5H92C

Crystal structure of the complex between maize sulfite reductase and ferredoxin in the form-3 crystal
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite reductase [ferredoxin], chloroplastic
publication title Structural and mutational studies of an electron transfer complex of maize sulfite reductase and ferredoxin.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase/electron transport
total genus 20
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2015-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5h92C00
2WLBA 1GAQB 4WQMA 1CJEA 4N6EB 1E10A 4KX6B 1J7CA 1NEKB 4YSZB 3BIID 1DOYA 2CU3A 3AEGB 2WP9B 1XLOA 3HRDD 4JWSC 1KF6B 4YSYB 4YT0B 4HRSA 1XLNA 3AM9A 4ITKA 3AE3B 2BS2B 3AEAB 2WS3B 3CIRB 1FFVA 3SFEB 5C3JB 1GPXA 1J7AA 3P4RB 3AE6B 1YJJA 2B76B 2WQYB 4YTNB 4JWUC 3AEEB 3P63A 2QIEB 2WU2B 3FAHA 1T3QA 2BS4B 3B2GA 3AN1A 5EE9A 3W5UB 4C7ZA 2E3TA 2KAJA 1FMAD 1NENB 2WDRB 3AEBB 1TKGA 4LTUA 1QLBB 1L0VB 2K22A 2Q5WD 4P6VF 4ZOHC 1TKEA 5AUKA 3AECB 2BS3B 1WYGA 3ABVB 3SFDB 2PKOA 2W55A 1RFKA 1V97A 2Y5CA 3NRZA 1NVID 3NVZA 1JROA 1JW9D 1ZP0B 1VJKA 1PFDA 3NVVA 4HROA 1OFFA 3DWMA 3B9JA 4USAA 2W3SA 1JALA 1PUTA 1R7SA 1JWBD 1TYGB 3P1MA 3PO0A 3SR6A 1L6UA 3RPFC 2LEKA 1ZOYB 1E7PB 2MJEA 1N63A 2H88B 1EWYC 3LXFA 3B2FA 3L4PA 1SB3C 1N5XA 1L6VA 1VDVA 1N5WA 1E9MA 3AH7A 1AYFA 1TKYA 1ROEA 3DWGC 1JRPA 2MJ3A 2H89B 2L83A 1DOIA 1L5PA 4WWMA 3AE2B 3WCQA 4US8A 1XLPA 2WU5B 3AMZA 2ACZB 2MJDA 3AE9B 1KFYB 1DOXA 1A70A 2W54A 2PIAA 3HVZA 1RYJA 3AEDB 3P4SB 2L52A 4IDIA 3VR8B 3AB5A 1WWTA 2QJLA 5EE3A 2JQRB 5GXGB 2PVGC 4JX1C 4US9A 1SIJA 1ZXIA 1YQ4B 2K5PA 1V8CA 3P4PB 4A9AA 3HUIA 4YSXB 2FBWB 1CZPA 4ZHOA 1IUEA 1N60A 3AE7B 1RWSA 2N0SB 5G5GA 3W5VB 2G1EA 1FRRA 3NVYA 4N59A 1QT9A 3VRBB 1FFUA 1FM0D 2PVOD 1F0ZA 1N62A 5C2TB 1QOFA 3VR9B 2KMMA 2M19A 5EE0A 1I7HA 2BT6A 4N58A 5AUIA 1QOGA 3LB8C 3NS1A 4ZHPA 1FXIA 1J7BA 5H8YE 1SF0A 1WXQA 1ZUD2 2CJNA 1DGJA 3FC4A 1FIQA 3ZYYX 3VRAB 3W9CB 1KRHA 1QOAA 1XLQA 1E6EB 1JWAD 1YQ3B 2K9XA 2OHFA 3AE4B 1NYQA 4YTMB 4C80A 2MH7A 1PDXA 1QOBA 2DWQA 1RM6C 2M56B 1FXAA 1OQQA 5EE1A 1QF6A 1WRIA 4FXCA 1AWDA 2JX5A 2HTME 4C7YA 3ETRA 3EUB2 2CJOA 3AE5B 1OQRA 5G5HA 1TJEA 2W3RA 1E0ZA 1JQ4A 1VLBA 2WDQB 3KWLA 2WDVB 3AE8B 1UWMA 3AEFB 3CWIA 5MPOA 4YTPB 1YJIA 1XO3A 1N61A 1NI3A 3NVWA 1WGKA 2EKIA 1NYRA 3AV8A 1FO4A 1B9RA 2AX5A 5H92C 3P4QB 4YXDB 1FRDA 3AE1B 2DBYA
chains in the Genus database with same CATH superfamily
1WXAA 1BMLC 3DVGY 2N9EB 2EKEC 3RNBC 1JCKB 2TSSA 4HRSA 1H8CA 1PGXA 2Y3AA 4ASWC 4XX5A 5BYSA 2D3BA 3SEBA 2PEAA 2E3TA 2KAJA 3TEZA 2Q5WD 1UBQA 3GZNB 1C76A 4GLSC 4RF0A 3QK0A 4MDKE 2PJHA 3IT6B 2WYQA 4GIVA 2DAFA 1E5WA 2KLGA 2KWUB 3N32A 3NHEB 1YJ1A 5IKCM 1P0RA 4LK0M 1SE9A 2O2VA 1JWSD 4HCNB 3VFKA 4F8CB 3M3JA 2CR5A 2LXAA 4C56C 4ICUA 2J42A 3K9PB 4GB9A 3NG0A 5CHVC 4D2KA 1SGHA 2LZ6A 2FBWB 1ZDXA 3R7RA 1WX7A 1UH6A 3Q8FA 3S2AA 4FHJA 2A5UA 5C2TB 4MELA 2M19A 2KJHB 3VUWA 2BF8B 3UQBA 4I6PA 2SAKA 2C7NB 3R3MA 1I4GA 4MH8A 4MM3B 5I4DA 1FNUA 4MSQB 2Y5BB 1TTNA 4OVVA 4RCOA 3FILA 3RUIB 4B0MA 1VLBA 2ZW0A 1N61A 4UDUC 4JGHB 3RI7C 3JW0X 3UGBB 3P2BA 1FD6A 4HDQA 1KLUD 2DYBA 4DHJB 1P9DU 1XLOA 1ET9A 4GXBA 3IVFA 4JLCA 3M62B 2NMQA 3AE6B 2L0FA 2B76B 1T3QA 1HQRD 3W5VB 4ZOHC 2J52A 1WXMA 1EM7A 3ZDMC 2GOWA 3MHZA 2V4LA 2MA9B 4FHKA 4ZRQA 1PUTA 3PO0A 2GB1A 1L6UA 1E7PB 2MJEA 4KIKB 1VDVA 4A90A 3OJ4B 3TMPB 3PHXB 4KSLC 5J17A 1R4NI 1C1YB 2O6VB 1SEBD 2QCZA 3WA0A 5LNK1 3WANA 4K81A 4S17A 2DLBA 1RYJA 3AEDB 5IP4D 3AB5A 5D3DA 4KGRA 2JQRB 2R61A 4PYZA 3KH0A 3L08A 2MX2A 4K3BA 1N60A 4AOFA 4URKA 3NVYA 3M95A 3AXCA 4II3B 1V9JA 2M4NA 2B3AA 4A8XC 1J7BA 3I57A 5HI1A 2BQQA 5LLIA 4TSSA 2L1AA 4TMAB 4REZA 1YN4A 1QKZA 1E6EB 3TEYA 3SU8X 2Z59B 1PDXA 1C9FA 3PZDA 1OQQA 2AQ3B 3HK0A 1JRUA 5T8IA 1SBBB 2K6DB 3KLSX 2L76A 3PZ7A 1IP9A 4KGTA 1B9RA 2YVCA 3GE3C 1IGDA 4WAAA 3KUDB 5H92C 2OOBB 1GAQB 1J7CA 4KGSA 4FADA 1TY2A 4W9KA 1LGRA 5GMVA 1BUIC 3ZJUA 1KF6B 4DHJD 5DPTA 4YT0B 3RFZB 3ZDTA 1GPXA 2WQYB 4JWUC 2BS4B 3QWZB 3Q3NC 1XCTL 1QLBB 3D32A 3DHGC 3AECB 2Z0DB 4IWOA 2QDFA 3U52E 4MJSA 1PFDA 1RRBA 1JALA 4LNKA 2WXJA 3UIPB 3ZJVA 2LD9A 1SB3C 4AWJA 1UGJA 1WMHA 1D4BA 3VDZA 2WX0A 3H1UA 1FXTB 2MJ3A 5IA7A 2AYOB 3I9V1 2O6VD 3AMZA 3AE9B 1KFYB 3HHMA 4EFOA 1RFAA 3EC8A 3DVGX 2N7JA 2V3PA 4RGTA 3M63B 3U7ZA 2KLCA 2N9LA 1V8CA 2VH2A 1R4NB 4CO7A 3Q3OC 4TQ1A 3BYTB 4NJ6A 4QAYA 5HHDG 2KVRA 1FIQA 4KSKC 1QZEA 4J3OD 1KRHA 1JWAD 4H2AA 4WQOB 4WWNA 1ZE3D 1C4AA 4BFRA 1OQRA 2GBKA 1ZPSA 2LGYA 3CF6E 2MBOA 3NVWA 4WJQA 3DBRI 2LGIA 5DPWA 3AE1B 5IO9A 1CJEA 2KTRB 2DYMA 2D07B 2LI5A 2Z8LA 2MBQA 3BIID 4CHKA 2IPKD 3AEGB 5J2RA 1WX9A 2HD5B 2W9NA 2J53A 2BYVE 4FA6A 3EECA 4IM0A 3WAMA 3AEAB 2ZCCA 2G4DB 1YJJA 3T8MA 3AEEB 3VTVA 1TKEA 2M17A 1TY0A 1WYGA 2BBCA 3ZQ4A 1RFKA 5HFYA 3NVZA 3PHWB 4TKNA 1TGZB 2I1KA 4M01A 3DWMA 3E9SA 2M0XA 1WI0A 4G3XB 1JWBD 1TYGB 1VZ7A 4OW0A 3ENEA 4GDLA 2DYOA 3L4PA 3IAM1 2LVOA 4GU2A 4WURA 1WFYA 2AQ1B 3CSFA 1ROEA 3DWGC 1KH0A 1A5RA 2V1YA 1XLPA 2WXNA 1MHHE 2N9XA 4WJNA 1LXDA 2L52A 1WGYA 1IBXA 1WWTA 3CSTA 5EE3A 4K1RB 2K5PA 3Q8BA 4NAWA 1S3SG 2N0SB 4HCPB 3ZIMA 3C0RB 2L00B 1KOTA 4IUMB 1FFUA 2AWTA 3MTNB 2KFJA 2PPHA 5FR3A 1F1HA 4R3DA 4ARIA 3B08A 5AZGA 2GBRA 2MCNB 3PTFC 4IWPA 1QOAA 3ZTDA 3OLMD 3IXSA 2DWQA 4BKSD 1UELA 3BVGA 1OEYA 1WH3A 3NY5A 3ETRA 3AE5B 1WM3A 2INCC 5BYRA 1ET6A 2C60A 2WDTB 3ZKJC 1C79A 4RM8A 1V1OA 1YJIA 4HKZE 1NI3A 1P1AA 1E8WA 3R8BA 4K7SA 5BMIA 4ITKA 3FILB 4M0WB 2L05A 3ZW3A 1JWMD 2LGXA 3HIZA 2G9HD 4LLGM 5LXHA 1HTQA 3IHPC 2I38A 2XN9C 4KKIA 1D5ZC 3APCA 1OTRB 4YTNB 3DBRB 2WU2B 2KDFB 1NENB 4P6VF 5AUKA 5KHQA 5IOIA 3SFDB 2W82A 2KWVB 1SE3A 1OFFA 3GZNI 3GOEA 1V49A 2G45B 4FN2A 2JUOA 1K53A 1N63A 1WYWB 2DZIA 1L6VA 4XE0A 4HK2A 2XEWA 4P1BC 1TKYA 1L5PA 2C9WB 1AARA 2GI9A 2MJDA 2ZNVC 5BYQA 4EUTA 2JT4B 4IDIA 1WE6A 4AJWA 4GOCA 2L7RA 2QJLA 2MW5A 4JX1C 1KJTA 3SHQA 1HEZE 1RWSA 5G2NA 1P7FA 4EZJA 2BTEA 3NS1A 4S0RA 3NZ3A 4K7UA 5AZFA 1WXQA 1AN8A 3VRAB 3W9CB 1NYQA 2E6XA 4ZYNA 1XEEA 4J6IA 2NR2A 4M8MA 4XWTA 5G5HA 2CU1A 4JIOU 2NVUI 4KKJA 1JQ4A 4A6QA 4KDLB 2KOXA 1WGKA 1HE8A 4TV3A 2L0TA 2KDMA 3PRPB 2IO0B 2ZPNA 1E10A 3U4EG 4MACA 4XC2A 4HJKA 3QJZA 1WSPA 3P4RB 3SD5A 2LHDA 4RF1A 4B0EA 4ZRIA 2WHIA 2NTTA 1C4CA 1QQRA 2KXJA 2BWES 3AEBB 5E6PA 1K51A 2N9KA 1V1PB 1L2NA 4RGMA 2D11A 2N7EA 1FNWA 1XF5L 5AZHA 1TBEA 2KACA 1ZXHA 4EZLA 5AEKB 3BYYB 4GDKB 5J18A 3ZGZA 3GB1A 2OEDA 1L4DB 2WU5B 4HXDA 2ON8A 2BW2A 1WZ3A 1WMHB 3VR8B 4US9A 1S1QB 4HKQA 3FKYA 4WH4A 4Q2JA 3U8ZA 2LVQA 4N59A 4WJOA 4HLEA 2DENB 2LRUA 3ZNID 2FNJB 1GG3A 3IAS1 2HE7A 1ACCA 4EE2A 1OEYJ 1C4PA 2HTHA 4E74A 2OHFA 3Q3FA 1HTOA 1MG4A 2DNFA 1QF6A 3T3OA 5E6OA 3EUB2 3W1YA 3L0WB 3AE8B 2WX1A 3V61A 2JYTA 1LFDA 2GBJA 1MPEA 4JL9A 5IAAC 1NEKB 3MP9A 2INNE 2RDGA 3JSVB 5JHAA 2NPTA 4YSYB 1WGRA 2QILA 4A20A 5C3JB 1J7AA 1SIFA 1PGBA 3JVZX 4N9F4 3VXWA 4B95A 2WDRB 1L0VB 2N4FA 1ENFA 3BWUD 2M0AA 4PT5A 1NVID 5EDSA 1EU3A 5D7GA 4USAA 1V86A 4LNIA 2BWFA 2C7HA 3PSEB 3PS6A 1M94A 3KUCB 3I63C 2H88B 4NJ7A 1GNUA 3QCAA 1WJNA 4JQWC 3IG3A 2FCNA 2MSED 2LRWA 3DHIC 2LUMA 5HG2A 2KQ7A 4WWMA 2R2OA 5G55A 3RT3B 4LNNA 1UD7A 4HJGE 4FJVB 4W9HA 2J0KA 3I5JC 2PE6B 4BAXA 3W1SC 1N6ZA 1TZOA 1VCBA 2DAJA 3EFUA 1IBXB 5LXIB 3ONSA 4B9KA 3QC8B 4AJYB 1YMHE 3N1ZC 1E7VA 2RMMA 1ZUD2 3QA8A 4NAWB 2MQJA 1TS5A 3J9CA 1MG8A 3ML8A 1WY8A 4MEMA 1B1ZA 1WJ6A 2LHEA 3APDA 2CHWA 3NOBA 1FXAA 3ZXVA 2MEKA 4OVUA 2CJOA 4LCDE 1TJEA 3QHTA 2REXA 4W9LA 4WWOA 3AV8A 2JY6A 3B2GA 1Y56A 4AUQC 1DOYA 2KDEB 1UWXA 4XDDA 4G0NB 1P3QU 4ANXA 1SE2A 3PRZA 2BYEA 3I3TB 2IGGA 1STEA 3A9JA 4BKGA 3BVZA 4RGNA 4KV2A 3W2DA 2BYFA 1UF0A 3LDZE 3LJ3A 4ZHOA 2NBUA 4FBJB 2XK5B 3TJPA 2IO1B 3PLUA 2BB5A 1WE7A 1C78A 1YQBA 1M4VA 3L13A 4M8NA 2KYWA 2N7DA 1E90A 4K3CA 2L8JA 3AE2B 1WIAA 2IJ0A 1VR9A 1GC6A 3P4SB 4DXAB 4WWPA 4B6WA 4YSXB 1MVKA 4OZCA 2KN4A 2LGSA 3IFWB 3TCAA 2WXGA 1QOGA 3DVNV 3Q8AA 3A9KB 4XGAB 5KHOA 3ZYYX 1J8CA 2R2QA 1WXSA 4W9JA 3TL5A 1YX6B 5DPRA 3V6EB 3PV1A 4P1CC 2BKFA 1J0GA 1V5OA 2ZJDA 4FULA 3ZO5B 2K0PA 3DHHC 1E0ZA 4DWFA 2VRRB 1LO5D 2D3CA 3DBHI 3ZNZB 4W9GA 2YEPF 4ZRJA 1WXVA 1K50A 3RD2A 1JWUD 3KUZA 4RMAA 4OVZA 1I4PA 3BZDB 3L10B 3U2SC 1ZW7A 2FE8A 2KQSA 3VTUA 2LJ5A 3AE3B 1XD3B 1T0RC 1X1MA 3FAHA 1R4MI 1QILA 3P42A 1YIWA 1TS4A 1FMAD 1PYWD 4IWQA 1Q1OA 3OAWA 3PVLA 2Y5CA 1KLVA 2CKHB 5TR5A 4HROA 2JZPA 3OG5A 5E6NA 2KDBA 2LEKA 2J0MA 4MH0E 4MM3A 2IGDA 1PGAA 1E9MA 1UUPA 3EA6A 2KC1A 2LJIA 4ZYSA 3EFCA 2QC8A 2ACZB 2PMVA 3MC8A 3RN9C 4NJCA 2HDEA 1GB1A 3HVZA 2PW9A 3HVDA 5JZEB 3WAOA 1V2YA 1VRAB 4A9AA 5C23A 3AE7B 3NS8A 4IM3A 1WM2A 2CHXA 3VRBB 2MHJA 3N30A 4W9DA 2KQ4X 4W9EA 3VR9B 4IM2A 2K8BA 4OHJA 2X8XX 2CS4A 3C19A 2OJRA 1TZ1A 1F77A 3QAQA 3Q2AC 4IC7B 2D2QA 3AE4B 4IG7B 4YTMB 1RAXA 2O2VB 3N20C 3Q8EA 2M8SA 1KM7A 1WRIA 4C7YA 3V62A 5IN7A 2MP2A 2K25A 2K3UA 3AEFB 2KNBA 4NAMA 2IO3B 3O65B 3TSSA 4KIKA 2PLPA 1Q5WB 2FCQA 3ML9A 3DPDA 2V4IB 2ZVOA 3KYDD 1WJ4A 3T9LA 4C4VA 2BPSA 2FIFA 1RLFA 1TIFA 1XT9B 3DBHB 4C7ZA 3N3KB 1TKGA 1FNVA 3ZVVA 1L0YB 1Q0WB 1LQBA 2N1WA 3NVVA 4RH6A 2D3AA 2ASQA 2RPQA 1MI0A 2FUG1 1MHXA 1TS2A 3RPFC 2BYTA 3DBLI 4BKTA 4BOSC 2G4SA 1R4MB 2WXLA 3AH7A 1D5XC 4GGQA 1I4RA 2H89B 1OGWA 2KMAA 4RFBA 2K1FA 3VAWA 1DOXA 1L4ZB 3W1SA 4PS7A 4WIPA 5GXGB 3ZRCA 4I6NB 1IUEA 2WXKA 4A3OA 5FR6A 2V9HA 4EEWA 4F7ZA 2D3GA 2QMTA 5AUIA 1MFWA 3PRMB 1HXYD 3N1XC 1LM8B 1VZ6A 1NI2A 4MGIE 3QQ8B 4NZLB 3GE8C 1SXTA 4C00A 4FXCA 2JX5A 4LJOB 1E8XA 2NS5A 1HZ6A 2WDQB 2A4ZA 4W9CA 1XO3A 1FO4A 1NDDA 1YNTE 1F2RI 2INPE 3DOWA 1WZ0A 3Q8CA 4NNJB 4I6LB 4DXGA 2Y5PA 2KKCA 2IY0B 4BZAA 3UQAA 3NZSA 2VZKD 1Z2MA 1ESFA 3NZUA 1NBFC 4F1SA 1V6EA 5JHBA 2LWPA 1VD2A 2WXPA 2D10A 3X23A 2WXRA 2GBNA 1JW9D 1D3ZA 3RZFA 2M1MA 2V0GA 2GBMA 1ZOYB 2LXCA 3LXFA 3B2FA 1N5XA 3WAPA 1N5WA 3A4RA 3TBLD 2GMIC 1V5TA 4II2B 1P7EA 4HWIB 4US8A 1WR6E 4LNOA 1A70A 2W54A 2ZNVB 3MFGA 4E71A 3H7PA 1I4HA 3TUOA 3B1LX 3C8YA 3ZUNA 3DBLB 2J7QB 3HM6X 2I2YA 3L17A 4DHZE 1N62A 4MJSB 2KMMA 2JXXA 4DXFA 1DGJA 3QARA 3FC4A 1D6EC 3RNAC 3NUHB 3GS2A 3AULA 3MJ5A 3VH4B 2L3ZA 3URYA 1JMLA 5EE1A 1BXTA 2YLMA 4KVGB 5D94A 5JXVA 2IBIB 4MGZE 3B0AA 3DBSA 1FCLA 2IZVB 2JRIB 2W3RA 4NPNA 1UWMA 5D6JB 3BVMA 2GRIA 2EKIA 1NYRA 4XWWA 1F9JA 3ZTCA 1GB4A 1E8YA 3ZLZA 3OJ3A 2KWCA 1FEHA 4G50A 2LVPA 3ZXRA 2JWZA 5D3IB 3QX1A 1XLNA 3AM9A 1P98A 1HZ5A 2NBVB 1DYQA 1FFVA 3AI5A 3R2IA 2DX5B 1SSNA 2IYDB 3Q6BA 2RPVA 4DK5A 4LTUA 4M02A 4RNAA 2K22A 4ZDVA 3PGEA 2BS3B 3RNGC 2J4XA 4WAFA 3NRZA 2WXQA 3CMMB 2W3SA 4HEA1 5D2MB 3A1QA 1C3TA 2X38A 2KZRA 3IBEA 5HKHA 2ZVNA 2AL3A 2HJ1A 4BOZB 2IGHA 1DOIA 4ANUA 1TT5B 2NBWB 3RCZA 3H8HA 2GLSA 5CX3A 2KD0A 4K7WA 1EO6A 4A3PA 1UBIA 1PQSA 2D5GA 2RDHA 1YQ4B 3HUIA 1E7UA 4TUUA 4M0WA 2JVCA 4TQ0A 4N58A 3APFA 2UWQA 3LB8C 4GDLB 2KANA 2KHWB 2BB6A 5FK9C 1WF9A 1XLQA 4IW0A 3ZNGC 2RD0A 4C80A 4LDTB 2NTSA 4OZBA 1V81A 1UNSA 1L0XB 4CQNA 1YOVB 2RGFA 2G3QB 1YX5B 2L32A 2MBHA 2C7MB 4P16A 1MJDA 3CWIA 3GP7A 2V3SA 3QIJA 4GMVA 2PTLA 2WLBA 2BVCA 3VUXA 2MP2B 2QSDA 2QEJC 2V3NA 1OQYA 2WXIA 2BS2B 3DDCB 5L95C 2BKRB 2UYZB 2FIDA 2LASA 2KO3A 3ZNHB 3HM3A 1EF1A 2LMCA 4C4VB 3PT2B 2W55A 3IT4B 2ZEQA 3Q69A 1ZP0B 2ZW1A 4ANVA 3U30A 2WWZA 1R7SA 3P1MA 2WXMA 3BK1A 2KC2A 3WALA 3BK2A 2JF5A 2MBBB 3ZRFA 4LNFA 4PS8A 3N1YC 3V6CB 3V05A 3Q3JA 4GN1A 4L2YA 2IDYA 4L23A 4BBNC 3JYUA 4XZ4A 3RULA 1YN5A 2DZMA 3RNEC 3T3NA 3SDLC 1CZPA 2G1EA 3KWVA 1QT9A 3O13A 1F0ZA 2WXFA 3EGRA 2KJRA 1K52A 2WNMA 3PZ8A 2KMCA 3L16A 3ALBA 1SF0A 1K8RB 3VVWB 1WR1A 2KWDA 2FAZA 3RNCC 4ZRKA 2K9XA 2MH7A 3R2TA 1QOBA 1EU4A 1UGMA 1D5MC 4WJPA 3R66C 1I42A 4LDTD 1V1PA 2MBEA 2HTME 4BBNF 2KFKA 2XBBC 4EOYA 1Z5SB 4YTPB 2CHZA 3DVNU 4YXDB 1FRDA 4GDKA 1L7YA 4WQMA 2K39A 4L1BA 4KX6B 2N1VA 2KVZA 2AEHA 2EMTA 3HRDD 2ZZPB 1SE4A 3A33B 2KK8A 4X57B 3VTWA 1U4AA 3SFEB 4HPLB 2MRPA 4PS3A 2JYEA 3AN1A 4PYUA 2KJ6A 2WGSA 4YL8A 2MLBA 3ABVB 3BY4B 4ARCA 1EWCA 3B9JA 3WIMA 1GOZA 3Q14C 1IYFA 2KDIA 4KZCA 3KYCD 1AYFA 4E3CA 3N9YC 1T0YA 5DPSA 1FPYA 2QHOA 1EF5A 2ZPYA 2J0JA 1FCCC 4M00A 3AU4A 4ANWA 4AP4C 1SIJA 3VH3B 2XNAC 2RSUA 3RNFC 4NQLB 3ECIA 2YEPB 4AS1A 2C5LC 1QOFA 4ZHPA 3H7PB 1T5XD 3JSVA 1HA5A 4O1NA 3UINB 5CTRC 1ZDVA 3V60A 1WX8A 1WJUA 4XYCA 1YD8U 1CK1A 3V3XA 4P7IA 3AU5A 4HDOA 4FJYA 3MJWA 4JPSA 4YWGG 5E6JA 2WDVB 4N6EB 3OWEB 4YSZB 1ISNA 2DZJA 1XCQL 2CU3A 3K9OB 4JWSC 5FKAC 4MGKE 3BINA 4KZ0A 2WS3B 3CIRB 3TEWA 3VUYA 1ZGUB 3P63A 4RM9A 2DZKA 3W5UB 2EELA 2FCSA 2K8HA 2IY1B 2JPHA 2KT7A 3H6NA 1VJKA 1T0SC 2WXOA 3VQIA 3SR6A 2O6VA 3U7DA 2LGDA 1WGHA 4MT5A 3PREA 4DDGD 2HJ8A 5DCNA 5JH5C 4RGOS 2VZKB 2JSVX 2RDBC 1TS3A 1JRPA 1XQQA 3KVFB 3A1QB 1UZXB 4DBGA 1WRDB 2NPTB 1CMXB 2JWUA 2PIAA 2AQ2B 3DCGA 4GSWA 5CHWA 5L83A 4MSMB 3P4PB 4IKGA 1C77A 3LYYA 2RR9A 2ZCBA 1FM0D 4EKUA 4DQOC 3E56A 2BT6A 1I4QA 2CJNA 1KTKA 3VHTC 2JZ3B 1KLGD 2DHZA 4XDCA 1YQ3B 1E8ZA 2WXHA 4ZRPA 1RM6C 2M56B 4ACFA 4ICVA 1GC7A 4JE3B 1T0QC 4OZAA 4W9FA 3KWLA 1I4XA 2IO2B 2PE9A 2XK5A 2KN5A 3UI3A 3KQ4A 2AX5A 2FCMA 3P4QB 1CQVA 4FJZA 4FLHA 1Q10A 2LFIA 1VZ8A 3MC0B 3RYTA 5BO4B 3H9DA 3EHVA 2Z0EB 4NY0A 2WP9B 4G11A 3MHSD 4HVBA 4MGYE 2KTFA 4HPMB 3UIOB 1XXGA 4KDIC 2QIEB 1I35A 5EE9A 3MC9A 1GUAB 3PLVA 4DDID 3TIXA 2PKOA 3X0WA 4BVUC 4NQKE 1V97A 3DQVA 1JROA 2OJWA 2N9PC 1GJZA 3KW5B 1WGDA 2I1JA 4EZKA 1IPGA 2KX3A 3A9KA 1EUVB 1T6BX 4PK1A 1EWYC 2JXTA 1ZKHA 5C1ZA 1H4RA 3L54A 2L83A 3WCQA 3NJTA 2FUHB 4CYEA 2UU7A 3H7SA 4LJPB 2JZZA 2PVGC 2SEBD 5TSSA 1ZXIA 3A9JB 5MPOA 1YN3A 5G5GA 1FRRA 1AW7A 5BMHA 5BMGA 4W9IA 2ICIA 3A4SC 2PVOD 2LUEA 4BKSA 1WGGA 2JRHA 1Y8RC 5EE0A 1I7HA 1FXIA 3TEXA 1BT0A 2JU6X 5H8YE 2VH1A 4A55A 2KX0A 4DHZB 1F52A 2K6QA 2INDC 4AQ7A 3PPAA 1SJHD 2K8CA 1AWDA 4IOIE 1J19A 4HPPA 2NCNA 3RMKC 3ZJTA 1V80A 2KTRA 2BGFA 3R7QA 1F2RC 2ONQA 3UF8A 1SJED 3RZWC 2AL6A 1G6JA 2EMSA 3Q3MC 2MWSB 1IGCA 5CHFA 2KFKB 2DBYA
chains in the Genus database with same CATH topology
3FILB 1BMLC 2WLBA 1K50A 1JWMD 1JWUD 2G9HD 4LLGM 4OVZA 1I4PA 1JCKB 2QSDA 3BZDB 2QEJC 2TSSA 3U2SC 2V3NA 2I38A 2FE8A 2XN9C 2WXIA 4HRSA 3AE3B 2BS2B 1PGXA 2Y3AA 4KKIA 1D5ZC 4YTNB 5BYSA 3FAHA 2WU2B 3SEBA 1QILA 3P42A 2E3TA 2KAJA 1TS4A 1FMAD 1NENB 4P6VF 3TEZA 2LMCA 1PYWD 2Q5WD 5AUKA 3SFDB 1C76A 2W55A 3IT4B 2W82A 4GLSC 3Q69A 4RF0A 2Y5CA 1SE3A 1ZP0B 2ZW1A 4HROA 1OFFA 2JZPA 1R7SA 3P1MA 2WXMA 3IT6B 3BK1A 2LEKA 1K53A 1N63A 3BK2A 1L6VA 4XE0A 2IGDA 1PGAA 1E9MA 1UUPA 4LK0M 1TKYA 1JWSD 3EA6A 3V05A 2LJIA 4ZYSA 1L5PA 4L2YA 2IDYA 4L23A 2GI9A 2ACZB 2MJDA 2PMVA 4C56C 4NJCA 2HDEA 1GB1A 2J42A 1YN5A 3HVZA 2PW9A 3HVDA 4IDIA 5BYQA 3T3NA 2QJLA 4JX1C 4D2KA 1VRAB 4A9AA 2FBWB 1CZPA 1ZDXA 1HEZE 3AE7B 1RWSA 2G1EA 3KWVA 1QT9A 1P7FA 3O13A 3Q8FA 3VRBB 1F0ZA 2BTEA 2WXFA 3EGRA 2KQ4X 1K52A 2WNMA 5C2TB 3PZ8A 3VR9B 2M19A 3NS1A 3NZ3A 4OHJA 1SF0A 1WXQA 2SAKA 1AN8A 1I4GA 2KWDA 3VRAB 1F77A 4MH8A 4MM3B 3W9CB 5I4DA 1FNUA 2K9XA 3AE4B 1NYQA 2E6XA 4YTMB 2MH7A 1XEEA 1QOBA 3R2TA 1EU4A 1D5MC 3Q8EA 1V1PA 1WRIA 2HTME 4C7YA 4RCOA 4XWTA 3FILA 5G5HA 4KKJA 4B0MA 1JQ4A 1VLBA 2K3UA 3AEFB 4A6QA 2ZW0A 4YTPB 4NAMA 1N61A 1WGKA 4UDUC 2KDMA 3TSSA 4YXDB 1FRDA 2PLPA 4WQMA 4L1BA 1E10A 4KX6B 1FD6A 1KLUD 3U4EG 4MACA 2V4IB 1XLOA 3HRDD 1ET9A 1SE4A 1WSPA 3SFEB 2NMQA 3AE6B 3P4RB 2B76B 2LHDA 4RF1A 4B0EA 2JYEA 1T3QA 3AN1A 4C7ZA 2NTTA 1C4CA 1HQRD 1QQRA 3W5VB 3AEBB 1TKGA 1FNVA 1K51A 2N9KA 4ZOHC 1V1PB 2J52A 1EM7A 4RGMA 3ABVB 1L0YB 3MHZA 1FNWA 1XF5L 3NVVA 4RH6A 4ZRQA 4ARCA 1EWCA 3B9JA 1PUTA 1GOZA 3PO0A 1MI0A 2GB1A 2KACA 1L6UA 1MHXA 1TS2A 1ZXHA 2FUG1 3RPFC 1E7PB 2MJEA 2PTLA 3BYYB 1VDVA 4GDKB 2BYTA 4A90A 2WXLA 3AH7A 1AYFA 1D5XC 3GB1A 3ZGZA 3N9YC 1I4RA 2H89B 4RFBA 1SEBD 2OEDA 1L4DB 2WU5B 2ON8A 5LNK1 1DOXA 2BW2A 1L4ZB 1FCCC 2DLBA 3W1SA 1RYJA 3AEDB 3VR8B 3AB5A 4WIPA 5D3DA 4KGRA 2JQRB 5GXGB 4US9A 2R61A 1SIJA 2XNAC 4HKQA 1IUEA 1N60A 2WXKA 4WH4A 4Q2JA 3NVYA 4N59A 2YEPB 2QMTA 4AS1A 1QOFA 5AUIA 3IAS1 4ZHPA 1HXYD 1T5XD 4A8XC 1ACCA 1J7BA 1HA5A 4EE2A 3I57A 1C4PA 4O1NA 5HI1A 1ZDVA 4TSSA 1VZ6A 2L1AA 4TMAB 4REZA 1YN4A 1QKZA 1E6EB 3TEYA 2OHFA 4NZLB 1PDXA 1C9FA 1SXTA 1OQQA 1CK1A 2AQ3B 1QF6A 3V3XA 4FXCA 3T3OA 2JX5A 5T8IA 1SBBB 3EUB2 3KLSX 1HZ6A 3PZ7A 2WDQB 3AE8B 4KGTA 1XO3A 2JYTA 1FO4A 1B9RA 1IGDA 5H92C 4JPSA 1YNTE 4YWGG 5E6JA 1MPEA 2WDVB 1GAQB 1F2RI 4N6EB 1J7CA 4KGSA 1NEKB 2INPE 3Q8CA 3OWEB 1TY2A 4YSZB 3MP9A 2INNE 1BUIC 1XCQL 2RDGA 2CU3A 3ZJUA 4DXGA 2Y5PA 4JWSC 5FKAC 1KF6B 3RFZB 4YSYB 4YT0B 2QILA 2WS3B 3CIRB 3TEWA 5C3JB 1GPXA 1J7AA 2WQYB 4JWUC 2VZKD 3P63A 1PGBA 2BS4B 3W5UB 2EELA 1ESFA 1XCTL 2WDRB 1QLBB 1L0VB 1ENFA 3AECB 2WXPA 3BWUD 2M0AA 4PT5A 3U52E 2WXRA 1NVID 1JW9D 1EU3A 1VJKA 1PFDA 5D7GA 4USAA 1JALA 2WXOA 3VQIA 3SR6A 2V0GA 2WXJA 1ZOYB 3ZJVA 3LXFA 2H88B 4MT5A 3B2FA 1SB3C 1N5XA 1N5WA 1UGJA 1D4BA 4RGOS 2VZKB 2JSVX 1TS3A 1JRPA 2MJ3A 2LUMA 5HG2A 4WWMA 1P7EA 4US8A 3I9V1 3AMZA 3AE9B 1KFYB 1A70A 2JWUA 2W54A 4HJGE 2PIAA 2AQ2B 2N7JA 2V3PA 4RGTA 3MFGA 3U7ZA 1I4HA 2N9LA 3P4PB 1V8CA 4IKGA 1C77A 3TUOA 3LYYA 3C8YA 1TZOA 2I2YA 1FM0D 1IBXB 1N62A 4DQOC 3E56A 2KMMA 2BT6A 1YMHE 4TQ1A 1I4QA 3BYTB 2RMMA 2CJNA 1ZUD2 1KTKA 4DXFA 1DGJA 4NAWB 5HHDG 1KLGD 1FIQA 1TS5A 3FC4A 3J9CA 1D6EC 4J3OD 3NUHB 1B1ZA 1KRHA 3GS2A 4XDCA 1YQ3B 1JWAD 4H2AA 2WXHA 3MJ5A 1ZE3D 2LHEA 1C4AA 4ZRPA 3URYA 1RM6C 2M56B 1JMLA 1FXAA 5EE1A 1BXTA 5JXVA 2MEKA 4JE3B 2CJOA 1FCLA 1OQRA 1TJEA 1ZPSA 2W3RA 4OZAA 3KWLA 1I4XA 3UI3A 1UWMA 3KQ4A 3NVWA 3BVMA 2GRIA 2EKIA 1NYRA 3AV8A 4XWWA 2AX5A 2LGIA 3P4QB 1CQVA 3AE1B 3B2GA 1Y56A 1GB4A 1CJEA 1Q10A 2LFIA 1VZ8A 3MC0B 2DYMA 2Z8LA 1FEHA 3BIID 1DOYA 1UWXA 2IPKD 3AEGB 4XDDA 2WP9B 5D3IB 2J53A 1XLNA 3AM9A 4ITKA 1HZ5A 1SE2A 3AEAB 1DYQA 1FFVA 3R2IA 1YJJA 2IGGA 3AEEB 1STEA 1SSNA 1XXGA 2QIEB 5EE9A 2RPVA 4LTUA 4RNAA 2K22A 3BVZA 4RGNA 3W2DA 1TKEA 1TY0A 2BS3B 1WYGA 2BBCA 2J4XA 2PKOA 4WAFA 3ZQ4A 1RFKA 5HFYA 1V97A 3NRZA 3NVZA 4ZHOA 1JROA 2WXQA 3DWMA 3E9SA 2W3SA 4HEA1 1JWBD 1TYGB 2X38A 1VZ7A 4OW0A 2BB5A 1C78A 1T6BX 2DYOA 3L4PA 1EWYC 1M4VA 2JXTA 3IAM1 4WURA 2AQ1B 1ROEA 3DWGC 1KH0A 2IGHA 2L83A 1DOIA 3AE2B 3WCQA 2IJ0A 1XLPA 2WXNA 1MHHE 1VR9A 3P4SB 2L52A 3H8HA 1IBXA 1WWTA 5EE3A 2D5GA 2PVGC 2RDHA 2SEBD 1ZXIA 5TSSA 1YQ4B 2K5PA 3Q8BA 3HUIA 1MVKA 4YSXB 5MPOA 2N0SB 1YN3A 4M0WA 5G5GA 1FRRA 1AW7A 4OZCA 5BMHA 5BMGA 1FFUA 2ICIA 2KN4A 5FR3A 2PVOD 4TQ0A 2WXGA 5EE0A 1I7HA 4N58A 1QOGA 3LB8C 4R3DA 1FXIA 3TEXA 2JU6X 4ARIA 5H8YE 3Q8AA 3ZYYX 4GDLB 4A55A 2BB6A 5FK9C 1QOAA 1XLQA 4C80A 3IXSA 2DWQA 4AQ7A 2NTSA 1SJHD 4OZBA 3BVGA 1UNSA 1AWDA 4IOIE 1L0XB 3ETRA 2K0PA 3AE5B 4CQNA 3ZJTA 5BYRA 1ET6A 2L32A 1E0ZA 1C79A 4P16A 1F2RC 1V1OA 2ONQA 1SJED 3CWIA 1YJIA 1LO5D 3GP7A 1NI3A 4HKZE 1IGCA 3R8BA 2YEPF 5BMIA 2DBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLB A;  1GAQ B;  4WQM A;  1CJE A;  4N6E B;  1E10 A;  4KX6 B;  1J7C A;  1NEK B;  4YSZ B;  3BII D;  1DOY A;  2CU3 A;  3AEG B;  2WP9 B;  1XLO A;  3HRD D;  4JWS C;  1KF6 B;  4YSY B;  4YT0 B;  4HRS A;  1XLN A;  3AM9 A;  4ITK A;  3AE3 B;  2BS2 B;  3AEA B;  2WS3 B;  3CIR B;  1FFV A;  3SFE B;  5C3J B;  1GPX A;  1J7A A;  3P4R B;  3AE6 B;  1YJJ A;  2B76 B;  2WQY B;  4YTN B;  4JWU C;  3AEE B;  3P63 A;  2QIE B;  2WU2 B;  3FAH A;  1T3Q A;  2BS4 B;  3B2G A;  3AN1 A;  5EE9 A;  3W5U B;  4C7Z A;  2E3T A;  2KAJ A;  1FMA D;  1NEN B;  2WDR B;  3AEB B;  1TKG A;  4LTU A;  1QLB B;  1L0V B;  2K22 A;  2Q5W D;  4P6V F;  4ZOH C;  1TKE A;  5AUK A;  3AEC B;  2BS3 B;  1WYG A;  3ABV B;  3SFD B;  2PKO A;  2W55 A;  1RFK A;  1V97 A;  2Y5C A;  3NRZ A;  1NVI D;  3NVZ A;  1JRO A;  1JW9 D;  1ZP0 B;  1VJK A;  1PFD A;  3NVV A;  4HRO A;  1OFF A;  3DWM A;  3B9J A;  4USA A;  2W3S A;  1JAL A;  1PUT A;  1R7S A;  1JWB D;  1TYG B;  3P1M A;  3PO0 A;  3SR6 A;  1L6U A;  3RPF C;  2LEK A;  1ZOY B;  1E7P B;  2MJE A;  1N63 A;  2H88 B;  1EWY C;  3LXF A;  3B2F A;  3L4P A;  1SB3 C;  1N5X A;  1L6V A;  1VDV A;  1N5W A;  1E9M A;  3AH7 A;  1AYF A;  1TKY A;  1ROE A;  3DWG C;  1JRP A;  2MJ3 A;  2H89 B;  2L83 A;  1DOI A;  1L5P A;  4WWM A;  3AE2 B;  3WCQ A;  4US8 A;  1XLP A;  2WU5 B;  3AMZ A;  2ACZ B;  2MJD A;  3AE9 B;  1KFY B;  1DOX A;  1A70 A;  2W54 A;  2PIA A;  3HVZ A;  1RYJ A;  3AED B;  3P4S B;  2L52 A;  4IDI A;  3VR8 B;  3AB5 A;  1WWT A;  2QJL A;  5EE3 A;  2JQR B;  5GXG B;  2PVG C;  4JX1 C;  4US9 A;  1SIJ A;  1ZXI A;  1YQ4 B;  2K5P A;  1V8C A;  3P4P B;  4A9A A;  3HUI A;  4YSX B;  2FBW B;  1CZP A;  4ZHO A;  1IUE A;  1N60 A;  3AE7 B;  1RWS A;  2N0S B;  5G5G A;  3W5V B;  2G1E A;  1FRR A;  3NVY A;  4N59 A;  1QT9 A;  3VRB B;  1FFU A;  1FM0 D;  2PVO D;  1F0Z A;  1N62 A;  5C2T B;  1QOF A;  3VR9 B;  2KMM A;  2M19 A;  5EE0 A;  1I7H A;  2BT6 A;  4N58 A;  5AUI A;  1QOG A;  3LB8 C;  3NS1 A;  4ZHP A;  1FXI A;  1J7B A;  5H8Y E;  1SF0 A;  1WXQ A;  1ZUD 2;  2CJN A;  1DGJ A;  3FC4 A;  1FIQ A;  3ZYY X;  3VRA B;  3W9C B;  1KRH A;  1QOA A;  1XLQ A;  1E6E B;  1JWA D;  1YQ3 B;  2K9X A;  2OHF A;  3AE4 B;  1NYQ A;  4YTM B;  4C80 A;  2MH7 A;  1PDX A;  1QOB A;  2DWQ A;  1RM6 C;  2M56 B;  1FXA A;  1OQQ A;  5EE1 A;  1QF6 A;  1WRI A;  4FXC A;  1AWD A;  2JX5 A;  2HTM E;  4C7Y A;  3ETR A;  3EUB 2;  2CJO A;  3AE5 B;  1OQR A;  5G5H A;  1TJE A;  2W3R A;  1E0Z A;  1JQ4 A;  1VLB A;  2WDQ B;  3KWL A;  2WDV B;  3AE8 B;  1UWM A;  3AEF B;  3CWI A;  5MPO A;  4YTP B;  1YJI A;  1XO3 A;  1N61 A;  1NI3 A;  3NVW A;  1WGK A;  2EKI A;  1NYR A;  3AV8 A;  1FO4 A;  1B9R A;  2AX5 A;  5H92 C;  3P4Q B;  4YXD B;  1FRD A;  3AE1 B;  2DBY A; 
#chains in the Genus database with same CATH topology
 1WXA A;  1BML C;  3DVG Y;  2N9E B;  2EKE C;  3RNB C;  1JCK B;  2TSS A;  4HRS A;  1H8C A;  1PGX A;  2Y3A A;  4ASW C;  4XX5 A;  5BYS A;  2D3B A;  3SEB A;  2PEA A;  2E3T A;  2KAJ A;  3TEZ A;  2Q5W D;  1UBQ A;  3GZN B;  1C76 A;  4GLS C;  4RF0 A;  3QK0 A;  4MDK E;  2PJH A;  3IT6 B;  2WYQ A;  4GIV A;  2DAF A;  1E5W A;  2KLG A;  2KWU B;  3N32 A;  3NHE B;  1YJ1 A;  5IKC M;  1P0R A;  4LK0 M;  1SE9 A;  2O2V A;  1JWS D;  4HCN B;  3VFK A;  4F8C B;  3M3J A;  2CR5 A;  2LXA A;  4C56 C;  4ICU A;  2J42 A;  3K9P B;  4GB9 A;  3NG0 A;  5CHV C;  4D2K A;  1SGH A;  2LZ6 A;  2FBW B;  1ZDX A;  3R7R A;  1WX7 A;  1UH6 A;  3Q8F A;  3S2A A;  4FHJ A;  2A5U A;  5C2T B;  4MEL A;  2M19 A;  2KJH B;  3VUW A;  2BF8 B;  3UQB A;  4I6P A;  2SAK A;  2C7N B;  3R3M A;  1I4G A;  4MH8 A;  4MM3 B;  5I4D A;  1FNU A;  4MSQ B;  2Y5B B;  1TTN A;  4OVV A;  4RCO A;  3FIL A;  3RUI B;  4B0M A;  1VLB A;  2ZW0 A;  1N61 A;  4UDU C;  4JGH B;  3RI7 C;  3JW0 X;  3UGB B;  3P2B A;  1FD6 A;  4HDQ A;  1KLU D;  2DYB A;  4DHJ B;  1P9D U;  1XLO A;  1ET9 A;  4GXB A;  3IVF A;  4JLC A;  3M62 B;  2NMQ A;  3AE6 B;  2L0F A;  2B76 B;  1T3Q A;  1HQR D;  3W5V B;  4ZOH C;  2J52 A;  1WXM A;  1EM7 A;  3ZDM C;  2GOW A;  3MHZ A;  2V4L A;  2MA9 B;  4FHK A;  4ZRQ A;  1PUT A;  3PO0 A;  2GB1 A;  1L6U A;  1E7P B;  2MJE A;  4KIK B;  1VDV A;  4A90 A;  3OJ4 B;  3TMP B;  3PHX B;  4KSL C;  5J17 A;  1R4N I;  1C1Y B;  2O6V B;  1SEB D;  2QCZ A;  3WA0 A;  5LNK 1;  3WAN A;  4K81 A;  4S17 A;  2DLB A;  1RYJ A;  3AED B;  5IP4 D;  3AB5 A;  5D3D A;  4KGR A;  2JQR B;  2R61 A;  4PYZ A;  3KH0 A;  3L08 A;  2MX2 A;  4K3B A;  1N60 A;  4AOF A;  4URK A;  3NVY A;  3M95 A;  3AXC A;  4II3 B;  1V9J A;  2M4N A;  2B3A A;  4A8X C;  1J7B A;  3I57 A;  5HI1 A;  2BQQ A;  5LLI A;  4TSS A;  2L1A A;  4TMA B;  4REZ A;  1YN4 A;  1QKZ A;  1E6E B;  3TEY A;  3SU8 X;  2Z59 B;  1PDX A;  1C9F A;  3PZD A;  1OQQ A;  2AQ3 B;  3HK0 A;  1JRU A;  5T8I A;  1SBB B;  2K6D B;  3KLS X;  2L76 A;  3PZ7 A;  1IP9 A;  4KGT A;  1B9R A;  2YVC A;  3GE3 C;  1IGD A;  4WAA A;  3KUD B;  5H92 C;  2OOB B;  1GAQ B;  1J7C A;  4KGS A;  4FAD A;  1TY2 A;  4W9K A;  1LGR A;  5GMV A;  1BUI C;  3ZJU A;  1KF6 B;  4DHJ D;  5DPT A;  4YT0 B;  3RFZ B;  3ZDT A;  1GPX A;  2WQY B;  4JWU C;  2BS4 B;  3QWZ B;  3Q3N C;  1XCT L;  1QLB B;  3D32 A;  3DHG C;  3AEC B;  2Z0D B;  4IWO A;  2QDF A;  3U52 E;  4MJS A;  1PFD A;  1RRB A;  1JAL A;  4LNK A;  2WXJ A;  3UIP B;  3ZJV A;  2LD9 A;  1SB3 C;  4AWJ A;  1UGJ A;  1WMH A;  1D4B A;  3VDZ A;  2WX0 A;  3H1U A;  1FXT B;  2MJ3 A;  5IA7 A;  2AYO B;  3I9V 1;  2O6V D;  3AMZ A;  3AE9 B;  1KFY B;  3HHM A;  4EFO A;  1RFA A;  3EC8 A;  3DVG X;  2N7J A;  2V3P A;  4RGT A;  3M63 B;  3U7Z A;  2KLC A;  2N9L A;  1V8C A;  2VH2 A;  1R4N B;  4CO7 A;  3Q3O C;  4TQ1 A;  3BYT B;  4NJ6 A;  4QAY A;  5HHD G;  2KVR A;  1FIQ A;  4KSK C;  1QZE A;  4J3O D;  1KRH A;  1JWA D;  4H2A A;  4WQO B;  4WWN A;  1ZE3 D;  1C4A A;  4BFR A;  1OQR A;  2GBK A;  1ZPS A;  2LGY A;  3CF6 E;  2MBO A;  3NVW A;  4WJQ A;  3DBR I;  2LGI A;  5DPW A;  3AE1 B;  5IO9 A;  1CJE A;  2KTR B;  2DYM A;  2D07 B;  2LI5 A;  2Z8L A;  2MBQ A;  3BII D;  4CHK A;  2IPK D;  3AEG B;  5J2R A;  1WX9 A;  2HD5 B;  2W9N A;  2J53 A;  2BYV E;  4FA6 A;  3EEC A;  4IM0 A;  3WAM A;  3AEA B;  2ZCC A;  2G4D B;  1YJJ A;  3T8M A;  3AEE B;  3VTV A;  1TKE A;  2M17 A;  1TY0 A;  1WYG A;  2BBC A;  3ZQ4 A;  1RFK A;  5HFY A;  3NVZ A;  3PHW B;  4TKN A;  1TGZ B;  2I1K A;  4M01 A;  3DWM A;  3E9S A;  2M0X A;  1WI0 A;  4G3X B;  1JWB D;  1TYG B;  1VZ7 A;  4OW0 A;  3ENE A;  4GDL A;  2DYO A;  3L4P A;  3IAM 1;  2LVO A;  4GU2 A;  4WUR A;  1WFY A;  2AQ1 B;  3CSF A;  1ROE A;  3DWG C;  1KH0 A;  1A5R A;  2V1Y A;  1XLP A;  2WXN A;  1MHH E;  2N9X A;  4WJN A;  1LXD A;  2L52 A;  1WGY A;  1IBX A;  1WWT A;  3CST A;  5EE3 A;  4K1R B;  2K5P A;  3Q8B A;  4NAW A;  1S3S G;  2N0S B;  4HCP B;  3ZIM A;  3C0R B;  2L00 B;  1KOT A;  4IUM B;  1FFU A;  2AWT A;  3MTN B;  2KFJ A;  2PPH A;  5FR3 A;  1F1H A;  4R3D A;  4ARI A;  3B08 A;  5AZG A;  2GBR A;  2MCN B;  3PTF C;  4IWP A;  1QOA A;  3ZTD A;  3OLM D;  3IXS A;  2DWQ A;  4BKS D;  1UEL A;  3BVG A;  1OEY A;  1WH3 A;  3NY5 A;  3ETR A;  3AE5 B;  1WM3 A;  2INC C;  5BYR A;  1ET6 A;  2C60 A;  2WDT B;  3ZKJ C;  1C79 A;  4RM8 A;  1V1O A;  1YJI A;  4HKZ E;  1NI3 A;  1P1A A;  1E8W A;  3R8B A;  4K7S A;  5BMI A;  4ITK A;  3FIL B;  4M0W B;  2L05 A;  3ZW3 A;  1JWM D;  2LGX A;  3HIZ A;  2G9H D;  4LLG M;  5LXH A;  1HTQ A;  3IHP C;  2I38 A;  2XN9 C;  4KKI A;  1D5Z C;  3APC A;  1OTR B;  4YTN B;  3DBR B;  2WU2 B;  2KDF B;  1NEN B;  4P6V F;  5AUK A;  5KHQ A;  5IOI A;  3SFD B;  2W82 A;  2KWV B;  1SE3 A;  1OFF A;  3GZN I;  3GOE A;  1V49 A;  2G45 B;  4FN2 A;  2JUO A;  1K53 A;  1N63 A;  1WYW B;  2DZI A;  1L6V A;  4XE0 A;  4HK2 A;  2XEW A;  4P1B C;  1TKY A;  1L5P A;  2C9W B;  1AAR A;  2GI9 A;  2MJD A;  2ZNV C;  5BYQ A;  4EUT A;  2JT4 B;  4IDI A;  1WE6 A;  4AJW A;  4GOC A;  2L7R A;  2QJL A;  2MW5 A;  4JX1 C;  1KJT A;  3SHQ A;  1HEZ E;  1RWS A;  5G2N A;  1P7F A;  4EZJ A;  2BTE A;  3NS1 A;  4S0R A;  3NZ3 A;  4K7U A;  5AZF A;  1WXQ A;  1AN8 A;  3VRA B;  3W9C B;  1NYQ A;  2E6X A;  4ZYN A;  1XEE A;  4J6I A;  2NR2 A;  4M8M A;  4XWT A;  5G5H A;  2CU1 A;  4JIO U;  2NVU I;  4KKJ A;  1JQ4 A;  4A6Q A;  4KDL B;  2KOX A;  1WGK A;  1HE8 A;  4TV3 A;  2L0T A;  2KDM A;  3PRP B;  2IO0 B;  2ZPN A;  1E10 A;  3U4E G;  4MAC A;  4XC2 A;  4HJK A;  3QJZ A;  1WSP A;  3P4R B;  3SD5 A;  2LHD A;  4RF1 A;  4B0E A;  4ZRI A;  2WHI A;  2NTT A;  1C4C A;  1QQR A;  2KXJ A;  2BWE S;  3AEB B;  5E6P A;  1K51 A;  2N9K A;  1V1P B;  1L2N A;  4RGM A;  2D11 A;  2N7E A;  1FNW A;  1XF5 L;  5AZH A;  1TBE A;  2KAC A;  1ZXH A;  4EZL A;  5AEK B;  3BYY B;  4GDK B;  5J18 A;  3ZGZ A;  3GB1 A;  2OED A;  1L4D B;  2WU5 B;  4HXD A;  2ON8 A;  2BW2 A;  1WZ3 A;  1WMH B;  3VR8 B;  4US9 A;  1S1Q B;  4HKQ A;  3FKY A;  4WH4 A;  4Q2J A;  3U8Z A;  2LVQ A;  4N59 A;  4WJO A;  4HLE A;  2DEN B;  2LRU A;  3ZNI D;  2FNJ B;  1GG3 A;  3IAS 1;  2HE7 A;  1ACC A;  4EE2 A;  1OEY J;  1C4P A;  2HTH A;  4E74 A;  2OHF A;  3Q3F A;  1HTO A;  1MG4 A;  2DNF A;  1QF6 A;  3T3O A;  5E6O A;  3EUB 2;  3W1Y A;  3L0W B;  3AE8 B;  2WX1 A;  3V61 A;  2JYT A;  1LFD A;  2GBJ A;  1MPE A;  4JL9 A;  5IAA C;  1NEK B;  3MP9 A;  2INN E;  2RDG A;  3JSV B;  5JHA A;  2NPT A;  4YSY B;  1WGR A;  2QIL A;  4A20 A;  5C3J B;  1J7A A;  1SIF A;  1PGB A;  3JVZ X;  4N9F 4;  3VXW A;  4B95 A;  2WDR B;  1L0V B;  2N4F A;  1ENF A;  3BWU D;  2M0A A;  4PT5 A;  1NVI D;  5EDS A;  1EU3 A;  5D7G A;  4USA A;  1V86 A;  4LNI A;  2BWF A;  2C7H A;  3PSE B;  3PS6 A;  1M94 A;  3KUC B;  3I63 C;  2H88 B;  4NJ7 A;  1GNU A;  3QCA A;  1WJN A;  4JQW C;  3IG3 A;  2FCN A;  2MSE D;  2LRW A;  3DHI C;  2LUM A;  5HG2 A;  2KQ7 A;  4WWM A;  2R2O A;  5G55 A;  3RT3 B;  4LNN A;  1UD7 A;  4HJG E;  4FJV B;  4W9H A;  2J0K A;  3I5J C;  2PE6 B;  4BAX A;  3W1S C;  1N6Z A;  1TZO A;  1VCB A;  2DAJ A;  3EFU A;  1IBX B;  5LXI B;  3ONS A;  4B9K A;  3QC8 B;  4AJY B;  1YMH E;  3N1Z C;  1E7V A;  2RMM A;  1ZUD 2;  3QA8 A;  4NAW B;  2MQJ A;  1TS5 A;  3J9C A;  1MG8 A;  3ML8 A;  1WY8 A;  4MEM A;  1B1Z A;  1WJ6 A;  2LHE A;  3APD A;  2CHW A;  3NOB A;  1FXA A;  3ZXV A;  2MEK A;  4OVU A;  2CJO A;  4LCD E;  1TJE A;  3QHT A;  2REX A;  4W9L A;  4WWO A;  3AV8 A;  2JY6 A;  3B2G A;  1Y56 A;  4AUQ C;  1DOY A;  2KDE B;  1UWX A;  4XDD A;  4G0N B;  1P3Q U;  4ANX A;  1SE2 A;  3PRZ A;  2BYE A;  3I3T B;  2IGG A;  1STE A;  3A9J A;  4BKG A;  3BVZ A;  4RGN A;  4KV2 A;  3W2D A;  2BYF A;  1UF0 A;  3LDZ E;  3LJ3 A;  4ZHO A;  2NBU A;  4FBJ B;  2XK5 B;  3TJP A;  2IO1 B;  3PLU A;  2BB5 A;  1WE7 A;  1C78 A;  1YQB A;  1M4V A;  3L13 A;  4M8N A;  2KYW A;  2N7D A;  1E90 A;  4K3C A;  2L8J A;  3AE2 B;  1WIA A;  2IJ0 A;  1VR9 A;  1GC6 A;  3P4S B;  4DXA B;  4WWP A;  4B6W A;  4YSX B;  1MVK A;  4OZC A;  2KN4 A;  2LGS A;  3IFW B;  3TCA A;  2WXG A;  1QOG A;  3DVN V;  3Q8A A;  3A9K B;  4XGA B;  5KHO A;  3ZYY X;  1J8C A;  2R2Q A;  1WXS A;  4W9J A;  3TL5 A;  1YX6 B;  5DPR A;  3V6E B;  3PV1 A;  4P1C C;  2BKF A;  1J0G A;  1V5O A;  2ZJD A;  4FUL A;  3ZO5 B;  2K0P A;  3DHH C;  1E0Z A;  4DWF A;  2VRR B;  1LO5 D;  2D3C A;  3DBH I;  3ZNZ B;  4W9G A;  2YEP F;  4ZRJ A;  1WXV A;  1K50 A;  3RD2 A;  1JWU D;  3KUZ A;  4RMA A;  4OVZ A;  1I4P A;  3BZD B;  3L10 B;  3U2S C;  1ZW7 A;  2FE8 A;  2KQS A;  3VTU A;  2LJ5 A;  3AE3 B;  1XD3 B;  1T0R C;  1X1M A;  3FAH A;  1R4M I;  1QIL A;  3P42 A;  1YIW A;  1TS4 A;  1FMA D;  1PYW D;  4IWQ A;  1Q1O A;  3OAW A;  3PVL A;  2Y5C A;  1KLV A;  2CKH B;  5TR5 A;  4HRO A;  2JZP A;  3OG5 A;  5E6N A;  2KDB A;  2LEK A;  2J0M A;  4MH0 E;  4MM3 A;  2IGD A;  1PGA A;  1E9M A;  1UUP A;  3EA6 A;  2KC1 A;  2LJI A;  4ZYS A;  3EFC A;  2QC8 A;  2ACZ B;  2PMV A;  3MC8 A;  3RN9 C;  4NJC A;  2HDE A;  1GB1 A;  3HVZ A;  2PW9 A;  3HVD A;  5JZE B;  3WAO A;  1V2Y A;  1VRA B;  4A9A A;  5C23 A;  3AE7 B;  3NS8 A;  4IM3 A;  1WM2 A;  2CHX A;  3VRB B;  2MHJ A;  3N30 A;  4W9D A;  2KQ4 X;  4W9E A;  3VR9 B;  4IM2 A;  2K8B A;  4OHJ A;  2X8X X;  2CS4 A;  3C19 A;  2OJR A;  1TZ1 A;  1F77 A;  3QAQ A;  3Q2A C;  4IC7 B;  2D2Q A;  3AE4 B;  4IG7 B;  4YTM B;  1RAX A;  2O2V B;  3N20 C;  3Q8E A;  2M8S A;  1KM7 A;  1WRI A;  4C7Y A;  3V62 A;  5IN7 A;  2MP2 A;  2K25 A;  2K3U A;  3AEF B;  2KNB A;  4NAM A;  2IO3 B;  3O65 B;  3TSS A;  4KIK A;  2PLP A;  1Q5W B;  2FCQ A;  3ML9 A;  3DPD A;  2V4I B;  2ZVO A;  3KYD D;  1WJ4 A;  3T9L A;  4C4V A;  2BPS A;  2FIF A;  1RLF A;  1TIF A;  1XT9 B;  3DBH B;  4C7Z A;  3N3K B;  1TKG A;  1FNV A;  3ZVV A;  1L0Y B;  1Q0W B;  1LQB A;  2N1W A;  3NVV A;  4RH6 A;  2D3A A;  2ASQ A;  2RPQ A;  1MI0 A;  2FUG 1;  1MHX A;  1TS2 A;  3RPF C;  2BYT A;  3DBL I;  4BKT A;  4BOS C;  2G4S A;  1R4M B;  2WXL A;  3AH7 A;  1D5X C;  4GGQ A;  1I4R A;  2H89 B;  1OGW A;  2KMA A;  4RFB A;  2K1F A;  3VAW A;  1DOX A;  1L4Z B;  3W1S A;  4PS7 A;  4WIP A;  5GXG B;  3ZRC A;  4I6N B;  1IUE A;  2WXK A;  4A3O A;  5FR6 A;  2V9H A;  4EEW A;  4F7Z A;  2D3G A;  2QMT A;  5AUI A;  1MFW A;  3PRM B;  1HXY D;  3N1X C;  1LM8 B;  1VZ6 A;  1NI2 A;  4MGI E;  3QQ8 B;  4NZL B;  3GE8 C;  1SXT A;  4C00 A;  4FXC A;  2JX5 A;  4LJO B;  1E8X A;  2NS5 A;  1HZ6 A;  2WDQ B;  2A4Z A;  4W9C A;  1XO3 A;  1FO4 A;  1NDD A;  1YNT E;  1F2R I;  2INP E;  3DOW A;  1WZ0 A;  3Q8C A;  4NNJ B;  4I6L B;  4DXG A;  2Y5P A;  2KKC A;  2IY0 B;  4BZA A;  3UQA A;  3NZS A;  2VZK D;  1Z2M A;  1ESF A;  3NZU A;  1NBF C;  4F1S A;  1V6E A;  5JHB A;  2LWP A;  1VD2 A;  2WXP A;  2D10 A;  3X23 A;  2WXR A;  2GBN A;  1JW9 D;  1D3Z A;  3RZF A;  2M1M A;  2V0G A;  2GBM A;  1ZOY B;  2LXC A;  3LXF A;  3B2F A;  1N5X A;  3WAP A;  1N5W A;  3A4R A;  3TBL D;  2GMI C;  1V5T A;  4II2 B;  1P7E A;  4HWI B;  4US8 A;  1WR6 E;  4LNO A;  1A70 A;  2W54 A;  2ZNV B;  3MFG A;  4E71 A;  3H7P A;  1I4H A;  3TUO A;  3B1L X;  3C8Y A;  3ZUN A;  3DBL B;  2J7Q B;  3HM6 X;  2I2Y A;  3L17 A;  4DHZ E;  1N62 A;  4MJS B;  2KMM A;  2JXX A;  4DXF A;  1DGJ A;  3QAR A;  3FC4 A;  1D6E C;  3RNA C;  3NUH B;  3GS2 A;  3AUL A;  3MJ5 A;  3VH4 B;  2L3Z A;  3URY A;  1JML A;  5EE1 A;  1BXT A;  2YLM A;  4KVG B;  5D94 A;  5JXV A;  2IBI B;  4MGZ E;  3B0A A;  3DBS A;  1FCL A;  2IZV B;  2JRI B;  2W3R A;  4NPN A;  1UWM A;  5D6J B;  3BVM A;  2GRI A;  2EKI A;  1NYR A;  4XWW A;  1F9J A;  3ZTC A;  1GB4 A;  1E8Y A;  3ZLZ A;  3OJ3 A;  2KWC A;  1FEH A;  4G50 A;  2LVP A;  3ZXR A;  2JWZ A;  5D3I B;  3QX1 A;  1XLN A;  3AM9 A;  1P98 A;  1HZ5 A;  2NBV B;  1DYQ A;  1FFV A;  3AI5 A;  3R2I A;  2DX5 B;  1SSN A;  2IYD B;  3Q6B A;  2RPV A;  4DK5 A;  4LTU A;  4M02 A;  4RNA A;  2K22 A;  4ZDV A;  3PGE A;  2BS3 B;  3RNG C;  2J4X A;  4WAF A;  3NRZ A;  2WXQ A;  3CMM B;  2W3S A;  4HEA 1;  5D2M B;  3A1Q A;  1C3T A;  2X38 A;  2KZR A;  3IBE A;  5HKH A;  2ZVN A;  2AL3 A;  2HJ1 A;  4BOZ B;  2IGH A;  1DOI A;  4ANU A;  1TT5 B;  2NBW B;  3RCZ A;  3H8H A;  2GLS A;  5CX3 A;  2KD0 A;  4K7W A;  1EO6 A;  4A3P A;  1UBI A;  1PQS A;  2D5G A;  2RDH A;  1YQ4 B;  3HUI A;  1E7U A;  4TUU A;  4M0W A;  2JVC A;  4TQ0 A;  4N58 A;  3APF A;  2UWQ A;  3LB8 C;  4GDL B;  2KAN A;  2KHW B;  2BB6 A;  5FK9 C;  1WF9 A;  1XLQ A;  4IW0 A;  3ZNG C;  2RD0 A;  4C80 A;  4LDT B;  2NTS A;  4OZB A;  1V81 A;  1UNS A;  1L0X B;  4CQN A;  1YOV B;  2RGF A;  2G3Q B;  1YX5 B;  2L32 A;  2MBH A;  2C7M B;  4P16 A;  1MJD A;  3CWI A;  3GP7 A;  2V3S A;  3QIJ A;  4GMV A;  2PTL A;  2WLB A;  2BVC A;  3VUX A;  2MP2 B;  2QSD A;  2QEJ C;  2V3N A;  1OQY A;  2WXI A;  2BS2 B;  3DDC B;  5L95 C;  2BKR B;  2UYZ B;  2FID A;  2LAS A;  2KO3 A;  3ZNH B;  3HM3 A;  1EF1 A;  2LMC A;  4C4V B;  3PT2 B;  2W55 A;  3IT4 B;  2ZEQ A;  3Q69 A;  1ZP0 B;  2ZW1 A;  4ANV A;  3U30 A;  2WWZ A;  1R7S A;  3P1M A;  2WXM A;  3BK1 A;  2KC2 A;  3WAL A;  3BK2 A;  2JF5 A;  2MBB B;  3ZRF A;  4LNF A;  4PS8 A;  3N1Y C;  3V6C B;  3V05 A;  3Q3J A;  4GN1 A;  4L2Y A;  2IDY A;  4L23 A;  4BBN C;  3JYU A;  4XZ4 A;  3RUL A;  1YN5 A;  2DZM A;  3RNE C;  3T3N A;  3SDL C;  1CZP A;  2G1E A;  3KWV A;  1QT9 A;  3O13 A;  1F0Z A;  2WXF A;  3EGR A;  2KJR A;  1K52 A;  2WNM A;  3PZ8 A;  2KMC A;  3L16 A;  3ALB A;  1SF0 A;  1K8R B;  3VVW B;  1WR1 A;  2KWD A;  2FAZ A;  3RNC C;  4ZRK A;  2K9X A;  2MH7 A;  3R2T A;  1QOB A;  1EU4 A;  1UGM A;  1D5M C;  4WJP A;  3R66 C;  1I42 A;  4LDT D;  1V1P A;  2MBE A;  2HTM E;  4BBN F;  2KFK A;  2XBB C;  4EOY A;  1Z5S B;  4YTP B;  2CHZ A;  3DVN U;  4YXD B;  1FRD A;  4GDK A;  1L7Y A;  4WQM A;  2K39 A;  4L1B A;  4KX6 B;  2N1V A;  2KVZ A;  2AEH A;  2EMT A;  3HRD D;  2ZZP B;  1SE4 A;  3A33 B;  2KK8 A;  4X57 B;  3VTW A;  1U4A A;  3SFE B;  4HPL B;  2MRP A;  4PS3 A;  2JYE A;  3AN1 A;  4PYU A;  2KJ6 A;  2WGS A;  4YL8 A;  2MLB A;  3ABV B;  3BY4 B;  4ARC A;  1EWC A;  3B9J A;  3WIM A;  1GOZ A;  3Q14 C;  1IYF A;  2KDI A;  4KZC A;  3KYC D;  1AYF A;  4E3C A;  3N9Y C;  1T0Y A;  5DPS A;  1FPY A;  2QHO A;  1EF5 A;  2ZPY A;  2J0J A;  1FCC C;  4M00 A;  3AU4 A;  4ANW A;  4AP4 C;  1SIJ A;  3VH3 B;  2XNA C;  2RSU A;  3RNF C;  4NQL B;  3ECI A;  2YEP B;  4AS1 A;  2C5L C;  1QOF A;  4ZHP A;  3H7P B;  1T5X D;  3JSV A;  1HA5 A;  4O1N A;  3UIN B;  5CTR C;  1ZDV A;  3V60 A;  1WX8 A;  1WJU A;  4XYC A;  1YD8 U;  1CK1 A;  3V3X A;  4P7I A;  3AU5 A;  4HDO A;  4FJY A;  3MJW A;  4JPS A;  4YWG G;  5E6J A;  2WDV B;  4N6E B;  3OWE B;  4YSZ B;  1ISN A;  2DZJ A;  1XCQ L;  2CU3 A;  3K9O B;  4JWS C;  5FKA C;  4MGK E;  3BIN A;  4KZ0 A;  2WS3 B;  3CIR B;  3TEW A;  3VUY A;  1ZGU B;  3P63 A;  4RM9 A;  2DZK A;  3W5U B;  2EEL A;  2FCS A;  2K8H A;  2IY1 B;  2JPH A;  2KT7 A;  3H6N A;  1VJK A;  1T0S C;  2WXO A;  3VQI A;  3SR6 A;  2O6V A;  3U7D A;  2LGD A;  1WGH A;  4MT5 A;  3PRE A;  4DDG D;  2HJ8 A;  5DCN A;  5JH5 C;  4RGO S;  2VZK B;  2JSV X;  2RDB C;  1TS3 A;  1JRP A;  1XQQ A;  3KVF B;  3A1Q B;  1UZX B;  4DBG A;  1WRD B;  2NPT B;  1CMX B;  2JWU A;  2PIA A;  2AQ2 B;  3DCG A;  4GSW A;  5CHW A;  5L83 A;  4MSM B;  3P4P B;  4IKG A;  1C77 A;  3LYY A;  2RR9 A;  2ZCB A;  1FM0 D;  4EKU A;  4DQO C;  3E56 A;  2BT6 A;  1I4Q A;  2CJN A;  1KTK A;  3VHT C;  2JZ3 B;  1KLG D;  2DHZ A;  4XDC A;  1YQ3 B;  1E8Z A;  2WXH A;  4ZRP A;  1RM6 C;  2M56 B;  4ACF A;  4ICV A;  1GC7 A;  4JE3 B;  1T0Q C;  4OZA A;  4W9F A;  3KWL A;  1I4X A;  2IO2 B;  2PE9 A;  2XK5 A;  2KN5 A;  3UI3 A;  3KQ4 A;  2AX5 A;  2FCM A;  3P4Q B;  1CQV A;  4FJZ A;  4FLH A;  1Q10 A;  2LFI A;  1VZ8 A;  3MC0 B;  3RYT A;  5BO4 B;  3H9D A;  3EHV A;  2Z0E B;  4NY0 A;  2WP9 B;  4G11 A;  3MHS D;  4HVB A;  4MGY E;  2KTF A;  4HPM B;  3UIO B;  1XXG A;  4KDI C;  2QIE B;  1I35 A;  5EE9 A;  3MC9 A;  1GUA B;  3PLV A;  4DDI D;  3TIX A;  2PKO A;  3X0W A;  4BVU C;  4NQK E;  1V97 A;  3DQV A;  1JRO A;  2OJW A;  2N9P C;  1GJZ A;  3KW5 B;  1WGD A;  2I1J A;  4EZK A;  1IPG A;  2KX3 A;  3A9K A;  1EUV B;  1T6B X;  4PK1 A;  1EWY C;  2JXT A;  1ZKH A;  5C1Z A;  1H4R A;  3L54 A;  2L83 A;  3WCQ A;  3NJT A;  2FUH B;  4CYE A;  2UU7 A;  3H7S A;  4LJP B;  2JZZ A;  2PVG C;  2SEB D;  5TSS A;  1ZXI A;  3A9J B;  5MPO A;  1YN3 A;  5G5G A;  1FRR A;  1AW7 A;  5BMH A;  5BMG A;  4W9I A;  2ICI A;  3A4S C;  2PVO D;  2LUE A;  4BKS A;  1WGG A;  2JRH A;  1Y8R C;  5EE0 A;  1I7H A;  1FXI A;  3TEX A;  1BT0 A;  2JU6 X;  5H8Y E;  2VH1 A;  4A55 A;  2KX0 A;  4DHZ B;  1F52 A;  2K6Q A;  2IND C;  4AQ7 A;  3PPA A;  1SJH D;  2K8C A;  1AWD A;  4IOI E;  1J19 A;  4HPP A;  2NCN A;  3RMK C;  3ZJT A;  1V80 A;  2KTR A;  2BGF A;  3R7Q A;  1F2R C;  2ONQ A;  3UF8 A;  1SJE D;  3RZW C;  2AL6 A;  1G6J A;  2EMS A;  3Q3M C;  2MWS B;  1IGC A;  5CHF A;  2KFK B;  2DBY A; 
#chains in the Genus database with same CATH homology
 3FIL B;  1BML C;  2WLB A;  1K50 A;  1JWM D;  1JWU D;  2G9H D;  4LLG M;  4OVZ A;  1I4P A;  1JCK B;  2QSD A;  3BZD B;  2QEJ C;  2TSS A;  3U2S C;  2V3N A;  2I38 A;  2FE8 A;  2XN9 C;  2WXI A;  4HRS A;  3AE3 B;  2BS2 B;  1PGX A;  2Y3A A;  4KKI A;  1D5Z C;  4YTN B;  5BYS A;  3FAH A;  2WU2 B;  3SEB A;  1QIL A;  3P42 A;  2E3T A;  2KAJ A;  1TS4 A;  1FMA D;  1NEN B;  4P6V F;  3TEZ A;  2LMC A;  1PYW D;  2Q5W D;  5AUK A;  3SFD B;  1C76 A;  2W55 A;  3IT4 B;  2W82 A;  4GLS C;  3Q69 A;  4RF0 A;  2Y5C A;  1SE3 A;  1ZP0 B;  2ZW1 A;  4HRO A;  1OFF A;  2JZP A;  1R7S A;  3P1M A;  2WXM A;  3IT6 B;  3BK1 A;  2LEK A;  1K53 A;  1N63 A;  3BK2 A;  1L6V A;  4XE0 A;  2IGD A;  1PGA A;  1E9M A;  1UUP A;  4LK0 M;  1TKY A;  1JWS D;  3EA6 A;  3V05 A;  2LJI A;  4ZYS A;  1L5P A;  4L2Y A;  2IDY A;  4L23 A;  2GI9 A;  2ACZ B;  2MJD A;  2PMV A;  4C56 C;  4NJC A;  2HDE A;  1GB1 A;  2J42 A;  1YN5 A;  3HVZ A;  2PW9 A;  3HVD A;  4IDI A;  5BYQ A;  3T3N A;  2QJL A;  4JX1 C;  4D2K A;  1VRA B;  4A9A A;  2FBW B;  1CZP A;  1ZDX A;  1HEZ E;  3AE7 B;  1RWS A;  2G1E A;  3KWV A;  1QT9 A;  1P7F A;  3O13 A;  3Q8F A;  3VRB B;  1F0Z A;  2BTE A;  2WXF A;  3EGR A;  2KQ4 X;  1K52 A;  2WNM A;  5C2T B;  3PZ8 A;  3VR9 B;  2M19 A;  3NS1 A;  3NZ3 A;  4OHJ A;  1SF0 A;  1WXQ A;  2SAK A;  1AN8 A;  1I4G A;  2KWD A;  3VRA B;  1F77 A;  4MH8 A;  4MM3 B;  3W9C B;  5I4D A;  1FNU A;  2K9X A;  3AE4 B;  1NYQ A;  2E6X A;  4YTM B;  2MH7 A;  1XEE A;  1QOB A;  3R2T A;  1EU4 A;  1D5M C;  3Q8E A;  1V1P A;  1WRI A;  2HTM E;  4C7Y A;  4RCO A;  4XWT A;  3FIL A;  5G5H A;  4KKJ A;  4B0M A;  1JQ4 A;  1VLB A;  2K3U A;  3AEF B;  4A6Q A;  2ZW0 A;  4YTP B;  4NAM A;  1N61 A;  1WGK A;  4UDU C;  2KDM A;  3TSS A;  4YXD B;  1FRD A;  2PLP A;  4WQM A;  4L1B A;  1E10 A;  4KX6 B;  1FD6 A;  1KLU D;  3U4E G;  4MAC A;  2V4I B;  1XLO A;  3HRD D;  1ET9 A;  1SE4 A;  1WSP A;  3SFE B;  2NMQ A;  3AE6 B;  3P4R B;  2B76 B;  2LHD A;  4RF1 A;  4B0E A;  2JYE A;  1T3Q A;  3AN1 A;  4C7Z A;  2NTT A;  1C4C A;  1HQR D;  1QQR A;  3W5V B;  3AEB B;  1TKG A;  1FNV A;  1K51 A;  2N9K A;  4ZOH C;  1V1P B;  2J52 A;  1EM7 A;  4RGM A;  3ABV B;  1L0Y B;  3MHZ A;  1FNW A;  1XF5 L;  3NVV A;  4RH6 A;  4ZRQ A;  4ARC A;  1EWC A;  3B9J A;  1PUT A;  1GOZ A;  3PO0 A;  1MI0 A;  2GB1 A;  2KAC A;  1L6U A;  1MHX A;  1TS2 A;  1ZXH A;  2FUG 1;  3RPF C;  1E7P B;  2MJE A;  2PTL A;  3BYY B;  1VDV A;  4GDK B;  2BYT A;  4A90 A;  2WXL A;  3AH7 A;  1AYF A;  1D5X C;  3GB1 A;  3ZGZ A;  3N9Y C;  1I4R A;  2H89 B;  4RFB A;  1SEB D;  2OED A;  1L4D B;  2WU5 B;  2ON8 A;  5LNK 1;  1DOX A;  2BW2 A;  1L4Z B;  1FCC C;  2DLB A;  3W1S A;  1RYJ A;  3AED B;  3VR8 B;  3AB5 A;  4WIP A;  5D3D A;  4KGR A;  2JQR B;  5GXG B;  4US9 A;  2R61 A;  1SIJ A;  2XNA C;  4HKQ A;  1IUE A;  1N60 A;  2WXK A;  4WH4 A;  4Q2J A;  3NVY A;  4N59 A;  2YEP B;  2QMT A;  4AS1 A;  1QOF A;  5AUI A;  3IAS 1;  4ZHP A;  1HXY D;  1T5X D;  4A8X C;  1ACC A;  1J7B A;  1HA5 A;  4EE2 A;  3I57 A;  1C4P A;  4O1N A;  5HI1 A;  1ZDV A;  4TSS A;  1VZ6 A;  2L1A A;  4TMA B;  4REZ A;  1YN4 A;  1QKZ A;  1E6E B;  3TEY A;  2OHF A;  4NZL B;  1PDX A;  1C9F A;  1SXT A;  1OQQ A;  1CK1 A;  2AQ3 B;  1QF6 A;  3V3X A;  4FXC A;  3T3O A;  2JX5 A;  5T8I A;  1SBB B;  3EUB 2;  3KLS X;  1HZ6 A;  3PZ7 A;  2WDQ B;  3AE8 B;  4KGT A;  1XO3 A;  2JYT A;  1FO4 A;  1B9R A;  1IGD A;  5H92 C;  4JPS A;  1YNT E;  4YWG G;  5E6J A;  1MPE A;  2WDV B;  1GAQ B;  1F2R I;  4N6E B;  1J7C A;  4KGS A;  1NEK B;  2INP E;  3Q8C A;  3OWE B;  1TY2 A;  4YSZ B;  3MP9 A;  2INN E;  1BUI C;  1XCQ L;  2RDG A;  2CU3 A;  3ZJU A;  4DXG A;  2Y5P A;  4JWS C;  5FKA C;  1KF6 B;  3RFZ B;  4YSY B;  4YT0 B;  2QIL A;  2WS3 B;  3CIR B;  3TEW A;  5C3J B;  1GPX A;  1J7A A;  2WQY B;  4JWU C;  2VZK D;  3P63 A;  1PGB A;  2BS4 B;  3W5U B;  2EEL A;  1ESF A;  1XCT L;  2WDR B;  1QLB B;  1L0V B;  1ENF A;  3AEC B;  2WXP A;  3BWU D;  2M0A A;  4PT5 A;  3U52 E;  2WXR A;  1NVI D;  1JW9 D;  1EU3 A;  1VJK A;  1PFD A;  5D7G A;  4USA A;  1JAL A;  2WXO A;  3VQI A;  3SR6 A;  2V0G A;  2WXJ A;  1ZOY B;  3ZJV A;  3LXF A;  2H88 B;  4MT5 A;  3B2F A;  1SB3 C;  1N5X A;  1N5W A;  1UGJ A;  1D4B A;  4RGO S;  2VZK B;  2JSV X;  1TS3 A;  1JRP A;  2MJ3 A;  2LUM A;  5HG2 A;  4WWM A;  1P7E A;  4US8 A;  3I9V 1;  3AMZ A;  3AE9 B;  1KFY B;  1A70 A;  2JWU A;  2W54 A;  4HJG E;  2PIA A;  2AQ2 B;  2N7J A;  2V3P A;  4RGT A;  3MFG A;  3U7Z A;  1I4H A;  2N9L A;  3P4P B;  1V8C A;  4IKG A;  1C77 A;  3TUO A;  3LYY A;  3C8Y A;  1TZO A;  2I2Y A;  1FM0 D;  1IBX B;  1N62 A;  4DQO C;  3E56 A;  2KMM A;  2BT6 A;  1YMH E;  4TQ1 A;  1I4Q A;  3BYT B;  2RMM A;  2CJN A;  1ZUD 2;  1KTK A;  4DXF A;  1DGJ A;  4NAW B;  5HHD G;  1KLG D;  1FIQ A;  1TS5 A;  3FC4 A;  3J9C A;  1D6E C;  4J3O D;  3NUH B;  1B1Z A;  1KRH A;  3GS2 A;  4XDC A;  1YQ3 B;  1JWA D;  4H2A A;  2WXH A;  3MJ5 A;  1ZE3 D;  2LHE A;  1C4A A;  4ZRP A;  3URY A;  1RM6 C;  2M56 B;  1JML A;  1FXA A;  5EE1 A;  1BXT A;  5JXV A;  2MEK A;  4JE3 B;  2CJO A;  1FCL A;  1OQR A;  1TJE A;  1ZPS A;  2W3R A;  4OZA A;  3KWL A;  1I4X A;  3UI3 A;  1UWM A;  3KQ4 A;  3NVW A;  3BVM A;  2GRI A;  2EKI A;  1NYR A;  3AV8 A;  4XWW A;  2AX5 A;  2LGI A;  3P4Q B;  1CQV A;  3AE1 B;  3B2G A;  1Y56 A;  1GB4 A;  1CJE A;  1Q10 A;  2LFI A;  1VZ8 A;  3MC0 B;  2DYM A;  2Z8L A;  1FEH A;  3BII D;  1DOY A;  1UWX A;  2IPK D;  3AEG B;  4XDD A;  2WP9 B;  5D3I B;  2J53 A;  1XLN A;  3AM9 A;  4ITK A;  1HZ5 A;  1SE2 A;  3AEA B;  1DYQ A;  1FFV A;  3R2I A;  1YJJ A;  2IGG A;  3AEE B;  1STE A;  1SSN A;  1XXG A;  2QIE B;  5EE9 A;  2RPV A;  4LTU A;  4RNA A;  2K22 A;  3BVZ A;  4RGN A;  3W2D A;  1TKE A;  1TY0 A;  2BS3 B;  1WYG A;  2BBC A;  2J4X A;  2PKO A;  4WAF A;  3ZQ4 A;  1RFK A;  5HFY A;  1V97 A;  3NRZ A;  3NVZ A;  4ZHO A;  1JRO A;  2WXQ A;  3DWM A;  3E9S A;  2W3S A;  4HEA 1;  1JWB D;  1TYG B;  2X38 A;  1VZ7 A;  4OW0 A;  2BB5 A;  1C78 A;  1T6B X;  2DYO A;  3L4P A;  1EWY C;  1M4V A;  2JXT A;  3IAM 1;  4WUR A;  2AQ1 B;  1ROE A;  3DWG C;  1KH0 A;  2IGH A;  2L83 A;  1DOI A;  3AE2 B;  3WCQ A;  2IJ0 A;  1XLP A;  2WXN A;  1MHH E;  1VR9 A;  3P4S B;  2L52 A;  3H8H A;  1IBX A;  1WWT A;  5EE3 A;  2D5G A;  2PVG C;  2RDH A;  2SEB D;  1ZXI A;  5TSS A;  1YQ4 B;  2K5P A;  3Q8B A;  3HUI A;  1MVK A;  4YSX B;  5MPO A;  2N0S B;  1YN3 A;  4M0W A;  5G5G A;  1FRR A;  1AW7 A;  4OZC A;  5BMH A;  5BMG A;  1FFU A;  2ICI A;  2KN4 A;  5FR3 A;  2PVO D;  4TQ0 A;  2WXG A;  5EE0 A;  1I7H A;  4N58 A;  1QOG A;  3LB8 C;  4R3D A;  1FXI A;  3TEX A;  2JU6 X;  4ARI A;  5H8Y E;  3Q8A A;  3ZYY X;  4GDL B;  4A55 A;  2BB6 A;  5FK9 C;  1QOA A;  1XLQ A;  4C80 A;  3IXS A;  2DWQ A;  4AQ7 A;  2NTS A;  1SJH D;  4OZB A;  3BVG A;  1UNS A;  1AWD A;  4IOI E;  1L0X B;  3ETR A;  2K0P A;  3AE5 B;  4CQN A;  3ZJT A;  5BYR A;  1ET6 A;  2L32 A;  1E0Z A;  1C79 A;  4P16 A;  1F2R C;  1V1O A;  2ONQ A;  1SJE D;  3CWI A;  1YJI A;  1LO5 D;  3GP7 A;  1NI3 A;  4HKZ E;  1IGC A;  3R8B A;  2YEP F;  5BMI A;  2DBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...