4FJVB

Crystal structure of human otubain2 and ubiquitin complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
DVPDYAHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin thioesterase OTUB2
total genus 20
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4fjvB00
1WX7A 4LCDE 3MHSD 2KTRA 4MM3A 3SU8X 4G50A 1U4AA 2D10A 3H7PB 3IBEA 4M8NA 4ZRJA 3ZRCA 2NBUA 2R2OA 5AEKB 1GC7A 2WDTB 2UYZB 3NHEB 4RMAA 2JY6A 3ZNZB 3B08A 2Y5BB 2RD0A 3DVNV 4BBNF 3PHXB 4MGKE 5J18A 3ZNHB 3SDLC 3ZVVA 2KDFB 4E71A 4BKTA 2O6VA 3LJ3A 3BINA 1LXDA 1A5RA 3R3MA 4FJYA 4LJPB 3X23A 3HM3A 1AARA 2KXJA 3CSTA 2KKCA 1XQQA 4HXDA 3T9LA 2N1VA 1WJ6A 2PEAA 1YX5B 2AWTA 1R4MI 4P7IA 4W9KA 5IA7A 4OVUA 1V9JA 2M17A 3QCAA 4B95A 1WIAA 4NJ7A 4BKSD 1JRUA 5C1ZA 4KVGB 2KFKB 2N4FA 2KMAA 3VH3B 3V61A 2KOXA 4EOYA 2ZVNA 2FCQA 3A4SC 5D94A 3ZKJC 4EKUA 4I6PA 4J6IA 2HD5B 4W9HA 2C7MB 2JZ3B 2PPHA 4YL8A 5LXIB 4EZKA 3ML8A 2ZJDA 3OJ4B 3KVFB 1P98A 2LUEA 3KYDD 2L8JA 3H9DA 1C3TA 4HLEA 1P3QU 2DX5B 3VH4B 2KC1A 4WJNA 4EFOA 4GDLA 4IUMB 1G6JA 1WX9A 3DBSA 1E8XA 3AULA 3PSEB 1K8RB 4ANWA 3QWZB 2LVQA 3OAWA 3PS6A 3QA8A 1WGRA 1SIFA 4XX5A 1WX8A 1IYFA 1V80A 3KH0A 3WAMA 4DHZE 2AL6A 3S2AA 3IHPC 1VCBA 3EECA 5DCNA 3U30A 1P1AA 1YIWA 2MBBB 4URKA 4MELA 2G45B 3DVGX 1TBEA 3ZLZA 3TJPA 2N1WA 3L10B 2A5UA 5AZHA 2ZPNA 3R66C 2YVCA 2DAFA 3MTNB 2QHOA 4G3XB 3A9JB 2PE9A 3AXCA 3L13A 3A1QA 4CHKA 4JQWC 2BKRB 2OOBB 4ZRIA 2XEWA 2KTRB 2D11A 3ZO5B 4A3OA 2BKFA 4HVBA 2KLCA 2G3QB 4W9IA 2LZ6A 2GBRA 1QZEA 4DWFA 2V3SA 3QHTA 3RUIB 4I6NB 4EUTA 1ZKHA 5JH5C 2KWCA 3ML9A 1WJNA 1OGWA 3PLVA 3JW0X 2IO2B 4OVVA 5L95C 2KDIA 4W9EA 3R7QA 2N7EA 2J7QB 1GC6A 4B6WA 2MRPA 1NBFC 1TGZB 4CO7A 2IY1B 3ONSA 1WXSA 3M3JA 3D32A 3RCZA 4KDIC 4NQLB 3DOWA 2JVCA 4RM9A 3RZFA 2I1KA 4II2B 4KDLB 4W9GA 1YQBA 1E7UA 3PZDA 4KZCA 5LXHA 5D2MB 4ZDVA 5DPTA 1V5OA 1R4NI 1GUAB 3RYTA 2JRHA 4WJQA 2RPQA 3M95A 3DCGA 4IM3A 3ZTDA 1LFDA 2CHWA 2KJRA 2M4NA 5AZFA 2CR5A 2KWUB 2O2VB 1WI0A 1ZW7A 3DDCB 4PS3A 2GMIC 4GSWA 2D2QA 3P2BA 4K81A 2KHWB 2BWFA 2ZCCA 2ZVOA 2MBQA 3X0WA 5L83A 2UWQA 3SHQA 4WWPA 2BYFA 3RZWC 1SE9A 4N9F4 4GN1A 3TL5A 2W9NA 3AU5A 2LRWA 2NBWB 4JIOU 5DPRA 4W9JA 5CHVC 4BVUC 4LJOB 1NI2A 2O6VB 1WR6E 4IM2A 2XK5B 5EDSA 3OLMD 4EZLA 1WJUA 1OTRB 2DYOA 4DHZB 3PV1A 4KIKA 4MEMA 3UF8A 3WA0A 4AWJA 1J19A 3M62B 2KJ6A 1HE8A 3WALA 3W1YA 1WF9A 1YX6B 2CS4A 1WM3A 2DZKA 2FCNA 2PE6B 3H1UA 2KO3A 3IG3A 4FJZA 2K25A 3CSFA 4HK2A 2JPHA 2RSUA 1CMXB 3O65B 3VQIA 1Z5SB 1I35A 1EO6A 2N9PC 1WXAA 4TQ1A 2C60A 3VTUA 4TKNA 3EHVA 4GMVA 2XBBC 1OQYA 3TMPB 4HPLB 4KV2A 1NDDA 3AI5A 2KTFA 2C7NB 2JXXA 1E8ZA 3NY5A 5GMVA 3V62A 2IO3B 3K9PB 3PPAA 5KHOA 4BOSC 4E74A 1L2NA 2CHZA 2D07B 2O6VD 2JRIB 3A4RA 1UGMA 2REXA 5HKHA 2FCSA 3JYUA 1UELA 4MGYE 1V81A 5J2RA 4G0NB 1P0RA 1XD3B 2BWES 2FNJB 3DQVA 3A9KA 3L0WB 2MCNB 4IW0A 2KNBA 2OJRA 3APCA 2DZJA 2L0FA 5FR6A 2NBVB 2MA9B 2N7DA 2IO1B 2L0TA 2XK5A 3ZNGC 3Q3FA 4IWQA 2MW5A 5JZEB 1KM7A 4IM0A 3APDA 2M8SA 5D6JB 1I42A 2AEHA 2CHXA 3VFKA 2KQ7A 3TBLD 3VTWA 4KZ0A 2K8CA 3QARA 3ZW3A 4F8CB 2LGXA 2FAZA 2EMTA 3VXWA 1MG8A 2M0XA 1H4RA 4DDID 4LDTB 3QQ8B 4PS8A 3WIMA 1UBQA 3NZSA 2GBNA 2FIDA 2KFKA 4WWNA 4TV3A 3H7SA 3PGEA 4FJVB 2G4DB 3HIZA 4I6LB 5G2NA 3VVWB 3ZDTA 3PVLA 3NZUA 1IP9A 4BKGA 3PRPB 2ZZPB 1EUVB 1WE6A 4FHKA 2DAJA 4MJSA 3CF6E 1V5TA 2LJ5A 4NQKE 3ZTCA 1XT9B 3L17A 4K7UA 3PLUA 4B9KA 2IY0B 1EF1A 1WY8A 3U8ZA 4XZ4A 2KFJA 2KLGA 3ENEA 4GIVA 4GDLB 2NPTB 2WYQA 4AOFA 3WAPA 4F7ZA 3QC8B 2BGFA 2WX0A 4GDKB 3WANA 4MH0E 2K8BA 3N30A 1WXVA 2MSED 4PYUA 4EZJA 2J0JA 4E3CA 3HHMA 2LGDA 2JF5A 2HJ8A 2KN5A 5JHBA 3BY4B 4LDTD 2AL3A 4MSQB 4KSKC 2C7HA 4FADA 4M0WB 1LM8B 2JWZA 2LXCA 3DBHI 3IVFA 2IO0B 3DPDA 4NJ6A 1EF5A 2NR2A 2V4LA 3K9OB 4ZYNA 2Z59B 4A20A 3ZIMA 1Q1OA 2LASA 2ZCBA 4MGZE 4GOCA 3EC8A 4K7SA 4RM8A 4W9CA 4HCPB 3A9JA 3APFA 1TZ1A 1WXMA 1WGHA 2C5LC 3RULA 2IYDB 4BFRA 1E90A 3DBLI 4DHJD 4MSMB 3W1SC 1SGHA 4HCNB 2MBOA 2MLBA 1WGGA 1Y8RC 1UBIA 1WMHB 2I1JA 2KQSA 4NPNA 3PTFC 2K8HA 3RD2A 4F1SA 3CMMB 5IAAC 2BYVE 2L3ZA 4GGQA 4NAWB 2KZRA 4KIKB 1J8CA 3M63B 3V6EB 1WM2A 3JVZX 4IG7B 2NVUI 5JHAA 1E7VA 3VTVA 2DYBA 2WWZA 2KANA 3MJWA 4NY0A 4DK5A 2MWSB 1OEYA 3DBRI 4X57B 3L54A 4ANUA 4NNJB 4JL9A 2BF8B 3KUDB 3ZUNA 1YJ1A 3H6NA 1OEYJ 4AP4C 2AYOB 4XC2A 1UZXB 5CX3A 5J17A 2K39A 5CHWA 5G55A 3VUXA 4II3B 1E5WA 2VRRB 3JSVA 1KLVA 1LQBA 4TQ0A 2IZVB 4HDOA 2BPSA 2LD9A 5E6PA 5LLIA 1L7YA 2LVPA 2L00B 3UQAA 3I3TB 1D3ZA 1GJZA 3QK0A 3B1LX 4ZRKA 2KDEB 3A33B 4W9LA 3Q3JA 3IFWB 2FIFA 2KK8A 3LDZE 4GU2A 4G11A 3A9KB 2O2VA 4WWOA 2JUOA 3HK0A 3QIJA 2EKEC 2B3AA 2GOWA 2N9XA 1KJTA 4FLHA 2ZNVC 3H7PA 2MQJA 3PRZA 5KHQA 1RFAA 3UIPB 4MDKE 4HDQA 1VD2A 1PQSA 3HM6X 2MBEA 1X1MA 5AZGA 2Z0DB 2BYEA 4K1RB 2DENB 5BO4B 3KW5B 3PRMB 3UINB 4IWOA 2GBMA 3L08A 1T0YA 3U7DA 2YLMA 2LWPA 1UD7A 4EEWA 4KSLC 5E6NA 1S3SG 1UH6A 3RT3B 4CYEA 3ALBA 2HE7A 2L05A 4BBNC 3UQBA 4DDGD 4HWIB 4AUQC 4ANVA 2DHZA 1WYWB 4MGIE 5C23A 4FA6A 5CHFA 1C1YB 2KX0A 3PHWB 5CTRC 5D7GA 1WZ3A 1WGDA 3GZNI 2C9WB 2M1MA 3N32A 4GB9A 4A3PA 4DBGA 2LVOA 1V6EA 3NS8A 2K6DB 4ICUA 2CKHB 2NCNA 4FULA 1WZ0A 4FBJB 2L7RA 3DVGY 2LXAA 2CU1A 2JT4B 4MJSB 1E8WA 2EMSA 3WAOA 3QJZA 3V6CB 4TUUA 4BKSA 1V49A 2JZZA 2GBJA 2KVRA 2ZNVB 1Q0WB 2GBKA 4AJYB 3W1SA 3UGBB 2LRUA 3PREA 4BOZB 1WFYA 3ZNID 1RLFA 2LI5A 5E6OA 1V2YA 1RAXA 4IWPA 3ECIA 4W9FA 1IPGA 1ZGUB 2K1FA 3QAQA 4GDKA 4PS7A 4NAWA 3KUZA 1KOTA 4HPMB 2ZPYA 4JGHB 1M94A 4K7WA 3ZDMC 1S1QB 2DZIA 2ZEQA 1TTNA 3L16A 3NOBA 2MP2A 2KMCA 1YD8U 1WJ4A 3ZRFA 2KWVB 1FXTB 3UIOB 1WGYA 2LGYA 1V86A 2DYMA 3SD5A 1WH3A 5DPWA 4AJWA 2NS5A 3VHTC 1J0GA 3VUWA 2KDBA 1Q5WB 3JSVB 4M8MA 5DPSA 1E8YA 1ISNA 1WR1A 2KC2A 2N9EB 3N3KB 3B0AA 4WJPA 1H8CA 3TIXA 2WX1A 4FHJA 4ICVA 3VAWA 4W9DA 3V60A 2ASQA 1BT0A 2FCMA 4IC7B 4JLCA 4DXAB 1GG3A 2V1YA 3C0RB 4WAAA 1WMHA 4ASWC 4DHJB 5TR5A 2PJHA 4ANXA 3GOEA 4WQOB 2IBIB 3OJ3A 1WRDB 3KYCD 1GNUA 2KJHB 2RGFA 4HJKA 2NPTA 2FUHB 1F9JA 4PYZA 2RR9A 3VDZA 2MP2B 2R2QA 1Z2MA 2DZMA 3DVNU 2KX3A 2HTHA 2KD0A 4WJOA 2J0KA 2MX2A 1P9DU 2MBHA 3AU4A 3PT2B 1WE7A 2D3GA 4GXBA 2G4SA 3T8MA 2A4ZA 2Z0EB 3EFUA 3QX1A 2K6QA 3KUCB 3TCAA 3VUYA 2J0MA 1RRBA 3R7RA 4FN2A 2L76A 3A1QB
chains in the Genus database with same CATH superfamily
3P63A 4KGTA 3IAM1 3SU8X 1U4AA 3H7PB 3IBEA 1GC7A 2JY6A 4OHJA 4DXGA 3PHXB 5J18A 3ZNHB 1CQVA 3B2FA 1B9RA 5IKCM 1LXDA 2LEKA 1FMAD 1XQQA 2N0SB 2PEAA 1YX5B 1ZDXA 2AWTA 1R4MI 1V9JA 2M17A 4S0RA 1WIAA 1BMLC 3FILB 2N4FA 3T3NA 4ZRQA 4WWMA 3I9V1 3V61A 1DYQA 3AEFB 1N6ZA 2LFIA 5D94A 4J6IA 2C7MB 2JZ3B 5LXIB 2YEPF 2ZJDA 3OJ4B 3KVFB 2LUEA 2L8JA 4HLEA 2K22A 1WX9A 1E8XA 1TYGB 2K9XA 4XX5A 5C3JB 2W55A 3KH0A 4DHZE 3S2AA 1VCBA 1AN8A 2JXTA 2G45B 3DVGX 1WGKA 2N1WA 3L10B 3R66C 2YVCA 2DAFA 1FCLA 3U2SC 4CHKA 3A1QA 2BKRB 3DBLB 1QZEA 5FKAC 3RUIB 1ZKHA 5JH5C 2KWCA 3MC9A 1WJNA 1YNTE 4NZLB 5IOIA 2KDIA 1FNWA 1TGZB 3D32A 4NQLB 1E6EB 1R4NI 3I57A 3AH7A 2J4XA 4WJQA 3AE8B 1I4GA 1ACCA 4FA6A 2KWUB 5C2TB 2GMIC 2MBQA 3Q8EA 2FE8A 1VJKA 2FUG1 3TL5A 1TZOA 4LNIA 4JIOU 5DPRA 1WXQA 5CHVC 2XK5B 1STEA 3PZ7A 2DYOA 4MEMA 1J19A 1UF0A 4ZRPA 3M62B 1KLGD 1WF9A 2DZKA 1WM3A 2AQ2B 2RSUA 1CMXB 5BMHA 4H2AA 1R4NB 1NDDA 5EE1A 2C7NB 2JXXA 3NY5A 3V62A 1TS5A 2O6VD 4RGNA 4UDUC 3P4SB 2WXLA 1ZE3D 3MJ5A 4G0NB 3DQVA 2OJRA 2V9HA 3AE9B 2L0FA 1ZP0B 2NBVB 1YJIA 2IO1B 2WLBA 1EU3A 5FK9C 1P7FA 3Q3FA 2INPE 5JZEB 3AEEB 1I42A 5D6JB 2CHXA 3VFKA 3ZW3A 4F8CB 2AX5A 1VZ8A 2FAZA 4YTMB 2CJOA 3VXWA 2WQYB 1N60A 4O1NA 3NZSA 3DBHB 2FIDA 1VRAB 4WWNA 4TV3A 3BVMA 3H7SA 4FJVB 3RNEC 1GOZA 3HIZA 1UWXA 4I6LB 5G2NA 3VVWB 1SE4A 1VR9A 1DOYA 2ZZPB 1EUVB 2WXGA 1WE6A 4FHKA 2DAJA 1FXAA 1WRIA 1XXGA 3L17A 4K7UA 1C4CA 1C79A 2SEBD 4XZ4A 2KLGA 1JWUD 2NPTB 4GDLB 1NYQA 3WAPA 3QC8B 4GDKB 3GP7A 1XCTL 4C7ZA 1K52A 4E3CA 2KN5A 1HTOA 2JZPA 4AQ7A 2KACA 3BYYB 4ZYNA 2Z59B 4MGZE 3AE1B 3A9JA 3APFA 1TZ1A 2C5LC 4BFRA 1E90A 3RNCC 1K51A 4DHJD 4ZHPA 2INNE 3RD2A 3BVGA 5IAAC 4NAWB 1A70A 4KIKB 3M63B 2NVUI 1E7VA 4DK5A 2MWSB 4ITKA 2KDMA 3GE3C 3H6NA 4WAFA 4XC2A 5CX3A 1SF0A 3JSVA 3ZJVA 2M19A 1LQBA 4TQ0A 3BK1A 2IZVB 2LD9A 5E6PA 5LLIA 3UQAA 3A33B 4W9LA 2FIFA 3LDZE 3SFEB 2JUOA 2WXOA 3QIJA 4C00A 2GOWA 1KJTA 5KHQA 2ZNVC 2IPKD 2MQJA 4OW0A 1VD2A 3N1ZC 1OQQA 2BYEA 3RPFC 1UD7A 1SIJA 1UH6A 3U52E 3OWEB 1TY2A 2HE7A 2L05A 4BBNC 4P16A 4DDGD 1TKGA 2DLBA 2MJEA 4MGIE 3MHZA 1T5XD 1I4HA 2J53A 3GZNI 4HRSA 2PMVA 2X8XX 1V6EA 1F52A 3ZXVA 3Q3OC 2LXAA 4Q2JA 4J3OD 3WAOA 3QJZA 4TUUA 4N58A 3W1SA 3PREA 1WFYA 3TEZA 1C77A 4GDKA 1KOTA 2LHEA 2Y5PA 3URYA 1AYFA 3ZDMC 5EE0A 2DZIA 3NOBA 3B9JA 2MP2A 2KMCA 2KWVB 2WXIA 1JQ4A 1FXTB 3DHHC 1SBBB 2AQ1B 4RFBA 1WGYA 1V86A 1WH3A 5DPWA 3P1MA 1JROA 3KLSX 2PTLA 3KWVA 3N3KB 3Q8BA 1N5XA 4FHJA 3EA6A 4B0MA 1BT0A 2JWUA 1K53A 1KRHA 1WMHA 3BIID 4XE0A 2D5GA 2FBWB 3Q3NC 3KYCD 3ETRA 1D4BA 1HTQA 1FNUA 2HTME 3NZ3A 2KD0A 2Z8LA 1BXTA 1P9DU 2BYTA 3T8MA 2K6QA 1FD6A 3HUIA 4YTPB 1F2RC 4RF0A 3Q8AA 2GI9A 2KTRA 4IOIE 4G50A 2D10A 4RMAA 3C8YA 3DVNV 2WXMA 1K50A 3NUHB 3IT4B 2O6VA 4FJYA 3X23A 1AARA 4HXDA 4P7IA 4B95A 4NJ7A 4BKSD 1E9MA 4KVGB 2KVZA 2KMAA 3MFGA 1JW9D 2FCQA 3LXFA 4EKUA 5BMIA 3CWIA 2IGDA 3GS2A 4YL8A 4ZOHC 2QDFA 5BMGA 3H9DA 2QC8A 2DX5B 1J7BA 1ZOYB 1D5ZC 2KC1A 4NAMA 4WJNA 3VH4B 4IUMB 4PK1A 1G6JA 3DBSA 3AULA 2BQQA 3IXSA 4K3BA 3QA8A 1SIFA 3P42A 1V80A 2LJIA 2TSSA 3LYYA 2BVCA 3ZYYX 2N9KA 2BS3B 2BS2B 1V97A 2ZPNA 1FXIA 3A9JB 2VH2A 2PE9A 4XYCA 4JQWC 2KT7A 3AE7B 4A3OA 4HVBA 2BKFA 4ARCA 1ESFA 1TJEA 1XLPA 4RGOS 4XWTA 1OGWA 5GXGB 2IO2B 1KLUD 2KYWA 2LGSA 5L95C 3R7QA 1EWYC 2J7QB 1QOFA 3ZJTA 4CO7A 3ONSA 1WXSA 2DNFA 4RM9A 2I1KA 1MI0A 4KDLB 4W9GA 3FC4A 1E7UA 3PZDA 4JX1C 3IAS1 1QILA 1V5OA 2N9LA 1GUAB 4P1BC 1M4VA 4RF1A 3RYTA 3FILA 2G9HD 4MM3B 1ZXHA 3AV8A 2CHWA 2DBYA 2KJRA 2M4NA 2CR5A 3DDCB 1ZW7A 4K81A 1B1ZA 4GSWA 3P2BA 4YSZB 2VZKD 2ZCCA 4OZCA 4GN1A 2W9NA 3AU5A 2NBWB 2O6VB 1WR6E 5EDSA 3OLMD 4EZLA 1WJUA 3C19A 3UF8A 1HE8A 3VRBB 1ROEA 3WALA 1YX6B 2CS4A 3IG3A 2FCNA 4C80A 2KO3A 3RNBC 2MJDA 2K0PA 3RFZB 3VQIA 1KH0A 1I35A 1EO6A 2N9PC 3VTUA 1YJJA 3EHVA 4GMVA 2XBBC 3TMPB 4HPLB 3AI5A 2E3TA 3K9PB 2CHZA 2I2YA 3W2DA 2ONQA 3B2GA 2GRIA 1OFFA 2JRIB 3DWGC 2REXA 3JYUA 2CU3A 3BWUD 1QQRA 3L0WB 1YN4A 3AE6B 2MCNB 3AEDB 2OJWA 2DZJA 1PFDA 2Y3AA 5BYQA 5FR6A 2MA9B 2XK5A 2L0TA 1JALA 4IWQA 1WYGA 4IM0A 2M8SA 3PZ8A 3RI7C 3VTWA 3AN1A 1C4AA 4C7YA 4DDID 4PS8A 3QQ8B 3WIMA 1TT5B 2KFKA 2PLPA 4CQNA 4BKGA 1EU4A 4NQKE 3PLUA 4LNNA 2IGGA 4YSXB 2MH7A 2IY0B 3AECB 2RPVA 5IP4D 2OEDA 4ARIA 4MH0E 2ACZB 2K8BA 3DBRB 4R3DA 4EZJA 4ZHOA 2LGDA 2HJ8A 2YEPB 2PW9A 4LDTD 2KQ4X 2AL3A 1LM8B 2JWZA 2LUMA 1HEZE 3IVFA 1FRDA 4NJ6A 5LNK1 1XEEA 2NR2A 2V4LA 2X38A 4OZAA 4RCOA 4A20A 1YQ4B 3ZIMA 2LASA 4K7SA 4W9CA 1PGXA 2IYDB 2IGHA 3Q8CA 4HCNB 2KQSA 2I1JA 2QCZA 4NPNA 3PTFC 3CMMB 5FR3A 2L3ZA 2GB1A 3V6EB 2WP9B 1TIFA 4YSYB 4IG7B 3MC8A 1XO3A 2INDC 2DYBA 4NY0A 4LNFA 1V1PB 3MJWA 4ANUA 4JL9A 1JWSD 1R4MB 4KGSA 2V3PA 1J7CA 1XLNA 2OHFA 4HPPA 4HDOA 1DGJA 1L7YA 3GZNB 3I3TB 1GJZA 4ZRKA 2PVOD 1UGJA 2VZKB 4G11A 3A9KB 2N9XA 2W3RA 2DWQA 4MDKE 1AW7A 1X1MA 4N6EB 1I4RA 1RYJA 3NVYA 1E7PB 3BYTB 3KW5B 3PRMB 2HDEA 2WS3B 1MFWA 3U7DA 2JSVX 2LWPA 4EEWA 1XLQA 3RT3B 3TEWA 3PO0A 1FFVA 3UQBA 1WYWB 4FXCA 5CHFA 2KX0A 2JYEA 5CTRC 1YQ3B 2B76B 3N32A 4DBGA 2NMQA 4ICUA 2CKHB 2WXQA 3NS1A 4FBJB 1DOXA 1F0ZA 1VDVA 1E8WA 2XNAC 1V49A 2GBJA 2ZNVB 1Q0WB 4AJYB 3UGBB 2LRUA 4BOZB 2LI5A 1XCQL 5MPOA 1FM0D 1V2YA 1RAXA 4IWPA 3AEGB 3ECIA 4W9FA 3QAQA 4PS7A 3KUZA 2LHDA 2ZPYA 4JGHB 1M94A 4K7WA 3L16A 2BS4B 1D5MC 2RDBC 3UIOB 3SD5A 1IGCA 2NS5A 4AJWA 1J0GA 3JSVB 1ISNA 2KC2A 2N9EB 1H8CA 3TIXA 2WX1A 3RN9C 1ENFA 3V60A 3C0RB 4C4VA 4DHJB 3NVZA 5TR5A 4DXFA 3GOEA 3OJ3A 2BT6A 2WXPA 1SSNA 2RGFA 2FUHB 1F9JA 5TSSA 3VDZA 1EWCA 2R2QA 2DZMA 2WXFA 4WJOA 3AU4A 1WE7A 2D3GA 4BZAA 3KUCB 3TCAA 1KFYB 1GB4A 3W5VB 2L76A 4XGAB 1WX7A 4LCDE 3MHSD 4LLGM 4WIPA 1IBXA 5EE9A 2NBUA 5AEKB 3ZNZB 2UYZB 1NEKB 3FAHA 1TKEA 1ZDVA 2Y5BB 3B08A 5IO9A 1FNVA 4BBNF 1ET6A 5D3DA 2H89B 4E71A 3ZVVA 4BKTA 3LJ3A 5T8IA 1A5RA 4AS1A 3HM3A 4L2YA 2KXJA 3CSTA 3T9LA 2JX5A 1SE3A 1WJ6A 3KWLA 4US8A 1WWTA 4REZA 3QCAA 4LNOA 4KX6B 2KFKB 3VH3B 4IKGA 2ZVNA 3A4SC 3ZKJC 3NVVA 2QMTA 3NRZA 2HD5B 4I6PA 4EZKA 3ML8A 4L1BA 1ZPSA 1BUIC 1P3QU 2L52A 4WQMA 1DOIA 1K8RB 4ANWA 2D3BA 2LVQA 3OAWA 1IYFA 1WX8A 3IHPC 3HVDA 5HG2A 3EECA 3U30A 2MBBB 1IUEA 1I4PA 1ZXIA 1GAQB 3MTNB 3E56A 3AXCA 3W9CB 3L13A 2M0AA 3N1YC 4ZYSA 2XEWA 2KTRB 2D11A 3ZO5B 1XLOA 2G3QB 2GBRA 2V3SA 4EUTA 5HFYA 3AB5A 3JW0X 1C4PA 2HJ1A 2QSDA 3TSSA 4B6WA 2MRPA 1NBFC 4HJGE 2ZW1A 4KDIC 3RNFC 3P4RB 3RNAC 3DOWA 4US9A 2JVCA 4RGTA 4KZCA 5LXHA 4YT0B 5D2MB 4ZDVA 2WXNA 2RPQA 1EM7A 3M95A 3DCGA 3ZTDA 4PS3A 2O2VB 1WI0A 2D2QA 2QJLA 5JXVA 1L4ZB 5L83A 3X0WA 1N62A 3HVZA 1SE9A 4N9F4 2BB6A 3ZXRA 1T3QA 1V1OA 1NI2A 1MVKA 1OTRB 3R2IA 4DHZB 3PV1A 4KIKA 2MEKA 3ZGZA 1ZUD2 2WU5B 1AWDA 2I38A 1JWBD 2K25A 3CSFA 4HK2A 2MJ3A 3R2TA 4USAA 1WXAA 2C60A 1OQYA 4KV2A 2KTFA 2WXJA 5G5HA 4E74A 3PPAA 4XDDA 5KHOA 1CK1A 3TUOA 1SJED 4RGMA 3A4RA 1UGMA 2KMMA 3TEXA 2FCSA 3SFDB 1N5WA 3I63C 3NG0A 1P0RA 1XD3B 2BWES 3KQ4A 2KNBA 3APCA 1SJHD 3VRAB 2N7DA 2R61A 3U4EG 2VH1A 1CJEA 1V1PA 1KM7A 3APDA 4KKJA 4S17A 3TBLD 4KZ0A 2K8CA 3QARA 2WDVB 2LGXA 1I4QA 1MG8A 2M0XA 1F77A 1H4RA 2INCC 4LDTB 1JWAD 1UBQA 1TS2A 3IT6B 3U7ZA 1SE2A 3PGEA 1F1HA 3PVLA 3NZUA 1D6EC 2EKIA 3PRPB 3BK2A 3RNGC 4MJSA 1V5TA 3ZTCA 1XT9B 4B9KA 3U8ZA 2BTEA 3ENEA 2WYQA 3V3XA 1PGAA 2WGSA 1RFKA 4F7ZA 4L23A 3N30A 4PYUA 2MSED 3HHMA 2XN9C 2WU2B 2C7HA 3DBHI 2RDHA 3AE5B 3AE3B 3K9OB 1Q1OA 1C9FA 4RM8A 4HCPB 4LNKA 1WXMA 3DBLI 4MSMB 3W1SC 1SGHA 1WGGA 2MLBA 1WMHB 4IDIA 2K8HA 4F1SA 3GB1A 3CIRB 3LB8C 1J8CA 1F2RI 1L5PA 2KANA 2L1AA 2V3NA 3DBRI 4X57B 3L54A 2BF8B 3KUDB 1T6BX 5IN7A 1OEYJ 2AYOB 5J17A 5CHWA 1V8CA 1L0XB 2L00B 2NTTA 3B1LX 1C78A 3Q3JA 4C4VB 4GU2A 2QILA 4WWOA 3O13A 3AEAB 3HK0A 1JCKB 2B3AA 1E10A 3PRZA 4HDQA 1PQSA 3HM6X 2IDYA 5BO4B 4K1RB 2DENB 2KAJA 3VR8B 3UINB 4M00A 5D3IB 1S3SG 5AUKA 3ALBA 4TSSA 1QT9A 5BYRA 1RWSA 4HWIB 4AUQC 3E9SA 4ANVA 2EELA 2DHZA 1QLBB 1C1YB 3PHWB 1PGBA 5D7GA 2C9WB 4GB9A 3ZQ4A 2L83A 2LVOA 1LGRA 3NS8A 2K6DB 1NI3A 4ACFA 2NCNA 4FULA 1WZ0A 2IJ0A 2L7RA 2WDQB 4MJSB 4MH8A 2EMSA 4BKSA 1TS4A 2JZZA 2GBKA 5G5GA 2W3SA 3ZNID 3AEBB 1L4DB 1T0SC 4JE3B 5E6OA 2BW2A 2BBCA 1IPGA 1FO4A 4LK0M 1YD8U 4A8XC 3J9CA 2BB5A 3OG5A 2LGYA 2DYMA 2UU7A 4MACA 4A90A 3VUWA 2KDBA 4M8MA 5DPSA 1E8YA 2PKOA 4ICVA 4W9DA 2ASQA 4IC7B 4JLCA 4PT5A 4DXAB 2LGIA 1GG3A 2V1YA 4WAAA 1IBXB 4ANXA 2IBIB 1GNUA 3I5JC 1E0ZA 5EE3A 4PYZA 4BAXA 2RR9A 2D3CA 3GE8C 2KX3A 2V0GA 2MX2A 2MBHA 2G4SA 2A4ZA 2Z0EB 3L4PA 3EFUA 1NYRA 3VUYA 1RRBA 3R7RA 4FN2A 3A1QB 3Q69A 1PYWD 4QAYA 4MM3A 2N7JA 4RH6A 3ZRCA 4M8NA 4ZRJA 2R2OA 2WDTB 3NHEB 3ABVB 2RD0A 1VLBA 2J42A 1QF6A 4MGKE 5E6JA 1HXYD 3SDLC 2KDFB 2PVGC 4OVZA 3BINA 3R3MA 4LJPB 1UNSA 2KKCA 1TKYA 2N1VA 1I7HA 4W9KA 3EFCA 3V05A 5IA7A 4OVUA 1FEHA 1QOBA 1JRUA 1L6VA 5C1ZA 1Q10A 4P6VF 5AUIA 5BYSA 2K3UA 2KOXA 4EOYA 4GLSC 4HEA1 4W9HA 3Q14C 2PPHA 1P98A 5HHDG 3KYDD 2JU6X 1C3TA 1XF5L 4EFOA 4GDLA 3PSEB 2RMMA 3QWZB 3P4PB 1C76A 3PS6A 4A6QA 1WGRA 3T3OA 2PIAA 2KWDA 3WAMA 2AL6A 1HQRD 5DCNA 1P1AA 1YIWA 4URKA 4MELA 2SAKA 1R7SA 1TBEA 1N63A 2NTSA 4OZBA 3ZLZA 3TJPA 1P7EA 2QEJC 3AMZA 1FIQA 2A5UA 2QIEB 3DHGC 5AZHA 2G1EA 2QHOA 4G3XB 1FPYA 4YXDB 3P4QB 1L0VB 2OOBB 4ZRIA 2KLCA 2MHJA 4W9IA 4B0EA 2LZ6A 4DWFA 1YMHE 1QKZA 3QHTA 4I6NB 1JWMD 3ML9A 4XWWA 3PLVA 1NENB 4OVVA 1I4XA 4W9EA 2N7EA 1GC6A 2IY1B 3M3JA 3RCZA 3Q6BA 3RZFA 4II2B 1ET9A 1YQBA 1QOGA 4DQOC 3TEYA 4YTNB 4MT5A 5DPTA 2KN4A 4M0WA 1T0RC 2JRHA 4IM3A 1LFDA 5AZFA 1PUTA 2KHWB 2BWFA 2ZVOA 2UWQA 3SHQA 4WWPA 2BYFA 3RZWC 5H92C 3RMKC 2LRWA 4W9JA 2W82A 4LJOB 4BVUC 4IM2A 2M56B 3WA0A 4AWJA 1YN5A 2KJ6A 3W1YA 3H1UA 1MHXA 2PE6B 4FJZA 2JPHA 3O65B 1HZ5A 1Z5SB 4TQ1A 4TKNA 3MP9A 3EGRA 2WXHA 4TMAB 2GLSA 1E8ZA 5GMVA 1HA5A 2IO3B 4BOSC 1L2NA 2ICIA 2D07B 5HKHA 1UELA 2WDRB 4MGYE 1V81A 3VR9B 5J2RA 2FNJB 3A9KA 1FCCC 4IW0A 4HROA 3R8BA 3ZNGC 1WSPA 2MW5A 1YN3A 2AEHA 1MG4A 2KQ7A 4NJCA 3WCQA 2EMTA 1KF6B 3Q8FA 3AM9A 1MJDA 3AE4B 2GBNA 4KGRA 3NJTA 2G4DB 3ZDTA 1IP9A 3N20C 2JQRB 2J52A 1NVID 1PDXA 1JRPA 3CF6E 2LJ5A 4YWGG 2WXRA 1VZ6A 3MC0B 1EF1A 1RM6C 1WY8A 2KFJA 4AOFA 4GIVA 3ZJUA 1CZPA 2Q5WD 2BGFA 4RNAA 2WX0A 4M01A 3WANA 1WXVA 1SXTA 2J0JA 2JF5A 1MPEA 5JHBA 2WHIA 3BY4B 4MSQB 4KSKC 4FADA 1TS3A 4M0WB 2LXCA 2IO0B 3DPDA 4KKIA 4JWSC 1EF5A 3UI3A 2ZCBA 4GOCA 3EC8A 1SB3C 4JWUC 2K5PA 1WGHA 3NVWA 3RULA 4C56C 2MBOA 1Y8RC 1UBIA 2JYTA 1MHHE 2BYVE 4GGQA 2KZRA 3EUB2 3W5UB 1WM2A 3JVZX 1FFUA 5JHAA 1HZ6A 3VTVA 2WWZA 1OEYA 4NNJB 4N59A 3ZUNA 1UWMA 1YJ1A 4AP4C 1UZXB 1SEBD 2K39A 5G55A 3H8HA 5H8YE 3VUXA 4II3B 1E5WA 2VRRB 1KLVA 4WH4A 4XDCA 2BPSA 2LVPA 1D3ZA 3QK0A 3DHIC 4D2KA 2KDEB 3BVZA 3IFWB 2KK8A 2O2VA 4WURA 3SEBA 2EKEC 4FLHA 3H7PA 1RFAA 1UUPA 3UIPB 2AQ3B 1Y56A 3N9YC 2MBEA 1FRRA 4EE2A 5AZGA 2Z0DB 4A9AA 4IWOA 2GBMA 3L08A 1T0YA 2YLMA 1GPXA 4KSLC 5E6NA 3BZDB 1VZ7A 1L6UA 4CYEA 1KTKA 4M02A 5C23A 2D3AA 2LMCA 2ON8A 1WZ3A 1WGDA 2M1MA 4A3PA 2Y5CA 1OQRA 1TY0A 4P1CC 2ZW0A 3DWMA 3DVGY 2CU1A 3AE2B 2JT4B 3V6CB 3HRDD 2KVRA 1RLFA 2H88B 2RDGA 5I4DA 1GB1A 3Q2AC 4JPSA 1T0QC 1ZGUB 2K1FA 4NAWA 4LTUA 4HPMB 1IGDA 4K3CA 1S1QB 2ZEQA 1TTNA 4HKZE 3ZRFA 1WJ4A 2WXKA 1JMLA 2W54A 3Q3MC 2E6XA 3VHTC 1YOVB 1Q5WB 1WR1A 4A55A 3N1XC 3B0AA 4WJPA 1D5XC 1L0YB 3FKYA 2L32A 3VAWA 2FCMA 1LO5D 1J7AA 2WNMA 4ASWC 2PJHA 4WQOB 1WRDB 2KJHB 4HJKA 3SR6A 2NPTA 5HI1A 2CJNA 2MP2B 1N61A 1Z2MA 3DVNU 2HTHA 3PT2B 2J0KA 2V4IB 4GXBA 3QX1A 2J0MA 1QOAA 4HKQA
chains in the Genus database with same CATH topology
1WX7A 4LCDE 3MHSD 2KTRA 4MM3A 3SU8X 4G50A 1U4AA 2D10A 3H7PB 3IBEA 4M8NA 4ZRJA 3ZRCA 2NBUA 2R2OA 5AEKB 1GC7A 2WDTB 2UYZB 3NHEB 4RMAA 2JY6A 3ZNZB 3B08A 2Y5BB 2RD0A 3DVNV 4BBNF 3PHXB 4MGKE 5J18A 3ZNHB 3SDLC 3ZVVA 2KDFB 4E71A 4BKTA 2O6VA 3LJ3A 3BINA 1LXDA 1A5RA 3R3MA 4FJYA 4LJPB 3X23A 3HM3A 1AARA 2KXJA 3CSTA 2KKCA 1XQQA 4HXDA 3T9LA 2N1VA 1WJ6A 2PEAA 1YX5B 2AWTA 1R4MI 4P7IA 4W9KA 5IA7A 4OVUA 1V9JA 2M17A 3QCAA 4B95A 1WIAA 4NJ7A 4BKSD 1JRUA 5C1ZA 4KVGB 2KFKB 2N4FA 2KMAA 3VH3B 3V61A 2KOXA 4EOYA 2ZVNA 2FCQA 3A4SC 5D94A 3ZKJC 4EKUA 4I6PA 4J6IA 2HD5B 4W9HA 2C7MB 2JZ3B 2PPHA 4YL8A 5LXIB 4EZKA 3ML8A 2ZJDA 3OJ4B 3KVFB 1P98A 2LUEA 3KYDD 2L8JA 3H9DA 1C3TA 4HLEA 1P3QU 2DX5B 3VH4B 2KC1A 4WJNA 4EFOA 4GDLA 4IUMB 1G6JA 1WX9A 3DBSA 1E8XA 3AULA 3PSEB 1K8RB 4ANWA 3QWZB 2LVQA 3OAWA 3PS6A 3QA8A 1WGRA 1SIFA 4XX5A 1WX8A 1IYFA 1V80A 3KH0A 3WAMA 4DHZE 2AL6A 3S2AA 3IHPC 1VCBA 3EECA 5DCNA 3U30A 1P1AA 1YIWA 2MBBB 4URKA 4MELA 2G45B 3DVGX 1TBEA 3ZLZA 3TJPA 2N1WA 3L10B 2A5UA 5AZHA 2ZPNA 3R66C 2YVCA 2DAFA 3MTNB 2QHOA 4G3XB 3A9JB 2PE9A 3AXCA 3L13A 3A1QA 4CHKA 4JQWC 2BKRB 2OOBB 4ZRIA 2XEWA 2KTRB 2D11A 3ZO5B 4A3OA 2BKFA 4HVBA 2KLCA 2G3QB 4W9IA 2LZ6A 2GBRA 1QZEA 4DWFA 2V3SA 3QHTA 3RUIB 4I6NB 4EUTA 1ZKHA 5JH5C 2KWCA 3ML9A 1WJNA 1OGWA 3PLVA 3JW0X 2IO2B 4OVVA 5L95C 2KDIA 4W9EA 3R7QA 2N7EA 2J7QB 1GC6A 4B6WA 2MRPA 1NBFC 1TGZB 4CO7A 2IY1B 3ONSA 1WXSA 3M3JA 3D32A 3RCZA 4KDIC 4NQLB 3DOWA 2JVCA 4RM9A 3RZFA 2I1KA 4II2B 4KDLB 4W9GA 1YQBA 1E7UA 3PZDA 4KZCA 5LXHA 5D2MB 4ZDVA 5DPTA 1V5OA 1R4NI 1GUAB 3RYTA 2JRHA 4WJQA 2RPQA 3M95A 3DCGA 4IM3A 3ZTDA 1LFDA 2CHWA 2KJRA 2M4NA 5AZFA 2CR5A 2KWUB 2O2VB 1WI0A 1ZW7A 3DDCB 4PS3A 2GMIC 4GSWA 2D2QA 3P2BA 4K81A 2KHWB 2BWFA 2ZCCA 2ZVOA 2MBQA 3X0WA 5L83A 2UWQA 3SHQA 4WWPA 2BYFA 3RZWC 1SE9A 4N9F4 4GN1A 3TL5A 2W9NA 3AU5A 2LRWA 2NBWB 4JIOU 5DPRA 4W9JA 5CHVC 4BVUC 4LJOB 1NI2A 2O6VB 1WR6E 4IM2A 2XK5B 5EDSA 3OLMD 4EZLA 1WJUA 1OTRB 2DYOA 4DHZB 3PV1A 4KIKA 4MEMA 3UF8A 3WA0A 4AWJA 1J19A 3M62B 2KJ6A 1HE8A 3WALA 3W1YA 1WF9A 1YX6B 2CS4A 1WM3A 2DZKA 2FCNA 2PE6B 3H1UA 2KO3A 3IG3A 4FJZA 2K25A 3CSFA 4HK2A 2JPHA 2RSUA 1CMXB 3O65B 3VQIA 1Z5SB 1I35A 1EO6A 2N9PC 1WXAA 4TQ1A 2C60A 3VTUA 4TKNA 3EHVA 4GMVA 2XBBC 1OQYA 3TMPB 4HPLB 4KV2A 1NDDA 3AI5A 2KTFA 2C7NB 2JXXA 1E8ZA 3NY5A 5GMVA 3V62A 2IO3B 3K9PB 3PPAA 5KHOA 4BOSC 4E74A 1L2NA 2CHZA 2D07B 2O6VD 2JRIB 3A4RA 1UGMA 2REXA 5HKHA 2FCSA 3JYUA 1UELA 4MGYE 1V81A 5J2RA 4G0NB 1P0RA 1XD3B 2BWES 2FNJB 3DQVA 3A9KA 3L0WB 2MCNB 4IW0A 2KNBA 2OJRA 3APCA 2DZJA 2L0FA 5FR6A 2NBVB 2MA9B 2N7DA 2IO1B 2L0TA 2XK5A 3ZNGC 3Q3FA 4IWQA 2MW5A 5JZEB 1KM7A 4IM0A 3APDA 2M8SA 5D6JB 1I42A 2AEHA 2CHXA 3VFKA 2KQ7A 3TBLD 3VTWA 4KZ0A 2K8CA 3QARA 3ZW3A 4F8CB 2LGXA 2FAZA 2EMTA 3VXWA 1MG8A 2M0XA 1H4RA 4DDID 4LDTB 3QQ8B 4PS8A 3WIMA 1UBQA 3NZSA 2GBNA 2FIDA 2KFKA 4WWNA 4TV3A 3H7SA 3PGEA 4FJVB 2G4DB 3HIZA 4I6LB 5G2NA 3VVWB 3ZDTA 3PVLA 3NZUA 1IP9A 4BKGA 3PRPB 2ZZPB 1EUVB 1WE6A 4FHKA 2DAJA 4MJSA 3CF6E 1V5TA 2LJ5A 4NQKE 3ZTCA 1XT9B 3L17A 4K7UA 3PLUA 4B9KA 2IY0B 1EF1A 1WY8A 3U8ZA 4XZ4A 2KFJA 2KLGA 3ENEA 4GIVA 4GDLB 2NPTB 2WYQA 4AOFA 3WAPA 4F7ZA 3QC8B 2BGFA 2WX0A 4GDKB 3WANA 4MH0E 2K8BA 3N30A 1WXVA 2MSED 4PYUA 4EZJA 2J0JA 4E3CA 3HHMA 2LGDA 2JF5A 2HJ8A 2KN5A 5JHBA 3BY4B 4LDTD 2AL3A 4MSQB 4KSKC 2C7HA 4FADA 4M0WB 1LM8B 2JWZA 2LXCA 3DBHI 3IVFA 2IO0B 3DPDA 4NJ6A 1EF5A 2NR2A 2V4LA 3K9OB 4ZYNA 2Z59B 4A20A 3ZIMA 1Q1OA 2LASA 2ZCBA 4MGZE 4GOCA 3EC8A 4K7SA 4RM8A 4W9CA 4HCPB 3A9JA 3APFA 1TZ1A 1WXMA 1WGHA 2C5LC 3RULA 2IYDB 4BFRA 1E90A 3DBLI 4DHJD 4MSMB 3W1SC 1SGHA 4HCNB 2MBOA 2MLBA 1WGGA 1Y8RC 1UBIA 1WMHB 2I1JA 2KQSA 4NPNA 3PTFC 2K8HA 3RD2A 4F1SA 3CMMB 5IAAC 2BYVE 2L3ZA 4GGQA 4NAWB 2KZRA 4KIKB 1J8CA 3M63B 3V6EB 1WM2A 3JVZX 4IG7B 2NVUI 5JHAA 1E7VA 3VTVA 2DYBA 2WWZA 2KANA 3MJWA 4NY0A 4DK5A 2MWSB 1OEYA 3DBRI 4X57B 3L54A 4ANUA 4NNJB 4JL9A 2BF8B 3KUDB 3ZUNA 1YJ1A 3H6NA 1OEYJ 4AP4C 2AYOB 4XC2A 1UZXB 5CX3A 5J17A 2K39A 5CHWA 5G55A 3VUXA 4II3B 1E5WA 2VRRB 3JSVA 1KLVA 1LQBA 4TQ0A 2IZVB 4HDOA 2BPSA 2LD9A 5E6PA 5LLIA 1L7YA 2LVPA 2L00B 3UQAA 3I3TB 1D3ZA 1GJZA 3QK0A 3B1LX 4ZRKA 2KDEB 3A33B 4W9LA 3Q3JA 3IFWB 2FIFA 2KK8A 3LDZE 4GU2A 4G11A 3A9KB 2O2VA 4WWOA 2JUOA 3HK0A 3QIJA 2EKEC 2B3AA 2GOWA 2N9XA 1KJTA 4FLHA 2ZNVC 3H7PA 2MQJA 3PRZA 5KHQA 1RFAA 3UIPB 4MDKE 4HDQA 1VD2A 1PQSA 3HM6X 2MBEA 1X1MA 5AZGA 2Z0DB 2BYEA 4K1RB 2DENB 5BO4B 3KW5B 3PRMB 3UINB 4IWOA 2GBMA 3L08A 1T0YA 3U7DA 2YLMA 2LWPA 1UD7A 4EEWA 4KSLC 5E6NA 1S3SG 1UH6A 3RT3B 4CYEA 3ALBA 2HE7A 2L05A 4BBNC 3UQBA 4DDGD 4HWIB 4AUQC 4ANVA 2DHZA 1WYWB 4MGIE 5C23A 4FA6A 5CHFA 1C1YB 2KX0A 3PHWB 5CTRC 5D7GA 1WZ3A 1WGDA 3GZNI 2C9WB 2M1MA 3N32A 4GB9A 4A3PA 4DBGA 2LVOA 1V6EA 3NS8A 2K6DB 4ICUA 2CKHB 2NCNA 4FULA 1WZ0A 4FBJB 2L7RA 3DVGY 2LXAA 2CU1A 2JT4B 4MJSB 1E8WA 2EMSA 3WAOA 3QJZA 3V6CB 4TUUA 4BKSA 1V49A 2JZZA 2GBJA 2KVRA 2ZNVB 1Q0WB 2GBKA 4AJYB 3W1SA 3UGBB 2LRUA 3PREA 4BOZB 1WFYA 3ZNID 1RLFA 2LI5A 5E6OA 1V2YA 1RAXA 4IWPA 3ECIA 4W9FA 1IPGA 1ZGUB 2K1FA 3QAQA 4GDKA 4PS7A 4NAWA 3KUZA 1KOTA 4HPMB 2ZPYA 4JGHB 1M94A 4K7WA 3ZDMC 1S1QB 2DZIA 2ZEQA 1TTNA 3L16A 3NOBA 2MP2A 2KMCA 1YD8U 1WJ4A 3ZRFA 2KWVB 1FXTB 3UIOB 1WGYA 2LGYA 1V86A 2DYMA 3SD5A 1WH3A 5DPWA 4AJWA 2NS5A 3VHTC 1J0GA 3VUWA 2KDBA 1Q5WB 3JSVB 4M8MA 5DPSA 1E8YA 1ISNA 1WR1A 2KC2A 2N9EB 3N3KB 3B0AA 4WJPA 1H8CA 3TIXA 2WX1A 4FHJA 4ICVA 3VAWA 4W9DA 3V60A 2ASQA 1BT0A 2FCMA 4IC7B 4JLCA 4DXAB 1GG3A 2V1YA 3C0RB 4WAAA 1WMHA 4ASWC 4DHJB 5TR5A 2PJHA 4ANXA 3GOEA 4WQOB 2IBIB 3OJ3A 1WRDB 3KYCD 1GNUA 2KJHB 2RGFA 4HJKA 2NPTA 2FUHB 1F9JA 4PYZA 2RR9A 3VDZA 2MP2B 2R2QA 1Z2MA 2DZMA 3DVNU 2KX3A 2HTHA 2KD0A 4WJOA 2J0KA 2MX2A 1P9DU 2MBHA 3AU4A 3PT2B 1WE7A 2D3GA 4GXBA 2G4SA 3T8MA 2A4ZA 2Z0EB 3EFUA 3QX1A 2K6QA 3KUCB 3TCAA 3VUYA 2J0MA 1RRBA 3R7RA 4FN2A 2L76A 3A1QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX7 A;  4LCD E;  3MHS D;  2KTR A;  4MM3 A;  3SU8 X;  4G50 A;  1U4A A;  2D10 A;  3H7P B;  3IBE A;  4M8N A;  4ZRJ A;  3ZRC A;  2NBU A;  2R2O A;  5AEK B;  1GC7 A;  2WDT B;  2UYZ B;  3NHE B;  4RMA A;  2JY6 A;  3ZNZ B;  3B08 A;  2Y5B B;  2RD0 A;  3DVN V;  4BBN F;  3PHX B;  4MGK E;  5J18 A;  3ZNH B;  3SDL C;  3ZVV A;  2KDF B;  4E71 A;  4BKT A;  2O6V A;  3LJ3 A;  3BIN A;  1LXD A;  1A5R A;  3R3M A;  4FJY A;  4LJP B;  3X23 A;  3HM3 A;  1AAR A;  2KXJ A;  3CST A;  2KKC A;  1XQQ A;  4HXD A;  3T9L A;  2N1V A;  1WJ6 A;  2PEA A;  1YX5 B;  2AWT A;  1R4M I;  4P7I A;  4W9K A;  5IA7 A;  4OVU A;  1V9J A;  2M17 A;  3QCA A;  4B95 A;  1WIA A;  4NJ7 A;  4BKS D;  1JRU A;  5C1Z A;  4KVG B;  2KFK B;  2N4F A;  2KMA A;  3VH3 B;  3V61 A;  2KOX A;  4EOY A;  2ZVN A;  2FCQ A;  3A4S C;  5D94 A;  3ZKJ C;  4EKU A;  4I6P A;  4J6I A;  2HD5 B;  4W9H A;  2C7M B;  2JZ3 B;  2PPH A;  4YL8 A;  5LXI B;  4EZK A;  3ML8 A;  2ZJD A;  3OJ4 B;  3KVF B;  1P98 A;  2LUE A;  3KYD D;  2L8J A;  3H9D A;  1C3T A;  4HLE A;  1P3Q U;  2DX5 B;  3VH4 B;  2KC1 A;  4WJN A;  4EFO A;  4GDL A;  4IUM B;  1G6J A;  1WX9 A;  3DBS A;  1E8X A;  3AUL A;  3PSE B;  1K8R B;  4ANW A;  3QWZ B;  2LVQ A;  3OAW A;  3PS6 A;  3QA8 A;  1WGR A;  1SIF A;  4XX5 A;  1WX8 A;  1IYF A;  1V80 A;  3KH0 A;  3WAM A;  4DHZ E;  2AL6 A;  3S2A A;  3IHP C;  1VCB A;  3EEC A;  5DCN A;  3U30 A;  1P1A A;  1YIW A;  2MBB B;  4URK A;  4MEL A;  2G45 B;  3DVG X;  1TBE A;  3ZLZ A;  3TJP A;  2N1W A;  3L10 B;  2A5U A;  5AZH A;  2ZPN A;  3R66 C;  2YVC A;  2DAF A;  3MTN B;  2QHO A;  4G3X B;  3A9J B;  2PE9 A;  3AXC A;  3L13 A;  3A1Q A;  4CHK A;  4JQW C;  2BKR B;  2OOB B;  4ZRI A;  2XEW A;  2KTR B;  2D11 A;  3ZO5 B;  4A3O A;  2BKF A;  4HVB A;  2KLC A;  2G3Q B;  4W9I A;  2LZ6 A;  2GBR A;  1QZE A;  4DWF A;  2V3S A;  3QHT A;  3RUI B;  4I6N B;  4EUT A;  1ZKH A;  5JH5 C;  2KWC A;  3ML9 A;  1WJN A;  1OGW A;  3PLV A;  3JW0 X;  2IO2 B;  4OVV A;  5L95 C;  2KDI A;  4W9E A;  3R7Q A;  2N7E A;  2J7Q B;  1GC6 A;  4B6W A;  2MRP A;  1NBF C;  1TGZ B;  4CO7 A;  2IY1 B;  3ONS A;  1WXS A;  3M3J A;  3D32 A;  3RCZ A;  4KDI C;  4NQL B;  3DOW A;  2JVC A;  4RM9 A;  3RZF A;  2I1K A;  4II2 B;  4KDL B;  4W9G A;  1YQB A;  1E7U A;  3PZD A;  4KZC A;  5LXH A;  5D2M B;  4ZDV A;  5DPT A;  1V5O A;  1R4N I;  1GUA B;  3RYT A;  2JRH A;  4WJQ A;  2RPQ A;  3M95 A;  3DCG A;  4IM3 A;  3ZTD A;  1LFD A;  2CHW A;  2KJR A;  2M4N A;  5AZF A;  2CR5 A;  2KWU B;  2O2V B;  1WI0 A;  1ZW7 A;  3DDC B;  4PS3 A;  2GMI C;  4GSW A;  2D2Q A;  3P2B A;  4K81 A;  2KHW B;  2BWF A;  2ZCC A;  2ZVO A;  2MBQ A;  3X0W A;  5L83 A;  2UWQ A;  3SHQ A;  4WWP A;  2BYF A;  3RZW C;  1SE9 A;  4N9F 4;  4GN1 A;  3TL5 A;  2W9N A;  3AU5 A;  2LRW A;  2NBW B;  4JIO U;  5DPR A;  4W9J A;  5CHV C;  4BVU C;  4LJO B;  1NI2 A;  2O6V B;  1WR6 E;  4IM2 A;  2XK5 B;  5EDS A;  3OLM D;  4EZL A;  1WJU A;  1OTR B;  2DYO A;  4DHZ B;  3PV1 A;  4KIK A;  4MEM A;  3UF8 A;  3WA0 A;  4AWJ A;  1J19 A;  3M62 B;  2KJ6 A;  1HE8 A;  3WAL A;  3W1Y A;  1WF9 A;  1YX6 B;  2CS4 A;  1WM3 A;  2DZK A;  2FCN A;  2PE6 B;  3H1U A;  2KO3 A;  3IG3 A;  4FJZ A;  2K25 A;  3CSF A;  4HK2 A;  2JPH A;  2RSU A;  1CMX B;  3O65 B;  3VQI A;  1Z5S B;  1I35 A;  1EO6 A;  2N9P C;  1WXA A;  4TQ1 A;  2C60 A;  3VTU A;  4TKN A;  3EHV A;  4GMV A;  2XBB C;  1OQY A;  3TMP B;  4HPL B;  4KV2 A;  1NDD A;  3AI5 A;  2KTF A;  2C7N B;  2JXX A;  1E8Z A;  3NY5 A;  5GMV A;  3V62 A;  2IO3 B;  3K9P B;  3PPA A;  5KHO A;  4BOS C;  4E74 A;  1L2N A;  2CHZ A;  2D07 B;  2O6V D;  2JRI B;  3A4R A;  1UGM A;  2REX A;  5HKH A;  2FCS A;  3JYU A;  1UEL A;  4MGY E;  1V81 A;  5J2R A;  4G0N B;  1P0R A;  1XD3 B;  2BWE S;  2FNJ B;  3DQV A;  3A9K A;  3L0W B;  2MCN B;  4IW0 A;  2KNB A;  2OJR A;  3APC A;  2DZJ A;  2L0F A;  5FR6 A;  2NBV B;  2MA9 B;  2N7D A;  2IO1 B;  2L0T A;  2XK5 A;  3ZNG C;  3Q3F A;  4IWQ A;  2MW5 A;  5JZE B;  1KM7 A;  4IM0 A;  3APD A;  2M8S A;  5D6J B;  1I42 A;  2AEH A;  2CHX A;  3VFK A;  2KQ7 A;  3TBL D;  3VTW A;  4KZ0 A;  2K8C A;  3QAR A;  3ZW3 A;  4F8C B;  2LGX A;  2FAZ A;  2EMT A;  3VXW A;  1MG8 A;  2M0X A;  1H4R A;  4DDI D;  4LDT B;  3QQ8 B;  4PS8 A;  3WIM A;  1UBQ A;  3NZS A;  2GBN A;  2FID A;  2KFK A;  4WWN A;  4TV3 A;  3H7S A;  3PGE A;  4FJV B;  2G4D B;  3HIZ A;  4I6L B;  5G2N A;  3VVW B;  3ZDT A;  3PVL A;  3NZU A;  1IP9 A;  4BKG A;  3PRP B;  2ZZP B;  1EUV B;  1WE6 A;  4FHK A;  2DAJ A;  4MJS A;  3CF6 E;  1V5T A;  2LJ5 A;  4NQK E;  3ZTC A;  1XT9 B;  3L17 A;  4K7U A;  3PLU A;  4B9K A;  2IY0 B;  1EF1 A;  1WY8 A;  3U8Z A;  4XZ4 A;  2KFJ A;  2KLG A;  3ENE A;  4GIV A;  4GDL B;  2NPT B;  2WYQ A;  4AOF A;  3WAP A;  4F7Z A;  3QC8 B;  2BGF A;  2WX0 A;  4GDK B;  3WAN A;  4MH0 E;  2K8B A;  3N30 A;  1WXV A;  2MSE D;  4PYU A;  4EZJ A;  2J0J A;  4E3C A;  3HHM A;  2LGD A;  2JF5 A;  2HJ8 A;  2KN5 A;  5JHB A;  3BY4 B;  4LDT D;  2AL3 A;  4MSQ B;  4KSK C;  2C7H A;  4FAD A;  4M0W B;  1LM8 B;  2JWZ A;  2LXC A;  3DBH I;  3IVF A;  2IO0 B;  3DPD A;  4NJ6 A;  1EF5 A;  2NR2 A;  2V4L A;  3K9O B;  4ZYN A;  2Z59 B;  4A20 A;  3ZIM A;  1Q1O A;  2LAS A;  2ZCB A;  4MGZ E;  4GOC A;  3EC8 A;  4K7S A;  4RM8 A;  4W9C A;  4HCP B;  3A9J A;  3APF A;  1TZ1 A;  1WXM A;  1WGH A;  2C5L C;  3RUL A;  2IYD B;  4BFR A;  1E90 A;  3DBL I;  4DHJ D;  4MSM B;  3W1S C;  1SGH A;  4HCN B;  2MBO A;  2MLB A;  1WGG A;  1Y8R C;  1UBI A;  1WMH B;  2I1J A;  2KQS A;  4NPN A;  3PTF C;  2K8H A;  3RD2 A;  4F1S A;  3CMM B;  5IAA C;  2BYV E;  2L3Z A;  4GGQ A;  4NAW B;  2KZR A;  4KIK B;  1J8C A;  3M63 B;  3V6E B;  1WM2 A;  3JVZ X;  4IG7 B;  2NVU I;  5JHA A;  1E7V A;  3VTV A;  2DYB A;  2WWZ A;  2KAN A;  3MJW A;  4NY0 A;  4DK5 A;  2MWS B;  1OEY A;  3DBR I;  4X57 B;  3L54 A;  4ANU A;  4NNJ B;  4JL9 A;  2BF8 B;  3KUD B;  3ZUN A;  1YJ1 A;  3H6N A;  1OEY J;  4AP4 C;  2AYO B;  4XC2 A;  1UZX B;  5CX3 A;  5J17 A;  2K39 A;  5CHW A;  5G55 A;  3VUX A;  4II3 B;  1E5W A;  2VRR B;  3JSV A;  1KLV A;  1LQB A;  4TQ0 A;  2IZV B;  4HDO A;  2BPS A;  2LD9 A;  5E6P A;  5LLI A;  1L7Y A;  2LVP A;  2L00 B;  3UQA A;  3I3T B;  1D3Z A;  1GJZ A;  3QK0 A;  3B1L X;  4ZRK A;  2KDE B;  3A33 B;  4W9L A;  3Q3J A;  3IFW B;  2FIF A;  2KK8 A;  3LDZ E;  4GU2 A;  4G11 A;  3A9K B;  2O2V A;  4WWO A;  2JUO A;  3HK0 A;  3QIJ A;  2EKE C;  2B3A A;  2GOW A;  2N9X A;  1KJT A;  4FLH A;  2ZNV C;  3H7P A;  2MQJ A;  3PRZ A;  5KHQ A;  1RFA A;  3UIP B;  4MDK E;  4HDQ A;  1VD2 A;  1PQS A;  3HM6 X;  2MBE A;  1X1M A;  5AZG A;  2Z0D B;  2BYE A;  4K1R B;  2DEN B;  5BO4 B;  3KW5 B;  3PRM B;  3UIN B;  4IWO A;  2GBM A;  3L08 A;  1T0Y A;  3U7D A;  2YLM A;  2LWP A;  1UD7 A;  4EEW A;  4KSL C;  5E6N A;  1S3S G;  1UH6 A;  3RT3 B;  4CYE A;  3ALB A;  2HE7 A;  2L05 A;  4BBN C;  3UQB A;  4DDG D;  4HWI B;  4AUQ C;  4ANV A;  2DHZ A;  1WYW B;  4MGI E;  5C23 A;  4FA6 A;  5CHF A;  1C1Y B;  2KX0 A;  3PHW B;  5CTR C;  5D7G A;  1WZ3 A;  1WGD A;  3GZN I;  2C9W B;  2M1M A;  3N32 A;  4GB9 A;  4A3P A;  4DBG A;  2LVO A;  1V6E A;  3NS8 A;  2K6D B;  4ICU A;  2CKH B;  2NCN A;  4FUL A;  1WZ0 A;  4FBJ B;  2L7R A;  3DVG Y;  2LXA A;  2CU1 A;  2JT4 B;  4MJS B;  1E8W A;  2EMS A;  3WAO A;  3QJZ A;  3V6C B;  4TUU A;  4BKS A;  1V49 A;  2JZZ A;  2GBJ A;  2KVR A;  2ZNV B;  1Q0W B;  2GBK A;  4AJY B;  3W1S A;  3UGB B;  2LRU A;  3PRE A;  4BOZ B;  1WFY A;  3ZNI D;  1RLF A;  2LI5 A;  5E6O A;  1V2Y A;  1RAX A;  4IWP A;  3ECI A;  4W9F A;  1IPG A;  1ZGU B;  2K1F A;  3QAQ A;  4GDK A;  4PS7 A;  4NAW A;  3KUZ A;  1KOT A;  4HPM B;  2ZPY A;  4JGH B;  1M94 A;  4K7W A;  3ZDM C;  1S1Q B;  2DZI A;  2ZEQ A;  1TTN A;  3L16 A;  3NOB A;  2MP2 A;  2KMC A;  1YD8 U;  1WJ4 A;  3ZRF A;  2KWV B;  1FXT B;  3UIO B;  1WGY A;  2LGY A;  1V86 A;  2DYM A;  3SD5 A;  1WH3 A;  5DPW A;  4AJW A;  2NS5 A;  3VHT C;  1J0G A;  3VUW A;  2KDB A;  1Q5W B;  3JSV B;  4M8M A;  5DPS A;  1E8Y A;  1ISN A;  1WR1 A;  2KC2 A;  2N9E B;  3N3K B;  3B0A A;  4WJP A;  1H8C A;  3TIX A;  2WX1 A;  4FHJ A;  4ICV A;  3VAW A;  4W9D A;  3V60 A;  2ASQ A;  1BT0 A;  2FCM A;  4IC7 B;  4JLC A;  4DXA B;  1GG3 A;  2V1Y A;  3C0R B;  4WAA A;  1WMH A;  4ASW C;  4DHJ B;  5TR5 A;  2PJH A;  4ANX A;  3GOE A;  4WQO B;  2IBI B;  3OJ3 A;  1WRD B;  3KYC D;  1GNU A;  2KJH B;  2RGF A;  4HJK A;  2NPT A;  2FUH B;  1F9J A;  4PYZ A;  2RR9 A;  3VDZ A;  2MP2 B;  2R2Q A;  1Z2M A;  2DZM A;  3DVN U;  2KX3 A;  2HTH A;  2KD0 A;  4WJO A;  2J0K A;  2MX2 A;  1P9D U;  2MBH A;  3AU4 A;  3PT2 B;  1WE7 A;  2D3G A;  4GXB A;  2G4S A;  3T8M A;  2A4Z A;  2Z0E B;  3EFU A;  3QX1 A;  2K6Q A;  3KUC B;  3TCA A;  3VUY A;  2J0M A;  1RRB A;  3R7R A;  4FN2 A;  2L76 A;  3A1Q B; 
#chains in the Genus database with same CATH topology
 3P63 A;  4KGT A;  3IAM 1;  3SU8 X;  1U4A A;  3H7P B;  3IBE A;  1GC7 A;  2JY6 A;  4OHJ A;  4DXG A;  3PHX B;  5J18 A;  3ZNH B;  1CQV A;  3B2F A;  1B9R A;  5IKC M;  1LXD A;  2LEK A;  1FMA D;  1XQQ A;  2N0S B;  2PEA A;  1YX5 B;  1ZDX A;  2AWT A;  1R4M I;  1V9J A;  2M17 A;  4S0R A;  1WIA A;  1BML C;  3FIL B;  2N4F A;  3T3N A;  4ZRQ A;  4WWM A;  3I9V 1;  3V61 A;  1DYQ A;  3AEF B;  1N6Z A;  2LFI A;  5D94 A;  4J6I A;  2C7M B;  2JZ3 B;  5LXI B;  2YEP F;  2ZJD A;  3OJ4 B;  3KVF B;  2LUE A;  2L8J A;  4HLE A;  2K22 A;  1WX9 A;  1E8X A;  1TYG B;  2K9X A;  4XX5 A;  5C3J B;  2W55 A;  3KH0 A;  4DHZ E;  3S2A A;  1VCB A;  1AN8 A;  2JXT A;  2G45 B;  3DVG X;  1WGK A;  2N1W A;  3L10 B;  3R66 C;  2YVC A;  2DAF A;  1FCL A;  3U2S C;  4CHK A;  3A1Q A;  2BKR B;  3DBL B;  1QZE A;  5FKA C;  3RUI B;  1ZKH A;  5JH5 C;  2KWC A;  3MC9 A;  1WJN A;  1YNT E;  4NZL B;  5IOI A;  2KDI A;  1FNW A;  1TGZ B;  3D32 A;  4NQL B;  1E6E B;  1R4N I;  3I57 A;  3AH7 A;  2J4X A;  4WJQ A;  3AE8 B;  1I4G A;  1ACC A;  4FA6 A;  2KWU B;  5C2T B;  2GMI C;  2MBQ A;  3Q8E A;  2FE8 A;  1VJK A;  2FUG 1;  3TL5 A;  1TZO A;  4LNI A;  4JIO U;  5DPR A;  1WXQ A;  5CHV C;  2XK5 B;  1STE A;  3PZ7 A;  2DYO A;  4MEM A;  1J19 A;  1UF0 A;  4ZRP A;  3M62 B;  1KLG D;  1WF9 A;  2DZK A;  1WM3 A;  2AQ2 B;  2RSU A;  1CMX B;  5BMH A;  4H2A A;  1R4N B;  1NDD A;  5EE1 A;  2C7N B;  2JXX A;  3NY5 A;  3V62 A;  1TS5 A;  2O6V D;  4RGN A;  4UDU C;  3P4S B;  2WXL A;  1ZE3 D;  3MJ5 A;  4G0N B;  3DQV A;  2OJR A;  2V9H A;  3AE9 B;  2L0F A;  1ZP0 B;  2NBV B;  1YJI A;  2IO1 B;  2WLB A;  1EU3 A;  5FK9 C;  1P7F A;  3Q3F A;  2INP E;  5JZE B;  3AEE B;  1I42 A;  5D6J B;  2CHX A;  3VFK A;  3ZW3 A;  4F8C B;  2AX5 A;  1VZ8 A;  2FAZ A;  4YTM B;  2CJO A;  3VXW A;  2WQY B;  1N60 A;  4O1N A;  3NZS A;  3DBH B;  2FID A;  1VRA B;  4WWN A;  4TV3 A;  3BVM A;  3H7S A;  4FJV B;  3RNE C;  1GOZ A;  3HIZ A;  1UWX A;  4I6L B;  5G2N A;  3VVW B;  1SE4 A;  1VR9 A;  1DOY A;  2ZZP B;  1EUV B;  2WXG A;  1WE6 A;  4FHK A;  2DAJ A;  1FXA A;  1WRI A;  1XXG A;  3L17 A;  4K7U A;  1C4C A;  1C79 A;  2SEB D;  4XZ4 A;  2KLG A;  1JWU D;  2NPT B;  4GDL B;  1NYQ A;  3WAP A;  3QC8 B;  4GDK B;  3GP7 A;  1XCT L;  4C7Z A;  1K52 A;  4E3C A;  2KN5 A;  1HTO A;  2JZP A;  4AQ7 A;  2KAC A;  3BYY B;  4ZYN A;  2Z59 B;  4MGZ E;  3AE1 B;  3A9J A;  3APF A;  1TZ1 A;  2C5L C;  4BFR A;  1E90 A;  3RNC C;  1K51 A;  4DHJ D;  4ZHP A;  2INN E;  3RD2 A;  3BVG A;  5IAA C;  4NAW B;  1A70 A;  4KIK B;  3M63 B;  2NVU I;  1E7V A;  4DK5 A;  2MWS B;  4ITK A;  2KDM A;  3GE3 C;  3H6N A;  4WAF A;  4XC2 A;  5CX3 A;  1SF0 A;  3JSV A;  3ZJV A;  2M19 A;  1LQB A;  4TQ0 A;  3BK1 A;  2IZV B;  2LD9 A;  5E6P A;  5LLI A;  3UQA A;  3A33 B;  4W9L A;  2FIF A;  3LDZ E;  3SFE B;  2JUO A;  2WXO A;  3QIJ A;  4C00 A;  2GOW A;  1KJT A;  5KHQ A;  2ZNV C;  2IPK D;  2MQJ A;  4OW0 A;  1VD2 A;  3N1Z C;  1OQQ A;  2BYE A;  3RPF C;  1UD7 A;  1SIJ A;  1UH6 A;  3U52 E;  3OWE B;  1TY2 A;  2HE7 A;  2L05 A;  4BBN C;  4P16 A;  4DDG D;  1TKG A;  2DLB A;  2MJE A;  4MGI E;  3MHZ A;  1T5X D;  1I4H A;  2J53 A;  3GZN I;  4HRS A;  2PMV A;  2X8X X;  1V6E A;  1F52 A;  3ZXV A;  3Q3O C;  2LXA A;  4Q2J A;  4J3O D;  3WAO A;  3QJZ A;  4TUU A;  4N58 A;  3W1S A;  3PRE A;  1WFY A;  3TEZ A;  1C77 A;  4GDK A;  1KOT A;  2LHE A;  2Y5P A;  3URY A;  1AYF A;  3ZDM C;  5EE0 A;  2DZI A;  3NOB A;  3B9J A;  2MP2 A;  2KMC A;  2KWV B;  2WXI A;  1JQ4 A;  1FXT B;  3DHH C;  1SBB B;  2AQ1 B;  4RFB A;  1WGY A;  1V86 A;  1WH3 A;  5DPW A;  3P1M A;  1JRO A;  3KLS X;  2PTL A;  3KWV A;  3N3K B;  3Q8B A;  1N5X A;  4FHJ A;  3EA6 A;  4B0M A;  1BT0 A;  2JWU A;  1K53 A;  1KRH A;  1WMH A;  3BII D;  4XE0 A;  2D5G A;  2FBW B;  3Q3N C;  3KYC D;  3ETR A;  1D4B A;  1HTQ A;  1FNU A;  2HTM E;  3NZ3 A;  2KD0 A;  2Z8L A;  1BXT A;  1P9D U;  2BYT A;  3T8M A;  2K6Q A;  1FD6 A;  3HUI A;  4YTP B;  1F2R C;  4RF0 A;  3Q8A A;  2GI9 A;  2KTR A;  4IOI E;  4G50 A;  2D10 A;  4RMA A;  3C8Y A;  3DVN V;  2WXM A;  1K50 A;  3NUH B;  3IT4 B;  2O6V A;  4FJY A;  3X23 A;  1AAR A;  4HXD A;  4P7I A;  4B95 A;  4NJ7 A;  4BKS D;  1E9M A;  4KVG B;  2KVZ A;  2KMA A;  3MFG A;  1JW9 D;  2FCQ A;  3LXF A;  4EKU A;  5BMI A;  3CWI A;  2IGD A;  3GS2 A;  4YL8 A;  4ZOH C;  2QDF A;  5BMG A;  3H9D A;  2QC8 A;  2DX5 B;  1J7B A;  1ZOY B;  1D5Z C;  2KC1 A;  4NAM A;  4WJN A;  3VH4 B;  4IUM B;  4PK1 A;  1G6J A;  3DBS A;  3AUL A;  2BQQ A;  3IXS A;  4K3B A;  3QA8 A;  1SIF A;  3P42 A;  1V80 A;  2LJI A;  2TSS A;  3LYY A;  2BVC A;  3ZYY X;  2N9K A;  2BS3 B;  2BS2 B;  1V97 A;  2ZPN A;  1FXI A;  3A9J B;  2VH2 A;  2PE9 A;  4XYC A;  4JQW C;  2KT7 A;  3AE7 B;  4A3O A;  4HVB A;  2BKF A;  4ARC A;  1ESF A;  1TJE A;  1XLP A;  4RGO S;  4XWT A;  1OGW A;  5GXG B;  2IO2 B;  1KLU D;  2KYW A;  2LGS A;  5L95 C;  3R7Q A;  1EWY C;  2J7Q B;  1QOF A;  3ZJT A;  4CO7 A;  3ONS A;  1WXS A;  2DNF A;  4RM9 A;  2I1K A;  1MI0 A;  4KDL B;  4W9G A;  3FC4 A;  1E7U A;  3PZD A;  4JX1 C;  3IAS 1;  1QIL A;  1V5O A;  2N9L A;  1GUA B;  4P1B C;  1M4V A;  4RF1 A;  3RYT A;  3FIL A;  2G9H D;  4MM3 B;  1ZXH A;  3AV8 A;  2CHW A;  2DBY A;  2KJR A;  2M4N A;  2CR5 A;  3DDC B;  1ZW7 A;  4K81 A;  1B1Z A;  4GSW A;  3P2B A;  4YSZ B;  2VZK D;  2ZCC A;  4OZC A;  4GN1 A;  2W9N A;  3AU5 A;  2NBW B;  2O6V B;  1WR6 E;  5EDS A;  3OLM D;  4EZL A;  1WJU A;  3C19 A;  3UF8 A;  1HE8 A;  3VRB B;  1ROE A;  3WAL A;  1YX6 B;  2CS4 A;  3IG3 A;  2FCN A;  4C80 A;  2KO3 A;  3RNB C;  2MJD A;  2K0P A;  3RFZ B;  3VQI A;  1KH0 A;  1I35 A;  1EO6 A;  2N9P C;  3VTU A;  1YJJ A;  3EHV A;  4GMV A;  2XBB C;  3TMP B;  4HPL B;  3AI5 A;  2E3T A;  3K9P B;  2CHZ A;  2I2Y A;  3W2D A;  2ONQ A;  3B2G A;  2GRI A;  1OFF A;  2JRI B;  3DWG C;  2REX A;  3JYU A;  2CU3 A;  3BWU D;  1QQR A;  3L0W B;  1YN4 A;  3AE6 B;  2MCN B;  3AED B;  2OJW A;  2DZJ A;  1PFD A;  2Y3A A;  5BYQ A;  5FR6 A;  2MA9 B;  2XK5 A;  2L0T A;  1JAL A;  4IWQ A;  1WYG A;  4IM0 A;  2M8S A;  3PZ8 A;  3RI7 C;  3VTW A;  3AN1 A;  1C4A A;  4C7Y A;  4DDI D;  4PS8 A;  3QQ8 B;  3WIM A;  1TT5 B;  2KFK A;  2PLP A;  4CQN A;  4BKG A;  1EU4 A;  4NQK E;  3PLU A;  4LNN A;  2IGG A;  4YSX B;  2MH7 A;  2IY0 B;  3AEC B;  2RPV A;  5IP4 D;  2OED A;  4ARI A;  4MH0 E;  2ACZ B;  2K8B A;  3DBR B;  4R3D A;  4EZJ A;  4ZHO A;  2LGD A;  2HJ8 A;  2YEP B;  2PW9 A;  4LDT D;  2KQ4 X;  2AL3 A;  1LM8 B;  2JWZ A;  2LUM A;  1HEZ E;  3IVF A;  1FRD A;  4NJ6 A;  5LNK 1;  1XEE A;  2NR2 A;  2V4L A;  2X38 A;  4OZA A;  4RCO A;  4A20 A;  1YQ4 B;  3ZIM A;  2LAS A;  4K7S A;  4W9C A;  1PGX A;  2IYD B;  2IGH A;  3Q8C A;  4HCN B;  2KQS A;  2I1J A;  2QCZ A;  4NPN A;  3PTF C;  3CMM B;  5FR3 A;  2L3Z A;  2GB1 A;  3V6E B;  2WP9 B;  1TIF A;  4YSY B;  4IG7 B;  3MC8 A;  1XO3 A;  2IND C;  2DYB A;  4NY0 A;  4LNF A;  1V1P B;  3MJW A;  4ANU A;  4JL9 A;  1JWS D;  1R4M B;  4KGS A;  2V3P A;  1J7C A;  1XLN A;  2OHF A;  4HPP A;  4HDO A;  1DGJ A;  1L7Y A;  3GZN B;  3I3T B;  1GJZ A;  4ZRK A;  2PVO D;  1UGJ A;  2VZK B;  4G11 A;  3A9K B;  2N9X A;  2W3R A;  2DWQ A;  4MDK E;  1AW7 A;  1X1M A;  4N6E B;  1I4R A;  1RYJ A;  3NVY A;  1E7P B;  3BYT B;  3KW5 B;  3PRM B;  2HDE A;  2WS3 B;  1MFW A;  3U7D A;  2JSV X;  2LWP A;  4EEW A;  1XLQ A;  3RT3 B;  3TEW A;  3PO0 A;  1FFV A;  3UQB A;  1WYW B;  4FXC A;  5CHF A;  2KX0 A;  2JYE A;  5CTR C;  1YQ3 B;  2B76 B;  3N32 A;  4DBG A;  2NMQ A;  4ICU A;  2CKH B;  2WXQ A;  3NS1 A;  4FBJ B;  1DOX A;  1F0Z A;  1VDV A;  1E8W A;  2XNA C;  1V49 A;  2GBJ A;  2ZNV B;  1Q0W B;  4AJY B;  3UGB B;  2LRU A;  4BOZ B;  2LI5 A;  1XCQ L;  5MPO A;  1FM0 D;  1V2Y A;  1RAX A;  4IWP A;  3AEG B;  3ECI A;  4W9F A;  3QAQ A;  4PS7 A;  3KUZ A;  2LHD A;  2ZPY A;  4JGH B;  1M94 A;  4K7W A;  3L16 A;  2BS4 B;  1D5M C;  2RDB C;  3UIO B;  3SD5 A;  1IGC A;  2NS5 A;  4AJW A;  1J0G A;  3JSV B;  1ISN A;  2KC2 A;  2N9E B;  1H8C A;  3TIX A;  2WX1 A;  3RN9 C;  1ENF A;  3V60 A;  3C0R B;  4C4V A;  4DHJ B;  3NVZ A;  5TR5 A;  4DXF A;  3GOE A;  3OJ3 A;  2BT6 A;  2WXP A;  1SSN A;  2RGF A;  2FUH B;  1F9J A;  5TSS A;  3VDZ A;  1EWC A;  2R2Q A;  2DZM A;  2WXF A;  4WJO A;  3AU4 A;  1WE7 A;  2D3G A;  4BZA A;  3KUC B;  3TCA A;  1KFY B;  1GB4 A;  3W5V B;  2L76 A;  4XGA B;  1WX7 A;  4LCD E;  3MHS D;  4LLG M;  4WIP A;  1IBX A;  5EE9 A;  2NBU A;  5AEK B;  3ZNZ B;  2UYZ B;  1NEK B;  3FAH A;  1TKE A;  1ZDV A;  2Y5B B;  3B08 A;  5IO9 A;  1FNV A;  4BBN F;  1ET6 A;  5D3D A;  2H89 B;  4E71 A;  3ZVV A;  4BKT A;  3LJ3 A;  5T8I A;  1A5R A;  4AS1 A;  3HM3 A;  4L2Y A;  2KXJ A;  3CST A;  3T9L A;  2JX5 A;  1SE3 A;  1WJ6 A;  3KWL A;  4US8 A;  1WWT A;  4REZ A;  3QCA A;  4LNO A;  4KX6 B;  2KFK B;  3VH3 B;  4IKG A;  2ZVN A;  3A4S C;  3ZKJ C;  3NVV A;  2QMT A;  3NRZ A;  2HD5 B;  4I6P A;  4EZK A;  3ML8 A;  4L1B A;  1ZPS A;  1BUI C;  1P3Q U;  2L52 A;  4WQM A;  1DOI A;  1K8R B;  4ANW A;  2D3B A;  2LVQ A;  3OAW A;  1IYF A;  1WX8 A;  3IHP C;  3HVD A;  5HG2 A;  3EEC A;  3U30 A;  2MBB B;  1IUE A;  1I4P A;  1ZXI A;  1GAQ B;  3MTN B;  3E56 A;  3AXC A;  3W9C B;  3L13 A;  2M0A A;  3N1Y C;  4ZYS A;  2XEW A;  2KTR B;  2D11 A;  3ZO5 B;  1XLO A;  2G3Q B;  2GBR A;  2V3S A;  4EUT A;  5HFY A;  3AB5 A;  3JW0 X;  1C4P A;  2HJ1 A;  2QSD A;  3TSS A;  4B6W A;  2MRP A;  1NBF C;  4HJG E;  2ZW1 A;  4KDI C;  3RNF C;  3P4R B;  3RNA C;  3DOW A;  4US9 A;  2JVC A;  4RGT A;  4KZC A;  5LXH A;  4YT0 B;  5D2M B;  4ZDV A;  2WXN A;  2RPQ A;  1EM7 A;  3M95 A;  3DCG A;  3ZTD A;  4PS3 A;  2O2V B;  1WI0 A;  2D2Q A;  2QJL A;  5JXV A;  1L4Z B;  5L83 A;  3X0W A;  1N62 A;  3HVZ A;  1SE9 A;  4N9F 4;  2BB6 A;  3ZXR A;  1T3Q A;  1V1O A;  1NI2 A;  1MVK A;  1OTR B;  3R2I A;  4DHZ B;  3PV1 A;  4KIK A;  2MEK A;  3ZGZ A;  1ZUD 2;  2WU5 B;  1AWD A;  2I38 A;  1JWB D;  2K25 A;  3CSF A;  4HK2 A;  2MJ3 A;  3R2T A;  4USA A;  1WXA A;  2C60 A;  1OQY A;  4KV2 A;  2KTF A;  2WXJ A;  5G5H A;  4E74 A;  3PPA A;  4XDD A;  5KHO A;  1CK1 A;  3TUO A;  1SJE D;  4RGM A;  3A4R A;  1UGM A;  2KMM A;  3TEX A;  2FCS A;  3SFD B;  1N5W A;  3I63 C;  3NG0 A;  1P0R A;  1XD3 B;  2BWE S;  3KQ4 A;  2KNB A;  3APC A;  1SJH D;  3VRA B;  2N7D A;  2R61 A;  3U4E G;  2VH1 A;  1CJE A;  1V1P A;  1KM7 A;  3APD A;  4KKJ A;  4S17 A;  3TBL D;  4KZ0 A;  2K8C A;  3QAR A;  2WDV B;  2LGX A;  1I4Q A;  1MG8 A;  2M0X A;  1F77 A;  1H4R A;  2INC C;  4LDT B;  1JWA D;  1UBQ A;  1TS2 A;  3IT6 B;  3U7Z A;  1SE2 A;  3PGE A;  1F1H A;  3PVL A;  3NZU A;  1D6E C;  2EKI A;  3PRP B;  3BK2 A;  3RNG C;  4MJS A;  1V5T A;  3ZTC A;  1XT9 B;  4B9K A;  3U8Z A;  2BTE A;  3ENE A;  2WYQ A;  3V3X A;  1PGA A;  2WGS A;  1RFK A;  4F7Z A;  4L23 A;  3N30 A;  4PYU A;  2MSE D;  3HHM A;  2XN9 C;  2WU2 B;  2C7H A;  3DBH I;  2RDH A;  3AE5 B;  3AE3 B;  3K9O B;  1Q1O A;  1C9F A;  4RM8 A;  4HCP B;  4LNK A;  1WXM A;  3DBL I;  4MSM B;  3W1S C;  1SGH A;  1WGG A;  2MLB A;  1WMH B;  4IDI A;  2K8H A;  4F1S A;  3GB1 A;  3CIR B;  3LB8 C;  1J8C A;  1F2R I;  1L5P A;  2KAN A;  2L1A A;  2V3N A;  3DBR I;  4X57 B;  3L54 A;  2BF8 B;  3KUD B;  1T6B X;  5IN7 A;  1OEY J;  2AYO B;  5J17 A;  5CHW A;  1V8C A;  1L0X B;  2L00 B;  2NTT A;  3B1L X;  1C78 A;  3Q3J A;  4C4V B;  4GU2 A;  2QIL A;  4WWO A;  3O13 A;  3AEA B;  3HK0 A;  1JCK B;  2B3A A;  1E10 A;  3PRZ A;  4HDQ A;  1PQS A;  3HM6 X;  2IDY A;  5BO4 B;  4K1R B;  2DEN B;  2KAJ A;  3VR8 B;  3UIN B;  4M00 A;  5D3I B;  1S3S G;  5AUK A;  3ALB A;  4TSS A;  1QT9 A;  5BYR A;  1RWS A;  4HWI B;  4AUQ C;  3E9S A;  4ANV A;  2EEL A;  2DHZ A;  1QLB B;  1C1Y B;  3PHW B;  1PGB A;  5D7G A;  2C9W B;  4GB9 A;  3ZQ4 A;  2L83 A;  2LVO A;  1LGR A;  3NS8 A;  2K6D B;  1NI3 A;  4ACF A;  2NCN A;  4FUL A;  1WZ0 A;  2IJ0 A;  2L7R A;  2WDQ B;  4MJS B;  4MH8 A;  2EMS A;  4BKS A;  1TS4 A;  2JZZ A;  2GBK A;  5G5G A;  2W3S A;  3ZNI D;  3AEB B;  1L4D B;  1T0S C;  4JE3 B;  5E6O A;  2BW2 A;  2BBC A;  1IPG A;  1FO4 A;  4LK0 M;  1YD8 U;  4A8X C;  3J9C A;  2BB5 A;  3OG5 A;  2LGY A;  2DYM A;  2UU7 A;  4MAC A;  4A90 A;  3VUW A;  2KDB A;  4M8M A;  5DPS A;  1E8Y A;  2PKO A;  4ICV A;  4W9D A;  2ASQ A;  4IC7 B;  4JLC A;  4PT5 A;  4DXA B;  2LGI A;  1GG3 A;  2V1Y A;  4WAA A;  1IBX B;  4ANX A;  2IBI B;  1GNU A;  3I5J C;  1E0Z A;  5EE3 A;  4PYZ A;  4BAX A;  2RR9 A;  2D3C A;  3GE8 C;  2KX3 A;  2V0G A;  2MX2 A;  2MBH A;  2G4S A;  2A4Z A;  2Z0E B;  3L4P A;  3EFU A;  1NYR A;  3VUY A;  1RRB A;  3R7R A;  4FN2 A;  3A1Q B;  3Q69 A;  1PYW D;  4QAY A;  4MM3 A;  2N7J A;  4RH6 A;  3ZRC A;  4M8N A;  4ZRJ A;  2R2O A;  2WDT B;  3NHE B;  3ABV B;  2RD0 A;  1VLB A;  2J42 A;  1QF6 A;  4MGK E;  5E6J A;  1HXY D;  3SDL C;  2KDF B;  2PVG C;  4OVZ A;  3BIN A;  3R3M A;  4LJP B;  1UNS A;  2KKC A;  1TKY A;  2N1V A;  1I7H A;  4W9K A;  3EFC A;  3V05 A;  5IA7 A;  4OVU A;  1FEH A;  1QOB A;  1JRU A;  1L6V A;  5C1Z A;  1Q10 A;  4P6V F;  5AUI A;  5BYS A;  2K3U A;  2KOX A;  4EOY A;  4GLS C;  4HEA 1;  4W9H A;  3Q14 C;  2PPH A;  1P98 A;  5HHD G;  3KYD D;  2JU6 X;  1C3T A;  1XF5 L;  4EFO A;  4GDL A;  3PSE B;  2RMM A;  3QWZ B;  3P4P B;  1C76 A;  3PS6 A;  4A6Q A;  1WGR A;  3T3O A;  2PIA A;  2KWD A;  3WAM A;  2AL6 A;  1HQR D;  5DCN A;  1P1A A;  1YIW A;  4URK A;  4MEL A;  2SAK A;  1R7S A;  1TBE A;  1N63 A;  2NTS A;  4OZB A;  3ZLZ A;  3TJP A;  1P7E A;  2QEJ C;  3AMZ A;  1FIQ A;  2A5U A;  2QIE B;  3DHG C;  5AZH A;  2G1E A;  2QHO A;  4G3X B;  1FPY A;  4YXD B;  3P4Q B;  1L0V B;  2OOB B;  4ZRI A;  2KLC A;  2MHJ A;  4W9I A;  4B0E A;  2LZ6 A;  4DWF A;  1YMH E;  1QKZ A;  3QHT A;  4I6N B;  1JWM D;  3ML9 A;  4XWW A;  3PLV A;  1NEN B;  4OVV A;  1I4X A;  4W9E A;  2N7E A;  1GC6 A;  2IY1 B;  3M3J A;  3RCZ A;  3Q6B A;  3RZF A;  4II2 B;  1ET9 A;  1YQB A;  1QOG A;  4DQO C;  3TEY A;  4YTN B;  4MT5 A;  5DPT A;  2KN4 A;  4M0W A;  1T0R C;  2JRH A;  4IM3 A;  1LFD A;  5AZF A;  1PUT A;  2KHW B;  2BWF A;  2ZVO A;  2UWQ A;  3SHQ A;  4WWP A;  2BYF A;  3RZW C;  5H92 C;  3RMK C;  2LRW A;  4W9J A;  2W82 A;  4LJO B;  4BVU C;  4IM2 A;  2M56 B;  3WA0 A;  4AWJ A;  1YN5 A;  2KJ6 A;  3W1Y A;  3H1U A;  1MHX A;  2PE6 B;  4FJZ A;  2JPH A;  3O65 B;  1HZ5 A;  1Z5S B;  4TQ1 A;  4TKN A;  3MP9 A;  3EGR A;  2WXH A;  4TMA B;  2GLS A;  1E8Z A;  5GMV A;  1HA5 A;  2IO3 B;  4BOS C;  1L2N A;  2ICI A;  2D07 B;  5HKH A;  1UEL A;  2WDR B;  4MGY E;  1V81 A;  3VR9 B;  5J2R A;  2FNJ B;  3A9K A;  1FCC C;  4IW0 A;  4HRO A;  3R8B A;  3ZNG C;  1WSP A;  2MW5 A;  1YN3 A;  2AEH A;  1MG4 A;  2KQ7 A;  4NJC A;  3WCQ A;  2EMT A;  1KF6 B;  3Q8F A;  3AM9 A;  1MJD A;  3AE4 B;  2GBN A;  4KGR A;  3NJT A;  2G4D B;  3ZDT A;  1IP9 A;  3N20 C;  2JQR B;  2J52 A;  1NVI D;  1PDX A;  1JRP A;  3CF6 E;  2LJ5 A;  4YWG G;  2WXR A;  1VZ6 A;  3MC0 B;  1EF1 A;  1RM6 C;  1WY8 A;  2KFJ A;  4AOF A;  4GIV A;  3ZJU A;  1CZP A;  2Q5W D;  2BGF A;  4RNA A;  2WX0 A;  4M01 A;  3WAN A;  1WXV A;  1SXT A;  2J0J A;  2JF5 A;  1MPE A;  5JHB A;  2WHI A;  3BY4 B;  4MSQ B;  4KSK C;  4FAD A;  1TS3 A;  4M0W B;  2LXC A;  2IO0 B;  3DPD A;  4KKI A;  4JWS C;  1EF5 A;  3UI3 A;  2ZCB A;  4GOC A;  3EC8 A;  1SB3 C;  4JWU C;  2K5P A;  1WGH A;  3NVW A;  3RUL A;  4C56 C;  2MBO A;  1Y8R C;  1UBI A;  2JYT A;  1MHH E;  2BYV E;  4GGQ A;  2KZR A;  3EUB 2;  3W5U B;  1WM2 A;  3JVZ X;  1FFU A;  5JHA A;  1HZ6 A;  3VTV A;  2WWZ A;  1OEY A;  4NNJ B;  4N59 A;  3ZUN A;  1UWM A;  1YJ1 A;  4AP4 C;  1UZX B;  1SEB D;  2K39 A;  5G55 A;  3H8H A;  5H8Y E;  3VUX A;  4II3 B;  1E5W A;  2VRR B;  1KLV A;  4WH4 A;  4XDC A;  2BPS A;  2LVP A;  1D3Z A;  3QK0 A;  3DHI C;  4D2K A;  2KDE B;  3BVZ A;  3IFW B;  2KK8 A;  2O2V A;  4WUR A;  3SEB A;  2EKE C;  4FLH A;  3H7P A;  1RFA A;  1UUP A;  3UIP B;  2AQ3 B;  1Y56 A;  3N9Y C;  2MBE A;  1FRR A;  4EE2 A;  5AZG A;  2Z0D B;  4A9A A;  4IWO A;  2GBM A;  3L08 A;  1T0Y A;  2YLM A;  1GPX A;  4KSL C;  5E6N A;  3BZD B;  1VZ7 A;  1L6U A;  4CYE A;  1KTK A;  4M02 A;  5C23 A;  2D3A A;  2LMC A;  2ON8 A;  1WZ3 A;  1WGD A;  2M1M A;  4A3P A;  2Y5C A;  1OQR A;  1TY0 A;  4P1C C;  2ZW0 A;  3DWM A;  3DVG Y;  2CU1 A;  3AE2 B;  2JT4 B;  3V6C B;  3HRD D;  2KVR A;  1RLF A;  2H88 B;  2RDG A;  5I4D A;  1GB1 A;  3Q2A C;  4JPS A;  1T0Q C;  1ZGU B;  2K1F A;  4NAW A;  4LTU A;  4HPM B;  1IGD A;  4K3C A;  1S1Q B;  2ZEQ A;  1TTN A;  4HKZ E;  3ZRF A;  1WJ4 A;  2WXK A;  1JML A;  2W54 A;  3Q3M C;  2E6X A;  3VHT C;  1YOV B;  1Q5W B;  1WR1 A;  4A55 A;  3N1X C;  3B0A A;  4WJP A;  1D5X C;  1L0Y B;  3FKY A;  2L32 A;  3VAW A;  2FCM A;  1LO5 D;  1J7A A;  2WNM A;  4ASW C;  2PJH A;  4WQO B;  1WRD B;  2KJH B;  4HJK A;  3SR6 A;  2NPT A;  5HI1 A;  2CJN A;  2MP2 B;  1N61 A;  1Z2M A;  3DVN U;  2HTH A;  3PT2 B;  2J0K A;  2V4I B;  4GXB A;  3QX1 A;  2J0M A;  1QOA A;  4HKQ A; 
#chains in the Genus database with same CATH homology
 1WX7 A;  4LCD E;  3MHS D;  2KTR A;  4MM3 A;  3SU8 X;  4G50 A;  1U4A A;  2D10 A;  3H7P B;  3IBE A;  4M8N A;  4ZRJ A;  3ZRC A;  2NBU A;  2R2O A;  5AEK B;  1GC7 A;  2WDT B;  2UYZ B;  3NHE B;  4RMA A;  2JY6 A;  3ZNZ B;  3B08 A;  2Y5B B;  2RD0 A;  3DVN V;  4BBN F;  3PHX B;  4MGK E;  5J18 A;  3ZNH B;  3SDL C;  3ZVV A;  2KDF B;  4E71 A;  4BKT A;  2O6V A;  3LJ3 A;  3BIN A;  1LXD A;  1A5R A;  3R3M A;  4FJY A;  4LJP B;  3X23 A;  3HM3 A;  1AAR A;  2KXJ A;  3CST A;  2KKC A;  1XQQ A;  4HXD A;  3T9L A;  2N1V A;  1WJ6 A;  2PEA A;  1YX5 B;  2AWT A;  1R4M I;  4P7I A;  4W9K A;  5IA7 A;  4OVU A;  1V9J A;  2M17 A;  3QCA A;  4B95 A;  1WIA A;  4NJ7 A;  4BKS D;  1JRU A;  5C1Z A;  4KVG B;  2KFK B;  2N4F A;  2KMA A;  3VH3 B;  3V61 A;  2KOX A;  4EOY A;  2ZVN A;  2FCQ A;  3A4S C;  5D94 A;  3ZKJ C;  4EKU A;  4I6P A;  4J6I A;  2HD5 B;  4W9H A;  2C7M B;  2JZ3 B;  2PPH A;  4YL8 A;  5LXI B;  4EZK A;  3ML8 A;  2ZJD A;  3OJ4 B;  3KVF B;  1P98 A;  2LUE A;  3KYD D;  2L8J A;  3H9D A;  1C3T A;  4HLE A;  1P3Q U;  2DX5 B;  3VH4 B;  2KC1 A;  4WJN A;  4EFO A;  4GDL A;  4IUM B;  1G6J A;  1WX9 A;  3DBS A;  1E8X A;  3AUL A;  3PSE B;  1K8R B;  4ANW A;  3QWZ B;  2LVQ A;  3OAW A;  3PS6 A;  3QA8 A;  1WGR A;  1SIF A;  4XX5 A;  1WX8 A;  1IYF A;  1V80 A;  3KH0 A;  3WAM A;  4DHZ E;  2AL6 A;  3S2A A;  3IHP C;  1VCB A;  3EEC A;  5DCN A;  3U30 A;  1P1A A;  1YIW A;  2MBB B;  4URK A;  4MEL A;  2G45 B;  3DVG X;  1TBE A;  3ZLZ A;  3TJP A;  2N1W A;  3L10 B;  2A5U A;  5AZH A;  2ZPN A;  3R66 C;  2YVC A;  2DAF A;  3MTN B;  2QHO A;  4G3X B;  3A9J B;  2PE9 A;  3AXC A;  3L13 A;  3A1Q A;  4CHK A;  4JQW C;  2BKR B;  2OOB B;  4ZRI A;  2XEW A;  2KTR B;  2D11 A;  3ZO5 B;  4A3O A;  2BKF A;  4HVB A;  2KLC A;  2G3Q B;  4W9I A;  2LZ6 A;  2GBR A;  1QZE A;  4DWF A;  2V3S A;  3QHT A;  3RUI B;  4I6N B;  4EUT A;  1ZKH A;  5JH5 C;  2KWC A;  3ML9 A;  1WJN A;  1OGW A;  3PLV A;  3JW0 X;  2IO2 B;  4OVV A;  5L95 C;  2KDI A;  4W9E A;  3R7Q A;  2N7E A;  2J7Q B;  1GC6 A;  4B6W A;  2MRP A;  1NBF C;  1TGZ B;  4CO7 A;  2IY1 B;  3ONS A;  1WXS A;  3M3J A;  3D32 A;  3RCZ A;  4KDI C;  4NQL B;  3DOW A;  2JVC A;  4RM9 A;  3RZF A;  2I1K A;  4II2 B;  4KDL B;  4W9G A;  1YQB A;  1E7U A;  3PZD A;  4KZC A;  5LXH A;  5D2M B;  4ZDV A;  5DPT A;  1V5O A;  1R4N I;  1GUA B;  3RYT A;  2JRH A;  4WJQ A;  2RPQ A;  3M95 A;  3DCG A;  4IM3 A;  3ZTD A;  1LFD A;  2CHW A;  2KJR A;  2M4N A;  5AZF A;  2CR5 A;  2KWU B;  2O2V B;  1WI0 A;  1ZW7 A;  3DDC B;  4PS3 A;  2GMI C;  4GSW A;  2D2Q A;  3P2B A;  4K81 A;  2KHW B;  2BWF A;  2ZCC A;  2ZVO A;  2MBQ A;  3X0W A;  5L83 A;  2UWQ A;  3SHQ A;  4WWP A;  2BYF A;  3RZW C;  1SE9 A;  4N9F 4;  4GN1 A;  3TL5 A;  2W9N A;  3AU5 A;  2LRW A;  2NBW B;  4JIO U;  5DPR A;  4W9J A;  5CHV C;  4BVU C;  4LJO B;  1NI2 A;  2O6V B;  1WR6 E;  4IM2 A;  2XK5 B;  5EDS A;  3OLM D;  4EZL A;  1WJU A;  1OTR B;  2DYO A;  4DHZ B;  3PV1 A;  4KIK A;  4MEM A;  3UF8 A;  3WA0 A;  4AWJ A;  1J19 A;  3M62 B;  2KJ6 A;  1HE8 A;  3WAL A;  3W1Y A;  1WF9 A;  1YX6 B;  2CS4 A;  1WM3 A;  2DZK A;  2FCN A;  2PE6 B;  3H1U A;  2KO3 A;  3IG3 A;  4FJZ A;  2K25 A;  3CSF A;  4HK2 A;  2JPH A;  2RSU A;  1CMX B;  3O65 B;  3VQI A;  1Z5S B;  1I35 A;  1EO6 A;  2N9P C;  1WXA A;  4TQ1 A;  2C60 A;  3VTU A;  4TKN A;  3EHV A;  4GMV A;  2XBB C;  1OQY A;  3TMP B;  4HPL B;  4KV2 A;  1NDD A;  3AI5 A;  2KTF A;  2C7N B;  2JXX A;  1E8Z A;  3NY5 A;  5GMV A;  3V62 A;  2IO3 B;  3K9P B;  3PPA A;  5KHO A;  4BOS C;  4E74 A;  1L2N A;  2CHZ A;  2D07 B;  2O6V D;  2JRI B;  3A4R A;  1UGM A;  2REX A;  5HKH A;  2FCS A;  3JYU A;  1UEL A;  4MGY E;  1V81 A;  5J2R A;  4G0N B;  1P0R A;  1XD3 B;  2BWE S;  2FNJ B;  3DQV A;  3A9K A;  3L0W B;  2MCN B;  4IW0 A;  2KNB A;  2OJR A;  3APC A;  2DZJ A;  2L0F A;  5FR6 A;  2NBV B;  2MA9 B;  2N7D A;  2IO1 B;  2L0T A;  2XK5 A;  3ZNG C;  3Q3F A;  4IWQ A;  2MW5 A;  5JZE B;  1KM7 A;  4IM0 A;  3APD A;  2M8S A;  5D6J B;  1I42 A;  2AEH A;  2CHX A;  3VFK A;  2KQ7 A;  3TBL D;  3VTW A;  4KZ0 A;  2K8C A;  3QAR A;  3ZW3 A;  4F8C B;  2LGX A;  2FAZ A;  2EMT A;  3VXW A;  1MG8 A;  2M0X A;  1H4R A;  4DDI D;  4LDT B;  3QQ8 B;  4PS8 A;  3WIM A;  1UBQ A;  3NZS A;  2GBN A;  2FID A;  2KFK A;  4WWN A;  4TV3 A;  3H7S A;  3PGE A;  4FJV B;  2G4D B;  3HIZ A;  4I6L B;  5G2N A;  3VVW B;  3ZDT A;  3PVL A;  3NZU A;  1IP9 A;  4BKG A;  3PRP B;  2ZZP B;  1EUV B;  1WE6 A;  4FHK A;  2DAJ A;  4MJS A;  3CF6 E;  1V5T A;  2LJ5 A;  4NQK E;  3ZTC A;  1XT9 B;  3L17 A;  4K7U A;  3PLU A;  4B9K A;  2IY0 B;  1EF1 A;  1WY8 A;  3U8Z A;  4XZ4 A;  2KFJ A;  2KLG A;  3ENE A;  4GIV A;  4GDL B;  2NPT B;  2WYQ A;  4AOF A;  3WAP A;  4F7Z A;  3QC8 B;  2BGF A;  2WX0 A;  4GDK B;  3WAN A;  4MH0 E;  2K8B A;  3N30 A;  1WXV A;  2MSE D;  4PYU A;  4EZJ A;  2J0J A;  4E3C A;  3HHM A;  2LGD A;  2JF5 A;  2HJ8 A;  2KN5 A;  5JHB A;  3BY4 B;  4LDT D;  2AL3 A;  4MSQ B;  4KSK C;  2C7H A;  4FAD A;  4M0W B;  1LM8 B;  2JWZ A;  2LXC A;  3DBH I;  3IVF A;  2IO0 B;  3DPD A;  4NJ6 A;  1EF5 A;  2NR2 A;  2V4L A;  3K9O B;  4ZYN A;  2Z59 B;  4A20 A;  3ZIM A;  1Q1O A;  2LAS A;  2ZCB A;  4MGZ E;  4GOC A;  3EC8 A;  4K7S A;  4RM8 A;  4W9C A;  4HCP B;  3A9J A;  3APF A;  1TZ1 A;  1WXM A;  1WGH A;  2C5L C;  3RUL A;  2IYD B;  4BFR A;  1E90 A;  3DBL I;  4DHJ D;  4MSM B;  3W1S C;  1SGH A;  4HCN B;  2MBO A;  2MLB A;  1WGG A;  1Y8R C;  1UBI A;  1WMH B;  2I1J A;  2KQS A;  4NPN A;  3PTF C;  2K8H A;  3RD2 A;  4F1S A;  3CMM B;  5IAA C;  2BYV E;  2L3Z A;  4GGQ A;  4NAW B;  2KZR A;  4KIK B;  1J8C A;  3M63 B;  3V6E B;  1WM2 A;  3JVZ X;  4IG7 B;  2NVU I;  5JHA A;  1E7V A;  3VTV A;  2DYB A;  2WWZ A;  2KAN A;  3MJW A;  4NY0 A;  4DK5 A;  2MWS B;  1OEY A;  3DBR I;  4X57 B;  3L54 A;  4ANU A;  4NNJ B;  4JL9 A;  2BF8 B;  3KUD B;  3ZUN A;  1YJ1 A;  3H6N A;  1OEY J;  4AP4 C;  2AYO B;  4XC2 A;  1UZX B;  5CX3 A;  5J17 A;  2K39 A;  5CHW A;  5G55 A;  3VUX A;  4II3 B;  1E5W A;  2VRR B;  3JSV A;  1KLV A;  1LQB A;  4TQ0 A;  2IZV B;  4HDO A;  2BPS A;  2LD9 A;  5E6P A;  5LLI A;  1L7Y A;  2LVP A;  2L00 B;  3UQA A;  3I3T B;  1D3Z A;  1GJZ A;  3QK0 A;  3B1L X;  4ZRK A;  2KDE B;  3A33 B;  4W9L A;  3Q3J A;  3IFW B;  2FIF A;  2KK8 A;  3LDZ E;  4GU2 A;  4G11 A;  3A9K B;  2O2V A;  4WWO A;  2JUO A;  3HK0 A;  3QIJ A;  2EKE C;  2B3A A;  2GOW A;  2N9X A;  1KJT A;  4FLH A;  2ZNV C;  3H7P A;  2MQJ A;  3PRZ A;  5KHQ A;  1RFA A;  3UIP B;  4MDK E;  4HDQ A;  1VD2 A;  1PQS A;  3HM6 X;  2MBE A;  1X1M A;  5AZG A;  2Z0D B;  2BYE A;  4K1R B;  2DEN B;  5BO4 B;  3KW5 B;  3PRM B;  3UIN B;  4IWO A;  2GBM A;  3L08 A;  1T0Y A;  3U7D A;  2YLM A;  2LWP A;  1UD7 A;  4EEW A;  4KSL C;  5E6N A;  1S3S G;  1UH6 A;  3RT3 B;  4CYE A;  3ALB A;  2HE7 A;  2L05 A;  4BBN C;  3UQB A;  4DDG D;  4HWI B;  4AUQ C;  4ANV A;  2DHZ A;  1WYW B;  4MGI E;  5C23 A;  4FA6 A;  5CHF A;  1C1Y B;  2KX0 A;  3PHW B;  5CTR C;  5D7G A;  1WZ3 A;  1WGD A;  3GZN I;  2C9W B;  2M1M A;  3N32 A;  4GB9 A;  4A3P A;  4DBG A;  2LVO A;  1V6E A;  3NS8 A;  2K6D B;  4ICU A;  2CKH B;  2NCN A;  4FUL A;  1WZ0 A;  4FBJ B;  2L7R A;  3DVG Y;  2LXA A;  2CU1 A;  2JT4 B;  4MJS B;  1E8W A;  2EMS A;  3WAO A;  3QJZ A;  3V6C B;  4TUU A;  4BKS A;  1V49 A;  2JZZ A;  2GBJ A;  2KVR A;  2ZNV B;  1Q0W B;  2GBK A;  4AJY B;  3W1S A;  3UGB B;  2LRU A;  3PRE A;  4BOZ B;  1WFY A;  3ZNI D;  1RLF A;  2LI5 A;  5E6O A;  1V2Y A;  1RAX A;  4IWP A;  3ECI A;  4W9F A;  1IPG A;  1ZGU B;  2K1F A;  3QAQ A;  4GDK A;  4PS7 A;  4NAW A;  3KUZ A;  1KOT A;  4HPM B;  2ZPY A;  4JGH B;  1M94 A;  4K7W A;  3ZDM C;  1S1Q B;  2DZI A;  2ZEQ A;  1TTN A;  3L16 A;  3NOB A;  2MP2 A;  2KMC A;  1YD8 U;  1WJ4 A;  3ZRF A;  2KWV B;  1FXT B;  3UIO B;  1WGY A;  2LGY A;  1V86 A;  2DYM A;  3SD5 A;  1WH3 A;  5DPW A;  4AJW A;  2NS5 A;  3VHT C;  1J0G A;  3VUW A;  2KDB A;  1Q5W B;  3JSV B;  4M8M A;  5DPS A;  1E8Y A;  1ISN A;  1WR1 A;  2KC2 A;  2N9E B;  3N3K B;  3B0A A;  4WJP A;  1H8C A;  3TIX A;  2WX1 A;  4FHJ A;  4ICV A;  3VAW A;  4W9D A;  3V60 A;  2ASQ A;  1BT0 A;  2FCM A;  4IC7 B;  4JLC A;  4DXA B;  1GG3 A;  2V1Y A;  3C0R B;  4WAA A;  1WMH A;  4ASW C;  4DHJ B;  5TR5 A;  2PJH A;  4ANX A;  3GOE A;  4WQO B;  2IBI B;  3OJ3 A;  1WRD B;  3KYC D;  1GNU A;  2KJH B;  2RGF A;  4HJK A;  2NPT A;  2FUH B;  1F9J A;  4PYZ A;  2RR9 A;  3VDZ A;  2MP2 B;  2R2Q A;  1Z2M A;  2DZM A;  3DVN U;  2KX3 A;  2HTH A;  2KD0 A;  4WJO A;  2J0K A;  2MX2 A;  1P9D U;  2MBH A;  3AU4 A;  3PT2 B;  1WE7 A;  2D3G A;  4GXB A;  2G4S A;  3T8M A;  2A4Z A;  2Z0E B;  3EFU A;  3QX1 A;  2K6Q A;  3KUC B;  3TCA A;  3VUY A;  2J0M A;  1RRB A;  3R7R A;  4FN2 A;  2L76 A;  3A1Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...