1KTKA

Complex of streptococcal pyrogenic enterotoxin c (spec) with a human t cell receptor beta chain (vbeta2.1)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
203
Chain Sequence
KKDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of two streptococcal superantigens bound to TCR beta chains reveal diversity in the architecture of T cell signaling complexes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
molecule keywords Exotoxin type C
total genus 50
structure length 203
sequence length 206
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ktkA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ktkA01
1HA5A 4O1NA 1PZKD 1PYWD 1TY2A 4RGMA 1JCKB 1ET6A 3GP7A 4L6TB 2IPKD 1BCPB 1AN8A 1BCPD 1ESFA 1S5BD 4L63B 4UDUC 3DWAA 1TS3A 1KLUD 1DYQA 2O2LD 1B44D 1SBBB 5ELEA 4DXGA 1PZID 1F77A 1UUPA 1BCPF 2XN9C 1JWSD 2AQ1B 1RD9D 4RHRA 3CHBD 2TSSA 3R2IA 3TSSA 3MC0B 3BVMA 5I4DA 1FD7D 1PTOH 4RCOA 3BVZA 1LT6D 1SE2A 4RH6A 1CHPD 2XNAC 1I4XA 4RGTA 1ET9A 1RCVD 1LTTD 1V1PB 2R61A 1YN5A 1EU4A 1LTBD 3EA6A 3EFXD 1PRTF 3BVGA 1PRTC 1KLGD 2G9HD 1KTKA 1CK1A 1JQYD 1SE3A 3BYTB 1SJHD 2J4XA 1BXTA 1L0YB 1SE4A 5ELFA 4NZLB 1I4RA 2Z8LA 2CHBD 2AQ3B 1PRTB 2NTTA 1T5XD 1M4VA 5D3DA 1PTOC 1PTOB 4ZYSA 1STEA 1EWCA 1HXYD 5TSSA 2XRQD 5ELCA 4RGOS 4C56C 1LT4D 1S5FD 1FNUA 1MD2D 3V05A 1D6EC 1CT1D 1JR0D 1PTOF 3MFGA 1S5CD 1PZJD 4RGNA 1I4HA 3O13A 1S5ED 2IJ0A 5FK9C 1EEID 1RF2D 1FNWA 1D5XC 1LLRD 1LTGD 1HTLD 1RDPD 1LT5D 4K6LA 1TS4A 1LT3D 1EU3A 3OWEB 1XXGA 1TS2A 2RDGA 2NTSA 5ELDA 1G8ZD 4RHSA 1YN4A 1HQRD 3W2DA 1SXTA 1PTOD 3DWQA 1LTID 1XTCD 1D5MC 3DWPA 2ICIA 1JWUD 2RDHA 1SEBD 1BCPC 1I4QA 5FKAC 1GOZA 3R8BA 1L0XB 1D5ZC 1V1OA 1LTAD 1B1ZA 3BZDB 1PRTD 1CQVA 4OHJA 1CHQD 3KLSX 2AQ2B 5D3IB 1I4PA 1QILA 1ENFA 1AW7A 1FGBD 4Z9CB 1V1PA 4BWGB 2XRSD 3R2TA 4RFBA 1EEFD 1UNSA 3SEBA 1TS5A 2WV6D 1LO5D 4DXFA 1LTRD 2QEJC 3URYA 1EFID 1SJED 5ELBA 1FNVA 1TY0A 1JWMD 2QILA 3BYYB 1S5DD 4TSSA 2SEBD 1YN3A 1I4GA 1LTSD 1DJRD
chains in the Genus database with same CATH superfamily
2EMTA 1A62A 2FMMA 1Q8IA 2KDMA 3P63A 1PZKD 5LL6X 5IYCH 5AEKB 4C2MH 3U2SC 4C80A 1PYWD 2EY5A 4LF7L 4Q2JA 3RULA 1WX9A 1VQIA 2PZWA 1X9NA 4N9F4 4FYDA 2NVYH 1VS0A 4BA1I 1SN8A 2LKVA 1N60A 4GN3B 2MEKA 4X3TA 1XJVA 1QVGA 1XEEA 4HSVA 4NMZA 3AXCA 1K52A 1G2TA 4BBSG 3CCVA 3PO2G 1WJ4A 1EZ6A 3Q3MC 4HRSA 5BR8L 2BWES 4NXNQ 2INCC 3K7AB 2A68D 4HIDA 4A3IG 1D3ZA 2LVQA 3CSFA 3I8ZA 4GU2A 1K53A 4ICUA 1LYLA 3BVGA 1WRIA 1NCVA 1HNZQ 1MVKA 2KDEB 3NTHA 3W5VB 1L1OA 3DBLI 2Y5BB 2GBMA 3HOZH 5HKHA 2O6VA 2P5ZX 3OHXC 2MJDA 1EQRA 3IL8A 3QQ8B 1GAQB 4YTMB 2KO3A 2KX3A 3TRZA 4DDID 3AV8A 4XZ4A 2ZCBA 3EIVA 3IFWB 2DNEA 1ZPSA 3GTOH 5L83A 2IT1A 4DV7Q 2ACZB 4KX6B 1EWCA 5AZFA 2YVCA 3R7RA 4IUVA 3ULLA 1VLBA 2WQYB 4BOSC 4A3EB 1A6XA 1XLQA 2XBBC 5CBAE 4GDKA 1WE7A 3MC9A 1IHZA 4OELB 4A3IB 2PNRC 3EGRA 4OWWB 1QVFA 3I4NG 4CKBA 1W3SA 5M5YH 1JOKA 4QQBX 3PO2B 1BMLC 2F0WA 1D5XC 3DEPA 1TWHB 2JYOA 2LJ5A 2G4SA 2R92G 1AEXA 4C2MB 3W1SC 2XVSA 4MIUA 2KFKB 4MGYE 2MP2A 1YQBA 1WJ6A 1ZDVA 2KVZA 3VR4A 2ZJQA 2N9PC 3PIPA 3VFKA 5KEEA 2J42A 2LMCB 4C3JH 1E2VA 3QR8A 1PDQA 2E5LL 4JC0A 4A3EG 3WWVA 3GTLH 4A3BG 4A3GH 2NR2A 4DN4M 1PH6A 2MH7A 1C4PA 4B3ML 2R7DA 3KUZA 3PPAA 4K14A 4HJGE 2C7HA 2B63G 1AE3A 4NQLB 2HQLA 2SNSA 1LTAD 3C1FA 3GOEA 2F0HA 2HUGA 2M9VA 1XLOA 1U4PA 3E5SA 5K36G 2UUBQ 1I4PA 4FO2A 3RZDB 1Q5WB 2AWOA 1QOHA 1IXRA 4OVUA 1EEFD 3GTLB 1N6ZA 5GROA 2N88A 2DYMA 2H89B 3IT6B 1NYQA 5C3WA 2JU6X 3HOWB 1SJED 3AEGB 2ZTDA 2JZ3B 5LMNW 4LK0M 2M56B 1WSPA 3M9BA 1LTSD 3P75A 4OXPA 2MJ3A 1V5OA 1ZYRD 3TJPA 3DBHB 3TL5A 3A0JA 4KKTA 4B3TL 2V4IB 4K0KQ 1Q8KA 2LXKA 1IYFA 2KQSA 2EXDA 2ZXPA 5IWAL 1V81A 3S2DH 4DKAC 3VTVA 4R9WA 4AP4C 4MDKE 1BCPD 2F0OA 1Q1EA 3PIO3 2B2TA 1GJZA 1TS3A 4YWLA 3AEVA 1C79A 1RLFA 2LVOA 1K28A 4KVGB 1HTQA 3DHHC 1LACA 4LF9L 4YSXB 5IT9L 2JA6B 4A3EH 4C4VB 2QMTA 1A0IA 1BBWA 3AQQA 1VZ6A 4MJSB 1X54A 4NDXA 5JZEB 1N5XA 3HEJA 2PI2A 1JMLA 1PTOH 3HGBA 3K5MA 2FUHB 4MT5A 3ZNZB 1M8AA 1XD3B 2ON8A 1K0SA 1F2ZA 2AWTA 4N6EB 1TKEA 1OXTA 4J8QA 2KMMA 1NR4A 5IT9E 2D11A 5L37A 4MJSA 4N9TA 2VUMG 2I46A 1FEHA 3MXPA 4FADA 1GHJA 3LWUA 1SJHD 1QUQB 1CSQA 2Z6KC 3A7LA 1Q82C 1J8IA 2KDIA 1JOQA 1CM9A 2AQ3B 3AECB 4JI6Q 2NTTA 3PCOB 1TT2A 1WI5A 2PNHA 1YNND 3GTGB 2B39A 3T4AC 1RFAA 1J5EL 3OG5A 5KNBA 3PLVA 1STEA 2QDFA 1JE4A 2VXWA 4HJ9A 3LB8C 2WLBA 1E5WA 4XWWA 2F4VQ 5TSSA 3QO2A 3I4MB 1LABA 3T53B 2LUEA 1HZBA 1FNUA 3HM6X 4YT0B 5CYUA 4KHPQ 1ZXHA 4WFN3 5CV7A 4WIPA 1XQQA 1R9TH 3OYYA 4A3LH 2Z59B 4NPSA 2CKHB 1ASYA 3DHQA 1L2FA 3I4LA 1X3FA 1Z5SB 1H95A 3WANA 2JSVX 3EUB2 3D6CA 1L1OB 2K5QA 1C48A 1N36Q 1SFOB 5E6JA 1SNMA 4WJ3M 3CCEA 1WTPA 4KD3A 1ZKHA 4JVZA 3A9JA 3PUYA 4W9FA 4NJCA 2I0QA 1OQRA 4JBJA 1G8ZD 5JHBA 4A3CG 2ZEQA 4LW1A 4OX9Q 2Z6BA 1F9QA 3MTSA 3MXUA 3W2DA 4IKGA 4KV6A 3ENEA 1VCBA 3M85A 3I4NH 3AMUA 2MBBB 1B9RA 1X65A 4XT1B 3T1YL 1YJ1A 2MHJA 4K3CA 3GE3C 2VQFL 2VUMH 2PW5A 2PTLA 4URKA 4OO1I 3NY5A 1TWFB 2A6EC 3HVDA 2F0DA 3R8BA 3FKIH 1GUTA 1D7QA 1UWXA 2UUAQ 2DAJA 3HFZB 1D5ZC 4IG7B 3Q3OC 4EZKA 2JUOA 1BR9A 1EQTA 2WP9B 4ZAIA 5C23A 3ZJYC 3ULJA 2DZMA 3AYHB 3DVGY 3EBEA 2LRUA 3W1YA 1K8RB 3BIID 1XX8A 1B50A 3I72A 1YIJA 3UDIA 2JA6G 1TKWB 2WXNA 3HOVB 3LWEA 3HOXH 4KGTA 3T8MA 1VQKA 4F1SA 4OONA 3TMEA 2EYMA 3NSWA 3RLOA 3CMEA 2KVMA 3BG3A 3I73A 4KD4A 4O1NA 4IQZA 4B95A 3AEFB 2DNCA 2EYHA 2SOBA 3G6EA 1JWBD 4GIVA 3Q3JA 4GN4B 4JG2A 2D5GA 1SGHA 4EZJA 1VZ8A 1VQHA 3AI5A 4DAYB 5ELEA 2D3CA 2L15A 1PFNA 2WGSA 5IGCA 2WXJA 3RI7C 4ICVA 4K7SA 3DVNV 3RZWC 1IYVA 2JXXA 3ML9A 2F0MA 3MXGA 4RHRA 3SE0A 3R2IA 5EPJA 1F9RA 5I4DA 4LNQA 4C7YA 4XE0A 2PW7A 2WXRA 2BVCA 3CQZH 4X62Q 1STBA 1FL0A 2AKWB 1MI0A 1K9MC 2KWUB 1EY7A 2F1MA 2ZW0A 4MSMB 1F1HA 2J0KA 5K5PA 1L5PA 4IPHA 2C9OA 5M5WB 1XNQL 1KHIA 2CHBD 4PQXA 4C3JG 1PGXA 2XWBB 1ILPA 4BAXA 5ISRA 4DHJB 2G4DB 3NRZA 4IN3A 1VQMA 5EBCA 3Q6SA 4HTHA 2GA4B 1XCQL 2INDC 2ZZPB 4XC2A 4FHKA 1KNAA 3SR1A 4WWPA 2YU9H 3S1QB 2Z0EB 2K6DB 1EIGA 2WXLA 2ASBA 2ONQA 1U0LA 1NAPA 5KNDA 2DLBA 3WAPA 5M3FH 3ZO5B 5IGFA 3X0WA 1TR5A 1WCMB 4J6IA 5C1ZA 1UGJA 3VH3B 3R3OA 5AUKA 1WTWA 1NBFC 3RNBC 4G4KA 4BBRH 1V43A 5CV9A 3H6MA 3CAMA 5KYIA 3F2BA 3NG0A 3E6ZX 5CX3A 2RA4A 5IOCA 3KJPA 4BBSH 1XO3A 4ZUIA 4OO1H 2GI9A 5AZGA 1UBQA 3FVQA 3VTWA 4NJ6A 1TS2A 3J80L 3DBSA 4RA8A 2UXBQ 2MBHA 2CR5A 4RHSA 4JWSC 3BDLA 5HURA 1WD0A 3MWYW 4W9KA 1PH1A 1ZDXA 4R4IA 1FYCA 3E0EA 4JV5Q 3GTKH 2NPTB 3TP8A 4HJ5A 3KF8A 5CC4A 1YX6B 1K8GA 2J7QB 1Y14B 4RCNA 2WDQB 4DFAA 3KQ4A 4DV4L 1T3QA 2CU1A 4DV6L 4JI5Q 4PNYA 4R4OA 3RZDH 2I1JA 1VR9A 2IZVB 2WYQA 1VQFA 3EN2A 1M90C 2XK5B 1EOVA 3D8GA 3JSVA 1HTOA 3HIZA 2K32A 1NUCA 4LF8Q 4KDLB 3STBD 2KECA 1SYDA 4JPSA 4CJ0B 1O7IA 1QILA 4A4IA 2VL6A 1HNWL 2KD0A 2XRSD 5M5WH 1JOOA 2IX3A 4LNFA 1ONLA 1Y8NB 2NB0A 5M3MB 2DY7A 2R7ZB 3A54A 4PS3A 1FNVA 2A73B 2HHHL 2B29A 4Y7NH 2FCNA 1YHBA 1WTRA 2NVXH 2E6XA 4FDBA 1MG4A 2KQ7A 3PQIA 2R6GA 4JLCA 1EY9A 1KDBA 1JCKB 5KGUA 2M4NA 2JPHA 4XQNA 2JEAI 3DOWA 1S5BD 2O6VB 3NHEB 5I9OA 4TRDA 4XX5A 1UE6A 2DGYA 1K73C 3TEYA 5DPSA 1G291 3HM3A 1VZ7A 1TWGH 2GLSA 4V190 2PEAA 1VDVA 1BCPF 5C44H 2OF1A 4S3SA 3S14H 1CTMA 5BN3A 5M9OA 4FXDA 3AE4B 3EECA 1E22A 2L1AA 1ILQA 2BS4B 2JEBI 4BY7B 4C3HB 1XMOL 3N6RA 2BE5D 4GLXA 4WJQA 2DWQA 3A9KB 2F0JA 4JI3Q 4IOAA 3P2BA 1HZAA 1WR1A 1PV4A 2L1BA 1KTKA 2HTME 2JZZA 3OJ3A 3SDLC 3CCQA 4NY0A 2PW9A 4YSYB 4QL5A 4MNOA 1TBEA 4ACFA 1CZWA 4NZLB 4DUYL 3CCUA 4CO7A 3H3VC 3T1HL 3PO3G 4G7HC 1V9JA 1LTLA 2DYBA 1C0AA 2KFKA 2L00B 2Y3AA 3MJWA 3SFDB 1L6UA 4B9KA 3Q14C 4A3DH 1OQYA 3FDTA 2VH2A 4FA6A 2A74C 1HUMA 2UXDQ 4JI8L 3IAM1 3AEBB 1STYA 2BKRB 4A3DB 1MSHA 4FF3A 5FO8B 3RNEC 2JE6I 2BE5C 4B3SQ 1C8CA 5T1IA 3MFGA 4MACA 3FILB 1S5CD 3ZKJC 3O13A 1L0VB 4C3IH 4X65L 2IJ0A 4L1BA 4OZBA 3SHQA 2MBQA 3VR5A 2NZOA 1K51A 1WTXA 3EHVA 1H8CA 3RCZA 2GBRA 1FNWA 2CWPA 4N59A 2D3AA 4H13C 2YTYA 2CJOA 1QUQA 1IBXB 2WXHA 4C3HH 1LT3D 1CSPA 3S24A 1XYIA 1WGHA 2EDGA 2PVOD 4XYCA 5LMUQ 4JI7Q 1WMHA 1SNCA 1SFOH 2LMCA 4DR3L 4B3RQ 1AYFA 2IGDA 3N1XC 3K80C 2F0KA 3ICEA 4NB3A 3L08A 1ZGUB 3KOJA 1EIFA 1UZXB 1P98A 3H91A 1CI3M 3HKZB 4LJZC 1Q10A 2WX1A 3HRZC 1QZGA 5BMGA 3X23A 4E74A 2Z4HA 3QOLA 2BPSA 2ES2A 3Q8FA 1WF9A 3GB1A 1PRTD 1EO6A 3NOBA 2Q8RE 2R3ZA 4QIWE 5FOBB 3RD2A 2RGFA 2WU5B 2DYOA 2AQ2B 3OPOA 2KACA 2LUMA 2JA8G 4Y7NB 4JI0Q 3WAOA 3S2HH 5KHOA 2R7ZH 3W9CB 2EY1A 3DMUA 3G4SA 1L0WA 4IFDG 1WFYA 2VQEQ 2KHJA 4IALA 1QOGA 1TS5A 5E4WC 3QA8A 3SGIA 2KUMA 1FMAD 4TSSA 3E9SA 1N33L 2HJ8A 3NVYA 4LFAQ 3W1BA 2KTFA 3GV3A 3ECIA 3E0JA 2B2YC 2B2WA 1PH9A 3M63B 5EE3A 5C0XI 4MN3A 3HOYG 4HROA 1ENAA 1DZ1A 1Z7TA 2Q8IB 2IW3A 2L0TA 1JJGA 4HDOA 4I6PA 1W2BA 1TWAH 3M3YB 2O6VD 1H9SA 3KDFA 1F52A 3F2UA 3C19A 4K81A 4MZ9A 4B0EA 1ISNA 4QIWB 1X3GA 2RBMA 4GNXC 3GS2A 1C78A 2KJ6A 3PSEB 1RD9D 4R4TA 1B9MA 2K5NA 3CHBD 3AE6B 2FJ2A 1FD6A 2TMPA 1QNKA 1UEBA 3KFUA 1U5KA 2A1AA 3I91A 4RH6A 1GXDC 4JBWA 2IGHA 4EUTA 4XDXA 2I5LX 1J9OA 1AH9A 3NHHA 1EU4A 2ENBA 2L11A 1E2ZA 3A4RA 4JK1C 5NUCA 2A6ED 2RDFA 4XTCS 2PQAB 4X66L 1SMYD 3AE2B 1SE4A 5BMHA 1EZ8A 3QWNA 3W1GA 3SVMA 2EKIA 4P72A 3B08A 4MM3A 3TZDA 4DHZE 4AJWA 3RNGC 1W6KA 4BS9A 1T9HA 2C7MB 1T5XD 2RSOA 5EE0A 1I50H 4ANVA 2NYZD 4LNIA 1VF5C 1WJJA 5J39A 3L13A 4ZYSA 5A2QL 2A69C 2AX5A 4LDTD 2F0FA 2WXGA 1TWCH 4K6DA 2D9UA 1TT5B 3JAME 2JVCA 4LTUA 5AJ3L 1LT4D 4NJ7A 3D4DA 3VUWA 5LMNQ 2D0PA 1TVXA 4RGNA 1G51A 1Q90A 1DGJA 3L3OC 2ZPNA 2JWUA 1UWVA 4GLAC 5E6NA 1IBKL 5I2XA 4KHPL 3QARA 4FBJB 4EQPA 2EJFC 1TS4A 2OJRA 1EU3A 3H6NA 2PQEA 4EOYA 4DNRB 3CCMA 2JRHA 4M00A 3HOXG 3EVQA 4ZRJA 2GBJA 2SNMA 5LMNL 1HE8A 4R3DA 1Z6HA 1UAPA 1V8CA 2G5DA 1VQNA 2D10A 2K5DA 1F2RC 1NTGA 3S15B 4YCVA 3AM9A 2AMCB 4EZLA 1CKNA 2JX5A 4A76A 5IP9H 3ABVB 3VH4B 3VUYA 2A19A 4QUCA 1SAPA 1P9DU 2JT4B 2NBWB 4DPGA 3M62B 4A9AA 2XTIA 4DR1Q 3NS8A 4HCEA 4XYQA 2GB1A 2EYFA 2RR9A 4IUNA 1WFQA 2Q8TA 1RYJA 1S3OA 2FIFA 4IZ8A 5JEAG 2N1VA 4W9LA 2D5DA 5C5LA 2VB3X 5C44G 4G7ZC 3SK4A 1WGGA 3A1QB 4B6WA 2Q5WD 3R93A 2HD3A 4DR3Q 1Y8OB 1ASZA 4GMVA 3TZUA 3RUZA 4DR2Q 1HR0Q 4O0AA 5GQOA 5IGEA 3CD6A 1DD2A 2J0JA 3DDCB 3NVVA 1V8QA 3PLUA 1U4RA 2CVRA 1GUGA 1XLPA 2LASA 3LJ3A 1RTOA 1WGDA 1I42A 4KDIC 2JN4A 1S5DD 1ENCA 2X69A 3NUCA 1K83H 3KUCB 3AH7A 1IBLQ 5CV6A 4DUZQ 2BYTA 4OIKA 1WMHB 3T16A 1TXYA 4NKLA 4AJYB 3K7AH 3H7PB 1S40A 3FRPB 4IJHA 2R93H 1A3VA 5A2QE 4XXEA 4PS7A 1C3TA 1EOTA 3DWAA 4YY3L 2KZRA 5JJLA 2B3AA 1KLUD 5BYSA 1F9PA 1STAA 2BW2A 2EXZA 1X3EA 1MI2A 4F7XA 3HOYB 4LF4Q 3FILA 1HFNA 4PMBA 1VQ6A 3ZDMC 3MHZA 3B9JA 4IFDJ 2CWAA 2TSSA 1YIWA 4HR7B 2E2DC 2HIXA 4LFCL 1A70A 2MJEA 2KOXA 4IDIA 3UINB 4I7ZC 1N63A 2KFJA 3W5UB 2B2UC 3PTFC 3NTIA 1VQCA 4IUUA 1XMQL 4GN5A 5IOIA 1I3QB 4ZRZA 1HJPA 4OL7A 3J9CA 1LM8B 1BUVT 3SK8A 2Y0SG 1LTBD 3EFXD 2KWDA 4YHHQ 1DOMA 1IW7C 2KJRA 1I7HA 3NZUA 3QX1A 1CK1A 4KKJA 2IY0B 1H4RA 3H9DA 3UQAA 2B2VC 4P6VF 2F0TA 3W3AA 1DM0B 4GKJL 2F0PA 2WP8J 1I4RA 4LF6L 3IXSA 1MIUA 4S0RA 2Z0SA 3J81E 5GXGB 3APCA 1QB5D 1MGSA 5DAUA 2M1MA 1VQBA 3U30A 3I3CA 1XMQQ 1K0RA 1ACCA 1WTVA 1VQAA 2KMAA 1TKGA 1SNPA 1SR3A 4HMIA 3RNCC 4A3MH 1P7FA 3UF8A 3VR3A 4JX1C 1NJIC 2HDMA 3ZW3A 1KJTA 2CU3A 2DHZA 3EFUA 3LDZE 4YWMA 1VCIA 3CIRB 4B3RL 2MSED 3UIPB 3UDFA 4A3GB 4XGAB 2M19A 1H9KA 2RCNA 4MTKA 3V96A 5LMUL 5E7NA 2NVQH 3BU2A 3S1NH 4A3BH 4A3GG 1RF2D 1JT8A 1J7CA 1LTGD 1E1TA 5IYCG 1C4QA 3CF6E 3CPFA 1GC7A 4PMCA 1B8AA 2JA9A 2K22A 2ZJPA 3K0XA 4X65Q 4UPAA 2C9WB 3E9HA 1N5WA 5C2TB 1NI3A 4HIOA 4B3SL 5D6JB 2Z6KA 2QKIC 1VD2A 3DWQA 4IUPA 3HOYH 5C4HA 1PVOA 3VVWB 2V4DA 3QIAA 1KRTA 2K5WA 3V3XA 3NQTA 3J7AF 5BYQA 1IW7D 2YTVA 3JSVB 5DNFA 3DVNU 3LNNA 3L0OA 1VQ7A 3PUVA 2CS4A 2LFIA 2D3BA 2FXQA 2I07B 2A4ZA 3ZYYX 1ICWA 1WX8A 2VNUD 1XLNA 4CDEC 1Z9FA 2N3SA 4AYBE 3U52E 1HFGA 2MPMA 4JI2L 1D4BA 2HCCA 5IE8A 2YTXA 1N9WA 2E3TA 3A1QA 2K8CA 1I4GA 2ICEC 1PUTA 3TREA 4HIKA 1WRDB 3L10B 3VAWA 2E2HB 1PFBA 1PHJA 1RWSA 2EOTA 2OOBB 2A5UA 4RGMA 1EF5A 1GPXA 2K5VA 4HN7A 4OVVA 2IPKD 2PE9A 1NENB 4YSZB 4FNFA 2LD9A 5LNK1 2DJFC 1CA5A 2FHTA 1DYQA 4I6LB 1B44D 2KWCA 3NK9A 2C60A 4DXGA 2N7EA 4XDCA 3TIXA 1FRRA 3D4WA 4DF7A 4RG1A 1UUPA 2BB5A 3DHIC 4ILWA 3RUIB 2Z1CA 1XNQQ 2QA4A 1IPGA 2AHOB 5EQ0A 5A35A 1A2TA 1I3QH 1JALA 3S16H 3SR6A 3BVZA 1OXSC 4JGHB 4X62L 1P7EA 5LLIA 1R4QB 1CQFA 1RCVD 1WGRA 2BS2B 1PLFA 1XT9B 3WOEA 5BN4A 1PH5A 3MJ5A 1JQYD 1SE3A 4LUOA 3J81j 2DAFA 4RF1A 2R92B 3NXWA 3CC4A 3TBLD 2J4XA 1Q1OA 2K03A 3L4PA 3K5LA 2JA7H 4YHHL 5C0XJ 3HOXB 4ABNA 4WAAA 2W82A 3HOVH 1ZP0B 1O7LA 1SLJA 2EVBA 3U7DA 2MA9B 3DBRB 1C9OA 2OJWA 3H94A 2NZ1D 3CMMB 1EY6A 4JI3L 4MELA 4AS1A 3S17H 1KRSA 1SIJA 3DQVA 4LJPB 4GOCA 5KHQA 1I50B 2NN6I 1NE3A 1WE6A 4EE2A 1GC6A 5JPNC 3GTPB 1XWEA 4WQMA 2QEXA 3DBRI 4FLHA 1FPYA 3K59A 2WXKA 3GTPH 1WWTA 3ZQ4A 2RMMA 3O65B 2K50A 4FXKC 3X3MA 2BWFA 3VR2A 4DV7L 4JCVE 3VRAB 2E74C 1E8ZA 2Z9HA 3JAML 2XGTA 4DUZL 1QZEA 1ZXIA 2WU2B 4A3MG 3DBHI 4HCNB 1RRBA 4IWQA 1AZQA 5HHDG 2NTSA 4CKEA 3I5JC 5FLXL 1CKOA 5HGQA 4OWXB 4JWUC 1GNUA 1NEKB 1HTPA 3J7ZC 3H8HA 1NSNS 1C9FA 3HS0C 2WWZA 2N78A 3I90A 2WXOA 5GMVA 2ZXRA 2NVYB 1P0RA 1F2RI 3RPFC 2VH1A 3VR9B 2OXPA 1WXSA 1VMPA 1TKYA 3RR5A 1KXLA 2Y0SE 4LMQD 1PFDA 1PQSA 3V6EB 4C4VA 4JI0L 3L2PA 1O7YA 4ULLA 2JA5G 2WKDA 2NWGA 1BUIC 5CV5A 3VR6A 1HA6A 3AMZA 4KZCA 2RDBC 2IY1B 3E9IA 4GOPB 3KF8B 4GN1A 1BBXC 4JI2Q 1KC8C 3DVGX 3QOJA 3PO3B 4HPMB 4JI5L 5FR3A 4MHEA 4UHVA 1EY5A 1E6EB 1SMXA 3CWIA 1LO5D 1X56A 3HRDD 4WWMA 3VA7A 1FVIA 5AZHA 4ANWA 3A5ZB 1WXAA 4L5QA 5D7GA 3MEHA 4KJNA 5EPKA 4LF4L 3VYUA 1HR0W 2M00A 2M17A 1PDXA 1N61A 4JI7L 2J53A 2IYDB 3NVZA 2OEOA 2HIVA 4HK2A 1VJKA 1Y1VH 2WB1G 3MTNB 4NAWA 3PHXB 4UDUC 1HCZA 1L7YA 4L5RC 1DGSA 2EMSA 3S1RH 2XEWA 3KF6B 3K9PB 1T0SC 1K8AC 5COYA 1ZE3D 3Q0AA 2HT1A 1E0ZA 3RZOH 2JQOA 3GTKB 2B2UA 2GBNA 3PT2B 3W1SA 3AU7A 2N9EB 2PLPA 5FJ8H 1I5FA 1XTDA 3NUHB 4K0KL 1KDAA 2R7FA 4HCPB 4FXCA 1P1AA 1G91A 4A3KB 1LGRA 1WI0A 4G7OC 3I4OA 3MC0B 1YNTE 2BF8B 3W5OA 4G57A 2RHSB 1LT6D 5HI1A 3PSIA 5C4JB 2K7VA 2A6HC 1QG7A 2JQRB 4QB4A 4DR2L 3KWLA 2L05A 4KZ0A 3EA6A 2KHIA 3IFTA 1ZKOA 2X6LA 2BH2A 4DUYQ 1PRTC 4A3KH 3S1MH 5C44B 4F87A 4E6IA 1JB7A 1J7BA 1E8YA 5EBDA 2WXQA 3F8TA 1OQQA 1P3QU 2KN5A 1TWGB 1YJIA 2N7JA 4OIJA 4KSKC 3KYDD 4K8JA 2JZPA 2V1YA 4X3SA 4G11A 4DR1L 5I2YA 4JL9A 4R1JA 5DM63 2KYWA 5C3XA 1MPEA 4BY1B 4WQOB 1PTOC 2UU7A 2HDLA 3CC2A 4BZAA 4AYBG 2DUDA 1VQ4A 2NMQA 1A3TA 1ESRA 3NELA 4GKJQ 2NPTA 1Z2MA 3P4QB 3IAS1 1R7SA 4DHZB 3V05A 3VRBB 1JR0D 1N34L 1QQRA 4BBNF 3OW2A 1II3A 3HUIA 2N55A 2JA7G 5FK9C 2EYOA 4HJ8A 1DXMA 2CHWA 4BOZB 3MFYA 4ZQ3A 2B76B 3OJ4B 1VQLA 3L0WB 2AWNA 2KHSA 3Q8EA 4A3PA 4DNTB 4GOPC 4A90A 3L7ZC 4ZHPA 2HE7A 1HH2P 4BY7H 2BYEA 5CHVC 4A6QA 1WGYA 1HPCA 3GTQB 3MXNA 3ERQA 3TS2A 4A75A 2O5JC 2WDTB 5C3JB 1JB3A 4DAVA 1XTCD 5C5MA 1Q7YC 4RF0A 3G6JB 1Q1BA 2VZKD 1KIXA 2FE8A 3H7SA 3RNFC 2K3UA 1BCPC 1F2LA 1KNEA 2QCZA 4HVBA 4NAWB 3J81c 1V1OA 4LUZA 1X32A 4IPGA 4A3IH 4OHJA 4PYUA 4NXMQ 4LF8L 2E2IB 3KYCD 2N9KA 2PO4A 5IODA 5J1ZA 3FKIG 5C4JH 2EY2A 3JYUA 1V1QA 1W6JA 5EJWA 4ZRQA 3ZRFA 3QK0A 1QCBD 4DV6Q 3B2GA 2UUAL 3QIJA 4I65A 4BBRB 4A93H 1HR0L 1PYBA 3PMFA 2JA8H 2LEKA 4B9XA 1FFUA 3RZOB 2PKOA 3LXFA 5JJZA 4JYAL 4DGZA 4HEA1 4BKGA 4I6NB 1JWMD 1IUEA 3M7NA 4BVUC 4Q5VA 2CHZA 1TU2B 1MSGA 4A3FB 1E1OA 2L12A 1Q86C 1NY4A 3KLSA 2D62A 2MP2B 4E3CA 3H0GB 2FIDA 5I9PA 3G7LA 2IHEA 2CCZA 4LF9Q 4TQUS 1QOFA 1K3BC 5FLXE 4EVOA 4US9A 4F7ZA 2VB2X 2YEPB 2KTRB 2V3SA 4RMAA 2PZTA 2DZKA 5IT9c 3WALA 1MG8A 3PS6A 3V60A 5C4XH 3QJYA 2JA5B 2MBOA 3ZTCA 1IBLL 3K0YA 1XPOA 3QHTA 5IWAQ 2FCSA 2INNE 4LF7Q 1EYAA 3CRLC 3ITPA 2JA7B 1AFPA 2JRIB 1YZ6A 2R92H 2ZNVC 1Z47A 2LFNA 2LGXA 3MP9A 4TV3A 1DOLA 1FXAA 2PPBC 3SK6A 5IYBG 2GMIC 4PV1C 5FR6A 3ZXRA 4BBSB 1ET9A 1TIID 4WJWA 1J5EQ 3HOUH 2MP1A 3S16B 4CBVA 3A8KE 1IL8A 1HRJA 2ZVOA 3P1MA 1L1OC 1STNA 4RAUC 4HEDA 3GTJH 3S15H 2KA7A 1S72A 2N7DA 3HOVG 4HKQA 5C6AA 2GVBA 3Q8CA 1J6QA 1BDOA 2BS3B 4KKUA 3TP5A 1BT0A 2BQQA 4N8FA 4X3UA 2OTLA 3GTQH 1EYGA 4K2KA 5FLMH 1B70B 4BXXG 4R8IA 1YJNA 1WVLA 3AE3B 2QF7A 1WYWB 2NUCA 4NQKE 4JW0A 4ZHOA 4GS3A 2NVXB 4UAIA 2DNFA 2HTHA 4K7WA 4BKTA 1BQQT 3GTGH 2BKFA 2BYFA 4RGOS 1T6BX 4C56C 4JE3B 1VQ8A 4A3KG 2IGGA 4HPPA 2HQEA 1CT1D 5E3FA 3JW0X 3U4VA 2L32A 2ZVNA 1KAWA 1WYDA 2LWPA 1KLVA 3IFDA 3HOWG 1O78A 3KW5B 2FNJB 3KH0A 5M5XH 4A3JB 1IBKQ 1C4AA 3ZDTA 2C7NB 5DM73 3V61A 1YOVB 1V86A 1YEZA 2ATWA 3HKSA 3VA5A 4JI1L 2D2QA 2OTJA 5T8IA 4A3DG 2L4NA 5BMIA 5BO4B 3MXNB 2M8SA 4LK1C 2JA6H 2UXDL 1TQOA 1C7YA 3HOUG 1DONA 2KWVB 5E6PA 3R7QA 5LXIB 3D31A 1HNWQ 2WIIB 2ICIA 1KM7A 5IA7A 2LRWA 1KDCA 3AU5A 5IAAC 2B8GA 5FKAC 1GOZA 5IP4D 1VQDA 3OTOL 1YBYA 3H15A 2GOWA 3N32A 4HJAA 1FCCC 4W9CA 2DY8A 4A55A 4TKOB 1N33Q 2K1FA 3HK0A 1WOCA 4DR7L 2LGYA 5C3EB 5JPMC 2D0OA 2K04A 2XK5A 3AFPA 3VXWA 4AOFA 3NVWA 5JEAH 2VQEL 3J80i 2RCFA 2XIWA 3RLNA 4IJLA 1J0GA 4HPLB 4M8MA 4JPBW 3C2PA 4C3HG 1MFWA 2K8HA 1WCMH 5IKCM 4KLKA 4US8A 2QEJC 2VY3A 3S1NB 4KHZA 5JJKA 1NVID 5MPOA 2JXMB 2IBIB 2F3IA 3PV1A 4H02A 4M8NA 5J22A 1GB1A 2PIAA 1Y1VB 1XPRA 5IGGA 3ZJUA 4WWNA 2KCTA 3M4QA 2KT7A 4BY1G 2G3QB 3ETRA 2KENA 3E3XA 1TY2A 4HIMA 4N58A 2CKZB 3PUWA 2JF5A 3AE7B 3NBHA 2UU9Q 2FINB 2OHFA 3TEWA 4A3LG 1TIFA 3IVFA 1B53A 1Y69U 2Q2IA 4QJFA 2QGQA 2Z0DB 3BK2A 5DCNA 2ALYB 3DEOA 1LXDA 1DOIA 1PH3A 1BKBA 1PYSB 4DK6C 3R3MA 2K6AA 2AQ1B 1EWIA 4AH6A 2EKEC 2IX0A 2N4FA 4EEWA 1YNXA 2R7ZG 4FP5D 2IO0B 2O2VB 1FD7D 4CYEA 2BYVE 2VW9A 1H9SB 1SE2A 2K5HA 3KDFB 4ID6A 2ZJRA 2KOLA 5CHFA 1NBWA 4UP8A 1YN5A 5EE1A 1H9MA 4DR6Q 3EC8A 4XQQA 4LJOB 4ANUA 3D0FA 4IUTA 1Q12A 1KF6B 3TEHB 3CF5A 1V49A 1HZ5A 3BYTB 3T51B 4IO9A 3ZJTA 2ID0A 3IBEA 3PO0A 3U50C 3WDNA 2H5XA 4W9GA 4JI8Q 4ZKCB 2F0IA 3STBC 4CDCC 5EDSA 1HNZL 1M4VA 2MO0A 2SAKA 4ZLTF 1YVCA 4CQNA 1WY8A 1EWHA 3GD7A 3CSTA 1EL0A 3RNUA 3NENA 4J15A 2ZW1A 4IWPA 2DJGC 3L16A 1V97A 3TEXA 4GDLA 2B63B 2PZUA 1X3QA 2KK8A 2UXBL 2GBKA 1E7VA 3ZNID 1PTOF 1I94Q 2JA5H 1PZJD 1UE5A 2G45B 4BBNC 1I4HA 4DU9A 1YJJA 5EPLA 4F8CB 3I4MG 1S5ED 4TQ0A 2NBVB 2KLGA 1VDZA 4KV2A 3A7AB 1K3RA 1E90A 5IP7G 3P4SB 2V1CC 2OCEA 4BXXH 1CKMA 4JIOU 4C00A 2NN6H 1P16A 4Q0FA 2RQXA 2NVTH 3Q8BA 3PRPB 1JROA 1NR2A 5DEHA 1XXGA 4DV3L 4B3TQ 3FKYA 5EKKA 2RDGA 2O4XA 2RD0A 2Y0SB 3NWTA 1YN4A 4AQ7A 1TWFH 4FF1A 1C4CA 4JQWC 2WX0A 4GNXA 1SROA 3FEWX 2E2JH 2VUMB 2REXA 2F0UA 4OW0A 2IY5B 1E8WA 1G2SA 4NPNA 4L23A 2NCNA 2WKCA 1IYUA 1KAAA 1RM6C 5DPWA 2LVPA 4ME5A 5FO9B 3M3JA 4QCLA 1FJGQ 2PMVA 2JWZA 3F1ZA 2K8BA 4MGZE 3PGZA 3SHLA 4LNKA 5IYDH 3D32A 1EYDA 1PH2A 3CRKC 5J17A 2RSNA 2YYZA 4K8IA 2ZTEA 2VQFQ 5CGKA 3T1YQ 1HNXL 3Q3NC 4B3MQ 1EUJA 4IUMB 4IW0A 5M5YB 3PV0A 5CV8A 1VQ9A 3K8AA 3PZ7A 1RIPA 4EQOA 3OMCA 2G1EA 2WXPA 3A33B 4HSPA 3AE5B 1RAXA 4FF2A 5M3MG 4DQOC 3ZUNA 2CH4W 5CR3A 2SEBD 2FCQA 4DV1L 3ZLZA 1TZ1A 4KKSA 2E2JB 2JYTA 3J80E 1GJXA 3ZRCA 1V9PA 1ROEA 1IL2A 2MHVA 3GTOB 2KN4A 4M1UB 2L0CA 1N62A 1I6HH 3ZXVA 2E2HH 4AYBB 2WDRB 1ESFA 1LFDA 2ZXOA 3VTUA 3N20C 4DBGA 1E10A 1K83B 2WXMA 3MAQA 4JOIA 2KC1A 2I5HA 4A3CH 2DENB 4MH0E 2Q2TA 4GZYC 5J3BA 1OTRB 1BF4A 4OO1G 2F4VL 1OXVA 1X6OA 4YY3Q 4DR4L 5AFWA 1IZ6A 1FO4A 3TSSA 4DV2L 3HP3A 2MRPA 3BVMA 1E7UA 3Q69A 3DM1A 4DR5L 4YWKA 1I4XA 4FULA 2M2LA 4RGTA 4NAMA 1GUSA 5ELNA 1PMRA 1V1PB 2R61A 1L4ZB 1QLBB 1LM0A 4DK3C 2F0QA 2WXIA 2ZPYA 3QB3A 2N8NA 2G9HD 5IYDG 2IO2B 1M1KC 2KNBA 1SNOA 3IKJA 4IPCA 4GNXB 1G6ZA 4A93G 1O7ZA 4C3IG 2XSCA 4RKBA 2ZM6L 3BJUA 2Z8LA 2A8VA 1RFKA 1VMCA 4Y52H 3SU8X 4E71A 3I2ZA 4R4QA 4D2KA 4A3JG 3B6YA 2PQAA 1PXUA 2WB1B 3F2CA 1HUNA 1K8MA 1SIFA 3OOCA 4LDTB 1WXVA 5IO9A 2KCNA 1EWYC 1UE1A 3ML8A 3WA0A 3HOWH 3OWFA 1FXTB 3I57A 2B2YA 1T0YA 1U4AA 1SRUA 2FMCA 3S1RB 1F9JA 2UYZB 2ZCCA 4ASWC 4K5VA 2YU9B 3S1QH 4PZ8A 4XT3B 5FO7B 1ZOYB 4JBMA 1PFMA 3TCAA 1VQOA 1I35A 4DXAB 4EGVA 3G71A 3Q22A 1TWCB 3ONSA 1MJCA 2UXCL 3VHTC 2RF4A 3M7GA 5IGDA 5ELDA 1QNUA 1ICFB 2QJLA 2NZHA 3NJTA 2W3RA 1H9JA 1ZUD2 3ZTDA 4P1CC 3MHSD 1PTOD 3KBGA 2MUYA 1U4MA 1LTID 4LCDE 1J7AA 2W9NA 4FHJA 1YJWA 1ZYRC 1GUAB 3GQBA 3K58A 4HJKA 2CFMA 2RDHA 2Z4IA 3RYTA 5AJ3Q 2SDFA 1OEYJ 3TS0A 1PH7A 5L95C 3CCLA 3HVZA 3DXJC 4PMWA 1B1ZA 2Q2UA 2KDFB 4HDQA 1SNDA 4XYOA 1J8CA 4KN4C 2BB6A 3NBIA 1CHQD 5LHY1 2WS3B 3L17A 4DAPA 1FR3A 2VS1A 3QJZA 1QJOA 2LI5A 3DWGC 4L5TA 3FAHA 1NDDA 4C1NK 3PZ8A 3A9KA 2JJQA 2BDNA 3H09A 2KC2A 2AEHA 4HXDA 2F0LA 4H0LC 4HAEA 3URYA 4X66Q 5JVH3 4GKKQ 4WAFA 2F0VA 2K14A 2MFIA 2C5CA 3V6CB 3VYRA 4O42A 5CBEE 1HA5A 3RFZB 2R93B 3A9JB 2L0FA 2MCNB 4G0NB 4IFDI 5DPRA 3M4OH 2BDOA 3H0GG 3KLWA 4AWJA 1ZEQX 4L6TB 2B8FA 1V6EA 3D3RA 5EKIA 2L76A 2KQ3A 5D2MB 1R4MB 2K01A 2UUCQ 3TDQA 2KKCA 4A3BB 2NVQB 2KJHB 4HMJA 1UBIA 4NNJB 1PZID 2W55A 4RNAA 4NP5A 3HOZB 3B2FA 4DAYA 3K6OA 4BA2I 1WZ3A 2K9XA 2A69D 1PGBA 3UI2A 3NPPA 2IX1A 1MJEA 1JWSD 5G5HA 1Y56A 1CJEA 1WTQA 5G5GA 4CKCA 1AARA 2C5LC 1GB4A 1HQMC 2EPBA 4P2CB 2LS01 1HHVA 3V62A 1KD1C 3SK5A 3FKIB 2K5PA 2LGIA 1VF7A 5JEAJ 3VQIA 4LFAL 1PGAA 3VYSA 2Y5PA 2JSOA 4QMGA 2E75C 4DK0A 1BXTA 1MBYA 2HHHQ 2PVGC 2KCCA 5HG2A 3TEZA 4N8X1 1O80A 1NI2A 1A5RA 3EQLC 2F3WA 1L2NA 2EELA 1GD7A 1Y1WB 2R93G 2K39A 4LF6Q 4AQYQ 4M8AA 3QAQA 1K8OA 1XNRQ 4JI6L 3HOUB 4ARIA 1NMFA 2C35B 3RN2A 2IL8A 4WJ4A 1S1QB 2WACA 5J18A 2CW0C 4RMFA 4MM3B 1GHKA 4UY8C 1ZW7A 4KIKB 3U8ZA 1R9TB 2H88B 2MW5A 1U9RA 2AUKA 1D6EC 3DPDA 2EZVA 4L2YA 3UQBA 4LFBQ 1UELA 1F9SA 5BYRA 5IP9G 2KEEA 4DDGD 1C76A 1SSOA 1QT9A 2BGFA 3TQYA 3ZNHB 1B3QA 3CU7A 4OWTB 3X3NA 1JE5A 2L9HA 1EYCA 2GRIA 4MEMA 1RDPD 1JJCB 4K6LA 1L6VA 1QZHA 1YD8U 2MJ8A 5JOBA 2IO3B 3BY4B 2EY6A 2EYPA 2N49A 5D65A 3SXHA 2W3SA 4ZK9B 2BBCA 1SYGA 3PHWB 3J7YW 4FJYA 4A3FH 1EUVB 4M01A 4P73A 2RHQB 3DBLB 5E6OA 4OZCA 5HGTA 4DR7Q 2ZM6Q 4ODGA 4KMUC 2B3GA 2LHDA 4DWFA 1YMHE 3OIPA 1GG3A 1E0BA 2QHOA 3FPPA 1LUZA 4DK5A 1NNXA 1I4QA 1KABA 1ML0D 3B0AA 1Q81C 1N32Q 4II2B 1WGKA 4IUQA 4YCWA 1E7PB 2ZT9C 3OAWA 3Q24A 1A8VA 3FHWA 3GO5A 1BVSA 1OO9B 1BBUA 3PUZA 3AN1A 5GADC 1EY4A 4DR4Q 4PS8A 1STHA 3R2TA 3T56B 2J0MA 1IP9A 2L8JA 5JAVA 3GTMH 4DXFA 2UUCL 3H7PA 4XDDA 2D2CC 3LGJA 2AL6A 1FCLA 4MSQB 1TWAB 1TY0A 3M3YH 2INPE 3BYYB 5CTRC 1YN3A 4GOPA 2NVUI 3U7ZA 3RNAC 2IWHA 3K9OB 2VRRB 5IP7H 3UDGA 3WOFA 1KRHA 4GLVB 1XMOQ 2KX0A 2J0TD 3MEFA 4LNOA 5JHAA 1ET6A 3H1UA 1WM3A 1JJ2A 3PIP3 4XIGS 3AULA 1SYBA 3P4RB 1E24A 5FLXc 2WNMA 5I6WA 3EROA 1AZPA 4OVZA 4RM8A 4USAA 1FIQA 4IPDA 2V3NA 5G3LD 3FP9A 3JVZX 3L54A 4DK1A 4DV0Q 3GZNB 2FFKB 4TKNA 2QDLA 2AL3A 4ANXA 1GKHA 1SE8A 3ERSX 4PZ7A 4LAAA 4AIMA 1HNXQ 5M3FG 3IHPC 5JH5C 3I70A 3RD4A 1SF0A 4ZKBB 3PF5A 3CQZB 3RN9C 3UIOB 1CUKA 4X64Q 1IKMA 5D14A 1VQPA 3I9V1 3GZNI 4IOIE 4CJ2C 4LNNA 5DPTA 4X64L 5H8YE 4KJOA 3KLRA 1ZXTA 4R8NA 3I56A 2QW7A 2NBUA 1KLGD 4REZA 3S2AA 3T13A 1Y1WG 2LZ6A 3C0RB 3PRMB 1MHWC 2QSDA 1KOTA 1VQEA 5CMDA 3AE8B 1YI2A 4IFDH 3GTJB 2EJGC 2I38A 3GTMB 3ER0A 2KANA 3Q8AA 4P75A 3HHMA 4QF4A 5C3EH 1PH8A 3M4PA 3BINA 2E5LQ 2AYOB 4KHVA 3DM3A 3Q23A 4DV3Q 2K33A 3QCAA 1NYRA 2PJHA 1YJ9A 2LXCA 2XRQD 5FJ8G 4ZRKA 5EKLA 4KY7A 2X38A 4DV4Q 2I2YA 2K0PA 1WIAA 4RM9A 4MGKE 3P42A 5HY6A 4IM3A 3SFEB 2EYJA 3JC66 3T3NA 5CV4A 4GGQA 1I94L 2OQKA 5C4XB 1WTOA 5M3FB 2KDBA 1UE7A 1Q3LA 4EX5A 1VQJA 4W9HA 1LT5D 4ITKA 4OX9L 4FJVB 2YLMA 4J6HA 2KXJA 3KUPA 1GUNA 2DZIA 4K7UA 4X6AH 1IGCA 5GAHC 4YXDB 4HKZE 5T1GA 1FRDA 4QY7A 3S9WA 1SXTA 1OXXK 2PYKA 2WAQE 2WFWA 1N36L 5C0XH 1N32L 1QE6A 2B2TC 3BS1A 1B2TA 2L55A 1R4NI 2GN5A 1OTCA 2FAZA 2R2OA 3R66C 3DUZA 3MVVA 4P1BC 4WRDA 2A68C 5ELOA 2DN8A 4U673 1Q0WB 4GDKB 2KVRA 3S2HB 4DNIA 3Q8DA 2KCMA 1GUWA 2QC8A 3TN2A 5TR5A 4M02A 3BDOA 2HJ1A 2EQSA 2MO1A 2EYLA 3PGEA 2F03A 3UGBB 4LUVA 5DLQE 1MHHE 2LY7A 3D6WA 4WJOA 1YX5B 2YV5A 4G3XB 1AW7A 4ALPA 1V1PA 3A5UA 2PMZE 4X57B 2E8GA 3NZ3A 4L8JA 4NXNL 3SEBA 2RPQA 2WV6D 3N1ZC 5J2RA 4H44C 5C4XG 4KI0A 2ZTCA 1DOKA 1EFID 4P74A 3NP8A 5ELBA 2QILA 4APVA 1LQBA 3A4SC 4BBRG 4OEMB 3CCRA 1DJRD 2IHFA 1XPUA 2VZKB 1LV9A 4JI4Q 1QF6A 3V2TA 1C77A 1MJDA 4DV1Q 2LXAA 2PMZB 4K5WA 3TP7A 4WJNA 4L63B 2I5MX 3P4PB 3OSOA 3EFCA 1JORA 4KGSA 4GDLB 3WIMA 2JK8A 2X6GA 4B08A 5M3MH 1YHQA 1F2MA 1E7ZA 1SE9A 2M0XA 4A8XC 3RLFA 4IC7B 4X3KA 1G6PA 3H3VH 1IGDA 2ZJDA 5IY0A 1IBMQ 3ULPA 2M0AA 3BK1A 4ZUJA 1E9MA 4IM2A 4EKUA 4KIKA 3J7AV 3J80c 4P7IA 5FLMG 1EIYB 2NVTB 4QGUA 4RWSC 4BY7G 3J81L 1CHPD 1D1IA 4L5SA 4EQ5A 1N8RC 1LTTD 1EQVA 3RMHA 5JVG3 1QOAA 3APFA 1R4NB 1GM5A 1PRTF 3QWZB 3NE5B 3SD5A 4KGRA 4OGQC 1SYFA 1SDFA 1I6VC 4V0BA 2BCOA 2JA8B 4DV5Q 1QKZA 4A93B 3MZ5A 3AE9B 3NTKA 5F2DA 1B3AA 2K25A 2V9HA 1JC7A 1PRTB 1Y1VG 1SNQA 2CW0D 1HZ9A 2PCFB 3OLMD 5H1SE 3T1HQ 1UD7A 2UWQA 2MQJA 5EGTA 2D3GA 1YNJD 4W9EA 3CCSA 2H1EA 2LJIA 4CHKA 4TVAB 1HXYD 5IN7A 1IBML 4YTNB 2EIFA 1AE2A 3VUXA 4A20A 3AFQA 2B2WC 4JOIC 2EJMA 3DLLA 1T0QC 1VQ5A 1JWAD 1WYGA 3U58A 4B9WA 4H2AA 3ZIMA 1EEID 3OIQA 3G48A 1FXIA 1DOYA 4TMAB 3HZXA 3CXCA 3PF4A 2UXCQ 1LLRD 1STGA 2WHIA 4WURA 5HFYA 1WM2A 3I4MH 4C1NI 4WWOA 1PFSA 5JJIA 1TYGB 2WAQG 1X3PA 2F0GA 1F0ZA 1T0RC 3I3TB 3PRZA 1WD1A 4LFBL 2NBFA 2J52A 1F2YA 2BH8A 1YNJC 1HQRD 1WR6E 4GB9A 3N52A 2O5IC 3KVFB 3A55A 4IM0A 4XWTA 1HZCA 1Q46A 4YTPB 4TUUA 3Q6BA 1QWYA 2V0GA 1B7YB 3TBIB 1CKNB 1V80A 4DHJD 3HKZG 2L5TA 3CC7A 3DCGA 3NQIA 5CHWA 4HJ7A 4MH8A 4POFA 3PO3H 1L0XB 2F0EA 3VDZA 1SMYC 4FXGC 3BZDB 3UE0A 2L3ZA 4FJZA 1QVCA 1PH4A 3Q2AC 1R4MI 4J3OD 1EIHA 3H3VI 1VQGA 1B4OA 4BY1H 5KYLA 1D8LA 3TUOA 3FMCA 1ENFA 3N30A 1TWHH 2FCMA 2X8XX 2JYEA 5D94A 1YNNC 4LF5Q 4QAYA 2UU9L 4EFOA 4DR5Q 2A6HD 5KIXA 4POGA 1Y8RC 3FC4A 4II3B 3PUXA 3KJOA 3RN5A 3A8JE 2KMCA 4ZYNA 2FBWB 3ZGZA 3LX0A 4JV5L 1GVPA 2MBEA 4B0MA 3HG9A 5IIFA 3IAYA 4ARCA 3CPWA 3NEMA 5LL6S 1CZGA 3B1LX 3KK7A 3U4ZA 4C3IB 2O2LD 1YQ3B 5BR8Q 2BOSA 4C7ZA 3N1YC 4KY6A 2AUJD 3SDZA 3IG3A 3N3KB 2KHWB 1E8XA 1EY8A 2N0SB 3PZDA 4YWGG 1BOSA 2OWOA 3UE1A 3EJIA 3A8IE 2RSUA 2GVAA 2N9LA 5AUIA 5EAYA 2PPHA 1UEAB 1FFVA 4LF5L 1MKHA 1WJUA 2V3PA 3H0GH 1WCMG 4RCOA 3I7FA 1TGZB 4FVMA 2EE1A 5E4XA 4PZ6A 4GKKL 2XNAC 2QCPX 4A3MB 3CP0A 1I6HB 5JXVA 4W9DA 1U4LA 1M94A 4WJPA 2V4LA 1CFMA 1J19A 4DV5L 3UDXA 2A5HA 2B2VA 4CDFC 3P1HA 3TMPB 4DV2Q 4N9PA 4MGIE 3GDEA 4GXBA 1D1KA 1L0YB 2CH4A 2ASQA 4J1MA 1WH3A 2K75A 3F2DA 1A63A 3M95A 3IT4B 2K28A 3HOZG 2VZAA 4CHTB 4C3JB 4FF4A 4A3FG 1EQQA 4DA2A 3AU4A 2H4OA 4K3BA 5D3DA 4ZOHC 5G2NA 2WDVB 3JAMi 5LXHA 5K36H 2JXTA 2R2QA 3T9LA 4BKSA 4GSWA 1KQSA 3ALBA 2FUG1 1FGUA 2IO1B 2NS5A 4CGYB 1NMGA 3S14B 2KEDA 1YQ4B 3KYHC 1MD2D 3VYTA 4GLSC 2J7ZA 3PO2H 3BDCA 4DV0L 5CORA 4K2LA 2RKSA 4ME3A 3RT3B 1N34Q 2BA1A 4KK7A 4CJ1B 3AEDB 4ZCKA 3J7A5 1HEZE 3AE1B 1CZPA 1G6JA 1TTNA 3GE8C 2JP1A 3MC8A 2OQ0A 2F52A 4JI4L 4NW2A 3U9OA 4QUFA 1CMXB 3I55A 1V5TA 1X1MA 3K57A 4WH4A 2ZNVB 2DBYA 1A3UA 1B9NA 4H7BA 4YIJA 2LGDA 2LGSA 2L83A 4BKSD 3HKZE 2MGSA 2K52A 2JY6A 3T3OA 2F3VA 1FJGL 1WJNA 4F8MA 3I63C 1VRAB 2KAJA 2RVLA 2WB1E 1SEBD 2CQOA 4G50A 2QIEB 4MTNA 4PT5A 1UWMA 3C8YA 3RMKC 5EE9A 2N1WA 1IKLA 4KKIA 3IRBA 2B63H 3S17B 5C3EG 3KLSX 1EFWA 1C1YB 4IWOA 1E3PA 1T5EA 1GO3E 5G3LF 5E1FA 1JMCA 2O2VA 5D3IB 1S4ZA 1SB3C 1IBXA 1X55A 3FPUB 1TZOA 2DX5B 4Z9CB 3AB5A 4HWIB 4O2DA 1OXUA 4BWGB 5H92C 4RFBA 2LSSA 1OGWA 3BWUD 1K50A 2K05A 5G55A 4WORA 4YL8A 2WAQB 1LTRD 3K7UC 1KFYB 3ONAB 3CMAA 3S1MB 1BNZA 2WXFA 3P20A 1JRUA 1XF5L 2I1KA 2D07B 3NS1A 2PI2E 2HDEA 3N9YC 2HD5B 2E2IH 2WINB 1JRPA 5BN5A 2MQHA 3KUDB 3C46A 1MHXA 3GP7A 3APDA 4W9IA 4TQ1A 1BCPB 1AN8A 2CJNA 4HLEA 4JYAQ 3NWSA 5GAEC 2E76C 3M4YA 2MNAA 2KTRA 1RJTA 1JW9D 4ZRIA 3ND8A 1SBBB 4LLGM 2F0SA 2RPVA 1JQ4A 4EQNA 3WAMA 4OZAA 1F77A 2XWJB 1DOXA 2XN9C 2G9DA 3OW7A 1OEYA 3AEAB 4FN2A 3A74A 3ND9A 2PE6B 1RKNA 4NXML 4W9JA 1RODA 2LXJA 1IYJB 3LYYA 1XNRL 1UF0A 3CKIB 3K5NA 2F4IA 2N9XA 2Q2HA 4DR6L 2K6QA 4AQYL 4UP7A 1QOBA 3AEEB 3KWVA 1HZ6A 4M0WA 2K4KA 4P71A 4KSLC 1XCTL 1KL9A 1AP0A 4K5XA 1DCZA 2CQAA 5ELFA 3E56A 1S3SG 3DHGC 2L7RA 5IGBA 4U68A 4LFCQ 2MLBA 4I7AA 5C4ZA 3KF6A 3MA2B 4PG3A 2KJXA 4IOCA 1V2YA 1SYEA 3PVLA 1E2WA 2MX2A 3GV6A 3BZKA 1PTOB 1EM7A 3U4EG 3ZVVA 1OFFA 3J81i 4XQJA 2KBNA 4PYZA 3CCJA 1CA6A 4UP9A 5ELCA 1GUOA 4F88A 1Y1WH 4BFRA 1S5FD 3KBXA 4P16A 4A3OA 1H9RA 4JI1Q 3NZSA 4IURA 3QC8B 3VR8B 3K81C 4KN7C 3U9SA 4M0WB 3TP6A 4ZDVA 2BT6A 1WXMA 1WZ0A 1A2UA 3RZFA 3ZJVA 1HTLD 3S2DB 4DAMA 1FM0D 1P8LA 2KQ4X 3QG1A 3OWEB 2Y5CA 1SYCA 2KLCA 3UI3A 1R4PB 2W54A 3K5OA 3L9AX 5KRUA 1D2BA 3PIOA 2BTEA 3JAMc 1Y8PB 3WCQA 4KTAA 2OEDA 2YEPF 4HCSA 1WX7A 5M5XB 1WTHA 4A3JH 2K1BA 4LWCA 2HCIA 3AB9A 3D4RA 3P7JA 3OTOQ 1D5MC 3DWPA 1L4DB 1WXQA 1JWUD 2BA0A 2CHXA 2DZJA 3Q3FA 1KH0A 5IYBH 1PA6A 3PREA 1AWDA 4S17A 3CW2C 4JBKA 1SSNA 1CQVA 3ZNGC 1YHAA 5I6YA 3M4OB 4KY5A 4CDDC 2MWSB 4AUQC 2OT2A 1YITA 2L52A 1UH6A 5C0XG 1FGBD 2F0NA 2QDBA 2IDYA 1RHPA 1UGMA 4R4CA 2UUBL 1A15A 3DWMA 3MHBA 1UNSA 3VDYA 3I4NB 2NN6G 1JICA 4RKLA 3A56A 5KNCA 1TJEA 2LHEA 4PK1A 1RTNA 3OMGA 1BO0A 1RL2A 3NBHB 3C3LA 5GAGC 3BZCA 4YCUA 1EF1A 4ZRPA 4K1RB 3C1EA 1EY0A
chains in the Genus database with same CATH topology
2FMMA 1Q8IA 2KDMA 3P63A 1PZKD 5LL6X 3U2SC 4C80A 1PYWD 2EY5A 4Q2JA 2PZWA 4FYDA 4BA1I 2LKVA 1N60A 2MEKA 4X3TA 1XEEA 4HSVA 4NMZA 1K52A 1G2TA 1EZ6A 4HRSA 3K7AB 2A68D 3I8ZA 1K53A 3BVGA 1WRIA 1NCVA 1MVKA 3NTHA 3W5VB 3OHXC 2MJDA 3IL8A 1GAQB 4YTMB 3AV8A 2DNEA 1ZPSA 2IT1A 2ACZB 4KX6B 1EWCA 4IUVA 1VLBA 2WQYB 4A3EB 1A6XA 1XLQA 5CBAE 1IHZA 4A3IB 2PNRC 3EGRA 4CKBA 1JOKA 3PO2B 1BMLC 2F0WA 1D5XC 3DEPA 1TWHB 2JYOA 1AEXA 4C2MB 2XVSA 4MIUA 1ZDVA 3VR4A 5KEEA 2J42A 2LMCB 1E2VA 1PDQA 4DN4M 2MH7A 1C4PA 4K14A 4HJGE 2SNSA 1LTAD 3C1FA 2F0HA 2HUGA 2M9VA 1XLOA 1U4PA 3E5SA 5K36G 1I4PA 4FO2A 3RZDB 2AWOA 1QOHA 1EEFD 3GTLB 2DYMA 2N88A 2H89B 3IT6B 1NYQA 5C3WA 2JU6X 3HOWB 1SJED 3AEGB 4LK0M 2M56B 1WSPA 2MJ3A 1LTSD 3P75A 1ZYRD 4KKTA 2V4IB 2ZXPA 4R9WA 1BCPD 2F0OA 1Q1EA 3PIO3 2B2TA 1TS3A 1C79A 1LACA 4YSXB 5IT9L 2JA6B 2QMTA 1VZ6A 4NDXA 1N5XA 3HEJA 1JMLA 1PTOH 3HGBA 3K5MA 4MT5A 1M8AA 2ON8A 1F2ZA 4N6EB 1TKEA 1OXTA 4J8QA 2KMMA 1NR4A 5IT9E 4N9TA 2I46A 1FEHA 3MXPA 1GHJA 3LWUA 1SJHD 1J8IA 3A7LA 1JOQA 1CM9A 2AQ3B 3AECB 2NTTA 1TT2A 1YNND 3GTGB 2B39A 3T4AC 5KNBA 1STEA 1JE4A 2VXWA 3LB8C 4XWWA 2WLBA 5TSSA 3QO2A 3I4MB 1LABA 3T53B 1FNUA 4YT0B 5CYUA 1ZXHA 4WFN3 5CV7A 4WIPA 3DHQA 3I4LA 2JSVX 3EUB2 3D6CA 2K5QA 1C48A 1SFOB 5E6JA 1SNMA 1WTPA 4KD3A 3PUYA 4NJCA 1OQRA 1G8ZD 3MTSA 1F9QA 3W2DA 3MXUA 4IKGA 4KV6A 3M85A 3AMUA 1B9RA 4XT1B 2PW5A 2PTLA 4OO1I 1TWFB 2A6EC 3HVDA 2F0DA 3R8BA 1GUTA 1UWXA 1D5ZC 1BR9A 1EQTA 2WP9B 4ZAIA 3BIID 1XX8A 1B50A 3I72A 1TKWB 2WXNA 3HOVB 3LWEA 4KGTA 3TMEA 2EYMA 3NSWA 2KVMA 3BG3A 3I73A 4KD4A 4O1NA 4IQZA 3AEFB 2DNCA 2EYHA 2SOBA 1JWBD 2D5GA 1VZ8A 5ELEA 1PFNA 5IGCA 2WXJA 1IYVA 2F0MA 3MXGA 4RHRA 3SE0A 3R2IA 5EPJA 1F9RA 5I4DA 4C7YA 4XE0A 2PW7A 2WXRA 1STBA 1MI0A 1EY7A 2F1MA 2ZW0A 5K5PA 1L5PA 2C9OA 5M5WB 1PGXA 2CHBD 4PQXA 4C3JG 2XWBB 1ILPA 5ISRA 3NRZA 4IN3A 5EBCA 3Q6SA 4HTHA 2GA4B 1XCQL 1KNAA 3SR1A 3S1QB 1EIGA 2WXLA 2ONQA 1NAPA 5KNDA 2DLBA 5IGFA 1TR5A 1WCMB 1UGJA 3R3OA 5AUKA 1WTWA 4G4KA 1V43A 5CV9A 3H6MA 5KYIA 3E6ZX 2RA4A 5IOCA 1XO3A 4ZUIA 4OO1H 2GI9A 3FVQA 1TS2A 3J80L 4RA8A 4RHSA 3BDLA 5HURA 1WD0A 3MWYW 1ZDXA 1FYCA 3TP8A 3KF8A 5CC4A 2WDQB 4RCNA 4DFAA 3KQ4A 1T3QA 4PNYA 1VR9A 3D8GA 2K32A 1NUCA 2KECA 1SYDA 4JPSA 4CJ0B 1QILA 2XRSD 1JOOA 2IX3A 1ONLA 1Y8NB 2NB0A 5M3MB 2DY7A 2R7ZB 3A54A 1FNVA 2A73B 1WTRA 2E6XA 2R6GA 1EY9A 1KDBA 1JCKB 5KGUA 4XQNA 2JEAI 1S5BD 5I9OA 4TRDA 3TEYA 1G291 1VZ7A 4V190 1VDVA 1BCPF 2OF1A 4S3SA 1CTMA 5BN3A 5M9OA 4FXDA 3AE4B 2L1AA 1ILQA 2BS4B 2JEBI 4BY7B 4C3HB 3N6RA 2BE5D 2DWQA 2F0JA 2L1BA 1KTKA 2HTME 2PW9A 4YSYB 1CZWA 4NZLB 3H3VC 2Y3AA 4WAFA 4G7HC 3SFDB 3U4EG 1L6UA 3FDTA 2A74C 1HUMA 3IAM1 3AEBB 1STYA 4A3DB 1MSHA 4FF3A 5FO8B 2JE6I 2BE5C 1C8CA 5T1IA 3MFGA 4MACA 3FILB 1S5CD 3O13A 1L0VB 4OZBA 2IJ0A 4L1BA 3VR5A 1K51A 1WTXA 1FNWA 4N59A 4H13C 2CJOA 1IBXB 2WXHA 1LT3D 1XYIA 2PVOD 2EDGA 1SNCA 2LMCA 2IGDA 1AYFA 2F0KA 3H91A 1CI3M 3HKZB 4LJZC 1Q10A 3HRZC 5BMGA 2Z4HA 3QOLA 3Q8FA 3GB1A 1PRTD 2Q8RE 2R3ZA 5FOBB 2WU5B 2DYOA 2AQ2B 3OPOA 2KACA 2LUMA 4Y7NB 3W9CB 2EY1A 3DMUA 4IFDG 4IALA 1QOGA 1TS5A 5E4WC 2KUMA 1FMAD 4TSSA 3E9SA 3NVYA 3GV3A 3E0JA 2B2YC 2B2WA 5EE3A 5C0XI 4MN3A 4HROA 1ENAA 1DZ1A 1Z7TA 2Q8IB 2IW3A 3M3YB 1H9SA 3F2UA 4QIWB 2RBMA 3GS2A 1C78A 1RD9D 1B9MA 3CHBD 3AE6B 2FJ2A 1FD6A 2TMPA 1QNKA 3I91A 4RH6A 1GXDC 4JBWA 2IGHA 4XDXA 1J9OA 3NHHA 1EU4A 2ENBA 2L11A 1E2ZA 4JK1C 5NUCA 2A6ED 2RDFA 4XTCS 1SMYD 3AE2B 1SE4A 5BMHA 1EZ8A 3QWNA 2EKIA 3SVMA 3TZDA 1W6KA 4BS9A 1T5XD 2RSOA 5EE0A 2NYZD 1VF5C 5J39A 4ZYSA 5A2QL 2A69C 2AX5A 2F0FA 2WXGA 4K6DA 2D9UA 4LTUA 3JAME 1LT4D 3D4DA 4RGNA 1TVXA 1DGJA 1Q90A 3L3OC 2JWUA 5I2XA 4EQPA 2EJFC 1TS4A 1EU3A 2PQEA 4DNRB 3EVQA 2SNMA 4R3DA 1Z6HA 1UAPA 1V8CA 2K5DA 1F2RC 3S15B 3AM9A 2JX5A 3ABVB 4QUCA 1SAPA 4A9AA 4HCEA 4XYQA 2GB1A 2EYFA 4IUNA 2Q8TA 1RYJA 4IZ8A 5JEAG 2D5DA 5C5LA 2VB3X 4G7ZC 3SK4A 2Q5WD 3R93A 1Y8OB 3TZUA 3RUZA 1DD2A 5IGEA 3NVVA 1V8QA 1U4RA 2CVRA 1GUGA 1XLPA 1RTOA 1S5DD 1ENCA 2X69A 3NUCA 3AH7A 5CV6A 2BYTA 4OIKA 3T16A 4NKLA 3FRPB 1A3VA 5A2QE 4XXEA 1EOTA 3DWAA 1KLUD 5BYSA 1F9PA 1STAA 2BW2A 2EXZA 4F7XA 1MI2A 3HOYB 3FILA 1HFNA 4PMBA 3MHZA 3B9JA 4IFDJ 2TSSA 4HR7B 2E2DC 4IDIA 1A70A 2MJEA 4I7ZC 1N63A 3W5UB 2B2UC 3NTIA 4IUUA 1I3QB 4ZRZA 4OL7A 3J9CA 1BUVT 3SK8A 1LTBD 3EFXD 2KWDA 1DOMA 1IW7C 1I7HA 4KKJA 1CK1A 2B2VC 4P6VF 2F0TA 3W3AA 1DM0B 2F0PA 2WP8J 1I4RA 3IXSA 5GXGB 3J81E 1QB5D 1MGSA 5DAUA 3I3CA 1ACCA 1WTVA 1TKGA 1SNPA 4HMIA 1P7FA 3VR3A 4JX1C 2HDMA 2CU3A 1VCIA 3CIRB 4A3GB 2M19A 1H9KA 3V96A 1RF2D 1J7CA 1LTGD 1C4QA 4PMCA 2K22A 1N5WA 5C2TB 1NI3A 2QKIC 3DWQA 4IUPA 5C4HA 2V4DA 3QIAA 3V3XA 2K5WA 3NQTA 3J7AF 5BYQA 1IW7D 5DNFA 3LNNA 3PUVA 2LFIA 2I07B 3ZYYX 1ICWA 2VNUD 1XLNA 3U52E 1HFGA 2MPMA 1D4BA 2HCCA 2E3TA 1I4GA 2ICEC 1PUTA 2E2HB 1PFBA 1RWSA 2EOTA 4RGMA 1GPXA 4HN7A 2IPKD 1NENB 4YSZB 4FNFA 5LNK1 1CA5A 2FHTA 1DYQA 1B44D 3NK9A 4DXGA 4XDCA 1FRRA 3D4WA 4DF7A 1UUPA 2BB5A 4ILWA 2Z1CA 5EQ0A 5A35A 1A2TA 1JALA 3SR6A 3BVZA 1OXSC 1P7EA 1R4QB 1CQFA 1RCVD 2BS2B 1PLFA 3WOEA 5BN4A 3MJ5A 1JQYD 1SE3A 4RF1A 2R92B 3NXWA 2J4XA 2K03A 3L4PA 3K5LA 5C0XJ 3HOXB 4ABNA 2W82A 1ZP0B 1O7LA 2EVBA 3H94A 2NZ1D 1EY6A 4AS1A 1SIJA 1I50B 2NN6I 4EE2A 5JPNC 3GTPB 1XWEA 4WQMA 3K59A 2WXKA 1WWTA 3ZQ4A 2RMMA 4FXKC 3X3MA 3VR2A 3VRAB 2E74C 3JAML 1ZXIA 2WU2B 5HHDG 1AZQA 2NTSA 4CKEA 5FLXL 4JWUC 1NEKB 1C9FA 1HTPA 3H8HA 1NSNS 3HS0C 3I90A 2WXOA 2ZXRA 2NVYB 1F2RI 3RPFC 3VR9B 2OXPA 1VMPA 1TKYA 4LMQD 1PFDA 1O7YA 4ULLA 2WKDA 2NWGA 1BUIC 5CV5A 3VR6A 1HA6A 3AMZA 1BBXC 3QOJA 3PO3B 5FR3A 4MHEA 1EY5A 1E6EB 3CWIA 1LO5D 3HRDD 4WWMA 3VA7A 5D7GA 3MEHA 4KJNA 5EPKA 3VYUA 2M00A 1PDXA 1N61A 2J53A 3NVZA 2OEOA 1VJKA 4UDUC 1HCZA 5COYA 1ZE3D 3Q0AA 1E0ZA 3GTKB 2B2UA 3W1SA 3AU7A 2PLPA 3NUHB 1KDAA 4FXCA 1G91A 4A3KB 4G7OC 3MC0B 1YNTE 4G57A 5HI1A 1LT6D 5C4JB 2K7VA 2A6HC 1QG7A 2JQRB 4QB4A 3KWLA 3EA6A 3IFTA 1ZKOA 2X6LA 1PRTC 5C44B 4F87A 4E6IA 1J7BA 2WXQA 5EBDA 1OQQA 2N7JA 1TWGB 1YJIA 4OIJA 4K8JA 2JZPA 4X3SA 5I2YA 5DM63 5C3XA 1MPEA 4BY1B 1PTOC 2HDLA 2NMQA 1A3TA 1ESRA 3P4QB 3IAS1 1R7SA 3V05A 3VRBB 1JR0D 1QQRA 1II3A 3HUIA 2N55A 5FK9C 2EYOA 1DXMA 3MFYA 4ZQ3A 2B76B 2AWNA 2KHSA 3Q8EA 4DNTB 4A90A 3L7ZC 4ZHPA 4A6QA 1HPCA 3GTQB 3MXNA 3ERQA 2O5JC 5C3JB 1JB3A 4DAVA 1XTCD 5C5MA 4RF0A 3G6JB 1Q1BA 2VZKD 2FE8A 2K3UA 1BCPC 1F2LA 1KNEA 4NAWB 1V1OA 1X32A 4OHJA 2E2IB 2N9KA 2PO4A 5IODA 5J1ZA 2EY2A 1W6JA 5EJWA 4ZRQA 1QCBD 3B2GA 4I65A 4BBRB 3PMFA 2PKOA 2LEKA 4B9XA 1FFUA 3RZOB 3LXFA 4HEA1 5JJZA 4DGZA 1JWMD 1IUEA 3M7NA 4Q5VA 1TU2B 1MSGA 4A3FB 2L12A 3KLSA 2D62A 3H0GB 5I9PA 3G7LA 4TQUS 1QOFA 4US9A 5FLXE 4EVOA 2VB2X 2YEPB 2PZTA 3QJYA 2JA5B 3K0YA 2INNE 1EYAA 3CRLC 3ITPA 2JA7B 1AFPA 1Z47A 2LFNA 3MP9A 1DOLA 1FXAA 2PPBC 3SK6A 4PV1C 4BBSB 1ET9A 1TIID 4WJWA 3S16B 2MP1A 1HRJA 4CBVA 3A8KE 1IL8A 3P1MA 1STNA 4RAUC 4HEDA 2KA7A 4HKQA 5C6AA 3Q8CA 1BDOA 2BS3B 4KKUA 3TP5A 4X3UA 4K2KA 4R8IA 1WVLA 3AE3B 2QF7A 2NUCA 4ZHOA 2NVXB 4UAIA 1BQQT 4RGOS 1T6BX 4C56C 4JE3B 2IGGA 2HQEA 1CT1D 5E3FA 2L32A 3IFDA 1O78A 4A3JB 1C4AA 5DM73 3VA5A 5T8IA 2L4NA 5BMIA 4LK1C 1DONA 1TQOA 3D31A 2WIIB 2ICIA 1KDCA 2B8GA 5FKAC 1GOZA 1FCCC 2DY8A 4A55A 4TKOB 5C3EB 5JPMC 2K04A 3NVWA 5JEAH 2XIWA 3C2PA 4C3HG 4US8A 2QEJC 3S1NB 4KHZA 1NVID 5MPOA 2JXMB 5J22A 1GB1A 2PIAA 1Y1VB 3ZJUA 5IGGA 3ETRA 1TY2A 4N58A 3PUWA 3AE7B 3NBHA 2OHFA 2FINB 3TEWA 1B53A 1Y69U 3BK2A 3DEOA 1DOIA 2K6AA 2AQ1B 2IX0A 4FP5D 1FD7D 1H9SB 1SE2A 4ID6A 2KOLA 1YN5A 5EE1A 1H9MA 4XQQA 4IUTA 1Q12A 1KF6B 1HZ5A 3BYTB 3T51B 3ZJTA 2ID0A 3PO0A 3WDNA 4ZKCB 2F0IA 1M4VA 2SAKA 4ZLTF 4CQNA 1EWHA 3GD7A 1EL0A 2ZW1A 1V97A 3TEXA 2B63B 2PZUA 1X3QA 1PTOF 1PZJD 1I4HA 4DU9A 1YJJA 5EPLA 4TQ0A 1S5ED 1VDZA 3A7AB 3P4SB 2NN6H 4Q0FA 2RQXA 3Q8BA 1JROA 1NR2A 5DEHA 1XXGA 5EKKA 2RDGA 2O4XA 2Y0SB 3NWTA 1YN4A 4AQ7A 1C4CA 4FF1A 3FEWX 2VUMB 4OW0A 2F0UA 1G2SA 2WKCA 1IYUA 1KAAA 1RM6C 4ME5A 5FO9B 4QCLA 2PMVA 3SHLA 1EYDA 3CRKC 2RSNA 2YYZA 4K8IA 4L23A 5CGKA 5M5YB 3PV0A 5CV8A 3PZ7A 4EQOA 3OMCA 2G1EA 2WXPA 3AE5B 4HSPA 4FF2A 4DQOC 5CR3A 2SEBD 4KKSA 2E2JB 2JYTA 3J80E 1GJXA 1ROEA 2MHVA 3GTOB 2KN4A 4M1UB 2L0CA 1N62A 4AYBB 2WDRB 1ESFA 2ZXOA 1E10A 1K83B 2WXMA 3MAQA 4GZYC 1BF4A 4OO1G 1OXVA 5AFWA 1FO4A 3TSSA 3HP3A 3BVMA 3Q69A 3DM1A 1I4XA 4NAMA 2M2LA 4RGTA 4B0EA 1GUSA 1QLBB 1PMRA 1V1PB 2R61A 1L4ZB 4JWSC 2F0QA 2WXIA 3QB3A 2G9HD 1SNOA 3IKJA 1G6ZA 1O7ZA 4C3IG 2XSCA 4RKBA 2Z8LA 1RFKA 1VMCA 4D2KA 1PXUA 2WB1B 1HUNA 1K8MA 3OOCA 2KCNA 1EWYC 3OWFA 3I57A 2B2YA 2FMCA 3S1RB 4K5VA 2YU9B 4XT3B 5FO7B 1ZOYB 1PFMA 4EGVA 3Q22A 1TWCB 3M7GA 5IGDA 5ELDA 1QNUA 2QJLA 2W3RA 1H9JA 1ZUD2 1PTOD 3KBGA 2MUYA 1U4MA 1LTID 1J7AA 1ZYRC 3GQBA 3K58A 2RDHA 2Z4IA 2SDFA 3HVZA 3DXJC 4PMWA 1B1ZA 1SNDA 4XYOA 4KN4C 2BB6A 3NBIA 1CHQD 5LHY1 2WS3B 4DAPA 1FR3A 1QJOA 3DWGC 3FAHA 4C1NK 3PZ8A 2BDNA 3H09A 2F0LA 4H0LC 4HAEA 3URYA 5JVH3 2F0VA 2C5CA 3VYRA 4O42A 5CBEE 1HA5A 3RFZB 2R93B 4IFDI 2BDOA 1ZEQX 4L6TB 2B8FA 3D3RA 5EKIA 2KQ3A 2K01A 3TDQA 4A3BB 2NVQB 4HMJA 1PZID 2W55A 4RNAA 4NP5A 3HOZB 3B2FA 4DAYA 3K6OA 4BA2I 2K9XA 2A69D 1PGBA 3UI2A 3NPPA 2IX1A 1JWSD 5G5HA 1Y56A 1CJEA 1WTQA 5G5GA 4CKCA 1GB4A 1HQMC 2EPBA 4P2CB 2LS01 1HHVA 3SK5A 3FKIB 2K5PA 2LGIA 1VF7A 5JEAJ 3VQIA 1PGAA 3VYSA 2Y5PA 2JSOA 4QMGA 2E75C 4DK0A 1BXTA 1MBYA 2PVGC 2KCCA 5HG2A 3TEZA 1O80A 3EQLC 2F3WA 2EELA 1Y1WB 4M8AA 1K8OA 3HOUB 4ARIA 2IL8A 2WACA 2CW0C 4MM3B 1GHKA 1R9TB 2H88B 1U9RA 2AUKA 1D6EC 2EZVA 4L2YA 1F9SA 5BYRA 2KEEA 1C76A 1SSOA 1QT9A 3CU7A 3X3NA 2L9HA 1EYCA 2GRIA 1RDPD 4K6LA 1L6VA 2MJ8A 5JOBA 2EY6A 2EYPA 5D65A 3SXHA 2W3SA 4ZK9B 2BBCA 1SYGA 3J7YW 4OZCA 5HGTA 4ODGA 4KMUC 2LHDA 1YMHE 3OIPA 1E0BA 3FPPA 1I4QA 1KABA 1ML0D 1WGKA 4IUQA 1E7PB 2ZT9C 3Q24A 3GO5A 1OO9B 3PUZA 3AN1A 1EY4A 1STHA 3R2TA 3T56B 5JAVA 4DXFA 4XDDA 2D2CC 1FCLA 1TWAB 1TY0A 2INPE 3BYYB 1YN3A 3U7ZA 2IWHA 3WOFA 1KRHA 2J0TD 1ET6A 3PIP3 4XIGS 1SYBA 3P4RB 2WNMA 5I6WA 3EROA 1AZPA 4OVZA 4USAA 1FIQA 2V3NA 5G3LD 4DK1A 2FFKB 4LAAA 3I70A 3RD4A 1SF0A 4ZKBB 3CQZB 1IKMA 3I9V1 5D14A 4IOIE 4CJ2C 5H8YE 4KJOA 3KLRA 1ZXTA 4R8NA 4REZA 1KLGD 3T13A 2QSDA 5CMDA 3AE8B 4IFDH 3GTJB 2EJGC 2I38A 3GTMB 3Q8AA 4QF4A 4KHVA 3Q23A 2K33A 1NYRA 2XRQD 5EKLA 4KY7A 2X38A 2I2YA 2K0PA 3P42A 3SFEB 2EYJA 3T3NA 5CV4A 5C4XB 1WTOA 5M3FB 1Q3LA 1LT5D 4ITKA 4J6HA 3KUPA 1GUNA 1IGCA 4YXDB 4HKZE 5T1GA 1FRDA 3S9WA 1SXTA 1OXXK 2PYKA 5C0XH 1QE6A 2B2TC 3BS1A 1B2TA 2L55A 3DUZA 3MVVA 4WRDA 2A68C 4GDKB 2DN8A 4U673 3S2HB 1GUWA 3TN2A 3BDOA 2EYLA 2F03A 1MHHE 2LY7A 3D6WA 1AW7A 1V1PA 3NZ3A 4L8JA 3SEBA 2WV6D 4H44C 4KI0A 1DOKA 1EFID 5ELBA 3NP8A 2QILA 1DJRD 2VZKB 1LV9A 1QF6A 3V2TA 1C77A 2PMZB 4K5WA 3TP7A 4L63B 3P4PB 3OSOA 1JORA 4KGSA 4GDLB 2X6GA 4B08A 1F2MA 4A8XC 3RLFA 4X3KA 1IGDA 2M0AA 3BK1A 4ZUJA 1E9MA 3J7AV 2NVTB 4RWSC 3J81L 1CHPD 1D1IA 1LTTD 1EQVA 3RMHA 5JVG3 1QOAA 1PRTF 3NE5B 4KGRA 4OGQC 1SYFA 1SDFA 1I6VC 4V0BA 2BCOA 2JA8B 1QKZA 4A93B 3MZ5A 3AE9B 3NTKA 5F2DA 1B3AA 1JC7A 1PRTB 1SNQA 2CW0D 2PCFB 5EGTA 1YNJD 2H1EA 2LJIA 1HXYD 4YTNB 2B2WC 2EJMA 1JWAD 1WYGA 4B9WA 4H2AA 1EEID 3OIQA 1FXIA 1DOYA 4TMAB 3HZXA 1LLRD 1STGA 4WURA 5HFYA 4C1NI 1TYGB 1X3PA 2F0GA 1F0ZA 1WD1A 2NBFA 2J52A 1F2YA 1YNJC 1HQRD 3N52A 2O5IC 3A55A 4XWTA 4YTPB 1QWYA 2V0GA 3TBIB 2L5TA 3NQIA 4MH8A 1L0XB 2F0EA 1SMYC 4FXGC 3BZDB 4J3OD 1EIHA 1B4OA 5KYLA 3TUOA 3FMCA 1ENFA 2JYEA 1YNNC 2A6HD 5KIXA 3FC4A 3PUXA 3A8JE 2FBWB 3ZGZA 3LX0A 4B0MA 3HG9A 5IIFA 3IAYA 4ARCA 5LL6S 1CZGA 3KK7A 4C3IB 2O2LD 1YQ3B 4C7ZA 2BOSA 4KY6A 2AUJD 3SDZA 4YWGG 1EY8A 2N0SB 1BOSA 3EJIA 3A8IE 2N9LA 5AUIA 1UEAB 1FFVA 2V3PA 4RCOA 4FVMA 2EE1A 5E4XA 5JXVA 2XNAC 2QCPX 4A3MB 1I6HB 1U4LA 1CFMA 2A5HA 2B2VA 3P1HA 4N9PA 1D1KA 1L0YB 4J1MA 3IT4B 2K28A 4CHTB 4C3JB 4FF4A 4DA2A 2H4OA 4ZOHC 5D3DA 2WDVB 5K36H 2JXTA 2FUG1 4CGYB 3S14B 2KEDA 1YQ4B 1MD2D 3VYTA 4GLSC 2J7ZA 3BDCA 5CORA 4K2LA 2RKSA 2BA1A 4KK7A 4CJ1B 3AEDB 3AE1B 1HEZE 1CZPA 2JP1A 4NW2A 3U9OA 4QUFA 3K57A 4WH4A 2DBYA 1A3UA 1B9NA 4H7BA 4YIJA 2L83A 2MGSA 3T3OA 2F3VA 4F8MA 1VRAB 2KAJA 2RVLA 1SEBD 2QIEB 4PT5A 1UWMA 3C8YA 5EE9A 1IKLA 4KKIA 3S17B 3KLSX 1T5EA 5G3LF 5E1FA 5D3IB 1S4ZA 1SB3C 1IBXA 3FPUB 1TZOA 5H92C 3AB5A 4Z9CB 1OXUA 4BWGB 4RFBA 3BWUD 1K50A 2K05A 4WORA 2WAQB 1LTRD 1KFYB 3ONAB 3S1MB 1BNZA 2WXFA 3P20A 1XF5L 3NS1A 2HDEA 3N9YC 2WINB 1JRPA 5BN5A 3C46A 1MHXA 3GP7A 4TQ1A 1BCPB 1AN8A 2CJNA 3NWSA 2E76C 3M4YA 1RJTA 1JW9D 3ND8A 1SBBB 4LLGM 2F0SA 2RPVA 1JQ4A 4EQNA 4OZAA 1F77A 2XWJB 1DOXA 2XN9C 2G9DA 3OW7A 3AEAB 3ND9A 1RKNA 1RODA 3LYYA 3CKIB 3K5NA 2F4IA 1QOBA 3AEEB 3KWVA 1HZ6A 4M0WA 1XCTL 1AP0A 4K5XA 1DCZA 2CQAA 5ELFA 3E56A 5IGBA 4U68A 5C4ZA 3MA2B 2KJXA 1SYEA 1E2WA 3GV6A 1EM7A 1PTOB 1OFFA 4XQJA 1CA6A 5ELCA 1GUOA 4F88A 1S5FD 3KBXA 4P16A 1H9RA 4IURA 3VR8B 4KN7C 3U9SA 3TP6A