7U A;  4WWM A;  2CS4 A;  3KH0 A;  4C7Z A;  5G55 A;  2M0A A;  2W54 A;  2BWF A;  2LI5 A;  4ITK A;  5CX3 A;  1WGK A;  2IPK D;  2LUM A;  3JSV B;  4ZHP A;  3BVM A;  1VZ8 A;  1L4Z B;  4ZDV A;  1ACC A;  3DHI C;  4ZRK A;  3SU8 X;  4LNK A;  3VUY A;  1PGX A;  3FAH A;  4ICV A;  4IM0 A;  1I35 A;  4JLC A;  1WJ6 A;  4NQK E;  1EF5 A;  3WA0 A;  4KDL B;  3IAM 1;  2ZNV B;  1V81 A;  4RF1 A;  4JX1 C;  3R8B A;  1F1H A;  4G11 A;  4BKG A;  5JHB A;  4BKS A;  1P1A A;  2C9W B;  4HDQ A;  3M3J A;  4NAM A;  2G1E A;  4G0N B;  1WM2 A;  2HDE A;  3ZVV A;  4DQO C;  2X38 A;  3UIO B;  4MM3 A;  4URK A;  1R4N B;  4AQ7 A;  4C56 C;  1B9R A;  2IJ0 A;  3DHG C;  3ZW3 A;  4FA6 A;  1LFD A;  3V05 A;  2KTR B;  1WJN A;  1SEB D;  4XX5 A;  1X1M A;  5KHO A;  1TBE A;  3I9V 1;  1NEN B;  1I7H A;  3VRB B;  4WIP A;  1YNT E;  2PLP A;  3OG5 A;  4EKU A;  1WGY A;  2GBK A;  1QQR A;  1TZO A;  4KZ0 A;  3TEW A;  1XF5 L;  3RNG C;  2BYT A;  4B6W A;  2ICI A;  4HK2 A;  2JYE A;  2G4S A;  1TJE A;  2K3U A;  4WJN A;  1C79 A;  1T0Q C;  4ZRI A;  3NS8 A;  3M63 B;  2KX0 A;  4DHJ D;  3L0W B;  3TCA A;  2V3S A;  4PYZ A;  3H7S A;  2DYO A;  2J7Q B;  1OTR B;  2L32 A;  2X8X X;  3Q3M C;  3ZYY X;  3CF6 E;  3GOE A;  1C77 A;  2ZCC A;  2MJ3 A;  2R61 A;  4B9K A;  3QHT A;  3KWL A;  2BQQ A;  4OVV A;  3WCQ A;  2INC C;  1C78 A;  5EDS A;  3PTF C;  1JQ4 A;  3HUI A;  1WE6 A;  4CO7 A;  5DPT A;  2WX0 A;  1B1Z A;  4ANW A;  1SF0 A;  2EMT A;  2BPS A;  1WXA A;  2KC2 A;  1ZXI A;  3ZJV A;  4RGM A;  4DWF A;  1RFA A;  4HDO A;  4ZRP A;  1KOT A;  1XCT L;  3OAW A;  4GLS C;  1FEH A;  2WXK A;  2N9X A;  3P4P B;  3N9Y C;  3RFZ B;  3V61 A;  3P4R B;  3IAS 1;  4KIK B;  3QWZ B;  2J0J A;  2QJL A;  4S0R A;  3I3T B;  3AH7 A;  4XZ4 A;  4BZA A;  2LMC A;  3P42 A;  5TR5 A;  3KYC D;  3SD5 A;  2EMS A;  4PT5 A;  1QOF A;  1UBQ A;  4CQN A;  4WQO B;  1K51 A;  3R66 C;  2LJ5 A;  3U4E G;  3WAL A;  3AN1 A;  3PRM B;  1Y8R C;  3T8M A;  1BML C;  2MJD A;  2LXA A;  3NVY A;  1QF6 A;  1P9D U;  4B95 A;  2WGS A;  3KQ4 A;  1R4M I;  3APC A;  4KKI A;  4NPN A;  4LDT B;  4TMA B;  1QIL A;  3C8Y A;  2RMM A;  2ACZ B;  2O6V D;  3E9S A;  4RFB A;  4FHJ A;  4L1B A;  4KGT A;  2R2O A;  4A90 A;  1D3Z A;  4A8X C;  1H8C A;  2VZK B;  3T3N A;  4WWP A;  1MI0 A;  5C1Z A;  3UQB A;  1AAR A;  2MSE D;  3FIL B;  2G9H D;  1E0Z A;  2AQ2 B;  2PKO A;  4HCN B;  2VRR B;  3V60 A;  1L4D B;  4AWJ A;  4C7Y A;  1I4X A;  1LXD A;  1K50 A;  4IC7 B;  4KGS A;  1F0Z A;  1MG4 A;  4BAX A;  1CQV A;  2FCQ A;  3HM3 A;  3L10 B;  1TTN A;  4FHK A;  1D5M C;  4ACF A;  3SEB A;  5BYR A;  4GSW A;  1GB1 A;  3AMZ A;  1GPX A;  2XNA C;  3BK1 A;  2RD0 A;  3PGE A;  2A4Z A;  1P7F A;  2L8J A;  1ISN A;  1Q5W B;  3X0W A;  1ZKH A;  2XEW A;  1TIF A;  1QT9 A;  2WXI A;  3PVL A;  5FK9 C;  4GMV A;  2GMI C;  3EUB 2;  4E71 A;  1QOB A;  1L0V B;  1UNS A;  2Z59 B;  3NS1 A;  5IO9 A;  4AS1 A;  3AU5 A;  3QK0 A;  3JYU A;  2WXO A;  3AED B;  1E8Y A;  4XWT A;  3ZNZ B;  4RF0 A;  4ZRQ A;  1GB4 A;  4LJP B;  3WIM A;  5T8I A;  2FIF A;  2WXL A;  3ZRF A;  2MHJ A;  1F52 A;  3S2A A;  4US8 A;  1SBB B;  3VUX A;  1OFF A;  2KX3 A;  2K9X A;  3N20 C;  3ZTC A;  2LUE A;  5JH5 C;  3AEE B;  2DAF A;  3OWE B;  4ANV A;  2MP2 A;  1JW9 D;  1VD2 A;  3V6E B;  4WJO A;  1YD8 U;  3CSF A;  1SIF A;  4W9G A;  4LK0 M;  5E6N A;  3A4R A;  1JCK B;  2MBO A;  1C4C A;  1VDV A;  3ALB A;  5G5G A;  1PQS A;  3NVV A;  3MC8 A;  4B0M A;  2ZPY A;  4BKS D;  1Z5S B;  2LGY A;  4I6P A;  4ZHO A;  1LQB A;  1MPE A;  2FCS A;  2IO0 B;  2FAZ A;  4DXF A;  3I57 A;  1E7V A;  3VTW A;  1MFW A;  3JSV A;  4OHJ A;  5J18 A;  2PW9 A;  5D2M B;  3JW0 X;  4W9L A;  2MW5 A;  3EA6 A;  1M4V A;  3NUH B;  2CU1 A;  2H88 B;  3LB8 C;  5LNK 1;  3VTV A;  5DPR A;  1WX9 A;  2QMT A;  2IO1 B;  4P16 A;  4WWO A;  4KGR A;  1L6U A;  1KH0 A;  1XQQ A;  3BVZ A;  2BB5 A;  2Z0E B;  4X57 B;  3NZ3 A;  4HKQ A;  1TZ1 A;  2RSU A;  1WI0 A;  2W55 A;  2M56 B;  1EWY C;  1QOA A;  2DYM A;  1DOX A;  3RUI B;  2UU7 A;  3U30 A;  3RZW C;  3PZ7 A;  3P2B A;  3C19 A;  1E6E B;  4FJY A;  3UGB B;  2WNM A;  4HXD A;  4KV2 A;  2KOX A;  1N6Z A;  2KWV B;  4RGN A;  2I1K A;  2KT7 A;  3LXF A;  3NVW A;  1C4A A;  1L6V A;  5AUI A;  2KQ7 A;  3BK2 A;  4DHZ B;  2D5G A;  4M8M A;  2ZEQ A;  3W5U B;  3UIN B;  4GDL A;  1EM7 A;  5BYS A;  5IN7 A;  3VXW A;  2L0F A;  2KQS A;  1FCL A;  2KFK A;  2JRI B;  4GOC A;  5H92 C;  3AUL A;  4F1S A;  1MG8 A;  4PS7 A;  1TKE A;  3PHX B;  2NCN A;  3VR9 B;  1SB3 C;  4AP4 C;  2KDM A;  3V6C B;  4XWW A;  1QOG A;  3NZU A;  4AJW A;  3DOW A;  1I4H A;  3VDZ A;  2DX5 B;  1PYW D;  4WH4 A;  3SR6 A;  1ZGU B;  1FXT B;  4KSL C;  2KAJ A;  2K5P A;  3R2T A;  2PEA A;  5E6P A;  1TT5 B;  4I6L B;  1C4P A;  2CHX A;  3ZXV A;  3Q8A A;  2XK5 A;  2HTH A;  3N32 A;  1Q10 A;  4M02 A;  4BBN F;  1IPG A;  1R4M B;  1WJ4 A;  5J17 A;  5D6J B;  5IAA C;  1C3T A;  4FLH A;  1E5W A;  1I42 A;  3O65 B;  5HG2 A;  1ZW7 A;  2KDE B;  4W9J A;  4RH6 A;  2R2Q A;  2Y5C A;  2DNF A;  3W1S A;  1XLN A;  2IZV B;  2NMQ A;  2DZI A;  1FNU A;  3I63 C;  5CHF A;  1P98 A;  2GOW A;  4US9 A;  1ENF A;  1J7B A;  2RDB C;  4KIK A;  5D3I B;  5G2N A;  2PVG C;  1BXT A;  3HHM A;  2BGF A;  2MLB A;  2PTL A;  2KWC A;  3MHS D;  3VHT C;  3DVG Y;  5BYQ A;  1I4P A;  4C4V A;  1N63 A;  3TEZ A;  4KX6 B;  2K0P A;  2JWZ A;  2Y5P A;  2AL6 A;  2LVQ A;  3RNC C;  4A9A A;  4MT5 A;  4TUU A;  2BB6 A;  2IY1 B;  2I38 A;  3ML8 A;  1KF6 B;  3LYY A;  1L0Y B;  2EKI A;  2KKC A;  1CJE A;  3WAP A;  4JWS C;  2DAJ A;  4TQ0 A;  3NOB A;  3P1M A;  5FR3 A;  2MBH A;  1S1Q B;  1K52 A;  3QQ8 B;  4RMA A;  1FM0 D;  2GRI A;  4RM8 A;  1ET9 A;  4PYU A;  3QIJ A;  3QC8 B;  1JWA D;  1XO3 A;  3B0A A;  1EU4 A;  3B2F A;  3ZUN A;  3U7D A;  1V9J A;  2FNJ B;  4ZOH C;  4ASW C;  1KLG D;  4DXA B;  1WIA A;  2RR9 A;  4KZC A;  2NPT A;  2Y3A A;  3H1U A;  1V49 A;  3TSS A;  3PPA A;  1FCC C;  3DHH C;  1TS2 A;  4N9F 4;  2J42 A;  1FIQ A;  1YQ3 B;  2NS5 A;  2NBW B;  2KN4 A;  1V86 A;  1WXM A;  1F2R C;  5AZG A;  1SJH D;  1XT9 B;  5FKA C;  3TIX A;  3IT6 B;  1FRD A;  1P0R A;  1VRA B;  1WGH A;  2LHE A;  2LWP A;  3P4S B;  3RNE C;  3IHP C;  4YSX B;  2WXQ A;  1NBF C;  2W3S A;  1IP9 A;  2BTE A;  3HVD A;  4PS3 A;  3PO0 A;  3MC0 B;  5JHA A;  1EU3 A;  5AEK B;  1WR6 E;  4GB9 A;  4LNI A;  2L1A A;  4MSQ B;  1NEK B;  4JPS A;  4A3O A;  4W9H A;  3TL5 A;  5I4D A;  1E10 A;  3VVW B;  1IUE A;  1RYJ A;  2RPQ A;  2HTM E;  3ENE A;  2K1F A;  2DZK A;  1ET6 A;  2DZM A;  2WDQ B;  3ZDM C;  5L95 C;  3MTN B;  4LNO A;  3RD2 A;  5CHV C;  1V1P A;  4GDL B;  3L4P A;  2FUG 1;  4W9K A;  4L23 A;  1JWB D;  2G45 B;  4GGQ A;  2KFK B;  4XGA B;  3HVZ A;  3KUZ A;  3V3X A;  1GJZ A;  3BWU D;  3RCZ A;  1YN4 A;  4ZRJ A;  3QX1 A;  3AEB B;  2NBV B;  3SFE B;  2INN E;  3ONS A;  4MEL A;  1RFK A;  4WJP A;  2GBN A;  2V3N A;  4TV3 A;  4P1B C;  2OHF A;  4IUM B;  5C2T B;  1OQY A;  2CHW A;  2KO3 A;  3ZNI D;  1JRO A;  4MEM A;  1STE A;  2XK5 B;  5CHW A;  2VH1 A;  2N0S B;  1HQR D;  1SE3 A;  1EO6 A;  1C9F A;  1PGA A;  4HPL B;  4BKT A;  4WUR A;  3IG3 A;  3BIN A;  4HPM B;  4MJS A;  3B08 A;  3W1Y A;  2PIA A;  4LLG M;  1ZPS A;  3Q2A C;  2KTF A;  3U7Z A;  1WZ3 A;  2BYE A;  4O1N A;  2PE6 B;  2B3A A;  2NVU I;  3WAN A;  2GBJ A;  1N60 A;  5HKH A;  1IBX A;  1SIJ A;  2WU2 B;  2ONQ A;  5FR6 A;  2KDB A;  3PT2 B;  2BS2 B;  2N9K A;  4II2 B;  2L76 A;  2WQY B;  2WU5 B;  3A33 B;  3PLU A;  1ZUD 2;  4C4V B;  2BBC A;  3GE3 C;  1NYR A;  3AEF B;  4NZL B;  4RGT A;  3ZGZ A;  2WP9 B;  2DZJ A;  1P3Q U;  3VTU A;  1WXV A;  1N62 A;  3NVZ A;  2LXC A;  4LTU A;  4HVB A;  3LDZ E;  1NYQ A;  3A1Q B;  2BVC A;  2KLG A;  2LGD A;  1V5O A;  1NDD A;  2W9N A;  4NJ6 A;  1JRU A;  2BT6 A;  2DLB A;  3C0R B;  3VH4 B;  2D3B A;  2KXJ A;  1WYW B;  3AB5 A;  3E56 A;  1N5X A;  1KLV A;  1JWM D;  3EFC A; 
#chains in the Genus database with same CATH homology
 1M4V A;  3NUH B;  4RCO A;  4EE2 A;  2H88 B;  3LB8 C;  2FE8 A;  3BYT B;  5LNK 1;  2WDR B;  3MJ5 A;  1HA5 A;  3ZQ4 A;  2LEK A;  2QMT A;  4NJC A;  4P16 A;  4KGR A;  4YTN B;  1NI3 A;  1L6U A;  1I4Q A;  1KH0 A;  3BVZ A;  3T3O A;  2KQ4 X;  4HEA 1;  5H8Y E;  3U52 E;  2BB5 A;  2CU3 A;  4A6Q A;  1AW7 A;  3NZ3 A;  3MHZ A;  4HKQ A;  2KWD A;  4DXG A;  2W55 A;  4YT0 B;  4YTP B;  1PGB A;  2M56 B;  1EWY C;  1QOA A;  1YN3 A;  2DYM A;  2MJE A;  4OZA A;  1HXY D;  1DOX A;  1FMA D;  1T6B X;  3PZ7 A;  2MH7 A;  1XXG A;  3RPF C;  2QSD A;  3TEX A;  1SJE D;  1E6E B;  2PMV A;  2V4I B;  2WXH A;  1V8C A;  2WNM A;  5E6J A;  1DYQ A;  1OQQ A;  3B2G A;  4C80 A;  4RGN A;  1FXI A;  1I4G A;  3LXF A;  3TUO A;  1V1O A;  2RDH A;  2VZK D;  3AE3 B;  3ZJU A;  3NVW A;  1F2R I;  1C4A A;  4Q2J A;  4R3D A;  2GI9 A;  1L6V A;  5AUI A;  3AEG B;  1BUI C;  3BK2 A;  2D5G A;  3W5U B;  1A70 A;  2W3R A;  1PFD A;  1RWS A;  1EM7 A;  3AE6 B;  4OZC A;  1ESF A;  1JWU D;  5BYS A;  3DWM A;  3W9C B;  4IKG A;  1ZOY B;  4YSY B;  3FIL A;  1FCL A;  4WWM A;  4OVZ A;  1XLQ A;  4C7Z A;  2M0A A;  2W54 A;  5H92 C;  2WXN A;  1VLB A;  4ITK A;  2L83 A;  1TKE A;  1WGK A;  3AE4 B;  3VR9 B;  3W2D A;  2IPK D;  2LUM A;  1SB3 C;  1HEZ E;  3AE9 B;  1KTK A;  4HRS A;  3PZ8 A;  1TS3 A;  3U2S C;  4YSZ B;  2KDM A;  4XWW A;  3ABV B;  1WWT A;  2MEK A;  4ARI A;  1QOG A;  2ON8 A;  1ZE3 D;  4ZHP A;  4J3O D;  4N6E B;  3ZJT A;  3BVM A;  1VZ8 A;  1WSP A;  4H2A A;  1I4H A;  1UWX A;  5D3D A;  1L4Z B;  1V97 A;  3VRA B;  1ACC A;  1PYW D;  1ZDX A;  1ZDV A;  4WH4 A;  3SR6 A;  1FO4 A;  1V1P B;  1PGX A;  1SXT A;  3FAH A;  1YN5 A;  1GOZ A;  2YEP B;  1E7P B;  1E9M A;  2KAJ A;  2WXM A;  2K5P A;  4M0W A;  3R2T A;  2RDG A;  3IXS A;  2IDY A;  4KKJ A;  1AYF A;  1C4P A;  2JQR B;  3AE2 B;  4XDC A;  2JXT A;  3IAM 1;  3Q8A A;  2XN9 C;  1WRI A;  1SE2 A;  1Q10 A;  4RF1 A;  4RGO S;  3UI3 A;  4JX1 C;  3R8B A;  3DWG C;  4MAC A;  5C3J B;  3AEC B;  1D5Z C;  1D5X C;  2DWQ A;  2BS3 B;  4NAM A;  2G1E A;  1Y56 A;  2WXP A;  4WQM A;  2J52 A;  5HG2 A;  2HDE A;  4DQO C;  2X38 A;  1MVK A;  1TS5 A;  4RH6 A;  1KFY B;  2Y5C A;  1JWS D;  3W1S A;  1XLN A;  4AQ7 A;  2NMQ A;  2EEL A;  4C56 C;  4YTM B;  2IJ0 A;  1FNU A;  1B9R A;  5AUK A;  2GB1 A;  4US9 A;  1IGD A;  3V05 A;  2WXF A;  1ENF A;  1J7B A;  3R2I A;  5D3I B;  1SEB D;  1NVI D;  1CK1 A;  2PVG C;  1BXT A;  3URY A;  2PTL A;  4YWG G;  3I9V 1;  3Q8F A;  1NEN B;  1I7H A;  1AN8 A;  4WIP A;  3VRB B;  1VZ6 A;  5BYQ A;  2KAC A;  2AQ3 B;  1YNT E;  1I4P A;  2PLP A;  5JXV A;  4JWU C;  2LGI A;  1N63 A;  3TEZ A;  5TSS A;  1J7C A;  1QQR A;  1JAL A;  4KX6 B;  4JE3 B;  2K0P A;  2Y5P A;  1HZ6 A;  1TZO A;  3TEW A;  1XF5 L;  4A9A A;  3B9J A;  1YJJ A;  4MT5 A;  2BYT A;  2BB6 A;  2I38 A;  3H8H A;  4RNA A;  3KWV A;  2ICI A;  5EE9 A;  1KF6 B;  1ZP0 B;  2JYE A;  2K3U A;  1L0Y B;  1TJE A;  3LYY A;  1J7A A;  2EKI A;  1C79 A;  1VR9 A;  1CJE A;  1UUP A;  4JWS C;  4TQ0 A;  3P1M A;  2BS4 B;  5FR3 A;  1UGJ A;  4ARC A;  1IBX B;  3J9C A;  1K52 A;  4ZYS A;  1FFU A;  2DYO A;  2NTS A;  2L32 A;  3ZYY X;  2LJI A;  1FFV A;  2K22 A;  2RPV A;  5EE0 A;  3O13 A;  2V0G A;  1T3Q A;  1FM0 D;  2GRI A;  1CZP A;  1C77 A;  1ET9 A;  2MJ3 A;  2L52 A;  2R61 A;  4D2K A;  1JWA D;  1N61 A;  1XO3 A;  3KWL A;  2JX5 A;  3WCQ A;  1EU4 A;  3Q8B A;  3P63 A;  1C78 A;  1JQ4 A;  3HUI A;  3VQI A;  2CJO A;  1IGC A;  3B2F A;  2BW2 A;  4YXD B;  4ZOH C;  1B1Z A;  5HI1 A;  1KLG D;  1SF0 A;  1R7S A;  3AE7 B;  1RM6 C;  4USA A;  5BMI A;  3TEY A;  2Y3A A;  2ZW1 A;  1ZXI A;  1KRH A;  3TSS A;  1XEE A;  2JWU A;  4RGM A;  3ZJV A;  2OED A;  1FCC C;  4XE0 A;  1ZXH A;  1TS2 A;  5MPO A;  2J42 A;  1FIQ A;  1YQ3 B;  1XCT L;  4ZRP A;  1FNW A;  2KN4 A;  4GLS C;  1FEH A;  1ROE A;  2JU6 X;  4MM3 B;  1F2R C;  1SJH D;  1SE4 A;  2WXK A;  3BII D;  4UDU C;  3P4P B;  3N9Y C;  5FKA C;  2LHD A;  3RFZ B;  3IT6 B;  1FRD A;  2DBY A;  1VRA B;  2H89 B;  2LHE A;  3IAS 1;  3P4R B;  3P4S B;  2E6X A;  2QJL A;  2WXJ A;  4YSX B;  1TY2 A;  2WXQ A;  2YEP F;  2WDV B;  3AH7 A;  3MFG A;  2KMM A;  1TYG B;  2W3S A;  2LMC A;  3P42 A;  1YJI A;  2BTE A;  2IGG A;  4OZB A;  1FNV A;  2WXR A;  1QOF A;  4PT5 A;  1F77 A;  3HVD A;  3BZD B;  3PO0 A;  4CQN A;  3CWI A;  3MC0 B;  1K51 A;  5HFY A;  3U4E G;  1QLB B;  1EU3 A;  2V3P A;  3AN1 A;  2L1A A;  1YMH E;  2J4X A;  5D7G A;  1OQR A;  2JSV X;  1TY0 A;  1BML C;  2MJD A;  4REZ A;  3NVY A;  2AQ1 B;  1JML A;  1NEK B;  4JPS A;  1QF6 A;  5G5H A;  5I4D A;  4HRO A;  1E10 A;  1AWD A;  1I4R A;  3AE1 B;  1IUE A;  3KQ4 A;  2N7J A;  1RYJ A;  2HTM E;  4KKI A;  5HHD G;  2Q5W D;  1XLP A;  4TMA B;  2SAK A;  4FXC A;  1QIL A;  1ET6 A;  2WDQ B;  3C8Y A;  1N5W A;  1MHX A;  1P7E A;  2RMM A;  4L2Y A;  5GXG B;  4NAW B;  4HJG E;  1SSN A;  2ACZ B;  2IGD A;  5EE3 A;  3E9S A;  4RFB A;  1V1P A;  2CJN A;  2N9L A;  3GS2 A;  3L4P A;  2FUG 1;  4GDL B;  4KGT A;  4L1B A;  4A90 A;  1D4B A;  4A8X C;  2I2Y A;  4L23 A;  2VZK B;  3T3N A;  1JWB D;  4GDK B;  1MI0 A;  1UWM A;  2SEB D;  3FIL B;  2G9H D;  1E0Z A;  4OW0 A;  2AQ2 B;  2PKO A;  3HVZ A;  4TSS A;  3V3X A;  3BWU D;  2J53 A;  1L4D B;  4C7Y A;  1DOY A;  1YN4 A;  1I4X A;  2FBW B;  1XCQ L;  1K50 A;  2PVO D;  2TSS A;  4KGS A;  1F0Z A;  3AEB B;  2IGH A;  1CQV A;  3KLS X;  2B76 B;  1D5M C;  3SEB A;  3SFE B;  1FD6 A;  5BYR A;  2INN E;  3AV8 A;  3AMZ A;  1GB1 A;  1WXQ A;  1GPX A;  2XNA C;  4IDI A;  1RFK A;  2V3N A;  3BK1 A;  1DGJ A;  2QIL A;  1T5X D;  4N59 A;  1P7F A;  4B0E A;  2OHF A;  5C2T B;  3W5V B;  2LFI A;  1XLO A;  4IOI E;  1D6E C;  3Q8E A;  3SFD B;  1QT9 A;  2WXI A;  3Q69 A;  2AX5 A;  1TKG A;  1JRO A;  4HKZ E;  4XDD A;  5FK9 C;  1YQ4 B;  3EUB 2;  1QOB A;  1L0V B;  1UNS A;  2JZP A;  3NS1 A;  5BMH A;  4AS1 A;  3NRZ A;  1JRP A;  1STE A;  2Z8L A;  1MHH E;  2M19 A;  2WXO A;  3AED B;  2N0S B;  1HQR D;  1SE3 A;  1C9F A;  1PGA A;  3ETR A;  1TKY A;  2WS3 B;  4XWT A;  3VR8 B;  4WUR A;  4RF0 A;  4ZRQ A;  1GB4 A;  3Q8C A;  5T8I A;  2WXL A;  1DOI A;  4WAF A;  2JYT A;  4US8 A;  1SBB B;  1PDX A;  2PIA A;  4LLG M;  3GB1 A;  1ZPS A;  1OFF A;  4P6V F;  2K9X A;  3U7Z A;  4O1N A;  1N60 A;  3AEE B;  3OWE B;  1IBX A;  1SIJ A;  2WU2 B;  2ONQ A;  4A55 A;  1JW9 D;  1WYG A;  3AEA B;  2BS2 B;  2N9K A;  4TQ1 A;  1L0X B;  1VJK A;  3MP9 A;  2NTT A;  2WQY B;  4LK0 M;  2WU5 B;  5EE1 A;  3AE5 B;  1JCK B;  1ZUD 2;  1C4C A;  1VDV A;  2BBC A;  1GAQ B;  3BYY B;  5G5G A;  3NVV A;  1NYR A;  3AEF B;  4NZL B;  1FXA A;  4RGT A;  2WLB A;  4B0M A;  3ZGZ A;  2WP9 B;  5BMG A;  1N62 A;  4ZHO A;  1L5P A;  1MPE A;  1LO5 D;  1PUT A;  3IT4 B;  3NVZ A;  2QEJ C;  2WXG A;  4LTU A;  4DXF A;  1KLU D;  3AM9 A;  3I57 A;  2QIE B;  3FC4 A;  4N58 A;  1NYQ A;  1C76 A;  2E3T A;  4OHJ A;  3BVG A;  2PW9 A;  3AE8 B;  3HRD D;  1QKZ A;  2BT6 A;  2DLB A;  3CIR B;  1EWC A;  1HZ5 A;  1TS4 A;  2W82 A;  3AB5 A;  3E56 A;  1N5X A;  3GP7 A;  2INP E;  3P4Q B;  1VZ7 A;  1JWM D;  4MH8 A;  3EGR A;  1K53 A;  2ZW0 A;  3EA6 A;  1FRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...