5H92C

Crystal structure of the complex between maize sulfite reductase and ferredoxin in the form-3 crystal
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Sulfite reductase [ferredoxin], chloroplastic
publication title Structural and mutational studies of an electron transfer complex of maize sulfite reductase and ferredoxin.
pubmed doi rcsb
source organism Zea mays
total genus 20
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2015-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5h92C00
1FIQA 3AE2B 2WDVB 4N6EB 1B9RA 2WP9B 5H8YE 3AE1B 3AEAB 3LB8C 3HVZA 2WU5B 4C7ZA 4YSYB 1PDXA 1FMAD 1TJEA 3AEFB 2WDQB 1EWYC 1E6EB 2MJDA 3AECB 3P4QB 3BIID 2QIEB 4YTPB 1YJJA 3DWGC 1KRHA 1JW9D 3HUIA 2N0SB 1CJEA 2BS3B 2WU2B 4US8A 3VR9B 1N62A 3W5UB 2B76B 1E0ZA 1QOFA 1QLBB 4JWSC 1RYJA 1QT9A 1E9MA 1TYGB 1XO3A 1V8CA 3AV8A 3NVZA 3NVVA 1ZUD2 2Q5WD 5C3JB 1RWSA 3P63A 2PKOA 1FXIA 1N61A 4C7YA 2BS2B 3NVWA 1NENB 1ZOYB 2LEKA 4WQMA 2OHFA 4IDIA 1DOIA 1RFKA 2H88B 1YQ4B 2K9XA 2KAJA 1PUTA 2MJ3A 2WQYB 3L4PA 2MH7A 3W5VB 2QJLA 1RM6C 1XLOA 2M56B 4C80A 1WXQA 3P4SB 2JX5A 3AE6B 3LXFA 1FRDA 3RPFC 3AM9A 3AEDB 3VRAB 1KFYB 2W55A 1QOAA 2K22A 2WS3B 1F0ZA 2MJEA 3P4PB 3SFEB 2EKIA 3AN1A 3NRZA 1GAQB 3AH7A 2L83A 2M19A 5EE9A 5AUKA 3NS1A 1QF6A 1ROEA 1DGJA 1NVID 2E3TA 1CZPA 1PFDA 1VLBA 2HTME 4JX1C 1JALA 3ABVB 1JWAD 3AE8B 3NVYA 2PVGC 1XLQA 5EE1A 2DWQA 1FFVA 4N58A 5AUIA 1E10A 1FFUA 1VJKA 1IUEA 3AE4B 2K5PA 1GPXA 3B9JA 1FO4A 3CWIA 2PVOD 4LTUA 1J7BA 1AYFA 1L5PA 1L6VA 1TKEA 1UWMA 1DOXA 1XLNA 1NEKB 4FXCA 4USAA 4YTMB 1OQRA 3AMZA 3P4RB 1NYQA 1YJIA 2WDRB 1N63A 3AEEB 4HROA 4US9A 5GXGB 4ZHOA 1ZP0B 2AX5A 3VRBB 2PIAA 1SIJA 2G1EA 3FC4A 2ACZB 1N60A 4WWMA 3FAHA 5C2TB 4YSZB 1QOGA 4YT0B 2W3SA 1WWTA 2W3RA 1YQ3B 1J7CA 1T3QA 3DWMA 5EE0A 3KWLA 5EE3A 4HRSA 2CJNA 2WLBA 1WYGA 1SF0A 3P1MA 2KMMA 1N5WA 1FXAA 1NI3A 1TKGA 2FBWB 1OQQA 1WGKA 2BS4B 3AEBB 3PO0A 1FRRA 5MPOA 3ETRA 3AB5A 4N59A 2L52A 1FM0D 1QOBA 1AWDA 1R7SA 1N5XA 1XLPA 1VDVA 3AE3B 1L6UA 1J7AA 4A9AA 4YTNB 1NYRA 1JQ4A 1I7HA 4KX6B 2DBYA 4YXDB 1L0VB 1DOYA 2W54A 4ITKA 1JROA 1E7PB 5G5GA 4YSXB 2CJOA 5G5HA 2H89B 3SFDB 1KF6B 3AE9B 3B2GA 3HRDD 1WRIA 1A70A 2JQRB 3W9CB 1OFFA 1TKYA 3ZYYX 3WCQA 3B2FA 3AE7B 2BT6A 3EUB2 4ZHPA 1JRPA 1V97A 3AEGB 3CIRB 3VR8B 3AE5B 4P6VF 4JWUC 4ZOHC 3SR6A 2CU3A 1ZXIA 1SB3C 1JWBD 5H92C 2Y5CA
chains in the Genus database with same CATH superfamily
2QHOA 4TKNA 4MM3B 3NOBA 5H8YE 3C8YA 2LWPA 1PDXA 2C9WB 2JRIB 4YTPB 2ZVNA 3LJ3A 2INCC 3L10B 5HI1A 2KO3A 3VTUA 4HPLB 2VZKB 4RGNA 2YEPB 1C77A 4MJSB 1WGHA 3L4PA 2ZNVC 2MP2B 1RM6C 2M56B 1PGBA 2JX5A 1I4RA 4G0NB 3AEDB 4ANXA 1WGDA 1HE8A 5BYSA 2WS3B 3TSSA 2XBBC 3A33B 2KQ4X 3QCAA 4HJGE 1ROEA 2N9PC 4KDLB 2KANA 3S2AA 4WJOA 4IC7B 1FFVA 1E10A 1AW7A 2BKFA 2L00B 2WX1A 1DOXA 1WJ6A 5GXGB 4FJZA 2WXHA 3VRBB 2ACZB 2G9HD 2MBOA 3ZDTA 1T0RC 4KIKB 1QOGA 4RGOS 4GB9A 5LNK1 3DBHB 2WLBA 1F2RI 2KMMA 1N5WA 2DYOA 4C00A 2M4NA 1OQQA 1V2YA 1LO5D 1BMLC 3GZNI 4YXDB 3TMPB 4OVUA 4FN2A 4YWGG 3SFDB 1TS2A 3GZNB 2O2VA 4AS1A 1QZEA 3R2IA 3WAOA 2DZMA 1FCLA 3V6CB 3DHIC 2V4IB 4LNOA 3U7DA 2WXLA 1EU3A 2SAKA 3IAS1 4II2B 3ZVVA 1UF0A 5IAAC 2JSVX 1TJEA 1T0SC 3N9YC 1XXGA 2N0SB 5LXIB 2ZCCA 2BBCA 2INNE 1WJ4A 4XZ4A 1QLBB 2VRRB 1YX5B 5AZHA 2KMAA 3EA6A 4ZYSA 5JH5C 1WF9A 4REZA 1D3ZA 2KWDA 2WXFA 2V4LA 4WURA 1EM7A 4WQMA 4L2YA 2BWFA 1ACCA 4LCDE 3IAM1 2V3PA 4GOCA 2LJIA 1F0ZA 2BF8B 4KZCA 4R3DA 1JMLA 3AN1A 5IP4D 3EC8A 2DYMA 2WXIA 2JZPA 2WWZA 4JPSA 4G50A 2LASA 4DHJD 1XLQA 1CMXB 1UGMA 1KOTA 3M3JA 1GPXA 3Q3NC 2PTLA 4LTUA 1L6VA 3H6NA 2OEDA 4WJNA 4PS7A 2O2VB 3AEEB 4LK0M 3Q3FA 2PIAA 4YSZB 5HKHA 3ENEA 3B0AA 1EWCA 3KWLA 5EE3A 2I1KA 1ZE3D 3DBRI 3P1MA 4L1BA 1TKGA 4M8MA 3DVNU 1MG4A 4ARCA 1PQSA 2D2QA 4ANVA 4HCPB 4RNAA 2W54A 3PRZA 4FULA 4DHZE 1VRAB 3QQ8B 1I4PA 4HPPA 3A1QA 3TIXA 4GDKA 5JZEB 2K39A 2GOWA 3PREA 2Z8LA 4LDTB 4GDLA 1KJTA 3M95A 3HVZA 1JWMD 3J9CA 3P4QB 3Q3OC 1D5MC 3MHZA 4NQKE 3BIID 4M0WA 2GBKA 4RGMA 1XQQA 2B76B 1QOFA 2MHJA 5T8IA 5HHDG 1LXDA 2N4FA 5L95C 4C56C 2KDBA 3RNAC 2RPVA 3IVFA 1GB4A 2CR5A 4NJCA 4W9EA 3RPFC 2K6DB 2WGSA 3U7ZA 2KNBA 2LGDA 1J19A 3HHMA 3NRZA 2Z0DB 2NCNA 2Z0EB 3AE8B 4KGSA 2NMQA 1IUEA 3ZW3A 2WXRA 4YTMB 1LFDA 3RNBC 5AZGA 3U52E 4IWQA 3A1QB 3AI5A 4W9JA 4GDKB 3SD5A 5DPRA 2N9KA 4HRSA 2CJNA 3PPAA 4GDLB 1HEZE 2KK8A 3O13A 4S0RA 2L52A 4M0WB 1R7SA 1IPGA 3TCAA 4HKZE 1M94A 2IY1B 4WWOA 3APDA 4WJPA 3R8BA 3L54A 3BWUD 4EZLA 2XK5A 2ZNVB 5G5HA 2KJ6A 2XN9C 5AZFA 1Y8RC 1SBBB 3W9CB 1H8CA 4ZHPA 1EF1A 1JRPA 4DXGA 4S17A 3ML9A 2JRHA 4KSKC 1KLVA 2MQJA 2WP9B 3LB8C 5BMIA 1K8RB 3P42A 1HZ5A 1AN8A 2KMCA 3VR9B 3ZRCA 4JWSC 3OJ4B 2QEJC 3OWEB 1FXIA 1SSNA 1ZOYB 4IDIA 1P7EA 2D10A 2MJ3A 4JIOU 2KJHB 1ZDVA 2DAJA 1ZDXA 4LNIA 3RCZA 2KACA 1WH3A 3QC8B 1GAQB 3DBLI 3PZDA 3PZ8A 5J17A 1E8YA 4NJ6A 3PS6A 1UD7A 3WAMA 1FO4A 3ZXRA 2MW5A 3TEYA 2QILA 2XK5B 3WANA 2LXCA 2O6VA 2CU1A 3BY4B 1F77A 4I6NB 4HDOA 2AWTA 3FAHA 4DXFA 4MACA 2CHXA 3PHXB 1OQYA 4IW0A 3PRMB 1KLUD 1F9JA 2ONQA 5L83A 1I42A 1EF5A 1UELA 1QKZA 3D32A 2FBWB 3GP7A 3QX1A 5JHAA 1JRUA 1SXTA 3ZNHB 5FKAC 3PZ7A 1XLPA 3AE3B 2LZ6A 5TSSA 4JLCA 3N1YC 3W1YA 1JQ4A 2FIFA 3R3MA 4BKSA 2NBUA 4YSXB 1E7VA 3DCGA 1HTQA 3IFWB 3ZDMC 2JQRB 4JGHB 4W9DA 5J2RA 1RAXA 2KWVB 1D5XC 1T5XD 3N30A 3IG3A 4HLEA 1SB3C 1GG3A 1WX8A 1B1ZA 3Q14C 2IGGA 2IGDA 4OZBA 1YQBA 1E6EB 2MJDA 2R2QA 3HUIA 2BS3B 1R4NI 1SJHD 4EFOA 4ZRIA 2GMIC 2Q5WD 3MTNB 2KC2A 1R4NB 1FNVA 2YLMA 2EMSA 2HE7A 1ET9A 3DHGC 3I5JC 1PUTA 4NNJB 2O6VB 1K50A 3IXSA 3VRAB 3NS8A 2D5GA 3SFEB 3U2SC 2IBIB 5CX3A 2EKIA 2J7QB 2DHZA 2K8BA 4A55A 1L4DB 2LRUA 4M8NA 2RD0A 4N58A 2L05A 4KDIC 2YEPF 4MH0E 1E8ZA 1GOZA 3AULA 3PGEA 3SHQA 2K8CA 4ICVA 2KQSA 1KM7A 4OZCA 2IO3B 4A3OA 4ZHOA 2MBQA 2I2YA 1XEEA 3V05A 2XEWA 1C78A 4IUMB 4RF0A 1WX9A 5C1ZA 2PW9A 1WGGA 4PS3A 5E6JA 1TTNA 2TSSA 2N1WA 1NYRA 4AJYB 5IN7A 2K1FA 5IA7A 2JY6A 2N9XA 3HRDD 1LGRA 1P9DU 4XGAB 3RZWC 3GS2A 4IKGA 4HPMB 2V3SA 1WR6E 1WM3A 4ZOHC 2RR9A 3VXWA 3RNGC 1WIAA 1ESFA 3DQVA 2G4DB 2WDQB 4E3CA 2QIEB 3MP9A 4OW0A 4I6LB 1UWXA 3JW0X 1IGCA 3JYUA 2CHWA 3HM6X 2R61A 1GB1A 1ZGUB 2LUMA 5HFYA 3P63A 2JWUA 4HKQA 4RMAA 5GMVA 5JXVA 5TR5A 2E6XA 2WQYB 1WXSA 1I4XA 3Q8AA 3ZRFA 4JQWC 2LVOA 3V61A 2HDEA 1XD3B 1L0XB 5FR6A 3NS1A 3BK1A 1NVID 1OTRB 2M17A 4URKA 2K3UA 1JWAD 5EE1A 2K5PA 4L23A 3GE8C 1G6JA 1V49A 2GB1A 4XC2A 2KLCA 4IOIE 2NS5A 4CYEA 4DBGA 3O65B 4HROA 2INDC 4W9KA 3N20C 5LXHA 3H1UA 2D3AA 3AU5A 3FC4A 2WXOA 3FKYA 4F8CB 4ZRQA 5CHVC 1C4CA 3CSTA 2IDYA 4Q2JA 2C7MB 5DPWA 2ZJDA 2PJHA 4FA6A 3AB5A 4RF1A 2KHWB 1L7YA 2DENB 1WFYA 2MCNB 4ITKA 1JROA 1V5TA 3Q6BA 1E7PB 3DBHI 2CJOA 2ZEQA 3KWVA 1FD6A 2KOXA 2WNMA 2FCSA 1YN5A 4LNNA 3CIRB 2ZW1A 5C2TB 5E6PA 3WA0A 1E7UA 4KGRA 4NZLB 3KUDB 4MH8A 1C79A 2L3ZA 2WU5B 3UIPB 1CQVA 2KVRA 4MGZE 2VH2A 4KKJA 2MX2A 2GLSA 4BOSC 2BTEA 2PEAA 1H4RA 3PSEB 2KQ7A 1DYQA 4C7YA 3TL5A 2BYEA 4E74A 2BQQA 2QJLA 3AE6B 4GXBA 3TJPA 2DZIA 2DYBA 4RM9A 2IZVB 2ZW0A 5BO4B 1Z5SB 4WH4A 2UYZB 1DGJA 1P98A 4JX1C 5IO9A 3ABVB 4XDDA 4WWPA 1JCKB 4HVBA 4WWNA 1I4GA 2NPTA 2C7NB 3Q8EA 1SE2A 4GSWA 4LNFA 2G1EA 1LM8B 2RDBC 4OVVA 3EFUA 3X0WA 5DCNA 1J7CA 2BYFA 2ON8A 4P1BC 5CHFA 2Y5BB 4WAFA 2MBBB 2MSED 2REXA 1F52A 5EDSA 4G11A 2UU7A 3TEWA 1WX7A 3BINA 3RI7C 2B3AA 2G45B 5D7GA 2IYDB 3TUOA 2I1JA 3EGRA 1ET6A 3ZGZA 3ZYYX 3VQIA 2NVUI 2N1VA 2D3GA 4LDTD 4P6VF 1HTOA 5G2NA 1F1HA 3MC9A 2EMTA 2GBRA 2JZZA 1B9RA 2ZZPB 1HZ6A 1EWYC 1YJJA 1K52A 3LYYA 5D3DA 4OHJA 3KUZA 2J52A 3Q3MC 4TQ1A 3CF6E 1XO3A 2ICIA 2MRPA 2NPTB 3NVWA 1XT9B 2OHFA 2WXQA 2H88B 2K6QA 4MEMA 4BBNC 1SGHA 2Y3AA 2MH7A 3W5VB 1L4ZB 3MJWA 3KLSX 2I38A 1KFYB 5E6NA 1C76A 2X8XX 4RFBA 2DNFA 4IG7B 4PT5A 3V3XA 2CS4A 3NJTA 2HTME 1UH6A 2PVGC 4BKGA 4ZRJA 1YOVB 3KVFB 4ZRPA 2WXMA 2BYTA 1HQRD 1L5PA 1NEKB 4CO7A 3P4RB 1QQRA 2BGFA 3HIZA 4AP4C 1OEYA 5DPSA 4YT0B 5HG2A 2W3SA 5JHBA 3I63C 4JE3B 1YQ3B 1TIFA 1UUPA 1WYGA 2QSDA 1STEA 3R66C 5D2MB 3R2TA 3GOEA 4CHKA 1ZXHA 4A9AA 2L32A 1V1PA 3ZXVA 2XNAC 1L0VB 1IBXA 1FNUA 2MA9B 2CKHB 2QC8A 2IO2B 1Q10A 3UQAA 3AEGB 3VR8B 4J6IA 3VDZA 1ZXIA 3QJZA 5BMHA 1FPYA 4ANUA 2ZPNA 3A4SC 2C5LC 1JW9D 1YN4A 5G55A 4P16A 1N62A 2JUOA 3L17A 2GI9A 1QT9A 1HA5A 4MSQB 1GNUA 4M01A 4EOYA 2BWES 1J8CA 3UIOB 3PTFC 2BS2B 1NENB 4A90A 2LEKA 1YJ1A 4TQ0A 1TY0A 1XLOA 3P4SB 2KN4A 3TBLD 3L0WB 3OLMD 1RLFA 3HK0A 2PPHA 5CTRC 2E3TA 1BT0A 2DWQA 4LNKA 4HCNB 1V1PB 4FBJB 1SJED 3CWIA 1IBXB 1TKEA 2DX5B 4X57B 1OQRA 2ASQA 1L2NA 1NYQA 3M62B 4FHKA 4ZDVA 4EUTA 1C4PA 3VAWA 1SE4A 3B08A 4NQLB 1UBIA 3GE3C 2AYOB 1NI3A 4HEA1 3AEBB 1KH0A 1TZOA 2M0AA 4N59A 4AJWA 2EKEC 1MVKA 2KDEB 3URYA 4DDID 4BBNF 2RSUA 3AE9B 1AARA 5BYRA 3PV1A 3ZNID 4EE2A 3B2FA 3RZFA 3VFKA 3AE5B 1X1MA 4JWUC 1JWBD 1FIQA 3UGBB 2AQ3B 2WDVB 2KTRA 4TMAB 4N6EB 5KHOA 5DPTA 3OG5A 2WYQA 1T0QC 4W9CA 2L0FA 1K53A 5LLIA 2AQ2B 2N7JA 3PVLA 4IWPA 1TZ1A 2KFJA 4G3XB 4W9LA 2O6VD 3ZIMA 3Q8CA 4MGYE 1IP9A 2NR2A 2LD9A 1RFKA 1PYWD 2IO0B 2C7HA 4GIVA 3V6EB 1SEBD 1WR1A 4RH6A 4WQOB 2QCZA 2IGHA 4EZKA 4GMVA 4K1RB 1E90A 4BKSD 1UZXB 1J0GA 1VD2A 3VUWA 4P7IA 1UBQA 1RRBA 3N32A 2J42A 3SDLC 4WWMA 2X38A 4AOFA 2LGIA 1WWTA 2KDMA 1TT5B 3CSFA 3QAQA 5BYQA 2KTRB 4IWOA 4DDGD 1FXAA 2JF5A 3ZNZB 3NY5A 2GBNA 3ZTDA 1QOBA 2IPKD 2KX3A 4XWTA 2KLGA 1WSPA 3VTWA 4ICUA 2WX0A 1MI0A 3NHEB 1V6EA 5G5GA 4TV3A 4W9HA 2OJWA 2KVZA 1TS5A 2MWSB 2BPSA 2BT6A 1V97A 3AU4A 5C23A 1T0YA 4BZAA 3GB1A 3DBSA 3WAPA 4HXDA 4ANWA 3AE1B 4RCOA 4YSYB 3AEFB 2DZKA 1IYFA 4P1CC 3BYYB 4US8A 3W5UB 4A20A 3ML8A 3A9JA 2LRWA 3AV8A 4KV2A 1N61A 2KDIA 2N9LA 2FNJB 4KSLC 1DOIA 2BB6A 3APFA 2KAJA 3MJ5A 3JVZX 1IGDA 3IT6B 1WM2A 4OVZA 4NJ7A 4XWWA 2WXJA 3BK2A 2K22A 3P4PB 3ZQ4A 3VTVA 4M00A 5EE9A 2VZKD 4RM8A 4DXAB 2D3CA 1BXTA 1NI2A 1CZPA 1PFDA 1VLBA 3BVGA 2EELA 3RD2A 2RMMA 4II3B 2JPHA 1VJKA 3N3KB 2FIDA 3AE4B 4MDKE 3OJ3A 2GBMA 2HD5B 2PVOD 1UWMA 3PT2B 3VH4B 4US9A 3N1ZC 3BVMA 2WXPA 3QARA 4MT5A 4W9IA 1L0YB 4K7WA 4ARIA 4WAAA 2W3RA 1I4HA 3KH0A 1EUVB 1SF0A 4HDQA 3VVWB 3LDZE 1SIFA 3ETRA 3DPDA 2LGXA 2GBJA 1P3QU 1Q5WB 3ZJVA 3QIJA 3MC8A 4NAMA 3A9JB 2Y5PA 4EEWA 3DVGY 2IO1B 2KT7A 1TKYA 2JWZA 1Y56A 3EUB2 2PMVA 3I3TB 1OGWA 4MSMB 2D3BA 1TGZB 2RDGA 4GN1A 1XCTL 3Q3JA 2L7RA 4FLHA 1V5OA 3AEAB 3BZDB 4HJKA 3SEBA 4OZAA 2K0PA 3AECB 1OEYJ 1WXVA 2KJRA 1VZ7A 1CJEA 4BFRA 2WU2B 3OAWA 1KTKA 1RYJA 5E6OA 3N1XC 1V8CA 3CMMB 3U8ZA 3NVVA 1ZUD2 1EO6A 1WE6A 3IT4B 4M02A 2IY0B 3ZO5B 3AM9A 3R7RA 4MELA 4B0MA 2MJEA 4WIPA 3QHTA 3MHSD 3ALBA 1QF6A 1WY8A 1JALA 2LVPA 3Q8FA 2WHIA 1XF5L 2PE9A 1C9FA 3ZTCA 4DQOC 2UWQA 4BVUC 2J4XA 3KQ4A 4ZYNA 3RUIB 1VZ6A 2N7EA 3AMZA 4BKTA 4F7ZA 1D6EC 2WDRB 3PLVA 5IKCM 2LHEA 1D5ZC 1ENFA 4FJYA 4H2AA 3DWMA 3E9SA 5FR3A 3KYCD 1ZKHA 2G4SA 1WJUA 3M63B 4A3PA 3ZJUA 3NZUA 4XYCA 4PK1A 2LFIA 1AWDA 3EFCA 3NUHB 3UQBA 3W1SC 4DWFA 3V60A 3PLUA 3PRPB 3ZJTA 4AUQC 3HM3A 2K8HA 2G3QB 4FHJA 3WCQA 3AE7B 3H8HA 2JYTA 1U4AA 2L1AA 2Y5CA 3WALA 1N6ZA 1MJDA 4GGQA 4C7ZA 3VHTC 1C4AA 3EHVA 2W9NA 4JL9A 1FEHA 5J18A 1WXAA 2DAFA 2D11A 3NZSA 3RFZB 3NVZA 1MG8A 5C3JB 3RNCC 1RWSA 3KYDD 3IBEA 1WYWB 1E5WA 2KYWA 3LXFA 1FRDA 3MFGA 4CQNA 1YX6B 2FCMA 1LQBA 2W55A 3RMKC 3BVZA 5BMGA 2J53A 2M19A 3Q8BA 4AWJA 3V62A 2SEBD 2KFKA 4TSSA 3RT3B 4LJOB 3K9PB 4GU2A 1MPEA 1V80A 3B9JA 3DBRB 3PHWB 2FUHB 4D2KA 1UNSA 4DHJB 1Q0WB 1MHHE 1R4MI 5AEKB 1WMHA 1XLNA 4FXCA 2WXGA 1YNTE 1WGRA 1N63A 2RPQA 4W9FA 4KGTA 3A4RA 1R4MB 1P0RA 4PYZA 4PS8A 5D94A 3T9LA 3VUYA 4DK5A 3DHHC 3L16A 2PLPA 2KN5A 1WI0A 1WGKA 2BS4B 5MPOA 1JWUD 3C19A 4K81A 1TY2A 1FM0D 4IM0A 1VDVA 1L6UA 4DHZB 4YTNB 1M4VA 4W9GA 1I7HA 3KW5B 2J0MA 3B1LX 2H89B 3L08A 2LMCA 2R2OA 3B2GA 4XX5A 2KC1A 2BYVE 2KD0A 3NG0A 1ZW7A 1Z2MA 2ZVOA 4C4VA 1C1YB 1YIWA 3NZ3A 1QOAA 3RN9C 1PGXA 3AE2B 2V9HA 2OOBB 3A9KA 3E56A 1FMAD 3DDCB 4ZRKA 3X23A 2PE6B 4A8XC 3I9V1 2M0XA 4LJPB 3Q69A 4XE0A 1E0ZA 2KFKB 1C3TA 3R7QA 1E8XA 2CHZA 2MLBA 1WMHB 3ZNGC 2Z59B 1FXTB 2GRIA 4K3BA 2KXJA 2WXKA 2KTFA 1SE9A 2FCNA 2K25A 1WXQA 1ISNA 1BUIC 2M1MA 2QDFA 2MEKA 4NPNA 3DVGX 4O1NA 3H7SA 2JXXA 2LGYA 5AUKA 1XCQL 1P1AA 2JVCA 2NBVB 3KUCB 1I35A 2FCQA 1VZ8A 3H7PA 2N9EB 2JZ3B 1MHXA 4J3OD 4B9KA 1AYFA 1NBFC 4USAA 3RNFC 2NBWB 1YJIA 1ZP0B 2LXAA 4C4VB 4A6QA 3T3NA 1I4QA 3W1SA 5EE0A 2INPE 1S3SG 3A9KB 1V81A 3SU8X 2YVCA 4B0EA 4NY0A 1J7AA 1V86A 2LVQA 1FCCC 3P2BA 1P7FA 1WXMA 1HXYD 2IJ0A 1A70A 2WDTB 4EZJA 3UF8A 2LHDA 4YL8A 1VR9A 2CU3A 1NDDA 1QILA 3MC0B 3ECIA 3VUXA 2JXTA 2N7DA 5KHQA 2ZPYA 3DWGC 2NTSA 1KRHA 1GC6A 1S1QB 3Q2AC 1D4BA 3DOWA 1JWSD 4AQ7A 4ASWC 1PGAA 1MFWA 1E9MA 2HJ1A 3I57A 3H7PB 4QAYA 3UINB 2PKOA 2AL3A 1CK1A 2JT4B 1F2RC 3DBLB 4B95A 4IM3A 1TS3A 2ZCBA 1YQ4B 3UI3A 1T6BX 2KWCA 4C80A 3EECA 4XDCA 1TS4A 5D6JB 2MBHA 4N9F4 5I4DA 2J0JA 2JU6X 3FILA 4MGIE 3U30A 1WGYA 3AH7A 3QWZB 3ZKJC 4GLSC 2FAZA 2J0KA 2AEHA 2JYEA 2NTTA 1UGJA 4HK2A 5FK9C 2V3NA 4KZ0A 2V1YA 3JSVA 2LI5A 2KDFB 4NAWA 1ZPSA 2OJRA 4K7SA 1WZ3A 4ACFA 4BOZB 2AX5A 3QK0A 2A4ZA 2VH1A 3U4EG 1T3QA 1WZ0A 1GJZA 2FE8A 4K7UA 3WIMA 3HVDA 3APCA 3IHPC 4LLGM 3PO0A 5D3IB 3T3OA 2A5UA 5CHWA 2DBYA 3TEZA 2MBEA 1WE7A 2DLBA 4HWIB 2W82A 3RNEC 2DZJA 4F1SA 4I6PA 1WRIA 1WRDB 1GC7A 1V1OA 1OFFA 2C60A 3H9DA 3SR6A 1RFAA 3VH3B 3RYTA 2BKRB 3ONSA 1V9JA 3FILB 2M8SA 1K51A 1FNWA 2D07B 3ZLZA 1TYGB 1VCBA 3ZUNA 2QMTA 4E71A 3JSVB 2L8JA 3BYTB 3W2DA 4NAWB 2K9XA 3RULA 4KVGB 2LGSA 2KKCA 2FUG1 2LUEA 4MM3A 4BAXA 3DVNV 1E8WA 2L83A 2KZRA 3C0RB 2KX0A 4IM2A 1WJNA 4UDUC 2AL6A 3NVYA 3L13A 5AUIA 1A5RA 1FFUA 2KWUB 2LJ5A 3K9OB 4B6WA 1J7BA 1YD8U 4FADA 4MJSA 5IOIA 2MP2A 1SIJA 1N60A 3TEXA 3T8MA 2BB5A 4EKUA 1KLGD 1YN3A 1Q1OA 2HTHA 4TUUA 4KKIA 1GUAB 2WXNA 2V0GA 2L76A 2HJ8A 4RGTA 1FRRA 4PYUA 1N5XA 2L0TA 4MGKE 2AQ1B 4KX6B 1DOYA 1TBEA 2RDHA 4FJVB 1EU4A 1KF6B 1YMHE 2BVCA 4WJQA 1SE3A 2RGFA 4K3CA 4KIKA 3AXCA 2BW2A 3QA8A 5H92C
chains in the Genus database with same CATH topology
1B1ZA 5BMHA 4MM3B 5H8YE 2IGGA 3C8YA 2IGDA 4OZBA 4C7ZA 1PDXA 1E6EB 1C4AA 2MJDA 4YTPB 1JW9D 3HUIA 1YN4A 2BS3B 1FEHA 4P16A 1N62A 1SJHD 2GI9A 1QT9A 3RFZB 5HI1A 1HA5A 3NVZA 2Q5WD 5C3JB 1RWSA 2VZKB 4RGNA 1FNVA 2BS2B 2YEPB 1NENB 1C77A 4A90A 2LEKA 1ET9A 1PUTA 4TQ0A 1TY0A 3L4PA 1K50A 1RM6C 1XLOA 2M56B 1PGBA 3P4SB 2JX5A 1I4RA 3IXSA 1FRDA 3LXFA 3MFGA 2KN4A 3AEDB 3VRAB 4CQNA 2D5GA 5BYSA 2W55A 2WS3B 3TSSA 3BVZA 3SFEB 3U2SC 5BMGA 2EKIA 2KQ4X 2J53A 2M19A 3Q8BA 4HJGE 1ROEA 2E3TA 4A55A 1L4DB 2SEBD 2DWQA 1FFVA 4N58A 4TSSA 1E10A 1AW7A 2YEPF 1V1PB 1GOZA 1MPEA 1SJED 3B9JA 3CWIA 4D2KA 1UNSA 1IBXB 1MHHE 1TKEA 1DOXA 1XLNA 4FXCA 2WXGA 1YNTE 1OQRA 4OZCA 1NYQA 1N63A 5GXGB 4ZHOA 2WXHA 3VRBB 4KGTA 2ACZB 2G9HD 1C4PA 1QOGA 2I2YA 1XEEA 1SE4A 3V05A 4RGOS 1C78A 5LNK1 2WLBA 2PLPA 1F2RI 2KMMA 4RF0A 1N5WA 2DYOA 1NI3A 4HEA1 1OQQA 1WGKA 2BS4B 3AEBB 1LO5D 1KH0A 1TZOA 2PW9A 1JWUD 5MPOA 1BMLC 1TY2A 2M0AA 1FM0D 4N59A 5E6JA 1VDVA 2TSSA 1L6UA 1MVKA 4YTNB 1M4VA 1NYRA 1I7HA 4YXDB 3URYA 4YWGG 2H89B 3SFDB 1TS2A 3HRDD 3AE9B 2LMCA 3B2GA 4AS1A 3R2IA 5BYRA 4EE2A 1FCLA 3B2FA 2V4IB 3GS2A 4IKGA 3AE5B 4ZOHC 4JWUC 2WXLA 3NZ3A 1EU3A 2SAKA 3IAS1 1QOAA 1JWBD 1PGXA 1FIQA 2AQ3B 3AE2B 2WDVB 4TMAB 4N6EB 1ESFA 3E56A 2JSVX 1TJEA 1FMAD 2WDQB 2QIEB 3MP9A 3N9YC 1K53A 2AQ2B 1XXGA 2N7JA 4A8XC 3I9V1 2N0SB 4OW0A 1UWXA 2BBCA 2INNE 1IGCA 3Q69A 4XE0A 1E0ZA 1QLBB 2R61A 1GB1A 3EA6A 4ZYSA 4REZA 2LUMA 2KWDA 3P63A 5HFYA 2JWUA 4HKQA 2WXFA 3Q8CA 4WURA 1EM7A 4WQMA 2GRIA 5JXVA 1RFKA 2E6XA 4L2YA 1PYWD 2WXKA 2WQYB 1I4XA 3Q8AA 1ACCA 3IAM1 1WXQA 1BUIC 2V3PA 2HDEA 2LJIA 2MEKA 1F0ZA 4R3DA 1JMLA 1SEBD 1L0XB 4O1NA 4RH6A 3AN1A 5AUKA 3NS1A 2DYMA 3BK1A 2IGHA 1NVID 1XCQL 2WXIA 2JZPA 2K3UA 1JWAD 4JPSA 5EE1A 1XLQA 2K5PA 4L23A 1VZ8A 1GPXA 2PTLA 1MHXA 4J3OD 4LTUA 2GB1A 1AYFA 1L6VA 4IOIE 4USAA 2OEDA 1YJIA 3AEEB 4HROA 4LK0M 2J42A 1ZP0B 2PIAA 4WWMA 4YSZB 3FC4A 2X38A 2LGIA 4A6QA 3T3NA 1WWTA 2WXOA 2KDMA 1I4QA 3W1SA 5EE0A 1EWCA 3KWLA 5EE3A 4ZRQA 1C4CA 2INPE 1ZE3D 5BYQA 3P1MA 4L1BA 1FXAA 1TKGA 2IDYA 4Q2JA 4ARCA 3AB5A 4B0EA 1QOBA 4RF1A 1J7AA 2IPKD 4XWTA 1WSPA 4RNAA 2W54A 1MI0A 4ITKA 1JROA 1FCCC 1E7PB 5G5GA 1P7FA 2CJOA 1VRAB 3KWVA 1HXYD 2IJ0A 1TS5A 1FD6A 1A70A 2WNMA 1I4PA 2BT6A 2LHDA 1YN5A 1V97A 3CIRB 3GB1A 2ZW1A 1VR9A 2CU3A 5C2TB 1QILA 2Z8LA 3MC0B 4KGRA 4NZLB 4MH8A 3AE1B 3HVZA 1C79A 2JXTA 2WU5B 1JWMD 4RCOA 4YSYB 3AEFB 3J9CA 3P4QB 1D5MC 3MHZA 3BIID 1CQVA 4M0WA 3DWGC 2NTSA 1KRHA 4RGMA 1D4BA 1JWSD 4AQ7A 3BYYB 4US8A 1PGAA 2B76B 3W5UB 1QOFA 4KKJA 1E9MA 2BTEA 5T8IA 5HHDG 3I57A 3AV8A 2PKOA 1DYQA 1N61A 1CK1A 4C56C 1F2RC 4C7YA 2N9LA 1TS3A 2RPVA 1DOIA 2BB6A 3MJ5A 2KAJA 1YQ4B 1IGDA 3UI3A 1T6BX 3IT6B 1GB4A 2QJLA 4C80A 4XDCA 1TS4A 4NJCA 4OVZA 3AE6B 3RPFC 4XWWA 3U7ZA 2WXJA 3BK2A 2K22A 3P4PB 3FILA 2JU6X 5I4DA 4JX1C 3ZQ4A 2ZW0A 3NRZA 3AH7A 5EE9A 2VZKD 4WH4A 1DGJA 1BXTA 1CZPA 1PFDA 1VLBA 2JYEA 3BVGA 4GLSC 2EELA 2NTTA 2RMMA 3ABVB 3AE8B 4XDDA 1JCKB 1UGJA 4KGSA 1VJKA 2NMQA 1IUEA 3AE4B 5FK9C 2V3NA 2PVOD 1I4GA 2WXRA 1UWMA 3Q8EA 4YTMB 1ZPSA 1SE2A 4US9A 2AX5A 3BVMA 2WXPA 3U52E 4MT5A 2G1EA 1L0YB 4ARIA 4GDKB 3U4EG 2W3RA 1J7CA 1I4HA 1T3QA 2N9KA 2FE8A 4HRSA 2CJNA 2ON8A 1SF0A 4GDLB 3HVDA 1HEZE 3O13A 4WAFA 4LLGM 3PO0A 3ETRA 2L52A 1R7SA 5D3IB 3T3OA 3ZJVA 4HKZE 2DBYA 3TEWA 3TEZA 3R8BA 2DLBA 4NAMA 3BWUD 2Y5PA 2W82A 5G5HA 5D7GA 2XN9C 1WRIA 3TUOA 3EGRA 1ET6A 1V1OA 1SBBB 3W9CB 1OFFA 1TKYA 3ZYYX 3VQIA 3ZGZA 1Y56A 3EUB2 4ZHPA 1JRPA 2PMVA 4DXGA 4P6VF 3SR6A 2RDGA 1XCTL 1B9RA 2WP9B 1HZ6A 3AEAB 3BZDB 3LB8C 3SEBA 4OZAA 2K0PA 3AECB 1EWYC 3FILB 5BMIA 1YJJA 3P42A 1HZ5A 1VZ7A 1K52A 1K51A 1CJEA 3LYYA 5D3DA 1AN8A 4OHJA 1FNWA 2WU2B 3VR9B 2J52A 4TQ1A 1KTKA 4JWSC 1RYJA 2QEJC 1TYGB 1XO3A 1V8CA 3OWEB 2ICIA 1ZUD2 3NVVA 2QMTA 1FXIA 1SSNA 3BYTB 3NVWA 3W2DA 1ZOYB 4NAWB 2OHFA 2WXQA 2H88B 1P7EA 3IT4B 2K9XA 4IDIA 2MJ3A 2Y3AA 2MH7A 3W5VB 1L4ZB 1ZDVA 3AM9A 3KLSX 2FUG1 2I38A 1KFYB 1ZDXA 1C76A 4B0MA 4RFBA 2MJEA 4WIPA 2KACA 1GAQB 2L83A 3PZ8A 1QF6A 4PT5A 3V3XA 2HTME 1JALA 3Q8FA 4UDUC 3NVYA 1XF5L 2PVGC 5AUIA 1FFUA 1C9FA 4ZRPA 4DQOC 2WXMA 1FO4A 1J7BA 2J4XA 3KQ4A 2BYTA 1HQRD 1L5PA 3TEYA 2QILA 1NEKB 1VZ6A 3AMZA 3P4RB 1D6EC 2WDRB 1QQRA 2LHEA 1F77A 1SIJA 1D5ZC 1ENFA 1N60A 3TEXA 3FAHA 4DXFA 2BB5A 4MACA 4YT0B 5HG2A 2W3SA 1KLGD 4JE3B 1YQ3B 1KLUD 1YN3A 3DWMA 4H2AA 1UUPA 1WYGA 2ONQA 3E9SA 5FR3A 2QSDA 1QKZA 2WXNA 4KKIA 2FBWB 3GP7A 3ZJUA 2V0GA 1STEA 2LFIA 4RGTA 1FRRA 1SXTA 5FKAC 3R2TA 1AWDA 3PZ7A 1XLPA 1N5XA 3NUHB 1ZXHA 3AE3B 4A9AA 2L32A 5TSSA 2AQ1B 1V1PA 1JQ4A 4KX6B 1DOYA 2XNAC 1L0VB 2RDHA 1IBXA 1FNUA 4YSXB 3ZJTA 1EU4A 1KF6B 1YMHE 1Q10A 2JQRB 1SE3A 3WCQA 3AE7B 3H8HA 2JYTA 3AEGB 3VR8B 1D5XC 1T5XD 2BW2A 1ZXIA 2L1AA 1SB3C 5H92C 2Y5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIQ A;  3AE2 B;  2WDV B;  4N6E B;  1B9R A;  2WP9 B;  5H8Y E;  3AE1 B;  3AEA B;  3LB8 C;  3HVZ A;  2WU5 B;  4C7Z A;  4YSY B;  1PDX A;  1FMA D;  1TJE A;  3AEF B;  2WDQ B;  1EWY C;  1E6E B;  2MJD A;  3AEC B;  3P4Q B;  3BII D;  2QIE B;  4YTP B;  1YJJ A;  3DWG C;  1KRH A;  1JW9 D;  3HUI A;  2N0S B;  1CJE A;  2BS3 B;  2WU2 B;  4US8 A;  3VR9 B;  1N62 A;  3W5U B;  2B76 B;  1E0Z A;  1QOF A;  1QLB B;  4JWS C;  1RYJ A;  1QT9 A;  1E9M A;  1TYG B;  1XO3 A;  1V8C A;  3AV8 A;  3NVZ A;  3NVV A;  1ZUD 2;  2Q5W D;  5C3J B;  1RWS A;  3P63 A;  2PKO A;  1FXI A;  1N61 A;  4C7Y A;  2BS2 B;  3NVW A;  1NEN B;  1ZOY B;  2LEK A;  4WQM A;  2OHF A;  4IDI A;  1DOI A;  1RFK A;  2H88 B;  1YQ4 B;  2K9X A;  2KAJ A;  1PUT A;  2MJ3 A;  2WQY B;  3L4P A;  2MH7 A;  3W5V B;  2QJL A;  1RM6 C;  1XLO A;  2M56 B;  4C80 A;  1WXQ A;  3P4S B;  2JX5 A;  3AE6 B;  3LXF A;  1FRD A;  3RPF C;  3AM9 A;  3AED B;  3VRA B;  1KFY B;  2W55 A;  1QOA A;  2K22 A;  2WS3 B;  1F0Z A;  2MJE A;  3P4P B;  3SFE B;  2EKI A;  3AN1 A;  3NRZ A;  1GAQ B;  3AH7 A;  2L83 A;  2M19 A;  5EE9 A;  5AUK A;  3NS1 A;  1QF6 A;  1ROE A;  1DGJ A;  1NVI D;  2E3T A;  1CZP A;  1PFD A;  1VLB A;  2HTM E;  4JX1 C;  1JAL A;  3ABV B;  1JWA D;  3AE8 B;  3NVY A;  2PVG C;  1XLQ A;  5EE1 A;  2DWQ A;  1FFV A;  4N58 A;  5AUI A;  1E10 A;  1FFU A;  1VJK A;  1IUE A;  3AE4 B;  2K5P A;  1GPX A;  3B9J A;  1FO4 A;  3CWI A;  2PVO D;  4LTU A;  1J7B A;  1AYF A;  1L5P A;  1L6V A;  1TKE A;  1UWM A;  1DOX A;  1XLN A;  1NEK B;  4FXC A;  4USA A;  4YTM B;  1OQR A;  3AMZ A;  3P4R B;  1NYQ A;  1YJI A;  2WDR B;  1N63 A;  3AEE B;  4HRO A;  4US9 A;  5GXG B;  4ZHO A;  1ZP0 B;  2AX5 A;  3VRB B;  2PIA A;  1SIJ A;  2G1E A;  3FC4 A;  2ACZ B;  1N60 A;  4WWM A;  3FAH A;  5C2T B;  4YSZ B;  1QOG A;  4YT0 B;  2W3S A;  1WWT A;  2W3R A;  1YQ3 B;  1J7C A;  1T3Q A;  3DWM A;  5EE0 A;  3KWL A;  5EE3 A;  4HRS A;  2CJN A;  2WLB A;  1WYG A;  1SF0 A;  3P1M A;  2KMM A;  1N5W A;  1FXA A;  1NI3 A;  1TKG A;  2FBW B;  1OQQ A;  1WGK A;  2BS4 B;  3AEB B;  3PO0 A;  1FRR A;  5MPO A;  3ETR A;  3AB5 A;  4N59 A;  2L52 A;  1FM0 D;  1QOB A;  1AWD A;  1R7S A;  1N5X A;  1XLP A;  1VDV A;  3AE3 B;  1L6U A;  1J7A A;  4A9A A;  4YTN B;  1NYR A;  1JQ4 A;  1I7H A;  4KX6 B;  2DBY A;  4YXD B;  1L0V B;  1DOY A;  2W54 A;  4ITK A;  1JRO A;  1E7P B;  5G5G A;  4YSX B;  2CJO A;  5G5H A;  2H89 B;  3SFD B;  1KF6 B;  3AE9 B;  3B2G A;  3HRD D;  1WRI A;  1A70 A;  2JQR B;  3W9C B;  1OFF A;  1TKY A;  3ZYY X;  3WCQ A;  3B2F A;  3AE7 B;  2BT6 A;  3EUB 2;  4ZHP A;  1JRP A;  1V97 A;  3AEG B;  3CIR B;  3VR8 B;  3AE5 B;  4P6V F;  4JWU C;  4ZOH C;  3SR6 A;  2CU3 A;  1ZXI A;  1SB3 C;  1JWB D;  5H92 C;  2Y5C A; 
#chains in the Genus database with same CATH topology
 2QHO A;  4TKN A;  4MM3 B;  3NOB A;  5H8Y E;  3C8Y A;  2LWP A;  1PDX A;  2C9W B;  2JRI B;  4YTP B;  2ZVN A;  3LJ3 A;  2INC C;  3L10 B;  5HI1 A;  2KO3 A;  3VTU A;  4HPL B;  2VZK B;  4RGN A;  2YEP B;  1C77 A;  4MJS B;  1WGH A;  3L4P A;  2ZNV C;  2MP2 B;  1RM6 C;  2M56 B;  1PGB A;  2JX5 A;  1I4R A;  4G0N B;  3AED B;  4ANX A;  1WGD A;  1HE8 A;  5BYS A;  2WS3 B;  3TSS A;  2XBB C;  3A33 B;  2KQ4 X;  3QCA A;  4HJG E;  1ROE A;  2N9P C;  4KDL B;  2KAN A;  3S2A A;  4WJO A;  4IC7 B;  1FFV A;  1E10 A;  1AW7 A;  2BKF A;  2L00 B;  2WX1 A;  1DOX A;  1WJ6 A;  5GXG B;  4FJZ A;  2WXH A;  3VRB B;  2ACZ B;  2G9H D;  2MBO A;  3ZDT A;  1T0R C;  4KIK B;  1QOG A;  4RGO S;  4GB9 A;  5LNK 1;  3DBH B;  2WLB A;  1F2R I;  2KMM A;  1N5W A;  2DYO A;  4C00 A;  2M4N A;  1OQQ A;  1V2Y A;  1LO5 D;  1BML C;  3GZN I;  4YXD B;  3TMP B;  4OVU A;  4FN2 A;  4YWG G;  3SFD B;  1TS2 A;  3GZN B;  2O2V A;  4AS1 A;  1QZE A;  3R2I A;  3WAO A;  2DZM A;  1FCL A;  3V6C B;  3DHI C;  2V4I B;  4LNO A;  3U7D A;  2WXL A;  1EU3 A;  2SAK A;  3IAS 1;  4II2 B;  3ZVV A;  1UF0 A;  5IAA C;  2JSV X;  1TJE A;  1T0S C;  3N9Y C;  1XXG A;  2N0S B;  5LXI B;  2ZCC A;  2BBC A;  2INN E;  1WJ4 A;  4XZ4 A;  1QLB B;  2VRR B;  1YX5 B;  5AZH A;  2KMA A;  3EA6 A;  4ZYS A;  5JH5 C;  1WF9 A;  4REZ A;  1D3Z A;  2KWD A;  2WXF A;  2V4L A;  4WUR A;  1EM7 A;  4WQM A;  4L2Y A;  2BWF A;  1ACC A;  4LCD E;  3IAM 1;  2V3P A;  4GOC A;  2LJI A;  1F0Z A;  2BF8 B;  4KZC A;  4R3D A;  1JML A;  3AN1 A;  5IP4 D;  3EC8 A;  2DYM A;  2WXI A;  2JZP A;  2WWZ A;  4JPS A;  4G50 A;  2LAS A;  4DHJ D;  1XLQ A;  1CMX B;  1UGM A;  1KOT A;  3M3J A;  1GPX A;  3Q3N C;  2PTL A;  4LTU A;  1L6V A;  3H6N A;  2OED A;  4WJN A;  4PS7 A;  2O2V B;  3AEE B;  4LK0 M;  3Q3F A;  2PIA A;  4YSZ B;  5HKH A;  3ENE A;  3B0A A;  1EWC A;  3KWL A;  5EE3 A;  2I1K A;  1ZE3 D;  3DBR I;  3P1M A;  4L1B A;  1TKG A;  4M8M A;  3DVN U;  1MG4 A;  4ARC A;  1PQS A;  2D2Q A;  4ANV A;  4HCP B;  4RNA A;  2W54 A;  3PRZ A;  4FUL A;  4DHZ E;  1VRA B;  3QQ8 B;  1I4P A;  4HPP A;  3A1Q A;  3TIX A;  4GDK A;  5JZE B;  2K39 A;  2GOW A;  3PRE A;  2Z8L A;  4LDT B;  4GDL A;  1KJT A;  3M95 A;  3HVZ A;  1JWM D;  3J9C A;  3P4Q B;  3Q3O C;  1D5M C;  3MHZ A;  4NQK E;  3BII D;  4M0W A;  2GBK A;  4RGM A;  1XQQ A;  2B76 B;  1QOF A;  2MHJ A;  5T8I A;  5HHD G;  1LXD A;  2N4F A;  5L95 C;  4C56 C;  2KDB A;  3RNA C;  2RPV A;  3IVF A;  1GB4 A;  2CR5 A;  4NJC A;  4W9E A;  3RPF C;  2K6D B;  2WGS A;  3U7Z A;  2KNB A;  2LGD A;  1J19 A;  3HHM A;  3NRZ A;  2Z0D B;  2NCN A;  2Z0E B;  3AE8 B;  4KGS A;  2NMQ A;  1IUE A;  3ZW3 A;  2WXR A;  4YTM B;  1LFD A;  3RNB C;  5AZG A;  3U52 E;  4IWQ A;  3A1Q B;  3AI5 A;  4W9J A;  4GDK B;  3SD5 A;  5DPR A;  2N9K A;  4HRS A;  2CJN A;  3PPA A;  4GDL B;  1HEZ E;  2KK8 A;  3O13 A;  4S0R A;  2L52 A;  4M0W B;  1R7S A;  1IPG A;  3TCA A;  4HKZ E;  1M94 A;  2IY1 B;  4WWO A;  3APD A;  4WJP A;  3R8B A;  3L54 A;  3BWU D;  4EZL A;  2XK5 A;  2ZNV B;  5G5H A;  2KJ6 A;  2XN9 C;  5AZF A;  1Y8R C;  1SBB B;  3W9C B;  1H8C A;  4ZHP A;  1EF1 A;  1JRP A;  4DXG A;  4S17 A;  3ML9 A;  2JRH A;  4KSK C;  1KLV A;  2MQJ A;  2WP9 B;  3LB8 C;  5BMI A;  1K8R B;  3P42 A;  1HZ5 A;  1AN8 A;  2KMC A;  3VR9 B;  3ZRC A;  4JWS C;  3OJ4 B;  2QEJ C;  3OWE B;  1FXI A;  1SSN A;  1ZOY B;  4IDI A;  1P7E A;  2D10 A;  2MJ3 A;  4JIO U;  2KJH B;  1ZDV A;  2DAJ A;  1ZDX A;  4LNI A;  3RCZ A;  2KAC A;  1WH3 A;  3QC8 B;  1GAQ B;  3DBL I;  3PZD A;  3PZ8 A;  5J17 A;  1E8Y A;  4NJ6 A;  3PS6 A;  1UD7 A;  3WAM A;  1FO4 A;  3ZXR A;  2MW5 A;  3TEY A;  2QIL A;  2XK5 B;  3WAN A;  2LXC A;  2O6V A;  2CU1 A;  3BY4 B;  1F77 A;  4I6N B;  4HDO A;  2AWT A;  3FAH A;  4DXF A;  4MAC A;  2CHX A;  3PHX B;  1OQY A;  4IW0 A;  3PRM B;  1KLU D;  1F9J A;  2ONQ A;  5L83 A;  1I42 A;  1EF5 A;  1UEL A;  1QKZ A;  3D32 A;  2FBW B;  3GP7 A;  3QX1 A;  5JHA A;  1JRU A;  1SXT A;  3ZNH B;  5FKA C;  3PZ7 A;  1XLP A;  3AE3 B;  2LZ6 A;  5TSS A;  4JLC A;  3N1Y C;  3W1Y A;  1JQ4 A;  2FIF A;  3R3M A;  4BKS A;  2NBU A;  4YSX B;  1E7V A;  3DCG A;  1HTQ A;  3IFW B;  3ZDM C;  2JQR B;  4JGH B;  4W9D A;  5J2R A;  1RAX A;  2KWV B;  1D5X C;  1T5X D;  3N30 A;  3IG3 A;  4HLE A;  1SB3 C;  1GG3 A;  1WX8 A;  1B1Z A;  3Q14 C;  2IGG A;  2IGD A;  4OZB A;  1YQB A;  1E6E B;  2MJD A;  2R2Q A;  3HUI A;  2BS3 B;  1R4N I;  1SJH D;  4EFO A;  4ZRI A;  2GMI C;  2Q5W D;  3MTN B;  2KC2 A;  1R4N B;  1FNV A;  2YLM A;  2EMS A;  2HE7 A;  1ET9 A;  3DHG C;  3I5J C;  1PUT A;  4NNJ B;  2O6V B;  1K50 A;  3IXS A;  3VRA B;  3NS8 A;  2D5G A;  3SFE B;  3U2S C;  2IBI B;  5CX3 A;  2EKI A;  2J7Q B;  2DHZ A;  2K8B A;  4A55 A;  1L4D B;  2LRU A;  4M8N A;  2RD0 A;  4N58 A;  2L05 A;  4KDI C;  2YEP F;  4MH0 E;  1E8Z A;  1GOZ A;  3AUL A;  3PGE A;  3SHQ A;  2K8C A;  4ICV A;  2KQS A;  1KM7 A;  4OZC A;  2IO3 B;  4A3O A;  4ZHO A;  2MBQ A;  2I2Y A;  1XEE A;  3V05 A;  2XEW A;  1C78 A;  4IUM B;  4RF0 A;  1WX9 A;  5C1Z A;  2PW9 A;  1WGG A;  4PS3 A;  5E6J A;  1TTN A;  2TSS A;  2N1W A;  1NYR A;  4AJY B;  5IN7 A;  2K1F A;  5IA7 A;  2JY6 A;  2N9X A;  3HRD D;  1LGR A;  1P9D U;  4XGA B;  3RZW C;  3GS2 A;  4IKG A;  4HPM B;  2V3S A;  1WR6 E;  1WM3 A;  4ZOH C;  2RR9 A;  3VXW A;  3RNG C;  1WIA A;  1ESF A;  3DQV A;  2G4D B;  2WDQ B;  4E3C A;  2QIE B;  3MP9 A;  4OW0 A;  4I6L B;  1UWX A;  3JW0 X;  1IGC A;  3JYU A;  2CHW A;  3HM6 X;  2R61 A;  1GB1 A;  1ZGU B;  2LUM A;  5HFY A;  3P63 A;  2JWU A;  4HKQ A;  4RMA A;  5GMV A;  5JXV A;  5TR5 A;  2E6X A;  2WQY B;  1WXS A;  1I4X A;  3Q8A A;  3ZRF A;  4JQW C;  2LVO A;  3V61 A;  2HDE A;  1XD3 B;  1L0X B;  5FR6 A;  3NS1 A;  3BK1 A;  1NVI D;  1OTR B;  2M17 A;  4URK A;  2K3U A;  1JWA D;  5EE1 A;  2K5P A;  4L23 A;  3GE8 C;  1G6J A;  1V49 A;  2GB1 A;  4XC2 A;  2KLC A;  4IOI E;  2NS5 A;  4CYE A;  4DBG A;  3O65 B;  4HRO A;  2IND C;  4W9K A;  3N20 C;  5LXH A;  3H1U A;  2D3A A;  3AU5 A;  3FC4 A;  2WXO A;  3FKY A;  4F8C B;  4ZRQ A;  5CHV C;  1C4C A;  3CST A;  2IDY A;  4Q2J A;  2C7M B;  5DPW A;  2ZJD A;  2PJH A;  4FA6 A;  3AB5 A;  4RF1 A;  2KHW B;  1L7Y A;  2DEN B;  1WFY A;  2MCN B;  4ITK A;  1JRO A;  1V5T A;  3Q6B A;  1E7P B;  3DBH I;  2CJO A;  2ZEQ A;  3KWV A;  1FD6 A;  2KOX A;  2WNM A;  2FCS A;  1YN5 A;  4LNN A;  3CIR B;  2ZW1 A;  5C2T B;  5E6P A;  3WA0 A;  1E7U A;  4KGR A;  4NZL B;  3KUD B;  4MH8 A;  1C79 A;  2L3Z A;  2WU5 B;  3UIP B;  1CQV A;  2KVR A;  4MGZ E;  2VH2 A;  4KKJ A;  2MX2 A;  2GLS A;  4BOS C;  2BTE A;  2PEA A;  1H4R A;  3PSE B;  2KQ7 A;  1DYQ A;  4C7Y A;  3TL5 A;  2BYE A;  4E74 A;  2BQQ A;  2QJL A;  3AE6 B;  4GXB A;  3TJP A;  2DZI A;  2DYB A;  4RM9 A;  2IZV B;  2ZW0 A;  5BO4 B;  1Z5S B;  4WH4 A;  2UYZ B;  1DGJ A;  1P98 A;  4JX1 C;  5IO9 A;  3ABV B;  4XDD A;  4WWP A;  1JCK B;  4HVB A;  4WWN A;  1I4G A;  2NPT A;  2C7N B;  3Q8E A;  1SE2 A;  4GSW A;  4LNF A;  2G1E A;  1LM8 B;  2RDB C;  4OVV A;  3EFU A;  3X0W A;  5DCN A;  1J7C A;  2BYF A;  2ON8 A;  4P1B C;  5CHF A;  2Y5B B;  4WAF A;  2MBB B;  2MSE D;  2REX A;  1F52 A;  5EDS A;  4G11 A;  2UU7 A;  3TEW A;  1WX7 A;  3BIN A;  3RI7 C;  2B3A A;  2G45 B;  5D7G A;  2IYD B;  3TUO A;  2I1J A;  3EGR A;  1ET6 A;  3ZGZ A;  3ZYY X;  3VQI A;  2NVU I;  2N1V A;  2D3G A;  4LDT D;  4P6V F;  1HTO A;  5G2N A;  1F1H A;  3MC9 A;  2EMT A;  2GBR A;  2JZZ A;  1B9R A;  2ZZP B;  1HZ6 A;  1EWY C;  1YJJ A;  1K52 A;  3LYY A;  5D3D A;  4OHJ A;  3KUZ A;  2J52 A;  3Q3M C;  4TQ1 A;  3CF6 E;  1XO3 A;  2ICI A;  2MRP A;  2NPT B;  3NVW A;  1XT9 B;  2OHF A;  2WXQ A;  2H88 B;  2K6Q A;  4MEM A;  4BBN C;  1SGH A;  2Y3A A;  2MH7 A;  3W5V B;  1L4Z B;  3MJW A;  3KLS X;  2I38 A;  1KFY B;  5E6N A;  1C76 A;  2X8X X;  4RFB A;  2DNF A;  4IG7 B;  4PT5 A;  3V3X A;  2CS4 A;  3NJT A;  2HTM E;  1UH6 A;  2PVG C;  4BKG A;  4ZRJ A;  1YOV B;  3KVF B;  4ZRP A;  2WXM A;  2BYT A;  1HQR D;  1L5P A;  1NEK B;  4CO7 A;  3P4R B;  1QQR A;  2BGF A;  3HIZ A;  4AP4 C;  1OEY A;  5DPS A;  4YT0 B;  5HG2 A;  2W3S A;  5JHB A;  3I63 C;  4JE3 B;  1YQ3 B;  1TIF A;  1UUP A;  1WYG A;  2QSD A;  1STE A;  3R66 C;  5D2M B;  3R2T A;  3GOE A;  4CHK A;  1ZXH A;  4A9A A;  2L32 A;  1V1P A;  3ZXV A;  2XNA C;  1L0V B;  1IBX A;  1FNU A;  2MA9 B;  2CKH B;  2QC8 A;  2IO2 B;  1Q10 A;  3UQA A;  3AEG B;  3VR8 B;  4J6I A;  3VDZ A;  1ZXI A;  3QJZ A;  5BMH A;  1FPY A;  4ANU A;  2ZPN A;  3A4S C;  2C5L C;  1JW9 D;  1YN4 A;  5G55 A;  4P16 A;  1N62 A;  2JUO A;  3L17 A;  2GI9 A;  1QT9 A;  1HA5 A;  4MSQ B;  1GNU A;  4M01 A;  4EOY A;  2BWE S;  1J8C A;  3UIO B;  3PTF C;  2BS2 B;  1NEN B;  4A90 A;  2LEK A;  1YJ1 A;  4TQ0 A;  1TY0 A;  1XLO A;  3P4S B;  2KN4 A;  3TBL D;  3L0W B;  3OLM D;  1RLF A;  3HK0 A;  2PPH A;  5CTR C;  2E3T A;  1BT0 A;  2DWQ A;  4LNK A;  4HCN B;  1V1P B;  4FBJ B;  1SJE D;  3CWI A;  1IBX B;  1TKE A;  2DX5 B;  4X57 B;  1OQR A;  2ASQ A;  1L2N A;  1NYQ A;  3M62 B;  4FHK A;  4ZDV A;  4EUT A;  1C4P A;  3VAW A;  1SE4 A;  3B08 A;  4NQL B;  1UBI A;  3GE3 C;  2AYO B;  1NI3 A;  4HEA 1;  3AEB B;  1KH0 A;  1TZO A;  2M0A A;  4N59 A;  4AJW A;  2EKE C;  1MVK A;  2KDE B;  3URY A;  4DDI D;  4BBN F;  2RSU A;  3AE9 B;  1AAR A;  5BYR A;  3PV1 A;  3ZNI D;  4EE2 A;  3B2F A;  3RZF A;  3VFK A;  3AE5 B;  1X1M A;  4JWU C;  1JWB D;  1FIQ A;  3UGB B;  2AQ3 B;  2WDV B;  2KTR A;  4TMA B;  4N6E B;  5KHO A;  5DPT A;  3OG5 A;  2WYQ A;  1T0Q C;  4W9C A;  2L0F A;  1K53 A;  5LLI A;  2AQ2 B;  2N7J A;  3PVL A;  4IWP A;  1TZ1 A;  2KFJ A;  4G3X B;  4W9L A;  2O6V D;  3ZIM A;  3Q8C A;  4MGY E;  1IP9 A;  2NR2 A;  2LD9 A;  1RFK A;  1PYW D;  2IO0 B;  2C7H A;  4GIV A;  3V6E B;  1SEB D;  1WR1 A;  4RH6 A;  4WQO B;  2QCZ A;  2IGH A;  4EZK A;  4GMV A;  4K1R B;  1E90 A;  4BKS D;  1UZX B;  1J0G A;  1VD2 A;  3VUW A;  4P7I A;  1UBQ A;  1RRB A;  3N32 A;  2J42 A;  3SDL C;  4WWM A;  2X38 A;  4AOF A;  2LGI A;  1WWT A;  2KDM A;  1TT5 B;  3CSF A;  3QAQ A;  5BYQ A;  2KTR B;  4IWO A;  4DDG D;  1FXA A;  2JF5 A;  3ZNZ B;  3NY5 A;  2GBN A;  3ZTD A;  1QOB A;  2IPK D;  2KX3 A;  4XWT A;  2KLG A;  1WSP A;  3VTW A;  4ICU A;  2WX0 A;  1MI0 A;  3NHE B;  1V6E A;  5G5G A;  4TV3 A;  4W9H A;  2OJW A;  2KVZ A;  1TS5 A;  2MWS B;  2BPS A;  2BT6 A;  1V97 A;  3AU4 A;  5C23 A;  1T0Y A;  4BZA A;  3GB1 A;  3DBS A;  3WAP A;  4HXD A;  4ANW A;  3AE1 B;  4RCO A;  4YSY B;  3AEF B;  2DZK A;  1IYF A;  4P1C C;  3BYY B;  4US8 A;  3W5U B;  4A20 A;  3ML8 A;  3A9J A;  2LRW A;  3AV8 A;  4KV2 A;  1N61 A;  2KDI A;  2N9L A;  2FNJ B;  4KSL C;  1DOI A;  2BB6 A;  3APF A;  2KAJ A;  3MJ5 A;  3JVZ X;  1IGD A;  3IT6 B;  1WM2 A;  4OVZ A;  4NJ7 A;  4XWW A;  2WXJ A;  3BK2 A;  2K22 A;  3P4P B;  3ZQ4 A;  3VTV A;  4M00 A;  5EE9 A;  2VZK D;  4RM8 A;  4DXA B;  2D3C A;  1BXT A;  1NI2 A;  1CZP A;  1PFD A;  1VLB A;  3BVG A;  2EEL A;  3RD2 A;  2RMM A;  4II3 B;  2JPH A;  1VJK A;  3N3K B;  2FID A;  3AE4 B;  4MDK E;  3OJ3 A;  2GBM A;  2HD5 B;  2PVO D;  1UWM A;  3PT2 B;  3VH4 B;  4US9 A;  3N1Z C;  3BVM A;  2WXP A;  3QAR A;  4MT5 A;  4W9I A;  1L0Y B;  4K7W A;  4ARI A;  4WAA A;  2W3R A;  1I4H A;  3KH0 A;  1EUV B;  1SF0 A;  4HDQ A;  3VVW B;  3LDZ E;  1SIF A;  3ETR A;  3DPD A;  2LGX A;  2GBJ A;  1P3Q U;  1Q5W B;  3ZJV A;  3QIJ A;  3MC8 A;  4NAM A;  3A9J B;  2Y5P A;  4EEW A;  3DVG Y;  2IO1 B;  2KT7 A;  1TKY A;  2JWZ A;  1Y56 A;  3EUB 2;  2PMV A;  3I3T B;  1OGW A;  4MSM B;  2D3B A;  1TGZ B;  2RDG A;  4GN1 A;  1XCT L;  3Q3J A;  2L7R A;  4FLH A;  1V5O A;  3AEA B;  3BZD B;  4HJK A;  3SEB A;  4OZA A;  2K0P A;  3AEC B;  1OEY J;  1WXV A;  2KJR A;  1VZ7 A;  1CJE A;  4BFR A;  2WU2 B;  3OAW A;  1KTK A;  1RYJ A;  5E6O A;  3N1X C;  1V8C A;  3CMM B;  3U8Z A;  3NVV A;  1ZUD 2;  1EO6 A;  1WE6 A;  3IT4 B;  4M02 A;  2IY0 B;  3ZO5 B;  3AM9 A;  3R7R A;  4MEL A;  4B0M A;  2MJE A;  4WIP A;  3QHT A;  3MHS D;  3ALB A;  1QF6 A;  1WY8 A;  1JAL A;  2LVP A;  3Q8F A;  2WHI A;  1XF5 L;  2PE9 A;  1C9F A;  3ZTC A;  4DQO C;  2UWQ A;  4BVU C;  2J4X A;  3KQ4 A;  4ZYN A;  3RUI B;  1VZ6 A;  2N7E A;  3AMZ A;  4BKT A;  4F7Z A;  1D6E C;  2WDR B;  3PLV A;  5IKC M;  2LHE A;  1D5Z C;  1ENF A;  4FJY A;  4H2A A;  3DWM A;  3E9S A;  5FR3 A;  3KYC D;  1ZKH A;  2G4S A;  1WJU A;  3M63 B;  4A3P A;  3ZJU A;  3NZU A;  4XYC A;  4PK1 A;  2LFI A;  1AWD A;  3EFC A;  3NUH B;  3UQB A;  3W1S C;  4DWF A;  3V60 A;  3PLU A;  3PRP B;  3ZJT A;  4AUQ C;  3HM3 A;  2K8H A;  2G3Q B;  4FHJ A;  3WCQ A;  3AE7 B;  3H8H A;  2JYT A;  1U4A A;  2L1A A;  2Y5C A;  3WAL A;  1N6Z A;  1MJD A;  4GGQ A;  4C7Z A;  3VHT C;  1C4A A;  3EHV A;  2W9N A;  4JL9 A;  1FEH A;  5J18 A;  1WXA A;  2DAF A;  2D11 A;  3NZS A;  3RFZ B;  3NVZ A;  1MG8 A;  5C3J B;  3RNC C;  1RWS A;  3KYD D;  3IBE A;  1WYW B;  1E5W A;  2KYW A;  3LXF A;  1FRD A;  3MFG A;  4CQN A;  1YX6 B;  2FCM A;  1LQB A;  2W55 A;  3RMK C;  3BVZ A;  5BMG A;  2J53 A;  2M19 A;  3Q8B A;  4AWJ A;  3V62 A;  2SEB D;  2KFK A;  4TSS A;  3RT3 B;  4LJO B;  3K9P B;  4GU2 A;  1MPE A;  1V80 A;  3B9J A;  3DBR B;  3PHW B;  2FUH B;  4D2K A;  1UNS A;  4DHJ B;  1Q0W B;  1MHH E;  1R4M I;  5AEK B;  1WMH A;  1XLN A;  4FXC A;  2WXG A;  1YNT E;  1WGR A;  1N63 A;  2RPQ A;  4W9F A;  4KGT A;  3A4R A;  1R4M B;  1P0R A;  4PYZ A;  4PS8 A;  5D94 A;  3T9L A;  3VUY A;  4DK5 A;  3DHH C;  3L16 A;  2PLP A;  2KN5 A;  1WI0 A;  1WGK A;  2BS4 B;  5MPO A;  1JWU D;  3C19 A;  4K81 A;  1TY2 A;  1FM0 D;  4IM0 A;  1VDV A;  1L6U A;  4DHZ B;  4YTN B;  1M4V A;  4W9G A;  1I7H A;  3KW5 B;  2J0M A;  3B1L X;  2H89 B;  3L08 A;  2LMC A;  2R2O A;  3B2G A;  4XX5 A;  2KC1 A;  2BYV E;  2KD0 A;  3NG0 A;  1ZW7 A;  1Z2M A;  2ZVO A;  4C4V A;  1C1Y B;  1YIW A;  3NZ3 A;  1QOA A;  3RN9 C;  1PGX A;  3AE2 B;  2V9H A;  2OOB B;  3A9K A;  3E56 A;  1FMA D;  3DDC B;  4ZRK A;  3X23 A;  2PE6 B;  4A8X C;  3I9V 1;  2M0X A;  4LJP B;  3Q69 A;  4XE0 A;  1E0Z A;  2KFK B;  1C3T A;  3R7Q A;  1E8X A;  2CHZ A;  2MLB A;  1WMH B;  3ZNG C;  2Z59 B;  1FXT B;  2GRI A;  4K3B A;  2KXJ A;  2WXK A;  2KTF A;  1SE9 A;  2FCN A;  2K25 A;  1WXQ A;  1ISN A;  1BUI C;  2M1M A;  2QDF A;  2MEK A;  4NPN A;  3DVG X;  4O1N A;  3H7S A;  2JXX A;  2LGY A;  5AUK A;  1XCQ L;  1P1A A;  2JVC A;  2NBV B;  3KUC B;  1I35 A;  2FCQ A;  1VZ8 A;  3H7P A;  2N9E B;  2JZ3 B;  1MHX A;  4J3O D;  4B9K A;  1AYF A;  1NBF C;  4USA A;  3RNF C;  2NBW B;  1YJI A;  1ZP0 B;  2LXA A;  4C4V B;  4A6Q A;  3T3N A;  1I4Q A;  3W1S A;  5EE0 A;  2INP E;  1S3S G;  3A9K B;  1V81 A;  3SU8 X;  2YVC A;  4B0E A;  4NY0 A;  1J7A A;  1V86 A;  2LVQ A;  1FCC C;  3P2B A;  1P7F A;  1WXM A;  1HXY D;  2IJ0 A;  1A70 A;  2WDT B;  4EZJ A;  3UF8 A;  2LHD A;  4YL8 A;  1VR9 A;  2CU3 A;  1NDD A;  1QIL A;  3MC0 B;  3ECI A;  3VUX A;  2JXT A;  2N7D A;  5KHQ A;  2ZPY A;  3DWG C;  2NTS A;  1KRH A;  1GC6 A;  1S1Q B;  3Q2A C;  1D4B A;  3DOW A;  1JWS D;  4AQ7 A;  4ASW C;  1PGA A;  1MFW A;  1E9M A;  2HJ1 A;  3I57 A;  3H7P B;  4QAY A;  3UIN B;  2PKO A;  2AL3 A;  1CK1 A;  2JT4 B;  1F2R C;  3DBL B;  4B95 A;  4IM3 A;  1TS3 A;  2ZCB A;  1YQ4 B;  3UI3 A;  1T6B X;  2KWC A;  4C80 A;  3EEC A;  4XDC A;  1TS4 A;  5D6J B;  2MBH A;  4N9F 4;  5I4D A;  2J0J A;  2JU6 X;  3FIL A;  4MGI E;  3U30 A;  1WGY A;  3AH7 A;  3QWZ B;  3ZKJ C;  4GLS C;  2FAZ A;  2J0K A;  2AEH A;  2JYE A;  2NTT A;  1UGJ A;  4HK2 A;  5FK9 C;  2V3N A;  4KZ0 A;  2V1Y A;  3JSV A;  2LI5 A;  2KDF B;  4NAW A;  1ZPS A;  2OJR A;  4K7S A;  1WZ3 A;  4ACF A;  4BOZ B;  2AX5 A;  3QK0 A;  2A4Z A;  2VH1 A;  3U4E G;  1T3Q A;  1WZ0 A;  1GJZ A;  2FE8 A;  4K7U A;  3WIM A;  3HVD A;  3APC A;  3IHP C;  4LLG M;  3PO0 A;  5D3I B;  3T3O A;  2A5U A;  5CHW A;  2DBY A;  3TEZ A;  2MBE A;  1WE7 A;  2DLB A;  4HWI B;  2W82 A;  3RNE C;  2DZJ A;  4F1S A;  4I6P A;  1WRI A;  1WRD B;  1GC7 A;  1V1O A;  1OFF A;  2C60 A;  3H9D A;  3SR6 A;  1RFA A;  3VH3 B;  3RYT A;  2BKR B;  3ONS A;  1V9J A;  3FIL B;  2M8S A;  1K51 A;  1FNW A;  2D07 B;  3ZLZ A;  1TYG B;  1VCB A;  3ZUN A;  2QMT A;  4E71 A;  3JSV B;  2L8J A;  3BYT B;  3W2D A;  4NAW B;  2K9X A;  3RUL A;  4KVG B;  2LGS A;  2KKC A;  2FUG 1;  2LUE A;  4MM3 A;  4BAX A;  3DVN V;  1E8W A;  2L83 A;  2KZR A;  3C0R B;  2KX0 A;  4IM2 A;  1WJN A;  4UDU C;  2AL6 A;  3NVY A;  3L13 A;  5AUI A;  1A5R A;  1FFU A;  2KWU B;  2LJ5 A;  3K9O B;  4B6W A;  1J7B A;  1YD8 U;  4FAD A;  4MJS A;  5IOI A;  2MP2 A;  1SIJ A;  1N60 A;  3TEX A;  3T8M A;  2BB5 A;  4EKU A;  1KLG D;  1YN3 A;  1Q1O A;  2HTH A;  4TUU A;  4KKI A;  1GUA B;  2WXN A;  2V0G A;  2L76 A;  2HJ8 A;  4RGT A;  1FRR A;  4PYU A;  1N5X A;  2L0T A;  4MGK E;  2AQ1 B;  4KX6 B;  1DOY A;  1TBE A;  2RDH A;  4FJV B;  1EU4 A;  1KF6 B;  1YMH E;  2BVC A;  4WJQ A;  1SE3 A;  2RGF A;  4K3C A;  4KIK A;  3AXC A;  2BW2 A;  3QA8 A;  5H92 C; 
#chains in the Genus database with same CATH homology
 1B1Z A;  5BMH A;  4MM3 B;  5H8Y E;  2IGG A;  3C8Y A;  2IGD A;  4OZB A;  4C7Z A;  1PDX A;  1E6E B;  1C4A A;  2MJD A;  4YTP B;  1JW9 D;  3HUI A;  1YN4 A;  2BS3 B;  1FEH A;  4P16 A;  1N62 A;  1SJH D;  2GI9 A;  1QT9 A;  3RFZ B;  5HI1 A;  1HA5 A;  3NVZ A;  2Q5W D;  5C3J B;  1RWS A;  2VZK B;  4RGN A;  1FNV A;  2BS2 B;  2YEP B;  1NEN B;  1C77 A;  4A90 A;  2LEK A;  1ET9 A;  1PUT A;  4TQ0 A;  1TY0 A;  3L4P A;  1K50 A;  1RM6 C;  1XLO A;  2M56 B;  1PGB A;  3P4S B;  2JX5 A;  1I4R A;  3IXS A;  1FRD A;  3LXF A;  3MFG A;  2KN4 A;  3AED B;  3VRA B;  4CQN A;  2D5G A;  5BYS A;  2W55 A;  2WS3 B;  3TSS A;  3BVZ A;  3SFE B;  3U2S C;  5BMG A;  2EKI A;  2KQ4 X;  2J53 A;  2M19 A;  3Q8B A;  4HJG E;  1ROE A;  2E3T A;  4A55 A;  1L4D B;  2SEB D;  2DWQ A;  1FFV A;  4N58 A;  4TSS A;  1E10 A;  1AW7 A;  2YEP F;  1V1P B;  1GOZ A;  1MPE A;  1SJE D;  3B9J A;  3CWI A;  4D2K A;  1UNS A;  1IBX B;  1MHH E;  1TKE A;  1DOX A;  1XLN A;  4FXC A;  2WXG A;  1YNT E;  1OQR A;  4OZC A;  1NYQ A;  1N63 A;  5GXG B;  4ZHO A;  2WXH A;  3VRB B;  4KGT A;  2ACZ B;  2G9H D;  1C4P A;  1QOG A;  2I2Y A;  1XEE A;  1SE4 A;  3V05 A;  4RGO S;  1C78 A;  5LNK 1;  2WLB A;  2PLP A;  1F2R I;  2KMM A;  4RF0 A;  1N5W A;  2DYO A;  1NI3 A;  4HEA 1;  1OQQ A;  1WGK A;  2BS4 B;  3AEB B;  1LO5 D;  1KH0 A;  1TZO A;  2PW9 A;  1JWU D;  5MPO A;  1BML C;  1TY2 A;  2M0A A;  1FM0 D;  4N59 A;  5E6J A;  1VDV A;  2TSS A;  1L6U A;  1MVK A;  4YTN B;  1M4V A;  1NYR A;  1I7H A;  4YXD B;  3URY A;  4YWG G;  2H89 B;  3SFD B;  1TS2 A;  3HRD D;  3AE9 B;  2LMC A;  3B2G A;  4AS1 A;  3R2I A;  5BYR A;  4EE2 A;  1FCL A;  3B2F A;  2V4I B;  3GS2 A;  4IKG A;  3AE5 B;  4ZOH C;  4JWU C;  2WXL A;  3NZ3 A;  1EU3 A;  2SAK A;  3IAS 1;  1QOA A;  1JWB D;  1PGX A;  1FIQ A;  2AQ3 B;  3AE2 B;  2WDV B;  4TMA B;  4N6E B;  1ESF A;  3E56 A;  2JSV X;  1TJE A;  1FMA D;  2WDQ B;  2QIE B;  3MP9 A;  3N9Y C;  1K53 A;  2AQ2 B;  1XXG A;  2N7J A;  4A8X C;  3I9V 1;  2N0S B;  4OW0 A;  1UWX A;  2BBC A;  2INN E;  1IGC A;  3Q69 A;  4XE0 A;  1E0Z A;  1QLB B;  2R61 A;  1GB1 A;  3EA6 A;  4ZYS A;  4REZ A;  2LUM A;  2KWD A;  3P63 A;  5HFY A;  2JWU A;  4HKQ A;  2WXF A;  3Q8C A;  4WUR A;  1EM7 A;  4WQM A;  2GRI A;  5JXV A;  1RFK A;  2E6X A;  4L2Y A;  1PYW D;  2WXK A;  2WQY B;  1I4X A;  3Q8A A;  1ACC A;  3IAM 1;  1WXQ A;  1BUI C;  2V3P A;  2HDE A;  2LJI A;  2MEK A;  1F0Z A;  4R3D A;  1JML A;  1SEB D;  1L0X B;  4O1N A;  4RH6 A;  3AN1 A;  5AUK A;  3NS1 A;  2DYM A;  3BK1 A;  2IGH A;  1NVI D;  1XCQ L;  2WXI A;  2JZP A;  2K3U A;  1JWA D;  4JPS A;  5EE1 A;  1XLQ A;  2K5P A;  4L23 A;  1VZ8 A;  1GPX A;  2PTL A;  1MHX A;  4J3O D;  4LTU A;  2GB1 A;  1AYF A;  1L6V A;  4IOI E;  4USA A;  2OED A;  1YJI A;  3AEE B;  4HRO A;  4LK0 M;  2J42 A;  1ZP0 B;  2PIA A;  4WWM A;  4YSZ B;  3FC4 A;  2X38 A;  2LGI A;  4A6Q A;  3T3N A;  1WWT A;  2WXO A;  2KDM A;  1I4Q A;  3W1S A;  5EE0 A;  1EWC A;  3KWL A;  5EE3 A;  4ZRQ A;  1C4C A;  2INP E;  1ZE3 D;  5BYQ A;  3P1M A;  4L1B A;  1FXA A;  1TKG A;  2IDY A;  4Q2J A;  4ARC A;  3AB5 A;  4B0E A;  1QOB A;  4RF1 A;  1J7A A;  2IPK D;  4XWT A;  1WSP A;  4RNA A;  2W54 A;  1MI0 A;  4ITK A;  1JRO A;  1FCC C;  1E7P B;  5G5G A;  1P7F A;  2CJO A;  1VRA B;  3KWV A;  1HXY D;  2IJ0 A;  1TS5 A;  1FD6 A;  1A70 A;  2WNM A;  1I4P A;  2BT6 A;  2LHD A;  1YN5 A;  1V97 A;  3CIR B;  3GB1 A;  2ZW1 A;  1VR9 A;  2CU3 A;  5C2T B;  1QIL A;  2Z8L A;  3MC0 B;  4KGR A;  4NZL B;  4MH8 A;  3AE1 B;  3HVZ A;  1C79 A;  2JXT A;  2WU5 B;  1JWM D;  4RCO A;  4YSY B;  3AEF B;  3J9C A;  3P4Q B;  1D5M C;  3MHZ A;  3BII D;  1CQV A;  4M0W A;  3DWG C;  2NTS A;  1KRH A;  4RGM A;  1D4B A;  1JWS D;  4AQ7 A;  3BYY B;  4US8 A;  1PGA A;  2B76 B;  3W5U B;  1QOF A;  4KKJ A;  1E9M A;  2BTE A;  5T8I A;  5HHD G;  3I57 A;  3AV8 A;  2PKO A;  1DYQ A;  1N61 A;  1CK1 A;  4C56 C;  1F2R C;  4C7Y A;  2N9L A;  1TS3 A;  2RPV A;  1DOI A;  2BB6 A;  3MJ5 A;  2KAJ A;  1YQ4 B;  1IGD A;  3UI3 A;  1T6B X;  3IT6 B;  1GB4 A;  2QJL A;  4C80 A;  4XDC A;  1TS4 A;  4NJC A;  4OVZ A;  3AE6 B;  3RPF C;  4XWW A;  3U7Z A;  2WXJ A;  3BK2 A;  2K22 A;  3P4P B;  3FIL A;  2JU6 X;  5I4D A;  4JX1 C;  3ZQ4 A;  2ZW0 A;  3NRZ A;  3AH7 A;  5EE9 A;  2VZK D;  4WH4 A;  1DGJ A;  1BXT A;  1CZP A;  1PFD A;  1VLB A;  2JYE A;  3BVG A;  4GLS C;  2EEL A;  2NTT A;  2RMM A;  3ABV B;  3AE8 B;  4XDD A;  1JCK B;  1UGJ A;  4KGS A;  1VJK A;  2NMQ A;  1IUE A;  3AE4 B;  5FK9 C;  2V3N A;  2PVO D;  1I4G A;  2WXR A;  1UWM A;  3Q8E A;  4YTM B;  1ZPS A;  1SE2 A;  4US9 A;  2AX5 A;  3BVM A;  2WXP A;  3U52 E;  4MT5 A;  2G1E A;  1L0Y B;  4ARI A;  4GDK B;  3U4E G;  2W3R A;  1J7C A;  1I4H A;  1T3Q A;  2N9K A;  2FE8 A;  4HRS A;  2CJN A;  2ON8 A;  1SF0 A;  4GDL B;  3HVD A;  1HEZ E;  3O13 A;  4WAF A;  4LLG M;  3PO0 A;  3ETR A;  2L52 A;  1R7S A;  5D3I B;  3T3O A;  3ZJV A;  4HKZ E;  2DBY A;  3TEW A;  3TEZ A;  3R8B A;  2DLB A;  4NAM A;  3BWU D;  2Y5P A;  2W82 A;  5G5H A;  5D7G A;  2XN9 C;  1WRI A;  3TUO A;  3EGR A;  1ET6 A;  1V1O A;  1SBB B;  3W9C B;  1OFF A;  1TKY A;  3ZYY X;  3VQI A;  3ZGZ A;  1Y56 A;  3EUB 2;  4ZHP A;  1JRP A;  2PMV A;  4DXG A;  4P6V F;  3SR6 A;  2RDG A;  1XCT L;  1B9R A;  2WP9 B;  1HZ6 A;  3AEA B;  3BZD B;  3LB8 C;  3SEB A;  4OZA A;  2K0P A;  3AEC B;  1EWY C;  3FIL B;  5BMI A;  1YJJ A;  3P42 A;  1HZ5 A;  1VZ7 A;  1K52 A;  1K51 A;  1CJE A;  3LYY A;  5D3D A;  1AN8 A;  4OHJ A;  1FNW A;  2WU2 B;  3VR9 B;  2J52 A;  4TQ1 A;  1KTK A;  4JWS C;  1RYJ A;  2QEJ C;  1TYG B;  1XO3 A;  1V8C A;  3OWE B;  2ICI A;  1ZUD 2;  3NVV A;  2QMT A;  1FXI A;  1SSN A;  3BYT B;  3NVW A;  3W2D A;  1ZOY B;  4NAW B;  2OHF A;  2WXQ A;  2H88 B;  1P7E A;  3IT4 B;  2K9X A;  4IDI A;  2MJ3 A;  2Y3A A;  2MH7 A;  3W5V B;  1L4Z B;  1ZDV A;  3AM9 A;  3KLS X;  2FUG 1;  2I38 A;  1KFY B;  1ZDX A;  1C76 A;  4B0M A;  4RFB A;  2MJE A;  4WIP A;  2KAC A;  1GAQ B;  2L83 A;  3PZ8 A;  1QF6 A;  4PT5 A;  3V3X A;  2HTM E;  1JAL A;  3Q8F A;  4UDU C;  3NVY A;  1XF5 L;  2PVG C;  5AUI A;  1FFU A;  1C9F A;  4ZRP A;  4DQO C;  2WXM A;  1FO4 A;  1J7B A;  2J4X A;  3KQ4 A;  2BYT A;  1HQR D;  1L5P A;  3TEY A;  2QIL A;  1NEK B;  1VZ6 A;  3AMZ A;  3P4R B;  1D6E C;  2WDR B;  1QQR A;  2LHE A;  1F77 A;  1SIJ A;  1D5Z C;  1ENF A;  1N60 A;  3TEX A;  3FAH A;  4DXF A;  2BB5 A;  4MAC A;  4YT0 B;  5HG2 A;  2W3S A;  1KLG D;  4JE3 B;  1YQ3 B;  1KLU D;  1YN3 A;  3DWM A;  4H2A A;  1UUP A;  1WYG A;  2ONQ A;  3E9S A;  5FR3 A;  2QSD A;  1QKZ A;  2WXN A;  4KKI A;  2FBW B;  3GP7 A;  3ZJU A;  2V0G A;  1STE A;  2LFI A;  4RGT A;  1FRR A;  1SXT A;  5FKA C;  3R2T A;  1AWD A;  3PZ7 A;  1XLP A;  1N5X A;  3NUH B;  1ZXH A;  3AE3 B;  4A9A A;  2L32 A;  5TSS A;  2AQ1 B;  1V1P A;  1JQ4 A;  4KX6 B;  1DOY A;  2XNA C;  1L0V B;  2RDH A;  1IBX A;  1FNU A;  4YSX B;  3ZJT A;  1EU4 A;  1KF6 B;  1YMH E;  1Q10 A;  2JQR B;  1SE3 A;  3WCQ A;  3AE7 B;  3H8H A;  2JYT A;  3AEG B;  3VR8 B;  1D5X C;  1T5X D;  2BW2 A;  1ZXI A;  2L1A A;  1SB3 C;  5H92 C;  2Y5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...