1KTKA

Complex of streptococcal pyrogenic enterotoxin c (spec) with a human t cell receptor beta chain (vbeta2.1)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
203
Chain Sequence
KKDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of two streptococcal superantigens bound to TCR beta chains reveal diversity in the architecture of T cell signaling complexes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
molecule keywords Exotoxin type C
total genus 50
structure length 203
sequence length 206
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ktkA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ktkA01
1SBBB 1JWSD 5ELBA 4DXGA 1PRTF 4RGMA 4Z9CB 1ET9A 2G9HD 3R8BA 5FK9C 1SE3A 2AQ3B 2CHBD 1HQRD 3SEBA 1F77A 3TSSA 1DYQA 1STEA 2Z8LA 1CK1A 3MFGA 1HTLD 3MC0B 4RGNA 1LO5D 1JCKB 1BCPB 1SE4A 1FNWA 4RCOA 1SXTA 1KTKA 1EEID 1I4RA 3DWAA 4L6TB 4TSSA 1L0XB 1CT1D 1I4QA 2QILA 1S5ED 5ELDA 2XRSD 1RD9D 4BWGB 3BVMA 1EU4A 2NTTA 3R2IA 1AN8A 1LTGD 1BCPF 1UNSA 1ENFA 1LTSD 1PTOC 2R61A 1PTOD 1FNVA 1EEFD 4O1NA 1RCVD 1RDPD 1D5MC 1V1PA 1M4VA 1HA5A 1PZID 1TS5A 1XTCD 1MD2D 5ELCA 3V05A 1KLUD 2TSSA 5ELFA 3EFXD 1D5XC 1DJRD 3GP7A 3W2DA 2ICIA 1HXYD 1B1ZA 1FD7D 2O2LD 1ET6A 1AW7A 2IPKD 3R2TA 1PRTD 1ESFA 4OHJA 2AQ1B 2XN9C 1JWUD 4L63B 1EU3A 1LLRD 1CHQD 4K6LA 1S5FD 1PTOB 1SJED 2XNAC 1TS3A 1I4XA 2RDGA 1BXTA 3BYYB 1S5BD 1D6EC 1LT4D 3URYA 3OWEB 1LT3D 1YN4A 1TY0A 3DWQA 4RHSA 5D3IB 1PRTB 3KLSX 1BCPD 1B44D 1FGBD 4RH6A 1CHPD 1TY2A 4DXFA 2NTSA 1PRTC 3O13A 2J4XA 3BZDB 1L0YB 5FKAC 4C56C 4RGOS 1TS2A 1EFID 1LTRD 2XRQD 1I4PA 3BVGA 1JR0D 2SEBD 1LTTD 1FNUA 5ELEA 1PTOH 1RF2D 1PZKD 1JQYD 1PYWD 1I4HA 3BYTB 1EWCA 1JWMD 1QILA 1T5XD 1CQVA 1YN3A 2AQ2B 1G8ZD 1GOZA 1UUPA 1LTID 1TS4A 1S5DD 1LT5D 5I4DA 1V1PB 1LTBD 1I4GA 4RHRA 2IJ0A 4RGTA 1PTOF 4UDUC 1YN5A 3BVZA 1D5ZC 1S5CD 2QEJC 3CHBD 4ZYSA 5TSSA 1SJHD 3EA6A 4RFBA 1LTAD 1SEBD 3DWPA 2RDHA 1LT6D 4NZLB 1V1OA 1PZJD 2WV6D 1BCPC 1SE2A 5D3DA 1XXGA 1KLGD
chains in the Genus database with same CATH superfamily
5IP4D 3I70A 4W9DA 2IBIB 4Z9CB 3HOYG 1VDZA 4JC0A 2VZKB 1SNMA 3IAM1 4GDLB 1QOGA 4RGNA 3DBHB 3GTPH 3H1UA 3JAML 5IP9G 2C7MB 5G5HA 3QR8A 2WU5B 1IBMQ 1Y8RC 2DX5B 2WXMA 5FLXE 4C3IB 1GJXA 3TP8A 3PUWA 1E0ZA 1HEZE 3AMZA 4YWLA 3ER0A 3RN5A 4G7OC 4PMCA 2XTIA 4JI5Q 2WNMA 3AEEB 1JOOA 3DVGX 3I7FA 1T0QC 1RDPD 2Z0SA 4C3IG 4R4CA 5CMDA 4OWTB 1HA5A 1XCQL 1YQBA 5ELCA 2F0NA 1XMQQ 3I4NB 4CYEA 1HUNA 1C79A 5A35A 2O5IC 3QX1A 3VYSA 1MFWA 3FPPA 4JI6Q 3H15A 1TWAB 1IBXA 3WA0A 1FD7D 4NXNQ 4EZLA 4BBRG 2ZM6Q 3JVZX 3R2TA 5FLMG 3M7GA 3GTLB 4USAA 1VLBA 3CQZB 4X64L 3A8IE 2CKHB 4OZAA 4ZRIA 2F4VQ 3K5LA 3RN2A 4HVBA 3AE4B 1G291 2QSDA 1IBML 3ZTCA 4X57B 2K14A 3VUXA 4M02A 3DVNV 1TWFB 4KJNA 2MUYA 3M62B 1DOYA 1F2ZA 1PFSA 4A3BG 4ZRKA 2A6EC 5C0XJ 2JA7B 1D2BA 3OWEB 1HNWL 3EJIA 3E5SA 4WFN3 1ILPA 4K7UA 2BE5D 2UWQA 3PUYA 2IY5B 4KKJA 1YZ6A 3L13A 1RL2A 1FGBD 1NJIC 3A4SC 1PA6A 1VQNA 2LVPA 2NCNA 1OO9B 2K9XA 2KD0A 3VHTC 4GDLA 1UF0A 1E24A 3VDYA 1K8GA 2YEPB 5J17A 4DV6Q 5C0XI 4N59A 2F0JA 2W9NA 2O6VD 3DBHI 1ZOYB 3AB9A 1IKLA 5CC4A 4N6EB 3PO2H 3CCEA 5D65A 3WANA 1FJGL 1RF2D 2L55A 1PV4A 3Q3FA 4GB9A 4KX6B 1N32L 1LACA 4IQZA 3Q6BA 5K5PA 1J7CA 3S1NH 2HD3A 2XWBB 4MNOA 4WQOB 5DPRA 1UUPA 2K5HA 4BY1B 1JORA 1F9PA 4TRDA 3H3VC 2UXDL 1TWAH 1Y1WB 2WQYB 2B8GA 5BMHA 4DXAB 2CU3A 2A4ZA 3ZDMC 2R93H 3VH4B 2J52A 2UXCQ 3VA7A 1C4AA 2HQLA 1LTAD 2OF1A 4WH4A 1X65A 4CJ0B 4R8IA 2VUMG 4AJYB 2RDHA 3GTMB 1JOQA 1AE3A 3FPUB 2ZJQA 2EYMA 4IUUA 5IYBH 4XQNA 2F0GA 1KC8C 2D3AA 2F0QA 1HR0L 1L2NA 3NWTA 1JWSD 1ICFB 2C5LC 2LASA 1E8ZA 2LFNA 5CBEE 5FO7B 2VUMB 4JI0L 3H0GH 4A3CG 2DNFA 4G7HC 2FUG1 2KDBA 5DM63 1WRDB 2M19A 3CU7A 1P7EA 5JH5C 4V190 1QNKA 2AQ3B 2DWQA 3AB5A 4P7IA 3J81i 3RUIB 2MGSA 3VUWA 1IHZA 2N9XA 1UGMA 4JBJA 1B3AA 1PH2A 3OMCA 4JW0A 1JT8A 5IGEA 3OPOA 4ZAIA 2MBHA 3MJ5A 2O2VA 2WAQE 1NYQA 1Q3LA 4HJ8A 1LGRA 2K8CA 1VQ8A 1KF6B 4S3SA 5EBCA 2HT1A 2EIFA 4XDCA 2JU6X 2PIAA 2UUCL 2DZMA 4B0MA 2FHTA 4FVMA 3ZJVA 3CPFA 4NXNL 2K22A 5LLIA 4DV5L 2DZIA 1T5EA 2NN6H 3T9LA 3ND9A 1A3TA 4LK0M 3UE0A 2DYBA 4A3IG 1PZID 1CSPA 1HTPA 1NR2A 4K2KA 5BN3A 4DV0L 2NVYH 2RSNA 1DOIA 3NZ3A 2RGFA 4PQXA 2KANA 3GE8C 3HHMA 4RMAA 3T1YL 1UGJA 1XF5L 4HR7B 2B76B 1O78A 3S2DH 1BT0A 2R7ZB 2BWES 4A3MG 2MEKA 4L5QA 1UAPA 3LX0A 2V3PA 3A55A 4JI7Q 2JA7G 2WDVB 1WJ6A 4HSVA 2VB3X 2RA4A 1VZ6A 2ZCCA 3Q3JA 4LNQA 1YJJA 3U52E 4C80A 3NJTA 3TEZA 2A68D 1PH1A 1PVOA 3B6YA 4S17A 1EY7A 2AWTA 1XJVA 2E2DC 1Q86C 1HJPA 1SYEA 2JA6B 4DV1L 1NENB 1UE6A 4R8NA 3AE6B 4LK1C 3QC8B 1B53A 3BINA 1J8CA 1D6EC 1NE3A 5JJZA 2Z6BA 3I90A 1X56A 2QJLA 2CKZB 3CP0A 3C0RB 4ASWC 4FO2A 3HOZH 1DD2A 3VYUA 5HHDG 3M4QA 4RH6A 4WJ3M 2JK8A 3O13A 4H44C 3I4NG 1NBWA 3BZDB 3M63B 3ZQ4A 2EOTA 3KUCB 1TKWB 4F87A 1MG8A 2EYOA 2F0VA 3P42A 4OWXB 2ZJDA 2LSSA 1WH3A 1WMHB 4G0NB 4MEMA 5I6WA 3WWVA 5CHWA 1K0SA 2JX5A 3DBSA 4H0LC 3RLOA 1V80A 3JAMi 1Q1BA 1E3PA 3RNGC 4X62L 5CTRC 5KYIA 2KLCA 4XIGS 2WACA 2B8FA 1B9NA 2B2TA 4I6LB 1JRPA 5KNBA 4WAFA 4JI7L 1XD3B 4IM2A 1G51A 1GC7A 4RGTA 1PXUA 1KH0A 2UU9L 1S5CD 3N3KB 3CXCA 5EKLA 2KJHB 2VL6A 2B2UA 1BMLC 2CW0D 5T1GA 2KVZA 3Q8BA 4CHKA 1JQ4A 1EQTA 4LAAA 3AI5A 3TEXA 4YCUA 2BGFA 4B9KA 4UAIA 4HPMB 1T0SC 3TUOA 3PHWB 4RM9A 1FR3A 1QNUA 3I3CA 4TQ1A 1YJIA 1YNTE 3T16A 1F9SA 3RULA 1TR5A 2ATWA 1RM6C 4ID6A 2WXNA 2CJOA 2LHEA 3NK9A 4ODGA 1N5WA 3V61A 3EIVA 2WKCA 4ZQ3A 1KQSA 3CSTA 1U5KA 3MEFA 3S1RH 1HRJA 5LNK1 2X6LA 3L0OA 3S15H 2BBCA 4JLCA 1G91A 2BYEA 3P1HA 2QILA 2KVRA 2V3NA 2PEAA 4DV3L 1HA6A 5BR8Q 2E2HH 2WXRA 3PLUA 3SVMA 3FP9A 4GOCA 4HPPA 3FHWA 3V60A 4A3DH 2KWDA 2KUMA 1ESRA 2WAQB 2UUBQ 2R61A 1PGXA 3ERSX 1FD6A 4CKCA 1SNDA 4GS3A 1LM0A 2KKCA 5IOCA 2L0CA 4DK6C 1V49A 2V3SA 2M17A 2AEHA 2MBEA 2NBUA 2MHVA 4J6HA 2OT2A 1FJGQ 3DBLI 4QF4A 1NYRA 1C7YA 1WXMA 1SE9A 3E0EA 5IODA 2QDFA 2EJFC 4BBNC 4R1JA 4W9KA 4AWJA 3GV6A 1WIAA 4F8CB 5J3BA 2IX3A 1M94A 3CMAA 1KAWA 3QO2A 1LLRD 3L3OC 2KN4A 2LS01 3CCJA 2FCQA 1S5FD 2KECA 1PDQA 2KXJA 5DLQE 1QB5D 3S1MH 4L2YA 5J1ZA 4PMWA 4UY8C 3D6CA 1BXTA 4E6IA 4LF5L 1K51A 4XXEA 2IGDA 1UZXB 4NY0A 1G2SA 3T56B 2A6ED 2TMPA 3PZDA 2F4VL 3P1MA 5BMGA 1HR0W 1WGYA 1EY4A 4GXBA 2R7DA 3WALA 1TWCB 3R7RA 3HKZE 3ENEA 5C4JH 1PRTB 5C4JB 1B44D 3NRZA 1ZGUB 3NUHB 4TQUS 4HJ9A 3FKIB 3TZUA 3HOVH 4MM3A 3DUZA 1UWXA 4Y52H 3RR5A 2PQEA 4K7WA 4JCVE 3OTOL 4X6AH 1VCBA 2ZTEA 1MHHE 3M7NA 4B08A 3PRZA 3R66C 2B39A 1Y56A 3N1XC 3ZGZA 5FJ8H 1TS2A 4LF9L 3RZDB 4DR5L 1YHBA 2R92H 4W9CA 4GLVB 4HKZE 1TU2B 2SEBD 1XO3A 1EIGA 4L5RC 2A6HD 4W9GA 3AU4A 4K6DA 5E1FA 5DPSA 1FL0A 3W1SA 2Z1CA 4IJHA 4KV6A 1A62A 1X3EA 5M5XB 1C0AA 4JX1C 1IL2A 1LUZA 4LF5Q 3QWZB 1V9JA 2KX0A 4JIOU 1P1AA 2CR5A 1CKNB 2WXKA 1V1PB 4HCEA 3CC7A 4WWPA 3T8MA 3UQAA 4BOSC 2J7ZA 1PTOF 3IFDA 1HZAA 3G6JB 1YN5A 2BW2A 1RAXA 2WDRB 3K57A 4IOIE 2CS4A 4KN4C 2AL6A 2RD0A 4IFDI 4YTNB 1ONLA 1ZKOA 2KQ4X 1E2ZA 2JYTA 2IT1A 1JRUA 2EVBA 1ZYRC 1RFAA 4HN7A 3RZOB 2HTHA 1M90C 3AE5B 2A69C 3VR8B 1RHPA 1XXGA 1FEHA 1SMYC 1T6BX 3L0WB 3VA5A 1XMOQ 3A56A 3D4RA 4NJ7A 5H1SE 2ZXRA 2F0IA 1N34L 2OEOA 2E2HB 3IKJA 4QQBX 3BS1A 3SGIA 4IOAA 3NTHA 1I6HB 2FXQA 5IAAC 3S2HH 1TJEA 3TSSA 2IZVB 1C3TA 1PYBA 2B2VA 3B0AA 4BKTA 3KWVA 3QIAA 1V5TA 2KCCA 4DV4Q 2PPHA 1B3QA 1ZE3D 2BYVE 4K7SA 3I3TB 1GPXA 1XNQL 4URKA 2ASQA 4H02A 4YSZB 2J0MA 4KMUC 2ICEC 3VR3A 1HNXL 3N30A 4CDCC 2M0XA 5LMUQ 3DPDA 3C1EA 1KD1C 3JAME 4YXDB 1WTXA 1SNPA 3PUZA 1AN8A 1Q7YC 3W5VB 1WM2A 2LGDA 4B6WA 4DHJB 1EL0A 1S1QB 3Q8EA 3A1QB 3JSVA 1FNVA 3S1QB 3TCAA 1YQ3B 4MH0E 4C3JH 1H95A 3MVVA 2ZW1A 3M95A 1U0LA 2KO3A 2WIIB 2HJ8A 2BS3B 4MGIE 4P6VF 3NY5A 3PZ7A 2HHHL 1GB1A 3AE8B 2B2YA 1WXAA 2LJIA 1KL9A 3GV3A 5LMNL 1R4NI 1FMAD 1IL8A 4DV5Q 1VQ6A 2N1WA 3CF5A 1L0VB 3DOWA 3ZUNA 3GTGB 1JE4A 1BBWA 1HTQA 1EYGA 4OHJA 2DGYA 1K83B 2XN9C 4R4IA 1VS0A 4L63B 4XWTA 4DV0Q 4B9WA 3MXPA 2ASBA 3H3VH 4HRSA 3SFDB 5G2NA 1H4RA 1L2FA 1STBA 3DBLB 1YNNC 1QOAA 2MBBB 2AL3A 1QVFA 3RNAC 2JQOA 3FKIH 1VQDA 3O65B 4AOFA 4FF1A 1CKOA 1TT2A 2RSOA 3PREA 5E6PA 2CCZA 2B3AA 3WCQA 2EE1A 3ONSA 3GTOH 3U58A 1P0RA 2I2YA 4IPCA 1RYJA 2D0OA 4LDTD 1WOCA 3AECB 3SFEB 3PIOA 4RHSA 1VQ4A 3U7DA 4L5SA 1V8QA 2LGIA 3T13A 1F2YA 1NTGA 5L83A 1Z2MA 1NCVA 4QIWB 1WXSA 2KFKB 4HIKA 2J4XA 3AEVA 2HCIA 1KM7A 2IWHA 3BK2A 1DGJA 1TIID 1KNAA 3GD7A 1IGCA 2AWOA 2PW9A 1JR0D 4A3BH 2GVBA 4KI0A 4LW1A 2Y5CA 3PO0A 3TEYA 1RRBA 2EYPA 4BS9A 1SMXA 2K52A 4MGKE 4DK0A 4MDKE 3HOXB 2N7DA 2YTYA 4DDID 4EZKA 1QT9A 1K8RB 2K6DB 2PNRC 3A7LA 2K5VA 2QW7A 3PQIA 2KWUB 3EN2A 1UH6A 5AJ3Q 4IURA 4J6IA 4KZCA 3OW7A 3P20A 2ES2A 4DAVA 4GLXA 2G1EA 4H13C 1VQBA 5C3WA 4GN5A 1Y1VH 1EF5A 3EFUA 2I38A 3DWGC 1HTOA 1EIFA 3S15B 2FJ2A 4UP8A 3PTFC 3KJOA 3VTVA 3VTUA 1C9FA 1KLGD 1E5WA 1SBBB 4RF1A 4K5WA 4JI2Q 1F9QA 2PMZB 1ZDVA 4IWPA 1YX5B 4OONA 3R8BA 2E5LQ 3NHHA 4FXGC 2D2CC 2BKFA 3OOCA 2IY1B 3HKSA 5BO4B 4LFAL 3PIPA 3UDXA 2Z8LA 4DK3C 4CQNA 2JXMB 3MC0B 3GE3C 1SE4A 1JCKB 2ZJRA 4WWNA 5M5WH 3SD5A 4ZDVA 1XYIA 1S3SG 4GGQA 1TVXA 1SMYD 4WORA 2K1FA 2LGYA 2MJEA 3IBEA 3CPWA 2BS2B 2CFMA 2AX5A 2FINB 3BVMA 3M3YH 4DWFA 4NPNA 1BO0A 2XVSA 3IAS1 4FHKA 3G7LA 4IKGA 3LNNA 1EQVA 4FDBA 3H0GG 1PTOC 1C76A 1L4DB 1UBQA 4DU9A 5GAGC 4HJKA 4WWMA 1CZWA 4LFAQ 4JI6L 2YYZA 2ON8A 4AP4C 1TS5A 3I91A 3PO3H 2WWZA 2CWPA 4OVZA 2DYOA 3ERQA 3SK5A 4IWOA 4CDDC 2EY1A 4PZ6A 4AYBG 2ZM6L 2CHXA 1V1QA 4NQKE 1WI0A 2KTFA 3K81C 3R93A 3PRMB 1JB7A 4BY1H 4CO7A 1A5RA 2WB1E 4MTNA 4LF6Q 1OQRA 1ESFA 1UBIA 2EYFA 2KOLA 4ANVA 4F8MA 3J80L 4M8MA 2C35B 3W5UB 3DEPA 3PMFA 5IOIA 3BDOA 1FGUA 5M3MH 1TWHB 2CU1A 1WGGA 3VH3B 1B2TA 2NS5A 1D1KA 4ZRJA 4N8FA 2RDBC 3ZNHB 2RDFA 2K8HA 1F9RA 4GMVA 3URYA 1H9JA 1VQHA 4DR3L 1NI3A 2W54A 3TP6A 4B3SQ 1D1IA 1TY0A 2B2YC 3HG9A 3M4YA 1S4ZA 4FA6A 3FMCA 4OL7A 1CUKA 1WTRA 3D8GA 2D3GA 3H7PA 1WYDA 4DXFA 1OXXK 2BA1A 2ONQA 1ACCA 3H94A 2JA7H 3OWFA 1RTOA 4NAWA 2K5PA 4BFRA 4YIJA 3BY4B 2LD9A 3SR6A 2QCPX 4OO1G 1HNZL 3S17H 1WY8A 2HCCA 1VRAB 1ML0D 3CC2A 4GKKQ 5IY0A 1PTOH 1JW9D 1JQYD 1TQOA 1VR9A 4GN1A 4WAAA 1T3QA 1I42A 1GUSA 4EVOA 3BG3A 1WD1A 4MELA 2CVRA 3V62A 2J42A 3DHHC 3SDZA 4HMJA 3IXSA 1TS4A 3E56A 2UXBQ 1SYBA 3ULJA 2J0TD 2I5HA 1AARA 3HUIA 4US9A 2WXFA 1TYGB 1DOLA 3BVZA 2GOWA 2RPVA 3VUYA 3J7AF 1E22A 1YEZA 5J18A 2RKSA 1HZ9A 3U4ZA 5JEAJ 4A90A 5JEAG 4DV2Q 3DWPA 2KDIA 2KLGA 3N9YC 1N36Q 4LFBQ 4A3OA 4ZHOA 1UWVA 2BE5C 4JI0Q 3DWMA 4JI2L 2NVQH 4JI8L 4F7XA 4UHVA 4GN3B 5FOBB 2PKOA 2G4DB 3NE5B 4E3CA 4C3IH 5FK9C 5T1IA 3Q8CA 1E0BA 4DN4M 3HGBA 1QZGA 4LJZC 4XT1B 1SIFA 2W3SA 1DYQA 1STEA 1VQFA 1CK1A 2K75A 2PZWA 3VRAB 4C2MH 4I7ZC 4P2CB 2VUMH 2PQAB 2BOSA 1CQFA 1HPCA 2K5DA 4NB3A 3A5ZB 4LUVA 1XNRQ 5JXVA 1CT1D 5G5GA 3X0WA 1K3RA 5IIFA 1R4QB 2C9WB 4B3MQ 2N0SB 2Z59B 4YWGG 1W3SA 5IT9E 4JV5Q 2WDQB 3GDEA 3QK0A 2K7VA 2R93B 2HD5B 4MGYE 1ENFA 3AE7B 3TMEA 1RCVD 1KDCA 3MHBA 1F1HA 1YQ4B 2IHFA 3G71A 4REZA 3P75A 1XTCD 2Y3AA 2FIDA 1X3GA 3SHLA 2MLBA 5LMUL 4DR2L 1U9RA 2D0PA 1IBKQ 2X6GA 1DJRD 2K25A 4DBGA 4GDKA 1SSNA 4LTUA 2K05A 1WVLA 1SYDA 2F0PA 4P72A 2ZVOA 2CH4A 3A4RA 2VS1A 1KDBA 1HZ5A 4XDDA 2C7HA 2INNE 3CIRB 4P75A 2BPSA 3OIPA 3ECIA 2F0SA 2N55A 2L76A 1KFYB 1FO4A 4HKQA 1X3PA 2AHOB 4CKBA 2DBYA 1R4NB 1HZBA 1E1OA 4A3EH 5E7NA 4K8JA 1WD0A 1E1TA 5HGTA 2KQ7A 3HKZG 4BA1I 4GOPC 2D5GA 1A70A 1LYLA 2C9OA 4ZCKA 1A15A 2JN4A 1IBLL 2LXAA 4TKOB 5C4XH 5IN7A 1SFOH 3I72A 5HKHA 1XQQA 4DAYA 3PS6A 2A1AA 4WRDA 3TL5A 1TWFH 2GVAA 3KJPA 1TY2A 2I1JA 4JL9A 5CHFA 5M3MB 2JSOA 3IRBA 2UU7A 3V6EB 2NVXH 2KEEA 2KQSA 1T9HA 5NUCA 2LVOA 1CM9A 1WSPA 4ZHPA 1WYGA 2XRQD 3EBEA 4JVZA 3PCOB 1I4PA 4ALPA 2F03A 1J7AA 3A1QA 3JSVB 1L1OA 1LTTD 1FNUA 3CMEA 3L10B 3NVYA 4I6PA 1N6ZA 4LWCA 5LXIB 4MH8A 4DV2L 4YWMA 4UPAA 3J81j 3ITPA 4PS7A 4IFDJ 2BDOA 1LTID 4O42A 4LNIA 1ZKHA 3VQIA 4DPGA 3NTKA 2IJ0A 1AH9A 5EE0A 3CCLA 3MXNA 2CW0C 4WURA 2F0LA 1SN8A 4TKNA 4IPHA 3DCGA 3AFQA 5CV6A 2EJMA 2F52A 4IALA 3S9WA 3J7ZC 3J7A5 3M4OB 1E90A 1L7YA 1P9DU 3D4WA 2JQRB 2KACA 4KZ0A 3ZNGC 3X3MA 2NYZD 5GAHC 2KAJA 3E3XA 1J0GA 5DPTA 4WJNA 2NTSA 3DVNU 3GB1A 3Q3NC 1LM8B 5KGUA 2CH4W 5M5WB 5KHQA 3H3VI 3NTIA 4G7ZC 2VZKD 1MIUA 2N7EA 3J9CA 3I57A 3W1SC 1WCMH 3QOLA 1HNXQ 2FNJB 4XX5A 4ZYNA 2JZ3B 2MJ8A 3VXWA 4BA2I 5C2TB 4ICVA 1BCPB 3MHSD 4KD3A 2IY0B 3I73A 2D5DA 1ZDXA 3EUB2 2K04A 3CCVA 1YJWA 1PH5A 3Q3MC 4HPLB 1JICA 1E7VA 4XDXA 1GG3A 4M0WA 4YCVA 1LTSD 3DLLA 2DUDA 1MGSA 4OZCA 4HJ7A 1F2MA 2KJRA 3NZSA 2EYHA 3OLMD 4RM8A 1OXSC 5IYCH 1PFNA 1SDFA 1FIQA 3KWLA 4ABNA 1E7ZA 5EBDA 3W2DA 2PO4A 5AUIA 3DBRI 4QGUA 4EE2A 1EWYC 3EQLC 2UUAL 2LKVA 5DNFA 2JA5H 2L7RA 4ZRZA 2IPKD 3TP7A 2F0HA 4GLAC 2GBRA 4KSKC 2DAJA 4KIKA 4ARCA 4AIMA 1E2VA 1OQYA 1YX6B 2L1BA 1CSQA 1U4AA 2HDEA 3PHXB 2G9DA 2REXA 1R9TH 1EYAA 4P74A 3PUVA 3Q2AC 1E6EB 4IUMB 2JXXA 1E8YA 1C9OA 2RDGA 4DGZA 2OWOA 2J0KA 4NNJB 4DUZL 3TIXA 2MJ3A 3DXJC 3PPAA 3SHQA 2EZVA 2K5NA 5CYUA 3B1LX 1QF6A 4C4VB 2HQEA 2RHSB 4XGAB 1GUGA 4POGA 1YVCA 2Z6KA 4IDIA 3P4SB 1GHJA 3QOJA 3QAQA 4KKTA 1JWAD 4XT3B 3ALBA 2WXIA 1X32A 1LQBA 1V9PA 3IT6B 2A69D 3SK8A 2IGGA 1CA6A 1CKNA 1JOKA 2Q2HA 1J19A 2KYWA 2A74C 1B4OA 4JGHB 2MQHA 2O6VB 4XQQA 2WINB 1K83H 1TT5B 1GKHA 4LDTB 1UEBA 3VTWA 4C1NI 3IAYA 4XTCS 3C8YA 3NVVA 3BVGA 4A55A 1EO6A 3W1YA 3OJ4B 1TWGB 1I35A 4DFAA 1IGDA 3NS8A 3NZUA 3HP3A 1MG4A 1RIPA 3Q14C 1OXVA 3PV1A 2MP1A 1EY6A 1YIWA 2JA8G 3I4MG 2RCNA 1WGKA 4DHJD 3MXGA 4GNXC 4O2DA 1N5XA 1XLNA 1N9WA 1V43A 1NR4A 2JYOA 1VQ7A 4NPSA 2RHQB 3NBHB 4RFBA 2IX1A 1OEYJ 1NUCA 1YBYA 2ZW0A 1B9RA 3NBHA 3RFZB 4B0EA 4WJ4A 3TS0A 2NB0A 2SDFA 3OIQA 3MJWA 4H2AA 3FVQA 4DR4Q 4DR1L 4B3RL 2EPBA 1ZP0B 3SK4A 3TP5A 4A3FH 1Q8IA 4DR7L 3NENA 2P5ZX 5ELBA 1S40A 2DHZA 2PVOD 3AH7A 4IG7B 1STYA 3AV8A 5D14A 3QQ8B 1XEEA 1LV9A 2F3VA 4B9XA 2JE6I 5HURA 5C3EH 1BKBA 3CCRA 3S2HB 5AUKA 2HE7A 4EQNA 4KV2A 4N58A 5KRUA 4HEA1 5HFYA 2L12A 3ND8A 1VCIA 2YTVA 4OO1I 4GLSC 3I4LA 1IBXB 3KFUA 4HDOA 1DM0B 5CV7A 2PI2A 1VF7A 2B63H 2XRSD 4DNTB 3DEOA 1EIYB 1RD9D 3L7ZC 3TRZA 2RR9A 1OGWA 4YY3Q 3A33B 1BCPF 3IG3A 3GTJH 2PQAA 2D10A 5C23A 2VQFQ 1UE5A 2L3ZA 1VQIA 5CHVC 4X3TA 5HY6A 1PMRA 3S16H 4JI5L 1VQGA 3CMMB 3NSWA 3CCSA 2LGXA 2KCTA 3KBXA 3K5OA 2K6QA 3KLWA 2D62A 3L9AX 4GIVA 5D94A 3QJZA 2GN5A 5EPLA 2KDFB 2QF7A 4BKSD 1X6OA 1L1OB 1GB4A 2DJGC 2BH2A 4DA2A 4C3HB 2IYDB 1ET6A 2WFWA 1CZPA 4R4OA 1E8XA 2MH7A 2YVCA 5M5YH 1JWUD 2L83A 2NBVB 2ZPNA 3WAMA 2FMCA 3RLFA 3PF5A 1YHQA 4EGVA 2E5LL 4Y7NH 1SJED 4QB4A 1JC7A 3GTKB 4A3BB 2N4FA 3MXNB 5HI1A 1OTCA 4IUTA 2K5WA 4GU2A 2LY7A 4NXML 4NAMA 3RD2A 1O80A 2N8NA 3BYYB 1A2UA 4XC2A 4NJCA 3LWEA 3ONAB 5J39A 1Z6HA 4MM3B 5I9PA 5FO8B 1F2LA 1XMOL 2O2VB 1DONA 5IGDA 1I50B 1SIJA 3AE1B 4OX9L 4WJWA 3T4AC 4HTHA 2JP1A 5CBAE 4KHVA 1V6EA 1PRTC 4KGSA 3ZRFA 4RF0A 1L0YB 3HM6X 3T51B 3H09A 2W82A 2RPQA 2IO1B 1BDOA 1II3A 4X65L 1XPUA 4RGOS 1VZ8A 1PUTA 1SB3C 2NVTH 4LF6L 4PYZA 3J7AV 3UDGA 1MHWC 5M3FG 1VQEA 3UIOB 5GMVA 5IGFA 1I4HA 1WTPA 2LWPA 1T5XD 4AH6A 4DV7L 3FC4A 1YN3A 1HHVA 1G8ZD 1GOZA 4KHPQ 3I55A 2EXDA 1LTBD 4B3TQ 4GNXB 2RCFA 4P71A 2MNAA 2INCC 1T0RC 3FRPB 1WF9A 3CHBD 1NMGA 3APCA 1EM7A 5TSSA 1A0IA 2QEXA 2KT7A 3KUDB 5LXHA 4LF7L 2B63G 5IT9L 5IKCM 4MN3A 4A93H 3M4PA 1WR6E 4A20A 3T1HL 4W9LA 4A3LH 1F52A 4ZUIA 2OOBB 1PH4A 3ZDTA 3G6EA 4APVA 2XGTA 2XK5B 3ML9A 1Q90A 2HHHQ 2PE9A 1H9MA 1F0ZA 5FLXL 1BUIC 1MKHA 1V5OA 4ARIA 2CHBD 3T53B 3EGRA 1F77A 2KTRA 4CDFC 4ZKCB 1LO5D 1Q82C 3AMUA 3N1YC 5EGTA 4RCOA 5IP7H 4FXDA 3DWAA 1HNZQ 3ZLZA 1A8VA 3I4OA 2E2JB 1PDXA 1QZEA 4AQYQ 3L4PA 4CJ1B 5C3EB 2UXBL 4RWSC 2K4KA 3PSIA 4KHPL 2R7FA 4KY6A 1I6HH 4RCNA 4DF7A 2KC1A 3ZKJC 2MO0A 2LGSA 3R3OA 1TBEA 4C1NK 4HIMA 3B2GA 4EQOA 3K8AA 3HOWH 1UNSA 2QDBA 4WWOA 4W9HA 2HUGA 2ALYB 3RZOH 1LFDA 4IW0A 1V1PA 2KJXA 5C0XH 1WTHA 4YCWA 3J80c 2FFKB 4HIDA 2GI9A 4E71A 1MVKA 4ZRQA 3V05A 2Q8RE 4N9TA 1ASZA 2MPMA 4JI3Q 3F8TA 1VQCA 4KKIA 1R7SA 4ZRPA 4B95A 3K0YA 3MEHA 3N1ZC 1UE7A 2ICIA 1TIFA 3P63A 4KIKB 4PYUA 5M3MG 1SE8A 3Q6SA 5I6YA 5FJ8G 1FCLA 3KLRA 1AW7A 1H9SA 1MBYA 1YIJA 1K73C 3KH0A 2L9HA 3OSOA 3GS2A 3NQIA 3NPPA 4FHJA 1I3QB 5EPJA 3ETRA 4FJZA 3D6WA 4W9IA 2ZXPA 1LTLA 1JJGA 2OJRA 5D6JB 2H88B 1QCBD 3MAQA 4AQYL 5KNDA 5IWAQ 1QZHA 2XNAC 4DR6Q 5C3XA 4DUYQ 1I94L 1RKNA 4PZ7A 4LJPB 5JJIA 3TEWA 1I50H 2J0JA 1A3UA 4BBRH 3RZDH 2EMTA 2KFJA 3BZKA 2KK8A 3D0FA 3HOZB 5JPNC 3R7QA 3FILA 1S5BD 4V0BA 4DQOC 3WDNA 1N32Q 3E9HA 1GAQB 3CRLC 2K6AA 1GUOA 5D3IB 2O5JC 1CMXB 1UD7A 1J6QA 1Y1WG 1EF1A 4YTMB 4P73A 3HS0C 1Z7TA 2I07B 4Y7NB 2MBOA 3RYTA 3ZW3A 5ELNA 1NDDA 3I56A 4JI4L 4IJLA 2HIVA 4A4IA 4A3LG 2C60A 3Q8FA 4S0RA 2JYEA 1KLVA 1NNXA 5I9OA 1EY8A 5IGCA 1WGDA 1TGZB 1NVID 3HRDD 2R7ZH 5E3FA 3MWYW 1WYWB 1SROA 2R93G 1K28A 5JAVA 1XTDA 1HNWQ 4BOZB 1BVSA 5KIXA 5JVH3 2OHFA 3ZJUA 2BYTA 5IE8A 4YY3L 2AMCB 4HLEA 1M1KC 1Q12A 2NVYB 1S3OA 3Q0AA 1C4CA 1CTMA 3ZXVA 1PFBA 3MP9A 4X66Q 4IWQA 3QG1A 4RHRA 4P1CC 4F7ZA 4UDUC 1OXUA 3TREA 2IDYA 1GO3E 2Q8TA 1G6ZA 1MSGA 3RI7C 3H6MA 2Q2IA 3K7AB 4FULA 3VAWA 4ICUA 1CZGA 3D31A 2JY6A 4NP5A 4IFDG 1E2WA 4QCLA 1LT6D 5FR6A 2JA6G 1PZJD 1C1YB 4FYDA 2HDMA 2E75C 4HCNB 1E9MA 1D5MC 2KHSA 2KQ3A 3ZYYX 1P16A 2VQEL 2XK5A 4TQ0A 5L37A 2D07B 1ET9A 3QIJA 1WTQA 2SOBA 2BDNA 2PZTA 2M1MA 3PV0A 2G4SA 1MSHA 4HROA 4C3HG 1QJOA 4OW0A 1S72A 3H0GB 1JJCB 5JEAH 1FFVA 4IN3A 2UXCL 3IFWB 4RKBA 3ML8A 1EEID 4JG2A 1Q1EA 4ANWA 3W1GA 4CBVA 4EOYA 1TZOA 2INDC 3J81E 1NEKB 4BZAA 5GADC 4A8XC 1I4QA 3NXWA 4BBSH 4DAYB 1CFMA 2GB1A 4P1BC 1B8AA 4BWGB 3BWUD 1XX8A 3FKIG 1SR3A 2KC2A 2KN5A 3L16A 2DY7A 4OEMB 1RJTA 4OELB 3VFKA 2L0TA 3PZ8A 2FBWB 1WXQA 3I9V1 1T0YA 4G4KA 1KOTA 1WCMG 1STNA 3NEMA 2G45B 1FRDA 1L1OC 3U50C 3ULLA 1HH2P 1W6JA 3S1NB 4L23A 4IC7B 3DHGC 1D5XC 4EX5A 4QJFA 1I5FA 1Q5WB 2OEDA 4HK2A 4G11A 1Q81C 5I2XA 4GDKB 2DENB 2UUCQ 2N1VA 3HOZG 2PW5A 4A3DG 5EE9A 3U4EG 4CGYB 1WJUA 2I5MX 3U7ZA 2PI2E 1RODA 5E6NA 4C7YA 1DGSA 2LXJA 4GSWA 2VQFL 1I4XA 1SAPA 3K59A 4A3MH 3FDTA 1YHAA 2BWFA 3H6NA 1SSOA 4K5XA 3JAMc 1E7UA 2EYJA 1PH9A 2JWUA 5IYCG 2R2QA 2F0OA 1HZCA 4LUOA 4II2B 2K01A 2NVXB 5CGKA 2JT4B 3S14H 3TJPA 3WAOA 2PE6B 1GUAB 2JSVX 2K1BA 3GO5A 4JBMA 2QIEB 1VQPA 1GXDC 4A6QA 4A3EG 2RVLA 5E4XA 4DR4L 4B3RQ 1WFYA 5JVG3 3W5OA 2PYKA 4NJ6A 4LFBL 1L6VA 2Q2UA 5LL6X 2XSCA 1SFOB 5FKAC 1R9TB 2YEPF 5C4XB 2KCNA 4M8AA 3LYYA 4KY7A 4JWSC 1SYFA 5C44B 5C44G 2EKEC 1EWHA 2BB6A 2KHJA 1EFID 3CWIA 1MJCA 3GTLH 1Z47A 3KBGA 4CJ2C 3S2AA 1EY0A 1STHA 3H91A 1N60A 4LCDE 5C4HA 4DR1Q 1WJJA 3EROA 5LMNQ 2Z4HA 4RG1A 1PZKD 4HJ5A 1VQLA 2NR2A 5EAYA 1JWMD 4DHZB 2I1KA 4K3CA 3E9SA 3V6CB 4X65Q 3I4NH 3C1FA 1PH6A 3VR6A 3M85A 3FAHA 4OZBA 2KZRA 2DJFC 4QUCA 2D2QA 4LJOB 2K50A 2F0KA 5I4DA 3S2DB 2BCOA 3RMHA 3HOUH 1B50A 3AEGB 3CF6E 4OX9Q 3RMKC 4B3TL 2D9UA 3NWSA 2QKIC 3F2DA 1P7FA 2E3TA 2I5LX 3AE9B 4JV5L 3RD4A 4MSMB 3BJUA 4WJQA 2LRWA 5JHBA 2M00A 3IHPC 3P4QB 3PO3G 5AEKB 4KY5A 2GA4B 1B9MA 5H8YE 1U4RA 4PT5A 1SE2A 1AZQA 5EPKA 4X3KA 5CV8A 5IYDG 5E4WC 5BN5A 1CI3M 2B63B 4X3SA 5DAUA 2AYOB 1JJ2A 2E2IH 4GN4B 4FN2A 2PW7A 1DOKA 2E2IB 1XPRA 3TQYA 2CWAA 3MFGA 3DHIC 1EOTA 1YMHE 4JI8Q 3LB8C 1SNQA 4KD4A 2LXKA 3QJYA 1L0XB 1CJEA 1E7PB 1VJKA 3U30A 5LHY1 1S5ED 3J81L 4DV6L 2KNBA 2K28A 4JPBW 2N7JA 1KHIA 2F3IA 3UDIA 3T1HQ 3KYDD 5AZHA 2RQXA 2EMSA 2LUMA 2NVUI 3ZXRA 4LNOA 4MSQB 1L4ZB 2EY5A 2NWGA 4KJOA 4ME3A 4YSYB 5FO9B 1K9MC 1K8OA 1PTOD 1U4LA 2NBWB 1GD7A 2GRIA 4WIPA 3GTMH 2KHIA 2Z6KC 3KF6A 4F88A 1M4VA 5D2MB 4XWWA 2LFIA 4JI4Q 3RPFC 2F0DA 5IA7A 1R4PB 2TSSA 3OJ3A 4G3XB 1H9RA 2JPHA 1C8CA 1PFMA 1WGRA 2J53A 2KDEB 1QUQB 1D7QA 2HIXA 2VB2X 5EKKA 2KMAA 5GXGB 5TR5A 4BAXA 2V1CC 1XT9B 2CQAA 3SE0A 4MT5A 5C44H 3K58A 1Q8KA 1BQQT 1CHQD 2A73B 1PTOB 3J81c 1FFUA 1MI0A 2JRHA 3VR5A 2L05A 4EFOA 2DNEA 2PNHA 3PO2B 1I94Q 3HRZC 2B3GA 3RT3B 4LNFA 1XCTL 5ISRA 4DR3Q 1Z5SB 2K39A 2UYZB 1LT4D 4A3IB 4TUUA 5J2RA 1X1MA 3A9JB 1J9OA 2WHIA 4ZOHC 4KN7C 1N33L 3OMGA 2EQSA 5CORA 1FYCA 5EE3A 2AKWB 4KDLB 3DVGY 1BBUA 2LMCA 3JW0X 2OQ0A 3AXCA 3K5MA 3NUCA 4PS8A 2WXJA 2MFIA 1PLFA 1KIXA 3F1ZA 2LXCA 4RNAA 3PGEA 4U673 4R4QA 1FPYA 3P4RB 4LLGM 3MTNB 2F1MA 2LEKA 1WI5A 2LVQA 4XZ4A 1GUWA 4HCSA 4A75A 3AYHB 3MA2B 3E0JA 1AP0A 3HFZB 1K52A 3SDLC 1YJ9A 3HEJA 3RNEC 3CQZH 3HOVG 4EKUA 4DAPA 2DYMA 4ME5A 2KDMA 4OIJA 3E6ZX 1WTOA 2J7QB 2E74C 1F2RC 1C4QA 2X8XX 4A3FG 4JI1L 4M8NA 2D3BA 4LNNA 5C4ZA 4LF9Q 1VQOA 3LXFA 3PO3B 3B2FA 2M9VA 1GNUA 1X55A 2MO1A 3TEHB 3WOEA 4A3GB 1L6UA 2K0PA 1PH8A 4BBSB 2IO3B 4BVUC 3N32A 1PYSB 2KMMA 1VQ9A 2RMMA 1BCPC 4X66L 3K0XA 1AFPA 3TDQA 4MGZE 1O7IA 4RAUC 5E6JA 3Q8AA 4EEWA 3I5JC 1U4MA 4LF4Q 2KOXA 1TXYA 3FKYA 3ZRCA 2B2VC 2LRUA 1TZ1A 3F2BA 3MTSA 3CSFA 3D3RA 2BVCA 3RCZA 3MXUA 2WKDA 4A3KG 2WAQG 1BNZA 2WP9B 4JI1Q 4CHTB 1I6VC 3U8ZA 3GTPB 4YT0B 2DN8A 4KSLC 1ZW7A 3STBC 4DR5Q 1VQ5A 1FVIA 1YNJC 2BH8A 5C6AA 5KEEA 3BDLA 5IWAL 4DR6L 4A93G 3H9DA 1BR9A 2ENBA 3PUXA 5EDSA 1SLJA 3A74A 1ROEA 4FJVB 1JWBD 3KW5B 1HR0Q 1WE7A 2JXTA 1UE1A 3AEFB 1CA5A 4BY7G 1EEFD 1SNCA 3KYCD 1P8LA 5M9OA 4ITKA 1C48A 3ZNID 3IT4B 1Y1VB 2FMMA 1ZXIA 4I6NB 2NZOA 5IYBG 4DR2Q 3GTQB 1HFGA 2QA4A 3M4OH 2MX2A 4R9WA 3GZNI 4ANXA 1A3VA 2V9HA 3U4VA 5EKIA 3LGJA 2B2TC 2F0EA 2F0FA 3CRKC 4WJOA 1U4PA 3GQBA 4KGTA 3HOUB 4G50A 2O2LD 2BF8B 1IYFA 2QHOA 3KOJA 4GKJQ 4GZYC 4HDQA 2ID0A 1X9NA 4LMQD 2EKIA 4C3JG 3S17B 4YL8A 4KGRA 2BS4B 1AWDA 3AE3B 2V4LA 2AUJD 3OW2A 5HGQA 3L17A 4US8A 4YSXB 4NDXA 2Y0SE 3NS1A 3RUZA 2DAFA 3T1YQ 4IUNA 3AEBB 3QWNA 1YI2A 3DQVA 4J3OD 1Q1OA 2YV5A 3U9SA 1WFQA 4IUPA 2MP2A 1UWMA 3KF8B 1KDAA 2ZXOA 3VRBB 2JEBI 1Q10A 4PV1C 1O7ZA 1L0WA 1B7YB 4A3IH 1K50A 3CCUA 4JWUC 4MACA 2DNCA 1D4BA 5ELOA 1PGAA 3DWQA 3WOFA 1YN4A 4TV3A 1Y8NB 2IGHA 2WXLA 3DHQA 4DUZQ 2Z4IA 1TWHH 5M3FB 4JQWC 4DHZE 4BKGA 3S14B 5LL6S 3HOXG 2B2WC 5A2QL 1PFDA 4IUQA 1YNND 2NPTA 1H9KA 3EFCA 4I65A 1F9JA 2A5HA 3AE2B 3UQBA 1YJNA 3A9KB 2WXPA 4IUVA 2XEWA 3PIO3 1DOXA 2IHEA 1X3FA 2F0TA 1MI2A 1C4PA 1EZ8A 2NN6I 4K1RB 1BUVT 5CV9A 4W9FA 3E9IA 2O4XA 4LFCQ 2G3QB 3ZO5B 1F2RI 3V2TA 1SJHD 4G57A 1YOVB 4XE0A 1Y8PB 3PF4A 3HOYB 4C3JB 1ENAA 2E8GA 1JE5A 3NVWA 4NZLB 2MCNB 3Q8DA 2HDLA 5K36H 1EUJA 1XNQQ 2D3CA 3VR9B 4ACFA 2ZTDA 5D3DA 4BY7H 4DXGA 1RWSA 1NAPA 2EELA 1UEAB 5BN4A 2G9HD 2AUKA 4AS1A 1SE3A 4XYQA 2JA5G 5BYSA 1HQRD 1N62A 3PT2B 4R4TA 3VR4A 3TBLD 2KHWB 1Y14B 1VQMA 1BBXC 4QY7A 4AYBB 4DR7Q 1IYJB 1WR1A 1I4RA 4C2MB 4JYAQ 3Q69A 2H1EA 3C3LA 5ELDA 3SXHA 1FXTB 1WE6A 2K3UA 5BYQA 4A93B 4DKAC 2GMIC 2NTTA 4ULLA 2VW9A 3RNFC 3BK1A 1LTGD 5EJWA 1PGBA 3HZXA 3APFA 2ZNVC 4B3SL 4M1UB 2UXDQ 3AU5A 2PPBC 3OG5A 2Z9HA 2NPTB 1SGHA 2AWNA 1MD2D 2JUOA 3HK0A 1STAA 2JVCA 2N9EB 5BR8L 1K53A 3M9BA 3GZNB 2DLBA 3ZVVA 3EFXD 3GP7A 2MBQA 3PIP3 4GKJL 1IXRA 1FCCC 2KA7A 1XWEA 2MQJA 4JOIA 4YWKA 2JZZA 3D32A 4NQLB 1KNEA 3CAMA 5JOBA 5H92C 4ZUJA 5C1ZA 2L8JA 2R92G 3RZFA 3SR1A 1PRTD 4OGQC 3HVZA 2L11A 1GC6A 3QARA 2IX0A 2BB5A 2VNUD 4HJGE 2BQQA 2F3WA 3IFTA 2V4DA 2QCZA 3SK6A 1A6XA 3HKZB 2EDGA 2N9KA 2K32A 2N88A 1EFWA 3MC8A 3VDZA 5GAEC 4BY1G 1V97A 1MJDA 4F1SA 5A2QE 4BXXH 4OO1H 3QB3A 4J8QA 4ZK9B 2VY3A 1AZPA 2F0MA 2JA8B 3I4MB 4EUTA 4J1MA 1WRIA 2OJWA 2SAKA 2Y0SB 2YTXA 4NW2A 3C2PA 3GTOB 2KFKA 3KLSX 2WB1G 3OAWA 4A3JB 4A3MB 2MW5A 1Q46A 1KXLA 1YNXA 3GTKH 1RLFA 1EQRA 3IL8A 3PRPB 5KNCA 1OTRB 1Z9FA 2EJGC 1ASYA 3DM1A 1TKYA 3LWUA 1IBLQ 5EE1A 5GQOA 3G4SA 2Q5WD 2VH2A 5M5YB 1Y1VG 2KENA 1JROA 2GBNA 4Q5VA 1QVGA 2H5XA 2NZHA 3X3NA 2L32A 5ELEA 2CHZA 4QIWE 4A3JG 3AQQA 1KRTA 4OWWB 2WGSA 1I3QH 1ZUD2 4NAWB 4A3KH 3CC4A 2ZNVB 3R3MA 4MZ9A 3X23A 2OCEA 4IM3A 1ENCA 2VXWA 3L08A 3JYUA 3S1QH 3VR2A 3CCMA 1J5EQ 2E6XA 3KYHC 2E76C 4AQ7A 1KABA 1IBKL 4JI3L 1SNOA 1XLQA 3RN9C 2DZKA 2L52A 3UI2A 5IGBA 2WS3B 5BMIA 2IL8A 4DV3Q 3VVWB 2M0AA 1VQJA 1B70B 4FNFA 4CKEA 1WTWA 1FXIA 5L95C 2FCMA 3HOWB 2KWVB 1MJEA 2G5DA 2KWCA 2WX0A 3C19A 4BBNF 2A6HC 1PRTF 1K8AC 1VQKA 4FXCA 3K9OB 1Y69U 2L1AA 3KDFB 1V8CA 2QDLA 2A68C 3J80i 4KKSA 2N3SA 2FUHB 3EHVA 1ZYRD 4K5VA 2PJHA 3G48A 2ZPYA 3ZTDA 2KBNA 4JYAL 3PSEB 1FNWA 4XQJA 1SXTA 4J15A 3S1RB 4PK1A 2KJ6A 4A3FB 1J8IA 3W9CB 4L6TB 1K3BC 4JOIC 4K0KL 2PMZE 2V1YA 1N36L 2W55A 2K8BA 2C7NB 2O6VA 3L2PA 4HMIA 3CW2C 1EU4A 4KHZA 4MJSB 1SYGA 3RLNA 3MFYA 3Q24A 4PNYA 3K7AH 5GROA 5JJLA 2MRPA 2ZCBA 4I7AA 5IYDH 2YU9B 3UF8A 4O1NA 3A0JA 3TBIB 3OYYA 2M56B 4HIOA 2GLSA 4HCPB 4K81A 4BXXG 3KVFB 3NVZA 3NG0A 4IPGA 2WXHA 4KDIC 2LMCB 3ZIMA 3Q3OC 3OTOQ 2LJ5A 1XLPA 5DM73 1SRUA 1JMCA 2ZVNA 1ZXTA 2EXZA 3A54A 1HUMA 3HOXH 2VH1A 2NUCA 3ZJYC 3IVFA 3KUZA 3MC9A 3K80C 4JE3B 1GVPA 2AQ1B 4DNIA 2YLMA 2BA0A 4TVAB 2MJDA 3H7SA 2XWJB 2XBBC 3NOBA 1QKZA 4K6LA 1EY9A 1H9SB 4RKLA 1N8RC 1ICWA 4OIKA 4KK7A 4K0KQ 2WX1A 3GOEA 1VQAA 1ZEQX 3QHTA 3TS2A 3KQ4A 3FEWX 1FXAA 4A3JH 3STBD 2NVTB 3RNUA 3PO2G 1H8CA 2A19A 1TWCH 2QC8A 2I0QA 4N9PA 4DV7Q 2F0WA 4L1BA 3ABVB 1NSNS 4LF8L 1C78A 1VDVA 3J80E 3H7PB 4GKKL 4GOPB 4BBRB 2ZEQA 4DAMA 4LNKA 3S24A 5CX3A 1CHPD 1KAAA 5C5MA 2BTEA 2PZUA 2N78A 2EY2A 5EQ0A 5C4XG 1QG7A 2HJ1A 2N49A 1KRSA 4IPDA 1N34Q 2JRIB 1A2TA 1SYCA 1QOBA 1GUTA 2VQEQ 1WJNA 2NMQA 2JA6H 1QOHA 4UP9A 1IUEA 2QMTA 1ISNA 4UP7A 2WLBA 3AULA 5DCNA 5AZFA 2A5UA 3ZNZB 2X38A 3V96A 2KTRB 1DXMA 1PYWD 3WAPA 3C46A 4HSPA 4LF8Q 3CD6A 4ANUA 5JZEB 4FADA 4M01A 1D3ZA 4A3CH 2MWSB 3LJ3A 2WXOA 4KVGB 4E74A 3GTGH 5I2YA 3UDFA 1S5DD 1EUVB 1PH7A 4AUQC 2OTJA 4XYCA 5FLXc 3UI3A 1QUQA 3F2CA 1WJ4A 2F4IA 4K3BA 3CKIB 2RBMA 1EWIA 4W9JA 4A3DB 3APDA 1JB3A 2NZ1D 4KKUA 3UE1A 2L0FA 1HE8A 3BZCA 5C0XG 4W9EA 1EIHA 2MP2B 2PLPA 4A9AA 3T3NA 1IW7D 4BKSA 2YU9H 4A76A 3GTJB 2E2JH 3AM9A 4AYBE 1VMCA 4RGMA 3KUPA 3HOUG 1IKMA 2NN6G 5AFWA 2PMVA 4QL5A 3B9JA 1WGHA 4RA8A 5CV5A 3NP8A 3SEBA 4JPSA 1WCMB 3KDFA 4CDEC 4MHEA 3SU8X 4NMZA 1V81A 3M3JA 4QAYA 4IOCA 3EECA 4M0WB 3RNCC 4FXKC 1ILQA 1KTKA 1UELA 4BY7B 3B08A 2PCFB 4TSSA 1YNJD 2FE8A 3A9JA 2K5QA 3DBRB 3Q23A 3P4PB 2EY6A 2M2LA 1P98A 3UGBB 3HIZA 3FILB 2GBMA 4HAEA 2GBKA 3N20C 1LABA 1AEXA 3I8ZA 3DMUA 1N61A 4M00A 4DUYL 1HZ6A 2CJNA 4U68A 2WB1B 3U9OA 4PS3A 4OVVA 2LI5A 4IFDH 5AZGA 2WXGA 5JPMC 4LF4L 4WJPA 1Y8OB 4Q2JA 2ZJPA 3HVDA 1B1ZA 1OQQA 3K6OA 5IP9H 4O0AA 2Z0DB 3QA8A 4DV4L 2JEAI 3WIMA 4A3KB 2ACZB 1EOVA 2SNSA 5M5XH 4KLKA 5LMNW 2W3RA 4R3DA 2HTME 4HXDA 5C3JB 1X3QA 1QLBB 1EU3A 1TWGH 2B2WA 2I46A 2IW3A 4EQ5A 4HJAA 3VYTA 4IM0A 5HG2A 1WZ0A 1EZ6A 3U2SC 1J5EL 1I7HA 1TS3A 2GBJA 1GUNA 2R92B 1O7LA 1IPGA 3RZWC 2OTLA 2VZAA 2V4IB 4X3UA 5G3LF 1GHKA 1SF0A 4C7ZA 1GM5A 3HOVB 3TMPB 1W6KA 4YHHQ 4FF2A 1XPOA 1DZ1A 3AN1A 1BCPD 4DV1Q 4DNRB 4FF4A 4LFCL 3J7YW 3W1BA 1VMPA 1XLOA 3DDCB 2INPE 2JA8H 3AU7A 3I4MH 4DK5A 1W2BA 2M4NA 1TTNA 3AFPA 1IYVA 4EQPA 1XMQL 2M8SA 1LTRD 1OXTA 1R4MI 1HCZA 2NBFA 1VZ7A 4FP5D 3S1MB 5IP7G 2ZT9C 2KVMA 3KK7A 3K9PB 3PVLA 4C3HH 3T3OA 3EC8A 2XIWA 3NQTA 1YD8U 3RNBC 3BYTB 1QILA 1CQVA 3TZDA 4DK1A 5JHAA 1WXVA 2AQ2B 5CR3A 1STGA 3D4DA 1LXDA 3CCQA 2JA5B 2FIFA 2BKRB 3N6RA 3HM3A 3LDZE 4QMGA 3L54A 1P3QU 3HOWG 3S16B 1WTVA 1E8WA 2WXQA 1K8MA 3ZJTA 5IGGA 1Q0WB 2R3ZA 1D5ZC 1C77A 2LUEA 4OXPA 4GNXA 2N9LA 4JBWA 4YHHL 2BYFA 3I2ZA 4PG3A 1AYFA 4X64Q 2KMCA 3V3XA 5F2DA 3P7JA 2Y5BB 4IO9A 4P16A 2Y5PA 1G6JA 1V1OA 5DPWA 1NY4A 4L8JA 2WV6D 4NKLA 2MSED 4QUFA 1JALA 1R4MB 4TMAB 4GOPA 3AEDB 1EYDA 1WMHA 2LHDA 5J22A 1VF5C 3QCAA 4EZJA 1EY5A 4MIUA 3UIPB 2BT6A 2MA9B 1NBFC 2R7ZG 1HTLD 4OVUA 4IZ8A 4K14A 5T8IA 2WDTB 4D2KA 3KLSA 1RTNA 2NVQB 1G2TA 4H7BA 2B2UC 1QOFA 5G3LD 2FCNA 2RSUA 1WX8A 2JZPA 4MTKA 2L00B 4MJSA 2WP8J 3BU2A 5FR3A 4A3GH 5C3EG 1JMLA 1PQSA 4NXMQ 2CHWA 4JK1C 4PZ8A 3VYRA 3R2IA 4ZKBB 2DY8A 3MZ5A 4YTPB 1D8LA 5K36G 2JF5A 2Y0SG 2D11A 3F2UA 2ZZPB 5JJKA 1Y1WH 2MHJA 1MPEA 4II3B 2FCSA 3HOYH 3ULPA 2RF4A 4XYOA 4ZLTF 1WZ3A 4C4VA 4B3ML 1KLUD 4N9F4 5ELFA 5MPOA 4KTAA 3N52A 3A9KA 1HXYD 2SNMA 3A8JE 4K8IA 2ZTCA 1IW7C 2JA9A 2K33A 3OHXC 3K5NA 2UUBL 1XNRL 4FBJB 2N9PC 1IYUA 4POFA 4JBKA 1O7YA 1G6PA 1OEYA 4FF3A 2X69A 1NI2A 4HWIB 5IO9A 2KEDA 2F0UA 5KYLA 3I63C 2H4OA 3MHZA 2C5CA 1RFKA 1ZPSA 2KX3A 2L15A 1OFFA 5G55A 2Q8IB 2CQOA 1X54A 2L5TA 3A7AB 1BOSA 4BBSG 3W3AA 1EQQA 1IZ6A 2FAZA 2V0GA 3PGZA 2K03A 4Q0FA 1BF4A 3P2BA 2EYLA 1A63A 1LT3D 5M3FH 1HQMC 4LUZA 3KF8A 1AE2A 4L5TA 3TN2A 3BDCA 2R6GA 4K2LA 2WU2B 5E6OA 2PVGC 4HEDA 5C5LA 2Q2TA 3Q22A 2IO2B 1FM0D 4FJYA 1WX9A 1QVCA 5DEHA 1V86A 4RMFA 4FLHA 1YJ1A 2VRRB 5FLMH 4C56C 2KCMA 2WYQA 3K7UC 2OXPA 2Z0EB 2JJQA 4DDGD 4ILWA 2QGQA 4LF7Q 2A8VA 2DZJA 2IO0B 3DM3A 4WQMA 4X62Q 1VD2A 3A8KE 5COYA 1YITA 1KJTA 2LZ6A 1M8AA 2OQKA 4A3EB 1ZXHA 2PTLA 2R2OA 5D7GA 1GJZA 1CKMA 1EWCA 1N63A 1WX7A 3H8HA 2B29A 3UINB 1V2YA 4A3PA 2H89B 5CV4A 4AJWA 1PH3A 1DCZA 1WM3A 5BYRA 3ICEA 1TKGA 3BIID 5AJ3L 1EYCA 1L5PA 1LT5D 2UU9Q 3NBIA 1I4GA 2UUAQ 1KRHA 3A5UA 2L4NA 2QEJC 3AEAB 1MHXA 4ZYSA 5IT9c 3JC66 3EA6A 4C00A 1IP9A 1FRRA 1N33Q 3GTQH 1J7BA 3EVQA 1DOMA 3M3YB 1SEBD 1QQRA 1QE6A 3NHEB 4N8X1 1HFNA 5KHOA 1WWTA 4A3GG 3KF6B 2JWZA 1E10A 1TKEA 3NELA 3PLVA 1NMFA 1PHJA 1K0RA 4PMBA 1QWYA
chains in the Genus database with same CATH topology
3I70A 4Z9CB 1VDZA 2VZKB 1SNMA 3IAM1 4GDLB 1QOGA 4RGNA 3JAML 5G5HA 2WU5B 2WXMA 5FLXE 4C3IB 1GJXA 3TP8A 3PUWA 1E0ZA 1HEZE 3AMZA 4G7OC 4PMCA 2WNMA 3AEEB 1JOOA 1RDPD 4C3IG 5CMDA 1HA5A 1XCQL 5ELCA 2F0NA 3I4NB 1HUNA 1C79A 5A35A 2O5IC 3VYSA 3FPPA 1TWAB 1IBXA 1FD7D 3R2TA 3M7GA 3GTLB 4USAA 1VLBA 3CQZB 3A8IE 4OZAA 3K5LA 3AE4B 1G291 2QSDA 1TWFB 4KJNA 2MUYA 1DOYA 1F2ZA 2A6EC 5C0XJ 2JA7B 1D2BA 3OWEB 3EJIA 3E5SA 4WFN3 1ILPA 2BE5D 3PUYA 4KKJA 1FGBD 1OO9B 2K9XA 2YEPB 5C0XI 4N59A 2F0JA 1ZOYB 3AB9A 1IKLA 5CC4A 4N6EB 5D65A 1RF2D 2L55A 4KX6B 1LACA 4IQZA 5K5PA 1J7CA 2XWBB 1UUPA 4BY1B 1JORA 1F9PA 4TRDA 3H3VC 1Y1WB 2WQYB 2B8GA 5BMHA 2CU3A 2J52A 3VA7A 1C4AA 1LTAD 2OF1A 4WH4A 4R8IA 4CJ0B 2RDHA 3GTMB 1JOQA 3FPUB 2EYMA 4IUUA 4XQNA 2F0GA 2F0QA 3NWTA 1JWSD 2LFNA 5CBEE 5FO7B 2VUMB 2FUG1 4G7HC 2M19A 5DM63 3CU7A 1P7EA 4V190 1QNKA 2AQ3B 2DWQA 3AB5A 2MGSA 1IHZA 1B3AA 3OMCA 5IGEA 3OPOA 4ZAIA 3MJ5A 1NYQA 1Q3LA 1KF6B 4S3SA 5EBCA 4XDCA 2JU6X 2PIAA 4B0MA 2FHTA 4FVMA 3ZJVA 2K22A 1T5EA 2NN6H 3ND9A 1A3TA 4LK0M 1PZID 1HTPA 1NR2A 4K2KA 5BN3A 2RSNA 1DOIA 3NZ3A 4PQXA 1XF5L 1UGJA 2B76B 4HR7B 1O78A 2R7ZB 2MEKA 1UAPA 3LX0A 2V3PA 3A55A 2WDVB 4HSVA 2VB3X 2RA4A 1VZ6A 1YJJA 3U52E 4C80A 3TEZA 2A68D 1EY7A 2E2DC 2JA6B 1SYEA 1NENB 4R8NA 3AE6B 4LK1C 1B53A 1D6EC 5JJZA 3I90A 2QJLA 4FO2A 1DD2A 3VYUA 5HHDG 4RH6A 3O13A 4H44C 3BZDB 3ZQ4A 2EOTA 1TKWB 4F87A 2EYOA 2F0VA 3P42A 5I6WA 2JX5A 4H0LC 1Q1BA 5KYIA 4XIGS 2WACA 2B8FA 1B9NA 2B2TA 4WAFA 1JRPA 5KNBA 4RGTA 1PXUA 1KH0A 1S5CD 5EKLA 2B2UA 1BMLC 2CW0D 5T1GA 3Q8BA 1JQ4A 1EQTA 4LAAA 3TEXA 4UAIA 3TUOA 1FR3A 1QNUA 3I3CA 4TQ1A 1YJIA 1YNTE 3T16A 1F9SA 1TR5A 1RM6C 4ID6A 2WXNA 2CJOA 2LHEA 3NK9A 4ODGA 1N5WA 2WKCA 4ZQ3A 1HRJA 5LNK1 2X6LA 2BBCA 1G91A 3P1HA 2QILA 2V3NA 1HA6A 2WXRA 3SVMA 2KWDA 2KUMA 1ESRA 2WAQB 1PGXA 2R61A 1FD6A 4CKCA 1SNDA 5IOCA 2L0CA 2MHVA 4J6HA 2OT2A 4QF4A 1NYRA 5IODA 2EJFC 3GV6A 2IX3A 3QO2A 1LLRD 3L3OC 2KN4A 2LS01 1S5FD 2KECA 1PDQA 1QB5D 4L2YA 5J1ZA 4PMWA 3D6CA 1BXTA 4E6IA 1K51A 4XXEA 2IGDA 1G2SA 3T56B 2A6ED 2TMPA 3P1MA 5BMGA 1EY4A 1TWCB 1PRTB 5C4JB 1B44D 3NRZA 3NUHB 4TQUS 3FKIB 3TZUA 3DUZA 1UWXA 2PQEA 1MHHE 3M7NA 4B08A 3ZGZA 2B39A 1Y56A 1TS2A 3RZDB 4HKZE 1TU2B 2SEBD 1XO3A 1EIGA 2A6HD 4K6DA 5E1FA 3W1SA 2Z1CA 5M5XB 4KV6A 4JX1C 2WXKA 1V1PB 4HCEA 2J7ZA 1PTOF 3IFDA 3G6JB 1YN5A 2BW2A 2WDRB 4IOIE 3K57A 4KN4C 4IFDI 4YTNB 1ONLA 1ZKOA 2KQ4X 1E2ZA 2JYTA 2IT1A 2EVBA 1ZYRC 4HN7A 3RZOB 3AE5B 2A69C 3VR8B 1RHPA 1XXGA 1FEHA 1SMYC 1T6BX 3VA5A 3A56A 3D4RA 2ZXRA 2F0IA 2OEOA 2E2HB 3IKJA 3BS1A 1I6HB 3NTHA 1TJEA 3TSSA 2B2VA 3KWVA 3QIAA 2KCCA 1ZE3D 1GPXA 4YSZB 4KMUC 2ICEC 3VR3A 3C1EA 3JAME 4YXDB 1WTXA 1SNPA 3PUZA 1AN8A 3W5VB 1EL0A 3Q8EA 1FNVA 3S1QB 1YQ3B 3MVVA 2ZW1A 2WIIB 4P6VF 2BS3B 3PZ7A 1GB1A 3AE8B 2B2YA 2LJIA 3GV3A 1FMAD 1IL8A 1L0VB 3GTGB 1JE4A 4OHJA 3SR6A 1K83B 2XN9C 4XWTA 4L63B 3SFDB 4B9WA 3MXPA 4HRSA 1STBA 1YNNC 1QOAA 4FF1A 1TT2A 2RSOA 3WCQA 2EE1A 2I2YA 1RYJA 3AECB 3SFEB 4RHSA 1V8QA 2LGIA 3T13A 1F2YA 1NCVA 4QIWB 2J4XA 2HCIA 2IWHA 3BK2A 1DGJA 1TIID 1KNAA 3GD7A 1IGCA 2AWOA 2PW9A 1JR0D 4KI0A 2Y5CA 3PO0A 3TEYA 2EYPA 4BS9A 4DK0A 3HOXB 1QT9A 2PNRC 3A7LA 4IURA 3OW7A 3P20A 4DAVA 2G1EA 4H13C 5C3WA 2I38A 3DWGC 3S15B 2FJ2A 1C9FA 1KLGD 4RF1A 1SBBB 4K5WA 1F9QA 2PMZB 1ZDVA 3R8BA 3NHHA 4FXGC 2D2CC 3OOCA 2Z8LA 4CQNA 2JXMB 3MC0B 1SE4A 1JCKB 1XYIA 1TVXA 1SMYD 4WORA 2MJEA 2BS2B 2AX5A 2FINB 3BVMA 1BO0A 2XVSA 3IAS1 3G7LA 4IKGA 3LNNA 1EQVA 1PTOC 1C76A 1L4DB 4DU9A 4WWMA 1CZWA 2YYZA 2ON8A 1TS5A 3I91A 4OVZA 2DYOA 3ERQA 3SK5A 2EY1A 3R93A 1OQRA 1ESFA 2EYFA 2KOLA 4F8MA 3J80L 3W5UB 3DEPA 3PMFA 3BDOA 1TWHB 1B2TA 1D1KA 2RDFA 1F9RA 3URYA 1H9JA 1NI3A 2W54A 3TP6A 1D1IA 1TY0A 2B2YC 3HG9A 3M4YA 1S4ZA 3FMCA 4OL7A 1WTRA 3D8GA 4DXFA 1OXXK 2BA1A 2ONQA 1ACCA 3H94A 3OWFA 1RTOA 2K5PA 4YIJA 2QCPX 4OO1G 2HCCA 1VRAB 1ML0D 1PTOH 1JW9D 1JQYD 1TQOA 1VR9A 1T3QA 1GUSA 4EVOA 3BG3A 1WD1A 2CVRA 2J42A 3SDZA 4HMJA 3IXSA 1TS4A 3E56A 3HUIA 1SYBA 2J0TD 4US9A 2WXFA 1TYGB 1DOLA 3BVZA 2RPVA 3J7AF 2RKSA 5JEAJ 4A90A 5JEAG 3DWPA 3N9YC 4ZHOA 2BE5C 3DWMA 4F7XA 5FOBB 2PKOA 3NE5B 3Q8CA 5T1IA 5FK9C 1E0BA 4DN4M 3HGBA 4LJZC 4XT1B 2W3SA 1DYQA 1STEA 2PZWA 1CK1A 3VRAB 4I7ZC 4P2CB 2BOSA 1CQFA 1HPCA 2K5DA 5JXVA 1CT1D 5G5GA 5IIFA 1R4QB 2N0SB 5IT9E 2WDQB 2K7VA 2R93B 1ENFA 3AE7B 3TMEA 1RCVD 1KDCA 3MHBA 1YQ4B 4REZA 3P75A 1XTCD 2Y3AA 3SHLA 1U9RA 2X6GA 1DJRD 1SSNA 2K05A 1WVLA 1SYDA 2F0PA 1KDBA 1HZ5A 4XDDA 2INNE 3CIRB 3OIPA 2F0SA 2N55A 1KFYB 1FO4A 4HKQA 1X3PA 4CKBA 2DBYA 1WD0A 4K8JA 5HGTA 4BA1I 2D5GA 1A70A 2C9OA 1A15A 4TKOB 3I72A 4DAYA 4WRDA 1TY2A 5M3MB 2JSOA 2KEEA 5NUCA 1CM9A 1WSPA 4ZHPA 1WYGA 2XRQD 1I4PA 2F03A 1J7AA 1LTTD 1FNUA 3NVYA 4MH8A 3ITPA 4IFDJ 2BDOA 1LTID 4O42A 3VQIA 3NTKA 2IJ0A 5EE0A 3MXNA 2CW0C 4WURA 2F0LA 3S9WA 5CV6A 2EJMA 4IALA 3M4OB 1DOXA 3D4WA 2JQRB 2KACA 3X3MA 2NYZD 2KAJA 2NTSA 3GB1A 5KGUA 5M5WB 3NTIA 4G7ZC 2VZKD 3J9CA 3I57A 3QOLA 2MJ8A 4BA2I 5C2TB 1BCPB 4KD3A 3I73A 2D5DA 1ZDXA 3EUB2 2K04A 1JICA 4XDXA 4M0WA 1LTSD 1MGSA 4OZCA 1F2MA 2EYHA 1OXSC 1PFNA 1SDFA 1FIQA 3KWLA 4ABNA 3W2DA 5EBDA 5AUIA 2PO4A 4EE2A 1EWYC 3EQLC 2LKVA 5DNFA 4ZRZA 2IPKD 3TP7A 2F0HA 4ARCA 1E2VA 2HDEA 2L1BA 2G9DA 1EYAA 3PUVA 1E6EB 2RDGA 4DGZA 2MJ3A 3DXJC 2EZVA 5CYUA 1QF6A 2HQEA 1GUGA 4IDIA 3P4SB 1GHJA 3QOJA 4KKTA 1JWAD 4XT3B 2WXIA 1X32A 3IT6B 2A69D 3SK8A 2IGGA 1CA6A 1JOKA 2A74C 1B4OA 4XQQA 2WINB 4C1NI 3IAYA 4XTCS 3C8YA 3NVVA 3BVGA 4A55A 1TWGB 4DFAA 1IGDA 3HP3A 1OXVA 2MP1A 1EY6A 1WGKA 3MXGA 1N5XA 1XLNA 1V43A 1NR4A 2JYOA 4RFBA 2IX1A 1NUCA 2ZW0A 1B9RA 3NBHA 3RFZB 4B0EA 2NB0A 2SDFA 3OIQA 4H2AA 3FVQA 2EPBA 1ZP0B 3SK4A 3TP5A 1Q8IA 2PVOD 5ELBA 3AH7A 1STYA 3AV8A 5D14A 1XEEA 1LV9A 2F3VA 4B9XA 2JE6I 5HURA 3S2HB 5AUKA 4EQNA 4N58A 5KRUA 4HEA1 5HFYA 2L12A 3ND8A 1VCIA 4OO1I 1IBXB 4GLSC 3I4LA 1DM0B 5CV7A 1VF7A 2XRSD 4DNTB 3DEOA 1RD9D 3L7ZC 1BCPF 4X3TA 1PMRA 3NSWA 3KBXA 3K5OA 2D62A 3L9AX 5EPLA 2QF7A 1GB4A 4DA2A 4C3HB 1ET6A 1CZPA 2MH7A 1JWUD 2L83A 2FMCA 3RLFA 4EGVA 1SJED 4QB4A 1JC7A 3GTKB 4A3BB 5HI1A 4IUTA 2K5WA 2LY7A 4NAMA 1O80A 3BYYB 1A2UA 4NJCA 3LWEA 3ONAB 5J39A 1Z6HA 4MM3B 5I9PA 5FO8B 1F2LA 1DONA 5IGDA 1I50B 1SIJA 3AE1B 4WJWA 3T4AC 4HTHA 2JP1A 5CBAE 4KHVA 4KGSA 1PRTC 4RF0A 1L0YB 3T51B 3H09A 2W82A 1BDOA 1II3A 4RGOS 1VZ8A 1PUTA 1SB3C 3J7AV 5IGFA 1I4HA 1WTPA 1T5XD 3FC4A 1YN3A 1HHVA 1G8ZD 1GOZA 1LTBD 3FRPB 3CHBD 1EM7A 5TSSA 5IT9L 4MN3A 4ZUIA 1Q90A 1H9MA 1F0ZA 5FLXL 1BUIC 4ARIA 2CHBD 3T53B 3EGRA 1F77A 3AMUA 4ZKCB 1LO5D 5EGTA 4RCOA 4FXDA 3DWAA 2E2JB 1PDXA 3L4PA 4CJ1B 5C3EB 4RWSC 4KY6A 4RCNA 4DF7A 3R3OA 4C1NK 3B2GA 4EQOA 1UNSA 2QDBA 2HUGA 1V1PA 2KJXA 5C0XH 2GI9A 2FFKB 1MVKA 4ZRQA 3V05A 2Q8RE 4N9TA 2MPMA 4KKIA 4ZRPA 1R7SA 3K0YA 3MEHA 2ICIA 3P63A 3Q6SA 5I6YA 1FCLA 3KLRA 1AW7A 1H9SA 1MBYA 2L9HA 3OSOA 3GS2A 3NQIA 3NPPA 1I3QB 5EPJA 3ETRA 3D6WA 2ZXPA 2H88B 1QCBD 3MAQA 5KNDA 2XNAC 5C3XA 1RKNA 3TEWA 1A3UA 3HOZB 5JPNC 3FILA 1S5BD 4V0BA 4DQOC 3WDNA 1GAQB 3CRLC 2K6AA 1GUOA 5D3IB 2O5JC 4YTMB 3HS0C 1Z7TA 2I07B 4Y7NB 3Q8FA 2JYEA 5I9OA 1EY8A 5IGCA 1NVID 3HRDD 5E3FA 3MWYW 5JAVA 5KIXA 5JVH3 2OHFA 3ZJUA 2BYTA 1Q12A 2NVYB 3Q0AA 1C4CA 1CTMA 1PFBA 3MP9A 3QG1A 4RHRA 4UDUC 1OXUA 2IDYA 2Q8TA 1G6ZA 1MSGA 3H6MA 3K7AB 1CZGA 3D31A 4NP5A 4IFDG 1E2WA 4QCLA 1LT6D 1PZJD 4FYDA 2HDMA 2E75C 1E9MA 1D5MC 2KHSA 2KQ3A 3ZYYX 4TQ0A 1ET9A 1WTQA 2SOBA 2BDNA 2PZTA 3PV0A 1MSHA 4HROA 4C3HG 1QJOA 4OW0A 3H0GB 5JEAH 1FFVA 4IN3A 4RKBA 1EEID 1Q1EA 4CBVA 1TZOA 3J81E 1NEKB 4A8XC 1I4QA 3NXWA 2GB1A 1CFMA 4BWGB 3BWUD 1XX8A 2DY7A 1RJTA 3PZ8A 2FBWB 1WXQA 3I9V1 4G4KA 1STNA 1FRDA 1W6JA 3S1NB 4L23A 1D5XC 2OEDA 5I2XA 4GDKB 2PW5A 5EE9A 3U4EG 4CGYB 3U7ZA 1RODA 4C7YA 1I4XA 1SAPA 3K59A 3FDTA 1SSOA 4K5XA 2EYJA 2JWUA 2F0OA 2K01A 2NVXB 5CGKA 2JSVX 2K1BA 3GO5A 2QIEB 1GXDC 4A6QA 2RVLA 5E4XA 5JVG3 2PYKA 1L6VA 5LL6X 2XSCA 1SFOB 5FKAC 1R9TB 2YEPF 5C4XB 2KCNA 4M8AA 3LYYA 4KY7A 4JWSC 1SYFA 5C44B 1EWHA 2BB6A 1EFID 3CWIA 1Z47A 3KBGA 4CJ2C 1EY0A 1STHA 3H91A 1N60A 5C4HA 3EROA 2Z4HA 1PZKD 1JWMD 3E9SA 3C1FA 4OZBA 3VR6A 3M85A 3FAHA 4QUCA 5I4DA 2F0KA 3S2DB 2BCOA 3RMHA 1B50A 3AEGB 2D9UA 3NWSA 2QKIC 1P7FA 2E3TA 3AE9B 3RD4A 2M00A 3P4QB 4KY5A 2GA4B 1B9MA 5H8YE 1U4RA 4PT5A 1SE2A 1AZQA 5EPKA 4X3KA 5CV8A 5E4WC 5BN5A 1CI3M 2B63B 4X3SA 5DAUA 2PW7A 1DOKA 2E2IB 3MFGA 1EOTA 1YMHE 3LB8C 1SNQA 3QJYA 4KD4A 1L0XB 1CJEA 1E7PB 1VJKA 5LHY1 1S5ED 3J81L 2N7JA 2K28A 2RQXA 2LUMA 1L4ZB 2EY5A 2NWGA 4KJOA 4YSYB 5FO9B 1K8OA 1PTOD 1U4LA 2GRIA 4WIPA 4XWWA 4F88A 1M4VA 2LFIA 3RPFC 2F0DA 1R4PB 2TSSA 1H9RA 1C8CA 1PFMA 2J53A 2VB2X 5EKKA 5GXGB 2CQAA 3SE0A 4MT5A 3K58A 1BQQT 1CHQD 2A73B 1PTOB 1FFUA 1MI0A 3VR5A 2DNEA 3PO2B 3HRZC 1XCTL 5ISRA 1LT4D 4A3IB 1J9OA 4ZOHC 4KN7C 3OMGA 5CORA 1FYCA 5EE3A 2LMCA 3K5MA 3NUCA 2WXJA 1PLFA 4RNAA 4U673 3P4RB 4LLGM 2F1MA 2LEKA 1GUWA 4HCSA 3MA2B 3E0JA 1AP0A 1K52A 3HEJA 4DAPA 2DYMA 4ME5A 2KDMA 4OIJA 3E6ZX 1WTOA 2E74C 1F2RC 1C4QA 5C4ZA 3LXFA 3PO3B 3B2FA 2M9VA 1L6UA 3WOEA 4A3GB 2K0PA 4BBSB 2KMMA 2RMMA 1BCPC 1AFPA 3TDQA 5E6JA 4RAUC 3Q8AA 1U4MA 2B2VC 3MTSA 3D3RA 3MXUA 2WKDA 1BNZA 2WP9B 4CHTB 1I6VC 3GTPB 4YT0B 2DN8A 1YNJC 5C6AA 5KEEA 3BDLA 1BR9A 2ENBA 3PUXA 1ROEA 1JWBD 2JXTA 3AEFB 1CA5A 1EEFD 1SNCA 5M9OA 4ITKA 1C48A 3IT4B 1Y1VB 2FMMA 1ZXIA 3GTQB 1HFGA 4R9WA 1A3VA 5EKIA 2B2TC 2F0EA 2F0FA 3CRKC 1U4PA 3GQBA 4KGTA 3HOUB 2O2LD 4GZYC 2ID0A 4LMQD 2EKIA 4C3JG 3S17B 4KGRA 2BS4B 1AWDA 3AE3B 2AUJD 4US8A 4YSXB 4NDXA 3NS1A 3RUZA 4IUNA 3AEBB 3QWNA 4J3OD 3U9SA 4IUPA 1UWMA 1KDAA 2ZXOA 3VRBB 2JEBI 1Q10A 4PV1C 1O7ZA 4JWUC 1K50A 4MACA 2DNCA 1D4BA 1PGAA 1YN4A 3DWQA 3WOFA 1Y8NB 2IGHA 2WXLA 3DHQA 2Z4IA 5M3FB 3S14B 5LL6S 2B2WC 5A2QL 1PFDA 4IUQA 1YNND 1H9KA 4I65A 2A5HA 3AE2B 2WXPA 4IUVA 3PIO3 2F0TA 1MI2A 1C4PA 1EZ8A 2NN6I 1BUVT 5CV9A 2O4XA 1F2RI 3V2TA 1SJHD 4G57A 4XE0A 1Y8PB 3HOYB 4C3JB 1ENAA 4NZLB 3NVWA 2HDLA 5K36H 3VR9B 5D3DA 4DXGA 1RWSA 1NAPA 2EELA 1UEAB 5BN4A 2G9HD 2AUKA 4AS1A 1SE3A 4XYQA 5BYSA 1HQRD 1N62A 3VR4A 1BBXC 4AYBB 1I4RA 4C2MB 3Q69A 2H1EA 3C3LA 5ELDA 3SXHA 2K3UA 5BYQA 4A93B 2NTTA 4ULLA 3BK1A 1LTGD 5EJWA 1PGBA 3HZXA 4M1UB 2PPBC 2AWNA 1MD2D 1STAA 1K53A 2DLBA 3EFXD 3GP7A 3PIP3 1FCCC 2KA7A 1XWEA 1KNEA 5JOBA 5H92C 4ZUJA 3SR1A 1PRTD 4OGQC 3HVZA 2L11A 2IX0A 2BB5A 2VNUD 4HJGE 2F3WA 3IFTA 2V4DA 3SK6A 1A6XA 3HKZB 2EDGA 2N9KA 2K32A 2N88A 1V97A 5A2QE 4OO1H 3QB3A 4J8QA 4ZK9B 1AZPA 2JA8B 2F0MA 3I4MB 4J1MA 1WRIA 2SAKA 2Y0SB 4NW2A 3C2PA 3GTOB 3KLSX 4A3JB 4A3MB 3IL8A 5KNCA 2EJGC 3DM1A 1TKYA 3LWUA 5EE1A 2Q5WD 5M5YB 1JROA 4Q5VA 3X3NA 2L32A 5ELEA 1ZUD2 4NAWB 1ENCA 2VXWA 3VR2A 2E6XA 2E76C 4AQ7A 1KABA 1SNOA 1XLQA 2L52A 3UI2A 5IGBA 2WS3B 5BMIA 2IL8A 2M0AA 4FNFA 4CKEA 1WTWA 1FXIA 3HOWB 2A6HC 1PRTF 4FXCA 1Y69U 2L1AA 1V8CA 2A68C 4KKSA 1ZYRD 4K5VA 1FNWA 4XQJA 1SXTA 3S1RB 4A3FB 1J8IA 3W9CB 4L6TB 2W55A 4HMIA 1EU4A 4KHZA 1SYGA 3Q24A 3MFYA 4PNYA 2YU9B 4O1NA 3TBIB 2M56B 3NVZA 2WXHA 2LMCB 1XLPA 5DM73 1ZXTA 2EXZA 3A54A 1HUMA 4LTUA 2NUCA 4JE3B 2AQ1B 2BA0A 2MJDA 2XWJB 1QKZA 4K6LA 1EY9A 1H9SB 4RKLA 1ICWA 4KK7A 4OIKA 1ZEQX 3KQ4A 3FEWX 1FXAA 2NVTB 4N9PA 4L1BA 2F0WA 3ABVB 1NSNS 1C78A 1VDVA 3J80E 4BBRB 1CHPD 1KAAA 5C5MA 2BTEA 2PZUA 5EQ0A 2EY2A 1QG7A 1A2TA 1SYCA 1QOBA 1GUTA 2NMQA 1QOHA 1IUEA 2QMTA 2WLBA 2X38A 3V96A 1DXMA 1PYWD 3C46A 4HSPA 2WXOA 5I2YA 1S5DD 3UI3A 2F4IA 3CKIB 2RBMA 4A3DB 1JB3A 2NZ1D 4KKUA 5C0XG 1EIHA 2PLPA 4A9AA 3T3NA 1IW7D 3GTJB 3AM9A 1VMCA 4RGMA 3KUPA 1IKMA 2PMVA 2NN6G 5AFWA 3B9JA 4RA8A 5CV5A 3NP8A 3SEBA 4JPSA 1WCMB 4MHEA 4NMZA 4FXKC 1ILQA 1KTKA 4BY7B 2PCFB 4TSSA 1YNJD 2FE8A 2K5QA 3Q23A 3P4PB 2EY6A 2M2LA 3FILB 4HAEA 1LABA 1AEXA 3I8ZA 3DMUA 1N61A 1HZ6A 2CJNA 4U68A 2WB1B 3U9OA 4IFDH 2WXGA 5JPMC 1Y8OB 4Q2JA 3HVDA 1B1ZA 1OQQA 3K6OA 2JEAI 4A3KB 2ACZB 2W3RA 2SNSA 5C3JB 4R3DA 2HTME 1X3QA 1QLBB 1EU3A 2B2WA 2I46A 2IW3A 5HG2A 3VYTA 1EZ6A 3U2SC 1I7HA 1TS3A 1GUNA 2R92B 1O7LA 2V4IB 4X3UA 5G3LF 1GHKA 1SF0A 4C7ZA 3HOVB 1W6KA 4FF2A 1DZ1A 3AN1A 1BCPD 4DNRB 4FF4A 3J7YW 1VMPA 1XLOA 2INPE 3AU7A 1IYVA 4EQPA 1LTRD 1OXTA 1HCZA 2NBFA 1VZ7A 4FP5D 3S1MB 2ZT9C 2KVMA 3KK7A 3T3OA 2XIWA 3NQTA 3BYTB 1QILA 1CQVA 3TZDA 4DK1A 2AQ2B 5CR3A 1STGA 3D4DA 2JA5B 3N6RA 4YWGG 4QMGA 3ZJTA 3S16B 1WTVA 2WXQA 1K8MA 5IGGA 2R3ZA 1D5ZC 1C77A 2N9LA 4JBWA 1AYFA 3V3XA 5F2DA 3P7JA 4P16A 2Y5PA 1V1OA 4L8JA 2WV6D 4NKLA 4QUFA 1JALA 4TMAB 3AEDB 1EYDA 2LHDA 5J22A 1VF5C 1EY5A 4MIUA 2BT6A 1HTLD 4IZ8A 4K14A 5T8IA 4D2KA 3KLSA 1RTNA 2NVQB 1G2TA 4H7BA 2B2UC 1QOFA 5G3LD 2JZPA 2WP8J 5FR3A 1JMLA 4JK1C 3VYRA 3R2IA 4ZKBB 2DY8A 3MZ5A 4YTPB 5K36G 3F2UA 1MPEA 4XYOA 4ZLTF 1KLUD 5MPOA 5ELFA 4KTAA 3N52A 1HXYD 2SNMA 3A8JE 3K5NA 4K8IA 1IW7C 3OHXC 2K33A 1IYUA 1O7YA 4FF3A 2X69A 2KEDA 2F0UA 5KYLA 2H4OA 3MHZA 2C5CA 1RFKA 1ZPSA