4FJVB

Crystal structure of human otubain2 and ubiquitin complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
DVPDYAHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin thioesterase OTUB2
publication title The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4fjvB00
2IO2B 1OEYA 3QA8A 2L7RA 4ZRKA 2DYOA 2K25A 4ZYNA 3ML8A 3ZLZA 4I6LB 2L0TA 2N7DA 4PS3A 4EKUA 2MX2A 3IHPC 4HDOA 1E5WA 1UH6A 2KDBA 2NPTB 5TR5A 1WGDA 2L3ZA 2REXA 2WYQA 1I42A 4GDKA 5G55A 4ZDVA 4WJNA 2ZPYA 3KYCD 3JSVB 4GDLA 3A33B 1WX7A 1V9JA 2RR9A 2BPSA 3DVNV 3T8MA 2D3GA 2J0KA 3ZDMC 2WWZA 2KOXA 4IUMB 4DBGA 1V5OA 2ZEQA 2KC2A 3AU4A 5DCNA 2NS5A 2FCNA 2UYZB 1J0GA 1JRUA 2LVPA 2WDTB 1YX6B 3I3TB 3KUZA 3W1SA 1E8WA 3ECIA 3H6NA 1WY8A 3P2BA 1V86A 4A20A 3VUWA 4BKSD 4MM3A 1NBFC 4BOZB 3OLMD 3QCAA 3SU8X 4IWPA 3B08A 2J7QB 2HTHA 3ZTDA 2FAZA 3H9DA 4EZKA 3VTVA 1Z2MA 3ZNID 2L76A 2KWCA 4DK5A 4DDGD 4CYEA 3NY5A 5LXHA 4JIOU 4K7UA 2QHOA 2KTRB 3M63B 2AL3A 2ASQA 2GOWA 3DDCB 1BT0A 4F8CB 3LJ3A 5C23A 2ZVNA 2IO1B 3DBHI 4FHKA 2ZZPB 4W9HA 3MHSD 2MCNB 2NR2A 4EEWA 1R4MI 3UINB 4CHKA 4NAWA 4JLCA 3PVLA 4W9CA 4YL8A 2GBMA 2NCNA 2LD9A 3V60A 3EHVA 1GUAB 2DYBA 3TIXA 4FLHA 3L08A 4NQLB 3A9KB 1E8ZA 1F9JA 3PHWB 3L0WB 2L0FA 3WANA 2XK5A 4KSLC 1WRDB 2N1VA 4IM2A 3OJ4B 4JQWC 1XD3B 1IP9A 2FIFA 1RLFA 4PS7A 4B9KA 1T0YA 2C5LC 2JY6A 2KJ6A 2NBVB 4HLEA 4LDTD 4DHJB 2I1KA 1IPGA 3QHTA 4NAWB 2O6VD 3RZWC 2BWFA 2LXCA 2KFKA 3IVFA 3DVNU 5DPWA 1E90A 4XX5A 3JW0X 4W9LA 3TBLD 4FJVB 3CSFA 1UD7A 1TZ1A 1NDDA 4FN2A 4HWIB 1S3SG 4KDIC 4MSQB 1WGHA 2DYMA 4NJ6A 4WWPA 4MGYE 4AUQC 4CO7A 3UQAA 5C1ZA 1Q5WB 2JF5A 4AJWA 1LM8B 2M17A 4GIVA 1EF1A 1VD2A 2PEAA 3APDA 1WGRA 3C0RB 4G50A 4ANUA 2FIDA 3PRPB 2ZPNA 2C7MB 2EKEC 3BINA 4HVBA 3PV1A 3QARA 4ZRJA 3KH0A 1WE6A 3R7RA 1E8YA 2KTFA 3PREA 4KIKB 2DHZA 4B95A 3NS8A 1OGWA 3VDZA 4IC7B 5D94A 1S1QB 1WXVA 3A9JB 3TMPB 2IY1B 1OQYA 2C9WB 4MDKE 3QIJA 1P98A 5E6OA 4W9DA 5E6NA 4ZRIA 3T9LA 2LRWA 1LXDA 4KDLB 2RPQA 1RRBA 2CS4A 4WWNA 1WJNA 3R7QA 3DVGY 1M94A 2DZJA 3VAWA 1KOTA 1MG8A 3DCGA 1WJ4A 5DPRA 1E7UA 2LZ6A 2WX1A 2ZCCA 2K39A 2JRIB 2LGXA 2N7EA 4LDTB 3PTFC 3N3KB 3ZNZB 4G3XB 4IM0A 3HHMA 4EOYA 1WR6E 2O6VB 3CF6E 3A4SC 2MBBB 3AULA 3AXCA 2V1YA 4HJKA 4N9F4 4I6PA 2JUOA 3HIZA 2LGYA 2DENB 3L54A 3RUIB 4DDID 1PQSA 4W9EA 4HPMB 2LUEA 3HM6X 3N30A 2ZNVB 5LLIA 5EDSA 1H8CA 1R4NI 2MA9B 4MELA 5AZGA 2KQSA 2KANA 3NOBA 4TV3A 2XBBC 1G6JA 4WJQA 4AP4C 3QJZA 4E74A 1V81A 2KDIA 4MGKE 3PRZA 3CMMB 3WIMA 4DHJD 4KSKC 4LCDE 2K6QA 3OAWA 3U8ZA 2KN5A 2G3QB 1WM3A 2PE9A 2PJHA 3ZTCA 1WFYA 3K9PB 5CX3A 4A3OA 2D11A 2KMAA 4GDKB 4ANXA 1WYWB 4E3CA 2AYOB 3QAQA 4GDLB 3RD2A 1YJ1A 3UIOB 3ZIMA 1WMHA 4PYZA 2IY0B 2KLGA 4M8NA 1WXSA 3M95A 4J6IA 5D6JB 2IYDB 5AZFA 2BF8B 3Q3JA 3V6EB 1KJTA 4EFOA 3MJWA 4PS8A 3OJ3A 2CHXA 3JYUA 5L83A 1OTRB 2JZZA 2CU1A 2YLMA 2PE6B 5LXIB 1D3ZA 1EUVB 3AI5A 1FXTB 1UZXB 2KJRA 5CHWA 1LFDA 5J18A 5D2MB 2BKFA 2LVQA 3JVZX 2GBNA 3K9OB 3PZDA 4FHJA 4MGIE 3B1LX 2FCSA 2MW5A 1UGMA 1ZW7A 3R3MA 2K1FA 2A5UA 2N9EB 3DBRI 3PS6A 4W9FA 2K8BA 2LWPA 5JHAA 3X0WA 3MTNB 3ZNGC 2GMIC 2KWUB 3UF8A 2M0XA 2DZIA 3V6CB 4KVGB 2LJ5A 4WWOA 1WGYA 1GJZA 4BKTA 3DQVA 2V4LA 2LVOA 4XZ4A 1KM7A 3H1UA 2G45B 1Q1OA 4EZJA 4BVUC 2MSED 4WJPA 5HKHA 1L7YA 2J0JA 1OEYJ 2KVRA 1WH3A 2AWTA 2KDEB 2KDFB 4I6NB 2C7NB 4BKSA 3W1SC 4EZLA 2GBKA 1WM2A 4MJSA 2K6DB 1EF5A 2XK5B 4K7SA 4IM3A 4AWJA 2IBIB 3L13A 3U30A 3VUXA 2W9NA 1WF9A 3ML9A 4W9JA 3RT3B 3L16A 2KX0A 3N32A 4KV2A 2NVUI 1WR1A 3PPAA 1CMXB 3KW5B 1V5TA 4FJYA 2JVCA 4RMAA 3SDLC 2MBHA 4OVVA 2Z59B 2KFKB 3ONSA 3IBEA 1WJUA 4W9GA 2D10A 4MH0E 3ZO5B 4GGQA 2MWSB 3HK0A 4NNJB 5IAAC 2NBUA 2G4SA 3Q3FA 3VH3B 3RCZA 2MP2A 2WX0A 3KYDD 2IO0B 4K7WA 2FNJB 2DAFA 2ZVOA 4GSWA 4IG7B 5J2RA 2LGDA 4EUTA 3RYTA 1GC7A 1WX8A 2XEWA 3VUYA 5IA7A 3UQBA 2K8HA 1A5RA 2JWZA 1GC6A 2MQJA 3PRMB 2DZMA 4MSMB 5CHVC 3B0AA 5JH5C 3M3JA 4JL9A 2AL6A 3D32A 1V49A 2G4DB 4KZCA 1Q0WB 3ZVVA 4HPLB 2KQ7A 2BGFA 2RD0A 4NJ7A 5DPSA 3WAPA 1AARA 2MBEA 4IWQA 5FR6A 2MP2B 3EFUA 4OVUA 3TCAA 4A3PA 2EMTA 3QX1A 4HXDA 3DOWA 3IG3A 4GMVA 2C7HA 4BKGA 4FA6A 1GG3A 3VVWB 5AZHA 3JSVA 5JZEB 3VTWA 1V6EA 3DVGX 4W9KA 1WXMA 2IO3B 1U4AA 2BYVE 2LI5A 1XT9B 2L05A 1GNUA 3A1QA 1SGHA 2R2OA 2Y5BB 4LJPB 3LDZE 4IWOA 2JZ3B 2M4NA 5KHQA 3APFA 4K81A 2KO3A 5KHOA 4P7IA 2KLCA 2LRUA 1UBQA 4GB9A 4MGZE 4NY0A 5G2NA 2JT4B 4GN1A 2FCQA 4HK2A 4KZ0A 2CR5A 4W9IA 2OJRA 3ZW3A 3UIPB 3KUDB 4NPNA 4RM8A 4WJOA 2KC1A 4TUUA 2FUHB 2O2VA 4GXBA 2YVCA 1QZEA 2KWVB 3L10B 2K8CA 2N9PC 2N9XA 3ENEA 2M1MA 3O65B 2Z0DB 2B3AA 1P0RA 1WGGA 3V61A 4WQOB 1Y8RC 3A1QB 5D7GA 2JRHA 1J19A 3QC8B 3V62A 5E6PA 3U7DA 3VTUA 1LQBA 1YIWA 1WE7A 2Z0EB 1TBEA 3ZNHB 4NQKE 2KTRA 3DPDA 1V2YA 2OOBB 1K8RB 3L17A 1WZ3A 2ZNVC 5AEKB 4B6WA 1I35A 2CKHB 1TGZB 3PGEA 3VXWA 3WAOA 4ICUA 4TQ0A 4F1SA 2O2VB 4GU2A 2AEHA 3WA0A 2DX5B 3RZFA 2MBOA 1SE9A 3ZDTA 4BBNF 3ZUNA 4RM9A 2J0MA 2KNBA 4JGHB 1WMHB 4II2B 3X23A 4II3B 5CHFA 1RFAA 4ANWA 2NBWB 3SHQA 3SD5A 1H4RA 3A9KA 2VRRB 1TTNA 2KMCA 3GOEA 3VH4B 2EMSA 2JXXA 3APCA 4IW0A 1P3QU 4X57B 3NZSA 3PHXB 4M8MA 4AOFA 4MEMA 4WAAA 2I1JA 1Z5SB 2N1WA 3EECA 2MRPA 1ZKHA 2D07B 3DBLI 1VCBA 3H7PA 4ICVA 4DXAB 4AJYB 2A4ZA 3IFWB 1UBIA 1IYFA 3NHEB 3W1YA 1YQBA 2LASA 3AU5A 4G11A 2LXAA 1WX9A 3KUCB 3KVFB 3WALA 4ANVA 2BKRB 2DAJA 3CSTA 2KXJA 2FCMA 2ZJDA 2MLBA 2UWQA 4HCNB 1E7VA 2D2QA 3RULA 3S2AA 4FBJB 4BOSC 3GZNI 4BBNC 2KX3A 2KFJA 3H7PB 5DPTA 2KJHB 2L8JA 3BY4B 4BFRA 1RAXA 3QWZB 3ZKJC 1ISNA 4DWFA 4XC2A 2R2QA 3A4RA 3ZRCA 4HDQA 4KIKA 2ZCBA 3NZUA 3WAMA 1WI0A 1YX5B 4K1RB 2MBQA 4TKNA 3A9JA 3TL5A 2KHWB 1X1MA 2RSUA 5GMVA 3TJPA 2CHZA 4MJSB 2CHWA 4ASWC 1WJ6A 1ZGUB 4DHZB 1P1AA 2L00B 1C3TA 5JHBA 4HCPB 2PPHA 4M0WB 2C60A 2N4FA 3R66C 3M62B 5BO4B 4FULA 2BWES 1EO6A 1XQQA 4G0NB 2DZKA 3VFKA 3H7SA 5J17A 4FJZA 2KZRA 1P9DU 4FADA 4URKA 3PSEB 3PT2B 2BYFA 1J8CA 2GBRA 1C1YB 3ZRFA 2M8SA 4E71A 1NI2A 1UELA 3HM3A 2GBJA 2V3SA 3PLUA 1SIFA 1WZ0A 3UGBB 1WXAA 5L95C 1YD8U 4PYUA 2KK8A 4TQ1A 2BYEA 2RGFA 2KD0A 2O6VA 1L2NA 1KLVA 2NPTA 2HD5B 1WIAA 3VQIA 2HE7A 2HJ8A 2KKCA 3EC8A 3PLVA 4LJOB 2IZVB 4DHZE 1HE8A 4GOCA 3QK0A 1V80A 5CTRC 3DBSA 3ALBA 4F7ZA 1E8XA 2JPHA 3QQ8B 3VHTC
chains in the Genus database with same CATH superfamily
3QA8A 1D5ZC 2WXMA 3ML8A 3PZ7A 1L6UA 2N7DA 1OFFA 4PS3A 2MX2A 5TR5A 2L3ZA 2PMVA 4XDDA 2REXA 1GPXA 1JW9D 4GDKA 5G55A 2ZPYA 3SEBA 2MJDA 1V9JA 1VZ7A 2OHFA 2D3GA 2J0KA 2WWZA 5BMIA 3AU4A 1QOGA 3PZ8A 4JWSC 1J0GA 2QC8A 3AE5B 4WURA 3KUZA 4YT0B 4JE3B 1WY8A 2V9HA 1V86A 3P2BA 4A20A 4BKSD 3AE4B 4MM3A 4C00A 1SJED 4IWPA 3B08A 3ZQ4A 2FAZA 2L76A 2KWCA 4DK5A 3NY5A 4C56C 1UF0A 1L6VA 4JIOU 2TSSA 3M63B 2GOWA 1FPYA 3IAM1 1V1OA 5IKCM 4FHKA 1FEHA 4EEWA 3W2DA 4YL8A 1LGRA 3EHVA 1GUAB 3LB8C 1F9JA 3VR9B 3PHWB 1UWXA 1XD3B 1RLFA 2JY6A 2KJ6A 3V05A 3RZWC 2LXCA 2KFKA 1YMHE 1E90A 3JW0X 4W9LA 3TBLD 1B9RA 4KDIC 1TZ1A 1JWMD 2VZKB 1S3SG 4FN2A 4MSQB 2DYMA 4AUQC 4MGYE 4H2AA 1LM8B 4D2KA 2INNE 1LO5D 1EU3A 4GIVA 2RPVA 4G50A 2ZPNA 3R7RA 3QARA 2KTFA 1I4GA 4KIKB 4B95A 3P4PB 1QF6A 2CJOA 1OQYA 3SFDB 5E6OA 1TKEA 2HJ1A 4ZRIA 2WXOA 2MJEA 4WH4A 2RPQA 3DVGY 1MG8A 2IPKD 1ZDVA 1TY0A 1V8CA 3PTFC 1TJEA 2SEBD 4G3XB 2O6VB 4Q2JA 3AULA 4WAFA 2WXGA 3HIZA 3L54A 3R8BA 3N30A 1YNTE 5AZGA 1G6JA 2XBBC 1V81A 4KSKC 3IXSA 1PUTA 3K9PB 2J53A 3AEEB 2KMAA 2QEJC 1WYWB 4E3CA 4GDLB 4QAYA 3UIOB 1PGXA 1WMHA 4PYZA 3BVMA 5AZFA 1MVKA 4EFOA 3MJWA 4CQNA 3OJ3A 4XE0A 5G5GA 3JYUA 5L83A 4ZRPA 1DOYA 2PE6B 1D3ZA 1ZOYB 2ACZB 1ZP0B 3ETRA 2W55A 1LFDA 5D2MB 3K9OB 4FHJA 2FCSA 1ZW7A 3R3MA 3PS6A 2A5UA 3V6CB 1MHHE 2M0XA 2JYEA 1YN5A 1KH0A 1TZOA 4NZLB 3NG0A 3W5UB 1SJHD 4RGMA 1EWCA 2ON8A 1L7YA 2KVRA 3TEYA 5HHDG 1FIQA 2KDEB 2KDFB 1L4DB 4I6NB 1C4CA 2LGSA 3W1SC 4EZLA 2GBKA 3AN1A 2K6DB 4AWJA 3L13A 2PKOA 3ML9A 4M0WA 3Q6BA 1N5WA 4P1BC 4ITKA 1T0QC 2XNAC 1CMXB 4FJYA 4A55A 1K53A 2QCZA 2W82A 4GGQA 5GXGB 3HVZA 3RCZA 1N6ZA 1T6BX 2LGDA 2M56B 4EUTA 2JU6X 2XEWA 5IA7A 2BTEA 1A5RA 3PRMB 5H92C 5CHVC 3M3JA 4KZCA 3ZVVA 1K50A 2RD0A 4IWQA 5HFYA 2MP2B 3EFUA 4OVUA 2EMTA 2LJIA 3AEAB 4HXDA 3IG3A 4FA6A 5BYRA 4US8A 3U52E 3ZXRA 1C4AA 3JSVA 5JZEB 4W9KA 2L83A 3DBRB 2Y5BB 1XO3A 2Y5PA 2JZ3B 2M4NA 3APFA 1I4QA 2KO3A 5KHOA 3R2TA 2FCQA 4KZ0A 2CR5A 2OJRA 3UIPB 4NPNA 4WJOA 4RF0A 4TUUA 2FUHB 2O2VA 1QOFA 1QZEA 3L10B 3Q8AA 1P0RA 3V61A 5D7GA 2JRHA 1HTQA 1J19A 3U7ZA 3MC8A 3ZYYX 1TBEA 3ZNHB 4JX1C 2WP9B 3AECB 2KAJA 1I35A 4TQ0A 3PGEA 3WAOA 3ZJUA 1TYGB 3WA0A 1QKZA 1SE9A 1AWDA 1QOAA 2KN4A 4C7ZA 3TEXA 3X23A 4II3B 5CHFA 1RFAA 2NBWB 1H4RA 3C19A 2PTLA 4LNFA 4X57B 1P3QU 2EKIA 2FUG1 2Q5WD 1YN4A 1XLPA 3PHXB 3MHZA 4WAAA 2A4ZA 1L0YB 3HVDA 3AE8B 3NHEB 2LASA 3L4PA 3BK2A 4ANVA 2BKRB 2DAJA 3CSTA 2KXJA 1V97A 4HCNB 4FBJB 3GZNI 2WHIA 5C2TB 1N63A 3ZKJC 4XC2A 4YWGG 4YSXB 3NZUA 3WAMA 1WI0A 3HUIA 4ASWC 1WJ6A 1ZGUB 5BYSA 1C3TA 1D6EC 2WQYB 3AV8A 2PPHA 3SR6A 3M62B 5BO4B 3P42A 3NVZA 1N5XA 3RN9C 4WWMA 1P9DU 3PSEB 1JQ4A 1C1YB 2H89B 4E71A 1NI2A 2BW2A 2V3SA 3PLUA 2WXQA 1CQVA 1WZ0A 1WXAA 1JWUD 4TQ1A 3EUB2 1TKGA 2MJ3A 4UDUC 2NPTA 2HD5B 2HE7A 3PLVA 4LJOB 1JALA 5CTRC 1E8XA 3VHTC 1T0SC 5LNK1 3P4SB 2L0TA 1ZXIA 1UH6A 1WGDA 2WYQA 4LTUA 4EE2A 4C4VB 3DBLB 3KYCD 3CWIA 2KQ4X 3A33B 1WX7A 4LK0M 2RR9A 3T8MA 4A9AA 3ZDMC 1FNWA 1DOIA 4YTPB 1WXQA 2WDTB 1YX6B 3NZ3A 3AEBB 4GLSC 2BBCA 3DWMA 2OJWA 5IP4D 2J7QB 2MEKA 4DDGD 3Q14C 3I5JC 4K7UA 4F8CB 3N1ZC 5JXVA 2J42A 2ZZPB 4MM3B 2V4IB 2NR2A 3NUHB 5HG2A 4CHKA 4NAWA 4JLCA 5IN7A 2GBMA 2NCNA 2LD9A 3N1XC 4FLHA 3A9KB 1E8ZA 2XK5A 4KSLC 4IM2A 4JQWC 1T0YA 2C5LC 4HLEA 4NJCA 3AB5A 2O6VD 1MHXA 2LMCA 3IVFA 3NVVA 3Q8BA 4XX5A 2HDEA 4TSSA 1UD7A 1NDDA 4NJ6A 1TS5A 1Q5WB 4AJWA 1QILA 1JWBD 3GE8C 1EF1A 2L32A 3APDA 1WGRA 1E6EB 1L5PA 1E8YA 2W3RA 5E6JA 4RGNA 1S1QB 3TMPB 3TSSA 1IBXA 5BYQA 2BS3B 3QIJA 2WU2B 1KLGD 1RYJA 3R2IA 4IOIE 1LXDA 4KDLB 1RRBA 1WJNA 1I4RA 2DZJA 1JWAD 1VJKA 1WJ4A 5DPRA 1NEKB 2WX1A 1XF5L 2ZCCA 2K39A 2N7EA 3N3KB 4IM0A 4EOYA 3A4SC 2M19A 2JUOA 3RUIB 4DDID 1PQSA 2ZNVB 3I57A 5EDSA 1GOZA 1R4NI 2MA9B 1VZ8A 3AEDB 2BB5A 2KANA 3NOBA 4TV3A 4E74A 3NJTA 3PRZA 4DHJD 2WDVB 2K6QA 2G3QB 2PJHA 3GZNB 1L0VB 2AYOB 3QAQA 4R3DA 3RD2A 3BZDB 3AE1B 1WSPA 4M8NA 3M95A 2INPE 1NYRA 1TS3A 2CU1A 3AE9B 1EUVB 2YEPF 4LNIA 5CHWA 1NYQA 1SSNA 2BKFA 3PZDA 3B1LX 2K1FA 3DBRI 3X0WA 3CIRB 2KWUB 5D3IB 1GJZA 2LVOA 2UU7A 3MP9A 2KWDA 1KM7A 1FXAA 1Q1OA 2H88B 4EZJA 2MSED 5HKHA 1K52A 4A8XC 2WXJA 2AWTA 4LNKA 1GB4A 4OVZA 3BWUD 3N20C 4IM3A 4YXDB 4W9JA 3RT3B 3L16A 2WU5B 4IDIA 3N32A 4MH8A 1WR1A 3VR8B 4RMAA 3ONSA 3IBEA 1JRPA 2NBUA 3Q3FA 3UI3A 2IO0B 4K7WA 1ET9A 1XCTL 5IOIA 5J2RA 4REZA 3RMKC 1WX8A 3UQBA 2K8HA 1GC6A 2MQJA 2DZMA 1C9FA 3RNFC 3B0AA 1BXTA 2JYTA 2LFIA 4JL9A 4LNOA 4MT5A 5EE1A 1F0ZA 1Q0WB 1QOBA 4HPLB 1PFDA 2KQ7A 2BGFA 2PVOD 4NJ7A 1AARA 1J7BA 2WDRB 5FR6A 4A3PA 3QX1A 3DOWA 5IO9A 1KRHA 1GG3A 4JWUC 1V6EA 4OZBA 2IO3B 4XDCA 2L05A 3A1QA 2R2OA 3LDZE 4JPSA 2JXTA 5KHQA 5G2NA 1UBQA 4GN1A 3T3NA 4W9IA 3ZW3A 1TIFA 2N9PC 3O65B 4OW0A 1ZE3D 3W9CB 1LQBA 1YIWA 5EE0A 4NQKE 1ZXHA 4N58A 3BK1A 2ONQA 2ZNVC 4K3CA 2CKHB 4RGOS 4ICUA 2O2VB 1XEEA 4BBNF 3RNGC 3GP7A 3GB1A 4AS1A 1FNVA 4J3OD 3GOEA 1TTNA 3AH7A 2EMSA 2PVGC 4IW0A 4M8MA 4MEMA 3B2GA 2KVZA 2V3PA 2N1WA 3DBLI 1WGKA 5EE9A 3NS1A 3W1YA 4G11A 2LXAA 1WWTA 3KUCB 2B76B 4P1CC 3RFZB 2L52A 2FCMA 2ZJDA 2MLBA 2UWQA 3S2AA 1E7VA 3RULA 1R4NB 1CJEA 1KLUD 5DPTA 2KJHB 2L8JA 5FKAC 1C76A 3QWZB 3Q8CA 1FD6A 2DWQA 2R2QA 4HDQA 1M4VA 4KIKA 2MBQA 2CHZA 4MJSB 4DHZB 2KT7A 3LYYA 3NVYA 3GE3C 3NVWA 1KTKA 2N4FA 1N61A 2BWES 2FBWB 1EO6A 1XQQA 2DZKA 1QLBB 4URKA 3PT2B 2BYFA 2QILA 3ZRFA 3MFGA 2IGDA 1FRRA 2KYWA 5L95C 4PYUA 2KK8A 2INCC 2O6VA 1L2NA 1KLVA 1WIAA 2HJ8A 2KKCA 3EC8A 2IZVB 1HE8A 5T8IA 2KMMA 3ALBA 3DBSA 4L1BA 1RFKA 2V0GA 2DYOA 2K25A 3ZLZA 1TT5B 2IGHA 3URYA 2NPTB 1EM7A 1FO4A 4WJNA 1MJDA 4XYCA 3Q8EA 4GDLA 1FXIA 3EFCA 3DVNV 3DHHC 2KOXA 4IUMB 2CU3A 1V5OA 3RNEC 2ZEQA 5DCNA 4FXCA 2NS5A 2UYZB 4LNNA 3RPFC 2SAKA 4A6QA 2LVPA 2LHDA 1DYQA 3ECIA 3H6NA 2AX5A 3RNCC 2WLBA 4BOZB 3OLMD 3QCAA 3E9SA 3FILA 2JZPA 1RWSA 2HTHA 3H9DA 4KKJA 4CYEA 1HZ5A 4YSYB 2QHOA 1EWYC 3VRBB 2KTRB 4PT5A 2AL3A 2QDFA 1NENB 1BT0A 5FK9C 1SE2A 3DBHI 4AQ7A 4W9HA 3MHSD 1AN8A 2I2YA 4W9CA 2DYBA 1XXGA 1HXYD 1QQRA 2WXRA 3AE2B 3L0WB 2L0FA 4HROA 2FIFA 4B9KA 2NBVB 2QIEB 1IPGA 2BQQA 3QHTA 4NAWB 1E7PB 2QSDA 1R7SA 1PYWD 5DPWA 2GB1A 3CSFA 2K3UA 4WWPA 3UQAA 2JF5A 2WXIA 3Q8FA 2M17A 3C0RB 4USAA 2EKEC 4HVBA 3PV1A 4ZRJA 1XCQL 3PREA 4IKGA 3NS8A 1OGWA 5D94A 3A9JB 4MDKE 4YSZB 1P98A 4BZAA 4ZOHC 3R7QA 3VAWA 3DHIC 1E7UA 2LZ6A 3P63A 2LGXA 3AM9A 4LDTB 3ZNZB 3HHMA 5FR3A 3AXCA 2V1YA 4HJKA 4HPMB 2LUEA 3BVGA 3GS2A 4MELA 2RDGA 2E3TA 2MHJA 1V1PB 4LLGM 3QJZA 2KDIA 2LEKA 1N60A 2J52A 3CMMB 3WIMA 1SF0A 3OAWA 3U8ZA 2PE9A 1WM3A 3ZTCA 1WFYA 2RDHA 4GDKB 4ANXA 2VZKD 1OQRA 1HA5A 1YJ1A 3ZIMA 2IY0B 2KLGA 1WXSA 1T3QA 2IYDB 3V6EB 1KJTA 1E10A 4ARIA 2CHXA 1OTRB 2JZZA 2YLMA 3AI5A 4HPPA 3WCQA 1VZ6A 5J18A 3JVZX 2KACA 1UGMA 1SXTA 3AE7B 2K8BA 1B1ZA 2LWPA 3MTNB 2DZIA 4KVGB 2LJ5A 4L23A 1WGYA 4WWOA 3DQVA 2V4LA 4XZ4A 3H1UA 1N62A 4WJPA 2E6XA 3ABVB 2J0JA 3HRDD 3T3OA 1WH3A 2C7NB 4OHJA 1CK1A 1EF5A 4K7SA 3U30A 1HQRD 4RNAA 4KV2A 3KW5B 2WXLA 2WXKA 2JVCA 2OEDA 3SDLC 2MBHA 4OVVA 2Z59B 2KFKB 3V3XA 1WJUA 4W9GA 1TS4A 3HK0A 3O13A 4XGAB 3VH3B 1VRAB 2FNJB 2DAFA 2ZVOA 4IG7B 1DGJA 4ACFA 1GC7A 3VUYA 2JWZA 2K0PA 1V49A 2G4DB 2DBYA 1F77A 1F1HA 4HJGE 5DPSA 3DBHB 1GB1A 4N6EB 4HEA1 4GMVA 3KLSX 4C4VA 2QJLA 5AZHA 3VTWA 1AW7A 3DVGX 4DXFA 1WXMA 3Q3MC 2BYVE 2BYTA 1GNUA 4LJPB 4IWOA 4N59A 4K81A 1GAQB 2GRIA 2LRUA 4MGZE 2JT4B 2BVCA 3B2FA 2FE8A 3KUDB 3N1YC 2KC1A 1P7EA 4PK1A 2K8CA 2N9XA 2B3AA 1WGGA 1Y8RC 3A1QB 3QC8B 5E6PA 3U7DA 1BUIC 4XWWA 2PLPA 3B9JA 2Z0EB 1C77A 4DQOC 2ZW0A 2X38A 3I9V1 1F2RI 2W3SA 4B6WA 1TGZB 3RI7C 3VXWA 1E9MA 2AEHA 2DX5B 1SIJA 3RZFA 2Z8LA 3ZDTA 2WS3B 2J0MA 4JGHB 1WMHB 4II2B 2HTME 3KQ4A 1UNSA 2AQ1B 3SD5A 3A9KA 2KMCA 2JXXA 3EA6A 4XWTA 3EECA 2MRPA 3H7PA 1VCBA 4M01A 3RNBC 4DXAB 4AJYB 1JWSD 1UBIA 1IYFA 1YQBA 4RFBA 1ET6A 1T5XD 1WX9A 3BVZA 3KVFB 1HZ6A 4M00A 1D4BA 1HEZE 5AUKA 2VH2A 3IT6B 4BOSC 4BBNC 3BY4B 4BFRA 1RAXA 4DWFA 3ZRCA 4MACA 5MPOA 1C4PA 1YX5B 4K1RB 4TKNA 1X1MA 2RSUA 5GMVA 2KDMA 2CHWA 1P1AA 5JHBA 3MJ5A 4HCPB 1Y56A 4M0WB 3R66C 5BMGA 1JROA 4G0NB 3H7SA 4FJZA 1SBBB 1J8CA 1T0RC 2BT6A 2EELA 1TY2A 2GBJA 4B0EA 2LHEA 1SIFA 1NI3A 2N9KA 3UGBB 1YD8U 3Q69A 4S17A 2RGFA 2K9XA 4C80A 3VQIA 4WIPA 3W5VB 1JMLA 4GOCA 3QK0A 2JPHA 4YTNB 3SFEB 1ENFA 2IO2B 1OEYA 1STEA 4ZRKA 2L7RA 2WDQB 1ROEA 4ZYNA 2V3NA 4I6LB 1VLBA 4EKUA 2ZW1A 3IHPC 4HDOA 1E5WA 2KDBA 3MC9A 1I42A 1XLNA 5D3DA 4ZDVA 1FFUA 1CZPA 3JSVB 4ARCA 4A90A 2BPSA 1PDXA 2DLBA 4C7YA 4DBGA 1L0XB 3AE3B 2KC2A 2J4XA 2FCNA 1JRUA 2Y3AA 3I3TB 3W1SA 1E8WA 2D3CA 3VUWA 3OG5A 4OZCA 1NBFC 3FAHA 3SU8X 5HI1A 3ZTDA 4EZKA 3VTVA 1Z2MA 3ZNID 2LGIA 1MFWA 4KKIA 5LXHA 2ASQA 2IJ0A 1PGAA 3DDCB 3IAS1 3LJ3A 5C23A 2ZVNA 3MC0B 1J7CA 2IO1B 1MPEA 2MCNB 1Q10A 2RDBC 3FILB 3TUOA 1R4MI 3UINB 1MI0A 3PVLA 1C79A 3V60A 2JX5A 2D3BA 3TIXA 3RNAC 3Q3OC 2NMQA 3L08A 1TKYA 4NQLB 4YTMB 3WANA 2XN9C 1WRDB 2N1VA 3OJ4B 1IP9A 4PS7A 1SB3C 4LDTD 4DHJB 3Q2AC 1D5MC 2I1KA 3AE6B 2BWFA 3DVNU 3U2SC 4FJVB 2VH1A 4BAXA 4HWIB 1KFYB 4L2YA 1WGHA 4CO7A 5C1ZA 1QT9A 5BMHA 1SE3A 1VD2A 2PEAA 4ANUA 2FIDA 3PRPB 2C7MB 3BINA 1D5XC 1ACCA 2G9HD 1WE6A 1RM6C 3KH0A 2DHZA 2WXHA 3TEWA 2K5PA 3ZJTA 3VDZA 4IC7B 1WXVA 2IY1B 4KGTA 2C9WB 4ZHOA 4M02A 4W9DA 5E6NA 3T9LA 2LRWA 2M0AA 2LUMA 4WWNA 2CS4A 1M94A 3J9CA 1KOTA 3DCGA 1FNUA 2GI9A 2JRIB 1WR6E 3CF6E 2MBBB 4N9F4 4I6PA 2LGYA 2DENB 2D3AA 4W9EA 3HM6X 5LLIA 1H8CA 3ZJVA 2KQSA 4WJQA 4AP4C 4P16A 4MGKE 4HRSA 1XLOA 2BB6A 4KGRA 2N7JA 1ZPSA 4LCDE 3OWEB 2KN5A 4A3OA 5CX3A 2D11A 5AUIA 2WXNA 3FKYA 4J6IA 2INDC 5D6JB 2BF8B 3Q3JA 5EE3A 1IGDA 1FM0D 4PS8A 1FCLA 5LXIB 2PW9A 1UZXB 1FXTB 2KJRA 2YEPB 2N0SB 2LVQA 2GBNA 3H8HA 4MGIE 1VR9A 2MW5A 1DOXA 2PIAA 2AQ3B 2IGGA 2N9EB 4W9FA 5JHAA 3ZNGC 2GMIC 3UF8A 2BS2B 2D5GA 3FC4A 1XLQA 4BKTA 2IDYA 3U4EG 2G1EA 2L1AA 2MH7A 2AQ2B 2G45B 5G5HA 4BVUC 2R61A 1OEYJ 3BYTB 5I4DA 2WNMA 4S0RA 4BKSA 1BMLC 1WM2A 3AEGB 1E0ZA 4MJSA 2I38A 2XK5B 4DXGA 2IBIB 3VUXA 2W9NA 1I4XA 1WF9A 1YN3A 1WYGA 2KX0A 1SE4A 3VRAB 2ICIA 2NVUI 3PPAA 1K51A 1V5TA 2DNFA 1FFVA 2K22A 2D10A 4MH0E 3ZO5B 4NNJB 2MWSB 5IAAC 3EGRA 2G4SA 1IUEA 1YJJA 2MP2A 2WX0A 3KYDD 4GSWA 2Y5CA 4RGTA 3Q3NC 2X8XX 3RYTA 1P7FA 3IT4B 1I4PA 2CJNA 1NVID 1YJIA 4MSMB 2NTTA 5JH5C 2AL6A 3D32A 1IBXB 4TMAB 4P6VF 1PGBA 3WAPA 2MBEA 3TCAA 3KWVA 4BKGA 2C7HA 4O1NA 1R4MB 3VVWB 4HKZE 1C78A 3LXFA 1U4AA 2LI5A 1XT9B 1SGHA 5TSSA 1TS2A 1F2RC 3P4QB 4P7IA 2KLCA 4GB9A 4NY0A 1J7AA 1JCKB 3DWGC 4HK2A 3BIID 4ZHPA 1OQQA 2NTSA 4RM8A 3TEZA 4GXBA 2YVCA 2KWVB 4RH6A 3ENEA 2M1MA 2JWUA 2Z0DB 1FCCC 5C3JB 4WQOB 3AEFB 3V62A 3ZXVA 1FRDA 3VTUA 1F52A 1WE7A 1YQ3B 1A70A 1EU4A 1AYFA 2KTRA 4US9A 3DPDA 1V2YA 2OOBB 1K8RB 3L17A 1WZ3A 2WGSA 5AEKB 3N9YC 4F1SA 1YOVB 4GU2A 2MBOA 3P1MA 3ZUNA 4RM9A 2KNBA 1UGJA 5H8YE 1L4ZB 3P4RB 2W54A 4ANWA 3SHQA 2VRRB 3VH4B 3APCA 3NZSA 4AOFA 1VDVA 2I1JA 1Z5SB 1ZKHA 2D07B 1SEBD 2RMMA 2WXFA 4ICVA 4ZRQA 3IFWB 1HTOA 4ZYSA 3AU5A 4K3BA 3E56A 3WALA 2QMTA 1KF6B 3I63C 1IGCA 3C8YA 2D2QA 4HKQA 3ZGZA 1MG4A 2KFJA 2KX3A 3H7PB 2JQRB 1ISNA 4KX6B 3A4RA 1UWMA 1ZDXA 1I7HA 2ZCBA 4RF1A 3NRZA 3A9JA 4WQMA 3TL5A 2KHWB 3AMZA 3TJPA 2L00B 2BS4B 3DHGC 2C60A 2N9LA 1WRIA 2WXPA 4FULA 1I4HA 3VFKA 5J17A 2KZRA 4FADA 2GBRA 4NAMA 4OZAA 2M8SA 3PO0A 2JSVX 3KWLA 1ESFA 3HM3A 1UELA 4KGSA 1FMAD 2BYEA 2GLSA 2KD0A 4DHZE 1YQ4B 1V80A 1UUPA 4B0MA 4F7ZA 1ZUD2 3QQ8B 1V1PA 3BYYB 4RCOA
chains in the Genus database with same CATH topology
2IO2B 1OEYA 3QA8A 2L7RA 4ZRKA 2DYOA 2K25A 4ZYNA 3ML8A 3ZLZA 4I6LB 2L0TA 2N7DA 4PS3A 4EKUA 2MX2A 3IHPC 4HDOA 1E5WA 1UH6A 2KDBA 2NPTB 5TR5A 1WGDA 2L3ZA 2REXA 2WYQA 1I42A 4GDKA 5G55A 4ZDVA 4WJNA 2ZPYA 3KYCD 3JSVB 4GDLA 3A33B 1WX7A 1V9JA 2RR9A 2BPSA 3DVNV 3T8MA 2D3GA 2J0KA 3ZDMC 2WWZA 2KOXA 4IUMB 4DBGA 1V5OA 2ZEQA 2KC2A 3AU4A 5DCNA 2NS5A 2FCNA 2UYZB 1J0GA 1JRUA 2LVPA 2WDTB 1YX6B 3I3TB 3KUZA 3W1SA 1E8WA 3ECIA 3H6NA 1WY8A 3P2BA 1V86A 4A20A 3VUWA 4BKSD 4MM3A 1NBFC 4BOZB 3OLMD 3QCAA 3SU8X 4IWPA 3B08A 2J7QB 2HTHA 3ZTDA 2FAZA 3H9DA 4EZKA 3VTVA 1Z2MA 3ZNID 2L76A 2KWCA 4DK5A 4DDGD 4CYEA 3NY5A 5LXHA 4JIOU 4K7UA 2QHOA 2KTRB 3M63B 2AL3A 2ASQA 2GOWA 3DDCB 1BT0A 4F8CB 3LJ3A 5C23A 2ZVNA 2IO1B 3DBHI 4FHKA 2ZZPB 4W9HA 3MHSD 2MCNB 2NR2A 4EEWA 1R4MI 3UINB 4CHKA 4NAWA 4JLCA 3PVLA 4W9CA 4YL8A 2GBMA 2NCNA 2LD9A 3V60A 3EHVA 1GUAB 2DYBA 3TIXA 4FLHA 3L08A 4NQLB 3A9KB 1E8ZA 1F9JA 3PHWB 3L0WB 2L0FA 3WANA 2XK5A 4KSLC 1WRDB 2N1VA 4IM2A 3OJ4B 4JQWC 1XD3B 1IP9A 2FIFA 1RLFA 4PS7A 4B9KA 1T0YA 2C5LC 2JY6A 2KJ6A 2NBVB 4HLEA 4LDTD 4DHJB 2I1KA 1IPGA 3QHTA 4NAWB 2O6VD 3RZWC 2BWFA 2LXCA 2KFKA 3IVFA 3DVNU 5DPWA 1E90A 4XX5A 3JW0X 4W9LA 3TBLD 4FJVB 3CSFA 1UD7A 1TZ1A 1NDDA 4FN2A 4HWIB 1S3SG 4KDIC 4MSQB 1WGHA 2DYMA 4NJ6A 4WWPA 4MGYE 4AUQC 4CO7A 3UQAA 5C1ZA 1Q5WB 2JF5A 4AJWA 1LM8B 2M17A 4GIVA 1EF1A 1VD2A 2PEAA 3APDA 1WGRA 3C0RB 4G50A 4ANUA 2FIDA 3PRPB 2ZPNA 2C7MB 2EKEC 3BINA 4HVBA 3PV1A 3QARA 4ZRJA 3KH0A 1WE6A 3R7RA 1E8YA 2KTFA 3PREA 4KIKB 2DHZA 4B95A 3NS8A 1OGWA 3VDZA 4IC7B 5D94A 1S1QB 1WXVA 3A9JB 3TMPB 2IY1B 1OQYA 2C9WB 4MDKE 3QIJA 1P98A 5E6OA 4W9DA 5E6NA 4ZRIA 3T9LA 2LRWA 1LXDA 4KDLB 2RPQA 1RRBA 2CS4A 4WWNA 1WJNA 3R7QA 3DVGY 1M94A 2DZJA 3VAWA 1KOTA 1MG8A 3DCGA 1WJ4A 5DPRA 1E7UA 2LZ6A 2WX1A 2ZCCA 2K39A 2JRIB 2LGXA 2N7EA 4LDTB 3PTFC 3N3KB 3ZNZB 4G3XB 4IM0A 3HHMA 4EOYA 1WR6E 2O6VB 3CF6E 3A4SC 2MBBB 3AULA 3AXCA 2V1YA 4HJKA 4N9F4 4I6PA 2JUOA 3HIZA 2LGYA 2DENB 3L54A 3RUIB 4DDID 1PQSA 4W9EA 4HPMB 2LUEA 3HM6X 3N30A 2ZNVB 5LLIA 5EDSA 1H8CA 1R4NI 2MA9B 4MELA 5AZGA 2KQSA 2KANA 3NOBA 4TV3A 2XBBC 1G6JA 4WJQA 4AP4C 3QJZA 4E74A 1V81A 2KDIA 4MGKE 3PRZA 3CMMB 3WIMA 4DHJD 4KSKC 4LCDE 2K6QA 3OAWA 3U8ZA 2KN5A 2G3QB 1WM3A 2PE9A 2PJHA 3ZTCA 1WFYA 3K9PB 5CX3A 4A3OA 2D11A 2KMAA 4GDKB 4ANXA 1WYWB 4E3CA 2AYOB 3QAQA 4GDLB 3RD2A 1YJ1A 3UIOB 3ZIMA 1WMHA 4PYZA 2IY0B 2KLGA 4M8NA 1WXSA 3M95A 4J6IA 5D6JB 2IYDB 5AZFA 2BF8B 3Q3JA 3V6EB 1KJTA 4EFOA 3MJWA 4PS8A 3OJ3A 2CHXA 3JYUA 5L83A 1OTRB 2JZZA 2CU1A 2YLMA 2PE6B 5LXIB 1D3ZA 1EUVB 3AI5A 1FXTB 1UZXB 2KJRA 5CHWA 1LFDA 5J18A 5D2MB 2BKFA 2LVQA 3JVZX 2GBNA 3K9OB 3PZDA 4FHJA 4MGIE 3B1LX 2FCSA 2MW5A 1UGMA 1ZW7A 3R3MA 2K1FA 2A5UA 2N9EB 3DBRI 3PS6A 4W9FA 2K8BA 2LWPA 5JHAA 3X0WA 3MTNB 3ZNGC 2GMIC 2KWUB 3UF8A 2M0XA 2DZIA 3V6CB 4KVGB 2LJ5A 4WWOA 1WGYA 1GJZA 4BKTA 3DQVA 2V4LA 2LVOA 4XZ4A 1KM7A 3H1UA 2G45B 1Q1OA 4EZJA 4BVUC 2MSED 4WJPA 5HKHA 1L7YA 2J0JA 1OEYJ 2KVRA 1WH3A 2AWTA 2KDEB 2KDFB 4I6NB 2C7NB 4BKSA 3W1SC 4EZLA 2GBKA 1WM2A 4MJSA 2K6DB 1EF5A 2XK5B 4K7SA 4IM3A 4AWJA 2IBIB 3L13A 3U30A 3VUXA 2W9NA 1WF9A 3ML9A 4W9JA 3RT3B 3L16A 2KX0A 3N32A 4KV2A 2NVUI 1WR1A 3PPAA 1CMXB 3KW5B 1V5TA 4FJYA 2JVCA 4RMAA 3SDLC 2MBHA 4OVVA 2Z59B 2KFKB 3ONSA 3IBEA 1WJUA 4W9GA 2D10A 4MH0E 3ZO5B 4GGQA 2MWSB 3HK0A 4NNJB 5IAAC 2NBUA 2G4SA 3Q3FA 3VH3B 3RCZA 2MP2A 2WX0A 3KYDD 2IO0B 4K7WA 2FNJB 2DAFA 2ZVOA 4GSWA 4IG7B 5J2RA 2LGDA 4EUTA 3RYTA 1GC7A 1WX8A 2XEWA 3VUYA 5IA7A 3UQBA 2K8HA 1A5RA 2JWZA 1GC6A 2MQJA 3PRMB 2DZMA 4MSMB 5CHVC 3B0AA 5JH5C 3M3JA 4JL9A 2AL6A 3D32A 1V49A 2G4DB 4KZCA 1Q0WB 3ZVVA 4HPLB 2KQ7A 2BGFA 2RD0A 4NJ7A 5DPSA 3WAPA 1AARA 2MBEA 4IWQA 5FR6A 2MP2B 3EFUA 4OVUA 3TCAA 4A3PA 2EMTA 3QX1A 4HXDA 3DOWA 3IG3A 4GMVA 2C7HA 4BKGA 4FA6A 1GG3A 3VVWB 5AZHA 3JSVA 5JZEB 3VTWA 1V6EA 3DVGX 4W9KA 1WXMA 2IO3B 1U4AA 2BYVE 2LI5A 1XT9B 2L05A 1GNUA 3A1QA 1SGHA 2R2OA 2Y5BB 4LJPB 3LDZE 4IWOA 2JZ3B 2M4NA 5KHQA 3APFA 4K81A 2KO3A 5KHOA 4P7IA 2KLCA 2LRUA 1UBQA 4GB9A 4MGZE 4NY0A 5G2NA 2JT4B 4GN1A 2FCQA 4HK2A 4KZ0A 2CR5A 4W9IA 2OJRA 3ZW3A 3UIPB 3KUDB 4NPNA 4RM8A 4WJOA 2KC1A 4TUUA 2FUHB 2O2VA 4GXBA 2YVCA 1QZEA 2KWVB 3L10B 2K8CA 2N9PC 2N9XA 3ENEA 2M1MA 3O65B 2Z0DB 2B3AA 1P0RA 1WGGA 3V61A 4WQOB 1Y8RC 3A1QB 5D7GA 2JRHA 1J19A 3QC8B 3V62A 5E6PA 3U7DA 3VTUA 1LQBA 1YIWA 1WE7A 2Z0EB 1TBEA 3ZNHB 4NQKE 2KTRA 3DPDA 1V2YA 2OOBB 1K8RB 3L17A 1WZ3A 2ZNVC 5AEKB 4B6WA 1I35A 2CKHB 1TGZB 3PGEA 3VXWA 3WAOA 4ICUA 4TQ0A 4F1SA 2O2VB 4GU2A 2AEHA 3WA0A 2DX5B 3RZFA 2MBOA 1SE9A 3ZDTA 4BBNF 3ZUNA 4RM9A 2J0MA 2KNBA 4JGHB 1WMHB 4II2B 3X23A 4II3B 5CHFA 1RFAA 4ANWA 2NBWB 3SHQA 3SD5A 1H4RA 3A9KA 2VRRB 1TTNA 2KMCA 3GOEA 3VH4B 2EMSA 2JXXA 3APCA 4IW0A 1P3QU 4X57B 3NZSA 3PHXB 4M8MA 4AOFA 4MEMA 4WAAA 2I1JA 1Z5SB 2N1WA 3EECA 2MRPA 1ZKHA 2D07B 3DBLI 1VCBA 3H7PA 4ICVA 4DXAB 4AJYB 2A4ZA 3IFWB 1UBIA 1IYFA 3NHEB 3W1YA 1YQBA 2LASA 3AU5A 4G11A 2LXAA 1WX9A 3KUCB 3KVFB 3WALA 4ANVA 2BKRB 2DAJA 3CSTA 2KXJA 2FCMA 2ZJDA 2MLBA 2UWQA 4HCNB 1E7VA 2D2QA 3RULA 3S2AA 4FBJB 4BOSC 3GZNI 4BBNC 2KX3A 2KFJA 3H7PB 5DPTA 2KJHB 2L8JA 3BY4B 4BFRA 1RAXA 3QWZB 3ZKJC 1ISNA 4DWFA 4XC2A 2R2QA 3A4RA 3ZRCA 4HDQA 4KIKA 2ZCBA 3NZUA 3WAMA 1WI0A 1YX5B 4K1RB 2MBQA 4TKNA 3A9JA 3TL5A 2KHWB 1X1MA 2RSUA 5GMVA 3TJPA 2CHZA 4MJSB 2CHWA 4ASWC 1WJ6A 1ZGUB 4DHZB 1P1AA 2L00B 1C3TA 5JHBA 4HCPB 2PPHA 4M0WB 2C60A 2N4FA 3R66C 3M62B 5BO4B 4FULA 2BWES 1EO6A 1XQQA 4G0NB 2DZKA 3VFKA 3H7SA 5J17A 4FJZA 2KZRA 1P9DU 4FADA 4URKA 3PSEB 3PT2B 2BYFA 1J8CA 2GBRA 1C1YB 3ZRFA 2M8SA 4E71A 1NI2A 1UELA 3HM3A 2GBJA 2V3SA 3PLUA 1SIFA 1WZ0A 3UGBB 1WXAA 5L95C 1YD8U 4PYUA 2KK8A 4TQ1A 2BYEA 2RGFA 2KD0A 2O6VA 1L2NA 1KLVA 2NPTA 2HD5B 1WIAA 3VQIA 2HE7A 2HJ8A 2KKCA 3EC8A 3PLVA 4LJOB 2IZVB 4DHZE 1HE8A 4GOCA 3QK0A 1V80A 5CTRC 3DBSA 3ALBA 4F7ZA 1E8XA 2JPHA 3QQ8B 3VHTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO2 B;  1OEY A;  3QA8 A;  2L7R A;  4ZRK A;  2DYO A;  2K25 A;  4ZYN A;  3ML8 A;  3ZLZ A;  4I6L B;  2L0T A;  2N7D A;  4PS3 A;  4EKU A;  2MX2 A;  3IHP C;  4HDO A;  1E5W A;  1UH6 A;  2KDB A;  2NPT B;  5TR5 A;  1WGD A;  2L3Z A;  2REX A;  2WYQ A;  1I42 A;  4GDK A;  5G55 A;  4ZDV A;  4WJN A;  2ZPY A;  3KYC D;  3JSV B;  4GDL A;  3A33 B;  1WX7 A;  1V9J A;  2RR9 A;  2BPS A;  3DVN V;  3T8M A;  2D3G A;  2J0K A;  3ZDM C;  2WWZ A;  2KOX A;  4IUM B;  4DBG A;  1V5O A;  2ZEQ A;  2KC2 A;  3AU4 A;  5DCN A;  2NS5 A;  2FCN A;  2UYZ B;  1J0G A;  1JRU A;  2LVP A;  2WDT B;  1YX6 B;  3I3T B;  3KUZ A;  3W1S A;  1E8W A;  3ECI A;  3H6N A;  1WY8 A;  3P2B A;  1V86 A;  4A20 A;  3VUW A;  4BKS D;  4MM3 A;  1NBF C;  4BOZ B;  3OLM D;  3QCA A;  3SU8 X;  4IWP A;  3B08 A;  2J7Q B;  2HTH A;  3ZTD A;  2FAZ A;  3H9D A;  4EZK A;  3VTV A;  1Z2M A;  3ZNI D;  2L76 A;  2KWC A;  4DK5 A;  4DDG D;  4CYE A;  3NY5 A;  5LXH A;  4JIO U;  4K7U A;  2QHO A;  2KTR B;  3M63 B;  2AL3 A;  2ASQ A;  2GOW A;  3DDC B;  1BT0 A;  4F8C B;  3LJ3 A;  5C23 A;  2ZVN A;  2IO1 B;  3DBH I;  4FHK A;  2ZZP B;  4W9H A;  3MHS D;  2MCN B;  2NR2 A;  4EEW A;  1R4M I;  3UIN B;  4CHK A;  4NAW A;  4JLC A;  3PVL A;  4W9C A;  4YL8 A;  2GBM A;  2NCN A;  2LD9 A;  3V60 A;  3EHV A;  1GUA B;  2DYB A;  3TIX A;  4FLH A;  3L08 A;  4NQL B;  3A9K B;  1E8Z A;  1F9J A;  3PHW B;  3L0W B;  2L0F A;  3WAN A;  2XK5 A;  4KSL C;  1WRD B;  2N1V A;  4IM2 A;  3OJ4 B;  4JQW C;  1XD3 B;  1IP9 A;  2FIF A;  1RLF A;  4PS7 A;  4B9K A;  1T0Y A;  2C5L C;  2JY6 A;  2KJ6 A;  2NBV B;  4HLE A;  4LDT D;  4DHJ B;  2I1K A;  1IPG A;  3QHT A;  4NAW B;  2O6V D;  3RZW C;  2BWF A;  2LXC A;  2KFK A;  3IVF A;  3DVN U;  5DPW A;  1E90 A;  4XX5 A;  3JW0 X;  4W9L A;  3TBL D;  4FJV B;  3CSF A;  1UD7 A;  1TZ1 A;  1NDD A;  4FN2 A;  4HWI B;  1S3S G;  4KDI C;  4MSQ B;  1WGH A;  2DYM A;  4NJ6 A;  4WWP A;  4MGY E;  4AUQ C;  4CO7 A;  3UQA A;  5C1Z A;  1Q5W B;  2JF5 A;  4AJW A;  1LM8 B;  2M17 A;  4GIV A;  1EF1 A;  1VD2 A;  2PEA A;  3APD A;  1WGR A;  3C0R B;  4G50 A;  4ANU A;  2FID A;  3PRP B;  2ZPN A;  2C7M B;  2EKE C;  3BIN A;  4HVB A;  3PV1 A;  3QAR A;  4ZRJ A;  3KH0 A;  1WE6 A;  3R7R A;  1E8Y A;  2KTF A;  3PRE A;  4KIK B;  2DHZ A;  4B95 A;  3NS8 A;  1OGW A;  3VDZ A;  4IC7 B;  5D94 A;  1S1Q B;  1WXV A;  3A9J B;  3TMP B;  2IY1 B;  1OQY A;  2C9W B;  4MDK E;  3QIJ A;  1P98 A;  5E6O A;  4W9D A;  5E6N A;  4ZRI A;  3T9L A;  2LRW A;  1LXD A;  4KDL B;  2RPQ A;  1RRB A;  2CS4 A;  4WWN A;  1WJN A;  3R7Q A;  3DVG Y;  1M94 A;  2DZJ A;  3VAW A;  1KOT A;  1MG8 A;  3DCG A;  1WJ4 A;  5DPR A;  1E7U A;  2LZ6 A;  2WX1 A;  2ZCC A;  2K39 A;  2JRI B;  2LGX A;  2N7E A;  4LDT B;  3PTF C;  3N3K B;  3ZNZ B;  4G3X B;  4IM0 A;  3HHM A;  4EOY A;  1WR6 E;  2O6V B;  3CF6 E;  3A4S C;  2MBB B;  3AUL A;  3AXC A;  2V1Y A;  4HJK A;  4N9F 4;  4I6P A;  2JUO A;  3HIZ A;  2LGY A;  2DEN B;  3L54 A;  3RUI B;  4DDI D;  1PQS A;  4W9E A;  4HPM B;  2LUE A;  3HM6 X;  3N30 A;  2ZNV B;  5LLI A;  5EDS A;  1H8C A;  1R4N I;  2MA9 B;  4MEL A;  5AZG A;  2KQS A;  2KAN A;  3NOB A;  4TV3 A;  2XBB C;  1G6J A;  4WJQ A;  4AP4 C;  3QJZ A;  4E74 A;  1V81 A;  2KDI A;  4MGK E;  3PRZ A;  3CMM B;  3WIM A;  4DHJ D;  4KSK C;  4LCD E;  2K6Q A;  3OAW A;  3U8Z A;  2KN5 A;  2G3Q B;  1WM3 A;  2PE9 A;  2PJH A;  3ZTC A;  1WFY A;  3K9P B;  5CX3 A;  4A3O A;  2D11 A;  2KMA A;  4GDK B;  4ANX A;  1WYW B;  4E3C A;  2AYO B;  3QAQ A;  4GDL B;  3RD2 A;  1YJ1 A;  3UIO B;  3ZIM A;  1WMH A;  4PYZ A;  2IY0 B;  2KLG A;  4M8N A;  1WXS A;  3M95 A;  4J6I A;  5D6J B;  2IYD B;  5AZF A;  2BF8 B;  3Q3J A;  3V6E B;  1KJT A;  4EFO A;  3MJW A;  4PS8 A;  3OJ3 A;  2CHX A;  3JYU A;  5L83 A;  1OTR B;  2JZZ A;  2CU1 A;  2YLM A;  2PE6 B;  5LXI B;  1D3Z A;  1EUV B;  3AI5 A;  1FXT B;  1UZX B;  2KJR A;  5CHW A;  1LFD A;  5J18 A;  5D2M B;  2BKF A;  2LVQ A;  3JVZ X;  2GBN A;  3K9O B;  3PZD A;  4FHJ A;  4MGI E;  3B1L X;  2FCS A;  2MW5 A;  1UGM A;  1ZW7 A;  3R3M A;  2K1F A;  2A5U A;  2N9E B;  3DBR I;  3PS6 A;  4W9F A;  2K8B A;  2LWP A;  5JHA A;  3X0W A;  3MTN B;  3ZNG C;  2GMI C;  2KWU B;  3UF8 A;  2M0X A;  2DZI A;  3V6C B;  4KVG B;  2LJ5 A;  4WWO A;  1WGY A;  1GJZ A;  4BKT A;  3DQV A;  2V4L A;  2LVO A;  4XZ4 A;  1KM7 A;  3H1U A;  2G45 B;  1Q1O A;  4EZJ A;  4BVU C;  2MSE D;  4WJP A;  5HKH A;  1L7Y A;  2J0J A;  1OEY J;  2KVR A;  1WH3 A;  2AWT A;  2KDE B;  2KDF B;  4I6N B;  2C7N B;  4BKS A;  3W1S C;  4EZL A;  2GBK A;  1WM2 A;  4MJS A;  2K6D B;  1EF5 A;  2XK5 B;  4K7S A;  4IM3 A;  4AWJ A;  2IBI B;  3L13 A;  3U30 A;  3VUX A;  2W9N A;  1WF9 A;  3ML9 A;  4W9J A;  3RT3 B;  3L16 A;  2KX0 A;  3N32 A;  4KV2 A;  2NVU I;  1WR1 A;  3PPA A;  1CMX B;  3KW5 B;  1V5T A;  4FJY A;  2JVC A;  4RMA A;  3SDL C;  2MBH A;  4OVV A;  2Z59 B;  2KFK B;  3ONS A;  3IBE A;  1WJU A;  4W9G A;  2D10 A;  4MH0 E;  3ZO5 B;  4GGQ A;  2MWS B;  3HK0 A;  4NNJ B;  5IAA C;  2NBU A;  2G4S A;  3Q3F A;  3VH3 B;  3RCZ A;  2MP2 A;  2WX0 A;  3KYD D;  2IO0 B;  4K7W A;  2FNJ B;  2DAF A;  2ZVO A;  4GSW A;  4IG7 B;  5J2R A;  2LGD A;  4EUT A;  3RYT A;  1GC7 A;  1WX8 A;  2XEW A;  3VUY A;  5IA7 A;  3UQB A;  2K8H A;  1A5R A;  2JWZ A;  1GC6 A;  2MQJ A;  3PRM B;  2DZM A;  4MSM B;  5CHV C;  3B0A A;  5JH5 C;  3M3J A;  4JL9 A;  2AL6 A;  3D32 A;  1V49 A;  2G4D B;  4KZC A;  1Q0W B;  3ZVV A;  4HPL B;  2KQ7 A;  2BGF A;  2RD0 A;  4NJ7 A;  5DPS A;  3WAP A;  1AAR A;  2MBE A;  4IWQ A;  5FR6 A;  2MP2 B;  3EFU A;  4OVU A;  3TCA A;  4A3P A;  2EMT A;  3QX1 A;  4HXD A;  3DOW A;  3IG3 A;  4GMV A;  2C7H A;  4BKG A;  4FA6 A;  1GG3 A;  3VVW B;  5AZH A;  3JSV A;  5JZE B;  3VTW A;  1V6E A;  3DVG X;  4W9K A;  1WXM A;  2IO3 B;  1U4A A;  2BYV E;  2LI5 A;  1XT9 B;  2L05 A;  1GNU A;  3A1Q A;  1SGH A;  2R2O A;  2Y5B B;  4LJP B;  3LDZ E;  4IWO A;  2JZ3 B;  2M4N A;  5KHQ A;  3APF A;  4K81 A;  2KO3 A;  5KHO A;  4P7I A;  2KLC A;  2LRU A;  1UBQ A;  4GB9 A;  4MGZ E;  4NY0 A;  5G2N A;  2JT4 B;  4GN1 A;  2FCQ A;  4HK2 A;  4KZ0 A;  2CR5 A;  4W9I A;  2OJR A;  3ZW3 A;  3UIP B;  3KUD B;  4NPN A;  4RM8 A;  4WJO A;  2KC1 A;  4TUU A;  2FUH B;  2O2V A;  4GXB A;  2YVC A;  1QZE A;  2KWV B;  3L10 B;  2K8C A;  2N9P C;  2N9X A;  3ENE A;  2M1M A;  3O65 B;  2Z0D B;  2B3A A;  1P0R A;  1WGG A;  3V61 A;  4WQO B;  1Y8R C;  3A1Q B;  5D7G A;  2JRH A;  1J19 A;  3QC8 B;  3V62 A;  5E6P A;  3U7D A;  3VTU A;  1LQB A;  1YIW A;  1WE7 A;  2Z0E B;  1TBE A;  3ZNH B;  4NQK E;  2KTR A;  3DPD A;  1V2Y A;  2OOB B;  1K8R B;  3L17 A;  1WZ3 A;  2ZNV C;  5AEK B;  4B6W A;  1I35 A;  2CKH B;  1TGZ B;  3PGE A;  3VXW A;  3WAO A;  4ICU A;  4TQ0 A;  4F1S A;  2O2V B;  4GU2 A;  2AEH A;  3WA0 A;  2DX5 B;  3RZF A;  2MBO A;  1SE9 A;  3ZDT A;  4BBN F;  3ZUN A;  4RM9 A;  2J0M A;  2KNB A;  4JGH B;  1WMH B;  4II2 B;  3X23 A;  4II3 B;  5CHF A;  1RFA A;  4ANW A;  2NBW B;  3SHQ A;  3SD5 A;  1H4R A;  3A9K A;  2VRR B;  1TTN A;  2KMC A;  3GOE A;  3VH4 B;  2EMS A;  2JXX A;  3APC A;  4IW0 A;  1P3Q U;  4X57 B;  3NZS A;  3PHX B;  4M8M A;  4AOF A;  4MEM A;  4WAA A;  2I1J A;  1Z5S B;  2N1W A;  3EEC A;  2MRP A;  1ZKH A;  2D07 B;  3DBL I;  1VCB A;  3H7P A;  4ICV A;  4DXA B;  4AJY B;  2A4Z A;  3IFW B;  1UBI A;  1IYF A;  3NHE B;  3W1Y A;  1YQB A;  2LAS A;  3AU5 A;  4G11 A;  2LXA A;  1WX9 A;  3KUC B;  3KVF B;  3WAL A;  4ANV A;  2BKR B;  2DAJ A;  3CST A;  2KXJ A;  2FCM A;  2ZJD A;  2MLB A;  2UWQ A;  4HCN B;  1E7V A;  2D2Q A;  3RUL A;  3S2A A;  4FBJ B;  4BOS C;  3GZN I;  4BBN C;  2KX3 A;  2KFJ A;  3H7P B;  5DPT A;  2KJH B;  2L8J A;  3BY4 B;  4BFR A;  1RAX A;  3QWZ B;  3ZKJ C;  1ISN A;  4DWF A;  4XC2 A;  2R2Q A;  3A4R A;  3ZRC A;  4HDQ A;  4KIK A;  2ZCB A;  3NZU A;  3WAM A;  1WI0 A;  1YX5 B;  4K1R B;  2MBQ A;  4TKN A;  3A9J A;  3TL5 A;  2KHW B;  1X1M A;  2RSU A;  5GMV A;  3TJP A;  2CHZ A;  4MJS B;  2CHW A;  4ASW C;  1WJ6 A;  1ZGU B;  4DHZ B;  1P1A A;  2L00 B;  1C3T A;  5JHB A;  4HCP B;  2PPH A;  4M0W B;  2C60 A;  2N4F A;  3R66 C;  3M62 B;  5BO4 B;  4FUL A;  2BWE S;  1EO6 A;  1XQQ A;  4G0N B;  2DZK A;  3VFK A;  3H7S A;  5J17 A;  4FJZ A;  2KZR A;  1P9D U;  4FAD A;  4URK A;  3PSE B;  3PT2 B;  2BYF A;  1J8C A;  2GBR A;  1C1Y B;  3ZRF A;  2M8S A;  4E71 A;  1NI2 A;  1UEL A;  3HM3 A;  2GBJ A;  2V3S A;  3PLU A;  1SIF A;  1WZ0 A;  3UGB B;  1WXA A;  5L95 C;  1YD8 U;  4PYU A;  2KK8 A;  4TQ1 A;  2BYE A;  2RGF A;  2KD0 A;  2O6V A;  1L2N A;  1KLV A;  2NPT A;  2HD5 B;  1WIA A;  3VQI A;  2HE7 A;  2HJ8 A;  2KKC A;  3EC8 A;  3PLV A;  4LJO B;  2IZV B;  4DHZ E;  1HE8 A;  4GOC A;  3QK0 A;  1V80 A;  5CTR C;  3DBS A;  3ALB A;  4F7Z A;  1E8X A;  2JPH A;  3QQ8 B;  3VHT C; 
#chains in the Genus database with same CATH topology
 3QA8 A;  1D5Z C;  2WXM A;  3ML8 A;  3PZ7 A;  1L6U A;  2N7D A;  1OFF A;  4PS3 A;  2MX2 A;  5TR5 A;  2L3Z A;  2PMV A;  4XDD A;  2REX A;  1GPX A;  1JW9 D;  4GDK A;  5G55 A;  2ZPY A;  3SEB A;  2MJD A;  1V9J A;  1VZ7 A;  2OHF A;  2D3G A;  2J0K A;  2WWZ A;  5BMI A;  3AU4 A;  1QOG A;  3PZ8 A;  4JWS C;  1J0G A;  2QC8 A;  3AE5 B;  4WUR A;  3KUZ A;  4YT0 B;  4JE3 B;  1WY8 A;  2V9H A;  1V86 A;  3P2B A;  4A20 A;  4BKS D;  3AE4 B;  4MM3 A;  4C00 A;  1SJE D;  4IWP A;  3B08 A;  3ZQ4 A;  2FAZ A;  2L76 A;  2KWC A;  4DK5 A;  3NY5 A;  4C56 C;  1UF0 A;  1L6V A;  4JIO U;  2TSS A;  3M63 B;  2GOW A;  1FPY A;  3IAM 1;  1V1O A;  5IKC M;  4FHK A;  1FEH A;  4EEW A;  3W2D A;  4YL8 A;  1LGR A;  3EHV A;  1GUA B;  3LB8 C;  1F9J A;  3VR9 B;  3PHW B;  1UWX A;  1XD3 B;  1RLF A;  2JY6 A;  2KJ6 A;  3V05 A;  3RZW C;  2LXC A;  2KFK A;  1YMH E;  1E90 A;  3JW0 X;  4W9L A;  3TBL D;  1B9R A;  4KDI C;  1TZ1 A;  1JWM D;  2VZK B;  1S3S G;  4FN2 A;  4MSQ B;  2DYM A;  4AUQ C;  4MGY E;  4H2A A;  1LM8 B;  4D2K A;  2INN E;  1LO5 D;  1EU3 A;  4GIV A;  2RPV A;  4G50 A;  2ZPN A;  3R7R A;  3QAR A;  2KTF A;  1I4G A;  4KIK B;  4B95 A;  3P4P B;  1QF6 A;  2CJO A;  1OQY A;  3SFD B;  5E6O A;  1TKE A;  2HJ1 A;  4ZRI A;  2WXO A;  2MJE A;  4WH4 A;  2RPQ A;  3DVG Y;  1MG8 A;  2IPK D;  1ZDV A;  1TY0 A;  1V8C A;  3PTF C;  1TJE A;  2SEB D;  4G3X B;  2O6V B;  4Q2J A;  3AUL A;  4WAF A;  2WXG A;  3HIZ A;  3L54 A;  3R8B A;  3N30 A;  1YNT E;  5AZG A;  1G6J A;  2XBB C;  1V81 A;  4KSK C;  3IXS A;  1PUT A;  3K9P B;  2J53 A;  3AEE B;  2KMA A;  2QEJ C;  1WYW B;  4E3C A;  4GDL B;  4QAY A;  3UIO B;  1PGX A;  1WMH A;  4PYZ A;  3BVM A;  5AZF A;  1MVK A;  4EFO A;  3MJW A;  4CQN A;  3OJ3 A;  4XE0 A;  5G5G A;  3JYU A;  5L83 A;  4ZRP A;  1DOY A;  2PE6 B;  1D3Z A;  1ZOY B;  2ACZ B;  1ZP0 B;  3ETR A;  2W55 A;  1LFD A;  5D2M B;  3K9O B;  4FHJ A;  2FCS A;  1ZW7 A;  3R3M A;  3PS6 A;  2A5U A;  3V6C B;  1MHH E;  2M0X A;  2JYE A;  1YN5 A;  1KH0 A;  1TZO A;  4NZL B;  3NG0 A;  3W5U B;  1SJH D;  4RGM A;  1EWC A;  2ON8 A;  1L7Y A;  2KVR A;  3TEY A;  5HHD G;  1FIQ A;  2KDE B;  2KDF B;  1L4D B;  4I6N B;  1C4C A;  2LGS A;  3W1S C;  4EZL A;  2GBK A;  3AN1 A;  2K6D B;  4AWJ A;  3L13 A;  2PKO A;  3ML9 A;  4M0W A;  3Q6B A;  1N5W A;  4P1B C;  4ITK A;  1T0Q C;  2XNA C;  1CMX B;  4FJY A;  4A55 A;  1K53 A;  2QCZ A;  2W82 A;  4GGQ A;  5GXG B;  3HVZ A;  3RCZ A;  1N6Z A;  1T6B X;  2LGD A;  2M56 B;  4EUT A;  2JU6 X;  2XEW A;  5IA7 A;  2BTE A;  1A5R A;  3PRM B;  5H92 C;  5CHV C;  3M3J A;  4KZC A;  3ZVV A;  1K50 A;  2RD0 A;  4IWQ A;  5HFY A;  2MP2 B;  3EFU A;  4OVU A;  2EMT A;  2LJI A;  3AEA B;  4HXD A;  3IG3 A;  4FA6 A;  5BYR A;  4US8 A;  3U52 E;  3ZXR A;  1C4A A;  3JSV A;  5JZE B;  4W9K A;  2L83 A;  3DBR B;  2Y5B B;  1XO3 A;  2Y5P A;  2JZ3 B;  2M4N A;  3APF A;  1I4Q A;  2KO3 A;  5KHO A;  3R2T A;  2FCQ A;  4KZ0 A;  2CR5 A;  2OJR A;  3UIP B;  4NPN A;  4WJO A;  4RF0 A;  4TUU A;  2FUH B;  2O2V A;  1QOF A;  1QZE A;  3L10 B;  3Q8A A;  1P0R A;  3V61 A;  5D7G A;  2JRH A;  1HTQ A;  1J19 A;  3U7Z A;  3MC8 A;  3ZYY X;  1TBE A;  3ZNH B;  4JX1 C;  2WP9 B;  3AEC B;  2KAJ A;  1I35 A;  4TQ0 A;  3PGE A;  3WAO A;  3ZJU A;  1TYG B;  3WA0 A;  1QKZ A;  1SE9 A;  1AWD A;  1QOA A;  2KN4 A;  4C7Z A;  3TEX A;  3X23 A;  4II3 B;  5CHF A;  1RFA A;  2NBW B;  1H4R A;  3C19 A;  2PTL A;  4LNF A;  4X57 B;  1P3Q U;  2EKI A;  2FUG 1;  2Q5W D;  1YN4 A;  1XLP A;  3PHX B;  3MHZ A;  4WAA A;  2A4Z A;  1L0Y B;  3HVD A;  3AE8 B;  3NHE B;  2LAS A;  3L4P A;  3BK2 A;  4ANV A;  2BKR B;  2DAJ A;  3CST A;  2KXJ A;  1V97 A;  4HCN B;  4FBJ B;  3GZN I;  2WHI A;  5C2T B;  1N63 A;  3ZKJ C;  4XC2 A;  4YWG G;  4YSX B;  3NZU A;  3WAM A;  1WI0 A;  3HUI A;  4ASW C;  1WJ6 A;  1ZGU B;  5BYS A;  1C3T A;  1D6E C;  2WQY B;  3AV8 A;  2PPH A;  3SR6 A;  3M62 B;  5BO4 B;  3P42 A;  3NVZ A;  1N5X A;  3RN9 C;  4WWM A;  1P9D U;  3PSE B;  1JQ4 A;  1C1Y B;  2H89 B;  4E71 A;  1NI2 A;  2BW2 A;  2V3S A;  3PLU A;  2WXQ A;  1CQV A;  1WZ0 A;  1WXA A;  1JWU D;  4TQ1 A;  3EUB 2;  1TKG A;  2MJ3 A;  4UDU C;  2NPT A;  2HD5 B;  2HE7 A;  3PLV A;  4LJO B;  1JAL A;  5CTR C;  1E8X A;  3VHT C;  1T0S C;  5LNK 1;  3P4S B;  2L0T A;  1ZXI A;  1UH6 A;  1WGD A;  2WYQ A;  4LTU A;  4EE2 A;  4C4V B;  3DBL B;  3KYC D;  3CWI A;  2KQ4 X;  3A33 B;  1WX7 A;  4LK0 M;  2RR9 A;  3T8M A;  4A9A A;  3ZDM C;  1FNW A;  1DOI A;  4YTP B;  1WXQ A;  2WDT B;  1YX6 B;  3NZ3 A;  3AEB B;  4GLS C;  2BBC A;  3DWM A;  2OJW A;  5IP4 D;  2J7Q B;  2MEK A;  4DDG D;  3Q14 C;  3I5J C;  4K7U A;  4F8C B;  3N1Z C;  5JXV A;  2J42 A;  2ZZP B;  4MM3 B;  2V4I B;  2NR2 A;  3NUH B;  5HG2 A;  4CHK A;  4NAW A;  4JLC A;  5IN7 A;  2GBM A;  2NCN A;  2LD9 A;  3N1X C;  4FLH A;  3A9K B;  1E8Z A;  2XK5 A;  4KSL C;  4IM2 A;  4JQW C;  1T0Y A;  2C5L C;  4HLE A;  4NJC A;  3AB5 A;  2O6V D;  1MHX A;  2LMC A;  3IVF A;  3NVV A;  3Q8B A;  4XX5 A;  2HDE A;  4TSS A;  1UD7 A;  1NDD A;  4NJ6 A;  1TS5 A;  1Q5W B;  4AJW A;  1QIL A;  1JWB D;  3GE8 C;  1EF1 A;  2L32 A;  3APD A;  1WGR A;  1E6E B;  1L5P A;  1E8Y A;  2W3R A;  5E6J A;  4RGN A;  1S1Q B;  3TMP B;  3TSS A;  1IBX A;  5BYQ A;  2BS3 B;  3QIJ A;  2WU2 B;  1KLG D;  1RYJ A;  3R2I A;  4IOI E;  1LXD A;  4KDL B;  1RRB A;  1WJN A;  1I4R A;  2DZJ A;  1JWA D;  1VJK A;  1WJ4 A;  5DPR A;  1NEK B;  2WX1 A;  1XF5 L;  2ZCC A;  2K39 A;  2N7E A;  3N3K B;  4IM0 A;  4EOY A;  3A4S C;  2M19 A;  2JUO A;  3RUI B;  4DDI D;  1PQS A;  2ZNV B;  3I57 A;  5EDS A;  1GOZ A;  1R4N I;  2MA9 B;  1VZ8 A;  3AED B;  2BB5 A;  2KAN A;  3NOB A;  4TV3 A;  4E74 A;  3NJT A;  3PRZ A;  4DHJ D;  2WDV B;  2K6Q A;  2G3Q B;  2PJH A;  3GZN B;  1L0V B;  2AYO B;  3QAQ A;  4R3D A;  3RD2 A;  3BZD B;  3AE1 B;  1WSP A;  4M8N A;  3M95 A;  2INP E;  1NYR A;  1TS3 A;  2CU1 A;  3AE9 B;  1EUV B;  2YEP F;  4LNI A;  5CHW A;  1NYQ A;  1SSN A;  2BKF A;  3PZD A;  3B1L X;  2K1F A;  3DBR I;  3X0W A;  3CIR B;  2KWU B;  5D3I B;  1GJZ A;  2LVO A;  2UU7 A;  3MP9 A;  2KWD A;  1KM7 A;  1FXA A;  1Q1O A;  2H88 B;  4EZJ A;  2MSE D;  5HKH A;  1K52 A;  4A8X C;  2WXJ A;  2AWT A;  4LNK A;  1GB4 A;  4OVZ A;  3BWU D;  3N20 C;  4IM3 A;  4YXD B;  4W9J A;  3RT3 B;  3L16 A;  2WU5 B;  4IDI A;  3N32 A;  4MH8 A;  1WR1 A;  3VR8 B;  4RMA A;  3ONS A;  3IBE A;  1JRP A;  2NBU A;  3Q3F A;  3UI3 A;  2IO0 B;  4K7W A;  1ET9 A;  1XCT L;  5IOI A;  5J2R A;  4REZ A;  3RMK C;  1WX8 A;  3UQB A;  2K8H A;  1GC6 A;  2MQJ A;  2DZM A;  1C9F A;  3RNF C;  3B0A A;  1BXT A;  2JYT A;  2LFI A;  4JL9 A;  4LNO A;  4MT5 A;  5EE1 A;  1F0Z A;  1Q0W B;  1QOB A;  4HPL B;  1PFD A;  2KQ7 A;  2BGF A;  2PVO D;  4NJ7 A;  1AAR A;  1J7B A;  2WDR B;  5FR6 A;  4A3P A;  3QX1 A;  3DOW A;  5IO9 A;  1KRH A;  1GG3 A;  4JWU C;  1V6E A;  4OZB A;  2IO3 B;  4XDC A;  2L05 A;  3A1Q A;  2R2O A;  3LDZ E;  4JPS A;  2JXT A;  5KHQ A;  5G2N A;  1UBQ A;  4GN1 A;  3T3N A;  4W9I A;  3ZW3 A;  1TIF A;  2N9P C;  3O65 B;  4OW0 A;  1ZE3 D;  3W9C B;  1LQB A;  1YIW A;  5EE0 A;  4NQK E;  1ZXH A;  4N58 A;  3BK1 A;  2ONQ A;  2ZNV C;  4K3C A;  2CKH B;  4RGO S;  4ICU A;  2O2V B;  1XEE A;  4BBN F;  3RNG C;  3GP7 A;  3GB1 A;  4AS1 A;  1FNV A;  4J3O D;  3GOE A;  1TTN A;  3AH7 A;  2EMS A;  2PVG C;  4IW0 A;  4M8M A;  4MEM A;  3B2G A;  2KVZ A;  2V3P A;  2N1W A;  3DBL I;  1WGK A;  5EE9 A;  3NS1 A;  3W1Y A;  4G11 A;  2LXA A;  1WWT A;  3KUC B;  2B76 B;  4P1C C;  3RFZ B;  2L52 A;  2FCM A;  2ZJD A;  2MLB A;  2UWQ A;  3S2A A;  1E7V A;  3RUL A;  1R4N B;  1CJE A;  1KLU D;  5DPT A;  2KJH B;  2L8J A;  5FKA C;  1C76 A;  3QWZ B;  3Q8C A;  1FD6 A;  2DWQ A;  2R2Q A;  4HDQ A;  1M4V A;  4KIK A;  2MBQ A;  2CHZ A;  4MJS B;  4DHZ B;  2KT7 A;  3LYY A;  3NVY A;  3GE3 C;  3NVW A;  1KTK A;  2N4F A;  1N61 A;  2BWE S;  2FBW B;  1EO6 A;  1XQQ A;  2DZK A;  1QLB B;  4URK A;  3PT2 B;  2BYF A;  2QIL A;  3ZRF A;  3MFG A;  2IGD A;  1FRR A;  2KYW A;  5L95 C;  4PYU A;  2KK8 A;  2INC C;  2O6V A;  1L2N A;  1KLV A;  1WIA A;  2HJ8 A;  2KKC A;  3EC8 A;  2IZV B;  1HE8 A;  5T8I A;  2KMM A;  3ALB A;  3DBS A;  4L1B A;  1RFK A;  2V0G A;  2DYO A;  2K25 A;  3ZLZ A;  1TT5 B;  2IGH A;  3URY A;  2NPT B;  1EM7 A;  1FO4 A;  4WJN A;  1MJD A;  4XYC A;  3Q8E A;  4GDL A;  1FXI A;  3EFC A;  3DVN V;  3DHH C;  2KOX A;  4IUM B;  2CU3 A;  1V5O A;  3RNE C;  2ZEQ A;  5DCN A;  4FXC A;  2NS5 A;  2UYZ B;  4LNN A;  3RPF C;  2SAK A;  4A6Q A;  2LVP A;  2LHD A;  1DYQ A;  3ECI A;  3H6N A;  2AX5 A;  3RNC C;  2WLB A;  4BOZ B;  3OLM D;  3QCA A;  3E9S A;  3FIL A;  2JZP A;  1RWS A;  2HTH A;  3H9D A;  4KKJ A;  4CYE A;  1HZ5 A;  4YSY B;  2QHO A;  1EWY C;  3VRB B;  2KTR B;  4PT5 A;  2AL3 A;  2QDF A;  1NEN B;  1BT0 A;  5FK9 C;  1SE2 A;  3DBH I;  4AQ7 A;  4W9H A;  3MHS D;  1AN8 A;  2I2Y A;  4W9C A;  2DYB A;  1XXG A;  1HXY D;  1QQR A;  2WXR A;  3AE2 B;  3L0W B;  2L0F A;  4HRO A;  2FIF A;  4B9K A;  2NBV B;  2QIE B;  1IPG A;  2BQQ A;  3QHT A;  4NAW B;  1E7P B;  2QSD A;  1R7S A;  1PYW D;  5DPW A;  2GB1 A;  3CSF A;  2K3U A;  4WWP A;  3UQA A;  2JF5 A;  2WXI A;  3Q8F A;  2M17 A;  3C0R B;  4USA A;  2EKE C;  4HVB A;  3PV1 A;  4ZRJ A;  1XCQ L;  3PRE A;  4IKG A;  3NS8 A;  1OGW A;  5D94 A;  3A9J B;  4MDK E;  4YSZ B;  1P98 A;  4BZA A;  4ZOH C;  3R7Q A;  3VAW A;  3DHI C;  1E7U A;  2LZ6 A;  3P63 A;  2LGX A;  3AM9 A;  4LDT B;  3ZNZ B;  3HHM A;  5FR3 A;  3AXC A;  2V1Y A;  4HJK A;  4HPM B;  2LUE A;  3BVG A;  3GS2 A;  4MEL A;  2RDG A;  2E3T A;  2MHJ A;  1V1P B;  4LLG M;  3QJZ A;  2KDI A;  2LEK A;  1N60 A;  2J52 A;  3CMM B;  3WIM A;  1SF0 A;  3OAW A;  3U8Z A;  2PE9 A;  1WM3 A;  3ZTC A;  1WFY A;  2RDH A;  4GDK B;  4ANX A;  2VZK D;  1OQR A;  1HA5 A;  1YJ1 A;  3ZIM A;  2IY0 B;  2KLG A;  1WXS A;  1T3Q A;  2IYD B;  3V6E B;  1KJT A;  1E10 A;  4ARI A;  2CHX A;  1OTR B;  2JZZ A;  2YLM A;  3AI5 A;  4HPP A;  3WCQ A;  1VZ6 A;  5J18 A;  3JVZ X;  2KAC A;  1UGM A;  1SXT A;  3AE7 B;  2K8B A;  1B1Z A;  2LWP A;  3MTN B;  2DZI A;  4KVG B;  2LJ5 A;  4L23 A;  1WGY A;  4WWO A;  3DQV A;  2V4L A;  4XZ4 A;  3H1U A;  1N62 A;  4WJP A;  2E6X A;  3ABV B;  2J0J A;  3HRD D;  3T3O A;  1WH3 A;  2C7N B;  4OHJ A;  1CK1 A;  1EF5 A;  4K7S A;  3U30 A;  1HQR D;  4RNA A;  4KV2 A;  3KW5 B;  2WXL A;  2WXK A;  2JVC A;  2OED A;  3SDL C;  2MBH A;  4OVV A;  2Z59 B;  2KFK B;  3V3X A;  1WJU A;  4W9G A;  1TS4 A;  3HK0 A;  3O13 A;  4XGA B;  3VH3 B;  1VRA B;  2FNJ B;  2DAF A;  2ZVO A;  4IG7 B;  1DGJ A;  4ACF A;  1GC7 A;  3VUY A;  2JWZ A;  2K0P A;  1V49 A;  2G4D B;  2DBY A;  1F77 A;  1F1H A;  4HJG E;  5DPS A;  3DBH B;  1GB1 A;  4N6E B;  4HEA 1;  4GMV A;  3KLS X;  4C4V A;  2QJL A;  5AZH A;  3VTW A;  1AW7 A;  3DVG X;  4DXF A;  1WXM A;  3Q3M C;  2BYV E;  2BYT A;  1GNU A;  4LJP B;  4IWO A;  4N59 A;  4K81 A;  1GAQ B;  2GRI A;  2LRU A;  4MGZ E;  2JT4 B;  2BVC A;  3B2F A;  2FE8 A;  3KUD B;  3N1Y C;  2KC1 A;  1P7E A;  4PK1 A;  2K8C A;  2N9X A;  2B3A A;  1WGG A;  1Y8R C;  3A1Q B;  3QC8 B;  5E6P A;  3U7D A;  1BUI C;  4XWW A;  2PLP A;  3B9J A;  2Z0E B;  1C77 A;  4DQO C;  2ZW0 A;  2X38 A;  3I9V 1;  1F2R I;  2W3S A;  4B6W A;  1TGZ B;  3RI7 C;  3VXW A;  1E9M A;  2AEH A;  2DX5 B;  1SIJ A;  3RZF A;  2Z8L A;  3ZDT A;  2WS3 B;  2J0M A;  4JGH B;  1WMH B;  4II2 B;  2HTM E;  3KQ4 A;  1UNS A;  2AQ1 B;  3SD5 A;  3A9K A;  2KMC A;  2JXX A;  3EA6 A;  4XWT A;  3EEC A;  2MRP A;  3H7P A;  1VCB A;  4M01 A;  3RNB C;  4DXA B;  4AJY B;  1JWS D;  1UBI A;  1IYF A;  1YQB A;  4RFB A;  1ET6 A;  1T5X D;  1WX9 A;  3BVZ A;  3KVF B;  1HZ6 A;  4M00 A;  1D4B A;  1HEZ E;  5AUK A;  2VH2 A;  3IT6 B;  4BOS C;  4BBN C;  3BY4 B;  4BFR A;  1RAX A;  4DWF A;  3ZRC A;  4MAC A;  5MPO A;  1C4P A;  1YX5 B;  4K1R B;  4TKN A;  1X1M A;  2RSU A;  5GMV A;  2KDM A;  2CHW A;  1P1A A;  5JHB A;  3MJ5 A;  4HCP B;  1Y56 A;  4M0W B;  3R66 C;  5BMG A;  1JRO A;  4G0N B;  3H7S A;  4FJZ A;  1SBB B;  1J8C A;  1T0R C;  2BT6 A;  2EEL A;  1TY2 A;  2GBJ A;  4B0E A;  2LHE A;  1SIF A;  1NI3 A;  2N9K A;  3UGB B;  1YD8 U;  3Q69 A;  4S17 A;  2RGF A;  2K9X A;  4C80 A;  3VQI A;  4WIP A;  3W5V B;  1JML A;  4GOC A;  3QK0 A;  2JPH A;  4YTN B;  3SFE B;  1ENF A;  2IO2 B;  1OEY A;  1STE A;  4ZRK A;  2L7R A;  2WDQ B;  1ROE A;  4ZYN A;  2V3N A;  4I6L B;  1VLB A;  4EKU A;  2ZW1 A;  3IHP C;  4HDO A;  1E5W A;  2KDB A;  3MC9 A;  1I42 A;  1XLN A;  5D3D A;  4ZDV A;  1FFU A;  1CZP A;  3JSV B;  4ARC A;  4A90 A;  2BPS A;  1PDX A;  2DLB A;  4C7Y A;  4DBG A;  1L0X B;  3AE3 B;  2KC2 A;  2J4X A;  2FCN A;  1JRU A;  2Y3A A;  3I3T B;  3W1S A;  1E8W A;  2D3C A;  3VUW A;  3OG5 A;  4OZC A;  1NBF C;  3FAH A;  3SU8 X;  5HI1 A;  3ZTD A;  4EZK A;  3VTV A;  1Z2M A;  3ZNI D;  2LGI A;  1MFW A;  4KKI A;  5LXH A;  2ASQ A;  2IJ0 A;  1PGA A;  3DDC B;  3IAS 1;  3LJ3 A;  5C23 A;  2ZVN A;  3MC0 B;  1J7C A;  2IO1 B;  1MPE A;  2MCN B;  1Q10 A;  2RDB C;  3FIL B;  3TUO A;  1R4M I;  3UIN B;  1MI0 A;  3PVL A;  1C79 A;  3V60 A;  2JX5 A;  2D3B A;  3TIX A;  3RNA C;  3Q3O C;  2NMQ A;  3L08 A;  1TKY A;  4NQL B;  4YTM B;  3WAN A;  2XN9 C;  1WRD B;  2N1V A;  3OJ4 B;  1IP9 A;  4PS7 A;  1SB3 C;  4LDT D;  4DHJ B;  3Q2A C;  1D5M C;  2I1K A;  3AE6 B;  2BWF A;  3DVN U;  3U2S C;  4FJV B;  2VH1 A;  4BAX A;  4HWI B;  1KFY B;  4L2Y A;  1WGH A;  4CO7 A;  5C1Z A;  1QT9 A;  5BMH A;  1SE3 A;  1VD2 A;  2PEA A;  4ANU A;  2FID A;  3PRP B;  2C7M B;  3BIN A;  1D5X C;  1ACC A;  2G9H D;  1WE6 A;  1RM6 C;  3KH0 A;  2DHZ A;  2WXH A;  3TEW A;  2K5P A;  3ZJT A;  3VDZ A;  4IC7 B;  1WXV A;  2IY1 B;  4KGT A;  2C9W B;  4ZHO A;  4M02 A;  4W9D A;  5E6N A;  3T9L A;  2LRW A;  2M0A A;  2LUM A;  4WWN A;  2CS4 A;  1M94 A;  3J9C A;  1KOT A;  3DCG A;  1FNU A;  2GI9 A;  2JRI B;  1WR6 E;  3CF6 E;  2MBB B;  4N9F 4;  4I6P A;  2LGY A;  2DEN B;  2D3A A;  4W9E A;  3HM6 X;  5LLI A;  1H8C A;  3ZJV A;  2KQS A;  4WJQ A;  4AP4 C;  4P16 A;  4MGK E;  4HRS A;  1XLO A;  2BB6 A;  4KGR A;  2N7J A;  1ZPS A;  4LCD E;  3OWE B;  2KN5 A;  4A3O A;  5CX3 A;  2D11 A;  5AUI A;  2WXN A;  3FKY A;  4J6I A;  2IND C;  5D6J B;  2BF8 B;  3Q3J A;  5EE3 A;  1IGD A;  1FM0 D;  4PS8 A;  1FCL A;  5LXI B;  2PW9 A;  1UZX B;  1FXT B;  2KJR A;  2YEP B;  2N0S B;  2LVQ A;  2GBN A;  3H8H A;  4MGI E;  1VR9 A;  2MW5 A;  1DOX A;  2PIA A;  2AQ3 B;  2IGG A;  2N9E B;  4W9F A;  5JHA A;  3ZNG C;  2GMI C;  3UF8 A;  2BS2 B;  2D5G A;  3FC4 A;  1XLQ A;  4BKT A;  2IDY A;  3U4E G;  2G1E A;  2L1A A;  2MH7 A;  2AQ2 B;  2G45 B;  5G5H A;  4BVU C;  2R61 A;  1OEY J;  3BYT B;  5I4D A;  2WNM A;  4S0R A;  4BKS A;  1BML C;  1WM2 A;  3AEG B;  1E0Z A;  4MJS A;  2I38 A;  2XK5 B;  4DXG A;  2IBI B;  3VUX A;  2W9N A;  1I4X A;  1WF9 A;  1YN3 A;  1WYG A;  2KX0 A;  1SE4 A;  3VRA B;  2ICI A;  2NVU I;  3PPA A;  1K51 A;  1V5T A;  2DNF A;  1FFV A;  2K22 A;  2D10 A;  4MH0 E;  3ZO5 B;  4NNJ B;  2MWS B;  5IAA C;  3EGR A;  2G4S A;  1IUE A;  1YJJ A;  2MP2 A;  2WX0 A;  3KYD D;  4GSW A;  2Y5C A;  4RGT A;  3Q3N C;  2X8X X;  3RYT A;  1P7F A;  3IT4 B;  1I4P A;  2CJN A;  1NVI D;  1YJI A;  4MSM B;  2NTT A;  5JH5 C;  2AL6 A;  3D32 A;  1IBX B;  4TMA B;  4P6V F;  1PGB A;  3WAP A;  2MBE A;  3TCA A;  3KWV A;  4BKG A;  2C7H A;  4O1N A;  1R4M B;  3VVW B;  4HKZ E;  1C78 A;  3LXF A;  1U4A A;  2LI5 A;  1XT9 B;  1SGH A;  5TSS A;  1TS2 A;  1F2R C;  3P4Q B;  4P7I A;  2KLC A;  4GB9 A;  4NY0 A;  1J7A A;  1JCK B;  3DWG C;  4HK2 A;  3BII D;  4ZHP A;  1OQQ A;  2NTS A;  4RM8 A;  3TEZ A;  4GXB A;  2YVC A;  2KWV B;  4RH6 A;  3ENE A;  2M1M A;  2JWU A;  2Z0D B;  1FCC C;  5C3J B;  4WQO B;  3AEF B;  3V62 A;  3ZXV A;  1FRD A;  3VTU A;  1F52 A;  1WE7 A;  1YQ3 B;  1A70 A;  1EU4 A;  1AYF A;  2KTR A;  4US9 A;  3DPD A;  1V2Y A;  2OOB B;  1K8R B;  3L17 A;  1WZ3 A;  2WGS A;  5AEK B;  3N9Y C;  4F1S A;  1YOV B;  4GU2 A;  2MBO A;  3P1M A;  3ZUN A;  4RM9 A;  2KNB A;  1UGJ A;  5H8Y E;  1L4Z B;  3P4R B;  2W54 A;  4ANW A;  3SHQ A;  2VRR B;  3VH4 B;  3APC A;  3NZS A;  4AOF A;  1VDV A;  2I1J A;  1Z5S B;  1ZKH A;  2D07 B;  1SEB D;  2RMM A;  2WXF A;  4ICV A;  4ZRQ A;  3IFW B;  1HTO A;  4ZYS A;  3AU5 A;  4K3B A;  3E56 A;  3WAL A;  2QMT A;  1KF6 B;  3I63 C;  1IGC A;  3C8Y A;  2D2Q A;  4HKQ A;  3ZGZ A;  1MG4 A;  2KFJ A;  2KX3 A;  3H7P B;  2JQR B;  1ISN A;  4KX6 B;  3A4R A;  1UWM A;  1ZDX A;  1I7H A;  2ZCB A;  4RF1 A;  3NRZ A;  3A9J A;  4WQM A;  3TL5 A;  2KHW B;  3AMZ A;  3TJP A;  2L00 B;  2BS4 B;  3DHG C;  2C60 A;  2N9L A;  1WRI A;  2WXP A;  4FUL A;  1I4H A;  3VFK A;  5J17 A;  2KZR A;  4FAD A;  2GBR A;  4NAM A;  4OZA A;  2M8S A;  3PO0 A;  2JSV X;  3KWL A;  1ESF A;  3HM3 A;  1UEL A;  4KGS A;  1FMA D;  2BYE A;  2GLS A;  2KD0 A;  4DHZ E;  1YQ4 B;  1V80 A;  1UUP A;  4B0M A;  4F7Z A;  1ZUD 2;  3QQ8 B;  1V1P A;  3BYY B;  4RCO A; 
#chains in the Genus database with same CATH homology
 2IO2 B;  1OEY A;  3QA8 A;  2L7R A;  4ZRK A;  2DYO A;  2K25 A;  4ZYN A;  3ML8 A;  3ZLZ A;  4I6L B;  2L0T A;  2N7D A;  4PS3 A;  4EKU A;  2MX2 A;  3IHP C;  4HDO A;  1E5W A;  1UH6 A;  2KDB A;  2NPT B;  5TR5 A;  1WGD A;  2L3Z A;  2REX A;  2WYQ A;  1I42 A;  4GDK A;  5G55 A;  4ZDV A;  4WJN A;  2ZPY A;  3KYC D;  3JSV B;  4GDL A;  3A33 B;  1WX7 A;  1V9J A;  2RR9 A;  2BPS A;  3DVN V;  3T8M A;  2D3G A;  2J0K A;  3ZDM C;  2WWZ A;  2KOX A;  4IUM B;  4DBG A;  1V5O A;  2ZEQ A;  2KC2 A;  3AU4 A;  5DCN A;  2NS5 A;  2FCN A;  2UYZ B;  1J0G A;  1JRU A;  2LVP A;  2WDT B;  1YX6 B;  3I3T B;  3KUZ A;  3W1S A;  1E8W A;  3ECI A;  3H6N A;  1WY8 A;  3P2B A;  1V86 A;  4A20 A;  3VUW A;  4BKS D;  4MM3 A;  1NBF C;  4BOZ B;  3OLM D;  3QCA A;  3SU8 X;  4IWP A;  3B08 A;  2J7Q B;  2HTH A;  3ZTD A;  2FAZ A;  3H9D A;  4EZK A;  3VTV A;  1Z2M A;  3ZNI D;  2L76 A;  2KWC A;  4DK5 A;  4DDG D;  4CYE A;  3NY5 A;  5LXH A;  4JIO U;  4K7U A;  2QHO A;  2KTR B;  3M63 B;  2AL3 A;  2ASQ A;  2GOW A;  3DDC B;  1BT0 A;  4F8C B;  3LJ3 A;  5C23 A;  2ZVN A;  2IO1 B;  3DBH I;  4FHK A;  2ZZP B;  4W9H A;  3MHS D;  2MCN B;  2NR2 A;  4EEW A;  1R4M I;  3UIN B;  4CHK A;  4NAW A;  4JLC A;  3PVL A;  4W9C A;  4YL8 A;  2GBM A;  2NCN A;  2LD9 A;  3V60 A;  3EHV A;  1GUA B;  2DYB A;  3TIX A;  4FLH A;  3L08 A;  4NQL B;  3A9K B;  1E8Z A;  1F9J A;  3PHW B;  3L0W B;  2L0F A;  3WAN A;  2XK5 A;  4KSL C;  1WRD B;  2N1V A;  4IM2 A;  3OJ4 B;  4JQW C;  1XD3 B;  1IP9 A;  2FIF A;  1RLF A;  4PS7 A;  4B9K A;  1T0Y A;  2C5L C;  2JY6 A;  2KJ6 A;  2NBV B;  4HLE A;  4LDT D;  4DHJ B;  2I1K A;  1IPG A;  3QHT A;  4NAW B;  2O6V D;  3RZW C;  2BWF A;  2LXC A;  2KFK A;  3IVF A;  3DVN U;  5DPW A;  1E90 A;  4XX5 A;  3JW0 X;  4W9L A;  3TBL D;  4FJV B;  3CSF A;  1UD7 A;  1TZ1 A;  1NDD A;  4FN2 A;  4HWI B;  1S3S G;  4KDI C;  4MSQ B;  1WGH A;  2DYM A;  4NJ6 A;  4WWP A;  4MGY E;  4AUQ C;  4CO7 A;  3UQA A;  5C1Z A;  1Q5W B;  2JF5 A;  4AJW A;  1LM8 B;  2M17 A;  4GIV A;  1EF1 A;  1VD2 A;  2PEA A;  3APD A;  1WGR A;  3C0R B;  4G50 A;  4ANU A;  2FID A;  3PRP B;  2ZPN A;  2C7M B;  2EKE C;  3BIN A;  4HVB A;  3PV1 A;  3QAR A;  4ZRJ A;  3KH0 A;  1WE6 A;  3R7R A;  1E8Y A;  2KTF A;  3PRE A;  4KIK B;  2DHZ A;  4B95 A;  3NS8 A;  1OGW A;  3VDZ A;  4IC7 B;  5D94 A;  1S1Q B;  1WXV A;  3A9J B;  3TMP B;  2IY1 B;  1OQY A;  2C9W B;  4MDK E;  3QIJ A;  1P98 A;  5E6O A;  4W9D A;  5E6N A;  4ZRI A;  3T9L A;  2LRW A;  1LXD A;  4KDL B;  2RPQ A;  1RRB A;  2CS4 A;  4WWN A;  1WJN A;  3R7Q A;  3DVG Y;  1M94 A;  2DZJ A;  3VAW A;  1KOT A;  1MG8 A;  3DCG A;  1WJ4 A;  5DPR A;  1E7U A;  2LZ6 A;  2WX1 A;  2ZCC A;  2K39 A;  2JRI B;  2LGX A;  2N7E A;  4LDT B;  3PTF C;  3N3K B;  3ZNZ B;  4G3X B;  4IM0 A;  3HHM A;  4EOY A;  1WR6 E;  2O6V B;  3CF6 E;  3A4S C;  2MBB B;  3AUL A;  3AXC A;  2V1Y A;  4HJK A;  4N9F 4;  4I6P A;  2JUO A;  3HIZ A;  2LGY A;  2DEN B;  3L54 A;  3RUI B;  4DDI D;  1PQS A;  4W9E A;  4HPM B;  2LUE A;  3HM6 X;  3N30 A;  2ZNV B;  5LLI A;  5EDS A;  1H8C A;  1R4N I;  2MA9 B;  4MEL A;  5AZG A;  2KQS A;  2KAN A;  3NOB A;  4TV3 A;  2XBB C;  1G6J A;  4WJQ A;  4AP4 C;  3QJZ A;  4E74 A;  1V81 A;  2KDI A;  4MGK E;  3PRZ A;  3CMM B;  3WIM A;  4DHJ D;  4KSK C;  4LCD E;  2K6Q A;  3OAW A;  3U8Z A;  2KN5 A;  2G3Q B;  1WM3 A;  2PE9 A;  2PJH A;  3ZTC A;  1WFY A;  3K9P B;  5CX3 A;  4A3O A;  2D11 A;  2KMA A;  4GDK B;  4ANX A;  1WYW B;  4E3C A;  2AYO B;  3QAQ A;  4GDL B;  3RD2 A;  1YJ1 A;  3UIO B;  3ZIM A;  1WMH A;  4PYZ A;  2IY0 B;  2KLG A;  4M8N A;  1WXS A;  3M95 A;  4J6I A;  5D6J B;  2IYD B;  5AZF A;  2BF8 B;  3Q3J A;  3V6E B;  1KJT A;  4EFO A;  3MJW A;  4PS8 A;  3OJ3 A;  2CHX A;  3JYU A;  5L83 A;  1OTR B;  2JZZ A;  2CU1 A;  2YLM A;  2PE6 B;  5LXI B;  1D3Z A;  1EUV B;  3AI5 A;  1FXT B;  1UZX B;  2KJR A;  5CHW A;  1LFD A;  5J18 A;  5D2M B;  2BKF A;  2LVQ A;  3JVZ X;  2GBN A;  3K9O B;  3PZD A;  4FHJ A;  4MGI E;  3B1L X;  2FCS A;  2MW5 A;  1UGM A;  1ZW7 A;  3R3M A;  2K1F A;  2A5U A;  2N9E B;  3DBR I;  3PS6 A;  4W9F A;  2K8B A;  2LWP A;  5JHA A;  3X0W A;  3MTN B;  3ZNG C;  2GMI C;  2KWU B;  3UF8 A;  2M0X A;  2DZI A;  3V6C B;  4KVG B;  2LJ5 A;  4WWO A;  1WGY A;  1GJZ A;  4BKT A;  3DQV A;  2V4L A;  2LVO A;  4XZ4 A;  1KM7 A;  3H1U A;  2G45 B;  1Q1O A;  4EZJ A;  4BVU C;  2MSE D;  4WJP A;  5HKH A;  1L7Y A;  2J0J A;  1OEY J;  2KVR A;  1WH3 A;  2AWT A;  2KDE B;  2KDF B;  4I6N B;  2C7N B;  4BKS A;  3W1S C;  4EZL A;  2GBK A;  1WM2 A;  4MJS A;  2K6D B;  1EF5 A;  2XK5 B;  4K7S A;  4IM3 A;  4AWJ A;  2IBI B;  3L13 A;  3U30 A;  3VUX A;  2W9N A;  1WF9 A;  3ML9 A;  4W9J A;  3RT3 B;  3L16 A;  2KX0 A;  3N32 A;  4KV2 A;  2NVU I;  1WR1 A;  3PPA A;  1CMX B;  3KW5 B;  1V5T A;  4FJY A;  2JVC A;  4RMA A;  3SDL C;  2MBH A;  4OVV A;  2Z59 B;  2KFK B;  3ONS A;  3IBE A;  1WJU A;  4W9G A;  2D10 A;  4MH0 E;  3ZO5 B;  4GGQ A;  2MWS B;  3HK0 A;  4NNJ B;  5IAA C;  2NBU A;  2G4S A;  3Q3F A;  3VH3 B;  3RCZ A;  2MP2 A;  2WX0 A;  3KYD D;  2IO0 B;  4K7W A;  2FNJ B;  2DAF A;  2ZVO A;  4GSW A;  4IG7 B;  5J2R A;  2LGD A;  4EUT A;  3RYT A;  1GC7 A;  1WX8 A;  2XEW A;  3VUY A;  5IA7 A;  3UQB A;  2K8H A;  1A5R A;  2JWZ A;  1GC6 A;  2MQJ A;  3PRM B;  2DZM A;  4MSM B;  5CHV C;  3B0A A;  5JH5 C;  3M3J A;  4JL9 A;  2AL6 A;  3D32 A;  1V49 A;  2G4D B;  4KZC A;  1Q0W B;  3ZVV A;  4HPL B;  2KQ7 A;  2BGF A;  2RD0 A;  4NJ7 A;  5DPS A;  3WAP A;  1AAR A;  2MBE A;  4IWQ A;  5FR6 A;  2MP2 B;  3EFU A;  4OVU A;  3TCA A;  4A3P A;  2EMT A;  3QX1 A;  4HXD A;  3DOW A;  3IG3 A;  4GMV A;  2C7H A;  4BKG A;  4FA6 A;  1GG3 A;  3VVW B;  5AZH A;  3JSV A;  5JZE B;  3VTW A;  1V6E A;  3DVG X;  4W9K A;  1WXM A;  2IO3 B;  1U4A A;  2BYV E;  2LI5 A;  1XT9 B;  2L05 A;  1GNU A;  3A1Q A;  1SGH A;  2R2O A;  2Y5B B;  4LJP B;  3LDZ E;  4IWO A;  2JZ3 B;  2M4N A;  5KHQ A;  3APF A;  4K81 A;  2KO3 A;  5KHO A;  4P7I A;  2KLC A;  2LRU A;  1UBQ A;  4GB9 A;  4MGZ E;  4NY0 A;  5G2N A;  2JT4 B;  4GN1 A;  2FCQ A;  4HK2 A;  4KZ0 A;  2CR5 A;  4W9I A;  2OJR A;  3ZW3 A;  3UIP B;  3KUD B;  4NPN A;  4RM8 A;  4WJO A;  2KC1 A;  4TUU A;  2FUH B;  2O2V A;  4GXB A;  2YVC A;  1QZE A;  2KWV B;  3L10 B;  2K8C A;  2N9P C;  2N9X A;  3ENE A;  2M1M A;  3O65 B;  2Z0D B;  2B3A A;  1P0R A;  1WGG A;  3V61 A;  4WQO B;  1Y8R C;  3A1Q B;  5D7G A;  2JRH A;  1J19 A;  3QC8 B;  3V62 A;  5E6P A;  3U7D A;  3VTU A;  1LQB A;  1YIW A;  1WE7 A;  2Z0E B;  1TBE A;  3ZNH B;  4NQK E;  2KTR A;  3DPD A;  1V2Y A;  2OOB B;  1K8R B;  3L17 A;  1WZ3 A;  2ZNV C;  5AEK B;  4B6W A;  1I35 A;  2CKH B;  1TGZ B;  3PGE A;  3VXW A;  3WAO A;  4ICU A;  4TQ0 A;  4F1S A;  2O2V B;  4GU2 A;  2AEH A;  3WA0 A;  2DX5 B;  3RZF A;  2MBO A;  1SE9 A;  3ZDT A;  4BBN F;  3ZUN A;  4RM9 A;  2J0M A;  2KNB A;  4JGH B;  1WMH B;  4II2 B;  3X23 A;  4II3 B;  5CHF A;  1RFA A;  4ANW A;  2NBW B;  3SHQ A;  3SD5 A;  1H4R A;  3A9K A;  2VRR B;  1TTN A;  2KMC A;  3GOE A;  3VH4 B;  2EMS A;  2JXX A;  3APC A;  4IW0 A;  1P3Q U;  4X57 B;  3NZS A;  3PHX B;  4M8M A;  4AOF A;  4MEM A;  4WAA A;  2I1J A;  1Z5S B;  2N1W A;  3EEC A;  2MRP A;  1ZKH A;  2D07 B;  3DBL I;  1VCB A;  3H7P A;  4ICV A;  4DXA B;  4AJY B;  2A4Z A;  3IFW B;  1UBI A;  1IYF A;  3NHE B;  3W1Y A;  1YQB A;  2LAS A;  3AU5 A;  4G11 A;  2LXA A;  1WX9 A;  3KUC B;  3KVF B;  3WAL A;  4ANV A;  2BKR B;  2DAJ A;  3CST A;  2KXJ A;  2FCM A;  2ZJD A;  2MLB A;  2UWQ A;  4HCN B;  1E7V A;  2D2Q A;  3RUL A;  3S2A A;  4FBJ B;  4BOS C;  3GZN I;  4BBN C;  2KX3 A;  2KFJ A;  3H7P B;  5DPT A;  2KJH B;  2L8J A;  3BY4 B;  4BFR A;  1RAX A;  3QWZ B;  3ZKJ C;  1ISN A;  4DWF A;  4XC2 A;  2R2Q A;  3A4R A;  3ZRC A;  4HDQ A;  4KIK A;  2ZCB A;  3NZU A;  3WAM A;  1WI0 A;  1YX5 B;  4K1R B;  2MBQ A;  4TKN A;  3A9J A;  3TL5 A;  2KHW B;  1X1M A;  2RSU A;  5GMV A;  3TJP A;  2CHZ A;  4MJS B;  2CHW A;  4ASW C;  1WJ6 A;  1ZGU B;  4DHZ B;  1P1A A;  2L00 B;  1C3T A;  5JHB A;  4HCP B;  2PPH A;  4M0W B;  2C60 A;  2N4F A;  3R66 C;  3M62 B;  5BO4 B;  4FUL A;  2BWE S;  1EO6 A;  1XQQ A;  4G0N B;  2DZK A;  3VFK A;  3H7S A;  5J17 A;  4FJZ A;  2KZR A;  1P9D U;  4FAD A;  4URK A;  3PSE B;  3PT2 B;  2BYF A;  1J8C A;  2GBR A;  1C1Y B;  3ZRF A;  2M8S A;  4E71 A;  1NI2 A;  1UEL A;  3HM3 A;  2GBJ A;  2V3S A;  3PLU A;  1SIF A;  1WZ0 A;  3UGB B;  1WXA A;  5L95 C;  1YD8 U;  4PYU A;  2KK8 A;  4TQ1 A;  2BYE A;  2RGF A;  2KD0 A;  2O6V A;  1L2N A;  1KLV A;  2NPT A;  2HD5 B;  1WIA A;  3VQI A;  2HE7 A;  2HJ8 A;  2KKC A;  3EC8 A;  3PLV A;  4LJO B;  2IZV B;  4DHZ E;  1HE8 A;  4GOC A;  3QK0 A;  1V80 A;  5CTR C;  3DBS A;  3ALB A;  4F7Z A;  1E8X A;  2JPH A;  3QQ8 B;  3VHT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...