5H92C

Crystal structure of the complex between maize sulfite reductase and ferredoxin in the form-3 crystal
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
b'ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite reductase [ferredoxin], chloroplastic
publication title Structural and mutational studies of an electron transfer complex of maize sulfite reductase and ferredoxin.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase/electron transport
total genus 20
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2015-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5h92C00
3P4PB 1VLBA 1SIJA 1TKYA 1N5WA 4C7ZA 3EUB2 4ZHOA 1QOGA 1DOXA 1YQ3B 1FO4A 1YQ4B 2WS3B 1JALA 1QLBB 5GXGB 1QT9A 4YSZB 3LXFA 4US9A 4ZHPA 1FXIA 1FXAA 1WGKA 4C80A 1B9RA 2MJDA 1NI3A 1PDXA 2WP9B 1ZOYB 2N0SB 1OQRA 1E9MA 2K22A 2W3RA 3SR6A 2WU2B 3AH7A 4FXCA 4WQMA 1KF6B 2DBYA 1L0VB 4YTMB 1E6EB 1E0ZA 3AV8A 1V8CA 4YSYB 4YXDB 3P4SB 3B2FA 1FFVA 1RFKA 1JWAD 4P6VF 2H89B 5G5HA 1I7HA 2W54A 3AE2B 1GPXA 3NVWA 1WWTA 2W55A 3HUIA 5EE1A 3ZYYX 2FBWB 3HRDD 3P4QB 2ACZB 2L83A 1IUEA 1XLOA 2H88B 2PVOD 3AE6B 3AEEB 2K5PA 3B9JA 2WU5B 3AEBB 4USAA 5AUKA 2DWQA 1NVID 2Y5CA 2LEKA 4YSXB 1J7BA 1FM0D 2K9XA 2KMMA 2PKOA 1N5XA 1E10A 3AEDB 2EKIA 1RYJA 3AM9A 3NRZA 1TJEA 3W5VB 3NVZA 4WWMA 3VR9B 1QF6A 1CJEA 1FMAD 5C3JB 2BS3B 4HROA 3VRBB 3AN1A 1DOYA 3WCQA 3FAHA 4ZOHC 1N62A 2MJ3A 1E7PB 1N63A 2BS4B 5EE9A 5C2TB 1JW9D 3AEAB 2WDQB 4YTPB 1L5PA 1TKGA 1WRIA 3AE8B 1FFUA 1ZP0B 2CU3A 1NENB 2JX5A 1KRHA 1XLQA 3ETRA 4ITKA 5H92C 3VRAB 4N6EB 2BS2B 2G1EA 3AE7B 3P1MA 1N61A 3DWGC 3HVZA 4HRSA 1JQ4A 2WDRB 1QOAA 1N60A 1XLPA 1JWBD 1YJJA 3AE5B 3NVVA 3AEGB 1VJKA 1WYGA 2L52A 3PO0A 1T3QA 4JWSC 3W5UB 2PIAA 3P4RB 4JX1C 3W9CB 2M56B 2MH7A 1KFYB 1FIQA 1R7SA 1RWSA 1ZUD2 2W3SA 2OHFA 3AE3B 3VR8B 3AECB 1V97A 1XO3A 1GAQB 3CWIA 3FC4A 3SFEB 1NYQA 2E3TA 2PVGC 3NS1A 4N58A 3ABVB 5H8YE 1F0ZA 2M19A 1RM6C 1XLNA 3L4PA 2B76B 1FRDA 4JWUC 1L6UA 1J7CA 1ROEA 2QJLA 1QOFA 3AB5A 1QOBA 2WDVB 2BT6A 1A70A 1DGJA 1YJIA 1J7AA 1ZXIA 2WQYB 2CJOA 1OFFA 3DWMA 5AUIA 4N59A 3P63A 3SFDB 4KX6B 3RPFC 1FRRA 1JROA 1TKEA 1SF0A 1AYFA 1PUTA 1SB3C 1OQQA 1TYGB 1VDVA 3AEFB 1AWDA 1EWYC 2QIEB 1DOIA 3AE9B 2HTME 4YT0B 1NYRA 4YTNB 2AX5A 5EE0A 1UWMA 3KWLA 5G5GA 1L6VA 2MJEA 5EE3A 2CJNA 3LB8C 3AE4B 2JQRB 3AMZA 4A9AA 4US8A 2WLBA 3CIRB 3NVYA 1PFDA 1CZPA 1WXQA 1JRPA 1NEKB 3BIID 4C7YA 5MPOA 2Q5WD 4LTUA 3AE1B 2KAJA 4IDIA 3B2GA
chains in the Genus database with same CATH superfamily
1ET9A 3P4PB 1FNUA 4MJSB 1C76A 1GOZA 2IGDA 3E56A 4US9A 3DBLB 4ZHPA 1WGKA 2MJDA 2QCZA 3ML9A 2WP9B 2N0SB 2V0GA 1E9MA 3A9JB 4W9JA 2INPE 1Y56A 2JZPA 3M95A 4AJWA 3KVFB 2QHOA 1WJUA 1D5XC 4S17A 3PGEA 4DQOC 3WA0A 4USAA 1NVID 3VQIA 2FE8A 2CR5A 4DDID 4IWPA 1SE4A 4NJCA 3PT2B 4CHKA 4XC2A 1H4RA 2KC1A 3LYYA 2HTHA 5J17A 3A9KA 1NBFC 1KRHA 1L4ZB 2LUEA 2LHDA 5E6JA 1H8CA 1WRDB 1XF5L 4TUUA 1I4GA 1WH3A 3L08A 4JX1C 1EO6A 1ZUD2 4DHZB 3WALA 2D3AA 2CHXA 2YEPF 5CX3A 3LJ3A 2PW9A 2KHWB 3A9KB 3I57A 3N3KB 2NCNA 3A33B 3RT3B 1SF0A 1EU4A 2INNE 1TIFA 2LVQA 2WXRA 2JZZA 5EE3A 3DHGC 1ACCA 1ZPSA 4Q2JA 2OOBB 2NTSA 2W82A 4K7WA 3AE1B 3UIPB 1TZ1A 1KJTA 3EUB2 4DXGA 1LQBA 1XEEA 4KVGB 2K8CA 1QLBB 1B9RA 4OVZA 3VTVA 1OQRA 3SR6A 3AH7A 1C9FA 2IZVB 3UF8A 1EF5A 1X1MA 1WGDA 1KM7A 4MH8A 1WXSA 5BO4B 5BYSA 3Q3MC 1YOVB 3MC0B 5L95C 1BXTA 2KWCA 2VH2A 2Z0DB 3MTNB 2C7NB 2ACZB 3AEEB 1VD2A 4DHZE 4A20A 3QK0A 2NMQA 4ICVA 1E10A 2QC8A 3SDLC 4ARIA 2RSUA 4HXDA 2OJWA 2NTTA 4F7ZA 3WAPA 1DOYA 4FJYA 3NJTA 2C60A 4LNFA 2KDFB 2WX0A 1P0RA 1TKGA 4KZ0A 3AE8B 1V5OA 2JX5A 5C1ZA 5FR3A 3QHTA 5AEKB 4XDCA 2G1EA 4ICUA 3MC9A 3AEGB 4ZRIA 2L32A 3U7ZA 2D11A 1MPEA 1I4RA 3ZTCA 3CWIA 3IBEA 3Q3FA 3B1LX 1KLUD 2FNJB 2KX3A 3O65B 1XT9B 3QX1A 4HJKA 2GB1A 3IT6B 1PUTA 3MJ5A 2N9XA 1K52A 4KZCA 1WX7A 2MJEA 2Z0EB 3R7QA 3LB8C 3AMZA 3Q3NC 2FUHB 3R8BA 4B0EA 3V60A 2J7QB 1I4QA 2SEBD 3HM6X 4CO7A 2UU7A 2ZEQA 4HJGE 5D94A 2NS5A 1WM3A 4HCNB 1ZGUB 2KLCA 2LGSA 2HD5B 1KF6B 2DZMA 4IWOA 2GBKA 3KYDD 5DPSA 1Q0WB 2J53A 2N9EB 1SE3A 2WXHA 4AWJA 3DVNU 3KUZA 3SEBA 3QAQA 2FAZA 4YSXB 3ALBA 2I38A 2QSDA 1TJEA 1VZ8A 3W5VB 2LFIA 1QF6A 4REZA 2N1VA 1N62A 4WJOA 2J0KA 5KHOA 4FHKA 1L5PA 1TS2A 1WR6E 3AU5A 4HKZE 3BINA 4M00A 2C9WB 3GZNI 3PPAA 2R2OA 2DHZA 3I9V1 4A6QA 2RDGA 1XD3B 1JQ4A 3QARA 3PV1A 1T0QC 2KZRA 3IAS1 4EEWA 1V49A 5DPRA 2OHFA 1XO3A 2AL6A 4GDLA 4MSQB 4K3CA 1EWCA 2ZCBA 3L4PA 1T0SC 2VZKD 3NZ3A 2IY0B 4M8MA 4DWFA 2D10A 3IT4B 1V5TA 2R2QA 1HTOA 1SE9A 4MGYE 3ECIA 2K0PA 4GDLB 1TZOA 1C77A 4W9HA 1CZPA 3RMKC 1MG8A 2MQJA 4EOYA 1GUAB 4E3CA 4P1CC 4RCOA 1TY0A 1CQVA 2ZZPB 4LJPB 2K22A 1F2RI 2L1AA 3DVNV 4G0NB 3AU4A 4HCPB 5HG2A 1RLFA 1EM7A 5BMHA 2ZW1A 2RR9A 1YN5A 2H88B 2RGFA 3AE6B 4W9IA 4WJPA 1E5WA 2JXXA 2L0FA 4LCDE 1WGGA 4IW0A 3ZDMC 4ANXA 3VR9B 3N32A 3TUOA 1WIAA 4TMAB 5EE9A 4K1RB 2DNFA 4FN2A 1NDDA 5D2MB 1ZP0B 2WNMA 5E6PA 3RZFA 4N6EB 2BYEA 3HVZA 3URYA 4LK0M 1HTQA 1SJED 1V1OA 4ZDVA 1FIQA 1HZ5A 2OEDA 2AWTA 2J4XA 1STEA 1GAQB 3RNAC 2K6QA 2MBHA 5H8YE 2M19A 2B76B 3GE3C 4W9FA 4FADA 5IP4D 1DGJA 3OAWA 1OFFA 2JF5A 4A3OA 2Y5PA 4M0WA 2XEWA 1TYGB 4M01A 4S0RA 4DXFA 2KYWA 4PS8A 4XWTA 1NYRA 2CS4A 2AX5A 2DLBA 4FULA 1WGYA 4LDTD 2CJNA 3VUWA 1E7UA 1IGDA 2N1WA 2GMIC 2DAFA 4XYCA 4ACFA 4M0WB 1QT9A 1NI2A 3FILA 4XX5A 4BZAA 2I1JA 4KDLB 2D3CA 1UUPA 4TSSA 1ZXHA 3T3OA 4P6VF 1K51A 4HDQA 4KSLC 4WWOA 4WQOB 3N20C 3T9LA 1WF9A 1FNVA 4NPNA 3PZ7A 3TL5A 2KJ6A 4FJZA 3K9OB 1IYFA 3FILB 3L54A 1C79A 2IPKD 2PKOA 3QA8A 2GBJA 2ZNVC 3C8YA 1E8XA 4C56C 2YLMA 3V61A 3ZNHB 2V9HA 4DHJB 1YX5B 4NJ7A 3E9SA 4RGOS 3U7DA 2VH1A 1HEZE 4YTPB 1L4DB 3AXCA 3QWZB 1TT5B 2IO0B 4BKGA 1LM8B 4OHJA 1T3QA 4WIPA 5D3IB 2Z8LA 2AQ2B 3DCGA 1UELA 2M1MA 3N1ZC 4DXAB 3KYCD 4W9EA 2BQQA 1QOFA 1IBXA 3VTWA 1A70A 2RDBC 3UQBA 2N7JA 2NBVB 3EGRA 2JT4B 5E6OA 1AYFA 3RNEC 2LRWA 2QILA 3H1UA 1AWDA 4YL8A 5EE0A 3RFZB 2NPTA 3GZNB 4AUQC 2JQRB 3MP9A 4LTUA 2KDMA 1IBXB 3P42A 1T0RC 3BVZA 2YVCA 3OWEB 1C3TA 4ZRJA 3UI3A 3RI7C 1JALA 2X38A 5GXGB 2KKCA 2IO1B 3TSSA 4MELA 2ZNVB 4LLGM 4UDUC 1LXDA 3OLMD 4NQLB 3IAM1 1MHXA 3MFGA 3Q6BA 4PS3A 5IAAC 1QILA 4ZYSA 2NPTB 5D3DA 2V4LA 1YD8U 2H89B 3AE2B 4GGQA 1SXTA 3H6NA 4ARCA 2KX0A 1RFAA 2LGDA 2ICIA 2Z59B 2EMSA 5AUKA 1P7EA 2DWQA 1P9DU 3PRPB 1Z5SB 5IN7A 3PVLA 3GOEA 4JGHB 5HI1A 2WXQA 1SJHD 3ENEA 1XCQL 2G45B 2PPHA 1EU3A 2CU3A 4KKIA 3TEYA 3VRAB 3AE7B 2L8JA 1N61A 2NBWB 1SE2A 1YX6B 1YJJA 2L52A 2JYTA 4FJVB 3W9CB 2KQSA 2IGHA 1D3ZA 2LWPA 2FCNA 3PTFC 2WGSA 2KC2A 1F77A 5IOIA 4MACA 1NYQA 2PVGC 4N58A 3B0AA 3TMPB 1L6UA 3BK2A 3KUCB 4B9KA 2IY1B 1XQQA 1YJIA 2CJOA 1E8ZA 4G11A 1TS3A 1G6JA 4GMVA 4GN1A 4DHJD 1JROA 3ZIMA 1ZDVA 2B3AA 5J2RA 1F1HA 3WAMA 4FLHA 2DYOA 4BFRA 4YT0B 3ZLZA 1ENFA 1L6VA 2I1KA 1WM2A 4A9AA 4II3B 3W2DA 3OG5A 1JRPA 4C7YA 3TEWA 2KK8A 2X8XX 4C7ZA 1DOXA 4EKUA 4BVUC 4KSKC 2ZCCA 3AI5A 4YSZB 1GG3A 1PDXA 1ZOYB 3U2SC 3ZNGC 2Y5BB 2WU2B 3PHXB 4P1BC 4K3BA 3FKYA 3SD5A 1V8CA 3QC8B 1ET6A 1SBBB 1RAXA 2HJ8A 3SHQA 2AQ1B 2KXJA 3HRDD 4BKSA 2K39A 5CTRC 2DYMA 2FCSA 2KDBA 2L3ZA 2IDYA 4HWIB 3BY4B 3FAHA 4M8NA 4KDIC 2ZJDA 2KMCA 2WXLA 4OVVA 1FFUA 3B08A 3RUIB 1XLQA 2BYVE 4ITKA 2KDEB 2BS2B 4KV2A 3NS8A 3KQ4A 1VJKA 4JIOU 2TSSA 2VZKB 4OZAA 2EKEC 4JL9A 2OJRA 4DBGA 3AECB 4MGIE 3FC4A 2KN5A 2FIDA 3NZUA 4W9KA 5BMGA 2KWVB 2WXKA 5D6JB 2BYTA 3O13A 1J7CA 4BOSC 1YN4A 1WYWB 4NAMA 1CK1A 2MBBB 3SFDB 4JPSA 2HDEA 1I4HA 1WGHA 5TSSA 1TS5A 1I4XA 3WANA 1WI0A 4LNKA 5G2NA 5FKAC 2IBIB 4A3PA 3VAWA 3CIRB 4WURA 4RH6A 4MGZE 3A4RA 2A5UA 1QOGA 1T6BX 5FK9C 5JHBA 4J6IA 3RN9C 3R3MA 5C23A 4RMAA 2QDFA 4TQ1A 3LXFA 4KKJA 4AP4C 2BKRB 3DBSA 3I63C 4W9DA 1E90A 2XNAC 4ZRQA 1M94A 1RFKA 1CMXB 5G5HA 1XCTL 4CYEA 5HKHA 2REXA 4URKA 3Q8AA 4JLCA 2LXCA 3IHPC 3M63B 3DBHI 5LLIA 2Y5CA 3ZO5B 3ZJUA 2W9NA 3ZUNA 1D4BA 3AN1A 3WCQA 1WSPA 5C2TB 3QCAA 3VXWA 1UH6A 3ZXRA 1T5XD 4II2B 3R2IA 4I6PA 3CF6E 4BOZB 1EUVB 1WYGA 3L10B 4PK1A 3PSEB 2RD0A 4RM9A 1HQRD 2LMCA 4ANUA 5GMVA 5BMIA 4XE0A 2E3TA 2N7EA 3ZGZA 3RULA 2EELA 4BAXA 2LGYA 1WX9A 3ZDTA 3KWVA 2BGFA 4LDTB 3LDZE 4WH4A 1R4NI 2KT7A 2WXGA 2D5GA 4ZYNA 2MBOA 1LGRA 2KWUB 2HTME 1TY2A 4BKSD 4US8A 3S2AA 2ON8A 4AJYB 2JRIB 3PRMB 1N5WA 4G3XB 3NY5A 1YJ1A 1KH0A 4W9CA 2WS3B 3HVDA 1UWXA 1FXAA 3QIJA 4RGTA 2J0JA 3T8MA 2IGGA 3U30A 2LRUA 4YSYB 2JY6A 4RGNA 1V86A 3OJ3A 1FFVA 4NNJB 1I7HA 2KACA 4W9GA 3NVWA 1WWTA 3KW5B 3DOWA 3RNBC 1IUEA 2K5PA 3U8ZA 3N9YC 1S1QB 4LNNA 3BWUD 3MJWA 3ZW3A 3DBLI 2V3PA 3M62B 3A4SC 1IP9A 3AEAB 2FIFA 2FCQA 1HXYD 4K7UA 2PEAA 1RRBA 3ETRA 4IG7B 4K81A 2MWSB 2BTEA 4I6NB 4H2AA 1XLPA 5BYQA 2D3GA 2MX2A 1UGJA 1KFYB 2AL3A 2KO3A 2MRPA 4GDKA 1MJDA 4GOCA 4ASWC 1AARA 2DX5B 1SEBD 2WDVB 4KGSA 1V2YA 3DWMA 1YIWA 4KX6B 1K8RB 1QZEA 2MP2A 3C0RB 4HEA1 2KQ7A 2M8SA 1V80A 2JU6X 1VDVA 2O2VA 3VUYA 1JRUA 4GDKB 2MEKA 2NVUI 1V9JA 4PYZA 1ZW7A 4JQWC 1D5ZC 2IYDB 3RNFC 1VLBA 1SIJA 4D2KA 1YQ3B 1FO4A 3D32A 2GBNA 4EUTA 2MP2B 1KTKA 4WWNA 2O2VB 1L0XB 4WQMA 4A90A 3RZWC 1Z2MA 4YTMB 2KTFA 3BYYB 4C4VA 1EF1A 1QQRA 1J19A 2C5LC 2W54A 2K1FA 2KD0A 3I3TB 2JZ3B 2M4NA 4PT5A 1JWUD 2LEKA 2K3UA 1ZKHA 2BVCA 3DHIC 4J3OD 2EKIA 4KGRA 4GXBA 3PS6A 3R2TA 4MSMB 1CJEA 1GNUA 4HROA 4ANWA 3K9PB 4C4VB 1GC6A 1JW9D 3L17A 2PE9A 1YN3A 4AOFA 1NENB 3Q8BA 1D5MC 2V3NA 2WXOA 3DBRI 1OEYJ 1JWBD 4A8XC 2PIAA 1Q10A 3PRZA 1AN8A 1R7SA 1RWSA 2KVZA 1OGWA 1V97A 4WAFA 3VTUA 1GB1A 5DCNA 1JMLA 4OZBA 4TQ0A 5EDSA 3PHWB 3DBHB 3Q8FA 4OW0A 4RF0A 5JXVA 1QOBA 1T0YA 4O1NA 3ML8A 5AZGA 1TKEA 3OJ4B 5L83A 2JWUA 1A5RA 3IVFA 3AE9B 2ZVNA 1Q5WB 4YTNB 4IM2A 1ISNA 4NAWA 1HE8A 2N9KA 2NR2A 5BYRA 3TEXA 1UD7A 4HLEA 1IGCA 1VCBA 3GB1A 4IUMB 1M4VA 3TCAA 2UYZB 2WDTB 1FCLA 1VR9A 1ZDXA 1QKZA 2RPVA 3A1QA 3KUDB 1FXIA 4C80A 1F2RC 3HM3A 3EC8A 4BKTA 2WXNA 2O6VD 4FXCA 2LGIA 4NAWB 1E0ZA 3GP7A 4YXDB 2ASQA 4L1BA 3DPDA 1JWAD 2PE6B 4AS1A 3RCZA 2MBEA 1K53A 2BB5A 1R4NB 3U52E 2YEPB 2FBWB 2PVOD 3A1QB 1WX8A 4EFOA 1D6EC 3BK1A 3H8HA 2N7DA 2KMMA 4XDDA 1TS4A 2BF8B 4DDGD 2BKFA 2BW2A 3VVWB 3NZSA 1P98A 2IO3B 4NQKE 4B95A 1GB4A 3R66C 3TJPA 2QEJC 5HHDG 4MDKE 2BPSA 1WXVA 5AZFA 2WDQB 3L16A 2RPQA 2VRRB 1VZ6A 4HRSA 2WDRB 1V1PA 3UINB 1BMLC 3X23A 4JWSC 1UBIA 2CKHB 4F1SA 1UGMA 2JRHA 1P3QU 4HPMB 3SFEB 1PGXA 2QJLA 3AB5A 2IJ0A 4EZJA 1J7AA 1ZXIA 2LD9A 4GB9A 1V1PB 2HJ1A 1P1AA 1GC7A 1IPGA 1WGRA 4IC7B 2ZVOA 2BB6A 3BIID 2L76A 2Q5WD 2GLSA 3PREA 3B2GA 5IA7A 5FR6A 2JXTA 1SSNA 2ZPYA 4WWPA 1TBEA 4AQ7A 5JZEB 2PLPA 3V6EB 2WHIA 4TV3A 1R4MI 4JE3B 4N9F4 4DK5A 1P7FA 2JUOA 3EFUA 1WFYA 3Q69A 4K7SA 4OVUA 1KLVA 1J0GA 3RD2A 1LO5D 2KFKA 3GS2A 3P4QB 3W1SC 4PYUA 1WJ4A 5CHWA 1J7BA 1FM0D 3L0WB 3AM9A 1U4AA 4YWGG 1KOTA 3VDZA 3NHEB 4A55A 3PLVA 4IM3A 1V81A 1I35A 2HE7A 2G9HD 2L00B 3TIXA 2XBBC 2KFKB 5CHFA 2PJHA 2DZIA 2KFJA 2DZKA 2LZ6A 3Q3JA 3MHSD 2UWQA 4M02A 3AE5B 2AYOB 1L2NA 2D3BA 3Q2AC 3DVGX 2M56B 4MM3A 2AQ3B 4WAAA 3AE3B 1MFWA 2M0XA 2J52A 5DPWA 1WR1A 4HDOA 3T3NA 2L0TA 5DPTA 4TKNA 3BYTB 4E71A 3W1SA 5D7GA 3DQVA 2BBCA 3PZDA 2JYEA 4GIVA 1WXAA 4HPPA 2K25A 4MM3B 3CSTA 4RNAA 1DOIA 2LGXA 1PQSA 2MW5A 1WY8A 3Q8CA 4ANVA 2KQ4X 2RDHA 1ESFA 2LVPA 2WLBA 3DDCB 1PFDA 1NEKB 3DBRB 3L13A 4XGAB 5T8IA 3R7RA 1FCCC 4LNOA 3APCA 2ONQA 3ZJVA 1C1YB 1YQBA 2D07B 5IKCM 1C4PA 3ZQ4A 2DBYA 1UNSA 3ZRFA 3RNCC 4GSWA 3AV8A 2MSED 3Q3OC 1FEHA 3EHVA 3B2FA 2WWZA 2L7RA 2MCNB 4HK2A 1GPXA 2N4FA 3N1XC 1SIFA 2L83A 1WE6A 4PS7A 1BUIC 2G3QB 3AEBB 3HHMA 3C19A 1MVKA 3WIMA 2G4SA 1B1ZA 2FCMA 2BS3B 4MEMA 3VRBB 5CHVC 2KDIA 4P7IA 4B6WA 3I5JC 1YMHE 5I4DA 3P1MA 2MA9B 4GU2A 4BBNC 1J8CA 1N60A 2LASA 4L2YA 3PO0A 3W5UB 3MC8A 1LFDA 3JSVA 2W3SA 3VR8B 2WX1A 4HPLB 1C4CA 4CQNA 1ROEA 3TEZA 5AZHA 3Q14C 5AUIA 1I42A 3RPFC 2K8HA 1WZ0A 3AEFB 3M3JA 1YNTE 3JSVB 3PZ8A 5J18A 2MBQA 2DAJA 2WXJA 3AE4B 3HK0A 3NVYA 2V1YA 2EMTA 2LVOA 4MGKE 5JH5C 1VZ7A 4XWWA 4ZRKA 1K50A 4IM0A 2W3RA 1E8WA 1MHHE 1MG4A 2KANA 1L0VB 3AULA 2KJHB 1PYWD 2JVCA 3ONSA 3DVGY 2W55A 3V05A 4KGTA 2KNBA 5LNK1 3APDA 3UIOB 1E7VA 3ZJTA 2K6DB 2K9XA 3JYUA 3NUHB 3NRZA 4FHJA 1FPYA 2ZW0A 4KIKA 5C3JB 2SAKA 2A4ZA 3Q8EA 4W9LA 2KMAA 2MJ3A 1WJ6A 2K8BA 4WJNA 2PTLA 2AEHA 5H92C 1R4MB 1FNWA 3QJZA 3CMMB 1WJNA 3DWGC 5G55A 1FXTB 1SGHA 4LNIA 5E6NA 2D2QA 3P4RB 3N30A 1Q1OA 2LUMA 4KIKB 2J0MA 4C00A 3ABVB 1XLNA 3ZVVA 4JWUC 2O6VA 3VH4B 2FUG1 1OTRB 2WXMA 3EA6A 4N59A 3P63A 1AW7A 1L0YB 3NG0A 1UWMA 3JVZX 5G5GA 3X0WA 1HZ6A 1JCKB 4EZLA 3KH0A 5MPOA 4FBJB 1OEYA 2RMMA 2O6VB 2N9PC 2KJRA 2KWDA 4ZHOA 3DHHC 1I4PA 3H7PA 1F9JA 1WE7A 2V3SA 1KLGD 1PGBA 2KOXA 3TBLD 2WXFA 3ZTDA 2JWZA 2BWFA 5EE1A 2MLBA 2BWES 3ZYYX 1UBQA 3H9DA 4MT5A 2KTRA 3H7PB 3VH3B 3AEDB 1DYQA 1RYJA 3KLSX 3NVZA 2CHZA 3JW0X 3VFKA 3N1YC 4ZOHC 3IFWB 4BBNF 1E7PB 2M17A 5JHAA 2INDC 2M0AA 3NOBA 2DYBA 1WRIA 3ZKJC 4IKGA 2KTRB 2QMTA 1QOAA 2R61A 3NVVA 2ZPNA 4RFBA 4MH0E 1TGZB 2MH7A 2XN9C 5KHQA 4RM8A 1MI0A 2N9LA 3RYTA 3NS1A 1C78A 3RNGC 2BT6A 2WQYB 3J9CA 3EFCA 4EE2A 3ZRCA 4B0MA 3U4EG 1WXMA 4EZKA 2BYFA 3BVGA 2DZJA 4QAYA 3P2BA 4NJ6A 2WYQA 3MHZA 3KWLA 4XZ4A 3BVMA 4G50A 2XK5A 4L23A 1HA5A 2Y3AA 2V4IB 1S3SG 2KVRA 1JWSD 1OQYA 5IO9A 2KAJA 3ZXVA 3ZNZB 1VRAB 4F8CB 1TKYA 2WXPA 1YQ4B 3V3XA 2L05A 1WZ3A 1JWMD 2CU1A 1ZE3D 1NI3A 3UGBB 4P16A 1C4AA 1V6EA 1WMHA 3VUXA 3W1YA 1E6EB 4RGMA 3P4SB 2LI5A 2XK5B 2JPHA 4FA6A 4WJQA 3PLUA 3V6CB 4RF1A 3H7SA 2E6XA 3HUIA 4IWQA 1N6ZA 1L7YA 5LXHA 1XLOA 3B9JA 1E8YA 2LJIA 3UQAA 2WU5B 3IG3A 1FD6A 4I6LB 1N5XA 4LJOB 2KLGA 4HKQA 2I2YA 4WWMA 3HIZA 1FMAD 1WMHB 2LJ5A 3APFA 1N63A 2BS4B 4ZRPA 1Y8RC 1BT0A 2IO2B 2GBRA 1GJZA 4X57B 3CSFA 5LXIB 4NY0A 1PGAA 2C7MB 2KN4A 2JSVX 1TTNA 2CHWA 4IOIE 2GRIA 4OZCA 4R3DA 2WXIA 4GLSC 3V62A 3BZDB 2C7HA 3WAOA 2PMVA 2GOWA 3EECA 1F0ZA 2DENB 1RM6C 3SU8X 2GBMA 1FRDA 2G4DB 1F52A 3GE8C 4MJSA 3QQ8B 2J42A 2NBUA 1FRRA 2LXAA 2GI9A 4NZLB 2LHEA 1SB3C 1OQQA 1UF0A 1EWYC 2QIEB 3VHTC 5HFYA 3A9JA 5TR5A 2MHJA 2INCC 3IXSA 4HVBA 1XXGA 1WXQA 4E74A 1UZXB 3ZNID 4IDIA
chains in the Genus database with same CATH topology
1ET9A 1FCCC 3P4PB 1FNUA 1C76A 1N5WA 1KH0A 2ONQA 2WS3B 1GOZA 3HVDA 3ZJVA 1QT9A 2IGDA 3E56A 4US9A 1UWXA 3FILA 1FXAA 1WGKA 4ZHPA 2MJDA 2WP9B 2N0SB 2V0GA 4RGTA 1E9MA 1C4PA 2IGGA 3ZQ4A 2DBYA 1UNSA 2INPE 1UUPA 1Y56A 3AV8A 4YSYB 1FEHA 2JZPA 4RGNA 4TSSA 3B2FA 1FFVA 1ZXHA 3T3OA 4P6VF 1K51A 1I7HA 2KACA 1GPXA 1D5XC 3NVWA 1WWTA 1FNVA 4DQOC 3PZ7A 2L83A 1IUEA 1BUIC 2K5PA 3N9YC 3AEBB 3FILB 4USAA 1NVID 1C79A 2IPKD 2PKOA 1MVKA 3VQIA 3BWUD 2FE8A 3C8YA 4C56C 1B1ZA 1SE4A 2BS3B 4NJCA 3VRBB 2V3PA 3E9SA 4RGOS 3AEAB 3LYYA 4YTPB 1HEZE 1L4DB 1HXYD 1KRHA 1YMHE 1L4ZB 3ETRA 2LHDA 5E6JA 5I4DA 2BTEA 3P1MA 1XF5L 4H2AA 1XLPA 1N60A 4OHJA 5BYQA 1I4GA 4L2YA 3PO0A 1T3QA 3W5UB 4JX1C 1UGJA 1KFYB 4WIPA 5D3IB 2Z8LA 1ZUD2 2W3SA 3VR8B 2AQ2B 2YEPF 1C4CA 2PW9A 4CQNA 1ROEA 1SEBD 1QOFA 3I57A 1IBXA 2WDVB 4KGSA 1A70A 3TEZA 2N7JA 3DWMA 5AUIA 3EGRA 4KX6B 3RPFC 1SF0A 4HEA1 1EU4A 1AYFA 2JU6X 3AEFB 1VDVA 2INNE 2QILA 1AWDA 1YNTE 3PZ8A 2WXRA 5EE0A 4GDKB 3RFZB 2MEKA 5EE3A 2WXJA 2JQRB 3AE4B 1ACCA 3MP9A 3NVYA 1ZPSA 4Q2JA 2NTSA 2W82A 4LTUA 1D5ZC 3AE1B 2KDMA 1IBXB 1VLBA 1SIJA 3P42A 4D2KA 3BVZA 3OWEB 3EUB2 3UI3A 1YQ3B 1FO4A 4DXGA 1XEEA 1JALA 1QLBB 2X38A 5GXGB 1B9RA 3TSSA 1KTKA 4OVZA 4UDUC 4LLGM 1VZ7A 4XWWA 1OQRA 3IAM1 1L0XB 1K50A 1MHXA 3SR6A 2W3RA 3AH7A 1MHHE 4WQMA 3MFGA 1C9FA 4A90A 1QILA 4ZYSA 1L0VB 4YTMB 5D3DA 4MH8A 5BYSA 1PYWD 3BYYB 1QQRA 2H89B 3AE2B 2W54A 3MC0B 1SXTA 1BXTA 4ARCA 2W55A 3V05A 4KGTA 4PT5A 5LNK1 2ACZB 1JWUD 2ICIA 3AEEB 5AUKA 1P7EA 2DWQA 3ZJTA 2LEKA 2NMQA 2K3UA 2K9XA 1E10A 4J3OD 2EKIA 4KGRA 3NUHB 3NRZA 4ARIA 3R2TA 5HI1A 2NTTA 1CJEA 2ZW0A 5C3JB 2SAKA 3Q8EA 2WXQA 4HROA 1SJHD 1DOYA 1XCQL 2MJ3A 1JW9D 1EU3A 1TKGA 1YN3A 2PTLA 3AE8B 2CU3A 4KKIA 3TEYA 1NENB 2JX5A 3Q8BA 5FR3A 1D5MC 5H92C 1FNWA 2V3NA 3VRAB 2WXOA 4XDCA 2G1EA 3AE7B 1N61A 3DWGC 1SE2A 1JWBD 1YJJA 4A8XC 3AEGB 2L52A 2JYTA 2L32A 2PIAA 3P4RB 3U7ZA 3W9CB 1Q10A 2IGHA 2LUMA 1MPEA 1I4RA 1AN8A 1R7SA 1RWSA 4WAFA 1V97A 3CWIA 1F77A 4MACA 1NYQA 1GB1A 1JMLA 2PVGC 4N58A 3ABVB 4OZBA 4TQ0A 1XLNA 3Q8FA 4JWUC 4OW0A 1L6UA 3BK2A 4RF0A 5JXVA 1QOBA 1KLUD 1YJIA 2FUG1 4O1NA 2CJOA 2WXMA 3EA6A 1TS3A 4N59A 3P63A 2GB1A 1JROA 1TKEA 1ZDVA 3IT6B 2JWUA 1AW7A 1L0YB 1PUTA 3MJ5A 3AE9B 2DYOA 4YT0B 1K52A 4YTNB 1ENFA 1UWMA 5G5GA 1HZ6A 1L6VA 2MJEA 2N9KA 5BYRA 3LB8C 1JCKB 3AMZA 3TEXA 4A9AA 3R8BA 3W2DA 1IGCA 5MPOA 1JRPA 4C7YA 3GB1A 4B0EA 1M4VA 2RMMA 3TEWA 1FCLA 1I4QA 2KWDA 1VR9A 1ZDXA 2SEBD 4C7ZA 4ZHOA 1DOXA 1QKZA 2RPVA 1I4PA 4HJGE 4YSZB 1FXIA 4C80A 1F2RC 1PDXA 1ZOYB 3U2SC 2WXNA 2WU2B 4FXCA 2LGIA 1KF6B 1KLGD 4NAWB 1E0ZA 1PGBA 3GP7A 4YXDB 1V8CA 4L1BA 1ET6A 1SBBB 2WXFA 1JWAD 2J53A 4AS1A 1SE3A 1K53A 2BB5A 5EE1A 2WXHA 3U52E 2YEPB 2AQ1B 3ZYYX 2FBWB 3HRDD 2PVOD 4MT5A 3SEBA 1D6EC 3BK1A 3H8HA 4YSXB 2KMMA 4XDDA 2DYMA 3AEDB 2I38A 1DYQA 1RYJA 2QSDA 3KLSX 1TJEA 1VZ8A 3W5VB 2LFIA 1TS4A 3NVZA 1QF6A 4REZA 2BW2A 2IDYA 1GB4A 3FAHA 4ZOHC 1N62A 1E7PB 2QEJC 5HHDG 2WXLA 2WDQB 2M0AA 1L5PA 1TS2A 1WRIA 4HKZE 1FFUA 1XLQA 3I9V1 4ITKA 4IKGA 4A6QA 2BS2B 2RDGA 2QMTA 1VZ6A 4HRSA 1JQ4A 2WDRB 1QOAA 2R61A 3NVVA 1V1PA 3KQ4A 4RFBA 1BMLC 1VJKA 4JWSC 2MH7A 2TSSA 3IAS1 2VZKB 2XN9C 4OZAA 2OHFA 3AECB 1MI0A 2N9LA 1XO3A 3SFEB 3FC4A 1PGXA 5BMGA 1EWCA 3NS1A 2WXKA 2BYTA 3L4PA 1C78A 3O13A 1J7CA 2QJLA 2VZKD 1YN4A 3AB5A 3NZ3A 2BT6A 2IJ0A 1J7AA 1ZXIA 2WQYB 4NAMA 1CK1A 3J9CA 4EE2A 3SFDB 1V1PB 4B0MA 3U4EG 4JPSA 2HDEA 3BVGA 1I4HA 5TSSA 1TS5A 1I4XA 3IT4B 3MHZA 3KWLA 5FKAC 3BVMA 2K0PA 4GDLB 2BB6A 1TZOA 1C77A 4L23A 3CIRB 1HA5A 2Y3AA 1CZPA 2V4IB 3BIID 1JWSD 2Q5WD 4WURA 2KAJA 3B2GA 4RH6A 1VRAB 1TKYA 2JXTA 2WXPA 1SSNA 4RCOA 1QOGA 1T6BX 5FK9C 1YQ4B 4AQ7A 1TY0A 3V3XA 1CQVA 1JWMD 4TQ1A 3LXFA 2PLPA 4KKJA 1ZE3D 1NI3A 4JE3B 2K22A 1F2RI 2L1AA 4P16A 1P7FA 2XNAC 1C4AA 1E6EB 4RGMA 3Q69A 4ZRQA 3P4SB 1RFKA 5G5HA 1XCTL 5HG2A 1EM7A 5BMHA 4RF1A 1LO5D 3GS2A 2E6XA 3HUIA 2ZW1A 3Q8AA 3P4QB 1YN5A 1XLOA 2H88B 2LJIA 3AE6B 3B9JA 2WU5B 2Y5CA 1FD6A 1J7BA 1FM0D 1N5XA 3ZJUA 3AM9A 4HKQA 2I2YA 4WWMA 4YWGG 3VR9B 1D4BA 1FMAD 3TUOA 3AN1A 3WCQA 4TMAB 4A55A 1N63A 2BS4B 1WSPA 4ZRPA 5EE9A 5C2TB 2G9HD 1ZP0B 1T5XD 2WNMA 1PGAA 4N6EB 3R2IA 3HVZA 3URYA 3AE5B 4LK0M 2KN4A 1WYGA 2JSVX 1SJED 1V1OA 2M56B 4IOIE 2GRIA 1FIQA 1HZ5A 2AQ3B 4OZCA 2OEDA 4R3DA 1HQRD 2WXIA 2LMCA 3AE3B 4GLSC 3BZDB 2J4XA 5BMIA 1STEA 1GAQB 2PMVA 2J52A 2E3TA 4XE0A 5H8YE 3T3NA 1F0ZA 2M19A 1RM6C 3ZGZA 2B76B 1FRDA 2EELA 3KWVA 1DGJA 3BYTB 3W1SA 1OFFA 2J42A 5D7GA 2Y5PA 2BBCA 1FRRA 4M0WA 2JYEA 2GI9A 4NZLB 2LHEA 1SB3C 4WH4A 1OQQA 1TYGB 2WXGA 2D5GA 4MM3B 4RNAA 1EWYC 4DXFA 2QIEB 1DOIA 2HTME 4XWTA 5HFYA 1NYRA 2AX5A 2DLBA 3Q8CA 2KQ4X 2RDHA 2CJNA 1TY2A 1ESFA 3IXSA 4US8A 1XXGA 2WLBA 1PFDA 1WXQA 1IGDA 1NEKB 2ON8A 5T8IA 4IDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4P B;  1VLB A;  1SIJ A;  1TKY A;  1N5W A;  4C7Z A;  3EUB 2;  4ZHO A;  1QOG A;  1DOX A;  1YQ3 B;  1FO4 A;  1YQ4 B;  2WS3 B;  1JAL A;  1QLB B;  5GXG B;  1QT9 A;  4YSZ B;  3LXF A;  4US9 A;  4ZHP A;  1FXI A;  1FXA A;  1WGK A;  4C80 A;  1B9R A;  2MJD A;  1NI3 A;  1PDX A;  2WP9 B;  1ZOY B;  2N0S B;  1OQR A;  1E9M A;  2K22 A;  2W3R A;  3SR6 A;  2WU2 B;  3AH7 A;  4FXC A;  4WQM A;  1KF6 B;  2DBY A;  1L0V B;  4YTM B;  1E6E B;  1E0Z A;  3AV8 A;  1V8C A;  4YSY B;  4YXD B;  3P4S B;  3B2F A;  1FFV A;  1RFK A;  1JWA D;  4P6V F;  2H89 B;  5G5H A;  1I7H A;  2W54 A;  3AE2 B;  1GPX A;  3NVW A;  1WWT A;  2W55 A;  3HUI A;  5EE1 A;  3ZYY X;  2FBW B;  3HRD D;  3P4Q B;  2ACZ B;  2L83 A;  1IUE A;  1XLO A;  2H88 B;  2PVO D;  3AE6 B;  3AEE B;  2K5P A;  3B9J A;  2WU5 B;  3AEB B;  4USA A;  5AUK A;  2DWQ A;  1NVI D;  2Y5C A;  2LEK A;  4YSX B;  1J7B A;  1FM0 D;  2K9X A;  2KMM A;  2PKO A;  1N5X A;  1E10 A;  3AED B;  2EKI A;  1RYJ A;  3AM9 A;  3NRZ A;  1TJE A;  3W5V B;  3NVZ A;  4WWM A;  3VR9 B;  1QF6 A;  1CJE A;  1FMA D;  5C3J B;  2BS3 B;  4HRO A;  3VRB B;  3AN1 A;  1DOY A;  3WCQ A;  3FAH A;  4ZOH C;  1N62 A;  2MJ3 A;  1E7P B;  1N63 A;  2BS4 B;  5EE9 A;  5C2T B;  1JW9 D;  3AEA B;  2WDQ B;  4YTP B;  1L5P A;  1TKG A;  1WRI A;  3AE8 B;  1FFU A;  1ZP0 B;  2CU3 A;  1NEN B;  2JX5 A;  1KRH A;  1XLQ A;  3ETR A;  4ITK A;  5H92 C;  3VRA B;  4N6E B;  2BS2 B;  2G1E A;  3AE7 B;  3P1M A;  1N61 A;  3DWG C;  3HVZ A;  4HRS A;  1JQ4 A;  2WDR B;  1QOA A;  1N60 A;  1XLP A;  1JWB D;  1YJJ A;  3AE5 B;  3NVV A;  3AEG B;  1VJK A;  1WYG A;  2L52 A;  3PO0 A;  1T3Q A;  4JWS C;  3W5U B;  2PIA A;  3P4R B;  4JX1 C;  3W9C B;  2M56 B;  2MH7 A;  1KFY B;  1FIQ A;  1R7S A;  1RWS A;  1ZUD 2;  2W3S A;  2OHF A;  3AE3 B;  3VR8 B;  3AEC B;  1V97 A;  1XO3 A;  1GAQ B;  3CWI A;  3FC4 A;  3SFE B;  1NYQ A;  2E3T A;  2PVG C;  3NS1 A;  4N58 A;  3ABV B;  5H8Y E;  1F0Z A;  2M19 A;  1RM6 C;  1XLN A;  3L4P A;  2B76 B;  1FRD A;  4JWU C;  1L6U A;  1J7C A;  1ROE A;  2QJL A;  1QOF A;  3AB5 A;  1QOB A;  2WDV B;  2BT6 A;  1A70 A;  1DGJ A;  1YJI A;  1J7A A;  1ZXI A;  2WQY B;  2CJO A;  1OFF A;  3DWM A;  5AUI A;  4N59 A;  3P63 A;  3SFD B;  4KX6 B;  3RPF C;  1FRR A;  1JRO A;  1TKE A;  1SF0 A;  1AYF A;  1PUT A;  1SB3 C;  1OQQ A;  1TYG B;  1VDV A;  3AEF B;  1AWD A;  1EWY C;  2QIE B;  1DOI A;  3AE9 B;  2HTM E;  4YT0 B;  1NYR A;  4YTN B;  2AX5 A;  5EE0 A;  1UWM A;  3KWL A;  5G5G A;  1L6V A;  2MJE A;  5EE3 A;  2CJN A;  3LB8 C;  3AE4 B;  2JQR B;  3AMZ A;  4A9A A;  4US8 A;  2WLB A;  3CIR B;  3NVY A;  1PFD A;  1CZP A;  1WXQ A;  1JRP A;  1NEK B;  3BII D;  4C7Y A;  5MPO A;  2Q5W D;  4LTU A;  3AE1 B;  2KAJ A;  4IDI A;  3B2G A; 
#chains in the Genus database with same CATH topology
 1ET9 A;  3P4P B;  1FNU A;  4MJS B;  1C76 A;  1GOZ A;  2IGD A;  3E56 A;  4US9 A;  3DBL B;  4ZHP A;  1WGK A;  2MJD A;  2QCZ A;  3ML9 A;  2WP9 B;  2N0S B;  2V0G A;  1E9M A;  3A9J B;  4W9J A;  2INP E;  1Y56 A;  2JZP A;  3M95 A;  4AJW A;  3KVF B;  2QHO A;  1WJU A;  1D5X C;  4S17 A;  3PGE A;  4DQO C;  3WA0 A;  4USA A;  1NVI D;  3VQI A;  2FE8 A;  2CR5 A;  4DDI D;  4IWP A;  1SE4 A;  4NJC A;  3PT2 B;  4CHK A;  4XC2 A;  1H4R A;  2KC1 A;  3LYY A;  2HTH A;  5J17 A;  3A9K A;  1NBF C;  1KRH A;  1L4Z B;  2LUE A;  2LHD A;  5E6J A;  1H8C A;  1WRD B;  1XF5 L;  4TUU A;  1I4G A;  1WH3 A;  3L08 A;  4JX1 C;  1EO6 A;  1ZUD 2;  4DHZ B;  3WAL A;  2D3A A;  2CHX A;  2YEP F;  5CX3 A;  3LJ3 A;  2PW9 A;  2KHW B;  3A9K B;  3I57 A;  3N3K B;  2NCN A;  3A33 B;  3RT3 B;  1SF0 A;  1EU4 A;  2INN E;  1TIF A;  2LVQ A;  2WXR A;  2JZZ A;  5EE3 A;  3DHG C;  1ACC A;  1ZPS A;  4Q2J A;  2OOB B;  2NTS A;  2W82 A;  4K7W A;  3AE1 B;  3UIP B;  1TZ1 A;  1KJT A;  3EUB 2;  4DXG A;  1LQB A;  1XEE A;  4KVG B;  2K8C A;  1QLB B;  1B9R A;  4OVZ A;  3VTV A;  1OQR A;  3SR6 A;  3AH7 A;  1C9F A;  2IZV B;  3UF8 A;  1EF5 A;  1X1M A;  1WGD A;  1KM7 A;  4MH8 A;  1WXS A;  5BO4 B;  5BYS A;  3Q3M C;  1YOV B;  3MC0 B;  5L95 C;  1BXT A;  2KWC A;  2VH2 A;  2Z0D B;  3MTN B;  2C7N B;  2ACZ B;  3AEE B;  1VD2 A;  4DHZ E;  4A20 A;  3QK0 A;  2NMQ A;  4ICV A;  1E10 A;  2QC8 A;  3SDL C;  4ARI A;  2RSU A;  4HXD A;  2OJW A;  2NTT A;  4F7Z A;  3WAP A;  1DOY A;  4FJY A;  3NJT A;  2C60 A;  4LNF A;  2KDF B;  2WX0 A;  1P0R A;  1TKG A;  4KZ0 A;  3AE8 B;  1V5O A;  2JX5 A;  5C1Z A;  5FR3 A;  3QHT A;  5AEK B;  4XDC A;  2G1E A;  4ICU A;  3MC9 A;  3AEG B;  4ZRI A;  2L32 A;  3U7Z A;  2D11 A;  1MPE A;  1I4R A;  3ZTC A;  3CWI A;  3IBE A;  3Q3F A;  3B1L X;  1KLU D;  2FNJ B;  2KX3 A;  3O65 B;  1XT9 B;  3QX1 A;  4HJK A;  2GB1 A;  3IT6 B;  1PUT A;  3MJ5 A;  2N9X A;  1K52 A;  4KZC A;  1WX7 A;  2MJE A;  2Z0E B;  3R7Q A;  3LB8 C;  3AMZ A;  3Q3N C;  2FUH B;  3R8B A;  4B0E A;  3V60 A;  2J7Q B;  1I4Q A;  2SEB D;  3HM6 X;  4CO7 A;  2UU7 A;  2ZEQ A;  4HJG E;  5D94 A;  2NS5 A;  1WM3 A;  4HCN B;  1ZGU B;  2KLC A;  2LGS A;  2HD5 B;  1KF6 B;  2DZM A;  4IWO A;  2GBK A;  3KYD D;  5DPS A;  1Q0W B;  2J53 A;  2N9E B;  1SE3 A;  2WXH A;  4AWJ A;  3DVN U;  3KUZ A;  3SEB A;  3QAQ A;  2FAZ A;  4YSX B;  3ALB A;  2I38 A;  2QSD A;  1TJE A;  1VZ8 A;  3W5V B;  2LFI A;  1QF6 A;  4REZ A;  2N1V A;  1N62 A;  4WJO A;  2J0K A;  5KHO A;  4FHK A;  1L5P A;  1TS2 A;  1WR6 E;  3AU5 A;  4HKZ E;  3BIN A;  4M00 A;  2C9W B;  3GZN I;  3PPA A;  2R2O A;  2DHZ A;  3I9V 1;  4A6Q A;  2RDG A;  1XD3 B;  1JQ4 A;  3QAR A;  3PV1 A;  1T0Q C;  2KZR A;  3IAS 1;  4EEW A;  1V49 A;  5DPR A;  2OHF A;  1XO3 A;  2AL6 A;  4GDL A;  4MSQ B;  4K3C A;  1EWC A;  2ZCB A;  3L4P A;  1T0S C;  2VZK D;  3NZ3 A;  2IY0 B;  4M8M A;  4DWF A;  2D10 A;  3IT4 B;  1V5T A;  2R2Q A;  1HTO A;  1SE9 A;  4MGY E;  3ECI A;  2K0P A;  4GDL B;  1TZO A;  1C77 A;  4W9H A;  1CZP A;  3RMK C;  1MG8 A;  2MQJ A;  4EOY A;  1GUA B;  4E3C A;  4P1C C;  4RCO A;  1TY0 A;  1CQV A;  2ZZP B;  4LJP B;  2K22 A;  1F2R I;  2L1A A;  3DVN V;  4G0N B;  3AU4 A;  4HCP B;  5HG2 A;  1RLF A;  1EM7 A;  5BMH A;  2ZW1 A;  2RR9 A;  1YN5 A;  2H88 B;  2RGF A;  3AE6 B;  4W9I A;  4WJP A;  1E5W A;  2JXX A;  2L0F A;  4LCD E;  1WGG A;  4IW0 A;  3ZDM C;  4ANX A;  3VR9 B;  3N32 A;  3TUO A;  1WIA A;  4TMA B;  5EE9 A;  4K1R B;  2DNF A;  4FN2 A;  1NDD A;  5D2M B;  1ZP0 B;  2WNM A;  5E6P A;  3RZF A;  4N6E B;  2BYE A;  3HVZ A;  3URY A;  4LK0 M;  1HTQ A;  1SJE D;  1V1O A;  4ZDV A;  1FIQ A;  1HZ5 A;  2OED A;  2AWT A;  2J4X A;  1STE A;  1GAQ B;  3RNA C;  2K6Q A;  2MBH A;  5H8Y E;  2M19 A;  2B76 B;  3GE3 C;  4W9F A;  4FAD A;  5IP4 D;  1DGJ A;  3OAW A;  1OFF A;  2JF5 A;  4A3O A;  2Y5P A;  4M0W A;  2XEW A;  1TYG B;  4M01 A;  4S0R A;  4DXF A;  2KYW A;  4PS8 A;  4XWT A;  1NYR A;  2CS4 A;  2AX5 A;  2DLB A;  4FUL A;  1WGY A;  4LDT D;  2CJN A;  3VUW A;  1E7U A;  1IGD A;  2N1W A;  2GMI C;  2DAF A;  4XYC A;  4ACF A;  4M0W B;  1QT9 A;  1NI2 A;  3FIL A;  4XX5 A;  4BZA A;  2I1J A;  4KDL B;  2D3C A;  1UUP A;  4TSS A;  1ZXH A;  3T3O A;  4P6V F;  1K51 A;  4HDQ A;  4KSL C;  4WWO A;  4WQO B;  3N20 C;  3T9L A;  1WF9 A;  1FNV A;  4NPN A;  3PZ7 A;  3TL5 A;  2KJ6 A;  4FJZ A;  3K9O B;  1IYF A;  3FIL B;  3L54 A;  1C79 A;  2IPK D;  2PKO A;  3QA8 A;  2GBJ A;  2ZNV C;  3C8Y A;  1E8X A;  4C56 C;  2YLM A;  3V61 A;  3ZNH B;  2V9H A;  4DHJ B;  1YX5 B;  4NJ7 A;  3E9S A;  4RGO S;  3U7D A;  2VH1 A;  1HEZ E;  4YTP B;  1L4D B;  3AXC A;  3QWZ B;  1TT5 B;  2IO0 B;  4BKG A;  1LM8 B;  4OHJ A;  1T3Q A;  4WIP A;  5D3I B;  2Z8L A;  2AQ2 B;  3DCG A;  1UEL A;  2M1M A;  3N1Z C;  4DXA B;  3KYC D;  4W9E A;  2BQQ A;  1QOF A;  1IBX A;  3VTW A;  1A70 A;  2RDB C;  3UQB A;  2N7J A;  2NBV B;  3EGR A;  2JT4 B;  5E6O A;  1AYF A;  3RNE C;  2LRW A;  2QIL A;  3H1U A;  1AWD A;  4YL8 A;  5EE0 A;  3RFZ B;  2NPT A;  3GZN B;  4AUQ C;  2JQR B;  3MP9 A;  4LTU A;  2KDM A;  1IBX B;  3P42 A;  1T0R C;  3BVZ A;  2YVC A;  3OWE B;  1C3T A;  4ZRJ A;  3UI3 A;  3RI7 C;  1JAL A;  2X38 A;  5GXG B;  2KKC A;  2IO1 B;  3TSS A;  4MEL A;  2ZNV B;  4LLG M;  4UDU C;  1LXD A;  3OLM D;  4NQL B;  3IAM 1;  1MHX A;  3MFG A;  3Q6B A;  4PS3 A;  5IAA C;  1QIL A;  4ZYS A;  2NPT B;  5D3D A;  2V4L A;  1YD8 U;  2H89 B;  3AE2 B;  4GGQ A;  1SXT A;  3H6N A;  4ARC A;  2KX0 A;  1RFA A;  2LGD A;  2ICI A;  2Z59 B;  2EMS A;  5AUK A;  1P7E A;  2DWQ A;  1P9D U;  3PRP B;  1Z5S B;  5IN7 A;  3PVL A;  3GOE A;  4JGH B;  5HI1 A;  2WXQ A;  1SJH D;  3ENE A;  1XCQ L;  2G45 B;  2PPH A;  1EU3 A;  2CU3 A;  4KKI A;  3TEY A;  3VRA B;  3AE7 B;  2L8J A;  1N61 A;  2NBW B;  1SE2 A;  1YX6 B;  1YJJ A;  2L52 A;  2JYT A;  4FJV B;  3W9C B;  2KQS A;  2IGH A;  1D3Z A;  2LWP A;  2FCN A;  3PTF C;  2WGS A;  2KC2 A;  1F77 A;  5IOI A;  4MAC A;  1NYQ A;  2PVG C;  4N58 A;  3B0A A;  3TMP B;  1L6U A;  3BK2 A;  3KUC B;  4B9K A;  2IY1 B;  1XQQ A;  1YJI A;  2CJO A;  1E8Z A;  4G11 A;  1TS3 A;  1G6J A;  4GMV A;  4GN1 A;  4DHJ D;  1JRO A;  3ZIM A;  1ZDV A;  2B3A A;  5J2R A;  1F1H A;  3WAM A;  4FLH A;  2DYO A;  4BFR A;  4YT0 B;  3ZLZ A;  1ENF A;  1L6V A;  2I1K A;  1WM2 A;  4A9A A;  4II3 B;  3W2D A;  3OG5 A;  1JRP A;  4C7Y A;  3TEW A;  2KK8 A;  2X8X X;  4C7Z A;  1DOX A;  4EKU A;  4BVU C;  4KSK C;  2ZCC A;  3AI5 A;  4YSZ B;  1GG3 A;  1PDX A;  1ZOY B;  3U2S C;  3ZNG C;  2Y5B B;  2WU2 B;  3PHX B;  4P1B C;  4K3B A;  3FKY A;  3SD5 A;  1V8C A;  3QC8 B;  1ET6 A;  1SBB B;  1RAX A;  2HJ8 A;  3SHQ A;  2AQ1 B;  2KXJ A;  3HRD D;  4BKS A;  2K39 A;  5CTR C;  2DYM A;  2FCS A;  2KDB A;  2L3Z A;  2IDY A;  4HWI B;  3BY4 B;  3FAH A;  4M8N A;  4KDI C;  2ZJD A;  2KMC A;  2WXL A;  4OVV A;  1FFU A;  3B08 A;  3RUI B;  1XLQ A;  2BYV E;  4ITK A;  2KDE B;  2BS2 B;  4KV2 A;  3NS8 A;  3KQ4 A;  1VJK A;  4JIO U;  2TSS A;  2VZK B;  4OZA A;  2EKE C;  4JL9 A;  2OJR A;  4DBG A;  3AEC B;  4MGI E;  3FC4 A;  2KN5 A;  2FID A;  3NZU A;  4W9K A;  5BMG A;  2KWV B;  2WXK A;  5D6J B;  2BYT A;  3O13 A;  1J7C A;  4BOS C;  1YN4 A;  1WYW B;  4NAM A;  1CK1 A;  2MBB B;  3SFD B;  4JPS A;  2HDE A;  1I4H A;  1WGH A;  5TSS A;  1TS5 A;  1I4X A;  3WAN A;  1WI0 A;  4LNK A;  5G2N A;  5FKA C;  2IBI B;  4A3P A;  3VAW A;  3CIR B;  4WUR A;  4RH6 A;  4MGZ E;  3A4R A;  2A5U A;  1QOG A;  1T6B X;  5FK9 C;  5JHB A;  4J6I A;  3RN9 C;  3R3M A;  5C23 A;  4RMA A;  2QDF A;  4TQ1 A;  3LXF A;  4KKJ A;  4AP4 C;  2BKR B;  3DBS A;  3I63 C;  4W9D A;  1E90 A;  2XNA C;  4ZRQ A;  1M94 A;  1RFK A;  1CMX B;  5G5H A;  1XCT L;  4CYE A;  5HKH A;  2REX A;  4URK A;  3Q8A A;  4JLC A;  2LXC A;  3IHP C;  3M63 B;  3DBH I;  5LLI A;  2Y5C A;  3ZO5 B;  3ZJU A;  2W9N A;  3ZUN A;  1D4B A;  3AN1 A;  3WCQ A;  1WSP A;  5C2T B;  3QCA A;  3VXW A;  1UH6 A;  3ZXR A;  1T5X D;  4II2 B;  3R2I A;  4I6P A;  3CF6 E;  4BOZ B;  1EUV B;  1WYG A;  3L10 B;  4PK1 A;  3PSE B;  2RD0 A;  4RM9 A;  1HQR D;  2LMC A;  4ANU A;  5GMV A;  5BMI A;  4XE0 A;  2E3T A;  2N7E A;  3ZGZ A;  3RUL A;  2EEL A;  4BAX A;  2LGY A;  1WX9 A;  3ZDT A;  3KWV A;  2BGF A;  4LDT B;  3LDZ E;  4WH4 A;  1R4N I;  2KT7 A;  2WXG A;  2D5G A;  4ZYN A;  2MBO A;  1LGR A;  2KWU B;  2HTM E;  1TY2 A;  4BKS D;  4US8 A;  3S2A A;  2ON8 A;  4AJY B;  2JRI B;  3PRM B;  1N5W A;  4G3X B;  3NY5 A;  1YJ1 A;  1KH0 A;  4W9C A;  2WS3 B;  3HVD A;  1UWX A;  1FXA A;  3QIJ A;  4RGT A;  2J0J A;  3T8M A;  2IGG A;  3U30 A;  2LRU A;  4YSY B;  2JY6 A;  4RGN A;  1V86 A;  3OJ3 A;  1FFV A;  4NNJ B;  1I7H A;  2KAC A;  4W9G A;  3NVW A;  1WWT A;  3KW5 B;  3DOW A;  3RNB C;  1IUE A;  2K5P A;  3U8Z A;  3N9Y C;  1S1Q B;  4LNN A;  3BWU D;  3MJW A;  3ZW3 A;  3DBL I;  2V3P A;  3M62 B;  3A4S C;  1IP9 A;  3AEA B;  2FIF A;  2FCQ A;  1HXY D;  4K7U A;  2PEA A;  1RRB A;  3ETR A;  4IG7 B;  4K81 A;  2MWS B;  2BTE A;  4I6N B;  4H2A A;  1XLP A;  5BYQ A;  2D3G A;  2MX2 A;  1UGJ A;  1KFY B;  2AL3 A;  2KO3 A;  2MRP A;  4GDK A;  1MJD A;  4GOC A;  4ASW C;  1AAR A;  2DX5 B;  1SEB D;  2WDV B;  4KGS A;  1V2Y A;  3DWM A;  1YIW A;  4KX6 B;  1K8R B;  1QZE A;  2MP2 A;  3C0R B;  4HEA 1;  2KQ7 A;  2M8S A;  1V80 A;  2JU6 X;  1VDV A;  2O2V A;  3VUY A;  1JRU A;  4GDK B;  2MEK A;  2NVU I;  1V9J A;  4PYZ A;  1ZW7 A;  4JQW C;  1D5Z C;  2IYD B;  3RNF C;  1VLB A;  1SIJ A;  4D2K A;  1YQ3 B;  1FO4 A;  3D32 A;  2GBN A;  4EUT A;  2MP2 B;  1KTK A;  4WWN A;  2O2V B;  1L0X B;  4WQM A;  4A90 A;  3RZW C;  1Z2M A;  4YTM B;  2KTF A;  3BYY B;  4C4V A;  1EF1 A;  1QQR A;  1J19 A;  2C5L C;  2W54 A;  2K1F A;  2KD0 A;  3I3T B;  2JZ3 B;  2M4N A;  4PT5 A;  1JWU D;  2LEK A;  2K3U A;  1ZKH A;  2BVC A;  3DHI C;  4J3O D;  2EKI A;  4KGR A;  4GXB A;  3PS6 A;  3R2T A;  4MSM B;  1CJE A;  1GNU A;  4HRO A;  4ANW A;  3K9P B;  4C4V B;  1GC6 A;  1JW9 D;  3L17 A;  2PE9 A;  1YN3 A;  4AOF A;  1NEN B;  3Q8B A;  1D5M C;  2V3N A;  2WXO A;  3DBR I;  1OEY J;  1JWB D;  4A8X C;  2PIA A;  1Q10 A;  3PRZ A;  1AN8 A;  1R7S A;  1RWS A;  2KVZ A;  1OGW A;  1V97 A;  4WAF A;  3VTU A;  1GB1 A;  5DCN A;  1JML A;  4OZB A;  4TQ0 A;  5EDS A;  3PHW B;  3DBH B;  3Q8F A;  4OW0 A;  4RF0 A;  5JXV A;  1QOB A;  1T0Y A;  4O1N A;  3ML8 A;  5AZG A;  1TKE A;  3OJ4 B;  5L83 A;  2JWU A;  1A5R A;  3IVF A;  3AE9 B;  2ZVN A;  1Q5W B;  4YTN B;  4IM2 A;  1ISN A;  4NAW A;  1HE8 A;  2N9K A;  2NR2 A;  5BYR A;  3TEX A;  1UD7 A;  4HLE A;  1IGC A;  1VCB A;  3GB1 A;  4IUM B;  1M4V A;  3TCA A;  2UYZ B;  2WDT B;  1FCL A;  1VR9 A;  1ZDX A;  1QKZ A;  2RPV A;  3A1Q A;  3KUD B;  1FXI A;  4C80 A;  1F2R C;  3HM3 A;  3EC8 A;  4BKT A;  2WXN A;  2O6V D;  4FXC A;  2LGI A;  4NAW B;  1E0Z A;  3GP7 A;  4YXD B;  2ASQ A;  4L1B A;  3DPD A;  1JWA D;  2PE6 B;  4AS1 A;  3RCZ A;  2MBE A;  1K53 A;  2BB5 A;  1R4N B;  3U52 E;  2YEP B;  2FBW B;  2PVO D;  3A1Q B;  1WX8 A;  4EFO A;  1D6E C;  3BK1 A;  3H8H A;  2N7D A;  2KMM A;  4XDD A;  1TS4 A;  2BF8 B;  4DDG D;  2BKF A;  2BW2 A;  3VVW B;  3NZS A;  1P98 A;  2IO3 B;  4NQK E;  4B95 A;  1GB4 A;  3R66 C;  3TJP A;  2QEJ C;  5HHD G;  4MDK E;  2BPS A;  1WXV A;  5AZF A;  2WDQ B;  3L16 A;  2RPQ A;  2VRR B;  1VZ6 A;  4HRS A;  2WDR B;  1V1P A;  3UIN B;  1BML C;  3X23 A;  4JWS C;  1UBI A;  2CKH B;  4F1S A;  1UGM A;  2JRH A;  1P3Q U;  4HPM B;  3SFE B;  1PGX A;  2QJL A;  3AB5 A;  2IJ0 A;  4EZJ A;  1J7A A;  1ZXI A;  2LD9 A;  4GB9 A;  1V1P B;  2HJ1 A;  1P1A A;  1GC7 A;  1IPG A;  1WGR A;  4IC7 B;  2ZVO A;  2BB6 A;  3BII D;  2L76 A;  2Q5W D;  2GLS A;  3PRE A;  3B2G A;  5IA7 A;  5FR6 A;  2JXT A;  1SSN A;  2ZPY A;  4WWP A;  1TBE A;  4AQ7 A;  5JZE B;  2PLP A;  3V6E B;  2WHI A;  4TV3 A;  1R4M I;  4JE3 B;  4N9F 4;  4DK5 A;  1P7F A;  2JUO A;  3EFU A;  1WFY A;  3Q69 A;  4K7S A;  4OVU A;  1KLV A;  1J0G A;  3RD2 A;  1LO5 D;  2KFK A;  3GS2 A;  3P4Q B;  3W1S C;  4PYU A;  1WJ4 A;  5CHW A;  1J7B A;  1FM0 D;  3L0W B;  3AM9 A;  1U4A A;  4YWG G;  1KOT A;  3VDZ A;  3NHE B;  4A55 A;  3PLV A;  4IM3 A;  1V81 A;  1I35 A;  2HE7 A;  2G9H D;  2L00 B;  3TIX A;  2XBB C;  2KFK B;  5CHF A;  2PJH A;  2DZI A;  2KFJ A;  2DZK A;  2LZ6 A;  3Q3J A;  3MHS D;  2UWQ A;  4M02 A;  3AE5 B;  2AYO B;  1L2N A;  2D3B A;  3Q2A C;  3DVG X;  2M56 B;  4MM3 A;  2AQ3 B;  4WAA A;  3AE3 B;  1MFW A;  2M0X A;  2J52 A;  5DPW A;  1WR1 A;  4HDO A;  3T3N A;  2L0T A;  5DPT A;  4TKN A;  3BYT B;  4E71 A;  3W1S A;  5D7G A;  3DQV A;  2BBC A;  3PZD A;  2JYE A;  4GIV A;  1WXA A;  4HPP A;  2K25 A;  4MM3 B;  3CST A;  4RNA A;  1DOI A;  2LGX A;  1PQS A;  2MW5 A;  1WY8 A;  3Q8C A;  4ANV A;  2KQ4 X;  2RDH A;  1ESF A;  2LVP A;  2WLB A;  3DDC B;  1PFD A;  1NEK B;  3DBR B;  3L13 A;  4XGA B;  5T8I A;  3R7R A;  1FCC C;  4LNO A;  3APC A;  2ONQ A;  3ZJV A;  1C1Y B;  1YQB A;  2D07 B;  5IKC M;  1C4P A;  3ZQ4 A;  2DBY A;  1UNS A;  3ZRF A;  3RNC C;  4GSW A;  3AV8 A;  2MSE D;  3Q3O C;  1FEH A;  3EHV A;  3B2F A;  2WWZ A;  2L7R A;  2MCN B;  4HK2 A;  1GPX A;  2N4F A;  3N1X C;  1SIF A;  2L83 A;  1WE6 A;  4PS7 A;  1BUI C;  2G3Q B;  3AEB B;  3HHM A;  3C19 A;  1MVK A;  3WIM A;  2G4S A;  1B1Z A;  2FCM A;  2BS3 B;  4MEM A;  3VRB B;  5CHV C;  2KDI A;  4P7I A;  4B6W A;  3I5J C;  1YMH E;  5I4D A;  3P1M A;  2MA9 B;  4GU2 A;  4BBN C;  1J8C A;  1N60 A;  2LAS A;  4L2Y A;  3PO0 A;  3W5U B;  3MC8 A;  1LFD A;  3JSV A;  2W3S A;  3VR8 B;  2WX1 A;  4HPL B;  1C4C A;  4CQN A;  1ROE A;  3TEZ A;  5AZH A;  3Q14 C;  5AUI A;  1I42 A;  3RPF C;  2K8H A;  1WZ0 A;  3AEF B;  3M3J A;  1YNT E;  3JSV B;  3PZ8 A;  5J18 A;  2MBQ A;  2DAJ A;  2WXJ A;  3AE4 B;  3HK0 A;  3NVY A;  2V1Y A;  2EMT A;  2LVO A;  4MGK E;  5JH5 C;  1VZ7 A;  4XWW A;  4ZRK A;  1K50 A;  4IM0 A;  2W3R A;  1E8W A;  1MHH E;  1MG4 A;  2KAN A;  1L0V B;  3AUL A;  2KJH B;  1PYW D;  2JVC A;  3ONS A;  3DVG Y;  2W55 A;  3V05 A;  4KGT A;  2KNB A;  5LNK 1;  3APD A;  3UIO B;  1E7V A;  3ZJT A;  2K6D B;  2K9X A;  3JYU A;  3NUH B;  3NRZ A;  4FHJ A;  1FPY A;  2ZW0 A;  4KIK A;  5C3J B;  2SAK A;  2A4Z A;  3Q8E A;  4W9L A;  2KMA A;  2MJ3 A;  1WJ6 A;  2K8B A;  4WJN A;  2PTL A;  2AEH A;  5H92 C;  1R4M B;  1FNW A;  3QJZ A;  3CMM B;  1WJN A;  3DWG C;  5G55 A;  1FXT B;  1SGH A;  4LNI A;  5E6N A;  2D2Q A;  3P4R B;  3N30 A;  1Q1O A;  2LUM A;  4KIK B;  2J0M A;  4C00 A;  3ABV B;  1XLN A;  3ZVV A;  4JWU C;  2O6V A;  3VH4 B;  2FUG 1;  1OTR B;  2WXM A;  3EA6 A;  4N59 A;  3P63 A;  1AW7 A;  1L0Y B;  3NG0 A;  1UWM A;  3JVZ X;  5G5G A;  3X0W A;  1HZ6 A;  1JCK B;  4EZL A;  3KH0 A;  5MPO A;  4FBJ B;  1OEY A;  2RMM A;  2O6V B;  2N9P C;  2KJR A;  2KWD A;  4ZHO A;  3DHH C;  1I4P A;  3H7P A;  1F9J A;  1WE7 A;  2V3S A;  1KLG D;  1PGB A;  2KOX A;  3TBL D;  2WXF A;  3ZTD A;  2JWZ A;  2BWF A;  5EE1 A;  2MLB A;  2BWE S;  3ZYY X;  1UBQ A;  3H9D A;  4MT5 A;  2KTR A;  3H7P B;  3VH3 B;  3AED B;  1DYQ A;  1RYJ A;  3KLS X;  3NVZ A;  2CHZ A;  3JW0 X;  3VFK A;  3N1Y C;  4ZOH C;  3IFW B;  4BBN F;  1E7P B;  2M17 A;  5JHA A;  2IND C;  2M0A A;  3NOB A;  2DYB A;  1WRI A;  3ZKJ C;  4IKG A;  2KTR B;  2QMT A;  1QOA A;  2R61 A;  3NVV A;  2ZPN A;  4RFB A;  4MH0 E;  1TGZ B;  2MH7 A;  2XN9 C;  5KHQ A;  4RM8 A;  1MI0 A;  2N9L A;  3RYT A;  3NS1 A;  1C78 A;  3RNG C;  2BT6 A;  2WQY B;  3J9C A;  3EFC A;  4EE2 A;  3ZRC A;  4B0M A;  3U4E G;  1WXM A;  4EZK A;  2BYF A;  3BVG A;  2DZJ A;  4QAY A;  3P2B A;  4NJ6 A;  2WYQ A;  3MHZ A;  3KWL A;  4XZ4 A;  3BVM A;  4G50 A;  2XK5 A;  4L23 A;  1HA5 A;  2Y3A A;  2V4I B;  1S3S G;  2KVR A;  1JWS D;  1OQY A;  5IO9 A;  2KAJ A;  3ZXV A;  3ZNZ B;  1VRA B;  4F8C B;  1TKY A;  2WXP A;  1YQ4 B;  3V3X A;  2L05 A;  1WZ3 A;  1JWM D;  2CU1 A;  1ZE3 D;  1NI3 A;  3UGB B;  4P16 A;  1C4A A;  1V6E A;  1WMH A;  3VUX A;  3W1Y A;  1E6E B;  4RGM A;  3P4S B;  2LI5 A;  2XK5 B;  2JPH A;  4FA6 A;  4WJQ A;  3PLU A;  3V6C B;  4RF1 A;  3H7S A;  2E6X A;  3HUI A;  4IWQ A;  1N6Z A;  1L7Y A;  5LXH A;  1XLO A;  3B9J A;  1E8Y A;  2LJI A;  3UQA A;  2WU5 B;  3IG3 A;  1FD6 A;  4I6L B;  1N5X A;  4LJO B;  2KLG A;  4HKQ A;  2I2Y A;  4WWM A;  3HIZ A;  1FMA D;  1WMH B;  2LJ5 A;  3APF A;  1N63 A;  2BS4 B;  4ZRP A;  1Y8R C;  1BT0 A;  2IO2 B;  2GBR A;  1GJZ A;  4X57 B;  3CSF A;  5LXI B;  4NY0 A;  1PGA A;  2C7M B;  2KN4 A;  2JSV X;  1TTN A;  2CHW A;  4IOI E;  2GRI A;  4OZC A;  4R3D A;  2WXI A;  4GLS C;  3V62 A;  3BZD B;  2C7H A;  3WAO A;  2PMV A;  2GOW A;  3EEC A;  1F0Z A;  2DEN B;  1RM6 C;  3SU8 X;  2GBM A;  1FRD A;  2G4D B;  1F52 A;  3GE8 C;  4MJS A;  3QQ8 B;  2J42 A;  2NBU A;  1FRR A;  2LXA A;  2GI9 A;  4NZL B;  2LHE A;  1SB3 C;  1OQQ A;  1UF0 A;  1EWY C;  2QIE B;  3VHT C;  5HFY A;  3A9J A;  5TR5 A;  2MHJ A;  2INC C;  3IXS A;  4HVB A;  1XXG A;  1WXQ A;  4E74 A;  1UZX B;  3ZNI D;  4IDI A; 
#chains in the Genus database with same CATH homology
 1ET9 A;  1FCC C;  3P4P B;  1FNU A;  1C76 A;  1N5W A;  1KH0 A;  2ONQ A;  2WS3 B;  1GOZ A;  3HVD A;  3ZJV A;  1QT9 A;  2IGD A;  3E56 A;  4US9 A;  1UWX A;  3FIL A;  1FXA A;  1WGK A;  4ZHP A;  2MJD A;  2WP9 B;  2N0S B;  2V0G A;  4RGT A;  1E9M A;  1C4P A;  2IGG A;  3ZQ4 A;  2DBY A;  1UNS A;  2INP E;  1UUP A;  1Y56 A;  3AV8 A;  4YSY B;  1FEH A;  2JZP A;  4RGN A;  4TSS A;  3B2F A;  1FFV A;  1ZXH A;  3T3O A;  4P6V F;  1K51 A;  1I7H A;  2KAC A;  1GPX A;  1D5X C;  3NVW A;  1WWT A;  1FNV A;  4DQO C;  3PZ7 A;  2L83 A;  1IUE A;  1BUI C;  2K5P A;  3N9Y C;  3AEB B;  3FIL B;  4USA A;  1NVI D;  1C79 A;  2IPK D;  2PKO A;  1MVK A;  3VQI A;  3BWU D;  2FE8 A;  3C8Y A;  4C56 C;  1B1Z A;  1SE4 A;  2BS3 B;  4NJC A;  3VRB B;  2V3P A;  3E9S A;  4RGO S;  3AEA B;  3LYY A;  4YTP B;  1HEZ E;  1L4D B;  1HXY D;  1KRH A;  1YMH E;  1L4Z B;  3ETR A;  2LHD A;  5E6J A;  5I4D A;  2BTE A;  3P1M A;  1XF5 L;  4H2A A;  1XLP A;  1N60 A;  4OHJ A;  5BYQ A;  1I4G A;  4L2Y A;  3PO0 A;  1T3Q A;  3W5U B;  4JX1 C;  1UGJ A;  1KFY B;  4WIP A;  5D3I B;  2Z8L A;  1ZUD 2;  2W3S A;  3VR8 B;  2AQ2 B;  2YEP F;  1C4C A;  2PW9 A;  4CQN A;  1ROE A;  1SEB D;  1QOF A;  3I57 A;  1IBX A;  2WDV B;  4KGS A;  1A70 A;  3TEZ A;  2N7J A;  3DWM A;  5AUI A;  3EGR A;  4KX6 B;  3RPF C;  1SF0 A;  4HEA 1;  1EU4 A;  1AYF A;  2JU6 X;  3AEF B;  1VDV A;  2INN E;  2QIL A;  1AWD A;  1YNT E;  3PZ8 A;  2WXR A;  5EE0 A;  4GDK B;  3RFZ B;  2MEK A;  5EE3 A;  2WXJ A;  2JQR B;  3AE4 B;  1ACC A;  3MP9 A;  3NVY A;  1ZPS A;  4Q2J A;  2NTS A;  2W82 A;  4LTU A;  1D5Z C;  3AE1 B;  2KDM A;  1IBX B;  1VLB A;  1SIJ A;  3P42 A;  4D2K A;  3BVZ A;  3OWE B;  3EUB 2;  3UI3 A;  1YQ3 B;  1FO4 A;  4DXG A;  1XEE A;  1JAL A;  1QLB B;  2X38 A;  5GXG B;  1B9R A;  3TSS A;  1KTK A;  4OVZ A;  4UDU C;  4LLG M;  1VZ7 A;  4XWW A;  1OQR A;  3IAM 1;  1L0X B;  1K50 A;  1MHX A;  3SR6 A;  2W3R A;  3AH7 A;  1MHH E;  4WQM A;  3MFG A;  1C9F A;  4A90 A;  1QIL A;  4ZYS A;  1L0V B;  4YTM B;  5D3D A;  4MH8 A;  5BYS A;  1PYW D;  3BYY B;  1QQR A;  2H89 B;  3AE2 B;  2W54 A;  3MC0 B;  1SXT A;  1BXT A;  4ARC A;  2W55 A;  3V05 A;  4KGT A;  4PT5 A;  5LNK 1;  2ACZ B;  1JWU D;  2ICI A;  3AEE B;  5AUK A;  1P7E A;  2DWQ A;  3ZJT A;  2LEK A;  2NMQ A;  2K3U A;  2K9X A;  1E10 A;  4J3O D;  2EKI A;  4KGR A;  3NUH B;  3NRZ A;  4ARI A;  3R2T A;  5HI1 A;  2NTT A;  1CJE A;  2ZW0 A;  5C3J B;  2SAK A;  3Q8E A;  2WXQ A;  4HRO A;  1SJH D;  1DOY A;  1XCQ L;  2MJ3 A;  1JW9 D;  1EU3 A;  1TKG A;  1YN3 A;  2PTL A;  3AE8 B;  2CU3 A;  4KKI A;  3TEY A;  1NEN B;  2JX5 A;  3Q8B A;  5FR3 A;  1D5M C;  5H92 C;  1FNW A;  2V3N A;  3VRA B;  2WXO A;  4XDC A;  2G1E A;  3AE7 B;  1N61 A;  3DWG C;  1SE2 A;  1JWB D;  1YJJ A;  4A8X C;  3AEG B;  2L52 A;  2JYT A;  2L32 A;  2PIA A;  3P4R B;  3U7Z A;  3W9C B;  1Q10 A;  2IGH A;  2LUM A;  1MPE A;  1I4R A;  1AN8 A;  1R7S A;  1RWS A;  4WAF A;  1V97 A;  3CWI A;  1F77 A;  4MAC A;  1NYQ A;  1GB1 A;  1JML A;  2PVG C;  4N58 A;  3ABV B;  4OZB A;  4TQ0 A;  1XLN A;  3Q8F A;  4JWU C;  4OW0 A;  1L6U A;  3BK2 A;  4RF0 A;  5JXV A;  1QOB A;  1KLU D;  1YJI A;  2FUG 1;  4O1N A;  2CJO A;  2WXM A;  3EA6 A;  1TS3 A;  4N59 A;  3P63 A;  2GB1 A;  1JRO A;  1TKE A;  1ZDV A;  3IT6 B;  2JWU A;  1AW7 A;  1L0Y B;  1PUT A;  3MJ5 A;  3AE9 B;  2DYO A;  4YT0 B;  1K52 A;  4YTN B;  1ENF A;  1UWM A;  5G5G A;  1HZ6 A;  1L6V A;  2MJE A;  2N9K A;  5BYR A;  3LB8 C;  1JCK B;  3AMZ A;  3TEX A;  4A9A A;  3R8B A;  3W2D A;  1IGC A;  5MPO A;  1JRP A;  4C7Y A;  3GB1 A;  4B0E A;  1M4V A;  2RMM A;  3TEW A;  1FCL A;  1I4Q A;  2KWD A;  1VR9 A;  1ZDX A;  2SEB D;  4C7Z A;  4ZHO A;  1DOX A;  1QKZ A;  2RPV A;  1I4P A;  4HJG E;  4YSZ B;  1FXI A;  4C80 A;  1F2R C;  1PDX A;  1ZOY B;  3U2S C;  2WXN A;  2WU2 B;  4FXC A;  2LGI A;  1KF6 B;  1KLG D;  4NAW B;  1E0Z A;  1PGB A;  3GP7 A;  4YXD B;  1V8C A;  4L1B A;  1ET6 A;  1SBB B;  2WXF A;  1JWA D;  2J53 A;  4AS1 A;  1SE3 A;  1K53 A;  2BB5 A;  5EE1 A;  2WXH A;  3U52 E;  2YEP B;  2AQ1 B;  3ZYY X;  2FBW B;  3HRD D;  2PVO D;  4MT5 A;  3SEB A;  1D6E C;  3BK1 A;  3H8H A;  4YSX B;  2KMM A;  4XDD A;  2DYM A;  3AED B;  2I38 A;  1DYQ A;  1RYJ A;  2QSD A;  3KLS X;  1TJE A;  1VZ8 A;  3W5V B;  2LFI A;  1TS4 A;  3NVZ A;  1QF6 A;  4REZ A;  2BW2 A;  2IDY A;  1GB4 A;  3FAH A;  4ZOH C;  1N62 A;  1E7P B;  2QEJ C;  5HHD G;  2WXL A;  2WDQ B;  2M0A A;  1L5P A;  1TS2 A;  1WRI A;  4HKZ E;  1FFU A;  1XLQ A;  3I9V 1;  4ITK A;  4IKG A;  4A6Q A;  2BS2 B;  2RDG A;  2QMT A;  1VZ6 A;  4HRS A;  1JQ4 A;  2WDR B;  1QOA A;  2R61 A;  3NVV A;  1V1P A;  3KQ4 A;  4RFB A;  1BML C;  1VJK A;  4JWS C;  2MH7 A;  2TSS A;  3IAS 1;  2VZK B;  2XN9 C;  4OZA A;  2OHF A;  3AEC B;  1MI0 A;  2N9L A;  1XO3 A;  3SFE B;  3FC4 A;  1PGX A;  5BMG A;  1EWC A;  3NS1 A;  2WXK A;  2BYT A;  3L4P A;  1C78 A;  3O13 A;  1J7C A;  2QJL A;  2VZK D;  1YN4 A;  3AB5 A;  3NZ3 A;  2BT6 A;  2IJ0 A;  1J7A A;  1ZXI A;  2WQY B;  4NAM A;  1CK1 A;  3J9C A;  4EE2 A;  3SFD B;  1V1P B;  4B0M A;  3U4E G;  4JPS A;  2HDE A;  3BVG A;  1I4H A;  5TSS A;  1TS5 A;  1I4X A;  3IT4 B;  3MHZ A;  3KWL A;  5FKA C;  3BVM A;  2K0P A;  4GDL B;  2BB6 A;  1TZO A;  1C77 A;  4L23 A;  3CIR B;  1HA5 A;  2Y3A A;  1CZP A;  2V4I B;  3BII D;  1JWS D;  2Q5W D;  4WUR A;  2KAJ A;  3B2G A;  4RH6 A;  1VRA B;  1TKY A;  2JXT A;  2WXP A;  1SSN A;  4RCO A;  1QOG A;  1T6B X;  5FK9 C;  1YQ4 B;  4AQ7 A;  1TY0 A;  3V3X A;  1CQV A;  1JWM D;  4TQ1 A;  3LXF A;  2PLP A;  4KKJ A;  1ZE3 D;  1NI3 A;  4JE3 B;  2K22 A;  1F2R I;  2L1A A;  4P16 A;  1P7F A;  2XNA C;  1C4A A;  1E6E B;  4RGM A;  3Q69 A;  4ZRQ A;  3P4S B;  1RFK A;  5G5H A;  1XCT L;  5HG2 A;  1EM7 A;  5BMH A;  4RF1 A;  1LO5 D;  3GS2 A;  2E6X A;  3HUI A;  2ZW1 A;  3Q8A A;  3P4Q B;  1YN5 A;  1XLO A;  2H88 B;  2LJI A;  3AE6 B;  3B9J A;  2WU5 B;  2Y5C A;  1FD6 A;  1J7B A;  1FM0 D;  1N5X A;  3ZJU A;  3AM9 A;  4HKQ A;  2I2Y A;  4WWM A;  4YWG G;  3VR9 B;  1D4B A;  1FMA D;  3TUO A;  3AN1 A;  3WCQ A;  4TMA B;  4A55 A;  1N63 A;  2BS4 B;  1WSP A;  4ZRP A;  5EE9 A;  5C2T B;  2G9H D;  1ZP0 B;  1T5X D;  2WNM A;  1PGA A;  4N6E B;  3R2I A;  3HVZ A;  3URY A;  3AE5 B;  4LK0 M;  2KN4 A;  1WYG A;  2JSV X;  1SJE D;  1V1O A;  2M56 B;  4IOI E;  2GRI A;  1FIQ A;  1HZ5 A;  2AQ3 B;  4OZC A;  2OED A;  4R3D A;  1HQR D;  2WXI A;  2LMC A;  3AE3 B;  4GLS C;  3BZD B;  2J4X A;  5BMI A;  1STE A;  1GAQ B;  2PMV A;  2J52 A;  2E3T A;  4XE0 A;  5H8Y E;  3T3N A;  1F0Z A;  2M19 A;  1RM6 C;  3ZGZ A;  2B76 B;  1FRD A;  2EEL A;  3KWV A;  1DGJ A;  3BYT B;  3W1S A;  1OFF A;  2J42 A;  5D7G A;  2Y5P A;  2BBC A;  1FRR A;  4M0W A;  2JYE A;  2GI9 A;  4NZL B;  2LHE A;  1SB3 C;  4WH4 A;  1OQQ A;  1TYG B;  2WXG A;  2D5G A;  4MM3 B;  4RNA A;  1EWY C;  4DXF A;  2QIE B;  1DOI A;  2HTM E;  4XWT A;  5HFY A;  1NYR A;  2AX5 A;  2DLB A;  3Q8C A;  2KQ4 X;  2RDH A;  2CJN A;  1TY2 A;  1ESF A;  3IXS A;  4US8 A;  1XXG A;  2WLB A;  1PFD A;  1WXQ A;  1IGD A;  1NEK B;  2ON8 A;  5T8I A;  4IDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...