4O1NA

Crystal structure of staphylococcal superantigen-like protein saouhsc_00383
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
SESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Superantigen-like protein
publication title Crystal structure of Staphylococcal superantigen-like protein SAOUHSC_00383
rcsb
source organism Staphylococcus aureus
total genus 52
structure length 189
sequence length 189
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4o1nA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4o1nA01
2XRSD 1LLRD 1SE4A 1TS5A 2WV6D 1PYWD 3URYA 4C56C 5D3IB 1EFID 1LTAD 1JCKB 2ICIA 3SEBA 1I4PA 1CHPD 4ZYSA 1LTBD 1AN8A 1EU4A 1XXGA 1PTOD 1CK1A 3V05A 1RF2D 1SBBB 1SXTA 3EA6A 1FD7D 1S5FD 1TY2A 4RHSA 2SEBD 2IPKD 1PZID 1BCPF 2TSSA 1XTCD 2XRQD 1S5DD 1S5CD 1UUPA 1PRTF 3TSSA 1LTTD 1BCPC 1BXTA 1V1OA 5TSSA 3BYYB 1LT3D 5I4DA 3DWQA 1STEA 1JWSD 3OWEB 1TS4A 1JR0D 1FNUA 4RFBA 1EU3A 5ELFA 4L63B 2AQ1B 1L0YB 4O1NA 1BCPB 1LTGD 1S5BD 1YN5A 1KLGD 3DWAA 1V1PB 1YN4A 3R8BA 2IJ0A 5FK9C 4DXFA 1PTOH 2QEJC 1D5MC 1HTLD 1I4GA 1I4HA 2RDGA 1V1PA 1ENFA 2AQ2B 1B44D 3KLSX 1D5XC 1PTOF 1ESFA 1L0XB 2NTTA 3CHBD 1T5XD 4RGMA 4RH6A 1I4QA 3MFGA 3GP7A 1ET6A 4DXGA 1PRTC 1LTSD 1YN3A 1I4XA 1B1ZA 3DWPA 4BWGB 3BVMA 1D6EC 1HA5A 2QILA 1M4VA 2AQ3B 1S5ED 3EFXD 5FKAC 1SJED 2G9HD 1SEBD 1G8ZD 1DYQA 1RDPD 1KTKA 1ET9A 3BVGA 4RCOA 1PRTB 2O2LD 3BVZA 1LTRD 1JQYD 3R2TA 1UNSA 1SE3A 1JWMD 2RDHA 4L6TB 4Z9CB 5ELDA 1DJRD 1LO5D 4K6LA 3BYTB 1CQVA 1I4RA 1SE2A 1D5ZC 1PTOC 1RCVD 4RGOS 1EEID 1QILA 1GOZA 1MD2D 3BZDB 1F77A 2XNAC 4TSSA 1LT6D 1BCPD 4RGTA 1KLUD 5D3DA 1PRTD 1TY0A 4RGNA 4OHJA 5ELEA 2NTSA 1AW7A 1HQRD 1RD9D 1LT5D 1FNVA 1HXYD 5ELCA 1PTOB 2Z8LA 1LT4D 2J4XA 1LTID 2R61A 5ELBA 3O13A 2CHBD 2XN9C 3MC0B 1PZJD 4RHRA 3W2DA 1EWCA 1PZKD 3R2IA 4UDUC 1EEFD 1CHQD 1FGBD 1SJHD 1JWUD 1FNWA 1TS3A 1TS2A 4NZLB 1CT1D
chains in the Genus database with same CATH superfamily
2RPQA 4GKJL 2MH7A 1PXUA 1JB3A 1SYDA 3RT3B 3NBHB 3OOCA 2WXOA 5E4WC 2LMCB 3WCQA 1AN8A 3WAOA 3TL5A 5BMHA 2BOSA 2F0GA 1XXGA 3S2HH 1V8QA 2PCFB 3ETRA 5EE1A 1VQAA 4NAWA 2CKHB 1JJCB 4O2DA 4IUVA 4V0BA 3AMZA 1GJXA 3HOUB 1F2RC 4LJPB 4EVOA 2F4VL 1WOCA 1EWHA 1W2BA 1TT2A 3ZGZA 2JA7B 1B8AA 4CHKA 4KHVA 4JYAQ 3L08A 2ENBA 4QUCA 1V1OA 4C3IH 4US9A 3DEPA 1Y69U 1Q1EA 3A8IE 3M7GA 2O2VA 4MH0E 4YWGG 2UXCL 2JWZA 5C3WA 3QOJA 3WIMA 2A6HD 5JPMC 2B63H 1R4NB 5D6JB 1FNUA 4HCSA 5H92C 3PO2G 2F0LA 1KM7A 3BJUA 3HIZA 5FO8B 1X3FA 2QGQA 1KC8C 5EAYA 1H9SB 1BCPB 1MHWC 1V9PA 2Z1CA 4EQNA 4POFA 3K8AA 2JQOA 3DWAA 2BVCA 2V4LA 3N30A 4KZ0A 2IJ0A 5K36H 3SR6A 4NP5A 1QOHA 4DUZQ 1QOGA 1X1MA 1V1PA 1J8IA 2V3NA 2ZVNA 2GN5A 2NPTB 3PIO3 2K28A 4EZJA 2EE1A 2Y0SG 5BMIA 1R4PB 1WTVA 4W9JA 1D4BA 4M8NA 4JI2Q 1ENCA 1KLVA 2UU7A 1B7YB 2Q8TA 4OWXB 1VQPA 3AEAB 3DWPA 4HVBA 1DOKA 1N32L 4N8FA 1VQ7A 1QZHA 2EJFC 3BVMA 2DGYA 4QB4A 1JW9D 3BZKA 3P7JA 4MM3B 4YTNB 1SROA 4DNRB 4KI0A 3HG9A 2O4XA 4A4IA 2PKOA 4GIVA 2WB1B 2ZZPB 1JQ4A 1WRDB 2WAQE 4DHZB 2KENA 2A6ED 3UE0A 3KLWA 2J53A 4DAYA 4Q2JA 4C7ZA 2KFJA 3PS6A 1IBMQ 1L4ZB 3EFCA 2A19A 5DNFA 5LMUQ 2DENB 4XX5A 4DV0Q 1JWMD 4X3KA 1N5WA 2AWTA 1DJRD 1G51A 2EXDA 5G55A 3BYTB 4IOCA 2VZKD 2NBVB 2A4ZA 1IYVA 1BO0A 4A3EH 2MSED 4TKNA 3PO0A 3APDA 2NUCA 2BF8B 4R1JA 2KX3A 2GBNA 5GROA 1TTNA 3J9CA 3CQZB 1K53A 3M3JA 4AYBG 4BY1H 3RZDB 1DGSA 1PH1A 1VQ8A 4DV2L 5ELEA 2KYWA 4IDIA 3BDCA 4JI8L 1K50A 1PTOB 1M94A 1J5EL 1TWHB 3J81j 4ICUA 2IO2B 4HLEA 2FCQA 4A3MB 3K59A 2ATWA 3AE4B 2D0PA 4W9FA 1P7FA 3DUZA 1Y8NB 1KD1C 1F2RI 1S4ZA 3E5SA 2D07B 2Z0EB 3K7AB 1FR3A 1TS2A 4HEA1 4AOFA 3ZW3A 5J1ZA 1TQOA 1PH7A 3GTMH 3LGJA 1LLRD 1IGDA 3VHTC 3S16H 3TN2A 3PLUA 4H13C 3KF8A 3BU2A 2L76A 2F0NA 1ASZA 1W6JA 4XE0A 5DCNA 3KBGA 1EU4A 3NTIA 4QJFA 2RQXA 1H8CA 4A3JH 4L1BA 5KNDA 3MP9A 3L16A 5I9OA 3PTFC 4NPNA 1S5FD 4MSMB 2GMIC 1UE5A 4A3CH 3NZUA 3A4RA 1BOSA 5G5HA 3MEHA 3I91A 2MHVA 1YHAA 2BS2B 3A0JA 3D6CA 2XWBB 2NVYH 2FAZA 4LFAQ 1KDBA 3BYYB 3VUYA 5EE9A 5A35A 1GUOA 2ZTDA 3SU8X 3NZSA 3PSIA 5C4XB 1ISNA 1WY8A 3T1HQ 2Y0SE 3RNAC 1JJ2A 4HSVA 2MBBB 5IWAL 1QT9A 2KKCA 1QNUA 2D5DA 1EQQA 3Q3FA 1I50B 5CC4A 2N9LA 1WXSA 4CKBA 3CP0A 2VQFQ 4WAAA 1E1TA 2B29A 3Q8AA 2L1BA 1SDFA 3I63C 2KMMA 4FDBA 1JE5A 1WCMG 2H89B 2ES2A 4YY3Q 4G0NB 1XPUA 2JU6X 4BBSG 5CV7A 4DR6L 1D5XC 1PTOF 2A69C 4KLKA 4HJ5A 1XMOL 4G7OC 3VQIA 1GB4A 2M0AA 1WMHB 1X65A 2WS3B 1E7VA 3BZCA 4GLAC 2RHQB 3DEOA 4ABNA 1OQQA 3QC8B 2MQHA 5BYSA 5HI1A 4ARIA 5KHQA 4A93B 1WGGA 3JC66 3BS1A 2WXJA 3SK5A 4A55A 1VQIA 3ZUNA 4EE2A 3QG1A 4ZRPA 3J81i 1EIGA 1NMGA 2KLCA 1GUNA 1FXAA 1E7UA 2L83A 3Q8FA 4IN3A 3HS0C 2LGSA 3AB5A 5D7GA 1F2MA 1RKNA 4K14A 5EQ0A 2L11A 4N9TA 4UP7A 4F88A 1EO6A 1YOVB 3W5VB 4RMAA 3CSFA 2QC8A 5M3FB 3IFDA 4AYBE 4KSKC 2PO4A 1VCIA 4LF6L 1SE3A 3DOWA 2NYZD 1RYJA 2F03A 1XQQA 5ELDA 3NQTA 2BH2A 2EVBA 1STHA 3TZDA 3S1NB 3VTVA 1M8AA 3RNCC 1IP9A 4XYOA 1WR1A 3H0GG 4QGUA 1IL8A 2UWQA 5HGQA 3APFA 1UWVA 3TMPB 3IVFA 4C1NK 4JI5L 2XNAC 3AU7A 2WP8J 4A3DG 4MJSA 3GQBA 4C3HB 1BUIC 2YEPF 4BBRB 4GKKQ 2V9HA 2N55A 2WNMA 2PMZB 5IN7A 2Z6KA 2OQKA 3M4OB 1V1QA 3KYDD 1Q1OA 4P75A 2G45B 2HE7A 3L7ZC 1KRHA 4HWIB 3G6EA 1YJNA 4HIOA 1XWEA 4NNJB 3PCOB 2IWHA 2C5CA 1NNXA 3DVNV 4ZRQA 2YU9B 1FGBD 2HCCA 1TWGB 1N34L 1GO3E 4WJOA 4RAUC 5CMDA 1EUJA 4TQUS 5IGBA 4YT0B 2J7ZA 2IX1A 1UBIA 4A9AA 2R7ZB 4R8NA 4F8MA 3SDZA 1V6EA 2NBUA 2I5LX 2K1BA 3TEWA 3A7AB 1C9FA 3E3XA 4OONA 1S3OA 1YJ9A 1Q82C 2PVOD 4YHHQ 4R4IA 1WVLA 1PGAA 3AU4A 3UINB 2WXRA 1VQOA 3J7ZC 1F52A 4DKAC 1X55A 1NJIC 5C3XA 4CKCA 3K9OB 1CKNB 3MTSA 3RLFA 1HZ6A 1L7YA 2I2YA 4PG3A 2L00B 4PYZA 3VUXA 1TU2B 3D4DA 4HJ8A 2NN6G 1F9JA 4DK3C 1MSHA 3O65B 2D3GA 3CCJA 3ULLA 1T3QA 1B9NA 4C4VB 2I5HA 3RMHA 4W9EA 2Q5WD 3JAMi 3AE9B 2RSOA 1MJDA 3U50C 3L9AX 5JJZA 2INNE 2HDLA 4MACA 4OW0A 3OW7A 1EY0A 3TEHB 1YITA 5FR3A 1YN4A 2GBRA 2LRWA 4H44C 4YSYB 1HZAA 5CHFA 2K32A 2EY6A 2F0UA 3V6EB 1Z7TA 2IW3A 2XVSA 4HK2A 2JQRB 3AEBB 3V2TA 2NVYB 3HOVH 3F2DA 4S3SA 4WQOB 3MZ5A 2UXBQ 2K22A 3DBHI 3OJ4B 3MFGA 2BQQA 2MNAA 1PRTC 1J7CA 4A90A 2QA4A 2D9UA 3QIAA 3QJZA 2MP2B 1KDCA 3U8ZA 2KJXA 4K0KQ 4P71A 5C4JH 2DYBA 1I94L 1PDXA 3AM9A 2QILA 4DDID 3WDNA 2LVQA 2Z0SA 1R9TH 2KN5A 1AYFA 4LF7Q 4B95A 3P63A 1A5RA 3BVGA 4Y7NB 2FUG1 2LXAA 2PQAB 2A6HC 3Q69A 3SGIA 2UU9Q 3Q14C 3S2DB 3RMKC 5AFWA 1WTHA 4MSQB 2LGXA 2MLBA 3CCSA 1XNRQ 5IKCM 2BBCA 4A3BG 4GOCA 1PV4A 2XWJB 1WWTA 3I4MB 4WORA 4HJAA 4EGVA 4F1SA 3SFEB 3L17A 1TWFH 4K1RB 4XQQA 4WJWA 4PS8A 3CCQA 2DAJA 5C44G 4DN4M 1K52A 4TSSA 1Q90A 3SHLA 4DAVA 3H3VH 3VRAB 4BBNF 2F1MA 4GSWA 1SR3A 2KD0A 4BA1I 1D7QA 1X56A 3LYYA 3CF5A 1V80A 2DJGC 3MEFA 3IBEA 3HOYG 1E7PB 3K5LA 4HROA 1RRBA 1EFWA 4CJ0B 2PYKA 2FXQA 4PYUA 2WQYB 2XN9C 2L0CA 3DDCB 4GNXB 1ROEA 3BINA 1U4AA 2UUAQ 4M8MA 1K0SA 2DZJA 1L2FA 3H91A 3MC8A 3GTLH 2NVTH 3PQIA 3A8JE 1FYCA 5IOIA 2KQSA 4KKJA 2Q2TA 2XSCA 4LF5L 4XC2A 3QHTA 4HKZE 3Q8EA 1JOQA 3FKIG 5D3IB 1XLQA 4A6QA 1P8LA 4RMFA 1E5WA 3I73A 1ZYRD 1BKBA 5D94A 3AE8B 4P72A 4UP8A 3RNGC 1PTOD 2FUHB 4HMIA 3NZ3A 1R4QB 1FM0D 3PGEA 1EF1A 3N1YC 3PUYA 2QDFA 1Z47A 1TZOA 1XO3A 3OLMD 5IO9A 2V3PA 3VUWA 4FVMA 3JYUA 2MJ3A 4BY7B 4NB3A 3PUZA 3H3VC 2PJHA 2V4IB 1NR4A 3I3CA 1S5CD 3B1LX 1CJEA 3C1EA 3UI2A 5T1GA 2E2JB 5BR8L 1AZPA 1K8OA 1TWCH 2BYEA 3PO2H 3EFUA 1XD3B 4M0WB 1NVID 5LNK1 1NCVA 3K80C 3N1ZC 4X3SA 5ISRA 1KABA 3TEZA 1FJGQ 1SE8A 2R7FA 1A8VA 4P2CB 3MHZA 5C0XG 4A20A 2LGIA 1ZDXA 4G11A 1BT0A 4DV4L 2KJRA 1FCLA 2KMCA 1Y1VG 3KYCD 2PTLA 4WWNA 4DV7L 1PH6A 3NENA 4QUFA 4F7ZA 5CX3A 1I42A 4ZQ3A 3AE7B 5HURA 2YYZA 3IT6B 3DBLI 3CCRA 2JA8G 1EY4A 1STYA 1JORA 1N5XA 1UF0A 2O6VB 1VQBA 2MP1A 2FINB 2OTJA 1QVGA 2L0FA 5GAEC 1TXYA 3M85A 3G4SA 4HPPA 1M90C 3Q8CA 3CC2A 3GTPH 2E6XA 1NE3A 2ZXRA 5HGTA 4YWLA 3D4WA 3DMUA 3RZWC 4L5QA 4LDTB 2PEAA 2EXZA 4HCEA 3T1YL 4LTUA 2WXKA 1B9RA 1KRTA 1S5ED 1ZUD2 4ZCKA 1G8ZD 1VQFA 5M9OA 2BDNA 2QCZA 2IO1B 4GN3B 2WXHA 2EY1A 2IL8A 4C2MH 2FCSA 2XK5B 3M62B 1WX7A 3A9KB 4N8X1 3HOVB 1WXQA 2WXGA 1N9WA 3U9OA 4Z9CB 2PPHA 3IT4B 5CR3A 4JK1C 2ZPNA 5JHBA 2IT1A 3T13A 3KLRA 4BKTA 1I4RA 4WFN3 3GB1A 4XGAB 2A68D 3AFPA 3MXNB 3OMCA 4KGSA 3AB9A 5DLQE 1EY7A 2KHIA 5M5WB 1MG8A 5JH5C 3A5UA 1QG7A 2N1VA 2QCPX 1IBKL 1F9PA 1WI5A 2BE5C 4X65Q 1T0QC 4YTPB 1SNPA 3TBLD 5LXIB 3TRZA 2GBMA 3E56A 1HXYD 4AS1A 1LTLA 1CSQA 3NUHB 4HCNB 1P98A 1Q8KA 3D8GA 2OQ0A 3PZ7A 1X3QA 2F0DA 4GOPA 2B2TA 2WXFA 1VQGA 3ICEA 2ZTEA 3VRBB 4LWCA 1SIFA 3ZNZB 4ANUA 1LFDA 1QNKA 1FD6A 5HG2A 3A8KE 2B76B 5H1SE 4GZYC 3DM3A 5DM73 3H3VI 1C4AA 4WWMA 1CA6A 2KJHB 2UUCL 3X3NA 5J18A 5C3EG 4ZUIA 1KIXA 1W6KA 4DK1A 4KY6A 1GD7A 1PH8A 4EEWA 4H0LC 1LTBD 4B9WA 3R7RA 2K6DB 3DVGX 3QWZB 2QHOA 4KDLB 1GJZA 1Q3LA 1SNCA 3KW5B 3T3NA 1XT9B 5AUKA 1SMYD 1P0RA 1U9RA 1VQ9A 4J3OD 2FCMA 4H02A 3H8HA 3S15B 1KQSA 4L2YA 3U4ZA 2K39A 1WE6A 2NVTB 2N9PC 1F0ZA 4IWPA 1EQTA 2MUYA 3GV3A 1JMLA 2KQ7A 1HZ9A 4G4KA 3H15A 4DR5L 5JVH3 1SMXA 1OEYJ 3AEGB 2Q2HA 4RFBA 3NS1A 1N33L 4RF1A 1VJKA 3MJ5A 4A3IG 2C5LC 1VZ8A 2JA6G 1WCMH 3GTGH 4XWTA 3CMEA 1OTRB 3L13A 4REZA 4IOAA 4EOYA 4AWJA 4BBSH 3R8BA 4FF3A 4TKOB 4DXFA 1RAXA 3RLOA 1YNJD 1ENAA 4X62Q 1VRAB 2IY0B 4DHJB 4GDKA 4XDDA 2RDGA 2BWES 4MHEA 1ZP0B 5KHOA 2E2HH 2AQ2B 2HJ1A 1HNWQ 2RHSB 3K5MA 3PF4A 2E2IB 1SIJA 4KZCA 3V6CB 2HTHA 3ZTDA 1GG3A 1A3UA 4P16A 4IURA 4DXGA 3S17H 2DWQA 1UD7A 1HR0Q 3S2AA 3WA0A 2EYOA 2JN4A 4FNFA 4Q0FA 5FLXE 5J39A 5JJIA 1D6EC 3FILB 3L54A 2HIXA 4I7ZC 4JI3Q 1JICA 3RYTA 1HPCA 1JE4A 2KT7A 3ML8A 3PT2B 5FKAC 2CR5A 4G57A 4CKEA 2HD5B 2WX1A 1IBLQ 2Y0SB 4DV5L 3Q8DA 3PO3G 3GTQH 2AYOB 1CI3M 5KYLA 3AI5A 3AULA 4W9HA 1S1QB 2KWDA 5DM63 4KD4A 4DA2A 2X6LA 3ZQ4A 1TJEA 4HIKA 4LFCQ 1Y1WB 3H0GH 1WXAA 2IGGA 4A3GG 1SAPA 2RSNA 4JGHB 2A73B 4PV1C 3GTPB 4A3DH 1WR6E 1CA5A 1SNQA 3M3YH 3TS0A 4AQYL 4HIMA 2D3BA 3AEDB 4PK1A 2UYZB 2VH2A 3NRZA 3MHSD 3DVNU 2JF5A 4DR7L 3W1BA 4W9GA 4WH4A 5FLXL 1ZXHA 2JZZA 4M01A 4CO7A 1VQEA 2PI2A 2PIAA 2ZM6Q 2Z4IA 4DR3L 2QDLA 3TMEA 1XNQQ 4C2MB 2Z4HA 3QARA 2GA4B 4A3KG 4UHVA 4E74A 3S1RH 2JXXA 5IGCA 2K5DA 3MJWA 2F0IA 2LI5A 2RCNA 1ZGUB 2INPE 3ULJA 4OELB 4DR2Q 1GUSA 3I90A 2M00A 5IT9E 1SJHD 4AYBB 1FNWA 4LF8L 3GTOH 5KNBA 4NZLB 5F2DA 1E10A 3PUXA 2OHFA 3IXSA 5IYCH 4G50A 2WV6D 1FFUA 3HOWB 2LWPA 1B50A 3M9BA 3CC4A 3C3LA 3QAQA 4L23A 4M00A 1EFID 1I3QH 4IUMB 3CSTA 2H1EA 2FFKB 5AJ3L 2A5UA 1GKHA 3NUCA 1V97A 2VXWA 1QLBB 1Q0WB 3FEWX 1N6ZA 2QSDA 4ZKBB 1I6HH 2NN6H 3RN2A 1VQJA 3RZOH 1WYWB 3PHXB 3CCLA 3ENEA 1A62A 4WJ4A 1O7LA 2B2VA 3FDTA 2CW0D 2KTRA 4X57B 3SD5A 5DAUA 2KNBA 2BKFA 1WD1A 2G4SA 4IQZA 4XWWA 2F0OA 2LS01 1PYBA 1NUCA 4CDCC 4MGIE 2FNJB 1JWSD 5C4HA 1WTOA 2BTEA 3KYHC 4LLGM 1N32Q 2O5IC 4NJ6A 2LSSA 2CJOA 4NAMA 5E4XA 1PGXA 2WXIA 2EJGC 1QZEA 3KK7A 2K8HA 1ACCA 4NQKE 4DR4L 1WFYA 3I55A 5IA7A 1NBWA 2XEWA 1YN5A 3BIID 3PIPA 1G2SA 1U4PA 5FR6A 4JI1Q 3V3XA 4OVVA 3SK6A 4XXEA 5FJ8G 1I4GA 3KF6A 2J0MA 2OEDA 1DOMA 2JZ3B 2N0SB 1VDZA 3JVZX 1ENFA 3Q3MC 5G5GA 1SYBA 3NP8A 3NY5A 3NE5B 1OGWA 4CYEA 4URKA 1ZYRC 3M4PA 3F2CA 2WX0A 5M3MG 5JHAA 4BKSD 3PGZA 2B3AA 1J7BA 3P75A 3HZXA 1XPRA 1Z6HA 2GOWA 4JCVE 4JI4L 4KJNA 5JVG3 3GO5A 5LHY1 1H9RA 3D6WA 1HUNA 3GTGB 1SNMA 1WCMB 5G3LF 1E6EB 1WXVA 5I6WA 1WXMA 4KK7A 2EKIA 4DUYL 2KAJA 4X64Q 3QCAA 3P4RB 1PA6A 2DNCA 4DV2Q 4R8IA 3M95A 1GM5A 5JPNC 2V1YA 3VAWA 5EE3A 2CWPA 1WD0A 2JRIB 3ZNGC 3TJPA 3VR8B 1B9MA 3R3OA 3BK2A 4AIMA 4FXCA 3AFQA 2E2HB 2L55A 4A3BH 4BVUC 2JYEA 4C80A 2QJLA 1B3AA 1A3TA 3KFUA 1V43A 1LQBA 3J80E 5NUCA 2HIVA 1K8MA 5CTRC 3NWTA 5C44H 1V9JA 2NVXB 1RCVD 1OO9B 2V1CC 2X69A 3CPFA 2L0TA 4LDTD 1E2VA 1GOZA 4LUOA 1G2TA 2KXJA 2IHEA 3HVZA 1MD2D 3ONSA 2K04A 3HOYH 5D2MB 4HJKA 3PUVA 2QKIC 1KFYB 2HUGA 2F4IA 5D3DA 4ZRKA 2NTSA 5ELCA 1GC7A 2K5NA 1C79A 4ME5A 1YNND 3QO2A 2R61A 2L52A 2IBIB 3NOBA 1UWXA 3NVZA 4IFDG 2IYDB 4US8A 3ER0A 3Q3JA 1DOXA 2WXQA 3N9YC 2DUDA 4C3JB 1IXRA 3VR3A 3H7PA 4C7YA 4UDUC 1EOTA 1TWAB 3FKIH 1CHQD 3V60A 3GTJH 1TS3A 1C9OA 4LK1C 3VYUA 3J80L 1G6ZA 3KUCB 4H2AA 2J0KA 2PQEA 2WKDA 3VA5A 5IWAQ 2HDEA 1FO4A 3IG3A 1ONLA 1YEZA 4IWOA 2OEOA 2FIDA 3FPPA 4CHTB 3DHGC 1YIWA 3JSVA 3MFYA 1A3VA 4RNAA 1RF2D 2M19A 4B6WA 2KWUB 3Q6BA 3CCMA 1VR9A 1C1YB 1K83H 2RR9A 4K3CA 1PVOA 1TKYA 2N7EA 2NBWB 1BCPF 2O2VB 4OIKA 4KV2A 2I1JA 2PLPA 4JYAL 4IOIE 3MXUA 3D31A 2OOBB 5TSSA 4LF4Q 2FCNA 2RVLA 5C0XH 2IO0B 2KFKA 1Y8OB 1STEA 3NXWA 4BXXG 3S14B 2VUMB 2F0SA 2LKVA 2Y5PA 1VQ6A 1Y1VH 5T1IA 1V2YA 3AEEB 2V0GA 1WMHA 4UY8C 1DOYA 1JR0D 5EPJA 1A63A 2JA5G 5DPSA 2E76C 3HOZG 4JC0A 2JA8H 2NN6I 2NZ1D 1SFOB 1PFSA 2DYMA 4AQ7A 1V1PB 4MTNA 1C4CA 3GE3C 1EM7A 1HTPA 2R6GA 1UE6A 4DUZL 1HTLD 2BA1A 2G3QB 3KWLA 1Y8PB 2BB5A 3QQ8B 4ODGA 3HFZB 2BW2A 3ITPA 3MXGA 3Q2AC 3TZUA 2K14A 4TUUA 4K7UA 1L0XB 1T5XD 4JI2L 2B2UC 4WJNA 5IP4D 4R4OA 4GXBA 3U2SC 4QAYA 3C46A 1SMYC 4ANVA 5A2QE 2YLMA 4FHJA 1MJCA 3J7AV 2ASBA 4P74A 1KF6B 3K9PB 1PH9A 4DAYB 1HEZE 3VVWB 3KH0A 3F1ZA 3UDIA 3S2HB 3E9SA 4IUQA 2WDTB 3HK0A 2JE6I 4DNTB 1XJVA 1CSPA 4FF4A 4DHJD 4ZDVA 3RR5A 2O2LD 1BBXC 2KCMA 5LL6X 1WF9A 5CV8A 4DXAB 4B9XA 1WTRA 3K81C 2EELA 1IBML 2B2UA 2DYOA 1EY9A 3E9IA 1E90A 3AE3B 4JI6Q 4DV0L 1C4QA 2GRIA 4L6TB 4OGQC 3WOFA 4C3IB 2KOLA 2GI9A 4UAIA 3RN5A 4K6LA 2CH4W 3GTKH 4K5VA 4KY5A 3BDLA 4FYDA 2DZKA 3RZFA 3QOLA 4RCNA 4RGOS 1YD8U 2JA7G 2E74C 2E5LL 2WU5B 3SR1A 5IYBG 2B63B 2MQJA 3CC7A 3D4RA 3DHQA 1WX8A 3DHIC 4KSLC 4WJPA 4A3PA 5GXGB 5M5YH 1VZ6A 3VH3B 4E3CA 2MWSB 2VRRB 3W5UB 4DR1Q 5CGKA 1MI0A 3ULPA 5A2QL 3N1XC 4QIWB 3NS8A 3RFZB 5I9PA 1OFFA 3QK0A 4RG1A 2RGFA 1RD9D 1BBWA 3WAPA 4JOIA 1N36Q 2KDFB 1LT4D 2DAFA 1SGHA 3TS2A 3HOXG 4TQ0A 3NEMA 1E2ZA 4RHRA 1EYGA 3P1MA 5C1ZA 2Z6KC 3ERQA 4IWQA 1T0RC 2HQLA 4YL8A 1PZKD 1UZXB 3PZDA 4EQPA 5C3EH 3DBRB 4POGA 4P1BC 3C19A 3KF8B 1SNOA 2LXCA 2NBFA 4DQOC 1JRPA 1IKLA 4JVZA 2C7MB 2EKEC 1N60A 1E22A 4KJOA 3MWYW 3ZXVA 2DLBA 2ICIA 3I72A 2UXDL 1B3QA 4EUTA 1E7ZA 4LUVA 1IW7C 1WTQA 3NELA 3OIQA 1L1OA 4OVZA 3CRLC 2MFIA 3CW2C 3SHQA 1SXTA 3RD4A 2VL6A 3F2UA 2ZT9C 3CRKC 1UE1A 4K8IA 4LUZA 3CCUA 2H88B 1HUMA 1MHHE 3OTOQ 2WB1G 1ZOYB 1XTCD 1XMQQ 2XRQD 3UE1A 4ZRJA 3AMUA 4KIKA 1LTTD 4LFAL 1CKOA 5G3LD 2CQOA 3ZVVA 4XYQA 3GTJB 1PGBA 3U9SA 3HUIA 4A3IH 3ZJTA 2K0PA 2KVMA 4A3EB 4B3SQ 2JA6H 4LNIA 3F2BA 3W9CB 1L6VA 3T1HL 2YTVA 2P5ZX 1JB7A 3IAS1 1K8GA 2WGSA 4U673 2PE6B 4ZLTF 2KEEA 1XPOA 4N9PA 1EF5A 1TKGA 2LUEA 2MJDA 3GOEA 4BY1B 2AQ1B 2OTLA 2RA4A 1VLBA 1HFGA 2VQFL 1P16A 2BCOA 3DWMA 2WINB 3STBD 5J22A 4QY7A 1SE9A 5AZFA 2D62A 3LX0A 5JJLA 2D11A 3QIJA 2KZRA 1ILQA 5C0XI 2E3TA 2BS3B 4JG2A 2F0JA 4CDDC 1O78A 2PQAA 4DGZA 1A0IA 3CPWA 3J7AF 1GHKA 4C00A 3CHBD 4YWKA 4NAWB 2PI2E 3NTHA 2B2WA 4KN7C 1KAWA 1UBQA 1NSNS 2DNEA 4A3MG 4JBKA 4ITKA 3GTMB 4NJCA 2MPMA 2A1AA 1Q7YC 3S16B 4DNIA 3PO3H 2GVAA 3SXHA 2PNHA 3KJOA 3U30A 2MGSA 1PFBA 2PZTA 1M4VA 3DQVA 4KKUA 4X6AH 4FULA 1P1AA 4A3JB 2LEKA 3UDFA 2LRUA 4OXPA 1ET9A 4A3GH 2GBJA 1V49A 3KUPA 2LVPA 2M17A 4IUTA 5FLXc 1LTRD 1PDQA 4XT1B 2BPSA 4JV5Q 1B70B 2KCCA 3X23A 4DV3Q 1SN8A 1E2WA 3MC9A 3CD6A 4XDCA 2L8JA 1D5ZC 4JQWC 1QQRA 3P2BA 2Z9HA 3DBHB 2AUJD 4IJHA 2F3IA 2K5QA 2I0QA 2ZCBA 4A3KH 3K57A 4GKKL 1BCPD 2LJ5A 3RNFC 1HNZQ 1CZPA 3U52E 5C4XG 3NPPA 4I6NB 5E6JA 4OHJA 4KMUC 4HR7B 1JMCA 2ON8A 4J15A 1EZ8A 1AARA 4IC7B 5GMVA 4J1MA 1OTCA 1CQFA 1WM2A 4FJZA 2IX3A 3A9JA 1GHJA 1VQ5A 3T4AC 1VCBA 2W82A 4E71A 1U4LA 5BR8Q 1Y56A 4BOZB 1NENB 2BYVE 3PIP3 2XBBC 2WIIB 4O42A 3PPAA 1CT1D 2WB1E 2PPBC 1V5OA 4M0WA 3RD2A 1SE4A 1SRUA 5C4ZA 4DHZE 1A70A 3URYA 3CF6E 3OPOA 2L1AA 4X66Q 2OJRA 3N3KB 2KN4A 4BKSA 3E9HA 4DBGA 3AU5A 2JX5A 2WFWA 5IT9c 4YHHL 1GUTA 1K73C 3G71A 4A93G 4UPAA 1JJGA 1G6JA 2SOBA 4LK0M 3A54A 2YTYA 4K7SA 4HJ7A 1ZXIA 3I70A 1FD7D 2MO1A 5IP7G 1QJOA 1TY2A 1PH2A 4RM8A 3RI7C 4CQNA 4GDLA 1EIHA 4IPCA 4FF1A 2N49A 5E7NA 2JXMB 2JK8A 3KDFB 1GXDC 1WJJA 3PRZA 4BKGA 1C4PA 1PYSB 3P42A 1B53A 2IX0A 4PZ6A 4ZAIA 2L5TA 4IALA 4X3TA 2A8VA 3DWQA 2YV5A 5M3FG 1C3TA 4ULLA 4P7IA 3S1MH 5E6NA 2A6EC 2YVCA 3AEFB 1LGRA 4K5XA 1HNXQ 2Q8IB 1L2NA 2L3ZA 1IYUA 4MDKE 5ELFA 3UI3A 4A8XC 2C9OA 2HHHL 5FJ8H 4HRSA 3BK1A 1S5BD 2F0MA 3RUZA 1ML0D 1GUGA 5FK9C 1BUVT 4K7WA 1SYFA 4B0MA 1STBA 1Q46A 2KEDA 4C3HG 5M3MH 4BBRG 1WSPA 2ZW0A 3TCAA 5DPTA 5FLMG 5C5LA 3BDOA 3APCA 1HRJA 3P4QB 3VR5A 2IO3B 1CKMA 1ESFA 1KHIA 2F0FA 2K6AA 2UXBL 4OX9Q 1WGHA 2LFNA 3NTKA 3VDYA 4NDXA 2OWOA 1VMPA 1MGSA 1ZEQX 1FEHA 1GUAB 4HCPB 4KVGB 3DBSA 4DAPA 2X6GA 4K0KL 3LJ3A 3Q23A 4LF9Q 2N3SA 1E3PA 3A7LA 2LY7A 3M7NA 1DYQA 1FL0A 3KUDB 1QKZA 1EIYB 2R7ZG 1AFPA 1TZ1A 1NAPA 1BQQT 1VS0A 5KRUA 1PRTB 2KHWB 1F9SA 2EZVA 2OCEA 2Z59B 3LDZE 2RDBC 5AZGA 1YJ1A 2INCC 2UU9L 3B0AA 4YXDB 4LFBQ 4HTHA 1WZ0A 2H5XA 3DBLB 1QB5D 4L5RC 1XNRL 4ICVA 3FVQA 1AEXA 1IL2A 1FFVA 5M5XH 1X3EA 2K33A 2WU2B 1NR2A 2KBNA 2BA0A 1F77A 3MXPA 3S1QH 3L0OA 3U58A 2PMVA 1GC6A 3J80c 3TIXA 4OL7A 4IFDH 4A3GB 1WFQA 1TY0A 1M1KC 2NVQH 2B8GA 1AW7A 3QJYA 1Z9FA 2JP1A 4JWUC 2DNFA 1FIQA 1LTID 2K75A 1ICFB 2XGTA 3X3MA 3MC0B 2KWVB 1U5KA 2B39A 2UUAL 4HJ9A 2MBQA 2ZNVC 1EY5A 4HXDA 3R2IA 1E8XA 2JXTA 4OZCA 2NS5A 2I1KA 2RMMA 4DK0A 1XLPA 4GOPC 4IJLA 2B2TC 2R92G 1MPEA 2F0WA 4NXNQ 4AUQC 1QWYA 2L7RA 3H1UA 1Q1BA 3UQBA 1EWIA 4NJ7A 5C4JB 3ND9A 1II3A 1F2LA 1YNTE 2ACZB 2DZMA 2LD9A 1F2YA 3E6ZX 2CHWA 4LNFA 3U7ZA 2K8BA 1R9TB 4KDIC 4J6IA 1W3SA 3W1SA 1A15A 2BWFA 3B9JA 4DV6Q 3D3RA 1NDDA 2RPVA 2NMQA 2Q2UA 4EKUA 1LUZA 5HHDG 4BXXH 1FGUA 1QCBD 4K5WA 1H95A 1KNEA 2EYHA 2HJ8A 2LVOA 2MA9B 4WWOA 4R3DA 2TMPA 1UUPA 1PRTF 2WAQB 2WDVB 3DLLA 2JA5H 3HOZH 5I4DA 1YQ3B 3L2PA 2VS1A 1F1HA 4KKTA 1H9KA 4DV1Q 2MCNB 2FBWB 5L37A 1FJGL 2CH4A 1A2TA 1TWFB 4FO2A 3AE5B 4HDQA 4WIPA 4EZLA 1WRIA 2Q8RE 2JYTA 5GAHC 1JC7A 4ILWA 3I4MG 4KKSA 4LW1A 1BDOA 4IFDJ 4B3RQ 3K7UC 2EYFA 4B3TQ 3E0EA 4HAEA 4KKIA 2I46A 1RODA 4QQBX 5DEHA 3HP3A 3Q6SA 1QVCA 4CDEC 1AZQA 3R93A 4M1UB 3GTLB 3GS2A 1I4QA 3AYHB 1MVKA 3J81E 4JL9A 1JWBD 1F9QA 4TV3A 3VXWA 3PZ8A 3GZNI 4B3MQ 3ZDMC 2JJQA 2WHIA 4IPHA 5ELOA 3TUOA 1E9MA 3H09A 4JI7Q 1C76A 4YCVA 3T8MA 1WGDA 3NHEB 3WALA 2B3GA 4KHPQ 3CIRB 1SEBD 4WJ3M 3C2PA 2X8XX 2JUOA 2A5HA 2VH1A 4A3OA 4JI0Q 3T16A 2X38A 1VQLA 1I7HA 4CJ1B 2KECA 4BOSC 1PHJA 2ASQA 4I6LB 2WWZA 2JEAI 2N7JA 2JA7H 2V3SA 2WLBA 4PNYA 1HHVA 5IYBH 4IUNA 1TWCB 3PO2B 3IHPC 5E6PA 1YBYA 2HDMA 3GD7A 3H94A 5FO9B 2K1FA 3ZO5B 2ZJRA 2G1EA 4BY7G 4Q5VA 3J81L 2JSVX 4K6DA 3LNNA 2CFMA 4HSPA 5BN3A 1Y8RC 2PVGC 2A69D 1WTXA 4CDFC 2K4KA 2KDBA 3RNEC 4X65L 3HOXH 3B2FA 2MBOA 4NXMQ 1WGRA 4TVAB 2J7QB 1QF6A 4FHKA 1ICWA 3CMAA 4GN5A 4BA2I 1MHXA 3BG3A 4G7HC 4JE3B 2EMSA 1HH2P 1DZ1A 1QUQA 1RFAA 2DX5B 2WXMA 1SYEA 3A1QB 2DY7A 2BS4B 1YHQA 5M5XB 4MTKA 2B2YA 5CV4A 4IFDI 1EY8A 5J3BA 4GKJQ 1V86A 3FC4A 3X0WA 2QEXA 3HGBA 1RWSA 1NMFA 2QW7A 4BS9A 1GVPA 2KDEB 4QL5A 1DCZA 1L5PA 3EN2A 2IHFA 1WTWA 2E2DC 3OMGA 4MIUA 1CK1A 3NBHA 2K5WA 3OAWA 2LMCA 3ZTCA 2FE8A 5BN5A 4MGKE 3VFKA 3VR4A 2E8GA 1EYDA 1ZXTA 4F8CB 2BB6A 2F4VQ 1UAPA 1J0GA 3WOEA 4A3FG 3T9LA 2EY5A 1BCPC 1RLFA 1C48A 3JAME 4FXDA 1K51A 1P3QU 5EE0A 4ME3A 4XDXA 2M9VA 3OWEB 3VR2A 1YIJA 1C0AA 2L32A 2B2VC 2Y5BB 1Y14B 2UXCQ 2F3WA 5CORA 1O7YA 1JALA 1E8ZA 5IIFA 3ZLZA 1TKWB 1EYCA 3I8ZA 4R4QA 5EBCA 3T56B 5KYIA 3CQZH 3EIVA 3I4NG 2IGDA 3NVYA 4O1NA 3RZDH 1SF0A 4XIGS 1FRRA 4GDKB 5IGFA 2KO3A 2K8CA 4ZK9B 1BNZA 4W9IA 5EGTA 1LM8B 3PMFA 2KVRA 4I65A 1PTOH 1KAAA 3VYRA 4X62L 4JW0A 1H9SA 1TWHH 1BF4A 4V190 4W9DA 1ASYA 4ZHPA 4A3MH 2N9KA 3MVVA 1T9HA 2WYQA 2IY5B 4LNKA 1R4MI 3A4SC 4OEMB 3PLVA 1HNWL 5L83A 3HOZB 5JAVA 1L4DB 5CV6A 2AHOB 2KMAA 2KVZA 2NPTA 3OWFA 2M4NA 1XYIA 3UDGA 4OWTB 1HTQA 1D1KA 3JAML 3TDQA 2CU3A 1A6XA 1YX5B 1HA5A 4JI3L 5IT9L 1VQ4A 3A33B 3RNBC 1OQYA 2JPHA 1IPGA 4FLHA 2UUBL 4LMQD 2VY3A 1IBLL 1HZBA 1IBXB 2VQEL 1O7IA 1QVFA 4MM3A 2NR2A 2FMMA 5GAGC 1SB3C 3EHVA 3PRMB 1UWMA 2C35B 2J52A 1AE3A 3R2TA 3GV6A 1TKEA 1JT8A 2NZOA 1MIUA 3ZJVA 5C3JB 2KTFA 4FJVB 2LFIA 4HN7A 5LLIA 3OHXC 3RNUA 1EY6A 1SNDA 3TP5A 1PTOC 3VYSA 1WM3A 1VF5C 3VH4B 5C4XH 1RL2A 4MEMA 1K28A 2F52A 3L3OC 4ANXA 4WURA 5HKHA 1I50H 2F0QA 2G9DA 1Q86C 1ILPA 2WP9B 1RJTA 2ZM6L 1PRTD 3M4YA 3HKZG 2KCTA 4BBSB 4GLVB 1XNQL 3L0WB 4KX6B 4JI8Q 5LMNL 1IGCA 5LMNW 1WIAA 3LXFA 1YJWA 1J5EQ 1CTMA 1RTNA 2O6VD 4IM0A 5CHVC 1WJ4A 4ACFA 4QMGA 1PFNA 1P9DU 2NCNA 4MGZE 3W2DA 4DR2L 2VB3X 3SK4A 1R4NI 3S17B 1MSGA 2N1WA 1X54A 3G7LA 1Z5SB 2K5PA 1XEEA 1YJIA 2LGYA 3SK8A 4IW0A 2XRSD 1WZ3A 4DK5A 2F0PA 2PW5A 4A93H 4WQMA 3VTUA 4C56C 1B4OA 2WKCA 3EVQA 1VMCA 1JCKB 4ZKCB 2XIWA 5IP7H 4B08A 3HOXB 3TEYA 5IYDG 4ZUJA 1KDAA 3F8TA 1EQVA 3V62A 1GUWA 4HEDA 2SDFA 3GTQB 4G7ZC 1QOBA 2EYMA 2KTRB 3SE0A 3HM3A 4N6EB 2SEBD 5M3FH 3D32A 4HPLB 1IYJB 2A74C 4R4TA 2B8FA 3H0GB 1T0SC 2KDMA 2DBYA 2KWCA 2N8NA 4H7BA 4A3DB 4GMVA 1KL9A 1DXMA 2N78A 3KOJA 4JBJA 4M8AA 3RLNA 3S1NH 3M3YB 2NVUI 2N4FA 2EYPA 3R7QA 1Y1WG 2K52A 3MTNB 3DBRI 4KGRA 5IOCA 1J19A 4HKQA 1OXXK 4PT5A 2OT2A 4K2KA 1C78A 3FP9A 2CKZB 4C3HH 1RHPA 1EWYC 4BBRH 1HQMC 1L0YB 2N88A 1BBUA 5FLMH 1LTGD 1N63A 2MEKA 3KF6B 4N9F4 3W1YA 2BYTA 1CUKA 2D0OA 3IL8A 2KACA 1ZKHA 5IAAC 4JI1L 1SLJA 1O80A 2KX0A 3AXCA 3P20A 1D5MC 3S1RB 3M4OH 3OIPA 4QF4A 4TQ1A 3VR6A 1I4HA 2A68C 5BMGA 5ELNA 5T8IA 4ARCA 5CV5A 4KN4C 4II3B 4OZAA 4LAAA 4DR6Q 2NTTA 5IE8A 1XMOQ 1Z2MA 4RGMA 3QB3A 5JEAG 2VW9A 4WAFA 4C1NI 2YU9H 1Q8IA 1TWGH 4NMZA 3GTOB 3C0RB 4MGYE 3W1GA 2LXKA 1JOOA 2YTXA 2E5LQ 3ZIMA 1ZE3D 2KANA 3ZXRA 4BWGB 1EQRA 2M1MA 4XYCA 2L9HA 2R7ZH 1IHZA 1I3QB 1VQNA 5DPRA 4PQXA 2MBHA 4OO1G 1X32A 2KHSA 2RF4A 5EKLA 2AQ3B 4X64L 1EL0A 3T3OA 1SJED 4PMWA 4XTCS 2R93G 2FIFA 4NKLA 3HOWG 1DGJA 3SDLC 3UQAA 5J17A 1UGMA 1I6HB 4MN3A 3RZOB 4CJ2C 1K8AC 3G48A 4KGTA 2ONQA 3KQ4A 1N8RC 4LF6Q 3HKZE 4B0EA 3SVMA 2RDHA 4YTMB 4GLSC 1YMHE 3A55A 3FRPB 4FXGC 1LABA 2C9WB 4MELA 1SE2A 3NK9A 2ZVOA 4HJGE 3S24A 5COYA 4G3XB 3EUB2 2EYJA 4GN4B 4JPBW 3VA7A 2PW7A 2D5GA 4JI5Q 3RULA 2UXDQ 1LT6D 4XQJA 2MO0A 1KLUD 3W3AA 4A3LG 1TGZB 2W54A 2KQ3A 2BT6A 2ZJPA 3DPDA 2KK8A 1L0VB 1U4RA 2BKRB 1C8CA 2Z0DB 1N62A 3ZRCA 3H7PB 2L15A 3C8YA 1TVXA 3PHWB 2PNRC 2R92H 1PH3A 5LMUL 1IYFA 4FP5D 2F0TA 2K50A 4JOIC 2LHEA 1KOTA 1NYRA 4IM2A 1D1IA 3EC8A 3HOUG 1YHBA 2YEPB 1N34Q 1I35A 4PMCA 3A74A 5C0XJ 4JIOU 1PFDA 1YNJC 2GLSA 2AWNA 2WACA 5KEEA 3I56A 4R4CA 2N9XA 3JSVB 1LTAD 3TP6A 3SEBA 4N58A 3RN9C 5IGGA 2F0KA 3VTWA 5JZEB 1BVSA 1YZ6A 4KHZA 3SFDB 3U4EG 1OXTA 1HA6A 3NBIA 3R3MA 4BBNC 4Y7NH 1DOIA 2PZUA 3P1HA 4DU9A 2KA7A 4A3BB 4ASWC 3K58A 2IPKD 3T51B 2KFKB 3S2DH 1L1OC 1LV9A 5AZHA 3UGBB 5IP9G 3H6MA 2WXPA 2BE5D 4LF4L 1WJUA 2RCFA 3LB8C 1LT3D 1CKNA 5C44B 1Q10A 4ANWA 3QA8A 4DK6C 1X6OA 2N9EB 1FRDA 3I4MH 5KIXA 1TS4A 5AEKB 2SAKA 5CYUA 1WX9A 2ZJDA 2LHDA 4TRDA 3HOYB 4B9KA 2CS4A 4HDOA 4C4VA 4ZRZA 5C6AA 1KLGD 3EQLC 3J7A5 2ZCCA 1NYQA 5HY6A 1VQHA 4IG7B 1WYGA 3RCZA 4Y52H 2QEJC 2D2QA 3N6RA 3EROA 1A2UA 2VZAA 2KDIA 3U7DA 5D14A 3TP7A 3KLSX 2JY6A 4LJZC 2EY2A 4D2KA 3FKIB 5E6OA 3AE2B 5I2YA 1ET6A 2INDC 1LTSD 5EKKA 2LXJA 4IKGA 3IKJA 4C3JG 3FHWA 3PUWA 3UDXA 1PMRA 5BO4B 4WWPA 3CU7A 2B2WC 1XLOA 4EFOA 1DM0B 1JROA 1I94Q 1KNAA 3ML9A 4NQLB 1EZ6A 2MP2A 3J7YW 2JA9A 3J81c 1E8WA 1KH0A 2CHZA 1RDPD 3H7SA 3KUZA 3PREA 1TYGB 1SSOA 2M2LA 3L10B 2W9NA 3K5OA 2L05A 2CHXA 1K83B 1JQYD 4YSXB 1WH3A 1X9NA 3DHHC 4YY3L 4BY7H 4JI6L 4HMJA 2HCIA 5JXVA 3TQYA 1Q5WB 1QOAA 2E2JH 1JOKA 4J6HA 2R2QA 2EPBA 4N59A 1CQVA 3ZRFA 4OIJA 1PH5A 3WANA 5IY0A 4ZYNA 4KY7A 1Y1VB 2C7NB 4BFRA 4GU2A 2JSOA 2MBEA 3PSEB 2F0EA 4GNXC 2LJIA 2JA8B 1FXIA 3WWVA 2VUMG 1XX8A 4IPDA 4DR1L 2CW0C 2AL3A 5IYCG 2K25A 3FAHA 5MPOA 3ERSX 2OXPA 3S9WA 3OW2A 4RGNA 3I4LA 4GS3A 1FNVA 4O0AA 2MJEA 1N36L 3UF8A 2J4XA 1UEAB 3O13A 1WTPA 4XQNA 3QR8A 2MRPA 2SNMA 4GGQA 2NZHA 1RFKA 5CV9A 1CM9A 4GN1A 5I2XA 2K03A 4FXKC 2D3CA 2XTIA 3KDFA 4K3BA 2LZ6A 2JVCA 4IM3A 1JWUD 2QDBA 4GNXA 2CWAA 5FO7B 2PZWA 2Z6BA 1MKHA 4MJSB 1STGA 4LF5Q 2O5JC 4I6PA 1G6PA 2FHTA 2M8SA 1L1OB 1UH6A 2HHHQ 3UIOB 2KLGA 1G91A 3TBIB 1S72A 5BYRA 2MW5A 4PZ8A 4A3FH 2MJ8A 5EKIA 1LYLA 3V05A 3OYYA 3EA6A 4KIKB 1D8LA 1H9JA 4KTAA 4RHSA 3AV8A 3PV1A 2R92B 3KVFB 1HZCA 3OTOL 2TSSA 1XMQL 3MA2B 3W5OA 4A76A 3NWSA 1NEKB 2Y5CA 1T6BX 4WJQA 1VQMA 1H9MA 4NPSA 3GTKB 1G291 4YWMA 2RSUA 2ID0A 4W9LA 3I4NH 5AUIA 2EDGA 4B3SL 1EUVB 3KWVA 1QOFA 1VQKA 2AUKA 1VD2A 1D3ZA 3RPFC 3K5NA 1V81A 4J8QA 2OF1A 3HKSA 4C3IG 3ZYYX 4NW2A 1EU3A 1DD2A 1TT5B 1XCTL 5M5WH 5M5YB 1MFWA 4FJYA 4DV4Q 2BYFA 3JAMc 1GNUA 1GAQB 3U4VA 4IUUA 1T0YA 4DV7Q 4AP4C 2B63G 3Q24A 4FN2A 4TMAB 2WXNA 3IAM1 3AECB 4ZOHC 2HT1A 1LACA 3TREA 3NSWA 1R7SA 4U68A 1JWAD 1MG4A 1K0RA 2W3RA 3D0FA 1UGJA 4M02A 1B44D 5K36G 2J0TD 5C3EB 3BY4B 2ICEC 5H8YE 3GP7A 1UELA 1UE7A 2O6VA 4F7XA 1I4XA 1FPYA 5K5PA 1K8RB 1Q12A 1IZ6A 4EQ5A 1FMAD 1YNNC 1HTOA 3I5JC 3Q3OC 2QF7A 2IZVB 4LNNA 4RWSC 4OVUA 3T1YQ 3I57A 3A5ZB 1O7ZA 4AH6A 3CXCA 3CWIA 1XCQL 2WDRB 4RCOA 2DHZA 3ZNID 2WXLA 1DOLA 2I07B 2H4OA 4JV5L 1E8YA 5KNCA 1D2BA 4E6IA 4DV3L 2D3AA 2DY8A 1HCZA 4EX5A 4ID6A 3S15H 1H4RA 1PFMA 1BMLC 2RDFA 2XK5A 3A9KA 2FJ2A 3AH7A 2NWGA 4A3IB 5HFYA 1OQRA 2Y3AA 2JA6B 1XLNA 1WJ6A 3ND8A 5I6YA 2DJFC 3ZNHB 2ZXPA 4PMBA 4OZBA 2D10A 4JBWA 4K2LA 3J80i 2F3VA 1F2ZA 1OXVA 2ZXOA 5FOBB 3PIOA 1Q81C 4L5SA 4A3EG 1HNZL 1SSNA 2VNUD 1IBKQ 3MAQA 3MXNA 3C1FA 2F0HA 3A9JB 2R2OA 4LF7L 2QMTA 2GVBA 3Q22A 2I5MX 1WE7A 1XTDA 2ZJQA 2V4DA 3EJIA 4BAXA 3GDEA 4BY1G 3IAYA 4MZ9A 1VQDA 3K0YA 1NI2A 3M63B 1U0LA 4IUPA 1VDVA 4ZRIA 5EDSA 2E2IH 2CU1A 3TP8A 1YQBA 4JBMA 2M56B 1RM6C 4DAMA 1HJPA 1VZ7A 1HFNA 2MX2A 2JZPA 3NVVA 5IYDH 4P6VF 3N32A 1TS5A 2Q2IA 3VDZA 3PO3B 1PYWD 4X66L 2UUCQ 4P73A 2EJMA 1TBEA 3PRPB 2ZEQA 4ZYSA 3KJPA 1YI2A 2QIEB 2CVRA 1EOVA 2RBMA 4GDLB 1AE2A 1AWDA 2VB2X 2REXA 2EYLA 2R7DA 4W9CA 1T5EA 4A75A 4OWWB 1TR5A 3GE8C 5CHWA 4FADA 1LM0A 3CCVA 5GADC 1J6QA 1PZID 5DPWA 3HM6X 3W1SC 4A3JG 1JRUA 2JRHA 1Y1WH 3I9V1 1S5DD 5L95C 1E24A 1FCCC 5EPLA 1P7EA 1X3PA 4K8JA 1GB1A 4A3CG 3RUIB 3ZJYC 1QZGA 3I2ZA 1K3RA 4S17A 4QIWE 4USAA 1K3BC 4DR5Q 4DDGD 4UP9A 1HNXL 3PF5A 1KXLA 4DWFA 1N33Q 1NBFC 2L4NA 4A3KB 4L63B 2M0XA 2N7DA 1OXSC 5E1FA 5C5MA 4FBJB 4A3FB 3Q0AA 1TIFA 4MNOA 1CMXB 2AMCB 2NB0A 5CBAE 5JEAH 4IO9A 1IUEA 1EIFA 3T53B 1ZPSA 2E75C 1TIID 4KV6A 2AX5A 2IY1B 4LJOB 4OX9L 3TEXA 4II2B 3I4NB 3I7FA 4YCUA 4FA6A 4OO1H 1RTOA 4IZ8A 1YN3A 2OJWA 2BH8A 5IGEA 1PH4A 1SYGA 3EGRA 2K3UA 2VZKB 3EECA 4RF0A 1QE6A 3ONAB 4ALPA 2PMZE 1CFMA 4ZHOA 2R93H 3HOWH 3HRDD 1NTGA 4DFAA 4LF9L 4YCWA 5GQOA 2KC1A 2JWUA 3FILA 1PLFA 1ESRA 3HVDA 2EMTA 4DV5Q 4F87A 2D2CC 3Q3NC 4I7AA 1UEBA 4LFBL 2I38A 1KRSA 2AL6A 1VF7A 4P1CC 2BGFA 3H9DA 2KOXA 5LXHA 1LO5D 5EPKA 1F9RA 3EBEA 2WDQB 3ZDTA 3FKYA 3OSOA 2IDYA 2K9XA 4AQYQ 3G6JB 4R9WA 1I6VC 3AEVA 3S1MB 4A3LH 1QILA 1HZ5A 3KBXA 2LASA 3A1QA 3DCGA 1K9MC 3I3TB 3IFWB 2RD0A 1NI3A 4RM9A 2KQ4X 2K01A 1KJTA 4DR7Q 2JYOA 4RGTA 3GZNB 2W3SA 3QX1A 3QWNA 1L6UA 1OXUA 2LGDA 4PZ7A 4PS3A 4DR3Q 3I4OA 2AWOA 1WGYA 4IPGA 5C2TB 2Z8LA 2CQAA 1AP0A 3LWEA 2KJ6A 5M3MB 1N61A 3V96A 2DN8A 3Q8BA 3DXJC 3HOUH 5C23A 2CHBD 3ZKJC 4APVA 1PZJD 1BR9A 5JEAJ 1J9OA 3K6OA 2AEHA 4K81A 4XZ4A 2HD3A 2K5HA 3AN1A 1CZGA 4RKLA 3HHMA 1YNXA 1S40A 1EEFD 1E1OA 4YIJA 3B2GA 3NHHA 4LF8Q 3LWUA 1EYAA 3STBC 3HKZB 4NXNL 4HPMB 1OEYA 2EIFA 3P4SB 4YSZB 2G4DB 2JEBI 4CBVA 1I4PA 1ZKOA 1CHPD 1LXDA 1GPXA 2ZNVB 1FXTB 2B2YC 4GB9A 5AJ3Q 2BDOA 3HEJA 1V8CA 3IRBA 1L0WA 4DV6L 5IP9H 4KD3A 1SBBB 1DONA 2ZW1A 4GOPB 2JT4B 4RKBA 3HRZC 5G2NA 1E0BA 1WJNA 3TSSA 4LNOA 4FF2A 1BXTA 1MBYA 1WYDA 2G5DA 3E0JA 3AQQA 2K5VA 4MT5A 1XF5L 1J7AA 2C7HA 4DV1L 3B08A 2ZTCA 5E3FA 2NVXH 2CJNA 3K0XA 5CBEE 3AE6B 3ECIA 1S3SG 3WAMA 3NVWA 1STNA 3S1QB 2KC2A 5D65A 3FPUB 2UUBQ 1HE8A 4DR4Q 2F0VA 2VQEQ 2DZIA 2NVQB 4B3RL 3BWUD 3NJTA 1MI2A 4B3TL 3OG5A 1IBXA 4L8JA 3R66C 4LCDE 4LNQA 5JOBA 1AH9A 2HTME 3V61A 3IFTA 4C3JH 4JX1C 3VYTA 1FVIA 1IW7D 2SNSA 3MHBA 4RH6A 1TWAH 1VQCA 1STAA 1PUTA 3B6YA 1WI0A 2EOTA 1ZDVA 3CKIB 1B1ZA 4WRDA 4B3ML 3HOVG 2RKSA 3CAMA 2R3ZA 2KHJA 1CZWA 1I5FA 2KUMA 3P4PB 2L12A 3DWGC 2PE9A 4JI4Q 4EZKA 3PVLA 1U4MA 5IODA 1ZW7A 2GBKA 4JI7L 4L5TA 4EQOA 4BZAA 4KHPL 3EFXD 4DUYQ 5IGDA 2G9HD 2ALYB 1V5TA 1C77A 1KTKA 3N20C 1YVCA 4JI0L 5LMNQ 3NG0A 2K7VA 4X3UA 1WGKA 3BVZA 2J42A 4S0RA 1NY4A 3ABVB 4AJYB 5TR5A 4OO1I 2C60A 3VR9B 1UNSA 1RIPA 3N52A 4RA8A 1MJEA 1C7YA 2K6QA 2JA5B 2PW9A 2K05A 2W55A 4XT3B 5LL6S 2J0JA 2VUMH 4DF7A 5BN4A 3K7AH 3S14H 1R4MB 5J2RA 1EEID 2R93B 1HR0L 5EJWA 3DVGY 4MH8A 1HR0W 4GLXA 3DM1A 3KLSA 2WAQG 3A56A 3ALBA 2CCZA 3H6NA 3BZDB 3FMCA 1YX6B 2GB1A 3OJ3A 4JPSA 3M4QA 4QCLA 1E0ZA 4JWSC 1J8CA 1B2TA 3CMMB 3UIPB 4HIDA 4CGYB 1SFOH 3JW0X 3L4PA 2FMCA 2KCNA 4NXML 1HQRD 2LUMA 2EQSA 1LT5D 3ZJUA 1PQSA 5EBDA 1YJJA 1YQ4B 1QUQB 3CCEA 1IKMA 5ELBA 4JLCA 4W9KA 2MHJA 4PS7A 5BYQA 4LFCL 3PV0A 5KGUA 1SYCA 2ZPYA 1X3GA 5JJKA 1EWCA 4AJWA 3AE1B 3NQIA 2AKWB 4NY0A 2IGHA 2HQEA 4DPGA
chains in the Genus database with same CATH topology
2MH7A 1PXUA 1JB3A 1SYDA 3OOCA 2WXOA 5E4WC 2LMCB 3WCQA 1AN8A 5BMHA 2BOSA 2F0GA 1XXGA 1V8QA 2PCFB 3ETRA 5EE1A 4IUVA 4V0BA 3AMZA 1GJXA 3HOUB 1F2RC 4EVOA 1EWHA 1TT2A 3ZGZA 2JA7B 4KHVA 2ENBA 4QUCA 1V1OA 4US9A 3DEPA 1Y69U 1Q1EA 3A8IE 3M7GA 4YWGG 5C3WA 3QOJA 2A6HD 5JPMC 1FNUA 4HCSA 5H92C 2F0LA 5FO8B 1H9SB 1BCPB 2Z1CA 4EQNA 5C3JB 3DWAA 3SR6A 2IJ0A 5K36H 4NP5A 1QOHA 1QOGA 1V1PA 1J8IA 2V3NA 3PIO3 2K28A 2EE1A 5BMIA 1R4PB 1WTVA 1D4BA 1ENCA 2Q8TA 3AEAB 3DWPA 1DOKA 1JW9D 2EJFC 3BVMA 4QB4A 3P7JA 4MM3B 4YTNB 4DNRB 4KI0A 3HG9A 2O4XA 1JQ4A 2PKOA 2WB1B 2A6ED 2J53A 4DAYA 4Q2JA 4C7ZA 1L4ZB 5DNFA 1JWMD 4X3KA 1N5WA 1DJRD 3BYTB 2VZKD 1IYVA 1BO0A 3PO0A 2NUCA 3J9CA 3CQZB 1K53A 3RZDB 5ELEA 4IDIA 3BDCA 1K50A 1PTOB 1TWHB 4A3MB 3K59A 3AE4B 1P7FA 3DUZA 1Y8NB 1F2RI 1S4ZA 3E5SA 3K7AB 1FR3A 1TS2A 4HEA1 5J1ZA 1TQOA 1LLRD 1IGDA 3TN2A 4H13C 3KF8A 2F0NA 4XE0A 1W6JA 3KBGA 1EU4A 3NTIA 2RQXA 4L1BA 5KNDA 3MP9A 5I9OA 1S5FD 1BOSA 5G5HA 3MEHA 3I91A 2MHVA 2BS2B 3D6CA 2XWBB 1KDBA 3BYYB 5EE9A 5A35A 1GUOA 5C4XB 4HSVA 1QT9A 1QNUA 2D5DA 1I50B 5CC4A 2N9LA 4CKBA 3Q8AA 2L1BA 1SDFA 2KMMA 2H89B 2JU6X 5CV7A 1D5XC 1PTOF 2A69C 4G7OC 3VQIA 1GB4A 2M0AA 2WS3B 3DEOA 4ABNA 5BYSA 1OQQA 4ARIA 5HI1A 4A93B 2WXJA 3BS1A 3SK5A 4A55A 4EE2A 3QG1A 4ZRPA 1EIGA 1GUNA 1FXAA 3Q8FA 2L83A 4IN3A 3HS0C 3AB5A 5D7GA 1F2MA 1RKNA 4K14A 5EQ0A 2L11A 4N9TA 4F88A 3W5VB 5M3FB 3IFDA 2PO4A 1VCIA 1SE3A 2NYZD 1RYJA 2F03A 5ELDA 3NQTA 2EVBA 1STHA 3TZDA 3S1NB 1M8AA 4XYOA 1IL8A 4C1NK 2XNAC 3AU7A 2WP8J 3GQBA 4C3HB 1BUIC 2YEPF 4BBRB 2N55A 2WNMA 2PMZB 3M4OB 3L7ZC 1KRHA 1XWEA 2IWHA 2C5CA 4ZRQA 2YU9B 1FGBD 2HCCA 1TWGB 4RAUC 5CMDA 4TQUS 5IGBA 4YT0B 2J7ZA 2IX1A 4A9AA 2R7ZB 4R8NA 4F8MA 3SDZA 2K1BA 3TEWA 3A7AB 1C9FA 2PVOD 1WVLA 1PGAA 2WXRA 5C3XA 4CKCA 3MTSA 3RLFA 1HZ6A 2I2YA 1TU2B 3D4DA 2NN6G 1MSHA 1T3QA 1B9NA 3RMHA 2Q5WD 3AE9B 2RSOA 2INNE 3L9AX 5JJZA 2HDLA 4MACA 4OW0A 3OW7A 1EY0A 5FR3A 1YN4A 4H44C 4YSYB 2EY6A 2K32A 2F0UA 1Z7TA 2IW3A 2XVSA 2JQRB 3AEBB 3V2TA 2NVYB 4S3SA 3MZ5A 2K22A 3MFGA 1PRTC 1J7CA 4A90A 2D9UA 3QIAA 1KDCA 2KJXA 3AM9A 1PDXA 2QILA 3WDNA 1AYFA 3P63A 3BVGA 4Y7NB 2FUG1 2A6HC 3Q69A 3S2DB 5AFWA 2BBCA 2XWJB 1WWTA 3I4MB 4WORA 4EGVA 3SFEB 4XQQA 4WJWA 1K52A 4DN4M 4TSSA 1Q90A 3SHLA 4DAVA 3VRAB 2F1MA 4BA1I 3LYYA 1E7PB 3K5LA 4HROA 4CJ0B 2PYKA 2WQYB 2XN9C 2L0CA 1ROEA 3H91A 3A8JE 1FYCA 4KKJA 2XSCA 4HKZE 3Q8EA 1JOQA 1XLQA 5D3IB 4A6QA 3I73A 1ZYRD 3AE8B 1PTOD 4HMIA 3NZ3A 1R4QB 1FM0D 3PUYA 1Z47A 1TZOA 1XO3A 2V3PA 4FVMA 2MJ3A 4BY7B 3H3VC 3PUZA 2V4IB 1NR4A 3I3CA 1S5CD 1CJEA 3C1EA 3UI2A 5T1GA 2E2JB 1K8OA 1AZPA 1NVID 5LNK1 1NCVA 4X3SA 5ISRA 1KABA 3TEZA 4P2CB 3MHZA 5C0XG 2LGIA 1ZDXA 1FCLA 2PTLA 4QUFA 4ZQ3A 3AE7B 5HURA 2YYZA 3IT6B 1EY4A 1STYA 1JORA 1N5XA 2MP1A 2FINB 3M85A 3Q8CA 2E6XA 2ZXRA 5HGTA 3D4WA 3DMUA 2EXZA 4HCEA 1B9RA 4LTUA 2WXKA 1S5ED 1ZUD2 1G8ZD 5M9OA 2BDNA 2WXHA 2EY1A 2IL8A 3HOVB 1WXQA 2WXGA 3U9OA 4Z9CB 3IT4B 5CR3A 4JK1C 2IT1A 3T13A 3KLRA 1I4RA 4WFN3 3GB1A 2A68D 3OMCA 4KGSA 3AB9A 1EY7A 5M5WB 1QG7A 2QCPX 1F9PA 2BE5C 4YTPB 1SNPA 3E56A 1HXYD 4AS1A 3NUHB 3D8GA 3PZ7A 1X3QA 2F0DA 2B2TA 3VRBB 1FD6A 1QNKA 5HG2A 3A8KE 2B76B 4GZYC 5DM73 1C4AA 4WWMA 1CA6A 3X3NA 4ZUIA 1W6KA 4DK1A 4KY6A 4H0LC 1LTBD 4B9WA 1Q3LA 1SNCA 3T3NA 5AUKA 1SMYD 1U9RA 4J3OD 4L2YA 3H8HA 3S15B 2NVTB 1F0ZA 1EQTA 2MUYA 3GV3A 1JMLA 4G4KA 5JVH3 3AEGB 4RF1A 4RFBA 3NS1A 1VJKA 3MJ5A 1VZ8A 4XWTA 4REZA 3R8BA 4FF3A 4TKOB 4DXFA 1YNJD 1ENAA 1VRAB 4XDDA 2RDGA 4MHEA 1ZP0B 2AQ2B 2E2IB 3K5MA 1SIJA 1A3UA 4P16A 4IURA 4DXGA 2DWQA 2EYOA 4FNFA 4Q0FA 5FLXE 5J39A 1D6EC 3FILB 4I7ZC 1JICA 1HPCA 1JE4A 5FKAC 4G57A 4CKEA 2Y0SB 1CI3M 5KYLA 2KWDA 5DM63 4KD4A 4DA2A 2X6LA 3ZQ4A 1TJEA 2IGGA 1Y1WB 1SAPA 2RSNA 2A73B 4PV1C 3GTPB 1CA5A 1SNQA 3AEDB 3NRZA 4WH4A 5FLXL 1ZXHA 2PIAA 2Z4IA 3TMEA 4C2MB 2Z4HA 2GA4B 5IGCA 2K5DA 2F0IA 2INPE 1GUSA 3I90A 2M00A 5IT9E 1SJHD 4AYBB 1FNWA 4NZLB 1E10A 5KNBA 5F2DA 3PUXA 2OHFA 3IXSA 2WV6D 1FFUA 3HOWB 1B50A 3C3LA 4L23A 1EFID 2H1EA 2FFKB 3NUCA 1V97A 2VXWA 1QLBB 3FEWX 2QSDA 4ZKBB 2NN6H 1O7LA 2B2VA 3FDTA 2CW0D 5DAUA 1WD1A 4IQZA 4XWWA 2F0OA 2LS01 1NUCA 1JWSD 5C4HA 1WTOA 2BTEA 4LLGM 2O5IC 2CJOA 4NAMA 5E4XA 1PGXA 2WXIA 2EJGC 3KK7A 1ACCA 1YN5A 3BIID 1G2SA 1U4PA 3V3XA 3SK6A 4XXEA 1I4GA 2OEDA 5G5GA 1DOMA 2N0SB 1VDZA 1ENFA 1SYBA 3NP8A 3NE5B 1ZYRC 1J7BA 3P75A 3HZXA 1Z6HA 4KJNA 5JVG3 3GO5A 5LHY1 1H9RA 3D6WA 1HUNA 3GTGB 1SNMA 1WCMB 5G3LF 1E6EB 2KAJA 5I6WA 2EKIA 4KK7A 2WXFA 3P4RB 2DNCA 4R8IA 5JPNC 5EE3A 1WD0A 3VR8B 1B9MA 3R3OA 3BK2A 4FXCA 2E2HB 2L55A 2JYEA 4C80A 2QJLA 1B3AA 1A3TA 1V43A 3J80E 5NUCA 1K8MA 3NWTA 2NVXB 1RCVD 1OO9B 2X69A 1E2VA 1GOZA 3HVZA 1G2TA 1MD2D 2K04A 3PUVA 2QKIC 1KFYB 2HUGA 2F4IA 5D3DA 2NTSA 5ELCA 1C79A 4ME5A 1YNND 3QO2A 2R61A 2L52A 1UWXA 3NVZA 4IFDG 4US8A 1DOXA 2WXQA 3N9YC 4C3JB 3VR3A 4C7YA 4UDUC 1EOTA 1TWAB 1CHQD 1TS3A 4LK1C 3VYUA 3J80L 1G6ZA 4H2AA 2PQEA 2WKDA 3VA5A 2HDEA 1FO4A 1ONLA 2OEOA 3FPPA 4CHTB 3MFYA 1A3VA 4RNAA 1RF2D 2M19A 1VR9A 1TKYA 1BCPF 4OIKA 2PLPA 4IOIE 3MXUA 3D31A 5TSSA 2RVLA 5C0XH 1Y8OB 1STEA 3NXWA 3S14B 2VUMB 2Y5PA 2F0SA 2LKVA 5T1IA 2V0GA 1DOYA 3AEEB 1JR0D 5EPJA 2E76C 2NN6I 2NZ1D 1SFOB 2DYMA 4AQ7A 1V1PB 1C4CA 1EM7A 1HTPA 2R6GA 1HTLD 2BA1A 3KWLA 1Y8PB 2BB5A 4ODGA 2BW2A 3ITPA 3MXGA 3TZUA 1L0XB 1T5XD 2B2UC 3U2SC 3C46A 1SMYC 5A2QE 3J7AV 1KF6B 1HEZE 3S2HB 3E9SA 4IUQA 2JE6I 4DNTB 4FF4A 2O2LD 1BBXC 5LL6X 5CV8A 4B9XA 1WTRA 2EELA 2B2UA 2DYOA 1EY9A 3AE3B 1C4QA 2GRIA 4L6TB 4OGQC 3WOFA 4C3IB 2KOLA 2GI9A 4UAIA 4K6LA 4FYDA 4K5VA 4KY5A 3BDLA 3QOLA 4RCNA 4RGOS 2E74C 2WU5B 3SR1A 2B63B 3D4RA 3DHQA 5GXGB 1VZ6A 3W5UB 5CGKA 1MI0A 5A2QL 4QIWB 3RFZB 5I9PA 1OFFA 1RD9D 1LT4D 4TQ0A 1E2ZA 4RHRA 3P1MA 3ERQA 1PZKD 4EQPA 1SNOA 2NBFA 4DQOC 1JRPA 1IKLA 1N60A 4KJOA 3MWYW 2DLBA 2ICIA 3I72A 1IW7C 1WTQA 3OIQA 4OVZA 3CRLC 1SXTA 3RD4A 3F2UA 2ZT9C 3CRKC 4K8IA 2H88B 1HUMA 1MHHE 1ZOYB 1XTCD 2XRQD 3AMUA 1LTTD 5G3LD 3ZJTA 4XYQA 3GTJB 1PGBA 3U9SA 3HUIA 2K0PA 2KVMA 4A3EB 3W9CB 1L6VA 3IAS1 4U673 4ZLTF 2KEEA 4N9PA 1TKGA 2MJDA 4BY1B 2AQ1B 2RA4A 1VLBA 1HFGA 2BCOA 3DWMA 2WINB 5J22A 2D62A 3LX0A 1ILQA 5C0XI 2E3TA 2BS3B 2F0JA 1O78A 1GHKA 4DGZA 3J7AF 3CHBD 3NTHA 2B2WA 4KN7C 1NSNS 2DNEA 4ITKA 3GTMB 4NJCA 2MPMA 3S16B 3SXHA 2MGSA 1PFBA 2PZTA 1M4VA 4KKUA 4A3JB 2LEKA 1ET9A 3KUPA 4IUTA 1LTRD 1PDQA 4XT1B 2KCCA 1E2WA 4XDCA 1D5ZC 1QQRA 2AUJD 2K5QA 3K57A 3U52E 1BCPD 1CZPA 3NPPA 5E6JA 4OHJA 4KMUC 4HR7B 2ON8A 1EZ8A 4J1MA 1CQFA 2IX3A 1GHJA 3T4AC 2W82A 1U4LA 1Y56A 1NENB 3PIP3 2WIIB 4O42A 1CT1D 2PPBC 4M0WA 1SE4A 5C4ZA 1A70A 3URYA 3OPOA 2L1AA 2KN4A 2JX5A 1GUTA 2SOBA 4LK0M 3A54A 1ZXIA 3I70A 1FD7D 1QJOA 1TY2A 4CQNA 1EIHA 4FF1A 2JXMB 1GXDC 1C4PA 3P42A 1B53A 2IX0A 4ZAIA 2L5TA 4IALA 4X3TA 3DWQA 4ULLA 2A6EC 3AEFB 4K5XA 2Q8IB 1IYUA 5ELFA 3UI3A 4A8XC 2C9OA 4HRSA 3BK1A 1S5BD 2F0MA 3RUZA 1ML0D 1GUGA 5FK9C 1BUVT 1SYFA 4B0MA 1STBA 4C3HG 2KEDA 2ZW0A 1WSPA 5C5LA 3BDOA 1HRJA 3P4QB 3VR5A 1ESFA 2F0FA 2K6AA 2LFNA 3NTKA 1FEHA 4NDXA 1VMPA 1MGSA 1ZEQX 4DAPA 2X6GA 3Q23A 3A7LA 2LY7A 3M7NA 1DYQA 1QKZA 1AFPA 1NAPA 1BQQT 5KRUA 1PRTB 1F9SA 2EZVA 4YXDB 4HTHA 1QB5D 3FVQA 1AEXA 1FFVA 2K33A 2WU2B 1NR2A 2BA0A 1F77A 3MXPA 2PMVA 4OL7A 4IFDH 4A3GB 1TY0A 2B8GA 1AW7A 3QJYA 2JP1A 4JWUC 1FIQA 1LTID 3X3MA 3MC0B 2B39A 1EY5A 4OZCA 3R2IA 2JXTA 2RMMA 4DK0A 1XLPA 2B2TC 1MPEA 2F0WA 1QWYA 1Q1BA 5C4JB 3ND9A 1II3A 1F2LA 1YNTE 2ACZB 1F2YA 3E6ZX 3U7ZA 1R9TB 3W1SA 1A15A 3B9JA 3D3RA 2RPVA 2NMQA 5HHDG 4K5WA 1QCBD 1KNEA 2EYHA 4R3DA 2TMPA 1UUPA 1PRTF 2WAQB 2WDVB 5I4DA 1YQ3B 4KKTA 1H9KA 2FBWB 1A2TA 1TWFB 4FO2A 3AE5B 4WIPA 1WRIA 2Q8RE 2JYTA 1JC7A 4ILWA 4KKSA 1BDOA 4IFDJ 2EYFA 4HAEA 4KKIA 2I46A 1RODA 5DEHA 3HP3A 3Q6SA 1AZQA 3R93A 4M1UB 3GTLB 3GS2A 1I4QA 1MVKA 3J81E 1JWBD 1F9QA 3PZ8A 3TUOA 1E9MA 3H09A 1C76A 3CIRB 1SEBD 3C2PA 2A5HA 3T16A 2X38A 1I7HA 4CJ1B 2KECA 2JEAI 2N7JA 2WLBA 4PNYA 1HHVA 4IUNA 1TWCB 3PO2B 2HDMA 3GD7A 3H94A 5FO9B 2G1EA 4Q5VA 3J81L 2JSVX 4K6DA 3LNNA 4HSPA 2PVGC 5BN3A 2A69D 1WTXA 3B2FA 1QF6A 1ICWA 4BA2I 1MHXA 3BG3A 4G7HC 4JE3B 1DZ1A 2WXMA 1SYEA 2DY7A 2BS4B 5M5XB 2B2YA 5CV4A 4IFDI 1EY8A 3FC4A 3HGBA 1RWSA 4BS9A 1DCZA 1L5PA 1WTWA 2E2DC 3OMGA 4MIUA 1CK1A 3NBHA 2K5WA 2LMCA 2FE8A 5BN5A 3VR4A 1EYDA 1ZXTA 2BB6A 1UAPA 3WOEA 2EY5A 1BCPC 1C48A 3JAME 4FXDA 1K51A 5EE0A 4XDXA 3VR2A 2M9VA 3OWEB 2L32A 2B2VC 2F3WA 5CORA 1O7YA 1JALA 5IIFA 1TKWB 1EYCA 3I8ZA 5EBCA 5KYIA 3T56B 2IGDA 3NVYA 4O1NA 1SF0A 4XIGS 1FRRA 4GDKB 5IGFA 4ZK9B 1BNZA 5EGTA 3PMFA 4I65A 1PTOH 1KAAA 3VYRA 1BF4A 1H9SA 4V190 4ZHPA 2N9KA 3MVVA 3HOZB 5JAVA 1L4DB 5CV6A 3OWFA 1XYIA 1D1KA 3JAML 3TDQA 2CU3A 1A6XA 1HA5A 5IT9L 4LMQD 1IBXB 2FMMA 1SB3C 1UWMA 2J52A 3R2TA 3GV6A 1TKEA 3ZJVA 2LFIA 4HN7A 3OHXC 1EY6A 3TP5A 1SNDA 1PTOC 3VYSA 1VF5C 3L3OC 4WURA 2F0QA 2G9DA 1ILPA 2WP9B 1RJTA 1PRTD 3M4YA 4BBSB 4KX6B 1IGCA 3LXFA 1CTMA 1RTNA 4QMGA 1PFNA 3W2DA 2VB3X 3SK4A 3S17B 1MSGA 3G7LA 2K5PA 1XEEA 1YJIA 3SK8A 2XRSD 2F0PA 2PW5A 4WQMA 4C56C 1B4OA 2WKCA 3EVQA 1VMCA 4ZKCB 1JCKB 2XIWA 4B08A 3HOXB 3TEYA 4ZUJA 1KDAA 1EQVA 1GUWA 4HEDA 2SDFA 3GTQB 4G7ZC 1QOBA 2EYMA 3SE0A 4N6EB 2SEBD 2A74C 2B8FA 3H0GB 2KDMA 2DBYA 4H7BA 4A3DB 1DXMA 4M8AA 3M3YB 2EYPA 4KGRA 5IOCA 4HKQA 1OXXK 4PT5A 2OT2A 4K2KA 1C78A 4NAWB 1RHPA 1EWYC 1N63A 1HQMC 1L0YB 2N88A 1LTGD 2MEKA 2BYTA 3IL8A 2KACA 1O80A 3P20A 1D5MC 3S1RB 3OIPA 4QF4A 4TQ1A 3VR6A 1I4HA 2A68C 5BMGA 5T8IA 4ARCA 5CV5A 4KN4C 4OZAA 4LAAA 2NTTA 4RGMA 3QB3A 5JEAG 4WAFA 4C1NI 1Q8IA 3GTOB 4NMZA 1JOOA 1ZE3D 4BWGB 2L9HA 1IHZA 1I3QB 4PQXA 4OO1G 1X32A 2KHSA 5EKLA 2AQ3B 1EL0A 3T3OA 1SJED 4PMWA 4XTCS 4NKLA 1DGJA 1I6HB 4MN3A 3RZOB 4CJ2C 4KGTA 2ONQA 3KQ4A 4B0EA 3SVMA 2RDHA 4YTMB 4GLSC 1YMHE 3A55A 3FRPB 4FXGC 1LABA 1SE2A 3NK9A 4HJGE 5COYA 3EUB2 2EYJA 3VA7A 2PW7A 2D5GA 1LT6D 4XQJA 1KLUD 3W3AA 2W54A 2KQ3A 2BT6A 1L0VB 1U4RA 1C8CA 1N62A 3C8YA 1TVXA 2PNRC 4FP5D 2F0TA 2LHEA 1NYRA 1D1IA 2YEPB 4PMCA 5C0XJ 1PFDA 1YNJC 2AWNA 2WACA 5KEEA 1LTAD 3TP6A 3SEBA 4N58A 5IGGA 2F0KA 4KHZA 3SFDB 3U4EG 1OXTA 1HA6A 3NBIA 1DOIA 2PZUA 3P1HA 4DU9A 2KA7A 4A3BB 3K58A 2IPKD 3T51B 1LV9A 3H6MA 2WXPA 2BE5D 3LB8C 1LT3D 5C44B 1Q10A 1FRDA 5KIXA 1TS4A 2SAKA 5CYUA 2LHDA 4TRDA 3HOYB 4ZRZA 5C6AA 1KLGD 3EQLC 1NYQA 1WYGA 2QEJC 3N6RA 3EROA 1A2UA 5D14A 3TP7A 3KLSX 4LJZC 2EY2A 4D2KA 3FKIB 3AE2B 5I2YA 1ET6A 1LTSD 5EKKA 4IKGA 3IKJA 4C3JG 3PUWA 1PMRA 3CU7A 2B2WC 1XLOA 1DM0B 1JROA 1KNAA 1EZ6A 3J7YW 1KH0A 1RDPD 1TYGB 1SSOA 2M2LA 3K5OA 1K83B 1JQYD 4YSXB 4HMJA 2HCIA 5JXVA 1QOAA 1JOKA 4J6HA 2EPBA 4N59A 1CQVA 4OIJA 4KY7A 1Y1VB 2JSOA 2F0EA 2LJIA 2JA8B 1FXIA 1XX8A 5MPOA 2CW0C 3FAHA 2OXPA 3S9WA 4RGNA 3I4LA 1FNVA 2MJEA 2J4XA 1UEAB 3O13A 1WTPA 4XQNA 2SNMA 1RFKA 5CV9A 1CM9A 5I2XA 2K03A 4FXKC 1JWUD 2QDBA 5FO7B 2PZWA 1STGA 2O5JC 2FHTA 1G91A 3TBIB 5BYRA 2MJ8A 5EKIA 3V05A 3EA6A 1H9JA 4KTAA 4RHSA 3AV8A 2R92B 2TSSA 3MA2B 3NWSA 1NEKB 2Y5CA 1T6BX 1H9MA 3GTKB 1G291 2ID0A 5AUIA 2EDGA 3KWVA 1QOFA 2AUKA 3RPFC 3K5NA 4J8QA 2OF1A 4C3IG 3ZYYX 4NW2A 1EU3A 1DD2A 1XCTL 5M5YB 1GAQB 4IUUA 3Q24A 4TMAB 2WXNA 3IAM1 3AECB 4ZOHC 1LACA 3NSWA 1R7SA 4U68A 1JWAD 2W3RA 1UGJA 1B44D 5K36G 2J0TD 5C3EB 5H8YE 2ICEC 3GP7A 4F7XA 1I4XA 5K5PA 1Q12A 1FMAD 1YNNC 2QF7A 4RWSC 3I57A 1O7ZA 3CWIA 1XCQL 2WDRB 4RCOA 2WXLA 1DOLA 2I07B 2H4OA 5KNCA 1D2BA 4E6IA 2DY8A 1HCZA 4ID6A 1PFMA 1BMLC 2RDFA 3AH7A 2FJ2A 2NWGA 4A3IB 5HFYA 1OQRA 2Y3AA 2JA6B 1XLNA 3ND8A 5I6YA 2ZXPA 4PMBA 4OZBA 4JBWA 4K2LA 2F3VA 1F2ZA 1OXVA 2ZXOA 5FOBB 1SSNA 2VNUD 3MAQA 3MXNA 3C1FA 2F0HA 2QMTA 3Q22A 2V4DA 3EJIA 3IAYA 3K0YA 4IUPA 1VDVA 3TP8A 2M56B 1RM6C 1VZ7A 1HFNA 3NVVA 2JZPA 4P6VF 1TS5A 3PO3B 1PYWD 2EJMA 4ZYSA 2QIEB 2CVRA 2RBMA 4GDLB 1AWDA 2VB2X 2EYLA 1T5EA 1TR5A 1PZID 3I9V1 1S5DD 1FCCC 5EPLA 1P7EA 1X3PA 4K8JA 1GB1A 4USAA 2L4NA 4A3KB 4L63B 1OXSC 5E1FA 5C5MA 4A3FB 3Q0AA 2NB0A 5CBAE 5JEAH 1IUEA 3T53B 1ZPSA 2E75C 1TIID 4KV6A 2AX5A 3TEXA 3I4NB 4OO1H 1RTOA 4IZ8A 1YN3A 5IGEA 1SYGA 3EGRA 2K3UA 2VZKB 4RF0A 1QE6A 3ONAB 4ZHOA 1CFMA 3HRDD 4DFAA 2JWUA 3FILA 1PLFA 1ESRA 3HVDA 4F87A 2D2CC 2I38A 1VF7A 1LO5D 5EPKA 1F9RA 2WDQB 3OSOA 2IDYA 2K9XA 3S1MB 3G6JB 4R9WA 1I6VC 1HZ5A 1QILA 3KBXA 1NI3A 2KQ4X 2K01A 2JYOA 4RGTA 2W3SA 3QWNA 1L6UA 1OXUA 2AWOA 5C2TB 2Z8LA 2CQAA 1AP0A 3LWEA 5M3MB 1N61A 3V96A 2DN8A 3Q8BA 3DXJC 2CHBD 1PZJD 1BR9A 5JEAJ 1J9OA 3K6OA 3AN1A 1CZGA 4RKLA 1EEFD 4YIJA 3B2GA 3NHHA 3LWUA 1EYAA 3HKZB 4YSZB 3P4SB 4CBVA 2JEBI 1I4PA 1ZKOA 1CHPD 1GPXA 2B2YC 2BDOA 3HEJA 1V8CA 4KD3A 1SBBB 1DONA 2ZW1A 4RKBA 3HRZC 1E0BA 3TSSA 4FF2A 1BXTA 1MBYA 3E0JA 4MT5A 1XF5L 1J7AA 5E3FA 2CJNA 5CBEE 3AE6B 3NVWA 1STNA 3S1QB 5D65A 3FPUB 2F0VA 2NVQB 3BWUD 1MI2A 1IBXA 4L8JA 5JOBA 2HTME 3IFTA 4JX1C 3VYTA 1IW7D 2SNSA 3MHBA 4RH6A 1STAA 1PUTA 2EOTA 1ZDVA 3CKIB 1B1ZA 4WRDA 2RKSA 2R3ZA 3P4PB