4FJVB

Crystal structure of human otubain2 and ubiquitin complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
DVPDYAHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin thioesterase OTUB2
total genus 20
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4fjvB00
1P1AA 4W9KA 4HVBA 4NY0A 1WR1A 3AI5A 2CU1A 4B95A 3KYCD 2C7HA 2WX1A 4JIOU 1EUVB 2NCNA 1GC6A 3GZNI 2IO2B 2CR5A 4MEMA 1FXTB 5DPWA 4GMVA 3JSVB 1ZW7A 2ZNVB 2DX5B 3VDZA 4OVVA 2LXAA 2KX3A 3M62B 3OLMD 2GBKA 3M3JA 3O65B 1GJZA 1F9JA 2R2QA 1WMHA 1V81A 2RGFA 3S2AA 3ZNGC 1WFYA 1WE6A 3A9JA 2MW5A 1KLVA 2KMAA 2MBQA 1KM7A 3VAWA 1E8WA 3PRPB 3ZUNA 2XEWA 2DZKA 3AXCA 4G50A 3PS6A 2WDTB 1D3ZA 2YVCA 4HPLB 4GIVA 1I35A 2N1VA 2LRUA 1GC7A 3A4SC 3UIPB 4ICUA 2BKFA 4NNJB 2FCQA 2LVPA 3DVGX 4ICVA 4FLHA 1VCBA 4MSQB 2C7MB 3VUWA 2MCNB 2N1WA 5D7GA 2L0TA 4GN1A 1ZKHA 2PJHA 2DENB 5C1ZA 2KKCA 2KO3A 3JSVA 2Z59B 3K9OB 3ZLZA 5EDSA 4IG7B 5D2MB 3V61A 4A3PA 1E5WA 2MBEA 2K1FA 4I6PA 5AZGA 2KOXA 1UELA 3ENEA 2DAFA 1GUAB 3L13A 3VTVA 4HK2A 2FIFA 3RT3B 2KQSA 1P9DU 2EKEC 3AULA 5J17A 5JH5C 4DDID 5JZEB 3DBHI 2KLCA 2K25A 1E8YA 2FIDA 4W9HA 4II2B 3PSEB 4IC7B 1C3TA 2BYEA 2LXCA 4NPNA 2KJ6A 4CHKA 2KQ7A 3DBRI 3TMPB 3L16A 4HDQA 2KN5A 4IWQA 3OJ3A 4MM3A 1SE9A 4G0NB 2KWUB 3VHTC 1IYFA 2D10A 2DZJA 2KXJA 2KK8A 2C60A 2G4DB 2PPHA 1WJ4A 4KZ0A 3V62A 4LDTB 2FCNA 4AJWA 3EECA 2YLMA 1WGGA 3M95A 5E6PA 2GMIC 4K7UA 4XX5A 5J18A 4MGKE 4PYZA 2KHWB 1LM8B 5D94A 3ZVVA 2IY0B 5D6JB 4BFRA 2NBWB 4EKUA 4F1SA 1UZXB 2K39A 3A4RA 3RZWC 3N32A 2GBMA 4HWIB 2KDBA 4LJOB 5CHFA 1UGMA 3BINA 5DPTA 3PRMB 4HJKA 3ZRFA 3V6CB 1J0GA 3VFKA 2REXA 3KUDB 4PYUA 4BOSC 3QK0A 2MP2B 4WWOA 1T0YA 4AP4C 2IY1B 3UF8A 1S1QB 2KANA 3LJ3A 2LGYA 4N9F4 4MGYE 1KOTA 4FADA 4RM8A 4A20A 1OGWA 1UD7A 3DQVA 4ZDVA 2NPTB 2UYZB 3QC8B 4II3B 2HE7A 4HXDA 2CHZA 4NJ7A 3PTFC 4X57B 2O6VA 2ZEQA 3H9DA 3PGEA 5LXIB 2L05A 3A9KA 3H7SA 2KTRB 3HM3A 4ZRJA 3ZDTA 4GGQA 3B0AA 4KIKB 3W1SA 4IM0A 3UIOB 4GDLA 1WXAA 3ZRCA 1J8CA 1WZ3A 3TIXA 2WWZA 2J0KA 3KH0A 1WM3A 3ZDMC 4I6NB 2FCMA 5DCNA 4XC2A 4K7SA 2XK5B 4TQ1A 3AU5A 1JRUA 1Q1OA 2XBBC 3OJ4B 2LVOA 4ASWC 1WYWB 2AL3A 2BWES 2L3ZA 2MX2A 3MTNB 4FA6A 2M4NA 2MP2A 1IP9A 4LJPB 3ZKJC 3R3MA 5L83A 4NJ6A 2DYMA 3EHVA 1E7VA 2N9EB 5L95C 1XD3B 1UBIA 3ML8A 2L00B 4NQLB 4XZ4A 4HDOA 4TV3A 1WF9A 3T9LA 5G55A 4DHJD 3M63B 4BKSA 1V80A 3PV1A 3RCZA 3TBLD 2JWZA 3PVLA 2NR2A 2NVUI 2HTHA 2B3AA 1TZ1A 2UWQA 2QHOA 2J0JA 4WWPA 2RPQA 2V1YA 4K7WA 4MDKE 1YD8U 2LI5A 4GB9A 1M94A 3AU4A 2C9WB 2KX0A 3W1SC 4G11A 3IFWB 1LXDA 5C23A 1TGZB 3QX1A 2O6VD 1GNUA 2KZRA 1Z5SB 4CYEA 1K8RB 2KDEB 3APDA 1RLFA 4EFOA 4HPMB 3L10B 5IA7A 4AWJA 2EMSA 3QHTA 2NPTA 1L7YA 1WGYA 2WX0A 3V6EB 3ZNHB 3HM6X 3SD5A 2CHWA 2NBVB 2DZMA 2GBNA 2KJHB 2L7RA 4E71A 3QARA 2JUOA 3QJZA 3DDCB 1WX7A 2VRRB 2IO0B 4EZJA 3VTUA 1WI0A 4W9FA 3TCAA 3U30A 4DHJB 2BKRB 2ASQA 2DZIA 2ZNVC 2N7DA 2ZVNA 4IM3A 1P3QU 2I1JA 3VTWA 3A9JB 4LDTD 1R4NI 5HKHA 4IWPA 2MBOA 3VQIA 4GDKB 1V2YA 4GU2A 3VXWA 4GDKA 2BPSA 1L2NA 3Q3FA 4BKTA 2DHZA 3QIJA 4G3XB 2D3GA 3IVFA 2BGFA 1TTNA 2FCSA 3A1QB 1AARA 2JZZA 4JL9A 4WJQA 3ML9A 4EEWA 3CMMB 5IAAC 2J7QB 4JGHB 1UBQA 5G2NA 1Q5WB 3KUZA 4MGZE 2M17A 2KTFA 5BO4B 4A3OA 1V49A 2DAJA 3UQAA 1X1MA 2C5LC 3UINB 1Y8RC 1OEYA 1Z2MA 2D2QA 3U7DA 2N4FA 3NHEB 4IM2A 3V60A 4AJYB 1HE8A 1WR6E 1WMHB 2K6DB 4W9LA 2K8CA 3NZSA 3RD2A 4AOFA 4EZKA 4PS7A 3RULA 2IO3B 2O2VB 2BWFA 2JRIB 1OEYJ 2LJ5A 3ONSA 3WANA 2DYOA 3PRZA 1TBEA 3DCGA 1E8XA 4IWOA 1WGDA 3ZNZB 2KC2A 4B9KA 1E7UA 4FULA 3APFA 3QWZB 2MBBB 2MWSB 3Q3JA 4NAWB 4M8MA 1XQQA 1GG3A 5JHAA 2XK5A 2BF8B 4FJYA 3W1YA 1H4RA 3HHMA 3QA8A 2KC1A 1YQBA 5DPRA 4K1RB 2LVQA 1WXVA 4P7IA 2OOBB 4ANVA 3IBEA 1WX9A 1YJ1A 1EO6A 3DPDA 3KYDD 1PQSA 2L76A 1LFDA 3WAPA 1SGHA 2N9XA 1WE7A 4KSLC 4RM9A 3UQBA 3P2BA 3NOBA 2CS4A 4WAAA 1IPGA 2JPHA 2LGDA 5E6NA 2A4ZA 3VUYA 4DHZB 5AEKB 2OJRA 1SIFA 1WZ0A 2JT4B 1YX6B 1WGHA 1YIWA 2GBRA 2Z0EB 2PE9A 2DYBA 3OAWA 2ZCBA 3I3TB 2K6QA 3EFUA 3EC8A 4HLEA 2KDIA 2HJ8A 4ANUA 2JF5A 3ZTDA 3H1UA 2M8SA 4IUMB 4KZCA 4LCDE 4J6IA 3L54A 1E8ZA 2D07B 2BYVE 4DHZE 1WGRA 4ZYNA 5CHWA 2NS5A 2CHXA 3KUCB 3PLUA 2WYQA 4EOYA 1E90A 2MSED 4FBJB 1ISNA 2R2OA 2RD0A 4JQWC 1S3SG 2PEAA 1UH6A 4KVGB 1LQBA 4PS3A 1WIAA 3A33B 2KMCA 2N9PC 4WQOB 5E6OA 4RMAA 2NBUA 1C1YB 2GBJA 2LZ6A 1RRBA 1YX5B 2AL6A 2M0XA 3GOEA 1P98A 3NY5A 3RUIB 1XT9B 4BOZB 4AUQC 4E3CA 1WXSA 3L0WB 4KIKA 2JZ3B 2KWVB 3QQ8B 1EF1A 4HCPB 4EUTA 3PHXB 2BYFA 5J2RA 3PLVA 3SHQA 3X0WA 2AEHA 4NQKE 1J19A 2IYDB 2JY6A 2K8HA 3ECIA 2A5UA 1V86A 2KFKA 3SDLC 2JXXA 3LDZE 5GMVA 3RZFA 1R4MI 1WRDB 2LASA 1V5OA 4KDLB 4MELA 3X23A 2ZJDA 4M8NA 4YL8A 5CTRC 3TJPA 4BKGA 3JVZX 2C7NB 4GOCA 2ZCCA 2AWTA 1ZGUB 5CX3A 2MRPA 2HD5B 4F8CB 4OVUA 2KDFB 1WM2A 3BY4B 1G6JA 3N3KB 2JVCA 2ZPNA 4MJSA 4FN2A 4ANXA 3PZDA 1WJUA 2IO1B 4FJVB 2K8BA 3CF6E 4MSMB 4WJOA 1BT0A 1WJ6A 2RSUA 2Y5BB 3JYUA 1A5RA 3IG3A 3NS8A 1MG8A 2FNJB 4BVUC 4GXBA 4TUUA 2KNBA 5LLIA 5FR6A 1NBFC 2ZVOA 3NZUA 3DVNU 4NAWA 1I42A 1WY8A 4WJPA 4DWFA 3WA0A 2KFKB 4M0WB 2O2VA 2EMTA 2KWCA 4ANWA 2LUEA 4I6LB 2IBIB 2L0FA 3DVNV 4JLCA 4DDGD 4DK5A 2KFJA 3ZW3A 3T8MA 4IW0A 4MGIE 3KVFB 5LXHA 2LGXA 3B1LX 4TQ0A 3MHSD 4BBNF 2G45B 1P0RA 3D32A 4FHJA 2MQJA 2KVRA 3ALBA 3APCA 2MA9B 3VVWB 3WAMA 4PS8A 5TR5A 2V3SA 4ZRKA 4DBGA 4WWNA 3H7PB 3C0RB 2Z0DB 4GSWA 2G3QB 2FAZA 1QZEA 2L8JA 3WIMA 3KW5B 2MLBA 2PE6B 3VH4B 3K9PB 1RFAA 1WH3A 2JRHA 3PPAA 2LRWA 2RR9A 3ZO5B 3QCAA 1H8CA 3SU8X 1WX8A 2KLGA 3VH3B 1V5TA 2N7EA 4GDLB 3WAOA 1WXMA 3L08A 4W9IA 1VD2A 5CHVC 3R7QA 2LWPA 4W9EA 3UGBB 4F7ZA 3A1QA 1EF5A 2AYOB 3B08A 4BKSD 1RAXA 2J0MA 4TKNA 4CO7A 2G4SA 4WJNA 1OTRB 3TL5A 2MBHA 3HIZA 1WJNA 5JHBA 1KJTA 3DVGY 4ZRIA 4URKA 1Q0WB 2D11A 1NI2A 1CMXB 2KJRA 2W9NA 3U8ZA 3QAQA 4FHKA 2ZZPB 3R7RA 3VUXA 4EZLA 1NDDA 2KD0A 3HK0A 3DOWA 3PREA 2M1MA 4MJSB 1V6EA 3ZTCA 3IHPC 2LD9A 3CSFA 4MH0E 3PT2B 3JW0X 4FJZA 4KSKC 3MJWA 4HCNB 3R66C 3H7PA 3ZIMA 4B6WA 5KHQA 4KDIC 4DXAB 5KHOA 4W9CA 1V9JA 2CKHB 5AZFA 3PHWB 4BBNC 3DBLI 3ZNID 2V4LA 3CSTA 3L17A 4W9JA 5AZHA 3RYTA 4KV2A 3H6NA 2KTRA 3N30A 2O6VB 3DBSA 4K81A 1U4AA 4W9GA 2I1KA 3A9KB 3WALA 4E74A 1OQYA 2GOWA 5DPSA 2IZVB 4W9DA 2ZPYA 2FUHB
chains in the Genus database with same CATH superfamily
2GRIA 4W9KA 1SIJA 4LK0M 1DOIA 3KYCD 2WX1A 1EUVB 2NCNA 3Q2AC 3EA6A 4GMVA 3JSVB 2ZNVB 2DX5B 3VDZA 4OVVA 1EWCA 2KX3A 1R4NB 3O65B 3GP7A 1F9JA 3ZNGC 2K9XA 2KMAA 3W5UB 3CIRB 3PRPB 3ZUNA 4HPLB 2N1VA 4XGAB 1FNVA 1GC7A 4NNJB 3VUWA 3HRDD 1TS3A 1ET6A 4HEA1 2PJHA 1HXYD 4K3BA 1TY2A 3U2SC 5D2MB 4KKIA 1T6BX 2K1FA 1ZOYB 4I6PA 5AZGA 3ENEA 2DAFA 2KQSA 4OW0A 1FNUA 3PSEB 4IC7B 3B2FA 4M00A 4NPNA 4HDQA 4IWQA 1C4CA 3OJ3A 4PK1A 1YN5A 4AJWA 1DYQA 3ZVVA 1LM8B 1TY0A 4TMAB 2IY0B 2K0PA 4GLSC 5D94A 3SFEB 4F1SA 2BTEA 2K39A 2GB1A 2IGHA 4YTNB 3ZRFA 3ZGZA 1TZOA 2KQ4X 1C79A 4AP4C 2IY1B 3LJ3A 3DQVA 2UYZB 4II3B 2Y5CA 1SJED 5LXIB 3E9SA 3ZDTA 4GGQA 3UIOB 1J8CA 4L1BA 3TIXA 1STEA 3ZDMC 4K7SA 2V4IB 1SBBB 3V3XA 1VR9A 3Q8AA 3MTNB 4FA6A 1IP9A 5L83A 1F0ZA 4OZCA 3TEZA 2L00B 3KWVA 3M63B 2JWZA 2L83A 3PVLA 1HQRD 4RCOA 1FCLA 5MPOA 4L23A 2V1YA 4GB9A 2KX0A 1MHHE 1LXDA 5C23A 1Z5SB 1E7PB 1RLFA 3AM9A 2QMTA 2EMSA 2LMCA 3DHGC 2L7RA 4E71A 2JUOA 3KQ4A 3AEGB 2WXIA 2IO0B 4W9FA 3TCAA 4EE2A 2DZIA 4LDTD 4GDKB 2ONQA 3Q8BA 2KN4A 2BPSA 2M0AA 1FO4A 2B76B 3MP9A 3Q3FA 4BKTA 1GB4A 1WRIA 3A1QB 1AARA 5IAAC 4JGHB 1XEEA 5G2NA 1Q5WB 2Y3AA 2W54A 1RM6C 3IT4B 2D2QA 2N4FA 2L32A 3V60A 3C19A 4A90A 2N0SB 4JE3B 5C3JB 3NZSA 2LUMA 3RULA 2IO3B 2BWFA 1OEYJ 2LJ5A 3ONSA 3PRZA 3I9V1 3T3NA 2KWDA 1IUEA 3DCGA 4IWOA 2KC2A 3TEYA 1E7UA 1M4VA 2V9HA 2TSSA 3MFGA 3Q3JA 1F1HA 3MC8A 2BF8B 4FJYA 1FCCC 1QT9A 1VJKA 2X38A 3DPDA 3GB1A 1PQSA 3NJTA 3Q8EA 4XWTA 3H8HA 2WDRB 5E6NA 2INDC 1YX6B 2D3CA 1YIWA 2GBRA 2DYBA 3I3TB 3EC8A 1B9RA 2LEKA 4N58A 1SE2A 4KZCA 2AQ2B 4LCDE 3BVMA 1CJEA 1WGRA 5CHWA 4M01A 1R7SA 2KT7A 1E90A 4EOYA 2R2OA 2RD0A 1J7BA 4JQWC 1S3SG 1F77A 1V1OA 3BVGA 1UH6A 4KVGB 4HPPA 5E6OA 1HA5A 2M0XA 2AL6A 1YX5B 3NY5A 3GOEA 3RUIB 4XDCA 3C8YA 4AUQC 1WXSA 3L0WB 1IGDA 3RPFC 3PO0A 1SXTA 4EUTA 2INNE 3PLVA 2JY6A 2K8HA 3AEEB 3IAS1 2A5UA 1V86A 3LDZE 5GMVA 4MELA 2LASA 1KH0A 2ZJDA 4M8NA 4YL8A 2WXFA 2ZCCA 2AWTA 1FXIA 1TKGA 2M56B 4OVUA 3BY4B 2FUG1 4FN2A 4NZLB 2K8BA 4MSMB 1BT0A 2RSUA 4UDUC 2UU7A 2WXKA 3IG3A 4BVUC 2FNJB 4GXBA 4TUUA 1J7CA 5IKCM 3NZUA 1I42A 4WJPA 4M0WB 3AB5A 1D5ZC 2KWCA 4ANWA 4C00A 2BQQA 4BZAA 2L0FA 4DDGD 5FKAC 4US8A 3T8MA 2LGXA 3AE4B 4BBNF 2MQJA 1BMLC 1PGBA 4L2YA 4DBGA 2Y5PA 1FNWA 3C0RB 2Z0DB 2J4XA 2FAZA 1YJJA 2PE6B 5EE3A 1JWAD 3PPAA 4N59A 5IN7A 2RR9A 4YSZB 3QCAA 1VDVA 3RNCC 1WX8A 2KLGA 3VH3B 2N7EA 4W9IA 2GI9A 2QDFA 3UGBB 2V0GA 2QEJC 3A1QA 3B08A 3Q14C 4BKSD 4NJCA 3AE9B 4WJNA 1WJNA 4ZRIA 1NI2A 3VUXA 2KJRA 2DBYA 5AUKA 3QAQA 4FHKA 2ZZPB 1I4GA 1K53A 3HK0A 1ZDXA 3GE8C 4MH0E 4FJZA 1D5XC 4KSKC 4HCNB 5KHQA 3Q6BA 5KHOA 1V9JA 5AZFA 2WU2B 3RN9C 3PHWB 4DXFA 2V4LA 3CSTA 4JPSA 3N30A 3ZJTA 4US9A 4E74A 5DPSA 1AWDA 4ZRPA 2ZPYA 2W3SA 4ZYNA 4NY0A 1WR1A 1UNSA 2C7HA 5DPWA 2N9KA 1ZW7A 3OLMD 1GJZA 2R2QA 1WMHA 1V81A 3S2AA 1WSPA 3A9JA 3AH7A 3BK2A 1E8WA 1QOAA 1D3ZA 2YVCA 4KGRA 1C78A 2LRUA 3UIPB 2RMMA 4ACFA 3N1YC 4ICVA 5EE9A 1SSNA 5C1ZA 1I4QA 1XO3A 2KO3A 3JSVA 4IG7B 1DOXA 2ZW0A 1XLNA 3V61A 2BVCA 2MBEA 1LO5D 3L13A 3VTVA 4HK2A 3AULA 4DDID 1K50A 4II2B 1HEZE 1C3TA 4CHKA 1UWMA 3DBRI 4JWSC 2KN5A 4G0NB 2D10A 2DZJA 2KXJA 2KK8A 1L0YB 2G4DB 2PPHA 1WJ4A 4LDTB 2FCNA 3VRAB 1WGGA 4K7UA 4XX5A 5J18A 4PYZA 5D6JB 4EKUA 2NBWB 1XLOA 3RZWC 2GBMA 1UGMA 4HJKA 4KKJA 5GXGB 2REXA 2OHFA 3N9YC 1YN3A 4BOSC 5AUIA 1S1QB 2KANA 1FRRA 2LGYA 4MGYE 3MHZA 1OGWA 2MH7A 3AMZA 2KDMA 2O6VA 3AV8A 2L05A 3A9KA 4ZRJA 4IM0A 1HZ5A 2JYEA 1WXAA 1WZ3A 1I4PA 2BYTA 2WWZA 2J0KA 2RPVA 1WM3A 1C77A 5DCNA 4XC2A 4TQ1A 1JRUA 4KGTA 2XBBC 3Q69A 2WDQB 3BYYB 4ASWC 1WYWB 2AL3A 2BWES 4P6VF 2L3ZA 2M4NA 2K3UA 3EHVA 1E7VA 5L95C 1OQRA 1JMLA 1UBIA 4A55A 4HDOA 3T9LA 4DHJD 3PV1A 3RCZA 3TBLD 2WXRA 2NVUI 2B3AA 2WDVB 2QCZA 2QHOA 5HI1A 2LHDA 2RDGA 4WWPA 5EE0A 1M94A 4YTPB 4G11A 3QX1A 1SE3A 1GNUA 2KZRA 4HRSA 3L10B 4AWJA 1I4XA 1MPEA 1WGYA 2WX0A 1AW7A 2CHWA 2GBNA 1FXAA 2VH1A 1WX7A 3DDCB 1NEKB 4EZJA 1T0SC 2QSDA 4DHJB 2ZNVC 2ZVNA 3VTWA 4XWWA 2MBOA 3VQIA 3URYA 1MJDA 2ACZB 2WQYB 2BS4B 4G3XB 3IVFA 1TKYA 4JL9A 5BYSA 3CMMB 1IGCA 5BO4B 1V49A 2BS3B 2DAJA 3UQAA 3P1MA 1K51A 3UINB 4AJYB 1D5MC 1HE8A 3IAM1 2K6DB 2K8CA 3RD2A 4HKQA 3SFDB 4EZKA 1QOGA 2JRIB 2KYWA 3WANA 1TBEA 2JZPA 1QLBB 3ZNZB 2CU3A 1VRAB 4QAYA 3APFA 3QWZB 2MWSB 3AEBB 4M8MA 1GG3A 1JCKB 2XK5A 3BWUD 2I38A 2JU6X 1D4BA 1SB3C 1GB1A 5DPRA 4K1RB 1WXVA 2FE8A 1YJ1A 1EO6A 5IP4D 3RMKC 3Q3OC 3L4PA 2G9HD 2N9XA 4RM9A 3P2BA 3NOBA 2CS4A 4WAAA 2JPHA 3LYYA 2A4ZA 5AEKB 1PYWD 1ZUD2 3EFCA 1WGHA 2DLBA 2Z0EB 2PVOD 3OAWA 2ZCBA 1A70A 1YOVB 2HJ8A 3B9JA 1L6UA 2JF5A 1T5XD 3H1UA 4J6IA 2BBCA 3L54A 1E8ZA 2K22A 3NS1A 2NS5A 3SEBA 1AYFA 3PLUA 2RDHA 2WYQA 2IGGA 1ZDVA 1JWMD 1TS4A 4MM3B 3A33B 1MHXA 1HTOA 3DWMA 1Q10A 2KMCA 3WCQA 1GPXA 4FXCA 1C1YB 2D3BA 1RRBA 4ZDVA 2WNMA 1AN8A 4E3CA 1ET9A 3U4EG 3V05A 1L6VA 4IOIE 1EF1A 3PHXB 3P4RB 4NQKE 3BZDB 4AS1A 2WHIA 4WH4A 4RGOS 4OZBA 3RZFA 4LNFA 4KDLB 5CTRC 4J3OD 2C7NB 1ZGUB 5CX3A 2X8XX 1WM2A 5BMHA 3PZDA 3RNGC 1YNTE 4WJOA 1UUPA 1WJ6A 2Y5BB 5HG2A 1CZPA 3NS8A 2PTLA 3DVNU 4DWFA 2LJIA 3WA0A 2KFKB 4IDIA 1N5XA 2EMTA 2LUEA 2IBIB 3DVNV 4DK5A 1FRDA 1N61A 3B1LX 3MHSD 1P0RA 1ENFA 3APCA 2MA9B 3VVWB 2LGIA 3WAMA 5TR5A 4ZRKA 4WWNA 2L8JA 4RF0A 3KW5B 2MLBA 1RFAA 1WH3A 1H8CA 4C7ZA 2WLBA 3NRZA 1V5TA 5T8IA 1VD2A 3AE3B 2LWPA 4W9EA 4R3DA 2AYOB 1HZ6A 1UGJA 2MBHA 3HUIA 1KJTA 1Q0WB 1ZP0B 2D11A 2W9NA 3U8ZA 3RNFC 1NDDA 2KD0A 4RNAA 3IT6B 2BS2B 1ZE3D 1JWUD 4REZA 2OJWA 4MJSB 1V6EA 4LNIA 3JW0X 1WGKA 1RFKA 1WWTA 3H7PA 4KDIC 5FR3A 3ZNID 3TEWA 4W9JA 2PKOA 1JROA 4KV2A 5H8YE 2O6VB 1U4AA 4W9GA 2GOWA 2IZVB 2PMVA 4W9DA 3TSSA 2JYTA 2E3TA 1P1AA 4A8XC 2HJ1A 2CU1A 4XE0A 1GC6A 3GZNI 2IO2B 4MEMA 4WAFA 3M62B 1FFVA 2GBKA 1KLUD 1WFYA 4ZRQA 2OEDA 1NYRA 2MW5A 2XEWA 3AXCA 4G50A 3PS6A 2Z8LA 1I35A 3A4SC 1L5PA 4ICUA 2BKFA 2FCQA 2LVPA 3DVGX 4ARIA 4MSQB 1VCBA 1C76A 3OG5A 5D7GA 2L0TA 4GN1A 1ZKHA 2DENB 2YEPB 2Z59B 5G5HA 3ZLZA 2VH2A 5EDSA 1E10A 4A3PA 1E5WA 2KOXA 1GAQB 1UELA 2PVGC 1GUAB 3AEDB 3RT3B 3VR9B 2CJNA 2WU5B 3BIID 5J17A 2VZKD 5JH5C 2J52A 2KLCA 2K25A 1E8YA 5HHDG 2NTTA 2LXCA 4MACA 2KJ6A 5EE1A 1BXTA 4N6EB 4MM3A 1B1ZA 1SE9A 1XCQL 2KWUB 1IYFA 2WS3B 1PGAA 1ESFA 3HVDA 3M95A 5E6PA 1XCTL 2GMIC 4MGKE 2KHWB 4BFRA 2LHEA 1XF5L 1UZXB 3A4RA 4S17A 3DWGC 4C7YA 4LJOB 5DPTA 1MFWA 3Q8FA 3AEFB 3RNAC 1T0YA 2XNAC 2WXJA 3FAHA 4N9F4 4FADA 4DQOC 4RM8A 4A20A 2HE7A 4NJ7A 3AE8B 4X57B 5BYRA 4YT0B 2WGSA 2ZEQA 3B0AA 3W1SA 2IDYA 3ZRCA 3KH0A 4MT5A 4P1CC 4ITKA 3AU5A 1Q1OA 1TS2A 4WWMA 5LNK1 2MX2A 3AEAB 4LJPB 3RI7C 4NJ6A 2DYMA 2N9EB 3ML8A 2WXOA 4NQLB 4XZ4A 4TV3A 1WF9A 1TJEA 5G55A 1V80A 1TZ1A 2UWQA 1J7AA 1V97A 2V3PA 2J0JA 1TT5B 4K7WA 2LI5A 2ICIA 1N63A 3W1SC 5D3DA 1TGZB 4EFOA 2H89B 3QHTA 3N20C 2NPTA 1L7YA 2IGDA 3NVVA 4HJGE 2D5GA 3ZNHB 3HM6X 2NBVB 2KJHB 3QARA 4ARCA 1V1PB 3U30A 2BKRB 2GLSA 1N6ZA 3T3OA 1R4NI 4IWPA 3Q3NC 2M19A 2L1AA 4GU2A 1DGJA 4GDKA 3OWEB 2DHZA 3QIJA 2D3GA 2BGFA 1TTNA 2FCSA 3FILB 2JZZA 3ML9A 3KUZA 1QF6A 1FM0D 2M17A 3SR6A 1QQRA 4A3OA 3U7ZA 3W2DA 3LB8C 1Z2MA 3ZJVA 1JWSD 5C2TB 5IO9A 2MEKA 4RFBA 3P63A 4W9LA 3R8BA 4PS7A 2O2VB 1ACCA 4B9KA 3I57A 4P16A 2QILA 2MBBB 2HTME 4NAWB 5JHAA 1XQQA 4WURA 1C9FA 2WXLA 3O13A 1H4RA 3HHMA 1C4PA 4P7IA 2OOBB 3IBEA 1WX9A 1SF0A 3ZYYX 2DNFA 1JWBD 1WE7A 4KSLC 3UQBA 1L4ZB 3BVZA 2LGDA 4H2AA 1T3QA 4DHZB 2AQ1B 1L4DB 1SIFA 1WZ0A 1E6EB 1TS5A 2K6QA 4HLEA 3W9CB 1L0VB 2JX5A 4ANUA 1VZ8A 3AE1B 4CQNA 2M8SA 4IUMB 3TEXA 2D07B 1OFFA 1QILA 4DHZE 2CHXA 4C4VB 4P1BC 1P7EA 3PZ8A 2MSED 3P4SB 1ISNA 4PS3A 1LQBA 1WIAA 2N9PC 4RMAA 2NBUA 1JW9D 2GBJA 4BOZB 3I63C 2L52A 4KIKA 2JZ3B 2KWVB 4BAXA 1FIQA 4HROA 3HVZA 2BYFA 5J2RA 1LGRA 2IYDB 1IBXA 1SJHD 2EKIA 3GZNB 1R4MI 1WRDB 1V5OA 3X23A 3E56A 1MVKA 4BKGA 2HD5B 2KDFB 3ETRA 2QIEB 2JVCA 3N3KB 2ZPNA 1JRPA 1MG4A 1QOBA 4FJVB 2KAJA 2WXMA 1MG8A 5HFYA 2KNBA 5LLIA 4WQMA 2VZKB 1NBFC 3FC4A 3AE5B 1NENB 4M0WA 1T0RC 1FPYA 1K52A 4IW0A 4MGIE 5LXHA 2W3RA 3D32A 1SE4A 4PS8A 2V3SA 2LFIA 2PW9A 1QZEA 2PLPA 3VH4B 2AQ3B 1RWSA 1XXGA 2YEPF 5IOIA 4LLGM 3SU8X 1I4RA 2D3AA 3ABVB 2WXNA 3P4PB 4GDLB 1TYGB 5CHVC 3R7QA 4F7ZA 2WXHA 1EF5A 1UWXA 1RAXA 2J0MA 4TKNA 3HIZA 5BMGA 3DVGY 1YMHE 4URKA 4DXGA 3R7RA 2E6XA 3DOWA 4OZAA 3IHPC 2LD9A 2JQRB 1CK1A 3PT2B 3ZIMA 3MJWA 3R66C 2CKHB 4BBNC 2KVZA 3NVZA 3RYTA 3P4QB 3H6NA 2KTRA 4M02A 3R2IA 3DBSA 4ZOHC 4K3CA 2I1KA 3WALA 1OQYA 3FILA 1IBXB 3QQ8B 4HVBA 2G1EA 3AI5A 4B95A 1EWYC 4JIOU 2CR5A 1FXTB 2SEBD 4RH6A 2LXAA 4HKZE 3M3JA 2RGFA 1WE6A 2KACA 1KLVA 2MBQA 1KM7A 3VAWA 2NMQA 2DZKA 2WDTB 2HDEA 4GIVA 4KGSA 4LNKA 4JWUC 1KF6B 4FLHA 3NUHB 2C7MB 2MCNB 2JXTA 2N1WA 1QOFA 2MJ3A 2KKCA 3K9OB 1VLBA 1R4MB 4USAA 3MC0B 3DHIC 1CQVA 2DWQA 2FIFA 2WXQA 1F52A 1P9DU 2EKEC 4ZYSA 5JZEB 3DBHI 3U52E 2FIDA 4W9HA 2WP9B 3R2TA 3UI3A 2BYEA 3P42A 1KLGD 2KQ7A 3TMPB 3L16A 2BW2A 2Q5WD 3RNEC 3VHTC 1VZ7A 4KZ0A 2C60A 3V62A 2N9LA 4WIPA 4C56C 3EECA 3PZ7A 2YLMA 4D2KA 1D6EC 2N7JA 1YJIA 1F2RC 3N32A 4HWIB 2KDBA 5CHFA 3BINA 3EGRA 3PRMB 3V6CB 1J0GA 1SEBD 3VFKA 2R61A 3KUDB 4PYUA 3QK0A 4LNOA 2MP2B 1E0ZA 4WWOA 4XDDA 3UF8A 1KOTA 1TKEA 2JSVX 1UD7A 3TUOA 2NPTB 3QC8B 4HXDA 2CHZA 1PFDA 3PTFC 1UF0A 1V8CA 1GOZA 3H9DA 3PGEA 3H7SA 2KTRB 3HM3A 3MJ5A 2CJOA 4KIKB 1YQ3B 4GDLA 1KFYB 4I6NB 2FCMA 3VR8B 3GS2A 2XK5B 1TIFA 3BYTB 4O1NA 3OJ4B 2LVOA 1BUIC 2W82A 4LNNA 5BMIA 2MHJA 3AN1A 2MP2A 3ZKJC 3R3MA 4B0EA 3J9CA 1XD3B 4RGNA 4XYCA 3Q3MC 4BKSA 1V1PA 2NR2A 2HTHA 4ZHOA 2KMMA 3ZJUA 2RPQA 4C80A 4MDKE 1YD8U 3AU4A 2C9WB 2PIAA 3IFWB 3NVWA 2O6VD 4CYEA 1K8RB 2KDEB 3APDA 1RYJA 4HPMB 5IA7A 2XN9C 4IKGA 2V3NA 3V6EB 4Q2JA 3SD5A 2DZMA 1PUTA 4JX1C 3QJZA 4C4VA 2VRRB 3VTUA 1WI0A 3LXFA 1FD6A 2ASQA 2N7DA 4IM3A 1P3QU 2I1JA 3A9JB 5HKHA 1FMAD 2JWUA 1V2YA 3AE6B 3VXWA 1L2NA 3CWIA 1YQ4B 1PDXA 1DOYA 4YTMB 2WXPA 3FKYA 4WJQA 4EEWA 2J7QB 1UBQA 4MGZE 5E6JA 2KTFA 3DBRB 3N1XC 2ZW1A 2AX5A 1X1MA 1I7HA 2C5LC 2K5PA 1Y8RC 3IXSA 1OEYA 4S0RA 1N60A 3U7DA 3NHEB 4IM2A 1NYQA 3KLSX 2QJLA 2RDBC 1WR6E 2J42A 1WMHB 4AOFA 1ZPSA 3NZ3A 4YWGG 2DYOA 1P7FA 3I5JC 5I4DA 1E8XA 1WGDA 2QC8A 3KWLA 3VRBB 1KTKA 4FULA 2FBWB 3W1YA 3DBLB 5D3IB 1L0XB 3QA8A 2KC1A 4LTUA 1YQBA 2LVQA 3GE3C 1F2RI 4ANVA 2LGSA 3KYDD 2L76A 1LFDA 3MC9A 2SAKA 1SGHA 3WAPA 4PT5A 3N1ZC 1IPGA 2WXGA 1XLPA 4A9AA 3VUYA 2OJRA 3DHHC 2JT4B 2PE9A 4A6QA 3EFUA 4YSXB 2KDIA 3AE2B 5BYQA 3ZTDA 2BT6A 4OHJA 1PGXA 2BYVE 2MJDA 5FK9C 3KUCB 2IJ0A 4FBJB 5JXVA 1YN4A 2PEAA 3RNBC 1WYGA 4NAMA 4WQOB 2BB6A 3RFZB 4OVZA 2LZ6A 1JQ4A 2INCC 1P98A 4YSYB 1XT9B 1ZXHA 2W55A 2H88B 4HCPB 3B2GA 3SHQA 3X0WA 2AEHA 1J19A 3ECIA 1HTQA 1NI3A 2KFKA 3SDLC 2JXXA 4ZHPA 1VZ6A 1OQQA 3ZXVA 3TJPA 3JVZX 4GOCA 3ZQ4A 2MRPA 4F8CB 4YXDB 3Q8CA 1G6JA 3BK1A 1NVID 4MJSA 1WXQA 4ANXA 1WJUA 2IO1B 1KRHA 3CF6E 4RF1A 3JYUA 1A5RA 3W5VB 3DBHB 1EU4A 5FR6A 5G5GA 2ZVOA 4NAWA 1WY8A 1EU3A 2I2YA 2O2VA 2J53A 4I6LB 4JLCA 1T0QC 2KFJA 3ZW3A 3KVFB 3EUB2 4TQ0A 2G45B 3NVYA 4FHJA 2KVRA 3ALBA 1Y56A 2NTSA 1E9MA 3H7PB 4GSWA 2G3QB 3WIMA 1ROEA 1XLQA 4KX6B 3K9PB 2JRHA 2LRWA 3ZO5B 1I4HA 1FFUA 2INPE 4RGMA 3ZXRA 1FEHA 1JALA 1MI0A 3WAOA 4AQ7A 1WXMA 3L08A 1N5WA 4CO7A 2G4SA 1OTRB 3TL5A 5JHBA 2EELA 1ZXIA 1CMXB 5H92C 4TSSA 4EZLA 1C4AA 1EM7A 3PREA 2M1MA 4RGTA 1QKZA 3ZTCA 2ON8A 3CSFA 4B6WA 4DXAB 2MJEA 2IPKD 4W9CA 4B0MA 2BB5A 4MH8A 3DBLI 3L17A 3NG0A 3AE7B 5AZHA 5TSSA 3AECB 1N62A 4K81A 3A9KB 2FUHB
chains in the Genus database with same CATH topology
1P1AA 4W9KA 4HVBA 4NY0A 1WR1A 3AI5A 2CU1A 4B95A 3KYCD 2C7HA 2WX1A 4JIOU 1EUVB 2NCNA 1GC6A 3GZNI 2IO2B 2CR5A 4MEMA 1FXTB 5DPWA 4GMVA 3JSVB 1ZW7A 2ZNVB 2DX5B 3VDZA 4OVVA 2LXAA 2KX3A 3M62B 3OLMD 2GBKA 3M3JA 3O65B 1GJZA 1F9JA 2R2QA 1WMHA 1V81A 2RGFA 3S2AA 3ZNGC 1WFYA 1WE6A 3A9JA 2MW5A 1KLVA 2KMAA 2MBQA 1KM7A 3VAWA 1E8WA 3PRPB 3ZUNA 2XEWA 2DZKA 3AXCA 4G50A 3PS6A 2WDTB 1D3ZA 2YVCA 4HPLB 4GIVA 1I35A 2N1VA 2LRUA 1GC7A 3A4SC 3UIPB 4ICUA 2BKFA 4NNJB 2FCQA 2LVPA 3DVGX 4ICVA 4FLHA 1VCBA 4MSQB 2C7MB 3VUWA 2MCNB 2N1WA 5D7GA 2L0TA 4GN1A 1ZKHA 2PJHA 2DENB 5C1ZA 2KKCA 2KO3A 3JSVA 2Z59B 3K9OB 3ZLZA 5EDSA 4IG7B 5D2MB 3V61A 4A3PA 1E5WA 2MBEA 2K1FA 4I6PA 5AZGA 2KOXA 1UELA 3ENEA 2DAFA 1GUAB 3L13A 3VTVA 4HK2A 2FIFA 3RT3B 2KQSA 1P9DU 2EKEC 3AULA 5J17A 5JH5C 4DDID 5JZEB 3DBHI 2KLCA 2K25A 1E8YA 2FIDA 4W9HA 4II2B 3PSEB 4IC7B 1C3TA 2BYEA 2LXCA 4NPNA 2KJ6A 4CHKA 2KQ7A 3DBRI 3TMPB 3L16A 4HDQA 2KN5A 4IWQA 3OJ3A 4MM3A 1SE9A 4G0NB 2KWUB 3VHTC 1IYFA 2D10A 2DZJA 2KXJA 2KK8A 2C60A 2G4DB 2PPHA 1WJ4A 4KZ0A 3V62A 4LDTB 2FCNA 4AJWA 3EECA 2YLMA 1WGGA 3M95A 5E6PA 2GMIC 4K7UA 4XX5A 5J18A 4MGKE 4PYZA 2KHWB 1LM8B 5D94A 3ZVVA 2IY0B 5D6JB 4BFRA 2NBWB 4EKUA 4F1SA 1UZXB 2K39A 3A4RA 3RZWC 3N32A 2GBMA 4HWIB 2KDBA 4LJOB 5CHFA 1UGMA 3BINA 5DPTA 3PRMB 4HJKA 3ZRFA 3V6CB 1J0GA 3VFKA 2REXA 3KUDB 4PYUA 4BOSC 3QK0A 2MP2B 4WWOA 1T0YA 4AP4C 2IY1B 3UF8A 1S1QB 2KANA 3LJ3A 2LGYA 4N9F4 4MGYE 1KOTA 4FADA 4RM8A 4A20A 1OGWA 1UD7A 3DQVA 4ZDVA 2NPTB 2UYZB 3QC8B 4II3B 2HE7A 4HXDA 2CHZA 4NJ7A 3PTFC 4X57B 2O6VA 2ZEQA 3H9DA 3PGEA 5LXIB 2L05A 3A9KA 3H7SA 2KTRB 3HM3A 4ZRJA 3ZDTA 4GGQA 3B0AA 4KIKB 3W1SA 4IM0A 3UIOB 4GDLA 1WXAA 3ZRCA 1J8CA 1WZ3A 3TIXA 2WWZA 2J0KA 3KH0A 1WM3A 3ZDMC 4I6NB 2FCMA 5DCNA 4XC2A 4K7SA 2XK5B 4TQ1A 3AU5A 1JRUA 1Q1OA 2XBBC 3OJ4B 2LVOA 4ASWC 1WYWB 2AL3A 2BWES 2L3ZA 2MX2A 3MTNB 4FA6A 2M4NA 2MP2A 1IP9A 4LJPB 3ZKJC 3R3MA 5L83A 4NJ6A 2DYMA 3EHVA 1E7VA 2N9EB 5L95C 1XD3B 1UBIA 3ML8A 2L00B 4NQLB 4XZ4A 4HDOA 4TV3A 1WF9A 3T9LA 5G55A 4DHJD 3M63B 4BKSA 1V80A 3PV1A 3RCZA 3TBLD 2JWZA 3PVLA 2NR2A 2NVUI 2HTHA 2B3AA 1TZ1A 2UWQA 2QHOA 2J0JA 4WWPA 2RPQA 2V1YA 4K7WA 4MDKE 1YD8U 2LI5A 4GB9A 1M94A 3AU4A 2C9WB 2KX0A 3W1SC 4G11A 3IFWB 1LXDA 5C23A 1TGZB 3QX1A 2O6VD 1GNUA 2KZRA 1Z5SB 4CYEA 1K8RB 2KDEB 3APDA 1RLFA 4EFOA 4HPMB 3L10B 5IA7A 4AWJA 2EMSA 3QHTA 2NPTA 1L7YA 1WGYA 2WX0A 3V6EB 3ZNHB 3HM6X 3SD5A 2CHWA 2NBVB 2DZMA 2GBNA 2KJHB 2L7RA 4E71A 3QARA 2JUOA 3QJZA 3DDCB 1WX7A 2VRRB 2IO0B 4EZJA 3VTUA 1WI0A 4W9FA 3TCAA 3U30A 4DHJB 2BKRB 2ASQA 2DZIA 2ZNVC 2N7DA 2ZVNA 4IM3A 1P3QU 2I1JA 3VTWA 3A9JB 4LDTD 1R4NI 5HKHA 4IWPA 2MBOA 3VQIA 4GDKB 1V2YA 4GU2A 3VXWA 4GDKA 2BPSA 1L2NA 3Q3FA 4BKTA 2DHZA 3QIJA 4G3XB 2D3GA 3IVFA 2BGFA 1TTNA 2FCSA 3A1QB 1AARA 2JZZA 4JL9A 4WJQA 3ML9A 4EEWA 3CMMB 5IAAC 2J7QB 4JGHB 1UBQA 5G2NA 1Q5WB 3KUZA 4MGZE 2M17A 2KTFA 5BO4B 4A3OA 1V49A 2DAJA 3UQAA 1X1MA 2C5LC 3UINB 1Y8RC 1OEYA 1Z2MA 2D2QA 3U7DA 2N4FA 3NHEB 4IM2A 3V60A 4AJYB 1HE8A 1WR6E 1WMHB 2K6DB 4W9LA 2K8CA 3NZSA 3RD2A 4AOFA 4EZKA 4PS7A 3RULA 2IO3B 2O2VB 2BWFA 2JRIB 1OEYJ 2LJ5A 3ONSA 3WANA 2DYOA 3PRZA 1TBEA 3DCGA 1E8XA 4IWOA 1WGDA 3ZNZB 2KC2A 4B9KA 1E7UA 4FULA 3APFA 3QWZB 2MBBB 2MWSB 3Q3JA 4NAWB 4M8MA 1XQQA 1GG3A 5JHAA 2XK5A 2BF8B 4FJYA 3W1YA 1H4RA 3HHMA 3QA8A 2KC1A 1YQBA 5DPRA 4K1RB 2LVQA 1WXVA 4P7IA 2OOBB 4ANVA 3IBEA 1WX9A 1YJ1A 1EO6A 3DPDA 3KYDD 1PQSA 2L76A 1LFDA 3WAPA 1SGHA 2N9XA 1WE7A 4KSLC 4RM9A 3UQBA 3P2BA 3NOBA 2CS4A 4WAAA 1IPGA 2JPHA 2LGDA 5E6NA 2A4ZA 3VUYA 4DHZB 5AEKB 2OJRA 1SIFA 1WZ0A 2JT4B 1YX6B 1WGHA 1YIWA 2GBRA 2Z0EB 2PE9A 2DYBA 3OAWA 2ZCBA 3I3TB 2K6QA 3EFUA 3EC8A 4HLEA 2KDIA 2HJ8A 4ANUA 2JF5A 3ZTDA 3H1UA 2M8SA 4IUMB 4KZCA 4LCDE 4J6IA 3L54A 1E8ZA 2D07B 2BYVE 4DHZE 1WGRA 4ZYNA 5CHWA 2NS5A 2CHXA 3KUCB 3PLUA 2WYQA 4EOYA 1E90A 2MSED 4FBJB 1ISNA 2R2OA 2RD0A 4JQWC 1S3SG 2PEAA 1UH6A 4KVGB 1LQBA 4PS3A 1WIAA 3A33B 2KMCA 2N9PC 4WQOB 5E6OA 4RMAA 2NBUA 1C1YB 2GBJA 2LZ6A 1RRBA 1YX5B 2AL6A 2M0XA 3GOEA 1P98A 3NY5A 3RUIB 1XT9B 4BOZB 4AUQC 4E3CA 1WXSA 3L0WB 4KIKA 2JZ3B 2KWVB 3QQ8B 1EF1A 4HCPB 4EUTA 3PHXB 2BYFA 5J2RA 3PLVA 3SHQA 3X0WA 2AEHA 4NQKE 1J19A 2IYDB 2JY6A 2K8HA 3ECIA 2A5UA 1V86A 2KFKA 3SDLC 2JXXA 3LDZE 5GMVA 3RZFA 1R4MI 1WRDB 2LASA 1V5OA 4KDLB 4MELA 3X23A 2ZJDA 4M8NA 4YL8A 5CTRC 3TJPA 4BKGA 3JVZX 2C7NB 4GOCA 2ZCCA 2AWTA 1ZGUB 5CX3A 2MRPA 2HD5B 4F8CB 4OVUA 2KDFB 1WM2A 3BY4B 1G6JA 3N3KB 2JVCA 2ZPNA 4MJSA 4FN2A 4ANXA 3PZDA 1WJUA 2IO1B 4FJVB 2K8BA 3CF6E 4MSMB 4WJOA 1BT0A 1WJ6A 2RSUA 2Y5BB 3JYUA 1A5RA 3IG3A 3NS8A 1MG8A 2FNJB 4BVUC 4GXBA 4TUUA 2KNBA 5LLIA 5FR6A 1NBFC 2ZVOA 3NZUA 3DVNU 4NAWA 1I42A 1WY8A 4WJPA 4DWFA 3WA0A 2KFKB 4M0WB 2O2VA 2EMTA 2KWCA 4ANWA 2LUEA 4I6LB 2IBIB 2L0FA 3DVNV 4JLCA 4DDGD 4DK5A 2KFJA 3ZW3A 3T8MA 4IW0A 4MGIE 3KVFB 5LXHA 2LGXA 3B1LX 4TQ0A 3MHSD 4BBNF 2G45B 1P0RA 3D32A 4FHJA 2MQJA 2KVRA 3ALBA 3APCA 2MA9B 3VVWB 3WAMA 4PS8A 5TR5A 2V3SA 4ZRKA 4DBGA 4WWNA 3H7PB 3C0RB 2Z0DB 4GSWA 2G3QB 2FAZA 1QZEA 2L8JA 3WIMA 3KW5B 2MLBA 2PE6B 3VH4B 3K9PB 1RFAA 1WH3A 2JRHA 3PPAA 2LRWA 2RR9A 3ZO5B 3QCAA 1H8CA 3SU8X 1WX8A 2KLGA 3VH3B 1V5TA 2N7EA 4GDLB 3WAOA 1WXMA 3L08A 4W9IA 1VD2A 5CHVC 3R7QA 2LWPA 4W9EA 3UGBB 4F7ZA 3A1QA 1EF5A 2AYOB 3B08A 4BKSD 1RAXA 2J0MA 4TKNA 4CO7A 2G4SA 4WJNA 1OTRB 3TL5A 2MBHA 3HIZA 1WJNA 5JHBA 1KJTA 3DVGY 4ZRIA 4URKA 1Q0WB 2D11A 1NI2A 1CMXB 2KJRA 2W9NA 3U8ZA 3QAQA 4FHKA 2ZZPB 3R7RA 3VUXA 4EZLA 1NDDA 2KD0A 3HK0A 3DOWA 3PREA 2M1MA 4MJSB 1V6EA 3ZTCA 3IHPC 2LD9A 3CSFA 4MH0E 3PT2B 3JW0X 4FJZA 4KSKC 3MJWA 4HCNB 3R66C 3H7PA 3ZIMA 4B6WA 5KHQA 4KDIC 4DXAB 5KHOA 4W9CA 1V9JA 2CKHB 5AZFA 3PHWB 4BBNC 3DBLI 3ZNID 2V4LA 3CSTA 3L17A 4W9JA 5AZHA 3RYTA 4KV2A 3H6NA 2KTRA 3N30A 2O6VB 3DBSA 4K81A 1U4AA 4W9GA 2I1KA 3A9KB 3WALA 4E74A 1OQYA 2GOWA 5DPSA 2IZVB 4W9DA 2ZPYA 2FUHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1A A;  4W9K A;  4HVB A;  4NY0 A;  1WR1 A;  3AI5 A;  2CU1 A;  4B95 A;  3KYC D;  2C7H A;  2WX1 A;  4JIO U;  1EUV B;  2NCN A;  1GC6 A;  3GZN I;  2IO2 B;  2CR5 A;  4MEM A;  1FXT B;  5DPW A;  4GMV A;  3JSV B;  1ZW7 A;  2ZNV B;  2DX5 B;  3VDZ A;  4OVV A;  2LXA A;  2KX3 A;  3M62 B;  3OLM D;  2GBK A;  3M3J A;  3O65 B;  1GJZ A;  1F9J A;  2R2Q A;  1WMH A;  1V81 A;  2RGF A;  3S2A A;  3ZNG C;  1WFY A;  1WE6 A;  3A9J A;  2MW5 A;  1KLV A;  2KMA A;  2MBQ A;  1KM7 A;  3VAW A;  1E8W A;  3PRP B;  3ZUN A;  2XEW A;  2DZK A;  3AXC A;  4G50 A;  3PS6 A;  2WDT B;  1D3Z A;  2YVC A;  4HPL B;  4GIV A;  1I35 A;  2N1V A;  2LRU A;  1GC7 A;  3A4S C;  3UIP B;  4ICU A;  2BKF A;  4NNJ B;  2FCQ A;  2LVP A;  3DVG X;  4ICV A;  4FLH A;  1VCB A;  4MSQ B;  2C7M B;  3VUW A;  2MCN B;  2N1W A;  5D7G A;  2L0T A;  4GN1 A;  1ZKH A;  2PJH A;  2DEN B;  5C1Z A;  2KKC A;  2KO3 A;  3JSV A;  2Z59 B;  3K9O B;  3ZLZ A;  5EDS A;  4IG7 B;  5D2M B;  3V61 A;  4A3P A;  1E5W A;  2MBE A;  2K1F A;  4I6P A;  5AZG A;  2KOX A;  1UEL A;  3ENE A;  2DAF A;  1GUA B;  3L13 A;  3VTV A;  4HK2 A;  2FIF A;  3RT3 B;  2KQS A;  1P9D U;  2EKE C;  3AUL A;  5J17 A;  5JH5 C;  4DDI D;  5JZE B;  3DBH I;  2KLC A;  2K25 A;  1E8Y A;  2FID A;  4W9H A;  4II2 B;  3PSE B;  4IC7 B;  1C3T A;  2BYE A;  2LXC A;  4NPN A;  2KJ6 A;  4CHK A;  2KQ7 A;  3DBR I;  3TMP B;  3L16 A;  4HDQ A;  2KN5 A;  4IWQ A;  3OJ3 A;  4MM3 A;  1SE9 A;  4G0N B;  2KWU B;  3VHT C;  1IYF A;  2D10 A;  2DZJ A;  2KXJ A;  2KK8 A;  2C60 A;  2G4D B;  2PPH A;  1WJ4 A;  4KZ0 A;  3V62 A;  4LDT B;  2FCN A;  4AJW A;  3EEC A;  2YLM A;  1WGG A;  3M95 A;  5E6P A;  2GMI C;  4K7U A;  4XX5 A;  5J18 A;  4MGK E;  4PYZ A;  2KHW B;  1LM8 B;  5D94 A;  3ZVV A;  2IY0 B;  5D6J B;  4BFR A;  2NBW B;  4EKU A;  4F1S A;  1UZX B;  2K39 A;  3A4R A;  3RZW C;  3N32 A;  2GBM A;  4HWI B;  2KDB A;  4LJO B;  5CHF A;  1UGM A;  3BIN A;  5DPT A;  3PRM B;  4HJK A;  3ZRF A;  3V6C B;  1J0G A;  3VFK A;  2REX A;  3KUD B;  4PYU A;  4BOS C;  3QK0 A;  2MP2 B;  4WWO A;  1T0Y A;  4AP4 C;  2IY1 B;  3UF8 A;  1S1Q B;  2KAN A;  3LJ3 A;  2LGY A;  4N9F 4;  4MGY E;  1KOT A;  4FAD A;  4RM8 A;  4A20 A;  1OGW A;  1UD7 A;  3DQV A;  4ZDV A;  2NPT B;  2UYZ B;  3QC8 B;  4II3 B;  2HE7 A;  4HXD A;  2CHZ A;  4NJ7 A;  3PTF C;  4X57 B;  2O6V A;  2ZEQ A;  3H9D A;  3PGE A;  5LXI B;  2L05 A;  3A9K A;  3H7S A;  2KTR B;  3HM3 A;  4ZRJ A;  3ZDT A;  4GGQ A;  3B0A A;  4KIK B;  3W1S A;  4IM0 A;  3UIO B;  4GDL A;  1WXA A;  3ZRC A;  1J8C A;  1WZ3 A;  3TIX A;  2WWZ A;  2J0K A;  3KH0 A;  1WM3 A;  3ZDM C;  4I6N B;  2FCM A;  5DCN A;  4XC2 A;  4K7S A;  2XK5 B;  4TQ1 A;  3AU5 A;  1JRU A;  1Q1O A;  2XBB C;  3OJ4 B;  2LVO A;  4ASW C;  1WYW B;  2AL3 A;  2BWE S;  2L3Z A;  2MX2 A;  3MTN B;  4FA6 A;  2M4N A;  2MP2 A;  1IP9 A;  4LJP B;  3ZKJ C;  3R3M A;  5L83 A;  4NJ6 A;  2DYM A;  3EHV A;  1E7V A;  2N9E B;  5L95 C;  1XD3 B;  1UBI A;  3ML8 A;  2L00 B;  4NQL B;  4XZ4 A;  4HDO A;  4TV3 A;  1WF9 A;  3T9L A;  5G55 A;  4DHJ D;  3M63 B;  4BKS A;  1V80 A;  3PV1 A;  3RCZ A;  3TBL D;  2JWZ A;  3PVL A;  2NR2 A;  2NVU I;  2HTH A;  2B3A A;  1TZ1 A;  2UWQ A;  2QHO A;  2J0J A;  4WWP A;  2RPQ A;  2V1Y A;  4K7W A;  4MDK E;  1YD8 U;  2LI5 A;  4GB9 A;  1M94 A;  3AU4 A;  2C9W B;  2KX0 A;  3W1S C;  4G11 A;  3IFW B;  1LXD A;  5C23 A;  1TGZ B;  3QX1 A;  2O6V D;  1GNU A;  2KZR A;  1Z5S B;  4CYE A;  1K8R B;  2KDE B;  3APD A;  1RLF A;  4EFO A;  4HPM B;  3L10 B;  5IA7 A;  4AWJ A;  2EMS A;  3QHT A;  2NPT A;  1L7Y A;  1WGY A;  2WX0 A;  3V6E B;  3ZNH B;  3HM6 X;  3SD5 A;  2CHW A;  2NBV B;  2DZM A;  2GBN A;  2KJH B;  2L7R A;  4E71 A;  3QAR A;  2JUO A;  3QJZ A;  3DDC B;  1WX7 A;  2VRR B;  2IO0 B;  4EZJ A;  3VTU A;  1WI0 A;  4W9F A;  3TCA A;  3U30 A;  4DHJ B;  2BKR B;  2ASQ A;  2DZI A;  2ZNV C;  2N7D A;  2ZVN A;  4IM3 A;  1P3Q U;  2I1J A;  3VTW A;  3A9J B;  4LDT D;  1R4N I;  5HKH A;  4IWP A;  2MBO A;  3VQI A;  4GDK B;  1V2Y A;  4GU2 A;  3VXW A;  4GDK A;  2BPS A;  1L2N A;  3Q3F A;  4BKT A;  2DHZ A;  3QIJ A;  4G3X B;  2D3G A;  3IVF A;  2BGF A;  1TTN A;  2FCS A;  3A1Q B;  1AAR A;  2JZZ A;  4JL9 A;  4WJQ A;  3ML9 A;  4EEW A;  3CMM B;  5IAA C;  2J7Q B;  4JGH B;  1UBQ A;  5G2N A;  1Q5W B;  3KUZ A;  4MGZ E;  2M17 A;  2KTF A;  5BO4 B;  4A3O A;  1V49 A;  2DAJ A;  3UQA A;  1X1M A;  2C5L C;  3UIN B;  1Y8R C;  1OEY A;  1Z2M A;  2D2Q A;  3U7D A;  2N4F A;  3NHE B;  4IM2 A;  3V60 A;  4AJY B;  1HE8 A;  1WR6 E;  1WMH B;  2K6D B;  4W9L A;  2K8C A;  3NZS A;  3RD2 A;  4AOF A;  4EZK A;  4PS7 A;  3RUL A;  2IO3 B;  2O2V B;  2BWF A;  2JRI B;  1OEY J;  2LJ5 A;  3ONS A;  3WAN A;  2DYO A;  3PRZ A;  1TBE A;  3DCG A;  1E8X A;  4IWO A;  1WGD A;  3ZNZ B;  2KC2 A;  4B9K A;  1E7U A;  4FUL A;  3APF A;  3QWZ B;  2MBB B;  2MWS B;  3Q3J A;  4NAW B;  4M8M A;  1XQQ A;  1GG3 A;  5JHA A;  2XK5 A;  2BF8 B;  4FJY A;  3W1Y A;  1H4R A;  3HHM A;  3QA8 A;  2KC1 A;  1YQB A;  5DPR A;  4K1R B;  2LVQ A;  1WXV A;  4P7I A;  2OOB B;  4ANV A;  3IBE A;  1WX9 A;  1YJ1 A;  1EO6 A;  3DPD A;  3KYD D;  1PQS A;  2L76 A;  1LFD A;  3WAP A;  1SGH A;  2N9X A;  1WE7 A;  4KSL C;  4RM9 A;  3UQB A;  3P2B A;  3NOB A;  2CS4 A;  4WAA A;  1IPG A;  2JPH A;  2LGD A;  5E6N A;  2A4Z A;  3VUY A;  4DHZ B;  5AEK B;  2OJR A;  1SIF A;  1WZ0 A;  2JT4 B;  1YX6 B;  1WGH A;  1YIW A;  2GBR A;  2Z0E B;  2PE9 A;  2DYB A;  3OAW A;  2ZCB A;  3I3T B;  2K6Q A;  3EFU A;  3EC8 A;  4HLE A;  2KDI A;  2HJ8 A;  4ANU A;  2JF5 A;  3ZTD A;  3H1U A;  2M8S A;  4IUM B;  4KZC A;  4LCD E;  4J6I A;  3L54 A;  1E8Z A;  2D07 B;  2BYV E;  4DHZ E;  1WGR A;  4ZYN A;  5CHW A;  2NS5 A;  2CHX A;  3KUC B;  3PLU A;  2WYQ A;  4EOY A;  1E90 A;  2MSE D;  4FBJ B;  1ISN A;  2R2O A;  2RD0 A;  4JQW C;  1S3S G;  2PEA A;  1UH6 A;  4KVG B;  1LQB A;  4PS3 A;  1WIA A;  3A33 B;  2KMC A;  2N9P C;  4WQO B;  5E6O A;  4RMA A;  2NBU A;  1C1Y B;  2GBJ A;  2LZ6 A;  1RRB A;  1YX5 B;  2AL6 A;  2M0X A;  3GOE A;  1P98 A;  3NY5 A;  3RUI B;  1XT9 B;  4BOZ B;  4AUQ C;  4E3C A;  1WXS A;  3L0W B;  4KIK A;  2JZ3 B;  2KWV B;  3QQ8 B;  1EF1 A;  4HCP B;  4EUT A;  3PHX B;  2BYF A;  5J2R A;  3PLV A;  3SHQ A;  3X0W A;  2AEH A;  4NQK E;  1J19 A;  2IYD B;  2JY6 A;  2K8H A;  3ECI A;  2A5U A;  1V86 A;  2KFK A;  3SDL C;  2JXX A;  3LDZ E;  5GMV A;  3RZF A;  1R4M I;  1WRD B;  2LAS A;  1V5O A;  4KDL B;  4MEL A;  3X23 A;  2ZJD A;  4M8N A;  4YL8 A;  5CTR C;  3TJP A;  4BKG A;  3JVZ X;  2C7N B;  4GOC A;  2ZCC A;  2AWT A;  1ZGU B;  5CX3 A;  2MRP A;  2HD5 B;  4F8C B;  4OVU A;  2KDF B;  1WM2 A;  3BY4 B;  1G6J A;  3N3K B;  2JVC A;  2ZPN A;  4MJS A;  4FN2 A;  4ANX A;  3PZD A;  1WJU A;  2IO1 B;  4FJV B;  2K8B A;  3CF6 E;  4MSM B;  4WJO A;  1BT0 A;  1WJ6 A;  2RSU A;  2Y5B B;  3JYU A;  1A5R A;  3IG3 A;  3NS8 A;  1MG8 A;  2FNJ B;  4BVU C;  4GXB A;  4TUU A;  2KNB A;  5LLI A;  5FR6 A;  1NBF C;  2ZVO A;  3NZU A;  3DVN U;  4NAW A;  1I42 A;  1WY8 A;  4WJP A;  4DWF A;  3WA0 A;  2KFK B;  4M0W B;  2O2V A;  2EMT A;  2KWC A;  4ANW A;  2LUE A;  4I6L B;  2IBI B;  2L0F A;  3DVN V;  4JLC A;  4DDG D;  4DK5 A;  2KFJ A;  3ZW3 A;  3T8M A;  4IW0 A;  4MGI E;  3KVF B;  5LXH A;  2LGX A;  3B1L X;  4TQ0 A;  3MHS D;  4BBN F;  2G45 B;  1P0R A;  3D32 A;  4FHJ A;  2MQJ A;  2KVR A;  3ALB A;  3APC A;  2MA9 B;  3VVW B;  3WAM A;  4PS8 A;  5TR5 A;  2V3S A;  4ZRK A;  4DBG A;  4WWN A;  3H7P B;  3C0R B;  2Z0D B;  4GSW A;  2G3Q B;  2FAZ A;  1QZE A;  2L8J A;  3WIM A;  3KW5 B;  2MLB A;  2PE6 B;  3VH4 B;  3K9P B;  1RFA A;  1WH3 A;  2JRH A;  3PPA A;  2LRW A;  2RR9 A;  3ZO5 B;  3QCA A;  1H8C A;  3SU8 X;  1WX8 A;  2KLG A;  3VH3 B;  1V5T A;  2N7E A;  4GDL B;  3WAO A;  1WXM A;  3L08 A;  4W9I A;  1VD2 A;  5CHV C;  3R7Q A;  2LWP A;  4W9E A;  3UGB B;  4F7Z A;  3A1Q A;  1EF5 A;  2AYO B;  3B08 A;  4BKS D;  1RAX A;  2J0M A;  4TKN A;  4CO7 A;  2G4S A;  4WJN A;  1OTR B;  3TL5 A;  2MBH A;  3HIZ A;  1WJN A;  5JHB A;  1KJT A;  3DVG Y;  4ZRI A;  4URK A;  1Q0W B;  2D11 A;  1NI2 A;  1CMX B;  2KJR A;  2W9N A;  3U8Z A;  3QAQ A;  4FHK A;  2ZZP B;  3R7R A;  3VUX A;  4EZL A;  1NDD A;  2KD0 A;  3HK0 A;  3DOW A;  3PRE A;  2M1M A;  4MJS B;  1V6E A;  3ZTC A;  3IHP C;  2LD9 A;  3CSF A;  4MH0 E;  3PT2 B;  3JW0 X;  4FJZ A;  4KSK C;  3MJW A;  4HCN B;  3R66 C;  3H7P A;  3ZIM A;  4B6W A;  5KHQ A;  4KDI C;  4DXA B;  5KHO A;  4W9C A;  1V9J A;  2CKH B;  5AZF A;  3PHW B;  4BBN C;  3DBL I;  3ZNI D;  2V4L A;  3CST A;  3L17 A;  4W9J A;  5AZH A;  3RYT A;  4KV2 A;  3H6N A;  2KTR A;  3N30 A;  2O6V B;  3DBS A;  4K81 A;  1U4A A;  4W9G A;  2I1K A;  3A9K B;  3WAL A;  4E74 A;  1OQY A;  2GOW A;  5DPS A;  2IZV B;  4W9D A;  2ZPY A;  2FUH B; 
#chains in the Genus database with same CATH topology
 2GRI A;  4W9K A;  1SIJ A;  4LK0 M;  1DOI A;  3KYC D;  2WX1 A;  1EUV B;  2NCN A;  3Q2A C;  3EA6 A;  4GMV A;  3JSV B;  2ZNV B;  2DX5 B;  3VDZ A;  4OVV A;  1EWC A;  2KX3 A;  1R4N B;  3O65 B;  3GP7 A;  1F9J A;  3ZNG C;  2K9X A;  2KMA A;  3W5U B;  3CIR B;  3PRP B;  3ZUN A;  4HPL B;  2N1V A;  4XGA B;  1FNV A;  1GC7 A;  4NNJ B;  3VUW A;  3HRD D;  1TS3 A;  1ET6 A;  4HEA 1;  2PJH A;  1HXY D;  4K3B A;  1TY2 A;  3U2S C;  5D2M B;  4KKI A;  1T6B X;  2K1F A;  1ZOY B;  4I6P A;  5AZG A;  3ENE A;  2DAF A;  2KQS A;  4OW0 A;  1FNU A;  3PSE B;  4IC7 B;  3B2F A;  4M00 A;  4NPN A;  4HDQ A;  4IWQ A;  1C4C A;  3OJ3 A;  4PK1 A;  1YN5 A;  4AJW A;  1DYQ A;  3ZVV A;  1LM8 B;  1TY0 A;  4TMA B;  2IY0 B;  2K0P A;  4GLS C;  5D94 A;  3SFE B;  4F1S A;  2BTE A;  2K39 A;  2GB1 A;  2IGH A;  4YTN B;  3ZRF A;  3ZGZ A;  1TZO A;  2KQ4 X;  1C79 A;  4AP4 C;  2IY1 B;  3LJ3 A;  3DQV A;  2UYZ B;  4II3 B;  2Y5C A;  1SJE D;  5LXI B;  3E9S A;  3ZDT A;  4GGQ A;  3UIO B;  1J8C A;  4L1B A;  3TIX A;  1STE A;  3ZDM C;  4K7S A;  2V4I B;  1SBB B;  3V3X A;  1VR9 A;  3Q8A A;  3MTN B;  4FA6 A;  1IP9 A;  5L83 A;  1F0Z A;  4OZC A;  3TEZ A;  2L00 B;  3KWV A;  3M63 B;  2JWZ A;  2L83 A;  3PVL A;  1HQR D;  4RCO A;  1FCL A;  5MPO A;  4L23 A;  2V1Y A;  4GB9 A;  2KX0 A;  1MHH E;  1LXD A;  5C23 A;  1Z5S B;  1E7P B;  1RLF A;  3AM9 A;  2QMT A;  2EMS A;  2LMC A;  3DHG C;  2L7R A;  4E71 A;  2JUO A;  3KQ4 A;  3AEG B;  2WXI A;  2IO0 B;  4W9F A;  3TCA A;  4EE2 A;  2DZI A;  4LDT D;  4GDK B;  2ONQ A;  3Q8B A;  2KN4 A;  2BPS A;  2M0A A;  1FO4 A;  2B76 B;  3MP9 A;  3Q3F A;  4BKT A;  1GB4 A;  1WRI A;  3A1Q B;  1AAR A;  5IAA C;  4JGH B;  1XEE A;  5G2N A;  1Q5W B;  2Y3A A;  2W54 A;  1RM6 C;  3IT4 B;  2D2Q A;  2N4F A;  2L32 A;  3V60 A;  3C19 A;  4A90 A;  2N0S B;  4JE3 B;  5C3J B;  3NZS A;  2LUM A;  3RUL A;  2IO3 B;  2BWF A;  1OEY J;  2LJ5 A;  3ONS A;  3PRZ A;  3I9V 1;  3T3N A;  2KWD A;  1IUE A;  3DCG A;  4IWO A;  2KC2 A;  3TEY A;  1E7U A;  1M4V A;  2V9H A;  2TSS A;  3MFG A;  3Q3J A;  1F1H A;  3MC8 A;  2BF8 B;  4FJY A;  1FCC C;  1QT9 A;  1VJK A;  2X38 A;  3DPD A;  3GB1 A;  1PQS A;  3NJT A;  3Q8E A;  4XWT A;  3H8H A;  2WDR B;  5E6N A;  2IND C;  1YX6 B;  2D3C A;  1YIW A;  2GBR A;  2DYB A;  3I3T B;  3EC8 A;  1B9R A;  2LEK A;  4N58 A;  1SE2 A;  4KZC A;  2AQ2 B;  4LCD E;  3BVM A;  1CJE A;  1WGR A;  5CHW A;  4M01 A;  1R7S A;  2KT7 A;  1E90 A;  4EOY A;  2R2O A;  2RD0 A;  1J7B A;  4JQW C;  1S3S G;  1F77 A;  1V1O A;  3BVG A;  1UH6 A;  4KVG B;  4HPP A;  5E6O A;  1HA5 A;  2M0X A;  2AL6 A;  1YX5 B;  3NY5 A;  3GOE A;  3RUI B;  4XDC A;  3C8Y A;  4AUQ C;  1WXS A;  3L0W B;  1IGD A;  3RPF C;  3PO0 A;  1SXT A;  4EUT A;  2INN E;  3PLV A;  2JY6 A;  2K8H A;  3AEE B;  3IAS 1;  2A5U A;  1V86 A;  3LDZ E;  5GMV A;  4MEL A;  2LAS A;  1KH0 A;  2ZJD A;  4M8N A;  4YL8 A;  2WXF A;  2ZCC A;  2AWT A;  1FXI A;  1TKG A;  2M56 B;  4OVU A;  3BY4 B;  2FUG 1;  4FN2 A;  4NZL B;  2K8B A;  4MSM B;  1BT0 A;  2RSU A;  4UDU C;  2UU7 A;  2WXK A;  3IG3 A;  4BVU C;  2FNJ B;  4GXB A;  4TUU A;  1J7C A;  5IKC M;  3NZU A;  1I42 A;  4WJP A;  4M0W B;  3AB5 A;  1D5Z C;  2KWC A;  4ANW A;  4C00 A;  2BQQ A;  4BZA A;  2L0F A;  4DDG D;  5FKA C;  4US8 A;  3T8M A;  2LGX A;  3AE4 B;  4BBN F;  2MQJ A;  1BML C;  1PGB A;  4L2Y A;  4DBG A;  2Y5P A;  1FNW A;  3C0R B;  2Z0D B;  2J4X A;  2FAZ A;  1YJJ A;  2PE6 B;  5EE3 A;  1JWA D;  3PPA A;  4N59 A;  5IN7 A;  2RR9 A;  4YSZ B;  3QCA A;  1VDV A;  3RNC C;  1WX8 A;  2KLG A;  3VH3 B;  2N7E A;  4W9I A;  2GI9 A;  2QDF A;  3UGB B;  2V0G A;  2QEJ C;  3A1Q A;  3B08 A;  3Q14 C;  4BKS D;  4NJC A;  3AE9 B;  4WJN A;  1WJN A;  4ZRI A;  1NI2 A;  3VUX A;  2KJR A;  2DBY A;  5AUK A;  3QAQ A;  4FHK A;  2ZZP B;  1I4G A;  1K53 A;  3HK0 A;  1ZDX A;  3GE8 C;  4MH0 E;  4FJZ A;  1D5X C;  4KSK C;  4HCN B;  5KHQ A;  3Q6B A;  5KHO A;  1V9J A;  5AZF A;  2WU2 B;  3RN9 C;  3PHW B;  4DXF A;  2V4L A;  3CST A;  4JPS A;  3N30 A;  3ZJT A;  4US9 A;  4E74 A;  5DPS A;  1AWD A;  4ZRP A;  2ZPY A;  2W3S A;  4ZYN A;  4NY0 A;  1WR1 A;  1UNS A;  2C7H A;  5DPW A;  2N9K A;  1ZW7 A;  3OLM D;  1GJZ A;  2R2Q A;  1WMH A;  1V81 A;  3S2A A;  1WSP A;  3A9J A;  3AH7 A;  3BK2 A;  1E8W A;  1QOA A;  1D3Z A;  2YVC A;  4KGR A;  1C78 A;  2LRU A;  3UIP B;  2RMM A;  4ACF A;  3N1Y C;  4ICV A;  5EE9 A;  1SSN A;  5C1Z A;  1I4Q A;  1XO3 A;  2KO3 A;  3JSV A;  4IG7 B;  1DOX A;  2ZW0 A;  1XLN A;  3V61 A;  2BVC A;  2MBE A;  1LO5 D;  3L13 A;  3VTV A;  4HK2 A;  3AUL A;  4DDI D;  1K50 A;  4II2 B;  1HEZ E;  1C3T A;  4CHK A;  1UWM A;  3DBR I;  4JWS C;  2KN5 A;  4G0N B;  2D10 A;  2DZJ A;  2KXJ A;  2KK8 A;  1L0Y B;  2G4D B;  2PPH A;  1WJ4 A;  4LDT B;  2FCN A;  3VRA B;  1WGG A;  4K7U A;  4XX5 A;  5J18 A;  4PYZ A;  5D6J B;  4EKU A;  2NBW B;  1XLO A;  3RZW C;  2GBM A;  1UGM A;  4HJK A;  4KKJ A;  5GXG B;  2REX A;  2OHF A;  3N9Y C;  1YN3 A;  4BOS C;  5AUI A;  1S1Q B;  2KAN A;  1FRR A;  2LGY A;  4MGY E;  3MHZ A;  1OGW A;  2MH7 A;  3AMZ A;  2KDM A;  2O6V A;  3AV8 A;  2L05 A;  3A9K A;  4ZRJ A;  4IM0 A;  1HZ5 A;  2JYE A;  1WXA A;  1WZ3 A;  1I4P A;  2BYT A;  2WWZ A;  2J0K A;  2RPV A;  1WM3 A;  1C77 A;  5DCN A;  4XC2 A;  4TQ1 A;  1JRU A;  4KGT A;  2XBB C;  3Q69 A;  2WDQ B;  3BYY B;  4ASW C;  1WYW B;  2AL3 A;  2BWE S;  4P6V F;  2L3Z A;  2M4N A;  2K3U A;  3EHV A;  1E7V A;  5L95 C;  1OQR A;  1JML A;  1UBI A;  4A55 A;  4HDO A;  3T9L A;  4DHJ D;  3PV1 A;  3RCZ A;  3TBL D;  2WXR A;  2NVU I;  2B3A A;  2WDV B;  2QCZ A;  2QHO A;  5HI1 A;  2LHD A;  2RDG A;  4WWP A;  5EE0 A;  1M94 A;  4YTP B;  4G11 A;  3QX1 A;  1SE3 A;  1GNU A;  2KZR A;  4HRS A;  3L10 B;  4AWJ A;  1I4X A;  1MPE A;  1WGY A;  2WX0 A;  1AW7 A;  2CHW A;  2GBN A;  1FXA A;  2VH1 A;  1WX7 A;  3DDC B;  1NEK B;  4EZJ A;  1T0S C;  2QSD A;  4DHJ B;  2ZNV C;  2ZVN A;  3VTW A;  4XWW A;  2MBO A;  3VQI A;  3URY A;  1MJD A;  2ACZ B;  2WQY B;  2BS4 B;  4G3X B;  3IVF A;  1TKY A;  4JL9 A;  5BYS A;  3CMM B;  1IGC A;  5BO4 B;  1V49 A;  2BS3 B;  2DAJ A;  3UQA A;  3P1M A;  1K51 A;  3UIN B;  4AJY B;  1D5M C;  1HE8 A;  3IAM 1;  2K6D B;  2K8C A;  3RD2 A;  4HKQ A;  3SFD B;  4EZK A;  1QOG A;  2JRI B;  2KYW A;  3WAN A;  1TBE A;  2JZP A;  1QLB B;  3ZNZ B;  2CU3 A;  1VRA B;  4QAY A;  3APF A;  3QWZ B;  2MWS B;  3AEB B;  4M8M A;  1GG3 A;  1JCK B;  2XK5 A;  3BWU D;  2I38 A;  2JU6 X;  1D4B A;  1SB3 C;  1GB1 A;  5DPR A;  4K1R B;  1WXV A;  2FE8 A;  1YJ1 A;  1EO6 A;  5IP4 D;  3RMK C;  3Q3O C;  3L4P A;  2G9H D;  2N9X A;  4RM9 A;  3P2B A;  3NOB A;  2CS4 A;  4WAA A;  2JPH A;  3LYY A;  2A4Z A;  5AEK B;  1PYW D;  1ZUD 2;  3EFC A;  1WGH A;  2DLB A;  2Z0E B;  2PVO D;  3OAW A;  2ZCB A;  1A70 A;  1YOV B;  2HJ8 A;  3B9J A;  1L6U A;  2JF5 A;  1T5X D;  3H1U A;  4J6I A;  2BBC A;  3L54 A;  1E8Z A;  2K22 A;  3NS1 A;  2NS5 A;  3SEB A;  1AYF A;  3PLU A;  2RDH A;  2WYQ A;  2IGG A;  1ZDV A;  1JWM D;  1TS4 A;  4MM3 B;  3A33 B;  1MHX A;  1HTO A;  3DWM A;  1Q10 A;  2KMC A;  3WCQ A;  1GPX A;  4FXC A;  1C1Y B;  2D3B A;  1RRB A;  4ZDV A;  2WNM A;  1AN8 A;  4E3C A;  1ET9 A;  3U4E G;  3V05 A;  1L6V A;  4IOI E;  1EF1 A;  3PHX B;  3P4R B;  4NQK E;  3BZD B;  4AS1 A;  2WHI A;  4WH4 A;  4RGO S;  4OZB A;  3RZF A;  4LNF A;  4KDL B;  5CTR C;  4J3O D;  2C7N B;  1ZGU B;  5CX3 A;  2X8X X;  1WM2 A;  5BMH A;  3PZD A;  3RNG C;  1YNT E;  4WJO A;  1UUP A;  1WJ6 A;  2Y5B B;  5HG2 A;  1CZP A;  3NS8 A;  2PTL A;  3DVN U;  4DWF A;  2LJI A;  3WA0 A;  2KFK B;  4IDI A;  1N5X A;  2EMT A;  2LUE A;  2IBI B;  3DVN V;  4DK5 A;  1FRD A;  1N61 A;  3B1L X;  3MHS D;  1P0R A;  1ENF A;  3APC A;  2MA9 B;  3VVW B;  2LGI A;  3WAM A;  5TR5 A;  4ZRK A;  4WWN A;  2L8J A;  4RF0 A;  3KW5 B;  2MLB A;  1RFA A;  1WH3 A;  1H8C A;  4C7Z A;  2WLB A;  3NRZ A;  1V5T A;  5T8I A;  1VD2 A;  3AE3 B;  2LWP A;  4W9E A;  4R3D A;  2AYO B;  1HZ6 A;  1UGJ A;  2MBH A;  3HUI A;  1KJT A;  1Q0W B;  1ZP0 B;  2D11 A;  2W9N A;  3U8Z A;  3RNF C;  1NDD A;  2KD0 A;  4RNA A;  3IT6 B;  2BS2 B;  1ZE3 D;  1JWU D;  4REZ A;  2OJW A;  4MJS B;  1V6E A;  4LNI A;  3JW0 X;  1WGK A;  1RFK A;  1WWT A;  3H7P A;  4KDI C;  5FR3 A;  3ZNI D;  3TEW A;  4W9J A;  2PKO A;  1JRO A;  4KV2 A;  5H8Y E;  2O6V B;  1U4A A;  4W9G A;  2GOW A;  2IZV B;  2PMV A;  4W9D A;  3TSS A;  2JYT A;  2E3T A;  1P1A A;  4A8X C;  2HJ1 A;  2CU1 A;  4XE0 A;  1GC6 A;  3GZN I;  2IO2 B;  4MEM A;  4WAF A;  3M62 B;  1FFV A;  2GBK A;  1KLU D;  1WFY A;  4ZRQ A;  2OED A;  1NYR A;  2MW5 A;  2XEW A;  3AXC A;  4G50 A;  3PS6 A;  2Z8L A;  1I35 A;  3A4S C;  1L5P A;  4ICU A;  2BKF A;  2FCQ A;  2LVP A;  3DVG X;  4ARI A;  4MSQ B;  1VCB A;  1C76 A;  3OG5 A;  5D7G A;  2L0T A;  4GN1 A;  1ZKH A;  2DEN B;  2YEP B;  2Z59 B;  5G5H A;  3ZLZ A;  2VH2 A;  5EDS A;  1E10 A;  4A3P A;  1E5W A;  2KOX A;  1GAQ B;  1UEL A;  2PVG C;  1GUA B;  3AED B;  3RT3 B;  3VR9 B;  2CJN A;  2WU5 B;  3BII D;  5J17 A;  2VZK D;  5JH5 C;  2J52 A;  2KLC A;  2K25 A;  1E8Y A;  5HHD G;  2NTT A;  2LXC A;  4MAC A;  2KJ6 A;  5EE1 A;  1BXT A;  4N6E B;  4MM3 A;  1B1Z A;  1SE9 A;  1XCQ L;  2KWU B;  1IYF A;  2WS3 B;  1PGA A;  1ESF A;  3HVD A;  3M95 A;  5E6P A;  1XCT L;  2GMI C;  4MGK E;  2KHW B;  4BFR A;  2LHE A;  1XF5 L;  1UZX B;  3A4R A;  4S17 A;  3DWG C;  4C7Y A;  4LJO B;  5DPT A;  1MFW A;  3Q8F A;  3AEF B;  3RNA C;  1T0Y A;  2XNA C;  2WXJ A;  3FAH A;  4N9F 4;  4FAD A;  4DQO C;  4RM8 A;  4A20 A;  2HE7 A;  4NJ7 A;  3AE8 B;  4X57 B;  5BYR A;  4YT0 B;  2WGS A;  2ZEQ A;  3B0A A;  3W1S A;  2IDY A;  3ZRC A;  3KH0 A;  4MT5 A;  4P1C C;  4ITK A;  3AU5 A;  1Q1O A;  1TS2 A;  4WWM A;  5LNK 1;  2MX2 A;  3AEA B;  4LJP B;  3RI7 C;  4NJ6 A;  2DYM A;  2N9E B;  3ML8 A;  2WXO A;  4NQL B;  4XZ4 A;  4TV3 A;  1WF9 A;  1TJE A;  5G55 A;  1V80 A;  1TZ1 A;  2UWQ A;  1J7A A;  1V97 A;  2V3P A;  2J0J A;  1TT5 B;  4K7W A;  2LI5 A;  2ICI A;  1N63 A;  3W1S C;  5D3D A;  1TGZ B;  4EFO A;  2H89 B;  3QHT A;  3N20 C;  2NPT A;  1L7Y A;  2IGD A;  3NVV A;  4HJG E;  2D5G A;  3ZNH B;  3HM6 X;  2NBV B;  2KJH B;  3QAR A;  4ARC A;  1V1P B;  3U30 A;  2BKR B;  2GLS A;  1N6Z A;  3T3O A;  1R4N I;  4IWP A;  3Q3N C;  2M19 A;  2L1A A;  4GU2 A;  1DGJ A;  4GDK A;  3OWE B;  2DHZ A;  3QIJ A;  2D3G A;  2BGF A;  1TTN A;  2FCS A;  3FIL B;  2JZZ A;  3ML9 A;  3KUZ A;  1QF6 A;  1FM0 D;  2M17 A;  3SR6 A;  1QQR A;  4A3O A;  3U7Z A;  3W2D A;  3LB8 C;  1Z2M A;  3ZJV A;  1JWS D;  5C2T B;  5IO9 A;  2MEK A;  4RFB A;  3P63 A;  4W9L A;  3R8B A;  4PS7 A;  2O2V B;  1ACC A;  4B9K A;  3I57 A;  4P16 A;  2QIL A;  2MBB B;  2HTM E;  4NAW B;  5JHA A;  1XQQ A;  4WUR A;  1C9F A;  2WXL A;  3O13 A;  1H4R A;  3HHM A;  1C4P A;  4P7I A;  2OOB B;  3IBE A;  1WX9 A;  1SF0 A;  3ZYY X;  2DNF A;  1JWB D;  1WE7 A;  4KSL C;  3UQB A;  1L4Z B;  3BVZ A;  2LGD A;  4H2A A;  1T3Q A;  4DHZ B;  2AQ1 B;  1L4D B;  1SIF A;  1WZ0 A;  1E6E B;  1TS5 A;  2K6Q A;  4HLE A;  3W9C B;  1L0V B;  2JX5 A;  4ANU A;  1VZ8 A;  3AE1 B;  4CQN A;  2M8S A;  4IUM B;  3TEX A;  2D07 B;  1OFF A;  1QIL A;  4DHZ E;  2CHX A;  4C4V B;  4P1B C;  1P7E A;  3PZ8 A;  2MSE D;  3P4S B;  1ISN A;  4PS3 A;  1LQB A;  1WIA A;  2N9P C;  4RMA A;  2NBU A;  1JW9 D;  2GBJ A;  4BOZ B;  3I63 C;  2L52 A;  4KIK A;  2JZ3 B;  2KWV B;  4BAX A;  1FIQ A;  4HRO A;  3HVZ A;  2BYF A;  5J2R A;  1LGR A;  2IYD B;  1IBX A;  1SJH D;  2EKI A;  3GZN B;  1R4M I;  1WRD B;  1V5O A;  3X23 A;  3E56 A;  1MVK A;  4BKG A;  2HD5 B;  2KDF B;  3ETR A;  2QIE B;  2JVC A;  3N3K B;  2ZPN A;  1JRP A;  1MG4 A;  1QOB A;  4FJV B;  2KAJ A;  2WXM A;  1MG8 A;  5HFY A;  2KNB A;  5LLI A;  4WQM A;  2VZK B;  1NBF C;  3FC4 A;  3AE5 B;  1NEN B;  4M0W A;  1T0R C;  1FPY A;  1K52 A;  4IW0 A;  4MGI E;  5LXH A;  2W3R A;  3D32 A;  1SE4 A;  4PS8 A;  2V3S A;  2LFI A;  2PW9 A;  1QZE A;  2PLP A;  3VH4 B;  2AQ3 B;  1RWS A;  1XXG A;  2YEP F;  5IOI A;  4LLG M;  3SU8 X;  1I4R A;  2D3A A;  3ABV B;  2WXN A;  3P4P B;  4GDL B;  1TYG B;  5CHV C;  3R7Q A;  4F7Z A;  2WXH A;  1EF5 A;  1UWX A;  1RAX A;  2J0M A;  4TKN A;  3HIZ A;  5BMG A;  3DVG Y;  1YMH E;  4URK A;  4DXG A;  3R7R A;  2E6X A;  3DOW A;  4OZA A;  3IHP C;  2LD9 A;  2JQR B;  1CK1 A;  3PT2 B;  3ZIM A;  3MJW A;  3R66 C;  2CKH B;  4BBN C;  2KVZ A;  3NVZ A;  3RYT A;  3P4Q B;  3H6N A;  2KTR A;  4M02 A;  3R2I A;  3DBS A;  4ZOH C;  4K3C A;  2I1K A;  3WAL A;  1OQY A;  3FIL A;  1IBX B;  3QQ8 B;  4HVB A;  2G1E A;  3AI5 A;  4B95 A;  1EWY C;  4JIO U;  2CR5 A;  1FXT B;  2SEB D;  4RH6 A;  2LXA A;  4HKZ E;  3M3J A;  2RGF A;  1WE6 A;  2KAC A;  1KLV A;  2MBQ A;  1KM7 A;  3VAW A;  2NMQ A;  2DZK A;  2WDT B;  2HDE A;  4GIV A;  4KGS A;  4LNK A;  4JWU C;  1KF6 B;  4FLH A;  3NUH B;  2C7M B;  2MCN B;  2JXT A;  2N1W A;  1QOF A;  2MJ3 A;  2KKC A;  3K9O B;  1VLB A;  1R4M B;  4USA A;  3MC0 B;  3DHI C;  1CQV A;  2DWQ A;  2FIF A;  2WXQ A;  1F52 A;  1P9D U;  2EKE C;  4ZYS A;  5JZE B;  3DBH I;  3U52 E;  2FID A;  4W9H A;  2WP9 B;  3R2T A;  3UI3 A;  2BYE A;  3P42 A;  1KLG D;  2KQ7 A;  3TMP B;  3L16 A;  2BW2 A;  2Q5W D;  3RNE C;  3VHT C;  1VZ7 A;  4KZ0 A;  2C60 A;  3V62 A;  2N9L A;  4WIP A;  4C56 C;  3EEC A;  3PZ7 A;  2YLM A;  4D2K A;  1D6E C;  2N7J A;  1YJI A;  1F2R C;  3N32 A;  4HWI B;  2KDB A;  5CHF A;  3BIN A;  3EGR A;  3PRM B;  3V6C B;  1J0G A;  1SEB D;  3VFK A;  2R61 A;  3KUD B;  4PYU A;  3QK0 A;  4LNO A;  2MP2 B;  1E0Z A;  4WWO A;  4XDD A;  3UF8 A;  1KOT A;  1TKE A;  2JSV X;  1UD7 A;  3TUO A;  2NPT B;  3QC8 B;  4HXD A;  2CHZ A;  1PFD A;  3PTF C;  1UF0 A;  1V8C A;  1GOZ A;  3H9D A;  3PGE A;  3H7S A;  2KTR B;  3HM3 A;  3MJ5 A;  2CJO A;  4KIK B;  1YQ3 B;  4GDL A;  1KFY B;  4I6N B;  2FCM A;  3VR8 B;  3GS2 A;  2XK5 B;  1TIF A;  3BYT B;  4O1N A;  3OJ4 B;  2LVO A;  1BUI C;  2W82 A;  4LNN A;  5BMI A;  2MHJ A;  3AN1 A;  2MP2 A;  3ZKJ C;  3R3M A;  4B0E A;  3J9C A;  1XD3 B;  4RGN A;  4XYC A;  3Q3M C;  4BKS A;  1V1P A;  2NR2 A;  2HTH A;  4ZHO A;  2KMM A;  3ZJU A;  2RPQ A;  4C80 A;  4MDK E;  1YD8 U;  3AU4 A;  2C9W B;  2PIA A;  3IFW B;  3NVW A;  2O6V D;  4CYE A;  1K8R B;  2KDE B;  3APD A;  1RYJ A;  4HPM B;  5IA7 A;  2XN9 C;  4IKG A;  2V3N A;  3V6E B;  4Q2J A;  3SD5 A;  2DZM A;  1PUT A;  4JX1 C;  3QJZ A;  4C4V A;  2VRR B;  3VTU A;  1WI0 A;  3LXF A;  1FD6 A;  2ASQ A;  2N7D A;  4IM3 A;  1P3Q U;  2I1J A;  3A9J B;  5HKH A;  1FMA D;  2JWU A;  1V2Y A;  3AE6 B;  3VXW A;  1L2N A;  3CWI A;  1YQ4 B;  1PDX A;  1DOY A;  4YTM B;  2WXP A;  3FKY A;  4WJQ A;  4EEW A;  2J7Q B;  1UBQ A;  4MGZ E;  5E6J A;  2KTF A;  3DBR B;  3N1X C;  2ZW1 A;  2AX5 A;  1X1M A;  1I7H A;  2C5L C;  2K5P A;  1Y8R C;  3IXS A;  1OEY A;  4S0R A;  1N60 A;  3U7D A;  3NHE B;  4IM2 A;  1NYQ A;  3KLS X;  2QJL A;  2RDB C;  1WR6 E;  2J42 A;  1WMH B;  4AOF A;  1ZPS A;  3NZ3 A;  4YWG G;  2DYO A;  1P7F A;  3I5J C;  5I4D A;  1E8X A;  1WGD A;  2QC8 A;  3KWL A;  3VRB B;  1KTK A;  4FUL A;  2FBW B;  3W1Y A;  3DBL B;  5D3I B;  1L0X B;  3QA8 A;  2KC1 A;  4LTU A;  1YQB A;  2LVQ A;  3GE3 C;  1F2R I;  4ANV A;  2LGS A;  3KYD D;  2L76 A;  1LFD A;  3MC9 A;  2SAK A;  1SGH A;  3WAP A;  4PT5 A;  3N1Z C;  1IPG A;  2WXG A;  1XLP A;  4A9A A;  3VUY A;  2OJR A;  3DHH C;  2JT4 B;  2PE9 A;  4A6Q A;  3EFU A;  4YSX B;  2KDI A;  3AE2 B;  5BYQ A;  3ZTD A;  2BT6 A;  4OHJ A;  1PGX A;  2BYV E;  2MJD A;  5FK9 C;  3KUC B;  2IJ0 A;  4FBJ B;  5JXV A;  1YN4 A;  2PEA A;  3RNB C;  1WYG A;  4NAM A;  4WQO B;  2BB6 A;  3RFZ B;  4OVZ A;  2LZ6 A;  1JQ4 A;  2INC C;  1P98 A;  4YSY B;  1XT9 B;  1ZXH A;  2W55 A;  2H88 B;  4HCP B;  3B2G A;  3SHQ A;  3X0W A;  2AEH A;  1J19 A;  3ECI A;  1HTQ A;  1NI3 A;  2KFK A;  3SDL C;  2JXX A;  4ZHP A;  1VZ6 A;  1OQQ A;  3ZXV A;  3TJP A;  3JVZ X;  4GOC A;  3ZQ4 A;  2MRP A;  4F8C B;  4YXD B;  3Q8C A;  1G6J A;  3BK1 A;  1NVI D;  4MJS A;  1WXQ A;  4ANX A;  1WJU A;  2IO1 B;  1KRH A;  3CF6 E;  4RF1 A;  3JYU A;  1A5R A;  3W5V B;  3DBH B;  1EU4 A;  5FR6 A;  5G5G A;  2ZVO A;  4NAW A;  1WY8 A;  1EU3 A;  2I2Y A;  2O2V A;  2J53 A;  4I6L B;  4JLC A;  1T0Q C;  2KFJ A;  3ZW3 A;  3KVF B;  3EUB 2;  4TQ0 A;  2G45 B;  3NVY A;  4FHJ A;  2KVR A;  3ALB A;  1Y56 A;  2NTS A;  1E9M A;  3H7P B;  4GSW A;  2G3Q B;  3WIM A;  1ROE A;  1XLQ A;  4KX6 B;  3K9P B;  2JRH A;  2LRW A;  3ZO5 B;  1I4H A;  1FFU A;  2INP E;  4RGM A;  3ZXR A;  1FEH A;  1JAL A;  1MI0 A;  3WAO A;  4AQ7 A;  1WXM A;  3L08 A;  1N5W A;  4CO7 A;  2G4S A;  1OTR B;  3TL5 A;  5JHB A;  2EEL A;  1ZXI A;  1CMX B;  5H92 C;  4TSS A;  4EZL A;  1C4A A;  1EM7 A;  3PRE A;  2M1M A;  4RGT A;  1QKZ A;  3ZTC A;  2ON8 A;  3CSF A;  4B6W A;  4DXA B;  2MJE A;  2IPK D;  4W9C A;  4B0M A;  2BB5 A;  4MH8 A;  3DBL I;  3L17 A;  3NG0 A;  3AE7 B;  5AZH A;  5TSS A;  3AEC B;  1N62 A;  4K81 A;  3A9K B;  2FUH B; 
#chains in the Genus database with same CATH homology
 1P1A A;  4W9K A;  4HVB A;  4NY0 A;  1WR1 A;  3AI5 A;  2CU1 A;  4B95 A;  3KYC D;  2C7H A;  2WX1 A;  4JIO U;  1EUV B;  2NCN A;  1GC6 A;  3GZN I;  2IO2 B;  2CR5 A;  4MEM A;  1FXT B;  5DPW A;  4GMV A;  3JSV B;  1ZW7 A;  2ZNV B;  2DX5 B;  3VDZ A;  4OVV A;  2LXA A;  2KX3 A;  3M62 B;  3OLM D;  2GBK A;  3M3J A;  3O65 B;  1GJZ A;  1F9J A;  2R2Q A;  1WMH A;  1V81 A;  2RGF A;  3S2A A;  3ZNG C;  1WFY A;  1WE6 A;  3A9J A;  2MW5 A;  1KLV A;  2KMA A;  2MBQ A;  1KM7 A;  3VAW A;  1E8W A;  3PRP B;  3ZUN A;  2XEW A;  2DZK A;  3AXC A;  4G50 A;  3PS6 A;  2WDT B;  1D3Z A;  2YVC A;  4HPL B;  4GIV A;  1I35 A;  2N1V A;  2LRU A;  1GC7 A;  3A4S C;  3UIP B;  4ICU A;  2BKF A;  4NNJ B;  2FCQ A;  2LVP A;  3DVG X;  4ICV A;  4FLH A;  1VCB A;  4MSQ B;  2C7M B;  3VUW A;  2MCN B;  2N1W A;  5D7G A;  2L0T A;  4GN1 A;  1ZKH A;  2PJH A;  2DEN B;  5C1Z A;  2KKC A;  2KO3 A;  3JSV A;  2Z59 B;  3K9O B;  3ZLZ A;  5EDS A;  4IG7 B;  5D2M B;  3V61 A;  4A3P A;  1E5W A;  2MBE A;  2K1F A;  4I6P A;  5AZG A;  2KOX A;  1UEL A;  3ENE A;  2DAF A;  1GUA B;  3L13 A;  3VTV A;  4HK2 A;  2FIF A;  3RT3 B;  2KQS A;  1P9D U;  2EKE C;  3AUL A;  5J17 A;  5JH5 C;  4DDI D;  5JZE B;  3DBH I;  2KLC A;  2K25 A;  1E8Y A;  2FID A;  4W9H A;  4II2 B;  3PSE B;  4IC7 B;  1C3T A;  2BYE A;  2LXC A;  4NPN A;  2KJ6 A;  4CHK A;  2KQ7 A;  3DBR I;  3TMP B;  3L16 A;  4HDQ A;  2KN5 A;  4IWQ A;  3OJ3 A;  4MM3 A;  1SE9 A;  4G0N B;  2KWU B;  3VHT C;  1IYF A;  2D10 A;  2DZJ A;  2KXJ A;  2KK8 A;  2C60 A;  2G4D B;  2PPH A;  1WJ4 A;  4KZ0 A;  3V62 A;  4LDT B;  2FCN A;  4AJW A;  3EEC A;  2YLM A;  1WGG A;  3M95 A;  5E6P A;  2GMI C;  4K7U A;  4XX5 A;  5J18 A;  4MGK E;  4PYZ A;  2KHW B;  1LM8 B;  5D94 A;  3ZVV A;  2IY0 B;  5D6J B;  4BFR A;  2NBW B;  4EKU A;  4F1S A;  1UZX B;  2K39 A;  3A4R A;  3RZW C;  3N32 A;  2GBM A;  4HWI B;  2KDB A;  4LJO B;  5CHF A;  1UGM A;  3BIN A;  5DPT A;  3PRM B;  4HJK A;  3ZRF A;  3V6C B;  1J0G A;  3VFK A;  2REX A;  3KUD B;  4PYU A;  4BOS C;  3QK0 A;  2MP2 B;  4WWO A;  1T0Y A;  4AP4 C;  2IY1 B;  3UF8 A;  1S1Q B;  2KAN A;  3LJ3 A;  2LGY A;  4N9F 4;  4MGY E;  1KOT A;  4FAD A;  4RM8 A;  4A20 A;  1OGW A;  1UD7 A;  3DQV A;  4ZDV A;  2NPT B;  2UYZ B;  3QC8 B;  4II3 B;  2HE7 A;  4HXD A;  2CHZ A;  4NJ7 A;  3PTF C;  4X57 B;  2O6V A;  2ZEQ A;  3H9D A;  3PGE A;  5LXI B;  2L05 A;  3A9K A;  3H7S A;  2KTR B;  3HM3 A;  4ZRJ A;  3ZDT A;  4GGQ A;  3B0A A;  4KIK B;  3W1S A;  4IM0 A;  3UIO B;  4GDL A;  1WXA A;  3ZRC A;  1J8C A;  1WZ3 A;  3TIX A;  2WWZ A;  2J0K A;  3KH0 A;  1WM3 A;  3ZDM C;  4I6N B;  2FCM A;  5DCN A;  4XC2 A;  4K7S A;  2XK5 B;  4TQ1 A;  3AU5 A;  1JRU A;  1Q1O A;  2XBB C;  3OJ4 B;  2LVO A;  4ASW C;  1WYW B;  2AL3 A;  2BWE S;  2L3Z A;  2MX2 A;  3MTN B;  4FA6 A;  2M4N A;  2MP2 A;  1IP9 A;  4LJP B;  3ZKJ C;  3R3M A;  5L83 A;  4NJ6 A;  2DYM A;  3EHV A;  1E7V A;  2N9E B;  5L95 C;  1XD3 B;  1UBI A;  3ML8 A;  2L00 B;  4NQL B;  4XZ4 A;  4HDO A;  4TV3 A;  1WF9 A;  3T9L A;  5G55 A;  4DHJ D;  3M63 B;  4BKS A;  1V80 A;  3PV1 A;  3RCZ A;  3TBL D;  2JWZ A;  3PVL A;  2NR2 A;  2NVU I;  2HTH A;  2B3A A;  1TZ1 A;  2UWQ A;  2QHO A;  2J0J A;  4WWP A;  2RPQ A;  2V1Y A;  4K7W A;  4MDK E;  1YD8 U;  2LI5 A;  4GB9 A;  1M94 A;  3AU4 A;  2C9W B;  2KX0 A;  3W1S C;  4G11 A;  3IFW B;  1LXD A;  5C23 A;  1TGZ B;  3QX1 A;  2O6V D;  1GNU A;  2KZR A;  1Z5S B;  4CYE A;  1K8R B;  2KDE B;  3APD A;  1RLF A;  4EFO A;  4HPM B;  3L10 B;  5IA7 A;  4AWJ A;  2EMS A;  3QHT A;  2NPT A;  1L7Y A;  1WGY A;  2WX0 A;  3V6E B;  3ZNH B;  3HM6 X;  3SD5 A;  2CHW A;  2NBV B;  2DZM A;  2GBN A;  2KJH B;  2L7R A;  4E71 A;  3QAR A;  2JUO A;  3QJZ A;  3DDC B;  1WX7 A;  2VRR B;  2IO0 B;  4EZJ A;  3VTU A;  1WI0 A;  4W9F A;  3TCA A;  3U30 A;  4DHJ B;  2BKR B;  2ASQ A;  2DZI A;  2ZNV C;  2N7D A;  2ZVN A;  4IM3 A;  1P3Q U;  2I1J A;  3VTW A;  3A9J B;  4LDT D;  1R4N I;  5HKH A;  4IWP A;  2MBO A;  3VQI A;  4GDK B;  1V2Y A;  4GU2 A;  3VXW A;  4GDK A;  2BPS A;  1L2N A;  3Q3F A;  4BKT A;  2DHZ A;  3QIJ A;  4G3X B;  2D3G A;  3IVF A;  2BGF A;  1TTN A;  2FCS A;  3A1Q B;  1AAR A;  2JZZ A;  4JL9 A;  4WJQ A;  3ML9 A;  4EEW A;  3CMM B;  5IAA C;  2J7Q B;  4JGH B;  1UBQ A;  5G2N A;  1Q5W B;  3KUZ A;  4MGZ E;  2M17 A;  2KTF A;  5BO4 B;  4A3O A;  1V49 A;  2DAJ A;  3UQA A;  1X1M A;  2C5L C;  3UIN B;  1Y8R C;  1OEY A;  1Z2M A;  2D2Q A;  3U7D A;  2N4F A;  3NHE B;  4IM2 A;  3V60 A;  4AJY B;  1HE8 A;  1WR6 E;  1WMH B;  2K6D B;  4W9L A;  2K8C A;  3NZS A;  3RD2 A;  4AOF A;  4EZK A;  4PS7 A;  3RUL A;  2IO3 B;  2O2V B;  2BWF A;  2JRI B;  1OEY J;  2LJ5 A;  3ONS A;  3WAN A;  2DYO A;  3PRZ A;  1TBE A;  3DCG A;  1E8X A;  4IWO A;  1WGD A;  3ZNZ B;  2KC2 A;  4B9K A;  1E7U A;  4FUL A;  3APF A;  3QWZ B;  2MBB B;  2MWS B;  3Q3J A;  4NAW B;  4M8M A;  1XQQ A;  1GG3 A;  5JHA A;  2XK5 A;  2BF8 B;  4FJY A;  3W1Y A;  1H4R A;  3HHM A;  3QA8 A;  2KC1 A;  1YQB A;  5DPR A;  4K1R B;  2LVQ A;  1WXV A;  4P7I A;  2OOB B;  4ANV A;  3IBE A;  1WX9 A;  1YJ1 A;  1EO6 A;  3DPD A;  3KYD D;  1PQS A;  2L76 A;  1LFD A;  3WAP A;  1SGH A;  2N9X A;  1WE7 A;  4KSL C;  4RM9 A;  3UQB A;  3P2B A;  3NOB A;  2CS4 A;  4WAA A;  1IPG A;  2JPH A;  2LGD A;  5E6N A;  2A4Z A;  3VUY A;  4DHZ B;  5AEK B;  2OJR A;  1SIF A;  1WZ0 A;  2JT4 B;  1YX6 B;  1WGH A;  1YIW A;  2GBR A;  2Z0E B;  2PE9 A;  2DYB A;  3OAW A;  2ZCB A;  3I3T B;  2K6Q A;  3EFU A;  3EC8 A;  4HLE A;  2KDI A;  2HJ8 A;  4ANU A;  2JF5 A;  3ZTD A;  3H1U A;  2M8S A;  4IUM B;  4KZC A;  4LCD E;  4J6I A;  3L54 A;  1E8Z A;  2D07 B;  2BYV E;  4DHZ E;  1WGR A;  4ZYN A;  5CHW A;  2NS5 A;  2CHX A;  3KUC B;  3PLU A;  2WYQ A;  4EOY A;  1E90 A;  2MSE D;  4FBJ B;  1ISN A;  2R2O A;  2RD0 A;  4JQW C;  1S3S G;  2PEA A;  1UH6 A;  4KVG B;  1LQB A;  4PS3 A;  1WIA A;  3A33 B;  2KMC A;  2N9P C;  4WQO B;  5E6O A;  4RMA A;  2NBU A;  1C1Y B;  2GBJ A;  2LZ6 A;  1RRB A;  1YX5 B;  2AL6 A;  2M0X A;  3GOE A;  1P98 A;  3NY5 A;  3RUI B;  1XT9 B;  4BOZ B;  4AUQ C;  4E3C A;  1WXS A;  3L0W B;  4KIK A;  2JZ3 B;  2KWV B;  3QQ8 B;  1EF1 A;  4HCP B;  4EUT A;  3PHX B;  2BYF A;  5J2R A;  3PLV A;  3SHQ A;  3X0W A;  2AEH A;  4NQK E;  1J19 A;  2IYD B;  2JY6 A;  2K8H A;  3ECI A;  2A5U A;  1V86 A;  2KFK A;  3SDL C;  2JXX A;  3LDZ E;  5GMV A;  3RZF A;  1R4M I;  1WRD B;  2LAS A;  1V5O A;  4KDL B;  4MEL A;  3X23 A;  2ZJD A;  4M8N A;  4YL8 A;  5CTR C;  3TJP A;  4BKG A;  3JVZ X;  2C7N B;  4GOC A;  2ZCC A;  2AWT A;  1ZGU B;  5CX3 A;  2MRP A;  2HD5 B;  4F8C B;  4OVU A;  2KDF B;  1WM2 A;  3BY4 B;  1G6J A;  3N3K B;  2JVC A;  2ZPN A;  4MJS A;  4FN2 A;  4ANX A;  3PZD A;  1WJU A;  2IO1 B;  4FJV B;  2K8B A;  3CF6 E;  4MSM B;  4WJO A;  1BT0 A;  1WJ6 A;  2RSU A;  2Y5B B;  3JYU A;  1A5R A;  3IG3 A;  3NS8 A;  1MG8 A;  2FNJ B;  4BVU C;  4GXB A;  4TUU A;  2KNB A;  5LLI A;  5FR6 A;  1NBF C;  2ZVO A;  3NZU A;  3DVN U;  4NAW A;  1I42 A;  1WY8 A;  4WJP A;  4DWF A;  3WA0 A;  2KFK B;  4M0W B;  2O2V A;  2EMT A;  2KWC A;  4ANW A;  2LUE A;  4I6L B;  2IBI B;  2L0F A;  3DVN V;  4JLC A;  4DDG D;  4DK5 A;  2KFJ A;  3ZW3 A;  3T8M A;  4IW0 A;  4MGI E;  3KVF B;  5LXH A;  2LGX A;  3B1L X;  4TQ0 A;  3MHS D;  4BBN F;  2G45 B;  1P0R A;  3D32 A;  4FHJ A;  2MQJ A;  2KVR A;  3ALB A;  3APC A;  2MA9 B;  3VVW B;  3WAM A;  4PS8 A;  5TR5 A;  2V3S A;  4ZRK A;  4DBG A;  4WWN A;  3H7P B;  3C0R B;  2Z0D B;  4GSW A;  2G3Q B;  2FAZ A;  1QZE A;  2L8J A;  3WIM A;  3KW5 B;  2MLB A;  2PE6 B;  3VH4 B;  3K9P B;  1RFA A;  1WH3 A;  2JRH A;  3PPA A;  2LRW A;  2RR9 A;  3ZO5 B;  3QCA A;  1H8C A;  3SU8 X;  1WX8 A;  2KLG A;  3VH3 B;  1V5T A;  2N7E A;  4GDL B;  3WAO A;  1WXM A;  3L08 A;  4W9I A;  1VD2 A;  5CHV C;  3R7Q A;  2LWP A;  4W9E A;  3UGB B;  4F7Z A;  3A1Q A;  1EF5 A;  2AYO B;  3B08 A;  4BKS D;  1RAX A;  2J0M A;  4TKN A;  4CO7 A;  2G4S A;  4WJN A;  1OTR B;  3TL5 A;  2MBH A;  3HIZ A;  1WJN A;  5JHB A;  1KJT A;  3DVG Y;  4ZRI A;  4URK A;  1Q0W B;  2D11 A;  1NI2 A;  1CMX B;  2KJR A;  2W9N A;  3U8Z A;  3QAQ A;  4FHK A;  2ZZP B;  3R7R A;  3VUX A;  4EZL A;  1NDD A;  2KD0 A;  3HK0 A;  3DOW A;  3PRE A;  2M1M A;  4MJS B;  1V6E A;  3ZTC A;  3IHP C;  2LD9 A;  3CSF A;  4MH0 E;  3PT2 B;  3JW0 X;  4FJZ A;  4KSK C;  3MJW A;  4HCN B;  3R66 C;  3H7P A;  3ZIM A;  4B6W A;  5KHQ A;  4KDI C;  4DXA B;  5KHO A;  4W9C A;  1V9J A;  2CKH B;  5AZF A;  3PHW B;  4BBN C;  3DBL I;  3ZNI D;  2V4L A;  3CST A;  3L17 A;  4W9J A;  5AZH A;  3RYT A;  4KV2 A;  3H6N A;  2KTR A;  3N30 A;  2O6V B;  3DBS A;  4K81 A;  1U4A A;  4W9G A;  2I1K A;  3A9K B;  3WAL A;  4E74 A;  1OQY A;  2GOW A;  5DPS A;  2IZV B;  4W9D A;  2ZPY A;  2FUH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...