4FJVB

Crystal structure of human otubain2 and ubiquitin complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
b'DVPDYAHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase OTUB2
publication title The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 20
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4fjvB00
1OTRB 1R4MI 2J0KA 3KUZA 3N30A 3QQ8B 2M4NA 3CMMB 3APFA 4K7UA 2IO0B 4HCPB 2LGXA 3EFUA 2DAFA 3VUWA 2CHWA 2KX0A 3W1SC 4IWOA 4JL9A 2O6VB 5E6NA 3A9JB 4AJWA 1K8RB 4NAWB 3APDA 4EFOA 3AI5A 2VRRB 2N9PC 5BO4B 4F1SA 2LRUA 4MGZE 3PVLA 2MWSB 4ZYNA 2BWES 2KX3A 1SIFA 2AL3A 2KXJA 4DHZE 3PGEA 1GC7A 4I6NB 5CHVC 1WXAA 3DOWA 1I42A 2WX0A 4F8CB 3DVNU 2EMSA 2K39A 2KFKA 2LVPA 2NS5A 1QZEA 1WGRA 2RPQA 5EDSA 2HJ8A 3DBSA 4NJ7A 3L54A 5C1ZA 3SU8X 4M8MA 1UD7A 2D10A 1ZW7A 3ML8A 5JHBA 3A4RA 1E8XA 1WXSA 2JVCA 3MHSD 4ICUA 4ANVA 3OAWA 2D07B 2G45B 2BWFA 3NHEB 3ZKJC 3TIXA 1GC6A 2FIFA 4KIKA 3WANA 1H8CA 1TZ1A 1WR1A 1P98A 2LASA 3HIZA 3BINA 3PREA 1L2NA 1Z5SB 2PEAA 4FN2A 2KD0A 5E6OA 2ZCBA 2BKRB 3UF8A 2DHZA 4PS7A 4IUMB 1Q0WB 1GJZA 3R66C 2R2QA 1P0RA 2I1JA 3DQVA 4XZ4A 1WX9A 2V4LA 3QA8A 1WIAA 4MDKE 1YIWA 2WYQA 5J18A 2NVUI 4BKSA 4DDID 5DPRA 3QIJA 1VD2A 2ZPYA 2JWZA 3WA0A 4EKUA 4MSQB 1LQBA 2IYDB 2DENB 5L95C 5J17A 1J0GA 2XK5A 4WWPA 4F7ZA 4BBNC 4ANWA 2K6DB 2RD0A 1GUAB 2JZ3B 1T0YA 2WDTB 3KYDD 3M63B 4MSMB 4OVUA 4TUUA 2C5LC 3TJPA 2L8JA 2LWPA 4BOSC 2EKEC 2J7QB 4WQOB 5LLIA 2C60A 1C1YB 4X57B 4HCNB 4WWOA 4BKGA 4G0NB 4KZCA 2KTRA 1WGHA 3L17A 4EOYA 2BGFA 3R3MA 4E74A 2KC2A 4WJQA 1PQSA 2AL6A 4GB9A 4GDKB 2V3SA 2BPSA 3OLMD 3DCGA 4RM9A 5CTRC 5CHWA 5LXIB 3OJ3A 2AEHA 2BYVE 2O2VB 3QARA 2CKHB 5AZGA 3ZNZB 4HLEA 2L00B 1I35A 3IBEA 4FULA 2D2QA 3PTFC 5IA7A 1KJTA 4ASWC 2FNJB 1WXMA 4NJ6A 3VAWA 1EO6A 1TBEA 3K9PB 2KKCA 2MRPA 2FCSA 2O6VD 4EZJA 3C0RB 3T9LA 1E7UA 1KM7A 4NNJB 2AYOB 3VH4B 2DZJA 3R7RA 1U4AA 4YL8A 4BFRA 5AEKB 1VCBA 2HTHA 1XD3B 2K1FA 3IFWB 3KW5B 3X23A 2GBRA 4II2B 3PRPB 4DK5A 2BKFA 1V5TA 1WM3A 2K8BA 3QK0A 1JRUA 4PS8A 4WWNA 2DZMA 3VVWB 4AOFA 3AU4A 1UH6A 2IY0B 2DYOA 3UINB 3DVGY 1HE8A 1Q5WB 3TBLD 1SGHA 2DAJA 3PRMB 1OGWA 4E3CA 1EUVB 4MJSA 2C7NB 1UELA 2KJRA 3U30A 4W9JA 1RLFA 2LI5A 2A5UA 1WGDA 2L7RA 2N1VA 1E8YA 2KQSA 2MBQA 5KHQA 3ZW3A 4BOZB 2PJHA 4NQKE 3A9KA 2NBWB 2EMTA 1WY8A 3A33B 4TQ1A 5D94A 3VUXA 2DX5B 1WX7A 1UGMA 3QX1A 2OJRA 2OOBB 3RYTA 3ZRFA 2LZ6A 1UBQA 4DDGD 3QAQA 2MP2B 1YX6B 3PPAA 1J8CA 2ZJDA 3PSEB 3SD5A 2IZVB 2MX2A 2MBBB 3P2BA 2KZRA 4GGQA 4GOCA 2GBKA 2JPHA 2G4SA 3L08A 2WWZA 3TL5A 2ZNVC 1S3SG 4FJYA 4KDIC 2KDBA 3RD2A 3V6EB 1OQYA 2BYEA 2V1YA 3VUYA 3ALBA 3CSFA 2IO1B 3QCAA 3DPDA 2XBBC 4LJOB 1G6JA 3DBLI 4ZRIA 3DBHI 1KLVA 4ZDVA 2C7MB 3KH0A 3JSVA 3L10B 3VDZA 2C9WB 3PS6A 1V86A 3A1QB 4GDLB 2JXXA 4HPMB 1IYFA 2FCNA 5G55A 4IWQA 2DYBA 2NPTA 3ZO5B 4ANUA 3NZUA 3TMPB 4HDOA 3D32A 3H1UA 5AZFA 3VFKA 1WJNA 2ZZPB 2YVCA 1ISNA 1A5RA 4EEWA 2MBHA 1WH3A 3H7PB 3X0WA 4IC7B 2O6VA 3A9JA 4B9KA 3UQBA 4NAWA 3K9OB 1XT9B 4B6WA 3DDCB 4MGYE 2KTFA 3R7QA 3EECA 1ZKHA 5G2NA 3NS8A 3AU5A 1AARA 2KDFB 4I6PA 1E8WA 2M1MA 1F9JA 2R2OA 4GXBA 5D6JB 1P1AA 3OJ4B 4LCDE 2GMIC 3WIMA 4NY0A 3WAPA 2KOXA 4A20A 1WR6E 1YX5B 4M0WB 2K6QA 2ZEQA 3M95A 2CR5A 2IBIB 2M0XA 2Z0EB 4GSWA 4E71A 2J0MA 4FA6A 3AXCA 1BT0A 2LXCA 3IHPC 4MGKE 2ZPNA 2WX1A 3IVFA 1WMHB 3BY4B 2KWCA 4JLCA 1WZ3A 1EF1A 5DPSA 4TKNA 4WJNA 2NCNA 1YJ1A 2FCQA 4MELA 3SDLC 1WJ6A 2N7EA 4G3XB 4G50A 3ONSA 3V60A 1TTNA 3VTWA 2RGFA 5TR5A 2CHXA 2M17A 4M8NA 3ZTCA 1NDDA 3ZNHB 4HXDA 3S2AA 4LDTB 1P9DU 3RCZA 2LD9A 5KHOA 2MLBA 2PE9A 3Q3JA 2L05A 3EC8A 3H7SA 2KDIA 4W9GA 3I3TB 1Q1OA 2MCNB 2BF8B 3LDZE 2D11A 4HDQA 3VH3B 1WGGA 2KWVB 5D7GA 4IM3A 4CYEA 3ZTDA 4EUTA 1UZXB 2RR9A 4JQWC 2LVOA 3DVGX 3B0AA 1C3TA 2A4ZA 3ZNID 2KO3A 4K81A 4ZRJA 3GOEA 5GMVA 5JH5C 3U8ZA 3HHMA 1WJ4A 2N4FA 2ZNVB 2JUOA 3NY5A 2GBJA 3RZFA 3PLUA 1GNUA 3RULA 3HM3A 1ZGUB 4FHJA 5C23A 2HD5B 3KYCD 5DCNA 4GIVA 2KN5A 1YD8U 2KJHB 2J0JA 1NI2A 3KUDB 3V6CB 4WJOA 2JY6A 1LM8B 4KZ0A 2KC1A 4GDKA 2KWUB 4N9F4 3VTVA 1WM2A 2LGDA 2N9EB 4DHJB 1OEYJ 2KFKB 2FCMA 4AJYB 2FAZA 2NR2A 2O2VA 4BVUC 4W9HA 4J6IA 3W1YA 1E90A 2N7DA 1E5WA 3QC8B 2YLMA 3RT3B 4I6LB 4TV3A 1WFYA 4NPNA 2C7HA 2GBNA 2JRIB 4W9LA 3W1SA 4G11A 1TGZB 2GBMA 3WAOA 3PV1A 3APCA 3KUCB 3U7DA 1E8ZA 2CS4A 2K8HA 4JGHB 1WGYA 4W9EA 1P3QU 3PRZA 4IM2A 1LXDA 1WX8A 3JVZX 4MH0E 5IAAC 4KIKB 2REXA 1SE9A 4XX5A 3KVFB 2M8SA 4CO7A 3ZDMC 3GZNI 1GG3A 3M62B 4ICVA 2L76A 2W9NA 3HM6X 3ZRCA 3M3JA 4FJZA 1UBIA 3L0WB 4HPLB 3L16A 4DXAB 2LUEA 1V2YA 3PZDA 2MA9B 2MBEA 2BYFA 4RM8A 2LRWA 2N1WA 3CF6E 5HKHA 3VHTC 4PYUA 1J19A 2NBUA 3RUIB 5L83A 4AUQC 3ZIMA 4DWFA 3ENEA 2K25A 2KJ6A 3T8MA 3UGBB 3EHVA 2ZVNA 1V81A 3H9DA 3UQAA 2JRHA 3B1LX 3WAMA 2ASQA 1OEYA 3PT2B 3ZVVA 1R4NI 1L7YA 3TCAA 2XK5B 2LVQA 4K1RB 1RFAA 4K7SA 4MEMA 1M94A 3B08A 4NQLB 2KFJA 3ZNGC 2KNBA 5LXHA 3N3KB 1WXVA 3H6NA 4EZKA 2KMCA 4IW0A 1V49A 3MJWA 5AZHA 2G3QB 4W9FA 2B3AA 4JIOU 3VTUA 3UIOB 2DZKA 3IG3A 2UWQA 1MG8A 3DVNV 4KSLC 4LDTD 2KTRB 2MP2A 4HVBA 3ZUNA 4FJVB 2KMAA 5JHAA 4URKA 4KDLB 2L0TA 3PLVA 5E6PA 2FUHB 2NBVB 1V6EA 3DBRI 2GOWA 4HJKA 4K7WA 2DYMA 1D3ZA 3AULA 2KANA 2RSUA 2LGYA 2LJ5A 1WF9A 3L13A 2G4DB 4DBGA 2JT4B 1FXTB 4B95A 3VXWA 3ML9A 3UIPB 3QHTA 4HK2A 5DPTA 2Y5BB 2N9XA 4TQ0A 1WYWB 3A1QA 4GDLA 2K8CA 4P7IA 4PYZA 3HK0A 3RZWC 1NBFC 4FHKA 2XEWA 3V62A 3PHXB 3A4SC 2JF5A 4DHZB 4ZRKA 1KOTA 4KV2A 4MGIE 2QHOA 2D3GA 5CX3A 2I1KA 2HE7A 4FADA 1CMXB 4IWPA 2IO2B 2L3ZA 3H7PA 4W9DA 3NZSA 3ZDTA 4DHJD 5JZEB 4GN1A 1YQBA 3PHWB 4RMAA 2MQJA 1LFDA 2AWTA 2IY1B 4W9IA 2KLCA 3WALA 3NOBA 4FBJB 5J2RA 4W9KA 3MTNB 2KLGA 1Z2MA 4AP4C 4W9CA 2Z59B 4MJSB 1EF5A 2Z0DB 3JYUA 1WI0A 1WJUA 4AWJA 2MBOA 1RRBA 1IP9A 4FLHA 4IM0A 3A9KB 1WE7A 4BBNF 1XQQA 3ECIA 4II3B 4WJPA 1IPGA 2ZVOA 2JZZA 3Q3FA 3O65B 2KK8A 3QJZA 4GMVA 4KVGB 4OVVA 4A3PA 2DZIA 4A3OA 2IO3B 2KQ7A 2LXAA 2ZCCA 2KHWB 1WMHA 2CHZA 1S1QB 2FIDA 3N32A 3V61A 2MW5A 1WZ0A 1H4RA 4MM3A 4XC2A 4ANXA 1X1MA 2CU1A 2KDEB 4BKSD 3QWZB 4WAAA 5D2MB 2MSED 3VQIA 4BKTA 1RAXA 1E7VA 1WRDB 4GU2A 4IG7B 2L0FA 1Y8RC 4CHKA 1V5OA 5DPWA 3LJ3A 4EZLA 1V9JA 3CSTA 1V80A 4PS3A 3JW0X 3JSVB 4KSKC 5CHFA 3ZLZA 2UYZB 2KVRA 2PPHA 4LJPB 5FR6A 2PE6B 3SHQA 2NPTB 4HWIB 1WE6A
chains in the Genus database with same CATH superfamily
2QIEB 1XLNA 4YSYB 1TS5A 3EFUA 4TMAB 1E0ZA 2CHWA 3W1SC 4IWOA 1TS4A 5E6NA 3PZ7A 3APDA 2VRRB 2N9PC 1KLGD 3OG5A 2BWES 4DHZE 1PGXA 3PGEA 3Q8EA 2CJOA 4I6NB 3DOWA 1I42A 3IT4B 1ROEA 5EDSA 2WXOA 3DBSA 4KGSA 2EELA 1C78A 3B2GA 4ICUA 2QC8A 4P6VF 2ICIA 3Q8AA 3WANA 4KIKA 2CU3A 4FN2A 1UF0A 2KD0A 5E6OA 2ZCBA 3DHIC 2DHZA 2WU5B 2E3TA 3BK2A 4S17A 1T5XD 2N7JA 4IDIA 3TEZA 4BKSA 4DDID 2KAJA 4RGTA 3I5JC 4MSQB 2IYDB 1VDVA 2DENB 5L95C 2XK5A 4WWPA 4BBNC 2K6DB 4N6EB 4BZAA 4KX6B 1VZ6A 4MSMB 1J7CA 1I4QA 2C5LC 1MI0A 3TJPA 2V3PA 5LLIA 3AEDB 2KTRA 1SBBB 2RPVA 4GB9A 1HXYD 2V3SA 2BPSA 3OLMD 3N9YC 5CHWA 5LXIB 1N60A 3BYTB 3I63C 2JWUA 2N9LA 4HLEA 2WXIA 3ZNZB 5AZGA 2L00B 1I35A 5BYQA 3PTFC 5IA7A 3MHZA 1TBEA 1HQRD 4RFBA 5BMIA 2X38A 2LGIA 3SFEB 1N62A 1E7UA 5JXVA 4ITKA 2DZJA 1VCBA 2IPKD 4DK5A 2BKFA 2INDC 2WXPA 2DYOA 3DVGY 1HE8A 1Q5WB 3ZGZA 4OZBA 2KJRA 1UWXA 2L7RA 1E8YA 4NQKE 5EE0A 4TQ1A 2WXKA 1JWUD 1WX7A 1UGMA 3MP9A 2CJNA 2OJRA 2OOBB 3QAQA 1ZE3D 4A8XC 1YX6B 3PPAA 1J8CA 3GE8C 2ZJDA 3SD5A 2IZVB 2MX2A 2MBBB 1C76A 1K51A 3RN9C 1TY0A 2WWZA 2ZNVC 5G5GA 3RNBC 2D3CA 3C19A 4FJYA 2FUG1 2BYEA 1AWDA 5TSSA 3ALBA 3QCAA 1QILA 3DBLI 3DBHI 1MHXA 4ZDVA 2C7MB 1F0ZA 3KH0A 1R4NB 1FNWA 3JSVA 1IYFA 3A1QB 1QKZA 2JXXA 2FCNA 4IWQA 3H8HA 4M01A 4C80A 3TMPB 3DHGC 5AZFA 4M02A 2O6VA 4B6WA 1F52A 2WU2B 1JALA 3DDCB 2IGDA 2KTFA 4XDDA 4I6PA 4TSSA 4GXBA 2GMIC 1MVKA 3WIMA 3UI3A 4A20A 1FCCC 1YX5B 2K6QA 2M0XA 4GSWA 3HUIA 2W54A 2PTLA 2ACZB 3ZYYX 1BT0A 2ZPNA 1WMHB 4YTPB 1DYQA 4JLCA 1WZ3A 3VR8B 1YJ1A 1WJ6A 2N7EA 3P4RB 4G50A 3ONSA 3V60A 5BYRA 5TR5A 4C7ZA 4M8NA 1NDDA 3SR6A 3S2AA 2ZW0A 3P1MA 3TEXA 5KHOA 3Q3JA 1JWSD 2PE9A 2KDIA 4W9GA 1ET6A 1MG4A 1K53A 5FK9C 2BF8B 3LDZE 1MHHE 2V0GA 3GB1A 2M19A 2RR9A 1CJEA 3DVGX 3B0AA 2ONQA 4ZRJA 1EU3A 3U8ZA 2ZNVB 3GS2A 5C3JB 3RZFA 1GNUA 4CQNA 3HM3A 1KLUD 4FHJA 3Q2AC 2KN5A 4ZHOA 4WJOA 2JY6A 1LM8B 1FRRA 2QEJC 2KWUB 1RYJA 1OEYJ 2FAZA 2NR2A 2WHIA 4W9HA 4RGMA 3QC8B 2AQ2B 3RT3B 2INPE 4MT5A 4NPNA 2C7HA 4WAFA 4W9LA 3C8YA 3WAOA 1QT9A 2CS4A 4XWTA 1WGYA 4W9EA 1P3QU 4MH0E 5FR3A 3WCQA 3KVFB 2M8SA 2WLBA 3ZDMC 2L76A 1ZDVA 2OHFA 1XLOA 2PW9A 4FJZA 2MHJA 3CF6E 2PMVA 3RUIB 4DWFA 2JZPA 3I9V1 3BVZA 2JRHA 3WAMA 1J7BA 4RCOA 2LVQA 2PLPA 2KNBA 2BVCA 1WXVA 4JWSC 4JWUC 4GLSC 2KMCA 3KWVA 4W9FA 3IT6B 1H8CA 3IG3A 4KSLC 3ZXVA 3RMKC 3ZJVA 4IKGA 4HVBA 2KMAA 3AN1A 3DBRI 2GOWA 3U52E 4K7WA 4LNFA 5EE1A 2KANA 1KH0A 1WF9A 2WXHA 3L13A 4HKZE 4DBGA 4B95A 1LO5D 1L0XB 3VXWA 3IXSA 2BQQA 1L6UA 3ML9A 4YXDB 1IGCA 3E9SA 4P1BC 2N9XA 2LGSA 4FHKA 2XEWA 3PHXB 3A4SC 1BUIC 2BB5A 4DHZB 1QF6A 4MGIE 1B9RA 2D3GA 1KF6B 4IWPA 4W9DA 5JZEB 3H7PA 1YQBA 2G1EA 2AWTA 2IY1B 2K0PA 3VRBB 1JROA 3NOBA 5J2RA 4AP4C 4NJCA 1SIJA 1V1PB 2MBOA 1RRBA 5AUIA 1JWAD 1ACCA 3QJZA 2DZIA 4A3OA 1MPEA 2KQ7A 2KHWB 2CHZA 2N0SB 3SEBA 1H4RA 2KDEB 4ZRQA 2FE8A 3VQIA 4A9AA 1WRDB 1HA5A 5DPWA 3AM9A 2BS4B 1WWTA 1DOIA 3KWLA 4BAXA 4YT0B 5FR6A 3SHQA 4K7UA 2ZW1A 3NVYA 2PE6B 3NVWA 3B2FA 1L0YB 3QQ8B 3KUZA 4JE3B 2M4NA 2IO0B 4B0EA 2DAFA 1C9FA 4AJWA 1R7SA 3A9JB 1K8RB 1YN5A 4F1SA 3MC9A 3DHHC 4MGZE 4P1CC 2WNMA 2MWSB 4ZYNA 3PZ8A 3CIRB 1GC7A 2KWDA 5CHVC 3W5UB 2JYEA 2M56B 3DVNU 3R8BA 3AV8A 2HJ8A 4WWMA 1T6BX 3L54A 4OVZA 1AN8A 1NI3A 4XWWA 4Q2JA 4QAYA 3ZXRA 5JHBA 3HVDA 1NENB 3MHSD 3OAWA 2G45B 1XEEA 3AMZA 3ZKJC 5I4DA 3NVZA 1GC6A 5IOIA 1TZ1A 1WR1A 2LASA 1BXTA 3BINA 3PREA 1Z5SB 2WDRB 3UF8A 4J3OD 1Q10A 1Q0WB 1GJZA 2DNFA 4XZ4A 5J18A 5DPRA 2ZPYA 3AE9B 2JWZA 5T8IA 1B1ZA 1FEHA 4ANWA 1STEA 2RD0A 3M63B 2L8JA 2LWPA 4BOSC 2EKEC 3NG0A 4HCNB 4BKGA 2LUMA 1RFKA 2X8XX 5HG2A 1DOXA 4EOYA 2KC2A 2AL6A 1YJJA 3DCGA 2UU7A 5CTRC 2JQRB 2GB1A 5HI1A 1DGJA 3OJ3A 2O2VB 1N61A 3E56A 3IBEA 1KJTA 2FNJB 2L32A 3IAS1 2KKCA 3HRDD 2J4XA 2FCSA 2MRPA 2M0AA 3AH7A 1QOAA 2AYOB 4YL8A 3R2TA 1SB3C 3IFWB 5IKCM 5C2TB 3PRPB 2DZMA 3URYA 1UH6A 5H92C 1RM6C 3TBLD 4MJSA 2C7NB 3U30A 4W9JA 2A5UA 2WXGA 1WGDA 2MBQA 1EM7A 3ZW3A 2VH2A 2EMTA 1WY8A 2INCC 3QX1A 3AEGB 3RYTA 1UBQA 4YSXB 5MPOA 2GBKA 1YMHE 2G4SA 3L08A 5D3IB 2KVZA 3RD2A 2KDBA 1OQRA 1OQYA 2V1YA 2JU6X 2IO1B 2QJLA 2XBBC 1G6JA 1KLVA 4REZA 2MJEA 5D3DA 5H8YE 3L10B 4GDLB 1UGJA 3ZO5B 4ANUA 3D32A 3H1UA 2LJIA 2GLSA 1ISNA 1TKEA 2MBHA 4LLGM 4IC7B 1XT9B 2PVGC 1ZKHA 1TS3A 1SJED 1E8WA 2BW2A 2L52A 2M1MA 1P1AA 5AUKA 3WAPA 4XYCA 4HEA1 4M0WB 3M95A 2ZEQA 2E6XA 1AW7A 2Z0EB 1C4PA 4E71A 2J0MA 2Y5CA 3TUOA 4ZOHC 2KWCA 4WJNA 4MM3B 2NCNA 4MELA 3SDLC 4HKQA 1TTNA 3BWUD 1ENFA 2M17A 3ZNHB 4HXDA 1P9DU 2QDFA 3W9CB 2QILA 2K5PA 3AE4B 3TEWA 2D11A 4HDQA 3VRAB 5IN7A 4IM3A 4JQWC 2LVOA 4YTMB 1D4BA 2IJ0A 4LK0M 2A4ZA 2KO3A 4K81A 3RNFC 3O13A 2W55A 1WJ4A 2N4FA 4RNAA 2INNE 1F2RI 3AEBB 3RULA 5C23A 2HD5B 3KYCD 5DCNA 3FC4A 3V6CB 1D5ZC 2Q5WD 1T0SC 2KFKB 1J7AA 4AJYB 4C4VB 4J6IA 3IAM1 1E5WA 2YLMA 4TV3A 3W1SA 1VZ8A 3PV1A 3KUCB 3U7DA 4XDCA 4JGHB 1IBXB 3N1YC 1KFYB 4IM2A 3PRZA 5IAAC 2MH7A 2REXA 1SE9A 4MH8A 3GZNI 2W9NA 2GRIA 3W2DA 1I4PA 2J52A 2N1WA 1LGRA 2NBUA 5L83A 4AUQC 4P16A 2K25A 3UGBB 3EHVA 2AX5A 2ON8A 4DXFA 1I7HA 3PO0A 1VZ7A 3ZJTA 1VR9A 1C4AA 3ZVVA 1L7YA 4K1RB 5LXHA 4MEMA 2KFJA 3N3KB 3U4EG 4IW0A 3MJWA 4XGAB 1UNSA 2K9XA 4JIOU 5BYSA 3DVNV 1MG8A 2R61A 4FJVB 4ARIA 4KDLB 2FUHB 3ZQ4A 2DYMA 2NTSA 3AULA 5BMHA 2JT4B 1D6EC 4DXGA 1I4HA 3QHTA 4HK2A 3A1QA 1VRAB 3FILB 1IUEA 3GP7A 2JXTA 1JWBD 2I1KA 2L3ZA 2PIAA 3AE1B 4DQOC 2KLCA 4FBJB 3MJ5A 3MTNB 2BS3B 2Z59B 3JYUA 1EWCA 3FAHA 4AWJA 4LNIA 4RGOS 1QOGA 3A9KB 4BBNF 3ECIA 4II3B 1C79A 2ZVOA 3Q3FA 4OVVA 2ZCCA 2LXAA 2LHEA 5IP4D 1WMHA 3N32A 3V61A 2MW5A 4ANXA 3R2IA 2CU1A 3QWZB 4WAAA 5D2MB 1I4GA 1EWYC 4GU2A 3KLSX 3ETRA 2L0FA 1FO4A 1Y8RC 1YQ4B 2H89B 4A55A 1QOFA 3CSTA 1TT5B 1R4MB 2UYZB 2KVRA 2PPHA 2OEDA 2NPTB 1ESFA 2J0KA 3N30A 3CMMB 3Q3NC 4RH6A 3FKYA 3VUWA 2KX0A 3NS1A 2GI9A 4JL9A 4NAWB 4EFOA 3AI5A 2LRUA 1F77A 4AQ7A 2AL3A 2KXJA 1FFVA 1HTQA 3BYYB 2VZKB 2WX0A 4F8CB 2K39A 4NJ7A 2WDVB 1HZ6A 3DBLB 5C1ZA 1NYRA 1ZOYB 4PT5A 3N1XC 1UD7A 3LYYA 3A4RA 1WXSA 3N20C 2D07B 2BWFA 3NHEB 4WIPA 2FIFA 3Q3OC 1L2NA 2PEAA 2SAKA 4L2YA 2BKRB 1WRIA 2IDYA 1P0RA 2I1JA 3DQVA 4C56C 4MDKE 1SSNA 1WIAA 4N59A 1YIWA 3NZ3A 3BVMA 1T3QA 3QIJA 1VD2A 3WA0A 4EKUA 1WGKA 2HTME 1C4CA 4WQMA 2JZ3B 4D2KA 4TUUA 4OVUA 1V1OA 2J7QB 2I2YA 2C60A 1FRDA 1TIFA 4WWOA 4US9A 2KACA 1ET9A 2W3SA 4GDKB 4RM9A 2AEHA 2BYVE 3QARA 2CKHB 1SE4A 4FULA 4ASWC 3VAWA 1EO6A 3V3XA 4EZJA 3C0RB 3T9LA 4H2AA 1FCLA 3VH4B 3R7RA 1U4AA 5AEKB 1RWSA 3NJTA 4PK1A 3X23A 1I4XA 2JSVX 2DLBA 3P4QB 1V5TA 2VZKD 1JRUA 4PS8A 4WWNA 1HZ5A 3AU4A 2B76B 3UINB 2DAJA 3PRMB 1OGWA 4E3CA 1EUVB 1UELA 1FFUA 1RLFA 1MFWA 3U2SC 1V1PA 5KHQA 4BOZB 2NBWB 3A33B 3VUXA 4KKIA 1PGAA 3ZRFA 1D5MC 2MP2B 3CWIA 1JMLA 2VH1A 1ZUD2 2KZRA 4GOCA 3VR9B 3EGRA 2JPHA 3EFCA 1QLBB 1E7PB 1P7FA 1S3SG 3V6EB 1YN3A 5E6JA 4LJOB 2D3BA 2SEBD 4ZRIA 4HPMB 3PS6A 1V86A 4A90A 2H88B 4KKJA 2L83A 4R3DA 3VFKA 3SFDB 1A5RA 3X0WA 3A9JA 3UQBA 3K9OB 1YNTE 4RGNA 3AE3B 3R7QA 4B0MA 1SE3A 3EECA 3DBRB 5G2NA 3AU5A 1E10A 2R2OA 3AEEB 5D6JB 3OJ4B 4LCDE 1WR6E 4IOIE 2IBIB 3RNAC 1N63A 1T0QC 1JRPA 4KGTA 4FA6A 3AXCA 2BYTA 1FMAD 1FM0D 2WXFA 4MGKE 2WX1A 1XXGA 3P42A 3BY4B 1EF1A 5DPSA 4TKNA 3P63A 2IGHA 3VTWA 3BIID 1L4DB 2WXQA 2LD9A 1TY2A 2KMMA 2L05A 3EC8A 3H7SA 3ZJUA 3I3TB 1Q1OA 2MCNB 4LNOA 1OFFA 3ZTDA 4EUTA 1UZXB 3GOEA 1PYWD 5GMVA 5JH5C 2D3AA 3HHMA 2QMTA 2JUOA 1TJEA 3PLUA 1L5PA 2MJ3A 3Q8FA 3BZDB 1ZGUB 2HDEA 2JYTA 4GIVA 3J9CA 2KJHB 1KTKA 3KUDB 2WXNA 2KC1A 3DWMA 4N9F4 2LGDA 2N9EB 4DHJB 3DWGC 2FCMA 3MFGA 2O2VA 4BVUC 1T0RC 3W1YA 4HRSA 1SE2A 3Q3MC 4I6LB 1N5WA 1WFYA 2JRIB 2GBNA 4G11A 1TGZB 2GBMA 1A70A 1HEZE 2K8HA 1AYFA 1LXDA 1WX8A 4KIKB 1KRHA 3NUHB 1GG3A 3M62B 4ICVA 3NVVA 1UBIA 2QSDA 1SXTA 4DXAB 2LUEA 3PZDA 2MA9B 2MBEA 2BYFA 2NTTA 1CK1A 3VHTC 4PYUA 1EU4A 1E9MA 2KJ6A 1F1HA 2ZVNA 3UQAA 1E6EB 2ASQA 1OEYA 1R4NI 3TCAA 2XK5B 2YEPB 4K7SA 1RFAA 3ZNGC 3B08A 4NQLB 3H6NA 4EZKA 5AZHA 2G3QB 4C7YA 1WXQA 2B3AA 3VTUA 2DZKA 2KTRB 3Q69A 5JHAA 4URKA 2L0TA 3PLVA 2WS3B 1GOZA 2DBYA 2NBVB 4HJKA 2W82A 1D3ZA 5EE3A 3V05A 2RDBC 2LGYA 2LJ5A 2G4DB 4FXCA 2KT7A 1V97A 1FNUA 1NVID 5DPTA 4TQ0A 2LEKA 1WYWB 4GDLA 3T3OA 2K8CA 3Q14C 4PYZA 3RZWC 1NBFC 1MJDA 3V62A 2RMMA 4ZRKA 1KOTA 3TSSA 2IO2B 2WP9B 4DHJD 3NZSA 1ZXHA 3I57A 4LNKA 1JWMD 1V8CA 3PHWB 3RNCC 4W9IA 3WALA 4JPSA 3AE8B 1Z2MA 2PVOD 1DOYA 1EF5A 2Y3AA 4KGRA 4AS1A 2DWQA 3AECB 1WI0A 1WJUA 4ARCA 4FLHA 2KN4A 1WE7A 4M0WA 4K3BA 1XQQA 2KYWA 4WJPA 1IPGA 2JZZA 1FPYA 3N1ZC 4A3PA 4YSZB 2IO3B 4JX1C 5BMGA 1S1QB 1WZ0A 2BT6A 4MM3A 1X1MA 2YEPF 4BKSD 4ACFA 1RAXA 1WYGA 1E7VA 1VLBA 3L4PA 3Q6BA 3ABVB 1V5OA 3AE6B 3LJ3A 4EZLA 1V9JA 1V80A 1FXIA 2RDGA 3JSVB 3JW0X 3ZLZA 4LJPB 2KDMA 1WE6A 2WXMA 1OTRB 1R4MI 1TZOA 3T3NA 3APFA 4HCPB 2LGXA 2O6VB 5BO4B 2BBCA 1ZDXA 2KQ4X 3PVLA 4OW0A 4XE0A 5EE9A 2KX3A 1SIFA 1QQRA 1FIQA 1F2RC 1WXAA 2EMSA 2KFKA 2LVPA 2NS5A 1QZEA 1WGRA 2RPQA 4C4VA 1SJHD 1YN4A 4M8MA 3SU8X 2V9HA 1YQ3B 5LNK1 2D10A 1ZW7A 3ML8A 1E8XA 2JVCA 4ANVA 1IBXA 3TIXA 3TEYA 1P98A 3HIZA 3HVZA 2WXJA 2LMCA 4IUMB 4PS7A 1XLPA 2K3UA 3R66C 2R2QA 1WX9A 2V4LA 3QA8A 2WYQA 1WSPA 2NVUI 4L1BA 1SF0A 1LQBA 2Y5PA 1J0GA 5J17A 1UUPA 4F7ZA 1JQ4A 2LHDA 1GUAB 2WDTB 1T0YA 3KYDD 4WQOB 4X57B 1C1YB 4YWGG 4EE2A 4G0NB 4HROA 4KZCA 1WGHA 3L17A 2BGFA 3R3MA 4UDUC 4E74A 4WJQA 1PQSA 1XO3A 3OWEB 1UWMA 2D2QA 1WXMA 4NJ6A 3K9PB 2O6VD 3RPFC 1KM7A 4NNJB 1FD6A 3FILA 4WURA 1FXAA 1YOVB 4BFRA 2HTHA 1L0VB 1XD3B 2K1FA 2Z8LA 3KW5B 2WDQB 2GBRA 4II2B 1HTOA 4ZHPA 1WM3A 2K8BA 5HFYA 3QK0A 4HJGE 3VVWB 4AOFA 4OHJA 2IY0B 2V4IB 4K3CA 1SGHA 4ZYSA 1K52A 1M4VA 2TSSA 2LI5A 1GPXA 1TKYA 1VJKA 2N1VA 2KQSA 5IO9A 2PJHA 3A9KA 1N6ZA 5D94A 2DX5B 4DDGD 2LZ6A 3P4SB 1IGDA 3GZNB 3PSEB 3P2BA 4GGQA 3BK1A 3TL5A 2J42A 4KDIC 4LTUA 4ZRPA 3DBHB 3RNEC 3VUYA 3CSFA 3DPDA 4NAMA 2NMQA 1CZPA 4N58A 3VDZA 2C9WB 5G55A 2DYBA 2NPTA 3AB5A 3MC8A 1PDXA 3NZUA 3EA6A 4HDOA 2PKOA 4OZCA 2MEKA 1WJNA 2ZZPB 2YVCA 4EEWA 1WH3A 1OQQA 3H7PB 4B9KA 4NAWA 1L6VA 4MGYE 3KQ4A 2XNAC 1JCKB 3NS8A 1AARA 2KDFB 4RF1A 1F9JA 1PFDA 4S0RA 4M00A 4NY0A 2JX5A 2KOXA 3RFZB 5HHDG 2CR5A 2WQYB 4A6QA 2V3NA 2FBWB 5FKAC 4C00A 2G9HD 4O1NA 2LXCA 1NEKB 3IHPC 3IVFA 4WH4A 3AE2B 2FCQA 4G3XB 1ZXIA 2EKIA 2RGFA 2CHXA 3ZTCA 1SEBD 4LDTB 3RCZA 2MLBA 1C77A 2BB6A 1YJIA 3VH3B 4L23A 1WGGA 2KWVB 5D7GA 4CYEA 1ZP0B 1C3TA 3ZNID 1I4RA 1TKGA 3NY5A 1GB4A 2GBJA 3Q8BA 1JW9D 4HPPA 3AEAB 2L1AA 2WXRA 2XN9C 1YD8U 1QOBA 2J0JA 4KZ0A 2K22A 4GDKA 3VTVA 1WM2A 1FNVA 1E90A 2N7DA 4YTNB 2RDHA 3P4PB 3APCA 1E8ZA 4LNNA 1K50A 3JVZX 4XX5A 4CO7A 2BTEA 3HM6X 3ZRCA 3M3JA 3L0WB 4HPLB 2HJ1A 3L16A 1V2YA 4OZAA 4RM8A 2LRWA 5HKHA 1J19A 1N5XA 3ZIMA 3ENEA 3T8MA 1CQVA 1V81A 3H9DA 2D5GA 3B1LX 3PT2B 4RF0A 3EUB2 1M94A 1TYGB 3GE3C 1XF5L 2N9KA 3W5VB 1V49A 4NZLB 3LB8C 3Q8CA 3UIOB 4MACA 2UWQA 4LDTD 2MP2A 3ZUNA 2OJWA 5E6PA 2MJDA 1D5XC 1V6EA 2RSUA 3U7ZA 1FXTB 2BS2B 3UIPB 1Y56A 3RI7C 2Y5BB 4P7IA 1GAQB 1XCTL 2WGSA 3HK0A 3AE7B 1XLQA 3AEFB 2JF5A 2WXLA 4KV2A 2QHOA 5CX3A 4FADA 2HE7A 1CMXB 1P7EA 3ZDTA 2QCZA 4GN1A 4RMAA 2MQJA 1LFDA 1XCQL 1PGBA 1L4ZB 4W9KA 1PUTA 2KLGA 2AQ1B 4MJSB 4W9CA 4US8A 2IGGA 2Z0DB 3AE5B 1IP9A 4IM0A 1GB1A 1BMLC 3NRZA 3BVGA 3O65B 2KK8A 4GMVA 4KVGB 1TS2A 2LFIA 2AQ3B 2FIDA 1ZPSA 4XC2A 3LXFA 3B9JA 5G5HA 2MSED 4BKTA 2W3RA 4IG7B 3MC0B 4CHKA 2I38A 4USAA 5GXGB 1NYQA 4PS3A 5CHFA 4KSKC 3RNGC 2J53A 4HWIB 1NI2A
chains in the Genus database with same CATH topology
1OTRB 1R4MI 2J0KA 3KUZA 3N30A 3QQ8B 2M4NA 3CMMB 3APFA 4K7UA 2IO0B 4HCPB 2LGXA 3EFUA 2DAFA 3VUWA 2CHWA 2KX0A 3W1SC 4IWOA 4JL9A 2O6VB 5E6NA 3A9JB 4AJWA 1K8RB 4NAWB 3APDA 4EFOA 3AI5A 2VRRB 2N9PC 5BO4B 4F1SA 2LRUA 4MGZE 3PVLA 2MWSB 4ZYNA 2BWES 2KX3A 1SIFA 2AL3A 2KXJA 4DHZE 3PGEA 1GC7A 4I6NB 5CHVC 1WXAA 3DOWA 1I42A 2WX0A 4F8CB 3DVNU 2EMSA 2K39A 2KFKA 2LVPA 2NS5A 1QZEA 1WGRA 2RPQA 5EDSA 2HJ8A 3DBSA 4NJ7A 3L54A 5C1ZA 3SU8X 4M8MA 1UD7A 2D10A 1ZW7A 3ML8A 5JHBA 3A4RA 1E8XA 1WXSA 2JVCA 3MHSD 4ICUA 4ANVA 3OAWA 2D07B 2G45B 2BWFA 3NHEB 3ZKJC 3TIXA 1GC6A 2FIFA 4KIKA 3WANA 1H8CA 1TZ1A 1WR1A 1P98A 2LASA 3HIZA 3BINA 3PREA 1L2NA 1Z5SB 2PEAA 4FN2A 2KD0A 5E6OA 2ZCBA 2BKRB 3UF8A 2DHZA 4PS7A 4IUMB 1Q0WB 1GJZA 3R66C 2R2QA 1P0RA 2I1JA 3DQVA 4XZ4A 1WX9A 2V4LA 3QA8A 1WIAA 4MDKE 1YIWA 2WYQA 5J18A 2NVUI 4BKSA 4DDID 5DPRA 3QIJA 1VD2A 2ZPYA 2JWZA 3WA0A 4EKUA 4MSQB 1LQBA 2IYDB 2DENB 5L95C 5J17A 1J0GA 2XK5A 4WWPA 4F7ZA 4BBNC 4ANWA 2K6DB 2RD0A 1GUAB 2JZ3B 1T0YA 2WDTB 3KYDD 3M63B 4MSMB 4OVUA 4TUUA 2C5LC 3TJPA 2L8JA 2LWPA 4BOSC 2EKEC 2J7QB 4WQOB 5LLIA 2C60A 1C1YB 4X57B 4HCNB 4WWOA 4BKGA 4G0NB 4KZCA 2KTRA 1WGHA 3L17A 4EOYA 2BGFA 3R3MA 4E74A 2KC2A 4WJQA 1PQSA 2AL6A 4GB9A 4GDKB 2V3SA 2BPSA 3OLMD 3DCGA 4RM9A 5CTRC 5CHWA 5LXIB 3OJ3A 2AEHA 2BYVE 2O2VB 3QARA 2CKHB 5AZGA 3ZNZB 4HLEA 2L00B 1I35A 3IBEA 4FULA 2D2QA 3PTFC 5IA7A 1KJTA 4ASWC 2FNJB 1WXMA 4NJ6A 3VAWA 1EO6A 1TBEA 3K9PB 2KKCA 2MRPA 2FCSA 2O6VD 4EZJA 3C0RB 3T9LA 1E7UA 1KM7A 4NNJB 2AYOB 3VH4B 2DZJA 3R7RA 1U4AA 4YL8A 4BFRA 5AEKB 1VCBA 2HTHA 1XD3B 2K1FA 3IFWB 3KW5B 3X23A 2GBRA 4II2B 3PRPB 4DK5A 2BKFA 1V5TA 1WM3A 2K8BA 3QK0A 1JRUA 4PS8A 4WWNA 2DZMA 3VVWB 4AOFA 3AU4A 1UH6A 2IY0B 2DYOA 3UINB 3DVGY 1HE8A 1Q5WB 3TBLD 1SGHA 2DAJA 3PRMB 1OGWA 4E3CA 1EUVB 4MJSA 2C7NB 1UELA 2KJRA 3U30A 4W9JA 1RLFA 2LI5A 2A5UA 1WGDA 2L7RA 2N1VA 1E8YA 2KQSA 2MBQA 5KHQA 3ZW3A 4BOZB 2PJHA 4NQKE 3A9KA 2NBWB 2EMTA 1WY8A 3A33B 4TQ1A 5D94A 3VUXA 2DX5B 1WX7A 1UGMA 3QX1A 2OJRA 2OOBB 3RYTA 3ZRFA 2LZ6A 1UBQA 4DDGD 3QAQA 2MP2B 1YX6B 3PPAA 1J8CA 2ZJDA 3PSEB 3SD5A 2IZVB 2MX2A 2MBBB 3P2BA 2KZRA 4GGQA 4GOCA 2GBKA 2JPHA 2G4SA 3L08A 2WWZA 3TL5A 2ZNVC 1S3SG 4FJYA 4KDIC 2KDBA 3RD2A 3V6EB 1OQYA 2BYEA 2V1YA 3VUYA 3ALBA 3CSFA 2IO1B 3QCAA 3DPDA 2XBBC 4LJOB 1G6JA 3DBLI 4ZRIA 3DBHI 1KLVA 4ZDVA 2C7MB 3KH0A 3JSVA 3L10B 3VDZA 2C9WB 3PS6A 1V86A 3A1QB 4GDLB 2JXXA 4HPMB 1IYFA 2FCNA 5G55A 4IWQA 2DYBA 2NPTA 3ZO5B 4ANUA 3NZUA 3TMPB 4HDOA 3D32A 3H1UA 5AZFA 3VFKA 1WJNA 2ZZPB 2YVCA 1ISNA 1A5RA 4EEWA 2MBHA 1WH3A 3H7PB 3X0WA 4IC7B 2O6VA 3A9JA 4B9KA 3UQBA 4NAWA 3K9OB 1XT9B 4B6WA 3DDCB 4MGYE 2KTFA 3R7QA 3EECA 1ZKHA 5G2NA 3NS8A 3AU5A 1AARA 2KDFB 4I6PA 1E8WA 2M1MA 1F9JA 2R2OA 4GXBA 5D6JB 1P1AA 3OJ4B 4LCDE 2GMIC 3WIMA 4NY0A 3WAPA 2KOXA 4A20A 1WR6E 1YX5B 4M0WB 2K6QA 2ZEQA 3M95A 2CR5A 2IBIB 2M0XA 2Z0EB 4GSWA 4E71A 2J0MA 4FA6A 3AXCA 1BT0A 2LXCA 3IHPC 4MGKE 2ZPNA 2WX1A 3IVFA 1WMHB 3BY4B 2KWCA 4JLCA 1WZ3A 1EF1A 5DPSA 4TKNA 4WJNA 2NCNA 1YJ1A 2FCQA 4MELA 3SDLC 1WJ6A 2N7EA 4G3XB 4G50A 3ONSA 3V60A 1TTNA 3VTWA 2RGFA 5TR5A 2CHXA 2M17A 4M8NA 3ZTCA 1NDDA 3ZNHB 4HXDA 3S2AA 4LDTB 1P9DU 3RCZA 2LD9A 5KHOA 2MLBA 2PE9A 3Q3JA 2L05A 3EC8A 3H7SA 2KDIA 4W9GA 3I3TB 1Q1OA 2MCNB 2BF8B 3LDZE 2D11A 4HDQA 3VH3B 1WGGA 2KWVB 5D7GA 4IM3A 4CYEA 3ZTDA 4EUTA 1UZXB 2RR9A 4JQWC 2LVOA 3DVGX 3B0AA 1C3TA 2A4ZA 3ZNID 2KO3A 4K81A 4ZRJA 3GOEA 5GMVA 5JH5C 3U8ZA 3HHMA 1WJ4A 2N4FA 2ZNVB 2JUOA 3NY5A 2GBJA 3RZFA 3PLUA 1GNUA 3RULA 3HM3A 1ZGUB 4FHJA 5C23A 2HD5B 3KYCD 5DCNA 4GIVA 2KN5A 1YD8U 2KJHB 2J0JA 1NI2A 3KUDB 3V6CB 4WJOA 2JY6A 1LM8B 4KZ0A 2KC1A 4GDKA 2KWUB 4N9F4 3VTVA 1WM2A 2LGDA 2N9EB 4DHJB 1OEYJ 2KFKB 2FCMA 4AJYB 2FAZA 2NR2A 2O2VA 4BVUC 4W9HA 4J6IA 3W1YA 1E90A 2N7DA 1E5WA 3QC8B 2YLMA 3RT3B 4I6LB 4TV3A 1WFYA 4NPNA 2C7HA 2GBNA 2JRIB 4W9LA 3W1SA 4G11A 1TGZB 2GBMA 3WAOA 3PV1A 3APCA 3KUCB 3U7DA 1E8ZA 2CS4A 2K8HA 4JGHB 1WGYA 4W9EA 1P3QU 3PRZA 4IM2A 1LXDA 1WX8A 3JVZX 4MH0E 5IAAC 4KIKB 2REXA 1SE9A 4XX5A 3KVFB 2M8SA 4CO7A 3ZDMC 3GZNI 1GG3A 3M62B 4ICVA 2L76A 2W9NA 3HM6X 3ZRCA 3M3JA 4FJZA 1UBIA 3L0WB 4HPLB 3L16A 4DXAB 2LUEA 1V2YA 3PZDA 2MA9B 2MBEA 2BYFA 4RM8A 2LRWA 2N1WA 3CF6E 5HKHA 3VHTC 4PYUA 1J19A 2NBUA 3RUIB 5L83A 4AUQC 3ZIMA 4DWFA 3ENEA 2K25A 2KJ6A 3T8MA 3UGBB 3EHVA 2ZVNA 1V81A 3H9DA 3UQAA 2JRHA 3B1LX 3WAMA 2ASQA 1OEYA 3PT2B 3ZVVA 1R4NI 1L7YA 3TCAA 2XK5B 2LVQA 4K1RB 1RFAA 4K7SA 4MEMA 1M94A 3B08A 4NQLB 2KFJA 3ZNGC 2KNBA 5LXHA 3N3KB 1WXVA 3H6NA 4EZKA 2KMCA 4IW0A 1V49A 3MJWA 5AZHA 2G3QB 4W9FA 2B3AA 4JIOU 3VTUA 3UIOB 2DZKA 3IG3A 2UWQA 1MG8A 3DVNV 4KSLC 4LDTD 2KTRB 2MP2A 4HVBA 3ZUNA 4FJVB 2KMAA 5JHAA 4URKA 4KDLB 2L0TA 3PLVA 5E6PA 2FUHB 2NBVB 1V6EA 3DBRI 2GOWA 4HJKA 4K7WA 2DYMA 1D3ZA 3AULA 2KANA 2RSUA 2LGYA 2LJ5A 1WF9A 3L13A 2G4DB 4DBGA 2JT4B 1FXTB 4B95A 3VXWA 3ML9A 3UIPB 3QHTA 4HK2A 5DPTA 2Y5BB 2N9XA 4TQ0A 1WYWB 3A1QA 4GDLA 2K8CA 4P7IA 4PYZA 3HK0A 3RZWC 1NBFC 4FHKA 2XEWA 3V62A 3PHXB 3A4SC 2JF5A 4DHZB 4ZRKA 1KOTA 4KV2A 4MGIE 2QHOA 2D3GA 5CX3A 2I1KA 2HE7A 4FADA 1CMXB 4IWPA 2IO2B 2L3ZA 3H7PA 4W9DA 3NZSA 3ZDTA 4DHJD 5JZEB 4GN1A 1YQBA 3PHWB 4RMAA 2MQJA 1LFDA 2AWTA 2IY1B 4W9IA 2KLCA 3WALA 3NOBA 4FBJB 5J2RA 4W9KA 3MTNB 2KLGA 1Z2MA 4AP4C 4W9CA 2Z59B 4MJSB 1EF5A 2Z0DB 3JYUA 1WI0A 1WJUA 4AWJA 2MBOA 1RRBA 1IP9A 4FLHA 4IM0A 3A9KB 1WE7A 4BBNF 1XQQA 3ECIA 4II3B 4WJPA 1IPGA 2ZVOA 2JZZA 3Q3FA 3O65B 2KK8A 3QJZA 4GMVA 4KVGB 4OVVA 4A3PA 2DZIA 4A3OA 2IO3B 2KQ7A 2LXAA 2ZCCA 2KHWB 1WMHA 2CHZA 1S1QB 2FIDA 3N32A 3V61A 2MW5A 1WZ0A 1H4RA 4MM3A 4XC2A 4ANXA 1X1MA 2CU1A 2KDEB 4BKSD 3QWZB 4WAAA 5D2MB 2MSED 3VQIA 4BKTA 1RAXA 1E7VA 1WRDB 4GU2A 4IG7B 2L0FA 1Y8RC 4CHKA 1V5OA 5DPWA 3LJ3A 4EZLA 1V9JA 3CSTA 1V80A 4PS3A 3JW0X 3JSVB 4KSKC 5CHFA 3ZLZA 2UYZB 2KVRA 2PPHA 4LJPB 5FR6A 2PE6B 3SHQA 2NPTB 4HWIB 1WE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTR B;  1R4M I;  2J0K A;  3KUZ A;  3N30 A;  3QQ8 B;  2M4N A;  3CMM B;  3APF A;  4K7U A;  2IO0 B;  4HCP B;  2LGX A;  3EFU A;  2DAF A;  3VUW A;  2CHW A;  2KX0 A;  3W1S C;  4IWO A;  4JL9 A;  2O6V B;  5E6N A;  3A9J B;  4AJW A;  1K8R B;  4NAW B;  3APD A;  4EFO A;  3AI5 A;  2VRR B;  2N9P C;  5BO4 B;  4F1S A;  2LRU A;  4MGZ E;  3PVL A;  2MWS B;  4ZYN A;  2BWE S;  2KX3 A;  1SIF A;  2AL3 A;  2KXJ A;  4DHZ E;  3PGE A;  1GC7 A;  4I6N B;  5CHV C;  1WXA A;  3DOW A;  1I42 A;  2WX0 A;  4F8C B;  3DVN U;  2EMS A;  2K39 A;  2KFK A;  2LVP A;  2NS5 A;  1QZE A;  1WGR A;  2RPQ A;  5EDS A;  2HJ8 A;  3DBS A;  4NJ7 A;  3L54 A;  5C1Z A;  3SU8 X;  4M8M A;  1UD7 A;  2D10 A;  1ZW7 A;  3ML8 A;  5JHB A;  3A4R A;  1E8X A;  1WXS A;  2JVC A;  3MHS D;  4ICU A;  4ANV A;  3OAW A;  2D07 B;  2G45 B;  2BWF A;  3NHE B;  3ZKJ C;  3TIX A;  1GC6 A;  2FIF A;  4KIK A;  3WAN A;  1H8C A;  1TZ1 A;  1WR1 A;  1P98 A;  2LAS A;  3HIZ A;  3BIN A;  3PRE A;  1L2N A;  1Z5S B;  2PEA A;  4FN2 A;  2KD0 A;  5E6O A;  2ZCB A;  2BKR B;  3UF8 A;  2DHZ A;  4PS7 A;  4IUM B;  1Q0W B;  1GJZ A;  3R66 C;  2R2Q A;  1P0R A;  2I1J A;  3DQV A;  4XZ4 A;  1WX9 A;  2V4L A;  3QA8 A;  1WIA A;  4MDK E;  1YIW A;  2WYQ A;  5J18 A;  2NVU I;  4BKS A;  4DDI D;  5DPR A;  3QIJ A;  1VD2 A;  2ZPY A;  2JWZ A;  3WA0 A;  4EKU A;  4MSQ B;  1LQB A;  2IYD B;  2DEN B;  5L95 C;  5J17 A;  1J0G A;  2XK5 A;  4WWP A;  4F7Z A;  4BBN C;  4ANW A;  2K6D B;  2RD0 A;  1GUA B;  2JZ3 B;  1T0Y A;  2WDT B;  3KYD D;  3M63 B;  4MSM B;  4OVU A;  4TUU A;  2C5L C;  3TJP A;  2L8J A;  2LWP A;  4BOS C;  2EKE C;  2J7Q B;  4WQO B;  5LLI A;  2C60 A;  1C1Y B;  4X57 B;  4HCN B;  4WWO A;  4BKG A;  4G0N B;  4KZC A;  2KTR A;  1WGH A;  3L17 A;  4EOY A;  2BGF A;  3R3M A;  4E74 A;  2KC2 A;  4WJQ A;  1PQS A;  2AL6 A;  4GB9 A;  4GDK B;  2V3S A;  2BPS A;  3OLM D;  3DCG A;  4RM9 A;  5CTR C;  5CHW A;  5LXI B;  3OJ3 A;  2AEH A;  2BYV E;  2O2V B;  3QAR A;  2CKH B;  5AZG A;  3ZNZ B;  4HLE A;  2L00 B;  1I35 A;  3IBE A;  4FUL A;  2D2Q A;  3PTF C;  5IA7 A;  1KJT A;  4ASW C;  2FNJ B;  1WXM A;  4NJ6 A;  3VAW A;  1EO6 A;  1TBE A;  3K9P B;  2KKC A;  2MRP A;  2FCS A;  2O6V D;  4EZJ A;  3C0R B;  3T9L A;  1E7U A;  1KM7 A;  4NNJ B;  2AYO B;  3VH4 B;  2DZJ A;  3R7R A;  1U4A A;  4YL8 A;  4BFR A;  5AEK B;  1VCB A;  2HTH A;  1XD3 B;  2K1F A;  3IFW B;  3KW5 B;  3X23 A;  2GBR A;  4II2 B;  3PRP B;  4DK5 A;  2BKF A;  1V5T A;  1WM3 A;  2K8B A;  3QK0 A;  1JRU A;  4PS8 A;  4WWN A;  2DZM A;  3VVW B;  4AOF A;  3AU4 A;  1UH6 A;  2IY0 B;  2DYO A;  3UIN B;  3DVG Y;  1HE8 A;  1Q5W B;  3TBL D;  1SGH A;  2DAJ A;  3PRM B;  1OGW A;  4E3C A;  1EUV B;  4MJS A;  2C7N B;  1UEL A;  2KJR A;  3U30 A;  4W9J A;  1RLF A;  2LI5 A;  2A5U A;  1WGD A;  2L7R A;  2N1V A;  1E8Y A;  2KQS A;  2MBQ A;  5KHQ A;  3ZW3 A;  4BOZ B;  2PJH A;  4NQK E;  3A9K A;  2NBW B;  2EMT A;  1WY8 A;  3A33 B;  4TQ1 A;  5D94 A;  3VUX A;  2DX5 B;  1WX7 A;  1UGM A;  3QX1 A;  2OJR A;  2OOB B;  3RYT A;  3ZRF A;  2LZ6 A;  1UBQ A;  4DDG D;  3QAQ A;  2MP2 B;  1YX6 B;  3PPA A;  1J8C A;  2ZJD A;  3PSE B;  3SD5 A;  2IZV B;  2MX2 A;  2MBB B;  3P2B A;  2KZR A;  4GGQ A;  4GOC A;  2GBK A;  2JPH A;  2G4S A;  3L08 A;  2WWZ A;  3TL5 A;  2ZNV C;  1S3S G;  4FJY A;  4KDI C;  2KDB A;  3RD2 A;  3V6E B;  1OQY A;  2BYE A;  2V1Y A;  3VUY A;  3ALB A;  3CSF A;  2IO1 B;  3QCA A;  3DPD A;  2XBB C;  4LJO B;  1G6J A;  3DBL I;  4ZRI A;  3DBH I;  1KLV A;  4ZDV A;  2C7M B;  3KH0 A;  3JSV A;  3L10 B;  3VDZ A;  2C9W B;  3PS6 A;  1V86 A;  3A1Q B;  4GDL B;  2JXX A;  4HPM B;  1IYF A;  2FCN A;  5G55 A;  4IWQ A;  2DYB A;  2NPT A;  3ZO5 B;  4ANU A;  3NZU A;  3TMP B;  4HDO A;  3D32 A;  3H1U A;  5AZF A;  3VFK A;  1WJN A;  2ZZP B;  2YVC A;  1ISN A;  1A5R A;  4EEW A;  2MBH A;  1WH3 A;  3H7P B;  3X0W A;  4IC7 B;  2O6V A;  3A9J A;  4B9K A;  3UQB A;  4NAW A;  3K9O B;  1XT9 B;  4B6W A;  3DDC B;  4MGY E;  2KTF A;  3R7Q A;  3EEC A;  1ZKH A;  5G2N A;  3NS8 A;  3AU5 A;  1AAR A;  2KDF B;  4I6P A;  1E8W A;  2M1M A;  1F9J A;  2R2O A;  4GXB A;  5D6J B;  1P1A A;  3OJ4 B;  4LCD E;  2GMI C;  3WIM A;  4NY0 A;  3WAP A;  2KOX A;  4A20 A;  1WR6 E;  1YX5 B;  4M0W B;  2K6Q A;  2ZEQ A;  3M95 A;  2CR5 A;  2IBI B;  2M0X A;  2Z0E B;  4GSW A;  4E71 A;  2J0M A;  4FA6 A;  3AXC A;  1BT0 A;  2LXC A;  3IHP C;  4MGK E;  2ZPN A;  2WX1 A;  3IVF A;  1WMH B;  3BY4 B;  2KWC A;  4JLC A;  1WZ3 A;  1EF1 A;  5DPS A;  4TKN A;  4WJN A;  2NCN A;  1YJ1 A;  2FCQ A;  4MEL A;  3SDL C;  1WJ6 A;  2N7E A;  4G3X B;  4G50 A;  3ONS A;  3V60 A;  1TTN A;  3VTW A;  2RGF A;  5TR5 A;  2CHX A;  2M17 A;  4M8N A;  3ZTC A;  1NDD A;  3ZNH B;  4HXD A;  3S2A A;  4LDT B;  1P9D U;  3RCZ A;  2LD9 A;  5KHO A;  2MLB A;  2PE9 A;  3Q3J A;  2L05 A;  3EC8 A;  3H7S A;  2KDI A;  4W9G A;  3I3T B;  1Q1O A;  2MCN B;  2BF8 B;  3LDZ E;  2D11 A;  4HDQ A;  3VH3 B;  1WGG A;  2KWV B;  5D7G A;  4IM3 A;  4CYE A;  3ZTD A;  4EUT A;  1UZX B;  2RR9 A;  4JQW C;  2LVO A;  3DVG X;  3B0A A;  1C3T A;  2A4Z A;  3ZNI D;  2KO3 A;  4K81 A;  4ZRJ A;  3GOE A;  5GMV A;  5JH5 C;  3U8Z A;  3HHM A;  1WJ4 A;  2N4F A;  2ZNV B;  2JUO A;  3NY5 A;  2GBJ A;  3RZF A;  3PLU A;  1GNU A;  3RUL A;  3HM3 A;  1ZGU B;  4FHJ A;  5C23 A;  2HD5 B;  3KYC D;  5DCN A;  4GIV A;  2KN5 A;  1YD8 U;  2KJH B;  2J0J A;  1NI2 A;  3KUD B;  3V6C B;  4WJO A;  2JY6 A;  1LM8 B;  4KZ0 A;  2KC1 A;  4GDK A;  2KWU B;  4N9F 4;  3VTV A;  1WM2 A;  2LGD A;  2N9E B;  4DHJ B;  1OEY J;  2KFK B;  2FCM A;  4AJY B;  2FAZ A;  2NR2 A;  2O2V A;  4BVU C;  4W9H A;  4J6I A;  3W1Y A;  1E90 A;  2N7D A;  1E5W A;  3QC8 B;  2YLM A;  3RT3 B;  4I6L B;  4TV3 A;  1WFY A;  4NPN A;  2C7H A;  2GBN A;  2JRI B;  4W9L A;  3W1S A;  4G11 A;  1TGZ B;  2GBM A;  3WAO A;  3PV1 A;  3APC A;  3KUC B;  3U7D A;  1E8Z A;  2CS4 A;  2K8H A;  4JGH B;  1WGY A;  4W9E A;  1P3Q U;  3PRZ A;  4IM2 A;  1LXD A;  1WX8 A;  3JVZ X;  4MH0 E;  5IAA C;  4KIK B;  2REX A;  1SE9 A;  4XX5 A;  3KVF B;  2M8S A;  4CO7 A;  3ZDM C;  3GZN I;  1GG3 A;  3M62 B;  4ICV A;  2L76 A;  2W9N A;  3HM6 X;  3ZRC A;  3M3J A;  4FJZ A;  1UBI A;  3L0W B;  4HPL B;  3L16 A;  4DXA B;  2LUE A;  1V2Y A;  3PZD A;  2MA9 B;  2MBE A;  2BYF A;  4RM8 A;  2LRW A;  2N1W A;  3CF6 E;  5HKH A;  3VHT C;  4PYU A;  1J19 A;  2NBU A;  3RUI B;  5L83 A;  4AUQ C;  3ZIM A;  4DWF A;  3ENE A;  2K25 A;  2KJ6 A;  3T8M A;  3UGB B;  3EHV A;  2ZVN A;  1V81 A;  3H9D A;  3UQA A;  2JRH A;  3B1L X;  3WAM A;  2ASQ A;  1OEY A;  3PT2 B;  3ZVV A;  1R4N I;  1L7Y A;  3TCA A;  2XK5 B;  2LVQ A;  4K1R B;  1RFA A;  4K7S A;  4MEM A;  1M94 A;  3B08 A;  4NQL B;  2KFJ A;  3ZNG C;  2KNB A;  5LXH A;  3N3K B;  1WXV A;  3H6N A;  4EZK A;  2KMC A;  4IW0 A;  1V49 A;  3MJW A;  5AZH A;  2G3Q B;  4W9F A;  2B3A A;  4JIO U;  3VTU A;  3UIO B;  2DZK A;  3IG3 A;  2UWQ A;  1MG8 A;  3DVN V;  4KSL C;  4LDT D;  2KTR B;  2MP2 A;  4HVB A;  3ZUN A;  4FJV B;  2KMA A;  5JHA A;  4URK A;  4KDL B;  2L0T A;  3PLV A;  5E6P A;  2FUH B;  2NBV B;  1V6E A;  3DBR I;  2GOW A;  4HJK A;  4K7W A;  2DYM A;  1D3Z A;  3AUL A;  2KAN A;  2RSU A;  2LGY A;  2LJ5 A;  1WF9 A;  3L13 A;  2G4D B;  4DBG A;  2JT4 B;  1FXT B;  4B95 A;  3VXW A;  3ML9 A;  3UIP B;  3QHT A;  4HK2 A;  5DPT A;  2Y5B B;  2N9X A;  4TQ0 A;  1WYW B;  3A1Q A;  4GDL A;  2K8C A;  4P7I A;  4PYZ A;  3HK0 A;  3RZW C;  1NBF C;  4FHK A;  2XEW A;  3V62 A;  3PHX B;  3A4S C;  2JF5 A;  4DHZ B;  4ZRK A;  1KOT A;  4KV2 A;  4MGI E;  2QHO A;  2D3G A;  5CX3 A;  2I1K A;  2HE7 A;  4FAD A;  1CMX B;  4IWP A;  2IO2 B;  2L3Z A;  3H7P A;  4W9D A;  3NZS A;  3ZDT A;  4DHJ D;  5JZE B;  4GN1 A;  1YQB A;  3PHW B;  4RMA A;  2MQJ A;  1LFD A;  2AWT A;  2IY1 B;  4W9I A;  2KLC A;  3WAL A;  3NOB A;  4FBJ B;  5J2R A;  4W9K A;  3MTN B;  2KLG A;  1Z2M A;  4AP4 C;  4W9C A;  2Z59 B;  4MJS B;  1EF5 A;  2Z0D B;  3JYU A;  1WI0 A;  1WJU A;  4AWJ A;  2MBO A;  1RRB A;  1IP9 A;  4FLH A;  4IM0 A;  3A9K B;  1WE7 A;  4BBN F;  1XQQ A;  3ECI A;  4II3 B;  4WJP A;  1IPG A;  2ZVO A;  2JZZ A;  3Q3F A;  3O65 B;  2KK8 A;  3QJZ A;  4GMV A;  4KVG B;  4OVV A;  4A3P A;  2DZI A;  4A3O A;  2IO3 B;  2KQ7 A;  2LXA A;  2ZCC A;  2KHW B;  1WMH A;  2CHZ A;  1S1Q B;  2FID A;  3N32 A;  3V61 A;  2MW5 A;  1WZ0 A;  1H4R A;  4MM3 A;  4XC2 A;  4ANX A;  1X1M A;  2CU1 A;  2KDE B;  4BKS D;  3QWZ B;  4WAA A;  5D2M B;  2MSE D;  3VQI A;  4BKT A;  1RAX A;  1E7V A;  1WRD B;  4GU2 A;  4IG7 B;  2L0F A;  1Y8R C;  4CHK A;  1V5O A;  5DPW A;  3LJ3 A;  4EZL A;  1V9J A;  3CST A;  1V80 A;  4PS3 A;  3JW0 X;  3JSV B;  4KSK C;  5CHF A;  3ZLZ A;  2UYZ B;  2KVR A;  2PPH A;  4LJP B;  5FR6 A;  2PE6 B;  3SHQ A;  2NPT B;  4HWI B;  1WE6 A; 
#chains in the Genus database with same CATH topology
 2QIE B;  1XLN A;  4YSY B;  1TS5 A;  3EFU A;  4TMA B;  1E0Z A;  2CHW A;  3W1S C;  4IWO A;  1TS4 A;  5E6N A;  3PZ7 A;  3APD A;  2VRR B;  2N9P C;  1KLG D;  3OG5 A;  2BWE S;  4DHZ E;  1PGX A;  3PGE A;  3Q8E A;  2CJO A;  4I6N B;  3DOW A;  1I42 A;  3IT4 B;  1ROE A;  5EDS A;  2WXO A;  3DBS A;  4KGS A;  2EEL A;  1C78 A;  3B2G A;  4ICU A;  2QC8 A;  4P6V F;  2ICI A;  3Q8A A;  3WAN A;  4KIK A;  2CU3 A;  4FN2 A;  1UF0 A;  2KD0 A;  5E6O A;  2ZCB A;  3DHI C;  2DHZ A;  2WU5 B;  2E3T A;  3BK2 A;  4S17 A;  1T5X D;  2N7J A;  4IDI A;  3TEZ A;  4BKS A;  4DDI D;  2KAJ A;  4RGT A;  3I5J C;  4MSQ B;  2IYD B;  1VDV A;  2DEN B;  5L95 C;  2XK5 A;  4WWP A;  4BBN C;  2K6D B;  4N6E B;  4BZA A;  4KX6 B;  1VZ6 A;  4MSM B;  1J7C A;  1I4Q A;  2C5L C;  1MI0 A;  3TJP A;  2V3P A;  5LLI A;  3AED B;  2KTR A;  1SBB B;  2RPV A;  4GB9 A;  1HXY D;  2V3S A;  2BPS A;  3OLM D;  3N9Y C;  5CHW A;  5LXI B;  1N60 A;  3BYT B;  3I63 C;  2JWU A;  2N9L A;  4HLE A;  2WXI A;  3ZNZ B;  5AZG A;  2L00 B;  1I35 A;  5BYQ A;  3PTF C;  5IA7 A;  3MHZ A;  1TBE A;  1HQR D;  4RFB A;  5BMI A;  2X38 A;  2LGI A;  3SFE B;  1N62 A;  1E7U A;  5JXV A;  4ITK A;  2DZJ A;  1VCB A;  2IPK D;  4DK5 A;  2BKF A;  2IND C;  2WXP A;  2DYO A;  3DVG Y;  1HE8 A;  1Q5W B;  3ZGZ A;  4OZB A;  2KJR A;  1UWX A;  2L7R A;  1E8Y A;  4NQK E;  5EE0 A;  4TQ1 A;  2WXK A;  1JWU D;  1WX7 A;  1UGM A;  3MP9 A;  2CJN A;  2OJR A;  2OOB B;  3QAQ A;  1ZE3 D;  4A8X C;  1YX6 B;  3PPA A;  1J8C A;  3GE8 C;  2ZJD A;  3SD5 A;  2IZV B;  2MX2 A;  2MBB B;  1C76 A;  1K51 A;  3RN9 C;  1TY0 A;  2WWZ A;  2ZNV C;  5G5G A;  3RNB C;  2D3C A;  3C19 A;  4FJY A;  2FUG 1;  2BYE A;  1AWD A;  5TSS A;  3ALB A;  3QCA A;  1QIL A;  3DBL I;  3DBH I;  1MHX A;  4ZDV A;  2C7M B;  1F0Z A;  3KH0 A;  1R4N B;  1FNW A;  3JSV A;  1IYF A;  3A1Q B;  1QKZ A;  2JXX A;  2FCN A;  4IWQ A;  3H8H A;  4M01 A;  4C80 A;  3TMP B;  3DHG C;  5AZF A;  4M02 A;  2O6V A;  4B6W A;  1F52 A;  2WU2 B;  1JAL A;  3DDC B;  2IGD A;  2KTF A;  4XDD A;  4I6P A;  4TSS A;  4GXB A;  2GMI C;  1MVK A;  3WIM A;  3UI3 A;  4A20 A;  1FCC C;  1YX5 B;  2K6Q A;  2M0X A;  4GSW A;  3HUI A;  2W54 A;  2PTL A;  2ACZ B;  3ZYY X;  1BT0 A;  2ZPN A;  1WMH B;  4YTP B;  1DYQ A;  4JLC A;  1WZ3 A;  3VR8 B;  1YJ1 A;  1WJ6 A;  2N7E A;  3P4R B;  4G50 A;  3ONS A;  3V60 A;  5BYR A;  5TR5 A;  4C7Z A;  4M8N A;  1NDD A;  3SR6 A;  3S2A A;  2ZW0 A;  3P1M A;  3TEX A;  5KHO A;  3Q3J A;  1JWS D;  2PE9 A;  2KDI A;  4W9G A;  1ET6 A;  1MG4 A;  1K53 A;  5FK9 C;  2BF8 B;  3LDZ E;  1MHH E;  2V0G A;  3GB1 A;  2M19 A;  2RR9 A;  1CJE A;  3DVG X;  3B0A A;  2ONQ A;  4ZRJ A;  1EU3 A;  3U8Z A;  2ZNV B;  3GS2 A;  5C3J B;  3RZF A;  1GNU A;  4CQN A;  3HM3 A;  1KLU D;  4FHJ A;  3Q2A C;  2KN5 A;  4ZHO A;  4WJO A;  2JY6 A;  1LM8 B;  1FRR A;  2QEJ C;  2KWU B;  1RYJ A;  1OEY J;  2FAZ A;  2NR2 A;  2WHI A;  4W9H A;  4RGM A;  3QC8 B;  2AQ2 B;  3RT3 B;  2INP E;  4MT5 A;  4NPN A;  2C7H A;  4WAF A;  4W9L A;  3C8Y A;  3WAO A;  1QT9 A;  2CS4 A;  4XWT A;  1WGY A;  4W9E A;  1P3Q U;  4MH0 E;  5FR3 A;  3WCQ A;  3KVF B;  2M8S A;  2WLB A;  3ZDM C;  2L76 A;  1ZDV A;  2OHF A;  1XLO A;  2PW9 A;  4FJZ A;  2MHJ A;  3CF6 E;  2PMV A;  3RUI B;  4DWF A;  2JZP A;  3I9V 1;  3BVZ A;  2JRH A;  3WAM A;  1J7B A;  4RCO A;  2LVQ A;  2PLP A;  2KNB A;  2BVC A;  1WXV A;  4JWS C;  4JWU C;  4GLS C;  2KMC A;  3KWV A;  4W9F A;  3IT6 B;  1H8C A;  3IG3 A;  4KSL C;  3ZXV A;  3RMK C;  3ZJV A;  4IKG A;  4HVB A;  2KMA A;  3AN1 A;  3DBR I;  2GOW A;  3U52 E;  4K7W A;  4LNF A;  5EE1 A;  2KAN A;  1KH0 A;  1WF9 A;  2WXH A;  3L13 A;  4HKZ E;  4DBG A;  4B95 A;  1LO5 D;  1L0X B;  3VXW A;  3IXS A;  2BQQ A;  1L6U A;  3ML9 A;  4YXD B;  1IGC A;  3E9S A;  4P1B C;  2N9X A;  2LGS A;  4FHK A;  2XEW A;  3PHX B;  3A4S C;  1BUI C;  2BB5 A;  4DHZ B;  1QF6 A;  4MGI E;  1B9R A;  2D3G A;  1KF6 B;  4IWP A;  4W9D A;  5JZE B;  3H7P A;  1YQB A;  2G1E A;  2AWT A;  2IY1 B;  2K0P A;  3VRB B;  1JRO A;  3NOB A;  5J2R A;  4AP4 C;  4NJC A;  1SIJ A;  1V1P B;  2MBO A;  1RRB A;  5AUI A;  1JWA D;  1ACC A;  3QJZ A;  2DZI A;  4A3O A;  1MPE A;  2KQ7 A;  2KHW B;  2CHZ A;  2N0S B;  3SEB A;  1H4R A;  2KDE B;  4ZRQ A;  2FE8 A;  3VQI A;  4A9A A;  1WRD B;  1HA5 A;  5DPW A;  3AM9 A;  2BS4 B;  1WWT A;  1DOI A;  3KWL A;  4BAX A;  4YT0 B;  5FR6 A;  3SHQ A;  4K7U A;  2ZW1 A;  3NVY A;  2PE6 B;  3NVW A;  3B2F A;  1L0Y B;  3QQ8 B;  3KUZ A;  4JE3 B;  2M4N A;  2IO0 B;  4B0E A;  2DAF A;  1C9F A;  4AJW A;  1R7S A;  3A9J B;  1K8R B;  1YN5 A;  4F1S A;  3MC9 A;  3DHH C;  4MGZ E;  4P1C C;  2WNM A;  2MWS B;  4ZYN A;  3PZ8 A;  3CIR B;  1GC7 A;  2KWD A;  5CHV C;  3W5U B;  2JYE A;  2M56 B;  3DVN U;  3R8B A;  3AV8 A;  2HJ8 A;  4WWM A;  1T6B X;  3L54 A;  4OVZ A;  1AN8 A;  1NI3 A;  4XWW A;  4Q2J A;  4QAY A;  3ZXR A;  5JHB A;  3HVD A;  1NEN B;  3MHS D;  3OAW A;  2G45 B;  1XEE A;  3AMZ A;  3ZKJ C;  5I4D A;  3NVZ A;  1GC6 A;  5IOI A;  1TZ1 A;  1WR1 A;  2LAS A;  1BXT A;  3BIN A;  3PRE A;  1Z5S B;  2WDR B;  3UF8 A;  4J3O D;  1Q10 A;  1Q0W B;  1GJZ A;  2DNF A;  4XZ4 A;  5J18 A;  5DPR A;  2ZPY A;  3AE9 B;  2JWZ A;  5T8I A;  1B1Z A;  1FEH A;  4ANW A;  1STE A;  2RD0 A;  3M63 B;  2L8J A;  2LWP A;  4BOS C;  2EKE C;  3NG0 A;  4HCN B;  4BKG A;  2LUM A;  1RFK A;  2X8X X;  5HG2 A;  1DOX A;  4EOY A;  2KC2 A;  2AL6 A;  1YJJ A;  3DCG A;  2UU7 A;  5CTR C;  2JQR B;  2GB1 A;  5HI1 A;  1DGJ A;  3OJ3 A;  2O2V B;  1N61 A;  3E56 A;  3IBE A;  1KJT A;  2FNJ B;  2L32 A;  3IAS 1;  2KKC A;  3HRD D;  2J4X A;  2FCS A;  2MRP A;  2M0A A;  3AH7 A;  1QOA A;  2AYO B;  4YL8 A;  3R2T A;  1SB3 C;  3IFW B;  5IKC M;  5C2T B;  3PRP B;  2DZM A;  3URY A;  1UH6 A;  5H92 C;  1RM6 C;  3TBL D;  4MJS A;  2C7N B;  3U30 A;  4W9J A;  2A5U A;  2WXG A;  1WGD A;  2MBQ A;  1EM7 A;  3ZW3 A;  2VH2 A;  2EMT A;  1WY8 A;  2INC C;  3QX1 A;  3AEG B;  3RYT A;  1UBQ A;  4YSX B;  5MPO A;  2GBK A;  1YMH E;  2G4S A;  3L08 A;  5D3I B;  2KVZ A;  3RD2 A;  2KDB A;  1OQR A;  1OQY A;  2V1Y A;  2JU6 X;  2IO1 B;  2QJL A;  2XBB C;  1G6J A;  1KLV A;  4REZ A;  2MJE A;  5D3D A;  5H8Y E;  3L10 B;  4GDL B;  1UGJ A;  3ZO5 B;  4ANU A;  3D32 A;  3H1U A;  2LJI A;  2GLS A;  1ISN A;  1TKE A;  2MBH A;  4LLG M;  4IC7 B;  1XT9 B;  2PVG C;  1ZKH A;  1TS3 A;  1SJE D;  1E8W A;  2BW2 A;  2L52 A;  2M1M A;  1P1A A;  5AUK A;  3WAP A;  4XYC A;  4HEA 1;  4M0W B;  3M95 A;  2ZEQ A;  2E6X A;  1AW7 A;  2Z0E B;  1C4P A;  4E71 A;  2J0M A;  2Y5C A;  3TUO A;  4ZOH C;  2KWC A;  4WJN A;  4MM3 B;  2NCN A;  4MEL A;  3SDL C;  4HKQ A;  1TTN A;  3BWU D;  1ENF A;  2M17 A;  3ZNH B;  4HXD A;  1P9D U;  2QDF A;  3W9C B;  2QIL A;  2K5P A;  3AE4 B;  3TEW A;  2D11 A;  4HDQ A;  3VRA B;  5IN7 A;  4IM3 A;  4JQW C;  2LVO A;  4YTM B;  1D4B A;  2IJ0 A;  4LK0 M;  2A4Z A;  2KO3 A;  4K81 A;  3RNF C;  3O13 A;  2W55 A;  1WJ4 A;  2N4F A;  4RNA A;  2INN E;  1F2R I;  3AEB B;  3RUL A;  5C23 A;  2HD5 B;  3KYC D;  5DCN A;  3FC4 A;  3V6C B;  1D5Z C;  2Q5W D;  1T0S C;  2KFK B;  1J7A A;  4AJY B;  4C4V B;  4J6I A;  3IAM 1;  1E5W A;  2YLM A;  4TV3 A;  3W1S A;  1VZ8 A;  3PV1 A;  3KUC B;  3U7D A;  4XDC A;  4JGH B;  1IBX B;  3N1Y C;  1KFY B;  4IM2 A;  3PRZ A;  5IAA C;  2MH7 A;  2REX A;  1SE9 A;  4MH8 A;  3GZN I;  2W9N A;  2GRI A;  3W2D A;  1I4P A;  2J52 A;  2N1W A;  1LGR A;  2NBU A;  5L83 A;  4AUQ C;  4P16 A;  2K25 A;  3UGB B;  3EHV A;  2AX5 A;  2ON8 A;  4DXF A;  1I7H A;  3PO0 A;  1VZ7 A;  3ZJT A;  1VR9 A;  1C4A A;  3ZVV A;  1L7Y A;  4K1R B;  5LXH A;  4MEM A;  2KFJ A;  3N3K B;  3U4E G;  4IW0 A;  3MJW A;  4XGA B;  1UNS A;  2K9X A;  4JIO U;  5BYS A;  3DVN V;  1MG8 A;  2R61 A;  4FJV B;  4ARI A;  4KDL B;  2FUH B;  3ZQ4 A;  2DYM A;  2NTS A;  3AUL A;  5BMH A;  2JT4 B;  1D6E C;  4DXG A;  1I4H A;  3QHT A;  4HK2 A;  3A1Q A;  1VRA B;  3FIL B;  1IUE A;  3GP7 A;  2JXT A;  1JWB D;  2I1K A;  2L3Z A;  2PIA A;  3AE1 B;  4DQO C;  2KLC A;  4FBJ B;  3MJ5 A;  3MTN B;  2BS3 B;  2Z59 B;  3JYU A;  1EWC A;  3FAH A;  4AWJ A;  4LNI A;  4RGO S;  1QOG A;  3A9K B;  4BBN F;  3ECI A;  4II3 B;  1C79 A;  2ZVO A;  3Q3F A;  4OVV A;  2ZCC A;  2LXA A;  2LHE A;  5IP4 D;  1WMH A;  3N32 A;  3V61 A;  2MW5 A;  4ANX A;  3R2I A;  2CU1 A;  3QWZ B;  4WAA A;  5D2M B;  1I4G A;  1EWY C;  4GU2 A;  3KLS X;  3ETR A;  2L0F A;  1FO4 A;  1Y8R C;  1YQ4 B;  2H89 B;  4A55 A;  1QOF A;  3CST A;  1TT5 B;  1R4M B;  2UYZ B;  2KVR A;  2PPH A;  2OED A;  2NPT B;  1ESF A;  2J0K A;  3N30 A;  3CMM B;  3Q3N C;  4RH6 A;  3FKY A;  3VUW A;  2KX0 A;  3NS1 A;  2GI9 A;  4JL9 A;  4NAW B;  4EFO A;  3AI5 A;  2LRU A;  1F77 A;  4AQ7 A;  2AL3 A;  2KXJ A;  1FFV A;  1HTQ A;  3BYY B;  2VZK B;  2WX0 A;  4F8C B;  2K39 A;  4NJ7 A;  2WDV B;  1HZ6 A;  3DBL B;  5C1Z A;  1NYR A;  1ZOY B;  4PT5 A;  3N1X C;  1UD7 A;  3LYY A;  3A4R A;  1WXS A;  3N20 C;  2D07 B;  2BWF A;  3NHE B;  4WIP A;  2FIF A;  3Q3O C;  1L2N A;  2PEA A;  2SAK A;  4L2Y A;  2BKR B;  1WRI A;  2IDY A;  1P0R A;  2I1J A;  3DQV A;  4C56 C;  4MDK E;  1SSN A;  1WIA A;  4N59 A;  1YIW A;  3NZ3 A;  3BVM A;  1T3Q A;  3QIJ A;  1VD2 A;  3WA0 A;  4EKU A;  1WGK A;  2HTM E;  1C4C A;  4WQM A;  2JZ3 B;  4D2K A;  4TUU A;  4OVU A;  1V1O A;  2J7Q B;  2I2Y A;  2C60 A;  1FRD A;  1TIF A;  4WWO A;  4US9 A;  2KAC A;  1ET9 A;  2W3S A;  4GDK B;  4RM9 A;  2AEH A;  2BYV E;  3QAR A;  2CKH B;  1SE4 A;  4FUL A;  4ASW C;  3VAW A;  1EO6 A;  3V3X A;  4EZJ A;  3C0R B;  3T9L A;  4H2A A;  1FCL A;  3VH4 B;  3R7R A;  1U4A A;  5AEK B;  1RWS A;  3NJT A;  4PK1 A;  3X23 A;  1I4X A;  2JSV X;  2DLB A;  3P4Q B;  1V5T A;  2VZK D;  1JRU A;  4PS8 A;  4WWN A;  1HZ5 A;  3AU4 A;  2B76 B;  3UIN B;  2DAJ A;  3PRM B;  1OGW A;  4E3C A;  1EUV B;  1UEL A;  1FFU A;  1RLF A;  1MFW A;  3U2S C;  1V1P A;  5KHQ A;  4BOZ B;  2NBW B;  3A33 B;  3VUX A;  4KKI A;  1PGA A;  3ZRF A;  1D5M C;  2MP2 B;  3CWI A;  1JML A;  2VH1 A;  1ZUD 2;  2KZR A;  4GOC A;  3VR9 B;  3EGR A;  2JPH A;  3EFC A;  1QLB B;  1E7P B;  1P7F A;  1S3S G;  3V6E B;  1YN3 A;  5E6J A;  4LJO B;  2D3B A;  2SEB D;  4ZRI A;  4HPM B;  3PS6 A;  1V86 A;  4A90 A;  2H88 B;  4KKJ A;  2L83 A;  4R3D A;  3VFK A;  3SFD B;  1A5R A;  3X0W A;  3A9J A;  3UQB A;  3K9O B;  1YNT E;  4RGN A;  3AE3 B;  3R7Q A;  4B0M A;  1SE3 A;  3EEC A;  3DBR B;  5G2N A;  3AU5 A;  1E10 A;  2R2O A;  3AEE B;  5D6J B;  3OJ4 B;  4LCD E;  1WR6 E;  4IOI E;  2IBI B;  3RNA C;  1N63 A;  1T0Q C;  1JRP A;  4KGT A;  4FA6 A;  3AXC A;  2BYT A;  1FMA D;  1FM0 D;  2WXF A;  4MGK E;  2WX1 A;  1XXG A;  3P42 A;  3BY4 B;  1EF1 A;  5DPS A;  4TKN A;  3P63 A;  2IGH A;  3VTW A;  3BII D;  1L4D B;  2WXQ A;  2LD9 A;  1TY2 A;  2KMM A;  2L05 A;  3EC8 A;  3H7S A;  3ZJU A;  3I3T B;  1Q1O A;  2MCN B;  4LNO A;  1OFF A;  3ZTD A;  4EUT A;  1UZX B;  3GOE A;  1PYW D;  5GMV A;  5JH5 C;  2D3A A;  3HHM A;  2QMT A;  2JUO A;  1TJE A;  3PLU A;  1L5P A;  2MJ3 A;  3Q8F A;  3BZD B;  1ZGU B;  2HDE A;  2JYT A;  4GIV A;  3J9C A;  2KJH B;  1KTK A;  3KUD B;  2WXN A;  2KC1 A;  3DWM A;  4N9F 4;  2LGD A;  2N9E B;  4DHJ B;  3DWG C;  2FCM A;  3MFG A;  2O2V A;  4BVU C;  1T0R C;  3W1Y A;  4HRS A;  1SE2 A;  3Q3M C;  4I6L B;  1N5W A;  1WFY A;  2JRI B;  2GBN A;  4G11 A;  1TGZ B;  2GBM A;  1A70 A;  1HEZ E;  2K8H A;  1AYF A;  1LXD A;  1WX8 A;  4KIK B;  1KRH A;  3NUH B;  1GG3 A;  3M62 B;  4ICV A;  3NVV A;  1UBI A;  2QSD A;  1SXT A;  4DXA B;  2LUE A;  3PZD A;  2MA9 B;  2MBE A;  2BYF A;  2NTT A;  1CK1 A;  3VHT C;  4PYU A;  1EU4 A;  1E9M A;  2KJ6 A;  1F1H A;  2ZVN A;  3UQA A;  1E6E B;  2ASQ A;  1OEY A;  1R4N I;  3TCA A;  2XK5 B;  2YEP B;  4K7S A;  1RFA A;  3ZNG C;  3B08 A;  4NQL B;  3H6N A;  4EZK A;  5AZH A;  2G3Q B;  4C7Y A;  1WXQ A;  2B3A A;  3VTU A;  2DZK A;  2KTR B;  3Q69 A;  5JHA A;  4URK A;  2L0T A;  3PLV A;  2WS3 B;  1GOZ A;  2DBY A;  2NBV B;  4HJK A;  2W82 A;  1D3Z A;  5EE3 A;  3V05 A;  2RDB C;  2LGY A;  2LJ5 A;  2G4D B;  4FXC A;  2KT7 A;  1V97 A;  1FNU A;  1NVI D;  5DPT A;  4TQ0 A;  2LEK A;  1WYW B;  4GDL A;  3T3O A;  2K8C A;  3Q14 C;  4PYZ A;  3RZW C;  1NBF C;  1MJD A;  3V62 A;  2RMM A;  4ZRK A;  1KOT A;  3TSS A;  2IO2 B;  2WP9 B;  4DHJ D;  3NZS A;  1ZXH A;  3I57 A;  4LNK A;  1JWM D;  1V8C A;  3PHW B;  3RNC C;  4W9I A;  3WAL A;  4JPS A;  3AE8 B;  1Z2M A;  2PVO D;  1DOY A;  1EF5 A;  2Y3A A;  4KGR A;  4AS1 A;  2DWQ A;  3AEC B;  1WI0 A;  1WJU A;  4ARC A;  4FLH A;  2KN4 A;  1WE7 A;  4M0W A;  4K3B A;  1XQQ A;  2KYW A;  4WJP A;  1IPG A;  2JZZ A;  1FPY A;  3N1Z C;  4A3P A;  4YSZ B;  2IO3 B;  4JX1 C;  5BMG A;  1S1Q B;  1WZ0 A;  2BT6 A;  4MM3 A;  1X1M A;  2YEP F;  4BKS D;  4ACF A;  1RAX A;  1WYG A;  1E7V A;  1VLB A;  3L4P A;  3Q6B A;  3ABV B;  1V5O A;  3AE6 B;  3LJ3 A;  4EZL A;  1V9J A;  1V80 A;  1FXI A;  2RDG A;  3JSV B;  3JW0 X;  3ZLZ A;  4LJP B;  2KDM A;  1WE6 A;  2WXM A;  1OTR B;  1R4M I;  1TZO A;  3T3N A;  3APF A;  4HCP B;  2LGX A;  2O6V B;  5BO4 B;  2BBC A;  1ZDX A;  2KQ4 X;  3PVL A;  4OW0 A;  4XE0 A;  5EE9 A;  2KX3 A;  1SIF A;  1QQR A;  1FIQ A;  1F2R C;  1WXA A;  2EMS A;  2KFK A;  2LVP A;  2NS5 A;  1QZE A;  1WGR A;  2RPQ A;  4C4V A;  1SJH D;  1YN4 A;  4M8M A;  3SU8 X;  2V9H A;  1YQ3 B;  5LNK 1;  2D10 A;  1ZW7 A;  3ML8 A;  1E8X A;  2JVC A;  4ANV A;  1IBX A;  3TIX A;  3TEY A;  1P98 A;  3HIZ A;  3HVZ A;  2WXJ A;  2LMC A;  4IUM B;  4PS7 A;  1XLP A;  2K3U A;  3R66 C;  2R2Q A;  1WX9 A;  2V4L A;  3QA8 A;  2WYQ A;  1WSP A;  2NVU I;  4L1B A;  1SF0 A;  1LQB A;  2Y5P A;  1J0G A;  5J17 A;  1UUP A;  4F7Z A;  1JQ4 A;  2LHD A;  1GUA B;  2WDT B;  1T0Y A;  3KYD D;  4WQO B;  4X57 B;  1C1Y B;  4YWG G;  4EE2 A;  4G0N B;  4HRO A;  4KZC A;  1WGH A;  3L17 A;  2BGF A;  3R3M A;  4UDU C;  4E74 A;  4WJQ A;  1PQS A;  1XO3 A;  3OWE B;  1UWM A;  2D2Q A;  1WXM A;  4NJ6 A;  3K9P B;  2O6V D;  3RPF C;  1KM7 A;  4NNJ B;  1FD6 A;  3FIL A;  4WUR A;  1FXA A;  1YOV B;  4BFR A;  2HTH A;  1L0V B;  1XD3 B;  2K1F A;  2Z8L A;  3KW5 B;  2WDQ B;  2GBR A;  4II2 B;  1HTO A;  4ZHP A;  1WM3 A;  2K8B A;  5HFY A;  3QK0 A;  4HJG E;  3VVW B;  4AOF A;  4OHJ A;  2IY0 B;  2V4I B;  4K3C A;  1SGH A;  4ZYS A;  1K52 A;  1M4V A;  2TSS A;  2LI5 A;  1GPX A;  1TKY A;  1VJK A;  2N1V A;  2KQS A;  5IO9 A;  2PJH A;  3A9K A;  1N6Z A;  5D94 A;  2DX5 B;  4DDG D;  2LZ6 A;  3P4S B;  1IGD A;  3GZN B;  3PSE B;  3P2B A;  4GGQ A;  3BK1 A;  3TL5 A;  2J42 A;  4KDI C;  4LTU A;  4ZRP A;  3DBH B;  3RNE C;  3VUY A;  3CSF A;  3DPD A;  4NAM A;  2NMQ A;  1CZP A;  4N58 A;  3VDZ A;  2C9W B;  5G55 A;  2DYB A;  2NPT A;  3AB5 A;  3MC8 A;  1PDX A;  3NZU A;  3EA6 A;  4HDO A;  2PKO A;  4OZC A;  2MEK A;  1WJN A;  2ZZP B;  2YVC A;  4EEW A;  1WH3 A;  1OQQ A;  3H7P B;  4B9K A;  4NAW A;  1L6V A;  4MGY E;  3KQ4 A;  2XNA C;  1JCK B;  3NS8 A;  1AAR A;  2KDF B;  4RF1 A;  1F9J A;  1PFD A;  4S0R A;  4M00 A;  4NY0 A;  2JX5 A;  2KOX A;  3RFZ B;  5HHD G;  2CR5 A;  2WQY B;  4A6Q A;  2V3N A;  2FBW B;  5FKA C;  4C00 A;  2G9H D;  4O1N A;  2LXC A;  1NEK B;  3IHP C;  3IVF A;  4WH4 A;  3AE2 B;  2FCQ A;  4G3X B;  1ZXI A;  2EKI A;  2RGF A;  2CHX A;  3ZTC A;  1SEB D;  4LDT B;  3RCZ A;  2MLB A;  1C77 A;  2BB6 A;  1YJI A;  3VH3 B;  4L23 A;  1WGG A;  2KWV B;  5D7G A;  4CYE A;  1ZP0 B;  1C3T A;  3ZNI D;  1I4R A;  1TKG A;  3NY5 A;  1GB4 A;  2GBJ A;  3Q8B A;  1JW9 D;  4HPP A;  3AEA B;  2L1A A;  2WXR A;  2XN9 C;  1YD8 U;  1QOB A;  2J0J A;  4KZ0 A;  2K22 A;  4GDK A;  3VTV A;  1WM2 A;  1FNV A;  1E90 A;  2N7D A;  4YTN B;  2RDH A;  3P4P B;  3APC A;  1E8Z A;  4LNN A;  1K50 A;  3JVZ X;  4XX5 A;  4CO7 A;  2BTE A;  3HM6 X;  3ZRC A;  3M3J A;  3L0W B;  4HPL B;  2HJ1 A;  3L16 A;  1V2Y A;  4OZA A;  4RM8 A;  2LRW A;  5HKH A;  1J19 A;  1N5X A;  3ZIM A;  3ENE A;  3T8M A;  1CQV A;  1V81 A;  3H9D A;  2D5G A;  3B1L X;  3PT2 B;  4RF0 A;  3EUB 2;  1M94 A;  1TYG B;  3GE3 C;  1XF5 L;  2N9K A;  3W5V B;  1V49 A;  4NZL B;  3LB8 C;  3Q8C A;  3UIO B;  4MAC A;  2UWQ A;  4LDT D;  2MP2 A;  3ZUN A;  2OJW A;  5E6P A;  2MJD A;  1D5X C;  1V6E A;  2RSU A;  3U7Z A;  1FXT B;  2BS2 B;  3UIP B;  1Y56 A;  3RI7 C;  2Y5B B;  4P7I A;  1GAQ B;  1XCT L;  2WGS A;  3HK0 A;  3AE7 B;  1XLQ A;  3AEF B;  2JF5 A;  2WXL A;  4KV2 A;  2QHO A;  5CX3 A;  4FAD A;  2HE7 A;  1CMX B;  1P7E A;  3ZDT A;  2QCZ A;  4GN1 A;  4RMA A;  2MQJ A;  1LFD A;  1XCQ L;  1PGB A;  1L4Z B;  4W9K A;  1PUT A;  2KLG A;  2AQ1 B;  4MJS B;  4W9C A;  4US8 A;  2IGG A;  2Z0D B;  3AE5 B;  1IP9 A;  4IM0 A;  1GB1 A;  1BML C;  3NRZ A;  3BVG A;  3O65 B;  2KK8 A;  4GMV A;  4KVG B;  1TS2 A;  2LFI A;  2AQ3 B;  2FID A;  1ZPS A;  4XC2 A;  3LXF A;  3B9J A;  5G5H A;  2MSE D;  4BKT A;  2W3R A;  4IG7 B;  3MC0 B;  4CHK A;  2I38 A;  4USA A;  5GXG B;  1NYQ A;  4PS3 A;  5CHF A;  4KSK C;  3RNG C;  2J53 A;  4HWI B;  1NI2 A; 
#chains in the Genus database with same CATH homology
 1OTR B;  1R4M I;  2J0K A;  3KUZ A;  3N30 A;  3QQ8 B;  2M4N A;  3CMM B;  3APF A;  4K7U A;  2IO0 B;  4HCP B;  2LGX A;  3EFU A;  2DAF A;  3VUW A;  2CHW A;  2KX0 A;  3W1S C;  4IWO A;  4JL9 A;  2O6V B;  5E6N A;  3A9J B;  4AJW A;  1K8R B;  4NAW B;  3APD A;  4EFO A;  3AI5 A;  2VRR B;  2N9P C;  5BO4 B;  4F1S A;  2LRU A;  4MGZ E;  3PVL A;  2MWS B;  4ZYN A;  2BWE S;  2KX3 A;  1SIF A;  2AL3 A;  2KXJ A;  4DHZ E;  3PGE A;  1GC7 A;  4I6N B;  5CHV C;  1WXA A;  3DOW A;  1I42 A;  2WX0 A;  4F8C B;  3DVN U;  2EMS A;  2K39 A;  2KFK A;  2LVP A;  2NS5 A;  1QZE A;  1WGR A;  2RPQ A;  5EDS A;  2HJ8 A;  3DBS A;  4NJ7 A;  3L54 A;  5C1Z A;  3SU8 X;  4M8M A;  1UD7 A;  2D10 A;  1ZW7 A;  3ML8 A;  5JHB A;  3A4R A;  1E8X A;  1WXS A;  2JVC A;  3MHS D;  4ICU A;  4ANV A;  3OAW A;  2D07 B;  2G45 B;  2BWF A;  3NHE B;  3ZKJ C;  3TIX A;  1GC6 A;  2FIF A;  4KIK A;  3WAN A;  1H8C A;  1TZ1 A;  1WR1 A;  1P98 A;  2LAS A;  3HIZ A;  3BIN A;  3PRE A;  1L2N A;  1Z5S B;  2PEA A;  4FN2 A;  2KD0 A;  5E6O A;  2ZCB A;  2BKR B;  3UF8 A;  2DHZ A;  4PS7 A;  4IUM B;  1Q0W B;  1GJZ A;  3R66 C;  2R2Q A;  1P0R A;  2I1J A;  3DQV A;  4XZ4 A;  1WX9 A;  2V4L A;  3QA8 A;  1WIA A;  4MDK E;  1YIW A;  2WYQ A;  5J18 A;  2NVU I;  4BKS A;  4DDI D;  5DPR A;  3QIJ A;  1VD2 A;  2ZPY A;  2JWZ A;  3WA0 A;  4EKU A;  4MSQ B;  1LQB A;  2IYD B;  2DEN B;  5L95 C;  5J17 A;  1J0G A;  2XK5 A;  4WWP A;  4F7Z A;  4BBN C;  4ANW A;  2K6D B;  2RD0 A;  1GUA B;  2JZ3 B;  1T0Y A;  2WDT B;  3KYD D;  3M63 B;  4MSM B;  4OVU A;  4TUU A;  2C5L C;  3TJP A;  2L8J A;  2LWP A;  4BOS C;  2EKE C;  2J7Q B;  4WQO B;  5LLI A;  2C60 A;  1C1Y B;  4X57 B;  4HCN B;  4WWO A;  4BKG A;  4G0N B;  4KZC A;  2KTR A;  1WGH A;  3L17 A;  4EOY A;  2BGF A;  3R3M A;  4E74 A;  2KC2 A;  4WJQ A;  1PQS A;  2AL6 A;  4GB9 A;  4GDK B;  2V3S A;  2BPS A;  3OLM D;  3DCG A;  4RM9 A;  5CTR C;  5CHW A;  5LXI B;  3OJ3 A;  2AEH A;  2BYV E;  2O2V B;  3QAR A;  2CKH B;  5AZG A;  3ZNZ B;  4HLE A;  2L00 B;  1I35 A;  3IBE A;  4FUL A;  2D2Q A;  3PTF C;  5IA7 A;  1KJT A;  4ASW C;  2FNJ B;  1WXM A;  4NJ6 A;  3VAW A;  1EO6 A;  1TBE A;  3K9P B;  2KKC A;  2MRP A;  2FCS A;  2O6V D;  4EZJ A;  3C0R B;  3T9L A;  1E7U A;  1KM7 A;  4NNJ B;  2AYO B;  3VH4 B;  2DZJ A;  3R7R A;  1U4A A;  4YL8 A;  4BFR A;  5AEK B;  1VCB A;  2HTH A;  1XD3 B;  2K1F A;  3IFW B;  3KW5 B;  3X23 A;  2GBR A;  4II2 B;  3PRP B;  4DK5 A;  2BKF A;  1V5T A;  1WM3 A;  2K8B A;  3QK0 A;  1JRU A;  4PS8 A;  4WWN A;  2DZM A;  3VVW B;  4AOF A;  3AU4 A;  1UH6 A;  2IY0 B;  2DYO A;  3UIN B;  3DVG Y;  1HE8 A;  1Q5W B;  3TBL D;  1SGH A;  2DAJ A;  3PRM B;  1OGW A;  4E3C A;  1EUV B;  4MJS A;  2C7N B;  1UEL A;  2KJR A;  3U30 A;  4W9J A;  1RLF A;  2LI5 A;  2A5U A;  1WGD A;  2L7R A;  2N1V A;  1E8Y A;  2KQS A;  2MBQ A;  5KHQ A;  3ZW3 A;  4BOZ B;  2PJH A;  4NQK E;  3A9K A;  2NBW B;  2EMT A;  1WY8 A;  3A33 B;  4TQ1 A;  5D94 A;  3VUX A;  2DX5 B;  1WX7 A;  1UGM A;  3QX1 A;  2OJR A;  2OOB B;  3RYT A;  3ZRF A;  2LZ6 A;  1UBQ A;  4DDG D;  3QAQ A;  2MP2 B;  1YX6 B;  3PPA A;  1J8C A;  2ZJD A;  3PSE B;  3SD5 A;  2IZV B;  2MX2 A;  2MBB B;  3P2B A;  2KZR A;  4GGQ A;  4GOC A;  2GBK A;  2JPH A;  2G4S A;  3L08 A;  2WWZ A;  3TL5 A;  2ZNV C;  1S3S G;  4FJY A;  4KDI C;  2KDB A;  3RD2 A;  3V6E B;  1OQY A;  2BYE A;  2V1Y A;  3VUY A;  3ALB A;  3CSF A;  2IO1 B;  3QCA A;  3DPD A;  2XBB C;  4LJO B;  1G6J A;  3DBL I;  4ZRI A;  3DBH I;  1KLV A;  4ZDV A;  2C7M B;  3KH0 A;  3JSV A;  3L10 B;  3VDZ A;  2C9W B;  3PS6 A;  1V86 A;  3A1Q B;  4GDL B;  2JXX A;  4HPM B;  1IYF A;  2FCN A;  5G55 A;  4IWQ A;  2DYB A;  2NPT A;  3ZO5 B;  4ANU A;  3NZU A;  3TMP B;  4HDO A;  3D32 A;  3H1U A;  5AZF A;  3VFK A;  1WJN A;  2ZZP B;  2YVC A;  1ISN A;  1A5R A;  4EEW A;  2MBH A;  1WH3 A;  3H7P B;  3X0W A;  4IC7 B;  2O6V A;  3A9J A;  4B9K A;  3UQB A;  4NAW A;  3K9O B;  1XT9 B;  4B6W A;  3DDC B;  4MGY E;  2KTF A;  3R7Q A;  3EEC A;  1ZKH A;  5G2N A;  3NS8 A;  3AU5 A;  1AAR A;  2KDF B;  4I6P A;  1E8W A;  2M1M A;  1F9J A;  2R2O A;  4GXB A;  5D6J B;  1P1A A;  3OJ4 B;  4LCD E;  2GMI C;  3WIM A;  4NY0 A;  3WAP A;  2KOX A;  4A20 A;  1WR6 E;  1YX5 B;  4M0W B;  2K6Q A;  2ZEQ A;  3M95 A;  2CR5 A;  2IBI B;  2M0X A;  2Z0E B;  4GSW A;  4E71 A;  2J0M A;  4FA6 A;  3AXC A;  1BT0 A;  2LXC A;  3IHP C;  4MGK E;  2ZPN A;  2WX1 A;  3IVF A;  1WMH B;  3BY4 B;  2KWC A;  4JLC A;  1WZ3 A;  1EF1 A;  5DPS A;  4TKN A;  4WJN A;  2NCN A;  1YJ1 A;  2FCQ A;  4MEL A;  3SDL C;  1WJ6 A;  2N7E A;  4G3X B;  4G50 A;  3ONS A;  3V60 A;  1TTN A;  3VTW A;  2RGF A;  5TR5 A;  2CHX A;  2M17 A;  4M8N A;  3ZTC A;  1NDD A;  3ZNH B;  4HXD A;  3S2A A;  4LDT B;  1P9D U;  3RCZ A;  2LD9 A;  5KHO A;  2MLB A;  2PE9 A;  3Q3J A;  2L05 A;  3EC8 A;  3H7S A;  2KDI A;  4W9G A;  3I3T B;  1Q1O A;  2MCN B;  2BF8 B;  3LDZ E;  2D11 A;  4HDQ A;  3VH3 B;  1WGG A;  2KWV B;  5D7G A;  4IM3 A;  4CYE A;  3ZTD A;  4EUT A;  1UZX B;  2RR9 A;  4JQW C;  2LVO A;  3DVG X;  3B0A A;  1C3T A;  2A4Z A;  3ZNI D;  2KO3 A;  4K81 A;  4ZRJ A;  3GOE A;  5GMV A;  5JH5 C;  3U8Z A;  3HHM A;  1WJ4 A;  2N4F A;  2ZNV B;  2JUO A;  3NY5 A;  2GBJ A;  3RZF A;  3PLU A;  1GNU A;  3RUL A;  3HM3 A;  1ZGU B;  4FHJ A;  5C23 A;  2HD5 B;  3KYC D;  5DCN A;  4GIV A;  2KN5 A;  1YD8 U;  2KJH B;  2J0J A;  1NI2 A;  3KUD B;  3V6C B;  4WJO A;  2JY6 A;  1LM8 B;  4KZ0 A;  2KC1 A;  4GDK A;  2KWU B;  4N9F 4;  3VTV A;  1WM2 A;  2LGD A;  2N9E B;  4DHJ B;  1OEY J;  2KFK B;  2FCM A;  4AJY B;  2FAZ A;  2NR2 A;  2O2V A;  4BVU C;  4W9H A;  4J6I A;  3W1Y A;  1E90 A;  2N7D A;  1E5W A;  3QC8 B;  2YLM A;  3RT3 B;  4I6L B;  4TV3 A;  1WFY A;  4NPN A;  2C7H A;  2GBN A;  2JRI B;  4W9L A;  3W1S A;  4G11 A;  1TGZ B;  2GBM A;  3WAO A;  3PV1 A;  3APC A;  3KUC B;  3U7D A;  1E8Z A;  2CS4 A;  2K8H A;  4JGH B;  1WGY A;  4W9E A;  1P3Q U;  3PRZ A;  4IM2 A;  1LXD A;  1WX8 A;  3JVZ X;  4MH0 E;  5IAA C;  4KIK B;  2REX A;  1SE9 A;  4XX5 A;  3KVF B;  2M8S A;  4CO7 A;  3ZDM C;  3GZN I;  1GG3 A;  3M62 B;  4ICV A;  2L76 A;  2W9N A;  3HM6 X;  3ZRC A;  3M3J A;  4FJZ A;  1UBI A;  3L0W B;  4HPL B;  3L16 A;  4DXA B;  2LUE A;  1V2Y A;  3PZD A;  2MA9 B;  2MBE A;  2BYF A;  4RM8 A;  2LRW A;  2N1W A;  3CF6 E;  5HKH A;  3VHT C;  4PYU A;  1J19 A;  2NBU A;  3RUI B;  5L83 A;  4AUQ C;  3ZIM A;  4DWF A;  3ENE A;  2K25 A;  2KJ6 A;  3T8M A;  3UGB B;  3EHV A;  2ZVN A;  1V81 A;  3H9D A;  3UQA A;  2JRH A;  3B1L X;  3WAM A;  2ASQ A;  1OEY A;  3PT2 B;  3ZVV A;  1R4N I;  1L7Y A;  3TCA A;  2XK5 B;  2LVQ A;  4K1R B;  1RFA A;  4K7S A;  4MEM A;  1M94 A;  3B08 A;  4NQL B;  2KFJ A;  3ZNG C;  2KNB A;  5LXH A;  3N3K B;  1WXV A;  3H6N A;  4EZK A;  2KMC A;  4IW0 A;  1V49 A;  3MJW A;  5AZH A;  2G3Q B;  4W9F A;  2B3A A;  4JIO U;  3VTU A;  3UIO B;  2DZK A;  3IG3 A;  2UWQ A;  1MG8 A;  3DVN V;  4KSL C;  4LDT D;  2KTR B;  2MP2 A;  4HVB A;  3ZUN A;  4FJV B;  2KMA A;  5JHA A;  4URK A;  4KDL B;  2L0T A;  3PLV A;  5E6P A;  2FUH B;  2NBV B;  1V6E A;  3DBR I;  2GOW A;  4HJK A;  4K7W A;  2DYM A;  1D3Z A;  3AUL A;  2KAN A;  2RSU A;  2LGY A;  2LJ5 A;  1WF9 A;  3L13 A;  2G4D B;  4DBG A;  2JT4 B;  1FXT B;  4B95 A;  3VXW A;  3ML9 A;  3UIP B;  3QHT A;  4HK2 A;  5DPT A;  2Y5B B;  2N9X A;  4TQ0 A;  1WYW B;  3A1Q A;  4GDL A;  2K8C A;  4P7I A;  4PYZ A;  3HK0 A;  3RZW C;  1NBF C;  4FHK A;  2XEW A;  3V62 A;  3PHX B;  3A4S C;  2JF5 A;  4DHZ B;  4ZRK A;  1KOT A;  4KV2 A;  4MGI E;  2QHO A;  2D3G A;  5CX3 A;  2I1K A;  2HE7 A;  4FAD A;  1CMX B;  4IWP A;  2IO2 B;  2L3Z A;  3H7P A;  4W9D A;  3NZS A;  3ZDT A;  4DHJ D;  5JZE B;  4GN1 A;  1YQB A;  3PHW B;  4RMA A;  2MQJ A;  1LFD A;  2AWT A;  2IY1 B;  4W9I A;  2KLC A;  3WAL A;  3NOB A;  4FBJ B;  5J2R A;  4W9K A;  3MTN B;  2KLG A;  1Z2M A;  4AP4 C;  4W9C A;  2Z59 B;  4MJS B;  1EF5 A;  2Z0D B;  3JYU A;  1WI0 A;  1WJU A;  4AWJ A;  2MBO A;  1RRB A;  1IP9 A;  4FLH A;  4IM0 A;  3A9K B;  1WE7 A;  4BBN F;  1XQQ A;  3ECI A;  4II3 B;  4WJP A;  1IPG A;  2ZVO A;  2JZZ A;  3Q3F A;  3O65 B;  2KK8 A;  3QJZ A;  4GMV A;  4KVG B;  4OVV A;  4A3P A;  2DZI A;  4A3O A;  2IO3 B;  2KQ7 A;  2LXA A;  2ZCC A;  2KHW B;  1WMH A;  2CHZ A;  1S1Q B;  2FID A;  3N32 A;  3V61 A;  2MW5 A;  1WZ0 A;  1H4R A;  4MM3 A;  4XC2 A;  4ANX A;  1X1M A;  2CU1 A;  2KDE B;  4BKS D;  3QWZ B;  4WAA A;  5D2M B;  2MSE D;  3VQI A;  4BKT A;  1RAX A;  1E7V A;  1WRD B;  4GU2 A;  4IG7 B;  2L0F A;  1Y8R C;  4CHK A;  1V5O A;  5DPW A;  3LJ3 A;  4EZL A;  1V9J A;  3CST A;  1V80 A;  4PS3 A;  3JW0 X;  3JSV B;  4KSK C;  5CHF A;  3ZLZ A;  2UYZ B;  2KVR A;  2PPH A;  4LJP B;  5FR6 A;  2PE6 B;  3SHQ A;  2NPT B;  4HWI B;  1WE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...