1WXAA

Solution structure of ras-binding domain in mouse af-6 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
GSSGSSGSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Afadin
publication title Solution Structure of Ras-binding Domain in Mouse AF-6 Protein
rcsb
source organism Mus musculus
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxaA00
3TCAA 2ZCBA 4NJ7A 4BVUC 2LUEA 2KQSA 1V81A 2RPQA 1I35A 2KQ7A 3M62B 5IA7A 4KSKC 5CHWA 3ZDMC 1NI2A 1V9JA 2LI5A 3H7PA 4NJ6A 4BKGA 5G2NA 2LGXA 1WIAA 2KD0A 2GMIC 4HPLB 1IYFA 2J0MA 1WH3A 3HK0A 4W9DA 2O2VB 2ZPNA 1WMHB 4IM0A 3S2AA 3UF8A 3QARA 4ZRKA 5CX3A 1UBIA 2FIFA 4GDKB 2MLBA 1EUVB 3L54A 3QQ8B 1V6EA 3KUZA 4KZ0A 2R2OA 2CKHB 3KVFB 3DQVA 1WXMA 1PQSA 2G4SA 3OAWA 2CU1A 2IZVB 1WM2A 2DX5B 4WAAA 3RT3B 2FCQA 2ZZPB 3PRZA 5D94A 3DVGX 4BKSD 2C60A 1S3SG 3IG3A 1UGMA 4F1SA 1K8RB 3N32A 2KO3A 3SD5A 3VAWA 4KV2A 3V6EB 2JRHA 4DK5A 1G6JA 3ZTDA 2KFKA 2K8HA 5JHBA 2KWVB 4GDLA 3L10B 4AJWA 2OOBB 3VHTC 2LASA 4W9IA 3DBSA 1WGGA 4HJKA 1LQBA 1C1YB 2MA9B 4PYZA 5HKHA 3DBHI 3VFKA 2LVPA 4IC7B 4PS7A 4W9HA 3DVGY 1WX7A 2MP2B 2QHOA 4EEWA 5JZEB 3KW5B 5DPSA 2ZNVC 2M4NA 3IHPC 2KXJA 1HE8A 4KDLB 2YVCA 3T8MA 3ZDTA 4CO7A 3ZO5B 1Z2MA 2ZVNA 1GJZA 3B1LX 3B08A 3QAQA 2KJRA 2KK8A 2MBOA 2IO0B 2NR2A 2MW5A 2KVRA 3AULA 1KM7A 4FJYA 3A4RA 1WRDB 3AXCA 4WWNA 1E8WA 2KKCA 5C23A 3PT2B 3VXWA 1UBQA 2BF8B 2RGFA 4GXBA 2PE6B 2PJHA 2I1JA 1JRUA 4JLCA 3IBEA 2O6VA 4IG7B 4FBJB 1L2NA 1Q5WB 3M63B 3NOBA 3Q3JA 4MDKE 2A4ZA 1WGYA 1Q0WB 2L0FA 3DBRI 4GGQA 3JVZX 3KUCB 2FNJB 1TTNA 3B0AA 3VDZA 3A9JB 2WWZA 1UELA 4EFOA 3WIMA 2K6QA 3WAMA 1TBEA 3WALA 2DYBA 3PTFC 5C1ZA 2L00B 4W9FA 3ONSA 1ZKHA 4ANWA 2VRRB 3A9KB 3KUDB 4IM3A 2C7NB 1Q1OA 1WM3A 1F9JA 2V4LA 4TKNA 3VUXA 2J7QB 1P98A 3TL5A 2KN5A 3L0WB 2M0XA 2KC2A 4AJYB 4XZ4A 4CHKA 2LVOA 1GUAB 2C5LC 3ZW3A 3QC8B 5EDSA 1P1AA 3ML9A 2I1KA 2N1WA 3L08A 4I6LB 4B9KA 4M0WB 4WJQA 4DXAB 2ZVOA 1IPGA 5E6OA 4WWPA 1MG8A 3M3JA 3A4SC 5CHVC 2NBUA 2ZPYA 1XD3B 3QK0A 2PE9A 3ZNID 3HM3A 2JZ3B 3H6NA 1R4MI 4GDLB 4HDQA 1RLFA 1YJ1A 4OVUA 5CHFA 2LRWA 2GOWA 4E71A 1KJTA 3VQIA 2LGDA 4JIOU 4HLEA 1WX9A 4TUUA 1E7VA 3ZLZA 4E74A 3LDZE 1WZ3A 3U7DA 4PS3A 4EKUA 3UQBA 3ZTCA 5LXIB 2EMSA 2JUOA 5LLIA 2RD0A 2LGYA 3K9OB 4GOCA 1V5TA 1P3QU 3W1SA 4EZLA 4LJOB 3CSTA 1R4NI 1ZW7A 3H7SA 3JSVA 3MJWA 3PGEA 3T9LA 3R7RA 4W9KA 3BINA 1GC7A 4G50A 2V1YA 4NY0A 2Y5BB 3WAOA 2BWFA 1SE9A 3U30A 1OTRB 1V2YA 1E5WA 4DBGA 1VCBA 2G45B 2MQJA 2RSUA 4MGKE 4WJPA 1C3TA 3TBLD 2J0KA 2K1FA 3RYTA 3MHSD 2N9XA 1GNUA 2LWPA 1UH6A 3DVNU 4P7IA 5D7GA 4NAWA 1V5OA 4DHZB 2LXCA 4NQKE 1OEYA 2XK5A 5KHQA 3V60A 1WJNA 4M8MA 3GZNI 5DCNA 3SU8X 3PZDA 3UINB 3BY4B 2CHWA 5AZGA 3R7QA 2IO1B 4CYEA 4KDIC 4BOSC 2M17A 2N9PC 2FAZA 2KZRA 3R3MA 4EZJA 3AU4A 3GOEA 2DYMA 1WXVA 2FCNA 2OJRA 2DHZA 3EECA 4G11A 3VVWB 3QX1A 3ZRFA 2BKFA 3H9DA 3PHWB 2KOXA 4I6NB 2GBRA 3EC8A 4HDOA 4IW0A 3RCZA 1WXSA 4AWJA 2FUHB 3TJPA 2NCNA 4J6IA 5E6PA 2N7EA 2JPHA 2AYOB 3DVNV 2MWSB 4F8CB 5AEKB 4YL8A 4EOYA 3L17A 2ZEQA 4DDGD 1EO6A 1NDDA 3NS8A 2DZIA 4WWOA 1H8CA 4ANXA 1E8YA 5J17A 3P2BA 4MELA 3QHTA 3W1SC 4MJSB 2JWZA 1L7YA 2KX3A 2KJ6A 2KTRA 2LXAA 2LZ6A 2XBBC 4GIVA 4PS8A 3V62A 4JL9A 4TV3A 3WANA 5DPTA 3PS6A 4K7SA 2DAJA 1Y8RC 3CSFA 1YD8U 2L0TA 2ZNVB 3EFUA 3PV1A 3NY5A 2KNBA 3A1QA 3APDA 4X57B 1LFDA 1V80A 3NZSA 4RM9A 4G3XB 3PPAA 2MBEA 3KH0A 2AWTA 4JQWC 3X0WA 2K25A 5AZHA 1P0RA 3K9PB 1LXDA 4URKA 1YQBA 3PHXB 3OLMD 4ANUA 3DOWA 3H7PB 4EZKA 2R2QA 3PRMB 4K81A 2NVUI 2BWES 4FHJA 1EF1A 4W9CA 2IBIB 2XEWA 4NNJB 2CS4A 2KLCA 4I6PA 2XK5B 2CHZA 2ASQA 3RULA 1WI0A 2AEHA 3QCAA 2JF5A 4FJVB 2LJ5A 2BGFA 3PLVA 3ZNZB 2KDIA 3N30A 4FA6A 4XC2A 2DZJA 1OQYA 5D6JB 2DZMA 2GBKA 3IVFA 2DENB 4HK2A 4ZDVA 1AARA 2BYVE 1S1QB 2KFJA 3AU5A 1D3ZA 2O2VA 2YLMA 4MGZE 1WZ0A 1WMHA 1NBFC 1OGWA 2L76A 4KIKA 3PLUA 3VH4B 4B95A 2G4DB 3HHMA 5E6NA 4GDKA 5D2MB 4W9LA 2KDFB 1WE7A 2KFKB 4GB9A 4LDTB 1WJ4A 2D07B 2BPSA 2N1VA 4HVBA 2JY6A 3UGBB 1WXAA 5IAAC 1V49A 4DDID 1RAXA 4IWQA 3VTVA 1E8XA 2V3SA 5TR5A 5JHAA 3APCA 2ZJDA 2JXXA 3ZVVA 4MSQB 1RRBA 2LVQA 1V86A 2KTRB 4DHZE 3PREA 4FJZA 1SIFA 2KJHB 3SHQA 1E7UA 3I3TB 2IYDB 2C7MB 2A5UA 4DHJB 2KMCA 4IUMB 2Z0EB 3TIXA 3VUYA 3L13A 4WJNA 1WFYA 4HPMB 1M94A 1WYWB 3N3KB 4LCDE 3SDLC 2L8JA 1WJUA 1TGZB 3UQAA 5LXHA 4XX5A 2HJ8A 4PYUA 2N9EB 2MSED 3ZUNA 1J0GA 3DDCB 2W9NA 4IWOA 2D3GA 4FADA 2O6VB 1KOTA 4A20A 4KSLC 2EMTA 1UZXB 2IO3B 3HIZA 1ISNA 3LJ3A 4MH0E 3OJ3A 1Z5SB 1WF9A 1I42A 1YX5B 2KDEB 2DYOA 2NPTA 3DBLI 4A3OA 2NBVB 3PVLA 1E90A 1KLVA 2KANA 3QIJA 3ZIMA 3ENEA 4F7ZA 3QJZA 1RFAA 3A33B 3ALBA 2KWUB 4GSWA 4A3PA 1WGDA 4M8NA 5L95C 5JH5C 1ZGUB 3WA0A 4BOZB 4KZCA 4MM3A 2IO2B 2EKEC 5J2RA 3NHEB 3WAPA 1WJ6A 4AUQC 3RZFA 5FR6A 1QZEA 2FIDA 2CHXA 1BT0A 3A9JA 4BBNC 3NZUA 3KYCD 4KIKB 3VTUA 1A5RA 2L7RA 2L05A 1WR1A 2M1MA 5CTRC 5G55A 4GN1A 4MSMB 1SGHA 2LRUA 1LM8B 2WX1A 5J18A 1H4RA 2JRIB 2K6DB 3A9KA 4BKSA 4AP4C 4GU2A 2K8BA 5AZFA 4K7WA 5BO4B 2UWQA 4HCNB 3Q3FA 3RUIB 1FXTB 4DWFA 4G0NB 1GG3A 4WJOA 4LDTD 2FCMA 3IFWB 1T0YA 4EUTA 2HD5B 2KHWB 1WR6E 3UIPB 2WYQA 4HCPB 2KX0A 3ECIA 3APFA 3AI5A 4MGYE 2N4FA 2NS5A 3JSVB 3VUWA 1WGRA 2GBNA 4W9JA 4NQLB 2D11A 2K8CA 3CMMB 1J8CA 2HTHA 5DPRA 3X23A 4DHJD 2DZKA 2D10A 4FLHA 2MRPA 3VH3B 1WGHA 2D2QA 2KC1A 3JW0X 4B6WA 2IY1B 2K39A 2Z59B 3PSEB 4HXDA 4KVGB 3RD2A 2PPHA 3TMPB 2NPTB 5L83A 2WDTB 4NAWB 2O6VD 2MX2A 3C0RB 4E3CA 2J0JA 2UYZB 2KWCA 3KYDD 3V61A 2Z0DB 3UIOB 1WE6A 2BYEA 3DCGA 2IY0B 2DAFA 3QA8A 4N9F4 4W9EA 1U4AA 3W1YA 1OEYJ 2C7HA 2NBWB 3JYUA 4II2B 4RM8A 5KHOA 4AOFA 3V6CB 3VTWA 3RZWC 4ZRIA 2GBJA 3D32A 4FHKA 2HE7A 4IM2A 2MBBB 4RMAA 4K7UA 1CMXB 2CR5A 4ZRJA 4TQ1A 2MBHA 2KLGA 4K1RB 4MEMA 3PRPB 1X1MA 3M95A 4W9GA 1YIWA 4TQ0A 5GMVA 2MCNB 3ML8A 4ICVA 2KDBA 4BKTA 4ASWC 2KMAA 4GMVA 2AL6A 2G3QB 4ICUA 1YX6B 4NPNA 1E8ZA 2MBQA 4MGIE 2REXA 3ZRCA 2AL3A 4II3B 2KTFA 2JT4B 4JGHB 3H1UA 1IP9A 4ANVA 3QWZB 3DPDA 2GBMA 4HWIB 3OJ4B 1J19A 5DPWA 3CF6E 3EHVA 2L3ZA 3O65B 2N7DA 2JZZA 4BFRA 3R66C 4BBNF 2BKRB 2LD9A 2FCSA 2RR9A 3A1QB 1VD2A 1WX8A 4IWPA 4ZYNA 4OVVA 1XT9B 3ZNGC 4WQOB 1WY8A 3ZKJC 1UD7A 1P9DU 2WX0A 2C9WB 2JVCA 2ZCCA 2MP2A 1EF5A 4LJPB 4MJSA 3MTNB 2B3AA 3U8ZA 3HM6X 3ZNHB 2PEAA 3L16A 1GC6A 2M8SA 4FULA 1TZ1A 2BYFA 1XQQA 4FN2A
chains in the Genus database with same CATH superfamily
3Q2AC 2LUEA 1V81A 1QOGA 4IOIE 4C4VB 1NI2A 2LI5A 3LXFA 4BKGA 5G2NA 3GE8C 4HPLB 1IYFA 2ZPNA 1FRDA 4LNNA 3HUIA 2RPVA 3QARA 1ENFA 4P6VF 2FIFA 4GDKB 4QAYA 3QQ8B 3KUZA 3AEAB 3KVFB 1PQSA 3N1YC 2G4SA 2PIAA 2CU1A 1L4ZB 3PZ8A 2KWDA 2JWUA 3E9SA 1C4CA 1FNVA 4LK0M 3GS2A 3HVZA 4KV2A 2KQ4X 4GDLA 4AJWA 3DBSA 4JPSA 1C77A 4HJKA 4P1CC 1C1YB 1E10A 1KFYB 3TEWA 2LVPA 4W9HA 3C8YA 4EEWA 1VLBA 3KW5B 1TZOA 4RGTA 2M4NA 2KXJA 1HA5A 2YVCA 3Q3NC 4CO7A 1QOBA 2W3RA 2WXHA 4YWGG 3B1LX 2IO0B 3AE6B 2KVRA 3AULA 3EFCA 4FJYA 2KKCA 2NMQA 3PT2B 1UBQA 4GXBA 3AE7B 2XN9C 2O6VA 1Q5WB 3M63B 2E3TA 1DYQA 1YN5A 1Q0WB 2BB5A 3TEZA 1K52A 1I4GA 4EFOA 3Q8AA 3PTFC 5C1ZA 1ZKHA 4ANWA 2I38A 3KUDB 1DOXA 2C7NB 1SJHD 4TKNA 3VUXA 4OW0A 2WXGA 5C3JB 4CHKA 3I9V1 1GUAB 3ZXRA 2LGSA 1P1AA 2KACA 3L08A 2ZVOA 4WWPA 1MG8A 5CHVC 2ZPYA 4J3OD 3QK0A 3H6NA 1R4MI 1EWYC 3P4PB 2KVZA 4FXCA 1WX9A 3LDZE 1WZ3A 4PS3A 2TSSA 3RPFC 1T0QC 3T3OA 3JSVA 3DHIC 3H7SA 3PGEA 4W9KA 4NY0A 3WAOA 1OFFA 4YTMB 3U30A 5TSSA 1VCBA 1L6UA 2MQJA 1C3TA 2K1FA 3MHSD 3DVNU 1OQQA 2BS2B 2MJ3A 3W9CB 4P7IA 4NAWA 4DHZB 1OEYA 3V60A 1WJNA 3PZDA 2H89B 3UINB 4RGMA 2IO1B 4CYEA 5MPOA 2M17A 2N9PC 3CIRB 2DYMA 1WXVA 2FCNA 2DHZA 1YN4A 1T0SC 4OHJA 3QX1A 2BKFA 2Y5CA 2GBRA 3J9CA 4IW0A 4AWJA 2NCNA 2JPHA 2AYOB 2WXPA 1LO5D 1CJEA 2Q5WD 3UI3A 3IT4B 5AEKB 2ZEQA 4MH8A 1SE2A 2G1EA 3W5VB 1L7YA 2KJ6A 2LXAA 2LZ6A 4PS8A 2WNMA 3AB5A 1FXAA 2FUG1 1YD8U 3EFUA 3PV1A 2KNBA 3A1QA 1V80A 3OWEB 4RM9A 3P1MA 3PPAA 2AWTA 2QMTA 4IDIA 4JQWC 2K25A 5AZHA 1LXDA 1UNSA 2PTLA 3PHXB 4EE2A 4EZKA 1PGBA 2BWES 3AM9A 1VRAB 2XK5B 1WI0A 3GE3C 2G9HD 3PLVA 2N9KA 4C4VA 4FA6A 1OQYA 2DENB 4A9AA 1T0RC 3AU5A 3AN1A 1PGAA 1WZ0A 1NBFC 3PLUA 3VH4B 1FCCC 2G4DB 4GDKA 4W9LA 1WE7A 1WJ4A 1TIFA 3DHGC 2BPSA 3SEBA 3Q8CA 2FE8A 2AQ2B 1E8XA 5JHAA 5TR5A 3APCA 1HEZE 2JXXA 3ZVVA 2HTME 2KTRB 2WXOA 3O13A 4KGTA 3SHQA 1CZPA 3I3TB 4DHJB 2Z0EB 4LCDE 4HPMB 3SDLC 1WJUA 5LXHA 4XX5A 2N9EB 2WGSA 4FADA 1EU3A 1KOTA 1TY0A 2IO3B 2R61A 3HIZA 1I42A 4M02A 2DYOA 2QILA 3DBLI 4A3OA 1F2RI 3PVLA 1KLVA 2KAJA 2KANA 1XLPA 3ENEA 3KWLA 1ZPSA 3QJZA 2LGIA 5L95C 1GPXA 1ZGUB 2YEPF 4KZCA 5J2RA 3LB8C 3SFDB 5FR6A 1A5RA 1NVID 2MH7A 4GN1A 1ZOYB 1LM8B 2WX1A 5HHDG 1H4RA 2K6DB 4BKSA 2OJWA 3DBRB 4HCNB 5BYRA 2FCMA 2INCC 4R3DA 4ZRQA 3UIPB 2WXFA 1FPYA 3APFA 2N4FA 4W9JA 2WXQA 2DNFA 3BVMA 5E6JA 3HRDD 3CMMB 3T3NA 2D3CA 2D10A 3FAHA 3VH3B 3VRBB 4B6WA 2K39A 2Z59B 3PSEB 1MHXA 3TMPB 2NPTB 3MP9A 2MJEA 4RGOS 2J0JA 1FO4A 1QOAA 1E9MA 3MJ5A 2BYEA 4N9F4 3W1YA 1UWXA 2M56B 1TS4A 2LEKA 3V6CB 3RZWC 1R4NB 4ZRIA 3D32A 1CMXB 5AUKA 2KYWA 1QF6A 2W82A 3U7ZA 3M95A 2MCNB 3AEFB 1VR9A 4ICVA 4RFBA 2AL6A 2G3QB 3NRZA 3RNAC 1E8ZA 2V4IB 2WQYB 4N59A 2REXA 3ZRCA 2IDYA 4OZBA 1RWSA 1IP9A 2M0AA 3Q69A 5DPWA 4JE3B 2N7DA 2JZZA 2K0PA 4BBNF 3AE3B 2EKIA 4B0EA 2WX0A 2C9WB 1EF5A 4LJPB 2B3AA 2M8SA 5BYSA 1AW7A 1TZ1A 4FN2A 2ZCBA 4NJ7A 1FEHA 5I4DA 1I35A 2D3AA 3M62B 4O1NA 1ZXIA 5CHWA 1V9JA 1N6ZA 3RN9C 3Q8EA 4JWSC 3DWGC 2LGXA 2KD0A 2GMIC 3HK0A 2L83A 3WCQA 4IM0A 4YSZB 1V6EA 4KZ0A 2R2OA 2CKHB 3EA6A 3DQVA 2BB6A 2DX5B 4WAAA 2FCQA 2ZZPB 1TS5A 3DVGX 4BKSD 1J7CA 1F77A 4K3CA 4F1SA 2KO3A 1C4AA 2RDBC 2K8HA 3VR8B 1VJKA 1K51A 2W55A 2LASA 1PYWD 2BW2A 1LQBA 4PYZA 4XGAB 5FK9C 5IO9A 4PS7A 4IC7B 3VRAB 3DVGY 3P4QB 4RGNA 2QHOA 3T8MA 1XO3A 3ZO5B 3QAQA 1MHHE 2KJRA 4AQ7A 4UDUC 1XCTL 3NVYA 1KM7A 1E8WA 1IUEA 2BF8B 3I57A 2PJHA 1JRUA 2EELA 4WAFA 4US9A 2L0FA 3JVZX 2FNJB 3A9JB 2WWZA 1I7HA 1UELA 3GP7A 1TBEA 4WURA 3URYA 3ONSA 1I4PA 2VRRB 1Q1OA 4KX6B 4XZ4A 1D6EC 1GAQB 4I6LB 3BZDB 4DXAB 5E6OA 2UU7A 3A4SC 2JXTA 3ZNID 2NTTA 2JZ3B 4HDQA 3I63C 5LNK1 1YMHE 1KJTA 3VQIA 4JIOU 4TUUA 3U7DA 1C4PA 4OZCA 5LLIA 2LGYA 2WS3B 1MPEA 3CSTA 3MJWA 2Z8LA 3T9LA 1A70A 1FM0D 3FC4A 4G50A 2V1YA 1JMLA 1SE9A 4WIPA 1FFUA 1E5WA 5H92C 4MGKE 2J0KA 1D5ZC 5G5GA 1UH6A 5D7GA 1J7BA 3NG0A 5DCNA 1JWAD 3AEGB 3BY4B 1WXQA 1EWCA 2XNAC 3AU4A 4ZOHC 3EECA 3R2IA 3VVWB 1QKZA 2KOXA 3RNGC 4YSXB 5BMIA 3IAS1 3TJPA 4J6IA 5E6PA 2RDGA 1MI0A 2N9LA 2QCZA 2ZW0A 1DOYA 4DDGD 1XLQA 1NDDA 2VZKB 5J17A 4MELA 4N6EB 3QHTA 4MJSB 2KX3A 4WQOB 4GIVA 1AYFA 4TV3A 3WANA 5DPTA 3PS6A 1Y8RC 4X57B 3KH0A 4ARCA 1FMAD 3IT6B 4ANUA 3ZJUA 5HFYA 1BUIC 1TT5B 3PRMB 4K81A 4IKGA 2XEWA 4NNJB 2CS4A 2BVCA 2HJ1A 3RULA 2ASQA 4N58A 3QCAA 4FJVB 4C7YA 4REZA 2IGHA 2DZJA 5D6JB 2DZMA 2GBKA 1CQVA 4HK2A 1AARA 2OEDA 2OHFA 1KLGD 1SE3A 3P63A 2BT6A 2YLMA 4MGZE 4H2AA 1OGWA 3AEDB 4KIKA 5E6NA 5HG2A 1SE4A 3NJTA 1MFWA 5C2TB 2KDFB 4LDTB 4HVBA 1WXAA 2LHEA 2WXNA 4L23A 1L4DB 2ZJDA 3AEBB 5EE0A 3PREA 2KJHB 1E7UA 2C7MB 3MC9A 2KMCA 4IUMB 1XLOA 3TIXA 3VUYA 3N3KB 2L8JA 4LNIA 2LUMA 4IWOA 3FILB 4RF0A 1UZXB 3LJ3A 1T3QA 3OJ3A 1Z5SB 1WF9A 3FKYA 1YX5B 1ZP0B 5IN7A 1KH0A 2WU2B 1D5MC 5EE9A 1RFAA 3ALBA 2KWUB 4A3PA 1UGJA 1LGRA 5JH5C 2IO2B 2EKEC 1TS3A 3Q3MC 4KKIA 4AUQC 3RZFA 3ZYYX 3DWMA 1QZEA 1OQRA 2FIDA 3A9JA 3NZUA 3VTUA 1V97A 2BQQA 2LRUA 5J18A 4LNFA 1Q10A 2JRIB 5BO4B 3Q3FA 4ZYSA 4WH4A 3TSSA 3IFWB 4WWMA 1NYRA 2KHWB 3AE8B 3ECIA 4ARIA 2NS5A 1WGRA 4OZAA 2V3NA 4NQLB 2K8CA 5DPRA 1WGHA 1ET6A 3NS1A 3RD2A 4KVGB 2PVGC 2PPHA 3U52E 2O6VD 4A6QA 2MX2A 3C0RB 2UYZB 2Z0DB 1PUTA 3UIOB 4RH6A 4W9EA 2DAFA 2C7HA 3JYUA 1UF0A 1R7SA 4RF1A 3VTWA 1ROEA 1ZE3D 2HDEA 1JALA 3AE4B 4NZLB 2KLGA 1NI3A 4MEMA 3W5UB 4TQ0A 4XYCA 1ESFA 4OVZA 4BKTA 2BS4B 4GMVA 1YX6B 4NPNA 1JWUD 2MBQA 4MGIE 2AL3A 3GZNB 1F0ZA 2KTFA 2JT4B 4JGHB 3QWZB 4HWIB 3OJ4B 1J19A 2QDFA 2GI9A 3AE9B 1QT9A 1JQ4A 1YQ4B 4BFRA 3R66C 2ICIA 2BKRB 1FCLA 1D5XC 3ZJVA 4IWPA 2LHDA 1XT9B 3Q8BA 2QEJC 2ZCCA 2K3UA 2PVOD 1PFDA 4MJSA 3MTNB 3HM6X 2PEAA 1MJDA 4M01A 2NTSA 1SEBD 1VZ8A 5GXGB 1XQQA 3DBHB 3NVWA 2KQSA 2KQ7A 4YTPB 4XDDA 4KSKC 3ZDMC 2K22A 2AQ1B 2J0MA 1WH3A 4WQMA 2O2VB 3S2AA 3UF8A 4JX1C 4LLGM 2AX5A 4ZRKA 3U4EG 1VZ7A 2MLBA 1EUVB 1FRRA 2X38A 4MACA 1FNWA 4K3BA 4ACFA 2QC8A 1JWSD 1ZDVA 1MG4A 5D94A 1N5WA 2WLBA 1TKGA 1WGKA 3NVVA 3BVZA 3B9JA 1K8RB 2J4XA 1YNTE 1C78A 1SIJA 1G6JA 5JHBA 2KWVB 3LYYA 1IGCA 1SBBB 4W9IA 1IBXB 2MA9B 5HKHA 3DBHI 2IGGA 1WX7A 2MP2B 5JZEB 3IHPC 1HE8A 4KDLB 1BMLC 3BWUD 2ZVNA 1GJZA 3B08A 4DXGA 2MBOA 4P1BC 5D3IB 3A4RA 1WRDB 5C23A 1I4QA 3VXWA 2INDC 1ACCA 3FILA 3IBEA 4IG7B 4FBJB 2K9XA 4XWTA 4MDKE 3NOBA 3U2SC 1SJED 3DBRI 1WGYA 4GGQA 2B76B 3WAMA 3RI7C 2DYBA 1L0YB 1N62A 2LJIA 1QOFA 3A9KB 4M00A 4IM3A 1F9JA 2V4LA 3TL5A 3L0WB 2M0XA 2KC2A 4AJYB 2LVOA 1VZ6A 2C5LC 2V3PA 3QC8B 5EDSA 4WJQA 2N7JA 1IPGA 2K5PA 1XD3B 4HKQA 4NAMA 3HM3A 2VH2A 4GDLB 1RLFA 5CHFA 2LRWA 2SAKA 4E71A 1WYGA 2VH1A 1E7VA 3ZLZA 4EKUA 2JUOA 3ZGZA 2RD0A 2WXJA 3K9OB 3MHZA 4GOCA 1V5TA 1P3QU 1R4NI 1GC7A 3ZQ4A 2Y5BB 2GRIA 1V1OA 2GLSA 3KWVA 1OTRB 1V2YA 4DBGA 4WJPA 2G45B 3C19A 2RSUA 2L52A 3RYTA 2N9XA 1GNUA 1V5OA 4NQKE 2XK5A 5KHQA 4M8MA 3RNEC 1HZ6A 5AZGA 1SF0A 4KDIC 4BOSC 2KZRA 3R3MA 4EZJA 1AN8A 4YT0B 3PHWB 1ZDXA 4HDOA 3RCZA 2BTEA 2JZPA 1XEEA 4HROA 2DBYA 2QIEB 1EO6A 3NS8A 1E8YA 2V0GA 2XBBC 3V62A 3ZW3A 2KTRA 4JL9A 1P7EA 4K7SA 2DAJA 4Q2JA 3CSFA 1FFVA 2L0TA 2ZNVB 3NY5A 1LFDA 5AUIA 2MBEA 3X0WA 3AH7A 2MJDA 3K9PB 4URKA 3OLMD 4LNOA 3DOWA 3H7PB 2CU3A 1P7FA 2NVUI 3NVZA 4FHJA 3L4PA 4W9CA 1J7AA 4MT5A 2PMVA 2ON8A 1HTOA 2PW9A 3ZNZB 2JU6X 2KDIA 3N30A 3IVFA 2D3BA 2CJNA 1JROA 1M4VA 1S1QB 2O2VA 1N61A 2L76A 2ONQA 3E56A 3HHMA 1TS2A 2KFKB 1I4RA 2JQRB 2JY6A 3UGBB 2J42A 1ZUD2 1ZXHA 2V3SA 4P16A 2WDVB 2IYDB 2A5UA 2INNE 3P4RB 3RNBC 3L13A 4WJNA 1WYWB 2KMMA 2MSED 3ZUNA 5EE3A 3DDCB 2W9NA 4A20A 1ISNA 2N0SB 2KDEB 2NPTA 5FR3A 3MC8A 1E90A 4F7ZA 1TKYA 1WGDA 2PLPA 3WA0A 4BOZB 3TUOA 3NHEB 1FIQA 1WJ6A 4US8A 2CHXA 1BT0A 2X8XX 5G5HA 2QSDA 1TJEA 2FBWB 4BZAA 2L7RA 3AE2B 3I5JC 5CTRC 2M1MA 4MSMB 4DQOC 3A9KA 4GU2A 5JXVA 2K8BA 5AZFA 4K7WA 5T8IA 2UWQA 1PGXA 4PT5A 4DWFA 4G0NB 2JYTA 1C76A 1NYQA 1SSNA 1T0YA 3MC0B 4EUTA 3N9YC 1JW9D 4XE0A 3AI5A 4MGYE 5IOIA 1YN3A 3VUWA 1J8CA 2YEPB 3X23A 4DHJD 5BYQA 3AMZA 4FLHA 1XCQL 2D2QA 1R4MB 4HXDA 5L83A 2WDTB 4C80A 3Q3OC 5BMHA 3KYDD 3V61A 1WE6A 3DCGA 2IY0B 3QA8A 2WXRA 1OEYJ 4RM8A 2NBWB 4II2B 4AOFA 3B2FA 2GBJA 4FHKA 2HE7A 4TMAB 4IM2A 4RMAA 2CR5A 3N20C 1SXTA 2IGDA 3BK2A 1D4BA 3PRPB 1YIWA 2IPKD 5GMVA 3BK1A 1WRIA 3SFEB 1SB3C 4ASWC 4ICUA 2MEKA 4II3B 3BIID 4HRSA 4JWUC 3H1UA 3DPDA 4HKZE 4KGRA 1E6EB 3EHVA 1F1HA 3V3XA 3O65B 4L1BA 2LD9A 2FCSA 3ZXVA 1TKEA 1K53A 3Q8FA 4OVVA 4A55A 1I4XA 3ZKJC 1UD7A 1P9DU 2BS3B 2JVCA 5D3DA 2WXMA 1UWMA 3SR6A 3ZNHB 1BXTA 3P4SB 3V05A 2LFIA 3TEYA 1C79A 1AWDA 1E7PB 1JCKB 2BYFA 3R2TA 1RM6C 3R8BA 2JX5A 3TCAA 4BVUC 2INPE 2RPQA 2JYEA 1Y56A 1KF6B 5IA7A 3H7PA 4NJ6A 1WIAA 3CWIA 4W9DA 1WMHB 5CX3A 1E0ZA 1UBIA 2Y5PA 3L54A 4USAA 1WXMA 3OAWA 2W3SA 2IZVB 1B9RA 1WM2A 2MHJA 4XWWA 3P42A 3RT3B 3PRZA 2C60A 1S3SG 2L32A 3IG3A 1UGMA 1JWBD 3N32A 3SD5A 3VAWA 3V6EB 2JRHA 4DK5A 3ZTDA 2KFKA 3L10B 2OOBB 3VHTC 1WGGA 3VFKA 2ACZB 1L5PA 2E6XA 5IP4D 1GB1A 5DPSA 2ZNVC 5H8YE 4YSYB 3ZDTA 3GB1A 1Z2MA 4LTUA 2WHIA 2KK8A 2NR2A 2MW5A 1MVKA 3AXCA 4WWNA 2RGFA 1STEA 2DWQA 2PE6B 2I1JA 4MM3B 4JLCA 1L0VB 1L2NA 3Q3JA 1YOVB 2A4ZA 4AS1A 3KUCB 1TTNA 3B0AA 3VDZA 2I2YA 3VR9B 3NUHB 2K6QA 3WIMA 3WALA 1DOIA 1YJJA 2L00B 4W9FA 4A8XC 1WM3A 4ZHPA 2J7QB 1P98A 2KN5A 1JRPA 3DBLB 3N1XC 3RNCC 3IXSA 3ML9A 2I1KA 1EM7A 2N1WA 4B9KA 4M0WB 1F52A 1KTKA 3EUB2 3M3JA 2NBUA 1WSPA 2PE9A 1YJ1A 4OVUA 4TSSA 2GOWA 1B1ZA 2LGDA 4HLEA 2WP9B 4E74A 3UQBA 3ZTCA 1L0XB 5LXIB 2EMSA 1HZ5A 1XXGA 3W1SA 4EZLA 4LJOB 1ZW7A 1IGDA 4HJGE 3R7RA 3BINA 4S0RA 1FNUA 2BWFA 2KT7A 4ZRPA 2RMMA 1XLNA 5HI1A 3TBLD 2GB1A 2LWPA 3KLSX 1WWTA 2LXCA 1PDXA 3GZNI 3SU8X 1FXIA 2CHWA 3R7QA 4KGSA 2FAZA 3GOEA 4D2KA 3BYTB 2OJRA 3BYYB 4G11A 4YXDB 3AE5B 3ZRFA 2WXIA 3H9DA 1VDVA 4I6NB 3EC8A 1WXSA 4XDCA 1GOZA 2FUHB 1YQ3B 2N7EA 3DVNV 2MWSB 3IAM1 4NJCA 4S17A 4F8CB 2WXKA 4YL8A 4EOYA 3L17A 4KKJA 1H8CA 2DZIA 4WWOA 3PO0A 4ANXA 3P2BA 3W1SC 2JWZA 3B2GA 4CQNA 3AE1B 3NZ3A 1V1PB 1C9FA 2D5GA 4DXFA 3APDA 2BYTA 4G3XB 1DGJA 4L2YA 1P0RA 4C7ZA 1YQBA 3N1ZC 2R2QA 1EF1A 2IBIB 1HQRD 2KLCA 4B0MA 4I6PA 2CHZA 2AEHA 1TY2A 2JF5A 2LJ5A 1HXYD 2BGFA 3ETRA 3AECB 4XC2A 4HPPA 4ZDVA 2BYVE 3RFZB 3PZ7A 2KFJA 1D3ZA 1WMHA 1GB4A 4B95A 1NENB 2AQ3B 5D2MB 4C00A 4GB9A 3TEXA 1KLUD 2D07B 2N1VA 2PKOA 5IAAC 1V49A 4DDID 1RAXA 4IWQA 3VTVA 1QLBB 1RRBA 4MSQB 2LVQA 1K50A 2WDQB 2H88B 1V86A 4DHZE 4FJZA 2KDMA 1SIFA 3ZJTA 2VZKD 4C56C 1WFYA 1M94A 2WXLA 3UQAA 1TGZB 2HJ8A 4PYUA 1J0GA 2V9HA 5BMGA 3BVGA 2D3GA 4LNKA 2O6VB 4KSLC 2EMTA 3Q6BA 4MH0E 5IKCM 4ZHOA 4BAXA 3W2DA 2NBVB 1NEKB 3RNFC 3HVDA 3H8HA 4PK1A 3QIJA 2BBCA 3ZIMA 3A33B 4GSWA 4M8NA 2J53A 2WDRB 4MM3A 1YJIA 3KQ4A 3OG5A 3WAPA 4BBNC 1ET9A 3KYCD 4KIKB 1KRHA 2L05A 1WR1A 5G55A 1SGHA 5EE1A 4AP4C 1TYGB 5FKAC 3RUIB 1FXTB 2RDHA 2SEBD 1GG3A 4WJOA 4LDTD 1HTQA 2HD5B 4M0WA 3AEEB 1V8CA 1WR6E 2WYQA 4HCPB 2KX0A 1N5XA 2Y3AA 3JSVB 2WU5B 2GBNA 1XF5L 3DHHC 2QJLA 2D11A 2DLBA 2HTHA 4HEA1 2DZKA 3EGRA 2MRPA 2KC1A 2KN4A 3JW0X 2IY1B 1EU4A 2CJOA 2LMCA 1QQRA 3AV8A 4NAWB 2M19A 4E3CA 3Q14C 2KWCA 4YTNB 1U4AA 5KHOA 1JWMD 1RFKA 2MBBB 4GLSC 1UUPA 4K7UA 4ZRJA 4TQ1A 2MBHA 4K1RB 1I4HA 1X1MA 4W9GA 1F2RC 3ML8A 2KDBA 4ITKA 1RYJA 2KMAA 1L6VA 3RMKC 1T5XD 4ANVA 2GBMA 2IJ0A 2ZW1A 1T6BX 3CF6E 2L3ZA 2JSVX 1N60A 2L1AA 2J52A 2RR9A 3A1QB 1VD2A 1WX8A 4ZYNA 3ZNGC 1WY8A 4RCOA 1IBXA 1N63A 4RNAA 2MP2A 1FD6A 3ABVB 3U8ZA 1QILA 1CK1A 3L16A 1GC6A 4FULA 1V1PA 4A90A 3NZSA 2W54A 3MFGA
chains in the Genus database with same CATH topology
3TCAA 2ZCBA 4NJ7A 4BVUC 2LUEA 2KQSA 1V81A 2RPQA 1I35A 2KQ7A 3M62B 5IA7A 4KSKC 5CHWA 3ZDMC 1NI2A 1V9JA 2LI5A 3H7PA 4NJ6A 4BKGA 5G2NA 2LGXA 1WIAA 2KD0A 2GMIC 4HPLB 1IYFA 2J0MA 1WH3A 3HK0A 4W9DA 2O2VB 2ZPNA 1WMHB 4IM0A 3S2AA 3UF8A 3QARA 4ZRKA 5CX3A 1UBIA 2FIFA 4GDKB 2MLBA 1EUVB 3L54A 3QQ8B 1V6EA 3KUZA 4KZ0A 2R2OA 2CKHB 3KVFB 3DQVA 1WXMA 1PQSA 2G4SA 3OAWA 2CU1A 2IZVB 1WM2A 2DX5B 4WAAA 3RT3B 2FCQA 2ZZPB 3PRZA 5D94A 3DVGX 4BKSD 2C60A 1S3SG 3IG3A 1UGMA 4F1SA 1K8RB 3N32A 2KO3A 3SD5A 3VAWA 4KV2A 3V6EB 2JRHA 4DK5A 1G6JA 3ZTDA 2KFKA 2K8HA 5JHBA 2KWVB 4GDLA 3L10B 4AJWA 2OOBB 3VHTC 2LASA 4W9IA 3DBSA 1WGGA 4HJKA 1LQBA 1C1YB 2MA9B 4PYZA 5HKHA 3DBHI 3VFKA 2LVPA 4IC7B 4PS7A 4W9HA 3DVGY 1WX7A 2MP2B 2QHOA 4EEWA 5JZEB 3KW5B 5DPSA 2ZNVC 2M4NA 3IHPC 2KXJA 1HE8A 4KDLB 2YVCA 3T8MA 3ZDTA 4CO7A 3ZO5B 1Z2MA 2ZVNA 1GJZA 3B1LX 3B08A 3QAQA 2KJRA 2KK8A 2MBOA 2IO0B 2NR2A 2MW5A 2KVRA 3AULA 1KM7A 4FJYA 3A4RA 1WRDB 3AXCA 4WWNA 1E8WA 2KKCA 5C23A 3PT2B 3VXWA 1UBQA 2BF8B 2RGFA 4GXBA 2PE6B 2PJHA 2I1JA 1JRUA 4JLCA 3IBEA 2O6VA 4IG7B 4FBJB 1L2NA 1Q5WB 3M63B 3NOBA 3Q3JA 4MDKE 2A4ZA 1WGYA 1Q0WB 2L0FA 3DBRI 4GGQA 3JVZX 3KUCB 2FNJB 1TTNA 3B0AA 3VDZA 3A9JB 2WWZA 1UELA 4EFOA 3WIMA 2K6QA 3WAMA 1TBEA 3WALA 2DYBA 3PTFC 5C1ZA 2L00B 4W9FA 3ONSA 1ZKHA 4ANWA 2VRRB 3A9KB 3KUDB 4IM3A 2C7NB 1Q1OA 1WM3A 1F9JA 2V4LA 4TKNA 3VUXA 2J7QB 1P98A 3TL5A 2KN5A 3L0WB 2M0XA 2KC2A 4AJYB 4XZ4A 4CHKA 2LVOA 1GUAB 2C5LC 3ZW3A 3QC8B 5EDSA 1P1AA 3ML9A 2I1KA 2N1WA 3L08A 4I6LB 4B9KA 4M0WB 4WJQA 4DXAB 2ZVOA 1IPGA 5E6OA 4WWPA 1MG8A 3M3JA 3A4SC 5CHVC 2NBUA 2ZPYA 1XD3B 3QK0A 2PE9A 3ZNID 3HM3A 2JZ3B 3H6NA 1R4MI 4GDLB 4HDQA 1RLFA 1YJ1A 4OVUA 5CHFA 2LRWA 2GOWA 4E71A 1KJTA 3VQIA 2LGDA 4JIOU 4HLEA 1WX9A 4TUUA 1E7VA 3ZLZA 4E74A 3LDZE 1WZ3A 3U7DA 4PS3A 4EKUA 3UQBA 3ZTCA 5LXIB 2EMSA 2JUOA 5LLIA 2RD0A 2LGYA 3K9OB 4GOCA 1V5TA 1P3QU 3W1SA 4EZLA 4LJOB 3CSTA 1R4NI 1ZW7A 3H7SA 3JSVA 3MJWA 3PGEA 3T9LA 3R7RA 4W9KA 3BINA 1GC7A 4G50A 2V1YA 4NY0A 2Y5BB 3WAOA 2BWFA 1SE9A 3U30A 1OTRB 1V2YA 1E5WA 4DBGA 1VCBA 2G45B 2MQJA 2RSUA 4MGKE 4WJPA 1C3TA 3TBLD 2J0KA 2K1FA 3RYTA 3MHSD 2N9XA 1GNUA 2LWPA 1UH6A 3DVNU 4P7IA 5D7GA 4NAWA 1V5OA 4DHZB 2LXCA 4NQKE 1OEYA 2XK5A 5KHQA 3V60A 1WJNA 4M8MA 3GZNI 5DCNA 3SU8X 3PZDA 3UINB 3BY4B 2CHWA 5AZGA 3R7QA 2IO1B 4CYEA 4KDIC 4BOSC 2M17A 2N9PC 2FAZA 2KZRA 3R3MA 4EZJA 3AU4A 3GOEA 2DYMA 1WXVA 2FCNA 2OJRA 2DHZA 3EECA 4G11A 3VVWB 3QX1A 3ZRFA 2BKFA 3H9DA 3PHWB 2KOXA 4I6NB 2GBRA 3EC8A 4HDOA 4IW0A 3RCZA 1WXSA 4AWJA 2FUHB 3TJPA 2NCNA 4J6IA 5E6PA 2N7EA 2JPHA 2AYOB 3DVNV 2MWSB 4F8CB 5AEKB 4YL8A 4EOYA 3L17A 2ZEQA 4DDGD 1EO6A 1NDDA 3NS8A 2DZIA 4WWOA 1H8CA 4ANXA 1E8YA 5J17A 3P2BA 4MELA 3QHTA 3W1SC 4MJSB 2JWZA 1L7YA 2KX3A 2KJ6A 2KTRA 2LXAA 2LZ6A 2XBBC 4GIVA 4PS8A 3V62A 4JL9A 4TV3A 3WANA 5DPTA 3PS6A 4K7SA 2DAJA 1Y8RC 3CSFA 1YD8U 2L0TA 2ZNVB 3EFUA 3PV1A 3NY5A 2KNBA 3A1QA 3APDA 4X57B 1LFDA 1V80A 3NZSA 4RM9A 4G3XB 3PPAA 2MBEA 3KH0A 2AWTA 4JQWC 3X0WA 2K25A 5AZHA 1P0RA 3K9PB 1LXDA 4URKA 1YQBA 3PHXB 3OLMD 4ANUA 3DOWA 3H7PB 4EZKA 2R2QA 3PRMB 4K81A 2NVUI 2BWES 4FHJA 1EF1A 4W9CA 2IBIB 2XEWA 4NNJB 2CS4A 2KLCA 4I6PA 2XK5B 2CHZA 2ASQA 3RULA 1WI0A 2AEHA 3QCAA 2JF5A 4FJVB 2LJ5A 2BGFA 3PLVA 3ZNZB 2KDIA 3N30A 4FA6A 4XC2A 2DZJA 1OQYA 5D6JB 2DZMA 2GBKA 3IVFA 2DENB 4HK2A 4ZDVA 1AARA 2BYVE 1S1QB 2KFJA 3AU5A 1D3ZA 2O2VA 2YLMA 4MGZE 1WZ0A 1WMHA 1NBFC 1OGWA 2L76A 4KIKA 3PLUA 3VH4B 4B95A 2G4DB 3HHMA 5E6NA 4GDKA 5D2MB 4W9LA 2KDFB 1WE7A 2KFKB 4GB9A 4LDTB 1WJ4A 2D07B 2BPSA 2N1VA 4HVBA 2JY6A 3UGBB 1WXAA 5IAAC 1V49A 4DDID 1RAXA 4IWQA 3VTVA 1E8XA 2V3SA 5TR5A 5JHAA 3APCA 2ZJDA 2JXXA 3ZVVA 4MSQB 1RRBA 2LVQA 1V86A 2KTRB 4DHZE 3PREA 4FJZA 1SIFA 2KJHB 3SHQA 1E7UA 3I3TB 2IYDB 2C7MB 2A5UA 4DHJB 2KMCA 4IUMB 2Z0EB 3TIXA 3VUYA 3L13A 4WJNA 1WFYA 4HPMB 1M94A 1WYWB 3N3KB 4LCDE 3SDLC 2L8JA 1WJUA 1TGZB 3UQAA 5LXHA 4XX5A 2HJ8A 4PYUA 2N9EB 2MSED 3ZUNA 1J0GA 3DDCB 2W9NA 4IWOA 2D3GA 4FADA 2O6VB 1KOTA 4A20A 4KSLC 2EMTA 1UZXB 2IO3B 3HIZA 1ISNA 3LJ3A 4MH0E 3OJ3A 1Z5SB 1WF9A 1I42A 1YX5B 2KDEB 2DYOA 2NPTA 3DBLI 4A3OA 2NBVB 3PVLA 1E90A 1KLVA 2KANA 3QIJA 3ZIMA 3ENEA 4F7ZA 3QJZA 1RFAA 3A33B 3ALBA 2KWUB 4GSWA 4A3PA 1WGDA 4M8NA 5L95C 5JH5C 1ZGUB 3WA0A 4BOZB 4KZCA 4MM3A 2IO2B 2EKEC 5J2RA 3NHEB 3WAPA 1WJ6A 4AUQC 3RZFA 5FR6A 1QZEA 2FIDA 2CHXA 1BT0A 3A9JA 4BBNC 3NZUA 3KYCD 4KIKB 3VTUA 1A5RA 2L7RA 2L05A 1WR1A 2M1MA 5CTRC 5G55A 4GN1A 4MSMB 1SGHA 2LRUA 1LM8B 2WX1A 5J18A 1H4RA 2JRIB 2K6DB 3A9KA 4BKSA 4AP4C 4GU2A 2K8BA 5AZFA 4K7WA 5BO4B 2UWQA 4HCNB 3Q3FA 3RUIB 1FXTB 4DWFA 4G0NB 1GG3A 4WJOA 4LDTD 2FCMA 3IFWB 1T0YA 4EUTA 2HD5B 2KHWB 1WR6E 3UIPB 2WYQA 4HCPB 2KX0A 3ECIA 3APFA 3AI5A 4MGYE 2N4FA 2NS5A 3JSVB 3VUWA 1WGRA 2GBNA 4W9JA 4NQLB 2D11A 2K8CA 3CMMB 1J8CA 2HTHA 5DPRA 3X23A 4DHJD 2DZKA 2D10A 4FLHA 2MRPA 3VH3B 1WGHA 2D2QA 2KC1A 3JW0X 4B6WA 2IY1B 2K39A 2Z59B 3PSEB 4HXDA 4KVGB 3RD2A 2PPHA 3TMPB 2NPTB 5L83A 2WDTB 4NAWB 2O6VD 2MX2A 3C0RB 4E3CA 2J0JA 2UYZB 2KWCA 3KYDD 3V61A 2Z0DB 3UIOB 1WE6A 2BYEA 3DCGA 2IY0B 2DAFA 3QA8A 4N9F4 4W9EA 1U4AA 3W1YA 1OEYJ 2C7HA 2NBWB 3JYUA 4II2B 4RM8A 5KHOA 4AOFA 3V6CB 3VTWA 3RZWC 4ZRIA 2GBJA 3D32A 4FHKA 2HE7A 4IM2A 2MBBB 4RMAA 4K7UA 1CMXB 2CR5A 4ZRJA 4TQ1A 2MBHA 2KLGA 4K1RB 4MEMA 3PRPB 1X1MA 3M95A 4W9GA 1YIWA 4TQ0A 5GMVA 2MCNB 3ML8A 4ICVA 2KDBA 4BKTA 4ASWC 2KMAA 4GMVA 2AL6A 2G3QB 4ICUA 1YX6B 4NPNA 1E8ZA 2MBQA 4MGIE 2REXA 3ZRCA 2AL3A 4II3B 2KTFA 2JT4B 4JGHB 3H1UA 1IP9A 4ANVA 3QWZB 3DPDA 2GBMA 4HWIB 3OJ4B 1J19A 5DPWA 3CF6E 3EHVA 2L3ZA 3O65B 2N7DA 2JZZA 4BFRA 3R66C 4BBNF 2BKRB 2LD9A 2FCSA 2RR9A 3A1QB 1VD2A 1WX8A 4IWPA 4ZYNA 4OVVA 1XT9B 3ZNGC 4WQOB 1WY8A 3ZKJC 1UD7A 1P9DU 2WX0A 2C9WB 2JVCA 2ZCCA 2MP2A 1EF5A 4LJPB 4MJSA 3MTNB 2B3AA 3U8ZA 3HM6X 3ZNHB 2PEAA 3L16A 1GC6A 2M8SA 4FULA 1TZ1A 2BYFA 1XQQA 4FN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCA A;  2ZCB A;  4NJ7 A;  4BVU C;  2LUE A;  2KQS A;  1V81 A;  2RPQ A;  1I35 A;  2KQ7 A;  3M62 B;  5IA7 A;  4KSK C;  5CHW A;  3ZDM C;  1NI2 A;  1V9J A;  2LI5 A;  3H7P A;  4NJ6 A;  4BKG A;  5G2N A;  2LGX A;  1WIA A;  2KD0 A;  2GMI C;  4HPL B;  1IYF A;  2J0M A;  1WH3 A;  3HK0 A;  4W9D A;  2O2V B;  2ZPN A;  1WMH B;  4IM0 A;  3S2A A;  3UF8 A;  3QAR A;  4ZRK A;  5CX3 A;  1UBI A;  2FIF A;  4GDK B;  2MLB A;  1EUV B;  3L54 A;  3QQ8 B;  1V6E A;  3KUZ A;  4KZ0 A;  2R2O A;  2CKH B;  3KVF B;  3DQV A;  1WXM A;  1PQS A;  2G4S A;  3OAW A;  2CU1 A;  2IZV B;  1WM2 A;  2DX5 B;  4WAA A;  3RT3 B;  2FCQ A;  2ZZP B;  3PRZ A;  5D94 A;  3DVG X;  4BKS D;  2C60 A;  1S3S G;  3IG3 A;  1UGM A;  4F1S A;  1K8R B;  3N32 A;  2KO3 A;  3SD5 A;  3VAW A;  4KV2 A;  3V6E B;  2JRH A;  4DK5 A;  1G6J A;  3ZTD A;  2KFK A;  2K8H A;  5JHB A;  2KWV B;  4GDL A;  3L10 B;  4AJW A;  2OOB B;  3VHT C;  2LAS A;  4W9I A;  3DBS A;  1WGG A;  4HJK A;  1LQB A;  1C1Y B;  2MA9 B;  4PYZ A;  5HKH A;  3DBH I;  3VFK A;  2LVP A;  4IC7 B;  4PS7 A;  4W9H A;  3DVG Y;  1WX7 A;  2MP2 B;  2QHO A;  4EEW A;  5JZE B;  3KW5 B;  5DPS A;  2ZNV C;  2M4N A;  3IHP C;  2KXJ A;  1HE8 A;  4KDL B;  2YVC A;  3T8M A;  3ZDT A;  4CO7 A;  3ZO5 B;  1Z2M A;  2ZVN A;  1GJZ A;  3B1L X;  3B08 A;  3QAQ A;  2KJR A;  2KK8 A;  2MBO A;  2IO0 B;  2NR2 A;  2MW5 A;  2KVR A;  3AUL A;  1KM7 A;  4FJY A;  3A4R A;  1WRD B;  3AXC A;  4WWN A;  1E8W A;  2KKC A;  5C23 A;  3PT2 B;  3VXW A;  1UBQ A;  2BF8 B;  2RGF A;  4GXB A;  2PE6 B;  2PJH A;  2I1J A;  1JRU A;  4JLC A;  3IBE A;  2O6V A;  4IG7 B;  4FBJ B;  1L2N A;  1Q5W B;  3M63 B;  3NOB A;  3Q3J A;  4MDK E;  2A4Z A;  1WGY A;  1Q0W B;  2L0F A;  3DBR I;  4GGQ A;  3JVZ X;  3KUC B;  2FNJ B;  1TTN A;  3B0A A;  3VDZ A;  3A9J B;  2WWZ A;  1UEL A;  4EFO A;  3WIM A;  2K6Q A;  3WAM A;  1TBE A;  3WAL A;  2DYB A;  3PTF C;  5C1Z A;  2L00 B;  4W9F A;  3ONS A;  1ZKH A;  4ANW A;  2VRR B;  3A9K B;  3KUD B;  4IM3 A;  2C7N B;  1Q1O A;  1WM3 A;  1F9J A;  2V4L A;  4TKN A;  3VUX A;  2J7Q B;  1P98 A;  3TL5 A;  2KN5 A;  3L0W B;  2M0X A;  2KC2 A;  4AJY B;  4XZ4 A;  4CHK A;  2LVO A;  1GUA B;  2C5L C;  3ZW3 A;  3QC8 B;  5EDS A;  1P1A A;  3ML9 A;  2I1K A;  2N1W A;  3L08 A;  4I6L B;  4B9K A;  4M0W B;  4WJQ A;  4DXA B;  2ZVO A;  1IPG A;  5E6O A;  4WWP A;  1MG8 A;  3M3J A;  3A4S C;  5CHV C;  2NBU A;  2ZPY A;  1XD3 B;  3QK0 A;  2PE9 A;  3ZNI D;  3HM3 A;  2JZ3 B;  3H6N A;  1R4M I;  4GDL B;  4HDQ A;  1RLF A;  1YJ1 A;  4OVU A;  5CHF A;  2LRW A;  2GOW A;  4E71 A;  1KJT A;  3VQI A;  2LGD A;  4JIO U;  4HLE A;  1WX9 A;  4TUU A;  1E7V A;  3ZLZ A;  4E74 A;  3LDZ E;  1WZ3 A;  3U7D A;  4PS3 A;  4EKU A;  3UQB A;  3ZTC A;  5LXI B;  2EMS A;  2JUO A;  5LLI A;  2RD0 A;  2LGY A;  3K9O B;  4GOC A;  1V5T A;  1P3Q U;  3W1S A;  4EZL A;  4LJO B;  3CST A;  1R4N I;  1ZW7 A;  3H7S A;  3JSV A;  3MJW A;  3PGE A;  3T9L A;  3R7R A;  4W9K A;  3BIN A;  1GC7 A;  4G50 A;  2V1Y A;  4NY0 A;  2Y5B B;  3WAO A;  2BWF A;  1SE9 A;  3U30 A;  1OTR B;  1V2Y A;  1E5W A;  4DBG A;  1VCB A;  2G45 B;  2MQJ A;  2RSU A;  4MGK E;  4WJP A;  1C3T A;  3TBL D;  2J0K A;  2K1F A;  3RYT A;  3MHS D;  2N9X A;  1GNU A;  2LWP A;  1UH6 A;  3DVN U;  4P7I A;  5D7G A;  4NAW A;  1V5O A;  4DHZ B;  2LXC A;  4NQK E;  1OEY A;  2XK5 A;  5KHQ A;  3V60 A;  1WJN A;  4M8M A;  3GZN I;  5DCN A;  3SU8 X;  3PZD A;  3UIN B;  3BY4 B;  2CHW A;  5AZG A;  3R7Q A;  2IO1 B;  4CYE A;  4KDI C;  4BOS C;  2M17 A;  2N9P C;  2FAZ A;  2KZR A;  3R3M A;  4EZJ A;  3AU4 A;  3GOE A;  2DYM A;  1WXV A;  2FCN A;  2OJR A;  2DHZ A;  3EEC A;  4G11 A;  3VVW B;  3QX1 A;  3ZRF A;  2BKF A;  3H9D A;  3PHW B;  2KOX A;  4I6N B;  2GBR A;  3EC8 A;  4HDO A;  4IW0 A;  3RCZ A;  1WXS A;  4AWJ A;  2FUH B;  3TJP A;  2NCN A;  4J6I A;  5E6P A;  2N7E A;  2JPH A;  2AYO B;  3DVN V;  2MWS B;  4F8C B;  5AEK B;  4YL8 A;  4EOY A;  3L17 A;  2ZEQ A;  4DDG D;  1EO6 A;  1NDD A;  3NS8 A;  2DZI A;  4WWO A;  1H8C A;  4ANX A;  1E8Y A;  5J17 A;  3P2B A;  4MEL A;  3QHT A;  3W1S C;  4MJS B;  2JWZ A;  1L7Y A;  2KX3 A;  2KJ6 A;  2KTR A;  2LXA A;  2LZ6 A;  2XBB C;  4GIV A;  4PS8 A;  3V62 A;  4JL9 A;  4TV3 A;  3WAN A;  5DPT A;  3PS6 A;  4K7S A;  2DAJ A;  1Y8R C;  3CSF A;  1YD8 U;  2L0T A;  2ZNV B;  3EFU A;  3PV1 A;  3NY5 A;  2KNB A;  3A1Q A;  3APD A;  4X57 B;  1LFD A;  1V80 A;  3NZS A;  4RM9 A;  4G3X B;  3PPA A;  2MBE A;  3KH0 A;  2AWT A;  4JQW C;  3X0W A;  2K25 A;  5AZH A;  1P0R A;  3K9P B;  1LXD A;  4URK A;  1YQB A;  3PHX B;  3OLM D;  4ANU A;  3DOW A;  3H7P B;  4EZK A;  2R2Q A;  3PRM B;  4K81 A;  2NVU I;  2BWE S;  4FHJ A;  1EF1 A;  4W9C A;  2IBI B;  2XEW A;  4NNJ B;  2CS4 A;  2KLC A;  4I6P A;  2XK5 B;  2CHZ A;  2ASQ A;  3RUL A;  1WI0 A;  2AEH A;  3QCA A;  2JF5 A;  4FJV B;  2LJ5 A;  2BGF A;  3PLV A;  3ZNZ B;  2KDI A;  3N30 A;  4FA6 A;  4XC2 A;  2DZJ A;  1OQY A;  5D6J B;  2DZM A;  2GBK A;  3IVF A;  2DEN B;  4HK2 A;  4ZDV A;  1AAR A;  2BYV E;  1S1Q B;  2KFJ A;  3AU5 A;  1D3Z A;  2O2V A;  2YLM A;  4MGZ E;  1WZ0 A;  1WMH A;  1NBF C;  1OGW A;  2L76 A;  4KIK A;  3PLU A;  3VH4 B;  4B95 A;  2G4D B;  3HHM A;  5E6N A;  4GDK A;  5D2M B;  4W9L A;  2KDF B;  1WE7 A;  2KFK B;  4GB9 A;  4LDT B;  1WJ4 A;  2D07 B;  2BPS A;  2N1V A;  4HVB A;  2JY6 A;  3UGB B;  1WXA A;  5IAA C;  1V49 A;  4DDI D;  1RAX A;  4IWQ A;  3VTV A;  1E8X A;  2V3S A;  5TR5 A;  5JHA A;  3APC A;  2ZJD A;  2JXX A;  3ZVV A;  4MSQ B;  1RRB A;  2LVQ A;  1V86 A;  2KTR B;  4DHZ E;  3PRE A;  4FJZ A;  1SIF A;  2KJH B;  3SHQ A;  1E7U A;  3I3T B;  2IYD B;  2C7M B;  2A5U A;  4DHJ B;  2KMC A;  4IUM B;  2Z0E B;  3TIX A;  3VUY A;  3L13 A;  4WJN A;  1WFY A;  4HPM B;  1M94 A;  1WYW B;  3N3K B;  4LCD E;  3SDL C;  2L8J A;  1WJU A;  1TGZ B;  3UQA A;  5LXH A;  4XX5 A;  2HJ8 A;  4PYU A;  2N9E B;  2MSE D;  3ZUN A;  1J0G A;  3DDC B;  2W9N A;  4IWO A;  2D3G A;  4FAD A;  2O6V B;  1KOT A;  4A20 A;  4KSL C;  2EMT A;  1UZX B;  2IO3 B;  3HIZ A;  1ISN A;  3LJ3 A;  4MH0 E;  3OJ3 A;  1Z5S B;  1WF9 A;  1I42 A;  1YX5 B;  2KDE B;  2DYO A;  2NPT A;  3DBL I;  4A3O A;  2NBV B;  3PVL A;  1E90 A;  1KLV A;  2KAN A;  3QIJ A;  3ZIM A;  3ENE A;  4F7Z A;  3QJZ A;  1RFA A;  3A33 B;  3ALB A;  2KWU B;  4GSW A;  4A3P A;  1WGD A;  4M8N A;  5L95 C;  5JH5 C;  1ZGU B;  3WA0 A;  4BOZ B;  4KZC A;  4MM3 A;  2IO2 B;  2EKE C;  5J2R A;  3NHE B;  3WAP A;  1WJ6 A;  4AUQ C;  3RZF A;  5FR6 A;  1QZE A;  2FID A;  2CHX A;  1BT0 A;  3A9J A;  4BBN C;  3NZU A;  3KYC D;  4KIK B;  3VTU A;  1A5R A;  2L7R A;  2L05 A;  1WR1 A;  2M1M A;  5CTR C;  5G55 A;  4GN1 A;  4MSM B;  1SGH A;  2LRU A;  1LM8 B;  2WX1 A;  5J18 A;  1H4R A;  2JRI B;  2K6D B;  3A9K A;  4BKS A;  4AP4 C;  4GU2 A;  2K8B A;  5AZF A;  4K7W A;  5BO4 B;  2UWQ A;  4HCN B;  3Q3F A;  3RUI B;  1FXT B;  4DWF A;  4G0N B;  1GG3 A;  4WJO A;  4LDT D;  2FCM A;  3IFW B;  1T0Y A;  4EUT A;  2HD5 B;  2KHW B;  1WR6 E;  3UIP B;  2WYQ A;  4HCP B;  2KX0 A;  3ECI A;  3APF A;  3AI5 A;  4MGY E;  2N4F A;  2NS5 A;  3JSV B;  3VUW A;  1WGR A;  2GBN A;  4W9J A;  4NQL B;  2D11 A;  2K8C A;  3CMM B;  1J8C A;  2HTH A;  5DPR A;  3X23 A;  4DHJ D;  2DZK A;  2D10 A;  4FLH A;  2MRP A;  3VH3 B;  1WGH A;  2D2Q A;  2KC1 A;  3JW0 X;  4B6W A;  2IY1 B;  2K39 A;  2Z59 B;  3PSE B;  4HXD A;  4KVG B;  3RD2 A;  2PPH A;  3TMP B;  2NPT B;  5L83 A;  2WDT B;  4NAW B;  2O6V D;  2MX2 A;  3C0R B;  4E3C A;  2J0J A;  2UYZ B;  2KWC A;  3KYD D;  3V61 A;  2Z0D B;  3UIO B;  1WE6 A;  2BYE A;  3DCG A;  2IY0 B;  2DAF A;  3QA8 A;  4N9F 4;  4W9E A;  1U4A A;  3W1Y A;  1OEY J;  2C7H A;  2NBW B;  3JYU A;  4II2 B;  4RM8 A;  5KHO A;  4AOF A;  3V6C B;  3VTW A;  3RZW C;  4ZRI A;  2GBJ A;  3D32 A;  4FHK A;  2HE7 A;  4IM2 A;  2MBB B;  4RMA A;  4K7U A;  1CMX B;  2CR5 A;  4ZRJ A;  4TQ1 A;  2MBH A;  2KLG A;  4K1R B;  4MEM A;  3PRP B;  1X1M A;  3M95 A;  4W9G A;  1YIW A;  4TQ0 A;  5GMV A;  2MCN B;  3ML8 A;  4ICV A;  2KDB A;  4BKT A;  4ASW C;  2KMA A;  4GMV A;  2AL6 A;  2G3Q B;  4ICU A;  1YX6 B;  4NPN A;  1E8Z A;  2MBQ A;  4MGI E;  2REX A;  3ZRC A;  2AL3 A;  4II3 B;  2KTF A;  2JT4 B;  4JGH B;  3H1U A;  1IP9 A;  4ANV A;  3QWZ B;  3DPD A;  2GBM A;  4HWI B;  3OJ4 B;  1J19 A;  5DPW A;  3CF6 E;  3EHV A;  2L3Z A;  3O65 B;  2N7D A;  2JZZ A;  4BFR A;  3R66 C;  4BBN F;  2BKR B;  2LD9 A;  2FCS A;  2RR9 A;  3A1Q B;  1VD2 A;  1WX8 A;  4IWP A;  4ZYN A;  4OVV A;  1XT9 B;  3ZNG C;  4WQO B;  1WY8 A;  3ZKJ C;  1UD7 A;  1P9D U;  2WX0 A;  2C9W B;  2JVC A;  2ZCC A;  2MP2 A;  1EF5 A;  4LJP B;  4MJS A;  3MTN B;  2B3A A;  3U8Z A;  3HM6 X;  3ZNH B;  2PEA A;  3L16 A;  1GC6 A;  2M8S A;  4FUL A;  1TZ1 A;  2BYF A;  1XQQ A;  4FN2 A; 
#chains in the Genus database with same CATH topology
 3Q2A C;  2LUE A;  1V81 A;  1QOG A;  4IOI E;  4C4V B;  1NI2 A;  2LI5 A;  3LXF A;  4BKG A;  5G2N A;  3GE8 C;  4HPL B;  1IYF A;  2ZPN A;  1FRD A;  4LNN A;  3HUI A;  2RPV A;  3QAR A;  1ENF A;  4P6V F;  2FIF A;  4GDK B;  4QAY A;  3QQ8 B;  3KUZ A;  3AEA B;  3KVF B;  1PQS A;  3N1Y C;  2G4S A;  2PIA A;  2CU1 A;  1L4Z B;  3PZ8 A;  2KWD A;  2JWU A;  3E9S A;  1C4C A;  1FNV A;  4LK0 M;  3GS2 A;  3HVZ A;  4KV2 A;  2KQ4 X;  4GDL A;  4AJW A;  3DBS A;  4JPS A;  1C77 A;  4HJK A;  4P1C C;  1C1Y B;  1E10 A;  1KFY B;  3TEW A;  2LVP A;  4W9H A;  3C8Y A;  4EEW A;  1VLB A;  3KW5 B;  1TZO A;  4RGT A;  2M4N A;  2KXJ A;  1HA5 A;  2YVC A;  3Q3N C;  4CO7 A;  1QOB A;  2W3R A;  2WXH A;  4YWG G;  3B1L X;  2IO0 B;  3AE6 B;  2KVR A;  3AUL A;  3EFC A;  4FJY A;  2KKC A;  2NMQ A;  3PT2 B;  1UBQ A;  4GXB A;  3AE7 B;  2XN9 C;  2O6V A;  1Q5W B;  3M63 B;  2E3T A;  1DYQ A;  1YN5 A;  1Q0W B;  2BB5 A;  3TEZ A;  1K52 A;  1I4G A;  4EFO A;  3Q8A A;  3PTF C;  5C1Z A;  1ZKH A;  4ANW A;  2I38 A;  3KUD B;  1DOX A;  2C7N B;  1SJH D;  4TKN A;  3VUX A;  4OW0 A;  2WXG A;  5C3J B;  4CHK A;  3I9V 1;  1GUA B;  3ZXR A;  2LGS A;  1P1A A;  2KAC A;  3L08 A;  2ZVO A;  4WWP A;  1MG8 A;  5CHV C;  2ZPY A;  4J3O D;  3QK0 A;  3H6N A;  1R4M I;  1EWY C;  3P4P B;  2KVZ A;  4FXC A;  1WX9 A;  3LDZ E;  1WZ3 A;  4PS3 A;  2TSS A;  3RPF C;  1T0Q C;  3T3O A;  3JSV A;  3DHI C;  3H7S A;  3PGE A;  4W9K A;  4NY0 A;  3WAO A;  1OFF A;  4YTM B;  3U30 A;  5TSS A;  1VCB A;  1L6U A;  2MQJ A;  1C3T A;  2K1F A;  3MHS D;  3DVN U;  1OQQ A;  2BS2 B;  2MJ3 A;  3W9C B;  4P7I A;  4NAW A;  4DHZ B;  1OEY A;  3V60 A;  1WJN A;  3PZD A;  2H89 B;  3UIN B;  4RGM A;  2IO1 B;  4CYE A;  5MPO A;  2M17 A;  2N9P C;  3CIR B;  2DYM A;  1WXV A;  2FCN A;  2DHZ A;  1YN4 A;  1T0S C;  4OHJ A;  3QX1 A;  2BKF A;  2Y5C A;  2GBR A;  3J9C A;  4IW0 A;  4AWJ A;  2NCN A;  2JPH A;  2AYO B;  2WXP A;  1LO5 D;  1CJE A;  2Q5W D;  3UI3 A;  3IT4 B;  5AEK B;  2ZEQ A;  4MH8 A;  1SE2 A;  2G1E A;  3W5V B;  1L7Y A;  2KJ6 A;  2LXA A;  2LZ6 A;  4PS8 A;  2WNM A;  3AB5 A;  1FXA A;  2FUG 1;  1YD8 U;  3EFU A;  3PV1 A;  2KNB A;  3A1Q A;  1V80 A;  3OWE B;  4RM9 A;  3P1M A;  3PPA A;  2AWT A;  2QMT A;  4IDI A;  4JQW C;  2K25 A;  5AZH A;  1LXD A;  1UNS A;  2PTL A;  3PHX B;  4EE2 A;  4EZK A;  1PGB A;  2BWE S;  3AM9 A;  1VRA B;  2XK5 B;  1WI0 A;  3GE3 C;  2G9H D;  3PLV A;  2N9K A;  4C4V A;  4FA6 A;  1OQY A;  2DEN B;  4A9A A;  1T0R C;  3AU5 A;  3AN1 A;  1PGA A;  1WZ0 A;  1NBF C;  3PLU A;  3VH4 B;  1FCC C;  2G4D B;  4GDK A;  4W9L A;  1WE7 A;  1WJ4 A;  1TIF A;  3DHG C;  2BPS A;  3SEB A;  3Q8C A;  2FE8 A;  2AQ2 B;  1E8X A;  5JHA A;  5TR5 A;  3APC A;  1HEZ E;  2JXX A;  3ZVV A;  2HTM E;  2KTR B;  2WXO A;  3O13 A;  4KGT A;  3SHQ A;  1CZP A;  3I3T B;  4DHJ B;  2Z0E B;  4LCD E;  4HPM B;  3SDL C;  1WJU A;  5LXH A;  4XX5 A;  2N9E B;  2WGS A;  4FAD A;  1EU3 A;  1KOT A;  1TY0 A;  2IO3 B;  2R61 A;  3HIZ A;  1I42 A;  4M02 A;  2DYO A;  2QIL A;  3DBL I;  4A3O A;  1F2R I;  3PVL A;  1KLV A;  2KAJ A;  2KAN A;  1XLP A;  3ENE A;  3KWL A;  1ZPS A;  3QJZ A;  2LGI A;  5L95 C;  1GPX A;  1ZGU B;  2YEP F;  4KZC A;  5J2R A;  3LB8 C;  3SFD B;  5FR6 A;  1A5R A;  1NVI D;  2MH7 A;  4GN1 A;  1ZOY B;  1LM8 B;  2WX1 A;  5HHD G;  1H4R A;  2K6D B;  4BKS A;  2OJW A;  3DBR B;  4HCN B;  5BYR A;  2FCM A;  2INC C;  4R3D A;  4ZRQ A;  3UIP B;  2WXF A;  1FPY A;  3APF A;  2N4F A;  4W9J A;  2WXQ A;  2DNF A;  3BVM A;  5E6J A;  3HRD D;  3CMM B;  3T3N A;  2D3C A;  2D10 A;  3FAH A;  3VH3 B;  3VRB B;  4B6W A;  2K39 A;  2Z59 B;  3PSE B;  1MHX A;  3TMP B;  2NPT B;  3MP9 A;  2MJE A;  4RGO S;  2J0J A;  1FO4 A;  1QOA A;  1E9M A;  3MJ5 A;  2BYE A;  4N9F 4;  3W1Y A;  1UWX A;  2M56 B;  1TS4 A;  2LEK A;  3V6C B;  3RZW C;  1R4N B;  4ZRI A;  3D32 A;  1CMX B;  5AUK A;  2KYW A;  1QF6 A;  2W82 A;  3U7Z A;  3M95 A;  2MCN B;  3AEF B;  1VR9 A;  4ICV A;  4RFB A;  2AL6 A;  2G3Q B;  3NRZ A;  3RNA C;  1E8Z A;  2V4I B;  2WQY B;  4N59 A;  2REX A;  3ZRC A;  2IDY A;  4OZB A;  1RWS A;  1IP9 A;  2M0A A;  3Q69 A;  5DPW A;  4JE3 B;  2N7D A;  2JZZ A;  2K0P A;  4BBN F;  3AE3 B;  2EKI A;  4B0E A;  2WX0 A;  2C9W B;  1EF5 A;  4LJP B;  2B3A A;  2M8S A;  5BYS A;  1AW7 A;  1TZ1 A;  4FN2 A;  2ZCB A;  4NJ7 A;  1FEH A;  5I4D A;  1I35 A;  2D3A A;  3M62 B;  4O1N A;  1ZXI A;  5CHW A;  1V9J A;  1N6Z A;  3RN9 C;  3Q8E A;  4JWS C;  3DWG C;  2LGX A;  2KD0 A;  2GMI C;  3HK0 A;  2L83 A;  3WCQ A;  4IM0 A;  4YSZ B;  1V6E A;  4KZ0 A;  2R2O A;  2CKH B;  3EA6 A;  3DQV A;  2BB6 A;  2DX5 B;  4WAA A;  2FCQ A;  2ZZP B;  1TS5 A;  3DVG X;  4BKS D;  1J7C A;  1F77 A;  4K3C A;  4F1S A;  2KO3 A;  1C4A A;  2RDB C;  2K8H A;  3VR8 B;  1VJK A;  1K51 A;  2W55 A;  2LAS A;  1PYW D;  2BW2 A;  1LQB A;  4PYZ A;  4XGA B;  5FK9 C;  5IO9 A;  4PS7 A;  4IC7 B;  3VRA B;  3DVG Y;  3P4Q B;  4RGN A;  2QHO A;  3T8M A;  1XO3 A;  3ZO5 B;  3QAQ A;  1MHH E;  2KJR A;  4AQ7 A;  4UDU C;  1XCT L;  3NVY A;  1KM7 A;  1E8W A;  1IUE A;  2BF8 B;  3I57 A;  2PJH A;  1JRU A;  2EEL A;  4WAF A;  4US9 A;  2L0F A;  3JVZ X;  2FNJ B;  3A9J B;  2WWZ A;  1I7H A;  1UEL A;  3GP7 A;  1TBE A;  4WUR A;  3URY A;  3ONS A;  1I4P A;  2VRR B;  1Q1O A;  4KX6 B;  4XZ4 A;  1D6E C;  1GAQ B;  4I6L B;  3BZD B;  4DXA B;  5E6O A;  2UU7 A;  3A4S C;  2JXT A;  3ZNI D;  2NTT A;  2JZ3 B;  4HDQ A;  3I63 C;  5LNK 1;  1YMH E;  1KJT A;  3VQI A;  4JIO U;  4TUU A;  3U7D A;  1C4P A;  4OZC A;  5LLI A;  2LGY A;  2WS3 B;  1MPE A;  3CST A;  3MJW A;  2Z8L A;  3T9L A;  1A70 A;  1FM0 D;  3FC4 A;  4G50 A;  2V1Y A;  1JML A;  1SE9 A;  4WIP A;  1FFU A;  1E5W A;  5H92 C;  4MGK E;  2J0K A;  1D5Z C;  5G5G A;  1UH6 A;  5D7G A;  1J7B A;  3NG0 A;  5DCN A;  1JWA D;  3AEG B;  3BY4 B;  1WXQ A;  1EWC A;  2XNA C;  3AU4 A;  4ZOH C;  3EEC A;  3R2I A;  3VVW B;  1QKZ A;  2KOX A;  3RNG C;  4YSX B;  5BMI A;  3IAS 1;  3TJP A;  4J6I A;  5E6P A;  2RDG A;  1MI0 A;  2N9L A;  2QCZ A;  2ZW0 A;  1DOY A;  4DDG D;  1XLQ A;  1NDD A;  2VZK B;  5J17 A;  4MEL A;  4N6E B;  3QHT A;  4MJS B;  2KX3 A;  4WQO B;  4GIV A;  1AYF A;  4TV3 A;  3WAN A;  5DPT A;  3PS6 A;  1Y8R C;  4X57 B;  3KH0 A;  4ARC A;  1FMA D;  3IT6 B;  4ANU A;  3ZJU A;  5HFY A;  1BUI C;  1TT5 B;  3PRM B;  4K81 A;  4IKG A;  2XEW A;  4NNJ B;  2CS4 A;  2BVC A;  2HJ1 A;  3RUL A;  2ASQ A;  4N58 A;  3QCA A;  4FJV B;  4C7Y A;  4REZ A;  2IGH A;  2DZJ A;  5D6J B;  2DZM A;  2GBK A;  1CQV A;  4HK2 A;  1AAR A;  2OED A;  2OHF A;  1KLG D;  1SE3 A;  3P63 A;  2BT6 A;  2YLM A;  4MGZ E;  4H2A A;  1OGW A;  3AED B;  4KIK A;  5E6N A;  5HG2 A;  1SE4 A;  3NJT A;  1MFW A;  5C2T B;  2KDF B;  4LDT B;  4HVB A;  1WXA A;  2LHE A;  2WXN A;  4L23 A;  1L4D B;  2ZJD A;  3AEB B;  5EE0 A;  3PRE A;  2KJH B;  1E7U A;  2C7M B;  3MC9 A;  2KMC A;  4IUM B;  1XLO A;  3TIX A;  3VUY A;  3N3K B;  2L8J A;  4LNI A;  2LUM A;  4IWO A;  3FIL B;  4RF0 A;  1UZX B;  3LJ3 A;  1T3Q A;  3OJ3 A;  1Z5S B;  1WF9 A;  3FKY A;  1YX5 B;  1ZP0 B;  5IN7 A;  1KH0 A;  2WU2 B;  1D5M C;  5EE9 A;  1RFA A;  3ALB A;  2KWU B;  4A3P A;  1UGJ A;  1LGR A;  5JH5 C;  2IO2 B;  2EKE C;  1TS3 A;  3Q3M C;  4KKI A;  4AUQ C;  3RZF A;  3ZYY X;  3DWM A;  1QZE A;  1OQR A;  2FID A;  3A9J A;  3NZU A;  3VTU A;  1V97 A;  2BQQ A;  2LRU A;  5J18 A;  4LNF A;  1Q10 A;  2JRI B;  5BO4 B;  3Q3F A;  4ZYS A;  4WH4 A;  3TSS A;  3IFW B;  4WWM A;  1NYR A;  2KHW B;  3AE8 B;  3ECI A;  4ARI A;  2NS5 A;  1WGR A;  4OZA A;  2V3N A;  4NQL B;  2K8C A;  5DPR A;  1WGH A;  1ET6 A;  3NS1 A;  3RD2 A;  4KVG B;  2PVG C;  2PPH A;  3U52 E;  2O6V D;  4A6Q A;  2MX2 A;  3C0R B;  2UYZ B;  2Z0D B;  1PUT A;  3UIO B;  4RH6 A;  4W9E A;  2DAF A;  2C7H A;  3JYU A;  1UF0 A;  1R7S A;  4RF1 A;  3VTW A;  1ROE A;  1ZE3 D;  2HDE A;  1JAL A;  3AE4 B;  4NZL B;  2KLG A;  1NI3 A;  4MEM A;  3W5U B;  4TQ0 A;  4XYC A;  1ESF A;  4OVZ A;  4BKT A;  2BS4 B;  4GMV A;  1YX6 B;  4NPN A;  1JWU D;  2MBQ A;  4MGI E;  2AL3 A;  3GZN B;  1F0Z A;  2KTF A;  2JT4 B;  4JGH B;  3QWZ B;  4HWI B;  3OJ4 B;  1J19 A;  2QDF A;  2GI9 A;  3AE9 B;  1QT9 A;  1JQ4 A;  1YQ4 B;  4BFR A;  3R66 C;  2ICI A;  2BKR B;  1FCL A;  1D5X C;  3ZJV A;  4IWP A;  2LHD A;  1XT9 B;  3Q8B A;  2QEJ C;  2ZCC A;  2K3U A;  2PVO D;  1PFD A;  4MJS A;  3MTN B;  3HM6 X;  2PEA A;  1MJD A;  4M01 A;  2NTS A;  1SEB D;  1VZ8 A;  5GXG B;  1XQQ A;  3DBH B;  3NVW A;  2KQS A;  2KQ7 A;  4YTP B;  4XDD A;  4KSK C;  3ZDM C;  2K22 A;  2AQ1 B;  2J0M A;  1WH3 A;  4WQM A;  2O2V B;  3S2A A;  3UF8 A;  4JX1 C;  4LLG M;  2AX5 A;  4ZRK A;  3U4E G;  1VZ7 A;  2MLB A;  1EUV B;  1FRR A;  2X38 A;  4MAC A;  1FNW A;  4K3B A;  4ACF A;  2QC8 A;  1JWS D;  1ZDV A;  1MG4 A;  5D94 A;  1N5W A;  2WLB A;  1TKG A;  1WGK A;  3NVV A;  3BVZ A;  3B9J A;  1K8R B;  2J4X A;  1YNT E;  1C78 A;  1SIJ A;  1G6J A;  5JHB A;  2KWV B;  3LYY A;  1IGC A;  1SBB B;  4W9I A;  1IBX B;  2MA9 B;  5HKH A;  3DBH I;  2IGG A;  1WX7 A;  2MP2 B;  5JZE B;  3IHP C;  1HE8 A;  4KDL B;  1BML C;  3BWU D;  2ZVN A;  1GJZ A;  3B08 A;  4DXG A;  2MBO A;  4P1B C;  5D3I B;  3A4R A;  1WRD B;  5C23 A;  1I4Q A;  3VXW A;  2IND C;  1ACC A;  3FIL A;  3IBE A;  4IG7 B;  4FBJ B;  2K9X A;  4XWT A;  4MDK E;  3NOB A;  3U2S C;  1SJE D;  3DBR I;  1WGY A;  4GGQ A;  2B76 B;  3WAM A;  3RI7 C;  2DYB A;  1L0Y B;  1N62 A;  2LJI A;  1QOF A;  3A9K B;  4M00 A;  4IM3 A;  1F9J A;  2V4L A;  3TL5 A;  3L0W B;  2M0X A;  2KC2 A;  4AJY B;  2LVO A;  1VZ6 A;  2C5L C;  2V3P A;  3QC8 B;  5EDS A;  4WJQ A;  2N7J A;  1IPG A;  2K5P A;  1XD3 B;  4HKQ A;  4NAM A;  3HM3 A;  2VH2 A;  4GDL B;  1RLF A;  5CHF A;  2LRW A;  2SAK A;  4E71 A;  1WYG A;  2VH1 A;  1E7V A;  3ZLZ A;  4EKU A;  2JUO A;  3ZGZ A;  2RD0 A;  2WXJ A;  3K9O B;  3MHZ A;  4GOC A;  1V5T A;  1P3Q U;  1R4N I;  1GC7 A;  3ZQ4 A;  2Y5B B;  2GRI A;  1V1O A;  2GLS A;  3KWV A;  1OTR B;  1V2Y A;  4DBG A;  4WJP A;  2G45 B;  3C19 A;  2RSU A;  2L52 A;  3RYT A;  2N9X A;  1GNU A;  1V5O A;  4NQK E;  2XK5 A;  5KHQ A;  4M8M A;  3RNE C;  1HZ6 A;  5AZG A;  1SF0 A;  4KDI C;  4BOS C;  2KZR A;  3R3M A;  4EZJ A;  1AN8 A;  4YT0 B;  3PHW B;  1ZDX A;  4HDO A;  3RCZ A;  2BTE A;  2JZP A;  1XEE A;  4HRO A;  2DBY A;  2QIE B;  1EO6 A;  3NS8 A;  1E8Y A;  2V0G A;  2XBB C;  3V62 A;  3ZW3 A;  2KTR A;  4JL9 A;  1P7E A;  4K7S A;  2DAJ A;  4Q2J A;  3CSF A;  1FFV A;  2L0T A;  2ZNV B;  3NY5 A;  1LFD A;  5AUI A;  2MBE A;  3X0W A;  3AH7 A;  2MJD A;  3K9P B;  4URK A;  3OLM D;  4LNO A;  3DOW A;  3H7P B;  2CU3 A;  1P7F A;  2NVU I;  3NVZ A;  4FHJ A;  3L4P A;  4W9C A;  1J7A A;  4MT5 A;  2PMV A;  2ON8 A;  1HTO A;  2PW9 A;  3ZNZ B;  2JU6 X;  2KDI A;  3N30 A;  3IVF A;  2D3B A;  2CJN A;  1JRO A;  1M4V A;  1S1Q B;  2O2V A;  1N61 A;  2L76 A;  2ONQ A;  3E56 A;  3HHM A;  1TS2 A;  2KFK B;  1I4R A;  2JQR B;  2JY6 A;  3UGB B;  2J42 A;  1ZUD 2;  1ZXH A;  2V3S A;  4P16 A;  2WDV B;  2IYD B;  2A5U A;  2INN E;  3P4R B;  3RNB C;  3L13 A;  4WJN A;  1WYW B;  2KMM A;  2MSE D;  3ZUN A;  5EE3 A;  3DDC B;  2W9N A;  4A20 A;  1ISN A;  2N0S B;  2KDE B;  2NPT A;  5FR3 A;  3MC8 A;  1E90 A;  4F7Z A;  1TKY A;  1WGD A;  2PLP A;  3WA0 A;  4BOZ B;  3TUO A;  3NHE B;  1FIQ A;  1WJ6 A;  4US8 A;  2CHX A;  1BT0 A;  2X8X X;  5G5H A;  2QSD A;  1TJE A;  2FBW B;  4BZA A;  2L7R A;  3AE2 B;  3I5J C;  5CTR C;  2M1M A;  4MSM B;  4DQO C;  3A9K A;  4GU2 A;  5JXV A;  2K8B A;  5AZF A;  4K7W A;  5T8I A;  2UWQ A;  1PGX A;  4PT5 A;  4DWF A;  4G0N B;  2JYT A;  1C76 A;  1NYQ A;  1SSN A;  1T0Y A;  3MC0 B;  4EUT A;  3N9Y C;  1JW9 D;  4XE0 A;  3AI5 A;  4MGY E;  5IOI A;  1YN3 A;  3VUW A;  1J8C A;  2YEP B;  3X23 A;  4DHJ D;  5BYQ A;  3AMZ A;  4FLH A;  1XCQ L;  2D2Q A;  1R4M B;  4HXD A;  5L83 A;  2WDT B;  4C80 A;  3Q3O C;  5BMH A;  3KYD D;  3V61 A;  1WE6 A;  3DCG A;  2IY0 B;  3QA8 A;  2WXR A;  1OEY J;  4RM8 A;  2NBW B;  4II2 B;  4AOF A;  3B2F A;  2GBJ A;  4FHK A;  2HE7 A;  4TMA B;  4IM2 A;  4RMA A;  2CR5 A;  3N20 C;  1SXT A;  2IGD A;  3BK2 A;  1D4B A;  3PRP B;  1YIW A;  2IPK D;  5GMV A;  3BK1 A;  1WRI A;  3SFE B;  1SB3 C;  4ASW C;  4ICU A;  2MEK A;  4II3 B;  3BII D;  4HRS A;  4JWU C;  3H1U A;  3DPD A;  4HKZ E;  4KGR A;  1E6E B;  3EHV A;  1F1H A;  3V3X A;  3O65 B;  4L1B A;  2LD9 A;  2FCS A;  3ZXV A;  1TKE A;  1K53 A;  3Q8F A;  4OVV A;  4A55 A;  1I4X A;  3ZKJ C;  1UD7 A;  1P9D U;  2BS3 B;  2JVC A;  5D3D A;  2WXM A;  1UWM A;  3SR6 A;  3ZNH B;  1BXT A;  3P4S B;  3V05 A;  2LFI A;  3TEY A;  1C79 A;  1AWD A;  1E7P B;  1JCK B;  2BYF A;  3R2T A;  1RM6 C;  3R8B A;  2JX5 A;  3TCA A;  4BVU C;  2INP E;  2RPQ A;  2JYE A;  1Y56 A;  1KF6 B;  5IA7 A;  3H7P A;  4NJ6 A;  1WIA A;  3CWI A;  4W9D A;  1WMH B;  5CX3 A;  1E0Z A;  1UBI A;  2Y5P A;  3L54 A;  4USA A;  1WXM A;  3OAW A;  2W3S A;  2IZV B;  1B9R A;  1WM2 A;  2MHJ A;  4XWW A;  3P42 A;  3RT3 B;  3PRZ A;  2C60 A;  1S3S G;  2L32 A;  3IG3 A;  1UGM A;  1JWB D;  3N32 A;  3SD5 A;  3VAW A;  3V6E B;  2JRH A;  4DK5 A;  3ZTD A;  2KFK A;  3L10 B;  2OOB B;  3VHT C;  1WGG A;  3VFK A;  2ACZ B;  1L5P A;  2E6X A;  5IP4 D;  1GB1 A;  5DPS A;  2ZNV C;  5H8Y E;  4YSY B;  3ZDT A;  3GB1 A;  1Z2M A;  4LTU A;  2WHI A;  2KK8 A;  2NR2 A;  2MW5 A;  1MVK A;  3AXC A;  4WWN A;  2RGF A;  1STE A;  2DWQ A;  2PE6 B;  2I1J A;  4MM3 B;  4JLC A;  1L0V B;  1L2N A;  3Q3J A;  1YOV B;  2A4Z A;  4AS1 A;  3KUC B;  1TTN A;  3B0A A;  3VDZ A;  2I2Y A;  3VR9 B;  3NUH B;  2K6Q A;  3WIM A;  3WAL A;  1DOI A;  1YJJ A;  2L00 B;  4W9F A;  4A8X C;  1WM3 A;  4ZHP A;  2J7Q B;  1P98 A;  2KN5 A;  1JRP A;  3DBL B;  3N1X C;  3RNC C;  3IXS A;  3ML9 A;  2I1K A;  1EM7 A;  2N1W A;  4B9K A;  4M0W B;  1F52 A;  1KTK A;  3EUB 2;  3M3J A;  2NBU A;  1WSP A;  2PE9 A;  1YJ1 A;  4OVU A;  4TSS A;  2GOW A;  1B1Z A;  2LGD A;  4HLE A;  2WP9 B;  4E74 A;  3UQB A;  3ZTC A;  1L0X B;  5LXI B;  2EMS A;  1HZ5 A;  1XXG A;  3W1S A;  4EZL A;  4LJO B;  1ZW7 A;  1IGD A;  4HJG E;  3R7R A;  3BIN A;  4S0R A;  1FNU A;  2BWF A;  2KT7 A;  4ZRP A;  2RMM A;  1XLN A;  5HI1 A;  3TBL D;  2GB1 A;  2LWP A;  3KLS X;  1WWT A;  2LXC A;  1PDX A;  3GZN I;  3SU8 X;  1FXI A;  2CHW A;  3R7Q A;  4KGS A;  2FAZ A;  3GOE A;  4D2K A;  3BYT B;  2OJR A;  3BYY B;  4G11 A;  4YXD B;  3AE5 B;  3ZRF A;  2WXI A;  3H9D A;  1VDV A;  4I6N B;  3EC8 A;  1WXS A;  4XDC A;  1GOZ A;  2FUH B;  1YQ3 B;  2N7E A;  3DVN V;  2MWS B;  3IAM 1;  4NJC A;  4S17 A;  4F8C B;  2WXK A;  4YL8 A;  4EOY A;  3L17 A;  4KKJ A;  1H8C A;  2DZI A;  4WWO A;  3PO0 A;  4ANX A;  3P2B A;  3W1S C;  2JWZ A;  3B2G A;  4CQN A;  3AE1 B;  3NZ3 A;  1V1P B;  1C9F A;  2D5G A;  4DXF A;  3APD A;  2BYT A;  4G3X B;  1DGJ A;  4L2Y A;  1P0R A;  4C7Z A;  1YQB A;  3N1Z C;  2R2Q A;  1EF1 A;  2IBI B;  1HQR D;  2KLC A;  4B0M A;  4I6P A;  2CHZ A;  2AEH A;  1TY2 A;  2JF5 A;  2LJ5 A;  1HXY D;  2BGF A;  3ETR A;  3AEC B;  4XC2 A;  4HPP A;  4ZDV A;  2BYV E;  3RFZ B;  3PZ7 A;  2KFJ A;  1D3Z A;  1WMH A;  1GB4 A;  4B95 A;  1NEN B;  2AQ3 B;  5D2M B;  4C00 A;  4GB9 A;  3TEX A;  1KLU D;  2D07 B;  2N1V A;  2PKO A;  5IAA C;  1V49 A;  4DDI D;  1RAX A;  4IWQ A;  3VTV A;  1QLB B;  1RRB A;  4MSQ B;  2LVQ A;  1K50 A;  2WDQ B;  2H88 B;  1V86 A;  4DHZ E;  4FJZ A;  2KDM A;  1SIF A;  3ZJT A;  2VZK D;  4C56 C;  1WFY A;  1M94 A;  2WXL A;  3UQA A;  1TGZ B;  2HJ8 A;  4PYU A;  1J0G A;  2V9H A;  5BMG A;  3BVG A;  2D3G A;  4LNK A;  2O6V B;  4KSL C;  2EMT A;  3Q6B A;  4MH0 E;  5IKC M;  4ZHO A;  4BAX A;  3W2D A;  2NBV B;  1NEK B;  3RNF C;  3HVD A;  3H8H A;  4PK1 A;  3QIJ A;  2BBC A;  3ZIM A;  3A33 B;  4GSW A;  4M8N A;  2J53 A;  2WDR B;  4MM3 A;  1YJI A;  3KQ4 A;  3OG5 A;  3WAP A;  4BBN C;  1ET9 A;  3KYC D;  4KIK B;  1KRH A;  2L05 A;  1WR1 A;  5G55 A;  1SGH A;  5EE1 A;  4AP4 C;  1TYG B;  5FKA C;  3RUI B;  1FXT B;  2RDH A;  2SEB D;  1GG3 A;  4WJO A;  4LDT D;  1HTQ A;  2HD5 B;  4M0W A;  3AEE B;  1V8C A;  1WR6 E;  2WYQ A;  4HCP B;  2KX0 A;  1N5X A;  2Y3A A;  3JSV B;  2WU5 B;  2GBN A;  1XF5 L;  3DHH C;  2QJL A;  2D11 A;  2DLB A;  2HTH A;  4HEA 1;  2DZK A;  3EGR A;  2MRP A;  2KC1 A;  2KN4 A;  3JW0 X;  2IY1 B;  1EU4 A;  2CJO A;  2LMC A;  1QQR A;  3AV8 A;  4NAW B;  2M19 A;  4E3C A;  3Q14 C;  2KWC A;  4YTN B;  1U4A A;  5KHO A;  1JWM D;  1RFK A;  2MBB B;  4GLS C;  1UUP A;  4K7U A;  4ZRJ A;  4TQ1 A;  2MBH A;  4K1R B;  1I4H A;  1X1M A;  4W9G A;  1F2R C;  3ML8 A;  2KDB A;  4ITK A;  1RYJ A;  2KMA A;  1L6V A;  3RMK C;  1T5X D;  4ANV A;  2GBM A;  2IJ0 A;  2ZW1 A;  1T6B X;  3CF6 E;  2L3Z A;  2JSV X;  1N60 A;  2L1A A;  2J52 A;  2RR9 A;  3A1Q B;  1VD2 A;  1WX8 A;  4ZYN A;  3ZNG C;  1WY8 A;  4RCO A;  1IBX A;  1N63 A;  4RNA A;  2MP2 A;  1FD6 A;  3ABV B;  3U8Z A;  1QIL A;  1CK1 A;  3L16 A;  1GC6 A;  4FUL A;  1V1P A;  4A90 A;  3NZS A;  2W54 A;  3MFG A; 
#chains in the Genus database with same CATH homology
 3TCA A;  2ZCB A;  4NJ7 A;  4BVU C;  2LUE A;  2KQS A;  1V81 A;  2RPQ A;  1I35 A;  2KQ7 A;  3M62 B;  5IA7 A;  4KSK C;  5CHW A;  3ZDM C;  1NI2 A;  1V9J A;  2LI5 A;  3H7P A;  4NJ6 A;  4BKG A;  5G2N A;  2LGX A;  1WIA A;  2KD0 A;  2GMI C;  4HPL B;  1IYF A;  2J0M A;  1WH3 A;  3HK0 A;  4W9D A;  2O2V B;  2ZPN A;  1WMH B;  4IM0 A;  3S2A A;  3UF8 A;  3QAR A;  4ZRK A;  5CX3 A;  1UBI A;  2FIF A;  4GDK B;  2MLB A;  1EUV B;  3L54 A;  3QQ8 B;  1V6E A;  3KUZ A;  4KZ0 A;  2R2O A;  2CKH B;  3KVF B;  3DQV A;  1WXM A;  1PQS A;  2G4S A;  3OAW A;  2CU1 A;  2IZV B;  1WM2 A;  2DX5 B;  4WAA A;  3RT3 B;  2FCQ A;  2ZZP B;  3PRZ A;  5D94 A;  3DVG X;  4BKS D;  2C60 A;  1S3S G;  3IG3 A;  1UGM A;  4F1S A;  1K8R B;  3N32 A;  2KO3 A;  3SD5 A;  3VAW A;  4KV2 A;  3V6E B;  2JRH A;  4DK5 A;  1G6J A;  3ZTD A;  2KFK A;  2K8H A;  5JHB A;  2KWV B;  4GDL A;  3L10 B;  4AJW A;  2OOB B;  3VHT C;  2LAS A;  4W9I A;  3DBS A;  1WGG A;  4HJK A;  1LQB A;  1C1Y B;  2MA9 B;  4PYZ A;  5HKH A;  3DBH I;  3VFK A;  2LVP A;  4IC7 B;  4PS7 A;  4W9H A;  3DVG Y;  1WX7 A;  2MP2 B;  2QHO A;  4EEW A;  5JZE B;  3KW5 B;  5DPS A;  2ZNV C;  2M4N A;  3IHP C;  2KXJ A;  1HE8 A;  4KDL B;  2YVC A;  3T8M A;  3ZDT A;  4CO7 A;  3ZO5 B;  1Z2M A;  2ZVN A;  1GJZ A;  3B1L X;  3B08 A;  3QAQ A;  2KJR A;  2KK8 A;  2MBO A;  2IO0 B;  2NR2 A;  2MW5 A;  2KVR A;  3AUL A;  1KM7 A;  4FJY A;  3A4R A;  1WRD B;  3AXC A;  4WWN A;  1E8W A;  2KKC A;  5C23 A;  3PT2 B;  3VXW A;  1UBQ A;  2BF8 B;  2RGF A;  4GXB A;  2PE6 B;  2PJH A;  2I1J A;  1JRU A;  4JLC A;  3IBE A;  2O6V A;  4IG7 B;  4FBJ B;  1L2N A;  1Q5W B;  3M63 B;  3NOB A;  3Q3J A;  4MDK E;  2A4Z A;  1WGY A;  1Q0W B;  2L0F A;  3DBR I;  4GGQ A;  3JVZ X;  3KUC B;  2FNJ B;  1TTN A;  3B0A A;  3VDZ A;  3A9J B;  2WWZ A;  1UEL A;  4EFO A;  3WIM A;  2K6Q A;  3WAM A;  1TBE A;  3WAL A;  2DYB A;  3PTF C;  5C1Z A;  2L00 B;  4W9F A;  3ONS A;  1ZKH A;  4ANW A;  2VRR B;  3A9K B;  3KUD B;  4IM3 A;  2C7N B;  1Q1O A;  1WM3 A;  1F9J A;  2V4L A;  4TKN A;  3VUX A;  2J7Q B;  1P98 A;  3TL5 A;  2KN5 A;  3L0W B;  2M0X A;  2KC2 A;  4AJY B;  4XZ4 A;  4CHK A;  2LVO A;  1GUA B;  2C5L C;  3ZW3 A;  3QC8 B;  5EDS A;  1P1A A;  3ML9 A;  2I1K A;  2N1W A;  3L08 A;  4I6L B;  4B9K A;  4M0W B;  4WJQ A;  4DXA B;  2ZVO A;  1IPG A;  5E6O A;  4WWP A;  1MG8 A;  3M3J A;  3A4S C;  5CHV C;  2NBU A;  2ZPY A;  1XD3 B;  3QK0 A;  2PE9 A;  3ZNI D;  3HM3 A;  2JZ3 B;  3H6N A;  1R4M I;  4GDL B;  4HDQ A;  1RLF A;  1YJ1 A;  4OVU A;  5CHF A;  2LRW A;  2GOW A;  4E71 A;  1KJT A;  3VQI A;  2LGD A;  4JIO U;  4HLE A;  1WX9 A;  4TUU A;  1E7V A;  3ZLZ A;  4E74 A;  3LDZ E;  1WZ3 A;  3U7D A;  4PS3 A;  4EKU A;  3UQB A;  3ZTC A;  5LXI B;  2EMS A;  2JUO A;  5LLI A;  2RD0 A;  2LGY A;  3K9O B;  4GOC A;  1V5T A;  1P3Q U;  3W1S A;  4EZL A;  4LJO B;  3CST A;  1R4N I;  1ZW7 A;  3H7S A;  3JSV A;  3MJW A;  3PGE A;  3T9L A;  3R7R A;  4W9K A;  3BIN A;  1GC7 A;  4G50 A;  2V1Y A;  4NY0 A;  2Y5B B;  3WAO A;  2BWF A;  1SE9 A;  3U30 A;  1OTR B;  1V2Y A;  1E5W A;  4DBG A;  1VCB A;  2G45 B;  2MQJ A;  2RSU A;  4MGK E;  4WJP A;  1C3T A;  3TBL D;  2J0K A;  2K1F A;  3RYT A;  3MHS D;  2N9X A;  1GNU A;  2LWP A;  1UH6 A;  3DVN U;  4P7I A;  5D7G A;  4NAW A;  1V5O A;  4DHZ B;  2LXC A;  4NQK E;  1OEY A;  2XK5 A;  5KHQ A;  3V60 A;  1WJN A;  4M8M A;  3GZN I;  5DCN A;  3SU8 X;  3PZD A;  3UIN B;  3BY4 B;  2CHW A;  5AZG A;  3R7Q A;  2IO1 B;  4CYE A;  4KDI C;  4BOS C;  2M17 A;  2N9P C;  2FAZ A;  2KZR A;  3R3M A;  4EZJ A;  3AU4 A;  3GOE A;  2DYM A;  1WXV A;  2FCN A;  2OJR A;  2DHZ A;  3EEC A;  4G11 A;  3VVW B;  3QX1 A;  3ZRF A;  2BKF A;  3H9D A;  3PHW B;  2KOX A;  4I6N B;  2GBR A;  3EC8 A;  4HDO A;  4IW0 A;  3RCZ A;  1WXS A;  4AWJ A;  2FUH B;  3TJP A;  2NCN A;  4J6I A;  5E6P A;  2N7E A;  2JPH A;  2AYO B;  3DVN V;  2MWS B;  4F8C B;  5AEK B;  4YL8 A;  4EOY A;  3L17 A;  2ZEQ A;  4DDG D;  1EO6 A;  1NDD A;  3NS8 A;  2DZI A;  4WWO A;  1H8C A;  4ANX A;  1E8Y A;  5J17 A;  3P2B A;  4MEL A;  3QHT A;  3W1S C;  4MJS B;  2JWZ A;  1L7Y A;  2KX3 A;  2KJ6 A;  2KTR A;  2LXA A;  2LZ6 A;  2XBB C;  4GIV A;  4PS8 A;  3V62 A;  4JL9 A;  4TV3 A;  3WAN A;  5DPT A;  3PS6 A;  4K7S A;  2DAJ A;  1Y8R C;  3CSF A;  1YD8 U;  2L0T A;  2ZNV B;  3EFU A;  3PV1 A;  3NY5 A;  2KNB A;  3A1Q A;  3APD A;  4X57 B;  1LFD A;  1V80 A;  3NZS A;  4RM9 A;  4G3X B;  3PPA A;  2MBE A;  3KH0 A;  2AWT A;  4JQW C;  3X0W A;  2K25 A;  5AZH A;  1P0R A;  3K9P B;  1LXD A;  4URK A;  1YQB A;  3PHX B;  3OLM D;  4ANU A;  3DOW A;  3H7P B;  4EZK A;  2R2Q A;  3PRM B;  4K81 A;  2NVU I;  2BWE S;  4FHJ A;  1EF1 A;  4W9C A;  2IBI B;  2XEW A;  4NNJ B;  2CS4 A;  2KLC A;  4I6P A;  2XK5 B;  2CHZ A;  2ASQ A;  3RUL A;  1WI0 A;  2AEH A;  3QCA A;  2JF5 A;  4FJV B;  2LJ5 A;  2BGF A;  3PLV A;  3ZNZ B;  2KDI A;  3N30 A;  4FA6 A;  4XC2 A;  2DZJ A;  1OQY A;  5D6J B;  2DZM A;  2GBK A;  3IVF A;  2DEN B;  4HK2 A;  4ZDV A;  1AAR A;  2BYV E;  1S1Q B;  2KFJ A;  3AU5 A;  1D3Z A;  2O2V A;  2YLM A;  4MGZ E;  1WZ0 A;  1WMH A;  1NBF C;  1OGW A;  2L76 A;  4KIK A;  3PLU A;  3VH4 B;  4B95 A;  2G4D B;  3HHM A;  5E6N A;  4GDK A;  5D2M B;  4W9L A;  2KDF B;  1WE7 A;  2KFK B;  4GB9 A;  4LDT B;  1WJ4 A;  2D07 B;  2BPS A;  2N1V A;  4HVB A;  2JY6 A;  3UGB B;  1WXA A;  5IAA C;  1V49 A;  4DDI D;  1RAX A;  4IWQ A;  3VTV A;  1E8X A;  2V3S A;  5TR5 A;  5JHA A;  3APC A;  2ZJD A;  2JXX A;  3ZVV A;  4MSQ B;  1RRB A;  2LVQ A;  1V86 A;  2KTR B;  4DHZ E;  3PRE A;  4FJZ A;  1SIF A;  2KJH B;  3SHQ A;  1E7U A;  3I3T B;  2IYD B;  2C7M B;  2A5U A;  4DHJ B;  2KMC A;  4IUM B;  2Z0E B;  3TIX A;  3VUY A;  3L13 A;  4WJN A;  1WFY A;  4HPM B;  1M94 A;  1WYW B;  3N3K B;  4LCD E;  3SDL C;  2L8J A;  1WJU A;  1TGZ B;  3UQA A;  5LXH A;  4XX5 A;  2HJ8 A;  4PYU A;  2N9E B;  2MSE D;  3ZUN A;  1J0G A;  3DDC B;  2W9N A;  4IWO A;  2D3G A;  4FAD A;  2O6V B;  1KOT A;  4A20 A;  4KSL C;  2EMT A;  1UZX B;  2IO3 B;  3HIZ A;  1ISN A;  3LJ3 A;  4MH0 E;  3OJ3 A;  1Z5S B;  1WF9 A;  1I42 A;  1YX5 B;  2KDE B;  2DYO A;  2NPT A;  3DBL I;  4A3O A;  2NBV B;  3PVL A;  1E90 A;  1KLV A;  2KAN A;  3QIJ A;  3ZIM A;  3ENE A;  4F7Z A;  3QJZ A;  1RFA A;  3A33 B;  3ALB A;  2KWU B;  4GSW A;  4A3P A;  1WGD A;  4M8N A;  5L95 C;  5JH5 C;  1ZGU B;  3WA0 A;  4BOZ B;  4KZC A;  4MM3 A;  2IO2 B;  2EKE C;  5J2R A;  3NHE B;  3WAP A;  1WJ6 A;  4AUQ C;  3RZF A;  5FR6 A;  1QZE A;  2FID A;  2CHX A;  1BT0 A;  3A9J A;  4BBN C;  3NZU A;  3KYC D;  4KIK B;  3VTU A;  1A5R A;  2L7R A;  2L05 A;  1WR1 A;  2M1M A;  5CTR C;  5G55 A;  4GN1 A;  4MSM B;  1SGH A;  2LRU A;  1LM8 B;  2WX1 A;  5J18 A;  1H4R A;  2JRI B;  2K6D B;  3A9K A;  4BKS A;  4AP4 C;  4GU2 A;  2K8B A;  5AZF A;  4K7W A;  5BO4 B;  2UWQ A;  4HCN B;  3Q3F A;  3RUI B;  1FXT B;  4DWF A;  4G0N B;  1GG3 A;  4WJO A;  4LDT D;  2FCM A;  3IFW B;  1T0Y A;  4EUT A;  2HD5 B;  2KHW B;  1WR6 E;  3UIP B;  2WYQ A;  4HCP B;  2KX0 A;  3ECI A;  3APF A;  3AI5 A;  4MGY E;  2N4F A;  2NS5 A;  3JSV B;  3VUW A;  1WGR A;  2GBN A;  4W9J A;  4NQL B;  2D11 A;  2K8C A;  3CMM B;  1J8C A;  2HTH A;  5DPR A;  3X23 A;  4DHJ D;  2DZK A;  2D10 A;  4FLH A;  2MRP A;  3VH3 B;  1WGH A;  2D2Q A;  2KC1 A;  3JW0 X;  4B6W A;  2IY1 B;  2K39 A;  2Z59 B;  3PSE B;  4HXD A;  4KVG B;  3RD2 A;  2PPH A;  3TMP B;  2NPT B;  5L83 A;  2WDT B;  4NAW B;  2O6V D;  2MX2 A;  3C0R B;  4E3C A;  2J0J A;  2UYZ B;  2KWC A;  3KYD D;  3V61 A;  2Z0D B;  3UIO B;  1WE6 A;  2BYE A;  3DCG A;  2IY0 B;  2DAF A;  3QA8 A;  4N9F 4;  4W9E A;  1U4A A;  3W1Y A;  1OEY J;  2C7H A;  2NBW B;  3JYU A;  4II2 B;  4RM8 A;  5KHO A;  4AOF A;  3V6C B;  3VTW A;  3RZW C;  4ZRI A;  2GBJ A;  3D32 A;  4FHK A;  2HE7 A;  4IM2 A;  2MBB B;  4RMA A;  4K7U A;  1CMX B;  2CR5 A;  4ZRJ A;  4TQ1 A;  2MBH A;  2KLG A;  4K1R B;  4MEM A;  3PRP B;  1X1M A;  3M95 A;  4W9G A;  1YIW A;  4TQ0 A;  5GMV A;  2MCN B;  3ML8 A;  4ICV A;  2KDB A;  4BKT A;  4ASW C;  2KMA A;  4GMV A;  2AL6 A;  2G3Q B;  4ICU A;  1YX6 B;  4NPN A;  1E8Z A;  2MBQ A;  4MGI E;  2REX A;  3ZRC A;  2AL3 A;  4II3 B;  2KTF A;  2JT4 B;  4JGH B;  3H1U A;  1IP9 A;  4ANV A;  3QWZ B;  3DPD A;  2GBM A;  4HWI B;  3OJ4 B;  1J19 A;  5DPW A;  3CF6 E;  3EHV A;  2L3Z A;  3O65 B;  2N7D A;  2JZZ A;  4BFR A;  3R66 C;  4BBN F;  2BKR B;  2LD9 A;  2FCS A;  2RR9 A;  3A1Q B;  1VD2 A;  1WX8 A;  4IWP A;  4ZYN A;  4OVV A;  1XT9 B;  3ZNG C;  4WQO B;  1WY8 A;  3ZKJ C;  1UD7 A;  1P9D U;  2WX0 A;  2C9W B;  2JVC A;  2ZCC A;  2MP2 A;  1EF5 A;  4LJP B;  4MJS A;  3MTN B;  2B3A A;  3U8Z A;  3HM6 X;  3ZNH B;  2PEA A;  3L16 A;  1GC6 A;  2M8S A;  4FUL A;  1TZ1 A;  2BYF A;  1XQQ A;  4FN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...