1KTKA

Complex of streptococcal pyrogenic enterotoxin c (spec) with a human t cell receptor beta chain (vbeta2.1)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
203
Chain Sequence
b'KKDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin type C
publication title Structures of two streptococcal superantigens bound to TCR beta chains reveal diversity in the architecture of T cell signaling complexes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 50
structure length 203
sequence length 206
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ktkA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ktkA01
1TS3A 4RH6A 2O2LD 1S5BD 4DXFA 4TSSA 1TS4A 1BCPF 3EFXD 2IPKD 2R61A 3CHBD 4UDUC 3R8BA 1PRTC 2IJ0A 1I4QA 1I4GA 1ET9A 1CHQD 1HA5A 3BVGA 1S5CD 4RGMA 1MD2D 1QILA 1PRTD 5D3DA 1YN4A 5ELDA 5D3IB 1LT4D 1XXGA 5ELBA 1B44D 2QEJC 4RGNA 1EEFD 5ELFA 3TSSA 2J4XA 1HTLD 3GP7A 1BCPD 1BCPB 4NZLB 1JQYD 1TS2A 1XTCD 1SEBD 1ET6A 3MFGA 1L0YB 3KLSX 1SXTA 4DXGA 1FD7D 4OHJA 2G9HD 1KLUD 4L63B 1LTID 1T5XD 1EU3A 2AQ3B 1S5FD 1F77A 1LTRD 2XRSD 1D6EC 1SBBB 1FNVA 5FKAC 1YN5A 2SEBD 2CHBD 3R2TA 1D5MC 3BYTB 1I4HA 1SE2A 1BXTA 4RHSA 1I4RA 5ELCA 3MC0B 1BCPC 1S5ED 5I4DA 1RCVD 1RD9D 1UNSA 3DWPA 1JWSD 1PZID 1RF2D 3EA6A 3O13A 1M4VA 5FK9C 1PZKD 1V1PB 3URYA 4ZYSA 1L0XB 1HQRD 1CT1D 1EEID 4RCOA 3R2IA 1LT3D 1GOZA 1FNUA 3BVZA 3OWEB 1EWCA 3BVMA 1AN8A 2TSSA 1G8ZD 3SEBA 3BYYB 1STEA 1PTOF 3DWQA 1LTTD 1TS5A 4Z9CB 1LTGD 4RHRA 1EFID 1FNWA 1TY2A 2XN9C 4O1NA 4RGTA 4L6TB 2XNAC 1EU4A 1S5DD 1JR0D 2NTTA 1PYWD 1LT5D 1PRTF 2RDHA 3W2DA 4RFBA 1LTBD 1DYQA 1LLRD 1V1OA 1PTOD 1PTOB 1I4XA 1I4PA 2WV6D 2XRQD 2AQ2B 2RDGA 1KTKA 1B1ZA 1DJRD 1KLGD 2QILA 4K6LA 1JCKB 1LTAD 3V05A 1CHPD 1YN3A 2AQ1B 1SE3A 1CQVA 1UUPA 3BZDB 4RGOS 1HXYD 1TY0A 1PRTB 1CK1A 1FGBD 1JWMD 5TSSA 1ESFA 1PTOH 1SJED 1SE4A 2Z8LA 1PZJD 4BWGB 1RDPD 5ELEA 2NTSA 1SJHD 3DWAA 4C56C 2ICIA 1LO5D 1JWUD 1ENFA 1LTSD 1D5ZC 1PTOC 1AW7A 1V1PA 1LT6D 1D5XC
chains in the Genus database with same CATH superfamily
3RNEC 2O2LD 3DM1A 2K6AA 2E6XA 1MJCA 4H2AA 2YU9H 1UE5A 1YVCA 3GD7A 5DM73 1EQQA 3K9PB 2JZPA 5LL6S 3CCLA 4IOIE 4LF9Q 3RNFC 2R61A 3OSOA 3R8BA 5LL6X 3AMZA 3H7PA 4P72A 3RN5A 1S5CD 2OTLA 1QILA 1PRTD 4L8JA 1PH3A 4LF9L 1AYFA 3SD5A 4QAYA 4DNIA 1FO4A 3MEFA 5H8YE 1UBIA 1XXGA 1GB1A 4IM0A 1IHZA 4W9IA 3I57A 1II3A 1FXAA 4X57B 4JYAL 3A74A 1T0SC 4NMZA 5E6PA 3KOJA 3S24A 4C3HH 2XIWA 1EIGA 4OZAA 4MELA 5IP4D 2GVAA 1FD6A 2A19A 4JOIC 4U68A 2LKVA 4HRSA 3PO3H 1VDVA 4NQKE 1QVFA 1VMCA 2O2VB 3N30A 3A4RA 4FF1A 5BMHA 2K52A 5M3FG 2K6QA 4MN3A 2O6VB 4LFBQ 2LVQA 2ZPNA 1J5EQ 3HP3A 1OEYJ 5KNCA 3UQBA 2CS4A 4OELB 4RHSA 4IOAA 3AEBB 4IJHA 4OIJA 3MC0B 1E22A 4BBRG 4YTNB 1RCVD 4B0EA 4DK3C 4ABNA 1RODA 5CGKA 1A2TA 3GTOB 2EYPA 3NEMA 4BY1G 4GLSC 1K3RA 4DHJD 2O5JC 3M85A 1GKHA 4UP9A 2MQHA 2G3QB 4N9F4 1IP9A 2KFKB 2KT7A 1BUVT 5E4XA 2PI2E 1XTDA 1YIJA 2R7ZH 2O5IC 1H9RA 1AN8A 1GUSA 3K80C 3ND8A 1TGZB 2B2WA 4A9AA 2HD5B 4DF7A 4BOSC 1S72A 2BS2B 1LTTD 4Z9CB 2WU5B 1CZGA 1C4AA 4JI6L 2K8CA 3ETRA 1GNUA 2K5QA 4L6TB 1U4AA 4DAVA 4YWLA 3ONSA 4A3BH 4YSZB 4DV7Q 2HQEA 3AN1A 4A8XC 1PRTF 3UDFA 3IT4B 3H8HA 1ZKHA 2RDHA 1PV4A 2LUMA 3GTPH 4IW0A 1XMOQ 4ZAIA 2CJOA 1VDZA 3CP0A 1DYQA 2A5HA 1Z5SB 1JJ2A 1QOGA 4X66Q 2VH2A 2L00B 2YVCA 2QILA 4K6LA 1VQHA 1PFBA 3T16A 2KK8A 2IY1B 3JAMc 3JAME 4K0KL 2F0IA 5BYRA 3PLVA 2BGFA 4JI4Q 3I56A 2VY3A 2B76B 2LXCA 4JW0A 3LJ3A 4P6VF 2UXBQ 3AEDB 3TZUA 1WXVA 5C3JB 2LGYA 5JHBA 4HROA 5IAAC 3IFDA 3S15B 5ELEA 3NP8A 2JX5A 2LRUA 3ZXVA 1I50B 1E24A 1E2ZA 1KRSA 2G4SA 5H92C 1LYLA 3O65B 2M0AA 2HT1A 4CKBA 1B9NA 3A55A 5FLXL 3W3AA 3S1QH 2YEPB 2MLBA 5LXHA 4R1JA 2EY2A 4IPCA 3K57A 4R4OA 1UBQA 1QJOA 3OYYA 2E3TA 1W6KA 3UIPB 2N1VA 3HM6X 3JW0X 4RM9A 5KHOA 4LJZC 2IJ0A 5JAVA 1TWHB 2KNBA 4HVBA 4C1NI 4V0BA 1VQLA 2JJQA 2INDC 4XDXA 1Q1OA 2F1MA 3PIOA 2W9NA 5IYCH 3FP9A 1Q7YC 4HXDA 4ZUIA 2JXMB 1Q81C 1NMGA 3RPFC 5M3FH 3G48A 2D2QA 3DUZA 1VQAA 2MP1A 3W1SA 4DPGA 2R3ZA 4CDFC 2MEKA 3IL8A 3DOWA 2Q8IB 4JI2L 1XJVA 2XVSA 1WZ3A 3IVFA 2NZOA 5T8IA 3H1UA 2L11A 3A8IE 1AP0A 1CTMA 2KZRA 1CA5A 4JBWA 1SBBB 2L76A 4US9A 2VQEL 3IAS1 3IBEA 1E5WA 2QSDA 3A9KA 2KEEA 1ZYRC 2IO3B 1VMPA 3P42A 3ITPA 3OW2A 1PGBA 4ILWA 4JWSC 5KRUA 2P5ZX 2BBCA 2KAJA 5D7GA 5G2NA 2VB3X 4IPHA 1EIYB 2M56B 3NUHB 1HH2P 4ME5A 3U4ZA 2KOXA 1A3TA 2RDFA 2JXXA 2REXA 3L9AX 1HQRD 1CT1D 4DQOC 4RCOA 5E3FA 4OWXB 3EIVA 2WFWA 4IQZA 2DHZA 3L13A 1MBYA 5JEAG 1STAA 1X3FA 3GV6A 3SDZA 4CKEA 2WXLA 2EY1A 1WVLA 1P9DU 4ZHOA 2ZNVB 5E1FA 1DGSA 4GB9A 5FOBB 2QCZA 2M1MA 5FR3A 2SNMA 4IZ8A 1MG4A 3HFZB 1V81A 3OTOL 5EAYA 2ONQA 1ENAA 4NY0A 1VRAB 1O78A 2DZKA 4LJPB 2KQ3A 4PS7A 2YTVA 2KMMA 1D3ZA 3A56A 1A63A 4IC7B 5G5GA 2MCNB 2XN9C 2MA9B 1QWYA 3BWUD 5ELOA 2KUMA 2JZ3B 3E56A 2ZZPB 3X3NA 1QF6A 2JK8A 3LX0A 1OXVA 1EY4A 2Z9HA 1IL2A 1RFAA 2JYOA 1GUNA 2NYZD 2PLPA 1CSPA 4JI3Q 3GE3C 3SR1A 1SF0A 3P4SB 2FFKB 2ZXRA 1V1OA 3ML9A 4DV6L 3ZRFA 3JC66 1Y69U 1YJWA 4K3BA 3MXNB 2XRQD 4LFCL 1QG7A 1RJTA 3ZKJC 5GAEC 1B3AA 2LHEA 4HPPA 3AU4A 4F7ZA 3FKYA 1EIFA 3SGIA 4M02A 4I6PA 1HXYD 2AWOA 4IUPA 3PO0A 3OAWA 3ZVVA 3ULJA 4A3KB 1PH8A 2KYWA 4DR5L 4A3MB 4V190 3HKZE 4GS3A 1EF5A 4K3CA 1HNZQ 2RF4A 4JWUC 5C5MA 2NPTA 2MO0A 2QHOA 3Q2AC 2KQ7A 3QJZA 5LMUQ 4ZKBB 2DGYA 1KNEA 2RVLA 2B2YA 1L0VB 2GRIA 2INNE 4P1BC 1NR2A 3T56B 5FJ8G 3AM9A 4C3JB 4MJSA 3QA8A 4FULA 1SYEA 4BBSB 2HHHQ 4DXFA 2HIVA 3C19A 4DR7L 1Y56A 3PRPB 3SE0A 3VAWA 5IOIA 4HN7A 3KLRA 3I4NB 3VA5A 2K1FA 3HOZB 3I90A 1RTOA 1WMHA 2KCTA 4LF4Q 3U52E 3V3XA 1V1QA 4JV5Q 4RGMA 1MD2D 1WJUA 2Y3AA 4GIVA 3Q8FA 1SMYD 2ZCBA 4ACFA 4IKGA 5IGFA 3J80c 3J80E 1T3QA 5CHVC 4A3IH 4ZUJA 2JEAI 1CKNB 2J4XA 1FR3A 1A6XA 3MWYW 2OEOA 4MM3B 4EUTA 2K33A 1J7CA 1FGUA 1YHBA 1ROEA 4IUNA 4B3SQ 4GOPB 4GDKB 4RKLA 4EZJA 3K5OA 3F2BA 3PIPA 3I73A 2UU9Q 3HKZB 2XTIA 2WXFA 2PW9A 2N8NA 1ZXTA 3V60A 4ZDVA 5EPKA 3RCZA 1QCBD 1SE8A 3D31A 1HZAA 5ISRA 1R4MB 2HCIA 5JEAH 3ZNID 5L95C 3D32A 2VUMH 2LEKA 3FILB 2GBJA 2HJ1A 1RHPA 2J7ZA 2L1AA 3PO2H 5I6WA 1C1YB 3N20C 2MJEA 1JICA 4A3KG 3A1QA 2L5TA 4K14A 1VCIA 2KKCA 4W9FA 2ZT9C 4BOZB 2Y5BB 1Y1VB 3IKJA 2GBRA 3RD4A 3RUIB 4JI8Q 5E4WC 5I9PA 4UHVA 3C0RB 1G291 4EEWA 2K25A 3BY4B 3J7ZC 4YWGG 1O7IA 5EKLA 1K8RB 4KX6B 3S2AA 3ZNGC 2WS3B 1N63A 4PMWA 1SFOH 3OOCA 2KA7A 3KVFB 4C3IH 1AZPA 3FVQA 2KQ4X 3ZGZA 3I4LA 4IOCA 1D7QA 3M7NA 2MJ3A 3EQLC 1PTOF 3TEWA 3RNCC 3RN2A 3I4NG 3BDCA 3M95A 1FVIA 3HOZG 3AEEB 4A3OA 1TKWB 3WDNA 3C3LA 1RKNA 1VQGA 3I3CA 3CCRA 1R4PB 4L5SA 3UQAA 1IGCA 4E6IA 3UIOB 1E3PA 1S40A 2LD9A 2E74C 1LXDA 3HUIA 2IL8A 4ALPA 3DBSA 3JSVA 1H4RA 1LLRD 1DOKA 2N55A 3A33B 4WJQA 2PO4A 4DR2L 2WV6D 4XT3B 1EO6A 4KIKA 1B7YB 5KYLA 5IO9A 3T9LA 3NS1A 4LF8L 2RDGA 1V97A 4FXCA 4N8X1 4BKGA 3U7DA 5IT9L 2PNHA 4DWFA 5IYBH 4GDLA 4PT5A 3RT3B 3QWNA 3MP9A 3KH0A 1T0QC 2FCSA 1BDOA 1TY0A 1EM7A 3M4OB 3D6CA 1C78A 3PCOB 1WRIA 4DNRB 2EIFA 4S0RA 5DPSA 1IXRA 4B3RQ 4QQBX 2NVQB 1E8ZA 3HG9A 1OFFA 2ZVNA 5EDSA 3J7A5 4N8FA 3B2GA 3RLFA 3VR5A 4BWGB 5EBCA 1GHJA 2F4VL 1TWFB 2XWJB 2MJDA 3NVVA 1TQOA 1PDQA 1MSHA 3S2HH 1I3QB 1LO5D 3APDA 3T3OA 2R92H 1IW7D 4G3XB 2F0GA 4N58A 2NMQA 1TS3A 1TWGH 3T1HL 2I1KA 3KDFA 1Y1VG 2J42A 4D2KA 2L32A 1JJGA 1HZ6A 2LJIA 2WWZA 4B9XA 4G7HC 4J3OD 3V2TA 4H0LC 1I4QA 3ICEA 2NVYB 4R4QA 1ILPA 3L54A 4P74A 2RHQB 3JYUA 3NSWA 2KDIA 2F0KA 1WXAA 1YX5B 4OWTB 2SNSA 1EEFD 3TSSA 4EQNA 5A2QE 4FVMA 2BYVE 1O7LA 1IW7C 2KTRA 3Q3OC 5G5HA 3TL5A 2LMCB 4G0NB 2FIDA 3N1YC 3S14B 4DXGA 5D65A 1Y8RC 1WGHA 4PNYA 4LFAQ 5M5WB 2BT6A 2FUG1 2AHOB 3W5VB 2VRRB 4GGQA 4FNFA 4JQWC 2KLGA 1LTRD 1YJ1A 1D6EC 1Y8NB 1JRUA 1VQBA 1WTXA 3TS0A 2A74C 2JEBI 3T8MA 4OO1G 3QC8B 1ASYA 5ELCA 3BS1A 1WYGA 3IFTA 4A75A 4LNOA 2AWTA 3DWPA 2EPBA 3P7JA 3NS8A 2NBFA 3VA7A 4NAMA 4B6WA 1RLFA 3KWVA 4NKLA 4A3CH 2XK5B 2L4NA 4ZYSA 5KYIA 1UGJA 2V0GA 1P7EA 3K58A 1EOVA 1X55A 2B39A 1MHXA 1RAXA 1RIPA 1XPOA 3P63A 4XDDA 3X23A 1P1AA 1G2SA 2JA7H 1EUJA 3TDQA 2HUGA 4ZK9B 1HJPA 2E2DC 3OWEB 4RM8A 1Q8IA 1F2YA 3I3TB 1XMQQ 3BU2A 3KUCB 3VUYA 1TIID 1D1IA 3I4MB 5E6NA 3NBIA 1H9JA 1AARA 2KEDA 5CBAE 3C2PA 1STEA 4BY7G 2D3GA 3DWQA 4A3DB 1TS5A 3QAQA 1KAAA 1HFNA 3K7AH 3ZRCA 1OXSC 1PUTA 2EYHA 2A73B 3NE5B 2D10A 5BO4B 4P2CB 1KL9A 4EQOA 5L83A 3W1BA 4DR6Q 2Y5PA 2KC1A 3AV8A 1EY5A 1UE6A 1UELA 4DV5Q 1LTLA 4O2DA 3J7AV 2E2JB 1J19A 5AJ3Q 3S1MH 1Q10A 1N36Q 2QW7A 2E5LL 3NQTA 1I4PA 3K0XA 5CR3A 5JPMC 4DV0Q 2ZNVC 3N1XC 3OG5A 3AE3B 2EVBA 1XX8A 4W9CA 5BMIA 3V05A 4IURA 1JCKB 1N36L 2UUBQ 1UF0A 3ULLA 4HJGE 1D4BA 5GAHC 4Q2JA 4DV0L 1PLFA 4RGOS 4AP4C 1OXTA 1Z7TA 3OW7A 1PH4A 4KMUC 4OXPA 2BS4B 1CZWA 2K6DB 2GOWA 2KJXA 2UUBL 3HRZC 3RZOH 2VZKD 1F2RI 4QCLA 2CH4W 2CR5A 4ANVA 3TN2A 1KM7A 1WWTA 4DV2L 3WIMA 1DOMA 4PZ8A 2YU9B 2BYFA 1SN8A 2V1CC 2ZXOA 2ENBA 3QOJA 4LK1C 3I91A 3HGBA 1IKMA 4A3JH 1YD8U 2B3AA 3GZNB 2KCNA 2PYKA 1RM6C 3EFXD 4HDOA 2D3AA 5EE3A 1O7YA 3KYDD 1T5EA 4EQ5A 1N5XA 4FHKA 3ZQ4A 2BH8A 5GXGB 4DUYQ 1BBWA 4C3HB 4MDKE 1UWMA 4ZRKA 2BWFA 1WJNA 3TEHB 2I1JA 4L2YA 5C23A 4KHVA 2D3BA 5ELBA 3RZWC 2WXMA 3N1ZC 2NUCA 3CQZH 5ELFA 4DV1L 1AWDA 4UPAA 3PO3B 2JU6X 4NZLB 1X1MA 5JH5C 4IALA 3GTLH 1AH9A 2RA4A 3KF8B 1HNWQ 1XQQA 4K7SA 4LNKA 4A55A 5LXIB 4LF7L 1GB4A 4KGSA 1VQKA 3RULA 1RL2A 1VF5C 1EQVA 1LACA 3L10B 4RF0A 3CW2C 1L6VA 2EXZA 3S2DH 1ONLA 1E9MA 3CF6E 1EZ6A 5IGDA 1UZXB 2KDEB 1EF1A 4EZKA 1SYBA 3Q14C 4TQ1A 3SHQA 3ERQA 3WAMA 1NTGA 4BFRA 2V4IB 2R2OA 2CHBD 1VJKA 3BYTB 1ILQA 1YHQA 3A8KE 1SE2A 4NJ6A 1E7UA 1XLQA 1I6HH 1SIFA 1B2TA 2JZZA 4J1MA 2WDVB 4IFDJ 5FO8B 5I2YA 1PYBA 4OZBA 4YCUA 3PREA 2R7ZB 3H0GG 4GOPC 3NBHB 4FP5D 2EELA 1X3GA 1K83H 1PZKD 2N3SA 3QO2A 1OTRB 3H3VC 3CXCA 4PQXA 3U50C 2Z0DB 4DR1L 2Q5WD 4H7BA 1F9RA 2AKWB 1P98A 2K1BA 3V6EB 3TQYA 2K9XA 3BVZA 3M4PA 3A9JA 2MHJA 4DUZL 5JJLA 3PZ8A 3H7PB 4K8JA 3VR8B 1AE2A 1B9MA 4N9TA 2C35B 4F7XA 1UGMA 1JROA 3GTPB 4CQNA 5JXVA 4XX5A 4O1NA 4WWMA 1HFGA 4LNIA 4C3HG 2ZM6Q 5C4ZA 3RLOA 1XNQL 1FJGL 2K0PA 4ICUA 1HRJA 1VS0A 3MJ5A 3HOUH 1PDXA 4LTUA 4PMCA 3FDTA 3PO3G 4GMVA 3Q24A 2GB1A 4ULLA 4WURA 3UI2A 3K81C 1DXMA 2TMPA 1WYDA 1B1ZA 3Q8AA 2KECA 3NQIA 1WGRA 3J81j 1F9SA 3ONAB 4DR3Q 3B08A 3ABVB 3OMCA 2KWVB 4K1RB 2MGSA 1NBWA 1NMFA 5TSSA 1MI2A 3CCSA 2ZVOA 3GOEA 3S1QB 3NTIA 1GC6A 1TVXA 3ZTDA 2W82A 4CHTB 2F0FA 2GI9A 4P75A 3MFYA 1K0SA 5IGCA 1TWAH 4XYOA 3HOXH 3PMFA 2KCCA 3ZYYX 1WTOA 3IHPC 3KQ4A 3JAML 2D3CA 3W1YA 3CPWA 4ANUA 1N32L 2BA1A 1Q82C 2UWQA 1LT6D 4NXNQ 1QOBA 2R7ZG 2LVPA 3R3OA 5AZGA 5J2RA 2JPHA 3A7LA 3CIRB 4LLGM 1QZHA 1Z6HA 1GPXA 5IWAQ 1TS4A 5M3FB 1QUQA 3Q8DA 5FO7B 3TS2A 1IBLL 1OGWA 2IGHA 1YJJA 3S1RH 3W5OA 1K8GA 1U0LA 1K9MC 2EMSA 4A3BG 2LY7A 4IUUA 5ELDA 2JP1A 1FRRA 1VQCA 4X62L 4XC2A 2ZJQA 1U9RA 1SSNA 1TIFA 5JZEB 3RLNA 1N34L 1N33L 1L1OA 3E9IA 4S3SA 1GJXA 2KJRA 4JI7L 2N0SB 1L2NA 1VQ5A 2K03A 1NDDA 2VL6A 1CQFA 3QX1A 3CCEA 1Y1WH 4KK7A 4J15A 3KUPA 3VYRA 2M17A 4ZYNA 2PJHA 3PSEB 1SAPA 1IPGA 2BW2A 3I9V1 1IGDA 2I07B 1SSOA 1HR0W 1STGA 1K53A 1D5MC 1VZ8A 4KLKA 1A3VA 2PIAA 2Q2IA 4IWQA 4TUUA 1BXTA 2L12A 4A76A 3VR4A 4HJ9A 2G1EA 1C4QA 1JW9D 3U4VA 4LDTB 3E5SA 1HPCA 1TWCB 3L7ZC 5I4DA 2AL3A 1WI5A 1Q46A 4TMAB 1C4PA 1G51A 4K2KA 2AWNA 3O13A 3A7AB 3Q3FA 1BT0A 2CU1A 2JSVX 5M5YH 5JJIA 2MBQA 3WCQA 1ML0D 3OIQA 1MI0A 4UP7A 1TXYA 1PH6A 2KFJA 1XO3A 1FNUA 1YIWA 2NZ1D 2QA4A 3J9CA 1O7ZA 2IO1B 1QT9A 4IWOA 4B9KA 4CJ2C 1IBXA 3SEBA 2EQSA 5IYCG 2RKSA 2D5DA 3BYYB 3P4PB 2JA5H 2CHZA 5DAUA 4FBJB 3NUCA 1Q1BA 3VHTC 2FINB 2EZVA 2MSED 1VR9A 1SNMA 2EOTA 1KIXA 2LVOA 4Y52H 1XT9B 4NAWA 4EZLA 1EZ8A 3WOFA 1DOIA 5D94A 2PEAA 4LFBL 3C1FA 3CWIA 4HIDA 1T0YA 1J5EL 3K9OB 3HIZA 1AE3A 2Z6BA 1L7YA 2R2QA 2F3WA 4ZOHC 1XPRA 2PW5A 1VQEA 1H9MA 3KWLA 1XEEA 4K81A 5M9OA 3MTNB 3FC4A 4MGKE 1T9HA 4B0MA 4QUFA 5I6YA 2HJ8A 2OEDA 3OJ4B 2AX5A 2BTEA 1LTAD 2DX5B 2Z59B 1CHPD 2H4OA 3A9KB 2DNEA 3WOEA 1WD1A 3ZDTA 2EY6A 5FLMG 1ENCA 1MIUA 4GKJQ 1SB3C 2B63H 5IGBA 2WDQB 4I7ZC 2QKIC 1ZGUB 1UEBA 5LMNW 2KJHB 4EX5A 1VQDA 3NRZA 4MTKA 3ZIMA 2QDLA 1HNXQ 4HPLB 3ZNZB 2WU2B 4MT5A 1ENFA 2PPBC 2MUYA 3VYSA 4X6AH 2KTFA 4A3FH 3CC2A 2EYJA 1XYIA 2MP2A 2LZ6A 5M3MG 4DV7L 4PG3A 3W5UB 1WGGA 4GLVB 3J7AF 1WY8A 2F0OA 2M19A 1WFYA 3BINA 4A3IB 1RYJA 4KV2A 1XMOL 4QY7A 4A3GH 2DN8A 1Z2MA 2DJGC 5CV4A 4IFDG 3H09A 3CCQA 1X32A 4WRDA 3AU5A 3BVGA 2DBYA 4X66L 4FYDA 3U8ZA 1YBYA 2B2TC 1PMRA 1ACCA 3AE2B 3F2CA 2KC2A 3D8GA 1YQBA 5D3IB 4JCVE 1Q1EA 1I94Q 1B44D 2B2VC 1PH7A 1I6VC 1HTPA 1BCPB 1J9OA 1HR0Q 4JI4L 5EKIA 2J0KA 4HSPA 4JGHB 5CTRC 3SK5A 1X54A 2UXBL 2CJNA 2VUMB 2ALYB 1KNAA 1STNA 3HOVH 2BWES 3J80L 1EU3A 3ZJTA 3V62A 3MVVA 4KSKC 1N5WA 5C4XH 2IDYA 4GNXA 1R7SA 1JALA 2HQLA 2CWAA 1FNVA 3TP8A 2OCEA 1DCZA 1GUWA 5M5XH 2Z0SA 1JORA 5HURA 2Y0SB 3TP6A 4NNJB 4IFDI 1NY4A 4WAAA 3S1NB 4K2LA 1VQJA 2BCOA 2OOBB 1ZYRD 1EWIA 2PW7A 3MA2B 2LFIA 1PQSA 2BE5C 1H9KA 4B3TQ 4HLEA 2DAJA 5IOCA 2IX0A 3VR2A 3RZDH 1BBXC 3LB8C 4W9HA 1NSNS 5FK9C 1BKBA 2F0PA 5AUKA 4MJSB 4WJPA 3U4EG 4CGYB 4KHPQ 5C0XJ 3PHWB 1EY0A 4HIMA 1TT5B 4P71A 1OTCA 2JA6H 4PYZA 2D2CC 1GO3E 4JK1C 3U9OA 4DV3Q 2O2VA 5TR5A 2KO3A 3AE5B 3CRKC 1CMXB 1Q5WB 1WMHB 2J0MA 4XT1B 1QB5D 5CV8A 3TP5A 4K8IA 4A3IG 1JB7A 2UUAQ 4LNQA 1K28A 1EFID 2VZAA 1ZUD2 1TY2A 3M63B 2W55A 4QGUA 1WGKA 5FLMH 5HKHA 3PRZA 3ECIA 4DAYB 1GVPA 2AUKA 3TEXA 2DNFA 2JSOA 1Z47A 4KN7C 2I5MX 3LXFA 4HIOA 1N6ZA 4J8QA 4KY7A 2MHVA 5C6AA 2KFKA 4C00A 3B6YA 1MG8A 2KWCA 4DK6C 2VUMG 1IUEA 2B29A 2ZJRA 1WJ4A 2K28A 3D6WA 5LMNQ 4KDIC 3VYTA 4I7AA 4OVZA 2B8GA 1UUPA 5M3MH 3PO2G 3S2HB 2NVTB 1XF5L 2NS5A 3RMHA 2RSUA 3BIID 2R92B 5I2XA 1ESFA 1PTOH 3J7YW 4C1NK 2F0DA 2X8XX 2F0VA 1SE4A 3W1GA 4IFDH 2Y0SG 1SYFA 1FFVA 2KMCA 1X65A 4HSVA 2IGDA 5BN3A 3HS0C 5CC4A 3DBRI 2ZCCA 4MH8A 2KD0A 2SDFA 1Q0WB 4HJ8A 3B0AA 4LCDE 4B9WA 1AW7A 3QR8A 4KKTA 5LNK1 2ZXPA 4C3IG 1JWAD 1E7ZA 2M0XA 2JQOA 1KJTA 4C7ZA 4KDLB 1STBA 4UDUC 4JI3L 2V4LA 1V9JA 2OJWA 2IO0B 3QWZB 4YCWA 4LNNA 2L1BA 1L5PA 4EQPA 4N6EB 2M2LA 1KAWA 4BXXH 1A2UA 3RFZB 2EKIA 2V3NA 4H02A 2PI2A 2M4NA 2DZMA 4YWMA 1SIJA 2FNJB 3VH3B 3GO5A 2FE8A 1SEBD 2SOBA 1OQRA 4ARIA 5HGTA 1HNZL 1SE9A 2N7EA 3LDZE 2WNMA 3UF8A 3G4SA 4KIKB 4WWOA 4US8A 5IYBG 2B2WC 5LMUL 1QVGA 3IXSA 2CU3A 3X0WA 1S5FD 4NB3A 4IPDA 5CV5A 1E1TA 1IBMQ 3L4PA 5BN4A 5BR8Q 3Q6BA 2WIIB 1C77A 1KH0A 1GD7A 2SEBD 3DBLI 2HHHL 2CH4A 3K5LA 3ND9A 1A15A 4QUCA 1XD3B 1E6EB 4LUVA 1C79A 2WACA 1YMHE 3CSFA 5AFWA 1NI3A 3OHXC 2LUEA 2KENA 2DY8A 3PSIA 1TBEA 2JA7B 4ANXA 4O0AA 4B3MQ 2R92G 3MC9A 4LF4L 1VQMA 1RF2D 5NUCA 4JI1Q 1M4VA 2E8GA 4JV5L 4PS3A 2KVZA 1EEID 3Q0AA 2JA9A 2K5NA 3KDFB 4AQYQ 4GKKQ 4II3B 3TIXA 3EROA 2DYMA 1BOSA 4G11A 3K7AB 2ZEQA 3NVYA 4IG7B 1A8VA 4K5WA 1ZP0B 2K22A 1CJEA 3DDCB 1PGAA 3HHMA 4B3SL 1QVCA 4AQYL 2F0JA 1OQYA 2L8JA 4HPMB 1E1OA 1OO9B 2UU9L 1ICWA 3LYYA 4XDCA 4DXAB 4WORA 3VRBB 1E0ZA 1WJJA 5CYUA 5C44H 1IL8A 4HMJA 2C7HA 2O6VD 3EGRA 3S1MB 1LTGD 3FRPB 1XPUA 1JE5A 4ZQ3A 1JMLA 1NAPA 4FO2A 4OWWB 2N9KA 4M8NA 1UE1A 3AEVA 3BZKA 3DWMA 2KTRB 3J81i 2WP9B 4GSWA 4DHZB 4HCNB 1JC7A 4LF6Q 1H9SA 2KX3A 2LGXA 4NDXA 4EVOA 1J6QA 1EYCA 4M01A 1J7BA 5C3EH 2CHWA 4TV3A 2QDFA 4C4VA 3RZOB 2IBIB 2PQEA 4KGTA 1DJRD 1E8WA 3GTQH 2N78A 3CC7A 4JI8L 2X38A 2AQ1B 1CQVA 4DAMA 3U9SA 3CPFA 4G7OC 1OQQA 5DEHA 5C4HA 2MW5A 3R66C 3W1SC 2MBHA 1SR3A 1HE8A 4A3CG 1B4OA 2Z8LA 2MPMA 2N9EB 1CM9A 3KJOA 1I42A 1UAPA 4R4IA 1TJEA 1YNTE 3KYCD 2F0UA 1C3TA 2F4IA 2JA7G 2A69C 1CI3M 1V1PA 5EE9A 4A6QA 1D5XC 4JC0A 1TKYA 3B1LX 1C9OA 2BDNA 2QF7A 2RCFA 1WXSA 2IYDB 1CUKA 3AE4B 2Q8TA 3I70A 3DCGA 5DPTA 4L1BA 4X64Q 3PUZA 3CQZB 1YJ9A 3E9HA 4OVVA 3GTLB 1ET9A 2C7NB 1D2BA 4WJWA 4HEDA 3P2BA 2UXDQ 1BO0A 4HKZE 4W9EA 4X3TA 2YV5A 1MKHA 2WP8J 2MBEA 4FA6A 4N59A 1FL0A 3ZW3A 2B2UA 1GUOA 2VQFQ 4RGNA 3S2DB 4R3DA 1EY7A 1NR4A 2AUJD 1BCPD 3NY5A 3I7FA 4II2B 1FM0D 1UD7A 4B3RL 3VQIA 1FXIA 3BDOA 2VQFL 2LGDA 4L63B 1H95A 2V3SA 3KUDB 2Z6KA 1I6HB 3I4OA 4OZCA 1JQ4A 2RSNA 3ALBA 3VH4B 3EVQA 2GA4B 1YNNC 1PFDA 4BY7B 2N9XA 3EHVA 1VCBA 2YYZA 3TCAA 2ZTEA 1K83B 4HCEA 1I4HA 2GVBA 1VZ7A 4MZ9A 3VVWB 2RD0A 1TR5A 4RMAA 1UE7A 3BDLA 4FDBA 4AYBB 1BCPC 1KDAA 3M62B 1LUZA 4LUOA 2NZHA 1CKNA 4BKTA 4MM3A 4O42A 5C0XI 3S16H 2KDMA 1H8CA 4A3JG 3D0FA 3ZO5B 4JVZA 2OXPA 4CDCC 5GADC 4GN3B 4XQQA 1HUNA 1FFUA 3MTSA 2DLBA 1YOVB 3R3MA 3RNUA 4IUMB 4M0WA 4OGQC 4HWIB 3GV3A 4LWCA 3T51B 1GOZA 2OQKA 3CCMA 1PH2A 1YHAA 4XQJA 4L5RC 2A6HC 3KJPA 4MIUA 4LFAL 4A20A 2QMTA 4OX9Q 1WE6A 2PQAA 3HOUB 2WXJA 4WJ3M 1MHHE 4RAUC 3Q23A 1A0IA 2E2HH 2KLCA 1F1HA 1WCMH 1D1KA 1QOHA 2PNRC 3DQVA 5CHWA 5E6OA 1N60A 1TT2A 1I35A 1NYQA 2B2YC 2IWHA 1G6JA 4J6HA 3PQIA 4HCSA 3BJUA 2F0EA 4TVAB 1E8YA 1YQ3B 3Q8CA 4M00A 3CF5A 3UE0A 5KEEA 3IAM1 4KN4C 3G71A 4OL7A 1WSPA 4P1CC 3TEZA 1A62A 4X3KA 2WXQA 3TMPB 1BMLC 1PFMA 2N4FA 4G50A 1TWAB 2JWUA 3HOXB 4W9DA 3UGBB 2KVMA 3DHHC 3Q69A 4HEA1 4ANWA 2YEPF 2PE6B 2K05A 1PRTB 3I63C 3NG0A 3CMAA 1HCZA 4Y7NB 2MX2A 5FR6A 1XMQL 4YTPB 4A93H 1SROA 4NQLB 2VXWA 3ZXRA 4UP8A 3ZJVA 2IO2B 3GDEA 3QHTA 2NB0A 2FXQA 1XNRQ 3T4AC 2K39A 2V3PA 4AYBG 1XLPA 2IX1A 1P3QU 5E7NA 3PF4A 2E2IB 3AU7A 3UE1A 3S1RB 5C0XH 2C9OA 1R9TH 3PIO3 4DR6L 2GBKA 3GTMH 1CA6A 1C7YA 4QB4A 5CMDA 5GAGC 4AIMA 4DV5L 2FCMA 2FBWB 2CFMA 3A9JB 3NHEB 5AJ3L 4M8MA 2FIFA 2K01A 1TZ1A 3QCAA 4NJ7A 2JA8H 2J0TD 1LGRA 1PH5A 1PGXA 4KD3A 4XTCS 2GBMA 5BYQA 1HUMA 2BA0A 3OPOA 3UDXA 1Y1WB 4FADA 3H0GB 4KZCA 4P73A 2ZTCA 4RCNA 1WTHA 3HOUG 4KGRA 4IUTA 2Q2TA 4KY5A 2MNAA 2RPQA 5AZFA 4RF1A 3MXGA 2UUCQ 2WB1B 4U673 5EE0A 4WQMA 3V61A 4A3LH 4IM2A 3WA0A 1L0YB 2WHIA 4DR4Q 3VRAB 2F0HA 3CRLC 1NNXA 4DHJB 1IBKQ 2WX0A 1KLUD 2L0CA 4QL5A 1MPEA 4IDIA 2ES2A 4ZRPA 4DBGA 1YNJC 1WM2A 3Q22A 5IGEA 1BR9A 1F77A 4WFN3 2BB5A 1F2LA 2EJGC 1MVKA 2EE1A 5KNDA 5M5YB 3RD2A 2KX0A 3TREA 4KZ0A 1KC8C 3HOXG 3A5UA 3STBC 4QF4A 3EC8A 5JJKA 2W3RA 3PUYA 3AEGB 1XCTL 5IGGA 4FF2A 3TEYA 4X65Q 3V6CB 2A68C 5IT9c 5IT9E 4DUYL 4LNFA 2M00A 2LMCA 2JYEA 2HDLA 3VTUA 1L0XB 3VR6A 1VQ7A 1EWHA 2JA5B 1WX7A 2LJ5A 4XWTA 1PYSB 1LT3D 1WM3A 1XLOA 4QJFA 1M94A 2CW0C 1EQTA 3QG1A 2IT1A 1G6ZA 2WXRA 1QUQB 1G91A 3ZDMC 1HNWL 3U7ZA 3LGJA 1D8LA 2JXTA 1F9PA 3BVMA 1WE7A 3M3YH 1V8QA 4JOIA 5CV7A 1QNKA 3CCUA 2RDBC 3EFCA 4A90A 4XYCA 3Q8EA 3MJWA 2K04A 1V5TA 1HZ9A 4HTHA 1WTVA 4YT0B 2ON8A 2K50A 1JRPA 4IPGA 5DM63 3H7SA 4HCPB 2ZTDA 3SK4A 1FPYA 5IP9H 1KD1C 2WKCA 1P8LA 3PTFC 3DBHI 1K8OA 1Y1WG 1C8CA 1LT5D 4BBNC 3PUVA 2Q8RE 2OQ0A 1NI2A 2NVQH 3W2DA 2PVGC 4XE0A 2WB1G 1DOYA 2JE6I 5C3WA 5C3XA 2KANA 2B63B 1WIAA 4R4TA 3JVZX 2AQ2B 2JWZA 3OWFA 1ZDVA 1I3QH 1VQPA 4L5TA 2WKDA 4USAA 4J6IA 4A3BB 2CKHB 2K3UA 2F0SA 2KWUB 5JPNC 4REZA 3I72A 4H13C 2BVCA 2GN5A 2PVOD 4ZRIA 4JBMA 1K3BC 4A3FB 2CVRA 1A70A 1VQOA 4C7YA 3BG3A 2KVRA 4JI0Q 1GG3A 2O4XA 2LI5A 2LWPA 2NVXH 2ICIA 1V2YA 4A3GB 4KHZA 4ASWC 1IYFA 1N62A 3KLSX 3E0EA 3VTVA 2R7DA 4S17A 4ZRZA 3AMUA 2K14A 2EDGA 1DGJA 2ZM6L 1S5BD 4YY3Q 2WINB 3DXJC 1JT8A 3HOYH 4KJNA 4YIJA 2JA5G 3AULA 3J81c 3J81E 1E8XA 2F0MA 5IKCM 3FKIH 2OF1A 2Z4HA 3I55A 1V49A 4NPSA 3CAMA 3HOWH 4FLHA 4AJYB 3GB1A 4FHJA 2B8FA 5GROA 1HA5A 5M5WH 3RN9C 2F3VA 4G7ZC 1YN4A 3PIP3 1V80A 4NAWB 4JI5Q 5CORA 3HOVB 4F1SA 3MAQA 1LT4D 3TMEA 4DR3L 3DVGX 1E90A 3D4RA 4XZ4A 4LF5Q 5C4XB 2N1WA 1SNCA 1KHIA 1EQRA 4FJVB 1CKOA 4RNAA 3KLSA 5AUIA 2K5WA 5J18A 1SXTA 2SAKA 5M5XB 1MJEA 3PVLA 2KOLA 4DGZA 4DU9A 3EECA 3QIAA 1QE6A 3K6OA 5C4JH 2OWOA 3CSTA 2A1AA 1HA6A 3C46A 2DYBA 1V5OA 4NXNL 2B63G 5HI1A 3M9BA 3RZDB 3GZNI 4NXMQ 4XYQA 1RFKA 1UWXA 1VZ6A 4C80A 2A5UA 2BKFA 2PCFB 1WFQA 3VR3A 1WD0A 1HHVA 5IWAL 1B9RA 3A4SC 3KYHC 1O80A 2WAQB 3SFDB 1ZE3D 2FHTA 1XLNA 1R4NI 1YEZA 1I5FA 4KI0A 3F2DA 2BYTA 1Y14B 3LWEA 2WXKA 1IKLA 1STHA 1S3SG 1JWSD 1PZID 4A3FG 1UH6A 2H89B 3EA6A 3KF8A 2R93H 5J39A 4GN4B 1AZQA 4A3DH 4AWJA 1F52A 3C8YA 5EBDA 3G6EA 2MP2B 1Z9FA 5IE8A 4GU2A 2F0QA 4DV4Q 3NOBA 5IYDH 4DK1A 1KFYB 4ID6A 4A3GG 1WRDB 4ZRQA 1J7AA 2QCPX 4ZHPA 1F2RC 2LHDA 1FIQA 2HCCA 1EWCA 4ICVA 3DMUA 2I2YA 1F2MA 2KCMA 3B9JA 4BKSD 1WX8A 4ZKCB 5IP7H 4E3CA 4R8IA 2K5VA 4OIKA 3A8JE 4QIWE 3E9SA 3FAHA 5G3LD 5BMGA 3HOVG 3NJTA 2DZJA 5HFYA 1SMXA 1AFPA 3QQ8B 5M3MB 3GTKH 1EYAA 2G45B 3N52A 5C4XG 4RFBA 4WJNA 4YTMB 3QK0A 1PTOB 3MZ5A 1I4XA 4TRDA 2PE9A 4XQNA 2RPVA 3Q3NC 4I65A 4GNXB 4URKA 2F0TA 2QDBA 2MBOA 1KLGD 3AI5A 4NPNA 2K5HA 2KHSA 1VQFA 2JF5A 1E0BA 3I2ZA 1ICFB 3L08A 3BZDB 1X6OA 3KUZA 4JYAQ 4DAPA 3L0WB 1SJED 2A6EC 3P20A 1NJIC 1IYJB 1JE4A 1K8AC 2INCC 4A3EG 3KK7A 4KKUA 4MEMA 4IUQA 1SNPA 2N9PC 2WAQG 2OJRA 3SDLC 3DWAA 2LFNA 3I5JC 2VNUD 4GOCA 2JA6G 3APCA 1U4MA 3N6RA 3H91A 1QZGA 2KN5A 4TSSA 4QIWB 3AXCA 3PZ7A 5JVG3 4HKQA 3PUXA 1GUAB 2YTXA 2D0OA 2PZWA 1TZOA 2R6GA 2Z1CA 2WDTB 4YHHQ 1PRTC 4M1UB 1GXDC 1CHQD 3P75A 1C9FA 2PZUA 1S3OA 5HGQA 1L4DB 3T3NA 4WQOB 1HZCA 1IYVA 4YHHL 3UI3A 4YL8A 1HZBA 1F9JA 2QEJC 1P7FA 3Q3JA 5CX3A 2BOSA 1HTLD 4GKJL 1K8MA 3AE6B 1KDBA 2UU7A 2JRIB 1EYDA 2ID0A 3MEHA 3EBEA 5JOBA 2ASQA 2Y0SE 2G9HD 2IW3A 5G3LF 2QIEB 1LTID 3DM3A 4KV6A 1VQ9A 1IYUA 1MGSA 2LGIA 3Q8BA 1HNXL 4JI6Q 2KWDA 2N88A 4YXDB 3FEWX 3N32A 4KKSA 3S17H 4AJWA 2D62A 3NWSA 2C60A 2X69A 3D3RA 1WYWB 3DBRB 1V43A 2B3GA 2KJ6A 3NXWA 2D0PA 5E6JA 1NBFC 3DHIC 2CHXA 3TJPA 3AB5A 5K5PA 4CKCA 1EYGA 5ELNA 2FCNA 4FN2A 2BE5D 1SDFA 4C2MH 1V8CA 1MHWC 5C44B 2NBUA 4K0KQ 2FJ2A 4ARCA 1I94L 3KF6A 2RMMA 2DENB 3DHQA 4G4KA 1HR0L 4POGA 2KDFB 3PO2B 3K5MA 1G6PA 1P16A 2FUHB 2UXCQ 1WF9A 5FO9B 3HVZA 1QNUA 3E3XA 2TSSA 4BXXG 3BK2A 5BYSA 4E71A 3ERSX 4HJKA 4B08A 2F0NA 4ITKA 2KN4A 2XSCA 3T1YQ 1TU2B 2V1YA 4GXBA 4NW2A 1TTNA 3SVMA 4IUVA 1FYCA 1FNWA 2UXCL 1HEZE 3Q3MC 4I6LB 4ME3A 4IN3A 5C3EB 4H44C 2L52A 3MC8A 2NPTB 1LM0A 3I8ZA 4R8NA 3T1YL 1VQNA 1VLBA 1XWEA 3EJIA 3QB3A 2ZJDA 2JUOA 4EOYA 1JB3A 4IO9A 3GTQB 1E7VA 1JOQA 1SFOB 4CDDC 3NVZA 2K7VA 5LLIA 3FMCA 4C3IB 4A3EH 4LAAA 1DOXA 1KF6B 1HZ5A 3PF5A 3DBLB 4B3TL 5J3BA 2L05A 3KW5B 1A5RA 2WXPA 5HY6A 2K4KA 4DK5A 4MHEA 4RMFA 4KHPL 2KMAA 1CSQA 1FMAD 3DWGC 2O6VA 2L3ZA 1L1OC 4MNOA 3M3JA 3RNAC 4DV3L 3P4RB 1QKZA 4JI2Q 3RUZA 1WTPA 3GTGH 2C9WB 3GTJB 3AEFB 2K5PA 3FPUB 4GN5A 2RHSB 3NPPA 2UUAL 3L16A 4MACA 1JWUD 3MHSD 4BBRH 2IY0B 4WIPA 4YWKA 3IFWB 3WAPA 5JHAA 2MBBB 2EMTA 2VQEQ 5D6JB 3MXPA 2MH7A 1LM8B 4BY1H 5IA7A 3M7GA 1WH3A 4QMGA 5C44G 4AH6A 3IT6B 1IBXB 1Q3LA 5GMVA 2D9UA 2ZJPA 2J7QB 1KDCA 4KSLC 5J17A 2UYZB 1N9WA 3HZXA 1OXUA 3GTJH 2JVCA 1M1KC 3N9YC 1PXUA 3SK6A 3D4DA 1J0GA 2PTLA 3H6NA 5LMNL 2CWPA 1TWGB 1ZDXA 3FHWA 4CO7A 4HJ7A 3A1QB 3L3OC 4BZAA 2M9VA 3ZUNA 1H9SB 5C3EG 4WWPA 4F8CB 2L55A 1WGYA 1TWCH 3OTOQ 1CZPA 4C4VB 1VD2A 4KKJA 3H94A 3AB9A 3TZDA 3HVDA 3H9DA 5T1GA 4W9GA 2MQJA 4EKUA 1EOTA 2LGSA 3S16B 1JOKA 1V6EA 2EY5A 5DPWA 1DM0B 4M8AA 5DLQE 1GM5A 4ZRJA 4POFA 3VR9B 2QEXA 4HAEA 4OEMB 2BPSA 1ASZA 4KKIA 3A0JA 1QQRA 3LNNA 2M8SA 5KHQA 2HD3A 4DV6Q 1X3EA 1QOFA 4LFCQ 3K8AA 1V1PB 3URYA 1STYA 1Q90A 4CJ1B 1RTNA 3SXHA 1PHJA 1DD2A 2HE7A 2KHIA 2W54A 3QIJA 4JL9A 3JSVB 4W9LA 3R2IA 1NUCA 3HK0A 4MTNA 2E2HB 2N7JA 1KABA 1WCMB 5HG2A 1WI0A 1GUTA 4DR5Q 1FXTB 5A2QL 2F03A 2WXGA 3AE7B 4HJ5A 3GTOH 1QZEA 2IY5B 4GDLB 1G2TA 3NHHA 4DHZE 1MFWA 3GQBA 2CKZB 1IBML 2BYEA 2VZKB 3U30A 4RGTA 3RNGC 5BR8L 3HKSA 4HR7B 3HEJA 2XNAC 4LDTD 1EU4A 1SYGA 3PV0A 1GAQB 2D11A 3IRBA 2E76C 3RR5A 2WXHA 2Q2HA 3FPPA 4DR7Q 3E0JA 2JT4B 4PMBA 4CBVA 3PUWA 2ATWA 2FCQA 1LTBD 4B3ML 1LQBA 3RNBC 1PTOD 3DLLA 2RSOA 1YI2A 1WTWA 2XEWA 4JI1L 2Q2UA 1SYDA 4A93B 1EY9A 2ZPYA 2MFIA 3K0YA 1ZOYB 2MO1A 4ZLTF 2RGFA 2C5CA 4K5XA 3K5NA 2OT2A 4GKKL 2GLSA 1HTQA 1M8AA 1WXQA 4E74A 2EYLA 3ZJUA 2LXKA 1A3UA 2ACZB 2INPE 2LS01 3KBXA 5FLXc 5FLXE 4EFOA 4R4CA 1R9TB 4EGVA 3GTMB 1B3QA 4CHKA 1SRUA 5EKKA 4PYUA 3P1MA 3RYTA 4DAYA 2DYOA 1RWSA 1J8CA 1D5ZC 1PTOC 2FMCA 1Q12A 4FF3A 2ICEC 4HMIA 2JA8B 2QC8A 2MRPA 4M0WB 2PMZE 5G55A 4PZ7A 4GNXC 1EFWA 1OEYA 2ZW1A 1KXLA 4A3PA 3NZSA 2A69D 2LASA 2KQSA 4YSYB 3S15H 2NR2A 1F9QA 4APVA 1I50H 4LF6L 1NYRA 3SHLA 3HRDD 4BAXA 1WTRA 4RA8A 1ESRA 4CDEC 2JRHA 1WCMG 2Y5CA 4X3SA 5CV6A 1I4GA 1SMYC 2PQAB 2XWBB 4KY6A 5BN5A 2LXJA 4WWNA 3L0OA 1U4PA 1F0ZA 2LRWA 4MH0E 3R93A 2JQRB 4DDID 5D14A 4A3JB 4MSMB 4A3MG 4B95A 1KQSA 1TWHH 2VH1A 5DCNA 1JWBD 1PA6A 5CBEE 3S1NH 2JN4A 3AE8B 1FD7D 4OHJA 3CCVA 3DVGY 1OXXK 5C1ZA 3CCJA 4PV1C 2F0LA 4DK0A 1WTQA 4C3JG 3ENEA 3MXNA 2K8HA 4BBSG 1KRHA 1UEAB 4AYBE 1VQ4A 1J8IA 1LFDA 3NZ3A 3Q6SA 1WOCA 2AMCB 1KRTA 1T6BX 4A93G 1LABA 1YNND 2PMZB 3ZJYC 1TYGB 3U58A 3AECB 3PZDA 1TKEA 3QARA 3ZTCA 1I4RA 4X64L 3L17A 1B50A 3QJYA 4G57A 3TRZA 4TKNA 1RD9D 2WLBA 3VYUA 5C0XG 4DR2Q 1U4RA 2A8VA 2UXDL 2QJLA 5LHY1 4MGYE 4LF8Q 3MHZA 3M3YB 2BF8B 4GLAC 2HDMA 4JPSA 1X3QA 4BS9A 3A5ZB 1SYCA 2E75C 1VQ6A 4F87A 1PVOA 5FJ8H 2JA8G 4L5QA 5I9OA 4P16A 3HKZG 4XIGS 2G5DA 1IZ6A 4XWWA 2RQXA 1X3PA 2LSSA 3H6MA 1C4CA 2F4VQ 1ZPSA 1K50A 2KXJA 4YSXB 4FXKC 3K59A 2A6HD 5JVH3 3A54A 2VB2X 4A3LG 5KNBA 3T1HQ 1S5DD 3VDZA 1I7HA 2NVTH 4NP5A 1WXMA 3PT2B 1WR6E 3LWUA 4GN1A 4CYEA 3TUOA 1YITA 4RKBA 1KLVA 4GOPA 4GDKA 3G6JB 2DNCA 5EQ0A 2H1EA 2IHEA 1SNDA 1K51A 4BVUC 2DAFA 1GUGA 1BQQT 3NK9A 4RG1A 1MJDA 1NENB 2RCNA 2OHFA 2ZW0A 4WJ4A 3BK1A 3EN2A 5EPLA 3H3VI 3VUXA 2NVXB 2JY6A 3IAYA 3FILA 1FGBD 1EY8A 2C7MB 1U4LA 3ER0A 1R4MI 4WJOA 1JJCB 2JYTA 1KOTA 1BBUA 1BVSA 3HOYB 4IM3A 3RI7C 1U5KA 2L7RA 4OX9L 1SJHD 1PH1A 5D2MB 3FKIB 3MXUA 2Z0EB 3P1HA 4ODGA 1X9NA 3HOWB 2NCNA 2VW9A 3GS2A 4A3KH 2HDEA 4A3MH 4BA2I 4OW0A 3DEOA 3AH7A 1YJIA 3RMKC 2F3IA 2RR9A 1BCPF 2HTHA 3DHGC 2R7FA 4K7WA 4AUQC 3BZCA 2KHWB 3NTHA 3M4QA 1NEKB 1B53A 4AQ7A 2OTJA 1VQIA 4C3JH 2WB1E 2K32A 1EIHA 4BBSH 5IP9G 3DBHB 2I46A 5D3DA 1S1QB 5IODA 4K6DA 1HQMC 4A4IA 5C4JB 3J81L 2ASBA 3APFA 3I4NH 5J22A 4FJZA 3GP7A 3HOZH 2WX1A 1L2FA 1TS2A 1XTCD 4P7IA 1ET6A 3MFGA 1PH9A 3CC4A 2H5XA 3ULPA 2DWQA 5K36G 2YTYA 4LW1A 4XXEA 4I6NB 4WAFA 1CKMA 4K5VA 1T5XD 4N9PA 5J1ZA 2WGSA 4JBKA 1XNRL 5CHFA 5MPOA 3SFEB 5COYA 1AEXA 1YX6B 3G7LA 4KTAA 3T13A 5JJZA 5FKAC 1YN5A 1YNJD 3L2PA 2R93B 2GMIC 3DVNV 3TBLD 2CQOA 3OIPA 3H3VH 2EJMA 2DJFC 4JPBW 2NWGA 1WGDA 3OJ3A 4OO1I 2DY7A 3F2UA 1YJNA 2IX3A 1S5ED 1WJ6A 2L83A 2E5LQ 1UNSA 4DFAA 3STBD 1DZ1A 4PZ6A 4UAIA 5KIXA 2AYOB 1K0RA 3JAMi 3HOYG 1ISNA 2KHJA 2A68D 3T53B 3CMMB 4XGAB 2KACA 2WDRB 2FAZA 3NWTA 3SR6A 3AFQA 3FKIG 5EE1A 4Q0FA 5H1SE 2UUCL 3HOWG 2EYOA 2VS1A 2NBVB 3PRMB 3W9CB 4GLXA 3NTKA 2L15A 4LUZA 2CW0D 3QOLA 4DR4L 5AZHA 4MSQB 1Y1VH 1MSGA 3WWVA 4DV2Q 1IBKL 1E2VA 2PKOA 2PPHA 5C2TB 1DOLA 1SNQA 4KJOA 2AL6A 2J53A 3NZUA 3K7UC 1BF4A 3GTKB 3OLMD 1EWYC 2CCZA 3PPAA 3F1ZA 3D4WA 1FRDA 2N49A 1BNZA 2NTTA 3KFUA 1LV9A 1PYWD 2X6GA 1QOAA 4HK2A 3CD6A 1N61A 4UY8C 1FEHA 2D5GA 3CKIB 2WXOA 2IGGA 4X65L 2IHFA 1T0RC 1YQ4B 3PGEA 1K52A 4JE3B 3C1EA 1NE3A 3F8TA 1FCCC 1YNXA 1PFSA 3ZNHB 4K7UA 4GZYC 3NVWA 2BKRB 2IZVB 3P4QB 1N8RC 1YN3A 1SE3A 1R4NB 3R7QA 3AE9B 4DV1Q 4PS8A 4BKSA 3HM3A 2B2UC 3I4MG 3RZFA 2KDBA 2EKEC 2L0TA 4ZCKA 2NN6G 2MJ8A 4LF7Q 3AQQA 2R93G 4TQUS 1PZJD 3S9WA 4YCVA 4A3DG 2GBNA 3PS6A 1L1OB 1EY6A 2FMMA 2RBMA 1ZKOA 2NTSA 4DKAC 3V96A 3UDGA 4OO1H 5IIFA 1EUVB 4TKOB 1YZ6A 5IYDG 1NVID 1SLJA 1V9PA 3E6ZX 2Z6KC 2W3SA 2XK5A 1LTSD 2J0JA 4F88A 3M4OH 1FCLA 4CJ0B 4IJLA 1ZEQX 4RH6A 1E7PB 3AEAB 4LK0M 2J52A 1XCQL 3N3KB 4JG2A 3CMEA 4JLCA 2V9HA 1ZW7A 2BS3B 3MHBA 2PZTA 1TWFH 2IPKD 2C5LC 5K36H 3CHBD 2Z4IA 2DZIA 2QGQA 5IP7G 1HTOA 2D07B 1GC7A 2DUDA 4HDQA 4JX1C 2HIXA 4F8MA 2HTME 4LJOB 4HJAA 3GE8C 1W3SA 4DDGD 2I5LX 1WZ0A 4DR1Q 4BY7H 3AFPA 2NN6I 2XGTA 3VUWA 1Q8KA 2NVYH 1JQYD 1V86A 2LXAA 3WALA 1SNOA 2BDOA 2WQYB 4DUZQ 2EXDA 5T1IA 3S17B 4AS1A 4WH4A 2K5DA 5KGUA 1F2ZA 4EE2A 1VQ8A 4JI0L 4PK1A 4W9KA 3SU8X 2WAQE 4X3UA 2AQ3B 3ML8A 1B70B 2EYFA 5A35A 3H15A 4OVUA 2XRSD 3DPDA 5AEKB 2YLMA 3PHXB 4FXDA 4BBNF 1W6JA 3S14H 3R2TA 1XNQQ 4YY3L 3KBGA 4Q5VA 1FJGQ 5C5LA 2EYMA 2WYQA 2N9LA 4C2MB 2BH2A 4L23A 2I0QA 1S4ZA 1SGHA 2XBBC 2F52A 3KLWA 2K75A 2B2TA 3M4YA 4HIKA 1GJZA 1JOOA 1WR1A 4MGZE 2B2VA 4JI5L 1PFNA 3PLUA 5DPRA 1W2BA 3EFUA 5CV9A 4NJCA 1RRBA 1E10A 1B8AA 4LF5L 5EPJA 2V4DA 1JMCA 2PMVA 3WANA 5HHDG 5L37A 3R7RA 2L0FA 3EUB2 1C0AA 3B2FA 1CFMA 1E2WA 1G8ZD 4FXGC 4LMQD 3SK8A 5IN7A 3NENA 1UWVA 3IG3A 2NVUI 1QLBB 4A3EB 4RHRA 3VDYA 3PGZA 1C48A 2N7DA 1Y8OB 2WXIA 2NBWB 1N32Q 1GHKA 3VXWA 3TP7A 3WAOA 4KD4A 1EL0A 2K8BA 4NXML 2BB6A 3I4MH 4IWPA 1JR0D 2JA6B 3NELA 4JIOU 4FF4A 3U2SC 1K73C 1NCVA 2NN6H 3UINB 1Q86C 1ZXIA 4DA2A 2BQQA 3DVNU 4OONA 4BA1I 4Y7NH 4W9JA 1IBLQ 4FJYA 2CQAA 5GQOA 4R9WA 1TKGA 1ZXHA 2WXNA 3J80i 1L6UA 1KTKA 4RWSC 3TBIB 4JBJA 1VF7A 1L0WA 3GTGB 1C76A 1R4QB 5F2DA 5EJWA 3OMGA 4X62Q 2E2JH 3AE1B 5JEAJ 2E2IH 2AEHA 4MGIE 1DONA 3UDIA 2EJFC 4DV4L 1N34Q 1N33Q 5IY0A 3X3MA 1BUIC 3ZLZA 4BBRB 1X56A 3VTWA 1CK1A 1JWMD 1M90C 1WX9A 1Y8PB 2L9HA 4JI7Q 2KBNA 2F0WA 1L4ZB 2I38A 2I5HA 4AOFA 4DN4M 4BY1B 2A4ZA 3VFKA 1RDPD 2G9DA 2A6ED 2MWSB 5DNFA 4TQ0A 4KVGB 4DNTB 4C56C 2H88B 3NBHA 3PV1A 2G4DB 1P0RA 2X6LA 3DEPA 5EGTA 3CU7A 3KF6B 3H0GH 3AYHB
chains in the Genus database with same CATH topology
2O2LD 3DM1A 2K6AA 2E6XA 4H2AA 4IOIE 3GD7A 5DM73 2JZPA 5LL6S 2R61A 3OSOA 3R8BA 5LL6X 3AMZA 1S5CD 1AYFA 1QILA 1PRTD 4L8JA 1FO4A 5H8YE 1XXGA 1GB1A 1IHZA 3I57A 1II3A 1FXAA 4NMZA 2XIWA 1EIGA 4OZAA 1FD6A 4U68A 2LKVA 4HRSA 1VDVA 1VMCA 4FF1A 5BMHA 4MN3A 3HP3A 5KNCA 4RHSA 3AEBB 4OIJA 3MC0B 4YTNB 1RCVD 4B0EA 4ABNA 1RODA 5CGKA 1A2TA 3GTOB 2EYPA 4GLSC 2O5JC 3M85A 1BUVT 5E4XA 2O5IC 1H9RA 1AN8A 1GUSA 3ND8A 2B2WA 4A9AA 4DF7A 2BS2B 1LTTD 4Z9CB 2WU5B 1CZGA 1C4AA 3ETRA 2K5QA 4L6TB 4DAVA 4YSZB 2HQEA 3AN1A 4A8XC 1PRTF 3IT4B 3H8HA 2RDHA 2LUMA 4ZAIA 2CJOA 1VDZA 1DYQA 2A5HA 1QOGA 2QILA 4K6LA 1PFBA 3T16A 3JAME 2F0IA 5BYRA 2B76B 4P6VF 3AEDB 3TZUA 5C3JB 4HROA 3IFDA 3S15B 5ELEA 3NP8A 2JX5A 1I50B 1E2ZA 5H92C 2M0AA 4CKBA 1B9NA 3A55A 5FLXL 3W3AA 2YEPB 2EY2A 3K57A 1QJOA 2E3TA 1W6KA 4LJZC 2IJ0A 5JAVA 1TWHB 4C1NI 4V0BA 4XDXA 2F1MA 4ZUIA 2JXMB 3RPFC 3DUZA 3W1SA 2MP1A 2R3ZA 2MEKA 3IL8A 2Q8IB 2XVSA 5T8IA 2L11A 3A8IE 1AP0A 1CTMA 1CA5A 4JBWA 1SBBB 4US9A 3IAS1 2QSDA 2KEEA 1ZYRC 1VMPA 3P42A 3ITPA 1PGBA 4ILWA 4JWSC 5KRUA 2BBCA 2KAJA 5D7GA 2VB3X 2M56B 3NUHB 4ME5A 1A3TA 2RDFA 3L9AX 1HQRD 1CT1D 4DQOC 4RCOA 5E3FA 4IQZA 1MBYA 5JEAG 1STAA 4CKEA 3GV6A 3SDZA 2WXLA 2EY1A 1WVLA 4ZHOA 5E1FA 5FR3A 5FOBB 2SNMA 4IZ8A 2ONQA 1ENAA 1VRAB 1O78A 2KQ3A 2KMMA 3A56A 5G5GA 2XN9C 1QWYA 3BWUD 2KUMA 3E56A 3X3NA 1QF6A 3LX0A 1OXVA 1EY4A 2PLPA 2JYOA 1GUNA 2NYZD 3SR1A 1SF0A 3P4SB 2FFKB 2ZXRA 1V1OA 1Y69U 2XRQD 1QG7A 1RJTA 1B3AA 2LHEA 1HXYD 2AWOA 4IUPA 3PO0A 4A3KB 4A3MB 4V190 4JWUC 5C5MA 4ZKBB 2GRIA 1KNEA 2RVLA 2B2YA 1L0VB 2INNE 1NR2A 3T56B 3AM9A 4C3JB 1SYEA 4BBSB 4DXFA 1Y56A 3SE0A 4HN7A 3KLRA 3I4NB 3VA5A 3HOZB 3I90A 1RTOA 3U52E 3V3XA 4RGMA 1MD2D 2Y3AA 3Q8FA 1SMYD 4IKGA 5IGFA 3J80E 1T3QA 4ZUJA 2JEAI 2J4XA 1FR3A 1A6XA 2OEOA 3MWYW 4MM3B 2K33A 1J7CA 1ROEA 4IUNA 4GDKB 4RKLA 3K5OA 3I73A 3HKZB 2WXFA 2PW9A 1ZXTA 5EPKA 1QCBD 3D31A 5ISRA 2HCIA 5JEAH 3FILB 2LEKA 1RHPA 2J7ZA 2L1AA 5I6WA 2MJEA 1JICA 2L5TA 4K14A 1VCIA 2ZT9C 1Y1VB 3IKJA 3RD4A 5E4WC 1G291 4YWGG 5EKLA 4KX6B 2WS3B 1N63A 4PMWA 3OOCA 2KA7A 1AZPA 3FVQA 2KQ4X 3ZGZA 3I4LA 3M7NA 2MJ3A 3EQLC 1PTOF 3TEWA 3BDCA 3AEEB 1TKWB 3WDNA 3C3LA 1RKNA 3I3CA 1R4PB 1IGCA 4E6IA 3HUIA 2E74C 2IL8A 1LLRD 1DOKA 2N55A 2PO4A 2WV6D 4XT3B 5KYLA 3NS1A 2RDGA 1V97A 4FXCA 5IT9L 4PT5A 3QWNA 3MP9A 1BDOA 1TY0A 1EM7A 3M4OB 3D6CA 1C78A 1WRIA 4DNRB 2NVQB 3HG9A 1OFFA 3B2GA 3RLFA 3VR5A 4BWGB 5EBCA 1GHJA 1TWFB 2XWJB 2MJDA 3NVVA 1TQOA 1PDQA 1MSHA 1I3QB 1LO5D 3T3OA 1IW7D 2F0GA 4N58A 2NMQA 1TS3A 2J42A 4D2KA 2L32A 1HZ6A 2LJIA 4B9XA 4G7HC 4J3OD 3V2TA 4H0LC 1I4QA 2NVYB 1ILPA 3NSWA 2F0KA 2SNSA 1EEFD 3TSSA 4EQNA 5A2QE 4FVMA 5G5HA 1O7LA 1IW7C 2LMCB 3S14B 4DXGA 5D65A 4PNYA 5M5WB 2BT6A 2FUG1 3W5VB 4FNFA 1LTRD 1D6EC 1Y8NB 1WTXA 2A74C 2JEBI 4OO1G 5ELCA 3BS1A 1WYGA 3IFTA 3DWPA 2EPBA 3P7JA 4NAMA 2NBFA 3VA7A 3KWVA 4NKLA 2L4NA 4ZYSA 5KYIA 1UGJA 2V0GA 1P7EA 3K58A 3P63A 2B39A 1MHXA 4XDDA 1G2SA 3TDQA 2HUGA 4ZK9B 2E2DC 3OWEB 1Q8IA 1F2YA 1TIID 1D1IA 3I4MB 3NBIA 1H9JA 5CBAE 2KEDA 3C2PA 1STEA 3DWQA 4A3DB 1TS5A 1KAAA 1HFNA 1OXSC 1PUTA 2EYHA 2A73B 3NE5B 4P2CB 4EQOA 2Y5PA 3AV8A 1EY5A 3J7AV 2E2JB 1Q10A 3NQTA 1I4PA 5CR3A 5JPMC 3AE3B 2EVBA 1XX8A 5BMIA 3V05A 4IURA 1JCKB 4HJGE 1D4BA 4Q2JA 1PLFA 4RGOS 1OXTA 1Z7TA 3OW7A 4KMUC 2BS4B 1CZWA 2KJXA 3HRZC 2VZKD 1F2RI 4QCLA 3TN2A 1WWTA 1DOMA 2YU9B 2ZXOA 2ENBA 3QOJA 4LK1C 3I91A 3HGBA 1IKMA 2KCNA 2PYKA 1RM6C 3EFXD 5EE3A 1O7YA 1T5EA 1N5XA 3ZQ4A 5GXGB 4C3HB 1UWMA 4L2YA 4KHVA 5ELBA 2WXMA 2NUCA 5ELFA 1AWDA 3PO3B 2JU6X 4NZLB 4IALA 2RA4A 1GB4A 4KGSA 1VF5C 1EQVA 1LACA 4RF0A 1L6VA 2EXZA 1ONLA 1E9MA 1EZ6A 5IGDA 1SYBA 4TQ1A 3ERQA 2V4IB 2CHBD 1VJKA 3BYTB 1ILQA 3A8KE 1SE2A 1XLQA 1B2TA 4J1MA 2WDVB 4IFDJ 5FO8B 5I2YA 4OZBA 2R7ZB 4FP5D 2EELA 1PZKD 3QO2A 3H3VC 4PQXA 2Q5WD 4H7BA 1F9RA 2K1BA 2K9XA 3BVZA 3PZ8A 4K8JA 3VR8B 1B9MA 4N9TA 4F7XA 1JROA 3GTPB 4CQNA 5JXVA 4O1NA 4WWMA 1HFGA 4C3HG 5C4ZA 2K0PA 1HRJA 3MJ5A 1PDXA 4LTUA 4PMCA 3FDTA 3Q24A 2GB1A 4ULLA 4WURA 3UI2A 1DXMA 2TMPA 3Q8AA 1B1ZA 2KECA 3NQIA 1F9SA 3ONAB 3ABVB 3OMCA 2MGSA 5TSSA 1MI2A 3S1QB 3NTIA 1TVXA 2W82A 4CHTB 2F0FA 2GI9A 3MFYA 5IGCA 4XYOA 3PMFA 2KCCA 3ZYYX 1WTOA 3KQ4A 3JAML 2BA1A 1LT6D 1QOBA 3R3OA 3A7LA 3CIRB 4LLGM 1Z6HA 1GPXA 5M3FB 1TS4A 5FO7B 2IGHA 1YJJA 2LY7A 4IUUA 5ELDA 2JP1A 1FRRA 1SSNA 1U9RA 4S3SA 1GJXA 2N0SB 2K03A 1CQFA 4KK7A 3KUPA 3VYRA 1SAPA 2BW2A 3I9V1 1IGDA 2I07B 1SSOA 1STGA 1K53A 1D5MC 1VZ8A 2PIAA 1A3VA 1BXTA 2L12A 3VR4A 2G1EA 1C4QA 1JW9D 3E5SA 1HPCA 1TWCB 3L7ZC 5I4DA 4TMAB 1C4PA 4K2KA 2AWNA 3O13A 3A7AB 2JSVX 3WCQA 1ML0D 3OIQA 1MI0A 1XO3A 1FNUA 2NZ1D 3J9CA 1O7ZA 1QT9A 4CJ2C 3SEBA 3P4PB 2RKSA 2D5DA 3BYYB 5DAUA 3NUCA 1Q1BA 2FINB 2EZVA 1VR9A 1SNMA 2EOTA 1EZ8A 3WOFA 1DOIA 3CWIA 3C1FA 2F3WA 4ZOHC 2PW5A 1H9MA 3KWLA 1XEEA 5M9OA 3FC4A 4B0MA 4QUFA 5I6YA 2OEDA 2AX5A 2BTEA 1LTAD 1CHPD 2H4OA 2DNEA 3WOEA 1WD1A 2EY6A 1ENCA 1SB3C 2WDQB 5IGBA 4I7ZC 2QKIC 3NRZA 2WU2B 4MT5A 1ENFA 2PPBC 2MUYA 3VYSA 2EYJA 1XYIA 3W5UB 3J7AF 2F0OA 2M19A 4A3IB 1RYJA 2DN8A 4IFDG 5CV4A 3H09A 1X32A 4WRDA 3BVGA 2DBYA 4FYDA 2B2TC 1PMRA 1ACCA 3AE2B 3D8GA 5D3IB 1Q1EA 1B44D 2B2VC 1I6VC 1HTPA 1BCPB 1J9OA 5EKIA 4HSPA 3SK5A 2CJNA 2VUMB 1KNAA 1STNA 3J80L 1EU3A 3ZJTA 3MVVA 1N5WA 2IDYA 1R7SA 1JALA 1FNVA 3TP8A 1DCZA 1GUWA 1JORA 5HURA 2Y0SB 3TP6A 4IFDI 3S1NB 4K2LA 2BCOA 1ZYRD 3MA2B 2PW7A 2LFIA 2BE5C 1H9KA 5IOCA 2IX0A 3VR2A 1BBXC 3LB8C 1NSNS 5FK9C 2F0PA 5AUKA 3U4EG 4CGYB 5C0XJ 1EY0A 2D2CC 4JK1C 3U9OA 3AE5B 3CRKC 4XT1B 1QB5D 5CV8A 3TP5A 4K8IA 1EFID 1ZUD2 1TY2A 2W55A 1WGKA 2AUKA 3TEXA 2JSOA 1Z47A 4KN7C 3LXFA 4J8QA 4KY7A 2MHVA 5C6AA 1IUEA 2K28A 3D6WA 3VYTA 4OVZA 2B8GA 1UUPA 3S2HB 2NVTB 1XF5L 3RMHA 3BIID 2R92B 5I2XA 1ESFA 1PTOH 3J7YW 4C1NK 2F0DA 2F0VA 1SE4A 4IFDH 1SYFA 1FFVA 4HSVA 2IGDA 5BN3A 3HS0C 5CC4A 4MH8A 2SDFA 4B9WA 1AW7A 4KKTA 5LNK1 2ZXPA 4C3IG 1JWAD 4C7ZA 1STBA 4UDUC 2L1BA 1L5PA 4EQPA 4N6EB 2M2LA 1A2UA 3RFZB 2EKIA 2V3NA 1SIJA 3GO5A 2FE8A 1SEBD 2SOBA 1OQRA 4ARIA 5HGTA 2WNMA 4US8A 2B2WC 3IXSA 2CU3A 1S5FD 5CV5A 3L4PA 5BN4A 2WIIB 1C77A 1KH0A 2SEBD 3K5LA 3ND9A 1A15A 4QUCA 1E6EB 1C79A 2WACA 1YMHE 5AFWA 1NI3A 3OHXC 2DY8A 2JA7B 1RF2D 5NUCA 1M4VA 1EEID 3Q0AA 3EROA 2DYMA 1BOSA 3K7AB 3NVYA 4K5WA 1ZP0B 2K22A 1CJEA 1PGAA 1IBXA 2F0JA 4XDCA 1OO9B 3LYYA 1ICWA 4WORA 3VRBB 1E0ZA 5CYUA 1IL8A 4HMJA 3EGRA 3S1MB 1LTGD 3FRPB 4ZQ3A 1JMLA 1NAPA 4FO2A 2N9KA 3DWMA 2WP9B 1JC7A 1H9SA 4NDXA 4EVOA 1EYCA 1J7BA 3RZOB 2PQEA 4KGTA 1DJRD 2X38A 2AQ1B 1CQVA 3U9SA 4G7OC 1OQQA 5DEHA 5C4HA 1B4OA 2Z8LA 2MPMA 1CM9A 1UAPA 1TJEA 1YNTE 2F0UA 2F4IA 2A69C 1CI3M 1V1PA 5EE9A 4A6QA 1D5XC 1TKYA 2BDNA 2QF7A 3AE4B 2Q8TA 3I70A 4L1BA 3PUZA 3CQZB 3GTLB 1ET9A 1D2BA 4WJWA 4HEDA 1BO0A 4HKZE 4X3TA 2WP8J 4N59A 2B2UA 1GUOA 3S2DB 4RGNA 4R3DA 1EY7A 1NR4A 2AUJD 1BCPD 1FM0D 3VQIA 1FXIA 3BDOA 4L63B 1I6HB 4OZCA 1JQ4A 2RSNA 3EVQA 2GA4B 1YNNC 1PFDA 4BY7B 2YYZA 1K83B 4HCEA 1I4HA 1VZ7A 1TR5A 3BDLA 4AYBB 1BCPC 1KDAA 4O42A 5C0XI 2KDMA 2OXPA 4XQQA 1HUNA 1FFUA 3MTSA 2DLBA 4M0WA 4OGQC 3GV3A 3T51B 1GOZA 4XQJA 2A6HC 4MIUA 2QMTA 3HOUB 2WXJA 1MHHE 4RAUC 3Q23A 1D1KA 1QOHA 2PNRC 1N60A 1TT2A 1NYQA 2B2YC 2IWHA 4J6HA 3Q8CA 4HCSA 2F0EA 1YQ3B 5KEEA 3IAM1 4KN4C 4OL7A 1WSPA 3TEZA 4X3KA 2WXQA 1BMLC 1PFMA 1TWAB 2JWUA 3HOXB 2KVMA 3Q69A 4HEA1 2YEPF 2K05A 1PRTB 1HCZA 4Y7NB 4YTPB 2VXWA 3ZJVA 2NB0A 2V3PA 3T4AC 1XLPA 2IX1A 2E2IB 3AU7A 3S1RB 5C0XH 2C9OA 3PIO3 1CA6A 2W3RA 4QB4A 5CMDA 2FBWB 2K01A 2J0TD 1PGXA 4KD3A 4XTCS 5BYQA 1HUMA 2BA0A 3OPOA 1Y1WB 3H0GB 4RCNA 4KGRA 4IUTA 4KY5A 4RF1A 3MXGA 2WB1B 4U673 5EE0A 4WQMA 1L0YB 3VRAB 2F0HA 3CRLC 1KLUD 2L0CA 1MPEA 4IDIA 4ZRPA 1YNJC 3Q22A 5IGEA 1BR9A 1F77A 4WFN3 2BB5A 1F2LA 2EJGC 1MVKA 2EE1A 5KNDA 5M5YB 4QF4A 3AEGB 3PUYA 1XCTL 5IGGA 4FF2A 3TEYA 2A68C 5IT9E 2M00A 2LMCA 2JYEA 2HDLA 1L0XB 3VR6A 1EWHA 2JA5B 4XWTA 1LT3D 1XLOA 2CW0C 1EQTA 3QG1A 2IT1A 1G6ZA 2WXRA 1G91A 3U7ZA 2JXTA 1F9PA 3BVMA 1V8QA 5CV7A 1QNKA 4A90A 3Q8EA 2K04A 4HTHA 1WTVA 4YT0B 2ON8A 1JRPA 5DM63 3SK4A 2WKCA 1K8OA 1C8CA 1LT5D 3PUVA 2Q8RE 3W2DA 2PVGC 4XE0A 1DOYA 2JE6I 5C3WA 5C3XA 2B63B 2AQ2B 3OWFA 1ZDVA 2WKDA 4USAA 4A3BB 2K3UA 2F0SA 5JPNC 4REZA 3I72A 4H13C 2PVOD 4A3FB 2CVRA 1A70A 4C7YA 3BG3A 2O4XA 2ICIA 4A3GB 4KHZA 1N62A 3KLSX 4ZRZA 3AMUA 2EDGA 1DGJA 1S5BD 2WINB 3DXJC 4KJNA 4YIJA 3J81E 2F0MA 2OF1A 2Z4HA 3GB1A 2B8FA 1HA5A 2F3VA 4G7ZC 1YN4A 3PIP3 4NAWB 3HOVB 5CORA 3MAQA 1LT4D 3TMEA 3D4RA 5C4XB 1SNCA 4RNAA 3KLSA 5AUIA 2K5WA 1SXTA 2SAKA 5M5XB 2KOLA 4DGZA 4DU9A 3QIAA 1QE6A 3K6OA 1HA6A 3C46A 5HI1A 3RZDB 4XYQA 1RFKA 1UWXA 1VZ6A 4C80A 2PCFB 3VR3A 1WD0A 1HHVA 1B9RA 1O80A 2WAQB 3SFDB 1ZE3D 2FHTA 1XLNA 4KI0A 2BYTA 3LWEA 2WXKA 1IKLA 1STHA 1JWSD 1PZID 2H89B 3EA6A 3KF8A 1AZQA 3C8YA 5EBDA 2F0QA 4DK1A 1KFYB 4ID6A 4ZRQA 1J7AA 2QCPX 4ZHPA 1F2RC 2LHDA 1FIQA 2HCCA 1EWCA 3DMUA 2I2YA 1F2MA 3B9JA 4ZKCB 4R8IA 4OIKA 3A8JE 3E9SA 3FAHA 5G3LD 5BMGA 5HFYA 1AFPA 5M3MB 1EYAA 3N52A 4YTMB 4RFBA 1PTOB 3MZ5A 1I4XA 4TRDA 2RPVA 4XQNA 4I65A 2F0TA 2QDBA 1KLGD 2KHSA 1E0BA 3BZDB 4DAPA 1SJED 2A6EC 3P20A 1JE4A 3KK7A 4KKUA 4IUQA 1SNPA 3DWAA 2LFNA 2VNUD 1U4MA 3N6RA 3H91A 4TSSA 4QIWB 3PZ7A 5JVG3 4HKQA 3PUXA 2PZWA 1TZOA 2R6GA 2Z1CA 1PRTC 4M1UB 1GXDC 1CHQD 3P75A 1C9FA 2PZUA 1L4DB 3T3NA 1IYVA 3UI3A 2QEJC 1P7FA 2BOSA 1HTLD 1K8MA 3AE6B 1KDBA 1EYDA 2ID0A 3MEHA 5JOBA 2G9HD 2IW3A 5G3LF 2QIEB 1LTID 4KV6A 1IYUA 1MGSA 2LGIA 3Q8BA 2KWDA 2N88A 4YXDB 3FEWX 4KKSA 2D62A 3NWSA 2X69A 3D3RA 1V43A 3NXWA 5E6JA 3AB5A 5K5PA 4CKCA 2BE5D 1SDFA 1V8CA 5C44B 4ARCA 2FJ2A 2RMMA 3DHQA 4G4KA 3PO2B 3K5MA 3HVZA 5FO9B 1QNUA 2TSSA 5BYSA 3BK2A 4B08A 2F0NA 4ITKA 2KN4A 2XSCA 1TU2B 4NW2A 3SVMA 4IUVA 1FYCA 1FNWA 4IN3A 5C3EB 4H44C 2L52A 4R8NA 3I8ZA 1VLBA 1XWEA 3EJIA 3QB3A 1JB3A 3GTQB 1JOQA 1SFOB 3NVZA 2K7VA 3FMCA 4C3IB 1DOXA 4LAAA 1KF6B 1HZ5A 2WXPA 4MHEA 1FMAD 3DWGC 3P4RB 1QKZA 3RUZA 1WTPA 3GTJB 3AEFB 2K5PA 3FPUB 3NPPA 4MACA 1JWUD 4WIPA 3MXPA 2MH7A 3M7GA 4QMGA 3IT6B 1IBXB 1Q3LA 2D9UA 1KDCA 3HZXA 1OXUA 3N9YC 1PXUA 3SK6A 3D4DA 2PTLA 1TWGB 1ZDXA 3L3OC 2M9VA 1H9SB 2L55A 1CZPA 4KKJA 3H94A 3AB9A 3TZDA 3HVDA 5T1GA 1EOTA 3S16B 1JOKA 2EY5A 1DM0B 4M8AA 3VR9B 4HAEA 4KKIA 1QQRA 3LNNA 1QOFA 3URYA 1V1PB 1STYA 1Q90A 4CJ1B 1RTNA 3SXHA 1DD2A 4WAFA 2W54A 3R2IA 1NUCA 2E2HB 2N7JA 1KABA 1WCMB 5HG2A 1GUTA 5A2QL 2F03A 2WXGA 3AE7B 4GDLB 1G2TA 3NHHA 3GQBA 2VZKB 4RGTA 4HR7B 3HEJA 2XNAC 1EU4A 1SYGA 3PV0A 1GAQB 2E76C 2WXHA 3FPPA 3E0JA 4PMBA 4CBVA 3PUWA 1LTBD 1PTOD 1WTWA 2RSOA 1SYDA 4A93B 1EY9A 3K0YA 1ZOYB 4ZLTF 2C5CA 4K5XA 3K5NA 2OT2A 1M8AA 1WXQA 2EYLA 3ZJUA 1A3UA 2ACZB 2INPE 2LS01 3KBXA 5FLXE 1R9TB 4EGVA 3GTMB 5EKKA 3P1MA 4DAYA 2DYOA 1RWSA 1D5ZC 1PTOC 2FMCA 1Q12A 4FF3A 2ICEC 4HMIA 2JA8B 2ZW1A 2A69D 4YSYB 1F9QA 3HRDD 1NYRA 3SHLA 1WTRA 4RA8A 1ESRA 2Y5CA 4X3SA 5CV6A 1I4GA 1SMYC 2XWBB 4KY6A 5BN5A 1U4PA 1F0ZA 3R93A 2JQRB 5D14A 4A3JB 1JWBD 5CBEE 3AE8B 1FD7D 4OHJA 1OXXK 4PV1C 2F0LA 4DK0A 1WTQA 4C3JG 3MXNA 1KRHA 1UEAB 1J8IA 3NZ3A 3Q6SA 1T6BX 1LABA 1YNND 2PMZB 1TYGB 3AECB 1TKEA 1I4RA 1B50A 3QJYA 4G57A 1RD9D 2WLBA 3VYUA 5C0XG 1U4RA 2QJLA 5LHY1 3MHZA 3M3YB 2HDMA 4JPSA 1X3QA 4BS9A 1SYCA 2E75C 4F87A 5I9OA 4P16A 4XIGS 4XWWA 2RQXA 1X3PA 3H6MA 1C4CA 1ZPSA 1K50A 4YSXB 4FXKC 3K59A 2A6HD 5JVH3 3A54A 2VB2X 5KNBA 1S5DD 1I7HA 4NP5A 3LWUA 3TUOA 4RKBA 3G6JB 2DNCA 5EQ0A 2H1EA 1SNDA 1K51A 1GUGA 1BQQT 3NK9A 1NENB 2OHFA 2ZW0A 3BK1A 5EPLA 2NVXB 3IAYA 3FILA 1FGBD 1EY8A 1U4LA 2JYTA 3HOYB 1SJHD 3FKIB 3MXUA 3P1HA 4ODGA 3HOWB 3GS2A 2HDEA 4OW0A 4BA2I 3DEOA 3AH7A 1YJIA 1BCPF 3NTHA 1NEKB 1B53A 4AQ7A 1EIHA 2K32A 2I46A 5D3DA 5IODA 4K6DA 1HQMC 5C4JB 3J81L 5J22A 3GP7A 1TS2A 1XTCD 1ET6A 3MFGA 2DWQA 5K36G 4XXEA 4K5VA 1T5XD 4N9PA 5J1ZA 3SFEB 5COYA 1AEXA 3G7LA 4KTAA 3T13A 5JJZA 5FKAC 1YN5A 1YNJD 2R93B 3OIPA 2EJMA 2NWGA 4OO1I 2DY7A 3F2UA 2IX3A 1S5ED 2L83A 1UNSA 4DFAA 1DZ1A 4UAIA 5KIXA 5MPOA 2A68D 3T53B 2KACA 2WDRB 3NWTA 3SR6A 5EE1A 4Q0FA 2EYOA 3W9CB 3NTKA 2CW0D 3QOLA 5C2TB 1MSGA 2PKOA 1E2VA 1DOLA 1SNQA 4KJOA 2J53A 1BF4A 3GTKB 1EWYC 3D4WA 1FRDA 1BNZA 2NTTA 1QOAA 1LV9A 1PYWD 2X6GA 1N61A 2WXOA 1FEHA 2D5GA 3CKIB 2IGGA 1YQ4B 1K52A 4JE3B 3C1EA 1FCCC 4GZYC 3NVWA 3P4QB 1YN3A 1SE3A 3AE9B 2B2UC 2NN6G 2MJ8A 4TQUS 1PZJD 3S9WA 1EY6A 2FMMA 2RBMA 1ZKOA 2NTSA 4OO1H 3V96A 1HEZE 4A55A 5IIFA 1NVID 4TKOB 2W3SA 3E6ZX 1FCLA 1LTSD 4F88A 4CJ0B 1ZEQX 4RH6A 1E7PB 3AEAB 4LK0M 2J52A 1XCQL 2BS3B 3MHBA 2PZTA 2IPKD 5K36H 3CHBD 2Z4IA 4JX1C 4F8MA 2HTME 2NN6I 1JQYD 1SNOA 2BDOA 2WQYB 4AS1A 5T1IA 3S17B 4WH4A 2K5DA 5KGUA 1F2ZA 4EE2A 4X3UA 2AQ3B 2EYFA 5A35A 2XRSD 4FXDA 1W6JA 3R2TA 3KBGA 4Q5VA 5C5LA 2EYMA 2N9LA 4C2MB 4L23A 1S4ZA 2B2TA 3M4YA 1JOOA 2B2VA 1PFNA 5CV9A 4NJCA 1E10A 5EPJA 2V4DA 2PMVA 5HHDG 3EUB2 3B2FA 1CFMA 3SK8A