1WXAA

Solution structure of ras-binding domain in mouse af-6 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
GSSGSSGSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Afadin
publication title Solution Structure of Ras-binding Domain in Mouse AF-6 Protein
rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxaA00
1UBQA 3L10B 4EZLA 2LGYA 3IG3A 2L0FA 1J0GA 3V6EB 2O6VB 2JF5A 1SGHA 1Y8RC 4WJQA 4B6WA 3K9OB 2KC2A 1V2YA 4JLCA 1RRBA 4WWOA 4PYUA 3DQVA 1E90A 1Q5WB 3SDLC 4M8NA 2YLMA 5TR5A 4BOZB 2FUHB 2N9PC 4MSQB 2EKEC 4XZ4A 2LWPA 2EMTA 4ANUA 4NJ6A 2GOWA 2NS5A 4BFRA 1H8CA 2MBEA 2IYDB 4IWQA 2LVPA 2NPTA 1WM3A 3QQ8B 4FHJA 4GDKA 3VFKA 3HHMA 2GBJA 4N9F4 4DHJD 3NZSA 2D07B 1WM2A 2BGFA 1WR6E 4IM0A 3QCAA 4HJKA 2GBRA 1WJ4A 3RT3B 1QZEA 2N9EB 1WJUA 3ZDMC 4DDGD 3DVNV 2RR9A 3PLVA 3RYTA 2MWSB 2B3AA 3ZTDA 5C23A 4GGQA 2KTRB 1OEYJ 2DAJA 2FIFA 1G6JA 3DBLI 2KMCA 1KM7A 2K8CA 2KC1A 4G50A 2ZZPB 3KYCD 5CHWA 4KSLC 3WA0A 5AZGA 3RULA 1D3ZA 1LFDA 1Z5SB 3KH0A 3VTUA 3SHQA 4W9CA 4F7ZA 4W9LA 2REXA 3PS6A 5JHBA 3IHPC 5AEKB 4NQLB 2CHZA 2NVUI 3ENEA 4AP4C 2GBKA 3BINA 2KFJA 2DZKA 1C1YB 2XEWA 3UGBB 1ISNA 1WY8A 4EEWA 4P7IA 2HTHA 3HIZA 3OJ3A 1SIFA 3OJ4B 1R4NI 1GNUA 2C5LC 2MX2A 3ONSA 3NZUA 2J0MA 3GZNI 2KWCA 1V86A 2GMIC 3H7PA 3W1YA 3M95A 2OJRA 2K39A 3OAWA 3PPAA 2PPHA 3D32A 1YX6B 4KIKA 5L95C 3L08A 3ZNZB 2N9XA 4HCPB 4EFOA 1Q0WB 3QJZA 4EZKA 5HKHA 5E6PA 3TBLD 2K8HA 2PE9A 4MGIE 3T8MA 1LXDA 4TKNA 4CHKA 2KX3A 1RFAA 3WAPA 2DZMA 1C3TA 3R3MA 4IG7B 3N32A 2V3SA 2PEAA 2BWES 2MW5A 4JIOU 4MM3A 4GSWA 3UIPB 3A4RA 2LGXA 2FCSA 4EKUA 2KFKA 3DVNU 2R2OA 4LJOB 3UIOB 4BBNF 3IVFA 2K1FA 2W9NA 1WGDA 4K7WA 2L0TA 3HM6X 5E6OA 3PVLA 1WFYA 1LQBA 3IBEA 2DYOA 3VAWA 5CHFA 3VQIA 1WMHB 5AZHA 4AUQC 3N30A 3U7DA 5L83A 3S2AA 3RCZA 3R66C 2N1WA 5E6NA 2KJHB 2I1KA 4NJ7A 4ANVA 1V5TA 3EECA 3L17A 3NS8A 2CR5A 4ICVA 1EO6A 3QAQA 2IO1B 2D11A 1K8RB 2KZRA 4BOSC 2G4SA 1E7VA 2HE7A 2UYZB 3AULA 4W9IA 3V62A 4E3CA 1WE7A 1IP9A 1M94A 2HJ8A 4KV2A 1L7YA 4ANWA 4WJPA 2ZPNA 1KLVA 2MSED 3QHTA 1YQBA 4FJYA 4HPLB 4MGKE 3ML9A 1E5WA 3WANA 2LVOA 3AU4A 4MDKE 1EF1A 2FAZA 2AYOB 5CTRC 2Z59B 5LLIA 1WH3A 3DBRI 1HE8A 3PGEA 4MELA 3RZWC 4ANXA 3RD2A 2GBNA 4HPMB 2LRUA 3TL5A 2ZCBA 4M0WB 1SE9A 3VUWA 1WYWB 3VH4B 3HK0A 2R2QA 2WX1A 2MLBA 3TMPB 4K1RB 3DBSA 5D94A 3A9JA 1WX9A 2BYEA 4GDLA 1P1AA 4MJSB 3A1QA 2L7RA 5J17A 5JZEB 3I3TB 3DDCB 4DHJB 3PHXB 1L2NA 2IO3B 4GMVA 3X0WA 2O2VB 4GN1A 3ZNID 1WGHA 1J8CA 4HLEA 2ZVNA 1TZ1A 2UWQA 1S1QB 3ZRFA 5FR6A 2XK5A 4FJVB 3VDZA 1PQSA 4A3PA 2KO3A 4PS7A 1WZ0A 3UINB 3ZDTA 2KQSA 4GU2A 4JQWC 4OVVA 1J19A 4I6NB 4E74A 1H4RA 3O65B 1ZGUB 1VD2A 2IO2B 3SD5A 4WWNA 3UQBA 2MBOA 3L16A 1TTNA 2CU1A 4LDTD 4NY0A 2V1YA 4W9EA 1F9JA 4ZRIA 2RGFA 3MJWA 3ZIMA 2N7EA 5J18A 2OOBB 3TIXA 1MG8A 3ZVVA 2KOXA 1AARA 1V80A 2DX5B 4MH0E 1ZKHA 1WF9A 4F1SA 1OEYA 3DCGA 2NPTB 4ZRJA 4GDKB 3ZW3A 2CKHB 2BYVE 5DPTA 4HVBA 3H9DA 2JT4B 2KDBA 1GC6A 1ZW7A 2KDIA 5CHVC 3PT2B 1WX8A 2L05A 3KVFB 4NNJB 2N4FA 3QARA 1IPGA 4NPNA 3PSEB 1GG3A 2JPHA 1OGWA 1UBIA 5IA7A 2NBVB 2WX0A 3P2BA 2KX0A 3ML8A 4DDID 1UH6A 2MQJA 3QK0A 2IO0B 3QC8B 4GIVA 4EOYA 3QA8A 3WIMA 4PS8A 3H6NA 5DPWA 2M8SA 4PYZA 3U8ZA 3VUXA 2K25A 4RM8A 3JSVA 2ZEQA 1WXMA 2LGDA 3EHVA 2CHWA 4GXBA 3JYUA 4FADA 4ZYNA 3PHWB 4DHZB 3ZLZA 3A9KA 1XQQA 2MA9B 2FIDA 3ECIA 2JVCA 2EMSA 2KK8A 2LRWA 2Z0EB 1V81A 4B9KA 4K81A 2LZ6A 1V6EA 2BPSA 4DHZE 1E8WA 2KJ6A 2NR2A 1WXAA 2BKFA 2MP2A 4AWJA 3M62B 2L3ZA 2AL3A 3ZUNA 1V9JA 2DHZA 4I6LB 5DPSA 2LJ5A 2NBUA 3JW0X 2CHXA 3A33B 2RD0A 2YVCA 4DXAB 2LI5A 4KZ0A 1E7UA 2JY6A 1I42A 4ICUA 3W1SA 4W9DA 1WJ6A 3AI5A 3H7PB 3V61A 2C9WB 3VH3B 2KJRA 2WDTB 1KJTA 5LXIB 4KIKB 3BY4B 2Y5BB 2KMAA 3MHSD 3U30A 2DENB 2JXXA 1Q1OA 2BYFA 4AJYB 5G2NA 2CS4A 1E8YA 3KUCB 1T0YA 3UF8A 1YIWA 2DAFA 4W9GA 3PV1A 3VVWB 1LM8B 1NBFC 1WI0A 2ZJDA 4X57B 4II2B 2ZPYA 3QIJA 3H7SA 2DYBA 3UQAA 2BKRB 2J7QB 3VTWA 4FN2A 3EC8A 3MTNB 2MBQA 4ZRKA 3JVZX 5LXHA 5DPRA 1NI2A 4BVUC 2KFKB 2PJHA 2IZVB 4G11A 3ZKJC 4FBJB 3H1UA 3ZNGC 3K9PB 5CX3A 2LASA 1WIAA 3CSTA 4NAWA 4GB9A 2G4DB 4FULA 3PLUA 2PE6B 4WJOA 4W9JA 2IBIB 4KSKC 1WGYA 2ZVOA 4WJNA 2KDEB 1R4MI 3Q3FA 3WALA 1WX7A 2WYQA 3CMMB 4IWPA 2FCNA 2MBHA 4URKA 2G45B 2QHOA 3KW5B 2AL6A 2O6VA 4MEMA 2NCNA 5AZFA 3TJPA 2L8JA 4NAWB 1U4AA 1XT9B 3VXWA 3X23A 4I6PA 2C60A 1UGMA 4W9HA 4CO7A 4KDLB 4TUUA 4BKSA 2BF8B 2ZNVB 3NOBA 4DWFA 4E71A 3N3KB 1YX5B 4IM2A 1JRUA 1E8XA 1WXSA 2L00B 1TBEA 3TCAA 2KNBA 5D7GA 2LUEA 2DZJA 3KUZA 2KQ7A 4LDTB 3L54A 3DVGX 1VCBA 4HCNB 3APDA 2KTFA 1KOTA 3A9JB 4FLHA 4KDIC 4GDLB 2JZZA 3LDZE 4XX5A 1WGGA 3CF6E 4FA6A 1IYFA 3A1QB 1I35A 4K7SA 3L0WB 2ASQA 4AOFA 3APCA 4KZCA 4EZJA 1WE6A 4G0NB 4ASWC 3WAMA 2JUOA 2M1MA 5C1ZA 3PZDA 2KD0A 2O6VD 2RSUA 2KVRA 3CSFA 3NHEB 1E8ZA 2LVQA 2MRPA 3C0RB 2KN5A 2XK5B 5D6JB 2KTRA 1P0RA 1CMXB 2JZ3B 2M0XA 4BKSD 4WQOB 1NDDA 3R7QA 3PRZA 2C7NB 4DBGA 3B0AA 3M3JA 3AXCA 4M8MA 1OTRB 2KDFB 2N7DA 4IC7B 3RUIB 1UELA 1EF5A 2DZIA 3KUDB 1V49A 2IY0B 4RMAA 2V4LA 2L76A 5IAAC 5D2MB 3APFA 2ZCCA 1RAXA 2KHWB 2KLGA 2VRRB 4FJZA 3PREA 1XD3B 1P98A 1TGZB 4BKGA 2J0JA 3B08A 3VHTC 1P3QU 2KXJA 2A5UA 2LXAA 4WAAA 1P9DU 3KYDD 5JH5C 3GOEA 4MSMB 1UZXB 3VTVA 2AWTA 4II3B 3WAOA 1GUAB 2N1VA 3L13A 5KHOA 4BBNC 1YJ1A 3PTFC 2JWZA 3ZO5B 3B1LX 3DOWA 4FHKA 3ZRCA 3DBHI 4TQ0A 3IFWB 2LXCA 4TQ1A 2I1JA 2FNJB 4PS3A 5GMVA 3V6CB 4TV3A 3OLMD 4HDQA 3EFUA 2JRHA 3JSVB 2FCMA 3QX1A 5DCNA 1S3SG 4IM3A 2MCNB 1WZ3A 3SU8X 1WRDB 4W9KA 2XBBC 3A4SC 2RPQA 1WGRA 4EUTA 3A9KB 4AJWA 4ZDVA 1WJNA 2LD9A 4MGYE 4WWPA 3W1SC 4F8CB 4HK2A 2MP2B 1RLFA 2NBWB 2KWVB 4IW0A 2M4NA 4IUMB 2K6DB 4XC2A 4BKTA 1WMHA 1A5RA 2Z0DB 3PRPB 2WWZA 5G55A 5JHAA 4HWIB 2HD5B 3M63B 4W9FA 4A3OA 4LJPB 4LCDE 2KKCA 4A20A 5KHQA 2J0KA 2AEHA 4NQKE 1BT0A 2KANA 3VUYA 4YL8A 1EUVB 5BO4B 3V60A 4G3XB 2M17A 2BWFA 3AU5A 5EDSA 1Z2MA 2G3QB 3T9LA 4K7UA 3LJ3A 4JGHB 3ALBA 1X1MA 2C7MB 4OVUA 2GBMA 3NY5A 2MBBB 2K6QA 2KWUB 2KLCA 1GC7A 3DPDA 4B95A 1UD7A 2C7HA 1WR1A 2A4ZA 3Q3JA 3R7RA 3QWZB 4CYEA 2D10A 2ZNVC 2FCQA 4IWOA 3HM3A 4KVGB 4RM9A 4HXDA 4GOCA 3ZNHB 2D2QA 5J2RA 2JRIB 4J6IA 3RZFA 2D3GA 4MJSA 4MGZE 2DYMA 3DVGY 1V5OA 4JL9A 1OQYA 1GJZA 3PRMB 2O2VA 4DK5A 1FXTB 3ZTCA 4HDOA 2IY1B 1YD8U 1WXVA 2K8BA
chains in the Genus database with same CATH superfamily
3DWGC 2QSDA 2LJIA 4B6WA 1FNVA 2KC2A 1V2YA 2LGSA 1IGCA 2DNFA 2PTLA 5TR5A 2N9PC 2EKEC 4HPPA 4RF0A 1FO4A 2EMTA 4HKZE 2QIEB 4NJ6A 2IYDB 1CJEA 4IWQA 2LVPA 2HTME 4FHJA 3VFKA 3HHMA 4DHJD 1T0RC 4YTNB 3W2DA 2WHIA 4CQNA 4HJKA 1WJ4A 3RT3B 1QZEA 5IO9A 1WJUA 4DXFA 3DVNV 2RR9A 1FMAD 3ZTDA 3Q8BA 1OEYJ 1G6JA 2KMCA 2NMQA 5AZGA 1D3ZA 2D3BA 1LFDA 1EU3A 3SHQA 4W9CA 2QCZA 5JHBA 2JYTA 2CHZA 1L0XB 2GBKA 5TSSA 4J3OD 4ZOHC 3OJ4B 1EWCA 2C5LC 4C80A 4ARIA 1HTQA 2GMIC 3M95A 2WXPA 3OAWA 3ZNZB 1ZXIA 5EE1A 4EZKA 5HKHA 3TBLD 4WWMA 2KX3A 1RFAA 3OG5A 4GLSC 1C3TA 3R3MA 2Z8LA 2PEAA 3CWIA 2MW5A 3UIPB 3A4RA 3DVNU 1UUPA 4C7ZA 1N5XA 3U52E 1ZDXA 1WGDA 4K7WA 2GLSA 3HM6X 2PKOA 1LQBA 2WXIA 4RGMA 2ICIA 3AMZA 2KQ4X 3C8YA 3R66C 3IXSA 2KJHB 2I1KA 5AUKA 1V5TA 3L17A 1F2RI 2DWQA 2SAKA 1WSPA 2BT6A 4KGTA 4BOSC 3N1XC 1E7VA 2QJLA 4KV2A 1QOBA 4HPLB 3ZYYX 3SEBA 3ML9A 1E5WA 5IN7A 2Z59B 4MELA 4HPMB 1MPEA 3VUWA 1OQQA 4HJGE 2MJEA 3HUIA 2BYEA 4GDLA 3RI7C 1FRDA 2D3CA 3Q3MC 1N62A 3ZNID 4HLEA 1ZE3D 4FJVB 3VDZA 1PQSA 2KO3A 2X38A 4PS7A 5EE9A 4JQWC 4OVVA 1OQRA 1XLQA 1WYGA 3RNGC 4ZRIA 1JWSD 1N6ZA 3Q8FA 5BYRA 2KOXA 2DX5B 1OEYA 4ZRJA 2MH7A 2CKHB 2BYVE 2INPE 2BBCA 1N61A 5E6JA 1ZW7A 1HZ5A 3PT2B 1QILA 2CJNA 4C7YA 1D4BA 4NJCA 3DBHB 1IPGA 3Q8CA 2R61A 2NBVB 2BYTA 3P2BA 4M00A 3QA8A 1FNWA 2M8SA 3VUXA 1I4GA 2CHWA 4GXBA 3BVMA 3A9KA 1C4CA 4YSYB 2MA9B 2EMSA 2L1AA 1FCLA 2GRIA 2NR2A 1FXAA 1WXAA 2MP2A 4AWJA 2AL3A 5DPSA 1TJEA 3JW0X 5BMIA 3NZ3A 3U4EG 3WCQA 3GS2A 3H7PB 2WDTB 1KJTA 3GE3C 4KIKB 3MHSD 2KMAA 1SE2A 2JXXA 1Q1OA 2BYFA 2FE8A 1ROEA 3KUCB 1UWMA 1YIWA 2NTTA 4LNKA 3PV1A 1NBFC 1E9MA 1IUEA 2DYBA 2J7QB 3VTWA 3MTNB 2W3SA 3TUOA 1LGRA 1NEKB 2QEJC 2KFKB 5G5GA 4NAWA 1CZPA 4FULA 5MPOA 1STEA 2V3NA 3SR6A 1KF6B 2IBIB 2L32A 4YTPB 1R4MI 5HFYA 3WALA 1WX7A 1T0SC 3RMKC 3ZJTA 1I4HA 2O6VA 3EUB2 5D3IB 2XN9C 2YEPF 4NAWB 1U4AA 1XT9B 3AV8A 2ON8A 4LTUA 1YN5A 2BF8B 1V1PB 3U7ZA 1K52A 4IM2A 1WXSA 3KUZA 3IT6B 2KWDA 3L54A 3P4RB 1XLOA 3A9JB 1WGGA 2J42A 4FA6A 1I35A 3A1QB 1XLPA 4K7SA 2DBYA 3L0WB 2ASQA 1MJDA 4KZCA 4ASWC 3WAMA 2M1MA 1LO5D 1B1ZA 5BMHA 2KVRA 1E8ZA 2LVQA 2RDGA 4YSZB 3C0RB 2XK5B 3B2GA 3ETRA 2JZ3B 1NDDA 1TY2A 1TYGB 3M3JA 3RNFC 1UF0A 2PMVA 2DZIA 1HQRD 2IY0B 2SEBD 3Q3OC 3ZQ4A 1JWMD 1R7SA 2L76A 5IAAC 4YSXB 2ZCCA 1RAXA 3PREA 1XD3B 1TGZB 2J0JA 5EE0A 1HXYD 3BWUD 1P9DU 5JH5C 4MSMB 3VTVA 5BYQA 4II3B 3V3XA 4BBNC 2LMCA 4XE0A 3B1LX 1XCTL 4A6QA 4RNAA 5D3DA 3OLMD 4K3BA 2JXTA 5DCNA 2KACA 2MCNB 4OHJA 4W9KA 2XBBC 2WXNA 1L6VA 4AJWA 5AUIA 1F77A 1WJNA 1E7PB 3W1SC 3Q2AC 4IUMB 4XC2A 3AEBB 1IBXA 2XNAC 1WMHA 3PRPB 5G55A 5FR3A 4LCDE 2KKCA 2KANA 5IKCM 3PZ7A 1EUVB 3NVZA 4YL8A 4G3XB 1MVKA 5EDSA 1Z2MA 1XEEA 1UNSA 2J52A 4JGHB 4OVUA 4S17A 2MBBB 1VDVA 3AECB 3DPDA 2RMMA 3NS1A 1EWYC 2A4ZA 2N9KA 1JQ4A 2V9HA 1B9RA 1K50A 4KKIA 4C00A 1JWUD 2D10A 2RDHA 2ZNVC 4RM9A 1KRHA 1C77A 5HG2A 1KLUD 4J6IA 2Q5WD 4YXDB 4MGZE 4JL9A 3V05A 3SFEB 4DK5A 1QT9A 2ZVOA 2B76B 4XDCA 1FRRA 1UBQA 2BB6A 2LGYA 3RNCC 3URYA 3ZXRA 4M01A 1E90A 4BOZB 1MG4A 4XZ4A 2LWPA 4ANUA 1ZXHA 3KWLA 2BVCA 1C9FA 3RNBC 1WM3A 2GBJA 4HEA1 2V4IB 3NZSA 3W5UB 4R3DA 2BGFA 4IM0A 2GBRA 1TY0A 4HRSA 1JRPA 3ZDMC 3Q69A 2WXMA 3AE9B 1SJHD 1AWDA 2PW9A 3DBLI 1KM7A 2K8CA 2KC1A 4G50A 2ZZPB 3KYCD 3RULA 4YTMB 2IGGA 1VJKA 2WU2B 5AEKB 3ENEA 3BINA 2DZKA 1C1YB 1C76A 3MFGA 1ISNA 3VR9B 1VZ6A 3HIZA 3OJ3A 5HI1A 1R4NI 2L83A 1GNUA 2J53A 4UDUC 4US9A 1ZUD2 5IP4D 2WDRB 2WQYB 2PPHA 3D32A 5L95C 3L08A 2LHDA 3NRZA 1RM6C 3QJZA 4L2YA 3I9V1 2PE9A 3T8MA 1M4VA 4WH4A 4P1BC 2DLBA 3OWEB 4IG7B 3N32A 2KT7A 4JIOU 4MM3A 1J7CA 3LB8C 2LGXA 4EKUA 1TS3A 2R2OA 4LJOB 2HJ1A 3IVFA 2W9NA 2BW2A 2JYEA 1TT5B 3PVLA 1WFYA 3VQIA 3S2AA 3RCZA 4NJ7A 4ANVA 3EECA 3QAQA 2IO1B 3EFCA 2KZRA 2G4SA 2HE7A 1F1HA 4W9IA 1YJJA 1IP9A 4S0RA 4WJPA 2ZPNA 4FJYA 4MGKE 4MDKE 4IKGA 1EF1A 2FAZA 1WH3A 4ANXA 2LRUA 2IGHA 1T3QA 3VH4B 2Y5PA 2BQQA 1WX9A 5BYSA 3N20C 3I3TB 1C4PA 2WXFA 1L2NA 1QOAA 2M56B 4MT5A 4GMVA 4B0EA 2O2VB 1WGHA 3VRBB 3EGRA 1S1QB 3ZRFA 5FR6A 4A3PA 1JALA 3UINB 1WZ0A 3B2FA 4E74A 4RGNA 3L16A 1TTNA 1KH0A 2KAJA 5J18A 1AARA 1V80A 1WF9A 4YT0B 1SE4A 2ZW1A 3H9DA 2JT4B 2KDBA 1GC6A 1C79A 5H8YE 2L05A 4NNJB 3BZDB 1EU4A 4NPNA 3PSEB 1OGWA 4P6VF 4O1NA 5IA7A 2WX0A 2WXKA 4PS8A 3TEWA 3H6NA 3W9CB 3JSVA 1WXMA 1GB4A 1XQQA 3HVDA 2Z0EB 4B9KA 1V81A 4K81A 2BPSA 4DHZE 1E8WA 2KJ6A 4KX6B 2L3ZA 1V9JA 4I6LB 1Q10A 2NBUA 4DXAB 1E7UA 1I42A 4ICUA 1L4ZB 2C9WB 2Y5BB 2BS4B 3U30A 2K0PA 3AE8B 1XXGA 2BS2B 3UF8A 1TZOA 4BZAA 3VVWB 1LM8B 1WI0A 3NVYA 4ZHPA 4WAFA 5LXHA 5DPRA 1NI2A 4KGRA 4FBJB 3TEXA 3K9PB 3ZNGC 1T6BX 1WIAA 2G4DB 1WGYA 1AYFA 3T3NA 4L1BA 1F52A 2QHOA 4MEMA 2NCNA 1QKZA 3R8BA 4LNOA 3VXWA 4KDLB 4TUUA 4BKSA 3NOBA 3N3KB 1JRUA 1TBEA 2KNBA 2KQ7A 4LDTB 3APDA 2KTFA 4KDIC 4GDLB 2JZZA 2L52A 4XX5A 1IYFA 4D2KA 4WURA 4EE2A 2JUOA 3C19A 3U2SC 2KN5A 3ZGZA 1J7AA 5D6JB 2KTRA 1P0RA 1CMXB 2M0XA 3MC9A 2WGSA 3FILA 3AXCA 3BVZA 2AQ2B 3KUDB 1WRIA 2PVOD 2V4LA 3AEFB 2OEDA 2KLGA 2VRRB 3AB5A 1P98A 1ZOYB 1SJED 3Q3NC 2LXAA 1PUTA 3GOEA 1UZXB 1GUAB 5KHOA 1YN3A 1YJ1A 2JWZA 3DOWA 4TQ0A 3IFWB 2LXCA 1EM7A 4TQ1A 2FNJB 4TV3A 1MHHE 1ZPSA 3EFUA 2JRHA 3KWVA 4N58A 3R2TA 1S3SG 4NZLB 2VH1A 4PK1A 3A4SC 2RPQA 1WGRA 2AQ3B 3A9KB 1BMLC 3AM9A 1D5MC 3GP7A 4ZDVA 2LD9A 4MGYE 1KTKA 1T0QC 2MP2B 1RLFA 4C4VA 2K6DB 1JWAD 1A5RA 4A3OA 2HD5B 3M63B 4LJPB 4NQKE 2JU6X 3V60A 3LXFA 5BO4B 2M17A 2G3QB 3T9LA 2C7MB 4RGTA 2GBMA 4RF1A 4M02A 2KWUB 1GC7A 2VZKD 4REZA 1MFWA 4M0WA 4ARCA 3RZFA 4MJSA 3BVGA 3BK2A 1TS5A 3DHIC 4YWGG 1V5OA 1OQYA 1GJZA 1FXTB 3ZTCA 2IY1B 3V61A 2G1EA 1UGJA 3RNAC 1FFUA 1L6UA 3IG3A 2L0FA 2O6VB 2JF5A 4WJQA 3K9OB 1RRBA 4WWOA 2WDQB 4PYUA 2YLMA 2FUHB 4A8XC 1AN8A 2W55A 2NS5A 1XLNA 4BFRA 2MBEA 3N9YC 3QQ8B 2NPTA 4MH8A 4GDKA 1IGDA 1WM2A 3O13A 3MC0B 3QCAA 4RGOS 2WXOA 2N9EB 2NTSA 3RYTA 3PLVA 2MWSB 5C23A 4GGQA 2Y3AA 2CU3A 1VLBA 3WA0A 4C56C 3KH0A 3VTUA 3MP9A 3VR8B 1L4DB 4W9LA 2REXA 3IHPC 4AP4C 3RN9C 2KFJA 1MI0A 4P7IA 2HTHA 1V8CA 1ACCA 2IPKD 3ZJVA 1PGBA 3ONSA 3GZNI 2KWCA 1V86A 3W1YA 2OJRA 2M0AA 4ZRQA 4LNNA 1DOIA 1YX6B 4HCPB 4EFOA 5E6PA 2K8HA 4MGIE 3AEAB 1LXDA 1BXTA 3N1ZC 4GSWA 3KQ4A 1XO3A 2WXJA 2FCSA 1DGJA 4BBNF 2K1FA 1E10A 5E6OA 4IOIE 3AE3B 2IDYA 2DYOA 2MHJA 5CHFA 2YEPB 1WMHB 5AZHA 3VAWA 1IBXB 3N30A 5L83A 5E6NA 1XCQL 4ICVA 2CR5A 1R4MB 1EO6A 3NJTA 1RYJA 2D11A 1K8RB 1I4RA 1PGXA 2UYZB 2VH2A 4JWSC 2HJ8A 3Q8EA 4ANWA 3I57A 1PYWD 2MSED 3QHTA 4H2AA 3WANA 2LVOA 2AYOB 5LLIA 3DBRI 3PGEA 3RD2A 4JX1C 1SXTA 3RFZB 1WYWB 2K5PA 3HK0A 2CJOA 2WU5B 2QDFA 2WX1A 3TMPB 5D94A 3I63C 5FK9C 1P1AA 1VRAB 1ENFA 2L7RA 5J17A 5JZEB 1RWSA 1HZ6A 3PHXB 2IO3B 1J8CA 4OZBA 2ZVNA 3ZDTA 1GOZA 4GU2A 4I6NB 1PGAA 3O65B 5C3JB 1FFVA 1SEBD 1JWBD 1FPYA 1VD2A 3SD5A 2E6XA 4WWNA 3UQBA 2CU1A 4LDTD 4NY0A 3ZIMA 2N7EA 2AQ1B 3TIXA 3IAS1 1JMLA 4L23A 3ZVVA 4MH0E 4F1SA 3DCGA 4AS1A 4BAXA 2ONQA 5CHVC 2WLBA 4TMAB 3QARA 1WWTA 2JPHA 5T8IA 4DDID 3ML8A 2MQJA 2IO0B 3WIMA 2K25A 4RM8A 1SE3A 3EHVA 2W3RA 3JYUA 4FADA 3PHWB 4DHZB 3ZLZA 1L0VB 1YNTE 2INCC 1DYQA 3W5VB 1VZ7A 4USAA 2FIDA 2JVCA 2KK8A 2LRWA 2LZ6A 3FAHA 2TSSA 3IT4B 3ZUNA 2DHZA 1WXQA 1RFKA 3A33B 2RD0A 2YVCA 3AEEB 4IDIA 1K53A 2JY6A 3W1SA 4W9DA 3AI5A 2KJRA 3ABVB 5LXIB 4A9AA 3Q6BA 2DENB 3AE1B 1E8YA 1T0YA 2D5GA 2DAFA 4W9GA 3BYYB 4II2B 2FUG1 2ZPYA 4FN2A 3EC8A 4MM3B 3JVZX 2AX5A 1MHXA 2WNMA 4OZAA 3ZKJC 4G11A 3KLSX 5CX3A 1TS2A 4GB9A 1ZDVA 2PE6B 3P4QB 4KSKC 2BS3B 3CMMB 2WYQA 4IWPA 4A55A 2FCNA 2MBHA 4URKA 1PFDA 2G45B 3KW5B 2WS3B 5AZFA 1D5ZC 2L8JA 3X23A 4I6PA 2C60A 1UGMA 2ZNVB 4E71A 1YX5B 1E8XA 1GB1A 3TCAA 5D7GA 2LUEA 1Y56A 3GE8C 1KOTA 3BYTB 4FLHA 3P63A 4B0MA 3CF6E 4AOFA 1WE6A 4G0NB 1FXIA 5C1ZA 3PZDA 2KD0A 2O6VD 4N59A 1A70A 2G9HD 1DOYA 3DBLB 1ZP0B 3PRZA 4DBGA 3B0AA 4OVZA 1OTRB 3RUIB 2N7DA 3Q14C 2K3UA 3ZJUA 1EF5A 2WXGA 1V49A 1HA5A 3P4SB 5D2MB 3IAM1 3TEYA 4BKGA 3PO0A 3R2IA 1P3QU 1HTOA 2KXJA 4WIPA 1KLGD 4WAAA 3KYDD 1R4NB 3L13A 1K51A 1VR9A 1CQVA 1TKYA 4FHKA 3DBHI 2I1JA 5GMVA 2INNE 5EE3A 3V6CB 4XYCA 4XGAB 3JSVB 3QX1A 3SU8X 1WRDB 3AE2B 2WP9B 3TEZA 4F8CB 1VZ8A 1P7EA 1F2RC 3B9JA 4RCOA 2KWVB 4IW0A 2M4NA 3AE6B 3N1YC 2WWZA 5JHAA 4HWIB 2V3PA 4W9FA 1FM0D 4ACFA 5KHQA 4A20A 2JZPA 2J0KA 1WGKA 1FD6A 2BWFA 1YMHE 1CK1A 2BB5A 4K7UA 3LJ3A 1FEHA 1X1MA 1YJIA 1SIJA 4P16A 2KLCA 4B95A 1D6EC 1UD7A 2C7HA 3R7RA 1I4PA 4CYEA 1TS4A 2LEKA 2E3TA 2WDVB 3AE5B 2PLPA 1C4AA 3HM3A 2D2QA 5J2RA 2LFIA 1SBBB 2D3GA 3EA6A 1J7BA 4JPSA 3PRMB 3AN1A 4HDOA 1YD8U 1WXVA 2K8BA 2IGDA 3L10B 1HEZE 3ZXVA 4EZLA 1J0GA 3V6EB 1SGHA 1Y8RC 4JLCA 3P42A 3DQVA 1Q5WB 3SDLC 4M8NA 2V0GA 4MSQB 4ZRPA 3Q8AA 2GOWA 4XDDA 1H8CA 1QF6A 2FBWB 2OHFA 1V97A 1AW7A 4JWUC 4N9F4 3BIID 4PT5A 1SF0A 2K22A 2D07B 1WR6E 2EKIA 1XF5L 3E56A 1TIFA 4DDGD 2JX5A 2B3AA 1I7HA 2KTRB 2DAJA 2FIFA 1GPXA 3AE4B 3FILB 4XWTA 4KSLC 4LNFA 5CHWA 1Z5SB 4FXCA 4F7ZA 2N9LA 4RH6A 5BMGA 3PS6A 4NQLB 3TSSA 2NVUI 2XEWA 2ZW0A 3UGBB 4DQOC 1WY8A 4EEWA 3FKYA 1SIFA 5GXGB 1SSNA 2MX2A 1I4QA 3BK1A 3AEGB 3NZUA 2J0MA 3LYYA 3H7PA 1E6EB 1JROA 2K39A 4P1CC 3PPAA 4KIKA 2N9XA 1Q0WB 1YN4A 2H88B 2W54A 4TKNA 4CHKA 1N60A 3WAPA 3E9SA 2DZMA 3P1MA 1FNUA 2V3SA 3H8HA 1DOXA 2BWES 1E0ZA 2KMMA 2KFKA 3UIOB 2HDEA 2RDBC 2MEKA 2L0TA 4C4VB 3IBEA 2ACZB 4AUQC 3NVVA 4DXGA 4ZHOA 3U7DA 2QC8A 2K9XA 2N1WA 3PZ8A 2KDMA 3NS8A 1ESFA 2WXLA 2OJWA 2MJ3A 3V62A 3AULA 4E3CA 4MACA 1WE7A 1M94A 1L7YA 3NVWA 2I38A 2WXHA 1KLVA 1PDXA 1YQBA 4LK0M 1V1PA 1JCKB 1QLBB 3AU4A 1I4XA 1FCCC 5CTRC 3RZWC 1HE8A 2GBNA 3TL5A 2ZCBA 4M0WB 1SE9A 2PVGC 2R2QA 2MLBA 2QMTA 4K1RB 3DBSA 1YQ4B 3A9JA 4MJSB 3A1QA 3DDCB 4DHJB 4TSSA 3X0WA 4GN1A 4QAYA 2X8XX 1TZ1A 2UWQA 1N5WA 2XK5A 2J4XA 2LUMA 2KQSA 1J19A 1H4RA 4JE3B 1ZGUB 2IO2B 3AH7A 2MBOA 2V1YA 4W9EA 1N63A 3NG0A 1F9JA 2RGFA 3MJWA 2OOBB 1MG8A 1TKEA 1ZKHA 2NPTB 1F0ZA 4GDKB 3ZW3A 5DPTA 4HVBA 2KDIA 1WX8A 3KVFB 2N4FA 1GAQB 1GG3A 2WXRA 1UBIA 2KX0A 5H92C 3SFDB 1UH6A 3QK0A 4GIVA 3QC8B 4EOYA 5DPWA 2UU7A 4PYZA 3U8ZA 1NYRA 2LGDA 2D3AA 1L5PA 4A90A 3DHHC 4ZYNA 4LNIA 1V1OA 3ECIA 2BTEA 1V6EA 1QQRA 2BKFA 3M62B 1ET6A 2LJ5A 1NENB 2CHXA 1TKGA 2LI5A 4KZ0A 1WJ6A 3VH3B 3HVZA 3NUHB 4OW0A 3BY4B 4AJYB 5G2NA 2CS4A 3MC8A 4RFBA 2ZJDA 4X57B 3UI3A 2I2YA 4Q2JA 3QIJA 3H7SA 3UQAA 2BKRB 1QOFA 2W82A 3VRAB 2MBQA 2MJDA 1P7FA 2JWUA 3CIRB 3FC4A 4ZRKA 3DHGC 1SB3C 4KKJA 4BVUC 2PJHA 2IZVB 3H1UA 2LASA 3CSTA 4N6EB 3PLUA 1BUIC 5G5HA 4OZCA 4WJOA 1YQ3B 1KFYB 2M19A 2GI9A 2PIAA 4W9JA 5IOIA 4WJNA 2KDEB 3Q3FA 2AL6A 3T3OA 3TJPA 4CO7A 4W9HA 4DWFA 1L0YB 1QOGA 4HKQA 2L00B 1UWXA 5JXVA 2IJ0A 2DZJA 1C78A 3L4PA 2LHEA 5C2TB 3DVGX 1VCBA 4HCNB 3LDZE 1NYQA 4EZJA 1OFFA 3APCA 4ITKA 2KVZA 2KN4A 2RSUA 3CSFA 3NHEB 2MRPA 5FKAC 4BKSD 4WQOB 3P4PB 3R7QA 2C7NB 4M8MA 4IC7B 2KDFB 5HHDG 1ET9A 1UELA 4AQ7A 3DWMA 4RMAA 2H89B 3APFA 2KHWB 4FJZA 2QILA 4WQMA 3B08A 1JW9D 3VHTC 2A5UA 5LNK1 1T5XD 2AWTA 3WAOA 2N1VA 4NAMA 3GZNB 2EELA 3PTFC 3ZO5B 4LLGM 2WXQA 3ZRCA 4PS3A 2Y5CA 4HDQA 3GB1A 4K3CA 4KGSA 5I4DA 3MJ5A 2FCMA 3J9CA 1YOVB 4IM3A 1WZ3A 4EUTA 3MHZA 2JSVX 3RPFC 4WWPA 3RNEC 4HK2A 2N0SB 2NBWB 2INDC 4BKTA 2Z0DB 3AE7B 2AEHA 1BT0A 3VUYA 3HRDD 2VZKB 1NI3A 3AU5A 4XWWA 3AEDB 3ALBA 1FIQA 2LGIA 3NY5A 2K6QA 2KYWA 3I5JC 3DBRB 1WR1A 3Q3JA 3QWZB 2GB1A 2RPVA 2FCQA 4IWOA 4KVGB 4HXDA 4GOCA 3ZNHB 2N7JA 1D5XC 4US8A 2JRIB 2DYMA 3DVGY 2JQRB 4ZYSA 4HROA 1NVID 2ZEQA 2O2VA
chains in the Genus database with same CATH topology
1UBQA 3L10B 4EZLA 2LGYA 3IG3A 2L0FA 1J0GA 3V6EB 2O6VB 2JF5A 1SGHA 1Y8RC 4WJQA 4B6WA 3K9OB 2KC2A 1V2YA 4JLCA 1RRBA 4WWOA 4PYUA 3DQVA 1E90A 1Q5WB 3SDLC 4M8NA 2YLMA 5TR5A 4BOZB 2FUHB 2N9PC 4MSQB 2EKEC 4XZ4A 2LWPA 2EMTA 4ANUA 4NJ6A 2GOWA 2NS5A 4BFRA 1H8CA 2MBEA 2IYDB 4IWQA 2LVPA 2NPTA 1WM3A 3QQ8B 4FHJA 4GDKA 3VFKA 3HHMA 2GBJA 4N9F4 4DHJD 3NZSA 2D07B 1WM2A 2BGFA 1WR6E 4IM0A 3QCAA 4HJKA 2GBRA 1WJ4A 3RT3B 1QZEA 2N9EB 1WJUA 3ZDMC 4DDGD 3DVNV 2RR9A 3PLVA 3RYTA 2MWSB 2B3AA 3ZTDA 5C23A 4GGQA 2KTRB 1OEYJ 2DAJA 2FIFA 1G6JA 3DBLI 2KMCA 1KM7A 2K8CA 2KC1A 4G50A 2ZZPB 3KYCD 5CHWA 4KSLC 3WA0A 5AZGA 3RULA 1D3ZA 1LFDA 1Z5SB 3KH0A 3VTUA 3SHQA 4W9CA 4F7ZA 4W9LA 2REXA 3PS6A 5JHBA 3IHPC 5AEKB 4NQLB 2CHZA 2NVUI 3ENEA 4AP4C 2GBKA 3BINA 2KFJA 2DZKA 1C1YB 2XEWA 3UGBB 1ISNA 1WY8A 4EEWA 4P7IA 2HTHA 3HIZA 3OJ3A 1SIFA 3OJ4B 1R4NI 1GNUA 2C5LC 2MX2A 3ONSA 3NZUA 2J0MA 3GZNI 2KWCA 1V86A 2GMIC 3H7PA 3W1YA 3M95A 2OJRA 2K39A 3OAWA 3PPAA 2PPHA 3D32A 1YX6B 4KIKA 5L95C 3L08A 3ZNZB 2N9XA 4HCPB 4EFOA 1Q0WB 3QJZA 4EZKA 5HKHA 5E6PA 3TBLD 2K8HA 2PE9A 4MGIE 3T8MA 1LXDA 4TKNA 4CHKA 2KX3A 1RFAA 3WAPA 2DZMA 1C3TA 3R3MA 4IG7B 3N32A 2V3SA 2PEAA 2BWES 2MW5A 4JIOU 4MM3A 4GSWA 3UIPB 3A4RA 2LGXA 2FCSA 4EKUA 2KFKA 3DVNU 2R2OA 4LJOB 3UIOB 4BBNF 3IVFA 2K1FA 2W9NA 1WGDA 4K7WA 2L0TA 3HM6X 5E6OA 3PVLA 1WFYA 1LQBA 3IBEA 2DYOA 3VAWA 5CHFA 3VQIA 1WMHB 5AZHA 4AUQC 3N30A 3U7DA 5L83A 3S2AA 3RCZA 3R66C 2N1WA 5E6NA 2KJHB 2I1KA 4NJ7A 4ANVA 1V5TA 3EECA 3L17A 3NS8A 2CR5A 4ICVA 1EO6A 3QAQA 2IO1B 2D11A 1K8RB 2KZRA 4BOSC 2G4SA 1E7VA 2HE7A 2UYZB 3AULA 4W9IA 3V62A 4E3CA 1WE7A 1IP9A 1M94A 2HJ8A 4KV2A 1L7YA 4ANWA 4WJPA 2ZPNA 1KLVA 2MSED 3QHTA 1YQBA 4FJYA 4HPLB 4MGKE 3ML9A 1E5WA 3WANA 2LVOA 3AU4A 4MDKE 1EF1A 2FAZA 2AYOB 5CTRC 2Z59B 5LLIA 1WH3A 3DBRI 1HE8A 3PGEA 4MELA 3RZWC 4ANXA 3RD2A 2GBNA 4HPMB 2LRUA 3TL5A 2ZCBA 4M0WB 1SE9A 3VUWA 1WYWB 3VH4B 3HK0A 2R2QA 2WX1A 2MLBA 3TMPB 4K1RB 3DBSA 5D94A 3A9JA 1WX9A 2BYEA 4GDLA 1P1AA 4MJSB 3A1QA 2L7RA 5J17A 5JZEB 3I3TB 3DDCB 4DHJB 3PHXB 1L2NA 2IO3B 4GMVA 3X0WA 2O2VB 4GN1A 3ZNID 1WGHA 1J8CA 4HLEA 2ZVNA 1TZ1A 2UWQA 1S1QB 3ZRFA 5FR6A 2XK5A 4FJVB 3VDZA 1PQSA 4A3PA 2KO3A 4PS7A 1WZ0A 3UINB 3ZDTA 2KQSA 4GU2A 4JQWC 4OVVA 1J19A 4I6NB 4E74A 1H4RA 3O65B 1ZGUB 1VD2A 2IO2B 3SD5A 4WWNA 3UQBA 2MBOA 3L16A 1TTNA 2CU1A 4LDTD 4NY0A 2V1YA 4W9EA 1F9JA 4ZRIA 2RGFA 3MJWA 3ZIMA 2N7EA 5J18A 2OOBB 3TIXA 1MG8A 3ZVVA 2KOXA 1AARA 1V80A 2DX5B 4MH0E 1ZKHA 1WF9A 4F1SA 1OEYA 3DCGA 2NPTB 4ZRJA 4GDKB 3ZW3A 2CKHB 2BYVE 5DPTA 4HVBA 3H9DA 2JT4B 2KDBA 1GC6A 1ZW7A 2KDIA 5CHVC 3PT2B 1WX8A 2L05A 3KVFB 4NNJB 2N4FA 3QARA 1IPGA 4NPNA 3PSEB 1GG3A 2JPHA 1OGWA 1UBIA 5IA7A 2NBVB 2WX0A 3P2BA 2KX0A 3ML8A 4DDID 1UH6A 2MQJA 3QK0A 2IO0B 3QC8B 4GIVA 4EOYA 3QA8A 3WIMA 4PS8A 3H6NA 5DPWA 2M8SA 4PYZA 3U8ZA 3VUXA 2K25A 4RM8A 3JSVA 2ZEQA 1WXMA 2LGDA 3EHVA 2CHWA 4GXBA 3JYUA 4FADA 4ZYNA 3PHWB 4DHZB 3ZLZA 3A9KA 1XQQA 2MA9B 2FIDA 3ECIA 2JVCA 2EMSA 2KK8A 2LRWA 2Z0EB 1V81A 4B9KA 4K81A 2LZ6A 1V6EA 2BPSA 4DHZE 1E8WA 2KJ6A 2NR2A 1WXAA 2BKFA 2MP2A 4AWJA 3M62B 2L3ZA 2AL3A 3ZUNA 1V9JA 2DHZA 4I6LB 5DPSA 2LJ5A 2NBUA 3JW0X 2CHXA 3A33B 2RD0A 2YVCA 4DXAB 2LI5A 4KZ0A 1E7UA 2JY6A 1I42A 4ICUA 3W1SA 4W9DA 1WJ6A 3AI5A 3H7PB 3V61A 2C9WB 3VH3B 2KJRA 2WDTB 1KJTA 5LXIB 4KIKB 3BY4B 2Y5BB 2KMAA 3MHSD 3U30A 2DENB 2JXXA 1Q1OA 2BYFA 4AJYB 5G2NA 2CS4A 1E8YA 3KUCB 1T0YA 3UF8A 1YIWA 2DAFA 4W9GA 3PV1A 3VVWB 1LM8B 1NBFC 1WI0A 2ZJDA 4X57B 4II2B 2ZPYA 3QIJA 3H7SA 2DYBA 3UQAA 2BKRB 2J7QB 3VTWA 4FN2A 3EC8A 3MTNB 2MBQA 4ZRKA 3JVZX 5LXHA 5DPRA 1NI2A 4BVUC 2KFKB 2PJHA 2IZVB 4G11A 3ZKJC 4FBJB 3H1UA 3ZNGC 3K9PB 5CX3A 2LASA 1WIAA 3CSTA 4NAWA 4GB9A 2G4DB 4FULA 3PLUA 2PE6B 4WJOA 4W9JA 2IBIB 4KSKC 1WGYA 2ZVOA 4WJNA 2KDEB 1R4MI 3Q3FA 3WALA 1WX7A 2WYQA 3CMMB 4IWPA 2FCNA 2MBHA 4URKA 2G45B 2QHOA 3KW5B 2AL6A 2O6VA 4MEMA 2NCNA 5AZFA 3TJPA 2L8JA 4NAWB 1U4AA 1XT9B 3VXWA 3X23A 4I6PA 2C60A 1UGMA 4W9HA 4CO7A 4KDLB 4TUUA 4BKSA 2BF8B 2ZNVB 3NOBA 4DWFA 4E71A 3N3KB 1YX5B 4IM2A 1JRUA 1E8XA 1WXSA 2L00B 1TBEA 3TCAA 2KNBA 5D7GA 2LUEA 2DZJA 3KUZA 2KQ7A 4LDTB 3L54A 3DVGX 1VCBA 4HCNB 3APDA 2KTFA 1KOTA 3A9JB 4FLHA 4KDIC 4GDLB 2JZZA 3LDZE 4XX5A 1WGGA 3CF6E 4FA6A 1IYFA 3A1QB 1I35A 4K7SA 3L0WB 2ASQA 4AOFA 3APCA 4KZCA 4EZJA 1WE6A 4G0NB 4ASWC 3WAMA 2JUOA 2M1MA 5C1ZA 3PZDA 2KD0A 2O6VD 2RSUA 2KVRA 3CSFA 3NHEB 1E8ZA 2LVQA 2MRPA 3C0RB 2KN5A 2XK5B 5D6JB 2KTRA 1P0RA 1CMXB 2JZ3B 2M0XA 4BKSD 4WQOB 1NDDA 3R7QA 3PRZA 2C7NB 4DBGA 3B0AA 3M3JA 3AXCA 4M8MA 1OTRB 2KDFB 2N7DA 4IC7B 3RUIB 1UELA 1EF5A 2DZIA 3KUDB 1V49A 2IY0B 4RMAA 2V4LA 2L76A 5IAAC 5D2MB 3APFA 2ZCCA 1RAXA 2KHWB 2KLGA 2VRRB 4FJZA 3PREA 1XD3B 1P98A 1TGZB 4BKGA 2J0JA 3B08A 3VHTC 1P3QU 2KXJA 2A5UA 2LXAA 4WAAA 1P9DU 3KYDD 5JH5C 3GOEA 4MSMB 1UZXB 3VTVA 2AWTA 4II3B 3WAOA 1GUAB 2N1VA 3L13A 5KHOA 4BBNC 1YJ1A 3PTFC 2JWZA 3ZO5B 3B1LX 3DOWA 4FHKA 3ZRCA 3DBHI 4TQ0A 3IFWB 2LXCA 4TQ1A 2I1JA 2FNJB 4PS3A 5GMVA 3V6CB 4TV3A 3OLMD 4HDQA 3EFUA 2JRHA 3JSVB 2FCMA 3QX1A 5DCNA 1S3SG 4IM3A 2MCNB 1WZ3A 3SU8X 1WRDB 4W9KA 2XBBC 3A4SC 2RPQA 1WGRA 4EUTA 3A9KB 4AJWA 4ZDVA 1WJNA 2LD9A 4MGYE 4WWPA 3W1SC 4F8CB 4HK2A 2MP2B 1RLFA 2NBWB 2KWVB 4IW0A 2M4NA 4IUMB 2K6DB 4XC2A 4BKTA 1WMHA 1A5RA 2Z0DB 3PRPB 2WWZA 5G55A 5JHAA 4HWIB 2HD5B 3M63B 4W9FA 4A3OA 4LJPB 4LCDE 2KKCA 4A20A 5KHQA 2J0KA 2AEHA 4NQKE 1BT0A 2KANA 3VUYA 4YL8A 1EUVB 5BO4B 3V60A 4G3XB 2M17A 2BWFA 3AU5A 5EDSA 1Z2MA 2G3QB 3T9LA 4K7UA 3LJ3A 4JGHB 3ALBA 1X1MA 2C7MB 4OVUA 2GBMA 3NY5A 2MBBB 2K6QA 2KWUB 2KLCA 1GC7A 3DPDA 4B95A 1UD7A 2C7HA 1WR1A 2A4ZA 3Q3JA 3R7RA 3QWZB 4CYEA 2D10A 2ZNVC 2FCQA 4IWOA 3HM3A 4KVGB 4RM9A 4HXDA 4GOCA 3ZNHB 2D2QA 5J2RA 2JRIB 4J6IA 3RZFA 2D3GA 4MJSA 4MGZE 2DYMA 3DVGY 1V5OA 4JL9A 1OQYA 1GJZA 3PRMB 2O2VA 4DK5A 1FXTB 3ZTCA 4HDOA 2IY1B 1YD8U 1WXVA 2K8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UBQ A;  3L10 B;  4EZL A;  2LGY A;  3IG3 A;  2L0F A;  1J0G A;  3V6E B;  2O6V B;  2JF5 A;  1SGH A;  1Y8R C;  4WJQ A;  4B6W A;  3K9O B;  2KC2 A;  1V2Y A;  4JLC A;  1RRB A;  4WWO A;  4PYU A;  3DQV A;  1E90 A;  1Q5W B;  3SDL C;  4M8N A;  2YLM A;  5TR5 A;  4BOZ B;  2FUH B;  2N9P C;  4MSQ B;  2EKE C;  4XZ4 A;  2LWP A;  2EMT A;  4ANU A;  4NJ6 A;  2GOW A;  2NS5 A;  4BFR A;  1H8C A;  2MBE A;  2IYD B;  4IWQ A;  2LVP A;  2NPT A;  1WM3 A;  3QQ8 B;  4FHJ A;  4GDK A;  3VFK A;  3HHM A;  2GBJ A;  4N9F 4;  4DHJ D;  3NZS A;  2D07 B;  1WM2 A;  2BGF A;  1WR6 E;  4IM0 A;  3QCA A;  4HJK A;  2GBR A;  1WJ4 A;  3RT3 B;  1QZE A;  2N9E B;  1WJU A;  3ZDM C;  4DDG D;  3DVN V;  2RR9 A;  3PLV A;  3RYT A;  2MWS B;  2B3A A;  3ZTD A;  5C23 A;  4GGQ A;  2KTR B;  1OEY J;  2DAJ A;  2FIF A;  1G6J A;  3DBL I;  2KMC A;  1KM7 A;  2K8C A;  2KC1 A;  4G50 A;  2ZZP B;  3KYC D;  5CHW A;  4KSL C;  3WA0 A;  5AZG A;  3RUL A;  1D3Z A;  1LFD A;  1Z5S B;  3KH0 A;  3VTU A;  3SHQ A;  4W9C A;  4F7Z A;  4W9L A;  2REX A;  3PS6 A;  5JHB A;  3IHP C;  5AEK B;  4NQL B;  2CHZ A;  2NVU I;  3ENE A;  4AP4 C;  2GBK A;  3BIN A;  2KFJ A;  2DZK A;  1C1Y B;  2XEW A;  3UGB B;  1ISN A;  1WY8 A;  4EEW A;  4P7I A;  2HTH A;  3HIZ A;  3OJ3 A;  1SIF A;  3OJ4 B;  1R4N I;  1GNU A;  2C5L C;  2MX2 A;  3ONS A;  3NZU A;  2J0M A;  3GZN I;  2KWC A;  1V86 A;  2GMI C;  3H7P A;  3W1Y A;  3M95 A;  2OJR A;  2K39 A;  3OAW A;  3PPA A;  2PPH A;  3D32 A;  1YX6 B;  4KIK A;  5L95 C;  3L08 A;  3ZNZ B;  2N9X A;  4HCP B;  4EFO A;  1Q0W B;  3QJZ A;  4EZK A;  5HKH A;  5E6P A;  3TBL D;  2K8H A;  2PE9 A;  4MGI E;  3T8M A;  1LXD A;  4TKN A;  4CHK A;  2KX3 A;  1RFA A;  3WAP A;  2DZM A;  1C3T A;  3R3M A;  4IG7 B;  3N32 A;  2V3S A;  2PEA A;  2BWE S;  2MW5 A;  4JIO U;  4MM3 A;  4GSW A;  3UIP B;  3A4R A;  2LGX A;  2FCS A;  4EKU A;  2KFK A;  3DVN U;  2R2O A;  4LJO B;  3UIO B;  4BBN F;  3IVF A;  2K1F A;  2W9N A;  1WGD A;  4K7W A;  2L0T A;  3HM6 X;  5E6O A;  3PVL A;  1WFY A;  1LQB A;  3IBE A;  2DYO A;  3VAW A;  5CHF A;  3VQI A;  1WMH B;  5AZH A;  4AUQ C;  3N30 A;  3U7D A;  5L83 A;  3S2A A;  3RCZ A;  3R66 C;  2N1W A;  5E6N A;  2KJH B;  2I1K A;  4NJ7 A;  4ANV A;  1V5T A;  3EEC A;  3L17 A;  3NS8 A;  2CR5 A;  4ICV A;  1EO6 A;  3QAQ A;  2IO1 B;  2D11 A;  1K8R B;  2KZR A;  4BOS C;  2G4S A;  1E7V A;  2HE7 A;  2UYZ B;  3AUL A;  4W9I A;  3V62 A;  4E3C A;  1WE7 A;  1IP9 A;  1M94 A;  2HJ8 A;  4KV2 A;  1L7Y A;  4ANW A;  4WJP A;  2ZPN A;  1KLV A;  2MSE D;  3QHT A;  1YQB A;  4FJY A;  4HPL B;  4MGK E;  3ML9 A;  1E5W A;  3WAN A;  2LVO A;  3AU4 A;  4MDK E;  1EF1 A;  2FAZ A;  2AYO B;  5CTR C;  2Z59 B;  5LLI A;  1WH3 A;  3DBR I;  1HE8 A;  3PGE A;  4MEL A;  3RZW C;  4ANX A;  3RD2 A;  2GBN A;  4HPM B;  2LRU A;  3TL5 A;  2ZCB A;  4M0W B;  1SE9 A;  3VUW A;  1WYW B;  3VH4 B;  3HK0 A;  2R2Q A;  2WX1 A;  2MLB A;  3TMP B;  4K1R B;  3DBS A;  5D94 A;  3A9J A;  1WX9 A;  2BYE A;  4GDL A;  1P1A A;  4MJS B;  3A1Q A;  2L7R A;  5J17 A;  5JZE B;  3I3T B;  3DDC B;  4DHJ B;  3PHX B;  1L2N A;  2IO3 B;  4GMV A;  3X0W A;  2O2V B;  4GN1 A;  3ZNI D;  1WGH A;  1J8C A;  4HLE A;  2ZVN A;  1TZ1 A;  2UWQ A;  1S1Q B;  3ZRF A;  5FR6 A;  2XK5 A;  4FJV B;  3VDZ A;  1PQS A;  4A3P A;  2KO3 A;  4PS7 A;  1WZ0 A;  3UIN B;  3ZDT A;  2KQS A;  4GU2 A;  4JQW C;  4OVV A;  1J19 A;  4I6N B;  4E74 A;  1H4R A;  3O65 B;  1ZGU B;  1VD2 A;  2IO2 B;  3SD5 A;  4WWN A;  3UQB A;  2MBO A;  3L16 A;  1TTN A;  2CU1 A;  4LDT D;  4NY0 A;  2V1Y A;  4W9E A;  1F9J A;  4ZRI A;  2RGF A;  3MJW A;  3ZIM A;  2N7E A;  5J18 A;  2OOB B;  3TIX A;  1MG8 A;  3ZVV A;  2KOX A;  1AAR A;  1V80 A;  2DX5 B;  4MH0 E;  1ZKH A;  1WF9 A;  4F1S A;  1OEY A;  3DCG A;  2NPT B;  4ZRJ A;  4GDK B;  3ZW3 A;  2CKH B;  2BYV E;  5DPT A;  4HVB A;  3H9D A;  2JT4 B;  2KDB A;  1GC6 A;  1ZW7 A;  2KDI A;  5CHV C;  3PT2 B;  1WX8 A;  2L05 A;  3KVF B;  4NNJ B;  2N4F A;  3QAR A;  1IPG A;  4NPN A;  3PSE B;  1GG3 A;  2JPH A;  1OGW A;  1UBI A;  5IA7 A;  2NBV B;  2WX0 A;  3P2B A;  2KX0 A;  3ML8 A;  4DDI D;  1UH6 A;  2MQJ A;  3QK0 A;  2IO0 B;  3QC8 B;  4GIV A;  4EOY A;  3QA8 A;  3WIM A;  4PS8 A;  3H6N A;  5DPW A;  2M8S A;  4PYZ A;  3U8Z A;  3VUX A;  2K25 A;  4RM8 A;  3JSV A;  2ZEQ A;  1WXM A;  2LGD A;  3EHV A;  2CHW A;  4GXB A;  3JYU A;  4FAD A;  4ZYN A;  3PHW B;  4DHZ B;  3ZLZ A;  3A9K A;  1XQQ A;  2MA9 B;  2FID A;  3ECI A;  2JVC A;  2EMS A;  2KK8 A;  2LRW A;  2Z0E B;  1V81 A;  4B9K A;  4K81 A;  2LZ6 A;  1V6E A;  2BPS A;  4DHZ E;  1E8W A;  2KJ6 A;  2NR2 A;  1WXA A;  2BKF A;  2MP2 A;  4AWJ A;  3M62 B;  2L3Z A;  2AL3 A;  3ZUN A;  1V9J A;  2DHZ A;  4I6L B;  5DPS A;  2LJ5 A;  2NBU A;  3JW0 X;  2CHX A;  3A33 B;  2RD0 A;  2YVC A;  4DXA B;  2LI5 A;  4KZ0 A;  1E7U A;  2JY6 A;  1I42 A;  4ICU A;  3W1S A;  4W9D A;  1WJ6 A;  3AI5 A;  3H7P B;  3V61 A;  2C9W B;  3VH3 B;  2KJR A;  2WDT B;  1KJT A;  5LXI B;  4KIK B;  3BY4 B;  2Y5B B;  2KMA A;  3MHS D;  3U30 A;  2DEN B;  2JXX A;  1Q1O A;  2BYF A;  4AJY B;  5G2N A;  2CS4 A;  1E8Y A;  3KUC B;  1T0Y A;  3UF8 A;  1YIW A;  2DAF A;  4W9G A;  3PV1 A;  3VVW B;  1LM8 B;  1NBF C;  1WI0 A;  2ZJD A;  4X57 B;  4II2 B;  2ZPY A;  3QIJ A;  3H7S A;  2DYB A;  3UQA A;  2BKR B;  2J7Q B;  3VTW A;  4FN2 A;  3EC8 A;  3MTN B;  2MBQ A;  4ZRK A;  3JVZ X;  5LXH A;  5DPR A;  1NI2 A;  4BVU C;  2KFK B;  2PJH A;  2IZV B;  4G11 A;  3ZKJ C;  4FBJ B;  3H1U A;  3ZNG C;  3K9P B;  5CX3 A;  2LAS A;  1WIA A;  3CST A;  4NAW A;  4GB9 A;  2G4D B;  4FUL A;  3PLU A;  2PE6 B;  4WJO A;  4W9J A;  2IBI B;  4KSK C;  1WGY A;  2ZVO A;  4WJN A;  2KDE B;  1R4M I;  3Q3F A;  3WAL A;  1WX7 A;  2WYQ A;  3CMM B;  4IWP A;  2FCN A;  2MBH A;  4URK A;  2G45 B;  2QHO A;  3KW5 B;  2AL6 A;  2O6V A;  4MEM A;  2NCN A;  5AZF A;  3TJP A;  2L8J A;  4NAW B;  1U4A A;  1XT9 B;  3VXW A;  3X23 A;  4I6P A;  2C60 A;  1UGM A;  4W9H A;  4CO7 A;  4KDL B;  4TUU A;  4BKS A;  2BF8 B;  2ZNV B;  3NOB A;  4DWF A;  4E71 A;  3N3K B;  1YX5 B;  4IM2 A;  1JRU A;  1E8X A;  1WXS A;  2L00 B;  1TBE A;  3TCA A;  2KNB A;  5D7G A;  2LUE A;  2DZJ A;  3KUZ A;  2KQ7 A;  4LDT B;  3L54 A;  3DVG X;  1VCB A;  4HCN B;  3APD A;  2KTF A;  1KOT A;  3A9J B;  4FLH A;  4KDI C;  4GDL B;  2JZZ A;  3LDZ E;  4XX5 A;  1WGG A;  3CF6 E;  4FA6 A;  1IYF A;  3A1Q B;  1I35 A;  4K7S A;  3L0W B;  2ASQ A;  4AOF A;  3APC A;  4KZC A;  4EZJ A;  1WE6 A;  4G0N B;  4ASW C;  3WAM A;  2JUO A;  2M1M A;  5C1Z A;  3PZD A;  2KD0 A;  2O6V D;  2RSU A;  2KVR A;  3CSF A;  3NHE B;  1E8Z A;  2LVQ A;  2MRP A;  3C0R B;  2KN5 A;  2XK5 B;  5D6J B;  2KTR A;  1P0R A;  1CMX B;  2JZ3 B;  2M0X A;  4BKS D;  4WQO B;  1NDD A;  3R7Q A;  3PRZ A;  2C7N B;  4DBG A;  3B0A A;  3M3J A;  3AXC A;  4M8M A;  1OTR B;  2KDF B;  2N7D A;  4IC7 B;  3RUI B;  1UEL A;  1EF5 A;  2DZI A;  3KUD B;  1V49 A;  2IY0 B;  4RMA A;  2V4L A;  2L76 A;  5IAA C;  5D2M B;  3APF A;  2ZCC A;  1RAX A;  2KHW B;  2KLG A;  2VRR B;  4FJZ A;  3PRE A;  1XD3 B;  1P98 A;  1TGZ B;  4BKG A;  2J0J A;  3B08 A;  3VHT C;  1P3Q U;  2KXJ A;  2A5U A;  2LXA A;  4WAA A;  1P9D U;  3KYD D;  5JH5 C;  3GOE A;  4MSM B;  1UZX B;  3VTV A;  2AWT A;  4II3 B;  3WAO A;  1GUA B;  2N1V A;  3L13 A;  5KHO A;  4BBN C;  1YJ1 A;  3PTF C;  2JWZ A;  3ZO5 B;  3B1L X;  3DOW A;  4FHK A;  3ZRC A;  3DBH I;  4TQ0 A;  3IFW B;  2LXC A;  4TQ1 A;  2I1J A;  2FNJ B;  4PS3 A;  5GMV A;  3V6C B;  4TV3 A;  3OLM D;  4HDQ A;  3EFU A;  2JRH A;  3JSV B;  2FCM A;  3QX1 A;  5DCN A;  1S3S G;  4IM3 A;  2MCN B;  1WZ3 A;  3SU8 X;  1WRD B;  4W9K A;  2XBB C;  3A4S C;  2RPQ A;  1WGR A;  4EUT A;  3A9K B;  4AJW A;  4ZDV A;  1WJN A;  2LD9 A;  4MGY E;  4WWP A;  3W1S C;  4F8C B;  4HK2 A;  2MP2 B;  1RLF A;  2NBW B;  2KWV B;  4IW0 A;  2M4N A;  4IUM B;  2K6D B;  4XC2 A;  4BKT A;  1WMH A;  1A5R A;  2Z0D B;  3PRP B;  2WWZ A;  5G55 A;  5JHA A;  4HWI B;  2HD5 B;  3M63 B;  4W9F A;  4A3O A;  4LJP B;  4LCD E;  2KKC A;  4A20 A;  5KHQ A;  2J0K A;  2AEH A;  4NQK E;  1BT0 A;  2KAN A;  3VUY A;  4YL8 A;  1EUV B;  5BO4 B;  3V60 A;  4G3X B;  2M17 A;  2BWF A;  3AU5 A;  5EDS A;  1Z2M A;  2G3Q B;  3T9L A;  4K7U A;  3LJ3 A;  4JGH B;  3ALB A;  1X1M A;  2C7M B;  4OVU A;  2GBM A;  3NY5 A;  2MBB B;  2K6Q A;  2KWU B;  2KLC A;  1GC7 A;  3DPD A;  4B95 A;  1UD7 A;  2C7H A;  1WR1 A;  2A4Z A;  3Q3J A;  3R7R A;  3QWZ B;  4CYE A;  2D10 A;  2ZNV C;  2FCQ A;  4IWO A;  3HM3 A;  4KVG B;  4RM9 A;  4HXD A;  4GOC A;  3ZNH B;  2D2Q A;  5J2R A;  2JRI B;  4J6I A;  3RZF A;  2D3G A;  4MJS A;  4MGZ E;  2DYM A;  3DVG Y;  1V5O A;  4JL9 A;  1OQY A;  1GJZ A;  3PRM B;  2O2V A;  4DK5 A;  1FXT B;  3ZTC A;  4HDO A;  2IY1 B;  1YD8 U;  1WXV A;  2K8B A; 
#chains in the Genus database with same CATH topology
 3DWG C;  2QSD A;  2LJI A;  4B6W A;  1FNV A;  2KC2 A;  1V2Y A;  2LGS A;  1IGC A;  2DNF A;  2PTL A;  5TR5 A;  2N9P C;  2EKE C;  4HPP A;  4RF0 A;  1FO4 A;  2EMT A;  4HKZ E;  2QIE B;  4NJ6 A;  2IYD B;  1CJE A;  4IWQ A;  2LVP A;  2HTM E;  4FHJ A;  3VFK A;  3HHM A;  4DHJ D;  1T0R C;  4YTN B;  3W2D A;  2WHI A;  4CQN A;  4HJK A;  1WJ4 A;  3RT3 B;  1QZE A;  5IO9 A;  1WJU A;  4DXF A;  3DVN V;  2RR9 A;  1FMA D;  3ZTD A;  3Q8B A;  1OEY J;  1G6J A;  2KMC A;  2NMQ A;  5AZG A;  1D3Z A;  2D3B A;  1LFD A;  1EU3 A;  3SHQ A;  4W9C A;  2QCZ A;  5JHB A;  2JYT A;  2CHZ A;  1L0X B;  2GBK A;  5TSS A;  4J3O D;  4ZOH C;  3OJ4 B;  1EWC A;  2C5L C;  4C80 A;  4ARI A;  1HTQ A;  2GMI C;  3M95 A;  2WXP A;  3OAW A;  3ZNZ B;  1ZXI A;  5EE1 A;  4EZK A;  5HKH A;  3TBL D;  4WWM A;  2KX3 A;  1RFA A;  3OG5 A;  4GLS C;  1C3T A;  3R3M A;  2Z8L A;  2PEA A;  3CWI A;  2MW5 A;  3UIP B;  3A4R A;  3DVN U;  1UUP A;  4C7Z A;  1N5X A;  3U52 E;  1ZDX A;  1WGD A;  4K7W A;  2GLS A;  3HM6 X;  2PKO A;  1LQB A;  2WXI A;  4RGM A;  2ICI A;  3AMZ A;  2KQ4 X;  3C8Y A;  3R66 C;  3IXS A;  2KJH B;  2I1K A;  5AUK A;  1V5T A;  3L17 A;  1F2R I;  2DWQ A;  2SAK A;  1WSP A;  2BT6 A;  4KGT A;  4BOS C;  3N1X C;  1E7V A;  2QJL A;  4KV2 A;  1QOB A;  4HPL B;  3ZYY X;  3SEB A;  3ML9 A;  1E5W A;  5IN7 A;  2Z59 B;  4MEL A;  4HPM B;  1MPE A;  3VUW A;  1OQQ A;  4HJG E;  2MJE A;  3HUI A;  2BYE A;  4GDL A;  3RI7 C;  1FRD A;  2D3C A;  3Q3M C;  1N62 A;  3ZNI D;  4HLE A;  1ZE3 D;  4FJV B;  3VDZ A;  1PQS A;  2KO3 A;  2X38 A;  4PS7 A;  5EE9 A;  4JQW C;  4OVV A;  1OQR A;  1XLQ A;  1WYG A;  3RNG C;  4ZRI A;  1JWS D;  1N6Z A;  3Q8F A;  5BYR A;  2KOX A;  2DX5 B;  1OEY A;  4ZRJ A;  2MH7 A;  2CKH B;  2BYV E;  2INP E;  2BBC A;  1N61 A;  5E6J A;  1ZW7 A;  1HZ5 A;  3PT2 B;  1QIL A;  2CJN A;  4C7Y A;  1D4B A;  4NJC A;  3DBH B;  1IPG A;  3Q8C A;  2R61 A;  2NBV B;  2BYT A;  3P2B A;  4M00 A;  3QA8 A;  1FNW A;  2M8S A;  3VUX A;  1I4G A;  2CHW A;  4GXB A;  3BVM A;  3A9K A;  1C4C A;  4YSY B;  2MA9 B;  2EMS A;  2L1A A;  1FCL A;  2GRI A;  2NR2 A;  1FXA A;  1WXA A;  2MP2 A;  4AWJ A;  2AL3 A;  5DPS A;  1TJE A;  3JW0 X;  5BMI A;  3NZ3 A;  3U4E G;  3WCQ A;  3GS2 A;  3H7P B;  2WDT B;  1KJT A;  3GE3 C;  4KIK B;  3MHS D;  2KMA A;  1SE2 A;  2JXX A;  1Q1O A;  2BYF A;  2FE8 A;  1ROE A;  3KUC B;  1UWM A;  1YIW A;  2NTT A;  4LNK A;  3PV1 A;  1NBF C;  1E9M A;  1IUE A;  2DYB A;  2J7Q B;  3VTW A;  3MTN B;  2W3S A;  3TUO A;  1LGR A;  1NEK B;  2QEJ C;  2KFK B;  5G5G A;  4NAW A;  1CZP A;  4FUL A;  5MPO A;  1STE A;  2V3N A;  3SR6 A;  1KF6 B;  2IBI B;  2L32 A;  4YTP B;  1R4M I;  5HFY A;  3WAL A;  1WX7 A;  1T0S C;  3RMK C;  3ZJT A;  1I4H A;  2O6V A;  3EUB 2;  5D3I B;  2XN9 C;  2YEP F;  4NAW B;  1U4A A;  1XT9 B;  3AV8 A;  2ON8 A;  4LTU A;  1YN5 A;  2BF8 B;  1V1P B;  3U7Z A;  1K52 A;  4IM2 A;  1WXS A;  3KUZ A;  3IT6 B;  2KWD A;  3L54 A;  3P4R B;  1XLO A;  3A9J B;  1WGG A;  2J42 A;  4FA6 A;  1I35 A;  3A1Q B;  1XLP A;  4K7S A;  2DBY A;  3L0W B;  2ASQ A;  1MJD A;  4KZC A;  4ASW C;  3WAM A;  2M1M A;  1LO5 D;  1B1Z A;  5BMH A;  2KVR A;  1E8Z A;  2LVQ A;  2RDG A;  4YSZ B;  3C0R B;  2XK5 B;  3B2G A;  3ETR A;  2JZ3 B;  1NDD A;  1TY2 A;  1TYG B;  3M3J A;  3RNF C;  1UF0 A;  2PMV A;  2DZI A;  1HQR D;  2IY0 B;  2SEB D;  3Q3O C;  3ZQ4 A;  1JWM D;  1R7S A;  2L76 A;  5IAA C;  4YSX B;  2ZCC A;  1RAX A;  3PRE A;  1XD3 B;  1TGZ B;  2J0J A;  5EE0 A;  1HXY D;  3BWU D;  1P9D U;  5JH5 C;  4MSM B;  3VTV A;  5BYQ A;  4II3 B;  3V3X A;  4BBN C;  2LMC A;  4XE0 A;  3B1L X;  1XCT L;  4A6Q A;  4RNA A;  5D3D A;  3OLM D;  4K3B A;  2JXT A;  5DCN A;  2KAC A;  2MCN B;  4OHJ A;  4W9K A;  2XBB C;  2WXN A;  1L6V A;  4AJW A;  5AUI A;  1F77 A;  1WJN A;  1E7P B;  3W1S C;  3Q2A C;  4IUM B;  4XC2 A;  3AEB B;  1IBX A;  2XNA C;  1WMH A;  3PRP B;  5G55 A;  5FR3 A;  4LCD E;  2KKC A;  2KAN A;  5IKC M;  3PZ7 A;  1EUV B;  3NVZ A;  4YL8 A;  4G3X B;  1MVK A;  5EDS A;  1Z2M A;  1XEE A;  1UNS A;  2J52 A;  4JGH B;  4OVU A;  4S17 A;  2MBB B;  1VDV A;  3AEC B;  3DPD A;  2RMM A;  3NS1 A;  1EWY C;  2A4Z A;  2N9K A;  1JQ4 A;  2V9H A;  1B9R A;  1K50 A;  4KKI A;  4C00 A;  1JWU D;  2D10 A;  2RDH A;  2ZNV C;  4RM9 A;  1KRH A;  1C77 A;  5HG2 A;  1KLU D;  4J6I A;  2Q5W D;  4YXD B;  4MGZ E;  4JL9 A;  3V05 A;  3SFE B;  4DK5 A;  1QT9 A;  2ZVO A;  2B76 B;  4XDC A;  1FRR A;  1UBQ A;  2BB6 A;  2LGY A;  3RNC C;  3URY A;  3ZXR A;  4M01 A;  1E90 A;  4BOZ B;  1MG4 A;  4XZ4 A;  2LWP A;  4ANU A;  1ZXH A;  3KWL A;  2BVC A;  1C9F A;  3RNB C;  1WM3 A;  2GBJ A;  4HEA 1;  2V4I B;  3NZS A;  3W5U B;  4R3D A;  2BGF A;  4IM0 A;  2GBR A;  1TY0 A;  4HRS A;  1JRP A;  3ZDM C;  3Q69 A;  2WXM A;  3AE9 B;  1SJH D;  1AWD A;  2PW9 A;  3DBL I;  1KM7 A;  2K8C A;  2KC1 A;  4G50 A;  2ZZP B;  3KYC D;  3RUL A;  4YTM B;  2IGG A;  1VJK A;  2WU2 B;  5AEK B;  3ENE A;  3BIN A;  2DZK A;  1C1Y B;  1C76 A;  3MFG A;  1ISN A;  3VR9 B;  1VZ6 A;  3HIZ A;  3OJ3 A;  5HI1 A;  1R4N I;  2L83 A;  1GNU A;  2J53 A;  4UDU C;  4US9 A;  1ZUD 2;  5IP4 D;  2WDR B;  2WQY B;  2PPH A;  3D32 A;  5L95 C;  3L08 A;  2LHD A;  3NRZ A;  1RM6 C;  3QJZ A;  4L2Y A;  3I9V 1;  2PE9 A;  3T8M A;  1M4V A;  4WH4 A;  4P1B C;  2DLB A;  3OWE B;  4IG7 B;  3N32 A;  2KT7 A;  4JIO U;  4MM3 A;  1J7C A;  3LB8 C;  2LGX A;  4EKU A;  1TS3 A;  2R2O A;  4LJO B;  2HJ1 A;  3IVF A;  2W9N A;  2BW2 A;  2JYE A;  1TT5 B;  3PVL A;  1WFY A;  3VQI A;  3S2A A;  3RCZ A;  4NJ7 A;  4ANV A;  3EEC A;  3QAQ A;  2IO1 B;  3EFC A;  2KZR A;  2G4S A;  2HE7 A;  1F1H A;  4W9I A;  1YJJ A;  1IP9 A;  4S0R A;  4WJP A;  2ZPN A;  4FJY A;  4MGK E;  4MDK E;  4IKG A;  1EF1 A;  2FAZ A;  1WH3 A;  4ANX A;  2LRU A;  2IGH A;  1T3Q A;  3VH4 B;  2Y5P A;  2BQQ A;  1WX9 A;  5BYS A;  3N20 C;  3I3T B;  1C4P A;  2WXF A;  1L2N A;  1QOA A;  2M56 B;  4MT5 A;  4GMV A;  4B0E A;  2O2V B;  1WGH A;  3VRB B;  3EGR A;  1S1Q B;  3ZRF A;  5FR6 A;  4A3P A;  1JAL A;  3UIN B;  1WZ0 A;  3B2F A;  4E74 A;  4RGN A;  3L16 A;  1TTN A;  1KH0 A;  2KAJ A;  5J18 A;  1AAR A;  1V80 A;  1WF9 A;  4YT0 B;  1SE4 A;  2ZW1 A;  3H9D A;  2JT4 B;  2KDB A;  1GC6 A;  1C79 A;  5H8Y E;  2L05 A;  4NNJ B;  3BZD B;  1EU4 A;  4NPN A;  3PSE B;  1OGW A;  4P6V F;  4O1N A;  5IA7 A;  2WX0 A;  2WXK A;  4PS8 A;  3TEW A;  3H6N A;  3W9C B;  3JSV A;  1WXM A;  1GB4 A;  1XQQ A;  3HVD A;  2Z0E B;  4B9K A;  1V81 A;  4K81 A;  2BPS A;  4DHZ E;  1E8W A;  2KJ6 A;  4KX6 B;  2L3Z A;  1V9J A;  4I6L B;  1Q10 A;  2NBU A;  4DXA B;  1E7U A;  1I42 A;  4ICU A;  1L4Z B;  2C9W B;  2Y5B B;  2BS4 B;  3U30 A;  2K0P A;  3AE8 B;  1XXG A;  2BS2 B;  3UF8 A;  1TZO A;  4BZA A;  3VVW B;  1LM8 B;  1WI0 A;  3NVY A;  4ZHP A;  4WAF A;  5LXH A;  5DPR A;  1NI2 A;  4KGR A;  4FBJ B;  3TEX A;  3K9P B;  3ZNG C;  1T6B X;  1WIA A;  2G4D B;  1WGY A;  1AYF A;  3T3N A;  4L1B A;  1F52 A;  2QHO A;  4MEM A;  2NCN A;  1QKZ A;  3R8B A;  4LNO A;  3VXW A;  4KDL B;  4TUU A;  4BKS A;  3NOB A;  3N3K B;  1JRU A;  1TBE A;  2KNB A;  2KQ7 A;  4LDT B;  3APD A;  2KTF A;  4KDI C;  4GDL B;  2JZZ A;  2L52 A;  4XX5 A;  1IYF A;  4D2K A;  4WUR A;  4EE2 A;  2JUO A;  3C19 A;  3U2S C;  2KN5 A;  3ZGZ A;  1J7A A;  5D6J B;  2KTR A;  1P0R A;  1CMX B;  2M0X A;  3MC9 A;  2WGS A;  3FIL A;  3AXC A;  3BVZ A;  2AQ2 B;  3KUD B;  1WRI A;  2PVO D;  2V4L A;  3AEF B;  2OED A;  2KLG A;  2VRR B;  3AB5 A;  1P98 A;  1ZOY B;  1SJE D;  3Q3N C;  2LXA A;  1PUT A;  3GOE A;  1UZX B;  1GUA B;  5KHO A;  1YN3 A;  1YJ1 A;  2JWZ A;  3DOW A;  4TQ0 A;  3IFW B;  2LXC A;  1EM7 A;  4TQ1 A;  2FNJ B;  4TV3 A;  1MHH E;  1ZPS A;  3EFU A;  2JRH A;  3KWV A;  4N58 A;  3R2T A;  1S3S G;  4NZL B;  2VH1 A;  4PK1 A;  3A4S C;  2RPQ A;  1WGR A;  2AQ3 B;  3A9K B;  1BML C;  3AM9 A;  1D5M C;  3GP7 A;  4ZDV A;  2LD9 A;  4MGY E;  1KTK A;  1T0Q C;  2MP2 B;  1RLF A;  4C4V A;  2K6D B;  1JWA D;  1A5R A;  4A3O A;  2HD5 B;  3M63 B;  4LJP B;  4NQK E;  2JU6 X;  3V60 A;  3LXF A;  5BO4 B;  2M17 A;  2G3Q B;  3T9L A;  2C7M B;  4RGT A;  2GBM A;  4RF1 A;  4M02 A;  2KWU B;  1GC7 A;  2VZK D;  4REZ A;  1MFW A;  4M0W A;  4ARC A;  3RZF A;  4MJS A;  3BVG A;  3BK2 A;  1TS5 A;  3DHI C;  4YWG G;  1V5O A;  1OQY A;  1GJZ A;  1FXT B;  3ZTC A;  2IY1 B;  3V61 A;  2G1E A;  1UGJ A;  3RNA C;  1FFU A;  1L6U A;  3IG3 A;  2L0F A;  2O6V B;  2JF5 A;  4WJQ A;  3K9O B;  1RRB A;  4WWO A;  2WDQ B;  4PYU A;  2YLM A;  2FUH B;  4A8X C;  1AN8 A;  2W55 A;  2NS5 A;  1XLN A;  4BFR A;  2MBE A;  3N9Y C;  3QQ8 B;  2NPT A;  4MH8 A;  4GDK A;  1IGD A;  1WM2 A;  3O13 A;  3MC0 B;  3QCA A;  4RGO S;  2WXO A;  2N9E B;  2NTS A;  3RYT A;  3PLV A;  2MWS B;  5C23 A;  4GGQ A;  2Y3A A;  2CU3 A;  1VLB A;  3WA0 A;  4C56 C;  3KH0 A;  3VTU A;  3MP9 A;  3VR8 B;  1L4D B;  4W9L A;  2REX A;  3IHP C;  4AP4 C;  3RN9 C;  2KFJ A;  1MI0 A;  4P7I A;  2HTH A;  1V8C A;  1ACC A;  2IPK D;  3ZJV A;  1PGB A;  3ONS A;  3GZN I;  2KWC A;  1V86 A;  3W1Y A;  2OJR A;  2M0A A;  4ZRQ A;  4LNN A;  1DOI A;  1YX6 B;  4HCP B;  4EFO A;  5E6P A;  2K8H A;  4MGI E;  3AEA B;  1LXD A;  1BXT A;  3N1Z C;  4GSW A;  3KQ4 A;  1XO3 A;  2WXJ A;  2FCS A;  1DGJ A;  4BBN F;  2K1F A;  1E10 A;  5E6O A;  4IOI E;  3AE3 B;  2IDY A;  2DYO A;  2MHJ A;  5CHF A;  2YEP B;  1WMH B;  5AZH A;  3VAW A;  1IBX B;  3N30 A;  5L83 A;  5E6N A;  1XCQ L;  4ICV A;  2CR5 A;  1R4M B;  1EO6 A;  3NJT A;  1RYJ A;  2D11 A;  1K8R B;  1I4R A;  1PGX A;  2UYZ B;  2VH2 A;  4JWS C;  2HJ8 A;  3Q8E A;  4ANW A;  3I57 A;  1PYW D;  2MSE D;  3QHT A;  4H2A A;  3WAN A;  2LVO A;  2AYO B;  5LLI A;  3DBR I;  3PGE A;  3RD2 A;  4JX1 C;  1SXT A;  3RFZ B;  1WYW B;  2K5P A;  3HK0 A;  2CJO A;  2WU5 B;  2QDF A;  2WX1 A;  3TMP B;  5D94 A;  3I63 C;  5FK9 C;  1P1A A;  1VRA B;  1ENF A;  2L7R A;  5J17 A;  5JZE B;  1RWS A;  1HZ6 A;  3PHX B;  2IO3 B;  1J8C A;  4OZB A;  2ZVN A;  3ZDT A;  1GOZ A;  4GU2 A;  4I6N B;  1PGA A;  3O65 B;  5C3J B;  1FFV A;  1SEB D;  1JWB D;  1FPY A;  1VD2 A;  3SD5 A;  2E6X A;  4WWN A;  3UQB A;  2CU1 A;  4LDT D;  4NY0 A;  3ZIM A;  2N7E A;  2AQ1 B;  3TIX A;  3IAS 1;  1JML A;  4L23 A;  3ZVV A;  4MH0 E;  4F1S A;  3DCG A;  4AS1 A;  4BAX A;  2ONQ A;  5CHV C;  2WLB A;  4TMA B;  3QAR A;  1WWT A;  2JPH A;  5T8I A;  4DDI D;  3ML8 A;  2MQJ A;  2IO0 B;  3WIM A;  2K25 A;  4RM8 A;  1SE3 A;  3EHV A;  2W3R A;  3JYU A;  4FAD A;  3PHW B;  4DHZ B;  3ZLZ A;  1L0V B;  1YNT E;  2INC C;  1DYQ A;  3W5V B;  1VZ7 A;  4USA A;  2FID A;  2JVC A;  2KK8 A;  2LRW A;  2LZ6 A;  3FAH A;  2TSS A;  3IT4 B;  3ZUN A;  2DHZ A;  1WXQ A;  1RFK A;  3A33 B;  2RD0 A;  2YVC A;  3AEE B;  4IDI A;  1K53 A;  2JY6 A;  3W1S A;  4W9D A;  3AI5 A;  2KJR A;  3ABV B;  5LXI B;  4A9A A;  3Q6B A;  2DEN B;  3AE1 B;  1E8Y A;  1T0Y A;  2D5G A;  2DAF A;  4W9G A;  3BYY B;  4II2 B;  2FUG 1;  2ZPY A;  4FN2 A;  3EC8 A;  4MM3 B;  3JVZ X;  2AX5 A;  1MHX A;  2WNM A;  4OZA A;  3ZKJ C;  4G11 A;  3KLS X;  5CX3 A;  1TS2 A;  4GB9 A;  1ZDV A;  2PE6 B;  3P4Q B;  4KSK C;  2BS3 B;  3CMM B;  2WYQ A;  4IWP A;  4A55 A;  2FCN A;  2MBH A;  4URK A;  1PFD A;  2G45 B;  3KW5 B;  2WS3 B;  5AZF A;  1D5Z C;  2L8J A;  3X23 A;  4I6P A;  2C60 A;  1UGM A;  2ZNV B;  4E71 A;  1YX5 B;  1E8X A;  1GB1 A;  3TCA A;  5D7G A;  2LUE A;  1Y56 A;  3GE8 C;  1KOT A;  3BYT B;  4FLH A;  3P63 A;  4B0M A;  3CF6 E;  4AOF A;  1WE6 A;  4G0N B;  1FXI A;  5C1Z A;  3PZD A;  2KD0 A;  2O6V D;  4N59 A;  1A70 A;  2G9H D;  1DOY A;  3DBL B;  1ZP0 B;  3PRZ A;  4DBG A;  3B0A A;  4OVZ A;  1OTR B;  3RUI B;  2N7D A;  3Q14 C;  2K3U A;  3ZJU A;  1EF5 A;  2WXG A;  1V49 A;  1HA5 A;  3P4S B;  5D2M B;  3IAM 1;  3TEY A;  4BKG A;  3PO0 A;  3R2I A;  1P3Q U;  1HTO A;  2KXJ A;  4WIP A;  1KLG D;  4WAA A;  3KYD D;  1R4N B;  3L13 A;  1K51 A;  1VR9 A;  1CQV A;  1TKY A;  4FHK A;  3DBH I;  2I1J A;  5GMV A;  2INN E;  5EE3 A;  3V6C B;  4XYC A;  4XGA B;  3JSV B;  3QX1 A;  3SU8 X;  1WRD B;  3AE2 B;  2WP9 B;  3TEZ A;  4F8C B;  1VZ8 A;  1P7E A;  1F2R C;  3B9J A;  4RCO A;  2KWV B;  4IW0 A;  2M4N A;  3AE6 B;  3N1Y C;  2WWZ A;  5JHA A;  4HWI B;  2V3P A;  4W9F A;  1FM0 D;  4ACF A;  5KHQ A;  4A20 A;  2JZP A;  2J0K A;  1WGK A;  1FD6 A;  2BWF A;  1YMH E;  1CK1 A;  2BB5 A;  4K7U A;  3LJ3 A;  1FEH A;  1X1M A;  1YJI A;  1SIJ A;  4P16 A;  2KLC A;  4B95 A;  1D6E C;  1UD7 A;  2C7H A;  3R7R A;  1I4P A;  4CYE A;  1TS4 A;  2LEK A;  2E3T A;  2WDV B;  3AE5 B;  2PLP A;  1C4A A;  3HM3 A;  2D2Q A;  5J2R A;  2LFI A;  1SBB B;  2D3G A;  3EA6 A;  1J7B A;  4JPS A;  3PRM B;  3AN1 A;  4HDO A;  1YD8 U;  1WXV A;  2K8B A;  2IGD A;  3L10 B;  1HEZ E;  3ZXV A;  4EZL A;  1J0G A;  3V6E B;  1SGH A;  1Y8R C;  4JLC A;  3P42 A;  3DQV A;  1Q5W B;  3SDL C;  4M8N A;  2V0G A;  4MSQ B;  4ZRP A;  3Q8A A;  2GOW A;  4XDD A;  1H8C A;  1QF6 A;  2FBW B;  2OHF A;  1V97 A;  1AW7 A;  4JWU C;  4N9F 4;  3BII D;  4PT5 A;  1SF0 A;  2K22 A;  2D07 B;  1WR6 E;  2EKI A;  1XF5 L;  3E56 A;  1TIF A;  4DDG D;  2JX5 A;  2B3A A;  1I7H A;  2KTR B;  2DAJ A;  2FIF A;  1GPX A;  3AE4 B;  3FIL B;  4XWT A;  4KSL C;  4LNF A;  5CHW A;  1Z5S B;  4FXC A;  4F7Z A;  2N9L A;  4RH6 A;  5BMG A;  3PS6 A;  4NQL B;  3TSS A;  2NVU I;  2XEW A;  2ZW0 A;  3UGB B;  4DQO C;  1WY8 A;  4EEW A;  3FKY A;  1SIF A;  5GXG B;  1SSN A;  2MX2 A;  1I4Q A;  3BK1 A;  3AEG B;  3NZU A;  2J0M A;  3LYY A;  3H7P A;  1E6E B;  1JRO A;  2K39 A;  4P1C C;  3PPA A;  4KIK A;  2N9X A;  1Q0W B;  1YN4 A;  2H88 B;  2W54 A;  4TKN A;  4CHK A;  1N60 A;  3WAP A;  3E9S A;  2DZM A;  3P1M A;  1FNU A;  2V3S A;  3H8H A;  1DOX A;  2BWE S;  1E0Z A;  2KMM A;  2KFK A;  3UIO B;  2HDE A;  2RDB C;  2MEK A;  2L0T A;  4C4V B;  3IBE A;  2ACZ B;  4AUQ C;  3NVV A;  4DXG A;  4ZHO A;  3U7D A;  2QC8 A;  2K9X A;  2N1W A;  3PZ8 A;  2KDM A;  3NS8 A;  1ESF A;  2WXL A;  2OJW A;  2MJ3 A;  3V62 A;  3AUL A;  4E3C A;  4MAC A;  1WE7 A;  1M94 A;  1L7Y A;  3NVW A;  2I38 A;  2WXH A;  1KLV A;  1PDX A;  1YQB A;  4LK0 M;  1V1P A;  1JCK B;  1QLB B;  3AU4 A;  1I4X A;  1FCC C;  5CTR C;  3RZW C;  1HE8 A;  2GBN A;  3TL5 A;  2ZCB A;  4M0W B;  1SE9 A;  2PVG C;  2R2Q A;  2MLB A;  2QMT A;  4K1R B;  3DBS A;  1YQ4 B;  3A9J A;  4MJS B;  3A1Q A;  3DDC B;  4DHJ B;  4TSS A;  3X0W A;  4GN1 A;  4QAY A;  2X8X X;  1TZ1 A;  2UWQ A;  1N5W A;  2XK5 A;  2J4X A;  2LUM A;  2KQS A;  1J19 A;  1H4R A;  4JE3 B;  1ZGU B;  2IO2 B;  3AH7 A;  2MBO A;  2V1Y A;  4W9E A;  1N63 A;  3NG0 A;  1F9J A;  2RGF A;  3MJW A;  2OOB B;  1MG8 A;  1TKE A;  1ZKH A;  2NPT B;  1F0Z A;  4GDK B;  3ZW3 A;  5DPT A;  4HVB A;  2KDI A;  1WX8 A;  3KVF B;  2N4F A;  1GAQ B;  1GG3 A;  2WXR A;  1UBI A;  2KX0 A;  5H92 C;  3SFD B;  1UH6 A;  3QK0 A;  4GIV A;  3QC8 B;  4EOY A;  5DPW A;  2UU7 A;  4PYZ A;  3U8Z A;  1NYR A;  2LGD A;  2D3A A;  1L5P A;  4A90 A;  3DHH C;  4ZYN A;  4LNI A;  1V1O A;  3ECI A;  2BTE A;  1V6E A;  1QQR A;  2BKF A;  3M62 B;  1ET6 A;  2LJ5 A;  1NEN B;  2CHX A;  1TKG A;  2LI5 A;  4KZ0 A;  1WJ6 A;  3VH3 B;  3HVZ A;  3NUH B;  4OW0 A;  3BY4 B;  4AJY B;  5G2N A;  2CS4 A;  3MC8 A;  4RFB A;  2ZJD A;  4X57 B;  3UI3 A;  2I2Y A;  4Q2J A;  3QIJ A;  3H7S A;  3UQA A;  2BKR B;  1QOF A;  2W82 A;  3VRA B;  2MBQ A;  2MJD A;  1P7F A;  2JWU A;  3CIR B;  3FC4 A;  4ZRK A;  3DHG C;  1SB3 C;  4KKJ A;  4BVU C;  2PJH A;  2IZV B;  3H1U A;  2LAS A;  3CST A;  4N6E B;  3PLU A;  1BUI C;  5G5H A;  4OZC A;  4WJO A;  1YQ3 B;  1KFY B;  2M19 A;  2GI9 A;  2PIA A;  4W9J A;  5IOI A;  4WJN A;  2KDE B;  3Q3F A;  2AL6 A;  3T3O A;  3TJP A;  4CO7 A;  4W9H A;  4DWF A;  1L0Y B;  1QOG A;  4HKQ A;  2L00 B;  1UWX A;  5JXV A;  2IJ0 A;  2DZJ A;  1C78 A;  3L4P A;  2LHE A;  5C2T B;  3DVG X;  1VCB A;  4HCN B;  3LDZ E;  1NYQ A;  4EZJ A;  1OFF A;  3APC A;  4ITK A;  2KVZ A;  2KN4 A;  2RSU A;  3CSF A;  3NHE B;  2MRP A;  5FKA C;  4BKS D;  4WQO B;  3P4P B;  3R7Q A;  2C7N B;  4M8M A;  4IC7 B;  2KDF B;  5HHD G;  1ET9 A;  1UEL A;  4AQ7 A;  3DWM A;  4RMA A;  2H89 B;  3APF A;  2KHW B;  4FJZ A;  2QIL A;  4WQM A;  3B08 A;  1JW9 D;  3VHT C;  2A5U A;  5LNK 1;  1T5X D;  2AWT A;  3WAO A;  2N1V A;  4NAM A;  3GZN B;  2EEL A;  3PTF C;  3ZO5 B;  4LLG M;  2WXQ A;  3ZRC A;  4PS3 A;  2Y5C A;  4HDQ A;  3GB1 A;  4K3C A;  4KGS A;  5I4D A;  3MJ5 A;  2FCM A;  3J9C A;  1YOV B;  4IM3 A;  1WZ3 A;  4EUT A;  3MHZ A;  2JSV X;  3RPF C;  4WWP A;  3RNE C;  4HK2 A;  2N0S B;  2NBW B;  2IND C;  4BKT A;  2Z0D B;  3AE7 B;  2AEH A;  1BT0 A;  3VUY A;  3HRD D;  2VZK B;  1NI3 A;  3AU5 A;  4XWW A;  3AED B;  3ALB A;  1FIQ A;  2LGI A;  3NY5 A;  2K6Q A;  2KYW A;  3I5J C;  3DBR B;  1WR1 A;  3Q3J A;  3QWZ B;  2GB1 A;  2RPV A;  2FCQ A;  4IWO A;  4KVG B;  4HXD A;  4GOC A;  3ZNH B;  2N7J A;  1D5X C;  4US8 A;  2JRI B;  2DYM A;  3DVG Y;  2JQR B;  4ZYS A;  4HRO A;  1NVI D;  2ZEQ A;  2O2V A; 
#chains in the Genus database with same CATH homology
 1UBQ A;  3L10 B;  4EZL A;  2LGY A;  3IG3 A;  2L0F A;  1J0G A;  3V6E B;  2O6V B;  2JF5 A;  1SGH A;  1Y8R C;  4WJQ A;  4B6W A;  3K9O B;  2KC2 A;  1V2Y A;  4JLC A;  1RRB A;  4WWO A;  4PYU A;  3DQV A;  1E90 A;  1Q5W B;  3SDL C;  4M8N A;  2YLM A;  5TR5 A;  4BOZ B;  2FUH B;  2N9P C;  4MSQ B;  2EKE C;  4XZ4 A;  2LWP A;  2EMT A;  4ANU A;  4NJ6 A;  2GOW A;  2NS5 A;  4BFR A;  1H8C A;  2MBE A;  2IYD B;  4IWQ A;  2LVP A;  2NPT A;  1WM3 A;  3QQ8 B;  4FHJ A;  4GDK A;  3VFK A;  3HHM A;  2GBJ A;  4N9F 4;  4DHJ D;  3NZS A;  2D07 B;  1WM2 A;  2BGF A;  1WR6 E;  4IM0 A;  3QCA A;  4HJK A;  2GBR A;  1WJ4 A;  3RT3 B;  1QZE A;  2N9E B;  1WJU A;  3ZDM C;  4DDG D;  3DVN V;  2RR9 A;  3PLV A;  3RYT A;  2MWS B;  2B3A A;  3ZTD A;  5C23 A;  4GGQ A;  2KTR B;  1OEY J;  2DAJ A;  2FIF A;  1G6J A;  3DBL I;  2KMC A;  1KM7 A;  2K8C A;  2KC1 A;  4G50 A;  2ZZP B;  3KYC D;  5CHW A;  4KSL C;  3WA0 A;  5AZG A;  3RUL A;  1D3Z A;  1LFD A;  1Z5S B;  3KH0 A;  3VTU A;  3SHQ A;  4W9C A;  4F7Z A;  4W9L A;  2REX A;  3PS6 A;  5JHB A;  3IHP C;  5AEK B;  4NQL B;  2CHZ A;  2NVU I;  3ENE A;  4AP4 C;  2GBK A;  3BIN A;  2KFJ A;  2DZK A;  1C1Y B;  2XEW A;  3UGB B;  1ISN A;  1WY8 A;  4EEW A;  4P7I A;  2HTH A;  3HIZ A;  3OJ3 A;  1SIF A;  3OJ4 B;  1R4N I;  1GNU A;  2C5L C;  2MX2 A;  3ONS A;  3NZU A;  2J0M A;  3GZN I;  2KWC A;  1V86 A;  2GMI C;  3H7P A;  3W1Y A;  3M95 A;  2OJR A;  2K39 A;  3OAW A;  3PPA A;  2PPH A;  3D32 A;  1YX6 B;  4KIK A;  5L95 C;  3L08 A;  3ZNZ B;  2N9X A;  4HCP B;  4EFO A;  1Q0W B;  3QJZ A;  4EZK A;  5HKH A;  5E6P A;  3TBL D;  2K8H A;  2PE9 A;  4MGI E;  3T8M A;  1LXD A;  4TKN A;  4CHK A;  2KX3 A;  1RFA A;  3WAP A;  2DZM A;  1C3T A;  3R3M A;  4IG7 B;  3N32 A;  2V3S A;  2PEA A;  2BWE S;  2MW5 A;  4JIO U;  4MM3 A;  4GSW A;  3UIP B;  3A4R A;  2LGX A;  2FCS A;  4EKU A;  2KFK A;  3DVN U;  2R2O A;  4LJO B;  3UIO B;  4BBN F;  3IVF A;  2K1F A;  2W9N A;  1WGD A;  4K7W A;  2L0T A;  3HM6 X;  5E6O A;  3PVL A;  1WFY A;  1LQB A;  3IBE A;  2DYO A;  3VAW A;  5CHF A;  3VQI A;  1WMH B;  5AZH A;  4AUQ C;  3N30 A;  3U7D A;  5L83 A;  3S2A A;  3RCZ A;  3R66 C;  2N1W A;  5E6N A;  2KJH B;  2I1K A;  4NJ7 A;  4ANV A;  1V5T A;  3EEC A;  3L17 A;  3NS8 A;  2CR5 A;  4ICV A;  1EO6 A;  3QAQ A;  2IO1 B;  2D11 A;  1K8R B;  2KZR A;  4BOS C;  2G4S A;  1E7V A;  2HE7 A;  2UYZ B;  3AUL A;  4W9I A;  3V62 A;  4E3C A;  1WE7 A;  1IP9 A;  1M94 A;  2HJ8 A;  4KV2 A;  1L7Y A;  4ANW A;  4WJP A;  2ZPN A;  1KLV A;  2MSE D;  3QHT A;  1YQB A;  4FJY A;  4HPL B;  4MGK E;  3ML9 A;  1E5W A;  3WAN A;  2LVO A;  3AU4 A;  4MDK E;  1EF1 A;  2FAZ A;  2AYO B;  5CTR C;  2Z59 B;  5LLI A;  1WH3 A;  3DBR I;  1HE8 A;  3PGE A;  4MEL A;  3RZW C;  4ANX A;  3RD2 A;  2GBN A;  4HPM B;  2LRU A;  3TL5 A;  2ZCB A;  4M0W B;  1SE9 A;  3VUW A;  1WYW B;  3VH4 B;  3HK0 A;  2R2Q A;  2WX1 A;  2MLB A;  3TMP B;  4K1R B;  3DBS A;  5D94 A;  3A9J A;  1WX9 A;  2BYE A;  4GDL A;  1P1A A;  4MJS B;  3A1Q A;  2L7R A;  5J17 A;  5JZE B;  3I3T B;  3DDC B;  4DHJ B;  3PHX B;  1L2N A;  2IO3 B;  4GMV A;  3X0W A;  2O2V B;  4GN1 A;  3ZNI D;  1WGH A;  1J8C A;  4HLE A;  2ZVN A;  1TZ1 A;  2UWQ A;  1S1Q B;  3ZRF A;  5FR6 A;  2XK5 A;  4FJV B;  3VDZ A;  1PQS A;  4A3P A;  2KO3 A;  4PS7 A;  1WZ0 A;  3UIN B;  3ZDT A;  2KQS A;  4GU2 A;  4JQW C;  4OVV A;  1J19 A;  4I6N B;  4E74 A;  1H4R A;  3O65 B;  1ZGU B;  1VD2 A;  2IO2 B;  3SD5 A;  4WWN A;  3UQB A;  2MBO A;  3L16 A;  1TTN A;  2CU1 A;  4LDT D;  4NY0 A;  2V1Y A;  4W9E A;  1F9J A;  4ZRI A;  2RGF A;  3MJW A;  3ZIM A;  2N7E A;  5J18 A;  2OOB B;  3TIX A;  1MG8 A;  3ZVV A;  2KOX A;  1AAR A;  1V80 A;  2DX5 B;  4MH0 E;  1ZKH A;  1WF9 A;  4F1S A;  1OEY A;  3DCG A;  2NPT B;  4ZRJ A;  4GDK B;  3ZW3 A;  2CKH B;  2BYV E;  5DPT A;  4HVB A;  3H9D A;  2JT4 B;  2KDB A;  1GC6 A;  1ZW7 A;  2KDI A;  5CHV C;  3PT2 B;  1WX8 A;  2L05 A;  3KVF B;  4NNJ B;  2N4F A;  3QAR A;  1IPG A;  4NPN A;  3PSE B;  1GG3 A;  2JPH A;  1OGW A;  1UBI A;  5IA7 A;  2NBV B;  2WX0 A;  3P2B A;  2KX0 A;  3ML8 A;  4DDI D;  1UH6 A;  2MQJ A;  3QK0 A;  2IO0 B;  3QC8 B;  4GIV A;  4EOY A;  3QA8 A;  3WIM A;  4PS8 A;  3H6N A;  5DPW A;  2M8S A;  4PYZ A;  3U8Z A;  3VUX A;  2K25 A;  4RM8 A;  3JSV A;  2ZEQ A;  1WXM A;  2LGD A;  3EHV A;  2CHW A;  4GXB A;  3JYU A;  4FAD A;  4ZYN A;  3PHW B;  4DHZ B;  3ZLZ A;  3A9K A;  1XQQ A;  2MA9 B;  2FID A;  3ECI A;  2JVC A;  2EMS A;  2KK8 A;  2LRW A;  2Z0E B;  1V81 A;  4B9K A;  4K81 A;  2LZ6 A;  1V6E A;  2BPS A;  4DHZ E;  1E8W A;  2KJ6 A;  2NR2 A;  1WXA A;  2BKF A;  2MP2 A;  4AWJ A;  3M62 B;  2L3Z A;  2AL3 A;  3ZUN A;  1V9J A;  2DHZ A;  4I6L B;  5DPS A;  2LJ5 A;  2NBU A;  3JW0 X;  2CHX A;  3A33 B;  2RD0 A;  2YVC A;  4DXA B;  2LI5 A;  4KZ0 A;  1E7U A;  2JY6 A;  1I42 A;  4ICU A;  3W1S A;  4W9D A;  1WJ6 A;  3AI5 A;  3H7P B;  3V61 A;  2C9W B;  3VH3 B;  2KJR A;  2WDT B;  1KJT A;  5LXI B;  4KIK B;  3BY4 B;  2Y5B B;  2KMA A;  3MHS D;  3U30 A;  2DEN B;  2JXX A;  1Q1O A;  2BYF A;  4AJY B;  5G2N A;  2CS4 A;  1E8Y A;  3KUC B;  1T0Y A;  3UF8 A;  1YIW A;  2DAF A;  4W9G A;  3PV1 A;  3VVW B;  1LM8 B;  1NBF C;  1WI0 A;  2ZJD A;  4X57 B;  4II2 B;  2ZPY A;  3QIJ A;  3H7S A;  2DYB A;  3UQA A;  2BKR B;  2J7Q B;  3VTW A;  4FN2 A;  3EC8 A;  3MTN B;  2MBQ A;  4ZRK A;  3JVZ X;  5LXH A;  5DPR A;  1NI2 A;  4BVU C;  2KFK B;  2PJH A;  2IZV B;  4G11 A;  3ZKJ C;  4FBJ B;  3H1U A;  3ZNG C;  3K9P B;  5CX3 A;  2LAS A;  1WIA A;  3CST A;  4NAW A;  4GB9 A;  2G4D B;  4FUL A;  3PLU A;  2PE6 B;  4WJO A;  4W9J A;  2IBI B;  4KSK C;  1WGY A;  2ZVO A;  4WJN A;  2KDE B;  1R4M I;  3Q3F A;  3WAL A;  1WX7 A;  2WYQ A;  3CMM B;  4IWP A;  2FCN A;  2MBH A;  4URK A;  2G45 B;  2QHO A;  3KW5 B;  2AL6 A;  2O6V A;  4MEM A;  2NCN A;  5AZF A;  3TJP A;  2L8J A;  4NAW B;  1U4A A;  1XT9 B;  3VXW A;  3X23 A;  4I6P A;  2C60 A;  1UGM A;  4W9H A;  4CO7 A;  4KDL B;  4TUU A;  4BKS A;  2BF8 B;  2ZNV B;  3NOB A;  4DWF A;  4E71 A;  3N3K B;  1YX5 B;  4IM2 A;  1JRU A;  1E8X A;  1WXS A;  2L00 B;  1TBE A;  3TCA A;  2KNB A;  5D7G A;  2LUE A;  2DZJ A;  3KUZ A;  2KQ7 A;  4LDT B;  3L54 A;  3DVG X;  1VCB A;  4HCN B;  3APD A;  2KTF A;  1KOT A;  3A9J B;  4FLH A;  4KDI C;  4GDL B;  2JZZ A;  3LDZ E;  4XX5 A;  1WGG A;  3CF6 E;  4FA6 A;  1IYF A;  3A1Q B;  1I35 A;  4K7S A;  3L0W B;  2ASQ A;  4AOF A;  3APC A;  4KZC A;  4EZJ A;  1WE6 A;  4G0N B;  4ASW C;  3WAM A;  2JUO A;  2M1M A;  5C1Z A;  3PZD A;  2KD0 A;  2O6V D;  2RSU A;  2KVR A;  3CSF A;  3NHE B;  1E8Z A;  2LVQ A;  2MRP A;  3C0R B;  2KN5 A;  2XK5 B;  5D6J B;  2KTR A;  1P0R A;  1CMX B;  2JZ3 B;  2M0X A;  4BKS D;  4WQO B;  1NDD A;  3R7Q A;  3PRZ A;  2C7N B;  4DBG A;  3B0A A;  3M3J A;  3AXC A;  4M8M A;  1OTR B;  2KDF B;  2N7D A;  4IC7 B;  3RUI B;  1UEL A;  1EF5 A;  2DZI A;  3KUD B;  1V49 A;  2IY0 B;  4RMA A;  2V4L A;  2L76 A;  5IAA C;  5D2M B;  3APF A;  2ZCC A;  1RAX A;  2KHW B;  2KLG A;  2VRR B;  4FJZ A;  3PRE A;  1XD3 B;  1P98 A;  1TGZ B;  4BKG A;  2J0J A;  3B08 A;  3VHT C;  1P3Q U;  2KXJ A;  2A5U A;  2LXA A;  4WAA A;  1P9D U;  3KYD D;  5JH5 C;  3GOE A;  4MSM B;  1UZX B;  3VTV A;  2AWT A;  4II3 B;  3WAO A;  1GUA B;  2N1V A;  3L13 A;  5KHO A;  4BBN C;  1YJ1 A;  3PTF C;  2JWZ A;  3ZO5 B;  3B1L X;  3DOW A;  4FHK A;  3ZRC A;  3DBH I;  4TQ0 A;  3IFW B;  2LXC A;  4TQ1 A;  2I1J A;  2FNJ B;  4PS3 A;  5GMV A;  3V6C B;  4TV3 A;  3OLM D;  4HDQ A;  3EFU A;  2JRH A;  3JSV B;  2FCM A;  3QX1 A;  5DCN A;  1S3S G;  4IM3 A;  2MCN B;  1WZ3 A;  3SU8 X;  1WRD B;  4W9K A;  2XBB C;  3A4S C;  2RPQ A;  1WGR A;  4EUT A;  3A9K B;  4AJW A;  4ZDV A;  1WJN A;  2LD9 A;  4MGY E;  4WWP A;  3W1S C;  4F8C B;  4HK2 A;  2MP2 B;  1RLF A;  2NBW B;  2KWV B;  4IW0 A;  2M4N A;  4IUM B;  2K6D B;  4XC2 A;  4BKT A;  1WMH A;  1A5R A;  2Z0D B;  3PRP B;  2WWZ A;  5G55 A;  5JHA A;  4HWI B;  2HD5 B;  3M63 B;  4W9F A;  4A3O A;  4LJP B;  4LCD E;  2KKC A;  4A20 A;  5KHQ A;  2J0K A;  2AEH A;  4NQK E;  1BT0 A;  2KAN A;  3VUY A;  4YL8 A;  1EUV B;  5BO4 B;  3V60 A;  4G3X B;  2M17 A;  2BWF A;  3AU5 A;  5EDS A;  1Z2M A;  2G3Q B;  3T9L A;  4K7U A;  3LJ3 A;  4JGH B;  3ALB A;  1X1M A;  2C7M B;  4OVU A;  2GBM A;  3NY5 A;  2MBB B;  2K6Q A;  2KWU B;  2KLC A;  1GC7 A;  3DPD A;  4B95 A;  1UD7 A;  2C7H A;  1WR1 A;  2A4Z A;  3Q3J A;  3R7R A;  3QWZ B;  4CYE A;  2D10 A;  2ZNV C;  2FCQ A;  4IWO A;  3HM3 A;  4KVG B;  4RM9 A;  4HXD A;  4GOC A;  3ZNH B;  2D2Q A;  5J2R A;  2JRI B;  4J6I A;  3RZF A;  2D3G A;  4MJS A;  4MGZ E;  2DYM A;  3DVG Y;  1V5O A;  4JL9 A;  1OQY A;  1GJZ A;  3PRM B;  2O2V A;  4DK5 A;  1FXT B;  3ZTC A;  4HDO A;  2IY1 B;  1YD8 U;  1WXV A;  2K8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...