1M94A

Solution structure of the yeast ubiquitin-like modifier protein hub1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MIEVVVNDRLGKKVRVKCLAEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLELYYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, signaling protein
molecule keywords Protein YNR032c-a
publication title Solution Structure of the Yeast Ubiquitin-Like Modifier Protein Hub1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1m94A00
2LVPA 2Z59B 3QK0A 2KDEB 3PREA 4WJQA 1WE6A 2KK8A 4EZJA 1WR1A 1WGDA 3JSVA 2C7NB 3Q3JA 2DYOA 5CX3A 2BYFA 1BT0A 3KUZA 2ZPYA 2LRWA 1ZW7A 4MEMA 5BO4B 4ZRKA 1U4AA 4E71A 2O2VA 3R7RA 3HM6X 4FN2A 2LASA 3K9OB 2AL3A 4EZLA 2ZJDA 3H7SA 2KJ6A 4IWPA 4K7SA 2N4FA 3GOEA 2RD0A 2AEHA 2R2QA 3L16A 4X57B 2KMAA 2LRUA 1Y8RC 2KANA 4DK5A 3KH0A 2MW5A 3PHXB 1WI0A 1SGHA 4DHJB 4XX5A 3QWZB 2IYDB 4TV3A 3NS8A 2JVCA 2JY6A 2L3ZA 2L8JA 2IZVB 2RSUA 4K7WA 5D94A 3OJ4B 1IPGA 4FJZA 4BBNC 4IWQA 4KDLB 3B0AA 4BKSD 2IO1B 3ZLZA 4GSWA 3NY5A 5L95C 2LJ5A 4KIKB 2KMCA 4GDLA 1SIFA 2DENB 3ECIA 3P2BA 2GOWA 4KSKC 2YLMA 1E8YA 3ZRCA 2FCQA 3A4RA 4A3PA 2BYEA 4K1RB 3PT2B 1UBIA 3K9PB 2WDTB 1V6EA 2KN5A 4IUMB 1R4NI 3VH3B 1Z2MA 4ZRJA 3RT3B 4BOSC 3A33B 5CTRC 3TBLD 3SU8X 4EZKA 4GN1A 4MGIE 2HJ8A 2KX3A 3L0WB 3EC8A 5DPRA 2D11A 2AYOB 2ZNVB 3V6EB 1YX5B 4NPNA 1GJZA 2CKHB 3TMPB 3ZDTA 4DBGA 3PRMB 5FR6A 4AJWA 1E5WA 4J6IA 1E8ZA 4LJOB 2C7MB 1IYFA 2O6VB 4IM3A 5DPTA 2MBBB 4F7ZA 1XD3B 4FBJB 5J18A 2JZZA 1TBEA 2N1WA 5JH5C 2DAJA 2J7QB 1J8CA 5JHBA 3V61A 3WA0A 2KTRB 2N7DA 3OAWA 2NCNA 4RM9A 3RZWC 2NBWB 3Q3FA 1GNUA 3A9KB 4JL9A 4BKGA 2EKEC 2G4SA 2IO0B 5GMVA 3ML9A 4ANWA 2PEAA 2D3GA 2K1FA 2NPTB 3L10B 1WGRA 2KWUB 3UQAA 5IA7A 5G2NA 4MELA 3EHVA 2NBVB 2JRIB 4DHZB 1OGWA 3LJ3A 2IY1B 4HDQA 2ZCBA 1EF5A 4ICUA 4CO7A 3M3JA 4MJSB 1R4MI 3SDLC 2K6QA 1ZGUB 1T0YA 2FUHB 1V2YA 3QHTA 2CHXA 4KIKA 2N9PC 1E8WA 3BINA 4EUTA 2LD9A 2L0TA 3V6CB 3ZUNA 2V4LA 2MRPA 2KWCA 3L17A 1WIAA 3WIMA 4WWPA 3ZW3A 5JZEB 4OVUA 2LGDA 4AOFA 1L7YA 3PLUA 3QARA 2IO3B 4P7IA 1WXSA 1ISNA 2DX5B 2FCMA 2HTHA 3EFUA 1NDDA 3T8MA 2J0JA 1KOTA 4GIVA 2LI5A 1Q0WB 1F9JA 2G4DB 2FCNA 3VDZA 1WGYA 2FAZA 4NAWB 1RLFA 1V5TA 1WYWB 4XC2A 4TQ1A 3SHQA 2C7HA 4II2B 1WFYA 3TL5A 4GB9A 5LLIA 3AULA 4PS7A 1V80A 1LXDA 5D6JB 4FHKA 2KTFA 2KFKB 4W9DA 3QJZA 4WJOA 2N9XA 1WGGA 3QAQA 3DBSA 2O6VA 3DVGY 3VTUA 1LQBA 2JUOA 3R66C 4MSQB 1GC7A 3UIOB 4MGZE 1GUAB 2WX0A 2K25A 1WRDB 1CMXB 4FLHA 4RMAA 1GC6A 3PVLA 4ANXA 3RCZA 5J2RA 2RPQA 4I6LB 2LVQA 3PRZA 4WWOA 2JPHA 2KTRA 3O65B 4PYZA 2OJRA 2VRRB 5DPWA 4HCNB 2LXAA 3A9KA 2MBQA 3PSEB 3VUWA 2KFJA 3X0WA 1TGZB 4WAAA 2NPTA 3DBHI 1WZ0A 4W9HA 3SD5A 4A20A 1C3TA 1J0GA 4HXDA 4FA6A 1D3ZA 2REXA 2KDFB 1S1QB 2BKFA 2K6DB 4TQ0A 4FADA 4CYEA 4F1SA 1TZ1A 2XK5B 2I1JA 4RM8A 3ENEA 2N9EB 2EMTA 1I42A 4MJSA 2DAFA 2KLGA 4B95A 1H8CA 4FJVB 4DDID 2R2OA 2KOXA 3OJ3A 2XEWA 3ZNZB 2MBOA 2CS4A 2ZPNA 3NZUA 3V62A 1V9JA 3M62B 4BBNF 1WXMA 2W9NA 4IC7B 4IWOA 4YL8A 4NQKE 3I3TB 3KVFB 3ZTCA 5CHVC 1E7UA 2M4NA 3S2AA 2WWZA 2Z0DB 5AZFA 1P98A 4DHJD 1VD2A 1WM2A 2EMSA 3L54A 3DVNV 1HE8A 4WWNA 1WM3A 4MDKE 2QHOA 4NJ7A 2BYVE 2GBKA 2PPHA 3GZNI 3WALA 4NAWA 4NNJB 3A1QB 2KC2A 4G11A 1X1MA 1WF9A 3H9DA 1SE9A 2CR5A 2JZ3B 3RUIB 3PZDA 2PJHA 5D2MB 4W9KA 2KFKA 2DZMA 3MHSD 1UD7A 4HPMB 2WX1A 3WAPA 2KHWB 2IO2B 3W1SC 3ONSA 2J0KA 1WE7A 4I6PA 4NY0A 3T9LA 3TJPA 5E6NA 1YQBA 4KDIC 1WJUA 4BKTA 1KLVA 1Z5SB 2M8SA 1V5OA 3HIZA 4M8MA 1ZKHA 4E74A 1KM7A 1G6JA 5KHQA 4HLEA 3RZFA 4WJNA 4HDOA 3DBRI 4ICVA 4F8CB 4LDTB 2D07B 2L05A 4I6NB 2AL6A 4WJPA 1P0RA 2MP2B 3WAOA 4ASWC 2BWES 3QX1A 5TR5A 2DZJA 2ZVOA 4MM3A 4DWFA 2LGXA 2IY0B 4WQOB 4K7UA 3ZKJC 3ZNHB 2XK5A 3APDA 4GGQA 2JXXA 2O6VD 3PRPB 3ML8A 1NBFC 5C1ZA 3PGEA 3HM3A 3QA8A 2NVUI 4XZ4A 2GBMA 2LXCA 1V49A 1YJ1A 2JT4B 3DOWA 4BVUC 2NS5A 4TUUA 3H7PB 2WYQA 3NZSA 2MBHA 2RR9A 1XQQA 3OLMD 5C23A 4BFRA 2BKRB 2FIDA 3JYUA 2DYBA 4DDGD 4KVGB 2CU1A 1OQYA 3R7QA 1YD8U 4ZDVA 2L7RA 3APFA 3DDCB 2KZRA 2KX0A 2MA9B 3L13A 4W9EA 4NQLB 3AU4A 4IG7B 3PTFC 4G3XB 5AZHA 3ZTDA 4EEWA 3A1QA 3QCAA 3DVNU 1E90A 1EUVB 3VH4B 4CHKA 1WR6E 2CHZA 2BWFA 4ANVA 1MG8A 2MSED 2L76A 2M1MA 3AXCA 1Q5WB 3UIPB 3ZIMA 2KDBA 2DYMA 3WAMA 3MTNB 2MBEA 2BF8B 3RYTA 2HE7A 2DZIA 5LXIB 3ZRFA 4E3CA 1LFDA 3KUCB 4EFOA 3UF8A 4OVVA 3D32A 1E7VA 1YIWA 4HJKA 4II3B 4MH0E 3V60A 3CMMB 4G50A 4JLCA 3A9JB 1OEYA 1WX9A 2FNJB 4ZRIA 4HWIB 1RFAA 3IFWB 2MP2A 1UGMA 2L0FA 3KYDD 1WH3A 2ASQA 2GBJA 1WXVA 3H1UA 3WANA 4EKUA 2AWTA 2D2QA 3PPAA 4IM0A 1E8XA 3B08A 4DXAB 2MCNB 3JVZX 4DHZE 3B1LX 4KV2A 2KJRA 4AJYB 5KHOA 1WMHB 2DHZA 3CF6E 2K39A 3BY4B 4PYUA 5CHFA 3N3KB 1WJ4A 1WZ3A 3H7PA 2D10A 1H4RA 3PLVA 1WY8A 3U8ZA 2A4ZA 2C60A 1VCBA 4JQWC 4GXBA 2MLBA 4N9F4 5G55A 4B9KA 3N30A 3VUYA 1OTRB 2XBBC 1V81A 1Q1OA 2ZEQA 1LM8B 2JWZA 2MQJA 3X23A 3TIXA 2Y5BB 3ZNGC 2PE9A 3UGBB 3PV1A 4JGHB 5EDSA 3RULA 4HPLB 2LZ6A 4FJYA 4MGKE 5D7GA 3CSFA 2GMIC 2HD5B 3IG3A 2G3QB 2NBUA 4ANUA 2IBIB 2K8CA 2LUEA 3IBEA 2K8HA 2UWQA 2A5UA 4TKNA 1EF1A 2J0MA 3NHEB 4GDKB 4FULA 1K8RB 1EO6A 1YX6B 2KDIA 2M0XA 1JRUA 3APCA 5E6OA 3W1YA 2C9WB 1P3QU 3VFKA 2KKCA 1UELA 2ZZPB 1XT9B 1UZXB 4JIOU 1WX8A 4MGYE 5HKHA 3VQIA 3VHTC 1PQSA 3VTWA 3QIJA 5AEKB 4G0NB 2KO3A 4M8NA 3A9JA 2KD0A 3ALBA 3UQBA 3HK0A 1IP9A 4LCDE 2I1KA 2KVRA 4B6WA 4URKA 3C0RB 2N7EA 2KQ7A 3JW0X 4AP4C 3AI5A 3MJWA 3TCAA 4MSMB 3W1SA 3RD2A 2G45B 3M95A 4HVBA 2YVCA 1WMHA 2CHWA 2LWPA 4IM2A 3LDZE 1P9DU 3QQ8B 4GU2A 4W9IA 5CHWA 3VVWB 3IHPC 2OOBB 1A5RA 2LGYA 3DBLI 4HK2A 2JRHA 2LVOA 4W9JA 5IAAC 2ZVNA 3DPDA 4ZYNA 5JHAA 3L08A 4KSLC 4LDTD 3KUDB 2L00B 4M0WB 2Z0EB 3AU5A 3JSVB 2GBRA 1OEYJ 2DZKA 4GMVA 3DQVA 1QZEA 4A3OA 3DCGA 4GOCA 3KYCD 5DPSA 1TTNA 1WX7A 3H6NA 3R3MA 2B3AA 3VTVA 4BOZB 4W9GA 4W9CA 3ZNID 2KWVB 4K81A 2MX2A 1KJTA 1AARA 1WJNA 2O2VB 2N1VA 3M63B 4NJ6A 1RAXA 1FXTB 3VAWA 3IVFA 2FCSA 5AZGA 1WXAA 2KNBA 3PS6A 4KZCA 5DCNA 1L2NA 4AUQC 1V86A 3N32A 4BKSA 1S3SG 3HHMA 4GDKA 3UINB 1GG3A 3U30A 3A4SC 3VUXA 3ZO5B 3U7DA 4IW0A 4LJPB 3EECA 2NR2A 5L83A 2KJHB 2V3SA 4AWJA 2BPSA 4KZ0A 2UYZB 2KLCA 4FHJA 4HCPB 4W9FA 3NOBA 2K8BA 2GBNA 2FIFA 1P1AA 5E6PA 3ZDMC 5LXHA 1UBQA 2PE6B 1I35A 3CSTA 4PS3A 5J17A 2RGFA 2KC1A 2C5LC 2MWSB 2ZCCA 1C1YB 3DVGX 3QC8B 2ZNVC 2M17A 1NI2A 1M94A 4GDLB 1RRBA 1UH6A 1WJ6A 2BGFA 2KXJA 3PHWB 2JF5A 4W9LA 3VXWA 1J19A 1WGHA 4EOYA 2KQSA 3ZVVA 4PS8A 2V1YA 3KW5B
chains in the Genus database with same CATH superfamily
2JZPA 3DBRB 2LHEA 3DHGC 3PREA 4WJQA 4M0WA 2RMMA 5CX3A 5BMHA 2ZPYA 3DBLB 2JYEA 4MEMA 2O2VA 3BK1A 2AL3A 2ZJDA 2KJ6A 2RD0A 4GLSC 2KMAA 2KANA 1RYJA 4OZCA 1NEKB 1SGHA 3AM9A 1I4XA 2ON8A 2FE8A 4TV3A 1V97A 4K7WA 1IPGA 1JWSD 4US8A 4BBNC 3B0AA 5G5GA 5L95C 1SIFA 3W2DA 3RNGC 2GOWA 3R2IA 5GXGB 2FCQA 4A3PA 3LXFA 1V6EA 2KN5A 3C8YA 5CTRC 1YQ3B 2KX3A 2W3SA 1SF0A 3GE3C 3ZDTA 2PW9A 3PRMB 1E8ZA 4LJOB 2C7MB 4DQOC 1IYFA 3BYYB 1GPXA 4F7ZA 1ZDVA 1XD3B 2X38A 2N1WA 2J7QB 3V61A 2KTRB 1AWDA 3OAWA 2NBWB 4JX1C 2EKEC 1KRHA 3ML9A 3BVMA 4LNOA 1HQRD 1C77A 4ICUA 3M3JA 1R4MI 2X8XX 1T0YA 2FUHB 5H8YE 2WXOA 4EUTA 3V6CB 1FFVA 1WIAA 3SFEB 3RN9C 2K3UA 4AOFA 1IBXA 3PLUA 3QARA 4OW0A 1V1PA 4P7IA 3EFUA 2HTHA 2J0JA 3BK2A 4NAWB 1WYWB 4IKGA 1FO4A 4YT0B 4W9DA 3QJZA 1YJIA 3QAQA 2O6VA 4TMAB 2JUOA 2RDHA 1GC7A 5FK9C 4RMAA 4ANXA 2LVQA 3TEWA 4PYZA 2LMCA 4KKJA 1D5ZC 1WZ0A 4W9HA 3MP9A 3ZYYX 1FCCC 4HXDA 1QQRA 1R7SA 1T6BX 1MJDA 3P1MA 4RM8A 2N9EB 2KLGA 4RF1A 2ACZB 3ZNZB 2BS2B 2CS4A 3V62A 1V9JA 4IC7B 2W9NA 5CHVC 2M4NA 5EE9A 1R4MB 1XLNA 3W5VB 1WM2A 2EMSA 1MHXA 2PKOA 1AW7A 4WWNA 1WM3A 1FXAA 1WF9A 1SE9A 4LNIA 2CR5A 5D2MB 2DZMA 1A70A 4P1BC 2WX1A 3WAPA 3W1SC 4I6PA 1NVID 5E6NA 2WDVB 1YOVB 1G6JA 5KHQA 3SFDB 4WJNA 3IXSA 4I6NB 2WXGA 3WAOA 4ASWC 3PZ7A 4N58A 5TR5A 2DZJA 4KKIA 3MC0B 4RGOS 3ZKJC 4K7UA 3ZNHB 5JH5C 1QILA 3DHHC 1ZP0B 1MG4A 1SE4A 2GBMA 2LXCA 4BVUC 5HFYA 2E6XA 1VRAB 1KLUD 4TUUA 1YJJA 1JWMD 2LGSA 3APFA 5IKCM 1EWYC 2KZRA 4LNFA 3H8HA 2QIEB 4BAXA 4EEWA 3A1QA 2DWQA 3EGRA 1WR6E 2CHZA 4NAMA 4WQMA 3AXCA 1Q5WB 2BYTA 3ZIMA 4ARCA 3HVZA 3RMKC 4KGRA 3WAMA 3MTNB 4UDUC 2MJ3A 3RYTA 2RPVA 2NTSA 1AYFA 2XN9C 3KUCB 1WGKA 1E7VA 1YIWA 1YN4A 4HJKA 3N9YC 4II3B 3V60A 1UGJA 4JLCA 1OEYA 1WX9A 2FNJB 4ZRIA 5HHDG 1QT9A 2JSVX 3KYDD 4MH8A 1C79A 2D2QA 2G9HD 1E8XA 1LO5D 4DHZE 3B1LX 4AJYB 1E9MA 1WMHB 5KHOA 4JWSC 3BY4B 3N3KB 3H7PA 1H4RA 1VCBA 1XLPA 4GXBA 5T8IA 2MLBA 4N9F4 4B9KA 1Y56A 3N30A 4A6QA 2JWZA 3FKYA 2RDBC 3MC8A 2Y5BB 2VH2A 3UGBB 3RULA 4HPLB 2LZ6A 4FJYA 1QOGA 1NYRA 1IGDA 4C00A 1GAQB 3U2SC 3IBEA 1UWMA 1SE2A 3DHIC 2J0MA 4FULA 1EO6A 3W1YA 1XT9B 1VJKA 1WX8A 2KO3A 1JWAD 3ALBA 3HK0A 3UQBA 4LCDE 2I1KA 3RNEC 3C0RB 1XLQA 4C7YA 3TCAA 3MJWA 1E10A 4MSMB 3RD2A 2G45B 3M95A 1SIJA 2Y3AA 3FILA 3LDZE 3W5UB 3IHPC 4PT5A 4AS1A 4HEA1 2WU5B 4LK0M 5IAAC 3DPDA 1L0XB 3L08A 2L00B 2Z0EB 3Q8FA 3JSVB 2GBRA 1OEYJ 3DQVA 2WQYB 1FFUA 3B2GA 4XGAB 3KYCD 5DPSA 1QF6A 4RNAA 4HPPA 1KJTA 4NJ6A 1CJEA 3M63B 1N5XA 2BS4B 5AZGA 1L4ZB 2FCSA 1B1ZA 1WXAA 3RNFC 1V86A 4GDKA 3U30A 3A4SC 3VUXA 3NG0A 4LJPB 2LFIA 2BPSA 4FHJA 3RNCC 1JMLA 2K8BA 3P4RB 3R8BA 2GBNA 4EE2A 1P1AA 1TYGB 5LXHA 1UBQA 4KX6B 4C80A 2ZCCA 3QC8B 3KQ4A 2M17A 1D4BA 4GDLB 3RI7C 1RRBA 3GB1A 1FEHA 1UH6A 4B0EA 2DNFA 2K22A 1XF5L 2V1YA 3I9V1 3QK0A 4A90A 3AE3B 4NJCA 3GE8C 4EZJA 1WR1A 3Q3JA 2B76B 1N60A 2DYOA 1BT0A 3KUZA 5BYQA 3KWVA 1IUEA 4ZYSA 4ZRKA 1I4QA 1U4AA 2V0GA 1M4VA 4E71A 1L6UA 3SEBA 3HM6X 1FD6A 4FN2A 2LASA 4M01A 1BMLC 3H7SA 4K7SA 2N4FA 3GOEA 2AEHA 2LRUA 3PHXB 1ZUD2 4LTUA 1D5MC 1KH0A 1ENFA 4DHJB 2VH1A 3RNAC 3MC9A 2IYDB 1E0ZA 2BT6A 2L8JA 4FJZA 4IWQA 2IO1B 4XWTA 2YLMA 3UI3A 1KTKA 4K1RB 1UBIA 3K9PB 1WXQA 2WDTB 3VH3B 3RT3B 2I38A 4BOSC 4GN1A 2HJ8A 3EC8A 4XE0A 3V6EB 1GJZA 2CKHB 3TMPB 3ZXVA 3TEYA 1C9FA 1VZ8A 1MHHE 5DPTA 1IGCA 2J4XA 1J8CA 2DAJA 1J7CA 3WA0A 2NCNA 1GNUA 1SXTA 4BKGA 3NJTA 2PEAA 2D3GA 2NPTB 2ZW1A 5MPOA 5BYRA 2LGIA 5G2NA 3EHVA 1BUIC 2NBVB 1TKYA 1OGWA 2PIAA 2TSSA 3LJ3A 4HDQA 2NMQA 3ZXRA 2LEKA 4MJSB 3ZQ4A 3NVYA 1J7BA 4KIKA 1E8WA 1WYGA 2L0TA 2PMVA 1MVKA 3L17A 2WS3B 4WWPA 2LGDA 2JX5A 2IGDA 2AX5A 1KOTA 1NDDA 2LI5A 1Q0WB 1F9JA 2FAZA 2C7HA 3LYYA 4II2B 4PS7A 3C19A 1LXDA 1DGJA 1F2RI 4FHKA 4P1CC 1FRRA 2KTFA 4HKZE 4YTPB 3DWGC 4MSQB 1VR9A 3UIOB 4MGZE 2WX0A 4C4VA 2K25A 2QILA 3PVLA 2D3CA 5J2RA 4I6LB 1ZOYB 2WXRA 2SAKA 3O65B 4YSZB 5BMIA 2VRRB 4HCNB 3WCQA 2WDRB 2MBQA 3A9KA 3PSEB 1F1HA 1TGZB 4WAAA 3DBHI 1J0GA 1FPYA 4A20A 1C3TA 2REXA 2KDFB 4MM3B 2K6DB 2WXHA 4FADA 4CYEA 2XK5B 3NUHB 3NVZA 2BQQA 2EMTA 3TEZA 1N63A 4FJVB 2R2OA 2KOXA 3OJ3A 2GB1A 3NZUA 4BBNF 4YL8A 3I3TB 3KVFB 1E7UA 3S2AA 1KLGD 2Z0DB 5AZFA 4DHJD 1HE8A 2N9KA 4PK1A 2PPHA 2D3AA 3IT6B 4OVZA 3H9DA 3RNBC 4WAFA 3N1XC 2KFKA 4HPMB 3VR9B 4YSXB 3ONSA 2J0KA 1WE7A 1E7PB 3T9LA 3TJPA 1YQBA 4KDIC 1Z5SB 4L1BA 2NTTA 1JWUD 2JU6X 4HLEA 2WXLA 3B2FA 1HEZE 4HROA 4ICVA 4F8CB 2D07B 3P4PB 4WJPA 2AL6A 5I4DA 1P0RA 1OFFA 1TKGA 3O13A 4WQOB 3PGEA 1XCTL 3AEBB 4XZ4A 4O1NA 1HTOA 2NS5A 3GP7A 2MBHA 3DWMA 5C23A 1I7HA 4BFRA 3TEXA 1OQYA 1YD8U 2L7RA 3ZJVA 2KQ4X 1JROA 3L13A 4W9EA 3ZTDA 1EUVB 4CHKA 4KGSA 2MSED 2N0SB 2L52A 5EE3A 2QDFA 1FMAD 2MBEA 2HE7A 1TS5A 1I4PA 3UF8A 2MJEA 2YEPB 3D32A 4MH0E 1PDXA 5H92C 3A9JB 4WH4A 4B0MA 3IFWB 2MP2A 1WH3A 3H1UA 1CZPA 4YSYB 4HKQA 3U52E 2WXMA 4KV2A 2KJRA 2INNE 4J3OD 3RPFC 2QJLA 1HZ6A 2M19A 2DBYA 4PYUA 1WJ4A 1WZ3A 1XEEA 4HJGE 2D10A 2K5PA 2IGHA 3FAHA 1JW9D 3Q6BA 1OTRB 3CIRB 3BWUD 2MQJA 3TIXA 1QLBB 2D3BA 5EDSA 1VZ6A 2MEKA 5D7GA 3CSFA 2GMIC 2HD5B 1RM6C 1XCQL 3J9CA 2NBUA 4ANUA 4XWWA 3NHEB 3Q8BA 2WNMA 3Q3MC 2M0XA 1YMHE 2V9HA 3APCA 5E6OA 2L83A 1T0RC 2JXTA 3RFZB 3VFKA 2KKCA 1UELA 4JIOU 3VQIA 3VHTC 1QOFA 3QIJA 5AEKB 1KF6B 1IP9A 1UF0A 4B6WA 1SSNA 4HVBA 2CHWA 1NENB 4M00A 1P9DU 3QQ8B 4REZA 4W9IA 1A5RA 2LHDA 4RGNA 2R61A 4ZYNA 4USAA 2AQ2B 4M0WB 3AN1A 3AU5A 1C76A 4GMVA 1PGXA 3DCGA 3VTVA 2WHIA 1V8CA 2CJOA 2HJ1A 3EA6A 4K81A 1TJEA 2MX2A 2WGSA 4LNKA 2O2VB 2N1VA 1RAXA 1FXTB 3IVFA 3UINB 2QEJC 2INDC 3URYA 5G5HA 3ZO5B 1ZDXA 3N20C 4IW0A 1Q10A 2NR2A 2KJHB 5IN7A 2KLCA 4HCPB 4W9FA 3NOBA 3ZDMC 4AQ7A 2N7JA 2PE6B 3CSTA 2I2YA 2RGFA 4K3BA 2C5LC 2MWSB 2HTME 4N6EB 1EM7A 2ZNVC 1NI2A 4ZHOA 1NI3A 2KXJA 1FNUA 3PHWB 4W9LA 3VXWA 4ZHPA 2KQSA 1D5XC 2LVPA 4XDCA 1WE6A 2Y5CA 2BYFA 3AMZA 2LRWA 1YNTE 2KACA 5HI1A 2WXFA 3V05A 3R7RA 3EUB2 2H88B 1GOZA 1ZE3D 4EZLA 1PGAA 5D3IB 2R2QA 3L16A 1VDVA 4OHJA 2AQ1B 4DK5A 1QOBA 2MW5A 1WI0A 1ZPSA 4XX5A 4RF0A 2RSUA 2IZVB 2WXKA 1TS4A 1TKEA 2KDMA 2IDYA 4KDLB 4BKSD 4GSWA 3AE2B 3U7ZA 2LJ5A 2KMCA 2D5GA 3P2BA 3CWIA 4KSKC 1E8YA 1E6EB 3ZRCA 2BYEA 5IOIA 1IBXB 3PT2B 3OG5A 2JYTA 4IUMB 1Z2MA 1V1PB 4ZRJA 3A33B 3SU8X 1L4DB 3BVZA 4MGIE 1PYWD 3L0WB 5DPRA 2D11A 2PTLA 2AYOB 2ZNVB 5EE1A 1YX5B 5E6JA 4DBGA 1YN5A 5FR6A 1WSPA 4J6IA 2ZW0A 1UWXA 2O6VB 3Q8CA 3Q8EA 3MFGA 4FBJB 5J18A 1TBEA 5LNK1 5JHBA 3RZWC 3Q3FA 4JL9A 3AE7B 2G4SA 2IO0B 2ONQA 5GMVA 3VRAB 1WGRA 2KWUB 3UQAA 5IA7A 4DHZB 2JRIB 1CQVA 3SR6A 1EF5A 5D3DA 2WP9B 3EFCA 1VLBA 3SDLC 5FR3A 1JCKB 1V2YA 2CHXA 2N9PC 2LD9A 3T3OA 3ZUNA 2V4LA 2FBWB 2MRPA 2KWCA 3ZW3A 5JZEB 5HG2A 2CU3A 1WXSA 2QSDA 2FCMA 3T8MA 4GIVA 2G4DB 5AUKA 2FCNA 1WGYA 1V5TA 3SHQA 3AULA 1V80A 5D6JB 4C7ZA 3AV8A 1LQBA 3R66C 1T0QC 2PVOD 3FC4A 1CMXB 1GC6A 1FIQA 5IP4D 3RCZA 2RPQA 3PRZA 2KTRA 2OJRA 4YXDB 3VUWA 2KFJA 1RFKA 1D3ZA 4FA6A 1HA5A 4A8XC 1S1QB 4US9A 4TQ0A 4F1SA 3W9CB 1TZ1A 2J52A 2I1JA 1ESFA 3AEEB 3AH7A 2DAFA 4B95A 1C4CA 1H8CA 4DDID 2XEWA 2ZPNA 1T0SC 1ET9A 3M62B 1N5WA 4IWOA 4NQKE 2BTEA 3ZTCA 1SE3A 2WWZA 1P98A 1PFDA 1VD2A 3L54A 2WXPA 4MDKE 1MPEA 2BYVE 3GZNI 3WALA 4NAWA 4NNJB 3A1QB 4G11A 4LNNA 3PZ8A 1X1MA 2JWUA 3PZDA 3MHSD 1C4PA 1UD7A 1RWSA 4ZRPA 1D6EC 1QOAA 2KHWB 4P16A 4NY0A 1WJUA 2M8SA 3HIZA 1V5OA 4RFBA 1ZKHA 1KM7A 1YN3A 3N1YC 1K52A 3RZFA 4HDOA 3DBRI 2DLBA 4LDTB 2L05A 2BWES 3B9JA 2IY0B 2O6VD 1XO3A 3PRPB 3AECB 3HM3A 1V49A 1YJ1A 3HVDA 3H7PB 2WYQA 5JXVA 2IJ0A 3OLMD 4JWUC 1L6VA 4DDGD 2DYBA 2CU1A 3NZ3A 2Y5PA 3R7QA 2ICIA 2MH7A 2L32A 2KX0A 2MJDA 4IOIE 1TY2A 2LUMA 3PTFC 1T3QA 3Q2AC 4G3XB 4IG7B 5IO9A 3QCAA 3DVNU 2BW2A 1E90A 2BWFA 3Q3OC 1EU4A 1F2RC 2L76A 3UIPB 2KDBA 3GZNB 3ZRFA 1LFDA 1ACCA 4EFOA 3CMMB 2RDGA 1UGMA 4RCOA 4EKUA 3WANA 3HRDD 2AWTA 3ZJUA 1QKZA 3PPAA 3B08A 4DXAB 2MCNB 3JVZX 2WDQB 1N6ZA 3FILB 2DHZA 3CF6E 5CHFA 1PGBA 2SEBD 3U8ZA 2A4ZA 2C60A 2V3PA 2J42A 2WXQA 4RGTA 2W55A 4DXFA 3PV1A 4R3DA 4MGKE 4JPSA 3IG3A 2G3QB 2YEPF 1K53A 2BS3B 2XNAC 4D2KA 2Z8LA 4TKNA 4DXGA 4GDKB 1FNWA 1K8RB 1OQRA 1YX6B 2KDIA 4BZAA 3BYTB 1ZXIA 1FM0D 1I4HA 1UZXB 4A9AA 1JWBD 4NZLB 2INCC 2VZKD 3I5JC 2KD0A 2QCZA 1V1OA 2KVRA 4URKA 1C78A 2BB6A 3JW0X 4AP4C 3AI5A 3PO0A 3W1SA 2YVCA 1WMHA 3P4QB 3U4EG 1B9RA 3VVWB 1I4GA 2OOBB 2LGYA 1PUTA 4HK2A 2LVOA 4W9JA 1SB3C 4YTMB 2ZVNA 1P7EA 4LDTD 3AEGB 2BVCA 3DBHB 1FRDA 4XYCA 2DZKA 2HDEA 4A3OA 4RH6A 2W54A 3R3MA 4W9GA 3ZNID 3E56A 4Q2JA 3N1ZC 2KWVB 3AE9B 1AARA 1EWCA 5EE0A 2KNBA 3PS6A 4KZCA 1F77A 1EU3A 1NYQA 3U7DA 1N62A 4H2AA 5L83A 3VRBB 2UYZB 1XXGA 2MHJA 2N9LA 1TZOA 1I35A 5J17A 2KVZA 2M56B 3KLSX 4ACFA 3P63A 3ZGZA 1M94A 3V3XA 4WIPA 2JF5A 1T5XD 1J19A 1WGHA 4PS8A 3KW5B 1J7AA 1VZ7A 3HUIA 2Z59B 1K51A 2KDEB 4WWMA 1BXTA 2KK8A 1WGDA 2E3TA 2C7NB 3JSVA 3MHZA 1ZW7A 5BO4B 1TT5B 3NRZA 3I63C 4K3CA 1HZ5A 3K9OB 4IWPA 4ZOHC 1C4AA 4X57B 4TSSA 1Y8RC 1SEBD 3KH0A 1UUPA 1ET6A 2KT7A 2AQ3B 4JE3B 3QWZB 3L4PA 3NS8A 2JVCA 2JY6A 2L3ZA 5D94A 3OJ4B 1DYQA 3ZLZA 3NY5A 4KIKB 4GDLA 4ZRQA 2DENB 3ECIA 3A4RA 4XDDA 2IGGA 1R4NI 2J53A 3TBLD 4EZKA 1DOIA 3OWEB 4NPNA 1DOYA 4AJWA 2H89B 1E5WA 2W3RA 4KGTA 4IM3A 2MBBB 4C4VB 2JZZA 4ITKA 2EKIA 3BVGA 2N7DA 1SBBB 4RM9A 3KWLA 3A9KB 1ROEA 4ANWA 2K1FA 3L10B 2WXJA 4MELA 2UU7A 2IY1B 2ZCBA 4P6VF 4CO7A 3NS1A 2K6QA 1ZGUB 3QHTA 3BINA 3R2TA 5BMGA 3TUOA 2K9XA 3WIMA 4OVUA 4RGMA 1F52A 1L7YA 2L1AA 3P42A 2BBCA 2IO3B 3AE6B 1ISNA 2DX5B 2QC8A 3VDZA 1RLFA 4XC2A 4TQ1A 1WFYA 3TL5A 4GB9A 5LLIA 1TS2A 4YTNB 1R4NB 4M02A 2KFKB 2W82A 2WLBA 4WJOA 2N9XA 2PLPA 1WGGA 3DBSA 3DVGY 2PVGC 3VTUA 1JALA 2OHFA 1GUAB 1CK1A 1WRDB 4FLHA 2WXIA 4WWOA 2JPHA 5DPWA 2LXAA 1JQ4A 3LB8C 3X0WA 1FNVA 2NPTA 3SD5A 4C56C 4MACA 2BKFA 3IAS1 3ENEA 1I42A 4MJSA 2GRIA 2CJNA 1GB4A 3ZJTA 1L0VB 2MBOA 1WXMA 3ABVB 4L23A 5FKAC 3AE4B 3DVNV 2QHOA 4NJ7A 2GBKA 2WXNA 3AEDB 2KC2A 4IDIA 2GLSA 2JZ3B 3RUIB 2FUG1 2PJHA 4W9KA 4S0RA 4N59A 1YQ4B 2IO2B 1MI0A 4BKTA 1KLVA 2INPE 4M8MA 4E74A 1LGRA 2WU2B 1WRIA 4CQNA 3AE1B 2MP2B 4HRSA 3QX1A 2ZVOA 4MM3A 4DWFA 3E9SA 2IPKD 2LGXA 3Q3NC 2OJWA 2XK5A 3APDA 2JXXA 4GGQA 5C1ZA 3ML8A 1NBFC 3ETRA 3QA8A 2NVUI 2JT4B 3DOWA 3NZSA 2RR9A 1XQQA 2BKRB 2FIDA 3JYUA 4KVGB 4ZDVA 3AEAB 3AB5A 5C3JB 3DDCB 3NVVA 3AEFB 2MA9B 2LJIA 4NQLB 3AU4A 5AZHA 2K0PA 2V4IB 3IT4B 3VH4B 3AE5B 2JQRB 4ANVA 1SJHD 1MG8A 2M1MA 1SJED 4OZAA 2DYMA 4A55A 2BB5A 2BF8B 4FXCA 3BIID 2DZIA 3Q8AA 5LXIB 4E3CA 1HTQA 4OVVA 5TSSA 1N61A 1OQQA 4G50A 4HWIB 1RFAA 2L0FA 2GBJA 2ASQA 1WXVA 3VR8B 4IM0A 4LLGM 1WWTA 2KAJA 1L5PA 1ZXHA 2K39A 2OEDA 3PLVA 1WY8A 3P4SB 1TS3A 4JQWC 2M0AA 1GB1A 5G55A 3I57A 3VUYA 2XBBC 1V81A 1Q1OA 1JRPA 1XLOA 1LM8B 2ZEQA 3X23A 3ZNGC 2PE9A 4MT5A 4JGHB 2G1EA 3MJ5A 2IBIB 2K8CA 2LUEA 2K8HA 2UWQA 2VZKB 2A5UA 1F0ZA 1EF1A 2KWDA 3Q69A 3Q14C 1JRUA 5AUIA 2C9WB 3TSSA 1P3QU 2ZZPB 1FXIA 4MGYE 5C2TB 5HKHA 1PQSA 3VTWA 4G0NB 4M8NA 3A9JA 3NVWA 1STEA 1I4RA 1HXYD 2N7EA 2KQ7A 3AE8B 3T3NA 2LWPA 4IM2A 4GU2A 5CHWA 4OZBA 1TIFA 1AN8A 2KYWA 3DBLI 2JRHA 3GS2A 5JHAA 4KSLC 2QMTA 3KUDB 1KFYB 1P7FA 1QZEA 4QAYA 4GOCA 1TTNA 1WX7A 3H6NA 4BOZB 2B3AA 4W9CA 4YWGG 1WJNA 3VAWA 4ARIA 4L2YA 1TY0A 5DCNA 1L0YB 2GI9A 1L2NA 4AUQC 4BKSA 3N32A 1S3SG 3HHMA 1GG3A 1UNSA 1MFWA 3EECA 4WURA 2V3SA 4AWJA 4KZ0A 2KMMA 1FCLA 5BYSA 2FIFA 5E6PA 4PS3A 2KC1A 1C1YB 3DVGX 2Q5WD 2EELA 1DOXA 3IAM1 1K50A 2KN4A 2V3NA 4S17A 1WJ6A 2BGFA 4EOYA 3ZVVA 3BZDB
chains in the Genus database with same CATH topology
2LVPA 2Z59B 3QK0A 2KDEB 3PREA 4WJQA 1WE6A 2KK8A 4EZJA 1WR1A 1WGDA 3JSVA 2C7NB 3Q3JA 2DYOA 5CX3A 2BYFA 1BT0A 3KUZA 2ZPYA 2LRWA 1ZW7A 4MEMA 5BO4B 4ZRKA 1U4AA 4E71A 2O2VA 3R7RA 3HM6X 4FN2A 2LASA 3K9OB 2AL3A 4EZLA 2ZJDA 3H7SA 2KJ6A 4IWPA 4K7SA 2N4FA 3GOEA 2RD0A 2AEHA 2R2QA 3L16A 4X57B 2KMAA 2LRUA 1Y8RC 2KANA 4DK5A 3KH0A 2MW5A 3PHXB 1WI0A 1SGHA 4DHJB 4XX5A 3QWZB 2IYDB 4TV3A 3NS8A 2JVCA 2JY6A 2L3ZA 2L8JA 2IZVB 2RSUA 4K7WA 5D94A 3OJ4B 1IPGA 4FJZA 4BBNC 4IWQA 4KDLB 3B0AA 4BKSD 2IO1B 3ZLZA 4GSWA 3NY5A 5L95C 2LJ5A 4KIKB 2KMCA 4GDLA 1SIFA 2DENB 3ECIA 3P2BA 2GOWA 4KSKC 2YLMA 1E8YA 3ZRCA 2FCQA 3A4RA 4A3PA 2BYEA 4K1RB 3PT2B 1UBIA 3K9PB 2WDTB 1V6EA 2KN5A 4IUMB 1R4NI 3VH3B 1Z2MA 4ZRJA 3RT3B 4BOSC 3A33B 5CTRC 3TBLD 3SU8X 4EZKA 4GN1A 4MGIE 2HJ8A 2KX3A 3L0WB 3EC8A 5DPRA 2D11A 2AYOB 2ZNVB 3V6EB 1YX5B 4NPNA 1GJZA 2CKHB 3TMPB 3ZDTA 4DBGA 3PRMB 5FR6A 4AJWA 1E5WA 4J6IA 1E8ZA 4LJOB 2C7MB 1IYFA 2O6VB 4IM3A 5DPTA 2MBBB 4F7ZA 1XD3B 4FBJB 5J18A 2JZZA 1TBEA 2N1WA 5JH5C 2DAJA 2J7QB 1J8CA 5JHBA 3V61A 3WA0A 2KTRB 2N7DA 3OAWA 2NCNA 4RM9A 3RZWC 2NBWB 3Q3FA 1GNUA 3A9KB 4JL9A 4BKGA 2EKEC 2G4SA 2IO0B 5GMVA 3ML9A 4ANWA 2PEAA 2D3GA 2K1FA 2NPTB 3L10B 1WGRA 2KWUB 3UQAA 5IA7A 5G2NA 4MELA 3EHVA 2NBVB 2JRIB 4DHZB 1OGWA 3LJ3A 2IY1B 4HDQA 2ZCBA 1EF5A 4ICUA 4CO7A 3M3JA 4MJSB 1R4MI 3SDLC 2K6QA 1ZGUB 1T0YA 2FUHB 1V2YA 3QHTA 2CHXA 4KIKA 2N9PC 1E8WA 3BINA 4EUTA 2LD9A 2L0TA 3V6CB 3ZUNA 2V4LA 2MRPA 2KWCA 3L17A 1WIAA 3WIMA 4WWPA 3ZW3A 5JZEB 4OVUA 2LGDA 4AOFA 1L7YA 3PLUA 3QARA 2IO3B 4P7IA 1WXSA 1ISNA 2DX5B 2FCMA 2HTHA 3EFUA 1NDDA 3T8MA 2J0JA 1KOTA 4GIVA 2LI5A 1Q0WB 1F9JA 2G4DB 2FCNA 3VDZA 1WGYA 2FAZA 4NAWB 1RLFA 1V5TA 1WYWB 4XC2A 4TQ1A 3SHQA 2C7HA 4II2B 1WFYA 3TL5A 4GB9A 5LLIA 3AULA 4PS7A 1V80A 1LXDA 5D6JB 4FHKA 2KTFA 2KFKB 4W9DA 3QJZA 4WJOA 2N9XA 1WGGA 3QAQA 3DBSA 2O6VA 3DVGY 3VTUA 1LQBA 2JUOA 3R66C 4MSQB 1GC7A 3UIOB 4MGZE 1GUAB 2WX0A 2K25A 1WRDB 1CMXB 4FLHA 4RMAA 1GC6A 3PVLA 4ANXA 3RCZA 5J2RA 2RPQA 4I6LB 2LVQA 3PRZA 4WWOA 2JPHA 2KTRA 3O65B 4PYZA 2OJRA 2VRRB 5DPWA 4HCNB 2LXAA 3A9KA 2MBQA 3PSEB 3VUWA 2KFJA 3X0WA 1TGZB 4WAAA 2NPTA 3DBHI 1WZ0A 4W9HA 3SD5A 4A20A 1C3TA 1J0GA 4HXDA 4FA6A 1D3ZA 2REXA 2KDFB 1S1QB 2BKFA 2K6DB 4TQ0A 4FADA 4CYEA 4F1SA 1TZ1A 2XK5B 2I1JA 4RM8A 3ENEA 2N9EB 2EMTA 1I42A 4MJSA 2DAFA 2KLGA 4B95A 1H8CA 4FJVB 4DDID 2R2OA 2KOXA 3OJ3A 2XEWA 3ZNZB 2MBOA 2CS4A 2ZPNA 3NZUA 3V62A 1V9JA 3M62B 4BBNF 1WXMA 2W9NA 4IC7B 4IWOA 4YL8A 4NQKE 3I3TB 3KVFB 3ZTCA 5CHVC 1E7UA 2M4NA 3S2AA 2WWZA 2Z0DB 5AZFA 1P98A 4DHJD 1VD2A 1WM2A 2EMSA 3L54A 3DVNV 1HE8A 4WWNA 1WM3A 4MDKE 2QHOA 4NJ7A 2BYVE 2GBKA 2PPHA 3GZNI 3WALA 4NAWA 4NNJB 3A1QB 2KC2A 4G11A 1X1MA 1WF9A 3H9DA 1SE9A 2CR5A 2JZ3B 3RUIB 3PZDA 2PJHA 5D2MB 4W9KA 2KFKA 2DZMA 3MHSD 1UD7A 4HPMB 2WX1A 3WAPA 2KHWB 2IO2B 3W1SC 3ONSA 2J0KA 1WE7A 4I6PA 4NY0A 3T9LA 3TJPA 5E6NA 1YQBA 4KDIC 1WJUA 4BKTA 1KLVA 1Z5SB 2M8SA 1V5OA 3HIZA 4M8MA 1ZKHA 4E74A 1KM7A 1G6JA 5KHQA 4HLEA 3RZFA 4WJNA 4HDOA 3DBRI 4ICVA 4F8CB 4LDTB 2D07B 2L05A 4I6NB 2AL6A 4WJPA 1P0RA 2MP2B 3WAOA 4ASWC 2BWES 3QX1A 5TR5A 2DZJA 2ZVOA 4MM3A 4DWFA 2LGXA 2IY0B 4WQOB 4K7UA 3ZKJC 3ZNHB 2XK5A 3APDA 4GGQA 2JXXA 2O6VD 3PRPB 3ML8A 1NBFC 5C1ZA 3PGEA 3HM3A 3QA8A 2NVUI 4XZ4A 2GBMA 2LXCA 1V49A 1YJ1A 2JT4B 3DOWA 4BVUC 2NS5A 4TUUA 3H7PB 2WYQA 3NZSA 2MBHA 2RR9A 1XQQA 3OLMD 5C23A 4BFRA 2BKRB 2FIDA 3JYUA 2DYBA 4DDGD 4KVGB 2CU1A 1OQYA 3R7QA 1YD8U 4ZDVA 2L7RA 3APFA 3DDCB 2KZRA 2KX0A 2MA9B 3L13A 4W9EA 4NQLB 3AU4A 4IG7B 3PTFC 4G3XB 5AZHA 3ZTDA 4EEWA 3A1QA 3QCAA 3DVNU 1E90A 1EUVB 3VH4B 4CHKA 1WR6E 2CHZA 2BWFA 4ANVA 1MG8A 2MSED 2L76A 2M1MA 3AXCA 1Q5WB 3UIPB 3ZIMA 2KDBA 2DYMA 3WAMA 3MTNB 2MBEA 2BF8B 3RYTA 2HE7A 2DZIA 5LXIB 3ZRFA 4E3CA 1LFDA 3KUCB 4EFOA 3UF8A 4OVVA 3D32A 1E7VA 1YIWA 4HJKA 4II3B 4MH0E 3V60A 3CMMB 4G50A 4JLCA 3A9JB 1OEYA 1WX9A 2FNJB 4ZRIA 4HWIB 1RFAA 3IFWB 2MP2A 1UGMA 2L0FA 3KYDD 1WH3A 2ASQA 2GBJA 1WXVA 3H1UA 3WANA 4EKUA 2AWTA 2D2QA 3PPAA 4IM0A 1E8XA 3B08A 4DXAB 2MCNB 3JVZX 4DHZE 3B1LX 4KV2A 2KJRA 4AJYB 5KHOA 1WMHB 2DHZA 3CF6E 2K39A 3BY4B 4PYUA 5CHFA 3N3KB 1WJ4A 1WZ3A 3H7PA 2D10A 1H4RA 3PLVA 1WY8A 3U8ZA 2A4ZA 2C60A 1VCBA 4JQWC 4GXBA 2MLBA 4N9F4 5G55A 4B9KA 3N30A 3VUYA 1OTRB 2XBBC 1V81A 1Q1OA 2ZEQA 1LM8B 2JWZA 2MQJA 3X23A 3TIXA 2Y5BB 3ZNGC 2PE9A 3UGBB 3PV1A 4JGHB 5EDSA 3RULA 4HPLB 2LZ6A 4FJYA 4MGKE 5D7GA 3CSFA 2GMIC 2HD5B 3IG3A 2G3QB 2NBUA 4ANUA 2IBIB 2K8CA 2LUEA 3IBEA 2K8HA 2UWQA 2A5UA 4TKNA 1EF1A 2J0MA 3NHEB 4GDKB 4FULA 1K8RB 1EO6A 1YX6B 2KDIA 2M0XA 1JRUA 3APCA 5E6OA 3W1YA 2C9WB 1P3QU 3VFKA 2KKCA 1UELA 2ZZPB 1XT9B 1UZXB 4JIOU 1WX8A 4MGYE 5HKHA 3VQIA 3VHTC 1PQSA 3VTWA 3QIJA 5AEKB 4G0NB 2KO3A 4M8NA 3A9JA 2KD0A 3ALBA 3UQBA 3HK0A 1IP9A 4LCDE 2I1KA 2KVRA 4B6WA 4URKA 3C0RB 2N7EA 2KQ7A 3JW0X 4AP4C 3AI5A 3MJWA 3TCAA 4MSMB 3W1SA 3RD2A 2G45B 3M95A 4HVBA 2YVCA 1WMHA 2CHWA 2LWPA 4IM2A 3LDZE 1P9DU 3QQ8B 4GU2A 4W9IA 5CHWA 3VVWB 3IHPC 2OOBB 1A5RA 2LGYA 3DBLI 4HK2A 2JRHA 2LVOA 4W9JA 5IAAC 2ZVNA 3DPDA 4ZYNA 5JHAA 3L08A 4KSLC 4LDTD 3KUDB 2L00B 4M0WB 2Z0EB 3AU5A 3JSVB 2GBRA 1OEYJ 2DZKA 4GMVA 3DQVA 1QZEA 4A3OA 3DCGA 4GOCA 3KYCD 5DPSA 1TTNA 1WX7A 3H6NA 3R3MA 2B3AA 3VTVA 4BOZB 4W9GA 4W9CA 3ZNID 2KWVB 4K81A 2MX2A 1KJTA 1AARA 1WJNA 2O2VB 2N1VA 3M63B 4NJ6A 1RAXA 1FXTB 3VAWA 3IVFA 2FCSA 5AZGA 1WXAA 2KNBA 3PS6A 4KZCA 5DCNA 1L2NA 4AUQC 1V86A 3N32A 4BKSA 1S3SG 3HHMA 4GDKA 3UINB 1GG3A 3U30A 3A4SC 3VUXA 3ZO5B 3U7DA 4IW0A 4LJPB 3EECA 2NR2A 5L83A 2KJHB 2V3SA 4AWJA 2BPSA 4KZ0A 2UYZB 2KLCA 4FHJA 4HCPB 4W9FA 3NOBA 2K8BA 2GBNA 2FIFA 1P1AA 5E6PA 3ZDMC 5LXHA 1UBQA 2PE6B 1I35A 3CSTA 4PS3A 5J17A 2RGFA 2KC1A 2C5LC 2MWSB 2ZCCA 1C1YB 3DVGX 3QC8B 2ZNVC 2M17A 1NI2A 1M94A 4GDLB 1RRBA 1UH6A 1WJ6A 2BGFA 2KXJA 3PHWB 2JF5A 4W9LA 3VXWA 1J19A 1WGHA 4EOYA 2KQSA 3ZVVA 4PS8A 2V1YA 3KW5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVP A;  2Z59 B;  3QK0 A;  2KDE B;  3PRE A;  4WJQ A;  1WE6 A;  2KK8 A;  4EZJ A;  1WR1 A;  1WGD A;  3JSV A;  2C7N B;  3Q3J A;  2DYO A;  5CX3 A;  2BYF A;  1BT0 A;  3KUZ A;  2ZPY A;  2LRW A;  1ZW7 A;  4MEM A;  5BO4 B;  4ZRK A;  1U4A A;  4E71 A;  2O2V A;  3R7R A;  3HM6 X;  4FN2 A;  2LAS A;  3K9O B;  2AL3 A;  4EZL A;  2ZJD A;  3H7S A;  2KJ6 A;  4IWP A;  4K7S A;  2N4F A;  3GOE A;  2RD0 A;  2AEH A;  2R2Q A;  3L16 A;  4X57 B;  2KMA A;  2LRU A;  1Y8R C;  2KAN A;  4DK5 A;  3KH0 A;  2MW5 A;  3PHX B;  1WI0 A;  1SGH A;  4DHJ B;  4XX5 A;  3QWZ B;  2IYD B;  4TV3 A;  3NS8 A;  2JVC A;  2JY6 A;  2L3Z A;  2L8J A;  2IZV B;  2RSU A;  4K7W A;  5D94 A;  3OJ4 B;  1IPG A;  4FJZ A;  4BBN C;  4IWQ A;  4KDL B;  3B0A A;  4BKS D;  2IO1 B;  3ZLZ A;  4GSW A;  3NY5 A;  5L95 C;  2LJ5 A;  4KIK B;  2KMC A;  4GDL A;  1SIF A;  2DEN B;  3ECI A;  3P2B A;  2GOW A;  4KSK C;  2YLM A;  1E8Y A;  3ZRC A;  2FCQ A;  3A4R A;  4A3P A;  2BYE A;  4K1R B;  3PT2 B;  1UBI A;  3K9P B;  2WDT B;  1V6E A;  2KN5 A;  4IUM B;  1R4N I;  3VH3 B;  1Z2M A;  4ZRJ A;  3RT3 B;  4BOS C;  3A33 B;  5CTR C;  3TBL D;  3SU8 X;  4EZK A;  4GN1 A;  4MGI E;  2HJ8 A;  2KX3 A;  3L0W B;  3EC8 A;  5DPR A;  2D11 A;  2AYO B;  2ZNV B;  3V6E B;  1YX5 B;  4NPN A;  1GJZ A;  2CKH B;  3TMP B;  3ZDT A;  4DBG A;  3PRM B;  5FR6 A;  4AJW A;  1E5W A;  4J6I A;  1E8Z A;  4LJO B;  2C7M B;  1IYF A;  2O6V B;  4IM3 A;  5DPT A;  2MBB B;  4F7Z A;  1XD3 B;  4FBJ B;  5J18 A;  2JZZ A;  1TBE A;  2N1W A;  5JH5 C;  2DAJ A;  2J7Q B;  1J8C A;  5JHB A;  3V61 A;  3WA0 A;  2KTR B;  2N7D A;  3OAW A;  2NCN A;  4RM9 A;  3RZW C;  2NBW B;  3Q3F A;  1GNU A;  3A9K B;  4JL9 A;  4BKG A;  2EKE C;  2G4S A;  2IO0 B;  5GMV A;  3ML9 A;  4ANW A;  2PEA A;  2D3G A;  2K1F A;  2NPT B;  3L10 B;  1WGR A;  2KWU B;  3UQA A;  5IA7 A;  5G2N A;  4MEL A;  3EHV A;  2NBV B;  2JRI B;  4DHZ B;  1OGW A;  3LJ3 A;  2IY1 B;  4HDQ A;  2ZCB A;  1EF5 A;  4ICU A;  4CO7 A;  3M3J A;  4MJS B;  1R4M I;  3SDL C;  2K6Q A;  1ZGU B;  1T0Y A;  2FUH B;  1V2Y A;  3QHT A;  2CHX A;  4KIK A;  2N9P C;  1E8W A;  3BIN A;  4EUT A;  2LD9 A;  2L0T A;  3V6C B;  3ZUN A;  2V4L A;  2MRP A;  2KWC A;  3L17 A;  1WIA A;  3WIM A;  4WWP A;  3ZW3 A;  5JZE B;  4OVU A;  2LGD A;  4AOF A;  1L7Y A;  3PLU A;  3QAR A;  2IO3 B;  4P7I A;  1WXS A;  1ISN A;  2DX5 B;  2FCM A;  2HTH A;  3EFU A;  1NDD A;  3T8M A;  2J0J A;  1KOT A;  4GIV A;  2LI5 A;  1Q0W B;  1F9J A;  2G4D B;  2FCN A;  3VDZ A;  1WGY A;  2FAZ A;  4NAW B;  1RLF A;  1V5T A;  1WYW B;  4XC2 A;  4TQ1 A;  3SHQ A;  2C7H A;  4II2 B;  1WFY A;  3TL5 A;  4GB9 A;  5LLI A;  3AUL A;  4PS7 A;  1V80 A;  1LXD A;  5D6J B;  4FHK A;  2KTF A;  2KFK B;  4W9D A;  3QJZ A;  4WJO A;  2N9X A;  1WGG A;  3QAQ A;  3DBS A;  2O6V A;  3DVG Y;  3VTU A;  1LQB A;  2JUO A;  3R66 C;  4MSQ B;  1GC7 A;  3UIO B;  4MGZ E;  1GUA B;  2WX0 A;  2K25 A;  1WRD B;  1CMX B;  4FLH A;  4RMA A;  1GC6 A;  3PVL A;  4ANX A;  3RCZ A;  5J2R A;  2RPQ A;  4I6L B;  2LVQ A;  3PRZ A;  4WWO A;  2JPH A;  2KTR A;  3O65 B;  4PYZ A;  2OJR A;  2VRR B;  5DPW A;  4HCN B;  2LXA A;  3A9K A;  2MBQ A;  3PSE B;  3VUW A;  2KFJ A;  3X0W A;  1TGZ B;  4WAA A;  2NPT A;  3DBH I;  1WZ0 A;  4W9H A;  3SD5 A;  4A20 A;  1C3T A;  1J0G A;  4HXD A;  4FA6 A;  1D3Z A;  2REX A;  2KDF B;  1S1Q B;  2BKF A;  2K6D B;  4TQ0 A;  4FAD A;  4CYE A;  4F1S A;  1TZ1 A;  2XK5 B;  2I1J A;  4RM8 A;  3ENE A;  2N9E B;  2EMT A;  1I42 A;  4MJS A;  2DAF A;  2KLG A;  4B95 A;  1H8C A;  4FJV B;  4DDI D;  2R2O A;  2KOX A;  3OJ3 A;  2XEW A;  3ZNZ B;  2MBO A;  2CS4 A;  2ZPN A;  3NZU A;  3V62 A;  1V9J A;  3M62 B;  4BBN F;  1WXM A;  2W9N A;  4IC7 B;  4IWO A;  4YL8 A;  4NQK E;  3I3T B;  3KVF B;  3ZTC A;  5CHV C;  1E7U A;  2M4N A;  3S2A A;  2WWZ A;  2Z0D B;  5AZF A;  1P98 A;  4DHJ D;  1VD2 A;  1WM2 A;  2EMS A;  3L54 A;  3DVN V;  1HE8 A;  4WWN A;  1WM3 A;  4MDK E;  2QHO A;  4NJ7 A;  2BYV E;  2GBK A;  2PPH A;  3GZN I;  3WAL A;  4NAW A;  4NNJ B;  3A1Q B;  2KC2 A;  4G11 A;  1X1M A;  1WF9 A;  3H9D A;  1SE9 A;  2CR5 A;  2JZ3 B;  3RUI B;  3PZD A;  2PJH A;  5D2M B;  4W9K A;  2KFK A;  2DZM A;  3MHS D;  1UD7 A;  4HPM B;  2WX1 A;  3WAP A;  2KHW B;  2IO2 B;  3W1S C;  3ONS A;  2J0K A;  1WE7 A;  4I6P A;  4NY0 A;  3T9L A;  3TJP A;  5E6N A;  1YQB A;  4KDI C;  1WJU A;  4BKT A;  1KLV A;  1Z5S B;  2M8S A;  1V5O A;  3HIZ A;  4M8M A;  1ZKH A;  4E74 A;  1KM7 A;  1G6J A;  5KHQ A;  4HLE A;  3RZF A;  4WJN A;  4HDO A;  3DBR I;  4ICV A;  4F8C B;  4LDT B;  2D07 B;  2L05 A;  4I6N B;  2AL6 A;  4WJP A;  1P0R A;  2MP2 B;  3WAO A;  4ASW C;  2BWE S;  3QX1 A;  5TR5 A;  2DZJ A;  2ZVO A;  4MM3 A;  4DWF A;  2LGX A;  2IY0 B;  4WQO B;  4K7U A;  3ZKJ C;  3ZNH B;  2XK5 A;  3APD A;  4GGQ A;  2JXX A;  2O6V D;  3PRP B;  3ML8 A;  1NBF C;  5C1Z A;  3PGE A;  3HM3 A;  3QA8 A;  2NVU I;  4XZ4 A;  2GBM A;  2LXC A;  1V49 A;  1YJ1 A;  2JT4 B;  3DOW A;  4BVU C;  2NS5 A;  4TUU A;  3H7P B;  2WYQ A;  3NZS A;  2MBH A;  2RR9 A;  1XQQ A;  3OLM D;  5C23 A;  4BFR A;  2BKR B;  2FID A;  3JYU A;  2DYB A;  4DDG D;  4KVG B;  2CU1 A;  1OQY A;  3R7Q A;  1YD8 U;  4ZDV A;  2L7R A;  3APF A;  3DDC B;  2KZR A;  2KX0 A;  2MA9 B;  3L13 A;  4W9E A;  4NQL B;  3AU4 A;  4IG7 B;  3PTF C;  4G3X B;  5AZH A;  3ZTD A;  4EEW A;  3A1Q A;  3QCA A;  3DVN U;  1E90 A;  1EUV B;  3VH4 B;  4CHK A;  1WR6 E;  2CHZ A;  2BWF A;  4ANV A;  1MG8 A;  2MSE D;  2L76 A;  2M1M A;  3AXC A;  1Q5W B;  3UIP B;  3ZIM A;  2KDB A;  2DYM A;  3WAM A;  3MTN B;  2MBE A;  2BF8 B;  3RYT A;  2HE7 A;  2DZI A;  5LXI B;  3ZRF A;  4E3C A;  1LFD A;  3KUC B;  4EFO A;  3UF8 A;  4OVV A;  3D32 A;  1E7V A;  1YIW A;  4HJK A;  4II3 B;  4MH0 E;  3V60 A;  3CMM B;  4G50 A;  4JLC A;  3A9J B;  1OEY A;  1WX9 A;  2FNJ B;  4ZRI A;  4HWI B;  1RFA A;  3IFW B;  2MP2 A;  1UGM A;  2L0F A;  3KYD D;  1WH3 A;  2ASQ A;  2GBJ A;  1WXV A;  3H1U A;  3WAN A;  4EKU A;  2AWT A;  2D2Q A;  3PPA A;  4IM0 A;  1E8X A;  3B08 A;  4DXA B;  2MCN B;  3JVZ X;  4DHZ E;  3B1L X;  4KV2 A;  2KJR A;  4AJY B;  5KHO A;  1WMH B;  2DHZ A;  3CF6 E;  2K39 A;  3BY4 B;  4PYU A;  5CHF A;  3N3K B;  1WJ4 A;  1WZ3 A;  3H7P A;  2D10 A;  1H4R A;  3PLV A;  1WY8 A;  3U8Z A;  2A4Z A;  2C60 A;  1VCB A;  4JQW C;  4GXB A;  2MLB A;  4N9F 4;  5G55 A;  4B9K A;  3N30 A;  3VUY A;  1OTR B;  2XBB C;  1V81 A;  1Q1O A;  2ZEQ A;  1LM8 B;  2JWZ A;  2MQJ A;  3X23 A;  3TIX A;  2Y5B B;  3ZNG C;  2PE9 A;  3UGB B;  3PV1 A;  4JGH B;  5EDS A;  3RUL A;  4HPL B;  2LZ6 A;  4FJY A;  4MGK E;  5D7G A;  3CSF A;  2GMI C;  2HD5 B;  3IG3 A;  2G3Q B;  2NBU A;  4ANU A;  2IBI B;  2K8C A;  2LUE A;  3IBE A;  2K8H A;  2UWQ A;  2A5U A;  4TKN A;  1EF1 A;  2J0M A;  3NHE B;  4GDK B;  4FUL A;  1K8R B;  1EO6 A;  1YX6 B;  2KDI A;  2M0X A;  1JRU A;  3APC A;  5E6O A;  3W1Y A;  2C9W B;  1P3Q U;  3VFK A;  2KKC A;  1UEL A;  2ZZP B;  1XT9 B;  1UZX B;  4JIO U;  1WX8 A;  4MGY E;  5HKH A;  3VQI A;  3VHT C;  1PQS A;  3VTW A;  3QIJ A;  5AEK B;  4G0N B;  2KO3 A;  4M8N A;  3A9J A;  2KD0 A;  3ALB A;  3UQB A;  3HK0 A;  1IP9 A;  4LCD E;  2I1K A;  2KVR A;  4B6W A;  4URK A;  3C0R B;  2N7E A;  2KQ7 A;  3JW0 X;  4AP4 C;  3AI5 A;  3MJW A;  3TCA A;  4MSM B;  3W1S A;  3RD2 A;  2G45 B;  3M95 A;  4HVB A;  2YVC A;  1WMH A;  2CHW A;  2LWP A;  4IM2 A;  3LDZ E;  1P9D U;  3QQ8 B;  4GU2 A;  4W9I A;  5CHW A;  3VVW B;  3IHP C;  2OOB B;  1A5R A;  2LGY A;  3DBL I;  4HK2 A;  2JRH A;  2LVO A;  4W9J A;  5IAA C;  2ZVN A;  3DPD A;  4ZYN A;  5JHA A;  3L08 A;  4KSL C;  4LDT D;  3KUD B;  2L00 B;  4M0W B;  2Z0E B;  3AU5 A;  3JSV B;  2GBR A;  1OEY J;  2DZK A;  4GMV A;  3DQV A;  1QZE A;  4A3O A;  3DCG A;  4GOC A;  3KYC D;  5DPS A;  1TTN A;  1WX7 A;  3H6N A;  3R3M A;  2B3A A;  3VTV A;  4BOZ B;  4W9G A;  4W9C A;  3ZNI D;  2KWV B;  4K81 A;  2MX2 A;  1KJT A;  1AAR A;  1WJN A;  2O2V B;  2N1V A;  3M63 B;  4NJ6 A;  1RAX A;  1FXT B;  3VAW A;  3IVF A;  2FCS A;  5AZG A;  1WXA A;  2KNB A;  3PS6 A;  4KZC A;  5DCN A;  1L2N A;  4AUQ C;  1V86 A;  3N32 A;  4BKS A;  1S3S G;  3HHM A;  4GDK A;  3UIN B;  1GG3 A;  3U30 A;  3A4S C;  3VUX A;  3ZO5 B;  3U7D A;  4IW0 A;  4LJP B;  3EEC A;  2NR2 A;  5L83 A;  2KJH B;  2V3S A;  4AWJ A;  2BPS A;  4KZ0 A;  2UYZ B;  2KLC A;  4FHJ A;  4HCP B;  4W9F A;  3NOB A;  2K8B A;  2GBN A;  2FIF A;  1P1A A;  5E6P A;  3ZDM C;  5LXH A;  1UBQ A;  2PE6 B;  1I35 A;  3CST A;  4PS3 A;  5J17 A;  2RGF A;  2KC1 A;  2C5L C;  2MWS B;  2ZCC A;  1C1Y B;  3DVG X;  3QC8 B;  2ZNV C;  2M17 A;  1NI2 A;  1M94 A;  4GDL B;  1RRB A;  1UH6 A;  1WJ6 A;  2BGF A;  2KXJ A;  3PHW B;  2JF5 A;  4W9L A;  3VXW A;  1J19 A;  1WGH A;  4EOY A;  2KQS A;  3ZVV A;  4PS8 A;  2V1Y A;  3KW5 B; 
#chains in the Genus database with same CATH topology
 2JZP A;  3DBR B;  2LHE A;  3DHG C;  3PRE A;  4WJQ A;  4M0W A;  2RMM A;  5CX3 A;  5BMH A;  2ZPY A;  3DBL B;  2JYE A;  4MEM A;  2O2V A;  3BK1 A;  2AL3 A;  2ZJD A;  2KJ6 A;  2RD0 A;  4GLS C;  2KMA A;  2KAN A;  1RYJ A;  4OZC A;  1NEK B;  1SGH A;  3AM9 A;  1I4X A;  2ON8 A;  2FE8 A;  4TV3 A;  1V97 A;  4K7W A;  1IPG A;  1JWS D;  4US8 A;  4BBN C;  3B0A A;  5G5G A;  5L95 C;  1SIF A;  3W2D A;  3RNG C;  2GOW A;  3R2I A;  5GXG B;  2FCQ A;  4A3P A;  3LXF A;  1V6E A;  2KN5 A;  3C8Y A;  5CTR C;  1YQ3 B;  2KX3 A;  2W3S A;  1SF0 A;  3GE3 C;  3ZDT A;  2PW9 A;  3PRM B;  1E8Z A;  4LJO B;  2C7M B;  4DQO C;  1IYF A;  3BYY B;  1GPX A;  4F7Z A;  1ZDV A;  1XD3 B;  2X38 A;  2N1W A;  2J7Q B;  3V61 A;  2KTR B;  1AWD A;  3OAW A;  2NBW B;  4JX1 C;  2EKE C;  1KRH A;  3ML9 A;  3BVM A;  4LNO A;  1HQR D;  1C77 A;  4ICU A;  3M3J A;  1R4M I;  2X8X X;  1T0Y A;  2FUH B;  5H8Y E;  2WXO A;  4EUT A;  3V6C B;  1FFV A;  1WIA A;  3SFE B;  3RN9 C;  2K3U A;  4AOF A;  1IBX A;  3PLU A;  3QAR A;  4OW0 A;  1V1P A;  4P7I A;  3EFU A;  2HTH A;  2J0J A;  3BK2 A;  4NAW B;  1WYW B;  4IKG A;  1FO4 A;  4YT0 B;  4W9D A;  3QJZ A;  1YJI A;  3QAQ A;  2O6V A;  4TMA B;  2JUO A;  2RDH A;  1GC7 A;  5FK9 C;  4RMA A;  4ANX A;  2LVQ A;  3TEW A;  4PYZ A;  2LMC A;  4KKJ A;  1D5Z C;  1WZ0 A;  4W9H A;  3MP9 A;  3ZYY X;  1FCC C;  4HXD A;  1QQR A;  1R7S A;  1T6B X;  1MJD A;  3P1M A;  4RM8 A;  2N9E B;  2KLG A;  4RF1 A;  2ACZ B;  3ZNZ B;  2BS2 B;  2CS4 A;  3V62 A;  1V9J A;  4IC7 B;  2W9N A;  5CHV C;  2M4N A;  5EE9 A;  1R4M B;  1XLN A;  3W5V B;  1WM2 A;  2EMS A;  1MHX A;  2PKO A;  1AW7 A;  4WWN A;  1WM3 A;  1FXA A;  1WF9 A;  1SE9 A;  4LNI A;  2CR5 A;  5D2M B;  2DZM A;  1A70 A;  4P1B C;  2WX1 A;  3WAP A;  3W1S C;  4I6P A;  1NVI D;  5E6N A;  2WDV B;  1YOV B;  1G6J A;  5KHQ A;  3SFD B;  4WJN A;  3IXS A;  4I6N B;  2WXG A;  3WAO A;  4ASW C;  3PZ7 A;  4N58 A;  5TR5 A;  2DZJ A;  4KKI A;  3MC0 B;  4RGO S;  3ZKJ C;  4K7U A;  3ZNH B;  5JH5 C;  1QIL A;  3DHH C;  1ZP0 B;  1MG4 A;  1SE4 A;  2GBM A;  2LXC A;  4BVU C;  5HFY A;  2E6X A;  1VRA B;  1KLU D;  4TUU A;  1YJJ A;  1JWM D;  2LGS A;  3APF A;  5IKC M;  1EWY C;  2KZR A;  4LNF A;  3H8H A;  2QIE B;  4BAX A;  4EEW A;  3A1Q A;  2DWQ A;  3EGR A;  1WR6 E;  2CHZ A;  4NAM A;  4WQM A;  3AXC A;  1Q5W B;  2BYT A;  3ZIM A;  4ARC A;  3HVZ A;  3RMK C;  4KGR A;  3WAM A;  3MTN B;  4UDU C;  2MJ3 A;  3RYT A;  2RPV A;  2NTS A;  1AYF A;  2XN9 C;  3KUC B;  1WGK A;  1E7V A;  1YIW A;  1YN4 A;  4HJK A;  3N9Y C;  4II3 B;  3V60 A;  1UGJ A;  4JLC A;  1OEY A;  1WX9 A;  2FNJ B;  4ZRI A;  5HHD G;  1QT9 A;  2JSV X;  3KYD D;  4MH8 A;  1C79 A;  2D2Q A;  2G9H D;  1E8X A;  1LO5 D;  4DHZ E;  3B1L X;  4AJY B;  1E9M A;  1WMH B;  5KHO A;  4JWS C;  3BY4 B;  3N3K B;  3H7P A;  1H4R A;  1VCB A;  1XLP A;  4GXB A;  5T8I A;  2MLB A;  4N9F 4;  4B9K A;  1Y56 A;  3N30 A;  4A6Q A;  2JWZ A;  3FKY A;  2RDB C;  3MC8 A;  2Y5B B;  2VH2 A;  3UGB B;  3RUL A;  4HPL B;  2LZ6 A;  4FJY A;  1QOG A;  1NYR A;  1IGD A;  4C00 A;  1GAQ B;  3U2S C;  3IBE A;  1UWM A;  1SE2 A;  3DHI C;  2J0M A;  4FUL A;  1EO6 A;  3W1Y A;  1XT9 B;  1VJK A;  1WX8 A;  2KO3 A;  1JWA D;  3ALB A;  3HK0 A;  3UQB A;  4LCD E;  2I1K A;  3RNE C;  3C0R B;  1XLQ A;  4C7Y A;  3TCA A;  3MJW A;  1E10 A;  4MSM B;  3RD2 A;  2G45 B;  3M95 A;  1SIJ A;  2Y3A A;  3FIL A;  3LDZ E;  3W5U B;  3IHP C;  4PT5 A;  4AS1 A;  4HEA 1;  2WU5 B;  4LK0 M;  5IAA C;  3DPD A;  1L0X B;  3L08 A;  2L00 B;  2Z0E B;  3Q8F A;  3JSV B;  2GBR A;  1OEY J;  3DQV A;  2WQY B;  1FFU A;  3B2G A;  4XGA B;  3KYC D;  5DPS A;  1QF6 A;  4RNA A;  4HPP A;  1KJT A;  4NJ6 A;  1CJE A;  3M63 B;  1N5X A;  2BS4 B;  5AZG A;  1L4Z B;  2FCS A;  1B1Z A;  1WXA A;  3RNF C;  1V86 A;  4GDK A;  3U30 A;  3A4S C;  3VUX A;  3NG0 A;  4LJP B;  2LFI A;  2BPS A;  4FHJ A;  3RNC C;  1JML A;  2K8B A;  3P4R B;  3R8B A;  2GBN A;  4EE2 A;  1P1A A;  1TYG B;  5LXH A;  1UBQ A;  4KX6 B;  4C80 A;  2ZCC A;  3QC8 B;  3KQ4 A;  2M17 A;  1D4B A;  4GDL B;  3RI7 C;  1RRB A;  3GB1 A;  1FEH A;  1UH6 A;  4B0E A;  2DNF A;  2K22 A;  1XF5 L;  2V1Y A;  3I9V 1;  3QK0 A;  4A90 A;  3AE3 B;  4NJC A;  3GE8 C;  4EZJ A;  1WR1 A;  3Q3J A;  2B76 B;  1N60 A;  2DYO A;  1BT0 A;  3KUZ A;  5BYQ A;  3KWV A;  1IUE A;  4ZYS A;  4ZRK A;  1I4Q A;  1U4A A;  2V0G A;  1M4V A;  4E71 A;  1L6U A;  3SEB A;  3HM6 X;  1FD6 A;  4FN2 A;  2LAS A;  4M01 A;  1BML C;  3H7S A;  4K7S A;  2N4F A;  3GOE A;  2AEH A;  2LRU A;  3PHX B;  1ZUD 2;  4LTU A;  1D5M C;  1KH0 A;  1ENF A;  4DHJ B;  2VH1 A;  3RNA C;  3MC9 A;  2IYD B;  1E0Z A;  2BT6 A;  2L8J A;  4FJZ A;  4IWQ A;  2IO1 B;  4XWT A;  2YLM A;  3UI3 A;  1KTK A;  4K1R B;  1UBI A;  3K9P B;  1WXQ A;  2WDT B;  3VH3 B;  3RT3 B;  2I38 A;  4BOS C;  4GN1 A;  2HJ8 A;  3EC8 A;  4XE0 A;  3V6E B;  1GJZ A;  2CKH B;  3TMP B;  3ZXV A;  3TEY A;  1C9F A;  1VZ8 A;  1MHH E;  5DPT A;  1IGC A;  2J4X A;  1J8C A;  2DAJ A;  1J7C A;  3WA0 A;  2NCN A;  1GNU A;  1SXT A;  4BKG A;  3NJT A;  2PEA A;  2D3G A;  2NPT B;  2ZW1 A;  5MPO A;  5BYR A;  2LGI A;  5G2N A;  3EHV A;  1BUI C;  2NBV B;  1TKY A;  1OGW A;  2PIA A;  2TSS A;  3LJ3 A;  4HDQ A;  2NMQ A;  3ZXR A;  2LEK A;  4MJS B;  3ZQ4 A;  3NVY A;  1J7B A;  4KIK A;  1E8W A;  1WYG A;  2L0T A;  2PMV A;  1MVK A;  3L17 A;  2WS3 B;  4WWP A;  2LGD A;  2JX5 A;  2IGD A;  2AX5 A;  1KOT A;  1NDD A;  2LI5 A;  1Q0W B;  1F9J A;  2FAZ A;  2C7H A;  3LYY A;  4II2 B;  4PS7 A;  3C19 A;  1LXD A;  1DGJ A;  1F2R I;  4FHK A;  4P1C C;  1FRR A;  2KTF A;  4HKZ E;  4YTP B;  3DWG C;  4MSQ B;  1VR9 A;  3UIO B;  4MGZ E;  2WX0 A;  4C4V A;  2K25 A;  2QIL A;  3PVL A;  2D3C A;  5J2R A;  4I6L B;  1ZOY B;  2WXR A;  2SAK A;  3O65 B;  4YSZ B;  5BMI A;  2VRR B;  4HCN B;  3WCQ A;  2WDR B;  2MBQ A;  3A9K A;  3PSE B;  1F1H A;  1TGZ B;  4WAA A;  3DBH I;  1J0G A;  1FPY A;  4A20 A;  1C3T A;  2REX A;  2KDF B;  4MM3 B;  2K6D B;  2WXH A;  4FAD A;  4CYE A;  2XK5 B;  3NUH B;  3NVZ A;  2BQQ A;  2EMT A;  3TEZ A;  1N63 A;  4FJV B;  2R2O A;  2KOX A;  3OJ3 A;  2GB1 A;  3NZU A;  4BBN F;  4YL8 A;  3I3T B;  3KVF B;  1E7U A;  3S2A A;  1KLG D;  2Z0D B;  5AZF A;  4DHJ D;  1HE8 A;  2N9K A;  4PK1 A;  2PPH A;  2D3A A;  3IT6 B;  4OVZ A;  3H9D A;  3RNB C;  4WAF A;  3N1X C;  2KFK A;  4HPM B;  3VR9 B;  4YSX B;  3ONS A;  2J0K A;  1WE7 A;  1E7P B;  3T9L A;  3TJP A;  1YQB A;  4KDI C;  1Z5S B;  4L1B A;  2NTT A;  1JWU D;  2JU6 X;  4HLE A;  2WXL A;  3B2F A;  1HEZ E;  4HRO A;  4ICV A;  4F8C B;  2D07 B;  3P4P B;  4WJP A;  2AL6 A;  5I4D A;  1P0R A;  1OFF A;  1TKG A;  3O13 A;  4WQO B;  3PGE A;  1XCT L;  3AEB B;  4XZ4 A;  4O1N A;  1HTO A;  2NS5 A;  3GP7 A;  2MBH A;  3DWM A;  5C23 A;  1I7H A;  4BFR A;  3TEX A;  1OQY A;  1YD8 U;  2L7R A;  3ZJV A;  2KQ4 X;  1JRO A;  3L13 A;  4W9E A;  3ZTD A;  1EUV B;  4CHK A;  4KGS A;  2MSE D;  2N0S B;  2L52 A;  5EE3 A;  2QDF A;  1FMA D;  2MBE A;  2HE7 A;  1TS5 A;  1I4P A;  3UF8 A;  2MJE A;  2YEP B;  3D32 A;  4MH0 E;  1PDX A;  5H92 C;  3A9J B;  4WH4 A;  4B0M A;  3IFW B;  2MP2 A;  1WH3 A;  3H1U A;  1CZP A;  4YSY B;  4HKQ A;  3U52 E;  2WXM A;  4KV2 A;  2KJR A;  2INN E;  4J3O D;  3RPF C;  2QJL A;  1HZ6 A;  2M19 A;  2DBY A;  4PYU A;  1WJ4 A;  1WZ3 A;  1XEE A;  4HJG E;  2D10 A;  2K5P A;  2IGH A;  3FAH A;  1JW9 D;  3Q6B A;  1OTR B;  3CIR B;  3BWU D;  2MQJ A;  3TIX A;  1QLB B;  2D3B A;  5EDS A;  1VZ6 A;  2MEK A;  5D7G A;  3CSF A;  2GMI C;  2HD5 B;  1RM6 C;  1XCQ L;  3J9C A;  2NBU A;  4ANU A;  4XWW A;  3NHE B;  3Q8B A;  2WNM A;  3Q3M C;  2M0X A;  1YMH E;  2V9H A;  3APC A;  5E6O A;  2L83 A;  1T0R C;  2JXT A;  3RFZ B;  3VFK A;  2KKC A;  1UEL A;  4JIO U;  3VQI A;  3VHT C;  1QOF A;  3QIJ A;  5AEK B;  1KF6 B;  1IP9 A;  1UF0 A;  4B6W A;  1SSN A;  4HVB A;  2CHW A;  1NEN B;  4M00 A;  1P9D U;  3QQ8 B;  4REZ A;  4W9I A;  1A5R A;  2LHD A;  4RGN A;  2R61 A;  4ZYN A;  4USA A;  2AQ2 B;  4M0W B;  3AN1 A;  3AU5 A;  1C76 A;  4GMV A;  1PGX A;  3DCG A;  3VTV A;  2WHI A;  1V8C A;  2CJO A;  2HJ1 A;  3EA6 A;  4K81 A;  1TJE A;  2MX2 A;  2WGS A;  4LNK A;  2O2V B;  2N1V A;  1RAX A;  1FXT B;  3IVF A;  3UIN B;  2QEJ C;  2IND C;  3URY A;  5G5H A;  3ZO5 B;  1ZDX A;  3N20 C;  4IW0 A;  1Q10 A;  2NR2 A;  2KJH B;  5IN7 A;  2KLC A;  4HCP B;  4W9F A;  3NOB A;  3ZDM C;  4AQ7 A;  2N7J A;  2PE6 B;  3CST A;  2I2Y A;  2RGF A;  4K3B A;  2C5L C;  2MWS B;  2HTM E;  4N6E B;  1EM7 A;  2ZNV C;  1NI2 A;  4ZHO A;  1NI3 A;  2KXJ A;  1FNU A;  3PHW B;  4W9L A;  3VXW A;  4ZHP A;  2KQS A;  1D5X C;  2LVP A;  4XDC A;  1WE6 A;  2Y5C A;  2BYF A;  3AMZ A;  2LRW A;  1YNT E;  2KAC A;  5HI1 A;  2WXF A;  3V05 A;  3R7R A;  3EUB 2;  2H88 B;  1GOZ A;  1ZE3 D;  4EZL A;  1PGA A;  5D3I B;  2R2Q A;  3L16 A;  1VDV A;  4OHJ A;  2AQ1 B;  4DK5 A;  1QOB A;  2MW5 A;  1WI0 A;  1ZPS A;  4XX5 A;  4RF0 A;  2RSU A;  2IZV B;  2WXK A;  1TS4 A;  1TKE A;  2KDM A;  2IDY A;  4KDL B;  4BKS D;  4GSW A;  3AE2 B;  3U7Z A;  2LJ5 A;  2KMC A;  2D5G A;  3P2B A;  3CWI A;  4KSK C;  1E8Y A;  1E6E B;  3ZRC A;  2BYE A;  5IOI A;  1IBX B;  3PT2 B;  3OG5 A;  2JYT A;  4IUM B;  1Z2M A;  1V1P B;  4ZRJ A;  3A33 B;  3SU8 X;  1L4D B;  3BVZ A;  4MGI E;  1PYW D;  3L0W B;  5DPR A;  2D11 A;  2PTL A;  2AYO B;  2ZNV B;  5EE1 A;  1YX5 B;  5E6J A;  4DBG A;  1YN5 A;  5FR6 A;  1WSP A;  4J6I A;  2ZW0 A;  1UWX A;  2O6V B;  3Q8C A;  3Q8E A;  3MFG A;  4FBJ B;  5J18 A;  1TBE A;  5LNK 1;  5JHB A;  3RZW C;  3Q3F A;  4JL9 A;  3AE7 B;  2G4S A;  2IO0 B;  2ONQ A;  5GMV A;  3VRA B;  1WGR A;  2KWU B;  3UQA A;  5IA7 A;  4DHZ B;  2JRI B;  1CQV A;  3SR6 A;  1EF5 A;  5D3D A;  2WP9 B;  3EFC A;  1VLB A;  3SDL C;  5FR3 A;  1JCK B;  1V2Y A;  2CHX A;  2N9P C;  2LD9 A;  3T3O A;  3ZUN A;  2V4L A;  2FBW B;  2MRP A;  2KWC A;  3ZW3 A;  5JZE B;  5HG2 A;  2CU3 A;  1WXS A;  2QSD A;  2FCM A;  3T8M A;  4GIV A;  2G4D B;  5AUK A;  2FCN A;  1WGY A;  1V5T A;  3SHQ A;  3AUL A;  1V80 A;  5D6J B;  4C7Z A;  3AV8 A;  1LQB A;  3R66 C;  1T0Q C;  2PVO D;  3FC4 A;  1CMX B;  1GC6 A;  1FIQ A;  5IP4 D;  3RCZ A;  2RPQ A;  3PRZ A;  2KTR A;  2OJR A;  4YXD B;  3VUW A;  2KFJ A;  1RFK A;  1D3Z A;  4FA6 A;  1HA5 A;  4A8X C;  1S1Q B;  4US9 A;  4TQ0 A;  4F1S A;  3W9C B;  1TZ1 A;  2J52 A;  2I1J A;  1ESF A;  3AEE B;  3AH7 A;  2DAF A;  4B95 A;  1C4C A;  1H8C A;  4DDI D;  2XEW A;  2ZPN A;  1T0S C;  1ET9 A;  3M62 B;  1N5W A;  4IWO A;  4NQK E;  2BTE A;  3ZTC A;  1SE3 A;  2WWZ A;  1P98 A;  1PFD A;  1VD2 A;  3L54 A;  2WXP A;  4MDK E;  1MPE A;  2BYV E;  3GZN I;  3WAL A;  4NAW A;  4NNJ B;  3A1Q B;  4G11 A;  4LNN A;  3PZ8 A;  1X1M A;  2JWU A;  3PZD A;  3MHS D;  1C4P A;  1UD7 A;  1RWS A;  4ZRP A;  1D6E C;  1QOA A;  2KHW B;  4P16 A;  4NY0 A;  1WJU A;  2M8S A;  3HIZ A;  1V5O A;  4RFB A;  1ZKH A;  1KM7 A;  1YN3 A;  3N1Y C;  1K52 A;  3RZF A;  4HDO A;  3DBR I;  2DLB A;  4LDT B;  2L05 A;  2BWE S;  3B9J A;  2IY0 B;  2O6V D;  1XO3 A;  3PRP B;  3AEC B;  3HM3 A;  1V49 A;  1YJ1 A;  3HVD A;  3H7P B;  2WYQ A;  5JXV A;  2IJ0 A;  3OLM D;  4JWU C;  1L6V A;  4DDG D;  2DYB A;  2CU1 A;  3NZ3 A;  2Y5P A;  3R7Q A;  2ICI A;  2MH7 A;  2L32 A;  2KX0 A;  2MJD A;  4IOI E;  1TY2 A;  2LUM A;  3PTF C;  1T3Q A;  3Q2A C;  4G3X B;  4IG7 B;  5IO9 A;  3QCA A;  3DVN U;  2BW2 A;  1E90 A;  2BWF A;  3Q3O C;  1EU4 A;  1F2R C;  2L76 A;  3UIP B;  2KDB A;  3GZN B;  3ZRF A;  1LFD A;  1ACC A;  4EFO A;  3CMM B;  2RDG A;  1UGM A;  4RCO A;  4EKU A;  3WAN A;  3HRD D;  2AWT A;  3ZJU A;  1QKZ A;  3PPA A;  3B08 A;  4DXA B;  2MCN B;  3JVZ X;  2WDQ B;  1N6Z A;  3FIL B;  2DHZ A;  3CF6 E;  5CHF A;  1PGB A;  2SEB D;  3U8Z A;  2A4Z A;  2C60 A;  2V3P A;  2J42 A;  2WXQ A;  4RGT A;  2W55 A;  4DXF A;  3PV1 A;  4R3D A;  4MGK E;  4JPS A;  3IG3 A;  2G3Q B;  2YEP F;  1K53 A;  2BS3 B;  2XNA C;  4D2K A;  2Z8L A;  4TKN A;  4DXG A;  4GDK B;  1FNW A;  1K8R B;  1OQR A;  1YX6 B;  2KDI A;  4BZA A;  3BYT B;  1ZXI A;  1FM0 D;  1I4H A;  1UZX B;  4A9A A;  1JWB D;  4NZL B;  2INC C;  2VZK D;  3I5J C;  2KD0 A;  2QCZ A;  1V1O A;  2KVR A;  4URK A;  1C78 A;  2BB6 A;  3JW0 X;  4AP4 C;  3AI5 A;  3PO0 A;  3W1S A;  2YVC A;  1WMH A;  3P4Q B;  3U4E G;  1B9R A;  3VVW B;  1I4G A;  2OOB B;  2LGY A;  1PUT A;  4HK2 A;  2LVO A;  4W9J A;  1SB3 C;  4YTM B;  2ZVN A;  1P7E A;  4LDT D;  3AEG B;  2BVC A;  3DBH B;  1FRD A;  4XYC A;  2DZK A;  2HDE A;  4A3O A;  4RH6 A;  2W54 A;  3R3M A;  4W9G A;  3ZNI D;  3E56 A;  4Q2J A;  3N1Z C;  2KWV B;  3AE9 B;  1AAR A;  1EWC A;  5EE0 A;  2KNB A;  3PS6 A;  4KZC A;  1F77 A;  1EU3 A;  1NYQ A;  3U7D A;  1N62 A;  4H2A A;  5L83 A;  3VRB B;  2UYZ B;  1XXG A;  2MHJ A;  2N9L A;  1TZO A;  1I35 A;  5J17 A;  2KVZ A;  2M56 B;  3KLS X;  4ACF A;  3P63 A;  3ZGZ A;  1M94 A;  3V3X A;  4WIP A;  2JF5 A;  1T5X D;  1J19 A;  1WGH A;  4PS8 A;  3KW5 B;  1J7A A;  1VZ7 A;  3HUI A;  2Z59 B;  1K51 A;  2KDE B;  4WWM A;  1BXT A;  2KK8 A;  1WGD A;  2E3T A;  2C7N B;  3JSV A;  3MHZ A;  1ZW7 A;  5BO4 B;  1TT5 B;  3NRZ A;  3I63 C;  4K3C A;  1HZ5 A;  3K9O B;  4IWP A;  4ZOH C;  1C4A A;  4X57 B;  4TSS A;  1Y8R C;  1SEB D;  3KH0 A;  1UUP A;  1ET6 A;  2KT7 A;  2AQ3 B;  4JE3 B;  3QWZ B;  3L4P A;  3NS8 A;  2JVC A;  2JY6 A;  2L3Z A;  5D94 A;  3OJ4 B;  1DYQ A;  3ZLZ A;  3NY5 A;  4KIK B;  4GDL A;  4ZRQ A;  2DEN B;  3ECI A;  3A4R A;  4XDD A;  2IGG A;  1R4N I;  2J53 A;  3TBL D;  4EZK A;  1DOI A;  3OWE B;  4NPN A;  1DOY A;  4AJW A;  2H89 B;  1E5W A;  2W3R A;  4KGT A;  4IM3 A;  2MBB B;  4C4V B;  2JZZ A;  4ITK A;  2EKI A;  3BVG A;  2N7D A;  1SBB B;  4RM9 A;  3KWL A;  3A9K B;  1ROE A;  4ANW A;  2K1F A;  3L10 B;  2WXJ A;  4MEL A;  2UU7 A;  2IY1 B;  2ZCB A;  4P6V F;  4CO7 A;  3NS1 A;  2K6Q A;  1ZGU B;  3QHT A;  3BIN A;  3R2T A;  5BMG A;  3TUO A;  2K9X A;  3WIM A;  4OVU A;  4RGM A;  1F52 A;  1L7Y A;  2L1A A;  3P42 A;  2BBC A;  2IO3 B;  3AE6 B;  1ISN A;  2DX5 B;  2QC8 A;  3VDZ A;  1RLF A;  4XC2 A;  4TQ1 A;  1WFY A;  3TL5 A;  4GB9 A;  5LLI A;  1TS2 A;  4YTN B;  1R4N B;  4M02 A;  2KFK B;  2W82 A;  2WLB A;  4WJO A;  2N9X A;  2PLP A;  1WGG A;  3DBS A;  3DVG Y;  2PVG C;  3VTU A;  1JAL A;  2OHF A;  1GUA B;  1CK1 A;  1WRD B;  4FLH A;  2WXI A;  4WWO A;  2JPH A;  5DPW A;  2LXA A;  1JQ4 A;  3LB8 C;  3X0W A;  1FNV A;  2NPT A;  3SD5 A;  4C56 C;  4MAC A;  2BKF A;  3IAS 1;  3ENE A;  1I42 A;  4MJS A;  2GRI A;  2CJN A;  1GB4 A;  3ZJT A;  1L0V B;  2MBO A;  1WXM A;  3ABV B;  4L23 A;  5FKA C;  3AE4 B;  3DVN V;  2QHO A;  4NJ7 A;  2GBK A;  2WXN A;  3AED B;  2KC2 A;  4IDI A;  2GLS A;  2JZ3 B;  3RUI B;  2FUG 1;  2PJH A;  4W9K A;  4S0R A;  4N59 A;  1YQ4 B;  2IO2 B;  1MI0 A;  4BKT A;  1KLV A;  2INP E;  4M8M A;  4E74 A;  1LGR A;  2WU2 B;  1WRI A;  4CQN A;  3AE1 B;  2MP2 B;  4HRS A;  3QX1 A;  2ZVO A;  4MM3 A;  4DWF A;  3E9S A;  2IPK D;  2LGX A;  3Q3N C;  2OJW A;  2XK5 A;  3APD A;  2JXX A;  4GGQ A;  5C1Z A;  3ML8 A;  1NBF C;  3ETR A;  3QA8 A;  2NVU I;  2JT4 B;  3DOW A;  3NZS A;  2RR9 A;  1XQQ A;  2BKR B;  2FID A;  3JYU A;  4KVG B;  4ZDV A;  3AEA B;  3AB5 A;  5C3J B;  3DDC B;  3NVV A;  3AEF B;  2MA9 B;  2LJI A;  4NQL B;  3AU4 A;  5AZH A;  2K0P A;  2V4I B;  3IT4 B;  3VH4 B;  3AE5 B;  2JQR B;  4ANV A;  1SJH D;  1MG8 A;  2M1M A;  1SJE D;  4OZA A;  2DYM A;  4A55 A;  2BB5 A;  2BF8 B;  4FXC A;  3BII D;  2DZI A;  3Q8A A;  5LXI B;  4E3C A;  1HTQ A;  4OVV A;  5TSS A;  1N61 A;  1OQQ A;  4G50 A;  4HWI B;  1RFA A;  2L0F A;  2GBJ A;  2ASQ A;  1WXV A;  3VR8 B;  4IM0 A;  4LLG M;  1WWT A;  2KAJ A;  1L5P A;  1ZXH A;  2K39 A;  2OED A;  3PLV A;  1WY8 A;  3P4S B;  1TS3 A;  4JQW C;  2M0A A;  1GB1 A;  5G55 A;  3I57 A;  3VUY A;  2XBB C;  1V81 A;  1Q1O A;  1JRP A;  1XLO A;  1LM8 B;  2ZEQ A;  3X23 A;  3ZNG C;  2PE9 A;  4MT5 A;  4JGH B;  2G1E A;  3MJ5 A;  2IBI B;  2K8C A;  2LUE A;  2K8H A;  2UWQ A;  2VZK B;  2A5U A;  1F0Z A;  1EF1 A;  2KWD A;  3Q69 A;  3Q14 C;  1JRU A;  5AUI A;  2C9W B;  3TSS A;  1P3Q U;  2ZZP B;  1FXI A;  4MGY E;  5C2T B;  5HKH A;  1PQS A;  3VTW A;  4G0N B;  4M8N A;  3A9J A;  3NVW A;  1STE A;  1I4R A;  1HXY D;  2N7E A;  2KQ7 A;  3AE8 B;  3T3N A;  2LWP A;  4IM2 A;  4GU2 A;  5CHW A;  4OZB A;  1TIF A;  1AN8 A;  2KYW A;  3DBL I;  2JRH A;  3GS2 A;  5JHA A;  4KSL C;  2QMT A;  3KUD B;  1KFY B;  1P7F A;  1QZE A;  4QAY A;  4GOC A;  1TTN A;  1WX7 A;  3H6N A;  4BOZ B;  2B3A A;  4W9C A;  4YWG G;  1WJN A;  3VAW A;  4ARI A;  4L2Y A;  1TY0 A;  5DCN A;  1L0Y B;  2GI9 A;  1L2N A;  4AUQ C;  4BKS A;  3N32 A;  1S3S G;  3HHM A;  1GG3 A;  1UNS A;  1MFW A;  3EEC A;  4WUR A;  2V3S A;  4AWJ A;  4KZ0 A;  2KMM A;  1FCL A;  5BYS A;  2FIF A;  5E6P A;  4PS3 A;  2KC1 A;  1C1Y B;  3DVG X;  2Q5W D;  2EEL A;  1DOX A;  3IAM 1;  1K50 A;  2KN4 A;  2V3N A;  4S17 A;  1WJ6 A;  2BGF A;  4EOY A;  3ZVV A;  3BZD B; 
#chains in the Genus database with same CATH homology
 2LVP A;  2Z59 B;  3QK0 A;  2KDE B;  3PRE A;  4WJQ A;  1WE6 A;  2KK8 A;  4EZJ A;  1WR1 A;  1WGD A;  3JSV A;  2C7N B;  3Q3J A;  2DYO A;  5CX3 A;  2BYF A;  1BT0 A;  3KUZ A;  2ZPY A;  2LRW A;  1ZW7 A;  4MEM A;  5BO4 B;  4ZRK A;  1U4A A;  4E71 A;  2O2V A;  3R7R A;  3HM6 X;  4FN2 A;  2LAS A;  3K9O B;  2AL3 A;  4EZL A;  2ZJD A;  3H7S A;  2KJ6 A;  4IWP A;  4K7S A;  2N4F A;  3GOE A;  2RD0 A;  2AEH A;  2R2Q A;  3L16 A;  4X57 B;  2KMA A;  2LRU A;  1Y8R C;  2KAN A;  4DK5 A;  3KH0 A;  2MW5 A;  3PHX B;  1WI0 A;  1SGH A;  4DHJ B;  4XX5 A;  3QWZ B;  2IYD B;  4TV3 A;  3NS8 A;  2JVC A;  2JY6 A;  2L3Z A;  2L8J A;  2IZV B;  2RSU A;  4K7W A;  5D94 A;  3OJ4 B;  1IPG A;  4FJZ A;  4BBN C;  4IWQ A;  4KDL B;  3B0A A;  4BKS D;  2IO1 B;  3ZLZ A;  4GSW A;  3NY5 A;  5L95 C;  2LJ5 A;  4KIK B;  2KMC A;  4GDL A;  1SIF A;  2DEN B;  3ECI A;  3P2B A;  2GOW A;  4KSK C;  2YLM A;  1E8Y A;  3ZRC A;  2FCQ A;  3A4R A;  4A3P A;  2BYE A;  4K1R B;  3PT2 B;  1UBI A;  3K9P B;  2WDT B;  1V6E A;  2KN5 A;  4IUM B;  1R4N I;  3VH3 B;  1Z2M A;  4ZRJ A;  3RT3 B;  4BOS C;  3A33 B;  5CTR C;  3TBL D;  3SU8 X;  4EZK A;  4GN1 A;  4MGI E;  2HJ8 A;  2KX3 A;  3L0W B;  3EC8 A;  5DPR A;  2D11 A;  2AYO B;  2ZNV B;  3V6E B;  1YX5 B;  4NPN A;  1GJZ A;  2CKH B;  3TMP B;  3ZDT A;  4DBG A;  3PRM B;  5FR6 A;  4AJW A;  1E5W A;  4J6I A;  1E8Z A;  4LJO B;  2C7M B;  1IYF A;  2O6V B;  4IM3 A;  5DPT A;  2MBB B;  4F7Z A;  1XD3 B;  4FBJ B;  5J18 A;  2JZZ A;  1TBE A;  2N1W A;  5JH5 C;  2DAJ A;  2J7Q B;  1J8C A;  5JHB A;  3V61 A;  3WA0 A;  2KTR B;  2N7D A;  3OAW A;  2NCN A;  4RM9 A;  3RZW C;  2NBW B;  3Q3F A;  1GNU A;  3A9K B;  4JL9 A;  4BKG A;  2EKE C;  2G4S A;  2IO0 B;  5GMV A;  3ML9 A;  4ANW A;  2PEA A;  2D3G A;  2K1F A;  2NPT B;  3L10 B;  1WGR A;  2KWU B;  3UQA A;  5IA7 A;  5G2N A;  4MEL A;  3EHV A;  2NBV B;  2JRI B;  4DHZ B;  1OGW A;  3LJ3 A;  2IY1 B;  4HDQ A;  2ZCB A;  1EF5 A;  4ICU A;  4CO7 A;  3M3J A;  4MJS B;  1R4M I;  3SDL C;  2K6Q A;  1ZGU B;  1T0Y A;  2FUH B;  1V2Y A;  3QHT A;  2CHX A;  4KIK A;  2N9P C;  1E8W A;  3BIN A;  4EUT A;  2LD9 A;  2L0T A;  3V6C B;  3ZUN A;  2V4L A;  2MRP A;  2KWC A;  3L17 A;  1WIA A;  3WIM A;  4WWP A;  3ZW3 A;  5JZE B;  4OVU A;  2LGD A;  4AOF A;  1L7Y A;  3PLU A;  3QAR A;  2IO3 B;  4P7I A;  1WXS A;  1ISN A;  2DX5 B;  2FCM A;  2HTH A;  3EFU A;  1NDD A;  3T8M A;  2J0J A;  1KOT A;  4GIV A;  2LI5 A;  1Q0W B;  1F9J A;  2G4D B;  2FCN A;  3VDZ A;  1WGY A;  2FAZ A;  4NAW B;  1RLF A;  1V5T A;  1WYW B;  4XC2 A;  4TQ1 A;  3SHQ A;  2C7H A;  4II2 B;  1WFY A;  3TL5 A;  4GB9 A;  5LLI A;  3AUL A;  4PS7 A;  1V80 A;  1LXD A;  5D6J B;  4FHK A;  2KTF A;  2KFK B;  4W9D A;  3QJZ A;  4WJO A;  2N9X A;  1WGG A;  3QAQ A;  3DBS A;  2O6V A;  3DVG Y;  3VTU A;  1LQB A;  2JUO A;  3R66 C;  4MSQ B;  1GC7 A;  3UIO B;  4MGZ E;  1GUA B;  2WX0 A;  2K25 A;  1WRD B;  1CMX B;  4FLH A;  4RMA A;  1GC6 A;  3PVL A;  4ANX A;  3RCZ A;  5J2R A;  2RPQ A;  4I6L B;  2LVQ A;  3PRZ A;  4WWO A;  2JPH A;  2KTR A;  3O65 B;  4PYZ A;  2OJR A;  2VRR B;  5DPW A;  4HCN B;  2LXA A;  3A9K A;  2MBQ A;  3PSE B;  3VUW A;  2KFJ A;  3X0W A;  1TGZ B;  4WAA A;  2NPT A;  3DBH I;  1WZ0 A;  4W9H A;  3SD5 A;  4A20 A;  1C3T A;  1J0G A;  4HXD A;  4FA6 A;  1D3Z A;  2REX A;  2KDF B;  1S1Q B;  2BKF A;  2K6D B;  4TQ0 A;  4FAD A;  4CYE A;  4F1S A;  1TZ1 A;  2XK5 B;  2I1J A;  4RM8 A;  3ENE A;  2N9E B;  2EMT A;  1I42 A;  4MJS A;  2DAF A;  2KLG A;  4B95 A;  1H8C A;  4FJV B;  4DDI D;  2R2O A;  2KOX A;  3OJ3 A;  2XEW A;  3ZNZ B;  2MBO A;  2CS4 A;  2ZPN A;  3NZU A;  3V62 A;  1V9J A;  3M62 B;  4BBN F;  1WXM A;  2W9N A;  4IC7 B;  4IWO A;  4YL8 A;  4NQK E;  3I3T B;  3KVF B;  3ZTC A;  5CHV C;  1E7U A;  2M4N A;  3S2A A;  2WWZ A;  2Z0D B;  5AZF A;  1P98 A;  4DHJ D;  1VD2 A;  1WM2 A;  2EMS A;  3L54 A;  3DVN V;  1HE8 A;  4WWN A;  1WM3 A;  4MDK E;  2QHO A;  4NJ7 A;  2BYV E;  2GBK A;  2PPH A;  3GZN I;  3WAL A;  4NAW A;  4NNJ B;  3A1Q B;  2KC2 A;  4G11 A;  1X1M A;  1WF9 A;  3H9D A;  1SE9 A;  2CR5 A;  2JZ3 B;  3RUI B;  3PZD A;  2PJH A;  5D2M B;  4W9K A;  2KFK A;  2DZM A;  3MHS D;  1UD7 A;  4HPM B;  2WX1 A;  3WAP A;  2KHW B;  2IO2 B;  3W1S C;  3ONS A;  2J0K A;  1WE7 A;  4I6P A;  4NY0 A;  3T9L A;  3TJP A;  5E6N A;  1YQB A;  4KDI C;  1WJU A;  4BKT A;  1KLV A;  1Z5S B;  2M8S A;  1V5O A;  3HIZ A;  4M8M A;  1ZKH A;  4E74 A;  1KM7 A;  1G6J A;  5KHQ A;  4HLE A;  3RZF A;  4WJN A;  4HDO A;  3DBR I;  4ICV A;  4F8C B;  4LDT B;  2D07 B;  2L05 A;  4I6N B;  2AL6 A;  4WJP A;  1P0R A;  2MP2 B;  3WAO A;  4ASW C;  2BWE S;  3QX1 A;  5TR5 A;  2DZJ A;  2ZVO A;  4MM3 A;  4DWF A;  2LGX A;  2IY0 B;  4WQO B;  4K7U A;  3ZKJ C;  3ZNH B;  2XK5 A;  3APD A;  4GGQ A;  2JXX A;  2O6V D;  3PRP B;  3ML8 A;  1NBF C;  5C1Z A;  3PGE A;  3HM3 A;  3QA8 A;  2NVU I;  4XZ4 A;  2GBM A;  2LXC A;  1V49 A;  1YJ1 A;  2JT4 B;  3DOW A;  4BVU C;  2NS5 A;  4TUU A;  3H7P B;  2WYQ A;  3NZS A;  2MBH A;  2RR9 A;  1XQQ A;  3OLM D;  5C23 A;  4BFR A;  2BKR B;  2FID A;  3JYU A;  2DYB A;  4DDG D;  4KVG B;  2CU1 A;  1OQY A;  3R7Q A;  1YD8 U;  4ZDV A;  2L7R A;  3APF A;  3DDC B;  2KZR A;  2KX0 A;  2MA9 B;  3L13 A;  4W9E A;  4NQL B;  3AU4 A;  4IG7 B;  3PTF C;  4G3X B;  5AZH A;  3ZTD A;  4EEW A;  3A1Q A;  3QCA A;  3DVN U;  1E90 A;  1EUV B;  3VH4 B;  4CHK A;  1WR6 E;  2CHZ A;  2BWF A;  4ANV A;  1MG8 A;  2MSE D;  2L76 A;  2M1M A;  3AXC A;  1Q5W B;  3UIP B;  3ZIM A;  2KDB A;  2DYM A;  3WAM A;  3MTN B;  2MBE A;  2BF8 B;  3RYT A;  2HE7 A;  2DZI A;  5LXI B;  3ZRF A;  4E3C A;  1LFD A;  3KUC B;  4EFO A;  3UF8 A;  4OVV A;  3D32 A;  1E7V A;  1YIW A;  4HJK A;  4II3 B;  4MH0 E;  3V60 A;  3CMM B;  4G50 A;  4JLC A;  3A9J B;  1OEY A;  1WX9 A;  2FNJ B;  4ZRI A;  4HWI B;  1RFA A;  3IFW B;  2MP2 A;  1UGM A;  2L0F A;  3KYD D;  1WH3 A;  2ASQ A;  2GBJ A;  1WXV A;  3H1U A;  3WAN A;  4EKU A;  2AWT A;  2D2Q A;  3PPA A;  4IM0 A;  1E8X A;  3B08 A;  4DXA B;  2MCN B;  3JVZ X;  4DHZ E;  3B1L X;  4KV2 A;  2KJR A;  4AJY B;  5KHO A;  1WMH B;  2DHZ A;  3CF6 E;  2K39 A;  3BY4 B;  4PYU A;  5CHF A;  3N3K B;  1WJ4 A;  1WZ3 A;  3H7P A;  2D10 A;  1H4R A;  3PLV A;  1WY8 A;  3U8Z A;  2A4Z A;  2C60 A;  1VCB A;  4JQW C;  4GXB A;  2MLB A;  4N9F 4;  5G55 A;  4B9K A;  3N30 A;  3VUY A;  1OTR B;  2XBB C;  1V81 A;  1Q1O A;  2ZEQ A;  1LM8 B;  2JWZ A;  2MQJ A;  3X23 A;  3TIX A;  2Y5B B;  3ZNG C;  2PE9 A;  3UGB B;  3PV1 A;  4JGH B;  5EDS A;  3RUL A;  4HPL B;  2LZ6 A;  4FJY A;  4MGK E;  5D7G A;  3CSF A;  2GMI C;  2HD5 B;  3IG3 A;  2G3Q B;  2NBU A;  4ANU A;  2IBI B;  2K8C A;  2LUE A;  3IBE A;  2K8H A;  2UWQ A;  2A5U A;  4TKN A;  1EF1 A;  2J0M A;  3NHE B;  4GDK B;  4FUL A;  1K8R B;  1EO6 A;  1YX6 B;  2KDI A;  2M0X A;  1JRU A;  3APC A;  5E6O A;  3W1Y A;  2C9W B;  1P3Q U;  3VFK A;  2KKC A;  1UEL A;  2ZZP B;  1XT9 B;  1UZX B;  4JIO U;  1WX8 A;  4MGY E;  5HKH A;  3VQI A;  3VHT C;  1PQS A;  3VTW A;  3QIJ A;  5AEK B;  4G0N B;  2KO3 A;  4M8N A;  3A9J A;  2KD0 A;  3ALB A;  3UQB A;  3HK0 A;  1IP9 A;  4LCD E;  2I1K A;  2KVR A;  4B6W A;  4URK A;  3C0R B;  2N7E A;  2KQ7 A;  3JW0 X;  4AP4 C;  3AI5 A;  3MJW A;  3TCA A;  4MSM B;  3W1S A;  3RD2 A;  2G45 B;  3M95 A;  4HVB A;  2YVC A;  1WMH A;  2CHW A;  2LWP A;  4IM2 A;  3LDZ E;  1P9D U;  3QQ8 B;  4GU2 A;  4W9I A;  5CHW A;  3VVW B;  3IHP C;  2OOB B;  1A5R A;  2LGY A;  3DBL I;  4HK2 A;  2JRH A;  2LVO A;  4W9J A;  5IAA C;  2ZVN A;  3DPD A;  4ZYN A;  5JHA A;  3L08 A;  4KSL C;  4LDT D;  3KUD B;  2L00 B;  4M0W B;  2Z0E B;  3AU5 A;  3JSV B;  2GBR A;  1OEY J;  2DZK A;  4GMV A;  3DQV A;  1QZE A;  4A3O A;  3DCG A;  4GOC A;  3KYC D;  5DPS A;  1TTN A;  1WX7 A;  3H6N A;  3R3M A;  2B3A A;  3VTV A;  4BOZ B;  4W9G A;  4W9C A;  3ZNI D;  2KWV B;  4K81 A;  2MX2 A;  1KJT A;  1AAR A;  1WJN A;  2O2V B;  2N1V A;  3M63 B;  4NJ6 A;  1RAX A;  1FXT B;  3VAW A;  3IVF A;  2FCS A;  5AZG A;  1WXA A;  2KNB A;  3PS6 A;  4KZC A;  5DCN A;  1L2N A;  4AUQ C;  1V86 A;  3N32 A;  4BKS A;  1S3S G;  3HHM A;  4GDK A;  3UIN B;  1GG3 A;  3U30 A;  3A4S C;  3VUX A;  3ZO5 B;  3U7D A;  4IW0 A;  4LJP B;  3EEC A;  2NR2 A;  5L83 A;  2KJH B;  2V3S A;  4AWJ A;  2BPS A;  4KZ0 A;  2UYZ B;  2KLC A;  4FHJ A;  4HCP B;  4W9F A;  3NOB A;  2K8B A;  2GBN A;  2FIF A;  1P1A A;  5E6P A;  3ZDM C;  5LXH A;  1UBQ A;  2PE6 B;  1I35 A;  3CST A;  4PS3 A;  5J17 A;  2RGF A;  2KC1 A;  2C5L C;  2MWS B;  2ZCC A;  1C1Y B;  3DVG X;  3QC8 B;  2ZNV C;  2M17 A;  1NI2 A;  1M94 A;  4GDL B;  1RRB A;  1UH6 A;  1WJ6 A;  2BGF A;  2KXJ A;  3PHW B;  2JF5 A;  4W9L A;  3VXW A;  1J19 A;  1WGH A;  4EOY A;  2KQS A;  3ZVV A;  4PS8 A;  2V1Y A;  3KW5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...