1WXAA

Solution structure of ras-binding domain in mouse af-6 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
b'GSSGSSGSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Afadin
publication title Solution Structure of Ras-binding Domain in Mouse AF-6 Protein
rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxaA00
2N4FA 3KVFB 2IO1B 1YX5B 4GIVA 5L83A 1P3QU 3MJWA 2O6VB 4HXDA 4W9IA 3W1SA 3MTNB 2LVPA 4J6IA 3SD5A 3VTUA 3R66C 3EC8A 2MX2A 2LWPA 2G45B 3ML8A 1LM8B 5DCNA 2KJ6A 4LDTD 2KDFB 4P7IA 4HJKA 2KWVB 3SU8X 4B95A 1S3SG 3UQAA 2KMCA 3ZNID 1X1MA 2ZEQA 3DDCB 2C7NB 1TTNA 1WXSA 5GMVA 1JRUA 4WWOA 1WR6E 2RGFA 2KOXA 5DPSA 1V2YA 1LFDA 1XQQA 4YL8A 2DENB 1WRDB 2ZCCA 4EZLA 2IY0B 2LGXA 4WAAA 2C9WB 4GDLA 4HK2A 1UELA 4K1RB 2M17A 2HJ8A 3GOEA 2NBWB 3SHQA 1GC6A 4ICUA 2RR9A 4ICVA 1A5RA 2JRIB 4MGKE 1WX8A 3N32A 2FIDA 4ANVA 4TQ0A 1E7VA 1LQBA 3UIOB 4NAWA 2IZVB 4MJSA 2XK5A 1OEYJ 4K7WA 4ZYNA 2FUHB 4ZDVA 3PPAA 3DBHI 1WJNA 3TL5A 3QAQA 3JYUA 1YJ1A 2XEWA 1SIFA 2MBHA 4LJOB 2VRRB 2KQ7A 5D6JB 3JSVA 2K8BA 4XX5A 2FCQA 2L0FA 1WGHA 1D3ZA 4M0WB 2LZ6A 2ZCBA 2I1JA 2KO3A 2Y5BB 4GDKA 2NPTB 5CX3A 2C7MB 5JHAA 4MSMB 5TR5A 4DXAB 4BOSC 4IM2A 4BBNF 2BYEA 2EMSA 4RMAA 2ZNVC 3L0WB 3PTFC 4G11A 3PT2B 4IWOA 2J7QB 3ZRCA 3H6NA 1E5WA 3M95A 2GOWA 1RLFA 4WJNA 2KX0A 4K81A 5E6OA 1WF9A 2BPSA 1V5TA 3VXWA 2BGFA 2KJRA 5D7GA 1XD3B 2NBUA 3ZVVA 2N1VA 3DCGA 4BKGA 4WJQA 2JVCA 3W1YA 3NZSA 2MLBA 2N9PC 4IM0A 3I3TB 4II3B 3ZNHB 3ZUNA 4DHZB 4FBJB 2CHWA 3U30A 1TZ1A 1EF5A 4F1SA 4XZ4A 2DZMA 2C5LC 1E8ZA 4DHJB 2KVRA 4GDLB 2CS4A 2G4DB 1NI2A 3AU4A 3VTWA 4M8NA 3DBRI 4KDIC 4KIKA 5AZHA 2L8JA 3ML9A 3GZNI 4JGHB 1RAXA 3PRZA 4K7SA 4GB9A 1H4RA 3IFWB 3RZWC 2XBBC 1GJZA 4IWPA 1WGGA 2G4SA 2L76A 3Q3FA 2MCNB 2BKRB 4JQWC 5J2RA 1P9DU 4JL9A 1WZ3A 4TQ1A 4MJSB 2XK5B 3DBLI 4HWIB 3ZNZB 4CYEA 1G6JA 2LVOA 3A9JA 1J8CA 2UYZB 1M94A 1OEYA 3JW0X 3UIPB 3ZTDA 3HM6X 1V6EA 4PYUA 3ECIA 4HVBA 1WJUA 3R3MA 2WX1A 2ZZPB 2RSUA 4LDTB 1V49A 4K7UA 3JSVB 4WWPA 5C1ZA 3BINA 4EUTA 2FCMA 2M1MA 3DQVA 1IPGA 3QIJA 4E71A 3NHEB 1BT0A 4GDKB 3QHTA 3CSTA 4ASWC 4I6NB 3KUDB 5CHWA 1AARA 2QHOA 2JUOA 2FCNA 4HPMB 4A20A 4FADA 4AUQC 4HLEA 2KDIA 4GXBA 1OQYA 2L3ZA 2YVCA 3APCA 1Q0WB 5DPTA 4HDOA 3LJ3A 2JZZA 3V6CB 4EEWA 2N1WA 3VQIA 2LRWA 3WAMA 1WMHA 3R7QA 1GNUA 1WX9A 4DHZE 1ZGUB 3TJPA 2KWCA 5AZFA 2JPHA 3M63B 4A3OA 3B08A 2NBVB 3U7DA 5LLIA 1E7UA 2J0KA 3AU5A 3RYTA 2KFKA 3KYDD 4KVGB 2LASA 2DZKA 3UINB 3H1UA 2O2VA 3PHXB 1ZKHA 2ZPYA 3H9DA 4DBGA 3A33B 3AI5A 5IAAC 3ZIMA 3DVNU 2KANA 3UQBA 4IW0A 5JHBA 3T8MA 1ISNA 1TBEA 3AXCA 4KIKB 5AEKB 2MP2A 1YQBA 3WALA 1V80A 2OJRA 2PJHA 4IM3A 3X23A 1NDDA 4BOZB 1WE6A 2BYVE 5DPWA 3QX1A 2HD5B 2N9XA 3QK0A 3PRPB 3A9JB 3NS8A 3ENEA 4MGIE 3L54A 4AJWA 2KXJA 3ONSA 4NJ7A 4GU2A 1WM3A 1WJ6A 2ZVNA 4W9HA 4KV2A 3PVLA 5L95C 5G2NA 1EF1A 4W9JA 2N7EA 2BWFA 2WDTB 3ZDTA 1WZ0A 4LCDE 4W9LA 4ZRIA 4I6LB 3EHVA 5LXHA 2R2OA 1J0GA 4ZRJA 3QQ8B 2DYOA 4W9KA 2WX0A 2AEHA 5J18A 1S1QB 1WY8A 4WWNA 1E8WA 4BVUC 2V1YA 4HDQA 1IYFA 2LGDA 4NQKE 1V5OA 3OJ3A 2ZPNA 3WANA 2O6VD 3N3KB 2RPQA 2KHWB 2Z0DB 2J0MA 5J17A 3A1QA 4IC7B 2JF5A 4PS8A 5KHOA 5LXIB 3APDA 3EFUA 2IO3B 1OTRB 1CMXB 2KFKB 2PPHA 1UBIA 1VD2A 2EMTA 3VH3B 3P2BA 3M62B 2O2VB 3DVGY 4ANXA 1UH6A 2Z59B 3C0RB 3IBEA 3OLMD 3TMPB 4AWJA 1R4NI 3SDLC 4HPLB 4FJVB 4FJYA 3VFKA 2MP2B 3HM3A 5D94A 1E8XA 2ZNVB 3VDZA 1V86A 4NY0A 1C3TA 3K9PB 4EOYA 2KTRA 3DVNV 3H7SA 3QC8B 4G0NB 4EFOA 3ZKJC 4GSWA 3V60A 1GUAB 2K25A 1WGDA 1E90A 3K9OB 3ZW3A 2K8CA 3IVFA 5E6PA 4AJYB 3IHPC 2G3QB 4NAWB 2O6VA 4NPNA 2NVUI 3L16A 4X57B 4AP4C 5IA7A 3D32A 2A4ZA 1F9JA 3VAWA 4TUUA 4OVUA 5FR6A 2GBJA 3DOWA 4IUMB 1PQSA 2KD0A 2FCSA 2N9EB 2DYMA 1RRBA 3PLUA 5BO4B 2LVQA 2UWQA 3VH4B 2KN5A 4KSKC 4RM8A 1WFYA 3BY4B 2JZ3B 4LJPB 1WXAA 3U8ZA 4E74A 1XT9B 1K8RB 1GG3A 2JWZA 5EDSA 3JVZX 2D3GA 2FIFA 3UGBB 3A1QB 2KC2A 3VTVA 3NZUA 1FXTB 1Q5WB 1WH3A 1UD7A 1KOTA 3A4SC 2MW5A 2D2QA 2JT4B 1OGWA 5AZGA 2MBBB 3RD2A 2I1KA 1KM7A 2LGYA 4EZKA 5D2MB 2K39A 1E8YA 1I35A 2MQJA 4G3XB 5C23A 3ZTCA 2MRPA 4DDID 4HCPB 3CMMB 1YD8U 2CU1A 2CR5A 2KK8A 4IG7B 2K1FA 3VUXA 5DPRA 3QA8A 2D07B 2AYOB 2KJHB 2BF8B 2KWUB 3APFA 3VHTC 2DYBA 4FULA 4W9EA 2IYDB 5HKHA 5CHVC 3QCAA 2KTRB 2NCNA 3PLVA 4DK5A 1UZXB 1ZW7A 4W9FA 1T0YA 3L10B 1WR1A 2D11A 1WI0A 2KZRA 2HE7A 2FNJB 2MSED 4ZRKA 4F7ZA 3ZNGC 2EKEC 4W9DA 1IP9A 4MM3A 1YIWA 1Y8RC 1WIAA 3PRMB 3ZDMC 2KDBA 2JXXA 2CHZA 3HIZA 3A9KA 1Z2MA 2LD9A 2GBMA 3PGEA 1R4MI 1J19A 4GMVA 3UF8A 4FA6A 2JRHA 2K6QA 1YX6B 2NS5A 3PREA 4PS7A 2GBNA 1L2NA 2IBIB 3RULA 2KX3A 2LXAA 4CO7A 2MA9B 1WGRA 4G50A 3L08A 3CF6E 4KSLC 3AULA 3TBLD 4DWFA 4FN2A 1WM2A 3RZFA 4FLHA 4M8MA 2LUEA 4GN1A 2LJ5A 2M0XA 3R7RA 2DZIA 2DAJA 1KJTA 2L05A 3N30A 3X0WA 1WGYA 4OVVA 1VCBA 3VVWB 4CHKA 5JH5C 2LRUA 2KQSA 3PS6A 4KDLB 2MBQA 2FAZA 4MELA 4TV3A 3TIXA 4IWQA 2B3AA 2MBEA 1V9JA 4MDKE 4WQOB 2PEAA 4BKTA 4AOFA 3O65B 2C7HA 3OJ4B 2KFJA 3PHWB 1H8CA 2AL6A 1P0RA 4XC2A 4MGZE 4NQLB 3OAWA 1WMHB 2BKFA 4WJPA 1TGZB 3KW5B 2OOBB 5CTRC 4A3PA 3HHMA 4MSQB 3B1LX 4MEMA 2KTFA 2W9NA 4GOCA 4NNJB 2AL3A 4RM9A 2NR2A 4EKUA 3TCAA 1WE7A 3KYCD 3H7PA 2ZVOA 2R2QA 2BWES 1EUVB 1QZEA 3W1SC 4BKSD 3V61A 1RFAA 2IO2B 2ZJDA 4N9F4 5E6NA 4W9CA 3V62A 1SE9A 2IO0B 2L7RA 3ZO5B 2GBKA 4JIOU 2MBOA 2WYQA 4PS3A 3A9KB 3L13A 4PYZA 2KKCA 3KH0A 4FHKA 4WJOA 2M4NA 3NOBA 3B0AA 1WXVA 3ALBA 3VUYA 4BFRA 3PV1A 1HE8A 4FHJA 4I6PA 2KDEB 4KZ0A 3KUZA 2C60A 3T9LA 3WA0A 3L17A 5G55A 3PZDA 2N7DA 4KZCA 3DVGX 1LXDA 1UGMA 1WXMA 3ZRFA 3RUIB 2YLMA 1MG8A 1SGHA 3M3JA 3DBSA 3WAOA 1I42A 3KUCB 4HCNB 2KLCA 4DDGD 2LI5A 4B6WA 3HK0A 3RCZA 2L0TA 3ZLZA 3RT3B 2DAFA 3IG3A 3DPDA 2KMAA 2KNBA 2PE9A 4MGYE 2BYFA 1GC7A 4BKSA 1V81A 2KLGA 4F8CB 1EO6A 2JY6A 3QWZB 4MH0E 2V4LA 4NJ6A 2IY1B 2D10A 2HTHA 3QARA 2A5UA 2CHXA 2DHZA 1UBQA 2REXA 2WWZA 5CHFA 3NY5A 1KLVA 3PSEB 1WJ4A 3VUWA 2M8SA 5JZEB 4II2B 4FJZA 4ANWA 1U4AA 1L7YA 2MWSB 2J0JA 3H7PB 3CSFA 4W9GA 3S2AA 2L00B 2AWTA 2DZJA 3LDZE 1WYWB 3Q3JA 2DX5B 1Z5SB 2KC1A 2RD0A 4ANUA 3A4RA 2GMIC 1NBFC 3WAPA 4URKA 4TKNA 5KHQA 3QJZA 1P98A 4B9KA 1WX7A 2PE6B 2GBRA 4JLCA 4DHJD 2Z0EB 1Q1OA 1P1AA 2V3SA 2K8HA 3V6EB 3WIMA 4BBNC 4E3CA 3MHSD 4GGQA 2ASQA 2CKHB 2LXCA 1C1YB 2K6DB 3EECA 2NPTA 4EZJA
chains in the Genus database with same CATH superfamily
1L5PA 3SFEB 4JPSA 4XYCA 5AUKA 5L83A 1C4CA 2QC8A 4US9A 3W1SA 3R66C 3HUIA 3ML8A 5DCNA 4LDTD 2GRIA 3IAS1 3Q3MC 3C19A 2INDC 3ZNID 2X38A 1X1MA 3IAM1 3DDCB 1WXSA 4WWOA 1WR6E 5DPSA 3Q14C 1XQQA 2DENB 3TEZA 1TIFA 2BBCA 2LGXA 4WAAA 4HK2A 4YT0B 2PVOD 3SHQA 4ICUA 2WDQB 4ICVA 2JRIB 4MGKE 1E7VA 1SE2A 1LQBA 3MC0B 4K7WA 5LNK1 4ZDVA 2WXOA 1YJ1A 2OEDA 2WXRA 2KQ7A 2K8BA 3AMZA 1D3ZA 3R2IA 4M0WB 2LZ6A 4GDKA 2NPTB 4KKIA 5CX3A 5EE9A 4MSMB 5TR5A 1MPEA 2EMSA 1N63A 1DOXA 3PT2B 4IWOA 3H6NA 1V5TA 2KJRA 2NBUA 3NZSA 3ZNHB 2N9PC 3I3TB 1V1PA 2AQ3B 3AEEB 2CHWA 4ARCA 1EF5A 4F1SA 1E8ZA 2N0SB 1CJEA 3AU4A 3OWEB 2L8JA 4J3OD 1E7PB 1H4RA 3IFWB 3RZWC 1SB3C 3ZJUA 2G4SA 2BKRB 4JL9A 4TQ1A 4MJSB 1G6JA 3W5VB 1V6EA 3ECIA 2B76B 3JSVB 4WWPA 1DYQA 2PW9A 1BT0A 4ASWC 3QHTA 2QHOA 4FADA 3WCQA 5IN7A 5IOIA 4GXBA 3O13A 2YVCA 3APCA 4GLSC 1OFFA 3Q8FA 3BWUD 1T0RC 2N1WA 2E3TA 2LRWA 3WAMA 1IGCA 1GNUA 1ZGUB 3TJPA 4HKZE 2M19A 2NBVB 3U4EG 3U7DA 2BVCA 3AU5A 2WGSA 3RYTA 4KVGB 3IXSA 1YQ4B 1WXQA 2NMQA 2ZPYA 3H9DA 3A33B 2KANA 1TKEA 3UI3A 1TBEA 1T3QA 3AXCA 4KIKB 4OZAA 5AEKB 4PT5A 3SEBA 3NUHB 4JE3B 3C8YA 1YN5A 2OJRA 5D3DA 2WP9B 1KTKA 1L0XB 2D5GA 5G5HA 3X23A 1GAQB 1MI0A 4OHJA 2BYVE 3QX1A 2N9XA 3QK0A 3PRPB 3A9JB 3EGRA 3R8BA 4MGIE 4AJWA 2V0GA 4NJ7A 1WM3A 1E0ZA 3PVLA 1EF1A 1XXGA 5C2TB 1FNUA 4W9LA 4ZRIA 3FKYA 2DBYA 1J0GA 3BVGA 2DYOA 4W9KA 2WXQA 2WX0A 1S1QB 4WWNA 1UWMA 5D3IB 2V1YA 1V5OA 3N3KB 2RPQA 3A1QA 4PS8A 3APDA 3EFUA 2IO3B 1VLBA 1CMXB 2KFKB 2PPHA 1UBIA 3VH3B 3P2BA 3M62B 2Z59B 2LGSA 3C0RB 3P4QB 2DWQA 4AWJA 4HPLB 3VRBB 1F0ZA 2WU5B 4BAXA 2KAJA 4NY0A 3AH7A 3FILB 3DVNV 3BK2A 3MP9A 4EFOA 1GUAB 1WGDA 1QOFA 1YQ3B 3K9OB 3ZW3A 4AJYB 3AV8A 2O6VA 3VR9B 4RF0A 4X57B 4PK1A 2WDVB 2GBJA 3DOWA 2WHIA 4IUMB 1PQSA 2DYMA 5BO4B 1WYGA 2LVQA 1FCCC 3BY4B 4LJPB 1XT9B 1K8RB 5EDSA 3JVZX 1HTOA 2L32A 1Q5WB 1UD7A 4B0MA 3A4SC 2MW5A 2MJDA 1I35A 2MQJA 3Q3OC 3CMMB 2K1FA 3N1XC 1V1PB 3DHGC 3VHTC 2DYBA 4LNIA 2IYDB 1PGBA 2NCNA 3L10B 3P4PB 2HE7A 3DHIC 4HROA 2EKEC 1SXTA 1YIWA 3PRMB 1GB4A 2JXXA 1Z2MA 1R4MI 1J19A 2K6QA 2VZKD 2BYTA 4PS7A 2GBNA 1L2NA 3RULA 4HKQA 2L52A 4G50A 4KSLC 4DWFA 4B0EA 3P1MA 3RZFA 4FLHA 2LJ5A 5FKAC 2L05A 2PKOA 2J4XA 5JH5C 1ZDVA 2KQSA 3PS6A 2FAZA 2MBEA 2X8XX 4AOFA 3OJ4B 1YNTE 1MVKA 1RWSA 2KFJA 2AL6A 2EELA 4WJPA 4OZCA 4A3PA 5FK9C 2BB6A 3MC9A 3HHMA 4MEMA 2NTSA 2XN9C 3KYCD 1QLBB 3ABVB 2I38A 3W2DA 2WLBA 2K5PA 1L0VB 2WDRB 1I4GA 4MM3B 4P6VF 5BYQA 1E10A 4A9AA 3ZQ4A 2KKCA 1TS2A 3ALBA 3VUYA 5BMIA 1NI3A 2L1AA 2KDEB 1NYRA 1RFKA 3T9LA 3Q3NC 3L17A 3PZDA 3AEBB 3RUIB 2WNMA 4YXDB 5FR3A 2LI5A 3ZLZA 3N20C 1FFVA 3RT3B 5G5GA 3DPDA 4MGYE 3RNGC 2KLGA 2CU3A 4F8CB 1EO6A 3RMKC 3QWZB 4MH0E 3P42A 2IY1B 2REXA 2WWZA 3NVZA 1WJ4A 2M8SA 4LTUA 4ANWA 1U4AA 3CSFA 3Q69A 5C23A 2DZJA 2LUMA 2VH1A 3TEYA 1NEKB 2J52A 2W82A 4B9KA 4HPPA 2JXTA 4JLCA 4MACA 2Z0EB 1P1AA 4HEA1 3V6EB 2QDFA 4M0WA 2NPTA 2N4FA 1VZ7A 1GPXA 2NTTA 3W9CB 2IO1B 1YX5B 4GIVA 3MJWA 2O6VB 1FD6A 3MTNB 3VTUA 3AE6B 3EC8A 2G45B 2KYWA 2KJ6A 4XGAB 2KDFB 3U52E 4HJKA 3SU8X 4B95A 3UQAA 2C7NB 2RGFA 3HVDA 1ZXHA 4YL8A 1WRDB 5E6JA 2YEPF 1QF6A 1UELA 1A5RA 1HZ5A 2V4IB 4ANVA 4TQ0A 4L1BA 4MJSA 1OEYJ 2IPKD 4ZYNA 2JSVX 3DBHI 3GB1A 1CK1A 3PO0A 1ET9A 3JYUA 2MBHA 4NZLB 5D6JB 3JSVA 2BS2B 1ESFA 1FIQA 2IDYA 2C7MB 2QCZA 2BYEA 1XO3A 3MFGA 1HZ6A 4RMAA 2ZNVC 3PTFC 4G11A 2ICIA 3KQ4A 3ZRCA 3SR6A 2KWDA 2GOWA 5E6OA 4K81A 3Q2AC 5D7GA 1XD3B 3DCGA 4WJQA 2RPVA 3W1YA 4II3B 4RNAA 1A70A 4XZ4A 2C5LC 2SEBD 1TY2A 4GDLB 4D2KA 1NI2A 2INNE 1XCTL 2LHEA 3DBRI 4KDIC 4KIKA 4JGHB 4JX1C 4K7SA 2L76A 4ZHOA 1P9DU 4HWIB 4LK0M 3A9JA 1J8CA 1OEYA 3JW0X 1OQRA 4BZAA 4PYUA 4HVBA 1WJUA 3R3MA 2WX1A 1AYFA 2ZZPB 1V49A 4K7UA 3BINA 1VRAB 3AECB 3DQVA 2V3NA 1UF0A 1IPGA 1HXYD 4ZYSA 4E71A 2D3AA 3NHEB 3CSTA 3KUDB 1RM6C 2FCNA 4AUQC 4HJGE 1N6ZA 3BVZA 4WURA 1TYGB 2JPHA 5LLIA 1SEBD 4Q2JA 2KFKA 2LASA 1R7SA 3UQBA 4IW0A 3U2SC 1LGRA 1D4BA 3AB5A 5EE0A 2PJHA 3FILA 4BOZB 1WE6A 2HD5B 3FC4A 1FCLA 3ENEA 4WQMA 1J7AA 1WJ6A 2BWFA 2DNFA 2WDTB 1QOAA 4I6LB 1PGAA 2R2OA 1N61A 1UWXA 5HHDG 2ACZB 2BQQA 1WY8A 4BVUC 4HDQA 2O6VD 3FAHA 5LXIB 1EWCA 5KHOA 2MHJA 1K52A 1J7BA 1VD2A 1DGJA 2O2VB 4ANXA 1WGKA 2H89B 3IBEA 1SIJA 4TMAB 3RNCC 2MP2B 3HM3A 3AE4B 1C3TA 4C00A 4EOYA 1UUPA 1YN3A 1L6VA 4GSWA 3V60A 4C4VA 1AWDA 2PLPA 3AEDB 3Q6BA 1YMHE 4M02A 1BUIC 1XLPA 4NPNA 3T3NA 3HVZA 4K3CA 2NVUI 1EU4A 3D32A 1F9JA 2JX5A 3VAWA 4OVUA 5FR6A 2KD0A 3PLUA 2MJEA 4KSKC 4RM8A 4E74A 1STEA 1GG3A 2JWZA 2N7JA 1WSPA 3N1YC 3VTVA 2D3CA 1KOTA 2D2QA 2JT4B 4US8A 5AZGA 3RD2A 1JWAD 2I1KA 3AE3B 2LGYA 4EZKA 4LLGM 2M56B 4G3XB 2CR5A 4IG7B 3VUXA 5DPRA 4S17A 3QA8A 2BF8B 4FULA 1PGXA 2ZW0A 5CHVC 2KTRB 4DK5A 1TJEA 1WR1A 1WI0A 2FNJB 2LJIA 1JWMD 3ZNGC 4W9DA 3MJ5A 1IP9A 4MM3A 1WIAA 3U7ZA 2CHZA 1ET6A 3B9JA 4GMVA 2JRHA 3PREA 4A90A 2LXAA 3DHHC 4CO7A 4H2AA 1SF0A 2KQ4X 3L08A 3TBLD 4FN2A 4A6QA 2ONQA 4WH4A 2DZIA 1KJTA 3PZ8A 1HA5A 3BYTB 4CHKA 4MELA 2N9KA 3TEWA 1V9JA 4MDKE 4BKTA 3GE8C 2C7HA 3LB8C 1VZ8A 2WXJA 3MHZA 1QILA 4XC2A 1P0RA 1ZUD2 1HEZE 1PFDA 2BKFA 2OOBB 5CTRC 4REZA 2W9NA 2JWUA 5EE1A 3W5UB 3TCAA 4ARIA 2AQ1B 2BS3B 3AEFB 1QZEA 3W1SC 3SFDB 5HG2A 2IO2B 4ITKA 5E6NA 2IO0B 2L7RA 3ZO5B 2GBKA 4JIOU 2MBOA 4PS3A 3KH0A 2MEKA 3I57A 2WU2B 2JYEA 1WXVA 3KWVA 3AE8B 4BFRA 2BW2A 1D5XC 2GI9A 4YSYB 1YJIA 5G55A 4IDIA 4KZCA 1UGMA 1WXMA 4DXFA 4DXGA 1MG8A 1JMLA 2EKIA 2BS4B 4DDGD 3KWLA 2L0TA 2JZPA 2Y3AA 2IJ0A 3LXFA 2PE9A 2BYFA 1LO5D 1XLQA 2QILA 2HTHA 4OZBA 4AS1A 1NYQA 1UBQA 2WXKA 3R2TA 3H7PB 2J0JA 4RCOA 3Q3JA 2DX5B 2KC1A 3QJZA 2GBRA 2G1EA 3OG5A 1I4PA 2K8HA 3WIMA 4BBNC 4C4VB 3MHSD 2CKHB 2K6DB 5GMVA 1ZP0B 3P4RB 1P3QU 4RGMA 4HXDA 4J6IA 2LVPA 3SD5A 1C79A 3N9YC 4JWUC 2IGDA 1LM8B 1WRIA 3P4SB 4P7IA 2KWVB 4XE0A 1RYJA 1T5XD 4UDUC 1TTNA 4LNFA 2JU6X 1TKGA 1LFDA 1V2YA 2V3PA 1MG4A 4YTPB 2C9WB 4GDLA 1L4DB 4KGRA 2HJ8A 3GOEA 1P7FA 4R3DA 1GC6A 4RF1A 2GLSA 3NRZA 2W54A 2WXFA 1WX8A 1E9MA 2K9XA 3N32A 2FIDA 5GXGB 2I2YA 5BMHA 4TSSA 3UIOB 4NAWA 2IZVB 1R4MB 3PPAA 1WJNA 1FFUA 3TL5A 1C4AA 2HDEA 3HRDD 1VR9A 4MH8A 1K53A 4XX5A 2L0FA 1IBXB 1KH0A 4IKGA 2I1JA 2KO3A 1JROA 1P7EA 5JHAA 4DXAB 2WXGA 4BOSC 4IM2A 4BBNF 4NJCA 2DLBA 1QT9A 3L0WB 1TZOA 3I9V1 2J7QB 3LYYA 2KDMA 3GP7A 4WJNA 2KX0A 5H8YE 2BPSA 2KMMA 4BKGA 2N1VA 1BXTA 2MLBA 3ZUNA 4ACFA 4DHZB 3T3OA 3DWMA 5HI1A 2DZMA 4DHJB 4XDCA 2CS4A 2G4DB 3VTWA 5AZHA 3ML9A 1TS3A 3GZNI 1RAXA 3PRZA 1GJZA 2XBBC 4IWPA 2INCC 5J2RA 1VZ6A 1WZ3A 2XK5B 3DBLI 3ZNZB 2YEPB 2LVOA 2UYZB 1YJJA 4LDTB 5C1ZA 4EUTA 5I4DA 2FCMA 3ZJVA 2KVZA 4I6NB 4YTNB 4HPMB 3AE5B 4HLEA 3L4PA 3RN9C 3CIRB 1D5MC 1OQYA 1Q10A 3LJ3A 3V6CB 3GE3C 3GZNB 2E6XA 1WX9A 5AZFA 2VH2A 4A3OA 3B08A 2WXPA 1E7UA 2J0KA 4LNOA 3H1UA 2O2VA 2MJ3A 4ZRPA 3ZIMA 1NVID 1ZDXA 5JHBA 1ISNA 3RFZB 1MHXA 2MP2A 5BYRA 3P63A 3WALA 1V80A 1TS5A 4IM3A 3BVMA 5DPWA 3MC8A 1CZPA 3NS8A 3ONSA 1YN4A 5L95C 5G2NA 2N7EA 1WZ0A 1I4HA 4LCDE 2LHDA 3EHVA 5EE3A 2CJNA 5J18A 1E8WA 3ZYYX 2HJ1A 2LGDA 2Q5WD 2KHWB 2Z0DB 3ZGZA 1JWSD 1OTRB 2JYTA 1UH6A 3CWIA 1KLUD 1R4NI 3SDLC 4FJVB 3VFKA 1E8XA 2ZNVB 1FPYA 1L4ZB 1V86A 3DBHB 3K9PB 2KTRA 2WQYB 4L2YA 1KLGD 3ZKJC 4IOIE 3RI7C 2OJWA 3IVFA 3IHPC 4NAWB 5TSSA 4AP4C 4ZOHC 2A4ZA 3AN1A 4TUUA 5BMGA 2N9EB 4EE2A 4P16A 2UWQA 2INPE 3VH4B 2JZ3B 3AE9B 4N6EB 3U8ZA 3TEXA 1AW7A 3UGBB 1FNVA 1TS4A 1WH3A 2MBBB 3DBRB 4YWGG 1KM7A 2Z8LA 3RNFC 2K39A 1E8YA 3ZTCA 2MRPA 4DDID 1GOZA 1YD8U 1FEHA 2KK8A 2KACA 1SE4A 2AYOB 2KWUB 3APFA 1CQVA 4W9EA 5HKHA 3AEGB 3PLVA 3E9SA 2WXLA 4W9FA 1F2RC 2D11A 5AUIA 4OVZA 1T0QC 4LNKA 4P1CC 1C77A 1QOBA 5HFYA 1DOIA 2GBMA 3PGEA 2LD9A 3UF8A 1D6EC 2NS5A 4P1BC 2K0PA 4K3BA 1VDVA 2Y5PA 1WGRA 1WM2A 4M8MA 4A55A 4GN1A 2M0XA 1WGYA 4N58A 1M4VA 4OVVA 1VCBA 3VVWB 4DQOC 2BT6A 2MBQA 3TIXA 4IWQA 4A8XC 4KX6B 3NG0A 3NVWA 1F52A 3PHWB 1N60A 3OAWA 1TGZB 2H88B 1SBBB 4MSQB 1K50A 1ENFA 3B1LX 2KTFA 4GOCA 4RM9A 2RMMA 4EKUA 4O1NA 2XNAC 2V9HA 3H7PA 2R2QA 1F1HA 1EUVB 3Q8CA 1RFAA 2KT7A 2WYQA 3A9KB 3L13A 4RGNA 1C76A 4FHKA 2AQ2B 4WJOA 1UNSA 2M4NA 2SAKA 4ZRQA 1PDXA 2IGGA 3N1ZC 2WXHA 3E56A 1F77A 2C60A 1EM7A 3DVGX 1LXDA 3ZRFA 3M3JA 2MH7A 3DBSA 3WAOA 1DOYA 3RNAC 2KLCA 1I4XA 2R61A 3HK0A 3I63C 4XDDA 3RCZA 4B6WA 1B1ZA 3Q8BA 1ZPSA 1ZE3D 1TKYA 2FBWB 2KNBA 2KMAA 1ROEA 1GC7A 4BKSA 1C4PA 4NJ6A 3QARA 2A5UA 2CHXA 4RGTA 3PSEB 2VZKB 3VUWA 1N5WA 5JZEB 2LEKA 4FJZA 1XCQL 3VRAB 3S2AA 2L00B 4ANUA 1Z5SB 2RD0A 2K22A 3ZJTA 3A4RA 4URKA 4YSZB 1Q1OA 2V3SA 4OW0A 4E3CA 1KFYB 4GGQA 1IBXA 2W3RA 2LXCA 3EECA 3V3XA 4EZJA 3ZXVA 3KVFB 2WXIA 2QIEB 4LNNA 4RGOS 4W9IA 1XEEA 4L23A 2MX2A 2LWPA 2TSSA 1ZOYB 1S3SG 2KMCA 1VJKA 1PUTA 5H92C 2ZEQA 1JRUA 2KOXA 1B9RA 4JWSC 4KGTA 2ZCCA 3J9CA 2IY0B 3PZ7A 4EZLA 1SJED 3I5JC 4K1RB 2M17A 2NBWB 1JALA 2RR9A 4YTMB 2BB5A 1FRDA 2XK5A 1L6UA 2FUHB 3Q8EA 3QAQA 1I7HA 2XEWA 1SIFA 4LJOB 2VRRB 1N62A 4YSXB 2FCQA 1WGHA 1KF6B 2ZCBA 2QJLA 2Y5BB 1XLNA 1E6EB 4C56C 2RDBC 1KRHA 3M95A 1E5WA 1V97A 1N5XA 1RLFA 4XWTA 1WF9A 1MHHE 3VXWA 2BGFA 3ZVVA 1AN8A 2JVCA 3BZDB 4IM0A 1ZXIA 1SJHD 4FBJB 3U30A 1EWYC 1JRPA 2RDHA 2OHFA 1TZ1A 3B2GA 3B2FA 2KVRA 1FM0D 4M8NA 4GB9A 3H8HA 1WGGA 3Q3FA 2MCNB 1WWTA 4JQWC 4KGSA 2QSDA 4CYEA 2W55A 1TT5B 1M94A 3ZTDA 3UIPB 3HM6X 2IGHA 2RSUA 3DWGC 3GS2A 3URYA 2M1MA 3QIJA 2PTLA 1JWUD 4GDKB 5CHWA 1AARA 2LFIA 2JUOA 4A20A 1TY0A 2WXMA 2WS3B 2KDIA 2KN4A 2L3ZA 1Q0WB 5DPTA 4HDOA 2JZZA 4EEWA 1FMAD 3VQIA 2FUG1 1WMHA 3R7QA 3IT4B 1JCKB 4DHZE 2KWCA 3M63B 3NVYA 3KYDD 2DZKA 3UINB 1QQRA 3PHXB 1ZKHA 1J7CA 4DBGA 5IAAC 2W3SA 3AI5A 3DVNU 3T8MA 2D3BA 1IUEA 4S0RA 1YQBA 4WWMA 2WXNA 4C7ZA 1NDDA 1C9FA 2BTEA 2M0AA 3L54A 2KXJA 4GU2A 1IGDA 1SSNA 5IKCM 1PYWD 2L83A 2ZVNA 4KV2A 4W9HA 4W9JA 1BMLC 3ZDTA 3RNEC 2J53A 5T8IA 5LXHA 4N59A 4ZRJA 3QQ8B 1JQ4A 3BYYB 2AEHA 3EFCA 1XLOA 5BYSA 3EUB2 1IYFA 3AEAB 4NQKE 4MT5A 3OJ3A 2ZPNA 3WANA 1L0YB 4WAFA 2J0MA 5J17A 4IC7B 2JF5A 3NZ3A 2AX5A 2EMTA 4XWWA 2PIAA 3DVGY 2ZW1A 3OLMD 3TMPB 1NENB 3AM9A 4FJYA 5D94A 3VDZA 1QOGA 4AQ7A 3QC8B 3H7SA 4G0NB 1MJDA 4RH6A 4NAMA 2K25A 1E90A 4CQNA 4C80A 2K8CA 3NS1A 1JW9D 5E6PA 2G3QB 3L16A 5IA7A 1I4RA 2FCSA 1K51A 1RRBA 2KN5A 4HRSA 1WFYA 1WXAA 1V8CA 2G9HD 3ZXRA 1C78A 2D3GA 4M00A 2FIFA 2LGIA 3Q8AA 3A1QB 2KC2A 3NZUA 1FXAA 3EA6A 1FXTB 1OGWA 1FXIA 5D2MB 1QKZA 4HCPB 2CU1A 2D07B 2KJHB 3DBLB 3QCAA 3BK1A 1UZXB 1ZW7A 3AE2B 1FRRA 1T0YA 2CJOA 2KZRA 2MSED 5IP4D 4ZRKA 4F7ZA 1SE3A 1Y8RC 3ZDMC 2KDBA 3HIZA 3A9KA 3KLSX 4FA6A 1YX6B 1FNWA 2IBIB 1V1OA 2KX3A 4M01A 2MA9B 3RPFC 3CF6E 3AULA 2LUEA 3R7RA 2DAJA 3N30A 3X0WA 4RFBA 1OQQA 2PMVA 2LRUA 4KDLB 3NJTA 4TV3A 2B3AA 4WQOB 2PEAA 3O65B 3TSSA 1FO4A 1H8CA 3IT6B 3VR8B 4MGZE 5MPOA 4NQLB 1WMHB 3KW5B 2N9LA 2Y5CA 2QMTA 4NNJB 5IO9A 2AL3A 2NR2A 4ZHPA 3AE1B 1WE7A 5JXVA 2RDGA 2ZVOA 1HQRD 2BWES 4BKSD 3V61A 2ZJDA 4N9F4 4W9CA 1XF5L 4QAYA 3V62A 5C3JB 1SE9A 1JWBD 4PYZA 3NOBA 1HTQA 1ACCA 3B0AA 2PVGC 3AE7B 3PV1A 1MFWA 1HE8A 4FHJA 1I4QA 2JQRB 4I6PA 1T0SC 4KZ0A 3KUZA 3WA0A 2N7DA 2YLMA 1SGHA 1I42A 4HCNB 2HTME 3KUCB 3BIID 3V05A 1YOVB 2ON8A 1GB1A 2DAFA 3IG3A 2J42A 1R4NB 3ETRA 4USAA 4C7YA 1EU3A 1V81A 2QEJC 1F2RI 2UU7A 2JY6A 2V4LA 2D10A 1Y56A 2DHZA 3TUOA 5CHFA 3NY5A 1KLVA 4FXCA 2LMCA 1T6BX 4II2B 2K3UA 1L7YA 2MWSB 4W9GA 2AWTA 3LDZE 1WYWB 3RNBC 4KKJA 2GMIC 1NBFC 3WAPA 4TKNA 3NVVA 5KHQA 1P98A 2GB1A 1WX7A 2PE6B 4WIPA 4DHJD 2FE8A 1UGJA 1D5ZC 2ASQA 1C1YB
chains in the Genus database with same CATH topology
2N4FA 3KVFB 2IO1B 1YX5B 4GIVA 5L83A 1P3QU 3MJWA 2O6VB 4HXDA 4W9IA 3W1SA 3MTNB 2LVPA 4J6IA 3SD5A 3VTUA 3R66C 3EC8A 2MX2A 2LWPA 2G45B 3ML8A 1LM8B 5DCNA 2KJ6A 4LDTD 2KDFB 4P7IA 4HJKA 2KWVB 3SU8X 4B95A 1S3SG 3UQAA 2KMCA 3ZNID 1X1MA 2ZEQA 3DDCB 2C7NB 1TTNA 1WXSA 5GMVA 1JRUA 4WWOA 1WR6E 2RGFA 2KOXA 5DPSA 1V2YA 1LFDA 1XQQA 4YL8A 2DENB 1WRDB 2ZCCA 4EZLA 2IY0B 2LGXA 4WAAA 2C9WB 4GDLA 4HK2A 1UELA 4K1RB 2M17A 2HJ8A 3GOEA 2NBWB 3SHQA 1GC6A 4ICUA 2RR9A 4ICVA 1A5RA 2JRIB 4MGKE 1WX8A 3N32A 2FIDA 4ANVA 4TQ0A 1E7VA 1LQBA 3UIOB 4NAWA 2IZVB 4MJSA 2XK5A 1OEYJ 4K7WA 4ZYNA 2FUHB 4ZDVA 3PPAA 3DBHI 1WJNA 3TL5A 3QAQA 3JYUA 1YJ1A 2XEWA 1SIFA 2MBHA 4LJOB 2VRRB 2KQ7A 5D6JB 3JSVA 2K8BA 4XX5A 2FCQA 2L0FA 1WGHA 1D3ZA 4M0WB 2LZ6A 2ZCBA 2I1JA 2KO3A 2Y5BB 4GDKA 2NPTB 5CX3A 2C7MB 5JHAA 4MSMB 5TR5A 4DXAB 4BOSC 4IM2A 4BBNF 2BYEA 2EMSA 4RMAA 2ZNVC 3L0WB 3PTFC 4G11A 3PT2B 4IWOA 2J7QB 3ZRCA 3H6NA 1E5WA 3M95A 2GOWA 1RLFA 4WJNA 2KX0A 4K81A 5E6OA 1WF9A 2BPSA 1V5TA 3VXWA 2BGFA 2KJRA 5D7GA 1XD3B 2NBUA 3ZVVA 2N1VA 3DCGA 4BKGA 4WJQA 2JVCA 3W1YA 3NZSA 2MLBA 2N9PC 4IM0A 3I3TB 4II3B 3ZNHB 3ZUNA 4DHZB 4FBJB 2CHWA 3U30A 1TZ1A 1EF5A 4F1SA 4XZ4A 2DZMA 2C5LC 1E8ZA 4DHJB 2KVRA 4GDLB 2CS4A 2G4DB 1NI2A 3AU4A 3VTWA 4M8NA 3DBRI 4KDIC 4KIKA 5AZHA 2L8JA 3ML9A 3GZNI 4JGHB 1RAXA 3PRZA 4K7SA 4GB9A 1H4RA 3IFWB 3RZWC 2XBBC 1GJZA 4IWPA 1WGGA 2G4SA 2L76A 3Q3FA 2MCNB 2BKRB 4JQWC 5J2RA 1P9DU 4JL9A 1WZ3A 4TQ1A 4MJSB 2XK5B 3DBLI 4HWIB 3ZNZB 4CYEA 1G6JA 2LVOA 3A9JA 1J8CA 2UYZB 1M94A 1OEYA 3JW0X 3UIPB 3ZTDA 3HM6X 1V6EA 4PYUA 3ECIA 4HVBA 1WJUA 3R3MA 2WX1A 2ZZPB 2RSUA 4LDTB 1V49A 4K7UA 3JSVB 4WWPA 5C1ZA 3BINA 4EUTA 2FCMA 2M1MA 3DQVA 1IPGA 3QIJA 4E71A 3NHEB 1BT0A 4GDKB 3QHTA 3CSTA 4ASWC 4I6NB 3KUDB 5CHWA 1AARA 2QHOA 2JUOA 2FCNA 4HPMB 4A20A 4FADA 4AUQC 4HLEA 2KDIA 4GXBA 1OQYA 2L3ZA 2YVCA 3APCA 1Q0WB 5DPTA 4HDOA 3LJ3A 2JZZA 3V6CB 4EEWA 2N1WA 3VQIA 2LRWA 3WAMA 1WMHA 3R7QA 1GNUA 1WX9A 4DHZE 1ZGUB 3TJPA 2KWCA 5AZFA 2JPHA 3M63B 4A3OA 3B08A 2NBVB 3U7DA 5LLIA 1E7UA 2J0KA 3AU5A 3RYTA 2KFKA 3KYDD 4KVGB 2LASA 2DZKA 3UINB 3H1UA 2O2VA 3PHXB 1ZKHA 2ZPYA 3H9DA 4DBGA 3A33B 3AI5A 5IAAC 3ZIMA 3DVNU 2KANA 3UQBA 4IW0A 5JHBA 3T8MA 1ISNA 1TBEA 3AXCA 4KIKB 5AEKB 2MP2A 1YQBA 3WALA 1V80A 2OJRA 2PJHA 4IM3A 3X23A 1NDDA 4BOZB 1WE6A 2BYVE 5DPWA 3QX1A 2HD5B 2N9XA 3QK0A 3PRPB 3A9JB 3NS8A 3ENEA 4MGIE 3L54A 4AJWA 2KXJA 3ONSA 4NJ7A 4GU2A 1WM3A 1WJ6A 2ZVNA 4W9HA 4KV2A 3PVLA 5L95C 5G2NA 1EF1A 4W9JA 2N7EA 2BWFA 2WDTB 3ZDTA 1WZ0A 4LCDE 4W9LA 4ZRIA 4I6LB 3EHVA 5LXHA 2R2OA 1J0GA 4ZRJA 3QQ8B 2DYOA 4W9KA 2WX0A 2AEHA 5J18A 1S1QB 1WY8A 4WWNA 1E8WA 4BVUC 2V1YA 4HDQA 1IYFA 2LGDA 4NQKE 1V5OA 3OJ3A 2ZPNA 3WANA 2O6VD 3N3KB 2RPQA 2KHWB 2Z0DB 2J0MA 5J17A 3A1QA 4IC7B 2JF5A 4PS8A 5KHOA 5LXIB 3APDA 3EFUA 2IO3B 1OTRB 1CMXB 2KFKB 2PPHA 1UBIA 1VD2A 2EMTA 3VH3B 3P2BA 3M62B 2O2VB 3DVGY 4ANXA 1UH6A 2Z59B 3C0RB 3IBEA 3OLMD 3TMPB 4AWJA 1R4NI 3SDLC 4HPLB 4FJVB 4FJYA 3VFKA 2MP2B 3HM3A 5D94A 1E8XA 2ZNVB 3VDZA 1V86A 4NY0A 1C3TA 3K9PB 4EOYA 2KTRA 3DVNV 3H7SA 3QC8B 4G0NB 4EFOA 3ZKJC 4GSWA 3V60A 1GUAB 2K25A 1WGDA 1E90A 3K9OB 3ZW3A 2K8CA 3IVFA 5E6PA 4AJYB 3IHPC 2G3QB 4NAWB 2O6VA 4NPNA 2NVUI 3L16A 4X57B 4AP4C 5IA7A 3D32A 2A4ZA 1F9JA 3VAWA 4TUUA 4OVUA 5FR6A 2GBJA 3DOWA 4IUMB 1PQSA 2KD0A 2FCSA 2N9EB 2DYMA 1RRBA 3PLUA 5BO4B 2LVQA 2UWQA 3VH4B 2KN5A 4KSKC 4RM8A 1WFYA 3BY4B 2JZ3B 4LJPB 1WXAA 3U8ZA 4E74A 1XT9B 1K8RB 1GG3A 2JWZA 5EDSA 3JVZX 2D3GA 2FIFA 3UGBB 3A1QB 2KC2A 3VTVA 3NZUA 1FXTB 1Q5WB 1WH3A 1UD7A 1KOTA 3A4SC 2MW5A 2D2QA 2JT4B 1OGWA 5AZGA 2MBBB 3RD2A 2I1KA 1KM7A 2LGYA 4EZKA 5D2MB 2K39A 1E8YA 1I35A 2MQJA 4G3XB 5C23A 3ZTCA 2MRPA 4DDID 4HCPB 3CMMB 1YD8U 2CU1A 2CR5A 2KK8A 4IG7B 2K1FA 3VUXA 5DPRA 3QA8A 2D07B 2AYOB 2KJHB 2BF8B 2KWUB 3APFA 3VHTC 2DYBA 4FULA 4W9EA 2IYDB 5HKHA 5CHVC 3QCAA 2KTRB 2NCNA 3PLVA 4DK5A 1UZXB 1ZW7A 4W9FA 1T0YA 3L10B 1WR1A 2D11A 1WI0A 2KZRA 2HE7A 2FNJB 2MSED 4ZRKA 4F7ZA 3ZNGC 2EKEC 4W9DA 1IP9A 4MM3A 1YIWA 1Y8RC 1WIAA 3PRMB 3ZDMC 2KDBA 2JXXA 2CHZA 3HIZA 3A9KA 1Z2MA 2LD9A 2GBMA 3PGEA 1R4MI 1J19A 4GMVA 3UF8A 4FA6A 2JRHA 2K6QA 1YX6B 2NS5A 3PREA 4PS7A 2GBNA 1L2NA 2IBIB 3RULA 2KX3A 2LXAA 4CO7A 2MA9B 1WGRA 4G50A 3L08A 3CF6E 4KSLC 3AULA 3TBLD 4DWFA 4FN2A 1WM2A 3RZFA 4FLHA 4M8MA 2LUEA 4GN1A 2LJ5A 2M0XA 3R7RA 2DZIA 2DAJA 1KJTA 2L05A 3N30A 3X0WA 1WGYA 4OVVA 1VCBA 3VVWB 4CHKA 5JH5C 2LRUA 2KQSA 3PS6A 4KDLB 2MBQA 2FAZA 4MELA 4TV3A 3TIXA 4IWQA 2B3AA 2MBEA 1V9JA 4MDKE 4WQOB 2PEAA 4BKTA 4AOFA 3O65B 2C7HA 3OJ4B 2KFJA 3PHWB 1H8CA 2AL6A 1P0RA 4XC2A 4MGZE 4NQLB 3OAWA 1WMHB 2BKFA 4WJPA 1TGZB 3KW5B 2OOBB 5CTRC 4A3PA 3HHMA 4MSQB 3B1LX 4MEMA 2KTFA 2W9NA 4GOCA 4NNJB 2AL3A 4RM9A 2NR2A 4EKUA 3TCAA 1WE7A 3KYCD 3H7PA 2ZVOA 2R2QA 2BWES 1EUVB 1QZEA 3W1SC 4BKSD 3V61A 1RFAA 2IO2B 2ZJDA 4N9F4 5E6NA 4W9CA 3V62A 1SE9A 2IO0B 2L7RA 3ZO5B 2GBKA 4JIOU 2MBOA 2WYQA 4PS3A 3A9KB 3L13A 4PYZA 2KKCA 3KH0A 4FHKA 4WJOA 2M4NA 3NOBA 3B0AA 1WXVA 3ALBA 3VUYA 4BFRA 3PV1A 1HE8A 4FHJA 4I6PA 2KDEB 4KZ0A 3KUZA 2C60A 3T9LA 3WA0A 3L17A 5G55A 3PZDA 2N7DA 4KZCA 3DVGX 1LXDA 1UGMA 1WXMA 3ZRFA 3RUIB 2YLMA 1MG8A 1SGHA 3M3JA 3DBSA 3WAOA 1I42A 3KUCB 4HCNB 2KLCA 4DDGD 2LI5A 4B6WA 3HK0A 3RCZA 2L0TA 3ZLZA 3RT3B 2DAFA 3IG3A 3DPDA 2KMAA 2KNBA 2PE9A 4MGYE 2BYFA 1GC7A 4BKSA 1V81A 2KLGA 4F8CB 1EO6A 2JY6A 3QWZB 4MH0E 2V4LA 4NJ6A 2IY1B 2D10A 2HTHA 3QARA 2A5UA 2CHXA 2DHZA 1UBQA 2REXA 2WWZA 5CHFA 3NY5A 1KLVA 3PSEB 1WJ4A 3VUWA 2M8SA 5JZEB 4II2B 4FJZA 4ANWA 1U4AA 1L7YA 2MWSB 2J0JA 3H7PB 3CSFA 4W9GA 3S2AA 2L00B 2AWTA 2DZJA 3LDZE 1WYWB 3Q3JA 2DX5B 1Z5SB 2KC1A 2RD0A 4ANUA 3A4RA 2GMIC 1NBFC 3WAPA 4URKA 4TKNA 5KHQA 3QJZA 1P98A 4B9KA 1WX7A 2PE6B 2GBRA 4JLCA 4DHJD 2Z0EB 1Q1OA 1P1AA 2V3SA 2K8HA 3V6EB 3WIMA 4BBNC 4E3CA 3MHSD 4GGQA 2ASQA 2CKHB 2LXCA 1C1YB 2K6DB 3EECA 2NPTA 4EZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N4F A;  3KVF B;  2IO1 B;  1YX5 B;  4GIV A;  5L83 A;  1P3Q U;  3MJW A;  2O6V B;  4HXD A;  4W9I A;  3W1S A;  3MTN B;  2LVP A;  4J6I A;  3SD5 A;  3VTU A;  3R66 C;  3EC8 A;  2MX2 A;  2LWP A;  2G45 B;  3ML8 A;  1LM8 B;  5DCN A;  2KJ6 A;  4LDT D;  2KDF B;  4P7I A;  4HJK A;  2KWV B;  3SU8 X;  4B95 A;  1S3S G;  3UQA A;  2KMC A;  3ZNI D;  1X1M A;  2ZEQ A;  3DDC B;  2C7N B;  1TTN A;  1WXS A;  5GMV A;  1JRU A;  4WWO A;  1WR6 E;  2RGF A;  2KOX A;  5DPS A;  1V2Y A;  1LFD A;  1XQQ A;  4YL8 A;  2DEN B;  1WRD B;  2ZCC A;  4EZL A;  2IY0 B;  2LGX A;  4WAA A;  2C9W B;  4GDL A;  4HK2 A;  1UEL A;  4K1R B;  2M17 A;  2HJ8 A;  3GOE A;  2NBW B;  3SHQ A;  1GC6 A;  4ICU A;  2RR9 A;  4ICV A;  1A5R A;  2JRI B;  4MGK E;  1WX8 A;  3N32 A;  2FID A;  4ANV A;  4TQ0 A;  1E7V A;  1LQB A;  3UIO B;  4NAW A;  2IZV B;  4MJS A;  2XK5 A;  1OEY J;  4K7W A;  4ZYN A;  2FUH B;  4ZDV A;  3PPA A;  3DBH I;  1WJN A;  3TL5 A;  3QAQ A;  3JYU A;  1YJ1 A;  2XEW A;  1SIF A;  2MBH A;  4LJO B;  2VRR B;  2KQ7 A;  5D6J B;  3JSV A;  2K8B A;  4XX5 A;  2FCQ A;  2L0F A;  1WGH A;  1D3Z A;  4M0W B;  2LZ6 A;  2ZCB A;  2I1J A;  2KO3 A;  2Y5B B;  4GDK A;  2NPT B;  5CX3 A;  2C7M B;  5JHA A;  4MSM B;  5TR5 A;  4DXA B;  4BOS C;  4IM2 A;  4BBN F;  2BYE A;  2EMS A;  4RMA A;  2ZNV C;  3L0W B;  3PTF C;  4G11 A;  3PT2 B;  4IWO A;  2J7Q B;  3ZRC A;  3H6N A;  1E5W A;  3M95 A;  2GOW A;  1RLF A;  4WJN A;  2KX0 A;  4K81 A;  5E6O A;  1WF9 A;  2BPS A;  1V5T A;  3VXW A;  2BGF A;  2KJR A;  5D7G A;  1XD3 B;  2NBU A;  3ZVV A;  2N1V A;  3DCG A;  4BKG A;  4WJQ A;  2JVC A;  3W1Y A;  3NZS A;  2MLB A;  2N9P C;  4IM0 A;  3I3T B;  4II3 B;  3ZNH B;  3ZUN A;  4DHZ B;  4FBJ B;  2CHW A;  3U30 A;  1TZ1 A;  1EF5 A;  4F1S A;  4XZ4 A;  2DZM A;  2C5L C;  1E8Z A;  4DHJ B;  2KVR A;  4GDL B;  2CS4 A;  2G4D B;  1NI2 A;  3AU4 A;  3VTW A;  4M8N A;  3DBR I;  4KDI C;  4KIK A;  5AZH A;  2L8J A;  3ML9 A;  3GZN I;  4JGH B;  1RAX A;  3PRZ A;  4K7S A;  4GB9 A;  1H4R A;  3IFW B;  3RZW C;  2XBB C;  1GJZ A;  4IWP A;  1WGG A;  2G4S A;  2L76 A;  3Q3F A;  2MCN B;  2BKR B;  4JQW C;  5J2R A;  1P9D U;  4JL9 A;  1WZ3 A;  4TQ1 A;  4MJS B;  2XK5 B;  3DBL I;  4HWI B;  3ZNZ B;  4CYE A;  1G6J A;  2LVO A;  3A9J A;  1J8C A;  2UYZ B;  1M94 A;  1OEY A;  3JW0 X;  3UIP B;  3ZTD A;  3HM6 X;  1V6E A;  4PYU A;  3ECI A;  4HVB A;  1WJU A;  3R3M A;  2WX1 A;  2ZZP B;  2RSU A;  4LDT B;  1V49 A;  4K7U A;  3JSV B;  4WWP A;  5C1Z A;  3BIN A;  4EUT A;  2FCM A;  2M1M A;  3DQV A;  1IPG A;  3QIJ A;  4E71 A;  3NHE B;  1BT0 A;  4GDK B;  3QHT A;  3CST A;  4ASW C;  4I6N B;  3KUD B;  5CHW A;  1AAR A;  2QHO A;  2JUO A;  2FCN A;  4HPM B;  4A20 A;  4FAD A;  4AUQ C;  4HLE A;  2KDI A;  4GXB A;  1OQY A;  2L3Z A;  2YVC A;  3APC A;  1Q0W B;  5DPT A;  4HDO A;  3LJ3 A;  2JZZ A;  3V6C B;  4EEW A;  2N1W A;  3VQI A;  2LRW A;  3WAM A;  1WMH A;  3R7Q A;  1GNU A;  1WX9 A;  4DHZ E;  1ZGU B;  3TJP A;  2KWC A;  5AZF A;  2JPH A;  3M63 B;  4A3O A;  3B08 A;  2NBV B;  3U7D A;  5LLI A;  1E7U A;  2J0K A;  3AU5 A;  3RYT A;  2KFK A;  3KYD D;  4KVG B;  2LAS A;  2DZK A;  3UIN B;  3H1U A;  2O2V A;  3PHX B;  1ZKH A;  2ZPY A;  3H9D A;  4DBG A;  3A33 B;  3AI5 A;  5IAA C;  3ZIM A;  3DVN U;  2KAN A;  3UQB A;  4IW0 A;  5JHB A;  3T8M A;  1ISN A;  1TBE A;  3AXC A;  4KIK B;  5AEK B;  2MP2 A;  1YQB A;  3WAL A;  1V80 A;  2OJR A;  2PJH A;  4IM3 A;  3X23 A;  1NDD A;  4BOZ B;  1WE6 A;  2BYV E;  5DPW A;  3QX1 A;  2HD5 B;  2N9X A;  3QK0 A;  3PRP B;  3A9J B;  3NS8 A;  3ENE A;  4MGI E;  3L54 A;  4AJW A;  2KXJ A;  3ONS A;  4NJ7 A;  4GU2 A;  1WM3 A;  1WJ6 A;  2ZVN A;  4W9H A;  4KV2 A;  3PVL A;  5L95 C;  5G2N A;  1EF1 A;  4W9J A;  2N7E A;  2BWF A;  2WDT B;  3ZDT A;  1WZ0 A;  4LCD E;  4W9L A;  4ZRI A;  4I6L B;  3EHV A;  5LXH A;  2R2O A;  1J0G A;  4ZRJ A;  3QQ8 B;  2DYO A;  4W9K A;  2WX0 A;  2AEH A;  5J18 A;  1S1Q B;  1WY8 A;  4WWN A;  1E8W A;  4BVU C;  2V1Y A;  4HDQ A;  1IYF A;  2LGD A;  4NQK E;  1V5O A;  3OJ3 A;  2ZPN A;  3WAN A;  2O6V D;  3N3K B;  2RPQ A;  2KHW B;  2Z0D B;  2J0M A;  5J17 A;  3A1Q A;  4IC7 B;  2JF5 A;  4PS8 A;  5KHO A;  5LXI B;  3APD A;  3EFU A;  2IO3 B;  1OTR B;  1CMX B;  2KFK B;  2PPH A;  1UBI A;  1VD2 A;  2EMT A;  3VH3 B;  3P2B A;  3M62 B;  2O2V B;  3DVG Y;  4ANX A;  1UH6 A;  2Z59 B;  3C0R B;  3IBE A;  3OLM D;  3TMP B;  4AWJ A;  1R4N I;  3SDL C;  4HPL B;  4FJV B;  4FJY A;  3VFK A;  2MP2 B;  3HM3 A;  5D94 A;  1E8X A;  2ZNV B;  3VDZ A;  1V86 A;  4NY0 A;  1C3T A;  3K9P B;  4EOY A;  2KTR A;  3DVN V;  3H7S A;  3QC8 B;  4G0N B;  4EFO A;  3ZKJ C;  4GSW A;  3V60 A;  1GUA B;  2K25 A;  1WGD A;  1E90 A;  3K9O B;  3ZW3 A;  2K8C A;  3IVF A;  5E6P A;  4AJY B;  3IHP C;  2G3Q B;  4NAW B;  2O6V A;  4NPN A;  2NVU I;  3L16 A;  4X57 B;  4AP4 C;  5IA7 A;  3D32 A;  2A4Z A;  1F9J A;  3VAW A;  4TUU A;  4OVU A;  5FR6 A;  2GBJ A;  3DOW A;  4IUM B;  1PQS A;  2KD0 A;  2FCS A;  2N9E B;  2DYM A;  1RRB A;  3PLU A;  5BO4 B;  2LVQ A;  2UWQ A;  3VH4 B;  2KN5 A;  4KSK C;  4RM8 A;  1WFY A;  3BY4 B;  2JZ3 B;  4LJP B;  1WXA A;  3U8Z A;  4E74 A;  1XT9 B;  1K8R B;  1GG3 A;  2JWZ A;  5EDS A;  3JVZ X;  2D3G A;  2FIF A;  3UGB B;  3A1Q B;  2KC2 A;  3VTV A;  3NZU A;  1FXT B;  1Q5W B;  1WH3 A;  1UD7 A;  1KOT A;  3A4S C;  2MW5 A;  2D2Q A;  2JT4 B;  1OGW A;  5AZG A;  2MBB B;  3RD2 A;  2I1K A;  1KM7 A;  2LGY A;  4EZK A;  5D2M B;  2K39 A;  1E8Y A;  1I35 A;  2MQJ A;  4G3X B;  5C23 A;  3ZTC A;  2MRP A;  4DDI D;  4HCP B;  3CMM B;  1YD8 U;  2CU1 A;  2CR5 A;  2KK8 A;  4IG7 B;  2K1F A;  3VUX A;  5DPR A;  3QA8 A;  2D07 B;  2AYO B;  2KJH B;  2BF8 B;  2KWU B;  3APF A;  3VHT C;  2DYB A;  4FUL A;  4W9E A;  2IYD B;  5HKH A;  5CHV C;  3QCA A;  2KTR B;  2NCN A;  3PLV A;  4DK5 A;  1UZX B;  1ZW7 A;  4W9F A;  1T0Y A;  3L10 B;  1WR1 A;  2D11 A;  1WI0 A;  2KZR A;  2HE7 A;  2FNJ B;  2MSE D;  4ZRK A;  4F7Z A;  3ZNG C;  2EKE C;  4W9D A;  1IP9 A;  4MM3 A;  1YIW A;  1Y8R C;  1WIA A;  3PRM B;  3ZDM C;  2KDB A;  2JXX A;  2CHZ A;  3HIZ A;  3A9K A;  1Z2M A;  2LD9 A;  2GBM A;  3PGE A;  1R4M I;  1J19 A;  4GMV A;  3UF8 A;  4FA6 A;  2JRH A;  2K6Q A;  1YX6 B;  2NS5 A;  3PRE A;  4PS7 A;  2GBN A;  1L2N A;  2IBI B;  3RUL A;  2KX3 A;  2LXA A;  4CO7 A;  2MA9 B;  1WGR A;  4G50 A;  3L08 A;  3CF6 E;  4KSL C;  3AUL A;  3TBL D;  4DWF A;  4FN2 A;  1WM2 A;  3RZF A;  4FLH A;  4M8M A;  2LUE A;  4GN1 A;  2LJ5 A;  2M0X A;  3R7R A;  2DZI A;  2DAJ A;  1KJT A;  2L05 A;  3N30 A;  3X0W A;  1WGY A;  4OVV A;  1VCB A;  3VVW B;  4CHK A;  5JH5 C;  2LRU A;  2KQS A;  3PS6 A;  4KDL B;  2MBQ A;  2FAZ A;  4MEL A;  4TV3 A;  3TIX A;  4IWQ A;  2B3A A;  2MBE A;  1V9J A;  4MDK E;  4WQO B;  2PEA A;  4BKT A;  4AOF A;  3O65 B;  2C7H A;  3OJ4 B;  2KFJ A;  3PHW B;  1H8C A;  2AL6 A;  1P0R A;  4XC2 A;  4MGZ E;  4NQL B;  3OAW A;  1WMH B;  2BKF A;  4WJP A;  1TGZ B;  3KW5 B;  2OOB B;  5CTR C;  4A3P A;  3HHM A;  4MSQ B;  3B1L X;  4MEM A;  2KTF A;  2W9N A;  4GOC A;  4NNJ B;  2AL3 A;  4RM9 A;  2NR2 A;  4EKU A;  3TCA A;  1WE7 A;  3KYC D;  3H7P A;  2ZVO A;  2R2Q A;  2BWE S;  1EUV B;  1QZE A;  3W1S C;  4BKS D;  3V61 A;  1RFA A;  2IO2 B;  2ZJD A;  4N9F 4;  5E6N A;  4W9C A;  3V62 A;  1SE9 A;  2IO0 B;  2L7R A;  3ZO5 B;  2GBK A;  4JIO U;  2MBO A;  2WYQ A;  4PS3 A;  3A9K B;  3L13 A;  4PYZ A;  2KKC A;  3KH0 A;  4FHK A;  4WJO A;  2M4N A;  3NOB A;  3B0A A;  1WXV A;  3ALB A;  3VUY A;  4BFR A;  3PV1 A;  1HE8 A;  4FHJ A;  4I6P A;  2KDE B;  4KZ0 A;  3KUZ A;  2C60 A;  3T9L A;  3WA0 A;  3L17 A;  5G55 A;  3PZD A;  2N7D A;  4KZC A;  3DVG X;  1LXD A;  1UGM A;  1WXM A;  3ZRF A;  3RUI B;  2YLM A;  1MG8 A;  1SGH A;  3M3J A;  3DBS A;  3WAO A;  1I42 A;  3KUC B;  4HCN B;  2KLC A;  4DDG D;  2LI5 A;  4B6W A;  3HK0 A;  3RCZ A;  2L0T A;  3ZLZ A;  3RT3 B;  2DAF A;  3IG3 A;  3DPD A;  2KMA A;  2KNB A;  2PE9 A;  4MGY E;  2BYF A;  1GC7 A;  4BKS A;  1V81 A;  2KLG A;  4F8C B;  1EO6 A;  2JY6 A;  3QWZ B;  4MH0 E;  2V4L A;  4NJ6 A;  2IY1 B;  2D10 A;  2HTH A;  3QAR A;  2A5U A;  2CHX A;  2DHZ A;  1UBQ A;  2REX A;  2WWZ A;  5CHF A;  3NY5 A;  1KLV A;  3PSE B;  1WJ4 A;  3VUW A;  2M8S A;  5JZE B;  4II2 B;  4FJZ A;  4ANW A;  1U4A A;  1L7Y A;  2MWS B;  2J0J A;  3H7P B;  3CSF A;  4W9G A;  3S2A A;  2L00 B;  2AWT A;  2DZJ A;  3LDZ E;  1WYW B;  3Q3J A;  2DX5 B;  1Z5S B;  2KC1 A;  2RD0 A;  4ANU A;  3A4R A;  2GMI C;  1NBF C;  3WAP A;  4URK A;  4TKN A;  5KHQ A;  3QJZ A;  1P98 A;  4B9K A;  1WX7 A;  2PE6 B;  2GBR A;  4JLC A;  4DHJ D;  2Z0E B;  1Q1O A;  1P1A A;  2V3S A;  2K8H A;  3V6E B;  3WIM A;  4BBN C;  4E3C A;  3MHS D;  4GGQ A;  2ASQ A;  2CKH B;  2LXC A;  1C1Y B;  2K6D B;  3EEC A;  2NPT A;  4EZJ A; 
#chains in the Genus database with same CATH topology
 1L5P A;  3SFE B;  4JPS A;  4XYC A;  5AUK A;  5L83 A;  1C4C A;  2QC8 A;  4US9 A;  3W1S A;  3R66 C;  3HUI A;  3ML8 A;  5DCN A;  4LDT D;  2GRI A;  3IAS 1;  3Q3M C;  3C19 A;  2IND C;  3ZNI D;  2X38 A;  1X1M A;  3IAM 1;  3DDC B;  1WXS A;  4WWO A;  1WR6 E;  5DPS A;  3Q14 C;  1XQQ A;  2DEN B;  3TEZ A;  1TIF A;  2BBC A;  2LGX A;  4WAA A;  4HK2 A;  4YT0 B;  2PVO D;  3SHQ A;  4ICU A;  2WDQ B;  4ICV A;  2JRI B;  4MGK E;  1E7V A;  1SE2 A;  1LQB A;  3MC0 B;  4K7W A;  5LNK 1;  4ZDV A;  2WXO A;  1YJ1 A;  2OED A;  2WXR A;  2KQ7 A;  2K8B A;  3AMZ A;  1D3Z A;  3R2I A;  4M0W B;  2LZ6 A;  4GDK A;  2NPT B;  4KKI A;  5CX3 A;  5EE9 A;  4MSM B;  5TR5 A;  1MPE A;  2EMS A;  1N63 A;  1DOX A;  3PT2 B;  4IWO A;  3H6N A;  1V5T A;  2KJR A;  2NBU A;  3NZS A;  3ZNH B;  2N9P C;  3I3T B;  1V1P A;  2AQ3 B;  3AEE B;  2CHW A;  4ARC A;  1EF5 A;  4F1S A;  1E8Z A;  2N0S B;  1CJE A;  3AU4 A;  3OWE B;  2L8J A;  4J3O D;  1E7P B;  1H4R A;  3IFW B;  3RZW C;  1SB3 C;  3ZJU A;  2G4S A;  2BKR B;  4JL9 A;  4TQ1 A;  4MJS B;  1G6J A;  3W5V B;  1V6E A;  3ECI A;  2B76 B;  3JSV B;  4WWP A;  1DYQ A;  2PW9 A;  1BT0 A;  4ASW C;  3QHT A;  2QHO A;  4FAD A;  3WCQ A;  5IN7 A;  5IOI A;  4GXB A;  3O13 A;  2YVC A;  3APC A;  4GLS C;  1OFF A;  3Q8F A;  3BWU D;  1T0R C;  2N1W A;  2E3T A;  2LRW A;  3WAM A;  1IGC A;  1GNU A;  1ZGU B;  3TJP A;  4HKZ E;  2M19 A;  2NBV B;  3U4E G;  3U7D A;  2BVC A;  3AU5 A;  2WGS A;  3RYT A;  4KVG B;  3IXS A;  1YQ4 B;  1WXQ A;  2NMQ A;  2ZPY A;  3H9D A;  3A33 B;  2KAN A;  1TKE A;  3UI3 A;  1TBE A;  1T3Q A;  3AXC A;  4KIK B;  4OZA A;  5AEK B;  4PT5 A;  3SEB A;  3NUH B;  4JE3 B;  3C8Y A;  1YN5 A;  2OJR A;  5D3D A;  2WP9 B;  1KTK A;  1L0X B;  2D5G A;  5G5H A;  3X23 A;  1GAQ B;  1MI0 A;  4OHJ A;  2BYV E;  3QX1 A;  2N9X A;  3QK0 A;  3PRP B;  3A9J B;  3EGR A;  3R8B A;  4MGI E;  4AJW A;  2V0G A;  4NJ7 A;  1WM3 A;  1E0Z A;  3PVL A;  1EF1 A;  1XXG A;  5C2T B;  1FNU A;  4W9L A;  4ZRI A;  3FKY A;  2DBY A;  1J0G A;  3BVG A;  2DYO A;  4W9K A;  2WXQ A;  2WX0 A;  1S1Q B;  4WWN A;  1UWM A;  5D3I B;  2V1Y A;  1V5O A;  3N3K B;  2RPQ A;  3A1Q A;  4PS8 A;  3APD A;  3EFU A;  2IO3 B;  1VLB A;  1CMX B;  2KFK B;  2PPH A;  1UBI A;  3VH3 B;  3P2B A;  3M62 B;  2Z59 B;  2LGS A;  3C0R B;  3P4Q B;  2DWQ A;  4AWJ A;  4HPL B;  3VRB B;  1F0Z A;  2WU5 B;  4BAX A;  2KAJ A;  4NY0 A;  3AH7 A;  3FIL B;  3DVN V;  3BK2 A;  3MP9 A;  4EFO A;  1GUA B;  1WGD A;  1QOF A;  1YQ3 B;  3K9O B;  3ZW3 A;  4AJY B;  3AV8 A;  2O6V A;  3VR9 B;  4RF0 A;  4X57 B;  4PK1 A;  2WDV B;  2GBJ A;  3DOW A;  2WHI A;  4IUM B;  1PQS A;  2DYM A;  5BO4 B;  1WYG A;  2LVQ A;  1FCC C;  3BY4 B;  4LJP B;  1XT9 B;  1K8R B;  5EDS A;  3JVZ X;  1HTO A;  2L32 A;  1Q5W B;  1UD7 A;  4B0M A;  3A4S C;  2MW5 A;  2MJD A;  1I35 A;  2MQJ A;  3Q3O C;  3CMM B;  2K1F A;  3N1X C;  1V1P B;  3DHG C;  3VHT C;  2DYB A;  4LNI A;  2IYD B;  1PGB A;  2NCN A;  3L10 B;  3P4P B;  2HE7 A;  3DHI C;  4HRO A;  2EKE C;  1SXT A;  1YIW A;  3PRM B;  1GB4 A;  2JXX A;  1Z2M A;  1R4M I;  1J19 A;  2K6Q A;  2VZK D;  2BYT A;  4PS7 A;  2GBN A;  1L2N A;  3RUL A;  4HKQ A;  2L52 A;  4G50 A;  4KSL C;  4DWF A;  4B0E A;  3P1M A;  3RZF A;  4FLH A;  2LJ5 A;  5FKA C;  2L05 A;  2PKO A;  2J4X A;  5JH5 C;  1ZDV A;  2KQS A;  3PS6 A;  2FAZ A;  2MBE A;  2X8X X;  4AOF A;  3OJ4 B;  1YNT E;  1MVK A;  1RWS A;  2KFJ A;  2AL6 A;  2EEL A;  4WJP A;  4OZC A;  4A3P A;  5FK9 C;  2BB6 A;  3MC9 A;  3HHM A;  4MEM A;  2NTS A;  2XN9 C;  3KYC D;  1QLB B;  3ABV B;  2I38 A;  3W2D A;  2WLB A;  2K5P A;  1L0V B;  2WDR B;  1I4G A;  4MM3 B;  4P6V F;  5BYQ A;  1E10 A;  4A9A A;  3ZQ4 A;  2KKC A;  1TS2 A;  3ALB A;  3VUY A;  5BMI A;  1NI3 A;  2L1A A;  2KDE B;  1NYR A;  1RFK A;  3T9L A;  3Q3N C;  3L17 A;  3PZD A;  3AEB B;  3RUI B;  2WNM A;  4YXD B;  5FR3 A;  2LI5 A;  3ZLZ A;  3N20 C;  1FFV A;  3RT3 B;  5G5G A;  3DPD A;  4MGY E;  3RNG C;  2KLG A;  2CU3 A;  4F8C B;  1EO6 A;  3RMK C;  3QWZ B;  4MH0 E;  3P42 A;  2IY1 B;  2REX A;  2WWZ A;  3NVZ A;  1WJ4 A;  2M8S A;  4LTU A;  4ANW A;  1U4A A;  3CSF A;  3Q69 A;  5C23 A;  2DZJ A;  2LUM A;  2VH1 A;  3TEY A;  1NEK B;  2J52 A;  2W82 A;  4B9K A;  4HPP A;  2JXT A;  4JLC A;  4MAC A;  2Z0E B;  1P1A A;  4HEA 1;  3V6E B;  2QDF A;  4M0W A;  2NPT A;  2N4F A;  1VZ7 A;  1GPX A;  2NTT A;  3W9C B;  2IO1 B;  1YX5 B;  4GIV A;  3MJW A;  2O6V B;  1FD6 A;  3MTN B;  3VTU A;  3AE6 B;  3EC8 A;  2G45 B;  2KYW A;  2KJ6 A;  4XGA B;  2KDF B;  3U52 E;  4HJK A;  3SU8 X;  4B95 A;  3UQA A;  2C7N B;  2RGF A;  3HVD A;  1ZXH A;  4YL8 A;  1WRD B;  5E6J A;  2YEP F;  1QF6 A;  1UEL A;  1A5R A;  1HZ5 A;  2V4I B;  4ANV A;  4TQ0 A;  4L1B A;  4MJS A;  1OEY J;  2IPK D;  4ZYN A;  2JSV X;  3DBH I;  3GB1 A;  1CK1 A;  3PO0 A;  1ET9 A;  3JYU A;  2MBH A;  4NZL B;  5D6J B;  3JSV A;  2BS2 B;  1ESF A;  1FIQ A;  2IDY A;  2C7M B;  2QCZ A;  2BYE A;  1XO3 A;  3MFG A;  1HZ6 A;  4RMA A;  2ZNV C;  3PTF C;  4G11 A;  2ICI A;  3KQ4 A;  3ZRC A;  3SR6 A;  2KWD A;  2GOW A;  5E6O A;  4K81 A;  3Q2A C;  5D7G A;  1XD3 B;  3DCG A;  4WJQ A;  2RPV A;  3W1Y A;  4II3 B;  4RNA A;  1A70 A;  4XZ4 A;  2C5L C;  2SEB D;  1TY2 A;  4GDL B;  4D2K A;  1NI2 A;  2INN E;  1XCT L;  2LHE A;  3DBR I;  4KDI C;  4KIK A;  4JGH B;  4JX1 C;  4K7S A;  2L76 A;  4ZHO A;  1P9D U;  4HWI B;  4LK0 M;  3A9J A;  1J8C A;  1OEY A;  3JW0 X;  1OQR A;  4BZA A;  4PYU A;  4HVB A;  1WJU A;  3R3M A;  2WX1 A;  1AYF A;  2ZZP B;  1V49 A;  4K7U A;  3BIN A;  1VRA B;  3AEC B;  3DQV A;  2V3N A;  1UF0 A;  1IPG A;  1HXY D;  4ZYS A;  4E71 A;  2D3A A;  3NHE B;  3CST A;  3KUD B;  1RM6 C;  2FCN A;  4AUQ C;  4HJG E;  1N6Z A;  3BVZ A;  4WUR A;  1TYG B;  2JPH A;  5LLI A;  1SEB D;  4Q2J A;  2KFK A;  2LAS A;  1R7S A;  3UQB A;  4IW0 A;  3U2S C;  1LGR A;  1D4B A;  3AB5 A;  5EE0 A;  2PJH A;  3FIL A;  4BOZ B;  1WE6 A;  2HD5 B;  3FC4 A;  1FCL A;  3ENE A;  4WQM A;  1J7A A;  1WJ6 A;  2BWF A;  2DNF A;  2WDT B;  1QOA A;  4I6L B;  1PGA A;  2R2O A;  1N61 A;  1UWX A;  5HHD G;  2ACZ B;  2BQQ A;  1WY8 A;  4BVU C;  4HDQ A;  2O6V D;  3FAH A;  5LXI B;  1EWC A;  5KHO A;  2MHJ A;  1K52 A;  1J7B A;  1VD2 A;  1DGJ A;  2O2V B;  4ANX A;  1WGK A;  2H89 B;  3IBE A;  1SIJ A;  4TMA B;  3RNC C;  2MP2 B;  3HM3 A;  3AE4 B;  1C3T A;  4C00 A;  4EOY A;  1UUP A;  1YN3 A;  1L6V A;  4GSW A;  3V60 A;  4C4V A;  1AWD A;  2PLP A;  3AED B;  3Q6B A;  1YMH E;  4M02 A;  1BUI C;  1XLP A;  4NPN A;  3T3N A;  3HVZ A;  4K3C A;  2NVU I;  1EU4 A;  3D32 A;  1F9J A;  2JX5 A;  3VAW A;  4OVU A;  5FR6 A;  2KD0 A;  3PLU A;  2MJE A;  4KSK C;  4RM8 A;  4E74 A;  1STE A;  1GG3 A;  2JWZ A;  2N7J A;  1WSP A;  3N1Y C;  3VTV A;  2D3C A;  1KOT A;  2D2Q A;  2JT4 B;  4US8 A;  5AZG A;  3RD2 A;  1JWA D;  2I1K A;  3AE3 B;  2LGY A;  4EZK A;  4LLG M;  2M56 B;  4G3X B;  2CR5 A;  4IG7 B;  3VUX A;  5DPR A;  4S17 A;  3QA8 A;  2BF8 B;  4FUL A;  1PGX A;  2ZW0 A;  5CHV C;  2KTR B;  4DK5 A;  1TJE A;  1WR1 A;  1WI0 A;  2FNJ B;  2LJI A;  1JWM D;  3ZNG C;  4W9D A;  3MJ5 A;  1IP9 A;  4MM3 A;  1WIA A;  3U7Z A;  2CHZ A;  1ET6 A;  3B9J A;  4GMV A;  2JRH A;  3PRE A;  4A90 A;  2LXA A;  3DHH C;  4CO7 A;  4H2A A;  1SF0 A;  2KQ4 X;  3L08 A;  3TBL D;  4FN2 A;  4A6Q A;  2ONQ A;  4WH4 A;  2DZI A;  1KJT A;  3PZ8 A;  1HA5 A;  3BYT B;  4CHK A;  4MEL A;  2N9K A;  3TEW A;  1V9J A;  4MDK E;  4BKT A;  3GE8 C;  2C7H A;  3LB8 C;  1VZ8 A;  2WXJ A;  3MHZ A;  1QIL A;  4XC2 A;  1P0R A;  1ZUD 2;  1HEZ E;  1PFD A;  2BKF A;  2OOB B;  5CTR C;  4REZ A;  2W9N A;  2JWU A;  5EE1 A;  3W5U B;  3TCA A;  4ARI A;  2AQ1 B;  2BS3 B;  3AEF B;  1QZE A;  3W1S C;  3SFD B;  5HG2 A;  2IO2 B;  4ITK A;  5E6N A;  2IO0 B;  2L7R A;  3ZO5 B;  2GBK A;  4JIO U;  2MBO A;  4PS3 A;  3KH0 A;  2MEK A;  3I57 A;  2WU2 B;  2JYE A;  1WXV A;  3KWV A;  3AE8 B;  4BFR A;  2BW2 A;  1D5X C;  2GI9 A;  4YSY B;  1YJI A;  5G55 A;  4IDI A;  4KZC A;  1UGM A;  1WXM A;  4DXF A;  4DXG A;  1MG8 A;  1JML A;  2EKI A;  2BS4 B;  4DDG D;  3KWL A;  2L0T A;  2JZP A;  2Y3A A;  2IJ0 A;  3LXF A;  2PE9 A;  2BYF A;  1LO5 D;  1XLQ A;  2QIL A;  2HTH A;  4OZB A;  4AS1 A;  1NYQ A;  1UBQ A;  2WXK A;  3R2T A;  3H7P B;  2J0J A;  4RCO A;  3Q3J A;  2DX5 B;  2KC1 A;  3QJZ A;  2GBR A;  2G1E A;  3OG5 A;  1I4P A;  2K8H A;  3WIM A;  4BBN C;  4C4V B;  3MHS D;  2CKH B;  2K6D B;  5GMV A;  1ZP0 B;  3P4R B;  1P3Q U;  4RGM A;  4HXD A;  4J6I A;  2LVP A;  3SD5 A;  1C79 A;  3N9Y C;  4JWU C;  2IGD A;  1LM8 B;  1WRI A;  3P4S B;  4P7I A;  2KWV B;  4XE0 A;  1RYJ A;  1T5X D;  4UDU C;  1TTN A;  4LNF A;  2JU6 X;  1TKG A;  1LFD A;  1V2Y A;  2V3P A;  1MG4 A;  4YTP B;  2C9W B;  4GDL A;  1L4D B;  4KGR A;  2HJ8 A;  3GOE A;  1P7F A;  4R3D A;  1GC6 A;  4RF1 A;  2GLS A;  3NRZ A;  2W54 A;  2WXF A;  1WX8 A;  1E9M A;  2K9X A;  3N32 A;  2FID A;  5GXG B;  2I2Y A;  5BMH A;  4TSS A;  3UIO B;  4NAW A;  2IZV B;  1R4M B;  3PPA A;  1WJN A;  1FFU A;  3TL5 A;  1C4A A;  2HDE A;  3HRD D;  1VR9 A;  4MH8 A;  1K53 A;  4XX5 A;  2L0F A;  1IBX B;  1KH0 A;  4IKG A;  2I1J A;  2KO3 A;  1JRO A;  1P7E A;  5JHA A;  4DXA B;  2WXG A;  4BOS C;  4IM2 A;  4BBN F;  4NJC A;  2DLB A;  1QT9 A;  3L0W B;  1TZO A;  3I9V 1;  2J7Q B;  3LYY A;  2KDM A;  3GP7 A;  4WJN A;  2KX0 A;  5H8Y E;  2BPS A;  2KMM A;  4BKG A;  2N1V A;  1BXT A;  2MLB A;  3ZUN A;  4ACF A;  4DHZ B;  3T3O A;  3DWM A;  5HI1 A;  2DZM A;  4DHJ B;  4XDC A;  2CS4 A;  2G4D B;  3VTW A;  5AZH A;  3ML9 A;  1TS3 A;  3GZN I;  1RAX A;  3PRZ A;  1GJZ A;  2XBB C;  4IWP A;  2INC C;  5J2R A;  1VZ6 A;  1WZ3 A;  2XK5 B;  3DBL I;  3ZNZ B;  2YEP B;  2LVO A;  2UYZ B;  1YJJ A;  4LDT B;  5C1Z A;  4EUT A;  5I4D A;  2FCM A;  3ZJV A;  2KVZ A;  4I6N B;  4YTN B;  4HPM B;  3AE5 B;  4HLE A;  3L4P A;  3RN9 C;  3CIR B;  1D5M C;  1OQY A;  1Q10 A;  3LJ3 A;  3V6C B;  3GE3 C;  3GZN B;  2E6X A;  1WX9 A;  5AZF A;  2VH2 A;  4A3O A;  3B08 A;  2WXP A;  1E7U A;  2J0K A;  4LNO A;  3H1U A;  2O2V A;  2MJ3 A;  4ZRP A;  3ZIM A;  1NVI D;  1ZDX A;  5JHB A;  1ISN A;  3RFZ B;  1MHX A;  2MP2 A;  5BYR A;  3P63 A;  3WAL A;  1V80 A;  1TS5 A;  4IM3 A;  3BVM A;  5DPW A;  3MC8 A;  1CZP A;  3NS8 A;  3ONS A;  1YN4 A;  5L95 C;  5G2N A;  2N7E A;  1WZ0 A;  1I4H A;  4LCD E;  2LHD A;  3EHV A;  5EE3 A;  2CJN A;  5J18 A;  1E8W A;  3ZYY X;  2HJ1 A;  2LGD A;  2Q5W D;  2KHW B;  2Z0D B;  3ZGZ A;  1JWS D;  1OTR B;  2JYT A;  1UH6 A;  3CWI A;  1KLU D;  1R4N I;  3SDL C;  4FJV B;  3VFK A;  1E8X A;  2ZNV B;  1FPY A;  1L4Z B;  1V86 A;  3DBH B;  3K9P B;  2KTR A;  2WQY B;  4L2Y A;  1KLG D;  3ZKJ C;  4IOI E;  3RI7 C;  2OJW A;  3IVF A;  3IHP C;  4NAW B;  5TSS A;  4AP4 C;  4ZOH C;  2A4Z A;  3AN1 A;  4TUU A;  5BMG A;  2N9E B;  4EE2 A;  4P16 A;  2UWQ A;  2INP E;  3VH4 B;  2JZ3 B;  3AE9 B;  4N6E B;  3U8Z A;  3TEX A;  1AW7 A;  3UGB B;  1FNV A;  1TS4 A;  1WH3 A;  2MBB B;  3DBR B;  4YWG G;  1KM7 A;  2Z8L A;  3RNF C;  2K39 A;  1E8Y A;  3ZTC A;  2MRP A;  4DDI D;  1GOZ A;  1YD8 U;  1FEH A;  2KK8 A;  2KAC A;  1SE4 A;  2AYO B;  2KWU B;  3APF A;  1CQV A;  4W9E A;  5HKH A;  3AEG B;  3PLV A;  3E9S A;  2WXL A;  4W9F A;  1F2R C;  2D11 A;  5AUI A;  4OVZ A;  1T0Q C;  4LNK A;  4P1C C;  1C77 A;  1QOB A;  5HFY A;  1DOI A;  2GBM A;  3PGE A;  2LD9 A;  3UF8 A;  1D6E C;  2NS5 A;  4P1B C;  2K0P A;  4K3B A;  1VDV A;  2Y5P A;  1WGR A;  1WM2 A;  4M8M A;  4A55 A;  4GN1 A;  2M0X A;  1WGY A;  4N58 A;  1M4V A;  4OVV A;  1VCB A;  3VVW B;  4DQO C;  2BT6 A;  2MBQ A;  3TIX A;  4IWQ A;  4A8X C;  4KX6 B;  3NG0 A;  3NVW A;  1F52 A;  3PHW B;  1N60 A;  3OAW A;  1TGZ B;  2H88 B;  1SBB B;  4MSQ B;  1K50 A;  1ENF A;  3B1L X;  2KTF A;  4GOC A;  4RM9 A;  2RMM A;  4EKU A;  4O1N A;  2XNA C;  2V9H A;  3H7P A;  2R2Q A;  1F1H A;  1EUV B;  3Q8C A;  1RFA A;  2KT7 A;  2WYQ A;  3A9K B;  3L13 A;  4RGN A;  1C76 A;  4FHK A;  2AQ2 B;  4WJO A;  1UNS A;  2M4N A;  2SAK A;  4ZRQ A;  1PDX A;  2IGG A;  3N1Z C;  2WXH A;  3E56 A;  1F77 A;  2C60 A;  1EM7 A;  3DVG X;  1LXD A;  3ZRF A;  3M3J A;  2MH7 A;  3DBS A;  3WAO A;  1DOY A;  3RNA C;  2KLC A;  1I4X A;  2R61 A;  3HK0 A;  3I63 C;  4XDD A;  3RCZ A;  4B6W A;  1B1Z A;  3Q8B A;  1ZPS A;  1ZE3 D;  1TKY A;  2FBW B;  2KNB A;  2KMA A;  1ROE A;  1GC7 A;  4BKS A;  1C4P A;  4NJ6 A;  3QAR A;  2A5U A;  2CHX A;  4RGT A;  3PSE B;  2VZK B;  3VUW A;  1N5W A;  5JZE B;  2LEK A;  4FJZ A;  1XCQ L;  3VRA B;  3S2A A;  2L00 B;  4ANU A;  1Z5S B;  2RD0 A;  2K22 A;  3ZJT A;  3A4R A;  4URK A;  4YSZ B;  1Q1O A;  2V3S A;  4OW0 A;  4E3C A;  1KFY B;  4GGQ A;  1IBX A;  2W3R A;  2LXC A;  3EEC A;  3V3X A;  4EZJ A;  3ZXV A;  3KVF B;  2WXI A;  2QIE B;  4LNN A;  4RGO S;  4W9I A;  1XEE A;  4L23 A;  2MX2 A;  2LWP A;  2TSS A;  1ZOY B;  1S3S G;  2KMC A;  1VJK A;  1PUT A;  5H92 C;  2ZEQ A;  1JRU A;  2KOX A;  1B9R A;  4JWS C;  4KGT A;  2ZCC A;  3J9C A;  2IY0 B;  3PZ7 A;  4EZL A;  1SJE D;  3I5J C;  4K1R B;  2M17 A;  2NBW B;  1JAL A;  2RR9 A;  4YTM B;  2BB5 A;  1FRD A;  2XK5 A;  1L6U A;  2FUH B;  3Q8E A;  3QAQ A;  1I7H A;  2XEW A;  1SIF A;  4LJO B;  2VRR B;  1N62 A;  4YSX B;  2FCQ A;  1WGH A;  1KF6 B;  2ZCB A;  2QJL A;  2Y5B B;  1XLN A;  1E6E B;  4C56 C;  2RDB C;  1KRH A;  3M95 A;  1E5W A;  1V97 A;  1N5X A;  1RLF A;  4XWT A;  1WF9 A;  1MHH E;  3VXW A;  2BGF A;  3ZVV A;  1AN8 A;  2JVC A;  3BZD B;  4IM0 A;  1ZXI A;  1SJH D;  4FBJ B;  3U30 A;  1EWY C;  1JRP A;  2RDH A;  2OHF A;  1TZ1 A;  3B2G A;  3B2F A;  2KVR A;  1FM0 D;  4M8N A;  4GB9 A;  3H8H A;  1WGG A;  3Q3F A;  2MCN B;  1WWT A;  4JQW C;  4KGS A;  2QSD A;  4CYE A;  2W55 A;  1TT5 B;  1M94 A;  3ZTD A;  3UIP B;  3HM6 X;  2IGH A;  2RSU A;  3DWG C;  3GS2 A;  3URY A;  2M1M A;  3QIJ A;  2PTL A;  1JWU D;  4GDK B;  5CHW A;  1AAR A;  2LFI A;  2JUO A;  4A20 A;  1TY0 A;  2WXM A;  2WS3 B;  2KDI A;  2KN4 A;  2L3Z A;  1Q0W B;  5DPT A;  4HDO A;  2JZZ A;  4EEW A;  1FMA D;  3VQI A;  2FUG 1;  1WMH A;  3R7Q A;  3IT4 B;  1JCK B;  4DHZ E;  2KWC A;  3M63 B;  3NVY A;  3KYD D;  2DZK A;  3UIN B;  1QQR A;  3PHX B;  1ZKH A;  1J7C A;  4DBG A;  5IAA C;  2W3S A;  3AI5 A;  3DVN U;  3T8M A;  2D3B A;  1IUE A;  4S0R A;  1YQB A;  4WWM A;  2WXN A;  4C7Z A;  1NDD A;  1C9F A;  2BTE A;  2M0A A;  3L54 A;  2KXJ A;  4GU2 A;  1IGD A;  1SSN A;  5IKC M;  1PYW D;  2L83 A;  2ZVN A;  4KV2 A;  4W9H A;  4W9J A;  1BML C;  3ZDT A;  3RNE C;  2J53 A;  5T8I A;  5LXH A;  4N59 A;  4ZRJ A;  3QQ8 B;  1JQ4 A;  3BYY B;  2AEH A;  3EFC A;  1XLO A;  5BYS A;  3EUB 2;  1IYF A;  3AEA B;  4NQK E;  4MT5 A;  3OJ3 A;  2ZPN A;  3WAN A;  1L0Y B;  4WAF A;  2J0M A;  5J17 A;  4IC7 B;  2JF5 A;  3NZ3 A;  2AX5 A;  2EMT A;  4XWW A;  2PIA A;  3DVG Y;  2ZW1 A;  3OLM D;  3TMP B;  1NEN B;  3AM9 A;  4FJY A;  5D94 A;  3VDZ A;  1QOG A;  4AQ7 A;  3QC8 B;  3H7S A;  4G0N B;  1MJD A;  4RH6 A;  4NAM A;  2K25 A;  1E90 A;  4CQN A;  4C80 A;  2K8C A;  3NS1 A;  1JW9 D;  5E6P A;  2G3Q B;  3L16 A;  5IA7 A;  1I4R A;  2FCS A;  1K51 A;  1RRB A;  2KN5 A;  4HRS A;  1WFY A;  1WXA A;  1V8C A;  2G9H D;  3ZXR A;  1C78 A;  2D3G A;  4M00 A;  2FIF A;  2LGI A;  3Q8A A;  3A1Q B;  2KC2 A;  3NZU A;  1FXA A;  3EA6 A;  1FXT B;  1OGW A;  1FXI A;  5D2M B;  1QKZ A;  4HCP B;  2CU1 A;  2D07 B;  2KJH B;  3DBL B;  3QCA A;  3BK1 A;  1UZX B;  1ZW7 A;  3AE2 B;  1FRR A;  1T0Y A;  2CJO A;  2KZR A;  2MSE D;  5IP4 D;  4ZRK A;  4F7Z A;  1SE3 A;  1Y8R C;  3ZDM C;  2KDB A;  3HIZ A;  3A9K A;  3KLS X;  4FA6 A;  1YX6 B;  1FNW A;  2IBI B;  1V1O A;  2KX3 A;  4M01 A;  2MA9 B;  3RPF C;  3CF6 E;  3AUL A;  2LUE A;  3R7R A;  2DAJ A;  3N30 A;  3X0W A;  4RFB A;  1OQQ A;  2PMV A;  2LRU A;  4KDL B;  3NJT A;  4TV3 A;  2B3A A;  4WQO B;  2PEA A;  3O65 B;  3TSS A;  1FO4 A;  1H8C A;  3IT6 B;  3VR8 B;  4MGZ E;  5MPO A;  4NQL B;  1WMH B;  3KW5 B;  2N9L A;  2Y5C A;  2QMT A;  4NNJ B;  5IO9 A;  2AL3 A;  2NR2 A;  4ZHP A;  3AE1 B;  1WE7 A;  5JXV A;  2RDG A;  2ZVO A;  1HQR D;  2BWE S;  4BKS D;  3V61 A;  2ZJD A;  4N9F 4;  4W9C A;  1XF5 L;  4QAY A;  3V62 A;  5C3J B;  1SE9 A;  1JWB D;  4PYZ A;  3NOB A;  1HTQ A;  1ACC A;  3B0A A;  2PVG C;  3AE7 B;  3PV1 A;  1MFW A;  1HE8 A;  4FHJ A;  1I4Q A;  2JQR B;  4I6P A;  1T0S C;  4KZ0 A;  3KUZ A;  3WA0 A;  2N7D A;  2YLM A;  1SGH A;  1I42 A;  4HCN B;  2HTM E;  3KUC B;  3BII D;  3V05 A;  1YOV B;  2ON8 A;  1GB1 A;  2DAF A;  3IG3 A;  2J42 A;  1R4N B;  3ETR A;  4USA A;  4C7Y A;  1EU3 A;  1V81 A;  2QEJ C;  1F2R I;  2UU7 A;  2JY6 A;  2V4L A;  2D10 A;  1Y56 A;  2DHZ A;  3TUO A;  5CHF A;  3NY5 A;  1KLV A;  4FXC A;  2LMC A;  1T6B X;  4II2 B;  2K3U A;  1L7Y A;  2MWS B;  4W9G A;  2AWT A;  3LDZ E;  1WYW B;  3RNB C;  4KKJ A;  2GMI C;  1NBF C;  3WAP A;  4TKN A;  3NVV A;  5KHQ A;  1P98 A;  2GB1 A;  1WX7 A;  2PE6 B;  4WIP A;  4DHJ D;  2FE8 A;  1UGJ A;  1D5Z C;  2ASQ A;  1C1Y B; 
#chains in the Genus database with same CATH homology
 2N4F A;  3KVF B;  2IO1 B;  1YX5 B;  4GIV A;  5L83 A;  1P3Q U;  3MJW A;  2O6V B;  4HXD A;  4W9I A;  3W1S A;  3MTN B;  2LVP A;  4J6I A;  3SD5 A;  3VTU A;  3R66 C;  3EC8 A;  2MX2 A;  2LWP A;  2G45 B;  3ML8 A;  1LM8 B;  5DCN A;  2KJ6 A;  4LDT D;  2KDF B;  4P7I A;  4HJK A;  2KWV B;  3SU8 X;  4B95 A;  1S3S G;  3UQA A;  2KMC A;  3ZNI D;  1X1M A;  2ZEQ A;  3DDC B;  2C7N B;  1TTN A;  1WXS A;  5GMV A;  1JRU A;  4WWO A;  1WR6 E;  2RGF A;  2KOX A;  5DPS A;  1V2Y A;  1LFD A;  1XQQ A;  4YL8 A;  2DEN B;  1WRD B;  2ZCC A;  4EZL A;  2IY0 B;  2LGX A;  4WAA A;  2C9W B;  4GDL A;  4HK2 A;  1UEL A;  4K1R B;  2M17 A;  2HJ8 A;  3GOE A;  2NBW B;  3SHQ A;  1GC6 A;  4ICU A;  2RR9 A;  4ICV A;  1A5R A;  2JRI B;  4MGK E;  1WX8 A;  3N32 A;  2FID A;  4ANV A;  4TQ0 A;  1E7V A;  1LQB A;  3UIO B;  4NAW A;  2IZV B;  4MJS A;  2XK5 A;  1OEY J;  4K7W A;  4ZYN A;  2FUH B;  4ZDV A;  3PPA A;  3DBH I;  1WJN A;  3TL5 A;  3QAQ A;  3JYU A;  1YJ1 A;  2XEW A;  1SIF A;  2MBH A;  4LJO B;  2VRR B;  2KQ7 A;  5D6J B;  3JSV A;  2K8B A;  4XX5 A;  2FCQ A;  2L0F A;  1WGH A;  1D3Z A;  4M0W B;  2LZ6 A;  2ZCB A;  2I1J A;  2KO3 A;  2Y5B B;  4GDK A;  2NPT B;  5CX3 A;  2C7M B;  5JHA A;  4MSM B;  5TR5 A;  4DXA B;  4BOS C;  4IM2 A;  4BBN F;  2BYE A;  2EMS A;  4RMA A;  2ZNV C;  3L0W B;  3PTF C;  4G11 A;  3PT2 B;  4IWO A;  2J7Q B;  3ZRC A;  3H6N A;  1E5W A;  3M95 A;  2GOW A;  1RLF A;  4WJN A;  2KX0 A;  4K81 A;  5E6O A;  1WF9 A;  2BPS A;  1V5T A;  3VXW A;  2BGF A;  2KJR A;  5D7G A;  1XD3 B;  2NBU A;  3ZVV A;  2N1V A;  3DCG A;  4BKG A;  4WJQ A;  2JVC A;  3W1Y A;  3NZS A;  2MLB A;  2N9P C;  4IM0 A;  3I3T B;  4II3 B;  3ZNH B;  3ZUN A;  4DHZ B;  4FBJ B;  2CHW A;  3U30 A;  1TZ1 A;  1EF5 A;  4F1S A;  4XZ4 A;  2DZM A;  2C5L C;  1E8Z A;  4DHJ B;  2KVR A;  4GDL B;  2CS4 A;  2G4D B;  1NI2 A;  3AU4 A;  3VTW A;  4M8N A;  3DBR I;  4KDI C;  4KIK A;  5AZH A;  2L8J A;  3ML9 A;  3GZN I;  4JGH B;  1RAX A;  3PRZ A;  4K7S A;  4GB9 A;  1H4R A;  3IFW B;  3RZW C;  2XBB C;  1GJZ A;  4IWP A;  1WGG A;  2G4S A;  2L76 A;  3Q3F A;  2MCN B;  2BKR B;  4JQW C;  5J2R A;  1P9D U;  4JL9 A;  1WZ3 A;  4TQ1 A;  4MJS B;  2XK5 B;  3DBL I;  4HWI B;  3ZNZ B;  4CYE A;  1G6J A;  2LVO A;  3A9J A;  1J8C A;  2UYZ B;  1M94 A;  1OEY A;  3JW0 X;  3UIP B;  3ZTD A;  3HM6 X;  1V6E A;  4PYU A;  3ECI A;  4HVB A;  1WJU A;  3R3M A;  2WX1 A;  2ZZP B;  2RSU A;  4LDT B;  1V49 A;  4K7U A;  3JSV B;  4WWP A;  5C1Z A;  3BIN A;  4EUT A;  2FCM A;  2M1M A;  3DQV A;  1IPG A;  3QIJ A;  4E71 A;  3NHE B;  1BT0 A;  4GDK B;  3QHT A;  3CST A;  4ASW C;  4I6N B;  3KUD B;  5CHW A;  1AAR A;  2QHO A;  2JUO A;  2FCN A;  4HPM B;  4A20 A;  4FAD A;  4AUQ C;  4HLE A;  2KDI A;  4GXB A;  1OQY A;  2L3Z A;  2YVC A;  3APC A;  1Q0W B;  5DPT A;  4HDO A;  3LJ3 A;  2JZZ A;  3V6C B;  4EEW A;  2N1W A;  3VQI A;  2LRW A;  3WAM A;  1WMH A;  3R7Q A;  1GNU A;  1WX9 A;  4DHZ E;  1ZGU B;  3TJP A;  2KWC A;  5AZF A;  2JPH A;  3M63 B;  4A3O A;  3B08 A;  2NBV B;  3U7D A;  5LLI A;  1E7U A;  2J0K A;  3AU5 A;  3RYT A;  2KFK A;  3KYD D;  4KVG B;  2LAS A;  2DZK A;  3UIN B;  3H1U A;  2O2V A;  3PHX B;  1ZKH A;  2ZPY A;  3H9D A;  4DBG A;  3A33 B;  3AI5 A;  5IAA C;  3ZIM A;  3DVN U;  2KAN A;  3UQB A;  4IW0 A;  5JHB A;  3T8M A;  1ISN A;  1TBE A;  3AXC A;  4KIK B;  5AEK B;  2MP2 A;  1YQB A;  3WAL A;  1V80 A;  2OJR A;  2PJH A;  4IM3 A;  3X23 A;  1NDD A;  4BOZ B;  1WE6 A;  2BYV E;  5DPW A;  3QX1 A;  2HD5 B;  2N9X A;  3QK0 A;  3PRP B;  3A9J B;  3NS8 A;  3ENE A;  4MGI E;  3L54 A;  4AJW A;  2KXJ A;  3ONS A;  4NJ7 A;  4GU2 A;  1WM3 A;  1WJ6 A;  2ZVN A;  4W9H A;  4KV2 A;  3PVL A;  5L95 C;  5G2N A;  1EF1 A;  4W9J A;  2N7E A;  2BWF A;  2WDT B;  3ZDT A;  1WZ0 A;  4LCD E;  4W9L A;  4ZRI A;  4I6L B;  3EHV A;  5LXH A;  2R2O A;  1J0G A;  4ZRJ A;  3QQ8 B;  2DYO A;  4W9K A;  2WX0 A;  2AEH A;  5J18 A;  1S1Q B;  1WY8 A;  4WWN A;  1E8W A;  4BVU C;  2V1Y A;  4HDQ A;  1IYF A;  2LGD A;  4NQK E;  1V5O A;  3OJ3 A;  2ZPN A;  3WAN A;  2O6V D;  3N3K B;  2RPQ A;  2KHW B;  2Z0D B;  2J0M A;  5J17 A;  3A1Q A;  4IC7 B;  2JF5 A;  4PS8 A;  5KHO A;  5LXI B;  3APD A;  3EFU A;  2IO3 B;  1OTR B;  1CMX B;  2KFK B;  2PPH A;  1UBI A;  1VD2 A;  2EMT A;  3VH3 B;  3P2B A;  3M62 B;  2O2V B;  3DVG Y;  4ANX A;  1UH6 A;  2Z59 B;  3C0R B;  3IBE A;  3OLM D;  3TMP B;  4AWJ A;  1R4N I;  3SDL C;  4HPL B;  4FJV B;  4FJY A;  3VFK A;  2MP2 B;  3HM3 A;  5D94 A;  1E8X A;  2ZNV B;  3VDZ A;  1V86 A;  4NY0 A;  1C3T A;  3K9P B;  4EOY A;  2KTR A;  3DVN V;  3H7S A;  3QC8 B;  4G0N B;  4EFO A;  3ZKJ C;  4GSW A;  3V60 A;  1GUA B;  2K25 A;  1WGD A;  1E90 A;  3K9O B;  3ZW3 A;  2K8C A;  3IVF A;  5E6P A;  4AJY B;  3IHP C;  2G3Q B;  4NAW B;  2O6V A;  4NPN A;  2NVU I;  3L16 A;  4X57 B;  4AP4 C;  5IA7 A;  3D32 A;  2A4Z A;  1F9J A;  3VAW A;  4TUU A;  4OVU A;  5FR6 A;  2GBJ A;  3DOW A;  4IUM B;  1PQS A;  2KD0 A;  2FCS A;  2N9E B;  2DYM A;  1RRB A;  3PLU A;  5BO4 B;  2LVQ A;  2UWQ A;  3VH4 B;  2KN5 A;  4KSK C;  4RM8 A;  1WFY A;  3BY4 B;  2JZ3 B;  4LJP B;  1WXA A;  3U8Z A;  4E74 A;  1XT9 B;  1K8R B;  1GG3 A;  2JWZ A;  5EDS A;  3JVZ X;  2D3G A;  2FIF A;  3UGB B;  3A1Q B;  2KC2 A;  3VTV A;  3NZU A;  1FXT B;  1Q5W B;  1WH3 A;  1UD7 A;  1KOT A;  3A4S C;  2MW5 A;  2D2Q A;  2JT4 B;  1OGW A;  5AZG A;  2MBB B;  3RD2 A;  2I1K A;  1KM7 A;  2LGY A;  4EZK A;  5D2M B;  2K39 A;  1E8Y A;  1I35 A;  2MQJ A;  4G3X B;  5C23 A;  3ZTC A;  2MRP A;  4DDI D;  4HCP B;  3CMM B;  1YD8 U;  2CU1 A;  2CR5 A;  2KK8 A;  4IG7 B;  2K1F A;  3VUX A;  5DPR A;  3QA8 A;  2D07 B;  2AYO B;  2KJH B;  2BF8 B;  2KWU B;  3APF A;  3VHT C;  2DYB A;  4FUL A;  4W9E A;  2IYD B;  5HKH A;  5CHV C;  3QCA A;  2KTR B;  2NCN A;  3PLV A;  4DK5 A;  1UZX B;  1ZW7 A;  4W9F A;  1T0Y A;  3L10 B;  1WR1 A;  2D11 A;  1WI0 A;  2KZR A;  2HE7 A;  2FNJ B;  2MSE D;  4ZRK A;  4F7Z A;  3ZNG C;  2EKE C;  4W9D A;  1IP9 A;  4MM3 A;  1YIW A;  1Y8R C;  1WIA A;  3PRM B;  3ZDM C;  2KDB A;  2JXX A;  2CHZ A;  3HIZ A;  3A9K A;  1Z2M A;  2LD9 A;  2GBM A;  3PGE A;  1R4M I;  1J19 A;  4GMV A;  3UF8 A;  4FA6 A;  2JRH A;  2K6Q A;  1YX6 B;  2NS5 A;  3PRE A;  4PS7 A;  2GBN A;  1L2N A;  2IBI B;  3RUL A;  2KX3 A;  2LXA A;  4CO7 A;  2MA9 B;  1WGR A;  4G50 A;  3L08 A;  3CF6 E;  4KSL C;  3AUL A;  3TBL D;  4DWF A;  4FN2 A;  1WM2 A;  3RZF A;  4FLH A;  4M8M A;  2LUE A;  4GN1 A;  2LJ5 A;  2M0X A;  3R7R A;  2DZI A;  2DAJ A;  1KJT A;  2L05 A;  3N30 A;  3X0W A;  1WGY A;  4OVV A;  1VCB A;  3VVW B;  4CHK A;  5JH5 C;  2LRU A;  2KQS A;  3PS6 A;  4KDL B;  2MBQ A;  2FAZ A;  4MEL A;  4TV3 A;  3TIX A;  4IWQ A;  2B3A A;  2MBE A;  1V9J A;  4MDK E;  4WQO B;  2PEA A;  4BKT A;  4AOF A;  3O65 B;  2C7H A;  3OJ4 B;  2KFJ A;  3PHW B;  1H8C A;  2AL6 A;  1P0R A;  4XC2 A;  4MGZ E;  4NQL B;  3OAW A;  1WMH B;  2BKF A;  4WJP A;  1TGZ B;  3KW5 B;  2OOB B;  5CTR C;  4A3P A;  3HHM A;  4MSQ B;  3B1L X;  4MEM A;  2KTF A;  2W9N A;  4GOC A;  4NNJ B;  2AL3 A;  4RM9 A;  2NR2 A;  4EKU A;  3TCA A;  1WE7 A;  3KYC D;  3H7P A;  2ZVO A;  2R2Q A;  2BWE S;  1EUV B;  1QZE A;  3W1S C;  4BKS D;  3V61 A;  1RFA A;  2IO2 B;  2ZJD A;  4N9F 4;  5E6N A;  4W9C A;  3V62 A;  1SE9 A;  2IO0 B;  2L7R A;  3ZO5 B;  2GBK A;  4JIO U;  2MBO A;  2WYQ A;  4PS3 A;  3A9K B;  3L13 A;  4PYZ A;  2KKC A;  3KH0 A;  4FHK A;  4WJO A;  2M4N A;  3NOB A;  3B0A A;  1WXV A;  3ALB A;  3VUY A;  4BFR A;  3PV1 A;  1HE8 A;  4FHJ A;  4I6P A;  2KDE B;  4KZ0 A;  3KUZ A;  2C60 A;  3T9L A;  3WA0 A;  3L17 A;  5G55 A;  3PZD A;  2N7D A;  4KZC A;  3DVG X;  1LXD A;  1UGM A;  1WXM A;  3ZRF A;  3RUI B;  2YLM A;  1MG8 A;  1SGH A;  3M3J A;  3DBS A;  3WAO A;  1I42 A;  3KUC B;  4HCN B;  2KLC A;  4DDG D;  2LI5 A;  4B6W A;  3HK0 A;  3RCZ A;  2L0T A;  3ZLZ A;  3RT3 B;  2DAF A;  3IG3 A;  3DPD A;  2KMA A;  2KNB A;  2PE9 A;  4MGY E;  2BYF A;  1GC7 A;  4BKS A;  1V81 A;  2KLG A;  4F8C B;  1EO6 A;  2JY6 A;  3QWZ B;  4MH0 E;  2V4L A;  4NJ6 A;  2IY1 B;  2D10 A;  2HTH A;  3QAR A;  2A5U A;  2CHX A;  2DHZ A;  1UBQ A;  2REX A;  2WWZ A;  5CHF A;  3NY5 A;  1KLV A;  3PSE B;  1WJ4 A;  3VUW A;  2M8S A;  5JZE B;  4II2 B;  4FJZ A;  4ANW A;  1U4A A;  1L7Y A;  2MWS B;  2J0J A;  3H7P B;  3CSF A;  4W9G A;  3S2A A;  2L00 B;  2AWT A;  2DZJ A;  3LDZ E;  1WYW B;  3Q3J A;  2DX5 B;  1Z5S B;  2KC1 A;  2RD0 A;  4ANU A;  3A4R A;  2GMI C;  1NBF C;  3WAP A;  4URK A;  4TKN A;  5KHQ A;  3QJZ A;  1P98 A;  4B9K A;  1WX7 A;  2PE6 B;  2GBR A;  4JLC A;  4DHJ D;  2Z0E B;  1Q1O A;  1P1A A;  2V3S A;  2K8H A;  3V6E B;  3WIM A;  4BBN C;  4E3C A;  3MHS D;  4GGQ A;  2ASQ A;  2CKH B;  2LXC A;  1C1Y B;  2K6D B;  3EEC A;  2NPT A;  4EZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...