1KTKA

Complex of streptococcal pyrogenic enterotoxin c (spec) with a human t cell receptor beta chain (vbeta2.1)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
203
Chain Sequence
KKDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin type C
publication title Structures of two streptococcal superantigens bound to TCR beta chains reveal diversity in the architecture of T cell signaling complexes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 50
structure length 203
sequence length 206
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ktkA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ktkA01
2XNAC 1KLGD 1KTKA 1L0XB 2IPKD 5ELBA 4NZLB 1EWCA 2AQ2B 1LTBD 5TSSA 1BXTA 1YN4A 1SXTA 1I4QA 1TS3A 1AW7A 3BVZA 4ZYSA 1PTOC 1D5MC 2XN9C 4C56C 1EEFD 1LT4D 3BVMA 4L63B 5FKAC 4L6TB 1RCVD 3O13A 1PTOF 3DWPA 4RHRA 1TY2A 1HA5A 1FNWA 1I4XA 2J4XA 1S5BD 1M4VA 1PTOB 1D5ZC 1EU3A 1EEID 2Z8LA 1CQVA 1YN5A 1I4RA 1RF2D 1STEA 1G8ZD 3EA6A 3KLSX 3R8BA 1PZJD 1FD7D 1UNSA 5FK9C 1YN3A 1LT6D 1S5ED 4DXFA 3TSSA 1HXYD 4RGMA 5ELEA 3R2IA 1PRTC 1PTOD 4RGTA 1V1PB 5ELCA 2RDHA 2XRQD 3SEBA 3R2TA 5ELFA 1DYQA 1FNVA 1MD2D 1PRTF 4BWGB 3BYTB 2TSSA 1LT3D 4RH6A 1SEBD 1UUPA 1FNUA 1PRTB 2G9HD 1CHPD 1BCPF 3URYA 1ET6A 1SE3A 1FGBD 1JWSD 1LTGD 1TY0A 1XTCD 1LLRD 1I4PA 1S5CD 4K6LA 5D3IB 1PYWD 1EFID 3CHBD 1RD9D 4OHJA 1PTOH 1JWUD 2AQ3B 1LTSD 1L0YB 2SEBD 1S5FD 1TS4A 1PZID 1PRTD 3OWEB 1ET9A 1V1PA 1HTLD 1LTTD 1SE4A 3DWQA 1QILA 1JWMD 3GP7A 1JCKB 1RDPD 1S5DD 1BCPC 2IJ0A 2NTTA 4O1NA 1SE2A 1GOZA 1I4HA 1AN8A 5ELDA 2CHBD 2WV6D 2XRSD 1T5XD 2AQ1B 1JQYD 1SBBB 2ICIA 4TSSA 1SJED 1PZKD 5I4DA 1LTRD 1ENFA 1V1OA 1TS5A 1TS2A 4Z9CB 4UDUC 1EU4A 1XXGA 3DWAA 1BCPB 1D5XC 1LO5D 2R61A 1LTAD 4RFBA 4RHSA 2O2LD 4RGOS 1I4GA 1JR0D 3MC0B 1CHQD 3V05A 4RCOA 5D3DA 3W2DA 3EFXD 3BYYB 1KLUD 1LTID 1CK1A 2QEJC 2QILA 1D6EC 4DXGA 1B1ZA 1HQRD 1CT1D 1ESFA 1BCPD 1F77A 1LT5D 1SJHD 1DJRD 2RDGA 3BVGA 2NTSA 4RGNA 3BZDB 1B44D 3MFGA
chains in the Genus database with same CATH superfamily
1N33Q 1KLGD 4NMZA 3CCMA 2INNE 3N1XC 4POFA 3CCJA 3DUZA 4WWNA 2EJGC 1R4NI 5AZFA 3AE7B 1GC6A 3UIOB 2I46A 2ZJQA 3NHHA 5TSSA 1BXTA 2EMSA 4DR3Q 1QZHA 3ZGZA 5FLXE 2IW3A 3Q8DA 2PMVA 4KIKB 2KZRA 4N59A 4ZKBB 1C0AA 1PGBA 2K22A 1FEHA 3HVDA 1YHQA 1N32L 4DR2L 3KBXA 3SU8X 3GDEA 1BF4A 2F0TA 1RCVD 1XTDA 2XSCA 2I0QA 3A4RA 3CF6E 2ZXPA 5D14A 2L4NA 4A3EB 2J4XA 4DK1A 1EF1A 1PTOB 3KFUA 5IP9H 3KUPA 4KKTA 4C7ZA 5T1IA 2KVZA 3ITPA 5FJ8G 1I6HB 1WTVA 4H44C 1Q86C 3D6CA 1STAA 3QR8A 1OXSC 5IODA 4BOZB 1Z9FA 4B0EA 1G6ZA 4NY0A 3PPAA 2CVRA 5M3FH 4AIMA 3QO2A 1Q0WB 1VF7A 1K52A 2X8XX 4EZKA 1WFYA 4FBJB 3T8MA 5ELCA 5C5LA 4GN3B 1ZEQX 2JXTA 5IYDG 1DXMA 4EQOA 4K0KL 1E24A 3E9HA 2QIEB 1HZ9A 3FRPB 3S2HB 2MGSA 3KWLA 4AOFA 4LFCL 2F03A 2K5HA 2JA7H 2HD5B 3U9OA 5H1SE 2F0QA 2K14A 1TBEA 1XLNA 1KDAA 1FNUA 3HOWB 1X6OA 2LKVA 3JSVB 1YZ6A 2CR5A 2C5CA 2OEOA 3WA0A 1LTGD 4CYEA 1WZ0A 4GLSC 3RMKC 4DNIA 3EC8A 5EGTA 4ZK9B 1SRUA 4ODGA 1SGHA 1SSOA 2ZXRA 5EE9A 4FXDA 2N8NA 1B50A 4GKJQ 1S5FD 2X69A 1E2VA 4LCDE 4MGKE 1YIJA 5JJZA 5JEAH 2EY1A 1XF5L 2NB0A 1MIUA 2GLSA 2QF7A 1L0WA 3G6EA 1RAXA 3N52A 4XYQA 1VJKA 1YJJA 4BBNF 1PMRA 2HD3A 3OJ3A 4MJSA 4MACA 3A8JE 3HGBA 3STBC 2WXQA 1JB3A 2F0HA 4O2DA 3U4VA 3GE3C 1P7EA 4ZYNA 3Q14C 4K2KA 1LUZA 2K5DA 4J1MA 4A3EG 1IKMA 3R3OA 1VCBA 5F2DA 3Q23A 2JWZA 1RKNA 5C3WA 2LGYA 4A20A 4R4QA 1SJED 1UE6A 1V2YA 2NYZD 3DEPA 1ENFA 1UAPA 2X6LA 1TS2A 4HCSA 1BQQT 1EY7A 4R1JA 5I6YA 1OGWA 3W5OA 4FYDA 2BGFA 3W1YA 2RBMA 3KLSA 3HIZA 4B9XA 4II3B 4MTKA 3L9AX 5FLXc 2LHDA 4R4OA 4HIOA 4MM3A 2MFIA 3QJYA 2HTHA 4W9IA 3E6ZX 1E1OA 4O42A 3MHBA 1HNZL 5IAAC 4PMWA 3T13A 3S16B 1TWHB 3L2PA 4IFDI 3ZJYC 2RSOA 3ZDMC 2RMMA 1XQQA 1S4ZA 3MC8A 3CMEA 1EY6A 4OO1I 1ENCA 3B1LX 2Z0SA 1IYVA 1J7BA 3P1HA 2PCFB 5EQ0A 3HOWG 3URYA 1Q82C 3IT4B 1X65A 4HJ9A 3KYDD 4L2YA 4DU9A 4DA2A 1WMHB 3HM6X 3N3KB 4JV5Q 3D4DA 1OTCA 1ZOYB 4LW1A 1EQQA 2DAFA 3TCAA 3NBHB 5JZEB 1I50H 4LFAQ 5ELNA 4JBWA 3I4NB 4QIWB 1YVCA 2N0SB 3ZLZA 2F52A 2EYOA 3BVMA 1KXLA 2CHZA 2NN6I 3RNAC 3LWUA 5HI1A 4YSYB 3D3RA 3O13A 1UELA 4IWOA 3MXNA 1EY8A 3QCAA 4GU2A 5IT9E 1FNWA 2BKFA 2OWOA 3VHTC 1XLOA 1A15A 3H3VI 3PLVA 2JA6H 5GXGB 2QDFA 2EYHA 1QNUA 1EYAA 2F0MA 4BY1G 2KAJA 2PJHA 3OSOA 4IPHA 4BBSB 4OO1H 1DONA 5C0XI 4GLXA 3H0GH 4YWKA 1IL2A 5EDSA 1HEZE 3BWUD 2JYOA 1C78A 4JBJA 4YY3Q 1MVKA 1P98A 5AFWA 1RLFA 1CSPA 4NPSA 4DAYB 3R2IA 3DLLA 3SK4A 4JOIA 4DR6Q 2Z4HA 4I6LB 3TN2A 1H9JA 4IURA 1MG4A 5CV9A 1WGYA 2DZJA 5C6AA 1LT3D 5EPLA 2Z4IA 5M3MH 1JORA 3CCEA 3Q22A 4LF4Q 4K8IA 1SE3A 1FGBD 1QB5D 4A3LG 3T51B 1K8RB 3GQBA 4GS3A 3PO2H 3WIMA 1FRRA 1Y1WH 2PMZB 4M00A 4A55A 2LHEA 4HMJA 4GDLB 3NSWA 3H3VH 2R7ZG 2QA4A 3GTMH 5IO9A 4LF9Q 3ZTCA 1FCLA 2SEBD 2V4DA 1GD7A 4BBNC 1VQJA 3A33B 4NAMA 2MLBA 3DVGY 2GA4B 1YX6B 1N9WA 1KAWA 2F0SA 5AUKA 5MPOA 4IUNA 1TR5A 2BPSA 3F1ZA 1JQ4A 3EECA 3DBLB 5I9PA 1N5XA 3H9DA 3DM3A 3M4QA 1ZGUB 3CIRB 3RMHA 1E2WA 1VLBA 2WFWA 3K5MA 4B08A 4JOIC 1XNQL 3U7ZA 3DXJC 5C3EH 3W1BA 5FR6A 1IBXA 5BN4A 4OWTB 5AJ3Q 4LK1C 4YWMA 3NTIA 1TIID 3L17A 4XDXA 4OZAA 4QUFA 3DCGA 1Y8RC 4LJPB 1CKNB 4KI0A 3HUIA 3CF5A 1V5TA 2N9XA 2N9EB 2D11A 2C7MB 1PH6A 1WTXA 1NEKB 1I94L 3I9V1 3APCA 1SMYD 4JI0L 1VDVA 2INCC 1S3SG 5EE0A 2JZZA 3HOZH 1AYFA 1YNJC 1ZYRC 3AFPA 2F0WA 1KOTA 1YITA 3EIVA 4WURA 3MEFA 2XNAC 3M4YA 5JOBA 3K58A 4EE2A 2MCNB 1Q12A 1VQIA 3N6RA 2Q2UA 4ANVA 2F0IA 2KCTA 2TMPA 1EOVA 2UUAL 1XNRL 2GB1A 3K80C 1AZPA 4NQKE 3D8GA 1HZBA 3A1QB 3NUHB 2LXAA 2LZ6A 4G7ZC 3L0WB 4YCVA 2N1VA 4BFRA 1D5MC 2CKHB 3M63B 3GE8C 3H7PB 4L63B 5DM73 2NBVB 3UQAA 3RFZB 2REXA 5DPWA 4B95A 2IBIB 4AQYL 5CX3A 1H9SB 2Q2HA 5JJKA 4QL5A 2WXMA 3UDGA 1I4XA 2BH8A 1EY0A 5IGDA 1XYIA 5C44B 1H9KA 2L0TA 1WCMB 1KDBA 4KGSA 1FJGQ 1LGRA 3S1MH 3S2DB 1W6JA 4QJFA 2CQOA 1I4RA 1FO4A 5JJIA 2A6HD 3J81i 2KOLA 1VMPA 1SDFA 3R8BA 2OJRA 1KIXA 3S15H 4X3SA 1IGCA 3NK9A 2JE6I 1R7SA 3ERQA 2K5NA 3PO3G 2NVXB 1V81A 1LT6D 2EYMA 4JPSA 1HCZA 2Y0SG 5EKKA 2C5LC 4PZ7A 4EX5A 4ZRPA 2MJEA 3UI3A 5E6PA 2IX0A 3E9IA 4C1NI 4FJVB 4E74A 4DNRB 4HTHA 2VUMH 2J42A 2KWUB 3T53B 2V4IB 1PRTF 2K32A 1J6QA 4Q0FA 3K8AA 3CC2A 3C0RB 1NNXA 1BVSA 2TSSA 3NPPA 5J39A 3FVQA 3GTPB 1L5PA 2Y5CA 3T1YQ 2ZZPB 4X62L 2FHTA 4GGQA 2LGIA 1QUQA 1QVFA 5J1ZA 1ET6A 2JT4B 2E5LL 2KTFA 4XYCA 3OJ4B 3MXPA 3U52E 3DMUA 4DK0A 1J19A 4ARCA 4HIDA 2B2UC 4A3IB 1X9NA 4CJ1B 3OW7A 3M4OB 3KF8A 4C7YA 5D94A 1J9OA 4ZDVA 5E6JA 2PW5A 1ET9A 3K5OA 3TDQA 1HTLD 2Z59B 3ULLA 1GKHA 4WORA 2XEWA 2FXQA 4GNXA 4HPLB 2UXDQ 1N34Q 2JY6A 1HZAA 2IJ0A 1XEEA 2V3NA 3IFWB 4XWWA 1GOZA 2VS1A 3P1MA 4C3IH 2ONQA 5C44G 1HA6A 2FCSA 1T5XD 2AQ1B 3OMCA 4IUVA 4A8XC 2QEXA 2O4XA 4O0AA 4TQUS 2VQEQ 4DV7L 1RYJA 1WGHA 2E2IB 4JWSC 2M17A 1VQPA 4GB9A 1DOKA 4P2CB 4A3JB 4CDEC 2QGQA 1ENAA 1RJTA 1V9PA 4S0RA 4FULA 1ZPSA 1CHQD 4IUTA 3RUZA 2LJ5A 4FF1A 1PFNA 1UBQA 3AMUA 4EOYA 4DV1Q 5J17A 5E6NA 1U5KA 3PCOB 4DUZQ 1SYBA 2KANA 1GPXA 1YJ9A 3F2UA 3GTKB 3VR9B 4IN3A 5KRUA 3MHSD 2WIIB 4TVAB 1EY5A 2KHWB 1CT1D 1H4RA 3HHMA 2L00B 2L3ZA 4NPNA 2F3VA 1DJRD 4KHZA 4DR1Q 2YU9H 2KD0A 3CRKC 1WVLA 2R93H 1D2BA 2RR9A 2W3SA 2ZNVC 2AUKA 3TS0A 2PVOD 3OIQA 3EROA 3QOJA 3QWNA 4GNXC 1Q1OA 3HKZB 4A3FB 1I42A 3OMGA 3AYHB 1Z7TA 1XLPA 4ULLA 1Y1VB 4X66Q 4K3CA 1TWCB 1N33L 4P16A 1R4MI 2WWZA 2LD9A 3J81L 3AFQA 1LT4D 2E75C 1C79A 2ZW1A 5M5YH 4HJAA 2GBMA 4OXPA 3NELA 4DR3L 4GOCA 2KWCA 4X3TA 5CHWA 5LL6X 4IUMB 4IJLA 4AQ7A 3MC9A 2ID0A 2QDBA 2O2VB 1STNA 2WAQE 1S5BD 1S40A 1PDXA 1J0GA 1IBLQ 4IOIE 1AARA 1MBYA 1G8ZD 3U30A 2K8CA 4ACFA 5AEKB 2UYZB 4HCNB 2A68D 3EJIA 3W1GA 1RHPA 2I2YA 4MZ9A 3BDOA 4A3JG 3PMFA 3KDFB 2CW0D 4DXFA 1FPYA 4G7OC 1HXYD 5IYBH 2MW5A 5ELEA 1PRTC 3S17B 1MPEA 3NG0A 1FIQA 1HR0Q 4HJ5A 2RDFA 1MJDA 3H3VC 4A90A 3WAMA 2NWGA 2YTYA 3PO3H 4TKOB 1L4DB 1SYFA 4MDKE 2M0XA 2SNSA 3I8ZA 3M3YH 3S1RB 1K53A 4RH6A 4EZJA 1JWAD 2R2QA 4HKZE 3UINB 3G6JB 2B29A 4F7ZA 3E5SA 2MUYA 4D2KA 3LNNA 4NJ7A 3E9SA 5DM63 1NR2A 3VR3A 4Y7NB 3AEEB 3GZNB 1PYWD 1GJXA 1EFID 1G6PA 4W9CA 2ZCBA 2VB3X 1XWEA 1YNNC 3NP8A 1T0YA 4MH0E 1OEYJ 2XK5A 4HEDA 1K9MC 3LB8C 3GB1A 1FYCA 4PQXA 1Y1VG 1TWGH 2K50A 2P5ZX 5M5WH 1Q5WB 3NVZA 2JQRB 1C4CA 1IUEA 1L6UA 2LMCB 2KX3A 2E2DC 3GV3A 5HGQA 2I5HA 2NVTH 3J9CA 3RZOB 2E2HH 4GKJL 3KWVA 5HKHA 2CH4W 4MGIE 1A63A 3FKIH 1LYLA 5EBDA 4H7BA 2D5GA 2KT7A 4A3GH 3SD5A 2DY7A 3AQQA 1SE2A 4GDKB 4AYBE 2K9XA 4QAYA 5BYRA 1I4HA 2LXJA 1ASYA 2CCZA 3Q3FA 1O7IA 5K5PA 2G9DA 1OO9B 4HWIB 4JBMA 2K28A 1PHJA 3MJWA 3LGJA 3DDCB 4TMAB 2F0LA 1YI2A 3IAYA 4JI6Q 3I57A 3NHEB 3B2GA 2M4NA 1MHHE 1N6ZA 5TR5A 4RGOS 4AJWA 2BYTA 4ILWA 3ZNGC 4US9A 4RCOA 5EAYA 2PZTA 3J7AF 1HUNA 3N20C 5IYCH 4LNIA 4LK0M 3A7AB 2CS4A 2B2YA 1V9JA 3A8KE 2X6GA 2KC1A 3NQIA 4IJHA 1I5FA 2Q8TA 4IM0A 1PH1A 2A1AA 1KL9A 2K03A 2PTLA 4QMGA 2PI2A 1K8MA 2NVYH 2DBYA 5LMNW 3L0OA 1WGDA 3PSIA 3KF6B 2RD0A 5CHFA 1L0XB 5G5GA 2IPKD 4L5TA 1G291 1UWMA 4BS9A 1WTWA 1P7FA 4YTPB 5BO4B 3ZJUA 2MP2A 3T3NA 4XT3B 3BU2A 3HFZB 1EUVB 1TT2A 3V62A 3VYUA 1PV4A 3SVMA 4KD4A 2JA7B 2EY6A 2O6VD 3CRLC 3NE5B 1OFFA 1SYDA 4DUYQ 1VF5C 1M1KC 3ER0A 4JV5L 4GN1A 1VQDA 3NS8A 2KMCA 2WX1A 2Q8IB 3Q8CA 1ZXHA 1U0LA 3TP5A 3A0JA 3VH3B 3Q3JA 4IPCA 4LFAL 4P73A 3RYTA 1TY2A 3I56A 1XJVA 4KKIA 1HA5A 4ZUIA 1B4OA 2Z8LA 1TTNA 3IFDA 3SHQA 5GAGC 3QG1A 1J5EQ 2WXFA 2B2YC 3EA6A 4MSMB 2JVCA 2MBHA 3ZRCA 1C8CA 1JJGA 3X0WA 2ASQA 1K83B 5FK9C 1ZXIA 1TXYA 5BMHA 3I7FA 3I4MB 3TRZA 4DKAC 3VA7A 3RZDB 3H6NA 2FFKB 1EF5A 2BB5A 2L8JA 2RDHA 3MP9A 3HOUB 3J81j 1VQ6A 5IP7H 3V61A 3PRPB 5D2MB 5JHBA 1I35A 5IP9G 4YY3L 5JHAA 3MFYA 5IOCA 4HJ7A 3CSFA 2R92G 2FMCA 3PHWB 2E2JB 1UH6A 2FNJB 1WFQA 2X38A 4DR6L 4DAPA 2B3GA 4YHHQ 1QLBB 2KC2A 2KMMA 4X3KA 2B39A 3A9KB 1KAAA 1XTCD 5M3FG 1LLRD 1STHA 1S5CD 3Q24A 1ILPA 1UF0A 2WGSA 3N1ZC 4WWMA 3X23A 2FE8A 5HGTA 4IOCA 1JJ2A 3DVNU 3NRZA 2AQ3B 1LTSD 1TU2B 4LF4L 1W3SA 5LMUQ 3DHQA 3W5UB 1MI0A 2G1EA 4AJYB 4M0WA 1PZID 5BMGA 3K7AH 4X65Q 4CDFC 4DV5Q 2JA7G 2MWSB 2AEHA 3W5VB 3Q8BA 3DEOA 1SE4A 2ES2A 1ZXTA 1CUKA 4LF9L 2MA9B 2QJLA 2YVCA 4I7AA 2KJXA 4B0MA 1V97A 3G7LA 2I5LX 4F87A 2DYBA 2JUOA 4LUVA 4HEA1 2KCMA 4PZ6A 4BVUC 1T3QA 1XLQA 2AYOB 1GM5A 2FJ2A 1B7YB 2KLGA 1TGZB 5KHQA 4HK2A 2N9KA 5FLMH 4A3MH 3PHXB 4YTMB 2I5MX 2RHSB 3WWVA 2NPTA 1AZQA 4YSXB 1S3OA 3M7GA 2K5WA 2R3ZA 1BUVT 3I4OA 1S72A 1MG8A 1TS5A 1EZ6A 5CV4A 5JEAG 4GDLA 4OZBA 1UE5A 2JA5H 2N55A 4RHSA 3J81c 4S17A 4KKSA 3JYUA 1ESRA 4JBKA 3W2DA 1I6VC 4R4CA 3S1QH 3HZXA 1RWSA 1XD3B 4ZRZA 3FILA 5AJ3L 1VQCA 2JA8H 1WH3A 2LGSA 2L0FA 4G0NB 4HXDA 3W9CB 2MHJA 1HUMA 1C1YB 2IT1A 1VQKA 1BUIC 2MNAA 3ONAB 3AE2B 2KK8A 1L2FA 3H0GB 4MGZE 3OAWA 1GUWA 3I3CA 1V5OA 2ZJPA 1EO6A 4AWJA 4BY7H 3TP8A 4A3PA 1OXTA 3KBGA 2KTRA 1WR6E 2DNEA 1YNND 3D4WA 2DWQA 2DYOA 2HE7A 4UP7A 1AW7A 4A76A 1YMHE 3AI5A 5LLIA 3I72A 1DOYA 5DPTA 3VR2A 4QUCA 4RF1A 4PNYA 4L6TB 3EVQA 2PEAA 2GBJA 3C46A 4XC2A 4USAA 2Z1CA 2K0PA 2C35B 4JE3B 3D6WA 1NAPA 1Z5SB 3PO2B 5C4JB 2IO1B 4P6VF 1Y1WB 2BVCA 1QWYA 2F0FA 4MH8A 3NQTA 4LF8Q 4DXAB 2NBFA 3H94A 1WYWB 3NUCA 4ZRQA 2B63H 3UF8A 4FA6A 1TWAH 3BINA 2RCFA 1EM7A 4LFBQ 1FJGL 3L3OC 1RM6C 1ZP0B 1YJNA 5EPJA 4L5SA 4IOAA 2EE1A 1PTOD 3C2PA 1CMXB 1U4AA 2J7QB 3H7SA 4N9F4 4DWFA 1D3ZA 1FXIA 3L08A 3SEBA 2EELA 2BS2B 4L23A 1D1KA 1FNVA 5AZHA 2JA6G 4GIVA 1HZ5A 4M02A 3V96A 2L12A 2LS01 2CU1A 3AE3B 1PFSA 3NJTA 4RKBA 2JWUA 4WFN3 2J0KA 1IXRA 4XT1B 4OO1G 3AE1B 3IL8A 3I2ZA 3S9WA 1JW9D 1CI3M 3H0GG 1JWSD 3NTKA 1IYUA 1E90A 1E7UA 2R92H 4I7ZC 3CCUA 5AZGA 2OT2A 3A5UA 3T1YL 4LNQA 2BWFA 2HDMA 2EPBA 1VQAA 1CA5A 2KFKB 4ZRJA 3A74A 4NAWA 1WTOA 4J15A 4W9GA 2RDBC 2JEBI 4YSZB 5C5MA 3QIAA 3FEWX 1NJIC 3HOZB 3DWQA 4XDDA 3J80i 4HDOA 2VZKD 2JX5A 5M3MG 3N1YC 1ICFB 3GOEA 3MWYW 4QY7A 1LABA 1SMYC 5C23A 2L7RA 2AX5A 3PO2G 1Y56A 1PH9A 1Y1WG 1SF0A 2H1EA 3J7A5 4F88A 4GOPA 4A75A 4JVZA 2L9HA 1N34L 2UXDL 2VH2A 3AE4B 1C9OA 2L0CA 4TSSA 1PZKD 3KK7A 1SB3C 3KH0A 4WH4A 1O7YA 3KLRA 4AYBB 2JQOA 3VRAB 2WAQG 1BCPB 4NDXA 2O5IC 3HK0A 4DR4Q 1U9RA 1VQFA 1Q90A 4ZUJA 2VQEL 3BK2A 4MELA 1PQSA 2D0PA 2XWBB 3ND8A 4W9LA 1EYDA 4N8X1 2AWNA 3JC66 5E4WC 3BYYB 4B3MQ 1X3EA 1ROEA 3VUWA 1CKOA 2QCZA 2WX0A 1CK1A 4JQWC 3TEHB 1D6EC 3S1MB 1NDDA 1RFKA 4ANWA 1Q1EA 3LXFA 4NXMQ 1QVCA 4DV1L 1B9NA 3TZDA 2IDYA 1BOSA 2N7DA 3VR6A 1YJIA 2K25A 2WKCA 2G45B 4DUZL 2WQYB 5C3EG 1EYCA 2K39A 4FF3A 3C8YA 1NTGA 3RNBC 3TIXA 2KUMA 1R4QB 4JCVE 1SSNA 1YIWA 2CH4A 4XYOA 3GTQB 1RFAA 2Y3AA 3SDLC 1UEAB 2A6HC 4BY1B 1EIGA 1Q7YC 3L54A 4DR1L 5I9OA 4MHEA 1RRBA 3V2TA 2BB6A 3U2SC 2M2LA 4AH6A 3AU7A 4Q2JA 4OGQC 3JAMi 4ZYSA 4EQPA 1SE9A 4GOPC 4NQLB 1WGKA 3M3JA 3ZW3A 1WJ6A 2Z0DB 4N6EB 1V80A 4X66L 4LUZA 4JK1C 4K81A 4JI7Q 3F2DA 1FCCC 3U58A 2L15A 1RTOA 5J22A 4A4IA 3Q0AA 3HOZG 1F9RA 4J8QA 1TWFB 1CFMA 3KJOA 1ICWA 5J2RA 4RG1A 1PXUA 1EU3A 3HRDD 1EQVA 2KVMA 2JP1A 2N9PC 1DOLA 2YTVA 2JJQA 2UU9Q 4DGZA 3P2BA 4YCUA 4LWCA 2D3BA 3TEWA 1TYGB 2QCPX 2NZHA 3NVYA 4AYBG 2R7ZB 1IBLL 2YTXA 1UGJA 3LYYA 1NBWA 1AEXA 3AB9A 2D07B 2KWVB 2V3PA 1UZXB 5BMIA 1G2TA 1HFNA 1WX8A 5ISRA 4PT5A 3H1UA 1VQ4A 4LDTB 4DAMA 2PW9A 4C3IB 4IZ8A 4RAUC 1OXXK 1NMGA 4BWGB 1JMCA 3T1HQ 2KDFB 1HR0L 4JX1C 4AS1A 2W54A 4APVA 3WOFA 1SEBD 2O2VA 4HRSA 3GTLH 4WJ4A 4FHJA 2NVQH 2Z9HA 2B8FA 4OONA 4UHVA 4NNJB 1D8LA 2PQAA 1A0IA 1F9QA 3C1EA 4A93H 1GHJA 2PO4A 4DV3Q 2MH7A 4IM3A 4IFDH 1L1OB 2UU7A 3Q3OC 4CKBA 1WXSA 5J18A 5DAUA 3PUWA 4BXXH 1II3A 2VUMG 5I2YA 2JSOA 2SOBA 2CQAA 5I6WA 4BA2I 3RNFC 4XTCS 3OWEB 3VDYA 2YU9B 3IG3A 4ANXA 3GO5A 2R93B 4IO9A 2KECA 3DVNV 2KLCA 1WZ3A 4WRDA 2GN5A 1L6VA 1K50A 1E10A 3RN9C 2F4VQ 4TQ1A 4IALA 4MTNA 1LTLA 2NN6H 5KYIA 2CHBD 2XRSD 5COYA 1C77A 2GBRA 1LACA 4R8NA 3L4PA 1LTRD 4MSQB 2LJIA 4UDUC 3HP3A 1HH2P 2F0PA 3E56A 5IP4D 1BDOA 4R3DA 1SNDA 1E1TA 4HSVA 4C4VA 1JE4A 3PIO3 4KZCA 2IY5B 3L7ZC 2FUG1 3GV6A 3PIPA 2GI9A 4JI6L 2LVQA 5M9OA 3TBIB 4REZA 1SR3A 5C0XH 1YX5B 1R9TH 2M8SA 5IGEA 1JT8A 2ZJDA 4C3IG 3CC4A 2AWTA 1HQRD 1STBA 1ACCA 2MBQA 1TZ1A 3JAML 2C7HA 2ZPYA 2ZEQA 4NJ6A 3QX1A 3I63C 3PV1A 3BVGA 2ICEC 1T0QC 1FL0A 3DBHB 2A68C 1BT0A 1ZDVA 4ME5A 4PS7A 1SNOA 4KV6A 3PO3B 2R7DA 4XQNA 2CW0C 1W6KA 4DF7A 1ISNA 2Y0SB 1QG7A 3N32A 1GO3E 2D3CA 3BVZA 4HJGE 1N5WA 4KN4C 1M8AA 3M3YB 1D1IA 3B6YA 2K05A 3C19A 1K3RA 3AXCA 3VTUA 1Q3LA 1DGJA 4EGVA 3T3OA 2R93G 1VQEA 2RVLA 4PV1C 1JE5A 1WYGA 2IZVB 1GC7A 2WLBA 4DUYL 1E22A 5BR8Q 5CV6A 3EFUA 2ZTCA 1K28A 3M85A 2ZTEA 1CQVA 5G5HA 3VR5A 2B8GA 1TWGB 2WB1E 3VA5A 3KF6A 1B70B 1M94A 2WU5B 3AU4A 1KD1C 1CM9A 2DY8A 2RCNA 2WP9B 4CGYB 4XE0A 1WE7A 3WANA 3ECIA 2VL6A 4WJ3M 2L32A 4LF5Q 2NVTB 4B9KA 1J5EL 1I6HH 2K5VA 1NR4A 3VAWA 5GAHC 2DZKA 4A6QA 4K7UA 4YWLA 4DHZE 1KRSA 4WJWA 4B3TQ 1T0SC 3CKIB 1MFWA 2CU3A 4RF0A 1E7VA 2D3GA 3CU7A 1Q8KA 5J3BA 2LVOA 1P8LA 2L1BA 3FDTA 1E9MA 5C4XH 2EY5A 2N7JA 1UE7A 5DLQE 3N9YC 4TKNA 3NBIA 1QE6A 1EIHA 2K7VA 3X3MA 1KRHA 1HNXQ 1F52A 2O6VA 2Q5WD 4HJKA 1I4PA 3NVWA 2IL8A 2SDFA 4HAEA 1B3QA 2A5UA 5DCNA 3BJUA 5IYBG 2OQKA 4KZ0A 1RD9D 4OHJA 2N1WA 3A9JA 1IW7D 2H5XA 4YHHL 1WIAA 2RGFA 1CKMA 2Q2IA 3W1SA 3DBRB 3NWSA 3CW2C 1WRDB 3HM3A 3V3XA 1G91A 2FUHB 2EJMA 1Q10A 1IYFA 4MT5A 1P9DU 4IC7B 5K36H 4POGA 5HFYA 2IO2B 1GAQB 2WXOA 4ZQ3A 3H8HA 4ASWC 2EOTA 5FOBB 1OQYA 2NVYB 5LMUL 2XIWA 1XPOA 1SAPA 1JWMD 2BE5C 3C1FA 1JCKB 3GP7A 1JMLA 1YQBA 3BY4B 4PMCA 4X65L 4DV5L 5LMNQ 3A8IE 2RF4A 2QW7A 3GTGH 3P4SB 2KDMA 2ZM6Q 4W9FA 2A19A 2WV6D 2W55A 4BZAA 1SBBB 4KVGB 4A3KH 3S1NB 3PLUA 5JH5C 1WTPA 1N32Q 1XT9B 1P16A 3RD2A 2R61A 1AFPA 2CWAA 3A4SC 1PA6A 3MTSA 3P42A 1KC8C 3FKIG 4A3GG 2RA4A 2F3WA 3W1SC 3DPDA 4P72A 2BS3B 2A69C 3AECB 1C4QA 2F3IA 2AWOA 2KMAA 4FDBA 2RPVA 1VZ8A 2ZW0A 5IE8A 5M5XH 3RUIB 1UGMA 1IGDA 2K04A 2ASBA 1DD2A 1NENB 1K0SA 1MJEA 1HZ6A 5T8IA 3BDCA 3D0FA 5GQOA 1UE1A 3NENA 1XPRA 3T16A 4F7XA 4LUOA 2UUBQ 2XBBC 2H89B 4K5WA 5IYCG 4M8NA 2J0MA 4IWPA 1I4QA 5IIFA 1PH2A 3OHXC 2WXRA 3CQZB 2MBBB 1QOGA 5HHDG 1JRUA 1EOTA 4MJSB 3MA2B 2RHQB 2CHXA 3QIJA 2UWQA 1F2RI 1LQBA 3VYRA 4NKLA 1KHIA 1IYJB 1PTOF 2B2VA 4BBRH 1U4PA 2L11A 2PW7A 3DWPA 3I4NH 4ANUA 2XGTA 4JW0A 1UWXA 1WX7A 1GVPA 3QQ8B 2UXCQ 4G11A 3U7DA 1E0BA 2HQEA 2D2QA 2MJ8A 1CZGA 5CBAE 3ZKJC 2WXNA 3WAPA 4I6PA 4ZHPA 1S1QB 3IBEA 3FPUB 4QB4A 3AE9B 5D65A 3WDNA 4X6AH 5EBCA 3K7AB 1PZJD 2KX0A 2NVUI 1H9RA 4LF8L 2ZVOA 2ATWA 4HPMB 4DBGA 3CD6A 3QOLA 4GLVB 2ALYB 4RGMA 4BBSH 4WQOB 4A3CH 1EY9A 3SHLA 3QHTA 2B2TA 4V0BA 4LFBL 2JXXA 1VRAB 1WTHA 3FHWA 2LFIA 2BA0A 5GMVA 2VQFQ 4A3MB 1QZEA 4YXDB 5GADC 2LASA 1WJ4A 3DBLI 2DJFC 1FVIA 1ZKOA 1V1QA 3APDA 4DHJB 1EWIA 2EYFA 2J53A 2RPQA 4KGRA 1JOKA 4UP9A 3QARA 4N8FA 2B3AA 2K1FA 3R66C 2DGYA 1BCPF 4C3JH 1QQRA 1TY0A 1YHAA 1CZPA 1MSHA 4ITKA 1PGXA 4CDDC 4Y52H 1CJEA 4C2MH 2B2VC 2M0AA 1QOAA 4HROA 1E8YA 1PLFA 1WTQA 3NS1A 3C3LA 4OL7A 4RMFA 2JA8B 1PFBA 5IY0A 5G2NA 2IHFA 1QKZA 5IP7G 4KIKA 4QGUA 4FXCA 5GROA 3UE0A 1BBWA 3JAMc 1MGSA 1WJNA 1EWHA 3MXNB 1F9JA 2KYWA 4BKGA 4BY7B 2IO0B 1FFUA 5LXIB 4IKGA 2RQXA 2ON8A 2CKZB 2VZAA 1SNMA 3G4SA 3I91A 1M90C 2B2TC 3QWZB 2G3QB 2N4FA 4HSPA 1EWYC 3IAS1 5I4DA 4RA8A 4UPAA 1VQNA 3PZDA 1EYGA 2NBWB 1DOIA 2KA7A 1PUTA 2B76B 1LO5D 2WDVB 1X3QA 3CCLA 2WXLA 3AU5A 1BKBA 1JR0D 2VH1A 1C7YA 2W3RA 4CJ2C 3NZSA 5FO8B 1SIFA 3EFXD 1KLUD 1DZ1A 3AULA 2WS3B 2V3SA 4DR4L 2QEJC 3P20A 2BCOA 5FLMG 4A3MG 1XMQQ 3VR4A 2IX1A 2BYVE 2V9HA 3BG3A 4B3ML 4L1BA 4LF6Q 3GTJH 4KJNA 1W2BA 3PF4A 3RT3B 5KHOA 3JSVA 2JA5G 2OQ0A 1GHKA 4WWPA 4F1SA 4NXML 4CHTB 3ZXRA 4GKKQ 1NE3A 4R4IA 2AQ2B 1Z6HA 4DR5Q 1VQ7A 1JB7A 1LTBD 2LUMA 2JYTA 4XZ4A 2BQQA 3K57A 1L4ZB 1YN4A 2L1AA 1HFGA 3HG9A 1IP9A 2JA8G 1EL0A 2IY1B 1FM0D 1PTOC 2XN9C 2OTJA 3RLNA 4L8JA 3GD7A 2KQ3A 2F0VA 1GXDC 3R3MA 2DHZA 4JPBW 3OWFA 3UDIA 2KJ6A 1YJWA 2KACA 2KJHB 4IFDJ 2LRUA 2BE5D 2R92B 1HZCA 4DK5A 4G57A 4BY7G 4JI7L 4RCNA 4MNOA 2GBKA 5IWAQ 1XCTL 3AMZA 5M3FB 1IBXB 3L16A 3V6CB 1PYSB 5EPKA 4DN4M 1V6EA 3TMEA 2IO3B 1WCMH 4KSLC 3MEHA 1XMOQ 3HOVH 4KDIC 1UNSA 3J81E 4KSKC 2EYPA 4ZRKA 2Y5PA 2BYEA 3JW0X 2FIFA 3PV0A 1SNPA 2D5DA 4LAAA 2UU9L 4LNOA 3B0AA 1V1PB 2I07B 2J0TD 2PI2E 2K6QA 3FP9A 2WNMA 2JPHA 3P4QB 2XRQD 3TS2A 3WOEA 2VB2X 1AH9A 4JG2A 2M1MA 3DM1A 2WKDA 2B63G 3TREA 1EUJA 3CXCA 1WJUA 3ML9A 2A69D 3TEZA 4ME3A 3MZ5A 1QVGA 3IAM1 3UE1A 2SAKA 2MP1A 4M1UB 2QDLA 3OPOA 3S24A 1HRJA 1JJCB 4JL9A 2Z6BA 4HN7A 2K6DB 5D3IB 5CBEE 3T1HL 2DUDA 2MQHA 3PIP3 1F2LA 2L52A 1Y8NB 5KGUA 4RMAA 3F8TA 5C0XJ 1WMHA 4BKSD 1X32A 4GSWA 4CO7A 3PUXA 5EKLA 1O78A 2BS4B 4DV3L 4JI0Q 3NBHA 4FADA 1A2UA 2EY2A 4DV2Q 1YEZA 1BR9A 4A3IH 3KOJA 3V6EB 1EIYB 5L37A 2ENBA 3IRBA 3K9PB 4IM2A 4IPDA 5IN7A 2I1KA 2WINB 4HCPB 4JWUC 3HOXH 4W9KA 1B9RA 2PZUA 4XXEA 1JICA 1FXAA 4LJZC 4R9WA 1EQTA 2F4VL 4X3UA 3CSTA 4QIWE 5GAEC 1L1OA 1I7HA 3TQYA 1VQOA 3FMCA 4B3RQ 3QB3A 1T6BX 3HOYH 1D5XC 3CPWA 2J0JA 3PT2B 3Q2AC 2MSED 4KV2A 1I4GA 4DAVA 4IW0A 2M00A 1P0RA 2L83A 3ETRA 1WF9A 1KJTA 1PYBA 3L13A 1YNXA 2MHVA 3D31A 3MXGA 4N9TA 4DAYA 3RNUA 1PH8A 1E7PB 1WI0A 2INDC 2ZT9C 4S3SA 4H2AA 2QILA 1YHBA 3ZNHB 3AE5B 3M62B 4FO2A 3RZWC 3K0YA 1F77A 3I5JC 1QUQB 1F2YA 2KHSA 4KHVA 2EDGA 3KJPA 4URKA 1GUNA 3CC7A 4RGNA 4G3XB 2LY7A 4K2LA 4OX9Q 4P7IA 4LNKA 2IGDA 1ML0D 1KTKA 4KKJA 2M19A 2L05A 4IQZA 1UWVA 1I50B 1EWCA 2JN4A 2H88B 2NZ1D 2JRIB 4YL8A 2DZIA 3KF8B 4QCLA 3AV8A 4LJOB 1EFWA 4A3FH 3AEGB 2F0DA 4H02A 4K8JA 5H92C 4RM8A 4GNXB 3NVVA 1CTMA 3SK5A 1TWCH 2O5JC 5CMDA 5BN3A 3GTLB 3E0JA 1U4RA 5JPMC 2NVQB 1HE8A 1OQRA 3NZ3A 3BZCA 4EZLA 3RCZA 2HIXA 2QMTA 2JA6B 4TV3A 1J7CA 4BA1I 1NI3A 1V86A 2HJ8A 4A3BH 3MVVA 4JI2Q 1N60A 2PMZE 1KLVA 4KKUA 1IL8A 5IKCM 1D5ZC 2IY0B 4JI3Q 2LXCA 2A8VA 1IZ6A 2EYJA 3GZNI 1STEA 3KLSX 4EUTA 3DHIC 5BR8L 3RULA 4WIPA 1VZ7A 1BBXC 1F2RC 1ZW7A 5G55A 2OEDA 1E0ZA 4LF7Q 1B2TA 1YN3A 2R2OA 5NUCA 2FMMA 2Y5BB 4JI8Q 4ZCKA 1E8WA 2M56B 2HIVA 3PUYA 1VQLA 5LL6S 3RLOA 3NXWA 1NYQA 4LF5L 1WGGA 2WDRB 1CKNA 5M3MB 3L10B 3P63A 5IA7A 1A70A 1EZ8A 1KRTA 5KNBA 4DQOC 1SYGA 3S17H 1MHWC 3BYTB 2FINB 1LFDA 2N3SA 2CJOA 4XX5A 4B3TL 2DNFA 1Q46A 2JK8A 1PRTB 3KLWA 1WM3A 1BNZA 3GTMB 1VD2A 4OWWB 1K73C 3EGRA 5G3LD 3WCQA 1I3QH 4KD3A 4GN4B 1G2SA 2KQ7A 4PG3A 2WAQB 4XWTA 4RNAA 1JWUD 2MRPA 4IUPA 4WJOA 3SFDB 5CC4A 1HPCA 2QC8A 1HNXL 1R9TB 2OXPA 3A1QA 1IBMQ 1KDCA 4OIKA 2V1YA 2F0NA 2FIDA 1TS4A 1HNWQ 1JRPA 1KNEA 1K8AC 4E3CA 3TP7A 2OTLA 2KHIA 4LNNA 3SR6A 4DR7Q 5KNCA 1RTNA 3H7PA 3K9OB 5C3JB 5EE3A 2E74C 3KYHC 1KQSA 1H9SA 3J7ZC 4A93G 2KFJA 1PH7A 3ZDTA 5C3EB 4IFDG 4P1BC 1Q8IA 3RZOH 1AN8A 2F4IA 2OHFA 3ABVB 5EKIA 4BXXG 3PREA 2WXPA 3VUYA 3K7UC 5LMNL 2BT6A 5C2TB 3VR8B 3PUVA 5E7NA 1OTRB 1UEBA 3DWAA 2WXIA 1GNUA 5HY6A 1BO0A 2ZM6L 1LTAD 1PH4A 3LJ3A 3ERSX 4A3DH 3RNGC 4W9HA 3VDZA 1TVXA 2EXZA 2CWPA 4YIJA 3MTNB 2MQJA 1PVOA 3H6MA 1B9MA 2Q8RE 4X57B 2N88A 3U50C 1NMFA 1BBUA 4DXGA 4KX6B 2NN6G 2L55A 4WQMA 4F8CB 1BCPD 1SJHD 3OIPA 1L0VB 4FNFA 3VVWB 2NTSA 3BZDB 3RLFA 5IT9L 1YD8U 1TKYA 5L83A 4A9AA 1U4MA 2NBUA 2LXKA 3NWTA 2PQEA 2XK5B 4JLCA 1CA6A 5JXVA 1C3TA 2JA9A 5IGCA 4HDQA 1QJOA 4XQJA 3PTFC 4J6HA 1WD1A 5C0XG 1WXAA 1QNKA 2LSSA 3V60A 1V8QA 2OJWA 1WYDA 3CP0A 3LWEA 2UUBL 5C4XB 3KYCD 3PSEB 2HCIA 1WE6A 4FF4A 4KY5A 4KMUC 4PZ8A 4UY8C 1ILQA 1E8ZA 4HPPA 2J7ZA 4JIOU 2B2WA 3OLMD 4MGYE 3CCSA 3VTVA 3CPFA 1YQ4B 3LDZE 1M4VA 3H15A 3N30A 2F0UA 3S15B 2M9VA 4C3HH 3PQIA 2VZKB 3B08A 1DM0B 1T9HA 1RF2D 2E3TA 4HLEA 5A35A 2EXDA 2WDQB 2LWPA 4GMVA 2UXCL 1OQQA 1FD7D 1IW7C 4U673 4OEMB 2E6XA 1SFOH 2ZCCA 1VQHA 4W9DA 3E0EA 4MN3A 2VUMB 2KVRA 1S5ED 2UXBQ 5LXHA 2QKIC 4YT0B 2HT1A 1K83H 1A3UA 3GTGB 3VTWA 3I4MH 1E7ZA 3D4RA 3RN2A 5ELFA 3RZDH 1MD2D 3D32A 3PRZA 2KN5A 1A6XA 3TZUA 3QC8B 2YLMA 4KTAA 4A3KB 3QJZA 1F1HA 3HOUH 3T9LA 2VQFL 2JZPA 1VDZA 3TBLD 2MP2B 2DENB 3ZYYX 4LDTD 3S14H 2WXKA 4C80A 4G50A 4K14A 3CCQA 4N9PA 1MHXA 2QHOA 2F0GA 2A6ED 2B2WC 2ZXOA 3BK1A 1IBKQ 2HJ1A 4ICUA 4TRDA 4PYZA 2MO0A 1TT5B 4CQNA 2KCCA 1WR1A 3MAQA 4UP8A 2Q2TA 4HMIA 5JVG3 5CV5A 3RI7C 2F0EA 1TIFA 1O7ZA 2OOBB 4MEMA 4K6DA 5M5XB 5C4XG 4PK1A 4A3OA 2PPHA 1MKHA 1NSNS 2BA1A 3AE6B 1S5DD 5EJWA 3HKZE 1CQFA 2DN8A 4YWGG 2BDOA 3I70A 4B9WA 1NCVA 3AEAB 1X55A 4DV0Q 2J52A 1B3AA 1TKWB 3J80L 4ZAIA 3PVLA 3PZ8A 1P1AA 1V8CA 4JGHB 3UQBA 4EQ5A 2L5TA 4HR7B 5CV7A 1TZOA 5K36G 1WXVA 3DQVA 3QA8A 5KEEA 4JYAQ 3WAOA 5CGKA 2K5QA 5JAVA 4M8MA 5E3FA 1GB1A 3M95A 4BBRB 3OG5A 3SXHA 1GG3A 1D4BA 4KHPQ 2I1JA 3ONSA 3KDFA 3J7YW 2K33A 2WXHA 3PS6A 1HJPA 4FVMA 2MO1A 1VQBA 4HJ8A 4US8A 1QCBD 4ARIA 1ESFA 3PF5A 1EQRA 4GZYC 2N9LA 4LNFA 4OVUA 2INPE 4HCEA 4A3KG 1DCZA 2WYQA 4NJCA 1TKGA 4QQBX 1YBYA 1X3PA 1VMCA 1KABA 4FP5D 3MC0B 5IGGA 1XMQL 3AEVA 1C4PA 2C9WB 3SDZA 5LHY1 4EKUA 4X64Q 3G71A 3QK0A 1HTQA 3H91A 3GTOH 3OOCA 4LF6L 5FJ8H 2KDBA 1OXVA 2K8HA 5M5YB 1SLJA 2YEPB 4M0WB 1F0ZA 4L5RC 1FR3A 2ZJRA 4M01A 4GKKL 2EZVA 2BTEA 1KNAA 1IKLA 2A4ZA 1AE3A 4RWSC 4DR5L 4KGTA 5KYLA 3FC4A 2LMCA 4FHKA 4C3JB 3ZXVA 3ND9A 2OCEA 2NCNA 4K7SA 5D7GA 2JSVX 5IYDH 4C2MB 1LV9A 2Z0EB 2IHEA 1SN8A 2NPTB 5AUIA 4JI4Q 1STYA 4GDKA 3A5ZB 4FN2A 4H0LC 5C4JH 4II2B 2DYMA 1NVID 3AEBB 4LTUA 1XX8A 4DV4Q 4JI5Q 2IX3A 1MSGA 5IWAL 3G48A 5BYQA 2LGDA 3RZFA 1MJCA 2PE9A 2OF1A 1NUCA 3I4NG 4BBRG 1T5EA 2AHOB 1VQGA 1R4MB 3PGZA 1XMOL 2HHHQ 1WWTA 3FILB 2PPBC 3QAQA 3DHHC 4ALPA 1IPGA 3AE8B 4DDGD 3AM9A 3R2TA 2DLBA 3GS2A 2PVGC 2FBWB 3OTOQ 4LLGM 1DYQA 4KK7A 3VH4B 2BYFA 4NXNQ 2GVBA 4DV6Q 1RIPA 2JXMB 2ZVNA 2UUCQ 3U4EG 3HKSA 4E71A 1CHPD 2PYKA 1WXMA 2PNRC 4K5VA 5M5WB 4A3EH 2KTRB 4BBSG 3CHBD 3I55A 4A3CG 1HHVA 1PTOH 3FPPA 3R7RA 1A5RA 3EFCA 4I6NB 2KN4A 2KEDA 3RPFC 2E2HB 4JI1Q 2WP8J 1PFDA 5JVH3 1YQ3B 1K3BC 2MJDA 3FKIB 1X3FA 1F9PA 1V1PA 4A3GB 3ZRFA 3GTJB 3SK8A 4J3OD 2MEKA 1Y8OB 3U9SA 2K4KA 5CORA 3UIPB 5CR3A 4C3JG 5FR3A 2KHJA 3J80E 1AWDA 1E8XA 4HKQA 2YYZA 4OWXB 4H13C 4DV2L 5IGBA 5IT9c 4O1NA 2VW9A 1X56A 2DX5B 5D6JB 4IG7B 1C4AA 2JZ3B 1N36Q 3S2HH 1C76A 4N58A 1JC7A 1JQYD 2AUJD 1EIFA 3VFKA 1A8VA 2K6AA 4OIJA 4B3SQ 1H95A 2N78A 1SIJA 3HOWH 1C9FA 4GLAC 1FMAD 2W9NA 4AUQC 2O2LD 2D0OA 3I3TB 2DAJA 1K0RA 3P4PB 2JRHA 3P7JA 4M8AA 4B3RL 1LTID 2IGGA 1PDQA 1JROA 4ID6A 4DPGA 3STBD 3ZUNA 4GXBA 4OZCA 2B2UA 1FGUA 4TUUA 4KN7C 3TUOA 4BKSA 3K59A 2LFNA 2WDTB 2E76C 1GUTA 2MPMA 3AN1A 4R4TA 1WTRA 3HOVB 2EQSA 4L5QA 1HTPA 5CHVC 1Y8PB 3M9BA 2BH2A 1ZE3D 5BYSA 2CFMA 5HG2A 1A62A 2L76A 1FXTB 2R6GA 4NP5A 3A9KA 3EHVA 2C60A 1SNCA 4DR2Q 2WHIA 1GUSA 2G5DA 2N49A 4NAWB 3GTQH 4OX9L 2VXWA 4BY1H 2CJNA 3S2AA 1SXTA 2WACA 1PH3A 1VZ6A 1OEYA 3ZJVA 1EEFD 1LXDA 1PGAA 3U4ZA 1UBIA 2EMTA 3JAME 3BZKA 4IUQA 4G7HC 4DK3C 1WD0A 2EVBA 2XVSA 4BOSC 2V0GA 4OELB 1A3TA 3I4LA 4JC0A 4GOPB 2KNBA 1EEID 3R7QA 1TWFH 2F0JA 3S16H 1YN5A 1TWHH 3SK6A 4JI2L 1N62A 5C4ZA 3IFTA 2NZOA 4JI3L 1K51A 1ASZA 3CMMB 1B53A 5G3LF 4A3LH 3TJPA 4K0KQ 3ZJTA 3CAMA 3O65B 3TSSA 2AKWB 4CKCA 4LFCQ 5T1GA 3KUZA 4RGTA 2R7ZH 3PRMB 3HOXB 4LF7L 3HVZA 3TEXA 3M4PA 2JYEA 4ZLTF 5KIXA 4JI8L 1IHZA 5E4XA 3VRBB 3J80c 2A5HA 3UGBB 3X3NA 2F0KA 3ML8A 1WCMG 3HOYB 3HOVG 1VQMA 1EY4A 4K6LA 5FO7B 5IGFA 4P74A 1G51A 4DK6C 3EUB2 1L0YB 1HTOA 1F2MA 4DHJD 1LM8B 5IOIA 4R8IA 4MM3B 3ULJA 1ZKHA 3Q6SA 1NI2A 1AE2A 5CV8A 2NR2A 3ALBA 3VQIA 3FKYA 1WY8A 1K8OA 1DGSA 1IBML 2AL3A 2KBNA 1RDPD 2KCNA 1HNWL 5H8YE 1SNQA 5L95C 4XIGS 2D9UA 4ABNA 2KXJA 2IWHA 4DR7L 1J7AA 2PLPA 1TJEA 1A2TA 3A7LA 4FF2A 2JA5B 1TKEA 1ZUD2 1F9SA 2ICIA 4ZOHC 3ZQ4A 2WXGA 4NB3A 1QOFA 2GRIA 3DBHI 4K5XA 2EKIA 2F1MA 1EU4A 1STGA 3A54A 3S1QB 3CWIA 4C1NK 4DNTB 4A3IG 1HNZQ 1BMLC 2C7NB 2HDLA 1WXQA 2RSUA 3RNCC 4V190 1E2ZA 2KENA 4A3BB 2FCMA 2BBCA 1N8RC 4P1CC 4IDIA 1CSQA 4DDID 1G6JA 5C4HA 2K1BA 4RM9A 1QZGA 5ELOA 4PMBA 4AP4C 5CYUA 3I73A 1B1ZA 3RD4A 3HOXG 3J7AV 2KDEB 4WJNA 4WWOA 4TQ0A 2K01A 1O7LA 4Q5VA 2EJFC 4KY6A 2EIFA 1E5WA 1QF6A 2BDNA 2G4DB 2D62A 5BN5A 3P75A 3B2FA 2PQAB 1QOHA 3TL5A 1WJJA 3AH7A 2BOSA 2E8GA 1X3GA 3MFGA 5JEAJ 1Y69U 3HOYG 1T0RC 4IWQA 5E6OA 5ELBA 5A2QL 1CZWA 4NZLB 2RKSA 1WOCA 1QOBA 3ZNID 2K52A 3CCVA 2KWDA 3R93A 2PIAA 4W9JA 3SFEB 3UDXA 4ZKCB 1Q81C 1YJ1A 1FFVA 2HUGA 1OXUA 1TS3A 3DBSA 2KFKA 1V43A 2AMCB 3MHZA 3K81C 1RODA 2PNHA 4RKLA 2WXJA 2GMIC 2XTIA 3DOWA 1KM7A 2KQ4X 1SYEA 5E1FA 1VQ8A 4I65A 4WAAA 2VY3A 2ZTDA 3A55A 2QSDA 1VQ5A 2NS5A 2GBNA 2B63B 1I3QB 4CBVA 4P71A 2GOWA 1TWAB 2V4LA 3Q3NC 5FO9B 1JOQA 1YNJD 3AB5A 1ZYRD 3RN5A 1WSPA 3VUXA 4XQQA 1KH0A 1SROA 4XGAB 2K5PA 1HQMC 3HKZG 4A3FG 1H8CA 3DHGC 4NW2A 5DPRA 4BKTA 3DBRI 3E3XA 4C4VB 1GUOA 1V49A 1YNTE 3OYYA 2PE6B 4HIMA 1E6EB 1TQOA 2VNUD 3I90A 2XWJB 4A3BG 1VCIA 5C1ZA 4F8MA 2G4SA 3ZVVA 2IYDB 2MJ3A 4C00A 2RSNA 4QF4A 2UXBL 2JU6X 1L2NA 5DEHA 2FCQA 5KNDA 4YCWA 2CHWA 5LNK1 4OW0A 3Q3MC 3ZTDA 2G9HD 2A74C 3TMPB 3IXSA 2HQLA 4FXGC 2KO3A 4A3DB 4PYUA 1XO3A 2D10A 1WGRA 3A56A 4K1RB 5C44H 1N61A 1R4NB 1B8AA 2SNMA 3S2DH 3DVGX 3AEDB 2YV5A 2WB1B 1LM0A 1J8CA 3RNEC 2JF5A 4FJYA 3ENEA 2C9OA 4KJOA 1Y14B 2AL6A 1LTTD 2N7EA 1QILA 3HRZC 3H09A 1IBKL 2HTME 2NVXH 1JWBD 2JEAI 2KJRA 1XNQQ 1X1MA 2LEKA 2KEEA 3ZIMA 1BCPC 4DHZB 2LI5A 3KW5B 1WM2A 3IT6B 2LGXA 2YEPF 2MX2A 3JVZX 1JALA 3GTPH 1R4PB 3T56B 4ZRIA 5JJLA 2D2CC 1J8IA 2EKEC 3B9JA 4DV0L 4U68A 1H9MA 4PS8A 1VS0A 2NMQA 3S1NH 2Z6KA 1WI5A 3PUZA 1I94Q 3PO0A 1ZDXA 4EEWA 4LMQD 3KVFB 2H4OA 4JYAL 3U8ZA 3UDFA 3HS0C 3PZ7A 4C3HB 3M4OH 3MXUA 4KHPL 3PIOA 4IPGA 1LT5D 3AEFB 1XNRQ 5A2QE 2UUAQ 2O6VB 4K7WA 3TEYA 4CJ0B 3IVFA 2RDGA 1SFOB 2I38A 1L7YA 4CHKA 1B44D 3T4AC 5C3XA 1GUAB 4IUUA 4B6WA 1KFYB 4KY7A 4A3DG 1SE8A 3A9JB 2DNCA 4XDCA 1FD6A 3CMAA 3LX0A 1UD7A 3F2CA 1U4LA 2BKRB 2VRRB 4KDLB 2V1CC 3EBEA 4CKEA 3CCRA 4AQYQ 2KDIA 4X64L 4K3BA 1JOOA 2WB1G 4GN5A 4C56C 2E2IH 5JPNC 3EN2A 4A3JH 5FKAC 3SGIA 3FAHA 3P4RB 5FLXL 3KUDB 1N63A 1NBFC 4DFAA 4RHRA 2F0OA 3CQZH 5HURA 4G4KA 4WJQA 3S14B 3DWGC 1SMXA 2Z6KC 2EYLA 5CTRC 3ULPA 1XPUA 2GVAA 2HCCA 1GJZA 4WAFA 1ONLA 3GTKH 1WX9A 3ZO5B 3BIID 4OVVA 4EQNA 2LUEA 4FJZA 4MIUA 4YTNB 4HVBA 3K5NA 4OVZA 1PFMA 1WRIA 4EVOA 1D7QA 2K3UA 3DWMA 2A6EC 2K75A 4JI4L 3Q8EA 3M7NA 1QT9A 3Q8FA 2DJGC 4HIKA 2ZNVB 3ZNZB 4JI5L 4DV4L 4E6IA 4X62Q 1Y1VH 2PKOA 2R7FA 3UI2A 4EFOA 1P3QU 1L1OC 1O80A 1K8GA 2E5LQ 4C3HG 3NZUA 3NTHA 3F2BA 4A93B 2ZPNA 2HHHL 4ZHOA 2ACZB 1UUPA 4CDCC 2MBOA 2BWES 5EE1A 3NY5A 2D3AA 3KUCB 3OTOL 3W3AA 3VYTA 4NXNL 5DPSA 1FRDA 4DV6L 3K5LA 3BDLA 3NEMA 2UUCL 4UAIA 1KF6B 4FLHA 3EQLC 5I2XA 3WALA 1SYCA 2WU2B 4W9EA 3HEJA 3I4MG 3IHPC 1Z47A 3IKJA 1PRTD 2LVPA 1NYRA 1RL2A 3HOUG 1HR0W 3Q8AA 1X54A 2DZMA 4P75A 1DOMA 2BW2A 3TP6A 4JI1L 3APFA 2KQSA 4KLKA 4DV7Q 3GTOB 4FXKC 2NTTA 5ELDA 3BS1A 3OW2A 1Z2MA 3VYSA 1VR9A 3Q69A 2Y0SE 2FCNA 2IGHA 3K0XA 1MI2A 1V1OA 3S1RH 1NY4A 4Z9CB 2HDEA 1GB4A 1XXGA 2KKCA 4RFBA 1N36L 4J6IA 1YOVB 1C48A 2NUCA 1F2ZA 2A73B 3V05A 4Y7NH 1AP0A 3Q6BA 1A3VA 1Q1BA 4B3SL 5D3DA 4WJPA 2K8BA 3SR1A 5DNFA 3SE0A 2BF8B 3KQ4A 3NOBA 3ICEA 2E2JH 2KOXA 4PS3A 3RR5A 4ICVA 1GUGA 3VXWA 3MJ5A 2MBEA 1VQ9A 1XCQL 4BAXA 1DOXA 1E3PA 3PGEA 2FAZA 2LRWA 2PZWA 1PH5A 3K6OA 2W82A
chains in the Genus database with same CATH topology
1KLGD 4NMZA 2INNE 3DUZA 2EJGC 3AE7B 2I46A 3NHHA 5TSSA 1BXTA 3ZGZA 5FLXE 2IW3A 2PMVA 4N59A 4ZKBB 1PGBA 2K22A 3HVDA 1FEHA 3KBXA 1BF4A 2F0TA 1RCVD 2XSCA 2ZXPA 5D14A 2L4NA 4A3EB 2J4XA 4DK1A 1PTOB 4C7ZA 3KUPA 4KKTA 5T1IA 3ITPA 1I6HB 1WTVA 4H44C 3D6CA 1STAA 1OXSC 5IODA 4B0EA 1G6ZA 2CVRA 3QO2A 1VF7A 1K52A 5ELCA 5C5LA 2JXTA 1ZEQX 1DXMA 4EQOA 2QIEB 3KWLA 3FRPB 3S2HB 2MGSA 2F03A 3U9OA 2F0QA 1XLNA 1KDAA 1FNUA 3HOWB 2LKVA 2C5CA 2OEOA 1LTGD 4GLSC 5EGTA 4ZK9B 4ODGA 1SSOA 2ZXRA 5EE9A 4FXDA 1B50A 1S5FD 2X69A 1E2VA 1XF5L 5JJZA 5JEAH 2EY1A 2NB0A 2QF7A 1VJKA 3N52A 4XYQA 1YJJA 1PMRA 4MACA 3A8JE 3HGBA 2WXQA 1JB3A 2F0HA 1P7EA 4K2KA 2K5DA 4J1MA 1IKMA 3R3OA 5F2DA 3Q23A 1RKNA 5C3WA 1SJED 2NYZD 2X6LA 1ENFA 1UAPA 4HCSA 1TS2A 3DEPA 1BQQT 1EY7A 5I6YA 4FYDA 2RBMA 3KLSA 4B9XA 3L9AX 2LHDA 3QJYA 3E6ZX 4O42A 3MHBA 4PMWA 3T13A 3S16B 1TWHB 4IFDI 2RSOA 2RMMA 1S4ZA 1EY6A 4OO1I 1ENCA 1IYVA 1J7BA 3P1HA 2PCFB 5EQ0A 3URYA 3IT4B 4L2YA 4DU9A 4DA2A 3D4DA 1ZOYB 3I4NB 4JBWA 4QIWB 2N0SB 2EYOA 3BVMA 2NN6I 3LWUA 5HI1A 4YSYB 3D3RA 3O13A 3MXNA 1EY8A 5IT9E 1FNWA 1XLOA 1A15A 5GXGB 2EYHA 1QNUA 1EYAA 2F0MA 2KAJA 3OSOA 4BBSB 1DONA 4OO1H 5C0XI 1HEZE 3BWUD 2JYOA 1C78A 1MVKA 5AFWA 3R2IA 3SK4A 2Z4HA 3TN2A 1H9JA 4IURA 5CV9A 5C6AA 1LT3D 5EPLA 2Z4IA 1JORA 3Q22A 4K8IA 1SE3A 1FGBD 1QB5D 3T51B 3GQBA 1FRRA 4A55A 2PMZB 2LHEA 4HMJA 4GDLB 3NSWA 1FCLA 2SEBD 2V4DA 4NAMA 2GA4B 2F0SA 5AUKA 5MPOA 4IUNA 1TR5A 1JQ4A 5I9PA 1N5XA 3CIRB 3RMHA 1E2WA 1VLBA 3K5MA 4B08A 3U7ZA 3DXJC 1IBXA 5BN4A 4LK1C 3NTIA 1TIID 4XDXA 4OZAA 4QUFA 4KI0A 3HUIA 1WTXA 1NEKB 3I9V1 1SMYD 1VDVA 5EE0A 1AYFA 1YNJC 1ZYRC 2F0WA 4WURA 2XNAC 3M4YA 5JOBA 3K58A 4EE2A 1Q12A 3N6RA 2F0IA 2TMPA 2GB1A 1AZPA 3D8GA 3NUHB 4G7ZC 1D5MC 4L63B 5DM73 1H9SB 2WXMA 1I4XA 1EY0A 5IGDA 1XYIA 5C44B 1H9KA 4KGSA 1WCMB 1KDBA 3S2DB 1W6JA 1FO4A 1I4RA 2A6HD 2KOLA 1VMPA 1SDFA 3R8BA 4X3SA 1IGCA 3NK9A 2JE6I 1R7SA 3ERQA 2NVXB 1LT6D 2EYMA 4JPSA 1HCZA 5EKKA 4ZRPA 2MJEA 3UI3A 2IX0A 4C1NI 4DNRB 4HTHA 2J42A 3T53B 2V4IB 1PRTF 2K32A 4Q0FA 2TSSA 5J39A 3NPPA 3GTPB 1L5PA 3FVQA 2Y5CA 2FHTA 2LGIA 5J1ZA 1ET6A 3MXPA 3U52E 3DMUA 4DK0A 4ARCA 2B2UC 4A3IB 4CJ1B 3OW7A 3M4OB 3KF8A 4C7YA 1J9OA 5E6JA 2PW5A 1ET9A 3K5OA 3TDQA 1HTLD 4WORA 2IJ0A 1XEEA 2V3NA 4XWWA 1GOZA 3P1MA 2ONQA 1HA6A 1T5XD 2AQ1B 3OMCA 4IUVA 4A8XC 1RYJA 2O4XA 4TQUS 4JWSC 2E2IB 1DOKA 4P2CB 4A3JB 1ENAA 1RJTA 1ZPSA 1CHQD 4IUTA 3RUZA 4FF1A 1PFNA 3AMUA 1SYBA 1GPXA 3F2UA 3GTKB 3VR9B 4IN3A 5KRUA 2WIIB 1EY5A 1CT1D 2F3VA 1DJRD 4KHZA 3CRKC 1WVLA 2W3SA 1D2BA 2AUKA 2PVOD 3OIQA 3EROA 3QOJA 3QWNA 3HKZB 4A3FB 3OMGA 1Z7TA 1XLPA 4ULLA 1Y1VB 1TWCB 4P16A 3J81L 1LT4D 2E75C 1C79A 2ZW1A 4X3TA 5LL6X 4AQ7A 2ID0A 2QDBA 1STNA 1S5BD 1PDXA 4IOIE 1MBYA 1G8ZD 2A68D 3EJIA 2I2YA 1RHPA 3BDOA 3PMFA 2CW0D 4DXFA 4G7OC 1HXYD 5ELEA 1PRTC 3S17B 1MPEA 1FIQA 4A90A 2RDFA 3H3VC 2NWGA 4TKOB 1L4DB 1SYFA 2SNSA 3I8ZA 3S1RB 1K53A 4RH6A 1JWAD 4HKZE 3G6JB 3E5SA 2MUYA 4D2KA 3LNNA 3E9SA 5DM63 1NR2A 3VR3A 4Y7NB 3AEEB 1PYWD 1GJXA 1EFID 2VB3X 1XWEA 1YNNC 3NP8A 4HEDA 3LB8C 3GB1A 1FYCA 4PQXA 3NVZA 2JQRB 1C4CA 1IUEA 1L6UA 2LMCB 2E2DC 3GV3A 3J9CA 3RZOB 3KWVA 5EBDA 2D5GA 4H7BA 2DY7A 4GDKB 1SE2A 2K9XA 5BYRA 1I4HA 5K5PA 2G9DA 1OO9B 2K28A 4TMAB 2F0LA 3I57A 3IAYA 3RFZB 3B2GA 1MHHE 2BYTA 4RGOS 4ILWA 4US9A 4RCOA 2PZTA 3J7AF 1HUNA 4LK0M 3A7AB 2B2YA 3A8KE 2X6GA 3NQIA 2Q8TA 2K03A 2PTLA 4QMGA 1K8MA 2DBYA 1L0XB 5G5GA 2IPKD 1UWMA 1G291 4YTPB 4BS9A 1WTWA 1P7FA 3ZJUA 3T3NA 4XT3B 1TT2A 3VYUA 3SVMA 4KD4A 2JA7B 2EY6A 3CRLC 3NE5B 1OFFA 1SYDA 1VF5C 2Q8IB 3Q8CA 1ZXHA 3TP5A 1TY2A 4KKIA 1HA5A 4ZUIA 1B4OA 2Z8LA 3IFDA 3QG1A 2WXFA 2B2YC 3EA6A 1C8CA 1K83B 5FK9C 1ZXIA 5BMHA 3I4MB 3VA7A 3RZDB 2FFKB 2BB5A 2RDHA 3MP9A 3HOUB 3MFYA 5IOCA 2FMCA 2E2JB 2X38A 4DAPA 1QLBB 2KMMA 4X3KA 2B39A 1KAAA 1XTCD 1LLRD 1STHA 1S5CD 3Q24A 1ILPA 4WWMA 2FE8A 5HGTA 3NRZA 2AQ3B 1LTSD 1TU2B 3DHQA 3W5UB 1MI0A 2G1EA 4M0WA 1PZID 5BMGA 3W5VB 3Q8BA 3DEOA 1SE4A 1ZXTA 2QJLA 4B0MA 2KJXA 1V97A 3G7LA 4F87A 4HEA1 1T3QA 1XLQA 2FJ2A 2N9KA 4YTMB 1AZQA 4YSXB 3M7GA 2K5WA 2R3ZA 1BUVT 1TS5A 1EZ6A 5CV4A 5JEAG 4OZBA 2N55A 4RHSA 4KKSA 1ESRA 3W2DA 1I6VC 3HZXA 1RWSA 4ZRZA 3FILA 3W9CB 1HUMA 2IT1A 1BUIC 3ONAB 3AE2B 3H0GB 1GUWA 3I3CA 3TP8A 1OXTA 3KBGA 2DNEA 1YNND 3D4WA 2DWQA 2DYOA 1AW7A 1YMHE 3I72A 1DOYA 3VR2A 4QUCA 4RF1A 4PNYA 4L6TB 3EVQA 4USAA 3C46A 2Z1CA 2K0PA 4JE3B 3D6WA 1NAPA 3PO2B 5C4JB 4P6VF 1Y1WB 1QWYA 2F0FA 4MH8A 3NQTA 2NBFA 3H94A 3NUCA 4ZRQA 1EM7A 3L3OC 1RM6C 1ZP0B 5EPJA 2EE1A 1PTOD 3C2PA 1FXIA 3SEBA 2EELA 2BS2B 4L23A 1D1KA 1FNVA 1HZ5A 3V96A 2L12A 2LS01 3AE3B 4RKBA 2JWUA 4WFN3 4XT1B 4OO1G 3AE1B 3IL8A 3S9WA 1JW9D 4FXCA 1CI3M 1JWSD 3NTKA 1IYUA 4I7ZC 2OT2A 2HDMA 2EPBA 1CA5A 1WTOA 2JEBI 4YSZB 5C5MA 3QIAA 3FEWX 3HOZB 3DWQA 4XDDA 2VZKD 2JX5A 3MWYW 1LABA 1SMYC 2AX5A 1Y56A 1SF0A 2H1EA 4F88A 3AE4B 2L9HA 4TSSA 2L0CA 1SB3C 1PZKD 3KK7A 4WH4A 1O7YA 3KLRA 4AYBB 3VRAB 1BCPB 4NDXA 2O5IC 1U9RA 4ZUJA 1Q90A 3BK2A 2XWBB 3ND8A 1EYDA 5E4WC 2AWNA 1ROEA 3BYYB 1CK1A 3S1MB 1D6EC 1RFKA 1Q1EA 3LXFA 1B9NA 3TZDA 2IDYA 1BOSA 3VR6A 1YJIA 2WKCA 2WQYB 1EYCA 4FF3A 3C8YA 2KUMA 1R4QB 1SSNA 4XYOA 3GTQB 2Y3AA 1UEAB 2A6HC 4BY1B 1EIGA 5I9OA 4MHEA 3V2TA 2BB6A 3U2SC 2M2LA 3AU7A 4Q2JA 4OGQC 4ZYSA 4EQPA 1WGKA 4N6EB 4JK1C 1FCCC 1RTOA 5J22A 3Q0AA 1F9RA 4J8QA 1TWFB 1CFMA 1ICWA 1PXUA 1EU3A 3HRDD 1EQVA 2KVMA 2JP1A 1DOLA 4DGZA 3TEWA 1TYGB 2QCPX 3NVYA 2R7ZB 1UGJA 3LYYA 1AEXA 3AB9A 2V3PA 5BMIA 1G2TA 1HFNA 5ISRA 4PT5A 2PW9A 4C3IB 4IZ8A 4RAUC 1OXXK 4BWGB 4JX1C 4AS1A 2W54A 3WOFA 1SEBD 4HRSA 2B8FA 1F9QA 3C1EA 2MH7A 1GHJA 2PO4A 4IFDH 4CKBA 5DAUA 3PUWA 1II3A 5I2YA 2JSOA 2SOBA 2CQAA 5I6WA 4BA2I 4XTCS 3OWEB 2YU9B 3GO5A 2R93B 2KECA 4WRDA 1L6VA 1K50A 1E10A 4TQ1A 4IALA 2NN6H 5KYIA 2CHBD 2XRSD 5COYA 1C77A 1LACA 4R8NA 3L4PA 1LTRD 2LJIA 4UDUC 3HP3A 3E56A 2F0PA 1BDOA 4R3DA 1SNDA 4HSVA 1JE4A 3PIO3 3L7ZC 2FUG1 3GV6A 4REZA 2GI9A 5M9OA 3TBIB 5C0XH 5IGEA 4C3IG 1HQRD 1STBA 1ACCA 3JAML 3BVGA 2ICEC 2A68C 1ZDVA 4ME5A 1SNOA 4KV6A 3PO3B 4XQNA 2CW0C 1W6KA 4DF7A 2Y0SB 1QG7A 4HJGE 3BVZA 1N5WA 4KN4C 1M8AA 3M3YB 1D1IA 2K05A 1Q3LA 1DGJA 4EGVA 3T3OA 2RVLA 4PV1C 2WLBA 1WYGA 5CV6A 3M85A 1CQVA 5G5HA 3VR5A 2B8GA 1TWGB 3VA5A 2WU5B 1CM9A 2DY8A 2WP9B 4CGYB 4XE0A 2L32A 2NVTB 1NR4A 4A6QA 4WJWA 2CU3A 3CKIB 4RF0A 3CU7A 2L1BA 3FDTA 1E9MA 2EY5A 2N7JA 3N9YC 3NBIA 1QE6A 1EIHA 2K7VA 3X3MA 1KRHA 2Q5WD 1I4PA 3NVWA 2IL8A 2SDFA 4HAEA 1RD9D 4OHJA 1IW7D 3W1SA 3NWSA 3V3XA 1G91A 2EJMA 1Q10A 4MT5A 5K36H 5HFYA 1GAQB 2WXOA 4ZQ3A 3H8HA 2EOTA 5FOBB 2NVYB 2XIWA 1SAPA 1JWMD 2BE5C 3C1FA 1JCKB 3GP7A 1JMLA 4PMCA 3A8IE 3P4SB 2KDMA 2WV6D 2W55A 1SBBB 3S1NB 1WTPA 2R61A 1AFPA 3MTSA 3P42A 2RA4A 2F3WA 2BS3B 3AECB 2A69C 1C4QA 2AWOA 2RPVA 1VZ8A 2ZW0A 1IGDA 2K04A 1DD2A 1NENB 1HZ6A 5T8IA 3BDCA 3T16A 4F7XA 2H89B 4K5WA 1I4QA 5IIFA 5HHDG 3OHXC 2WXRA 3CQZB 1QOGA 1EOTA 3MA2B 1F2RI 3VYRA 4NKLA 1PTOF 2B2VA 1U4PA 2L11A 2PW7A 3DWPA 1UWXA 1E0BA 2HQEA 2MJ8A 1CZGA 5CBAE 2WXNA 4ZHPA 3FPUB 4QB4A 3AE9B 5D65A 3WDNA 5EBCA 3K7AB 1PZJD 1H9RA 3QOLA 4RGMA 1EY9A 3SHLA 2B2TA 4V0BA 5JXVA 1VRAB 2LFIA 2BA0A 4A3MB 4YXDB 1ZKOA 2EYFA 2J53A 4KGRA 1JOKA 1BCPF 1QQRA 1TY0A 1CZPA 1MSHA 4ITKA 1PGXA 1CJEA 2B2VC 2M0AA 1QOAA 4HROA 1PLFA 1WTQA 3NS1A 3C3LA 4OL7A 2JA8B 1PFBA 1QKZA 1MGSA 1EWHA 4BY7B 1FFUA 4IKGA 2RQXA 2ON8A 1SNMA 3I91A 2B2TC 4HSPA 1EWYC 3IAS1 5I4DA 4RA8A 1DOIA 2KA7A 1PUTA 2B76B 1LO5D 2WDVB 1X3QA 2WXLA 1JR0D 2W3RA 4CJ2C 5FO8B 3EFXD 1KLUD 1DZ1A 2WS3B 2QEJC 3P20A 2BCOA 3VR4A 2IX1A 3BG3A 4L1BA 4KJNA 1GHKA 4CHTB 2AQ2B 1Z6HA 2LUMA 1LTBD 2JYTA 3K57A 1L4ZB 1YN4A 2L1AA 1HFGA 3HG9A 1EL0A 1FM0D 1PTOC 2XN9C 4L8JA 3GD7A 2KQ3A 2F0VA 1GXDC 3OWFA 2KACA 4IFDJ 2BE5D 2R92B 4G57A 4RCNA 1XCTL 3AMZA 5M3FB 1IBXB 5EPKA 4DN4M 3TMEA 3MEHA 1UNSA 3J81E 2EYPA 2Y5PA 3PV0A 1SNPA 2D5DA 4LAAA 1V1PB 2I07B 2J0TD 2WNMA 3P4QB 2XRQD 3WOEA 2VB2X 3DM1A 2WKDA 3TEZA 2A69D 3MZ5A 3IAM1 2SAKA 2MP1A 4M1UB 3OPOA 1HRJA 4HN7A 5D3IB 5CBEE 2L52A 3PIP3 1F2LA 1Y8NB 5KGUA 5C0XJ 1X32A 3PUXA 5EKLA 1O78A 2BS4B 3NBHA 1A2UA 2EY2A 1BR9A 2ENBA 2WINB 1B9RA 2PZUA 4XXEA 1JICA 1FXAA 4LJZC 4R9WA 1EQTA 4X3UA 1I7HA 3FMCA 3QB3A 1T6BX 1D5XC 1I4GA 4DAVA 2M00A 2L83A 3ETRA 3D31A 2MHVA 3AE6B 3MXGA 4N9TA 4DAYA 1E7PB 2ZT9C 4S3SA 4H2AA 2QILA 3AE5B 4FO2A 3K0YA 1F77A 1F2YA 2KHSA 4KHVA 2EDGA 1GUNA 4RGNA 2LY7A 4K2LA 2IGDA 1ML0D 1KTKA 4KKJA 2M19A 4IQZA 1I50B 1EWCA 2H88B 2NZ1D 4QCLA 3AV8A 3AEGB 2F0DA 5H92C 4K8JA 3NVVA 1CTMA 3SK5A 2O5JC 5CMDA 5BN3A 3GTLB 3E0JA 1U4RA 5JPMC 2NVQB 1OQRA 3NZ3A 2QMTA 2JA6B 1J7CA 4BA1I 1NI3A 3MVVA 1N60A 4KKUA 1IL8A 1D5ZC 2EYJA 1STEA 3KLSX 4WIPA 1VZ7A 1BBXC 1F2RC 2OEDA 1E0ZA 1B2TA 1YN3A 5NUCA 2FMMA 2M56B 3PUYA 5LL6S 1NYQA 3NXWA 2WDRB 3P63A 5M3MB 1A70A 1EZ8A 5KNBA 4DQOC 1SYGA 3BYTB 2FINB 2CJOA 1PRTB 1BNZA 3GTMB 3EGRA 5G3LD 3WCQA 4KD3A 1G2SA 2WAQB 4XWTA 4RNAA 1JWUD 3SFDB 4IUPA 5CC4A 1HPCA 1R9TB 2OXPA 1KDCA 4OIKA 2F0NA 1TS4A 1JRPA 1KNEA 3TP7A 3SR6A 5KNCA 1RTNA 5C3JB 5EE3A 2E74C 1H9SA 5C3EB 4IFDG 1Q8IA 1AN8A 2F4IA 2OHFA 3ABVB 5EKIA 2WXPA 5C2TB 2BT6A 3VR8B 3PUVA 3DWAA 2WXIA 1BO0A 1LTAD 1TVXA 2EXZA 4YIJA 3H6MA 1B9MA 2Q8RE 2N88A 4KX6B 4DXGA 2NN6G 2L55A 4WQMA 1BCPD 1SJHD 3OIPA 1L0VB 4FNFA 2NTSA 3BZDB 3RLFA 5IT9L 1TKYA 4A9AA 1U4MA 3NWTA 2PQEA 1CA6A 5IGCA 1QJOA 4XQJA 4J6HA 1WD1A 5C0XG 1QNKA 1V8QA 3LWEA 5C4XB 2HCIA 4FF4A 4KY5A 4KMUC 1ILQA 2J7ZA 2B2WA 1YQ4B 1M4VA 2F0UA 3S15B 2M9VA 2VZKB 1DM0B 1RF2D 2E3TA 5A35A 2WDQB 1OQQA 1FD7D 1IW7C 4U673 2E6XA 4MN3A 2VUMB 1S5ED 2QKIC 4YT0B 1A3UA 3GTGB 3D4RA 5ELFA 1MD2D 1A6XA 3TZUA 4KTAA 4A3KB 2JZPA 1VDZA 3ZYYX 2WXKA 4C80A 4K14A 4N9PA 1MHXA 2F0GA 2A6ED 2B2WC 2ZXOA 3BK1A 4TRDA 4CQNA 2KCCA 3MAQA 4HMIA 5JVG3 5CV5A 2F0EA 1O7ZA 4K6DA 5M5XB 1NSNS 2BA1A 1S5DD 5EJWA 1CQFA 2DN8A 4YWGG 2BDOA 3I70A 4B9WA 1NCVA 3AEAB 2J52A 1B3AA 1TKWB 3J80L 4ZAIA 3PZ8A 1V8CA 2L5TA 4HR7B 5CV7A 1TZOA 5K36G 5KEEA 5CGKA 2K5QA 5JAVA 1GB1A 5E3FA 4BBRB 1D4BA 3SXHA 3J7YW 2K33A 2WXHA 4FVMA 4US8A 1QCBD 4ARIA 1ESFA 4GZYC 2N9LA 2INPE 4HCEA 1DCZA 4NJCA 1TKGA 1X3PA 1VMCA 1KABA 4FP5D 3MC0B 5IGGA 1C4PA 3SDZA 5LHY1 3H91A 3OOCA 1OXVA 2YEPB 5M5YB 1F0ZA 1FR3A 2EZVA 2BTEA 1KNAA 1IKLA 4RWSC 4KGTA 5KYLA 3FC4A 2LMCA 4C3JB 3ND9A 5D7GA 2JSVX 4C2MB 1LV9A 5AUIA 1STYA 4H0LC 2DYMA 1NVID 3AEBB 4LTUA 1XX8A 2IX3A 1MSGA 5BYQA 2OF1A 1NUCA 1T5EA 4JWUC 1WWTA 3FILB 2PPBC 3AE8B 3AM9A 3R2TA 2DLBA 3GS2A 2PVGC 2FBWB 4LLGM 1DYQA 4KK7A 2JXMB 3U4EG 1CHPD 2PYKA 2PNRC 4K5VA 5M5WB 3CHBD 1HHVA 1PTOH 3FPPA 2KN4A 2KEDA 3RPFC 2E2HB 2WP8J 1PFDA 5JVH3 1YQ3B 2MJDA 3FKIB 1F9PA 1V1PA 4A3GB 3GTJB 3SK8A 4J3OD 2MEKA 1Y8OB 3U9SA 5CORA 5CR3A 4C3JG 5FR3A 3J80E 1AWDA 4HKQA 2YYZA 4H13C 5IGBA 4O1NA 1C4AA 1C76A 4N58A 1JC7A 1JQYD 2AUJD 4OIJA 2K6AA 1SIJA 1C9FA 1FMAD 2O2LD 3P4PB 3P7JA 4M8AA 1LTID 2IGGA 1PDQA 1JROA 4ID6A 4OZCA 2B2UA 3TUOA 4KN7C 3K59A 2LFNA 2E76C 1GUTA 2MPMA 3AN1A 1WTRA 3HOVB 1HTPA 5BYSA 1Y8PB 1ZE3D 5HG2A 2R6GA 4NP5A 1SNCA 1GUSA 4NAWB 2VXWA 2CJNA 1SXTA 2WACA 1VZ6A 3ZJVA 1EEFD 1PGAA 3JAME 4G7HC 4IUQA 1WD0A 2EVBA 2XVSA 2V0GA 1A3TA 3I4LA 1EEID 2F0JA 1YN5A 3SK6A 1N62A 5C4ZA 3IFTA 1K51A 1B53A 5G3LF 3ZJTA 3TSSA 4CKCA 5T1GA 4RGTA 3HOXB 3HVZA 3TEXA 2JYEA 4ZLTF 5KIXA 1IHZA 5E4XA 3VRBB 2A5HA 3X3NA 2F0KA 3HOYB 1EY4A 4K6LA 5FO7B 5IGFA 3EUB2 1L0YB 1F2MA 4R8IA 4MM3B 3Q6SA 5CV8A 3VQIA 1K8OA 1RDPD 2KCNA 5H8YE 1SNQA 4XIGS 2D9UA 4ABNA 2IWHA 1J7AA 2PLPA 1TJEA 1A2TA 3A7LA 4FF2A 2JA5B 1TKEA 1ZUD2 1F9SA 2ICIA 4ZOHC 3ZQ4A 2WXGA 1QOFA 2GRIA 4K5XA 2EKIA 2F1MA 1EU4A 1STGA 3A54A 3S1QB 3CWIA 4C1NK 4DNTB 1BMLC 2HDLA 1WXQA 4V190 1E2ZA 4A3BB 2BBCA 4IDIA 5C4HA 2K1BA 4PMBA 5CYUA 3I73A 1B1ZA 3RD4A 4TQ0A 3J7AV 2K01A 1O7LA 4Q5VA 2EJFC 4KY6A 1QF6A 2BDNA 2D62A 5BN5A 3P75A 3B2FA 1QOHA 3AH7A 2BOSA 1Y69U 3MFGA 5JEAJ 5ELBA 5A2QL 1CZWA 4NZLB 2RKSA 1QOBA 2KWDA 3R93A 2PIAA 3SFEB 4ZKCB 1FFVA 2HUGA 1OXUA 1TS3A 1V43A 3MHZA 4RKLA 1RODA 2WXJA 2KQ4X 1SYEA 5E1FA 4I65A 3A55A 2QSDA 2B63B 1I3QB 4CBVA 1TWAB 5FO9B 1JOQA 1YNJD 3AB5A 1ZYRD 1WSPA 4XQQA 1KH0A 2K5PA 1HQMC 4NW2A 1GUOA 1YNTE 1E6EB 1TQOA 2VNUD 3I90A 2XWJB 1VCIA 4F8MA 2MJ3A 2RSNA 4QF4A 2JU6X 5DEHA 5KNDA 5LNK1 4OW0A 2G9HD 2A74C 3IXSA 4FXGC 4A3DB 1XO3A 3A56A 1N61A 2SNMA 3AEDB 2WB1B 2C9OA 4KJOA 1LTTD 1QILA 3HRZC 3H09A 2HTME 1JWBD 2JEAI 2LEKA 2KEEA 1BCPC 3IT6B 2YEPF 1JALA 1R4PB 3T56B 2D2CC 1J8IA 3B9JA 4U68A 1H9MA 2NMQA 3PUZA 3PO0A 1ZDXA 4LMQD 2H4OA 3HS0C 3PZ7A 4C3HB 3MXUA 3AEFB 1LT5D 5A2QE 3TEYA 4CJ0B 2RDGA 1SFOB 2I38A 1B44D 3T4AC 5C3XA 4IUUA 1KFYB 4KY7A 1FD6A 2DNCA 4XDCA 3LX0A 1U4LA 4CKEA 1JOOA 4C56C 5JPNC 3P4RB 5FKAC 3FAHA 5FLXL 1N63A 4DFAA 4RHRA 2F0OA 5HURA 4G4KA 3S14B 3DWGC 2EYLA 2HCCA 4WAFA 1ONLA 3BIID 4EQNA 4MIUA 4YTNB 3K5NA 4OVZA 1PFMA 1WRIA 4EVOA 2K3UA 3DWMA 2A6EC