2OEDA

Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of backbone proton positions and dynamics in a small protein by liquid crystal NMR spectroscopy
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2oedA00
4KGTA 1MI0A 2JWUA 2ZW0A 2RPVA 1IBXA 2QMTA 2I2YA 1HZ6A 2KWDA 2JSVX 1K50A 1GB1A 1F2RC 2IGDA 4OZAA 1FCLA 2JXTA 4KGSA 4KGRA 5HFYA 2I38A 1JMLA 1PGBA 5BMIA 2ONQA 1HZ5A 2NMQA 3V3XA 2ZW1A 1XCQL 3MP9A 4IKGA 3GB1A 4WH4A 2IGGA 1P7EA 1ZXHA 5BMHA 1PGAA 2LGIA 1Q10A 1IGCA 1HEZE 2GI9A 5HI1A 3UI3A 2KDMA 5JXVA 2N9KA 2JZPA 1YNTE 1EM7A 2J52A 1XCTL 2KQ4X 2N9LA 1IGDA 4OZBA 2GB1A 3FILA 2IGHA 2PTLA 4IOIE 1K51A 2K0PA 2KACA 5BMGA 1K53A 2JU6X 1IBXB 2ON8A 2EELA 4HJGE 1F2RI 2LUMA 3FILB 1MPEA 4GLSC 1GB4A 2LHDA 1FD6A 1XF5L 1YMHE 2LHEA 2PW9A 4HKZE 4D2KA 1MHXA 1C9FA 2RMMA 5HHDG 1PGXA 1QKZA 2OEDA 1FCCC 2PLPA 2N7JA 1MVKA 2QSDA 4OZCA 2J53A 1K52A 2KN4A 4MACA 1KH0A 1D4BA 1UWXA 1P7FA 1MHHE 5HG2A
chains in the Genus database with same CATH superfamily
2JY6A 4HPMB 3AM9A 1GPXA 1YX6B 4ACFA 2D3BA 1EF5A 3CF6E 2JSVX 1I4PA 4WURA 3GZNI 1WRDB 3CIRB 1WR6E 2I1JA 5CHWA 1C78A 2N7EA 3UGBB 2ZVOA 3QQ8B 2PPHA 3NZSA 1EF1A 2PMVA 4LK0M 2ZZPB 2CHXA 1E7VA 2K9XA 2GRIA 1WY8A 4KVGB 4K3BA 1E9MA 3V61A 4WAFA 4HXDA 2LUEA 5EE3A 3VH4B 4TKNA 4US8A 5HKHA 3HHMA 5IKCM 4GIVA 3I57A 4K7WA 5CHVC 2DX5B 3DBHI 3PSEB 1FRRA 1WI0A 4YL8A 1UH6A 3U4EG 2KACA 2YEPB 3TIXA 2RPQA 1MG4A 1XLOA 2ON8A 3L08A 2LUMA 2J0KA 2FNJB 4GLSC 2BYTA 3HM6X 4FULA 2AYOB 1X1MA 3QCAA 4JPSA 3KYDD 3KUDB 2REXA 2MEKA 1XO3A 4ZRQA 4K81A 3P42A 3A4RA 5HHDG 5E6NA 4PYUA 2LZ6A 5E6JA 3ZXRA 3UIPB 1WYWB 1RRBA 1XQQA 2QEJC 1V9JA 2KQ7A 2KFKA 2QCZA 2WX0A 1WMHB 2KWUB 4AJYB 2RPVA 2FE8A 4HPLB 4KZ0A 4C80A 3ALBA 4DBGA 4M8NA 2JZ3B 2G3QB 2MJDA 1GB1A 4I6NB 2BS4B 3H7SA 1JMLA 3UF8A 4YSZB 1FXIA 2MA9B 1NI3A 2BKFA 1UGMA 2BGFA 4A90A 3Q8BA 4F7ZA 3PLVA 4K7SA 2KMAA 2Z59B 3ZUNA 3X0WA 3T9LA 4HKQA 1P7EA 2BPSA 3APDA 2CJNA 2WYQA 4K7UA 3PPAA 4HDOA 4R3DA 3NOBA 3VHTC 1V5OA 3ZRFA 3AE3B 2X8XX 3K9PB 4MH8A 1RWSA 2YVCA 4C4VA 2K3UA 2XNAC 1OGWA 1S1QB 3PHXB 2IGHA 1FRDA 2INCC 4LDTB 1J0GA 2L8JA 4IM2A 4ASWC 2KWVB 1TY2A 4MGKE 1P1AA 4ANXA 1DOYA 3WA0A 2QC8A 2LHEA 4W9HA 4L2YA 4HPPA 4I6PA 1GOZA 3SR6A 2A5UA 5D6JB 2MQJA 2L52A 2D2QA 1XEEA 4DXFA 4PT5A 4JX1C 3RULA 4XYCA 2MP2A 2BVCA 1V2YA 1JQ4A 3DCGA 3IBEA 1E7UA 1ZUD2 4WWPA 3ML8A 2ZVNA 3A4SC 2N9PC 3VH3B 5IA7A 2O6VB 1QOAA 2KMMA 1JWUD 1V5TA 2PVOD 4J3OD 2ZEQA 3RUIB 1DOIA 2KMCA 1SJED 1YX5B 4GDLA 5HFYA 2NBVB 1PGBA 3E9SA 5DPWA 2BYEA 2WXOA 4NZLB 3U8ZA 2J0MA 2Z0EB 4EZJA 2AWTA 3WANA 3Q2AC 3ZIMA 1FXAA 3ZTCA 5LXIB 1UWMA 1ZXHA 3JVZX 3TEXA 3LXFA 3MC8A 3NS1A 3OJ3A 4TQ0A 1YIWA 5J2RA 1Q10A 4LLGM 4UDUC 4DK5A 4XDDA 4OVZA 2LJIA 1P3QU 1YNTE 3APCA 1OFFA 2DZJA 2NVUI 2X38A 1BT0A 3R2IA 2W3RA 5JH5C 4GOCA 3H8HA 3M62B 4OZBA 1ET6A 2HJ8A 3WAPA 4JLCA 1VZ6A 4GXBA 1I35A 3CMMB 2MBQA 1F0ZA 2CKHB 1IBXB 4G3XB 2IDYA 2EELA 3TCAA 1VZ8A 2KANA 1I4QA 3ONSA 5AZHA 1V1PB 3MJWA 1YMHE 3DVGY 1V1PA 3AV8A 2LGDA 2WXJA 2QHOA 4BKGA 1C3TA 2M19A 2KT7A 5C23A 3H6NA 3DVGX 1UBQA 1LXDA 1F52A 1H4RA 1K52A 4TV3A 3S2AA 3R7QA 5BO4B 2J4XA 4DHZE 1LFDA 4MEMA 5AUKA 4XWWA 3H7PB 2L00B 1BXTA 2ZNVC 2K6QA 2KX0A 4GDKB 4EEWA 1L2NA 1UUPA 4EZKA 2ZJDA 3ZO5B 2R2OA 3HK0A 5E6OA 1VCBA 1TT5B 1WXSA 1WIAA 4W9CA 2BYFA 2NMQA 2DLBA 2FCQA 3BIID 1CMXB 4RF1A 1SE2A 1V1OA 4F1SA 4IKGA 1YN3A 1YJ1A 5DCNA 3VTUA 2I1KA 1SB3C 4JWSC 3M63B 3PO0A 3SHQA 3PT2B 3RYTA 3Q3OC 4P1BC 4ICVA 2DAFA 2WDVB 2KDMA 3NZUA 3AE5B 1TYGB 3U52E 3DBLI 2N9XA 4XZ4A 2KK8A 4TQ1A 2JQRB 3P2BA 5D2MB 4DXAB 2M56B 3KUCB 4H2AA 2KQ4X 1QLBB 3NUHB 3NVVA 2KZRA 3RZWC 1AYFA 4NPNA 1E0ZA 3RNBC 4FJZA 4E71A 5DPRA 3Q8CA 5AZFA 2AX5A 3KWVA 3I9V1 4PS7A 2G4SA 5T8IA 3OJ4B 2LHDA 4EUTA 2FIFA 5DPTA 3HVZA 3W2DA 2KFKB 5DPSA 3U2SC 5FKAC 2KNBA 4J6IA 4IDIA 4NJ6A 4RFBA 4ARIA 1TBEA 4KDIC 2GLSA 2Y5CA 1PDXA 4MGYE 4LJOB 3ZQ4A 3T3OA 1HQRD 2LRUA 2RDHA 2IO3B 1SJHD 4ICUA 4LNOA 4MACA 5EE9A 3SD5A 1D6EC 1KJTA 1FNWA 5AZGA 3DDCB 2WWZA 5D3DA 3VFKA 3AE8B 1UELA 2VH2A 2KWDA 1UZXB 3IAS1 2BB5A 4DXGA 2AL6A 1FIQA 1PUTA 1WRIA 1FCLA 2JXTA 2FUG1 2W55A 2L1AA 2MW5A 4K3CA 3UQBA 1JWMD 1T6BX 4TUUA 1YQBA 3MFGA 2KXJA 2WXLA 1I4HA 1SXTA 4PYZA 3ZJVA 1ZOYB 2OJRA 1V97A 5H8YE 3Q6BA 1JRPA 3M95A 3LJ3A 4A6QA 3MC0B 4C7ZA 2LGIA 4WAAA 2UU7A 3W1YA 3VTVA 1ZDXA 3QK0A 1QOGA 1RAXA 2KVZA 3MTNB 3IFWB 4DWFA 1XCTL 4GDKA 3AI5A 1XXGA 1HTQA 4BFRA 1KLGD 1ZGUB 3BYTB 3V05A 2EMTA 5JHAA 3TEWA 3QX1A 3TEYA 2LASA 3MC9A 2GBJA 2ACZB 4EE2A 1D5MC 3LDZE 4DHJB 1ZPSA 2MX2A 3U7ZA 2V4LA 3DHGC 1NYQA 1TKYA 2W54A 2HTHA 1N5XA 2Z8LA 3L16A 1XLNA 2JT4B 3CSFA 2WXGA 3L10B 2XK5A 3GOEA 5IP4D 2JWZA 4OHJA 3U30A 4IWPA 3VR8B 1D3ZA 2MP2B 3VUYA 4MJSB 1CK1A 5E6PA 3J9CA 1EO6A 1TKEA 3ZRCA 2O6VD 1ESFA 1T0QC 2W3SA 2D3GA 2IY0B 3ZDTA 3Q3FA 1C1YB 1E8ZA 4OW0A 1QQRA 3N3KB 2MSED 4ZHOA 3C8YA 2KDIA 3B2GA 1WYGA 1EWCA 2RGFA 1HEZE 1B1ZA 4AJWA 1R4NB 4ZHPA 2INDC 2KTRA 3EHVA 2HTME 4LNFA 2D10A 4NQLB 3V6CB 1TKGA 2YEPF 4BOZB 2JX5A 2C7MB 1WGKA 3WAMA 2UWQA 1KOTA 4P6VF 1FNVA 4JL9A 4P1CC 1TTNA 1ZKHA 4DDID 2INPE 1WSPA 4YSYB 4A20A 1NBFC 3QAQA 4G50A 2KO3A 5BYRA 1WJNA 2BF8B 3ZGZA 2XBBC 2WXKA 3Q8EA 1E10A 1QKZA 3AEFB 2DBYA 2QIEB 4EZLA 2LWPA 3VDZA 2FIDA 2KX3A 3AEEB 5MPOA 3AMZA 1XD3B 3C19A 4OVUA 1H8CA 1F9JA 1WXMA 3SFDB 1YN4A 2VZKB 2IYDB 4C56C 3N1ZC 3BVGA 4W9KA 2JWUA 3NG0A 4CQNA 4L1BA 2R61A 3DPDA 3VAWA 2WP9B 2FUHB 2L76A 3BWUD 4ITKA 1QOFA 1SBBB 2R2QA 1AW7A 3ZYYX 3AXCA 2MBEA 3T3NA 3PHWB 4XWTA 5BMIA 1QF6A 1R4MB 2KQSA 4BKSA 4CHKA 4KKIA 2EKIA 1TZOA 4GSWA 1JCKB 4RCOA 2M17A 5EE1A 2GI9A 2MJ3A 1EU4A 3PRZA 2OOBB 4RGMA 1PYWD 3D32A 3HUIA 1WX8A 2L05A 2INNE 5C3JB 3ZJUA 2NPTB 2UYZB 3NJTA 2J0JA 2NR2A 1B9RA 4IOIE 4B9KA 1C4CA 3HIZA 2PJHA 3EA6A 3DHHC 2M8SA 3RPFC 3P4PB 5H92C 2BYVE 2D3CA 2Z0DB 2CS4A 1I42A 3P4QB 4CO7A 3BK2A 1XF5L 2AEHA 3IT6B 4CYEA 2ASQA 2L32A 4GDLB 1L4ZB 3I63C 4ZRKA 3SDLC 2BS3B 3OWEB 2LJ5A 1WR1A 1ZW7A 2K22A 1C79A 3RNCC 1KTKA 1WM3A 3EFUA 2Q5WD 2BB6A 1E6EB 3P63A 4RMAA 1T0SC 5G5GA 1IUEA 3IXSA 1Q1OA 3ZVVA 1OEYA 4GGQA 2I2YA 4LNNA 4ZYSA 2N0SB 1KF6B 1WGYA 4YTMB 4HVBA 1K50A 1TS2A 1J19A 3BZDB 4ZYNA 2DNFA 5CX3A 4HWIB 2N1VA 1TS3A 1XCQL 3MP9A 4IW0A 1OEYJ 3GB1A 4ZRIA 4WH4A 3ZNZB 4FJYA 4M00A 1I4GA 4FADA 3KUZA 1AARA 1YOVB 3UINB 4XGAB 3GE8C 4NY0A 2SAKA 3UI3A 5J18A 4EKUA 1C76A 2WDTB 4DHZB 1WGHA 2NPTA 5FR6A 2FCMA 3NS8A 3BVZA 1P9DU 3AU4A 2JXXA 2AQ2B 2DWQA 1IGDA 2FAZA 3RMKC 3NY5A 2N1WA 4RGTA 4ANWA 2CU1A 2V4IB 3A9JB 2CHWA 4XDCA 3RNAC 3RN9C 1I4RA 3N20C 3L0WB 2PIAA 1J7BA 2JYTA 2J7QB 3VVWB 4C7YA 2PW9A 3DBRB 2AL3A 3LYYA 1IPGA 3KYCD 5FK9C 4W9LA 4N6EB 4WWMA 4YXDB 2ZCBA 2OEDA 1FCCC 1FM0D 2LVPA 3AH7A 1UD7A 2WU5B 1MVKA 2D11A 4OZCA 1CQVA 1ZXIA 2PEAA 4BBNF 2XN9C 3DWMA 1UWXA 1P7FA 2AQ1B 2DZMA 4KGTA 4KV2A 1JW9D 4WWOA 3AEAB 4OVVA 5I4DA 2KLGA 1F1HA 1L0XB 2KAJA 2PVGC 1EU3A 2NS5A 1IYFA 2M4NA 2BWES 1N5WA 1JWBD 1HXYD 3A9KA 4M01A 2V3NA 4ZOHC 1J7AA 5GXGB 4RM8A 3A1QB 2ONQA 4HCNB 4B95A 3O65B 2ZNVB 4MELA 3DQVA 4YWGG 2KFJA 1YJIA 4XX5A 4YT0B 3KVFB 2L3ZA 3O13A 1RFAA 4TMAB 2WXQA 2NTSA 1GUAB 1WGRA 1T0YA 2FCNA 4RGOS 2G4DB 4IC7B 4GN1A 4WQMA 4G11A 2B3AA 2KDEB 3ABVB 2N4FA 2N9LA 3FILA 2HD5B 1VR9A 3GP7A 2ZCCA 3VRAB 3CWIA 2D07B 3QHTA 2IBIB 1N61A 1NDDA 2QDFA 3P4SB 1UGJA 1WXQA 2QJLA 3L17A 3IG3A 4N9F4 1GJZA 3ZKJC 2VH1A 1FD6A 1ROEA 3RCZA 1LGRA 3NVZA 1M94A 3LB8C 1E90A 2PKOA 2W82A 3R3MA 4ZRJA 3RT3B 2L0FA 3U7DA 2MBHA 1QT9A 2QSDA 2V3PA 1MFWA 2WHIA 3KH0A 1JWAD 2KN4A 2WU2B 3DHIC 1KH0A 1SE4A 4EFOA 2LFIA 3K9OB 1HA5A 3ZDMC 1JWSD 1MI0A 4YTPB 2A4ZA 5IOIA 1WGGA 1E8XA 4GB9A 5IO9A 2ZPYA 3AEBB 3W5UB 3EC8A 1XLQA 3JSVA 4NNJB 3Q3MC 1V86A 2L7RA 3P1MA 4PK1A 4IM3A 4NJCA 2BW2A 3AEDB 4US9A 2I38A 4M02A 4B6WA 3MHSD 2K5PA 1NVID 4M0WB 2N9EB 4W9EA 2WGSA 2XK5B 4KSKC 2MBBB 1UNSA 4BOSC 1FMAD 4MDKE 4RNAA 2KJ6A 3E56A 4NAWB 4FBJB 4C00A 1T3QA 1YJJA 2JUOA 2VZKD 4HEA1 4KDLB 3RNFC 1L6VA 3L54A 4WQOB 2WDRB 4DDGD 1NI2A 3W1SA 2NBWB 2GB1A 3VR9B 1EUVB 3A33B 4URKA 4E74A 1IP9A 1TZ1A 1SF0A 3OLMD 2RDGA 3EECA 4LDTD 3AU5A 1DGJA 3QIJA 3ML9A 3FAHA 1FEHA 4JE3B 4LJPB 3PV1A 1OQQA 4HKZE 4D2KA 3IAM1 2QILA 2IZVB 2IY1B 2L83A 2BBCA 1SIJA 2ZPNA 3R8BA 2DYOA 2BT6A 2PLPA 2N7JA 2ICIA 2JRIB 3QWZB 4AP4C 5LLIA 1T0RC 2AQ3B 2IO0B 4A8XC 2DYBA 1CZPA 4FHKA 4EOYA 3PS6A 2KYWA 1MHHE 4JGHB 1K8RB 3BINA 1V8CA 1OQRA 2C5LC 2LVQA 4MSQB 2OJWA 1QILA 3V60A 1PQSA 2H89B 1FXTB 3W1SC 2SEBD 3DWGC 3QC8B 4II3B 1JROA 4KGRA 4MH0E 3RNGC 4BKTA 1P98A 1SE9A 1HZ5A 1ZP0B 2HDEA 4IWOA 1DYQA 4HK2A 5IAAC 3PGEA 3A9KB 2FBWB 1Q0WB 1C4AA 1RYJA 3AB5A 1E8WA 3JSVB 3JW0X 3APFA 1U4AA 4IG7B 4W9IA 4MM3B 4KZCA 1BUIC 1WWTA 1ACCA 3ZLZA 3URYA 3HVDA 1KLUD 1LO5D 1K51A 2DZKA 4G0NB 1HE8A 1DOXA 4AS1A 1RFKA 4O1NA 4F8CB 1MPEA 1WGDA 1GB4A 3SFEB 4MT5A 1A70A 3VUWA 3A1QA 4FA6A 1SE3A 4X57B 1VDVA 4NAMA 1FFUA 4L23A 2WLBA 1PFDA 2JF5A 2WXFA 3VRBB 4NQKE 1WX9A 3ZNHB 4W9FA 3Q3JA 1S3SG 1QZEA 2CJOA 3QJZA 3AE4B 2K8BA 1V6EA 4ARCA 3JYUA 1N63A 4QAYA 2QMTA 2GBRA 2V9HA 1KRHA 3FKYA 2GMIC 2JVCA 2G9HD 4MGZE 1ISNA 1F2RC 2OHFA 4N58A 3UQAA 5CHFA 5D7GA 2PE6B 2ZW1A 4KIKB 1RLFA 2IGGA 3ENEA 1VLBA 2GBKA 1PGAA 2C7HA 2XEWA 1OTRB 3RFZB 2RSUA 2JPHA 2K39A 3ZTDA 4II2B 3EFCA 1JALA 1WFYA 2EMSA 1WXVA 4P16A 2LMCA 3AN1A 2K8CA 3M3JA 3NRZA 4LNKA 2K25A 3WAOA 3TUOA 4WJQA 2DAJA 2K0PA 1XT9B 1WH3A 3VTWA 5BYQA 3IVFA 2G45B 1HTOA 3B9JA 2YLMA 3AE7B 3N32A 4BVUC 2Y3AA 3I5JC 4HLEA 2NBUA 5FR3A 3AECB 1MHXA 4FN2A 3TBLD 2KN5A 1ZDVA 1YN5A 1BMLC 2MH7A 5KHOA 3PZDA 2J53A 3ZJTA 4AOFA 1GC7A 3ECIA 4ANVA 3WCQA 1L7YA 3RD2A 4HRSA 4HROA 3PREA 1HZ6A 2M0AA 3SU8X 4NAWA 3Q69A 1Q5WB 2KKCA 1Z2MA 2MRPA 3KQ4A 2KLCA 1STEA 4WJPA 2E6XA 3BYYB 1A5RA 1LM8B 1TS4A 1WX7A 4DQOC 4K1RB 4S17A 3H1UA 1N6ZA 2DZIA 4W9DA 2N7DA 5BMHA 1UF0A 2WXHA 1L0YB 3T8MA 3QA8A 3TMPB 4A9AA 1V81A 2G1EA 5G5HA 2LRWA 3Q8FA 5LNK1 2J52A 2JZZA 3PVLA 4I6LB 2MLBA 2GBNA 4RGNA 4ZDVA 5JHBA 1TIFA 2CHZA 1WE6A 3WIMA 5BMGA 1K53A 2H88B 3WALA 3TL5A 1CJEA 5TSSA 3H9DA 2PE9A 2MWSB 3V62A 1L0VB 4M0WA 1Y8RC 1GG3A 5G55A 3L13A 2JRHA 4MGIE 4P7IA 5L83A 1TS5A 4IM0A 3DVNU 1AN8A 3SEBA 3ZW3A 2RMMA 1PGXA 3A9JA 1N62A 2GOWA 4N59A 2KJHB 4RF0A 1T5XD 2WDQB 1WMHA 3RNEC 2LXCA 4MJSA 3IHPC 2BTEA 2C9WB 1M4VA 5TR5A 3VQIA 2O2VB 1YQ3B 2RD0A 2BS2B 3B08A 2MHJA 2C60A 5EDSA 3OAWA 3AE6B 1J8CA 3NVWA 3W9CB 1VZ7A 2WXMA 4XC2A 1TY0A 2HJ1A 2MCNB 4GU2A 4LCDE 3N9YC 3V3XA 3BY4B 2KC2A 4BBNC 2KVRA 5GMVA 3ZXVA 1WJUA 3RI7C 2IJ0A 2LVOA 1FNUA 1GNUA 5KHQA 2GBMA 2KOXA 4KIKA 2WXNA 4HJKA 5JXVA 2N9KA 4IUMB 3CSTA 1YD8U 1V49A 1ENFA 2RDBC 2M0XA 3PRMB 1FPYA 5G2NA 3NVYA 1VJKA 3GZNB 2D3AA 3NHEB 2JU6X 1SSNA 4IWQA 2O2VA 2WNMA 1KLVA 2BKRB 1Y56A 3DBLB 4BKSD 3HRDD 1Z5SB 1WJ4A 4MSMB 3BVMA 3DVNV 4W9JA 4ZRPA 4RM9A 2DYMA 2TSSA 2E3TA 3PTFC 4GMVA 1SGHA 4KX6B 2CR5A 3KW5B 2V0GA 4HCPB 4LTUA 5AUIA 5AEKB 3RZFA 1QOBA 1R4MI 2FCSA 5HG2A 2KTRB 4A3OA 4B0MA 1IBXA 3DBRI 2M1MA 2Y5PA 4M8MA 3R66C 5JZEB 4FJVB 3AE2B 3B1LX 3B0AA 3EUB2 2JYEA 4JIOU 4A3PA 2IGDA 2WS3B 1MG8A 4OZAA 1ZE3D 1WZ0A 1E5WA 4WIPA 4REZA 1JRUA 2LD9A 1SEBD 4USAA 4DHJD 3R7RA 1WZ3A 5D3IB 5LXHA 2KHWB 2IO1B 2RR9A 1NEKB 2D5GA 2O6VA 4AWJA 5CTRC 2Y5BB 3AE9B 1G6JA 3N1YC 1I7HA 1LQBA 3R2TA 1EWYC 5C1ZA 3GE3C 3TEZA 2KD0A 2B76B 2PTLA 3IT4B 4XE0A 3QARA 1YQ4B 4TSSA 2V1YA 3NZ3A 1P0RA 2WX1A 4RH6A 3X23A 1F2RI 2KWCA 1L5PA 2MJEA 1KFYB 4C4VB 2VRRB 3AEGB 3TSSA 3B2FA 4FHJA 3ZNGC 2HE7A 2C7NB 5BYSA 3N30A 1NYRA 2K8HA 5L95C 2CU3A 1C9FA 2LEKA 3L4PA 1WE7A 4KKJA 1J7CA 2LGYA 4JQWC 3MJ5A 4KSLC 1KM7A 2KTFA 2K6DB 5J17A 2EKEC 4W9GA 2MBOA 1WJ6A 5C2TB 3TJPA 1FFVA 2V3SA 1TGZB 4WWNA 4LNIA 1D4BA 1D5ZC 4MM3A 2BWFA 1MJDA 4S0RA 2ZW0A 3DBHB 4B0EA 4A55A 3W5VB 3FC4A 4Q2JA 1WM2A 2J42A 5EE0A 1VD2A 2DENB 3BK1A 2KJRA 1E8YA 4AQ7A 1D5XC 4HDQA 2NTTA 1OQYA 1C77A 1GAQB 1R4NI 2DHZA 1F77A 4KGSA 4FXCA 3KWLA 4BZAA 2KDBA 4AUQC 3VXWA 1TJEA 1NENB 4NJ7A 1L4DB 1VRAB 2WXIA 3Q8AA 1FO4A 1GC6A 3KLSX 4BAXA 2KC1A 4YTNB 2KDFB 1WF9A 2WQYB 1IGCA 5HI1A 3H7PA 1RM6C 3AULA 3ZNID 3PRPB 4WJOA 2JZPA 3AE1B 4ANUA 3I3TB 1C4PA 1EM7A 2BQQA 2WXRA 2LI5A 3C0RB 3PLUA 4PS3A 1AWDA 4JWUC 2IO2B 1ET9A 1SIFA 3VUXA 4PS8A 1V80A 4FLHA 1E7PB 3DBSA 4HJGE 2W9NA 3FILB 3GS2A 2NCNA 4WJNA 2LGSA 2LXAA 3MHZA 3PZ8A 3N1XC 1I4XA 2IPKD 4YSXB 3Q3NC 5IN7A 3EGRA 3DOWA 1L6UA 3PZ7A 3HM3A 1R7SA 3OG5A 3P4RB 1N60A 2K1FA 1WXAA 4E3CA 2L0TA 2LGXA 3ETRA 3Q14C 3UIOB 1XLPA 1UBIA 5D94A 3V6EB 2WXPA
chains in the Genus database with same CATH topology
2AQ1B 4KGTA 1JW9D 5D3DA 4HRSA 4HROA 3AM9A 1GPXA 3AEAB 3AE8B 1HZ6A 2M0AA 5I4DA 2KWDA 2JSVX 1L0XB 3IAS1 1I4PA 2KAJA 2PVGC 1EU3A 4WURA 2BB5A 3Q69A 4DXGA 1N5WA 1FIQA 1JWBD 1PUTA 1HXYD 1WRIA 3KQ4A 1FCLA 3CIRB 2JXTA 2FUG1 2V3NA 2L1AA 2W55A 4ZOHC 1STEA 1J7AA 2E6XA 5GXGB 1JWMD 1T6BX 1C78A 3BYYB 2ONQA 3MFGA 1TS4A 2WXLA 1I4HA 1SXTA 4DQOC 3ZJVA 1ZOYB 2PMVA 1V97A 5H8YE 1JRPA 4LK0M 5BMHA 4A6QA 4YWGG 3MC0B 1YJIA 2K9XA 4YT0B 2GRIA 4C7ZA 2LGIA 2WXHA 1E9MA 1L0YB 4WAFA 3O13A 4TMAB 5EE3A 2WXQA 2NTSA 4A9AA 1ZDXA 4RGOS 4US8A 2G1EA 5G5HA 1QOGA 4WQMA 3Q8FA 5LNK1 2J52A 3I57A 1XCTL 3ABVB 2N9LA 3FILA 4RGNA 1VR9A 1FRRA 3GP7A 1XXGA 3VRAB 3U4EG 3CWIA 2KACA 2YEPB 5BMGA 1K53A 2H88B 1XLOA 2ON8A 1KLGD 1CJEA 1N61A 5TSSA 3P4SB 1UGJA 1WXQA 2LUMA 2QJLA 1L0VB 4GLSC 4M0WA 2BYTA 3BYTB 3V05A 1FD6A 1ROEA 3NVZA 3TEWA 4JPSA 3TEYA 1TS5A 2ACZB 3LB8C 4EE2A 2MEKA 1AN8A 1XO3A 4ZRQA 2PKOA 1D5MC 3SEBA 1ZPSA 3P42A 2W82A 2RMMA 5HHDG 1PGXA 3U7ZA 1N62A 5E6JA 1NYQA 1TKYA 2W54A 1N5XA 2Z8LA 4N59A 2QSDA 1QT9A 1XLNA 2V3PA 2WXGA 4RF0A 1T5XD 2WDQB 4OHJA 2QEJC 1JWAD 2KN4A 2WU2B 1KH0A 1SE4A 2LFIA 2BTEA 3VR8B 1HA5A 1JWSD 1MI0A 1CK1A 4YTPB 3J9CA 2RPVA 1M4VA 2FE8A 3VQIA 4C80A 1TKEA 1YQ3B 2BS2B 3AEBB 3W5UB 1ESFA 2W3SA 1XLQA 2MJDA 1GB1A 3AE6B 3P1MA 2BS4B 4NJCA 3NVWA 3W9CB 2BW2A 3AEDB 1VZ7A 2WXMA 4US9A 2I38A 1JMLA 1TY0A 4YSZB 1FXIA 1NI3A 2K5PA 4A90A 4OW0A 1NVID 3N9YC 3Q8BA 3V3XA 1QQRA 4ZHOA 3C8YA 1UNSA 3B2GA 1FMAD 4HKQA 2IJ0A 1P7EA 1WYGA 4RNAA 1FNUA 1EWCA 3E56A 4NAWB 2CJNA 1HEZE 1T3QA 4R3DA 1YJJA 1B1ZA 2VZKD 3AE3B 2WXNA 5JXVA 4HEA1 2N9KA 4MH8A 2WXPA 4ZHPA 2HTME 1RWSA 1L6VA 2K3UA 1TKGA 2XNAC 2YEPF 1ENFA 2WDRB 2JX5A 3W1SA 2GB1A 3VR9B 1WGKA 2IGHA 3NVYA 1VJKA 1FRDA 4P6VF 1TY2A 1SF0A 2JU6X 2RDGA 1SSNA 1DOYA 1DGJA 3FAHA 1FEHA 1FNVA 2WNMA 4JE3B 1Y56A 2INPE 1WSPA 4YSYB 2LHEA 1OQQA 3HRDD 4L2YA 4HKZE 4D2KA 3IAM1 2QILA 2L83A 3BVMA 2BBCA 1SIJA 4ZRPA 1GOZA 3SR6A 2DYMA 2TSSA 5BYRA 3ZGZA 2E3TA 3R8BA 2DYOA 2WXKA 3Q8EA 2L52A 1QKZA 2BT6A 1E10A 2PLPA 2N7JA 1XEEA 4DXFA 2ICIA 3AEFB 4PT5A 4JX1C 2DBYA 2QIEB 4KX6B 5MPOA 2AQ3B 3AEEB 2V0GA 4LTUA 3AMZA 5AUIA 4A8XC 1QOBA 1CZPA 3SFDB 1JQ4A 1YN4A 2VZKB 4C56C 1MHHE 3BVGA 5HG2A 2JWUA 1V8CA 1ZUD2 1OQRA 4B0MA 4CQNA 4L1BA 1IBXA 2Y5PA 2R61A 1QILA 1QOAA 2WP9B 2H89B 2KMMA 1JWUD 3AE2B 3BWUD 4ITKA 1QOFA 2PVOD 2SEBD 3EUB2 2JYEA 4J3OD 1SBBB 2IGDA 3DWGC 1AW7A 2WS3B 3ZYYX 1DOIA 1ZE3D 4OZAA 1JROA 1SJED 3T3NA 4KGRA 4XWTA 5HFYA 1PGBA 3E9SA 4WIPA 5BMIA 4REZA 2WXOA 4NZLB 1SEBD 1HZ5A 1ZP0B 4USAA 1QF6A 2HDEA 5D3IB 1DYQA 4KKIA 1FXAA 2EKIA 1TZOA 1UWMA 1ZXHA 3TEXA 1JCKB 2FBWB 4RCOA 3LXFA 1C4AA 3NS1A 4TQ0A 1RYJA 3AB5A 5EE1A 1Q10A 1NEKB 2GI9A 2D5GA 2MJ3A 4LLGM 4UDUC 1EU4A 4RGMA 4MM3B 1PYWD 1BUIC 3HUIA 1WWTA 4XDDA 2INNE 4OVZA 2LJIA 5C3JB 1YNTE 1ACCA 1OFFA 2X38A 3AE9B 3R2IA 2W3RA 3ZJUA 1I7HA 3H8HA 3R2TA 1EWYC 3URYA 3HVDA 3TEZA 4OZBA 1ET6A 2B76B 2PTLA 1KLUD 3IT4B 1VZ6A 1LO5D 4XE0A 1B9RA 1YQ4B 4IOIE 4TSSA 1K51A 1F0ZA 3NZ3A 1IBXB 2IDYA 1C4CA 2EELA 4RH6A 3EA6A 1F2RI 1VZ8A 3RPFC 4AS1A 1DOXA 1RFKA 1L5PA 3P4PB 1I4QA 4O1NA 1MPEA 5H92C 1GB4A 2MJEA 3P4QB 3SFEB 1KFYB 1V1PB 4MT5A 3BK2A 1A70A 1XF5L 3IT6B 1YMHE 1SE3A 2L32A 3AEGB 1V1PA 3AV8A 4GDLB 3B2FA 3TSSA 1L4ZB 1VDVA 5BYSA 4NAMA 1NYRA 2CU3A 2BS3B 1FFUA 2LEKA 1C9FA 2WXJA 3L4PA 3OWEB 4L23A 2WLBA 4KKJA 1PFDA 2K22A 1J7CA 2WXFA 2M19A 1C79A 3VRBB 3MJ5A 1KTKA 2Q5WD 2BB6A 1E6EB 3P63A 5C2TB 2CJOA 3AE4B 1FFVA 1K52A 5G5GA 1IUEA 1D4BA 3IXSA 1D5ZC 2J4XA 4ARCA 2ZW0A 5AUKA 4B0EA 1N63A 4A55A 3W5VB 4XWWA 3FC4A 1BXTA 2QMTA 4Q2JA 2J42A 5EE0A 2I2YA 3BK1A 1KRHA 4GDKB 4ZYSA 2N0SB 4AQ7A 1KF6B 1D5XC 2G9HD 4YTMB 1K50A 1TS2A 1UUPA 2NTTA 1F2RC 3BZDB 1C77A 1GAQB 2OHFA 1F77A 4N58A 4KGSA 4FXCA 3KWLA 1TS3A 1TJEA 1NENB 2DLBA 2NMQA 5D7GA 1XCQL 2ZW1A 3BIID 3MP9A 1L4DB 1VRAB 2WXIA 4RF1A 3Q8AA 1SE2A 1FO4A 1V1OA 4IKGA 1YN3A 3KLSX 3GB1A 4WH4A 1SB3C 4JWSC 2IGGA 4YTNB 3PO0A 1VLBA 1I4GA 1PGAA 2WQYB 3RFZB 1IGCA 2SAKA 3UI3A 5HI1A 1RM6C 2WDVB 2KDMA 1C76A 3AE5B 1TYGB 3U52E 2JZPA 3AE1B 1JALA 1C4PA 1EM7A 2JQRB 2WXRA 3BVZA 4P16A 4TQ1A 2M56B 2LMCA 3AN1A 4H2AA 2AQ2B 2KQ4X 2DWQA 1AWDA 1IGDA 1QLBB 3NUHB 3NVVA 4JWUC 1ET9A 1AYFA 1E0ZA 4RGTA 3NRZA 2V4IB 3TUOA 2K0PA 1E7PB 3Q8CA 4HJGE 4XDCA 5BYQA 2AX5A 3KWVA 3I9V1 3B9JA 3FILB 3GS2A 5T8IA 1I4RA 2LHDA 3AE7B 2PIAA 3MHZA 1J7BA 3PZ8A 2JYTA 1I4XA 4C7YA 3HVZA 2Y3AA 3W2DA 2IPKD 2PW9A 3U2SC 3LYYA 4YSXB 5FR3A 3AECB 1MHXA 5FKAC 3EGRA 4IDIA 4RFBA 1L6UA 3PZ7A 5FK9C 4ARIA 4N6EB 4WWMA 4YXDB 1R7SA 1ZDVA 2Y5CA 2OEDA 1PDXA 3P4RB 1FCCC 1N60A 1YN5A 1BMLC 1FM0D 2MH7A 3AH7A 2WU5B 1MVKA 3ZQ4A 3T3OA 4OZCA 1HQRD 1CQVA 1ZXIA 2J53A 2RDHA 3ZJTA 3ETRA 1XLPA 4MACA 2XN9C 5EE9A 3WCQA 3DWMA 1D6EC 1UWXA 1P7FA 1SJHD 1FNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGT A;  1MI0 A;  2JWU A;  2ZW0 A;  2RPV A;  1IBX A;  2QMT A;  2I2Y A;  1HZ6 A;  2KWD A;  2JSV X;  1K50 A;  1GB1 A;  1F2R C;  2IGD A;  4OZA A;  1FCL A;  2JXT A;  4KGS A;  4KGR A;  5HFY A;  2I38 A;  1JML A;  1PGB A;  5BMI A;  2ONQ A;  1HZ5 A;  2NMQ A;  3V3X A;  2ZW1 A;  1XCQ L;  3MP9 A;  4IKG A;  3GB1 A;  4WH4 A;  2IGG A;  1P7E A;  1ZXH A;  5BMH A;  1PGA A;  2LGI A;  1Q10 A;  1IGC A;  1HEZ E;  2GI9 A;  5HI1 A;  3UI3 A;  2KDM A;  5JXV A;  2N9K A;  2JZP A;  1YNT E;  1EM7 A;  2J52 A;  1XCT L;  2KQ4 X;  2N9L A;  1IGD A;  4OZB A;  2GB1 A;  3FIL A;  2IGH A;  2PTL A;  4IOI E;  1K51 A;  2K0P A;  2KAC A;  5BMG A;  1K53 A;  2JU6 X;  1IBX B;  2ON8 A;  2EEL A;  4HJG E;  1F2R I;  2LUM A;  3FIL B;  1MPE A;  4GLS C;  1GB4 A;  2LHD A;  1FD6 A;  1XF5 L;  1YMH E;  2LHE A;  2PW9 A;  4HKZ E;  4D2K A;  1MHX A;  1C9F A;  2RMM A;  5HHD G;  1PGX A;  1QKZ A;  2OED A;  1FCC C;  2PLP A;  2N7J A;  1MVK A;  2QSD A;  4OZC A;  2J53 A;  1K52 A;  2KN4 A;  4MAC A;  1KH0 A;  1D4B A;  1UWX A;  1P7F A;  1MHH E;  5HG2 A; 
#chains in the Genus database with same CATH topology
 2JY6 A;  4HPM B;  3AM9 A;  1GPX A;  1YX6 B;  4ACF A;  2D3B A;  1EF5 A;  3CF6 E;  2JSV X;  1I4P A;  4WUR A;  3GZN I;  1WRD B;  3CIR B;  1WR6 E;  2I1J A;  5CHW A;  1C78 A;  2N7E A;  3UGB B;  2ZVO A;  3QQ8 B;  2PPH A;  3NZS A;  1EF1 A;  2PMV A;  4LK0 M;  2ZZP B;  2CHX A;  1E7V A;  2K9X A;  2GRI A;  1WY8 A;  4KVG B;  4K3B A;  1E9M A;  3V61 A;  4WAF A;  4HXD A;  2LUE A;  5EE3 A;  3VH4 B;  4TKN A;  4US8 A;  5HKH A;  3HHM A;  5IKC M;  4GIV A;  3I57 A;  4K7W A;  5CHV C;  2DX5 B;  3DBH I;  3PSE B;  1FRR A;  1WI0 A;  4YL8 A;  1UH6 A;  3U4E G;  2KAC A;  2YEP B;  3TIX A;  2RPQ A;  1MG4 A;  1XLO A;  2ON8 A;  3L08 A;  2LUM A;  2J0K A;  2FNJ B;  4GLS C;  2BYT A;  3HM6 X;  4FUL A;  2AYO B;  1X1M A;  3QCA A;  4JPS A;  3KYD D;  3KUD B;  2REX A;  2MEK A;  1XO3 A;  4ZRQ A;  4K81 A;  3P42 A;  3A4R A;  5HHD G;  5E6N A;  4PYU A;  2LZ6 A;  5E6J A;  3ZXR A;  3UIP B;  1WYW B;  1RRB A;  1XQQ A;  2QEJ C;  1V9J A;  2KQ7 A;  2KFK A;  2QCZ A;  2WX0 A;  1WMH B;  2KWU B;  4AJY B;  2RPV A;  2FE8 A;  4HPL B;  4KZ0 A;  4C80 A;  3ALB A;  4DBG A;  4M8N A;  2JZ3 B;  2G3Q B;  2MJD A;  1GB1 A;  4I6N B;  2BS4 B;  3H7S A;  1JML A;  3UF8 A;  4YSZ B;  1FXI A;  2MA9 B;  1NI3 A;  2BKF A;  1UGM A;  2BGF A;  4A90 A;  3Q8B A;  4F7Z A;  3PLV A;  4K7S A;  2KMA A;  2Z59 B;  3ZUN A;  3X0W A;  3T9L A;  4HKQ A;  1P7E A;  2BPS A;  3APD A;  2CJN A;  2WYQ A;  4K7U A;  3PPA A;  4HDO A;  4R3D A;  3NOB A;  3VHT C;  1V5O A;  3ZRF A;  3AE3 B;  2X8X X;  3K9P B;  4MH8 A;  1RWS A;  2YVC A;  4C4V A;  2K3U A;  2XNA C;  1OGW A;  1S1Q B;  3PHX B;  2IGH A;  1FRD A;  2INC C;  4LDT B;  1J0G A;  2L8J A;  4IM2 A;  4ASW C;  2KWV B;  1TY2 A;  4MGK E;  1P1A A;  4ANX A;  1DOY A;  3WA0 A;  2QC8 A;  2LHE A;  4W9H A;  4L2Y A;  4HPP A;  4I6P A;  1GOZ A;  3SR6 A;  2A5U A;  5D6J B;  2MQJ A;  2L52 A;  2D2Q A;  1XEE A;  4DXF A;  4PT5 A;  4JX1 C;  3RUL A;  4XYC A;  2MP2 A;  2BVC A;  1V2Y A;  1JQ4 A;  3DCG A;  3IBE A;  1E7U A;  1ZUD 2;  4WWP A;  3ML8 A;  2ZVN A;  3A4S C;  2N9P C;  3VH3 B;  5IA7 A;  2O6V B;  1QOA A;  2KMM A;  1JWU D;  1V5T A;  2PVO D;  4J3O D;  2ZEQ A;  3RUI B;  1DOI A;  2KMC A;  1SJE D;  1YX5 B;  4GDL A;  5HFY A;  2NBV B;  1PGB A;  3E9S A;  5DPW A;  2BYE A;  2WXO A;  4NZL B;  3U8Z A;  2J0M A;  2Z0E B;  4EZJ A;  2AWT A;  3WAN A;  3Q2A C;  3ZIM A;  1FXA A;  3ZTC A;  5LXI B;  1UWM A;  1ZXH A;  3JVZ X;  3TEX A;  3LXF A;  3MC8 A;  3NS1 A;  3OJ3 A;  4TQ0 A;  1YIW A;  5J2R A;  1Q10 A;  4LLG M;  4UDU C;  4DK5 A;  4XDD A;  4OVZ A;  2LJI A;  1P3Q U;  1YNT E;  3APC A;  1OFF A;  2DZJ A;  2NVU I;  2X38 A;  1BT0 A;  3R2I A;  2W3R A;  5JH5 C;  4GOC A;  3H8H A;  3M62 B;  4OZB A;  1ET6 A;  2HJ8 A;  3WAP A;  4JLC A;  1VZ6 A;  4GXB A;  1I35 A;  3CMM B;  2MBQ A;  1F0Z A;  2CKH B;  1IBX B;  4G3X B;  2IDY A;  2EEL A;  3TCA A;  1VZ8 A;  2KAN A;  1I4Q A;  3ONS A;  5AZH A;  1V1P B;  3MJW A;  1YMH E;  3DVG Y;  1V1P A;  3AV8 A;  2LGD A;  2WXJ A;  2QHO A;  4BKG A;  1C3T A;  2M19 A;  2KT7 A;  5C23 A;  3H6N A;  3DVG X;  1UBQ A;  1LXD A;  1F52 A;  1H4R A;  1K52 A;  4TV3 A;  3S2A A;  3R7Q A;  5BO4 B;  2J4X A;  4DHZ E;  1LFD A;  4MEM A;  5AUK A;  4XWW A;  3H7P B;  2L00 B;  1BXT A;  2ZNV C;  2K6Q A;  2KX0 A;  4GDK B;  4EEW A;  1L2N A;  1UUP A;  4EZK A;  2ZJD A;  3ZO5 B;  2R2O A;  3HK0 A;  5E6O A;  1VCB A;  1TT5 B;  1WXS A;  1WIA A;  4W9C A;  2BYF A;  2NMQ A;  2DLB A;  2FCQ A;  3BII D;  1CMX B;  4RF1 A;  1SE2 A;  1V1O A;  4F1S A;  4IKG A;  1YN3 A;  1YJ1 A;  5DCN A;  3VTU A;  2I1K A;  1SB3 C;  4JWS C;  3M63 B;  3PO0 A;  3SHQ A;  3PT2 B;  3RYT A;  3Q3O C;  4P1B C;  4ICV A;  2DAF A;  2WDV B;  2KDM A;  3NZU A;  3AE5 B;  1TYG B;  3U52 E;  3DBL I;  2N9X A;  4XZ4 A;  2KK8 A;  4TQ1 A;  2JQR B;  3P2B A;  5D2M B;  4DXA B;  2M56 B;  3KUC B;  4H2A A;  2KQ4 X;  1QLB B;  3NUH B;  3NVV A;  2KZR A;  3RZW C;  1AYF A;  4NPN A;  1E0Z A;  3RNB C;  4FJZ A;  4E71 A;  5DPR A;  3Q8C A;  5AZF A;  2AX5 A;  3KWV A;  3I9V 1;  4PS7 A;  2G4S A;  5T8I A;  3OJ4 B;  2LHD A;  4EUT A;  2FIF A;  5DPT A;  3HVZ A;  3W2D A;  2KFK B;  5DPS A;  3U2S C;  5FKA C;  2KNB A;  4J6I A;  4IDI A;  4NJ6 A;  4RFB A;  4ARI A;  1TBE A;  4KDI C;  2GLS A;  2Y5C A;  1PDX A;  4MGY E;  4LJO B;  3ZQ4 A;  3T3O A;  1HQR D;  2LRU A;  2RDH A;  2IO3 B;  1SJH D;  4ICU A;  4LNO A;  4MAC A;  5EE9 A;  3SD5 A;  1D6E C;  1KJT A;  1FNW A;  5AZG A;  3DDC B;  2WWZ A;  5D3D A;  3VFK A;  3AE8 B;  1UEL A;  2VH2 A;  2KWD A;  1UZX B;  3IAS 1;  2BB5 A;  4DXG A;  2AL6 A;  1FIQ A;  1PUT A;  1WRI A;  1FCL A;  2JXT A;  2FUG 1;  2W55 A;  2L1A A;  2MW5 A;  4K3C A;  3UQB A;  1JWM D;  1T6B X;  4TUU A;  1YQB A;  3MFG A;  2KXJ A;  2WXL A;  1I4H A;  1SXT A;  4PYZ A;  3ZJV A;  1ZOY B;  2OJR A;  1V97 A;  5H8Y E;  3Q6B A;  1JRP A;  3M95 A;  3LJ3 A;  4A6Q A;  3MC0 B;  4C7Z A;  2LGI A;  4WAA A;  2UU7 A;  3W1Y A;  3VTV A;  1ZDX A;  3QK0 A;  1QOG A;  1RAX A;  2KVZ A;  3MTN B;  3IFW B;  4DWF A;  1XCT L;  4GDK A;  3AI5 A;  1XXG A;  1HTQ A;  4BFR A;  1KLG D;  1ZGU B;  3BYT B;  3V05 A;  2EMT A;  5JHA A;  3TEW A;  3QX1 A;  3TEY A;  2LAS A;  3MC9 A;  2GBJ A;  2ACZ B;  4EE2 A;  1D5M C;  3LDZ E;  4DHJ B;  1ZPS A;  2MX2 A;  3U7Z A;  2V4L A;  3DHG C;  1NYQ A;  1TKY A;  2W54 A;  2HTH A;  1N5X A;  2Z8L A;  3L16 A;  1XLN A;  2JT4 B;  3CSF A;  2WXG A;  3L10 B;  2XK5 A;  3GOE A;  5IP4 D;  2JWZ A;  4OHJ A;  3U30 A;  4IWP A;  3VR8 B;  1D3Z A;  2MP2 B;  3VUY A;  4MJS B;  1CK1 A;  5E6P A;  3J9C A;  1EO6 A;  1TKE A;  3ZRC A;  2O6V D;  1ESF A;  1T0Q C;  2W3S A;  2D3G A;  2IY0 B;  3ZDT A;  3Q3F A;  1C1Y B;  1E8Z A;  4OW0 A;  1QQR A;  3N3K B;  2MSE D;  4ZHO A;  3C8Y A;  2KDI A;  3B2G A;  1WYG A;  1EWC A;  2RGF A;  1HEZ E;  1B1Z A;  4AJW A;  1R4N B;  4ZHP A;  2IND C;  2KTR A;  3EHV A;  2HTM E;  4LNF A;  2D10 A;  4NQL B;  3V6C B;  1TKG A;  2YEP F;  4BOZ B;  2JX5 A;  2C7M B;  1WGK A;  3WAM A;  2UWQ A;  1KOT A;  4P6V F;  1FNV A;  4JL9 A;  4P1C C;  1TTN A;  1ZKH A;  4DDI D;  2INP E;  1WSP A;  4YSY B;  4A20 A;  1NBF C;  3QAQ A;  4G50 A;  2KO3 A;  5BYR A;  1WJN A;  2BF8 B;  3ZGZ A;  2XBB C;  2WXK A;  3Q8E A;  1E10 A;  1QKZ A;  3AEF B;  2DBY A;  2QIE B;  4EZL A;  2LWP A;  3VDZ A;  2FID A;  2KX3 A;  3AEE B;  5MPO A;  3AMZ A;  1XD3 B;  3C19 A;  4OVU A;  1H8C A;  1F9J A;  1WXM A;  3SFD B;  1YN4 A;  2VZK B;  2IYD B;  4C56 C;  3N1Z C;  3BVG A;  4W9K A;  2JWU A;  3NG0 A;  4CQN A;  4L1B A;  2R61 A;  3DPD A;  3VAW A;  2WP9 B;  2FUH B;  2L76 A;  3BWU D;  4ITK A;  1QOF A;  1SBB B;  2R2Q A;  1AW7 A;  3ZYY X;  3AXC A;  2MBE A;  3T3N A;  3PHW B;  4XWT A;  5BMI A;  1QF6 A;  1R4M B;  2KQS A;  4BKS A;  4CHK A;  4KKI A;  2EKI A;  1TZO A;  4GSW A;  1JCK B;  4RCO A;  2M17 A;  5EE1 A;  2GI9 A;  2MJ3 A;  1EU4 A;  3PRZ A;  2OOB B;  4RGM A;  1PYW D;  3D32 A;  3HUI A;  1WX8 A;  2L05 A;  2INN E;  5C3J B;  3ZJU A;  2NPT B;  2UYZ B;  3NJT A;  2J0J A;  2NR2 A;  1B9R A;  4IOI E;  4B9K A;  1C4C A;  3HIZ A;  2PJH A;  3EA6 A;  3DHH C;  2M8S A;  3RPF C;  3P4P B;  5H92 C;  2BYV E;  2D3C A;  2Z0D B;  2CS4 A;  1I42 A;  3P4Q B;  4CO7 A;  3BK2 A;  1XF5 L;  2AEH A;  3IT6 B;  4CYE A;  2ASQ A;  2L32 A;  4GDL B;  1L4Z B;  3I63 C;  4ZRK A;  3SDL C;  2BS3 B;  3OWE B;  2LJ5 A;  1WR1 A;  1ZW7 A;  2K22 A;  1C79 A;  3RNC C;  1KTK A;  1WM3 A;  3EFU A;  2Q5W D;  2BB6 A;  1E6E B;  3P63 A;  4RMA A;  1T0S C;  5G5G A;  1IUE A;  3IXS A;  1Q1O A;  3ZVV A;  1OEY A;  4GGQ A;  2I2Y A;  4LNN A;  4ZYS A;  2N0S B;  1KF6 B;  1WGY A;  4YTM B;  4HVB A;  1K50 A;  1TS2 A;  1J19 A;  3BZD B;  4ZYN A;  2DNF A;  5CX3 A;  4HWI B;  2N1V A;  1TS3 A;  1XCQ L;  3MP9 A;  4IW0 A;  1OEY J;  3GB1 A;  4ZRI A;  4WH4 A;  3ZNZ B;  4FJY A;  4M00 A;  1I4G A;  4FAD A;  3KUZ A;  1AAR A;  1YOV B;  3UIN B;  4XGA B;  3GE8 C;  4NY0 A;  2SAK A;  3UI3 A;  5J18 A;  4EKU A;  1C76 A;  2WDT B;  4DHZ B;  1WGH A;  2NPT A;  5FR6 A;  2FCM A;  3NS8 A;  3BVZ A;  1P9D U;  3AU4 A;  2JXX A;  2AQ2 B;  2DWQ A;  1IGD A;  2FAZ A;  3RMK C;  3NY5 A;  2N1W A;  4RGT A;  4ANW A;  2CU1 A;  2V4I B;  3A9J B;  2CHW A;  4XDC A;  3RNA C;  3RN9 C;  1I4R A;  3N20 C;  3L0W B;  2PIA A;  1J7B A;  2JYT A;  2J7Q B;  3VVW B;  4C7Y A;  2PW9 A;  3DBR B;  2AL3 A;  3LYY A;  1IPG A;  3KYC D;  5FK9 C;  4W9L A;  4N6E B;  4WWM A;  4YXD B;  2ZCB A;  2OED A;  1FCC C;  1FM0 D;  2LVP A;  3AH7 A;  1UD7 A;  2WU5 B;  1MVK A;  2D11 A;  4OZC A;  1CQV A;  1ZXI A;  2PEA A;  4BBN F;  2XN9 C;  3DWM A;  1UWX A;  1P7F A;  2AQ1 B;  2DZM A;  4KGT A;  4KV2 A;  1JW9 D;  4WWO A;  3AEA B;  4OVV A;  5I4D A;  2KLG A;  1F1H A;  1L0X B;  2KAJ A;  2PVG C;  1EU3 A;  2NS5 A;  1IYF A;  2M4N A;  2BWE S;  1N5W A;  1JWB D;  1HXY D;  3A9K A;  4M01 A;  2V3N A;  4ZOH C;  1J7A A;  5GXG B;  4RM8 A;  3A1Q B;  2ONQ A;  4HCN B;  4B95 A;  3O65 B;  2ZNV B;  4MEL A;  3DQV A;  4YWG G;  2KFJ A;  1YJI A;  4XX5 A;  4YT0 B;  3KVF B;  2L3Z A;  3O13 A;  1RFA A;  4TMA B;  2WXQ A;  2NTS A;  1GUA B;  1WGR A;  1T0Y A;  2FCN A;  4RGO S;  2G4D B;  4IC7 B;  4GN1 A;  4WQM A;  4G11 A;  2B3A A;  2KDE B;  3ABV B;  2N4F A;  2N9L A;  3FIL A;  2HD5 B;  1VR9 A;  3GP7 A;  2ZCC A;  3VRA B;  3CWI A;  2D07 B;  3QHT A;  2IBI B;  1N61 A;  1NDD A;  2QDF A;  3P4S B;  1UGJ A;  1WXQ A;  2QJL A;  3L17 A;  3IG3 A;  4N9F 4;  1GJZ A;  3ZKJ C;  2VH1 A;  1FD6 A;  1ROE A;  3RCZ A;  1LGR A;  3NVZ A;  1M94 A;  3LB8 C;  1E90 A;  2PKO A;  2W82 A;  3R3M A;  4ZRJ A;  3RT3 B;  2L0F A;  3U7D A;  2MBH A;  1QT9 A;  2QSD A;  2V3P A;  1MFW A;  2WHI A;  3KH0 A;  1JWA D;  2KN4 A;  2WU2 B;  3DHI C;  1KH0 A;  1SE4 A;  4EFO A;  2LFI A;  3K9O B;  1HA5 A;  3ZDM C;  1JWS D;  1MI0 A;  4YTP B;  2A4Z A;  5IOI A;  1WGG A;  1E8X A;  4GB9 A;  5IO9 A;  2ZPY A;  3AEB B;  3W5U B;  3EC8 A;  1XLQ A;  3JSV A;  4NNJ B;  3Q3M C;  1V86 A;  2L7R A;  3P1M A;  4PK1 A;  4IM3 A;  4NJC A;  2BW2 A;  3AED B;  4US9 A;  2I38 A;  4M02 A;  4B6W A;  3MHS D;  2K5P A;  1NVI D;  4M0W B;  2N9E B;  4W9E A;  2WGS A;  2XK5 B;  4KSK C;  2MBB B;  1UNS A;  4BOS C;  1FMA D;  4MDK E;  4RNA A;  2KJ6 A;  3E56 A;  4NAW B;  4FBJ B;  4C00 A;  1T3Q A;  1YJJ A;  2JUO A;  2VZK D;  4HEA 1;  4KDL B;  3RNF C;  1L6V A;  3L54 A;  4WQO B;  2WDR B;  4DDG D;  1NI2 A;  3W1S A;  2NBW B;  2GB1 A;  3VR9 B;  1EUV B;  3A33 B;  4URK A;  4E74 A;  1IP9 A;  1TZ1 A;  1SF0 A;  3OLM D;  2RDG A;  3EEC A;  4LDT D;  3AU5 A;  1DGJ A;  3QIJ A;  3ML9 A;  3FAH A;  1FEH A;  4JE3 B;  4LJP B;  3PV1 A;  1OQQ A;  4HKZ E;  4D2K A;  3IAM 1;  2QIL A;  2IZV B;  2IY1 B;  2L83 A;  2BBC A;  1SIJ A;  2ZPN A;  3R8B A;  2DYO A;  2BT6 A;  2PLP A;  2N7J A;  2ICI A;  2JRI B;  3QWZ B;  4AP4 C;  5LLI A;  1T0R C;  2AQ3 B;  2IO0 B;  4A8X C;  2DYB A;  1CZP A;  4FHK A;  4EOY A;  3PS6 A;  2KYW A;  1MHH E;  4JGH B;  1K8R B;  3BIN A;  1V8C A;  1OQR A;  2C5L C;  2LVQ A;  4MSQ B;  2OJW A;  1QIL A;  3V60 A;  1PQS A;  2H89 B;  1FXT B;  3W1S C;  2SEB D;  3DWG C;  3QC8 B;  4II3 B;  1JRO A;  4KGR A;  4MH0 E;  3RNG C;  4BKT A;  1P98 A;  1SE9 A;  1HZ5 A;  1ZP0 B;  2HDE A;  4IWO A;  1DYQ A;  4HK2 A;  5IAA C;  3PGE A;  3A9K B;  2FBW B;  1Q0W B;  1C4A A;  1RYJ A;  3AB5 A;  1E8W A;  3JSV B;  3JW0 X;  3APF A;  1U4A A;  4IG7 B;  4W9I A;  4MM3 B;  4KZC A;  1BUI C;  1WWT A;  1ACC A;  3ZLZ A;  3URY A;  3HVD A;  1KLU D;  1LO5 D;  1K51 A;  2DZK A;  4G0N B;  1HE8 A;  1DOX A;  4AS1 A;  1RFK A;  4O1N A;  4F8C B;  1MPE A;  1WGD A;  1GB4 A;  3SFE B;  4MT5 A;  1A70 A;  3VUW A;  3A1Q A;  4FA6 A;  1SE3 A;  4X57 B;  1VDV A;  4NAM A;  1FFU A;  4L23 A;  2WLB A;  1PFD A;  2JF5 A;  2WXF A;  3VRB B;  4NQK E;  1WX9 A;  3ZNH B;  4W9F A;  3Q3J A;  1S3S G;  1QZE A;  2CJO A;  3QJZ A;  3AE4 B;  2K8B A;  1V6E A;  4ARC A;  3JYU A;  1N63 A;  4QAY A;  2QMT A;  2GBR A;  2V9H A;  1KRH A;  3FKY A;  2GMI C;  2JVC A;  2G9H D;  4MGZ E;  1ISN A;  1F2R C;  2OHF A;  4N58 A;  3UQA A;  5CHF A;  5D7G A;  2PE6 B;  2ZW1 A;  4KIK B;  1RLF A;  2IGG A;  3ENE A;  1VLB A;  2GBK A;  1PGA A;  2C7H A;  2XEW A;  1OTR B;  3RFZ B;  2RSU A;  2JPH A;  2K39 A;  3ZTD A;  4II2 B;  3EFC A;  1JAL A;  1WFY A;  2EMS A;  1WXV A;  4P16 A;  2LMC A;  3AN1 A;  2K8C A;  3M3J A;  3NRZ A;  4LNK A;  2K25 A;  3WAO A;  3TUO A;  4WJQ A;  2DAJ A;  2K0P A;  1XT9 B;  1WH3 A;  3VTW A;  5BYQ A;  3IVF A;  2G45 B;  1HTO A;  3B9J A;  2YLM A;  3AE7 B;  3N32 A;  4BVU C;  2Y3A A;  3I5J C;  4HLE A;  2NBU A;  5FR3 A;  3AEC B;  1MHX A;  4FN2 A;  3TBL D;  2KN5 A;  1ZDV A;  1YN5 A;  1BML C;  2MH7 A;  5KHO A;  3PZD A;  2J53 A;  3ZJT A;  4AOF A;  1GC7 A;  3ECI A;  4ANV A;  3WCQ A;  1L7Y A;  3RD2 A;  4HRS A;  4HRO A;  3PRE A;  1HZ6 A;  2M0A A;  3SU8 X;  4NAW A;  3Q69 A;  1Q5W B;  2KKC A;  1Z2M A;  2MRP A;  3KQ4 A;  2KLC A;  1STE A;  4WJP A;  2E6X A;  3BYY B;  1A5R A;  1LM8 B;  1TS4 A;  1WX7 A;  4DQO C;  4K1R B;  4S17 A;  3H1U A;  1N6Z A;  2DZI A;  4W9D A;  2N7D A;  5BMH A;  1UF0 A;  2WXH A;  1L0Y B;  3T8M A;  3QA8 A;  3TMP B;  4A9A A;  1V81 A;  2G1E A;  5G5H A;  2LRW A;  3Q8F A;  5LNK 1;  2J52 A;  2JZZ A;  3PVL A;  4I6L B;  2MLB A;  2GBN A;  4RGN A;  4ZDV A;  5JHB A;  1TIF A;  2CHZ A;  1WE6 A;  3WIM A;  5BMG A;  1K53 A;  2H88 B;  3WAL A;  3TL5 A;  1CJE A;  5TSS A;  3H9D A;  2PE9 A;  2MWS B;  3V62 A;  1L0V B;  4M0W A;  1Y8R C;  1GG3 A;  5G55 A;  3L13 A;  2JRH A;  4MGI E;  4P7I A;  5L83 A;  1TS5 A;  4IM0 A;  3DVN U;  1AN8 A;  3SEB A;  3ZW3 A;  2RMM A;  1PGX A;  3A9J A;  1N62 A;  2GOW A;  4N59 A;  2KJH B;  4RF0 A;  1T5X D;  2WDQ B;  1WMH A;  3RNE C;  2LXC A;  4MJS A;  3IHP C;  2BTE A;  2C9W B;  1M4V A;  5TR5 A;  3VQI A;  2O2V B;  1YQ3 B;  2RD0 A;  2BS2 B;  3B08 A;  2MHJ A;  2C60 A;  5EDS A;  3OAW A;  3AE6 B;  1J8C A;  3NVW A;  3W9C B;  1VZ7 A;  2WXM A;  4XC2 A;  1TY0 A;  2HJ1 A;  2MCN B;  4GU2 A;  4LCD E;  3N9Y C;  3V3X A;  3BY4 B;  2KC2 A;  4BBN C;  2KVR A;  5GMV A;  3ZXV A;  1WJU A;  3RI7 C;  2IJ0 A;  2LVO A;  1FNU A;  1GNU A;  5KHQ A;  2GBM A;  2KOX A;  4KIK A;  2WXN A;  4HJK A;  5JXV A;  2N9K A;  4IUM B;  3CST A;  1YD8 U;  1V49 A;  1ENF A;  2RDB C;  2M0X A;  3PRM B;  1FPY A;  5G2N A;  3NVY A;  1VJK A;  3GZN B;  2D3A A;  3NHE B;  2JU6 X;  1SSN A;  4IWQ A;  2O2V A;  2WNM A;  1KLV A;  2BKR B;  1Y56 A;  3DBL B;  4BKS D;  3HRD D;  1Z5S B;  1WJ4 A;  4MSM B;  3BVM A;  3DVN V;  4W9J A;  4ZRP A;  4RM9 A;  2DYM A;  2TSS A;  2E3T A;  3PTF C;  4GMV A;  1SGH A;  4KX6 B;  2CR5 A;  3KW5 B;  2V0G A;  4HCP B;  4LTU A;  5AUI A;  5AEK B;  3RZF A;  1QOB A;  1R4M I;  2FCS A;  5HG2 A;  2KTR B;  4A3O A;  4B0M A;  1IBX A;  3DBR I;  2M1M A;  2Y5P A;  4M8M A;  3R66 C;  5JZE B;  4FJV B;  3AE2 B;  3B1L X;  3B0A A;  3EUB 2;  2JYE A;  4JIO U;  4A3P A;  2IGD A;  2WS3 B;  1MG8 A;  4OZA A;  1ZE3 D;  1WZ0 A;  1E5W A;  4WIP A;  4REZ A;  1JRU A;  2LD9 A;  1SEB D;  4USA A;  4DHJ D;  3R7R A;  1WZ3 A;  5D3I B;  5LXH A;  2KHW B;  2IO1 B;  2RR9 A;  1NEK B;  2D5G A;  2O6V A;  4AWJ A;  5CTR C;  2Y5B B;  3AE9 B;  1G6J A;  3N1Y C;  1I7H A;  1LQB A;  3R2T A;  1EWY C;  5C1Z A;  3GE3 C;  3TEZ A;  2KD0 A;  2B76 B;  2PTL A;  3IT4 B;  4XE0 A;  3QAR A;  1YQ4 B;  4TSS A;  2V1Y A;  3NZ3 A;  1P0R A;  2WX1 A;  4RH6 A;  3X23 A;  1F2R I;  2KWC A;  1L5P A;  2MJE A;  1KFY B;  4C4V B;  2VRR B;  3AEG B;  3TSS A;  3B2F A;  4FHJ A;  3ZNG C;  2HE7 A;  2C7N B;  5BYS A;  3N30 A;  1NYR A;  2K8H A;  5L95 C;  2CU3 A;  1C9F A;  2LEK A;  3L4P A;  1WE7 A;  4KKJ A;  1J7C A;  2LGY A;  4JQW C;  3MJ5 A;  4KSL C;  1KM7 A;  2KTF A;  2K6D B;  5J17 A;  2EKE C;  4W9G A;  2MBO A;  1WJ6 A;  5C2T B;  3TJP A;  1FFV A;  2V3S A;  1TGZ B;  4WWN A;  4LNI A;  1D4B A;  1D5Z C;  4MM3 A;  2BWF A;  1MJD A;  4S0R A;  2ZW0 A;  3DBH B;  4B0E A;  4A55 A;  3W5V B;  3FC4 A;  4Q2J A;  1WM2 A;  2J42 A;  5EE0 A;  1VD2 A;  2DEN B;  3BK1 A;  2KJR A;  1E8Y A;  4AQ7 A;  1D5X C;  4HDQ A;  2NTT A;  1OQY A;  1C77 A;  1GAQ B;  1R4N I;  2DHZ A;  1F77 A;  4KGS A;  4FXC A;  3KWL A;  4BZA A;  2KDB A;  4AUQ C;  3VXW A;  1TJE A;  1NEN B;  4NJ7 A;  1L4D B;  1VRA B;  2WXI A;  3Q8A A;  1FO4 A;  1GC6 A;  3KLS X;  4BAX A;  2KC1 A;  4YTN B;  2KDF B;  1WF9 A;  2WQY B;  1IGC A;  5HI1 A;  3H7P A;  1RM6 C;  3AUL A;  3ZNI D;  3PRP B;  4WJO A;  2JZP A;  3AE1 B;  4ANU A;  3I3T B;  1C4P A;  1EM7 A;  2BQQ A;  2WXR A;  2LI5 A;  3C0R B;  3PLU A;  4PS3 A;  1AWD A;  4JWU C;  2IO2 B;  1ET9 A;  1SIF A;  3VUX A;  4PS8 A;  1V80 A;  4FLH A;  1E7P B;  3DBS A;  4HJG E;  2W9N A;  3FIL B;  3GS2 A;  2NCN A;  4WJN A;  2LGS A;  2LXA A;  3MHZ A;  3PZ8 A;  3N1X C;  1I4X A;  2IPK D;  4YSX B;  3Q3N C;  5IN7 A;  3EGR A;  3DOW A;  1L6U A;  3PZ7 A;  3HM3 A;  1R7S A;  3OG5 A;  3P4R B;  1N60 A;  2K1F A;  1WXA A;  4E3C A;  2L0T A;  2LGX A;  3ETR A;  3Q14 C;  3UIO B;  1XLP A;  1UBI A;  5D94 A;  3V6E B;  2WXP A; 
#chains in the Genus database with same CATH homology
 2AQ1 B;  4KGT A;  1JW9 D;  5D3D A;  4HRS A;  4HRO A;  3AM9 A;  1GPX A;  3AEA B;  3AE8 B;  1HZ6 A;  2M0A A;  5I4D A;  2KWD A;  2JSV X;  1L0X B;  3IAS 1;  1I4P A;  2KAJ A;  2PVG C;  1EU3 A;  4WUR A;  2BB5 A;  3Q69 A;  4DXG A;  1N5W A;  1FIQ A;  1JWB D;  1PUT A;  1HXY D;  1WRI A;  3KQ4 A;  1FCL A;  3CIR B;  2JXT A;  2FUG 1;  2V3N A;  2L1A A;  2W55 A;  4ZOH C;  1STE A;  1J7A A;  2E6X A;  5GXG B;  1JWM D;  1T6B X;  1C78 A;  3BYY B;  2ONQ A;  3MFG A;  1TS4 A;  2WXL A;  1I4H A;  1SXT A;  4DQO C;  3ZJV A;  1ZOY B;  2PMV A;  1V97 A;  5H8Y E;  1JRP A;  4LK0 M;  5BMH A;  4A6Q A;  4YWG G;  3MC0 B;  1YJI A;  2K9X A;  4YT0 B;  2GRI A;  4C7Z A;  2LGI A;  2WXH A;  1E9M A;  1L0Y B;  4WAF A;  3O13 A;  4TMA B;  5EE3 A;  2WXQ A;  2NTS A;  4A9A A;  1ZDX A;  4RGO S;  4US8 A;  2G1E A;  5G5H A;  1QOG A;  4WQM A;  3Q8F A;  5LNK 1;  2J52 A;  3I57 A;  1XCT L;  3ABV B;  2N9L A;  3FIL A;  4RGN A;  1VR9 A;  1FRR A;  3GP7 A;  1XXG A;  3VRA B;  3U4E G;  3CWI A;  2KAC A;  2YEP B;  5BMG A;  1K53 A;  2H88 B;  1XLO A;  2ON8 A;  1KLG D;  1CJE A;  1N61 A;  5TSS A;  3P4S B;  1UGJ A;  1WXQ A;  2LUM A;  2QJL A;  1L0V B;  4GLS C;  4M0W A;  2BYT A;  3BYT B;  3V05 A;  1FD6 A;  1ROE A;  3NVZ A;  3TEW A;  4JPS A;  3TEY A;  1TS5 A;  2ACZ B;  3LB8 C;  4EE2 A;  2MEK A;  1AN8 A;  1XO3 A;  4ZRQ A;  2PKO A;  1D5M C;  3SEB A;  1ZPS A;  3P42 A;  2W82 A;  2RMM A;  5HHD G;  1PGX A;  3U7Z A;  1N62 A;  5E6J A;  1NYQ A;  1TKY A;  2W54 A;  1N5X A;  2Z8L A;  4N59 A;  2QSD A;  1QT9 A;  1XLN A;  2V3P A;  2WXG A;  4RF0 A;  1T5X D;  2WDQ B;  4OHJ A;  2QEJ C;  1JWA D;  2KN4 A;  2WU2 B;  1KH0 A;  1SE4 A;  2LFI A;  2BTE A;  3VR8 B;  1HA5 A;  1JWS D;  1MI0 A;  1CK1 A;  4YTP B;  3J9C A;  2RPV A;  1M4V A;  2FE8 A;  3VQI A;  4C80 A;  1TKE A;  1YQ3 B;  2BS2 B;  3AEB B;  3W5U B;  1ESF A;  2W3S A;  1XLQ A;  2MJD A;  1GB1 A;  3AE6 B;  3P1M A;  2BS4 B;  4NJC A;  3NVW A;  3W9C B;  2BW2 A;  3AED B;  1VZ7 A;  2WXM A;  4US9 A;  2I38 A;  1JML A;  1TY0 A;  4YSZ B;  1FXI A;  1NI3 A;  2K5P A;  4A90 A;  4OW0 A;  1NVI D;  3N9Y C;  3Q8B A;  3V3X A;  1QQR A;  4ZHO A;  3C8Y A;  1UNS A;  3B2G A;  1FMA D;  4HKQ A;  2IJ0 A;  1P7E A;  1WYG A;  4RNA A;  1FNU A;  1EWC A;  3E56 A;  4NAW B;  2CJN A;  1HEZ E;  1T3Q A;  4R3D A;  1YJJ A;  1B1Z A;  2VZK D;  3AE3 B;  2WXN A;  5JXV A;  4HEA 1;  2N9K A;  4MH8 A;  2WXP A;  4ZHP A;  2HTM E;  1RWS A;  1L6V A;  2K3U A;  1TKG A;  2XNA C;  2YEP F;  1ENF A;  2WDR B;  2JX5 A;  3W1S A;  2GB1 A;  3VR9 B;  1WGK A;  2IGH A;  3NVY A;  1VJK A;  1FRD A;  4P6V F;  1TY2 A;  1SF0 A;  2JU6 X;  2RDG A;  1SSN A;  1DOY A;  1DGJ A;  3FAH A;  1FEH A;  1FNV A;  2WNM A;  4JE3 B;  1Y56 A;  2INP E;  1WSP A;  4YSY B;  2LHE A;  1OQQ A;  3HRD D;  4L2Y A;  4HKZ E;  4D2K A;  3IAM 1;  2QIL A;  2L83 A;  3BVM A;  2BBC A;  1SIJ A;  4ZRP A;  1GOZ A;  3SR6 A;  2DYM A;  2TSS A;  5BYR A;  3ZGZ A;  2E3T A;  3R8B A;  2DYO A;  2WXK A;  3Q8E A;  2L52 A;  1QKZ A;  2BT6 A;  1E10 A;  2PLP A;  2N7J A;  1XEE A;  4DXF A;  2ICI A;  3AEF B;  4PT5 A;  4JX1 C;  2DBY A;  2QIE B;  4KX6 B;  5MPO A;  2AQ3 B;  3AEE B;  2V0G A;  4LTU A;  3AMZ A;  5AUI A;  4A8X C;  1QOB A;  1CZP A;  3SFD B;  1JQ4 A;  1YN4 A;  2VZK B;  4C56 C;  1MHH E;  3BVG A;  5HG2 A;  2JWU A;  1V8C A;  1ZUD 2;  1OQR A;  4B0M A;  4CQN A;  4L1B A;  1IBX A;  2Y5P A;  2R61 A;  1QIL A;  1QOA A;  2WP9 B;  2H89 B;  2KMM A;  1JWU D;  3AE2 B;  3BWU D;  4ITK A;  1QOF A;  2PVO D;  2SEB D;  3EUB 2;  2JYE A;  4J3O D;  1SBB B;  2IGD A;  3DWG C;  1AW7 A;  2WS3 B;  3ZYY X;  1DOI A;  1ZE3 D;  4OZA A;  1JRO A;  1SJE D;  3T3N A;  4KGR A;  4XWT A;  5HFY A;  1PGB A;  3E9S A;  4WIP A;  5BMI A;  4REZ A;  2WXO A;  4NZL B;  1SEB D;  1HZ5 A;  1ZP0 B;  4USA A;  1QF6 A;  2HDE A;  5D3I B;  1DYQ A;  4KKI A;  1FXA A;  2EKI A;  1TZO A;  1UWM A;  1ZXH A;  3TEX A;  1JCK B;  2FBW B;  4RCO A;  3LXF A;  1C4A A;  3NS1 A;  4TQ0 A;  1RYJ A;  3AB5 A;  5EE1 A;  1Q10 A;  1NEK B;  2GI9 A;  2D5G A;  2MJ3 A;  4LLG M;  4UDU C;  1EU4 A;  4RGM A;  4MM3 B;  1PYW D;  1BUI C;  3HUI A;  1WWT A;  4XDD A;  2INN E;  4OVZ A;  2LJI A;  5C3J B;  1YNT E;  1ACC A;  1OFF A;  2X38 A;  3AE9 B;  3R2I A;  2W3R A;  3ZJU A;  1I7H A;  3H8H A;  3R2T A;  1EWY C;  3URY A;  3HVD A;  3TEZ A;  4OZB A;  1ET6 A;  2B76 B;  2PTL A;  1KLU D;  3IT4 B;  1VZ6 A;  1LO5 D;  4XE0 A;  1B9R A;  1YQ4 B;  4IOI E;  4TSS A;  1K51 A;  1F0Z A;  3NZ3 A;  1IBX B;  2IDY A;  1C4C A;  2EEL A;  4RH6 A;  3EA6 A;  1F2R I;  1VZ8 A;  3RPF C;  4AS1 A;  1DOX A;  1RFK A;  1L5P A;  3P4P B;  1I4Q A;  4O1N A;  1MPE A;  5H92 C;  1GB4 A;  2MJE A;  3P4Q B;  3SFE B;  1KFY B;  1V1P B;  4MT5 A;  3BK2 A;  1A70 A;  1XF5 L;  3IT6 B;  1YMH E;  1SE3 A;  2L32 A;  3AEG B;  1V1P A;  3AV8 A;  4GDL B;  3B2F A;  3TSS A;  1L4Z B;  1VDV A;  5BYS A;  4NAM A;  1NYR A;  2CU3 A;  2BS3 B;  1FFU A;  2LEK A;  1C9F A;  2WXJ A;  3L4P A;  3OWE B;  4L23 A;  2WLB A;  4KKJ A;  1PFD A;  2K22 A;  1J7C A;  2WXF A;  2M19 A;  1C79 A;  3VRB B;  3MJ5 A;  1KTK A;  2Q5W D;  2BB6 A;  1E6E B;  3P63 A;  5C2T B;  2CJO A;  3AE4 B;  1FFV A;  1K52 A;  5G5G A;  1IUE A;  1D4B A;  3IXS A;  1D5Z C;  2J4X A;  4ARC A;  2ZW0 A;  5AUK A;  4B0E A;  1N63 A;  4A55 A;  3W5V B;  4XWW A;  3FC4 A;  1BXT A;  2QMT A;  4Q2J A;  2J42 A;  5EE0 A;  2I2Y A;  3BK1 A;  1KRH A;  4GDK B;  4ZYS A;  2N0S B;  4AQ7 A;  1KF6 B;  1D5X C;  2G9H D;  4YTM B;  1K50 A;  1TS2 A;  1UUP A;  2NTT A;  1F2R C;  3BZD B;  1C77 A;  1GAQ B;  2OHF A;  1F77 A;  4N58 A;  4KGS A;  4FXC A;  3KWL A;  1TS3 A;  1TJE A;  1NEN B;  2DLB A;  2NMQ A;  5D7G A;  1XCQ L;  2ZW1 A;  3BII D;  3MP9 A;  1L4D B;  1VRA B;  2WXI A;  4RF1 A;  3Q8A A;  1SE2 A;  1FO4 A;  1V1O A;  4IKG A;  1YN3 A;  3KLS X;  3GB1 A;  4WH4 A;  1SB3 C;  4JWS C;  2IGG A;  4YTN B;  3PO0 A;  1VLB A;  1I4G A;  1PGA A;  2WQY B;  3RFZ B;  1IGC A;  2SAK A;  3UI3 A;  5HI1 A;  1RM6 C;  2WDV B;  2KDM A;  1C76 A;  3AE5 B;  1TYG B;  3U52 E;  2JZP A;  3AE1 B;  1JAL A;  1C4P A;  1EM7 A;  2JQR B;  2WXR A;  3BVZ A;  4P16 A;  4TQ1 A;  2M56 B;  2LMC A;  3AN1 A;  4H2A A;  2AQ2 B;  2KQ4 X;  2DWQ A;  1AWD A;  1IGD A;  1QLB B;  3NUH B;  3NVV A;  4JWU C;  1ET9 A;  1AYF A;  1E0Z A;  4RGT A;  3NRZ A;  2V4I B;  3TUO A;  2K0P A;  1E7P B;  3Q8C A;  4HJG E;  4XDC A;  5BYQ A;  2AX5 A;  3KWV A;  3I9V 1;  3B9J A;  3FIL B;  3GS2 A;  5T8I A;  1I4R A;  2LHD A;  3AE7 B;  2PIA A;  3MHZ A;  1J7B A;  3PZ8 A;  2JYT A;  1I4X A;  4C7Y A;  3HVZ A;  2Y3A A;  3W2D A;  2IPK D;  2PW9 A;  3U2S C;  3LYY A;  4YSX B;  5FR3 A;  3AEC B;  1MHX A;  5FKA C;  3EGR A;  4IDI A;  4RFB A;  1L6U A;  3PZ7 A;  5FK9 C;  4ARI A;  4N6E B;  4WWM A;  4YXD B;  1R7S A;  1ZDV A;  2Y5C A;  2OED A;  1PDX A;  3P4R B;  1FCC C;  1N60 A;  1YN5 A;  1BML C;  1FM0 D;  2MH7 A;  3AH7 A;  2WU5 B;  1MVK A;  3ZQ4 A;  3T3O A;  4OZC A;  1HQR D;  1CQV A;  1ZXI A;  2J53 A;  2RDH A;  3ZJT A;  3ETR A;  1XLP A;  4MAC A;  2XN9 C;  5EE9 A;  3WCQ A;  3DWM A;  1D6E C;  1UWX A;  1P7F A;  1SJH D;  1FNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...