1PGAA

Two crystal structures of the b1 immunoglobulin-binding domain of streptococcal protein g and comparison with nmr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two crystal structures of the B1 immunoglobulin-binding domain of streptococcal protein G and comparison with NMR.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
molecule tags Immunoglobulin binding protein
molecule keywords PROTEIN G
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1993-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgaA00
2IGHA 5BMIA 1K51A 4GLSC 4OZCA 1JMLA 4HJGE 1PGAA 2GI9A 2RMMA 2KACA 1P7EA 1PGBA 1P7FA 3V3XA 2J53A 4KGRA 3FILA 4HKZE 3GB1A 1PGXA 2LGIA 2PW9A 1YMHE 1MHHE 1EM7A 1XCTL 2PLPA 2J52A 3MP9A 1XF5L 4IKGA 1IGDA 4KGTA 2K0PA 2QSDA 4KGSA 1GB4A 2JWUA 2KWDA 2PTLA 1K52A 2N7JA 2N9LA 2EELA 5HI1A 2JU6X 1Q10A 1F2RC 2I2YA 1FCLA 2JSVX 2QMTA 4D2KA 3UI3A 4IOIE 2NMQA 1YNTE 1FCCC 1HEZE 1FD6A 2I38A 5BMHA 2KDMA 1F2RI 2LHEA 4MACA 2KN4A 1IBXA 4WH4A 1GB1A 2N9KA 2IGGA 2LUMA 3FILB 2ON8A 2KQ4X 1KH0A 2RPVA 2JXTA 2ZW1A 5HHDG 5HG2A 1HZ6A 2ONQA 1C9FA 1MVKA 2OEDA 1MHXA 1IBXB 2IGDA 1K50A 1D4BA 5HFYA 1UWXA 2LHDA 1MI0A 5JXVA 1ZXHA 1K53A 2GB1A 1IGCA 2JZPA 1MPEA 1QKZA 1XCQL 1HZ5A 4OZAA 5BMGA 2ZW0A 4OZBA
chains in the Genus database with same CATH superfamily
1E6EB 3ZDMC 3HM6X 4HEA1 2KTFA 2ZCBA 4P1CC 2RMMA 2JRHA 1PGBA 1R4MI 2AQ1B 4I6PA 2KQSA 2WX1A 2IO2B 3APCA 3DOWA 3B1LX 3QWZB 3ZUNA 1I4XA 2WXMA 5TR5A 2PKOA 2LEKA 4FLHA 2J52A 1TKEA 4UDUC 4EZJA 1YX5B 3N30A 1TIFA 2CU1A 2PJHA 4K3BA 5AUKA 4WJQA 1Q1OA 4G11A 2L1AA 4BBNF 2AL3A 2V4IB 5D3DA 4XDCA 3W1SC 1FD6A 2MBQA 1TJEA 4RF0A 1V2YA 2LHEA 4W9IA 2LJIA 3NHEB 4GIVA 2AQ3B 2GBNA 2NBVB 2N7DA 2FE8A 1MG4A 3IXSA 4IM2A 3DBHB 4YSYB 3RYTA 2BW2A 3RCZA 2MA9B 3BYYB 1SB3C 3FKYA 3UINB 3A4RA 1WJUA 3VAWA 4JE3B 1KM7A 1T5XD 4XGAB 1TS5A 4HPMB 5G5HA 4OW0A 3H8HA 4KKIA 4O1NA 2KLCA 3CSTA 2Z8LA 1TS3A 1UUPA 3BIID 4M01A 1BMLC 2H88B 2J7QB 2J53A 1YQ4B 1N63A 4MGIE 4HKZE 1FMAD 3KYCD 4NJ7A 4B0MA 4RM9A 2BWES 1QILA 4M0WA 3NJTA 1FEHA 1SSNA 2BS2B 2DENB 4RGTA 1YJIA 1YD8U 2LASA 2ZJDA 4JWSC 1R4NI 1N5XA 3PGEA 3K9PB 3AMZA 1I4PA 2M4NA 4GDLB 5FKAC 1K52A 2N9LA 2QJLA 2MX2A 2KX0A 4YWGG 3TIXA 2ZZPB 3CSFA 2BQQA 3TBLD 1HEZE 5D7GA 2NBWB 1V97A 4ASWC 4DK5A 3DCGA 1JQ4A 4P7IA 1YJJA 2M1MA 1L7YA 4WJPA 1SE9A 2CS4A 1T0RC 3SD5A 1VDVA 2WXOA 3DBLB 5KHQA 1E7UA 3MC0B 2GOWA 3QJZA 1OQYA 2C7MB 1E8XA 3PREA 3JW0X 1NI3A 2JQRB 4YT0B 2GRIA 4PK1A 3SFEB 2QC8A 4KIKB 1OGWA 3I9V1 3P63A 2JYEA 1GNUA 3RT3B 2WLBA 1SE2A 3Q69A 1K50A 2IO0B 2MRPA 4FJVB 3GP7A 3ZXRA 1B1ZA 1AYFA 3L13A 3NZSA 1TZOA 1L4ZB 1ZXHA 3N20C 1SBBB 2HTHA 2JRIB 3FC4A 4GOCA 3U7ZA 2ZNVC 1FNWA 1IPGA 3OWEB 1E5WA 2WXKA 2FNJB 3NRZA 2HTME 5DPSA 4DQOC 3I57A 4LCDE 3QQ8B 1NVID 3VTVA 4X57B 5G5GA 4MJSB 2KACA 3A9JB 2WXIA 4ANUA 1C79A 4C7ZA 5IN7A 4LDTB 2QHOA 3AE6B 1J7CA 4TQ0A 4DXFA 3A9KB 2MH7A 4H2AA 4TSSA 2XK5A 4YL8A 1GB4A 3ABVB 1QOFA 4NZLB 4JX1C 5KHOA 1L2NA 2LGDA 3RNEC 1Q10A 1F2RC 2J0KA 4EOYA 2V9HA 1EUVB 1FXTB 4B6WA 4QAYA 4OVVA 2WXRA 4ZRKA 3ZDTA 1AWDA 2N9PC 3N9YC 3TJPA 1CJEA 4HJKA 1EWYC 3LJ3A 2N9KA 2DBYA 2IGGA 2KFJA 3VFKA 4AQ7A 4TKNA 3DBRI 1DYQA 3QHTA 1WSPA 2G4DB 3DWMA 1EU4A 2XK5B 2UYZB 2KQ4X 2L3ZA 1QOAA 4WWPA 3ENEA 2JXTA 3PV1A 3AEFB 4ARCA 1MHXA 2PVGC 4IUMB 3LYYA 3MFGA 4PT5A 3R8BA 2CHZA 1ZGUB 2G45B 4NQLB 5HKHA 1L5PA 3JYUA 2N4FA 1TT5B 1MPEA 4LNFA 1AARA 2L8JA 2KWVB 1JWUD 1C4PA 3IG3A 2YVCA 4GGQA 2M56B 3Q3MC 1EF5A 3BVMA 2KWUB 4A8XC 3DPDA 4E71A 2I1JA 1E90A 1E8WA 1HXYD 2BT6A 2BB6A 1XXGA 2EMSA 4AOFA 2JWZA 2REXA 1J8CA 2XEWA 1EO6A 3Q8FA 4US8A 3ZLZA 1J7AA 4EZKA 1IGDA 4FN2A 2NS5A 3T3OA 3RPFC 1WFYA 3V05A 3L0WB 4E3CA 4TV3A 2J42A 3HIZA 4FHJA 1UF0A 1JRPA 4D2KA 2B3AA 3P42A 4A9AA 2VZKB 1SE3A 2WXNA 3WAMA 3KUDB 2CHXA 2FCSA 1UWMA 2AX5A 3C8YA 3DHIC 3QIJA 4WH4A 3AECB 4N9F4 5GXGB 3UQBA 5FR6A 4GB9A 2MP2B 1HQRD 2LVOA 1WY8A 3VRAB 1SXTA 1IUEA 1YIWA 1RFAA 2MBOA 1MVKA 4OVUA 2G4SA 4KDLB 3AM9A 2KTRB 5H92C 3I5JC 4WWOA 4FHKA 3VDZA 4ZYSA 1A5RA 2INDC 1L4DB 2AWTA 4MDKE 4LK0M 2L76A 2QDFA 3H7SA 4AUQC 1VLBA 1ET9A 1CK1A 3B2GA 4OZAA 4OZBA 3Q14C 4EUTA 4HJGE 1PGAA 3PSEB 2QIEB 1RFKA 5EE3A 1V81A 3T3NA 3FILA 5IOIA 3KW5B 2LFIA 1UD7A 2LVPA 5J17A 2J4XA 4TUUA 2ICIA 1WXMA 2GBKA 5J18A 3CIRB 2KVRA 4ZDVA 1YJ1A 3TEZA 2KXJA 2K3UA 2NPTA 1FIQA 1TY2A 1UH6A 2JU6X 1FCLA 1ET6A 2O6VD 3ZTDA 2HE7A 4M00A 2GLSA 1JROA 3AEGB 4HCPB 3PRMB 3NUHB 3EFCA 1XEEA 1V1OA 3L08A 4N59A 3EC8A 3SU8X 3BY4B 2KD0A 2VH1A 3GE3C 3AE5B 2IO1B 3BZDB 2NVUI 1T0YA 4MJSA 5IAAC 3W1SA 5FR3A 3AE9B 3D32A 3Q2AC 1E0ZA 4LJOB 3RNAC 2GBMA 5G55A 3HHMA 4KDIC 2L7RA 1R7SA 1NYQA 2ZNVB 3NZ3A 3N1XC 2D10A 1IGCA 2N0SB 2LD9A 1Y8RC 3I3TB 4FBJB 3RI7C 3O65B 3AXCA 4EKUA 4A90A 2GMIC 2D2QA 5D2MB 1VR9A 4DBGA 1JALA 1QQRA 3EUB2 5BYSA 3BYTB 3VQIA 2PMVA 2CJOA 4ZYNA 3RNCC 2PE9A 4II2B 2HJ8A 2MBHA 2EMTA 1ENFA 1S3SG 1V1PB 3HRDD 1WGYA 1UELA 2YEPF 2K0PA 5C23A 5IA7A 3PRPB 4YSZB 2N7JA 4BKGA 2BBCA 1FNVA 4K1RB 1YOVB 2BVCA 3AE2B 2QMTA 3KYDD 3ZRCA 5EDSA 2K8HA 4GDKA 1Q5WB 4XE0A 2PVOD 2FCNA 5BMHA 2BGFA 2WX0A 4KV2A 3WAOA 1F2RI 2K9XA 3AEBB 2WXHA 3A4SC 1N6ZA 2KFKA 3IVFA 1IYFA 5DCNA 4B95A 1ISNA 1WMHA 3A9JA 3CF6E 1R4MB 1E8ZA 1SIFA 4RMAA 4BFRA 4HPPA 1OTRB 1TBEA 3DBRB 2LVQA 3TMPB 4FULA 4K7SA 4CYEA 4KZCA 3IBEA 3V6EB 1D4BA 2W3RA 5HFYA 2NPTB 3ZIMA 5IO9A 4ANVA 2L0FA 4NJ6A 1WRIA 1ZP0B 4L1BA 1LXDA 4PS7A 2AYOB 4K3CA 4NNJB 4P16A 3V61A 3KUZA 2TSSA 1P98A 2J0MA 4GLSC 5L83A 1FM0D 3ETRA 5JH5C 4AWJA 1I4HA 2K6QA 3V3XA 3DVNV 4WJOA 4BKTA 4WQMA 2LJ5A 3ZW3A 1FRDA 2KYWA 2ZPNA 2K8BA 4WURA 1ROEA 1EM7A 1NI2A 3DBHI 4HK2A 3MJWA 3HK0A 1KTKA 2RR9A 2D3AA 2INPE 1WZ0A 4C00A 3V60A 2MW5A 1C76A 2ZPYA 3PVLA 4ZRJA 4WAFA 1V9JA 4AJYB 4M0WB 2GBRA 2YEPB 3WANA 2KDMA 4MACA 2KN4A 1ZXIA 3RULA 3M62B 1DGJA 2HDEA 1GB1A 3DHGC 1WWTA 4I6NB 5E6NA 4LNKA 2MQJA 4DXGA 2V3PA 2Z59B 3WCQA 1NYRA 3Q3JA 2JPHA 2UWQA 3ZGZA 3ZO5B 4B9KA 2ZVOA 3EGRA 1TKYA 3H6NA 1GPXA 3RZWC 1I4RA 1WGHA 1I4GA 4J3OD 1K53A 4LTUA 1V6EA 1WGRA 3WIMA 4HCNB 4LJPB 1J19A 3ONSA 2ASQA 4IWPA 2DHZA 3VH4B 2KOXA 3U7DA 4P1BC 2GI9A 3QAQA 2L52A 2DAJA 2KDFB 1P7EA 2D5GA 3GS2A 2IJ0A 2D3GA 3MP9A 3AEDB 1J7BA 4W9DA 3QK0A 2KANA 3EHVA 2K5PA 3NS8A 4KGSA 4JLCA 4N6EB 1WZ3A 3VHTC 2RDHA 4W9HA 2EELA 5HI1A 4CQNA 3AU4A 3B2FA 3DVGY 1MJDA 4W9JA 4C56C 3A1QB 4IOIE 1TS4A 1YNTE 2FBWB 2KX3A 2PE6B 3DQVA 2M0AA 3UIOB 2C60A 1BUIC 2QEJC 5CX3A 3T8MA 4KSLC 2NTTA 3BK1A 3VTWA 3ZJVA 1WXVA 2L32A 3M3JA 3BVGA 3OAWA 3FILB 2ON8A 3N1ZC 2X38A 3N32A 4RF1A 3N1YC 3MHSD 1L6VA 1MG8A 4US9A 2MBEA 1ZKHA 2OEDA 1FXIA 4HRSA 5C1ZA 3L54A 1MI0A 3V62A 4PYUA 4BOSC 3AB5A 3VUWA 1WE7A 1LGRA 2AL6A 2RD0A 3VRBB 5CHVC 4F8CB 5BMIA 2J0JA 3KH0A 1WYGA 3PPAA 4URKA 1GJZA 4NPNA 4OHJA 2YLMA 1JRUA 2HD5B 4JGHB 4KGRA 3L10B 1TKGA 4BZAA 1JCKB 4YTPB 2MWSB 2D07B 4XX5A 2MHJA 1HE8A 4YTMB 1SF0A 4NAMA 4HKQA 3K9OB 4W9CA 1XCTL 2ZEQA 3BK2A 1FFUA 2KDEB 1V5OA 1N62A 3VR8B 1OQQA 1RWSA 1WXQA 3TUOA 1OEYJ 4K81A 3AE8B 4IDIA 1TS2A 1ZDVA 1GAQB 4EE2A 2LZ6A 2I2YA 2JSVX 1E7VA 2WQYB 2X8XX 5LLIA 3GZNB 2QILA 4MGYE 4KVGB 1WJNA 2LWPA 3R2IA 2LMCA 3R66C 3VR9B 1T0QC 3GZNI 3AEAB 3Q3FA 3Q8BA 2LGSA 3C0RB 2LXAA 5MPOA 1HTQA 2WDRB 2NBUA 4P6VF 3B08A 2OHFA 2KVZA 4RNAA 1WX8A 3VXWA 1RLFA 4YXDB 2AQ2B 1SGHA 3W5VB 2WNMA 3SFDB 3PLVA 2UU7A 1HZ6A 2ONQA 1D5MC 3AI5A 5LXIB 4JPSA 3W9CB 1UWXA 1Q0WB 1FNUA 1XLOA 3NVZA 1IP9A 4JL9A 4MH0E 3W1YA 2HJ1A 3W5UB 2JZPA 1HA5A 2G3QB 3ZNHB 5D94A 2M17A 1UZXB 2DZKA 3PTFC 2DWQA 3NG0A 5DPRA 1L0YB 4A55A 3TEWA 4DHZE 4JQWC 1FXAA 2KMCA 3PLUA 2ZVNA 2Y5CA 3UGBB 1WJ6A 2LGXA 4GDKB 1SJHD 2WHIA 2BYTA 4XZ4A 3Q3NC 2MSED 1YMHE 3BWUD 3TCAA 2KLGA 5E6JA 1YQ3B 4DWFA 2KWCA 3DDCB 2KQ7A 3AH7A 3AEEB 3PO0A 2KJ6A 4ZRIA 3IFWB 3ZNGC 1SIJA 4LNNA 4PYZA 1TZ1A 4W9LA 2KMMA 3IAM1 1I42A 1F52A 1FPYA 2I38A 3ALBA 1V5TA 4FJYA 2GBJA 1LO5D 3BINA 1IBXA 2OJWA 1UGJA 5L95C 2KT7A 1E8YA 5C2TB 1N60A 2BS4B 5BYQA 2FIDA 1C4CA 2SAKA 2BYEA 3Q6BA 4RFBA 2CU3A 3ZYYX 3ZXVA 1X1MA 2AEHA 2Y5PA 3JSVB 1I35A 4A3OA 2FAZA 2RPQA 1ESFA 3BVZA 4ARIA 2JF5A 3ZTCA 2IY0B 4EZLA 4MSQB 1KLUD 2KDBA 2C9WB 1WE6A 3P2BA 4RGNA 1R4NB 4JIOU 2QCZA 3MC8A 2D11A 4HWIB 3W2DA 2N7EA 2KMAA 3ZNID 4DXAB 1WGKA 4KSKC 3VTUA 3LDZE 2SEBD 4M02A 1D5XC 2KTRA 4DDID 1PFDA 3VUXA 4KIKA 3WALA 2WXLA 3EECA 2Q5WD 2LRWA 4DDGD 1U4AA 4BKSD 1WGGA 2WXGA 4BKSA 5AZFA 2IZVB 2KKCA 4GMVA 1FFVA 4II3B 1XQQA 4CHKA 4MGZE 3HUIA 4IKGA 4AS1A 4KGTA 4MM3A 3TL5A 3DVNU 2W3SA 3FAHA 4MM3B 2MCNB 2JWUA 1ZOYB 3MTNB 2W9NA 2PPHA 5AZHA 1TGZB 3N3KB 2IY1B 1GC6A 2WYQA 1XO3A 4IWOA 1UBQA 1T6BX 4S0RA 2BS3B 4K7UA 4R3DA 4ZRQA 3P1MA 3R2TA 1KFYB 1GC7A 3SHQA 3KWVA 2DX5B 1WIAA 4BBNC 2CJNA 2WP9B 5EE9A 3Q3OC 1MFWA 4HLEA 4AJWA 1KLVA 3U52E 1UBIA 3PHXB 2LUMA 2DYOA 4DHJB 4XDDA 1V80A 1QT9A 4L23A 2D3BA 1XLNA 4GU2A 2L0TA 3ZJTA 4ACFA 1F9JA 4TQ1A 2EKIA 5DPTA 3ECIA 2N1WA 3DBLI 2CHWA 1C3TA 1OFFA 3VH3B 2M19A 2LRUA 3H7PA 4MGKE 1FO4A 1QOGA 4XC2A 2BB5A 2XBBC 2MP2A 2RDGA 2L05A 3L17A 5JHAA 4BAXA 2RDBC 4Q2JA 1VZ8A 2JXXA 3KQ4A 2Z0DB 3A33B 3NS1A 2JVCA 4WWMA 4CO7A 2IGHA 1JMLA 1WGDA 3LXFA 3Q8EA 2OJRA 3OJ3A 1T0SC 1QLBB 1P7FA 2BYFA 2E3TA 2KAJA 1WXAA 5JZEB 1GG3A 3I63C 1PGXA 3NZUA 2IPKD 2PW9A 3IAS1 4NQKE 1BT0A 1DOYA 4ITKA 4KX6B 1WM2A 3NY5A 1WXSA 4C80A 1C4AA 1QF6A 2ZCCA 2O6VA 2PIAA 4KZ0A 4FJZA 2Z0EB 1S1QB 1P9DU 1C1YB 4M8NA 4AP4C 1RM6C 4L2YA 2Y5BB 2M0XA 1VZ6A 3AE4B 2NMQA 1XT9B 2JX5A 3APDA 3X23A 2VH2A 5LNK1 2WU5B 1RAXA 1KOTA 3T9LA 3SR6A 3RNFC 5E6PA 1YN3A 1Y56A 2KO3A 1JWSD 5E6OA 1JWMD 2DZIA 3AULA 2H89B 1WJ4A 5IKCM 4WJNA 4ZRPA 2N9EB 4IM3A 3SEBA 1BXTA 3QA8A 3PS6A 2N1VA 4OVZA 2XN9C 1DOIA 2DNFA 3AN1A 3M95A 3NVYA 2FUHB 1IBXB 3GE8C 2WDVB 4MEMA 1H8CA 2R2OA 4WWNA 2WXJA 3DHHC 3IT4B 2W82A 5G2NA 1WRDB 3P4QB 4LLGM 5EE1A 3L4PA 2IYDB 2LXCA 1AN8A 2A4ZA 1OQRA 4OZCA 2N9XA 1KLGD 4RGMA 3U2SC 2LGYA 3AU5A 1VZ7A 3HVZA 1ZW7A 1N61A 3B9JA 2O2VB 3QARA 4XWWA 2FIFA 3AE3B 1MHHE 3MHZA 1TYGB 3QC8B 2BYVE 1DOXA 2C7NB 3PHWB 4A20A 4I6LB 2KWDA 3KLSX 1NEKB 1E10A 2CR5A 4ZHOA 4GN1A 3WAPA 4W9FA 1WH3A 1J0GA 4W9EA 4ICVA 2LI5A 1A70A 5AUIA 3P4RB 1VRAB 3TEXA 1FCCC 3UIPB 2C7HA 4C4VB 2IO3B 5I4DA 3GOEA 4BOZB 4LDTD 3LB8C 4M8MA 4ANWA 3P4PB 5AEKB 4EEWA 4PS8A 1V86A 2KZRA 1SJED 2K25A 2K1FA 3PZ8A 3H1UA 3APFA 1N5WA 5DPWA 3P4SB 4DHZB 2BPSA 3H7PB 3MJ5A 1PUTA 1D5ZC 4G3XB 2IGDA 2BKRB 4RM8A 4YTNB 3Q8AA 4C4VA 3ZQ4A 2VRRB 1WF9A 2Y3AA 4ZOHC 2WU2B 3OLMD 2G9HD 2VZKD 2WDTB 4IC7B 2BWFA 4F1SA 3RD2A 3ML9A 4MT5A 1XCQL 5H8YE 3R7RA 3B0AA 1EU3A 3PRZA 4C7YA 2EKEC 1SE4A 5GMVA 3QCAA 1HTOA 4A6QA 1PYWD 1WX9A 4GSWA 4N58A 3GB1A 4K7WA 2V3SA 1H4RA 2WDQB 4LNIA 2L83A 2O6VB 2DZJA 2XNAC 5D6JB 4ZHPA 4XYCA 4G50A 3HVDA 5JHBA 5AZGA 2KJHB 2DYBA 1C78A 1Z5SB 2QSDA 3URYA 1QOBA 3EFUA 1D6EC 1LFDA 4HXDA 4J6IA 2FCMA 4GXBA 4YSXB 3VVWB 1RYJA 2PEAA 3OJ4B 1WM3A 1AW7A 2KDIA 4XWTA 1ACCA 1QZEA 2BTEA 1WYWB 4EFOA 2DAFA 5T8IA 3PT2B 4F7ZA 3DVGX 3MC9A 2I1KA 2KHWB 1JWBD 1OEYA 4E74A 5CHFA 1TTNA 1YQBA 1LM8B 3U4EG 1TY0A 2ACZB 3Q8CA 4RCOA 2MLBA 1WMHB 1V1PA 3U8ZA 2WS3B 2V4LA 5TSSA 4S17A 1KH0A 1XD3B 2RPVA 1V8CA 1F0ZA 2MJDA 1M4VA 3L16A 1VD2A 3IT6B 5HG2A 2B76B 1EWCA 2E6XA 1GUAB 2DLBA 1YN5A 4WQOB 4MSMB 4WAAA 3UF8A 1WI0A 2M8SA 2IDYA 3H9DA 4NJCA 3A9KA 2FCQA 4G0NB 2RGFA 3U30A 1G6JA 2KNBA 4RGOS 3CWIA 2ZW0A 4HVBA 3HM3A 3JSVA 3NOBA 1NDDA 3RMKC 5IP4D 3V6CB 4B0EA 5LXHA 3RZFA 4RH6A 1WR1A 1GOZA 3PZDA 2JZZA 2JT4B 2MBBB 2NR2A 3NVWA 2WGSA 1KRHA 2LGIA 1YX6B 1VCBA 1I7HA 1JWAD 3RFZB 1I4QA 2KK8A 2CKHB 4NY0A 4DHJD 1XF5L 5C3JB 3E9SA 2JUOA 3DWGC 4LNOA 1Z2MA 2LUEA 2PTLA 1SEBD 2G1EA 1ZDXA 3ZRFA 3S2AA 3UI3A 1VJKA 2DZMA 5CHWA 1M94A 2K22A 2WXQA 1JW9D 2WWZA 3RN9C 4KKJA 4REZA 2V0GA 3X0WA 1NENB 3EA6A 3RNBC 2MJ3A 3UQAA 1F77A 2IBIB 1P3QU 2OOBB 4JWUC 4USAA 4HPLB 1NBFC 2KC2A 2ZW1A 2V1YA 3QX1A 1KF6B 4A3PA 2K39A 1LQBA 1V49A 2DYMA 5BYRA 4MH8A 3KUCB 4TMAB 3R7QA 3WA0A 3ML8A 5D3IB 2O2VA 5BO4B 2LHDA 3IHPC 3C19A 3PZ7A 5JXVA 4IG7B 3DBSA 4ANXA 4W9KA 1F1HA 5J2RA 2NTSA 2V3NA 2WXPA 3NVVA 1ZUD2 3OG5A 4MELA 4W9GA 2WXFA 4FADA 1K8RB 5BMGA 4HDOA 1STEA 2NCNA 3A1QA 1K51A 2K6DB 3JVZX 2MJEA 2JY6A 4NAWB 3TEYA 1CZPA 2JYTA 4NAWA 3O13A 4IM0A 3E56A 3VUYA 1KJTA 2JZ3B 1T3QA 3TSSA 5FK9C 2A5UA 2INCC 3ZKJC 2FUG1 2PLPA 3AV8A 3AE7B 3KVFB 5EE0A 1FRRA 4IW0A 4WIPA 2K8CA 1CMXB 3RNGC 1C77A 1WR6E 1EF1A 2KN5A 4HROA 1P1AA 1RRBA 1YN4A 4HDQA 2W54A 1PDXA 2L00B 2BF8B 1B9RA 4FA6A 1UNSA 3KWLA 1XLPA 4PS3A 3ZVVA 2KC1A 4ICUA 1L6UA 2W55A 3RUIB 2D3CA 1WX7A 2BKFA 2R2QA 4FXCA 3SDLC 2R61A 1D3ZA 1ZPSA 1ZE3D 3AE1B 1P0RA 4IWQA 1L0XB 3ZNZB 5HHDG 1C9FA 1PQSA 1E9MA 2RSUA 2KFKB 1E7PB 1CQVA 1L0VB 1UGMA 4GDLA 2INNE 2C5LC 1XLQA 2GB1A 2MEKA 5CTRC 3CMMB 3R3MA 4BVUC 3J9CA 2KJRA 1QKZA 1HZ5A 3M63B 3ZJUA
chains in the Genus database with same CATH topology
1E6EB 5BMIA 1OQRA 4OZCA 4HEA1 4HJGE 1WYGA 1KLGD 4RGMA 3U2SC 1PGAA 2RMMA 2QIEB 1RFKA 4OHJA 1PGBA 1VZ7A 2AQ1B 5EE3A 3HVZA 4KGRA 1N61A 3B9JA 3T3NA 3FILA 1TKGA 4XWWA 1JCKB 4YTPB 2LFIA 4YTMB 1SF0A 3AE3B 4NAMA 1I4XA 2WXMA 4HKQA 2PKOA 2LEKA 1MHHE 1XCTL 3MHZA 2J52A 1TYGB 1TKEA 4UDUC 3BK2A 1FFUA 1DOXA 1N62A 2J4XA 1OQQA 1RWSA 2ICIA 1WXQA 3VR8B 3CIRB 3TUOA 2KWDA 3TEZA 3AE8B 5AUKA 2K3UA 4IDIA 1TS2A 3KLSX 1NEKB 1ZDVA 1GAQB 1E10A 1FIQA 1TY2A 2JU6X 4EE2A 4ZHOA 2I2YA 1FCLA 2L1AA 2JSVX 2WQYB 1ET6A 2V4IB 5AUIA 1A70A 3P4RB 1VRAB 3TEXA 1FCCC 2QILA 5D3DA 1JROA 3AEGB 5I4DA 4XDCA 1FD6A 3R2IA 2LMCA 1TJEA 3NUHB 4RF0A 2LHEA 1XEEA 3VR9B 3LB8C 1V1OA 3P4PB 3AEAB 3Q8BA 5MPOA 2WDRB 4N59A 4P6VF 2LJIA 2OHFA 4RNAA 1SJED 4YXDB 2AQ2B 3PZ8A 2AQ3B 3W5VB 3AE5B 2WNMA 1N5WA 3SFDB 3BZDB 3P4SB 2FE8A 3W1SA 5FR3A 1HZ6A 2ONQA 1D5MC 3IXSA 3MJ5A 1PUTA 1D5ZC 3AE9B 2IGDA 4JPSA 4YTNB 1E0ZA 3Q8AA 3W9CB 1UWXA 4YSYB 1R7SA 1FNUA 3ZQ4A 2BW2A 2Y3AA 1XLOA 1NYQA 2WU2B 3BYYB 1SB3C 4ZOHC 3NZ3A 2G9HD 3NVZA 2VZKD 4JE3B 1T5XD 1IGCA 3W5UB 2JZPA 2N0SB 1HA5A 1TS5A 4MT5A 1XCQL 5G5HA 5H8YE 4OW0A 3H8HA 4KKIA 4O1NA 2DWQA 1L0YB 4A55A 3TEWA 4A90A 2Z8LA 1EU3A 1FXAA 4C7YA 1SE4A 1TS3A 1UUPA 1VR9A 2Y5CA 3BIID 1JALA 4A6QA 1BMLC 1QQRA 2H88B 2J53A 1PYWD 3EUB2 1YQ4B 1N63A 5BYSA 4N58A 3BYTB 4HKZE 3GB1A 3VQIA 2PMVA 4GDKB 1FMAD 2CJOA 1SJHD 4B0MA 2BYTA 1QILA 2WDQB 4M0WA 1YMHE 2L83A 1FEHA 2XNAC 1SSNA 2BS2B 1ENFA 4ZHPA 1V1PB 3HRDD 3BWUD 4RGTA 1YJIA 3HVDA 2YEPF 1C78A 5E6JA 2K0PA 2QSDA 3URYA 4JWSC 1YQ3B 1QOBA 1N5XA 1D6EC 3AMZA 1I4PA 4GDLB 5FKAC 1K52A 2N7JA 3AH7A 2N9LA 3AEEB 3PO0A 4YSZB 2QJLA 4YSXB 2BBCA 1FNVA 1SIJA 4YWGG 3AE2B 2QMTA 1RYJA 1HEZE 5D7GA 1AW7A 2KMMA 4XE0A 4XWTA 3IAM1 2PVOD 1V97A 2I38A 5BMHA 1ACCA 1JQ4A 2BTEA 1F2RI 1YJJA 2K9XA 3AEBB 2WXHA 5T8IA 1LO5D 1IBXA 1UGJA 1JWBD 1VDVA 2WXOA 5C2TB 3U4EG 1TY0A 2ACZB 1N60A 2BS4B 3MC0B 3Q8CA 5BYQA 4RCOA 1C4CA 1NI3A 2JQRB 1V1PA 2GRIA 2SAKA 4YT0B 4RFBA 3SFEB 2WS3B 2CU3A 5TSSA 3ZYYX 1KH0A 2RPVA 3I9V1 1V8CA 2Y5PA 3P63A 1F0ZA 2MJDA 1M4VA 2JYEA 3IT6B 5HG2A 2B76B 1ESFA 3BVZA 4ARIA 2WLBA 1SE2A 3Q69A 1K50A 1EWCA 2E6XA 1KLUD 1D4BA 2DLBA 2W3RA 3GP7A 5HFYA 1B1ZA 1YN5A 1AYFA 4RGNA 1TZOA 1L4ZB 1ZXHA 1SBBB 1WRIA 1ZP0B 3FC4A 3W2DA 3U7ZA 4L1BA 2IDYA 1FNWA 4NJCA 3OWEB 1WGKA 2WXKA 2SEBD 3NRZA 4P16A 2HTME 4RGOS 1D5XC 3CWIA 4DQOC 2ZW0A 2TSSA 1PFDA 3I57A 4GLSC 2WXLA 4B0EA 1FM0D 1NVID 4RH6A 2Q5WD 5G5GA 1GOZA 2KACA 3ETRA 1I4HA 3V3XA 2WXIA 4WQMA 1C79A 3NVWA 4C7ZA 1FRDA 1KRHA 2LGIA 2WXGA 3AE6B 1J7CA 4TQ0A 4DXFA 1I7HA 1FFVA 4WURA 1JWAD 3RFZB 2MH7A 1ROEA 1EM7A 1I4QA 3HUIA 1XF5L 4IKGA 4H2AA 5C3JB 4TSSA 4AS1A 4KGTA 3E9SA 1GB4A 2W3SA 3FAHA 4MM3B 2JWUA 3ABVB 1QOFA 1ZOYB 3DWGC 1KTKA 4NZLB 2PTLA 4JX1C 2INPE 1SEBD 1C76A 1Q10A 1F2RC 2G1EA 1ZDXA 4WAFA 3UI3A 1XO3A 1T6BX 1VJKA 2BS3B 4R3DA 4ZRQA 3P1MA 2WXRA 2K22A 2WXQA 1JW9D 2YEPB 1KFYB 3R2TA 2KDMA 3KWVA 1AWDA 3N9YC 1CJEA 4MACA 2CJNA 2KN4A 1ZXIA 1EWYC 2WP9B 4KKJA 4REZA 5EE9A 1DGJA 2HDEA 1GB1A 2V0GA 1WWTA 2N9KA 2DBYA 2IGGA 3U52E 2LUMA 2DYOA 4AQ7A 4XDDA 1NENB 3EA6A 1DYQA 1QT9A 2MJ3A 4DXGA 1F77A 2V3PA 4L23A 1WSPA 1XLNA 3DWMA 3ZJTA 1EU4A 4JWUC 4USAA 3WCQA 2KQ4X 1NYRA 1QOAA 2JXTA 3ZGZA 2ZW1A 1KF6B 3AEFB 2EKIA 4TQ1A 4ARCA 3EGRA 1TKYA 1MHXA 2PVGC 2DYMA 5BYRA 4MH8A 4TMAB 1GPXA 3LYYA 5D3IB 3MFGA 4PT5A 1OFFA 3R8BA 2LHDA 2M19A 3PZ7A 1I4RA 4J3OD 1I4GA 5JXVA 1K53A 1L5PA 2NTSA 2V3NA 4LTUA 1FO4A 2WXPA 1QOGA 3NVVA 2BB5A 2RDGA 1MPEA 1ZUD2 2WXFA 4Q2JA 1VZ8A 5BMGA 3KQ4A 3NS1A 1STEA 1JWUD 4WWMA 2IGHA 1K51A 1JMLA 3LXFA 3Q8EA 2MJEA 2GI9A 4NAWB 2L52A 1C4PA 2M56B 1P7EA 1QLBB 1CZPA 1P7FA 2JYTA 3TEYA 2E3TA 3BVMA 2KAJA 2D5GA 3O13A 4A8XC 3GS2A 3E56A 1PGXA 1T3QA 3TSSA 1HXYD 2IPKD 2BT6A 2BB6A 5FK9C 1XXGA 2PW9A 3IAS1 2IJ0A 2FUG1 1DOYA 2PLPA 4ITKA 3AV8A 3Q8FA 4KX6B 3AE7B 3MP9A 5EE0A 4US8A 3AEDB 4C80A 1J7BA 1FRRA 1C4AA 1J7AA 1QF6A 1IGDA 2K5PA 4KGSA 2PIAA 4WIPA 3T3OA 1C77A 3RPFC 4N6EB 3V05A 2RDHA 4HROA 1RM6C 4L2YA 2EELA 5HI1A 2J42A 4CQNA 1YN4A 1VZ6A 2W54A 1PDXA 3AE4B 3B2FA 1JRPA 4C56C 4D2KA 1B9RA 4IOIE 1UNSA 2NMQA 1TS4A 2JX5A 1YNTE 2FBWB 3KWLA 1XLPA 3P42A 4A9AA 5LNK1 2WU5B 2VZKB 1SE3A 2M0AA 3SR6A 1L6UA 2WXNA 1BUIC 2W55A 2QEJC 1YN3A 1UWMA 2AX5A 3C8YA 2NTTA 1Y56A 3BK1A 4WH4A 3AECB 1JWSD 1JWMD 3ZJVA 5GXGB 2H89B 4FXCA 2L32A 2R61A 4ZRPA 1HQRD 3BVGA 3SEBA 3FILB 2ON8A 1BXTA 1ZPSA 1ZE3D 2X38A 3AE1B 3VRAB 4RF1A 1SXTA 1IUEA 1L6VA 4US9A 4OVZA 1L0XB 5HHDG 2XN9C 1DOIA 1C9FA 1MVKA 2OEDA 1FXIA 3AN1A 1E9MA 3NVYA 4HRSA 1IBXB 1E7PB 2WDVB 3AM9A 5H92C 1MI0A 1CQVA 4ZYSA 1L0VB 1L4DB 2WXJA 3IT4B 2INNE 4LK0M 2W82A 2GB1A 1XLQA 2MEKA 3P4QB 3AB5A 4LLGM 3J9CA 1VLBA 1QKZA 5EE1A 1ET9A 1CK1A 1HZ5A 3B2GA 3VRBB 4OZAA 3L4PA 4OZBA 3ZJUA 1AN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGH A;  5BMI A;  1K51 A;  4GLS C;  4OZC A;  1JML A;  4HJG E;  1PGA A;  2GI9 A;  2RMM A;  2KAC A;  1P7E A;  1PGB A;  1P7F A;  3V3X A;  2J53 A;  4KGR A;  3FIL A;  4HKZ E;  3GB1 A;  1PGX A;  2LGI A;  2PW9 A;  1YMH E;  1MHH E;  1EM7 A;  1XCT L;  2PLP A;  2J52 A;  3MP9 A;  1XF5 L;  4IKG A;  1IGD A;  4KGT A;  2K0P A;  2QSD A;  4KGS A;  1GB4 A;  2JWU A;  2KWD A;  2PTL A;  1K52 A;  2N7J A;  2N9L A;  2EEL A;  5HI1 A;  2JU6 X;  1Q10 A;  1F2R C;  2I2Y A;  1FCL A;  2JSV X;  2QMT A;  4D2K A;  3UI3 A;  4IOI E;  2NMQ A;  1YNT E;  1FCC C;  1HEZ E;  1FD6 A;  2I38 A;  5BMH A;  2KDM A;  1F2R I;  2LHE A;  4MAC A;  2KN4 A;  1IBX A;  4WH4 A;  1GB1 A;  2N9K A;  2IGG A;  2LUM A;  3FIL B;  2ON8 A;  2KQ4 X;  1KH0 A;  2RPV A;  2JXT A;  2ZW1 A;  5HHD G;  5HG2 A;  1HZ6 A;  2ONQ A;  1C9F A;  1MVK A;  2OED A;  1MHX A;  1IBX B;  2IGD A;  1K50 A;  1D4B A;  5HFY A;  1UWX A;  2LHD A;  1MI0 A;  5JXV A;  1ZXH A;  1K53 A;  2GB1 A;  1IGC A;  2JZP A;  1MPE A;  1QKZ A;  1XCQ L;  1HZ5 A;  4OZA A;  5BMG A;  2ZW0 A;  4OZB A; 
#chains in the Genus database with same CATH topology
 1E6E B;  3ZDM C;  3HM6 X;  4HEA 1;  2KTF A;  2ZCB A;  4P1C C;  2RMM A;  2JRH A;  1PGB A;  1R4M I;  2AQ1 B;  4I6P A;  2KQS A;  2WX1 A;  2IO2 B;  3APC A;  3DOW A;  3B1L X;  3QWZ B;  3ZUN A;  1I4X A;  2WXM A;  5TR5 A;  2PKO A;  2LEK A;  4FLH A;  2J52 A;  1TKE A;  4UDU C;  4EZJ A;  1YX5 B;  3N30 A;  1TIF A;  2CU1 A;  2PJH A;  4K3B A;  5AUK A;  4WJQ A;  1Q1O A;  4G11 A;  2L1A A;  4BBN F;  2AL3 A;  2V4I B;  5D3D A;  4XDC A;  3W1S C;  1FD6 A;  2MBQ A;  1TJE A;  4RF0 A;  1V2Y A;  2LHE A;  4W9I A;  2LJI A;  3NHE B;  4GIV A;  2AQ3 B;  2GBN A;  2NBV B;  2N7D A;  2FE8 A;  1MG4 A;  3IXS A;  4IM2 A;  3DBH B;  4YSY B;  3RYT A;  2BW2 A;  3RCZ A;  2MA9 B;  3BYY B;  1SB3 C;  3FKY A;  3UIN B;  3A4R A;  1WJU A;  3VAW A;  4JE3 B;  1KM7 A;  1T5X D;  4XGA B;  1TS5 A;  4HPM B;  5G5H A;  4OW0 A;  3H8H A;  4KKI A;  4O1N A;  2KLC A;  3CST A;  2Z8L A;  1TS3 A;  1UUP A;  3BII D;  4M01 A;  1BML C;  2H88 B;  2J7Q B;  2J53 A;  1YQ4 B;  1N63 A;  4MGI E;  4HKZ E;  1FMA D;  3KYC D;  4NJ7 A;  4B0M A;  4RM9 A;  2BWE S;  1QIL A;  4M0W A;  3NJT A;  1FEH A;  1SSN A;  2BS2 B;  2DEN B;  4RGT A;  1YJI A;  1YD8 U;  2LAS A;  2ZJD A;  4JWS C;  1R4N I;  1N5X A;  3PGE A;  3K9P B;  3AMZ A;  1I4P A;  2M4N A;  4GDL B;  5FKA C;  1K52 A;  2N9L A;  2QJL A;  2MX2 A;  2KX0 A;  4YWG G;  3TIX A;  2ZZP B;  3CSF A;  2BQQ A;  3TBL D;  1HEZ E;  5D7G A;  2NBW B;  1V97 A;  4ASW C;  4DK5 A;  3DCG A;  1JQ4 A;  4P7I A;  1YJJ A;  2M1M A;  1L7Y A;  4WJP A;  1SE9 A;  2CS4 A;  1T0R C;  3SD5 A;  1VDV A;  2WXO A;  3DBL B;  5KHQ A;  1E7U A;  3MC0 B;  2GOW A;  3QJZ A;  1OQY A;  2C7M B;  1E8X A;  3PRE A;  3JW0 X;  1NI3 A;  2JQR B;  4YT0 B;  2GRI A;  4PK1 A;  3SFE B;  2QC8 A;  4KIK B;  1OGW A;  3I9V 1;  3P63 A;  2JYE A;  1GNU A;  3RT3 B;  2WLB A;  1SE2 A;  3Q69 A;  1K50 A;  2IO0 B;  2MRP A;  4FJV B;  3GP7 A;  3ZXR A;  1B1Z A;  1AYF A;  3L13 A;  3NZS A;  1TZO A;  1L4Z B;  1ZXH A;  3N20 C;  1SBB B;  2HTH A;  2JRI B;  3FC4 A;  4GOC A;  3U7Z A;  2ZNV C;  1FNW A;  1IPG A;  3OWE B;  1E5W A;  2WXK A;  2FNJ B;  3NRZ A;  2HTM E;  5DPS A;  4DQO C;  3I57 A;  4LCD E;  3QQ8 B;  1NVI D;  3VTV A;  4X57 B;  5G5G A;  4MJS B;  2KAC A;  3A9J B;  2WXI A;  4ANU A;  1C79 A;  4C7Z A;  5IN7 A;  4LDT B;  2QHO A;  3AE6 B;  1J7C A;  4TQ0 A;  4DXF A;  3A9K B;  2MH7 A;  4H2A A;  4TSS A;  2XK5 A;  4YL8 A;  1GB4 A;  3ABV B;  1QOF A;  4NZL B;  4JX1 C;  5KHO A;  1L2N A;  2LGD A;  3RNE C;  1Q10 A;  1F2R C;  2J0K A;  4EOY A;  2V9H A;  1EUV B;  1FXT B;  4B6W A;  4QAY A;  4OVV A;  2WXR A;  4ZRK A;  3ZDT A;  1AWD A;  2N9P C;  3N9Y C;  3TJP A;  1CJE A;  4HJK A;  1EWY C;  3LJ3 A;  2N9K A;  2DBY A;  2IGG A;  2KFJ A;  3VFK A;  4AQ7 A;  4TKN A;  3DBR I;  1DYQ A;  3QHT A;  1WSP A;  2G4D B;  3DWM A;  1EU4 A;  2XK5 B;  2UYZ B;  2KQ4 X;  2L3Z A;  1QOA A;  4WWP A;  3ENE A;  2JXT A;  3PV1 A;  3AEF B;  4ARC A;  1MHX A;  2PVG C;  4IUM B;  3LYY A;  3MFG A;  4PT5 A;  3R8B A;  2CHZ A;  1ZGU B;  2G45 B;  4NQL B;  5HKH A;  1L5P A;  3JYU A;  2N4F A;  1TT5 B;  1MPE A;  4LNF A;  1AAR A;  2L8J A;  2KWV B;  1JWU D;  1C4P A;  3IG3 A;  2YVC A;  4GGQ A;  2M56 B;  3Q3M C;  1EF5 A;  3BVM A;  2KWU B;  4A8X C;  3DPD A;  4E71 A;  2I1J A;  1E90 A;  1E8W A;  1HXY D;  2BT6 A;  2BB6 A;  1XXG A;  2EMS A;  4AOF A;  2JWZ A;  2REX A;  1J8C A;  2XEW A;  1EO6 A;  3Q8F A;  4US8 A;  3ZLZ A;  1J7A A;  4EZK A;  1IGD A;  4FN2 A;  2NS5 A;  3T3O A;  3RPF C;  1WFY A;  3V05 A;  3L0W B;  4E3C A;  4TV3 A;  2J42 A;  3HIZ A;  4FHJ A;  1UF0 A;  1JRP A;  4D2K A;  2B3A A;  3P42 A;  4A9A A;  2VZK B;  1SE3 A;  2WXN A;  3WAM A;  3KUD B;  2CHX A;  2FCS A;  1UWM A;  2AX5 A;  3C8Y A;  3DHI C;  3QIJ A;  4WH4 A;  3AEC B;  4N9F 4;  5GXG B;  3UQB A;  5FR6 A;  4GB9 A;  2MP2 B;  1HQR D;  2LVO A;  1WY8 A;  3VRA B;  1SXT A;  1IUE A;  1YIW A;  1RFA A;  2MBO A;  1MVK A;  4OVU A;  2G4S A;  4KDL B;  3AM9 A;  2KTR B;  5H92 C;  3I5J C;  4WWO A;  4FHK A;  3VDZ A;  4ZYS A;  1A5R A;  2IND C;  1L4D B;  2AWT A;  4MDK E;  4LK0 M;  2L76 A;  2QDF A;  3H7S A;  4AUQ C;  1VLB A;  1ET9 A;  1CK1 A;  3B2G A;  4OZA A;  4OZB A;  3Q14 C;  4EUT A;  4HJG E;  1PGA A;  3PSE B;  2QIE B;  1RFK A;  5EE3 A;  1V81 A;  3T3N A;  3FIL A;  5IOI A;  3KW5 B;  2LFI A;  1UD7 A;  2LVP A;  5J17 A;  2J4X A;  4TUU A;  2ICI A;  1WXM A;  2GBK A;  5J18 A;  3CIR B;  2KVR A;  4ZDV A;  1YJ1 A;  3TEZ A;  2KXJ A;  2K3U A;  2NPT A;  1FIQ A;  1TY2 A;  1UH6 A;  2JU6 X;  1FCL A;  1ET6 A;  2O6V D;  3ZTD A;  2HE7 A;  4M00 A;  2GLS A;  1JRO A;  3AEG B;  4HCP B;  3PRM B;  3NUH B;  3EFC A;  1XEE A;  1V1O A;  3L08 A;  4N59 A;  3EC8 A;  3SU8 X;  3BY4 B;  2KD0 A;  2VH1 A;  3GE3 C;  3AE5 B;  2IO1 B;  3BZD B;  2NVU I;  1T0Y A;  4MJS A;  5IAA C;  3W1S A;  5FR3 A;  3AE9 B;  3D32 A;  3Q2A C;  1E0Z A;  4LJO B;  3RNA C;  2GBM A;  5G55 A;  3HHM A;  4KDI C;  2L7R A;  1R7S A;  1NYQ A;  2ZNV B;  3NZ3 A;  3N1X C;  2D10 A;  1IGC A;  2N0S B;  2LD9 A;  1Y8R C;  3I3T B;  4FBJ B;  3RI7 C;  3O65 B;  3AXC A;  4EKU A;  4A90 A;  2GMI C;  2D2Q A;  5D2M B;  1VR9 A;  4DBG A;  1JAL A;  1QQR A;  3EUB 2;  5BYS A;  3BYT B;  3VQI A;  2PMV A;  2CJO A;  4ZYN A;  3RNC C;  2PE9 A;  4II2 B;  2HJ8 A;  2MBH A;  2EMT A;  1ENF A;  1S3S G;  1V1P B;  3HRD D;  1WGY A;  1UEL A;  2YEP F;  2K0P A;  5C23 A;  5IA7 A;  3PRP B;  4YSZ B;  2N7J A;  4BKG A;  2BBC A;  1FNV A;  4K1R B;  1YOV B;  2BVC A;  3AE2 B;  2QMT A;  3KYD D;  3ZRC A;  5EDS A;  2K8H A;  4GDK A;  1Q5W B;  4XE0 A;  2PVO D;  2FCN A;  5BMH A;  2BGF A;  2WX0 A;  4KV2 A;  3WAO A;  1F2R I;  2K9X A;  3AEB B;  2WXH A;  3A4S C;  1N6Z A;  2KFK A;  3IVF A;  1IYF A;  5DCN A;  4B95 A;  1ISN A;  1WMH A;  3A9J A;  3CF6 E;  1R4M B;  1E8Z A;  1SIF A;  4RMA A;  4BFR A;  4HPP A;  1OTR B;  1TBE A;  3DBR B;  2LVQ A;  3TMP B;  4FUL A;  4K7S A;  4CYE A;  4KZC A;  3IBE A;  3V6E B;  1D4B A;  2W3R A;  5HFY A;  2NPT B;  3ZIM A;  5IO9 A;  4ANV A;  2L0F A;  4NJ6 A;  1WRI A;  1ZP0 B;  4L1B A;  1LXD A;  4PS7 A;  2AYO B;  4K3C A;  4NNJ B;  4P16 A;  3V61 A;  3KUZ A;  2TSS A;  1P98 A;  2J0M A;  4GLS C;  5L83 A;  1FM0 D;  3ETR A;  5JH5 C;  4AWJ A;  1I4H A;  2K6Q A;  3V3X A;  3DVN V;  4WJO A;  4BKT A;  4WQM A;  2LJ5 A;  3ZW3 A;  1FRD A;  2KYW A;  2ZPN A;  2K8B A;  4WUR A;  1ROE A;  1EM7 A;  1NI2 A;  3DBH I;  4HK2 A;  3MJW A;  3HK0 A;  1KTK A;  2RR9 A;  2D3A A;  2INP E;  1WZ0 A;  4C00 A;  3V60 A;  2MW5 A;  1C76 A;  2ZPY A;  3PVL A;  4ZRJ A;  4WAF A;  1V9J A;  4AJY B;  4M0W B;  2GBR A;  2YEP B;  3WAN A;  2KDM A;  4MAC A;  2KN4 A;  1ZXI A;  3RUL A;  3M62 B;  1DGJ A;  2HDE A;  1GB1 A;  3DHG C;  1WWT A;  4I6N B;  5E6N A;  4LNK A;  2MQJ A;  4DXG A;  2V3P A;  2Z59 B;  3WCQ A;  1NYR A;  3Q3J A;  2JPH A;  2UWQ A;  3ZGZ A;  3ZO5 B;  4B9K A;  2ZVO A;  3EGR A;  1TKY A;  3H6N A;  1GPX A;  3RZW C;  1I4R A;  1WGH A;  1I4G A;  4J3O D;  1K53 A;  4LTU A;  1V6E A;  1WGR A;  3WIM A;  4HCN B;  4LJP B;  1J19 A;  3ONS A;  2ASQ A;  4IWP A;  2DHZ A;  3VH4 B;  2KOX A;  3U7D A;  4P1B C;  2GI9 A;  3QAQ A;  2L52 A;  2DAJ A;  2KDF B;  1P7E A;  2D5G A;  3GS2 A;  2IJ0 A;  2D3G A;  3MP9 A;  3AED B;  1J7B A;  4W9D A;  3QK0 A;  2KAN A;  3EHV A;  2K5P A;  3NS8 A;  4KGS A;  4JLC A;  4N6E B;  1WZ3 A;  3VHT C;  2RDH A;  4W9H A;  2EEL A;  5HI1 A;  4CQN A;  3AU4 A;  3B2F A;  3DVG Y;  1MJD A;  4W9J A;  4C56 C;  3A1Q B;  4IOI E;  1TS4 A;  1YNT E;  2FBW B;  2KX3 A;  2PE6 B;  3DQV A;  2M0A A;  3UIO B;  2C60 A;  1BUI C;  2QEJ C;  5CX3 A;  3T8M A;  4KSL C;  2NTT A;  3BK1 A;  3VTW A;  3ZJV A;  1WXV A;  2L32 A;  3M3J A;  3BVG A;  3OAW A;  3FIL B;  2ON8 A;  3N1Z C;  2X38 A;  3N32 A;  4RF1 A;  3N1Y C;  3MHS D;  1L6V A;  1MG8 A;  4US9 A;  2MBE A;  1ZKH A;  2OED A;  1FXI A;  4HRS A;  5C1Z A;  3L54 A;  1MI0 A;  3V62 A;  4PYU A;  4BOS C;  3AB5 A;  3VUW A;  1WE7 A;  1LGR A;  2AL6 A;  2RD0 A;  3VRB B;  5CHV C;  4F8C B;  5BMI A;  2J0J A;  3KH0 A;  1WYG A;  3PPA A;  4URK A;  1GJZ A;  4NPN A;  4OHJ A;  2YLM A;  1JRU A;  2HD5 B;  4JGH B;  4KGR A;  3L10 B;  1TKG A;  4BZA A;  1JCK B;  4YTP B;  2MWS B;  2D07 B;  4XX5 A;  2MHJ A;  1HE8 A;  4YTM B;  1SF0 A;  4NAM A;  4HKQ A;  3K9O B;  4W9C A;  1XCT L;  2ZEQ A;  3BK2 A;  1FFU A;  2KDE B;  1V5O A;  1N62 A;  3VR8 B;  1OQQ A;  1RWS A;  1WXQ A;  3TUO A;  1OEY J;  4K81 A;  3AE8 B;  4IDI A;  1TS2 A;  1ZDV A;  1GAQ B;  4EE2 A;  2LZ6 A;  2I2Y A;  2JSV X;  1E7V A;  2WQY B;  2X8X X;  5LLI A;  3GZN B;  2QIL A;  4MGY E;  4KVG B;  1WJN A;  2LWP A;  3R2I A;  2LMC A;  3R66 C;  3VR9 B;  1T0Q C;  3GZN I;  3AEA B;  3Q3F A;  3Q8B A;  2LGS A;  3C0R B;  2LXA A;  5MPO A;  1HTQ A;  2WDR B;  2NBU A;  4P6V F;  3B08 A;  2OHF A;  2KVZ A;  4RNA A;  1WX8 A;  3VXW A;  1RLF A;  4YXD B;  2AQ2 B;  1SGH A;  3W5V B;  2WNM A;  3SFD B;  3PLV A;  2UU7 A;  1HZ6 A;  2ONQ A;  1D5M C;  3AI5 A;  5LXI B;  4JPS A;  3W9C B;  1UWX A;  1Q0W B;  1FNU A;  1XLO A;  3NVZ A;  1IP9 A;  4JL9 A;  4MH0 E;  3W1Y A;  2HJ1 A;  3W5U B;  2JZP A;  1HA5 A;  2G3Q B;  3ZNH B;  5D94 A;  2M17 A;  1UZX B;  2DZK A;  3PTF C;  2DWQ A;  3NG0 A;  5DPR A;  1L0Y B;  4A55 A;  3TEW A;  4DHZ E;  4JQW C;  1FXA A;  2KMC A;  3PLU A;  2ZVN A;  2Y5C A;  3UGB B;  1WJ6 A;  2LGX A;  4GDK B;  1SJH D;  2WHI A;  2BYT A;  4XZ4 A;  3Q3N C;  2MSE D;  1YMH E;  3BWU D;  3TCA A;  2KLG A;  5E6J A;  1YQ3 B;  4DWF A;  2KWC A;  3DDC B;  2KQ7 A;  3AH7 A;  3AEE B;  3PO0 A;  2KJ6 A;  4ZRI A;  3IFW B;  3ZNG C;  1SIJ A;  4LNN A;  4PYZ A;  1TZ1 A;  4W9L A;  2KMM A;  3IAM 1;  1I42 A;  1F52 A;  1FPY A;  2I38 A;  3ALB A;  1V5T A;  4FJY A;  2GBJ A;  1LO5 D;  3BIN A;  1IBX A;  2OJW A;  1UGJ A;  5L95 C;  2KT7 A;  1E8Y A;  5C2T B;  1N60 A;  2BS4 B;  5BYQ A;  2FID A;  1C4C A;  2SAK A;  2BYE A;  3Q6B A;  4RFB A;  2CU3 A;  3ZYY X;  3ZXV A;  1X1M A;  2AEH A;  2Y5P A;  3JSV B;  1I35 A;  4A3O A;  2FAZ A;  2RPQ A;  1ESF A;  3BVZ A;  4ARI A;  2JF5 A;  3ZTC A;  2IY0 B;  4EZL A;  4MSQ B;  1KLU D;  2KDB A;  2C9W B;  1WE6 A;  3P2B A;  4RGN A;  1R4N B;  4JIO U;  2QCZ A;  3MC8 A;  2D11 A;  4HWI B;  3W2D A;  2N7E A;  2KMA A;  3ZNI D;  4DXA B;  1WGK A;  4KSK C;  3VTU A;  3LDZ E;  2SEB D;  4M02 A;  1D5X C;  2KTR A;  4DDI D;  1PFD A;  3VUX A;  4KIK A;  3WAL A;  2WXL A;  3EEC A;  2Q5W D;  2LRW A;  4DDG D;  1U4A A;  4BKS D;  1WGG A;  2WXG A;  4BKS A;  5AZF A;  2IZV B;  2KKC A;  4GMV A;  1FFV A;  4II3 B;  1XQQ A;  4CHK A;  4MGZ E;  3HUI A;  4IKG A;  4AS1 A;  4KGT A;  4MM3 A;  3TL5 A;  3DVN U;  2W3S A;  3FAH A;  4MM3 B;  2MCN B;  2JWU A;  1ZOY B;  3MTN B;  2W9N A;  2PPH A;  5AZH A;  1TGZ B;  3N3K B;  2IY1 B;  1GC6 A;  2WYQ A;  1XO3 A;  4IWO A;  1UBQ A;  1T6B X;  4S0R A;  2BS3 B;  4K7U A;  4R3D A;  4ZRQ A;  3P1M A;  3R2T A;  1KFY B;  1GC7 A;  3SHQ A;  3KWV A;  2DX5 B;  1WIA A;  4BBN C;  2CJN A;  2WP9 B;  5EE9 A;  3Q3O C;  1MFW A;  4HLE A;  4AJW A;  1KLV A;  3U52 E;  1UBI A;  3PHX B;  2LUM A;  2DYO A;  4DHJ B;  4XDD A;  1V80 A;  1QT9 A;  4L23 A;  2D3B A;  1XLN A;  4GU2 A;  2L0T A;  3ZJT A;  4ACF A;  1F9J A;  4TQ1 A;  2EKI A;  5DPT A;  3ECI A;  2N1W A;  3DBL I;  2CHW A;  1C3T A;  1OFF A;  3VH3 B;  2M19 A;  2LRU A;  3H7P A;  4MGK E;  1FO4 A;  1QOG A;  4XC2 A;  2BB5 A;  2XBB C;  2MP2 A;  2RDG A;  2L05 A;  3L17 A;  5JHA A;  4BAX A;  2RDB C;  4Q2J A;  1VZ8 A;  2JXX A;  3KQ4 A;  2Z0D B;  3A33 B;  3NS1 A;  2JVC A;  4WWM A;  4CO7 A;  2IGH A;  1JML A;  1WGD A;  3LXF A;  3Q8E A;  2OJR A;  3OJ3 A;  1T0S C;  1QLB B;  1P7F A;  2BYF A;  2E3T A;  2KAJ A;  1WXA A;  5JZE B;  1GG3 A;  3I63 C;  1PGX A;  3NZU A;  2IPK D;  2PW9 A;  3IAS 1;  4NQK E;  1BT0 A;  1DOY A;  4ITK A;  4KX6 B;  1WM2 A;  3NY5 A;  1WXS A;  4C80 A;  1C4A A;  1QF6 A;  2ZCC A;  2O6V A;  2PIA A;  4KZ0 A;  4FJZ A;  2Z0E B;  1S1Q B;  1P9D U;  1C1Y B;  4M8N A;  4AP4 C;  1RM6 C;  4L2Y A;  2Y5B B;  2M0X A;  1VZ6 A;  3AE4 B;  2NMQ A;  1XT9 B;  2JX5 A;  3APD A;  3X23 A;  2VH2 A;  5LNK 1;  2WU5 B;  1RAX A;  1KOT A;  3T9L A;  3SR6 A;  3RNF C;  5E6P A;  1YN3 A;  1Y56 A;  2KO3 A;  1JWS D;  5E6O A;  1JWM D;  2DZI A;  3AUL A;  2H89 B;  1WJ4 A;  5IKC M;  4WJN A;  4ZRP A;  2N9E B;  4IM3 A;  3SEB A;  1BXT A;  3QA8 A;  3PS6 A;  2N1V A;  4OVZ A;  2XN9 C;  1DOI A;  2DNF A;  3AN1 A;  3M95 A;  3NVY A;  2FUH B;  1IBX B;  3GE8 C;  2WDV B;  4MEM A;  1H8C A;  2R2O A;  4WWN A;  2WXJ A;  3DHH C;  3IT4 B;  2W82 A;  5G2N A;  1WRD B;  3P4Q B;  4LLG M;  5EE1 A;  3L4P A;  2IYD B;  2LXC A;  1AN8 A;  2A4Z A;  1OQR A;  4OZC A;  2N9X A;  1KLG D;  4RGM A;  3U2S C;  2LGY A;  3AU5 A;  1VZ7 A;  3HVZ A;  1ZW7 A;  1N61 A;  3B9J A;  2O2V B;  3QAR A;  4XWW A;  2FIF A;  3AE3 B;  1MHH E;  3MHZ A;  1TYG B;  3QC8 B;  2BYV E;  1DOX A;  2C7N B;  3PHW B;  4A20 A;  4I6L B;  2KWD A;  3KLS X;  1NEK B;  1E10 A;  2CR5 A;  4ZHO A;  4GN1 A;  3WAP A;  4W9F A;  1WH3 A;  1J0G A;  4W9E A;  4ICV A;  2LI5 A;  1A70 A;  5AUI A;  3P4R B;  1VRA B;  3TEX A;  1FCC C;  3UIP B;  2C7H A;  4C4V B;  2IO3 B;  5I4D A;  3GOE A;  4BOZ B;  4LDT D;  3LB8 C;  4M8M A;  4ANW A;  3P4P B;  5AEK B;  4EEW A;  4PS8 A;  1V86 A;  2KZR A;  1SJE D;  2K25 A;  2K1F A;  3PZ8 A;  3H1U A;  3APF A;  1N5W A;  5DPW A;  3P4S B;  4DHZ B;  2BPS A;  3H7P B;  3MJ5 A;  1PUT A;  1D5Z C;  4G3X B;  2IGD A;  2BKR B;  4RM8 A;  4YTN B;  3Q8A A;  4C4V A;  3ZQ4 A;  2VRR B;  1WF9 A;  2Y3A A;  4ZOH C;  2WU2 B;  3OLM D;  2G9H D;  2VZK D;  2WDT B;  4IC7 B;  2BWF A;  4F1S A;  3RD2 A;  3ML9 A;  4MT5 A;  1XCQ L;  5H8Y E;  3R7R A;  3B0A A;  1EU3 A;  3PRZ A;  4C7Y A;  2EKE C;  1SE4 A;  5GMV A;  3QCA A;  1HTO A;  4A6Q A;  1PYW D;  1WX9 A;  4GSW A;  4N58 A;  3GB1 A;  4K7W A;  2V3S A;  1H4R A;  2WDQ B;  4LNI A;  2L83 A;  2O6V B;  2DZJ A;  2XNA C;  5D6J B;  4ZHP A;  4XYC A;  4G50 A;  3HVD A;  5JHB A;  5AZG A;  2KJH B;  2DYB A;  1C78 A;  1Z5S B;  2QSD A;  3URY A;  1QOB A;  3EFU A;  1D6E C;  1LFD A;  4HXD A;  4J6I A;  2FCM A;  4GXB A;  4YSX B;  3VVW B;  1RYJ A;  2PEA A;  3OJ4 B;  1WM3 A;  1AW7 A;  2KDI A;  4XWT A;  1ACC A;  1QZE A;  2BTE A;  1WYW B;  4EFO A;  2DAF A;  5T8I A;  3PT2 B;  4F7Z A;  3DVG X;  3MC9 A;  2I1K A;  2KHW B;  1JWB D;  1OEY A;  4E74 A;  5CHF A;  1TTN A;  1YQB A;  1LM8 B;  3U4E G;  1TY0 A;  2ACZ B;  3Q8C A;  4RCO A;  2MLB A;  1WMH B;  1V1P A;  3U8Z A;  2WS3 B;  2V4L A;  5TSS A;  4S17 A;  1KH0 A;  1XD3 B;  2RPV A;  1V8C A;  1F0Z A;  2MJD A;  1M4V A;  3L16 A;  1VD2 A;  3IT6 B;  5HG2 A;  2B76 B;  1EWC A;  2E6X A;  1GUA B;  2DLB A;  1YN5 A;  4WQO B;  4MSM B;  4WAA A;  3UF8 A;  1WI0 A;  2M8S A;  2IDY A;  3H9D A;  4NJC A;  3A9K A;  2FCQ A;  4G0N B;  2RGF A;  3U30 A;  1G6J A;  2KNB A;  4RGO S;  3CWI A;  2ZW0 A;  4HVB A;  3HM3 A;  3JSV A;  3NOB A;  1NDD A;  3RMK C;  5IP4 D;  3V6C B;  4B0E A;  5LXH A;  3RZF A;  4RH6 A;  1WR1 A;  1GOZ A;  3PZD A;  2JZZ A;  2JT4 B;  2MBB B;  2NR2 A;  3NVW A;  2WGS A;  1KRH A;  2LGI A;  1YX6 B;  1VCB A;  1I7H A;  1JWA D;  3RFZ B;  1I4Q A;  2KK8 A;  2CKH B;  4NY0 A;  4DHJ D;  1XF5 L;  5C3J B;  3E9S A;  2JUO A;  3DWG C;  4LNO A;  1Z2M A;  2LUE A;  2PTL A;  1SEB D;  2G1E A;  1ZDX A;  3ZRF A;  3S2A A;  3UI3 A;  1VJK A;  2DZM A;  5CHW A;  1M94 A;  2K22 A;  2WXQ A;  1JW9 D;  2WWZ A;  3RN9 C;  4KKJ A;  4REZ A;  2V0G A;  3X0W A;  1NEN B;  3EA6 A;  3RNB C;  2MJ3 A;  3UQA A;  1F77 A;  2IBI B;  1P3Q U;  2OOB B;  4JWU C;  4USA A;  4HPL B;  1NBF C;  2KC2 A;  2ZW1 A;  2V1Y A;  3QX1 A;  1KF6 B;  4A3P A;  2K39 A;  1LQB A;  1V49 A;  2DYM A;  5BYR A;  4MH8 A;  3KUC B;  4TMA B;  3R7Q A;  3WA0 A;  3ML8 A;  5D3I B;  2O2V A;  5BO4 B;  2LHD A;  3IHP C;  3C19 A;  3PZ7 A;  5JXV A;  4IG7 B;  3DBS A;  4ANX A;  4W9K A;  1F1H A;  5J2R A;  2NTS A;  2V3N A;  2WXP A;  3NVV A;  1ZUD 2;  3OG5 A;  4MEL A;  4W9G A;  2WXF A;  4FAD A;  1K8R B;  5BMG A;  4HDO A;  1STE A;  2NCN A;  3A1Q A;  1K51 A;  2K6D B;  3JVZ X;  2MJE A;  2JY6 A;  4NAW B;  3TEY A;  1CZP A;  2JYT A;  4NAW A;  3O13 A;  4IM0 A;  3E56 A;  3VUY A;  1KJT A;  2JZ3 B;  1T3Q A;  3TSS A;  5FK9 C;  2A5U A;  2INC C;  3ZKJ C;  2FUG 1;  2PLP A;  3AV8 A;  3AE7 B;  3KVF B;  5EE0 A;  1FRR A;  4IW0 A;  4WIP A;  2K8C A;  1CMX B;  3RNG C;  1C77 A;  1WR6 E;  1EF1 A;  2KN5 A;  4HRO A;  1P1A A;  1RRB A;  1YN4 A;  4HDQ A;  2W54 A;  1PDX A;  2L00 B;  2BF8 B;  1B9R A;  4FA6 A;  1UNS A;  3KWL A;  1XLP A;  4PS3 A;  3ZVV A;  2KC1 A;  4ICU A;  1L6U A;  2W55 A;  3RUI B;  2D3C A;  1WX7 A;  2BKF A;  2R2Q A;  4FXC A;  3SDL C;  2R61 A;  1D3Z A;  1ZPS A;  1ZE3 D;  3AE1 B;  1P0R A;  4IWQ A;  1L0X B;  3ZNZ B;  5HHD G;  1C9F A;  1PQS A;  1E9M A;  2RSU A;  2KFK B;  1E7P B;  1CQV A;  1L0V B;  1UGM A;  4GDL A;  2INN E;  2C5L C;  1XLQ A;  2GB1 A;  2MEK A;  5CTR C;  3CMM B;  3R3M A;  4BVU C;  3J9C A;  2KJR A;  1QKZ A;  1HZ5 A;  3M63 B;  3ZJU A; 
#chains in the Genus database with same CATH homology
 1E6E B;  5BMI A;  1OQR A;  4OZC A;  4HEA 1;  4HJG E;  1WYG A;  1KLG D;  4RGM A;  3U2S C;  1PGA A;  2RMM A;  2QIE B;  1RFK A;  4OHJ A;  1PGB A;  1VZ7 A;  2AQ1 B;  5EE3 A;  3HVZ A;  4KGR A;  1N61 A;  3B9J A;  3T3N A;  3FIL A;  1TKG A;  4XWW A;  1JCK B;  4YTP B;  2LFI A;  4YTM B;  1SF0 A;  3AE3 B;  4NAM A;  1I4X A;  2WXM A;  4HKQ A;  2PKO A;  2LEK A;  1MHH E;  1XCT L;  3MHZ A;  2J52 A;  1TYG B;  1TKE A;  4UDU C;  3BK2 A;  1FFU A;  1DOX A;  1N62 A;  2J4X A;  1OQQ A;  1RWS A;  2ICI A;  1WXQ A;  3VR8 B;  3CIR B;  3TUO A;  2KWD A;  3TEZ A;  3AE8 B;  5AUK A;  2K3U A;  4IDI A;  1TS2 A;  3KLS X;  1NEK B;  1ZDV A;  1GAQ B;  1E10 A;  1FIQ A;  1TY2 A;  2JU6 X;  4EE2 A;  4ZHO A;  2I2Y A;  1FCL A;  2L1A A;  2JSV X;  2WQY B;  1ET6 A;  2V4I B;  5AUI A;  1A70 A;  3P4R B;  1VRA B;  3TEX A;  1FCC C;  2QIL A;  5D3D A;  1JRO A;  3AEG B;  5I4D A;  4XDC A;  1FD6 A;  3R2I A;  2LMC A;  1TJE A;  3NUH B;  4RF0 A;  2LHE A;  1XEE A;  3VR9 B;  3LB8 C;  1V1O A;  3P4P B;  3AEA B;  3Q8B A;  5MPO A;  2WDR B;  4N59 A;  4P6V F;  2LJI A;  2OHF A;  4RNA A;  1SJE D;  4YXD B;  2AQ2 B;  3PZ8 A;  2AQ3 B;  3W5V B;  3AE5 B;  2WNM A;  1N5W A;  3SFD B;  3BZD B;  3P4S B;  2FE8 A;  3W1S A;  5FR3 A;  1HZ6 A;  2ONQ A;  1D5M C;  3IXS A;  3MJ5 A;  1PUT A;  1D5Z C;  3AE9 B;  2IGD A;  4JPS A;  4YTN B;  1E0Z A;  3Q8A A;  3W9C B;  1UWX A;  4YSY B;  1R7S A;  1FNU A;  3ZQ4 A;  2BW2 A;  2Y3A A;  1XLO A;  1NYQ A;  2WU2 B;  3BYY B;  1SB3 C;  4ZOH C;  3NZ3 A;  2G9H D;  3NVZ A;  2VZK D;  4JE3 B;  1T5X D;  1IGC A;  3W5U B;  2JZP A;  2N0S B;  1HA5 A;  1TS5 A;  4MT5 A;  1XCQ L;  5G5H A;  5H8Y E;  4OW0 A;  3H8H A;  4KKI A;  4O1N A;  2DWQ A;  1L0Y B;  4A55 A;  3TEW A;  4A90 A;  2Z8L A;  1EU3 A;  1FXA A;  4C7Y A;  1SE4 A;  1TS3 A;  1UUP A;  1VR9 A;  2Y5C A;  3BII D;  1JAL A;  4A6Q A;  1BML C;  1QQR A;  2H88 B;  2J53 A;  1PYW D;  3EUB 2;  1YQ4 B;  1N63 A;  5BYS A;  4N58 A;  3BYT B;  4HKZ E;  3GB1 A;  3VQI A;  2PMV A;  4GDK B;  1FMA D;  2CJO A;  1SJH D;  4B0M A;  2BYT A;  1QIL A;  2WDQ B;  4M0W A;  1YMH E;  2L83 A;  1FEH A;  2XNA C;  1SSN A;  2BS2 B;  1ENF A;  4ZHP A;  1V1P B;  3HRD D;  3BWU D;  4RGT A;  1YJI A;  3HVD A;  2YEP F;  1C78 A;  5E6J A;  2K0P A;  2QSD A;  3URY A;  4JWS C;  1YQ3 B;  1QOB A;  1N5X A;  1D6E C;  3AMZ A;  1I4P A;  4GDL B;  5FKA C;  1K52 A;  2N7J A;  3AH7 A;  2N9L A;  3AEE B;  3PO0 A;  4YSZ B;  2QJL A;  4YSX B;  2BBC A;  1FNV A;  1SIJ A;  4YWG G;  3AE2 B;  2QMT A;  1RYJ A;  1HEZ E;  5D7G A;  1AW7 A;  2KMM A;  4XE0 A;  4XWT A;  3IAM 1;  2PVO D;  1V97 A;  2I38 A;  5BMH A;  1ACC A;  1JQ4 A;  2BTE A;  1F2R I;  1YJJ A;  2K9X A;  3AEB B;  2WXH A;  5T8I A;  1LO5 D;  1IBX A;  1UGJ A;  1JWB D;  1VDV A;  2WXO A;  5C2T B;  3U4E G;  1TY0 A;  2ACZ B;  1N60 A;  2BS4 B;  3MC0 B;  3Q8C A;  5BYQ A;  4RCO A;  1C4C A;  1NI3 A;  2JQR B;  1V1P A;  2GRI A;  2SAK A;  4YT0 B;  4RFB A;  3SFE B;  2WS3 B;  2CU3 A;  5TSS A;  3ZYY X;  1KH0 A;  2RPV A;  3I9V 1;  1V8C A;  2Y5P A;  3P63 A;  1F0Z A;  2MJD A;  1M4V A;  2JYE A;  3IT6 B;  5HG2 A;  2B76 B;  1ESF A;  3BVZ A;  4ARI A;  2WLB A;  1SE2 A;  3Q69 A;  1K50 A;  1EWC A;  2E6X A;  1KLU D;  1D4B A;  2DLB A;  2W3R A;  3GP7 A;  5HFY A;  1B1Z A;  1YN5 A;  1AYF A;  4RGN A;  1TZO A;  1L4Z B;  1ZXH A;  1SBB B;  1WRI A;  1ZP0 B;  3FC4 A;  3W2D A;  3U7Z A;  4L1B A;  2IDY A;  1FNW A;  4NJC A;  3OWE B;  1WGK A;  2WXK A;  2SEB D;  3NRZ A;  4P16 A;  2HTM E;  4RGO S;  1D5X C;  3CWI A;  4DQO C;  2ZW0 A;  2TSS A;  1PFD A;  3I57 A;  4GLS C;  2WXL A;  4B0E A;  1FM0 D;  1NVI D;  4RH6 A;  2Q5W D;  5G5G A;  1GOZ A;  2KAC A;  3ETR A;  1I4H A;  3V3X A;  2WXI A;  4WQM A;  1C79 A;  3NVW A;  4C7Z A;  1FRD A;  1KRH A;  2LGI A;  2WXG A;  3AE6 B;  1J7C A;  4TQ0 A;  4DXF A;  1I7H A;  1FFV A;  4WUR A;  1JWA D;  3RFZ B;  2MH7 A;  1ROE A;  1EM7 A;  1I4Q A;  3HUI A;  1XF5 L;  4IKG A;  4H2A A;  5C3J B;  4TSS A;  4AS1 A;  4KGT A;  3E9S A;  1GB4 A;  2W3S A;  3FAH A;  4MM3 B;  2JWU A;  3ABV B;  1QOF A;  1ZOY B;  3DWG C;  1KTK A;  4NZL B;  2PTL A;  4JX1 C;  2INP E;  1SEB D;  1C76 A;  1Q10 A;  1F2R C;  2G1E A;  1ZDX A;  4WAF A;  3UI3 A;  1XO3 A;  1T6B X;  1VJK A;  2BS3 B;  4R3D A;  4ZRQ A;  3P1M A;  2WXR A;  2K22 A;  2WXQ A;  1JW9 D;  2YEP B;  1KFY B;  3R2T A;  2KDM A;  3KWV A;  1AWD A;  3N9Y C;  1CJE A;  4MAC A;  2CJN A;  2KN4 A;  1ZXI A;  1EWY C;  2WP9 B;  4KKJ A;  4REZ A;  5EE9 A;  1DGJ A;  2HDE A;  1GB1 A;  2V0G A;  1WWT A;  2N9K A;  2DBY A;  2IGG A;  3U52 E;  2LUM A;  2DYO A;  4AQ7 A;  4XDD A;  1NEN B;  3EA6 A;  1DYQ A;  1QT9 A;  2MJ3 A;  4DXG A;  1F77 A;  2V3P A;  4L23 A;  1WSP A;  1XLN A;  3DWM A;  3ZJT A;  1EU4 A;  4JWU C;  4USA A;  3WCQ A;  2KQ4 X;  1NYR A;  1QOA A;  2JXT A;  3ZGZ A;  2ZW1 A;  1KF6 B;  3AEF B;  2EKI A;  4TQ1 A;  4ARC A;  3EGR A;  1TKY A;  1MHX A;  2PVG C;  2DYM A;  5BYR A;  4MH8 A;  4TMA B;  1GPX A;  3LYY A;  5D3I B;  3MFG A;  4PT5 A;  1OFF A;  3R8B A;  2LHD A;  2M19 A;  3PZ7 A;  1I4R A;  4J3O D;  1I4G A;  5JXV A;  1K53 A;  1L5P A;  2NTS A;  2V3N A;  4LTU A;  1FO4 A;  2WXP A;  1QOG A;  3NVV A;  2BB5 A;  2RDG A;  1MPE A;  1ZUD 2;  2WXF A;  4Q2J A;  1VZ8 A;  5BMG A;  3KQ4 A;  3NS1 A;  1STE A;  1JWU D;  4WWM A;  2IGH A;  1K51 A;  1JML A;  3LXF A;  3Q8E A;  2MJE A;  2GI9 A;  4NAW B;  2L52 A;  1C4P A;  2M56 B;  1P7E A;  1QLB B;  1CZP A;  1P7F A;  2JYT A;  3TEY A;  2E3T A;  3BVM A;  2KAJ A;  2D5G A;  3O13 A;  4A8X C;  3GS2 A;  3E56 A;  1PGX A;  1T3Q A;  3TSS A;  1HXY D;  2IPK D;  2BT6 A;  2BB6 A;  5FK9 C;  1XXG A;  2PW9 A;  3IAS 1;  2IJ0 A;  2FUG 1;  1DOY A;  2PLP A;  4ITK A;  3AV8 A;  3Q8F A;  4KX6 B;  3AE7 B;  3MP9 A;  5EE0 A;  4US8 A;  3AED B;  4C80 A;  1J7B A;  1FRR A;  1C4A A;  1J7A A;  1QF6 A;  1IGD A;  2K5P A;  4KGS A;  2PIA A;  4WIP A;  3T3O A;  1C77 A;  3RPF C;  4N6E B;  3V05 A;  2RDH A;  4HRO A;  1RM6 C;  4L2Y A;  2EEL A;  5HI1 A;  2J42 A;  4CQN A;  1YN4 A;  1VZ6 A;  2W54 A;  1PDX A;  3AE4 B;  3B2F A;  1JRP A;  4C56 C;  4D2K A;  1B9R A;  4IOI E;  1UNS A;  2NMQ A;  1TS4 A;  2JX5 A;  1YNT E;  2FBW B;  3KWL A;  1XLP A;  3P42 A;  4A9A A;  5LNK 1;  2WU5 B;  2VZK B;  1SE3 A;  2M0A A;  3SR6 A;  1L6U A;  2WXN A;  1BUI C;  2W55 A;  2QEJ C;  1YN3 A;  1UWM A;  2AX5 A;  3C8Y A;  2NTT A;  1Y56 A;  3BK1 A;  4WH4 A;  3AEC B;  1JWS D;  1JWM D;  3ZJV A;  5GXG B;  2H89 B;  4FXC A;  2L32 A;  2R61 A;  4ZRP A;  1HQR D;  3BVG A;  3SEB A;  3FIL B;  2ON8 A;  1BXT A;  1ZPS A;  1ZE3 D;  2X38 A;  3AE1 B;  3VRA B;  4RF1 A;  1SXT A;  1IUE A;  1L6V A;  4US9 A;  4OVZ A;  1L0X B;  5HHD G;  2XN9 C;  1DOI A;  1C9F A;  1MVK A;  2OED A;  1FXI A;  3AN1 A;  1E9M A;  3NVY A;  4HRS A;  1IBX B;  1E7P B;  2WDV B;  3AM9 A;  5H92 C;  1MI0 A;  1CQV A;  4ZYS A;  1L0V B;  1L4D B;  2WXJ A;  3IT4 B;  2INN E;  4LK0 M;  2W82 A;  2GB1 A;  1XLQ A;  2MEK A;  3P4Q B;  3AB5 A;  4LLG M;  3J9C A;  1VLB A;  1QKZ A;  5EE1 A;  1ET9 A;  1CK1 A;  1HZ5 A;  3B2G A;  3VRB B;  4OZA A;  3L4P A;  4OZB A;  3ZJU A;  1AN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...