4O1NA

Crystal structure of staphylococcal superantigen-like protein saouhsc_00383
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
SESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal superantigen-like protein SAOUHSC_00383
rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
molecule keywords Superantigen-like protein
total genus 52
structure length 189
sequence length 189
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4o1nA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4o1nA01
3BVGA 1I4PA 1I4RA 1PZKD 3CHBD 1MD2D 1T5XD 1JQYD 1FNVA 5D3DA 3MFGA 5D3IB 1HA5A 1LTSD 1RCVD 3R2IA 1HQRD 3BYTB 3BVMA 5I4DA 1UNSA 1DYQA 1SJED 1ET9A 1LTRD 1BCPD 1PRTB 1LT6D 4DXFA 1CHQD 1XXGA 1PTOD 1BCPC 2AQ3B 4K6LA 1D6EC 1D5MC 1I4XA 1SE4A 2NTSA 1DJRD 2AQ1B 1S5FD 2IJ0A 3KLSX 2SEBD 1LTBD 4RFBA 1TS3A 5ELDA 1EU4A 4O1NA 3TSSA 1XTCD 5ELEA 2XRSD 1KLUD 1LTTD 1RF2D 3DWPA 1YN4A 1RD9D 1LTAD 4L6TB 3URYA 1G8ZD 2Z8LA 5FK9C 1LTID 2WV6D 2O2LD 4RHSA 1TS4A 1D5XC 3OWEB 4RGTA 1EU3A 1LTGD 1JWUD 4C56C 1YN5A 4UDUC 1ESFA 1YN3A 1SXTA 1PTOC 2ICIA 2AQ2B 1SE2A 3MC0B 1S5BD 1BCPF 2QEJC 4OHJA 1PZJD 1LT5D 1TS2A 1SBBB 4DXGA 1AW7A 4L63B 1HXYD 2J4XA 2G9HD 1BCPB 1AN8A 1S5ED 5FKAC 1I4GA 1V1OA 5TSSA 1D5ZC 4Z9CB 1EEFD 1JWMD 3R8BA 1ENFA 1HTLD 4RHRA 5ELCA 1KLGD 3EFXD 1LLRD 3DWQA 2R61A 3EA6A 2CHBD 1PRTC 1FNWA 1PTOF 2QILA 1L0XB 3BVZA 1CT1D 4RCOA 1QILA 1I4HA 1L0YB 1RDPD 4NZLB 1PYWD 1BXTA 1EWCA 3BZDB 4RGNA 1F77A 2NTTA 2XRQD 1B1ZA 1TS5A 1PRTD 1CK1A 3O13A 1EEID 1JR0D 1S5CD 1LT3D 1I4QA 4BWGB 1B44D 2XN9C 1SJHD 2IPKD 3SEBA 1FNUA 4TSSA 1PZID 1V1PB 1TY0A 2RDGA 1M4VA 1LT4D 1PTOB 2RDHA 1EFID 3DWAA 1LO5D 1JCKB 1V1PA 1PRTF 3BYYB 1ET6A 1S5DD 1STEA 1CQVA 1GOZA 2TSSA 5ELFA 3GP7A 1SE3A 1TY2A 3V05A 1SEBD 3R2TA 4RH6A 1JWSD 4RGMA 5ELBA 1FD7D 1FGBD 4RGOS 1UUPA 4ZYSA 1PTOH 2XNAC 1KTKA 3W2DA 1CHPD
chains in the Genus database with same CATH superfamily
4K14A 2VZAA 1T5EA 1HPCA 4QCLA 5EE1A 2MHJA 1FYCA 1F52A 2BT6A 1Q1BA 4X62L 5FR3A 3TDQA 4R4IA 2BCOA 3T1HL 1E8XA 4A3OA 2Y0SE 2KDFB 2A1AA 2LXKA 4KHPL 3UI3A 3DBHB 1HUMA 1N34L 3VR9B 4OWWB 2BKFA 3BJUA 2HD3A 2F0LA 2Z59B 3DWMA 3EECA 2PMVA 4G11A 5CYUA 5H92C 3SK4A 4WFN3 5E1FA 1J7CA 3PZ8A 4P7IA 4G7ZC 5FR6A 2K5WA 4DHZE 1GUSA 4EQ5A 4RKLA 1H9KA 2F1MA 5IP7H 1GHKA 4LJOB 3K7AB 4JV5Q 4AIMA 4W9DA 2MX2A 2IY5B 4PYZA 2AL6A 1L2NA 5IT9L 1RF2D 3M3YH 2PCFB 2SNSA 5EKIA 2KHJA 4P74A 1MIUA 4AQYL 4GKKQ 4WJPA 2BDNA 1F9PA 2R7ZG 1MFWA 3B0AA 2A73B 5FLXc 2BKRB 2E76C 4JI7Q 4LAAA 3Q23A 1ZP0B 2KHWB 1N6ZA 2WXPA 2O2VA 1DOYA 2CU3A 1ZDXA 3U4EG 3VTUA 4AQ7A 4GLVB 4LF6Q 5AUKA 1RLFA 1JT8A 1W6JA 1IL2A 5IYCG 1TZ1A 3C0RB 4NAWA 3BDOA 1FJGQ 5I9PA 4OO1G 4GZYC 2ZJDA 2M4NA 4KDIC 5IO9A 1WVLA 4HJ7A 1CZPA 2KMAA 3HVZA 3E9IA 4H44C 3VA5A 2WP8J 2J0MA 4IWOA 5BO4B 1S5ED 2R7DA 3VR2A 4GNXC 3D4DA 4K8JA 5EQ0A 1UE6A 1UD7A 2KJRA 3GTOB 3E9SA 3P42A 2KC1A 1VF5C 1ENFA 2J52A 4MH8A 3CP0A 2EJMA 2DZIA 4XDDA 2OJWA 3T16A 1LYLA 1C8CA 2LVPA 2EY6A 3KDFB 2B8GA 1CMXB 5IP7G 2VQFQ 1QCBD 3D6WA 4HEDA 3I56A 4HIDA 1N32Q 3TIXA 4BOZB 3GO5A 2EVBA 3OJ4B 4JK1C 2GBNA 3GS2A 1R4MI 5EKKA 1X1MA 3N9YC 5JVH3 4JV5L 2R93G 2I07B 2SNMA 1FFUA 3K5LA 4DR5Q 1N36Q 4BBNF 4DK3C 4L1BA 3SEBA 2CKHB 4EQNA 2YV5A 1EQTA 2Q2UA 4IPHA 4XT3B 2L52A 1WX8A 1XO3A 1SNDA 4NAMA 1VJKA 2HT1A 1B7YB 5DEHA 2OTJA 1EUJA 5G3LF 2LGXA 5M9OA 1QB5D 2JQOA 3Q69A 3P4SB 2Z4HA 3R93A 3J80c 3EC8A 1L0VB 2WB1B 1K8MA 2YU9B 1MVKA 4DR4L 4BKTA 1UELA 3TMPB 3Q8DA 1JW9D 5ELBA 4KGSA 2MO1A 1RTNA 1N33Q 5FLMG 4IOCA 2FCMA 1U5KA 4RGOS 2UXCL 2DNEA 4IFDH 1SYFA 4C4VA 3W2DA 3AU4A 1KRSA 3BVGA 2QCPX 2GI9A 3ULPA 2ALYB 2HCIA 3P1HA 1NI2A 4DAVA 4ANWA 1XPRA 5E6OA 1TGZB 2EYMA 3SK8A 4ALPA 3TEYA 2DY7A 3MC8A 1U4LA 2QC8A 1JJGA 2FCNA 1HZ9A 2ZTEA 3BDLA 3MAQA 1X3FA 2PMZB 2K5DA 3J80i 1SJED 3H94A 3VQIA 4XQNA 1P0RA 5JEAH 5T1IA 4X3UA 3NUHB 4A93G 3UIOB 1UZXB 1ZYRD 3CKIB 5GADC 1KH0A 1CHQD 3AEAB 5GAGC 4W9IA 3KWLA 5C4ZA 2OEOA 2UXBL 3DXJC 4BBSB 4BZAA 3PV1A 3KYDD 4HAEA 4IC7B 2BH2A 3EHVA 3PLVA 2BBCA 4Q2JA 3IAYA 2ZW0A 4JI4L 4EEWA 4DR6Q 2C7MB 2B2WA 2J42A 1BDOA 3QO2A 3OIQA 2ZJRA 4HIKA 2A6EC 3F2CA 2K14A 4KY7A 3MWYW 1G8ZD 2Z8LA 4TKOB 2LFIA 2KJXA 2WV6D 3LXFA 4YWLA 3NY5A 4JIOU 3FP9A 4NJ6A 1WJ6A 1I6HH 3OHXC 3OWEB 2JXXA 4XYQA 4C1NK 3QJZA 5HKHA 2KDEB 2KMCA 1EWHA 2K33A 4KTAA 4UDUC 2KTFA 3ZGZA 2CFMA 1MJEA 3MC0B 3UGBB 2WYQA 5JPNC 1WH3A 3K9OB 1P98A 4DR1L 1SF0A 2JQRB 2JZ3B 3H1UA 4B0EA 3HKZE 1SR3A 4BKSD 2F0KA 2KUMA 3NQTA 3W5UB 2RBMA 1E7ZA 1L1OC 2G9HD 3CCSA 1QOBA 4GLSC 2UWQA 3Q8FA 1AN8A 4RM9A 5HURA 1PDQA 2LSSA 4C3JB 2L00B 5LMNL 3UF8A 3A54A 4RWSC 2WXKA 5D65A 3TP8A 5KYIA 1VS0A 2M2LA 1VQ8A 1LGRA 3R7QA 5M3FG 1AZPA 1TWHH 1C78A 3U4ZA 2ZZPB 4WJNA 5LXIB 1QOAA 1IBKQ 1FGUA 2LVQA 4XE0A 1H9RA 1I4HA 1XWEA 4BY7G 1WX9A 1WD1A 4OIKA 3HOYB 3PREA 5EPLA 2R92G 3HOUH 2K3UA 4ZUIA 4XC2A 5E3FA 4GDKB 3MXGA 3FC4A 2K5QA 4WJWA 1STAA 5JZEB 1ZE3D 2FAZA 2G9DA 3VUWA 1DONA 2XN9C 2EMSA 1FCCC 4L2YA 1WWTA 1PZID 4ANXA 3AEGB 2NVYH 3H3VC 1V80A 2FCQA 4REZA 3C1EA 4PZ8A 4AYBG 3TP5A 3GZNB 4HWIB 1JRPA 1V1PA 1VQ5A 3IXSA 3MJ5A 1P8LA 3CPFA 4DK1A 1AEXA 1X3PA 2MPMA 3FILA 1LM8B 1YJ9A 4EX5A 3DBRI 4UP9A 4IPDA 3APDA 4G4KA 3E9HA 3KF8B 4P75A 2IBIB 3B08A 4OEMB 1JWSD 3HHMA 2EXDA 2WXGA 1TT2A 2K1BA 1J5EQ 2KNBA 4LDTD 2KN5A 2PO4A 2NPTA 3JAME 5CV7A 2DN8A 2W54A 2PIAA 3VR4A 2QHOA 4TMAB 4ZYSA 5C4HA 1F2MA 4LF8L 4EQPA 1XMQL 1G291 1YIWA 2QIEB 3KVFB 2ZM6L 1WX7A 1MD2D 4O42A 5L37A 1T5XD 2VXWA 1ZKHA 3OG5A 2PYKA 4IUTA 3S2DB 3KW5B 3OJ3A 1WFYA 1QJOA 1S4ZA 2R92H 2JA6H 1XLQA 3R2IA 3E6ZX 2BS2B 5E6JA 2W55A 1VQHA 1I6HB 2L11A 3PHWB 5L83A 2NN6I 2F3WA 2PI2A 4DAPA 1WJNA 1UE1A 2E5LQ 2A5UA 2INNE 3GE3C 1NE3A 2UUAQ 5M5YB 4FLHA 4AJYB 3MVVA 3TEXA 3ZLZA 2JVCA 1AE3A 2ID0A 5FO7B 1WGYA 2ZVOA 5I2XA 2Z4IA 4L5QA 1SE4A 2D0PA 3FRPB 2WHIA 1HNXQ 1WTHA 3HOVG 2I1KA 3UI2A 3MXPA 5LNK1 2SEBD 3PRPB 5DPTA 3PO3H 5CORA 4IOAA 4PZ6A 1E7UA 2D07B 1D3ZA 2E2IH 1IYVA 1YN4A 5J18A 1VRAB 3HFZB 4ZRIA 2BA0A 3GTGB 3M4PA 2RR9A 2PVOD 3NVVA 2KA7A 1IGDA 3RCZA 3V6CB 3NRZA 5IGGA 1L4DB 4B3TQ 3QHTA 3P4RB 2M0AA 1TWHB 3NXWA 1IKLA 3A9JA 1YX6B 4CJ0B 3PPAA 4LTUA 4FULA 1BBWA 1ZKOA 4JBJA 4HJ5A 2B63G 2E5LL 3P4PB 2WB1G 1LT5D 3T3OA 4A3EG 2N0SB 4F7XA 1PH6A 4OL7A 2MW5A 4NNJB 3S14H 1K50A 3EROA 4A3BB 1FRDA 2PVGC 4A75A 4MNOA 4BBRG 2KD0A 2UYZB 3DPDA 1VQFA 1I4GA 4P72A 3A8IE 3V60A 2HQEA 2MLBA 3R3OA 4W9EA 2PMZE 2NVYB 4JBMA 1HTLD 1WGKA 2FNJB 1KLGD 2JJQA 1G2SA 5JPMC 1K8GA 1N60A 2ICEC 1WZ3A 2HIXA 1PDXA 3U52E 4ZRZA 2Y5CA 5AZHA 3CQZB 2LVOA 1M94A 5JJIA 2JA9A 1HR0W 2LEKA 3A0JA 3BZDB 3A5ZB 3I4NH 4HJKA 4HK2A 1VQGA 2F0FA 4TRDA 5D14A 4AH6A 4GOPB 2JZZA 4N59A 3NHEB 3D4WA 1YMHE 1TWGH 1MJCA 3PZDA 3W1SA 1HTOA 5FLXE 2FINB 2JWUA 2K39A 3B9JA 1BMLC 2K8HA 2WWZA 1GUNA 1X55A 1HZBA 2PNHA 4GLXA 3IVFA 2SDFA 3P75A 2LJ5A 4M8NA 4JW0A 5C1ZA 1D4BA 1KDCA 4C1NI 2WDRB 1K8RB 4MHEA 4KV2A 1LT4D 3VR3A 1QVGA 1AWDA 2MBOA 3QX1A 1LO5D 2K28A 1VF7A 2MP1A 1RWSA 1XLPA 3K80C 1B9NA 1WCMH 1J5EL 1Q1EA 2WXOA 1O7LA 2V4DA 2LGYA 2KTRB 5LMNQ 4XWTA 1KDBA 1UEBA 1Q90A 3KK7A 5IODA 4POGA 4A3LH 1ESRA 5IT9E 1P1AA 3AM9A 1MSHA 3ERQA 1T0YA 2C9OA 3SU8X 4DV4L 1HCZA 1T0QC 2HTHA 3L7ZC 1HNWQ 4K5XA 1DOKA 1IYUA 1CKNA 1YBYA 5CV6A 5IYDG 2NS5A 3NBHA 4XDXA 2RPVA 3A4RA 4LNKA 4RNAA 4YT0B 1XCTL 4KKTA 2CR5A 3LDZE 3S1NH 1WR6E 5J1ZA 4FVMA 5MPOA 5IYCH 1X3EA 3PQIA 5DNFA 3KF6A 4LFAL 3W3AA 3SE0A 1E5WA 1YD8U 1IP9A 2IY1B 1O80A 2MBEA 2WX0A 3RNGC 3TQYA 2KX3A 3V3XA 2O4XA 3H3VI 2MBQA 3Q8AA 2JYEA 2ES2A 2OTLA 3HOUG 1PHJA 1STHA 1SRUA 3KLSA 3PCOB 1NYQA 2CKZB 4LNOA 2V3PA 1ENCA 1JWAD 3I57A 3VDZA 4YSXB 3E56A 1FM0D 2IO1B 3H0GH 2ZTDA 4GOPC 3NWTA 1EM7A 5LHY1 2BA1A 2D3AA 4DV5Q 2YTYA 4H2AA 5C4JH 3HZXA 2IT1A 4PQXA 2R92B 5J2RA 2A5HA 3JSVB 3NOBA 1YNXA 4ME5A 2KMMA 1YHBA 4PMWA 2N9EB 1H9JA 4GIVA 4W9LA 3ZJTA 1WCMG 5JOBA 2KCNA 4A3MG 1TWFH 3N6RA 4DUZQ 3Q3NC 1SAPA 2KLCA 2CW0D 4FP5D 5FK9C 3A8JE 5IA7A 3ZUNA 1GVPA 2YEPB 1NYRA 1EF1A 1BQQT 1NMGA 2KJHB 1BKBA 3RUZA 1SYGA 1T0RC 1U4RA 2EKIA 2L32A 3L17A 1FFVA 5E4XA 1S5BD 1YQBA 4OHJA 4HDQA 2JA8H 3K7UC 1Q5WB 2GRIA 4KKIA 4OWXB 3WCQA 3N3KB 1SBBB 4LUOA 5IWAQ 3GTGH 1ENAA 1L6VA 3P4QB 4L63B 1EZ6A 3WAMA 2BB6A 2HDLA 2DY8A 4IUVA 2REXA 5IGFA 2HE7A 2WXJA 5LMNW 3BWUD 4NQLB 1Z7TA 4URKA 2KYWA 4EVOA 1R4PB 3IFDA 4G3XB 5TR5A 2DYBA 4UY8C 4XGAB 2Z6BA 1KAWA 2QDBA 3Q0AA 3QWZB 4MACA 4WJOA 3EFXD 3GTPB 2ZPYA 1PTOF 2D5DA 4RM8A 4A3KG 3S14B 2TMPA 2NVTH 1N33L 4FHJA 4GOCA 3BVZA 4JI2Q 3HK0A 1RDPD 4HKZE 5BN3A 4LCDE 1W3SA 2LXAA 2R7ZB 5HY6A 1PH9A 2KEDA 4YCUA 2W82A 2NTTA 4B3SL 1EY7A 2AUKA 2R7FA 1K3BC 3NTKA 1IW7D 2KEEA 5ELOA 4WRDA 3J9CA 1GD7A 4ICUA 3E0JA 1O7ZA 4EZJA 2K50A 3RULA 4BWGB 2RKSA 4ZDVA 2WS3B 1N32L 2PZTA 2N8NA 5IGCA 1K0SA 3NEMA 4ZRJA 4C3IH 3EGRA 3RNEC 1PFBA 2I5LX 3I4NB 3LNNA 1SSNA 3KYCD 4OX9Q 3MXNA 3DHIC 3TL5A 3ZVVA 3W1BA 1NVID 4DNRB 2F4VL 3S1MH 2M00A 1M8AA 2I1JA 2WXMA 5KGUA 4DAYA 5C4XG 3WAOA 2JRIB 1VQDA 1C76A 1WFQA 2WXQA 2IZVB 4HJGE 4A3GB 3S1QH 2LJIA 3LWEA 4GS3A 3AFQA 2XGTA 4NB3A 3CMAA 2XNAC 1TT5B 5DPRA 4CGYB 2VB2X 2B63B 4CKBA 2BQQA 1CHPD 1JALA 4A3EB 3RNUA 1PZKD 3KUDB 4UAIA 2RSNA 4GOPA 2JEAI 4LF6L 4KZ0A 1I3QB 3CMEA 1TWFB 4K7WA 4A9AA 2L1AA 1ICWA 2Q2IA 3DBRB 1OXUA 3M9BA 3BVMA 5I4DA 3MA2B 3HOWG 5K5PA 1EUVB 3TREA 3PV0A 2E2JH 2IX1A 2J7ZA 2WFWA 4B9XA 2O5IC 1PGXA 2AX5A 4J1MA 1FL0A 1YJIA 3QB3A 1V9PA 1PRTB 4ZRKA 2VQEQ 4DV0L 1OFFA 3WAPA 2KQ3A 4A3GG 4ACFA 1MKHA 3ZKJC 4DV3Q 1LTBD 3PSIA 3GV6A 4O1NA 5KHOA 5A35A 3OMGA 1GO3E 1SIJA 3CIRB 1RD9D 2LASA 5CMDA 2EY5A 2V1CC 1T0SC 1O7IA 5M5WH 3K58A 3S1RH 2F0PA 1EIFA 4KV6A 4ZUJA 1P7EA 1YJ1A 2BYTA 4NXML 4WAAA 1TS4A 4B3SQ 1QZEA 2OXPA 1SNCA 4MGYE 5K36H 3L9AX 4MTKA 1SE2A 2Z0DB 4YHHQ 2QEJC 1P16A 3UE1A 5JJKA 1ZPSA 4XWWA 4QUFA 4X66L 1HE8A 1PZJD 3RNAC 3UQBA 4NMZA 4OZCA 2JYOA 2KCCA 4KX6B 1N34Q 4BY1H 2HHHL 4ASWC 2VUMH 1RODA 2XWJB 5C6AA 1VZ6A 4GN4B 5C3WA 1EY6A 4KD4A 5EDSA 5FKAC 4CHTB 3I70A 4BOSC 1CSPA 4X62Q 4N58A 1V1OA 3KH0A 3AH7A 1A6XA 4YWGG 1JC7A 3R8BA 1XPUA 4IFDG 4C3IB 4RHRA 3WALA 1BR9A 4IUNA 5BN5A 2LI5A 1I35A 4ZYNA 5LMUQ 1EWYC 1PUTA 2Y5BB 3RZFA 2JA7B 1PRTC 1FNWA 3SR1A 2WXNA 4A6QA 2A6HC 2EJGC 4R4TA 1O78A 1SYEA 4LF9L 1FXTB 1C0AA 3SDLC 3KLWA 3TP6A 1F9JA 2RGFA 1VQIA 3I4MH 4PNYA 2XRQD 4C3HG 2F0DA 1IBML 1IYFA 3R7RA 1GKHA 3J81i 4K2KA 1L7YA 3PLUA 5BYRA 1VQMA 3RD4A 1CUKA 2IY0B 2EYOA 1J6QA 4A76A 1TYGB 3RZOH 2VZKD 4KN7C 5EBCA 3IAM1 3N52A 3EBEA 4X64L 3GV3A 1FIQA 2ASBA 2B3AA 2L15A 3RNBC 3PGZA 3I63C 1I50B 1G91A 2INPE 2VUMG 3GQBA 4QF4A 2B2UC 1SNPA 3C46A 4EQOA 1EL0A 3QJYA 4GDLB 3J7AV 3M3JA 3TCAA 1SEBD 3B1LX 4EZKA 3EIVA 1TVXA 2RCNA 1PH5A 4FJVB 4GSWA 1IUEA 1EY9A 3U8ZA 2G3QB 4RMFA 4DR5L 3L4PA 1XD3B 1TKGA 3IAS1 4YL8A 3A55A 4HMIA 4FNFA 1PH3A 1IBLL 4PMCA 1QNKA 3HOZH 4LFAQ 2JE6I 4FF4A 4MGZE 3TS0A 4MJSB 4XDCA 1A3VA 2BOSA 1YX5B 3B2FA 1TWAH 3X3MA 4XXEA 2MJDA 4B3ML 3IG3A 1ROEA 3T8MA 1HFGA 1V43A 5HHDG 1Q7YC 3VYTA 4DV4Q 2NN6G 1BF4A 1EFWA 2ZJQA 4FXGC 2FUG1 3NQIA 4A3DG 1WTWA 3F1ZA 1LTRD 3HRZC 4DV0Q 4IG7B 2R2QA 1BCPD 2MGSA 4GKJQ 3P2BA 2UXDL 2C7HA 4GB9A 1TWAB 1D5MC 2AWTA 3QARA 3HKZB 4DV5L 5DAUA 2HHHQ 1KF6B 1UWXA 2KANA 4N9TA 1B4OA 1J8CA 4HCSA 1YZ6A 1KLUD 1E8YA 1JB3A 1Q8IA 2KWCA 3N20C 4K3BA 3RZWC 1JJ2A 2HD5B 1A8VA 4DDGD 5FO9B 2X6LA 5IN7A 1SE9A 4IUUA 5AFWA 1WF9A 4H02A 3ALBA 3CCLA 3U50C 2LWPA 4RGTA 3L2PA 1EU3A 4IO9A 3HOXH 4AQYQ 1U4MA 4GKKL 5LL6X 2A68C 3TRZA 5C44H 1GC6A 1H4RA 1B2TA 3QK0A 1E90A 3S17H 3M4OH 5C4XB 4A3CG 4DQOC 1A62A 1S40A 1XF5L 5M3MH 1BBXC 4P16A 4CDDC 1L5PA 1KC8C 5BR8L 3DUZA 4YCWA 3PMFA 1MG4A 2EKEC 1BCPB 1X32A 2WDQB 3TUOA 4HJAA 2HIVA 3SXHA 3S24A 4O2DA 3ML8A 1KIXA 5KRUA 5C3EB 2DYOA 3L0OA 3AE7B 1SE8A 4BY1B 1RKNA 2QW7A 2DJFC 3DWQA 4F88A 4FF3A 2QCZA 4JYAQ 5DPWA 3T1HQ 2KK8A 1L0XB 1VQ9A 4YY3Q 2L3ZA 3P20A 1ASZA 3D0FA 1FVIA 3RT3B 2LHEA 2HQLA 3ZTDA 2EE1A 1E10A 4XTCS 1B9RA 5T1GA 2IO3B 5IOIA 3NUCA 3O13A 4ICVA 3RNFC 5JXVA 1NR2A 2WACA 3WIMA 3BS1A 1EY4A 3K0YA 4B9WA 3M85A 4HEA1 1MI0A 4KGTA 2B2WC 4LNIA 5CTRC 4KSLC 5AEKB 4QAYA 1TY0A 4JBKA 3FDTA 3Q2AC 4A90A 3VHTC 3HP3A 2GN5A 3I2ZA 1WTOA 4K0KQ 5M3MG 5JJLA 3L3OC 4BY1G 2NVQH 1TKEA 3AMZA 1G6JA 1ZDVA 1GUTA 4YTNB 3K0XA 3T1YL 4A3JB 1KJTA 1ZXHA 3J81E 2K9XA 1YNNC 2AKWB 4DFAA 1XEEA 1NY4A 3ULLA 3PIO3 2ATWA 5D7GA 1K8AC 2VRRB 2IO2B 2K1FA 3AXCA 4AJWA 2JUOA 3CCUA 3H6NA 5IYBH 3PO3B 3I3CA 2JX5A 2FJ2A 3KBGA 3SD5A 4A3JH 1FEHA 4D2KA 4LLGM 1ZXTA 2B2VA 2RHQB 1YNJC 4H13C 1XCQL 4Y7NB 3ICEA 5CC4A 3PVLA 3ZJUA 4H7BA 4MJSA 1U4PA 1HQRD 1CZGA 4A3MB 1DYQA 1KLVA 2IHEA 2N49A 3VH3B 4MIUA 2X8XX 1E0ZA 1LT6D 5C44B 4OONA 3KYHC 1VQJA 2QDFA 3I3TB 1EOVA 2ZXOA 2V3SA 2JRHA 4R9WA 2O6VD 4OXPA 4DN4M 3PRMB 2K8BA 4NQKE 2WAQB 4FXCA 2L5TA 1NI3A 2XTIA 3PUXA 2XRSD 2KOXA 1YNJD 2KDMA 1X56A 3U7DA 4X3KA 4A3FB 1MBYA 4LNNA 3U58A 4HPMB 1UBQA 4MEMA 3ZO5B 1X54A 2IGGA 5BMGA 2F0SA 4ANVA 4JI0L 3HKSA 2O6VA 4A20A 3UQAA 1GJZA 3NPPA 2VZKB 3ZW3A 3WOFA 4PK1A 4X3SA 4X3TA 3Q14C 2VB3X 3Q8CA 1FCLA 1GJXA 1E6EB 2KO3A 2A69D 5M5XB 1RFKA 4KZCA 2KC2A 4A3FH 1VZ7A 4DK6C 3HOYH 3CAMA 2E2HB 4R3DA 1WGHA 5I6WA 3GTPH 1A3UA 5JVG3 1STNA 2M9VA 3SK6A 2K05A 4JG2A 2CHWA 1JJCB 3QOLA 2K22A 4MH0E 3RI7C 3STBD 5CGKA 1Y1VG 2CJNA 2M8SA 2DX5B 1X3QA 3U2SC 3PO0A 4Z9CB 3AN1A 2F4IA 4BKGA 1AH9A 1EQVA 1FR3A 3CW2C 1WM3A 2HDEA 1WCMB 3U9OA 2KVRA 4M00A 1PXUA 1WD0A 3AYHB 1WGDA 3J7YW 4M8MA 1B3AA 5JAVA 4JWSC 1B50A 2L1BA 2F3VA 1CK1A 2KHIA 3M4YA 2MWSB 1EEID 5H1SE 1VDVA 1GG3A 4X65Q 1V9JA 4LF5Q 1AYFA 3F2BA 2KFKB 1A15A 1D1KA 1W6KA 2A6HD 2IPKD 4LFBQ 2DJGC 4GMVA 2PQEA 3ITPA 1V1PB 4A3GH 1D7QA 3AE9B 4ZAIA 2NBWB 1VDZA 3W5OA 1R4QB 1PTOB 1P7FA 3HOYG 2B63H 1GNUA 1WE6A 3W1YA 2UXBQ 2BE5C 3QAQA 3VVWB 1TWGB 2UXDQ 2I38A 4A3MH 1ASYA 2TSSA 1UWMA 4M1UB 1WY8A 4U673 5IE8A 2WX1A 4HRSA 1TY2A 5CBAE 4ARIA 2RD0A 1G51A 3DBHI 3HG9A 3I91A 1NEKB 1QE6A 1Y1VH 2K5NA 1BUVT 3ONAB 4TQUS 3QA8A 4P2CB 2B8FA 4JQWC 3MTSA 3LX0A 1UUPA 3FEWX 4FBJB 2PKOA 4IWQA 3M63B 2HUGA 1K3RA 1V8CA 2NBVB 3A1QA 4BXXG 2HJ8A 2E3TA 3A33B 1FMAD 2Q5WD 1EOTA 1J7AA 5D3DA 1DOXA 1Y8PB 4DUYQ 1ZUD2 4IKGA 4E74A 1AE2A 2Z9HA 3GDEA 5D3IB 1S72A 1I6VC 2NUCA 2V1YA 4EUTA 1G2TA 3ND9A 4TQ1A 2PNRC 5BYSA 4MGIE 4GN1A 1SYCA 4JPSA 2OJRA 1JOKA 1MPEA 1Q86C 2EOTA 5M5XH 2JXTA 3S1RB 5E6PA 2DUDA 4DR3Q 5IGDA 3JVZX 4K6LA 2K5VA 3UINB 3J80E 4DAYB 4A3KH 1JMLA 3LYYA 4OVUA 1KD1C 4RFBA 4X66Q 5C0XH 1EZ8A 4LWCA 4YHHL 4A3BH 1OEYA 1K51A 2JWZA 1LTTD 1IZ6A 1JQ4A 1MG8A 1V6EA 2MFIA 3I4MG 3MP9A 4C7YA 3URYA 1Q46A 3H6MA 4A3LG 2J7QB 2KJ6A 4ABNA 1QKZA 3RMHA 2G45B 3S2AA 4RHSA 3PS6A 4LF8Q 3ZXVA 2PZUA 2SOBA 4LNFA 2DZKA 2FCSA 2VNUD 4C3IG 2LKVA 4IDIA 3CCJA 1SMYD 4N8FA 1QLBB 5COYA 4DV3L 1Z5SB 2ACZB 4A3JG 1YVCA 2FMCA 5LMUL 1TS2A 3N1XC 2MCNB 5F2DA 2MBBB 2GLSA 3JYUA 3RFZB 3EFUA 2JA6G 1PVOA 3NZ3A 2A6ED 2EYHA 2IW3A 2RF4A 2VL6A 2G4DB 5JH5C 1VCIA 4XX5A 1QVCA 4BBNC 4UP7A 4JI1L 4MM3B 1GB1A 1SN8A 4J15A 1DGSA 2PPHA 1EEFD 4JOIA 2PQAA 3NP8A 4MDKE 4S17A 4ANUA 2EIFA 4LF7Q 1LLRD 2K8CA 3V61A 4JVZA 4N8X1 2H5XA 3EA6A 1A63A 1AP0A 4FN2A 1E3PA 5KEEA 3FVQA 3P1MA 4K7SA 3K5MA 2Q2TA 2QEXA 1U9RA 2B29A 3N30A 3PIPA 4WURA 4L5TA 3VYUA 1QILA 4GNXA 1PGAA 3EVQA 1Z2MA 2O6VB 2WLBA 4W9JA 4C4VB 1TWCB 4EOYA 2K5PA 3JC66 3U4VA 3PUYA 2NN6H 4PS8A 3HOWH 3CF5A 4W9CA 1B1ZA 1E22A 3AEBB 4WAFA 2X6GA 4GXBA 4Q5VA 3PO2H 1C3TA 4MGKE 2EQSA 2B2YA 2NVTB 1Q0WB 3SFEB 1QG7A 2N55A 4HMJA 1ZYRC 2JZPA 2NMQA 2WKCA 3EN2A 1VQPA 3OTOQ 1F0ZA 2ZCBA 1L1OB 4DV2L 4A3FG 3N1ZC 5G2NA 3CCQA 4DV2Q 1JCKB 2R6GA 3G7LA 1HQMC 4IW0A 3V05A 3RZDH 3RLNA 4HIOA 1ISNA 4JE3B 5IP4D 1DOIA 1L6UA 5CV8A 2A8VA 3I73A 1F2LA 2A69C 2WKDA 3S16H 1L4ZB 4DU9A 5EPKA 1PFDA 1HTPA 3TMEA 4GN5A 2J0JA 1PTOH 1Q12A 1R9TB 2LUEA 5C4JB 4HPLB 1LQBA 1N62A 1VQNA 2RVLA 2LXCA 3GTKH 1I4PA 1YQ3B 2DAJA 3R3MA 3D3RA 2WXFA 3AB9A 3ONSA 4DV1Q 3MFGA 4JI4Q 1Y1VB 2B2TC 2FXQA 3S16B 1SLJA 1XT9B 1YJJA 3DWGC 2C5CA 4RMAA 4E3CA 3RN9C 1QWYA 2F0GA 3BZKA 2GMIC 3DVGY 3QG1A 2BTEA 4HCEA 4KK7A 2PI2E 2ONQA 3I55A 3T3NA 2F4VQ 2ENBA 1I3QH 2JA8B 3CD6A 1HTQA 2B2TA 2UU9Q 4OX9L 2YTVA 2NTSA 3VFKA 3H9DA 1NSNS 4IUQA 2VUMB 4NDXA 1KRTA 1JRUA 1WE7A 2LGIA 3IBEA 2E2JB 3SFDB 2BB5A 4LK0M 1E2VA 2KHSA 2CH4W 2NCNA 1LTAD 1OQRA 1F9QA 2F0WA 5C4XH 2N7EA 4FF2A 3HRDD 5G3LD 1H95A 5I6YA 1I94Q 3SHQA 4B0MA 2EJFC 2CWAA 5ELNA 3RD2A 5A2QL 2JA7H 3QQ8B 4JLCA 4HCPB 3ZYYX 1BCPF 4O0AA 2IL8A 3ERSX 3P63A 3T53B 2UUBL 3PIOA 4YTMB 4ZHPA 1F2YA 1I94L 2N88A 3DLLA 4CJ2C 1CI3M 2CQOA 2J4XA 3DHQA 4PMBA 3QC8B 2INCC 4KHVA 1EYAA 1ZW7A 2N7JA 4ZRPA 4EZLA 3DHHC 2NVUI 4MTNA 1SMYC 1OQYA 1SYBA 3AE2B 3RZOB 1YEZA 1KFYB 4W9KA 1E2WA 2M19A 2PJHA 2FE8A 3A7LA 2L05A 4F7ZA 4WWMA 3VTVA 3Q3FA 2UU7A 3UE0A 3IRBA 3MZ5A 1UGJA 1FXAA 5HG2A 2XK5A 3GZNI 5BYQA 1H9MA 2A4ZA 3HOVB 3BK2A 2H1EA 2QGQA 4QIWE 4FO2A 2WGSA 4KVGB 1HNWL 2KVZA 3K59A 3W5VB 1VQAA 4CQNA 1UWVA 3TZDA 5JEAG 3FAHA 5KIXA 2KWUB 1C1YB 2LZ6A 1II3A 4DUZL 1W2BA 1K83H 4CKEA 4DPGA 1OO9B 4QQBX 1RFAA 1A0IA 2SAKA 1TIFA 5CBEE 3GTOH 4LDTB 4BVUC 4F1SA 1QNUA 2Q8TA 4V0BA 3WA0A 2MUYA 4JI6L 3FKIH 3HOVH 3K81C 1EYCA 1M4VA 3OIPA 4KJNA 1OXXK 2LFNA 3TS2A 1UBIA 3CSTA 3HM6X 5CHWA 2F0OA 5DCNA 1KM7A 2I5HA 2KQSA 1OTCA 3H7SA 3W1GA 2K6DB 2WU2B 4IURA 1NAPA 4JI5Q 3K6OA 1C48A 4RH6A 2D3CA 3M62B 4Y7NH 5C3EG 4P73A 3NSWA 3CC7A 2VS1A 4PYUA 4YTPB 4DA2A 5C44G 2JPHA 2GBKA 2MRPA 2WDVB 4UHVA 4F8MA 5GROA 2F0NA 1FNVA 5EE0A 1ZGUB 1J19A 3ZXRA 1SNOA 1Y8RC 1C79A 4QIWB 1TR5A 4HLEA 1MJDA 2LHDA 4I6LB 1EIYB 3H09A 4HN7A 1RTOA 2R93H 1CTMA 1CQFA 3GTJB 4A55A 1CSQA 3PIP3 5D2MB 4DHJD 2RDFA 3GTKB 1ACCA 2RQXA 4OVZA 3NE5B 4FF1A 1M1KC 2BS4B 2QMTA 5G55A 3ZJVA 1IBXA 4DBGA 4KHZA 4FXKC 2K03A 5NUCA 3I4OA 5M3MB 3F8TA 4IM3A 3N1YC 4XZ4A 1TS3A 3ZNZB 3ER0A 4OELB 4G57A 1QZHA 3GTJH 3VR6A 3DWPA 1QT9A 5KYLA 2WP9B 2ZW1A 3UDFA 3NHHA 3TP7A 4B3TL 2LD9A 4PG3A 1XNQL 1QOHA 1BUIC 3AV8A 5D94A 4DR7L 1F9SA 2A19A 3KLRA 1BNZA 2MA9B 1CM9A 3WANA 3DVNU 3DCGA 5J3BA 3K57A 4R1JA 5EE9A 3PUVA 4HSPA 3PTFC 1G6ZA 4MZ9A 4FJYA 1JOQA 2K6AA 3DBLI 2EXZA 3KJOA 3RYTA 3DVGX 4A3IB 1DOLA 4BBSH 3GOEA 2D2CC 2CCZA 4GDLA 1GXDC 1A70A 1C4CA 2M17A 5D6JB 1K0RA 3C8YA 4NJCA 1XLNA 2JXMB 2N9KA 1A2UA 1E0BA 1C9OA 2EYLA 2D10A 2XIWA 3IHPC 2RMMA 4KY6A 5CV9A 3I72A 1XQQA 3CCMA 1HZAA 2KTRA 1JWMD 2K52A 5CV4A 2QA4A 4KKUA 2D5GA 4A3IH 3FKIB 3NVZA 3J81c 4HXDA 2UUCQ 2F0UA 4KHPQ 2WAQG 2L9HA 2CHBD 1ML0D 2LRWA 1GC7A 2NVQB 1N9WA 1WXAA 2Z6KC 1OXTA 4JI8L 1IKMA 3UDGA 1Y1WG 1UF0A 1XMQQ 2BWES 1A5RA 2ZPNA 1Q10A 1H8CA 1B3QA 1D8LA 1S1QB 1K53A 3KF8A 2L7RA 3CRKC 2W9NA 4C3JH 4NXNL 3VR5A 2GBRA 3HOZB 2L0TA 5K36G 1PH2A 2KFKA 1K73C 4IM2A 3VUXA 4KGRA 2RDHA 2MO0A 1RYJA 3BYYB 1L2FA 1JORA 1EWIA 4KLKA 1J8IA 4HPPA 4QY7A 4NJ7A 4TUUA 3HKZG 1STEA 2GOWA 3CWIA 5DPSA 4K8IA 1R4MB 2RA4A 1B70B 1SE3A 3U9SA 4DV6L 1Z47A 2DYMA 1K83B 4RG1A 4I65A 4I7ZC 3X0WA 5EBDA 1FPYA 5ISRA 2WIIB 1G6PA 1RM6C 3D32A 2NVXH 3NS1A 1PA6A 3I5JC 3KJPA 1FGBD 2GBJA 2NR2A 1PH8A 3AB5A 3HIZA 3QWNA 1X65A 3R66C 2BDOA 4WQOB 5BMHA 2MJ8A 5C0XJ 4II2B 1QZGA 1Y8OB 4K2LA 1VCBA 3DM3A 3ZQ4A 1HEZE 3CHBD 3H7PA 4M0WB 1IPGA 3B2GA 2JF5A 4IUMB 2CJOA 4W9HA 4JCVE 2M1MA 1ONLA 1ICFB 4MN3A 4BY7H 1V49A 3A1QB 1E9MA 3PT2B 4OW0A 4QMGA 5IGEA 1MHWC 4AYBB 2ZCCA 5EJWA 4K5VA 3CXCA 1KRHA 3RLOA 2MNAA 4PV1C 4IWPA 1HUNA 5IT9c 1JROA 2E6XA 2K0PA 3W9CB 1JOOA 2JEBI 1C77A 1LACA 2EPBA 2D9UA 4M01A 1PTOD 4S3SA 5BR8Q 1CKOA 4DK0A 1K52A 3AFPA 3B6YA 5FJ8H 1EY0A 3DBLB 2AQ1B 2EELA 2I5MX 2NBUA 2LMCB 4BBRB 3RN5A 4JI0Q 5IKCM 3TSSA 4AP4C 2JU6X 1KABA 4XQJA 4XQQA 3HS0C 2N78A 1WTXA 2KQ7A 3I4NG 2JT4B 4GU2A 2N9PC 1LTID 3GE8C 2CHXA 4J3OD 1B53A 5C3EH 2E75C 2O2LD 4B08A 2XVSA 3PO2G 1RHPA 1WXSA 3H15A 1JWUD 4EKUA 1L1OA 3IKJA 1L0WA 3V2TA 1HNZQ 4ZK9B 5C5MA 1F2RC 4B3RQ 1PTOC 1I42A 2MH7A 4EE2A 1S3OA 1WTVA 1Q82C 1OQQA 3E5SA 2LRUA 2DWQA 3AMUA 1AW7A 2XEWA 1JWBD 3RLFA 3T4AC 4IN3A 2FMMA 4NKLA 2K32A 2E2IB 1HZ5A 3A5UA 4OZAA 4PS3A 4FDBA 5TSSA 2VH2A 1MHHE 3HOWB 4A93H 1SROA 1E2ZA 1PLFA 3CMMB 1MI2A 3AU5A 2L0FA 4B3MQ 2N1VA 3SDZA 1YJNA 2GB1A 3MJWA 4CDCC 3RMKC 2AWNA 1AARA 2AEHA 4WQMA 1WOCA 3A9KA 1CT1D 4RCOA 3PO3G 3MHSD 1L0YB 1Q1OA 2KDIA 2OEDA 4CHKA 2G5DA 3E3XA 2F0QA 4ZOHC 1EWCA 1KL9A 4H0LC 1N8RC 2K7VA 3AU7A 5FOBB 5IIFA 1LFDA 4A93B 5J17A 1BBUA 2IGDA 1TKYA 1JR0D 1UEAB 5CR3A 2B76B 1S5CD 3GTQB 2C9WB 3J80L 3ZIMA 4K81A 4DR6L 3HOXG 1R4NB 4DV7L 2XK5B 4PT5A 1FD6A 5IP9G 1QUQA 1PYSB 1BOSA 1E24A 1KQSA 3DMUA 4X64Q 3KUCB 4WORA 4TQ0A 1WZ0A 1GAQB 3I90A 4A3PA 5EKLA 4IPGA 4QGUA 1XMOQ 2PE6B 3WOEA 3HEJA 2V3NA 4L23A 1VQEA 1SNMA 4YY3L 1N36L 1GB4A 2ZM6Q 2N9XA 1C4AA 1GHJA 3GTLH 4ILWA 4UP8A 1SSOA 2N4FA 3I4LA 1VMCA 1WSPA 4GNXB 4A3IG 1FO4A 1DZ1A 2HDMA 2EYPA 4G7OC 2K04A 3D4RA 2KXJA 2V4IB 3H3VH 2JA8G 2I0QA 5AZGA 2YTXA 2F0TA 3WWVA 2PW5A 1DXMA 1JQYD 4HJ9A 3AULA 3T1YQ 4OO1H 3JSVA 2K25A 1EYDA 2NVXB 1RCVD 2NBFA 4E71A 2IX0A 3GTLB 3VA7A 1VQ6A 1V2YA 4HCNB 3V6EB 4NY0A 4TVAB 4FYDA 4KSKC 4C7ZA 1ET9A 3OMCA 4NW2A 1CKNB 2KOLA 3TN2A 2J0TD 3OW2A 4N6EB 4JYAL 4DXFA 3BDCA 3C3LA 1TBEA 1WR1A 3DVNV 1TTNA 1JICA 1D6EC 4BY7B 3GD7A 4HKQA 4NP5A 1N61A 3A8KE 4AYBE 2PW7A 1Y69U 1JMCA 3EQLC 1EU4A 2AMCB 2ZVNA 3AE4B 4BA1I 3ND8A 3VYSA 1GUAB 1UH6A 3HM3A 5IAAC 2B2YC 2C35B 4WJQA 2V4LA 5C2TB 2EY1A 4JI7L 1HNZL 2Q2HA 4M0WA 2INDC 5AJ3Q 4LFCL 3OPOA 3H8HA 4FA6A 1WIAA 5CX3A 5JHBA 1BVSA 4YIJA 3AI5A 3H0GB 2H89B 2D11A 2IX3A 3NVYA 1O7YA 1VR9A 1WYWB 4IFDI 1E7VA 4JBWA 2ZEQA 3IFWB 2PPBC 2Z0SA 2D3BA 1HA6A 4W9GA 2NZ1D 1WXMA 2BH8A 2EMTA 5G5GA 1JB7A 1XNQQ 1HXYD 3K9PB 4XT1B 2DBYA 2PEAA 2VQEL 4DHZB 4JC0A 4BA2I 2KWVB 2B3GA 2Z0EB 3NS8A 4JI5L 2DENB 4KKJA 3M7GA 2WDTB 1D1IA 1STGA 1DOMA 3VRAB 2KCTA 2E2DC 4TKNA 3QIAA 4B9KA 4A3DB 4Q0FA 1R4NI 1WYDA 4I6PA 2PZWA 4LK1C 3JAMc 2R61A 1M90C 2BYFA 1WRDB 2KCMA 1QQRA 3OAWA 4II3B 3SK5A 1GUOA 3IL8A 3CCVA 3S1MB 1TXYA 5L95C 1FXIA 3RZDB 2K01A 3F2UA 3FPUB 2M56B 1IBKL 4KN4C 2OQKA 2YVCA 3MHBA 3CRLC 3VDYA 4LJZC 2CVRA 3IFTA 1VQKA 4NPNA 1SJHD 2AL3A 2R3ZA 4LF4Q 4TSSA 3S9WA 1SDFA 2N3SA 2FHTA 4GN3B 1TWCH 3MEHA 4APVA 2RDGA 1MSGA 3D31A 3UDXA 1EF5A 3ZRFA 3FPPA 1NJIC 1EFID 4CBVA 1ZEQX 1ZOYB 4DAMA 2D0OA 3QR8A 3NVWA 1LV9A 1XNRQ 1F9RA 1OTRB 1IBMQ 2R2OA 3G4SA 3G6EA 3NZUA 3RPFC 3ZDTA 5ELFA 2KKCA 3Q6BA 2X69A 3KOJA 2OQ0A 3STBC 1TJEA 5HI1A 2LXJA 1GPXA 2R7ZH 2PW9A 5BN4A 4ID6A 4WJ3M 3LGJA 1K8OA 3LB8C 1C9FA 2F0EA 1WXQA 3A4SC 1YI2A 1IBLQ 1E7PB 4USAA 1STYA 2C7NB 2Y0SG 2QKIC 2KQ4X 1WTQA 2X38A 2D62A 5E4WC 4CDEC 4JI2L 3IT4B 4BBSG 1NDDA 3Q24A 3ULJA 3L10B 4KDLB 2WINB 1Y8NB 4KD3A 3QOJA 3KDFA 4ZCKA 4DR2L 2WQYB 3VR8B 5M5WB 2KBNA 4N9PA 3CC2A 3M7NA 3KWVA 4JGHB 4E6IA 3X3NA 2G1EA 4AS1A 1KOTA 1RIPA 2PLPA 1UNSA 1PGBA 1F2RI 2YYZA 1VQBA 3DQVA 4LF9Q 1OEYJ 5IY0A 3C19A 4US9A 2RHSB 4R4CA 1GM5A 1SIFA 3ZNID 2Y5PA 4YWKA 4RA8A 4DNIA 3DOWA 3VH4B 5EE3A 3P7JA 1LM0A 1KXLA 3SHLA 4MSQB 2OF1A 1RAXA 2IJ0A 3PRZA 3VYRA 1SFOB 2MJ3A 1KHIA 2F0HA 4ME3A 2XSCA 2PTLA 1Y1WH 1XTCD 3PF4A 3S15H 1OGWA 4J6IA 2D3GA 3MC9A 2MP2A 2RPQA 1J9OA 2K75A 1H9SB 1E1OA 5HGTA 1D5XC 1LTGD 4L8JA 2NYZD 4C3JG 4DR2Q 1PV4A 3IT6B 5IYDH 2JA5G 4CDFC 1SXTA 3ABVB 3RUIB 2ICIA 2AQ2B 3FKIG 4V190 3S15B 5M3FB 4BXXH 1WI5A 4WWOA 3K8AA 4DXGA 2EYJA 3I4MB 3MEFA 5LXHA 1YNND 3OOCA 4MM3A 5JHAA 2NZHA 2C5LC 2ZJPA 3T13A 3M3YB 4RKBA 2PQAB 4KKSA 4HIMA 2F0VA 5GXGB 1Y14B 2L4NA 1EQQA 5FLMH 4R8IA 3I9V1 4HROA 1D5ZC 4LNQA 4OVVA 4IJHA 4PS7A 2KLGA 4KIKB 1WGGA 1GUWA 4ZHOA 4ZKBB 2JSVX 2FUHB 2F0JA 5IYBG 4G7HC 4NXMQ 1CFMA 2NB0A 3OTOL 3HOZG 2QILA 1I50H 2JA5B 5G5HA 5FLXL 1V5TA 3T51B 2EY2A 3NK9A 4NZLB 4QJFA 4B95A 4HR7B 1PFSA 4K1RB 4P6VF 1YHAA 4BAXA 4ULLA 1F77A 4CKCA 3EJIA 4HTHA 5KHQA 1R9TH 5CHFA 1V8QA 4DV1L 5J39A 2W3RA 1VQLA 4IQZA 2QDLA 2P5ZX 2JA5H 3Q3MC 3V62A 2WXLA 3OW7A 3GTMH 1WM2A 3L54A 2MBHA 2IDYA 3EUB2 5H8YE 3JAMi 3ML9A 3KF6B 1PH1A 1S5DD 1Q8KA 3OSOA 1CQVA 1GOZA 3Q8EA 1ILPA 2HTME 5GQOA 3CCEA 3TEHB 3R2TA 4ARCA 4KY5A 1LABA 4RGMA 5EGTA 3AE3B 2ZTCA 2RCFA 4IALA 5HFYA 2JY6A 3MHZA 4C3HB 2V9HA 3C1FA 1KTKA 4A4IA 2H4OA 4CO7A 1SFOH 3WDNA 2A68D 1QVFA 2YEPF 5GMVA 4YSZB 2I46A 1Y1WB 3AE5B 3LJ3A 3J7AF 5IGBA 3TZUA 1EYGA 1HA5A 5BMIA 3ZNGC 4P1BC 1C4PA 1IXRA 4BBRH 4C3HH 4DXAB 1YITA 3NWSA 4XIGS 3AE1B 4ZQ3A 1HH2P 1HHVA 1V1QA 2DZJA 1PH4A 1BO0A 4YSYB 5CHVC 3JW0X 4YXDB 5M3FH 1C4QA 2B2VC 3RNCC 5GAEC 3S17B 2J53A 3G71A 3MXUA 3KLSX 1N5WA 4HDOA 3VXWA 2LGSA 4X57B 4RCNA 4WIPA 3J81L 1YOVB 4MELA 4JI1Q 2L55A 5ELEA 2DLBA 1IL8A 2Q8IB 2BW2A 3S2DH 2KT7A 4C00A 4LW1A 4P71A 2BYEA 3NZSA 3NENA 3T9LA 2KN4A 4YCVA 1IW7C 2KECA 3G6JB 1TU2B 1HRJA 1J0GA 1IGCA 3DBSA 1HZ6A 1WXVA 4HJ8A 5IWAL 2VH1A 1YJWA 4ZKCB 3UIPB 2VW9A 4US8A 4DWFA 1NNXA 4DUYL 4C56C 2RSOA 1MHXA 2KZRA 3GB1A 5HGQA 3K7AH 1RRBA 5IP9H 4DR3L 4NAWB 2Z6KA 3Q8BA 3C2PA 2ON8A 2V0GA 1OXSC 2CQAA 2QJLA 3PGEA 2WNMA 4DDID 3U30A 3G48A 5I9OA 1VQ7A 2K4KA 1SYDA 3A7AB 1WMHA 3BU2A 4P1CC 3CSFA 4M8AA 2UU9L 4AOFA 4K3CA 1C7YA 1TKWB 1S3SG 2UUAL 2Y0SB 5C5LA 1HR0Q 3T56B 4LF4L 2F0IA 1KNEA 4QL5A 2IWHA 1XMOL 3HGBA 3AEFB 4FXDA 4CJ1B 3GTMB 3EFCA 3NBIA 4TV3A 4WWPA 1QF6A 3HOXB 5I2YA 4X6AH 2K5HA 1UE5A 2N1WA 4N9F4 1I5FA 3SVMA 4DV7Q 4WJ4A 2I2YA 5E7NA 1IYJB 1U0LA 1TIID 1WMHB 1H9SA 4B3RL 1EY8A 1PFNA 2LUMA 3M4OB 2DZMA 3PF5A 4NPSA 1UAPA 1F2ZA 3S2HH 2CW0C 5EPJA 3NG0A 2ZT9C 1R7SA 3NTIA 1WTRA 1N5XA 1LT3D 4WH4A 3H91A 2EZVA 2B2UA 4BS9A 3A56A 3L16A 1VMPA 2BYVE 2FIDA 3OYYA 4LF5L 1NTGA 4BFRA 2G4SA 3KUZA 1SNQA 1XNRL 1PRTF 2ZNVC 1I7HA 1NR4A 4A3CH 3S2HB 4F8CB 1ET6A 4M02A 2MQHA 3CQZH 2BS3B 2WB1E 1N63A 2R93B 3QCAA 1D2BA 3X23A 2WAQE 1WTPA 2OOBB 3HOUB 5CV5A 4G0NB 4FHKA 3TJPA 4A8XC 2CH4A 4JX1C 5KNCA 1GUGA 1A2TA 3OWFA 4LFCQ 1B8AA 4IUPA 4JI3Q 1NUCA 3AQQA 2BF8B 4LMQD 2NZOA 4OO1I 4LFBL 2QSDA 1PH7A 2LGDA 2EYFA 4JPBW 2BGFA 4DF7A 4X65L 3NELA 2BVCA 5AZFA 2Z1CA 1TZOA 1NENB 2KENA 1LTSD 5KNDA 3PUWA 2IYDB 1VQ4A 1XTDA 3BYTB 4IPCA 2J0KA 1EY5A 1AZQA 4WWNA 4DKAC 4LF7L 1IBXB 1EIGA 1QUQB 4MT5A 4IM0A 1NMFA 3SR6A 4L5SA 4RF0A 5C23A 4GLAC 1XLOA 4KJOA 2AQ3B 4LUZA 2IHFA 2MHVA 1I4XA 4QUCA 1WRIA 3ZJYC 3OLMD 1DJRD 1KNAA 1S5FD 3BG3A 2AUJD 3DEPA 4DR1Q 3BY4B 2W3SA 4C2MH 3AE6B 3J81j 1Z9FA 4IFDJ 5C3JB 4NXNQ 1XPOA 1KAAA 2E74C 2EDGA 2ZNVB 3LWUA 1UGMA 1X9NA 4DNTB 2F03A 3D6CA 5AJ3L 4OWTB 1YN5A 2KDBA 1HNXL 3J7ZC 4KI0A 1WGRA 3MFYA 3VAWA 4HSVA 4C2MB 3BIID 5JEAJ 3TBLD 3PUZA 1QOFA 2L83A 2CU1A 4OZBA 3VTWA 1FRRA 2UUCL 4C80A 1V81A 5A2QE 1JE4A 2JP1A 3KBXA 3ETRA 1A3TA 1Q81C 1YIJA 4XYOA 2MQJA 4J8QA 1HR0L 1VLBA 2KX0A 2HJ1A 4ZRQA 3KFUA 4W9FA 2BE5D 2CWPA 4YWMA 4K0KL 1DGJA 3FILB 4LJPB 3L13A 3V96A 2XWBB 5ELCA 3U7ZA 4DGZA 1V86A 5LLIA 3SGIA 1RL2A 1QOGA 2WXRA 5EAYA 4BKSA 1CA5A 2JYTA 1U4AA 1YQ4B 1K9MC 2ASQA 3L08A 1IHZA 3TEWA 1E8WA 3K5OA 1PYWD 1BXTA 5J22A 3K5NA 2E2HH 1T3QA 2IGHA 1PQSA 2N9LA 3H7PB 3DEOA 2LY7A 4MSMB 4DHJB 4DK5A 2UXCQ 2KACA 4DR7Q 2N7DA 3CCRA 3KUPA 4R4OA 3MTNB 1EO6A 5DLQE 3N32A 1SB3C 3H0GG 1ILQA 2L8JA 1T6BX 1B44D 2F0MA 2OWOA 2Q8RE 2IO0B 2RDBC 3TEZA 3FHWA 3NJTA 2GVBA 4RAUC 2KWDA 1Z6HA 1K28A 5C0XI 1WJ4A 1B9MA 3ZTCA 3AECB 3DWAA 1LUZA 4IOIE 2DHZA 2DNFA 2WU5B 3DDCB 3QIJA 1CZWA 2OT2A 2KAJA 2BWFA 2NPTB 3VRBB 1WYGA 2AWOA 1HJPA 3Q22A 3A9JB 2NWGA 2H88B 3CU7A 4AWJA 1FD7D 1PYBA 4KMUC 4OIJA 1EQRA 4JI3L 2JK8A 2FIFA 2E8GA 3KQ4A 4L5RC 4A3KB 1YN3A 5JJZA 1P3QU 4JL9A 1V97A 3W1SC 2DGYA 1P9DU 1I4RA 4IJLA 3BZCA 1CKMA 1Q3LA 2DAFA 2L76A 3AEDB 4R8NA 2KFJA 1WJUA 3DM1A 1Y56A 4AUQC 1XJVA 3BK1A 4F87A 1XYIA 1DD2A 1LTLA 4GDKA 1CA6A 1TQOA 5FO8B 3S1QB 3MXNB 1XXGA 2DNCA 1YNTE 3L0WB 2GA4B 1BCPC 2LMCA 3A9KB 2KVMA 1FJGL 4GGQA 2JA6B 1E1TA 4HVBA 3ZRCA 5ELDA 2OCEA 2ZXRA 3S1NB 3M95A 1MGSA 1NBFC 2OHFA 5C3XA 5M5YH 4K7UA 4L6TB 5DM73 1DCZA 3JAML 2GVAA 3E0EA 1VZ8A 3VUYA 2O2VB 2Y3AA 3D8GA 4LUVA 1CJEA 1SGHA 1WJJA 2BPSA 3HUIA 4ITKA 1KDAA 3PHXB 4K5WA 4Y52H 1ESFA 1V5OA 1WI0A 3ENEA 4OGQC 4EFOA 2B39A 4ODGA 1T9HA 4GKJL 2C60A 3RN2A 4CYEA 4DV6Q 3CPWA 4I7AA 1BT0A 4JOIC 5T8IA 3PZ7A 5IOCA 2MSED 1OXVA 2PE9A 4POFA 4S0RA 2AHOB 3RR5A 2L12A 1VQCA 3A74A 1UE7A 4QB4A 3GTQH 3PO2B 2FBWB 2GBMA 3APFA 1E8ZA 3O65B 3Q3JA 4JWUC 1ZXIA 3CC4A 1AFPA 4XYCA 4IZ8A 3DHGC 1SMXA 3ECIA 1HFNA 2WXIA 5LL6S 2MEKA 2JN4A 4R4QA 1VQOA 5FJ8G 4JI6Q 2WXHA 4KIKA 3M4QA 1PFMA 2L0CA 2MP2B 4I6NB 5DM63 3APCA 4FJZA 5C0XG 3ZNHB 4JI8Q 4A3BG 4DR4Q 1PMRA 2VY3A 3AEVA 3I7FA 1NCVA 4RGNA 2M0XA 2ZXPA 2AYOB 2D2QA 1JE5A 2O5JC 1YHQA 1TS5A 3Q6SA 1PRTD 4A3DH 3TBIB 2HCCA 1LXDA 3AEEB 1STBA 2YLMA 3FMCA 1I4QA 5KNBA 1F1HA 3BINA 2YU9H 1NBWA 3CF6E 1RJTA 1HZCA 2F52A 1FNUA 2MJEA 3HVDA 3I8ZA 3F2DA 3AE8B 2CHZA 2QF7A 4EGVA 2CS4A 1X3GA 3NTHA 4UPAA 2A74C 4A3EH 4J6HA 2LS01 3PSEB 3UDIA 4K6DA 3GP7A 4FADA 5E6NA 5GAHC 4U68A 4ZLTF 2F3IA 1J7BA 3FKYA 3NBHB 2JSOA 3ZDMC 4B6WA 2VQFL 1VD2A 2FFKB 2K6QA 2RSUA 3J7A5 4G50A 5AUIA 1X6OA 1XX8A 2JA7G 2UUBQ 2XBBC 3Q3OC 1EIHA 4RF1A 4PZ7A 1DM0B
chains in the Genus database with same CATH topology
4K14A 5EE1A 1T5EA 1HPCA 4QCLA 1FYCA 2BT6A 1Q1BA 5FR3A 3TDQA 2BCOA 3UI3A 1HUMA 3VR9B 2F0LA 3DWMA 2PMVA 5CYUA 5H92C 3SK4A 4WFN3 5E1FA 1J7CA 3PZ8A 4G7ZC 2K5WA 1GUSA 4RKLA 1H9KA 2F1MA 1GHKA 3K7AB 5IT9L 1RF2D 2PCFB 2SNSA 5EKIA 2BDNA 1F9PA 2A73B 2E76C 1ZP0B 4LAAA 3Q23A 2WXPA 2CU3A 1ZDXA 3U4EG 4AQ7A 5AUKA 1W6JA 3BDOA 5I9PA 4OO1G 4GZYC 1WVLA 3HVZA 1CZPA 3VA5A 4H44C 2WP8J 1S5ED 3VR2A 3D4DA 4K8JA 5EQ0A 3GTOB 3P42A 1VF5C 1ENFA 2J52A 4MH8A 4XDDA 2EJMA 3T16A 1C8CA 2EY6A 2B8GA 1QCBD 3D6WA 4HEDA 3GO5A 2EVBA 4JK1C 3GS2A 5EKKA 3N9YC 5JVH3 2I07B 2SNMA 1FFUA 3K5LA 4L1BA 3SEBA 4EQNA 1EQTA 4XT3B 2L52A 1XO3A 1SNDA 4NAMA 1VJKA 5DEHA 3Q69A 5G3LF 5M9OA 1QB5D 3P4SB 2Z4HA 3R93A 1L0VB 2WB1B 1K8MA 2YU9B 1MVKA 1JW9D 5ELBA 4KGSA 1RTNA 4RGOS 2DNEA 4IFDH 1SYFA 3W2DA 3BVGA 2QCPX 2GI9A 2HCIA 3P1HA 4DAVA 2EYMA 3SK8A 3TEYA 2DY7A 1U4LA 3BDLA 3MAQA 2PMZB 2K5DA 3VQIA 1SJED 3H94A 4XQNA 5JEAH 5T1IA 4X3UA 3NUHB 1ZYRD 3CKIB 1KH0A 1CHQD 3AEAB 3KWLA 5C4ZA 2OEOA 3DXJC 4BBSB 4HAEA 2BBCA 4Q2JA 3IAYA 2ZW0A 2B2WA 2J42A 1BDOA 3QO2A 3OIQA 2A6EC 4TKOB 4KY7A 3MWYW 1G8ZD 2Z8LA 2LFIA 3LXFA 2KJXA 2WV6D 3OHXC 3OWEB 4XYQA 4C1NK 1EWHA 2K33A 4KTAA 4UDUC 3ZGZA 3MC0B 5JPNC 1SF0A 2JQRB 2F0KA 2KUMA 3NQTA 3W5UB 2RBMA 4GLSC 1QOBA 2G9HD 3Q8FA 1AN8A 5HURA 1PDQA 4C3JB 3A54A 4RWSC 2WXKA 5D65A 3TP8A 5KYIA 2M2LA 1AZPA 1C78A 1QOAA 4XE0A 1H9RA 1I4HA 1XWEA 1WD1A 4OIKA 3HOYB 5EPLA 2K3UA 4ZUIA 5E3FA 4GDKB 3MXGA 3FC4A 2K5QA 4WJWA 1STAA 1ZE3D 2G9DA 1DONA 2XN9C 1FCCC 4L2YA 1WWTA 1PZID 3AEGB 3H3VC 4REZA 3C1EA 3TP5A 1JRPA 1V1PA 3IXSA 3MJ5A 4DK1A 1AEXA 1X3PA 2MPMA 3FILA 3E9SA 4G4KA 1JWSD 2WXGA 1TT2A 2K1BA 2PO4A 3JAME 5CV7A 2DN8A 2W54A 2PIAA 3VR4A 4TMAB 4ZYSA 5C4HA 1F2MA 4EQPA 1G291 2QIEB 1MD2D 4O42A 1T5XD 2VXWA 2PYKA 4IUTA 3S2DB 1QJOA 1S4ZA 1XLQA 3R2IA 3E6ZX 2BS2B 5E6JA 2W55A 1I6HB 2L11A 2NN6I 2F3WA 4DAPA 2INNE 5M5YB 3MVVA 3TEXA 2ID0A 5FO7B 5I2XA 2Z4IA 1SE4A 3FRPB 3UI2A 3MXPA 2SEBD 5CORA 1IYVA 1YN4A 1VRAB 2BA0A 3GTGB 3NVVA 2PVOD 2KA7A 1IGDA 3NRZA 5IGGA 1L4DB 3P4RB 2M0AA 1TWHB 3NXWA 1IKLA 4CJ0B 4LTUA 1ZKOA 3P4PB 1LT5D 3T3OA 2N0SB 4F7XA 4OL7A 1K50A 3EROA 4A3BB 1FRDA 2PVGC 1I4GA 3A8IE 2HQEA 3R3OA 2NVYB 1HTLD 1WGKA 1KLGD 5JPMC 1G2SA 1N60A 2ICEC 1PDXA 3U52E 4ZRZA 2Y5CA 3CQZB 2LEKA 3BZDB 2F0FA 5D14A 4TRDA 4N59A 3D4WA 1YMHE 3W1SA 3B9JA 5FLXE 2FINB 2JWUA 1BMLC 1GUNA 2SDFA 3P75A 1D4BA 1KDCA 4C1NI 2WDRB 4MHEA 1LT4D 3VR3A 1AWDA 5LNK1 1LO5D 2K28A 1VF7A 2MP1A 1RWSA 1XLPA 1B9NA 1Q1EA 2WXOA 1O7LA 2V4DA 4XWTA 1KDBA 1Q90A 3KK7A 5IODA 5IT9E 1ESRA 3AM9A 1MSHA 3ERQA 2C9OA 1HCZA 3L7ZC 4K5XA 1DOKA 1IYUA 5CV6A 2RPVA 4YT0B 3NBHA 4XDXA 4RNAA 1XCTL 4KKTA 5J1ZA 4FVMA 5MPOA 5DNFA 3W3AA 3SE0A 1O80A 3V3XA 2O4XA 3Q8AA 2JYEA 1STHA 3KLSA 1NYQA 2V3PA 1ENCA 1JWAD 3I57A 4YSXB 3E56A 1FM0D 1EM7A 3NWTA 5LHY1 2BA1A 4H2AA 3HZXA 2IT1A 4PQXA 2R92B 2A5HA 4ME5A 2KMMA 4PMWA 1H9JA 3ZJTA 5JOBA 2KCNA 3N6RA 1SAPA 2CW0D 4FP5D 5FK9C 3A8JE 2YEPB 1NYRA 1BQQT 3RUZA 1SYGA 2EKIA 1U4RA 2L32A 1FFVA 5E4XA 1S5BD 4OHJA 2GRIA 4KKIA 3WCQA 1SBBB 1ENAA 1L6VA 4L63B 1EZ6A 2BB6A 2HDLA 2DY8A 4IUVA 5IGFA 2WXJA 3BWUD 1Z7TA 4EVOA 1R4PB 3IFDA 2QDBA 3Q0AA 4MACA 3EFXD 3GTPB 1PTOF 2D5DA 3S14B 2TMPA 3BVZA 1RDPD 4HKZE 5BN3A 2R7ZB 2KEDA 2W82A 2NTTA 1EY7A 2AUKA 2KEEA 3NTKA 1IW7D 3J9CA 4WRDA 3E0JA 1O7ZA 4BWGB 2RKSA 2WS3B 2PZTA 5IGCA 3EGRA 1PFBA 3I4NB 3LNNA 1SSNA 3MXNA 1NVID 4DNRB 2M00A 1M8AA 2WXMA 5KGUA 4DAYA 1C76A 2WXQA 4HJGE 4A3GB 2LJIA 3LWEA 2XNAC 4CGYB 2VB2X 2B63B 4CKBA 1CHPD 1JALA 4A3EB 1PZKD 4UAIA 2RSNA 2JEAI 1I3QB 1TWFB 4A9AA 2L1AA 1ICWA 1OXUA 3BVMA 5I4DA 3MA2B 5K5PA 3PV0A 2IX1A 2J7ZA 4B9XA 2O5IC 1PGXA 2AX5A 4J1MA 1YJIA 3QB3A 1PRTB 1OFFA 2KQ3A 1LTBD 3GV6A 4O1NA 5A35A 3OMGA 1SIJA 3CIRB 1RD9D 5CMDA 2EY5A 3K58A 2F0PA 2BYTA 4KV6A 4ZUJA 1P7EA 1TS4A 2OXPA 1SNCA 5K36H 3L9AX 1SE2A 2QEJC 4XWWA 1ZPSA 4QUFA 1PZJD 4NMZA 4OZCA 2JYOA 2KCCA 4KX6B 1RODA 2XWJB 5C6AA 1VZ6A 5C3WA 1EY6A 4KD4A 5FKAC 4CHTB 3I70A 4N58A 1V1OA 3AH7A 1A6XA 4YWGG 1JC7A 3R8BA 4IFDG 4C3IB 4RHRA 1BR9A 4IUNA 5BN5A 1EWYC 1PUTA 2JA7B 1PRTC 1FNWA 3SR1A 2WXNA 4A6QA 2A6HC 2EJGC 1O78A 1SYEA 3TP6A 4PNYA 2XRQD 4C3HG 2F0DA 4K2KA 5BYRA 3RD4A 2EYOA 1TYGB 2VZKD 4KN7C 5EBCA 3IAM1 3N52A 3GV3A 1FIQA 1I50B 1G91A 2INPE 3GQBA 4QF4A 2B2UC 1SNPA 3C46A 4EQOA 1EL0A 3QJYA 4GDLB 3J7AV 1SEBD 1TVXA 1IUEA 1EY9A 3L4PA 1TKGA 3IAS1 3A55A 4HMIA 4FNFA 4PMCA 1QNKA 2JE6I 4FF4A 4XDCA 1A3VA 2BOSA 3B2FA 3X3MA 4XXEA 2MJDA 1ROEA 1HFGA 1V43A 5HHDG 3VYTA 1BF4A 2NN6G 4FXGC 2FUG1 3NQIA 1WTWA 1LTRD 3HRZC 1BCPD 2MGSA 1TWAB 1D5MC 3HKZB 1KF6B 5DAUA 1UWXA 4N9TA 1B4OA 4HCSA 1KLUD 1JB3A 1Q8IA 5FO9B 2X6LA 4IUUA 5AFWA 4RGTA 1EU3A 1U4MA 5LL6X 2A68C 1B2TA 5C4XB 4DQOC 1XF5L 1BBXC 4P16A 1L5PA 3DUZA 3PMFA 1BCPB 1X32A 2WDQB 3TUOA 3SXHA 5KRUA 5C3EB 2DYOA 3AE7B 4BY1B 1RKNA 3DWQA 4F88A 4FF3A 1L0XB 3P20A 2LHEA 2EE1A 1E10A 4XTCS 1B9RA 5T1GA 3NUCA 3O13A 5JXVA 1NR2A 2WACA 3BS1A 1EY4A 3K0YA 4B9WA 3M85A 4HEA1 1MI0A 4KGTA 2B2WC 1TY0A 3FDTA 4A90A 3HP3A 1WTOA 3P4QB 3L3OC 1TKEA 3AMZA 1ZDVA 1GUTA 4YTNB 4A3JB 1ZXHA 3J81E 2K9XA 1YNNC 4DFAA 1XEEA 3PIO3 5D7GA 3PO3B 3I3CA 2JX5A 2FJ2A 3KBGA 1FEHA 4D2KA 4LLGM 1ZXTA 2B2VA 1YNJC 4H13C 1XCQL 4Y7NB 5CC4A 3ZJUA 4H7BA 1U4PA 1HQRD 1CZGA 4A3MB 1DYQA 4MIUA 1E0ZA 1LT6D 5C44B 2ZXOA 4R9WA 4DN4M 2WAQB 4FXCA 2L5TA 1NI3A 3PUXA 2XRSD 1YNJD 2KDMA 4X3KA 4A3FB 1MBYA 2IGGA 5BMGA 2F0SA 3NPPA 2VZKB 3WOFA 4X3SA 4X3TA 3Q8CA 2VB3X 1FCLA 1GJXA 1E6EB 2A69D 5M5XB 1RFKA 1VZ7A 2E2HB 4R3DA 5I6WA 1A3UA 5JVG3 3SK6A 1STNA 2M9VA 2K05A 3QOLA 2K22A 5CGKA 2CJNA 1X3QA 3U2SC 3PO0A 4Z9CB 3AN1A 2F4IA 1EQVA 1FR3A 2HDEA 1WCMB 3U9OA 1PXUA 1WD0A 3J7YW 1B3AA 5JAVA 4JWSC 1B50A 2L1BA 2F3VA 1CK1A 3M4YA 1EEID 1VDVA 1AYFA 1A15A 1D1KA 1W6KA 2A6HD 2IPKD 2PQEA 3ITPA 1V1PB 3AE9B 4ZAIA 1VDZA 1R4QB 1PTOB 1P7FA 2BE5C 1TWGB 2I38A 1UWMA 2TSSA 4M1UB 4U673 4HRSA 4ARIA 1TY2A 5CBAE 3HG9A 3I91A 1NEKB 4TQUS 1QE6A 3ONAB 1BUVT 4P2CB 2B8FA 3MTSA 3LX0A 1UUPA 3FEWX 2PKOA 2HUGA 1V8CA 2E3TA 1FMAD 2Q5WD 1EOTA 1J7AA 5D3DA 1DOXA 1Y8PB 1ZUD2 4IKGA 5D3IB 1I6VC 2NUCA 1G2TA 3ND9A 4TQ1A 2PNRC 1SYCA 4JPSA 1JOKA 1MPEA 2EOTA 2JXTA 3S1RB 5IGDA 4K6LA 3J80E 1JMLA 3LYYA 4RFBA 5C0XH 1EZ8A 1K51A 1LTTD 1JQ4A 3MP9A 4C7YA 3URYA 3H6MA 4ABNA 1QKZA 3RMHA 4RHSA 2PZUA 2SOBA 2VNUD 4C3IG 2LKVA 4IDIA 1SMYD 1QLBB 5COYA 2ACZB 2FMCA 1TS2A 5F2DA 3RFZB 3NZ3A 2A6ED 2EYHA 2IW3A 1VCIA 4MM3B 1GB1A 1EEFD 3NP8A 1LLRD 3EA6A 1AP0A 5KEEA 3FVQA 3P1MA 3K5MA 4WURA 1U9RA 3VYUA 1QILA 1PGAA 3EVQA 2WLBA 1TWCB 2K5PA 3PUYA 2NN6H 1B1ZA 3AEBB 4WAFA 2X6GA 4Q5VA 2B2YA 2NVTB 3SFEB 1QG7A 2N55A 4HMJA 1ZYRC 2JZPA 2NMQA 2WKCA 1F0ZA 1JCKB 2R6GA 3G7LA 1HQMC 3V05A 4JE3B 1DOIA 1L6UA 5CV8A 3I73A 1F2LA 2A69C 2WKDA 1L4ZB 4DU9A 5EPKA 1PFDA 1HTPA 3TMEA 1PTOH 1Q12A 1R9TB 5C4JB 1N62A 2RVLA 1I4PA 1YQ3B 3D3RA 2WXFA 3AB9A 3MFGA 1Y1VB 2B2TC 3S16B 1YJJA 3DWGC 2C5CA 1QWYA 2F0GA 2BTEA 3QG1A 4HCEA 4KK7A 2ONQA 3T3NA 2ENBA 2JA8B 2B2TA 2NTSA 1NSNS 4IUQA 2VUMB 4NDXA 2LGIA 3SFDB 2E2JB 2BB5A 4LK0M 1E2VA 2KHSA 1LTAD 1OQRA 1F9QA 2F0WA 4FF2A 3HRDD 5G3LD 5I6YA 4B0MA 2EJFC 5A2QL 3ZYYX 1BCPF 2IL8A 3P63A 3T53B 4YTMB 4ZHPA 1F2YA 2N88A 4CJ2C 1CI3M 3DHQA 2J4XA 4PMBA 4KHVA 1EYAA 2N7JA 4ZRPA 1SMYC 1SYBA 3AE2B 3RZOB 1KFYB 1E2WA 2M19A 2FE8A 3A7LA 4WWMA 3MZ5A 1UGJA 1FXAA 5HG2A 5BYQA 1H9MA 3HOVB 3BK2A 2H1EA 4FO2A 3K59A 3W5VB 4CQNA 3TZDA 5JEAG 3FAHA 5KIXA 1II3A 4CKEA 1OO9B 2SAKA 5CBEE 1QNUA 2Q8TA 4V0BA 2MUYA 1EYCA 1M4VA 3OIPA 4KJNA 1OXXK 2LFNA 2F0OA 2WU2B 4IURA 1NAPA 3K6OA 1C48A 4RH6A 3NSWA 4YTPB 4DA2A 2WDVB 4F8MA 2F0NA 1FNVA 5EE0A 1SNOA 1C79A 4QIWB 1TR5A 2LHDA 3H09A 4HN7A 1RTOA 1CTMA 3GTJB 1CQFA 4A55A 3PIP3 2RDFA 3GTKB 1ACCA 2RQXA 4OVZA 3NE5B 4FF1A 2BS4B 2QMTA 1IBXA 3ZJVA 4KHZA 4FXKC 2K03A 5NUCA 5M3MB 1TS3A 4G57A 3VR6A 3DWPA 1QT9A 5KYLA 2WP9B 2ZW1A 3NHHA 3TP7A 1QOHA 1BUIC 3AV8A 1F9SA 3KLRA 1BNZA 1CM9A 3K57A 5EE9A 3PUVA 4HSPA 1G6ZA 1JOQA 2K6AA 2EXZA 4A3IB 1DOLA 2D2CC 1GXDC 1A70A 1C4CA 4NJCA 3C8YA 1XLNA 2JXMB 2N9KA 1A2UA 1E0BA 2EYLA 2XIWA 2RMMA 4KY6A 5CV9A 3I72A 1JWMD 5CV4A 2D5GA 4KKUA 3NVZA 3FKIB 2F0UA 2L9HA 2CHBD 1ML0D 2NVQB 1OXTA 1IKMA 1Q10A 1K53A 3KF8A 3CRKC 3VR5A 3HOZB 5K36G 4KGRA 2RDHA 1RYJA 3BYYB 1JORA 1J8IA 1STEA 3CWIA 4K8IA 2RA4A 3U9SA 1SE3A 2DYMA 1Z47A 1K83B 4I65A 4I7ZC 5EBDA 5ISRA 2WIIB 1RM6C 3NS1A 3AB5A 1FGBD 3QWNA 5BMHA 2BDOA 2MJ8A 5C0XJ 1Y8OB 4K2LA 3ZQ4A 1HEZE 3CHBD 3B2GA 2CJOA 1ONLA 4MN3A 1E9MA 4OW0A 4QMGA 5IGEA 4AYBB 5EJWA 4K5VA 1KRHA 4PV1C 1HUNA 2K0PA 1JROA 2E6XA 3W9CB 1JOOA 2JEBI 1C77A 1LACA 2EPBA 2D9UA 1PTOD 4S3SA 4DK0A 1K52A 1EY0A 2AQ1B 2EELA 2LMCB 4BBRB 3TSSA 2JU6X 1KABA 4XQJA 4XQQA 3HS0C 1WTXA 1LTID 4J3OD 1B53A 2E75C 2O2LD 4B08A 2XVSA 1RHPA 1JWUD 3IKJA 3V2TA 4ZK9B 5C5MA 1F2RC 1PTOC 2MH7A 4EE2A 1WTVA 1OQQA 3E5SA 2DWQA 3AMUA 1AW7A 1JWBD 3RLFA 3T4AC 4IN3A 2FMMA 4NKLA 2K32A 2E2IB 1HZ5A 4OZAA 5TSSA 1MHHE 3HOWB 1E2ZA 1PLFA 1MI2A 3SDZA 2GB1A 2AWNA 4WQMA 1CT1D 4RCOA 1L0YB 2OEDA 2F0QA 4ZOHC 1EWCA 4H0LC 2K7VA 3AU7A 5FOBB 5IIFA 4A93B 2IGDA 1TKYA 1JR0D 1UEAB 5CR3A 2B76B 1S5CD 3GTQB 3J80L 1FD6A 4PT5A 1BOSA 3DMUA 4WORA 4TQ0A 1GAQB 3I90A 5EKLA 3WOEA 3HEJA 2V3NA 4L23A 1SNMA 1GB4A 1C4AA 1GHJA 4ILWA 1SSOA 3I4LA 1VMCA 1WSPA 1FO4A 1DZ1A 2HDMA 2EYPA 4G7OC 2K04A 3D4RA 2V4IB 2F0TA 2PW5A 1DXMA 1JQYD 4OO1H 1EYDA 2NVXB 1RCVD 2NBFA 2IX0A 3GTLB 3VA7A 4FYDA 4C7ZA 1ET9A 3OMCA 4NW2A 2KOLA 3TN2A 2J0TD 4N6EB 4DXFA 3BDCA 3C3LA 1JICA 1D6EC 4BY7B 3GD7A 4HKQA 4NP5A 1N61A 3A8KE 2PW7A 1Y69U 3EQLC 1EU4A 3AE4B 4BA1I 3ND8A 3VYSA 2B2YC 5C2TB 2EY1A 4M0WA 3H8HA 3OPOA 4YIJA 3H0GB 2H89B 3NVYA 2IX3A 1O7YA 1VR9A 4IFDI 4JBWA 2PPBC 1HA6A 2NZ1D 5G5GA 1HXYD 4XT1B 2DBYA 4BA2I 4KKJA 3M7GA 1D1IA 1STGA 1DOMA 3VRAB 2E2DC 3QIAA 4A3DB 4Q0FA 2PZWA 4LK1C 2R61A 1QQRA 3SK5A 1GUOA 3IL8A 3S1MB 1FXIA 3RZDB 2K01A 3F2UA 3FPUB 2M56B 4KN4C 3MHBA 3CRLC 4LJZC 2CVRA 3IFTA 1SJHD 2R3ZA 4TSSA 3S9WA 1SDFA 2FHTA 3MEHA 2RDGA 1MSGA 3D31A 4B0EA 3FPPA 1EFID 4CBVA 1ZEQX 1ZOYB 3NVWA 1LV9A 1F9RA 3RPFC 5ELFA 2X69A 1TJEA 5HI1A 1GPXA 2PW9A 5BN4A 4ID6A 1K8OA 3LB8C 1C9FA 2F0EA 1WXQA 1E7PB 4USAA 1STYA 2QKIC 2KQ4X 1WTQA 2X38A 2D62A 5E4WC 3IT4B 3Q24A 2WINB 1Y8NB 4KD3A 3QOJA 2WQYB 3VR8B 5M5WB 4N9PA 3M7NA 4AS1A 3KWVA 4E6IA 3X3NA 2G1EA 2PLPA 1UNSA 1PGBA 1F2RI 2YYZA 4US9A 2Y5PA 4RA8A 5EE3A 3P7JA 3SHLA 2OF1A 2IJ0A 3VYRA 1SFOB 2MJ3A 2F0HA 2XSCA 2PTLA 1XTCD 1J9OA 1H9SB 5HGTA 1D5XC 1LTGD 4L8JA 2NYZD 4C3JG 3IT6B 1SXTA 3ABVB 2ICIA 2AQ2B 4V190 3S15B 5M3FB 4DXGA 2EYJA 3I4MB 1YNND 3OOCA 3T13A 3M3YB 4RKBA 4KKSA 2F0VA 5GXGB 3I9V1 2L4NA 4HROA 4R8IA 1D5ZC 4ZHOA 1GUWA 4ZKBB 2JSVX 2F0JA 4G7HC 1CFMA 2NB0A 2QILA 2JA5B 5G5HA 5FLXL 3T51B 2EY2A 3NK9A 4NZLB 4HR7B 4P6VF 4ULLA 1F77A 4CKCA 3EJIA 4HTHA 1V8QA 5J39A 2W3RA 4IQZA 2WXLA 3OW7A 2IDYA 3EUB2 5H8YE 1S5DD 3OSOA 1CQVA 1GOZA 3Q8EA 1ILPA 2HTME 4ARCA 3R2TA 4KY5A 1LABA 4RGMA 5EGTA 3AE3B 4IALA 5HFYA 3MHZA 4C3HB 3C1FA 1KTKA 2H4OA 3WDNA 2A68D 2YEPF 4YSZB 2I46A 1Y1WB 3AE5B 3J7AF 5IGBA 3TZUA 1HA5A 5BMIA 1C4PA 3NWSA 4XIGS 3AE1B 4ZQ3A 1HHVA 1BO0A 4YSYB 4YXDB 1C4QA 2B2VC 3S17B 2J53A 3MXUA 3KLSX 1N5WA 4RCNA 4WIPA 3J81L 2L55A 5ELEA 2DLBA 1IL8A 2Q8IB 2BW2A 2KN4A 1IW7C 2KECA 3G6JB 1TU2B 1HRJA 1IGCA 1HZ6A 4ZKCB 4US8A 4C56C 2RSOA 1MHXA 3GB1A 4NAWB 3Q8BA 3C2PA 2ON8A 2V0GA 1OXSC 2CQAA 2QJLA 2WNMA 5I9OA 1SYDA 3A7AB 4M8AA 1TKWB 2Y0SB 5C5LA 3T56B 2F0IA 1KNEA 2IWHA 3HGBA 3AEFB 4FXDA 4CJ1B 3GTMB 3NBIA 1QF6A 3HOXB 5I2YA 3SVMA 2I2YA 5BYSA 1TIID 2LUMA 1H9SA 1EY8A 1PFNA 3M4OB 1UAPA 1F2ZA 2CW0C 5EPJA 2ZT9C 1R7SA 3NTIA 1WTRA 1N5XA 1LT3D 4WH4A 3H91A 2EZVA 2B2UA 4BS9A 3A56A 1VMPA 1SNQA 1PRTF 1I7HA 1NR4A 3S2HB 1ET6A 2BS3B 1N63A 2R93B 1D2BA 1WTPA 3HOUB 5CV5A 4A8XC 4JX1C 5KNCA 1GUGA 1A2TA 3OWFA 4IUPA 1NUCA 4LMQD 4OO1I 2QSDA 2EYFA 4DF7A 2Z1CA 1TZOA 1NENB 5KNDA 1LTSD 3PUWA 3BYTB 1EY5A 1AZQA 1IBXB 1EIGA 4MT5A 3SR6A 4RF0A 1XLOA 4KJOA 2AQ3B 1WRIA 2MHVA 1I4XA 4QUCA 1DJRD 1KNAA 1S5FD 3BG3A 2AUJD 3DEPA 2W3SA 3AE6B 4IFDJ 5C3JB 1KAAA 2E74C 2EDGA 3LWUA 4DNTB 2F03A 3D6CA 1YN5A 4KI0A 3MFYA 4HSVA 4C2MB 3BIID 5JEAJ 3PUZA 1QOFA 2L83A 4OZBA 1FRRA 4C80A 5A2QE 1JE4A 2JP1A 3KBXA 3ETRA 1A3TA 4XYOA 4J8QA 1VLBA 4ZRQA 2BE5D 1DGJA 3FILB 3V96A 2XWBB 5ELCA 3U7ZA 4DGZA 1QOGA 2WXRA 1CA5A 2JYTA 1YQ4B 1IHZA 3TEWA 1PYWD 3K5OA 1BXTA 5J22A 3K5NA 1T3QA 2IGHA 2N9LA 1DOYA 3DEOA 2LY7A 2KACA 3KUPA 1SB3C 1ILQA 1T6BX 1B44D 2F0MA 3TEZA 2Q8RE 4RAUC 2KWDA 1Z6HA 5C0XI 1B9MA 3AECB 3DWAA 4IOIE 2WU5B 1CZWA 2OT2A 2KAJA 3VRBB 1WYGA 2AWOA 3Q22A 2NWGA 2H88B 3CU7A 1FD7D 4KMUC 4OIJA 3KQ4A 4A3KB 1YN3A 5JJZA 1V97A 1I4RA 3AEDB 1Q3LA 4R8NA 3DM1A 1Y56A 3BK1A 4F87A 1XYIA 1DD2A 1CA6A 1TQOA 5FO8B 3S1QB 1YNTE 1XXGA 2DNCA 2GA4B 1BCPC 2LMCA 2KVMA 2JA6B 5ELDA 2ZXRA 3S1NB 1MGSA 2OHFA 5C3XA 4L6TB 5DM73 1DCZA 3JAML 1VZ8A 2Y3AA 3D8GA 1CJEA 3HUI<