1WXAA

Solution structure of ras-binding domain in mouse af-6 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
GSSGSSGSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Ras-binding Domain in Mouse AF-6 Protein
rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Afadin
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxaA00
3ZDMC 4F8CB 2A4ZA 2J0JA 3KH0A 4EUTA 3HM6X 2N9XA 2KTFA 2ZCBA 3PSEB 2LGYA 3AU5A 3PPAA 4URKA 1GJZA 2JRHA 4NPNA 2YLMA 1R4MI 1JRUA 4I6PA 2HD5B 4JGHB 2KQSA 2WX1A 1ZW7A 2IO2B 1V81A 3L10B 2O2VB 3APCA 3QARA 2FIFA 3DOWA 2MWSB 3B1LX 2D07B 3KW5B 3QWZB 4XX5A 3ZUNA 1HE8A 1UD7A 5TR5A 3K9OB 4W9CA 4FLHA 2ZEQA 3QC8B 2BYVE 4EZJA 1YX5B 2KDEB 2C7NB 2LVPA 3N30A 1V5OA 5J17A 4TUUA 3PHWB 4A20A 2CU1A 1WXMA 2GBKA 2PJHA 5J18A 4ZDVA 2KVRA 1OEYJ 4I6LB 4K81A 1YJ1A 2KXJA 2NPTA 4WJQA 1Q1OA 2CR5A 1UH6A 4G11A 4GN1A 3WAPA 2LZ6A 1E7VA 1WH3A 4W9FA 4BBNF 1J0GA 4W9EA 2AL3A 4ICVA 2LI5A 2O6VD 5LLIA 3ZTDA 2HE7A 3UIPB 2C7HA 2IO3B 4MGYE 4KVGB 1WJNA 3W1SC 2LWPA 2MBQA 3GOEA 4HCPB 3R66C 3PRMB 4BOZB 1V2YA 4LDTD 4M8MA 4ANWA 3GZNI 5AEKB 4EEWA 3Q3FA 3C0RB 4PS8A 2LXAA 1V86A 3L08A 2KZRA 2NBUA 4W9IA 3B08A 2K25A 3EC8A 3NHEB 1WX8A 3VXWA 2K1FA 1RLFA 3SU8X 3BY4B 4GIVA 1SGHA 2KD0A 2GBNA 2NBVB 3APFA 3H1UA 2IO1B 2NVUI 2N7DA 3PLVA 1T0YA 4DHZB 4MJSA 5IAAC 5DPWA 3W1SA 2BPSA 3H7PB 4IM2A 3AI5A 5LXIB 3D32A 4G3XB 2BKRB 4RM8A 4LJOB 2GBMA 5G55A 3HHMA 4KDIC 2L7RA 1Q0WB 3RYTA 2VRRB 3RCZA 1WF9A 2MA9B 3OLMD 2ZNVB 3UINB 3A4RA 1IP9A 1WJUA 4JL9A 4MH0E 3VAWA 2WDTB 1KM7A 3W1YA 2D10A 4IC7B 2LD9A 2BWFA 2G3QB 4F1SA 3ZNHB 3RD2A 1Y8RC 3I3TB 3ML9A 2M17A 4HPMB 5D94A 3R7RA 4FBJB 1UZXB 2DZKA 3PTFC 2KLCA 5DPRA 3O65B 3AXCA 3CSTA 4EKUA 3B0AA 4DHZE 4JQWC 2GMIC 3PRZA 2EKEC 2D2QA 2KMCA 5D2MB 5GMVA 3QCAA 3PLUA 2ZVNA 4DBGA 2J7QB 3UGBB 1WX9A 4GSWA 4MGIE 1WJ6A 2LGXA 3VQIA 4K7WA 4GDKB 3KYCD 4NJ7A 4ZYNA 4RM9A 4XZ4A 2BWES 2PE9A 2V3SA 1H4RA 2MSED 4II2B 2O6VB 2DZJA 2HJ8A 2MBHA 2EMTA 2DENB 5D6JB 1S3SG 4G50A 3TCAA 5JHBA 1YD8U 1WGYA 1UELA 2KJHB 5AZGA 2DYBA 1Z5SB 2KLGA 2LASA 2ZJDA 5C23A 2KWCA 4DWFA 5IA7A 1R4NI 3EFUA 3PGEA 3K9PB 1LFDA 4HXDA 2M4NA 3PRPB 3DDCB 2KQ7A 4GDLB 4J6IA 2FCMA 4BKGA 4GXBA 2KJ6A 2MX2A 4K1RB 4ZRIA 3IFWB 3ZNGC 2KX0A 3TIXA 3VVWB 3KYDD 3ZRCA 2ZZPB 4PYZA 5EDSA 3CSFA 2K8HA 4GDKA 1TZ1A 2PEAA 4W9LA 1Q5WB 3OJ4B 3TBLD 1WM3A 5D7GA 2KDIA 1I42A 2NBWB 4ASWC 2FCNA 4DK5A 3ALBA 2BGFA 1QZEA 2WX0A 3DCGA 4KV2A 3WAOA 4P7IA 1WYWB 3A4SC 2DAFA 4EFOA 1V5TA 2M1MA 4FJYA 1L7YA 2GBJA 3PT2B 4WJPA 3BINA 2KFKA 3IVFA 1SE9A 1IYFA 4F7ZA 2CS4A 3DVGX 2I1KA 2KHWB 5DCNA 4B95A 5L95C 3SD5A 1OEYA 4E74A 5CHFA 1E8YA 1TTNA 1YQBA 1LM8B 1ISNA 5KHQA 1E7UA 1WMHA 3A9JA 2GOWA 1OQYA 3CF6E 3QJZA 2C7MB 2FIDA 1E8XA 2MLBA 1WMHB 3JW0X 3PREA 1E8ZA 2BYEA 3U8ZA 1SIFA 4RMAA 2V4LA 4KIKB 4BFRA 1X1MA 1OGWA 1XD3B 2AEHA 1TBEA 1OTRB 3JSVB 2LVQA 1I35A 4A3OA 2FAZA 3TMPB 3L16A 1VD2A 2RPQA 1GNUA 4FULA 3RT3B 2JF5A 3ZTCA 2IY0B 4K7SA 4CYEA 4KZCA 3IBEA 2IO0B 2MRPA 4MSQB 3V6EB 4EZLA 1GUAB 2KDBA 4FJVB 2C9WB 2NPTB 1WE6A 3P2BA 3L13A 3NZSA 3ZIMA 4JIOU 4WQOB 4ANVA 2L0FA 2D11A 4MSMB 4NJ6A 4WAAA 2HTHA 2JRIB 4HWIB 3UF8A 2N7EA 1WI0A 2M8SA 4GOCA 2ZNVC 2KMAA 3H9DA 3ZNID 1LXDA 1IPGA 4DXAB 1E5WA 2FCQA 3A9KA 4PS7A 2AYOB 4G0NB 4KSKC 3VTUA 2FNJB 3LDZE 4NNJB 2RGFA 3U30A 1G6JA 2KNBA 3V61A 3KUZA 5DPSA 2KTRA 4HVBA 3HM3A 3JSVA 3NOBA 1NDDA 1P98A 2J0MA 4DDID 3VUXA 4KIKA 5L83A 4LCDE 3V6CB 3WALA 3QQ8B 3EECA 5LXHA 3VTVA 3RZFA 4X57B 1WR1A 2LRWA 4MJSB 4DDGD 5JH5C 3PZDA 4AWJA 1U4AA 4BKSD 2K6QA 3A9JB 4ANUA 2JZZA 3DVNV 2JT4B 4WJOA 4BKTA 3ZW3A 2LJ5A 2MBBB 2NR2A 4LDTB 2QHOA 1WGGA 1YX6B 2ZPNA 4BKSA 5AZFA 2K8BA 4TQ0A 2IZVB 2KKCA 4GMVA 1VCBA 3A9KB 4II3B 1XQQA 4CHKA 2KK8A 1NI2A 2CKHB 4MGZE 4NY0A 3DBHI 4DHJD 2XK5A 4HK2A 4MM3A 3TL5A 4YL8A 3DVNU 3MJWA 2MCNB 2JUOA 3HK0A 1Z2MA 3MTNB 2LUEA 2W9NA 2PPHA 2RR9A 5AZHA 1TGZB 1WZ0A 3N3KB 5KHOA 3V60A 2MW5A 1L2NA 2LGDA 2IY1B 2J0KA 2ZPYA 3PVLA 4ZRJA 3ZRFA 1GC6A 1V9JA 4AJYB 4EOYA 4M0WB 2WYQA 3S2AA 2GBRA 1EUVB 1FXTB 4IWOA 1UBQA 2DZMA 4B6WA 4K7UA 5CHWA 4OVVA 1M94A 2WWZA 4ZRKA 3WANA 3ZDTA 1GC7A 3SHQA 2DX5B 2N9PC 1WIAA 3TJPA 4BBNC 4HJKA 3LJ3A 3RULA 3M62B 4HLEA 4AJWA 1KLVA 1UBIA 2KFJA 4I6NB 3PHXB 3VFKA 3X0WA 2DYOA 4DHJB 5E6NA 1V80A 4TKNA 3DBRI 3QHTA 2MQJA 3UQAA 2IBIB 1P3QU 2OOBB 4GU2A 2L0TA 2Z59B 2G4DB 2XK5B 2UYZB 2L3ZA 3Q3JA 4HPLB 1NBFC 2JPHA 4WWPA 2UWQA 2KC2A 3ENEA 3PV1A 1F9JA 2V1YA 3QX1A 3ZO5B 4TQ1A 4B9KA 2ZVOA 2K39A 4A3PA 1LQBA 1V49A 4IUMB 2DYMA 3H6NA 3KUCB 5DPTA 3R7QA 3ECIA 3ML8A 3WA0A 2N1WA 3DBLI 2CHWA 2O2VA 1C3TA 5BO4B 3RZWC 3VH3B 3IHPC 2CHZA 1WGHA 1ZGUB 2G45B 2LRUA 3DBSA 3H7PA 4IG7B 4NQLB 4ANXA 5HKHA 4W9KA 4MGKE 5J2RA 3JYUA 2N4FA 1V6EA 4XC2A 1WGRA 3WIMA 4HCNB 2XBBC 2MP2A 4LJPB 2L05A 3L17A 5JHAA 1AARA 4MELA 2L8JA 4W9GA 4FADA 1J19A 1K8RB 2JXXA 3ONSA 2ASQA 2Z0DB 3A33B 4HDOA 2KWVB 4IWPA 2DHZA 2JVCA 2NCNA 3A1QA 3VH4B 4CO7A 2K6DB 1WGDA 2KOXA 3JVZX 3U7DA 2OJRA 3OJ3A 3QAQA 2JY6A 4NAWB 3IG3A 2DAJA 2KDFB 2YVCA 4GGQA 2BYFA 4NAWA 1EF5A 2KWUB 3DPDA 1WXAA 4IM0A 4E71A 2I1JA 5JZEB 1GG3A 3VUYA 1KJTA 2JZ3B 1E90A 3NZUA 1E8WA 2A5UA 2EMSA 4AOFA 4NQKE 1BT0A 2JWZA 2REXA 3ZKJC 1J8CA 2D3GA 2XEWA 1EO6A 1WM2A 3KVFB 3NY5A 1WXSA 3ZLZA 4W9DA 3QK0A 2KANA 2ZCCA 4IW0A 4EZKA 4FN2A 3EHVA 3NS8A 4JLCA 2O6VA 4KZ0A 4FJZA 2K8CA 2NS5A 1CMXB 2Z0EB 1S1QB 1P9DU 1WFYA 1WZ3A 1WR6E 1C1YB 3L0WB 1EF1A 2KN5A 4M8NA 3VHTC 4AP4C 4W9HA 4E3CA 4TV3A 3HIZA 1P1AA 1RRBA 2Y5BB 3AU4A 4HDQA 2M0XA 4FHJA 3DVGY 2L00B 4W9JA 2BF8B 3A1QB 4FA6A 1XT9B 2KX3A 3APDA 2B3AA 2PE6B 3X23A 4PS3A 3ZVVA 3DQVA 1RAXA 1KOTA 3T9LA 2KC1A 3UIOB 2C60A 4ICUA 3WAMA 3KUDB 5E6PA 2CHXA 2FCSA 5CX3A 3T8MA 4KSLC 3RUIB 2KO3A 3QIJA 1WX7A 5E6OA 4N9F4 3VTWA 1WXVA 2DZIA 3UQBA 3AULA 2BKFA 1WJ4A 2R2QA 5FR6A 3SDLC 4WJNA 2N9EB 4IM3A 4GB9A 2MP2B 3M3JA 3OAWA 2LVOA 1D3ZA 1WY8A 3N32A 3QA8A 1P0RA 3MHSD 3PS6A 4IWQA 1MG8A 2N1VA 1YIWA 1RFAA 3ZNZB 2MBOA 2MBEA 1ZKHA 4OVUA 3M95A 1PQSA 2G4SA 2FUHB 2RSUA 2KFKB 5C1ZA 4KDLB 3L54A 2KTRB 4MEMA 1H8CA 4WWOA 4FHKA 2R2OA 3VDZA 3V62A 1A5RA 2AWTA 4WWNA 1UGMA 4GDLA 4PYUA 4MDKE 4BOSC 5G2NA 2C5LC 1WRDB 2L76A 5CTRC 3H7SA 4AUQC 3CMMB 3R3MA 3VUWA 4BVUC 1WE7A 2KJRA 2AL6A 2RD0A 3M63B 2IYDB 2LXCA 5CHVC
chains in the Genus database with same CATH superfamily
1E6EB 3ZDMC 3HM6X 4HEA1 2KTFA 2ZCBA 4P1CC 2RMMA 2JRHA 1PGBA 1R4MI 2AQ1B 4I6PA 2KQSA 2WX1A 2IO2B 3APCA 3DOWA 3B1LX 3QWZB 3ZUNA 1I4XA 2WXMA 5TR5A 2PKOA 2LEKA 4FLHA 2J52A 1TKEA 4UDUC 4EZJA 1YX5B 3N30A 1TIFA 2CU1A 2PJHA 4K3BA 5AUKA 4WJQA 1Q1OA 4G11A 2L1AA 4BBNF 2AL3A 2V4IB 5D3DA 4XDCA 3W1SC 1FD6A 2MBQA 1TJEA 4RF0A 1V2YA 2LHEA 4W9IA 2LJIA 3NHEB 4GIVA 2AQ3B 2GBNA 2NBVB 2N7DA 2FE8A 1MG4A 3IXSA 4IM2A 3DBHB 4YSYB 3RYTA 2BW2A 3RCZA 2MA9B 3BYYB 1SB3C 3FKYA 3UINB 3A4RA 1WJUA 3VAWA 4JE3B 1KM7A 1T5XD 4XGAB 1TS5A 4HPMB 5G5HA 4OW0A 3H8HA 4KKIA 4O1NA 2KLCA 3CSTA 2Z8LA 1TS3A 1UUPA 3BIID 4M01A 1BMLC 2H88B 2J7QB 2J53A 1YQ4B 1N63A 4MGIE 4HKZE 1FMAD 3KYCD 4NJ7A 4B0MA 4RM9A 2BWES 1QILA 4M0WA 3NJTA 1FEHA 1SSNA 2BS2B 2DENB 4RGTA 1YJIA 1YD8U 2LASA 2ZJDA 4JWSC 1R4NI 1N5XA 3PGEA 3K9PB 3AMZA 1I4PA 2M4NA 4GDLB 5FKAC 1K52A 2N9LA 2QJLA 2MX2A 2KX0A 4YWGG 3TIXA 2ZZPB 3CSFA 2BQQA 3TBLD 1HEZE 5D7GA 2NBWB 1V97A 4ASWC 4DK5A 3DCGA 1JQ4A 4P7IA 1YJJA 2M1MA 1L7YA 4WJPA 1SE9A 2CS4A 1T0RC 3SD5A 1VDVA 2WXOA 3DBLB 5KHQA 1E7UA 3MC0B 2GOWA 3QJZA 1OQYA 2C7MB 1E8XA 3PREA 3JW0X 1NI3A 2JQRB 4YT0B 2GRIA 4PK1A 3SFEB 2QC8A 4KIKB 1OGWA 3I9V1 3P63A 2JYEA 1GNUA 3RT3B 2WLBA 1SE2A 3Q69A 1K50A 2IO0B 2MRPA 4FJVB 3GP7A 3ZXRA 1B1ZA 1AYFA 3L13A 3NZSA 1TZOA 1L4ZB 1ZXHA 3N20C 1SBBB 2HTHA 2JRIB 3FC4A 4GOCA 3U7ZA 2ZNVC 1FNWA 1IPGA 3OWEB 1E5WA 2WXKA 2FNJB 3NRZA 2HTME 5DPSA 4DQOC 3I57A 4LCDE 3QQ8B 1NVID 3VTVA 4X57B 5G5GA 4MJSB 2KACA 3A9JB 2WXIA 4ANUA 1C79A 4C7ZA 5IN7A 4LDTB 2QHOA 3AE6B 1J7CA 4TQ0A 4DXFA 3A9KB 2MH7A 4H2AA 4TSSA 2XK5A 4YL8A 1GB4A 3ABVB 1QOFA 4NZLB 4JX1C 5KHOA 1L2NA 2LGDA 3RNEC 1Q10A 1F2RC 2J0KA 4EOYA 2V9HA 1EUVB 1FXTB 4B6WA 4QAYA 4OVVA 2WXRA 4ZRKA 3ZDTA 1AWDA 2N9PC 3N9YC 3TJPA 1CJEA 4HJKA 1EWYC 3LJ3A 2N9KA 2DBYA 2IGGA 2KFJA 3VFKA 4AQ7A 4TKNA 3DBRI 1DYQA 3QHTA 1WSPA 2G4DB 3DWMA 1EU4A 2XK5B 2UYZB 2KQ4X 2L3ZA 1QOAA 4WWPA 3ENEA 2JXTA 3PV1A 3AEFB 4ARCA 1MHXA 2PVGC 4IUMB 3LYYA 3MFGA 4PT5A 3R8BA 2CHZA 1ZGUB 2G45B 4NQLB 5HKHA 1L5PA 3JYUA 2N4FA 1TT5B 1MPEA 4LNFA 1AARA 2L8JA 2KWVB 1JWUD 1C4PA 3IG3A 2YVCA 4GGQA 2M56B 3Q3MC 1EF5A 3BVMA 2KWUB 4A8XC 3DPDA 4E71A 2I1JA 1E90A 1E8WA 1HXYD 2BT6A 2BB6A 1XXGA 2EMSA 4AOFA 2JWZA 2REXA 1J8CA 2XEWA 1EO6A 3Q8FA 4US8A 3ZLZA 1J7AA 4EZKA 1IGDA 4FN2A 2NS5A 3T3OA 3RPFC 1WFYA 3V05A 3L0WB 4E3CA 4TV3A 2J42A 3HIZA 4FHJA 1UF0A 1JRPA 4D2KA 2B3AA 3P42A 4A9AA 2VZKB 1SE3A 2WXNA 3WAMA 3KUDB 2CHXA 2FCSA 1UWMA 2AX5A 3C8YA 3DHIC 3QIJA 4WH4A 3AECB 4N9F4 5GXGB 3UQBA 5FR6A 4GB9A 2MP2B 1HQRD 2LVOA 1WY8A 3VRAB 1SXTA 1IUEA 1YIWA 1RFAA 2MBOA 1MVKA 4OVUA 2G4SA 4KDLB 3AM9A 2KTRB 5H92C 3I5JC 4WWOA 4FHKA 3VDZA 4ZYSA 1A5RA 2INDC 1L4DB 2AWTA 4MDKE 4LK0M 2L76A 2QDFA 3H7SA 4AUQC 1VLBA 1ET9A 1CK1A 3B2GA 4OZAA 4OZBA 3Q14C 4EUTA 4HJGE 1PGAA 3PSEB 2QIEB 1RFKA 5EE3A 1V81A 3T3NA 3FILA 5IOIA 3KW5B 2LFIA 1UD7A 2LVPA 5J17A 2J4XA 4TUUA 2ICIA 1WXMA 2GBKA 5J18A 3CIRB 2KVRA 4ZDVA 1YJ1A 3TEZA 2KXJA 2K3UA 2NPTA 1FIQA 1TY2A 1UH6A 2JU6X 1FCLA 1ET6A 2O6VD 3ZTDA 2HE7A 4M00A 2GLSA 1JROA 3AEGB 4HCPB 3PRMB 3NUHB 3EFCA 1XEEA 1V1OA 3L08A 4N59A 3EC8A 3SU8X 3BY4B 2KD0A 2VH1A 3GE3C 3AE5B 2IO1B 3BZDB 2NVUI 1T0YA 4MJSA 5IAAC 3W1SA 5FR3A 3AE9B 3D32A 3Q2AC 1E0ZA 4LJOB 3RNAC 2GBMA 5G55A 3HHMA 4KDIC 2L7RA 1R7SA 1NYQA 2ZNVB 3NZ3A 3N1XC 2D10A 1IGCA 2N0SB 2LD9A 1Y8RC 3I3TB 4FBJB 3RI7C 3O65B 3AXCA 4EKUA 4A90A 2GMIC 2D2QA 5D2MB 1VR9A 4DBGA 1JALA 1QQRA 3EUB2 5BYSA 3BYTB 3VQIA 2PMVA 2CJOA 4ZYNA 3RNCC 2PE9A 4II2B 2HJ8A 2MBHA 2EMTA 1ENFA 1S3SG 1V1PB 3HRDD 1WGYA 1UELA 2YEPF 2K0PA 5C23A 5IA7A 3PRPB 4YSZB 2N7JA 4BKGA 2BBCA 1FNVA 4K1RB 1YOVB 2BVCA 3AE2B 2QMTA 3KYDD 3ZRCA 5EDSA 2K8HA 4GDKA 1Q5WB 4XE0A 2PVOD 2FCNA 5BMHA 2BGFA 2WX0A 4KV2A 3WAOA 1F2RI 2K9XA 3AEBB 2WXHA 3A4SC 1N6ZA 2KFKA 3IVFA 1IYFA 5DCNA 4B95A 1ISNA 1WMHA 3A9JA 3CF6E 1R4MB 1E8ZA 1SIFA 4RMAA 4BFRA 4HPPA 1OTRB 1TBEA 3DBRB 2LVQA 3TMPB 4FULA 4K7SA 4CYEA 4KZCA 3IBEA 3V6EB 1D4BA 2W3RA 5HFYA 2NPTB 3ZIMA 5IO9A 4ANVA 2L0FA 4NJ6A 1WRIA 1ZP0B 4L1BA 1LXDA 4PS7A 2AYOB 4K3CA 4NNJB 4P16A 3V61A 3KUZA 2TSSA 1P98A 2J0MA 4GLSC 5L83A 1FM0D 3ETRA 5JH5C 4AWJA 1I4HA 2K6QA 3V3XA 3DVNV 4WJOA 4BKTA 4WQMA 2LJ5A 3ZW3A 1FRDA 2KYWA 2ZPNA 2K8BA 4WURA 1ROEA 1EM7A 1NI2A 3DBHI 4HK2A 3MJWA 3HK0A 1KTKA 2RR9A 2D3AA 2INPE 1WZ0A 4C00A 3V60A 2MW5A 1C76A 2ZPYA 3PVLA 4ZRJA 4WAFA 1V9JA 4AJYB 4M0WB 2GBRA 2YEPB 3WANA 2KDMA 4MACA 2KN4A 1ZXIA 3RULA 3M62B 1DGJA 2HDEA 1GB1A 3DHGC 1WWTA 4I6NB 5E6NA 4LNKA 2MQJA 4DXGA 2V3PA 2Z59B 3WCQA 1NYRA 3Q3JA 2JPHA 2UWQA 3ZGZA 3ZO5B 4B9KA 2ZVOA 3EGRA 1TKYA 3H6NA 1GPXA 3RZWC 1I4RA 1WGHA 1I4GA 4J3OD 1K53A 4LTUA 1V6EA 1WGRA 3WIMA 4HCNB 4LJPB 1J19A 3ONSA 2ASQA 4IWPA 2DHZA 3VH4B 2KOXA 3U7DA 4P1BC 2GI9A 3QAQA 2L52A 2DAJA 2KDFB 1P7EA 2D5GA 3GS2A 2IJ0A 2D3GA 3MP9A 3AEDB 1J7BA 4W9DA 3QK0A 2KANA 3EHVA 2K5PA 3NS8A 4KGSA 4JLCA 4N6EB 1WZ3A 3VHTC 2RDHA 4W9HA 2EELA 5HI1A 4CQNA 3AU4A 3B2FA 3DVGY 1MJDA 4W9JA 4C56C 3A1QB 4IOIE 1TS4A 1YNTE 2FBWB 2KX3A 2PE6B 3DQVA 2M0AA 3UIOB 2C60A 1BUIC 2QEJC 5CX3A 3T8MA 4KSLC 2NTTA 3BK1A 3VTWA 3ZJVA 1WXVA 2L32A 3M3JA 3BVGA 3OAWA 3FILB 2ON8A 3N1ZC 2X38A 3N32A 4RF1A 3N1YC 3MHSD 1L6VA 1MG8A 4US9A 2MBEA 1ZKHA 2OEDA 1FXIA 4HRSA 5C1ZA 3L54A 1MI0A 3V62A 4PYUA 4BOSC 3AB5A 3VUWA 1WE7A 1LGRA 2AL6A 2RD0A 3VRBB 5CHVC 4F8CB 5BMIA 2J0JA 3KH0A 1WYGA 3PPAA 4URKA 1GJZA 4NPNA 4OHJA 2YLMA 1JRUA 2HD5B 4JGHB 4KGRA 3L10B 1TKGA 4BZAA 1JCKB 4YTPB 2MWSB 2D07B 4XX5A 2MHJA 1HE8A 4YTMB 1SF0A 4NAMA 4HKQA 3K9OB 4W9CA 1XCTL 2ZEQA 3BK2A 1FFUA 2KDEB 1V5OA 1N62A 3VR8B 1OQQA 1RWSA 1WXQA 3TUOA 1OEYJ 4K81A 3AE8B 4IDIA 1TS2A 1ZDVA 1GAQB 4EE2A 2LZ6A 2I2YA 2JSVX 1E7VA 2WQYB 2X8XX 5LLIA 3GZNB 2QILA 4MGYE 4KVGB 1WJNA 2LWPA 3R2IA 2LMCA 3R66C 3VR9B 1T0QC 3GZNI 3AEAB 3Q3FA 3Q8BA 2LGSA 3C0RB 2LXAA 5MPOA 1HTQA 2WDRB 2NBUA 4P6VF 3B08A 2OHFA 2KVZA 4RNAA 1WX8A 3VXWA 1RLFA 4YXDB 2AQ2B 1SGHA 3W5VB 2WNMA 3SFDB 3PLVA 2UU7A 1HZ6A 2ONQA 1D5MC 3AI5A 5LXIB 4JPSA 3W9CB 1UWXA 1Q0WB 1FNUA 1XLOA 3NVZA 1IP9A 4JL9A 4MH0E 3W1YA 2HJ1A 3W5UB 2JZPA 1HA5A 2G3QB 3ZNHB 5D94A 2M17A 1UZXB 2DZKA 3PTFC 2DWQA 3NG0A 5DPRA 1L0YB 4A55A 3TEWA 4DHZE 4JQWC 1FXAA 2KMCA 3PLUA 2ZVNA 2Y5CA 3UGBB 1WJ6A 2LGXA 4GDKB 1SJHD 2WHIA 2BYTA 4XZ4A 3Q3NC 2MSED 1YMHE 3BWUD 3TCAA 2KLGA 5E6JA 1YQ3B 4DWFA 2KWCA 3DDCB 2KQ7A 3AH7A 3AEEB 3PO0A 2KJ6A 4ZRIA 3IFWB 3ZNGC 1SIJA 4LNNA 4PYZA 1TZ1A 4W9LA 2KMMA 3IAM1 1I42A 1F52A 1FPYA 2I38A 3ALBA 1V5TA 4FJYA 2GBJA 1LO5D 3BINA 1IBXA 2OJWA 1UGJA 5L95C 2KT7A 1E8YA 5C2TB 1N60A 2BS4B 5BYQA 2FIDA 1C4CA 2SAKA 2BYEA 3Q6BA 4RFBA 2CU3A 3ZYYX 3ZXVA 1X1MA 2AEHA 2Y5PA 3JSVB 1I35A 4A3OA 2FAZA 2RPQA 1ESFA 3BVZA 4ARIA 2JF5A 3ZTCA 2IY0B 4EZLA 4MSQB 1KLUD 2KDBA 2C9WB 1WE6A 3P2BA 4RGNA 1R4NB 4JIOU 2QCZA 3MC8A 2D11A 4HWIB 3W2DA 2N7EA 2KMAA 3ZNID 4DXAB 1WGKA 4KSKC 3VTUA 3LDZE 2SEBD 4M02A 1D5XC 2KTRA 4DDID 1PFDA 3VUXA 4KIKA 3WALA 2WXLA 3EECA 2Q5WD 2LRWA 4DDGD 1U4AA 4BKSD 1WGGA 2WXGA 4BKSA 5AZFA 2IZVB 2KKCA 4GMVA 1FFVA 4II3B 1XQQA 4CHKA 4MGZE 3HUIA 4IKGA 4AS1A 4KGTA 4MM3A 3TL5A 3DVNU 2W3SA 3FAHA 4MM3B 2MCNB 2JWUA 1ZOYB 3MTNB 2W9NA 2PPHA 5AZHA 1TGZB 3N3KB 2IY1B 1GC6A 2WYQA 1XO3A 4IWOA 1UBQA 1T6BX 4S0RA 2BS3B 4K7UA 4R3DA 4ZRQA 3P1MA 3R2TA 1KFYB 1GC7A 3SHQA 3KWVA 2DX5B 1WIAA 4BBNC 2CJNA 2WP9B 5EE9A 3Q3OC 1MFWA 4HLEA 4AJWA 1KLVA 3U52E 1UBIA 3PHXB 2LUMA 2DYOA 4DHJB 4XDDA 1V80A 1QT9A 4L23A 2D3BA 1XLNA 4GU2A 2L0TA 3ZJTA 4ACFA 1F9JA 4TQ1A 2EKIA 5DPTA 3ECIA 2N1WA 3DBLI 2CHWA 1C3TA 1OFFA 3VH3B 2M19A 2LRUA 3H7PA 4MGKE 1FO4A 1QOGA 4XC2A 2BB5A 2XBBC 2MP2A 2RDGA 2L05A 3L17A 5JHAA 4BAXA 2RDBC 4Q2JA 1VZ8A 2JXXA 3KQ4A 2Z0DB 3A33B 3NS1A 2JVCA 4WWMA 4CO7A 2IGHA 1JMLA 1WGDA 3LXFA 3Q8EA 2OJRA 3OJ3A 1T0SC 1QLBB 1P7FA 2BYFA 2E3TA 2KAJA 1WXAA 5JZEB 1GG3A 3I63C 1PGXA 3NZUA 2IPKD 2PW9A 3IAS1 4NQKE 1BT0A 1DOYA 4ITKA 4KX6B 1WM2A 3NY5A 1WXSA 4C80A 1C4AA 1QF6A 2ZCCA 2O6VA 2PIAA 4KZ0A 4FJZA 2Z0EB 1S1QB 1P9DU 1C1YB 4M8NA 4AP4C 1RM6C 4L2YA 2Y5BB 2M0XA 1VZ6A 3AE4B 2NMQA 1XT9B 2JX5A 3APDA 3X23A 2VH2A 5LNK1 2WU5B 1RAXA 1KOTA 3T9LA 3SR6A 3RNFC 5E6PA 1YN3A 1Y56A 2KO3A 1JWSD 5E6OA 1JWMD 2DZIA 3AULA 2H89B 1WJ4A 5IKCM 4WJNA 4ZRPA 2N9EB 4IM3A 3SEBA 1BXTA 3QA8A 3PS6A 2N1VA 4OVZA 2XN9C 1DOIA 2DNFA 3AN1A 3M95A 3NVYA 2FUHB 1IBXB 3GE8C 2WDVB 4MEMA 1H8CA 2R2OA 4WWNA 2WXJA 3DHHC 3IT4B 2W82A 5G2NA 1WRDB 3P4QB 4LLGM 5EE1A 3L4PA 2IYDB 2LXCA 1AN8A 2A4ZA 1OQRA 4OZCA 2N9XA 1KLGD 4RGMA 3U2SC 2LGYA 3AU5A 1VZ7A 3HVZA 1ZW7A 1N61A 3B9JA 2O2VB 3QARA 4XWWA 2FIFA 3AE3B 1MHHE 3MHZA 1TYGB 3QC8B 2BYVE 1DOXA 2C7NB 3PHWB 4A20A 4I6LB 2KWDA 3KLSX 1NEKB 1E10A 2CR5A 4ZHOA 4GN1A 3WAPA 4W9FA 1WH3A 1J0GA 4W9EA 4ICVA 2LI5A 1A70A 5AUIA 3P4RB 1VRAB 3TEXA 1FCCC 3UIPB 2C7HA 4C4VB 2IO3B 5I4DA 3GOEA 4BOZB 4LDTD 3LB8C 4M8MA 4ANWA 3P4PB 5AEKB 4EEWA 4PS8A 1V86A 2KZRA 1SJED 2K25A 2K1FA 3PZ8A 3H1UA 3APFA 1N5WA 5DPWA 3P4SB 4DHZB 2BPSA 3H7PB 3MJ5A 1PUTA 1D5ZC 4G3XB 2IGDA 2BKRB 4RM8A 4YTNB 3Q8AA 4C4VA 3ZQ4A 2VRRB 1WF9A 2Y3AA 4ZOHC 2WU2B 3OLMD 2G9HD 2VZKD 2WDTB 4IC7B 2BWFA 4F1SA 3RD2A 3ML9A 4MT5A 1XCQL 5H8YE 3R7RA 3B0AA 1EU3A 3PRZA 4C7YA 2EKEC 1SE4A 5GMVA 3QCAA 1HTOA 4A6QA 1PYWD 1WX9A 4GSWA 4N58A 3GB1A 4K7WA 2V3SA 1H4RA 2WDQB 4LNIA 2L83A 2O6VB 2DZJA 2XNAC 5D6JB 4ZHPA 4XYCA 4G50A 3HVDA 5JHBA 5AZGA 2KJHB 2DYBA 1C78A 1Z5SB 2QSDA 3URYA 1QOBA 3EFUA 1D6EC 1LFDA 4HXDA 4J6IA 2FCMA 4GXBA 4YSXB 3VVWB 1RYJA 2PEAA 3OJ4B 1WM3A 1AW7A 2KDIA 4XWTA 1ACCA 1QZEA 2BTEA 1WYWB 4EFOA 2DAFA 5T8IA 3PT2B 4F7ZA 3DVGX 3MC9A 2I1KA 2KHWB 1JWBD 1OEYA 4E74A 5CHFA 1TTNA 1YQBA 1LM8B 3U4EG 1TY0A 2ACZB 3Q8CA 4RCOA 2MLBA 1WMHB 1V1PA 3U8ZA 2WS3B 2V4LA 5TSSA 4S17A 1KH0A 1XD3B 2RPVA 1V8CA 1F0ZA 2MJDA 1M4VA 3L16A 1VD2A 3IT6B 5HG2A 2B76B 1EWCA 2E6XA 1GUAB 2DLBA 1YN5A 4WQOB 4MSMB 4WAAA 3UF8A 1WI0A 2M8SA 2IDYA 3H9DA 4NJCA 3A9KA 2FCQA 4G0NB 2RGFA 3U30A 1G6JA 2KNBA 4RGOS 3CWIA 2ZW0A 4HVBA 3HM3A 3JSVA 3NOBA 1NDDA 3RMKC 5IP4D 3V6CB 4B0EA 5LXHA 3RZFA 4RH6A 1WR1A 1GOZA 3PZDA 2JZZA 2JT4B 2MBBB 2NR2A 3NVWA 2WGSA 1KRHA 2LGIA 1YX6B 1VCBA 1I7HA 1JWAD 3RFZB 1I4QA 2KK8A 2CKHB 4NY0A 4DHJD 1XF5L 5C3JB 3E9SA 2JUOA 3DWGC 4LNOA 1Z2MA 2LUEA 2PTLA 1SEBD 2G1EA 1ZDXA 3ZRFA 3S2AA 3UI3A 1VJKA 2DZMA 5CHWA 1M94A 2K22A 2WXQA 1JW9D 2WWZA 3RN9C 4KKJA 4REZA 2V0GA 3X0WA 1NENB 3EA6A 3RNBC 2MJ3A 3UQAA 1F77A 2IBIB 1P3QU 2OOBB 4JWUC 4USAA 4HPLB 1NBFC 2KC2A 2ZW1A 2V1YA 3QX1A 1KF6B 4A3PA 2K39A 1LQBA 1V49A 2DYMA 5BYRA 4MH8A 3KUCB 4TMAB 3R7QA 3WA0A 3ML8A 5D3IB 2O2VA 5BO4B 2LHDA 3IHPC 3C19A 3PZ7A 5JXVA 4IG7B 3DBSA 4ANXA 4W9KA 1F1HA 5J2RA 2NTSA 2V3NA 2WXPA 3NVVA 1ZUD2 3OG5A 4MELA 4W9GA 2WXFA 4FADA 1K8RB 5BMGA 4HDOA 1STEA 2NCNA 3A1QA 1K51A 2K6DB 3JVZX 2MJEA 2JY6A 4NAWB 3TEYA 1CZPA 2JYTA 4NAWA 3O13A 4IM0A 3E56A 3VUYA 1KJTA 2JZ3B 1T3QA 3TSSA 5FK9C 2A5UA 2INCC 3ZKJC 2FUG1 2PLPA 3AV8A 3AE7B 3KVFB 5EE0A 1FRRA 4IW0A 4WIPA 2K8CA 1CMXB 3RNGC 1C77A 1WR6E 1EF1A 2KN5A 4HROA 1P1AA 1RRBA 1YN4A 4HDQA 2W54A 1PDXA 2L00B 2BF8B 1B9RA 4FA6A 1UNSA 3KWLA 1XLPA 4PS3A 3ZVVA 2KC1A 4ICUA 1L6UA 2W55A 3RUIB 2D3CA 1WX7A 2BKFA 2R2QA 4FXCA 3SDLC 2R61A 1D3ZA 1ZPSA 1ZE3D 3AE1B 1P0RA 4IWQA 1L0XB 3ZNZB 5HHDG 1C9FA 1PQSA 1E9MA 2RSUA 2KFKB 1E7PB 1CQVA 1L0VB 1UGMA 4GDLA 2INNE 2C5LC 1XLQA 2GB1A 2MEKA 5CTRC 3CMMB 3R3MA 4BVUC 3J9CA 2KJRA 1QKZA 1HZ5A 3M63B 3ZJUA
chains in the Genus database with same CATH topology
3ZDMC 4F8CB 2A4ZA 2J0JA 3KH0A 4EUTA 3HM6X 2N9XA 2KTFA 2ZCBA 3PSEB 2LGYA 3AU5A 3PPAA 4URKA 1GJZA 2JRHA 4NPNA 2YLMA 1R4MI 1JRUA 4I6PA 2HD5B 4JGHB 2KQSA 2WX1A 1ZW7A 2IO2B 1V81A 3L10B 2O2VB 3APCA 3QARA 2FIFA 3DOWA 2MWSB 3B1LX 2D07B 3KW5B 3QWZB 4XX5A 3ZUNA 1HE8A 1UD7A 5TR5A 3K9OB 4W9CA 4FLHA 2ZEQA 3QC8B 2BYVE 4EZJA 1YX5B 2KDEB 2C7NB 2LVPA 3N30A 1V5OA 5J17A 4TUUA 3PHWB 4A20A 2CU1A 1WXMA 2GBKA 2PJHA 5J18A 4ZDVA 2KVRA 1OEYJ 4I6LB 4K81A 1YJ1A 2KXJA 2NPTA 4WJQA 1Q1OA 2CR5A 1UH6A 4G11A 4GN1A 3WAPA 2LZ6A 1E7VA 1WH3A 4W9FA 4BBNF 1J0GA 4W9EA 2AL3A 4ICVA 2LI5A 2O6VD 5LLIA 3ZTDA 2HE7A 3UIPB 2C7HA 2IO3B 4MGYE 4KVGB 1WJNA 3W1SC 2LWPA 2MBQA 3GOEA 4HCPB 3R66C 3PRMB 4BOZB 1V2YA 4LDTD 4M8MA 4ANWA 3GZNI 5AEKB 4EEWA 3Q3FA 3C0RB 4PS8A 2LXAA 1V86A 3L08A 2KZRA 2NBUA 4W9IA 3B08A 2K25A 3EC8A 3NHEB 1WX8A 3VXWA 2K1FA 1RLFA 3SU8X 3BY4B 4GIVA 1SGHA 2KD0A 2GBNA 2NBVB 3APFA 3H1UA 2IO1B 2NVUI 2N7DA 3PLVA 1T0YA 4DHZB 4MJSA 5IAAC 5DPWA 3W1SA 2BPSA 3H7PB 4IM2A 3AI5A 5LXIB 3D32A 4G3XB 2BKRB 4RM8A 4LJOB 2GBMA 5G55A 3HHMA 4KDIC 2L7RA 1Q0WB 3RYTA 2VRRB 3RCZA 1WF9A 2MA9B 3OLMD 2ZNVB 3UINB 3A4RA 1IP9A 1WJUA 4JL9A 4MH0E 3VAWA 2WDTB 1KM7A 3W1YA 2D10A 4IC7B 2LD9A 2BWFA 2G3QB 4F1SA 3ZNHB 3RD2A 1Y8RC 3I3TB 3ML9A 2M17A 4HPMB 5D94A 3R7RA 4FBJB 1UZXB 2DZKA 3PTFC 2KLCA 5DPRA 3O65B 3AXCA 3CSTA 4EKUA 3B0AA 4DHZE 4JQWC 2GMIC 3PRZA 2EKEC 2D2QA 2KMCA 5D2MB 5GMVA 3QCAA 3PLUA 2ZVNA 4DBGA 2J7QB 3UGBB 1WX9A 4GSWA 4MGIE 1WJ6A 2LGXA 3VQIA 4K7WA 4GDKB 3KYCD 4NJ7A 4ZYNA 4RM9A 4XZ4A 2BWES 2PE9A 2V3SA 1H4RA 2MSED 4II2B 2O6VB 2DZJA 2HJ8A 2MBHA 2EMTA 2DENB 5D6JB 1S3SG 4G50A 3TCAA 5JHBA 1YD8U 1WGYA 1UELA 2KJHB 5AZGA 2DYBA 1Z5SB 2KLGA 2LASA 2ZJDA 5C23A 2KWCA 4DWFA 5IA7A 1R4NI 3EFUA 3PGEA 3K9PB 1LFDA 4HXDA 2M4NA 3PRPB 3DDCB 2KQ7A 4GDLB 4J6IA 2FCMA 4BKGA 4GXBA 2KJ6A 2MX2A 4K1RB 4ZRIA 3IFWB 3ZNGC 2KX0A 3TIXA 3VVWB 3KYDD 3ZRCA 2ZZPB 4PYZA 5EDSA 3CSFA 2K8HA 4GDKA 1TZ1A 2PEAA 4W9LA 1Q5WB 3OJ4B 3TBLD 1WM3A 5D7GA 2KDIA 1I42A 2NBWB 4ASWC 2FCNA 4DK5A 3ALBA 2BGFA 1QZEA 2WX0A 3DCGA 4KV2A 3WAOA 4P7IA 1WYWB 3A4SC 2DAFA 4EFOA 1V5TA 2M1MA 4FJYA 1L7YA 2GBJA 3PT2B 4WJPA 3BINA 2KFKA 3IVFA 1SE9A 1IYFA 4F7ZA 2CS4A 3DVGX 2I1KA 2KHWB 5DCNA 4B95A 5L95C 3SD5A 1OEYA 4E74A 5CHFA 1E8YA 1TTNA 1YQBA 1LM8B 1ISNA 5KHQA 1E7UA 1WMHA 3A9JA 2GOWA 1OQYA 3CF6E 3QJZA 2C7MB 2FIDA 1E8XA 2MLBA 1WMHB 3JW0X 3PREA 1E8ZA 2BYEA 3U8ZA 1SIFA 4RMAA 2V4LA 4KIKB 4BFRA 1X1MA 1OGWA 1XD3B 2AEHA 1TBEA 1OTRB 3JSVB 2LVQA 1I35A 4A3OA 2FAZA 3TMPB 3L16A 1VD2A 2RPQA 1GNUA 4FULA 3RT3B 2JF5A 3ZTCA 2IY0B 4K7SA 4CYEA 4KZCA 3IBEA 2IO0B 2MRPA 4MSQB 3V6EB 4EZLA 1GUAB 2KDBA 4FJVB 2C9WB 2NPTB 1WE6A 3P2BA 3L13A 3NZSA 3ZIMA 4JIOU 4WQOB 4ANVA 2L0FA 2D11A 4MSMB 4NJ6A 4WAAA 2HTHA 2JRIB 4HWIB 3UF8A 2N7EA 1WI0A 2M8SA 4GOCA 2ZNVC 2KMAA 3H9DA 3ZNID 1LXDA 1IPGA 4DXAB 1E5WA 2FCQA 3A9KA 4PS7A 2AYOB 4G0NB 4KSKC 3VTUA 2FNJB 3LDZE 4NNJB 2RGFA 3U30A 1G6JA 2KNBA 3V61A 3KUZA 5DPSA 2KTRA 4HVBA 3HM3A 3JSVA 3NOBA 1NDDA 1P98A 2J0MA 4DDID 3VUXA 4KIKA 5L83A 4LCDE 3V6CB 3WALA 3QQ8B 3EECA 5LXHA 3VTVA 3RZFA 4X57B 1WR1A 2LRWA 4MJSB 4DDGD 5JH5C 3PZDA 4AWJA 1U4AA 4BKSD 2K6QA 3A9JB 4ANUA 2JZZA 3DVNV 2JT4B 4WJOA 4BKTA 3ZW3A 2LJ5A 2MBBB 2NR2A 4LDTB 2QHOA 1WGGA 1YX6B 2ZPNA 4BKSA 5AZFA 2K8BA 4TQ0A 2IZVB 2KKCA 4GMVA 1VCBA 3A9KB 4II3B 1XQQA 4CHKA 2KK8A 1NI2A 2CKHB 4MGZE 4NY0A 3DBHI 4DHJD 2XK5A 4HK2A 4MM3A 3TL5A 4YL8A 3DVNU 3MJWA 2MCNB 2JUOA 3HK0A 1Z2MA 3MTNB 2LUEA 2W9NA 2PPHA 2RR9A 5AZHA 1TGZB 1WZ0A 3N3KB 5KHOA 3V60A 2MW5A 1L2NA 2LGDA 2IY1B 2J0KA 2ZPYA 3PVLA 4ZRJA 3ZRFA 1GC6A 1V9JA 4AJYB 4EOYA 4M0WB 2WYQA 3S2AA 2GBRA 1EUVB 1FXTB 4IWOA 1UBQA 2DZMA 4B6WA 4K7UA 5CHWA 4OVVA 1M94A 2WWZA 4ZRKA 3WANA 3ZDTA 1GC7A 3SHQA 2DX5B 2N9PC 1WIAA 3TJPA 4BBNC 4HJKA 3LJ3A 3RULA 3M62B 4HLEA 4AJWA 1KLVA 1UBIA 2KFJA 4I6NB 3PHXB 3VFKA 3X0WA 2DYOA 4DHJB 5E6NA 1V80A 4TKNA 3DBRI 3QHTA 2MQJA 3UQAA 2IBIB 1P3QU 2OOBB 4GU2A 2L0TA 2Z59B 2G4DB 2XK5B 2UYZB 2L3ZA 3Q3JA 4HPLB 1NBFC 2JPHA 4WWPA 2UWQA 2KC2A 3ENEA 3PV1A 1F9JA 2V1YA 3QX1A 3ZO5B 4TQ1A 4B9KA 2ZVOA 2K39A 4A3PA 1LQBA 1V49A 4IUMB 2DYMA 3H6NA 3KUCB 5DPTA 3R7QA 3ECIA 3ML8A 3WA0A 2N1WA 3DBLI 2CHWA 2O2VA 1C3TA 5BO4B 3RZWC 3VH3B 3IHPC 2CHZA 1WGHA 1ZGUB 2G45B 2LRUA 3DBSA 3H7PA 4IG7B 4NQLB 4ANXA 5HKHA 4W9KA 4MGKE 5J2RA 3JYUA 2N4FA 1V6EA 4XC2A 1WGRA 3WIMA 4HCNB 2XBBC 2MP2A 4LJPB 2L05A 3L17A 5JHAA 1AARA 4MELA 2L8JA 4W9GA 4FADA 1J19A 1K8RB 2JXXA 3ONSA 2ASQA 2Z0DB 3A33B 4HDOA 2KWVB 4IWPA 2DHZA 2JVCA 2NCNA 3A1QA 3VH4B 4CO7A 2K6DB 1WGDA 2KOXA 3JVZX 3U7DA 2OJRA 3OJ3A 3QAQA 2JY6A 4NAWB 3IG3A 2DAJA 2KDFB 2YVCA 4GGQA 2BYFA 4NAWA 1EF5A 2KWUB 3DPDA 1WXAA 4IM0A 4E71A 2I1JA 5JZEB 1GG3A 3VUYA 1KJTA 2JZ3B 1E90A 3NZUA 1E8WA 2A5UA 2EMSA 4AOFA 4NQKE 1BT0A 2JWZA 2REXA 3ZKJC 1J8CA 2D3GA 2XEWA 1EO6A 1WM2A 3KVFB 3NY5A 1WXSA 3ZLZA 4W9DA 3QK0A 2KANA 2ZCCA 4IW0A 4EZKA 4FN2A 3EHVA 3NS8A 4JLCA 2O6VA 4KZ0A 4FJZA 2K8CA 2NS5A 1CMXB 2Z0EB 1S1QB 1P9DU 1WFYA 1WZ3A 1WR6E 1C1YB 3L0WB 1EF1A 2KN5A 4M8NA 3VHTC 4AP4C 4W9HA 4E3CA 4TV3A 3HIZA 1P1AA 1RRBA 2Y5BB 3AU4A 4HDQA 2M0XA 4FHJA 3DVGY 2L00B 4W9JA 2BF8B 3A1QB 4FA6A 1XT9B 2KX3A 3APDA 2B3AA 2PE6B 3X23A 4PS3A 3ZVVA 3DQVA 1RAXA 1KOTA 3T9LA 2KC1A 3UIOB 2C60A 4ICUA 3WAMA 3KUDB 5E6PA 2CHXA 2FCSA 5CX3A 3T8MA 4KSLC 3RUIB 2KO3A 3QIJA 1WX7A 5E6OA 4N9F4 3VTWA 1WXVA 2DZIA 3UQBA 3AULA 2BKFA 1WJ4A 2R2QA 5FR6A 3SDLC 4WJNA 2N9EB 4IM3A 4GB9A 2MP2B 3M3JA 3OAWA 2LVOA 1D3ZA 1WY8A 3N32A 3QA8A 1P0RA 3MHSD 3PS6A 4IWQA 1MG8A 2N1VA 1YIWA 1RFAA 3ZNZB 2MBOA 2MBEA 1ZKHA 4OVUA 3M95A 1PQSA 2G4SA 2FUHB 2RSUA 2KFKB 5C1ZA 4KDLB 3L54A 2KTRB 4MEMA 1H8CA 4WWOA 4FHKA 2R2OA 3VDZA 3V62A 1A5RA 2AWTA 4WWNA 1UGMA 4GDLA 4PYUA 4MDKE 4BOSC 5G2NA 2C5LC 1WRDB 2L76A 5CTRC 3H7SA 4AUQC 3CMMB 3R3MA 3VUWA 4BVUC 1WE7A 2KJRA 2AL6A 2RD0A 3M63B 2IYDB 2LXCA 5CHVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDM C;  4F8C B;  2A4Z A;  2J0J A;  3KH0 A;  4EUT A;  3HM6 X;  2N9X A;  2KTF A;  2ZCB A;  3PSE B;  2LGY A;  3AU5 A;  3PPA A;  4URK A;  1GJZ A;  2JRH A;  4NPN A;  2YLM A;  1R4M I;  1JRU A;  4I6P A;  2HD5 B;  4JGH B;  2KQS A;  2WX1 A;  1ZW7 A;  2IO2 B;  1V81 A;  3L10 B;  2O2V B;  3APC A;  3QAR A;  2FIF A;  3DOW A;  2MWS B;  3B1L X;  2D07 B;  3KW5 B;  3QWZ B;  4XX5 A;  3ZUN A;  1HE8 A;  1UD7 A;  5TR5 A;  3K9O B;  4W9C A;  4FLH A;  2ZEQ A;  3QC8 B;  2BYV E;  4EZJ A;  1YX5 B;  2KDE B;  2C7N B;  2LVP A;  3N30 A;  1V5O A;  5J17 A;  4TUU A;  3PHW B;  4A20 A;  2CU1 A;  1WXM A;  2GBK A;  2PJH A;  5J18 A;  4ZDV A;  2KVR A;  1OEY J;  4I6L B;  4K81 A;  1YJ1 A;  2KXJ A;  2NPT A;  4WJQ A;  1Q1O A;  2CR5 A;  1UH6 A;  4G11 A;  4GN1 A;  3WAP A;  2LZ6 A;  1E7V A;  1WH3 A;  4W9F A;  4BBN F;  1J0G A;  4W9E A;  2AL3 A;  4ICV A;  2LI5 A;  2O6V D;  5LLI A;  3ZTD A;  2HE7 A;  3UIP B;  2C7H A;  2IO3 B;  4MGY E;  4KVG B;  1WJN A;  3W1S C;  2LWP A;  2MBQ A;  3GOE A;  4HCP B;  3R66 C;  3PRM B;  4BOZ B;  1V2Y A;  4LDT D;  4M8M A;  4ANW A;  3GZN I;  5AEK B;  4EEW A;  3Q3F A;  3C0R B;  4PS8 A;  2LXA A;  1V86 A;  3L08 A;  2KZR A;  2NBU A;  4W9I A;  3B08 A;  2K25 A;  3EC8 A;  3NHE B;  1WX8 A;  3VXW A;  2K1F A;  1RLF A;  3SU8 X;  3BY4 B;  4GIV A;  1SGH A;  2KD0 A;  2GBN A;  2NBV B;  3APF A;  3H1U A;  2IO1 B;  2NVU I;  2N7D A;  3PLV A;  1T0Y A;  4DHZ B;  4MJS A;  5IAA C;  5DPW A;  3W1S A;  2BPS A;  3H7P B;  4IM2 A;  3AI5 A;  5LXI B;  3D32 A;  4G3X B;  2BKR B;  4RM8 A;  4LJO B;  2GBM A;  5G55 A;  3HHM A;  4KDI C;  2L7R A;  1Q0W B;  3RYT A;  2VRR B;  3RCZ A;  1WF9 A;  2MA9 B;  3OLM D;  2ZNV B;  3UIN B;  3A4R A;  1IP9 A;  1WJU A;  4JL9 A;  4MH0 E;  3VAW A;  2WDT B;  1KM7 A;  3W1Y A;  2D10 A;  4IC7 B;  2LD9 A;  2BWF A;  2G3Q B;  4F1S A;  3ZNH B;  3RD2 A;  1Y8R C;  3I3T B;  3ML9 A;  2M17 A;  4HPM B;  5D94 A;  3R7R A;  4FBJ B;  1UZX B;  2DZK A;  3PTF C;  2KLC A;  5DPR A;  3O65 B;  3AXC A;  3CST A;  4EKU A;  3B0A A;  4DHZ E;  4JQW C;  2GMI C;  3PRZ A;  2EKE C;  2D2Q A;  2KMC A;  5D2M B;  5GMV A;  3QCA A;  3PLU A;  2ZVN A;  4DBG A;  2J7Q B;  3UGB B;  1WX9 A;  4GSW A;  4MGI E;  1WJ6 A;  2LGX A;  3VQI A;  4K7W A;  4GDK B;  3KYC D;  4NJ7 A;  4ZYN A;  4RM9 A;  4XZ4 A;  2BWE S;  2PE9 A;  2V3S A;  1H4R A;  2MSE D;  4II2 B;  2O6V B;  2DZJ A;  2HJ8 A;  2MBH A;  2EMT A;  2DEN B;  5D6J B;  1S3S G;  4G50 A;  3TCA A;  5JHB A;  1YD8 U;  1WGY A;  1UEL A;  2KJH B;  5AZG A;  2DYB A;  1Z5S B;  2KLG A;  2LAS A;  2ZJD A;  5C23 A;  2KWC A;  4DWF A;  5IA7 A;  1R4N I;  3EFU A;  3PGE A;  3K9P B;  1LFD A;  4HXD A;  2M4N A;  3PRP B;  3DDC B;  2KQ7 A;  4GDL B;  4J6I A;  2FCM A;  4BKG A;  4GXB A;  2KJ6 A;  2MX2 A;  4K1R B;  4ZRI A;  3IFW B;  3ZNG C;  2KX0 A;  3TIX A;  3VVW B;  3KYD D;  3ZRC A;  2ZZP B;  4PYZ A;  5EDS A;  3CSF A;  2K8H A;  4GDK A;  1TZ1 A;  2PEA A;  4W9L A;  1Q5W B;  3OJ4 B;  3TBL D;  1WM3 A;  5D7G A;  2KDI A;  1I42 A;  2NBW B;  4ASW C;  2FCN A;  4DK5 A;  3ALB A;  2BGF A;  1QZE A;  2WX0 A;  3DCG A;  4KV2 A;  3WAO A;  4P7I A;  1WYW B;  3A4S C;  2DAF A;  4EFO A;  1V5T A;  2M1M A;  4FJY A;  1L7Y A;  2GBJ A;  3PT2 B;  4WJP A;  3BIN A;  2KFK A;  3IVF A;  1SE9 A;  1IYF A;  4F7Z A;  2CS4 A;  3DVG X;  2I1K A;  2KHW B;  5DCN A;  4B95 A;  5L95 C;  3SD5 A;  1OEY A;  4E74 A;  5CHF A;  1E8Y A;  1TTN A;  1YQB A;  1LM8 B;  1ISN A;  5KHQ A;  1E7U A;  1WMH A;  3A9J A;  2GOW A;  1OQY A;  3CF6 E;  3QJZ A;  2C7M B;  2FID A;  1E8X A;  2MLB A;  1WMH B;  3JW0 X;  3PRE A;  1E8Z A;  2BYE A;  3U8Z A;  1SIF A;  4RMA A;  2V4L A;  4KIK B;  4BFR A;  1X1M A;  1OGW A;  1XD3 B;  2AEH A;  1TBE A;  1OTR B;  3JSV B;  2LVQ A;  1I35 A;  4A3O A;  2FAZ A;  3TMP B;  3L16 A;  1VD2 A;  2RPQ A;  1GNU A;  4FUL A;  3RT3 B;  2JF5 A;  3ZTC A;  2IY0 B;  4K7S A;  4CYE A;  4KZC A;  3IBE A;  2IO0 B;  2MRP A;  4MSQ B;  3V6E B;  4EZL A;  1GUA B;  2KDB A;  4FJV B;  2C9W B;  2NPT B;  1WE6 A;  3P2B A;  3L13 A;  3NZS A;  3ZIM A;  4JIO U;  4WQO B;  4ANV A;  2L0F A;  2D11 A;  4MSM B;  4NJ6 A;  4WAA A;  2HTH A;  2JRI B;  4HWI B;  3UF8 A;  2N7E A;  1WI0 A;  2M8S A;  4GOC A;  2ZNV C;  2KMA A;  3H9D A;  3ZNI D;  1LXD A;  1IPG A;  4DXA B;  1E5W A;  2FCQ A;  3A9K A;  4PS7 A;  2AYO B;  4G0N B;  4KSK C;  3VTU A;  2FNJ B;  3LDZ E;  4NNJ B;  2RGF A;  3U30 A;  1G6J A;  2KNB A;  3V61 A;  3KUZ A;  5DPS A;  2KTR A;  4HVB A;  3HM3 A;  3JSV A;  3NOB A;  1NDD A;  1P98 A;  2J0M A;  4DDI D;  3VUX A;  4KIK A;  5L83 A;  4LCD E;  3V6C B;  3WAL A;  3QQ8 B;  3EEC A;  5LXH A;  3VTV A;  3RZF A;  4X57 B;  1WR1 A;  2LRW A;  4MJS B;  4DDG D;  5JH5 C;  3PZD A;  4AWJ A;  1U4A A;  4BKS D;  2K6Q A;  3A9J B;  4ANU A;  2JZZ A;  3DVN V;  2JT4 B;  4WJO A;  4BKT A;  3ZW3 A;  2LJ5 A;  2MBB B;  2NR2 A;  4LDT B;  2QHO A;  1WGG A;  1YX6 B;  2ZPN A;  4BKS A;  5AZF A;  2K8B A;  4TQ0 A;  2IZV B;  2KKC A;  4GMV A;  1VCB A;  3A9K B;  4II3 B;  1XQQ A;  4CHK A;  2KK8 A;  1NI2 A;  2CKH B;  4MGZ E;  4NY0 A;  3DBH I;  4DHJ D;  2XK5 A;  4HK2 A;  4MM3 A;  3TL5 A;  4YL8 A;  3DVN U;  3MJW A;  2MCN B;  2JUO A;  3HK0 A;  1Z2M A;  3MTN B;  2LUE A;  2W9N A;  2PPH A;  2RR9 A;  5AZH A;  1TGZ B;  1WZ0 A;  3N3K B;  5KHO A;  3V60 A;  2MW5 A;  1L2N A;  2LGD A;  2IY1 B;  2J0K A;  2ZPY A;  3PVL A;  4ZRJ A;  3ZRF A;  1GC6 A;  1V9J A;  4AJY B;  4EOY A;  4M0W B;  2WYQ A;  3S2A A;  2GBR A;  1EUV B;  1FXT B;  4IWO A;  1UBQ A;  2DZM A;  4B6W A;  4K7U A;  5CHW A;  4OVV A;  1M94 A;  2WWZ A;  4ZRK A;  3WAN A;  3ZDT A;  1GC7 A;  3SHQ A;  2DX5 B;  2N9P C;  1WIA A;  3TJP A;  4BBN C;  4HJK A;  3LJ3 A;  3RUL A;  3M62 B;  4HLE A;  4AJW A;  1KLV A;  1UBI A;  2KFJ A;  4I6N B;  3PHX B;  3VFK A;  3X0W A;  2DYO A;  4DHJ B;  5E6N A;  1V80 A;  4TKN A;  3DBR I;  3QHT A;  2MQJ A;  3UQA A;  2IBI B;  1P3Q U;  2OOB B;  4GU2 A;  2L0T A;  2Z59 B;  2G4D B;  2XK5 B;  2UYZ B;  2L3Z A;  3Q3J A;  4HPL B;  1NBF C;  2JPH A;  4WWP A;  2UWQ A;  2KC2 A;  3ENE A;  3PV1 A;  1F9J A;  2V1Y A;  3QX1 A;  3ZO5 B;  4TQ1 A;  4B9K A;  2ZVO A;  2K39 A;  4A3P A;  1LQB A;  1V49 A;  4IUM B;  2DYM A;  3H6N A;  3KUC B;  5DPT A;  3R7Q A;  3ECI A;  3ML8 A;  3WA0 A;  2N1W A;  3DBL I;  2CHW A;  2O2V A;  1C3T A;  5BO4 B;  3RZW C;  3VH3 B;  3IHP C;  2CHZ A;  1WGH A;  1ZGU B;  2G45 B;  2LRU A;  3DBS A;  3H7P A;  4IG7 B;  4NQL B;  4ANX A;  5HKH A;  4W9K A;  4MGK E;  5J2R A;  3JYU A;  2N4F A;  1V6E A;  4XC2 A;  1WGR A;  3WIM A;  4HCN B;  2XBB C;  2MP2 A;  4LJP B;  2L05 A;  3L17 A;  5JHA A;  1AAR A;  4MEL A;  2L8J A;  4W9G A;  4FAD A;  1J19 A;  1K8R B;  2JXX A;  3ONS A;  2ASQ A;  2Z0D B;  3A33 B;  4HDO A;  2KWV B;  4IWP A;  2DHZ A;  2JVC A;  2NCN A;  3A1Q A;  3VH4 B;  4CO7 A;  2K6D B;  1WGD A;  2KOX A;  3JVZ X;  3U7D A;  2OJR A;  3OJ3 A;  3QAQ A;  2JY6 A;  4NAW B;  3IG3 A;  2DAJ A;  2KDF B;  2YVC A;  4GGQ A;  2BYF A;  4NAW A;  1EF5 A;  2KWU B;  3DPD A;  1WXA A;  4IM0 A;  4E71 A;  2I1J A;  5JZE B;  1GG3 A;  3VUY A;  1KJT A;  2JZ3 B;  1E90 A;  3NZU A;  1E8W A;  2A5U A;  2EMS A;  4AOF A;  4NQK E;  1BT0 A;  2JWZ A;  2REX A;  3ZKJ C;  1J8C A;  2D3G A;  2XEW A;  1EO6 A;  1WM2 A;  3KVF B;  3NY5 A;  1WXS A;  3ZLZ A;  4W9D A;  3QK0 A;  2KAN A;  2ZCC A;  4IW0 A;  4EZK A;  4FN2 A;  3EHV A;  3NS8 A;  4JLC A;  2O6V A;  4KZ0 A;  4FJZ A;  2K8C A;  2NS5 A;  1CMX B;  2Z0E B;  1S1Q B;  1P9D U;  1WFY A;  1WZ3 A;  1WR6 E;  1C1Y B;  3L0W B;  1EF1 A;  2KN5 A;  4M8N A;  3VHT C;  4AP4 C;  4W9H A;  4E3C A;  4TV3 A;  3HIZ A;  1P1A A;  1RRB A;  2Y5B B;  3AU4 A;  4HDQ A;  2M0X A;  4FHJ A;  3DVG Y;  2L00 B;  4W9J A;  2BF8 B;  3A1Q B;  4FA6 A;  1XT9 B;  2KX3 A;  3APD A;  2B3A A;  2PE6 B;  3X23 A;  4PS3 A;  3ZVV A;  3DQV A;  1RAX A;  1KOT A;  3T9L A;  2KC1 A;  3UIO B;  2C60 A;  4ICU A;  3WAM A;  3KUD B;  5E6P A;  2CHX A;  2FCS A;  5CX3 A;  3T8M A;  4KSL C;  3RUI B;  2KO3 A;  3QIJ A;  1WX7 A;  5E6O A;  4N9F 4;  3VTW A;  1WXV A;  2DZI A;  3UQB A;  3AUL A;  2BKF A;  1WJ4 A;  2R2Q A;  5FR6 A;  3SDL C;  4WJN A;  2N9E B;  4IM3 A;  4GB9 A;  2MP2 B;  3M3J A;  3OAW A;  2LVO A;  1D3Z A;  1WY8 A;  3N32 A;  3QA8 A;  1P0R A;  3MHS D;  3PS6 A;  4IWQ A;  1MG8 A;  2N1V A;  1YIW A;  1RFA A;  3ZNZ B;  2MBO A;  2MBE A;  1ZKH A;  4OVU A;  3M95 A;  1PQS A;  2G4S A;  2FUH B;  2RSU A;  2KFK B;  5C1Z A;  4KDL B;  3L54 A;  2KTR B;  4MEM A;  1H8C A;  4WWO A;  4FHK A;  2R2O A;  3VDZ A;  3V62 A;  1A5R A;  2AWT A;  4WWN A;  1UGM A;  4GDL A;  4PYU A;  4MDK E;  4BOS C;  5G2N A;  2C5L C;  1WRD B;  2L76 A;  5CTR C;  3H7S A;  4AUQ C;  3CMM B;  3R3M A;  3VUW A;  4BVU C;  1WE7 A;  2KJR A;  2AL6 A;  2RD0 A;  3M63 B;  2IYD B;  2LXC A;  5CHV C; 
#chains in the Genus database with same CATH topology
 1E6E B;  3ZDM C;  3HM6 X;  4HEA 1;  2KTF A;  2ZCB A;  4P1C C;  2RMM A;  2JRH A;  1PGB A;  1R4M I;  2AQ1 B;  4I6P A;  2KQS A;  2WX1 A;  2IO2 B;  3APC A;  3DOW A;  3B1L X;  3QWZ B;  3ZUN A;  1I4X A;  2WXM A;  5TR5 A;  2PKO A;  2LEK A;  4FLH A;  2J52 A;  1TKE A;  4UDU C;  4EZJ A;  1YX5 B;  3N30 A;  1TIF A;  2CU1 A;  2PJH A;  4K3B A;  5AUK A;  4WJQ A;  1Q1O A;  4G11 A;  2L1A A;  4BBN F;  2AL3 A;  2V4I B;  5D3D A;  4XDC A;  3W1S C;  1FD6 A;  2MBQ A;  1TJE A;  4RF0 A;  1V2Y A;  2LHE A;  4W9I A;  2LJI A;  3NHE B;  4GIV A;  2AQ3 B;  2GBN A;  2NBV B;  2N7D A;  2FE8 A;  1MG4 A;  3IXS A;  4IM2 A;  3DBH B;  4YSY B;  3RYT A;  2BW2 A;  3RCZ A;  2MA9 B;  3BYY B;  1SB3 C;  3FKY A;  3UIN B;  3A4R A;  1WJU A;  3VAW A;  4JE3 B;  1KM7 A;  1T5X D;  4XGA B;  1TS5 A;  4HPM B;  5G5H A;  4OW0 A;  3H8H A;  4KKI A;  4O1N A;  2KLC A;  3CST A;  2Z8L A;  1TS3 A;  1UUP A;  3BII D;  4M01 A;  1BML C;  2H88 B;  2J7Q B;  2J53 A;  1YQ4 B;  1N63 A;  4MGI E;  4HKZ E;  1FMA D;  3KYC D;  4NJ7 A;  4B0M A;  4RM9 A;  2BWE S;  1QIL A;  4M0W A;  3NJT A;  1FEH A;  1SSN A;  2BS2 B;  2DEN B;  4RGT A;  1YJI A;  1YD8 U;  2LAS A;  2ZJD A;  4JWS C;  1R4N I;  1N5X A;  3PGE A;  3K9P B;  3AMZ A;  1I4P A;  2M4N A;  4GDL B;  5FKA C;  1K52 A;  2N9L A;  2QJL A;  2MX2 A;  2KX0 A;  4YWG G;  3TIX A;  2ZZP B;  3CSF A;  2BQQ A;  3TBL D;  1HEZ E;  5D7G A;  2NBW B;  1V97 A;  4ASW C;  4DK5 A;  3DCG A;  1JQ4 A;  4P7I A;  1YJJ A;  2M1M A;  1L7Y A;  4WJP A;  1SE9 A;  2CS4 A;  1T0R C;  3SD5 A;  1VDV A;  2WXO A;  3DBL B;  5KHQ A;  1E7U A;  3MC0 B;  2GOW A;  3QJZ A;  1OQY A;  2C7M B;  1E8X A;  3PRE A;  3JW0 X;  1NI3 A;  2JQR B;  4YT0 B;  2GRI A;  4PK1 A;  3SFE B;  2QC8 A;  4KIK B;  1OGW A;  3I9V 1;  3P63 A;  2JYE A;  1GNU A;  3RT3 B;  2WLB A;  1SE2 A;  3Q69 A;  1K50 A;  2IO0 B;  2MRP A;  4FJV B;  3GP7 A;  3ZXR A;  1B1Z A;  1AYF A;  3L13 A;  3NZS A;  1TZO A;  1L4Z B;  1ZXH A;  3N20 C;  1SBB B;  2HTH A;  2JRI B;  3FC4 A;  4GOC A;  3U7Z A;  2ZNV C;  1FNW A;  1IPG A;  3OWE B;  1E5W A;  2WXK A;  2FNJ B;  3NRZ A;  2HTM E;  5DPS A;  4DQO C;  3I57 A;  4LCD E;  3QQ8 B;  1NVI D;  3VTV A;  4X57 B;  5G5G A;  4MJS B;  2KAC A;  3A9J B;  2WXI A;  4ANU A;  1C79 A;  4C7Z A;  5IN7 A;  4LDT B;  2QHO A;  3AE6 B;  1J7C A;  4TQ0 A;  4DXF A;  3A9K B;  2MH7 A;  4H2A A;  4TSS A;  2XK5 A;  4YL8 A;  1GB4 A;  3ABV B;  1QOF A;  4NZL B;  4JX1 C;  5KHO A;  1L2N A;  2LGD A;  3RNE C;  1Q10 A;  1F2R C;  2J0K A;  4EOY A;  2V9H A;  1EUV B;  1FXT B;  4B6W A;  4QAY A;  4OVV A;  2WXR A;  4ZRK A;  3ZDT A;  1AWD A;  2N9P C;  3N9Y C;  3TJP A;  1CJE A;  4HJK A;  1EWY C;  3LJ3 A;  2N9K A;  2DBY A;  2IGG A;  2KFJ A;  3VFK A;  4AQ7 A;  4TKN A;  3DBR I;  1DYQ A;  3QHT A;  1WSP A;  2G4D B;  3DWM A;  1EU4 A;  2XK5 B;  2UYZ B;  2KQ4 X;  2L3Z A;  1QOA A;  4WWP A;  3ENE A;  2JXT A;  3PV1 A;  3AEF B;  4ARC A;  1MHX A;  2PVG C;  4IUM B;  3LYY A;  3MFG A;  4PT5 A;  3R8B A;  2CHZ A;  1ZGU B;  2G45 B;  4NQL B;  5HKH A;  1L5P A;  3JYU A;  2N4F A;  1TT5 B;  1MPE A;  4LNF A;  1AAR A;  2L8J A;  2KWV B;  1JWU D;  1C4P A;  3IG3 A;  2YVC A;  4GGQ A;  2M56 B;  3Q3M C;  1EF5 A;  3BVM A;  2KWU B;  4A8X C;  3DPD A;  4E71 A;  2I1J A;  1E90 A;  1E8W A;  1HXY D;  2BT6 A;  2BB6 A;  1XXG A;  2EMS A;  4AOF A;  2JWZ A;  2REX A;  1J8C A;  2XEW A;  1EO6 A;  3Q8F A;  4US8 A;  3ZLZ A;  1J7A A;  4EZK A;  1IGD A;  4FN2 A;  2NS5 A;  3T3O A;  3RPF C;  1WFY A;  3V05 A;  3L0W B;  4E3C A;  4TV3 A;  2J42 A;  3HIZ A;  4FHJ A;  1UF0 A;  1JRP A;  4D2K A;  2B3A A;  3P42 A;  4A9A A;  2VZK B;  1SE3 A;  2WXN A;  3WAM A;  3KUD B;  2CHX A;  2FCS A;  1UWM A;  2AX5 A;  3C8Y A;  3DHI C;  3QIJ A;  4WH4 A;  3AEC B;  4N9F 4;  5GXG B;  3UQB A;  5FR6 A;  4GB9 A;  2MP2 B;  1HQR D;  2LVO A;  1WY8 A;  3VRA B;  1SXT A;  1IUE A;  1YIW A;  1RFA A;  2MBO A;  1MVK A;  4OVU A;  2G4S A;  4KDL B;  3AM9 A;  2KTR B;  5H92 C;  3I5J C;  4WWO A;  4FHK A;  3VDZ A;  4ZYS A;  1A5R A;  2IND C;  1L4D B;  2AWT A;  4MDK E;  4LK0 M;  2L76 A;  2QDF A;  3H7S A;  4AUQ C;  1VLB A;  1ET9 A;  1CK1 A;  3B2G A;  4OZA A;  4OZB A;  3Q14 C;  4EUT A;  4HJG E;  1PGA A;  3PSE B;  2QIE B;  1RFK A;  5EE3 A;  1V81 A;  3T3N A;  3FIL A;  5IOI A;  3KW5 B;  2LFI A;  1UD7 A;  2LVP A;  5J17 A;  2J4X A;  4TUU A;  2ICI A;  1WXM A;  2GBK A;  5J18 A;  3CIR B;  2KVR A;  4ZDV A;  1YJ1 A;  3TEZ A;  2KXJ A;  2K3U A;  2NPT A;  1FIQ A;  1TY2 A;  1UH6 A;  2JU6 X;  1FCL A;  1ET6 A;  2O6V D;  3ZTD A;  2HE7 A;  4M00 A;  2GLS A;  1JRO A;  3AEG B;  4HCP B;  3PRM B;  3NUH B;  3EFC A;  1XEE A;  1V1O A;  3L08 A;  4N59 A;  3EC8 A;  3SU8 X;  3BY4 B;  2KD0 A;  2VH1 A;  3GE3 C;  3AE5 B;  2IO1 B;  3BZD B;  2NVU I;  1T0Y A;  4MJS A;  5IAA C;  3W1S A;  5FR3 A;  3AE9 B;  3D32 A;  3Q2A C;  1E0Z A;  4LJO B;  3RNA C;  2GBM A;  5G55 A;  3HHM A;  4KDI C;  2L7R A;  1R7S A;  1NYQ A;  2ZNV B;  3NZ3 A;  3N1X C;  2D10 A;  1IGC A;  2N0S B;  2LD9 A;  1Y8R C;  3I3T B;  4FBJ B;  3RI7 C;  3O65 B;  3AXC A;  4EKU A;  4A90 A;  2GMI C;  2D2Q A;  5D2M B;  1VR9 A;  4DBG A;  1JAL A;  1QQR A;  3EUB 2;  5BYS A;  3BYT B;  3VQI A;  2PMV A;  2CJO A;  4ZYN A;  3RNC C;  2PE9 A;  4II2 B;  2HJ8 A;  2MBH A;  2EMT A;  1ENF A;  1S3S G;  1V1P B;  3HRD D;  1WGY A;  1UEL A;  2YEP F;  2K0P A;  5C23 A;  5IA7 A;  3PRP B;  4YSZ B;  2N7J A;  4BKG A;  2BBC A;  1FNV A;  4K1R B;  1YOV B;  2BVC A;  3AE2 B;  2QMT A;  3KYD D;  3ZRC A;  5EDS A;  2K8H A;  4GDK A;  1Q5W B;  4XE0 A;  2PVO D;  2FCN A;  5BMH A;  2BGF A;  2WX0 A;  4KV2 A;  3WAO A;  1F2R I;  2K9X A;  3AEB B;  2WXH A;  3A4S C;  1N6Z A;  2KFK A;  3IVF A;  1IYF A;  5DCN A;  4B95 A;  1ISN A;  1WMH A;  3A9J A;  3CF6 E;  1R4M B;  1E8Z A;  1SIF A;  4RMA A;  4BFR A;  4HPP A;  1OTR B;  1TBE A;  3DBR B;  2LVQ A;  3TMP B;  4FUL A;  4K7S A;  4CYE A;  4KZC A;  3IBE A;  3V6E B;  1D4B A;  2W3R A;  5HFY A;  2NPT B;  3ZIM A;  5IO9 A;  4ANV A;  2L0F A;  4NJ6 A;  1WRI A;  1ZP0 B;  4L1B A;  1LXD A;  4PS7 A;  2AYO B;  4K3C A;  4NNJ B;  4P16 A;  3V61 A;  3KUZ A;  2TSS A;  1P98 A;  2J0M A;  4GLS C;  5L83 A;  1FM0 D;  3ETR A;  5JH5 C;  4AWJ A;  1I4H A;  2K6Q A;  3V3X A;  3DVN V;  4WJO A;  4BKT A;  4WQM A;  2LJ5 A;  3ZW3 A;  1FRD A;  2KYW A;  2ZPN A;  2K8B A;  4WUR A;  1ROE A;  1EM7 A;  1NI2 A;  3DBH I;  4HK2 A;  3MJW A;  3HK0 A;  1KTK A;  2RR9 A;  2D3A A;  2INP E;  1WZ0 A;  4C00 A;  3V60 A;  2MW5 A;  1C76 A;  2ZPY A;  3PVL A;  4ZRJ A;  4WAF A;  1V9J A;  4AJY B;  4M0W B;  2GBR A;  2YEP B;  3WAN A;  2KDM A;  4MAC A;  2KN4 A;  1ZXI A;  3RUL A;  3M62 B;  1DGJ A;  2HDE A;  1GB1 A;  3DHG C;  1WWT A;  4I6N B;  5E6N A;  4LNK A;  2MQJ A;  4DXG A;  2V3P A;  2Z59 B;  3WCQ A;  1NYR A;  3Q3J A;  2JPH A;  2UWQ A;  3ZGZ A;  3ZO5 B;  4B9K A;  2ZVO A;  3EGR A;  1TKY A;  3H6N A;  1GPX A;  3RZW C;  1I4R A;  1WGH A;  1I4G A;  4J3O D;  1K53 A;  4LTU A;  1V6E A;  1WGR A;  3WIM A;  4HCN B;  4LJP B;  1J19 A;  3ONS A;  2ASQ A;  4IWP A;  2DHZ A;  3VH4 B;  2KOX A;  3U7D A;  4P1B C;  2GI9 A;  3QAQ A;  2L52 A;  2DAJ A;  2KDF B;  1P7E A;  2D5G A;  3GS2 A;  2IJ0 A;  2D3G A;  3MP9 A;  3AED B;  1J7B A;  4W9D A;  3QK0 A;  2KAN A;  3EHV A;  2K5P A;  3NS8 A;  4KGS A;  4JLC A;  4N6E B;  1WZ3 A;  3VHT C;  2RDH A;  4W9H A;  2EEL A;  5HI1 A;  4CQN A;  3AU4 A;  3B2F A;  3DVG Y;  1MJD A;  4W9J A;  4C56 C;  3A1Q B;  4IOI E;  1TS4 A;  1YNT E;  2FBW B;  2KX3 A;  2PE6 B;  3DQV A;  2M0A A;  3UIO B;  2C60 A;  1BUI C;  2QEJ C;  5CX3 A;  3T8M A;  4KSL C;  2NTT A;  3BK1 A;  3VTW A;  3ZJV A;  1WXV A;  2L32 A;  3M3J A;  3BVG A;  3OAW A;  3FIL B;  2ON8 A;  3N1Z C;  2X38 A;  3N32 A;  4RF1 A;  3N1Y C;  3MHS D;  1L6V A;  1MG8 A;  4US9 A;  2MBE A;  1ZKH A;  2OED A;  1FXI A;  4HRS A;  5C1Z A;  3L54 A;  1MI0 A;  3V62 A;  4PYU A;  4BOS C;  3AB5 A;  3VUW A;  1WE7 A;  1LGR A;  2AL6 A;  2RD0 A;  3VRB B;  5CHV C;  4F8C B;  5BMI A;  2J0J A;  3KH0 A;  1WYG A;  3PPA A;  4URK A;  1GJZ A;  4NPN A;  4OHJ A;  2YLM A;  1JRU A;  2HD5 B;  4JGH B;  4KGR A;  3L10 B;  1TKG A;  4BZA A;  1JCK B;  4YTP B;  2MWS B;  2D07 B;  4XX5 A;  2MHJ A;  1HE8 A;  4YTM B;  1SF0 A;  4NAM A;  4HKQ A;  3K9O B;  4W9C A;  1XCT L;  2ZEQ A;  3BK2 A;  1FFU A;  2KDE B;  1V5O A;  1N62 A;  3VR8 B;  1OQQ A;  1RWS A;  1WXQ A;  3TUO A;  1OEY J;  4K81 A;  3AE8 B;  4IDI A;  1TS2 A;  1ZDV A;  1GAQ B;  4EE2 A;  2LZ6 A;  2I2Y A;  2JSV X;  1E7V A;  2WQY B;  2X8X X;  5LLI A;  3GZN B;  2QIL A;  4MGY E;  4KVG B;  1WJN A;  2LWP A;  3R2I A;  2LMC A;  3R66 C;  3VR9 B;  1T0Q C;  3GZN I;  3AEA B;  3Q3F A;  3Q8B A;  2LGS A;  3C0R B;  2LXA A;  5MPO A;  1HTQ A;  2WDR B;  2NBU A;  4P6V F;  3B08 A;  2OHF A;  2KVZ A;  4RNA A;  1WX8 A;  3VXW A;  1RLF A;  4YXD B;  2AQ2 B;  1SGH A;  3W5V B;  2WNM A;  3SFD B;  3PLV A;  2UU7 A;  1HZ6 A;  2ONQ A;  1D5M C;  3AI5 A;  5LXI B;  4JPS A;  3W9C B;  1UWX A;  1Q0W B;  1FNU A;  1XLO A;  3NVZ A;  1IP9 A;  4JL9 A;  4MH0 E;  3W1Y A;  2HJ1 A;  3W5U B;  2JZP A;  1HA5 A;  2G3Q B;  3ZNH B;  5D94 A;  2M17 A;  1UZX B;  2DZK A;  3PTF C;  2DWQ A;  3NG0 A;  5DPR A;  1L0Y B;  4A55 A;  3TEW A;  4DHZ E;  4JQW C;  1FXA A;  2KMC A;  3PLU A;  2ZVN A;  2Y5C A;  3UGB B;  1WJ6 A;  2LGX A;  4GDK B;  1SJH D;  2WHI A;  2BYT A;  4XZ4 A;  3Q3N C;  2MSE D;  1YMH E;  3BWU D;  3TCA A;  2KLG A;  5E6J A;  1YQ3 B;  4DWF A;  2KWC A;  3DDC B;  2KQ7 A;  3AH7 A;  3AEE B;  3PO0 A;  2KJ6 A;  4ZRI A;  3IFW B;  3ZNG C;  1SIJ A;  4LNN A;  4PYZ A;  1TZ1 A;  4W9L A;  2KMM A;  3IAM 1;  1I42 A;  1F52 A;  1FPY A;  2I38 A;  3ALB A;  1V5T A;  4FJY A;  2GBJ A;  1LO5 D;  3BIN A;  1IBX A;  2OJW A;  1UGJ A;  5L95 C;  2KT7 A;  1E8Y A;  5C2T B;  1N60 A;  2BS4 B;  5BYQ A;  2FID A;  1C4C A;  2SAK A;  2BYE A;  3Q6B A;  4RFB A;  2CU3 A;  3ZYY X;  3ZXV A;  1X1M A;  2AEH A;  2Y5P A;  3JSV B;  1I35 A;  4A3O A;  2FAZ A;  2RPQ A;  1ESF A;  3BVZ A;  4ARI A;  2JF5 A;  3ZTC A;  2IY0 B;  4EZL A;  4MSQ B;  1KLU D;  2KDB A;  2C9W B;  1WE6 A;  3P2B A;  4RGN A;  1R4N B;  4JIO U;  2QCZ A;  3MC8 A;  2D11 A;  4HWI B;  3W2D A;  2N7E A;  2KMA A;  3ZNI D;  4DXA B;  1WGK A;  4KSK C;  3VTU A;  3LDZ E;  2SEB D;  4M02 A;  1D5X C;  2KTR A;  4DDI D;  1PFD A;  3VUX A;  4KIK A;  3WAL A;  2WXL A;  3EEC A;  2Q5W D;  2LRW A;  4DDG D;  1U4A A;  4BKS D;  1WGG A;  2WXG A;  4BKS A;  5AZF A;  2IZV B;  2KKC A;  4GMV A;  1FFV A;  4II3 B;  1XQQ A;  4CHK A;  4MGZ E;  3HUI A;  4IKG A;  4AS1 A;  4KGT A;  4MM3 A;  3TL5 A;  3DVN U;  2W3S A;  3FAH A;  4MM3 B;  2MCN B;  2JWU A;  1ZOY B;  3MTN B;  2W9N A;  2PPH A;  5AZH A;  1TGZ B;  3N3K B;  2IY1 B;  1GC6 A;  2WYQ A;  1XO3 A;  4IWO A;  1UBQ A;  1T6B X;  4S0R A;  2BS3 B;  4K7U A;  4R3D A;  4ZRQ A;  3P1M A;  3R2T A;  1KFY B;  1GC7 A;  3SHQ A;  3KWV A;  2DX5 B;  1WIA A;  4BBN C;  2CJN A;  2WP9 B;  5EE9 A;  3Q3O C;  1MFW A;  4HLE A;  4AJW A;  1KLV A;  3U52 E;  1UBI A;  3PHX B;  2LUM A;  2DYO A;  4DHJ B;  4XDD A;  1V80 A;  1QT9 A;  4L23 A;  2D3B A;  1XLN A;  4GU2 A;  2L0T A;  3ZJT A;  4ACF A;  1F9J A;  4TQ1 A;  2EKI A;  5DPT A;  3ECI A;  2N1W A;  3DBL I;  2CHW A;  1C3T A;  1OFF A;  3VH3 B;  2M19 A;  2LRU A;  3H7P A;  4MGK E;  1FO4 A;  1QOG A;  4XC2 A;  2BB5 A;  2XBB C;  2MP2 A;  2RDG A;  2L05 A;  3L17 A;  5JHA A;  4BAX A;  2RDB C;  4Q2J A;  1VZ8 A;  2JXX A;  3KQ4 A;  2Z0D B;  3A33 B;  3NS1 A;  2JVC A;  4WWM A;  4CO7 A;  2IGH A;  1JML A;  1WGD A;  3LXF A;  3Q8E A;  2OJR A;  3OJ3 A;  1T0S C;  1QLB B;  1P7F A;  2BYF A;  2E3T A;  2KAJ A;  1WXA A;  5JZE B;  1GG3 A;  3I63 C;  1PGX A;  3NZU A;  2IPK D;  2PW9 A;  3IAS 1;  4NQK E;  1BT0 A;  1DOY A;  4ITK A;  4KX6 B;  1WM2 A;  3NY5 A;  1WXS A;  4C80 A;  1C4A A;  1QF6 A;  2ZCC A;  2O6V A;  2PIA A;  4KZ0 A;  4FJZ A;  2Z0E B;  1S1Q B;  1P9D U;  1C1Y B;  4M8N A;  4AP4 C;  1RM6 C;  4L2Y A;  2Y5B B;  2M0X A;  1VZ6 A;  3AE4 B;  2NMQ A;  1XT9 B;  2JX5 A;  3APD A;  3X23 A;  2VH2 A;  5LNK 1;  2WU5 B;  1RAX A;  1KOT A;  3T9L A;  3SR6 A;  3RNF C;  5E6P A;  1YN3 A;  1Y56 A;  2KO3 A;  1JWS D;  5E6O A;  1JWM D;  2DZI A;  3AUL A;  2H89 B;  1WJ4 A;  5IKC M;  4WJN A;  4ZRP A;  2N9E B;  4IM3 A;  3SEB A;  1BXT A;  3QA8 A;  3PS6 A;  2N1V A;  4OVZ A;  2XN9 C;  1DOI A;  2DNF A;  3AN1 A;  3M95 A;  3NVY A;  2FUH B;  1IBX B;  3GE8 C;  2WDV B;  4MEM A;  1H8C A;  2R2O A;  4WWN A;  2WXJ A;  3DHH C;  3IT4 B;  2W82 A;  5G2N A;  1WRD B;  3P4Q B;  4LLG M;  5EE1 A;  3L4P A;  2IYD B;  2LXC A;  1AN8 A;  2A4Z A;  1OQR A;  4OZC A;  2N9X A;  1KLG D;  4RGM A;  3U2S C;  2LGY A;  3AU5 A;  1VZ7 A;  3HVZ A;  1ZW7 A;  1N61 A;  3B9J A;  2O2V B;  3QAR A;  4XWW A;  2FIF A;  3AE3 B;  1MHH E;  3MHZ A;  1TYG B;  3QC8 B;  2BYV E;  1DOX A;  2C7N B;  3PHW B;  4A20 A;  4I6L B;  2KWD A;  3KLS X;  1NEK B;  1E10 A;  2CR5 A;  4ZHO A;  4GN1 A;  3WAP A;  4W9F A;  1WH3 A;  1J0G A;  4W9E A;  4ICV A;  2LI5 A;  1A70 A;  5AUI A;  3P4R B;  1VRA B;  3TEX A;  1FCC C;  3UIP B;  2C7H A;  4C4V B;  2IO3 B;  5I4D A;  3GOE A;  4BOZ B;  4LDT D;  3LB8 C;  4M8M A;  4ANW A;  3P4P B;  5AEK B;  4EEW A;  4PS8 A;  1V86 A;  2KZR A;  1SJE D;  2K25 A;  2K1F A;  3PZ8 A;  3H1U A;  3APF A;  1N5W A;  5DPW A;  3P4S B;  4DHZ B;  2BPS A;  3H7P B;  3MJ5 A;  1PUT A;  1D5Z C;  4G3X B;  2IGD A;  2BKR B;  4RM8 A;  4YTN B;  3Q8A A;  4C4V A;  3ZQ4 A;  2VRR B;  1WF9 A;  2Y3A A;  4ZOH C;  2WU2 B;  3OLM D;  2G9H D;  2VZK D;  2WDT B;  4IC7 B;  2BWF A;  4F1S A;  3RD2 A;  3ML9 A;  4MT5 A;  1XCQ L;  5H8Y E;  3R7R A;  3B0A A;  1EU3 A;  3PRZ A;  4C7Y A;  2EKE C;  1SE4 A;  5GMV A;  3QCA A;  1HTO A;  4A6Q A;  1PYW D;  1WX9 A;  4GSW A;  4N58 A;  3GB1 A;  4K7W A;  2V3S A;  1H4R A;  2WDQ B;  4LNI A;  2L83 A;  2O6V B;  2DZJ A;  2XNA C;  5D6J B;  4ZHP A;  4XYC A;  4G50 A;  3HVD A;  5JHB A;  5AZG A;  2KJH B;  2DYB A;  1C78 A;  1Z5S B;  2QSD A;  3URY A;  1QOB A;  3EFU A;  1D6E C;  1LFD A;  4HXD A;  4J6I A;  2FCM A;  4GXB A;  4YSX B;  3VVW B;  1RYJ A;  2PEA A;  3OJ4 B;  1WM3 A;  1AW7 A;  2KDI A;  4XWT A;  1ACC A;  1QZE A;  2BTE A;  1WYW B;  4EFO A;  2DAF A;  5T8I A;  3PT2 B;  4F7Z A;  3DVG X;  3MC9 A;  2I1K A;  2KHW B;  1JWB D;  1OEY A;  4E74 A;  5CHF A;  1TTN A;  1YQB A;  1LM8 B;  3U4E G;  1TY0 A;  2ACZ B;  3Q8C A;  4RCO A;  2MLB A;  1WMH B;  1V1P A;  3U8Z A;  2WS3 B;  2V4L A;  5TSS A;  4S17 A;  1KH0 A;  1XD3 B;  2RPV A;  1V8C A;  1F0Z A;  2MJD A;  1M4V A;  3L16 A;  1VD2 A;  3IT6 B;  5HG2 A;  2B76 B;  1EWC A;  2E6X A;  1GUA B;  2DLB A;  1YN5 A;  4WQO B;  4MSM B;  4WAA A;  3UF8 A;  1WI0 A;  2M8S A;  2IDY A;  3H9D A;  4NJC A;  3A9K A;  2FCQ A;  4G0N B;  2RGF A;  3U30 A;  1G6J A;  2KNB A;  4RGO S;  3CWI A;  2ZW0 A;  4HVB A;  3HM3 A;  3JSV A;  3NOB A;  1NDD A;  3RMK C;  5IP4 D;  3V6C B;  4B0E A;  5LXH A;  3RZF A;  4RH6 A;  1WR1 A;  1GOZ A;  3PZD A;  2JZZ A;  2JT4 B;  2MBB B;  2NR2 A;  3NVW A;  2WGS A;  1KRH A;  2LGI A;  1YX6 B;  1VCB A;  1I7H A;  1JWA D;  3RFZ B;  1I4Q A;  2KK8 A;  2CKH B;  4NY0 A;  4DHJ D;  1XF5 L;  5C3J B;  3E9S A;  2JUO A;  3DWG C;  4LNO A;  1Z2M A;  2LUE A;  2PTL A;  1SEB D;  2G1E A;  1ZDX A;  3ZRF A;  3S2A A;  3UI3 A;  1VJK A;  2DZM A;  5CHW A;  1M94 A;  2K22 A;  2WXQ A;  1JW9 D;  2WWZ A;  3RN9 C;  4KKJ A;  4REZ A;  2V0G A;  3X0W A;  1NEN B;  3EA6 A;  3RNB C;  2MJ3 A;  3UQA A;  1F77 A;  2IBI B;  1P3Q U;  2OOB B;  4JWU C;  4USA A;  4HPL B;  1NBF C;  2KC2 A;  2ZW1 A;  2V1Y A;  3QX1 A;  1KF6 B;  4A3P A;  2K39 A;  1LQB A;  1V49 A;  2DYM A;  5BYR A;  4MH8 A;  3KUC B;  4TMA B;  3R7Q A;  3WA0 A;  3ML8 A;  5D3I B;  2O2V A;  5BO4 B;  2LHD A;  3IHP C;  3C19 A;  3PZ7 A;  5JXV A;  4IG7 B;  3DBS A;  4ANX A;  4W9K A;  1F1H A;  5J2R A;  2NTS A;  2V3N A;  2WXP A;  3NVV A;  1ZUD 2;  3OG5 A;  4MEL A;  4W9G A;  2WXF A;  4FAD A;  1K8R B;  5BMG A;  4HDO A;  1STE A;  2NCN A;  3A1Q A;  1K51 A;  2K6D B;  3JVZ X;  2MJE A;  2JY6 A;  4NAW B;  3TEY A;  1CZP A;  2JYT A;  4NAW A;  3O13 A;  4IM0 A;  3E56 A;  3VUY A;  1KJT A;  2JZ3 B;  1T3Q A;  3TSS A;  5FK9 C;  2A5U A;  2INC C;  3ZKJ C;  2FUG 1;  2PLP A;  3AV8 A;  3AE7 B;  3KVF B;  5EE0 A;  1FRR A;  4IW0 A;  4WIP A;  2K8C A;  1CMX B;  3RNG C;  1C77 A;  1WR6 E;  1EF1 A;  2KN5 A;  4HRO A;  1P1A A;  1RRB A;  1YN4 A;  4HDQ A;  2W54 A;  1PDX A;  2L00 B;  2BF8 B;  1B9R A;  4FA6 A;  1UNS A;  3KWL A;  1XLP A;  4PS3 A;  3ZVV A;  2KC1 A;  4ICU A;  1L6U A;  2W55 A;  3RUI B;  2D3C A;  1WX7 A;  2BKF A;  2R2Q A;  4FXC A;  3SDL C;  2R61 A;  1D3Z A;  1ZPS A;  1ZE3 D;  3AE1 B;  1P0R A;  4IWQ A;  1L0X B;  3ZNZ B;  5HHD G;  1C9F A;  1PQS A;  1E9M A;  2RSU A;  2KFK B;  1E7P B;  1CQV A;  1L0V B;  1UGM A;  4GDL A;  2INN E;  2C5L C;  1XLQ A;  2GB1 A;  2MEK A;  5CTR C;  3CMM B;  3R3M A;  4BVU C;  3J9C A;  2KJR A;  1QKZ A;  1HZ5 A;  3M63 B;  3ZJU A; 
#chains in the Genus database with same CATH homology
 3ZDM C;  4F8C B;  2A4Z A;  2J0J A;  3KH0 A;  4EUT A;  3HM6 X;  2N9X A;  2KTF A;  2ZCB A;  3PSE B;  2LGY A;  3AU5 A;  3PPA A;  4URK A;  1GJZ A;  2JRH A;  4NPN A;  2YLM A;  1R4M I;  1JRU A;  4I6P A;  2HD5 B;  4JGH B;  2KQS A;  2WX1 A;  1ZW7 A;  2IO2 B;  1V81 A;  3L10 B;  2O2V B;  3APC A;  3QAR A;  2FIF A;  3DOW A;  2MWS B;  3B1L X;  2D07 B;  3KW5 B;  3QWZ B;  4XX5 A;  3ZUN A;  1HE8 A;  1UD7 A;  5TR5 A;  3K9O B;  4W9C A;  4FLH A;  2ZEQ A;  3QC8 B;  2BYV E;  4EZJ A;  1YX5 B;  2KDE B;  2C7N B;  2LVP A;  3N30 A;  1V5O A;  5J17 A;  4TUU A;  3PHW B;  4A20 A;  2CU1 A;  1WXM A;  2GBK A;  2PJH A;  5J18 A;  4ZDV A;  2KVR A;  1OEY J;  4I6L B;  4K81 A;  1YJ1 A;  2KXJ A;  2NPT A;  4WJQ A;  1Q1O A;  2CR5 A;  1UH6 A;  4G11 A;  4GN1 A;  3WAP A;  2LZ6 A;  1E7V A;  1WH3 A;  4W9F A;  4BBN F;  1J0G A;  4W9E A;  2AL3 A;  4ICV A;  2LI5 A;  2O6V D;  5LLI A;  3ZTD A;  2HE7 A;  3UIP B;  2C7H A;  2IO3 B;  4MGY E;  4KVG B;  1WJN A;  3W1S C;  2LWP A;  2MBQ A;  3GOE A;  4HCP B;  3R66 C;  3PRM B;  4BOZ B;  1V2Y A;  4LDT D;  4M8M A;  4ANW A;  3GZN I;  5AEK B;  4EEW A;  3Q3F A;  3C0R B;  4PS8 A;  2LXA A;  1V86 A;  3L08 A;  2KZR A;  2NBU A;  4W9I A;  3B08 A;  2K25 A;  3EC8 A;  3NHE B;  1WX8 A;  3VXW A;  2K1F A;  1RLF A;  3SU8 X;  3BY4 B;  4GIV A;  1SGH A;  2KD0 A;  2GBN A;  2NBV B;  3APF A;  3H1U A;  2IO1 B;  2NVU I;  2N7D A;  3PLV A;  1T0Y A;  4DHZ B;  4MJS A;  5IAA C;  5DPW A;  3W1S A;  2BPS A;  3H7P B;  4IM2 A;  3AI5 A;  5LXI B;  3D32 A;  4G3X B;  2BKR B;  4RM8 A;  4LJO B;  2GBM A;  5G55 A;  3HHM A;  4KDI C;  2L7R A;  1Q0W B;  3RYT A;  2VRR B;  3RCZ A;  1WF9 A;  2MA9 B;  3OLM D;  2ZNV B;  3UIN B;  3A4R A;  1IP9 A;  1WJU A;  4JL9 A;  4MH0 E;  3VAW A;  2WDT B;  1KM7 A;  3W1Y A;  2D10 A;  4IC7 B;  2LD9 A;  2BWF A;  2G3Q B;  4F1S A;  3ZNH B;  3RD2 A;  1Y8R C;  3I3T B;  3ML9 A;  2M17 A;  4HPM B;  5D94 A;  3R7R A;  4FBJ B;  1UZX B;  2DZK A;  3PTF C;  2KLC A;  5DPR A;  3O65 B;  3AXC A;  3CST A;  4EKU A;  3B0A A;  4DHZ E;  4JQW C;  2GMI C;  3PRZ A;  2EKE C;  2D2Q A;  2KMC A;  5D2M B;  5GMV A;  3QCA A;  3PLU A;  2ZVN A;  4DBG A;  2J7Q B;  3UGB B;  1WX9 A;  4GSW A;  4MGI E;  1WJ6 A;  2LGX A;  3VQI A;  4K7W A;  4GDK B;  3KYC D;  4NJ7 A;  4ZYN A;  4RM9 A;  4XZ4 A;  2BWE S;  2PE9 A;  2V3S A;  1H4R A;  2MSE D;  4II2 B;  2O6V B;  2DZJ A;  2HJ8 A;  2MBH A;  2EMT A;  2DEN B;  5D6J B;  1S3S G;  4G50 A;  3TCA A;  5JHB A;  1YD8 U;  1WGY A;  1UEL A;  2KJH B;  5AZG A;  2DYB A;  1Z5S B;  2KLG A;  2LAS A;  2ZJD A;  5C23 A;  2KWC A;  4DWF A;  5IA7 A;  1R4N I;  3EFU A;  3PGE A;  3K9P B;  1LFD A;  4HXD A;  2M4N A;  3PRP B;  3DDC B;  2KQ7 A;  4GDL B;  4J6I A;  2FCM A;  4BKG A;  4GXB A;  2KJ6 A;  2MX2 A;  4K1R B;  4ZRI A;  3IFW B;  3ZNG C;  2KX0 A;  3TIX A;  3VVW B;  3KYD D;  3ZRC A;  2ZZP B;  4PYZ A;  5EDS A;  3CSF A;  2K8H A;  4GDK A;  1TZ1 A;  2PEA A;  4W9L A;  1Q5W B;  3OJ4 B;  3TBL D;  1WM3 A;  5D7G A;  2KDI A;  1I42 A;  2NBW B;  4ASW C;  2FCN A;  4DK5 A;  3ALB A;  2BGF A;  1QZE A;  2WX0 A;  3DCG A;  4KV2 A;  3WAO A;  4P7I A;  1WYW B;  3A4S C;  2DAF A;  4EFO A;  1V5T A;  2M1M A;  4FJY A;  1L7Y A;  2GBJ A;  3PT2 B;  4WJP A;  3BIN A;  2KFK A;  3IVF A;  1SE9 A;  1IYF A;  4F7Z A;  2CS4 A;  3DVG X;  2I1K A;  2KHW B;  5DCN A;  4B95 A;  5L95 C;  3SD5 A;  1OEY A;  4E74 A;  5CHF A;  1E8Y A;  1TTN A;  1YQB A;  1LM8 B;  1ISN A;  5KHQ A;  1E7U A;  1WMH A;  3A9J A;  2GOW A;  1OQY A;  3CF6 E;  3QJZ A;  2C7M B;  2FID A;  1E8X A;  2MLB A;  1WMH B;  3JW0 X;  3PRE A;  1E8Z A;  2BYE A;  3U8Z A;  1SIF A;  4RMA A;  2V4L A;  4KIK B;  4BFR A;  1X1M A;  1OGW A;  1XD3 B;  2AEH A;  1TBE A;  1OTR B;  3JSV B;  2LVQ A;  1I35 A;  4A3O A;  2FAZ A;  3TMP B;  3L16 A;  1VD2 A;  2RPQ A;  1GNU A;  4FUL A;  3RT3 B;  2JF5 A;  3ZTC A;  2IY0 B;  4K7S A;  4CYE A;  4KZC A;  3IBE A;  2IO0 B;  2MRP A;  4MSQ B;  3V6E B;  4EZL A;  1GUA B;  2KDB A;  4FJV B;  2C9W B;  2NPT B;  1WE6 A;  3P2B A;  3L13 A;  3NZS A;  3ZIM A;  4JIO U;  4WQO B;  4ANV A;  2L0F A;  2D11 A;  4MSM B;  4NJ6 A;  4WAA A;  2HTH A;  2JRI B;  4HWI B;  3UF8 A;  2N7E A;  1WI0 A;  2M8S A;  4GOC A;  2ZNV C;  2KMA A;  3H9D A;  3ZNI D;  1LXD A;  1IPG A;  4DXA B;  1E5W A;  2FCQ A;  3A9K A;  4PS7 A;  2AYO B;  4G0N B;  4KSK C;  3VTU A;  2FNJ B;  3LDZ E;  4NNJ B;  2RGF A;  3U30 A;  1G6J A;  2KNB A;  3V61 A;  3KUZ A;  5DPS A;  2KTR A;  4HVB A;  3HM3 A;  3JSV A;  3NOB A;  1NDD A;  1P98 A;  2J0M A;  4DDI D;  3VUX A;  4KIK A;  5L83 A;  4LCD E;  3V6C B;  3WAL A;  3QQ8 B;  3EEC A;  5LXH A;  3VTV A;  3RZF A;  4X57 B;  1WR1 A;  2LRW A;  4MJS B;  4DDG D;  5JH5 C;  3PZD A;  4AWJ A;  1U4A A;  4BKS D;  2K6Q A;  3A9J B;  4ANU A;  2JZZ A;  3DVN V;  2JT4 B;  4WJO A;  4BKT A;  3ZW3 A;  2LJ5 A;  2MBB B;  2NR2 A;  4LDT B;  2QHO A;  1WGG A;  1YX6 B;  2ZPN A;  4BKS A;  5AZF A;  2K8B A;  4TQ0 A;  2IZV B;  2KKC A;  4GMV A;  1VCB A;  3A9K B;  4II3 B;  1XQQ A;  4CHK A;  2KK8 A;  1NI2 A;  2CKH B;  4MGZ E;  4NY0 A;  3DBH I;  4DHJ D;  2XK5 A;  4HK2 A;  4MM3 A;  3TL5 A;  4YL8 A;  3DVN U;  3MJW A;  2MCN B;  2JUO A;  3HK0 A;  1Z2M A;  3MTN B;  2LUE A;  2W9N A;  2PPH A;  2RR9 A;  5AZH A;  1TGZ B;  1WZ0 A;  3N3K B;  5KHO A;  3V60 A;  2MW5 A;  1L2N A;  2LGD A;  2IY1 B;  2J0K A;  2ZPY A;  3PVL A;  4ZRJ A;  3ZRF A;  1GC6 A;  1V9J A;  4AJY B;  4EOY A;  4M0W B;  2WYQ A;  3S2A A;  2GBR A;  1EUV B;  1FXT B;  4IWO A;  1UBQ A;  2DZM A;  4B6W A;  4K7U A;  5CHW A;  4OVV A;  1M94 A;  2WWZ A;  4ZRK A;  3WAN A;  3ZDT A;  1GC7 A;  3SHQ A;  2DX5 B;  2N9P C;  1WIA A;  3TJP A;  4BBN C;  4HJK A;  3LJ3 A;  3RUL A;  3M62 B;  4HLE A;  4AJW A;  1KLV A;  1UBI A;  2KFJ A;  4I6N B;  3PHX B;  3VFK A;  3X0W A;  2DYO A;  4DHJ B;  5E6N A;  1V80 A;  4TKN A;  3DBR I;  3QHT A;  2MQJ A;  3UQA A;  2IBI B;  1P3Q U;  2OOB B;  4GU2 A;  2L0T A;  2Z59 B;  2G4D B;  2XK5 B;  2UYZ B;  2L3Z A;  3Q3J A;  4HPL B;  1NBF C;  2JPH A;  4WWP A;  2UWQ A;  2KC2 A;  3ENE A;  3PV1 A;  1F9J A;  2V1Y A;  3QX1 A;  3ZO5 B;  4TQ1 A;  4B9K A;  2ZVO A;  2K39 A;  4A3P A;  1LQB A;  1V49 A;  4IUM B;  2DYM A;  3H6N A;  3KUC B;  5DPT A;  3R7Q A;  3ECI A;  3ML8 A;  3WA0 A;  2N1W A;  3DBL I;  2CHW A;  2O2V A;  1C3T A;  5BO4 B;  3RZW C;  3VH3 B;  3IHP C;  2CHZ A;  1WGH A;  1ZGU B;  2G45 B;  2LRU A;  3DBS A;  3H7P A;  4IG7 B;  4NQL B;  4ANX A;  5HKH A;  4W9K A;  4MGK E;  5J2R A;  3JYU A;  2N4F A;  1V6E A;  4XC2 A;  1WGR A;  3WIM A;  4HCN B;  2XBB C;  2MP2 A;  4LJP B;  2L05 A;  3L17 A;  5JHA A;  1AAR A;  4MEL A;  2L8J A;  4W9G A;  4FAD A;  1J19 A;  1K8R B;  2JXX A;  3ONS A;  2ASQ A;  2Z0D B;  3A33 B;  4HDO A;  2KWV B;  4IWP A;  2DHZ A;  2JVC A;  2NCN A;  3A1Q A;  3VH4 B;  4CO7 A;  2K6D B;  1WGD A;  2KOX A;  3JVZ X;  3U7D A;  2OJR A;  3OJ3 A;  3QAQ A;  2JY6 A;  4NAW B;  3IG3 A;  2DAJ A;  2KDF B;  2YVC A;  4GGQ A;  2BYF A;  4NAW A;  1EF5 A;  2KWU B;  3DPD A;  1WXA A;  4IM0 A;  4E71 A;  2I1J A;  5JZE B;  1GG3 A;  3VUY A;  1KJT A;  2JZ3 B;  1E90 A;  3NZU A;  1E8W A;  2A5U A;  2EMS A;  4AOF A;  4NQK E;  1BT0 A;  2JWZ A;  2REX A;  3ZKJ C;  1J8C A;  2D3G A;  2XEW A;  1EO6 A;  1WM2 A;  3KVF B;  3NY5 A;  1WXS A;  3ZLZ A;  4W9D A;  3QK0 A;  2KAN A;  2ZCC A;  4IW0 A;  4EZK A;  4FN2 A;  3EHV A;  3NS8 A;  4JLC A;  2O6V A;  4KZ0 A;  4FJZ A;  2K8C A;  2NS5 A;  1CMX B;  2Z0E B;  1S1Q B;  1P9D U;  1WFY A;  1WZ3 A;  1WR6 E;  1C1Y B;  3L0W B;  1EF1 A;  2KN5 A;  4M8N A;  3VHT C;  4AP4 C;  4W9H A;  4E3C A;  4TV3 A;  3HIZ A;  1P1A A;  1RRB A;  2Y5B B;  3AU4 A;  4HDQ A;  2M0X A;  4FHJ A;  3DVG Y;  2L00 B;  4W9J A;  2BF8 B;  3A1Q B;  4FA6 A;  1XT9 B;  2KX3 A;  3APD A;  2B3A A;  2PE6 B;  3X23 A;  4PS3 A;  3ZVV A;  3DQV A;  1RAX A;  1KOT A;  3T9L A;  2KC1 A;  3UIO B;  2C60 A;  4ICU A;  3WAM A;  3KUD B;  5E6P A;  2CHX A;  2FCS A;  5CX3 A;  3T8M A;  4KSL C;  3RUI B;  2KO3 A;  3QIJ A;  1WX7 A;  5E6O A;  4N9F 4;  3VTW A;  1WXV A;  2DZI A;  3UQB A;  3AUL A;  2BKF A;  1WJ4 A;  2R2Q A;  5FR6 A;  3SDL C;  4WJN A;  2N9E B;  4IM3 A;  4GB9 A;  2MP2 B;  3M3J A;  3OAW A;  2LVO A;  1D3Z A;  1WY8 A;  3N32 A;  3QA8 A;  1P0R A;  3MHS D;  3PS6 A;  4IWQ A;  1MG8 A;  2N1V A;  1YIW A;  1RFA A;  3ZNZ B;  2MBO A;  2MBE A;  1ZKH A;  4OVU A;  3M95 A;  1PQS A;  2G4S A;  2FUH B;  2RSU A;  2KFK B;  5C1Z A;  4KDL B;  3L54 A;  2KTR B;  4MEM A;  1H8C A;  4WWO A;  4FHK A;  2R2O A;  3VDZ A;  3V62 A;  1A5R A;  2AWT A;  4WWN A;  1UGM A;  4GDL A;  4PYU A;  4MDK E;  4BOS C;  5G2N A;  2C5L C;  1WRD B;  2L76 A;  5CTR C;  3H7S A;  4AUQ C;  3CMM B;  3R3M A;  3VUW A;  4BVU C;  1WE7 A;  2KJR A;  2AL6 A;  2RD0 A;  3M63 B;  2IYD B;  2LXC A;  5CHV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...