2OEDA

Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
publication title Evaluation of backbone proton positions and dynamics in a small protein by liquid crystal NMR spectroscopy
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2oedA00
1KH0A 1HZ5A 1K52A 2N9KA 1HZ6A 2GB1A 2LHDA 1UWXA 4OZBA 2N7JA 1EM7A 1IGCA 1PGAA 2RMMA 4OZCA 1P7EA 2KWDA 4HJGE 2NMQA 1MHXA 1D4BA 1K53A 1YMHE 1IBXB 1FCLA 1PGBA 2KN4A 1F2RI 1IGDA 2JSVX 1XCTL 5HHDG 2JZPA 1ZXHA 1MI0A 3FILB 2JWUA 4IKGA 1XCQL 2ZW1A 2QSDA 1MPEA 2LGIA 1K51A 5HFYA 1MVKA 1P7FA 1FD6A 2IGGA 4MACA 2J53A 1QKZA 2K0PA 3UI3A 1K50A 2PW9A 2PLPA 5BMGA 2GI9A 5BMHA 1GB1A 4WH4A 2ZW0A 1Q10A 2IGDA 3V3XA 4IOIE 2KACA 2LUMA 3MP9A 1MHHE 1YNTE 2J52A 2OEDA 5HG2A 5JXVA 1C9FA 1XF5L 4HKZE 2N9LA 1FCCC 2KQ4X 1GB4A 1IBXA 2PTLA 2ON8A 1JMLA 5BMIA 2I38A 2KDMA 2EELA 2LHEA 1F2RC 2I2YA 4KGTA 2IGHA 3GB1A 2JU6X 1PGXA 4KGSA 5HI1A 2ONQA 2RPVA 1HEZE 3FILA 4D2KA 4OZAA 2QMTA 4GLSC 4KGRA 2JXTA
chains in the Genus database with same CATH superfamily
2Z59B 1XD3B 3Q8BA 4FHJA 3W1SA 1WYGA 2OHFA 4NPNA 4FULA 3PLVA 4XX5A 4IWPA 4JIOU 2Y3AA 4KZ0A 1KJTA 1SEBD 2SAKA 3R2IA 3AE4B 1EO6A 4LNNA 2WXJA 1NDDA 1IBXB 2V3SA 5DCNA 2FIFA 1GAQB 1L7YA 5AUKA 2MA9B 4XWTA 1IGDA 5HHDG 1IP9A 1MFWA 3CWIA 3U7ZA 2FUG1 2D3BA 4FHKA 1FFVA 2JXXA 4EUTA 4HRSA 1E0ZA 4NQLB 1TY2A 5HFYA 1MG8A 1FD6A 1XXGA 4CYEA 5HKHA 1ET6A 4PS8A 1JROA 4EZJA 2VZKB 4LJOB 1J8CA 2SEBD 4FLHA 3L4PA 1RYJA 1C4CA 5FK9C 1NEKB 3B1LX 1UWMA 3HRDD 4F7ZA 3DQVA 2VRRB 1LM8B 3SD5A 2BQQA 4NY0A 4PS3A 5JXVA 4KIKA 3R3MA 2MW5A 4HPLB 5IKCM 2CHWA 3R7RA 2CKHB 3Q2AC 1YQ3B 2FNJB 3ZDMC 1GNUA 1PGXA 1TKGA 4DWFA 3CSFA 3OG5A 1X1MA 3FILA 3OWEB 2D07B 1EWYC 3PHWB 1QOFA 4HJKA 4W9JA 3QHTA 5FKAC 2KMCA 4BBNC 4WJQA 3B08A 3E9SA 3QK0A 2J0MA 1P3QU 4IW0A 5D3DA 4OVVA 2PIAA 2UWQA 4HCNB 3WA0A 1KRHA 4BOZB 5GXGB 1FMAD 1IYFA 2JRHA 2BGFA 3R2TA 4IWOA 2ZJDA 2UU7A 3GOEA 2LRUA 2KWDA 1TY0A 2WXIA 4C4VB 3ZKJC 2WWZA 1ISNA 3VUWA 2KX3A 4JX1C 4IM3A 2KTFA 1XCTL 3DPDA 1SE4A 1WGRA 2MBQA 1SE9A 1KFYB 1S1QB 2KVZA 3MTNB 2AYOB 4XDDA 3DVNU 3ZNZB 4WURA 3FAHA 1TT5B 2V4IB 1FNWA 2WLBA 1K51A 1RM6C 1SJED 3AE9B 2BWFA 2QDFA 1TS5A 2Q5WD 3ZYYX 1ESFA 3DWGC 2BT6A 4ZDVA 3P4PB 3VAWA 4B0EA 3ZUNA 3JSVA 4AWJA 3ZXRA 1R4MI 3W1SC 2WS3B 4HKZE 5IO9A 1YOVB 4KZCA 2ON8A 4WWOA 3BYYB 3PS6A 1T0RC 1ZKHA 3EFCA 4MELA 3DVGX 2FCNA 4FJVB 2LMCA 1QLBB 2KN5A 3NG0A 1NI3A 3P1MA 2BVCA 3FC4A 2WDVB 4ZYNA 3NUHB 1WM2A 3H6NA 2K6QA 1S3SG 4DXGA 3MC9A 3BY4B 1Y56A 2NBWB 3NVZA 3M95A 1FPYA 3TSSA 2M0AA 4ZRJA 2PJHA 4XDCA 1WGKA 4HCPB 3GZNI 2LVOA 1WYWB 4HJGE 4DHJD 2WXMA 1FXIA 2OJWA 2XK5B 2J42A 1GC7A 3HK0A 4BKSD 3WAOA 2JYEA 1KLVA 2L52A 3EFUA 1C78A 2KLGA 4Q2JA 1V5OA 2D5GA 5JHBA 5E6PA 2LFIA 2V3PA 3AEEB 2MEKA 3Q8AA 3TEZA 4OVUA 1JCKB 3JSVB 5C2TB 4MT5A 1I4RA 3L13A 1D5ZC 1E10A 3AXCA 3IT6B 3ZLZA 1GG3A 4YSXB 3UQAA 2WDQB 2KDBA 2ZCBA 1ZOYB 2D2QA 2B76B 2H88B 4W9GA 3P2BA 2G4DB 2MCNB 2BYEA 1QOBA 4XZ4A 2NS5A 2J0KA 3MP9A 2KTRA 4ZRKA 3UINB 4P1BC 1FFUA 3T3OA 2L76A 2MWSB 1FCCC 3DBRI 3J9CA 2HTME 1CZPA 1YIWA 4GMVA 3BVZA 4KX6B 4NAMA 2NPTB 2KWCA 2BS4B 3A9JB 1ET9A 2QEJC 2FE8A 1TS2A 2O2VA 1SE3A 2DYOA 3HHMA 4W9IA 1GPXA 5C1ZA 1AARA 2N9PC 2GBJA 3VXWA 4PT5A 3BINA 4LDTD 4I6LB 2K3UA 1ZW7A 2MX2A 2N9KA 2BBCA 3BWUD 4X57B 3KUCB 4JGHB 1WF9A 5BYQA 1TIFA 1PQSA 4EOYA 4MM3B 3V6EB 3BIID 1JW9D 4K1RB 1E8YA 2MBHA 3BZDB 3N3KB 4BKGA 3QAQA 3URYA 1YX6B 2R2QA 2L1AA 1L0YB 4LNIA 3GZNB 4W9EA 3PZDA 3SR6A 1YN3A 2YEPF 2WNMA 2D10A 1CMXB 4C7ZA 2BS3B 2LGSA 1I4XA 3AEFB 3RNGC 2WXQA 4GDKA 2GBNA 3IHPC 3QX1A 3NZUA 4KSKC 3VTUA 3KYCD 3PRZA 1EWCA 1WXAA 3LB8C 4M02A 3DVNV 2C9WB 5BMHA 4K3CA 4WH4A 2K8CA 3PGEA 4FBJB 1KF6B 3Q3OC 2A5UA 1N60A 2LUMA 3VDZA 4YSZB 2NBVB 4M0WA 4KDIC 4P6VF 3LJ3A 4K7WA 2MBBB 3P4SB 2KJHB 4M8NA 2KQSA 3W9CB 1UF0A 4FJYA 4CQNA 3TCAA 3LXFA 1SB3C 2V0GA 1G6JA 1WJNA 1I42A 2K8BA 2EMTA 4XYCA 1F52A 4MGIE 3DBRB 2ONQA 5E6OA 4FJZA 1EU4A 5CX3A 1EF1A 5KHOA 3AEBB 1ZGUB 1WZ3A 2M56B 3PPAA 2N0SB 2MQJA 1EM7A 1JRPA 2INNE 2KAJA 3AMZA 3R7QA 3DHIC 2PE6B 1V1PA 2GBRA 3PSEB 1J19A 3ZTDA 2KVRA 5LNK1 2BPSA 4JWSC 2QIEB 1HXYD 2HJ8A 1XO3A 2MBEA 1WXMA 5D7GA 3V05A 1SJHD 3DCGA 4XC2A 4ZRPA 2D3AA 2EKIA 2G1EA 4TMAB 1ZPSA 3V61A 2JZPA 3APCA 1ZXHA 2BF8B 3SFDB 2KANA 5J18A 1STEA 2W55A 4YL8A 2D3CA 3QWZB 2W54A 3ZNGC 2OOBB 3QIJA 2BKRB 4R3DA 3Q3FA 2O6VB 4YTNB 1WZ0A 1D5MC 4N6EB 2WXRA 1BXTA 2LUEA 1C76A 1KM7A 2PW9A 2Y5CA 3A1QB 4G11A 2QC8A 4K81A 1UGMA 1YNTE 5HG2A 4I6NB 1WRDB 3X0WA 2KLCA 1V97A 3ZGZA 4JQWC 2AWTA 1IBXA 3ZVVA 4ZYSA 4A20A 2ZNVC 2J4XA 1GUAB 2KWUB 2VH2A 2KC1A 2WP9B 5DPSA 4A8XC 3RNCC 4OZAA 1C4PA 5JH5C 3U7DA 1XLQA 2IPKD 3VHTC 2I1KA 4K7SA 4L23A 4GSWA 2CHXA 3MFGA 1B9RA 4WJOA 1M4VA 2LHDA 1DYQA 3P4QB 4WIPA 3VTWA 3B2FA 5DPRA 2JPHA 1V49A 1VCBA 4ZOHC 4LNFA 2Z0DB 1YMHE 1DOIA 2NBUA 4II3B 1RLFA 2MHJA 1PGBA 1E8WA 1YX5B 3V62A 3HUIA 3DBHI 2WXNA 4JWUC 1CQVA 3RNFC 1WH3A 4K3BA 3W2DA 3UF8A 4IDIA 1MG4A 1ZXIA 4JE3B 2D11A 2M8SA 3L10B 3V60A 2FAZA 2KDFB 1QQRA 2PEAA 3H7PB 3HM3A 1J7CA 1YJ1A 4HDOA 2NTTA 3PLUA 4ZHOA 3W1YA 5EE1A 1PYWD 4MGKE 2KWVB 2N1VA 1LGRA 2KACA 3VFKA 3OLMD 1XLNA 3FKYA 3UIOB 2PVGC 5D3IB 1WX7A 2IJ0A 2N4FA 3C0RB 4MEMA 1WFYA 3VH3B 4C4VA 1WGDA 2K5PA 3AE8B 3A4RA 2HDEA 1RFAA 2C7MB 4F8CB 3AN1A 2MP2B 2LJIA 3ZXVA 2FUHB 4MJSB 1V1OA 3TJPA 4WQMA 3DBLB 3U8ZA 4DK5A 4GU2A 2V9HA 3L08A 3N30A 1FNVA 2Y5PA 3EHVA 2CU1A 1NI2A 2V3NA 3IAS1 1WGGA 1ZE3D 1I4QA 2L0FA 4OZCA 3AEAB 1BT0A 1P7EA 4DHZE 4IM2A 3ZIMA 4RGNA 1YJJA 5AZFA 3C8YA 1FCLA 3SDLC 3AULA 4E74A 5T8IA 5J2RA 2MRPA 1VZ7A 5DPWA 1TS3A 1JALA 3I63C 2KOXA 5MPOA 3RZFA 4ZHPA 4RGTA 3DBSA 4B95A 1AN8A 4PYZA 4YWGG 3AV8A 1HTOA 3KYDD 3B9JA 4J3OD 1MVKA 2G3QB 5FR6A 3RI7C 3U4EG 3ZJTA 3ZDTA 3MHSD 2DENB 1I7HA 4TKNA 4ARCA 3WAPA 1UZXB 4MSQB 1WM3A 2INCC 3N1YC 4W9DA 3SEBA 1UBIA 5I4DA 4WQOB 2XK5A 2PTLA 2WDRB 4URKA 3R8BA 3NVYA 4P1CC 4HROA 2KJ6A 2WYQA 4ANUA 4HLEA 1HQRD 5G5HA 4AOFA 2R61A 1E90A 2MBOA 1J7BA 2IDYA 1I4PA 1SSNA 5BYRA 5FR3A 3TL5A 4KKIA 4CHKA 2K39A 4N58A 4PYUA 2L32A 2KFJA 3S2AA 2KXJA 3P4RB 4WWNA 2YEPB 5AZGA 4IUMB 2KHWB 3AU5A 1KLGD 2L3ZA 3KW5B 4RNAA 3DHHC 3KLSX 2W9NA 4M01A 3ML8A 1KLUD 2KDIA 1H8CA 4GDLB 1GJZA 3WAMA 2KN4A 4HXDA 2J0JA 4USAA 2DYBA 5LXIB 4YSYB 4YT0B 2AEHA 2CJNA 2PKOA 4C80A 2NPTA 4FA6A 3VR9B 3PRPB 3A9JA 2BKFA 1U4AA 4HPPA 1F1HA 3RZWC 1ACCA 1TZOA 4TQ0A 1L0XB 3AEDB 2JUOA 2W3RA 1JWMD 3Q3MC 1GB1A 4REZA 3VTVA 1QF6A 3RNEC 1L6UA 5EE3A 1LO5D 1C79A 1B1ZA 4MM3A 4YXDB 2AQ1B 4NQKE 4DDGD 4WAAA 2LWPA 5IAAC 4C7YA 2K25A 2GBMA 1F2RC 1N5WA 3L0WB 1WSPA 1OEYA 1V2YA 2LRWA 4IG7B 4OVZA 3Q8EA 3ZRFA 3TEWA 2RDBC 2LD9A 1E6EB 4NJ6A 3T3NA 3APDA 2K1FA 2BS2B 1SIJA 5AEKB 3BK1A 2N9LA 2AL3A 5CHWA 3ZNHB 3VRBB 3KH0A 4DDID 1K52A 2MJ3A 5CHFA 1R4MB 3ZJUA 1FXAA 2TSSA 3RPFC 2BWES 2BTEA 3IT4B 2AQ3B 4A3PA 1GC6A 5EDSA 1WJ6A 2KYWA 1XQQA 4BFRA 4EZKA 5D2MB 1L0VB 2M4NA 3N1XC 3AE2B 1T6BX 4US8A 3O65B 1C3TA 3SU8X 1QILA 4WWMA 5TSSA 1E7UA 1T0QC 4FADA 4LDTB 2NR2A 2HTHA 2ZW1A 1D6EC 1TGZB 2LGIA 2RD0A 3DVGY 1NVID 2XN9C 4ZRQA 3W5VB 1WE6A 2KC2A 5E6JA 2QCZA 4UDUC 1V9JA 3KVFB 4N9F4 1T0YA 4LNOA 3KWVA 4GXBA 3QARA 3NY5A 1BUIC 2DHZA 1WIAA 4CO7A 3IXSA 1WY8A 3MC8A 4MDKE 1L4DB 2GRIA 4YTPB 2BYFA 1XF5L 3VRAB 5H92C 3RNAC 1R4NI 4IM0A 1YJIA 2WXFA 4TUUA 4NAWB 2LHEA 1OQRA 2WX0A 5BYSA 5E6NA 2WXHA 1OTRB 2CJOA 1HE8A 3AU4A 4M8MA 1WX9A 2WXLA 3GB1A 3M3JA 2GOWA 2C7HA 4EEWA 2G9HD 2IYDB 1LQBA 3TIXA 4G0NB 1TJEA 4RM8A 4LTUA 2L00B 1BMLC 2HD5B 1VR9A 1RRBA 2O6VA 4B0MA 2M19A 1FO4A 1KH0A 3A33B 3OJ3A 3JW0X 4HDQA 2N1WA 2GB1A 1UWXA 2BB6A 3A9KB 4YTMB 3A1QA 3QC8B 2AQ2B 1PGAA 2GMIC 5BO4B 4NJCA 1XLPA 4A3OA 2INDC 1VZ6A 1YN5A 2BB5A 4HEA1 3NZ3A 1OQYA 2CHZA 3HM6X 5KHQA 3DOWA 3AE3B 1C4AA 1E5WA 3Q8FA 3ONSA 4LCDE 3RMKC 2ZNVB 1WXQA 2LVPA 2QHOA 3LDZE 1TZ1A 1SE2A 3ZW3A 4MGZE 3HVDA 3PT2B 3RNBC 3AE7B 4ANXA 3ML9A 5AUIA 1CJEA 4GOCA 3EC8A 1N6ZA 1ZP0B 1K50A 3X23A 4W9HA 4KKJA 2GI9A 2ZPNA 4WAFA 3KUZA 4W9FA 4IOIE 3ZNID 2WXPA 2DBYA 3R66C 3VUYA 4RMAA 3IAM1 4JPSA 5D94A 2OEDA 3SHQA 2ZPYA 2LI5A 2C7NB 2FIDA 3VVWB 4A55A 2QJLA 5C3JB 5BMIA 4LK0M 3MHZA 1FIQA 4A90A 2I2YA 4KGTA 2LGYA 3VUXA 5AZHA 1I4HA 4ICUA 3VH4B 3JVZX 4D2KA 1J7AA 1WXVA 3RUIB 4GLSC 5D6JB 1EUVB 2DLBA 3BVMA 4NZLB 1WR1A 2WU2B 1L2NA 4ANVA 5CTRC 2W3SA 5IOIA 2JZ3B 4GB9A 5G5GA 3TBLD 4DHZB 4EE2A 2PE9A 3H7PA 1KTKA 2RMMA 3MJ5A 2I1JA 2ZVOA 3Q3JA 4FN2A 1N62A 3Q3NC 2GBKA 1EU3A 2DAFA 4MSMB 1XEEA 3PREA 1M94A 4L2YA 2KMMA 2X38A 3NVVA 2MSED 1VRAB 2ZEQA 5C23A 3LYYA 2QILA 1MJDA 1PDXA 1J0GA 1V86A 1TKYA 4OHJA 2DYMA 2MP2A 4E71A 3M62B 4MJSA 1DOYA 3KQ4A 4W9KA 1NENB 5JZEB 2WDTB 3O13A 2DZIA 1P98A 3H8HA 2WX1A 1AYFA 2ZW0A 2OJRA 3E56A 3L16A 1VDVA 5IP4D 4JLCA 1WX8A 4ASWC 3GE8C 2J52A 4AJYB 3TUOA 3PV1A 3IVFA 2JVCA 2KX0A 2BW2A 2Z0EB 1JWSD 2V1YA 1JMLA 2J7QB 5GMVA 1QOAA 2FBWB 4S0RA 4RCOA 4KGSA 3NJTA 1ENFA 4ITKA 1Q5WB 1P9DU 2RR9A 3DHGC 2NCNA 2Z8LA 4KGRA 2JY6A 3RYTA 2V4LA 1IGCA 1WI0A 4G50A 2KJRA 2LGXA 1VLBA 2W82A 1QOGA 2DZJA 1L6VA 2IY0B 2VZKD 5IN7A 1EF5A 1OGWA 2NMQA 2C60A 2LASA 2UYZB 4HK2A 3CMMB 1KOTA 2JZZA 2LXAA 4OW0A 1UBQA 4LNKA 1F2RI 3H9DA 2ZCCA 2JSVX 4HWIB 1VJKA 3EUB2 5EE0A 1QT9A 4XE0A 1QZEA 3KWLA 1HTQA 4G3XB 2K9XA 2KFKB 4GN1A 4WJNA 3ZQ4A 4XGAB 1UGJA 2XBBC 1V5TA 1AW7A 1ROEA 3Q69A 2IO3B 2INPE 3WANA 1P7FA 2PVOD 3NRZA 2IGGA 4MACA 1QKZA 4ICVA 4S17A 1D5XC 5BMGA 3ECIA 1P0RA 5TR5A 5G55A 2RDGA 2FCSA 2FCMA 3TEYA 5G2NA 5LXHA 3APFA 2B3AA 3JYUA 2FCQA 1IUEA 1WGYA 4N59A 1C1YB 1T5XD 2RGFA 3DBHB 1GB4A 4GDLA 3Q6BA 2I38A 2KDMA 4F1SA 1SIFA 4I6PA 1SF0A 3IG3A 2VH1A 1RAXA 3RT3B 3PTFC 3WIMA 3T9LA 2MH7A 1F0ZA 3I57A 1V81A 2K22A 2H89B 1NBFC 1VD2A 3CIRB 3B0AA 4US9A 1WRIA 4TQ1A 3QCAA 1JRUA 4MGYE 1WJ4A 2KKCA 1Y8RC 2HE7A 3AB5A 3NS1A 2WQYB 2NTSA 1XT9B 3OJ4B 1FEHA 4TV3A 4KIKB 1V6EA 4BZAA 3IFWB 2XEWA 1TYGB 2ICIA 4BKSA 1MHXA 3UGBB 2JT4B 2LVQA 4XWWA 3M63B 2KK8A 2ASQA 2IBIB 4BKTA 3NHEB 1WXSA 4KV2A 4E3CA 4BBNF 3FILB 1T0SC 1SGHA 4RGOS 4W9CA 3Q14C 3ZJVA 1A5RA 3AEGB 1YD8U 3RD2A 1P1AA 3BYTB 3NOBA 3SFEB 1N5XA 1UH6A 1YQ4B 3PZ7A 3AH7A 2M1MA 1Q10A 1Z2MA 3ABVB 2DZKA 3H7SA 3K9OB 2N9XA 4EFOA 2DWQA 2KZRA 4A6QA 4IC7B 2DAJA 3U2SC 1FM0D 2XNAC 1JWUD 1IPGA 3VR8B 2M0XA 2R2OA 2EELA 3AI5A 4DHJB 3L54A 4MH8A 4W9LA 1C77A 4WWPA 2ZZPB 2AL6A 5IA7A 4BVUC 2E3TA 1HA5A 4C56C 2MJDA 2LEKA 4OZBA 1E8ZA 3U52E 4B9KA 1D3ZA 2ZVNA 3OAWA 4L1BA 2WXOA 1JWBD 3MC0B 2G4SA 3KUDB 3VQIA 3EGRA 2K8HA 3PO0A 3N1ZC 4WJPA 2ACZB 3TEXA 2IO1B 4NJ7A 3N32A 4NAWA 2X8XX 1H4RA 3T8MA 2KDEB 3GS2A 1L5PA 2A4ZA 2MJEA 1WJUA 1N63A 2PPHA 3L17A 4C00A 1UD7A 2WXGA 4PS7A 2CR5A 3HIZA 3RULA 4KDLB 5CHVC 2J53A 2K0PA 1NYRA 1R7SA 3EECA 4RF0A 3K9PB 3NS8A 3EA6A 4II2B 3PRMB 1JWAD 2BYVE 3BVGA 3CF6E 1YQBA 2IO0B 3A9KA 3BK2A 1V8CA 4BOSC 2G45B 1Z5SB 2NVUI 2JRIB 2L7RA 2YLMA 1I4GA 4FXCA 3B2GA 5L95C 4KSLC 3UQBA 1DGJA 2JU6X 5HI1A 2WGSA 3P42A 3ALBA 2JYTA 3AE5B 2D3GA 4ZRIA 3RN9C 4P7IA 2JXTA 2L05A 4TSSA 1FXTB 1HZ5A 2DX5B 3I9V1 3C19A 1WE7A 2N7JA 3A4SC 2WHIA 1A70A 4DXAB 2KTRB 4RGMA 3GE3C 1WR6E 1OEYJ 4LLGM 3AE6B 3QA8A 1D4BA 4AS1A 1Q0WB 3AE1B 2JQRB 3AECB 2REXA 2HJ1A 4RM9A 1TBEA 5LLIA 4LJPB 2JWUA 3W5UB 4P16A 4GIVA 3N20C 2O2VB 2JWZA 2N9EB 1XCQL 4AQ7A 1E7PB 1TTNA 1PFDA 3D32A 3N9YC 4ACFA 3ZRCA 2MLBA 2EKEC 1JQ4A 3HVZA 2IY1B 1SXTA 2PLPA 1LFDA 1UUPA 2CS4A 1ZDVA 3GP7A 3V6CB 2RSUA 3V3XA 4A9AA 3H1UA 3UIPB 1E8XA 4J6IA 1WGHA 2YVCA 4HPMB 1E7VA 3AM9A 1Q1OA 4IWQA 3Q8CA 2LGDA 1AWDA 5EE9A 4DXFA 4AJWA 2M17A 1RWSA 4DQOC 1N61A 2N7EA 1ZDXA 1WWTA 2RPVA 1HEZE 4DBGA 4GGQA 2E6XA 2IO2B 2BYTA 3I5JC 2RPQA 4GDKB 4ARIA 3ZO5B 4AP4C 4JL9A 4HKQA 2KQ7A 4HVBA 1HZ6A 3PVLA 1GOZA 2O6VD 2Y5BB 2DNFA 4ANWA 3ETRA 1SBBB 5J17A 1E9MA 1R4NB 4M0WB 4QAYA 1V80A 2N7DA 1NYQA 4NNJB 1I35A 2EMSA 2AX5A 3ENEA 1F9JA 1K53A 1CK1A 4BAXA 1WMHA 2C5LC 3NVWA 4RFBA 3WALA 4RH6A 1F77A 5L83A 2L8JA 1OFFA 4PK1A 2K6DB 4H2AA 4AUQC 1PUTA 2GLSA 1MI0A 2WU5B 3NZSA 1OQQA 4O1NA 4EZLA 4IKGA 2JX5A 5DPTA 1FNUA 1XLOA 2KT7A 2RDHA 2QSDA 1MPEA 2KMAA 2WXKA 4M00A 3I3TB 1LXDA 3QQ8B 2KD0A 4KVGB 3PHXB 3UI3A 1V1PB 2CU3A 3QJZA 1FRDA 3DBLI 1ZUD2 4K7UA 3RFZB 1K8RB 2JF5A 5JHAA 3DDCB 2IGDA 1T3QA 1YN4A 2IZVB 2KNBA 1FRRA 2LJ5A 5H8YE 1MHHE 2KO3A 1TKEA 1C9FA 1L4ZB 2LZ6A 3MJWA 3P63A 3PZ8A 1DOXA 2KQ4X 1UNSA 3TMPB 4B6WA 2LXCA 4RF1A 3DWMA 4MH0E 2IGHA 2DZMA 1UELA 3U30A 2L83A 3ZTCA 2PMVA 3RCZA 3IBEA 1WMHB 2QMTA 1TS4A 2KFKA 3WCQA 3CSTA 4EKUA 2L0TA 1VZ8A 1RFKA
chains in the Genus database with same CATH topology
1JRPA 3VRBB 2INNE 3AB5A 1K52A 3NS1A 3Q8BA 2MJ3A 2KAJA 3AMZA 2WQYB 2NTSA 1V1PA 3ZJUA 3W1SA 1WYGA 2OHFA 1FEHA 1FXAA 2TSSA 3RPFC 2Y3AA 2BTEA 1SEBD 5LNK1 3IT4B 2SAKA 1TYGB 2ICIA 3R2IA 3AE4B 4JWSC 2QIEB 2AQ3B 1HXYD 1MHXA 2WXJA 1IBXB 1XO3A 4XWWA 5D7GA 3V05A 1GAQB 1SJHD 4ZRPA 5AUKA 4XWTA 2EKIA 1IGDA 2G1EA 4TMAB 1ZPSA 5HHDG 2JZPA 1ZXHA 1L0VB 3FILB 3AE2B 1T6BX 3SFDB 3CWIA 3U7ZA 4US8A 2FUG1 1QILA 4WWMA 4RGOS 5TSSA 1STEA 2W55A 2ZW1A 1FFVA 2W54A 1D6EC 4HRSA 1E0ZA 4R3DA 1TY2A 2LGIA 3ZJVA 1NVID 4YTNB 3AEGB 5HFYA 1XXGA 2XN9C 1FD6A 1D5MC 4ZRQA 4N6EB 3W5VB 2WXRA 1ET6A 1BXTA 1JROA 5E6JA 3BYTB 4UDUC 2VZKB 1C76A 2PW9A 2Y5CA 3SFEB 1N5XA 2SEBD 1YQ4B 3L4PA 1RYJA 3PZ7A 1C4CA 3AH7A 5FK9C 3KWVA 1NEKB 3HRDD 1UWMA 1Q10A 1BUIC 3ABVB 3IXSA 1YNTE 1L4DB 2GRIA 4YTPB 5HG2A 5JXVA 2DWQA 1XF5L 4A6QA 3U2SC 1FM0D 1V97A 2XNAC 3VRAB 5H92C 1JWUD 3ZGZA 3VR8B 1YJIA 1IBXA 2WXFA 4ZYSA 4NAWB 2J4XA 2EELA 2LHEA 1OQRA 1YQ3B 5BYSA 2WXHA 2CJOA 2WP9B 2WXLA 3GB1A 1PGXA 1TKGA 4MH8A 2G9HD 3FILA 3OWEB 4A8XC 1EWYC 1C77A 4OZAA 1C4PA 1QOFA 1TJEA 4LTUA 1XLQA 5FKAC 2IPKD 1BMLC 3E9SA 4L23A 1VR9A 3MFGA 5D3DA 2M19A 4B0MA 2E3TA 1B9RA 1FO4A 1HA5A 1KH0A 4C56C 2PIAA 2GB1A 1M4VA 1UWXA 2LHDA 2MJDA 2LEKA 1DYQA 1KRHA 2BB6A 3P4QB 4OZBA 4WIPA 3B2FA 3U52E 4YTMB 5GXGB 1FMAD 2AQ2B 4L1BA 3R2TA 1PGAA 2WXOA 1JWBD 3MC0B 4NJCA 2KWDA 3VQIA 3EGRA 1TY0A 4ZOHC 2WXIA 3PO0A 1XLPA 1YMHE 1DOIA 1VZ6A 1YN5A 2BB5A 4HEA1 3NZ3A 2ACZB 3TEXA 1PGBA 4JX1C 1XCTL 3AE3B 1C4AA 1SE4A 1KFYB 3Q8FA 3HUIA 4XDDA 3GS2A 1WXQA 1L5PA 3FAHA 4WURA 2WXNA 4JWUC 1CQVA 2V4IB 1SE2A 1FNWA 2MJEA 3W2DA 1N63A 2WLBA 3HVDA 4IDIA 1ZXIA 1K51A 2WXGA 1RM6C 4JE3B 3AE7B 5AUIA 1CJEA 1SJED 3AE9B 2J53A 2K0PA 1NYRA 1R7SA 1TS5A 4RF0A 1QQRA 2Q5WD 1ZP0B 1K50A 3ZYYX 4KKJA 1J7CA 1ESFA 2GI9A 3DWGC 2NTTA 2BT6A 3EA6A 4ZHOA 3P4PB 4WAFA 5EE1A 1PYWD 1JWAD 4B0EA 4IOIE 2KACA 3BVGA 2WXPA 2DBYA 3BK2A 1V8CA 1XLNA 3IAM1 4JPSA 2PVGC 5D3IB 2OEDA 2IJ0A 2WS3B 4HKZE 1I4GA 4A55A 2ON8A 2QJLA 3BYYB 5C3JB 5BMIA 4FXCA 2K5PA 3AE8B 4LK0M 3B2GA 3MHZA 2HDEA 1FIQA 4A90A 2I2YA 4KGTA 1DGJA 2LMCA 1QLBB 2JU6X 5HI1A 1I4HA 3AN1A 1NI3A 3P1MA 4D2KA 3FC4A 3P42A 2LJIA 2JYTA 3AE5B 1V1OA 2WDVB 1J7AA 3NUHB 4WQMA 4GLSC 2DLBA 3BVMA 4NZLB 2WU2B 4DXGA 1FNVA 2Y5PA 2JXTA 1Y56A 4TSSA 1HZ5A 3I9V1 2W3SA 3NVZA 2V3NA 3IAS1 3TSSA 5G5GA 2M0AA 2N7JA 4EE2A 1A70A 1ZE3D 4XDCA 4RGMA 1KTKA 1WGKA 1I4QA 2RMMA 3MJ5A 4OZCA 3AEAB 1P7EA 4LLGM 3AE6B 4HJGE 1N62A 2WXMA 1FXIA 1D4BA 1EU3A 3BK1A 4AS1A 2J42A 4RGNA 3AE1B 1YJJA 2JQRB 3C8YA 2JYEA 1FCLA 3AECB 1XEEA 2L52A 1C78A 4Q2JA 2D5GA 5T8IA 1VZ7A 2LFIA 1TS3A 2V3PA 3AEEB 4L2YA 2MEKA 2KMMA 3Q8AA 1JALA 3TEZA 1JCKB 2X38A 2JWUA 3NVVA 5C2TB 5MPOA 4MT5A 3W5UB 1I4RA 1VRAB 4P16A 4RGTA 4ZHPA 1D5ZC 1E10A 1AN8A 3IT6B 3LYYA 2QILA 1PDXA 1XCQL 4YSXB 4AQ7A 4YWGG 1E7PB 3AV8A 1TKYA 4OHJA 1PFDA 3B9JA 2DYMA 3N9YC 2WDQB 4J3OD 1MVKA 1DOYA 3KQ4A 1ZOYB 1JQ4A 1NENB 3HVZA 3O13A 3U4EG 3ZJTA 2B76B 1SXTA 2H88B 2PLPA 1UUPA 3H8HA 1I7HA 1QOBA 1AYFA 1ZDVA 2ZW0A 3GP7A 3E56A 1VDVA 4ARCA 3V3XA 3MP9A 4A9AA 2J52A 3TUOA 1FFUA 3SEBA 3T3OA 2N9LA 5I4DA 3AM9A 1FCCC 2BW2A 1JWSD 3J9CA 2HTME 2PTLA 3Q8CA 2WDRB 1CZPA 1JMLA 1AWDA 5EE9A 4DXFA 3R8BA 1QOAA 3NVYA 2FBWB 1RWSA 3BVZA 4KX6B 4DQOC 4NAMA 1N61A 4HROA 4RCOA 4KGSA 1ZDXA 1WWTA 2RPVA 2BS4B 1ENFA 1HEZE 4ITKA 2BYTA 2E6XA 1HQRD 5G5HA 2R61A 1ET9A 4GDKB 4ARIA 1J7BA 2IDYA 1I4PA 2QEJC 1SSNA 2FE8A 5BYRA 1TS2A 5FR3A 1SE3A 4KKIA 2Z8LA 2DYOA 1GPXA 4KGRA 4N58A 4PT5A 4HKQA 2L32A 2K3UA 2N9KA 2BBCA 1HZ6A 3BWUD 3P4RB 1GOZA 5BYQA 2YEPB 1IGCA 3ETRA 1SBBB 1VLBA 2W82A 1KLGD 4RNAA 1E9MA 1QOGA 1L6VA 3KLSX 4MM3B 3BIID 2VZKD 1NYQA 1JW9D 1KLUD 2NMQA 3BZDB 2AX5A 1K53A 1CK1A 3URYA 4GDLB 2L1AA 3NVWA 4RFBA 4OW0A 4RH6A 1F77A 1L0YB 2KN4A 1F2RI 1OFFA 2JSVX 3SR6A 4H2AA 1YN3A 1VJKA 3EUB2 2YEPF 1PUTA 4USAA 1MI0A 2WU5B 5EE0A 1OQQA 2WNMA 1QT9A 4XE0A 3KWLA 4C7ZA 4O1NA 4YSYB 4YT0B 2BS3B 2CJNA 2K9XA 2PKOA 4C80A 4IKGA 2JX5A 3ZQ4A 1UGJA 1FNUA 1XLOA 3VR9B 1I4XA 1AW7A 2RDHA 2QSDA 1MPEA 3AEFB 2WXKA 1ROEA 3Q69A 2INPE 2WXQA 1P7FA 2PVOD 3NRZA 1ACCA 1TZOA 2IGGA 4TQ0A 1L0XB 3AEDB 4MACA 1QKZA 2W3RA 3UI3A 1V1PB 1JWMD 1D5XC 1EWCA 2CU3A 3LB8C 5BMGA 5BMHA 1GB1A 1FRDA 1ZUD2 4REZA 4WH4A 1QF6A 3RFZB 1KF6B 2IGDA 2RDGA 1L6UA 1N60A 5EE3A 1T3QA 2LUMA 1LO5D 1YN4A 4YSZB 3TEYA 1FRRA 5H8YE 1MHHE 4M0WA 1C79A 1B1ZA 1TKEA 4P6VF 4YXDB 3P4SB 1C9FA 2AQ1B 1L4ZB 3P63A 1IUEA 3PZ8A 4N59A 1DOXA 3W9CB 1T5XD 2KQ4X 4CQNA 4C7YA 1GB4A 1UNSA 2I38A 2KDMA 3LXFA 1F2RC 4RF1A 1N5WA 1SB3C 2V0GA 1WSPA 3DWMA 1SF0A 2IGHA 2L83A 2ONQA 2PMVA 4OVZA 3Q8EA 3TEWA 2MH7A 1EU4A 1F0ZA 3I57A 1E6EB 3AEBB 2K22A 2H89B 3T3NA 2QMTA 3CIRB 1TS4A 3WCQA 4US9A 1WRIA 2M56B 4TQ1A 2BS2B 2N0SB 1SIJA 1EM7A 1VZ8A 1RFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KH0 A;  1HZ5 A;  1K52 A;  2N9K A;  1HZ6 A;  2GB1 A;  2LHD A;  1UWX A;  4OZB A;  2N7J A;  1EM7 A;  1IGC A;  1PGA A;  2RMM A;  4OZC A;  1P7E A;  2KWD A;  4HJG E;  2NMQ A;  1MHX A;  1D4B A;  1K53 A;  1YMH E;  1IBX B;  1FCL A;  1PGB A;  2KN4 A;  1F2R I;  1IGD A;  2JSV X;  1XCT L;  5HHD G;  2JZP A;  1ZXH A;  1MI0 A;  3FIL B;  2JWU A;  4IKG A;  1XCQ L;  2ZW1 A;  2QSD A;  1MPE A;  2LGI A;  1K51 A;  5HFY A;  1MVK A;  1P7F A;  1FD6 A;  2IGG A;  4MAC A;  2J53 A;  1QKZ A;  2K0P A;  3UI3 A;  1K50 A;  2PW9 A;  2PLP A;  5BMG A;  2GI9 A;  5BMH A;  1GB1 A;  4WH4 A;  2ZW0 A;  1Q10 A;  2IGD A;  3V3X A;  4IOI E;  2KAC A;  2LUM A;  3MP9 A;  1MHH E;  1YNT E;  2J52 A;  2OED A;  5HG2 A;  5JXV A;  1C9F A;  1XF5 L;  4HKZ E;  2N9L A;  1FCC C;  2KQ4 X;  1GB4 A;  1IBX A;  2PTL A;  2ON8 A;  1JML A;  5BMI A;  2I38 A;  2KDM A;  2EEL A;  2LHE A;  1F2R C;  2I2Y A;  4KGT A;  2IGH A;  3GB1 A;  2JU6 X;  1PGX A;  4KGS A;  5HI1 A;  2ONQ A;  2RPV A;  1HEZ E;  3FIL A;  4D2K A;  4OZA A;  2QMT A;  4GLS C;  4KGR A;  2JXT A; 
#chains in the Genus database with same CATH topology
 2Z59 B;  1XD3 B;  3Q8B A;  4FHJ A;  3W1S A;  1WYG A;  2OHF A;  4NPN A;  4FUL A;  3PLV A;  4XX5 A;  4IWP A;  4JIO U;  2Y3A A;  4KZ0 A;  1KJT A;  1SEB D;  2SAK A;  3R2I A;  3AE4 B;  1EO6 A;  4LNN A;  2WXJ A;  1NDD A;  1IBX B;  2V3S A;  5DCN A;  2FIF A;  1GAQ B;  1L7Y A;  5AUK A;  2MA9 B;  4XWT A;  1IGD A;  5HHD G;  1IP9 A;  1MFW A;  3CWI A;  3U7Z A;  2FUG 1;  2D3B A;  4FHK A;  1FFV A;  2JXX A;  4EUT A;  4HRS A;  1E0Z A;  4NQL B;  1TY2 A;  5HFY A;  1MG8 A;  1FD6 A;  1XXG A;  4CYE A;  5HKH A;  1ET6 A;  4PS8 A;  1JRO A;  4EZJ A;  2VZK B;  4LJO B;  1J8C A;  2SEB D;  4FLH A;  3L4P A;  1RYJ A;  1C4C A;  5FK9 C;  1NEK B;  3B1L X;  1UWM A;  3HRD D;  4F7Z A;  3DQV A;  2VRR B;  1LM8 B;  3SD5 A;  2BQQ A;  4NY0 A;  4PS3 A;  5JXV A;  4KIK A;  3R3M A;  2MW5 A;  4HPL B;  5IKC M;  2CHW A;  3R7R A;  2CKH B;  3Q2A C;  1YQ3 B;  2FNJ B;  3ZDM C;  1GNU A;  1PGX A;  1TKG A;  4DWF A;  3CSF A;  3OG5 A;  1X1M A;  3FIL A;  3OWE B;  2D07 B;  1EWY C;  3PHW B;  1QOF A;  4HJK A;  4W9J A;  3QHT A;  5FKA C;  2KMC A;  4BBN C;  4WJQ A;  3B08 A;  3E9S A;  3QK0 A;  2J0M A;  1P3Q U;  4IW0 A;  5D3D A;  4OVV A;  2PIA A;  2UWQ A;  4HCN B;  3WA0 A;  1KRH A;  4BOZ B;  5GXG B;  1FMA D;  1IYF A;  2JRH A;  2BGF A;  3R2T A;  4IWO A;  2ZJD A;  2UU7 A;  3GOE A;  2LRU A;  2KWD A;  1TY0 A;  2WXI A;  4C4V B;  3ZKJ C;  2WWZ A;  1ISN A;  3VUW A;  2KX3 A;  4JX1 C;  4IM3 A;  2KTF A;  1XCT L;  3DPD A;  1SE4 A;  1WGR A;  2MBQ A;  1SE9 A;  1KFY B;  1S1Q B;  2KVZ A;  3MTN B;  2AYO B;  4XDD A;  3DVN U;  3ZNZ B;  4WUR A;  3FAH A;  1TT5 B;  2V4I B;  1FNW A;  2WLB A;  1K51 A;  1RM6 C;  1SJE D;  3AE9 B;  2BWF A;  2QDF A;  1TS5 A;  2Q5W D;  3ZYY X;  1ESF A;  3DWG C;  2BT6 A;  4ZDV A;  3P4P B;  3VAW A;  4B0E A;  3ZUN A;  3JSV A;  4AWJ A;  3ZXR A;  1R4M I;  3W1S C;  2WS3 B;  4HKZ E;  5IO9 A;  1YOV B;  4KZC A;  2ON8 A;  4WWO A;  3BYY B;  3PS6 A;  1T0R C;  1ZKH A;  3EFC A;  4MEL A;  3DVG X;  2FCN A;  4FJV B;  2LMC A;  1QLB B;  2KN5 A;  3NG0 A;  1NI3 A;  3P1M A;  2BVC A;  3FC4 A;  2WDV B;  4ZYN A;  3NUH B;  1WM2 A;  3H6N A;  2K6Q A;  1S3S G;  4DXG A;  3MC9 A;  3BY4 B;  1Y56 A;  2NBW B;  3NVZ A;  3M95 A;  1FPY A;  3TSS A;  2M0A A;  4ZRJ A;  2PJH A;  4XDC A;  1WGK A;  4HCP B;  3GZN I;  2LVO A;  1WYW B;  4HJG E;  4DHJ D;  2WXM A;  1FXI A;  2OJW A;  2XK5 B;  2J42 A;  1GC7 A;  3HK0 A;  4BKS D;  3WAO A;  2JYE A;  1KLV A;  2L52 A;  3EFU A;  1C78 A;  2KLG A;  4Q2J A;  1V5O A;  2D5G A;  5JHB A;  5E6P A;  2LFI A;  2V3P A;  3AEE B;  2MEK A;  3Q8A A;  3TEZ A;  4OVU A;  1JCK B;  3JSV B;  5C2T B;  4MT5 A;  1I4R A;  3L13 A;  1D5Z C;  1E10 A;  3AXC A;  3IT6 B;  3ZLZ A;  1GG3 A;  4YSX B;  3UQA A;  2WDQ B;  2KDB A;  2ZCB A;  1ZOY B;  2D2Q A;  2B76 B;  2H88 B;  4W9G A;  3P2B A;  2G4D B;  2MCN B;  2BYE A;  1QOB A;  4XZ4 A;  2NS5 A;  2J0K A;  3MP9 A;  2KTR A;  4ZRK A;  3UIN B;  4P1B C;  1FFU A;  3T3O A;  2L76 A;  2MWS B;  1FCC C;  3DBR I;  3J9C A;  2HTM E;  1CZP A;  1YIW A;  4GMV A;  3BVZ A;  4KX6 B;  4NAM A;  2NPT B;  2KWC A;  2BS4 B;  3A9J B;  1ET9 A;  2QEJ C;  2FE8 A;  1TS2 A;  2O2V A;  1SE3 A;  2DYO A;  3HHM A;  4W9I A;  1GPX A;  5C1Z A;  1AAR A;  2N9P C;  2GBJ A;  3VXW A;  4PT5 A;  3BIN A;  4LDT D;  4I6L B;  2K3U A;  1ZW7 A;  2MX2 A;  2N9K A;  2BBC A;  3BWU D;  4X57 B;  3KUC B;  4JGH B;  1WF9 A;  5BYQ A;  1TIF A;  1PQS A;  4EOY A;  4MM3 B;  3V6E B;  3BII D;  1JW9 D;  4K1R B;  1E8Y A;  2MBH A;  3BZD B;  3N3K B;  4BKG A;  3QAQ A;  3URY A;  1YX6 B;  2R2Q A;  2L1A A;  1L0Y B;  4LNI A;  3GZN B;  4W9E A;  3PZD A;  3SR6 A;  1YN3 A;  2YEP F;  2WNM A;  2D10 A;  1CMX B;  4C7Z A;  2BS3 B;  2LGS A;  1I4X A;  3AEF B;  3RNG C;  2WXQ A;  4GDK A;  2GBN A;  3IHP C;  3QX1 A;  3NZU A;  4KSK C;  3VTU A;  3KYC D;  3PRZ A;  1EWC A;  1WXA A;  3LB8 C;  4M02 A;  3DVN V;  2C9W B;  5BMH A;  4K3C A;  4WH4 A;  2K8C A;  3PGE A;  4FBJ B;  1KF6 B;  3Q3O C;  2A5U A;  1N60 A;  2LUM A;  3VDZ A;  4YSZ B;  2NBV B;  4M0W A;  4KDI C;  4P6V F;  3LJ3 A;  4K7W A;  2MBB B;  3P4S B;  2KJH B;  4M8N A;  2KQS A;  3W9C B;  1UF0 A;  4FJY A;  4CQN A;  3TCA A;  3LXF A;  1SB3 C;  2V0G A;  1G6J A;  1WJN A;  1I42 A;  2K8B A;  2EMT A;  4XYC A;  1F52 A;  4MGI E;  3DBR B;  2ONQ A;  5E6O A;  4FJZ A;  1EU4 A;  5CX3 A;  1EF1 A;  5KHO A;  3AEB B;  1ZGU B;  1WZ3 A;  2M56 B;  3PPA A;  2N0S B;  2MQJ A;  1EM7 A;  1JRP A;  2INN E;  2KAJ A;  3AMZ A;  3R7Q A;  3DHI C;  2PE6 B;  1V1P A;  2GBR A;  3PSE B;  1J19 A;  3ZTD A;  2KVR A;  5LNK 1;  2BPS A;  4JWS C;  2QIE B;  1HXY D;  2HJ8 A;  1XO3 A;  2MBE A;  1WXM A;  5D7G A;  3V05 A;  1SJH D;  3DCG A;  4XC2 A;  4ZRP A;  2D3A A;  2EKI A;  2G1E A;  4TMA B;  1ZPS A;  3V61 A;  2JZP A;  3APC A;  1ZXH A;  2BF8 B;  3SFD B;  2KAN A;  5J18 A;  1STE A;  2W55 A;  4YL8 A;  2D3C A;  3QWZ B;  2W54 A;  3ZNG C;  2OOB B;  3QIJ A;  2BKR B;  4R3D A;  3Q3F A;  2O6V B;  4YTN B;  1WZ0 A;  1D5M C;  4N6E B;  2WXR A;  1BXT A;  2LUE A;  1C76 A;  1KM7 A;  2PW9 A;  2Y5C A;  3A1Q B;  4G11 A;  2QC8 A;  4K81 A;  1UGM A;  1YNT E;  5HG2 A;  4I6N B;  1WRD B;  3X0W A;  2KLC A;  1V97 A;  3ZGZ A;  4JQW C;  2AWT A;  1IBX A;  3ZVV A;  4ZYS A;  4A20 A;  2ZNV C;  2J4X A;  1GUA B;  2KWU B;  2VH2 A;  2KC1 A;  2WP9 B;  5DPS A;  4A8X C;  3RNC C;  4OZA A;  1C4P A;  5JH5 C;  3U7D A;  1XLQ A;  2IPK D;  3VHT C;  2I1K A;  4K7S A;  4L23 A;  4GSW A;  2CHX A;  3MFG A;  1B9R A;  4WJO A;  1M4V A;  2LHD A;  1DYQ A;  3P4Q B;  4WIP A;  3VTW A;  3B2F A;  5DPR A;  2JPH A;  1V49 A;  1VCB A;  4ZOH C;  4LNF A;  2Z0D B;  1YMH E;  1DOI A;  2NBU A;  4II3 B;  1RLF A;  2MHJ A;  1PGB A;  1E8W A;  1YX5 B;  3V62 A;  3HUI A;  3DBH I;  2WXN A;  4JWU C;  1CQV A;  3RNF C;  1WH3 A;  4K3B A;  3W2D A;  3UF8 A;  4IDI A;  1MG4 A;  1ZXI A;  4JE3 B;  2D11 A;  2M8S A;  3L10 B;  3V60 A;  2FAZ A;  2KDF B;  1QQR A;  2PEA A;  3H7P B;  3HM3 A;  1J7C A;  1YJ1 A;  4HDO A;  2NTT A;  3PLU A;  4ZHO A;  3W1Y A;  5EE1 A;  1PYW D;  4MGK E;  2KWV B;  2N1V A;  1LGR A;  2KAC A;  3VFK A;  3OLM D;  1XLN A;  3FKY A;  3UIO B;  2PVG C;  5D3I B;  1WX7 A;  2IJ0 A;  2N4F A;  3C0R B;  4MEM A;  1WFY A;  3VH3 B;  4C4V A;  1WGD A;  2K5P A;  3AE8 B;  3A4R A;  2HDE A;  1RFA A;  2C7M B;  4F8C B;  3AN1 A;  2MP2 B;  2LJI A;  3ZXV A;  2FUH B;  4MJS B;  1V1O A;  3TJP A;  4WQM A;  3DBL B;  3U8Z A;  4DK5 A;  4GU2 A;  2V9H A;  3L08 A;  3N30 A;  1FNV A;  2Y5P A;  3EHV A;  2CU1 A;  1NI2 A;  2V3N A;  3IAS 1;  1WGG A;  1ZE3 D;  1I4Q A;  2L0F A;  4OZC A;  3AEA B;  1BT0 A;  1P7E A;  4DHZ E;  4IM2 A;  3ZIM A;  4RGN A;  1YJJ A;  5AZF A;  3C8Y A;  1FCL A;  3SDL C;  3AUL A;  4E74 A;  5T8I A;  5J2R A;  2MRP A;  1VZ7 A;  5DPW A;  1TS3 A;  1JAL A;  3I63 C;  2KOX A;  5MPO A;  3RZF A;  4ZHP A;  4RGT A;  3DBS A;  4B95 A;  1AN8 A;  4PYZ A;  4YWG G;  3AV8 A;  1HTO A;  3KYD D;  3B9J A;  4J3O D;  1MVK A;  2G3Q B;  5FR6 A;  3RI7 C;  3U4E G;  3ZJT A;  3ZDT A;  3MHS D;  2DEN B;  1I7H A;  4TKN A;  4ARC A;  3WAP A;  1UZX B;  4MSQ B;  1WM3 A;  2INC C;  3N1Y C;  4W9D A;  3SEB A;  1UBI A;  5I4D A;  4WQO B;  2XK5 A;  2PTL A;  2WDR B;  4URK A;  3R8B A;  3NVY A;  4P1C C;  4HRO A;  2KJ6 A;  2WYQ A;  4ANU A;  4HLE A;  1HQR D;  5G5H A;  4AOF A;  2R61 A;  1E90 A;  2MBO A;  1J7B A;  2IDY A;  1I4P A;  1SSN A;  5BYR A;  5FR3 A;  3TL5 A;  4KKI A;  4CHK A;  2K39 A;  4N58 A;  4PYU A;  2L32 A;  2KFJ A;  3S2A A;  2KXJ A;  3P4R B;  4WWN A;  2YEP B;  5AZG A;  4IUM B;  2KHW B;  3AU5 A;  1KLG D;  2L3Z A;  3KW5 B;  4RNA A;  3DHH C;  3KLS X;  2W9N A;  4M01 A;  3ML8 A;  1KLU D;  2KDI A;  1H8C A;  4GDL B;  1GJZ A;  3WAM A;  2KN4 A;  4HXD A;  2J0J A;  4USA A;  2DYB A;  5LXI B;  4YSY B;  4YT0 B;  2AEH A;  2CJN A;  2PKO A;  4C80 A;  2NPT A;  4FA6 A;  3VR9 B;  3PRP B;  3A9J A;  2BKF A;  1U4A A;  4HPP A;  1F1H A;  3RZW C;  1ACC A;  1TZO A;  4TQ0 A;  1L0X B;  3AED B;  2JUO A;  2W3R A;  1JWM D;  3Q3M C;  1GB1 A;  4REZ A;  3VTV A;  1QF6 A;  3RNE C;  1L6U A;  5EE3 A;  1LO5 D;  1C79 A;  1B1Z A;  4MM3 A;  4YXD B;  2AQ1 B;  4NQK E;  4DDG D;  4WAA A;  2LWP A;  5IAA C;  4C7Y A;  2K25 A;  2GBM A;  1F2R C;  1N5W A;  3L0W B;  1WSP A;  1OEY A;  1V2Y A;  2LRW A;  4IG7 B;  4OVZ A;  3Q8E A;  3ZRF A;  3TEW A;  2RDB C;  2LD9 A;  1E6E B;  4NJ6 A;  3T3N A;  3APD A;  2K1F A;  2BS2 B;  1SIJ A;  5AEK B;  3BK1 A;  2N9L A;  2AL3 A;  5CHW A;  3ZNH B;  3VRB B;  3KH0 A;  4DDI D;  1K52 A;  2MJ3 A;  5CHF A;  1R4M B;  3ZJU A;  1FXA A;  2TSS A;  3RPF C;  2BWE S;  2BTE A;  3IT4 B;  2AQ3 B;  4A3P A;  1GC6 A;  5EDS A;  1WJ6 A;  2KYW A;  1XQQ A;  4BFR A;  4EZK A;  5D2M B;  1L0V B;  2M4N A;  3N1X C;  3AE2 B;  1T6B X;  4US8 A;  3O65 B;  1C3T A;  3SU8 X;  1QIL A;  4WWM A;  5TSS A;  1E7U A;  1T0Q C;  4FAD A;  4LDT B;  2NR2 A;  2HTH A;  2ZW1 A;  1D6E C;  1TGZ B;  2LGI A;  2RD0 A;  3DVG Y;  1NVI D;  2XN9 C;  4ZRQ A;  3W5V B;  1WE6 A;  2KC2 A;  5E6J A;  2QCZ A;  4UDU C;  1V9J A;  3KVF B;  4N9F 4;  1T0Y A;  4LNO A;  3KWV A;  4GXB A;  3QAR A;  3NY5 A;  1BUI C;  2DHZ A;  1WIA A;  4CO7 A;  3IXS A;  1WY8 A;  3MC8 A;  4MDK E;  1L4D B;  2GRI A;  4YTP B;  2BYF A;  1XF5 L;  3VRA B;  5H92 C;  3RNA C;  1R4N I;  4IM0 A;  1YJI A;  2WXF A;  4TUU A;  4NAW B;  2LHE A;  1OQR A;  2WX0 A;  5BYS A;  5E6N A;  2WXH A;  1OTR B;  2CJO A;  1HE8 A;  3AU4 A;  4M8M A;  1WX9 A;  2WXL A;  3GB1 A;  3M3J A;  2GOW A;  2C7H A;  4EEW A;  2G9H D;  2IYD B;  1LQB A;  3TIX A;  4G0N B;  1TJE A;  4RM8 A;  4LTU A;  2L00 B;  1BML C;  2HD5 B;  1VR9 A;  1RRB A;  2O6V A;  4B0M A;  2M19 A;  1FO4 A;  1KH0 A;  3A33 B;  3OJ3 A;  3JW0 X;  4HDQ A;  2N1W A;  2GB1 A;  1UWX A;  2BB6 A;  3A9K B;  4YTM B;  3A1Q A;  3QC8 B;  2AQ2 B;  1PGA A;  2GMI C;  5BO4 B;  4NJC A;  1XLP A;  4A3O A;  2IND C;  1VZ6 A;  1YN5 A;  2BB5 A;  4HEA 1;  3NZ3 A;  1OQY A;  2CHZ A;  3HM6 X;  5KHQ A;  3DOW A;  3AE3 B;  1C4A A;  1E5W A;  3Q8F A;  3ONS A;  4LCD E;  3RMK C;  2ZNV B;  1WXQ A;  2LVP A;  2QHO A;  3LDZ E;  1TZ1 A;  1SE2 A;  3ZW3 A;  4MGZ E;  3HVD A;  3PT2 B;  3RNB C;  3AE7 B;  4ANX A;  3ML9 A;  5AUI A;  1CJE A;  4GOC A;  3EC8 A;  1N6Z A;  1ZP0 B;  1K50 A;  3X23 A;  4W9H A;  4KKJ A;  2GI9 A;  2ZPN A;  4WAF A;  3KUZ A;  4W9F A;  4IOI E;  3ZNI D;  2WXP A;  2DBY A;  3R66 C;  3VUY A;  4RMA A;  3IAM 1;  4JPS A;  5D94 A;  2OED A;  3SHQ A;  2ZPY A;  2LI5 A;  2C7N B;  2FID A;  3VVW B;  4A55 A;  2QJL A;  5C3J B;  5BMI A;  4LK0 M;  3MHZ A;  1FIQ A;  4A90 A;  2I2Y A;  4KGT A;  2LGY A;  3VUX A;  5AZH A;  1I4H A;  4ICU A;  3VH4 B;  3JVZ X;  4D2K A;  1J7A A;  1WXV A;  3RUI B;  4GLS C;  5D6J B;  1EUV B;  2DLB A;  3BVM A;  4NZL B;  1WR1 A;  2WU2 B;  1L2N A;  4ANV A;  5CTR C;  2W3S A;  5IOI A;  2JZ3 B;  4GB9 A;  5G5G A;  3TBL D;  4DHZ B;  4EE2 A;  2PE9 A;  3H7P A;  1KTK A;  2RMM A;  3MJ5 A;  2I1J A;  2ZVO A;  3Q3J A;  4FN2 A;  1N62 A;  3Q3N C;  2GBK A;  1EU3 A;  2DAF A;  4MSM B;  1XEE A;  3PRE A;  1M94 A;  4L2Y A;  2KMM A;  2X38 A;  3NVV A;  2MSE D;  1VRA B;  2ZEQ A;  5C23 A;  3LYY A;  2QIL A;  1MJD A;  1PDX A;  1J0G A;  1V86 A;  1TKY A;  4OHJ A;  2DYM A;  2MP2 A;  4E71 A;  3M62 B;  4MJS A;  1DOY A;  3KQ4 A;  4W9K A;  1NEN B;  5JZE B;  2WDT B;  3O13 A;  2DZI A;  1P98 A;  3H8H A;  2WX1 A;  1AYF A;  2ZW0 A;  2OJR A;  3E56 A;  3L16 A;  1VDV A;  5IP4 D;  4JLC A;  1WX8 A;  4ASW C;  3GE8 C;  2J52 A;  4AJY B;  3TUO A;  3PV1 A;  3IVF A;  2JVC A;  2KX0 A;  2BW2 A;  2Z0E B;  1JWS D;  2V1Y A;  1JML A;  2J7Q B;  5GMV A;  1QOA A;  2FBW B;  4S0R A;  4RCO A;  4KGS A;  3NJT A;  1ENF A;  4ITK A;  1Q5W B;  1P9D U;  2RR9 A;  3DHG C;  2NCN A;  2Z8L A;  4KGR A;  2JY6 A;  3RYT A;  2V4L A;  1IGC A;  1WI0 A;  4G50 A;  2KJR A;  2LGX A;  1VLB A;  2W82 A;  1QOG A;  2DZJ A;  1L6V A;  2IY0 B;  2VZK D;  5IN7 A;  1EF5 A;  1OGW A;  2NMQ A;  2C60 A;  2LAS A;  2UYZ B;  4HK2 A;  3CMM B;  1KOT A;  2JZZ A;  2LXA A;  4OW0 A;  1UBQ A;  4LNK A;  1F2R I;  3H9D A;  2ZCC A;  2JSV X;  4HWI B;  1VJK A;  3EUB 2;  5EE0 A;  1QT9 A;  4XE0 A;  1QZE A;  3KWL A;  1HTQ A;  4G3X B;  2K9X A;  2KFK B;  4GN1 A;  4WJN A;  3ZQ4 A;  4XGA B;  1UGJ A;  2XBB C;  1V5T A;  1AW7 A;  1ROE A;  3Q69 A;  2IO3 B;  2INP E;  3WAN A;  1P7F A;  2PVO D;  3NRZ A;  2IGG A;  4MAC A;  1QKZ A;  4ICV A;  4S17 A;  1D5X C;  5BMG A;  3ECI A;  1P0R A;  5TR5 A;  5G55 A;  2RDG A;  2FCS A;  2FCM A;  3TEY A;  5G2N A;  5LXH A;  3APF A;  2B3A A;  3JYU A;  2FCQ A;  1IUE A;  1WGY A;  4N59 A;  1C1Y B;  1T5X D;  2RGF A;  3DBH B;  1GB4 A;  4GDL A;  3Q6B A;  2I38 A;  2KDM A;  4F1S A;  1SIF A;  4I6P A;  1SF0 A;  3IG3 A;  2VH1 A;  1RAX A;  3RT3 B;  3PTF C;  3WIM A;  3T9L A;  2MH7 A;  1F0Z A;  3I57 A;  1V81 A;  2K22 A;  2H89 B;  1NBF C;  1VD2 A;  3CIR B;  3B0A A;  4US9 A;  1WRI A;  4TQ1 A;  3QCA A;  1JRU A;  4MGY E;  1WJ4 A;  2KKC A;  1Y8R C;  2HE7 A;  3AB5 A;  3NS1 A;  2WQY B;  2NTS A;  1XT9 B;  3OJ4 B;  1FEH A;  4TV3 A;  4KIK B;  1V6E A;  4BZA A;  3IFW B;  2XEW A;  1TYG B;  2ICI A;  4BKS A;  1MHX A;  3UGB B;  2JT4 B;  2LVQ A;  4XWW A;  3M63 B;  2KK8 A;  2ASQ A;  2IBI B;  4BKT A;  3NHE B;  1WXS A;  4KV2 A;  4E3C A;  4BBN F;  3FIL B;  1T0S C;  1SGH A;  4RGO S;  4W9C A;  3Q14 C;  3ZJV A;  1A5R A;  3AEG B;  1YD8 U;  3RD2 A;  1P1A A;  3BYT B;  3NOB A;  3SFE B;  1N5X A;  1UH6 A;  1YQ4 B;  3PZ7 A;  3AH7 A;  2M1M A;  1Q10 A;  1Z2M A;  3ABV B;  2DZK A;  3H7S A;  3K9O B;  2N9X A;  4EFO A;  2DWQ A;  2KZR A;  4A6Q A;  4IC7 B;  2DAJ A;  3U2S C;  1FM0 D;  2XNA C;  1JWU D;  1IPG A;  3VR8 B;  2M0X A;  2R2O A;  2EEL A;  3AI5 A;  4DHJ B;  3L54 A;  4MH8 A;  4W9L A;  1C77 A;  4WWP A;  2ZZP B;  2AL6 A;  5IA7 A;  4BVU C;  2E3T A;  1HA5 A;  4C56 C;  2MJD A;  2LEK A;  4OZB A;  1E8Z A;  3U52 E;  4B9K A;  1D3Z A;  2ZVN A;  3OAW A;  4L1B A;  2WXO A;  1JWB D;  3MC0 B;  2G4S A;  3KUD B;  3VQI A;  3EGR A;  2K8H A;  3PO0 A;  3N1Z C;  4WJP A;  2ACZ B;  3TEX A;  2IO1 B;  4NJ7 A;  3N32 A;  4NAW A;  2X8X X;  1H4R A;  3T8M A;  2KDE B;  3GS2 A;  1L5P A;  2A4Z A;  2MJE A;  1WJU A;  1N63 A;  2PPH A;  3L17 A;  4C00 A;  1UD7 A;  2WXG A;  4PS7 A;  2CR5 A;  3HIZ A;  3RUL A;  4KDL B;  5CHV C;  2J53 A;  2K0P A;  1NYR A;  1R7S A;  3EEC A;  4RF0 A;  3K9P B;  3NS8 A;  3EA6 A;  4II2 B;  3PRM B;  1JWA D;  2BYV E;  3BVG A;  3CF6 E;  1YQB A;  2IO0 B;  3A9K A;  3BK2 A;  1V8C A;  4BOS C;  2G45 B;  1Z5S B;  2NVU I;  2JRI B;  2L7R A;  2YLM A;  1I4G A;  4FXC A;  3B2G A;  5L95 C;  4KSL C;  3UQB A;  1DGJ A;  2JU6 X;  5HI1 A;  2WGS A;  3P42 A;  3ALB A;  2JYT A;  3AE5 B;  2D3G A;  4ZRI A;  3RN9 C;  4P7I A;  2JXT A;  2L05 A;  4TSS A;  1FXT B;  1HZ5 A;  2DX5 B;  3I9V 1;  3C19 A;  1WE7 A;  2N7J A;  3A4S C;  2WHI A;  1A70 A;  4DXA B;  2KTR B;  4RGM A;  3GE3 C;  1WR6 E;  1OEY J;  4LLG M;  3AE6 B;  3QA8 A;  1D4B A;  4AS1 A;  1Q0W B;  3AE1 B;  2JQR B;  3AEC B;  2REX A;  2HJ1 A;  4RM9 A;  1TBE A;  5LLI A;  4LJP B;  2JWU A;  3W5U B;  4P16 A;  4GIV A;  3N20 C;  2O2V B;  2JWZ A;  2N9E B;  1XCQ L;  4AQ7 A;  1E7P B;  1TTN A;  1PFD A;  3D32 A;  3N9Y C;  4ACF A;  3ZRC A;  2MLB A;  2EKE C;  1JQ4 A;  3HVZ A;  2IY1 B;  1SXT A;  2PLP A;  1LFD A;  1UUP A;  2CS4 A;  1ZDV A;  3GP7 A;  3V6C B;  2RSU A;  3V3X A;  4A9A A;  3H1U A;  3UIP B;  1E8X A;  4J6I A;  1WGH A;  2YVC A;  4HPM B;  1E7V A;  3AM9 A;  1Q1O A;  4IWQ A;  3Q8C A;  2LGD A;  1AWD A;  5EE9 A;  4DXF A;  4AJW A;  2M17 A;  1RWS A;  4DQO C;  1N61 A;  2N7E A;  1ZDX A;  1WWT A;  2RPV A;  1HEZ E;  4DBG A;  4GGQ A;  2E6X A;  2IO2 B;  2BYT A;  3I5J C;  2RPQ A;  4GDK B;  4ARI A;  3ZO5 B;  4AP4 C;  4JL9 A;  4HKQ A;  2KQ7 A;  4HVB A;  1HZ6 A;  3PVL A;  1GOZ A;  2O6V D;  2Y5B B;  2DNF A;  4ANW A;  3ETR A;  1SBB B;  5J17 A;  1E9M A;  1R4N B;  4M0W B;  4QAY A;  1V80 A;  2N7D A;  1NYQ A;  4NNJ B;  1I35 A;  2EMS A;  2AX5 A;  3ENE A;  1F9J A;  1K53 A;  1CK1 A;  4BAX A;  1WMH A;  2C5L C;  3NVW A;  4RFB A;  3WAL A;  4RH6 A;  1F77 A;  5L83 A;  2L8J A;  1OFF A;  4PK1 A;  2K6D B;  4H2A A;  4AUQ C;  1PUT A;  2GLS A;  1MI0 A;  2WU5 B;  3NZS A;  1OQQ A;  4O1N A;  4EZL A;  4IKG A;  2JX5 A;  5DPT A;  1FNU A;  1XLO A;  2KT7 A;  2RDH A;  2QSD A;  1MPE A;  2KMA A;  2WXK A;  4M00 A;  3I3T B;  1LXD A;  3QQ8 B;  2KD0 A;  4KVG B;  3PHX B;  3UI3 A;  1V1P B;  2CU3 A;  3QJZ A;  1FRD A;  3DBL I;  1ZUD 2;  4K7U A;  3RFZ B;  1K8R B;  2JF5 A;  5JHA A;  3DDC B;  2IGD A;  1T3Q A;  1YN4 A;  2IZV B;  2KNB A;  1FRR A;  2LJ5 A;  5H8Y E;  1MHH E;  2KO3 A;  1TKE A;  1C9F A;  1L4Z B;  2LZ6 A;  3MJW A;  3P63 A;  3PZ8 A;  1DOX A;  2KQ4 X;  1UNS A;  3TMP B;  4B6W A;  2LXC A;  4RF1 A;  3DWM A;  4MH0 E;  2IGH A;  2DZM A;  1UEL A;  3U30 A;  2L83 A;  3ZTC A;  2PMV A;  3RCZ A;  3IBE A;  1WMH B;  2QMT A;  1TS4 A;  2KFK A;  3WCQ A;  3CST A;  4EKU A;  2L0T A;  1VZ8 A;  1RFK A; 
#chains in the Genus database with same CATH homology
 1JRP A;  3VRB B;  2INN E;  3AB5 A;  1K52 A;  3NS1 A;  3Q8B A;  2MJ3 A;  2KAJ A;  3AMZ A;  2WQY B;  2NTS A;  1V1P A;  3ZJU A;  3W1S A;  1WYG A;  2OHF A;  1FEH A;  1FXA A;  2TSS A;  3RPF C;  2Y3A A;  2BTE A;  1SEB D;  5LNK 1;  3IT4 B;  2SAK A;  1TYG B;  2ICI A;  3R2I A;  3AE4 B;  4JWS C;  2QIE B;  2AQ3 B;  1HXY D;  1MHX A;  2WXJ A;  1IBX B;  1XO3 A;  4XWW A;  5D7G A;  3V05 A;  1GAQ B;  1SJH D;  4ZRP A;  5AUK A;  4XWT A;  2EKI A;  1IGD A;  2G1E A;  4TMA B;  1ZPS A;  5HHD G;  2JZP A;  1ZXH A;  1L0V B;  3FIL B;  3AE2 B;  1T6B X;  3SFD B;  3CWI A;  3U7Z A;  4US8 A;  2FUG 1;  1QIL A;  4WWM A;  4RGO S;  5TSS A;  1STE A;  2W55 A;  2ZW1 A;  1FFV A;  2W54 A;  1D6E C;  4HRS A;  1E0Z A;  4R3D A;  1TY2 A;  2LGI A;  3ZJV A;  1NVI D;  4YTN B;  3AEG B;  5HFY A;  1XXG A;  2XN9 C;  1FD6 A;  1D5M C;  4ZRQ A;  4N6E B;  3W5V B;  2WXR A;  1ET6 A;  1BXT A;  1JRO A;  5E6J A;  3BYT B;  4UDU C;  2VZK B;  1C76 A;  2PW9 A;  2Y5C A;  3SFE B;  1N5X A;  2SEB D;  1YQ4 B;  3L4P A;  1RYJ A;  3PZ7 A;  1C4C A;  3AH7 A;  5FK9 C;  3KWV A;  1NEK B;  3HRD D;  1UWM A;  1Q10 A;  1BUI C;  3ABV B;  3IXS A;  1YNT E;  1L4D B;  2GRI A;  4YTP B;  5HG2 A;  5JXV A;  2DWQ A;  1XF5 L;  4A6Q A;  3U2S C;  1FM0 D;  1V97 A;  2XNA C;  3VRA B;  5H92 C;  1JWU D;  3ZGZ A;  3VR8 B;  1YJI A;  1IBX A;  2WXF A;  4ZYS A;  4NAW B;  2J4X A;  2EEL A;  2LHE A;  1OQR A;  1YQ3 B;  5BYS A;  2WXH A;  2CJO A;  2WP9 B;  2WXL A;  3GB1 A;  1PGX A;  1TKG A;  4MH8 A;  2G9H D;  3FIL A;  3OWE B;  4A8X C;  1EWY C;  1C77 A;  4OZA A;  1C4P A;  1QOF A;  1TJE A;  4LTU A;  1XLQ A;  5FKA C;  2IPK D;  1BML C;  3E9S A;  4L23 A;  1VR9 A;  3MFG A;  5D3D A;  2M19 A;  4B0M A;  2E3T A;  1B9R A;  1FO4 A;  1HA5 A;  1KH0 A;  4C56 C;  2PIA A;  2GB1 A;  1M4V A;  1UWX A;  2LHD A;  2MJD A;  2LEK A;  1DYQ A;  1KRH A;  2BB6 A;  3P4Q B;  4OZB A;  4WIP A;  3B2F A;  3U52 E;  4YTM B;  5GXG B;  1FMA D;  2AQ2 B;  4L1B A;  3R2T A;  1PGA A;  2WXO A;  1JWB D;  3MC0 B;  4NJC A;  2KWD A;  3VQI A;  3EGR A;  1TY0 A;  4ZOH C;  2WXI A;  3PO0 A;  1XLP A;  1YMH E;  1DOI A;  1VZ6 A;  1YN5 A;  2BB5 A;  4HEA 1;  3NZ3 A;  2ACZ B;  3TEX A;  1PGB A;  4JX1 C;  1XCT L;  3AE3 B;  1C4A A;  1SE4 A;  1KFY B;  3Q8F A;  3HUI A;  4XDD A;  3GS2 A;  1WXQ A;  1L5P A;  3FAH A;  4WUR A;  2WXN A;  4JWU C;  1CQV A;  2V4I B;  1SE2 A;  1FNW A;  2MJE A;  3W2D A;  1N63 A;  2WLB A;  3HVD A;  4IDI A;  1ZXI A;  1K51 A;  2WXG A;  1RM6 C;  4JE3 B;  3AE7 B;  5AUI A;  1CJE A;  1SJE D;  3AE9 B;  2J53 A;  2K0P A;  1NYR A;  1R7S A;  1TS5 A;  4RF0 A;  1QQR A;  2Q5W D;  1ZP0 B;  1K50 A;  3ZYY X;  4KKJ A;  1J7C A;  1ESF A;  2GI9 A;  3DWG C;  2NTT A;  2BT6 A;  3EA6 A;  4ZHO A;  3P4P B;  4WAF A;  5EE1 A;  1PYW D;  1JWA D;  4B0E A;  4IOI E;  2KAC A;  3BVG A;  2WXP A;  2DBY A;  3BK2 A;  1V8C A;  1XLN A;  3IAM 1;  4JPS A;  2PVG C;  5D3I B;  2OED A;  2IJ0 A;  2WS3 B;  4HKZ E;  1I4G A;  4A55 A;  2ON8 A;  2QJL A;  3BYY B;  5C3J B;  5BMI A;  4FXC A;  2K5P A;  3AE8 B;  4LK0 M;  3B2G A;  3MHZ A;  2HDE A;  1FIQ A;  4A90 A;  2I2Y A;  4KGT A;  1DGJ A;  2LMC A;  1QLB B;  2JU6 X;  5HI1 A;  1I4H A;  3AN1 A;  1NI3 A;  3P1M A;  4D2K A;  3FC4 A;  3P42 A;  2LJI A;  2JYT A;  3AE5 B;  1V1O A;  2WDV B;  1J7A A;  3NUH B;  4WQM A;  4GLS C;  2DLB A;  3BVM A;  4NZL B;  2WU2 B;  4DXG A;  1FNV A;  2Y5P A;  2JXT A;  1Y56 A;  4TSS A;  1HZ5 A;  3I9V 1;  2W3S A;  3NVZ A;  2V3N A;  3IAS 1;  3TSS A;  5G5G A;  2M0A A;  2N7J A;  4EE2 A;  1A70 A;  1ZE3 D;  4XDC A;  4RGM A;  1KTK A;  1WGK A;  1I4Q A;  2RMM A;  3MJ5 A;  4OZC A;  3AEA B;  1P7E A;  4LLG M;  3AE6 B;  4HJG E;  1N62 A;  2WXM A;  1FXI A;  1D4B A;  1EU3 A;  3BK1 A;  4AS1 A;  2J42 A;  4RGN A;  3AE1 B;  1YJJ A;  2JQR B;  3C8Y A;  2JYE A;  1FCL A;  3AEC B;  1XEE A;  2L52 A;  1C78 A;  4Q2J A;  2D5G A;  5T8I A;  1VZ7 A;  2LFI A;  1TS3 A;  2V3P A;  3AEE B;  4L2Y A;  2MEK A;  2KMM A;  3Q8A A;  1JAL A;  3TEZ A;  1JCK B;  2X38 A;  2JWU A;  3NVV A;  5C2T B;  5MPO A;  4MT5 A;  3W5U B;  1I4R A;  1VRA B;  4P16 A;  4RGT A;  4ZHP A;  1D5Z C;  1E10 A;  1AN8 A;  3IT6 B;  3LYY A;  2QIL A;  1PDX A;  1XCQ L;  4YSX B;  4AQ7 A;  4YWG G;  1E7P B;  3AV8 A;  1TKY A;  4OHJ A;  1PFD A;  3B9J A;  2DYM A;  3N9Y C;  2WDQ B;  4J3O D;  1MVK A;  1DOY A;  3KQ4 A;  1ZOY B;  1JQ4 A;  1NEN B;  3HVZ A;  3O13 A;  3U4E G;  3ZJT A;  2B76 B;  1SXT A;  2H88 B;  2PLP A;  1UUP A;  3H8H A;  1I7H A;  1QOB A;  1AYF A;  1ZDV A;  2ZW0 A;  3GP7 A;  3E56 A;  1VDV A;  4ARC A;  3V3X A;  3MP9 A;  4A9A A;  2J52 A;  3TUO A;  1FFU A;  3SEB A;  3T3O A;  2N9L A;  5I4D A;  3AM9 A;  1FCC C;  2BW2 A;  1JWS D;  3J9C A;  2HTM E;  2PTL A;  3Q8C A;  2WDR B;  1CZP A;  1JML A;  1AWD A;  5EE9 A;  4DXF A;  3R8B A;  1QOA A;  3NVY A;  2FBW B;  1RWS A;  3BVZ A;  4KX6 B;  4DQO C;  4NAM A;  1N61 A;  4HRO A;  4RCO A;  4KGS A;  1ZDX A;  1WWT A;  2RPV A;  2BS4 B;  1ENF A;  1HEZ E;  4ITK A;  2BYT A;  2E6X A;  1HQR D;  5G5H A;  2R61 A;  1ET9 A;  4GDK B;  4ARI A;  1J7B A;  2IDY A;  1I4P A;  2QEJ C;  1SSN A;  2FE8 A;  5BYR A;  1TS2 A;  5FR3 A;  1SE3 A;  4KKI A;  2Z8L A;  2DYO A;  1GPX A;  4KGR A;  4N58 A;  4PT5 A;  4HKQ A;  2L32 A;  2K3U A;  2N9K A;  2BBC A;  1HZ6 A;  3BWU D;  3P4R B;  1GOZ A;  5BYQ A;  2YEP B;  1IGC A;  3ETR A;  1SBB B;  1VLB A;  2W82 A;  1KLG D;  4RNA A;  1E9M A;  1QOG A;  1L6V A;  3KLS X;  4MM3 B;  3BII D;  2VZK D;  1NYQ A;  1JW9 D;  1KLU D;  2NMQ A;  3BZD B;  2AX5 A;  1K53 A;  1CK1 A;  3URY A;  4GDL B;  2L1A A;  3NVW A;  4RFB A;  4OW0 A;  4RH6 A;  1F77 A;  1L0Y B;  2KN4 A;  1F2R I;  1OFF A;  2JSV X;  3SR6 A;  4H2A A;  1YN3 A;  1VJK A;  3EUB 2;  2YEP F;  1PUT A;  4USA A;  1MI0 A;  2WU5 B;  5EE0 A;  1OQQ A;  2WNM A;  1QT9 A;  4XE0 A;  3KWL A;  4C7Z A;  4O1N A;  4YSY B;  4YT0 B;  2BS3 B;  2CJN A;  2K9X A;  2PKO A;  4C80 A;  4IKG A;  2JX5 A;  3ZQ4 A;  1UGJ A;  1FNU A;  1XLO A;  3VR9 B;  1I4X A;  1AW7 A;  2RDH A;  2QSD A;  1MPE A;  3AEF B;  2WXK A;  1ROE A;  3Q69 A;  2INP E;  2WXQ A;  1P7F A;  2PVO D;  3NRZ A;  1ACC A;  1TZO A;  2IGG A;  4TQ0 A;  1L0X B;  3AED B;  4MAC A;  1QKZ A;  2W3R A;  3UI3 A;  1V1P B;  1JWM D;  1D5X C;  1EWC A;  2CU3 A;  3LB8 C;  5BMG A;  5BMH A;  1GB1 A;  1FRD A;  1ZUD 2;  4REZ A;  4WH4 A;  1QF6 A;  3RFZ B;  1KF6 B;  2IGD A;  2RDG A;  1L6U A;  1N60 A;  5EE3 A;  1T3Q A;  2LUM A;  1LO5 D;  1YN4 A;  4YSZ B;  3TEY A;  1FRR A;  5H8Y E;  1MHH E;  4M0W A;  1C79 A;  1B1Z A;  1TKE A;  4P6V F;  4YXD B;  3P4S B;  1C9F A;  2AQ1 B;  1L4Z B;  3P63 A;  1IUE A;  3PZ8 A;  4N59 A;  1DOX A;  3W9C B;  1T5X D;  2KQ4 X;  4CQN A;  4C7Y A;  1GB4 A;  1UNS A;  2I38 A;  2KDM A;  3LXF A;  1F2R C;  4RF1 A;  1N5W A;  1SB3 C;  2V0G A;  1WSP A;  3DWM A;  1SF0 A;  2IGH A;  2L83 A;  2ONQ A;  2PMV A;  4OVZ A;  3Q8E A;  3TEW A;  2MH7 A;  1EU4 A;  1F0Z A;  3I57 A;  1E6E B;  3AEB B;  2K22 A;  2H89 B;  3T3N A;  2QMT A;  3CIR B;  1TS4 A;  3WCQ A;  4US9 A;  1WRI A;  2M56 B;  4TQ1 A;  2BS2 B;  2N0S B;  1SIJ A;  1EM7 A;  1VZ8 A;  1RFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...