4O1NA

Crystal structure of staphylococcal superantigen-like protein saouhsc_00383
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
b'SESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like protein
publication title Crystal structure of Staphylococcal superantigen-like protein SAOUHSC_00383
rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 52
structure length 189
sequence length 189
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4o1nA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4o1nA01
5D3DA 1LT3D 1LT6D 4DXGA 1YN3A 1PTOC 1RD9D 1TY2A 4DXFA 3R2TA 5D3IB 1LTID 3DWPA 1D6EC 1PTOF 1TY0A 1JCKB 1PYWD 1SE3A 3DWQA 1V1PA 2XRQD 3R2IA 3MC0B 4TSSA 4C56C 1GOZA 4RH6A 1SE2A 1D5MC 1L0YB 1EFID 2XN9C 3BVZA 5ELCA 3CHBD 1S5CD 1B1ZA 1EWCA 1I4QA 1PTOD 1STEA 2AQ3B 2NTSA 1YN4A 1DJRD 5ELBA 1CT1D 1AW7A 1I4GA 2WV6D 1ET6A 1JWMD 1CHQD 1SBBB 1TS5A 2CHBD 2NTTA 1HTLD 2Z8LA 1FNWA 1AN8A 1HQRD 2QILA 1LTTD 1S5ED 2RDHA 1LLRD 3OWEB 1BCPC 1BXTA 1EU3A 1XTCD 4L63B 1I4HA 2O2LD 1FNVA 2XNAC 1L0XB 1S5BD 1FGBD 3BVMA 2SEBD 4UDUC 1BCPF 1LTGD 4L6TB 2R61A 1FNUA 2QEJC 1KTKA 4RCOA 4RGTA 1PZJD 1RCVD 1PZKD 1CHPD 4RGOS 1LT5D 1SJHD 5ELFA 4Z9CB 1LTAD 1UUPA 1I4XA 3KLSX 1CQVA 1LO5D 1BCPD 1ESFA 1SE4A 2RDGA 1S5DD 5TSSA 1CK1A 2AQ1B 4OHJA 1SXTA 1PRTD 2G9HD 1JWUD 1TS4A 1ET9A 3EA6A 1PZID 1PTOB 1ENFA 3W2DA 2IPKD 3TSSA 4RFBA 1I4PA 3EFXD 1JWSD 1BCPB 1TS2A 3GP7A 3R8BA 1T5XD 3BVGA 1PRTC 1D5ZC 5FK9C 1UNSA 4RHSA 4RGMA 4K6LA 1PRTF 1I4RA 4ZYSA 1EEFD 3BZDB 1XXGA 1EEID 1JR0D 3MFGA 5ELEA 1RF2D 3O13A 5FKAC 3SEBA 3BYTB 4RGNA 1LTSD 1V1PB 1LT4D 1SEBD 2XRSD 1TS3A 1S5FD 2IJ0A 1LTRD 4O1NA 2J4XA 4BWGB 1V1OA 1YN5A 1M4VA 4NZLB 2ICIA 1SJED 1FD7D 3BYYB 1MD2D 1PTOH 1KLGD 1B44D 1D5XC 2AQ2B 1F77A 4RHRA 1LTBD 1KLUD 1HA5A 1PRTB 1QILA 1EU4A 3URYA 3V05A 1G8ZD 5ELDA 1RDPD 2TSSA 1DYQA 1HXYD 1JQYD 3DWAA 5I4DA
chains in the Genus database with same CATH superfamily
5C3EH 2JEAI 3V61A 4BY7B 5KNDA 2I1JA 5HHDG 2ZEQA 4IKGA 2RCNA 4DXFA 2BKFA 1OXUA 1VQMA 1T5EA 2KD0A 1B9MA 3C19A 5DPSA 3DBSA 3CRLC 3VTVA 5E6JA 4PZ8A 1N36Q 4YIJA 2ATWA 2EELA 4DKAC 5HY6A 2H89B 3QOLA 3OW7A 5C5MA 4EKUA 4HIMA 1C4QA 2L4NA 1WR1A 2N9LA 3KH0A 2I07B 4C4VA 1GD7A 1YD8U 3DM1A 1TWCB 3FEWX 4DR3L 2JA5H 2AHOB 1OEYJ 1KOTA 2CKZB 1KAAA 1CT1D 2ID0A 4K6DA 2F0VA 1KAWA 3RNFC 3RZWC 4TVAB 2VZAA 3D4RA 2EXDA 4FDBA 2NYZD 5EPLA 5G3LD 2PZTA 3S1MH 1V5TA 2N9XA 2NPTB 3QCAA 3T51B 2NVYH 1ROEA 4IC7B 3T3NA 2IY5B 3TJPA 1E1TA 2F3VA 3OWEB 3UDFA 4IN3A 2KTRB 4IPDA 1K9MC 4IOIE 1I4HA 3FKIB 1CZWA 4KY5A 1WE7A 2PMVA 3R3MA 1K8OA 4BBRH 2RHQB 1N36L 4RF1A 5IAAC 1V81A 2SEBD 1FCLA 3TIXA 1IYFA 2NZ1D 1I42A 2DAJA 4I7AA 2BWES 3NVWA 5FR6A 2WDRB 1GJZA 2AMCB 4G57A 2X69A 1KTKA 5A2QE 5IN7A 5JOBA 4K8JA 3Q3MC 4JQWC 1N8RC 1OXTA 3DHHC 3P63A 1CHPD 2YV5A 4LK1C 5C6AA 1QB5D 3W1BA 2HT1A 2CR5A 5M5XB 1VCIA 5C23A 2B2TC 1Y1VB 3WAPA 2EXZA 4N58A 3UI2A 3A5ZB 5NUCA 5IGGA 4OX9Q 5LL6S 3QWNA 3SDZA 2IPKD 1S1QB 4HDQA 2QW7A 3HOWB 2N9KA 2UU9Q 3T3OA 4QUFA 4DAVA 3S1NH 1XLPA 2NPTA 4JI1Q 4BY7G 4FN2A 4HJ8A 4ARIA 3L17A 1QT9A 1B3QA 3I73A 1NR4A 2KTRA 3PUZA 2Z0SA 3W5UB 3H91A 4LUVA 3LWUA 3PF4A 4LF5Q 4YWLA 2XEWA 3H1UA 3MFGA 4DUZL 3QWZB 1K8AC 4LNOA 2B2WC 2RSNA 2HCCA 3K8AA 1EOVA 4JC0A 4R9WA 1ZP0B 2WB1G 4C2MB 3T16A 2LASA 3EJIA 2I46A 3VAWA 2IJ0A 2VXWA 2V3PA 3RULA 3LNNA 1Y8RC 1WMHA 3GTKH 5FLXc 5FLXL 2PQAB 1FD7D 4CHTB 3J80c 3J80L 2E2JB 1CJEA 4JI1L 1GUWA 2EY6A 2YVCA 3NBIA 1TTNA 4QCLA 1TWAH 2PE6B 3C1FA 3TZUA 5LMNQ 4JI5Q 1CSPA 4LF5L 4A3EH 2SDFA 5GQOA 2E6XA 2D10A 5JXVA 3M63B 1J5EQ 3Q8EA 5E6NA 2YEPB 4N9PA 2WX0A 4LFAL 1LT6D 2B8GA 1YX5B 2PTLA 3CWIA 2NVQH 4FF1A 1PTOC 1UF0A 4NAWB 3A0JA 4L2YA 1PH6A 1J7CA 4P1CC 4W9JA 3CIRB 3FAHA 3M3JA 1PUTA 1DM0B 2PW9A 3NVZA 4HAEA 1NYQA 4GNXB 4K5WA 1A6XA 3DMUA 3PHWB 3EGRA 3AU7A 3AU4A 4M01A 3DBLI 4IUUA 4UHVA 3VUYA 4QIWB 4MJSB 1JRUA 2B8FA 3IXSA 2UU7A 1Y1VG 1N63A 2KCMA 3AULA 2K3UA 1J5EL 2M0AA 1HZBA 2NVUI 3DBHI 4DV4L 1C79A 1I4GA 4E6IA 5GADC 3A54A 1JWMD 4KKSA 1OXSC 3GZNI 2AL6A 4ABNA 3S17B 1E24A 5FJ8H 2IDYA 2MX2A 4KD3A 1ICWA 1IBLQ 1XJVA 1Q1BA 2AWOA 3UE0A 3F2BA 2DJGC 1XMOQ 1SNOA 3GO5A 2E2IH 1Q46A 1FFUA 1BBWA 2W82A 5CYUA 4YHHQ 5H92C 3PO3B 2LGIA 1BQQT 1GC7A 1RYJA 2LMCA 4NAWA 3OTOL 3EQLC 4OWWB 3IG3A 3M4OH 1MGSA 1FNUA 5CV4A 1F52A 1UGJA 4RCOA 1G2SA 2LRWA 3PREA 4ZHPA 1NSNS 5CORA 3SK6A 1EL0A 3PZ8A 2WFWA 2KWUB 3HOUH 3N1YC 3MHSD 2P5ZX 4GNXA 3NY5A 1FMAD 3GOEA 2MEKA 1LO5D 1TZ1A 3Q14C 4H7BA 4ZOHC 1EY4A 1WH3A 3A74A 4KKIA 4JL9A 4CGYB 1IBLL 1A15A 2ZNVC 2WKDA 3AE6B 1SNPA 2F0UA 4DR1Q 4OGQC 4F88A 4DDID 2NVTB 2G3QB 2LXCA 4ITKA 1HTPA 4E74A 4GSWA 4A3IH 3GTGH 4DR6Q 4BFRA 1Y69U 1C0AA 1DOMA 2LSSA 3UDGA 4XXEA 1XT9B 3CCJA 1U4MA 1I6HH 4FLHA 2WAQB 1L7YA 2SNSA 2AEHA 1KRSA 2BYFA 2RDFA 1YJ1A 1D1KA 1VQCA 1JR0D 1KNAA 2A19A 4JVZA 2KX3A 3H15A 3WOEA 4S0RA 4DQOC 4IZ8A 3Q22A 4OO1G 3V6CB 1O7LA 3IRBA 4EQ5A 4NPSA 4LUZA 1WTOA 3NZSA 2JX5A 4KV2A 5J2RA 2C7NB 4DR1L 1VCBA 1WY8A 3W1SA 1YJ9A 1MPEA 1E2WA 2WXKA 2F0FA 1NJIC 1PTOH 4N8FA 4DR6L 4HEDA 4A8XC 3F2DA 2J52A 4A3DG 1SYEA 4JOIA 4NB3A 1SMXA 4ZRIA 1Z2MA 3S16B 2ICEC 3TP5A 2HD5B 4HN7A 5IOCA 3IFDA 2AWTA 2ZVNA 3A9JB 5EE3A 3VH3B 4IURA 1MSGA 1I7HA 3J7AV 3ZW3A 1H9SB 3R2TA 2KFKA 3R66C 3ZXRA 1IGDA 3KLRA 4FULA 3PSEB 4BY1B 3KFUA 1XLQA 1TY0A 2BDOA 2O5JC 5FR3A 2ZJRA 1DD2A 2E3TA 1N60A 2PYKA 4K2KA 4OIJA 1P9DU 1JJGA 2NWGA 5J3BA 3HUIA 2B29A 4TSSA 2QJLA 4K0KL 1GUGA 2L76A 2CHXA 4JI3Q 1GJXA 1L1OB 1FJGQ 4L5RC 4HCNB 3IHPC 4HIKA 4DAYB 2QEXA 2JYTA 2MWSB 2WKCA 4C7YA 3V62A 2FCQA 1SNMA 3APCA 3PRZA 2YU9H 1CHQD 3AE3B 4WJOA 2F0HA 1I35A 1HQRD 1NMGA 3I4NH 4NNJB 1FXAA 1S5ED 3EECA 3UE1A 4XWWA 1SFOH 2IYDB 3AE5B 4H0LC 1EQVA 1F9QA 3JSVA 5HKHA 2O2LD 4HJGE 3LYYA 3Q8CA 3RPFC 2ZTDA 2QDLA 2WAQG 3A9JA 2EKEC 3C46A 2I5LX 3A7LA 1BCPF 3AYHB 3RMHA 3J81i 3S2HB 1H9SA 5AJ3Q 1VJKA 1G2TA 1FJGL 1WTRA 3RCZA 2PPBC 1SE9A 4NY0A 4EOYA 1RCVD 1STYA 1WWTA 1HNXQ 2F52A 1EYDA 4KKUA 3KF8A 1MVKA 2FNJB 2MHVA 4A3OA 5CX3A 2PZUA 1SE4A 5IE8A 3ZDTA 2F0SA 2K03A 5IT9E 4PG3A 4V0BA 4OHJA 4ZRJA 1L1OA 4LWCA 2MFIA 4BY7H 1QZEA 3CC4A 2BQQA 3K5OA 4L8JA 1XYIA 4DAYA 3NHEB 4ZHOA 5C4XB 4ZUJA 1FR3A 1V80A 4Q5VA 1BMLC 3A5UA 1WX8A 2KMMA 4M8MA 1Q90A 3W2DA 3TSSA 4LK0M 3BU2A 1C77A 4GN4B 2MUYA 2IX1A 4K7WA 1T6BX 5AJ3L 1YMHE 3K5MA 4TQ0A 4UP8A 2G1EA 1E0ZA 1HNXL 1I4RA 4MSQB 2EDGA 1SMYD 1K51A 2KQ7A 1EEFD 1EEID 5CV9A 5ELEA 4BY1G 1WTPA 3D32A 4X66L 1TWGB 2Q5WD 1S3OA 1V1PB 3VYUA 1WXMA 3KVFB 3PLUA 4KHVA 4RG1A 4TKOB 4ANWA 4PZ6A 3HGBA 1S5FD 2RBMA 4KKTA 3ND9A 4FA6A 1U9RA 5JHAA 2MP2A 1EUVB 4CKEA 4JX1C 1ZXTA 2J0TD 1IBXB 3M85A 4DXAB 5IIFA 1DOIA 1Q82C 4KY6A 3KQ4A 3FKIH 4QMGA 4ZRKA 1WXSA 4P75A 4FJZA 2Y0SE 4ZYNA 1MHXA 2JA5B 4XYOA 4WJQA 1II3A 2IY0B 2M9VA 4NJ6A 2NN6I 2DZKA 3PV0A 1LACA 4OWXB 3RZOH 1PVOA 1C4AA 3DEOA 4IM0A 2BDNA 4DV2L 3AMZA 1JQYD 2RPQA 3A8KE 1YX6B 2HJ1A 2LXAA 2ZZPB 2NVYB 1KL9A 2B2UA 2JQRB 3U4VA 4Q2JA 3MA2B 4K8IA 4C3HB 3KBGA 2JZZA 5M5XH 1RLFA 3K0YA 1FYCA 1LTID 1ONLA 2DYOA 1J0GA 3AEVA 1Y1VH 1IW7D 1N62A 2JPHA 4EQNA 1HHVA 1R4PB 4J15A 3U9SA 5HFYA 1KIXA 1WJ6A 1V1PA 3J81j 3HOVG 1CUKA 2BWFA 3I4LA 1XPOA 3ULPA 5DPTA 2DUDA 4ZK9B 3HOWH 3M4YA 3L3OC 3AE9B 1VF7A 4DV6Q 2F0NA 5EKKA 1BF4A 1AARA 1E10A 3CRKC 2RVLA 1HUNA 1HEZE 4GKJL 2KYWA 2FBWB 3APFA 1ET6A 5CC4A 5KNBA 2NBFA 1QOBA 4JOIC 3L08A 3IFTA 2J7ZA 1D2BA 3IBEA 1FNWA 3QOJA 1KH0A 1EIGA 1IUEA 1LM0A 4YSYB 2QDFA 2KMAA 3BK2A 3IAM1 1F9PA 5AFWA 4C2MH 3FRPB 5I9PA 2L0TA 5CGKA 4A3PA 1MG8A 1WGYA 1WSPA 3RUIB 5C3EG 3MEFA 1L0XB 1QG7A 4CDCC 1WZ3A 2GBRA 3LJ3A 2D62A 3O65B 3AEEB 4X3KA 4L6TB 1HJPA 5M3FB 2E2JH 4DV6L 2AWNA 4G3XB 4MZ9A 1PZKD 2BB6A 2D5GA 3WOFA 3AMUA 4ME3A 4IM3A 2D0OA 4X62Q 4O0AA 2Z4IA 3HM6X 3DVGY 1FD6A 1A8VA 4B3TQ 3Q3JA 1IXRA 5TSSA 1JWAD 2WS3B 3Q8AA 5D14A 1CK1A 4AQ7A 2KC1A 3DDCB 3QAQA 4URKA 3GTOB 4HLEA 1DCZA 3AQQA 4B3ML 2HD3A 2JA5G 2KUMA 1NMFA 1EY6A 2BS3B 3ZJTA 1MSHA 4HSPA 2B3GA 5I6YA 3HOYH 1L4DB 5KGUA 3A4SC 3QARA 1DGSA 4ANXA 4A55A 1QUQA 2ASQA 3X3NA 1PLFA 1TWAB 4WJWA 1T0YA 3U2SC 3U30A 4JI4Q 4ANUA 2ZJDA 1OEYA 3P75A 5I2XA 4E71A 4X62L 3K57A 5F2DA 2WGSA 3HOZH 1VRAB 1EYAA 4BBRG 3PUXA 3OOCA 2JA6H 4B3TL 3J7AF 3D8GA 2J0JA 4HJAA 3FILA 5C1ZA 1NBFC 4KGTA 2I0QA 3N1XC 1K73C 4G7OC 4GLAC 4N6EB 4EVOA 2IT1A 2C9WB 3P4SB 3S17H 5LMUL 4REZA 1JE4A 2LGYA 2QHOA 3CXCA 4DV7Q 3A9KB 4X64L 2X38A 1EY9A 5BMGA 5IA7A 1XCTL 3VXWA 1QE6A 1C7YA 2NBWB 3HZXA 2IGDA 4ARCA 1VQGA 1L1OC 4X6AH 1F77A 3RNUA 2Y5CA 3N52A 3ERSX 3NP8A 5BR8L 3PO3H 4FYDA 3I9V1 3NTKA 1KD1C 4KGRA 1HR0W 3PZDA 2K05A 2KJHB 1E90A 2KCTA 5GXGB 4NMZA 3KOJA 3T4AC 1ASZA 3S2DB 1U4LA 1YJWA 1PYSB 2PQEA 4PMWA 1VQ4A 5K5PA 1AE3A 1VQ9A 4J6IA 2LUMA 5JH5C 3PSIA 1TWFB 2HUGA 1DXMA 2A6HD 3DVGX 1T0RC 1J7BA 5M3FG 2E2IB 4TV3A 2F4VQ 4KDIC 1B2TA 2YYZA 3ULLA 1YITA 2GVAA 2G45B 1Q81C 3J7YW 5AZGA 4JIOU 3I3TB 5IGBA 5C0XG 5DM63 3T8MA 3M4OB 2VW9A 2MP1A 1AWDA 2N7JA 4BKSA 2JWUA 3A55A 1AH9A 1VD2A 2IBIB 2D3AA 4HMJA 2CWPA 3CHBD 2UXCQ 2RA4A 3A9KA 3UINB 4JBJA 2KAJA 1Y1WB 2NTSA 2AQ3B 1SAPA 1K53A 2A68D 3K9OB 3PV1A 1KRHA 5CTRC 1HZCA 3CPWA 2E5LQ 3EFUA 4H2AA 3CQZB 5A2QL 2Z8LA 1AN8A 2OOBB 2ON8A 2JVCA 4ANVA 3SFEB 3OMGA 3VH4B 3SK5A 2F4VL 1MI0A 3IAYA 2EY1A 3W1YA 1B50A 2EQSA 4R4TA 1F2MA 2HIXA 5M5WH 5BYRA 4GOPB 2LFNA 1FNVA 1HE8A 1BVSA 1N5XA 2PE9A 1GAQB 4WQOB 1E8WA 1CI3M 3KYDD 5C4ZA 3BZKA 4HVBA 2G4DB 3ABVB 3HP3A 4V190 2ACZB 2M4NA 1TR5A 5HGTA 1AE2A 1WI5A 2UXCL 5L83A 3HFZB 2PNHA 1WIAA 2CHZA 2B2TA 3IVFA 3E3XA 5HGQA 1LT5D 2IX0A 2E5LL 3B2FA 1UUPA 1XLOA 2YEPF 4AIMA 2KHIA 3CAMA 1ESFA 1U4PA 4WJ4A 1IYVA 3VDYA 1VQNA 4A3LG 3ENEA 1SMYC 1ZEQX 4KKJA 4WURA 1SXTA 3RNEC 2WXLA 3ND8A 2C7HA 3NZUA 1GKHA 2K32A 1STNA 3RN2A 2KHWB 1PTOB 3CCEA 3Q3OC 3J7A5 2KJ6A 4H44C 4KZ0A 4RFBA 4GXBA 4OZBA 2FAZA 3A8IE 4XT1B 5A35A 5JAVA 4BY1H 1MFWA 5FJ8G 4B3SL 2BYVE 5C4HA 4IG7B 4P7IA 3SR6A 4CO7A 2QMTA 3ITPA 1VMPA 2B2WA 2GN5A 1UBIA 4YCUA 1PH3A 1EIFA 1PRTF 2MW5A 3EVQA 5KRUA 3PO0A 3NK9A 4LFCQ 1RKNA 3FC4A 1WJUA 3ZUNA 1B9RA 5FKAC 2EIFA 2C60A 2BYEA 2K6DB 1WRDB 2PPHA 3BDLA 1TS3A 5DPWA 4HK2A 2H5XA 4KDLB 3T9LA 3BG3A 2LS01 3CW2C 1Y1WG 2K04A 4WWPA 3SDLC 1SJED 3UQAA 4FF4A 2WNMA 4X65L 1JICA 2R7DA 3S2AA 4KVGB 2RDBC 2BT6A 3BS1A 1U5KA 1TU2B 1UWXA 5DM73 3S2HH 3URYA 2YU9B 2F3IA 3DVNV 1DOYA 3K7UC 1PV4A 4HCEA 3HVZA 5AZHA 2JE6I 5ELNA 4KV6A 3M62B 3PUYA 4A3IG 4RKBA 1DZ1A 2M2LA 4DA2A 1M8AA 4CJ1B 5DCNA 4YTMB 2K8BA 3NJTA 4XTCS 2KTFA 3VR8B 4FADA 5G55A 2JA8B 4I6LB 1JC7A 1GUOA 2DZJA 2Y5BB 3DBLB 3BDCA 3H6MA 1EWHA 1VQKA 2F0EA 2IX3A 2OJRA 1EY7A 5C4XH 3GB1A 1IL8A 4POFA 2Q8RE 3MC0B 3DBHB 1NTGA 1K0RA 4GN3B 5J22A 3MWYW 3GZNB 3SHLA 3LB8C 3BVZA 4A3CH 1GHJA 2KEDA 4HPPA 1NI3A 5CMDA 1O80A 2Y3AA 1LTLA 3HHMA 1DOXA 4U68A 1CZPA 2K8HA 2Q8IB 2VH1A 1P8LA 1NI2A 2PW7A 5LHY1 3SK4A 2MBQA 5EJWA 4J6HA 2Q2UA 1ESRA 5K36H 1X3FA 1VQ7A 5ELOA 4A3FB 1TWGH 4JI6Q 5LL6X 2VQFQ 3GE3C 2MO0A 2EPBA 3BINA 2XNAC 1EQTA 3PT2B 4HCPB 3CMEA 2L0FA 3IAS1 1RL2A 4XGAB 2ZT9C 4A3KH 1N32L 4YSZB 2R61A 3MEHA 3RLFA 3ULJA 3JAME 1EF1A 3EIVA 4DWFA 5MPOA 3RFZB 2QEJC 3A4RA 4HTHA 5JJKA 5AUIA 4R4IA 1VDZA 5E3FA 2UXDL 5M5YB 4F8CB 2LXKA 2N1VA 1LFDA 5G2NA 1I50B 4R8IA 4JI0Q 4KHPQ 1X3EA 1Z7TA 1IHZA 5DPRA 4XT3B 3VR3A 4PYUA 1WFQA 4JI6L 1O7IA 4KSLC 1EUJA 1VQOA 2VQFL 1ET9A 2OF1A 4NDXA 3MJ5A 3RN9C 5JPNC 4C3HH 2CCZA 2NBUA 4EFOA 2A74C 1BUIC 5C0XJ 2INPE 4AUQC 3TZDA 3STBC 3HKZE 1GHKA 4B0MA 3I4NG 4C1NI 1E2ZA 3AI5A 1KLVA 3ZRCA 1KXLA 3RZOB 2NVXB 4A75A 2KBNA 1ZYRC 2MGSA 4K6LA 2WHIA 2JA8G 1E8ZA 2JY6A 2PLPA 2D3CA 1IYUA 1PFDA 1WCMB 3RNBC 1ILQA 5EPKA 4JI0L 2VL6A 4KHPL 5KYIA 1Q0WB 4HJ5A 3QB3A 2MBHA 4CJ2C 3LX0A 2LI5A 2RQXA 4HIOA 1QOFA 3PS6A 3DQVA 4MACA 3UGBB 3K80C 4LFBQ 2KACA 3QC8B 4HJ7A 2N88A 1XD3B 1WYGA 3E0JA 3ECIA 2WU5B 1MD2D 2A6HC 4F87A 4LF7Q 2GBNA 1KHIA 2XBBC 3LXFA 1VF5C 5IP7H 2J53A 1VS0A 5M3FH 4A3FG 5EQ0A 2DN8A 1PGAA 2JXTA 2WXRA 3K7AB 3P7JA 3HIZA 2A69C 2ENBA 5EGTA 3DWAA 2QCZA 3HVDA 1YNXA 2LXJA 3G6JB 5JVG3 1VDVA 5AUKA 1E7ZA 3Q8FA 1SYDA 4IOCA 5C0XH 4B9WA 1YN3A 1JMLA 1KABA 3F8TA 3MXPA 4UPAA 1VQ8A 1ASYA 3H94A 1QVFA 3P42A 4GOPC 4JPBW 1Y56A 4OX9L 1C3TA 1XO3A 1WJJA 2XTIA 4YTPB 1RHPA 3NSWA 2KJRA 3GTOH 3ML9A 2XSCA 2VB3X 2UU9L 5AZFA 5T1IA 1M94A 3AE7B 2CW0C 1D1IA 4GLXA 2FIFA 1YNNC 4II3B 4O2DA 3RUZA 4B9XA 2LGDA 3H0GB 1WTQA 4RMAA 1TWHB 3I57A 1I4QA 1MJDA 2LGSA 3X3MA 3EHVA 5I9OA 4MGKE 2K6AA 5M3MB 4MGIE 1GVPA 4ULLA 1R9TB 3C1EA 3G6EA 1HNWQ 2EMTA 1VQLA 1XX8A 3FKIG 1BUVT 5JEAH 4XIGS 1SSNA 2RR9A 1I3QH 3SR1A 4XE0A 1BT0A 2MLBA 1JJ2A 5E7NA 3KJOA 4C1NK 4LF8Q 3HOYB 3TMPB 2BE5D 2NZHA 4HPMB 5BN3A 1OO9B 3VR5A 4ZKBB 1JALA 3AE8B 4UDUC 4WJPA 3NEMA 1S4ZA 3TUOA 1VLBA 5C5LA 1J6QA 3PF5A 5IGFA 4A3LH 1CSQA 5E6PA 3HOZB 1W6KA 2JA6B 4JI5L 5LMNL 2L83A 1JJCB 5DNFA 2KFJA 2MH7A 4HJKA 2PQAA 2A5UA 4QB4A 2OEDA 3TDQA 1WZ0A 2DNCA 3FVQA 4QL5A 1MG4A 2PVGC 3S2DH 3D31A 2PCFB 3HOWG 4WORA 2B3AA 2B63B 1AP0A 1PRTD 4LF8L 1TZOA 4IFDI 2WB1E 3NELA 5DAUA 2F0WA 1TWFH 1HZAA 4IPCA 4A3GH 4WWNA 3OIPA 4N8X1 4X57B 5T1GA 4K7SA 1IGCA 1W3SA 2HE7A 2MPMA 3HKSA 3MFYA 3FMCA 1D5ZC 2UYZB 1UNSA 2LVPA 1G51A 4TRDA 4DNIA 4B6WA 4OXPA 2GRIA 3PRMB 1Y8PB 4UY8C 1R4NB 3D0FA 1EFWA 1UBQA 3SEBA 1EF5A 2BB5A 1Y1WH 4XZ4A 3KW5B 1LTSD 3A56A 1SEBD 4LDTD 4P72A 3PIO3 3CQZH 2ZXPA 4W9IA 2C5CA 4MJSA 2K5VA 3J81L 3J81c 1LTRD 3RI7C 4ASWC 3I72A 1TKEA 4IUNA 1QOHA 4DF7A 3NWSA 1XMOL 2DY8A 2K9XA 3H0GG 1YN5A 3CC2A 2L05A 5BN4A 4YHHL 3VTWA 2FXQA 4BBSH 4CBVA 1MJEA 1W6JA 3KYCD 5M3MG 2WXGA 1YI2A 2EVBA 1LTBD 4ODGA 1GUTA 2KNBA 3JVZX 3PVLA 2O4XA 4N59A 1WR6E 1EY8A 5LLIA 1HA5A 3RZDH 3AEGB 2DHZA 1X3QA 2G9DA 3V05A 3VRAB 4XC2A 3U50C 1ISNA 4C7ZA 3HOYG 2RD0A 1FIQA 5CHWA 4B3RQ 2IZVB 1I94Q 3MC8A 2MO1A 1Z47A 1WYDA 2E75C 2F4IA 1SE8A 3DLLA 2BF8B 4GN5A 1QLBB 4WAFA 1EY0A 4KSKC 1WJ4A 1H9RA 3CP0A 4M00A 4DHJD 2N0SB 4MTKA 3GE8C 5M5WB 4DUYQ 2JWZA 3NZ3A 3HOZG 4IQZA 1SYCA 2JA6G 4JYAQ 1F2RI 2WXPA 5IWAQ 4GU2A 4EEWA 2LJ5A 4NJCA 3RN5A 1GOZA 4CJ0B 2HHHQ 2Z6BA 1D5MC 3S9WA 3I63C 1L0YB 2JF5A 4FHKA 2WLBA 5CBAE 5J1ZA 2HCIA 1S5CD 3MZ5A 1UE1A 3PUWA 2B63G 4KHZA 1YN4A 5D7GA 1STGA 2Y0SB 4PMBA 1A0IA 1XNQQ 1PGXA 1WXAA 2WXJA 1L5PA 1SBBB 1Z5SB 2LKVA 4K3CA 3E9SA 4QAYA 2EZVA 1EIYB 3PO3G 2L32A 2VQEQ 2B2YA 1SGHA 3KUZA 4GMVA 3S15B 2KVMA 1PH9A 1IZ6A 2FUHB 2KN4A 1GNUA 3A33B 2KECA 2RKSA 4JYAL 3T1YQ 1EO6A 5IY0A 1MBYA 2D07B 3CMMB 4KIKB 1VZ8A 3ZNHB 1LTGD 2A1AA 1ENCA 2GBJA 3H9DA 4IPGA 4LAAA 3VR9B 2Q8TA 2F0LA 3I55A 4RCNA 1PZJD 4O42A 1HNZQ 2ZPNA 5IP9G 1NEKB 2K50A 2DY7A 2F0QA 2V4DA 1QZGA 1CQVA 4M1UB 5IYBG 4IW0A 4J1MA 3OSOA 3Q23A 4DV3Q 4J3OD 2Q2IA 1LABA 2K5DA 1SNCA 1OTCA 1NENB 2KWDA 3EA6A 1WJNA 3JW0X 4UP9A 2INDC 2BCOA 1WF9A 1HA6A 2JA8H 2K1FA 1EYGA 1A3TA 1UWVA 2R7FA 1HUMA 3HRDD 2GA4B 1ACCA 3BVGA 1F2LA 2FINB 1LXDA 4JI3L 3R93A 3H7PB 3V3XA 3P1MA 3OPOA 1N33Q 3QIAA 3C2PA 2IO3B 3FPPA 5KNCA 2DWQA 3BZDB 5C44B 1XXGA 2CFMA 1YIJA 4KIKA 2JZ3B 2K33A 1NDDA 2HDEA 1SYGA 5D6JB 5FLXE 2CJNA 3N3KB 1I5FA 2FJ2A 4DV3L 3J80E 2NS5A 1O7YA 2NBVB 4DK1A 1JWBD 3J9CA 5IGDA 2YLMA 2UUBQ 4DPGA 4USAA 1Q8IA 2QKIC 4A3FH 3TQYA 1LM8B 3KWVA 5IOIA 2VZKD 1JOOA 2RSUA 3W3AA 1M1KC 2WDQB 3PIP3 2AUJD 1E2VA 4IJLA 2N7EA 3M7GA 4OO1I 1YIWA 3VFKA 4JV5Q 3MVVA 1T0QC 4LNKA 3TBLD 1ZPSA 1D3ZA 1HR0Q 1PH1A 1D8LA 1VQBA 1A63A 2GVBA 5M5YH 3H7PA 4WAAA 1I50H 1X32A 3MXGA 3DBRI 3WA0A 2DZMA 1AFPA 5D94A 3PCOB 1D6EC 1PTOF 4YCVA 2UUBL 1YEZA 1JCKB 2I38A 3Q0AA 1OGWA 2VRRB 3P2BA 4A3KB 2XK5B 4JI7Q 4S17A 2XRQD 3R2IA 3TBIB 4LJPB 5CHVC 4HROA 5EE9A 1IKMA 1RWSA 1AZPA 3DM3A 2YTYA 1WM3A 4CYEA 5EBDA 2AKWB 4P16A 4FXGC 1C4CA 2RSOA 2KDMA 3AB5A 2JZPA 2KQSA 3OJ3A 2NVXH 4LTUA 4X3TA 1V43A 3T1HQ 2R6GA 4G50A 4IALA 1JORA 3G7LA 3W5VB 2LHEA 1SNQA 1WCMH 1G91A 1E7UA 1UEBA 2J7QB 2L8JA 5E4XA 3K58A 2VUMH 4EZKA 2PO4A 4GGQA 2K0PA 3EN2A 4ZUIA 2DNFA 1XTCD 2ZXOA 2N49A 2IWHA 3WALA 2B76B 3IKJA 5KYLA 4AJYB 4TMAB 3EROA 4IWOA 2XWBB 2KENA 2NMQA 5IGEA 4X3UA 5CR3A 2HDLA 2N9PC 1Q86C 1SJHD 4IWQA 5E6OA 2XK5A 4ACFA 2C35B 2QDBA 1IBXA 5C4XG 2GLSA 3PO2H 2GB1A 2KLGA 2EYJA 2RHSB 3P1HA 3K7AH 3H3VI 2N78A 3ALBA 4EQOA 5FO7B 2IHFA 4A3CG 1YNJD 2G9HD 2J0KA 1QVGA 2VS1A 3PPAA 1P0RA 3Q24A 2D9UA 2FUG1 2LUEA 2W9NA 3TEXA 3VUXA 4A3BB 3MC9A 2UUAQ 1C48A 4R1JA 2EE1A 1V5OA 4DAMA 2ZJQA 1YHAA 3Q3NC 4BAXA 4EUTA 2B2YC 3QG1A 1J7AA 1RTNA 2J42A 1E0BA 2BA1A 5K36G 1RAXA 1RRBA 4HR7B 3TEYA 2B2VC 4FXCA 4YXDB 1S3SG 2K52A 3L0OA 3KK7A 2KK8A 3H6NA 3Q3FA 1FXTB 3LGJA 4B0EA 3C3LA 4W9CA 3H0GH 3M9BA 1TWHH 4IJHA 4G7HC 5D65A 1C9OA 1KDBA 4C3JB 4A3KG 5M3MH 1K8MA 1SDFA 1R9TH 5EKIA 1PDQA 2V3SA 3N30A 5BMIA 3AEDB 2GBMA 5D2MB 3SXHA 1PH5A 2W55A 2L12A 2MBBB 2C5LC 1BDOA 4DNRB 2UUAL 4AJWA 3OMCA 2V4IB 1WYWB 3F2UA 4LNFA 3SHQA 5CHFA 1BOSA 1TXYA 4KGSA 3Q6SA 1T3QA 4J8QA 4JWSC 4FJYA 1NCVA 1STBA 2D11A 4MN3A 5C4JB 1F2ZA 2WQYB 1ZDVA 3ZJVA 4C3HG 1CZGA 2GMIC 1DYQA 2IO1B 3TS0A 5I4DA 3AEBB 3TCAA 1I3QB 1WXVA 5EKLA 5GAGC 3ZJYC 4NXNQ 3PGZA 2KC2A 3EUB2 5BO4B 3ZYYX 1GC6A 2Z9HA 3ERQA 2OQKA 4R4CA 2X8XX 3MHBA 4RWSC 4LF9Q 4OIKA 2Z1CA 2B63H 2K39A 1X56A 1WTWA 2L0CA 2KCNA 1SN8A 1SE3A 4UP7A 1BNZA 3DHQA 4TQ1A 1UH6A 4BKSD 5G3LF 4AH6A 1SE2A 4PQXA 3E9IA 1YVCA 2BPSA 3SFDB 1B4OA 2D3BA 2OQ0A 4JI4L 4MEMA 1K3BC 1VQDA 1KC8C 1H95A 3U58A 1EWCA 2EYFA 3RZFA 3TP8A 3UIOB 1IP9A 4ZAIA 2L00B 2CHBD 2NTTA 2N1WA 2UWQA 4A3BG 1Q1EA 2D3GA 2O6VD 2K8CA 4DV0Q 1C78A 4GDKB 5IP7G 2K5QA 1IYJB 2CQAA 5HI1A 3TP7A 4A3GB 3K6OA 1QOGA 2HDMA 1MHWC 4DV7L 1ZW7A 4W9KA 1EU3A 5EE1A 4M0WB 5IP9H 2OT2A 2R2QA 1F2YA 2LFIA 4YWKA 2DAFA 2JXXA 4G7ZC 1XWEA 1Z9FA 2V9HA 1VQFA 5IYBH 2Z0DB 2NN6H 1L2FA 2JA7B 4GOCA 2DJFC 4X3SA 3NOBA 4EZLA 1HRJA 5IP4D 4L23A 2K22A 3RLOA 4A93B 1LYLA 2X6LA 1V9PA 4RGOS 4ZRQA 2PI2E 4US8A 5ELFA 4AQYQ 1PFSA 2OEOA 4YT0B 5GMVA 1WTHA 2K01A 4BXXH 5G5GA 3MHZA 1BCPD 2N55A 4M8AA 3PIPA 5BMHA 3GTJB 5COYA 1EQQA 1ILPA 1FCCC 1DONA 4FO2A 3C0RB 1C8CA 4BBSB 4LW1A 1ENFA 3NS8A 1WOCA 4EZJA 4ZQ3A 5GAHC 3KBXA 1X6OA 5C3JB 5L95C 1N6ZA 2Y5PA 4YY3Q 1BCPB 5JEAG 1T5XD 1EQRA 4GDKA 3RZDB 2LEKA 1JRPA 3P4QB 2L3ZA 4KJOA 1J19A 1UWMA 2K5HA 3NXWA 4G0NB 2ZM6Q 2F0DA 4K81A 4ZYSA 3HRZC 1ZKOA 4M0WA 4AQYL 4L5SA 1KDCA 4WJ3M 2BOSA 1P3QU 1SYFA 3O13A 1TBEA 4IUPA 1LT4D 1B3AA 2W3RA 2I5MX 3PUVA 1GG3A 4RF0A 1H9KA 2IO0B 4CHKA 1YQ3B 2J4XA 4DV1Q 3Q2AC 3L2PA 3PHXB 2XWJB 1H9JA 1M4VA 1X9NA 1F1HA 3Q8DA 3S15H 3MJWA 2ICIA 2EY2A 4NW2A 1PQSA 2WDVB 1LV9A 3HOXB 2K28A 3GTPH 3WAOA 3HKZB 4W9LA 1PFNA 2ZM6L 3PLVA 1QOAA 1TT2A 3VYRA 5ELDA 4A3GG 1WTVA 1NY4A 1TIID 3E0EA 4GOPA 3CD6A 1PFBA 3PRPB 2CS4A 2XGTA 1WD0A 3GDEA 1IBKQ 1EYCA 4QY7A 1E22A 1SIJA 2QSDA 2N3SA 3V6EB 1ZXIA 5D3IB 4U673 4DV1L 2BW2A 3JAMi 4R4OA 4CDDC 1WM2A 2X6GA 1GUNA 1PYWD 2PZWA 4A93G 2E2HB 2V3NA 4N9F4 3AU5A 4D2KA 1WXQA 1Q3LA 5JJZA 4GLSC 4ILWA 4BS9A 2F0KA 2Q2TA 1Q1OA 2KLCA 2CKHB 1Q5WB 1EFID 1CFMA 1P16A 1IW7C 3CC7A 4LF6Q 1K50A 2WXFA 1RFAA 2F0OA 2KOXA 1PH2A 4LFCL 2K5NA 2A5HA 1PH7A 4BBSG 1TS5A 4KI0A 1K52A 3RD2A 2REXA 3NVYA 5C44H 3P4PB 1IBKL 1MKHA 4AYBE 2M56B 2Z0EB 3H7SA 2CH4W 1HTOA 3ER0A 3MP9A 3IT4B 2LHDA 2UXBQ 2W54A 4M8NA 3ZNZB 3TEWA 4WWMA 2FCSA 1SSOA 1G6PA 2KN5A 2ZTCA 3S1RH 1YNJC 1FPYA 1KJTA 3ZIMA 4DR2Q 4ZRPA 3K5NA 3L4PA 3M4PA 3NVVA 2KA7A 4JI8Q 3RD4A 2PJHA 3EFCA 1SROA 4JPSA 4I7ZC 5EPJA 1EY5A 4Z9CB 2JUOA 4DDGD 2WDTB 1I4XA 2BVCA 1FRDA 4MGYE 4IUMB 2RDGA 2RMMA 4MDKE 4DGZA 3UF8A 2AQ1B 3KWLA 2OXPA 1NE3A 1UE6A 4C4VB 3VYSA 1A2TA 1QJOA 4CQNA 4MT5A 2E74C 5FOBB 4NQKE 3ONAB 1V6EA 4LJOB 5LNK1 4KD4A 4C80A 4YWMA 3AEAB 3DPDA 3GP7A 3OAWA 2B39A 3R8BA 2R2OA 2WXNA 4LNQA 4AWJA 2H1EA 4RHSA 3SK8A 4JI8L 2ZCCA 1RJTA 3QHTA 4ZDVA 5H1SE 4RGMA 4GIVA 3V96A 4DR3Q 3D4DA 1PFMA 3P20A 1JROA 2LVQA 1RF2D 2NUCA 3BYTB 2EJFC 4RGNA 4POGA 3S14H 4YL8A 2BH8A 3E6ZX 1FO4A 1CKNB 1NUCA 3VYTA 4HCSA 4CDEC 2KX0A 4DHZE 1UGMA 3ICEA 1EWYC 2JT4B 2KQ4X 2V4LA 3QK0A 2WB1B 4ALPA 1E5WA 2EOTA 1JMCA 5LXIB 1WGGA 2MJ3A 1F9RA 1ZGUB 4XWTA 1K83B 2BYTA 4ICVA 3L10B 1ZOYB 5HG2A 3IL8A 3U4ZA 1UD7A 1B8AA 4KY7A 3L13A 1G8ZD 2KZRA 3D4WA 1RDPD 4R3DA 4A90A 2WWZA 1ML0D 4C3IB 1CQFA 2R93H 2MNAA 3R3OA 1NR2A 1UE7A 1A5RA 1LT3D 2F0IA 2K4KA 4W9GA 4DXGA 4UAIA 2VUMB 2FE8A 3WANA 4GB9A 2D0PA 1SF0A 2F0JA 3E5SA 4TKNA 3ZTDA 1KRTA 3B6YA 4HXDA 2HQLA 1XEEA 3G4SA 3ZVVA 2KDEB 3OIQA 3AV8A 4K7UA 1PHJA 5IO9A 3RNGC 1VQAA 5KHOA 3QO2A 3HM3A 2KJXA 4HPLB 3DWQA 5JEAJ 3KDFB 4JBWA 3CCQA 1PH4A 4IFDG 1E6EB 2MQJA 3TS2A 3VQIA 3L54A 1CKNA 4A3BH 4EGVA 1HZ9A 2XN9C 1LQBA 2A4ZA 4YWGG 1H9MA 2NZOA 1JE5A 1STEA 2L5TA 1DOLA 4OWTB 2JP1A 4H02A 3PO2B 1WMHB 1ZKHA 2DZIA 2K6QA 2QC8A 3U52E 1AW7A 1L6UA 4DUZQ 2IGGA 2EYOA 2M17A 5BN5A 3LWEA 3ZRFA 4AS1A 4QGUA 1PDXA 1ICFB 1FVIA 3NRZA 4BZAA 2BGFA 1LTTD 3D6WA 1MIUA 2K7VA 2WXHA 2A68C 4C3JH 4LFBL 1YHBA 2MCNB 4JGHB 1OFFA 1BCPC 2KXJA 1YJNA 3X23A 4JI2Q 4Y7NB 2KT7A 4LUOA 1XMQQ 1N61A 3S1QH 3RT3B 1S40A 3DXJC 3ZGZA 4LF7L 1A62A 2L1BA 4LNIA 3AXCA 1QF6A 3CMAA 1V86A 5JJIA 2LZ6A 1AZQA 4DBGA 1UE5A 2RF4A 4DR4Q 4LNNA 4A20A 2EKIA 4FJVB 2G4SA 4OL7A 4GN1A 4K5VA 3G71A 4OZAA 2KANA 2DGYA 3KDFA 2AL3A 2MBEA 4XYQA 5EE0A 5C4JH 4P2CB 4LFAQ 1FXIA 2I5HA 3TMEA 2EYLA 1FFVA 2W3SA 1EOTA 1FEHA 3ZTCA 5LXHA 1LGRA 1CM9A 3NE5B 1JB3A 3I4OA 1N34Q 1P98A 3K9PB 3PZ7A 4MGZE 4IOAA 4JI2L 1PZID 3GTMB 3NTIA 4F1SA 4Q0FA 1XMQL 3BJUA 1PXUA 3MTNB 1R4MI 1RFKA 1WE6A 5IT9L 4DNTB 5IT9c 1YOVB 2H88B 3KUCB 2PIAA 3U4EG 4C3IG 1M90C 2KWCA 1IPGA 1R4QB 1WCMG 2BS4B 3DVNU 4KMUC 4IWPA 4DR4L 3MTSA 3CCSA 4B95A 1STHA 3F1ZA 2VUMG 1E1OA 4FXKC 2PMZE 3MXNB 4HSVA 4JBMA 2PNRC 2R3ZA 1J8IA 4E3CA 2F0MA 4H13C 4DV4Q 2ONQA 1HNWL 3H09A 4RNAA 1KDAA 3AB9A 2QIEB 2LMCB 1HPCA 4EX5A 4FNFA 1XQQA 2PW5A 1YHQA 3VR4A 3QX1A 4R8NA 4OZCA 1N34L 4NJ7A 1CA6A 1F9SA 1V2YA 4BA1I 3DHIC 1L2NA 2ALYB 1BR9A 1V1OA 3AE2B 4WQMA 4DR5Q 1LUZA 5J39A 1L0WA 3CCRA 3PO2G 1STAA 1B44D 1BO0A 3VA5A 1GM5A 4HWIB 3RLNA 3OTOQ 2Z59B 3I3CA 3KUDB 2WINB 4B08A 3JC66 1PRTB 3TEZA 3NBHB 2L9HA 2K5WA 2R7ZH 1DOKA 4DR7Q 4GKKQ 3DBRB 2JA7H 2KCCA 1RTOA 4MSMB 2D5DA 4A3DB 1TQOA 4A93H 1FM0D 4P74A 1KM7A 4K5XA 3UQBA 3U9OA 1TKYA 3VRBB 5IYCH 5T8IA 4PS7A 4JW0A 1EWIA 1WTXA 1VZ7A 3MXNA 3GTJH 1GXDC 3DWPA 2OWOA 2IO2B 2NR2A 4DK0A 1RIPA 4DR5L 4MH8A 3F2CA 1UAPA 1U4RA 2WYQA 2BA0A 2EYMA 4KX6B 4IUTA 3SVMA 2KHJA 4WRDA 1AEXA 4LDTB 1V1QA 4HIDA 3A8JE 4PNYA 4DR7L 4GKKL 3X0WA 4BVUC 1WVLA 5M9OA 1VMCA 4IPHA 1SRUA 3I2ZA 5ELBA 4BA2I 2MJDA 4YTNB 5TR5A 3UDXA 4P71A 3SD5A 5KHQA 4QJFA 4HMIA 3FHWA 3VA7A 3T56B 3HK0A 4NQLB 2KDFB 2OHFA 5FLMH 4IO9A 3NBHA 2KHSA 1GO3E 3NG0A 1V8QA 3HG9A 4XQNA 2SAKA 1D4BA 2A8VA 2LY7A 2VY3A 4KN7C 1ZDXA 4EE2A 3K81C 1PA6A 3RNCC 1S5BD 1OXXK 1CKOA 4HKQA 3T53B 1HZ5A 3I8ZA 3NTHA 1ENAA 3OLMD 4LJZC 4DHJB 2KFKB 3HOXH 1DGJA 3VVWB 4JK1C 4OEMB 3J80i 2JYOA 3BDOA 1LTAD 3D6CA 5IODA 2R92H 3DHGC 4B3RL 3QQ8B 1I94L 3VTUA 2YTXA 3M4QA 2F0PA 3I4MB 1K8RB 1IBMQ 4MIUA 4ICUA 2E8GA 4LF4Q 2D2CC 4IUVA 2AUKA 3KJPA 3GTLH 2XIWA 1E9MA 3PTFC 4K3BA 3EBEA 4PMCA 2BBCA 2WXIA 4OELB 4DUYL 1FL0A 5JVH3 4ZRZA 2RCFA 2FFKB 2ZXRA 3GV6A 2B2VA 4R4QA 1UZXB 3FP9A 5IWAL 2EJGC 4IFDJ 3GTPB 1F9JA 1OXVA 5E4WC 4DV5Q 2JQOA 4K0KQ 2HHHL 2N4FA 4KZCA 2M00A 2E2HH 3ZNGC 2ZW1A 1QNUA 5CV5A 3M3YB 4DN4M 4FVMA 1PGBA 3GS2A 1XNQL 5FO8B 3JSVB 2IW3A 2FHTA 4JE3B 4XDXA 3NWTA 1F2RC 2D2QA 4DFAA 1IBML 3QJZA 4BKTA 4LF4L 1D7QA 2NN6G 2VQEL 1WD1A 4II2B 1VQHA 5EBCA 4O1NA 2V1YA 3HS0C 3N32A 4TQUS 2MQHA 4DK6C 1Z6HA 3T1YL 3GTQB 2MRPA 3AE1B 4NZLB 3CU7A 3KF8B 4BXXG 3IT6B 5EDSA 1OTRB 2KOLA 4DV5L 2DLBA 5IYDG 4QIWE 3M7NA 5DLQE 3UI3A 1V49A 1I6VC 2KQ3A 2HTME 1B9NA 2E76C 5LMNW 4A3JB 1QNKA 4A3MB 1HCZA 5IGCA 1EU4A 1HNZL 3GQBA 1X1MA 3VR6A 1TT5B 1V97A 3AECB 1ZXHA 4WJNA 3RNAC 2GOWA 4XQJA 2TSSA 1A2UA 1HXYD 4L63B 4PV1C 2ZPYA 3SGIA 2A6ED 2F0TA 4C00A 2AYOB 4IFDH 4XQQA 3WDNA 1TY2A 4I65A 4BKGA 1C76A 4GZYC 3ZO5B 3E56A 3DOWA 2IHEA 3A1QB 3IFWB 3S1RB 2EYPA 2BKRB 3JYUA 3BY4B 4ID6A 2Y0SG 2SOBA 4CKBA 2JJQA 2ASBA 1G6JA 4OONA 3ZNID 2RPVA 2DYMA 5ELCA 3I4MG 4L5TA 1J8CA 1TIFA 4BOZB 2IL8A 2TMPA 3P4RB 1B1ZA 1N33L 3QJYA 2MP2B 1GB1A 4MNOA 3KF6B 4NKLA 1DJRD 1XPUA 3HOVB 2G5DA 4CDFC 3MXUA 3K59A 1NAPA 4X66Q 1BBXC 2VZKB 3WCQA 1TYGB 1HH2P 2EMSA 2UUCQ 1QWYA 2QILA 1N5WA 4FBJB 3VDZA 1XPRA 2M0XA 4HEA1 2Q2HA 3CKIB 1O7ZA 3ZKJC 4US9A 3TREA 1QVCA 4N9TA 1Q10A 5IKCM 2C9OA 2WP8J 4ZLTF 5CBEE 2MHJA 2L11A 3DUZA 2WACA 5I2YA 1YZ6A 1GPXA 4XDCA 2INCC 4PZ7A 3TRZA 1E8YA 1TJEA 2WAQE 2BE5C 1S72A 2IGHA 1X3PA 3L7ZC 4RGTA 1NYRA 4LLGM 4JV5L 5C3EB 4QQBX 3A1QA 1K83H 4NAMA 4JWUC 4DV2Q 1XLNA 1SNDA 3S14B 5C3XA 1TWCH 1W2BA 1HR0L 3KLSX 4FHJA 5C2TB 1YQ4B 4W9HA 1SB3C 2ZVOA 2UUCL 1R4NI 4C3IH 1WX7A 5H8YE 3ZQ4A 3ETRA 4A3JG 4GNXC 3BIID 1PMRA 3KF6A 2OTLA 4A3MG 4PK1A 4YSXB 3NQIA 4DU9A 1K8GA 4M02A 3A7AB 4JI7L 3EFXD 1JWSD 1TS2A 4MTNA 3B9JA 5C44G 1PRTC 2QCPX 2YTVA 1BKBA 3CCVA 4G4KA 4RM9A 4RMFA 3PIOA 1JW9D 1OQYA 1UELA 4IDIA 3RMKC 1G6ZA 3FDTA 3RYTA 5E1FA 3J7ZC 2R93B 4HKZE 3QR8A 3S1MB 1GUAB 3J81E 4GKJQ 4ME5A 3T1HL 3Q69A 1Q12A 2KKCA 2XVSA 1ZE3D 1RODA 1MHHE 2WXMA 1E7PB 5J17A 4BBNC 4BBRB 1YQBA 3ML8A 1E7VA 1WGRA 2E2DC 1N9WA 3PQIA 3CF6E 1VQ5A 1B7YB 3TN2A 4MH0E 1KLGD 2CU3A 1JOKA 4GS3A 4Y7NH 2PVOD 2AQ2B 3ZJUA 4W9EA 1IL2A 3W1SC 1JQ4A 1RM6C 1UEAB 2WX1A 2ZJPA 1Y8OB 1U4AA 1WGDA 1VZ6A 5JZEB 4IM2A 4MM3B 4K1RB 3NPPA 3OW2A 2KVZA 2PEAA 2I2YA 2MJ8A 4KLKA 1CMXB 1QUQB 2N9EB 1C9FA 1YNTE 3OJ4B 5KIXA 1BBUA 4S3SA 4G11A 4GDLB 2V0GA 3TL5A 1XTDA 4QF4A 4B3MQ 1U0LA 3S1QB 2HTHA 2GBKA 2MJEA 4JLCA 3S1NB 1FRRA 2DENB 3C8YA 3M95A 3VR2A 2A73B 2PI2A 3B08A 1YJIA 3GTMH 4C56C 3G48A 3FILB 4NXMQ 1NBWA 4P73A 3H3VC 4RH6A 1SYBA 3L16A 3QIJA 4RA8A 1WX9A 4PYZA 3CCLA 4HRSA 5DEHA 2Z4HA 2JA9A 5J18A 1T0SC 1T9HA 1EZ6A 1Y14B 5KEEA 3U7ZA 2Z6KA 2RGFA 2DX5B 2MBOA 3U7DA 4FF2A 1G291 1XF5L 2K75A 3CF5A 5JHBA 3GTKB 4FF3A 3T13A 4IUQA 5LMUQ 3B1LX 4MM3A 2DNEA 4AP4C 4X64Q 2K1BA 2JRHA 1TKWB 1X3GA 3KYHC 2R93G 3BWUD 3UIPB 4DAPA 1FGBD 3KUPA 4NXML 1TKGA 3AEFB 2MA9B 3Q6BA 3R7RA 4OO1H 4GDLA 3AE4B 3K0XA 3KLWA 4A3EB 5BR8Q 2HQEA 3AFPA 3NQTA 3QA8A 1L0VB 4RKLA 5EAYA 3W1GA 2VNUD 1P7FA 1AYFA 2IY1B 1PH8A 1SIFA 2NVQB 2WIIB 3JAML 3JAMc 3DCGA 1KQSA 2ZW0A 3CPFA 1E8XA 4A9AA 2L7RA 4NXNL 1JB7A 1EIHA 4MELA 2FMMA 2JSOA 1EZ8A 3STBD 4A3DH 2JU6X 1PYBA 4WIPA 1QCBD 3NUCA 3PMFA 4LF9L 1R7SA 2OCEA 4AYBB 1XCQL 4P1BC 3NHHA 3W9CB 1ZYRD 4KK7A 4WH4A 3AFQA 5ISRA 1GB4A 5GAEC 2F03A 2WXOA 1CTMA 2CQOA 3ZXVA 2WP9B 4XX5A 2N8NA 2K25A 2O6VB 3U8ZA 5FK9C 2R7ZB 2O2VB 3R7QA 3SE0A 4TUUA 4C3JG 2JYEA 2INNE 1CKMA 1C4PA 2AX5A 1O78A 3MAQA 3DWGC 2O5IC 3AM9A 3B0AA 3GD7A 3WAMA 2CU1A 4WWOA 5AEKB 3AH7A 1P7EA 5IYDH 1HQMC 4DV0L 4A76A 3VUWA 1NVID 3Q8BA 2CHWA 1X54A 4GLVB 1YJJA 2BS2B 4ZCKA 1V8CA 4FP5D 2NB0A 3OHXC 4ZKCB 4Y52H 1MJCA 1Y8NB 2A6EC 2EYHA 2K14A 1VR9A 5I6WA 3I56A 4K14A 1VQEA 2KO3A 1X65A 2NVTH 1QZHA 4RAUC 1D5XC 5JJLA 2A69D 2GI9A 3N20C 4RHRA 2DBYA 1YBYA 1HTQA 1KLUD 3HOUB 2JK8A 4BOSC 4JCVE 4DK3C 3SU8X 1A3VA 3NENA 3N6RA 4W9DA 2JN4A 2MSED 2ZTEA 1GUSA 2K5PA 1A70A 3H3VH 2FCNA 4QUCA 4EQPA 1EM7A 2KEEA 3I91A 5D3DA 4OVUA 4W9FA 3APDA 2O6VA 3ONSA 2M8SA 3K5LA 2O2VA 1RD9D 2CW0D 1HZ6A 2QGQA 3I4MH 5CV8A 4A3EG 1VQIA 1YNND 3I70A 5JPMC 4A3IB 3GTGB 2HIVA 2BTEA 2B2UC 3N1ZC 4DHZB 4YY3L 2KVRA 5CV7A 4B3SQ 4MHEA 2KMCA 4JBKA 3BK1A 3EC8A 4OVVA 3WWVA 1I6HB 4F7XA 4DK5A 4I6PA 3CSTA 2CJOA 4LMQD 1WFYA 2R92B 2ZCBA 3AN1A 4F7ZA 1PTOD 1XNRQ 3NUHB 1VQ6A 3S16H 5BYSA 1E3PA 1K28A 4AYBG 3V60A 2WV6D 3GTLB 3M3YH 1F0ZA 1JT8A 1HTLD 4NP5A 4F8MA 2M1MA 4P6VF 2WU2B 1Q8KA 1SR3A 2RDHA 3VHTC 5HURA 1LLRD 4HJ9A 4XYCA 2R7ZG 4I6NB 2F3WA 1BXTA 2JA7G 4LCDE 2FMCA 3KLSA 2QF7A 3L0WB 3ZDMC 2L52A 2H4OA 4AOFA 4K2LA 3BVMA 2JSVX 5IYCG 1IKLA 4X65Q 3GTQH 4L5QA 3GV3A 2L1AA 3TEHB 2CH4A 2JEBI 1WI0A 2F0GA 1XNRL 2EY5A 2QA4A 4A3JH 1Q7YC 1OQQA 4APVA 3N9YC 3ZLZA 1SLJA 3L9AX 4KJNA 4A3MH 4RM8A 3TP6A 3I7FA 2LVOA 2PKOA 2NCNA 1FGUA 2FIDA 2SNMA 3OWFA 1V9JA 2EJMA 1R4MB 1S5DD 3HEJA 4A6QA 5CV6A 4A4IA 3OYYA 3V2TA 3BZCA 3UDIA 1QKZA 5C0XI 2KDIA 2VB2X 4PT5A 5G5HA 1JWUD 1TS4A 1VQJA 2F1MA 2Z6KC 4KTAA 1CA5A 3HOUG 1KFYB 3CSFA 2CVRA 4PS3A 2M19A 1HFNA 5L37A 2DYBA 2WXQA 4L1BA 4KN4C 2LWPA 4BBNF 4FXDA 1I4PA 2KDBA 1B70B 3NS1A 4B9KA 1WGHA 3DEPA 4PS8A 1K0SA 5FLMG 2J0MA 4LF6L 4XDDA 1KNEA 2LGXA 4HDOA 3B2GA 3E9HA 1ZUD2 2LRUA 4JG2A 1C1YB 5FO9B 1L6VA 4OVZA 3WIMA 2L15A 1TVXA 3I4NB 5BYQA 1OQRA 1P1AA 1L4ZB 2CWAA 2JRIB 1A3UA 1SFOB 3LDZE 4CKCA 3HOVH 2XRSD 3DWMA 4NPNA 2ES2A 2FCMA 3I5JC 3S24A 1X55A 2N7DA 3OG5A 3HOXG 1WGKA 5C3WA 2HJ8A 2UXBL 4OW0A 3W5OA 3FPUB 2BH2A 4BWGB 2V1CC 2L55A 3HKZG 3I90A 2OTJA 2R92G 2ZNVB 1JOQA 1TGZB 2JXMB 1MI2A 3FKYA 1H8CA 1HFGA 3BYYB 3D3RA 3CCMA 5GROA 3RR5A 3CCUA 4DR2L 1K3RA 1N32Q 2KWVB 3H8HA 1WRIA 1NNXA 1H4RA 2LJIA 1B53A 2C7MB 2OJWA 1QILA 1VQPA 2LD9A 2VH2A 1QQRA 3PGEA 1J9OA 2I1KA 2UXDQ 4WFN3 1KF6B 2PMZB 4YCWA
chains in the Genus database with same CATH topology
2JEAI 4BY7B 5KNDA 5HHDG 4IKGA 4DXFA 1OXUA 1T5EA 1B9MA 3CRLC 5E6JA 4YIJA 2EELA 2H89B 3QOLA 3OW7A 5C5MA 1C4QA 2L4NA 2N9LA 2I07B 3DM1A 1TWCB 3FEWX 1KAAA 1CT1D 2ID0A 4K6DA 2F0VA 3D4RA 5EPLA 5G3LD 2NYZD 2PZTA 3T51B 1ROEA 3T3NA 2F3VA 3OWEB 4IN3A 4IOIE 1I4HA 3FKIB 1CZWA 4KY5A 2PMVA 4RF1A 1K8OA 2SEBD 1FCLA 2NZ1D 3NVWA 2WDRB 4G57A 2X69A 1KTKA 5A2QE 5JOBA 4K8JA 1OXTA 3P63A 1CHPD 4LK1C 5C6AA 1QB5D 5M5XB 1VCIA 2B2TC 1Y1VB 2EXZA 4N58A 3UI2A 5NUCA 5IGGA 5LL6S 3QWNA 3SDZA 2IPKD 3HOWB 2N9KA 3T3OA 4QUFA 4DAVA 1XLPA 4ARIA 1QT9A 3I73A 1NR4A 3PUZA 3W5UB 3H91A 3LWUA 3MFGA 2B2WC 2RSNA 2HCCA 4R9WA 1ZP0B 4C2MB 3T16A 3EJIA 2I46A 2IJ0A 2VXWA 2V3PA 3LNNA 5FLXL 1FD7D 4CHTB 3J80L 2E2JB 1CJEA 1GUWA 2EY6A 3NBIA 4QCLA 3C1FA 3TZUA 2E6XA 2SDFA 5JXVA 3Q8EA 2YEPB 4N9PA 3CWIA 1LT6D 2B8GA 2PTLA 4FF1A 1PTOC 4NAWB 4L2YA 1J7CA 3CIRB 3FAHA 1PUTA 1DM0B 2PW9A 3NVZA 4HAEA 1NYQA 4K5WA 1A6XA 3DMUA 3EGRA 3AU7A 4IUUA 4QIWB 2B8FA 3IXSA 1N63A 2K3UA 2M0AA 1C79A 1I4GA 4E6IA 3A54A 1JWMD 4KKSA 1OXSC 4ABNA 3S17B 2IDYA 4KD3A 1ICWA 1Q1BA 2AWOA 1SNOA 3GO5A 1FFUA 2W82A 5CYUA 5H92C 3PO3B 2LGIA 1BQQT 1RYJA 2LMCA 3EQLC 1MGSA 1FNUA 5CV4A 1UGJA 4RCOA 1G2SA 4ZHPA 1NSNS 5CORA 3SK6A 1EL0A 3PZ8A 1FMAD 2MEKA 1LO5D 4H7BA 4ZOHC 1EY4A 4KKIA 4CGYB 1A15A 3AE6B 2WKDA 1SNPA 2F0UA 4OGQC 4F88A 2NVTB 4ITKA 1HTPA 1Y69U 1DOMA 4XXEA 1U4MA 2WAQB 2SNSA 2RDFA 1D1KA 1JR0D 1KNAA 3WOEA 4DQOC 4IZ8A 3Q22A 4OO1G 1O7LA 1WTOA 2JX5A 3W1SA 1MPEA 1E2WA 2WXKA 2F0FA 1PTOH 4HEDA 4A8XC 2J52A 1SYEA 3S16B 2ICEC 3TP5A 4HN7A 5IOCA 3IFDA 5EE3A 4IURA 1MSGA 1I7HA 3J7AV 1H9SB 3R2TA 1IGDA 3KLRA 4BY1B 1XLQA 1TY0A 2BDOA 2O5JC 5FR3A 1DD2A 2E3TA 1N60A 2PYKA 4K2KA 4OIJA 3HUIA 2NWGA 4TSSA 2QJLA 1GUGA 1GJXA 2JYTA 2WKCA 4C7YA 1SNMA 1CHQD 3AE3B 2F0HA 1HQRD 1FXAA 1S5ED 4XWWA 3AE5B 4H0LC 1EQVA 1F9QA 2O2LD 4HJGE 3LYYA 3Q8CA 3RPFC 3C46A 3A7LA 1BCPF 3RMHA 3S2HB 1H9SA 1VJKA 1G2TA 1WTRA 2PPBC 1RCVD 1STYA 1WWTA 1EYDA 4KKUA 3KF8A 1MVKA 2MHVA 2PZUA 1SE4A 2F0SA 2K03A 5IT9E 4V0BA 4OHJA 3K5OA 4L8JA 1XYIA 4DAYA 4ZHOA 5C4XB 4ZUJA 1FR3A 4Q2JA 4Q5VA 1BMLC 2KMMA 1Q90A 3W2DA 3TSSA 4LK0M 1C77A 2MUYA 2IX1A 1T6BX 1YMHE 3K5MA 4TQ0A 2G1EA 1I4RA 2EDGA 1SMYD 1K51A 1EEFD 1EEID 5CV9A 5ELEA 1WTPA 1TWGB 2Q5WD 1V1PB 3VYUA 4KHVA 4TKOB 3HGBA 1S5FD 2RBMA 4KKTA 3ND9A 1U9RA 4CKEA 4JX1C 1ZXTA 2J0TD 1IBXB 3M85A 5IIFA 1DOIA 4KY6A 3KQ4A 4QMGA 1MHXA 2JA5B 4XYOA 1II3A 2M9VA 2NN6I 3PV0A 1LACA 1C4AA 3DEOA 2BDNA 3AMZA 1JQYD 3A8KE 2NVYB 2B2UA 2JQRB 3MA2B 4K8IA 4C3HB 3KBGA 3K0YA 1FYCA 1LTID 1ONLA 2DYOA 1N62A 1IW7D 4EQNA 1HHVA 1R4PB 3U9SA 5HFYA 1V1PA 3I4LA 4ZK9B 3M4YA 3L3OC 3AE9B 1VF7A 2F0NA 5EKKA 1BF4A 1E10A 3CRKC 2RVLA 1HUNA 1HEZE 2FBWB 1ET6A 5KNBA 5CC4A 2NBFA 1QOBA 3IFTA 2J7ZA 1D2BA 1FNWA 3QOJA 1KH0A 1EIGA 1IUEA 4YSYB 3BK2A 3IAM1 1F9PA 5AFWA 5I9PA 3FRPB 5CGKA 1WSPA 1L0XB 1QG7A 2D62A 3AEEB 4X3KA 4L6TB 5M3FB 2AWNA 1PZKD 2BB6A 2D5GA 3WOFA 3AMUA 2Z4IA 1FD6A 5TSSA 1JWAD 2WS3B 3Q8AA 5D14A 1CK1A 4AQ7A 3GTOB 1DCZA 2KUMA 1EY6A 2BS3B 3ZJTA 1MSHA 4HSPA 5I6YA 1L4DB 1E0ZA 5KGUA 4A55A 3X3NA 1PLFA 1TWAB 4WJWA 3U2SC 3P75A 5I2XA 3K57A 5F2DA 1VRAB 1EYAA 3PUXA 3OOCA 3J7AF 3D8GA 3FILA 4KGTA 4G7OC 4N6EB 4EVOA 2IT1A 4REZA 3P4SB 1JE4A 5BMGA 2X38A 1EY9A 1XCTL 1QE6A 3HZXA 2IGDA 4ARCA 1F77A 2Y5CA 3N52A 3NP8A 4FYDA 3I9V1 3NTKA 4KGRA 2K05A 5GXGB 4NMZA 3T4AC 3S2DB 1U4LA 2PQEA 4PMWA 5K5PA 2LUMA 1TWFB 2HUGA 1DXMA 2A6HD 1J7BA 2E2IB 1B2TA 2YYZA 3J7YW 5IGBA 5C0XG 5DM63 3M4OB 1AWDA 2MP1A 2N7JA 2JWUA 3A55A 4HMJA 3CHBD 2RA4A 2KAJA 1Y1WB 2NTSA 2AQ3B 1SAPA 1K53A 2A68D 1KRHA 4H2AA 3CQZB 5A2QL 2Z8LA 1AN8A 2ON8A 3SFEB 3OMGA 3SK5A 1MI0A 3IAYA 2EY1A 1B50A 1F2MA 5BYRA 2LFNA 1FNVA 1N5XA 1GAQB 1CI3M 5C4ZA 3ABVB 3HP3A 4V190 2ACZB 1TR5A 5HGTA 2B2TA 3B2FA 1LT5D 2IX0A 1UUPA 1XLOA 2YEPF 1ESFA 1U4PA 1IYVA 1SMYC 1ZEQX 4KKJA 4WURA 1SXTA 2WXLA 3ND8A 2K32A 1STNA 1PTOB 4H44C 4RFBA 4OZBA 3Q8BA 3A8IE 4XT1B 5A35A 5JAVA 1D4BA 3SR6A 5C4HA 2QMTA 3ITPA 1VMPA 2B2WA 1PRTF 3EVQA 5KRUA 3PO0A 3NK9A 1RKNA 3FC4A 1B9RA 5FKAC 3BDLA 1TS3A 3BG3A 2LS01 2K04A 1SJED 4FF4A 2WNMA 1JICA 2BT6A 3BS1A 1TU2B 1UWXA 5DM73 3URYA 2YU9B 1DOYA 4HCEA 3HVZA 2JE6I 4KV6A 3PUYA 4RKBA 1DZ1A 2M2LA 4DA2A 1M8AA 4CJ1B 4YTMB 4XTCS 3VR8B 2JA8B 1JC7A 1GUOA 3BDCA 3H6MA 1EWHA 2F0EA 2IX3A 1EY7A 3GB1A 1IL8A 2Q8RE 3MC0B 5J22A 3MWYW 3SHLA 3LB8C 3BVZA 1GHJA 2KEDA 1NI3A 5CMDA 1O80A 2Y3AA 1DOXA 4U68A 1CZPA 2Q8IB 2PW7A 5LHY1 3SK4A 5EJWA 4J6HA 1ESRA 5K36H 4A3FB 5LL6X 2EPBA 2XNAC 1EQTA 3IAS1 2ZT9C 4YSZB 2R61A 3MEHA 3RLFA 3JAME 5MPOA 3RFZB 2QEJC 4HTHA 5AUIA 1VDZA 5E3FA 5M5YB 1I50B 4R8IA 1Z7TA 1IHZA 4XT3B 3VR3A 1ET9A 2OF1A 4NDXA 3MJ5A 5JPNC 2A74C 1BUIC 5C0XJ 2INPE 3TZDA 1GHKA 4B0MA 4C1NI 1E2ZA 3RZOB 2NVXB 1ZYRC 2MGSA 4K6LA 2PLPA 1IYUA 1PFDA 1WCMB 1ILQA 5EPKA 5KYIA 3QB3A 4CJ2C 3LX0A 4MACA 2RQXA 1QOFA 2KACA 1WYGA 2N88A 3E0JA 2WU5B 1MD2D 2A6HC 4F87A 3LXFA 1VF5C 2J53A 1PGAA 5EQ0A 2DN8A 2JXTA 2WXRA 3K7AB 3P7JA 2A69C 2ENBA 5EGTA 3DWAA 3HVDA 5AUKA 3G6JB 5JVG3 1VDVA 3Q8FA 1SYDA 5C0XH 4B9WA 1YN3A 1JMLA 1KABA 3MXPA 3H94A 3P42A 1Y56A 1XO3A 4YTPB 1RHPA 3NSWA 2XSCA 2VB3X 5T1IA 3AE7B 2CW0C 1D1IA 1YNNC 4B9XA 3RUZA 3H0GB 1WTQA 1TWHB 3I57A 1I4QA 3X3MA 5I9OA 2K6AA 5M3MB 4ULLA 1R9TB 3C1EA 1XX8A 1BUVT 5JEAH 4XIGS 1SSNA 3SR1A 4XE0A 4C1NK 3HOYB 2BE5D 5BN3A 1OO9B 3VR5A 4ZKBB 1JALA 3AE8B 4UDUC 1S4ZA 3TUOA 1VLBA 5C5LA 5IGFA 3HOZB 1W6KA 2JA6B 2L83A 5DNFA 2MH7A 4QB4A 2OEDA 3TDQA 2DNCA 3FVQA 2PVGC 3D31A 2PCFB 4WORA 2B63B 1AP0A 1PRTD 1TZOA 4IFDI 5DAUA 2F0WA 3OIPA 5T1GA 1IGCA 2MPMA 3MFYA 3FMCA 1D5ZC 1UNSA 4TRDA 2GRIA 1Y8PB 3SEBA 2BB5A 1LTSD 3A56A 1SEBD 3PIO3 2ZXPA 2C5CA 3J81L 1LTRD 3I72A 1TKEA 4IUNA 1QOHA 4DF7A 3NWSA 2DY8A 2K9XA 1YN5A 5BN4A 4CBVA 1W6JA 2WXGA 2EVBA 1LTBD 4ODGA 1GUTA 4N59A 2O4XA 1EY8A 1HA5A 3AEGB 1X3QA 3V05A 2G9DA 3VRAB 4C7ZA 1FIQA 1Z47A 2E75C 2F4IA 1QLBB 4WAFA 1EY0A 1H9RA 2N0SB 5M5WB 3NZ3A 4IQZA 1SYCA 1F2RI 2WXPA 4NJCA 1GOZA 4CJ0B 1D5MC 3S9WA 1L0YB 2WLBA 5CBAE 5J1ZA 2HCIA 1S5CD 3MZ5A 3PUWA 4KHZA 1YN4A 5D7GA 1STGA 2Y0SB 4PMBA 1PGXA 2WXJA 1L5PA 1SBBB 2LKVA 3E9SA 2EZVA 2L32A 2B2YA 3S15B 2KVMA 2KN4A 2KECA 2RKSA 1MBYA 1VZ8A 1LTGD 1ENCA 4LAAA 3VR9B 2Q8TA 2F0LA 4RCNA 1PZJD 4O42A 1NEKB 2DY7A 2F0QA 2V4DA 1CQVA 4M1UB 4J1MA 3OSOA 3Q23A 4J3OD 1LABA 2K5DA 1SNCA 1NENB 2KWDA 3EA6A 2BCOA 1HA6A 1A3TA 1HUMA 3HRDD 2GA4B 1ACCA 3BVGA 1F2LA 2FINB 3R93A 3V3XA 3P1MA 3OPOA 3QIAA 3C2PA 3FPPA 5KNCA 2DWQA 3BZDB 5C44B 1XXGA 2K33A 2HDEA 1SYGA 5FLXE 2CJNA 2FJ2A 3J80E 1O7YA 4DK1A 1JWBD 3J9CA 5IGDA 4USAA 1Q8IA 2QKIC 3KWVA 2VZKD 1JOOA 3W3AA 2WDQB 3PIP3 2AUJD 1E2VA 3M7GA 4OO1I 3MVVA 1ZPSA 1X32A 3MXGA 1AFPA 1D6EC 1PTOF 2I38A 1JCKB 3Q0AA 4A3KB 2XRQD 3R2IA 3TBIB 5EE9A 4HROA 1IKMA 1RWSA 1AZPA 5EBDA 4P16A 4FXGC 1C4CA 2RSOA 2KDMA 3AB5A 2JZPA 4LTUA 4X3TA 1V43A 2R6GA 4IALA 1JORA 3G7LA 3W5VB 2LHEA 1SNQA 1G91A 5E4XA 3K58A 2PO4A 2K0PA 4ZUIA 1XTCD 2ZXOA 2IWHA 2B76B 3IKJA 5KYLA 4TMAB 3EROA 2XWBB 2NMQA 5IGEA 4X3UA 5CR3A 2HDLA 1SJHD 2QDBA 1IBXA 2GB1A 2EYJA 3P1HA 4EQOA 5FO7B 1YNJD 2G9HD 3Q24A 2D9UA 2FUG1 3TEXA 4A3BB 1C48A 2EE1A 2B2YC 3QG1A 1J7AA 1RTNA 2J42A 1E0BA 2BA1A 5K36G 4HR7B 3TEYA 2B2VC 4FXCA 4YXDB 3KK7A 4B0EA 3C3LA 4G7HC 5D65A 1KDBA 4C3JB 1K8MA 1SDFA 5EKIA 1PDQA 5BMIA 3AEDB 3SXHA 2W55A 2L12A 1BDOA 4DNRB 3OMCA 2V4IB 3F2UA 1BOSA 4KGSA 3Q6SA 1T3QA 4J8QA 4JWSC 1NCVA 1STBA 4MN3A 5C4JB 1F2ZA 2WQYB 1ZDVA 3ZJVA 4C3HG 1CZGA 1DYQA 5I4DA 3AEBB 1I3QB 5EKLA 3EUB2 3ZYYX 3ERQA 3MHBA 4RWSC 4OIKA 2Z1CA 1WTWA 2L0CA 2KCNA 1SE3A 1BNZA 3DHQA 4TQ1A 5G3LF 1SE2A 4PQXA 3SFDB 1B4OA 1EWCA 2EYFA 3TP8A 4ZAIA 2CHBD 2NTTA 1Q1EA 1C78A 4GDKB 2K5QA 2CQAA 5HI1A 3TP7A 4A3GB 3K6OA 1QOGA 2HDMA 5EE1A 1EU3A 2OT2A 1F2YA 2LFIA 4G7ZC 1XWEA 2NN6H 2JA7B 4X3SA 1HRJA 4L23A 2K22A 4A93B 2X6LA 4ZRQA 4RGOS 4US8A 5ELFA 2OEOA 4YT0B 2K01A 5G5GA 3MHZA 1BCPD 2N55A 4M8AA 5BMHA 3GTJB 5COYA 1ILPA 1FCCC 1DONA 4FO2A 1C8CA 4BBSB 1ENFA 5C3JB 4ZQ3A 3KBXA 2Y5PA 1BCPB 5JEAG 1T5XD 3RZDB 2LEKA 1JRPA 3P4QB 4KJOA 1UWMA 3NXWA 2F0DA 4ZYSA 3HRZC 1ZKOA 4M0WA 1KDCA 2BOSA 1SYFA 3O13A 4IUPA 1LT4D 1B3AA 2W3RA 3PUVA 4RF0A 1H9KA 1YQ3B 2J4XA 2XWJB 1H9JA 1M4VA 2ICIA 2EY2A 4NW2A 2WDVB 1LV9A 3HOXB 2K28A 3HKZB 1PFNA 1QOAA 1TT2A 3VYRA 5ELDA 1WTVA 1TIID 1PFBA 1WD0A 1EYCA 2QSDA 1SIJA 1ZXIA 5D3IB 4U673 2BW2A 2X6GA 1GUNA 1PYWD 2PZWA 2E2HB 2V3NA 4D2KA 1WXQA 1Q3LA 5JJZA 4GLSC 4ILWA 4BS9A 2F0KA 1EFID 1CFMA 1K50A 1IW7C 2WXFA 2F0OA 2A5HA 1TS5A 4KI0A 1K52A 3NVYA 3P4PB 2M56B 3MP9A 3IT4B 2LHDA 2W54A 3TEWA 4WWMA 1SSOA 1YNJC 4ZRPA 3K5NA 3L4PA 3NVVA 2KA7A 3RD4A 4JPSA 4I7ZC 5EPJA 1EY5A 4Z9CB 1I4XA 1FRDA 2RDGA 2RMMA 4DGZA 2AQ1B 3KWLA 2OXPA 3VYSA 1A2TA 1QJOA 4CQNA 4MT5A 2E74C 5FOBB 3ONAB 5LNK1 4KD4A 4C80A 3AEAB 3GP7A 2B39A 3R8BA 2WXNA 2H1EA 4RHSA 3SK8A 1RJTA 4RGMA 3V96A 3D4DA 1PFMA 3P20A 1JROA 1RF2D 2NUCA 3BYTB 2EJFC 4RGNA 3E6ZX 1FO4A 1NUCA 3VYTA 4HCSA 1EWYC 2KQ4X 2WB1B 2EOTA 2MJ3A 1F9RA 2BYTA 4XWTA 1K83B 5HG2A 1ZOYB 3IL8A 4KY7A 1G8ZD 3D4WA 1RDPD 4R3DA 4A90A 1ML0D 4C3IB 1CQFA 1NR2A 3R3OA 1LT3D 2F0IA 4DXGA 4UAIA 2VUMB 2FE8A 1SF0A 2F0JA 3E5SA 1XEEA 3AV8A 3OIQA 3QO2A 2KJXA 3DWQA 5JEAJ 4JBWA 4IFDG 1E6EB 3VQIA 4EGVA 4YWGG 2XN9C 1H9MA 1STEA 2L5TA 1DOLA 3U52E 2JP1A 3PO2B 1AW7A 1L6UA 2IGGA 2EYOA 5BN5A 3LWEA 4AS1A 1PDXA 3NRZA 1LTTD 3D6WA 2K7VA 2WXHA 2A68C 1OFFA 1BCPC 4Y7NB 1N61A 3DXJC 3ZGZA 2L1BA 1QF6A 1AZQA 2EKIA 4OL7A 4K5VA 4OZAA 5EE0A 4XYQA 4P2CB 1FXIA 3TMEA 2EYLA 1FFVA 2W3SA 1EOTA 1FEHA 1CM9A 1JB3A 3NE5B 3PZ7A 1PZID 3GTMB 3NTIA 4Q0FA 1PXUA 1RFKA 5IT9L 4DNTB 2H88B 2PIAA 3U4EG 4C3IG 1R4QB 2BS4B 4KMUC 3MTSA 1STHA 4FXKC 4HSVA 2PNRC 2R3ZA 1J8IA 2F0MA 4H13C 2ONQA 3H09A 4RNAA 1KDAA 3AB9A 2QIEB 2LMCB 1HPCA 4FNFA 4OZCA 2PW5A 3VR4A 4R8NA 1CA6A 1F9SA 4BA1I 1BR9A 1V1OA 3AE2B 4WQMA 5J39A 1STAA 1B44D 1BO0A 3VA5A 3I3CA 2WINB 4B08A 1PRTB 3TEZA 2L9HA 2K5WA 1DOKA 2KCCA 1RTOA 2D5DA 4A3DB 1TQOA 1FM0D 4K5XA 3U9OA 1TKYA 3VRBB 5T8IA 1WTXA 1VZ7A 3MXNA 1GXDC 3DWPA 4DK0A 4MH8A 1UAPA 1U4RA 2BA0A 2EYMA 4KX6B 4IUTA 3SVMA 4WRDA 1AEXA 3A8JE 4PNYA 1WVLA 5M9OA 1VMCA 5ELBA 2MJDA 4BA2I 4YTNB 4HMIA 3VA7A 3T56B 2OHFA 3NBHA 2KHSA 1V8QA 3HG9A 4XQNA 2SAKA 2LY7A 4KN7C 1ZDXA 4EE2A 1S5BD 1OXXK 4HKQA 3T53B 1HZ5A 3I8ZA 3NTHA 1ENAA 4LJZC 1DGJA 4JK1C 2JYOA 3BDOA 1LTAD 3D6CA 5IODA 2F0PA 3I4MB 4MIUA 2D2CC 4IUVA 2AUKA 1E9MA 2XIWA 4PMCA 2BBCA 2WXIA 5JVH3 4ZRZA 2ZXRA 2FFKB 3GV6A 2B2VA 4IFDJ 2EJGC 3GTPB 1OXVA 5E4WC 2M00A 2ZW1A 1QNUA 5CV5A 3M3YB 4DN4M 4FVMA 1PGBA 3GS2A 4JE3B 5FO8B 2IW3A 2FHTA 4XDXA 3NWTA 1F2RC 4DFAA 2NN6G 1WD1A 5EBCA 4O1NA 3HS0C 4TQUS 1Z6HA 3GTQB 3AE1B 4NZLB 3CU7A 3IT6B 2KOLA 2DLBA 3UI3A 3M7NA 1I6VC 2KQ3A 2HTME 1B9NA 2E76C 4A3JB 1QNKA 4A3MB 1HCZA 5IGCA 1EU4A 3GQBA 1V97A 3VR6A 3AECB 1ZXHA 4XQJA 2TSSA 1A2UA 1HXYD 4L63B 4PV1C 2A6ED 2F0TA 4IFDH 4XQQA 3WDNA 1TY2A 4I65A 1C76A 4GZYC 3E56A 3S1RB 2EYPA 4ID6A 2SOBA 4CKBA 2RPVA 2DYMA 5ELCA 2IL8A 2TMPA 3P4RB 1B1ZA 3QJYA 1GB1A 4NKLA 1DJRD 3HOVB 3MXUA 3K59A 1NAPA 1BBXC 2VZKB 3WCQA 1TYGB 1QWYA 2QILA 1N5WA 4HEA1 3CKIB 1O7ZA 4US9A 4N9TA 1Q10A 2C9OA 2WP8J 4ZLTF 5CBEE 2L11A 3DUZA 2WACA 5I2YA 1GPXA 4XDCA 1TJEA 2IGHA 2BE5C 1X3PA 3L7ZC 4RGTA 1NYRA 4LLGM 5C3EB 4NAMA 4JWUC 1XLNA 1SNDA 3S14B 5C3XA 3KLSX 5C2TB 1YQ4B 1SB3C 3ZQ4A 5H8YE 3ETRA 3BIID 1PMRA 4YSXB 3NQIA 4DU9A 3A7AB 3EFXD 1JWSD 1TS2A 3B9JA 1PRTC 2QCPX 4G4KA 1JW9D 4IDIA 1G6ZA 3FDTA 5E1FA 2R93B 4HKZE 3S1MB 3J81E 4ME5A 3Q69A 1Q12A 2XVSA 1ZE3D 1RODA 1MHHE 2WXMA 1E7PB 4BBRB 2E2DC 3TN2A 1KLGD 2CU3A 1JOKA 2PVOD 2AQ2B 3ZJUA 1JQ4A 1RM6C 1UEAB 1Y8OB 1VZ6A 4MM3B 3NPPA 2I2YA 2MJ8A 1C9FA 1YNTE 5KIXA 4S3SA 4GDLB 2V0GA 4QF4A 3S1QB 2MJEA 3S1NB 1FRRA 3C8YA 3VR2A 2A73B 1YJIA 4C56C 3FILB 3H3VC 4RH6A 1SYBA 4RA8A 4HRSA 5DEHA 2Z4HA 1EZ6A 5KEEA 3U7ZA 4FF2A 1G291 1XF5L 3GTKB 4FF3A 3T13A 4IUQA 2DNEA 2K1BA 1TKWB 3BWUD 4DAPA 1FGBD 3KUPA 1TKGA 3AEFB 4OO1H 3AE4B 4A3EB 2HQEA 3NQTA 1L0VB 4RKLA 2VNUD 1P7FA 1AYFA 2NVQB 2WIIB 3JAML 2ZW0A 4A9AA 1EIHA 2FMMA 2JSOA 1EZ8A 2JU6X 4WIPA 1QCBD 3NUCA 3PMFA 1R7SA 4AYBB 1XCQL 3NHHA 3W9CB 1ZYRD 4KK7A 4WH4A 5ISRA 1GB4A 2F03A 2WXOA 1CTMA 2WP9B 5FK9C 2R7ZB 3SE0A 4C3JG 2JYEA 2INNE 1C4PA 2AX5A 1O78A 3MAQA 3DWGC 2O5IC 3AM9A 3GD7A 3AH7A 1P7EA 1HQMC 1NVID 1YJJA 2BS2B 1V8CA 4FP5D 2NB0A 3OHXC 4ZKCB 1Y8NB 2A6EC 2EYHA 1VR9A 5I6WA 4K14A 4RAUC 1D5XC 2A69D 2GI9A 4RHRA 2DBYA 1KLUD 3HOUB 1A3VA 3N6RA 2K5PA 1GUSA 1A70A 4QUCA 4EQPA 1EM7A 2KEEA 3I91A 5D3DA 3K5LA 1RD9D 2CW0D 1HZ6A 5CV8A 1YNND 5JPMC 3I70A 4A3IB 3GTGB 2BTEA 2B2UC 5CV7A 3BK1A 4MHEA 1I6HB 4F7XA 2CJOA 4LMQD 2R92B 3AN1A 1PTOD 3NUHB 5BYSA 2WV6D 3GTLB 1F0ZA 1HTLD 4NP5A 4F8MA 4P6VF 2WU2B 2RDHA 5HURA 1LLRD 2F3WA 1BXTA 2FMCA 3KLSA 2QF7A 2L52A 2H4OA 4K2LA 3BVMA 2JSVX 1IKLA 3GV3A 2L1AA 2JEBI 2F0GA 2EY5A 3N9YC 1OQQA 4KJNA 3L9AX 3TP6A 2PKOA 2SNMA <