1KTKA

Complex of streptococcal pyrogenic enterotoxin c (spec) with a human t cell receptor beta chain (vbeta2.1)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
203
Chain Sequence
KKDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Exotoxin type C
publication title Structures of two streptococcal superantigens bound to TCR beta chains reveal diversity in the architecture of T cell signaling complexes.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 50
structure length 203
sequence length 206
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ktkA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ktkA01
1I4GA 1TS3A 1SBBB 3BYYB 1RD9D 1BCPF 2AQ1B 1D5ZC 5D3DA 3BVZA 1LTSD 1I4RA 3W2DA 1RDPD 1SJED 1XXGA 1PRTB 4RGNA 2NTSA 1UUPA 5D3IB 1CHQD 1I4XA 4ZYSA 2XRQD 4DXGA 1EFID 3R2IA 1XTCD 3TSSA 1TS5A 1PTOD 1D6EC 1LTAD 2RDGA 4RGMA 1HXYD 1QILA 4RHRA 1ET9A 4L63B 5ELBA 1BCPC 1PTOB 1JWMD 1S5DD 1JQYD 2G9HD 1PTOH 1D5MC 1G8ZD 1TY2A 3DWPA 2IJ0A 1F77A 3GP7A 3MFGA 1I4PA 3CHBD 2AQ2B 4BWGB 1JWUD 1PZJD 4OHJA 1TY0A 2R61A 1AN8A 1ESFA 2XNAC 1YN3A 4NZLB 1BCPD 1CQVA 5TSSA 1LTRD 1JR0D 1S5ED 2J4XA 1TS4A 1MD2D 2CHBD 1S5BD 2XN9C 2Z8LA 1EEFD 1BXTA 1I4QA 3OWEB 1EU4A 4L6TB 4Z9CB 1BCPB 2NTTA 2WV6D 5FK9C 5ELCA 3SEBA 3R8BA 1JWSD 1EU3A 1D5XC 1YN4A 1CK1A 1SE3A 4RFBA 1CT1D 1PTOF 1STEA 2RDHA 3V05A 1LO5D 4TSSA 1FNWA 4RH6A 5I4DA 1EEID 1YN5A 1RF2D 1HQRD 3KLSX 3BVGA 1LLRD 1HA5A 3DWAA 2ICIA 3MC0B 1B1ZA 1UNSA 4RCOA 1KLUD 2QILA 1EWCA 1AW7A 1GOZA 1KLGD 1PRTF 1SEBD 2QEJC 1HTLD 2TSSA 4RHSA 4O1NA 5FKAC 1S5FD 1L0XB 1L0YB 3O13A 3URYA 5ELDA 1FGBD 1I4HA 5ELEA 1SXTA 1RCVD 1PYWD 1KTKA 2AQ3B 2IPKD 1SE2A 3BYTB 3EA6A 4C56C 1T5XD 1S5CD 1LTGD 1LT3D 1DYQA 1FNVA 2O2LD 1M4VA 1CHPD 1SJHD 5ELFA 1TS2A 1LT6D 1V1PA 3BVMA 1FD7D 1PRTC 1JCKB 1LTBD 1LT5D 1SE4A 3R2TA 1V1OA 2SEBD 2XRSD 1PZID 3BZDB 3DWQA 1ENFA 4DXFA 1FNUA 4RGOS 1LTID 1B44D 4RGTA 1DJRD 4UDUC 3EFXD 1LT4D 4K6LA 1PZKD 1PTOC 1ET6A 1LTTD 1V1PB 1PRTD
chains in the Genus database with same CATH superfamily
4HJAA 2MX2A 1CFMA 3CC4A 2JA8H 1K28A 1BCPF 2BH8A 5NUCA 3C1EA 2BKRB 3LJ3A 2G4SA 1ZXTA 4RF0A 1XXGA 3RNAC 2MRPA 1UUPA 4WRDA 4DKAC 1QZEA 1RJTA 4B08A 3I72A 3J81j 4LNNA 1VQ6A 2VQEL 1V6EA 5IP9G 2YVCA 4OEMB 1YJIA 2Y3AA 5HKHA 1PUTA 2DYMA 3EBEA 2N7EA 4ODGA 3SK4A 4HCSA 3O65B 5BMHA 3MHZA 2BBCA 1FFUA 1C76A 1QILA 1P1AA 3W1SC 2GVBA 4B3ML 2PE6B 3NVZA 1LM0A 4DF7A 1HNWQ 1Q12A 4QJFA 2KDBA 3VR8B 4BBSH 1FD6A 1FCCC 1V80A 2W9NA 3Q3NC 2IJ0A 4NPNA 3HFZB 1K83H 4LWCA 4R8IA 2Q2TA 4DUYL 1Q1OA 4M0WA 1F2YA 3H94A 3I73A 3GTGB 1NI3A 4HPMB 4DV3L 1FM0D 3CSFA 4X3SA 2EXZA 1IPGA 4HIOA 4JBJA 4RKLA 5JEAG 4QIWB 3AE7B 4NZLB 2LGSA 3DBLI 2WXJA 5CBEE 5EPJA 2SOBA 4W9FA 2PYKA 3AEEB 4MSMB 4XE0A 2Z8LA 4L5SA 5DEHA 4L6TB 2KHWB 1SYGA 2NTTA 1EUJA 2CW0C 2PJHA 3P4RB 4JIOU 2QDLA 4MACA 3ZJUA 2EY2A 4B3RQ 1IKMA 1VQ8A 2EYJA 3CQZH 2MJDA 2CJNA 2WX0A 1KOTA 5GMVA 4RM8A 5A35A 2L7RA 3K7UC 4HJGE 1YNTE 1BKBA 1E7ZA 4DR6Q 5T1GA 3HOXG 1E22A 1B1ZA 2DNFA 2B2VA 4DR2L 3P2BA 4YHHL 3SK5A 1U4PA 2K1BA 1JJ2A 4CKBA 3PO2G 5KNCA 4HJ5A 1MHWC 2XWJB 3R3OA 1PDXA 3R66C 3F1ZA 3MXUA 2E2IH 3M3YH 4DNIA 2LJIA 4XWTA 2PW7A 3EA6A 4QY7A 1YHAA 2REXA 4JI1Q 1ZUD2 1L1OA 1H9KA 2MQHA 3KH0A 4JV5Q 4GLSC 4KSKC 2CS4A 3AM9A 4FHKA 2O2LD 2BGFA 2I1JA 2C60A 4LF8Q 4OL7A 4ZUJA 3TDQA 2EYFA 1WI0A 2UU9Q 2GBNA 4TMAB 1BNZA 3HVDA 3N52A 1DGSA 4I6NB 1HNZL 3NQTA 3OTOL 1NI2A 3BZCA 5LMNW 3DWQA 1WXVA 1R7SA 2ZJRA 1EF1A 1TWHB 2R6GA 4OX9L 4LUOA 5KYLA 4DR4Q 3IAS1 5EE9A 2MSED 1KFYB 1PH3A 4A3FB 2F0HA 1EY7A 1K83B 1JW9D 4UAIA 1OEYA 2NB0A 2XBBC 2ZPNA 3BYYB 2QKIC 2N9XA 3CAMA 4DV6L 1D5ZC 2KBNA 3U52E 4K2KA 3ZJVA 1L4ZB 2YTVA 4ZQ3A 1GXDC 1KAWA 5IYCH 2K6QA 1MI0A 4GDLB 1I4XA 2VZAA 4A3PA 3MTNB 1SNPA 4KY5A 2V4DA 1XNQL 1KRTA 1OQYA 3GE3C 3U58A 3NBIA 3CCSA 4YTMB 3D6WA 2NBWB 5ELOA 2WGSA 1UEBA 3VTWA 2Q8TA 3P1HA 3T51B 1H9RA 3I2ZA 4F8MA 2DZKA 3AMZA 5ELBA 2L83A 3ECIA 4DA2A 2EY1A 5CV9A 2ZM6L 4JI5Q 5I2XA 1H9SA 4DK5A 3H0GB 1BOSA 2I0QA 2PI2A 2K52A 3A1QA 4IURA 1WTWA 3W1SA 3IHPC 2LZ6A 2QF7A 5J3BA 5J1ZA 4LMQD 1E24A 3CC2A 3MFGA 5IIFA 3IG3A 4IOCA 1DD2A 3Q3JA 4K7SA 5T1IA 1IBKQ 3VAWA 1GUSA 1PH7A 1D8LA 5AJ3Q 4M1UB 3M4OH 3R3MA 3UDXA 3W3AA 5KYIA 2DN8A 2IL8A 3JAML 1QZHA 3FRPB 1HUNA 1PH9A 1I7HA 1P7EA 2J0KA 1D4BA 1IBLL 4DN4M 1H95A 4NAWA 2XNAC 2JU6X 4L23A 4JGHB 5M3FB 1Y1VB 1TS4A 1T0RC 2KO3A 4OVUA 1F9RA 4DUZL 1JRUA 1BUIC 4KKTA 2UUCL 3AU5A 3SHLA 1LXDA 4DK0A 1V97A 1D1IA 2L76A 3FVQA 1M8AA 5ELCA 2WU2B 5G55A 1O7YA 2X6GA 2O5IC 3AE2B 4LFCQ 1XNRL 4JC0A 1GHKA 4E6IA 1YIJA 1MG4A 4NAMA 2JSVX 4AYBG 2UWQA 2ID0A 3I57A 3TL5A 3GTPH 5IY0A 1ENAA 1GHJA 1RF2D 2AMCB 2BE5C 2VS1A 3GTKH 1J8IA 4L5TA 4OXPA 3M85A 1G6ZA 2L05A 4ZHOA 4C2MH 2VQFL 1WXSA 1OO9B 3GZNI 4GXBA 3MVVA 3P42A 3D4RA 4DFAA 1F2MA 1JOQA 4QAYA 4I7AA 3A54A 3NQIA 5I9OA 1DGJA 3MJ5A 3RZDB 1JE4A 2F3WA 4J6HA 3NZUA 1S5FD 4R4CA 4JI8L 3URYA 1YQ3B 1C8CA 1VQLA 2E3TA 3SGIA 2WLBA 2N4FA 2PIAA 3A9KA 3B6YA 2LWPA 4P1BC 1T5EA 2IWHA 5DM73 3CCUA 1UWMA 2R2OA 1JWAD 2VUMH 2LRWA 1VR9A 2XGTA 4P2CB 4A3LH 3PZDA 5KNDA 4DV7Q 3FKIH 2JWUA 1ASZA 5IGBA 1HTOA 5C4XH 3TREA 4FXKC 4OWWB 2NMQA 3APDA 4N9TA 2V4IB 1Q90A 1CM9A 3I4NB 3H7PA 4ILWA 1PZID 3SE0A 2R7DA 3T4AC 1I50B 4A93H 1IHZA 1EWYC 4GOPC 4BFRA 4KHZA 1V81A 4DXFA 4MELA 1HNWL 2YLMA 1N34Q 4MTNA 4JI7Q 1K3BC 4FF1A 2PQAA 1AE2A 2IGGA 1WIAA 1YOVB 1B3AA 3QCAA 1NMFA 1TBEA 1P98A 1KDCA 1XD3B 1RM6C 1VQBA 4CDCC 4PZ7A 3PV1A 4W9KA 2QA4A 4J6IA 2FJ2A 2JXXA 1VF7A 1K51A 2KQ4X 1TTNA 1I4RA 3N1ZC 2MNAA 1HHVA 3KF8B 4RF1A 4S17A 3WIMA 1CKNA 3ZKJC 4N59A 3EFCA 4X6AH 1S3SG 1H4RA 3CC7A 4PS3A 4ZKBB 1A8VA 2KQ3A 1M90C 4JI4Q 2NWGA 4H7BA 2JE6I 2AYOB 1WWTA 4LJPB 1BF4A 1IXRA 1HXYD 2B2UC 2PMZB 4HIDA 1DCZA 4L63B 1MJEA 2JA6G 1XLPA 4R4IA 4B3RL 2J53A 1T0SC 3AE4B 2OOBB 3J81L 1TVXA 3EIVA 4WAFA 5J39A 4HEA1 3UDGA 3RN2A 5L37A 1SF0A 4DR1Q 1JQYD 1D5MC 5M5WB 4CDEC 1PDQA 3T1YQ 2NZOA 5EKKA 3GTKB 4DR6L 3M3JA 3PIP3 2ASBA 4K1RB 4IZ8A 2A6ED 1GUNA 3FMCA 4KN4C 2Y0SB 2EOTA 3K80C 1I6HB 2ZNVC 5CHWA 3VTVA 2R61A 1X55A 3NXWA 1G2TA 2V1CC 3WANA 1JT8A 2KEDA 2YEPF 3H09A 4MJSA 2JEBI 2N3SA 1FRDA 1JOOA 1DOKA 2BA1A 1K53A 1A70A 3K5MA 5LMNQ 5J2RA 5H8YE 1GUWA 1K8MA 4JI1L 2KMCA 1BXTA 4JV5L 4J1MA 2PZUA 3HOYB 4A3JB 1YVCA 4UY8C 1SSNA 1XF5L 2XK5B 1QZGA 4LF8L 4CJ2C 5HFYA 5IP4D 5IP7G 3MXNA 3NUCA 3KDFB 1NE3A 2UU9L 3ZUNA 3RD4A 1GC6A 1VS0A 4A3DG 4XYCA 2O2VA 1RTOA 2QJLA 1STAA 4X62Q 4N9PA 2BS2B 3G7LA 2TMPA 1LACA 3NELA 5I6YA 4I7ZC 4AWJA 1I94Q 5BYSA 4EZKA 1TGZB 1ZXIA 3NBHB 4KGTA 1Q82C 1E90A 2KDMA 3UIPB 4ZRJA 4QUFA 4O1NA 4DR4L 1P7FA 3UI2A 3KLRA 5BYQA 3GTJH 5C4JB 4C7YA 2PI2E 1TWFB 2KHSA 4A3EH 5IWAQ 1TWCH 2HDLA 4IUTA 2K5NA 3ULLA 4F88A 4JW0A 3K5LA 1OTRB 4G11A 3D3RA 4HLEA 2CHZA 1IP9A 2KOXA 1XPUA 3I3TB 1I42A 2A4ZA 1KIXA 4KV2A 3RLNA 1X54A 1WXAA 1PGAA 1U0LA 5IA7A 2VNUD 3BINA 5IODA 1NR4A 3VA5A 2IGDA 5AEKB 1X56A 3J80E 1AP0A 3W9CB 2LFNA 1SR3A 1VQIA 4JI0Q 4JI5L 1RFKA 3CU7A 4M8AA 2D3AA 2PZWA 5EGTA 1FNUA 1KF6B 3DBLB 2D5DA 4GGQA 4KGSA 2F03A 3E3XA 5CV8A 3VYSA 2ATWA 1LT4D 3QO2A 2JA8G 4A3MB 1PFMA 3ULPA 4B95A 1X1MA 3H91A 1IBKL 2ON8A 1V5OA 5AJ3L 2AQ1B 3RZOH 2JYEA 3ZLZA 1WJJA 2F3VA 2KDEB 1N62A 1RDPD 2NZ1D 4LNKA 1N5XA 1J9OA 2K0PA 2GBRA 2OJRA 2R2QA 1QUQA 2OHFA 3VR2A 3Q0AA 2INPE 5J22A 4HTHA 3WDNA 4EQNA 2QEXA 5FR3A 4GNXC 3PIO3 3EECA 2WAQG 2JUOA 5TR5A 5JVH3 1WYDA 5G3LD 2OF1A 2CR5A 1YQ4B 1YIWA 2EYLA 2PW9A 2GBJA 1UE1A 3AE5B 1VQ4A 3W5UB 4LFCL 5C0XJ 3K58A 4HJ7A 2AX5A 2WP9B 2ZVNA 4WORA 2AL6A 1R4QB 5K5PA 4A3FG 4W9CA 4REZA 1QVCA 3RFZB 3F2DA 2LGXA 2WDVB 1A3UA 2O5JC 1Q5WB 2HQLA 4RCNA 5G5GA 1EZ8A 3VFKA 2PZTA 2DYBA 4X3TA 1DONA 4KIKB 1NNXA 4LJOB 2K5DA 2LGIA 3JSVA 1WGYA 3GTJB 5FO7B 2I38A 4IM0A 1DOLA 5M5YH 2GOWA 4A3EB 1N60A 2G9DA 1TWCB 2RCNA 1L6VA 4K2LA 4K0KQ 2DENB 2QC8A 4XQQA 5HG2A 1I35A 4M8MA 2FFKB 1NAPA 1KNAA 3TEHB 3RD2A 1P0RA 4CJ0B 3DEOA 3SDZA 4DV7L 2JQRB 2AUJD 1CT1D 1LGRA 2F0IA 3Q14C 5D6JB 2Z6KC 1V9PA 1TR5A 4TSSA 1ZP0B 4ANXA 2LI5A 1A5RA 2QGQA 1PH4A 2FBWB 5JPMC 4OZBA 2HIXA 3TP6A 3BDOA 1XMQQ 4C3IB 3OHXC 1C9OA 2LXJA 3OW2A 2G1EA 3V60A 1D2BA 1N34L 4JI7L 3DM1A 3PUWA 4BY1H 1ONLA 1C77A 3DLLA 4A3BB 2JA5H 4MIUA 2ZZPB 5M3FG 1Y1VG 3M63B 2KVZA 1PH1A 4US8A 2F3IA 1E6EB 2G3QB 2IW3A 1SXTA 3RNFC 3N6RA 3PGZA 5E4XA 3OPOA 1H9JA 3K6OA 3ZO5B 3ZGZA 1AE3A 1LTGD 1ROEA 3UQBA 2OWOA 2YU9H 1F0ZA 3KOJA 5F2DA 2JXMB 4MZ9A 1H9MA 1MIUA 4JI4L 1WRDB 2DZMA 4FLHA 1PRTC 1XQQA 3UQAA 4W9JA 1GG3A 1WJNA 1V1OA 4MM3B 2ZVOA 3L4PA 3ERSX 2L5TA 5CORA 1EF5A 2KACA 3DUZA 5CV7A 3T3NA 3TMPB 5FJ8H 2RHQB 4U68A 1LFDA 2E74C 4N6EB 3PS6A 4URKA 2P5ZX 1ZDXA 1IBMQ 3OYYA 4EVOA 1VF5C 2LY7A 1PZKD 3R93A 5IOCA 2DJFC 3T1YL 4BBNF 2MO1A 4ZAIA 4JI2Q 1N6ZA 2B3AA 2OCEA 4JBMA 4FHJA 4C80A 3CCEA 5K36G 1PGBA 4AQYQ 1ZYRC 3WA0A 4EFOA 4I65A 4C00A 4EQPA 2R7ZB 2LUEA 1QNUA 4NDXA 4ALPA 3K7AH 2EKIA 4KVGB 1GUOA 3HOZH 1GPXA 1PYSB 4X66Q 3AU4A 3IT6B 4K7WA 4PYUA 1BBXC 2QW7A 4GB9A 3I7FA 1UEAB 5LMNL 1EFID 2JX5A 3NJTA 3GZNB 2CH4W 4ANWA 3TMEA 1LTAD 2B2TC 4FP5D 4DQOC 2BDNA 3NVVA 5C1ZA 1F9QA 4CJ1B 2WXPA 1SIFA 4BBRB 4XYQA 4QF4A 4IWPA 1QF6A 3Q22A 1EIYB 1TZOA 4GNXA 3GO5A 2K5WA 4DV4Q 1S5DD 2JP1A 4C3HH 1O78A 1STBA 5CV4A 2WNMA 3N30A 4C3JB 4X62L 3UIOB 4RKBA 1HPCA 1SMXA 1Q10A 1B7YB 1I94L 1YNNC 4AYBE 1P16A 2N1WA 3MP9A 2RSNA 1TWGB 4IFDI 2HHHQ 3CCQA 1UZXB 2KVMA 2AWNA 3WWVA 1WCMH 1WE6A 2BT6A 4WWOA 1V9JA 3NY5A 1RWSA 3PT2B 1VQEA 1SFOH 4F7XA 1E0BA 2KJXA 2LMCB 2LUMA 1LTRD 3KUDB 2FCQA 3EGRA 3VH3B 3PMFA 1RAXA 2LHDA 4LUVA 1A62A 2RSUA 3P4QB 3PLUA 1SYFA 1KAAA 4IQZA 5L95C 1EEFD 3P63A 1JE5A 5JHBA 5FK9C 4BXXG 3GOEA 3DBHB 2NUCA 2YU9B 3OG5A 1EQRA 2F0PA 3ONAB 4PMWA 4RFBA 1Y1WB 3W1GA 3Q23A 1ZXHA 2J0JA 1QKZA 3S14B 3HG9A 1X3FA 1EOTA 2Y5BB 3C8YA 2LVOA 2MFIA 3S15H 2Y0SG 1ISNA 1LUZA 1TWAH 2B63H 3KLSX 3V2TA 2QHOA 2K04A 2Q8RE 3TP5A 4JI0L 2BOSA 1K0SA 2Z6KA 3IFWB 1ICFB 4JPBW 1E7VA 3AECB 3G48A 1Z5SB 4DHZE 1UE7A 2TSSA 4BS9A 1U4RA 4DV1Q 4GDLA 4NQLB 5DCNA 3RLOA 4TRDA 2GMIC 4XZ4A 1L0XB 1A3VA 3J9CA 3JAME 1WJ4A 1FPYA 3EC8A 4WJ3M 2DZIA 4GDKA 2F0UA 3NE5B 2NS5A 1PYWD 4ZLTF 2AQ3B 2IPKD 1U4LA 3HS0C 2VUMG 1K50A 1O7LA 2L11A 4R4QA 3CW2C 2HIVA 4A3LG 2M56B 1LT3D 4GMVA 2E2HH 3RMKC 3G6JB 4UP9A 2N7JA 1CQFA 2B2VC 3K9OB 5A2QL 3VR5A 1V1PA 2Z9HA 1CA6A 2WACA 2O4XA 1K8GA 3CF6E 2UXCQ 4HCNB 4W9HA 3MXPA 2R92B 2ZPYA 2Q2IA 4G3XB 3TUOA 2QDBA 4OWXB 1F9JA 2JEAI 1FEHA 5IGEA 3PHXB 4IG7B 3VH4B 1P8LA 1ENFA 1BR9A 2LKVA 2PPBC 4DV5Q 5BN5A 4OIJA 3DWMA 2WB1E 2A5UA 2JYOA 3RULA 1UWVA 4YSZB 2BH2A 1WFQA 5CV6A 4WJNA 2NVXH 5LLIA 2INCC 4A4IA 3NPPA 3ZIMA 1YJ9A 4OO1G 1B53A 2BWFA 5D3DA 4BVUC 1WGHA 2MBOA 4BY7H 1JWBD 1E3PA 3STBD 1WCMB 4W9DA 2PEAA 1YNJD 4JI6Q 1E8ZA 1PH2A 1VDVA 2I1KA 2XRQD 4B3TQ 2I07B 3AEAB 3I63C 4LFBQ 3K57A 2ENBA 4K0KL 2CKHB 4C7ZA 1PTOD 1EQVA 2MJEA 4A3KH 1FL0A 1FR3A 2EIFA 2JA6B 5IGGA 2PPHA 1JB7A 4LF5Q 4AOFA 2J7ZA 5JHAA 1W6KA 3KWLA 2WXIA 4BA2I 2D5GA 1PTOB 1JWMD 4A3MG 2NCNA 1YD8U 3M62B 4PK1A 1KDAA 4WURA 1AZQA 2LXAA 1XMQL 2FUHB 2MLBA 2E6XA 4WH4A 1WTVA 4HSPA 3X3MA 1CSPA 4LTUA 2XSCA 3U7ZA 1B4OA 1E2ZA 3AE3B 4HVBA 4FDBA 2AWTA 1PZJD 4ASWC 2KOLA 5LL6S 4HJ9A 4NPSA 1QOFA 1E8YA 4ICVA 3VRAB 3TEXA 2YTYA 5TSSA 1ESRA 3Q3FA 2M0XA 5IE8A 1E2VA 1TXYA 4HWIB 4DAYB 3N1YC 1ZKOA 2D2CC 5IYBH 1V49A 1V86A 4BKSA 1A3TA 3SXHA 3QK0A 4K5VA 4JX1C 3VRBB 1CK1A 1SYDA 3FP9A 4N8FA 2X6LA 3RZFA 1SNMA 4JCVE 4L8JA 1J19A 4EKUA 3AU7A 2N49A 3J7ZC 2LD9A 2L1BA 3AEGB 3E9HA 4ZRPA 1F2LA 4A3DB 2VB3X 1YJ1A 4Y7NH 3J81E 3HOVH 4POGA 4OVZA 4YCWA 5DAUA 4OVVA 3S2HB 3EFUA 2MJ3A 5H1SE 2D07B 2IO0B 3LB8C 3PRPB 4IM3A 1EWCA 1PRTF 4YCVA 1LTLA 1SNQA 2MUYA 5C44H 1NSNS 4DV2Q 1VQKA 5JEAJ 4KKUA 1FXAA 1C78A 1HZ6A 2KTRB 3L0WB 1G6JA 5FKAC 2HE7A 2KENA 3VYRA 2I5LX 1E2WA 1YBYA 4A3EG 4JI2L 2KD0A 4LCDE 1CTMA 1FGBD 1I4HA 5ELEA 4K6DA 2WXKA 4AQYL 1VQMA 3Q3OC 1VRAB 2CVRA 1EY6A 5C3XA 3NENA 1VQOA 5EKIA 1ZPSA 2V1YA 2N1VA 2J52A 4BY7B 2AWOA 2RR9A 3Q2AC 2PQEA 1I6VC 2JK8A 3MTSA 4ZK9B 5HHDG 2I46A 4X66L 4P6VF 1MFWA 3DBRB 2R93H 3HRZC 2F0DA 2OT2A 4C3IG 1SE4A 3KF6B 2ZCBA 2F0EA 2VW9A 2E2DC 5JVG3 4A3KB 1G91A 3FKYA 4A3BG 2IYDB 5CHFA 4DV4L 1XJVA 4LFAQ 1MPEA 1WY8A 4B9WA 2CU1A 2KQSA 4NMZA 4UDUC 3QIJA 4IOAA 3GB1A 3JAMc 3B2GA 1DOXA 3DXJC 1IZ6A 2JA8B 1NBWA 2L15A 1NENB 4R9WA 4B9KA 1EWHA 1I4GA 1TS3A 4J15A 1D7QA 3T8MA 1VQGA 4LNOA 2L0CA 3V3XA 2HHHL 1D3ZA 2XK5A 1PH8A 3KDFA 1AARA 3QC8B 4XGAB 3U8ZA 1KLVA 4DR7Q 2EJFC 3SVMA 2I5MX 2CJOA 4LLGM 4FVMA 3PZ8A 3I4MH 4G7HC 5FOBB 3U4EG 3AE6B 1VQCA 4NB3A 2WAQB 4IFDH 3PHWB 4J8QA 1KABA 4LF4Q 4BOZB 5GAHC 4BBSB 1VZ6A 2EYOA 1ZKHA 2KN5A 5J17A 4Y7NB 2Q8IB 4WAAA 3KJPA 3AH7A 2R7ZG 1Y56A 2BPSA 5T8IA 5CGKA 2C7HA 3HP3A 5D7GA 3OWFA 5C44B 3Q8CA 2K8BA 4DV1L 1C9FA 2NVYH 2F0MA 2Z1CA 1Q7YC 4KLKA 2KZRA 4WJPA 3RN9C 5AFWA 1PFNA 1XMOQ 5ELNA 3V6EB 1E7PB 4EUTA 1BCPD 3M9BA 3H9DA 4K5WA 2WKDA 3VR3A 4LF6Q 1L7YA 2M2LA 2DBYA 4YL8A 3PO3H 4BBRG 3UINB 1STNA 1U4MA 2F0NA 3KFUA 1BCPB 1BVSA 3J80i 3NUHB 2Q2UA 3ZJYC 3CQZB 4C3JG 1PHJA 4NNJB 2R93B 3R7QA 1S3OA 2UXCL 3H1UA 4RH6A 2D10A 2KFJA 1U5KA 4MH8A 5I4DA 4HKZE 1WD1A 5DM63 4F8CB 1TJEA 1NMGA 3ZW3A 2FMMA 2B2YA 5IYDH 5C3EH 1N63A 1Q1BA 2XTIA 2QILA 3IKJA 1J5EQ 2JA5G 4LNFA 4DV5L 5G2NA 5C5MA 1WYGA 3B1LX 4N9F4 2DUDA 2E2IB 2KCMA 3M3YB 3L17A 1WGGA 4A20A 5JXVA 4W9GA 1Q46A 3A4SC 1L0YB 1HNXQ 3UE1A 1JQ4A 5ELDA 2MP2B 1W3SA 4RA8A 3TP7A 2CCZA 1C4CA 1JROA 1VZ8A 2BW2A 3AXCA 2N8NA 3QG1A 4JI3Q 5I9PA 1X3EA 4R4TA 2NBFA 1Y1WG 4ZRIA 4JI6L 4KX6B 2FE8A 1HJPA 2DY7A 4GIVA 2HT1A 4A3IH 1PV4A 5EE3A 4B3TL 3M7NA 2JZZA 2K3UA 4LFBL 1IBXB 2LGYA 4FXGC 3J81c 2KDIA 3I4MB 1G2SA 2A69D 5D65A 1OQQA 4WFN3 2KVRA 3MFYA 4P73A 5EQ0A 4BZAA 3VYTA 3S1QH 4LF5L 4A3CG 4KIKA 5JH5C 2HCCA 2RDBC 5M9OA 3C2PA 2PTLA 2A19A 4LW1A 5JJKA 4PG3A 3HOUH 1LTID 3J7AV 1UE6A 4RNAA 1HUMA 2KA7A 1S1QB 3S2DH 2BB6A 4V190 3JC66 2B76B 1SBBB 2HD5B 3I91A 3APFA 4DK3C 1CZWA 1RD9D 2ZJQA 2GBMA 1EYAA 2DAFA 4AS1A 5EBDA 2J42A 3HOZG 3ZXRA 2L32A 4H02A 3T16A 1RRBA 1JJGA 4IUNA 4AP4C 1SMYC 5IKCM 4ID6A 1MHXA 2KJHB 1XPRA 4ZYSA 1A6XA 1X65A 2A1AA 5JJIA 2R92G 3I90A 2MWSB 2OJWA 1FXTB 4AQ7A 2EDGA 3FEWX 4HJ8A 3APCA 4IJHA 3PO3B 2C5LC 4LNIA 2RDGA 4ZRZA 1XCTL 3H3VC 3HK0A 2FCNA 4XQJA 1MKHA 2F1MA 3UE0A 4H0LC 2PMZE 3VR9B 3W5OA 1ICWA 5EDSA 3N9YC 3G71A 1IYUA 4IO9A 4XTCS 3QWNA 1HH2P 2MBQA 4M00A 3DWPA 3ZDMC 3AEBB 2EY6A 1V8QA 2NN6G 3CHBD 3ULJA 2H1EA 2VL6A 4BWGB 1JWUD 3M4OB 4DV2L 1WCMG 2F4VQ 5C3WA 2Y0SE 3TS0A 4A3GH 1UH6A 1WGKA 3TRZA 1L5PA 1U4AA 2MCNB 4EZJA 2LXCA 1HE8A 2IY5B 2HUGA 1WTOA 4MM3A 2MP1A 4TV3A 5L83A 2QIEB 4H44C 2N78A 4WJ4A 3VUXA 4BBNC 2L3ZA 4UPAA 5HGQA 1J7AA 3PPAA 2OTLA 4TQUS 3SEBA 1RLFA 4M0WB 4RAUC 4ICUA 4A3IB 1NCVA 1SE3A 3NEMA 3A0JA 3KVFB 3RUIB 4A55A 3CPFA 3ML8A 2N9EB 5G3LF 3GTPB 5HURA 3CXCA 2UUAQ 5IT9c 2Q2HA 5CV5A 3S16H 4TQ1A 1EEID 3TP8A 4C2MB 1EZ6A 1EY8A 2PO4A 4IPGA 4IUMB 2LXKA 1K3RA 2ZXPA 3AV8A 4IWOA 2BTEA 2K01A 2XVSA 1KLUD 3RUZA 1XLNA 3H3VI 4LFAL 1SEBD 2KHJA 1O7IA 4OZAA 3DOWA 2K33A 1DOYA 2MPMA 1B2TA 3E56A 4TVAB 4C4VA 3D8GA 3NVYA 1VQHA 3IFDA 1N36Q 1VQNA 3B9JA 2EELA 1R4NB 3UDIA 1E5WA 2VUMB 3C19A 3RYTA 2RA4A 1UBQA 4YTPB 5DLQE 3CCLA 3E0EA 3P4PB 1UBIA 3FKIB 3A7LA 3F2BA 2A8VA 4DR7L 4JPSA 3TEZA 2BKFA 5C4XB 4KI0A 1JCKB 5GROA 1YX6B 1LT5D 4FADA 4GZYC 1KHIA 2A68D 2HDMA 2MA9B 4A93B 5GAEC 1T0YA 2HJ8A 1IW7C 4GN5A 4LF4L 3PVLA 3KYDD 5IP9H 1B8AA 2D9UA 3HM6X 4KKJA 4F1SA 1BO0A 4KD4A 4HCPB 2WP8J 1L1OB 3OSOA 4IPCA 4EEWA 4TUUA 4A9AA 4US9A 3L08A 5E3FA 1AWDA 2LMCA 2AKWB 4QCLA 1HZAA 1GUAB 2ZXOA 3BK1A 5FLXc 3BYTB 2BYFA 2HD3A 3W1BA 3S1RH 4FBJB 4BY7G 5FLMH 2KCTA 3ICEA 2EKEC 2WXMA 1ILQA 3RPFC 4P74A 2YYZA 1GKHA 3W2DA 1D1KA 2ZTEA 1FXIA 1XMOL 1NR2A 3OW7A 1CKMA 5E1FA 2J0MA 4XWWA 4AIMA 4HROA 4LF6L 2IZVB 2L0TA 1XPOA 4HN7A 4X3UA 2DHZA 4IOIE 2K1FA 2NBUA 4A3KG 4XT3B 2NPTA 3G6EA 3ZRCA 3RZWC 5A2QE 3KLSA 5IT9L 2K50A 1Y14B 1CKOA 2K32A 4PT5A 1OXXK 1V5TA 2IDYA 3EVQA 4KSLC 4ZDVA 3VXWA 1YJJA 4YIJA 1PMRA 1YEZA 2RHSB 2WXFA 4DDGD 1K8OA 4J3OD 3U4ZA 3NSWA 1GJXA 2RD0A 3HIZA 2JA7H 3S16B 1TY2A 3SHQA 5LMUQ 3E0JA 4GLAC 1VMCA 2OQKA 1J5EL 2PKOA 3JAMi 3NWSA 1SLJA 3FAHA 2R3ZA 2CWAA 1E1TA 4CGYB 3PGEA 3HOXH 1HNXL 1YN3A 1EYDA 3ZVVA 1KDBA 1XT9B 1EOVA 2RBMA 1IL2A 2UXBQ 1F2RI 1XX8A 3PO2H 2FUG1 3S1NH 1EIHA 4ANVA 4JI3L 1WTRA 1QOBA 1MJCA 2KLGA 3T13A 3A1QB 4M02A 2F0QA 3WOEA 2G5DA 4OIKA 4Y52H 2KNBA 2JSOA 2KJ6A 2M8SA 4HMJA 4BBSG 1D5XC 1Q0WB 2LSSA 3N1XC 2AUKA 3L3OC 2ASQA 3HOVG 1K73C 5MPOA 4NAWB 1PYBA 1C4AA 3MA2B 4TQ0A 2RCFA 4MNOA 3PZ7A 3ZTCA 1OQRA 2MGSA 3PUXA 3NP8A 1HEZE 5C44G 3KUCB 4JL9A 5FLXL 2HTME 3AMUA 3NZSA 1X6OA 3VDZA 1PFDA 2CW0D 4IC7B 5M3MH 3AULA 2OTJA 2HCIA 3QJZA 1JJCB 2J0TD 4Q0FA 1FIQA 3TS2A 1EL0A 1B9MA 2WDRB 5AZFA 1WM2A 3NHHA 4FF3A 4AJYB 2WXNA 1J7CA 4X3KA 1EYGA 4HKQA 2KX0A 3T53B 1XLQA 1GM5A 2GVAA 3EQLC 2R93G 3GTQH 1KJTA 3MEHA 3K9PB 4PS7A 1CHPD 4K3BA 4AUQC 2BVCA 1WX8A 4EZLA 2WKCA 3Q8AA 2K05A 1LTBD 4DV0Q 3C0RB 4Q2JA 5KNBA 1SYCA 1CZPA 3DHHC 3Q8FA 2BF8B 4PYZA 1CZGA 3RNBC 4LK0M 4APVA 3L54A 1CA5A 1IGDA 3BWUD 4NXNQ 4GN3B 1QOAA 2JA7B 2Z59B 4DAYA 1UGMA 1SAPA 2F4IA 4GKJQ 4RMAA 4WWMA 3RZOB 3Q6SA 2F4VL 1CUKA 3P4SB 3BVZA 1VLBA 2B8FA 2VH1A 4P75A 1WJ6A 3U30A 1U9RA 4WJWA 3CCJA 3P20A 4AH6A 4MN3A 4N58A 2K8HA 3AN1A 3I4MG 5EBCA 2B39A 4RM9A 1L2FA 3ML9A 2PQAB 4ARCA 3BK2A 4H13C 1O7ZA 3AB9A 1GUGA 2JJQA 1SSOA 2KUMA 1VQ7A 4PZ6A 5I2YA 5C0XI 4FULA 1C4QA 1OTCA 4JBWA 4YWKA 2PVGC 4E3CA 3J81i 1ET9A 2KC2A 3P1MA 3QB3A 4DR1L 3LNNA 1S72A 2KTRA 1PA6A 1BBUA 2EJMA 3A8JE 2HJ1A 3W5VB 2UUAL 4CYEA 3QWZB 2G9HD 3D0FA 1LYLA 2CH4A 1G8ZD 4C1NK 3HVZA 2BDOA 3K81C 2ACZB 1RIPA 1WMHB 1VMPA 1F77A 4FJYA 4WJQA 3GP7A 4L2YA 1Z7TA 1I5FA 2K6AA 3ITPA 2NR2A 1HCZA 3IVFA 5IYCG 2KQ7A 4YT0B 1BMLC 4LK1C 1NYQA 3DEPA 3WALA 1IYFA 5BR8Q 1GJZA 3QOLA 4QGUA 1YITA 5M3MB 1XYIA 1QLBB 2JT4B 1FRRA 3I4LA 3DVGY 1N36L 5M5YB 3PO3G 3KF6A 4ZCKA 1LM8B 1MD2D 3PF4A 1WSPA 3GE8C 3HOWH 3H3VH 1UE5A 3OWEB 3B0AA 4KD3A 4KHPQ 4K8JA 2CKZB 1R4MI 3GTQB 3J7YW 2JY6A 3PCOB 4HR7B 1SNDA 1PTOF 4ABNA 1B9NA 2FIFA 3MHBA 2N88A 1LO5D 3Q3MC 4ZRQA 3E9SA 5GQOA 3GV3A 2EZVA 2MHVA 5LNK1 3T1HQ 3MAQA 4YWGG 2IX1A 5EPLA 5IO9A 1HA5A 3VHTC 4QMGA 2N9KA 2A6HC 3LYYA 4BY1B 2DZJA 4RCOA 3R7RA 3HKZB 3QIAA 2F0SA 2JA5B 2WXGA 3HM3A 1VZ7A 2X38A 3TCAA 3BY4B 3A74A 4I6LB 1F9PA 3V61A 5I6WA 2PVOD 2WXLA 2C7NB 5IWAL 2LVQA 5DPRA 4XDXA 1WYWB 4JWSC 2FCSA 3E9IA 1KTKA 1TT2A 2BE5D 3Q8DA 1QT9A 2CQAA 5D14A 4A3IG 1UGJA 1T5XD 2KKCA 1ZGUB 4KDLB 2NVTH 2D11A 4ME3A 1GUTA 2V9HA 5FO9B 1SJHD 2QMTA 1WRIA 3CRLC 3GTLH 3VDYA 3ZNHB 4YSYB 3ND9A 5C3JB 2MH7A 2A73B 2UU7A 2W3SA 2FXQA 5LHY1 4GSWA 4X64Q 5IGFA 1HR0W 2JQOA 2FHTA 1NBFC 3RNGC 1L0WA 1SROA 1V43A 1SYBA 2W82A 4KHVA 3HEJA 4HJKA 3MWYW 3J7A5 4OONA 1JORA 2KWCA 2IX0A 4QUCA 4FO2A 1WX7A 2MQJA 1SGHA 3L13A 4CBVA 3U2SC 1W6JA 1A2UA 3VQIA 2I2YA 1JOKA 1WTXA 3K7AB 2RF4A 4IPHA 3FKIG 3HOZB 2LS01 5C4XG 4R8NA 3PTFC 4KN7C 4IPDA 5KIXA 2UXBL 2BB5A 2O6VD 4FF2A 3S2AA 3FILB 4A93G 1WD0A 1ACCA 2NVUI 1BDOA 4JVZA 4NJCA 2CQOA 1ZEQX 5AZHA 5BO4B 2A6EC 3TEYA 4JOIA 2XIWA 3HOWB 1D6EC 4WQOB 3TQYA 1L4DB 4GOPB 4G57A 2F0WA 4F7ZA 5C23A 2V0GA 2L12A 3H6NA 1KXLA 2O6VB 3KUPA 4LDTD 3AEVA 4C3HB 4G7OC 4GN1A 3IT4B 3I70A 1FFVA 3EROA 3I8ZA 1W2BA 1FYCA 2CFMA 4CDFC 4FXDA 4FYDA 2JRIB 3D4WA 3AI5A 1FCLA 3Q6BA 4UP8A 2VXWA 4X65Q 2CHXA 2MP2A 3A4RA 1J6QA 2B8GA 2IT1A 1G291 5IP7H 4LDTB 1I4PA 4I6PA 4KKIA 1TIID 3KK7A 3ND8A 4FXCA 2BYTA 2KYWA 3B08A 4XIGS 3S9WA 1QVFA 1T6BX 3A9JB 3ALBA 3WAOA 4PV1C 3PO0A 4PMBA 1SFOB 3OJ4B 1T9HA 4DHZB 5JZEB 3TZDA 4DK6C 1SE8A 5IGDA 3C1FA 2F0JA 3IRBA 1HFGA 4K14A 1Z9FA 1HRJA 2ZEQA 1GB1A 2VB2X 4B3SQ 1M1KC 1II3A 4EE2A 2BCOA 4GKKQ 2DWQA 3X3NA 2SAKA 4AJWA 1YN4A 2IO3B 4K81A 1STEA 5DPSA 1E7UA 2JWZA 1EIFA 1WTPA 3MHSD 3GTLB 4DV0L 1FNWA 3S15B 4CO7A 1TWAB 2B63B 3ENEA 3LX0A 1V2YA 2ZNVB 4ME5A 1F1HA 5CYUA 3M95A 3DWAA 4JQWC 4OZCA 5E6PA 4P16A 3IXSA 3RMHA 4NXNL 3CF5A 2MBHA 3S24A 3X23A 4QIWE 1R9TH 3MEFA 3PLVA 2FMCA 2A74C 4GU2A 4GKJL 2IHFA 3SR1A 1RKNA 3E6ZX 1GD7A 1S40A 3MC8A 1QB5D 2MBBB 1NVID 2GLSA 2IO2B 1MI2A 4BAXA 4IW0A 2YTXA 4NY0A 1XWEA 2E2HB 3OAWA 4C56C 1K8AC 1NJIC 1PH5A 2LVPA 1YQBA 2B2YC 3DDCB 1IW7D 2KFKB 4GLXA 1FMAD 1EY4A 4MEMA 4KY6A 1JICA 5DNFA 1Y8PB 1YJNA 1ZDVA 2DY8A 4HIMA 3RNEC 2N7DA 4HXDA 4IM2A 4MSQB 2DLBA 4UHVA 2XRSD 1IGCA 2K5VA 5C4HA 3KF8A 2K22A 2VH2A 1HTPA 1UELA 1IBML 1LV9A 1TIFA 2N55A 3Q8EA 1N9WA 1DJRD 4RGTA 3D4DA 3TN2A 4DPGA 3SD5A 1TWHH 1STYA 4OO1I 4K6LA 1SYEA 2NZHA 5C0XH 2NVXB 5FLMG 2DAJA 4HPPA 2H88B 2BS4B 4A3FH 2GN5A 2BWES 3AQQA 1TKWB 5EAYA 2JYTA 3QA8A 5BR8L 1EUVB 3JYUA 1VQFA 4DAPA 1YX5B 1ML0D 2NTSA 5D3IB 5CC4A 1T3QA 2F0OA 2ALYB 1BT0A 2FIDA 4HIKA 1AEXA 1XTCD 4NQKE 1YJWA 1K8RB 1QQRA 2V3PA 3TBLD 1PFSA 4KHPL 2WAQE 4L1BA 3MC9A 4E74A 2IBIB 1WR1A 1BBWA 3AB5A 2K5HA 3CPWA 2RVLA 3GTMH 1N33Q 2N9LA 3DVNU 2GB1A 1GO3E 2JA7G 1PQSA 5AZGA 2RKSA 1NTGA 4UP7A 4M8NA 3T1HL 3H0GH 2XWBB 4S0RA 1EWIA 5EE1A 2DJGC 2B2WA 2PNRC 2X8XX 3DHIC 5DPTA 4G7ZC 3X0WA 4H2AA 4YWMA 1AH9A 3K0XA 1TY0A 1Y8OB 2D3GA 2WXRA 1MBYA 1AN8A 1KM7A 2WWZA 2QCPX 1TQOA 1PGXA 2LFIA 1R9TB 1C79A 3K5NA 3J7AF 4G0NB 4GNXB 4KTAA 5COYA 3GD7A 1HR0Q 4HDQA 2C5CA 3A5UA 1HTQA 2E5LQ 5M3FH 1Y1VH 3NBHA 3ZNGC 5C6AA 3IBEA 1MHHE 1EU4A 5JJZA 1RHPA 4KKSA 2D0OA 1Y69U 1TKGA 3V05A 3D6CA 3DCGA 5IT9E 3HOVB 4QB4A 2BA0A 3IL8A 1Y8RC 2VRRB 3AEDB 4ITKA 3AYHB 5KEEA 4X64L 5J18A 3BVGA 3PIPA 4B0EA 1JC7A 1C3TA 4HMIA 5M3MG 4RWSC 1KL9A 1XEEA 2GI9A 2KDFB 1OXVA 3BG3A 3N32A 2Z0EB 1KRSA 5G5HA 4B9XA 2Z4IA 2E2JH 3RZDH 2QCZA 4IALA 4R1JA 2A5HA 2EE1A 2JF5A 4DK1A 1SE2A 3H7SA 4ANUA 4ZUIA 3CKIB 1QCBD 1EM7A 3QOJA 2CU3A 2LJ5A 3A8IE 1S5CD 5AUIA 1DYQA 1WTQA 1WOCA 3BJUA 1VQ5A 5K36H 3LGJA 4O2DA 2K8CA 2ZCCA 3FC4A 4P72A 1K0RA 2L0FA 4EGVA 4POFA 5JAVA 3G4SA 1F2RC 3VTUA 4BY1G 3M7GA 3HKZG 4XXEA 4GDKB 1WE7A 4IDIA 4TKOB 3I4NH 5C2TB 3GTMB 1NDDA 2ONQA 3VA7A 2MBEA 4A90A 4A6QA 1STGA 1I50H 4KMUC 4RGOS 3VR6A 4DNTB 1B44D 1TKYA 4RMFA 4X65L 3ZRFA 1CSQA 4BKTA 2H89B 4P7IA 4R4OA 1C7YA 3QR8A 1VCIA 1V1PB 5FLXE 3L2PA 1PRTD 5BN4A 3Q24A 1VD2A 4II3B 3I56A 3WOFA 1E1OA 2BS3B 2KJRA 4DDID 3ERQA 1R4MB 3AE8B 1LTSD 5BMIA 3MZ5A 2I5HA 1SJED 3FDTA 3P7JA 1PRTB 4YCUA 3ZYYX 3HZXA 1V8CA 2K5QA 4HEDA 3CMAA 2N0SB 4G4KA 4CKEA 4B3SL 2G45B 1YNXA 3CSTA 3SU8X 3L10B 3TSSA 1CI3M 4PQXA 1TS5A 2R7FA 3BU2A 5FJ8G 1TZ1A 2AL3A 2JXTA 2MHJA 4GKKL 3NS8A 4RGMA 1EY5A 2VZKD 4RHRA 5JOBA 4ULLA 1Q8IA 1ZYRD 4OELB 4PMCA 3SK8A 1VQ9A 1IYJB 2MO0A 1WFYA 2KT7A 1QOGA 4OWTB 3GS2A 3KYCD 3ZQ4A 5DPWA 4BOSC 4BXXH 3I4OA 5CTRC 5IN7A 3A7AB 1WH3A 3TZUA 2VZKB 3VVWB 1T0QC 5M5WH 1WJUA 3OIPA 5IGCA 3PUYA 2NVYB 3CP0A 3KWVA 1GVPA 1XCQL 3IFTA 4OHJA 1LABA 2DX5B 1QNKA 3PSIA 4LJZC 1I6HH 2OEDA 2PLPA 1VDZA 1ESFA 2E2JB 2K7VA 2EYPA 4WWPA 3RCZA 3HOWG 1JR0D 3HKSA 1WXQA 2L8JA 3QQ8B 2RSOA 1P3QU 1SNOA 4YY3Q 4DAVA 3MJWA 4YSXB 3PIOA 2WFWA 1Y8NB 1KC8C 4JYAQ 1I4QA 4C3HG 1ZOYB 4Z9CB 1YNND 2KCCA 2D3CA 3R8BA 1JWSD 4GOCA 3PQIA 2RQXA 1QVGA 3HOYH 4A3JH 2A6HD 3QX1A 2F0VA 1X32A 4BKSD 1Z47A 5HGTA 4NKLA 2PCFB 4A3OA 2ZJDA 4USAA 5C4ZA 1HQRD 2KK8A 5H92C 5C3EB 1HZ5A 1LLRD 3CCMA 1Q1EA 2WXOA 4HAEA 2JA9A 2Y5PA 2WIIB 3T9LA 1OXUA 1V1QA 3F8TA 4N8X1 1SE9A 1AYFA 4U673 1HTLD 3CCVA 1AZPA 5C5LA 2L55A 3Q8BA 2LGDA 3DBHI 3V96A 4IUUA 2DGYA 3DPDA 1SDFA 3ZJTA 5C4JH 1J7BA 1FVIA 3NZ3A 3HUIA 3A56A 1TWFH 1E0ZA 4X57B 5FR6A 1CJEA 2C7MB 4KJNA 3GQBA 4TKNA 1UAPA 3L16A 5JJLA 4OO1H 4IN3A 3M4YA 2WHIA 2B63G 1TS2A 2PNHA 3BVMA 1FD7D 3OIQA 1UF0A 3BS1A 4RG1A 5LL6X 4MGZE 4CHKA 1WMHA 4JG2A 3EN2A 2KLCA 1K52A 2UXDQ 1TU2B 2SEBD 3S1QB 5CMDA 1WGRA 5D2MB 5E6OA 3NTIA 2E75C 4GLVB 3BDCA 4IKGA 3STBC 5KGUA 1N33L 3AE9B 3BIID 3HOUB 1MSGA 3U9OA 1YNJC 3FPPA 3SFEB 2BYEA 2WB1G 3S2DB 3K8AA 5KRUA 3LWUA 3T56B 2W55A 1Z6HA 1PTOC 4YXDB 4ACFA 4ZYNA 1O80A 2E8GA 3DQVA 4A3MH 3OMGA 5EPKA 3I55A 2F0GA 2KXJA 3SK6A 2HQEA 4II2B 1YHQA 3PUVA 4L5QA 1MJDA 2FAZA 4RGNA 4K7UA 2K39A 1C48A 5AUKA 4Q5VA 1HR0L 2NVQH 1I3QH 4EQ5A 2ZW0A 3RT3B 2E5LL 1RFAA 2W3RA 3AEFB 1L0VB 3ER0A 4CDDC 3PRMB 4HK2A 3WAPA 4GN4B 3TIXA 1ASYA 3QARA 4MGYE 1JMLA 1B70B 4HSVA 1X3QA 2AHOB 2OQ0A 2X69A 1QJOA 2IO1B 2L52A 3NOBA 2D2QA 5CX3A 3M4QA 3NTHA 4EOYA 5KHQA 3S1MH 2NN6I 2D62A 1XTDA 4XT1B 5FO8B 1JRPA 4MGIE 1PXUA 3HGBA 1KH0A 1HFNA 2EMSA 4P1CC 2YV5A 2AQ2B 3U9SA 1FJGQ 2KWDA 4QL5A 4A3GB 2KWUB 2WQYB 4NW2A 2ES2A 4JLCA 3KYHC 1RTNA 1L6UA 1WX9A 1GNUA 2SNSA 1QE6A 2K25A 3KUZA 5D94A 4LAAA 2M1MA 3I5JC 3C3LA 1PLFA 1BQQT 3UI3A 1S5ED 2J4XA 5JEAH 4KZCA 1ENCA 4XDCA 3A8KE 1S5BD 2XN9C 3H15A 4A75A 1J0GA 3H6MA 1HZCA 3AFQA 5GADC 3LWEA 3HRDD 3NVWA 1BUVT 1DOMA 1WXMA 2JPHA 2JZPA 1MSHA 2DNCA 3TBIB 3IAM1 4K5XA 2JVCA 4LF9Q 3OJ3A 1VQDA 4E71A 4KK7A 5CBAE 3UDFA 1YN5A 4XC2A 2WDTB 1JB3A 4LF7Q 4MTKA 2PW5A 1S4ZA 4DHJD 4FA6A 2KHIA 1STHA 1Z2MA 1ZW7A 2FINB 4C3IH 1WM3A 2LHEA 1MVKA 2F52A 2INNE 1KLGD 2JZ3B 4YTNB 4RHSA 1VQJA 3D32A 2B3GA 1IL8A 4DHJB 1H9SB 4LUZA 3RNUA 1NYRA 5IYBG 3FILA 3JVZX 3O13A 4A3BH 1B3QA 2K9XA 3BDLA 1WZ3A 3L9AX 3PRZA 4HCEA 4GOPA 3H8HA 2Y5CA 5E6NA 1IUEA 4JE3B 1HQMC 2O6VA 2IY0B 3CRKC 1N32Q 5BYRA 5LXHA 1A15A 1Q3LA 2GBKA 4ZHPA 1PVOA 3QHTA 2FCMA 4ARIA 2EVBA 2L4NA 2D3BA 5EKLA 2GA4B 1LT6D 1FGUA 4EX5A 2NVQB 1E8WA 1I3QB 4ZRKA 2VY3A 1X9NA 5IOIA 5HI1A 2M17A 3LXFA 1R4PB 4JWUC 4OGQC 3DHQA 5CR3A 2C9WB 1MGSA 2K03A 2MEKA 3I3CA 2KTFA 3A9JA 1FO4A 3OOCA 4M01A 4A76A 1JALA 4MH0E 4W9EA 2Z0SA 3GDEA 5C0XG 3E5SA 3S1MB 5E7NA 1SNCA 1C1YB 3ZXVA 2H4OA 1OXSC 4QQBX 3S1RB 1GB4A 1LTTD 2B2UA 1UWXA 4A8XC 2CHBD 4FJZA 3KBXA 2AEHA 3TJPA 2HDEA 3DBRI 3UF8A 3WCQA 2ZJPA 3F2CA 3W1YA 2HTHA 3ZNZB 1QWYA 2KCNA 4IUVA 2R7ZH 1WZ0A 2KEEA 2V3SA 2YEPB 1F52A 3DHGC 4DR5Q 3RN5A 3ETRA 1H8CA 3KW5B 4CHTB 1DM0B 1GAQB 3V62A 2K4KA 2M9VA 4YY3L 2UUBQ 1TT5B 3R2IA 3PUZA 2MW5A 3A5ZB 3NRZA 3QAQA 4IJLA 5CHVC 2F0LA 2Z6BA 4NXMQ 4JYAL 3CD6A 4K8IA 2ZT9C 4G50A 3A9KB 3PV0A 3A55A 4DR3Q 1BCPC 4BBRH 2LEKA 1NY4A 1M94A 3H0GG 1G51A 3HHMA 3IAYA 2QDFA 1YZ6A 3D31A 4BA1I 4C3JH 5JPNC 4K3CA 1EQQA 4W9LA 1EQTA 3U50C 3DBSA 2D0PA 3H7PB 4JOIC 1X3GA 2NYZD 3HOXB 2KFKA 4O42A 4MHEA 1TWGH 2KN4A 2JRHA 3PO2B 2Z0DB 3RLFA 2SDFA 3S1NB 1OGWA 4R3DA 4IFDG 1Q86C 4IFDJ 2VQEQ 5BN3A 4WJOA 1G6PA 3AFPA 2OEOA 2NBVB 1F9SA 3NTKA 2KECA 4S3SA 2WYQA 2LRUA 1RYJA 1ILPA 4PS8A 1EU3A 3CIRB 4FN2A 4MGKE 1CKNB 1OFFA 1N61A 4B3MQ 2BYVE 2K5PA 2EY5A 1JMCA 1IYVA 1Y1WH 2WXQA 3GTOH 2K6DB 2UXDL 3S14H 2ZTDA 2CWPA 3T3OA 1WF9A 1EIGA 3AE1B 2ICIA 2M00A 3VR4A 4DU9A 4DUYQ 3MC0B 2KAJA 1UNSA 1CMXB 4EQOA 1OXTA 1GOZA 1AW7A 3HKZE 3NS1A 4DV3Q 1SN8A 1SB3C 2XEWA 2E76C 3RR5A 4A3CH 2INDC 2A69C 2M4NA 4WIPA 3C46A 3S17H 4MDKE 2IX3A 1RCVD 5E4WC 1KRHA 2RPVA 3CCRA 3ABVB 3TEWA 2N9PC 2ZW1A 1EO6A 3PSEB 3WAMA 4HRSA 1MG8A 4MJSB 2WINB 4YWLA 4LNQA 1C4PA 5IYDG 5C3EG 2PMVA 2WX1A 1EY9A 2B29A 4FNFA 4PZ8A 2IGHA 2WU5B 3R2TA 4FJVB 4ZOHC 4C4VB 3J80c 3I4NG 2RPQA 4KY7A 4WWNA 4DGZA 2ICEC 2R92H 4KV6A 3VYUA 2WXHA 2F0KA 3BZDB 1E8XA 4NJ6A 1A63A 3I9V1 1N8RC 4DR2Q 4YHHQ 3EHVA 2KANA 3NWTA 3MXNB 1RODA 4D2KA 1YHBA 3DWGC 4NJ7A 2O2VB 2MJ8A 3NHEB 4F87A 3EFXD 1FJGL 2M0AA 4FF4A 4C1NI 2ZXRA 3B2FA 3OLMD 2NN6H 3KQ4A 3DM3A 1CHQD 1WTHA 3Q69A 3PREA 5GXGB 3KBGA 4DXGA 3GV6A 3EUB2 2Z4HA 3NK9A 2KMAA 2EYMA 2EQSA 2L00B 5ISRA 4OW0A 2K75A 1Q8KA 1HNZQ 3HOUG 2V3NA 4DBGA 3OTOQ 1UD7A 2UYZB 4WQMA 4IWQA 1HA6A 4XX5A 2KWVB 2F0FA 5M5XH 2L1AA 2EYHA 2JA6H 2JN4A 3FPUB 4LF9L 4HPLB 4ZKCB 5E6JA 2F0TA 4OX9Q 5LMUL 3GTOB 1A0IA 1SMYD 1PTOH 2OXPA 1B9RA 1WR6E 4LF7L 3K59A 3N3KB 3U7DA 5EJWA 4AYBB 1WVLA 4IUPA 2G4DB 1KQSA 1E9MA 3RNCC 2RDFA 2NPTB 4DV6Q 4JBKA 1QG7A 4PNYA 2BQQA 1YI2A 3ZDTA 1VQAA 2CHWA 2EMTA 1XO3A 1PFBA 1GC7A 1VJKA 3CWIA 1CQVA 1RL2A 2GRIA 4KGRA 1SIJA 3S17B 1VCBA 3FHWA 1XNQQ 4BKGA 1N32L 3BZKA 2EJGC 4A3JG 3HOYG 2WV6D 3RI7C 1SRUA 3P75A 1EYCA 1DOIA 2B2WC 1LQBA 2Q5WD 4KDIC 3J80L 3SR6A 2FNJB 2EXDA 1C0AA 4XQNA 5HY6A 4DXAB 2RDHA 2ZM6Q 1QUQB 4HDOA 2M19A 2DYOA 5KHOA 3ZTDA 1F2ZA 4KJOA 3EJIA 1KNEA 2C9OA 3U4VA 1VQPA 1N5WA 4A3GG 3KJOA 4A3DH 1TYGB 2QSDA 3KLWA 3LDZE 3ZNID 2RGFA 3DMUA 4NP5A 3SDLC 3GTGH 3UGBB 1IKLA 3K0YA 3S2HH 1Q81C 2QEJC 4P71A 1HZBA 1IBXA 4XDDA 2PE9A 2L9HA 3CMEA 2K28A 1IBLQ 2A68C 2EPBA 1L1OC 2K14A 1K9MC 1P9DU 1WGDA 1ZE3D 2KC1A 2WDQB 1OEYJ 4GS3A 1B50A 3VUYA 2KMMA 3ONSA 3VUWA 4W9IA 1WI5A 5LXIB 1PH6A 2LASA 4MT5A 1TKEA 4V0BA 1NEKB 3CMMB 4DUZQ 2NVTB 1HZ9A 2UUCQ 3QJYA 1YMHE 3DVNV 3OMCA 1DXMA 1FNVA 2SNMA 4DR5L 1DZ1A 3V6CB 1M4VA 5GAGC 1EFWA 2J7QB 3JSVB 5ELFA 3L0OA 2UUBL 1NUCA 1XNRQ 2W54A 3NG0A 1X3PA 2RMMA 5IAAC 1J8CA 4NXML 2DNEA 3JW0X 4CQNA 2WS3B 4JK1C 2ZTCA 5BMGA 3L7ZC 3M4PA 4O0AA 3DVGX 1QOHA 1AFPA 1L2NA 3F2UA 1XLOA 2VQFQ 1E10A 2IY1B 2H5XA 4DR3L 5M5XB 2C35B 4B0MA 1R4NI 3A33B 3N20C 5EE0A 4CKCA 1EY0A 3MXGA 4B6WA 4DWFA 4IUQA 2WB1B 1KD1C 2IHEA 4DAMA 3SFDB 4L5RC 3K5OA 1A2TA 4DNRB 2B2TA 3PF5A 2V4LA 2KX3A 1ET6A 4JI8Q 4KZ0A 4XYOA
chains in the Genus database with same CATH topology
1CFMA 1BCPF 5NUCA 3C1EA 1ZXTA 4RF0A 1XXGA 1UUPA 4WRDA 1RJTA 4B08A 3I72A 1YJIA 2Y3AA 1PUTA 2DYMA 4ODGA 3SK4A 4HCSA 5BMHA 3MHZA 2BBCA 1FFUA 1C76A 1QILA 3NVZA 4DF7A 1Q12A 3VR8B 1FD6A 1FCCC 2IJ0A 4R8IA 4M0WA 1F2YA 3H94A 3I73A 3GTGB 1NI3A 1FM0D 4X3SA 2EXZA 4RKLA 5JEAG 4QIWB 3AE7B 4NZLB 2WXJA 5CBEE 5EPJA 2SOBA 2PYKA 3AEEB 4XE0A 2Z8LA 5DEHA 4L6TB 1SYGA 2NTTA 3P4RB 2CW0C 4MACA 3ZJUA 2EY2A 1IKMA 2EYJA 2MJDA 2CJNA 5A35A 4HJGE 1YNTE 5T1GA 1B1ZA 2B2VA 3SK5A 1U4PA 2K1BA 4CKBA 5KNCA 2XWJB 3R3OA 1PDXA 3MXUA 2LJIA 4XWTA 2PW7A 3EA6A 1ZUD2 1H9KA 4GLSC 3AM9A 2O2LD 4OL7A 3TDQA 4ZUJA 2EYFA 4TMAB 1BNZA 3HVDA 3N52A 3NQTA 3DWQA 1R7SA 1TWHB 2R6GA 5KYLA 3IAS1 5EE9A 1KFYB 4A3FB 2F0HA 1EY7A 1K83B 1JW9D 4UAIA 2NB0A 3BYYB 2QKIC 1D5ZC 3U52E 4K2KA 3ZJVA 1L4ZB 4ZQ3A 1GXDC 1MI0A 4GDLB 1I4XA 1SNPA 4KY5A 2V4DA 3NBIA 4YTMB 3D6WA 2Q8TA 3P1HA 3T51B 1H9RA 4F8MA 3AMZA 5ELBA 2L83A 4DA2A 2EY1A 5CV9A 5I2XA 1H9SA 3H0GB 1BOSA 3W1SA 4IURA 1WTWA 2QF7A 5J1ZA 4LMQD 3MFGA 5IIFA 1DD2A 5T1IA 1GUSA 4M1UB 5KYIA 3W3AA 3JAML 2DN8A 2IL8A 1P7EA 1D4BA 3FRPB 1HUNA 1I7HA 4DN4M 2XNAC 2JU6X 4L23A 5M3FB 1Y1VB 1TS4A 1F9RA 1BUIC 4KKTA 3SHLA 4DK0A 1V97A 1D1IA 2WU2B 3FVQA 1M8AA 5ELCA 1O7YA 2X6GA 2O5IC 3AE2B 1GHKA 4E6IA 4NAMA 2JSVX 2ID0A 3I57A 1ENAA 1GHJA 1RF2D 2BE5C 1J8IA 1G6ZA 1F2RI 3Q8FA 4ZHOA 3M85A 1OO9B 3MVVA 3P42A 3D4RA 4DFAA 1F2MA 1JOQA 3A54A 3NQIA 5I9OA 1DGJA 3MJ5A 3RZDB 1JE4A 2F3WA 4J6HA 1S5FD 3URYA 1YQ3B 1C8CA 2E3TA 2WLBA 2PIAA 1T5EA 2IWHA 5DM73 1UWMA 1JWAD 1VR9A 4P2CB 5KNDA 2JWUA 5IGBA 2NMQA 4FXKC 4N9TA 2V4IB 1Q90A 1CM9A 3I4NB 4ILWA 1PZID 3SE0A 3T4AC 1I50B 1IHZA 1EWYC 4KHZA 4DXFA 4FF1A 2IGGA 1B3AA 1KDCA 1RM6C 2FJ2A 1VF7A 1K51A 2KQ4X 1I4RA 1HHVA 4RF1A 4N59A 4ZKBB 2KQ3A 2NWGA 4H7BA 2JE6I 1WWTA 1BF4A 2B2UC 1HXYD 2PMZB 1XLPA 1DCZA 4L63B 2J53A 3AE4B 3J81L 1TVXA 4WAFA 5J39A 4HEA1 1SF0A 1JQYD 1D5MC 5M5WB 1PDQA 5EKKA 3GTKB 3PIP3 4IZ8A 2A6ED 1GUNA 3FMCA 4KN4C 2Y0SB 2EOTA 1I6HB 2R61A 3NXWA 1G2TA 2KEDA 2YEPF 3H09A 2JEBI 1FRDA 1JOOA 1DOKA 2BA1A 1K53A 1A70A 3K5MA 5H8YE 1GUWA 1K8MA 1BXTA 4J1MA 2PZUA 3HOYB 4A3JB 1XF5L 1SSNA 4CJ2C 5HFYA 3MXNA 3NUCA 3RD4A 1RTOA 2QJLA 1STAA 4N9PA 2BS2B 3G7LA 2TMPA 1LACA 5I6YA 4I7ZC 5BYSA 1ZXIA 4KGTA 2KDMA 4QUFA 4O1NA 1P7FA 3UI2A 3KLRA 5BYQA 5C4JB 4C7YA 1TWFB 2KHSA 2HDLA 4IUTA 4F88A 3K5LA 3D3RA 1PGAA 2VNUD 5IODA 1NR4A 3VA5A 2IGDA 3J80E 1AP0A 3W9CB 2LFNA 1RFKA 3CU7A 4M8AA 2PZWA 5EGTA 1FNUA 1KF6B 2D5DA 4KGSA 2F03A 5CV8A 3VYSA 1LT4D 3QO2A 4A3MB 1PFMA 3H91A 2ON8A 2AQ1B 2JYEA 2F3VA 1N62A 1RDPD 2NZ1D 1N5XA 1J9OA 2K0PA 2OHFA 3VR2A 3Q0AA 2INPE 5J22A 4HTHA 3WDNA 4EQNA 5FR3A 3PIO3 5JVH3 5G3LD 2OF1A 1YQ4B 2PW9A 2EYLA 3W5UB 3AE5B 5C0XJ 2AX5A 3K58A 2WP9B 4WORA 1R4QB 5K5PA 4REZA 3RFZB 2WDVB 1A3UA 2O5JC 4RCNA 5G5GA 1EZ8A 2PZTA 4X3TA 1DONA 2K5DA 2LGIA 3GTJB 5FO7B 2I38A 1DOLA 4A3EB 1N60A 2G9DA 1TWCB 1L6VA 4K2LA 4XQQA 5HG2A 2FFKB 1NAPA 1KNAA 4CJ0B 3DEOA 3SDZA 2JQRB 2AUJD 1CT1D 2F0IA 4TSSA 1TR5A 1ZP0B 2FBWB 5JPMC 4OZBA 3TP6A 3BDOA 4C3IB 3OHXC 2G1EA 1D2BA 3DM1A 3PUWA 1ONLA 1C77A 4A3BB 4MIUA 4US8A 1E6EB 2IW3A 1SXTA 3N6RA 5E4XA 3OPOA 1H9JA 3K6OA 3ZGZA 1LTGD 1ROEA 1F0ZA 5F2DA 2JXMB 1H9MA 1PRTC 1V1OA 4MM3B 3L4PA 5CORA 2L5TA 2KACA 3DUZA 5CV7A 3T3NA 4U68A 2E74C 4N6EB 1ZDXA 4EVOA 1VF5C 2LY7A 1PZKD 3R93A 5IOCA 4ZAIA 4C80A 5K36G 1PGBA 1ZYRC 4I65A 4EQPA 2R7ZB 1QNUA 4NDXA 2EKIA 1GUOA 1GPXA 3IT6B 1BBXC 1UEAB 1EFID 2JX5A 3TMEA 1LTAD 2B2TC 4FP5D 4DQOC 2BDNA 3NVVA 1F9QA 4CJ1B 2WXPA 4BBRB 4XYQA 4QF4A 1QF6A 3Q22A 1TZOA 3GO5A 2K5WA 2WNMA 1S5DD 2JP1A 1O78A 1STBA 5CV4A 4C3JB 4RKBA 1HPCA 1Q10A 1YNNC 3MP9A 2RSNA 1TWGB 4IFDI 2KVMA 2AWNA 2BT6A 1RWSA 4F7XA 1E0BA 2KJXA 2LMCB 2LUMA 1LTRD 3EGRA 3PMFA 2LHDA 3P4QB 1SYFA 1KAAA 4IQZA 1EEFD 3P63A 5FK9C 2NUCA 2YU9B 2F0PA 3ONAB 4PMWA 4RFBA 1Y1WB 1ZXHA 3Q23A 1QKZA 3S14B 3HG9A 1EOTA 3C8YA 3KLSX 3V2TA 2K04A 2Q8RE 3TP5A 2BOSA 3AECB 2TSSA 4BS9A 1U4RA 4TRDA 1L0XB 1A3VA 3J9CA 3JAME 2F0UA 3NE5B 1PYWD 4ZLTF 2AQ3B 2IPKD 1U4LA 3HS0C 1K50A 1O7LA 2L11A 2M56B 1LT3D 3G6JB 2N7JA 1CQFA 2B2VC 5A2QL 3VR5A 1V1PA 1CA6A 2WACA 2O4XA 3MXPA 2R92B 3TUOA 2QDBA 2JEAI 1FEHA 5IGEA 1ENFA 1BR9A 2LKVA 2PPBC 5BN5A 4OIJA 3DWMA 2JYOA 4YSZB 5CV6A 3NPPA 4OO1G 1B53A 5D3DA 1JWBD 1WCMB 1YNJD 1VDVA 2XRQD 2I07B 3AEAB 3K57A 2ENBA 4C7ZA 1PTOD 1EQVA 2MJEA 1FR3A 2JA6B 5IGGA 2J7ZA 1W6KA 3KWLA 2WXIA 4BA2I 2D5GA 1PTOB 1JWMD 1KDAA 4WURA 1AZQA 4WH4A 2E6XA 1WTVA 4HSPA 3X3MA 4LTUA 2XSCA 3U7ZA 1B4OA 1E2ZA 3AE3B 1PZJD 2KOLA 5LL6S 1QOFA 3VRAB 3TEXA 5TSSA 1ESRA 1E2VA 1ZKOA 2D2CC 1A3TA 3SXHA 4K5VA 4JX1C 3VRBB 1CK1A 1SYDA 2X6LA 1SNMA 4L8JA 3AU7A 4ZRPA 2L1BA 3AEGB 1F2LA 4A3DB 2VB3X 3J81E 4OVZA 5DAUA 3S2HB 2MJ3A 3LB8C 1EWCA 1PRTF 1SNQA 2MUYA 1FXAA 1NSNS 1HZ6A 5JEAJ 4KKUA 1C78A 5FKAC 3VYRA 1E2WA 1CTMA 1FGBD 1I4HA 5ELEA 4K6DA 2WXKA 1VRAB 2CVRA 1EY6A 5C3XA 5EKIA 1ZPSA 2J52A 4BY7B 2AWOA 2PQEA 1I6VC 4ZK9B 3MTSA 5HHDG 2I46A 4P6VF 3HRZC 2F0DA 2OT2A 4C3IG 1SE4A 2F0EA 2E2DC 5JVG3 4A3KB 1G91A 1MPEA 4B9WA 4NMZA 4UDUC 3GB1A 3B2GA 3DXJC 2JA8B 1NENB 4R9WA 1EWHA 1I4GA 1TS3A 2L0CA 3V3XA 2EJFC 3SVMA 2CJOA 4LLGM 4FVMA 3PZ8A 4G7HC 5FOBB 3U4EG 3AE6B 2WAQB 4IFDH 4J8QA 1KABA 4BBSB 1VZ6A 2EYOA 4Y7NB 2Q8IB 3AH7A 1Y56A 5T8IA 5CGKA 3HP3A 5D7GA 3OWFA 5C44B 3Q8CA 1C9FA 2F0MA 2Z1CA 5AFWA 1PFNA 1E7PB 1BCPD 4K5WA 2WKDA 3VR3A 2M2LA 2DBYA 1STNA 1U4MA 2F0NA 1BCPB 3NUHB 3CQZB 4C3JG 2R93B 4MH8A 4RH6A 5I4DA 4HKZE 1WD1A 5DM63 1TJEA 2FMMA 2B2YA 1N63A 1Q1BA 3IKJA 2QILA 5C5MA 1WYGA 2E2IB 3M3YB 5JXVA 1L0YB 1JQ4A 5ELDA 4RA8A 3TP7A 1C4CA 1JROA 1VZ8A 2BW2A 3QG1A 5I9PA 2NBFA 4KX6B 2FE8A 2DY7A 5EE3A 3M7NA 2K3UA 1IBXB 4FXGC 3I4MB 1G2SA 2A69D 5D65A 1OQQA 4WFN3 3MFYA 5EQ0A 3VYTA 2HCCA 5M9OA 3C2PA 2PTLA 1LTID 3J7AV 4RNAA 1HUMA 2KA7A 2BB6A 4V190 2B76B 1SBBB 3I91A 1CZWA 1RD9D 1EYAA 4AS1A 5EBDA 2J42A 2L32A 3T16A 4IUNA 1SMYC 4ID6A 1MHXA 4ZYSA 1A6XA 3I90A 4AQ7A 2EDGA 3FEWX 3PO3B 2RDGA 4ZRZA 1XCTL 3H3VC 4XQJA 2F1MA 4H0LC 3VR9B 1ICWA 3N9YC 1IYUA 4XTCS 3QWNA 3DWPA 3AEBB 2EY6A 1V8QA 2NN6G 3CHBD 2H1EA 4BWGB 1JWUD 3M4OB 5C3WA 1WGKA 1L5PA 2HUGA 1WTOA 2MP1A 2QIEB 4H44C 1J7AA 4TQUS 3SEBA 4RAUC 4A3IB 1NCVA 1SE3A 4A55A 5G3LF 3GTPB 5HURA 5CV5A 4TQ1A 1EEID 3TP8A 4C2MB 1EZ6A 1EY8A 2PO4A 2BTEA 2ZXPA 3AV8A 2K01A 2XVSA 1KLUD 3RUZA 1XLNA 1SEBD 4OZAA 2K33A 1DOYA 2MPMA 1B2TA 3E56A 3D8GA 3NVYA 3B9JA 3IFDA 2EELA 2VUMB 2RA4A 4YTPB 3P4PB 3FKIB 3A7LA 4JPSA 3TEZA 5C4XB 4KI0A 1JCKB 1LT5D 4GZYC 2A68D 2HDMA 4A93B 1IW7C 2D9UA 4KKJA 1BO0A 4KD4A 2WP8J 3OSOA 4A9AA 4US9A 5E3FA 1AWDA 2LMCA 4QCLA 2ZXOA 3BK1A 3BYTB 2WXMA 1ILQA 3RPFC 2YYZA 3W2DA 1D1KA 1FXIA 1NR2A 3OW7A 5E1FA 4XWWA 4HROA 4IOIE 4HN7A 4X3UA 4XT3B 5A2QE 3KLSA 5IT9L 2K32A 4PT5A 1OXXK 2IDYA 3EVQA 1YJJA 4YIJA 1PMRA 2WXFA 1K8OA 4J3OD 3NSWA 1GJXA 3S16B 1TY2A 3E0JA 1VMCA 2PKOA 3NWSA 3FAHA 2R3ZA 4CGYB 1YN3A 1EYDA 1KDBA 3HVZA 2RBMA 1XX8A 2FUG1 1EIHA 1WTRA 1QOBA 3T13A 2F0QA 3WOEA 4OIKA 2JSOA 4HMJA 1D5XC 2AUKA 3L3OC 5MPOA 4NAWB 1C4AA 4TQ0A 3MA2B 3PZ7A 1OQRA 2MGSA 3PUXA 3NP8A 1HEZE 5FLXL 2HTME 3AMUA 1PFDA 2CW0D 2HCIA 2J0TD 4Q0FA 1FIQA 1EL0A 1B9MA 2WDRB 3NHHA 4FF3A 2WXNA 1J7CA 4X3KA 4HKQA 3T53B 1XLQA 3EQLC 3MEHA 1CHPD 2WKCA 3Q8AA 2K05A 1LTBD 4Q2JA 5KNBA 1SYCA 1CZPA 1CZGA 4LK0M 1CA5A 1IGDA 3BWUD 1QOAA 2JA7B 4DAYA 1SAPA 2F4IA 4WWMA 3RZOB 3Q6SA 3P4SB 3BVZA 1VLBA 2B8FA 1U9RA 4WJWA 3P20A 4N58A 4MN3A 3AN1A 5EBCA 2B39A 4ARCA 3BK2A 4H13C 1O7ZA 3AB9A 1GUGA 2KUMA 1SSOA 1DOXA 5I2YA 5C0XI 1C4QA 4JBWA 2PVGC 1ET9A 3P1MA 3QB3A 3LNNA 2EJMA 3A8JE 3W5VB 2G9HD 1G8ZD 4C1NK 2BDOA 2ACZB 1VMPA 1F77A 3GP7A 4L2YA 1Z7TA 2K6AA 3ITPA 1HCZA 4YT0B 1BMLC 4LK1C 1NYQA 3DEPA 3QOLA 1XYIA 5M3MB 1QLBB 1FRRA 3I4LA 5M5YB 1MD2D 1WSPA 3OWEB 4KD3A 4K8JA 3GTQB 3J7YW 4HR7B 1SNDA 1PTOF 4ABNA 1B9NA 3MHBA 2N88A 1LO5D 4ZRQA 3E9SA 3GV3A 2EZVA 2MHVA 5LNK1 3MAQA 4YWGG 2IX1A 5EPLA 1HA5A 4QMGA 2N9KA 2A6HC 3LYYA 4BY1B 4RCOA 3HKZB 3QIAA 2F0SA 2JA5B 2WXGA 1VZ7A 2X38A 1F9PA 5I6WA 2PVOD 2WXLA 4XDXA 4JWSC 1KTKA 1TT2A 2BE5D 1QT9A 2CQAA 5D14A 1UGJA 1T5XD 1GUTA 5FO9B 1SJHD 2QMTA 1WRIA 3CRLC 4YSYB 3ND9A 5C3JB 2MH7A 2A73B 2W3SA 5LHY1 5IGFA 2FHTA 1V43A 1SYBA 2W82A 4KHVA 3HEJA 3MWYW 1JORA 2IX0A 4QUCA 4FO2A 4CBVA 3U2SC 1W6JA 1A2UA 3VQIA 2I2YA 1JOKA 1WTXA 3K7AB 3HOZB 2LS01 4R8NA 4KN7C 5KIXA 2BB5A 4FF2A 3FILB 1WD0A 1ACCA 1BDOA 4NJCA 1ZEQX 2A6EC 3TEYA 2XIWA 3HOWB 1D6EC 1L4DB 4G57A 2F0WA 2V0GA 2L12A 3KUPA 4C3HB 4G7OC 3IT4B 3I70A 1FFVA 3EROA 3I8ZA 4FYDA 1FYCA 4FXDA 1FCLA 3D4WA 2VXWA 2B8GA 2IT1A 1G291 1I4PA 4KKIA 1TIID 3KK7A 3ND8A 4FXCA 2BYTA 4XIGS 3S9WA 1T6BX 4PV1C 3PO0A 4PMBA 1SFOB 5IGDA 3TZDA 3C1FA 2F0JA 1GB1A 1HFGA 4K14A 1HRJA 2VB2X 1II3A 4EE2A 2BCOA 2DWQA 3X3NA 2SAKA 1YN4A 1STEA 1WTPA 3GTLB 1FNWA 3S15B 1TWAB 2B63B 3LX0A 4ME5A 5CYUA 3DWAA 4OZCA 4P16A 3IXSA 3RMHA 2FMCA 2A74C 3SR1A 1RKNA 3E6ZX 1QB5D 1NVID 1MI2A 1XWEA 2E2HB 4C56C 2B2YC 1IW7D 1FMAD 1EY4A 4KY6A 1JICA 5DNFA 1Y8PB 1ZDVA 2DY8A 2DLBA 2XRSD 1IGCA 5C4HA 2K22A 3KF8A 1HTPA 1LV9A 2N55A 3Q8EA 4RGTA 1DJRD 3D4DA 3TN2A 4OO1I 1STYA 2NVXB 4K6LA 1SYEA 5C0XH 2H88B 2BS4B 2JYTA 1TKWB 4DAPA 1ML0D 2NTSA 5D3IB 5CC4A 1T3QA 2F0OA 1AEXA 1XTCD 1QQRA 2V3PA 4L1BA 3AB5A 2N9LA 2RVLA 2GB1A 2RKSA 2XWBB 5EE1A 2B2WA 2PNRC 4G7ZC 4H2AA 2WXRA 1TY0A 1Y8OB 1MBYA 1AN8A 2QCPX 1TQOA 1PGXA 2LFIA 1R9TB 1C79A 3K5NA 3J7AF 4KTAA 5COYA 3GD7A 2C5CA 3NBHA 5C6AA 1MHHE 1EU4A 5JJZA 1RHPA 4KKSA 1Y69U 1TKGA 3V05A 3D6CA 5IT9E 3HOVB 4QB4A 2BA0A 3IL8A 3AEDB 4ITKA 5KEEA 3BVGA 4B0EA 1JC7A 4HMIA 4RWSC 1XEEA 2GI9A 1OXVA 3BG3A 5G5HA 4B9XA 2Z4IA 4IALA 2A5HA 2EE1A 4DK1A 1SE2A 4ZUIA 3CKIB 1QCBD 1EM7A 3QOJA 2CU3A 3A8IE 1S5CD 5AUIA 1DYQA 1WTQA 5K36H 3FC4A 4EGVA 5JAVA 1F2RC 3M7GA 4XXEA 4GDKB 4IDIA 4TKOB 5C2TB 3GTMB 4A6QA 2ONQA 3VA7A 4A90A 1STGA 4KMUC 4RGOS 3VR6A 4DNTB 1B44D 1TKYA 2H89B 1VCIA 5FLXE 1V1PB 5BN4A 1PRTD 3Q24A 3WOFA 2BS3B 3ERQA 3AE8B 1LTSD 5BMIA 3MZ5A 1SJED 3FDTA 3P7JA 1PRTB 3ZYYX 3HZXA 1V8CA 2K5QA 4HEDA 2N0SB 4G4KA 4CKEA 3TSSA 1CI3M 4PQXA 1TS5A 2JXTA 4RGMA 1EY5A 2VZKD 4RHRA 5JOBA 4ULLA 1Q8IA 1ZYRD 4PMCA 3SK8A 1QOGA 3GS2A 3ZQ4A 3A7AB 2VZKB 3TZUA 3OIPA 5IGCA 3PUYA 2NVYB 3KWVA 1XCQL 3IFTA 4OHJA 1LABA 1QNKA 4LJZC 2OEDA 2PLPA 1VDZA 1ESFA 2E2JB 2K7VA 2EYPA 1JR0D 1WXQA 2RSOA 1SNOA 4DAVA 4YSXB 1Y8NB 1I4QA 4C3HG 1ZOYB 4Z9CB 1YNND 2KCCA 3R8BA 1JWSD 2RQXA 2A6HD 2F0VA 1X32A 1Z47A 5HGTA 4NKLA 2PCFB 4USAA 5C4ZA 1HQRD 5H92C 5C3EB 1HZ5A 1LLRD 1Q1EA 2WXOA 4HAEA 2Y5PA 2WIIB 1OXUA 1AYFA 4U673 1HTLD 1AZPA 5C5LA 2L55A 3Q8BA 3V96A 4IUUA 3ZJTA 1SDFA 1J7BA 3NZ3A 3HUIA 3A56A 1E0ZA 1CJEA 4KJNA 3GQBA 1UAPA 4OO1H 4IN3A 3M4YA 1TS2A 3BVMA 1FD7D 3OIQA 3BS1A 5LL6X 1K52A 1TU2B 2SEBD 3S1QB 5CMDA 3NTIA 2E75C 3BDCA 4IKGA 5KGUA 3AE9B 3BIID 3HOUB 1MSGA 3U9OA 1YNJC 3FPPA 3SFEB 3S2DB 5KRUA 3LWUA 3T56B 2W55A 1Z6HA 1PTOC 4YXDB 1O80A 3OMGA 5EPKA 2F0GA 3SK6A 2HQEA 3PUVA 4RGNA 1C48A 5AUKA 4Q5VA 2ZW0A 2W3RA 3AEFB 1L0VB 1JMLA 4HSVA 1X3QA 2X69A 2L52A 1QJOA 3NTHA 2NN6I 2D62A 4XT1B 5FO8B 1JRPA 1PXUA 3HGBA 1KH0A 1HFNA 2AQ2B 3U9SA 2KWDA 4A3GB 2WQYB 4NW2A 1RTNA 1L6UA 2SNSA 1QE6A 4LAAA 3C3LA 1PLFA 1BQQT 3UI3A 1S5ED 2J4XA 5JEAH 1ENCA 4XDCA 3A8KE 1S5BD 2XN9C 3H6MA 3LWEA 3HRDD 3NVWA 1BUVT 1DOMA 2JZPA 1MSHA 2DNCA 3TBIB 3IAM1 4K5XA 4KK7A 5CBAE 1YN5A 1JB3A 2PW5A 1S4ZA 1STHA 2FINB 2LHEA 1MVKA 2INNE 1KLGD 4YTNB 4RHSA 1IL8A 1H9SB 3FILA 1NYRA 3O13A 2K9XA 3BDLA 3L9AX 4HCEA 3H8HA 2Y5CA 1IUEA 4JE3B 1HQMC 3CRKC 5BYRA 1A15A 1Q3LA 4ZHPA 4ARIA 2EVBA 2L4NA 5EKLA 2GA4B 1LT6D 2NVQB 1I3QB 5HI1A 3LXFA 1R4PB 4JWUC 4OGQC 3DHQA 5CR3A 1MGSA 2K03A 2MEKA 3I3CA 1FO4A 3OOCA 1JALA 5C0XG 3E5SA 3S1MB 1SNCA 2H4OA 1OXSC 3S1RB 1GB4A 1LTTD 2B2UA 1UWXA 4A8XC 2CHBD 3KBXA 2HDEA 3WCQA 1QWYA 2KCNA 4IUVA 2KEEA 2YEPB 3ETRA 4CHTB 1DM0B 1GAQB 2M9VA 3R2IA 3PUZA 3NRZA 2F0LA 4K8IA 2ZT9C 3PV0A 3A55A 1BCPC 2LEKA 3IAYA 3D31A 4BA1I 5JPNC 1EQTA 2NYZD 3HOXB 4O42A 4MHEA 2KN4A 3PO2B 3RLFA 2SDFA 3S1NB 4R3DA 4IFDG 4IFDJ 5BN3A 2OEOA 1F9SA 3NTKA 2KECA 4S3SA 1RYJA 1ILPA 1EU3A 3CIRB 1OFFA 1N61A 2K5PA 2EY5A 1IYVA 2WXQA 3T3OA 1EIGA 3AE1B 2ICIA 2M00A 3VR4A 4DU9A 2KAJA 3MC0B 1UNSA 4EQOA 1OXTA 1GOZA 1AW7A 3NS1A 1SB3C 2E76C 4WIPA 2A69C 3C46A 2IX3A 1RCVD 5E4WC 1KRHA 2RPVA 3ABVB 3TEWA 2ZW1A 4HRSA 2WINB 1C4PA 2PMVA 1EY9A 2IGHA 4FNFA 2WU5B 3R2TA 4ZOHC 4KY7A 4DGZA 2ICEC 2WXHA 4KV6A 3VYUA 2F0KA 3BZDB 3I9V1 3NWTA 1RODA 4D2KA 3DWGC 2MJ8A 4F87A 3EFXD 2M0AA 4FF4A 4C1NI 2ZXRA 3B2FA 2NN6H 3KQ4A 1CHQD 3Q69A 5GXGB 3KBGA 4DXGA 3GV6A 3EUB2 2Z4HA 3NK9A 2EYMA 5ISRA 4OW0A 2V3NA 4WQMA 1HA6A 2F0FA 2L1AA 2EYHA 3FPUB 4ZKCB 5E6JA 2F0TA 3GTOB 1SMYD 2OXPA 1PTOH 1B9RA 3K59A 5EJWA 4AYBB 1WVLA 4IUPA 1E9MA 2RDFA 1QG7A 4PNYA 1XO3A 1PFBA 1VJKA 3CWIA 1CQVA 4KGRA 2GRIA 1SIJA 3S17B 2EJGC 2WV6D 3P75A 1EYCA 1DOIA 2B2WC 2Q5WD 3J80L 3SR6A