1WXAA

Solution structure of ras-binding domain in mouse af-6 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
GSSGSSGSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Ras-binding Domain in Mouse AF-6 Protein
rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Afadin
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxaA00
4FN2A 3OAWA 4G3XB 3VH3B 2BWES 2MBQA 3RUIB 2FIDA 3H7SA 4GDLB 4II3B 4TKNA 4XZ4A 5D94A 2LWPA 3T9LA 3MJWA 4K1RB 5C23A 2HTHA 5BO4B 4KSKC 2BKFA 4DK5A 2CHXA 3IFWB 4LCDE 2KDBA 2MWSB 1EF1A 3GZNI 4LDTB 4GB9A 4KZ0A 4A3PA 3A9JB 2ZZPB 2DENB 1OQYA 2WYQA 2XEWA 4WWPA 5AZGA 3A9KB 2DYOA 4W9DA 2KTFA 4M8NA 1WMHA 3WALA 1E5WA 2V3SA 2CHZA 2Z0DB 2JRHA 4OVVA 4AJYB 4ANUA 3MTNB 2FNJB 2LZ6A 3A9KA 2RPQA 2GBRA 2KN5A 2J7QB 2AEHA 2BGFA 3QAQA 1J19A 1T0YA 2KLGA 3DVGY 3KUZA 3VUXA 2GOWA 3DBLI 1WXMA 2KDFB 1WX7A 3A33B 4WAAA 2G3QB 2MP2B 5IA7A 2KWUB 2BKRB 2KMAA 1Q1OA 3TCAA 3PVLA 3DVGX 2NVUI 4HPLB 3CMMB 4HDOA 4HVBA 4BKSD 2NBUA 4AWJA 2MBOA 4ZRIA 2KFKB 5LLIA 4KSLC 1E8YA 1RAXA 4FHJA 4EOYA 1FXTB 2GBKA 5IAAC 3V6EB 2WX1A 2KOXA 2XK5B 2JVCA 4LDTD 4F1SA 2LVOA 4MGKE 4ZRKA 2JZZA 2KXJA 3PTFC 3VXWA 3HM6X 3APDA 4KVGB 3L13A 4II2B 1E90A 3A1QA 4W9FA 4JQWC 3R3MA 3UF8A 1ZGUB 1KM7A 4BOSC 1UD7A 5J2RA 2LXAA 3SU8X 4F7ZA 1GC6A 4DHJD 4MJSA 4MSQB 3M62B 4XX5A 4CHKA 4KIKA 2JWZA 3QARA 2C60A 3PZDA 5DPSA 3C0RB 1P98A 3H6NA 2KHWB 2KLCA 3ZNID 3WAOA 2EMTA 1GUAB 2AL6A 4CYEA 4W9LA 1VD2A 2LI5A 3RZFA 2MP2A 4ANXA 3ML8A 4I6PA 1UBIA 3I3TB 1RFAA 1WE6A 1Q0WB 2KC2A 1UELA 3QC8B 4HWIB 4IM3A 4W9JA 3AXCA 1UH6A 4GGQA 5CX3A 1UZXB 3RYTA 4DBGA 3KH0A 1UGMA 4PYUA 5E6OA 4M8MA 2LASA 5C1ZA 1SE9A 2C7MB 4BBNC 4AJWA 4BVUC 2N1VA 1S3SG 2BWFA 2CS4A 2KKCA 2N9XA 4AUQC 4PS8A 4NJ7A 4AP4C 2WWZA 4HJKA 2KK8A 3VQIA 3RT3B 2M17A 3S2AA 4JLCA 3QA8A 4GDKA 1WYWB 2KTRB 4F8CB 2D10A 3QCAA 4HDQA 2LGYA 3HHMA 3MHSD 4MSMB 3H1UA 3L08A 4BOZB 2AYOB 4AOFA 3DBSA 5JH5C 5HKHA 2KVRA 1EO6A 4IG7B 1XQQA 3BY4B 2V4LA 5CHWA 5E6NA 2K8BA 4DHZE 2GMIC 3ZDMC 2KZRA 2D2QA 1EF5A 2GBNA 2KMCA 3B08A 4ASWC 1MG8A 4MEMA 3NZSA 2M4NA 3KVFB 2DZIA 1YD8U 4FJYA 4FBJB 4KDLB 2WDTB 3NHEB 5D6JB 2HD5B 3L0WB 2L05A 2KQSA 2KD0A 3W1SA 3DQVA 3T8MA 3CF6E 4HLEA 2MLBA 3DOWA 3RULA 1V5TA 1WIAA 3ENEA 4GDLA 1V6EA 4MGYE 2EKEC 2O6VA 5DCNA 5JHAA 2FCSA 1LQBA 1H8CA 4KIKB 5G2NA 2NPTB 2DZMA 2NS5A 1C3TA 2LD9A 3H7PA 2WX0A 3PV1A 5EDSA 4OVUA 3IBEA 2JUOA 2FUHB 4LJPB 3ZNHB 1V5OA 1CMXB 2K39A 1YX6B 1J0GA 1WJUA 3GOEA 4X57B 1KOTA 3PLVA 1WM3A 3Q3JA 4DWFA 1WJ6A 2KJHB 2MBHA 5TR5A 2JT4B 3VUYA 2J0MA 2LJ5A 4WJOA 2DYMA 3VTUA 1P9DU 1LXDA 3UINB 2KFKA 4P7IA 1WI0A 1OEYA 1WGGA 1OEYJ 2IY1B 1V49A 2AL3A 2REXA 3TL5A 4G11A 1WX9A 4G0NB 4HPMB 1XD3B 3CSFA 5LXHA 1ZW7A 2RD0A 1E8WA 3L54A 2K8HA 3IHPC 1P0RA 2KFJA 3ZDTA 2L7RA 1V2YA 2GBJA 3QQ8B 4GU2A 4IM0A 3Q3FA 1Z2MA 1SIFA 2KWCA 3OJ4B 4BKGA 3LJ3A 2I1JA 1WMHB 3TJPA 1J8CA 5AEKB 4W9GA 2K25A 3HK0A 3VTWA 2DZKA 3DPDA 5CTRC 4RMAA 2M0XA 2W9NA 3A9JA 4GMVA 4GOCA 4W9IA 4EZJA 1C1YB 2K1FA 3DCGA 4BBNF 2PE9A 4J6IA 3ZRFA 1TBEA 4YL8A 5D2MB 4IC7B 1M94A 3AU5A 4ZRJA 3WANA 1TGZB 2N7DA 1GG3A 3VHTC 1PQSA 3DDCB 4E74A 4E71A 3AI5A 2MBBB 4NAWB 4RM9A 1GNUA 2IO1B 2LUEA 4MGIE 3QK0A 3UIOB 1KLVA 2KDIA 4K7WA 2UWQA 2IO3B 4GIVA 3OJ3A 4GSWA 2KDEB 1R4MI 3LDZE 3PPAA 4W9CA 1WX8A 2FAZA 2G4SA 2NR2A 3QJZA 5J18A 3CSTA 3V61A 1EUVB 1WJNA 5G55A 3H7PB 2M8SA 2J0JA 4NJ6A 2FCQA 4WWNA 4JIOU 2ZVOA 4EUTA 2JXXA 4MELA 2JPHA 1QZEA 2N4FA 3NOBA 4WJNA 4DDGD 3QIJA 3VDZA 1V86A 3B1LX 4NPNA 3JVZX 2HE7A 1E7UA 2ZVNA 4MH0E 2O2VB 1Y8RC 1F9JA 2V1YA 1NDDA 3H9DA 3M95A 1OGWA 4FA6A 2RGFA 2O2VA 4IWOA 3U8ZA 3V6CB 2FCMA 2RR9A 2C7NB 4MGZE 4EZLA 4NQKE 4W9EA 3ZUNA 1TTNA 2LVPA 2NBVB 3V62A 1L2NA 1E8ZA 3M63B 1IPGA 2JZ3B 2VRRB 2IBIB 4NQLB 4FULA 3JW0X 2L76A 1AARA 3K9OB 1WE7A 4KZCA 5DPTA 2CU1A 2DAJA 4EKUA 4WJPA 3KYCD 2K6QA 2KWVB 1VCBA 4KV2A 3JSVA 3B0AA 2C9WB 3U30A 1NI2A 3JYUA 4WWOA 1WGYA 4HCPB 1IYFA 1WGRA 2KQ7A 3DVNU 4URKA 4PS7A 4PYZA 3A4RA 2C5LC 2DX5B 4RM8A 3WA0A 5DPRA 1Q5WB 1V81A 3KUCB 3M3JA 2D3GA 2MRPA 2N9PC 2PEAA 3PSEB 3ALBA 4DXAB 1TZ1A 2ZNVC 3R7QA 1G6JA 2ASQA 4IW0A 1K8RB 2D11A 4K7SA 4NY0A 3RD2A 4ZDVA 1S1QB 1WR6E 3EFUA 3ZTCA 1WZ3A 2LGDA 1IP9A 2BPSA 1GC7A 4N9F4 1E7VA 3ONSA 2K6DB 1RLFA 1H4RA 4BFRA 2CKHB 3V60A 1WXAA 1YX5B 2MX2A 2KJRA 4ANVA 1LM8B 2IYDB 2KANA 2DYBA 3TIXA 3ZO5B 2YVCA 4KDIC 4MM3A 3QX1A 5AZHA 3NS8A 2L0FA 2PJHA 5FR6A 2KC1A 2MA9B 2YLMA 4PS3A 4WJQA 4HK2A 3SDLC 2IY0B 3W1SC 3UQBA 3WIMA 4IWPA 4TQ0A 2ZCBA 3PGEA 4GN1A 3ZKJC 2DAFA 3APFA 5JZEB 3PRMB 2L00B 2M1MA 2B3AA 1SGHA 4FLHA 1WR1A 4XC2A 2KJ6A 2XBBC 2FIFA 3JSVB 3RCZA 3VVWB 1V9JA 4ICUA 2ZNVB 4ZYNA 3ZLZA 3ZNGC 4JGHB 2CHWA 5CHFA 4WQOB 4FJZA 2G45B 3EC8A 3X23A 2MSED 3N32A 3N3KB 2EMSA 4MDKE 3SD5A 3X0WA 3R7RA 2Z59B 1WM2A 3DVNV 2K8CA 2BF8B 3RZWC 5D7GA 3IVFA 2A4ZA 4GXBA 5CHVC 4LJOB 2BYFA 3ZRCA 2NPTA 5AZFA 4NAWA 3W1YA 1Z5SB 2L0TA 3PS6A 3PREA 1NBFC 1WFYA 3VFKA 3HIZA 2C7HA 2R2QA 4ICVA 1P3QU 1YQBA 1ZKHA 2DHZA 4G50A 4B9KA 1YIWA 2MCNB 3NY5A 3ZTDA 3U7DA 2LRWA 3ZVVA 3PRPB 4EZKA 3UQAA 2I1KA 1WRDB 2LGXA 1E8XA 3N30A 4HXDA 4ANWA 2BYVE 3VAWA 4FADA 4HCNB 1YJ1A 1X1MA 2MW5A 2NCNA 2AWTA 2RSUA 3O65B 1OTRB 2J0KA 5JHBA 3QHTA 3BINA 1R4NI 1V80A 2N1WA 1A5RA 2ZPNA 1U4AA 2NBWB 2R2OA 3UGBB 2MQJA 2JRIB 1WGHA 1XT9B 2Z0EB 2KO3A 1WXSA 3APCA 3DBRI 5E6PA 3KYDD 2ZPYA 4EEWA 1HE8A 2O6VD 4FHKA 3VH4B 2UYZB 5KHQA 2JY6A 1I42A 2QHOA 3DBHI 4GDKB 4DDID 1WGDA 2A5UA 2ZEQA 3AULA 3KUDB 3L16A 4M0WB 3D32A 3WAMA 3L10B 4B95A 2LVQA 3OLMD 2N7EA 3QWZB 3ZNZB 4K81A 3K9PB 3ZIMA 2LXCA 4IWQA 1KJTA 5KHOA 1P1AA 2IO0B 5L95C 3L17A 4TV3A 4BKTA 5DPWA 3NZUA 4NNJB 2N9EB 3R66C 2HJ8A 1GJZA 5LXIB 5GMVA 2CR5A 1ISNA 4A20A 1WY8A 2FCNA 5J17A 3A4SC 2Y5BB 1L7YA 4TUUA 2G4DB 2OJRA 2DZJA 4I6LB 4B6WA 4E3CA 2KX3A 2JF5A 3PHXB 2MBEA 2O6VB 3TBLD 2L3ZA 4BKSA 2GBMA 3TMPB 3ECIA 3VTVA 1WXVA 2KX0A 4EFOA 2IO2B 1LFDA 4K7UA 4W9HA 1BT0A 1UBQA 1JRUA 2ZJDA 3IG3A 4MJSB 3AU4A 3A1QB 4JL9A 3P2BA 3PLUA 4A3OA 1WJ4A 2PPHA 1RRBA 1WH3A 2IZVB 2LRUA 2BYEA 4W9KA 3UIPB 3ZW3A 2D07B 2L8JA 3HM3A 4IM2A 1WF9A 2PE6B 3EECA 3SHQA 3VUWA 3KW5B 4DHJB 4DHZB 3EHVA 3ML9A 1I35A 4I6NB 3PT2B 2OOBB 4CO7A 4IUMB 3WAPA 1WZ0A 2KTRA 3PHWB 5L83A 3PRZA 4FJVB 2ZCCA 4TQ1A 2KNBA 1D3ZA 2XK5A
chains in the Genus database with same CATH superfamily
4G3XB 2QJLA 2IPKD 2BWES 2MBQA 1MHXA 3H7SA 1QF6A 5IKCM 3DWMA 4XZ4A 2LWPA 5BO4B 2BKFA 2BS4B 1JWBD 1UUPA 1XLOA 3B2FA 4A3PA 3A9JB 2DENB 1OQYA 2WYQA 2K5PA 2Q5WD 1JCKB 5EE9A 2KTFA 3WALA 1ZOYB 2V3SA 2CHZA 4ANUA 3MTNB 3A9KA 1HEZE 2KN5A 3Q3MC 3QAQA 3IT6B 3CIRB 4S0RA 3VUXA 2GOWA 2INCC 1ZP0B 2G3QB 4LNNA 1Q1OA 2WXNA 3DVGX 4AWJA 4ZRIA 1E8YA 1RAXA 2GBKA 2WX1A 5C3JB 2XK5B 1DOYA 4ZRKA 3PTFC 3VXWA 3RMKC 3EGRA 1BUIC 3Q3OC 2V9HA 3UF8A 2W54A 1HZ5A 1ZGUB 1KM7A 3TEXA 4BOSC 1TKEA 3SU8X 2NMQA 4DHJD 4MJSA 3M62B 4XX5A 4CHKA 4AS1A 2C60A 3C0RB 3H6NA 2KLCA 2SAKA 3WAOA 1GUAB 4ANXA 2MP2A 4I6PA 1D6EC 1KTKA 4IM3A 4IOIE 1WSPA 5CX3A 1UZXB 2MJ3A 3I57A 3KH0A 3RPFC 1UGMA 1F2RI 4BBNC 4BVUC 2N1VA 1S3SG 1XLPA 2ICIA 3EUB2 1FCLA 1DYQA 4YSYB 5HI1A 2WXJA 4YSXB 1WYWB 2KTRB 2D10A 3QCAA 2LGYA 2INDC 4P6VF 1EWCA 2AYOB 5JH5C 2QILA 4IG7B 2LJIA 2K8BA 3AE7B 2GBNA 3NZSA 2DZIA 2H89B 3R8BA 1IGCA 4KDLB 2WDTB 3NHEB 1KH0A 3N1ZC 4ZHOA 2KD0A 1RFKA 3DQVA 3FAHA 3T8MA 3ZXVA 3CF6E 4YTNB 1NI3A 2BS3B 2PIAA 1WIAA 4GDLA 1L6VA 1GPXA 5JHAA 3PZ8A 4M01A 2KT7A 3AM9A 1C3TA 1DOIA 1NENB 3PV1A 2JUOA 3ZNHB 1CMXB 2K39A 2KN4A 1WJUA 4S17A 3AE6B 3RNFC 4DWFA 1WJ6A 1TT5B 3EA6A 2WXFA 3VUYA 1Q10A 3VTUA 1P9DU 1WGGA 2AL3A 4LNKA 4G11A 2ZW1A 5LXHA 1ZW7A 3L54A 1TIFA 2LGSA 2KFJA 3QQ8B 3Q3FA 5IOIA 3W5UB 1KF6B 1J8CA 3AEAB 3TJPA 2K25A 1R4NB 2WDQB 3DPDA 5CTRC 2M0XA 3A9JA 4GMVA 4GOCA 4W9IA 4BBNF 4J6IA 3RN9C 4YL8A 5D2MB 4IC7B 1M94A 2IJ0A 1FPYA 3DHHC 3VR9B 2CU3A 2MBBB 2DWQA 1CZPA 4RF0A 1SJED 3QK0A 3RNAC 3UIOB 4O1NA 2WXGA 2IO3B 1KFYB 2XNAC 3NS1A 1R4MI 2KACA 1L0VB 1IBXA 2G4SA 3CSTA 2J0JA 3RNCC 1VZ7A 4WWNA 4IDIA 2JXXA 2JPHA 3AV8A 2N4FA 3NOBA 5G5GA 4N6EB 3J9CA 3W2DA 3AE5B 1F9JA 3H9DA 1YMHE 2RGFA 2WXKA 2O2VA 4IWOA 1NYRA 4RCOA 2C7NB 4EZLA 3HUIA 2LVPA 3OG5A 4R3DA 1UF0A 1L4DB 2IBIB 3JW0X 2L76A 1AARA 2CU1A 2ONQA 4P1CC 3DBLB 3BVMA 1NI2A 1TY0A 3AE2B 4HCPB 1IYFA 1ROEA 1D4BA 4PYZA 2C5LC 1F2RC 2QCZA 3P42A 1V81A 3GZNB 2N9PC 1EWYC 2ZNVC 5BYQA 1WYGA 4ZDVA 2BPSA 3ONSA 1PUTA 3RI7C 2CKHB 1WXAA 4ANVA 1LM8B 3TIXA 1VZ8A 2LUMA 1PDXA 1TZOA 1JMLA 1YQ4B 2HJ1A 1MVKA 1V1PA 3WIMA 2W3RA 3VRAB 1NYQA 3PGEA 3WCQA 1XEEA 5JZEB 4FXCA 1WR1A 1TKGA 2ZNVB 1PGBA 3ZLZA 1N61A 4WQOB 3BVZA 3X23A 2QEJC 3X0WA 2EMSA 3SD5A 4AQ7A 3R7RA 5HG2A 4LNIA 2JU6X 2LHEA 1HA5A 2PVGC 2BYFA 3IAS1 2NPTA 1HQRD 1Z5SB 1AWDA 3PS6A 1K50A 3PREA 3VFKA 1YQBA 2DHZA 4TMAB 1MPEA 1BMLC 3R2IA 4EZKA 2M19A 4ANWA 2BYVE 3DBHB 4FADA 3BZDB 1XO3A 4HCNB 2WS3B 4XE0A 5JHBA 3QHTA 1N63A 4MACA 3BINA 1A5RA 2MQJA 1WGHA 2PMVA 2WXLA 1TS2A 1T0SC 4EEWA 1EU3A 4FHKA 5KHQA 1I42A 3DBHI 4GDKB 1WGDA 3BK2A 1FXIA 3WAMA 4B95A 5IN7A 3OLMD 3AECB 1I7HA 2IO0B 4USAA 2LGIA 3NZUA 2N9EB 2HJ8A 5GMVA 4EE2A 2KAJA 2G4DB 2OJRA 3TBLD 3VTVA 2KX0A 4EFOA 4A8XC 3H8HA 4W9HA 1BT0A 3PLUA 1L4ZB 1RRBA 2LRUA 1GB1A 1VLBA 3V3XA 2L8JA 3HM3A 4IM2A 3VUWA 4DHJB 3KW5B 4DHZB 3E56A 1I35A 3Q8CA 3W9CB 4WQMA 2ZCCA 4OZBA 2V3NA 3VH3B 2KWDA 1L5PA 4ARCA 4TKNA 5D94A 5H8YE 4KGRA 3ZGZA 2KDBA 2MWSB 2UU7A 4KZ0A 2L52A 4WWPA 2BB6A 2DYOA 4M8NA 1E5WA 2Z0DB 4DXFA 4AJYB 1JRPA 2GBRA 2AEHA 4A6QA 2KLGA 3DVGY 3GE8C 3DBLI 3A33B 2KWUB 1XXGA 2B76B 2V4IB 3Q8BA 4HPLB 2RDHA 3CMMB 4HDOA 3N1XC 3P4QB 2NBUA 4C80A 5LLIA 1XF5L 5IAAC 4OW0A 5C2TB 3TSSA 4F1SA 3ZJVA 2JVCA 1E7PB 3P63A 4MGKE 2KXJA 3HM6X 4RGOS 4II2B 1FIQA 1FFVA 1P7FA 2G1EA 3R3MA 5I4DA 1CJEA 5HFYA 3LB8C 2L83A 4F7ZA 3FC4A 1HTQA 1C4CA 3URYA 1F1HA 4CYEA 1VD2A 3ML8A 1UBIA 2GLSA 2KC2A 2WDRB 3QC8B 2MJDA 3AXCA 3NZ3A 5C1ZA 1ET9A 2C7MB 4ZRPA 1YN4A 4KGTA 2BWFA 2KKCA 2N9XA 4M0WA 1IGDA 4C00A 2WWZA 3VQIA 3S2AA 3MP9A 2I38A 4F8CB 3MHSD 3H1UA 1JWUD 4BOZB 2YEPF 1SBBB 3MC0B 3DBSA 1V97A 1EO6A 4H2AA 5AUKA 3ZDMC 4PK1A 2D2QA 2KMCA 2M0AA 3B08A 4ITKA 2M4NA 4C4VB 1LO5D 4RNAA 4FJYA 2HD5B 1ET6A 2WXHA 1D5MC 1SJHD 1V5TA 3ENEA 5DCNA 2FCSA 1H8CA 4WAFA 2DZMA 2NS5A 2WX0A 1L6UA 3DHGC 5IO9A 1STEA 2IGGA 1KOTA 1WM3A 2NTSA 1VRAB 1KRHA 1JROA 3U7ZA 3FILB 2J0MA 2LJ5A 3P4PB 2DYMA 3UINB 2EKIA 4IKGA 1WI0A 4D2KA 1V49A 1GB4A 1V1PB 1NEKB 2W82A 3SFDB 2BW2A 1WGKA 3IHPC 4L2YA 1P0RA 1P7EA 3ZDTA 2BB5A 4C7ZA 2L7RA 1F77A 4M00A 1Z2MA 2E6XA 1HXYD 1SIFA 4JX1C 4W9GA 3HK0A 1PYWD 4RMAA 1WXQA 2RDGA 2PE9A 4US9A 4HKQA 1QOFA 3I5JC 2KQ4X 3T3NA 2LUEA 4MGIE 1J7AA 3LDZE 2FAZA 5J18A 3V61A 1EUVB 5G55A 3H7PB 4HRSA 4NJ6A 3N20C 4JIOU 4DQOC 1QZEA 3QIJA 3VDZA 3JVZX 2HE7A 1Y8RC 3AE9B 2J53A 2PVOD 1V1OA 1TTNA 2NBVB 3V62A 3M63B 1FM0D 1IPGA 3PZ7A 1QOAA 2JZ3B 2EELA 4OHJA 1YNTE 2K6QA 1VCBA 3JSVA 1E9MA 3B0AA 3JYUA 4WWOA 1WGYA 2KQ7A 3DVNU 4PS7A 3A4RA 4RM8A 3KUCB 3M3JA 2D3GA 1D5ZC 2MRPA 2RMMA 2X8XX 3R7QA 2D11A 1S1QB 1WR6E 3AMZA 3C19A 1FEHA 4N9F4 2K22A 3DWGC 4HKZE 2IYDB 2KANA 3ZO5B 2YVCA 4MM3A 1A70A 1HZ6A 2TSSA 2L0FA 2PJHA 5FR6A 2YLMA 2OEDA 4HK2A 4WJQA 3SDLC 3W1SC 4IWPA 3Q3NC 2L00B 2M1MA 1SGHA 3P1MA 3RCZA 3VVWB 1V9JA 4ZYNA 2RPVA 1K53A 2CHWA 4FJZA 2G45B 1FO4A 2MSED 4MDKE 4OZAA 3BYYB 1WM2A 2BF8B 4MT5A 1LGRA 3RZWC 1PFDA 3IVFA 4GXBA 5CHVC 2BT6A 4LJOB 1DGJA 1T3QA 1OQQA 2PKOA 3TUOA 3O13A 1NBFC 4RH6A 2MCNB 2J42A 1VR9A 3Q6BA 2I1KA 3VAWA 2AWTA 3O65B 1OTRB 3AE1B 1U4AA 3NRZA 3UGBB 3B2GA 2Z0EB 4B0MA 3DBRI 2JY6A 3DHIC 1ZXIA 1AN8A 4KX6B 1UWMA 5BYSA 3QWZB 2D3CA 3ZIMA 1KJTA 1P1AA 4TV3A 5DPWA 3R66C 4L23A 3W5VB 1ISNA 3PO0A 5BMGA 5J17A 1N6ZA 2WXRA 2Y5BB 1L7YA 4TUUA 1I4PA 4XWTA 4BKSA 3TMPB 2IDYA 2HDEA 1VZ6A 3ZW3A 2BYEA 3UIPB 2D07B 1UNSA 1IBXB 3EHVA 3ML9A 4LLGM 4CO7A 3WAPA 4TQ1A 2KNBA 1YD8U 2XK5A 4P16A 3OAWA 1XCTL 3MJ5A 1B9RA 1GAQB 4II3B 5FR3A 3SEBA 2XN9C 3T9LA 2AQ3B 2ON8A 3MJWA 2HTHA 3IFWB 2N9KA 1EF1A 3GZNI 4RF1A 4XYCA 2ZZPB 2XEWA 5AZGA 3A9KB 4W9DA 2QIEB 3N9YC 4YTPB 5D3IB 1VJKA 3AE3B 2JRHA 1K51A 2YEPB 1D5XC 2J52A 2FNJB 2RPQA 3KWVA 2J7QB 2BGFA 1C77A 4RGMA 1WXMA 5IA7A 1RM6C 1Y56A 2KMAA 3TCAA 3PVLA 2NVUI 4BKSD 4WURA 1JWAD 2KFKB 2H88B 4KSLC 1CQVA 4EOYA 1FNUA 3U52E 4A9AA 1FXTB 1MHHE 3V6EB 3AN1A 2KOXA 2W55A 1J7CA 2LVOA 2JZZA 5EE1A 3L13A 2QDFA 4W9FA 3P4RB 1OFFA 2JZPA 1UD7A 3AB5A 3N1YC 1SIJA 4P1BC 4KIKA 4UDUC 4YT0B 1FNWA 3PZDA 3RNGC 1P98A 2KHWB 1RYJA 3ZNID 4DXGA 2EMTA 2AL6A 3DBRB 1WE6A 1UELA 3SFEB 3U4EG 4LNOA 4W9JA 1ZXHA 4GGQA 2KYWA 1ZE3D 5IP4D 3SR6A 3E9SA 4PYUA 5E6OA 4M8MA 5EE3A 1SE9A 4AJWA 1OQRA 4PS8A 4ZOHC 2KK8A 2PLPA 4JLCA 2MEKA 3NG0A 3Q8FA 3HHMA 2AQ2B 4MSMB 4KGSA 2WHIA 3I63C 5HKHA 2BVCA 3NVWA 3Q2AC 1XQQA 3MC9A 4DHZE 2KZRA 1EF5A 1XCQL 1MG8A 4MEMA 3NVVA 1N5XA 4FBJB 3Q8EA 2BBCA 3L0WB 2L05A 2KQSA 2LMCA 3AEDB 1R4MB 3AEBB 2D3BA 4HROA 3V05A 3GS2A 4HLEA 3RULA 4MM3B 2EKEC 2GB1A 4KIKB 5EDSA 2V3PA 4OVUA 2OHFA 2FUHB 1SE3A 1YX6B 3GOEA 2K3UA 3Q3JA 4QAYA 2AX5A 2MBHA 3P4SB 5TR5A 1YN5A 4WJOA 3ZYYX 1SE2A 2KFKA 3R2TA 3HRDD 1OEYJ 1FXAA 3TL5A 4G0NB 4HPMB 1XD3B 3LXFA 3CSFA 2RD0A 1E8WA 1ACCA 1V2YA 4GU2A 5H92C 3ZXRA 4LK0M 2KWCA 4BKGA 3LJ3A 5AEKB 3VTWA 1QQRA 4EZJA 2K1FA 3DCGA 4XDDA 2PTLA 5FKAC 1FFUA 3I9V1 3AU5A 4ZRJA 3WANA 1TGZB 2KDMA 3VHTC 1PQSA 3DDCB 2DLBA 4NAWB 3AI5A 1TS3A 3ABVB 2KMMA 2IO1B 4ZYSA 5MPOA 1KLVA 1MG4A 4K7WA 4GIVA 3PPAA 2FBWB 2NR2A 3QJZA 1C9FA 1WJNA 2M8SA 1FNVA 3AH7A 1PGAA 2ZVOA 4EUTA 4MELA 4DDGD 4RGTA 2WDVB 4XGAB 2ZVNA 3ZQ4A 2V1YA 4NZLB 3M95A 1OGWA 4FA6A 1AW7A 1I4RA 3NUHB 3V6CB 2RR9A 1TYGB 4NQKE 2KVZA 4W9EA 2LFIA 1C78A 2VRRB 4NQLB 4FULA 5DPTA 4EKUA 4B0EA 2DAJA 4WJPA 4KV2A 3U30A 1WGRA 2DX5B 2VH2A 5DPRA 1TKYA 2PEAA 3PSEB 2V0GA 2D5GA 3ALBA 1E6EB 4GLSC 1TZ1A 1G6JA 2ASQA 1K8RB 3ZTCA 3EFUA 2K6DB 1RLFA 4BFRA 1YX5B 2MX2A 1FMAD 4US8A 4KDIC 5AZHA 2KC1A 2MA9B 4PS3A 1I4GA 2IY0B 3FILA 3UQBA 3L4PA 3AEEB 4TQ0A 1AYFA 4GN1A 3ZKJC 3APFA 2XBBC 3MC8A 2FIFA 4ICUA 1SXTA 1FRRA 2X38A 1F52A 3GP7A 1ZUD2 2IGHA 3N32A 2FE8A 2QC8A 3DVNV 2BTEA 3ETRA 3GE3C 3ZRCA 4NAWA 2WGSA 3W1YA 2MJEA 2L0TA 2C7HA 1JW9D 2R2QA 1ZKHA 4B9KA 4C4VA 2ZW0A 3NY5A 4RFBA 2INPE 3PRPB 1WRDB 3N30A 1N60A 1DOXA 2MW5A 3Q14C 3ZJTA 4YXDB 1R4NI 1V80A 4K3CA 2JRIB 1XT9B 1WXSA 2KO3A 2N7JA 3APCA 5E6PA 2ZPYA 1HE8A 1T6BX 1MFWA 2UYZB 2Z8LA 4M02A 1TY2A 4DDID 4XDCA 2ZEQA 3KUDB 3AULA 3L16A 4M0WB 1I4QA 2LVQA 3ZNZB 2LXCA 5GXGB 5KHOA 3LYYA 3L17A 4BKTA 1YN3A 5BMHA 1J7BA 4MH8A 3TEYA 2JSVX 4WWMA 4A20A 2FCNA 2DNFA 4I6LB 1HTOA 4B6WA 2KX3A 1SSNA 2L3ZA 2GBMA 2G9HD 1LFDA 1UBQA 1JRUA 3IG3A 3AU4A 3A1QB 4JL9A 4A3OA 1WH3A 2IZVB 3EECA 4LTUA 3PT2B 2KTRA 3PHWB 4BAXA 3PRZA 4FJVB 1D3ZA 4REZA 2N0SB 4FN2A 1TS4A 4WH4A 3RUIB 2FIDA 4GDLB 4K1RB 5C23A 1N5WA 1VDVA 4KSKC 4L1BA 5FK9C 4DK5A 2CHXA 4LCDE 4LDTB 4GB9A 3AEFB 3RNEC 1I4HA 2Y5CA 4JWSC 1UGJA 1WMHA 3AEGB 5HHDG 4OVVA 2WXPA 3Q8AA 1QLBB 2LZ6A 4ACFA 2E3TA 3NVZA 3RNBC 1J19A 1T0YA 3KUZA 4WAAA 2KDFB 1WX7A 2MP2B 3BIID 4N59A 2BKRB 1RWSA 3C8YA 4HVBA 2CJNA 2MBOA 4FHJA 1YJJA 2AQ1B 2IGDA 5LNK1 4LDTD 2BS2B 1FRDA 3TEZA 4NJCA 3APDA 4KVGB 1E90A 3A1QA 1QKZA 4JQWC 4A90A 5J2RA 4ZHPA 2LXAA 1GC6A 4MSQB 2CJOA 2JWZA 3QARA 1GOZA 2W3SA 4C56C 5DPSA 1ZDXA 3IXSA 4LNFA 4W9LA 3RZFA 2LI5A 1T5XD 1C79A 3I3TB 1RFAA 1Q0WB 4HWIB 1UH6A 3KWLA 3RYTA 4DBGA 4WIPA 1SEBD 2LASA 2SEBD 1KLUD 2CS4A 4AUQC 2ACZB 4NJ7A 3HVDA 4AP4C 2K0PA 4HJKA 3TEWA 3RT3B 1FCCC 2M17A 2BQQA 3QA8A 4GDKA 2Y3AA 3AE8B 3BWUD 4HDQA 2WXQA 2WLBA 3OWEB 3L08A 4AOFA 1XLQA 2KVRA 3BY4B 1E0ZA 2V4LA 4J3OD 5CHWA 5E6NA 2RDBC 2GMIC 2QMTA 4Q2JA 4ASWC 3KVFB 4A55A 1XLNA 5D6JB 5BMIA 1B1ZA 3NVYA 1C4AA 4XWWA 2D3AA 3W1SA 2MLBA 3DOWA 4MGYE 1V6EA 3FKYA 2O6VA 1LQBA 1IUEA 2I2YA 5G2NA 2NPTB 2LD9A 3H7PA 4HJGE 3IBEA 1J0GA 4LJPB 1V5OA 4X57B 1ZPSA 3PLVA 1JWMD 1YOVB 1QT9A 1NVID 2KJHB 4JPSA 2JT4B 1SF0A 2WXMA 1ENFA 5G5HA 1LXDA 4P7IA 1OEYA 4KKJA 2IY1B 2VH1A 2REXA 1WX9A 2K8HA 2JWUA 2WU5B 2VZKD 2WXIA 2GBJA 3BYTB 4CQNA 2K9XA 4IM0A 3BVGA 3OJ4B 2I1JA 1WMHB 1N62A 2DZKA 4NAMA 2W9NA 2WU2B 5D3DA 1C1YB 1EU4A 1YJIA 2JX5A 2QSDA 3ZRFA 1TBEA 1T0QC 1JQ4A 2FUG1 2N7DA 1GG3A 4E74A 4E71A 2J4XA 2LEKA 4RM9A 1GNUA 3CWIA 3RFZB 2KDIA 2VZKB 2UWQA 3T3OA 3OJ3A 4GSWA 2KDEB 4W9CA 3MHZA 1WX8A 1QILA 1F0ZA 2FCQA 1TJEA 4WJNA 4YWGG 1V86A 3B1LX 4NPNA 1E7UA 4MH0E 2L32A 2O2VB 1R7SA 2Y5PA 3B9JA 1NDDA 2JYEA 3U8ZA 2FCMA 4MGZE 3ZUNA 3ZJUA 1L2NA 1E8ZA 1QOGA 2INNE 3IT4B 1V8CA 4KZCA 3K9OB 1WE7A 4YTMB 1YQ3B 4JE3B 3KYCD 2KWVB 2M56B 2C9WB 4URKA 1KLGD 1JALA 3WA0A 4YSZB 1Q5WB 2NTTA 2HTME 1ZDVA 3KQ4A 4DXAB 5T8IA 4IW0A 4NY0A 4K7SA 3RD2A 1IP9A 1WZ3A 2LGDA 3BK1A 1GC7A 1T0RC 3U2SC 1E7VA 1H4RA 3V60A 2KJRA 2DYBA 1E10A 3QX1A 2WP9B 3NS8A 2LHDA 1ESFA 1SE4A 2ZCBA 2DAFA 4RGNA 3PRMB 2B3AA 1MJDA 4FLHA 4N58A 2KJ6A 3JSVB 4XC2A 2WQYB 4JWUC 2JQRB 5EE0A 2DBYA 3ZNGC 4JGHB 5CHFA 1SB3C 2JYTA 3HVZA 3EC8A 2N9LA 1WRIA 3N3KB 4HPPA 1JWSD 1L0XB 1UWXA 2Z59B 2K8CA 5D7GA 2A4ZA 5BYRA 5AZFA 1WFYA 3HIZA 4ICVA 4G50A 1P3QU 3MFGA 1YIWA 3ZTDA 3U7DA 1PGXA 1WWTA 2R61A 2LRWA 3ZVVA 3UQAA 4HXDA 2LGXA 1E8XA 4ARIA 1FD6A 3EFCA 4TSSA 2GI9A 1YJ1A 1X1MA 1L0YB 2NCNA 2RSUA 2J0KA 1QOBA 2N1WA 2ZPNA 2NBWB 2R2OA 4HEA1 2JXTA 3KYDD 2O6VD 3GB1A 3VH4B 1MI0A 5E6JA 4C7YA 2QHOA 2MH7A 1BXTA 2A5UA 5AUIA 2OJWA 1K52A 3D32A 3L10B 1I4XA 2N7EA 4KKIA 4K81A 3K9PB 4OZCA 5TSSA 4IWQA 3IAM1 5L95C 4NNJB 1EM7A 1GJZA 5LXIB 2CR5A 1WY8A 2MHJA 4OVZA 3A4SC 2DZJA 4E3CA 2JF5A 3KLSX 1C4PA 3PHXB 2MBEA 2O6VB 1M4VA 3ECIA 1WXVA 2IO2B 2WNMA 4K7UA 4PT5A 2WXOA 2L1AA 3UI3A 2BYTA 2ZJDA 4MJSB 4BZAA 3VR8B 3P2BA 1WJ4A 2PPHA 4ZRQA 4W9KA 1CK1A 1C76A 5JXVA 3Q69A 1WF9A 3VRBB 2GRIA 2PE6B 3SHQA 1TS5A 2PW9A 4I6NB 3NJTA 2OOBB 4IUMB 1WZ0A 5L83A 3AE4B 4K3BA
chains in the Genus database with same CATH topology
4FN2A 3OAWA 4G3XB 3VH3B 2BWES 2MBQA 3RUIB 2FIDA 3H7SA 4GDLB 4II3B 4TKNA 4XZ4A 5D94A 2LWPA 3T9LA 3MJWA 4K1RB 5C23A 2HTHA 5BO4B 4KSKC 2BKFA 4DK5A 2CHXA 3IFWB 4LCDE 2KDBA 2MWSB 1EF1A 3GZNI 4LDTB 4GB9A 4KZ0A 4A3PA 3A9JB 2ZZPB 2DENB 1OQYA 2WYQA 2XEWA 4WWPA 5AZGA 3A9KB 2DYOA 4W9DA 2KTFA 4M8NA 1WMHA 3WALA 1E5WA 2V3SA 2CHZA 2Z0DB 2JRHA 4OVVA 4AJYB 4ANUA 3MTNB 2FNJB 2LZ6A 3A9KA 2RPQA 2GBRA 2KN5A 2J7QB 2AEHA 2BGFA 3QAQA 1J19A 1T0YA 2KLGA 3DVGY 3KUZA 3VUXA 2GOWA 3DBLI 1WXMA 2KDFB 1WX7A 3A33B 4WAAA 2G3QB 2MP2B 5IA7A 2KWUB 2BKRB 2KMAA 1Q1OA 3TCAA 3PVLA 3DVGX 2NVUI 4HPLB 3CMMB 4HDOA 4HVBA 4BKSD 2NBUA 4AWJA 2MBOA 4ZRIA 2KFKB 5LLIA 4KSLC 1E8YA 1RAXA 4FHJA 4EOYA 1FXTB 2GBKA 5IAAC 3V6EB 2WX1A 2KOXA 2XK5B 2JVCA 4LDTD 4F1SA 2LVOA 4MGKE 4ZRKA 2JZZA 2KXJA 3PTFC 3VXWA 3HM6X 3APDA 4KVGB 3L13A 4II2B 1E90A 3A1QA 4W9FA 4JQWC 3R3MA 3UF8A 1ZGUB 1KM7A 4BOSC 1UD7A 5J2RA 2LXAA 3SU8X 4F7ZA 1GC6A 4DHJD 4MJSA 4MSQB 3M62B 4XX5A 4CHKA 4KIKA 2JWZA 3QARA 2C60A 3PZDA 5DPSA 3C0RB 1P98A 3H6NA 2KHWB 2KLCA 3ZNID 3WAOA 2EMTA 1GUAB 2AL6A 4CYEA 4W9LA 1VD2A 2LI5A 3RZFA 2MP2A 4ANXA 3ML8A 4I6PA 1UBIA 3I3TB 1RFAA 1WE6A 1Q0WB 2KC2A 1UELA 3QC8B 4HWIB 4IM3A 4W9JA 3AXCA 1UH6A 4GGQA 5CX3A 1UZXB 3RYTA 4DBGA 3KH0A 1UGMA 4PYUA 5E6OA 4M8MA 2LASA 5C1ZA 1SE9A 2C7MB 4BBNC 4AJWA 4BVUC 2N1VA 1S3SG 2BWFA 2CS4A 2KKCA 2N9XA 4AUQC 4PS8A 4NJ7A 4AP4C 2WWZA 4HJKA 2KK8A 3VQIA 3RT3B 2M17A 3S2AA 4JLCA 3QA8A 4GDKA 1WYWB 2KTRB 4F8CB 2D10A 3QCAA 4HDQA 2LGYA 3HHMA 3MHSD 4MSMB 3H1UA 3L08A 4BOZB 2AYOB 4AOFA 3DBSA 5JH5C 5HKHA 2KVRA 1EO6A 4IG7B 1XQQA 3BY4B 2V4LA 5CHWA 5E6NA 2K8BA 4DHZE 2GMIC 3ZDMC 2KZRA 2D2QA 1EF5A 2GBNA 2KMCA 3B08A 4ASWC 1MG8A 4MEMA 3NZSA 2M4NA 3KVFB 2DZIA 1YD8U 4FJYA 4FBJB 4KDLB 2WDTB 3NHEB 5D6JB 2HD5B 3L0WB 2L05A 2KQSA 2KD0A 3W1SA 3DQVA 3T8MA 3CF6E 4HLEA 2MLBA 3DOWA 3RULA 1V5TA 1WIAA 3ENEA 4GDLA 1V6EA 4MGYE 2EKEC 2O6VA 5DCNA 5JHAA 2FCSA 1LQBA 1H8CA 4KIKB 5G2NA 2NPTB 2DZMA 2NS5A 1C3TA 2LD9A 3H7PA 2WX0A 3PV1A 5EDSA 4OVUA 3IBEA 2JUOA 2FUHB 4LJPB 3ZNHB 1V5OA 1CMXB 2K39A 1YX6B 1J0GA 1WJUA 3GOEA 4X57B 1KOTA 3PLVA 1WM3A 3Q3JA 4DWFA 1WJ6A 2KJHB 2MBHA 5TR5A 2JT4B 3VUYA 2J0MA 2LJ5A 4WJOA 2DYMA 3VTUA 1P9DU 1LXDA 3UINB 2KFKA 4P7IA 1WI0A 1OEYA 1WGGA 1OEYJ 2IY1B 1V49A 2AL3A 2REXA 3TL5A 4G11A 1WX9A 4G0NB 4HPMB 1XD3B 3CSFA 5LXHA 1ZW7A 2RD0A 1E8WA 3L54A 2K8HA 3IHPC 1P0RA 2KFJA 3ZDTA 2L7RA 1V2YA 2GBJA 3QQ8B 4GU2A 4IM0A 3Q3FA 1Z2MA 1SIFA 2KWCA 3OJ4B 4BKGA 3LJ3A 2I1JA 1WMHB 3TJPA 1J8CA 5AEKB 4W9GA 2K25A 3HK0A 3VTWA 2DZKA 3DPDA 5CTRC 4RMAA 2M0XA 2W9NA 3A9JA 4GMVA 4GOCA 4W9IA 4EZJA 1C1YB 2K1FA 3DCGA 4BBNF 2PE9A 4J6IA 3ZRFA 1TBEA 4YL8A 5D2MB 4IC7B 1M94A 3AU5A 4ZRJA 3WANA 1TGZB 2N7DA 1GG3A 3VHTC 1PQSA 3DDCB 4E74A 4E71A 3AI5A 2MBBB 4NAWB 4RM9A 1GNUA 2IO1B 2LUEA 4MGIE 3QK0A 3UIOB 1KLVA 2KDIA 4K7WA 2UWQA 2IO3B 4GIVA 3OJ3A 4GSWA 2KDEB 1R4MI 3LDZE 3PPAA 4W9CA 1WX8A 2FAZA 2G4SA 2NR2A 3QJZA 5J18A 3CSTA 3V61A 1EUVB 1WJNA 5G55A 3H7PB 2M8SA 2J0JA 4NJ6A 2FCQA 4WWNA 4JIOU 2ZVOA 4EUTA 2JXXA 4MELA 2JPHA 1QZEA 2N4FA 3NOBA 4WJNA 4DDGD 3QIJA 3VDZA 1V86A 3B1LX 4NPNA 3JVZX 2HE7A 1E7UA 2ZVNA 4MH0E 2O2VB 1Y8RC 1F9JA 2V1YA 1NDDA 3H9DA 3M95A 1OGWA 4FA6A 2RGFA 2O2VA 4IWOA 3U8ZA 3V6CB 2FCMA 2RR9A 2C7NB 4MGZE 4EZLA 4NQKE 4W9EA 3ZUNA 1TTNA 2LVPA 2NBVB 3V62A 1L2NA 1E8ZA 3M63B 1IPGA 2JZ3B 2VRRB 2IBIB 4NQLB 4FULA 3JW0X 2L76A 1AARA 3K9OB 1WE7A 4KZCA 5DPTA 2CU1A 2DAJA 4EKUA 4WJPA 3KYCD 2K6QA 2KWVB 1VCBA 4KV2A 3JSVA 3B0AA 2C9WB 3U30A 1NI2A 3JYUA 4WWOA 1WGYA 4HCPB 1IYFA 1WGRA 2KQ7A 3DVNU 4URKA 4PS7A 4PYZA 3A4RA 2C5LC 2DX5B 4RM8A 3WA0A 5DPRA 1Q5WB 1V81A 3KUCB 3M3JA 2D3GA 2MRPA 2N9PC 2PEAA 3PSEB 3ALBA 4DXAB 1TZ1A 2ZNVC 3R7QA 1G6JA 2ASQA 4IW0A 1K8RB 2D11A 4K7SA 4NY0A 3RD2A 4ZDVA 1S1QB 1WR6E 3EFUA 3ZTCA 1WZ3A 2LGDA 1IP9A 2BPSA 1GC7A 4N9F4 1E7VA 3ONSA 2K6DB 1RLFA 1H4RA 4BFRA 2CKHB 3V60A 1WXAA 1YX5B 2MX2A 2KJRA 4ANVA 1LM8B 2IYDB 2KANA 2DYBA 3TIXA 3ZO5B 2YVCA 4KDIC 4MM3A 3QX1A 5AZHA 3NS8A 2L0FA 2PJHA 5FR6A 2KC1A 2MA9B 2YLMA 4PS3A 4WJQA 4HK2A 3SDLC 2IY0B 3W1SC 3UQBA 3WIMA 4IWPA 4TQ0A 2ZCBA 3PGEA 4GN1A 3ZKJC 2DAFA 3APFA 5JZEB 3PRMB 2L00B 2M1MA 2B3AA 1SGHA 4FLHA 1WR1A 4XC2A 2KJ6A 2XBBC 2FIFA 3JSVB 3RCZA 3VVWB 1V9JA 4ICUA 2ZNVB 4ZYNA 3ZLZA 3ZNGC 4JGHB 2CHWA 5CHFA 4WQOB 4FJZA 2G45B 3EC8A 3X23A 2MSED 3N32A 3N3KB 2EMSA 4MDKE 3SD5A 3X0WA 3R7RA 2Z59B 1WM2A 3DVNV 2K8CA 2BF8B 3RZWC 5D7GA 3IVFA 2A4ZA 4GXBA 5CHVC 4LJOB 2BYFA 3ZRCA 2NPTA 5AZFA 4NAWA 3W1YA 1Z5SB 2L0TA 3PS6A 3PREA 1NBFC 1WFYA 3VFKA 3HIZA 2C7HA 2R2QA 4ICVA 1P3QU 1YQBA 1ZKHA 2DHZA 4G50A 4B9KA 1YIWA 2MCNB 3NY5A 3ZTDA 3U7DA 2LRWA 3ZVVA 3PRPB 4EZKA 3UQAA 2I1KA 1WRDB 2LGXA 1E8XA 3N30A 4HXDA 4ANWA 2BYVE 3VAWA 4FADA 4HCNB 1YJ1A 1X1MA 2MW5A 2NCNA 2AWTA 2RSUA 3O65B 1OTRB 2J0KA 5JHBA 3QHTA 3BINA 1R4NI 1V80A 2N1WA 1A5RA 2ZPNA 1U4AA 2NBWB 2R2OA 3UGBB 2MQJA 2JRIB 1WGHA 1XT9B 2Z0EB 2KO3A 1WXSA 3APCA 3DBRI 5E6PA 3KYDD 2ZPYA 4EEWA 1HE8A 2O6VD 4FHKA 3VH4B 2UYZB 5KHQA 2JY6A 1I42A 2QHOA 3DBHI 4GDKB 4DDID 1WGDA 2A5UA 2ZEQA 3AULA 3KUDB 3L16A 4M0WB 3D32A 3WAMA 3L10B 4B95A 2LVQA 3OLMD 2N7EA 3QWZB 3ZNZB 4K81A 3K9PB 3ZIMA 2LXCA 4IWQA 1KJTA 5KHOA 1P1AA 2IO0B 5L95C 3L17A 4TV3A 4BKTA 5DPWA 3NZUA 4NNJB 2N9EB 3R66C 2HJ8A 1GJZA 5LXIB 5GMVA 2CR5A 1ISNA 4A20A 1WY8A 2FCNA 5J17A 3A4SC 2Y5BB 1L7YA 4TUUA 2G4DB 2OJRA 2DZJA 4I6LB 4B6WA 4E3CA 2KX3A 2JF5A 3PHXB 2MBEA 2O6VB 3TBLD 2L3ZA 4BKSA 2GBMA 3TMPB 3ECIA 3VTVA 1WXVA 2KX0A 4EFOA 2IO2B 1LFDA 4K7UA 4W9HA 1BT0A 1UBQA 1JRUA 2ZJDA 3IG3A 4MJSB 3AU4A 3A1QB 4JL9A 3P2BA 3PLUA 4A3OA 1WJ4A 2PPHA 1RRBA 1WH3A 2IZVB 2LRUA 2BYEA 4W9KA 3UIPB 3ZW3A 2D07B 2L8JA 3HM3A 4IM2A 1WF9A 2PE6B 3EECA 3SHQA 3VUWA 3KW5B 4DHJB 4DHZB 3EHVA 3ML9A 1I35A 4I6NB 3PT2B 2OOBB 4CO7A 4IUMB 3WAPA 1WZ0A 2KTRA 3PHWB 5L83A 3PRZA 4FJVB 2ZCCA 4TQ1A 2KNBA 1D3ZA 2XK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FN2 A;  3OAW A;  4G3X B;  3VH3 B;  2BWE S;  2MBQ A;  3RUI B;  2FID A;  3H7S A;  4GDL B;  4II3 B;  4TKN A;  4XZ4 A;  5D94 A;  2LWP A;  3T9L A;  3MJW A;  4K1R B;  5C23 A;  2HTH A;  5BO4 B;  4KSK C;  2BKF A;  4DK5 A;  2CHX A;  3IFW B;  4LCD E;  2KDB A;  2MWS B;  1EF1 A;  3GZN I;  4LDT B;  4GB9 A;  4KZ0 A;  4A3P A;  3A9J B;  2ZZP B;  2DEN B;  1OQY A;  2WYQ A;  2XEW A;  4WWP A;  5AZG A;  3A9K B;  2DYO A;  4W9D A;  2KTF A;  4M8N A;  1WMH A;  3WAL A;  1E5W A;  2V3S A;  2CHZ A;  2Z0D B;  2JRH A;  4OVV A;  4AJY B;  4ANU A;  3MTN B;  2FNJ B;  2LZ6 A;  3A9K A;  2RPQ A;  2GBR A;  2KN5 A;  2J7Q B;  2AEH A;  2BGF A;  3QAQ A;  1J19 A;  1T0Y A;  2KLG A;  3DVG Y;  3KUZ A;  3VUX A;  2GOW A;  3DBL I;  1WXM A;  2KDF B;  1WX7 A;  3A33 B;  4WAA A;  2G3Q B;  2MP2 B;  5IA7 A;  2KWU B;  2BKR B;  2KMA A;  1Q1O A;  3TCA A;  3PVL A;  3DVG X;  2NVU I;  4HPL B;  3CMM B;  4HDO A;  4HVB A;  4BKS D;  2NBU A;  4AWJ A;  2MBO A;  4ZRI A;  2KFK B;  5LLI A;  4KSL C;  1E8Y A;  1RAX A;  4FHJ A;  4EOY A;  1FXT B;  2GBK A;  5IAA C;  3V6E B;  2WX1 A;  2KOX A;  2XK5 B;  2JVC A;  4LDT D;  4F1S A;  2LVO A;  4MGK E;  4ZRK A;  2JZZ A;  2KXJ A;  3PTF C;  3VXW A;  3HM6 X;  3APD A;  4KVG B;  3L13 A;  4II2 B;  1E90 A;  3A1Q A;  4W9F A;  4JQW C;  3R3M A;  3UF8 A;  1ZGU B;  1KM7 A;  4BOS C;  1UD7 A;  5J2R A;  2LXA A;  3SU8 X;  4F7Z A;  1GC6 A;  4DHJ D;  4MJS A;  4MSQ B;  3M62 B;  4XX5 A;  4CHK A;  4KIK A;  2JWZ A;  3QAR A;  2C60 A;  3PZD A;  5DPS A;  3C0R B;  1P98 A;  3H6N A;  2KHW B;  2KLC A;  3ZNI D;  3WAO A;  2EMT A;  1GUA B;  2AL6 A;  4CYE A;  4W9L A;  1VD2 A;  2LI5 A;  3RZF A;  2MP2 A;  4ANX A;  3ML8 A;  4I6P A;  1UBI A;  3I3T B;  1RFA A;  1WE6 A;  1Q0W B;  2KC2 A;  1UEL A;  3QC8 B;  4HWI B;  4IM3 A;  4W9J A;  3AXC A;  1UH6 A;  4GGQ A;  5CX3 A;  1UZX B;  3RYT A;  4DBG A;  3KH0 A;  1UGM A;  4PYU A;  5E6O A;  4M8M A;  2LAS A;  5C1Z A;  1SE9 A;  2C7M B;  4BBN C;  4AJW A;  4BVU C;  2N1V A;  1S3S G;  2BWF A;  2CS4 A;  2KKC A;  2N9X A;  4AUQ C;  4PS8 A;  4NJ7 A;  4AP4 C;  2WWZ A;  4HJK A;  2KK8 A;  3VQI A;  3RT3 B;  2M17 A;  3S2A A;  4JLC A;  3QA8 A;  4GDK A;  1WYW B;  2KTR B;  4F8C B;  2D10 A;  3QCA A;  4HDQ A;  2LGY A;  3HHM A;  3MHS D;  4MSM B;  3H1U A;  3L08 A;  4BOZ B;  2AYO B;  4AOF A;  3DBS A;  5JH5 C;  5HKH A;  2KVR A;  1EO6 A;  4IG7 B;  1XQQ A;  3BY4 B;  2V4L A;  5CHW A;  5E6N A;  2K8B A;  4DHZ E;  2GMI C;  3ZDM C;  2KZR A;  2D2Q A;  1EF5 A;  2GBN A;  2KMC A;  3B08 A;  4ASW C;  1MG8 A;  4MEM A;  3NZS A;  2M4N A;  3KVF B;  2DZI A;  1YD8 U;  4FJY A;  4FBJ B;  4KDL B;  2WDT B;  3NHE B;  5D6J B;  2HD5 B;  3L0W B;  2L05 A;  2KQS A;  2KD0 A;  3W1S A;  3DQV A;  3T8M A;  3CF6 E;  4HLE A;  2MLB A;  3DOW A;  3RUL A;  1V5T A;  1WIA A;  3ENE A;  4GDL A;  1V6E A;  4MGY E;  2EKE C;  2O6V A;  5DCN A;  5JHA A;  2FCS A;  1LQB A;  1H8C A;  4KIK B;  5G2N A;  2NPT B;  2DZM A;  2NS5 A;  1C3T A;  2LD9 A;  3H7P A;  2WX0 A;  3PV1 A;  5EDS A;  4OVU A;  3IBE A;  2JUO A;  2FUH B;  4LJP B;  3ZNH B;  1V5O A;  1CMX B;  2K39 A;  1YX6 B;  1J0G A;  1WJU A;  3GOE A;  4X57 B;  1KOT A;  3PLV A;  1WM3 A;  3Q3J A;  4DWF A;  1WJ6 A;  2KJH B;  2MBH A;  5TR5 A;  2JT4 B;  3VUY A;  2J0M A;  2LJ5 A;  4WJO A;  2DYM A;  3VTU A;  1P9D U;  1LXD A;  3UIN B;  2KFK A;  4P7I A;  1WI0 A;  1OEY A;  1WGG A;  1OEY J;  2IY1 B;  1V49 A;  2AL3 A;  2REX A;  3TL5 A;  4G11 A;  1WX9 A;  4G0N B;  4HPM B;  1XD3 B;  3CSF A;  5LXH A;  1ZW7 A;  2RD0 A;  1E8W A;  3L54 A;  2K8H A;  3IHP C;  1P0R A;  2KFJ A;  3ZDT A;  2L7R A;  1V2Y A;  2GBJ A;  3QQ8 B;  4GU2 A;  4IM0 A;  3Q3F A;  1Z2M A;  1SIF A;  2KWC A;  3OJ4 B;  4BKG A;  3LJ3 A;  2I1J A;  1WMH B;  3TJP A;  1J8C A;  5AEK B;  4W9G A;  2K25 A;  3HK0 A;  3VTW A;  2DZK A;  3DPD A;  5CTR C;  4RMA A;  2M0X A;  2W9N A;  3A9J A;  4GMV A;  4GOC A;  4W9I A;  4EZJ A;  1C1Y B;  2K1F A;  3DCG A;  4BBN F;  2PE9 A;  4J6I A;  3ZRF A;  1TBE A;  4YL8 A;  5D2M B;  4IC7 B;  1M94 A;  3AU5 A;  4ZRJ A;  3WAN A;  1TGZ B;  2N7D A;  1GG3 A;  3VHT C;  1PQS A;  3DDC B;  4E74 A;  4E71 A;  3AI5 A;  2MBB B;  4NAW B;  4RM9 A;  1GNU A;  2IO1 B;  2LUE A;  4MGI E;  3QK0 A;  3UIO B;  1KLV A;  2KDI A;  4K7W A;  2UWQ A;  2IO3 B;  4GIV A;  3OJ3 A;  4GSW A;  2KDE B;  1R4M I;  3LDZ E;  3PPA A;  4W9C A;  1WX8 A;  2FAZ A;  2G4S A;  2NR2 A;  3QJZ A;  5J18 A;  3CST A;  3V61 A;  1EUV B;  1WJN A;  5G55 A;  3H7P B;  2M8S A;  2J0J A;  4NJ6 A;  2FCQ A;  4WWN A;  4JIO U;  2ZVO A;  4EUT A;  2JXX A;  4MEL A;  2JPH A;  1QZE A;  2N4F A;  3NOB A;  4WJN A;  4DDG D;  3QIJ A;  3VDZ A;  1V86 A;  3B1L X;  4NPN A;  3JVZ X;  2HE7 A;  1E7U A;  2ZVN A;  4MH0 E;  2O2V B;  1Y8R C;  1F9J A;  2V1Y A;  1NDD A;  3H9D A;  3M95 A;  1OGW A;  4FA6 A;  2RGF A;  2O2V A;  4IWO A;  3U8Z A;  3V6C B;  2FCM A;  2RR9 A;  2C7N B;  4MGZ E;  4EZL A;  4NQK E;  4W9E A;  3ZUN A;  1TTN A;  2LVP A;  2NBV B;  3V62 A;  1L2N A;  1E8Z A;  3M63 B;  1IPG A;  2JZ3 B;  2VRR B;  2IBI B;  4NQL B;  4FUL A;  3JW0 X;  2L76 A;  1AAR A;  3K9O B;  1WE7 A;  4KZC A;  5DPT A;  2CU1 A;  2DAJ A;  4EKU A;  4WJP A;  3KYC D;  2K6Q A;  2KWV B;  1VCB A;  4KV2 A;  3JSV A;  3B0A A;  2C9W B;  3U30 A;  1NI2 A;  3JYU A;  4WWO A;  1WGY A;  4HCP B;  1IYF A;  1WGR A;  2KQ7 A;  3DVN U;  4URK A;  4PS7 A;  4PYZ A;  3A4R A;  2C5L C;  2DX5 B;  4RM8 A;  3WA0 A;  5DPR A;  1Q5W B;  1V81 A;  3KUC B;  3M3J A;  2D3G A;  2MRP A;  2N9P C;  2PEA A;  3PSE B;  3ALB A;  4DXA B;  1TZ1 A;  2ZNV C;  3R7Q A;  1G6J A;  2ASQ A;  4IW0 A;  1K8R B;  2D11 A;  4K7S A;  4NY0 A;  3RD2 A;  4ZDV A;  1S1Q B;  1WR6 E;  3EFU A;  3ZTC A;  1WZ3 A;  2LGD A;  1IP9 A;  2BPS A;  1GC7 A;  4N9F 4;  1E7V A;  3ONS A;  2K6D B;  1RLF A;  1H4R A;  4BFR A;  2CKH B;  3V60 A;  1WXA A;  1YX5 B;  2MX2 A;  2KJR A;  4ANV A;  1LM8 B;  2IYD B;  2KAN A;  2DYB A;  3TIX A;  3ZO5 B;  2YVC A;  4KDI C;  4MM3 A;  3QX1 A;  5AZH A;  3NS8 A;  2L0F A;  2PJH A;  5FR6 A;  2KC1 A;  2MA9 B;  2YLM A;  4PS3 A;  4WJQ A;  4HK2 A;  3SDL C;  2IY0 B;  3W1S C;  3UQB A;  3WIM A;  4IWP A;  4TQ0 A;  2ZCB A;  3PGE A;  4GN1 A;  3ZKJ C;  2DAF A;  3APF A;  5JZE B;  3PRM B;  2L00 B;  2M1M A;  2B3A A;  1SGH A;  4FLH A;  1WR1 A;  4XC2 A;  2KJ6 A;  2XBB C;  2FIF A;  3JSV B;  3RCZ A;  3VVW B;  1V9J A;  4ICU A;  2ZNV B;  4ZYN A;  3ZLZ A;  3ZNG C;  4JGH B;  2CHW A;  5CHF A;  4WQO B;  4FJZ A;  2G45 B;  3EC8 A;  3X23 A;  2MSE D;  3N32 A;  3N3K B;  2EMS A;  4MDK E;  3SD5 A;  3X0W A;  3R7R A;  2Z59 B;  1WM2 A;  3DVN V;  2K8C A;  2BF8 B;  3RZW C;  5D7G A;  3IVF A;  2A4Z A;  4GXB A;  5CHV C;  4LJO B;  2BYF A;  3ZRC A;  2NPT A;  5AZF A;  4NAW A;  3W1Y A;  1Z5S B;  2L0T A;  3PS6 A;  3PRE A;  1NBF C;  1WFY A;  3VFK A;  3HIZ A;  2C7H A;  2R2Q A;  4ICV A;  1P3Q U;  1YQB A;  1ZKH A;  2DHZ A;  4G50 A;  4B9K A;  1YIW A;  2MCN B;  3NY5 A;  3ZTD A;  3U7D A;  2LRW A;  3ZVV A;  3PRP B;  4EZK A;  3UQA A;  2I1K A;  1WRD B;  2LGX A;  1E8X A;  3N30 A;  4HXD A;  4ANW A;  2BYV E;  3VAW A;  4FAD A;  4HCN B;  1YJ1 A;  1X1M A;  2MW5 A;  2NCN A;  2AWT A;  2RSU A;  3O65 B;  1OTR B;  2J0K A;  5JHB A;  3QHT A;  3BIN A;  1R4N I;  1V80 A;  2N1W A;  1A5R A;  2ZPN A;  1U4A A;  2NBW B;  2R2O A;  3UGB B;  2MQJ A;  2JRI B;  1WGH A;  1XT9 B;  2Z0E B;  2KO3 A;  1WXS A;  3APC A;  3DBR I;  5E6P A;  3KYD D;  2ZPY A;  4EEW A;  1HE8 A;  2O6V D;  4FHK A;  3VH4 B;  2UYZ B;  5KHQ A;  2JY6 A;  1I42 A;  2QHO A;  3DBH I;  4GDK B;  4DDI D;  1WGD A;  2A5U A;  2ZEQ A;  3AUL A;  3KUD B;  3L16 A;  4M0W B;  3D32 A;  3WAM A;  3L10 B;  4B95 A;  2LVQ A;  3OLM D;  2N7E A;  3QWZ B;  3ZNZ B;  4K81 A;  3K9P B;  3ZIM A;  2LXC A;  4IWQ A;  1KJT A;  5KHO A;  1P1A A;  2IO0 B;  5L95 C;  3L17 A;  4TV3 A;  4BKT A;  5DPW A;  3NZU A;  4NNJ B;  2N9E B;  3R66 C;  2HJ8 A;  1GJZ A;  5LXI B;  5GMV A;  2CR5 A;  1ISN A;  4A20 A;  1WY8 A;  2FCN A;  5J17 A;  3A4S C;  2Y5B B;  1L7Y A;  4TUU A;  2G4D B;  2OJR A;  2DZJ A;  4I6L B;  4B6W A;  4E3C A;  2KX3 A;  2JF5 A;  3PHX B;  2MBE A;  2O6V B;  3TBL D;  2L3Z A;  4BKS A;  2GBM A;  3TMP B;  3ECI A;  3VTV A;  1WXV A;  2KX0 A;  4EFO A;  2IO2 B;  1LFD A;  4K7U A;  4W9H A;  1BT0 A;  1UBQ A;  1JRU A;  2ZJD A;  3IG3 A;  4MJS B;  3AU4 A;  3A1Q B;  4JL9 A;  3P2B A;  3PLU A;  4A3O A;  1WJ4 A;  2PPH A;  1RRB A;  1WH3 A;  2IZV B;  2LRU A;  2BYE A;  4W9K A;  3UIP B;  3ZW3 A;  2D07 B;  2L8J A;  3HM3 A;  4IM2 A;  1WF9 A;  2PE6 B;  3EEC A;  3SHQ A;  3VUW A;  3KW5 B;  4DHJ B;  4DHZ B;  3EHV A;  3ML9 A;  1I35 A;  4I6N B;  3PT2 B;  2OOB B;  4CO7 A;  4IUM B;  3WAP A;  1WZ0 A;  2KTR A;  3PHW B;  5L83 A;  3PRZ A;  4FJV B;  2ZCC A;  4TQ1 A;  2KNB A;  1D3Z A;  2XK5 A; 
#chains in the Genus database with same CATH topology
 4G3X B;  2QJL A;  2IPK D;  2BWE S;  2MBQ A;  1MHX A;  3H7S A;  1QF6 A;  5IKC M;  3DWM A;  4XZ4 A;  2LWP A;  5BO4 B;  2BKF A;  2BS4 B;  1JWB D;  1UUP A;  1XLO A;  3B2F A;  4A3P A;  3A9J B;  2DEN B;  1OQY A;  2WYQ A;  2K5P A;  2Q5W D;  1JCK B;  5EE9 A;  2KTF A;  3WAL A;  1ZOY B;  2V3S A;  2CHZ A;  4ANU A;  3MTN B;  3A9K A;  1HEZ E;  2KN5 A;  3Q3M C;  3QAQ A;  3IT6 B;  3CIR B;  4S0R A;  3VUX A;  2GOW A;  2INC C;  1ZP0 B;  2G3Q B;  4LNN A;  1Q1O A;  2WXN A;  3DVG X;  4AWJ A;  4ZRI A;  1E8Y A;  1RAX A;  2GBK A;  2WX1 A;  5C3J B;  2XK5 B;  1DOY A;  4ZRK A;  3PTF C;  3VXW A;  3RMK C;  3EGR A;  1BUI C;  3Q3O C;  2V9H A;  3UF8 A;  2W54 A;  1HZ5 A;  1ZGU B;  1KM7 A;  3TEX A;  4BOS C;  1TKE A;  3SU8 X;  2NMQ A;  4DHJ D;  4MJS A;  3M62 B;  4XX5 A;  4CHK A;  4AS1 A;  2C60 A;  3C0R B;  3H6N A;  2KLC A;  2SAK A;  3WAO A;  1GUA B;  4ANX A;  2MP2 A;  4I6P A;  1D6E C;  1KTK A;  4IM3 A;  4IOI E;  1WSP A;  5CX3 A;  1UZX B;  2MJ3 A;  3I57 A;  3KH0 A;  3RPF C;  1UGM A;  1F2R I;  4BBN C;  4BVU C;  2N1V A;  1S3S G;  1XLP A;  2ICI A;  3EUB 2;  1FCL A;  1DYQ A;  4YSY B;  5HI1 A;  2WXJ A;  4YSX B;  1WYW B;  2KTR B;  2D10 A;  3QCA A;  2LGY A;  2IND C;  4P6V F;  1EWC A;  2AYO B;  5JH5 C;  2QIL A;  4IG7 B;  2LJI A;  2K8B A;  3AE7 B;  2GBN A;  3NZS A;  2DZI A;  2H89 B;  3R8B A;  1IGC A;  4KDL B;  2WDT B;  3NHE B;  1KH0 A;  3N1Z C;  4ZHO A;  2KD0 A;  1RFK A;  3DQV A;  3FAH A;  3T8M A;  3ZXV A;  3CF6 E;  4YTN B;  1NI3 A;  2BS3 B;  2PIA A;  1WIA A;  4GDL A;  1L6V A;  1GPX A;  5JHA A;  3PZ8 A;  4M01 A;  2KT7 A;  3AM9 A;  1C3T A;  1DOI A;  1NEN B;  3PV1 A;  2JUO A;  3ZNH B;  1CMX B;  2K39 A;  2KN4 A;  1WJU A;  4S17 A;  3AE6 B;  3RNF C;  4DWF A;  1WJ6 A;  1TT5 B;  3EA6 A;  2WXF A;  3VUY A;  1Q10 A;  3VTU A;  1P9D U;  1WGG A;  2AL3 A;  4LNK A;  4G11 A;  2ZW1 A;  5LXH A;  1ZW7 A;  3L54 A;  1TIF A;  2LGS A;  2KFJ A;  3QQ8 B;  3Q3F A;  5IOI A;  3W5U B;  1KF6 B;  1J8C A;  3AEA B;  3TJP A;  2K25 A;  1R4N B;  2WDQ B;  3DPD A;  5CTR C;  2M0X A;  3A9J A;  4GMV A;  4GOC A;  4W9I A;  4BBN F;  4J6I A;  3RN9 C;  4YL8 A;  5D2M B;  4IC7 B;  1M94 A;  2IJ0 A;  1FPY A;  3DHH C;  3VR9 B;  2CU3 A;  2MBB B;  2DWQ A;  1CZP A;  4RF0 A;  1SJE D;  3QK0 A;  3RNA C;  3UIO B;  4O1N A;  2WXG A;  2IO3 B;  1KFY B;  2XNA C;  3NS1 A;  1R4M I;  2KAC A;  1L0V B;  1IBX A;  2G4S A;  3CST A;  2J0J A;  3RNC C;  1VZ7 A;  4WWN A;  4IDI A;  2JXX A;  2JPH A;  3AV8 A;  2N4F A;  3NOB A;  5G5G A;  4N6E B;  3J9C A;  3W2D A;  3AE5 B;  1F9J A;  3H9D A;  1YMH E;  2RGF A;  2WXK A;  2O2V A;  4IWO A;  1NYR A;  4RCO A;  2C7N B;  4EZL A;  3HUI A;  2LVP A;  3OG5 A;  4R3D A;  1UF0 A;  1L4D B;  2IBI B;  3JW0 X;  2L76 A;  1AAR A;  2CU1 A;  2ONQ A;  4P1C C;  3DBL B;  3BVM A;  1NI2 A;  1TY0 A;  3AE2 B;  4HCP B;  1IYF A;  1ROE A;  1D4B A;  4PYZ A;  2C5L C;  1F2R C;  2QCZ A;  3P42 A;  1V81 A;  3GZN B;  2N9P C;  1EWY C;  2ZNV C;  5BYQ A;  1WYG A;  4ZDV A;  2BPS A;  3ONS A;  1PUT A;  3RI7 C;  2CKH B;  1WXA A;  4ANV A;  1LM8 B;  3TIX A;  1VZ8 A;  2LUM A;  1PDX A;  1TZO A;  1JML A;  1YQ4 B;  2HJ1 A;  1MVK A;  1V1P A;  3WIM A;  2W3R A;  3VRA B;  1NYQ A;  3PGE A;  3WCQ A;  1XEE A;  5JZE B;  4FXC A;  1WR1 A;  1TKG A;  2ZNV B;  1PGB A;  3ZLZ A;  1N61 A;  4WQO B;  3BVZ A;  3X23 A;  2QEJ C;  3X0W A;  2EMS A;  3SD5 A;  4AQ7 A;  3R7R A;  5HG2 A;  4LNI A;  2JU6 X;  2LHE A;  1HA5 A;  2PVG C;  2BYF A;  3IAS 1;  2NPT A;  1HQR D;  1Z5S B;  1AWD A;  3PS6 A;  1K50 A;  3PRE A;  3VFK A;  1YQB A;  2DHZ A;  4TMA B;  1MPE A;  1BML C;  3R2I A;  4EZK A;  2M19 A;  4ANW A;  2BYV E;  3DBH B;  4FAD A;  3BZD B;  1XO3 A;  4HCN B;  2WS3 B;  4XE0 A;  5JHB A;  3QHT A;  1N63 A;  4MAC A;  3BIN A;  1A5R A;  2MQJ A;  1WGH A;  2PMV A;  2WXL A;  1TS2 A;  1T0S C;  4EEW A;  1EU3 A;  4FHK A;  5KHQ A;  1I42 A;  3DBH I;  4GDK B;  1WGD A;  3BK2 A;  1FXI A;  3WAM A;  4B95 A;  5IN7 A;  3OLM D;  3AEC B;  1I7H A;  2IO0 B;  4USA A;  2LGI A;  3NZU A;  2N9E B;  2HJ8 A;  5GMV A;  4EE2 A;  2KAJ A;  2G4D B;  2OJR A;  3TBL D;  3VTV A;  2KX0 A;  4EFO A;  4A8X C;  3H8H A;  4W9H A;  1BT0 A;  3PLU A;  1L4Z B;  1RRB A;  2LRU A;  1GB1 A;  1VLB A;  3V3X A;  2L8J A;  3HM3 A;  4IM2 A;  3VUW A;  4DHJ B;  3KW5 B;  4DHZ B;  3E56 A;  1I35 A;  3Q8C A;  3W9C B;  4WQM A;  2ZCC A;  4OZB A;  2V3N A;  3VH3 B;  2KWD A;  1L5P A;  4ARC A;  4TKN A;  5D94 A;  5H8Y E;  4KGR A;  3ZGZ A;  2KDB A;  2MWS B;  2UU7 A;  4KZ0 A;  2L52 A;  4WWP A;  2BB6 A;  2DYO A;  4M8N A;  1E5W A;  2Z0D B;  4DXF A;  4AJY B;  1JRP A;  2GBR A;  2AEH A;  4A6Q A;  2KLG A;  3DVG Y;  3GE8 C;  3DBL I;  3A33 B;  2KWU B;  1XXG A;  2B76 B;  2V4I B;  3Q8B A;  4HPL B;  2RDH A;  3CMM B;  4HDO A;  3N1X C;  3P4Q B;  2NBU A;  4C80 A;  5LLI A;  1XF5 L;  5IAA C;  4OW0 A;  5C2T B;  3TSS A;  4F1S A;  3ZJV A;  2JVC A;  1E7P B;  3P63 A;  4MGK E;  2KXJ A;  3HM6 X;  4RGO S;  4II2 B;  1FIQ A;  1FFV A;  1P7F A;  2G1E A;  3R3M A;  5I4D A;  1CJE A;  5HFY A;  3LB8 C;  2L83 A;  4F7Z A;  3FC4 A;  1HTQ A;  1C4C A;  3URY A;  1F1H A;  4CYE A;  1VD2 A;  3ML8 A;  1UBI A;  2GLS A;  2KC2 A;  2WDR B;  3QC8 B;  2MJD A;  3AXC A;  3NZ3 A;  5C1Z A;  1ET9 A;  2C7M B;  4ZRP A;  1YN4 A;  4KGT A;  2BWF A;  2KKC A;  2N9X A;  4M0W A;  1IGD A;  4C00 A;  2WWZ A;  3VQI A;  3S2A A;  3MP9 A;  2I38 A;  4F8C B;  3MHS D;  3H1U A;  1JWU D;  4BOZ B;  2YEP F;  1SBB B;  3MC0 B;  3DBS A;  1V97 A;  1EO6 A;  4H2A A;  5AUK A;  3ZDM C;  4PK1 A;  2D2Q A;  2KMC A;  2M0A A;  3B08 A;  4ITK A;  2M4N A;  4C4V B;  1LO5 D;  4RNA A;  4FJY A;  2HD5 B;  1ET6 A;  2WXH A;  1D5M C;  1SJH D;  1V5T A;  3ENE A;  5DCN A;  2FCS A;  1H8C A;  4WAF A;  2DZM A;  2NS5 A;  2WX0 A;  1L6U A;  3DHG C;  5IO9 A;  1STE A;  2IGG A;  1KOT A;  1WM3 A;  2NTS A;  1VRA B;  1KRH A;  1JRO A;  3U7Z A;  3FIL B;  2J0M A;  2LJ5 A;  3P4P B;  2DYM A;  3UIN B;  2EKI A;  4IKG A;  1WI0 A;  4D2K A;  1V49 A;  1GB4 A;  1V1P B;  1NEK B;  2W82 A;  3SFD B;  2BW2 A;  1WGK A;  3IHP C;  4L2Y A;  1P0R A;  1P7E A;  3ZDT A;  2BB5 A;  4C7Z A;  2L7R A;  1F77 A;  4M00 A;  1Z2M A;  2E6X A;  1HXY D;  1SIF A;  4JX1 C;  4W9G A;  3HK0 A;  1PYW D;  4RMA A;  1WXQ A;  2RDG A;  2PE9 A;  4US9 A;  4HKQ A;  1QOF A;  3I5J C;  2KQ4 X;  3T3N A;  2LUE A;  4MGI E;  1J7A A;  3LDZ E;  2FAZ A;  5J18 A;  3V61 A;  1EUV B;  5G55 A;  3H7P B;  4HRS A;  4NJ6 A;  3N20 C;  4JIO U;  4DQO C;  1QZE A;  3QIJ A;  3VDZ A;  3JVZ X;  2HE7 A;  1Y8R C;  3AE9 B;  2J53 A;  2PVO D;  1V1O A;  1TTN A;  2NBV B;  3V62 A;  3M63 B;  1FM0 D;  1IPG A;  3PZ7 A;  1QOA A;  2JZ3 B;  2EEL A;  4OHJ A;  1YNT E;  2K6Q A;  1VCB A;  3JSV A;  1E9M A;  3B0A A;  3JYU A;  4WWO A;  1WGY A;  2KQ7 A;  3DVN U;  4PS7 A;  3A4R A;  4RM8 A;  3KUC B;  3M3J A;  2D3G A;  1D5Z C;  2MRP A;  2RMM A;  2X8X X;  3R7Q A;  2D11 A;  1S1Q B;  1WR6 E;  3AMZ A;  3C19 A;  1FEH A;  4N9F 4;  2K22 A;  3DWG C;  4HKZ E;  2IYD B;  2KAN A;  3ZO5 B;  2YVC A;  4MM3 A;  1A70 A;  1HZ6 A;  2TSS A;  2L0F A;  2PJH A;  5FR6 A;  2YLM A;  2OED A;  4HK2 A;  4WJQ A;  3SDL C;  3W1S C;  4IWP A;  3Q3N C;  2L00 B;  2M1M A;  1SGH A;  3P1M A;  3RCZ A;  3VVW B;  1V9J A;  4ZYN A;  2RPV A;  1K53 A;  2CHW A;  4FJZ A;  2G45 B;  1FO4 A;  2MSE D;  4MDK E;  4OZA A;  3BYY B;  1WM2 A;  2BF8 B;  4MT5 A;  1LGR A;  3RZW C;  1PFD A;  3IVF A;  4GXB A;  5CHV C;  2BT6 A;  4LJO B;  1DGJ A;  1T3Q A;  1OQQ A;  2PKO A;  3TUO A;  3O13 A;  1NBF C;  4RH6 A;  2MCN B;  2J42 A;  1VR9 A;  3Q6B A;  2I1K A;  3VAW A;  2AWT A;  3O65 B;  1OTR B;  3AE1 B;  1U4A A;  3NRZ A;  3UGB B;  3B2G A;  2Z0E B;  4B0M A;  3DBR I;  2JY6 A;  3DHI C;  1ZXI A;  1AN8 A;  4KX6 B;  1UWM A;  5BYS A;  3QWZ B;  2D3C A;  3ZIM A;  1KJT A;  1P1A A;  4TV3 A;  5DPW A;  3R66 C;  4L23 A;  3W5V B;  1ISN A;  3PO0 A;  5BMG A;  5J17 A;  1N6Z A;  2WXR A;  2Y5B B;  1L7Y A;  4TUU A;  1I4P A;  4XWT A;  4BKS A;  3TMP B;  2IDY A;  2HDE A;  1VZ6 A;  3ZW3 A;  2BYE A;  3UIP B;  2D07 B;  1UNS A;  1IBX B;  3EHV A;  3ML9 A;  4LLG M;  4CO7 A;  3WAP A;  4TQ1 A;  2KNB A;  1YD8 U;  2XK5 A;  4P16 A;  3OAW A;  1XCT L;  3MJ5 A;  1B9R A;  1GAQ B;  4II3 B;  5FR3 A;  3SEB A;  2XN9 C;  3T9L A;  2AQ3 B;  2ON8 A;  3MJW A;  2HTH A;  3IFW B;  2N9K A;  1EF1 A;  3GZN I;  4RF1 A;  4XYC A;  2ZZP B;  2XEW A;  5AZG A;  3A9K B;  4W9D A;  2QIE B;  3N9Y C;  4YTP B;  5D3I B;  1VJK A;  3AE3 B;  2JRH A;  1K51 A;  2YEP B;  1D5X C;  2J52 A;  2FNJ B;  2RPQ A;  3KWV A;  2J7Q B;  2BGF A;  1C77 A;  4RGM A;  1WXM A;  5IA7 A;  1RM6 C;  1Y56 A;  2KMA A;  3TCA A;  3PVL A;  2NVU I;  4BKS D;  4WUR A;  1JWA D;  2KFK B;  2H88 B;  4KSL C;  1CQV A;  4EOY A;  1FNU A;  3U52 E;  4A9A A;  1FXT B;  1MHH E;  3V6E B;  3AN1 A;  2KOX A;  2W55 A;  1J7C A;  2LVO A;  2JZZ A;  5EE1 A;  3L13 A;  2QDF A;  4W9F A;  3P4R B;  1OFF A;  2JZP A;  1UD7 A;  3AB5 A;  3N1Y C;  1SIJ A;  4P1B C;  4KIK A;  4UDU C;  4YT0 B;  1FNW A;  3PZD A;  3RNG C;  1P98 A;  2KHW B;  1RYJ A;  3ZNI D;  4DXG A;  2EMT A;  2AL6 A;  3DBR B;  1WE6 A;  1UEL A;  3SFE B;  3U4E G;  4LNO A;  4W9J A;  1ZXH A;  4GGQ A;  2KYW A;  1ZE3 D;  5IP4 D;  3SR6 A;  3E9S A;  4PYU A;  5E6O A;  4M8M A;  5EE3 A;  1SE9 A;  4AJW A;  1OQR A;  4PS8 A;  4ZOH C;  2KK8 A;  2PLP A;  4JLC A;  2MEK A;  3NG0 A;  3Q8F A;  3HHM A;  2AQ2 B;  4MSM B;  4KGS A;  2WHI A;  3I63 C;  5HKH A;  2BVC A;  3NVW A;  3Q2A C;  1XQQ A;  3MC9 A;  4DHZ E;  2KZR A;  1EF5 A;  1XCQ L;  1MG8 A;  4MEM A;  3NVV A;  1N5X A;  4FBJ B;  3Q8E A;  2BBC A;  3L0W B;  2L05 A;  2KQS A;  2LMC A;  3AED B;  1R4M B;  3AEB B;  2D3B A;  4HRO A;  3V05 A;  3GS2 A;  4HLE A;  3RUL A;  4MM3 B;  2EKE C;  2GB1 A;  4KIK B;  5EDS A;  2V3P A;  4OVU A;  2OHF A;  2FUH B;  1SE3 A;  1YX6 B;  3GOE A;  2K3U A;  3Q3J A;  4QAY A;  2AX5 A;  2MBH A;  3P4S B;  5TR5 A;  1YN5 A;  4WJO A;  3ZYY X;  1SE2 A;  2KFK A;  3R2T A;  3HRD D;  1OEY J;  1FXA A;  3TL5 A;  4G0N B;  4HPM B;  1XD3 B;  3LXF A;  3CSF A;  2RD0 A;  1E8W A;  1ACC A;  1V2Y A;  4GU2 A;  5H92 C;  3ZXR A;  4LK0 M;  2KWC A;  4BKG A;  3LJ3 A;  5AEK B;  3VTW A;  1QQR A;  4EZJ A;  2K1F A;  3DCG A;  4XDD A;  2PTL A;  5FKA C;  1FFU A;  3I9V 1;  3AU5 A;  4ZRJ A;  3WAN A;  1TGZ B;  2KDM A;  3VHT C;  1PQS A;  3DDC B;  2DLB A;  4NAW B;  3AI5 A;  1TS3 A;  3ABV B;  2KMM A;  2IO1 B;  4ZYS A;  5MPO A;  1KLV A;  1MG4 A;  4K7W A;  4GIV A;  3PPA A;  2FBW B;  2NR2 A;  3QJZ A;  1C9F A;  1WJN A;  2M8S A;  1FNV A;  3AH7 A;  1PGA A;  2ZVO A;  4EUT A;  4MEL A;  4DDG D;  4RGT A;  2WDV B;  4XGA B;  2ZVN A;  3ZQ4 A;  2V1Y A;  4NZL B;  3M95 A;  1OGW A;  4FA6 A;  1AW7 A;  1I4R A;  3NUH B;  3V6C B;  2RR9 A;  1TYG B;  4NQK E;  2KVZ A;  4W9E A;  2LFI A;  1C78 A;  2VRR B;  4NQL B;  4FUL A;  5DPT A;  4EKU A;  4B0E A;  2DAJ A;  4WJP A;  4KV2 A;  3U30 A;  1WGR A;  2DX5 B;  2VH2 A;  5DPR A;  1TKY A;  2PEA A;  3PSE B;  2V0G A;  2D5G A;  3ALB A;  1E6E B;  4GLS C;  1TZ1 A;  1G6J A;  2ASQ A;  1K8R B;  3ZTC A;  3EFU A;  2K6D B;  1RLF A;  4BFR A;  1YX5 B;  2MX2 A;  1FMA D;  4US8 A;  4KDI C;  5AZH A;  2KC1 A;  2MA9 B;  4PS3 A;  1I4G A;  2IY0 B;  3FIL A;  3UQB A;  3L4P A;  3AEE B;  4TQ0 A;  1AYF A;  4GN1 A;  3ZKJ C;  3APF A;  2XBB C;  3MC8 A;  2FIF A;  4ICU A;  1SXT A;  1FRR A;  2X38 A;  1F52 A;  3GP7 A;  1ZUD 2;  2IGH A;  3N32 A;  2FE8 A;  2QC8 A;  3DVN V;  2BTE A;  3ETR A;  3GE3 C;  3ZRC A;  4NAW A;  2WGS A;  3W1Y A;  2MJE A;  2L0T A;  2C7H A;  1JW9 D;  2R2Q A;  1ZKH A;  4B9K A;  4C4V A;  2ZW0 A;  3NY5 A;  4RFB A;  2INP E;  3PRP B;  1WRD B;  3N30 A;  1N60 A;  1DOX A;  2MW5 A;  3Q14 C;  3ZJT A;  4YXD B;  1R4N I;  1V80 A;  4K3C A;  2JRI B;  1XT9 B;  1WXS A;  2KO3 A;  2N7J A;  3APC A;  5E6P A;  2ZPY A;  1HE8 A;  1T6B X;  1MFW A;  2UYZ B;  2Z8L A;  4M02 A;  1TY2 A;  4DDI D;  4XDC A;  2ZEQ A;  3KUD B;  3AUL A;  3L16 A;  4M0W B;  1I4Q A;  2LVQ A;  3ZNZ B;  2LXC A;  5GXG B;  5KHO A;  3LYY A;  3L17 A;  4BKT A;  1YN3 A;  5BMH A;  1J7B A;  4MH8 A;  3TEY A;  2JSV X;  4WWM A;  4A20 A;  2FCN A;  2DNF A;  4I6L B;  1HTO A;  4B6W A;  2KX3 A;  1SSN A;  2L3Z A;  2GBM A;  2G9H D;  1LFD A;  1UBQ A;  1JRU A;  3IG3 A;  3AU4 A;  3A1Q B;  4JL9 A;  4A3O A;  1WH3 A;  2IZV B;  3EEC A;  4LTU A;  3PT2 B;  2KTR A;  3PHW B;  4BAX A;  3PRZ A;  4FJV B;  1D3Z A;  4REZ A;  2N0S B;  4FN2 A;  1TS4 A;  4WH4 A;  3RUI B;  2FID A;  4GDL B;  4K1R B;  5C23 A;  1N5W A;  1VDV A;  4KSK C;  4L1B A;  5FK9 C;  4DK5 A;  2CHX A;  4LCD E;  4LDT B;  4GB9 A;  3AEF B;  3RNE C;  1I4H A;  2Y5C A;  4JWS C;  1UGJ A;  1WMH A;  3AEG B;  5HHD G;  4OVV A;  2WXP A;  3Q8A A;  1QLB B;  2LZ6 A;  4ACF A;  2E3T A;  3NVZ A;  3RNB C;  1J19 A;  1T0Y A;  3KUZ A;  4WAA A;  2KDF B;  1WX7 A;  2MP2 B;  3BII D;  4N59 A;  2BKR B;  1RWS A;  3C8Y A;  4HVB A;  2CJN A;  2MBO A;  4FHJ A;  1YJJ A;  2AQ1 B;  2IGD A;  5LNK 1;  4LDT D;  2BS2 B;  1FRD A;  3TEZ A;  4NJC A;  3APD A;  4KVG B;  1E90 A;  3A1Q A;  1QKZ A;  4JQW C;  4A90 A;  5J2R A;  4ZHP A;  2LXA A;  1GC6 A;  4MSQ B;  2CJO A;  2JWZ A;  3QAR A;  1GOZ A;  2W3S A;  4C56 C;  5DPS A;  1ZDX A;  3IXS A;  4LNF A;  4W9L A;  3RZF A;  2LI5 A;  1T5X D;  1C79 A;  3I3T B;  1RFA A;  1Q0W B;  4HWI B;  1UH6 A;  3KWL A;  3RYT A;  4DBG A;  4WIP A;  1SEB D;  2LAS A;  2SEB D;  1KLU D;  2CS4 A;  4AUQ C;  2ACZ B;  4NJ7 A;  3HVD A;  4AP4 C;  2K0P A;  4HJK A;  3TEW A;  3RT3 B;  1FCC C;  2M17 A;  2BQQ A;  3QA8 A;  4GDK A;  2Y3A A;  3AE8 B;  3BWU D;  4HDQ A;  2WXQ A;  2WLB A;  3OWE B;  3L08 A;  4AOF A;  1XLQ A;  2KVR A;  3BY4 B;  1E0Z A;  2V4L A;  4J3O D;  5CHW A;  5E6N A;  2RDB C;  2GMI C;  2QMT A;  4Q2J A;  4ASW C;  3KVF B;  4A55 A;  1XLN A;  5D6J B;  5BMI A;  1B1Z A;  3NVY A;  1C4A A;  4XWW A;  2D3A A;  3W1S A;  2MLB A;  3DOW A;  4MGY E;  1V6E A;  3FKY A;  2O6V A;  1LQB A;  1IUE A;  2I2Y A;  5G2N A;  2NPT B;  2LD9 A;  3H7P A;  4HJG E;  3IBE A;  1J0G A;  4LJP B;  1V5O A;  4X57 B;  1ZPS A;  3PLV A;  1JWM D;  1YOV B;  1QT9 A;  1NVI D;  2KJH B;  4JPS A;  2JT4 B;  1SF0 A;  2WXM A;  1ENF A;  5G5H A;  1LXD A;  4P7I A;  1OEY A;  4KKJ A;  2IY1 B;  2VH1 A;  2REX A;  1WX9 A;  2K8H A;  2JWU A;  2WU5 B;  2VZK D;  2WXI A;  2GBJ A;  3BYT B;  4CQN A;  2K9X A;  4IM0 A;  3BVG A;  3OJ4 B;  2I1J A;  1WMH B;  1N62 A;  2DZK A;  4NAM A;  2W9N A;  2WU2 B;  5D3D A;  1C1Y B;  1EU4 A;  1YJI A;  2JX5 A;  2QSD A;  3ZRF A;  1TBE A;  1T0Q C;  1JQ4 A;  2FUG 1;  2N7D A;  1GG3 A;  4E74 A;  4E71 A;  2J4X A;  2LEK A;  4RM9 A;  1GNU A;  3CWI A;  3RFZ B;  2KDI A;  2VZK B;  2UWQ A;  3T3O A;  3OJ3 A;  4GSW A;  2KDE B;  4W9C A;  3MHZ A;  1WX8 A;  1QIL A;  1F0Z A;  2FCQ A;  1TJE A;  4WJN A;  4YWG G;  1V86 A;  3B1L X;  4NPN A;  1E7U A;  4MH0 E;  2L32 A;  2O2V B;  1R7S A;  2Y5P A;  3B9J A;  1NDD A;  2JYE A;  3U8Z A;  2FCM A;  4MGZ E;  3ZUN A;  3ZJU A;  1L2N A;  1E8Z A;  1QOG A;  2INN E;  3IT4 B;  1V8C A;  4KZC A;  3K9O B;  1WE7 A;  4YTM B;  1YQ3 B;  4JE3 B;  3KYC D;  2KWV B;  2M56 B;  2C9W B;  4URK A;  1KLG D;  1JAL A;  3WA0 A;  4YSZ B;  1Q5W B;  2NTT A;  2HTM E;  1ZDV A;  3KQ4 A;  4DXA B;  5T8I A;  4IW0 A;  4NY0 A;  4K7S A;  3RD2 A;  1IP9 A;  1WZ3 A;  2LGD A;  3BK1 A;  1GC7 A;  1T0R C;  3U2S C;  1E7V A;  1H4R A;  3V60 A;  2KJR A;  2DYB A;  1E10 A;  3QX1 A;  2WP9 B;  3NS8 A;  2LHD A;  1ESF A;  1SE4 A;  2ZCB A;  2DAF A;  4RGN A;  3PRM B;  2B3A A;  1MJD A;  4FLH A;  4N58 A;  2KJ6 A;  3JSV B;  4XC2 A;  2WQY B;  4JWU C;  2JQR B;  5EE0 A;  2DBY A;  3ZNG C;  4JGH B;  5CHF A;  1SB3 C;  2JYT A;  3HVZ A;  3EC8 A;  2N9L A;  1WRI A;  3N3K B;  4HPP A;  1JWS D;  1L0X B;  1UWX A;  2Z59 B;  2K8C A;  5D7G A;  2A4Z A;  5BYR A;  5AZF A;  1WFY A;  3HIZ A;  4ICV A;  4G50 A;  1P3Q U;  3MFG A;  1YIW A;  3ZTD A;  3U7D A;  1PGX A;  1WWT A;  2R61 A;  2LRW A;  3ZVV A;  3UQA A;  4HXD A;  2LGX A;  1E8X A;  4ARI A;  1FD6 A;  3EFC A;  4TSS A;  2GI9 A;  1YJ1 A;  1X1M A;  1L0Y B;  2NCN A;  2RSU A;  2J0K A;  1QOB A;  2N1W A;  2ZPN A;  2NBW B;  2R2O A;  4HEA 1;  2JXT A;  3KYD D;  2O6V D;  3GB1 A;  3VH4 B;  1MI0 A;  5E6J A;  4C7Y A;  2QHO A;  2MH7 A;  1BXT A;  2A5U A;  5AUI A;  2OJW A;  1K52 A;  3D32 A;  3L10 B;  1I4X A;  2N7E A;  4KKI A;  4K81 A;  3K9P B;  4OZC A;  5TSS A;  4IWQ A;  3IAM 1;  5L95 C;  4NNJ B;  1EM7 A;  1GJZ A;  5LXI B;  2CR5 A;  1WY8 A;  2MHJ A;  4OVZ A;  3A4S C;  2DZJ A;  4E3C A;  2JF5 A;  3KLS X;  1C4P A;  3PHX B;  2MBE A;  2O6V B;  1M4V A;  3ECI A;  1WXV A;  2IO2 B;  2WNM A;  4K7U A;  4PT5 A;  2WXO A;  2L1A A;  3UI3 A;  2BYT A;  2ZJD A;  4MJS B;  4BZA A;  3VR8 B;  3P2B A;  1WJ4 A;  2PPH A;  4ZRQ A;  4W9K A;  1CK1 A;  1C76 A;  5JXV A;  3Q69 A;  1WF9 A;  3VRB B;  2GRI A;  2PE6 B;  3SHQ A;  1TS5 A;  2PW9 A;  4I6N B;  3NJT A;  2OOB B;  4IUM B;  1WZ0 A;  5L83 A;  3AE4 B;  4K3B A; 
#chains in the Genus database with same CATH homology
 4FN2 A;  3OAW A;  4G3X B;  3VH3 B;  2BWE S;  2MBQ A;  3RUI B;  2FID A;  3H7S A;  4GDL B;  4II3 B;  4TKN A;  4XZ4 A;  5D94 A;  2LWP A;  3T9L A;  3MJW A;  4K1R B;  5C23 A;  2HTH A;  5BO4 B;  4KSK C;  2BKF A;  4DK5 A;  2CHX A;  3IFW B;  4LCD E;  2KDB A;  2MWS B;  1EF1 A;  3GZN I;  4LDT B;  4GB9 A;  4KZ0 A;  4A3P A;  3A9J B;  2ZZP B;  2DEN B;  1OQY A;  2WYQ A;  2XEW A;  4WWP A;  5AZG A;  3A9K B;  2DYO A;  4W9D A;  2KTF A;  4M8N A;  1WMH A;  3WAL A;  1E5W A;  2V3S A;  2CHZ A;  2Z0D B;  2JRH A;  4OVV A;  4AJY B;  4ANU A;  3MTN B;  2FNJ B;  2LZ6 A;  3A9K A;  2RPQ A;  2GBR A;  2KN5 A;  2J7Q B;  2AEH A;  2BGF A;  3QAQ A;  1J19 A;  1T0Y A;  2KLG A;  3DVG Y;  3KUZ A;  3VUX A;  2GOW A;  3DBL I;  1WXM A;  2KDF B;  1WX7 A;  3A33 B;  4WAA A;  2G3Q B;  2MP2 B;  5IA7 A;  2KWU B;  2BKR B;  2KMA A;  1Q1O A;  3TCA A;  3PVL A;  3DVG X;  2NVU I;  4HPL B;  3CMM B;  4HDO A;  4HVB A;  4BKS D;  2NBU A;  4AWJ A;  2MBO A;  4ZRI A;  2KFK B;  5LLI A;  4KSL C;  1E8Y A;  1RAX A;  4FHJ A;  4EOY A;  1FXT B;  2GBK A;  5IAA C;  3V6E B;  2WX1 A;  2KOX A;  2XK5 B;  2JVC A;  4LDT D;  4F1S A;  2LVO A;  4MGK E;  4ZRK A;  2JZZ A;  2KXJ A;  3PTF C;  3VXW A;  3HM6 X;  3APD A;  4KVG B;  3L13 A;  4II2 B;  1E90 A;  3A1Q A;  4W9F A;  4JQW C;  3R3M A;  3UF8 A;  1ZGU B;  1KM7 A;  4BOS C;  1UD7 A;  5J2R A;  2LXA A;  3SU8 X;  4F7Z A;  1GC6 A;  4DHJ D;  4MJS A;  4MSQ B;  3M62 B;  4XX5 A;  4CHK A;  4KIK A;  2JWZ A;  3QAR A;  2C60 A;  3PZD A;  5DPS A;  3C0R B;  1P98 A;  3H6N A;  2KHW B;  2KLC A;  3ZNI D;  3WAO A;  2EMT A;  1GUA B;  2AL6 A;  4CYE A;  4W9L A;  1VD2 A;  2LI5 A;  3RZF A;  2MP2 A;  4ANX A;  3ML8 A;  4I6P A;  1UBI A;  3I3T B;  1RFA A;  1WE6 A;  1Q0W B;  2KC2 A;  1UEL A;  3QC8 B;  4HWI B;  4IM3 A;  4W9J A;  3AXC A;  1UH6 A;  4GGQ A;  5CX3 A;  1UZX B;  3RYT A;  4DBG A;  3KH0 A;  1UGM A;  4PYU A;  5E6O A;  4M8M A;  2LAS A;  5C1Z A;  1SE9 A;  2C7M B;  4BBN C;  4AJW A;  4BVU C;  2N1V A;  1S3S G;  2BWF A;  2CS4 A;  2KKC A;  2N9X A;  4AUQ C;  4PS8 A;  4NJ7 A;  4AP4 C;  2WWZ A;  4HJK A;  2KK8 A;  3VQI A;  3RT3 B;  2M17 A;  3S2A A;  4JLC A;  3QA8 A;  4GDK A;  1WYW B;  2KTR B;  4F8C B;  2D10 A;  3QCA A;  4HDQ A;  2LGY A;  3HHM A;  3MHS D;  4MSM B;  3H1U A;  3L08 A;  4BOZ B;  2AYO B;  4AOF A;  3DBS A;  5JH5 C;  5HKH A;  2KVR A;  1EO6 A;  4IG7 B;  1XQQ A;  3BY4 B;  2V4L A;  5CHW A;  5E6N A;  2K8B A;  4DHZ E;  2GMI C;  3ZDM C;  2KZR A;  2D2Q A;  1EF5 A;  2GBN A;  2KMC A;  3B08 A;  4ASW C;  1MG8 A;  4MEM A;  3NZS A;  2M4N A;  3KVF B;  2DZI A;  1YD8 U;  4FJY A;  4FBJ B;  4KDL B;  2WDT B;  3NHE B;  5D6J B;  2HD5 B;  3L0W B;  2L05 A;  2KQS A;  2KD0 A;  3W1S A;  3DQV A;  3T8M A;  3CF6 E;  4HLE A;  2MLB A;  3DOW A;  3RUL A;  1V5T A;  1WIA A;  3ENE A;  4GDL A;  1V6E A;  4MGY E;  2EKE C;  2O6V A;  5DCN A;  5JHA A;  2FCS A;  1LQB A;  1H8C A;  4KIK B;  5G2N A;  2NPT B;  2DZM A;  2NS5 A;  1C3T A;  2LD9 A;  3H7P A;  2WX0 A;  3PV1 A;  5EDS A;  4OVU A;  3IBE A;  2JUO A;  2FUH B;  4LJP B;  3ZNH B;  1V5O A;  1CMX B;  2K39 A;  1YX6 B;  1J0G A;  1WJU A;  3GOE A;  4X57 B;  1KOT A;  3PLV A;  1WM3 A;  3Q3J A;  4DWF A;  1WJ6 A;  2KJH B;  2MBH A;  5TR5 A;  2JT4 B;  3VUY A;  2J0M A;  2LJ5 A;  4WJO A;  2DYM A;  3VTU A;  1P9D U;  1LXD A;  3UIN B;  2KFK A;  4P7I A;  1WI0 A;  1OEY A;  1WGG A;  1OEY J;  2IY1 B;  1V49 A;  2AL3 A;  2REX A;  3TL5 A;  4G11 A;  1WX9 A;  4G0N B;  4HPM B;  1XD3 B;  3CSF A;  5LXH A;  1ZW7 A;  2RD0 A;  1E8W A;  3L54 A;  2K8H A;  3IHP C;  1P0R A;  2KFJ A;  3ZDT A;  2L7R A;  1V2Y A;  2GBJ A;  3QQ8 B;  4GU2 A;  4IM0 A;  3Q3F A;  1Z2M A;  1SIF A;  2KWC A;  3OJ4 B;  4BKG A;  3LJ3 A;  2I1J A;  1WMH B;  3TJP A;  1J8C A;  5AEK B;  4W9G A;  2K25 A;  3HK0 A;  3VTW A;  2DZK A;  3DPD A;  5CTR C;  4RMA A;  2M0X A;  2W9N A;  3A9J A;  4GMV A;  4GOC A;  4W9I A;  4EZJ A;  1C1Y B;  2K1F A;  3DCG A;  4BBN F;  2PE9 A;  4J6I A;  3ZRF A;  1TBE A;  4YL8 A;  5D2M B;  4IC7 B;  1M94 A;  3AU5 A;  4ZRJ A;  3WAN A;  1TGZ B;  2N7D A;  1GG3 A;  3VHT C;  1PQS A;  3DDC B;  4E74 A;  4E71 A;  3AI5 A;  2MBB B;  4NAW B;  4RM9 A;  1GNU A;  2IO1 B;  2LUE A;  4MGI E;  3QK0 A;  3UIO B;  1KLV A;  2KDI A;  4K7W A;  2UWQ A;  2IO3 B;  4GIV A;  3OJ3 A;  4GSW A;  2KDE B;  1R4M I;  3LDZ E;  3PPA A;  4W9C A;  1WX8 A;  2FAZ A;  2G4S A;  2NR2 A;  3QJZ A;  5J18 A;  3CST A;  3V61 A;  1EUV B;  1WJN A;  5G55 A;  3H7P B;  2M8S A;  2J0J A;  4NJ6 A;  2FCQ A;  4WWN A;  4JIO U;  2ZVO A;  4EUT A;  2JXX A;  4MEL A;  2JPH A;  1QZE A;  2N4F A;  3NOB A;  4WJN A;  4DDG D;  3QIJ A;  3VDZ A;  1V86 A;  3B1L X;  4NPN A;  3JVZ X;  2HE7 A;  1E7U A;  2ZVN A;  4MH0 E;  2O2V B;  1Y8R C;  1F9J A;  2V1Y A;  1NDD A;  3H9D A;  3M95 A;  1OGW A;  4FA6 A;  2RGF A;  2O2V A;  4IWO A;  3U8Z A;  3V6C B;  2FCM A;  2RR9 A;  2C7N B;  4MGZ E;  4EZL A;  4NQK E;  4W9E A;  3ZUN A;  1TTN A;  2LVP A;  2NBV B;  3V62 A;  1L2N A;  1E8Z A;  3M63 B;  1IPG A;  2JZ3 B;  2VRR B;  2IBI B;  4NQL B;  4FUL A;  3JW0 X;  2L76 A;  1AAR A;  3K9O B;  1WE7 A;  4KZC A;  5DPT A;  2CU1 A;  2DAJ A;  4EKU A;  4WJP A;  3KYC D;  2K6Q A;  2KWV B;  1VCB A;  4KV2 A;  3JSV A;  3B0A A;  2C9W B;  3U30 A;  1NI2 A;  3JYU A;  4WWO A;  1WGY A;  4HCP B;  1IYF A;  1WGR A;  2KQ7 A;  3DVN U;  4URK A;  4PS7 A;  4PYZ A;  3A4R A;  2C5L C;  2DX5 B;  4RM8 A;  3WA0 A;  5DPR A;  1Q5W B;  1V81 A;  3KUC B;  3M3J A;  2D3G A;  2MRP A;  2N9P C;  2PEA A;  3PSE B;  3ALB A;  4DXA B;  1TZ1 A;  2ZNV C;  3R7Q A;  1G6J A;  2ASQ A;  4IW0 A;  1K8R B;  2D11 A;  4K7S A;  4NY0 A;  3RD2 A;  4ZDV A;  1S1Q B;  1WR6 E;  3EFU A;  3ZTC A;  1WZ3 A;  2LGD A;  1IP9 A;  2BPS A;  1GC7 A;  4N9F 4;  1E7V A;  3ONS A;  2K6D B;  1RLF A;  1H4R A;  4BFR A;  2CKH B;  3V60 A;  1WXA A;  1YX5 B;  2MX2 A;  2KJR A;  4ANV A;  1LM8 B;  2IYD B;  2KAN A;  2DYB A;  3TIX A;  3ZO5 B;  2YVC A;  4KDI C;  4MM3 A;  3QX1 A;  5AZH A;  3NS8 A;  2L0F A;  2PJH A;  5FR6 A;  2KC1 A;  2MA9 B;  2YLM A;  4PS3 A;  4WJQ A;  4HK2 A;  3SDL C;  2IY0 B;  3W1S C;  3UQB A;  3WIM A;  4IWP A;  4TQ0 A;  2ZCB A;  3PGE A;  4GN1 A;  3ZKJ C;  2DAF A;  3APF A;  5JZE B;  3PRM B;  2L00 B;  2M1M A;  2B3A A;  1SGH A;  4FLH A;  1WR1 A;  4XC2 A;  2KJ6 A;  2XBB C;  2FIF A;  3JSV B;  3RCZ A;  3VVW B;  1V9J A;  4ICU A;  2ZNV B;  4ZYN A;  3ZLZ A;  3ZNG C;  4JGH B;  2CHW A;  5CHF A;  4WQO B;  4FJZ A;  2G45 B;  3EC8 A;  3X23 A;  2MSE D;  3N32 A;  3N3K B;  2EMS A;  4MDK E;  3SD5 A;  3X0W A;  3R7R A;  2Z59 B;  1WM2 A;  3DVN V;  2K8C A;  2BF8 B;  3RZW C;  5D7G A;  3IVF A;  2A4Z A;  4GXB A;  5CHV C;  4LJO B;  2BYF A;  3ZRC A;  2NPT A;  5AZF A;  4NAW A;  3W1Y A;  1Z5S B;  2L0T A;  3PS6 A;  3PRE A;  1NBF C;  1WFY A;  3VFK A;  3HIZ A;  2C7H A;  2R2Q A;  4ICV A;  1P3Q U;  1YQB A;  1ZKH A;  2DHZ A;  4G50 A;  4B9K A;  1YIW A;  2MCN B;  3NY5 A;  3ZTD A;  3U7D A;  2LRW A;  3ZVV A;  3PRP B;  4EZK A;  3UQA A;  2I1K A;  1WRD B;  2LGX A;  1E8X A;  3N30 A;  4HXD A;  4ANW A;  2BYV E;  3VAW A;  4FAD A;  4HCN B;  1YJ1 A;  1X1M A;  2MW5 A;  2NCN A;  2AWT A;  2RSU A;  3O65 B;  1OTR B;  2J0K A;  5JHB A;  3QHT A;  3BIN A;  1R4N I;  1V80 A;  2N1W A;  1A5R A;  2ZPN A;  1U4A A;  2NBW B;  2R2O A;  3UGB B;  2MQJ A;  2JRI B;  1WGH A;  1XT9 B;  2Z0E B;  2KO3 A;  1WXS A;  3APC A;  3DBR I;  5E6P A;  3KYD D;  2ZPY A;  4EEW A;  1HE8 A;  2O6V D;  4FHK A;  3VH4 B;  2UYZ B;  5KHQ A;  2JY6 A;  1I42 A;  2QHO A;  3DBH I;  4GDK B;  4DDI D;  1WGD A;  2A5U A;  2ZEQ A;  3AUL A;  3KUD B;  3L16 A;  4M0W B;  3D32 A;  3WAM A;  3L10 B;  4B95 A;  2LVQ A;  3OLM D;  2N7E A;  3QWZ B;  3ZNZ B;  4K81 A;  3K9P B;  3ZIM A;  2LXC A;  4IWQ A;  1KJT A;  5KHO A;  1P1A A;  2IO0 B;  5L95 C;  3L17 A;  4TV3 A;  4BKT A;  5DPW A;  3NZU A;  4NNJ B;  2N9E B;  3R66 C;  2HJ8 A;  1GJZ A;  5LXI B;  5GMV A;  2CR5 A;  1ISN A;  4A20 A;  1WY8 A;  2FCN A;  5J17 A;  3A4S C;  2Y5B B;  1L7Y A;  4TUU A;  2G4D B;  2OJR A;  2DZJ A;  4I6L B;  4B6W A;  4E3C A;  2KX3 A;  2JF5 A;  3PHX B;  2MBE A;  2O6V B;  3TBL D;  2L3Z A;  4BKS A;  2GBM A;  3TMP B;  3ECI A;  3VTV A;  1WXV A;  2KX0 A;  4EFO A;  2IO2 B;  1LFD A;  4K7U A;  4W9H A;  1BT0 A;  1UBQ A;  1JRU A;  2ZJD A;  3IG3 A;  4MJS B;  3AU4 A;  3A1Q B;  4JL9 A;  3P2B A;  3PLU A;  4A3O A;  1WJ4 A;  2PPH A;  1RRB A;  1WH3 A;  2IZV B;  2LRU A;  2BYE A;  4W9K A;  3UIP B;  3ZW3 A;  2D07 B;  2L8J A;  3HM3 A;  4IM2 A;  1WF9 A;  2PE6 B;  3EEC A;  3SHQ A;  3VUW A;  3KW5 B;  4DHJ B;  4DHZ B;  3EHV A;  3ML9 A;  1I35 A;  4I6N B;  3PT2 B;  2OOB B;  4CO7 A;  4IUM B;  3WAP A;  1WZ0 A;  2KTR A;  3PHW B;  5L83 A;  3PRZ A;  4FJV B;  2ZCC A;  4TQ1 A;  2KNB A;  1D3Z A;  2XK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...