2DNFA

Solution structure of rsgi ruh-062, a dcx domain from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
b'GSSGSSGRKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLRSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYGELLFDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Doublecortin domain-containing protein 2
publication title Solution structure of RSGI RUH-062, a DCX domain from human
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 2dnfA01
5IP4D 5IOIA 1MJDA 5IO9A 1MFWA 1MG4A 2BQQA 5IKCM 2DNFA 5IN7A 1UF0A
chains in the Genus database with same CATH superfamily
2LGSA 2HJ1A 3AEFB 1YIWA 1FD6A 3BYYB 4OZAA 3UQBA 1WYWB 3RN9C 1T0SC 5JZEB 4EFOA 2O6VB 4LLGM 1GOZA 3CMMB 2GBKA 1E6EB 2J42A 2RPQA 3ONSA 4G50A 3D32A 3L4PA 4K7UA 1XLNA 4ZRPA 2J53A 1NBFC 1TY2A 2J52A 3V3XA 5L95C 1BUIC 3QJZA 1WJNA 3RNGC 1ROEA 3GZNI 3ZTCA 2XN9C 3H7PA 3HUIA 1FM0D 2A5UA 3FILA 4GIVA 3RFZB 4QAYA 4REZA 2H89B 2IO1B 3GS2A 3R7RA 4MH8A 2IY0B 3PLUA 2MA9B 1TZ1A 5AEKB 3BK2A 4GGQA 3DPDA 1XF5L 2WXOA 3B2GA 3ZJTA 3NVYA 1V1PB 2KHWB 3ZQ4A 1D3ZA 2BS4B 1GUAB 5C2TB 4ZRQA 1PUTA 3ALBA 2I1KA 4TQ0A 2DWQA 1TT5B 2BWES 3T9LA 3NZUA 1XT9B 4BVUC 3SHQA 4ZYNA 3ECIA 1JQ4A 4TKNA 2C5LC 4LDTB 1XLQA 2W55A 2CR5A 5TSSA 2JRHA 4NPNA 1K51A 1R4NI 2LGYA 5KHOA 3L13A 2KN5A 1E0ZA 1TKYA 4O1NA 2EMTA 4ZRJA 3HVDA 3A1QA 4A8XC 1D6EC 3IHPC 4P1CC 5H8YE 3PSEB 3L10B 1NI2A 3WAOA 1L4ZB 3KWLA 5JXVA 3VUWA 1RFAA 1UGMA 3A33B 1TS5A 2KTRA 4II2B 3HM3A 3TEWA 2FCNA 2INNE 1WRIA 2HD5B 2LVPA 2YEPF 3VTWA 3NJTA 2X8XX 5CTRC 4P1BC 2IBIB 4WJOA 2VZKD 4HCPB 1E7PB 3BVMA 2NPTA 5HG2A 1WE7A 1GC6A 4ARIA 3ETRA 2PTLA 2MBEA 2K6QA 4NJ7A 1YX6B 3AE7B 3AEAB 4KKJA 3VR9B 4BBNF 2WQYB 1KRHA 4W9EA 3M62B 1C77A 3MP9A 3DHHC 4B0MA 5LXIB 3M95A 1YX5B 2FIDA 2K3UA 1HTQA 4DHZE 4C4VB 3NVZA 3DVNU 4IM0A 3GOEA 2WXKA 2MP2A 2D5GA 1WIAA 4PS3A 2FCQA 1XCQL 2LMCA 1WFYA 2NBWB 3DCGA 3I5JC 2KLCA 2KQSA 1P3QU 2JSVX 1IP9A 1SB3C 1WGKA 3U8ZA 4M00A 1SE3A 4JLCA 4W9CA 2KDBA 3HK0A 4WJNA 5BYSA 5BO4B 4EEWA 2V1YA 2ZW0A 3HIZA 5IO9A 1V81A 4NAWB 1TS2A 1L6UA 3AE2B 2KO3A 2KNBA 4PT5A 3RMKC 2RDHA 4HVBA 3U2SC 5H92C 3ZXVA 3H7SA 3L0WB 1WXVA 4URKA 1ZXHA 2NTSA 3RNAC 1XLPA 2LEKA 4WJPA 3V60A 5MPOA 4ARCA 2K1FA 1WX8A 2MJEA 1JROA 5IP4D 4MGYE 3V62A 4LNFA 4FA6A 2KVZA 4MELA 3ZNGC 4KIKB 1PDXA 2C7HA 2IGHA 2DENB 1E7UA 1STEA 3R66C 2Z0DB 2FNJB 2IPKD 1WGDA 4BOSC 1RRBA 2JXTA 1LXDA 2FCMA 1JWUD 5CHVC 1ACCA 5IOIA 1L4DB 1HA5A 3BZDB 3GE8C 2MBBB 3O65B 2DYBA 1OQRA 2CJOA 4OHJA 2M0AA 3A9KB 3RZWC 2ZCCA 2KX3A 2PKOA 2BYTA 3BVGA 2G3QB 3ZXRA 4KGTA 1WGRA 4WQMA 1AARA 2JZ3B 1ET6A 1KJTA 4EZKA 3QK0A 4BKGA 4EOYA 2G4DB 4XWWA 5DPWA 3VH3B 3AU5A 5AZFA 1JWSD 1VZ6A 4EZLA 4HWIB 2BS3B 3AE3B 3UQAA 2JUOA 4LTUA 3NY5A 2M56B 1VDVA 4TQ1A 3LDZE 4MJSB 1VLBA 3WALA 2KFKB 3UI3A 5CHFA 1L5PA 3PT2B 3C0RB 3AE1B 3BVZA 1E5WA 1UBQA 2UYZB 2L76A 5D2MB 2DYOA 1N62A 2HTHA 3DWGC 1UH6A 3Q3NC 1EF1A 1ZXIA 3PLVA 1QQRA 4NNJB 2AYOB 5EE0A 4BKSA 2J0KA 2WWZA 3KUZA 4HEA1 4BBNC 3NVVA 4L1BA 3ZDTA 4RF0A 1IYFA 1OEYJ 3WCQA 5EE9A 3AN1A 1V86A 2EKIA 2MP2B 3VUXA 1SF0A 3VDZA 1VD2A 2ZVNA 2Q5WD 4PS8A 3JSVB 3AM9A 3SDLC 2B76B 4NY0A 1JWAD 3DBHI 1D5XC 2WGSA 2W9NA 2D3CA 3AEEB 3T8MA 1GB4A 2PPHA 2WDVB 4W9IA 2K39A 4GB9A 2K0PA 3SEBA 4JX1C 3FC4A 3EFUA 3N1XC 3P2BA 3PREA 1WZ3A 2AQ3B 2J0MA 1YJ1A 2PVGC 1TKGA 5HKHA 2G9HD 3DVNV 4BZAA 3AE9B 2C9WB 4W9FA 2DZKA 3I57A 2VRRB 3W5VB 2DZMA 2M0XA 1C4CA 5EDSA 4P7IA 2XK5B 2N7DA 1ZP0B 1J8CA 2X38A 5BYQA 4AP4C 1PGXA 4IWPA 1OQQA 1DGJA 4IWOA 5G55A 1YD8U 2VZKB 1N5XA 2PW9A 4S17A 2LVOA 1FRDA 1V8CA 2L00B 2V4IB 3DBLI 5GMVA 5DPTA 3I3TB 3TSSA 1JALA 1I4XA 3R8BA 3IAS1 1AN8A 4NZLB 3UINB 4MGZE 3RD2A 5BMIA 2XNAC 3OJ4B 4FJZA 1GG3A 1WGGA 2DAFA 2RDBC 1C4PA 2IY1B 2KKCA 3N1ZC 3TCAA 1FIQA 3AH7A 2KDEB 2KQ7A 3KQ4A 5C1ZA 1WE6A 1UUPA 2WXJA 3P4QB 4NJCA 1E90A 2OEDA 3NS1A 4E74A 3A4SC 3ENEA 2FBWB 1T0RC 2KJHB 3Q3JA 1UGJA 1L0YB 2W82A 4L2YA 4YSYB 4K7WA 1EU3A 4ANVA 1XXGA 5LLIA 1FPYA 2N1WA 3QQ8B 3O13A 3KLSX 2MBHA 1KLVA 2YEPB 1KOTA 2BVCA 4WJQA 1FNVA 4GXBA 3AEDB 3PZ7A 4MDKE 3SD5A 1F9JA 2KMMA 3NHEB 3JYUA 2WYQA 3ZLZA 2ZEQA 1EWCA 1RAXA 4P6VF 4GDKA 2BYEA 3CSTA 2WDRB 1WX9A 2EELA 2WXMA 2N9EB 4XX5A 3PHXB 3RPFC 1HTOA 2K8CA 4H2AA 3Q8FA 3SFDB 1RLFA 2JYTA 3RNFC 1P1AA 3EHVA 1KF6B 4IG7B 1TTNA 1PGBA 4GN1A 2KN4A 2KTFA 4WAFA 2PMVA 1OEYA 2G1EA 3DHGC 1BXTA 2D2QA 3N9YC 4F8CB 3ZUNA 2ICIA 1F77A 2Z59B 4YT0B 4W9KA 1B1ZA 4II3B 2KDMA 3ZTDA 4RMAA 4GDLB 1CQVA 4YTPB 3EC8A 1F52A 2KACA 4A3OA 5G2NA 1WJ4A 5D94A 2MX2A 2KVRA 1E8XA 1FNUA 3PTFC 5D6JB 4DXAB 1ZPSA 2IYDB 1J19A 1QOGA 3CSFA 2MRPA 2I1JA 1T0QC 1XLOA 1QOBA 1PGAA 2NR2A 1WY8A 2PLPA 2D11A 4OVVA 4DHZB 3QCAA 3FKYA 4DXGA 1FXAA 3TEYA 4ICVA 4TMAB 4C7ZA 1GC7A 4B9KA 2PE9A 3V6CB 1J7CA 4K3CA 3Q3MC 1X1MA 2N9LA 1F1HA 2L0TA 1ZGUB 1FXTB 2L0FA 4XZ4A 1VJKA 1C1YB 4NAMA 4RGMA 1ISNA 2JT4B 4HPLB 1WR1A 4WAAA 2MBOA 2MSED 3OLMD 4MM3A 1P7EA 3KYDD 2E6XA 5C3JB 1TKEA 2C7MB 3HVZA 2D07B 2B3AA 2K8HA 3U52E 1PYWD 3BK1A 2WDQB 4DHJD 1IBXA 4ZRIA 2LFIA 4YSXB 2D3GA 1GJZA 1MFWA 5T8IA 3KH0A 4AWJA 3QAQA 1V5TA 3EUB2 1P0RA 3KW5B 2MW5A 2D3BA 4KDLB 1NENB 4C56C 3IT6B 2ZPNA 1UZXB 3N20C 3VR8B 2KANA 2WXLA 1EM7A 1E8ZA 4YTMB 3PV1A 2FUHB 1WGYA 3A9JB 4RNAA 5E6OA 2BF8B 1T0YA 4D2KA 2BPSA 3VUYA 1RM6C 2LZ6A 3PZDA 1VRAB 2C60A 1C76A 3VRAB 4L23A 3APDA 2K6DB 1SE9A 4LNKA 2R61A 1YQ3B 4W9LA 3MFGA 4WIPA 3AE8B 1S1QB 4UDUC 3R2TA 3NOBA 4ZOHC 1EO6A 2M8SA 1ESFA 1EUVB 2INPE 1NYQA 2OHFA 1JRUA 3N1YC 1C4AA 5C23A 1KFYB 2RDGA 4NQLB 1WYGA 4BAXA 3HHMA 2MJ3A 1V49A 4M0WA 2N1VA 4A90A 1Z2MA 2V3NA 4WH4A 4CQNA 2WLBA 2DZIA 4YXDB 3M3JA 2N0SB 2NBUA 3PPAA 3ZDMC 1E8YA 1FNWA 3H9DA 1DOIA 2K22A 2W3SA 1UELA 2LUMA 2O2VA 3VH4B 4B95A 4KSKC 1MHHE 4YSZB 3U30A 3TUOA 3APCA 1I4QA 1KTKA 2GB1A 3HM6X 3MJ5A 3RUIB 1AYFA 1WMHA 4I6LB 4FXCA 1TIFA 1NEKB 3AI5A 2JRIB 2L52A 4AS1A 1QILA 5D3IB 2V3SA 1F2RI 1I4PA 3I63C 2IZVB 4ASWC 4ANWA 1BMLC 3RZFA 1Y8RC 3VTVA 4A6QA 1I4HA 2AQ1B 5BMGA 5JHAA 2LASA 2WX0A 3GB1A 2GOWA 2WHIA 1FEHA 2L83A 1H8CA 3AV8A 1E9MA 3H7PB 4BKSD 2L05A 3FILB 1N61A 4YTNB 2JY6A 2KWVB 2MBQA 2BWFA 2LD9A 3A4RA 1WZ0A 2W3RA 1P9DU 3IBEA 3PZ8A 3EFCA 1S3SG 3P4SB 4IKGA 3W1YA 1IBXB 4C7YA 3L17A 2BB5A 2CKHB 1K52A 3LB8C 3UIOB 2J0JA 4R3DA 3QA8A 2GRIA 3WA0A 4DDGD 4WWOA 3S2AA 2BB6A 2Y5CA 1E10A 3KWVA 2J7QB 1ZDXA 1CJEA 4FADA 3A1QB 2LJ5A 2G45B 1XD3B 5TR5A 2CHXA 2KTRB 1ENFA 2NMQA 3TEXA 2FIFA 4I6NB 1SIFA 1WRDB 3I9V1 3PGEA 2RR9A 1NDDA 2BGFA 4MT5A 4MGKE 2LXAA 2NPTB 1IPGA 4W9HA 2IO2B 4N9F4 2SEBD 3UF8A 3QIJA 1L0XB 4HJKA 2KQ4X 4ZHOA 3VRBB 1P98A 1ET9A 2YLMA 2GBNA 4DDID 3PHWB 1MG8A 4AJWA 3B9JA 4K7SA 2UU7A 1SSNA 3B08A 4AOFA 3W2DA 2DAJA 1L2NA 1YMHE 5IKCM 1B9RA 1YQ4B 1EU4A 4ZDVA 4US9A 3VHTC 5EE1A 1NYRA 4KZCA 3E9SA 3TL5A 3OJ3A 4RM9A 4PK1A 1WXMA 2PJHA 1U4AA 1MI0A 2IGGA 4DHJB 1HZ5A 2L7RA 1PFDA 1UWMA 1YQBA 2FAZA 3V05A 2GLSA 2OJWA 4HPMB 1G6JA 1WJ6A 2BKFA 4RGOS 3VAWA 4ANXA 4AUQC 4FLHA 2V9HA 1VCBA 2VH1A 1FRRA 4KVGB 2ZNVC 4LNIA 3NUHB 4WWPA 4TSSA 1N6ZA 1IGDA 3P4PB 2HJ8A 2WU5B 1ZW7A 2LGIA 3DOWA 2WXQA 2AL3A 3B2FA 3PO0A 4NQKE 4G11A 4YL8A 1VZ8A 2GBJA 3PVLA 4XWTA 5J18A 4MH0E 2O6VA 4BKTA 2NS5A 4PS7A 2ZW1A 3AECB 4CHKA 2MHJA 2IJ0A 2R2OA 1WM2A 4TV3A 3ZRFA 1FXIA 1C3TA 1QOAA 2KAJA 3P42A 4JQWC 2WXRA 3AE5B 5IAAC 2HTME 2H88B 1Y56A 4HLEA 4DWFA 2CS4A 1WH3A 4MSMB 5FKAC 2AEHA 5IA7A 2M19A 5CHWA 4HJGE 1TJEA 5DPSA 2BYVE 3GP7A 1QKZA 4C00A 1QZEA 3ZNHB 2PEAA 2KJRA 4ACFA 4W9GA 3BWUD 1XCTL 1Q5WB 1J7AA 2LGXA 2MH7A 3B1LX 4K1RB 1V1PA 2BYFA 2JZZA 3X23A 1WM3A 3TJPA 5E6PA 2QSDA 2WU2B 4X57B 2QILA 3H1UA 4JE3B 4NJ6A 1OQYA 4LNOA 1RYJA 2M1MA 1VR9A 1JCKB 2NCNA 5AUIA 2V4LA 3P1MA 3AULA 3U7DA 2ASQA 1ZDVA 2Y5PA 2D3AA 1SGHA 4IW0A 2XEWA 3H8HA 1P7FA 1SXTA 1J0GA 4CYEA 1RFKA 4TUUA 4RGNA 1MHXA 2MWSB 2KMAA 4KGRA 5GXGB 2GBRA 2G4SA 4B0EA 5BMHA 3NS8A 3VTUA 3P4RB 4OZCA 5IN7A 1A5RA 1K53A 1KLGD 1OGWA 1WF9A 5HFYA 3MHZA 3ZVVA 3Q8AA 1C9FA 2MQJA 1KH0A 3TMPB 1FO4A 3C8YA 4KDIC 2QCZA 4ZYSA 2WP9B 1SIJA 1FFUA 3CF6E 4P16A 4HK2A 5L83A 1DOYA 1YJJA 4ITKA 5I4DA 1ZUD2 3DBRB 4FJYA 1R4MB 1NVID 3BIID 2TSSA 3URYA 2HDEA 1WXSA 4IUMB 2INCC 3AXCA 3QWZB 2KX0A 3OWEB 1GB1A 2NBVB 3TIXA 1SJED 1V2YA 2SAKA 1WXAA 3KYCD 2JWUA 2DYMA 3K9PB 3AB5A 1I4GA 3Q8CA 3SFEB 1D5MC 2R2QA 1HZ6A 4HCNB 1LQBA 1YN5A 3OAWA 2ZZPB 2WNMA 2KOXA 1CK1A 4NAWA 4FBJB 2DLBA 2RGFA 5E6NA 2IO3B 1KM7A 3WIMA 3KUCB 1V6EA 2BTEA 2D10A 2NTTA 3ML9A 3Q69A 4G3XB 2WS3B 2CU3A 3U4EG 4M02A 2BBCA 1XQQA 2LI5A 3DBSA 5LXHA 2MEKA 1HQRD 3ZYYX 2LWPA 3T3OA 4OW0A 5J17A 2IGDA 4FJVB 2WXFA 2I2YA 4JL9A 3AU4A 4KIKA 4W9JA 1L6VA 2ZCBA 1F0ZA 1DYQA 3ZJUA 3N3KB 2JQRB 3NG0A 3LXFA 1D4BA 2BS2B 1YN4A 4YWGG 1H4RA 2C7NB 1E8WA 4A55A 4C80A 1GAQB 4G0NB 2Z8LA 2I38A 2KT7A 2J4XA 4MGIE 2LGDA 4IWQA 5J2RA 1QT9A 1SE4A 4KV2A 3A9KA 2BW2A 4FHJA 1VZ7A 2RD0A 4GOCA 3IG3A 1HXYD 2QIEB 1UF0A 1SEBD 4IOIE 2DX5B 1V97A 4XDCA 1CZPA 4XYCA 3VQIA 3W1SA 4XDDA 2KDIA 3MTNB 1Q10A 3L08A 3ZGZA 3JW0X 3RYTA 1MVKA 1R7SA 4AJYB 1I4RA 3H6NA 2KMCA 4Q2JA 2OOBB 2PE6B 3Q3FA 1IUEA 3W5UB 3W1SC 2JPHA 4ZRKA 3L16A 4GDKB 4A20A 2JXXA 3TEZA 4IDIA 2QEJC 3RULA 2JYEA 2CJNA 5AZHA 2KC2A 2KLGA 3KUDB 4HRSA 4LK0M 2CU1A 1YOVB 1MG4A 4MJSA 3N30A 2K9XA 2KFKA 1TS3A 4IM2A 4W9DA 2INDC 4AQ7A 2KD0A 2MLBA 2Y5BB 3U7ZA 5FK9C 3APFA 5D7GA 1M4VA 2JVCA 4PYZA 2WXGA 4OVUA 1LFDA 4EE2A 2LHDA 4XE0A 4M8MA 1F2RC 4M01A 2HE7A 2GMIC 4M8NA 2KJ6A 2N7EA 5FR6A 3L54A 4RGTA 4WURA 4RFBA 2KZRA 3GZNB 4FN2A 1QOFA 1T5XD 4ICUA 2L1AA 2CHWA 1WR6E 3JSVA 2JWZA 5E6JA 2WX1A 2JX5A 1A70A 4A9AA 1KLUD 3BINA 1LM8B 2DNFA 2KDFB 4PYUA 4KX6B 4JPSA 2WXHA 2QHOA 5KHQA 3NZSA 4KGSA 2MJDA 1JWMD 2M17A 4CO7A 3OG5A 2LUEA 3Q2AC 4GMVA 1NI3A 2QJLA 1FMAD 1T3QA 4HKQA 3V6EB 2NVUI 2JF5A 2LVQA 1R4NB 3R7QA 3EA6A 3UGBB 4S0RA 3ZJVA 2XK5A 3X0WA 1WJUA 3SR6A 2BT6A 2PIAA 4MSQB 3RT3B 3NZ3A 4MM3B 3LYYA 3E56A 3IT4B 4WQOB 3N32A 4J6IA 2YVCA 2WXIA 4N6EB 2QC8A 4US8A 4HDOA 1XEEA 1L0VB 3QC8B 1YJIA 3DVGY 3Q3OC 2QDFA 2N7JA 1JW9D 1N63A 1I7HA 1QLBB 1DOXA 2K25A 1WXQA 2K8BA 2KYWA 3RCZA 4JWSC 1YN3A 3IAM1 2L3ZA 5DPRA 3AEGB 4JWUC 2V0GA 1AW7A 1C79A 3ML8A 3ZRCA 2KWCA 3DQVA 1MJDA 1I42A 2VH2A 3AE6B 2O6VD 2PVOD 4RCOA 4DBGA 2GI9A 1K8RB 3VVWB 1N60A 3DHIC 3VFKA 2LRUA 1WWTA 2L8JA 3MHSD 1I35A 4HDQA 2N9PC 1IGCA 1TBEA 1AWDA 1TY0A 4OZBA 3NVWA 1RWSA 1PQSA 4M0WB 2BQQA 2WDTB 3LJ3A 2ACZB 3R3MA 2K5PA 2IO0B 3ABVB 5HHDG 4A3PA 1GPXA 3QHTA 3EECA 3DWMA 2ZJDA 4BOZB 1HE8A 4FHKA 2BKRB 3CWIA 4HROA 3IVFA 1JRPA 1TGZB 4EUTA 4LJOB 5G5GA 3WANA 1UNSA 3AMZA 3BY4B 1EWYC 3DVGX 5DCNA 5EE3A 4MEMA 2O2VB 1LGRA 2RPVA 1Q1OA 3CIRB 5FR3A 1M94A 2REXA 1WX7A 4E3CA 1SJHD 1ZKHA 4LDTD 1WMHB 4WWMA 5G5HA 3MC9A 4GDLA 1OTRB 4JGHB 2KK8A 5AZGA 2WXPA 5JH5C 3PRMB 5JHBA 1Z5SB 4EKUA 4N59A 3RI7C 4XC2A 1GNUA 1LO5D 1ZE3D 1FCCC 3WAMA 3Q14C 3TBLD 3QARA 1YNTE 2KWDA 4IC7B 4OVZA 4HXDA 3V61A 2WXNA 4ZHPA 3IFWB 2M4NA 4IM3A 4K3BA 2N4FA 3P63A 2QMTA 2RSUA 3ZNID 2LRWA 1QF6A 4F1SA 1FCLA 1L7YA 4KKIA 4LCDE 4B6WA 2KWUB 3DBRI 3W9CB 1SBBB 3AEBB 1R4MI 4RF1A 4HKZE 5CX3A 3RNCC 3QX1A 3PS6A 3RNBC 4HPPA 2KC1A 4GSWA 3SU8X 3M63B 3MC8A 3PRPB 4GU2A 2OJRA 1ZOYB 1J7BA 3K9OB 4KZ0A 4JIOU 3Q8BA 2MCNB 1C78A 3RNEC 4BFRA 2Y3AA 2DHZA 3ZO5B 2V3PA 3UIPB 3HRDD 1XO3A 3T3NA 2ONQA 1BT0A 4N58A 3MJWA 1V9JA 2N9XA 2JZPA 4FULA 2IDYA 1TYGB 1TZOA 2EKEC 3R2IA 2W54A 1N5WA 1E7VA 3FAHA 3VXWA 2KFJA 2UWQA 2N9KA 2ZVOA 1OFFA 5D3DA 3NRZA 3ZKJC 1CMXB 1HEZE 3MC0B 1WGHA 4WWNA 1FFVA 2A4ZA 1WI0A 2LXCA 1V80A 1WSPA 2DZJA 3PRZA 5LNK1 3A9JA 4MACA 1V5OA 2ON8A 4XGAB 4ANUA 4RM8A 2EMSA 3ZIMA 5HI1A 3KVFB 3Q8EA 2LHEA 4DK5A 1MPEA 3DBHB 2ZPYA 3C19A 5AUKA 2CHZA 1UWXA 2GBMA 3JVZX 4DQOC 3ZNZB 2DBYA 4LNNA 2XBBC 3Q6BA 1EF5A 2AX5A 4USAA 1D5ZC 2Z0EB 3BYTB 3AE4B 5BYRA 1JWBD 3WAPA 1T6BX 2E3TA 4F7ZA 3B0AA 1SE2A 1JMLA 4EZJA 3ZW3A 3IXSA 4GLSC 2AQ2B 4LJPB 4E71A 1UD7A 2LJIA 1Q0WB 3DDCB 2RMMA 4C4VA 2FE8A 2FUG1 2L32A 1K50A 3GE3C 2AL6A 4K81A 2FCSA 2ZNVB 3J9CA 2KXJA 3EGRA 3DBLB 2JU6X 2AWTA 4KSLC 4I6PA 1V1OA 4J3OD 1UBIA 4RH6A 1TS4A 4DXFA
chains in the Genus database with same CATH topology
5IP4D 5IOIA 1MJDA 5IO9A 1MFWA 1MG4A 2BQQA 5IKCM 2DNFA 5IN7A 1UF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP4 D;  5IOI A;  1MJD A;  5IO9 A;  1MFW A;  1MG4 A;  2BQQ A;  5IKC M;  2DNF A;  5IN7 A;  1UF0 A; 
#chains in the Genus database with same CATH topology
 2LGS A;  2HJ1 A;  3AEF B;  1YIW A;  1FD6 A;  3BYY B;  4OZA A;  3UQB A;  1WYW B;  3RN9 C;  1T0S C;  5JZE B;  4EFO A;  2O6V B;  4LLG M;  1GOZ A;  3CMM B;  2GBK A;  1E6E B;  2J42 A;  2RPQ A;  3ONS A;  4G50 A;  3D32 A;  3L4P A;  4K7U A;  1XLN A;  4ZRP A;  2J53 A;  1NBF C;  1TY2 A;  2J52 A;  3V3X A;  5L95 C;  1BUI C;  3QJZ A;  1WJN A;  3RNG C;  1ROE A;  3GZN I;  3ZTC A;  2XN9 C;  3H7P A;  3HUI A;  1FM0 D;  2A5U A;  3FIL A;  4GIV A;  3RFZ B;  4QAY A;  4REZ A;  2H89 B;  2IO1 B;  3GS2 A;  3R7R A;  4MH8 A;  2IY0 B;  3PLU A;  2MA9 B;  1TZ1 A;  5AEK B;  3BK2 A;  4GGQ A;  3DPD A;  1XF5 L;  2WXO A;  3B2G A;  3ZJT A;  3NVY A;  1V1P B;  2KHW B;  3ZQ4 A;  1D3Z A;  2BS4 B;  1GUA B;  5C2T B;  4ZRQ A;  1PUT A;  3ALB A;  2I1K A;  4TQ0 A;  2DWQ A;  1TT5 B;  2BWE S;  3T9L A;  3NZU A;  1XT9 B;  4BVU C;  3SHQ A;  4ZYN A;  3ECI A;  1JQ4 A;  4TKN A;  2C5L C;  4LDT B;  1XLQ A;  2W55 A;  2CR5 A;  5TSS A;  2JRH A;  4NPN A;  1K51 A;  1R4N I;  2LGY A;  5KHO A;  3L13 A;  2KN5 A;  1E0Z A;  1TKY A;  4O1N A;  2EMT A;  4ZRJ A;  3HVD A;  3A1Q A;  4A8X C;  1D6E C;  3IHP C;  4P1C C;  5H8Y E;  3PSE B;  3L10 B;  1NI2 A;  3WAO A;  1L4Z B;  3KWL A;  5JXV A;  3VUW A;  1RFA A;  1UGM A;  3A33 B;  1TS5 A;  2KTR A;  4II2 B;  3HM3 A;  3TEW A;  2FCN A;  2INN E;  1WRI A;  2HD5 B;  2LVP A;  2YEP F;  3VTW A;  3NJT A;  2X8X X;  5CTR C;  4P1B C;  2IBI B;  4WJO A;  2VZK D;  4HCP B;  1E7P B;  3BVM A;  2NPT A;  5HG2 A;  1WE7 A;  1GC6 A;  4ARI A;  3ETR A;  2PTL A;  2MBE A;  2K6Q A;  4NJ7 A;  1YX6 B;  3AE7 B;  3AEA B;  4KKJ A;  3VR9 B;  4BBN F;  2WQY B;  1KRH A;  4W9E A;  3M62 B;  1C77 A;  3MP9 A;  3DHH C;  4B0M A;  5LXI B;  3M95 A;  1YX5 B;  2FID A;  2K3U A;  1HTQ A;  4DHZ E;  4C4V B;  3NVZ A;  3DVN U;  4IM0 A;  3GOE A;  2WXK A;  2MP2 A;  2D5G A;  1WIA A;  4PS3 A;  2FCQ A;  1XCQ L;  2LMC A;  1WFY A;  2NBW B;  3DCG A;  3I5J C;  2KLC A;  2KQS A;  1P3Q U;  2JSV X;  1IP9 A;  1SB3 C;  1WGK A;  3U8Z A;  4M00 A;  1SE3 A;  4JLC A;  4W9C A;  2KDB A;  3HK0 A;  4WJN A;  5BYS A;  5BO4 B;  4EEW A;  2V1Y A;  2ZW0 A;  3HIZ A;  5IO9 A;  1V81 A;  4NAW B;  1TS2 A;  1L6U A;  3AE2 B;  2KO3 A;  2KNB A;  4PT5 A;  3RMK C;  2RDH A;  4HVB A;  3U2S C;  5H92 C;  3ZXV A;  3H7S A;  3L0W B;  1WXV A;  4URK A;  1ZXH A;  2NTS A;  3RNA C;  1XLP A;  2LEK A;  4WJP A;  3V60 A;  5MPO A;  4ARC A;  2K1F A;  1WX8 A;  2MJE A;  1JRO A;  5IP4 D;  4MGY E;  3V62 A;  4LNF A;  4FA6 A;  2KVZ A;  4MEL A;  3ZNG C;  4KIK B;  1PDX A;  2C7H A;  2IGH A;  2DEN B;  1E7U A;  1STE A;  3R66 C;  2Z0D B;  2FNJ B;  2IPK D;  1WGD A;  4BOS C;  1RRB A;  2JXT A;  1LXD A;  2FCM A;  1JWU D;  5CHV C;  1ACC A;  5IOI A;  1L4D B;  1HA5 A;  3BZD B;  3GE8 C;  2MBB B;  3O65 B;  2DYB A;  1OQR A;  2CJO A;  4OHJ A;  2M0A A;  3A9K B;  3RZW C;  2ZCC A;  2KX3 A;  2PKO A;  2BYT A;  3BVG A;  2G3Q B;  3ZXR A;  4KGT A;  1WGR A;  4WQM A;  1AAR A;  2JZ3 B;  1ET6 A;  1KJT A;  4EZK A;  3QK0 A;  4BKG A;  4EOY A;  2G4D B;  4XWW A;  5DPW A;  3VH3 B;  3AU5 A;  5AZF A;  1JWS D;  1VZ6 A;  4EZL A;  4HWI B;  2BS3 B;  3AE3 B;  3UQA A;  2JUO A;  4LTU A;  3NY5 A;  2M56 B;  1VDV A;  4TQ1 A;  3LDZ E;  4MJS B;  1VLB A;  3WAL A;  2KFK B;  3UI3 A;  5CHF A;  1L5P A;  3PT2 B;  3C0R B;  3AE1 B;  3BVZ A;  1E5W A;  1UBQ A;  2UYZ B;  2L76 A;  5D2M B;  2DYO A;  1N62 A;  2HTH A;  3DWG C;  1UH6 A;  3Q3N C;  1EF1 A;  1ZXI A;  3PLV A;  1QQR A;  4NNJ B;  2AYO B;  5EE0 A;  4BKS A;  2J0K A;  2WWZ A;  3KUZ A;  4HEA 1;  4BBN C;  3NVV A;  4L1B A;  3ZDT A;  4RF0 A;  1IYF A;  1OEY J;  3WCQ A;  5EE9 A;  3AN1 A;  1V86 A;  2EKI A;  2MP2 B;  3VUX A;  1SF0 A;  3VDZ A;  1VD2 A;  2ZVN A;  2Q5W D;  4PS8 A;  3JSV B;  3AM9 A;  3SDL C;  2B76 B;  4NY0 A;  1JWA D;  3DBH I;  1D5X C;  2WGS A;  2W9N A;  2D3C A;  3AEE B;  3T8M A;  1GB4 A;  2PPH A;  2WDV B;  4W9I A;  2K39 A;  4GB9 A;  2K0P A;  3SEB A;  4JX1 C;  3FC4 A;  3EFU A;  3N1X C;  3P2B A;  3PRE A;  1WZ3 A;  2AQ3 B;  2J0M A;  1YJ1 A;  2PVG C;  1TKG A;  5HKH A;  2G9H D;  3DVN V;  4BZA A;  3AE9 B;  2C9W B;  4W9F A;  2DZK A;  3I57 A;  2VRR B;  3W5V B;  2DZM A;  2M0X A;  1C4C A;  5EDS A;  4P7I A;  2XK5 B;  2N7D A;  1ZP0 B;  1J8C A;  2X38 A;  5BYQ A;  4AP4 C;  1PGX A;  4IWP A;  1OQQ A;  1DGJ A;  4IWO A;  5G55 A;  1YD8 U;  2VZK B;  1N5X A;  2PW9 A;  4S17 A;  2LVO A;  1FRD A;  1V8C A;  2L00 B;  2V4I B;  3DBL I;  5GMV A;  5DPT A;  3I3T B;  3TSS A;  1JAL A;  1I4X A;  3R8B A;  3IAS 1;  1AN8 A;  4NZL B;  3UIN B;  4MGZ E;  3RD2 A;  5BMI A;  2XNA C;  3OJ4 B;  4FJZ A;  1GG3 A;  1WGG A;  2DAF A;  2RDB C;  1C4P A;  2IY1 B;  2KKC A;  3N1Z C;  3TCA A;  1FIQ A;  3AH7 A;  2KDE B;  2KQ7 A;  3KQ4 A;  5C1Z A;  1WE6 A;  1UUP A;  2WXJ A;  3P4Q B;  4NJC A;  1E90 A;  2OED A;  3NS1 A;  4E74 A;  3A4S C;  3ENE A;  2FBW B;  1T0R C;  2KJH B;  3Q3J A;  1UGJ A;  1L0Y B;  2W82 A;  4L2Y A;  4YSY B;  4K7W A;  1EU3 A;  4ANV A;  1XXG A;  5LLI A;  1FPY A;  2N1W A;  3QQ8 B;  3O13 A;  3KLS X;  2MBH A;  1KLV A;  2YEP B;  1KOT A;  2BVC A;  4WJQ A;  1FNV A;  4GXB A;  3AED B;  3PZ7 A;  4MDK E;  3SD5 A;  1F9J A;  2KMM A;  3NHE B;  3JYU A;  2WYQ A;  3ZLZ A;  2ZEQ A;  1EWC A;  1RAX A;  4P6V F;  4GDK A;  2BYE A;  3CST A;  2WDR B;  1WX9 A;  2EEL A;  2WXM A;  2N9E B;  4XX5 A;  3PHX B;  3RPF C;  1HTO A;  2K8C A;  4H2A A;  3Q8F A;  3SFD B;  1RLF A;  2JYT A;  3RNF C;  1P1A A;  3EHV A;  1KF6 B;  4IG7 B;  1TTN A;  1PGB A;  4GN1 A;  2KN4 A;  2KTF A;  4WAF A;  2PMV A;  1OEY A;  2G1E A;  3DHG C;  1BXT A;  2D2Q A;  3N9Y C;  4F8C B;  3ZUN A;  2ICI A;  1F77 A;  2Z59 B;  4YT0 B;  4W9K A;  1B1Z A;  4II3 B;  2KDM A;  3ZTD A;  4RMA A;  4GDL B;  1CQV A;  4YTP B;  3EC8 A;  1F52 A;  2KAC A;  4A3O A;  5G2N A;  1WJ4 A;  5D94 A;  2MX2 A;  2KVR A;  1E8X A;  1FNU A;  3PTF C;  5D6J B;  4DXA B;  1ZPS A;  2IYD B;  1J19 A;  1QOG A;  3CSF A;  2MRP A;  2I1J A;  1T0Q C;  1XLO A;  1QOB A;  1PGA A;  2NR2 A;  1WY8 A;  2PLP A;  2D11 A;  4OVV A;  4DHZ B;  3QCA A;  3FKY A;  4DXG A;  1FXA A;  3TEY A;  4ICV A;  4TMA B;  4C7Z A;  1GC7 A;  4B9K A;  2PE9 A;  3V6C B;  1J7C A;  4K3C A;  3Q3M C;  1X1M A;  2N9L A;  1F1H A;  2L0T A;  1ZGU B;  1FXT B;  2L0F A;  4XZ4 A;  1VJK A;  1C1Y B;  4NAM A;  4RGM A;  1ISN A;  2JT4 B;  4HPL B;  1WR1 A;  4WAA A;  2MBO A;  2MSE D;  3OLM D;  4MM3 A;  1P7E A;  3KYD D;  2E6X A;  5C3J B;  1TKE A;  2C7M B;  3HVZ A;  2D07 B;  2B3A A;  2K8H A;  3U52 E;  1PYW D;  3BK1 A;  2WDQ B;  4DHJ D;  1IBX A;  4ZRI A;  2LFI A;  4YSX B;  2D3G A;  1GJZ A;  1MFW A;  5T8I A;  3KH0 A;  4AWJ A;  3QAQ A;  1V5T A;  3EUB 2;  1P0R A;  3KW5 B;  2MW5 A;  2D3B A;  4KDL B;  1NEN B;  4C56 C;  3IT6 B;  2ZPN A;  1UZX B;  3N20 C;  3VR8 B;  2KAN A;  2WXL A;  1EM7 A;  1E8Z A;  4YTM B;  3PV1 A;  2FUH B;  1WGY A;  3A9J B;  4RNA A;  5E6O A;  2BF8 B;  1T0Y A;  4D2K A;  2BPS A;  3VUY A;  1RM6 C;  2LZ6 A;  3PZD A;  1VRA B;  2C60 A;  1C76 A;  3VRA B;  4L23 A;  3APD A;  2K6D B;  1SE9 A;  4LNK A;  2R61 A;  1YQ3 B;  4W9L A;  3MFG A;  4WIP A;  3AE8 B;  1S1Q B;  4UDU C;  3R2T A;  3NOB A;  4ZOH C;  1EO6 A;  2M8S A;  1ESF A;  1EUV B;  2INP E;  1NYQ A;  2OHF A;  1JRU A;  3N1Y C;  1C4A A;  5C23 A;  1KFY B;  2RDG A;  4NQL B;  1WYG A;  4BAX A;  3HHM A;  2MJ3 A;  1V49 A;  4M0W A;  2N1V A;  4A90 A;  1Z2M A;  2V3N A;  4WH4 A;  4CQN A;  2WLB A;  2DZI A;  4YXD B;  3M3J A;  2N0S B;  2NBU A;  3PPA A;  3ZDM C;  1E8Y A;  1FNW A;  3H9D A;  1DOI A;  2K22 A;  2W3S A;  1UEL A;  2LUM A;  2O2V A;  3VH4 B;  4B95 A;  4KSK C;  1MHH E;  4YSZ B;  3U30 A;  3TUO A;  3APC A;  1I4Q A;  1KTK A;  2GB1 A;  3HM6 X;  3MJ5 A;  3RUI B;  1AYF A;  1WMH A;  4I6L B;  4FXC A;  1TIF A;  1NEK B;  3AI5 A;  2JRI B;  2L52 A;  4AS1 A;  1QIL A;  5D3I B;  2V3S A;  1F2R I;  1I4P A;  3I63 C;  2IZV B;  4ASW C;  4ANW A;  1BML C;  3RZF A;  1Y8R C;  3VTV A;  4A6Q A;  1I4H A;  2AQ1 B;  5BMG A;  5JHA A;  2LAS A;  2WX0 A;  3GB1 A;  2GOW A;  2WHI A;  1FEH A;  2L83 A;  1H8C A;  3AV8 A;  1E9M A;  3H7P B;  4BKS D;  2L05 A;  3FIL B;  1N61 A;  4YTN B;  2JY6 A;  2KWV B;  2MBQ A;  2BWF A;  2LD9 A;  3A4R A;  1WZ0 A;  2W3R A;  1P9D U;  3IBE A;  3PZ8 A;  3EFC A;  1S3S G;  3P4S B;  4IKG A;  3W1Y A;  1IBX B;  4C7Y A;  3L17 A;  2BB5 A;  2CKH B;  1K52 A;  3LB8 C;  3UIO B;  2J0J A;  4R3D A;  3QA8 A;  2GRI A;  3WA0 A;  4DDG D;  4WWO A;  3S2A A;  2BB6 A;  2Y5C A;  1E10 A;  3KWV A;  2J7Q B;  1ZDX A;  1CJE A;  4FAD A;  3A1Q B;  2LJ5 A;  2G45 B;  1XD3 B;  5TR5 A;  2CHX A;  2KTR B;  1ENF A;  2NMQ A;  3TEX A;  2FIF A;  4I6N B;  1SIF A;  1WRD B;  3I9V 1;  3PGE A;  2RR9 A;  1NDD A;  2BGF A;  4MT5 A;  4MGK E;  2LXA A;  2NPT B;  1IPG A;  4W9H A;  2IO2 B;  4N9F 4;  2SEB D;  3UF8 A;  3QIJ A;  1L0X B;  4HJK A;  2KQ4 X;  4ZHO A;  3VRB B;  1P98 A;  1ET9 A;  2YLM A;  2GBN A;  4DDI D;  3PHW B;  1MG8 A;  4AJW A;  3B9J A;  4K7S A;  2UU7 A;  1SSN A;  3B08 A;  4AOF A;  3W2D A;  2DAJ A;  1L2N A;  1YMH E;  5IKC M;  1B9R A;  1YQ4 B;  1EU4 A;  4ZDV A;  4US9 A;  3VHT C;  5EE1 A;  1NYR A;  4KZC A;  3E9S A;  3TL5 A;  3OJ3 A;  4RM9 A;  4PK1 A;  1WXM A;  2PJH A;  1U4A A;  1MI0 A;  2IGG A;  4DHJ B;  1HZ5 A;  2L7R A;  1PFD A;  1UWM A;  1YQB A;  2FAZ A;  3V05 A;  2GLS A;  2OJW A;  4HPM B;  1G6J A;  1WJ6 A;  2BKF A;  4RGO S;  3VAW A;  4ANX A;  4AUQ C;  4FLH A;  2V9H A;  1VCB A;  2VH1 A;  1FRR A;  4KVG B;  2ZNV C;  4LNI A;  3NUH B;  4WWP A;  4TSS A;  1N6Z A;  1IGD A;  3P4P B;  2HJ8 A;  2WU5 B;  1ZW7 A;  2LGI A;  3DOW A;  2WXQ A;  2AL3 A;  3B2F A;  3PO0 A;  4NQK E;  4G11 A;  4YL8 A;  1VZ8 A;  2GBJ A;  3PVL A;  4XWT A;  5J18 A;  4MH0 E;  2O6V A;  4BKT A;  2NS5 A;  4PS7 A;  2ZW1 A;  3AEC B;  4CHK A;  2MHJ A;  2IJ0 A;  2R2O A;  1WM2 A;  4TV3 A;  3ZRF A;  1FXI A;  1C3T A;  1QOA A;  2KAJ A;  3P42 A;  4JQW C;  2WXR A;  3AE5 B;  5IAA C;  2HTM E;  2H88 B;  1Y56 A;  4HLE A;  4DWF A;  2CS4 A;  1WH3 A;  4MSM B;  5FKA C;  2AEH A;  5IA7 A;  2M19 A;  5CHW A;  4HJG E;  1TJE A;  5DPS A;  2BYV E;  3GP7 A;  1QKZ A;  4C00 A;  1QZE A;  3ZNH B;  2PEA A;  2KJR A;  4ACF A;  4W9G A;  3BWU D;  1XCT L;  1Q5W B;  1J7A A;  2LGX A;  2MH7 A;  3B1L X;  4K1R B;  1V1P A;  2BYF A;  2JZZ A;  3X23 A;  1WM3 A;  3TJP A;  5E6P A;  2QSD A;  2WU2 B;  4X57 B;  2QIL A;  3H1U A;  4JE3 B;  4NJ6 A;  1OQY A;  4LNO A;  1RYJ A;  2M1M A;  1VR9 A;  1JCK B;  2NCN A;  5AUI A;  2V4L A;  3P1M A;  3AUL A;  3U7D A;  2ASQ A;  1ZDV A;  2Y5P A;  2D3A A;  1SGH A;  4IW0 A;  2XEW A;  3H8H A;  1P7F A;  1SXT A;  1J0G A;  4CYE A;  1RFK A;  4TUU A;  4RGN A;  1MHX A;  2MWS B;  2KMA A;  4KGR A;  5GXG B;  2GBR A;  2G4S A;  4B0E A;  5BMH A;  3NS8 A;  3VTU A;  3P4R B;  4OZC A;  5IN7 A;  1A5R A;  1K53 A;  1KLG D;  1OGW A;  1WF9 A;  5HFY A;  3MHZ A;  3ZVV A;  3Q8A A;  1C9F A;  2MQJ A;  1KH0 A;  3TMP B;  1FO4 A;  3C8Y A;  4KDI C;  2QCZ A;  4ZYS A;  2WP9 B;  1SIJ A;  1FFU A;  3CF6 E;  4P16 A;  4HK2 A;  5L83 A;  1DOY A;  1YJJ A;  4ITK A;  5I4D A;  1ZUD 2;  3DBR B;  4FJY A;  1R4M B;  1NVI D;  3BII D;  2TSS A;  3URY A;  2HDE A;  1WXS A;  4IUM B;  2INC C;  3AXC A;  3QWZ B;  2KX0 A;  3OWE B;  1GB1 A;  2NBV B;  3TIX A;  1SJE D;  1V2Y A;  2SAK A;  1WXA A;  3KYC D;  2JWU A;  2DYM A;  3K9P B;  3AB5 A;  1I4G A;  3Q8C A;  3SFE B;  1D5M C;  2R2Q A;  1HZ6 A;  4HCN B;  1LQB A;  1YN5 A;  3OAW A;  2ZZP B;  2WNM A;  2KOX A;  1CK1 A;  4NAW A;  4FBJ B;  2DLB A;  2RGF A;  5E6N A;  2IO3 B;  1KM7 A;  3WIM A;  3KUC B;  1V6E A;  2BTE A;  2D10 A;  2NTT A;  3ML9 A;  3Q69 A;  4G3X B;  2WS3 B;  2CU3 A;  3U4E G;  4M02 A;  2BBC A;  1XQQ A;  2LI5 A;  3DBS A;  5LXH A;  2MEK A;  1HQR D;  3ZYY X;  2LWP A;  3T3O A;  4OW0 A;  5J17 A;  2IGD A;  4FJV B;  2WXF A;  2I2Y A;  4JL9 A;  3AU4 A;  4KIK A;  4W9J A;  1L6V A;  2ZCB A;  1F0Z A;  1DYQ A;  3ZJU A;  3N3K B;  2JQR B;  3NG0 A;  3LXF A;  1D4B A;  2BS2 B;  1YN4 A;  4YWG G;  1H4R A;  2C7N B;  1E8W A;  4A55 A;  4C80 A;  1GAQ B;  4G0N B;  2Z8L A;  2I38 A;  2KT7 A;  2J4X A;  4MGI E;  2LGD A;  4IWQ A;  5J2R A;  1QT9 A;  1SE4 A;  4KV2 A;  3A9K A;  2BW2 A;  4FHJ A;  1VZ7 A;  2RD0 A;  4GOC A;  3IG3 A;  1HXY D;  2QIE B;  1UF0 A;  1SEB D;  4IOI E;  2DX5 B;  1V97 A;  4XDC A;  1CZP A;  4XYC A;  3VQI A;  3W1S A;  4XDD A;  2KDI A;  3MTN B;  1Q10 A;  3L08 A;  3ZGZ A;  3JW0 X;  3RYT A;  1MVK A;  1R7S A;  4AJY B;  1I4R A;  3H6N A;  2KMC A;  4Q2J A;  2OOB B;  2PE6 B;  3Q3F A;  1IUE A;  3W5U B;  3W1S C;  2JPH A;  4ZRK A;  3L16 A;  4GDK B;  4A20 A;  2JXX A;  3TEZ A;  4IDI A;  2QEJ C;  3RUL A;  2JYE A;  2CJN A;  5AZH A;  2KC2 A;  2KLG A;  3KUD B;  4HRS A;  4LK0 M;  2CU1 A;  1YOV B;  1MG4 A;  4MJS A;  3N30 A;  2K9X A;  2KFK A;  1TS3 A;  4IM2 A;  4W9D A;  2IND C;  4AQ7 A;  2KD0 A;  2MLB A;  2Y5B B;  3U7Z A;  5FK9 C;  3APF A;  5D7G A;  1M4V A;  2JVC A;  4PYZ A;  2WXG A;  4OVU A;  1LFD A;  4EE2 A;  2LHD A;  4XE0 A;  4M8M A;  1F2R C;  4M01 A;  2HE7 A;  2GMI C;  4M8N A;  2KJ6 A;  2N7E A;  5FR6 A;  3L54 A;  4RGT A;  4WUR A;  4RFB A;  2KZR A;  3GZN B;  4FN2 A;  1QOF A;  1T5X D;  4ICU A;  2L1A A;  2CHW A;  1WR6 E;  3JSV A;  2JWZ A;  5E6J A;  2WX1 A;  2JX5 A;  1A70 A;  4A9A A;  1KLU D;  3BIN A;  1LM8 B;  2DNF A;  2KDF B;  4PYU A;  4KX6 B;  4JPS A;  2WXH A;  2QHO A;  5KHQ A;  3NZS A;  4KGS A;  2MJD A;  1JWM D;  2M17 A;  4CO7 A;  3OG5 A;  2LUE A;  3Q2A C;  4GMV A;  1NI3 A;  2QJL A;  1FMA D;  1T3Q A;  4HKQ A;  3V6E B;  2NVU I;  2JF5 A;  2LVQ A;  1R4N B;  3R7Q A;  3EA6 A;  3UGB B;  4S0R A;  3ZJV A;  2XK5 A;  3X0W A;  1WJU A;  3SR6 A;  2BT6 A;  2PIA A;  4MSQ B;  3RT3 B;  3NZ3 A;  4MM3 B;  3LYY A;  3E56 A;  3IT4 B;  4WQO B;  3N32 A;  4J6I A;  2YVC A;  2WXI A;  4N6E B;  2QC8 A;  4US8 A;  4HDO A;  1XEE A;  1L0V B;  3QC8 B;  1YJI A;  3DVG Y;  3Q3O C;  2QDF A;  2N7J A;  1JW9 D;  1N63 A;  1I7H A;  1QLB B;  1DOX A;  2K25 A;  1WXQ A;  2K8B A;  2KYW A;  3RCZ A;  4JWS C;  1YN3 A;  3IAM 1;  2L3Z A;  5DPR A;  3AEG B;  4JWU C;  2V0G A;  1AW7 A;  1C79 A;  3ML8 A;  3ZRC A;  2KWC A;  3DQV A;  1MJD A;  1I42 A;  2VH2 A;  3AE6 B;  2O6V D;  2PVO D;  4RCO A;  4DBG A;  2GI9 A;  1K8R B;  3VVW B;  1N60 A;  3DHI C;  3VFK A;  2LRU A;  1WWT A;  2L8J A;  3MHS D;  1I35 A;  4HDQ A;  2N9P C;  1IGC A;  1TBE A;  1AWD A;  1TY0 A;  4OZB A;  3NVW A;  1RWS A;  1PQS A;  4M0W B;  2BQQ A;  2WDT B;  3LJ3 A;  2ACZ B;  3R3M A;  2K5P A;  2IO0 B;  3ABV B;  5HHD G;  4A3P A;  1GPX A;  3QHT A;  3EEC A;  3DWM A;  2ZJD A;  4BOZ B;  1HE8 A;  4FHK A;  2BKR B;  3CWI A;  4HRO A;  3IVF A;  1JRP A;  1TGZ B;  4EUT A;  4LJO B;  5G5G A;  3WAN A;  1UNS A;  3AMZ A;  3BY4 B;  1EWY C;  3DVG X;  5DCN A;  5EE3 A;  4MEM A;  2O2V B;  1LGR A;  2RPV A;  1Q1O A;  3CIR B;  5FR3 A;  1M94 A;  2REX A;  1WX7 A;  4E3C A;  1SJH D;  1ZKH A;  4LDT D;  1WMH B;  4WWM A;  5G5H A;  3MC9 A;  4GDL A;  1OTR B;  4JGH B;  2KK8 A;  5AZG A;  2WXP A;  5JH5 C;  3PRM B;  5JHB A;  1Z5S B;  4EKU A;  4N59 A;  3RI7 C;  4XC2 A;  1GNU A;  1LO5 D;  1ZE3 D;  1FCC C;  3WAM A;  3Q14 C;  3TBL D;  3QAR A;  1YNT E;  2KWD A;  4IC7 B;  4OVZ A;  4HXD A;  3V61 A;  2WXN A;  4ZHP A;  3IFW B;  2M4N A;  4IM3 A;  4K3B A;  2N4F A;  3P63 A;  2QMT A;  2RSU A;  3ZNI D;  2LRW A;  1QF6 A;  4F1S A;  1FCL A;  1L7Y A;  4KKI A;  4LCD E;  4B6W A;  2KWU B;  3DBR I;  3W9C B;  1SBB B;  3AEB B;  1R4M I;  4RF1 A;  4HKZ E;  5CX3 A;  3RNC C;  3QX1 A;  3PS6 A;  3RNB C;  4HPP A;  2KC1 A;  4GSW A;  3SU8 X;  3M63 B;  3MC8 A;  3PRP B;  4GU2 A;  2OJR A;  1ZOY B;  1J7B A;  3K9O B;  4KZ0 A;  4JIO U;  3Q8B A;  2MCN B;  1C78 A;  3RNE C;  4BFR A;  2Y3A A;  2DHZ A;  3ZO5 B;  2V3P A;  3UIP B;  3HRD D;  1XO3 A;  3T3N A;  2ONQ A;  1BT0 A;  4N58 A;  3MJW A;  1V9J A;  2N9X A;  2JZP A;  4FUL A;  2IDY A;  1TYG B;  1TZO A;  2EKE C;  3R2I A;  2W54 A;  1N5W A;  1E7V A;  3FAH A;  3VXW A;  2KFJ A;  2UWQ A;  2N9K A;  2ZVO A;  1OFF A;  5D3D A;  3NRZ A;  3ZKJ C;  1CMX B;  1HEZ E;  3MC0 B;  1WGH A;  4WWN A;  1FFV A;  2A4Z A;  1WI0 A;  2LXC A;  1V80 A;  1WSP A;  2DZJ A;  3PRZ A;  5LNK 1;  3A9J A;  4MAC A;  1V5O A;  2ON8 A;  4XGA B;  4ANU A;  4RM8 A;  2EMS A;  3ZIM A;  5HI1 A;  3KVF B;  3Q8E A;  2LHE A;  4DK5 A;  1MPE A;  3DBH B;  2ZPY A;  3C19 A;  5AUK A;  2CHZ A;  1UWX A;  2GBM A;  3JVZ X;  4DQO C;  3ZNZ B;  2DBY A;  4LNN A;  2XBB C;  3Q6B A;  1EF5 A;  2AX5 A;  4USA A;  1D5Z C;  2Z0E B;  3BYT B;  3AE4 B;  5BYR A;  1JWB D;  3WAP A;  1T6B X;  2E3T A;  4F7Z A;  3B0A A;  1SE2 A;  1JML A;  4EZJ A;  3ZW3 A;  3IXS A;  4GLS C;  2AQ2 B;  4LJP B;  4E71 A;  1UD7 A;  2LJI A;  1Q0W B;  3DDC B;  2RMM A;  4C4V A;  2FE8 A;  2FUG 1;  2L32 A;  1K50 A;  3GE3 C;  2AL6 A;  4K81 A;  2FCS A;  2ZNV B;  3J9C A;  2KXJ A;  3EGR A;  3DBL B;  2JU6 X;  2AWT A;  4KSL C;  4I6P A;  1V1O A;  4J3O D;  1UBI A;  4RH6 A;  1TS4 A;  4DXF A; 
#chains in the Genus database with same CATH homology
 5IP4 D;  5IOI A;  1MJD A;  5IO9 A;  1MFW A;  1MG4 A;  2BQQ A;  5IKC M;  2DNF A;  5IN7 A;  1UF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...