1M94A

Solution structure of the yeast ubiquitin-like modifier protein hub1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MIEVVVNDRLGKKVRVKCLAEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLELYYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Yeast Ubiquitin-Like Modifier Protein Hub1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, signaling protein
molecule keywords Protein YNR032c-a
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1m94A00
4W9CA 3CMMB 1R4NI 2HJ8A 2MBBB 3DVGX 2KTFA 4LDTB 4BVUC 2KXJA 1QZEA 3RT3B 3H7PA 4MGKE 3ZLZA 3ZVVA 2NVUI 2N7EA 3A9JB 1Q0WB 1WYWB 2L05A 1S1QB 2JRHA 2FIDA 4M0WB 2ASQA 3QJZA 2IBIB 1J0GA 4K7WA 3ZRFA 2NBWB 4URKA 2KDIA 2WWZA 1Z5SB 2M4NA 3QWZB 4TKNA 2ZZPB 3ZTCA 2NCNA 1V80A 3PGEA 2AL3A 3DQVA 4AWJA 2PE6B 4OVVA 5D7GA 4DXAB 1OTRB 4MSQB 1SGHA 2V1YA 4DHZB 2D3GA 2N9XA 4MEMA 1WE6A 3L13A 1YIWA 1E8YA 3PT2B 2Y5BB 2CHXA 4NY0A 2O6VD 1JRUA 2DENB 1OQYA 4W9KA 2KC2A 3ZTDA 3KH0A 3IVFA 4II2B 3T8MA 3ZNHB 3VDZA 4MGYE 3B0AA 3ZNZB 3RULA 3VH4B 2BPSA 2GOWA 4HLEA 3A4RA 1D3ZA 3VQIA 2JXXA 4XZ4A 3WAMA 1WX9A 4A20A 3PTFC 2I1KA 2L76A 2LJ5A 3ML9A 4GB9A 4W9JA 4W9EA 4ZRIA 3RZWC 2PEAA 3W1SC 2K8BA 1P1AA 2DYOA 2MBEA 2BYVE 1WH3A 4LJOB 5CX3A 3V6CB 1IP9A 1LM8B 2C7MB 3H9DA 3QQ8B 4IWPA 4DDID 2FCQA 2N4FA 3A9KB 4BOZB 3N30A 3TIXA 3ECIA 3TL5A 2XBBC 5AEKB 5LXIB 1E5WA 2FCSA 2G4DB 4M8NA 1YQBA 3KUDB 2JPHA 1WMHB 2DX5B 2D2QA 3RYTA 4KIKB 1GJZA 1XQQA 2LXCA 4NJ7A 4PS3A 1NDDA 4LCDE 1WXMA 3JSVB 3O65B 1OGWA 1WIAA 2LUEA 3ALBA 4WJNA 3IHPC 2DZIA 3PV1A 3X23A 3EHVA 3AU4A 3OJ4B 3APFA 1U4AA 3VUXA 3DVNU 2BKFA 3APCA 3EC8A 4BKSA 2M17A 2Z0DB 3ZO5B 2KFKB 2KJHB 1MG8A 4JIOU 3PRPB 5HKHA 3C0RB 1UBQA 2D10A 5J2RA 2O2VA 1WXSA 4RM9A 2DZJA 4AUQC 1YJ1A 3DBRI 1XD3B 3Q3FA 2MX2A 4AJYB 2WDTB 1RLFA 3R3MA 4MGZE 2KKCA 2LWPA 2IZVB 4E74A 1V9JA 2KTRA 2ZPYA 3AI5A 2LASA 4GGQA 4WWNA 3UF8A 3L54A 2KQ7A 3V6EB 2L7RA 2KN5A 2FAZA 4ANXA 2FCMA 3KW5B 1WE7A 3VUWA 1UH6A 1WGHA 2MQJA 2RR9A 1WM3A 5D6JB 4WAAA 5E6OA 1Z2MA 4BKSD 1LFDA 4EZJA 2GBKA 3L17A 1V5TA 3RUIB 1WI0A 5AZGA 4FJZA 4TQ0A 4LDTD 4N9F4 4KIKA 4NQLB 1ZGUB 2MSED 1WZ3A 4KSKC 2L0TA 3PLVA 4RM8A 4FJYA 4A3OA 2JY6A 4WJOA 2PJHA 5E6NA 2KJRA 2KK8A 3BINA 3A9KA 2NBUA 1L2NA 2GBNA 2R2OA 3MHSD 3AXCA 4HK2A 1R4MI 2LD9A 2K8CA 2KVRA 4MGIE 1OEYJ 2HD5B 5BO4B 3DCGA 3DPDA 2VRRB 1HE8A 4W9DA 3UIPB 2KLCA 3AU5A 4FULA 5GMVA 2BYFA 2LGXA 4W9LA 4HXDA 4IC7B 3ZRCA 1P9DU 4IM3A 4WWPA 4M8MA 5DCNA 4PS8A 4EZLA 2AL6A 1GNUA 4PS7A 5CHVC 1UELA 3PPAA 4GIVA 5D2MB 4AP4C 4F7ZA 2KDFB 2LI5A 3PSEB 4ANWA 3OAWA 1KLVA 4GDLA 2NR2A 1V86A 1WRDB 2K6QA 3IG3A 2I1JA 2C5LC 4GXBA 3CSTA 3L08A 4WQOB 1GG3A 4KDIC 4JQWC 3V60A 3U8ZA 3R66C 3JW0X 5EDSA 1E8ZA 2LXAA 2CS4A 3PZDA 4GDKB 5L83A 3B1LX 1RAXA 5D94A 1WX7A 3ZDMC 4I6PA 3MTNB 2O6VA 2N9PC 4HDQA 5DPRA 2RPQA 4NAWA 2MWSB 5G55A 4X57B 2BGFA 3PLUA 3R7QA 2WX1A 2KHWB 2KMCA 2KC1A 5L95C 2KX3A 3SHQA 3ZW3A 4EEWA 2J0KA 4GSWA 2ZJDA 5CTRC 4IW0A 3R7RA 3X0WA 1LXDA 3QX1A 4CYEA 2JVCA 4GOCA 2NS5A 3RZFA 3VXWA 1UD7A 3VHTC 2J7QB 2MLBA 2C60A 1SIFA 2GBRA 4ANVA 3LJ3A 2LVOA 2ZNVB 2CKHB 1L7YA 3IBEA 3W1YA 5FR6A 4DHZE 1CMXB 2DYBA 4EZKA 2K8HA 2ZVNA 1E7UA 3KYDD 2MBQA 1OEYA 2KX0A 4RMAA 4CO7A 4PYUA 1J19A 5AZHA 1I42A 2LZ6A 4DDGD 1UZXB 5CHFA 4YL8A 3UGBB 4ZRKA 4DHJD 1TBEA 4W9IA 3WANA 2CR5A 4NNJB 1WGDA 1G6JA 1LQBA 1F9JA 2KQSA 2NPTA 2RSUA 4AJWA 2L0FA 1KM7A 1YX5B 2IO1B 4MDKE 3PHXB 3VFKA 4GDKA 1J8CA 1GC7A 5JHAA 2EKEC 2C7NB 4ZRJA 2LVQA 5KHQA 3HHMA 1EO6A 1VD2A 2IY0B 2LRWA 3SD5A 3DBLI 4FJVB 2REXA 4DK5A 2IO0B 4HCPB 4J6IA 4K1RB 2MCNB 3UIOB 1WGGA 1WJ6A 2JT4B 2OJRA 1KOTA 2MA9B 3ZNGC 4B95A 4JGHB 2ZEQA 2KWCA 2ZVOA 1GC6A 3H7SA 3PS6A 2EMTA 2XK5B 4KSLC 2KFKA 5J18A 3VVWB 5E6PA 2FCNA 1S3SG 3NY5A 4FBJB 2JWZA 3M63B 2V4LA 4B6WA 2LGYA 3ONSA 4BKGA 2KD0A 1WJUA 3TMPB 2RGFA 2KJ6A 4G50A 1E7VA 1E8XA 2G3QB 1WGRA 4I6NB 2K1FA 3PRMB 4II3B 4IM0A 4TQ1A 3W1SA 4DBGA 1WY8A 3N3KB 4IM2A 2Z0EB 4HPMB 3VTWA 3UQAA 1AARA 3L10B 4DHJB 2XEWA 1WMHA 4KZ0A 2KLGA 4PYZA 4NQKE 2K6DB 5DPWA 3S2AA 3DVNV 4MJSA 4MJSB 2IY1B 1BT0A 2LGDA 3LDZE 3P2BA 2AYOB 1TTNA 1WX8A 4HCNB 5G2NA 4EUTA 4F8CB 2O2VB 3HIZA 3T9LA 3V62A 2DAFA 1WGYA 3QK0A 4BFRA 1Y8RC 5C1ZA 1EF1A 4KVGB 3VUYA 4OVUA 5TR5A 3SU8X 4AOFA 3D32A 2KANA 3H1UA 2MBHA 3U7DA 4B9KA 1NI2A 1P98A 2G4SA 2YVCA 2N1WA 4JL9A 3KVFB 4BKTA 2LRUA 2JUOA 4FHJA 1IPGA 4MH0E 2QHOA 4WJPA 2KZRA 2NPTB 2KMAA 3ZKJC 3WAOA 3NZUA 2M1MA 3KUZA 4FA6A 3DBSA 3M62B 4FLHA 4K7UA 5KHOA 1IYFA 1Q5WB 2D11A 2N9EB 4KZCA 2KO3A 3UINB 2K25A 1XT9B 2OOBB 3DOWA 2N1VA 4IWOA 3M95A 3GOEA 4IWQA 4KDLB 3U30A 4EFOA 2KDBA 3M3JA 3L16A 4HDOA 1V2YA 3N32A 3TCAA 3WAPA 2ZPNA 2JRIB 3K9PB 4K7SA 4ICUA 3KYCD 4IG7B 2J0JA 5C23A 2HE7A 3OLMD 3JSVA 3ZUNA 3A1QB 2L3ZA 5JHBA 3A33B 5IA7A 1UBIA 3VTVA 1V49A 3SDLC 1TZ1A 2DAJA 2M0XA 4G11A 3NS8A 3A9JA 1WJNA 4W9FA 4HWIB 4ASWC 3GZNI 1EUVB 4NAWB 3ZDTA 2BWES 2KWVB 2JZZA 4WWOA 4HVBA 4NPNA 2DZMA 5J17A 1X1MA 2CHWA 4EKUA 2GMIC 4BBNC 3ENEA 3NZSA 5JH5C 3PVLA 3L0WB 3WA0A 1YD8U 3HK0A 2GBJA 2BKRB 2FNJB 4BBNF 2MP2A 1T0YA 2EMSA 1VCBA 2KFJA 2GBMA 3IFWB 4NJ6A 1WXVA 4WJQA 3QA8A 4DWFA 1GUAB 3NHEB 4KV2A 3AULA 1Q1OA 4FADA 3ZNID 4K81A 4ICVA 3ZIMA 4W9GA 2UWQA 3PHWB 4JLCA 1H4RA 1WZ0A 3QCAA 2KWUB 3A1QA 2DYMA 3QIJA 1E90A 4GMVA 1K8RB 1SE9A 2O6VB 4E3CA 2BWFA 2B3AA 4FN2A 4HPLB 2YLMA 3DVGY 5LLIA 1V81A 1I35A 4F1SA 1C3TA 1YX6B 4I6LB 2L00B 3RCZA 3QHTA 4P7IA 3VAWA 2PPHA 3WIMA 3KUCB 1V5OA 3APDA 4GDLB 2IO2B 3V61A 3UQBA 3VTUA 4ZYNA 2FIFA 1V6EA 3JVZX 2KOXA 2G45B 4A3PA 3OJ3A 3EECA 3CSFA 2NBVB 2AWTA 2A5UA 2WYQA 4ANUA 3H7PB 2BYEA 2JZ3B 2MRPA 2PE9A 4IUMB 5DPTA 4MSMB 2BF8B 3B08A 3QAQA 2MW5A 3HM6X 5DPSA 1ZKHA 2IO3B 2MBOA 2CU1A 2Z59B 3QARA 1PQSA 1E8WA 4HJKA 2DZKA 4GU2A 2C7HA 3PREA 1M94A 3JYUA 5JZEB 1UGMA 3H6NA 1H8CA 2KNBA 2L8JA 4FHKA 2RD0A 3EFUA 4TUUA 2ZCCA 1WM2A 3I3TB 3ML8A 1WFYA 2AEHA 3K9OB 3PRZA 4MM3A 2CHZA 1TGZB 2W9NA 3CF6E 2K39A 2JF5A 3RD2A 2C9WB 5CHWA 2V3SA 4EOYA 4TV3A 1WR6E 4G3XB 1ZW7A 4E71A 4GN1A 3MJWA 3TBLD 3TJPA 2A4ZA 1C1YB 2UYZB 3Q3JA 4W9HA 1ISNA 4LJPB 1WJ4A 2IYDB 1P3QU 2FUHB 2R2QA 2XK5A 5IAAC 2N7DA 1WF9A 2KTRB 3WALA 2D07B 2J0MA 4BOSC 1EF5A 2ZCBA 3QC8B 1RRBA 3BY4B 3NOBA 2KDEB 4CHKA 4ZDVA 1WR1A 1P0RA 1WXAA 2LVPA 2M8SA 4XX5A 5LXHA 1A5RA 3VH3B 1RFAA 3HM3A 4G0NB 5AZFA 1KJTA 2WX0A 1FXTB 3A4SC 2MP2B 4XC2A 2ZNVC 2HTHA 4MELA 1NBFC 2DHZA 3DBHI 3DDCB
chains in the Genus database with same CATH superfamily
2V0GA 1C4CA 2MBBB 2KTFA 2KXJA 5HI1A 4ZOHC 2NVUI 1Q0WB 2L05A 1S1QB 2MJEA 1ROEA 2WXLA 2IBIB 3Q8FA 3ZRFA 3QWZB 2M4NA 2NCNA 1IBXB 4AWJA 3DQVA 4M02A 4ARCA 4DHZB 2D3GA 3PT2B 2INDC 1JCKB 2CHXA 2WXKA 3J9CA 2D3AA 2V3PA 3KH0A 3IVFA 4II2B 3T8MA 2ICIA 2B76B 1EU3A 5FK9C 4MGYE 1UWXA 3VH4B 1MHHE 3VQIA 1RM6C 3WAMA 2LJ5A 1XLOA 2WXPA 4W9JA 2WDVB 3RZWC 1P1AA 2MBEA 2HTME 2C7MB 3QQ8B 3A9KB 1V1PA 3TL5A 3IAM1 1SEBD 2FCSA 2BQQA 1YQBA 2JPHA 1PGAA 2KWDA 1FRDA 2DX5B 3ZJUA 4YT0B 1XQQA 2LXCA 4NJ7A 4PS3A 1C76A 5EE0A 1OGWA 1SSNA 2BKFA 5D3DA 2Q5WD 1MG8A 3NZ3A 2D10A 1UF0A 1WXSA 4HJGE 4AUQC 1YJ1A 3DBRI 3Q3FA 2WDTB 1RLFA 3R3MA 4FXCA 4E74A 4GGQA 3SFDB 4WWNA 3V6EB 2L7RA 2BB5A 2FAZA 2JQRB 4NJCA 2FCMA 1WYGA 1WE7A 4WAAA 2FE8A 4WH4A 1VJKA 2MJDA 3RNAC 3AV8A 4FJZA 2QSDA 4FJYA 2UU7A 3E56A 1V8CA 2NBUA 2R61A 5BYSA 3RNFC 2BB6A 3DCGA 1HE8A 3UIPB 1ET9A 4KKIA 2LGXA 2WXJA 4HXDA 4IC7B 4WWPA 5DCNA 2G1EA 2V4IB 4EZLA 2MHJA 5CHVC 2VH1A 4ZRPA 4AP4C 4F7ZA 2KDFB 2LI5A 3PSEB 2NR2A 1FFVA 2C5LC 4KDIC 3V60A 3U8ZA 3R66C 1DYQA 1XCTL 4NZLB 4I6PA 2O6VA 2WXHA 4HDQA 4YTNB 2RDGA 2W55A 2KMCA 5L95C 2KX3A 4LTUA 4OZBA 2ZJDA 5CTRC 4IW0A 5BMIA 4XGAB 4CYEA 4A55A 3DHIC 1IUEA 2GBRA 1TYGB 1T6BX 2ZNVB 5FR6A 2LEKA 1CMXB 2DYBA 4EZKA 3BK1A 1E7UA 2CU3A 2MBQA 2KX0A 5AZHA 1L5PA 2BBCA 1UZXB 4M0WA 1D6EC 4N58A 4DHJD 1TBEA 2M56B 4XE0A 3EGRA 1YN3A 3NS1A 1YX5B 3TUOA 3PHXB 3N1YC 5JHAA 4ZRJA 1GB4A 2WDRB 1OQRA 2LRWA 1VD2A 4FJVB 2D3CA 1E9MA 2MCNB 3HVZA 1WGGA 2JT4B 4B95A 2K5PA 1E7PB 3H7SA 4HKZE 4KSLC 3Q8CA 1UGJA 5J18A 1AYFA 4JX1C 1S3SG 3NY5A 3M63B 1JW9D 2LGYA 3ONSA 2IGDA 2WGSA 2WP9B 1E7VA 2IDYA 4WAFA 3W1SA 1WY8A 3VTWA 3IAS1 3H8HA 2RDBC 4DHJB 2XEWA 1VR9A 4KZ0A 4NQKE 2K6DB 5DPWA 1YN4A 3LDZE 1GAQB 4F8CB 1QOBA 3V62A 3QK0A 1EF1A 1JWUD 4KVGB 4OW0A 3VUYA 4N6EB 3D32A 2KANA 2MBHA 1NI2A 2YVCA 2N1WA 3KVFB 4BKTA 1ZPSA 1TJEA 4FHJA 4MH0E 2QHOA 4WJPA 1KF6B 4FA6A 4KZCA 2KO3A 2K25A 1QQRA 3R2IA 4IWOA 4IWQA 4KDLB 1ZDXA 3EFCA 3NVWA 4HDOA 3TCAA 3OG5A 3K9PB 1TT5B 3N20C 2W3SA 3KYCD 2JSVX 2L3ZA 1V49A 5IP4D 3FAHA 1TZ1A 2DAJA 3MHZA 4B0MA 2J4XA 3W5VB 4W9FA 1MPEA 4ASWC 1E10A 1EUVB 2K0PA 4HVBA 4NPNA 3HVDA 5J17A 5EE1A 1FNVA 5JH5C 2VH2A 3PVLA 3HK0A 2FNJB 1SXTA 2EMSA 3IFWB 4ICVA 1ZOYB 2KWUB 4MH8A 3A1QA 2DYMA 3AN1A 1E90A 2O6VB 4XYCA 3ZXRA 4KGTA 2Y3AA 3AEFB 3DVGY 1FNWA 4LLGM 1V81A 2K22A 1YX6B 4I6LB 5EE3A 1FD6A 1D4BA 1V5OA 3URYA 3AEDB 5IKCM 2FIFA 2G45B 2AWTA 3H7PB 2BYEA 3ZXVA 1C79A 4MSMB 2BF8B 2N7JA 2WLBA 2MBOA 4WURA 4HJKA 3Q8AA 1J7AA 5JZEB 3H6NA 4C7ZA 1L6UA 1LGRA 4HKQA 3ML8A 2BT6A 4MM3A 3VR9B 2K39A 2PMVA 2JF5A 3RD2A 1ENFA 5CHWA 2V3SA 4EOYA 2E6XA 2GLSA 2ZW1A 4LJPB 1E0ZA 1P3QU 2I2YA 1WF9A 1JWAD 2D07B 2KVZA 2N0SB 2J0MA 1EF5A 2ZCBA 1ESFA 3NOBA 2WU5B 1WR1A 3VH3B 3N1ZC 5AZFA 1KJTA 3RPFC 1FXTB 4XC2A 4LNNA 2DHZA 4IDIA 1QKZA 4W9CA 3CMMB 3DVGX 4D2KA 2INNE 1L4DB 2W3RA 3RT3B 3ZLZA 3ZVVA 3A9JB 3RNCC 1HTOA 3DBHB 2WS3B 2FIDA 3QJZA 1J0GA 4K7WA 4URKA 1C4AA 1EWYC 2ZZPB 3ZTCA 1V80A 3PGEA 2PE6B 4OVVA 5D7GA 4O1NA 1SGHA 2V1YA 4MEMA 2N9XA 3L13A 3B2GA 1YIWA 2Y5BB 4W9KA 4HROA 1N61A 3AE2B 3MC9A 1XLPA 3VDZA 3RULA 2BPSA 2GOWA 3AEBB 3NVZA 1WX9A 3PTFC 1BMLC 2MEKA 1VDVA 4B0EA 4W9EA 3W1SC 1FM0D 3AE8B 5CX3A 4C00A 1LM8B 3H9DA 1AN8A 2FCQA 2N4FA 4AS1A 2AQ2B 4A8XC 1TIFA 1WMHB 3GE3C 1K53A 2BYTA 1WXMA 3JSVB 1WIAA 2LUEA 3Q3OC 4WJNA 3ETRA 3IHPC 1DGJA 2WXIA 4YSYB 2DZIA 3PV1A 3UI3A 3X23A 3AECB 4C56C 3I63C 3U7ZA 3DVNU 3Q14C 3CWIA 3APCA 4BKSA 4USAA 2KFKB 3DHHC 3LXFA 3PRPB 3C0RB 1UBQA 1JMLA 3ABVB 2MX2A 2N9LA 1I4QA 3AI5A 5E6JA 3L54A 2PLPA 4LNKA 3VUWA 2MQJA 2RR9A 4BKSD 1Z2MA 1LFDA 3RMKC 1V5TA 5AZGA 3Q69A 2BTEA 4KIKA 4NQLB 3V05A 3PLVA 2XNAC 4RM8A 1UNSA 3AEAB 3MC8A 1RYJA 4BZAA 2KK8A 3A9KA 1L2NA 1SJHD 2EKIA 1GPXA 2R2OA 4MGIE 1YJJA 1OEYJ 3DPDA 3AU5A 2Z8LA 1KLGD 2KMMA 1P9DU 4M8MA 3Q6BA 2W54A 1GNUA 4RFBA 5D2MB 4GDLA 3BVGA 3IG3A 2I1JA 4GXBA 2WDQB 3CSTA 2L1AA 4JQWC 1E8ZA 2LXAA 4GDKB 2MJ3A 1GOZA 3B1LX 2N9PC 5DPRA 3E9SA 4C80A 1IBXA 2BGFA 3PLUA 3AH7A 1HTQA 1SF0A 3KWLA 1YJIA 1IGCA 4EEWA 3R7RA 3X0WA 4GOCA 2WXGA 3RZFA 4OZCA 1UD7A 1C78A 4RH6A 4ANVA 3LJ3A 2D3BA 3IBEA 2BW2A 4DHZE 3N1XC 3KYDD 4RMAA 2LZ6A 4DDGD 2VZKD 2HJ1A 4W9IA 1WRIA 3WANA 4NNJB 1WGDA 4A90A 2KQSA 3NVYA 3N9YC 4AJWA 1F2RC 2RDHA 1J8CA 1ACCA 1GC7A 2C7NB 2LVQA 4CQNA 5KHQA 2GRIA 3U4EG 1HQRD 3SD5A 3DBLI 3Q3MC 2REXA 2SEBD 4DK5A 1MHXA 1L0VB 4RGNA 1QOAA 1WJ6A 2OJRA 2MA9B 1N5XA 5AUKA 4A6QA 4US8A 2ZEQA 2KWCA 2ZVOA 1GC6A 2EMTA 3OWEB 4K3CA 1A70A 4S0RA 3VVWB 5E6PA 2JWZA 4B6WA 2KD0A 3TMPB 1M4VA 1E8XA 4I6NB 1WGRA 4IM0A 4IM2A 1HXYD 3C8YA 3PZ8A 2KYWA 4PYZA 2BS4B 3S2AA 1NYRA 1KH0A 2LGDA 1YQ4B 3P2BA 1TTNA 1FFUA 4EUTA 4BFRA 4IKGA 4ACFA 4B9KA 5TR5A 5HHDG 2QC8A 1IPGA 2KMAA 5G5GA 1PDXA 3KUZA 4RGTA 3DBSA 3DBRB 5G5HA 1XT9B 2OOBB 2PTLA 4L1BA 1D5MC 3M95A 4EFOA 2JU6X 3M3JA 2Y5PA 1GB1A 3BVMA 2J0JA 5C23A 4DXFA 2WXMA 3ZUNA 5C3JB 3A33B 1UBIA 4G11A 4LK0M 2WXRA 3NS8A 2VZKB 1YN5A 4NAWB 2KWVB 2DZMA 4EKUA 2CHWA 2GMIC 1TS3A 5EE9A 3BVZA 4K3BA 2GBJA 3AM9A 2BKRB 3ZQ4A 1VCBA 1T0SC 2KFJA 4WJQA 4DWFA 3NHEB 1ZXHA 3ZNID 3ZIMA 4JLCA 1H4RA 1I4GA 2BVCA 4DXGA 3AE5B 4E3CA 2BWFA 4RF1A 5LLIA 4F1SA 3QHTA 2PPHA 3WIMA 3UQBA 3V61A 3RN9C 2CJNA 4MM3B 4ZYNA 2ZW0A 2PW9A 3AE9B 3FILA 3JVZX 3EECA 3CSFA 2WYQA 1ZXIA 5DPTA 2MRPA 2PE9A 4IUMB 3ZYYX 4REZA 2LGSA 3B2FA 3HM6X 5GXGB 4GU2A 2C7HA 3PREA 1QILA 4BAXA 1FMAD 4JE3B 1UGMA 2KNBA 2RD0A 4YWGG 2WXQA 2AEHA 1CQVA 1T0RC 2YEPF 1TGZB 2I38A 3GS2A 1SBBB 1TS4A 2ONQA 2C9WB 4TV3A 1WR6E 1ZW7A 3I9V1 1YNTE 1WSPA 2QEJC 4E71A 4GN1A 4P1CC 2NMQA 3MJWA 1QOFA 3TJPA 1EWCA 1C1YB 2UYZB 1NYQA 3Q3JA 1ISNA 4W9HA 1WJ4A 5IAAC 3P4PB 2N7DA 3QC8B 3IXSA 1RRBA 1C9FA 1P0RA 1WXAA 2M8SA 3Q8BA 2INPE 3U52E 1VZ7A 1NBFC 4RCOA 2PKOA 2HJ8A 4BVUC 2PVOD 3VRBB 4EE2A 5HG2A 4UDUC 4MGKE 5TSSA 1K51A 2KDIA 2WWZA 4TKNA 2AL3A 1OTRB 1XCQL 4IOIE 1LO5D 1WE6A 2WNMA 1HEZE 1E8YA 4WWMA 4NY0A 2O6VD 1JRUA 2DENB 2G9HD 3ZTDA 3IT6B 3ZNHB 1WXQA 1L0YB 2KDMA 4HLEA 3A4RA 1B1ZA 1D3ZA 2RMMA 2JXXA 4XZ4A 1PGBA 4A20A 2LHEA 2L76A 3NUHB 2PEAA 4A9AA 2DYOA 2K3UA 3HUIA 2TSSA 2V9HA 1IP9A 1FXIA 4IWPA 3TIXA 2E3TA 3ECIA 2XBBC 2FUG1 5AEKB 1E5WA 2LHDA 4M8NA 2QILA 3AEEB 1JRPA 3SEBA 3W5UB 3RNBC 2D2QA 3RYTA 1NDDA 2GB1A 3EHVA 3OJ4B 1ZDVA 3VUXA 4ZHOA 4ZHPA 4R3DA 3EC8A 4XDDA 3MP9A 1XF5L 1KLUD 4JIOU 3AE6B 1JALA 5J2RA 2OEDA 4RM9A 4XWTA 4KKJA 1XD3B 4MGZE 4J3OD 1V9JA 2KTRA 2ZPYA 4ZYSA 3Q2AC 1F1HA 1NI3A 4ANXA 2DBYA 1WGHA 5D6JB 4EZJA 5E6OA 1QOGA 3GE8C 2GBKA 3L17A 3RUIB 4TQ0A 2QCZA 1VRAB 1ZGUB 2MSED 1WZ3A 2PIAA 1F52A 2L0TA 4A3OA 1FEHA 4WJOA 2PJHA 5E6NA 2GBNA 2OHFA 1F2RI 1R4MI 1DOYA 1RFKA 2BYFA 2CJOA 4W9LA 3ZRCA 4IM3A 4PS8A 1UELA 3PPAA 4GIVA 4YSZB 1I4PA 2INCC 4YTMB 1OFFA 1V86A 1WRDB 2K6QA 3L08A 4WQOB 1GG3A 3JW0X 2CS4A 3PZDA 5L83A 5MPOA 1XEEA 1RAXA 5D94A 3ZDMC 2WXFA 1TS2A 2RPQA 4NAWA 2MWSB 5G55A 2QDFA 4X57B 1KFYB 1FO4A 2WX1A 2KC1A 2PVGC 1SE2A 1I4RA 3ZW3A 2J0KA 2L83A 1LXDA 3QX1A 1MFWA 2JVCA 2NS5A 3AE1B 1V1PB 4S17A 3VHTC 2J7QB 2C60A 3C19A 1SIFA 1L0XB 4ARIA 4YTPB 1L7YA 1V1OA 1IGDA 1QT9A 2KT7A 2DLBA 1R4MB 4MACA 2ZVNA 1OEYA 4P6VF 2JYEA 4CO7A 4PYUA 3TEWA 1PYWD 5CHFA 4ZRKA 3KQ4A 2KN4A 1LQBA 2LGIA 2RSUA 1KM7A 4MDKE 3VFKA 2EKEC 1K50A 1JWBD 2IY0B 2J42A 1EM7A 3KLSX 4PT5A 4XWWA 1JQ4A 5HFYA 2IO0B 4HCPB 3PZ7A 3ZNGC 4JGHB 4KGSA 3MJ5A 3PS6A 3BK2A 2AX5A 1B9RA 2KFKA 5C2TB 2K9XA 2YEPB 1NVID 3T3OA 1VLBA 2V4LA 2Y5CA 3DHGC 1WJUA 2RGFA 2G3QB 4II3B 3PRMB 4TQ1A 2Z0EB 4HPMB 1AARA 1K52A 1WMHA 3DVNV 4MJSA 5BYRA 3TEXA 5G2NA 1WX8A 2O2VB 3T9LA 1FCCC 1WGYA 4TSSA 2QJLA 5I4DA 4AOFA 3H1UA 1I7HA 3ZGZA 4JL9A 1C4PA 2LRUA 2JUOA 2KZRA 1JWMD 3NZUA 2M1MA 4Q2JA 3M62B 4FLHA 4K7UA 5KHOA 1IYFA 1Q5WB 2N9EB 3UINB 4MT5A 2X8XX 2N1VA 3U30A 2KDBA 3BIID 2LJIA 4LNOA 3L16A 2ZPNA 1FXAA 2QIEB 2JWUA 2MH7A 3JSVA 3A1QB 5JHBA 5IA7A 3SDLC 3NG0A 2LUMA 1STEA 3A9JA 1WJNA 3GZNI 2L32A 2IPKD 1KTKA 3SR6A 1TKEA 3P4QB 1HZ5A 3L4PA 4BBNC 3ENEA 1KRHA 3WA0A 1YD8U 3SFEB 4BBNF 2MP2A 1TS5A 1T0YA 4TMAB 2GBMA 3QA8A 1GUAB 4KV2A 1N6ZA 1Q1OA 2XN9C 4W9GA 1XLQA 2UWQA 3PHWB 1FCLA 1P7FA 2KACA 3QCAA 5AUIA 1ZP0B 2DNFA 4GLSC 2B3AA 4RNAA 2YLMA 1C3TA 2L00B 3RCZA 3VAWA 1R7SA 4HEA1 2IO2B 3GP7A 3VTUA 4DQOC 1FNUA 1V6EA 2WHIA 4A3PA 4YXDB 2NBVB 2A5UA 1MJDA 1V97A 3QAQA 2MW5A 5DPSA 1R4NB 1ZKHA 4H2AA 2CU1A 3QARA 1PQSA 1E8WA 2DZKA 2WQYB 1M94A 3JYUA 4HRSA 2L8JA 4FHKA 4TUUA 3I3TB 1YOVB 2NTSA 3K9OB 3PRZA 1T3QA 2CHZA 1XXGA 4PK1A 1HZ6A 4G3XB 1F0ZA 2AQ3B 1JROA 3DBLB 2A4ZA 2EELA 2IYDB 3FC4A 3GZNB 3RI7C 2KTRB 1UUPA 3WALA 2LFIA 3FKYA 1FRRA 1VZ8A 3BY4B 1A5RA 1RFAA 3HM3A 4G0NB 3A4SC 3RFZB 4M01A 1SIJA 4JPSA 3P4SB 1R4NI 4LDTB 1QZEA 3H7PA 1TKYA 2N7EA 1WYWB 2JRHA 1XO3A 4M0WB 2ASQA 1Q10A 2D5GA 2JXTA 4LNIA 2NBWB 2LMCA 4US9A 1Z5SB 1TKGA 4RGOS 4DXAB 4MSQB 1AW7A 1BXTA 3EA6A 3KWVA 3O13A 1JWSD 1OQYA 2KC2A 1J7BA 2DWQA 3B0AA 3ZNZB 2I1KA 2KAJA 3ML9A 4GB9A 1DOIA 4ZRIA 2K8BA 2BYVE 1WH3A 4LJOB 3V6CB 4P1BC 4DDID 3W9CB 4BOZB 3N30A 2J53A 5LXIB 2G4DB 3CIRB 4YSXB 2KQ4X 3KUDB 4KIKB 1GJZA 5IN7A 2FBWB 3AB5A 1YQ3B 4LCDE 5IO9A 1E6EB 3O65B 3ALBA 2WXOA 3AU4A 2L52A 3APFA 1U4AA 1CK1A 4LNFA 2M17A 2Z0DB 3ZO5B 2KJHB 4HPPA 3GB1A 4OVZA 1P7EA 5HKHA 2O2VA 2DZJA 3PO0A 4AJYB 2KKCA 1ET6A 2LWPA 2IZVB 3RNEC 2LASA 4C7YA 3UF8A 3T3NA 2KQ7A 2ON8A 2KN5A 3KW5B 3BWUD 2IGGA 1UH6A 2X38A 5IOIA 3IT4B 1WM3A 2M0AA 2V3NA 2GI9A 1ZE3D 1WI0A 4XDCA 4LDTD 4N9F4 2JZPA 4P16A 4N59A 4KSKC 5FR3A 2AQ1B 4RF0A 1C77A 1TZOA 3MC0B 2JY6A 4ITKA 1EU4A 2KJRA 3BINA 5BMGA 3EUB2 3MHSD 3AXCA 4HK2A 2LD9A 2K8CA 2KVRA 5BO4B 2HD5B 2VRRB 4W9DA 2KLCA 4FULA 3RNGC 5GMVA 3AE4B 3LB8C 3R8BA 2QMTA 3HRDD 2AL6A 4PS7A 3FILB 3TEZA 3TEYA 4ANWA 3OAWA 1KLVA 1WWTA 3BYYB 5EDSA 2W82A 1ZUD2 1WX7A 1FPYA 3MTNB 1TY0A 5JXVA 3AE7B 3R7QA 2KHWB 2SAKA 2WXNA 3SHQA 3ZJVA 1T0QC 4GSWA 2IJ0A 4L2YA 3VXWA 2MLBA 3Q3NC 3BYTB 1L6VA 2LVOA 3VRAB 2CKHB 3W1YA 1I4XA 2K8HA 2M19A 3B9JA 1J19A 1I42A 4YL8A 3UGBB 4JWUC 4C4VB 2CR5A 1RWSA 1CJEA 1N62A 1G6JA 3AE3B 1F9JA 5D3IB 1D5XC 2NPTA 2L0FA 1L4ZB 2IO1B 1SE4A 4GDKA 3P63A 5LNK1 3I5JC 3HHMA 1EO6A 4QAYA 3AMZA 4J6IA 3LYYA 4K1RB 3UIOB 1KOTA 2ACZB 1N5WA 3AEGB 1MG4A 2XK5B 1XLNA 2IGHA 2FCNA 4FBJB 1PFDA 4BKGA 1FIQA 2KJ6A 4G50A 2K1FA 3I57A 4DBGA 1N63A 1BUIC 3N3KB 5BYQA 3UQAA 3NVVA 3L10B 1PUTA 1TY2A 1CZPA 2KLGA 1OQQA 4MJSB 2IY1B 1BT0A 2BS3B 2AYOB 4HCNB 3HIZA 2DAFA 5C1ZA 3P42A 1Y8RC 1QLBB 3NRZA 4OVUA 3SU8X 3U2SC 3U7DA 2G4SA 1P98A 5H8YE 2HDEA 3DWGC 2RPVA 2NPTB 3ZKJC 3WAOA 1YMHE 2J52A 4RGMA 3ZJTA 4C4VA 1UWMA 3P4RB 2D11A 2NTTA 3DOWA 3GOEA 4KX6B 1V2YA 3N32A 3W2DA 3WAPA 2JRIB 4K7SA 1DOXA 4ICUA 4IG7B 4L23A 2HE7A 2JX5A 2WU2B 3OLMD 3VR8B 4JWSC 3VTVA 2M0XA 4OZAA 5H92C 1J7CA 4HWIB 3ZDTA 1F77A 5T8IA 2BWES 2JZZA 4WWOA 1X1MA 3NZSA 3TSSA 3L0WB 1VZ6A 5FKAC 1D5ZC 1Y56A 2N9KA 1I4HA 4NJ6A 1WXVA 3AULA 4FADA 4K81A 3V3XA 3MFGA 1WZ0A 2OJWA 3QIJA 4GMVA 1K8RB 1SE9A 4WQMA 1AWDA 3WCQA 4FN2A 4HPLB 1SB3C 1I35A 4P7IA 3KUCB 3APDA 4GDLB 3BZDB 3R2TA 2KOXA 1N60A 1PGXA 1WGKA 3OJ3A 1MI0A 4ANUA 2JZ3B 3B08A 1QF6A 3P1MA 1NEKB 2IO3B 2Z59B 2H88B 1MVKA 3NJTA 4AQ7A 4NAMA 1H8CA 3EFUA 2BS2B 1NENB 2ZCCA 1WM2A 1WFYA 4ZRQA 4M00A 2W9NA 3CF6E 5BMHA 3TBLD 1T5XD 3DWMA 2FUHB 2R2QA 2XK5A 2JYTA 1HA5A 3Q8EA 2H89B 4BOSC 1SJED 2KDEB 4CHKA 4ZDVA 2LVPA 5LXHA 4XX5A 4KGRA 4OHJA 2WX0A 2MP2B 4WIPA 2ZNVC 1SE3A 2HTHA 4MELA 3DBHI 3DDCB
chains in the Genus database with same CATH topology
4W9CA 3CMMB 1R4NI 2HJ8A 2MBBB 3DVGX 2KTFA 4LDTB 4BVUC 2KXJA 1QZEA 3RT3B 3H7PA 4MGKE 3ZLZA 3ZVVA 2NVUI 2N7EA 3A9JB 1Q0WB 1WYWB 2L05A 1S1QB 2JRHA 2FIDA 4M0WB 2ASQA 3QJZA 2IBIB 1J0GA 4K7WA 3ZRFA 2NBWB 4URKA 2KDIA 2WWZA 1Z5SB 2M4NA 3QWZB 4TKNA 2ZZPB 3ZTCA 2NCNA 1V80A 3PGEA 2AL3A 3DQVA 4AWJA 2PE6B 4OVVA 5D7GA 4DXAB 1OTRB 4MSQB 1SGHA 2V1YA 4DHZB 2D3GA 2N9XA 4MEMA 1WE6A 3L13A 1YIWA 1E8YA 3PT2B 2Y5BB 2CHXA 4NY0A 2O6VD 1JRUA 2DENB 1OQYA 4W9KA 2KC2A 3ZTDA 3KH0A 3IVFA 4II2B 3T8MA 3ZNHB 3VDZA 4MGYE 3B0AA 3ZNZB 3RULA 3VH4B 2BPSA 2GOWA 4HLEA 3A4RA 1D3ZA 3VQIA 2JXXA 4XZ4A 3WAMA 1WX9A 4A20A 3PTFC 2I1KA 2L76A 2LJ5A 3ML9A 4GB9A 4W9JA 4W9EA 4ZRIA 3RZWC 2PEAA 3W1SC 2K8BA 1P1AA 2DYOA 2MBEA 2BYVE 1WH3A 4LJOB 5CX3A 3V6CB 1IP9A 1LM8B 2C7MB 3H9DA 3QQ8B 4IWPA 4DDID 2FCQA 2N4FA 3A9KB 4BOZB 3N30A 3TIXA 3ECIA 3TL5A 2XBBC 5AEKB 5LXIB 1E5WA 2FCSA 2G4DB 4M8NA 1YQBA 3KUDB 2JPHA 1WMHB 2DX5B 2D2QA 3RYTA 4KIKB 1GJZA 1XQQA 2LXCA 4NJ7A 4PS3A 1NDDA 4LCDE 1WXMA 3JSVB 3O65B 1OGWA 1WIAA 2LUEA 3ALBA 4WJNA 3IHPC 2DZIA 3PV1A 3X23A 3EHVA 3AU4A 3OJ4B 3APFA 1U4AA 3VUXA 3DVNU 2BKFA 3APCA 3EC8A 4BKSA 2M17A 2Z0DB 3ZO5B 2KFKB 2KJHB 1MG8A 4JIOU 3PRPB 5HKHA 3C0RB 1UBQA 2D10A 5J2RA 2O2VA 1WXSA 4RM9A 2DZJA 4AUQC 1YJ1A 3DBRI 1XD3B 3Q3FA 2MX2A 4AJYB 2WDTB 1RLFA 3R3MA 4MGZE 2KKCA 2LWPA 2IZVB 4E74A 1V9JA 2KTRA 2ZPYA 3AI5A 2LASA 4GGQA 4WWNA 3UF8A 3L54A 2KQ7A 3V6EB 2L7RA 2KN5A 2FAZA 4ANXA 2FCMA 3KW5B 1WE7A 3VUWA 1UH6A 1WGHA 2MQJA 2RR9A 1WM3A 5D6JB 4WAAA 5E6OA 1Z2MA 4BKSD 1LFDA 4EZJA 2GBKA 3L17A 1V5TA 3RUIB 1WI0A 5AZGA 4FJZA 4TQ0A 4LDTD 4N9F4 4KIKA 4NQLB 1ZGUB 2MSED 1WZ3A 4KSKC 2L0TA 3PLVA 4RM8A 4FJYA 4A3OA 2JY6A 4WJOA 2PJHA 5E6NA 2KJRA 2KK8A 3BINA 3A9KA 2NBUA 1L2NA 2GBNA 2R2OA 3MHSD 3AXCA 4HK2A 1R4MI 2LD9A 2K8CA 2KVRA 4MGIE 1OEYJ 2HD5B 5BO4B 3DCGA 3DPDA 2VRRB 1HE8A 4W9DA 3UIPB 2KLCA 3AU5A 4FULA 5GMVA 2BYFA 2LGXA 4W9LA 4HXDA 4IC7B 3ZRCA 1P9DU 4IM3A 4WWPA 4M8MA 5DCNA 4PS8A 4EZLA 2AL6A 1GNUA 4PS7A 5CHVC 1UELA 3PPAA 4GIVA 5D2MB 4AP4C 4F7ZA 2KDFB 2LI5A 3PSEB 4ANWA 3OAWA 1KLVA 4GDLA 2NR2A 1V86A 1WRDB 2K6QA 3IG3A 2I1JA 2C5LC 4GXBA 3CSTA 3L08A 4WQOB 1GG3A 4KDIC 4JQWC 3V60A 3U8ZA 3R66C 3JW0X 5EDSA 1E8ZA 2LXAA 2CS4A 3PZDA 4GDKB 5L83A 3B1LX 1RAXA 5D94A 1WX7A 3ZDMC 4I6PA 3MTNB 2O6VA 2N9PC 4HDQA 5DPRA 2RPQA 4NAWA 2MWSB 5G55A 4X57B 2BGFA 3PLUA 3R7QA 2WX1A 2KHWB 2KMCA 2KC1A 5L95C 2KX3A 3SHQA 3ZW3A 4EEWA 2J0KA 4GSWA 2ZJDA 5CTRC 4IW0A 3R7RA 3X0WA 1LXDA 3QX1A 4CYEA 2JVCA 4GOCA 2NS5A 3RZFA 3VXWA 1UD7A 3VHTC 2J7QB 2MLBA 2C60A 1SIFA 2GBRA 4ANVA 3LJ3A 2LVOA 2ZNVB 2CKHB 1L7YA 3IBEA 3W1YA 5FR6A 4DHZE 1CMXB 2DYBA 4EZKA 2K8HA 2ZVNA 1E7UA 3KYDD 2MBQA 1OEYA 2KX0A 4RMAA 4CO7A 4PYUA 1J19A 5AZHA 1I42A 2LZ6A 4DDGD 1UZXB 5CHFA 4YL8A 3UGBB 4ZRKA 4DHJD 1TBEA 4W9IA 3WANA 2CR5A 4NNJB 1WGDA 1G6JA 1LQBA 1F9JA 2KQSA 2NPTA 2RSUA 4AJWA 2L0FA 1KM7A 1YX5B 2IO1B 4MDKE 3PHXB 3VFKA 4GDKA 1J8CA 1GC7A 5JHAA 2EKEC 2C7NB 4ZRJA 2LVQA 5KHQA 3HHMA 1EO6A 1VD2A 2IY0B 2LRWA 3SD5A 3DBLI 4FJVB 2REXA 4DK5A 2IO0B 4HCPB 4J6IA 4K1RB 2MCNB 3UIOB 1WGGA 1WJ6A 2JT4B 2OJRA 1KOTA 2MA9B 3ZNGC 4B95A 4JGHB 2ZEQA 2KWCA 2ZVOA 1GC6A 3H7SA 3PS6A 2EMTA 2XK5B 4KSLC 2KFKA 5J18A 3VVWB 5E6PA 2FCNA 1S3SG 3NY5A 4FBJB 2JWZA 3M63B 2V4LA 4B6WA 2LGYA 3ONSA 4BKGA 2KD0A 1WJUA 3TMPB 2RGFA 2KJ6A 4G50A 1E7VA 1E8XA 2G3QB 1WGRA 4I6NB 2K1FA 3PRMB 4II3B 4IM0A 4TQ1A 3W1SA 4DBGA 1WY8A 3N3KB 4IM2A 2Z0EB 4HPMB 3VTWA 3UQAA 1AARA 3L10B 4DHJB 2XEWA 1WMHA 4KZ0A 2KLGA 4PYZA 4NQKE 2K6DB 5DPWA 3S2AA 3DVNV 4MJSA 4MJSB 2IY1B 1BT0A 2LGDA 3LDZE 3P2BA 2AYOB 1TTNA 1WX8A 4HCNB 5G2NA 4EUTA 4F8CB 2O2VB 3HIZA 3T9LA 3V62A 2DAFA 1WGYA 3QK0A 4BFRA 1Y8RC 5C1ZA 1EF1A 4KVGB 3VUYA 4OVUA 5TR5A 3SU8X 4AOFA 3D32A 2KANA 3H1UA 2MBHA 3U7DA 4B9KA 1NI2A 1P98A 2G4SA 2YVCA 2N1WA 4JL9A 3KVFB 4BKTA 2LRUA 2JUOA 4FHJA 1IPGA 4MH0E 2QHOA 4WJPA 2KZRA 2NPTB 2KMAA 3ZKJC 3WAOA 3NZUA 2M1MA 3KUZA 4FA6A 3DBSA 3M62B 4FLHA 4K7UA 5KHOA 1IYFA 1Q5WB 2D11A 2N9EB 4KZCA 2KO3A 3UINB 2K25A 1XT9B 2OOBB 3DOWA 2N1VA 4IWOA 3M95A 3GOEA 4IWQA 4KDLB 3U30A 4EFOA 2KDBA 3M3JA 3L16A 4HDOA 1V2YA 3N32A 3TCAA 3WAPA 2ZPNA 2JRIB 3K9PB 4K7SA 4ICUA 3KYCD 4IG7B 2J0JA 5C23A 2HE7A 3OLMD 3JSVA 3ZUNA 3A1QB 2L3ZA 5JHBA 3A33B 5IA7A 1UBIA 3VTVA 1V49A 3SDLC 1TZ1A 2DAJA 2M0XA 4G11A 3NS8A 3A9JA 1WJNA 4W9FA 4HWIB 4ASWC 3GZNI 1EUVB 4NAWB 3ZDTA 2BWES 2KWVB 2JZZA 4WWOA 4HVBA 4NPNA 2DZMA 5J17A 1X1MA 2CHWA 4EKUA 2GMIC 4BBNC 3ENEA 3NZSA 5JH5C 3PVLA 3L0WB 3WA0A 1YD8U 3HK0A 2GBJA 2BKRB 2FNJB 4BBNF 2MP2A 1T0YA 2EMSA 1VCBA 2KFJA 2GBMA 3IFWB 4NJ6A 1WXVA 4WJQA 3QA8A 4DWFA 1GUAB 3NHEB 4KV2A 3AULA 1Q1OA 4FADA 3ZNID 4K81A 4ICVA 3ZIMA 4W9GA 2UWQA 3PHWB 4JLCA 1H4RA 1WZ0A 3QCAA 2KWUB 3A1QA 2DYMA 3QIJA 1E90A 4GMVA 1K8RB 1SE9A 2O6VB 4E3CA 2BWFA 2B3AA 4FN2A 4HPLB 2YLMA 3DVGY 5LLIA 1V81A 1I35A 4F1SA 1C3TA 1YX6B 4I6LB 2L00B 3RCZA 3QHTA 4P7IA 3VAWA 2PPHA 3WIMA 3KUCB 1V5OA 3APDA 4GDLB 2IO2B 3V61A 3UQBA 3VTUA 4ZYNA 2FIFA 1V6EA 3JVZX 2KOXA 2G45B 4A3PA 3OJ3A 3EECA 3CSFA 2NBVB 2AWTA 2A5UA 2WYQA 4ANUA 3H7PB 2BYEA 2JZ3B 2MRPA 2PE9A 4IUMB 5DPTA 4MSMB 2BF8B 3B08A 3QAQA 2MW5A 3HM6X 5DPSA 1ZKHA 2IO3B 2MBOA 2CU1A 2Z59B 3QARA 1PQSA 1E8WA 4HJKA 2DZKA 4GU2A 2C7HA 3PREA 1M94A 3JYUA 5JZEB 1UGMA 3H6NA 1H8CA 2KNBA 2L8JA 4FHKA 2RD0A 3EFUA 4TUUA 2ZCCA 1WM2A 3I3TB 3ML8A 1WFYA 2AEHA 3K9OB 3PRZA 4MM3A 2CHZA 1TGZB 2W9NA 3CF6E 2K39A 2JF5A 3RD2A 2C9WB 5CHWA 2V3SA 4EOYA 4TV3A 1WR6E 4G3XB 1ZW7A 4E71A 4GN1A 3MJWA 3TBLD 3TJPA 2A4ZA 1C1YB 2UYZB 3Q3JA 4W9HA 1ISNA 4LJPB 1WJ4A 2IYDB 1P3QU 2FUHB 2R2QA 2XK5A 5IAAC 2N7DA 1WF9A 2KTRB 3WALA 2D07B 2J0MA 4BOSC 1EF5A 2ZCBA 3QC8B 1RRBA 3BY4B 3NOBA 2KDEB 4CHKA 4ZDVA 1WR1A 1P0RA 1WXAA 2LVPA 2M8SA 4XX5A 5LXHA 1A5RA 3VH3B 1RFAA 3HM3A 4G0NB 5AZFA 1KJTA 2WX0A 1FXTB 3A4SC 2MP2B 4XC2A 2ZNVC 2HTHA 4MELA 1NBFC 2DHZA 3DBHI 3DDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9C A;  3CMM B;  1R4N I;  2HJ8 A;  2MBB B;  3DVG X;  2KTF A;  4LDT B;  4BVU C;  2KXJ A;  1QZE A;  3RT3 B;  3H7P A;  4MGK E;  3ZLZ A;  3ZVV A;  2NVU I;  2N7E A;  3A9J B;  1Q0W B;  1WYW B;  2L05 A;  1S1Q B;  2JRH A;  2FID A;  4M0W B;  2ASQ A;  3QJZ A;  2IBI B;  1J0G A;  4K7W A;  3ZRF A;  2NBW B;  4URK A;  2KDI A;  2WWZ A;  1Z5S B;  2M4N A;  3QWZ B;  4TKN A;  2ZZP B;  3ZTC A;  2NCN A;  1V80 A;  3PGE A;  2AL3 A;  3DQV A;  4AWJ A;  2PE6 B;  4OVV A;  5D7G A;  4DXA B;  1OTR B;  4MSQ B;  1SGH A;  2V1Y A;  4DHZ B;  2D3G A;  2N9X A;  4MEM A;  1WE6 A;  3L13 A;  1YIW A;  1E8Y A;  3PT2 B;  2Y5B B;  2CHX A;  4NY0 A;  2O6V D;  1JRU A;  2DEN B;  1OQY A;  4W9K A;  2KC2 A;  3ZTD A;  3KH0 A;  3IVF A;  4II2 B;  3T8M A;  3ZNH B;  3VDZ A;  4MGY E;  3B0A A;  3ZNZ B;  3RUL A;  3VH4 B;  2BPS A;  2GOW A;  4HLE A;  3A4R A;  1D3Z A;  3VQI A;  2JXX A;  4XZ4 A;  3WAM A;  1WX9 A;  4A20 A;  3PTF C;  2I1K A;  2L76 A;  2LJ5 A;  3ML9 A;  4GB9 A;  4W9J A;  4W9E A;  4ZRI A;  3RZW C;  2PEA A;  3W1S C;  2K8B A;  1P1A A;  2DYO A;  2MBE A;  2BYV E;  1WH3 A;  4LJO B;  5CX3 A;  3V6C B;  1IP9 A;  1LM8 B;  2C7M B;  3H9D A;  3QQ8 B;  4IWP A;  4DDI D;  2FCQ A;  2N4F A;  3A9K B;  4BOZ B;  3N30 A;  3TIX A;  3ECI A;  3TL5 A;  2XBB C;  5AEK B;  5LXI B;  1E5W A;  2FCS A;  2G4D B;  4M8N A;  1YQB A;  3KUD B;  2JPH A;  1WMH B;  2DX5 B;  2D2Q A;  3RYT A;  4KIK B;  1GJZ A;  1XQQ A;  2LXC A;  4NJ7 A;  4PS3 A;  1NDD A;  4LCD E;  1WXM A;  3JSV B;  3O65 B;  1OGW A;  1WIA A;  2LUE A;  3ALB A;  4WJN A;  3IHP C;  2DZI A;  3PV1 A;  3X23 A;  3EHV A;  3AU4 A;  3OJ4 B;  3APF A;  1U4A A;  3VUX A;  3DVN U;  2BKF A;  3APC A;  3EC8 A;  4BKS A;  2M17 A;  2Z0D B;  3ZO5 B;  2KFK B;  2KJH B;  1MG8 A;  4JIO U;  3PRP B;  5HKH A;  3C0R B;  1UBQ A;  2D10 A;  5J2R A;  2O2V A;  1WXS A;  4RM9 A;  2DZJ A;  4AUQ C;  1YJ1 A;  3DBR I;  1XD3 B;  3Q3F A;  2MX2 A;  4AJY B;  2WDT B;  1RLF A;  3R3M A;  4MGZ E;  2KKC A;  2LWP A;  2IZV B;  4E74 A;  1V9J A;  2KTR A;  2ZPY A;  3AI5 A;  2LAS A;  4GGQ A;  4WWN A;  3UF8 A;  3L54 A;  2KQ7 A;  3V6E B;  2L7R A;  2KN5 A;  2FAZ A;  4ANX A;  2FCM A;  3KW5 B;  1WE7 A;  3VUW A;  1UH6 A;  1WGH A;  2MQJ A;  2RR9 A;  1WM3 A;  5D6J B;  4WAA A;  5E6O A;  1Z2M A;  4BKS D;  1LFD A;  4EZJ A;  2GBK A;  3L17 A;  1V5T A;  3RUI B;  1WI0 A;  5AZG A;  4FJZ A;  4TQ0 A;  4LDT D;  4N9F 4;  4KIK A;  4NQL B;  1ZGU B;  2MSE D;  1WZ3 A;  4KSK C;  2L0T A;  3PLV A;  4RM8 A;  4FJY A;  4A3O A;  2JY6 A;  4WJO A;  2PJH A;  5E6N A;  2KJR A;  2KK8 A;  3BIN A;  3A9K A;  2NBU A;  1L2N A;  2GBN A;  2R2O A;  3MHS D;  3AXC A;  4HK2 A;  1R4M I;  2LD9 A;  2K8C A;  2KVR A;  4MGI E;  1OEY J;  2HD5 B;  5BO4 B;  3DCG A;  3DPD A;  2VRR B;  1HE8 A;  4W9D A;  3UIP B;  2KLC A;  3AU5 A;  4FUL A;  5GMV A;  2BYF A;  2LGX A;  4W9L A;  4HXD A;  4IC7 B;  3ZRC A;  1P9D U;  4IM3 A;  4WWP A;  4M8M A;  5DCN A;  4PS8 A;  4EZL A;  2AL6 A;  1GNU A;  4PS7 A;  5CHV C;  1UEL A;  3PPA A;  4GIV A;  5D2M B;  4AP4 C;  4F7Z A;  2KDF B;  2LI5 A;  3PSE B;  4ANW A;  3OAW A;  1KLV A;  4GDL A;  2NR2 A;  1V86 A;  1WRD B;  2K6Q A;  3IG3 A;  2I1J A;  2C5L C;  4GXB A;  3CST A;  3L08 A;  4WQO B;  1GG3 A;  4KDI C;  4JQW C;  3V60 A;  3U8Z A;  3R66 C;  3JW0 X;  5EDS A;  1E8Z A;  2LXA A;  2CS4 A;  3PZD A;  4GDK B;  5L83 A;  3B1L X;  1RAX A;  5D94 A;  1WX7 A;  3ZDM C;  4I6P A;  3MTN B;  2O6V A;  2N9P C;  4HDQ A;  5DPR A;  2RPQ A;  4NAW A;  2MWS B;  5G55 A;  4X57 B;  2BGF A;  3PLU A;  3R7Q A;  2WX1 A;  2KHW B;  2KMC A;  2KC1 A;  5L95 C;  2KX3 A;  3SHQ A;  3ZW3 A;  4EEW A;  2J0K A;  4GSW A;  2ZJD A;  5CTR C;  4IW0 A;  3R7R A;  3X0W A;  1LXD A;  3QX1 A;  4CYE A;  2JVC A;  4GOC A;  2NS5 A;  3RZF A;  3VXW A;  1UD7 A;  3VHT C;  2J7Q B;  2MLB A;  2C60 A;  1SIF A;  2GBR A;  4ANV A;  3LJ3 A;  2LVO A;  2ZNV B;  2CKH B;  1L7Y A;  3IBE A;  3W1Y A;  5FR6 A;  4DHZ E;  1CMX B;  2DYB A;  4EZK A;  2K8H A;  2ZVN A;  1E7U A;  3KYD D;  2MBQ A;  1OEY A;  2KX0 A;  4RMA A;  4CO7 A;  4PYU A;  1J19 A;  5AZH A;  1I42 A;  2LZ6 A;  4DDG D;  1UZX B;  5CHF A;  4YL8 A;  3UGB B;  4ZRK A;  4DHJ D;  1TBE A;  4W9I A;  3WAN A;  2CR5 A;  4NNJ B;  1WGD A;  1G6J A;  1LQB A;  1F9J A;  2KQS A;  2NPT A;  2RSU A;  4AJW A;  2L0F A;  1KM7 A;  1YX5 B;  2IO1 B;  4MDK E;  3PHX B;  3VFK A;  4GDK A;  1J8C A;  1GC7 A;  5JHA A;  2EKE C;  2C7N B;  4ZRJ A;  2LVQ A;  5KHQ A;  3HHM A;  1EO6 A;  1VD2 A;  2IY0 B;  2LRW A;  3SD5 A;  3DBL I;  4FJV B;  2REX A;  4DK5 A;  2IO0 B;  4HCP B;  4J6I A;  4K1R B;  2MCN B;  3UIO B;  1WGG A;  1WJ6 A;  2JT4 B;  2OJR A;  1KOT A;  2MA9 B;  3ZNG C;  4B95 A;  4JGH B;  2ZEQ A;  2KWC A;  2ZVO A;  1GC6 A;  3H7S A;  3PS6 A;  2EMT A;  2XK5 B;  4KSL C;  2KFK A;  5J18 A;  3VVW B;  5E6P A;  2FCN A;  1S3S G;  3NY5 A;  4FBJ B;  2JWZ A;  3M63 B;  2V4L A;  4B6W A;  2LGY A;  3ONS A;  4BKG A;  2KD0 A;  1WJU A;  3TMP B;  2RGF A;  2KJ6 A;  4G50 A;  1E7V A;  1E8X A;  2G3Q B;  1WGR A;  4I6N B;  2K1F A;  3PRM B;  4II3 B;  4IM0 A;  4TQ1 A;  3W1S A;  4DBG A;  1WY8 A;  3N3K B;  4IM2 A;  2Z0E B;  4HPM B;  3VTW A;  3UQA A;  1AAR A;  3L10 B;  4DHJ B;  2XEW A;  1WMH A;  4KZ0 A;  2KLG A;  4PYZ A;  4NQK E;  2K6D B;  5DPW A;  3S2A A;  3DVN V;  4MJS A;  4MJS B;  2IY1 B;  1BT0 A;  2LGD A;  3LDZ E;  3P2B A;  2AYO B;  1TTN A;  1WX8 A;  4HCN B;  5G2N A;  4EUT A;  4F8C B;  2O2V B;  3HIZ A;  3T9L A;  3V62 A;  2DAF A;  1WGY A;  3QK0 A;  4BFR A;  1Y8R C;  5C1Z A;  1EF1 A;  4KVG B;  3VUY A;  4OVU A;  5TR5 A;  3SU8 X;  4AOF A;  3D32 A;  2KAN A;  3H1U A;  2MBH A;  3U7D A;  4B9K A;  1NI2 A;  1P98 A;  2G4S A;  2YVC A;  2N1W A;  4JL9 A;  3KVF B;  4BKT A;  2LRU A;  2JUO A;  4FHJ A;  1IPG A;  4MH0 E;  2QHO A;  4WJP A;  2KZR A;  2NPT B;  2KMA A;  3ZKJ C;  3WAO A;  3NZU A;  2M1M A;  3KUZ A;  4FA6 A;  3DBS A;  3M62 B;  4FLH A;  4K7U A;  5KHO A;  1IYF A;  1Q5W B;  2D11 A;  2N9E B;  4KZC A;  2KO3 A;  3UIN B;  2K25 A;  1XT9 B;  2OOB B;  3DOW A;  2N1V A;  4IWO A;  3M95 A;  3GOE A;  4IWQ A;  4KDL B;  3U30 A;  4EFO A;  2KDB A;  3M3J A;  3L16 A;  4HDO A;  1V2Y A;  3N32 A;  3TCA A;  3WAP A;  2ZPN A;  2JRI B;  3K9P B;  4K7S A;  4ICU A;  3KYC D;  4IG7 B;  2J0J A;  5C23 A;  2HE7 A;  3OLM D;  3JSV A;  3ZUN A;  3A1Q B;  2L3Z A;  5JHB A;  3A33 B;  5IA7 A;  1UBI A;  3VTV A;  1V49 A;  3SDL C;  1TZ1 A;  2DAJ A;  2M0X A;  4G11 A;  3NS8 A;  3A9J A;  1WJN A;  4W9F A;  4HWI B;  4ASW C;  3GZN I;  1EUV B;  4NAW B;  3ZDT A;  2BWE S;  2KWV B;  2JZZ A;  4WWO A;  4HVB A;  4NPN A;  2DZM A;  5J17 A;  1X1M A;  2CHW A;  4EKU A;  2GMI C;  4BBN C;  3ENE A;  3NZS A;  5JH5 C;  3PVL A;  3L0W B;  3WA0 A;  1YD8 U;  3HK0 A;  2GBJ A;  2BKR B;  2FNJ B;  4BBN F;  2MP2 A;  1T0Y A;  2EMS A;  1VCB A;  2KFJ A;  2GBM A;  3IFW B;  4NJ6 A;  1WXV A;  4WJQ A;  3QA8 A;  4DWF A;  1GUA B;  3NHE B;  4KV2 A;  3AUL A;  1Q1O A;  4FAD A;  3ZNI D;  4K81 A;  4ICV A;  3ZIM A;  4W9G A;  2UWQ A;  3PHW B;  4JLC A;  1H4R A;  1WZ0 A;  3QCA A;  2KWU B;  3A1Q A;  2DYM A;  3QIJ A;  1E90 A;  4GMV A;  1K8R B;  1SE9 A;  2O6V B;  4E3C A;  2BWF A;  2B3A A;  4FN2 A;  4HPL B;  2YLM A;  3DVG Y;  5LLI A;  1V81 A;  1I35 A;  4F1S A;  1C3T A;  1YX6 B;  4I6L B;  2L00 B;  3RCZ A;  3QHT A;  4P7I A;  3VAW A;  2PPH A;  3WIM A;  3KUC B;  1V5O A;  3APD A;  4GDL B;  2IO2 B;  3V61 A;  3UQB A;  3VTU A;  4ZYN A;  2FIF A;  1V6E A;  3JVZ X;  2KOX A;  2G45 B;  4A3P A;  3OJ3 A;  3EEC A;  3CSF A;  2NBV B;  2AWT A;  2A5U A;  2WYQ A;  4ANU A;  3H7P B;  2BYE A;  2JZ3 B;  2MRP A;  2PE9 A;  4IUM B;  5DPT A;  4MSM B;  2BF8 B;  3B08 A;  3QAQ A;  2MW5 A;  3HM6 X;  5DPS A;  1ZKH A;  2IO3 B;  2MBO A;  2CU1 A;  2Z59 B;  3QAR A;  1PQS A;  1E8W A;  4HJK A;  2DZK A;  4GU2 A;  2C7H A;  3PRE A;  1M94 A;  3JYU A;  5JZE B;  1UGM A;  3H6N A;  1H8C A;  2KNB A;  2L8J A;  4FHK A;  2RD0 A;  3EFU A;  4TUU A;  2ZCC A;  1WM2 A;  3I3T B;  3ML8 A;  1WFY A;  2AEH A;  3K9O B;  3PRZ A;  4MM3 A;  2CHZ A;  1TGZ B;  2W9N A;  3CF6 E;  2K39 A;  2JF5 A;  3RD2 A;  2C9W B;  5CHW A;  2V3S A;  4EOY A;  4TV3 A;  1WR6 E;  4G3X B;  1ZW7 A;  4E71 A;  4GN1 A;  3MJW A;  3TBL D;  3TJP A;  2A4Z A;  1C1Y B;  2UYZ B;  3Q3J A;  4W9H A;  1ISN A;  4LJP B;  1WJ4 A;  2IYD B;  1P3Q U;  2FUH B;  2R2Q A;  2XK5 A;  5IAA C;  2N7D A;  1WF9 A;  2KTR B;  3WAL A;  2D07 B;  2J0M A;  4BOS C;  1EF5 A;  2ZCB A;  3QC8 B;  1RRB A;  3BY4 B;  3NOB A;  2KDE B;  4CHK A;  4ZDV A;  1WR1 A;  1P0R A;  1WXA A;  2LVP A;  2M8S A;  4XX5 A;  5LXH A;  1A5R A;  3VH3 B;  1RFA A;  3HM3 A;  4G0N B;  5AZF A;  1KJT A;  2WX0 A;  1FXT B;  3A4S C;  2MP2 B;  4XC2 A;  2ZNV C;  2HTH A;  4MEL A;  1NBF C;  2DHZ A;  3DBH I;  3DDC B; 
#chains in the Genus database with same CATH topology
 2V0G A;  1C4C A;  2MBB B;  2KTF A;  2KXJ A;  5HI1 A;  4ZOH C;  2NVU I;  1Q0W B;  2L05 A;  1S1Q B;  2MJE A;  1ROE A;  2WXL A;  2IBI B;  3Q8F A;  3ZRF A;  3QWZ B;  2M4N A;  2NCN A;  1IBX B;  4AWJ A;  3DQV A;  4M02 A;  4ARC A;  4DHZ B;  2D3G A;  3PT2 B;  2IND C;  1JCK B;  2CHX A;  2WXK A;  3J9C A;  2D3A A;  2V3P A;  3KH0 A;  3IVF A;  4II2 B;  3T8M A;  2ICI A;  2B76 B;  1EU3 A;  5FK9 C;  4MGY E;  1UWX A;  3VH4 B;  1MHH E;  3VQI A;  1RM6 C;  3WAM A;  2LJ5 A;  1XLO A;  2WXP A;  4W9J A;  2WDV B;  3RZW C;  1P1A A;  2MBE A;  2HTM E;  2C7M B;  3QQ8 B;  3A9K B;  1V1P A;  3TL5 A;  3IAM 1;  1SEB D;  2FCS A;  2BQQ A;  1YQB A;  2JPH A;  1PGA A;  2KWD A;  1FRD A;  2DX5 B;  3ZJU A;  4YT0 B;  1XQQ A;  2LXC A;  4NJ7 A;  4PS3 A;  1C76 A;  5EE0 A;  1OGW A;  1SSN A;  2BKF A;  5D3D A;  2Q5W D;  1MG8 A;  3NZ3 A;  2D10 A;  1UF0 A;  1WXS A;  4HJG E;  4AUQ C;  1YJ1 A;  3DBR I;  3Q3F A;  2WDT B;  1RLF A;  3R3M A;  4FXC A;  4E74 A;  4GGQ A;  3SFD B;  4WWN A;  3V6E B;  2L7R A;  2BB5 A;  2FAZ A;  2JQR B;  4NJC A;  2FCM A;  1WYG A;  1WE7 A;  4WAA A;  2FE8 A;  4WH4 A;  1VJK A;  2MJD A;  3RNA C;  3AV8 A;  4FJZ A;  2QSD A;  4FJY A;  2UU7 A;  3E56 A;  1V8C A;  2NBU A;  2R61 A;  5BYS A;  3RNF C;  2BB6 A;  3DCG A;  1HE8 A;  3UIP B;  1ET9 A;  4KKI A;  2LGX A;  2WXJ A;  4HXD A;  4IC7 B;  4WWP A;  5DCN A;  2G1E A;  2V4I B;  4EZL A;  2MHJ A;  5CHV C;  2VH1 A;  4ZRP A;  4AP4 C;  4F7Z A;  2KDF B;  2LI5 A;  3PSE B;  2NR2 A;  1FFV A;  2C5L C;  4KDI C;  3V60 A;  3U8Z A;  3R66 C;  1DYQ A;  1XCT L;  4NZL B;  4I6P A;  2O6V A;  2WXH A;  4HDQ A;  4YTN B;  2RDG A;  2W55 A;  2KMC A;  5L95 C;  2KX3 A;  4LTU A;  4OZB A;  2ZJD A;  5CTR C;  4IW0 A;  5BMI A;  4XGA B;  4CYE A;  4A55 A;  3DHI C;  1IUE A;  2GBR A;  1TYG B;  1T6B X;  2ZNV B;  5FR6 A;  2LEK A;  1CMX B;  2DYB A;  4EZK A;  3BK1 A;  1E7U A;  2CU3 A;  2MBQ A;  2KX0 A;  5AZH A;  1L5P A;  2BBC A;  1UZX B;  4M0W A;  1D6E C;  4N58 A;  4DHJ D;  1TBE A;  2M56 B;  4XE0 A;  3EGR A;  1YN3 A;  3NS1 A;  1YX5 B;  3TUO A;  3PHX B;  3N1Y C;  5JHA A;  4ZRJ A;  1GB4 A;  2WDR B;  1OQR A;  2LRW A;  1VD2 A;  4FJV B;  2D3C A;  1E9M A;  2MCN B;  3HVZ A;  1WGG A;  2JT4 B;  4B95 A;  2K5P A;  1E7P B;  3H7S A;  4HKZ E;  4KSL C;  3Q8C A;  1UGJ A;  5J18 A;  1AYF A;  4JX1 C;  1S3S G;  3NY5 A;  3M63 B;  1JW9 D;  2LGY A;  3ONS A;  2IGD A;  2WGS A;  2WP9 B;  1E7V A;  2IDY A;  4WAF A;  3W1S A;  1WY8 A;  3VTW A;  3IAS 1;  3H8H A;  2RDB C;  4DHJ B;  2XEW A;  1VR9 A;  4KZ0 A;  4NQK E;  2K6D B;  5DPW A;  1YN4 A;  3LDZ E;  1GAQ B;  4F8C B;  1QOB A;  3V62 A;  3QK0 A;  1EF1 A;  1JWU D;  4KVG B;  4OW0 A;  3VUY A;  4N6E B;  3D32 A;  2KAN A;  2MBH A;  1NI2 A;  2YVC A;  2N1W A;  3KVF B;  4BKT A;  1ZPS A;  1TJE A;  4FHJ A;  4MH0 E;  2QHO A;  4WJP A;  1KF6 B;  4FA6 A;  4KZC A;  2KO3 A;  2K25 A;  1QQR A;  3R2I A;  4IWO A;  4IWQ A;  4KDL B;  1ZDX A;  3EFC A;  3NVW A;  4HDO A;  3TCA A;  3OG5 A;  3K9P B;  1TT5 B;  3N20 C;  2W3S A;  3KYC D;  2JSV X;  2L3Z A;  1V49 A;  5IP4 D;  3FAH A;  1TZ1 A;  2DAJ A;  3MHZ A;  4B0M A;  2J4X A;  3W5V B;  4W9F A;  1MPE A;  4ASW C;  1E10 A;  1EUV B;  2K0P A;  4HVB A;  4NPN A;  3HVD A;  5J17 A;  5EE1 A;  1FNV A;  5JH5 C;  2VH2 A;  3PVL A;  3HK0 A;  2FNJ B;  1SXT A;  2EMS A;  3IFW B;  4ICV A;  1ZOY B;  2KWU B;  4MH8 A;  3A1Q A;  2DYM A;  3AN1 A;  1E90 A;  2O6V B;  4XYC A;  3ZXR A;  4KGT A;  2Y3A A;  3AEF B;  3DVG Y;  1FNW A;  4LLG M;  1V81 A;  2K22 A;  1YX6 B;  4I6L B;  5EE3 A;  1FD6 A;  1D4B A;  1V5O A;  3URY A;  3AED B;  5IKC M;  2FIF A;  2G45 B;  2AWT A;  3H7P B;  2BYE A;  3ZXV A;  1C79 A;  4MSM B;  2BF8 B;  2N7J A;  2WLB A;  2MBO A;  4WUR A;  4HJK A;  3Q8A A;  1J7A A;  5JZE B;  3H6N A;  4C7Z A;  1L6U A;  1LGR A;  4HKQ A;  3ML8 A;  2BT6 A;  4MM3 A;  3VR9 B;  2K39 A;  2PMV A;  2JF5 A;  3RD2 A;  1ENF A;  5CHW A;  2V3S A;  4EOY A;  2E6X A;  2GLS A;  2ZW1 A;  4LJP B;  1E0Z A;  1P3Q U;  2I2Y A;  1WF9 A;  1JWA D;  2D07 B;  2KVZ A;  2N0S B;  2J0M A;  1EF5 A;  2ZCB A;  1ESF A;  3NOB A;  2WU5 B;  1WR1 A;  3VH3 B;  3N1Z C;  5AZF A;  1KJT A;  3RPF C;  1FXT B;  4XC2 A;  4LNN A;  2DHZ A;  4IDI A;  1QKZ A;  4W9C A;  3CMM B;  3DVG X;  4D2K A;  2INN E;  1L4D B;  2W3R A;  3RT3 B;  3ZLZ A;  3ZVV A;  3A9J B;  3RNC C;  1HTO A;  3DBH B;  2WS3 B;  2FID A;  3QJZ A;  1J0G A;  4K7W A;  4URK A;  1C4A A;  1EWY C;  2ZZP B;  3ZTC A;  1V80 A;  3PGE A;  2PE6 B;  4OVV A;  5D7G A;  4O1N A;  1SGH A;  2V1Y A;  4MEM A;  2N9X A;  3L13 A;  3B2G A;  1YIW A;  2Y5B B;  4W9K A;  4HRO A;  1N61 A;  3AE2 B;  3MC9 A;  1XLP A;  3VDZ A;  3RUL A;  2BPS A;  2GOW A;  3AEB B;  3NVZ A;  1WX9 A;  3PTF C;  1BML C;  2MEK A;  1VDV A;  4B0E A;  4W9E A;  3W1S C;  1FM0 D;  3AE8 B;  5CX3 A;  4C00 A;  1LM8 B;  3H9D A;  1AN8 A;  2FCQ A;  2N4F A;  4AS1 A;  2AQ2 B;  4A8X C;  1TIF A;  1WMH B;  3GE3 C;  1K53 A;  2BYT A;  1WXM A;  3JSV B;  1WIA A;  2LUE A;  3Q3O C;  4WJN A;  3ETR A;  3IHP C;  1DGJ A;  2WXI A;  4YSY B;  2DZI A;  3PV1 A;  3UI3 A;  3X23 A;  3AEC B;  4C56 C;  3I63 C;  3U7Z A;  3DVN U;  3Q14 C;  3CWI A;  3APC A;  4BKS A;  4USA A;  2KFK B;  3DHH C;  3LXF A;  3PRP B;  3C0R B;  1UBQ A;  1JML A;  3ABV B;  2MX2 A;  2N9L A;  1I4Q A;  3AI5 A;  5E6J A;  3L54 A;  2PLP A;  4LNK A;  3VUW A;  2MQJ A;  2RR9 A;  4BKS D;  1Z2M A;  1LFD A;  3RMK C;  1V5T A;  5AZG A;  3Q69 A;  2BTE A;  4KIK A;  4NQL B;  3V05 A;  3PLV A;  2XNA C;  4RM8 A;  1UNS A;  3AEA B;  3MC8 A;  1RYJ A;  4BZA A;  2KK8 A;  3A9K A;  1L2N A;  1SJH D;  2EKI A;  1GPX A;  2R2O A;  4MGI E;  1YJJ A;  1OEY J;  3DPD A;  3AU5 A;  2Z8L A;  1KLG D;  2KMM A;  1P9D U;  4M8M A;  3Q6B A;  2W54 A;  1GNU A;  4RFB A;  5D2M B;  4GDL A;  3BVG A;  3IG3 A;  2I1J A;  4GXB A;  2WDQ B;  3CST A;  2L1A A;  4JQW C;  1E8Z A;  2LXA A;  4GDK B;  2MJ3 A;  1GOZ A;  3B1L X;  2N9P C;  5DPR A;  3E9S A;  4C80 A;  1IBX A;  2BGF A;  3PLU A;  3AH7 A;  1HTQ A;  1SF0 A;  3KWL A;  1YJI A;  1IGC A;  4EEW A;  3R7R A;  3X0W A;  4GOC A;  2WXG A;  3RZF A;  4OZC A;  1UD7 A;  1C78 A;  4RH6 A;  4ANV A;  3LJ3 A;  2D3B A;  3IBE A;  2BW2 A;  4DHZ E;  3N1X C;  3KYD D;  4RMA A;  2LZ6 A;  4DDG D;  2VZK D;  2HJ1 A;  4W9I A;  1WRI A;  3WAN A;  4NNJ B;  1WGD A;  4A90 A;  2KQS A;  3NVY A;  3N9Y C;  4AJW A;  1F2R C;  2RDH A;  1J8C A;  1ACC A;  1GC7 A;  2C7N B;  2LVQ A;  4CQN A;  5KHQ A;  2GRI A;  3U4E G;  1HQR D;  3SD5 A;  3DBL I;  3Q3M C;  2REX A;  2SEB D;  4DK5 A;  1MHX A;  1L0V B;  4RGN A;  1QOA A;  1WJ6 A;  2OJR A;  2MA9 B;  1N5X A;  5AUK A;  4A6Q A;  4US8 A;  2ZEQ A;  2KWC A;  2ZVO A;  1GC6 A;  2EMT A;  3OWE B;  4K3C A;  1A70 A;  4S0R A;  3VVW B;  5E6P A;  2JWZ A;  4B6W A;  2KD0 A;  3TMP B;  1M4V A;  1E8X A;  4I6N B;  1WGR A;  4IM0 A;  4IM2 A;  1HXY D;  3C8Y A;  3PZ8 A;  2KYW A;  4PYZ A;  2BS4 B;  3S2A A;  1NYR A;  1KH0 A;  2LGD A;  1YQ4 B;  3P2B A;  1TTN A;  1FFU A;  4EUT A;  4BFR A;  4IKG A;  4ACF A;  4B9K A;  5TR5 A;  5HHD G;  2QC8 A;  1IPG A;  2KMA A;  5G5G A;  1PDX A;  3KUZ A;  4RGT A;  3DBS A;  3DBR B;  5G5H A;  1XT9 B;  2OOB B;  2PTL A;  4L1B A;  1D5M C;  3M95 A;  4EFO A;  2JU6 X;  3M3J A;  2Y5P A;  1GB1 A;  3BVM A;  2J0J A;  5C23 A;  4DXF A;  2WXM A;  3ZUN A;  5C3J B;  3A33 B;  1UBI A;  4G11 A;  4LK0 M;  2WXR A;  3NS8 A;  2VZK B;  1YN5 A;  4NAW B;  2KWV B;  2DZM A;  4EKU A;  2CHW A;  2GMI C;  1TS3 A;  5EE9 A;  3BVZ A;  4K3B A;  2GBJ A;  3AM9 A;  2BKR B;  3ZQ4 A;  1VCB A;  1T0S C;  2KFJ A;  4WJQ A;  4DWF A;  3NHE B;  1ZXH A;  3ZNI D;  3ZIM A;  4JLC A;  1H4R A;  1I4G A;  2BVC A;  4DXG A;  3AE5 B;  4E3C A;  2BWF A;  4RF1 A;  5LLI A;  4F1S A;  3QHT A;  2PPH A;  3WIM A;  3UQB A;  3V61 A;  3RN9 C;  2CJN A;  4MM3 B;  4ZYN A;  2ZW0 A;  2PW9 A;  3AE9 B;  3FIL A;  3JVZ X;  3EEC A;  3CSF A;  2WYQ A;  1ZXI A;  5DPT A;  2MRP A;  2PE9 A;  4IUM B;  3ZYY X;  4REZ A;  2LGS A;  3B2F A;  3HM6 X;  5GXG B;  4GU2 A;  2C7H A;  3PRE A;  1QIL A;  4BAX A;  1FMA D;  4JE3 B;  1UGM A;  2KNB A;  2RD0 A;  4YWG G;  2WXQ A;  2AEH A;  1CQV A;  1T0R C;  2YEP F;  1TGZ B;  2I38 A;  3GS2 A;  1SBB B;  1TS4 A;  2ONQ A;  2C9W B;  4TV3 A;  1WR6 E;  1ZW7 A;  3I9V 1;  1YNT E;  1WSP A;  2QEJ C;  4E71 A;  4GN1 A;  4P1C C;  2NMQ A;  3MJW A;  1QOF A;  3TJP A;  1EWC A;  1C1Y B;  2UYZ B;  1NYQ A;  3Q3J A;  1ISN A;  4W9H A;  1WJ4 A;  5IAA C;  3P4P B;  2N7D A;  3QC8 B;  3IXS A;  1RRB A;  1C9F A;  1P0R A;  1WXA A;  2M8S A;  3Q8B A;  2INP E;  3U52 E;  1VZ7 A;  1NBF C;  4RCO A;  2PKO A;  2HJ8 A;  4BVU C;  2PVO D;  3VRB B;  4EE2 A;  5HG2 A;  4UDU C;  4MGK E;  5TSS A;  1K51 A;  2KDI A;  2WWZ A;  4TKN A;  2AL3 A;  1OTR B;  1XCQ L;  4IOI E;  1LO5 D;  1WE6 A;  2WNM A;  1HEZ E;  1E8Y A;  4WWM A;  4NY0 A;  2O6V D;  1JRU A;  2DEN B;  2G9H D;  3ZTD A;  3IT6 B;  3ZNH B;  1WXQ A;  1L0Y B;  2KDM A;  4HLE A;  3A4R A;  1B1Z A;  1D3Z A;  2RMM A;  2JXX A;  4XZ4 A;  1PGB A;  4A20 A;  2LHE A;  2L76 A;  3NUH B;  2PEA A;  4A9A A;  2DYO A;  2K3U A;  3HUI A;  2TSS A;  2V9H A;  1IP9 A;  1FXI A;  4IWP A;  3TIX A;  2E3T A;  3ECI A;  2XBB C;  2FUG 1;  5AEK B;  1E5W A;  2LHD A;  4M8N A;  2QIL A;  3AEE B;  1JRP A;  3SEB A;  3W5U B;  3RNB C;  2D2Q A;  3RYT A;  1NDD A;  2GB1 A;  3EHV A;  3OJ4 B;  1ZDV A;  3VUX A;  4ZHO A;  4ZHP A;  4R3D A;  3EC8 A;  4XDD A;  3MP9 A;  1XF5 L;  1KLU D;  4JIO U;  3AE6 B;  1JAL A;  5J2R A;  2OED A;  4RM9 A;  4XWT A;  4KKJ A;  1XD3 B;  4MGZ E;  4J3O D;  1V9J A;  2KTR A;  2ZPY A;  4ZYS A;  3Q2A C;  1F1H A;  1NI3 A;  4ANX A;  2DBY A;  1WGH A;  5D6J B;  4EZJ A;  5E6O A;  1QOG A;  3GE8 C;  2GBK A;  3L17 A;  3RUI B;  4TQ0 A;  2QCZ A;  1VRA B;  1ZGU B;  2MSE D;  1WZ3 A;  2PIA A;  1F52 A;  2L0T A;  4A3O A;  1FEH A;  4WJO A;  2PJH A;  5E6N A;  2GBN A;  2OHF A;  1F2R I;  1R4M I;  1DOY A;  1RFK A;  2BYF A;  2CJO A;  4W9L A;  3ZRC A;  4IM3 A;  4PS8 A;  1UEL A;  3PPA A;  4GIV A;  4YSZ B;  1I4P A;  2INC C;  4YTM B;  1OFF A;  1V86 A;  1WRD B;  2K6Q A;  3L08 A;  4WQO B;  1GG3 A;  3JW0 X;  2CS4 A;  3PZD A;  5L83 A;  5MPO A;  1XEE A;  1RAX A;  5D94 A;  3ZDM C;  2WXF A;  1TS2 A;  2RPQ A;  4NAW A;  2MWS B;  5G55 A;  2QDF A;  4X57 B;  1KFY B;  1FO4 A;  2WX1 A;  2KC1 A;  2PVG C;  1SE2 A;  1I4R A;  3ZW3 A;  2J0K A;  2L83 A;  1LXD A;  3QX1 A;  1MFW A;  2JVC A;  2NS5 A;  3AE1 B;  1V1P B;  4S17 A;  3VHT C;  2J7Q B;  2C60 A;  3C19 A;  1SIF A;  1L0X B;  4ARI A;  4YTP B;  1L7Y A;  1V1O A;  1IGD A;  1QT9 A;  2KT7 A;  2DLB A;  1R4M B;  4MAC A;  2ZVN A;  1OEY A;  4P6V F;  2JYE A;  4CO7 A;  4PYU A;  3TEW A;  1PYW D;  5CHF A;  4ZRK A;  3KQ4 A;  2KN4 A;  1LQB A;  2LGI A;  2RSU A;  1KM7 A;  4MDK E;  3VFK A;  2EKE C;  1K50 A;  1JWB D;  2IY0 B;  2J42 A;  1EM7 A;  3KLS X;  4PT5 A;  4XWW A;  1JQ4 A;  5HFY A;  2IO0 B;  4HCP B;  3PZ7 A;  3ZNG C;  4JGH B;  4KGS A;  3MJ5 A;  3PS6 A;  3BK2 A;  2AX5 A;  1B9R A;  2KFK A;  5C2T B;  2K9X A;  2YEP B;  1NVI D;  3T3O A;  1VLB A;  2V4L A;  2Y5C A;  3DHG C;  1WJU A;  2RGF A;  2G3Q B;  4II3 B;  3PRM B;  4TQ1 A;  2Z0E B;  4HPM B;  1AAR A;  1K52 A;  1WMH A;  3DVN V;  4MJS A;  5BYR A;  3TEX A;  5G2N A;  1WX8 A;  2O2V B;  3T9L A;  1FCC C;  1WGY A;  4TSS A;  2QJL A;  5I4D A;  4AOF A;  3H1U A;  1I7H A;  3ZGZ A;  4JL9 A;  1C4P A;  2LRU A;  2JUO A;  2KZR A;  1JWM D;  3NZU A;  2M1M A;  4Q2J A;  3M62 B;  4FLH A;  4K7U A;  5KHO A;  1IYF A;  1Q5W B;  2N9E B;  3UIN B;  4MT5 A;  2X8X X;  2N1V A;  3U30 A;  2KDB A;  3BII D;  2LJI A;  4LNO A;  3L16 A;  2ZPN A;  1FXA A;  2QIE B;  2JWU A;  2MH7 A;  3JSV A;  3A1Q B;  5JHB A;  5IA7 A;  3SDL C;  3NG0 A;  2LUM A;  1STE A;  3A9J A;  1WJN A;  3GZN I;  2L32 A;  2IPK D;  1KTK A;  3SR6 A;  1TKE A;  3P4Q B;  1HZ5 A;  3L4P A;  4BBN C;  3ENE A;  1KRH A;  3WA0 A;  1YD8 U;  3SFE B;  4BBN F;  2MP2 A;  1TS5 A;  1T0Y A;  4TMA B;  2GBM A;  3QA8 A;  1GUA B;  4KV2 A;  1N6Z A;  1Q1O A;  2XN9 C;  4W9G A;  1XLQ A;  2UWQ A;  3PHW B;  1FCL A;  1P7F A;  2KAC A;  3QCA A;  5AUI A;  1ZP0 B;  2DNF A;  4GLS C;  2B3A A;  4RNA A;  2YLM A;  1C3T A;  2L00 B;  3RCZ A;  3VAW A;  1R7S A;  4HEA 1;  2IO2 B;  3GP7 A;  3VTU A;  4DQO C;  1FNU A;  1V6E A;  2WHI A;  4A3P A;  4YXD B;  2NBV B;  2A5U A;  1MJD A;  1V97 A;  3QAQ A;  2MW5 A;  5DPS A;  1R4N B;  1ZKH A;  4H2A A;  2CU1 A;  3QAR A;  1PQS A;  1E8W A;  2DZK A;  2WQY B;  1M94 A;  3JYU A;  4HRS A;  2L8J A;  4FHK A;  4TUU A;  3I3T B;  1YOV B;  2NTS A;  3K9O B;  3PRZ A;  1T3Q A;  2CHZ A;  1XXG A;  4PK1 A;  1HZ6 A;  4G3X B;  1F0Z A;  2AQ3 B;  1JRO A;  3DBL B;  2A4Z A;  2EEL A;  2IYD B;  3FC4 A;  3GZN B;  3RI7 C;  2KTR B;  1UUP A;  3WAL A;  2LFI A;  3FKY A;  1FRR A;  1VZ8 A;  3BY4 B;  1A5R A;  1RFA A;  3HM3 A;  4G0N B;  3A4S C;  3RFZ B;  4M01 A;  1SIJ A;  4JPS A;  3P4S B;  1R4N I;  4LDT B;  1QZE A;  3H7P A;  1TKY A;  2N7E A;  1WYW B;  2JRH A;  1XO3 A;  4M0W B;  2ASQ A;  1Q10 A;  2D5G A;  2JXT A;  4LNI A;  2NBW B;  2LMC A;  4US9 A;  1Z5S B;  1TKG A;  4RGO S;  4DXA B;  4MSQ B;  1AW7 A;  1BXT A;  3EA6 A;  3KWV A;  3O13 A;  1JWS D;  1OQY A;  2KC2 A;  1J7B A;  2DWQ A;  3B0A A;  3ZNZ B;  2I1K A;  2KAJ A;  3ML9 A;  4GB9 A;  1DOI A;  4ZRI A;  2K8B A;  2BYV E;  1WH3 A;  4LJO B;  3V6C B;  4P1B C;  4DDI D;  3W9C B;  4BOZ B;  3N30 A;  2J53 A;  5LXI B;  2G4D B;  3CIR B;  4YSX B;  2KQ4 X;  3KUD B;  4KIK B;  1GJZ A;  5IN7 A;  2FBW B;  3AB5 A;  1YQ3 B;  4LCD E;  5IO9 A;  1E6E B;  3O65 B;  3ALB A;  2WXO A;  3AU4 A;  2L52 A;  3APF A;  1U4A A;  1CK1 A;  4LNF A;  2M17 A;  2Z0D B;  3ZO5 B;  2KJH B;  4HPP A;  3GB1 A;  4OVZ A;  1P7E A;  5HKH A;  2O2V A;  2DZJ A;  3PO0 A;  4AJY B;  2KKC A;  1ET6 A;  2LWP A;  2IZV B;  3RNE C;  2LAS A;  4C7Y A;  3UF8 A;  3T3N A;  2KQ7 A;  2ON8 A;  2KN5 A;  3KW5 B;  3BWU D;  2IGG A;  1UH6 A;  2X38 A;  5IOI A;  3IT4 B;  1WM3 A;  2M0A A;  2V3N A;  2GI9 A;  1ZE3 D;  1WI0 A;  4XDC A;  4LDT D;  4N9F 4;  2JZP A;  4P16 A;  4N59 A;  4KSK C;  5FR3 A;  2AQ1 B;  4RF0 A;  1C77 A;  1TZO A;  3MC0 B;  2JY6 A;  4ITK A;  1EU4 A;  2KJR A;  3BIN A;  5BMG A;  3EUB 2;  3MHS D;  3AXC A;  4HK2 A;  2LD9 A;  2K8C A;  2KVR A;  5BO4 B;  2HD5 B;  2VRR B;  4W9D A;  2KLC A;  4FUL A;  3RNG C;  5GMV A;  3AE4 B;  3LB8 C;  3R8B A;  2QMT A;  3HRD D;  2AL6 A;  4PS7 A;  3FIL B;  3TEZ A;  3TEY A;  4ANW A;  3OAW A;  1KLV A;  1WWT A;  3BYY B;  5EDS A;  2W82 A;  1ZUD 2;  1WX7 A;  1FPY A;  3MTN B;  1TY0 A;  5JXV A;  3AE7 B;  3R7Q A;  2KHW B;  2SAK A;  2WXN A;  3SHQ A;  3ZJV A;  1T0Q C;  4GSW A;  2IJ0 A;  4L2Y A;  3VXW A;  2MLB A;  3Q3N C;  3BYT B;  1L6V A;  2LVO A;  3VRA B;  2CKH B;  3W1Y A;  1I4X A;  2K8H A;  2M19 A;  3B9J A;  1J19 A;  1I42 A;  4YL8 A;  3UGB B;  4JWU C;  4C4V B;  2CR5 A;  1RWS A;  1CJE A;  1N62 A;  1G6J A;  3AE3 B;  1F9J A;  5D3I B;  1D5X C;  2NPT A;  2L0F A;  1L4Z B;  2IO1 B;  1SE4 A;  4GDK A;  3P63 A;  5LNK 1;  3I5J C;  3HHM A;  1EO6 A;  4QAY A;  3AMZ A;  4J6I A;  3LYY A;  4K1R B;  3UIO B;  1KOT A;  2ACZ B;  1N5W A;  3AEG B;  1MG4 A;  2XK5 B;  1XLN A;  2IGH A;  2FCN A;  4FBJ B;  1PFD A;  4BKG A;  1FIQ A;  2KJ6 A;  4G50 A;  2K1F A;  3I57 A;  4DBG A;  1N63 A;  1BUI C;  3N3K B;  5BYQ A;  3UQA A;  3NVV A;  3L10 B;  1PUT A;  1TY2 A;  1CZP A;  2KLG A;  1OQQ A;  4MJS B;  2IY1 B;  1BT0 A;  2BS3 B;  2AYO B;  4HCN B;  3HIZ A;  2DAF A;  5C1Z A;  3P42 A;  1Y8R C;  1QLB B;  3NRZ A;  4OVU A;  3SU8 X;  3U2S C;  3U7D A;  2G4S A;  1P98 A;  5H8Y E;  2HDE A;  3DWG C;  2RPV A;  2NPT B;  3ZKJ C;  3WAO A;  1YMH E;  2J52 A;  4RGM A;  3ZJT A;  4C4V A;  1UWM A;  3P4R B;  2D11 A;  2NTT A;  3DOW A;  3GOE A;  4KX6 B;  1V2Y A;  3N32 A;  3W2D A;  3WAP A;  2JRI B;  4K7S A;  1DOX A;  4ICU A;  4IG7 B;  4L23 A;  2HE7 A;  2JX5 A;  2WU2 B;  3OLM D;  3VR8 B;  4JWS C;  3VTV A;  2M0X A;  4OZA A;  5H92 C;  1J7C A;  4HWI B;  3ZDT A;  1F77 A;  5T8I A;  2BWE S;  2JZZ A;  4WWO A;  1X1M A;  3NZS A;  3TSS A;  3L0W B;  1VZ6 A;  5FKA C;  1D5Z C;  1Y56 A;  2N9K A;  1I4H A;  4NJ6 A;  1WXV A;  3AUL A;  4FAD A;  4K81 A;  3V3X A;  3MFG A;  1WZ0 A;  2OJW A;  3QIJ A;  4GMV A;  1K8R B;  1SE9 A;  4WQM A;  1AWD A;  3WCQ A;  4FN2 A;  4HPL B;  1SB3 C;  1I35 A;  4P7I A;  3KUC B;  3APD A;  4GDL B;  3BZD B;  3R2T A;  2KOX A;  1N60 A;  1PGX A;  1WGK A;  3OJ3 A;  1MI0 A;  4ANU A;  2JZ3 B;  3B08 A;  1QF6 A;  3P1M A;  1NEK B;  2IO3 B;  2Z59 B;  2H88 B;  1MVK A;  3NJT A;  4AQ7 A;  4NAM A;  1H8C A;  3EFU A;  2BS2 B;  1NEN B;  2ZCC A;  1WM2 A;  1WFY A;  4ZRQ A;  4M00 A;  2W9N A;  3CF6 E;  5BMH A;  3TBL D;  1T5X D;  3DWM A;  2FUH B;  2R2Q A;  2XK5 A;  2JYT A;  1HA5 A;  3Q8E A;  2H89 B;  4BOS C;  1SJE D;  2KDE B;  4CHK A;  4ZDV A;  2LVP A;  5LXH A;  4XX5 A;  4KGR A;  4OHJ A;  2WX0 A;  2MP2 B;  4WIP A;  2ZNV C;  1SE3 A;  2HTH A;  4MEL A;  3DBH I;  3DDC B; 
#chains in the Genus database with same CATH homology
 4W9C A;  3CMM B;  1R4N I;  2HJ8 A;  2MBB B;  3DVG X;  2KTF A;  4LDT B;  4BVU C;  2KXJ A;  1QZE A;  3RT3 B;  3H7P A;  4MGK E;  3ZLZ A;  3ZVV A;  2NVU I;  2N7E A;  3A9J B;  1Q0W B;  1WYW B;  2L05 A;  1S1Q B;  2JRH A;  2FID A;  4M0W B;  2ASQ A;  3QJZ A;  2IBI B;  1J0G A;  4K7W A;  3ZRF A;  2NBW B;  4URK A;  2KDI A;  2WWZ A;  1Z5S B;  2M4N A;  3QWZ B;  4TKN A;  2ZZP B;  3ZTC A;  2NCN A;  1V80 A;  3PGE A;  2AL3 A;  3DQV A;  4AWJ A;  2PE6 B;  4OVV A;  5D7G A;  4DXA B;  1OTR B;  4MSQ B;  1SGH A;  2V1Y A;  4DHZ B;  2D3G A;  2N9X A;  4MEM A;  1WE6 A;  3L13 A;  1YIW A;  1E8Y A;  3PT2 B;  2Y5B B;  2CHX A;  4NY0 A;  2O6V D;  1JRU A;  2DEN B;  1OQY A;  4W9K A;  2KC2 A;  3ZTD A;  3KH0 A;  3IVF A;  4II2 B;  3T8M A;  3ZNH B;  3VDZ A;  4MGY E;  3B0A A;  3ZNZ B;  3RUL A;  3VH4 B;  2BPS A;  2GOW A;  4HLE A;  3A4R A;  1D3Z A;  3VQI A;  2JXX A;  4XZ4 A;  3WAM A;  1WX9 A;  4A20 A;  3PTF C;  2I1K A;  2L76 A;  2LJ5 A;  3ML9 A;  4GB9 A;  4W9J A;  4W9E A;  4ZRI A;  3RZW C;  2PEA A;  3W1S C;  2K8B A;  1P1A A;  2DYO A;  2MBE A;  2BYV E;  1WH3 A;  4LJO B;  5CX3 A;  3V6C B;  1IP9 A;  1LM8 B;  2C7M B;  3H9D A;  3QQ8 B;  4IWP A;  4DDI D;  2FCQ A;  2N4F A;  3A9K B;  4BOZ B;  3N30 A;  3TIX A;  3ECI A;  3TL5 A;  2XBB C;  5AEK B;  5LXI B;  1E5W A;  2FCS A;  2G4D B;  4M8N A;  1YQB A;  3KUD B;  2JPH A;  1WMH B;  2DX5 B;  2D2Q A;  3RYT A;  4KIK B;  1GJZ A;  1XQQ A;  2LXC A;  4NJ7 A;  4PS3 A;  1NDD A;  4LCD E;  1WXM A;  3JSV B;  3O65 B;  1OGW A;  1WIA A;  2LUE A;  3ALB A;  4WJN A;  3IHP C;  2DZI A;  3PV1 A;  3X23 A;  3EHV A;  3AU4 A;  3OJ4 B;  3APF A;  1U4A A;  3VUX A;  3DVN U;  2BKF A;  3APC A;  3EC8 A;  4BKS A;  2M17 A;  2Z0D B;  3ZO5 B;  2KFK B;  2KJH B;  1MG8 A;  4JIO U;  3PRP B;  5HKH A;  3C0R B;  1UBQ A;  2D10 A;  5J2R A;  2O2V A;  1WXS A;  4RM9 A;  2DZJ A;  4AUQ C;  1YJ1 A;  3DBR I;  1XD3 B;  3Q3F A;  2MX2 A;  4AJY B;  2WDT B;  1RLF A;  3R3M A;  4MGZ E;  2KKC A;  2LWP A;  2IZV B;  4E74 A;  1V9J A;  2KTR A;  2ZPY A;  3AI5 A;  2LAS A;  4GGQ A;  4WWN A;  3UF8 A;  3L54 A;  2KQ7 A;  3V6E B;  2L7R A;  2KN5 A;  2FAZ A;  4ANX A;  2FCM A;  3KW5 B;  1WE7 A;  3VUW A;  1UH6 A;  1WGH A;  2MQJ A;  2RR9 A;  1WM3 A;  5D6J B;  4WAA A;  5E6O A;  1Z2M A;  4BKS D;  1LFD A;  4EZJ A;  2GBK A;  3L17 A;  1V5T A;  3RUI B;  1WI0 A;  5AZG A;  4FJZ A;  4TQ0 A;  4LDT D;  4N9F 4;  4KIK A;  4NQL B;  1ZGU B;  2MSE D;  1WZ3 A;  4KSK C;  2L0T A;  3PLV A;  4RM8 A;  4FJY A;  4A3O A;  2JY6 A;  4WJO A;  2PJH A;  5E6N A;  2KJR A;  2KK8 A;  3BIN A;  3A9K A;  2NBU A;  1L2N A;  2GBN A;  2R2O A;  3MHS D;  3AXC A;  4HK2 A;  1R4M I;  2LD9 A;  2K8C A;  2KVR A;  4MGI E;  1OEY J;  2HD5 B;  5BO4 B;  3DCG A;  3DPD A;  2VRR B;  1HE8 A;  4W9D A;  3UIP B;  2KLC A;  3AU5 A;  4FUL A;  5GMV A;  2BYF A;  2LGX A;  4W9L A;  4HXD A;  4IC7 B;  3ZRC A;  1P9D U;  4IM3 A;  4WWP A;  4M8M A;  5DCN A;  4PS8 A;  4EZL A;  2AL6 A;  1GNU A;  4PS7 A;  5CHV C;  1UEL A;  3PPA A;  4GIV A;  5D2M B;  4AP4 C;  4F7Z A;  2KDF B;  2LI5 A;  3PSE B;  4ANW A;  3OAW A;  1KLV A;  4GDL A;  2NR2 A;  1V86 A;  1WRD B;  2K6Q A;  3IG3 A;  2I1J A;  2C5L C;  4GXB A;  3CST A;  3L08 A;  4WQO B;  1GG3 A;  4KDI C;  4JQW C;  3V60 A;  3U8Z A;  3R66 C;  3JW0 X;  5EDS A;  1E8Z A;  2LXA A;  2CS4 A;  3PZD A;  4GDK B;  5L83 A;  3B1L X;  1RAX A;  5D94 A;  1WX7 A;  3ZDM C;  4I6P A;  3MTN B;  2O6V A;  2N9P C;  4HDQ A;  5DPR A;  2RPQ A;  4NAW A;  2MWS B;  5G55 A;  4X57 B;  2BGF A;  3PLU A;  3R7Q A;  2WX1 A;  2KHW B;  2KMC A;  2KC1 A;  5L95 C;  2KX3 A;  3SHQ A;  3ZW3 A;  4EEW A;  2J0K A;  4GSW A;  2ZJD A;  5CTR C;  4IW0 A;  3R7R A;  3X0W A;  1LXD A;  3QX1 A;  4CYE A;  2JVC A;  4GOC A;  2NS5 A;  3RZF A;  3VXW A;  1UD7 A;  3VHT C;  2J7Q B;  2MLB A;  2C60 A;  1SIF A;  2GBR A;  4ANV A;  3LJ3 A;  2LVO A;  2ZNV B;  2CKH B;  1L7Y A;  3IBE A;  3W1Y A;  5FR6 A;  4DHZ E;  1CMX B;  2DYB A;  4EZK A;  2K8H A;  2ZVN A;  1E7U A;  3KYD D;  2MBQ A;  1OEY A;  2KX0 A;  4RMA A;  4CO7 A;  4PYU A;  1J19 A;  5AZH A;  1I42 A;  2LZ6 A;  4DDG D;  1UZX B;  5CHF A;  4YL8 A;  3UGB B;  4ZRK A;  4DHJ D;  1TBE A;  4W9I A;  3WAN A;  2CR5 A;  4NNJ B;  1WGD A;  1G6J A;  1LQB A;  1F9J A;  2KQS A;  2NPT A;  2RSU A;  4AJW A;  2L0F A;  1KM7 A;  1YX5 B;  2IO1 B;  4MDK E;  3PHX B;  3VFK A;  4GDK A;  1J8C A;  1GC7 A;  5JHA A;  2EKE C;  2C7N B;  4ZRJ A;  2LVQ A;  5KHQ A;  3HHM A;  1EO6 A;  1VD2 A;  2IY0 B;  2LRW A;  3SD5 A;  3DBL I;  4FJV B;  2REX A;  4DK5 A;  2IO0 B;  4HCP B;  4J6I A;  4K1R B;  2MCN B;  3UIO B;  1WGG A;  1WJ6 A;  2JT4 B;  2OJR A;  1KOT A;  2MA9 B;  3ZNG C;  4B95 A;  4JGH B;  2ZEQ A;  2KWC A;  2ZVO A;  1GC6 A;  3H7S A;  3PS6 A;  2EMT A;  2XK5 B;  4KSL C;  2KFK A;  5J18 A;  3VVW B;  5E6P A;  2FCN A;  1S3S G;  3NY5 A;  4FBJ B;  2JWZ A;  3M63 B;  2V4L A;  4B6W A;  2LGY A;  3ONS A;  4BKG A;  2KD0 A;  1WJU A;  3TMP B;  2RGF A;  2KJ6 A;  4G50 A;  1E7V A;  1E8X A;  2G3Q B;  1WGR A;  4I6N B;  2K1F A;  3PRM B;  4II3 B;  4IM0 A;  4TQ1 A;  3W1S A;  4DBG A;  1WY8 A;  3N3K B;  4IM2 A;  2Z0E B;  4HPM B;  3VTW A;  3UQA A;  1AAR A;  3L10 B;  4DHJ B;  2XEW A;  1WMH A;  4KZ0 A;  2KLG A;  4PYZ A;  4NQK E;  2K6D B;  5DPW A;  3S2A A;  3DVN V;  4MJS A;  4MJS B;  2IY1 B;  1BT0 A;  2LGD A;  3LDZ E;  3P2B A;  2AYO B;  1TTN A;  1WX8 A;  4HCN B;  5G2N A;  4EUT A;  4F8C B;  2O2V B;  3HIZ A;  3T9L A;  3V62 A;  2DAF A;  1WGY A;  3QK0 A;  4BFR A;  1Y8R C;  5C1Z A;  1EF1 A;  4KVG B;  3VUY A;  4OVU A;  5TR5 A;  3SU8 X;  4AOF A;  3D32 A;  2KAN A;  3H1U A;  2MBH A;  3U7D A;  4B9K A;  1NI2 A;  1P98 A;  2G4S A;  2YVC A;  2N1W A;  4JL9 A;  3KVF B;  4BKT A;  2LRU A;  2JUO A;  4FHJ A;  1IPG A;  4MH0 E;  2QHO A;  4WJP A;  2KZR A;  2NPT B;  2KMA A;  3ZKJ C;  3WAO A;  3NZU A;  2M1M A;  3KUZ A;  4FA6 A;  3DBS A;  3M62 B;  4FLH A;  4K7U A;  5KHO A;  1IYF A;  1Q5W B;  2D11 A;  2N9E B;  4KZC A;  2KO3 A;  3UIN B;  2K25 A;  1XT9 B;  2OOB B;  3DOW A;  2N1V A;  4IWO A;  3M95 A;  3GOE A;  4IWQ A;  4KDL B;  3U30 A;  4EFO A;  2KDB A;  3M3J A;  3L16 A;  4HDO A;  1V2Y A;  3N32 A;  3TCA A;  3WAP A;  2ZPN A;  2JRI B;  3K9P B;  4K7S A;  4ICU A;  3KYC D;  4IG7 B;  2J0J A;  5C23 A;  2HE7 A;  3OLM D;  3JSV A;  3ZUN A;  3A1Q B;  2L3Z A;  5JHB A;  3A33 B;  5IA7 A;  1UBI A;  3VTV A;  1V49 A;  3SDL C;  1TZ1 A;  2DAJ A;  2M0X A;  4G11 A;  3NS8 A;  3A9J A;  1WJN A;  4W9F A;  4HWI B;  4ASW C;  3GZN I;  1EUV B;  4NAW B;  3ZDT A;  2BWE S;  2KWV B;  2JZZ A;  4WWO A;  4HVB A;  4NPN A;  2DZM A;  5J17 A;  1X1M A;  2CHW A;  4EKU A;  2GMI C;  4BBN C;  3ENE A;  3NZS A;  5JH5 C;  3PVL A;  3L0W B;  3WA0 A;  1YD8 U;  3HK0 A;  2GBJ A;  2BKR B;  2FNJ B;  4BBN F;  2MP2 A;  1T0Y A;  2EMS A;  1VCB A;  2KFJ A;  2GBM A;  3IFW B;  4NJ6 A;  1WXV A;  4WJQ A;  3QA8 A;  4DWF A;  1GUA B;  3NHE B;  4KV2 A;  3AUL A;  1Q1O A;  4FAD A;  3ZNI D;  4K81 A;  4ICV A;  3ZIM A;  4W9G A;  2UWQ A;  3PHW B;  4JLC A;  1H4R A;  1WZ0 A;  3QCA A;  2KWU B;  3A1Q A;  2DYM A;  3QIJ A;  1E90 A;  4GMV A;  1K8R B;  1SE9 A;  2O6V B;  4E3C A;  2BWF A;  2B3A A;  4FN2 A;  4HPL B;  2YLM A;  3DVG Y;  5LLI A;  1V81 A;  1I35 A;  4F1S A;  1C3T A;  1YX6 B;  4I6L B;  2L00 B;  3RCZ A;  3QHT A;  4P7I A;  3VAW A;  2PPH A;  3WIM A;  3KUC B;  1V5O A;  3APD A;  4GDL B;  2IO2 B;  3V61 A;  3UQB A;  3VTU A;  4ZYN A;  2FIF A;  1V6E A;  3JVZ X;  2KOX A;  2G45 B;  4A3P A;  3OJ3 A;  3EEC A;  3CSF A;  2NBV B;  2AWT A;  2A5U A;  2WYQ A;  4ANU A;  3H7P B;  2BYE A;  2JZ3 B;  2MRP A;  2PE9 A;  4IUM B;  5DPT A;  4MSM B;  2BF8 B;  3B08 A;  3QAQ A;  2MW5 A;  3HM6 X;  5DPS A;  1ZKH A;  2IO3 B;  2MBO A;  2CU1 A;  2Z59 B;  3QAR A;  1PQS A;  1E8W A;  4HJK A;  2DZK A;  4GU2 A;  2C7H A;  3PRE A;  1M94 A;  3JYU A;  5JZE B;  1UGM A;  3H6N A;  1H8C A;  2KNB A;  2L8J A;  4FHK A;  2RD0 A;  3EFU A;  4TUU A;  2ZCC A;  1WM2 A;  3I3T B;  3ML8 A;  1WFY A;  2AEH A;  3K9O B;  3PRZ A;  4MM3 A;  2CHZ A;  1TGZ B;  2W9N A;  3CF6 E;  2K39 A;  2JF5 A;  3RD2 A;  2C9W B;  5CHW A;  2V3S A;  4EOY A;  4TV3 A;  1WR6 E;  4G3X B;  1ZW7 A;  4E71 A;  4GN1 A;  3MJW A;  3TBL D;  3TJP A;  2A4Z A;  1C1Y B;  2UYZ B;  3Q3J A;  4W9H A;  1ISN A;  4LJP B;  1WJ4 A;  2IYD B;  1P3Q U;  2FUH B;  2R2Q A;  2XK5 A;  5IAA C;  2N7D A;  1WF9 A;  2KTR B;  3WAL A;  2D07 B;  2J0M A;  4BOS C;  1EF5 A;  2ZCB A;  3QC8 B;  1RRB A;  3BY4 B;  3NOB A;  2KDE B;  4CHK A;  4ZDV A;  1WR1 A;  1P0R A;  1WXA A;  2LVP A;  2M8S A;  4XX5 A;  5LXH A;  1A5R A;  3VH3 B;  1RFA A;  3HM3 A;  4G0N B;  5AZF A;  1KJT A;  2WX0 A;  1FXT B;  3A4S C;  2MP2 B;  4XC2 A;  2ZNV C;  2HTH A;  4MEL A;  1NBF C;  2DHZ A;  3DBH I;  3DDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...