4O1NA

Crystal structure of staphylococcal superantigen-like protein saouhsc_00383
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
SESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like protein
publication title Crystal structure of Staphylococcal superantigen-like protein SAOUHSC_00383
rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 52
structure length 189
sequence length 189
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4o1nA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4o1nA01
5FK9C 5ELFA 1HXYD 1I4HA 2AQ2B 1D5ZC 5D3DA 1AW7A 1S5CD 3DWQA 1PTOF 4RGMA 3R2IA 1TY2A 1PRTF 2WV6D 5FKAC 1LTRD 1CHQD 2Z8LA 1F77A 5I4DA 4ZYSA 5D3IB 1ESFA 1LTSD 1PTOC 4C56C 1D6EC 1PZID 1SJED 2CHBD 4RHSA 1PZKD 1BXTA 1S5BD 1YN4A 1JQYD 1LTTD 1SE3A 1BCPD 3R8BA 1FNVA 1V1PA 1I4QA 4RGOS 2NTSA 1TY0A 1M4VA 1LLRD 3OWEB 1SE4A 1KLUD 1HQRD 1PYWD 2O2LD 3W2DA 1TS5A 1LTGD 1PZJD 4O1NA 1TS4A 1ET6A 3EA6A 1G8ZD 1XTCD 1I4GA 5ELCA 1LO5D 3BZDB 2IPKD 1PTOH 1D5MC 1YN3A 1CQVA 4RCOA 1L0XB 4UDUC 4OHJA 1PRTC 2XRSD 4TSSA 3R2TA 1SJHD 1I4RA 1S5ED 2QILA 1DYQA 1RDPD 2QEJC 3V05A 1BCPF 1LT6D 1SXTA 3BYTB 1CK1A 1KTKA 1LTID 1JWMD 1EU4A 1I4XA 1EU3A 2NTTA 1STEA 3GP7A 1XXGA 4Z9CB 1S5DD 1FD7D 3SEBA 1BCPC 2G9HD 1LTBD 1UNSA 3MC0B 1L0YB 1ET9A 1EEFD 1PTOB 4RH6A 4L6TB 1SE2A 1V1PB 2R61A 1JWUD 2J4XA 1SBBB 1I4PA 1ENFA 1RD9D 2SEBD 4RGTA 1SEBD 1QILA 1EWCA 1TS3A 4DXFA 1RF2D 2TSSA 3BYYB 3BVMA 1B44D 4L63B 1JWSD 1CHPD 3EFXD 1CT1D 2RDGA 2ICIA 5ELEA 4RHRA 3TSSA 1LT3D 1S5FD 2XN9C 4DXGA 5ELBA 1YN5A 1LT4D 1EFID 1UUPA 2IJ0A 1HTLD 1PTOD 4K6LA 1FNWA 4RGNA 1PRTD 1EEID 1AN8A 1RCVD 5TSSA 2XNAC 1DJRD 3BVGA 1MD2D 1V1OA 1JCKB 1PRTB 1HA5A 4BWGB 1FGBD 3O13A 4RFBA 2AQ1B 5ELDA 1D5XC 2RDHA 1GOZA 1TS2A 2XRQD 1JR0D 2AQ3B 3BVZA 1FNUA 3CHBD 4NZLB 3DWAA 1LT5D 1BCPB 3DWPA 3KLSX 1KLGD 1T5XD 3URYA 3MFGA 1B1ZA 1LTAD
chains in the Genus database with same CATH superfamily
2N3SA 1YHAA 4QUFA 3DUZA 2Z6KC 1JB7A 2ZW0A 3CCQA 2EYMA 3KBXA 4RGMA 2NYZD 1LV9A 2CQAA 3PMFA 4IN3A 1ZXIA 4HJ8A 4ZYSA 1G91A 2ICEC 5T1IA 1WR1A 3NK9A 1HCZA 1TXYA 3NWSA 1PTOC 2JA7G 2CHBD 4A3KB 3PGZA 4N8FA 3W1SA 4ZOHC 2MFIA 1B4OA 1SE3A 4DHJD 3FC4A 1DOMA 5DPTA 4MNOA 4EVOA 3ITPA 2K05A 4LF9L 5KHOA 3HOWB 1SYDA 4WIPA 4NDXA 1UZXB 5CV9A 2K22A 4KIKB 3V62A 5A2QE 4IG7B 1HQRD 3C2PA 2QIEB 1E7VA 3NEMA 3M62B 1G6JA 5JHAA 1HZ9A 2ZTDA 1BT0A 5I6WA 1TWHB 3GTJB 2B8FA 1WI5A 1UWVA 3AE8B 1TWFB 3RLOA 5EE9A 2KBNA 2WB1E 1YJNA 3SDZA 5D7GA 3CWIA 4M01A 1MHWC 4GSWA 4XT1B 2L32A 1K9MC 1P1AA 1FL0A 2OJWA 1SNCA 3MTNB 1GUNA 5M5YH 1JT8A 5C3EG 2QILA 4PNYA 3KUZA 3VDZA 1SYEA 3SE0A 1VQOA 2N8NA 1V8CA 3S16B 1EU3A 1PH4A 3EN2A 4RM8A 5FO7B 5GMVA 2B39A 4DV3L 1VQ6A 3I4NH 1NDDA 1EWHA 1WX8A 1QWYA 3SEBA 3AE6B 4WQMA 2B63B 2ID0A 1D1IA 3L9AX 2A5UA 5BYRA 1BO0A 2N9XA 3N30A 5AUIA 5A2QL 5HKHA 3L7ZC 1XLQA 2LRUA 2Q2UA 1U4MA 2H5XA 5LHY1 5IGEA 1V8QA 3PF4A 4A4IA 3V6CB 3T1YQ 1QZGA 2V4DA 1F9RA 5DNFA 2LXAA 5M3MH 1T0YA 2WHIA 2NBVB 4NQKE 2R7ZH 2IY5B 3QK0A 4H7BA 4R8NA 3NHEB 5E6PA 3MXNB 3ZUNA 2L83A 3B0AA 3EFXD 4DAVA 4PMWA 3K7UC 3GZNB 3FKIB 3RNBC 4LNKA 4JL9A 2LVQA 3P63A 3KQ4A 5DEHA 2QA4A 3T1YL 3M3YH 2X38A 3AEGB 1NUCA 2BH8A 2OEOA 1E90A 1BKBA 1FNWA 2LXKA 2R7FA 5J22A 5I2XA 1NI2A 5GAEC 4IKGA 3GE3C 1IBMQ 1DJRD 3EJIA 5E3FA 1QVFA 2KMAA 5J18A 1J8CA 4JI7L 5LNK1 1ACCA 3MJ5A 4BWGB 4HEDA 1JALA 2G4DB 4MTKA 1U0LA 4CHTB 2AQ1B 3KLWA 1EL0A 2PE6B 2W3RA 4I6PA 2HT1A 2ZEQA 1YQ4B 1OTRB 2KDFB 1U4PA 3R7RA 1IBML 2N88A 4RCNA 2WGSA 1LT5D 5EKLA 3KLSX 1T5XD 1Q7YC 4QL5A 2BGFA 2I38A 4YTMB 2LXJA 2LUMA 4ZK9B 4CKEA 2DX5B 5IGGA 2L55A 4IO9A 2K14A 1F9PA 3DWQA 4KHVA 4DF7A 3GTLH 4CDEC 1FCCC 2H1EA 4GS3A 1A2TA 4EUTA 5LMNW 4MT5A 3RULA 2BYEA 3I5JC 2IGHA 2LXCA 4XYQA 2V4IB 5BN4A 2R92H 1E8XA 2GVAA 4DV7Q 4IFDG 1RAXA 3P42A 4BBRG 3A4SC 4GB9A 2K5PA 3AU7A 4ICUA 2JA5H 3FILA 3K57A 3MFYA 4KZ0A 2C9OA 1N63A 1Q1BA 4LNOA 3MTSA 2KVRA 1PYWD 1Z7TA 2PMZB 1QVGA 2EKEC 2ZPNA 1Q81C 4J1MA 1NEKB 4DV7L 2MX2A 1C9FA 3TDQA 3JC66 4NXMQ 1UGMA 5TR5A 3X0WA 4IFDJ 3JW0X 1Y1VB 3T56B 1PH9A 5IP4D 3K81C 4DAMA 3RZDH 1QOAA 1WJJA 4HCNB 4K8JA 3DHGC 5JZEB 3Q23A 3MA2B 2F0EA 5IIFA 4DR4L 1WXQA 2PNRC 1GVPA 2RKSA 2HDLA 3NTIA 4GOPC 1XD3B 3AEAB 3FDTA 3OW7A 4K2KA 1ASZA 2M1MA 3U8ZA 2LHEA 1EY0A 2G4SA 1NBFC 4YXDB 4PZ6A 1U4AA 2D3GA 2N0SB 4IPCA 3BS1A 2D9UA 4OVUA 1PFMA 5FR3A 2LFIA 3PVLA 3GP7A 1VQNA 1WM3A 2LJ5A 4OVZA 2WU2B 3FRPB 3CPFA 1TZOA 4NPNA 4A3EG 2ZM6Q 1KD1C 5IA7A 2GBRA 2IL8A 5IP9G 4LK1C 3H7PA 3HGBA 3JSVA 5J39A 3I70A 5JJKA 2FMMA 2FAZA 3AEDB 1F0ZA 2QW7A 3E3XA 1VQJA 1Z9FA 1LACA 3G6EA 3HOUB 1BOSA 2CH4A 2JA8H 2LWPA 2V3NA 1HTQA 3ONSA 2MWSB 3M4OH 2WXLA 1RF2D 3AFQA 2ZM6L 3C3LA 3DHQA 2Z0DB 2Q5WD 2RDGA 5M5XH 3KVFB 2G5DA 1BNZA 2MGSA 3NOBA 3ZJYC 3HKSA 1T0SC 1E22A 3IHPC 1SYCA 2HUGA 1MKHA 4MZ9A 4WAFA 4WJPA 2ATWA 2NCNA 1EEID 2PMZE 3EQLC 1NSNS 2B2YC 1QE6A 5TSSA 1WCMG 4UP9A 4JI2Q 4U673 4KZCA 2EZVA 4A76A 1L4DB 1JRUA 3BVGA 2Z59B 4TQ1A 1ZPSA 1RIPA 3JAME 2O5JC 3MXPA 3O13A 4LUZA 2L12A 3AQQA 4MGIE 4KK7A 4LMQD 1WH3A 4IWOA 4HEA1 4A3BH 1VRAB 4XX5A 2KJXA 2V1YA 2WXHA 3N20C 2B2WC 3KOJA 1EZ6A 1KRSA 2D3BA 2QF7A 3VAWA 1K73C 1B1ZA 1NE3A 1HUNA 1V97A 2NPTA 4K1RB 3BZKA 3NZSA 3B1LX 3E0EA 1LFDA 4POFA 4C3HG 2UUCL 3G48A 1B9NA 4G50A 3R2IA 1HR0Q 3VTWA 4EKUA 1I35A 4BBSG 4JX1C 4B9WA 1I6VC 1BMLC 4B6WA 4BKTA 3GTGB 2R3ZA 3KJPA 4W9GA 4ARCA 4W9DA 5HFYA 1GUGA 1I5FA 4KKUA 2K6AA 4B95A 5C0XJ 1AARA 4OO1H 1E24A 4DR3Q 1LGRA 1VJKA 2KT7A 2LI5A 3GZNI 1A63A 1K8AC 4DBGA 1HR0L 3JAML 5LXIB 5HGQA 3DEOA 1A8VA 5CV6A 2F3IA 1I4QA 1E6EB 4A3KH 1LQBA 4IQZA 2JT4B 3DEPA 2NVQH 5J1ZA 2A1AA 1GG3A 4GDKA 4C1NK 1C4QA 3DCGA 1FGUA 4KGRA 4GNXC 2F0OA 3EVQA 3N6RA 4HJKA 4DR3L 3ICEA 1CFMA 1Y8PB 2HDMA 4I65A 5FLXE 3U58A 5K36G 2F0FA 3IT4B 2FHTA 3HKZE 5C2TB 3ZJUA 1JQ4A 1PH2A 1FXIA 1TGZB 1WSPA 1K51A 2E2IB 1HZBA 5IT9E 4K14A 1UBIA 1Z6HA 2I46A 4HIOA 5CMDA 3T4AC 3CMMB 4RCOA 2F0MA 2PZUA 3UDIA 1G6PA 2DY7A 1A3UA 4OHJA 1PRTC 2CR5A 3PO0A 3DVGY 2JXMB 3HM3A 1SE8A 2IY1B 3V05A 2RA4A 1BCPF 2HIXA 4A3MB 4A3IB 3GV6A 3SHLA 1XTDA 3IFWB 3OAWA 3TMEA 2REXA 1O7LA 4N58A 5BN5A 2CW0C 3BDLA 1MG8A 5JEAJ 3UIOB 4XWTA 2ZJQA 4C2MB 4XGAB 4YCVA 2A6ED 3RMKC 1E1OA 2XVSA 3VYTA 3P1MA 3MEHA 1XNQQ 2BKRB 2WXRA 4JI4Q 3A8IE 2FUHB 3FILB 2ACZB 4FULA 3E9HA 4M8NA 2EJMA 4LF5Q 5EBDA 5FLXL 1GO3E 2OEDA 4XQNA 4YWMA 4BY1G 2TSSA 4ARIA 4W9LA 5IT9L 3H3VI 4YWKA 5MPOA 1MG4A 1OXVA 3S1NH 4NAWA 4DUYQ 1IZ6A 2MA9B 2EE1A 5C0XI 4L5SA 2DAJA 2YVCA 2RDBC 1A15A 1CZPA 4LF5L 3RNAC 1D1KA 2BCOA 2N49A 1LT4D 1TQOA 4DNTB 1PHJA 3VR2A 1XWEA 1GC7A 1MI0A 4JVZA 4WRDA 2HTHA 1V1OA 4KKIA 5FJ8G 4DUYL 4AUQC 2C9WB 2JP1A 3I2ZA 3J7ZC 1FGBD 5E6NA 1PYSB 1QLBB 4RM9A 2Q8RE 4QCLA 1TS2A 1JR0D 1XLOA 3B2FA 1FNUA 3H8HA 4OIKA 3K5NA 1B2TA 1YQ3B 2O5IC 4IUQA 3GTOH 1ISNA 2RHSB 4KKTA 1R7SA 5CORA 4DR7Q 1KLGD 1GC6A 3URYA 2AKWB 1WTOA 1G2TA 1F9JA 2AWTA 2KHIA 1CKOA 4A3FB 2AHOB 3PF5A 2JRIB 4EZJA 1PH6A 3KK7A 1LM8B 4L5RC 4MSQB 4OZAA 1TY2A 5BMIA 2DZIA 3K5OA 1KFYB 5BMGA 1EIHA 5D94A 3QC8B 4X66Q 1VF5C 4DR7L 1AFPA 2LFNA 1QF6A 4A3EH 2MJDA 2JN4A 4C56C 4JI6L 1SJED 4F8MA 2K9XA 2YU9H 1X65A 1PZKD 3I56A 1YN4A 4HRSA 4DR5L 1L6UA 1SLJA 4EZLA 2DY8A 2OQ0A 1N33Q 2WDRB 3ZW3A 3RD4A 4X66L 4ITKA 3OWEB 5IODA 2E8GA 1VZ7A 3T1HQ 3GTMB 1IHZA 3H0GG 3UE0A 1QNKA 2PO4A 3OIQA 1AZQA 2K5QA 3V3XA 2DWQA 2KANA 4WWMA 3CKIB 1X1MA 5JOBA 3EA6A 3GE8C 1G8ZD 1N33L 1KF6B 3RNUA 3KUDB 4L23A 5ELCA 2LEKA 1BR9A 3ML8A 2JYOA 2LRWA 2A69D 3Q3JA 2HCCA 4HLEA 2IPKD 3HOZG 2W9NA 4DQOC 2ZTEA 2KCNA 3HOYG 5DM73 4IM2A 3N1YC 4NP5A 4GN3B 2QEXA 2Y5BB 2EJFC 1I4RA 2K33A 1IBKQ 1HNWQ 1IYFA 3NPPA 2FFKB 4LUOA 3L2PA 5C4XG 2CQOA 2BS4B 1CK1A 2MP2B 2N55A 4NQLB 1JWMD 3C0RB 2RSOA 5KNDA 4CGYB 1STNA 2F0IA 1QZEA 3E9SA 1Q12A 4UAIA 5HI1A 4BKSD 2G9HD 1II3A 3ZNHB 1HNWL 1NBWA 2QDBA 3S2DH 4X6AH 3WWVA 1EYAA 3W9CB 1EEFD 5ELOA 4DV1Q 1X3QA 4EQ5A 3L3OC 5JJLA 4X3SA 2BF8B 2H89B 1IL8A 2KHSA 5C44G 3F1ZA 2KDIA 2MSED 4GDKB 1J19A 4XYOA 2F4VL 1V2YA 1TVXA 4HIMA 2Q2TA 2CFMA 4OZBA 3VH4B 2NN6I 2KX3A 2K7VA 3BG3A 1BBUA 1CI3M 3I4NB 4DV1L 1T5EA 2M19A 3K59A 3LDZE 4YT0B 1WWTA 3J7YW 1WI0A 2CH4W 4WJOA 3CD6A 4C3JG 3PZDA 1N34Q 2GB1A 1F2MA 2MQHA 4DUZQ 3HRDD 2BS2B 3PLUA 2YV5A 2GI9A 4JLCA 2M0XA 2F0TA 4LF6Q 1PRTD 4K0KQ 4G3XB 2PE9A 3ZTDA 1YNXA 5AUKA 3A54A 3OYYA 3T13A 3ZDTA 2JQOA 2IWHA 2WX1A 3OPOA 1CTMA 3QQ8B 3DVNU 1I3QB 1DOLA 2K8CA 3IL8A 4HDOA 3KF6A 5M3MB 4KI0A 2F0SA 2R7ZB 4DUZL 2XRQD 2EYOA 5GADC 4LF6L 1RTOA 4K0KL 1KM7A 1OFFA 4TKOB 3S14H 1YEZA 1HTOA 1S3SG 1VDZA 3D31A 3IKJA 3M3YB 1IKMA 3K0YA 2MQJA 3IAM1 2PTLA 4YHHL 5LL6S 1KRHA 1ZP0B 4ZRQA 2K8BA 3KH0A 3Q6BA 1QVCA 1NYRA 1PA6A 4FJZA 1I4HA 4CKCA 4HR7B 5J2RA 4PZ8A 3S24A 1N6ZA 3WIMA 2DGYA 4DN4M 3H91A 1XLPA 3N9YC 3BZCA 3DHIC 3RNGC 2Z6BA 4NAWB 1U5KA 2SDFA 2I2YA 3MXUA 5E7NA 1JQYD 4J15A 4TVAB 2EKIA 2CHWA 2BE5D 2Y0SB 3A7AB 4W9JA 1WZ0A 4RMFA 5GXGB 4GOCA 2ZXRA 4N59A 1XPUA 1C4CA 2AX5A 4K5XA 2IO3B 2JXTA 3K9OB 1WM2A 2OJRA 1JMLA 1JJCB 3RD2A 2E76C 1VQCA 1I6HH 1VLBA 2L7RA 4CJ0B 5G2NA 1DZ1A 2CWPA 5IP7G 3TBLD 2LVPA 1TS4A 3QOLA 4UHVA 2WXGA 3LWUA 2R92B 5IN7A 2C5CA 2K03A 4KJNA 3VA5A 5D2MB 1L1OB 4B0EA 1YJWA 2WNMA 1PTOH 3DBSA 3PQIA 4LFCQ 1I50H 2A19A 2JA5B 1L2FA 3ENEA 4YIJA 2KJRA 2L00B 4EQNA 4P75A 2G9DA 3SK4A 4HJGE 3LX0A 1MJCA 2P5ZX 3Q2AC 5IGCA 3OIPA 4RKLA 2B2VA 2UU7A 1E0BA 3AEVA 4JYAL 4YTPB 4KN7C 4GN4B 3ND9A 4LFCL 5DM63 1HZAA 4A3IH 3I73A 2DJGC 2MNAA 3RZDB 1OQQA 3JVZX 5C23A 3H3VC 5HG2A 4OW0A 3V60A 2M9VA 2OHFA 5I2YA 5AEKB 4JGHB 2HCIA 1VQMA 4DK0A 1GUWA 2O4XA 4AYBB 5EGTA 4KSKC 4NAMA 1MIUA 5M3FH 4NB3A 4C2MH 1N32Q 2MHJA 3QA8A 4G57A 3MVVA 4ZKCB 1CJEA 3NVWA 4XTCS 1V9JA 3P75A 1TS3A 1P7FA 1YMHE 3F2UA 2W54A 1E0ZA 1H9JA 1TWGH 2LASA 2KCTA 2BA0A 1AP0A 4A3GH 2VXWA 3O65B 4A93G 3AE1B 1LT3D 4AH6A 1N32L 3J81j 2NS5A 3M63B 2A5HA 2Y0SE 5ELBA 1J6QA 1OTCA 4W9CA 4W9FA 2IJ0A 3I3CA 2CCZA 4LF8L 2CHXA 2WXFA 2W82A 4A55A 4KY6A 1HZCA 4DAYB 3CXCA 3W1BA 3DBLB 1AN8A 3A5ZB 2OOBB 3L17A 2JA6G 3PS6A 2VUMG 3GTKH 5C5MA 1JOQA 2JA8B 1PH5A 4YCWA 3W1SC 1HZ6A 2DYMA 4LDTD 2PVGC 1V9PA 1M94A 2IBIB 3OWFA 1VQLA 5ELDA 1C78A 2RDHA 2KEDA 2JA7B 5M5XB 3NBIA 4FXGC 4ALPA 1WGHA 4HJAA 3QAQA 2X69A 1WTXA 3DWMA 4A3OA 3Q0AA 2CS4A 2R93H 3UQAA 3I90A 1PQSA 1SF0A 2PI2E 2KVMA 4EGVA 2N4FA 4FA6A 5C4XH 2HQLA 2J0TD 1STBA 2WB1B 3NZ3A 3Q8EA 4MJSA 1NMGA 4G11A 4RA8A 4DR2Q 2I1JA 1TWAH 4FF1A 4WH4A 1O7IA 3K8AA 4A3BB 1IPGA 1XNRQ 3AV8A 3R7QA 1Y8NB 1BVSA 3QO2A 4AYBE 1GHKA 3NJTA 1KDCA 4H2AA 2I0QA 3KF8A 3FPUB 3ZYYX 1J0GA 2B3AA 5EBCA 4KJOA 4DR2L 1KJTA 4YSYB 1FRRA 2KN5A 1MSHA 4X3UA 4DV2Q 1HRJA 3VR9B 1TJEA 4DNRB 2N7JA 1JROA 2EYPA 4USAA 3W2DA 1RKNA 1AE3A 1IBXB 3UF8A 1LUZA 4TKNA 2IT1A 2KN4A 3H9DA 4NW2A 3GTMH 1ET6A 1UE6A 2YTVA 1ROEA 3BY4B 3FAHA 4HMIA 1I4GA 4YCUA 4HPPA 4DV2L 3T8MA 1YX6B 3KYHC 3BZDB 3SK5A 3C1FA 5CV4A 3NHHA 4RNAA 4Y7NH 1CQVA 1XO3A 3PO2H 1QUQB 4KSLC 4WWPA 4BZAA 4KD4A 3WOEA 1SSOA 4A3DH 1WJUA 5JXVA 1SJHD 2VB3X 4B9XA 2NVQB 4PMBA 4S3SA 1CZWA 4B08A 4OIJA 3S2HH 4B3RQ 3AE2B 3EUB2 1Q5WB 2ZCCA 3HOXG 4OGQC 1M8AA 1VQGA 5A35A 2K28A 3I4MH 3SHQA 4F87A 1EWIA 4AJWA 4IWQA 3TS0A 2XGTA 2INPE 1BCPC 2DLBA 1UAPA 4O0AA 1OXUA 3U9OA 2W55A 3QOJA 3SU8X 1SDFA 2WKCA 1Y1WG 4B3RL 2QGQA 5FLMH 3U30A 4AIMA 2KWDA 2KFKA 2V3PA 2J4XA 4M00A 1I4PA 3A9KB 3G6JB 2AWOA 2A6HC 1MHHE 1JJ2A 4R4OA 2Q8TA 1J8IA 1EWCA 4LDTB 3RZWC 4IURA 2JE6I 2GBNA 2B2TA 1VCBA 3TEWA 1YJ9A 3NY5A 3SR1A 3A0JA 4EX5A 1C9OA 3JAMc 1PFSA 5ELEA 1ZUD2 4GXBA 4XWWA 3J80E 2XSCA 1V86A 2ZNVB 2JA9A 3JAMi 1YNNC 1FFVA 4JBMA 1UF0A 3TP6A 4ULLA 3UDGA 3TUOA 1Y69U 2M00A 3H09A 3VYRA 3L16A 1QOBA 4IUUA 4C3IH 3WA0A 3S1RH 1N9WA 4MM3B 2KNBA 3RI7C 1DOYA 1RM6C 2XK5B 3ZJVA 2LZ6A 4R4IA 3CQZH 1SIJA 1DXMA 2CU3A 4NJ7A 1I3QH 2WAQG 1Y56A 2WU5B 2RGFA 2AQ3B 2WDQB 3CCVA 3S1NB 4GZYC 1IGCA 2J0JA 3W1YA 4FNFA 4BOSC 3UQBA 4IOIE 1ML0D 4NZLB 3TL5A 1HPCA 3PIO3 1FEHA 2K1FA 2RF4A 3TP7A 2FXQA 4DNIA 3CPWA 4XIGS 1BXTA 1SROA 4DXFA 2JWUA 2D0OA 3I4OA 1C0AA 1P7EA 3HOVG 1F2LA 4ODGA 3V96A 4F7XA 5D3DA 4R8IA 2C5LC 2EYFA 2Z6KA 5JVH3 5C6AA 4WURA 1YHQA 1LTRD 4A3PA 4F8CB 3TMPB 1TKWB 1FRDA 3SR6A 1F9SA 1IUEA 2N9LA 4G4KA 1EWYC 1G51A 4UP7A 4IUPA 1NENB 1YJIA 3EHVA 1OO9B 1DONA 3ER0A 3AB9A 5FLXc 3HOWG 3GTOB 1H4RA 1E7UA 1HZ5A 2D10A 4ICVA 1OXSC 2C7HA 1EYGA 1VR9A 1IBLQ 5IT9c 1X3FA 1UE5A 4G0NB 4DHJB 2V0GA 2F0VA 3DBLI 4MELA 4HDQA 4FJVB 3PO3H 2WFWA 1DGJA 4P1BC 4B0MA 4Y52H 1VS0A 1E2ZA 1J7CA 5C1ZA 4BBNF 3J7AV 5AZHA 3P4SB 4A3EB 2F1MA 1YNJC 4PQXA 3AH7A 1LO5D 2YU9B 4CBVA 4YTNB 4AOFA 2JA6H 1DD2A 2F0DA 2L5TA 1WMHB 1S4ZA 2QMTA 4XYCA 2CU1A 5IO9A 4TSSA 1G2SA 1SNMA 1S5ED 4LWCA 2QEJC 3PT2B 5AFWA 4II3B 4MJSB 2OQKA 2BH2A 3ZXVA 4QQBX 4E6IA 1LTID 3R93A 1N5WA 3AE5B 3H7SA 3L0WB 1I4XA 2BPSA 1PDQA 2WXJA 1VQEA 3VR8B 4IUVA 2B63G 4B9KA 1S5DD 2BDOA 3FVQA 1S1QB 2D2QA 3Q3NC 2BVCA 2D07B 3U50C 3DMUA 3KF8B 2A73B 3RR5A 1WGRA 2KC1A 1ET9A 3MHSD 1YIWA 1A0IA 3STBD 1A2UA 2LMCB 2L9HA 1WTVA 2YTYA 5JJIA 3H6NA 3RUIB 4OONA 1K8GA 1RD9D 3CCSA 1Q8KA 1T9HA 1M1KC 5EE0A 3A8JE 4R1JA 3MZ5A 1C4AA 4HSVA 2A74C 2EXZA 4NXML 1FJGQ 2JJQA 3BVMA 1NYQA 4NKLA 2DBYA 3FKIG 3W5OA 1CHPD 1SFOH 1UELA 5IOCA 4AWJA 1Q0WB 3ML9A 3PUZA 2K75A 5AJ3Q 1NI3A 2INDC 2B2UA 4W9EA 4D2KA 4KV6A 5IYBG 1SYBA 3S2DB 1WYWB 1EFID 4MIUA 1S3OA 1YN5A 4ILWA 1PTOD 2NBFA 1FJGL 4I6NB 2MBQA 5DAUA 2L05A 2MRPA 1XLNA 4DK3C 4KGSA 3RN9C 1T6BX 2XTIA 1MD2D 3ULJA 4BBSB 2KZRA 2N7EA 2RPVA 3AEFB 1K8OA 2PQAA 5AJ3L 3LNNA 3PUXA 4RFBA 1FIQA 2K25A 3NS8A 4GLSC 1YJJA 1ZYRC 4NPSA 3NUHB 3I63C 2HDEA 1TR5A 3BJUA 4ZDVA 2OTLA 3RFZB 1YD8U 4US8A 2L11A 2JA7H 4JI1Q 3VUWA 4C00A 1ESRA 2KFKB 3NZUA 1B53A 1TT5B 2IW3A 1JWAD 3APCA 2A6HD 3HKZB 3NBHA 3KWVA 2GA4B 4C80A 1EUJA 2B76B 4E3CA 3ERQA 4S0RA 1O80A 3PHXB 1QT9A 5JPNC 3DDCB 3S1MH 1XMQQ 3N52A 1HA6A 3MP9A 2JZZA 2JZ3B 4HCSA 4JI1L 3FP9A 2PKOA 3AXCA 1H9SA 1CSQA 1XX8A 2YEPB 5LLIA 4LCDE 1X54A 3ZDMC 1Y1WH 3S14B 1Q1EA 4WJWA 4J6HA 4ZRZA 1KNAA 5T8IA 3ZQ4A 5EKIA 3F8TA 1XMQL 4JI2L 2F3WA 1YVCA 4A3CG 3CMEA 1LTLA 1M4VA 2YYZA 1SNOA 5D65A 2BS3B 1WFYA 1R4NB 1WXSA 5C3EH 3I55A 1C7YA 1HR0W 5C0XG 4AS1A 1STYA 1TS5A 3PV1A 1Y1VG 1X3EA 1JW9D 2PW7A 4O1NA 3RN5A 4J8QA 1WD0A 2KJHB 5D6JB 1PUTA 3A1QA 2MP2A 4W9HA 5C5LA 3VUXA 2FMCA 1EY6A 4P74A 3Q3FA 4X3TA 4GGQA 2LJIA 1N5XA 2G45B 3CCEA 1VZ8A 2IY0B 3EIVA 1MI2A 4MH0E 2L1BA 2VY3A 1J9OA 4BXXG 2IGDA 3NVVA 3HVZA 4GOPA 4BY1B 4HCPB 4ZRKA 4ZHOA 1C79A 2KENA 4NJ6A 4EQOA 1CA5A 2WDVB 4JPSA 1EU4A 1I6HB 3EFUA 2C35B 3L4PA 2HD5B 3RZOH 4R4CA 3AB5A 2MBEA 3CIRB 4E74A 3P4PB 4US9A 1F2ZA 5H8YE 4DWFA 3ZLZA 4KTAA 4FYDA 1P9DU 3VA7A 3IT6B 1PTOB 3NVZA 3HOVH 1WJNA 1I50B 3MEFA 3HOUG 3BWUD 3VRAB 4L2YA 1X6OA 4DKAC 1GAQB 1KRTA 5JEAG 2VZKD 4FVMA 4QB4A 1ZDVA 4DR1Q 1R9TH 2NZHA 3PZ8A 1EF5A 4EFOA 1VQ8A 3KWLA 4AQYQ 4JBWA 4L63B 4LNFA 3MWYW 4KLKA 1PGBA 4A20A 1CT1D 4V0BA 3ULPA 4FDBA 2EQSA 4CDDC 4FHJA 4DK1A 3AE7B 4GLAC 3F2BA 2WP8J 4HSPA 1A5RA 5FO9B 1KAWA 2HD3A 4HIKA 5M3FB 4LLGM 4AQYL 2KFJA 3V61A 3ONAB 1P8LA 1F9QA 2VB2X 3BU2A 4S17A 1MPEA 3TCAA 3MHZA 3TEZA 2B2YA 4KHZA 4LJOB 1LYLA 4L8JA 3OSOA 4DR6Q 3NVYA 2K4KA 3LYYA 3AI5A 3GTPH 1TWGB 5JVG3 1GNUA 3AMUA 2NVUI 4A3GB 2DN8A 2ONQA 3CHBD 3PSIA 5T1GA 4QJFA 2EYLA 2LKVA 1TKGA 2EDGA 2PQEA 1XNQL 4IFDH 4K3BA 1FYCA 4ANVA 2ZXOA 4XQQA 4JI4L 1V1QA 1D4BA 4OELB 4BBRH 4ANWA 1YNTE 2R6GA 1H9RA 3S9WA 1QZHA 2WX0A 1PFBA 5ELFA 4M1UB 4A3JG 3GTKB 5DPRA 4C4VA 4IZ8A 2N78A 3M85A 3HRZC 2NVYH 1HHVA 5BR8Q 4KD3A 3QHTA 3AECB 4IM3A 2OWOA 2Y3AA 1Y14B 2VH1A 2E74C 2EY6A 2ZVNA 2N1VA 3F2DA 1IYUA 4XQJA 1KC8C 2R93B 2WXPA 1D7QA 1E9MA 3RLNA 3PREA 4BKSA 3TEYA 1Q46A 4XDDA 3P4RB 1LABA 5C4XB 4QY7A 2NN6G 1GKHA 1L1OA 4YWLA 3UIPB 3DVGX 1D2BA 3I57A 4N9F4 4GN5A 4ZUIA 1WXVA 2PQAB 3B6YA 3PRMB 1WR6E 1TWAB 2PI2A 2MJ3A 2X8XX 1TIFA 3DBRB 1CUKA 1PV4A 3B2GA 4GNXA 2V9HA 1F2RI 5IYBH 2H4OA 4TQ0A 5L37A 2SNMA 5CV5A 2JX5A 1Q8IA 5IGDA 3NTHA 2MPMA 2NUCA 1D5MC 1PVOA 4UDUC 2NMQA 1E7PB 2XRSD 3NBHB 2CWAA 1K83H 3R2TA 4IPHA 5IP9H 4A3MG 2Z4IA 4A9AA 1PGXA 1DYQA 3CF6E 2PNHA 2V1CC 4B3TQ 1KTKA 4O42A 3D6WA 1STHA 2XWBB 1CMXB 1WY8A 5L83A 1H9SB 4N9TA 1FD7D 5EPKA 2DAFA 2CHZA 3VFKA 4FADA 3E5SA 2IO2B 3IBEA 4YSZB 4HJ9A 2JK8A 3K9PB 2VQFQ 3CSFA 1DM0B 3LJ3A 2JSVX 4B3TL 4Y7NB 2G1EA 4HTHA 3EC8A 4HMJA 3PO2B 2Q2IA 2GBJA 4JV5Q 1KH0A 2KWVB 4OEMB 1V5TA 4A3DB 3RLFA 4EEWA 4Q0FA 4GKJQ 3QJZA 3GV3A 4FF3A 2BYTA 3T1HL 1WCMH 3KLSA 3S2HB 3NTKA 4GMVA 4DAYA 1RJTA 4P71A 4IDIA 3DQVA 2FE8A 4A75A 2MUYA 1R4NI 5CGKA 3CCMA 4NJCA 1E2VA 1JWSD 3I4MB 2OCEA 3A1QB 2DNEA 4JV5L 1SYGA 4OX9Q 1ILPA 3WALA 3S17B 3S1QH 4KY5A 3HM6X 3NQTA 3H3VH 2DZMA 4YSXB 1VF7A 1WD1A 1ENCA 1UEBA 2L0FA 3TZDA 1IBKL 4GOPB 1VQBA 5IY0A 1QOGA 2MJ8A 3SXHA 2KWCA 2BBCA 4HPLB 1ONLA 1MGSA 3C46A 4OX9L 1EOVA 3ZIMA 1TKYA 4C3HH 4CDFC 2N9PC 3J81E 3LWEA 3L08A 4BBSH 3SVMA 4LF7Q 5C4ZA 1EY8A 1NVID 2KOLA 3MC8A 2ZVOA 1WRDB 5COYA 2K5VA 3CAMA 4G7HC 1EF1A 2SAKA 4GN1A 2MBOA 1U4RA 4A3FG 2CJNA 2GBMA 2WXQA 2WS3B 4C3IB 1JC7A 5KNCA 3S1RB 3CCRA 1RRBA 5DCNA 3K0XA 4LF7L 2ZNVC 4JQWC 2KC2A 2W3SA 2NVXH 1EZ8A 1PMRA 4TQUS 2WV6D 4ID6A 2EXDA 3CQZB 2RVLA 2BT6A 2E2JH 1FM0D 2J53A 2QJLA 3PSEB 4DPGA 2Z8LA 2F0QA 5K36H 5KRUA 1O78A 1RFAA 2UYZB 3A8KE 1IBXA 2GRIA 2K04A 4BY7G 3HS0C 3OW2A 1PZID 2Z4HA 1CKMA 1N34L 2N9KA 1K3RA 4CHKA 2CW0D 2E2HH 3CMAA 1X32A 5KHQA 2RCFA 2DYOA 3UGBB 5C4JH 1KNEA 1V1PA 4ME3A 3PV0A 3Q8DA 3OMGA 3PLVA 2KQSA 5JEAH 3ND8A 3Q6SA 1E8ZA 5JHBA 3W3AA 3WDNA 4JI5Q 3APFA 3E0JA 2F0WA 4F88A 2X6GA 1QUQA 1Y8OB 3TEXA 4JWUC 1OXTA 4H44C 3UE1A 2MHVA 1UBQA 2Y5CA 1N36Q 2F0NA 3N1XC 1K28A 3DXJC 4ZYNA 1XTCD 1AYFA 1HE8A 5E1FA 2JF5A 1X3GA 4GKKQ 1K0RA 3HIZA 3K7AH 2KLGA 1GJZA 2VS1A 1EQTA 1NTGA 4YY3Q 3RUZA 4BBNC 4PZ7A 4W9KA 1K52A 1NMFA 4W9IA 4IPDA 2GVBA 4C4VB 3L0OA 1N36L 2QHOA 2CVRA 2DNCA 3BYTB 4N8X1 1A3VA 5F2DA 1ICFB 4K5VA 4ZUJA 4DFAA 2C60A 3PO3B 2IO0B 3QWZB 1TU2B 1XJVA 4GKKL 3A9KA 4BY1H 3LB8C 3NS1A 3Q8BA 1VQFA 4JOIC 2B3GA 2MW5A 2KQ3A 4X3KA 2INCC 2JYTA 2L76A 1QNUA 3SDLC 3RPFC 4A8XC 3C1EA 1TYGB 3AULA 1WXMA 1HH2P 1JE4A 4OWWB 4XE0A 1SE9A 4PYZA 2JA6B 3ZNGC 4A3JH 3TZUA 3J80c 4LW1A 4DV4Q 1E7ZA 3GO5A 3J80i 1RLFA 1WZ3A 1PH7A 1Z5SB 2VW9A 2E6XA 4C1NI 1SAPA 2FNJB 1UWMA 4A6QA 2MCNB 2LGSA 1EIFA 1FCLA 5FJ8H 2ZXPA 3I4NG 4MM3A 2E75C 2XK5A 4GNXB 2ICIA 4OXPA 3TIXA 4DV4L 3DBRI 2Z9HA 1RL2A 3M3JA 5JPMC 1IXRA 4MHEA 1A70A 1C1YB 2K1BA 3LGJA 2K3UA 4IC7B 2WDTB 1HTLD 2NVTH 1PFNA 1W6JA 2D0PA 2NN6H 1OEYA 4BVUC 3A33B 1S40A 3H15A 1WRIA 1WTHA 2IX3A 4DV6Q 1FXAA 4M0WA 2KHJA 3AN1A 5M3MG 3KJOA 2BB6A 1YOVB 2R7ZG 1JCKB 1PRTB 2AUJD 2PW5A 4O2DA 4ZRPA 1C3TA 3QJYA 1E8YA 4B3SQ 3CP0A 3SK6A 3QARA 3VR3A 1GOZA 1SFOB 3W5VB 2F0LA 3WAMA 1VMPA 2ZZPB 1ZE3D 2IHFA 4L5QA 4H02A 4DV6L 4HN7A 3DWAA 3H1UA 2M0AA 2PVOD 3EROA 2LSSA 2O6VA 3G7LA 1B8AA 3MFGA 4HROA 2L0TA 5I6YA 4MEMA 5FK9C 2KA7A 4WQOB 1PH8A 3PIP3 1KXLA 2G3QB 1S5CD 3IFDA 4MGYE 1PRTF 3X3NA 2WYQA 1MSGA 3QX1A 1SNPA 4AP4C 3H0GH 2WXKA 3AM9A 3IFTA 3DBHB 3AEEB 3AEBB 1F77A 4RWSC 5D3IB 4Q5VA 3CC4A 4F7ZA 3R3OA 4FO2A 5JH5C 4BKGA 4RHSA 1DOXA 2EYJA 4K7UA 3U52E 1OXXK 1QB5D 5ELNA 2GLSA 1YQBA 5CHFA 3R8BA 4KV2A 2PZWA 3ULLA 3WOFA 4CDCC 5I9OA 3HOZH 2BW2A 4ZKBB 2KACA 1TT2A 2B8GA 3HOYH 1V49A 1TY0A 1NJIC 3Q24A 1A3TA 1LM0A 1SYFA 2VNUD 3PUYA 2DNFA 2LS01 1AZPA 3HOXB 1D3ZA 3CC2A 1WMHA 1PZJD 4HIDA 1FVIA 3S1MB 1WFQA 4EE2A 2KDMA 4JI0Q 2K8HA 5FR6A 3SD5A 3PCOB 4R4TA 2R92G 3ABVB 2Q8IB 2HHHQ 4HWIB 3I8ZA 1Y1WB 2K01A 2UXDQ 2EY5A 3L10B 2JY6A 1HJPA 2F52A 5I9PA 1H95A 2DHZA 1UEAB 1WVLA 3OJ3A 5BO4B 4JC0A 2FJ2A 2NB0A 2ZJDA 1TTNA 1L0XB 5KNBA 1N60A 5EPJA 1GJXA 3SFEB 3D4WA 4RAUC 4JI0L 1VD2A 2EIFA 5C44H 5C3EB 4QIWB 1B9RA 3G4SA 2ZW1A 4IUMB 2I1KA 2UXDL 4XC2A 3ZTCA 3K58A 2LMCA 3I3TB 1FD6A 4DA2A 4K81A 4POGA 4LNIA 1WYDA 3KBGA 4K5WA 3CF5A 1XNRL 2WIIB 4B3MQ 2FINB 3EECA 4YWGG 3K5MA 2BKFA 1LTBD 2F03A 4WFN3 3RMHA 3U9SA 4NXNQ 3P2BA 5E4XA 1K8RB 4C3JH 5GQOA 2K5HA 1V1PB 1JWUD 4CKBA 2O6VD 3U2SC 1JICA 1G291 1ENFA 3DM1A 1KIXA 3BIID 1WTPA 2K52A 2EPBA 2SEBD 1SEBD 3CU7A 2UUAQ 2K6QA 2N7DA 3OJ4B 2JSOA 3GDEA 4B3ML 2D3AA 1R4QB 2K5DA 1B44D 1NAPA 2BYVE 4DDGD 4LAAA 3RZOB 2LGDA 4RHRA 4CYEA 4X65Q 4HVBA 2BTEA 2F0HA 2TMPA 1GUTA 2BA1A 1WIAA 1IKLA 4DXGA 2ZCBA 2UUAL 5M5WH 3M4QA 1QOHA 4H13C 2KDBA 2L15A 4LF9Q 3HOVB 3S17H 4LNNA 3A56A 2JA8G 3UDXA 3VR5A 2JWZA 3ALBA 2LGXA 4X65L 2ASBA 1KHIA 3S2AA 4FXCA 1R9TB 3I9V1 4K7WA 1GM5A 2IX1A 2XBBC 1MJEA 3PIOA 1MFWA 4RKBA 4ZQ3A 2MBHA 2WQYB 3AMZA 2GBKA 1XPRA 1STGA 2K32A 1CKNA 1VCIA 1VQIA 3NENA 3T16A 4XXEA 2JUOA 4LTUA 1EY7A 2IHEA 3DWPA 2H88B 3ZKJC 4HK2A 3FHWA 4P6VF 2WB1G 1PXUA 4QIWE 3VYUA 3EFCA 3M7GA 1TBEA 2YLMA 1N8RC 1D5ZC 3M4YA 5KEEA 3IVFA 5G5GA 1EO6A 3RYTA 4FJYA 4G7ZC 4A3BG 5FKAC 3GTQB 1PH3A 5E6JA 5KYLA 3GTPB 3AE9B 5I4DA 1BBWA 3KLRA 3ZRFA 3UINB 4DV3Q 1VQ4A 5IP7H 2HQEA 5LMUQ 4K8IA 4TRDA 5NUCA 1DGSA 3G71A 2GMIC 3CCLA 3Q8CA 3TJPA 4JBJA 1I7HA 1WE6A 2R2OA 1YZ6A 3H94A 1F1HA 3TRZA 1LTTD 4XDXA 3GS2A 1EFWA 2NBWB 3RNFC 5EE3A 4MTNA 4BBRB 2C7NB 2NTSA 2D3CA 1ZGUB 4M0WB 2WAQE 3BDCA 3QG1A 5LMUL 2NVYB 2PCFB 4RF0A 4ASWC 2L8JA 1RYJA 2K5WA 2A68C 1D8LA 3AFPA 1WX7A 3I7FA 4FF4A 4P16A 2F0PA 5CTRC 4EQPA 1C76A 2K0PA 4OO1G 3ECIA 3J80L 2EMTA 4E71A 5EKKA 4FBJB 4GLVB 3MJWA 2UWQA 3EGRA 4A3KG 2MJEA 2GN5A 3OHXC 4IUTA 1V5OA 2O6VB 3ZGZA 4RMAA 1YI2A 3I91A 4KMUC 2IYDB 5LXHA 2B2UC 4DGZA 4JI7Q 1GD7A 2HE7A 1V43A 1H9MA 2V3SA 3AE4B 2AMCB 2X6LA 4KKJA 3DLLA 2KMCA 5HGTA 1VQ7A 2PYKA 2XIWA 3ZVVA 2D2CC 1AH9A 3DBHI 1EY5A 1UNSA 4NMZA 4A93H 5CC4A 1A6XA 2JU6X 4P1CC 1L0YB 3PRPB 3HZXA 3R3MA 4ANUA 1NNXA 2Q2HA 1SIFA 1IBLL 1SBBB 3SGIA 1PGAA 4LJZC 1Q1OA 3A9JA 1K83B 2WINB 3DPDA 1CSPA 3RZFA 2LGYA 3QWNA 1OQYA 1EYCA 3D0FA 2VUMH 1BUIC 1L4ZB 1C48A 4JI3Q 1X56A 3HK0A 1J7BA 4DK5A 3RCZA 2KEEA 1JJGA 2K39A 2PPBC 2FBWB 2NZ1D 1VDVA 2KLCA 1E1TA 1N61A 3P7JA 2XN9C 2KK8A 4DHZB 1BBXC 4M8AA 3J9CA 1W6KA 3SK8A 3P4QB 4V190 1WGDA 4JI3L 3L13A 2I07B 1GUSA 1VQKA 1EQVA 3KDFA 3VHTC 2JXXA 1WCMB 3T53B 3U4ZA 3MC9A 1DCZA 3D4DA 5C3WA 1K8MA 4BAXA 2AYOB 3A4RA 3LXFA 2K5NA 5HY6A 2NWGA 5IKCM 5LMNQ 4DK6C 1C4PA 4XZ4A 2A6EC 4L5TA 1WXAA 4TV3A 2I5HA 1YBYA 3S1QB 2HTME 1Q90A 5DLQE 5CBAE 3A74A 3UDFA 4DR4Q 2PPHA 1O7ZA 2KWUB 3T51B 3QR8A 3MXGA 5C3XA 5L95C 4OVVA 3CW2C 5LMNL 2HIVA 1L0WA 3D3RA 4LF4Q 1OEYJ 3S15H 1ZXHA 1GUOA 3U7ZA 2FCQA 5AZFA 4K6DA 4OO1I 2M4NA 2M2LA 3BDOA 4C3HB 1FFUA 3E6ZX 5IOIA 2F0GA 5DPSA 3NQIA 3KFUA 1V81A 1LTSD 3VDYA 3NRZA 2EVBA 3CRKC 2K6DB 2WXNA 2J0KA 1D6EC 1XMOQ 1YX5B 1S5BD 5IGFA 1VQPA 1Q86C 4LF4L 2F0JA 4ABNA 4FLHA 1BCPD 3E9IA 1WOCA 3X23A 1IP9A 1JB3A 2IZVB 2J7ZA 1HEZE 2PLPA 1Y8RC 3NE5B 2O2LD 1O7YA 2NVXB 3DHHC 4OWXB 1MJDA 1XMOL 2N1WA 5CHVC 1AEXA 1I94Q 5G55A 2E2JB 1B7YB 4MN3A 3HOXH 4ZAIA 4DHZE 3ZO5B 2D5DA 1K53A 1GXDC 4PT5A 3J7AF 4GLXA 3A7LA 2D5GA 4QMGA 3PUVA 2KO3A 4JW0A 1CKNB 5FOBB 2AL3A 4ACFA 1ILQA 1WTWA 3F2CA 2E2HB 1UE7A 1YNND 2LGIA 5C4JB 4BA1I 3IRBA 1JOKA 4MSMB 4A90A 1I94L 1WTQA 3WAPA 4JG2A 3RN2A 4UPAA 1GB4A 3D8GA 3TEHB 4JK1C 2ON8A 2DZJA 4JWSC 4F1SA 4PS7A 1STEA 1IYJB 2KCMA 2ZTCA 1WTRA 3IXSA 4MGZE 1H8CA 4WJ4A 4ME5A 4DAPA 2F4IA 3VTVA 5DPWA 1E8WA 3I4LA 2KAJA 1KDBA 3WCQA 3FMCA 5CYUA 4OZCA 3K7AB 1SSNA 2O2VA 1WX9A 1SE2A 2D11A 4LUVA 2YEPF 3GB1A 2Z0SA 3J7A5 3QCAA 4IFDI 3HFZB 5KGUA 2DENB 1FO4A 3DOWA 2PEAA 2DJFC 2LUEA 2JEAI 2UUCQ 1JORA 1CM9A 2A68D 1SNDA 2I5MX 2PJHA 4RG1A 2A69C 3QB3A 3ETRA 1QJOA 3TSSA 1IW7C 4DDID 2MLBA 1S5FD 3PUWA 1UGJA 1BDOA 3J81c 4BA2I 2OF1A 4IOCA 1EM7A 4ZHPA 2JZPA 2JPHA 4UP8A 4ZLTF 3J81i 1TWCH 5BN3A 4HKQA 5KIXA 2AL6A 4A3JB 1PFDA 1BUVT 3HP3A 3VYSA 1XQQA 4OL7A 2RQXA 2XNAC 2WXOA 2ZT9C 4HJ5A 3ZXRA 5GAGC 4XDCA 2E3TA 2JYEA 2DZKA 3C19A 2BWES 2ZJPA 3ZNZB 5M9OA 3Q8AA 1F52A 4IM0A 1KDAA 2F0KA 1S72A 4JCVE 3UI2A 1L1OC 1VQHA 3TS2A 3JYUA 2UU9Q 4MACA 3PTFC 1TIID 2KXJA 5IYDG 4PK1A 3IAYA 2RR9A 5BYSA 1BCPB 1YNJD 3HKZG 2D62A 1ZKOA 2NVTB 3HOWH 1EOTA 1L2NA 1EIYB 1LTAD 1EIGA 1U4LA 1YN3A 1WGYA 3A9JB 5ISRA 1QOFA 2J0MA 1L6VA 2EELA 2NR2A 1AW7A 4DR1L 1T3QA 1PTOF 3W5UB 2SNSA 2UU9L 4FP5D 1KL9A 3DWGC 4XT3B 4KDLB 3SFDB 3BK1A 1XCQL 1TWHH 3GTJH 2KD0A 3VQIA 3FKYA 1TWFH 4MDKE 5G3LD 2ZPYA 3OMCA 3BINA 4R9WA 3GTQH 2DYBA 2Z0EB 4PG3A 2QSDA 2BB5A 3PGEA 4NNJB 2QC8A 2EMSA 4P7IA 2AWNA 2BOSA 1JOOA 2RSNA 2IDYA 3KDFB 4BFRA 5JAVA 1QQRA 2WKDA 1EUVB 4UY8C 4Q2JA 2B2WA 4IWPA 1U9RA 2I5LX 3GD7A 4DR6L 3A5UA 2MO0A 4M8MA 2MP1A 3S16H 1NR2A 1WF9A 2JEBI 1KQSA 3H0GB 1UD7A 2HJ8A 2WACA 2KDEB 3OOCA 3VTUA 5CV7A 5CBEE 1P3QU 2IX0A 3HUIA 3VH3B 2V4LA 4WORA 2B63H 4X64Q 4WJNA 4N9PA 1SMYC 4PMCA 4APVA 4P73A 2MEKA 4K7SA 4REZA 1I42A 3HOZB 2ALYB 4J6IA 1PDXA 3HOYB 4KHPQ 2RPQA 2Z1CA 3P20A 4IPGA 1RDPD 5BR8L 2M17A 4MH8A 4X64L 3PHWB 3TP5A 1R4MB 3D4RA 1SR3A 2NTTA 1OGWA 1SB3C 3OTOQ 2PMVA 4N6EB 1PLFA 3FKIH 1UWXA 3E56A 2EOTA 4KHPL 2BE5C 4WWNA 1ZYRD 3TN2A 1SRUA 4RH6A 1B9MA 1YJ1A 1RTNA 1FMAD 1CZGA 2R61A 3N1ZC 5EE1A 1ASYA 1QG7A 3OTOL 2J52A 3D32A 3MHBA 1SN8A 3V6EB 5C44B 5BMHA 3OLMD 4H0LC 2JRHA 2LY7A 1FR3A 4A3IG 4JPBW 2VZKB 5EQ0A 3H7PB 1V6EA 3NXWA 2WXMA 1Q10A 3JSVB 3VUYA 4JI6Q 1TZ1A 2MO1A 1EQQA 4WJ3M 5M3FG 1STAA 2EYHA 1RHPA 4C3JB 4DR5Q 4LK0M 1BF4A 2UUBQ 4KKSA 1HTPA 1X3PA 1VMCA 2L0CA 3U4VA 1VQAA 2EY1A 3Q3OC 1E2WA 1X55A 4DU9A 4A3GG 1D5XC 1EQRA 4IALA 3QIAA 3WAOA 4BY7B 1KABA 2RBMA 3VR6A 2J42A 3B9JA 4IUNA 4ZRJA 3M95A 3K6OA 5H92C 4JIOU 2C7MB 2UUBL 2F0UA 2VQFL 1YIJA 4A3LG 2KOXA 1JRPA 5M5WB 2WXIA 2FUG1 4I7AA 2FCSA 4K2LA 1VQ9A 2O2VB 1N62A 3NELA 3ZNID 5EDSA 4GKJL 5E6OA 4I6LB 4OWTB 4JE3B 5K5PA 4A3CH 2K50A 1E3PA 1QKZA 3WANA 5IYCG 5GROA 1M90C 4DV0Q 1XCTL 5C0XH 1ZEQX 2KTRA 1TKEA 2KKCA 1Y1VH 4R4QA 1IW7D 1C77A 1ESFA 1ZOYB 1ICWA 5G3LF 2R93G 2UXBQ 2HJ1A 2NPTB 2KVZA 1MVKA 4ZRIA 3NUCA 2MBBB 1FNVA 1L0VB 1MBYA 3ZJTA 3Q69A 1HQMC 2QCZA 4DV0L 4MGKE 5IWAQ 2XWJB 4GDLA 4PS3A 1SE4A 1KLUD 2NZOA 4BXXH 2UXBL 2IO1B 3RT3B 2MH7A 2GOWA 1P16A 1LTGD 2R7DA 3HHMA 2F4VQ 3ZRCA 1SMXA 4II2B 1Q82C 3M4PA 2DUDA 5C4HA 1F2YA 5M5YB 5IWAL 2KHWB 2M56B 3KW5B 3CSTA 2KYWA 4LFBQ 2IGGA 3PPAA 3UI3A 2EY2A 2VRRB 5BYQA 3HEJA 1Z47A 2E2DC 1KAAA 3M9BA 3NSWA 3W1GA 2PIAA 3CC7A 3HOUH 3M7NA 1JMCA 1HFNA 2B2VC 1W2BA 2KMMA 3K80C 3B08A 2RDFA 3J81L 4CO7A 4LFBL 4DV5Q 1MHXA 4WAAA 4M02A 5IYDH 5HHDG 2QCPX 5LL6X 1XF5L 1ZDXA 3T3NA 1B3AA 1HNZQ 1ENAA 3NP8A 4BS9A 2A8VA 2OTJA 3PO2G 4RF1A 3RNCC 3MAQA 2QDLA 3V2TA 4A3DG 4L6TB 4FXKC 4YHHQ 1Z2MA 1FPYA 2YTXA 2KX0A 2KJ6A 3K5LA 3KYDD 4JI5L 4DV5L 2VH2A 5EJWA 1Q3LA 1YHBA 2KQ7A 1QILA 3TREA 1WGGA 3TP8A 4URKA 2LVOA 3DM3A 1HNZL 3I4MG 4TMAB 3BYYB 1P98A 3PZ7A 5J17A 1CQFA 4U68A 3N32A 3TQYA 2M8SA 2BYFA 1RODA 4I7ZC 3T3OA 4KN4C 1X9NA 1SMYD 5JJZA 5FLMG 2FCMA 2INNE 1LXDA 4A93B 3QIJA 2RMMA 1AWDA 2QDFA 3VR4A 4YY3L 4JBKA 1L5PA 1J5EQ 4RGNA 3GQBA 5CR3A 3ERSX 2CKHB 3A55A 1FXTB 4KIKA 2FIDA 5AZGA 1E10A 2N9EB 3Q14C 1BQQT 1HA5A 1VQDA 2VUMB 1V80A 3AU5A 1HUMA 5CHWA 1EY4A 3GTGH 3L54A 1IYVA 4BOZB 2B29A 3NWTA 1UE1A 1J5EL 3BVZA 1R4MI 1WYGA 2RSUA 1ZKHA 2F3VA 2WWZA 1HNXQ 4J3OD 5CX3A 4C3IG 4TUUA 1JE5A 2JVCA 3GTLB 2BDNA 3I72A 3PIPA 1EY9A 4X57B 1HXYD 2AQ2B 5IGBA 3KYCD 1HFGA 2UXCQ 4PYUA 4KGTA 2BWFA 1WE7A 3EBEA 4YL8A 5HURA 3Q3MC 1T0QC 1HNXL 4KVGB 3Q22A 4PS8A 1CHQD 1XPOA 1KOTA 1NY4A 4HCEA 5KYIA 3VVWB 2QKIC 5EAYA 4JYAQ 4CJ2C 3APDA 2EJGC 2OT2A 1EYDA 2E2IH 2ENBA 3HG9A 2ES2A 1G6ZA 4ANXA 4LJPB 2VQEQ 5FO8B 3R66C 1B3QA 3U7DA 4ZCKA 4IOAA 2UXCL 2RHQB 1RFKA 5H1SE 4RGOS 4K3CA 1T0RC 1LLRD 2SOBA 4HJ7A 1JWBD 2FCNA 4AQ7A 2BQQA 1GPXA 3DVNV 3S15B 1NR4A 4A3MH 1IL2A 1GUAB 1K50A 3N3KB 3U4EG 5E4WC 3D6CA 2PW9A 4B3SL 4IJLA 4JI8Q 4QAYA 3C8YA 2VL6A 1GB1A 2VQEL 3MXNA 4KX6B 4QUCA 4FN2A 2L4NA 2VZAA 1UH6A 3AU4A 1B70B 3BK2A 3NG0A 4PV1C 4X62Q 3CRLC 3P1HA 3T9LA 1DOIA 4LF8Q 4HPMB 4QF4A 1R4PB 4JI8L 1PH1A 2CKZB 5EPLA 1VZ6A 1ZXTA 2WLBA 1NCVA 2Y0SG 4C7YA 3PO3G 2KUMA 1F2RC 1LT6D 3CCUA 2LHDA 1SXTA 4HKZE 4R3DA 4P72A 2KCCA 4X62L 4P2CB 2J7QB 2KTRB 2L52A 2NBUA 4KDIC 4Z9CB 1XXGA 5IAAC 3RNEC 4EOYA 3X3MA 1SGHA 1OQRA 4A3LH 2ZJRA 4EZKA 3VRBB 4JOIA 5G5HA 3VXWA 4G7OC 3MC0B 1AE2A 2OXPA 4CJ1B 1B50A 2FIFA 5CV8A 4KY7A 4HXDA 3Q8FA 1K3BC 3M4OB 4NY0A 2RD0A 4FF2A 5IYCH 4GIVA 4GDLB 4RGTA 1YITA 2JA5G 1H9KA 2B2TC 3AYHB 1XEEA 1ZW7A 3PRZA 1J7AA 1RWSA 4FHKA 1DOKA 3OG5A 1P0RA 3HVDA 1K0SA 2L1AA 4IW0A 2A4ZA 2WP9B 1IGDA 2HHHL 2Y5PA 3IAS1 1QCBD 1SNQA 2LD9A 4GU2A 1L7YA 3KUPA 3TBIB 1UUPA 2AEHA 2KTFA 4IJHA 2XEWA 1XYIA 4K6LA 1WJ4A 1VQ5A 3KUCB 4WJQA 2ASQA 2KECA 1RCVD 4A3FH 4AYBG 3H6MA 1WJ6A 4WWOA 1KLVA 1GHJA 4LFAQ 4DXAB 2E5LQ 3CCJA 4QGUA 4L1BA 4HAEA 1E5WA 3AE3B 1A62A 2AUKA 4CQNA 4FXDA 3IG3A 1WGKA 2KQ4X 1XT9B 3GOEA 3FPPA 5D14A 2PZTA 1C8CA 2WAQB 2RCNA 5IE8A 5GAHC 4C7ZA 4LNQA 1W3SA 3STBC 4NXNL 4LFAL 1CA6A 2E5LL 1PYBA 4AJYB 4BY7H 2L3ZA 2JQRB 1TWCB 3KF6B 5C3JB 5J3BA 2R2QA 2CJOA 3FEWX
chains in the Genus database with same CATH topology
4QUFA 3DUZA 2ZW0A 2EYMA 3KBXA 4RGMA 2NYZD 1LV9A 2CQAA 3PMFA 4IN3A 1ZXIA 4ZYSA 1G91A 2ICEC 5T1IA 3NK9A 1HCZA 3NWSA 1PTOC 2CHBD 4A3KB 3W1SA 4ZOHC 1B4OA 1SE3A 3FC4A 1DOMA 4EVOA 3ITPA 2K05A 3HOWB 1SYDA 4WIPA 4NDXA 5CV9A 2K22A 5A2QE 1HQRD 3C2PA 2QIEB 5I6WA 1TWHB 3GTJB 2B8FA 3AE8B 1TWFB 5EE9A 5D7GA 3SDZA 3CWIA 4XT1B 2L32A 1SNCA 1GUNA 2QILA 4PNYA 1SYEA 3SE0A 1V8CA 3S16B 1EU3A 5FO7B 2B39A 1EWHA 3AE6B 1QWYA 3SEBA 4WQMA 2B63B 2ID0A 1D1IA 3L9AX 5BYRA 1BO0A 5A2QL 3L7ZC 1XLQA 1U4MA 5LHY1 5IGEA 1V8QA 2V4DA 1F9RA 5DNFA 4H7BA 4R8NA 2L83A 3EFXD 4DAVA 4PMWA 3FKIB 3P63A 3KQ4A 5DEHA 2X38A 3AEGB 1NUCA 2OEOA 1FNWA 5J22A 5I2XA 4IKGA 1DJRD 3EJIA 5E3FA 5LNK1 1ACCA 3MJ5A 4BWGB 4HEDA 1JALA 4CHTB 2AQ1B 2W3RA 1EL0A 1YQ4B 1U4PA 2N88A 4RCNA 1LT5D 5EKLA 3KLSX 1T5XD 2I38A 4YTMB 2LUMA 4ZK9B 4CKEA 5IGGA 2L55A 1F9PA 3DWQA 4KHVA 4DF7A 1FCCC 2H1EA 1A2TA 4MT5A 2IGHA 4XYQA 2V4IB 5BN4A 4IFDG 3P42A 2K5PA 3AU7A 3FILA 3K57A 3MFYA 2C9OA 1N63A 1Q1BA 3MTSA 1PYWD 1Z7TA 2PMZB 4J1MA 1NEKB 1C9FA 3TDQA 4IFDJ 1Y1VB 3T56B 1QOAA 4K8JA 3Q23A 3MA2B 2F0EA 5IIFA 1WXQA 2PNRC 2RKSA 3NTIA 2HDLA 3AEAB 3FDTA 3OW7A 4K2KA 2LHEA 1EY0A 4YXDB 2N0SB 3BS1A 2D9UA 1PFMA 5FR3A 2LFIA 3GP7A 4OVZA 2WU2B 3FRPB 1TZOA 2IL8A 4LK1C 3HGBA 5J39A 3I70A 1F0ZA 2FMMA 3AEDB 1ZDVA 1LACA 3HOUB 2V3NA 1BOSA 2WXLA 1RF2D 3C3LA 3DHQA 2Q5WD 2RDGA 1BNZA 2MGSA 1SYCA 2HUGA 4WAFA 1EEID 3EQLC 3VYUA 1NSNS 2B2YC 1QE6A 5TSSA 4U673 5AUIA 2EZVA 1L4DB 3BVGA 4TQ1A 1ZPSA 3JAME 2O5JC 3MXPA 3O13A 2L12A 4KK7A 4LMQD 4HEA1 1VRAB 2KJXA 2WXHA 2B2WC 1EZ6A 2QF7A 1B1ZA 1HUNA 1V97A 4C3HG 1B9NA 3R2IA 4JX1C 4B9WA 1I6VC 1BMLC 3GTGB 2R3ZA 4ARCA 5HFYA 1GUGA 4KKUA 2K6AA 5C0XJ 4OO1H 1VJKA 3JAML 3DEOA 5CV6A 1E6EB 1I4QA 4IQZA 3DEPA 5J1ZA 4C1NK 1C4QA 4KGRA 2F0OA 3EVQA 3N6RA 5K36G 1CFMA 1Y8PB 2HDMA 4I65A 5FLXE 3IT4B 2F0FA 5C2TB 2FHTA 1JQ4A 3ZJUA 1FXIA 1WSPA 1K51A 2E2IB 5IT9E 4K14A 1Z6HA 2I46A 5CMDA 3T4AC 4RCOA 2F0MA 2PZUA 2DY7A 1A3UA 4OHJA 1PRTC 3PO0A 2JXMB 3V05A 2RA4A 1BCPF 4A3MB 4A3IB 3GV6A 3SHLA 3TMEA 1O7LA 4N58A 5BN5A 2CW0C 3BDLA 5JEAJ 4XWTA 4C2MB 2A6ED 2XVSA 3VYTA 3P1MA 3MEHA 2WXRA 3A8IE 3FILB 2ACZB 2EJMA 5EBDA 5FLXL 2OEDA 4XQNA 2TSSA 4ARIA 5IT9L 5MPOA 1OXVA 2EE1A 5C0XI 1A15A 1CZPA 4DNTB 1D1KA 2BCOA 1LT4D 1TQOA 1MI0A 3VR2A 1XWEA 4WRDA 1V1OA 4KKIA 2JP1A 1FGBD 1QLBB 2Q8RE 4QCLA 1TS2A 1JR0D 1XLOA 3B2FA 1FNUA 3H8HA 4OIKA 3K5NA 1B2TA 1YQ3B 2O5IC 4IUQA 4KKTA 1R7SA 5CORA 1KLGD 3URYA 1WTOA 1G2TA 4A3FB 3KK7A 4OZAA 1TY2A 5BMIA 3K5OA 1KFYB 1EIHA 1VF5C 1AFPA 2LFNA 1QF6A 2MJDA 4C56C 1SJED 4F8MA 2K9XA 1PZKD 4HRSA 1YN4A 1L6UA 2DY8A 2WDRB 3RD4A 4ITKA 3OWEB 5IODA 1VZ7A 3GTMB 1IHZA 1QNKA 2PO4A 3OIQA 1AZQA 2K5QA 3V3XA 2DWQA 4WWMA 3CKIB 5JOBA 3EA6A 1G8ZD 1KF6B 4L23A 5ELCA 2LEKA 1BR9A 2JYOA 2A69D 2HCCA 2IPKD 4DQOC 2KCNA 5DM73 4NP5A 2EJFC 1I4RA 2K33A 3NPPA 2FFKB 2BS4B 1CK1A 2N55A 1JWMD 2RSOA 5KNDA 4CGYB 1STNA 2F0IA 3E9SA 1Q12A 4UAIA 5HI1A 2G9HD 1II3A 2QDBA 1EYAA 3W9CB 1EEFD 1X3QA 3L3OC 4X3SA 2H89B 1IL8A 2KHSA 4GDKB 4XYOA 1TVXA 4OZBA 2NN6I 2K7VA 3BG3A 3I4NB 1CI3M 1T5EA 2M19A 3K59A 4YT0B 1WWTA 3J7YW 4C3JG 2GB1A 1F2MA 3HRDD 2BS2B 2GI9A 2F0TA 1PRTD 5AUKA 3A54A 3T13A 2IWHA 3OPOA 1CTMA 1I3QB 1DOLA 3IL8A 5M3MB 4KI0A 2F0SA 2R7ZB 2XRQD 2EYOA 1RTOA 1OFFA 4TKOB 1VDZA 3D31A 3IKJA 3M3YB 1IKMA 3K0YA 3IAM1 2PTLA 5LL6S 1KRHA 1ZP0B 4ZRQA 1NYRA 1I4HA 4CKCA 4HR7B 1XLPA 4DN4M 3H91A 3N9YC 4NAWB 2SDFA 2I2YA 3MXUA 1JQYD 2EKIA 2BE5D 2Y0SB 3A7AB 5GXGB 2ZXRA 4N59A 1C4CA 2AX5A 2JXTA 4K5XA 1JMLA 2E76C 1VLBA 4CJ0B 1DZ1A 1TS4A 3QOLA 2WXGA 3LWUA 2R92B 2C5CA 2K03A 4KJNA 3VA5A 4B0EA 2WNMA 1PTOH 2JA5B 4YIJA 4EQNA 2G9DA 3SK4A 4HJGE 3LX0A 5IGCA 3OIPA 4RKLA 2B2VA 1E0BA 4YTPB 4KN7C 3ND9A 5DM63 3I73A 1OQQA 3RZDB 3H3VC 5HG2A 4OW0A 2M9VA 2OHFA 5I2YA 2HCIA 4DK0A 1GUWA 2O4XA 4AYBB 5EGTA 4NAMA 4G57A 3MVVA 4ZKCB 1CJEA 3NVWA 4XTCS 3P75A 1TS3A 1P7FA 1YMHE 3F2UA 2W54A 1E0ZA 1H9JA 2BA0A 1AP0A 2VXWA 3AE1B 1LT3D 2A5HA 5ELBA 2IJ0A 3I3CA 2WXFA 2W82A 4A55A 4KY6A 5BMGA 1AN8A 5C5MA 1JOQA 2JA8B 1HZ6A 2DYMA 2PVGC 3OWFA 5ELDA 1C78A 2RDHA 2KEDA 2JA7B 5M5XB 3NBIA 4FXGC 2X69A 1WTXA 3DWMA 3Q0AA 3I90A 1SF0A 2KVMA 4EGVA 2J0TD 1STBA 2WB1B 3NZ3A 3Q8EA 4RA8A 4FF1A 4WH4A 4A3BB 3AV8A 1Y8NB 3QO2A 1GHKA 1KDCA 4H2AA 3KF8A 3FPUB 3ZYYX 5EBCA 4KJOA 4YSYB 1FRRA 1MSHA 4X3UA 1HRJA 3VR9B 1TJEA 4DNRB 2N7JA 1JROA 2EYPA 4USAA 3W2DA 1RKNA 1IBXB 2IT1A 2KN4A 4NW2A 3FAHA 1ET6A 1ROEA 4HMIA 1I4GA 3BZDB 3SK5A 3C1FA 5CV4A 3NHHA 4RNAA 1CQVA 1XO3A 4KD4A 3WOEA 1SSOA 5JXVA 1SJHD 2VB3X 4B9XA 2NVQB 4PMBA 4S3SA 1CZWA 4B08A 4OIJA 3AE2B 3EUB2 4OGQC 1M8AA 5A35A 2K28A 4F87A 2INPE 1BCPC 2DLBA 1UAPA 3U9OA 1OXUA 2W55A 3QOJA 1SDFA 2WKCA 2KWDA 2V3PA 2J4XA 1I4PA 3G6JB 2AWOA 2A6HC 1MHHE 2Q8TA 1J8IA 1EWCA 4IURA 2JE6I 2B2TA 3TEWA 3SR1A 4XWWA 5ELEA 1ZUD2 3J80E 2XSCA 1YNNC 1FFVA 3TP6A 4ULLA 3TUOA 1Y69U 2M00A 3H09A 3VYRA 1QOBA 4IUUA 4MM3B 1DOYA 1RM6C 3ZJVA 1SIJA 1DXMA 2CU3A 1Y56A 2WU5B 2AQ3B 2WDQB 3S1NB 4GZYC 1IGCA 4FNFA 4IOIE 1ML0D 4NZLB 1HPCA 3PIO3 1FEHA 3TP7A 4XIGS 1BXTA 4DXFA 2JWUA 1P7EA 1F2LA 4ODGA 3V96A 4F7XA 5D3DA 4R8IA 2EYFA 5JVH3 5C6AA 4WURA 1LTRD 1TKWB 1FRDA 3SR6A 1F9SA 1IUEA 2N9LA 4G4KA 1EWYC 1NENB 4IUPA 1YJIA 1OO9B 1DONA 1HZ5A 3AB9A 3GTOB 1OXSC 1VR9A 2V0GA 2F0VA 1DGJA 4B0MA 1J7CA 1E2ZA 3J7AV 3P4SB 4A3EB 2F1MA 1YNJC 4PQXA 3AH7A 1LO5D 2YU9B 4CBVA 4YTNB 1DD2A 2F0DA 2L5TA 1S4ZA 2QMTA 4TSSA 1G2SA 1SNMA 1S5ED 2QEJC 5AFWA 4E6IA 1LTID 3R93A 1N5WA 3AE5B 1I4XA 1PDQA 2WXJA 3VR8B 4IUVA 1S5DD 2BDOA 3FVQA 3DMUA 2A73B 1ET9A 1A2UA 2LMCB 2L9HA 1WTVA 1RD9D 5EE0A 3A8JE 3MZ5A 1C4AA 4HSVA 2A74C 2EXZA 2DBYA 1NYQA 3BVMA 4NKLA 1CHPD 5IOCA 3PUZA 1NI3A 2B2UA 4D2KA 4KV6A 3S2DB 1SYBA 1YN5A 1EFID 4MIUA 4ILWA 1PTOD 2NBFA 5DAUA 1XLNA 4KGSA 1T6BX 1MD2D 4BBSB 2RPVA 3AEFB 1K8OA 3LNNA 3PUXA 4RFBA 1FIQA 4GLSC 1YJJA 1ZYRC 3NUHB 2HDEA 1TR5A 3RFZB 4US8A 2L11A 1ESRA 1B53A 2IW3A 1JWAD 3KWVA 2A6HD 3HKZB 3NBHA 4C80A 2GA4B 2B76B 3ERQA 1O80A 1QT9A 5JPNC 3N52A 1HA6A 3MP9A 4HCSA 2PKOA 1H9SA 2YEPB 1XX8A 3S14B 1Q1EA 4WJWA 4J6HA 4ZRZA 1KNAA 5T8IA 3ZQ4A 5EKIA 2F3WA 1M4VA 2YYZA 1SNOA 5D65A 2BS3B 5C0XG 4AS1A 1STYA 1TS5A 1JW9D 2PW7A 4O1NA 4J8QA 1WD0A 1PUTA 5C5LA 2FMCA 1EY6A 4X3TA 2LJIA 1N5XA 1VZ8A 1MI2A 2L1BA 1J9OA 2IGDA 3NVVA 3HVZA 4BY1B 4ZHOA 1C79A 4EQOA 1CA5A 2WDVB 4JPSA 1EU4A 1I6HB 3L4PA 3AB5A 3CIRB 3P4PB 4US9A 1F2ZA 5H8YE 4KTAA 4FYDA 3VA7A 3IT6B 1PTOB 3NVZA 1I50B 3VRAB 3BWUD 4L2YA 1GAQB 5JEAG 2VZKD 4FVMA 4QB4A 3PZ8A 3KWLA 4JBWA 4L63B 3MWYW 1PGBA 1CT1D 4V0BA 4DK1A 3AE7B 2WP8J 4HSPA 5FO9B 5M3FB 4LLGM 3ONAB 1F9QA 2VB2X 1MPEA 3MHZA 3TEZA 2B2YA 4KHZA 4L8JA 3OSOA 3NVYA 3LYYA 1TWGB 5JVG3 3AMUA 4A3GB 2DN8A 2ONQA 3CHBD 5T1GA 2EYLA 2LKVA 1TKGA 2EDGA 2PQEA 4IFDH 1FYCA 2ZXOA 4XQQA 1D4BA 1YNTE 2R6GA 1H9RA 3S9WA 1PFBA 5ELFA 4M1UB 3GTKB 4IZ8A 3M85A 3HRZC 1HHVA 4KD3A 3AECB 2Y3AA 2E74C 2EY6A 1IYUA 4XQJA 2R93B 2WXPA 1E9MA 3TEYA 4XDDA 3P4RB 1LABA 5C4XB 2NN6G 1D2BA 3I57A 4ZUIA 1TWAB 2MJ3A 3B2GA 1F2RI 2H4OA 4TQ0A 2SNMA 5CV5A 2JX5A 1Q8IA 5IGDA 3NTHA 2MPMA 2NUCA 1D5MC 4UDUC 2NMQA 1E7PB 2XRSD 3R2TA 2Z4IA 4A9AA 1PGXA 1DYQA 1KTKA 4O42A 3D6WA 1STHA 2XWBB 1H9SB 4N9TA 1FD7D 5EPKA 3E5SA 4YSZB 1DM0B 2JSVX 4Y7NB 2G1EA 4HTHA 4HMJA 3PO2B 1KH0A 4A3DB 3RLFA 4Q0FA 3GV3A 4FF3A 2BYTA 3KLSA 3S2HB 3NTKA 4IDIA 4DAYA 1RJTA 2FE8A 2MUYA 5CGKA 4NJCA 1E2VA 1JWSD 3I4MB 2DNEA 1SYGA 1ILPA 3S17B 4KY5A 3NQTA 4YSXB 1VF7A 1WD1A 1ENCA 3TZDA 1QOGA 2MJ8A 3SXHA 2BBCA 1ONLA 1MGSA 3C46A 1TKYA 3J81E 3LWEA 3SVMA 5C4ZA 1EY8A 1NVID 2KOLA 5COYA 4G7HC 2SAKA 1U4RA 2CJNA 2WXQA 2WS3B 4C3IB 1JC7A 5KNCA 3S1RB 2W3SA 1EZ8A 1PMRA 4TQUS 2WV6D 4ID6A 3CQZB 2BT6A 2RVLA 2QJLA 1FM0D 2J53A 2Z8LA 2F0QA 5K36H 5KRUA 1O78A 3A8KE 1IBXA 2GRIA 2K04A 2N9KA 3HS0C 1PZID 2Z4HA 2CW0D 1X32A 2DYOA 1KNEA 1V1PA 3PV0A 3OMGA 5JEAH 3ND8A 3Q6SA 3W3AA 3WDNA 3E0JA 2F0WA 4F88A 2X6GA 1Y8OB 3TEXA 4JWUC 1OXTA 4H44C 2Y5CA 2MHVA 2F0NA 3DXJC 1XTCD 1AYFA 5E1FA 1EQTA 3RUZA 1K52A 2CVRA 2DNCA 3BYTB 1A3VA 5F2DA 4ZUJA 4K5VA 3RPFC 4DFAA 3PO3B 1TU2B 3LB8C 3Q8BA 3NS1A 2KQ3A 4X3KA 2JYTA 4A8XC 1QNUA 3C1EA 1TYGB 1JE4A 4XE0A 2JA6B 3TZUA 3GO5A 2E6XA 4C1NI 1SAPA 1UWMA 4A6QA 1FCLA 2ZXPA 2E75C 2ICIA 5JPMC 4MHEA 1A70A 2K1BA 2K3UA 1HTLD 1PFNA 1W6JA 2NN6H 1WRIA 2IX3A 1FXAA 4M0WA 3AN1A 2BB6A 1JCKB 1PRTB 2AUJD 2PW5A 4ZRPA 3QJYA 3SK6A 3VR3A 1GOZA 1SFOB 3W5VB 2F0LA 1VMPA 1ZE3D 4HN7A 3DWAA 2M0AA 2PVOD 3EROA 3G7LA 3MFGA 4HROA 5I6YA 5FK9C 2KA7A 3PIP3 1S5CD 3IFDA 1PRTF 3X3NA 1MSGA 1SNPA 2WXKA 3AM9A 3IFTA 3AEEB 3AEBB 1F77A 4RWSC 5D3IB 4Q5VA 3R3OA 4FO2A 1DOXA 4RHSA 2EYJA 3U52E 1OXXK 1QB5D 3R8BA 2PZWA 3WOFA 5I9OA 2BW2A 2KACA 4ZKBB 1TT2A 2B8GA 1TY0A 3Q24A 1A3TA 1SYFA 2VNUD 3PUYA 2LS01 1AZPA 3HOXB 1PZJD 3S1MB 4EE2A 2KDMA 3ABVB 2Q8IB 3I8ZA 1Y1WB 2K01A 2EY5A 5I9PA 1UEAB 1WVLA 2FJ2A 2NB0A 1L0XB 5KNBA 1N60A 5EPJA 1GJXA 3SFEB 4RAUC 3D4WA 5C3EB 4QIWB 1B9RA 2ZW1A 1FD6A 3K58A 2LMCA 4DA2A 3KBGA 4K5WA 2WIIB 2FINB 4YWGG 3K5MA 1LTBD 2F03A 4WFN3 3RMHA 3U9SA 5E4XA 1V1PB 1JWUD 4CKBA 3U2SC 1JICA 1G291 1ENFA 3DM1A 3BIID 1WTPA 2SEBD 2EPBA 3CU7A 1SEBD 2JSOA 1R4QB 2K5DA 1B44D 1NAPA 4LAAA 3RZOB 4RHRA 2BTEA 2F0HA 2TMPA 1GUTA 2BA1A 1IKLA 4DXGA 1QOHA 4H13C 3HOVB 3A56A 3VR5A 4FXCA 1R9TB 3I9V1 2IX1A 4RKBA 4ZQ3A 3AMZA 2WQYB 1STGA 2K32A 1VCIA 3T16A 4XXEA 4LTUA 1EY7A 3DWPA 2H88B 4P6VF 1PXUA 3M7GA 1D5ZC 3M4YA 5KEEA 5G5GA 4G7ZC 5FKAC 3GTQB 5E6JA 5KYLA 3GTPB 3AE9B 5I4DA 3KLRA 2HQEA 3Q8CA 4K8IA 4TRDA 5NUCA 1I7HA 3H94A 1LTTD 4XDXA 3GS2A 5EE3A 4BBRB 2NTSA 3BDCA 3QG1A 2NVYB 2PCFB 4RF0A 1RYJA 2K5WA 2A68C 4P16A 4FF4A 2F0PA 4EQPA 1C76A 2K0PA 4OO1G 3J80L 5EKKA 3EGRA 2MJEA 4IUTA 3OHXC 3ZGZA 3I91A 4KMUC 2B2UC 4DGZA 1V43A 1H9MA 3AE4B 4KKJA 2X6LA 5HGTA 2PYKA 2XIWA 2D2CC 1EY5A 1UNSA 4NMZA 1A6XA 5CC4A 2JU6X 1L0YB 3HZXA 1SBBB 1PGAA 4LJZC 1K83B 2WINB 3QWNA 1EYCA 1BUIC 1L4ZB 1C48A 1J7BA 2KEEA 2PPBC 2FBWB 2NZ1D 1VDVA 1N61A 3P7JA 2XN9C 1BBXC 4M8AA 3J9CA 1W6KA 3SK8A 3P4QB 4V190 2I07B 1GUSA 1EQVA 1WCMB 3T53B 1DCZA 3D4DA 5C3WA 1K8MA 3LXFA 2NWGA 1C4PA 2A6EC 3S1QB 2HTME 1Q90A 5CBAE 1O7ZA 3T51B 3MXGA 5C3XA 3U7ZA 1ZXHA 3D3RA 1GUOA 4K6DA 4OO1I 2M2LA 3BDOA 4C3HB 1FFUA 3E6ZX 2F0GA 3NQIA 1LTSD 3NRZA 2EVBA 3CRKC 2WXNA 1D6EC 1S5BD 5IGFA 2F0JA 4ABNA 1BCPD 1JB3A 2J7ZA 1HEZE 2PLPA 3NE5B 2O2LD 1O7YA 2NVXB 1AEXA 2E2JB 4MN3A 4ZAIA 2D5DA 1K53A 1GXDC 4PT5A 3J7AF 3A7LA 2D5GA 4QMGA 3PUVA 5FOBB 1ILQA 1WTWA 2E2HB 1YNND 2LGIA 5C4JB 4BA1I 4A90A 1JOKA 1WTQA 1GB4A 3D8GA 4JK1C 2ON8A 4JWSC 1STEA 3IXSA 1WTRA 4ME5A 4DAPA 2F4IA 3I4LA 2KAJA 1KDBA 3WCQA 3FMCA 5CYUA 4OZCA 3K7AB 1SSNA 1SE2A 2YEPF 3GB1A 4IFDI 5KGUA 1FO4A 2JEAI 1JORA 1CM9A 2A68D 1SNDA 2A69C 3QB3A 3ETRA 1QJOA 3TSSA 1IW7C 1S5FD 3PUWA 1UGJA 1BDOA 4BA2I 2OF1A 4ZHPA 1EM7A 2JZPA 4ZLTF 5BN3A 4HKQA 5KIXA 4A3JB 1PFDA 1BUVT 3HP3A 3VYSA 4OL7A 2RQXA 2XNAC 2WXOA 2ZT9C 4XDCA 2E3TA 2JYEA 5M9OA 3Q8AA 1KDAA 2F0KA 3UI2A 4MACA 1TIID 3IAYA 5BYSA 1BCPB 1YNJD 2D62A 1ZKOA 2NVTB 1EOTA 1YN3A 1LTAD 1EIGA 1U4LA 5ISRA 1QOFA 1L6VA 2EELA 1AW7A 1T3QA 1PTOF 3W5UB 2SNSA 4FP5D 3DWGC 3SFDB 4XT3B 3BK1A 1XCQL 3VQIA 5G3LD 3OMCA 4R9WA 2QSDA 2BB5A 2AWNA 2BOSA 1JOOA 2RSNA 2IDYA 5JAVA 1QQRA 2WKDA 4Q2JA 2B2WA 1U9RA 3GD7A 2MP1A 1NR2A 2JEBI 3H0GB 2WACA 3OOCA 5CV7A 5CBEE 2IX0A 3HUIA 4WORA 4N9PA 1SMYC 4PMCA 2MEKA 4REZA 3HOZB 1PDXA 3HOYB 2Z1CA 3P20A 1RDPD 4MH8A 3TP5A 3D4RA 2NTTA 1SB3C 4N6EB 2PMVA 1PLFA 1UWXA 3E56A 2EOTA 2BE5C 1ZYRD 3TN2A 4RH6A 1B9MA 1RTNA 1FMAD 1CZGA 2R61A 5EE1A 1QG7A 2J52A 3MHBA 5C44B 5BMHA 4H0LC 2LY7A 1FR3A 2VZKB 5EQ0A 3NXWA 2WXMA 1Q10A 1STAA 2EYHA 1RHPA 4C3JB 4LK0M 1BF4A 4KKSA 1HTPA 1X3PA 1VMCA 2L0CA 2EY1A 1E2WA 4DU9A 1D5XC 4IALA 3QIAA 4BY7B 1KABA 2RBMA 3VR6A 2J42A 3B9JA 4IUNA 3K6OA 5H92C 2F0UA 1JRPA 5M5WB 2WXIA 2FUG1 4K2LA 1N62A 4JE3B 5K5PA 1QKZA 1XCTL 5C0XH 1ZEQX 1TKEA 1IW7D 1C77A 1ESFA 1ZOYB 1ICWA 5G3LF 1MVKA 3NUCA 1FNVA 1L0VB 1MBYA 3ZJTA 3Q69A 1HQMC 2XWJB 1SE4A 1KLUD 2MH7A 1LTGD 5C4HA 1F2YA 5M5YB 2M56B 2IGGA 3UI3A 2EY2A 5BYQA 3HEJA 1Z47A 2E2DC 1KAAA 3NSWA 2PIAA 3M7NA 1HFNA 2B2VC 2KMMA 2RDFA 3J81L 1MHXA 5HHDG 2QCPX 5LL6X 1XF5L 1ZDXA 3T3NA 1B3AA 1ENAA 3NP8A 4BS9A 4RF1A 3MAQA 3V2TA 4L6TB 4FXKC 3K5LA 5EJWA 1Q3LA 1QILA 3TP8A 4TMAB 3BYYB 3PZ7A 1CQFA 4U68A 1RODA 4I7ZC 3T3OA 4KN4C 1SMYD 5JJZA 2INNE 4A93B 2RMMA 1AWDA 3VR4A 1L5PA 4RGNA 3GQBA 5CR3A 3A55A 1E10A 1BQQT 1HA5A 2VUMB 1HUMA 1EY4A 1IYVA 3NWTA 3BVZA 1WYGA 2F3VA 4J3OD 4C3IG 3GTLB 2BDNA 3I72A 1EY9A 1HXYD 2AQ2B 5IGBA 1HFGA 4KGTA 5HURA 3Q22A 1CHQD 4HCEA 5KYIA 2QKIC 4CJ2C 2EJGC 2OT2A 1EYDA 1G6ZA 2ENBA 3HG9A 5FO8B 1RFKA 4RGOS 1LLRD 2SOBA 1JWBD 4AQ7A 1GPXA 3S15B 1NR4A 1K50A 3U4EG 5E4WC 3D6CA 2PW9A 1GB1A 3C8YA 3MXNA 4KX6B 4QUCA 2L4NA 3BK2A 4PV1C 3CRLC 3P1HA 1DOIA 4QF4A 1R4PB 5EPLA 1VZ6A 1ZXTA 2WLBA 1NCVA 4C7YA 2KUMA 1F2RC 1LT6D