1PGAA

Two crystal structures of the b1 immunoglobulin-binding domain of streptococcal protein g and comparison with nmr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title Two crystal structures of the B1 immunoglobulin-binding domain of streptococcal protein G and comparison with NMR.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
molecule tags Immunoglobulin binding protein
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1993-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgaA00
2QSDA 4IOIE 4WH4A 1YNTE 4OZAA 2QMTA 5BMHA 1ZXHA 1MI0A 2JU6X 4KGRA 1HEZE 1GB4A 2ZW0A 3GB1A 1YMHE 1MPEA 2PLPA 2LUMA 1XCTL 2JZPA 5HFYA 1PGXA 2J52A 1PGBA 4HKZE 1GB1A 1C9FA 1HZ6A 1KH0A 2J53A 1K51A 2IGGA 1IBXB 1HZ5A 4GLSC 1FCCC 2ZW1A 2N7JA 4OZBA 4KGTA 1JMLA 2I2YA 1F2RI 5JXVA 1IGCA 5HHDG 1K53A 2PW9A 2PTLA 4MACA 1K50A 2GB1A 2LGIA 4IKGA 1EM7A 5BMGA 1FD6A 1UWXA 3MP9A 2LHDA 4HJGE 2N9LA 1IBXA 1K52A 4D2KA 2I38A 2ONQA 2OEDA 1P7EA 1MHHE 1XCQL 4OZCA 2LHEA 3FILB 1D4BA 5HI1A 2ON8A 1Q10A 2NMQA 2GI9A 2N9KA 1IGDA 2JSVX 2IGHA 2EELA 2RPVA 5HG2A 1XF5L 1QKZA 2KWDA 2RMMA 1F2RC 5BMIA 1FCLA 4KGSA 2K0PA 2KACA 2KDMA 3FILA 2JWUA 2KN4A 2JXTA 1MVKA 2IGDA 3UI3A 1PGAA 1MHXA 3V3XA 2KQ4X 1P7FA
chains in the Genus database with same CATH superfamily
4YSYB 1XD3B 1DOIA 2QILA 1JRUA 4NPNA 1E6EB 2CHXA 3MTNB 1FM0D 3WALA 4YL8A 2BYFA 3Q3NC 4WWMA 1GC6A 1T0RC 1WY8A 1ZUD2 2NS5A 3Q3FA 4GDLB 4HRSA 1HTQA 3U8ZA 4TV3A 3BVGA 2QEJC 3NG0A 3V05A 2JX5A 4KKIA 4YSXB 2LZ6A 1GB1A 3ZJVA 3AE1B 4S0RA 3P4QB 2Y5PA 3QX1A 4HWIB 1GUAB 1J8CA 3VQIA 1E0ZA 2XEWA 2KYWA 3ECIA 2GRIA 3B2GA 3QCAA 2EKIA 2KC2A 1IPGA 2N4FA 3BK2A 3VTVA 1GJZA 2GB1A 2LHDA 3KWVA 2MBHA 5GXGB 5G55A 5CHVC 2XBBC 1D3ZA 1F77A 1LO5D 2K39A 2OEDA 3OLMD 1UNSA 4PYZA 4AQ7A 4W9IA 3HM6X 1D4BA 1VRAB 3B2FA 3ZVVA 2FCQA 2KVZA 5AZGA 3AEAB 4P1CC 1C4AA 3DVNV 1IGDA 1WJ4A 2RDHA 4EZJA 2D2QA 3X0WA 4IWPA 2AL6A 2W54A 4II3B 2D5GA 2Z0EB 2DENB 1XLQA 1YNTE 1WJ6A 3DWMA 2VH1A 3B0AA 2LGXA 4A20A 4ANXA 3ML9A 5TSSA 1GB4A 1E7PB 4MGKE 2SAKA 4RF0A 1XLNA 2D3CA 5D2MB 2M19A 3VUYA 1HQRD 4NQLB 3I5JC 2JZPA 4W9JA 5HFYA 3GZNI 1EO6A 2J4XA 4OVZA 1WX7A 1WR6E 4URKA 1TS5A 3AI5A 1HZ6A 2IY0B 3OJ4B 4N59A 1E9MA 2LASA 2VZKD 1WX8A 2DYOA 3PHXB 2LJIA 1WX9A 1SE4A 2K8BA 3GZNB 3AEEB 1SXTA 3Q8AA 1ZOYB 4KSKC 1PDXA 3W1YA 4ANWA 5LXHA 1LM8B 4MACA 4UDUC 1ET6A 3PV1A 1EU3A 1WMHB 3SDLC 3M3JA 1V81A 3ZXVA 4DWFA 4HJGE 5EE1A 1T6BX 4MJSA 2JZZA 2LWPA 1Q0WB 2V3PA 4F1SA 2WXIA 1T0YA 4IUMB 4W9FA 2N9PC 1IUEA 1L7YA 1DOYA 3S2AA 1SJHD 4AP4C 1R7SA 2D3GA 1QKZA 1WXQA 4OHJA 3TEXA 4MSQB 5BMIA 1GAQB 4IDIA 2KC1A 2KQSA 1ZPSA 2HTHA 2L83A 3AULA 3NRZA 4W9EA 2M8SA 2M0AA 2KFKA 3ALBA 1WI0A 1OQYA 1ACCA 2MCNB 3MC8A 4XDDA 1UGMA 1I4PA 4Q2JA 5C23A 1C3TA 1TY0A 2DAFA 3EC8A 4WWPA 5FR3A 2NR2A 2LVOA 3ENEA 1TBEA 2KD0A 1VZ8A 1F9JA 4GIVA 3LYYA 5KHOA 2W3RA 2ZEQA 3O13A 4LTUA 5E6PA 1WGHA 2SEBD 2ZVOA 1PGBA 2WXNA 4E74A 3IG3A 4B0EA 1K51A 4DBGA 5BYSA 1B1ZA 4TQ0A 1SIJA 1UD7A 3IAS1 1K8RB 2G4DB 4IWQA 4WQMA 2OJWA 4LNIA 3TJPA 4KKJA 1FMAD 4FA6A 2IJ0A 2KTRA 4CQNA 2DHZA 2LI5A 4I6LB 4II2B 5IAAC 3PTFC 5G2NA 2LVPA 3R2TA 1V6EA 4HDOA 1BT0A 3A9JA 1UGJA 3CIRB 4FLHA 1WZ0A 1SJED 3EGRA 1YX6B 1E8XA 2OOBB 3FAHA 1BMLC 4RGNA 2N7DA 3IFWB 3JSVB 1NEKB 1WRIA 2L05A 2GBMA 4P1BC 2RDBC 1F1HA 2LJ5A 1MG4A 2K8CA 1JW9D 2ASQA 2OHFA 3MC9A 2C9WB 4XX5A 1E5WA 2KWVB 2MWSB 3FILA 2JWUA 4US8A 2V4LA 2V1YA 4FN2A 1MG8A 3DVGY 1I7HA 1X1MA 4FJYA 2KJ6A 3NS8A 1LGRA 5DPSA 5H92C 3SFDB 4LK0M 1XO3A 3X23A 2N7EA 3R66C 3FKYA 4GOCA 1I4XA 2ZW0A 3GB1A 3MJ5A 2Y5BB 4KVGB 3JVZX 1QQRA 1NI3A 4NZLB 4LLGM 1WGGA 2KLGA 3JW0X 2RDGA 3KYCD 3LB8C 1E8YA 3PZDA 4HXDA 3HK0A 3VRBB 1V1PB 3P1MA 4FXCA 4MGIE 2WP9B 3WANA 1Y56A 3IT4B 3RNGC 1WF9A 4W9KA 1GPXA 1SE9A 3KUZA 1JALA 4W9CA 5I4DA 4JQWC 1K50A 4FJZA 5L83A 1OEYJ 5H8YE 3M63B 1FXIA 2WXLA 4LDTD 4M0WB 2FAZA 5BMGA 1V5OA 4KZCA 2EKEC 3BYTB 1N61A 1TKGA 2K3UA 4K3CA 2UYZB 2ICIA 1L0XB 2L0FA 1XLOA 2FIDA 4MSMB 2ON8A 4KDIC 1A5RA 3D32A 3VTUA 3V6CB 1L4DB 1FNUA 3NZSA 3ABVB 2LMCA 1XF5L 2XK5A 2DZIA 2IBIB 2BPSA 2JUOA 2UU7A 3A9KB 2BKFA 5DPWA 3TEWA 1C79A 2KACA 4LJOB 4X57B 1C76A 3GP7A 2FIFA 4I6NB 4JGHB 1CMXB 1HXYD 2L0TA 1XT9B 2KDFB 3ZQ4A 4US9A 4M8NA 2QSDA 4WH4A 2I1JA 1RAXA 2IDYA 2MRPA 2BYEA 3IHPC 3WA0A 2L8JA 2QMTA 2G1EA 1DYQA 5BMHA 1MI0A 4JL9A 2V9HA 1BUIC 1HEZE 3DBHI 2G3QB 3A4RA 2PE6B 3UINB 3HHMA 1YQ3B 3N9YC 4K7UA 3PRPB 1FFUA 4OVVA 4BKGA 3QHTA 5J17A 3DBHB 3VUWA 2JVCA 4AUQC 3BWUD 3N1XC 4NNJB 1JCKB 3PO0A 2KMCA 4BBNF 3L4PA 2INPE 3APCA 1IP9A 4EUTA 2KWUB 2WXMA 2CJNA 1CK1A 1JROA 4BVUC 4CHKA 2MBQA 1RRBA 5CHFA 1SE3A 2N9XA 1NI2A 4ZRKA 2GBKA 2H89B 2LGIA 1RYJA 4ACFA 1EM7A 4LJPB 2WU5B 4WAFA 4EZLA 4ZDVA 4FBJB 3RI7C 1B9RA 3A1QA 3AEBB 3B08A 2FUHB 5EE3A 3ETRA 1TIFA 1EF1A 4QAYA 2R2OA 3QWZB 3RCZA 2B3AA 3NY5A 1XCQL 2MX2A 4KSLC 3CF6E 5AZFA 2NMQA 1OQQA 1FFVA 1TYGB 4RGMA 1FNWA 3TBLD 3TCAA 3P42A 3N1YC 1L6VA 3RUIB 2AQ3B 2BS2B 1EU4A 2LXCA 2CS4A 1NENB 5EE9A 2O2VA 2K6QA 4AS1A 2W9NA 2DAJA 3AE8B 1YN3A 2FBWB 5LNK1 3DVNU 3E56A 1P9DU 4WWNA 1RLFA 1WRDB 4MM3B 1KFYB 2C60A 3AE5B 4IC7B 1XXGA 2Y3AA 4HDQA 4HLEA 1F0ZA 3J9CA 3AB5A 1E7UA 1KJTA 2HE7A 2M4NA 4JPSA 2PKOA 4KIKA 1I4HA 2LGSA 2NTSA 2MBEA 1TY2A 4WQOB 3CMMB 1ROEA 4DHJB 2M1MA 3C8YA 1JQ4A 1VJKA 2ZZPB 3NJTA 1SIFA 4OVUA 3Q6BA 3IAM1 3AMZA 4DQOC 2ZPNA 3VDZA 5T8IA 3MJWA 3K9OB 2KNBA 1C4PA 1YJIA 3OWEB 4F7ZA 3SHQA 2PW9A 3OJ3A 2KXJA 4ZHOA 4M02A 2N9LA 2DZKA 3EUB2 2FUG1 1SB3C 3R7RA 2VRRB 4JIOU 3ZO5B 4A9AA 1V5TA 2GI9A 3AE2B 4DXGA 2BYTA 5EE0A 1VZ6A 2MBBB 1A70A 2WGSA 2V3SA 1SSNA 3HVDA 4MEMA 4N58A 4USAA 1AWDA 2N9EB 4MGZE 3UI3A 4P6VF 4GU2A 4BZAA 2NCNA 3I9V1 3TMPB 3UGBB 3RPFC 4K1RB 5LLIA 2CU3A 1I4RA 2BF8B 5D7GA 2KOXA 1WE6A 2K6DB 2WHIA 3TIXA 1KOTA 1ZP0B 2WX0A 1N5WA 5FKAC 1P98A 4L1BA 5JH5C 1JWSD 3AH7A 1WJUA 2I1KA 1YMHE 1MPEA 2BS3B 2KQ7A 3AU5A 3RT3B 3P4PB 3N32A 5E6OA 2IPKD 3DBSA 1OFFA 2WXKA 4DHZB 1NDDA 1KLGD 2MP2B 2LD9A 4W9HA 1ZE3D 2WWZA 2J42A 1Y8RC 4C4VA 5L95C 1IBXB 2ZCBA 3APDA 4XC2A 3AU4A 4ZRPA 4OZBA 2M56B 2I2YA 2JRHA 1ZDVA 3PS6A 2DNFA 4W9LA 5C1ZA 2L00B 3T3NA 1FD6A 4ZHPA 4FADA 3H7PB 1L0VB 1RWSA 2C7NB 3WCQA 3ZIMA 4BKTA 1MHHE 2YLMA 4BOSC 3BVMA 1SE2A 2X8XX 5EDSA 2O6VA 3HM3A 1GG3A 2IYDB 4FHJA 2RPVA 1M94A 3V6EB 1QT9A 2KK8A 3VHTC 2WXPA 4PYUA 4BKSD 1YD8U 2RD0A 1AYFA 3O65B 2XN9C 1LFDA 3ZJUA 1SBBB 2GBRA 2D10A 3AEFB 5KHQA 4YTMB 1PFDA 1YN5A 4YXDB 4RNAA 2DYMA 2KX0A 5J18A 3L13A 3BK1A 1SF0A 2J0MA 2B76B 2KX3A 4A3PA 4EOYA 4YSZB 3AEDB 4JX1C 1Q1OA 3HVZA 1PYWD 4ICVA 2Z0DB 4P7IA 2GLSA 2L3ZA 2PLPA 3H9DA 4W9GA 2C5LC 3L17A 2CHWA 3ZNGC 1C78A 4MT5A 2A5UA 5IO9A 3SEBA 4C7YA 3T3OA 3JYUA 4HJKA 5JHAA 2NPTA 1Z5SB 3SD5A 2M17A 2LVQA 3H1UA 5DCNA 1WWTA 2AWTA 4S17A 2A4ZA 4DK5A 4LCDE 4A55A 1TZ1A 3ZNID 1YIWA 4L2YA 2DWQA 1PUTA 3KW5B 1P7EA 3QK0A 2Y5CA 5D6JB 4G50A 3T8MA 3MHZA 2JSVX 1T3QA 3IXSA 1XQQA 4NAMA 3N20C 2EMSA 3DDCB 2M0XA 1TKYA 3NUHB 1CZPA 3KUCB 3TEYA 2WX1A 2ZVNA 2IY1B 2WQYB 1S1QB 4B95A 1P7FA 4MH8A 1YQBA 3AN1A 2X38A 3Q2AC 3A4SC 3M95A 5D3IB 4KGRA 5IP4D 1V80A 3PT2B 3NVWA 2PVOD 1TZOA 1G6JA 2OJRA 5CX3A 1CJEA 2ZNVB 4B0MA 2WXFA 1WGKA 3ZUNA 5DPRA 4ANVA 1C9FA 3DWGC 4M00A 2NTTA 3R8BA 1KF6B 1WXVA 4GLSC 2ZW1A 2BWFA 4MJSB 1ZKHA 3RD2A 3U4EG 3DCGA 3RN9C 1VLBA 2ZNVC 2QDFA 2MW5A 3ZDMC 2W82A 1RFAA 1WSPA 4NAWA 1VDVA 3P4SB 1R4MI 1WIAA 3SFEB 4YTPB 3I63C 1E90A 4GDKA 3P4RB 2CJOA 2KT7A 2REXA 2YEPB 1EWCA 3V61A 3EECA 3ONSA 4IM2A 2R2QA 4HKQA 1UBIA 5HKHA 1R4MB 2QJLA 2UWQA 3PVLA 4IW0A 3ZRFA 5C3JB 2KMAA 1M4VA 2KFKB 1V9JA 5HI1A 4ASWC 3RNBC 3PLVA 4JWUC 1WGDA 3BVZA 4A3OA 2EELA 5HG2A 3QAQA 1N5XA 4HPPA 1CQVA 3RULA 1LQBA 3IVFA 3GE8C 3NOBA 2KWCA 2JXTA 1OGWA 4YTNB 1UH6A 2KZRA 3N3KB 3EA6A 5D3DA 3V3XA 1BXTA 1GOZA 1PQSA 3LDZE 4IOIE 1QILA 2AL3A 2JXXA 3P2BA 2J0KA 3Q8FA 4XWWA 3AV8A 2WXQA 3P63A 3PREA 2BBCA 1ZXIA 2FNJB 3LXFA 2K9XA 4XYCA 1HE8A 1L5PA 1ZGUB 1VD2A 2CR5A 4GB9A 2KTRB 2BT6A 2QC8A 2KKCA 1D5XC 4WURA 3FC4A 2WU2B 3ML8A 3W1SA 4A8XC 2V4IB 1JRPA 1V86A 4P16A 3DBRI 2HDEA 3BINA 3ZNZB 3A9JB 4NJ7A 3ZTDA 2FCMA 1F52A 2BGFA 4GDLA 2INNE 2K5PA 1AARA 2MEKA 3DBRB 2V0GA 4HROA 3TUOA 4IM0A 4RM9A 2L1AA 3ZW3A 4WIPA 1ISNA 1SEBD 1UWXA 3MP9A 2MHJA 3R3MA 5IOIA 1KLVA 4OW0A 2NBWB 4K7SA 1XEEA 1N6ZA 3FILB 3H7SA 2MJEA 2G4SA 4JWSC 1U4AA 2RSUA 2JQRB 3B1LX 4HEA1 3DHHC 4A6QA 4AJYB 1QOFA 3APFA 5IN7A 1N60A 2HD5B 1KM7A 3GS2A 1QOAA 3VVWB 2HJ8A 2RMMA 3AE7B 2CHZA 4REZA 3CSFA 2KN4A 3RNFC 4ZRJA 4H2AA 1T0SC 1MHXA 1JWMD 2IO0B 4C7ZA 1J0GA 3I3TB 4GGQA 4J3OD 1UF0A 2D07B 3IBEA 4CO7A 3RFZB 2G45B 3PPAA 2KDIA 4LNNA 1E8WA 3NVVA 1WGYA 3Q8CA 3VAWA 4RM8A 3QJZA 3DPDA 2WXJA 4DXFA 2DX5B 2AYOB 2KJRA 5JHBA 1PGXA 4N9F4 2WDVB 1KLUD 4TQ1A 1QF6A 3L16A 2IGGA 1FO4A 5TR5A 3AEGB 2DYBA 2VZKB 1WXSA 4FJVB 1QOBA 5D94A 2IO3B 5JXVA 2K8HA 2IZVB 2LGYA 2NBUA 4PK1A 1L0YB 5MPOA 2PIAA 3L08A 1V97A 3EFCA 2XK5B 4YWGG 1C77A 1LXDA 3VR9B 1UUPA 2LHEA 4TMAB 4EZKA 4ZRIA 1WMHA 3W9CB 2N1WA 3OAWA 4EE2A 5LXIB 1H8CA 4AOFA 4C56C 2FCNA 4TKNA 4WWOA 2K0PA 3MC0B 4IM3A 1WE7A 2IGDA 3TSSA 3AM9A 1YX5B 2INDC 1TS4A 2AEHA 3Q8EA 2DZJA 2KQ4X 2IO1B 3OG5A 1Q5WB 1FEHA 1JWBD 3BIID 4DXAB 2ZJDA 4OZAA 1R4NI 2WDQB 4G11A 5G5GA 3W1SC 4NJCA 4XGAB 1WJNA 4IWOA 2BTEA 2BB5A 1E7VA 2MBOA 3VH3B 5E6NA 1FRDA 5AUKA 3RMKC 1R4NB 1OTRB 3U52E 2LUMA 4KZ0A 1L6UA 1UWMA 3C19A 3PHWB 2J52A 2KAJA 1FXTB 2YVCA 4HKZE 1D6EC 1KH0A 2BWES 2J53A 3VTWA 2BVCA 1HZ5A 2LRWA 2VH2A 3C0RB 2ZPYA 3A1QB 3U7DA 1S3SG 4L23A 2DBYA 3H6NA 3ZNHB 3ZJTA 3GE3C 1D5MC 1ET9A 2FCSA 3N30A 2PJHA 1V2YA 1TS2A 4EFOA 1QLBB 2KO3A 3N1ZC 3QA8A 4ITKA 3KUDB 3KVFB 2PPHA 4TUUA 1K52A 1FPYA 4J6IA 4D2KA 2I38A 1C4CA 2ONQA 2AQ2B 2MJDA 2O2VB 2TSSA 2WXOA 3CSTA 3AE6B 2BB6A 1OQRA 2L52A 3L10B 4XDCA 2WLBA 3QQ8B 4WJQA 2N9KA 2QCZA 2LEKA 4K3BA 4WJOA 3KLSX 2GOWA 4IG7B 4ZOHC 1VR9A 2C7HA 2J0JA 3Q8BA 3WAOA 2KHWB 1TTNA 2E6XA 1NBFC 4KIKB 4FHKA 3Q3JA 4WJNA 1NYQA 3JSVA 3UIPB 4HCPB 2QIEB 5G5HA 4BAXA 4ZYNA 4XZ4A 3UQAA 3ZGZA 2KN5A 1MFWA 4JE3B 5CTRC 2JT4B 2NVUI 1RM6C 4DHJD 3TEZA 2LXAA 3ZTCA 2DLBA 3K9PB 4O1NA 3W5VB 3VRAB 2WDTB 2XNAC 4MDKE 2KDBA 4B9KA 3IT6B 5BO4B 4RGTA 1HA5A 2N1VA 4MGYE 1NYRA 3UQBA 2PEAA 3RZFA 2JYEA 3DHGC 4HPLB 4PT5A 3WAMA 3HUIA 1I35A 2IO2B 4NY0A 3AE4B 3V60A 2DZMA 2KANA 3KH0A 4BOZB 1TT5B 2NBVB 1V1PA 4LDTB 1IYFA 2MH7A 2W55A 2JYTA 2RGFA 3HIZA 4MELA 1TS3A 2AX5A 4RFBA 2Q5WD 2D3AA 3NHEB 2BS4B 3Q14C 4XWTA 3QARA 2CKHB 4M0WA 4HPMB 1J7BA 2JY6A 2KJHB 2WXRA 5FK9C 2MQJA 4WJPA 2KDMA 4XE0A 1YJJA 1MVKA 1YOVB 3E9SA 3W5UB 1N63A 4CYEA 2BW2A 5AEKB 4KDLB 1N62A 3U7ZA 2PVGC 2G9HD 2R61A 1C1YB 2KVRA 4GN1A 1WM2A 4ZRQA 1ZXHA 2KTFA 3A9KA 3PLUA 4C4VB 4RGOS 2D11A 2LGDA 1DGJA 3VR8B 4GXBA 1SGHA 4AWJA 1ZW7A 4AJWA 1P0RA 4DDGD 4I6PA 2ACZB 4E3CA 1XCTL 2JPHA 3DVGX 3GOEA 1T0QC 1UBQA 4K81A 3U2SC 5BYRA 2MSED 2WS3B 4HVBA 1JWAD 1KTKA 3SU8X 1L4ZB 2BYVE 2N0SB 3BZDB 2BQQA 1H4RA 2ZCCA 4RCOA 1FNVA 3DQVA 1GNUA 2EMTA 5HHDG 1K53A 1VZ7A 2PTLA 1T5XD 3ZXRA 4EEWA 4IKGA 2O6VB 1YN4A 4TSSA 4F8CB 2Z59B 4M8MA 3PZ8A 2K1FA 1V8CA 2Z8LA 3VUXA 3PRMB 2D3BA 2MJ3A 1E10A 3NVZA 4RH6A 1V49A 3URYA 1J19A 3ZKJC 2WNMA 1UELA 1E8ZA 2WYQA 2C7MB 3B9JA 3V62A 1YJ1A 3EFUA 3A33B 3KYDD 3CWIA 4PS3A 2IGHA 2KFJA 1WGRA 3RZWC 3ZRCA 1TJEA 3BY4B 4FULA 1P3QU 4GSWA 1WYWB 3QIJA 5C2TB 3DOWA 2JRIB 2BKRB 4EKUA 1WFYA 1QZEA 3Q3MC 2J7QB 1GC7A 3NVYA 4NQKE 1P1AA 1AW7A 3MHSD 1FIQA 3PZ7A 5FR6A 5DPTA 2L32A 3L0WB 1MJDA 4ZYSA 3I57A 5JZEB 4ICUA 2NPTB 3RNAC 1YQ4B 1Z2MA 3DBLI 4MM3A 4W9DA 1RFKA 2K22A 2INCC 3NZ3A 3KWLA 5GMVA 2JF5A 4LNKA 3VFKA 4DDID 2KLCA 4LNFA 1J7AA 1V1OA 3DBLB 1KRHA 4KV2A 2MLBA 2LFIA 5CHWA 4A90A 1EWYC 4BKSA 1HTOA 1F2RI 1DOXA 4ARIA 1IGCA 2CU1A 3R2IA 1EUVB 4BBNC 1AN8A 3LJ3A 1VCBA 1J7CA 2HJ1A 3PSEB 2HTME 1ESFA 4OZCA 1WXAA 2YEPF 4KX6B 4WAAA 4R3DA 2WDRB 1WXMA 2KDEB 3NZUA 1Q10A 1I42A 5J2RA 4YT0B 4C80A 3Q3OC 3WAPA 3WIMA 3VH4B 5AUIA 3NS1A 1F2RC 1FCLA 4ARCA 2WXGA 3PGEA 2W3SA 2PMVA 2FE8A 1PGAA 4PS8A 4C00A 1STEA 3AXCA 1I4GA 1FRRA 2JZ3B 1TKEA 4N6EB 3R7QA 1WZ3A 1OEYA 5E6JA 1UZXB 2JU6X 4HCNB 4G3XB 2L76A 2WXHA 3KQ4A 2E3TA 4K7WA 1WH3A 4NJ6A 4PS7A 3EHVA 4LNOA 1ENFA 1TGZB 1D5ZC 3ZLZA 2O6VD 4NAWB 2AQ1B 4RF1A 3M62B 2K25A 2GBJA 4GMVA 4GDKB 1FCCC 1JWUD 3L54A 2N7JA 2KMMA 3T9LA 5AZHA 3W2DA 4KGTA 3PRZA 1JMLA 3ZDTA 4B6WA 3MFGA 1EF5A 3RNEC 5BYQA 2GMIC 3ZYYX 3Q69A 4BFRA 2MP2A 1NVID 3VXWA 1I4QA 4ANUA 4JLCA 3AECB 2MA9B 4DHZE 2QHOA 1WR1A 2PE9A 1IBXA 2LRUA 2L7RA 1WYGA 1WM3A 3H8HA 1QOGA 4M01A 3QC8B 3TL5A 2JWZA 2V3NA 3U30A 1FXAA 4MH0E 2RR9A 5IA7A 4G0NB 3UIOB 3RYTA 3SR6A 1ZDXA 3HRDD 3H7PA 2KWDA 4E71A 2RPQA 3BYYB 2LUEA 3RNCC 3DHIC 4KGSA 3AE3B 3UF8A 5IKCM 2H88B 1L2NA 4HK2A 4RMAA 3AE9B 1XLPA 2GBNA
chains in the Genus database with same CATH topology
4YSYB 2QSDA 4WH4A 4MH8A 5G5HA 1DOIA 2IDYA 2QILA 2X38A 3AN1A 2QMTA 2G1EA 1DYQA 5BMHA 1MI0A 5D3IB 4KGRA 1BUIC 1HEZE 1E6EB 3ZGZA 1FM0D 3NVWA 1YQ3B 2PVOD 1TZOA 4JE3B 3N9YC 4WWMA 1CJEA 1RM6C 1FFUA 3TEZA 4B0MA 1ZUD2 4GDLB 2WXFA 4HRSA 2DLBA 1WGKA 3BVGA 4O1NA 2QEJC 3W5VB 3VRAB 3V05A 2JX5A 3BWUD 4KKIA 4YSXB 1GB1A 2XNAC 3ZJVA 1JCKB 1C9FA 3DWGC 3AE1B 3PO0A 3P4QB 2Y5PA 2NTTA 3IT6B 3R8BA 1KF6B 4RGTA 1HA5A 4GLSC 3VQIA 2ZW1A 3L4PA 1NYRA 2INPE 1E0ZA 2WXMA 2GRIA 2CJNA 3B2GA 2EKIA 3U4EG 1CK1A 2JYEA 1JROA 4PT5A 3HUIA 1SE3A 1VLBA 3BK2A 2H89B 2W82A 3AE4B 1WSPA 2GB1A 2LGIA 1VDVA 3P4SB 1RYJA 1EM7A 3SFEB 4YTPB 2WU5B 4WAFA 3P4RB 2LHDA 1V1PA 3KWVA 2CJOA 1B9RA 3AEBB 5GXGB 2YEPB 1EWCA 5EE3A 2MH7A 2W55A 3ETRA 1F77A 1LO5D 2OEDA 2JYTA 1UNSA 4HKQA 4AQ7A 1XCQL 2QJLA 1D4BA 1TS3A 1VRAB 3B2FA 5C3JB 2AX5A 4RFBA 1M4VA 2Q5WD 5HI1A 2BS4B 3AEAB 2NMQA 4XWTA 1C4AA 1IGDA 1OQQA 1FFVA 1TYGB 4JWUC 3BVZA 4RGMA 4M0WA 1FNWA 2EELA 5HG2A 1J7BA 2RDHA 3P42A 1N5XA 1L6VA 1CQVA 2WXRA 2AQ3B 2BS2B 5FK9C 1EU4A 1NENB 5EE9A 2W54A 2KDMA 4XE0A 1YJJA 4AS1A 2D5GA 2JXTA 1MVKA 3AE8B 4YTNB 1YN3A 3E9SA 3W5UB 2FBWB 1N63A 5LNK1 3EA6A 3E56A 5D3DA 3V3XA 1BXTA 2BW2A 1GOZA 1N62A 3U7ZA 2PVGC 1XLQA 2G9HD 2R61A 4MM3B 1KFYB 4IOIE 3AE5B 1QILA 1YNTE 1XXGA 2Y3AA 3DWMA 3Q8FA 4ZRQA 4XWWA 1F0ZA 1ZXHA 3AV8A 3J9CA 2WXQA 3P63A 3AB5A 2BBCA 4RGOS 5TSSA 1DGJA 1ZXIA 4JPSA 3VR8B 1GB4A 1E7PB 3LXFA 2PKOA 2SAKA 1I4HA 1XLNA 4RF0A 2K9XA 2NTSA 1TY2A 2M19A 1HQRD 1L5PA 2ACZB 1ROEA 1XCTL 2JZPA 2BT6A 5HFYA 3C8YA 1JQ4A 1VJKA 1D5XC 4WURA 3U2SC 5BYRA 3FC4A 2J4XA 4OVZA 2WU2B 1TS5A 3W1SA 2V4IB 1HZ6A 2WS3B 3IAM1 4A8XC 1JRPA 3AMZA 4DQOC 1JWAD 4N59A 1KTKA 2HDEA 4P16A 1E9MA 1L4ZB 2VZKD 2DYOA 2LJIA 2N0SB 1SE4A 3BZDB 5T8IA 4RCOA 1FNVA 3AEEB 1SXTA 3Q8AA 1ZOYB 1C4PA 2INNE 1YJIA 2K5PA 3OWEB 2MEKA 1PDXA 5HHDG 1K53A 1VZ7A 2V0GA 2PTLA 2PW9A 1T5XD 4MACA 4HROA 4UDUC 1ET6A 3TUOA 1EU3A 4IKGA 4ZHOA 1YN4A 2L1AA 4WIPA 4TSSA 1SEBD 1UWXA 3MP9A 4HJGE 2N9LA 5EE1A 1T6BX 2FUG1 3EUB2 1SB3C 3PZ8A 1V8CA 2Z8LA 4OW0A 2MJ3A 1E10A 2V3PA 3NVZA 2WXIA 4RH6A 3URYA 1XEEA 3FILB 2MJEA 2WNMA 4A9AA 1IUEA 1DOYA 3B9JA 4JWSC 2JQRB 2GI9A 4HEA1 4A6QA 1SJHD 3CWIA 1QOFA 3AE2B 4DXGA 2BYTA 5EE0A 1N60A 1R7SA 1VZ6A 2IGHA 1A70A 1QKZA 1WXQA 3GS2A 1QOAA 4OHJA 2RMMA 1TJEA 1SSNA 3TEXA 5BMIA 1GAQB 3AE7B 4IDIA 3HVDA 1ZPSA 4N58A 4REZA 2L83A 5C2TB 2KN4A 3NRZA 4H2AA 4USAA 1AWDA 2M0AA 3UI3A 4P6VF 1MHXA 1JWMD 3I9V1 1ACCA 4C7ZA 3RPFC 3NVYA 2CU3A 4XDDA 1I4RA 5D7GA 4Q2JA 1I4PA 1AW7A 4J3OD 1FIQA 1TY0A 3PZ7A 5FR3A 1ZP0B 1N5WA 5FKAC 3RFZB 2L32A 4L1BA 1JWSD 1VZ8A 3AH7A 4ZYSA 3I57A 1YMHE 1MPEA 3NVVA 2BS3B 3Q8CA 3LYYA 1YQ4B 3P4PB 2WXJA 2W3RA 2IPKD 4DXFA 1OFFA 2WXKA 3O13A 4LTUA 2SEBD 1PGXA 1KLGD 1RFKA 1PGBA 1ZE3D 2K22A 2WDVB 2WXNA 1KLUD 3NZ3A 4TQ1A 1QF6A 4B0EA 3KWLA 1K51A 2J42A 2IGGA 1FO4A 3AEGB 1IBXB 5BYSA 1B1ZA 1J7AA 1V1OA 2VZKB 1KRHA 4ZRPA 4TQ0A 1SIJA 3IAS1 2LFIA 4OZBA 4WQMA 4A90A 1EWYC 2M56B 2I2YA 1F2RI 4KKJA 1FMAD 1QOBA 1DOXA 1ZDVA 4ARIA 5JXVA 1IGCA 2IJ0A 4CQNA 3R2IA 1L0YB 3T3NA 5MPOA 1FD6A 1AN8A 2PIAA 3R2TA 4ZHPA 1V97A 1J7CA 1L0VB 1RWSA 4YWGG 1C77A 1UGJA 3CIRB 3WCQA 2HTME 1ESFA 3VR9B 1SJED 3EGRA 1MHHE 1UUPA 4OZCA 4KX6B 2YEPF 2LHEA 4TMAB 4R3DA 2WDRB 3FAHA 1BMLC 4RGNA 1Q10A 3BVMA 1SE2A 1NEKB 1WRIA 4YT0B 3W9CB 4C80A 2RPVA 4EE2A 5AUIA 1JW9D 1QT9A 2OHFA 3NS1A 4C56C 1F2RC 1FCLA 4ARCA 2WXPA 2WXGA 2K0PA 3MC0B 1AYFA 3FILA 2JWUA 2W3SA 2PMVA 2XN9C 4US8A 3ZJUA 2FE8A 2IGDA 1SBBB 1PGAA 3TSSA 3AM9A 1STEA 1I4GA 3AEFB 1TS4A 4YTMB 1PFDA 1FRRA 3Q8EA 1YN5A 2KQ4X 1TKEA 1I7HA 4N6EB 1FEHA 3BIID 1JWBD 4YXDB 4RNAA 2DYMA 4OZAA 3BK1A 5H92C 3SFDB 4LK0M 5E6JA 1XO3A 2WDQB 1SF0A 5G5GA 2JU6X 4NJCA 2B76B 2WXHA 3KQ4A 2E3TA 2BTEA 2BB5A 1I4XA 4YSZB 2ZW0A 3AEDB 3GB1A 3MJ5A 4JX1C 3HVZA 1PYWD 1FRDA 5AUKA 2PLPA 3U52E 1ENFA 1D5ZC 2LUMA 1QQRA 1NI3A 1L6UA 4NZLB 1UWMA 4LLGM 2J52A 2KAJA 4HKZE 4NAWB 2AQ1B 4RF1A 2RDGA 1C78A 1D6EC 1KH0A 3LB8C 4MT5A 2J53A 4GDKB 3SEBA 3VRBB 4C7YA 1HZ5A 1V1PB 3P1MA 4FXCA 3T3OA 1FCCC 2WP9B 1JWUD 4L23A 2N7JA 2DBYA 1Y56A 2KMMA 3IT4B 3W2DA 3ZJTA 4KGTA 1D5MC 1JMLA 1ET9A 1GPXA 3MFGA 5BYQA 1JALA 3ZYYX 3Q69A 5I4DA 1WWTA 1NVID 1TS2A 1K50A 1QLBB 1I4QA 4A55A 3AECB 4ITKA 5H8YE 1FXIA 2WXLA 5BMGA 1IBXA 3BYTB 1K52A 1WYGA 3H8HA 4L2YA 2DWQA 2K3UA 1N61A 1QOGA 1TKGA 2I38A 4D2KA 1PUTA 1C4CA 2ONQA 2AQ2B 2ICIA 1P7EA 2MJDA 1L0XB 1XLOA 2TSSA 2WXOA 2V3NA 2Y5CA 3AE6B 1FXAA 2BB6A 1OQRA 2L52A 2ON8A 4XDCA 2WLBA 2N9KA 1L4DB 3MHZA 2LEKA 1FNUA 1T3QA 2JSVX 3IXSA 3KLSX 4NAMA 3ABVB 1ZDXA 3SR6A 3HRDD 2LMCA 1XF5L 2KWDA 1TKYA 4ZOHC 1VR9A 3BYYB 3Q8BA 3NUHB 4KGSA 3TEWA 3AE3B 1C79A 1CZPA 2KACA 2E6XA 3TEYA 1C76A 2H88B 3GP7A 2WQYB 1HXYD 1NYQA 3AE9B 1XLPA 3ZQ4A 4US9A 2QIEB 1P7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSD A;  4IOI E;  4WH4 A;  1YNT E;  4OZA A;  2QMT A;  5BMH A;  1ZXH A;  1MI0 A;  2JU6 X;  4KGR A;  1HEZ E;  1GB4 A;  2ZW0 A;  3GB1 A;  1YMH E;  1MPE A;  2PLP A;  2LUM A;  1XCT L;  2JZP A;  5HFY A;  1PGX A;  2J52 A;  1PGB A;  4HKZ E;  1GB1 A;  1C9F A;  1HZ6 A;  1KH0 A;  2J53 A;  1K51 A;  2IGG A;  1IBX B;  1HZ5 A;  4GLS C;  1FCC C;  2ZW1 A;  2N7J A;  4OZB A;  4KGT A;  1JML A;  2I2Y A;  1F2R I;  5JXV A;  1IGC A;  5HHD G;  1K53 A;  2PW9 A;  2PTL A;  4MAC A;  1K50 A;  2GB1 A;  2LGI A;  4IKG A;  1EM7 A;  5BMG A;  1FD6 A;  1UWX A;  3MP9 A;  2LHD A;  4HJG E;  2N9L A;  1IBX A;  1K52 A;  4D2K A;  2I38 A;  2ONQ A;  2OED A;  1P7E A;  1MHH E;  1XCQ L;  4OZC A;  2LHE A;  3FIL B;  1D4B A;  5HI1 A;  2ON8 A;  1Q10 A;  2NMQ A;  2GI9 A;  2N9K A;  1IGD A;  2JSV X;  2IGH A;  2EEL A;  2RPV A;  5HG2 A;  1XF5 L;  1QKZ A;  2KWD A;  2RMM A;  1F2R C;  5BMI A;  1FCL A;  4KGS A;  2K0P A;  2KAC A;  2KDM A;  3FIL A;  2JWU A;  2KN4 A;  2JXT A;  1MVK A;  2IGD A;  3UI3 A;  1PGA A;  1MHX A;  3V3X A;  2KQ4 X;  1P7F A; 
#chains in the Genus database with same CATH topology
 4YSY B;  1XD3 B;  1DOI A;  2QIL A;  1JRU A;  4NPN A;  1E6E B;  2CHX A;  3MTN B;  1FM0 D;  3WAL A;  4YL8 A;  2BYF A;  3Q3N C;  4WWM A;  1GC6 A;  1T0R C;  1WY8 A;  1ZUD 2;  2NS5 A;  3Q3F A;  4GDL B;  4HRS A;  1HTQ A;  3U8Z A;  4TV3 A;  3BVG A;  2QEJ C;  3NG0 A;  3V05 A;  2JX5 A;  4KKI A;  4YSX B;  2LZ6 A;  1GB1 A;  3ZJV A;  3AE1 B;  4S0R A;  3P4Q B;  2Y5P A;  3QX1 A;  4HWI B;  1GUA B;  1J8C A;  3VQI A;  1E0Z A;  2XEW A;  2KYW A;  3ECI A;  2GRI A;  3B2G A;  3QCA A;  2EKI A;  2KC2 A;  1IPG A;  2N4F A;  3BK2 A;  3VTV A;  1GJZ A;  2GB1 A;  2LHD A;  3KWV A;  2MBH A;  5GXG B;  5G55 A;  5CHV C;  2XBB C;  1D3Z A;  1F77 A;  1LO5 D;  2K39 A;  2OED A;  3OLM D;  1UNS A;  4PYZ A;  4AQ7 A;  4W9I A;  3HM6 X;  1D4B A;  1VRA B;  3B2F A;  3ZVV A;  2FCQ A;  2KVZ A;  5AZG A;  3AEA B;  4P1C C;  1C4A A;  3DVN V;  1IGD A;  1WJ4 A;  2RDH A;  4EZJ A;  2D2Q A;  3X0W A;  4IWP A;  2AL6 A;  2W54 A;  4II3 B;  2D5G A;  2Z0E B;  2DEN B;  1XLQ A;  1YNT E;  1WJ6 A;  3DWM A;  2VH1 A;  3B0A A;  2LGX A;  4A20 A;  4ANX A;  3ML9 A;  5TSS A;  1GB4 A;  1E7P B;  4MGK E;  2SAK A;  4RF0 A;  1XLN A;  2D3C A;  5D2M B;  2M19 A;  3VUY A;  1HQR D;  4NQL B;  3I5J C;  2JZP A;  4W9J A;  5HFY A;  3GZN I;  1EO6 A;  2J4X A;  4OVZ A;  1WX7 A;  1WR6 E;  4URK A;  1TS5 A;  3AI5 A;  1HZ6 A;  2IY0 B;  3OJ4 B;  4N59 A;  1E9M A;  2LAS A;  2VZK D;  1WX8 A;  2DYO A;  3PHX B;  2LJI A;  1WX9 A;  1SE4 A;  2K8B A;  3GZN B;  3AEE B;  1SXT A;  3Q8A A;  1ZOY B;  4KSK C;  1PDX A;  3W1Y A;  4ANW A;  5LXH A;  1LM8 B;  4MAC A;  4UDU C;  1ET6 A;  3PV1 A;  1EU3 A;  1WMH B;  3SDL C;  3M3J A;  1V81 A;  3ZXV A;  4DWF A;  4HJG E;  5EE1 A;  1T6B X;  4MJS A;  2JZZ A;  2LWP A;  1Q0W B;  2V3P A;  4F1S A;  2WXI A;  1T0Y A;  4IUM B;  4W9F A;  2N9P C;  1IUE A;  1L7Y A;  1DOY A;  3S2A A;  1SJH D;  4AP4 C;  1R7S A;  2D3G A;  1QKZ A;  1WXQ A;  4OHJ A;  3TEX A;  4MSQ B;  5BMI A;  1GAQ B;  4IDI A;  2KC1 A;  2KQS A;  1ZPS A;  2HTH A;  2L83 A;  3AUL A;  3NRZ A;  4W9E A;  2M8S A;  2M0A A;  2KFK A;  3ALB A;  1WI0 A;  1OQY A;  1ACC A;  2MCN B;  3MC8 A;  4XDD A;  1UGM A;  1I4P A;  4Q2J A;  5C23 A;  1C3T A;  1TY0 A;  2DAF A;  3EC8 A;  4WWP A;  5FR3 A;  2NR2 A;  2LVO A;  3ENE A;  1TBE A;  2KD0 A;  1VZ8 A;  1F9J A;  4GIV A;  3LYY A;  5KHO A;  2W3R A;  2ZEQ A;  3O13 A;  4LTU A;  5E6P A;  1WGH A;  2SEB D;  2ZVO A;  1PGB A;  2WXN A;  4E74 A;  3IG3 A;  4B0E A;  1K51 A;  4DBG A;  5BYS A;  1B1Z A;  4TQ0 A;  1SIJ A;  1UD7 A;  3IAS 1;  1K8R B;  2G4D B;  4IWQ A;  4WQM A;  2OJW A;  4LNI A;  3TJP A;  4KKJ A;  1FMA D;  4FA6 A;  2IJ0 A;  2KTR A;  4CQN A;  2DHZ A;  2LI5 A;  4I6L B;  4II2 B;  5IAA C;  3PTF C;  5G2N A;  2LVP A;  3R2T A;  1V6E A;  4HDO A;  1BT0 A;  3A9J A;  1UGJ A;  3CIR B;  4FLH A;  1WZ0 A;  1SJE D;  3EGR A;  1YX6 B;  1E8X A;  2OOB B;  3FAH A;  1BML C;  4RGN A;  2N7D A;  3IFW B;  3JSV B;  1NEK B;  1WRI A;  2L05 A;  2GBM A;  4P1B C;  2RDB C;  1F1H A;  2LJ5 A;  1MG4 A;  2K8C A;  1JW9 D;  2ASQ A;  2OHF A;  3MC9 A;  2C9W B;  4XX5 A;  1E5W A;  2KWV B;  2MWS B;  3FIL A;  2JWU A;  4US8 A;  2V4L A;  2V1Y A;  4FN2 A;  1MG8 A;  3DVG Y;  1I7H A;  1X1M A;  4FJY A;  2KJ6 A;  3NS8 A;  1LGR A;  5DPS A;  5H92 C;  3SFD B;  4LK0 M;  1XO3 A;  3X23 A;  2N7E A;  3R66 C;  3FKY A;  4GOC A;  1I4X A;  2ZW0 A;  3GB1 A;  3MJ5 A;  2Y5B B;  4KVG B;  3JVZ X;  1QQR A;  1NI3 A;  4NZL B;  4LLG M;  1WGG A;  2KLG A;  3JW0 X;  2RDG A;  3KYC D;  3LB8 C;  1E8Y A;  3PZD A;  4HXD A;  3HK0 A;  3VRB B;  1V1P B;  3P1M A;  4FXC A;  4MGI E;  2WP9 B;  3WAN A;  1Y56 A;  3IT4 B;  3RNG C;  1WF9 A;  4W9K A;  1GPX A;  1SE9 A;  3KUZ A;  1JAL A;  4W9C A;  5I4D A;  4JQW C;  1K50 A;  4FJZ A;  5L83 A;  1OEY J;  5H8Y E;  3M63 B;  1FXI A;  2WXL A;  4LDT D;  4M0W B;  2FAZ A;  5BMG A;  1V5O A;  4KZC A;  2EKE C;  3BYT B;  1N61 A;  1TKG A;  2K3U A;  4K3C A;  2UYZ B;  2ICI A;  1L0X B;  2L0F A;  1XLO A;  2FID A;  4MSM B;  2ON8 A;  4KDI C;  1A5R A;  3D32 A;  3VTU A;  3V6C B;  1L4D B;  1FNU A;  3NZS A;  3ABV B;  2LMC A;  1XF5 L;  2XK5 A;  2DZI A;  2IBI B;  2BPS A;  2JUO A;  2UU7 A;  3A9K B;  2BKF A;  5DPW A;  3TEW A;  1C79 A;  2KAC A;  4LJO B;  4X57 B;  1C76 A;  3GP7 A;  2FIF A;  4I6N B;  4JGH B;  1CMX B;  1HXY D;  2L0T A;  1XT9 B;  2KDF B;  3ZQ4 A;  4US9 A;  4M8N A;  2QSD A;  4WH4 A;  2I1J A;  1RAX A;  2IDY A;  2MRP A;  2BYE A;  3IHP C;  3WA0 A;  2L8J A;  2QMT A;  2G1E A;  1DYQ A;  5BMH A;  1MI0 A;  4JL9 A;  2V9H A;  1BUI C;  1HEZ E;  3DBH I;  2G3Q B;  3A4R A;  2PE6 B;  3UIN B;  3HHM A;  1YQ3 B;  3N9Y C;  4K7U A;  3PRP B;  1FFU A;  4OVV A;  4BKG A;  3QHT A;  5J17 A;  3DBH B;  3VUW A;  2JVC A;  4AUQ C;  3BWU D;  3N1X C;  4NNJ B;  1JCK B;  3PO0 A;  2KMC A;  4BBN F;  3L4P A;  2INP E;  3APC A;  1IP9 A;  4EUT A;  2KWU B;  2WXM A;  2CJN A;  1CK1 A;  1JRO A;  4BVU C;  4CHK A;  2MBQ A;  1RRB A;  5CHF A;  1SE3 A;  2N9X A;  1NI2 A;  4ZRK A;  2GBK A;  2H89 B;  2LGI A;  1RYJ A;  4ACF A;  1EM7 A;  4LJP B;  2WU5 B;  4WAF A;  4EZL A;  4ZDV A;  4FBJ B;  3RI7 C;  1B9R A;  3A1Q A;  3AEB B;  3B08 A;  2FUH B;  5EE3 A;  3ETR A;  1TIF A;  1EF1 A;  4QAY A;  2R2O A;  3QWZ B;  3RCZ A;  2B3A A;  3NY5 A;  1XCQ L;  2MX2 A;  4KSL C;  3CF6 E;  5AZF A;  2NMQ A;  1OQQ A;  1FFV A;  1TYG B;  4RGM A;  1FNW A;  3TBL D;  3TCA A;  3P42 A;  3N1Y C;  1L6V A;  3RUI B;  2AQ3 B;  2BS2 B;  1EU4 A;  2LXC A;  2CS4 A;  1NEN B;  5EE9 A;  2O2V A;  2K6Q A;  4AS1 A;  2W9N A;  2DAJ A;  3AE8 B;  1YN3 A;  2FBW B;  5LNK 1;  3DVN U;  3E56 A;  1P9D U;  4WWN A;  1RLF A;  1WRD B;  4MM3 B;  1KFY B;  2C60 A;  3AE5 B;  4IC7 B;  1XXG A;  2Y3A A;  4HDQ A;  4HLE A;  1F0Z A;  3J9C A;  3AB5 A;  1E7U A;  1KJT A;  2HE7 A;  2M4N A;  4JPS A;  2PKO A;  4KIK A;  1I4H A;  2LGS A;  2NTS A;  2MBE A;  1TY2 A;  4WQO B;  3CMM B;  1ROE A;  4DHJ B;  2M1M A;  3C8Y A;  1JQ4 A;  1VJK A;  2ZZP B;  3NJT A;  1SIF A;  4OVU A;  3Q6B A;  3IAM 1;  3AMZ A;  4DQO C;  2ZPN A;  3VDZ A;  5T8I A;  3MJW A;  3K9O B;  2KNB A;  1C4P A;  1YJI A;  3OWE B;  4F7Z A;  3SHQ A;  2PW9 A;  3OJ3 A;  2KXJ A;  4ZHO A;  4M02 A;  2N9L A;  2DZK A;  3EUB 2;  2FUG 1;  1SB3 C;  3R7R A;  2VRR B;  4JIO U;  3ZO5 B;  4A9A A;  1V5T A;  2GI9 A;  3AE2 B;  4DXG A;  2BYT A;  5EE0 A;  1VZ6 A;  2MBB B;  1A70 A;  2WGS A;  2V3S A;  1SSN A;  3HVD A;  4MEM A;  4N58 A;  4USA A;  1AWD A;  2N9E B;  4MGZ E;  3UI3 A;  4P6V F;  4GU2 A;  4BZA A;  2NCN A;  3I9V 1;  3TMP B;  3UGB B;  3RPF C;  4K1R B;  5LLI A;  2CU3 A;  1I4R A;  2BF8 B;  5D7G A;  2KOX A;  1WE6 A;  2K6D B;  2WHI A;  3TIX A;  1KOT A;  1ZP0 B;  2WX0 A;  1N5W A;  5FKA C;  1P98 A;  4L1B A;  5JH5 C;  1JWS D;  3AH7 A;  1WJU A;  2I1K A;  1YMH E;  1MPE A;  2BS3 B;  2KQ7 A;  3AU5 A;  3RT3 B;  3P4P B;  3N32 A;  5E6O A;  2IPK D;  3DBS A;  1OFF A;  2WXK A;  4DHZ B;  1NDD A;  1KLG D;  2MP2 B;  2LD9 A;  4W9H A;  1ZE3 D;  2WWZ A;  2J42 A;  1Y8R C;  4C4V A;  5L95 C;  1IBX B;  2ZCB A;  3APD A;  4XC2 A;  3AU4 A;  4ZRP A;  4OZB A;  2M56 B;  2I2Y A;  2JRH A;  1ZDV A;  3PS6 A;  2DNF A;  4W9L A;  5C1Z A;  2L00 B;  3T3N A;  1FD6 A;  4ZHP A;  4FAD A;  3H7P B;  1L0V B;  1RWS A;  2C7N B;  3WCQ A;  3ZIM A;  4BKT A;  1MHH E;  2YLM A;  4BOS C;  3BVM A;  1SE2 A;  2X8X X;  5EDS A;  2O6V A;  3HM3 A;  1GG3 A;  2IYD B;  4FHJ A;  2RPV A;  1M94 A;  3V6E B;  1QT9 A;  2KK8 A;  3VHT C;  2WXP A;  4PYU A;  4BKS D;  1YD8 U;  2RD0 A;  1AYF A;  3O65 B;  2XN9 C;  1LFD A;  3ZJU A;  1SBB B;  2GBR A;  2D10 A;  3AEF B;  5KHQ A;  4YTM B;  1PFD A;  1YN5 A;  4YXD B;  4RNA A;  2DYM A;  2KX0 A;  5J18 A;  3L13 A;  3BK1 A;  1SF0 A;  2J0M A;  2B76 B;  2KX3 A;  4A3P A;  4EOY A;  4YSZ B;  3AED B;  4JX1 C;  1Q1O A;  3HVZ A;  1PYW D;  4ICV A;  2Z0D B;  4P7I A;  2GLS A;  2L3Z A;  2PLP A;  3H9D A;  4W9G A;  2C5L C;  3L17 A;  2CHW A;  3ZNG C;  1C78 A;  4MT5 A;  2A5U A;  5IO9 A;  3SEB A;  4C7Y A;  3T3O A;  3JYU A;  4HJK A;  5JHA A;  2NPT A;  1Z5S B;  3SD5 A;  2M17 A;  2LVQ A;  3H1U A;  5DCN A;  1WWT A;  2AWT A;  4S17 A;  2A4Z A;  4DK5 A;  4LCD E;  4A55 A;  1TZ1 A;  3ZNI D;  1YIW A;  4L2Y A;  2DWQ A;  1PUT A;  3KW5 B;  1P7E A;  3QK0 A;  2Y5C A;  5D6J B;  4G50 A;  3T8M A;  3MHZ A;  2JSV X;  1T3Q A;  3IXS A;  1XQQ A;  4NAM A;  3N20 C;  2EMS A;  3DDC B;  2M0X A;  1TKY A;  3NUH B;  1CZP A;  3KUC B;  3TEY A;  2WX1 A;  2ZVN A;  2IY1 B;  2WQY B;  1S1Q B;  4B95 A;  1P7F A;  4MH8 A;  1YQB A;  3AN1 A;  2X38 A;  3Q2A C;  3A4S C;  3M95 A;  5D3I B;  4KGR A;  5IP4 D;  1V80 A;  3PT2 B;  3NVW A;  2PVO D;  1TZO A;  1G6J A;  2OJR A;  5CX3 A;  1CJE A;  2ZNV B;  4B0M A;  2WXF A;  1WGK A;  3ZUN A;  5DPR A;  4ANV A;  1C9F A;  3DWG C;  4M00 A;  2NTT A;  3R8B A;  1KF6 B;  1WXV A;  4GLS C;  2ZW1 A;  2BWF A;  4MJS B;  1ZKH A;  3RD2 A;  3U4E G;  3DCG A;  3RN9 C;  1VLB A;  2ZNV C;  2QDF A;  2MW5 A;  3ZDM C;  2W82 A;  1RFA A;  1WSP A;  4NAW A;  1VDV A;  3P4S B;  1R4M I;  1WIA A;  3SFE B;  4YTP B;  3I63 C;  1E90 A;  4GDK A;  3P4R B;  2CJO A;  2KT7 A;  2REX A;  2YEP B;  1EWC A;  3V61 A;  3EEC A;  3ONS A;  4IM2 A;  2R2Q A;  4HKQ A;  1UBI A;  5HKH A;  1R4M B;  2QJL A;  2UWQ A;  3PVL A;  4IW0 A;  3ZRF A;  5C3J B;  2KMA A;  1M4V A;  2KFK B;  1V9J A;  5HI1 A;  4ASW C;  3RNB C;  3PLV A;  4JWU C;  1WGD A;  3BVZ A;  4A3O A;  2EEL A;  5HG2 A;  3QAQ A;  1N5X A;  4HPP A;  1CQV A;  3RUL A;  1LQB A;  3IVF A;  3GE8 C;  3NOB A;  2KWC A;  2JXT A;  1OGW A;  4YTN B;  1UH6 A;  2KZR A;  3N3K B;  3EA6 A;  5D3D A;  3V3X A;  1BXT A;  1GOZ A;  1PQS A;  3LDZ E;  4IOI E;  1QIL A;  2AL3 A;  2JXX A;  3P2B A;  2J0K A;  3Q8F A;  4XWW A;  3AV8 A;  2WXQ A;  3P63 A;  3PRE A;  2BBC A;  1ZXI A;  2FNJ B;  3LXF A;  2K9X A;  4XYC A;  1HE8 A;  1L5P A;  1ZGU B;  1VD2 A;  2CR5 A;  4GB9 A;  2KTR B;  2BT6 A;  2QC8 A;  2KKC A;  1D5X C;  4WUR A;  3FC4 A;  2WU2 B;  3ML8 A;  3W1S A;  4A8X C;  2V4I B;  1JRP A;  1V86 A;  4P16 A;  3DBR I;  2HDE A;  3BIN A;  3ZNZ B;  3A9J B;  4NJ7 A;  3ZTD A;  2FCM A;  1F52 A;  2BGF A;  4GDL A;  2INN E;  2K5P A;  1AAR A;  2MEK A;  3DBR B;  2V0G A;  4HRO A;  3TUO A;  4IM0 A;  4RM9 A;  2L1A A;  3ZW3 A;  4WIP A;  1ISN A;  1SEB D;  1UWX A;  3MP9 A;  2MHJ A;  3R3M A;  5IOI A;  1KLV A;  4OW0 A;  2NBW B;  4K7S A;  1XEE A;  1N6Z A;  3FIL B;  3H7S A;  2MJE A;  2G4S A;  4JWS C;  1U4A A;  2RSU A;  2JQR B;  3B1L X;  4HEA 1;  3DHH C;  4A6Q A;  4AJY B;  1QOF A;  3APF A;  5IN7 A;  1N60 A;  2HD5 B;  1KM7 A;  3GS2 A;  1QOA A;  3VVW B;  2HJ8 A;  2RMM A;  3AE7 B;  2CHZ A;  4REZ A;  3CSF A;  2KN4 A;  3RNF C;  4ZRJ A;  4H2A A;  1T0S C;  1MHX A;  1JWM D;  2IO0 B;  4C7Z A;  1J0G A;  3I3T B;  4GGQ A;  4J3O D;  1UF0 A;  2D07 B;  3IBE A;  4CO7 A;  3RFZ B;  2G45 B;  3PPA A;  2KDI A;  4LNN A;  1E8W A;  3NVV A;  1WGY A;  3Q8C A;  3VAW A;  4RM8 A;  3QJZ A;  3DPD A;  2WXJ A;  4DXF A;  2DX5 B;  2AYO B;  2KJR A;  5JHB A;  1PGX A;  4N9F 4;  2WDV B;  1KLU D;  4TQ1 A;  1QF6 A;  3L16 A;  2IGG A;  1FO4 A;  5TR5 A;  3AEG B;  2DYB A;  2VZK B;  1WXS A;  4FJV B;  1QOB A;  5D94 A;  2IO3 B;  5JXV A;  2K8H A;  2IZV B;  2LGY A;  2NBU A;  4PK1 A;  1L0Y B;  5MPO A;  2PIA A;  3L08 A;  1V97 A;  3EFC A;  2XK5 B;  4YWG G;  1C77 A;  1LXD A;  3VR9 B;  1UUP A;  2LHE A;  4TMA B;  4EZK A;  4ZRI A;  1WMH A;  3W9C B;  2N1W A;  3OAW A;  4EE2 A;  5LXI B;  1H8C A;  4AOF A;  4C56 C;  2FCN A;  4TKN A;  4WWO A;  2K0P A;  3MC0 B;  4IM3 A;  1WE7 A;  2IGD A;  3TSS A;  3AM9 A;  1YX5 B;  2IND C;  1TS4 A;  2AEH A;  3Q8E A;  2DZJ A;  2KQ4 X;  2IO1 B;  3OG5 A;  1Q5W B;  1FEH A;  1JWB D;  3BII D;  4DXA B;  2ZJD A;  4OZA A;  1R4N I;  2WDQ B;  4G11 A;  5G5G A;  3W1S C;  4NJC A;  4XGA B;  1WJN A;  4IWO A;  2BTE A;  2BB5 A;  1E7V A;  2MBO A;  3VH3 B;  5E6N A;  1FRD A;  5AUK A;  3RMK C;  1R4N B;  1OTR B;  3U52 E;  2LUM A;  4KZ0 A;  1L6U A;  1UWM A;  3C19 A;  3PHW B;  2J52 A;  2KAJ A;  1FXT B;  2YVC A;  4HKZ E;  1D6E C;  1KH0 A;  2BWE S;  2J53 A;  3VTW A;  2BVC A;  1HZ5 A;  2LRW A;  2VH2 A;  3C0R B;  2ZPY A;  3A1Q B;  3U7D A;  1S3S G;  4L23 A;  2DBY A;  3H6N A;  3ZNH B;  3ZJT A;  3GE3 C;  1D5M C;  1ET9 A;  2FCS A;  3N30 A;  2PJH A;  1V2Y A;  1TS2 A;  4EFO A;  1QLB B;  2KO3 A;  3N1Z C;  3QA8 A;  4ITK A;  3KUD B;  3KVF B;  2PPH A;  4TUU A;  1K52 A;  1FPY A;  4J6I A;  4D2K A;  2I38 A;  1C4C A;  2ONQ A;  2AQ2 B;  2MJD A;  2O2V B;  2TSS A;  2WXO A;  3CST A;  3AE6 B;  2BB6 A;  1OQR A;  2L52 A;  3L10 B;  4XDC A;  2WLB A;  3QQ8 B;  4WJQ A;  2N9K A;  2QCZ A;  2LEK A;  4K3B A;  4WJO A;  3KLS X;  2GOW A;  4IG7 B;  4ZOH C;  1VR9 A;  2C7H A;  2J0J A;  3Q8B A;  3WAO A;  2KHW B;  1TTN A;  2E6X A;  1NBF C;  4KIK B;  4FHK A;  3Q3J A;  4WJN A;  1NYQ A;  3JSV A;  3UIP B;  4HCP B;  2QIE B;  5G5H A;  4BAX A;  4ZYN A;  4XZ4 A;  3UQA A;  3ZGZ A;  2KN5 A;  1MFW A;  4JE3 B;  5CTR C;  2JT4 B;  2NVU I;  1RM6 C;  4DHJ D;  3TEZ A;  2LXA A;  3ZTC A;  2DLB A;  3K9P B;  4O1N A;  3W5V B;  3VRA B;  2WDT B;  2XNA C;  4MDK E;  2KDB A;  4B9K A;  3IT6 B;  5BO4 B;  4RGT A;  1HA5 A;  2N1V A;  4MGY E;  1NYR A;  3UQB A;  2PEA A;  3RZF A;  2JYE A;  3DHG C;  4HPL B;  4PT5 A;  3WAM A;  3HUI A;  1I35 A;  2IO2 B;  4NY0 A;  3AE4 B;  3V60 A;  2DZM A;  2KAN A;  3KH0 A;  4BOZ B;  1TT5 B;  2NBV B;  1V1P A;  4LDT B;  1IYF A;  2MH7 A;  2W55 A;  2JYT A;  2RGF A;  3HIZ A;  4MEL A;  1TS3 A;  2AX5 A;  4RFB A;  2Q5W D;  2D3A A;  3NHE B;  2BS4 B;  3Q14 C;  4XWT A;  3QAR A;  2CKH B;  4M0W A;  4HPM B;  1J7B A;  2JY6 A;  2KJH B;  2WXR A;  5FK9 C;  2MQJ A;  4WJP A;  2KDM A;  4XE0 A;  1YJJ A;  1MVK A;  1YOV B;  3E9S A;  3W5U B;  1N63 A;  4CYE A;  2BW2 A;  5AEK B;  4KDL B;  1N62 A;  3U7Z A;  2PVG C;  2G9H D;  2R61 A;  1C1Y B;  2KVR A;  4GN1 A;  1WM2 A;  4ZRQ A;  1ZXH A;  2KTF A;  3A9K A;  3PLU A;  4C4V B;  4RGO S;  2D11 A;  2LGD A;  1DGJ A;  3VR8 B;  4GXB A;  1SGH A;  4AWJ A;  1ZW7 A;  4AJW A;  1P0R A;  4DDG D;  4I6P A;  2ACZ B;  4E3C A;  1XCT L;  2JPH A;  3DVG X;  3GOE A;  1T0Q C;  1UBQ A;  4K81 A;  3U2S C;  5BYR A;  2MSE D;  2WS3 B;  4HVB A;  1JWA D;  1KTK A;  3SU8 X;  1L4Z B;  2BYV E;  2N0S B;  3BZD B;  2BQQ A;  1H4R A;  2ZCC A;  4RCO A;  1FNV A;  3DQV A;  1GNU A;  2EMT A;  5HHD G;  1K53 A;  1VZ7 A;  2PTL A;  1T5X D;  3ZXR A;  4EEW A;  4IKG A;  2O6V B;  1YN4 A;  4TSS A;  4F8C B;  2Z59 B;  4M8M A;  3PZ8 A;  2K1F A;  1V8C A;  2Z8L A;  3VUX A;  3PRM B;  2D3B A;  2MJ3 A;  1E10 A;  3NVZ A;  4RH6 A;  1V49 A;  3URY A;  1J19 A;  3ZKJ C;  2WNM A;  1UEL A;  1E8Z A;  2WYQ A;  2C7M B;  3B9J A;  3V62 A;  1YJ1 A;  3EFU A;  3A33 B;  3KYD D;  3CWI A;  4PS3 A;  2IGH A;  2KFJ A;  1WGR A;  3RZW C;  3ZRC A;  1TJE A;  3BY4 B;  4FUL A;  1P3Q U;  4GSW A;  1WYW B;  3QIJ A;  5C2T B;  3DOW A;  2JRI B;  2BKR B;  4EKU A;  1WFY A;  1QZE A;  3Q3M C;  2J7Q B;  1GC7 A;  3NVY A;  4NQK E;  1P1A A;  1AW7 A;  3MHS D;  1FIQ A;  3PZ7 A;  5FR6 A;  5DPT A;  2L32 A;  3L0W B;  1MJD A;  4ZYS A;  3I57 A;  5JZE B;  4ICU A;  2NPT B;  3RNA C;  1YQ4 B;  1Z2M A;  3DBL I;  4MM3 A;  4W9D A;  1RFK A;  2K22 A;  2INC C;  3NZ3 A;  3KWL A;  5GMV A;  2JF5 A;  4LNK A;  3VFK A;  4DDI D;  2KLC A;  4LNF A;  1J7A A;  1V1O A;  3DBL B;  1KRH A;  4KV2 A;  2MLB A;  2LFI A;  5CHW A;  4A90 A;  1EWY C;  4BKS A;  1HTO A;  1F2R I;  1DOX A;  4ARI A;  1IGC A;  2CU1 A;  3R2I A;  1EUV B;  4BBN C;  1AN8 A;  3LJ3 A;  1VCB A;  1J7C A;  2HJ1 A;  3PSE B;  2HTM E;  1ESF A;  4OZC A;  1WXA A;  2YEP F;  4KX6 B;  4WAA A;  4R3D A;  2WDR B;  1WXM A;  2KDE B;  3NZU A;  1Q10 A;  1I42 A;  5J2R A;  4YT0 B;  4C80 A;  3Q3O C;  3WAP A;  3WIM A;  3VH4 B;  5AUI A;  3NS1 A;  1F2R C;  1FCL A;  4ARC A;  2WXG A;  3PGE A;  2W3S A;  2PMV A;  2FE8 A;  1PGA A;  4PS8 A;  4C00 A;  1STE A;  3AXC A;  1I4G A;  1FRR A;  2JZ3 B;  1TKE A;  4N6E B;  3R7Q A;  1WZ3 A;  1OEY A;  5E6J A;  1UZX B;  2JU6 X;  4HCN B;  4G3X B;  2L76 A;  2WXH A;  3KQ4 A;  2E3T A;  4K7W A;  1WH3 A;  4NJ6 A;  4PS7 A;  3EHV A;  4LNO A;  1ENF A;  1TGZ B;  1D5Z C;  3ZLZ A;  2O6V D;  4NAW B;  2AQ1 B;  4RF1 A;  3M62 B;  2K25 A;  2GBJ A;  4GMV A;  4GDK B;  1FCC C;  1JWU D;  3L54 A;  2N7J A;  2KMM A;  3T9L A;  5AZH A;  3W2D A;  4KGT A;  3PRZ A;  1JML A;  3ZDT A;  4B6W A;  3MFG A;  1EF5 A;  3RNE C;  5BYQ A;  2GMI C;  3ZYY X;  3Q69 A;  4BFR A;  2MP2 A;  1NVI D;  3VXW A;  1I4Q A;  4ANU A;  4JLC A;  3AEC B;  2MA9 B;  4DHZ E;  2QHO A;  1WR1 A;  2PE9 A;  1IBX A;  2LRU A;  2L7R A;  1WYG A;  1WM3 A;  3H8H A;  1QOG A;  4M01 A;  3QC8 B;  3TL5 A;  2JWZ A;  2V3N A;  3U30 A;  1FXA A;  4MH0 E;  2RR9 A;  5IA7 A;  4G0N B;  3UIO B;  3RYT A;  3SR6 A;  1ZDX A;  3HRD D;  3H7P A;  2KWD A;  4E71 A;  2RPQ A;  3BYY B;  2LUE A;  3RNC C;  3DHI C;  4KGS A;  3AE3 B;  3UF8 A;  5IKC M;  2H88 B;  1L2N A;  4HK2 A;  4RMA A;  3AE9 B;  1XLP A;  2GBN A; 
#chains in the Genus database with same CATH homology
 4YSY B;  2QSD A;  4WH4 A;  4MH8 A;  5G5H A;  1DOI A;  2IDY A;  2QIL A;  2X38 A;  3AN1 A;  2QMT A;  2G1E A;  1DYQ A;  5BMH A;  1MI0 A;  5D3I B;  4KGR A;  1BUI C;  1HEZ E;  1E6E B;  3ZGZ A;  1FM0 D;  3NVW A;  1YQ3 B;  2PVO D;  1TZO A;  4JE3 B;  3N9Y C;  4WWM A;  1CJE A;  1RM6 C;  1FFU A;  3TEZ A;  4B0M A;  1ZUD 2;  4GDL B;  2WXF A;  4HRS A;  2DLB A;  1WGK A;  3BVG A;  4O1N A;  2QEJ C;  3W5V B;  3VRA B;  3V05 A;  2JX5 A;  3BWU D;  4KKI A;  4YSX B;  1GB1 A;  2XNA C;  3ZJV A;  1JCK B;  1C9F A;  3DWG C;  3AE1 B;  3PO0 A;  3P4Q B;  2Y5P A;  2NTT A;  3IT6 B;  3R8B A;  1KF6 B;  4RGT A;  1HA5 A;  4GLS C;  3VQI A;  2ZW1 A;  3L4P A;  1NYR A;  2INP E;  1E0Z A;  2WXM A;  2GRI A;  2CJN A;  3B2G A;  2EKI A;  3U4E G;  1CK1 A;  2JYE A;  1JRO A;  4PT5 A;  3HUI A;  1SE3 A;  1VLB A;  3BK2 A;  2H89 B;  2W82 A;  3AE4 B;  1WSP A;  2GB1 A;  2LGI A;  1VDV A;  3P4S B;  1RYJ A;  1EM7 A;  3SFE B;  4YTP B;  2WU5 B;  4WAF A;  3P4R B;  2LHD A;  1V1P A;  3KWV A;  2CJO A;  1B9R A;  3AEB B;  5GXG B;  2YEP B;  1EWC A;  5EE3 A;  2MH7 A;  2W55 A;  3ETR A;  1F77 A;  1LO5 D;  2OED A;  2JYT A;  1UNS A;  4HKQ A;  4AQ7 A;  1XCQ L;  2QJL A;  1D4B A;  1TS3 A;  1VRA B;  3B2F A;  5C3J B;  2AX5 A;  4RFB A;  1M4V A;  2Q5W D;  5HI1 A;  2BS4 B;  3AEA B;  2NMQ A;  4XWT A;  1C4A A;  1IGD A;  1OQQ A;  1FFV A;  1TYG B;  4JWU C;  3BVZ A;  4RGM A;  4M0W A;  1FNW A;  2EEL A;  5HG2 A;  1J7B A;  2RDH A;  3P42 A;  1N5X A;  1L6V A;  1CQV A;  2WXR A;  2AQ3 B;  2BS2 B;  5FK9 C;  1EU4 A;  1NEN B;  5EE9 A;  2W54 A;  2KDM A;  4XE0 A;  1YJJ A;  4AS1 A;  2D5G A;  2JXT A;  1MVK A;  3AE8 B;  4YTN B;  1YN3 A;  3E9S A;  3W5U B;  2FBW B;  1N63 A;  5LNK 1;  3EA6 A;  3E56 A;  5D3D A;  3V3X A;  1BXT A;  2BW2 A;  1GOZ A;  1N62 A;  3U7Z A;  2PVG C;  1XLQ A;  2G9H D;  2R61 A;  4MM3 B;  1KFY B;  4IOI E;  3AE5 B;  1QIL A;  1YNT E;  1XXG A;  2Y3A A;  3DWM A;  3Q8F A;  4ZRQ A;  4XWW A;  1F0Z A;  1ZXH A;  3AV8 A;  3J9C A;  2WXQ A;  3P63 A;  3AB5 A;  2BBC A;  4RGO S;  5TSS A;  1DGJ A;  1ZXI A;  4JPS A;  3VR8 B;  1GB4 A;  1E7P B;  3LXF A;  2PKO A;  2SAK A;  1I4H A;  1XLN A;  4RF0 A;  2K9X A;  2NTS A;  1TY2 A;  2M19 A;  1HQR D;  1L5P A;  2ACZ B;  1ROE A;  1XCT L;  2JZP A;  2BT6 A;  5HFY A;  3C8Y A;  1JQ4 A;  1VJK A;  1D5X C;  4WUR A;  3U2S C;  5BYR A;  3FC4 A;  2J4X A;  4OVZ A;  2WU2 B;  1TS5 A;  3W1S A;  2V4I B;  1HZ6 A;  2WS3 B;  3IAM 1;  4A8X C;  1JRP A;  3AMZ A;  4DQO C;  1JWA D;  4N59 A;  1KTK A;  2HDE A;  4P16 A;  1E9M A;  1L4Z B;  2VZK D;  2DYO A;  2LJI A;  2N0S B;  1SE4 A;  3BZD B;  5T8I A;  4RCO A;  1FNV A;  3AEE B;  1SXT A;  3Q8A A;  1ZOY B;  1C4P A;  2INN E;  1YJI A;  2K5P A;  3OWE B;  2MEK A;  1PDX A;  5HHD G;  1K53 A;  1VZ7 A;  2V0G A;  2PTL A;  2PW9 A;  1T5X D;  4MAC A;  4HRO A;  4UDU C;  1ET6 A;  3TUO A;  1EU3 A;  4IKG A;  4ZHO A;  1YN4 A;  2L1A A;  4WIP A;  4TSS A;  1SEB D;  1UWX A;  3MP9 A;  4HJG E;  2N9L A;  5EE1 A;  1T6B X;  2FUG 1;  3EUB 2;  1SB3 C;  3PZ8 A;  1V8C A;  2Z8L A;  4OW0 A;  2MJ3 A;  1E10 A;  2V3P A;  3NVZ A;  2WXI A;  4RH6 A;  3URY A;  1XEE A;  3FIL B;  2MJE A;  2WNM A;  4A9A A;  1IUE A;  1DOY A;  3B9J A;  4JWS C;  2JQR B;  2GI9 A;  4HEA 1;  4A6Q A;  1SJH D;  3CWI A;  1QOF A;  3AE2 B;  4DXG A;  2BYT A;  5EE0 A;  1N60 A;  1R7S A;  1VZ6 A;  2IGH A;  1A70 A;  1QKZ A;  1WXQ A;  3GS2 A;  1QOA A;  4OHJ A;  2RMM A;  1TJE A;  1SSN A;  3TEX A;  5BMI A;  1GAQ B;  3AE7 B;  4IDI A;  3HVD A;  1ZPS A;  4N58 A;  4REZ A;  2L83 A;  5C2T B;  2KN4 A;  3NRZ A;  4H2A A;  4USA A;  1AWD A;  2M0A A;  3UI3 A;  4P6V F;  1MHX A;  1JWM D;  3I9V 1;  1ACC A;  4C7Z A;  3RPF C;  3NVY A;  2CU3 A;  4XDD A;  1I4R A;  5D7G A;  4Q2J A;  1I4P A;  1AW7 A;  4J3O D;  1FIQ A;  1TY0 A;  3PZ7 A;  5FR3 A;  1ZP0 B;  1N5W A;  5FKA C;  3RFZ B;  2L32 A;  4L1B A;  1JWS D;  1VZ8 A;  3AH7 A;  4ZYS A;  3I57 A;  1YMH E;  1MPE A;  3NVV A;  2BS3 B;  3Q8C A;  3LYY A;  1YQ4 B;  3P4P B;  2WXJ A;  2W3R A;  2IPK D;  4DXF A;  1OFF A;  2WXK A;  3O13 A;  4LTU A;  2SEB D;  1PGX A;  1KLG D;  1RFK A;  1PGB A;  1ZE3 D;  2K22 A;  2WDV B;  2WXN A;  1KLU D;  3NZ3 A;  4TQ1 A;  1QF6 A;  4B0E A;  3KWL A;  1K51 A;  2J42 A;  2IGG A;  1FO4 A;  3AEG B;  1IBX B;  5BYS A;  1B1Z A;  1J7A A;  1V1O A;  2VZK B;  1KRH A;  4ZRP A;  4TQ0 A;  1SIJ A;  3IAS 1;  2LFI A;  4OZB A;  4WQM A;  4A90 A;  1EWY C;  2M56 B;  2I2Y A;  1F2R I;  4KKJ A;  1FMA D;  1QOB A;  1DOX A;  1ZDV A;  4ARI A;  5JXV A;  1IGC A;  2IJ0 A;  4CQN A;  3R2I A;  1L0Y B;  3T3N A;  5MPO A;  1FD6 A;  1AN8 A;  2PIA A;  3R2T A;  4ZHP A;  1V97 A;  1J7C A;  1L0V B;  1RWS A;  4YWG G;  1C77 A;  1UGJ A;  3CIR B;  3WCQ A;  2HTM E;  1ESF A;  3VR9 B;  1SJE D;  3EGR A;  1MHH E;  1UUP A;  4OZC A;  4KX6 B;  2YEP F;  2LHE A;  4TMA B;  4R3D A;  2WDR B;  3FAH A;  1BML C;  4RGN A;  1Q10 A;  3BVM A;  1SE2 A;  1NEK B;  1WRI A;  4YT0 B;  3W9C B;  4C80 A;  2RPV A;  4EE2 A;  5AUI A;  1JW9 D;  1QT9 A;  2OHF A;  3NS1 A;  4C56 C;  1F2R C;  1FCL A;  4ARC A;  2WXP A;  2WXG A;  2K0P A;  3MC0 B;  1AYF A;  3FIL A;  2JWU A;  2W3S A;  2PMV A;  2XN9 C;  4US8 A;  3ZJU A;  2FE8 A;  2IGD A;  1SBB B;  1PGA A;  3TSS A;  3AM9 A;  1STE A;  1I4G A;  3AEF B;  1TS4 A;  4YTM B;  1PFD A;  1FRR A;  3Q8E A;  1YN5 A;  2KQ4 X;  1TKE A;  1I7H A;  4N6E B;  1FEH A;  3BII D;  1JWB D;  4YXD B;  4RNA A;  2DYM A;  4OZA A;  3BK1 A;  5H92 C;  3SFD B;  4LK0 M;  5E6J A;  1XO3 A;  2WDQ B;  1SF0 A;  5G5G A;  2JU6 X;  4NJC A;  2B76 B;  2WXH A;  3KQ4 A;  2E3T A;  2BTE A;  2BB5 A;  1I4X A;  4YSZ B;  2ZW0 A;  3AED B;  3GB1 A;  3MJ5 A;  4JX1 C;  3HVZ A;  1PYW D;  1FRD A;  5AUK A;  2PLP A;  3U52 E;  1ENF A;  1D5Z C;  2LUM A;  1QQR A;  1NI3 A;  1L6U A;  4NZL B;  1UWM A;  4LLG M;  2J52 A;  2KAJ A;  4HKZ E;  4NAW B;  2AQ1 B;  4RF1 A;  2RDG A;  1C78 A;  1D6E C;  1KH0 A;  3LB8 C;  4MT5 A;  2J53 A;  4GDK B;  3SEB A;  3VRB B;  4C7Y A;  1HZ5 A;  1V1P B;  3P1M A;  4FXC A;  3T3O A;  1FCC C;  2WP9 B;  1JWU D;  4L23 A;  2N7J A;  2DBY A;  1Y56 A;  2KMM A;  3IT4 B;  3W2D A;  3ZJT A;  4KGT A;  1D5M C;  1JML A;  1ET9 A;  1GPX A;  3MFG A;  5BYQ A;  1JAL A;  3ZYY X;  3Q69 A;  5I4D A;  1WWT A;  1NVI D;  1TS2 A;  1K50 A;  1QLB B;  1I4Q A;  4A55 A;  3AEC B;  4ITK A;  5H8Y E;  1FXI A;  2WXL A;  5BMG A;  1IBX A;  3BYT B;  1K52 A;  1WYG A;  3H8H A;  4L2Y A;  2DWQ A;  2K3U A;  1N61 A;  1QOG A;  1TKG A;  2I38 A;  4D2K A;  1PUT A;  1C4C A;  2ONQ A;  2AQ2 B;  2ICI A;  1P7E A;  2MJD A;  1L0X B;  1XLO A;  2TSS A;  2WXO A;  2V3N A;  2Y5C A;  3AE6 B;  1FXA A;  2BB6 A;  1OQR A;  2L52 A;  2ON8 A;  4XDC A;  2WLB A;  2N9K A;  1L4D B;  3MHZ A;  2LEK A;  1FNU A;  1T3Q A;  2JSV X;  3IXS A;  3KLS X;  4NAM A;  3ABV B;  1ZDX A;  3SR6 A;  3HRD D;  2LMC A;  1XF5 L;  2KWD A;  1TKY A;  4ZOH C;  1VR9 A;  3BYY B;  3Q8B A;  3NUH B;  4KGS A;  3TEW A;  3AE3 B;  1C79 A;  1CZP A;  2KAC A;  2E6X A;  3TEY A;  1C76 A;  2H88 B;  3GP7 A;  2WQY B;  1HXY D;  1NYQ A;  3AE9 B;  1XLP A;  3ZQ4 A;  4US9 A;  2QIE B;  1P7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...