2OEDA

Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
b'MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Evaluation of backbone proton positions and dynamics in a small protein by liquid crystal NMR spectroscopy
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2oedA00
5BMHA 2OEDA 2EELA 1XF5L 1ZXHA 1KH0A 5HHDG 4D2KA 4IKGA 1UWXA 1YNTE 1PGAA 1JMLA 2PTLA 2ZW1A 5HG2A 5BMGA 1YMHE 2JU6X 2QSDA 2RPVA 3GB1A 1EM7A 2ONQA 1FCLA 1HZ5A 2GI9A 4GLSC 2QMTA 2KWDA 1MHXA 1IBXB 4KGTA 2PW9A 2PLPA 1IGDA 5BMIA 1K52A 2ZW0A 3FILB 2IGDA 2IGHA 2JSVX 2JXTA 1FD6A 1PGXA 1GB4A 1C9FA 1F2RC 2LUMA 2N9LA 4OZCA 4IOIE 1P7FA 1D4BA 4OZBA 4HKZE 1MI0A 1QKZA 1MVKA 1HEZE 2RMMA 1K53A 2KQ4X 4WH4A 5HFYA 2I38A 2K0PA 1MHHE 2J52A 1GB1A 2KN4A 3MP9A 1P7EA 4KGSA 2I2YA 2JZPA 2KDMA 2J53A 1PGBA 5HI1A 3V3XA 1MPEA 2NMQA 2KACA 1K50A 1XCQL 2GB1A 1F2RI 4KGRA 2IGGA 1IGCA 2ON8A 1HZ6A 4MACA 1IBXA 4HJGE 5JXVA 1K51A 2N7JA 2LHEA 1FCCC 2LGIA 1Q10A 2JWUA 3FILA 4OZAA 3UI3A 2LHDA 2N9KA 1XCTL
chains in the Genus database with same CATH superfamily
3A9JA 1I4PA 4NPNA 2Y3AA 2GBKA 1L4DB 1B9RA 2BWFA 4D2KA 3H9DA 4M00A 4TUUA 2ZPYA 1WE7A 4PS3A 4PYZA 4FADA 4JX1C 4GGQA 2JYTA 4W9EA 2LVQA 1CMXB 3UGBB 2MBEA 1BUIC 2V0GA 1L7YA 2JU6X 3GB1A 1IP9A 3DQVA 1ACCA 4DK5A 1Y8RC 1D5ZC 4RH6A 3KH0A 1EWCA 4MGZE 3FILB 5BO4B 3C0RB 1YJ1A 4ZRJA 1EO6A 3AB5A 2KANA 2LUMA 2DAJA 3RNBC 4HKZE 1OEYA 3ZJTA 2RD0A 3Q8EA 3IAS1 2OJRA 4DXAB 5HFYA 5AUIA 3VR8B 3KVFB 1WYGA 3R8BA 3W2DA 2NVUI 1R4MB 3H7PB 5IP4D 2VZKD 4KSLC 1E10A 3RI7C 1TKYA 4TSSA 4XZ4A 3RD2A 2JUOA 4N59A 2MP2B 1SB3C 2NTSA 3A9KA 3ENEA 3N1ZC 4RGOS 5LXIB 3RZFA 3U52E 3MTNB 1I7HA 4GDKA 1WY8A 1WRDB 1FMAD 3TJPA 2GB1A 2L32A 1RLFA 3AE4B 2K8CA 2L0FA 2KFJA 3FKYA 2UU7A 5IN7A 4K81A 5H8YE 4FJZA 1VCBA 4YL8A 3IBEA 2WXFA 1WYWB 3ZNGC 1HQRD 4MGYE 1C76A 1UBIA 2WYQA 3PZ7A 4PT5A 4HCPB 4K7WA 3HIZA 3DBHB 2AL6A 2WP9B 4JLCA 3R2IA 3PRPB 1YOVB 4NQKE 1FM0D 5BMGA 1HTOA 3NS1A 2HTHA 4KDLB 1JQ4A 4W9DA 3QC8B 2N9EB 2JSVX 1FD6A 2BB5A 1FIQA 1MG4A 2VRRB 3APCA 4ANUA 5JHBA 2VH1A 2RPQA 3L10B 1KLUD 3UIOB 4W9LA 2I1JA 2MQJA 2FIFA 2INCC 2V4IB 2RMMA 1CJEA 3GP7A 4LNKA 1J19A 2L8JA 1WXQA 3SU8X 3RFZB 4YTPB 2D07B 2V4LA 1EF1A 2LWPA 1AWDA 3HUIA 4GDLB 3IAM1 2KWUB 1OQQA 3DVNV 1D5MC 3M62B 1JALA 4K1RB 3B2FA 3WANA 3DBSA 2H88B 3QHTA 1D3ZA 1WX8A 3IT6B 3NZSA 4GMVA 2O6VB 4YT0B 1XCQL 1L2NA 1IPGA 1TZ1A 2JPHA 2FIDA 1YD8U 4JWUC 2KWVB 1IBXA 5JXVA 3V6CB 2M1MA 4ANWA 1UD7A 3K9PB 3P4RB 1VZ6A 4KZCA 3QA8A 2AYOB 4CQNA 1V9JA 2Y5BB 3NZ3A 4S17A 4WQOB 2MHJA 1VZ8A 1EF5A 1OGWA 4M8NA 2GBMA 3AI5A 2PTLA 2DAFA 4HK2A 3N9YC 4WIPA 3B2GA 4ANVA 2RPVA 1KM7A 2HJ8A 2ONQA 1PDXA 2BYVE 2QDFA 3VVWB 1FNVA 1E8WA 3AH7A 2LRUA 3NVZA 2INPE 4XE0A 3AEBB 3TEWA 2Z0EB 1ZP0B 4DHZB 4X57B 4GIVA 4NAMA 4DHJB 4N58A 4ICVA 2KDFB 2DWQA 4OZBA 4B9KA 1L6UA 2AEHA 2AQ3B 4REZA 1T3QA 3JYUA 3A4SC 2D2QA 1E8YA 1P9DU 5C1ZA 2NR2A 1BT0A 3QCAA 4MM3A 4YTNB 3VFKA 2MSED 4M01A 1E5WA 1SF0A 4HVBA 4IW0A 2BB6A 4TQ0A 3NOBA 3TCAA 4US8A 4AP4C 1WGKA 4FXCA 2LJ5A 2H89B 2WXGA 1BMLC 1WZ0A 4WWMA 4BBNF 2D10A 1C78A 2W3SA 4FULA 3A33B 1I42A 2KDIA 3PHXB 2KACA 2JQRB 3PSEB 1F2RI 4ZHPA 4G0NB 4M0WB 2ON8A 3SHQA 3A1QB 1SEBD 4R3DA 4MSMB 1JW9D 1I4GA 3J9CA 4K7UA 1WMHB 2R61A 3AEAB 1YJJA 2KVZA 2N0SB 1WSPA 3ZDMC 1C1YB 1KJTA 3APDA 1TJEA 1CK1A 4IWPA 2MLBA 3VAWA 2BS4B 1JRPA 1WX7A 4MELA 1YNTE 1V81A 1V2YA 1WE6A 1C4PA 2C60A 1GNUA 4KIKA 2DZIA 3L16A 4GLSC 1FFVA 1XD3B 3DDCB 3VRBB 2PE6B 2IDYA 4JGHB 5LLIA 1XQQA 1DGJA 2JXTA 3AULA 3BIID 2PKOA 1PGXA 1GB4A 3PTFC 2N1VA 3BY4B 1XT9B 1F77A 1WR6E 2JXXA 3AE6B 4XX5A 3W5VB 4L2YA 3KQ4A 4A3OA 4NAWA 1WWTA 3DWGC 1WX9A 4BKSD 2GMIC 2L1AA 3TSSA 4BKGA 1ENFA 1Q1OA 1C3TA 1NDDA 2KDEB 4GOCA 3NUHB 2KX3A 3KYDD 2RGFA 2ZVNA 2MBHA 4MGKE 4K3BA 4ITKA 3NY5A 2BQQA 5CX3A 5EE0A 1WH3A 3Q8AA 2K1FA 3GZNB 2KMMA 3PRZA 5EE9A 3DCGA 4B6WA 1L0XB 3SEBA 3ALBA 3ZRFA 4BZAA 1MJDA 1R4NI 1T0SC 1VR9A 1TGZB 3EUB2 2FAZA 1NYRA 1KF6B 3ZIMA 4HEA1 1E90A 4KKIA 4XC2A 3CSFA 3BVGA 1YX5B 2LGYA 3N3KB 1RAXA 3DBLB 2DBYA 1EM7A 2XK5B 2AQ1B 3H1UA 1NI3A 2KWDA 4RGMA 4MJSA 1ISNA 2PLPA 2UYZB 4K7SA 3JSVA 4MH8A 1UH6A 2IGDA 5FR6A 3L4PA 4IUMB 4TMAB 3JVZX 1ZOYB 2K39A 3PGEA 2CHXA 3OWEB 3P1MA 3DBRB 5C2TB 4AJYB 3QARA 4LDTD 4WJNA 5J18A 2BKFA 1RFKA 1QKZA 3DVNU 4C7ZA 1MVKA 1JWBD 2KQ4X 3AM9A 4IM0A 5JH5C 1TIFA 2D3CA 2LVPA 3AE5B 4USAA 3M63B 2KZRA 1V5OA 1QQRA 3TMPB 2JX5A 2J7QB 2KHWB 3WALA 3NHEB 4TKNA 4CHKA 2L52A 1TY0A 2XEWA 2KTRA 2WXJA 3AE1B 2J53A 4A90A 2W9NA 2Y5CA 3R7RA 4OVUA 3L13A 1MPEA 2DYOA 3SFDB 4US9A 3P4QB 2MJEA 3V60A 4EEWA 3E56A 1NI2A 3LDZE 2KOXA 3VH3B 1HZ6A 3VUYA 4LNNA 2DYBA 2UWQA 1EWYC 4HJGE 4XGAB 3BYYB 3HHMA 1SBBB 4II2B 4BOSC 5L83A 4BKSA 3MHSD 4ACFA 2OEDA 2WDTB 4K3CA 3MJWA 1WI0A 3PHWB 5E6PA 1L0YB 2N7EA 3MC9A 3AE3B 1FXIA 1ROEA 2R2OA 2M4NA 1J7AA 3BINA 4MH0E 2KDBA 1YMHE 2NBWB 3AEEB 4LCDE 3T9LA 3HM3A 3T8MA 4EUTA 3ZQ4A 3KWVA 4ZYNA 2XBBC 3W1SA 2IGHA 3RNGC 3QIJA 4YXDB 2ZZPB 2PPHA 4AUQC 2WWZA 1H4RA 1YN3A 1TZOA 2N4FA 4KVGB 1P0RA 2JVCA 2KMAA 2RDHA 5FK9C 2C7MB 4LJOB 2M8SA 4BOZB 1K53A 2K25A 4PS8A 2NPTB 4HRSA 3RN9C 1QILA 2J52A 1QT9A 3KYCD 1NVID 3PZ8A 3P63A 1QOGA 3D32A 1GG3A 5EDSA 2YVCA 3PLVA 5D94A 3EECA 1RYJA 1Q5WB 4HDOA 2WX1A 3DHGC 2O2VA 1I4QA 3QQ8B 1OEYJ 2JYEA 1SIJA 1OQYA 2EMTA 4FA6A 2LVOA 3TEXA 2YEPB 4BAXA 4MACA 5MPOA 2G45B 3CIRB 1Z2MA 3EFCA 1WGDA 4J6IA 1FCCC 1Y56A 2KXJA 2BYFA 4RGTA 5G2NA 4MGIE 4HPMB 4YSXB 1XF5L 2KVRA 1I4XA 2MJ3A 3BYTB 3DOWA 1R4NB 2KO3A 2WXMA 3V62A 1JMLA 5C3JB 3H6NA 2IYDB 2WDRB 3ZTDA 1XLPA 4OVZA 1WM2A 1KFYB 2DENB 3T3OA 3M95A 2N9XA 3Q3FA 1VDVA 1HE8A 2W82A 3KWLA 2DZJA 2WXHA 3A9JB 3R3MA 4RGNA 2C7NB 2GRIA 1E7UA 2IPKD 1F2RC 2V3NA 2GBJA 3C8YA 2ASQA 4RFBA 2LGDA 1SSNA 5D7GA 1N5WA 3ZO5B 4DBGA 3IXSA 3TEYA 4TV3A 3ETRA 3AE7B 1P1AA 4OHJA 4BKTA 2L83A 5CTRC 1TS3A 3PLUA 2Z0DB 3FC4A 1E0ZA 4W9CA 1PGBA 1A70A 1ESFA 2W3RA 1XLNA 3LXFA 3MHZA 2X38A 2FUHB 4KGRA 4OW0A 1QZEA 1ZE3D 2C9WB 1ZW7A 3C19A 3Q8FA 2ACZB 1VRAB 1UGMA 1WFYA 2JWUA 2BT6A 5BMHA 2FCSA 3AECB 4PYUA 1DOIA 3A9KB 1ZXHA 1QOAA 1KH0A 3BK2A 3RPFC 2W54A 2WS3B 1PGAA 3X23A 2JWZA 1V1PA 4GDKB 2ZW1A 3VDZA 5J2RA 3NVVA 4MEMA 2NTTA 1KLGD 2JT4B 1OFFA 5C23A 4MT5A 4C80A 2MA9B 2FBWB 4W9IA 4B95A 1GPXA 3OAWA 1UNSA 1C4CA 4ARCA 2PEAA 2ZNVB 3EA6A 1D5XC 4OVVA 2WQYB 1SXTA 3RNAC 1WGYA 5E6NA 2RDGA 2ZPNA 4KKJA 5E6OA 4CO7A 2ZCCA 1YN4A 1J7CA 1NBFC 4OZCA 4F1SA 3W9CB 3B0AA 2JZ3B 3URYA 3HRDD 1S3SG 1LXDA 3T3NA 1VD2A 3BVZA 2KN5A 1S1QB 3ZYYX 2KFKA 3WCQA 1XO3A 1VJKA 3V05A 1N63A 2BS3B 1C4AA 1YQ3B 2KN4A 3PV1A 2K8BA 2NS5A 4KGSA 4IWOA 5FKAC 2NBUA 2B76B 2AL3A 3RUIB 3VTVA 1WGHA 2L05A 1FFUA 2IO1B 4RM9A 1UBQA 3V3XA 1SE3A 2KMCA 2C7HA 3OLMD 1IUEA 1UUPA 4NZLB 4P1BC 2BYEA 4WWPA 2LRWA 3U4EG 1V1OA 5DPSA 4HLEA 4GSWA 1WR1A 4ANXA 4RM8A 3ZXVA 5CHFA 1YX6B 4HKQA 1Q10A 3ZXRA 3RNFC 1K8RB 3SD5A 4XYCA 2E6XA 1L4ZB 4P1CC 1VLBA 5AZGA 1UWXA 2FE8A 3B08A 5H92C 4KZ0A 3VRAB 5HG2A 3R66C 1V49A 1TS2A 1QLBB 1XXGA 1LFDA 2QSDA 2KT7A 4N6EB 1FCLA 3K9OB 2XNAC 2WXLA 1IBXB 1WZ3A 1TKGA 1F0ZA 2IO3B 5BMIA 1I35A 1M4VA 1JCKB 1RWSA 4I6LB 3PZDA 3WIMA 2MCNB 2VZKB 1SJHD 3AN1A 5J17A 4B0MA 4WWNA 1FXTB 3ABVB 3P42A 1JROA 3Q14C 3N30A 4J3OD 1GB1A 3SDLC 4RF1A 3MP9A 5BYRA 5LNK1 4GU2A 2KAJA 3OJ4B 2KDMA 1WXSA 1ET6A 4LNOA 1WXAA 4EZJA 4ARIA 2RR9A 3P4PB 3PT2B 1AN8A 2ZNVC 2A5UA 1LQBA 2KJ6A 1V5TA 5AUKA 3QAQA 3R7QA 1IGCA 1CQVA 3X0WA 2WDVB 3ZKJC 3P2BA 4DDGD 4MM3B 2WU2B 1F52A 3GOEA 1SJED 1E7PB 3UI3A 4EKUA 2HTME 2BBCA 1ET9A 1RRBA 2K5PA 1E6EB 2LXAA 3N20C 4NJ6A 1N62A 3AU5A 4C4VA 1YQ4B 5IOIA 3HM6X 2K8HA 3GE3C 2BS2B 3IVFA 4Q2JA 1ZXIA 2MEKA 3Q6BA 2BKRB 1R4MI 3VTWA 1Q0WB 1X1MA 3PS6A 4EZKA 4DHZE 1STEA 3PVLA 2PE9A 3VR9B 3VXWA 3NJTA 1XEEA 2WXQA 1C9FA 3IT4B 3GE8C 2EKIA 4IC7B 1Z5SB 4ZHOA 4P7IA 1IYFA 5TSSA 2KYWA 3ZUNA 2RSUA 2I38A 1MHHE 4KIKB 1UELA 1U4AA 2JZZA 1UZXB 4E3CA 2BPSA 4LJPB 2E3TA 5D6JB 2WXNA 2HJ1A 4IWQA 4A20A 1V86A 3DBHI 2J0JA 1MFWA 1G6JA 1WGRA 4WURA 4ASWC 4BVUC 4FN2A 4ZDVA 1SE4A 5IAAC 3CMMB 3EGRA 3U30A 4ZRIA 3I5JC 1P3QU 1TTNA 2L00B 3B1LX 2VH2A 3MFGA 3VUXA 4NAWB 4YSYB 2G3QB 4BFRA 3P4SB 3FILA 3EHVA 3WAOA 2N9PC 4GN1A 2LMCA 4A6QA 1WM3A 2O6VD 2I1KA 4TQ1A 3Q3JA 3UIPB 4KX6B 3I63C 1N61A 2MWSB 5IO9A 2PJHA 2V1YA 2WGSA 1SE2A 3M3JA 2KKCA 5D2MB 3O13A 1E8ZA 3O65B 1RFAA 3VHTC 3H7PA 3QJZA 2HDEA 4NNJB 1TS5A 3NG0A 2DX5B 4EZLA 3VQIA 2LUEA 2WXOA 5CHWA 5KHQA 2L7RA 2MP2A 5BYQA 4XWWA 3AE2B 3SFEB 1MG8A 3ZJVA 3KUCB 3ZNZB 2LXCA 3ZJUA 4YWGG 5IKCM 4WJPA 1A5RA 1YN5A 4FJVB 1RM6C 2N9LA 3W1YA 2G4SA 3PPAA 4ZRKA 2D11A 2WU5B 3IFWB 4I6PA 2KJRA 3VH4B 1AW7A 1FRRA 1N60A 3AMZA 5I4DA 2A4ZA 3BZDB 2KD0A 4LNFA 4MDKE 4DHJD 1JWSD 4MJSB 5HKHA 2C5LC 3JSVB 2KWCA 2KX0A 4HJKA 2M0XA 4W9HA 4FHKA 3Q2AC 2K6DB 3QWZB 3DWMA 1F9JA 3Q3OC 2XN9C 4HXDA 1KTKA 3RULA 1WJ4A 4C56C 2IGGA 5GMVA 1QOBA 2DYMA 3AE9B 1TYGB 4A55A 1TKEA 1FNUA 2N1WA 1K51A 2QHOA 4HPPA 2D3AA 1XCTL 3NRZA 3PRMB 1HXYD 2NBVB 3ML9A 2CKHB 3VUWA 3RNEC 2KTRB 3HVZA 3I9V1 2ICIA 4ICUA 1HA5A 4ZRPA 4LTUA 3AE8B 1J0GA 1ZGUB 1ZKHA 4GDLA 2GLSA 2QMTA 4B0EA 3DHHC 1F1HA 1VZ7A 4DQOC 3AV8A 2KQ7A 3TEZA 4E71A 4IG7B 2MBQA 5GXGB 2BTEA 5AZHA 2ZCBA 2O6VA 4IOIE 3WAPA 2PMVA 1DOYA 3BVMA 1FO4A 3Q3MC 1N5XA 4AS1A 3Q69A 4AOFA 1KRHA 2N7DA 4RNAA 4DWFA 1V97A 3HVDA 3V61A 2ZVOA 4QAYA 4EOYA 1WIAA 2KQSA 1JRUA 4G11A 4YTMB 2GBRA 4MSQB 3Q3NC 3QX1A 1WF9A 3U8ZA 2YLMA 5JHAA 3IG3A 4FBJB 2JF5A 5D3DA 2RDBC 2NCNA 1UGJA 3PREA 3S2AA 1JWUD 2WNMA 4A9AA 1YQBA 2YEPF 4ZRQA 2JY6A 5HI1A 1D6EC 1GUAB 2G4DB 2DNFA 2MH7A 4JIOU 2JRIB 2M0AA 1K50A 3U7DA 5DPTA 4EE2A 2LD9A 2QEJC 3W5UB 2LI5A 2J42A 2N7JA 4CYEA 3QK0A 4F8CB 4WWOA 2JRHA 1L5PA 5L95C 1FPYA 1P98A 4W9FA 2PVOD 1PQSA 3FAHA 4IKGA 1CZPA 3ZVVA 4AWJA 3ZRCA 2J0MA 1EU3A 2KC1A 2MX2A 2IJ0A 2O2VB 2MBOA 1SGHA 2J0KA 3ZDTA 3U2SC 2KJHB 3N1YC 4WJQA 3KW5B 1B1ZA 4LDTB 3BWUD 4JL9A 2D3GA 1WJNA 3L08A 2BW2A 3GS2A 1T0RC 4IM3A 3ONSA 2DZMA 2GOWA 1T5XD 1ZPSA 1FRDA 1PUTA 3NZUA 3WA0A 4A8XC 1T0QC 2EMSA 2IBIB 4LLGM 4N9F4 1D4BA 5AEKB 4ZYSA 1MI0A 2FCNA 2QILA 2OJWA 4M0WA 3A4RA 3GZNI 1HEZE 1EUVB 1J7BA 3A1QA 3ML8A 2WLBA 2D5GA 2K3UA 1GJZA 3R2TA 4W9GA 3Q8CA 5DPWA 3AXCA 2IZVB 1WMHA 2Q5WD 3ZLZA 3EFUA 2WDQB 1FXAA 3AEDB 3I57A 4AJWA 4PK1A 2L0TA 1FEHA 2CS4A 1E7VA 5CHVC 4YSZB 3TBLD 2MBBB 1NYQA 3DBLI 3H7SA 1WRIA 3HK0A 4HPLB 4JWSC 3VTUA 1H8CA 2AWTA 2MW5A 2KK8A 2LFIA 1QOFA 5T8IA 5EE3A 2CU3A 1BXTA 1GC6A 3AEFB 4W9JA 3DBRI 2MRPA 4JE3B 1T0YA 2L76A 1YJIA 3L17A 2WXIA 2M19A 2CJOA 2X8XX 4O1NA 3KLSX 2EKEC 1OQRA 3W1SC 1QF6A 1AYFA 1HZ5A 1OTRB 2Y5PA 3MC0B 1KLVA 4XDDA 3UQAA 2SEBD 4GB9A 1K52A 2ZW0A 1V80A 5DCNA 2BF8B 2TSSA 3RZWC 2D3BA 1GOZA 2WXKA 3NVYA 3CF6E 3ZNHB 1L0VB 2CU1A 2G9HD 3B9JA 1V1PB 4WQMA 1C79A 1WJUA 2LASA 5AZFA 3TIXA 1V6EA 2FCMA 3RT3B 4FJYA 3DHIC 2JZPA 4UDUC 2I2YA 3CSTA 3BK1A 4RMAA 4IM2A 2GBNA 3DPDA 4AQ7A 1N6ZA 4F7ZA 3DVGX 4DXFA 4URKA 2XK5A 3UINB 2Z59B 3AU4A 1XLQA 2LGIA 2KFKB 3ZGZA 4H2AA 1SIFA 3APFA 4OZAA 4EFOA 1ZDVA 2WX0A 3MC8A 2ZJDA 1LO5D 2INDC 2KNBA 2EELA 3I3TB 4C00A 2LZ6A 5HHDG 2LJIA 4LNIA 2V3PA 4XDCA 1AARA 4E74A 1TT5B 2FCQA 3RCZA 4II3B 2R2QA 3EC8A 3UF8A 2LEKA 5G55A 3KUZA 5DPRA 2CJNA 4L23A 2GI9A 4DXGA 1DOXA 4DDID 4W9KA 1MHXA 1WXMA 2OOBB 2QCZA 3ECIA 2BVCA 1T6BX 1IGDA 5EE1A 4LK0M 4GXBA 1NENB 2QIEB 1TY2A 2MJDA 3LYYA 4BBNC 2IY1B 3L54A 1R7SA 4FHJA 4NJCA 3MJ5A 5TR5A 2DZKA 1XLOA 2BGFA 2IY0B 1JWMD 4WH4A 3SR6A 2L3ZA 1PYWD 4PS7A 2PVGC 1L6VA 4NY0A 2M17A 5BYSA 2DLBA 4G50A 1DYQA 4P6VF 2INNE 2KLCA 1KOTA 2KC2A 1TS4A 2V9HA 1UWMA 5D3IB 2K9XA 2WXRA 4KDIC 4L1BA 2WHIA 1M94A 3OJ3A 1YIWA 3TUOA 3KUDB 2OHFA 2FNJB 2FUG1 2G1EA 4M02A 3AEGB 4WAAA 4JPSA 1EU4A 3Q8BA 5G5HA 3RMKC 4NQLB 1UF0A 1E8XA 4KV2A 3U7ZA 4NJ7A 3L0WB 3TL5A 3WAMA 1LGRA 4FLHA 5JZEB 2CHWA 1E9MA 2LGSA 3ZTCA 2LGXA 4XWTA 4RF0A 1FNWA 2M56B 3RYTA 1WJ6A 2V3SA 2HD5B 4HROA 2IO0B 1I4RA 1SE9A 5E6JA 4G3XB 1ZDXA 2NPTA 4HDQA 4HCNB 1WGGA 5IA7A 1NEKB 4RCOA 1J8CA 2HE7A 3N32A 5G5GA 1HTQA 3NS8A 2ZEQA 4IDIA 4KGTA 3JW0X 2PW9A 1GAQB 1ZUD2 3CWIA 2DHZA 3UQBA 2Z8LA 2K6QA 3N1XC 1WXVA 2CHZA 3V6EB 2B3AA 1P7FA 4JQWC 2CR5A 4P16A 4C4VB 2KLGA 3H8HA 5FR3A 2BYTA 2AX5A 2QJLA 4S0RA 3ZW3A 2AQ2B 2K0PA 1JWAD 3E9SA 4M8MA 3RNCC 3DVGY 4ZOHC 3LJ3A 2PIAA 4C7YA 3NVWA 2QC8A 1I4HA 1P7EA 1TBEA 4WJOA 3PO0A 3IHPC 2KTFA 3ZNID 2J4XA 2NMQA 2W55A 5LXHA 4I6NB 4A3PA 1C77A 1V8CA 3OG5A 5KHOA 2SAKA 3LB8C 2IO2B 2REXA 2WXPA 4WAFA 2BWES 2LHEA 4HWIB 1LM8B 1GC7A 1PFDA 4KSKC 2LHDA 2N9KA 2K22A
chains in the Genus database with same CATH topology
1I4PA 3EUB2 2Y3AA 1L5PA 1NYRA 2E6XA 1L4ZB 1KF6B 1L4DB 1VLBA 1B9RA 2PVOD 4D2KA 3FAHA 4HEA1 4IKGA 1CZPA 1UWXA 2FE8A 4KKIA 1EU3A 5H92C 2IJ0A 4JX1C 3BVGA 2JYTA 3VRAB 5HG2A 1TS2A 1BUIC 3U2SC 2V0GA 1QLBB 2JU6X 1XXGA 2QSDA 2DBYA 3GB1A 4N6EB 1EM7A 1FCLA 1B1ZA 3BWUD 2AQ1B 1ACCA 2XNAC 1NI3A 2KWDA 2BW2A 2WXLA 3GS2A 1IBXB 1D5ZC 4RH6A 4RGMA 1TKGA 1EWCA 2PLPA 1F0ZA 1T5XD 1ZPSA 5BMIA 1FRDA 1PUTA 4MH8A 1M4VA 3FILB 1JCKB 2IGDA 1RWSA 3L4PA 4A8XC 4TMAB 2VZKB 1SJHD 1ZOYB 3AB5A 2LUMA 3OWEB 3P1MA 3AN1A 4LLGM 1D4BA 5C2TB 4ZYSA 4B0MA 4HKZE 1MI0A 3ZJTA 2QILA 3Q8EA 4M0WA 1RFKA 1QKZA 4C7ZA 1MVKA 1HEZE 3IAS1 1JWBD 3ABVB 3P42A 1J7BA 2KQ4X 3AM9A 5HFYA 5AUIA 3VR8B 2WLBA 1JROA 2D5GA 2K3UA 3AE5B 1WYGA 4USAA 3R8BA 3W2DA 3R2TA 1QQRA 3Q8CA 2VZKD 1E10A 4J3OD 2JX5A 2Q5WD 1TKYA 4TSSA 4N59A 1GB1A 4RF1A 3MP9A 1SB3C 2NTSA 2WDQB 5BYRA 5LNK1 2KAJA 2L52A 1TY0A 4RGOS 2WXJA 2KDMA 1FXAA 1ET6A 3AEDB 3AE1B 2J53A 4A90A 3U52E 2Y5CA 3I57A 4ARIA 3P4PB 1I7HA 1FEHA 1MPEA 2DYOA 3SFDB 4US9A 3P4QB 1AN8A 2MJEA 1FMAD 4YSZB 2GB1A 2L32A 3AE4B 3E56A 1NYQA 5AUKA 1WRIA 1IGCA 1CQVA 4JWSC 1HZ6A 2WDVB 4MM3B 2WU2B 1EWYC 4HJGE 3BYYB 1SBBB 5H8YE 1SJED 1E7PB 2LFIA 3UI3A 2HTME 2WXFA 1QOFA 2BBCA 5T8IA 2OEDA 5EE3A 1ET9A 2CU3A 1HQRD 2K5PA 1E6EB 1BXTA 1C76A 1L0YB 1N62A 3AEFB 3PZ7A 3AE3B 4PT5A 4JE3B 1FXIA 1YQ4B 1ROEA 1YJIA 2WP9B 2BS2B 2WXIA 2M19A 3R2IA 2CJOA 1ZXIA 4Q2JA 1J7AA 2MEKA 4O1NA 1FM0D 3KLSX 5BMGA 1YMHE 1OQRA 3AEEB 3NS1A 1QF6A 1AYFA 1HZ5A 1JQ4A 2Y5PA 1STEA 3MC0B 3VR9B 4XDDA 2SEBD 3ZQ4A 3KWVA 1K52A 2ZW0A 3W1SA 2IGHA 2JSVX 1FD6A 2BB5A 1FIQA 4YXDB 1XEEA 2WXQA 2TSSA 1C9FA 3IT4B 1KLUD 1YN3A 1GOZA 1TZOA 2WXKA 3NVYA 2EKIA 1L0VB 2V4IB 2RDHA 5FK9C 4ZHOA 2G9HD 3B9JA 5TSSA 2RMMA 1K53A 1CJEA 1V1PB 3GP7A 4WQMA 1C79A 2I38A 4HRSA 1WXQA 1QILA 1MHHE 2J52A 3RFZB 4YTPB 1QT9A 1NVID 3PZ8A 1AWDA 3HUIA 3P63A 4GDLB 1QOGA 2E3TA 3IAM1 1OQQA 1D5MC 1JALA 2WXNA 1RYJA 3B2FA 2I2YA 2JZPA 4UDUC 3BK1A 2H88B 1I4QA 3IT6B 4WURA 2JYEA 4YT0B 1XCQL 1SIJA 4AQ7A 1SE4A 3EGRA 4DXFA 4JWUC 3TEXA 2YEPB 4MACA 5MPOA 3CIRB 1IBXA 3MFGA 4NAWB 4YSYB 5JXVA 3P4SB 1FCCC 1XLQA 1Y56A 2LGIA 4H2AA 3ZGZA 3FILA 4OZAA 4RGTA 1ZDVA 1LO5D 3P4RB 2EELA 1VZ6A 2LMCA 4A6QA 4YSXB 1XF5L 1I4XA 4CQNA 4TQ1A 4KX6B 5HHDG 2LJIA 2MJ3A 3NZ3A 1N61A 2V3PA 3BYTB 4XDCA 1VZ8A 2WXMA 1JMLA 2PTLA 5C3JB 1SE2A 3N9YC 4WIPA 2LEKA 2WDRB 3B2GA 1XLPA 3O13A 4OVZA 2RPVA 1KFYB 2HDEA 2ONQA 1PDXA 1TS5A 2CJNA 4L23A 2GI9A 4DXGA 3T3OA 3VQIA 1DOXA 2WXOA 1FNVA 1MHXA 3AH7A 5BYQA 1VDVA 4XWWA 1T6BX 1IGDA 3AE2B 3NVZA 2INPE 2W82A 3SFEB 5EE1A 4LK0M 1NENB 4XE0A 3ZJVA 3AEBB 3KWLA 3TEWA 2WXHA 2QIEB 4RGNA 1TY2A 2MJDA 1ZP0B 3LYYA 4YWGG 3ZJUA 1YN5A 2GRIA 1R7SA 2IPKD 1F2RC 1RM6C 2N9LA 4NAMA 4N58A 2DWQA 2V3NA 2WU5B 4OZBA 1L6UA 2AQ3B 4NJCA 3C8YA 4REZA 1T3QA 3MJ5A 4RFBA 1XLOA 1SSNA 1AW7A 5D7GA 1JWMD 1FRRA 1N60A 1N5WA 3AMZA 4WH4A 3SR6A 4YTNB 5I4DA 3IXSA 1PYWD 3BZDB 2PVGC 3TEYA 1L6VA 1SF0A 3ETRA 5BYSA 3AE7B 2BB6A 2DLBA 4TQ0A 4OHJA 1DYQA 4P6VF 1JWSD 2INNE 2L83A 4US8A 1TS4A 1TS3A 1UWMA 1WGKA 4FXCA 5D3IB 3FC4A 2K9XA 2WXRA 1E0ZA 2H89B 1PGBA 2WXGA 1BMLC 4L1BA 1A70A 1ESFA 2W3RA 4WWMA 3TUOA 3DWMA 1C78A 1XLNA 2W3SA 3LXFA 2OHFA 3MHZA 2KACA 2X38A 2FUG1 2G1EA 2JQRB 2XN9C 1F2RI 3AEGB 4KGRA 4ZHPA 1KTKA 4JPSA 1EU4A 3Q8BA 4OW0A 4C56C 2IGGA 1ZE3D 1QOBA 5G5HA 2ON8A 2DYMA 3AE9B 1TYGB 4A55A 3Q8FA 1TKEA 1SEBD 2ACZB 1FNUA 3U7ZA 1VRAB 1K51A 2JWUA 4R3DA 2BT6A 1XCTL 1JW9D 1I4GA 3J9CA 3NRZA 2R61A 5BMHA 3AEAB 1YJJA 1E9MA 1HXYD 2N0SB 1WSPA 3AECB 1DOIA 1ZXHA 1QOAA 1TJEA 1CK1A 1KH0A 4XWTA 3BK2A 4RF0A 1FNWA 2BS4B 1JRPA 2M56B 3RPFC 2W54A 3HVZA 1YNTE 3I9V1 2WS3B 2ICIA 4HROA 1PGAA 1I4RA 1HA5A 5E6JA 1C4PA 1V1PA 4GDKB 2ZW1A 4ZRPA 1ZDXA 4LTUA 3NVVA 2NTTA 3AE8B 1KLGD 1OFFA 1NEKB 4RCOA 4MT5A 4C80A 2FBWB 4GLSC 1FFVA 3VRBB 5G5GA 1GPXA 2QMTA 1UNSA 4IDIA 4B0EA 4KGTA 1C4CA 2PW9A 4ARCA 2IDYA 1GAQB 3EA6A 1D5XC 1VZ7A 1SXTA 1ZUD2 2WQYB 3CWIA 2Z8LA 4DQOC 3AV8A 1DGJA 2JXTA 2RDGA 3BIID 3TEZA 4KKJA 2PKOA 1PGXA 1GB4A 5GXGB 2BTEA 1YN4A 1J7CA 1F77A 4IOIE 2PMVA 4OZCA 1DOYA 1P7FA 3BVMA 3W9CB 4P16A 1FO4A 1N5XA 4AS1A 3Q69A 3URYA 1KRHA 3AE6B 3HRDD 4RNAA 1V97A 3T3NA 3H8HA 5FR3A 3W5VB 2BYTA 2AX5A 3HVDA 2QJLA 3BVZA 2AQ2B 4L2YA 3KQ4A 2K0PA 1JWAD 1WWTA 3DWGC 3E9SA 3ZYYX 3WCQA 4YTMB 1XO3A 2L1AA 1VJKA 3TSSA 3V05A 4ZOHC 1N63A 2PIAA 4C7YA 1ENFA 2BS3B 3NVWA 1C4AA 1YQ3B 2KN4A 1I4HA 1P7EA 4KGSA 5FKAC 5D3DA 3NUHB 2B76B 1UGJA 1JWUD 1FFUA 2WNMA 3PO0A 4A9AA 2YEPF 4ZRQA 5HI1A 1D6EC 3V3XA 1SE3A 4ITKA 5EE0A 2MH7A 1IUEA 1UUPA 2J4XA 2NMQA 4NZLB 2W55A 2M0AA 1K50A 3Q8AA 4EE2A 1C77A 1V8CA 2QEJC 3W5UB 2KMMA 3U4EG 1V1OA 5EE9A 2SAKA 3LB8C 2WXPA 4WAFA 2J42A 2N7JA 2LHEA 1L0XB 4HKQA 1Q10A 1PFDA 3SEBA 2LHDA 2N9KA 2K22A 1VR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMH A;  2OED A;  2EEL A;  1XF5 L;  1ZXH A;  1KH0 A;  5HHD G;  4D2K A;  4IKG A;  1UWX A;  1YNT E;  1PGA A;  1JML A;  2PTL A;  2ZW1 A;  5HG2 A;  5BMG A;  1YMH E;  2JU6 X;  2QSD A;  2RPV A;  3GB1 A;  1EM7 A;  2ONQ A;  1FCL A;  1HZ5 A;  2GI9 A;  4GLS C;  2QMT A;  2KWD A;  1MHX A;  1IBX B;  4KGT A;  2PW9 A;  2PLP A;  1IGD A;  5BMI A;  1K52 A;  2ZW0 A;  3FIL B;  2IGD A;  2IGH A;  2JSV X;  2JXT A;  1FD6 A;  1PGX A;  1GB4 A;  1C9F A;  1F2R C;  2LUM A;  2N9L A;  4OZC A;  4IOI E;  1P7F A;  1D4B A;  4OZB A;  4HKZ E;  1MI0 A;  1QKZ A;  1MVK A;  1HEZ E;  2RMM A;  1K53 A;  2KQ4 X;  4WH4 A;  5HFY A;  2I38 A;  2K0P A;  1MHH E;  2J52 A;  1GB1 A;  2KN4 A;  3MP9 A;  1P7E A;  4KGS A;  2I2Y A;  2JZP A;  2KDM A;  2J53 A;  1PGB A;  5HI1 A;  3V3X A;  1MPE A;  2NMQ A;  2KAC A;  1K50 A;  1XCQ L;  2GB1 A;  1F2R I;  4KGR A;  2IGG A;  1IGC A;  2ON8 A;  1HZ6 A;  4MAC A;  1IBX A;  4HJG E;  5JXV A;  1K51 A;  2N7J A;  2LHE A;  1FCC C;  2LGI A;  1Q10 A;  2JWU A;  3FIL A;  4OZA A;  3UI3 A;  2LHD A;  2N9K A;  1XCT L; 
#chains in the Genus database with same CATH topology
 3A9J A;  1I4P A;  4NPN A;  2Y3A A;  2GBK A;  1L4D B;  1B9R A;  2BWF A;  4D2K A;  3H9D A;  4M00 A;  4TUU A;  2ZPY A;  1WE7 A;  4PS3 A;  4PYZ A;  4FAD A;  4JX1 C;  4GGQ A;  2JYT A;  4W9E A;  2LVQ A;  1CMX B;  3UGB B;  2MBE A;  1BUI C;  2V0G A;  1L7Y A;  2JU6 X;  3GB1 A;  1IP9 A;  3DQV A;  1ACC A;  4DK5 A;  1Y8R C;  1D5Z C;  4RH6 A;  3KH0 A;  1EWC A;  4MGZ E;  3FIL B;  5BO4 B;  3C0R B;  1YJ1 A;  4ZRJ A;  1EO6 A;  3AB5 A;  2KAN A;  2LUM A;  2DAJ A;  3RNB C;  4HKZ E;  1OEY A;  3ZJT A;  2RD0 A;  3Q8E A;  3IAS 1;  2OJR A;  4DXA B;  5HFY A;  5AUI A;  3VR8 B;  3KVF B;  1WYG A;  3R8B A;  3W2D A;  2NVU I;  1R4M B;  3H7P B;  5IP4 D;  2VZK D;  4KSL C;  1E10 A;  3RI7 C;  1TKY A;  4TSS A;  4XZ4 A;  3RD2 A;  2JUO A;  4N59 A;  2MP2 B;  1SB3 C;  2NTS A;  3A9K A;  3ENE A;  3N1Z C;  4RGO S;  5LXI B;  3RZF A;  3U52 E;  3MTN B;  1I7H A;  4GDK A;  1WY8 A;  1WRD B;  1FMA D;  3TJP A;  2GB1 A;  2L32 A;  1RLF A;  3AE4 B;  2K8C A;  2L0F A;  2KFJ A;  3FKY A;  2UU7 A;  5IN7 A;  4K81 A;  5H8Y E;  4FJZ A;  1VCB A;  4YL8 A;  3IBE A;  2WXF A;  1WYW B;  3ZNG C;  1HQR D;  4MGY E;  1C76 A;  1UBI A;  2WYQ A;  3PZ7 A;  4PT5 A;  4HCP B;  4K7W A;  3HIZ A;  3DBH B;  2AL6 A;  2WP9 B;  4JLC A;  3R2I A;  3PRP B;  1YOV B;  4NQK E;  1FM0 D;  5BMG A;  1HTO A;  3NS1 A;  2HTH A;  4KDL B;  1JQ4 A;  4W9D A;  3QC8 B;  2N9E B;  2JSV X;  1FD6 A;  2BB5 A;  1FIQ A;  1MG4 A;  2VRR B;  3APC A;  4ANU A;  5JHB A;  2VH1 A;  2RPQ A;  3L10 B;  1KLU D;  3UIO B;  4W9L A;  2I1J A;  2MQJ A;  2FIF A;  2INC C;  2V4I B;  2RMM A;  1CJE A;  3GP7 A;  4LNK A;  1J19 A;  2L8J A;  1WXQ A;  3SU8 X;  3RFZ B;  4YTP B;  2D07 B;  2V4L A;  1EF1 A;  2LWP A;  1AWD A;  3HUI A;  4GDL B;  3IAM 1;  2KWU B;  1OQQ A;  3DVN V;  1D5M C;  3M62 B;  1JAL A;  4K1R B;  3B2F A;  3WAN A;  3DBS A;  2H88 B;  3QHT A;  1D3Z A;  1WX8 A;  3IT6 B;  3NZS A;  4GMV A;  2O6V B;  4YT0 B;  1XCQ L;  1L2N A;  1IPG A;  1TZ1 A;  2JPH A;  2FID A;  1YD8 U;  4JWU C;  2KWV B;  1IBX A;  5JXV A;  3V6C B;  2M1M A;  4ANW A;  1UD7 A;  3K9P B;  3P4R B;  1VZ6 A;  4KZC A;  3QA8 A;  2AYO B;  4CQN A;  1V9J A;  2Y5B B;  3NZ3 A;  4S17 A;  4WQO B;  2MHJ A;  1VZ8 A;  1EF5 A;  1OGW A;  4M8N A;  2GBM A;  3AI5 A;  2PTL A;  2DAF A;  4HK2 A;  3N9Y C;  4WIP A;  3B2G A;  4ANV A;  2RPV A;  1KM7 A;  2HJ8 A;  2ONQ A;  1PDX A;  2BYV E;  2QDF A;  3VVW B;  1FNV A;  1E8W A;  3AH7 A;  2LRU A;  3NVZ A;  2INP E;  4XE0 A;  3AEB B;  3TEW A;  2Z0E B;  1ZP0 B;  4DHZ B;  4X57 B;  4GIV A;  4NAM A;  4DHJ B;  4N58 A;  4ICV A;  2KDF B;  2DWQ A;  4OZB A;  4B9K A;  1L6U A;  2AEH A;  2AQ3 B;  4REZ A;  1T3Q A;  3JYU A;  3A4S C;  2D2Q A;  1E8Y A;  1P9D U;  5C1Z A;  2NR2 A;  1BT0 A;  3QCA A;  4MM3 A;  4YTN B;  3VFK A;  2MSE D;  4M01 A;  1E5W A;  1SF0 A;  4HVB A;  4IW0 A;  2BB6 A;  4TQ0 A;  3NOB A;  3TCA A;  4US8 A;  4AP4 C;  1WGK A;  4FXC A;  2LJ5 A;  2H89 B;  2WXG A;  1BML C;  1WZ0 A;  4WWM A;  4BBN F;  2D10 A;  1C78 A;  2W3S A;  4FUL A;  3A33 B;  1I42 A;  2KDI A;  3PHX B;  2KAC A;  2JQR B;  3PSE B;  1F2R I;  4ZHP A;  4G0N B;  4M0W B;  2ON8 A;  3SHQ A;  3A1Q B;  1SEB D;  4R3D A;  4MSM B;  1JW9 D;  1I4G A;  3J9C A;  4K7U A;  1WMH B;  2R61 A;  3AEA B;  1YJJ A;  2KVZ A;  2N0S B;  1WSP A;  3ZDM C;  1C1Y B;  1KJT A;  3APD A;  1TJE A;  1CK1 A;  4IWP A;  2MLB A;  3VAW A;  2BS4 B;  1JRP A;  1WX7 A;  4MEL A;  1YNT E;  1V81 A;  1V2Y A;  1WE6 A;  1C4P A;  2C60 A;  1GNU A;  4KIK A;  2DZI A;  3L16 A;  4GLS C;  1FFV A;  1XD3 B;  3DDC B;  3VRB B;  2PE6 B;  2IDY A;  4JGH B;  5LLI A;  1XQQ A;  1DGJ A;  2JXT A;  3AUL A;  3BII D;  2PKO A;  1PGX A;  1GB4 A;  3PTF C;  2N1V A;  3BY4 B;  1XT9 B;  1F77 A;  1WR6 E;  2JXX A;  3AE6 B;  4XX5 A;  3W5V B;  4L2Y A;  3KQ4 A;  4A3O A;  4NAW A;  1WWT A;  3DWG C;  1WX9 A;  4BKS D;  2GMI C;  2L1A A;  3TSS A;  4BKG A;  1ENF A;  1Q1O A;  1C3T A;  1NDD A;  2KDE B;  4GOC A;  3NUH B;  2KX3 A;  3KYD D;  2RGF A;  2ZVN A;  2MBH A;  4MGK E;  4K3B A;  4ITK A;  3NY5 A;  2BQQ A;  5CX3 A;  5EE0 A;  1WH3 A;  3Q8A A;  2K1F A;  3GZN B;  2KMM A;  3PRZ A;  5EE9 A;  3DCG A;  4B6W A;  1L0X B;  3SEB A;  3ALB A;  3ZRF A;  4BZA A;  1MJD A;  1R4N I;  1T0S C;  1VR9 A;  1TGZ B;  3EUB 2;  2FAZ A;  1NYR A;  1KF6 B;  3ZIM A;  4HEA 1;  1E90 A;  4KKI A;  4XC2 A;  3CSF A;  3BVG A;  1YX5 B;  2LGY A;  3N3K B;  1RAX A;  3DBL B;  2DBY A;  1EM7 A;  2XK5 B;  2AQ1 B;  3H1U A;  1NI3 A;  2KWD A;  4RGM A;  4MJS A;  1ISN A;  2PLP A;  2UYZ B;  4K7S A;  3JSV A;  4MH8 A;  1UH6 A;  2IGD A;  5FR6 A;  3L4P A;  4IUM B;  4TMA B;  3JVZ X;  1ZOY B;  2K39 A;  3PGE A;  2CHX A;  3OWE B;  3P1M A;  3DBR B;  5C2T B;  4AJY B;  3QAR A;  4LDT D;  4WJN A;  5J18 A;  2BKF A;  1RFK A;  1QKZ A;  3DVN U;  4C7Z A;  1MVK A;  1JWB D;  2KQ4 X;  3AM9 A;  4IM0 A;  5JH5 C;  1TIF A;  2D3C A;  2LVP A;  3AE5 B;  4USA A;  3M63 B;  2KZR A;  1V5O A;  1QQR A;  3TMP B;  2JX5 A;  2J7Q B;  2KHW B;  3WAL A;  3NHE B;  4TKN A;  4CHK A;  2L52 A;  1TY0 A;  2XEW A;  2KTR A;  2WXJ A;  3AE1 B;  2J53 A;  4A90 A;  2W9N A;  2Y5C A;  3R7R A;  4OVU A;  3L13 A;  1MPE A;  2DYO A;  3SFD B;  4US9 A;  3P4Q B;  2MJE A;  3V60 A;  4EEW A;  3E56 A;  1NI2 A;  3LDZ E;  2KOX A;  3VH3 B;  1HZ6 A;  3VUY A;  4LNN A;  2DYB A;  2UWQ A;  1EWY C;  4HJG E;  4XGA B;  3BYY B;  3HHM A;  1SBB B;  4II2 B;  4BOS C;  5L83 A;  4BKS A;  3MHS D;  4ACF A;  2OED A;  2WDT B;  4K3C A;  3MJW A;  1WI0 A;  3PHW B;  5E6P A;  1L0Y B;  2N7E A;  3MC9 A;  3AE3 B;  1FXI A;  1ROE A;  2R2O A;  2M4N A;  1J7A A;  3BIN A;  4MH0 E;  2KDB A;  1YMH E;  2NBW B;  3AEE B;  4LCD E;  3T9L A;  3HM3 A;  3T8M A;  4EUT A;  3ZQ4 A;  3KWV A;  4ZYN A;  2XBB C;  3W1S A;  2IGH A;  3RNG C;  3QIJ A;  4YXD B;  2ZZP B;  2PPH A;  4AUQ C;  2WWZ A;  1H4R A;  1YN3 A;  1TZO A;  2N4F A;  4KVG B;  1P0R A;  2JVC A;  2KMA A;  2RDH A;  5FK9 C;  2C7M B;  4LJO B;  2M8S A;  4BOZ B;  1K53 A;  2K25 A;  4PS8 A;  2NPT B;  4HRS A;  3RN9 C;  1QIL A;  2J52 A;  1QT9 A;  3KYC D;  1NVI D;  3PZ8 A;  3P63 A;  1QOG A;  3D32 A;  1GG3 A;  5EDS A;  2YVC A;  3PLV A;  5D94 A;  3EEC A;  1RYJ A;  1Q5W B;  4HDO A;  2WX1 A;  3DHG C;  2O2V A;  1I4Q A;  3QQ8 B;  1OEY J;  2JYE A;  1SIJ A;  1OQY A;  2EMT A;  4FA6 A;  2LVO A;  3TEX A;  2YEP B;  4BAX A;  4MAC A;  5MPO A;  2G45 B;  3CIR B;  1Z2M A;  3EFC A;  1WGD A;  4J6I A;  1FCC C;  1Y56 A;  2KXJ A;  2BYF A;  4RGT A;  5G2N A;  4MGI E;  4HPM B;  4YSX B;  1XF5 L;  2KVR A;  1I4X A;  2MJ3 A;  3BYT B;  3DOW A;  1R4N B;  2KO3 A;  2WXM A;  3V62 A;  1JML A;  5C3J B;  3H6N A;  2IYD B;  2WDR B;  3ZTD A;  1XLP A;  4OVZ A;  1WM2 A;  1KFY B;  2DEN B;  3T3O A;  3M95 A;  2N9X A;  3Q3F A;  1VDV A;  1HE8 A;  2W82 A;  3KWL A;  2DZJ A;  2WXH A;  3A9J B;  3R3M A;  4RGN A;  2C7N B;  2GRI A;  1E7U A;  2IPK D;  1F2R C;  2V3N A;  2GBJ A;  3C8Y A;  2ASQ A;  4RFB A;  2LGD A;  1SSN A;  5D7G A;  1N5W A;  3ZO5 B;  4DBG A;  3IXS A;  3TEY A;  4TV3 A;  3ETR A;  3AE7 B;  1P1A A;  4OHJ A;  4BKT A;  2L83 A;  5CTR C;  1TS3 A;  3PLU A;  2Z0D B;  3FC4 A;  1E0Z A;  4W9C A;  1PGB A;  1A70 A;  1ESF A;  2W3R A;  1XLN A;  3LXF A;  3MHZ A;  2X38 A;  2FUH B;  4KGR A;  4OW0 A;  1QZE A;  1ZE3 D;  2C9W B;  1ZW7 A;  3C19 A;  3Q8F A;  2ACZ B;  1VRA B;  1UGM A;  1WFY A;  2JWU A;  2BT6 A;  5BMH A;  2FCS A;  3AEC B;  4PYU A;  1DOI A;  3A9K B;  1ZXH A;  1QOA A;  1KH0 A;  3BK2 A;  3RPF C;  2W54 A;  2WS3 B;  1PGA A;  3X23 A;  2JWZ A;  1V1P A;  4GDK B;  2ZW1 A;  3VDZ A;  5J2R A;  3NVV A;  4MEM A;  2NTT A;  1KLG D;  2JT4 B;  1OFF A;  5C23 A;  4MT5 A;  4C80 A;  2MA9 B;  2FBW B;  4W9I A;  4B95 A;  1GPX A;  3OAW A;  1UNS A;  1C4C A;  4ARC A;  2PEA A;  2ZNV B;  3EA6 A;  1D5X C;  4OVV A;  2WQY B;  1SXT A;  3RNA C;  1WGY A;  5E6N A;  2RDG A;  2ZPN A;  4KKJ A;  5E6O A;  4CO7 A;  2ZCC A;  1YN4 A;  1J7C A;  1NBF C;  4OZC A;  4F1S A;  3W9C B;  3B0A A;  2JZ3 B;  3URY A;  3HRD D;  1S3S G;  1LXD A;  3T3N A;  1VD2 A;  3BVZ A;  2KN5 A;  1S1Q B;  3ZYY X;  2KFK A;  3WCQ A;  1XO3 A;  1VJK A;  3V05 A;  1N63 A;  2BS3 B;  1C4A A;  1YQ3 B;  2KN4 A;  3PV1 A;  2K8B A;  2NS5 A;  4KGS A;  4IWO A;  5FKA C;  2NBU A;  2B76 B;  2AL3 A;  3RUI B;  3VTV A;  1WGH A;  2L05 A;  1FFU A;  2IO1 B;  4RM9 A;  1UBQ A;  3V3X A;  1SE3 A;  2KMC A;  2C7H A;  3OLM D;  1IUE A;  1UUP A;  4NZL B;  4P1B C;  2BYE A;  4WWP A;  2LRW A;  3U4E G;  1V1O A;  5DPS A;  4HLE A;  4GSW A;  1WR1 A;  4ANX A;  4RM8 A;  3ZXV A;  5CHF A;  1YX6 B;  4HKQ A;  1Q10 A;  3ZXR A;  3RNF C;  1K8R B;  3SD5 A;  4XYC A;  2E6X A;  1L4Z B;  4P1C C;  1VLB A;  5AZG A;  1UWX A;  2FE8 A;  3B08 A;  5H92 C;  4KZ0 A;  3VRA B;  5HG2 A;  3R66 C;  1V49 A;  1TS2 A;  1QLB B;  1XXG A;  1LFD A;  2QSD A;  2KT7 A;  4N6E B;  1FCL A;  3K9O B;  2XNA C;  2WXL A;  1IBX B;  1WZ3 A;  1TKG A;  1F0Z A;  2IO3 B;  5BMI A;  1I35 A;  1M4V A;  1JCK B;  1RWS A;  4I6L B;  3PZD A;  3WIM A;  2MCN B;  2VZK B;  1SJH D;  3AN1 A;  5J17 A;  4B0M A;  4WWN A;  1FXT B;  3ABV B;  3P42 A;  1JRO A;  3Q14 C;  3N30 A;  4J3O D;  1GB1 A;  3SDL C;  4RF1 A;  3MP9 A;  5BYR A;  5LNK 1;  4GU2 A;  2KAJ A;  3OJ4 B;  2KDM A;  1WXS A;  1ET6 A;  4LNO A;  1WXA A;  4EZJ A;  4ARI A;  2RR9 A;  3P4P B;  3PT2 B;  1AN8 A;  2ZNV C;  2A5U A;  1LQB A;  2KJ6 A;  1V5T A;  5AUK A;  3QAQ A;  3R7Q A;  1IGC A;  1CQV A;  3X0W A;  2WDV B;  3ZKJ C;  3P2B A;  4DDG D;  4MM3 B;  2WU2 B;  1F52 A;  3GOE A;  1SJE D;  1E7P B;  3UI3 A;  4EKU A;  2HTM E;  2BBC A;  1ET9 A;  1RRB A;  2K5P A;  1E6E B;  2LXA A;  3N20 C;  4NJ6 A;  1N62 A;  3AU5 A;  4C4V A;  1YQ4 B;  5IOI A;  3HM6 X;  2K8H A;  3GE3 C;  2BS2 B;  3IVF A;  4Q2J A;  1ZXI A;  2MEK A;  3Q6B A;  2BKR B;  1R4M I;  3VTW A;  1Q0W B;  1X1M A;  3PS6 A;  4EZK A;  4DHZ E;  1STE A;  3PVL A;  2PE9 A;  3VR9 B;  3VXW A;  3NJT A;  1XEE A;  2WXQ A;  1C9F A;  3IT4 B;  3GE8 C;  2EKI A;  4IC7 B;  1Z5S B;  4ZHO A;  4P7I A;  1IYF A;  5TSS A;  2KYW A;  3ZUN A;  2RSU A;  2I38 A;  1MHH E;  4KIK B;  1UEL A;  1U4A A;  2JZZ A;  1UZX B;  4E3C A;  2BPS A;  4LJP B;  2E3T A;  5D6J B;  2WXN A;  2HJ1 A;  4IWQ A;  4A20 A;  1V86 A;  3DBH I;  2J0J A;  1MFW A;  1G6J A;  1WGR A;  4WUR A;  4ASW C;  4BVU C;  4FN2 A;  4ZDV A;  1SE4 A;  5IAA C;  3CMM B;  3EGR A;  3U30 A;  4ZRI A;  3I5J C;  1P3Q U;  1TTN A;  2L00 B;  3B1L X;  2VH2 A;  3MFG A;  3VUX A;  4NAW B;  4YSY B;  2G3Q B;  4BFR A;  3P4S B;  3FIL A;  3EHV A;  3WAO A;  2N9P C;  4GN1 A;  2LMC A;  4A6Q A;  1WM3 A;  2O6V D;  2I1K A;  4TQ1 A;  3Q3J A;  3UIP B;  4KX6 B;  3I63 C;  1N61 A;  2MWS B;  5IO9 A;  2PJH A;  2V1Y A;  2WGS A;  1SE2 A;  3M3J A;  2KKC A;  5D2M B;  3O13 A;  1E8Z A;  3O65 B;  1RFA A;  3VHT C;  3H7P A;  3QJZ A;  2HDE A;  4NNJ B;  1TS5 A;  3NG0 A;  2DX5 B;  4EZL A;  3VQI A;  2LUE A;  2WXO A;  5CHW A;  5KHQ A;  2L7R A;  2MP2 A;  5BYQ A;  4XWW A;  3AE2 B;  3SFE B;  1MG8 A;  3ZJV A;  3KUC B;  3ZNZ B;  2LXC A;  3ZJU A;  4YWG G;  5IKC M;  4WJP A;  1A5R A;  1YN5 A;  4FJV B;  1RM6 C;  2N9L A;  3W1Y A;  2G4S A;  3PPA A;  4ZRK A;  2D11 A;  2WU5 B;  3IFW B;  4I6P A;  2KJR A;  3VH4 B;  1AW7 A;  1FRR A;  1N60 A;  3AMZ A;  5I4D A;  2A4Z A;  3BZD B;  2KD0 A;  4LNF A;  4MDK E;  4DHJ D;  1JWS D;  4MJS B;  5HKH A;  2C5L C;  3JSV B;  2KWC A;  2KX0 A;  4HJK A;  2M0X A;  4W9H A;  4FHK A;  3Q2A C;  2K6D B;  3QWZ B;  3DWM A;  1F9J A;  3Q3O C;  2XN9 C;  4HXD A;  1KTK A;  3RUL A;  1WJ4 A;  4C56 C;  2IGG A;  5GMV A;  1QOB A;  2DYM A;  3AE9 B;  1TYG B;  4A55 A;  1TKE A;  1FNU A;  2N1W A;  1K51 A;  2QHO A;  4HPP A;  2D3A A;  1XCT L;  3NRZ A;  3PRM B;  1HXY D;  2NBV B;  3ML9 A;  2CKH B;  3VUW A;  3RNE C;  2KTR B;  3HVZ A;  3I9V 1;  2ICI A;  4ICU A;  1HA5 A;  4ZRP A;  4LTU A;  3AE8 B;  1J0G A;  1ZGU B;  1ZKH A;  4GDL A;  2GLS A;  2QMT A;  4B0E A;  3DHH C;  1F1H A;  1VZ7 A;  4DQO C;  3AV8 A;  2KQ7 A;  3TEZ A;  4E71 A;  4IG7 B;  2MBQ A;  5GXG B;  2BTE A;  5AZH A;  2ZCB A;  2O6V A;  4IOI E;  3WAP A;  2PMV A;  1DOY A;  3BVM A;  1FO4 A;  3Q3M C;  1N5X A;  4AS1 A;  3Q69 A;  4AOF A;  1KRH A;  2N7D A;  4RNA A;  4DWF A;  1V97 A;  3HVD A;  3V61 A;  2ZVO A;  4QAY A;  4EOY A;  1WIA A;  2KQS A;  1JRU A;  4G11 A;  4YTM B;  2GBR A;  4MSQ B;  3Q3N C;  3QX1 A;  1WF9 A;  3U8Z A;  2YLM A;  5JHA A;  3IG3 A;  4FBJ B;  2JF5 A;  5D3D A;  2RDB C;  2NCN A;  1UGJ A;  3PRE A;  3S2A A;  1JWU D;  2WNM A;  4A9A A;  1YQB A;  2YEP F;  4ZRQ A;  2JY6 A;  5HI1 A;  1D6E C;  1GUA B;  2G4D B;  2DNF A;  2MH7 A;  4JIO U;  2JRI B;  2M0A A;  1K50 A;  3U7D A;  5DPT A;  4EE2 A;  2LD9 A;  2QEJ C;  3W5U B;  2LI5 A;  2J42 A;  2N7J A;  4CYE A;  3QK0 A;  4F8C B;  4WWO A;  2JRH A;  1L5P A;  5L95 C;  1FPY A;  1P98 A;  4W9F A;  2PVO D;  1PQS A;  3FAH A;  4IKG A;  1CZP A;  3ZVV A;  4AWJ A;  3ZRC A;  2J0M A;  1EU3 A;  2KC1 A;  2MX2 A;  2IJ0 A;  2O2V B;  2MBO A;  1SGH A;  2J0K A;  3ZDT A;  3U2S C;  2KJH B;  3N1Y C;  4WJQ A;  3KW5 B;  1B1Z A;  4LDT B;  3BWU D;  4JL9 A;  2D3G A;  1WJN A;  3L08 A;  2BW2 A;  3GS2 A;  1T0R C;  4IM3 A;  3ONS A;  2DZM A;  2GOW A;  1T5X D;  1ZPS A;  1FRD A;  1PUT A;  3NZU A;  3WA0 A;  4A8X C;  1T0Q C;  2EMS A;  2IBI B;  4LLG M;  4N9F 4;  1D4B A;  5AEK B;  4ZYS A;  1MI0 A;  2FCN A;  2QIL A;  2OJW A;  4M0W A;  3A4R A;  3GZN I;  1HEZ E;  1EUV B;  1J7B A;  3A1Q A;  3ML8 A;  2WLB A;  2D5G A;  2K3U A;  1GJZ A;  3R2T A;  4W9G A;  3Q8C A;  5DPW A;  3AXC A;  2IZV B;  1WMH A;  2Q5W D;  3ZLZ A;  3EFU A;  2WDQ B;  1FXA A;  3AED B;  3I57 A;  4AJW A;  4PK1 A;  2L0T A;  1FEH A;  2CS4 A;  1E7V A;  5CHV C;  4YSZ B;  3TBL D;  2MBB B;  1NYQ A;  3DBL I;  3H7S A;  1WRI A;  3HK0 A;  4HPL B;  4JWS C;  3VTU A;  1H8C A;  2AWT A;  2MW5 A;  2KK8 A;  2LFI A;  1QOF A;  5T8I A;  5EE3 A;  2CU3 A;  1BXT A;  1GC6 A;  3AEF B;  4W9J A;  3DBR I;  2MRP A;  4JE3 B;  1T0Y A;  2L76 A;  1YJI A;  3L17 A;  2WXI A;  2M19 A;  2CJO A;  2X8X X;  4O1N A;  3KLS X;  2EKE C;  1OQR A;  3W1S C;  1QF6 A;  1AYF A;  1HZ5 A;  1OTR B;  2Y5P A;  3MC0 B;  1KLV A;  4XDD A;  3UQA A;  2SEB D;  4GB9 A;  1K52 A;  2ZW0 A;  1V80 A;  5DCN A;  2BF8 B;  2TSS A;  3RZW C;  2D3B A;  1GOZ A;  2WXK A;  3NVY A;  3CF6 E;  3ZNH B;  1L0V B;  2CU1 A;  2G9H D;  3B9J A;  1V1P B;  4WQM A;  1C79 A;  1WJU A;  2LAS A;  5AZF A;  3TIX A;  1V6E A;  2FCM A;  3RT3 B;  4FJY A;  3DHI C;  2JZP A;  4UDU C;  2I2Y A;  3CST A;  3BK1 A;  4RMA A;  4IM2 A;  2GBN A;  3DPD A;  4AQ7 A;  1N6Z A;  4F7Z A;  3DVG X;  4DXF A;  4URK A;  2XK5 A;  3UIN B;  2Z59 B;  3AU4 A;  1XLQ A;  2LGI A;  2KFK B;  3ZGZ A;  4H2A A;  1SIF A;  3APF A;  4OZA A;  4EFO A;  1ZDV A;  2WX0 A;  3MC8 A;  2ZJD A;  1LO5 D;  2IND C;  2KNB A;  2EEL A;  3I3T B;  4C00 A;  2LZ6 A;  5HHD G;  2LJI A;  4LNI A;  2V3P A;  4XDC A;  1AAR A;  4E74 A;  1TT5 B;  2FCQ A;  3RCZ A;  4II3 B;  2R2Q A;  3EC8 A;  3UF8 A;  2LEK A;  5G55 A;  3KUZ A;  5DPR A;  2CJN A;  4L23 A;  2GI9 A;  4DXG A;  1DOX A;  4DDI D;  4W9K A;  1MHX A;  1WXM A;  2OOB B;  2QCZ A;  3ECI A;  2BVC A;  1T6B X;  1IGD A;  5EE1 A;  4LK0 M;  4GXB A;  1NEN B;  2QIE B;  1TY2 A;  2MJD A;  3LYY A;  4BBN C;  2IY1 B;  3L54 A;  1R7S A;  4FHJ A;  4NJC A;  3MJ5 A;  5TR5 A;  2DZK A;  1XLO A;  2BGF A;  2IY0 B;  1JWM D;  4WH4 A;  3SR6 A;  2L3Z A;  1PYW D;  4PS7 A;  2PVG C;  1L6V A;  4NY0 A;  2M17 A;  5BYS A;  2DLB A;  4G50 A;  1DYQ A;  4P6V F;  2INN E;  2KLC A;  1KOT A;  2KC2 A;  1TS4 A;  2V9H A;  1UWM A;  5D3I B;  2K9X A;  2WXR A;  4KDI C;  4L1B A;  2WHI A;  1M94 A;  3OJ3 A;  1YIW A;  3TUO A;  3KUD B;  2OHF A;  2FNJ B;  2FUG 1;  2G1E A;  4M02 A;  3AEG B;  4WAA A;  4JPS A;  1EU4 A;  3Q8B A;  5G5H A;  3RMK C;  4NQL B;  1UF0 A;  1E8X A;  4KV2 A;  3U7Z A;  4NJ7 A;  3L0W B;  3TL5 A;  3WAM A;  1LGR A;  4FLH A;  5JZE B;  2CHW A;  1E9M A;  2LGS A;  3ZTC A;  2LGX A;  4XWT A;  4RF0 A;  1FNW A;  2M56 B;  3RYT A;  1WJ6 A;  2V3S A;  2HD5 B;  4HRO A;  2IO0 B;  1I4R A;  1SE9 A;  5E6J A;  4G3X B;  1ZDX A;  2NPT A;  4HDQ A;  4HCN B;  1WGG A;  5IA7 A;  1NEK B;  4RCO A;  1J8C A;  2HE7 A;  3N32 A;  5G5G A;  1HTQ A;  3NS8 A;  2ZEQ A;  4IDI A;  4KGT A;  3JW0 X;  2PW9 A;  1GAQ B;  1ZUD 2;  3CWI A;  2DHZ A;  3UQB A;  2Z8L A;  2K6Q A;  3N1X C;  1WXV A;  2CHZ A;  3V6E B;  2B3A A;  1P7F A;  4JQW C;  2CR5 A;  4P16 A;  4C4V B;  2KLG A;  3H8H A;  5FR3 A;  2BYT A;  2AX5 A;  2QJL A;  4S0R A;  3ZW3 A;  2AQ2 B;  2K0P A;  1JWA D;  3E9S A;  4M8M A;  3RNC C;  3DVG Y;  4ZOH C;  3LJ3 A;  2PIA A;  4C7Y A;  3NVW A;  2QC8 A;  1I4H A;  1P7E A;  1TBE A;  4WJO A;  3PO0 A;  3IHP C;  2KTF A;  3ZNI D;  2J4X A;  2NMQ A;  2W55 A;  5LXH A;  4I6N B;  4A3P A;  1C77 A;  1V8C A;  3OG5 A;  5KHO A;  2SAK A;  3LB8 C;  2IO2 B;  2REX A;  2WXP A;  4WAF A;  2BWE S;  2LHE A;  4HWI B;  1LM8 B;  1GC7 A;  1PFD A;  4KSK C;  2LHD A;  2N9K A;  2K22 A; 
#chains in the Genus database with same CATH homology
 1I4P A;  3EUB 2;  2Y3A A;  1L5P A;  1NYR A;  2E6X A;  1L4Z B;  1KF6 B;  1L4D B;  1VLB A;  1B9R A;  2PVO D;  4D2K A;  3FAH A;  4HEA 1;  4IKG A;  1CZP A;  1UWX A;  2FE8 A;  4KKI A;  1EU3 A;  5H92 C;  2IJ0 A;  4JX1 C;  3BVG A;  2JYT A;  3VRA B;  5HG2 A;  1TS2 A;  1BUI C;  3U2S C;  2V0G A;  1QLB B;  2JU6 X;  1XXG A;  2QSD A;  2DBY A;  3GB1 A;  4N6E B;  1EM7 A;  1FCL A;  1B1Z A;  3BWU D;  2AQ1 B;  1ACC A;  2XNA C;  1NI3 A;  2KWD A;  2BW2 A;  2WXL A;  3GS2 A;  1IBX B;  1D5Z C;  4RH6 A;  4RGM A;  1TKG A;  1EWC A;  2PLP A;  1F0Z A;  1T5X D;  1ZPS A;  5BMI A;  1FRD A;  1PUT A;  4MH8 A;  1M4V A;  3FIL B;  1JCK B;  2IGD A;  1RWS A;  3L4P A;  4A8X C;  4TMA B;  2VZK B;  1SJH D;  1ZOY B;  3AB5 A;  2LUM A;  3OWE B;  3P1M A;  3AN1 A;  4LLG M;  1D4B A;  5C2T B;  4ZYS A;  4B0M A;  4HKZ E;  1MI0 A;  3ZJT A;  2QIL A;  3Q8E A;  4M0W A;  1RFK A;  1QKZ A;  4C7Z A;  1MVK A;  1HEZ E;  3IAS 1;  1JWB D;  3ABV B;  3P42 A;  1J7B A;  2KQ4 X;  3AM9 A;  5HFY A;  5AUI A;  3VR8 B;  2WLB A;  1JRO A;  2D5G A;  2K3U A;  3AE5 B;  1WYG A;  4USA A;  3R8B A;  3W2D A;  3R2T A;  1QQR A;  3Q8C A;  2VZK D;  1E10 A;  4J3O D;  2JX5 A;  2Q5W D;  1TKY A;  4TSS A;  4N59 A;  1GB1 A;  4RF1 A;  3MP9 A;  1SB3 C;  2NTS A;  2WDQ B;  5BYR A;  5LNK 1;  2KAJ A;  2L52 A;  1TY0 A;  4RGO S;  2WXJ A;  2KDM A;  1FXA A;  1ET6 A;  3AED B;  3AE1 B;  2J53 A;  4A90 A;  3U52 E;  2Y5C A;  3I57 A;  4ARI A;  3P4P B;  1I7H A;  1FEH A;  1MPE A;  2DYO A;  3SFD B;  4US9 A;  3P4Q B;  1AN8 A;  2MJE A;  1FMA D;  4YSZ B;  2GB1 A;  2L32 A;  3AE4 B;  3E56 A;  1NYQ A;  5AUK A;  1WRI A;  1IGC A;  1CQV A;  4JWS C;  1HZ6 A;  2WDV B;  4MM3 B;  2WU2 B;  1EWY C;  4HJG E;  3BYY B;  1SBB B;  5H8Y E;  1SJE D;  1E7P B;  2LFI A;  3UI3 A;  2HTM E;  2WXF A;  1QOF A;  2BBC A;  5T8I A;  2OED A;  5EE3 A;  1ET9 A;  2CU3 A;  1HQR D;  2K5P A;  1E6E B;  1BXT A;  1C76 A;  1L0Y B;  1N62 A;  3AEF B;  3PZ7 A;  3AE3 B;  4PT5 A;  4JE3 B;  1FXI A;  1YQ4 B;  1ROE A;  1YJI A;  2WP9 B;  2BS2 B;  2WXI A;  2M19 A;  3R2I A;  2CJO A;  1ZXI A;  4Q2J A;  1J7A A;  2MEK A;  4O1N A;  1FM0 D;  3KLS X;  5BMG A;  1YMH E;  1OQR A;  3AEE B;  3NS1 A;  1QF6 A;  1AYF A;  1HZ5 A;  1JQ4 A;  2Y5P A;  1STE A;  3MC0 B;  3VR9 B;  4XDD A;  2SEB D;  3ZQ4 A;  3KWV A;  1K52 A;  2ZW0 A;  3W1S A;  2IGH A;  2JSV X;  1FD6 A;  2BB5 A;  1FIQ A;  4YXD B;  1XEE A;  2WXQ A;  2TSS A;  1C9F A;  3IT4 B;  1KLU D;  1YN3 A;  1GOZ A;  1TZO A;  2WXK A;  3NVY A;  2EKI A;  1L0V B;  2V4I B;  2RDH A;  5FK9 C;  4ZHO A;  2G9H D;  3B9J A;  5TSS A;  2RMM A;  1K53 A;  1CJE A;  1V1P B;  3GP7 A;  4WQM A;  1C79 A;  2I38 A;  4HRS A;  1WXQ A;  1QIL A;  1MHH E;  2J52 A;  3RFZ B;  4YTP B;  1QT9 A;  1NVI D;  3PZ8 A;  1AWD A;  3HUI A;  3P63 A;  4GDL B;  1QOG A;  2E3T A;  3IAM 1;  1OQQ A;  1D5M C;  1JAL A;  2WXN A;  1RYJ A;  3B2F A;  2I2Y A;  2JZP A;  4UDU C;  3BK1 A;  2H88 B;  1I4Q A;  3IT6 B;  4WUR A;  2JYE A;  4YT0 B;  1XCQ L;  1SIJ A;  4AQ7 A;  1SE4 A;  3EGR A;  4DXF A;  4JWU C;  3TEX A;  2YEP B;  4MAC A;  5MPO A;  3CIR B;  1IBX A;  3MFG A;  4NAW B;  4YSY B;  5JXV A;  3P4S B;  1FCC C;  1XLQ A;  1Y56 A;  2LGI A;  4H2A A;  3ZGZ A;  3FIL A;  4OZA A;  4RGT A;  1ZDV A;  1LO5 D;  3P4R B;  2EEL A;  1VZ6 A;  2LMC A;  4A6Q A;  4YSX B;  1XF5 L;  1I4X A;  4CQN A;  4TQ1 A;  4KX6 B;  5HHD G;  2LJI A;  2MJ3 A;  3NZ3 A;  1N61 A;  2V3P A;  3BYT B;  4XDC A;  1VZ8 A;  2WXM A;  1JML A;  2PTL A;  5C3J B;  1SE2 A;  3N9Y C;  4WIP A;  2LEK A;  2WDR B;  3B2G A;  1XLP A;  3O13 A;  4OVZ A;  2RPV A;  1KFY B;  2HDE A;  2ONQ A;  1PDX A;  1TS5 A;  2CJN A;  4L23 A;  2GI9 A;  4DXG A;  3T3O A;  3VQI A;  1DOX A;  2WXO A;  1FNV A;  1MHX A;  3AH7 A;  5BYQ A;  1VDV A;  4XWW A;  1T6B X;  1IGD A;  3AE2 B;  3NVZ A;  2INP E;  2W82 A;  3SFE B;  5EE1 A;  4LK0 M;  1NEN B;  4XE0 A;  3ZJV A;  3AEB B;  3KWL A;  3TEW A;  2WXH A;  2QIE B;  4RGN A;  1TY2 A;  2MJD A;  1ZP0 B;  3LYY A;  4YWG G;  3ZJU A;  1YN5 A;  2GRI A;  1R7S A;  2IPK D;  1F2R C;  1RM6 C;  2N9L A;  4NAM A;  4N58 A;  2DWQ A;  2V3N A;  2WU5 B;  4OZB A;  1L6U A;  2AQ3 B;  4NJC A;  3C8Y A;  4REZ A;  1T3Q A;  3MJ5 A;  4RFB A;  1XLO A;  1SSN A;  1AW7 A;  5D7G A;  1JWM D;  1FRR A;  1N60 A;  1N5W A;  3AMZ A;  4WH4 A;  3SR6 A;  4YTN B;  5I4D A;  3IXS A;  1PYW D;  3BZD B;  2PVG C;  3TEY A;  1L6V A;  1SF0 A;  3ETR A;  5BYS A;  3AE7 B;  2BB6 A;  2DLB A;  4TQ0 A;  4OHJ A;  1DYQ A;  4P6V F;  1JWS D;  2INN E;  2L83 A;  4US8 A;  1TS4 A;  1TS3 A;  1UWM A;  1WGK A;  4FXC A;  5D3I B;  3FC4 A;  2K9X A;  2WXR A;  1E0Z A;  2H89 B;  1PGB A;  2WXG A;  1BML C;  4L1B A;  1A70 A;  1ESF A;  2W3R A;  4WWM A;  3TUO A;  3DWM A;  1C78 A;  1XLN A;  2W3S A;  3LXF A;  2OHF A;  3MHZ A;  2KAC A;  2X38 A;  2FUG 1;  2G1E A;  2JQR B;  2XN9 C;  1F2R I;  3AEG B;  4KGR A;  4ZHP A;  1KTK A;  4JPS A;  1EU4 A;  3Q8B A;  4OW0 A;  4C56 C;  2IGG A;  1ZE3 D;  1QOB A;  5G5H A;  2ON8 A;  2DYM A;  3AE9 B;  1TYG B;  4A55 A;  3Q8F A;  1TKE A;  1SEB D;  2ACZ B;  1FNU A;  3U7Z A;  1VRA B;  1K51 A;  2JWU A;  4R3D A;  2BT6 A;  1XCT L;  1JW9 D;  1I4G A;  3J9C A;  3NRZ A;  2R61 A;  5BMH A;  3AEA B;  1YJJ A;  1E9M A;  1HXY D;  2N0S B;  1WSP A;  3AEC B;  1DOI A;  1ZXH A;  1QOA A;  1TJE A;  1CK1 A;  1KH0 A;  4XWT A;  3BK2 A;  4RF0 A;  1FNW A;  2BS4 B;  1JRP A;  2M56 B;  3RPF C;  2W54 A;  3HVZ A;  1YNT E;  3I9V 1;  2WS3 B;  2ICI A;  4HRO A;  1PGA A;  1I4R A;  1HA5 A;  5E6J A;  1C4P A;  1V1P A;  4GDK B;  2ZW1 A;  4ZRP A;  1ZDX A;  4LTU A;  3NVV A;  2NTT A;  3AE8 B;  1KLG D;  1OFF A;  1NEK B;  4RCO A;  4MT5 A;  4C80 A;  2FBW B;  4GLS C;  1FFV A;  3VRB B;  5G5G A;  1GPX A;  2QMT A;  1UNS A;  4IDI A;  4B0E A;  4KGT A;  1C4C A;  2PW9 A;  4ARC A;  2IDY A;  1GAQ B;  3EA6 A;  1D5X C;  1VZ7 A;  1SXT A;  1ZUD 2;  2WQY B;  3CWI A;  2Z8L A;  4DQO C;  3AV8 A;  1DGJ A;  2JXT A;  2RDG A;  3BII D;  3TEZ A;  4KKJ A;  2PKO A;  1PGX A;  1GB4 A;  5GXG B;  2BTE A;  1YN4 A;  1J7C A;  1F77 A;  4IOI E;  2PMV A;  4OZC A;  1DOY A;  1P7F A;  3BVM A;  3W9C B;  4P16 A;  1FO4 A;  1N5X A;  4AS1 A;  3Q69 A;  3URY A;  1KRH A;  3AE6 B;  3HRD D;  4RNA A;  1V97 A;  3T3N A;  3H8H A;  5FR3 A;  3W5V B;  2BYT A;  2AX5 A;  3HVD A;  2QJL A;  3BVZ A;  2AQ2 B;  4L2Y A;  3KQ4 A;  2K0P A;  1JWA D;  1WWT A;  3DWG C;  3E9S A;  3ZYY X;  3WCQ A;  4YTM B;  1XO3 A;  2L1A A;  1VJK A;  3TSS A;  3V05 A;  4ZOH C;  1N63 A;  2PIA A;  4C7Y A;  1ENF A;  2BS3 B;  3NVW A;  1C4A A;  1YQ3 B;  2KN4 A;  1I4H A;  1P7E A;  4KGS A;  5FKA C;  5D3D A;  3NUH B;  2B76 B;  1UGJ A;  1JWU D;  1FFU A;  2WNM A;  3PO0 A;  4A9A A;  2YEP F;  4ZRQ A;  5HI1 A;  1D6E C;  3V3X A;  1SE3 A;  4ITK A;  5EE0 A;  2MH7 A;  1IUE A;  1UUP A;  2J4X A;  2NMQ A;  4NZL B;  2W55 A;  2M0A A;  1K50 A;  3Q8A A;  4EE2 A;  1C77 A;  1V8C A;  2QEJ C;  3W5U B;  2KMM A;  3U4E G;  1V1O A;  5EE9 A;  2SAK A;  3LB8 C;  2WXP A;  4WAF A;  2J42 A;  2N7J A;  2LHE A;  1L0X B;  4HKQ A;  1Q10 A;  1PFD A;  3SEB A;  2LHD A;  2N9K A;  2K22 A;  1VR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...