1KTKA

Complex of streptococcal pyrogenic enterotoxin c (spec) with a human t cell receptor beta chain (vbeta2.1)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
203
Chain Sequence
KKDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin type C
publication title Structures of two streptococcal superantigens bound to TCR beta chains reveal diversity in the architecture of T cell signaling complexes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 50
structure length 203
sequence length 206
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ktkA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ktkA01
1EEFD 5ELCA 3GP7A 1SJHD 1F77A 1LT4D 2WV6D 4DXGA 2AQ3B 1S5ED 1XXGA 4OHJA 1FGBD 1TS4A 1V1PB 3SEBA 4C56C 1I4PA 1LT3D 3CHBD 3V05A 1CK1A 1EWCA 1FNUA 1DYQA 1PZJD 2Z8LA 1FNWA 5FKAC 1ET9A 4RGTA 4DXFA 1EU4A 2RDGA 2QEJC 3BVGA 5D3IB 1JQYD 1PYWD 1M4VA 1PRTF 1XTCD 2ICIA 1LT6D 1I4GA 1S5BD 1V1PA 5ELBA 1YN3A 1G8ZD 3DWPA 1KTKA 1RDPD 2R61A 2SEBD 4ZYSA 4BWGB 1QILA 1PTOF 1RCVD 1LTID 1SEBD 1S5FD 2NTSA 4TSSA 1ESFA 3W2DA 1PTOB 3MC0B 1FNVA 1TS3A 1I4RA 1EU3A 1PTOD 1HQRD 1HA5A 1HXYD 1LTGD 1T5XD 1UUPA 2AQ2B 1TY0A 4Z9CB 1SJED 1V1OA 1SBBB 2XRSD 1JWSD 1PZID 1D5XC 1CQVA 1S5CD 3O13A 1LTBD 1S5DD 1MD2D 4RGOS 3OWEB 1KLGD 1SE2A 1PRTB 1KLUD 5FK9C 5TSSA 3BVMA 1PRTD 3R2TA 5ELDA 1TY2A 5I4DA 1D6EC 2XNAC 1RD9D 3BZDB 1JR0D 1EEID 3TSSA 1D5ZC 1TS5A 1AW7A 1LLRD 1LTSD 1RF2D 1TS2A 1DJRD 2AQ1B 3DWAA 5ELFA 1BCPF 1PTOC 3EFXD 3BYYB 4RHSA 1BCPB 2IJ0A 2QILA 1LTRD 1BCPD 5ELEA 1AN8A 1I4QA 1L0XB 3URYA 1ENFA 2XRQD 3BVZA 1GOZA 1LT5D 1LTTD 4NZLB 1LO5D 2IPKD 2NTTA 4RFBA 1CHQD 2O2LD 4K6LA 1PZKD 4RHRA 5D3DA 1PRTC 2J4XA 3BYTB 1EFID 1I4XA 1SXTA 1I4HA 3R8BA 3EA6A 1SE3A 1SE4A 3MFGA 2G9HD 2TSSA 4RCOA 4UDUC 2XN9C 4RGNA 1BXTA 4L6TB 1FD7D 4O1NA 1UNSA 2CHBD 3KLSX 3R2IA 2RDHA 4L63B 1B1ZA 1PTOH 1CT1D 3DWQA 1B44D 1JCKB 1YN4A 1YN5A 4RGMA 1BCPC 1JWMD 1HTLD 1LTAD 4RH6A 1ET6A 1CHPD 1L0YB 1JWUD 1STEA 1D5MC
chains in the Genus database with same CATH superfamily
1LUZA 3U58A 2DAJA 2R6GA 4IM0A 4LJPB 2F0LA 1II3A 4IDIA 5TR5A 1E10A 1WFQA 4BY7G 2GLSA 4G4KA 1UBQA 4ICVA 4NXMQ 3SEBA 2D07B 1D7QA 2N78A 1LT3D 4JI1Q 2CKHB 3HOXH 3F2CA 2UXBQ 4GKJQ 2K14A 1VQIA 3CXCA 4DWFA 5EPKA 1ET9A 1E7VA 2BQQA 1GB1A 4A76A 4LF7L 1CMXB 3A7AB 4FADA 5AZGA 3E5SA 5C4JB 3AE6B 3DVGY 4K5XA 4ZRJA 4PV1C 5JAVA 3S24A 5IOIA 3L7ZC 4W9JA 1F1HA 3GTPB 4A3KG 1KTKA 4C3IH 1W6KA 3BY4B 5K36G 2MWSB 1EY5A 5NUCA 2F0TA 4OZAA 3RZDH 4IM3A 1FM0D 4A3GB 1HZBA 2NVXB 2JA7G 5HY6A 3MC0B 1XNQL 2RSNA 2V3PA 2IYDB 3CP0A 3OIQA 3CCSA 2MSED 4OVVA 2L32A 4H13C 5FLMH 1UUPA 4Q0FA 3S2AA 3FKIG 1WXQA 1SFOH 4JI2L 2Y5BB 4DDID 4US8A 3GV6A 1KAAA 1UEAB 4MTNA 2JZPA 3BG3A 1HCZA 2LWPA 3L17A 2YTYA 4XTCS 5IIFA 2ZVOA 1GVPA 3VTUA 1PRTB 2WXLA 5LHY1 2FCSA 2BDNA 4IN3A 3BWUD 1ZGUB 3NHEB 3NUCA 3H9DA 2JSOA 4FDBA 2SAKA 3AEBB 2LD9A 3TSSA 2NBFA 3W1BA 2PMVA 3PIPA 3HHMA 4LNFA 2PPBC 1EOTA 1O78A 4S3SA 1G291 4P2CB 4C3HH 1WTWA 4DAYB 4W9HA 4KX6B 1TTNA 3CCLA 4J15A 3I9V1 1ZEQX 4PMBA 3DHGC 3VTVA 1JRUA 5LL6S 4HAEA 3D0FA 5D6JB 3E3XA 1OFFA 1PGXA 3Q3OC 1SYEA 1BUVT 2NZOA 2EYLA 2F4IA 1XF5L 2M4NA 5GADC 2D5GA 3SGIA 2NVTH 4MN3A 1VS0A 4BA1I 2K5QA 5IP7G 2UWQA 1I4XA 3VFKA 3C8YA 2DNEA 1STBA 2JA8H 2OT2A 1RYJA 3NY5A 2Q8TA 1JMLA 3FAHA 4KY7A 4A3KH 5FR6A 2MBHA 2RPVA 4IUQA 4GNXB 4A93G 3JC66 2KDMA 2MJDA 2KAJA 1DXMA 3KLSX 4B3TQ 1N9WA 2N55A 3ND8A 2K32A 1KDAA 2NN6G 3ZW3A 3PF4A 2CQAA 3HZXA 1VQ9A 2LRWA 4ZRQA 2RSUA 1A5RA 1K0SA 4KHPQ 1RL2A 4WQMA 5BMHA 2H1EA 1J5EQ 3AEEB 4R4CA 4HIKA 2WXKA 3H0GB 3PO3H 2K5HA 5CX3A 3ZNID 1ASZA 1HE8A 1IW7D 3I4NH 2PEAA 3I55A 1C0AA 1WXVA 2HDEA 2ZPNA 3GP7A 1X3PA 4GOPA 1XMQL 4W9CA 4OIJA 1HZ6A 2XIWA 1RJTA 3ZGZA 1PXUA 2B2TC 4YY3L 3OTOL 1V5OA 3DXJC 4MNOA 2EJGC 1IBKQ 2VXWA 2TMPA 3AFPA 4FF4A 4H2AA 1TWAB 1HHVA 1FNWA 1L1OA 4RGTA 4BOSC 1YOVB 3RLNA 4X64L 4BBSG 2AWNA 5IGBA 2IGHA 2BCOA 3S2DB 3GTOH 1HTOA 2JA6B 3SK5A 1M90C 1MI2A 4LUZA 3TEXA 1JE4A 2ASQA 1EWYC 1M94A 4HJ9A 4WJ4A 2ZTCA 2D2QA 2B63H 2KCNA 2MCNB 3FILA 1S3OA 3ERSX 1GUNA 2HCIA 3MEHA 1CTMA 1N34L 3C46A 3P63A 1WCMG 3OLMD 5LNK1 5FOBB 5M3MB 1PLFA 3G4SA 4JYAL 4FNFA 5C2TB 2C5LC 2D0OA 2DNCA 4RA8A 2OWOA 4FF3A 1Q7YC 2K25A 3AU5A 2E2JB 4HXDA 1KNEA 3HM3A 4N9TA 2C7NB 2Q2IA 1Q5WB 3IVFA 2AUKA 3BDLA 3ZTDA 3P4PB 2ZVNA 2R7FA 5IP7H 1J7BA 4X3TA 1YZ6A 2VZAA 1HA5A 1YEZA 2LMCA 4MIUA 3A0JA 5I2XA 4A3BH 3GTQH 2RSOA 1OQQA 3K6OA 3S1QB 5M5YB 1CQVA 3I73A 3K7AB 2HIVA 3RN5A 2EQSA 1WJJA 4IPGA 4HJKA 2F52A 2Z9HA 4HROA 2NN6H 5L95C 3M4OB 1L2NA 2BKRB 3T3OA 2KTFA 2QKIC 4JK1C 3CCQA 3NPPA 2FIDA 2X38A 3H7SA 1H8CA 3U52E 1X9NA 2MRPA 1EIFA 2KLGA 2ZXPA 4FF2A 2R92H 4W9DA 3TL5A 1HTQA 4R4OA 5I6YA 3QIJA 2ZM6Q 1FVIA 3RR5A 3DDCB 2YTXA 2L3ZA 2KWDA 5DPTA 2BYTA 4LF9Q 2AKWB 5EKLA 2WB1G 4HPLB 1HQMC 2FINB 4GS3A 2M0XA 3W5OA 1CKNA 3Q8DA 2WP8J 1WYDA 4IWPA 3IAYA 2A1AA 3VR2A 1QVGA 1PH3A 2DZMA 2Y0SG 3W1GA 2XRQD 3V6EB 1GOZA 4FJYA 4BBSH 4GOCA 3NS1A 1CHQD 4CJ2C 4AIMA 3S1RB 1XCQL 3A1QA 3MC9A 4FULA 5BO4B 1DGSA 1E8ZA 1WZ0A 2F0OA 2NCNA 4WJPA 3V3XA 1VQEA 2HCCA 5C4ZA 2CJOA 5J3BA 1QNUA 4L6TB 3W9CB 2WACA 3FMCA 1Z47A 3I4LA 2WDTB 3AN1A 1SSOA 1KAWA 2GA4B 4JI4Q 2HTHA 2CQOA 1A6XA 1X65A 4AQYL 4XYOA 2I0QA 2V1YA 4OW0A 4MJSA 3QIAA 1L0YB 2I5LX 4GN5A 1VRAB 2XWJB 2KWUB 4QAYA 2OJWA 1Q12A 4USAA 3ZUNA 1Z9FA 4ZKBB 2O4XA 5AZFA 3CPWA 2LXJA 2DZKA 4K3BA 3GE8C 1LT4D 3OSOA 3J80c 4EQOA 2JA5H 1YQ4B 2WU2B 1SNDA 2EY2A 3UE1A 5KYLA 1SIFA 2J53A 2WXFA 4DXAB 2HQEA 1ZPSA 2JY6A 3OIPA 3W3AA 1LABA 3V05A 4B3RL 2L7RA 2O2VA 1TGZB 3PREA 4X65Q 4ANVA 3ZNZB 1F9RA 1NR4A 2MBQA 1OXUA 3A74A 4NXNQ 2E76C 2WS3B 5C4XB 4OGQC 3FEWX 1YN3A 2K28A 1B7YB 1I3QB 4GOPC 1H95A 1TWFB 1I6HB 4NP5A 5GMVA 3NEMA 2G1EA 2NVYB 3S15B 4RWSC 4K7SA 1V6EA 4LF6L 1NMFA 2MW5A 2MQHA 3PUYA 2O6VA 4GN1A 1EWHA 3RMKC 2IY5B 4ZKCB 3X0WA 4XT3B 1UEBA 3CQZH 1L1OC 3N9YC 3W2DA 3D8GA 1T0QC 3D32A 1HNZQ 3SHQA 3LJ3A 2WKDA 1TWCB 3ZQ4A 1LTGD 4KV2A 4EVOA 4IKGA 4A3MH 4ZRIA 1SJED 4J6HA 1SBBB 3AEGB 3APDA 2DZJA 3F1ZA 5E4WC 2G5DA 3U8ZA 2B2WA 2NVQB 2NPTB 3DPDA 1C78A 1KLGD 5AEKB 5CV6A 1TIFA 5IGEA 4DA2A 3MHSD 3QR8A 2ICEC 3QO2A 4A90A 2GOWA 4OEMB 3NBHB 4HJGE 2KYWA 3BZDB 4AJYB 1K8RB 1EEID 1XNRL 1K3BC 5JEAJ 4A3EB 4AYBB 5F2DA 3TQYA 5KNDA 1VQOA 1YIWA 1ZE3D 2IGGA 3K81C 4NY0A 3GZNB 3PTFC 1IKLA 4JI0Q 3AMUA 3M3YB 2AQ1B 2Y5PA 1MHWC 3HOUH 1C48A 4CJ0B 3HOZB 2DNFA 1R7SA 4PT5A 1KFYB 1WOCA 1DOLA 2WP9B 4QIWB 1FRDA 1L6VA 4FN2A 4OWWB 1PGAA 2YU9H 3RNGC 2NWGA 5ELEA 3A9JB 5EJWA 3PUXA 3S1NB 2OQKA 3LX0A 4GDKB 4ZRPA 1LT5D 4GKKL 1VQHA 1PMRA 4EZJA 4MM3A 3QX1A 2DYBA 3GV3A 3R7QA 2M2LA 3WALA 1ASYA 4GDLB 1F9QA 3TP6A 1CSPA 1K83H 4XT1B 3VUWA 5BYSA 1E7UA 2D5DA 4LK0M 1NSNS 1XLOA 1BXTA 5AJ3Q 3CPFA 1BBXC 2EJMA 2E2IB 2BBCA 1PTOH 1YNND 3TEWA 1JCKB 3TEZA 3D4RA 1FL0A 4I7ZC 1WYWB 4LFBL 3G6JB 2L0FA 1C1YB 1SGHA 2K7VA 2ZCBA 3PUWA 2GN5A 3Q2AC 4CJ1B 1ET6A 2RVLA 4E3CA 4DV3L 1V5TA 3A5ZB 1WM2A 1C4AA 1XO3A 3CCVA 1JWUD 4K0KQ 2ZNVB 4A3GG 2Q5WD 2BH8A 2CHXA 1QOAA 4B3SL 1H9SA 1VQGA 2J42A 1ZXTA 3RNAC 3I5JC 2A73B 3F2BA 1N63A 3NVYA 2ZW1A 2N9PC 4ANWA 1SB3C 4FBJB 2HD5B 2BYEA 3LB8C 1PZJD 2QMTA 2KTRA 3SVMA 4MTKA 3UDIA 2CR5A 1F2LA 1KRSA 3F2UA 2PLPA 3AEVA 4PNYA 2O6VD 4I65A 2PZUA 5JHAA 2M17A 1V1PA 1WE6A 2LVQA 4M0WA 4ME3A 3NUHB 1IYVA 5E6PA 3U30A 4LF7Q 3J81E 2WINB 1HNWL 4JGHB 2EYPA 3P1MA 1N8RC 2EVBA 4NMZA 2Z59B 3A55A 2K8CA 3AB9A 2OOBB 2QW7A 4OVZA 5LMNW 4XYQA 2VZKD 4X6AH 2MPMA 1HFNA 4OO1G 4W9FA 2WXGA 4K81A 3ZTCA 2NN6I 3LGJA 2R7ZB 5FJ8G 2RQXA 1WZ3A 1VZ8A 1EU3A 2F0NA 3KDFA 3DWGC 2WAQE 1ESRA 4NPSA 4JI3L 1XQQA 2JXMB 4A8XC 3RUIB 1XNQQ 1YMHE 3NQIA 5CV5A 2BKFA 2LY7A 1WD1A 3VDYA 3PRPB 1KABA 3L3OC 4OWXB 1MKHA 1N6ZA 2B39A 1MG8A 4JI2Q 5IA7A 3Q8FA 4B9WA 5JEAG 2FFKB 3Q69A 4MEMA 2K5WA 5C0XJ 2XNAC 3GTPH 1MHXA 5EPJA 3IHPC 3WANA 1EYDA 4E6IA 2F03A 4ZUIA 3MTSA 5JJZA 5CYUA 2KO3A 2E75C 5EDSA 5C3EH 3CAMA 4A3OA 2JQOA 1SR3A 1F2ZA 1LTSD 3RLFA 1V81A 2KN5A 2FMCA 3A8KE 4RF0A 5MPOA 3BDOA 1OEYJ 1XMOL 1T0SC 4XZ4A 2IBIB 4IC7B 1BCPF 2B2WC 4L5RC 1EY7A 3SXHA 3APFA 3NSWA 2IJ0A 1X3EA 4K8IA 2HD3A 1LTRD 4QY7A 4X62L 5LLIA 5G3LF 5DCNA 3H0GG 2DENB 5GROA 4JQWC 4DV7L 2PVGC 4L23A 4K2KA 1E3PA 1EWIA 1X3FA 1YNTE 4HMIA 4KV6A 2N7DA 3CC2A 3JW0X 1JORA 4DV5L 1E8WA 3DBHB 4KD4A 2QEXA 2KHSA 2RGFA 2WNMA 4P73A 3A8JE 3JVZX 5IO9A 1SXTA 3OHXC 4GMVA 3WA0A 4HK2A 3SD5A 3MXNB 2TSSA 4A3FG 3IG3A 4K8JA 4LUVA 4X3KA 3HOVB 2JA6G 4I6LB 4ABNA 1EQQA 1JRPA 5GQOA 1NBWA 1OTCA 1T0YA 2KXJA 3AEAB 1PFSA 1PH9A 4HDOA 3L4PA 4A9AA 1ZP0B 3M62B 5FJ8H 3G6EA 4DAMA 5H1SE 5LXHA 2LJIA 5M3MG 5JHBA 1IXRA 3P4RB 1E2WA 2GVBA 2KLCA 2LGSA 2F1MA 2DGYA 4GZYC 1I50B 4IUUA 4P1BC 1R4MI 4C2MH 3KH0A 1NTGA 2L8JA 2LXKA 2N3SA 2LGIA 1FGBD 3HK0A 2IZVB 4HPPA 4CBVA 1G2SA 3R7RA 1BR9A 2N4FA 1Y1VH 2MNAA 1XMQQ 2IGDA 1UE7A 3K7UC 4DPGA 1EU4A 2JYOA 3BVGA 2R93B 1JOQA 1WGDA 4YY3Q 3OTOQ 5C44B 4REZA 2EXZA 5DM63 2R7DA 3AYHB 4NNJB 3I2ZA 1KJTA 2WDQB 1Q86C 1S5BD 1KIXA 3AH7A 2WB1B 2F0MA 3E6ZX 3VUYA 3L16A 5M5WH 4TMAB 4L1BA 1F2RC 2INDC 2Y0SB 2QHOA 3STBD 2CH4A 1JE5A 3I56A 4ZYSA 1PTOF 3KLSA 4EEWA 1X3QA 4P74A 4O42A 5EE3A 3RNEC 4RF1A 4ZHPA 4JYAQ 3PO2H 5DPSA 4B9XA 4LAAA 5LMNQ 3GTKB 3QARA 3SHLA 4DNIA 4IFDJ 2LZ6A 4LNIA 4DR6L 1TY0A 2V3SA 2JF5A 3CRKC 2HIXA 2IHEA 3NENA 2J0KA 3Q24A 3ONSA 2QCPX 3TP8A 4KDLB 4F8CB 1VQCA 4IOCA 3O13A 2LI5A 5C0XG 1XPOA 3UE0A 3RZOB 3LYYA 4P1CC 3D6WA 3BVMA 4L2YA 4DV4L 5KGUA 3PUZA 5I4DA 4OELB 3BINA 2OQ0A 4ILWA 4DUZL 4LK1C 1KDBA 2C7HA 5HGQA 4HEA1 1UGJA 3VR5A 1QZGA 1G6ZA 4E71A 1RF2D 5IYCH 1DOXA 2VUMH 3S14H 1A63A 2BA1A 3I4MB 4C3JB 1WXMA 4RHSA 5ELNA 1NDDA 3AE8B 5EKIA 2KOLA 1ML0D 1RRBA 2V9HA 1BCPD 2K03A 4HEDA 1NUCA 3B1LX 1F9SA 1N36L 1JJ2A 1GAQB 4NDXA 1Q10A 1KLVA 3K7AH 1ICFB 4DR3Q 1DOKA 2D0PA 3E9HA 1LO5D 4QIWE 1JJGA 4BZAA 4XDXA 4DHJB 1PZKD 4A4IA 3EHVA 1EFID 3M4OH 2WKCA 2H5XA 1WTOA 1XPUA 2KWVB 2JVCA 4ARIA 3QAQA 1X55A 1P8LA 5M9OA 1Y8NB 4KLKA 1N60A 2BF8B 2R2QA 5G5HA 1FR3A 3GTJB 4KKUA 4DHZB 3P1HA 5C4XG 2B2UA 1B44D 4WIPA 1QUQB 2I1JA 2K6DB 2V4LA 3SK6A 2FE8A 1MFWA 3L13A 4MGKE 4URKA 2LUMA 1EYCA 1GD7A 3MHBA 4IJLA 5EBDA 2ACZB 1BCPC 3L0OA 3IBEA 1HTLD 3LXFA 2PI2E 3B6YA 2K75A 3K5NA 4A3JB 5EE9A 1KOTA 2KEEA 1J6QA 1WJNA 3E0EA 4A3DH 1Y1WH 4AQYQ 1JW9D 1R9TB 1VQDA 5ELCA 3T1YL 1QZHA 1X56A 3S1RH 3A4RA 2OCEA 2LGXA 4YTPB 4IPCA 3SFDB 4YWGG 2KANA 1HZCA 2KA7A 3UQAA 2NR2A 4A3LH 1VF5C 1VQMA 2ZTDA 4WFN3 2DAFA 2Z8LA 4PZ6A 4TKOB 2RBMA 4JOIA 1EFWA 1XLPA 3U2SC 4TV3A 3HFZB 4JI8L 5I2YA 2EY6A 3B9JA 4R9WA 4YSXB 1PRTF 3H7PA 4B3RQ 3IAS1 5GAEC 2Z0DB 3MEFA 1NI3A 2PO4A 1B53A 1VQKA 1C4QA 4UPAA 1AZPA 2ASBA 3DWPA 1QOGA 1WE7A 4YSYB 3KJPA 4UP8A 1VZ7A 2HDMA 3C1EA 2IO1B 4A3EG 5HFYA 4AYBG 1KRHA 2MJ8A 1YNJD 1YJ1A 3DCGA 3AE4B 3ZJVA 2SEBD 4TQUS 4LF8L 2ZJDA 2K3UA 4KKJA 4KMUC 4IFDG 4GXBA 3DHQA 3HOZG 2PMZE 4HIMA 4LF6Q 1N33Q 4IWOA 4R8IA 1TS3A 2PW9A 3W5UB 1E22A 1PTOD 3VTWA 2AQ2B 1SYBA 1EY0A 1EZ6A 3C19A 5IWAQ 4UP7A 3T1HL 2VH1A 1V43A 4X66L 2EYJA 1UD7A 4NAWB 1FJGL 5BN5A 1MD2D 4J8QA 1WJ4A 2N1WA 1H9RA 5C4XH 3KWLA 1U0LA 1WFYA 4K7WA 1TY2A 1SMYD 2AYOB 2BT6A 5LMUL 3QOJA 4XC2A 2NVYH 1YNJC 4A3CH 4IUNA 2KFJA 3AE9B 3RNBC 2XWBB 3KUCB 1QB5D 1HEZE 2RCNA 4HPMB 1MG4A 4B3ML 3OMGA 2QDLA 1PTOC 1XNRQ 1V8CA 3EECA 4EUTA 4J1MA 4GGQA 1B3QA 3P2BA 1CFMA 3K5LA 2JRHA 4OX9L 3MXPA 2R2OA 2JK8A 3URYA 4GNXA 2J0MA 2L9HA 5JJIA 1Q1OA 1RWSA 3N32A 1EYAA 3K9OB 2RPQA 1QT9A 3VRBB 4OO1I 3AE7B 4WQOB 1SNPA 2MBBB 4M8MA 1EIGA 2CHWA 1R4PB 5D14A 2A68D 4JI6L 1O80A 4OWTB 3MFGA 1QJOA 2D9UA 1SMXA 2J0TD 4DV2L 3N1YC 2X69A 4A3EH 1JQ4A 1H9KA 1UNSA 5IE8A 5E3FA 2MO1A 1VCIA 1E7PB 4BY7H 2CFMA 1T0RC 3KK7A 3U7ZA 1YN5A 3R3MA 3I63C 4AUQC 1TR5A 3KQ4A 3JAMi 2KZRA 4OZBA 2XK5A 1NJIC 3TP5A 4HN7A 1N32L 1C7YA 3GTGB 1WGRA 4A75A 2MJEA 1DOMA 2UUCL 2L5TA 4CQNA 1LM8B 2PTLA 4AP4C 1V9PA 1SJHD 1STHA 5IY0A 2R7ZG 1XLNA 2CS4A 2B2UC 3LWEA 1RTNA 2A68C 3SFEB 3KFUA 3KLWA 3PZ8A 1PYBA 4MACA 5L83A 4IPHA 2KACA 1YD8U 4TQ0A 5K36H 2DLBA 5HHDG 2C5CA 3M85A 5IYBG 2CHZA 2KCTA 2E2IH 2HE7A 3VR6A 4XQQA 3M7GA 1QG7A 3A4SC 3UI3A 2RF4A 1L5PA 2Q2HA 2DBYA 1YJIA 2JA7H 1SNCA 5AUIA 2CU3A 3I7FA 4ALPA 1XLQA 1PDQA 2A6ED 1T5EA 1NNXA 3A7LA 4P72A 5C3XA 5M5XB 1XYIA 1LGRA 5EAYA 3WCQA 4BOZB 3FKIH 5E6NA 2OTLA 3D4WA 5FR3A 3RMHA 3WAMA 4IURA 2WB1E 2VH2A 3V60A 1HNWQ 3K58A 2UUBL 4JOIC 4GN4B 2A5UA 3W1SA 4ULLA 1HFGA 1PH7A 2NUCA 3S1MB 3OJ4B 1C3TA 2Y0SE 3Q0AA 1WWTA 2F0SA 1IBLL 4OXPA 1P7EA 1ZDVA 3TEYA 1MSGA 4A3FB 1GO3E 2N9XA 1I42A 4LWCA 1E1OA 2WIIB 2WXRA 3GTLH 1PZID 3RCZA 4IG7B 2VY3A 3GS2A 5ELOA 2BYFA 2BGFA 3NE5B 1YQBA 4R8NA 1V80A 3AB5A 2MP1A 1J8CA 3TZDA 3DLLA 4JI3Q 5FK9C 2N7EA 2A6EC 2K52A 4RKBA 3NTKA 3R2TA 4L8JA 1WMHA 3N20C 1A0IA 4KHZA 3BS1A 3TS2A 2KDBA 3I91A 1IW7C 3IT4B 5BMIA 4A55A 2I38A 1E6EB 2EY5A 3BJUA 4BY1B 3HOVG 1KH0A 5CTRC 2MHJA 2L55A 3HOWB 3ZYYX 2KEDA 3ZJUA 1GC7A 4ZQ3A 2DN8A 3NS8A 3T56B 4J6IA 1YJJA 2EIFA 3P7JA 3PZDA 2R3ZA 5JXVA 4JV5L 1LV9A 3SU8X 2MH7A 2HQLA 2EYHA 4IUTA 4JVZA 1IBML 3ZRFA 1I94Q 2IY1B 3UIOB 1TWHH 4WJWA 1H9MA 4HIOA 1XMOQ 3AE3B 2VQFL 4NQKE 2PW7A 4A93H 2GBJA 1EF5A 1Y14B 1MSHA 1HR0L 1GJZA 4RNAA 1A62A 1EO6A 1WGGA 2XSCA 2JE6I 2EYMA 4X62Q 1B50A 1WXAA 1OO9B 1ZKHA 1FFUA 2WWZA 4KY5A 2K01A 3SK4A 1C79A 2J4XA 2L1BA 3V6CB 1V9JA 3DBLB 5D94A 1EIHA 2L76A 5EE1A 1O7YA 3QG1A 4HSVA 2F0DA 4DR1L 1ZDXA 4TUUA 1QNKA 1CA5A 4HTHA 2R93G 1VQ5A 1KM7A 3PT2B 5BYQA 1U4PA 4R4TA 4H7BA 5FO9B 5C44G 1HRJA 2ZJPA 1L4ZB 2DYMA 4UY8C 3GO5A 5C0XI 1L0VB 1UZXB 5J2RA 2PQEA 1T9HA 2L83A 4UHVA 3K80C 4DR2L 3CD6A 2D3GA 1YN4A 1UBIA 4GOPB 3AV8A 3VQIA 1K0RA 2KQ3A 3B2FA 2JWUA 2NBVB 4XYCA 1FD6A 2LUEA 4HRSA 3S16H 1AH9A 1BQQT 3HKZB 4RG1A 3J81L 1GHKA 1DOIA 1EL0A 3NTIA 1L1OB 4IUPA 2KT7A 4Y52H 1MHHE 3I70A 4DAVA 1VQPA 1PDXA 4HLEA 3S17B 2VB2X 1VDZA 4DXGA 1HZ5A 1VCBA 3ABVB 1GKHA 1V86A 1CKOA 1VQJA 2X6LA 4KKTA 3AE2B 4EQNA 5JVH3 2MJ3A 3FILB 1CK1A 1WCMH 4B0EA 2FNJB 1VF7A 2A5HA 2IX1A 5D3IB 3RPFC 4C4VA 4TQ1A 3GTMB 4HCSA 3VA5A 3Q6SA 2E2HB 4XE0A 1KHIA 3VXWA 3L54A 3PSIA 2ICIA 4AWJA 5IGDA 2Q8IB 5ELBA 1WI5A 1GUWA 2I1KA 2KN4A 5E6JA 3VYRA 3MP9A 4MT5A 4LW1A 3KLRA 3AM9A 3NELA 4RMFA 2LMCB 3UINB 2B3AA 2IO0B 4DR5L 3KF8A 3QOLA 4JPBW 4MHEA 4ZAIA 3U50C 2VQEQ 4BWGB 1RFAA 2B29A 1ZOYB 2DJFC 3CRLC 3I4MG 3I4OA 4C3JG 3DHHC 3MAQA 3KBXA 3RYTA 1IYFA 1FNVA 1MJEA 1ZW7A 3NBHA 1JB3A 4G11A 1TWGH 2F0PA 4Z9CB 4E74A 5DLQE 5C3JB 1SYDA 4XDCA 3B2GA 2R93H 1P1AA 3HOYB 3IFDA 4BFRA 1S5DD 1Y8OB 4MSMB 2V0GA 4DR6Q 4CDDC 4R3DA 3TIXA 4A20A 2KK8A 3HVZA 4IZ8A 4XGAB 1Y8RC 3HVDA 4A3IB 2IWHA 5EBCA 5ELDA 3W1SC 5EQ0A 3T3NA 3J7AV 1IZ6A 3ZRCA 3J80i 1JROA 1TKYA 1WH3A 2LFIA 3OW2A 2KWCA 3JSVA 4N8X1 2JXXA 4MGIE 2F0QA 5BR8L 1GHJA 3NXWA 1J8IA 3HOXB 1CKNB 2E8GA 1I6VC 1VMPA 1SLJA 1AW7A 3HM6X 3Q3FA 4DV4Q 3DVNV 4G57A 4HVBA 1K73C 1KC8C 4AJWA 4NAMA 3DWAA 2YEPB 2K9XA 5T1IA 2ON8A 5J22A 4R1JA 4NJ6A 3A1QB 1E8YA 3NBIA 2J0JA 3FPUB 3K0XA 4A3JG 4C3IB 1L0XB 1QOFA 2LEKA 2JRIB 3VDZA 1M8AA 3AECB 5DAUA 2RMMA 4N58A 4L5SA 4FXGC 3GZNI 3BK1A 3A8IE 2PI2A 2Z1CA 2LHDA 2KFKA 1RIPA 2IPKD 2NTTA 4IFDI 4ID6A 3RZDB 3N30A 2ZW0A 3RZOH 2KMMA 3EN2A 2UXBL 1VZ6A 1N36Q 4A3PA 2ZT9C 1X54A 1NVID 4LMQD 4PS7A 4X3SA 2JT4B 1ACCA 4RGNA 4KN7C 1E90A 3NZUA 2BTEA 1X3GA 3R3OA 1SFOB 4MJSB 3SDLC 1JWBD 1AP0A 1MVKA 3M95A 1SAPA 1NEKB 5G2NA 3ZO5B 3ND9A 4F1SA 4WWOA 5IP4D 3OMCA 3QB3A 1EY4A 2MUYA 1VQ7A 3KVFB 3DWQA 4F7ZA 4FA6A 4PK1A 2N1VA 2A4ZA 3K57A 2DJGC 2EE1A 2QCZA 2WFWA 4WH4A 2IL8A 3CKIB 3EJIA 3J81j 1SRUA 3WDNA 4DBGA 2NB0A 4RH6A 3KUZA 1AFPA 1VMCA 3QJZA 2O2VB 3QQ8B 3H09A 5CV4A 2IDYA 1D4BA 2H89B 2EKIA 4DFAA 1YJ9A 4PMCA 4C3HB 3ICEA 2C7MB 1K9MC 2BB5A 1TVXA 3Q3JA 3FDTA 4IO9A 4FF1A 1L0WA 5C3WA 4OHJA 2DY8A 3U9OA 2LVOA 3OAWA 4P16A 3J7ZC 4CYEA 2K0PA 4EQPA 3IRBA 1OXXK 1D2BA 2IHFA 2NBWB 2O6VB 2UXDL 2FJ2A 1K8AC 2MO0A 3UI2A 3MZ5A 5FLXE 2W82A 3A9KA 4GN3B 2JUOA 3N1ZC 1T3QA 2AUJD 4U673 3U4VA 2F4VL 2ONQA 4C00A 3MVVA 3QC8B 3VVWB 2KVRA 3VYTA 4EX5A 2E5LL 2JA8B 3L10B 1IP9A 1I35A 1N5XA 4JIOU 1YHQA 2K1FA 3TP7A 1BVSA 5C5MA 4M02A 2VZKB 1HZAA 1WIAA 4XWWA 1IHZA 3FVQA 1PH5A 1PQSA 1SEBD 2L00B 4F88A 1BNZA 1SN8A 1OTRB 1GC6A 4WAFA 1PH6A 4DF7A 2M19A 4BXXG 3HKSA 4JWUC 3ZXVA 2KJXA 1QVFA 1XCTL 1HA6A 1VQAA 3V96A 1QVCA 1E24A 1D5XC 1YNNC 4CKCA 3PO3B 1EQRA 1TKGA 3I4NB 5G55A 1SE2A 3MXGA 4ZYNA 1WJUA 2BW2A 3T1HQ 1XD3B 1FRRA 1XEEA 2GBKA 4X66Q 2OTJA 4DR7L 1FJGQ 1JR0D 2F0HA 2Q8RE 4CHKA 1J9OA 1V1QA 1D5ZC 2GB1A 1N5WA 1TXYA 2D11A 1YBYA 2QC8A 4ZCKA 4XDDA 1V8QA 2B8GA 5CV9A 1AE3A 3Q22A 5LMUQ 4KHPL 4HKQA 4DHZE 1ENAA 1YX5B 1ONLA 4MM3B 5E1FA 2CJNA 4OZCA 3ALBA 4RM8A 5JOBA 2QILA 4F8MA 2B63B 4M8AA 4PG3A 3KF6A 4KIKA 2L52A 3X3NA 1IBXA 2ID0A 4ZK9B 5C4JH 3PIO3 3J9CA 4K1RB 2J7QB 3PV0A 4J3OD 2Y5CA 3NQTA 1IBKL 2RHSB 2N49A 2A19A 3NHHA 2ENBA 4OX9Q 2KECA 3ENEA 1Q1EA 3R8BA 2JJQA 3PUVA 4DK0A 2FMMA 4LJZC 5KEEA 2G9HD 4ARCA 2KVMA 2SDFA 4NB3A 4A3BB 1S1QB 4XQNA 3GTQB 4EE2A 4K6DA 4POGA 4A3GH 1CSQA 1TT5B 2O5JC 3DBHI 4DUYL 3R2IA 2NVXH 4JI6Q 4L63B 4WJQA 2C9OA 4XIGS 1Q0WB 4IQZA 2HHHL 4ZOHC 3H91A 4DV2Q 2HT1A 2H88B 1H9SB 4PS8A 5EE0A 1JWMD 2P5ZX 4BXXH 1LTAD 2WXHA 1K8OA 2MP2A 3NRZA 3RULA 2I2YA 1ENCA 1NY4A 1OXVA 3OW7A 2R92B 1U9RA 2KTRB 2KCCA 3AE5B 1TKEA 1Y56A 3OWFA 2QGQA 3Q14C 4EZLA 3PLUA 3L0WB 1WX7A 1EM7A 2HTME 2L15A 1V1PB 1SNMA 2UUCQ 2MLBA 2PJHA 4M0WB 5EPLA 1I7HA 4ZDVA 2M9VA 3DUZA 1DD2A 2LGDA 2QA4A 3VR3A 3ULJA 4L5QA 2BVCA 4OO1H 1MPEA 4GIVA 1UE5A 2OEDA 2D10A 4NPNA 4FJZA 1WR6E 4LTUA 5AUKA 5T8IA 4XX5A 2LASA 4HKZE 2RD0A 1JT8A 2GBRA 1VJKA 5ISRA 1DGJA 4BY1G 3ML8A 3KDFB 3H3VI 3L08A 4BKSA 3HOWG 3T51B 4WURA 1EY6A 3T9LA 4ZHOA 1BBWA 5BN4A 1RFKA 1JJCB 1DCZA 2PYKA 4FXCA 1YHAA 3PVLA 3DM3A 4KSKC 4FHKA 5JEAH 3CMEA 2KJ6A 4QF4A 1J7CA 4Q5VA 4FP5D 3PQIA 3A54A 1V97A 3PHWB 1ILPA 1FO4A 1Q1BA 4O2DA 2UUBQ 2YLMA 3N6RA 1UELA 4UAIA 2IX3A 2BA0A 3NVVA 2GI9A 2NZ1D 4BBRG 1E7ZA 1WI0A 1IBLQ 4BBNF 1WJ6A 4JW0A 2W3SA 5TSSA 4X64Q 1ROEA 3UQBA 1MJCA 5M3FB 2Q2TA 2WX1A 1STAA 2BB6A 2B2YA 4DK5A 1TQOA 2PQAA 3H0GH 4G3XB 4GLXA 2WXOA 3RZWC 4LNKA 1TBEA 2MHVA 4JI4L 3WOFA 1P16A 1TJEA 4JPSA 1JOOA 3J81c 1N34Q 4IUVA 1VQFA 4HCEA 3PLVA 4IOIE 4LDTD 2CW0D 4CKBA 2ZJRA 3S1MH 1IPGA 4WWPA 4BAXA 1BCPB 4LFAL 3PMFA 3PF5A 1TWAH 1WTQA 1QKZA 3I90A 3HKZG 4A3FH 4HJ8A 2BH2A 1IUEA 3S2DH 3APCA 2JA6H 4W9KA 4I6NB 3I3TB 4LJOB 2E6XA 1IBMQ 4RHRA 3CQZB 2A8VA 4APVA 3VYUA 2VQFQ 4MSQB 4US9A 4X65L 3U4ZA 3AXCA 5D7GA 3STBC 1F0ZA 5M3MH 1IGDA 3ULPA 1DONA 2E2JH 2FCMA 2CHBD 3VRAB 2PNHA 2X8XX 2KQ4X 1AZQA 2RDHA 4DR1Q 1YITA 3DBSA 3K9PB 2CW0C 4AYBE 1EOVA 4N8FA 4POFA 1GJXA 2GBMA 1X32A 4DV1L 4RGMA 4WJNA 4KK7A 3RUZA 2KVZA 1H4RA 3S1QH 5M5YH 2SNMA 2Z4HA 4DR2Q 3WAOA 5G3LD 3P20A 5KRUA 4KJNA 3DM1A 1BT0A 1SYGA 4MDKE 4QQBX 2E2DC 1F9PA 2XTIA 5HGTA 3TEHB 3A56A 3ETRA 2K50A 3HOUB 2JEAI 2FBWB 4PZ8A 3N3KB 1TS4A 5D65A 4DU9A 1B9RA 3LNNA 3CCEA 4DKAC 3FC4A 3SK8A 2F0GA 1FNUA 1DYQA 3JAME 2YU9B 3HOYG 3CIRB 2QDBA 2V1CC 3A33B 4X57B 1KL9A 4OVUA 3R93A 4LF4L 2J7ZA 2I46A 1KQSA 2Z0SA 1XTCD 1EIYB 3N1XC 1SYFA 4IALA 3BIID 4BKSD 4A3IG 4JBMA 3CU7A 2N0SB 5CORA 3UF8A 2HDLA 4G7HC 1YIJA 4IW0A 2L0CA 3PCOB 3V61A 2KUMA 4YCUA 3HOXG 1RTOA 1NBFC 2UYZB 1P9DU 4EQ5A 1BUIC 2JYEA 5JPNC 2L12A 3NZ3A 1BBUA 2K22A 3AEFB 2NZHA 4KDIC 1CQFA 5C0XH 3GB1A 5DPRA 2GRIA 1E0BA 1Q8IA 3KJOA 3NVZA 1JB7A 3T8MA 3TMEA 1PTOB 4CHTB 1XT9B 4V190 1YQ3B 3OYYA 3H15A 1TZOA 3PS6A 4A6QA 2KOXA 4HJAA 3ZNHB 1HQRD 1HXYD 3H6MA 4R4QA 4C3IG 1FPYA 1STNA 1WX9A 2WYQA 5DM73 4KN4C 4RMAA 2ZZPB 2XRSD 3KBGA 3MJWA 3OJ3A 3I8ZA 3MXUA 4FO2A 1XTDA 4CDCC 2PVOD 5KHQA 5I9OA 4LUOA 4K5VA 2ALYB 3DBRB 4RGOS 5CV8A 3LDZE 2DYOA 5J17A 3NVWA 2QIEB 2EYFA 3TZUA 2V3NA 4PYZA 3KW5B 1UE6A 5FLMG 4ITKA 2J52A 1TIID 3WAPA 1F2MA 1FXAA 1R4NB 1ZXIA 2Z6KA 1SNQA 3VA7A 1TS2A 4S17A 2A6HD 3A5UA 2WX0A 2E3TA 5IN7A 1WVLA 2F0KA 1AYFA 3AU4A 4IUMB 3TDQA 2INPE 1J7AA 2K1BA 5BR8Q 2ZXOA 4P7IA 2VNUD 4DR4L 3DEPA 3HG9A 4ZRZA 2GVAA 1N61A 2KMAA 1U4LA 3C3LA 3AFQA 1HNXL 4KZ0A 3VR8B 3ZJTA 4DAYA 3TCAA 3BVZA 3RI7C 4C3HG 4L5TA 1AARA 1JOKA 1I3QH 4JBWA 3DVGX 3ZDTA 1TWFH 1I6HH 3LWUA 2KMCA 4A3IH 3J7AF 4BBNC 1PGBA 1OXSC 5EKKA 3S15H 2MA9B 4XQJA 3EA6A 1SE3A 2WXQA 2K5VA 1WY8A 4F7XA 1A3UA 1S4ZA 2L1AA 2A6HC 4JI5L 1Q82C 3S2HB 2KHWB 1WTHA 2SOBA 2KX0A 3OG5A 2RKSA 4KZCA 2WXJA 1HJPA 1MIUA 2LFNA 1TWCH 2BE5D 4CKEA 1FXTB 2JA9A 3DHIC 3H1UA 3IAM1 5D2MB 2EMTA 3RN9C 5A35A 2JA8G 2UXCL 1GB4A 2KX3A 5COYA 4EGVA 2M56B 3WWVA 3C0RB 2GMIC 2K6AA 4LFCL 2NVQH 2M8SA 5L37A 4PZ7A 1EEFD 2G3QB 1KNAA 4IJHA 5C3EB 1LTLA 2ATWA 2ZCCA 4MGYE 2MX2A 1SMYC 1F77A 4KGRA 2WV6D 1K53A 4JE3B 1EY9A 2NS5A 3H7PB 1CZPA 4DV6L 1S5ED 1XXGA 4GKKQ 1ZKOA 4EKUA 3PIOA 2M1MA 4DV0L 4NW2A 3CHBD 4ZUJA 4MH8A 4DAPA 1G2TA 3QK0A 3PO3G 2CU1A 2RDGA 4KGTA 3FP9A 3M3YH 1HPCA 3I4NG 1JQYD 2EYOA 4MH0E 4HJ5A 4IFDH 1WM3A 3HOZH 5JJLA 5IT9E 4IM2A 2BE5C 5IYDG 3ZLZA 1OXTA 3JAMc 1A2TA 1BDOA 2UXDQ 2G4DB 3GD7A 5C1ZA 1TKWB 3S1NH 3EC8A 1BKBA 5HKHA 4LFBQ 5H8YE 2CKZB 1NR2A 1RDPD 1WYGA 2PE6B 2VW9A 2F4VQ 2KNBA 3IFWB 2EJFC 1NYRA 2E5LQ 2IT1A 1ESFA 4DV3Q 2JQRB 1CA6A 1G6PA 3O65B 2B63G 4C7ZA 4GLAC 5E7NA 2I5MX 4B3SQ 3U4EG 1JWAD 3ZDMC 1EUJA 3G48A 1QLBB 2CWAA 3PRMB 4ASWC 1DOYA 2NVUI 3P42A 1Z2MA 2HUGA 2OHFA 3E9SA 5AFWA 2EKEC 1ZXHA 2PZTA 4LNQA 1EQTA 1O7IA 3IXSA 4Y7NB 4C1NI 2D3CA 4C2MB 5IKCM 1PRTD 5GXGB 3NJTA 2EY1A 3HIZA 4W9GA 2GBNA 3I57A 3AU7A 4A3BG 1SSNA 1MGSA 1Y1VB 3Q6BA 1LLRD 2K5NA 1VQLA 5HG2A 5KYIA 1WXSA 4DR7Q 1NE3A 2I07B 1C4CA 5CMDA 1L6UA 1NYQA 2N8NA 5C5LA 4DK6C 1A3VA 5IGCA 5CR3A 1A3TA 1WSPA 2AMCB 4WAAA 4PQXA 2G45B 2KQSA 2W55A 4BKTA 4EZKA 2PZWA 3D3RA 4RM9A 1I4QA 2JSVX 3J80E 5M5WB 2RHQB 2R92G 2Z0EB 1YI2A 2WLBA 1ENFA 4CDEC 1U5KA 4FHJA 2MGSA 2EELA 4YSZB 2Z6KC 3H94A 1CZGA 2UU9L 1OQRA 2B2VA 2INCC 1PRTC 4QCLA 1LACA 1SDFA 1E9MA 5IYDH 4B0MA 1P3QU 1X1MA 3PO2B 3PGEA 3RD4A 1XWEA 2FIFA 5CHWA 2UUAL 1U4AA 2C9WB 5IGGA 2BWES 2XK5B 4ICUA 1GPXA 1B4OA 4FYDA 1HZ9A 3DQVA 3HS0C 3K59A 2R7ZH 1WTVA 4MELA 5FLXL 3Q23A 1C9OA 1QOBA 3DBLI 4YTNB 3CMMB 4KKSA 5IGFA 4DUYQ 2DZIA 3P4SB 3FRPB 2AHOB 4DGZA 1OEYA 2BYVE 4CGYB 2EXDA 2RDBC 2G9DA 1A15A 5IYBH 2HHHQ 4BBRB 4O0AA 3MC8A 1D5MC 5LMNL 1A70A 2Y3AA 5HI1A 3ERQA 1UWVA 4HWIB 4DV7Q 3TUOA 2WAQB 2VUMB 3VH3B 3ZNGC 3S14B 3HEJA 4DV5Q 2ES2A 5IODA 3J7YW 4C56C 4DK1A 3VR9B 5JPMC 4OIKA 4JBJA 3D4DA 5FKAC 3K5MA 2OF1A 4GNXC 4DQOC 2NMQA 1KF6B 1E8XA 4CDFC 1WGKA 2EMSA 1CZWA 3SR1A 1BMLC 1WRDB 5M3FG 5CHVC 2BWFA 3I3CA 1B3AA 2JA5G 1J19A 1EUVB 1Z7TA 4KY6A 4H0LC 2KC1A 4NJ7A 2INNE 4ANXA 4WJ3M 4H44C 2ZJQA 3T53B 1IYUA 2DUDA 1OQYA 4HIDA 3DOWA 1WD0A 5IT9c 1P0RA 4K7UA 3BZCA 3PSEB 1KRTA 3CC7A 3RNCC 2YTVA 2PIAA 4PS3A 5JZEB 3RN2A 2KDIA 5KNBA 2JN4A 1QCBD 2YEPF 3WIMA 4JWSC 5BN3A 1I4RA 2JWZA 1PH1A 2CWPA 4HSPA 2UU7A 1FCLA 1WMHB 3TJPA 4QMGA 4DR3L 1F52A 2N7JA 3TMPB 3HOVH 1VR9A 1JWSD 1Q8KA 3GDEA 2M00A 4G7OC 1RODA 3PV1A 1PFBA 1H9JA 5E6OA 2WHIA 1EY8A 4A3DB 1Y1WB 4KVGB 5J1ZA 1KLUD 5JVG3 2K33A 3PO0A 2IW3A 1WTPA 3DMUA 5K5PA 1KDCA 2JZZA 2V4DA 1ZUD2 3ONAB 3DVNU 4A3MG 2BDOA 4LF5L 5JJKA 2QJLA 1G6JA 1TS5A 2CH4W 2NPTA 1I50H 1JC7A 3OOCA 1GNUA 4JI7L 2D3BA 1DJRD 2ZEQA 3RD2A 5A2QL 1AE2A 4B6WA 2D3AA 3BYYB 2JYTA 2Q2UA 3IFTA 4V0BA 3W5VB 2A74C 2F3VA 3H3VH 4TKNA 1PH4A 3C1FA 4FLHA 5C44H 3PPAA 2AL3A 3K0YA 1W3SA 2K5PA 4LFAQ 2K5DA 4RFBA 4N6EB 2KHJA 2PPHA 4HCNB 3HOUG 3NWSA 3G71A 1FMAD 1NMGA 2X6GA 3HRZC 5M3FH 2LJ5A 1LYLA 2QDFA 3Q3MC 2XVSA 3ULLA 2F0UA 3MA2B 4N9F4 3KUDB 2N9EB 3E9IA 3A9JA 2QSDA 1V49A 3ZVVA 3GE3C 1SF0A 4GDKA 4NQLB 4YXDB 4QUCA 2KDEB 1BO0A 4DDGD 4KGSA 1E2VA 4UP9A 5KIXA 4DUZQ 1KD1C 1VQ6A 1RM6C 5JH5C 5LXIB 1I5FA 1LQBA 4FXDA 4GDLA 1AEXA 1F9JA 1C76A 3GTKH 1K50A 3EVQA 3FPPA 4YHHL 3RNUA 1PV4A 2B2VC 1K8GA 2N9LA 1Y69U 3UGBB 2KJRA 3DWMA 4W9LA 4WORA 1GUOA 4EFOA 3T13A 2OXPA 2IO3B 3BU2A 2DY7A 4YWLA 1B8AA 4DN4M 1N33L 1STEA 4C1NK 4TRDA 4NXML 4DV1Q 3KYHC 1QOHA 4JI1L 2D2CC 4C4VB 1RLFA 4GKJL 1QWYA 2JX5A 1L7YA 1B9NA 4MGZE 1JICA 1SNOA 2AQ3B 2D62A 5IWAL 3V62A 3VYSA 1I4PA 1VD2A 1K3RA 1GG3A 3B08A 1HTPA 2M0AA 2JZ3B 3L2PA 4M1UB 1YX6B 4LNNA 2KDFB 2G4SA 1RAXA 1WR1A 2EDGA 3KF8B 3U7DA 1M4VA 1VQ4A 2IX0A 4QB4A 1YVCA 4C3JH 3I4MH 1I4GA 1GUTA 2VRRB 2FHTA 2VL6A 3QHTA 3C2PA 2FCNA 5C23A 4BVUC 3ZIMA 4LF4Q 1E5WA 1R4QB 3UIPB 2WXPA 3PRZA 5FO7B 3CWIA 1LTID 2O5IC 4C7YA 1S5FD 1EZ8A 4RCNA 4B9KA 4YCWA 1D1IA 4JCVE 3CCJA 4BY7B 1UWXA 4DK3C 3X3MA 2DWQA 4I7AA 4AS1A 3T1YQ 4JG2A 2NYZD 2AWOA 3GTJH 1UAPA 4H02A 2F0EA 1YJWA 2MQJA 1VQ8A 2WXNA 3JSVB 1QE6A 2RA4A 1S5CD 3SE0A 1S3SG 3KYCD 4YWMA 4G50A 1YJNA 1U4MA 2NVTB 1CKMA 4FJVB 3OWEB 4K14A 3HUIA 2YV5A 3S9WA 2FUHB 2BS3B 2C60A 4JI8Q 3NK9A 2BPSA 2B3GA 3UDGA 1D6EC 4A3JH 1RD9D 1DZ1A 3KOJA 3PZ7A 4IWQA 4A3KB 2KD0A 2ZXRA 1RKNA 2JEBI 5FO8B 5J18A 3TREA 1R9TH 3J7A5 2K6QA 3AQQA 3ER0A 4AOFA 2KHIA 5ELFA 3H6NA 4KHVA 2AWTA 2KFKB 3RNFC 5BYRA 2JA7B 4LF8Q 1PA6A 3CCRA 2K39A 1X6OA 2JU6X 3QJYA 5I6WA 2LS01 3FKIB 4AQ7A 2K8BA 1Q46A 3TS0A 3KUPA 1Z6HA 4DR4Q 5C3EG 5D3DA 4U68A 3T4AC 4K6LA 2CCZA 5CGKA 1B70B 3OPOA 1HNXQ 3R66C 1Z5SB 1SE9A 4B3TL 1IL8A 1KXLA 2L0TA 4RCOA 4LCDE 4LNOA 5IP9G 3CCUA 2YVCA 3ZKJC 2XN9C 3M63B 3KWVA 1FD7D 1E1TA 4RAUC 3IKJA 4IOAA 1MBYA 2WDRB 3GTLB 5EGTA 3GTOB 4D2KA 1Y8PB 2LHEA 1B1ZA 2CVRA 1CT1D 3JAML 3CCMA 1G91A 1J5EL 3B0AA 1A8VA 4N9PA 1NI2A 3PHXB 3MXNA 4JI5Q 4BKGA 1FEHA 3IL8A 1PVOA 4B3MQ 2OJRA 5G5GA 2F3IA 4R4IA 2H4OA 2Z6BA 2PMZB 2DHZA 2AL6A 2PKOA 1TZ1A 3AI5A 4JLCA 1UWMA 1HR0W 2AEHA 2EOTA 3RT3B 4BA2I 2UXCQ 1P98A 3A9KB 4II2B 4P6VF 1QZEA 4C80A 3RFZB 1XJVA 4LFCQ 4HCPB 1SROA 1UH6A 4GLVB 4JBKA 1F2RI 5I9PA 1PFMA 3E0JA 4B08A 4AH6A 1EWCA 4WWMA 3TBLD 3VAWA 5A2QE 1SYCA 1TWHB 4DXFA 3S2HH 4DV6Q 2FCQA 4A93B 3KYDD 1GXDC 1XX8A 3HP3A 2C35B 4NJCA 4DV0Q 4ODGA 3TBIB 2LVPA 2B76B 3QCAA 1C4PA 1Q90A 3EROA 3PIP3 4DNRB 1G8ZD 2JP1A 4YTMB 3NP8A 1GM5A 4M00A 1WTRA 2KKCA 1Y1VG 5DEHA 1SIJA 2WQYB 1U4RA 4M01A 1RHPA 1FXIA 3Q8EA 3VH4B 2ZNVC 1QILA 1JALA 2MBEA 1N32Q 2NTSA 4TSSA 1ZYRD 1PFNA 3HKZE 1I94L 1IL2A 2BS4B 3AE1B 2KQ7A 3CMAA 1K51A 2K8HA 5CBAE 5J39A 1MI0A 2W3RA 5C6AA 2LGYA 1FYCA 3RLOA 5IP9H 1NENB 4KD3A 3S16B 1C77A 4S0RA 3CSFA 2I5HA 3V2TA 1LTBD 4BBSB 3GOEA 2LXCA 4FXKC 2IO2B 4JX1C 3CF5A 1O7LA 1DM0B 4OL7A 2VB3X 1AWDA 3M4QA 3EGRA 3I72A 3PO2G 2ZTEA 3ITPA 5FLXc 2ZM6L 1TYGB 4JL9A 4ZLTF 4K2LA 2PE9A 2ZPYA 1M1KC 3GTGH 3L9AX 2EZVA 2N9KA 4XWTA 4LF9L 3CW2C 1CJEA 2YYZA 2KCMA 4HMJA 4LLGM 3KF6B 1WCMB 4FVMA 4QJFA 1PH2A 4KIKB 1J0GA 2KENA 1PH8A 2AX5A 1IBXB 1ZYRC 3M7NA 4LDTB 4HJ7A 1WF9A 2XBBC 3NG0A 3D31A 5DNFA 5BMGA 4YL8A 1NAPA 2REXA 2DX5B 1HH2P 1T6BX 2FAZA 3X23A 1AN8A 2KC2A 2XEWA 4KJOA 1K28A 3NWTA 4N59A 3AMZA 1LTTD 5IYCG 2WAQG 3M4PA 3UDFA 1BF4A 4PYUA 3Q8BA 2VUMG 4RKLA 4Y7NH 1CUKA 1N62A 1HUMA 5M5XH 3TRZA 2JA5B 3P4QB 1V2YA 3M9BA 5HURA 4GSWA 2OEOA 3AEDB 1YNXA 5T1GA 1TWGB 2RR9A 1NCVA 2UU9Q 3Q3NC 3RZFA 2Z4IA 1GUSA 4O1NA 2MP2B 5KHOA 3M4YA 5E4XA 3VHTC 4Q2JA 3DEOA 2JXTA 2WXMA 4W9IA 1W2BA 1B2TA 4ACFA 3EFUA 1UGMA 3T16A 2F0JA 1R4MB 2UUAQ 4M8NA 5IOCA 3P75A 2B8FA 1P7FA 5IT9L 2VQEL 2HJ1A 2KJHB 3ZJYC 1XPRA 2JPHA 2WDVB 5IAAC 1CHPD 4JV5Q 2EPBA 2QF7A 1CM9A 4KTAA 3NOBA 2A69D 1QUQA 1HUNA 5CBEE 5DPWA 4II3B 4WWNA 3J81i 1D1KA 4WRDA 1HR0Q 2F0WA 4ME5A 4YCVA 3HRDD 2K4KA 2WGSA 1Q3LA 4NXNL 4DNTB 1PHJA 5GAHC 3F8TA 2MEKA 3MJ5A 3GQBA 3F2DA 1BOSA 4BY1H 4A3MB 2WU5B 1VDVA 3HOWH 3K5OA 4QUFA 3U9SA 2QEJC 4X3UA 4A3DG 1Y1WG 2IY0B 1PYWD 1TU2B 3N52A 2BOSA 2F3WA 2L11A 1WRIA 1LT6D 3Q8CA 1IYJB 1MJDA 1OGWA 2FXQA 3K8AA 2K04A 2XGTA 3G7LA 5LL6X 1LXDA 1K8MA 4WJOA 4YT0B 2PW5A 1UE1A 4TVAB 3ML9A 1L2FA 4A3LG 2N88A 3AULA 1HNZL 4W9EA 3D6CA 2A69C 1A2UA 3NTHA 4YWKA 4BBRH 2R61A 4KKIA 5CC4A 1FFVA 2PCFB 1FIQA 3MTNB 1RCVD 4B95A 1VQBA 2HJ8A 4KI0A 1FGUA 4NKLA 5GAGC 4KSLC 1F2YA 3WOEA 3ZXRA 4CO7A 4QL5A 1S72A 1D8LA 3CSTA 3QWZB 1LM0A 3IT6B 1T5XD 3HGBA 1QF6A 5CHFA 3SR6A 2RDFA 3BDCA 4K5WA 1V1OA 4XXEA 2BS2B 3ECIA 4GU2A 2PQAB 2V4IB 3H3VC 1EYGA 3E56A 5C4HA 3CF6E 2L05A 1LFDA 3J80L 1E2ZA 3VUXA 4F87A 3EUB2 1PFDA 1C9FA 4IPDA 3QWNA 4HR7B 4JI0L 1EF1A 3JYUA 1D3ZA 1K83B 4EOYA 1ICWA 1UF0A 2W54A 3EFCA 1WTXA 2VS1A 3CC4A 1EQVA 4G0NB 1IKMA 4NAWA 4K3CA 5AZHA 4P71A 3PGZA 3TN2A 2WXIA 3DBRI 4GLSC 1W6JA 3S17H 3BK2A 4OONA 4LF5Q 4DR5Q 2F0VA 4G7ZC 3EFXD 5CV7A 3UDXA 1C8CA 2LSSA 3EBEA 2LRUA 1ISNA 2F0IA 2LXAA 3H8HA 1TT2A 4JI7Q 4HDQA 4ZRKA 1WGHA 1R4NI 3M3JA 2NBUA 4A3CG 4QGUA 2PNRC 1WGYA 1PYSB 3GTMH 3MFYA 4JC0A 1K52A 4NZLB 2E2HH 1YHBA 2MFIA 3EIVA 3SDZA 1ILQA 1L4DB 1GUGA 2O2LD 1IGCA 4BS9A 2MBOA 3MWYW 5AJ3L 4DHJD 3BYTB 3FKYA 2K05A 3W1YA 1WX8A 1I4HA 3NZSA 2W9NA 1SE4A 1STYA 2SNSA 4P75A 4UDUC 5KNCA 5H92C 4ANUA 1Q81C 1O7ZA 1S40A 2L4NA 4I6PA 1B9MA 1PUTA 4PMWA 1E0ZA 2B2TA 4MZ9A 3VR4A 1VLBA 4GB9A 1GUAB 1QQRA 2KBNA 2LKVA 3QA8A 2RCFA 4K0KL 2E74C 1G51A 2FUG1 3MHZA 1CI3M 2F0FA 1SE8A 2B2YC 3BZKA 1FCCC 1STGA 3EQLC 1JMCA 3HOYH 3Q8AA 1VQNA 4YIJA 3FHWA 4YHHQ
chains in the Genus database with same CATH topology
2R6GA 2F0LA 1II3A 4IDIA 1E10A 4G4KA 3SEBA 1LT3D 5EPKA 1ET9A 1GB1A 3A7AB 3E5SA 5C4JB 3AE6B 4K5XA 4PV1C 5JAVA 3L7ZC 3GTPB 1KTKA 1W6KA 5K36G 1EY5A 5NUCA 2F0TA 4OZAA 1FM0D 4A3GB 2NVXB 3MC0B 2RSNA 2V3PA 3OIQA 2L32A 4H13C 1UUPA 4Q0FA 1WXQA 4US8A 3GV6A 1KAAA 1UEAB 2JZPA 3BG3A 1HCZA 5IIFA 4XTCS 1PRTB 2WXLA 5LHY1 2BDNA 4IN3A 3BWUD 3NUCA 2JSOA 2SAKA 3AEBB 3TSSA 2NBFA 2PMVA 2PPBC 1EOTA 1O78A 4S3SA 1G291 4P2CB 1WTWA 4KX6B 3I9V1 1ZEQX 4PMBA 5LL6S 4HAEA 1OFFA 1PGXA 1SYEA 1BUVT 2EYLA 2F4IA 1XF5L 2D5GA 4MN3A 4BA1I 2K5QA 1I4XA 3C8YA 2DNEA 1STBA 1RYJA 2OT2A 2Q8TA 1JMLA 3FAHA 4KY7A 2RPVA 4IUQA 2MJDA 2KDMA 2KAJA 1DXMA 3KLSX 2N55A 3ND8A 2K32A 1KDAA 2NN6G 2CQAA 3HZXA 4ZRQA 4WQMA 5BMHA 2H1EA 3AEEB 2WXKA 3H0GB 1IW7D 2HDEA 3GP7A 1X3PA 4OIJA 1HZ6A 2XIWA 1RJTA 3ZGZA 1PXUA 2B2TC 3DXJC 2EJGC 2VXWA 2TMPA 4FF4A 4H2AA 1TWAB 1HHVA 1FNWA 4RGTA 2IGHA 2AWNA 5IGBA 2BCOA 3S2DB 2JA6B 3SK5A 1MI2A 3TEXA 1JE4A 1EWYC 2KCNA 3FILA 1GUNA 2HCIA 3MEHA 1CTMA 3C46A 3P63A 5LNK1 5FOBB 5M3MB 1PLFA 4FNFA 5C2TB 4RA8A 2DNCA 4FF3A 2E2JB 1KNEA 4N9TA 2AUKA 3BDLA 3P4PB 1J7BA 4X3TA 1HA5A 2LMCA 4MIUA 5I2XA 2RSOA 1OQQA 3K6OA 3S1QB 5M5YB 1CQVA 3I73A 3K7AB 4HROA 2NN6H 3M4OB 3T3OA 2QKIC 4JK1C 3NPPA 2X38A 3U52E 2ZXPA 4FF2A 5I6YA 2KWDA 2BYTA 5EKLA 1HQMC 2FINB 2WP8J 3IAYA 3VR2A 2XRQD 1GOZA 3NS1A 1CHQD 4CJ2C 3S1RB 1XCQL 2F0OA 3V3XA 2HCCA 5C4ZA 2CJOA 1QNUA 4L6TB 3W9CB 2WACA 3FMCA 1Z47A 3I4LA 3AN1A 1SSOA 2GA4B 1A6XA 4XYOA 4OW0A 3QIAA 1L0YB 1VRAB 2XWJB 1Q12A 4USAA 4ZKBB 2O4XA 1LT4D 3OSOA 4EQOA 1YQ4B 2WU2B 1SNDA 2EY2A 5KYLA 2WXFA 2J53A 2HQEA 1ZPSA 3OIPA 3W3AA 1LABA 3V05A 1F9RA 1NR4A 1OXUA 2E76C 2WS3B 5C4XB 4OGQC 3FEWX 1YN3A 2K28A 1I3QB 1TWFB 1I6HB 4NP5A 2G1EA 2NVYB 3S15B 4RWSC 3PUYA 1EWHA 4ZKCB 4XT3B 3N9YC 3W2DA 3D8GA 2WKDA 1TWCB 3ZQ4A 1LTGD 4EVOA 4IKGA 1SJED 4J6HA 1SBBB 3AEGB 5E4WC 2B2WA 2NVQB 1C78A 1KLGD 5CV6A 5IGEA 4DA2A 2ICEC 3QO2A 4A90A 4HJGE 3BZDB 1EEID 5JEAJ 4A3EB 4AYBB 5F2DA 5KNDA 1ZE3D 2IGGA 1IKLA 3AMUA 3M3YB 2AQ1B 2Y5PA 1C48A 4CJ0B 3HOZB 1R7SA 4PT5A 1KFYB 1DOLA 2WP9B 4QIWB 1FRDA 1L6VA 1PGAA 2NWGA 5ELEA 5EJWA 3PUXA 3S1NB 3LX0A 4GDKB 4ZRPA 1LT5D 1PMRA 3GV3A 2M2LA 4GDLB 1F9QA 3TP6A 4XT1B 5BYSA 4LK0M 2D5DA 1NSNS 1XLOA 1BXTA 1BBXC 2EJMA 2E2IB 2BBCA 1PTOH 1YNND 3TEWA 1JCKB 3TEZA 3D4RA 4I7ZC 3G6JB 2K7VA 3PUWA 4CJ1B 1ET6A 2RVLA 1XO3A 1C4AA 1JWUD 2Q5WD 1QOAA 1H9SA 2J42A 1ZXTA 2A73B 1N63A 3NVYA 2ZW1A 1SB3C 3LB8C 1PZJD 2QMTA 3SVMA 1F2LA 3F2UA 2PLPA 4PNYA 4I65A 2PZUA 1V1PA 4M0WA 3NUHB 1IYVA 3J81E 2WINB 2EYPA 3P1MA 2EVBA 4NMZA 3A55A 3AB9A 4OVZA 4XYQA 2VZKD 2MPMA 1HFNA 4OO1G 2WXGA 2NN6I 2R7ZB 2RQXA 1VZ8A 1EU3A 2F0NA 3DWGC 1ESRA 2JXMB 4A8XC 1YMHE 3NQIA 5CV5A 2LY7A 1WD1A 1KABA 3L3OC 2B39A 3Q8FA 4B9WA 5JEAG 2FFKB 3Q69A 2K5WA 5C0XJ 2XNAC 1MHXA 5EPJA 1EYDA 4E6IA 2F03A 4ZUIA 3MTSA 5JJZA 5CYUA 2E75C 1F2ZA 1LTSD 3RLFA 5MPOA 2FMCA 3A8KE 4RF0A 3BDOA 1BCPF 2B2WC 1EY7A 3SXHA 3NSWA 2IJ0A 4K8IA 1LTRD 5G3LF 2PVGC 4L23A 4K2KA 1YNTE 4HMIA 4KV6A 1JORA 4KD4A 2WNMA 2KHSA 3A8JE 1SXTA 3OHXC 2TSSA 4K8JA 4X3KA 3HOVB 4ABNA 1JRPA 3AEAB 3L4PA 4A9AA 1ZP0B 2LJIA 3P4RB 1E2WA 2F1MA 4GZYC 1I50B 4IUUA 2LGIA 1FGBD 4CBVA 1G2SA 1BR9A 2IGDA 2R93B 1EU4A 2JYOA 3BVGA 1JOQA 5C44B 4REZA 2EXZA 5DM63 2WDQB 3AH7A 1S5BD 2WB1B 2F0MA 3E6ZX 4TMAB 4L1BA 1F2RC 2Y0SB 4ZYSA 1PTOF 3KLSA 1X3QA 4O42A 5EE3A 4RF1A 4ZHPA 4B9XA 4LAAA 3GTKB 3SHLA 4IFDJ 1TY0A 3CRKC 3Q24A 4YTMB 2QCPX 3TP8A 3O13A 5C0XG 3RZOB 3LYYA 3D6WA 3BVMA 4L2YA 5KGUA 3PUZA 5I4DA 4ILWA 4LK1C 1KDBA 4HEA1 1UGJA 3VR5A 1G6ZA 1RF2D 1DOXA 2BA1A 3I4MB 4C3JB 4RHSA 3AE8B 5EKIA 2KOLA 1ML0D 1BCPD 2K03A 4HEDA 1NUCA 1F9SA 1GAQB 4NDXA 1Q10A 1DOKA 1LO5D 4XDXA 1PZKD 1EFID 2WKCA 1WTOA 4ARIA 5M9OA 1Y8NB 1N60A 5G5HA 1FR3A 3GTJB 4KKUA 3P1HA 2B2UA 1B44D 4WIPA 3SK6A 2FE8A 2LUMA 1EYCA 3MHBA 2ACZB 5EBDA 1BCPC 3LXFA 1HTLD 5EE9A 3K5NA 4A3JB 2KEEA 1JW9D 1R9TB 5ELCA 4YTPB 3SFDB 4YWGG 2KA7A 1VF5C 4WFN3 2Z8LA 4TKOB 2RBMA 1XLPA 3U2SC 5I2YA 2EY6A 3B9JA 4R9WA 4YSXB 1PRTF 3IAS1 1NI3A 2PO4A 1B53A 1C4QA 1AZPA 3DWPA 1QOGA 4YSYB 1VZ7A 2HDMA 3C1EA 5HFYA 1KRHA 2MJ8A 1YNJD 3ZJVA 3AE4B 2SEBD 4TQUS 2K3UA 4KKJA 4KMUC 4IFDG 3DHQA 4R8IA 1TS3A 2PW9A 3W5UB 1PTOD 2AQ2B 1SYBA 1EY0A 1EZ6A 1V43A 2EYJA 4NAWB 5BN5A 1MD2D 4J8QA 1H9RA 3KWLA 1TY2A 1SMYD 2BT6A 3QOJA 1YNJC 4IUNA 3AE9B 2XWBB 1QB5D 1HEZE 3OMGA 1V8CA 1PTOC 4J1MA 1CFMA 3K5LA 3MXPA 3URYA 2L9HA 1RWSA 1EYAA 1QT9A 3VRBB 4OO1I 3AE7B 1SNPA 1EIGA 1R4PB 5D14A 2A68D 1O80A 3MFGA 1QJOA 2D9UA 2J0TD 2X69A 1JQ4A 1H9KA 1UNSA 5E3FA 1VCIA 1E7PB 3KK7A 3U7ZA 1YN5A 1TR5A 3KQ4A 4OZBA 3TP5A 4HN7A 2MJEA 3GTGB 1DOMA 2L5TA 4CQNA 2PTLA 1XLNA 1SJHD 1STHA 2B2UC 3LWEA 1RTNA 2A68C 3SFEB 3PZ8A 4MACA 2KACA 4TQ0A 5K36H 2DLBA 5HHDG 2C5CA 3M85A 3VR6A 4XQQA 3M7GA 1QG7A 3UI3A 1L5PA 2DBYA 1YJIA 1SNCA 5AUIA 2CU3A 3VR8B 1XLQA 1PDQA 2A6ED 1T5EA 3A7LA 5C3XA 5M5XB 1XYIA 3WCQA 3D4WA 5FR3A 3RMHA 4IURA 3K58A 3W1SA 4ULLA 1HFGA 2NUCA 3S1MB 3Q0AA 1WWTA 2F0SA 1ZDVA 3TEYA 1P7EA 1MSGA 4A3FB 2WXRA 2WIIB 1PZID 3GS2A 3NE5B 4R8NA 3AB5A 2MP1A 3TZDA 5FK9C 2A6EC 4RKBA 3NTKA 3R2TA 4L8JA 4KHZA 3BS1A 3I91A 1IW7C 3IT4B 5BMIA 4A55A 2I38A 1E6EB 2EY5A 4BY1B 1KH0A 2L55A 3HOWB 3ZYYX 2KEDA 3ZJUA 4ZQ3A 2DN8A 3T56B 1YJJA 3P7JA 2R3ZA 5JXVA 1LV9A 2MH7A 2EYHA 4IUTA 4WJWA 3AE3B 1H9MA 2PW7A 1MSHA 4RNAA 2XSCA 2JE6I 2EYMA 1B50A 1OO9B 1FFUA 4KY5A 2K01A 3SK4A 1C79A 2J4XA 2L1BA 1EIHA 5EE1A 1O7YA 3QG1A 4HSVA 2F0DA 1ZDXA 1QNKA 1CA5A 4HTHA 1U4PA 1L4ZB 4H7BA 5FO9B 2DYMA 1HRJA 3GO5A 5C0XI 1L0VB 2PQEA 2L83A 3AV8A 1YN4A 3VQIA 2KQ3A 3B2FA 2JWUA 1FD6A 4HRSA 1BQQT 3HKZB 3J81L 1GHKA 1DOIA 1EL0A 3NTIA 4IUPA 1MHHE 3I70A 4DAVA 1PDXA 3S17B 2VB2X 1VDZA 4DXGA 1HZ5A 3ABVB 2X6LA 4KKTA 3AE2B 4EQNA 5JVH3 2MJ3A 3FILB 1CK1A 4B0EA 1VF7A 2A5HA 2IX1A 5D3IB 3RPFC 4TQ1A 3GTMB 4HCSA 3VA5A 3Q6SA 2E2HB 4XE0A 2ICIA 5IGDA 2Q8IB 5ELBA 1GUWA 2KN4A 5E6JA 3VYRA 3MP9A 4MT5A 3KLRA 3AM9A 2LMCB 3KF8A 3QOLA 4MHEA 4ZAIA 4BWGB 1ZOYB 3CRLC 4C3JG 3MAQA 3KBXA 1FNVA 3NBHA 1JB3A 2F0PA 4Z9CB 5C3JB 1SYDA 4XDCA 3B2GA 3HOYB 3IFDA 1S5DD 1Y8OB 2V0GA 4R3DA 3HVZA 4IZ8A 3HVDA 4A3IB 2IWHA 5EBCA 5ELDA 5EQ0A 3T3NA 3J7AV 1JROA 1TKYA 2LFIA 5BYQA 2F0QA 1GHJA 3NXWA 1J8IA 3HOXB 1I6VC 1VMPA 1AW7A 4G57A 4NAMA 3DWAA 2YEPB 2K9XA 5T1IA 2ON8A 5J22A 3NBIA 3FPUB 4C3IB 1L0XB 1QOFA 2LEKA 1M8AA 3AECB 5DAUA 2RMMA 4N58A 4FXGC 3BK1A 3A8IE 2Z1CA 2LHDA 2IPKD 2NTTA 4IFDI 4ID6A 3RZDB 2ZW0A 2KMMA 1VZ6A 2ZT9C 1NVID 4LMQD 4X3SA 1ACCA 4RGNA 4KN7C 2BTEA 3R3OA 1SFOB 1JWBD 1AP0A 1MVKA 1SAPA 1NEKB 3ND9A 3OMCA 3QB3A 1EY4A 2MUYA 3DWQA 3K57A 2EE1A 4WH4A 2IL8A 3CKIB 3EJIA 3WDNA 2NB0A 4RH6A 1AFPA 1VMCA 3H09A 5CV4A 2IDYA 1D4BA 2H89B 2EKIA 4DFAA 4PMCA 4C3HB 2BB5A 1TVXA 3FDTA 4FF1A 5C3WA 4OHJA 2DY8A 3U9OA 4P16A 2K0PA 4EQPA 1OXXK 1D2BA 2FJ2A 3UI2A 3MZ5A 5FLXE 2W82A 1T3QA 2AUJD 4U673 2ONQA 3MVVA 3VYTA 2JA8B 1N5XA 3TP7A 5C5MA 2VZKB 4XWWA 1IHZA 3FVQA 1SEBD 4F88A 1BNZA 4WAFA 4DF7A 2M19A 4JWUC 2KJXA 1XCTL 1HA6A 3V96A 1D5XC 1YNNC 4CKCA 3PO3B 1TKGA 3I4NB 1SE2A 3MXGA 2BW2A 1FRRA 1XEEA 1JR0D 2F0HA 2Q8RE 1J9OA 1D5ZC 2GB1A 1N5WA 4XDDA 1V8QA 2B8GA 5CV9A 3Q22A 4HKQA 1ENAA 4MM3B 1ONLA 5E1FA 2CJNA 4OZCA 5JOBA 2QILA 4F8MA 2B63B 4M8AA 2L52A 3X3NA 1IBXA 2ID0A 4ZK9B 3PIO3 3J9CA 3PV0A 4J3OD 2Y5CA 3NQTA 3NHHA 2ENBA 2KECA 3R8BA 1Q1EA 3PUVA 4DK0A 2FMMA 4LJZC 5KEEA 2G9HD 4ARCA 2KVMA 2SDFA 4A3BB 4EE2A 4XQNA 3GTQB 4K6DA 2O5JC 3R2IA 4L63B 2C9OA 4XIGS 4IQZA 4ZOHC 3H91A 2H88B 1H9SB 5EE0A 1JWMD 1LTAD 2WXHA 1K8OA 3NRZA 2I2YA 1ENCA 1OXVA 3OW7A 2R92B 1U9RA 2KCCA 3AE5B 1TKEA 1Y56A 3OWFA 1EM7A 2HTME 1V1PB 1SNMA 5EPLA 1I7HA 2M9VA 3DUZA 1DD2A 3VR3A 4OO1H 1MPEA 2OEDA 4LTUA 5AUKA 5T8IA 4HKZE 1VJKA 5ISRA 1DGJA 3T51B 4WURA 1EY6A 5BN4A 1RFKA 2PYKA 1DCZA 4FXCA 5JEAH 4QF4A 1J7CA 4Q5VA 4FP5D 3A54A 1V97A 1ILPA 1FO4A 1Q1BA 3N6RA 4UAIA 2IX3A 2BA0A 3NVVA 2GI9A 2NZ1D 2W3SA 5TSSA 1ROEA 5M3FB 1STAA 2BB6A 2B2YA 1TQOA 2WXOA 2MHVA 3WOFA 4JPSA 1TJEA 1JOOA 4IUVA 4HCEA 4IOIE 2CW0D 4CKBA 1BCPB 3PMFA 1WTQA 1QKZA 3I90A 1IUEA 2E6XA 4RHRA 3CQZB 3VYUA 4US9A 5D7GA 1F0ZA 1IGDA 1DONA 2CHBD 3VRAB 2KQ4X 1AZQA 2RDHA 2CW0C 1GJXA 1X32A 4RGMA 4KK7A 3RUZA 2SNMA 2Z4HA 5G3LD 3P20A 5KRUA 4KJNA 3DM1A 1SYGA 2E2DC 1F9PA 5HGTA 3A56A 3ETRA 3HOUB 2JEAI 2FBWB 1TS4A 5D65A 4DU9A 1B9RA 3LNNA 3FC4A 3SK8A 2F0GA 1FNUA 1DYQA 3JAME 2YU9B 3CIRB 2QDBA 3R93A 2J7ZA 2I46A 1XTCD 1SYFA 4IALA 3BIID 2N0SB 3CU7A 5CORA 2HDLA 4G7HC 2L0CA 2KUMA 1RTOA 1BUIC 2JYEA 5JPNC 2L12A 3NZ3A 2K22A 3AEFB 1CQFA 5C0XH 3GB1A 2GRIA 1E0BA 1Q8IA 3NVZA 3TMEA 1PTOB 4CHTB 1YQ3B 4V190 4A6QA 1TZOA 1HQRD 1HXYD 3H6MA 4C3IG 1STNA 5DM73 4KN4C 2XRSD 3KBGA 3I8ZA 3MXUA 4FO2A 2PVOD 5I9OA 4K5VA 4RGOS 5CV8A 2DYOA 3NVWA 2QIEB 2EYFA 3TZUA 2V3NA 4ITKA 2J52A 1TIID 1F2MA 1FXAA 1ZXIA 1SNQA 3VA7A 1TS2A 2A6HD 2E3TA 1WVLA 2F0KA 1AYFA 3TDQA 2INPE 1J7AA 2K1BA 2ZXOA 2VNUD 3DEPA 3HG9A 4ZRZA 1N61A 1U4LA 3C3LA 3ZJTA 4DAYA 3BVZA 4C3HG 1JOKA 4JBWA 3LWUA 3J7AF 1PGBA 1OXSC 5EKKA 4XQJA 3EA6A 1SE3A 2WXQA 4F7XA 1A3UA 1S4ZA 2L1AA 2A6HC 3S2HB 2SOBA 2RKSA 2WXJA 2LFNA 2BE5D 4CKEA 3IAM1 5A35A 1GB4A 5COYA 4EGVA 2M56B 2K6AA 1EEFD 1KNAA 5C3EB 1SMYC 1F77A 4KGRA 2WV6D 1K53A 4JE3B 1EY9A 1CZPA 1S5ED 1XXGA 1ZKOA 4NW2A 3CHBD 4ZUJA 4MH8A 4DAPA 1G2TA 2RDGA 4KGTA 1HPCA 1JQYD 2EYOA 4IFDH 5IT9E 2BE5C 1OXTA 1A2TA 1BDOA 3GD7A 1TKWB 5H8YE 1NR2A 1RDPD 1WYGA 2EJFC 1NYRA 2IT1A 1ESFA 2JQRB 1CA6A 4C7ZA 3U4EG 1JWAD 1QLBB 1DOYA 3P42A 2HUGA 2OHFA 3E9SA 5AFWA 1ZXHA 2PZTA 1EQTA 3IXSA 4Y7NB 4C1NI 4C2MB 1PRTD 5GXGB 2EY1A 3I57A 3AU7A 1SSNA 1MGSA 1Y1VB 1LLRD 5HG2A 5KYIA 1C4CA 2I07B 1NYQA 5CMDA 1L6UA 5C5LA 1A3VA 5IGCA 5CR3A 1A3TA 1WSPA 4PQXA 2W55A 2PZWA 3D3RA 1I4QA 2JSVX 3J80E 5M5WB 2WLBA 1ENFA 2MGSA 2EELA 4YSZB 3H94A 1CZGA 1OQRA 2B2VA 1PRTC 4QCLA 1LACA 1SDFA 1E9MA 4B0MA 3PO2B 3RD4A 1XWEA 5IGGA 1GPXA 1B4OA 4FYDA 3HS0C 3K59A 1WTVA 5FLXL 3Q23A 1QOBA 4YTNB 4KKSA 5IGFA 3P4SB 3FRPB 4DGZA 4CGYB 2G9DA 1A15A 4BBRB 1D5MC 1A70A 2Y3AA 5HI1A 3ERQA 3TUOA 2WAQB 2VUMB 3S14B 3HEJA 5IODA 3J7YW 4C56C 4DK1A 3VR9B 5JPMC 4OIKA 5FKAC 3D4DA 3K5MA 2OF1A 4DQOC 2NMQA 1KF6B 1WGKA 1CZWA 3SR1A 1BMLC 3I3CA 1B3AA 1Z7TA 4KY6A 4H0LC 2INNE 4H44C 3T53B 1IYUA 1WD0A 2PIAA 5KNBA 1QCBD 2YEPF 4JWSC 5BN3A 1I4RA 4HSPA 1FCLA 4QMGA 2N7JA 1VR9A 1JWSD 2M00A 4G7OC 1RODA 1PFBA 1H9JA 1EY8A 4A3DB 1Y1WB 5J1ZA 1KLUD 5JVG3 2K33A 3PO0A 2IW3A 1WTPA 3DMUA 5K5PA 1KDCA 2V4DA 1ZUD2 3ONAB 2BDOA 2QJLA 1TS5A 1JC7A 3OOCA 1DJRD 5A2QL 3BYYB 2JYTA 3IFTA 4V0BA 3W5VB 2A74C 2F3VA 3C1FA 3K0YA 2K5PA 2K5DA 4RFBA 4N6EB 3NWSA 1FMAD 2X6GA 3HRZC 2XVSA 2F0UA 3MA2B 2QSDA 1SF0A 4YXDB 4QUCA 1BO0A 4KGSA 1E2VA 5KIXA 1RM6C 4FXDA 1AEXA 1C76A 1K50A 3EVQA 3FPPA 2B2VC 2N9LA 1Y69U 3DWMA 4WORA 1GUOA 3T13A 2OXPA 2DY7A 4DN4M 1STEA 4C1NK 4TRDA 1QOHA 2D2CC 1QWYA 2JX5A 1B9NA 1JICA 1SNOA 2AQ3B 2D62A 3VYSA 1I4PA 1HTPA 2M0AA 4M1UB 2EDGA 1M4VA 2IX0A 4QB4A 1I4GA 1GUTA 2FHTA 3C2PA 1R4QB 2WXPA 5FO7B 3CWIA 1LTID 2O5IC 4C7YA 1S5FD 1EZ8A 4RCNA 1D1IA 4BY7B 1UWXA 3X3MA 2DWQA 4AS1A 2NYZD 2AWOA 1UAPA 2F0EA 2WXNA 1QE6A 2RA4A 1S5CD 3SE0A 1U4MA 2NVTB 3OWEB 4K14A 3HUIA 3S9WA 2BS3B 3NK9A 1D6EC 1RD9D 1DZ1A 3PZ7A 4A3KB 2ZXRA 1RKNA 2JEBI 5FO8B 5ELFA 4KHVA 5BYRA 2JA7B 2JU6X 3QJYA 5I6WA 2LS01 3FKIB 4AQ7A 3KUPA 1Z6HA 5D3DA 4U68A 3T4AC 4K6LA 5CGKA 3OPOA 1IL8A 4RCOA 2XN9C 3KWVA 1FD7D 4RAUC 3IKJA 2WDRB 1MBYA 3GTLB 5EGTA 3GTOB 4D2KA 1Y8PB 2LHEA 1B1ZA 2CVRA 1CT1D 3JAML 1G91A 4N9PA 3MXNA 1FEHA 3IL8A 5G5GA 2H4OA 4ZHOA 2PMZB 2PKOA 1UWMA 2EOTA 4BA2I 4P6VF 4C80A 3RFZB 1F2RI 5I9PA 1PFMA 3E0JA 4B08A 1EWCA 4WWMA 5A2QE 1SYCA 1TWHB 4DXFA 4A93B 1GXDC 1XX8A 3HP3A 4NJCA 4ODGA 3TBIB 2B76B 1C4PA 1Q90A 3EROA 3PIP3 4DNRB 1G8ZD 2JP1A 3NP8A 1WTRA 1SIJA 5DEHA 2WQYB 1U4RA 1RHPA 1FXIA 3Q8EA 1QILA 1JALA 2NTSA 4TSSA 1ZYRD 1PFNA 2BS4B 3AE1B 1K51A 5CBAE 5J39A 1MI0A 2W3RA 5C6AA 1FYCA 1NENB 4KD3A 3S16B 1C77A 3V2TA 1LTBD 4BBSB 4FXKC 4JX1C 1O7LA 1DM0B 4OL7A 2VB3X 1AWDA 3EGRA 3I72A 3ITPA 1TYGB 4ZLTF 4K2LA 3L9AX 2EZVA 2N9KA 4XWTA 1CJEA 2YYZA 4HMJA 4LLGM 1WCMB 4FVMA 1IBXB 2AX5A 1ZYRC 3M7NA 3D31A 5DNFA 5BMGA 1NAPA 1T6BX 1AN8A 4KJOA 3NWTA 4N59A 3AMZA 1LTTD 1BF4A 3Q8BA 4RKLA 1N62A 1HUMA 2JA5B 3P4QB 5HURA 2OEOA 3AEDB 5T1GA 1TWGB 1NCVA 2Z4IA 1GUSA 4O1NA 3M4YA 5E4XA 4Q2JA 3DEOA 2JXTA 2WXMA 1B2TA 3T16A 2F0JA 5IOCA 3P75A 2B8FA 1P7FA 5IT9L 2WDVB 1CHPD 2EPBA 2QF7A 1CM9A 4KTAA 2A69D 1HUNA 5CBEE 1D1KA 4WRDA 3HRDD 2F0WA 4ME5A 1Q3LA 4DNTB 2MEKA 3MJ5A 3GQBA 1BOSA 2WU5B 4A3MB 1VDVA 3K5OA 4QUFA 3U9SA 2QEJC 4X3UA 1PYWD 1TU2B 3N52A 2BOSA 2F3WA 2L11A 1WRIA 1LT6D 3Q8CA 5LL6X 2K04A 3G7LA 1K8MA 4YT0B 2PW5A 2N88A 3D6CA 2A69C 1A2UA 3NTHA 4KKIA 2R61A 5CC4A 1FFVA 2PCFB 1FIQA 1RCVD 4KI0A 4NKLA 1F2YA 3WOEA 3IT6B 1T5XD 3HGBA 1QF6A 3SR6A 2RDFA 3BDCA 4K5WA 1V1OA 4XXEA 2BS2B 2V4IB 3H3VC 3E56A