2DNFA

Solution structure of rsgi ruh-062, a dcx domain from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
GSSGSSGRKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLRSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYGELLFDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Doublecortin domain-containing protein 2
publication title Solution structure of RSGI RUH-062, a DCX domain from human
rcsb
source organism Homo sapiens
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 2dnfA01
5IOIA 1MJDA 1MFWA 2DNFA 5IN7A 5IKCM 2BQQA 5IO9A 1UF0A 5IP4D 1MG4A
chains in the Genus database with same CATH superfamily
2E3TA 3HRDD 3I57A 2CR5A 1HE8A 1XLNA 4RF1A 2J0JA 4MM3A 3P4RB 4LLGM 2DBYA 1WY8A 2I2YA 4MELA 2J53A 4KDLB 4MJSA 3A9KB 3P63A 2MBQA 2N4FA 3GS2A 2HTHA 4CHKA 2K8HA 2BS3B 3ALBA 3APDA 2PLPA 4W9GA 4IW0A 3N1YC 1KM7A 1ZDXA 1TBEA 1QLBB 1D4BA 4TQ1A 5FR6A 2HE7A 1F1HA 2QCZA 1FMAD 3E56A 2KN4A 2J0MA 2V0GA 1M4VA 4NQLB 4HWIB 4L23A 1WMHB 4RGMA 2BKFA 1PUTA 2LVPA 2AYOB 4N58A 4G50A 2HD5B 3ONSA 3ZXVA 1A5RA 3APFA 2KWUB 2FAZA 2J7QB 2DYMA 3PREA 4II2B 2N0SB 1D6EC 5KHQA 3ZDTA 3TSSA 3RUIB 2SAKA 2KC1A 3M3JA 4K1RB 3VHTC 1XD3B 4OHJA 4N9F4 1Z5SB 3AM9A 3U8ZA 2JX5A 1R4MB 1T5XD 5EE0A 2LXAA 3KVFB 4B6WA 2ZVNA 1JW9D 2O6VB 3ZW3A 4K3CA 1GAQB 1K50A 4XE0A 2WX0A 2N1WA 3KWLA 1L4DB 4KX6B 4TSSA 3B1LX 1WXVA 4PS8A 2RPQA 5BMIA 4ZYSA 1NDDA 1E90A 1E7VA 2VZKD 4GIVA 4ZRJA 3PLVA 2FIDA 3IT4B 2M4NA 3DWGC 1YJJA 3AB5A 1KJTA 2D2QA 3A1QB 1ENFA 3MFGA 4KZCA 1V8CA 5H92C 2JWUA 3VH3B 1WX9A 3IAS1 4FBJB 1JMLA 4JL9A 4FA6A 1VJKA 2WXLA 1WGYA 1CQVA 2PIAA 3JYUA 2RMMA 4A20A 2KQ7A 3P4QB 1UBIA 2UYZB 2CS4A 1STEA 4MSQB 2LASA 3H9DA 2BKRB 5CHWA 2L8JA 2MHJA 4ICUA 5CHFA 3DVNV 4W9HA 2MQJA 3DQVA 2MEKA 1PGXA 1T6BX 2IDYA 4W9KA 2BVCA 1WR6E 1RFKA 3HVDA 1WWTA 1IBXB 4OZCA 3BVGA 3AH7A 3I3TB 2WDVB 4YSYB 3PPAA 2KTFA 2GB1A 2IY0B 4M0WB 4B0EA 4DHZB 4OVZA 3QC8B 4IDIA 4RH6A 4B0MA 4ANUA 1L5PA 4RF0A 4DHJD 3SD5A 5DPRA 2W55A 4HVBA 4MACA 2JRHA 2WXIA 1AWDA 2L1AA 3A4SC 5H8YE 4HK2A 5J17A 2AL3A 4KZ0A 1GB4A 2FUHB 4P16A 3WAOA 3U4EG 3GZNI 4BVUC 4JE3B 1D5ZC 3AEAB 3TMPB 2J4XA 4TQ0A 2GBMA 4WAAA 4YL8A 3Q69A 1WIAA 3V61A 4JIOU 4WH4A 1E0ZA 4A8XC 2X38A 2DX5B 1KLUD 3Q8FA 4C7YA 2PE6B 5DCNA 4G0NB 4P6VF 3URYA 2DAJA 3AEGB 3NZUA 1KF6B 1LGRA 4WWOA 2AL6A 3NJTA 1HTQA 2RDHA 3JVZX 2MA9B 3TJPA 3TUOA 1CJEA 5BYRA 4I6LB 4WJQA 5IAAC 4PYUA 3P1MA 2Y3AA 4MGKE 3DBRB 4ZHPA 1C79A 2LUEA 2JZ3B 2GMIC 1FNVA 1WJUA 4BBNC 3ZNHB 2FUG1 1EO6A 2D3BA 5G5GA 2MP2A 1XLOA 2HJ1A 1X1MA 1OEYA 1I4XA 2FNJB 2R61A 3ZTDA 2I1KA 1RWSA 2PTLA 1JWAD 4YT0B 1TS3A 1WXMA 3NS8A 1D3ZA 1TGZB 2MRPA 1GUAB 1VLBA 3IHPC 1IUEA 4IOIE 1TIFA 1N5WA 1YQ3B 4C4VB 4AOFA 2WHIA 2KWCA 2MSED 1WZ0A 3R66C 4JX1C 2DZMA 3JSVB 2N9LA 2KAJA 2AX5A 4P1CC 2A5UA 5HG2A 2J42A 2ONQA 3AEEB 2NMQA 3B0AA 4JLCA 3ENEA 4BBNF 1ET9A 1SF0A 2KX3A 1KFYB 2N9PC 1RFAA 1UWXA 2JPHA 1Q5WB 2FE8A 3OWEB 5BMHA 1F2RC 4W9CA 1PGBA 2O2VA 5JH5C 2KANA 1BT0A 2I38A 3U7DA 1T0SC 5HKHA 2IJ0A 3NY5A 3QX1A 2M0AA 3ZQ4A 2LWPA 4HLEA 2RD0A 4JPSA 3QHTA 4IM3A 2BW2A 4OVVA 5J18A 1ESFA 3A33B 1YN4A 1E7PB 3AV8A 3EECA 1XT9B 4N59A 2M0XA 2AEHA 3AEBB 2V3SA 1Y8RC 3L13A 4A90A 2KT7A 1A70A 3Q8AA 1HZ5A 3WAPA 2VZKB 4NPNA 4GDKA 3ZTCA 1WE6A 2K6QA 1I4HA 3IAM1 2GBNA 5EE1A 5E6JA 4WJNA 3VQIA 2DHZA 5MPOA 3T3OA 2W82A 3MJWA 2KYWA 4HPPA 3PO0A 1JRUA 1GG3A 3L4PA 1C4AA 3RZWC 4ZHOA 4ZRKA 3KUDB 5L83A 3OLMD 2CU3A 3ZVVA 4ANVA 4J3OD 2CKHB 2IGDA 3AE8B 1YJIA 2C7MB 4BOZB 1L0YB 3DBHB 2JF5A 4P1BC 4MGIE 1KLGD 2KLGA 3VAWA 3ZIMA 1SB3C 2Z0DB 3ML9A 3AE4B 3ZYYX 2KDBA 2OJRA 2K25A 1XXGA 1FFVA 2D11A 1TKEA 2D3AA 4A3OA 2ZVOA 1XQQA 4YSXB 3ZGZA 2FCNA 5BYSA 4LNKA 3KW5B 4M8NA 3SFEB 1N60A 3A4RA 3W5VB 3Q2AC 2BT6A 2DAFA 4HPLB 5DPTA 2B76B 2L0FA 3Q14C 1E8WA 2XK5A 4RCOA 3B2GA 3SEBA 2WS3B 4H2AA 4A6QA 4WJPA 1PFDA 4DHJB 1UGJA 4US8A 1OGWA 1VZ7A 1PYWD 1ZKHA 4X57B 2IGHA 1VZ8A 2MBBB 2RGFA 2KNBA 5CHVC 5HI1A 2YEPF 2NBUA 3HIZA 1I4QA 2PEAA 2ZCBA 2LEKA 3ZNGC 3R7RA 3RPFC 3RULA 4OVUA 3V05A 4NAWA 1P1AA 2DENB 4E3CA 1N63A 4XWWA 4TUUA 1P98A 1S1QB 2IGGA 2W54A 3DBLB 2N7DA 3AU4A 2KDMA 2LJ5A 2BS4B 3GE3C 3AU5A 3AXCA 4MDKE 1V81A 1YX6B 4LJPB 4E71A 3AI5A 4EEWA 2KK8A 1ZP0B 3RNEC 3LDZE 3A9JA 4W9EA 3PHWB 2PKOA 1UZXB 1ACCA 4BKSD 2MX2A 3U30A 4NY0A 1DOXA 1RYJA 2JU6X 3FILA 3EA6A 4PYZA 3KYDD 1SE2A 3CWIA 2L83A 2LRWA 4MGYE 2LVOA 2CU1A 3DDCB 4M8MA 3PS6A 2VH2A 2M17A 1SJED 2N7JA 3OJ3A 3CIRB 3UQAA 5BO4B 3PV1A 1FXIA 2PPHA 3Q3OC 1WYGA 2A4ZA 4LK0M 1HQRD 3NS1A 1RLFA 2R2OA 3BIID 4WJOA 3RD2A 4KVGB 2KX0A 3AEFB 5AZGA 1FPYA 2OJWA 1WSPA 1OFFA 4HCPB 2MLBA 4C00A 5DPSA 2WXGA 4RM8A 2KMMA 1GJZA 3DVGY 2BBCA 3FKYA 2KD0A 2ZPYA 1SSNA 2KWVB 3V6CB 1UF0A 1B1ZA 1SGHA 1E8ZA 2NCNA 2KVZA 2BB6A 1YJ1A 2K3UA 5EDSA 3DHGC 2J52A 1T3QA 3DOWA 1WGDA 2KWDA 1LQBA 5HFYA 2LHDA 2K1FA 3K9PB 3KQ4A 4KIKB 2I1JA 3AECB 3Q3NC 3H7PB 1OEYJ 1ZPSA 3BINA 3DBLI 4XYCA 3MC0B 5AZFA 5E6OA 2JWZA 1WRDB 3MHSD 3VUXA 1FIQA 3ABVB 4ZOHC 2ICIA 3S2AA 1YN3A 2JT4B 2Y5BB 4F1SA 4ASWC 1ZE3D 2WXQA 3NVYA 2W9NA 3EGRA 1OTRB 3UF8A 3UIPB 2MBHA 2K0PA 4FJZA 3X0WA 5IA7A 1WX8A 2KQSA 1YIWA 4JWSC 4BAXA 2KOXA 3UGBB 1YQBA 2LGYA 3ZJTA 2FIFA 2LGXA 4BKSA 2GBKA 2GBJA 2Z0EB 1HZ6A 4ANXA 1TKYA 1WJNA 1C76A 2UU7A 3H8HA 2CHXA 2K9XA 3AE6B 4MM3B 1WH3A 2WXPA 3NOBA 2JQRB 1J19A 3ETRA 1XF5L 4MJSB 4YTPB 1YQ4B 1XEEA 4TV3A 2LUMA 2MW5A 3K9OB 1QT9A 3C0RB 3MJ5A 2WXOA 2C7NB 5LXHA 4LNOA 2VH1A 3P2BA 2KC2A 1JALA 1WI0A 3TEZA 1FXTB 2V9HA 1WGKA 4G11A 3VXWA 4DWFA 2AQ1B 1TS4A 1EM7A 3RNFC 4EZLA 1FCLA 4JWUC 1FRDA 4MGZE 4CQNA 2NBWB 4XZ4A 3WIMA 1IP9A 2IO1B 5BMGA 4BFRA 2OHFA 1YMHE 4NJCA 2M1MA 4A9AA 1NENB 3RI7C 4W9FA 4DHZE 1MG4A 2AQ2B 3PSEB 2MCNB 3NHEB 1J7BA 3T8MA 2Y5PA 4PK1A 3DPDA 3HUIA 2JYTA 5CTRC 5D3DA 1RM6C 3AE3B 3B2FA 4FHJA 1MHXA 3O13A 1MG8A 1L2NA 5BYQA 1BXTA 2IO0B 1K51A 1L6UA 1V2YA 4RGTA 2BYTA 1H8CA 1D5XC 3NG0A 1UNSA 2BPSA 2G3QB 2C60A 4AS1A 1R4MI 4KGSA 3VVWB 3AULA 1V9JA 4RGNA 3WA0A 2RDBC 3H6NA 4NJ6A 2PW9A 2UWQA 3VUYA 2INCC 3V62A 1I4GA 1T0RC 3TEXA 3N9YC 1J7CA 2ACZB 4P7IA 1P0RA 2DZJA 3T9LA 3W1YA 2WP9B 2BTEA 4IC7B 1LXDA 1ZGUB 4LNNA 4TMAB 2VRRB 2L0TA 2RPVA 1FRRA 3VH4B 2ZEQA 3EC8A 3PZ8A 2LHEA 1WJ6A 5AEKB 1TY0A 1WGRA 4HXDA 1V5OA 2WU2B 2WWZA 4K3BA 4EE2A 1JWMD 1YD8U 4A55A 1SE9A 4BZAA 2K8BA 4RNAA 3W5UB 3T3NA 2NPTA 3WCQA 1JWSD 2DNFA 1DYQA 1P3QU 1T0YA 3CF6E 3JW0X 4DDGD 4EOYA 4YXDB 2INDC 1MHHE 4WQMA 2DYOA 3PT2B 1Z2MA 1ZXHA 1N61A 4EZJA 3P4SB 1FNUA 2V3PA 1R4NB 1SE3A 3IVFA 1SEBD 4PS3A 4PT5A 4JGHB 3LB8C 1L4ZB 3W9CB 2IPKD 5LXIB 2H89B 1Q1OA 4DK5A 3Q8CA 1S3SG 3P42A 4PS7A 3APCA 1ISNA 3AE5B 4ZRQA 1F52A 1AYFA 3ZXRA 5IP4D 3LYYA 3KYCD 1QOBA 2W3RA 2YEPB 1QILA 4ZRPA 3KH0A 1E9MA 1FFUA 1WJ4A 2DZKA 5D2MB 4GDLA 4IKGA 4KKIA 2KMAA 4KDIC 2CHZA 2LRUA 2TSSA 4XDCA 3R7QA 4ARCA 3SHQA 1RAXA 3IT6B 2DYBA 2V3NA 1WXAA 5AZHA 2WLBA 4I6NB 1AN8A 3AEDB 3NZ3A 3MTNB 1F77A 3RCZA 2INNE 3B9JA 4EZKA 2O6VD 3IBEA 1CK1A 1WXQA 3N20C 1YX5B 3DBRI 1B9RA 3D32A 2REXA 2ZZPB 3NZSA 1Q0WB 3ECIA 2M8SA 2JYEA 2KDFB 1IGDA 1MI0A 4HKZE 2V4IB 2MP2B 1ZOYB 3RNGC 3QARA 4MH0E 3QCAA 4MH8A 1NVID 3NUHB 3C19A 2WNMA 1C77A 3FAHA 2E6XA 3VRAB 3QWZB 2KTRB 3DVGX 3VR9B 1TZ1A 1PQSA 2KZRA 2MJEA 1KOTA 4DQOC 1P7EA 5L95C 1TTNA 3ZUNA 3Q3JA 2M19A 1PDXA 1WZ3A 3HVZA 2BF8B 5FK9C 3O65B 1HA5A 3ZNZB 1V1PA 1KTKA 2CJOA 2JUOA 3P4PB 2J0KA 3MC9A 4B95A 4ZYNA 3VRBB 4FXCA 4GMVA 3A9KA 4LCDE 1JWBD 1TJEA 4G3XB 1SIFA 5D6JB 3L10B 4IUMB 5EE3A 3LXFA 4HEA1 4W9LA 3AE2B 5G55A 2BQQA 1G6JA 1UUPA 4JQWC 2QILA 2MWSB 4DDID 2K22A 2KFJA 3CSTA 2L05A 4RFBA 3TEYA 2C7HA 4J6IA 2BYVE 1TY2A 3QK0A 2O2VB 3R3MA 3NVWA 3I63C 3MHZA 2JY6A 3EUB2 1F9JA 1SXTA 4YTNB 2KHWB 3RFZB 2WXJA 1WMHA 1AW7A 3IXSA 3VTWA 1PGAA 4OZBA 4W9IA 2ZNVC 3UINB 3ZJVA 2NTTA 5JHBA 3KWVA 3VUWA 2Y5CA 1WFYA 1L0VB 1U4AA 2WXNA 2GLSA 2WDTB 1TS2A 3R2TA 3QQ8B 4GDKB 4IWPA 5FR3A 3DCGA 5GXGB 2D10A 4FJYA 3FC4A 3M63B 1L0XB 2JVCA 4LJOB 1V86A 2O6VA 4W9DA 4HDQA 1EF1A 2G4SA 4GU2A 3QAQA 1P9DU 1E8YA 4REZA 2BB5A 2LVQA 4NQKE 3CSFA 1KLVA 4KSLC 2B3AA 2KKCA 2N1VA 2YLMA 3J9CA 3DBHI 3ZLZA 3OG5A 2IYDB 4L1BA 1NBFC 2BYEA 4DXGA 5DPWA 3E9SA 4KV2A 4DBGA 3M62B 3V60A 5IOIA 3A1QA 1OQYA 2XEWA 2L52A 2IBIB 4M00A 2IY1B 1KH0A 2BWFA 2XN9C 2BGFA 4ZRIA 3RYTA 2QC8A 3TEWA 3BZDB 4ANWA 1NYQA 1K52A 4K7WA 2FCQA 1WYWB 4O1NA 3N1ZC 2Q5WD 4C80A 3ZRFA 3DVNU 4MSMB 2CHWA 3OAWA 2QIEB 2ZW0A 4XGAB 2XK5B 2KDEB 4NZLB 2C9WB 1EWYC 3H7SA 4GB9A 4BOSC 3RT3B 1QKZA 1UH6A 3AE7B 3TCAA 2KQ4X 2DWQA 3I5JC 3NRZA 3N32A 3AN1A 3BWUD 2FCMA 3MP9A 2KFKB 5HHDG 3PGEA 3LJ3A 1F0ZA 4M02A 4HJKA 2INPE 3DHHC 1K53A 1IBXA 3TL5A 3VDZA 1AARA 2NVUI 4FADA 3VR8B 3BY4B 4NAWB 3X23A 5C3JB 2JXXA 4UDUC 3L08A 4M0WA 2NS5A 1C4CA 4LDTD 4D2KA 2KJHB 2GI9A 2MBOA 2WXFA 1GNUA 4AQ7A 4AUQC 1N5XA 3N3KB 3TBLD 1XCQL 1EU3A 2LI5A 1JRPA 2JXTA 2LZ6A 1NI2A 1QOAA 3GZNB 1MPEA 5T8IA 2IO2B 3A9JB 1Y56A 3R8BA 2LXCA 2JZZA 4US9A 2LJIA 1WF9A 2L00B 1IGCA 2WXHA 3V3XA 1BMLC 1WGHA 2C5LC 3FILB 4WURA 4EUTA 2N7EA 3GE8C 2KVRA 2KACA 1LFDA 5LNK1 4QAYA 2D3GA 4USAA 2ZCCA 1TZOA 1UBQA 2DLBA 3M95A 2X8XX 2FCSA 4NNJB 3SFDB 5D3IB 1CZPA 3L54A 3UQBA 1JQ4A 2PVOD 2LGDA 1UD7A 1BUIC 4LNFA 2KDIA 3WALA 3Q3FA 4K7SA 1WXSA 4WIPA 1NEKB 3BYTB 1N62A 2DZIA 3BYYB 2Z8LA 1C9FA 1ZUD2 2EMTA 2LGSA 2WQYB 4W9JA 2PJHA 4GSWA 3CMMB 1ROEA 2QDFA 4AWJA 1E6EB 5FKAC 5LLIA 4IM0A 2PVGC 1VDVA 1MFWA 4NAMA 4ICVA 5KHOA 1GC6A 5TSSA 5GMVA 1ZDVA 3VTVA 3GB1A 2WDRB 4L2YA 4FN2A 4C4VA 1CMXB 1JWUD 1VRAB 4KKJA 3EHVA 2EMSA 4KSKC 4CYEA 2SEBD 5IO9A 2OOBB 4HJGE 4AJYB 1MJDA 3C8YA 3JSVA 5C1ZA 4YSZB 4OW0A 1QZEA 1RRBA 3SU8X 1UELA 2PE9A 1FM0D 4WAFA 2FBWB 2HTME 2CJNA 1SBBB 2QHOA 5TR5A 1NI3A 2D5GA 3EFCA 4EKUA 1T0QC 1I42A 3U52E 1EU4A 2EKIA 3WANA 4ZDVA 1M94A 2OEDA 4YTMB 2WU5B 4EFOA 1XCTL 4R3DA 1FO4A 5D7GA 3IFWB 3L17A 1GB1A 3ZNID 1LM8B 2IO3B 1I4RA 4AJWA 3ZO5B 1V97A 2WXKA 1IYFA 3B08A 1WM3A 3W1SA 1FEHA 3BK1A 3HK0A 2KO3A 5C2TB 1KRHA 4FHKA 1J7AA 1FD6A 3ZKJC 2RR9A 2KXJA 3AE1B 1ZW7A 1OQQA 3I9V1 2AQ3B 2R2QA 1TKGA 1WRIA 4IWQA 3VTUA 5D94A 4OZAA 5G5HA 2XNAC 1VZ6A 3N1XC 2JSVX 3MC8A 1ZXIA 2M56B 4ARIA 3EFUA 1V6EA 5JXVA 2KLCA 2NBVB 1WM2A 3PTFC 5JZEB 2EKEC 1FCCC 5CX3A 3PRZA 3TIXA 3U2SC 2NTSA 4FLHA 1SE4A 2KTRA 4NJ7A 1OQRA 2ASQA 1P7FA 3V6EB 3DHIC 3PVLA 1YN5A 4S0RA 3PRPB 3RMKC 1I7HA 3N30A 4II3B 3SDLC 1XLQA 3KLSX 2AWTA 1E10A 1C78A 4BKGA 3HHMA 3ZDMC 3OJ4B 3PLUA 1Q10A 4IM2A 1YNTE 2L3ZA 1I35A 3UI3A 1V5TA 3QIJA 4WWMA 1VD2A 1WR1A 3RZFA 2LMCA 4LDTB 1WX7A 2QMTA 3HM6X 1QOFA 4IWOA 2MBEA 1WGGA 1GOZA 1EWCA 1LO5D 3QJZA 1DGJA 3WAMA 3ZRCA 3GOEA 1I4PA 3BVZA 4HCNB 2W3SA 3BVMA 5J2RA 2GOWA 3RNCC 3HM3A 5AUKA 4K81A 1JCKB 3ML8A 4WWPA 4I6PA 4LNIA 2BS2B 3AMZA 3U7ZA 5JHAA 2NR2A 3AE9B 1EUVB 4B9KA 2WYQA 2L76A 3DBSA 1E8XA 5IN7A 1ET6A 1HEZE 4DXFA 3Q8BA 2RSUA 5C23A 1FNWA 2HJ8A 3IG3A 2N9XA 5E6PA 2RDGA 1UWMA 4HDOA 1MVKA 2WDQB 2G1EA 2NPTB 3VFKA 1J8CA 1SJHD 1TYGB 4E74A 3Q8EA 4S17A 5IKCM 2IZVB 1F2RI 3R2IA 1XO3A 3PZDA 4YWGG 2QSDA 3Q3MC 4GXBA 2JRIB 2D07B 5I4DA 2WGSA 1N6ZA 1UGMA 1WE7A 2G4DB 4GOCA 4A3PA 3SR6A 2QEJC 2ZJDA 1H4RA 2K5PA 2ZNVB 2D3CA 4MT5A 1YOVB 2V1YA 1R4NI 4F8CB 1L6VA 1TT5B 1GPXA 3UIOB 4FJVB 4XC2A 1FXAA 3QA8A 1JROA 1GC7A 2V4LA 4CO7A 1C1YB 2K6DB 3W1SC 1HTOA 3DWMA 4F7ZA 1C3TA 3KUZA 2MJDA 1VR9A 4GN1A 1IPGA 4N6EB 4HKQA 4C7ZA 2N9KA 2GBRA 2WXMA 2BYFA 4WQOB 1DOIA 4C56C 2WX1A 1R7SA 2MH7A 4MEMA 4URKA 4GDLB 3RN9C 1QOGA 1QF6A 2K39A 3PHXB 4KGRA 2H88B 1V49A 4AP4C 1DOYA 1C4PA 2LFIA 3L0WB 1QQRA 2KFKA 2L7RA 2YVCA 1V1OA 1XLPA 1E7UA 4HRSA 3GP7A 2G45B 3PRMB 4WWNA 2BWES 4GLSC 4RMAA 1E5WA 2PMVA 2L32A 1L7YA 2Z59B 4ITKA 4KIKA 2LD9A 2K8CA 1EF5A 2WXRA 1SIJA 5E6NA 3H7PA 4FULA 4BKTA 1K8RB 4IG7B 4K7UA 1TS5A 3PZ7A 4HROA 2MJ3A 4TKNA 2KN5A 5AUIA 2ZPNA 2KJ6A 4M01A 4ACFA 3NVZA 5EE9A 3L16A 3RNAC 4XDDA 3Q6BA 2JZPA 3W2DA 3BK2A 4Q2JA 4KGTA 1J0GA 4RGOS 3RNBC 4LTUA 2XBBC 2ZW1A 4GGQA 3ZJUA 2G9HD 4HPMB 4RM9A 5G2NA 2GRIA 1V80A 2ON8A 4DXAB 2QJLA 3KUCB 1HXYD 4XX5A 3H1UA 1VCBA 4XWTA 2EELA 1D5MC 2KMCA 2HDEA 2LGIA 3NVVA 1NYRA 2N9EB 2KJRA 1V1PB
chains in the Genus database with same CATH topology
5IOIA 1MJDA 1MFWA 2DNFA 5IN7A 5IKCM 2BQQA 5IO9A 1UF0A 5IP4D 1MG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOI A;  1MJD A;  1MFW A;  2DNF A;  5IN7 A;  5IKC M;  2BQQ A;  5IO9 A;  1UF0 A;  5IP4 D;  1MG4 A; 
#chains in the Genus database with same CATH topology
 2E3T A;  3HRD D;  3I57 A;  2CR5 A;  1HE8 A;  1XLN A;  4RF1 A;  2J0J A;  4MM3 A;  3P4R B;  4LLG M;  2DBY A;  1WY8 A;  2I2Y A;  4MEL A;  2J53 A;  4KDL B;  4MJS A;  3A9K B;  3P63 A;  2MBQ A;  2N4F A;  3GS2 A;  2HTH A;  4CHK A;  2K8H A;  2BS3 B;  3ALB A;  3APD A;  2PLP A;  4W9G A;  4IW0 A;  3N1Y C;  1KM7 A;  1ZDX A;  1TBE A;  1QLB B;  1D4B A;  4TQ1 A;  5FR6 A;  2HE7 A;  1F1H A;  2QCZ A;  1FMA D;  3E56 A;  2KN4 A;  2J0M A;  2V0G A;  1M4V A;  4NQL B;  4HWI B;  4L23 A;  1WMH B;  4RGM A;  2BKF A;  1PUT A;  2LVP A;  2AYO B;  4N58 A;  4G50 A;  2HD5 B;  3ONS A;  3ZXV A;  1A5R A;  3APF A;  2KWU B;  2FAZ A;  2J7Q B;  2DYM A;  3PRE A;  4II2 B;  2N0S B;  1D6E C;  5KHQ A;  3ZDT A;  3TSS A;  3RUI B;  2SAK A;  2KC1 A;  3M3J A;  4K1R B;  3VHT C;  1XD3 B;  4OHJ A;  4N9F 4;  1Z5S B;  3AM9 A;  3U8Z A;  2JX5 A;  1R4M B;  1T5X D;  5EE0 A;  2LXA A;  3KVF B;  4B6W A;  2ZVN A;  1JW9 D;  2O6V B;  3ZW3 A;  4K3C A;  1GAQ B;  1K50 A;  4XE0 A;  2WX0 A;  2N1W A;  3KWL A;  1L4D B;  4KX6 B;  4TSS A;  3B1L X;  1WXV A;  4PS8 A;  2RPQ A;  5BMI A;  4ZYS A;  1NDD A;  1E90 A;  1E7V A;  2VZK D;  4GIV A;  4ZRJ A;  3PLV A;  2FID A;  3IT4 B;  2M4N A;  3DWG C;  1YJJ A;  3AB5 A;  1KJT A;  2D2Q A;  3A1Q B;  1ENF A;  3MFG A;  4KZC A;  1V8C A;  5H92 C;  2JWU A;  3VH3 B;  1WX9 A;  3IAS 1;  4FBJ B;  1JML A;  4JL9 A;  4FA6 A;  1VJK A;  2WXL A;  1WGY A;  1CQV A;  2PIA A;  3JYU A;  2RMM A;  4A20 A;  2KQ7 A;  3P4Q B;  1UBI A;  2UYZ B;  2CS4 A;  1STE A;  4MSQ B;  2LAS A;  3H9D A;  2BKR B;  5CHW A;  2L8J A;  2MHJ A;  4ICU A;  5CHF A;  3DVN V;  4W9H A;  2MQJ A;  3DQV A;  2MEK A;  1PGX A;  1T6B X;  2IDY A;  4W9K A;  2BVC A;  1WR6 E;  1RFK A;  3HVD A;  1WWT A;  1IBX B;  4OZC A;  3BVG A;  3AH7 A;  3I3T B;  2WDV B;  4YSY B;  3PPA A;  2KTF A;  2GB1 A;  2IY0 B;  4M0W B;  4B0E A;  4DHZ B;  4OVZ A;  3QC8 B;  4IDI A;  4RH6 A;  4B0M A;  4ANU A;  1L5P A;  4RF0 A;  4DHJ D;  3SD5 A;  5DPR A;  2W55 A;  4HVB A;  4MAC A;  2JRH A;  2WXI A;  1AWD A;  2L1A A;  3A4S C;  5H8Y E;  4HK2 A;  5J17 A;  2AL3 A;  4KZ0 A;  1GB4 A;  2FUH B;  4P16 A;  3WAO A;  3U4E G;  3GZN I;  4BVU C;  4JE3 B;  1D5Z C;  3AEA B;  3TMP B;  2J4X A;  4TQ0 A;  2GBM A;  4WAA A;  4YL8 A;  3Q69 A;  1WIA A;  3V61 A;  4JIO U;  4WH4 A;  1E0Z A;  4A8X C;  2X38 A;  2DX5 B;  1KLU D;  3Q8F A;  4C7Y A;  2PE6 B;  5DCN A;  4G0N B;  4P6V F;  3URY A;  2DAJ A;  3AEG B;  3NZU A;  1KF6 B;  1LGR A;  4WWO A;  2AL6 A;  3NJT A;  1HTQ A;  2RDH A;  3JVZ X;  2MA9 B;  3TJP A;  3TUO A;  1CJE A;  5BYR A;  4I6L B;  4WJQ A;  5IAA C;  4PYU A;  3P1M A;  2Y3A A;  4MGK E;  3DBR B;  4ZHP A;  1C79 A;  2LUE A;  2JZ3 B;  2GMI C;  1FNV A;  1WJU A;  4BBN C;  3ZNH B;  2FUG 1;  1EO6 A;  2D3B A;  5G5G A;  2MP2 A;  1XLO A;  2HJ1 A;  1X1M A;  1OEY A;  1I4X A;  2FNJ B;  2R61 A;  3ZTD A;  2I1K A;  1RWS A;  2PTL A;  1JWA D;  4YT0 B;  1TS3 A;  1WXM A;  3NS8 A;  1D3Z A;  1TGZ B;  2MRP A;  1GUA B;  1VLB A;  3IHP C;  1IUE A;  4IOI E;  1TIF A;  1N5W A;  1YQ3 B;  4C4V B;  4AOF A;  2WHI A;  2KWC A;  2MSE D;  1WZ0 A;  3R66 C;  4JX1 C;  2DZM A;  3JSV B;  2N9L A;  2KAJ A;  2AX5 A;  4P1C C;  2A5U A;  5HG2 A;  2J42 A;  2ONQ A;  3AEE B;  2NMQ A;  3B0A A;  4JLC A;  3ENE A;  4BBN F;  1ET9 A;  1SF0 A;  2KX3 A;  1KFY B;  2N9P C;  1RFA A;  1UWX A;  2JPH A;  1Q5W B;  2FE8 A;  3OWE B;  5BMH A;  1F2R C;  4W9C A;  1PGB A;  2O2V A;  5JH5 C;  2KAN A;  1BT0 A;  2I38 A;  3U7D A;  1T0S C;  5HKH A;  2IJ0 A;  3NY5 A;  3QX1 A;  2M0A A;  3ZQ4 A;  2LWP A;  4HLE A;  2RD0 A;  4JPS A;  3QHT A;  4IM3 A;  2BW2 A;  4OVV A;  5J18 A;  1ESF A;  3A33 B;  1YN4 A;  1E7P B;  3AV8 A;  3EEC A;  1XT9 B;  4N59 A;  2M0X A;  2AEH A;  3AEB B;  2V3S A;  1Y8R C;  3L13 A;  4A90 A;  2KT7 A;  1A70 A;  3Q8A A;  1HZ5 A;  3WAP A;  2VZK B;  4NPN A;  4GDK A;  3ZTC A;  1WE6 A;  2K6Q A;  1I4H A;  3IAM 1;  2GBN A;  5EE1 A;  5E6J A;  4WJN A;  3VQI A;  2DHZ A;  5MPO A;  3T3O A;  2W82 A;  3MJW A;  2KYW A;  4HPP A;  3PO0 A;  1JRU A;  1GG3 A;  3L4P A;  1C4A A;  3RZW C;  4ZHO A;  4ZRK A;  3KUD B;  5L83 A;  3OLM D;  2CU3 A;  3ZVV A;  4ANV A;  4J3O D;  2CKH B;  2IGD A;  3AE8 B;  1YJI A;  2C7M B;  4BOZ B;  1L0Y B;  3DBH B;  2JF5 A;  4P1B C;  4MGI E;  1KLG D;  2KLG A;  3VAW A;  3ZIM A;  1SB3 C;  2Z0D B;  3ML9 A;  3AE4 B;  3ZYY X;  2KDB A;  2OJR A;  2K25 A;  1XXG A;  1FFV A;  2D11 A;  1TKE A;  2D3A A;  4A3O A;  2ZVO A;  1XQQ A;  4YSX B;  3ZGZ A;  2FCN A;  5BYS A;  4LNK A;  3KW5 B;  4M8N A;  3SFE B;  1N60 A;  3A4R A;  3W5V B;  3Q2A C;  2BT6 A;  2DAF A;  4HPL B;  5DPT A;  2B76 B;  2L0F A;  3Q14 C;  1E8W A;  2XK5 A;  4RCO A;  3B2G A;  3SEB A;  2WS3 B;  4H2A A;  4A6Q A;  4WJP A;  1PFD A;  4DHJ B;  1UGJ A;  4US8 A;  1OGW A;  1VZ7 A;  1PYW D;  1ZKH A;  4X57 B;  2IGH A;  1VZ8 A;  2MBB B;  2RGF A;  2KNB A;  5CHV C;  5HI1 A;  2YEP F;  2NBU A;  3HIZ A;  1I4Q A;  2PEA A;  2ZCB A;  2LEK A;  3ZNG C;  3R7R A;  3RPF C;  3RUL A;  4OVU A;  3V05 A;  4NAW A;  1P1A A;  2DEN B;  4E3C A;  1N63 A;  4XWW A;  4TUU A;  1P98 A;  1S1Q B;  2IGG A;  2W54 A;  3DBL B;  2N7D A;  3AU4 A;  2KDM A;  2LJ5 A;  2BS4 B;  3GE3 C;  3AU5 A;  3AXC A;  4MDK E;  1V81 A;  1YX6 B;  4LJP B;  4E71 A;  3AI5 A;  4EEW A;  2KK8 A;  1ZP0 B;  3RNE C;  3LDZ E;  3A9J A;  4W9E A;  3PHW B;  2PKO A;  1UZX B;  1ACC A;  4BKS D;  2MX2 A;  3U30 A;  4NY0 A;  1DOX A;  1RYJ A;  2JU6 X;  3FIL A;  3EA6 A;  4PYZ A;  3KYD D;  1SE2 A;  3CWI A;  2L83 A;  2LRW A;  4MGY E;  2LVO A;  2CU1 A;  3DDC B;  4M8M A;  3PS6 A;  2VH2 A;  2M17 A;  1SJE D;  2N7J A;  3OJ3 A;  3CIR B;  3UQA A;  5BO4 B;  3PV1 A;  1FXI A;  2PPH A;  3Q3O C;  1WYG A;  2A4Z A;  4LK0 M;  1HQR D;  3NS1 A;  1RLF A;  2R2O A;  3BII D;  4WJO A;  3RD2 A;  4KVG B;  2KX0 A;  3AEF B;  5AZG A;  1FPY A;  2OJW A;  1WSP A;  1OFF A;  4HCP B;  2MLB A;  4C00 A;  5DPS A;  2WXG A;  4RM8 A;  2KMM A;  1GJZ A;  3DVG Y;  2BBC A;  3FKY A;  2KD0 A;  2ZPY A;  1SSN A;  2KWV B;  3V6C B;  1UF0 A;  1B1Z A;  1SGH A;  1E8Z A;  2NCN A;  2KVZ A;  2BB6 A;  1YJ1 A;  2K3U A;  5EDS A;  3DHG C;  2J52 A;  1T3Q A;  3DOW A;  1WGD A;  2KWD A;  1LQB A;  5HFY A;  2LHD A;  2K1F A;  3K9P B;  3KQ4 A;  4KIK B;  2I1J A;  3AEC B;  3Q3N C;  3H7P B;  1OEY J;  1ZPS A;  3BIN A;  3DBL I;  4XYC A;  3MC0 B;  5AZF A;  5E6O A;  2JWZ A;  1WRD B;  3MHS D;  3VUX A;  1FIQ A;  3ABV B;  4ZOH C;  2ICI A;  3S2A A;  1YN3 A;  2JT4 B;  2Y5B B;  4F1S A;  4ASW C;  1ZE3 D;  2WXQ A;  3NVY A;  2W9N A;  3EGR A;  1OTR B;  3UF8 A;  3UIP B;  2MBH A;  2K0P A;  4FJZ A;  3X0W A;  5IA7 A;  1WX8 A;  2KQS A;  1YIW A;  4JWS C;  4BAX A;  2KOX A;  3UGB B;  1YQB A;  2LGY A;  3ZJT A;  2FIF A;  2LGX A;  4BKS A;  2GBK A;  2GBJ A;  2Z0E B;  1HZ6 A;  4ANX A;  1TKY A;  1WJN A;  1C76 A;  2UU7 A;  3H8H A;  2CHX A;  2K9X A;  3AE6 B;  4MM3 B;  1WH3 A;  2WXP A;  3NOB A;  2JQR B;  1J19 A;  3ETR A;  1XF5 L;  4MJS B;  4YTP B;  1YQ4 B;  1XEE A;  4TV3 A;  2LUM A;  2MW5 A;  3K9O B;  1QT9 A;  3C0R B;  3MJ5 A;  2WXO A;  2C7N B;  5LXH A;  4LNO A;  2VH1 A;  3P2B A;  2KC2 A;  1JAL A;  1WI0 A;  3TEZ A;  1FXT B;  2V9H A;  1WGK A;  4G11 A;  3VXW A;  4DWF A;  2AQ1 B;  1TS4 A;  1EM7 A;  3RNF C;  4EZL A;  1FCL A;  4JWU C;  1FRD A;  4MGZ E;  4CQN A;  2NBW B;  4XZ4 A;  3WIM A;  1IP9 A;  2IO1 B;  5BMG A;  4BFR A;  2OHF A;  1YMH E;  4NJC A;  2M1M A;  4A9A A;  1NEN B;  3RI7 C;  4W9F A;  4DHZ E;  1MG4 A;  2AQ2 B;  3PSE B;  2MCN B;  3NHE B;  1J7B A;  3T8M A;  2Y5P A;  4PK1 A;  3DPD A;  3HUI A;  2JYT A;  5CTR C;  5D3D A;  1RM6 C;  3AE3 B;  3B2F A;  4FHJ A;  1MHX A;  3O13 A;  1MG8 A;  1L2N A;  5BYQ A;  1BXT A;  2IO0 B;  1K51 A;  1L6U A;  1V2Y A;  4RGT A;  2BYT A;  1H8C A;  1D5X C;  3NG0 A;  1UNS A;  2BPS A;  2G3Q B;  2C60 A;  4AS1 A;  1R4M I;  4KGS A;  3VVW B;  3AUL A;  1V9J A;  4RGN A;  3WA0 A;  2RDB C;  3H6N A;  4NJ6 A;  2PW9 A;  2UWQ A;  3VUY A;  2INC C;  3V62 A;  1I4G A;  1T0R C;  3TEX A;  3N9Y C;  1J7C A;  2ACZ B;  4P7I A;  1P0R A;  2DZJ A;  3T9L A;  3W1Y A;  2WP9 B;  2BTE A;  4IC7 B;  1LXD A;  1ZGU B;  4LNN A;  4TMA B;  2VRR B;  2L0T A;  2RPV A;  1FRR A;  3VH4 B;  2ZEQ A;  3EC8 A;  3PZ8 A;  2LHE A;  1WJ6 A;  5AEK B;  1TY0 A;  1WGR A;  4HXD A;  1V5O A;  2WU2 B;  2WWZ A;  4K3B A;  4EE2 A;  1JWM D;  1YD8 U;  4A55 A;  1SE9 A;  4BZA A;  2K8B A;  4RNA A;  3W5U B;  3T3N A;  2NPT A;  3WCQ A;  1JWS D;  2DNF A;  1DYQ A;  1P3Q U;  1T0Y A;  3CF6 E;  3JW0 X;  4DDG D;  4EOY A;  4YXD B;  2IND C;  1MHH E;  4WQM A;  2DYO A;  3PT2 B;  1Z2M A;  1ZXH A;  1N61 A;  4EZJ A;  3P4S B;  1FNU A;  2V3P A;  1R4N B;  1SE3 A;  3IVF A;  1SEB D;  4PS3 A;  4PT5 A;  4JGH B;  3LB8 C;  1L4Z B;  3W9C B;  2IPK D;  5LXI B;  2H89 B;  1Q1O A;  4DK5 A;  3Q8C A;  1S3S G;  3P42 A;  4PS7 A;  3APC A;  1ISN A;  3AE5 B;  4ZRQ A;  1F52 A;  1AYF A;  3ZXR A;  5IP4 D;  3LYY A;  3KYC D;  1QOB A;  2W3R A;  2YEP B;  1QIL A;  4ZRP A;  3KH0 A;  1E9M A;  1FFU A;  1WJ4 A;  2DZK A;  5D2M B;  4GDL A;  4IKG A;  4KKI A;  2KMA A;  4KDI C;  2CHZ A;  2LRU A;  2TSS A;  4XDC A;  3R7Q A;  4ARC A;  3SHQ A;  1RAX A;  3IT6 B;  2DYB A;  2V3N A;  1WXA A;  5AZH A;  2WLB A;  4I6N B;  1AN8 A;  3AED B;  3NZ3 A;  3MTN B;  1F77 A;  3RCZ A;  2INN E;  3B9J A;  4EZK A;  2O6V D;  3IBE A;  1CK1 A;  1WXQ A;  3N20 C;  1YX5 B;  3DBR I;  1B9R A;  3D32 A;  2REX A;  2ZZP B;  3NZS A;  1Q0W B;  3ECI A;  2M8S A;  2JYE A;  2KDF B;  1IGD A;  1MI0 A;  4HKZ E;  2V4I B;  2MP2 B;  1ZOY B;  3RNG C;  3QAR A;  4MH0 E;  3QCA A;  4MH8 A;  1NVI D;  3NUH B;  3C19 A;  2WNM A;  1C77 A;  3FAH A;  2E6X A;  3VRA B;  3QWZ B;  2KTR B;  3DVG X;  3VR9 B;  1TZ1 A;  1PQS A;  2KZR A;  2MJE A;  1KOT A;  4DQO C;  1P7E A;  5L95 C;  1TTN A;  3ZUN A;  3Q3J A;  2M19 A;  1PDX A;  1WZ3 A;  3HVZ A;  2BF8 B;  5FK9 C;  3O65 B;  1HA5 A;  3ZNZ B;  1V1P A;  1KTK A;  2CJO A;  2JUO A;  3P4P B;  2J0K A;  3MC9 A;  4B95 A;  4ZYN A;  3VRB B;  4FXC A;  4GMV A;  3A9K A;  4LCD E;  1JWB D;  1TJE A;  4G3X B;  1SIF A;  5D6J B;  3L10 B;  4IUM B;  5EE3 A;  3LXF A;  4HEA 1;  4W9L A;  3AE2 B;  5G55 A;  2BQQ A;  1G6J A;  1UUP A;  4JQW C;  2QIL A;  2MWS B;  4DDI D;  2K22 A;  2KFJ A;  3CST A;  2L05 A;  4RFB A;  3TEY A;  2C7H A;  4J6I A;  2BYV E;  1TY2 A;  3QK0 A;  2O2V B;  3R3M A;  3NVW A;  3I63 C;  3MHZ A;  2JY6 A;  3EUB 2;  1F9J A;  1SXT A;  4YTN B;  2KHW B;  3RFZ B;  2WXJ A;  1WMH A;  1AW7 A;  3IXS A;  3VTW A;  1PGA A;  4OZB A;  4W9I A;  2ZNV C;  3UIN B;  3ZJV A;  2NTT A;  5JHB A;  3KWV A;  3VUW A;  2Y5C A;  1WFY A;  1L0V B;  1U4A A;  2WXN A;  2GLS A;  2WDT B;  1TS2 A;  3R2T A;  3QQ8 B;  4GDK B;  4IWP A;  5FR3 A;  3DCG A;  5GXG B;  2D10 A;  4FJY A;  3FC4 A;  3M63 B;  1L0X B;  2JVC A;  4LJO B;  1V86 A;  2O6V A;  4W9D A;  4HDQ A;  1EF1 A;  2G4S A;  4GU2 A;  3QAQ A;  1P9D U;  1E8Y A;  4REZ A;  2BB5 A;  2LVQ A;  4NQK E;  3CSF A;  1KLV A;  4KSL C;  2B3A A;  2KKC A;  2N1V A;  2YLM A;  3J9C A;  3DBH I;  3ZLZ A;  3OG5 A;  2IYD B;  4L1B A;  1NBF C;  2BYE A;  4DXG A;  5DPW A;  3E9S A;  4KV2 A;  4DBG A;  3M62 B;  3V60 A;  5IOI A;  3A1Q A;  1OQY A;  2XEW A;  2L52 A;  2IBI B;  4M00 A;  2IY1 B;  1KH0 A;  2BWF A;  2XN9 C;  2BGF A;  4ZRI A;  3RYT A;  2QC8 A;  3TEW A;  3BZD B;  4ANW A;  1NYQ A;  1K52 A;  4K7W A;  2FCQ A;  1WYW B;  4O1N A;  3N1Z C;  2Q5W D;  4C80 A;  3ZRF A;  3DVN U;  4MSM B;  2CHW A;  3OAW A;  2QIE B;  2ZW0 A;  4XGA B;  2XK5 B;  2KDE B;  4NZL B;  2C9W B;  1EWY C;  3H7S A;  4GB9 A;  4BOS C;  3RT3 B;  1QKZ A;  1UH6 A;  3AE7 B;  3TCA A;  2KQ4 X;  2DWQ A;  3I5J C;  3NRZ A;  3N32 A;  3AN1 A;  3BWU D;  2FCM A;  3MP9 A;  2KFK B;  5HHD G;  3PGE A;  3LJ3 A;  1F0Z A;  4M02 A;  4HJK A;  2INP E;  3DHH C;  1K53 A;  1IBX A;  3TL5 A;  3VDZ A;  1AAR A;  2NVU I;  4FAD A;  3VR8 B;  3BY4 B;  4NAW B;  3X23 A;  5C3J B;  2JXX A;  4UDU C;  3L08 A;  4M0W A;  2NS5 A;  1C4C A;  4LDT D;  4D2K A;  2KJH B;  2GI9 A;  2MBO A;  2WXF A;  1GNU A;  4AQ7 A;  4AUQ C;  1N5X A;  3N3K B;  3TBL D;  1XCQ L;  1EU3 A;  2LI5 A;  1JRP A;  2JXT A;  2LZ6 A;  1NI2 A;  1QOA A;  3GZN B;  1MPE A;  5T8I A;  2IO2 B;  3A9J B;  1Y56 A;  3R8B A;  2LXC A;  2JZZ A;  4US9 A;  2LJI A;  1WF9 A;  2L00 B;  1IGC A;  2WXH A;  3V3X A;  1BML C;  1WGH A;  2C5L C;  3FIL B;  4WUR A;  4EUT A;  2N7E A;  3GE8 C;  2KVR A;  2KAC A;  1LFD A;  5LNK 1;  4QAY A;  2D3G A;  4USA A;  2ZCC A;  1TZO A;  1UBQ A;  2DLB A;  3M95 A;  2X8X X;  2FCS A;  4NNJ B;  3SFD B;  5D3I B;  1CZP A;  3L54 A;  3UQB A;  1JQ4 A;  2PVO D;  2LGD A;  1UD7 A;  1BUI C;  4LNF A;  2KDI A;  3WAL A;  3Q3F A;  4K7S A;  1WXS A;  4WIP A;  1NEK B;  3BYT B;  1N62 A;  2DZI A;  3BYY B;  2Z8L A;  1C9F A;  1ZUD 2;  2EMT A;  2LGS A;  2WQY B;  4W9J A;  2PJH A;  4GSW A;  3CMM B;  1ROE A;  2QDF A;  4AWJ A;  1E6E B;  5FKA C;  5LLI A;  4IM0 A;  2PVG C;  1VDV A;  1MFW A;  4NAM A;  4ICV A;  5KHO A;  1GC6 A;  5TSS A;  5GMV A;  1ZDV A;  3VTV A;  3GB1 A;  2WDR B;  4L2Y A;  4FN2 A;  4C4V A;  1CMX B;  1JWU D;  1VRA B;  4KKJ A;  3EHV A;  2EMS A;  4KSK C;  4CYE A;  2SEB D;  5IO9 A;  2OOB B;  4HJG E;  4AJY B;  1MJD A;  3C8Y A;  3JSV A;  5C1Z A;  4YSZ B;  4OW0 A;  1QZE A;  1RRB A;  3SU8 X;  1UEL A;  2PE9 A;  1FM0 D;  4WAF A;  2FBW B;  2HTM E;  2CJN A;  1SBB B;  2QHO A;  5TR5 A;  1NI3 A;  2D5G A;  3EFC A;  4EKU A;  1T0Q C;  1I42 A;  3U52 E;  1EU4 A;  2EKI A;  3WAN A;  4ZDV A;  1M94 A;  2OED A;  4YTM B;  2WU5 B;  4EFO A;  1XCT L;  4R3D A;  1FO4 A;  5D7G A;  3IFW B;  3L17 A;  1GB1 A;  3ZNI D;  1LM8 B;  2IO3 B;  1I4R A;  4AJW A;  3ZO5 B;  1V97 A;  2WXK A;  1IYF A;  3B08 A;  1WM3 A;  3W1S A;  1FEH A;  3BK1 A;  3HK0 A;  2KO3 A;  5C2T B;  1KRH A;  4FHK A;  1J7A A;  1FD6 A;  3ZKJ C;  2RR9 A;  2KXJ A;  3AE1 B;  1ZW7 A;  1OQQ A;  3I9V 1;  2AQ3 B;  2R2Q A;  1TKG A;  1WRI A;  4IWQ A;  3VTU A;  5D94 A;  4OZA A;  5G5H A;  2XNA C;  1VZ6 A;  3N1X C;  2JSV X;  3MC8 A;  1ZXI A;  2M56 B;  4ARI A;  3EFU A;  1V6E A;  5JXV A;  2KLC A;  2NBV B;  1WM2 A;  3PTF C;  5JZE B;  2EKE C;  1FCC C;  5CX3 A;  3PRZ A;  3TIX A;  3U2S C;  2NTS A;  4FLH A;  1SE4 A;  2KTR A;  4NJ7 A;  1OQR A;  2ASQ A;  1P7F A;  3V6E B;  3DHI C;  3PVL A;  1YN5 A;  4S0R A;  3PRP B;  3RMK C;  1I7H A;  3N30 A;  4II3 B;  3SDL C;  1XLQ A;  3KLS X;  2AWT A;  1E10 A;  1C78 A;  4BKG A;  3HHM A;  3ZDM C;  3OJ4 B;  3PLU A;  1Q10 A;  4IM2 A;  1YNT E;  2L3Z A;  1I35 A;  3UI3 A;  1V5T A;  3QIJ A;  4WWM A;  1VD2 A;  1WR1 A;  3RZF A;  2LMC A;  4LDT B;  1WX7 A;  2QMT A;  3HM6 X;  1QOF A;  4IWO A;  2MBE A;  1WGG A;  1GOZ A;  1EWC A;  1LO5 D;  3QJZ A;  1DGJ A;  3WAM A;  3ZRC A;  3GOE A;  1I4P A;  3BVZ A;  4HCN B;  2W3S A;  3BVM A;  5J2R A;  2GOW A;  3RNC C;  3HM3 A;  5AUK A;  4K81 A;  1JCK B;  3ML8 A;  4WWP A;  4I6P A;  4LNI A;  2BS2 B;  3AMZ A;  3U7Z A;  5JHA A;  2NR2 A;  3AE9 B;  1EUV B;  4B9K A;  2WYQ A;  2L76 A;  3DBS A;  1E8X A;  5IN7 A;  1ET6 A;  1HEZ E;  4DXF A;  3Q8B A;  2RSU A;  5C23 A;  1FNW A;  2HJ8 A;  3IG3 A;  2N9X A;  5E6P A;  2RDG A;  1UWM A;  4HDO A;  1MVK A;  2WDQ B;  2G1E A;  2NPT B;  3VFK A;  1J8C A;  1SJH D;  1TYG B;  4E74 A;  3Q8E A;  4S17 A;  5IKC M;  2IZV B;  1F2R I;  3R2I A;  1XO3 A;  3PZD A;  4YWG G;  2QSD A;  3Q3M C;  4GXB A;  2JRI B;  2D07 B;  5I4D A;  2WGS A;  1N6Z A;  1UGM A;  1WE7 A;  2G4D B;  4GOC A;  4A3P A;  3SR6 A;  2QEJ C;  2ZJD A;  1H4R A;  2K5P A;  2ZNV B;  2D3C A;  4MT5 A;  1YOV B;  2V1Y A;  1R4N I;  4F8C B;  1L6V A;  1TT5 B;  1GPX A;  3UIO B;  4FJV B;  4XC2 A;  1FXA A;  3QA8 A;  1JRO A;  1GC7 A;  2V4L A;  4CO7 A;  1C1Y B;  2K6D B;  3W1S C;  1HTO A;  3DWM A;  4F7Z A;  1C3T A;  3KUZ A;  2MJD A;  1VR9 A;  4GN1 A;  1IPG A;  4N6E B;  4HKQ A;  4C7Z A;  2N9K A;  2GBR A;  2WXM A;  2BYF A;  4WQO B;  1DOI A;  4C56 C;  2WX1 A;  1R7S A;  2MH7 A;  4MEM A;  4URK A;  4GDL B;  3RN9 C;  1QOG A;  1QF6 A;  2K39 A;  3PHX B;  4KGR A;  2H88 B;  1V49 A;  4AP4 C;  1DOY A;  1C4P A;  2LFI A;  3L0W B;  1QQR A;  2KFK A;  2L7R A;  2YVC A;  1V1O A;  1XLP A;  1E7U A;  4HRS A;  3GP7 A;  2G45 B;  3PRM B;  4WWN A;  2BWE S;  4GLS C;  4RMA A;  1E5W A;  2PMV A;  2L32 A;  1L7Y A;  2Z59 B;  4ITK A;  4KIK A;  2LD9 A;  2K8C A;  1EF5 A;  2WXR A;  1SIJ A;  5E6N A;  3H7P A;  4FUL A;  4BKT A;  1K8R B;  4IG7 B;  4K7U A;  1TS5 A;  3PZ7 A;  4HRO A;  2MJ3 A;  4TKN A;  2KN5 A;  5AUI A;  2ZPN A;  2KJ6 A;  4M01 A;  4ACF A;  3NVZ A;  5EE9 A;  3L16 A;  3RNA C;  4XDD A;  3Q6B A;  2JZP A;  3W2D A;  3BK2 A;  4Q2J A;  4KGT A;  1J0G A;  4RGO S;  3RNB C;  4LTU A;  2XBB C;  2ZW1 A;  4GGQ A;  3ZJU A;  2G9H D;  4HPM B;  4RM9 A;  5G2N A;  2GRI A;  1V80 A;  2ON8 A;  4DXA B;  2QJL A;  3KUC B;  1HXY D;  4XX5 A;  3H1U A;  1VCB A;  4XWT A;  2EEL A;  1D5M C;  2KMC A;  2HDE A;  2LGI A;  3NVV A;  1NYR A;  2N9E B;  2KJR A;  1V1P B; 
#chains in the Genus database with same CATH homology
 5IOI A;  1MJD A;  1MFW A;  2DNF A;  5IN7 A;  5IKC M;  2BQQ A;  5IO9 A;  1UF0 A;  5IP4 D;  1MG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...