2DNFA

Solution structure of rsgi ruh-062, a dcx domain from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
GSSGSSGRKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLRSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYGELLFDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Doublecortin domain-containing protein 2
publication title Solution structure of RSGI RUH-062, a DCX domain from human
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 2dnfA01
5IO9A 1MG4A 2DNFA 5IKCM 1MJDA 5IOIA 5IN7A 5IP4D 1UF0A 1MFWA 2BQQA
chains in the Genus database with same CATH superfamily
2RGFA 1V49A 3A9JA 4FJYA 4DDGD 1YX5B 2KZRA 4RGNA 1H8CA 1C78A 4I6NB 5IP4D 5D7GA 4JX1C 2GMIC 4LJOB 1SF0A 4S17A 2DLBA 2M19A 2KTRA 4FADA 3ZJVA 1WE6A 1ZUD2 2AL6A 4S0RA 4YTMB 1XO3A 5EE9A 2RDBC 1WMHA 1UH6A 2DYBA 3A1QA 3DVGY 4HWIB 2D3CA 3ZNZB 4KDLB 4RM9A 1IGDA 1ESFA 2NS5A 2NR2A 4CHKA 3I5JC 2WXNA 4RGOS 3BVMA 2KN5A 1WYWB 3U7DA 3R66C 3SD5A 3ALBA 4FN2A 2PE9A 2O6VA 1SSNA 3EA6A 2LRUA 2ASQA 4A9AA 5FKAC 2BBCA 3BYTB 3JVZX 3B9JA 3UIPB 3PSEB 1CQVA 4TV3A 4NAWB 3LYYA 1GB4A 2YEPF 4LNIA 1WYGA 1TTNA 5JXVA 2Z59B 3RT3B 1E7PB 4IM2A 4JE3B 2W3RA 2BS3B 5C1ZA 4JPSA 1WX9A 2W55A 1I4RA 4XWTA 4HK2A 2CHWA 1L5PA 3K9PB 3QHTA 4P7IA 3NOBA 3APFA 2KLCA 4AWJA 4DHJB 3DHGC 4NAMA 2WNMA 1TS5A 4MJSB 4F8CB 2OJWA 3PRMB 3QARA 1JCKB 3N3KB 2V4LA 1ZGUB 2PLPA 5BYSA 4FHJA 2VRRB 1KOTA 2KWVB 1EF1A 2B76B 2QHOA 1AARA 5J18A 3U52E 2WWZA 5T8IA 1QQRA 2DAFA 4DXFA 3PTFC 4RFBA 2MX2A 3SU8X 3NS1A 2REXA 3UQBA 5H8YE 2AQ3B 1MFWA 2KACA 3ZKJC 1TIFA 1ZPSA 3NZSA 3Q8AA 2UWQA 1QOBA 2GB1A 4CQNA 2IYDB 5D2MB 4NAWA 2MP2A 1T0YA 3R8BA 2V3NA 2D11A 3PZ7A 4RCOA 4HKZE 1SE9A 1YJ1A 2FAZA 2CHXA 3NVWA 1P9DU 5AUIA 3IVFA 1Y8RC 1DYQA 2V4IB 4ITKA 2FUHB 3MJWA 4EEWA 1DGJA 5LXIB 1WFYA 1CJEA 5JH5C 2IY1B 3VH4B 3X0WA 3A9KB 3EHVA 3NHEB 3ZJUA 2EELA 4OVVA 2LHDA 3O13A 2PE6B 4ZYSA 1YNTE 2BYFA 3Q8BA 2WXFA 1C76A 5FR6A 4W9GA 2KNBA 1HXYD 2MW5A 1VZ8A 2HE7A 3D32A 4BOSC 1S3SG 3NVVA 2JZPA 1JRPA 1WJUA 2KFKA 2NBWB 4L1BA 2GBRA 3KUCB 5HHDG 2WX0A 2C7HA 3ENEA 5AZGA 3ZIMA 4J6IA 5CHVC 5CX3A 3AM9A 3A4RA 1UUPA 3FAHA 4EZKA 4EKUA 5AUKA 1N5XA 2KANA 1FXIA 2LGDA 4K1RB 5D3DA 3DHIC 3AV8A 4URKA 2K1FA 3FKYA 3BZDB 1XEEA 1N60A 1UBQA 3AU5A 1T3QA 2VH1A 1I4PA 2JVCA 4DHJD 5HG2A 3VUXA 2W9NA 5C3JB 1STEA 2JZZA 5LXHA 3UQAA 1JWAD 4K7SA 4FXCA 3VUWA 5L83A 1I35A 1MVKA 2L32A 4I6PA 3NVZA 3V62A 2AQ2B 1WE7A 3W1YA 3IT4B 2BGFA 3OG5A 2FUG1 3AE6B 3MC0B 2O2VB 1GC6A 3Q8EA 3W5VB 1IYFA 4LCDE 1E8ZA 3U2SC 1HE8A 1ZXHA 2WP9B 4M02A 4RM8A 3VR8B 1V1PB 3RNAC 1FM0D 3FILB 3WAPA 1HZ5A 1I7HA 1KLGD 3UIOB 1OQRA 1TBEA 1LXDA 2KT7A 2MHJA 1WZ3A 1FNWA 4RF1A 1DOYA 2C7MB 4PT5A 2LWPA 2PPHA 4XE0A 3N1YC 1KM7A 4WH4A 4TKNA 2V0GA 3JYUA 3Q14C 1V6EA 1D3ZA 2QMTA 1PGXA 1F9JA 2V1YA 1E10A 2BWES 1WF9A 2UYZB 4WURA 3QQ8B 3R7QA 4BKSA 3HIZA 1LGRA 2KK8A 4TUUA 3TEZA 4B0EA 4LDTB 4ZDVA 2NBVB 3P2BA 3T3OA 4KV2A 1QILA 1HA5A 3IT6B 3V6EB 1SIFA 5AZFA 3VUYA 3N1ZC 4GIVA 4C00A 1YQ4B 3RNBC 4KGSA 3OJ4B 2RD0A 3BK2A 1IGCA 2FCNA 2BS2B 1OFFA 4ZOHC 1C77A 2JYTA 4N58A 1KLUD 4WJNA 4WJPA 2KDMA 3KQ4A 4C4VA 3L13A 4G3XB 2LVOA 1L0YB 1F1HA 4X57B 4DDID 4K7UA 1KRHA 4K3BA 5IO9A 2YVCA 4M01A 3PHWB 3ZYYX 5FK9C 1FO4A 2LJIA 1UZXB 4OHJA 2KHWB 4JWUC 3N32A 5KHOA 3BYYB 4D2KA 5BMGA 1JWBD 3Q2AC 2KJHB 1QF6A 4MH0E 1T6BX 1XF5L 1K8RB 3MJ5A 4NY0A 3T3NA 4RH6A 1WXVA 1AYFA 1C4CA 2KC1A 3QCAA 4K81A 4TMAB 3WA0A 2BWFA 1I42A 1RRBA 4OZBA 3J9CA 3IAM1 2WHIA 1C4PA 1DOXA 1FNUA 2MH7A 4RGTA 4BAXA 2DZJA 2BPSA 4FHKA 3JW0X 3P4PB 2LUEA 1WM3A 2G9HD 2L52A 3MC8A 4I6LB 4PYUA 3AU4A 1WZ0A 3RNGC 2MCNB 4HVBA 2GBJA 1QOGA 4M8NA 4BFRA 1UF0A 1UD7A 4KZCA 3AB5A 1F77A 2EKIA 1TJEA 2YEPB 2L76A 4IWPA 4LDTD 3A9JB 4FJVB 1PUTA 2VH2A 5BO4B 2KQSA 1J7AA 2DZIA 3A33B 4FULA 2M17A 3Q3FA 5G5HA 1HTOA 2GI9A 1WRDB 2KVRA 1GOZA 4KVGB 4B0MA 4C80A 3IAS1 1FRDA 3AE4B 4MACA 1V81A 3CIRB 4US9A 1UBIA 1SEBD 2KTRB 4EFOA 4MSQB 2GBNA 2RDGA 1R4MB 3E56A 3V05A 2BB6A 1P0RA 2ZCCA 3GB1A 3Q8CA 4A3OA 4IW0A 1T5XD 2RSUA 4OVUA 2DYOA 1E8WA 1WMHB 3KW5B 1F52A 1MG8A 1CZPA 3H7PB 1WY8A 3I3TB 3H6NA 1F2RI 4WAFA 3DBLI 3A1QB 1IPGA 3SDLC 2MLBA 4WWPA 4GSWA 3NZUA 4L23A 1L2NA 4HROA 2B3AA 2PW9A 3L10B 3L4PA 2FCSA 4H2AA 2KD0A 2L00B 2CHZA 3RI7C 4E3CA 3GZNB 4KIKA 3DDCB 4GB9A 2LI5A 3DBHI 2SAKA 5FR3A 2M8SA 2KVZA 2O6VB 3TJPA 4GDLB 1T0QC 3TEXA 4ZHPA 1EU4A 1ZW7A 2WYQA 1T0SC 1XLPA 1OQYA 1XCTL 4HDQA 2XEWA 4P1CC 4WIPA 1YOVB 4NZLB 3AEBB 2DZKA 3ZDTA 2N9KA 1EWCA 1RFKA 1RWSA 3OLMD 2OJRA 2LRWA 1WGYA 2K6DB 4YL8A 4RF0A 4HPMB 3H7PA 2ICIA 1R4NB 2NBUA 2JX5A 4DBGA 2KFJA 2MJ3A 3C8YA 4ANUA 1N5WA 5HKHA 2MQJA 2G45B 5G5GA 1R4MI 1L6UA 2CJOA 2Z0DB 3VDZA 5GXGB 5EE3A 2KMCA 4PS3A 1FD6A 4YTNB 2BYEA 1WRIA 3NJTA 2ACZB 3ML8A 4GDLA 3U7ZA 4E74A 1TY0A 1XLOA 4N59A 4ICUA 2BKFA 4XDDA 3OAWA 2NPTA 1WI0A 3NVYA 1UGJA 2MP2B 4XGAB 1RAXA 2MBEA 2M1MA 1YN5A 1P7FA 2Q5WD 4G50A 4IM0A 4TSSA 2N9EB 3EFUA 3GZNI 2ZW1A 3QAQA 2XK5A 3TBLD 5LNK1 4KSLC 4W9DA 5DPRA 1L6VA 3I9V1 3APDA 2LEKA 1IBXA 3SHQA 4AP4C 4EZJA 1QT9A 5E6JA 3DCGA 3IHPC 4IM3A 4AUQC 2XBBC 1VLBA 3AXCA 4KSKC 4KKJA 3LJ3A 4US8A 2IPKD 4HRSA 4PS8A 3U4EG 1NI2A 1L0VB 2O6VD 3IG3A 3ZDMC 2Y3AA 4REZA 3QJZA 4W9KA 1NDDA 2KFKB 2WU2B 4MELA 3UGBB 4HCPB 4M0WB 4AJYB 4RMAA 1ZOYB 3MHZA 2CR5A 4MGYE 1E90A 3K9OB 4YSYB 2XNAC 3ETRA 1WJ6A 2WXLA 4YT0B 3Q3JA 1M94A 1MI0A 3W9CB 4F7ZA 3P63A 3ZQ4A 2KOXA 2INDC 1SGHA 1YIWA 1MHHE 2W3SA 2DX5B 1WJ4A 2JWZA 2AWTA 2I2YA 4B6WA 4KZ0A 1V80A 1HQRD 1MJDA 5H92C 4TQ1A 1JROA 2K5PA 1T0RC 4G0NB 1JRUA 3KYDD 1OGWA 4J3OD 2R2OA 2KYWA 4IWOA 3AE5B 3NY5A 3ZRFA 1AW7A 1V5TA 2SEBD 5BMHA 1FEHA 1V97A 2JRIB 2LGSA 2L3ZA 2R2QA 3PLVA 4BKTA 1J19A 4MEMA 4FA6A 3PZ8A 1TKGA 2L1AA 3ZGZA 3JSVA 4ZRIA 2DNFA 2WQYB 1GG3A 4M0WA 3Q3OC 1VRAB 3Q3NC 3PV1A 3PLUA 3RN9C 1GNUA 1LFDA 2KDFB 2QC8A 2IGHA 3OWEB 1C4AA 3ZXVA 2R61A 3ZNHB 2J0MA 2J0KA 2LVQA 4XZ4A 3U30A 2WXKA 2FCQA 4KDIC 1V1OA 4IWQA 5IOIA 2KJ6A 3N9YC 1A70A 3PREA 1XT9B 3DBRB 3MFGA 3RCZA 2Y5CA 3RFZB 4DWFA 5I4DA 4N9F4 2LGIA 1KTKA 3SFDB 2LASA 3Q6BA 2DAJA 4MM3B 3AULA 3IXSA 4P1BC 5CHWA 2NMQA 1J7CA 2ZPNA 1VJKA 1L7YA 3E9SA 2WXHA 4NJ7A 4NJCA 3KUDB 3QK0A 3L17A 1XCQL 1C1YB 1GAQB 1CK1A 1JWSD 2J7QB 4C4VB 2DHZA 2XN9C 3DWGC 2G4SA 2QEJC 4K3CA 4XX5A 3WAOA 1N6ZA 4JQWC 2FIDA 1PQSA 2OEDA 3R2TA 2EKEC 3PO0A 3AEGB 2C5LC 2CKHB 2LD9A 1NYRA 3KLSX 4WJQA 4ANXA 4A3PA 2KDBA 3ZRCA 4HEA1 3VTUA 2IO2B 2PJHA 1Y56A 2D10A 1KFYB 1D5XC 2FBWB 3VTVA 1J8CA 1MG4A 3AE9B 1R7SA 1ET6A 4TQ0A 2N9PC 3VRAB 3ML9A 4GXBA 1ZP0B 1TZOA 2K3UA 1WGHA 3MHSD 1TKEA 1VR9A 2MBQA 2ZCBA 4KX6B 4QAYA 2EMSA 2JSVX 4MM3A 2VZKB 1OEYA 2N0SB 4W9FA 3H1UA 5CTRC 2K6QA 1I4HA 2CU3A 2KKCA 3ZW3A 3VR9B 1MPEA 4EUTA 2MEKA 1FFUA 1XQQA 1AN8A 1P7EA 2GOWA 1LQBA 2RDHA 3O65B 1Z2MA 3NZ3A 4USAA 3DBRI 2ZNVC 1CMXB 3AEDB 3M62B 5BYQA 3TCAA 3RZFA 3W1SC 1ACCA 2IGDA 3TL5A 3APCA 1KLVA 4BKSD 4HPPA 4YTPB 4GU2A 4LNFA 1EF5A 3WAMA 1K51A 1YQ3B 2Y5PA 1UNSA 1E7VA 1QOAA 3RULA 2BTEA 2GBMA 2ZVOA 2KWDA 5D94A 5J17A 4WWOA 3EFCA 4KGRA 1WSPA 5EDSA 3R3MA 1RM6C 1F0ZA 4MDKE 3WANA 2H88B 1L4ZB 4II3B 1E5WA 4WQOB 2LVPA 2KX0A 2L7RA 1QKZA 3QA8A 4GMVA 1HTQA 2HJ8A 2C7NB 3NG0A 4YSXB 2KXJA 4LTUA 2FE8A 2KWUB 3NUHB 3PT2B 1E0ZA 1TS2A 3RNFC 1WXQA 1SE3A 2QSDA 1E8YA 1IUEA 3HHMA 3GE8C 5C23A 3Q3MC 1B1ZA 1V9JA 3B2GA 2L0TA 5L95C 4PYZA 1WXAA 5G2NA 2KMAA 4JIOU 4YSZB 2N9LA 2A5UA 4B9KA 2RMMA 4BBNC 2LHEA 2LMCA 2QJLA 2QIEB 2MA9B 4EOYA 2FIFA 3CSFA 4KIKB 1RYJA 3ZNGC 2H89B 4BOZB 2WXJA 3AEEB 1VD2A 4LNNA 2BS4B 4B95A 3QWZB 2MWSB 1JALA 1V8CA 1D6EC 4XC2A 4LLGM 1I4QA 1SJHD 3C19A 3QIJA 1QOFA 3QX1A 4IDIA 2J52A 2JXXA 2M56B 1V86A 4LK0M 4KKIA 1K50A 4WAAA 4Q2JA 1WIAA 1C3TA 2IO3B 1FFVA 3B08A 3V6CB 1TYGB 1HZ6A 1SE4A 2QDFA 2K8HA 4W9CA 4DK5A 1DOIA 1GJZA 2J4XA 3TSSA 4A55A 2BF8B 3ZTCA 3BWUD 1IP9A 2RPVA 1QZEA 3DPDA 3L0WB 3IFWB 3H9DA 2PTLA 1YJIA 4MH8A 5E6OA 3UINB 1EWYC 1NBFC 2PVOD 2OOBB 4A90A 1WX8A 2Y5BB 1C79A 3LDZE 1NEKB 3AE3B 4DXGA 3KH0A 1WGRA 4HJGE 5TR5A 2WXGA 2KQ7A 2L83A 4CYEA 4ZHOA 2INCC 4MGKE 2M0AA 2UU7A 2JPHA 2NPTB 2KTFA 1YD8U 4ZRJA 4DXAB 3GS2A 3VH3B 1YX6B 2HD5B 1NYQA 2D3GA 4C56C 1I4XA 3RD2A 2LGYA 3SR6A 2IGGA 4LJPB 3LXFA 2X8XX 4JLCA 3H8HA 3VTWA 2N4FA 1Q0WB 4P6VF 1K52A 1ENFA 4ASWC 2XK5B 4MGIE 2ZW0A 3EECA 2ZJDA 2PVGC 1IBXB 4N6EB 1P98A 3AEAB 3EGRA 3I57A 3AH7A 2KO3A 3ZUNA 5D6JB 5BYRA 5JHBA 2MJEA 1VZ7A 4HCNB 5HI1A 1B9RA 2INPE 1PFDA 1ZXIA 2LGXA 2BYTA 3ZVVA 1U4AA 3Q69A 4MT5A 5J2RA 4C7YA 1AWDA 1PGAA 5DPTA 1VCBA 3UF8A 5IN7A 4P16A 2LFIA 3AN1A 1Q10A 4JL9A 4A20A 2IO1B 4E71A 1TS3A 2K9XA 2GRIA 4WWMA 4GDKB 2X38A 1KJTA 3KYCD 2JRHA 4NJ6A 4NNJB 3PZDA 3PVLA 1G6JA 1K53A 4AS1A 3W1SA 3HVZA 4DQOC 2D3AA 4OZCA 1ROEA 2I1KA 3DBSA 4HDOA 3BINA 2JYEA 5E6NA 2BQQA 2D3BA 3BK1A 4PK1A 1SB3C 2HTHA 4LNOA 2KQ4X 3CMMB 3HVDA 2KX3A 1FPYA 2BW2A 1WJNA 4BVUC 3TIXA 3UI3A 3M95A 2J53A 4OVZA 2KN4A 5GMVA 3M63B 2QCZA 5LLIA 4ZYNA 3P4QB 3WALA 3R7RA 4KGTA 3IBEA 5MPOA 2RPQA 3RZWC 4GGQA 1YN3A 3AEFB 2ON8A 2AQ1B 1JMLA 3JSVB 1BMLC 3VAWA 2G3QB 4ANWA 3DQVA 4HPLB 3KUZA 1GPXA 1YJJA 5DCNA 1FCLA 1EO6A 1NVID 4ARIA 2PEAA 1D4BA 2TSSA 4GDKA 1WGKA 5DPSA 1R4NI 2C60A 4IG7B 2MRPA 3RMKC 3V60A 4XYCA 4OZAA 4ACFA 5IA7A 1SXTA 3RUIB 3ABVB 3ECIA 3GP7A 5BMIA 4ARCA 2ZPYA 1VZ6A 2IBIB 1WGDA 3Q8FA 1TT5B 2J0JA 2K39A 2AYOB 2WXMA 2V3SA 1WH3A 3X23A 1XD3B 2N7DA 3L54A 4A6QA 1P3QU 3NRZA 4NQLB 2WXIA 4W9EA 3LB8C 3CSTA 3VFKA 2PKOA 1QLBB 2G4DB 3AE8B 2DENB 1PGBA 2HTME 3GE3C 3RYTA 4CO7A 1JW9D 2IJ0A 2WXRA 2LZ6A 3DVGX 4HXDA 4YXDB 2W54A 4MJSA 1H4RA 2BVCA 1FXTB 4HLEA 3CF6E 2KMMA 5E6PA 5TSSA 3FC4A 2N7EA 3B0AA 4IUMB 2DBYA 2JUOA 3OJ3A 3BVZA 2N9XA 3N30A 5JHAA 3ZLZA 1N62A 1F2RC 3CWIA 4IC7B 1ZDXA 1NI3A 2HDEA 2WDQB 1E7UA 1TS4A 4GLSC 3RNEC 3HK0A 5IKCM 3VRBB 1J0GA 1FRRA 2ZZPB 1SE2A 3TMPB 2JF5A 4BBNF 4NQKE 4GOCA 2KAJA 4WWNA 3WIMA 4BKGA 1ZDVA 2ONQA 2A4ZA 4II2B 3MTNB 2KDEB 2OHFA 4RGMA 3SFEB 3EC8A 3V61A 2FNJB 3DHHC 3ONSA 1TGZB 2GBKA 2KJRA 4W9JA 1LM8B 2WDRB 3I63C 4M00A 1Q5WB 1Z5SB 2LXCA 4WQMA 3RNCC 5C2TB 5AEKB 2G1EA 1HEZE 3AECB 2WX1A 2NTSA 1VDVA 4XDCA 1Q1OA 1NENB 3A9KA 5CHFA 2WDTB 4JGHB 1N63A 3AE7B 4MSMB 2MBBB 1RFAA 2AX5A 2DWQA 4NPNA 3ZO5B 3C0RB 4M8MA 4BZAA 2QILA 1JQ4A 3R2IA 2JWUA 2HJ1A 2V3PA 2NCNA 4HJKA 2YLMA 1WM2A 4ZRKA 4AQ7A 3AE1B 3URYA 1EM7A 2WDVB 1FIQA 5KHQA 1KH0A 3PS6A 1GUAB 1E6EB 2INNE 4G11A 3B1LX 2WGSA 4RNAA 5IAAC 1PYWD 4FLHA 2L05A 1D5ZC 1WX7A 2JT4B 1X1MA 1ET9A 1PDXA 3MP9A 1SJED 1WGGA 3VHTC 4ZRPA 3P42A 1XXGA 3HM3A 4W9IA 3TEYA 2KC2A 2JXTA 3N1XC 2LUMA 2MSED 3PGEA 1M4VA 2E6XA 2WS3B 2ZEQA 3VVWB 5EE0A 5DPWA 2D5GA 2DZMA 2MBHA 1BXTA 2KDIA 1YN4A 2I1JA 1FMAD 2Z8LA 3PPAA 4ZRQA 3TEWA 1UELA 3VXWA 3A4SC 3P1MA 3DVNV 3DVNU 3L08A 2K8BA 1A5RA 2AEHA 2CU1A 2NVUI 3AMZA 2WU5B 3DWMA 2O2VA 2WXPA 5JZEB 3H7SA 4A8XC 2FCMA 2KLGA 1SIJA 4O1NA 1WXSA 1WWTA 2L8JA 1V1PA 1YMHE 2CJNA 3FILA 3W2DA 2K0PA 1V2YA 1WXMA 2I38A 2WXQA 2RR9A 1SBBB 3T9LA 2IY0B 4FBJB 2M0XA 4R3DA 2NTTA 2BKRB 1JWMD 1V5OA 3PHXB 2E3TA 4K7WA 1BT0A 4DHZB 4IOIE 2D07B 3S2AA 3BY4B 3M3JA 3W5UB 3ZNID 3DBLB 2N1VA 3MC9A 1WR1A 3ZJTA 2C9WB 5AZHA 3T8MA 4MGZE 1JWUD 5EE1A 5D3IB 3N20C 3AE2B 4OW0A 4C7ZA 2Z0EB 2MJDA 3DBHB 2ZVNA 4DHZE 1OQQA 1XLNA 1TZ1A 4EZLA 1FXAA 2WLBA 1UWMA 3V3XA 2BYVE 3RPFC 2DYMA 3ZTDA 2PIAA 3HM6X 2D2QA 2BB5A 1WR6E 1XLQA 2JZ3B 4WJOA 1FCCC 2LJ5A 3KWLA 1ZKHA 2CS4A 2J42A 3P4SB 2K22A 5HFYA 4YWGG 3HUIA 5G55A 2VZKD 2PMVA 2IO0B 4L2YA 3KWVA 4F1SA 2N7JA 1RLFA 2IZVB 3GOEA 1D5MC 1FNVA 2KWCA 4FJZA 3U8ZA 4AOFA 2GLSA 3B2FA 4W9HA 3QC8B 1E8XA 1I4GA 4XWWA 1E9MA 1UGMA 2W82A 1OTRB 2EMTA 2N1WA 3KVFB 4AJWA 3BVGA 2V9HA 3HRDD 4ICVA 1L4DB 3DOWA 3BIID 1J7BA 3L16A 2L0FA 3ZXRA 2K8CA 1YQBA 3PRZA 3AI5A 1UWXA 2JQRB 3WCQA 2JU6X 4UDUC 4ANVA 1EUVB 2JY6A 1GC7A 1L0XB 1P1AA 3TUOA 1OEYJ 4PS7A 1KF6B 3EUB2 3P4RB 1TY2A 2MBOA 2ZNVB 3NS8A 4HKQA 2WXOA 4IKGA 1ISNA 3SEBA 1LO5D 1GB1A 4EE2A 1N61A 1ZE3D 3VQIA 1C9FA 2AL3A 1MHXA 1S1QB 4LNKA 1TKYA 2IDYA 2M4NA 3PRPB 4W9LA 1EU3A 4GN1A 1BUIC 2LXAA 4JWSC 2K25A 2BT6A
chains in the Genus database with same CATH topology
5IO9A 1MG4A 2DNFA 5IKCM 1MJDA 5IOIA 5IN7A 5IP4D 1UF0A 1MFWA 2BQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IO9 A;  1MG4 A;  2DNF A;  5IKC M;  1MJD A;  5IOI A;  5IN7 A;  5IP4 D;  1UF0 A;  1MFW A;  2BQQ A; 
#chains in the Genus database with same CATH topology
 2RGF A;  1V49 A;  3A9J A;  4FJY A;  4DDG D;  1YX5 B;  2KZR A;  4RGN A;  1H8C A;  1C78 A;  4I6N B;  5IP4 D;  5D7G A;  4JX1 C;  2GMI C;  4LJO B;  1SF0 A;  4S17 A;  2DLB A;  2M19 A;  2KTR A;  4FAD A;  3ZJV A;  1WE6 A;  1ZUD 2;  2AL6 A;  4S0R A;  4YTM B;  1XO3 A;  5EE9 A;  2RDB C;  1WMH A;  1UH6 A;  2DYB A;  3A1Q A;  3DVG Y;  4HWI B;  2D3C A;  3ZNZ B;  4KDL B;  4RM9 A;  1IGD A;  1ESF A;  2NS5 A;  2NR2 A;  4CHK A;  3I5J C;  2WXN A;  4RGO S;  3BVM A;  2KN5 A;  1WYW B;  3U7D A;  3R66 C;  3SD5 A;  3ALB A;  4FN2 A;  2PE9 A;  2O6V A;  1SSN A;  3EA6 A;  2LRU A;  2ASQ A;  4A9A A;  5FKA C;  2BBC A;  3BYT B;  3JVZ X;  3B9J A;  3UIP B;  3PSE B;  1CQV A;  4TV3 A;  4NAW B;  3LYY A;  1GB4 A;  2YEP F;  4LNI A;  1WYG A;  1TTN A;  5JXV A;  2Z59 B;  3RT3 B;  1E7P B;  4IM2 A;  4JE3 B;  2W3R A;  2BS3 B;  5C1Z A;  4JPS A;  1WX9 A;  2W55 A;  1I4R A;  4XWT A;  4HK2 A;  2CHW A;  1L5P A;  3K9P B;  3QHT A;  4P7I A;  3NOB A;  3APF A;  2KLC A;  4AWJ A;  4DHJ B;  3DHG C;  4NAM A;  2WNM A;  1TS5 A;  4MJS B;  4F8C B;  2OJW A;  3PRM B;  3QAR A;  1JCK B;  3N3K B;  2V4L A;  1ZGU B;  2PLP A;  5BYS A;  4FHJ A;  2VRR B;  1KOT A;  2KWV B;  1EF1 A;  2B76 B;  2QHO A;  1AAR A;  5J18 A;  3U52 E;  2WWZ A;  5T8I A;  1QQR A;  2DAF A;  4DXF A;  3PTF C;  4RFB A;  2MX2 A;  3SU8 X;  3NS1 A;  2REX A;  3UQB A;  5H8Y E;  2AQ3 B;  1MFW A;  2KAC A;  3ZKJ C;  1TIF A;  1ZPS A;  3NZS A;  3Q8A A;  2UWQ A;  1QOB A;  2GB1 A;  4CQN A;  2IYD B;  5D2M B;  4NAW A;  2MP2 A;  1T0Y A;  3R8B A;  2V3N A;  2D11 A;  3PZ7 A;  4RCO A;  4HKZ E;  1SE9 A;  1YJ1 A;  2FAZ A;  2CHX A;  3NVW A;  1P9D U;  5AUI A;  3IVF A;  1Y8R C;  1DYQ A;  2V4I B;  4ITK A;  2FUH B;  3MJW A;  4EEW A;  1DGJ A;  5LXI B;  1WFY A;  1CJE A;  5JH5 C;  2IY1 B;  3VH4 B;  3X0W A;  3A9K B;  3EHV A;  3NHE B;  3ZJU A;  2EEL A;  4OVV A;  2LHD A;  3O13 A;  2PE6 B;  4ZYS A;  1YNT E;  2BYF A;  3Q8B A;  2WXF A;  1C76 A;  5FR6 A;  4W9G A;  2KNB A;  1HXY D;  2MW5 A;  1VZ8 A;  2HE7 A;  3D32 A;  4BOS C;  1S3S G;  3NVV A;  2JZP A;  1JRP A;  1WJU A;  2KFK A;  2NBW B;  4L1B A;  2GBR A;  3KUC B;  5HHD G;  2WX0 A;  2C7H A;  3ENE A;  5AZG A;  3ZIM A;  4J6I A;  5CHV C;  5CX3 A;  3AM9 A;  3A4R A;  1UUP A;  3FAH A;  4EZK A;  4EKU A;  5AUK A;  1N5X A;  2KAN A;  1FXI A;  2LGD A;  4K1R B;  5D3D A;  3DHI C;  3AV8 A;  4URK A;  2K1F A;  3FKY A;  3BZD B;  1XEE A;  1N60 A;  1UBQ A;  3AU5 A;  1T3Q A;  2VH1 A;  1I4P A;  2JVC A;  4DHJ D;  5HG2 A;  3VUX A;  2W9N A;  5C3J B;  1STE A;  2JZZ A;  5LXH A;  3UQA A;  1JWA D;  4K7S A;  4FXC A;  3VUW A;  5L83 A;  1I35 A;  1MVK A;  2L32 A;  4I6P A;  3NVZ A;  3V62 A;  2AQ2 B;  1WE7 A;  3W1Y A;  3IT4 B;  2BGF A;  3OG5 A;  2FUG 1;  3AE6 B;  3MC0 B;  2O2V B;  1GC6 A;  3Q8E A;  3W5V B;  1IYF A;  4LCD E;  1E8Z A;  3U2S C;  1HE8 A;  1ZXH A;  2WP9 B;  4M02 A;  4RM8 A;  3VR8 B;  1V1P B;  3RNA C;  1FM0 D;  3FIL B;  3WAP A;  1HZ5 A;  1I7H A;  1KLG D;  3UIO B;  1OQR A;  1TBE A;  1LXD A;  2KT7 A;  2MHJ A;  1WZ3 A;  1FNW A;  4RF1 A;  1DOY A;  2C7M B;  4PT5 A;  2LWP A;  2PPH A;  4XE0 A;  3N1Y C;  1KM7 A;  4WH4 A;  4TKN A;  2V0G A;  3JYU A;  3Q14 C;  1V6E A;  1D3Z A;  2QMT A;  1PGX A;  1F9J A;  2V1Y A;  1E10 A;  2BWE S;  1WF9 A;  2UYZ B;  4WUR A;  3QQ8 B;  3R7Q A;  4BKS A;  3HIZ A;  1LGR A;  2KK8 A;  4TUU A;  3TEZ A;  4B0E A;  4LDT B;  4ZDV A;  2NBV B;  3P2B A;  3T3O A;  4KV2 A;  1QIL A;  1HA5 A;  3IT6 B;  3V6E B;  1SIF A;  5AZF A;  3VUY A;  3N1Z C;  4GIV A;  4C00 A;  1YQ4 B;  3RNB C;  4KGS A;  3OJ4 B;  2RD0 A;  3BK2 A;  1IGC A;  2FCN A;  2BS2 B;  1OFF A;  4ZOH C;  1C77 A;  2JYT A;  4N58 A;  1KLU D;  4WJN A;  4WJP A;  2KDM A;  3KQ4 A;  4C4V A;  3L13 A;  4G3X B;  2LVO A;  1L0Y B;  1F1H A;  4X57 B;  4DDI D;  4K7U A;  1KRH A;  4K3B A;  5IO9 A;  2YVC A;  4M01 A;  3PHW B;  3ZYY X;  5FK9 C;  1FO4 A;  2LJI A;  1UZX B;  4OHJ A;  2KHW B;  4JWU C;  3N32 A;  5KHO A;  3BYY B;  4D2K A;  5BMG A;  1JWB D;  3Q2A C;  2KJH B;  1QF6 A;  4MH0 E;  1T6B X;  1XF5 L;  1K8R B;  3MJ5 A;  4NY0 A;  3T3N A;  4RH6 A;  1WXV A;  1AYF A;  1C4C A;  2KC1 A;  3QCA A;  4K81 A;  4TMA B;  3WA0 A;  2BWF A;  1I42 A;  1RRB A;  4OZB A;  3J9C A;  3IAM 1;  2WHI A;  1C4P A;  1DOX A;  1FNU A;  2MH7 A;  4RGT A;  4BAX A;  2DZJ A;  2BPS A;  4FHK A;  3JW0 X;  3P4P B;  2LUE A;  1WM3 A;  2G9H D;  2L52 A;  3MC8 A;  4I6L B;  4PYU A;  3AU4 A;  1WZ0 A;  3RNG C;  2MCN B;  4HVB A;  2GBJ A;  1QOG A;  4M8N A;  4BFR A;  1UF0 A;  1UD7 A;  4KZC A;  3AB5 A;  1F77 A;  2EKI A;  1TJE A;  2YEP B;  2L76 A;  4IWP A;  4LDT D;  3A9J B;  4FJV B;  1PUT A;  2VH2 A;  5BO4 B;  2KQS A;  1J7A A;  2DZI A;  3A33 B;  4FUL A;  2M17 A;  3Q3F A;  5G5H A;  1HTO A;  2GI9 A;  1WRD B;  2KVR A;  1GOZ A;  4KVG B;  4B0M A;  4C80 A;  3IAS 1;  1FRD A;  3AE4 B;  4MAC A;  1V81 A;  3CIR B;  4US9 A;  1UBI A;  1SEB D;  2KTR B;  4EFO A;  4MSQ B;  2GBN A;  2RDG A;  1R4M B;  3E56 A;  3V05 A;  2BB6 A;  1P0R A;  2ZCC A;  3GB1 A;  3Q8C A;  4A3O A;  4IW0 A;  1T5X D;  2RSU A;  4OVU A;  2DYO A;  1E8W A;  1WMH B;  3KW5 B;  1F52 A;  1MG8 A;  1CZP A;  3H7P B;  1WY8 A;  3I3T B;  3H6N A;  1F2R I;  4WAF A;  3DBL I;  3A1Q B;  1IPG A;  3SDL C;  2MLB A;  4WWP A;  4GSW A;  3NZU A;  4L23 A;  1L2N A;  4HRO A;  2B3A A;  2PW9 A;  3L10 B;  3L4P A;  2FCS A;  4H2A A;  2KD0 A;  2L00 B;  2CHZ A;  3RI7 C;  4E3C A;  3GZN B;  4KIK A;  3DDC B;  4GB9 A;  2LI5 A;  3DBH I;  2SAK A;  5FR3 A;  2M8S A;  2KVZ A;  2O6V B;  3TJP A;  4GDL B;  1T0Q C;  3TEX A;  4ZHP A;  1EU4 A;  1ZW7 A;  2WYQ A;  1T0S C;  1XLP A;  1OQY A;  1XCT L;  4HDQ A;  2XEW A;  4P1C C;  4WIP A;  1YOV B;  4NZL B;  3AEB B;  2DZK A;  3ZDT A;  2N9K A;  1EWC A;  1RFK A;  1RWS A;  3OLM D;  2OJR A;  2LRW A;  1WGY A;  2K6D B;  4YL8 A;  4RF0 A;  4HPM B;  3H7P A;  2ICI A;  1R4N B;  2NBU A;  2JX5 A;  4DBG A;  2KFJ A;  2MJ3 A;  3C8Y A;  4ANU A;  1N5W A;  5HKH A;  2MQJ A;  2G45 B;  5G5G A;  1R4M I;  1L6U A;  2CJO A;  2Z0D B;  3VDZ A;  5GXG B;  5EE3 A;  2KMC A;  4PS3 A;  1FD6 A;  4YTN B;  2BYE A;  1WRI A;  3NJT A;  2ACZ B;  3ML8 A;  4GDL A;  3U7Z A;  4E74 A;  1TY0 A;  1XLO A;  4N59 A;  4ICU A;  2BKF A;  4XDD A;  3OAW A;  2NPT A;  1WI0 A;  3NVY A;  1UGJ A;  2MP2 B;  4XGA B;  1RAX A;  2MBE A;  2M1M A;  1YN5 A;  1P7F A;  2Q5W D;  4G50 A;  4IM0 A;  4TSS A;  2N9E B;  3EFU A;  3GZN I;  2ZW1 A;  3QAQ A;  2XK5 A;  3TBL D;  5LNK 1;  4KSL C;  4W9D A;  5DPR A;  1L6V A;  3I9V 1;  3APD A;  2LEK A;  1IBX A;  3SHQ A;  4AP4 C;  4EZJ A;  1QT9 A;  5E6J A;  3DCG A;  3IHP C;  4IM3 A;  4AUQ C;  2XBB C;  1VLB A;  3AXC A;  4KSK C;  4KKJ A;  3LJ3 A;  4US8 A;  2IPK D;  4HRS A;  4PS8 A;  3U4E G;  1NI2 A;  1L0V B;  2O6V D;  3IG3 A;  3ZDM C;  2Y3A A;  4REZ A;  3QJZ A;  4W9K A;  1NDD A;  2KFK B;  2WU2 B;  4MEL A;  3UGB B;  4HCP B;  4M0W B;  4AJY B;  4RMA A;  1ZOY B;  3MHZ A;  2CR5 A;  4MGY E;  1E90 A;  3K9O B;  4YSY B;  2XNA C;  3ETR A;  1WJ6 A;  2WXL A;  4YT0 B;  3Q3J A;  1M94 A;  1MI0 A;  3W9C B;  4F7Z A;  3P63 A;  3ZQ4 A;  2KOX A;  2IND C;  1SGH A;  1YIW A;  1MHH E;  2W3S A;  2DX5 B;  1WJ4 A;  2JWZ A;  2AWT A;  2I2Y A;  4B6W A;  4KZ0 A;  1V80 A;  1HQR D;  1MJD A;  5H92 C;  4TQ1 A;  1JRO A;  2K5P A;  1T0R C;  4G0N B;  1JRU A;  3KYD D;  1OGW A;  4J3O D;  2R2O A;  2KYW A;  4IWO A;  3AE5 B;  3NY5 A;  3ZRF A;  1AW7 A;  1V5T A;  2SEB D;  5BMH A;  1FEH A;  1V97 A;  2JRI B;  2LGS A;  2L3Z A;  2R2Q A;  3PLV A;  4BKT A;  1J19 A;  4MEM A;  4FA6 A;  3PZ8 A;  1TKG A;  2L1A A;  3ZGZ A;  3JSV A;  4ZRI A;  2DNF A;  2WQY B;  1GG3 A;  4M0W A;  3Q3O C;  1VRA B;  3Q3N C;  3PV1 A;  3PLU A;  3RN9 C;  1GNU A;  1LFD A;  2KDF B;  2QC8 A;  2IGH A;  3OWE B;  1C4A A;  3ZXV A;  2R61 A;  3ZNH B;  2J0M A;  2J0K A;  2LVQ A;  4XZ4 A;  3U30 A;  2WXK A;  2FCQ A;  4KDI C;  1V1O A;  4IWQ A;  5IOI A;  2KJ6 A;  3N9Y C;  1A70 A;  3PRE A;  1XT9 B;  3DBR B;  3MFG A;  3RCZ A;  2Y5C A;  3RFZ B;  4DWF A;  5I4D A;  4N9F 4;  2LGI A;  1KTK A;  3SFD B;  2LAS A;  3Q6B A;  2DAJ A;  4MM3 B;  3AUL A;  3IXS A;  4P1B C;  5CHW A;  2NMQ A;  1J7C A;  2ZPN A;  1VJK A;  1L7Y A;  3E9S A;  2WXH A;  4NJ7 A;  4NJC A;  3KUD B;  3QK0 A;  3L17 A;  1XCQ L;  1C1Y B;  1GAQ B;  1CK1 A;  1JWS D;  2J7Q B;  4C4V B;  2DHZ A;  2XN9 C;  3DWG C;  2G4S A;  2QEJ C;  4K3C A;  4XX5 A;  3WAO A;  1N6Z A;  4JQW C;  2FID A;  1PQS A;  2OED A;  3R2T A;  2EKE C;  3PO0 A;  3AEG B;  2C5L C;  2CKH B;  2LD9 A;  1NYR A;  3KLS X;  4WJQ A;  4ANX A;  4A3P A;  2KDB A;  3ZRC A;  4HEA 1;  3VTU A;  2IO2 B;  2PJH A;  1Y56 A;  2D10 A;  1KFY B;  1D5X C;  2FBW B;  3VTV A;  1J8C A;  1MG4 A;  3AE9 B;  1R7S A;  1ET6 A;  4TQ0 A;  2N9P C;  3VRA B;  3ML9 A;  4GXB A;  1ZP0 B;  1TZO A;  2K3U A;  1WGH A;  3MHS D;  1TKE A;  1VR9 A;  2MBQ A;  2ZCB A;  4KX6 B;  4QAY A;  2EMS A;  2JSV X;  4MM3 A;  2VZK B;  1OEY A;  2N0S B;  4W9F A;  3H1U A;  5CTR C;  2K6Q A;  1I4H A;  2CU3 A;  2KKC A;  3ZW3 A;  3VR9 B;  1MPE A;  4EUT A;  2MEK A;  1FFU A;  1XQQ A;  1AN8 A;  1P7E A;  2GOW A;  1LQB A;  2RDH A;  3O65 B;  1Z2M A;  3NZ3 A;  4USA A;  3DBR I;  2ZNV C;  1CMX B;  3AED B;  3M62 B;  5BYQ A;  3TCA A;  3RZF A;  3W1S C;  1ACC A;  2IGD A;  3TL5 A;  3APC A;  1KLV A;  4BKS D;  4HPP A;  4YTP B;  4GU2 A;  4LNF A;  1EF5 A;  3WAM A;  1K51 A;  1YQ3 B;  2Y5P A;  1UNS A;  1E7V A;  1QOA A;  3RUL A;  2BTE A;  2GBM A;  2ZVO A;  2KWD A;  5D94 A;  5J17 A;  4WWO A;  3EFC A;  4KGR A;  1WSP A;  5EDS A;  3R3M A;  1RM6 C;  1F0Z A;  4MDK E;  3WAN A;  2H88 B;  1L4Z B;  4II3 B;  1E5W A;  4WQO B;  2LVP A;  2KX0 A;  2L7R A;  1QKZ A;  3QA8 A;  4GMV A;  1HTQ A;  2HJ8 A;  2C7N B;  3NG0 A;  4YSX B;  2KXJ A;  4LTU A;  2FE8 A;  2KWU B;  3NUH B;  3PT2 B;  1E0Z A;  1TS2 A;  3RNF C;  1WXQ A;  1SE3 A;  2QSD A;  1E8Y A;  1IUE A;  3HHM A;  3GE8 C;  5C23 A;  3Q3M C;  1B1Z A;  1V9J A;  3B2G A;  2L0T A;  5L95 C;  4PYZ A;  1WXA A;  5G2N A;  2KMA A;  4JIO U;  4YSZ B;  2N9L A;  2A5U A;  4B9K A;  2RMM A;  4BBN C;  2LHE A;  2LMC A;  2QJL A;  2QIE B;  2MA9 B;  4EOY A;  2FIF A;  3CSF A;  4KIK B;  1RYJ A;  3ZNG C;  2H89 B;  4BOZ B;  2WXJ A;  3AEE B;  1VD2 A;  4LNN A;  2BS4 B;  4B95 A;  3QWZ B;  2MWS B;  1JAL A;  1V8C A;  1D6E C;  4XC2 A;  4LLG M;  1I4Q A;  1SJH D;  3C19 A;  3QIJ A;  1QOF A;  3QX1 A;  4IDI A;  2J52 A;  2JXX A;  2M56 B;  1V86 A;  4LK0 M;  4KKI A;  1K50 A;  4WAA A;  4Q2J A;  1WIA A;  1C3T A;  2IO3 B;  1FFV A;  3B08 A;  3V6C B;  1TYG B;  1HZ6 A;  1SE4 A;  2QDF A;  2K8H A;  4W9C A;  4DK5 A;  1DOI A;  1GJZ A;  2J4X A;  3TSS A;  4A55 A;  2BF8 B;  3ZTC A;  3BWU D;  1IP9 A;  2RPV A;  1QZE A;  3DPD A;  3L0W B;  3IFW B;  3H9D A;  2PTL A;  1YJI A;  4MH8 A;  5E6O A;  3UIN B;  1EWY C;  1NBF C;  2PVO D;  2OOB B;  4A90 A;  1WX8 A;  2Y5B B;  1C79 A;  3LDZ E;  1NEK B;  3AE3 B;  4DXG A;  3KH0 A;  1WGR A;  4HJG E;  5TR5 A;  2WXG A;  2KQ7 A;  2L83 A;  4CYE A;  4ZHO A;  2INC C;  4MGK E;  2M0A A;  2UU7 A;  2JPH A;  2NPT B;  2KTF A;  1YD8 U;  4ZRJ A;  4DXA B;  3GS2 A;  3VH3 B;  1YX6 B;  2HD5 B;  1NYQ A;  2D3G A;  4C56 C;  1I4X A;  3RD2 A;  2LGY A;  3SR6 A;  2IGG A;  4LJP B;  3LXF A;  2X8X X;  4JLC A;  3H8H A;  3VTW A;  2N4F A;  1Q0W B;  4P6V F;  1K52 A;  1ENF A;  4ASW C;  2XK5 B;  4MGI E;  2ZW0 A;  3EEC A;  2ZJD A;  2PVG C;  1IBX B;  4N6E B;  1P98 A;  3AEA B;  3EGR A;  3I57 A;  3AH7 A;  2KO3 A;  3ZUN A;  5D6J B;  5BYR A;  5JHB A;  2MJE A;  1VZ7 A;  4HCN B;  5HI1 A;  1B9R A;  2INP E;  1PFD A;  1ZXI A;  2LGX A;  2BYT A;  3ZVV A;  1U4A A;  3Q69 A;  4MT5 A;  5J2R A;  4C7Y A;  1AWD A;  1PGA A;  5DPT A;  1VCB A;  3UF8 A;  5IN7 A;  4P16 A;  2LFI A;  3AN1 A;  1Q10 A;  4JL9 A;  4A20 A;  2IO1 B;  4E71 A;  1TS3 A;  2K9X A;  2GRI A;  4WWM A;  4GDK B;  2X38 A;  1KJT A;  3KYC D;  2JRH A;  4NJ6 A;  4NNJ B;  3PZD A;  3PVL A;  1G6J A;  1K53 A;  4AS1 A;  3W1S A;  3HVZ A;  4DQO C;  2D3A A;  4OZC A;  1ROE A;  2I1K A;  3DBS A;  4HDO A;  3BIN A;  2JYE A;  5E6N A;  2BQQ A;  2D3B A;  3BK1 A;  4PK1 A;  1SB3 C;  2HTH A;  4LNO A;  2KQ4 X;  3CMM B;  3HVD A;  2KX3 A;  1FPY A;  2BW2 A;  1WJN A;  4BVU C;  3TIX A;  3UI3 A;  3M95 A;  2J53 A;  4OVZ A;  2KN4 A;  5GMV A;  3M63 B;  2QCZ A;  5LLI A;  4ZYN A;  3P4Q B;  3WAL A;  3R7R A;  4KGT A;  3IBE A;  5MPO A;  2RPQ A;  3RZW C;  4GGQ A;  1YN3 A;  3AEF B;  2ON8 A;  2AQ1 B;  1JML A;  3JSV B;  1BML C;  3VAW A;  2G3Q B;  4ANW A;  3DQV A;  4HPL B;  3KUZ A;  1GPX A;  1YJJ A;  5DCN A;  1FCL A;  1EO6 A;  1NVI D;  4ARI A;  2PEA A;  1D4B A;  2TSS A;  4GDK A;  1WGK A;  5DPS A;  1R4N I;  2C60 A;  4IG7 B;  2MRP A;  3RMK C;  3V60 A;  4XYC A;  4OZA A;  4ACF A;  5IA7 A;  1SXT A;  3RUI B;  3ABV B;  3ECI A;  3GP7 A;  5BMI A;  4ARC A;  2ZPY A;  1VZ6 A;  2IBI B;  1WGD A;  3Q8F A;  1TT5 B;  2J0J A;  2K39 A;  2AYO B;  2WXM A;  2V3S A;  1WH3 A;  3X23 A;  1XD3 B;  2N7D A;  3L54 A;  4A6Q A;  1P3Q U;  3NRZ A;  4NQL B;  2WXI A;  4W9E A;  3LB8 C;  3CST A;  3VFK A;  2PKO A;  1QLB B;  2G4D B;  3AE8 B;  2DEN B;  1PGB A;  2HTM E;  3GE3 C;  3RYT A;  4CO7 A;  1JW9 D;  2IJ0 A;  2WXR A;  2LZ6 A;  3DVG X;  4HXD A;  4YXD B;  2W54 A;  4MJS A;  1H4R A;  2BVC A;  1FXT B;  4HLE A;  3CF6 E;  2KMM A;  5E6P A;  5TSS A;  3FC4 A;  2N7E A;  3B0A A;  4IUM B;  2DBY A;  2JUO A;  3OJ3 A;  3BVZ A;  2N9X A;  3N30 A;  5JHA A;  3ZLZ A;  1N62 A;  1F2R C;  3CWI A;  4IC7 B;  1ZDX A;  1NI3 A;  2HDE A;  2WDQ B;  1E7U A;  1TS4 A;  4GLS C;  3RNE C;  3HK0 A;  5IKC M;  3VRB B;  1J0G A;  1FRR A;  2ZZP B;  1SE2 A;  3TMP B;  2JF5 A;  4BBN F;  4NQK E;  4GOC A;  2KAJ A;  4WWN A;  3WIM A;  4BKG A;  1ZDV A;  2ONQ A;  2A4Z A;  4II2 B;  3MTN B;  2KDE B;  2OHF A;  4RGM A;  3SFE B;  3EC8 A;  3V61 A;  2FNJ B;  3DHH C;  3ONS A;  1TGZ B;  2GBK A;  2KJR A;  4W9J A;  1LM8 B;  2WDR B;  3I63 C;  4M00 A;  1Q5W B;  1Z5S B;  2LXC A;  4WQM A;  3RNC C;  5C2T B;  5AEK B;  2G1E A;  1HEZ E;  3AEC B;  2WX1 A;  2NTS A;  1VDV A;  4XDC A;  1Q1O A;  1NEN B;  3A9K A;  5CHF A;  2WDT B;  4JGH B;  1N63 A;  3AE7 B;  4MSM B;  2MBB B;  1RFA A;  2AX5 A;  2DWQ A;  4NPN A;  3ZO5 B;  3C0R B;  4M8M A;  4BZA A;  2QIL A;  1JQ4 A;  3R2I A;  2JWU A;  2HJ1 A;  2V3P A;  2NCN A;  4HJK A;  2YLM A;  1WM2 A;  4ZRK A;  4AQ7 A;  3AE1 B;  3URY A;  1EM7 A;  2WDV B;  1FIQ A;  5KHQ A;  1KH0 A;  3PS6 A;  1GUA B;  1E6E B;  2INN E;  4G11 A;  3B1L X;  2WGS A;  4RNA A;  5IAA C;  1PYW D;  4FLH A;  2L05 A;  1D5Z C;  1WX7 A;  2JT4 B;  1X1M A;  1ET9 A;  1PDX A;  3MP9 A;  1SJE D;  1WGG A;  3VHT C;  4ZRP A;  3P42 A;  1XXG A;  3HM3 A;  4W9I A;  3TEY A;  2KC2 A;  2JXT A;  3N1X C;  2LUM A;  2MSE D;  3PGE A;  1M4V A;  2E6X A;  2WS3 B;  2ZEQ A;  3VVW B;  5EE0 A;  5DPW A;  2D5G A;  2DZM A;  2MBH A;  1BXT A;  2KDI A;  1YN4 A;  2I1J A;  1FMA D;  2Z8L A;  3PPA A;  4ZRQ A;  3TEW A;  1UEL A;  3VXW A;  3A4S C;  3P1M A;  3DVN V;  3DVN U;  3L08 A;  2K8B A;  1A5R A;  2AEH A;  2CU1 A;  2NVU I;  3AMZ A;  2WU5 B;  3DWM A;  2O2V A;  2WXP A;  5JZE B;  3H7S A;  4A8X C;  2FCM A;  2KLG A;  1SIJ A;  4O1N A;  1WXS A;  1WWT A;  2L8J A;  1V1P A;  1YMH E;  2CJN A;  3FIL A;  3W2D A;  2K0P A;  1V2Y A;  1WXM A;  2I38 A;  2WXQ A;  2RR9 A;  1SBB B;  3T9L A;  2IY0 B;  4FBJ B;  2M0X A;  4R3D A;  2NTT A;  2BKR B;  1JWM D;  1V5O A;  3PHX B;  2E3T A;  4K7W A;  1BT0 A;  4DHZ B;  4IOI E;  2D07 B;  3S2A A;  3BY4 B;  3M3J A;  3W5U B;  3ZNI D;  3DBL B;  2N1V A;  3MC9 A;  1WR1 A;  3ZJT A;  2C9W B;  5AZH A;  3T8M A;  4MGZ E;  1JWU D;  5EE1 A;  5D3I B;  3N20 C;  3AE2 B;  4OW0 A;  4C7Z A;  2Z0E B;  2MJD A;  3DBH B;  2ZVN A;  4DHZ E;  1OQQ A;  1XLN A;  1TZ1 A;  4EZL A;  1FXA A;  2WLB A;  1UWM A;  3V3X A;  2BYV E;  3RPF C;  2DYM A;  3ZTD A;  2PIA A;  3HM6 X;  2D2Q A;  2BB5 A;  1WR6 E;  1XLQ A;  2JZ3 B;  4WJO A;  1FCC C;  2LJ5 A;  3KWL A;  1ZKH A;  2CS4 A;  2J42 A;  3P4S B;  2K22 A;  5HFY A;  4YWG G;  3HUI A;  5G55 A;  2VZK D;  2PMV A;  2IO0 B;  4L2Y A;  3KWV A;  4F1S A;  2N7J A;  1RLF A;  2IZV B;  3GOE A;  1D5M C;  1FNV A;  2KWC A;  4FJZ A;  3U8Z A;  4AOF A;  2GLS A;  3B2F A;  4W9H A;  3QC8 B;  1E8X A;  1I4G A;  4XWW A;  1E9M A;  1UGM A;  2W82 A;  1OTR B;  2EMT A;  2N1W A;  3KVF B;  4AJW A;  3BVG A;  2V9H A;  3HRD D;  4ICV A;  1L4D B;  3DOW A;  3BII D;  1J7B A;  3L16 A;  2L0F A;  3ZXR A;  2K8C A;  1YQB A;  3PRZ A;  3AI5 A;  1UWX A;  2JQR B;  3WCQ A;  2JU6 X;  4UDU C;  4ANV A;  1EUV B;  2JY6 A;  1GC7 A;  1L0X B;  1P1A A;  3TUO A;  1OEY J;  4PS7 A;  1KF6 B;  3EUB 2;  3P4R B;  1TY2 A;  2MBO A;  2ZNV B;  3NS8 A;  4HKQ A;  2WXO A;  4IKG A;  1ISN A;  3SEB A;  1LO5 D;  1GB1 A;  4EE2 A;  1N61 A;  1ZE3 D;  3VQI A;  1C9F A;  2AL3 A;  1MHX A;  1S1Q B;  4LNK A;  1TKY A;  2IDY A;  2M4N A;  3PRP B;  4W9L A;  1EU3 A;  4GN1 A;  1BUI C;  2LXA A;  4JWS C;  2K25 A;  2BT6 A; 
#chains in the Genus database with same CATH homology
 5IO9 A;  1MG4 A;  2DNF A;  5IKC M;  1MJD A;  5IOI A;  5IN7 A;  5IP4 D;  1UF0 A;  1MFW A;  2BQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...