1PGAA

Two crystal structures of the b1 immunoglobulin-binding domain of streptococcal protein g and comparison with nmr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
b'MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title Two crystal structures of the B1 immunoglobulin-binding domain of streptococcal protein G and comparison with NMR.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
molecule tags Immunoglobulin binding protein
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1993-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgaA00
5BMGA 1MHHE 2JU6X 2KQ4X 2PTLA 4OZCA 4WH4A 2J53A 2LHEA 4KGSA 2PW9A 1K51A 2NMQA 1D4BA 1MHXA 1FCLA 2EELA 1F2RC 4HJGE 1IGCA 2N9KA 2OEDA 1IGDA 1KH0A 1EM7A 2QMTA 1PGBA 1YMHE 1JMLA 4MACA 5HFYA 1HZ6A 1FCCC 2ONQA 3MP9A 2RPVA 5BMIA 4KGTA 1MI0A 2RMMA 1P7EA 2I38A 4OZAA 2QSDA 2GI9A 1XF5L 1IBXA 1Q10A 3GB1A 1GB4A 1FD6A 2ON8A 1K53A 2I2YA 5HHDG 2KACA 3FILA 2LUMA 1C9FA 5JXVA 1GB1A 2KWDA 4HKZE 1UWXA 1ZXHA 5BMHA 1K50A 1MPEA 3UI3A 2JSVX 1MVKA 2IGGA 4GLSC 4OZBA 2ZW1A 3V3XA 1PGAA 1PGXA 1HEZE 1XCQL 2JXTA 1F2RI 2GB1A 1IBXB 4IOIE 2ZW0A 2PLPA 2LHDA 2N9LA 2J52A 1XCTL 2KN4A 4KGRA 2LGIA 1QKZA 2KDMA 2IGHA 2N7JA 3FILB 5HI1A 2JWUA 2IGDA 1K52A 2JZPA 1P7FA 1YNTE 1HZ5A 2K0PA 4D2KA 5HG2A 4IKGA
chains in the Genus database with same CATH superfamily
2QJLA 2KVZA 3DHGC 2LVOA 2N7DA 3DHHC 2BBCA 5BYRA 2WU5B 4LJOB 1CMXB 4P1CC 4URKA 4CO7A 2KDIA 2AWTA 2ZJDA 4W9DA 1KH0A 4J3OD 1C4PA 2KC2A 3BY4B 2KD0A 4AOFA 1YMHE 1JMLA 3KYCD 4TSSA 1HZ6A 2PEAA 3PRPB 3SD5A 4AP4C 4W9GA 3UQAA 4S17A 4XZ4A 2FUG1 4ANWA 2V4IB 3HM6X 4L1BA 4RGMA 5EDSA 2LFIA 2D3AA 2PE9A 5LXHA 2KX0A 1WX7A 2LRUA 3VXWA 2MP2B 2N1VA 1E9MA 5T8IA 3VH4B 1R4MI 2CKHB 1K53A 3Q3NC 1VJKA 3IG3A 1LQBA 1C9FA 2DX5B 4CYEA 3DBRI 2N0SB 3AE8B 2WXIA 2MEKA 3KH0A 2KK8A 1KOTA 4W9JA 1QF6A 1XQQA 1WJ6A 3B9JA 3RT3B 2BB6A 2V3PA 1D5MC 3DBLI 3AH7A 1F2RI 3RMKC 1IBXB 4ANUA 1TYGB 4KZ0A 4WJPA 3IAM1 1DGJA 2KN4A 1ZUD2 2DBYA 2KWUB 2BYVE 2LUEA 4K3CA 3BWUD 3AXCA 4GMVA 4LCDE 3WCQA 3L08A 3BIID 2JWUA 4WQMA 2ZVNA 5EE3A 1NDDA 4WIPA 5G55A 2AQ3B 1V86A 2H88B 2VZKD 4A3PA 1WSPA 2WQYB 4FULA 3BVMA 1YX6B 4A90A 1UWMA 4W9CA 1V9JA 4WWNA 2KQ4X 3B2FA 3AV8A 4GB9A 4PT5A 2WXRA 2MWSB 3PTFC 3A9JA 4M00A 2BYEA 5AEKB 1V49A 4ZYNA 3ETRA 3P1MA 5D3DA 4II3B 4GIVA 3QWZB 3IXSA 3RI7C 1C77A 1OEYJ 1I42A 3NOBA 2HE7A 5HFYA 3BK2A 4EUTA 3H7SA 4ITKA 5DPSA 3W1SA 2LMCA 2OJRA 4RMAA 4RGTA 2QILA 4NAWA 3AU5A 2Z59B 1ROEA 1T6BX 4F1SA 1XF5L 1KLGD 3TBLD 1VD2A 4RFBA 1HE8A 2BS4B 2INPE 2I2YA 1RWSA 1D5ZC 5HHDG 3WAPA 4UDUC 3R2IA 4W9KA 1T3QA 4WAFA 1RAXA 2KXJA 2NBVB 5BMHA 2V4LA 2L1AA 1JCKB 3AEAB 4RM8A 2FIFA 1FM0D 2D3GA 2EMSA 2MLBA 3ALBA 1B9RA 4AJYB 1P0RA 1S1QB 5LNK1 2ZVOA 1TBEA 4FJZA 1QLBB 3T8MA 3ZYYX 4EFOA 4QAYA 3TEWA 1T0YA 2RDBC 3L4PA 3FILB 4B0MA 4G50A 3NVVA 1JW9D 4KZCA 4HRSA 4DWFA 3EA6A 1FXAA 1RRBA 2K22A 2IO1B 4N6EB 1UELA 5AZGA 1Q0WB 1UBIA 1WH3A 1MHHE 2IYDB 4WH4A 2MP2A 4WQOB 2GMIC 3JVZX 2N9XA 1UD7A 2EELA 3M62B 2WXHA 3C8YA 4MDKE 1SE4A 1EU4A 3A33B 5IOIA 4MACA 5JHBA 4XYCA 2LXAA 4ACFA 4EZLA 3WIMA 1PFDA 2X38A 4GDLA 2AQ2B 1E7PB 4DDGD 2QC8A 3AULA 1WJ4A 2A5UA 2CR5A 1ZDXA 3N9YC 1IBXA 3IVFA 3QCAA 2ON8A 1L4ZB 5G5HA 1JRPA 4FLHA 2B3AA 3S2AA 4Q2JA 4AUQC 1L6VA 3QAQA 3ZTDA 1MFWA 3B0AA 4F7ZA 1KLVA 3JSVB 1E90A 1MVKA 3A9KB 3VTWA 2Y5BB 3V3XA 2D11A 4AS1A 4NZLB 1HEZE 2JWZA 2MBQA 2JPHA 3RN9C 3W9CB 1LGRA 4DHZB 3KVFB 3E9SA 3VAWA 2KOXA 5L95C 2D07B 4NJ7A 4DK5A 3P4SB 5HI1A 3AN1A 3H1UA 3SR6A 2BVCA 1AN8A 2K0PA 4IWPA 3MC0B 2R61A 2WYQA 2K9XA 3P4RB 1UBQA 3KUZA 4EOYA 2LHEA 4KGSA 3AEFB 4GU2A 2DLBA 2BB5A 4L23A 1JWMD 1A70A 4FJYA 1WY8A 3TEYA 1WGKA 1UUPA 2JF5A 4YTPB 2AL3A 3Q6BA 4BFRA 2K25A 3SDLC 1WE7A 4KGTA 1ZGUB 4HDOA 2WXMA 1Z2MA 1Q10A 2ZPNA 4W9HA 4LNNA 4NPNA 4B95A 4KDLB 2MBHA 3NJTA 4RGOS 2DWQA 3AE4B 2KANA 2LVPA 3FILA 1V5TA 1YOVB 2G9HD 3ML9A 4OVVA 5MPOA 3P4PB 2KZRA 3PZDA 3L17A 3Q8FA 1N6ZA 5D7GA 3WALA 4C4VB 5AUIA 5TR5A 3UIPB 4MT5A 2YEPF 4TMAB 3PVLA 1A5RA 5IKCM 5FKAC 2PJHA 1QT9A 3KQ4A 4IWOA 4E71A 3K9OB 1FRRA 3VR8B 4WAAA 3ZKJC 1D5XC 3P42A 1NI2A 2MJ3A 1ZXIA 2KNBA 4GOCA 3VFKA 2ASQA 4JLCA 1XO3A 5J2RA 4M01A 1J7AA 3VUXA 1Y56A 5D2MB 3KUDB 3RZFA 4P1BC 2JU6X 4MJSB 2TSSA 2WXFA 4LJPB 1OEYA 1ZPSA 3OG5A 3KYDD 4B9KA 2JVCA 2OOBB 1F2RC 4GN1A 2AEHA 5C1ZA 1VCBA 3QIJA 2PIAA 2WX0A 2GBKA 3D32A 2JRIB 1SEBD 2H89B 3JSVA 1KRHA 3A9KA 1SJHD 3URYA 5GMVA 4RNAA 1J19A 5BMIA 1MI0A 2CU1A 1VRAB 2R2OA 3APFA 2Q5WD 1RYJA 5CHFA 2SEBD 4IDIA 1V8CA 2BYTA 3U2SC 3DVGY 2EKIA 1SB3C 1IYFA 2FAZA 3W1YA 3NVZA 3ZGZA 2LGYA 3L10B 1C4AA 3CWIA 1E8XA 3GS2A 3Q8AA 1BMLC 4DDID 1GB1A 3PRZA 3BYYB 1K50A 3DBHB 4E3CA 1HTOA 2BTEA 2JSVX 4REZA 3TIXA 2KN5A 2EMTA 3LYYA 2ZW1A 3OJ3A 4KSKC 3V62A 4C56C 2WHIA 3VDZA 3B1LX 3TMPB 3RFZB 2N9LA 1LFDA 4NQKE 2CHWA 2JYEA 2DZMA 3PPAA 2M56B 2UYZB 4BOSC 4WWOA 4JWSC 4TV3A 3PS6A 4NAMA 3ZNHB 2KTFA 2BW2A 1V81A 2XBBC 1N5XA 3AEEB 3DOWA 3VRBB 3EFUA 2KKCA 1I4XA 2BQQA 4LNKA 3I3TB 3AE7B 2LVQA 3KLSX 4W9LA 5E6NA 3SU8X 2W55A 3CSFA 3PLUA 3PSEB 1V1PB 2AQ1B 2O6VB 1WGGA 4K7SA 4ARCA 3V6CB 1WIAA 4BKSA 2N9EB 4S0RA 2OEDA 1IGDA 2O2VB 4YTMB 2NCNA 1Z5SB 1EM7A 2QMTA 2XN9C 3FKYA 4BZAA 3ZW3A 1N61A 1TKGA 4J6IA 2WDVB 2IY1B 1M94A 1JQ4A 2OHFA 1JWUD 1S3SG 4C4VA 2GI9A 2W3RA 2KC1A 1TIFA 1C1YB 1FFVA 5EE9A 3HUIA 3EC8A 1L4DB 1P9DU 2IPKD 3FAHA 3H9DA 1WX9A 3H6NA 4PYUA 1I4RA 3IFWB 4BBNF 2Y5PA 1R4NB 2N9PC 2GRIA 4ANVA 1V5OA 2RDGA 2GOWA 1C76A 5JH5C 1DOIA 2M8SA 4R3DA 3DHIC 4MJSA 2I1JA 1JWBD 5E6PA 3A4RA 3UINB 4LTUA 1YX5B 1WX8A 2L0TA 1GNUA 3AEDB 4ANXA 4ZHPA 3H7PA 1BXTA 4NQLB 3R7QA 2K6QA 2N1WA 2WXKA 1P7FA 1WI0A 4GDLB 4HCPB 4A20A 5BO4B 2WX1A 2DYOA 3RNBC 2QEJC 1LO5D 3RZWC 4FBJB 1PUTA 2FCMA 2RDHA 1B1ZA 4OZCA 2C7NB 1YN3A 2CU3A 4US9A 3PHXB 3UGBB 2NMQA 2C7MB 3QA8A 3UIOB 2V0GA 1D6EC 1IUEA 2N9KA 3EGRA 3N20C 4OW0A 1G6JA 3W5VB 5G5GA 4FADA 4AQ7A 1WGHA 1FCCC 1MJDA 2JRHA 2K8BA 3MC8A 1E10A 2WS3B 4GSWA 2DZIA 3H8HA 3PGEA 1EU3A 2M19A 1NI3A 1L0XB 2C60A 2LWPA 2JUOA 1VDVA 2D3CA 3U30A 2NTSA 2VH2A 4I6NB 4ZRIA 2QCZA 2L3ZA 3IBEA 2GBMA 3Q8BA 1XD3B 4DXFA 3N1YC 3U4EG 1MPEA 3U8ZA 3OWEB 1F9JA 2HTME 4HK2A 1YN4A 2O6VD 2CJOA 3DVNV 1PGAA 2LJIA 1OQYA 3BK1A 1V1PA 2QDFA 2O6VA 2DYBA 2MW5A 2LGDA 2LGIA 2O2VA 1WGYA 1BT0A 3M3JA 4RF1A 4MH8A 3BZDB 1HZ5A 1E8YA 2L00B 4OVZA 2QIEB 4M0WB 3VH3B 4YTNB 4LNFA 4MM3B 2HD5B 4KSLC 3JW0X 4JWUC 1WMHB 2WXQA 1VZ7A 1WXSA 4XDDA 1P98A 3DBHI 1NVID 2INCC 1JWAD 3ZLZA 3OAWA 5CHVC 2J42A 1SJED 2KJHB 4BBNC 2NBUA 3L13A 2D5GA 3HVZA 3DWGC 1JRUA 2L0FA 4A3OA 4B0EA 2G1EA 2PKOA 1FO4A 3ZNGC 1L2NA 3NS1A 2PVOD 3C0RB 3GE3C 2IY0B 3QQ8B 3NY5A 1R7SA 5JXVA 4MSQB 1N63A 3Q3JA 2KDBA 1T0SC 1UGMA 3PO0A 2IBIB 4OZBA 1OGWA 4ZOHC 4FN2A 2DENB 4HPMB 4MEMA 3SHQA 3ZJUA 4PK1A 2WP9B 2J4XA 1DOYA 3LDZE 5C23A 3LB8C 5IA7A 3N1ZC 2V9HA 3APCA 1J7BA 1MG4A 3A1QB 2JQRB 2IGDA 1SGHA 2JZPA 1WM2A 3ENEA 2IJ0A 1N60A 5G2NA 4D2KA 4FXCA 1NENB 2NBWB 2G4DB 4EKUA 2MRPA 2L05A 5BYSA 5IN7A 3VHTC 1YJ1A 1ENFA 2WWZA 3CSTA 2PW9A 1K51A 3HIZA 4MGIE 1R4NI 3ZXVA 4HKQA 2WLBA 4M8MA 4ZHOA 1QOGA 1LM8B 5DPRA 1GC7A 4MH0E 2FCNA 1D3ZA 1XLPA 2C5LC 4DHZE 2D10A 1LXDA 1TY0A 5IAAC 5BYQA 2ZNVC 1VZ6A 5H8YE 2GLSA 4ZRKA 2INNE 5D6JB 4OZAA 2HJ8A 1V1OA 3GB1A 4TQ1A 2VH1A 5DCNA 4US8A 3VTVA 3DPDA 4JL9A 4CQNA 1GUAB 3NZ3A 2LGSA 1FFUA 2KACA 1HTQA 3QJZA 2LUMA 3ZDMC 4G0NB 2N4FA 3E56A 2MSED 4HKZE 2J0JA 3V6EB 2JZ3B 4FHJA 2MBOA 3C19A 1JALA 2RR9A 1YIWA 4G11A 1OQQA 2IGGA 2UU7A 1WYWB 4GXBA 4M0WA 3FC4A 2NTTA 2BKRB 1WE6A 4YSXB 4MM3A 4RCOA 4EEWA 1FXIA 3AI5A 2IO0B 3DBRB 1WMHA 2PLPA 1TT5B 4PS8A 3NVYA 3DCGA 1SXTA 1I4GA 2LXCA 4IW0A 4LDTD 4IM3A 3MJ5A 1WR6E 1QKZA 5TSSA 1C78A 1TY2A 3DBLB 2FNJB 2W9NA 1FIQA 1N62A 2L32A 1L7YA 2KT7A 3RUIB 4A8XC 3Q69A 3DVGX 4TQ0A 3QARA 4K7WA 4A6QA 4JX1C 1XXGA 2M0XA 2ZZPB 3R2TA 1ZDVA 4BVUC 2FUHB 3NZUA 4JIOU 5LXIB 1P1AA 3VUWA 4ICVA 2MHJA 4KV2A 1KLUD 1AYFA 1IGCA 2KYWA 2KQSA 1IP9A 2G45B 2R2QA 1PQSA 2DAJA 2IZVB 3N3KB 3K9PB 2PVGC 3VVWB 3Q14C 1SIFA 1QOBA 4WJOA 1EF5A 3P2BA 4KVGB 4ICUA 1P7EA 2W54A 4ZDVA 1E8WA 3RNAC 3WANA 3R66C 1GB4A 3KUCB 2HJ1A 1UGJA 4WJNA 3BVZA 3V61A 2BPSA 1WRIA 2WXPA 3H7PB 2MCNB 1YQ3B 4EZKA 1OFFA 2MX2A 3A1QA 3AE6B 4HLEA 1H4RA 3I57A 1OQRA 2WGSA 4K7UA 4KIKB 4FHKA 1HA5A 3GOEA 1AARA 1GJZA 2LHDA 2KTRA 4I6PA 1XCTL 4AWJA 4C00A 1I7HA 1I4HA 5CX3A 2KDMA 3GZNB 3KWVA 1BUIC 1AWDA 1K52A 1OTRB 3PT2B 4WWMA 1UH6A 1WZ3A 2Z8LA 1P3QU 3ZNID 5I4DA 3SEBA 2K1FA 1STEA 4YSZB 2DHZA 2DZKA 1CJEA 1FNWA 4RH6A 3L16A 4HVBA 2LASA 1KM7A 1WXAA 4WWPA 1UF0A 1WM3A 1E7VA 2YEPB 3J9CA 2L52A 2KMAA 4YL8A 3JYUA 2RGFA 4DBGA 4HDQA 1DYQA 1KFYB 3RNEC 2NPTB 1L5PA 4DQOC 1N5WA 5EE0A 3W5UB 3SFEB 3ZO5B 2MBBB 3V60A 4CHKA 4C7ZA 2K39A 4G3XB 3ZDTA 3VUYA 5JZEB 3I5JC 4YWGG 3HM3A 2K6DB 3WA0A 1TGZB 4GDKB 3ECIA 1WF9A 3RULA 4C80A 3B2GA 1J0GA 3TEXA 3OJ4B 2B76B 4C7YA 4EE2A 3ZRFA 1TKEA 4X57B 1J7CA 4XWWA 2K8HA 4YT0B 4HPPA 1UWXA 4LK0M 1RFKA 2WU2B 5J18A 1I4QA 3ZNZB 1RLFA 5IO9A 2BWES 2XK5B 2RPQA 5GXGB 1FNVA 1QILA 3NVWA 1FRDA 2JXTA 4DXAB 2GB1A 1EWYC 4IOIE 2ZW0A 2LD9A 3P63A 1UNSA 2HTHA 4RF0A 3HVDA 1ACCA 2G4SA 2JT4B 5J17A 3TL5A 3Q3OC 4NJCA 4PS3A 3L0WB 3W1SC 1ESFA 3WAOA 1YNTE 3T3NA 5KHQA 1NYQA 1SE2A 2C9WB 5HG2A 1HQRD 3O13A 4F8CB 4IWQA 5KHOA 1WXQA 3RCZA 1TS4A 3T9LA 5C2TB 1WGDA 4LNIA 2NR2A 2KDFB 2VRRB 1FCLA 2M17A 2BT6A 2ZEQA 4XWTA 2BGFA 2BF8B 4RGNA 4KX6B 4KIKA 3BYTB 3PREA 3PV1A 2BYFA 2E3TA 2WDTB 3AE2B 1CK1A 1C3TA 2I38A 3I63C 2PE6B 5FR3A 5EE1A 2W82A 3RD2A 4ARIA 5AUKA 1AW7A 1K8RB 3AEGB 2KMMA 4NJ6A 3NHEB 4HXDA 1ZE3D 4XGAB 3NZSA 1VR9A 2BS3B 1ZXHA 1TKYA 2LEKA 2BKFA 3N30A 3UI3A 4BAXA 1FMAD 2KX3A 1F1HA 2I1KA 4XC2A 4DHJB 2V1YA 5IP4D 2KDEB 3ZUNA 2NVUI 4GGQA 4LLGM 2J52A 3Q8CA 1QOAA 4KDIC 3DWMA 4K3BA 1EF1A 2IGHA 1YQBA 2N7JA 1NBFC 1E8ZA 2K8CA 4N9F4 2HDEA 4HWIB 2JXXA 5C3JB 5JHAA 3KWLA 2KJRA 2D2QA 5H92C 2NPTA 2KLCA 3VTUA 1TTNA 4TUUA 4BKGA 1FXTB 3RNCC 1XLQA 2WXLA 4MGZE 4WJQA 4GDKA 2M4NA 3MFGA 2RSUA 2FCQA 1XLOA 1NEKB 1D4BA 4HJGE 3NUHB 2JX5A 5CTRC 2IO3B 1PGBA 1ISNA 3UF8A 2WNMA 2RPVA 4JPSA 2UWQA 3AEBB 5AZFA 2XK5A 3N32A 3RNFC 1CQVA 2ZPYA 2RD0A 1SBBB 4DXGA 3GZNI 2FCSA 1JWSD 3EFCA 2JY6A 2ACZB 2DNFA 1T0RC 3QX1A 3QK0A 2WXJA 3DBSA 4LDTB 3ZIMA 1QQRA 3M95A 1PDXA 2V3SA 1JROA 1WJUA 3QC8B 4OHJA 3CF6E 3DQVA 1IPGA 4PYZA 5HKHA 3Q8EA 5FR6A 2KAJA 2KLGA 1WXVA 2FIDA 1ET9A 2AL6A 4TKNA 1ZOYB 1TZOA 2CJNA 3GE8C 4HPLB 2Y5CA 2LI5A 3MHSD 2G3QB 1NYRA 1VZ8A 2V3NA 4KGRA 5DPWA 2AYOB 5E6JA 1KJTA 4KKIA 3TUOA 2YVCA 4XDCA 1UZXB 1YN5A 1C4CA 3TJPA 3HRDD 4P16A 3P4QB 3L54A 1M4VA 1Q5WB 1V80A 5BMGA 1VLBA 1GG3A 2PTLA 2ZNVB 3IAS1 4MGYE 1SF0A 2ZCBA 3AE3B 4O1NA 1GOZA 1WFYA 2K5PA 3AB5A 1L6UA 2MQJA 1MHXA 1V97A 1C79A 3NG0A 2KMCA 1WJNA 1ZP0B 4DHJD 2YLMA 3SFDB 1WGRA 3QHTA 4AJWA 1Q1OA 4RM9A 4B6WA 4ZRPA 1PYWD 3IT4B 3R3MA 3N1XC 1TS2A 2RMMA 2BWFA 2Y3AA 4MGKE 1DOXA 2KTRB 2IO2B 3Q3MC 4H2AA 4ZRQA 3ML8A 4HROA 1QOFA 2NS5A 2ICIA 3AE5B 2M1MA 5L83A 4WURA 1ZKHA 5D94A 2SAKA 2CHXA 1EWCA 2L8JA 1KF6B 2A4ZA 2LGXA 4MELA 1L0VB 2KWDA 3HHMA 1GAQB 3A4SC 4HEA1 1YQ4B 4USAA 3ZTCA 1MG8A 3LJ3A 2IDYA 1XCQL 2DYMA 3RNGC 3MJWA 3B08A 3TEZA 3AM9A 1WR1A 3IT6B 3I9V1 3EHVA 4ASWC 1YJJA 3VRAB 2C7HA 2M0AA 2PPHA 3R8BA 3KW5B 4W9IA 5D3IB 3UQBA 4PS7A 2DZJA 2INDC 1E7UA 1R4MB 1WRDB 2MH7A 2KO3A 3MTNB 4HCNB 4MSMB 3X0WA 1ET6A 2ZCCA 3ZXRA 4IKGA 3IHPC 3U7ZA 3TSSA 1X1MA 4P7IA 4JGHB 2E6XA 5E6OA 2FE8A 2J7QB 2MJDA 3ZJTA 2J53A 3OLMD 2OJWA 4ZRJA 1HXYD 1XT9B 1FEHA 1FNUA 3RPFC 1KTKA 4KKJA 2WXNA 4BKTA 4LNOA 3DVNU 4YXDB 2ONQA 3MP9A 1TS3A 2REXA 1WZ0A 2QHOA 1YD8U 2CS4A 2KFKB 1XEEA 1EO6A 2KQ7A 3APDA 1Y8RC 2D3BA 1TJEA 1T0QC 3V05A 1GC6A 4IM2A 1SIJA 2J0MA 2FBWB 2WXGA 3ZVVA 1SE3A 3GP7A 1WYGA 2AX5A 4IUMB 2WXOA 3PZ7A 2JZZA 3AU4A 3U7DA 3W2DA 1RM6C 2DAFA 3ZQ4A 3VR9B 2JYTA 3AE9B 1GPXA 4FJVB 2K3UA 2LZ6A 4HJKA 3EECA 4GLSC 3ONSA 3ZJVA 2LJ5A 4EZJA 2XNAC 4JE3B 5LLIA 1TZ1A 3RYTA 3BINA 4IM0A 1ZW7A 4IG7B 1E6EB 3TCAA 4ZYSA 1E5WA 4K1RB 1SE9A 1J8CA 3Q2AC 3BVGA 1WXMA 4A9AA 1FPYA 1I35A 2KVRA 1EUVB 3MHZA 4W9EA 5CHWA 2XEWA 4NY0A 3T3OA 2GBRA 2WDRB 2LRWA 3PRMB 1F0ZA 5AZHA 1U4AA 4I6LB 5DPTA 2EKEC 2Z0EB 5FK9C 3MC9A 3O65B 3NS8A 1T5XD 4YSYB 4M02A 3PZ8A 3PLVA 4E74A 1V2YA 3HK0A 2BS2B 1RFAA 4N59A 2MA9B 4FA6A 4P6VF 2L76A 2WDQB 3AE1B 4OVUA 2L7RA 2MBEA 2KWCA 1E0ZA 2Z0DB 3ZRCA 3EUB2 2QSDA 1FD6A 3VQIA 1L0YB 1XLNA 2VZKB 2GBNA 3WAMA 1CZPA 4N58A 1WWTA 4JQWC 4BOZB 3R7RA 2W3SA 4L2YA 3A9JB 1V6EA 2KWVB 1YJIA 2MJEA 1SSNA 1F52A 3Q3FA 3U52E 2KHWB 4K81A 4NNJB 1I4PA 3AECB 3LXFA 3CMMB 1QZEA 1PGXA 4NAWB 2KJ6A 3ABVB 2L83A 1TS5A 4BKSD 4XE0A 4A55A 1H8CA 2KFJA 2N7EA 1F77A 2J0KA 3DDCB 4W9FA 3AMZA 4IC7B 3CIRB 3X23A 3PHWB 4II2B 2CHZA 3NRZA 2PMVA 2X8XX 2KFKA 3M63B 2GBJA 4XX5A 4M8NA
chains in the Genus database with same CATH topology
5BYSA 2QJLA 1XLQA 2JU6X 2TSSA 2WXFA 2WXLA 1ZPSA 2BBCA 5BYRA 2WU5B 3MFGA 1ENFA 2PW9A 1K51A 1XLOA 1NEKB 4HKQA 2WLBA 1D4BA 1F2RC 4ZHOA 1QOGA 4HJGE 3NUHB 2JX5A 2PIAA 1KH0A 4J3OD 1C4PA 1PGBA 1XLPA 1YMHE 1JMLA 1SEBD 2H89B 4TSSA 1HZ6A 1KRHA 1TY0A 1SJHD 2FUG1 2RPVA 2WNMA 4JPSA 4RNAA 5BYQA 3URYA 1VZ6A 3AEBB 5BMIA 1MI0A 5H8YE 1VRAB 2V4IB 2INNE 4L1BA 4RGMA 1CQVA 1RYJA 2Q5WD 2LFIA 2SEBD 4IDIA 4OZAA 1V8CA 2BYTA 1V1OA 1SBBB 3U2SC 4DXGA 3GB1A 4TQ1A 4US8A 2EKIA 1SB3C 3NVZA 3ZGZA 4CQNA 1C4AA 5T8IA 1E9MA 1JWSD 3NZ3A 1K53A 3CWIA 1VJKA 2ACZB 1FFUA 3GS2A 2KACA 3Q8AA 1BMLC 2LUMA 1C9FA 1GB1A 3E56A 2N0SB 2WXJA 3AE8B 4HKZE 1QQRA 2WXIA 1PDXA 3BYYB 1K50A 2MEKA 1JALA 1JROA 2BTEA 2JSVX 1OQQA 4REZA 1QF6A 2IGGA 4OHJA 3LYYA 4M0WA 3B9JA 2ZW1A 2BB6A 2V3PA 1D5MC 4C56C 3FC4A 3Q8EA 2NTTA 3AH7A 2KAJA 4YSXB 1F2RI 4RCOA 1FXIA 1ET9A 1IBXB 1ZOYB 1TZOA 2PLPA 2CJNA 1TYGB 3RFZB 2N9LA 2Y5CA 2JYEA 3IAM1 1DGJA 2KN4A 1ZUD2 2DBYA 3NVYA 2M56B 1NYRA 1SXTA 1I4GA 4JWSC 1VZ8A 2V3NA 4KGRA 3MJ5A 5E6JA 1QKZA 3BWUD 4KKIA 4NAMA 3WCQA 3TUOA 3BIID 2JWUA 4WQMA 5TSSA 1C78A 1TY2A 2BW2A 4XDCA 1YN5A 5EE3A 1FIQA 1N62A 1C4CA 2L32A 1N5XA 4WIPA 3AEEB 3HRDD 3VRBB 4P16A 3P4QB 1I4XA 2AQ3B 2H88B 2VZKD 3Q69A 4A8XC 3AE7B 4TQ0A 3KLSX 1M4VA 4A6QA 1WSPA 2WQYB 4JX1C 1VLBA 3BVMA 1XXGA 3R2TA 5BMGA 4A90A 2W55A 1UWMA 1ZDVA 2KQ4X 2PTLA 3IAS1 1SF0A 3B2FA 3AV8A 3AE3B 4O1NA 1GOZA 4PT5A 2WXRA 1V1PB 2K5PA 2AQ1B 3AB5A 1L6UA 4ARCA 1KLUD 1MHXA 1V97A 1C79A 1AYFA 1IGCA 2OEDA 1IGDA 1ZP0B 3ETRA 3P1MA 5D3DA 3SFDB 4YTMB 3IXSA 1EM7A 2QMTA 2XN9C 1C77A 4ZRPA 5HFYA 2PVGC 1PYWD 3BK2A 3IT4B 4ITKA 1N61A 3W1SA 1TKGA 1QOBA 2LMCA 1TS2A 2RMMA 2WDVB 1P7EA 2Y3AA 2W54A 1JQ4A 4RGTA 1DOXA 2OHFA 2QILA 1JWUD 1ROEA 1T6BX 2GI9A 2W3RA 1XF5L 1KLGD 4H2AA 4ZRQA 4HROA 1GB4A 1QOFA 4RFBA 1FFVA 5EE9A 1UGJA 3BVZA 3HUIA 2ICIA 3AE5B 1WRIA 2WXPA 2BS4B 2INPE 1L4DB 4WURA 2I2YA 1RWSA 2IPKD 1D5ZC 5HHDG 2SAKA 1YQ3B 4UDUC 3R2IA 1OFFA 1EWCA 3FAHA 1T3QA 1KF6B 4WAFA 1L0VB 1I4RA 2KWDA 3AE6B 1GAQB 3I57A 1OQRA 2Y5PA 5BMHA 2L1AA 4HEA1 1YQ4B 1JCKB 2GRIA 3AEAB 4USAA 1FM0D 2RDGA 1C76A 1HA5A 1B9RA 1DOIA 1NENB 2IDYA 4R3DA 1XCQL 2DYMA 1JWBD 2LHDA 5LNK1 4LTUA 3TEZA 3AM9A 1XCTL 3IT6B 1QLBB 3I9V1 3ZYYX 3AEDB 1YJJA 3VRAB 2M0AA 3TEWA 1I7HA 1I4HA 3R8BA 2KDMA 3L4PA 4ZHPA 3FILB 1BXTA 5D3IB 3KWVA 4B0MA 1BUIC 1AWDA 1K52A 1JW9D 2WXKA 3NVVA 4WWMA 1P7FA 2MH7A 4HRSA 4GDLB 3EA6A 1ET6A 2Z8LA 1FXAA 4IKGA 5I4DA 2K22A 3SEBA 3U7ZA 3TSSA 2DYOA 4N6EB 1STEA 2QEJC 1LO5D 2E6XA 1MHHE 1PUTA 2FE8A 2MJDA 4YSZB 3ZJTA 2RDHA 1B1ZA 4OZCA 1YN3A 4WH4A 2J53A 2CU3A 4US9A 1CJEA 1FNWA 2NMQA 4RH6A 1HXYD 2V0GA 1FEHA 1D6EC 1IUEA 2EELA 1FNUA 2N9KA 3RPFC 3EGRA 2YEPB 1KTKA 3J9CA 4KKJA 4OW0A 2WXHA 2WXNA 3W5VB 2L52A 3C8YA 5G5GA 1SE4A 1EU4A 4AQ7A 4MACA 1DYQA 1FCCC 4YXDB 1KFYB 1L5PA 2ONQA 4DQOC 3MP9A 1TS3A 1N5WA 5EE0A 3W5UB 1E10A 1XEEA 1PFDA 2WS3B 3H8HA 3SFEB 4C7ZA 2X38A 1EU3A 2AQ2B 1E7PB 2M19A 1NI3A 1L0XB 1ZDXA 3N9YC 1VDVA 4YWGG 1IBXA 2NTSA 1TJEA 3V05A 4GDKB 1SIJA 2FBWB 4C80A 3B2GA 2WXGA 2ON8A 1L4ZB 5G5HA 1JRPA 1SE3A 3TEXA 3GP7A 4Q2JA 2B76B 1WYGA 4C7YA 2AX5A 4EE2A 1TKEA 2WXOA 1L6VA 3PZ7A 3Q8BA 1J7CA 3W2DA 4XWWA 4DXFA 1RM6C 4YT0B 3VR9B 3ZQ4A 1UWXA 4LK0M 3U4EG 1MPEA 1RFKA 2WU2B 3OWEB 1I4QA 2JYTA 3AE9B 1GPXA 2HTME 1YN4A 1MVKA 2K3UA 2CJOA 4GLSC 3V3XA 1PGAA 3ZJVA 5GXGB 4AS1A 4NZLB 1FNVA 2XNAC 1QILA 1HEZE 1FRDA 3NVWA 2JXTA 2LJIA 2GB1A 4JE3B 3W9CB 1EWYC 4IOIE 2ZW0A 3BK1A 1V1PA 3P63A 1E6EB 1UNSA 4ZYSA 3E9SA 4RF0A 2LGIA 3HVDA 1ACCA 3BVGA 3P4SB 5HI1A 4NJCA 3AN1A 1ESFA 3SR6A 4A9AA 4RF1A 3MHZA 1AN8A 1YNTE 4MH8A 3BZDB 1HZ5A 3T3OA 2K0PA 3T3NA 2WDRB 3MC0B 2R61A 1NYQA 1SE2A 4OVZA 5HG2A 2QIEB 1HQRD 3O13A 2K9XA 4YTNB 1F0ZA 1WXQA 3P4RB 1TS4A 5C2TB 4MM3B 2LHEA 2WXQA 4JWUC 5FK9C 1VZ7A 1T5XD 4KGSA 3AEFB 4XDDA 4YSYB 2DLBA 1FCLA 2BB5A 3PZ8A 4L23A 1NVID 1JWMD 1JWAD 1A70A 2BT6A 2BS2B 4XWTA 4N59A 3TEYA 2J42A 1SJED 4RGNA 1WGKA 1UUPA 4KX6B 4P6VF 2D5GA 4YTPB 3BYTB 2WDQB 3AE1B 3HVZA 3DWGC 2E3TA 4KGTA 3AE2B 1CK1A 2WXMA 1E0ZA 2I38A 5FR3A 5EE1A 3EUB2 2QSDA 1Q10A 4B0EA 2W82A 1FD6A 2G1EA 3VQIA 2PKOA 4ARIA 1L0YB 1XLNA 1FO4A 2VZKB 3NS1A 1CZPA 4N58A 1WWTA 5AUKA 1AW7A 2PVOD 2W3SA 4L2YA 3AEGB 2KMMA 4RGOS 2DWQA 3AE4B 1R7SA 3FILA 1YJIA 2MJEA 1SSNA 5JXVA 1ZE3D 3U52E 1N63A 1VR9A 2BS3B 1ZXHA 2G9HD 1TKYA 2LEKA 3UI3A 1I4PA 3AECB 3PO0A 1FMAD 3LXFA 4OZBA 5MPOA 4ZOHC 3P4PB 3Q8FA 1PGXA 3ZJUA 5D7GA 4NAWB 2WP9B 5AUIA 3ABVB 4LLGM 2J4XA 2YEPF 2L83A 4MT5A 1TS5A 4TMAB 1DOYA 4XE0A 2J52A 3Q8CA 4A55A 1QOAA 5FKAC 1QT9A 3KQ4A 3DWMA 3LB8C 1F77A 1FRRA 2IGHA 2N7JA 3VR8B 2HDEA 1J7BA 1D5XC 3AMZA 3CIRB 2JQRB 2IGDA 3P42A 2MJ3A 1ZXIA 2JZPA 5C3JB 3KWLA 5H92C 2IJ0A 1N60A 3NRZA 2PMVA 1XO3A 4D2KA 4FXCA 1J7AA 1Y56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMG A;  1MHH E;  2JU6 X;  2KQ4 X;  2PTL A;  4OZC A;  4WH4 A;  2J53 A;  2LHE A;  4KGS A;  2PW9 A;  1K51 A;  2NMQ A;  1D4B A;  1MHX A;  1FCL A;  2EEL A;  1F2R C;  4HJG E;  1IGC A;  2N9K A;  2OED A;  1IGD A;  1KH0 A;  1EM7 A;  2QMT A;  1PGB A;  1YMH E;  1JML A;  4MAC A;  5HFY A;  1HZ6 A;  1FCC C;  2ONQ A;  3MP9 A;  2RPV A;  5BMI A;  4KGT A;  1MI0 A;  2RMM A;  1P7E A;  2I38 A;  4OZA A;  2QSD A;  2GI9 A;  1XF5 L;  1IBX A;  1Q10 A;  3GB1 A;  1GB4 A;  1FD6 A;  2ON8 A;  1K53 A;  2I2Y A;  5HHD G;  2KAC A;  3FIL A;  2LUM A;  1C9F A;  5JXV A;  1GB1 A;  2KWD A;  4HKZ E;  1UWX A;  1ZXH A;  5BMH A;  1K50 A;  1MPE A;  3UI3 A;  2JSV X;  1MVK A;  2IGG A;  4GLS C;  4OZB A;  2ZW1 A;  3V3X A;  1PGA A;  1PGX A;  1HEZ E;  1XCQ L;  2JXT A;  1F2R I;  2GB1 A;  1IBX B;  4IOI E;  2ZW0 A;  2PLP A;  2LHD A;  2N9L A;  2J52 A;  1XCT L;  2KN4 A;  4KGR A;  2LGI A;  1QKZ A;  2KDM A;  2IGH A;  2N7J A;  3FIL B;  5HI1 A;  2JWU A;  2IGD A;  1K52 A;  2JZP A;  1P7F A;  1YNT E;  1HZ5 A;  2K0P A;  4D2K A;  5HG2 A;  4IKG A; 
#chains in the Genus database with same CATH topology
 2QJL A;  2KVZ A;  3DHG C;  2LVO A;  2N7D A;  3DHH C;  2BBC A;  5BYR A;  2WU5 B;  4LJO B;  1CMX B;  4P1C C;  4URK A;  4CO7 A;  2KDI A;  2AWT A;  2ZJD A;  4W9D A;  1KH0 A;  4J3O D;  1C4P A;  2KC2 A;  3BY4 B;  2KD0 A;  4AOF A;  1YMH E;  1JML A;  3KYC D;  4TSS A;  1HZ6 A;  2PEA A;  3PRP B;  3SD5 A;  4AP4 C;  4W9G A;  3UQA A;  4S17 A;  4XZ4 A;  2FUG 1;  4ANW A;  2V4I B;  3HM6 X;  4L1B A;  4RGM A;  5EDS A;  2LFI A;  2D3A A;  2PE9 A;  5LXH A;  2KX0 A;  1WX7 A;  2LRU A;  3VXW A;  2MP2 B;  2N1V A;  1E9M A;  5T8I A;  3VH4 B;  1R4M I;  2CKH B;  1K53 A;  3Q3N C;  1VJK A;  3IG3 A;  1LQB A;  1C9F A;  2DX5 B;  4CYE A;  3DBR I;  2N0S B;  3AE8 B;  2WXI A;  2MEK A;  3KH0 A;  2KK8 A;  1KOT A;  4W9J A;  1QF6 A;  1XQQ A;  1WJ6 A;  3B9J A;  3RT3 B;  2BB6 A;  2V3P A;  1D5M C;  3DBL I;  3AH7 A;  1F2R I;  3RMK C;  1IBX B;  4ANU A;  1TYG B;  4KZ0 A;  4WJP A;  3IAM 1;  1DGJ A;  2KN4 A;  1ZUD 2;  2DBY A;  2KWU B;  2BYV E;  2LUE A;  4K3C A;  3BWU D;  3AXC A;  4GMV A;  4LCD E;  3WCQ A;  3L08 A;  3BII D;  2JWU A;  4WQM A;  2ZVN A;  5EE3 A;  1NDD A;  4WIP A;  5G55 A;  2AQ3 B;  1V86 A;  2H88 B;  2VZK D;  4A3P A;  1WSP A;  2WQY B;  4FUL A;  3BVM A;  1YX6 B;  4A90 A;  1UWM A;  4W9C A;  1V9J A;  4WWN A;  2KQ4 X;  3B2F A;  3AV8 A;  4GB9 A;  4PT5 A;  2WXR A;  2MWS B;  3PTF C;  3A9J A;  4M00 A;  2BYE A;  5AEK B;  1V49 A;  4ZYN A;  3ETR A;  3P1M A;  5D3D A;  4II3 B;  4GIV A;  3QWZ B;  3IXS A;  3RI7 C;  1C77 A;  1OEY J;  1I42 A;  3NOB A;  2HE7 A;  5HFY A;  3BK2 A;  4EUT A;  3H7S A;  4ITK A;  5DPS A;  3W1S A;  2LMC A;  2OJR A;  4RMA A;  4RGT A;  2QIL A;  4NAW A;  3AU5 A;  2Z59 B;  1ROE A;  1T6B X;  4F1S A;  1XF5 L;  1KLG D;  3TBL D;  1VD2 A;  4RFB A;  1HE8 A;  2BS4 B;  2INP E;  2I2Y A;  1RWS A;  1D5Z C;  5HHD G;  3WAP A;  4UDU C;  3R2I A;  4W9K A;  1T3Q A;  4WAF A;  1RAX A;  2KXJ A;  2NBV B;  5BMH A;  2V4L A;  2L1A A;  1JCK B;  3AEA B;  4RM8 A;  2FIF A;  1FM0 D;  2D3G A;  2EMS A;  2MLB A;  3ALB A;  1B9R A;  4AJY B;  1P0R A;  1S1Q B;  5LNK 1;  2ZVO A;  1TBE A;  4FJZ A;  1QLB B;  3T8M A;  3ZYY X;  4EFO A;  4QAY A;  3TEW A;  1T0Y A;  2RDB C;  3L4P A;  3FIL B;  4B0M A;  4G50 A;  3NVV A;  1JW9 D;  4KZC A;  4HRS A;  4DWF A;  3EA6 A;  1FXA A;  1RRB A;  2K22 A;  2IO1 B;  4N6E B;  1UEL A;  5AZG A;  1Q0W B;  1UBI A;  1WH3 A;  1MHH E;  2IYD B;  4WH4 A;  2MP2 A;  4WQO B;  2GMI C;  3JVZ X;  2N9X A;  1UD7 A;  2EEL A;  3M62 B;  2WXH A;  3C8Y A;  4MDK E;  1SE4 A;  1EU4 A;  3A33 B;  5IOI A;  4MAC A;  5JHB A;  4XYC A;  2LXA A;  4ACF A;  4EZL A;  3WIM A;  1PFD A;  2X38 A;  4GDL A;  2AQ2 B;  1E7P B;  4DDG D;  2QC8 A;  3AUL A;  1WJ4 A;  2A5U A;  2CR5 A;  1ZDX A;  3N9Y C;  1IBX A;  3IVF A;  3QCA A;  2ON8 A;  1L4Z B;  5G5H A;  1JRP A;  4FLH A;  2B3A A;  3S2A A;  4Q2J A;  4AUQ C;  1L6V A;  3QAQ A;  3ZTD A;  1MFW A;  3B0A A;  4F7Z A;  1KLV A;  3JSV B;  1E90 A;  1MVK A;  3A9K B;  3VTW A;  2Y5B B;  3V3X A;  2D11 A;  4AS1 A;  4NZL B;  1HEZ E;  2JWZ A;  2MBQ A;  2JPH A;  3RN9 C;  3W9C B;  1LGR A;  4DHZ B;  3KVF B;  3E9S A;  3VAW A;  2KOX A;  5L95 C;  2D07 B;  4NJ7 A;  4DK5 A;  3P4S B;  5HI1 A;  3AN1 A;  3H1U A;  3SR6 A;  2BVC A;  1AN8 A;  2K0P A;  4IWP A;  3MC0 B;  2R61 A;  2WYQ A;  2K9X A;  3P4R B;  1UBQ A;  3KUZ A;  4EOY A;  2LHE A;  4KGS A;  3AEF B;  4GU2 A;  2DLB A;  2BB5 A;  4L23 A;  1JWM D;  1A70 A;  4FJY A;  1WY8 A;  3TEY A;  1WGK A;  1UUP A;  2JF5 A;  4YTP B;  2AL3 A;  3Q6B A;  4BFR A;  2K25 A;  3SDL C;  1WE7 A;  4KGT A;  1ZGU B;  4HDO A;  2WXM A;  1Z2M A;  1Q10 A;  2ZPN A;  4W9H A;  4LNN A;  4NPN A;  4B95 A;  4KDL B;  2MBH A;  3NJT A;  4RGO S;  2DWQ A;  3AE4 B;  2KAN A;  2LVP A;  3FIL A;  1V5T A;  1YOV B;  2G9H D;  3ML9 A;  4OVV A;  5MPO A;  3P4P B;  2KZR A;  3PZD A;  3L17 A;  3Q8F A;  1N6Z A;  5D7G A;  3WAL A;  4C4V B;  5AUI A;  5TR5 A;  3UIP B;  4MT5 A;  2YEP F;  4TMA B;  3PVL A;  1A5R A;  5IKC M;  5FKA C;  2PJH A;  1QT9 A;  3KQ4 A;  4IWO A;  4E71 A;  3K9O B;  1FRR A;  3VR8 B;  4WAA A;  3ZKJ C;  1D5X C;  3P42 A;  1NI2 A;  2MJ3 A;  1ZXI A;  2KNB A;  4GOC A;  3VFK A;  2ASQ A;  4JLC A;  1XO3 A;  5J2R A;  4M01 A;  1J7A A;  3VUX A;  1Y56 A;  5D2M B;  3KUD B;  3RZF A;  4P1B C;  2JU6 X;  4MJS B;  2TSS A;  2WXF A;  4LJP B;  1OEY A;  1ZPS A;  3OG5 A;  3KYD D;  4B9K A;  2JVC A;  2OOB B;  1F2R C;  4GN1 A;  2AEH A;  5C1Z A;  1VCB A;  3QIJ A;  2PIA A;  2WX0 A;  2GBK A;  3D32 A;  2JRI B;  1SEB D;  2H89 B;  3JSV A;  1KRH A;  3A9K A;  1SJH D;  3URY A;  5GMV A;  4RNA A;  1J19 A;  5BMI A;  1MI0 A;  2CU1 A;  1VRA B;  2R2O A;  3APF A;  2Q5W D;  1RYJ A;  5CHF A;  2SEB D;  4IDI A;  1V8C A;  2BYT A;  3U2S C;  3DVG Y;  2EKI A;  1SB3 C;  1IYF A;  2FAZ A;  3W1Y A;  3NVZ A;  3ZGZ A;  2LGY A;  3L10 B;  1C4A A;  3CWI A;  1E8X A;  3GS2 A;  3Q8A A;  1BML C;  4DDI D;  1GB1 A;  3PRZ A;  3BYY B;  1K50 A;  3DBH B;  4E3C A;  1HTO A;  2BTE A;  2JSV X;  4REZ A;  3TIX A;  2KN5 A;  2EMT A;  3LYY A;  2ZW1 A;  3OJ3 A;  4KSK C;  3V62 A;  4C56 C;  2WHI A;  3VDZ A;  3B1L X;  3TMP B;  3RFZ B;  2N9L A;  1LFD A;  4NQK E;  2CHW A;  2JYE A;  2DZM A;  3PPA A;  2M56 B;  2UYZ B;  4BOS C;  4WWO A;  4JWS C;  4TV3 A;  3PS6 A;  4NAM A;  3ZNH B;  2KTF A;  2BW2 A;  1V81 A;  2XBB C;  1N5X A;  3AEE B;  3DOW A;  3VRB B;  3EFU A;  2KKC A;  1I4X A;  2BQQ A;  4LNK A;  3I3T B;  3AE7 B;  2LVQ A;  3KLS X;  4W9L A;  5E6N A;  3SU8 X;  2W55 A;  3CSF A;  3PLU A;  3PSE B;  1V1P B;  2AQ1 B;  2O6V B;  1WGG A;  4K7S A;  4ARC A;  3V6C B;  1WIA A;  4BKS A;  2N9E B;  4S0R A;  2OED A;  1IGD A;  2O2V B;  4YTM B;  2NCN A;  1Z5S B;  1EM7 A;  2QMT A;  2XN9 C;  3FKY A;  4BZA A;  3ZW3 A;  1N61 A;  1TKG A;  4J6I A;  2WDV B;  2IY1 B;  1M94 A;  1JQ4 A;  2OHF A;  1JWU D;  1S3S G;  4C4V A;  2GI9 A;  2W3R A;  2KC1 A;  1TIF A;  1C1Y B;  1FFV A;  5EE9 A;  3HUI A;  3EC8 A;  1L4D B;  1P9D U;  2IPK D;  3FAH A;  3H9D A;  1WX9 A;  3H6N A;  4PYU A;  1I4R A;  3IFW B;  4BBN F;  2Y5P A;  1R4N B;  2N9P C;  2GRI A;  4ANV A;  1V5O A;  2RDG A;  2GOW A;  1C76 A;  5JH5 C;  1DOI A;  2M8S A;  4R3D A;  3DHI C;  4MJS A;  2I1J A;  1JWB D;  5E6P A;  3A4R A;  3UIN B;  4LTU A;  1YX5 B;  1WX8 A;  2L0T A;  1GNU A;  3AED B;  4ANX A;  4ZHP A;  3H7P A;  1BXT A;  4NQL B;  3R7Q A;  2K6Q A;  2N1W A;  2WXK A;  1P7F A;  1WI0 A;  4GDL B;  4HCP B;  4A20 A;  5BO4 B;  2WX1 A;  2DYO A;  3RNB C;  2QEJ C;  1LO5 D;  3RZW C;  4FBJ B;  1PUT A;  2FCM A;  2RDH A;  1B1Z A;  4OZC A;  2C7N B;  1YN3 A;  2CU3 A;  4US9 A;  3PHX B;  3UGB B;  2NMQ A;  2C7M B;  3QA8 A;  3UIO B;  2V0G A;  1D6E C;  1IUE A;  2N9K A;  3EGR A;  3N20 C;  4OW0 A;  1G6J A;  3W5V B;  5G5G A;  4FAD A;  4AQ7 A;  1WGH A;  1FCC C;  1MJD A;  2JRH A;  2K8B A;  3MC8 A;  1E10 A;  2WS3 B;  4GSW A;  2DZI A;  3H8H A;  3PGE A;  1EU3 A;  2M19 A;  1NI3 A;  1L0X B;  2C60 A;  2LWP A;  2JUO A;  1VDV A;  2D3C A;  3U30 A;  2NTS A;  2VH2 A;  4I6N B;  4ZRI A;  2QCZ A;  2L3Z A;  3IBE A;  2GBM A;  3Q8B A;  1XD3 B;  4DXF A;  3N1Y C;  3U4E G;  1MPE A;  3U8Z A;  3OWE B;  1F9J A;  2HTM E;  4HK2 A;  1YN4 A;  2O6V D;  2CJO A;  3DVN V;  1PGA A;  2LJI A;  1OQY A;  3BK1 A;  1V1P A;  2QDF A;  2O6V A;  2DYB A;  2MW5 A;  2LGD A;  2LGI A;  2O2V A;  1WGY A;  1BT0 A;  3M3J A;  4RF1 A;  4MH8 A;  3BZD B;  1HZ5 A;  1E8Y A;  2L00 B;  4OVZ A;  2QIE B;  4M0W B;  3VH3 B;  4YTN B;  4LNF A;  4MM3 B;  2HD5 B;  4KSL C;  3JW0 X;  4JWU C;  1WMH B;  2WXQ A;  1VZ7 A;  1WXS A;  4XDD A;  1P98 A;  3DBH I;  1NVI D;  2INC C;  1JWA D;  3ZLZ A;  3OAW A;  5CHV C;  2J42 A;  1SJE D;  2KJH B;  4BBN C;  2NBU A;  3L13 A;  2D5G A;  3HVZ A;  3DWG C;  1JRU A;  2L0F A;  4A3O A;  4B0E A;  2G1E A;  2PKO A;  1FO4 A;  3ZNG C;  1L2N A;  3NS1 A;  2PVO D;  3C0R B;  3GE3 C;  2IY0 B;  3QQ8 B;  3NY5 A;  1R7S A;  5JXV A;  4MSQ B;  1N63 A;  3Q3J A;  2KDB A;  1T0S C;  1UGM A;  3PO0 A;  2IBI B;  4OZB A;  1OGW A;  4ZOH C;  4FN2 A;  2DEN B;  4HPM B;  4MEM A;  3SHQ A;  3ZJU A;  4PK1 A;  2WP9 B;  2J4X A;  1DOY A;  3LDZ E;  5C23 A;  3LB8 C;  5IA7 A;  3N1Z C;  2V9H A;  3APC A;  1J7B A;  1MG4 A;  3A1Q B;  2JQR B;  2IGD A;  1SGH A;  2JZP A;  1WM2 A;  3ENE A;  2IJ0 A;  1N60 A;  5G2N A;  4D2K A;  4FXC A;  1NEN B;  2NBW B;  2G4D B;  4EKU A;  2MRP A;  2L05 A;  5BYS A;  5IN7 A;  3VHT C;  1YJ1 A;  1ENF A;  2WWZ A;  3CST A;  2PW9 A;  1K51 A;  3HIZ A;  4MGI E;  1R4N I;  3ZXV A;  4HKQ A;  2WLB A;  4M8M A;  4ZHO A;  1QOG A;  1LM8 B;  5DPR A;  1GC7 A;  4MH0 E;  2FCN A;  1D3Z A;  1XLP A;  2C5L C;  4DHZ E;  2D10 A;  1LXD A;  1TY0 A;  5IAA C;  5BYQ A;  2ZNV C;  1VZ6 A;  5H8Y E;  2GLS A;  4ZRK A;  2INN E;  5D6J B;  4OZA A;  2HJ8 A;  1V1O A;  3GB1 A;  4TQ1 A;  2VH1 A;  5DCN A;  4US8 A;  3VTV A;  3DPD A;  4JL9 A;  4CQN A;  1GUA B;  3NZ3 A;  2LGS A;  1FFU A;  2KAC A;  1HTQ A;  3QJZ A;  2LUM A;  3ZDM C;  4G0N B;  2N4F A;  3E56 A;  2MSE D;  4HKZ E;  2J0J A;  3V6E B;  2JZ3 B;  4FHJ A;  2MBO A;  3C19 A;  1JAL A;  2RR9 A;  1YIW A;  4G11 A;  1OQQ A;  2IGG A;  2UU7 A;  1WYW B;  4GXB A;  4M0W A;  3FC4 A;  2NTT A;  2BKR B;  1WE6 A;  4YSX B;  4MM3 A;  4RCO A;  4EEW A;  1FXI A;  3AI5 A;  2IO0 B;  3DBR B;  1WMH A;  2PLP A;  1TT5 B;  4PS8 A;  3NVY A;  3DCG A;  1SXT A;  1I4G A;  2LXC A;  4IW0 A;  4LDT D;  4IM3 A;  3MJ5 A;  1WR6 E;  1QKZ A;  5TSS A;  1C78 A;  1TY2 A;  3DBL B;  2FNJ B;  2W9N A;  1FIQ A;  1N62 A;  2L32 A;  1L7Y A;  2KT7 A;  3RUI B;  4A8X C;  3Q69 A;  3DVG X;  4TQ0 A;  3QAR A;  4K7W A;  4A6Q A;  4JX1 C;  1XXG A;  2M0X A;  2ZZP B;  3R2T A;  1ZDV A;  4BVU C;  2FUH B;  3NZU A;  4JIO U;  5LXI B;  1P1A A;  3VUW A;  4ICV A;  2MHJ A;  4KV2 A;  1KLU D;  1AYF A;  1IGC A;  2KYW A;  2KQS A;  1IP9 A;  2G45 B;  2R2Q A;  1PQS A;  2DAJ A;  2IZV B;  3N3K B;  3K9P B;  2PVG C;  3VVW B;  3Q14 C;  1SIF A;  1QOB A;  4WJO A;  1EF5 A;  3P2B A;  4KVG B;  4ICU A;  1P7E A;  2W54 A;  4ZDV A;  1E8W A;  3RNA C;  3WAN A;  3R66 C;  1GB4 A;  3KUC B;  2HJ1 A;  1UGJ A;  4WJN A;  3BVZ A;  3V61 A;  2BPS A;  1WRI A;  2WXP A;  3H7P B;  2MCN B;  1YQ3 B;  4EZK A;  1OFF A;  2MX2 A;  3A1Q A;  3AE6 B;  4HLE A;  1H4R A;  3I57 A;  1OQR A;  2WGS A;  4K7U A;  4KIK B;  4FHK A;  1HA5 A;  3GOE A;  1AAR A;  1GJZ A;  2LHD A;  2KTR A;  4I6P A;  1XCT L;  4AWJ A;  4C00 A;  1I7H A;  1I4H A;  5CX3 A;  2KDM A;  3GZN B;  3KWV A;  1BUI C;  1AWD A;  1K52 A;  1OTR B;  3PT2 B;  4WWM A;  1UH6 A;  1WZ3 A;  2Z8L A;  1P3Q U;  3ZNI D;  5I4D A;  3SEB A;  2K1F A;  1STE A;  4YSZ B;  2DHZ A;  2DZK A;  1CJE A;  1FNW A;  4RH6 A;  3L16 A;  4HVB A;  2LAS A;  1KM7 A;  1WXA A;  4WWP A;  1UF0 A;  1WM3 A;  1E7V A;  2YEP B;  3J9C A;  2L52 A;  2KMA A;  4YL8 A;  3JYU A;  2RGF A;  4DBG A;  4HDQ A;  1DYQ A;  1KFY B;  3RNE C;  2NPT B;  1L5P A;  4DQO C;  1N5W A;  5EE0 A;  3W5U B;  3SFE B;  3ZO5 B;  2MBB B;  3V60 A;  4CHK A;  4C7Z A;  2K39 A;  4G3X B;  3ZDT A;  3VUY A;  5JZE B;  3I5J C;  4YWG G;  3HM3 A;  2K6D B;  3WA0 A;  1TGZ B;  4GDK B;  3ECI A;  1WF9 A;  3RUL A;  4C80 A;  3B2G A;  1J0G A;  3TEX A;  3OJ4 B;  2B76 B;  4C7Y A;  4EE2 A;  3ZRF A;  1TKE A;  4X57 B;  1J7C A;  4XWW A;  2K8H A;  4YT0 B;  4HPP A;  1UWX A;  4LK0 M;  1RFK A;  2WU2 B;  5J18 A;  1I4Q A;  3ZNZ B;  1RLF A;  5IO9 A;  2BWE S;  2XK5 B;  2RPQ A;  5GXG B;  1FNV A;  1QIL A;  3NVW A;  1FRD A;  2JXT A;  4DXA B;  2GB1 A;  1EWY C;  4IOI E;  2ZW0 A;  2LD9 A;  3P63 A;  1UNS A;  2HTH A;  4RF0 A;  3HVD A;  1ACC A;  2G4S A;  2JT4 B;  5J17 A;  3TL5 A;  3Q3O C;  4NJC A;  4PS3 A;  3L0W B;  3W1S C;  1ESF A;  3WAO A;  1YNT E;  3T3N A;  5KHQ A;  1NYQ A;  1SE2 A;  2C9W B;  5HG2 A;  1HQR D;  3O13 A;  4F8C B;  4IWQ A;  5KHO A;  1WXQ A;  3RCZ A;  1TS4 A;  3T9L A;  5C2T B;  1WGD A;  4LNI A;  2NR2 A;  2KDF B;  2VRR B;  1FCL A;  2M17 A;  2BT6 A;  2ZEQ A;  4XWT A;  2BGF A;  2BF8 B;  4RGN A;  4KX6 B;  4KIK A;  3BYT B;  3PRE A;  3PV1 A;  2BYF A;  2E3T A;  2WDT B;  3AE2 B;  1CK1 A;  1C3T A;  2I38 A;  3I63 C;  2PE6 B;  5FR3 A;  5EE1 A;  2W82 A;  3RD2 A;  4ARI A;  5AUK A;  1AW7 A;  1K8R B;  3AEG B;  2KMM A;  4NJ6 A;  3NHE B;  4HXD A;  1ZE3 D;  4XGA B;  3NZS A;  1VR9 A;  2BS3 B;  1ZXH A;  1TKY A;  2LEK A;  2BKF A;  3N30 A;  3UI3 A;  4BAX A;  1FMA D;  2KX3 A;  1F1H A;  2I1K A;  4XC2 A;  4DHJ B;  2V1Y A;  5IP4 D;  2KDE B;  3ZUN A;  2NVU I;  4GGQ A;  4LLG M;  2J52 A;  3Q8C A;  1QOA A;  4KDI C;  3DWM A;  4K3B A;  1EF1 A;  2IGH A;  1YQB A;  2N7J A;  1NBF C;  1E8Z A;  2K8C A;  4N9F 4;  2HDE A;  4HWI B;  2JXX A;  5C3J B;  5JHA A;  3KWL A;  2KJR A;  2D2Q A;  5H92 C;  2NPT A;  2KLC A;  3VTU A;  1TTN A;  4TUU A;  4BKG A;  1FXT B;  3RNC C;  1XLQ A;  2WXL A;  4MGZ E;  4WJQ A;  4GDK A;  2M4N A;  3MFG A;  2RSU A;  2FCQ A;  1XLO A;  1NEK B;  1D4B A;  4HJG E;  3NUH B;  2JX5 A;  5CTR C;  2IO3 B;  1PGB A;  1ISN A;  3UF8 A;  2WNM A;  2RPV A;  4JPS A;  2UWQ A;  3AEB B;  5AZF A;  2XK5 A;  3N32 A;  3RNF C;  1CQV A;  2ZPY A;  2RD0 A;  1SBB B;  4DXG A;  3GZN I;  2FCS A;  1JWS D;  3EFC A;  2JY6 A;  2ACZ B;  2DNF A;  1T0R C;  3QX1 A;  3QK0 A;  2WXJ A;  3DBS A;  4LDT B;  3ZIM A;  1QQR A;  3M95 A;  1PDX A;  2V3S A;  1JRO A;  1WJU A;  3QC8 B;  4OHJ A;  3CF6 E;  3DQV A;  1IPG A;  4PYZ A;  5HKH A;  3Q8E A;  5FR6 A;  2KAJ A;  2KLG A;  1WXV A;  2FID A;  1ET9 A;  2AL6 A;  4TKN A;  1ZOY B;  1TZO A;  2CJN A;  3GE8 C;  4HPL B;  2Y5C A;  2LI5 A;  3MHS D;  2G3Q B;  1NYR A;  1VZ8 A;  2V3N A;  4KGR A;  5DPW A;  2AYO B;  5E6J A;  1KJT A;  4KKI A;  3TUO A;  2YVC A;  4XDC A;  1UZX B;  1YN5 A;  1C4C A;  3TJP A;  3HRD D;  4P16 A;  3P4Q B;  3L54 A;  1M4V A;  1Q5W B;  1V80 A;  5BMG A;  1VLB A;  1GG3 A;  2PTL A;  2ZNV B;  3IAS 1;  4MGY E;  1SF0 A;  2ZCB A;  3AE3 B;  4O1N A;  1GOZ A;  1WFY A;  2K5P A;  3AB5 A;  1L6U A;  2MQJ A;  1MHX A;  1V97 A;  1C79 A;  3NG0 A;  2KMC A;  1WJN A;  1ZP0 B;  4DHJ D;  2YLM A;  3SFD B;  1WGR A;  3QHT A;  4AJW A;  1Q1O A;  4RM9 A;  4B6W A;  4ZRP A;  1PYW D;  3IT4 B;  3R3M A;  3N1X C;  1TS2 A;  2RMM A;  2BWF A;  2Y3A A;  4MGK E;  1DOX A;  2KTR B;  2IO2 B;  3Q3M C;  4H2A A;  4ZRQ A;  3ML8 A;  4HRO A;  1QOF A;  2NS5 A;  2ICI A;  3AE5 B;  2M1M A;  5L83 A;  4WUR A;  1ZKH A;  5D94 A;  2SAK A;  2CHX A;  1EWC A;  2L8J A;  1KF6 B;  2A4Z A;  2LGX A;  4MEL A;  1L0V B;  2KWD A;  3HHM A;  1GAQ B;  3A4S C;  4HEA 1;  1YQ4 B;  4USA A;  3ZTC A;  1MG8 A;  3LJ3 A;  2IDY A;  1XCQ L;  2DYM A;  3RNG C;  3MJW A;  3B08 A;  3TEZ A;  3AM9 A;  1WR1 A;  3IT6 B;  3I9V 1;  3EHV A;  4ASW C;  1YJJ A;  3VRA B;  2C7H A;  2M0A A;  2PPH A;  3R8B A;  3KW5 B;  4W9I A;  5D3I B;  3UQB A;  4PS7 A;  2DZJ A;  2IND C;  1E7U A;  1R4M B;  1WRD B;  2MH7 A;  2KO3 A;  3MTN B;  4HCN B;  4MSM B;  3X0W A;  1ET6 A;  2ZCC A;  3ZXR A;  4IKG A;  3IHP C;  3U7Z A;  3TSS A;  1X1M A;  4P7I A;  4JGH B;  2E6X A;  5E6O A;  2FE8 A;  2J7Q B;  2MJD A;  3ZJT A;  2J53 A;  3OLM D;  2OJW A;  4ZRJ A;  1HXY D;  1XT9 B;  1FEH A;  1FNU A;  3RPF C;  1KTK A;  4KKJ A;  2WXN A;  4BKT A;  4LNO A;  3DVN U;  4YXD B;  2ONQ A;  3MP9 A;  1TS3 A;  2REX A;  1WZ0 A;  2QHO A;  1YD8 U;  2CS4 A;  2KFK B;  1XEE A;  1EO6 A;  2KQ7 A;  3APD A;  1Y8R C;  2D3B A;  1TJE A;  1T0Q C;  3V05 A;  1GC6 A;  4IM2 A;  1SIJ A;  2J0M A;  2FBW B;  2WXG A;  3ZVV A;  1SE3 A;  3GP7 A;  1WYG A;  2AX5 A;  4IUM B;  2WXO A;  3PZ7 A;  2JZZ A;  3AU4 A;  3U7D A;  3W2D A;  1RM6 C;  2DAF A;  3ZQ4 A;  3VR9 B;  2JYT A;  3AE9 B;  1GPX A;  4FJV B;  2K3U A;  2LZ6 A;  4HJK A;  3EEC A;  4GLS C;  3ONS A;  3ZJV A;  2LJ5 A;  4EZJ A;  2XNA C;  4JE3 B;  5LLI A;  1TZ1 A;  3RYT A;  3BIN A;  4IM0 A;  1ZW7 A;  4IG7 B;  1E6E B;  3TCA A;  4ZYS A;  1E5W A;  4K1R B;  1SE9 A;  1J8C A;  3Q2A C;  3BVG A;  1WXM A;  4A9A A;  1FPY A;  1I35 A;  2KVR A;  1EUV B;  3MHZ A;  4W9E A;  5CHW A;  2XEW A;  4NY0 A;  3T3O A;  2GBR A;  2WDR B;  2LRW A;  3PRM B;  1F0Z A;  5AZH A;  1U4A A;  4I6L B;  5DPT A;  2EKE C;  2Z0E B;  5FK9 C;  3MC9 A;  3O65 B;  3NS8 A;  1T5X D;  4YSY B;  4M02 A;  3PZ8 A;  3PLV A;  4E74 A;  1V2Y A;  3HK0 A;  2BS2 B;  1RFA A;  4N59 A;  2MA9 B;  4FA6 A;  4P6V F;  2L76 A;  2WDQ B;  3AE1 B;  4OVU A;  2L7R A;  2MBE A;  2KWC A;  1E0Z A;  2Z0D B;  3ZRC A;  3EUB 2;  2QSD A;  1FD6 A;  3VQI A;  1L0Y B;  1XLN A;  2VZK B;  2GBN A;  3WAM A;  1CZP A;  4N58 A;  1WWT A;  4JQW C;  4BOZ B;  3R7R A;  2W3S A;  4L2Y A;  3A9J B;  1V6E A;  2KWV B;  1YJI A;  2MJE A;  1SSN A;  1F52 A;  3Q3F A;  3U52 E;  2KHW B;  4K81 A;  4NNJ B;  1I4P A;  3AEC B;  3LXF A;  3CMM B;  1QZE A;  1PGX A;  4NAW B;  2KJ6 A;  3ABV B;  2L83 A;  1TS5 A;  4BKS D;  4XE0 A;  4A55 A;  1H8C A;  2KFJ A;  2N7E A;  1F77 A;  2J0K A;  3DDC B;  4W9F A;  3AMZ A;  4IC7 B;  3CIR B;  3X23 A;  3PHW B;  4II2 B;  2CHZ A;  3NRZ A;  2PMV A;  2X8X X;  2KFK A;  3M63 B;  2GBJ A;  4XX5 A;  4M8N A; 
#chains in the Genus database with same CATH homology
 5BYS A;  2QJL A;  1XLQ A;  2JU6 X;  2TSS A;  2WXF A;  2WXL A;  1ZPS A;  2BBC A;  5BYR A;  2WU5 B;  3MFG A;  1ENF A;  2PW9 A;  1K51 A;  1XLO A;  1NEK B;  4HKQ A;  2WLB A;  1D4B A;  1F2R C;  4ZHO A;  1QOG A;  4HJG E;  3NUH B;  2JX5 A;  2PIA A;  1KH0 A;  4J3O D;  1C4P A;  1PGB A;  1XLP A;  1YMH E;  1JML A;  1SEB D;  2H89 B;  4TSS A;  1HZ6 A;  1KRH A;  1TY0 A;  1SJH D;  2FUG 1;  2RPV A;  2WNM A;  4JPS A;  4RNA A;  5BYQ A;  3URY A;  1VZ6 A;  3AEB B;  5BMI A;  1MI0 A;  5H8Y E;  1VRA B;  2V4I B;  2INN E;  4L1B A;  4RGM A;  1CQV A;  1RYJ A;  2Q5W D;  2LFI A;  2SEB D;  4IDI A;  4OZA A;  1V8C A;  2BYT A;  1V1O A;  1SBB B;  3U2S C;  4DXG A;  3GB1 A;  4TQ1 A;  4US8 A;  2EKI A;  1SB3 C;  3NVZ A;  3ZGZ A;  4CQN A;  1C4A A;  5T8I A;  1E9M A;  1JWS D;  3NZ3 A;  1K53 A;  3CWI A;  1VJK A;  2ACZ B;  1FFU A;  3GS2 A;  2KAC A;  3Q8A A;  1BML C;  2LUM A;  1C9F A;  1GB1 A;  3E56 A;  2N0S B;  2WXJ A;  3AE8 B;  4HKZ E;  1QQR A;  2WXI A;  1PDX A;  3BYY B;  1K50 A;  2MEK A;  1JAL A;  1JRO A;  2BTE A;  2JSV X;  1OQQ A;  4REZ A;  1QF6 A;  2IGG A;  4OHJ A;  3LYY A;  4M0W A;  3B9J A;  2ZW1 A;  2BB6 A;  2V3P A;  1D5M C;  4C56 C;  3FC4 A;  3Q8E A;  2NTT A;  3AH7 A;  2KAJ A;  4YSX B;  1F2R I;  4RCO A;  1FXI A;  1ET9 A;  1IBX B;  1ZOY B;  1TZO A;  2PLP A;  2CJN A;  1TYG B;  3RFZ B;  2N9L A;  2Y5C A;  2JYE A;  3IAM 1;  1DGJ A;  2KN4 A;  1ZUD 2;  2DBY A;  3NVY A;  2M56 B;  1NYR A;  1SXT A;  1I4G A;  4JWS C;  1VZ8 A;  2V3N A;  4KGR A;  3MJ5 A;  5E6J A;  1QKZ A;  3BWU D;  4KKI A;  4NAM A;  3WCQ A;  3TUO A;  3BII D;  2JWU A;  4WQM A;  5TSS A;  1C78 A;  1TY2 A;  2BW2 A;  4XDC A;  1YN5 A;  5EE3 A;  1FIQ A;  1N62 A;  1C4C A;  2L32 A;  1N5X A;  4WIP A;  3AEE B;  3HRD D;  3VRB B;  4P16 A;  3P4Q B;  1I4X A;  2AQ3 B;  2H88 B;  2VZK D;  3Q69 A;  4A8X C;  3AE7 B;  4TQ0 A;  3KLS X;  1M4V A;  4A6Q A;  1WSP A;  2WQY B;  4JX1 C;  1VLB A;  3BVM A;  1XXG A;  3R2T A;  5BMG A;  4A90 A;  2W55 A;  1UWM A;  1ZDV A;  2KQ4 X;  2PTL A;  3IAS 1;  1SF0 A;  3B2F A;  3AV8 A;  3AE3 B;  4O1N A;  1GOZ A;  4PT5 A;  2WXR A;  1V1P B;  2K5P A;  2AQ1 B;  3AB5 A;  1L6U A;  4ARC A;  1KLU D;  1MHX A;  1V97 A;  1C79 A;  1AYF A;  1IGC A;  2OED A;  1IGD A;  1ZP0 B;  3ETR A;  3P1M A;  5D3D A;  3SFD B;  4YTM B;  3IXS A;  1EM7 A;  2QMT A;  2XN9 C;  1C77 A;  4ZRP A;  5HFY A;  2PVG C;  1PYW D;  3BK2 A;  3IT4 B;  4ITK A;  1N61 A;  3W1S A;  1TKG A;  1QOB A;  2LMC A;  1TS2 A;  2RMM A;  2WDV B;  1P7E A;  2Y3A A;  2W54 A;  1JQ4 A;  4RGT A;  1DOX A;  2OHF A;  2QIL A;  1JWU D;  1ROE A;  1T6B X;  2GI9 A;  2W3R A;  1XF5 L;  1KLG D;  4H2A A;  4ZRQ A;  4HRO A;  1GB4 A;  1QOF A;  4RFB A;  1FFV A;  5EE9 A;  1UGJ A;  3BVZ A;  3HUI A;  2ICI A;  3AE5 B;  1WRI A;  2WXP A;  2BS4 B;  2INP E;  1L4D B;  4WUR A;  2I2Y A;  1RWS A;  2IPK D;  1D5Z C;  5HHD G;  2SAK A;  1YQ3 B;  4UDU C;  3R2I A;  1OFF A;  1EWC A;  3FAH A;  1T3Q A;  1KF6 B;  4WAF A;  1L0V B;  1I4R A;  2KWD A;  3AE6 B;  1GAQ B;  3I57 A;  1OQR A;  2Y5P A;  5BMH A;  2L1A A;  4HEA 1;  1YQ4 B;  1JCK B;  2GRI A;  3AEA B;  4USA A;  1FM0 D;  2RDG A;  1C76 A;  1HA5 A;  1B9R A;  1DOI A;  1NEN B;  2IDY A;  4R3D A;  1XCQ L;  2DYM A;  1JWB D;  2LHD A;  5LNK 1;  4LTU A;  3TEZ A;  3AM9 A;  1XCT L;  3IT6 B;  1QLB B;  3I9V 1;  3ZYY X;  3AED B;  1YJJ A;  3VRA B;  2M0A A;  3TEW A;  1I7H A;  1I4H A;  3R8B A;  2KDM A;  3L4P A;  4ZHP A;  3FIL B;  1BXT A;  5D3I B;  3KWV A;  4B0M A;  1BUI C;  1AWD A;  1K52 A;  1JW9 D;  2WXK A;  3NVV A;  4WWM A;  1P7F A;  2MH7 A;  4HRS A;  4GDL B;  3EA6 A;  1ET6 A;  2Z8L A;  1FXA A;  4IKG A;  5I4D A;  2K22 A;  3SEB A;  3U7Z A;  3TSS A;  2DYO A;  4N6E B;  1STE A;  2QEJ C;  1LO5 D;  2E6X A;  1MHH E;  1PUT A;  2FE8 A;  2MJD A;  4YSZ B;  3ZJT A;  2RDH A;  1B1Z A;  4OZC A;  1YN3 A;  4WH4 A;  2J53 A;  2CU3 A;  4US9 A;  1CJE A;  1FNW A;  2NMQ A;  4RH6 A;  1HXY D;  2V0G A;  1FEH A;  1D6E C;  1IUE A;  2EEL A;  1FNU A;  2N9K A;  3RPF C;  3EGR A;  2YEP B;  1KTK A;  3J9C A;  4KKJ A;  4OW0 A;  2WXH A;  2WXN A;  3W5V B;  2L52 A;  3C8Y A;  5G5G A;  1SE4 A;  1EU4 A;  4AQ7 A;  4MAC A;  1DYQ A;  1FCC C;  4YXD B;  1KFY B;  1L5P A;  2ONQ A;  4DQO C;  3MP9 A;  1TS3 A;  1N5W A;  5EE0 A;  3W5U B;  1E10 A;  1XEE A;  1PFD A;  2WS3 B;  3H8H A;  3SFE B;  4C7Z A;  2X38 A;  1EU3 A;  2AQ2 B;  1E7P B;  2M19 A;  1NI3 A;  1L0X B;  1ZDX A;  3N9Y C;  1VDV A;  4YWG G;  1IBX A;  2NTS A;  1TJE A;  3V05 A;  4GDK B;  1SIJ A;  2FBW B;  4C80 A;  3B2G A;  2WXG A;  2ON8 A;  1L4Z B;  5G5H A;  1JRP A;  1SE3 A;  3TEX A;  3GP7 A;  4Q2J A;  2B76 B;  1WYG A;  4C7Y A;  2AX5 A;  4EE2 A;  1TKE A;  2WXO A;  1L6V A;  3PZ7 A;  3Q8B A;  1J7C A;  3W2D A;  4XWW A;  4DXF A;  1RM6 C;  4YT0 B;  3VR9 B;  3ZQ4 A;  1UWX A;  4LK0 M;  3U4E G;  1MPE A;  1RFK A;  2WU2 B;  3OWE B;  1I4Q A;  2JYT A;  3AE9 B;  1GPX A;  2HTM E;  1YN4 A;  1MVK A;  2K3U A;  2CJO A;  4GLS C;  3V3X A;  1PGA A;  3ZJV A;  5GXG B;  4AS1 A;  4NZL B;  1FNV A;  2XNA C;  1QIL A;  1HEZ E;  1FRD A;  3NVW A;  2JXT A;  2LJI A;  2GB1 A;  4JE3 B;  3W9C B;  1EWY C;  4IOI E;  2ZW0 A;  3BK1 A;  1V1P A;  3P63 A;  1E6E B;  1UNS A;  4ZYS A;  3E9S A;  4RF0 A;  2LGI A;  3HVD A;  1ACC A;  3BVG A;  3P4S B;  5HI1 A;  4NJC A;  3AN1 A;  1ESF A;  3SR6 A;  4A9A A;  4RF1 A;  3MHZ A;  1AN8 A;  1YNT E;  4MH8 A;  3BZD B;  1HZ5 A;  3T3O A;  2K0P A;  3T3N A;  2WDR B;  3MC0 B;  2R61 A;  1NYQ A;  1SE2 A;  4OVZ A;  5HG2 A;  2QIE B;  1HQR D;  3O13 A;  2K9X A;  4YTN B;  1F0Z A;  1WXQ A;  3P4R B;  1TS4 A;  5C2T B;  4MM3 B;  2LHE A;  2WXQ A;  4JWU C;  5FK9 C;  1VZ7 A;  1T5X D;  4KGS A;  3AEF B;  4XDD A;  4YSY B;  2DLB A;  1FCL A;  2BB5 A;  3PZ8 A;  4L23 A;  1NVI D;  1JWM D;  1JWA D;  1A70 A;  2BT6 A;  2BS2 B;  4XWT A;  4N59 A;  3TEY A;  2J42 A;  1SJE D;  4RGN A;  1WGK A;  1UUP A;  4KX6 B;  4P6V F;  2D5G A;  4YTP B;  3BYT B;  2WDQ B;  3AE1 B;  3HVZ A;  3DWG C;  2E3T A;  4KGT A;  3AE2 B;  1CK1 A;  2WXM A;  1E0Z A;  2I38 A;  5FR3 A;  5EE1 A;  3EUB 2;  2QSD A;  1Q10 A;  4B0E A;  2W82 A;  1FD6 A;  2G1E A;  3VQI A;  2PKO A;  4ARI A;  1L0Y B;  1XLN A;  1FO4 A;  2VZK B;  3NS1 A;  1CZP A;  4N58 A;  1WWT A;  5AUK A;  1AW7 A;  2PVO D;  2W3S A;  4L2Y A;  3AEG B;  2KMM A;  4RGO S;  2DWQ A;  3AE4 B;  1R7S A;  3FIL A;  1YJI A;  2MJE A;  1SSN A;  5JXV A;  1ZE3 D;  3U52 E;  1N63 A;  1VR9 A;  2BS3 B;  1ZXH A;  2G9H D;  1TKY A;  2LEK A;  3UI3 A;  1I4P A;  3AEC B;  3PO0 A;  1FMA D;  3LXF A;  4OZB A;  5MPO A;  4ZOH C;  3P4P B;  3Q8F A;  1PGX A;  3ZJU A;  5D7G A;  4NAW B;  2WP9 B;  5AUI A;  3ABV B;  4LLG M;  2J4X A;  2YEP F;  2L83 A;  4MT5 A;  1TS5 A;  4TMA B;  1DOY A;  4XE0 A;  2J52 A;  3Q8C A;  4A55 A;  1QOA A;  5FKA C;  1QT9 A;  3KQ4 A;  3DWM A;  3LB8 C;  1F77 A;  1FRR A;  2IGH A;  2N7J A;  3VR8 B;  2HDE A;  1J7B A;  1D5X C;  3AMZ A;  3CIR B;  2JQR B;  2IGD A;  3P42 A;  2MJ3 A;  1ZXI A;  2JZP A;  5C3J B;  3KWL A;  5H92 C;  2IJ0 A;  1N60 A;  3NRZ A;  2PMV A;  1XO3 A;  4D2K A;  4FXC A;  1J7A A;  1Y56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...