4FJVB

Crystal structure of human otubain2 and ubiquitin complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
DVPDYAHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin thioesterase OTUB2
total genus 20
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4fjvB00
2N9PC 3A1QB 3PT2B 1D3ZA 2HJ8A 1LM8B 2KK8A 3DBRI 1NDDA 4KSKC 4KDLB 4FN2A 4M8NA 2UWQA 4WJQA 2VRRB 2O6VB 4HDOA 4NY0A 2BGFA 3AXCA 1X1MA 2LGXA 4BFRA 4B95A 1TGZB 1TZ1A 2LD9A 4F8CB 4A3PA 2A4ZA 3A4RA 4KIKB 1NI2A 4K81A 2K8HA 2NPTA 3PSEB 4NAWA 4PS7A 3AU5A 2KVRA 2CHWA 4ZYNA 1UH6A 3PVLA 2RSUA 3IBEA 4AP4C 3CSTA 4A20A 4KZCA 3VTUA 5IA7A 3VFKA 3AI5A 2EMTA 1WE7A 3ZTCA 3HM3A 2C60A 5JZEB 3ZIMA 2JF5A 1RLFA 2IBIB 2V1YA 3ZKJC 1TBEA 3P2BA 1U4AA 2JRHA 3QHTA 4MJSB 4W9FA 1WMHA 2LJ5A 3RULA 4JLCA 4FJVB 4IUMB 2KHWB 2A5UA 2N7EA 3EFUA 3TCAA 4DDID 4WJOA 1V5TA 3QWZB 1S3SG 3T8MA 3DPDA 3HM6X 1GG3A 2YLMA 1KJTA 4NJ7A 4WJNA 1P9DU 2KANA 1YX6B 3CF6E 4GDKB 4ANXA 2CKHB 4B6WA 1R4NI 2MBOA 3D32A 2M4NA 2KDFB 2D3GA 1ZW7A 4IWQA 4FULA 2C7MB 4MGIE 2IZVB 3WAOA 1WI0A 3ZO5B 1WE6A 3ECIA 2JZ3B 2W9NA 4BBNC 5JH5C 4XZ4A 5DPTA 4M0WB 1L7YA 2FIFA 3R66C 4PS3A 4ZRIA 4MM3A 3L13A 2FIDA 1V80A 5AZGA 4GB9A 2Y5BB 4E3CA 1UBQA 3CMMB 3DVGY 1V5OA 4DHJB 1WJ4A 1WXSA 1M94A 3V62A 1CMXB 3C0RB 4BVUC 2IY0B 2WDTB 2YVCA 2MCNB 3V6EB 3ZRCA 3QIJA 3DBSA 3OJ4B 2KJ6A 5LXIB 2KFKA 1E7UA 1WM2A 2DX5B 2MBBB 3I3TB 4NNJB 3ZLZA 4OVUA 1EUVB 3SHQA 2BYFA 3UQBA 3SD5A 2D07B 2R2QA 4M8MA 3DVNU 1P98A 3AU4A 3W1SC 4AJWA 2V3SA 2AL6A 2KWVB 3O65B 1IP9A 2NBWB 3H7PB 3L08A 1FXTB 3NZSA 3R3MA 5D6JB 2N7DA 4W9EA 4FHJA 5GMVA 3ZNID 2L76A 4HDQA 4FBJB 1R4MI 1WX7A 1WZ0A 4XX5A 4FA6A 2MLBA 3PREA 2KMAA 4W9LA 2L3ZA 4HCNB 4W9GA 2R2OA 1WF9A 4MSQB 2Z0EB 5LLIA 3GOEA 4RMAA 3VTVA 3PRMB 2IY1B 4AWJA 2XK5A 4GOCA 4W9KA 4IG7B 4EZKA 4DDGD 1H8CA 2B3AA 1E8XA 3QC8B 4GMVA 4MGYE 3H7PA 2G4DB 2PE6B 4LJOB 3VTWA 2ZCBA 2NBVB 4PYUA 2DENB 4XC2A 2KX3A 3ZW3A 4KIKA 3ZUNA 1F9JA 2NPTB 2DAJA 2PPHA 4EOYA 2C7HA 2JVCA 3ML9A 4MDKE 3DVGX 3DBLI 2I1JA 4WJPA 3RUIB 3PS6A 1I42A 2KLCA 4EEWA 3UQAA 3NZUA 2MSED 3A9KA 4KV2A 4E74A 4NQKE 1IPGA 2KFJA 3B08A 3OLMD 3HHMA 3M95A 4K7SA 2REXA 3PPAA 3JW0X 4AUQC 2BWFA 5CTRC 1WRDB 3APCA 3BINA 4PS8A 4B9KA 2M8SA 2KQ7A 3KUDB 1GJZA 3MHSD 2KQSA 1P3QU 3LJ3A 2BYEA 4I6PA 2AL3A 5E6OA 4BOZB 2UYZB 4FLHA 3PRPB 5E6NA 5G2NA 1C1YB 4NQLB 2OJRA 3W1SA 2KLGA 1AARA 4J6IA 4WWNA 3U7DA 1QZEA 1Z2MA 2XBBC 2KDIA 3KYDD 1OEYA 4FJYA 3SDLC 2MA9B 2JZZA 2K8CA 2FUHB 3DBHI 2KJHB 3IG3A 4EFOA 2O6VA 4IM2A 3V61A 1J8CA 1WY8A 1XQQA 1TTNA 4MJSA 3VH4B 1E5WA 1WGDA 2MP2A 2O6VD 2CR5A 3NOBA 5G55A 2JXXA 2K8BA 3A1QA 2K39A 3L54A 3U30A 5L95C 1WJ6A 4A3OA 2CHZA 3PHWB 2LXAA 1V2YA 3T9LA 2NS5A 2KWCA 2KN5A 4PYZA 5JHAA 4IWPA 1EF1A 3H7SA 2O2VA 3DDCB 2KX0A 1YIWA 4JGHB 5J2RA 1IYFA 3JVZX 4II3B 5D7GA 2HD5B 2I1KA 3QQ8B 1RRBA 3B1LX 3VUWA 4FADA 1Q5WB 3AULA 3M3JA 2GOWA 3VHTC 2D2QA 4CYEA 1E7VA 2OOBB 3ALBA 3DOWA 4FHKA 2DYOA 3MJWA 2WWZA 1NBFC 4LCDE 4NPNA 1SIFA 1WJNA 4TKNA 2EKEC 3ZRFA 1WH3A 1I35A 1YX5B 2NBUA 2ZVNA 3BY4B 3KUCB 3ZVVA 5HKHA 3JYUA 3X0WA 2C9WB 2ZNVB 2KKCA 5C1ZA 3PV1A 1UD7A 1WJUA 1YQBA 2PJHA 2NVUI 2GBNA 4MELA 3L10B 4KVGB 4RM9A 4HPLB 1V9JA 4BKSD 4DK5A 4JL9A 4EKUA 1BT0A 2FCQA 2KOXA 4IW0A 3VXWA 3PGEA 4GSWA 1GUAB 2C7NB 1GNUA 3R7RA 2G45B 2KFKB 4IM0A 1WGRA 4G3XB 3RD2A 1K8RB 2V4LA 5KHQA 3V60A 1XT9B 4CO7A 3MTNB 2KC1A 4GGQA 1RFAA 3PLUA 5TR5A 3RZWC 3A4SC 2IYDB 3ZTDA 5DPWA 1KLVA 3TIXA 4DHJD 1WGGA 5DPRA 2M17A 1WR1A 1L2NA 4DWFA 4TQ0A 4I6LB 2L00B 2KJRA 2ZJDA 2L0TA 5CHWA 4FJZA 3WAPA 3KH0A 2J0JA 2CS4A 5KHOA 3U8ZA 4KZ0A 2KC2A 4TQ1A 2QHOA 3UIOB 2MQJA 5IAAC 3L17A 2J0KA 2ZPYA 1Z5SB 3QCAA 2GBRA 3TMPB 1WYWB 4KSLC 1GC6A 3NHEB 3R7QA 4W9JA 3M62B 2JY6A 5J18A 1S1QB 1V81A 5AZHA 4BKTA 4GN1A 3TJPA 5AEKB 2ZZPB 2GBMA 4LDTB 1VD2A 1EF5A 1V6EA 1WGHA 1WXVA 4ZDVA 3H6NA 2RPQA 2NR2A 5D2MB 5CHFA 3VUXA 4KDIC 4K7UA 4F1SA 4GIVA 2BYVE 2KNBA 3APDA 5BO4B 3SU8X 3ONSA 4GDLB 3TL5A 4OVVA 1OQYA 2AWTA 4HWIB 4EZLA 1OGWA 2LXCA 1XD3B 3IHPC 4BBNF 1JRUA 3W1YA 1V86A 1WXAA 4YL8A 4EUTA 1WX9A 4I6NB 1YD8U 4TUUA 4X57B 2BF8B 3RCZA 3CSFA 4TV3A 2DYBA 1ZGUB 2IO1B 2ZVOA 3VDZA 2JUOA 3WALA 2LI5A 3V6CB 1P1AA 4ASWC 2KO3A 1OEYJ 2BKFA 3PZDA 5FR6A 3VVWB 2JWZA 3KYCD 3OJ3A 3N30A 3A9JB 5D94A 2MBEA 2ZPNA 2WYQA 2K6QA 4F7ZA 1WIAA 4MSMB 3L16A 3WAMA 1E8WA 5J17A 4HCPB 4ICUA 2XK5B 3JSVA 4W9DA 1EO6A 1VCBA 2N1VA 2G4SA 2BWES 4IWOA 2IO3B 2KD0A 4K1RB 3L0WB 3N3KB 4BOSC 2K25A 1RAXA 2L7RA 3NS8A 4K7WA 4ANWA 2MX2A 2BKRB 2BPSA 3TBLD 2ASQA 1G6JA 2FCNA 3UGBB 4RM8A 2CHXA 4WWPA 2HE7A 2MRPA 4HLEA 1A5RA 1OTRB 5JHBA 4GXBA 2CU1A 4JIOU 4JQWC 3KVFB 4ZRKA 2AYOB 2KTRA 2RR9A 2KDEB 5EDSA 2KDBA 2N4FA 2WX1A 4MGKE 5DCNA 3QX1A 2D11A 4MGZE 4GDLA 1J0GA 3APFA 4DXAB 4N9F4 1LXDA 2KWUB 2LGYA 2GMIC 2MP2B 3JSVB 2MBHA 4CHKA 4LDTD 3WANA 2PEAA 1UGMA 1ISNA 1J19A 2GBJA 2LVQA 3A9JA 2LGDA 3QARA 2Z59B 2DZKA 2KTRB 2DZMA 1H4RA 2RD0A 2LRUA 2RGFA 2LVPA 4MEMA 4WWOA 2GBKA 3IVFA 3UF8A 1MG8A 3RYTA 2FNJB 3H9DA 2O2VB 4NJ6A 2LUEA 4G0NB 2MWSB 3HIZA 4IM3A 3PLVA 2J7QB 3LDZE 2L8JA 2N9EB 1SGHA 3A33B 1WZ3A 1V49A 3RZFA 4AJYB 1WM3A 2FCSA 2DYMA 3K9OB 3KUZA 3PRZA 3NY5A 3OAWA 4GU2A 4HJKA 2MW5A 4W9HA 3VUYA 4ANVA 2XEWA 3WIMA 1KM7A 4HVBA 3ZDTA 3Q3JA 3QJZA 2WX0A 3QK0A 4G11A 4ANUA 2JT4B 3UINB 2HTHA 4DHZB 2LASA 3ZNZB 1WXMA 3N32A 3QAQA 1WR6E 2KMCA 1E8ZA 4DBGA 1LFDA 2D10A 1YJ1A 4MH0E 4P7IA 4DHZE 1E8YA 3ZNGC 3UIPB 3RT3B 1C3TA 1SE9A 5LXHA 2DZIA 2G3QB 2L0FA 3WA0A 4LJPB 5CHVC 3ML8A 3Q3FA 4G50A 4BKSA 3ZNHB 1UBIA 2N9XA 3H1UA 1Y8RC 2KXJA 5C23A 1KOTA 2K6DB 1E90A 3PHXB 1T0YA 4W9CA 2LVOA 2DZJA 2IO0B 3B0AA 3PTFC 2EMSA 4HK2A 5E6PA 5AZFA 1UZXB 2NCNA 2IO2B 1LQBA 2FCMA 1WMHB 4WAAA 1P0RA 2LWPA 2LZ6A 2J0MA 4WQOB 3K9PB 4ZRJA 4HPMB 2JRIB 2K1FA 2ZEQA 3QA8A 2KTFA 1Q1OA 2C5LC 3S2AA 2DHZA 4AOFA 3A9KB 3HK0A 5CX3A 3ENEA 3EECA 3DCGA 4E71A 1Q0WB 2FAZA 2PE9A 3IFWB 1WFYA 2ZCCA 3DVNV 3EHVA 2AEHA 4II2B 2DAFA 2L05A 3X23A 3VQIA 4BKGA 3GZNI 2Z0DB 2MBQA 5DPSA 4ICVA 1ZKHA 2ZNVC 4W9IA 4NAWB 1PQSA 3KW5B 4GDKA 2N1WA 4URKA 3M63B 2KZRA 1HE8A 1WX8A 4EZJA 4HXDA 3VH3B 3VAWA 1GC7A 2M0XA 2M1MA 3DQVA 4IC7B 3EC8A 5L83A 1WGYA 2JPHA 2LRWA 1UELA 3ZDMC
chains in the Genus database with same CATH superfamily
2JYTA 3A1QB 3PT2B 1LM8B 4KDLB 2N0SB 4M8NA 2UWQA 4HJGE 3AXCA 1X1MA 1HZ6A 2LJIA 3A4RA 4LTUA 1NI2A 2NPTA 4NAWA 4ZYNA 3PVLA 2RSUA 3IBEA 4KGRA 4A20A 3VFKA 3AI5A 2EMTA 1WE7A 2WU2B 4A9AA 2C60A 1SE4A 2JRHA 3QHTA 4MJSB 2QSDA 3L4PA 3RULA 4JLCA 2KHWB 2A5UA 1V5TA 4JWSC 3HM6X 1GG3A 2D3CA 4NJ7A 1RWSA 3RNAC 3CF6E 1MHHE 4B6WA 2M0AA 3D32A 2KDFB 2D3GA 4REZA 4KGTA 4ACFA 4USAA 1WI0A 1XLOA 2ON8A 2W9NA 3Q8FA 1L7YA 4DXFA 1LO5D 4ZRIA 4MM3A 1V80A 4TMAB 5HI1A 4E3CA 3VRAB 1ENFA 4DHJB 1WXSA 1M94A 1N5XA 2WGSA 4MM3B 1CMXB 1JWMD 3AECB 3URYA 3V6EB 3ZRCA 3QIJA 2KJ6A 5LXIB 2DX5B 4NNJB 2WXNA 2AQ1B 4NJCA 1EUVB 1NYRA 1P98A 3O65B 3H7PB 2JYEA 2KACA 3R3MA 3AN1A 3DWGC 4ZRQA 2JSVX 1R4MI 4XX5A 3Q14C 5IO9A 2E3TA 3PREA 4RF0A 1JWUD 1YQ4B 4MACA 1YJIA 4OZBA 1H8CA 4DDGD 2HJ1A 2B3AA 2CJOA 4MGYE 1ZPSA 2PE6B 3VTWA 2PKOA 2ZCBA 1JRPA 2PPHA 4MDKE 2VH1A 4EEWA 1I4HA 5AUKA 3A9KA 4KV2A 2LGIA 3Q3MC 1IPGA 3B9JA 3OLMD 3HHMA 4AUQC 4ARCA 1E0ZA 4XGAB 1V97A 2KAJA 5CTRC 3BVMA 1QF6A 2OHFA 2QILA 1F2RI 1OQRA 4I6PA 2RDGA 4AS1A 4FLHA 1K50A 3AEBB 1AARA 4J6IA 4WWNA 3U7DA 2MA9B 1QOBA 3DBHI 2NTTA 4JE3B 1YQ3B 4YTPB 1QILA 2K8BA 3L54A 5L95C 4A3OA 3GE3C 1T0SC 3NG0A 5BMGA 4M0WA 2KWCA 1TY2A 3H7SA 2DLBA 5J2RA 2I1KA 2D2QA 1E7VA 3MC8A 1ESFA 1IUEA 3Q6BA 3E9SA 2JZPA 4NPNA 2WXIA 3ZRFA 1WH3A 1YX5B 2ZVNA 3PV1A 2PJHA 2NVUI 1BT0A 2FCQA 2G9HD 4IW0A 4GSWA 3DBRB 2C7NB 2WDQB 2K0PA 4P1BC 4IM0A 1WWTA 1EWCA 1L0YB 4GGQA 1RFAA 1I4XA 2AQ3B 3Q8AA 4PK1A 5DPWA 4ITKA 2M56B 1L2NA 1TS3A 5BMHA 3VRBB 3KH0A 2CS4A 3U8ZA 4TQ1A 3SFDB 2QHOA 1QKZA 1NI3A 1JROA 3BWUD 1BXTA 2WXLA 3H8HA 1WYGA 1VR9A 1VDVA 1CZPA 1GB1A 1VD2A 1WGHA 1WXVA 1D6EC 4KDIC 1EM7A 4JWUC 3TL5A 1OQYA 4HWIB 2IPKD 4EZLA 3R2TA 1SEBD 4YL8A 1YD8U 1N62A 3RCZA 1F77A 1K53A 4TV3A 2J52A 2IO1B 3BIID 1E6EB 4LNNA 4KKJA 1GOZA 2BKFA 3KYCD 1PDXA 2WYQA 2K6QA 4MSMB 3MP9A 1NYQA 1V1PA 3ZJTA 1EO6A 2BWES 1ET6A 2WHIA 3L0WB 3N3KB 3ZGZA 2MX2A 2BPSA 1JCKB 2FCNA 4RM8A 2CHXA 1D5ZC 2HE7A 3TEZA 4M01A 3IAS1 4JQWC 4LNFA 2LHEA 1RM6C 2KDBA 2WX1A 3QX1A 1CJEA 3FILB 1WRIA 4M02A 4K3CA 3APFA 1LXDA 1RFKA 2GMIC 2BTEA 2MBHA 4CHKA 3O13A 4HROA 2PEAA 1UGMA 1ISNA 1J19A 1ZP0B 3A9JA 1SJHD 1H4RA 2CU3A 3UF8A 4RGOS 4IM3A 3LYYA 1V1OA 2J7QB 1TYGB 3LDZE 2L8JA 5EE9A 2H88B 3B2FA 4RFBA 1SGHA 3RZFA 4AJYB 3K9OB 3NY5A 3OAWA 4HJKA 2MW5A 4W9HA 3NRZA 3RFZB 1FMAD 2Q5WD 3UINB 4LLGM 3QAQA 1E8ZA 3ZNGC 4BZAA 2SAKA 1C3TA 5LXHA 1QT9A 2DZIA 3WA0A 4C4VB 1BUIC 3Q3NC 3Q3FA 2BW2A 4BKSA 2JWUA 3AE5B 1JWAD 3KWLA 4C4VA 3FKYA 5EE0A 2IO0B 3B0AA 5E6PA 3SFEB 2NCNA 2FCMA 1P0RA 4WQOB 3BYTB 4HPMB 2JRIB 2K1FA 2ZEQA 4ZRJA 3DHGC 2KTFA 2C5LC 4IDIA 1DOIA 3IFWB 3SR6A 1ET9A 3DVNV 2AEHA 2IGHA 4TSSA 2MBQA 4ICVA 4S17A 4W9IA 4NAWB 1TKEA 4P16A 1FEHA 1HE8A 2WXQA 4HXDA 2SEBD 3ZJUA 1KRHA 1TS5A 1BMLC 3DQVA 2JPHA 1L6UA 2HJ8A 4CQNA 4FN2A 1NEKB 1MI0A 2VRRB 2O6VB 3BVZA 4HDOA 5FR3A 3P1MA 1ZDXA 1TZ1A 2LD9A 1VZ7A 4IOIE 2V0GA 3MC9A 4A8XC 2L1AA 2CHWA 3AM9A 2D3AA 4AP4C 5IA7A 3NJTA 3ZTCA 5JZEB 3ZIMA 2JF5A 3ZKJC 2IBIB 4LNOA 3P2BA 3MJ5A 1WMHA 2QDFA 4FJVB 4IUMB 3AE7B 4WJOA 3QWZB 3AE8B 3DPDA 3Q8CA 2YLMA 4S0RA 2BYTA 1YX6B 3U2SC 2CKHB 4FULA 2C7MB 4MGIE 2IZVB 3WAOA 4XDCA 4BBNC 5DPTA 3AB5A 3L13A 1FIQA 3PO0A 2ZW0A 5AZGA 3DVGY 1J7AA 3CMMB 4HKZE 4ARIA 1SIJA 2IY0B 2WDTB 1HTQA 1E9MA 2BVCA 3ZLZA 4OVUA 2D07B 3DVNU 3I57A 3W1SC 2AL6A 1IP9A 3L08A 3P4SB 3IT4B 3NZSA 2PVGC 4FHJA 5GMVA 4FBJB 3Q69A 4FA6A 4JPSA 3ABVB 3GOEA 1UF0A 4AWJA 2XK5A 1XXGA 5T8IA 1E8XA 3OG5A 3H7PA 1UWMA 2NBVB 1L4DB 1KLGD 3ZW3A 1MFWA 1F9JA 4A90A 2DAJA 1YNTE 3KWVA 3UI3A 3DBLI 1C4PA 4WJPA 4US8A 3B08A 3M95A 4K7SA 1PGAA 1V1PB 2JU6X 3NVZA 1HQRD 4YWGG 1WRDB 3APCA 3BINA 4B9KA 2M8SA 1TY0A 1K51A 3LJ3A 1C77A 5E6OA 4WH4A 3Q2AC 4YT0B 2UYZB 3PRPB 5E6NA 3RNGC 5IKCM 2OJRA 1QZEA 1Z2MA 1OEYA 1I7HA 2JZZA 2N9LA 4IM2A 4MJSA 3VH4B 1E5WA 1WGDA 2MP2A 2O6VD 3U52E 1T6BX 1K52A 3PHWB 2LXAA 2KN5A 2J42A 1YIWA 4II3B 5D7GA 2KMMA 3QQ8B 5BMIA 1RRBA 1L6VA 1Q5WB 3AULA 2HDEA 1TS4A 3DOWA 2DYOA 4A55A 2WWZA 1JMLA 1C79A 4P1CC 4TKNA 3KUCB 5H92C 2KKCA 1UD7A 1WJUA 3RNBC 2GBNA 4KVGB 1B1ZA 5G5GA 4RM9A 4HPLB 4JL9A 3FC4A 2PMVA 3PGEA 3R7RA 4O1NA 4G3XB 5HHDG 4UDUC 1KLUD 5KHQA 4CO7A 3MTNB 2KC1A 5TR5A 3RZWC 4C7YA 3EUB2 3AE2B 4DHJD 4KGSA 1QOAA 5DPRA 1WR1A 3GS2A 4DWFA 4TQ0A 3AV8A 2L0TA 1PFDA 4FJZA 1Y56A 1TS2A 5KHOA 2MQJA 5IAAC 2J0KA 3QCAA 1EU4A 3TMPB 1WYWB 4XE0A 3NHEB 5J18A 4BKTA 1D4BA 2BS3B 4YSZB 1FXAA 1KF6B 4ZDVA 5CHFA 4K7UA 2W54A 2BYVE 1SXTA 3APDA 5BO4B 1MJDA 4GDLB 1OGWA 1XD3B 1JRUA 1C9FA 1VZ6A 1L4ZB 4TUUA 3P4RB 1I4RA 2WXMA 3U7ZA 4L1BA 4GLSC 4YXDB 3AMZA 1OEYJ 5FR6A 3PZDA 2JWZA 2N7JA 3OJ3A 3A9JB 1WIAA 2XK5B 4W9DA 1OFFA 1VCBA 3CWIA 1P7FA 1RAXA 1MPEA 3TBLD 3UGBB 3PZ7A 4H2AA 1OTRB 4GXBA 4JIOU 4ZRKA 2KTRA 2VZKD 1XLPA 2RR9A 4EE2A 3PZ8A 4MGKE 4OZCA 4MGZE 1J0GA 1L0VB 4DXAB 2DNFA 2LEKA 2MP2B 3JSVB 4LDTD 4XWWA 1C4CA 1PUTA 3WANA 1ACCA 2Z59B 2DZKA 2DZMA 2LRUA 2RGFA 4LNIA 4MEMA 2GBKA 4WWOA 3IVFA 2GI9A 1IGCA 1VRAB 2MWSB 3LXFA 2N9EB 3AE6B 5LLIA 1TZOA 2DYMA 3VUYA 3PRZA 5H8YE 3WIMA 4HVBA 3ZDTA 1JW9D 1VZ8A 2HTHA 1WXMA 2KMCA 1CQVA 3Q8BA 1LFDA 4PT5A 4P7IA 4DHZE 1E8YA 4WWMA 4XYCA 3RT3B 1T5XD 4ZYSA 3AEDB 2N9KA 4LJPB 1QQRA 2K6DB 1E90A 1FD6A 1T0YA 1KOTA 2D3BA 4RGMA 4RF1A 4HK2A 3GE8C 1FM0D 4RCOA 3V3XA 2J0MA 2VH2A 2I38A 3S2AA 2DHZA 3EA6A 5CX3A 3HK0A 2FUG1 4AOFA 1C76A 3EGRA 4E71A 2FAZA 4HKQA 2ZCCA 3EHVA 4RNAA 2L05A 4C7ZA 3GZNI 4AQ7A 1ZKHA 2ZNVC 3AEAB 4OVZA 3KW5B 2EKIA 3M63B 4EZJA 3VH3B 4IC7B 3EC8A 2LRWA 1UELA 3ZDMC 2MH7A 1NDDA 4KSKC 1HXYD 4DXGA 4NY0A 2BGFA 1EU3A 2LFIA 4J3OD 1TT5B 1ZXHA 2A4ZA 2LUMA 2K8HA 3PSEB 4PS7A 2LMCA 3AU5A 2WXJA 2V4IB 3B2GA 3HM3A 1JWSD 2V1YA 5IOIA 1TBEA 2WXKA 2LJ5A 3DHHC 1YJJA 2K22A 4DDID 4XDDA 2INNE 2KT7A 1KJTA 4YTMB 1ZW7A 4IWQA 2JZ3B 1ROEA 2MJ3A 4XZ4A 2DWQA 2JX5A 2FIFA 5HG2A 2QCZA 4GB9A 2Y5BB 2KDMA 2GB1A 3HUIA 3C0RB 4WQMA 2MCNB 3OJ4B 2MBBB 4N59A 2WP9B 1UGJA 2BYFA 2M19A 3UQBA 2R2QA 4M8MA 2QMTA 3AU4A 4AJWA 1MG4A 5EE3A 1HA5A 2WXGA 3P4PB 4OZAA 3HVDA 1NENB 4W9EA 3NVYA 2L3ZA 4W9GA 2R2OA 1WF9A 2Z0EB 3BYYB 1QOGA 2BB6A 1QLBB 2IY1B 3EFCA 4GOCA 3I5JC 4W9KA 4IG7B 4EZKA 2NTSA 3Q8EA 2ICIA 1HTOA 1J7BA 3QC8B 4GMVA 3I9V1 5TSSA 1N63A 4PYUA 1FRRA 3RI7C 2JVCA 3ML9A 3DVGX 2I1JA 1I42A 3I63C 3UQAA 3MC0B 2DBYA 4NQKE 4MH8A 2WS3B 3GZNB 3AE9B 4R3DA 3PPAA 4YSXB 2RPVA 4ZRPA 3KUDB 5G5HA 3E56A 4C00A 1DOYA 3MHSD 2UU7A 2AL3A 1WSPA 2WXHA 1XO3A 5G2NA 1C1YB 1YN3A 4RGNA 3W1SA 2KLGA 4ZHPA 3GP7A 1C4AA 2XBBC 2KDIA 4FJYA 4N6EB 1SSNA 2BS2B 2KVZA 2FUHB 1J8CA 3IG3A 2O6VA 3V61A 1WY8A 2MJDA 1SJED 1XQQA 4BAXA 1T0RC 2WDRB 1HZ5A 2CR5A 5G55A 3KQ4A 3U30A 1WJ6A 2PTLA 4C56C 1FO4A 5EE1A 3P4QB 1FCCC 2XN9C 5JHAA 4IWPA 2FE8A 1EF1A 3BZDB 4JGHB 1IYFA 1M4VA 2HD5B 2FBWB 1XLQA 4LNKA 3B1LX 3P42A 3VUWA 4FADA 4YSYB 3M3JA 2GOWA 3VHTC 2OOBB 2YEPF 4A6QA 1FRDA 3MJWA 1YOVB 1NBFC 3AE4B 1SIFA 2EKEC 4OHJA 1I35A 2NBUA 3BY4B 5HKHA 2C9WB 2ZNVB 4DQOC 5C1ZA 4MELA 3N1ZC 1TIFA 4DK5A 4EKUA 2KOXA 3AEEB 1GUAB 2KFKB 3IXSA 1K8RB 2YEPB 5C2TB 3V60A 3PLUA 1EWYC 2WLBA 3ZTDA 4N58A 2H89B 3TIXA 2RDHA 2M17A 1A70A 2L00B 2KJRA 2ZJDA 2PLPA 3GB1A 4KZ0A 2BB5A 3ZXRA 2ZPYA 4KSLC 2NMQA 3C19A 4W9JA 3NS1A 3M62B 1V81A 4GN1A 2MHJA 2ZZPB 2GBMA 1V6EA 2RPQA 4WAFA 5D2MB 3VUXA 2KNBA 3ZJVA 2KWDA 2AWTA 4HPPA 3IHPC 4BBNF 3MHZA 3W1YA 1WXAA 2CJNA 3OWEB 2W82A 1AW7A 1ZXIA 1FXIA 3CSFA 2DYBA 3NVWA 1XEEA 1SBBB 3VDZA 1I4QA 1UNSA 3WALA 1NVID 2KO3A 1AN8A 5D94A 3MFGA 3AE3B 4F7ZA 3CIRB 3L16A 3WAMA 1E8WA 5J17A 1R4NB 1SE2A 3JSVA 2N1VA 2G4SA 2K9XA 2IO3B 2KD0A 1SB3C 1FFUA 4NAMA 1GAQB 1TKYA 4BOSC 4ANWA 3IAM1 1G6JA 2E6XA 1A5RA 5JHBA 5IN7A 2CU1A 3KVFB 2AYOB 2N4FA 5DCNA 4HRSA 5D3DA 2D11A 3P63A 4GDLA 3RMKC 4N9F4 2LGYA 2KWUB 3TEWA 2WNMA 2QEJC 2I2YA 5GXGB 2WU5B 2LVQA 4C80A 2TSSA 2Y5PA 2KTRB 2KN4A 1IGDA 2LVPA 1Q10A 1AWDA 1MG8A 2FNJB 1FFVA 3W5VB 4NJ6A 2LUEA 4G0NB 3N9YC 1QOFA 3PLVA 1AYFA 4M00A 2V3NA 1WZ3A 1V49A 4GU2A 1WM3A 3KUZA 2JXTA 2XEWA 3LB8C 3SEBA 2WX0A 1N6ZA 1GB4A 1WR6E 4DBGA 1YJ1A 3HRDD 5IP4D 3UIPB 1DGJA 2L32A 2G3QB 2L0FA 3ML8A 1UBIA 2IGGA 1Y8RC 5C23A 2BBCA 3PTFC 1UZXB 1D5MC 1WMHB 4NZLB 4WAAA 2LZ6A 1JALA 1F52A 1YMHE 1FPYA 3A9KB 2X8XX 3DCGA 3DWMA 3HVZA 2RDBC 4ZOHC 3C8YA 3X23A 5DPSA 1I4GA 4GDKA 2N1WA 2W55A 3VAWA 1P7EA 2M0XA 3DBLB 4B0MA 1XCTL 1WGYA 1WGKA 2N9PC 1D3ZA 2KK8A 3DBRI 1FNUA 3NUHB 2WXFA 4WJQA 2MJEA 2J53A 3VR8B 2LGXA 4BFRA 4B95A 1TGZB 1HEZE 5LNK1 4F8CB 4A3PA 1E7PB 4KIKB 4K81A 2KVRA 1UH6A 2K5PA 2MEKA 4WIPA 3CSTA 4KZCA 3VTUA 1RLFA 4K3BA 5FK9C 1U4AA 3ZYYX 4W9FA 4LK0M 1D5XC 2N7EA 3TCAA 2INDC 2Y3AA 3EFUA 1S3SG 3T8MA 4WJNA 1P9DU 2KANA 4GDKB 4ANXA 1R4NI 2MBOA 2M4NA 1I4PA 4IKGA 1WE6A 3ECIA 3ZO5B 5FKAC 3DBHB 5JH5C 4M0WB 3R66C 4PS3A 3AEGB 2FIDA 3NVVA 1UBQA 1V5OA 2X38A 1STEA 1WJ4A 3V62A 4BVUC 2YVCA 3DBSA 2V3PA 5MPOA 2KFKA 1E7UA 1LGRA 1WM2A 2OJWA 3I3TB 1FCLA 3BVGA 2WXRA 5C3JB 3SHQA 3SD5A 2VZKB 4WURA 2V3SA 2BQQA 2KWVB 2NBWB 1FXTB 5D6JB 3RNFC 2N7DA 2Z8LA 1XCQL 3ZNID 2L76A 4HDQA 5HFYA 1WX7A 1WZ0A 2PVOD 4L23A 2MLBA 3ZQ4A 2KMAA 4W9LA 4HCNB 4MSQB 4RH6A 4RMAA 3VTVA 2WQYB 1PGBA 3PRMB 3T3OA 3FILA 1KTKA 3AEFB 1SE3A 2G4DB 4LJOB 1ZUD2 1FNWA 2DENB 4XC2A 2KX3A 4KIKA 3ZUNA 5D3IB 2NPTB 1JQ4A 4EOYA 2C7HA 2GLSA 3RUIB 3PS6A 1R4MB 2KLCA 3NZUA 2MSED 3N20C 4E74A 2KFJA 1CK1A 5BYSA 2REXA 4RGTA 3JW0X 1T3QA 2QIEB 2WXOA 2BWFA 3W2DA 4PS8A 1GJZA 2KQ7A 2KQSA 1P3QU 2BYEA 1VLBA 4BOZB 5E6JA 1N61A 2W3SA 4L2YA 3RNCC 4Q2JA 4NQLB 1B9RA 2HTME 1ZDVA 2B76B 3AH7A 3KYDD 3SDLC 2PIAA 2K8CA 4EFOA 2KJHB 2L83A 1VJKA 1TTNA 1L5PA 3NOBA 2JXXA 3A1QA 2K39A 2QC8A 3N1YC 2CHZA 1DOXA 1V2YA 3T9LA 2NS5A 4PYZA 3T3NA 2IJ0A 2AQ2B 2O2VA 3DDCB 2KX0A 3IT6B 3JVZX 1RYJA 4US9A 3TEYA 1YN5A 3TSSA 4CYEA 3ALBA 3RPFC 1KFYB 1UWXA 4FHKA 3WCQA 1XF5L 1L0XB 3BK1A 1GPXA 1V8CA 4LCDE 1WJNA 2J4XA 3ZVVA 1J7CA 2ONQA 3JYUA 1TKGA 3X0WA 1MVKA 1N60A 2IGDA 1YQBA 4KX6B 3L10B 4P6VF 2W3RA 1V9JA 4BKSD 3AE1B 1MHXA 3TUOA 3VXWA 5I4DA 1GNUA 2BT6A 2G45B 3NZ3A 1WGRA 3RD2A 5BYQA 2QJLA 2V4LA 1XT9B 3A4SC 2IYDB 1KLVA 4OW0A 1WGGA 3ETRA 1TJEA 4I6LB 5CHWA 3V05A 3WAPA 2J0JA 4HEA1 2KC2A 3N1XC 3UIOB 3L17A 1Z5SB 2OEDA 1YN4A 2GBRA 5JXVA 1GC6A 3R7QA 2JY6A 1S1QB 5AZHA 3KLSX 3Q3OC 3TJPA 5AEKB 4LDTB 1OQQA 2ZW1A 1EF5A 3H6NA 3TEXA 2RMMA 2NR2A 4YTNB 4F1SA 4GIVA 3SU8X 3ONSA 4OVVA 1IBXA 2IDYA 2LXCA 4MT5A 1SF0A 1V86A 4EUTA 1WX9A 4I6NB 4X57B 2BF8B 3RNEC 1ZGUB 2LHDA 2ZVOA 2JUOA 1PGXA 4KKIA 2LI5A 3V6CB 1P1AA 4ASWC 3VVWB 1T0QC 3N30A 1JWBD 2L52A 2MBEA 2KYWA 2ZPNA 5BYRA 4HCPB 4ICUA 4IWOA 2EELA 4K1RB 1F1HA 4XWTA 1WXQA 2K25A 2L7RA 3NS8A 4K7WA 2BKRB 2Y5CA 2ASQA 4WWPA 2MRPA 4HLEA 1F0ZA 1E10A 2XNAC 2KDEB 5EDSA 1IBXB 1FNVA 1UUPA 1DYQA 2WXPA 2K3UA 2INPE 2GBJA 2R61A 3RN9C 3BK2A 2LGDA 3QARA 2RD0A 4ZHOA 1F2RC 4B0EA 3RYTA 3H9DA 2O2VB 2WDVB 3HIZA 3W5UB 3A33B 2BS4B 4JX1C 2FCSA 3DHIC 3FAHA 4ANVA 1KM7A 3Q3JA 3QJZA 3QK0A 4G11A 1ZE3D 4ANUA 2JT4B 3J9CA 4DHZB 2LASA 3ZNZB 3N32A 2D10A 4MH0E 5AUIA 2GRIA 4QAYA 1SE9A 3VR9B 2G1EA 3ZXVA 4D2KA 1ZOYB 5CHVC 2AX5A 2PW9A 4G50A 3ZNHB 2N9XA 3H1UA 1XLNA 2KXJA 3U4EG 3PHXB 4W9CA 2LVOA 1R7SA 2DZJA 3R2IA 2EMSA 5AZFA 2IO2B 1LQBA 2LWPA 3K9PB 3W9CB 2D5GA 2LGSA 3QA8A 2KQ4X 2INCC 1Q1OA 1KH0A 2V9HA 3R8BA 3ENEA 3EECA 1Q0WB 2PE9A 1WFYA 4II2B 2DAFA 3VQIA 4BKGA 2Z0DB 1PYWD 1PQSA 1C78A 4URKA 2KZRA 1WX8A 1GC7A 2JQRB 2M1MA 2ACZB 5L83A 4FXCA 1N5WA
chains in the Genus database with same CATH topology
2N9PC 3A1QB 3PT2B 1D3ZA 2HJ8A 1LM8B 2KK8A 3DBRI 1NDDA 4KSKC 4KDLB 4FN2A 4M8NA 2UWQA 4WJQA 2VRRB 2O6VB 4HDOA 4NY0A 2BGFA 3AXCA 1X1MA 2LGXA 4BFRA 4B95A 1TGZB 1TZ1A 2LD9A 4F8CB 4A3PA 2A4ZA 3A4RA 4KIKB 1NI2A 4K81A 2K8HA 2NPTA 3PSEB 4NAWA 4PS7A 3AU5A 2KVRA 2CHWA 4ZYNA 1UH6A 3PVLA 2RSUA 3IBEA 4AP4C 3CSTA 4A20A 4KZCA 3VTUA 5IA7A 3VFKA 3AI5A 2EMTA 1WE7A 3ZTCA 3HM3A 2C60A 5JZEB 3ZIMA 2JF5A 1RLFA 2IBIB 2V1YA 3ZKJC 1TBEA 3P2BA 1U4AA 2JRHA 3QHTA 4MJSB 4W9FA 1WMHA 2LJ5A 3RULA 4JLCA 4FJVB 4IUMB 2KHWB 2A5UA 2N7EA 3EFUA 3TCAA 4DDID 4WJOA 1V5TA 3QWZB 1S3SG 3T8MA 3DPDA 3HM6X 1GG3A 2YLMA 1KJTA 4NJ7A 4WJNA 1P9DU 2KANA 1YX6B 3CF6E 4GDKB 4ANXA 2CKHB 4B6WA 1R4NI 2MBOA 3D32A 2M4NA 2KDFB 2D3GA 1ZW7A 4IWQA 4FULA 2C7MB 4MGIE 2IZVB 3WAOA 1WI0A 3ZO5B 1WE6A 3ECIA 2JZ3B 2W9NA 4BBNC 5JH5C 4XZ4A 5DPTA 4M0WB 1L7YA 2FIFA 3R66C 4PS3A 4ZRIA 4MM3A 3L13A 2FIDA 1V80A 5AZGA 4GB9A 2Y5BB 4E3CA 1UBQA 3CMMB 3DVGY 1V5OA 4DHJB 1WJ4A 1WXSA 1M94A 3V62A 1CMXB 3C0RB 4BVUC 2IY0B 2WDTB 2YVCA 2MCNB 3V6EB 3ZRCA 3QIJA 3DBSA 3OJ4B 2KJ6A 5LXIB 2KFKA 1E7UA 1WM2A 2DX5B 2MBBB 3I3TB 4NNJB 3ZLZA 4OVUA 1EUVB 3SHQA 2BYFA 3UQBA 3SD5A 2D07B 2R2QA 4M8MA 3DVNU 1P98A 3AU4A 3W1SC 4AJWA 2V3SA 2AL6A 2KWVB 3O65B 1IP9A 2NBWB 3H7PB 3L08A 1FXTB 3NZSA 3R3MA 5D6JB 2N7DA 4W9EA 4FHJA 5GMVA 3ZNID 2L76A 4HDQA 4FBJB 1R4MI 1WX7A 1WZ0A 4XX5A 4FA6A 2MLBA 3PREA 2KMAA 4W9LA 2L3ZA 4HCNB 4W9GA 2R2OA 1WF9A 4MSQB 2Z0EB 5LLIA 3GOEA 4RMAA 3VTVA 3PRMB 2IY1B 4AWJA 2XK5A 4GOCA 4W9KA 4IG7B 4EZKA 4DDGD 1H8CA 2B3AA 1E8XA 3QC8B 4GMVA 4MGYE 3H7PA 2G4DB 2PE6B 4LJOB 3VTWA 2ZCBA 2NBVB 4PYUA 2DENB 4XC2A 2KX3A 3ZW3A 4KIKA 3ZUNA 1F9JA 2NPTB 2DAJA 2PPHA 4EOYA 2C7HA 2JVCA 3ML9A 4MDKE 3DVGX 3DBLI 2I1JA 4WJPA 3RUIB 3PS6A 1I42A 2KLCA 4EEWA 3UQAA 3NZUA 2MSED 3A9KA 4KV2A 4E74A 4NQKE 1IPGA 2KFJA 3B08A 3OLMD 3HHMA 3M95A 4K7SA 2REXA 3PPAA 3JW0X 4AUQC 2BWFA 5CTRC 1WRDB 3APCA 3BINA 4PS8A 4B9KA 2M8SA 2KQ7A 3KUDB 1GJZA 3MHSD 2KQSA 1P3QU 3LJ3A 2BYEA 4I6PA 2AL3A 5E6OA 4BOZB 2UYZB 4FLHA 3PRPB 5E6NA 5G2NA 1C1YB 4NQLB 2OJRA 3W1SA 2KLGA 1AARA 4J6IA 4WWNA 3U7DA 1QZEA 1Z2MA 2XBBC 2KDIA 3KYDD 1OEYA 4FJYA 3SDLC 2MA9B 2JZZA 2K8CA 2FUHB 3DBHI 2KJHB 3IG3A 4EFOA 2O6VA 4IM2A 3V61A 1J8CA 1WY8A 1XQQA 1TTNA 4MJSA 3VH4B 1E5WA 1WGDA 2MP2A 2O6VD 2CR5A 3NOBA 5G55A 2JXXA 2K8BA 3A1QA 2K39A 3L54A 3U30A 5L95C 1WJ6A 4A3OA 2CHZA 3PHWB 2LXAA 1V2YA 3T9LA 2NS5A 2KWCA 2KN5A 4PYZA 5JHAA 4IWPA 1EF1A 3H7SA 2O2VA 3DDCB 2KX0A 1YIWA 4JGHB 5J2RA 1IYFA 3JVZX 4II3B 5D7GA 2HD5B 2I1KA 3QQ8B 1RRBA 3B1LX 3VUWA 4FADA 1Q5WB 3AULA 3M3JA 2GOWA 3VHTC 2D2QA 4CYEA 1E7VA 2OOBB 3ALBA 3DOWA 4FHKA 2DYOA 3MJWA 2WWZA 1NBFC 4LCDE 4NPNA 1SIFA 1WJNA 4TKNA 2EKEC 3ZRFA 1WH3A 1I35A 1YX5B 2NBUA 2ZVNA 3BY4B 3KUCB 3ZVVA 5HKHA 3JYUA 3X0WA 2C9WB 2ZNVB 2KKCA 5C1ZA 3PV1A 1UD7A 1WJUA 1YQBA 2PJHA 2NVUI 2GBNA 4MELA 3L10B 4KVGB 4RM9A 4HPLB 1V9JA 4BKSD 4DK5A 4JL9A 4EKUA 1BT0A 2FCQA 2KOXA 4IW0A 3VXWA 3PGEA 4GSWA 1GUAB 2C7NB 1GNUA 3R7RA 2G45B 2KFKB 4IM0A 1WGRA 4G3XB 3RD2A 1K8RB 2V4LA 5KHQA 3V60A 1XT9B 4CO7A 3MTNB 2KC1A 4GGQA 1RFAA 3PLUA 5TR5A 3RZWC 3A4SC 2IYDB 3ZTDA 5DPWA 1KLVA 3TIXA 4DHJD 1WGGA 5DPRA 2M17A 1WR1A 1L2NA 4DWFA 4TQ0A 4I6LB 2L00B 2KJRA 2ZJDA 2L0TA 5CHWA 4FJZA 3WAPA 3KH0A 2J0JA 2CS4A 5KHOA 3U8ZA 4KZ0A 2KC2A 4TQ1A 2QHOA 3UIOB 2MQJA 5IAAC 3L17A 2J0KA 2ZPYA 1Z5SB 3QCAA 2GBRA 3TMPB 1WYWB 4KSLC 1GC6A 3NHEB 3R7QA 4W9JA 3M62B 2JY6A 5J18A 1S1QB 1V81A 5AZHA 4BKTA 4GN1A 3TJPA 5AEKB 2ZZPB 2GBMA 4LDTB 1VD2A 1EF5A 1V6EA 1WGHA 1WXVA 4ZDVA 3H6NA 2RPQA 2NR2A 5D2MB 5CHFA 3VUXA 4KDIC 4K7UA 4F1SA 4GIVA 2BYVE 2KNBA 3APDA 5BO4B 3SU8X 3ONSA 4GDLB 3TL5A 4OVVA 1OQYA 2AWTA 4HWIB 4EZLA 1OGWA 2LXCA 1XD3B 3IHPC 4BBNF 1JRUA 3W1YA 1V86A 1WXAA 4YL8A 4EUTA 1WX9A 4I6NB 1YD8U 4TUUA 4X57B 2BF8B 3RCZA 3CSFA 4TV3A 2DYBA 1ZGUB 2IO1B 2ZVOA 3VDZA 2JUOA 3WALA 2LI5A 3V6CB 1P1AA 4ASWC 2KO3A 1OEYJ 2BKFA 3PZDA 5FR6A 3VVWB 2JWZA 3KYCD 3OJ3A 3N30A 3A9JB 5D94A 2MBEA 2ZPNA 2WYQA 2K6QA 4F7ZA 1WIAA 4MSMB 3L16A 3WAMA 1E8WA 5J17A 4HCPB 4ICUA 2XK5B 3JSVA 4W9DA 1EO6A 1VCBA 2N1VA 2G4SA 2BWES 4IWOA 2IO3B 2KD0A 4K1RB 3L0WB 3N3KB 4BOSC 2K25A 1RAXA 2L7RA 3NS8A 4K7WA 4ANWA 2MX2A 2BKRB 2BPSA 3TBLD 2ASQA 1G6JA 2FCNA 3UGBB 4RM8A 2CHXA 4WWPA 2HE7A 2MRPA 4HLEA 1A5RA 1OTRB 5JHBA 4GXBA 2CU1A 4JIOU 4JQWC 3KVFB 4ZRKA 2AYOB 2KTRA 2RR9A 2KDEB 5EDSA 2KDBA 2N4FA 2WX1A 4MGKE 5DCNA 3QX1A 2D11A 4MGZE 4GDLA 1J0GA 3APFA 4DXAB 4N9F4 1LXDA 2KWUB 2LGYA 2GMIC 2MP2B 3JSVB 2MBHA 4CHKA 4LDTD 3WANA 2PEAA 1UGMA 1ISNA 1J19A 2GBJA 2LVQA 3A9JA 2LGDA 3QARA 2Z59B 2DZKA 2KTRB 2DZMA 1H4RA 2RD0A 2LRUA 2RGFA 2LVPA 4MEMA 4WWOA 2GBKA 3IVFA 3UF8A 1MG8A 3RYTA 2FNJB 3H9DA 2O2VB 4NJ6A 2LUEA 4G0NB 2MWSB 3HIZA 4IM3A 3PLVA 2J7QB 3LDZE 2L8JA 2N9EB 1SGHA 3A33B 1WZ3A 1V49A 3RZFA 4AJYB 1WM3A 2FCSA 2DYMA 3K9OB 3KUZA 3PRZA 3NY5A 3OAWA 4GU2A 4HJKA 2MW5A 4W9HA 3VUYA 4ANVA 2XEWA 3WIMA 1KM7A 4HVBA 3ZDTA 3Q3JA 3QJZA 2WX0A 3QK0A 4G11A 4ANUA 2JT4B 3UINB 2HTHA 4DHZB 2LASA 3ZNZB 1WXMA 3N32A 3QAQA 1WR6E 2KMCA 1E8ZA 4DBGA 1LFDA 2D10A 1YJ1A 4MH0E 4P7IA 4DHZE 1E8YA 3ZNGC 3UIPB 3RT3B 1C3TA 1SE9A 5LXHA 2DZIA 2G3QB 2L0FA 3WA0A 4LJPB 5CHVC 3ML8A 3Q3FA 4G50A 4BKSA 3ZNHB 1UBIA 2N9XA 3H1UA 1Y8RC 2KXJA 5C23A 1KOTA 2K6DB 1E90A 3PHXB 1T0YA 4W9CA 2LVOA 2DZJA 2IO0B 3B0AA 3PTFC 2EMSA 4HK2A 5E6PA 5AZFA 1UZXB 2NCNA 2IO2B 1LQBA 2FCMA 1WMHB 4WAAA 1P0RA 2LWPA 2LZ6A 2J0MA 4WQOB 3K9PB 4ZRJA 4HPMB 2JRIB 2K1FA 2ZEQA 3QA8A 2KTFA 1Q1OA 2C5LC 3S2AA 2DHZA 4AOFA 3A9KB 3HK0A 5CX3A 3ENEA 3EECA 3DCGA 4E71A 1Q0WB 2FAZA 2PE9A 3IFWB 1WFYA 2ZCCA 3DVNV 3EHVA 2AEHA 4II2B 2DAFA 2L05A 3X23A 3VQIA 4BKGA 3GZNI 2Z0DB 2MBQA 5DPSA 4ICVA 1ZKHA 2ZNVC 4W9IA 4NAWB 1PQSA 3KW5B 4GDKA 2N1WA 4URKA 3M63B 2KZRA 1HE8A 1WX8A 4EZJA 4HXDA 3VH3B 3VAWA 1GC7A 2M0XA 2M1MA 3DQVA 4IC7B 3EC8A 5L83A 1WGYA 2JPHA 2LRWA 1UELA 3ZDMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9P C;  3A1Q B;  3PT2 B;  1D3Z A;  2HJ8 A;  1LM8 B;  2KK8 A;  3DBR I;  1NDD A;  4KSK C;  4KDL B;  4FN2 A;  4M8N A;  2UWQ A;  4WJQ A;  2VRR B;  2O6V B;  4HDO A;  4NY0 A;  2BGF A;  3AXC A;  1X1M A;  2LGX A;  4BFR A;  4B95 A;  1TGZ B;  1TZ1 A;  2LD9 A;  4F8C B;  4A3P A;  2A4Z A;  3A4R A;  4KIK B;  1NI2 A;  4K81 A;  2K8H A;  2NPT A;  3PSE B;  4NAW A;  4PS7 A;  3AU5 A;  2KVR A;  2CHW A;  4ZYN A;  1UH6 A;  3PVL A;  2RSU A;  3IBE A;  4AP4 C;  3CST A;  4A20 A;  4KZC A;  3VTU A;  5IA7 A;  3VFK A;  3AI5 A;  2EMT A;  1WE7 A;  3ZTC A;  3HM3 A;  2C60 A;  5JZE B;  3ZIM A;  2JF5 A;  1RLF A;  2IBI B;  2V1Y A;  3ZKJ C;  1TBE A;  3P2B A;  1U4A A;  2JRH A;  3QHT A;  4MJS B;  4W9F A;  1WMH A;  2LJ5 A;  3RUL A;  4JLC A;  4FJV B;  4IUM B;  2KHW B;  2A5U A;  2N7E A;  3EFU A;  3TCA A;  4DDI D;  4WJO A;  1V5T A;  3QWZ B;  1S3S G;  3T8M A;  3DPD A;  3HM6 X;  1GG3 A;  2YLM A;  1KJT A;  4NJ7 A;  4WJN A;  1P9D U;  2KAN A;  1YX6 B;  3CF6 E;  4GDK B;  4ANX A;  2CKH B;  4B6W A;  1R4N I;  2MBO A;  3D32 A;  2M4N A;  2KDF B;  2D3G A;  1ZW7 A;  4IWQ A;  4FUL A;  2C7M B;  4MGI E;  2IZV B;  3WAO A;  1WI0 A;  3ZO5 B;  1WE6 A;  3ECI A;  2JZ3 B;  2W9N A;  4BBN C;  5JH5 C;  4XZ4 A;  5DPT A;  4M0W B;  1L7Y A;  2FIF A;  3R66 C;  4PS3 A;  4ZRI A;  4MM3 A;  3L13 A;  2FID A;  1V80 A;  5AZG A;  4GB9 A;  2Y5B B;  4E3C A;  1UBQ A;  3CMM B;  3DVG Y;  1V5O A;  4DHJ B;  1WJ4 A;  1WXS A;  1M94 A;  3V62 A;  1CMX B;  3C0R B;  4BVU C;  2IY0 B;  2WDT B;  2YVC A;  2MCN B;  3V6E B;  3ZRC A;  3QIJ A;  3DBS A;  3OJ4 B;  2KJ6 A;  5LXI B;  2KFK A;  1E7U A;  1WM2 A;  2DX5 B;  2MBB B;  3I3T B;  4NNJ B;  3ZLZ A;  4OVU A;  1EUV B;  3SHQ A;  2BYF A;  3UQB A;  3SD5 A;  2D07 B;  2R2Q A;  4M8M A;  3DVN U;  1P98 A;  3AU4 A;  3W1S C;  4AJW A;  2V3S A;  2AL6 A;  2KWV B;  3O65 B;  1IP9 A;  2NBW B;  3H7P B;  3L08 A;  1FXT B;  3NZS A;  3R3M A;  5D6J B;  2N7D A;  4W9E A;  4FHJ A;  5GMV A;  3ZNI D;  2L76 A;  4HDQ A;  4FBJ B;  1R4M I;  1WX7 A;  1WZ0 A;  4XX5 A;  4FA6 A;  2MLB A;  3PRE A;  2KMA A;  4W9L A;  2L3Z A;  4HCN B;  4W9G A;  2R2O A;  1WF9 A;  4MSQ B;  2Z0E B;  5LLI A;  3GOE A;  4RMA A;  3VTV A;  3PRM B;  2IY1 B;  4AWJ A;  2XK5 A;  4GOC A;  4W9K A;  4IG7 B;  4EZK A;  4DDG D;  1H8C A;  2B3A A;  1E8X A;  3QC8 B;  4GMV A;  4MGY E;  3H7P A;  2G4D B;  2PE6 B;  4LJO B;  3VTW A;  2ZCB A;  2NBV B;  4PYU A;  2DEN B;  4XC2 A;  2KX3 A;  3ZW3 A;  4KIK A;  3ZUN A;  1F9J A;  2NPT B;  2DAJ A;  2PPH A;  4EOY A;  2C7H A;  2JVC A;  3ML9 A;  4MDK E;  3DVG X;  3DBL I;  2I1J A;  4WJP A;  3RUI B;  3PS6 A;  1I42 A;  2KLC A;  4EEW A;  3UQA A;  3NZU A;  2MSE D;  3A9K A;  4KV2 A;  4E74 A;  4NQK E;  1IPG A;  2KFJ A;  3B08 A;  3OLM D;  3HHM A;  3M95 A;  4K7S A;  2REX A;  3PPA A;  3JW0 X;  4AUQ C;  2BWF A;  5CTR C;  1WRD B;  3APC A;  3BIN A;  4PS8 A;  4B9K A;  2M8S A;  2KQ7 A;  3KUD B;  1GJZ A;  3MHS D;  2KQS A;  1P3Q U;  3LJ3 A;  2BYE A;  4I6P A;  2AL3 A;  5E6O A;  4BOZ B;  2UYZ B;  4FLH A;  3PRP B;  5E6N A;  5G2N A;  1C1Y B;  4NQL B;  2OJR A;  3W1S A;  2KLG A;  1AAR A;  4J6I A;  4WWN A;  3U7D A;  1QZE A;  1Z2M A;  2XBB C;  2KDI A;  3KYD D;  1OEY A;  4FJY A;  3SDL C;  2MA9 B;  2JZZ A;  2K8C A;  2FUH B;  3DBH I;  2KJH B;  3IG3 A;  4EFO A;  2O6V A;  4IM2 A;  3V61 A;  1J8C A;  1WY8 A;  1XQQ A;  1TTN A;  4MJS A;  3VH4 B;  1E5W A;  1WGD A;  2MP2 A;  2O6V D;  2CR5 A;  3NOB A;  5G55 A;  2JXX A;  2K8B A;  3A1Q A;  2K39 A;  3L54 A;  3U30 A;  5L95 C;  1WJ6 A;  4A3O A;  2CHZ A;  3PHW B;  2LXA A;  1V2Y A;  3T9L A;  2NS5 A;  2KWC A;  2KN5 A;  4PYZ A;  5JHA A;  4IWP A;  1EF1 A;  3H7S A;  2O2V A;  3DDC B;  2KX0 A;  1YIW A;  4JGH B;  5J2R A;  1IYF A;  3JVZ X;  4II3 B;  5D7G A;  2HD5 B;  2I1K A;  3QQ8 B;  1RRB A;  3B1L X;  3VUW A;  4FAD A;  1Q5W B;  3AUL A;  3M3J A;  2GOW A;  3VHT C;  2D2Q A;  4CYE A;  1E7V A;  2OOB B;  3ALB A;  3DOW A;  4FHK A;  2DYO A;  3MJW A;  2WWZ A;  1NBF C;  4LCD E;  4NPN A;  1SIF A;  1WJN A;  4TKN A;  2EKE C;  3ZRF A;  1WH3 A;  1I35 A;  1YX5 B;  2NBU A;  2ZVN A;  3BY4 B;  3KUC B;  3ZVV A;  5HKH A;  3JYU A;  3X0W A;  2C9W B;  2ZNV B;  2KKC A;  5C1Z A;  3PV1 A;  1UD7 A;  1WJU A;  1YQB A;  2PJH A;  2NVU I;  2GBN A;  4MEL A;  3L10 B;  4KVG B;  4RM9 A;  4HPL B;  1V9J A;  4BKS D;  4DK5 A;  4JL9 A;  4EKU A;  1BT0 A;  2FCQ A;  2KOX A;  4IW0 A;  3VXW A;  3PGE A;  4GSW A;  1GUA B;  2C7N B;  1GNU A;  3R7R A;  2G45 B;  2KFK B;  4IM0 A;  1WGR A;  4G3X B;  3RD2 A;  1K8R B;  2V4L A;  5KHQ A;  3V60 A;  1XT9 B;  4CO7 A;  3MTN B;  2KC1 A;  4GGQ A;  1RFA A;  3PLU A;  5TR5 A;  3RZW C;  3A4S C;  2IYD B;  3ZTD A;  5DPW A;  1KLV A;  3TIX A;  4DHJ D;  1WGG A;  5DPR A;  2M17 A;  1WR1 A;  1L2N A;  4DWF A;  4TQ0 A;  4I6L B;  2L00 B;  2KJR A;  2ZJD A;  2L0T A;  5CHW A;  4FJZ A;  3WAP A;  3KH0 A;  2J0J A;  2CS4 A;  5KHO A;  3U8Z A;  4KZ0 A;  2KC2 A;  4TQ1 A;  2QHO A;  3UIO B;  2MQJ A;  5IAA C;  3L17 A;  2J0K A;  2ZPY A;  1Z5S B;  3QCA A;  2GBR A;  3TMP B;  1WYW B;  4KSL C;  1GC6 A;  3NHE B;  3R7Q A;  4W9J A;  3M62 B;  2JY6 A;  5J18 A;  1S1Q B;  1V81 A;  5AZH A;  4BKT A;  4GN1 A;  3TJP A;  5AEK B;  2ZZP B;  2GBM A;  4LDT B;  1VD2 A;  1EF5 A;  1V6E A;  1WGH A;  1WXV A;  4ZDV A;  3H6N A;  2RPQ A;  2NR2 A;  5D2M B;  5CHF A;  3VUX A;  4KDI C;  4K7U A;  4F1S A;  4GIV A;  2BYV E;  2KNB A;  3APD A;  5BO4 B;  3SU8 X;  3ONS A;  4GDL B;  3TL5 A;  4OVV A;  1OQY A;  2AWT A;  4HWI B;  4EZL A;  1OGW A;  2LXC A;  1XD3 B;  3IHP C;  4BBN F;  1JRU A;  3W1Y A;  1V86 A;  1WXA A;  4YL8 A;  4EUT A;  1WX9 A;  4I6N B;  1YD8 U;  4TUU A;  4X57 B;  2BF8 B;  3RCZ A;  3CSF A;  4TV3 A;  2DYB A;  1ZGU B;  2IO1 B;  2ZVO A;  3VDZ A;  2JUO A;  3WAL A;  2LI5 A;  3V6C B;  1P1A A;  4ASW C;  2KO3 A;  1OEY J;  2BKF A;  3PZD A;  5FR6 A;  3VVW B;  2JWZ A;  3KYC D;  3OJ3 A;  3N30 A;  3A9J B;  5D94 A;  2MBE A;  2ZPN A;  2WYQ A;  2K6Q A;  4F7Z A;  1WIA A;  4MSM B;  3L16 A;  3WAM A;  1E8W A;  5J17 A;  4HCP B;  4ICU A;  2XK5 B;  3JSV A;  4W9D A;  1EO6 A;  1VCB A;  2N1V A;  2G4S A;  2BWE S;  4IWO A;  2IO3 B;  2KD0 A;  4K1R B;  3L0W B;  3N3K B;  4BOS C;  2K25 A;  1RAX A;  2L7R A;  3NS8 A;  4K7W A;  4ANW A;  2MX2 A;  2BKR B;  2BPS A;  3TBL D;  2ASQ A;  1G6J A;  2FCN A;  3UGB B;  4RM8 A;  2CHX A;  4WWP A;  2HE7 A;  2MRP A;  4HLE A;  1A5R A;  1OTR B;  5JHB A;  4GXB A;  2CU1 A;  4JIO U;  4JQW C;  3KVF B;  4ZRK A;  2AYO B;  2KTR A;  2RR9 A;  2KDE B;  5EDS A;  2KDB A;  2N4F A;  2WX1 A;  4MGK E;  5DCN A;  3QX1 A;  2D11 A;  4MGZ E;  4GDL A;  1J0G A;  3APF A;  4DXA B;  4N9F 4;  1LXD A;  2KWU B;  2LGY A;  2GMI C;  2MP2 B;  3JSV B;  2MBH A;  4CHK A;  4LDT D;  3WAN A;  2PEA A;  1UGM A;  1ISN A;  1J19 A;  2GBJ A;  2LVQ A;  3A9J A;  2LGD A;  3QAR A;  2Z59 B;  2DZK A;  2KTR B;  2DZM A;  1H4R A;  2RD0 A;  2LRU A;  2RGF A;  2LVP A;  4MEM A;  4WWO A;  2GBK A;  3IVF A;  3UF8 A;  1MG8 A;  3RYT A;  2FNJ B;  3H9D A;  2O2V B;  4NJ6 A;  2LUE A;  4G0N B;  2MWS B;  3HIZ A;  4IM3 A;  3PLV A;  2J7Q B;  3LDZ E;  2L8J A;  2N9E B;  1SGH A;  3A33 B;  1WZ3 A;  1V49 A;  3RZF A;  4AJY B;  1WM3 A;  2FCS A;  2DYM A;  3K9O B;  3KUZ A;  3PRZ A;  3NY5 A;  3OAW A;  4GU2 A;  4HJK A;  2MW5 A;  4W9H A;  3VUY A;  4ANV A;  2XEW A;  3WIM A;  1KM7 A;  4HVB A;  3ZDT A;  3Q3J A;  3QJZ A;  2WX0 A;  3QK0 A;  4G11 A;  4ANU A;  2JT4 B;  3UIN B;  2HTH A;  4DHZ B;  2LAS A;  3ZNZ B;  1WXM A;  3N32 A;  3QAQ A;  1WR6 E;  2KMC A;  1E8Z A;  4DBG A;  1LFD A;  2D10 A;  1YJ1 A;  4MH0 E;  4P7I A;  4DHZ E;  1E8Y A;  3ZNG C;  3UIP B;  3RT3 B;  1C3T A;  1SE9 A;  5LXH A;  2DZI A;  2G3Q B;  2L0F A;  3WA0 A;  4LJP B;  5CHV C;  3ML8 A;  3Q3F A;  4G50 A;  4BKS A;  3ZNH B;  1UBI A;  2N9X A;  3H1U A;  1Y8R C;  2KXJ A;  5C23 A;  1KOT A;  2K6D B;  1E90 A;  3PHX B;  1T0Y A;  4W9C A;  2LVO A;  2DZJ A;  2IO0 B;  3B0A A;  3PTF C;  2EMS A;  4HK2 A;  5E6P A;  5AZF A;  1UZX B;  2NCN A;  2IO2 B;  1LQB A;  2FCM A;  1WMH B;  4WAA A;  1P0R A;  2LWP A;  2LZ6 A;  2J0M A;  4WQO B;  3K9P B;  4ZRJ A;  4HPM B;  2JRI B;  2K1F A;  2ZEQ A;  3QA8 A;  2KTF A;  1Q1O A;  2C5L C;  3S2A A;  2DHZ A;  4AOF A;  3A9K B;  3HK0 A;  5CX3 A;  3ENE A;  3EEC A;  3DCG A;  4E71 A;  1Q0W B;  2FAZ A;  2PE9 A;  3IFW B;  1WFY A;  2ZCC A;  3DVN V;  3EHV A;  2AEH A;  4II2 B;  2DAF A;  2L05 A;  3X23 A;  3VQI A;  4BKG A;  3GZN I;  2Z0D B;  2MBQ A;  5DPS A;  4ICV A;  1ZKH A;  2ZNV C;  4W9I A;  4NAW B;  1PQS A;  3KW5 B;  4GDK A;  2N1W A;  4URK A;  3M63 B;  2KZR A;  1HE8 A;  1WX8 A;  4EZJ A;  4HXD A;  3VH3 B;  3VAW A;  1GC7 A;  2M0X A;  2M1M A;  3DQV A;  4IC7 B;  3EC8 A;  5L83 A;  1WGY A;  2JPH A;  2LRW A;  1UEL A;  3ZDM C; 
#chains in the Genus database with same CATH topology
 2JYT A;  3A1Q B;  3PT2 B;  1LM8 B;  4KDL B;  2N0S B;  4M8N A;  2UWQ A;  4HJG E;  3AXC A;  1X1M A;  1HZ6 A;  2LJI A;  3A4R A;  4LTU A;  1NI2 A;  2NPT A;  4NAW A;  4ZYN A;  3PVL A;  2RSU A;  3IBE A;  4KGR A;  4A20 A;  3VFK A;  3AI5 A;  2EMT A;  1WE7 A;  2WU2 B;  4A9A A;  2C60 A;  1SE4 A;  2JRH A;  3QHT A;  4MJS B;  2QSD A;  3L4P A;  3RUL A;  4JLC A;  2KHW B;  2A5U A;  1V5T A;  4JWS C;  3HM6 X;  1GG3 A;  2D3C A;  4NJ7 A;  1RWS A;  3RNA C;  3CF6 E;  1MHH E;  4B6W A;  2M0A A;  3D32 A;  2KDF B;  2D3G A;  4REZ A;  4KGT A;  4ACF A;  4USA A;  1WI0 A;  1XLO A;  2ON8 A;  2W9N A;  3Q8F A;  1L7Y A;  4DXF A;  1LO5 D;  4ZRI A;  4MM3 A;  1V80 A;  4TMA B;  5HI1 A;  4E3C A;  3VRA B;  1ENF A;  4DHJ B;  1WXS A;  1M94 A;  1N5X A;  2WGS A;  4MM3 B;  1CMX B;  1JWM D;  3AEC B;  3URY A;  3V6E B;  3ZRC A;  3QIJ A;  2KJ6 A;  5LXI B;  2DX5 B;  4NNJ B;  2WXN A;  2AQ1 B;  4NJC A;  1EUV B;  1NYR A;  1P98 A;  3O65 B;  3H7P B;  2JYE A;  2KAC A;  3R3M A;  3AN1 A;  3DWG C;  4ZRQ A;  2JSV X;  1R4M I;  4XX5 A;  3Q14 C;  5IO9 A;  2E3T A;  3PRE A;  4RF0 A;  1JWU D;  1YQ4 B;  4MAC A;  1YJI A;  4OZB A;  1H8C A;  4DDG D;  2HJ1 A;  2B3A A;  2CJO A;  4MGY E;  1ZPS A;  2PE6 B;  3VTW A;  2PKO A;  2ZCB A;  1JRP A;  2PPH A;  4MDK E;  2VH1 A;  4EEW A;  1I4H A;  5AUK A;  3A9K A;  4KV2 A;  2LGI A;  3Q3M C;  1IPG A;  3B9J A;  3OLM D;  3HHM A;  4AUQ C;  4ARC A;  1E0Z A;  4XGA B;  1V97 A;  2KAJ A;  5CTR C;  3BVM A;  1QF6 A;  2OHF A;  2QIL A;  1F2R I;  1OQR A;  4I6P A;  2RDG A;  4AS1 A;  4FLH A;  1K50 A;  3AEB B;  1AAR A;  4J6I A;  4WWN A;  3U7D A;  2MA9 B;  1QOB A;  3DBH I;  2NTT A;  4JE3 B;  1YQ3 B;  4YTP B;  1QIL A;  2K8B A;  3L54 A;  5L95 C;  4A3O A;  3GE3 C;  1T0S C;  3NG0 A;  5BMG A;  4M0W A;  2KWC A;  1TY2 A;  3H7S A;  2DLB A;  5J2R A;  2I1K A;  2D2Q A;  1E7V A;  3MC8 A;  1ESF A;  1IUE A;  3Q6B A;  3E9S A;  2JZP A;  4NPN A;  2WXI A;  3ZRF A;  1WH3 A;  1YX5 B;  2ZVN A;  3PV1 A;  2PJH A;  2NVU I;  1BT0 A;  2FCQ A;  2G9H D;  4IW0 A;  4GSW A;  3DBR B;  2C7N B;  2WDQ B;  2K0P A;  4P1B C;  4IM0 A;  1WWT A;  1EWC A;  1L0Y B;  4GGQ A;  1RFA A;  1I4X A;  2AQ3 B;  3Q8A A;  4PK1 A;  5DPW A;  4ITK A;  2M56 B;  1L2N A;  1TS3 A;  5BMH A;  3VRB B;  3KH0 A;  2CS4 A;  3U8Z A;  4TQ1 A;  3SFD B;  2QHO A;  1QKZ A;  1NI3 A;  1JRO A;  3BWU D;  1BXT A;  2WXL A;  3H8H A;  1WYG A;  1VR9 A;  1VDV A;  1CZP A;  1GB1 A;  1VD2 A;  1WGH A;  1WXV A;  1D6E C;  4KDI C;  1EM7 A;  4JWU C;  3TL5 A;  1OQY A;  4HWI B;  2IPK D;  4EZL A;  3R2T A;  1SEB D;  4YL8 A;  1YD8 U;  1N62 A;  3RCZ A;  1F77 A;  1K53 A;  4TV3 A;  2J52 A;  2IO1 B;  3BII D;  1E6E B;  4LNN A;  4KKJ A;  1GOZ A;  2BKF A;  3KYC D;  1PDX A;  2WYQ A;  2K6Q A;  4MSM B;  3MP9 A;  1NYQ A;  1V1P A;  3ZJT A;  1EO6 A;  2BWE S;  1ET6 A;  2WHI A;  3L0W B;  3N3K B;  3ZGZ A;  2MX2 A;  2BPS A;  1JCK B;  2FCN A;  4RM8 A;  2CHX A;  1D5Z C;  2HE7 A;  3TEZ A;  4M01 A;  3IAS 1;  4JQW C;  4LNF A;  2LHE A;  1RM6 C;  2KDB A;  2WX1 A;  3QX1 A;  1CJE A;  3FIL B;  1WRI A;  4M02 A;  4K3C A;  3APF A;  1LXD A;  1RFK A;  2GMI C;  2BTE A;  2MBH A;  4CHK A;  3O13 A;  4HRO A;  2PEA A;  1UGM A;  1ISN A;  1J19 A;  1ZP0 B;  3A9J A;  1SJH D;  1H4R A;  2CU3 A;  3UF8 A;  4RGO S;  4IM3 A;  3LYY A;  1V1O A;  2J7Q B;  1TYG B;  3LDZ E;  2L8J A;  5EE9 A;  2H88 B;  3B2F A;  4RFB A;  1SGH A;  3RZF A;  4AJY B;  3K9O B;  3NY5 A;  3OAW A;  4HJK A;  2MW5 A;  4W9H A;  3NRZ A;  3RFZ B;  1FMA D;  2Q5W D;  3UIN B;  4LLG M;  3QAQ A;  1E8Z A;  3ZNG C;  4BZA A;  2SAK A;  1C3T A;  5LXH A;  1QT9 A;  2DZI A;  3WA0 A;  4C4V B;  1BUI C;  3Q3N C;  3Q3F A;  2BW2 A;  4BKS A;  2JWU A;  3AE5 B;  1JWA D;  3KWL A;  4C4V A;  3FKY A;  5EE0 A;  2IO0 B;  3B0A A;  5E6P A;  3SFE B;  2NCN A;  2FCM A;  1P0R A;  4WQO B;  3BYT B;  4HPM B;  2JRI B;  2K1F A;  2ZEQ A;  4ZRJ A;  3DHG C;  2KTF A;  2C5L C;  4IDI A;  1DOI A;  3IFW B;  3SR6 A;  1ET9 A;  3DVN V;  2AEH A;  2IGH A;  4TSS A;  2MBQ A;  4ICV A;  4S17 A;  4W9I A;  4NAW B;  1TKE A;  4P16 A;  1FEH A;  1HE8 A;  2WXQ A;  4HXD A;  2SEB D;  3ZJU A;  1KRH A;  1TS5 A;  1BML C;  3DQV A;  2JPH A;  1L6U A;  2HJ8 A;  4CQN A;  4FN2 A;  1NEK B;  1MI0 A;  2VRR B;  2O6V B;  3BVZ A;  4HDO A;  5FR3 A;  3P1M A;  1ZDX A;  1TZ1 A;  2LD9 A;  1VZ7 A;  4IOI E;  2V0G A;  3MC9 A;  4A8X C;  2L1A A;  2CHW A;  3AM9 A;  2D3A A;  4AP4 C;  5IA7 A;  3NJT A;  3ZTC A;  5JZE B;  3ZIM A;  2JF5 A;  3ZKJ C;  2IBI B;  4LNO A;  3P2B A;  3MJ5 A;  1WMH A;  2QDF A;  4FJV B;  4IUM B;  3AE7 B;  4WJO A;  3QWZ B;  3AE8 B;  3DPD A;  3Q8C A;  2YLM A;  4S0R A;  2BYT A;  1YX6 B;  3U2S C;  2CKH B;  4FUL A;  2C7M B;  4MGI E;  2IZV B;  3WAO A;  4XDC A;  4BBN C;  5DPT A;  3AB5 A;  3L13 A;  1FIQ A;  3PO0 A;  2ZW0 A;  5AZG A;  3DVG Y;  1J7A A;  3CMM B;  4HKZ E;  4ARI A;  1SIJ A;  2IY0 B;  2WDT B;  1HTQ A;  1E9M A;  2BVC A;  3ZLZ A;  4OVU A;  2D07 B;  3DVN U;  3I57 A;  3W1S C;  2AL6 A;  1IP9 A;  3L08 A;  3P4S B;  3IT4 B;  3NZS A;  2PVG C;  4FHJ A;  5GMV A;  4FBJ B;  3Q69 A;  4FA6 A;  4JPS A;  3ABV B;  3GOE A;  1UF0 A;  4AWJ A;  2XK5 A;  1XXG A;  5T8I A;  1E8X A;  3OG5 A;  3H7P A;  1UWM A;  2NBV B;  1L4D B;  1KLG D;  3ZW3 A;  1MFW A;  1F9J A;  4A90 A;  2DAJ A;  1YNT E;  3KWV A;  3UI3 A;  3DBL I;  1C4P A;  4WJP A;  4US8 A;  3B08 A;  3M95 A;  4K7S A;  1PGA A;  1V1P B;  2JU6 X;  3NVZ A;  1HQR D;  4YWG G;  1WRD B;  3APC A;  3BIN A;  4B9K A;  2M8S A;  1TY0 A;  1K51 A;  3LJ3 A;  1C77 A;  5E6O A;  4WH4 A;  3Q2A C;  4YT0 B;  2UYZ B;  3PRP B;  5E6N A;  3RNG C;  5IKC M;  2OJR A;  1QZE A;  1Z2M A;  1OEY A;  1I7H A;  2JZZ A;  2N9L A;  4IM2 A;  4MJS A;  3VH4 B;  1E5W A;  1WGD A;  2MP2 A;  2O6V D;  3U52 E;  1T6B X;  1K52 A;  3PHW B;  2LXA A;  2KN5 A;  2J42 A;  1YIW A;  4II3 B;  5D7G A;  2KMM A;  3QQ8 B;  5BMI A;  1RRB A;  1L6V A;  1Q5W B;  3AUL A;  2HDE A;  1TS4 A;  3DOW A;  2DYO A;  4A55 A;  2WWZ A;  1JML A;  1C79 A;  4P1C C;  4TKN A;  3KUC B;  5H92 C;  2KKC A;  1UD7 A;  1WJU A;  3RNB C;  2GBN A;  4KVG B;  1B1Z A;  5G5G A;  4RM9 A;  4HPL B;  4JL9 A;  3FC4 A;  2PMV A;  3PGE A;  3R7R A;  4O1N A;  4G3X B;  5HHD G;  4UDU C;  1KLU D;  5KHQ A;  4CO7 A;  3MTN B;  2KC1 A;  5TR5 A;  3RZW C;  4C7Y A;  3EUB 2;  3AE2 B;  4DHJ D;  4KGS A;  1QOA A;  5DPR A;  1WR1 A;  3GS2 A;  4DWF A;  4TQ0 A;  3AV8 A;  2L0T A;  1PFD A;  4FJZ A;  1Y56 A;  1TS2 A;  5KHO A;  2MQJ A;  5IAA C;  2J0K A;  3QCA A;  1EU4 A;  3TMP B;  1WYW B;  4XE0 A;  3NHE B;  5J18 A;  4BKT A;  1D4B A;  2BS3 B;  4YSZ B;  1FXA A;  1KF6 B;  4ZDV A;  5CHF A;  4K7U A;  2W54 A;  2BYV E;  1SXT A;  3APD A;  5BO4 B;  1MJD A;  4GDL B;  1OGW A;  1XD3 B;  1JRU A;  1C9F A;  1VZ6 A;  1L4Z B;  4TUU A;  3P4R B;  1I4R A;  2WXM A;  3U7Z A;  4L1B A;  4GLS C;  4YXD B;  3AMZ A;  1OEY J;  5FR6 A;  3PZD A;  2JWZ A;  2N7J A;  3OJ3 A;  3A9J B;  1WIA A;  2XK5 B;  4W9D A;  1OFF A;  1VCB A;  3CWI A;  1P7F A;  1RAX A;  1MPE A;  3TBL D;  3UGB B;  3PZ7 A;  4H2A A;  1OTR B;  4GXB A;  4JIO U;  4ZRK A;  2KTR A;  2VZK D;  1XLP A;  2RR9 A;  4EE2 A;  3PZ8 A;  4MGK E;  4OZC A;  4MGZ E;  1J0G A;  1L0V B;  4DXA B;  2DNF A;  2LEK A;  2MP2 B;  3JSV B;  4LDT D;  4XWW A;  1C4C A;  1PUT A;  3WAN A;  1ACC A;  2Z59 B;  2DZK A;  2DZM A;  2LRU A;  2RGF A;  4LNI A;  4MEM A;  2GBK A;  4WWO A;  3IVF A;  2GI9 A;  1IGC A;  1VRA B;  2MWS B;  3LXF A;  2N9E B;  3AE6 B;  5LLI A;  1TZO A;  2DYM A;  3VUY A;  3PRZ A;  5H8Y E;  3WIM A;  4HVB A;  3ZDT A;  1JW9 D;  1VZ8 A;  2HTH A;  1WXM A;  2KMC A;  1CQV A;  3Q8B A;  1LFD A;  4PT5 A;  4P7I A;  4DHZ E;  1E8Y A;  4WWM A;  4XYC A;  3RT3 B;  1T5X D;  4ZYS A;  3AED B;  2N9K A;  4LJP B;  1QQR A;  2K6D B;  1E90 A;  1FD6 A;  1T0Y A;  1KOT A;  2D3B A;  4RGM A;  4RF1 A;  4HK2 A;  3GE8 C;  1FM0 D;  4RCO A;  3V3X A;  2J0M A;  2VH2 A;  2I38 A;  3S2A A;  2DHZ A;  3EA6 A;  5CX3 A;  3HK0 A;  2FUG 1;  4AOF A;  1C76 A;  3EGR A;  4E71 A;  2FAZ A;  4HKQ A;  2ZCC A;  3EHV A;  4RNA A;  2L05 A;  4C7Z A;  3GZN I;  4AQ7 A;  1ZKH A;  2ZNV C;  3AEA B;  4OVZ A;  3KW5 B;  2EKI A;  3M63 B;  4EZJ A;  3VH3 B;  4IC7 B;  3EC8 A;  2LRW A;  1UEL A;  3ZDM C;  2MH7 A;  1NDD A;  4KSK C;  1HXY D;  4DXG A;  4NY0 A;  2BGF A;  1EU3 A;  2LFI A;  4J3O D;  1TT5 B;  1ZXH A;  2A4Z A;  2LUM A;  2K8H A;  3PSE B;  4PS7 A;  2LMC A;  3AU5 A;  2WXJ A;  2V4I B;  3B2G A;  3HM3 A;  1JWS D;  2V1Y A;  5IOI A;  1TBE A;  2WXK A;  2LJ5 A;  3DHH C;  1YJJ A;  2K22 A;  4DDI D;  4XDD A;  2INN E;  2KT7 A;  1KJT A;  4YTM B;  1ZW7 A;  4IWQ A;  2JZ3 B;  1ROE A;  2MJ3 A;  4XZ4 A;  2DWQ A;  2JX5 A;  2FIF A;  5HG2 A;  2QCZ A;  4GB9 A;  2Y5B B;  2KDM A;  2GB1 A;  3HUI A;  3C0R B;  4WQM A;  2MCN B;  3OJ4 B;  2MBB B;  4N59 A;  2WP9 B;  1UGJ A;  2BYF A;  2M19 A;  3UQB A;  2R2Q A;  4M8M A;  2QMT A;  3AU4 A;  4AJW A;  1MG4 A;  5EE3 A;  1HA5 A;  2WXG A;  3P4P B;  4OZA A;  3HVD A;  1NEN B;  4W9E A;  3NVY A;  2L3Z A;  4W9G A;  2R2O A;  1WF9 A;  2Z0E B;  3BYY B;  1QOG A;  2BB6 A;  1QLB B;  2IY1 B;  3EFC A;  4GOC A;  3I5J C;  4W9K A;  4IG7 B;  4EZK A;  2NTS A;  3Q8E A;  2ICI A;  1HTO A;  1J7B A;  3QC8 B;  4GMV A;  3I9V 1;  5TSS A;  1N63 A;  4PYU A;  1FRR A;  3RI7 C;  2JVC A;  3ML9 A;  3DVG X;  2I1J A;  1I42 A;  3I63 C;  3UQA A;  3MC0 B;  2DBY A;  4NQK E;  4MH8 A;  2WS3 B;  3GZN B;  3AE9 B;  4R3D A;  3PPA A;  4YSX B;  2RPV A;  4ZRP A;  3KUD B;  5G5H A;  3E56 A;  4C00 A;  1DOY A;  3MHS D;  2UU7 A;  2AL3 A;  1WSP A;  2WXH A;  1XO3 A;  5G2N A;  1C1Y B;  1YN3 A;  4RGN A;  3W1S A;  2KLG A;  4ZHP A;  3GP7 A;  1C4A A;  2XBB C;  2KDI A;  4FJY A;  4N6E B;  1SSN A;  2BS2 B;  2KVZ A;  2FUH B;  1J8C A;  3IG3 A;  2O6V A;  3V61 A;  1WY8 A;  2MJD A;  1SJE D;  1XQQ A;  4BAX A;  1T0R C;  2WDR B;  1HZ5 A;  2CR5 A;  5G55 A;  3KQ4 A;  3U30 A;  1WJ6 A;  2PTL A;  4C56 C;  1FO4 A;  5EE1 A;  3P4Q B;  1FCC C;  2XN9 C;  5JHA A;  4IWP A;  2FE8 A;  1EF1 A;  3BZD B;  4JGH B;  1IYF A;  1M4V A;  2HD5 B;  2FBW B;  1XLQ A;  4LNK A;  3B1L X;  3P42 A;  3VUW A;  4FAD A;  4YSY B;  3M3J A;  2GOW A;  3VHT C;  2OOB B;  2YEP F;  4A6Q A;  1FRD A;  3MJW A;  1YOV B;  1NBF C;  3AE4 B;  1SIF A;  2EKE C;  4OHJ A;  1I35 A;  2NBU A;  3BY4 B;  5HKH A;  2C9W B;  2ZNV B;  4DQO C;  5C1Z A;  4MEL A;  3N1Z C;  1TIF A;  4DK5 A;  4EKU A;  2KOX A;  3AEE B;  1GUA B;  2KFK B;  3IXS A;  1K8R B;  2YEP B;  5C2T B;  3V60 A;  3PLU A;  1EWY C;  2WLB A;  3ZTD A;  4N58 A;  2H89 B;  3TIX A;  2RDH A;  2M17 A;  1A70 A;  2L00 B;  2KJR A;  2ZJD A;  2PLP A;  3GB1 A;  4KZ0 A;  2BB5 A;  3ZXR A;  2ZPY A;  4KSL C;  2NMQ A;  3C19 A;  4W9J A;  3NS1 A;  3M62 B;  1V81 A;  4GN1 A;  2MHJ A;  2ZZP B;  2GBM A;  1V6E A;  2RPQ A;  4WAF A;  5D2M B;  3VUX A;  2KNB A;  3ZJV A;  2KWD A;  2AWT A;  4HPP A;  3IHP C;  4BBN F;  3MHZ A;  3W1Y A;  1WXA A;  2CJN A;  3OWE B;  2W82 A;  1AW7 A;  1ZXI A;  1FXI A;  3CSF A;  2DYB A;  3NVW A;  1XEE A;  1SBB B;  3VDZ A;  1I4Q A;  1UNS A;  3WAL A;  1NVI D;  2KO3 A;  1AN8 A;  5D94 A;  3MFG A;  3AE3 B;  4F7Z A;  3CIR B;  3L16 A;  3WAM A;  1E8W A;  5J17 A;  1R4N B;  1SE2 A;  3JSV A;  2N1V A;  2G4S A;  2K9X A;  2IO3 B;  2KD0 A;  1SB3 C;  1FFU A;  4NAM A;  1GAQ B;  1TKY A;  4BOS C;  4ANW A;  3IAM 1;  1G6J A;  2E6X A;  1A5R A;  5JHB A;  5IN7 A;  2CU1 A;  3KVF B;  2AYO B;  2N4F A;  5DCN A;  4HRS A;  5D3D A;  2D11 A;  3P63 A;  4GDL A;  3RMK C;  4N9F 4;  2LGY A;  2KWU B;  3TEW A;  2WNM A;  2QEJ C;  2I2Y A;  5GXG B;  2WU5 B;  2LVQ A;  4C80 A;  2TSS A;  2Y5P A;  2KTR B;  2KN4 A;  1IGD A;  2LVP A;  1Q10 A;  1AWD A;  1MG8 A;  2FNJ B;  1FFV A;  3W5V B;  4NJ6 A;  2LUE A;  4G0N B;  3N9Y C;  1QOF A;  3PLV A;  1AYF A;  4M00 A;  2V3N A;  1WZ3 A;  1V49 A;  4GU2 A;  1WM3 A;  3KUZ A;  2JXT A;  2XEW A;  3LB8 C;  3SEB A;  2WX0 A;  1N6Z A;  1GB4 A;  1WR6 E;  4DBG A;  1YJ1 A;  3HRD D;  5IP4 D;  3UIP B;  1DGJ A;  2L32 A;  2G3Q B;  2L0F A;  3ML8 A;  1UBI A;  2IGG A;  1Y8R C;  5C23 A;  2BBC A;  3PTF C;  1UZX B;  1D5M C;  1WMH B;  4NZL B;  4WAA A;  2LZ6 A;  1JAL A;  1F52 A;  1YMH E;  1FPY A;  3A9K B;  2X8X X;  3DCG A;  3DWM A;  3HVZ A;  2RDB C;  4ZOH C;  3C8Y A;  3X23 A;  5DPS A;  1I4G A;  4GDK A;  2N1W A;  2W55 A;  3VAW A;  1P7E A;  2M0X A;  3DBL B;  4B0M A;  1XCT L;  1WGY A;  1WGK A;  2N9P C;  1D3Z A;  2KK8 A;  3DBR I;  1FNU A;  3NUH B;  2WXF A;  4WJQ A;  2MJE A;  2J53 A;  3VR8 B;  2LGX A;  4BFR A;  4B95 A;  1TGZ B;  1HEZ E;  5LNK 1;  4F8C B;  4A3P A;  1E7P B;  4KIK B;  4K81 A;  2KVR A;  1UH6 A;  2K5P A;  2MEK A;  4WIP A;  3CST A;  4KZC A;  3VTU A;  1RLF A;  4K3B A;  5FK9 C;  1U4A A;  3ZYY X;  4W9F A;  4LK0 M;  1D5X C;  2N7E A;  3TCA A;  2IND C;  2Y3A A;  3EFU A;  1S3S G;  3T8M A;  4WJN A;  1P9D U;  2KAN A;  4GDK B;  4ANX A;  1R4N I;  2MBO A;  2M4N A;  1I4P A;  4IKG A;  1WE6 A;  3ECI A;  3ZO5 B;  5FKA C;  3DBH B;  5JH5 C;  4M0W B;  3R66 C;  4PS3 A;  3AEG B;  2FID A;  3NVV A;  1UBQ A;  1V5O A;  2X38 A;  1STE A;  1WJ4 A;  3V62 A;  4BVU C;  2YVC A;  3DBS A;  2V3P A;  5MPO A;  2KFK A;  1E7U A;  1LGR A;  1WM2 A;  2OJW A;  3I3T B;  1FCL A;  3BVG A;  2WXR A;  5C3J B;  3SHQ A;  3SD5 A;  2VZK B;  4WUR A;  2V3S A;  2BQQ A;  2KWV B;  2NBW B;  1FXT B;  5D6J B;  3RNF C;  2N7D A;  2Z8L A;  1XCQ L;  3ZNI D;  2L76 A;  4HDQ A;  5HFY A;  1WX7 A;  1WZ0 A;  2PVO D;  4L23 A;  2MLB A;  3ZQ4 A;  2KMA A;  4W9L A;  4HCN B;  4MSQ B;  4RH6 A;  4RMA A;  3VTV A;  2WQY B;  1PGB A;  3PRM B;  3T3O A;  3FIL A;  1KTK A;  3AEF B;  1SE3 A;  2G4D B;  4LJO B;  1ZUD 2;  1FNW A;  2DEN B;  4XC2 A;  2KX3 A;  4KIK A;  3ZUN A;  5D3I B;  2NPT B;  1JQ4 A;  4EOY A;  2C7H A;  2GLS A;  3RUI B;  3PS6 A;  1R4M B;  2KLC A;  3NZU A;  2MSE D;  3N20 C;  4E74 A;  2KFJ A;  1CK1 A;  5BYS A;  2REX A;  4RGT A;  3JW0 X;  1T3Q A;  2QIE B;  2WXO A;  2BWF A;  3W2D A;  4PS8 A;  1GJZ A;  2KQ7 A;  2KQS A;  1P3Q U;  2BYE A;  1VLB A;  4BOZ B;  5E6J A;  1N61 A;  2W3S A;  4L2Y A;  3RNC C;  4Q2J A;  4NQL B;  1B9R A;  2HTM E;  1ZDV A;  2B76 B;  3AH7 A;  3KYD D;  3SDL C;  2PIA A;  2K8C A;  4EFO A;  2KJH B;  2L83 A;  1VJK A;  1TTN A;  1L5P A;  3NOB A;  2JXX A;  3A1Q A;  2K39 A;  2QC8 A;  3N1Y C;  2CHZ A;  1DOX A;  1V2Y A;  3T9L A;  2NS5 A;  4PYZ A;  3T3N A;  2IJ0 A;  2AQ2 B;  2O2V A;  3DDC B;  2KX0 A;  3IT6 B;  3JVZ X;  1RYJ A;  4US9 A;  3TEY A;  1YN5 A;  3TSS A;  4CYE A;  3ALB A;  3RPF C;  1KFY B;  1UWX A;  4FHK A;  3WCQ A;  1XF5 L;  1L0X B;  3BK1 A;  1GPX A;  1V8C A;  4LCD E;  1WJN A;  2J4X A;  3ZVV A;  1J7C A;  2ONQ A;  3JYU A;  1TKG A;  3X0W A;  1MVK A;  1N60 A;  2IGD A;  1YQB A;  4KX6 B;  3L10 B;  4P6V F;  2W3R A;  1V9J A;  4BKS D;  3AE1 B;  1MHX A;  3TUO A;  3VXW A;  5I4D A;  1GNU A;  2BT6 A;  2G45 B;  3NZ3 A;  1WGR A;  3RD2 A;  5BYQ A;  2QJL A;  2V4L A;  1XT9 B;  3A4S C;  2IYD B;  1KLV A;  4OW0 A;  1WGG A;  3ETR A;  1TJE A;  4I6L B;  5CHW A;  3V05 A;  3WAP A;  2J0J A;  4HEA 1;  2KC2 A;  3N1X C;  3UIO B;  3L17 A;  1Z5S B;  2OED A;  1YN4 A;  2GBR A;  5JXV A;  1GC6 A;  3R7Q A;  2JY6 A;  1S1Q B;  5AZH A;  3KLS X;  3Q3O C;  3TJP A;  5AEK B;  4LDT B;  1OQQ A;  2ZW1 A;  1EF5 A;  3H6N A;  3TEX A;  2RMM A;  2NR2 A;  4YTN B;  4F1S A;  4GIV A;  3SU8 X;  3ONS A;  4OVV A;  1IBX A;  2IDY A;  2LXC A;  4MT5 A;  1SF0 A;  1V86 A;  4EUT A;  1WX9 A;  4I6N B;  4X57 B;  2BF8 B;  3RNE C;  1ZGU B;  2LHD A;  2ZVO A;  2JUO A;  1PGX A;  4KKI A;  2LI5 A;  3V6C B;  1P1A A;  4ASW C;  3VVW B;  1T0Q C;  3N30 A;  1JWB D;  2L52 A;  2MBE A;  2KYW A;  2ZPN A;  5BYR A;  4HCP B;  4ICU A;  4IWO A;  2EEL A;  4K1R B;  1F1H A;  4XWT A;  1WXQ A;  2K25 A;  2L7R A;  3NS8 A;  4K7W A;  2BKR B;  2Y5C A;  2ASQ A;  4WWP A;  2MRP A;  4HLE A;  1F0Z A;  1E10 A;  2XNA C;  2KDE B;  5EDS A;  1IBX B;  1FNV A;  1UUP A;  1DYQ A;  2WXP A;  2K3U A;  2INP E;  2GBJ A;  2R61 A;  3RN9 C;  3BK2 A;  2LGD A;  3QAR A;  2RD0 A;  4ZHO A;  1F2R C;  4B0E A;  3RYT A;  3H9D A;  2O2V B;  2WDV B;  3HIZ A;  3W5U B;  3A33 B;  2BS4 B;  4JX1 C;  2FCS A;  3DHI C;  3FAH A;  4ANV A;  1KM7 A;  3Q3J A;  3QJZ A;  3QK0 A;  4G11 A;  1ZE3 D;  4ANU A;  2JT4 B;  3J9C A;  4DHZ B;  2LAS A;  3ZNZ B;  3N32 A;  2D10 A;  4MH0 E;  5AUI A;  2GRI A;  4QAY A;  1SE9 A;  3VR9 B;  2G1E A;  3ZXV A;  4D2K A;  1ZOY B;  5CHV C;  2AX5 A;  2PW9 A;  4G50 A;  3ZNH B;  2N9X A;  3H1U A;  1XLN A;  2KXJ A;  3U4E G;  3PHX B;  4W9C A;  2LVO A;  1R7S A;  2DZJ A;  3R2I A;  2EMS A;  5AZF A;  2IO2 B;  1LQB A;  2LWP A;  3K9P B;  3W9C B;  2D5G A;  2LGS A;  3QA8 A;  2KQ4 X;  2INC C;  1Q1O A;  1KH0 A;  2V9H A;  3R8B A;  3ENE A;  3EEC A;  1Q0W B;  2PE9 A;  1WFY A;  4II2 B;  2DAF A;  3VQI A;  4BKG A;  2Z0D B;  1PYW D;  1PQS A;  1C78 A;  4URK A;  2KZR A;  1WX8 A;  1GC7 A;  2JQR B;  2M1M A;  2ACZ B;  5L83 A;  4FXC A;  1N5W A; 
#chains in the Genus database with same CATH homology
 2N9P C;  3A1Q B;  3PT2 B;  1D3Z A;  2HJ8 A;  1LM8 B;  2KK8 A;  3DBR I;  1NDD A;  4KSK C;  4KDL B;  4FN2 A;  4M8N A;  2UWQ A;  4WJQ A;  2VRR B;  2O6V B;  4HDO A;  4NY0 A;  2BGF A;  3AXC A;  1X1M A;  2LGX A;  4BFR A;  4B95 A;  1TGZ B;  1TZ1 A;  2LD9 A;  4F8C B;  4A3P A;  2A4Z A;  3A4R A;  4KIK B;  1NI2 A;  4K81 A;  2K8H A;  2NPT A;  3PSE B;  4NAW A;  4PS7 A;  3AU5 A;  2KVR A;  2CHW A;  4ZYN A;  1UH6 A;  3PVL A;  2RSU A;  3IBE A;  4AP4 C;  3CST A;  4A20 A;  4KZC A;  3VTU A;  5IA7 A;  3VFK A;  3AI5 A;  2EMT A;  1WE7 A;  3ZTC A;  3HM3 A;  2C60 A;  5JZE B;  3ZIM A;  2JF5 A;  1RLF A;  2IBI B;  2V1Y A;  3ZKJ C;  1TBE A;  3P2B A;  1U4A A;  2JRH A;  3QHT A;  4MJS B;  4W9F A;  1WMH A;  2LJ5 A;  3RUL A;  4JLC A;  4FJV B;  4IUM B;  2KHW B;  2A5U A;  2N7E A;  3EFU A;  3TCA A;  4DDI D;  4WJO A;  1V5T A;  3QWZ B;  1S3S G;  3T8M A;  3DPD A;  3HM6 X;  1GG3 A;  2YLM A;  1KJT A;  4NJ7 A;  4WJN A;  1P9D U;  2KAN A;  1YX6 B;  3CF6 E;  4GDK B;  4ANX A;  2CKH B;  4B6W A;  1R4N I;  2MBO A;  3D32 A;  2M4N A;  2KDF B;  2D3G A;  1ZW7 A;  4IWQ A;  4FUL A;  2C7M B;  4MGI E;  2IZV B;  3WAO A;  1WI0 A;  3ZO5 B;  1WE6 A;  3ECI A;  2JZ3 B;  2W9N A;  4BBN C;  5JH5 C;  4XZ4 A;  5DPT A;  4M0W B;  1L7Y A;  2FIF A;  3R66 C;  4PS3 A;  4ZRI A;  4MM3 A;  3L13 A;  2FID A;  1V80 A;  5AZG A;  4GB9 A;  2Y5B B;  4E3C A;  1UBQ A;  3CMM B;  3DVG Y;  1V5O A;  4DHJ B;  1WJ4 A;  1WXS A;  1M94 A;  3V62 A;  1CMX B;  3C0R B;  4BVU C;  2IY0 B;  2WDT B;  2YVC A;  2MCN B;  3V6E B;  3ZRC A;  3QIJ A;  3DBS A;  3OJ4 B;  2KJ6 A;  5LXI B;  2KFK A;  1E7U A;  1WM2 A;  2DX5 B;  2MBB B;  3I3T B;  4NNJ B;  3ZLZ A;  4OVU A;  1EUV B;  3SHQ A;  2BYF A;  3UQB A;  3SD5 A;  2D07 B;  2R2Q A;  4M8M A;  3DVN U;  1P98 A;  3AU4 A;  3W1S C;  4AJW A;  2V3S A;  2AL6 A;  2KWV B;  3O65 B;  1IP9 A;  2NBW B;  3H7P B;  3L08 A;  1FXT B;  3NZS A;  3R3M A;  5D6J B;  2N7D A;  4W9E A;  4FHJ A;  5GMV A;  3ZNI D;  2L76 A;  4HDQ A;  4FBJ B;  1R4M I;  1WX7 A;  1WZ0 A;  4XX5 A;  4FA6 A;  2MLB A;  3PRE A;  2KMA A;  4W9L A;  2L3Z A;  4HCN B;  4W9G A;  2R2O A;  1WF9 A;  4MSQ B;  2Z0E B;  5LLI A;  3GOE A;  4RMA A;  3VTV A;  3PRM B;  2IY1 B;  4AWJ A;  2XK5 A;  4GOC A;  4W9K A;  4IG7 B;  4EZK A;  4DDG D;  1H8C A;  2B3A A;  1E8X A;  3QC8 B;  4GMV A;  4MGY E;  3H7P A;  2G4D B;  2PE6 B;  4LJO B;  3VTW A;  2ZCB A;  2NBV B;  4PYU A;  2DEN B;  4XC2 A;  2KX3 A;  3ZW3 A;  4KIK A;  3ZUN A;  1F9J A;  2NPT B;  2DAJ A;  2PPH A;  4EOY A;  2C7H A;  2JVC A;  3ML9 A;  4MDK E;  3DVG X;  3DBL I;  2I1J A;  4WJP A;  3RUI B;  3PS6 A;  1I42 A;  2KLC A;  4EEW A;  3UQA A;  3NZU A;  2MSE D;  3A9K A;  4KV2 A;  4E74 A;  4NQK E;  1IPG A;  2KFJ A;  3B08 A;  3OLM D;  3HHM A;  3M95 A;  4K7S A;  2REX A;  3PPA A;  3JW0 X;  4AUQ C;  2BWF A;  5CTR C;  1WRD B;  3APC A;  3BIN A;  4PS8 A;  4B9K A;  2M8S A;  2KQ7 A;  3KUD B;  1GJZ A;  3MHS D;  2KQS A;  1P3Q U;  3LJ3 A;  2BYE A;  4I6P A;  2AL3 A;  5E6O A;  4BOZ B;  2UYZ B;  4FLH A;  3PRP B;  5E6N A;  5G2N A;  1C1Y B;  4NQL B;  2OJR A;  3W1S A;  2KLG A;  1AAR A;  4J6I A;  4WWN A;  3U7D A;  1QZE A;  1Z2M A;  2XBB C;  2KDI A;  3KYD D;  1OEY A;  4FJY A;  3SDL C;  2MA9 B;  2JZZ A;  2K8C A;  2FUH B;  3DBH I;  2KJH B;  3IG3 A;  4EFO A;  2O6V A;  4IM2 A;  3V61 A;  1J8C A;  1WY8 A;  1XQQ A;  1TTN A;  4MJS A;  3VH4 B;  1E5W A;  1WGD A;  2MP2 A;  2O6V D;  2CR5 A;  3NOB A;  5G55 A;  2JXX A;  2K8B A;  3A1Q A;  2K39 A;  3L54 A;  3U30 A;  5L95 C;  1WJ6 A;  4A3O A;  2CHZ A;  3PHW B;  2LXA A;  1V2Y A;  3T9L A;  2NS5 A;  2KWC A;  2KN5 A;  4PYZ A;  5JHA A;  4IWP A;  1EF1 A;  3H7S A;  2O2V A;  3DDC B;  2KX0 A;  1YIW A;  4JGH B;  5J2R A;  1IYF A;  3JVZ X;  4II3 B;  5D7G A;  2HD5 B;  2I1K A;  3QQ8 B;  1RRB A;  3B1L X;  3VUW A;  4FAD A;  1Q5W B;  3AUL A;  3M3J A;  2GOW A;  3VHT C;  2D2Q A;  4CYE A;  1E7V A;  2OOB B;  3ALB A;  3DOW A;  4FHK A;  2DYO A;  3MJW A;  2WWZ A;  1NBF C;  4LCD E;  4NPN A;  1SIF A;  1WJN A;  4TKN A;  2EKE C;  3ZRF A;  1WH3 A;  1I35 A;  1YX5 B;  2NBU A;  2ZVN A;  3BY4 B;  3KUC B;  3ZVV A;  5HKH A;  3JYU A;  3X0W A;  2C9W B;  2ZNV B;  2KKC A;  5C1Z A;  3PV1 A;  1UD7 A;  1WJU A;  1YQB A;  2PJH A;  2NVU I;  2GBN A;  4MEL A;  3L10 B;  4KVG B;  4RM9 A;  4HPL B;  1V9J A;  4BKS D;  4DK5 A;  4JL9 A;  4EKU A;  1BT0 A;  2FCQ A;  2KOX A;  4IW0 A;  3VXW A;  3PGE A;  4GSW A;  1GUA B;  2C7N B;  1GNU A;  3R7R A;  2G45 B;  2KFK B;  4IM0 A;  1WGR A;  4G3X B;  3RD2 A;  1K8R B;  2V4L A;  5KHQ A;  3V60 A;  1XT9 B;  4CO7 A;  3MTN B;  2KC1 A;  4GGQ A;  1RFA A;  3PLU A;  5TR5 A;  3RZW C;  3A4S C;  2IYD B;  3ZTD A;  5DPW A;  1KLV A;  3TIX A;  4DHJ D;  1WGG A;  5DPR A;  2M17 A;  1WR1 A;  1L2N A;  4DWF A;  4TQ0 A;  4I6L B;  2L00 B;  2KJR A;  2ZJD A;  2L0T A;  5CHW A;  4FJZ A;  3WAP A;  3KH0 A;  2J0J A;  2CS4 A;  5KHO A;  3U8Z A;  4KZ0 A;  2KC2 A;  4TQ1 A;  2QHO A;  3UIO B;  2MQJ A;  5IAA C;  3L17 A;  2J0K A;  2ZPY A;  1Z5S B;  3QCA A;  2GBR A;  3TMP B;  1WYW B;  4KSL C;  1GC6 A;  3NHE B;  3R7Q A;  4W9J A;  3M62 B;  2JY6 A;  5J18 A;  1S1Q B;  1V81 A;  5AZH A;  4BKT A;  4GN1 A;  3TJP A;  5AEK B;  2ZZP B;  2GBM A;  4LDT B;  1VD2 A;  1EF5 A;  1V6E A;  1WGH A;  1WXV A;  4ZDV A;  3H6N A;  2RPQ A;  2NR2 A;  5D2M B;  5CHF A;  3VUX A;  4KDI C;  4K7U A;  4F1S A;  4GIV A;  2BYV E;  2KNB A;  3APD A;  5BO4 B;  3SU8 X;  3ONS A;  4GDL B;  3TL5 A;  4OVV A;  1OQY A;  2AWT A;  4HWI B;  4EZL A;  1OGW A;  2LXC A;  1XD3 B;  3IHP C;  4BBN F;  1JRU A;  3W1Y A;  1V86 A;  1WXA A;  4YL8 A;  4EUT A;  1WX9 A;  4I6N B;  1YD8 U;  4TUU A;  4X57 B;  2BF8 B;  3RCZ A;  3CSF A;  4TV3 A;  2DYB A;  1ZGU B;  2IO1 B;  2ZVO A;  3VDZ A;  2JUO A;  3WAL A;  2LI5 A;  3V6C B;  1P1A A;  4ASW C;  2KO3 A;  1OEY J;  2BKF A;  3PZD A;  5FR6 A;  3VVW B;  2JWZ A;  3KYC D;  3OJ3 A;  3N30 A;  3A9J B;  5D94 A;  2MBE A;  2ZPN A;  2WYQ A;  2K6Q A;  4F7Z A;  1WIA A;  4MSM B;  3L16 A;  3WAM A;  1E8W A;  5J17 A;  4HCP B;  4ICU A;  2XK5 B;  3JSV A;  4W9D A;  1EO6 A;  1VCB A;  2N1V A;  2G4S A;  2BWE S;  4IWO A;  2IO3 B;  2KD0 A;  4K1R B;  3L0W B;  3N3K B;  4BOS C;  2K25 A;  1RAX A;  2L7R A;  3NS8 A;  4K7W A;  4ANW A;  2MX2 A;  2BKR B;  2BPS A;  3TBL D;  2ASQ A;  1G6J A;  2FCN A;  3UGB B;  4RM8 A;  2CHX A;  4WWP A;  2HE7 A;  2MRP A;  4HLE A;  1A5R A;  1OTR B;  5JHB A;  4GXB A;  2CU1 A;  4JIO U;  4JQW C;  3KVF B;  4ZRK A;  2AYO B;  2KTR A;  2RR9 A;  2KDE B;  5EDS A;  2KDB A;  2N4F A;  2WX1 A;  4MGK E;  5DCN A;  3QX1 A;  2D11 A;  4MGZ E;  4GDL A;  1J0G A;  3APF A;  4DXA B;  4N9F 4;  1LXD A;  2KWU B;  2LGY A;  2GMI C;  2MP2 B;  3JSV B;  2MBH A;  4CHK A;  4LDT D;  3WAN A;  2PEA A;  1UGM A;  1ISN A;  1J19 A;  2GBJ A;  2LVQ A;  3A9J A;  2LGD A;  3QAR A;  2Z59 B;  2DZK A;  2KTR B;  2DZM A;  1H4R A;  2RD0 A;  2LRU A;  2RGF A;  2LVP A;  4MEM A;  4WWO A;  2GBK A;  3IVF A;  3UF8 A;  1MG8 A;  3RYT A;  2FNJ B;  3H9D A;  2O2V B;  4NJ6 A;  2LUE A;  4G0N B;  2MWS B;  3HIZ A;  4IM3 A;  3PLV A;  2J7Q B;  3LDZ E;  2L8J A;  2N9E B;  1SGH A;  3A33 B;  1WZ3 A;  1V49 A;  3RZF A;  4AJY B;  1WM3 A;  2FCS A;  2DYM A;  3K9O B;  3KUZ A;  3PRZ A;  3NY5 A;  3OAW A;  4GU2 A;  4HJK A;  2MW5 A;  4W9H A;  3VUY A;  4ANV A;  2XEW A;  3WIM A;  1KM7 A;  4HVB A;  3ZDT A;  3Q3J A;  3QJZ A;  2WX0 A;  3QK0 A;  4G11 A;  4ANU A;  2JT4 B;  3UIN B;  2HTH A;  4DHZ B;  2LAS A;  3ZNZ B;  1WXM A;  3N32 A;  3QAQ A;  1WR6 E;  2KMC A;  1E8Z A;  4DBG A;  1LFD A;  2D10 A;  1YJ1 A;  4MH0 E;  4P7I A;  4DHZ E;  1E8Y A;  3ZNG C;  3UIP B;  3RT3 B;  1C3T A;  1SE9 A;  5LXH A;  2DZI A;  2G3Q B;  2L0F A;  3WA0 A;  4LJP B;  5CHV C;  3ML8 A;  3Q3F A;  4G50 A;  4BKS A;  3ZNH B;  1UBI A;  2N9X A;  3H1U A;  1Y8R C;  2KXJ A;  5C23 A;  1KOT A;  2K6D B;  1E90 A;  3PHX B;  1T0Y A;  4W9C A;  2LVO A;  2DZJ A;  2IO0 B;  3B0A A;  3PTF C;  2EMS A;  4HK2 A;  5E6P A;  5AZF A;  1UZX B;  2NCN A;  2IO2 B;  1LQB A;  2FCM A;  1WMH B;  4WAA A;  1P0R A;  2LWP A;  2LZ6 A;  2J0M A;  4WQO B;  3K9P B;  4ZRJ A;  4HPM B;  2JRI B;  2K1F A;  2ZEQ A;  3QA8 A;  2KTF A;  1Q1O A;  2C5L C;  3S2A A;  2DHZ A;  4AOF A;  3A9K B;  3HK0 A;  5CX3 A;  3ENE A;  3EEC A;  3DCG A;  4E71 A;  1Q0W B;  2FAZ A;  2PE9 A;  3IFW B;  1WFY A;  2ZCC A;  3DVN V;  3EHV A;  2AEH A;  4II2 B;  2DAF A;  2L05 A;  3X23 A;  3VQI A;  4BKG A;  3GZN I;  2Z0D B;  2MBQ A;  5DPS A;  4ICV A;  1ZKH A;  2ZNV C;  4W9I A;  4NAW B;  1PQS A;  3KW5 B;  4GDK A;  2N1W A;  4URK A;  3M63 B;  2KZR A;  1HE8 A;  1WX8 A;  4EZJ A;  4HXD A;  3VH3 B;  3VAW A;  1GC7 A;  2M0X A;  2M1M A;  3DQV A;  4IC7 B;  3EC8 A;  5L83 A;  1WGY A;  2JPH A;  2LRW A;  1UEL A;  3ZDM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...