4FJVB

Crystal structure of human otubain2 and ubiquitin complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
DVPDYAHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase OTUB2
publication title The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 20
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4fjvB00
4W9CA 3V61A 1WXVA 4A20A 2KJRA 3UIOB 4OVVA 5J2RA 4JQWC 4EKUA 3RD2A 1WM3A 2RR9A 4NNJB 2O2VA 5JHAA 4MGZE 2R2OA 1E8WA 2ZPYA 4E74A 2J7QB 3QHTA 3GZNI 4AJYB 1E7VA 4HLEA 3ZTDA 2ZNVC 1V5OA 1UH6A 3EECA 3JW0X 2Z59B 2AL6A 2HJ8A 1YX6B 3UINB 3WAPA 4KV2A 3ZNID 2Y5BB 1GC7A 3RCZA 3ZVVA 2I1KA 2GBMA 4DHJB 4BKTA 2VRRB 3RULA 4MH0E 2YLMA 1P98A 2KOXA 3R7RA 5JH5C 2IO1B 1M94A 4F1SA 1KLVA 2MRPA 1WE7A 1FXTB 3S2AA 1WF9A 2C9WB 2G4SA 5J17A 1I35A 4K7WA 5CHFA 4B9KA 2KANA 2KNBA 1UD7A 3KH0A 2A4ZA 2B3AA 3AULA 4KIKA 2L76A 3PVLA 4MEMA 3KYCD 2AWTA 2ZCCA 4HJKA 2KN5A 4E3CA 4ZDVA 5DPTA 3VFKA 4FN2A 1ZGUB 4YL8A 2N9XA 4MM3A 4WJNA 2D11A 2KZRA 2KJHB 2KX3A 2HTHA 5LLIA 2FCQA 4N9F4 2AYOB 3RZWC 3L16A 4JIOU 4IW0A 1V81A 5G55A 2G4DB 2M1MA 3EHVA 3H6NA 3ZO5B 2K8BA 4HVBA 2N7DA 1KOTA 1YQBA 2WYQA 5C23A 4WQOB 1TBEA 2DZIA 3IBEA 1WXSA 2Z0DB 3QA8A 4DHZE 3L17A 2D07B 3M63B 3NZUA 4ZRIA 2KJ6A 2WX1A 4II2B 2ASQA 4BFRA 4NAWA 3TJPA 1WX8A 3VTWA 4F7ZA 4M8MA 3BINA 4DXAB 3DVGX 2JRIB 4GB9A 3NHEB 4ANWA 2UWQA 3QAQA 1Q1OA 2MP2B 1WYWB 1OQYA 3PPAA 1SE9A 4WAAA 4CO7A 3ZIMA 4A3PA 3ZW3A 4I6LB 2JWZA 3H7SA 3PLUA 4W9GA 4EUTA 4IWQA 2LXCA 1A5RA 4K7UA 3ECIA 3ALBA 4EZLA 4TV3A 2KDIA 4PS8A 2UYZB 2JVCA 4W9JA 4ZYNA 4JL9A 4FADA 2KMCA 3OAWA 1L2NA 4G3XB 2DAJA 2KLCA 3PHXB 1V9JA 2PE9A 2WDTB 4HDQA 4LJOB 2EKEC 2KC1A 3L54A 2CS4A 4J6IA 3P2BA 2BWES 1WGHA 3QK0A 4FLHA 3KVFB 4ICUA 4FHJA 4W9KA 1SIFA 3KUZA 4G0NB 2K8HA 3NZSA 5GMVA 3RZFA 1F9JA 3HK0A 3NS8A 3RYTA 4TQ1A 3DCGA 3TCAA 2ZVOA 2KO3A 2C60A 5CHVC 4XX5A 3H7PB 3SU8X 2KWVB 1WFYA 2DYMA 2KVRA 3M62B 4DWFA 1WXAA 3QJZA 4EFOA 4URKA 2L05A 4BVUC 4FA6A 1C1YB 5CHWA 3PRZA 2M8SA 3PZDA 4ANVA 5D6JB 3KUCB 2IY1B 2NPTA 4TUUA 4DBGA 5AEKB 4ANUA 4IWOA 4CHKA 2MBHA 4LJPB 3N32A 3R3MA 2D2QA 4HXDA 3ZRCA 3UGBB 2DX5B 3UQAA 3L13A 3RT3B 5DCNA 1OGWA 2JF5A 1WMHA 3BY4B 2BYFA 4LCDE 3W1SC 2BWFA 4MJSB 3TIXA 1E8XA 3DOWA 3MJWA 3ML9A 3EC8A 5DPWA 1Q5WB 1NBFC 2V3SA 2XBBC 2FIDA 4GDLB 3JSVB 3CSFA 2PEAA 4IUMB 5FR6A 2BYEA 2KHWB 2LGYA 2KC2A 3PREA 4K7SA 2LGDA 2MP2A 3PT2B 5DPSA 1WY8A 2KQ7A 3DVNU 2DYBA 1IYFA 1ISNA 2G45B 2N7EA 2KK8A 2JRHA 1P3QU 1R4NI 1D3ZA 3LJ3A 1KJTA 4HPLB 5TR5A 1KM7A 2GMIC 4GIVA 1WJNA 4NJ7A 1WX9A 3V6CB 3H9DA 2R2QA 2BF8B 1WR6E 1IP9A 1S3SG 4M0WB 1WGYA 1P9DU 2I1JA 2KKCA 3QCAA 2ZNVB 1WR1A 3PS6A 4IG7B 1IPGA 2LUEA 2N9PC 4WJQA 3TBLD 2BPSA 3DVGY 1RLFA 2KTFA 1UBIA 4B6WA 2JZZA 4WWPA 3VVWB 1SGHA 4MDKE 5CTRC 5G2NA 2L0TA 2FUHB 5EDSA 2KMAA 3DBLI 2FIFA 4NQLB 4P7IA 2J0JA 2MSED 1LXDA 3DQVA 1GG3A 2JY6A 3H7PA 3I3TB 2DZJA 2NPTB 1G6JA 4IM3A 1V49A 2KDBA 1K8RB 2KWUB 2MBQA 2CHZA 2RPQA 1RFAA 3AXCA 2MLBA 3B0AA 3CF6E 3KYDD 3L08A 4WJOA 1YIWA 4EEWA 4GSWA 1H4RA 1UELA 2ZCBA 3ML8A 4HWIB 5L95C 3HHMA 4BKSD 2DAFA 1WMHB 2NBUA 3K9OB 2M4NA 4PS3A 1J8CA 3TMPB 4RM9A 4BKGA 3M95A 1OTRB 2ZVNA 4W9DA 4TQ0A 3A33B 1E7UA 3PSEB 3VTUA 3VUWA 1WI0A 2LGXA 2LRWA 2KX0A 3DBRI 4MJSA 3VUXA 2LWPA 3PGEA 2K25A 1RAXA 3ZKJC 3DBHI 4G50A 1Y8RC 3B1LX 1I42A 4IC7B 2KFKB 2IO3B 3B08A 3JSVA 3Q3JA 4GDLA 4AWJA 1WZ0A 3W1SA 3WAMA 1WH3A 2GBNA 2KXJA 2G3QB 3ONSA 1EO6A 5D7GA 3LDZE 3VHTC 5E6NA 5L83A 2IYDB 3SHQA 1LFDA 4FULA 2LXAA 2D10A 4HCNB 1WXMA 2MBOA 2WX0A 2DHZA 1WM2A 2RGFA 2IO0B 3O65B 5DPRA 3UF8A 4EZJA 3GOEA 5IAAC 2KLGA 2GBRA 2CU1A 3AU5A 3APCA 3K9PB 1Z5SB 2FCMA 3JYUA 2K1FA 2MWSB 1V2YA 3ZDMC 1VCBA 4ICVA 1OEYJ 5AZHA 3WALA 1RRBA 1LQBA 1WGGA 1U4AA 2ZEQA 4W9EA 2LASA 3QC8B 4NJ6A 1TTNA 4NPNA 1WGRA 2O6VD 4WJPA 2LZ6A 3DVNV 4W9IA 4GDKA 4HK2A 5C1ZA 2K6DB 1C3TA 3CMMB 4KSLC 2L3ZA 4KVGB 2ZZPB 3EFUA 1S1QB 4IM0A 3W1YA 2FAZA 1EUVB 2KD0A 4DDID 3PTFC 3A1QA 5KHQA 2LD9A 3D32A 4KZ0A 2J0MA 1NI2A 1WE6A 5BO4B 2FCSA 5E6OA 2LJ5A 2W9NA 1AARA 4II3B 2O6VB 1L7YA 4W9LA 4BOSC 3QWZB 4I6PA 3KUDB 3OJ3A 4W9FA 2C5LC 3R7QA 2ZPNA 3ZTCA 2AEHA 2D3GA 2NVUI 4ZRKA 3SD5A 4FJYA 3VTVA 1UZXB 2OOBB 4PS7A 3PV1A 2V4LA 1HE8A 1VD2A 2DYOA 4PYUA 1PQSA 1NDDA 1V86A 3MHSD 4FHKA 4PYZA 3DBSA 2MCNB 4E71A 2KFKA 2L0FA 5IA7A 2NBVB 4EZKA 2MBEA 2LVQA 4MSQB 1TGZB 3DPDA 4AUQC 2DZKA 4GOCA 2NR2A 4DK5A 4EOYA 4BKSA 2N4FA 2CHXA 2LVOA 1XQQA 4K1RB 3DDCB 2DENB 3U30A 2BKFA 3X0WA 2HE7A 2REXA 2YVCA 2BYVE 3IFWB 1GNUA 3V62A 3WIMA 2A5UA 3X23A 1XT9B 4KSKC 3U8ZA 4JGHB 2QHOA 1QZEA 1GUAB 2L00B 1XD3B 1YX5B 1X1MA 2M0XA 4HCPB 5AZFA 2XK5B 3A4SC 3AU4A 2NBWB 1WJ6A 3ENEA 2J0KA 3IVFA 4MELA 3VAWA 3APDA 4GU2A 3H1UA 1EF5A 4GDKB 3V60A 1WRDB 2IBIB 2K6QA 4GGQA 2N9EB 3PLVA 2PPHA 1EF1A 3VH3B 2DZMA 3M3JA 2JZ3B 3T9LA 2JUOA 4XZ4A 2MW5A 3QX1A 4FJZA 1P1AA 1WX7A 3HM6X 4K81A 4WWNA 3V6EB 3A1QB 3VUYA 2KFJA 3ZDTA 3T8MA 2CR5A 2C7MB 5JHBA 2LRUA 5JZEB 2KDFB 4AP4C 5KHOA 4HDOA 4GXBA 1R4MI 3CSTA 5LXHA 2Z0EB 2AL3A 1P0RA 2MA9B 2O6VA 3A9JB 1WJUA 2K8CA 3L0WB 1V5TA 4LDTD 2KQSA 4W9HA 3Q3FA 3QQ8B 4I6NB 4GMVA 3RUIB 3OJ4B 1GJZA 4GN1A 3AI5A 1ZKHA 5E6PA 4MGIE 3MTNB 3NY5A 2IZVB 3VQIA 5HKHA 3WANA 4DHZB 4IWPA 2CKHB 4JLCA 2JT4B 1MG8A 5J18A 3UIPB 4KZCA 2FCNA 1E90A 4RM8A 1WGDA 1J19A 2MX2A 4HPMB 2V1YA 1GC6A 1TZ1A 3C0RB 3A9KA 2MBBB 1UGMA 4MGKE 2ZJDA 4MSMB 1E8ZA 3TL5A 3VDZA 2KTRA 2BKRB 4RMAA 4A3OA 4LDTB 4F8CB 4DDGD 2N1WA 2EMTA 3ZLZA 2C7NB 1Q0WB 1T0YA 1JRUA 2O2VB 4BOZB 3A4RA 1LM8B 3R66C 2OJRA 2PE6B 3ZNHB 2KDEB 1E5WA 2XK5A 4G11A 3WAOA 2LVPA 2NS5A 2EMSA 5AZGA 1H8CA 2BGFA 4NY0A 4BBNF 4ZRJA 4FBJB 2GOWA 2JXXA 5D2MB 3L10B 3IG3A 2PJHA 3PRMB 4TKNA 3ZNGC 1WZ3A 2IO2B 3VH4B 3JVZX 5LXIB 1WIAA 2N1VA 3OLMD 4KDLB 1Z2MA 4CYEA 3APFA 4X57B 2WWZA 4AOFA 2GBKA 3UQBA 4XC2A 2K39A 1E8YA 2IY0B 3N3KB 4KIKB 2L7RA 4FJVB 1YJ1A 4MGYE 2HD5B 3HM3A 2RSUA 3SDLC 3A9JA 3ZRFA 4ANXA 2NCNA 3U7DA 3VXWA 1UBQA 3WA0A 4B95A 2C7HA 1OEYA 2FNJB 1V6EA 4AJWA 1V80A 2XEWA 3HIZA 1CMXB 2RD0A 1ZW7A 4IM2A 1YD8U 3NOBA 1WJ4A 2GBJA 2MQJA 2M17A 3A9KB 3KW5B 3PHWB 3QIJA 4NQKE 2CHWA 3QARA 4WWOA 3ZUNA 2JPHA 4OVUA 2L8JA 2LI5A 1J0GA 5D94A 2KTRB 3IHPC 3PRPB 3ZNZB 1BT0A 4BBNC 4NAWB 4DHJD 3N30A 4M8NA 2KWCA 4ASWC 4KDIC 5CX3A
chains in the Genus database with same CATH superfamily
3AEBB 1WXVA 1T5XD 2KJRA 3UIOB 4OVVA 5J2RA 2K5PA 2WXLA 4E74A 2LGIA 3LYYA 1T0QC 2WDQB 2ZNVC 3EECA 1PUTA 2AL6A 1YX6B 3ZNID 3ZVVA 2Y5BB 3RCZA 2GBMA 2M19A 3RULA 3SFEB 3R7RA 1JALA 1JWUD 4P6VF 4YTMB 4S17A 3DWGC 4A8XC 1WE7A 1L6VA 1MHHE 5J17A 2G1EA 3GE3C 4K7WA 4B9KA 2KANA 2RMMA 2DBYA 5JXVA 2KN5A 4ZDVA 3VFKA 2VH1A 1ZGUB 4YL8A 2N9XA 4WURA 4MM3A 1TS3A 4WJNA 1JROA 2KZRA 2KJHB 1ZXHA 1K52A 4N9F4 3RZWC 4BZAA 2G4DB 2M1MA 3EHVA 4RFBA 1EWCA 2K8BA 2E6XA 4HVBA 1C4AA 1UUPA 5C23A 3IBEA 2DZIA 1WXSA 3QA8A 1N5WA 2BS2B 2WX1A 3C19A 3TJPA 3VTWA 3ZJUA 4DXAB 3NHEB 4LTUA 2JZPA 3PPAA 2QJLA 2PMVA 1IGCA 2BBCA 3PLUA 4EUTA 1A5RA 4K7UA 3V3XA 4EZLA 1PGAA 3IAM1 4JE3B 5C2TB 2QEJC 4NAMA 2KLCA 4HDQA 1YJIA 2PE9A 2WDTB 4XDDA 4OVZA 1E0ZA 4ICUA 2BVCA 3AEEB 3HRDD 3TCAA 2KO3A 3IT6B 4XX5A 2DYMA 1WFYA 2MJEA 4YTNB 4EFOA 2MJDA 4ANVA 5D6JB 3KUCB 2HDEA 1JWMD 4ANUA 3N1XC 2DWQA 3ZRCA 3W5UB 1KRHA 1SBBB 2BYFA 4LCDE 3TIXA 3MJWA 2D3CA 3EC8A 1Q5WB 1QOGA 3FKYA 2FUG1 1NBFC 2WXGA 2FIDA 3AE7B 3JSVB 5FR6A 2LGYA 1UWXA 2DYBA 2EKIA 2KK8A 2JRHA 1WJNA 4NJ7A 3BWUD 1WX9A 2KAJA 2R2QA 1WR6E 5BMIA 1TJEA 2KKCA 3QCAA 4RCOA 1IPGA 4HKZE 4WJQA 1NI3A 3TBLD 2BPSA 3DVGY 2H88B 2FUHB 3W2DA 5IN7A 1LXDA 3H7PA 1I4XA 3I3TB 1E10A 4USAA 2KWUB 4ASWC 3L08A 2W3SA 3CF6E 2MLBA 1YIWA 4EEWA 1H4RA 2ZCBA 3ML8A 4HWIB 3HHMA 4RGMA 2M4NA 2FBWB 2ZVNA 1L0YB 3VTUA 1WI0A 3DBRI 2QILA 2ZW0A 4DXFA 1F77A 4G50A 3B1LX 1HQRD 2L32A 4IC7B 3B08A 1WZ0A 2LGSA 3CWIA 2KXJA 3MC0B 1EO6A 2WDVB 5E6NA 1XCQL 3SHQA 4C00A 2D10A 1WXMA 2IO0B 5DPRA 1QOFA 4EZJA 3AE9B 3U4EG 3RNBC 3K9PB 1A70A 2FCMA 1YOVB 3WALA 1LQBA 1U4AA 4W9EA 2D3BA 4NJ6A 4NPNA 4WJPA 3Q2AC 4HKQA 2IGGA 3DVNV 1I4HA 4MACA 2AQ1B 1C3TA 3CMMB 1ZDXA 4KVGB 2L3ZA 2FAZA 5D3DA 4DXGA 1OQRA 2KD0A 3A1QA 1TS2A 5KHQA 2ACZB 1WE6A 5BO4B 1L7YA 2BB6A 3IT4B 4W9LA 1CQVA 3R2TA 2WLBA 3R7QA 2OOBB 4PK1A 3GB1A 2DYOA 3MHSD 4PYZA 3Q3NC 4EZKA 1MVKA 2LVQA 3DPDA 2NR2A 1UWMA 1XQQA 3DDCB 2BKFA 3EUB2 1C4PA 4C80A 2ONQA 3U8ZA 2QHOA 1QZEA 3Q8FA 3A4SC 2NBWB 4MELA 3APDA 3KWLA 2BYTA 2N9EB 3PLVA 2PPHA 1EF1A 4M02A 4OW0A 3TSSA 3QX1A 1P1AA 3HM6X 2N9KA 3W5VB 3A1QB 3NVWA 2Q5WD 2KDFB 5JZEB 2WU5B 4JWUC 2SEBD 5KHOA 1R4MI 4H2AA 3CSTA 2MA9B 3A9JB 1WJUA 3L0WB 4OZAA 1C76A 3LB8C 2KQSA 4W9HA 3U7ZA 3RUIB 2WXOA 1CZPA 2AX5A 1ZKHA 3MTNB 2IZVB 5G5HA 3VQIA 5HKHA 5EE0A 3DWMA 1EWYC 2K9XA 3VDZA 2JYEA 4A3OA 1BXTA 2C7NB 1MHXA 3KWVA 2INDC 3R66C 2PE6B 1VZ8A 2NS5A 2EMSA 5AZGA 4BBNF 4NY0A 2QDFA 3IXSA 5D2MB 3L10B 3IG3A 1WZ3A 2EELA 2ON8A 3JVZX 5LXIB 2N1VA 3OLMD 2CJNA 1Z2MA 1JWAD 3UI3A 2L1AA 3HUIA 2GLSA 4K3CA 2L7RA 1YJ1A 3CIRB 3PZ8A 3HM3A 3NS1A 2OJWA 1FEHA 2C7HA 1QOBA 1OEYA 1V80A 2XEWA 3HIZA 1CMXB 2KN4A 1ZW7A 1ZOYB 3T3NA 3PHWB 4NQKE 4CYEA 3QARA 2V9HA 3RNFC 3PRPB 1QF6A 4W9CA 3AB5A 3FILA 2FE8A 4A20A 3NRZA 4HROA 3AEAB 4EKUA 3RD2A 1QLBB 2O2VA 1E8WA 2ZPYA 4C4VA 4ZHOA 1E7VA 1V5OA 4KX6B 3AE3B 2Z59B 4REZA 3WAPA 3MC9A 1STEA 1IUEA 2VRRB 4BKTA 4MH0E 2YLMA 1P98A 2NTTA 5JH5C 1YNTE 1ESFA 3S2AA 1WF9A 3AM9A 1KF6B 1IBXB 1B1ZA 1UD7A 2A4ZA 4KIKA 2L76A 3PVLA 2Y5PA 2M56B 4OHJA 3KQ4A 4E3CA 3AE6B 2HTHA 2FCQA 4IW0A 5G55A 1UNSA 3H6NA 3ZO5B 4XYCA 1KOTA 4KKIA 2Z0DB 2D07B 4P16A 1JMLA 1ACCA 1GB4A 2KJ6A 4II2B 4NAWA 1WX8A 3FILB 4F7ZA 4RGNA 1F2RC 3DVGX 2JRIB 1FNVA 4JWSC 3QAQA 1Q1OA 2J42A 2MP2B 4C4VB 1OQYA 2WQYB 1SE9A 1SJED 2INNE 3ZIMA 3ZW3A 4I6LB 1QKZA 4IWQA 3ECIA 3ALBA 3J9CA 4TV3A 1D6EC 4KGSA 2JQRB 4PS8A 1FIQA 1NENB 4FADA 2KMCA 1L2NA 2DAJA 1V9JA 1YMHE 4J6IA 2BWES 5H8YE 5IP4D 4FHJA 2SAKA 3AH7A 3KUZA 5GMVA 3HK0A 1SE3A 1P7FA 3RYTA 2BS3B 4KGTA 2C60A 2AQ3B 5CHVC 3SU8X 1MI0A 4DWFA 3ETRA 4FA6A 1C1YB 3PZDA 1FMAD 5AEKB 4IWOA 4B0EA 3KLSX 1N61A 2MBHA 3UQAA 3RT3B 2BT6A 5DCNA 1F2RI 4KGRA 1WMHA 4B0MA 2XNAC 1KLUD 3DOWA 1L5PA 2KMMA 4GDLB 4CQNA 4LNKA 3N9YC 1J7BA 1MJDA 2K3UA 2KHWB 1AW7A 1XLNA 1WY8A 5DPSA 3ZJTA 1OQQA 1TY2A 2WXJA 1P3QU 1R4NI 1ZP0B 1T3QA 3HVDA 1KM7A 3BYYB 5T8IA 3B2FA 3C8YA 1FCLA 1BUIC 2ZNVB 4XGAB 2ICIA 3NJTA 4IG7B 5FR3A 4TMAB 1RLFA 1HEZE 4B6WA 1VZ6A 2JZZA 4WWPA 3ZYYX 4ZHPA 1SGHA 1D5XC 4MDKE 5G2NA 4HRSA 5EDSA 1XEEA 2KMAA 3DBLI 2FIFA 3DQVA 1V49A 2MBQA 1K8RB 2CHZA 2DLBA 1RFAA 4WJOA 1HTQA 1LGRA 1UELA 2UU7A 4QAYA 1KFYB 1DYQA 1WMHB 3PZ7A 4PS3A 1J8CA 4RM9A 4TQ0A 4P1CC 3PGEA 2K25A 2INPE 3P4PB 3DBHI 3WCQA 1Y8RC 3ZKJC 2IO3B 3JSVA 3WAMA 2GBNA 2G3QB 3ONSA 1GPXA 3GP7A 3LDZE 3VHTC 2N0SB 2IYDB 1I4PA 4HCNB 1XF5L 3AU5A 2GI9A 2K1FA 4LLGM 1V2YA 3ZDMC 2TSSA 1OEYJ 5AZHA 5BMGA 1L6UA 1WGGA 3H8HA 2ZEQA 1KTKA 3BK2A 2LASA 3QC8B 4N6EB 4HEA1 4A90A 2LZ6A 5IOIA 5C1ZA 3P4RB 3EFUA 2INCC 2IGDA 1FO4A 1EUVB 3BIID 2IPKD 4IOIE 3U2SC 3RFZB 3BVZA 2R61A 2LJ5A 1XLPA 4IDIA 3OJ3A 4W9FA 3V05A 3Q3OC 1ZPSA 4ZRKA 4FJYA 2V4LA 1HE8A 5IKCM 2L0FA 3NVYA 2NBVB 5IA7A 1TGZB 1WWTA 1JQ4A 2WXHA 1AN8A 4K1RB 2PW9A 2MJ3A 3DBRB 3X0WA 2REXA 5EE3A 1WYGA 3WIMA 2A5UA 4BAXA 1XT9B 1JCKB 4JGHB 3FC4A 3B9JA 1TKYA 1XD3B 1X1MA 2V3NA 2XK5B 1WJ6A 1JWSD 2J0KA 3IVFA 3MHZA 3VAWA 1R7SA 2K6QA 5AUIA 3M3JA 3T9LA 4ITKA 3VR8B 2MW5A 4WWNA 2J4XA 5C3JB 4N59A 2CR5A 2LRUA 3R8BA 1D4BA 4GXBA 1LO5D 1C77A 1JRPA 1SB3C 4HPPA 5H92C 2K8CA 3Q3FA 2BB5A 1GJZA 3AN1A 5E6PA 3NY5A 3WANA 2CKHB 2JT4B 1MG8A 3UIPB 2FCNA 1J19A 2MX2A 1V1PB 1TZ1A 2E3TA 1FRRA 1PYWD 1VLBA 4MSMB 2HJ1A 4LDTB 4F8CB 4DDGD 2PIAA 2K22A 1VR9A 1T0YA 3N1YC 4BOZB 1ROEA 1KLGD 1YJJA 3RI7C 2VZKB 2OJRA 2WXRA 2LVPA 1T0SC 3AEDB 4FBJB 3NZ3A 4RH6A 1ZE3D 3PRMB 2KT7A 1WIAA 3APFA 2LEKA 2GBKA 3UQBA 1YN4A 4XC2A 1I4QA 2K39A 4MGYE 4GLSC 3A9JA 3ZRFA 3VXWA 2HTME 2FNJB 4AS1A 4IM2A 1YD8U 2JX5A 1RM6C 2V3PA 1WJ4A 1J7AA 2M17A 4MH8A 2Y3AA 1R4MB 2WXFA 1F52A 3IHPC 4BBNC 2IDYA 3N30A 3HVZA 1N63A 1I4RA 3V61A 4JQWC 2RR9A 4NNJB 1XO3A 2RPVA 5JHAA 4MGZE 1HZ6A 2R2OA 1UF0A 1WXQA 2J7QB 3GZNI 1UH6A 3EA6A 3JW0X 1WSPA 2HJ8A 2WXNA 5HHDG 4KV2A 3UINB 1QILA 3E9SA 2KOXA 1M94A 2MRPA 1FXTB 4UDUC 1TT5B 1JWBD 5CHFA 1TS4A 1FNUA 2B3AA 2YEPB 4MEMA 3TEWA 4C7YA 3KYCD 3AE1B 3ZXVA 4HJKA 4LNFA 1E6EB 2JU6X 1VRAB 2D11A 5I4DA 2AYOB 3L16A 3OG5A 1NYRA 4Q2JA 2WYQA 3TEXA 1C9FA 3L17A 4ZRIA 4K3BA 3AV8A 2QC8A 2ASQA 4ACFA 4BFRA 1C4CA 4YTPB 3BINA 4DQOC 4GB9A 4ANWA 3W9CB 2LUMA 2UWQA 3PO0A 1WYWB 4O1NA 4WAAA 4CO7A 4A3PA 4W9GA 2LXCA 2G9HD 3Q8CA 2MHJA 2KDIA 1D5ZC 2JVCA 1WRIA 4JL9A 3OAWA 4G3XB 3PHXB 4LJOB 1VDVA 1CJEA 2EKEC 2KC1A 1FNWA 3QK0A 1WGHA 4FLHA 3P1MA 3MJ5A 1SIFA 4G0NB 2K8HA 3RZFA 1IBXA 3NS8A 3BVGA 2KVRA 3M62B 3EGRA 1WXAA 4URKA 4LNOA 2J52A 2L05A 4BVUC 2V0GA 2M8SA 3RNCC 4ZOHC 5BYSA 4TUUA 2L83A 1L0XB 3N32A 3R3MA 3Q8BA 3N1ZC 4JPSA 1EM7A 3L13A 2MEKA 1PGBA 3BYTB 3W1SC 4MJSB 1E8XA 3BK1A 3ML9A 5DPWA 2LMCA 2V3SA 2I38A 3AEFB 1FRDA 1TY0A 3CSFA 3RNAC 4IUMB 1YN5A 2BYEA 2N9LA 2D5GA 5BMHA 3PREA 4K7SA 2LGDA 2MP2A 3PT2B 4P1BC 1IYFA 1ISNA 2N7EA 2WS3B 1DOIA 5TR5A 2QCZA 3Q3MC 3H9DA 1S3SG 1P9DU 2L52A 2BS4B 1BMLC 1WR1A 3PS6A 3AE2B 4AQ7A 3DHGC 4ARIA 2WGSA 3VVWB 5CTRC 2L0TA 2QSDA 2J0JA 1C78A 3AXCA 3GS2A 4GSWA 2X38A 4S0RA 5L95C 3K9OB 2NBUA 3TMPB 4W9DA 3A33B 3P4QB 3PSEB 4J3OD 2LGXA 4D2KA 2LRWA 2KX0A 1QT9A 3VUXA 2LWPA 4ZYSA 1L4ZB 2RDBC 1I42A 1PGXA 3N20C 2GB1A 2KFKB 3Q3JA 4GDLA 1Q10A 5D7GA 5L83A 2ZW1A 1LFDA 1WGKA 4FULA 2MBOA 2WX0A 2DHZA 1MFWA 1WM2A 2RGFA 3O65B 1MPEA 3UF8A 1I7HA 3GOEA 2KLGA 2CU1A 3APCA 2PKOA 2MWSB 1B9RA 3NVZA 1VCBA 4WWMA 1HA5A 2W54A 4ZRQA 1D5MC 1RRBA 1WGRA 3URYA 2WXIA 1R4NB 4GDKA 2D3AA 2K6DB 1V1OA 4KSLC 4R3DA 2ZZPB 1SE4A 1TKEA 1OFFA 1ENFA 1S1QB 4L23A 2JYTA 4XWWA 3PTFC 3D32A 4JX1C 1SJHD 2W9NA 1ET6A 1AARA 2O6VB 1SF0A 2J53A 3QWZB 5MPOA 2MH7A 3DBLB 3ZTCA 3Q14C 2AEHA 2D3GA 2NVUI 3VTVA 1UZXB 2PVOD 1TZOA 4XWTA 1V86A 1NDDA 2MCNB 4E71A 2DZKA 4DK5A 1YQ4B 1ET9A 4EOYA 2N4FA 3P63A 4M01A 2DENB 4L2YA 2HE7A 2YVCA 3IFWB 3DBHB 2WXKA 1E9MA 4LK0M 1DOXA 1YX5B 2M0XA 4HCPB 3ENEA 2IGHA 3H1UA 1EF5A 4GDKB 2IBIB 5GXGB 1SEBD 2DZMA 2JZ3B 4XZ4A 4FJZA 1WX7A 2LJIA 4XDCA 3V6EB 1FFUA 1XCTL 2KFJA 1MG4A 2Z8LA 1V8CA 2C7MB 3GE8C 4FXCA 2WP9B 4AP4C 1QOAA 3ZJVA 4NZLB 5TSSA 4PT5A 3RNGC 1P0RA 4LDTD 4I6NB 3O13A 3OJ4B 4GN1A 4WAFA 4YSXB 3L4PA 4YWGG 4MGIE 2VZKD 4IWPA 4WH4A 1E90A 1WGDA 2DNFA 2V1YA 4HPMB 3SEBA 3A9KA 4MGKE 2ZJDA 2OHFA 2WHIA 2KTRA 2BKRB 3RNEC 3P4SB 3I5JC 5D3IB 1FPYA 1Q0WB 1JRUA 3E56A 1TKGA 3NG0A 3A4RA 3Q69A 1LM8B 2W82A 4RGOS 3ZNHB 2KDEB 2XK5A 4G11A 2X8XX 1H8CA 1GOZA 2BGFA 1M4VA 2GOWA 4TKNA 4ZRPA 3VH4B 2QMTA 3NUHB 4YSZB 3I9V1 4KDLB 2WWZA 1FD6A 4AOFA 1IGDA 2W55A 1E8YA 2IY0B 4NJCA 3EFCA 3SDLC 3LXFA 1YN3A 3ZGZA 2NCNA 4MM3B 3U7DA 1UBQA 1NEKB 3WA0A 4B95A 1V6EA 4AJWA 2CJOA 1N5XA 2RD0A 1HTOA 1P7EA 3NOBA 1GAQB 5E6JA 2MQJA 3A9KB 4YSYB 2CHWA 3ZUNA 4OVUA 1V1PA 3MP9A 5D94A 1QQRA 2KTRB 1UGJA 1K51A 2KWCA 1N62A 5CX3A 4L1BA 1KH0A 1J7CA 3Q8AA 3AE8B 1WM3A 3NVVA 3QHTA 4AJYB 3U52E 4HLEA 1FXAA 3BVMA 3ZTDA 3I57A 1GC7A 2I1KA 4DHJB 2IO1B 4F1SA 1KLVA 2KQ4X 2C9WB 4TSSA 2G4SA 4RF1A 1I35A 2KNBA 3KH0A 3AULA 3OWEB 2AWTA 2ZCCA 5DPTA 4FN2A 2M0AA 4A9AA 2KX3A 5LLIA 4JIOU 5IO9A 1V81A 3MFGA 5HG2A 4WQMA 2N7DA 2KWDA 1YQBA 2WXMA 1TBEA 4WQOB 4DHZE 3M63B 3NZUA 3ABVB 4XE0A 2WNMA 4M8MA 2JWUA 1N6ZA 3RPFC 2WXQA 1Y56A 2JWZA 3H7SA 3TEZA 4A55A 2UYZB 4ZYNA 4W9JA 1T6BX 1XLQA 3L54A 2CS4A 1PDXA 4M0WA 3P2BA 3KVFB 2N7JA 4W9KA 3NZSA 5AUKA 1F9JA 3GZNB 4TQ1A 3DCGA 2ZVOA 5G5GA 3H7PB 2KWVB 3QJZA 1ZXIA 4HJGE 1L0VB 5CHWA 3PRZA 2IY1B 2NPTA 4DBGA 4WIPA 4CHKA 4LJPB 4HXDA 2D2QA 2RDGA 3UGBB 2DX5B 4C7ZA 3Q6BA 1OGWA 2JF5A 3BY4B 1FCCC 2BWFA 2BTEA 1SXTA 2XBBC 2PEAA 3BZDB 2KACA 2KC2A 4ARCA 3SR6A 2KQ7A 3DVNU 2K0PA 1TS5A 2G45B 3VRBB 2LFIA 1D3ZA 3ZXRA 3LJ3A 1KJTA 4HPLB 2GMIC 4GIVA 1DGJA 3V6CB 2BF8B 1IP9A 4M0WB 1WGYA 1VZ7A 2VH2A 4MT5A 2I1JA 3VR9B 3VRAB 2LUEA 2N9PC 4US9A 2KTFA 1UBIA 3IAS1 1TIFA 2IJ0A 4NQLB 4P7IA 1I4GA 1XXGA 2MSED 1GG3A 2JY6A 4A6QA 2DZJA 2NPTB 1G6JA 4IM3A 2KDBA 3B0AA 4LNIA 2RPQA 1YQ3B 3KYDD 4BKSD 2DAFA 4BKGA 3M95A 1FM0D 1OTRB 3VUWA 1E7UA 2JXTA 4MJSA 1F1HA 1RAXA 4AWJA 3W1SA 1WH3A 1T0RC 2WDRB 1TYGB 2LXAA 2NMQA 3MC8A 2NTSA 5IAAC 2GBRA 5BYRA 1ZUD2 1Z5SB 3JYUA 5EE1A 4ICVA 3TEYA 3DHIC 2BQQA 1L4DB 1GB1A 1RYJA 3AE5B 1TTNA 3AMZA 2O6VD 4C56C 4RGTA 4W9IA 4HK2A 4IM0A 5LNK1 3W1YA 4DDID 1N60A 1HZ5A 4LNNA 2LD9A 4KZ0A 3DHHC 1SE2A 2J0MA 1NI2A 2FCSA 5E6OA 4KKJA 4II3B 1E7PB 5BYQA 4BOSC 4I6PA 1RFKA 3ZQ4A 3KUDB 2C5LC 2ZPNA 2KDMA 3SD5A 4PS7A 2YEPF 3PV1A 4OZCA 1K50A 1VD2A 4IKGA 4PYUA 1PQSA 4FHKA 3DBSA 2KFKA 2MBEA 4AUQC 4MSQB 3AECB 4GOCA 4BKSA 2CHXA 2LVOA 3U30A 3RMKC 2BYVE 1GNUA 4YT0B 3V62A 1FXIA 3R2IA 3X23A 4KSKC 1FFVA 2AQ2B 1F0ZA 1SIJA 1GUAB 4RF0A 2L00B 5AZFA 3AU4A 2PVGC 2BW2A 3RN9C 4GU2A 3I63C 1VJKA 2PLPA 3V60A 1WRDB 4GGQA 3VH3B 2JUOA 1EU3A 1XLOA 2KYWA 4K81A 3FAHA 3VUYA 3ZDTA 3T8MA 2WU2B 4N58A 5JHBA 2QIEB 4HDOA 2B76B 5LXHA 2Z0EB 2AL3A 2O6VA 3TUOA 2GRIA 1V5TA 4US8A 5EE9A 4YXDB 4RNAA 3QQ8B 2Y5CA 4GMVA 3P42A 3Q8EA 2LHEA 1RWSA 5FKAC 2V4IB 3AI5A 2I2YA 4DHZB 4JLCA 4M00A 5J18A 4KZCA 1K53A 2W3RA 4RM8A 3T3OA 3AEGB 1GC6A 3C0RB 2MBBB 1UGMA 1EU4A 1E8ZA 3TL5A 4RMAA 2OEDA 2N1WA 2EMTA 3ZLZA 2O2VB 1AWDA 2LHDA 1SSNA 1C79A 1E5WA 2CU3A 5HI1A 3WAOA 1CK1A 4ZRJA 2JXXA 5HFYA 2PJHA 3ZNGC 2IO2B 2PTLA 3B2GA 3AE4B 2RDHA 4X57B 1NVID 3SFDB 1V97A 3N3KB 4KIKB 1ZDVA 2H89B 4FJVB 2HD5B 2RSUA 2JSVX 4ANXA 1AYFA 1DOYA 1HXYD 1PFDA 4OZBA 5FK9C 2GBJA 3QIJA 3KW5B 4WWOA 2JPHA 2XN9C 2L8JA 2LI5A 1J0GA 1NYQA 3ZNZB 1BT0A 1JW9D 4NAWB 4DHJD 2WXPA 4M8NA 4KDIC 2KVZA 4EE2A
chains in the Genus database with same CATH topology
4W9CA 3V61A 1WXVA 4A20A 2KJRA 3UIOB 4OVVA 5J2RA 4JQWC 4EKUA 3RD2A 1WM3A 2RR9A 4NNJB 2O2VA 5JHAA 4MGZE 2R2OA 1E8WA 2ZPYA 4E74A 2J7QB 3QHTA 3GZNI 4AJYB 1E7VA 4HLEA 3ZTDA 2ZNVC 1V5OA 1UH6A 3EECA 3JW0X 2Z59B 2AL6A 2HJ8A 1YX6B 3UINB 3WAPA 4KV2A 3ZNID 2Y5BB 1GC7A 3RCZA 3ZVVA 2I1KA 2GBMA 4DHJB 4BKTA 2VRRB 3RULA 4MH0E 2YLMA 1P98A 2KOXA 3R7RA 5JH5C 2IO1B 1M94A 4F1SA 1KLVA 2MRPA 1WE7A 1FXTB 3S2AA 1WF9A 2C9WB 2G4SA 5J17A 1I35A 4K7WA 5CHFA 4B9KA 2KANA 2KNBA 1UD7A 3KH0A 2A4ZA 2B3AA 3AULA 4KIKA 2L76A 3PVLA 4MEMA 3KYCD 2AWTA 2ZCCA 4HJKA 2KN5A 4E3CA 4ZDVA 5DPTA 3VFKA 4FN2A 1ZGUB 4YL8A 2N9XA 4MM3A 4WJNA 2D11A 2KZRA 2KJHB 2KX3A 2HTHA 5LLIA 2FCQA 4N9F4 2AYOB 3RZWC 3L16A 4JIOU 4IW0A 1V81A 5G55A 2G4DB 2M1MA 3EHVA 3H6NA 3ZO5B 2K8BA 4HVBA 2N7DA 1KOTA 1YQBA 2WYQA 5C23A 4WQOB 1TBEA 2DZIA 3IBEA 1WXSA 2Z0DB 3QA8A 4DHZE 3L17A 2D07B 3M63B 3NZUA 4ZRIA 2KJ6A 2WX1A 4II2B 2ASQA 4BFRA 4NAWA 3TJPA 1WX8A 3VTWA 4F7ZA 4M8MA 3BINA 4DXAB 3DVGX 2JRIB 4GB9A 3NHEB 4ANWA 2UWQA 3QAQA 1Q1OA 2MP2B 1WYWB 1OQYA 3PPAA 1SE9A 4WAAA 4CO7A 3ZIMA 4A3PA 3ZW3A 4I6LB 2JWZA 3H7SA 3PLUA 4W9GA 4EUTA 4IWQA 2LXCA 1A5RA 4K7UA 3ECIA 3ALBA 4EZLA 4TV3A 2KDIA 4PS8A 2UYZB 2JVCA 4W9JA 4ZYNA 4JL9A 4FADA 2KMCA 3OAWA 1L2NA 4G3XB 2DAJA 2KLCA 3PHXB 1V9JA 2PE9A 2WDTB 4HDQA 4LJOB 2EKEC 2KC1A 3L54A 2CS4A 4J6IA 3P2BA 2BWES 1WGHA 3QK0A 4FLHA 3KVFB 4ICUA 4FHJA 4W9KA 1SIFA 3KUZA 4G0NB 2K8HA 3NZSA 5GMVA 3RZFA 1F9JA 3HK0A 3NS8A 3RYTA 4TQ1A 3DCGA 3TCAA 2ZVOA 2KO3A 2C60A 5CHVC 4XX5A 3H7PB 3SU8X 2KWVB 1WFYA 2DYMA 2KVRA 3M62B 4DWFA 1WXAA 3QJZA 4EFOA 4URKA 2L05A 4BVUC 4FA6A 1C1YB 5CHWA 3PRZA 2M8SA 3PZDA 4ANVA 5D6JB 3KUCB 2IY1B 2NPTA 4TUUA 4DBGA 5AEKB 4ANUA 4IWOA 4CHKA 2MBHA 4LJPB 3N32A 3R3MA 2D2QA 4HXDA 3ZRCA 3UGBB 2DX5B 3UQAA 3L13A 3RT3B 5DCNA 1OGWA 2JF5A 1WMHA 3BY4B 2BYFA 4LCDE 3W1SC 2BWFA 4MJSB 3TIXA 1E8XA 3DOWA 3MJWA 3ML9A 3EC8A 5DPWA 1Q5WB 1NBFC 2V3SA 2XBBC 2FIDA 4GDLB 3JSVB 3CSFA 2PEAA 4IUMB 5FR6A 2BYEA 2KHWB 2LGYA 2KC2A 3PREA 4K7SA 2LGDA 2MP2A 3PT2B 5DPSA 1WY8A 2KQ7A 3DVNU 2DYBA 1IYFA 1ISNA 2G45B 2N7EA 2KK8A 2JRHA 1P3QU 1R4NI 1D3ZA 3LJ3A 1KJTA 4HPLB 5TR5A 1KM7A 2GMIC 4GIVA 1WJNA 4NJ7A 1WX9A 3V6CB 3H9DA 2R2QA 2BF8B 1WR6E 1IP9A 1S3SG 4M0WB 1WGYA 1P9DU 2I1JA 2KKCA 3QCAA 2ZNVB 1WR1A 3PS6A 4IG7B 1IPGA 2LUEA 2N9PC 4WJQA 3TBLD 2BPSA 3DVGY 1RLFA 2KTFA 1UBIA 4B6WA 2JZZA 4WWPA 3VVWB 1SGHA 4MDKE 5CTRC 5G2NA 2L0TA 2FUHB 5EDSA 2KMAA 3DBLI 2FIFA 4NQLB 4P7IA 2J0JA 2MSED 1LXDA 3DQVA 1GG3A 2JY6A 3H7PA 3I3TB 2DZJA 2NPTB 1G6JA 4IM3A 1V49A 2KDBA 1K8RB 2KWUB 2MBQA 2CHZA 2RPQA 1RFAA 3AXCA 2MLBA 3B0AA 3CF6E 3KYDD 3L08A 4WJOA 1YIWA 4EEWA 4GSWA 1H4RA 1UELA 2ZCBA 3ML8A 4HWIB 5L95C 3HHMA 4BKSD 2DAFA 1WMHB 2NBUA 3K9OB 2M4NA 4PS3A 1J8CA 3TMPB 4RM9A 4BKGA 3M95A 1OTRB 2ZVNA 4W9DA 4TQ0A 3A33B 1E7UA 3PSEB 3VTUA 3VUWA 1WI0A 2LGXA 2LRWA 2KX0A 3DBRI 4MJSA 3VUXA 2LWPA 3PGEA 2K25A 1RAXA 3ZKJC 3DBHI 4G50A 1Y8RC 3B1LX 1I42A 4IC7B 2KFKB 2IO3B 3B08A 3JSVA 3Q3JA 4GDLA 4AWJA 1WZ0A 3W1SA 3WAMA 1WH3A 2GBNA 2KXJA 2G3QB 3ONSA 1EO6A 5D7GA 3LDZE 3VHTC 5E6NA 5L83A 2IYDB 3SHQA 1LFDA 4FULA 2LXAA 2D10A 4HCNB 1WXMA 2MBOA 2WX0A 2DHZA 1WM2A 2RGFA 2IO0B 3O65B 5DPRA 3UF8A 4EZJA 3GOEA 5IAAC 2KLGA 2GBRA 2CU1A 3AU5A 3APCA 3K9PB 1Z5SB 2FCMA 3JYUA 2K1FA 2MWSB 1V2YA 3ZDMC 1VCBA 4ICVA 1OEYJ 5AZHA 3WALA 1RRBA 1LQBA 1WGGA 1U4AA 2ZEQA 4W9EA 2LASA 3QC8B 4NJ6A 1TTNA 4NPNA 1WGRA 2O6VD 4WJPA 2LZ6A 3DVNV 4W9IA 4GDKA 4HK2A 5C1ZA 2K6DB 1C3TA 3CMMB 4KSLC 2L3ZA 4KVGB 2ZZPB 3EFUA 1S1QB 4IM0A 3W1YA 2FAZA 1EUVB 2KD0A 4DDID 3PTFC 3A1QA 5KHQA 2LD9A 3D32A 4KZ0A 2J0MA 1NI2A 1WE6A 5BO4B 2FCSA 5E6OA 2LJ5A 2W9NA 1AARA 4II3B 2O6VB 1L7YA 4W9LA 4BOSC 3QWZB 4I6PA 3KUDB 3OJ3A 4W9FA 2C5LC 3R7QA 2ZPNA 3ZTCA 2AEHA 2D3GA 2NVUI 4ZRKA 3SD5A 4FJYA 3VTVA 1UZXB 2OOBB 4PS7A 3PV1A 2V4LA 1HE8A 1VD2A 2DYOA 4PYUA 1PQSA 1NDDA 1V86A 3MHSD 4FHKA 4PYZA 3DBSA 2MCNB 4E71A 2KFKA 2L0FA 5IA7A 2NBVB 4EZKA 2MBEA 2LVQA 4MSQB 1TGZB 3DPDA 4AUQC 2DZKA 4GOCA 2NR2A 4DK5A 4EOYA 4BKSA 2N4FA 2CHXA 2LVOA 1XQQA 4K1RB 3DDCB 2DENB 3U30A 2BKFA 3X0WA 2HE7A 2REXA 2YVCA 2BYVE 3IFWB 1GNUA 3V62A 3WIMA 2A5UA 3X23A 1XT9B 4KSKC 3U8ZA 4JGHB 2QHOA 1QZEA 1GUAB 2L00B 1XD3B 1YX5B 1X1MA 2M0XA 4HCPB 5AZFA 2XK5B 3A4SC 3AU4A 2NBWB 1WJ6A 3ENEA 2J0KA 3IVFA 4MELA 3VAWA 3APDA 4GU2A 3H1UA 1EF5A 4GDKB 3V60A 1WRDB 2IBIB 2K6QA 4GGQA 2N9EB 3PLVA 2PPHA 1EF1A 3VH3B 2DZMA 3M3JA 2JZ3B 3T9LA 2JUOA 4XZ4A 2MW5A 3QX1A 4FJZA 1P1AA 1WX7A 3HM6X 4K81A 4WWNA 3V6EB 3A1QB 3VUYA 2KFJA 3ZDTA 3T8MA 2CR5A 2C7MB 5JHBA 2LRUA 5JZEB 2KDFB 4AP4C 5KHOA 4HDOA 4GXBA 1R4MI 3CSTA 5LXHA 2Z0EB 2AL3A 1P0RA 2MA9B 2O6VA 3A9JB 1WJUA 2K8CA 3L0WB 1V5TA 4LDTD 2KQSA 4W9HA 3Q3FA 3QQ8B 4I6NB 4GMVA 3RUIB 3OJ4B 1GJZA 4GN1A 3AI5A 1ZKHA 5E6PA 4MGIE 3MTNB 3NY5A 2IZVB 3VQIA 5HKHA 3WANA 4DHZB 4IWPA 2CKHB 4JLCA 2JT4B 1MG8A 5J18A 3UIPB 4KZCA 2FCNA 1E90A 4RM8A 1WGDA 1J19A 2MX2A 4HPMB 2V1YA 1GC6A 1TZ1A 3C0RB 3A9KA 2MBBB 1UGMA 4MGKE 2ZJDA 4MSMB 1E8ZA 3TL5A 3VDZA 2KTRA 2BKRB 4RMAA 4A3OA 4LDTB 4F8CB 4DDGD 2N1WA 2EMTA 3ZLZA 2C7NB 1Q0WB 1T0YA 1JRUA 2O2VB 4BOZB 3A4RA 1LM8B 3R66C 2OJRA 2PE6B 3ZNHB 2KDEB 1E5WA 2XK5A 4G11A 3WAOA 2LVPA 2NS5A 2EMSA 5AZGA 1H8CA 2BGFA 4NY0A 4BBNF 4ZRJA 4FBJB 2GOWA 2JXXA 5D2MB 3L10B 3IG3A 2PJHA 3PRMB 4TKNA 3ZNGC 1WZ3A 2IO2B 3VH4B 3JVZX 5LXIB 1WIAA 2N1VA 3OLMD 4KDLB 1Z2MA 4CYEA 3APFA 4X57B 2WWZA 4AOFA 2GBKA 3UQBA 4XC2A 2K39A 1E8YA 2IY0B 3N3KB 4KIKB 2L7RA 4FJVB 1YJ1A 4MGYE 2HD5B 3HM3A 2RSUA 3SDLC 3A9JA 3ZRFA 4ANXA 2NCNA 3U7DA 3VXWA 1UBQA 3WA0A 4B95A 2C7HA 1OEYA 2FNJB 1V6EA 4AJWA 1V80A 2XEWA 3HIZA 1CMXB 2RD0A 1ZW7A 4IM2A 1YD8U 3NOBA 1WJ4A 2GBJA 2MQJA 2M17A 3A9KB 3KW5B 3PHWB 3QIJA 4NQKE 2CHWA 3QARA 4WWOA 3ZUNA 2JPHA 4OVUA 2L8JA 2LI5A 1J0GA 5D94A 2KTRB 3IHPC 3PRPB 3ZNZB 1BT0A 4BBNC 4NAWB 4DHJD 3N30A 4M8NA 2KWCA 4ASWC 4KDIC 5CX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9C A;  3V61 A;  1WXV A;  4A20 A;  2KJR A;  3UIO B;  4OVV A;  5J2R A;  4JQW C;  4EKU A;  3RD2 A;  1WM3 A;  2RR9 A;  4NNJ B;  2O2V A;  5JHA A;  4MGZ E;  2R2O A;  1E8W A;  2ZPY A;  4E74 A;  2J7Q B;  3QHT A;  3GZN I;  4AJY B;  1E7V A;  4HLE A;  3ZTD A;  2ZNV C;  1V5O A;  1UH6 A;  3EEC A;  3JW0 X;  2Z59 B;  2AL6 A;  2HJ8 A;  1YX6 B;  3UIN B;  3WAP A;  4KV2 A;  3ZNI D;  2Y5B B;  1GC7 A;  3RCZ A;  3ZVV A;  2I1K A;  2GBM A;  4DHJ B;  4BKT A;  2VRR B;  3RUL A;  4MH0 E;  2YLM A;  1P98 A;  2KOX A;  3R7R A;  5JH5 C;  2IO1 B;  1M94 A;  4F1S A;  1KLV A;  2MRP A;  1WE7 A;  1FXT B;  3S2A A;  1WF9 A;  2C9W B;  2G4S A;  5J17 A;  1I35 A;  4K7W A;  5CHF A;  4B9K A;  2KAN A;  2KNB A;  1UD7 A;  3KH0 A;  2A4Z A;  2B3A A;  3AUL A;  4KIK A;  2L76 A;  3PVL A;  4MEM A;  3KYC D;  2AWT A;  2ZCC A;  4HJK A;  2KN5 A;  4E3C A;  4ZDV A;  5DPT A;  3VFK A;  4FN2 A;  1ZGU B;  4YL8 A;  2N9X A;  4MM3 A;  4WJN A;  2D11 A;  2KZR A;  2KJH B;  2KX3 A;  2HTH A;  5LLI A;  2FCQ A;  4N9F 4;  2AYO B;  3RZW C;  3L16 A;  4JIO U;  4IW0 A;  1V81 A;  5G55 A;  2G4D B;  2M1M A;  3EHV A;  3H6N A;  3ZO5 B;  2K8B A;  4HVB A;  2N7D A;  1KOT A;  1YQB A;  2WYQ A;  5C23 A;  4WQO B;  1TBE A;  2DZI A;  3IBE A;  1WXS A;  2Z0D B;  3QA8 A;  4DHZ E;  3L17 A;  2D07 B;  3M63 B;  3NZU A;  4ZRI A;  2KJ6 A;  2WX1 A;  4II2 B;  2ASQ A;  4BFR A;  4NAW A;  3TJP A;  1WX8 A;  3VTW A;  4F7Z A;  4M8M A;  3BIN A;  4DXA B;  3DVG X;  2JRI B;  4GB9 A;  3NHE B;  4ANW A;  2UWQ A;  3QAQ A;  1Q1O A;  2MP2 B;  1WYW B;  1OQY A;  3PPA A;  1SE9 A;  4WAA A;  4CO7 A;  3ZIM A;  4A3P A;  3ZW3 A;  4I6L B;  2JWZ A;  3H7S A;  3PLU A;  4W9G A;  4EUT A;  4IWQ A;  2LXC A;  1A5R A;  4K7U A;  3ECI A;  3ALB A;  4EZL A;  4TV3 A;  2KDI A;  4PS8 A;  2UYZ B;  2JVC A;  4W9J A;  4ZYN A;  4JL9 A;  4FAD A;  2KMC A;  3OAW A;  1L2N A;  4G3X B;  2DAJ A;  2KLC A;  3PHX B;  1V9J A;  2PE9 A;  2WDT B;  4HDQ A;  4LJO B;  2EKE C;  2KC1 A;  3L54 A;  2CS4 A;  4J6I A;  3P2B A;  2BWE S;  1WGH A;  3QK0 A;  4FLH A;  3KVF B;  4ICU A;  4FHJ A;  4W9K A;  1SIF A;  3KUZ A;  4G0N B;  2K8H A;  3NZS A;  5GMV A;  3RZF A;  1F9J A;  3HK0 A;  3NS8 A;  3RYT A;  4TQ1 A;  3DCG A;  3TCA A;  2ZVO A;  2KO3 A;  2C60 A;  5CHV C;  4XX5 A;  3H7P B;  3SU8 X;  2KWV B;  1WFY A;  2DYM A;  2KVR A;  3M62 B;  4DWF A;  1WXA A;  3QJZ A;  4EFO A;  4URK A;  2L05 A;  4BVU C;  4FA6 A;  1C1Y B;  5CHW A;  3PRZ A;  2M8S A;  3PZD A;  4ANV A;  5D6J B;  3KUC B;  2IY1 B;  2NPT A;  4TUU A;  4DBG A;  5AEK B;  4ANU A;  4IWO A;  4CHK A;  2MBH A;  4LJP B;  3N32 A;  3R3M A;  2D2Q A;  4HXD A;  3ZRC A;  3UGB B;  2DX5 B;  3UQA A;  3L13 A;  3RT3 B;  5DCN A;  1OGW A;  2JF5 A;  1WMH A;  3BY4 B;  2BYF A;  4LCD E;  3W1S C;  2BWF A;  4MJS B;  3TIX A;  1E8X A;  3DOW A;  3MJW A;  3ML9 A;  3EC8 A;  5DPW A;  1Q5W B;  1NBF C;  2V3S A;  2XBB C;  2FID A;  4GDL B;  3JSV B;  3CSF A;  2PEA A;  4IUM B;  5FR6 A;  2BYE A;  2KHW B;  2LGY A;  2KC2 A;  3PRE A;  4K7S A;  2LGD A;  2MP2 A;  3PT2 B;  5DPS A;  1WY8 A;  2KQ7 A;  3DVN U;  2DYB A;  1IYF A;  1ISN A;  2G45 B;  2N7E A;  2KK8 A;  2JRH A;  1P3Q U;  1R4N I;  1D3Z A;  3LJ3 A;  1KJT A;  4HPL B;  5TR5 A;  1KM7 A;  2GMI C;  4GIV A;  1WJN A;  4NJ7 A;  1WX9 A;  3V6C B;  3H9D A;  2R2Q A;  2BF8 B;  1WR6 E;  1IP9 A;  1S3S G;  4M0W B;  1WGY A;  1P9D U;  2I1J A;  2KKC A;  3QCA A;  2ZNV B;  1WR1 A;  3PS6 A;  4IG7 B;  1IPG A;  2LUE A;  2N9P C;  4WJQ A;  3TBL D;  2BPS A;  3DVG Y;  1RLF A;  2KTF A;  1UBI A;  4B6W A;  2JZZ A;  4WWP A;  3VVW B;  1SGH A;  4MDK E;  5CTR C;  5G2N A;  2L0T A;  2FUH B;  5EDS A;  2KMA A;  3DBL I;  2FIF A;  4NQL B;  4P7I A;  2J0J A;  2MSE D;  1LXD A;  3DQV A;  1GG3 A;  2JY6 A;  3H7P A;  3I3T B;  2DZJ A;  2NPT B;  1G6J A;  4IM3 A;  1V49 A;  2KDB A;  1K8R B;  2KWU B;  2MBQ A;  2CHZ A;  2RPQ A;  1RFA A;  3AXC A;  2MLB A;  3B0A A;  3CF6 E;  3KYD D;  3L08 A;  4WJO A;  1YIW A;  4EEW A;  4GSW A;  1H4R A;  1UEL A;  2ZCB A;  3ML8 A;  4HWI B;  5L95 C;  3HHM A;  4BKS D;  2DAF A;  1WMH B;  2NBU A;  3K9O B;  2M4N A;  4PS3 A;  1J8C A;  3TMP B;  4RM9 A;  4BKG A;  3M95 A;  1OTR B;  2ZVN A;  4W9D A;  4TQ0 A;  3A33 B;  1E7U A;  3PSE B;  3VTU A;  3VUW A;  1WI0 A;  2LGX A;  2LRW A;  2KX0 A;  3DBR I;  4MJS A;  3VUX A;  2LWP A;  3PGE A;  2K25 A;  1RAX A;  3ZKJ C;  3DBH I;  4G50 A;  1Y8R C;  3B1L X;  1I42 A;  4IC7 B;  2KFK B;  2IO3 B;  3B08 A;  3JSV A;  3Q3J A;  4GDL A;  4AWJ A;  1WZ0 A;  3W1S A;  3WAM A;  1WH3 A;  2GBN A;  2KXJ A;  2G3Q B;  3ONS A;  1EO6 A;  5D7G A;  3LDZ E;  3VHT C;  5E6N A;  5L83 A;  2IYD B;  3SHQ A;  1LFD A;  4FUL A;  2LXA A;  2D10 A;  4HCN B;  1WXM A;  2MBO A;  2WX0 A;  2DHZ A;  1WM2 A;  2RGF A;  2IO0 B;  3O65 B;  5DPR A;  3UF8 A;  4EZJ A;  3GOE A;  5IAA C;  2KLG A;  2GBR A;  2CU1 A;  3AU5 A;  3APC A;  3K9P B;  1Z5S B;  2FCM A;  3JYU A;  2K1F A;  2MWS B;  1V2Y A;  3ZDM C;  1VCB A;  4ICV A;  1OEY J;  5AZH A;  3WAL A;  1RRB A;  1LQB A;  1WGG A;  1U4A A;  2ZEQ A;  4W9E A;  2LAS A;  3QC8 B;  4NJ6 A;  1TTN A;  4NPN A;  1WGR A;  2O6V D;  4WJP A;  2LZ6 A;  3DVN V;  4W9I A;  4GDK A;  4HK2 A;  5C1Z A;  2K6D B;  1C3T A;  3CMM B;  4KSL C;  2L3Z A;  4KVG B;  2ZZP B;  3EFU A;  1S1Q B;  4IM0 A;  3W1Y A;  2FAZ A;  1EUV B;  2KD0 A;  4DDI D;  3PTF C;  3A1Q A;  5KHQ A;  2LD9 A;  3D32 A;  4KZ0 A;  2J0M A;  1NI2 A;  1WE6 A;  5BO4 B;  2FCS A;  5E6O A;  2LJ5 A;  2W9N A;  1AAR A;  4II3 B;  2O6V B;  1L7Y A;  4W9L A;  4BOS C;  3QWZ B;  4I6P A;  3KUD B;  3OJ3 A;  4W9F A;  2C5L C;  3R7Q A;  2ZPN A;  3ZTC A;  2AEH A;  2D3G A;  2NVU I;  4ZRK A;  3SD5 A;  4FJY A;  3VTV A;  1UZX B;  2OOB B;  4PS7 A;  3PV1 A;  2V4L A;  1HE8 A;  1VD2 A;  2DYO A;  4PYU A;  1PQS A;  1NDD A;  1V86 A;  3MHS D;  4FHK A;  4PYZ A;  3DBS A;  2MCN B;  4E71 A;  2KFK A;  2L0F A;  5IA7 A;  2NBV B;  4EZK A;  2MBE A;  2LVQ A;  4MSQ B;  1TGZ B;  3DPD A;  4AUQ C;  2DZK A;  4GOC A;  2NR2 A;  4DK5 A;  4EOY A;  4BKS A;  2N4F A;  2CHX A;  2LVO A;  1XQQ A;  4K1R B;  3DDC B;  2DEN B;  3U30 A;  2BKF A;  3X0W A;  2HE7 A;  2REX A;  2YVC A;  2BYV E;  3IFW B;  1GNU A;  3V62 A;  3WIM A;  2A5U A;  3X23 A;  1XT9 B;  4KSK C;  3U8Z A;  4JGH B;  2QHO A;  1QZE A;  1GUA B;  2L00 B;  1XD3 B;  1YX5 B;  1X1M A;  2M0X A;  4HCP B;  5AZF A;  2XK5 B;  3A4S C;  3AU4 A;  2NBW B;  1WJ6 A;  3ENE A;  2J0K A;  3IVF A;  4MEL A;  3VAW A;  3APD A;  4GU2 A;  3H1U A;  1EF5 A;  4GDK B;  3V60 A;  1WRD B;  2IBI B;  2K6Q A;  4GGQ A;  2N9E B;  3PLV A;  2PPH A;  1EF1 A;  3VH3 B;  2DZM A;  3M3J A;  2JZ3 B;  3T9L A;  2JUO A;  4XZ4 A;  2MW5 A;  3QX1 A;  4FJZ A;  1P1A A;  1WX7 A;  3HM6 X;  4K81 A;  4WWN A;  3V6E B;  3A1Q B;  3VUY A;  2KFJ A;  3ZDT A;  3T8M A;  2CR5 A;  2C7M B;  5JHB A;  2LRU A;  5JZE B;  2KDF B;  4AP4 C;  5KHO A;  4HDO A;  4GXB A;  1R4M I;  3CST A;  5LXH A;  2Z0E B;  2AL3 A;  1P0R A;  2MA9 B;  2O6V A;  3A9J B;  1WJU A;  2K8C A;  3L0W B;  1V5T A;  4LDT D;  2KQS A;  4W9H A;  3Q3F A;  3QQ8 B;  4I6N B;  4GMV A;  3RUI B;  3OJ4 B;  1GJZ A;  4GN1 A;  3AI5 A;  1ZKH A;  5E6P A;  4MGI E;  3MTN B;  3NY5 A;  2IZV B;  3VQI A;  5HKH A;  3WAN A;  4DHZ B;  4IWP A;  2CKH B;  4JLC A;  2JT4 B;  1MG8 A;  5J18 A;  3UIP B;  4KZC A;  2FCN A;  1E90 A;  4RM8 A;  1WGD A;  1J19 A;  2MX2 A;  4HPM B;  2V1Y A;  1GC6 A;  1TZ1 A;  3C0R B;  3A9K A;  2MBB B;  1UGM A;  4MGK E;  2ZJD A;  4MSM B;  1E8Z A;  3TL5 A;  3VDZ A;  2KTR A;  2BKR B;  4RMA A;  4A3O A;  4LDT B;  4F8C B;  4DDG D;  2N1W A;  2EMT A;  3ZLZ A;  2C7N B;  1Q0W B;  1T0Y A;  1JRU A;  2O2V B;  4BOZ B;  3A4R A;  1LM8 B;  3R66 C;  2OJR A;  2PE6 B;  3ZNH B;  2KDE B;  1E5W A;  2XK5 A;  4G11 A;  3WAO A;  2LVP A;  2NS5 A;  2EMS A;  5AZG A;  1H8C A;  2BGF A;  4NY0 A;  4BBN F;  4ZRJ A;  4FBJ B;  2GOW A;  2JXX A;  5D2M B;  3L10 B;  3IG3 A;  2PJH A;  3PRM B;  4TKN A;  3ZNG C;  1WZ3 A;  2IO2 B;  3VH4 B;  3JVZ X;  5LXI B;  1WIA A;  2N1V A;  3OLM D;  4KDL B;  1Z2M A;  4CYE A;  3APF A;  4X57 B;  2WWZ A;  4AOF A;  2GBK A;  3UQB A;  4XC2 A;  2K39 A;  1E8Y A;  2IY0 B;  3N3K B;  4KIK B;  2L7R A;  4FJV B;  1YJ1 A;  4MGY E;  2HD5 B;  3HM3 A;  2RSU A;  3SDL C;  3A9J A;  3ZRF A;  4ANX A;  2NCN A;  3U7D A;  3VXW A;  1UBQ A;  3WA0 A;  4B95 A;  2C7H A;  1OEY A;  2FNJ B;  1V6E A;  4AJW A;  1V80 A;  2XEW A;  3HIZ A;  1CMX B;  2RD0 A;  1ZW7 A;  4IM2 A;  1YD8 U;  3NOB A;  1WJ4 A;  2GBJ A;  2MQJ A;  2M17 A;  3A9K B;  3KW5 B;  3PHW B;  3QIJ A;  4NQK E;  2CHW A;  3QAR A;  4WWO A;  3ZUN A;  2JPH A;  4OVU A;  2L8J A;  2LI5 A;  1J0G A;  5D94 A;  2KTR B;  3IHP C;  3PRP B;  3ZNZ B;  1BT0 A;  4BBN C;  4NAW B;  4DHJ D;  3N30 A;  4M8N A;  2KWC A;  4ASW C;  4KDI C;  5CX3 A; 
#chains in the Genus database with same CATH topology
 3AEB B;  1WXV A;  1T5X D;  2KJR A;  3UIO B;  4OVV A;  5J2R A;  2K5P A;  2WXL A;  4E74 A;  2LGI A;  3LYY A;  1T0Q C;  2WDQ B;  2ZNV C;  3EEC A;  1PUT A;  2AL6 A;  1YX6 B;  3ZNI D;  3ZVV A;  2Y5B B;  3RCZ A;  2GBM A;  2M19 A;  3RUL A;  3SFE B;  3R7R A;  1JAL A;  1JWU D;  4P6V F;  4YTM B;  4S17 A;  3DWG C;  4A8X C;  1WE7 A;  1L6V A;  1MHH E;  5J17 A;  2G1E A;  3GE3 C;  4K7W A;  4B9K A;  2KAN A;  2RMM A;  2DBY A;  5JXV A;  2KN5 A;  4ZDV A;  3VFK A;  2VH1 A;  1ZGU B;  4YL8 A;  2N9X A;  4WUR A;  4MM3 A;  1TS3 A;  4WJN A;  1JRO A;  2KZR A;  2KJH B;  1ZXH A;  1K52 A;  4N9F 4;  3RZW C;  4BZA A;  2G4D B;  2M1M A;  3EHV A;  4RFB A;  1EWC A;  2K8B A;  2E6X A;  4HVB A;  1C4A A;  1UUP A;  5C23 A;  3IBE A;  2DZI A;  1WXS A;  3QA8 A;  1N5W A;  2BS2 B;  2WX1 A;  3C19 A;  3TJP A;  3VTW A;  3ZJU A;  4DXA B;  3NHE B;  4LTU A;  2JZP A;  3PPA A;  2QJL A;  2PMV A;  1IGC A;  2BBC A;  3PLU A;  4EUT A;  1A5R A;  4K7U A;  3V3X A;  4EZL A;  1PGA A;  3IAM 1;  4JE3 B;  5C2T B;  2QEJ C;  4NAM A;  2KLC A;  4HDQ A;  1YJI A;  2PE9 A;  2WDT B;  4XDD A;  4OVZ A;  1E0Z A;  4ICU A;  2BVC A;  3AEE B;  3HRD D;  3TCA A;  2KO3 A;  3IT6 B;  4XX5 A;  2DYM A;  1WFY A;  2MJE A;  4YTN B;  4EFO A;  2MJD A;  4ANV A;  5D6J B;  3KUC B;  2HDE A;  1JWM D;  4ANU A;  3N1X C;  2DWQ A;  3ZRC A;  3W5U B;  1KRH A;  1SBB B;  2BYF A;  4LCD E;  3TIX A;  3MJW A;  2D3C A;  3EC8 A;  1Q5W B;  1QOG A;  3FKY A;  2FUG 1;  1NBF C;  2WXG A;  2FID A;  3AE7 B;  3JSV B;  5FR6 A;  2LGY A;  1UWX A;  2DYB A;  2EKI A;  2KK8 A;  2JRH A;  1WJN A;  4NJ7 A;  3BWU D;  1WX9 A;  2KAJ A;  2R2Q A;  1WR6 E;  5BMI A;  1TJE A;  2KKC A;  3QCA A;  4RCO A;  1IPG A;  4HKZ E;  4WJQ A;  1NI3 A;  3TBL D;  2BPS A;  3DVG Y;  2H88 B;  2FUH B;  3W2D A;  5IN7 A;  1LXD A;  3H7P A;  1I4X A;  3I3T B;  1E10 A;  4USA A;  2KWU B;  4ASW C;  3L08 A;  2W3S A;  3CF6 E;  2MLB A;  1YIW A;  4EEW A;  1H4R A;  2ZCB A;  3ML8 A;  4HWI B;  3HHM A;  4RGM A;  2M4N A;  2FBW B;  2ZVN A;  1L0Y B;  3VTU A;  1WI0 A;  3DBR I;  2QIL A;  2ZW0 A;  4DXF A;  1F77 A;  4G50 A;  3B1L X;  1HQR D;  2L32 A;  4IC7 B;  3B08 A;  1WZ0 A;  2LGS A;  3CWI A;  2KXJ A;  3MC0 B;  1EO6 A;  2WDV B;  5E6N A;  1XCQ L;  3SHQ A;  4C00 A;  2D10 A;  1WXM A;  2IO0 B;  5DPR A;  1QOF A;  4EZJ A;  3AE9 B;  3U4E G;  3RNB C;  3K9P B;  1A70 A;  2FCM A;  1YOV B;  3WAL A;  1LQB A;  1U4A A;  4W9E A;  2D3B A;  4NJ6 A;  4NPN A;  4WJP A;  3Q2A C;  4HKQ A;  2IGG A;  3DVN V;  1I4H A;  4MAC A;  2AQ1 B;  1C3T A;  3CMM B;  1ZDX A;  4KVG B;  2L3Z A;  2FAZ A;  5D3D A;  4DXG A;  1OQR A;  2KD0 A;  3A1Q A;  1TS2 A;  5KHQ A;  2ACZ B;  1WE6 A;  5BO4 B;  1L7Y A;  2BB6 A;  3IT4 B;  4W9L A;  1CQV A;  3R2T A;  2WLB A;  3R7Q A;  2OOB B;  4PK1 A;  3GB1 A;  2DYO A;  3MHS D;  4PYZ A;  3Q3N C;  4EZK A;  1MVK A;  2LVQ A;  3DPD A;  2NR2 A;  1UWM A;  1XQQ A;  3DDC B;  2BKF A;  3EUB 2;  1C4P A;  4C80 A;  2ONQ A;  3U8Z A;  2QHO A;  1QZE A;  3Q8F A;  3A4S C;  2NBW B;  4MEL A;  3APD A;  3KWL A;  2BYT A;  2N9E B;  3PLV A;  2PPH A;  1EF1 A;  4M02 A;  4OW0 A;  3TSS A;  3QX1 A;  1P1A A;  3HM6 X;  2N9K A;  3W5V B;  3A1Q B;  3NVW A;  2Q5W D;  2KDF B;  5JZE B;  2WU5 B;  4JWU C;  2SEB D;  5KHO A;  1R4M I;  4H2A A;  3CST A;  2MA9 B;  3A9J B;  1WJU A;  3L0W B;  4OZA A;  1C76 A;  3LB8 C;  2KQS A;  4W9H A;  3U7Z A;  3RUI B;  2WXO A;  1CZP A;  2AX5 A;  1ZKH A;  3MTN B;  2IZV B;  5G5H A;  3VQI A;  5HKH A;  5EE0 A;  3DWM A;  1EWY C;  2K9X A;  3VDZ A;  2JYE A;  4A3O A;  1BXT A;  2C7N B;  1MHX A;  3KWV A;  2IND C;  3R66 C;  2PE6 B;  1VZ8 A;  2NS5 A;  2EMS A;  5AZG A;  4BBN F;  4NY0 A;  2QDF A;  3IXS A;  5D2M B;  3L10 B;  3IG3 A;  1WZ3 A;  2EEL A;  2ON8 A;  3JVZ X;  5LXI B;  2N1V A;  3OLM D;  2CJN A;  1Z2M A;  1JWA D;  3UI3 A;  2L1A A;  3HUI A;  2GLS A;  4K3C A;  2L7R A;  1YJ1 A;  3CIR B;  3PZ8 A;  3HM3 A;  3NS1 A;  2OJW A;  1FEH A;  2C7H A;  1QOB A;  1OEY A;  1V80 A;  2XEW A;  3HIZ A;  1CMX B;  2KN4 A;  1ZW7 A;  1ZOY B;  3T3N A;  3PHW B;  4NQK E;  4CYE A;  3QAR A;  2V9H A;  3RNF C;  3PRP B;  1QF6 A;  4W9C A;  3AB5 A;  3FIL A;  2FE8 A;  4A20 A;  3NRZ A;  4HRO A;  3AEA B;  4EKU A;  3RD2 A;  1QLB B;  2O2V A;  1E8W A;  2ZPY A;  4C4V A;  4ZHO A;  1E7V A;  1V5O A;  4KX6 B;  3AE3 B;  2Z59 B;  4REZ A;  3WAP A;  3MC9 A;  1STE A;  1IUE A;  2VRR B;  4BKT A;  4MH0 E;  2YLM A;  1P98 A;  2NTT A;  5JH5 C;  1YNT E;  1ESF A;  3S2A A;  1WF9 A;  3AM9 A;  1KF6 B;  1IBX B;  1B1Z A;  1UD7 A;  2A4Z A;  4KIK A;  2L76 A;  3PVL A;  2Y5P A;  2M56 B;  4OHJ A;  3KQ4 A;  4E3C A;  3AE6 B;  2HTH A;  2FCQ A;  4IW0 A;  5G55 A;  1UNS A;  3H6N A;  3ZO5 B;  4XYC A;  1KOT A;  4KKI A;  2Z0D B;  2D07 B;  4P16 A;  1JML A;  1ACC A;  1GB4 A;  2KJ6 A;  4II2 B;  4NAW A;  1WX8 A;  3FIL B;  4F7Z A;  4RGN A;  1F2R C;  3DVG X;  2JRI B;  1FNV A;  4JWS C;  3QAQ A;  1Q1O A;  2J42 A;  2MP2 B;  4C4V B;  1OQY A;  2WQY B;  1SE9 A;  1SJE D;  2INN E;  3ZIM A;  3ZW3 A;  4I6L B;  1QKZ A;  4IWQ A;  3ECI A;  3ALB A;  3J9C A;  4TV3 A;  1D6E C;  4KGS A;  2JQR B;  4PS8 A;  1FIQ A;  1NEN B;  4FAD A;  2KMC A;  1L2N A;  2DAJ A;  1V9J A;  1YMH E;  4J6I A;  2BWE S;  5H8Y E;  5IP4 D;  4FHJ A;  2SAK A;  3AH7 A;  3KUZ A;  5GMV A;  3HK0 A;  1SE3 A;  1P7F A;  3RYT A;  2BS3 B;  4KGT A;  2C60 A;  2AQ3 B;  5CHV C;  3SU8 X;  1MI0 A;  4DWF A;  3ETR A;  4FA6 A;  1C1Y B;  3PZD A;  1FMA D;  5AEK B;  4IWO A;  4B0E A;  3KLS X;  1N61 A;  2MBH A;  3UQA A;  3RT3 B;  2BT6 A;  5DCN A;  1F2R I;  4KGR A;  1WMH A;  4B0M A;  2XNA C;  1KLU D;  3DOW A;  1L5P A;  2KMM A;  4GDL B;  4CQN A;  4LNK A;  3N9Y C;  1J7B A;  1MJD A;  2K3U A;  2KHW B;  1AW7 A;  1XLN A;  1WY8 A;  5DPS A;  3ZJT A;  1OQQ A;  1TY2 A;  2WXJ A;  1P3Q U;  1R4N I;  1ZP0 B;  1T3Q A;  3HVD A;  1KM7 A;  3BYY B;  5T8I A;  3B2F A;  3C8Y A;  1FCL A;  1BUI C;  2ZNV B;  4XGA B;  2ICI A;  3NJT A;  4IG7 B;  5FR3 A;  4TMA B;  1RLF A;  1HEZ E;  4B6W A;  1VZ6 A;  2JZZ A;  4WWP A;  3ZYY X;  4ZHP A;  1SGH A;  1D5X C;  4MDK E;  5G2N A;  4HRS A;  5EDS A;  1XEE A;  2KMA A;  3DBL I;  2FIF A;  3DQV A;  1V49 A;  2MBQ A;  1K8R B;  2CHZ A;  2DLB A;  1RFA A;  4WJO A;  1HTQ A;  1LGR A;  1UEL A;  2UU7 A;  4QAY A;  1KFY B;  1DYQ A;  1WMH B;  3PZ7 A;  4PS3 A;  1J8C A;  4RM9 A;  4TQ0 A;  4P1C C;  3PGE A;  2K25 A;  2INP E;  3P4P B;  3DBH I;  3WCQ A;  1Y8R C;  3ZKJ C;  2IO3 B;  3JSV A;  3WAM A;  2GBN A;  2G3Q B;  3ONS A;  1GPX A;  3GP7 A;  3LDZ E;  3VHT C;  2N0S B;  2IYD B;  1I4P A;  4HCN B;  1XF5 L;  3AU5 A;  2GI9 A;  2K1F A;  4LLG M;  1V2Y A;  3ZDM C;  2TSS A;  1OEY J;  5AZH A;  5BMG A;  1L6U A;  1WGG A;  3H8H A;  2ZEQ A;  1KTK A;  3BK2 A;  2LAS A;  3QC8 B;  4N6E B;  4HEA 1;  4A90 A;  2LZ6 A;  5IOI A;  5C1Z A;  3P4R B;  3EFU A;  2INC C;  2IGD A;  1FO4 A;  1EUV B;  3BII D;  2IPK D;  4IOI E;  3U2S C;  3RFZ B;  3BVZ A;  2R61 A;  2LJ5 A;  1XLP A;  4IDI A;  3OJ3 A;  4W9F A;  3V05 A;  3Q3O C;  1ZPS A;  4ZRK A;  4FJY A;  2V4L A;  1HE8 A;  5IKC M;  2L0F A;  3NVY A;  2NBV B;  5IA7 A;  1TGZ B;  1WWT A;  1JQ4 A;  2WXH A;  1AN8 A;  4K1R B;  2PW9 A;  2MJ3 A;  3DBR B;  3X0W A;  2REX A;  5EE3 A;  1WYG A;  3WIM A;  2A5U A;  4BAX A;  1XT9 B;  1JCK B;  4JGH B;  3FC4 A;  3B9J A;  1TKY A;  1XD3 B;  1X1M A;  2V3N A;  2XK5 B;  1WJ6 A;  1JWS D;  2J0K A;  3IVF A;  3MHZ A;  3VAW A;  1R7S A;  2K6Q A;  5AUI A;  3M3J A;  3T9L A;  4ITK A;  3VR8 B;  2MW5 A;  4WWN A;  2J4X A;  5C3J B;  4N59 A;  2CR5 A;  2LRU A;  3R8B A;  1D4B A;  4GXB A;  1LO5 D;  1C77 A;  1JRP A;  1SB3 C;  4HPP A;  5H92 C;  2K8C A;  3Q3F A;  2BB5 A;  1GJZ A;  3AN1 A;  5E6P A;  3NY5 A;  3WAN A;  2CKH B;  2JT4 B;  1MG8 A;  3UIP B;  2FCN A;  1J19 A;  2MX2 A;  1V1P B;  1TZ1 A;  2E3T A;  1FRR A;  1PYW D;  1VLB A;  4MSM B;  2HJ1 A;  4LDT B;  4F8C B;  4DDG D;  2PIA A;  2K22 A;  1VR9 A;  1T0Y A;  3N1Y C;  4BOZ B;  1ROE A;  1KLG D;  1YJJ A;  3RI7 C;  2VZK B;  2OJR A;  2WXR A;  2LVP A;  1T0S C;  3AED B;  4FBJ B;  3NZ3 A;  4RH6 A;  1ZE3 D;  3PRM B;  2KT7 A;  1WIA A;  3APF A;  2LEK A;  2GBK A;  3UQB A;  1YN4 A;  4XC2 A;  1I4Q A;  2K39 A;  4MGY E;  4GLS C;  3A9J A;  3ZRF A;  3VXW A;  2HTM E;  2FNJ B;  4AS1 A;  4IM2 A;  1YD8 U;  2JX5 A;  1RM6 C;  2V3P A;  1WJ4 A;  1J7A A;  2M17 A;  4MH8 A;  2Y3A A;  1R4M B;  2WXF A;  1F52 A;  3IHP C;  4BBN C;  2IDY A;  3N30 A;  3HVZ A;  1N63 A;  1I4R A;  3V61 A;  4JQW C;  2RR9 A;  4NNJ B;  1XO3 A;  2RPV A;  5JHA A;  4MGZ E;  1HZ6 A;  2R2O A;  1UF0 A;  1WXQ A;  2J7Q B;  3GZN I;  1UH6 A;  3EA6 A;  3JW0 X;  1WSP A;  2HJ8 A;  2WXN A;  5HHD G;  4KV2 A;  3UIN B;  1QIL A;  3E9S A;  2KOX A;  1M94 A;  2MRP A;  1FXT B;  4UDU C;  1TT5 B;  1JWB D;  5CHF A;  1TS4 A;  1FNU A;  2B3A A;  2YEP B;  4MEM A;  3TEW A;  4C7Y A;  3KYC D;  3AE1 B;  3ZXV A;  4HJK A;  4LNF A;  1E6E B;  2JU6 X;  1VRA B;  2D11 A;  5I4D A;  2AYO B;  3L16 A;  3OG5 A;  1NYR A;  4Q2J A;  2WYQ A;  3TEX A;  1C9F A;  3L17 A;  4ZRI A;  4K3B A;  3AV8 A;  2QC8 A;  2ASQ A;  4ACF A;  4BFR A;  1C4C A;  4YTP B;  3BIN A;  4DQO C;  4GB9 A;  4ANW A;  3W9C B;  2LUM A;  2UWQ A;  3PO0 A;  1WYW B;  4O1N A;  4WAA A;  4CO7 A;  4A3P A;  4W9G A;  2LXC A;  2G9H D;  3Q8C A;  2MHJ A;  2KDI A;  1D5Z C;  2JVC A;  1WRI A;  4JL9 A;  3OAW A;  4G3X B;  3PHX B;  4LJO B;  1VDV A;  1CJE A;  2EKE C;  2KC1 A;  1FNW A;  3QK0 A;  1WGH A;  4FLH A;  3P1M A;  3MJ5 A;  1SIF A;  4G0N B;  2K8H A;  3RZF A;  1IBX A;  3NS8 A;  3BVG A;  2KVR A;  3M62 B;  3EGR A;  1WXA A;  4URK A;  4LNO A;  2J52 A;  2L05 A;  4BVU C;  2V0G A;  2M8S A;  3RNC C;  4ZOH C;  5BYS A;  4TUU A;  2L83 A;  1L0X B;  3N32 A;  3R3M A;  3Q8B A;  3N1Z C;  4JPS A;  1EM7 A;  3L13 A;  2MEK A;  1PGB A;  3BYT B;  3W1S C;  4MJS B;  1E8X A;  3BK1 A;  3ML9 A;  5DPW A;  2LMC A;  2V3S A;  2I38 A;  3AEF B;  1FRD A;  1TY0 A;  3CSF A;  3RNA C;  4IUM B;  1YN5 A;  2BYE A;  2N9L A;  2D5G A;  5BMH A;  3PRE A;  4K7S A;  2LGD A;  2MP2 A;  3PT2 B;  4P1B C;  1IYF A;  1ISN A;  2N7E A;  2WS3 B;  1DOI A;  5TR5 A;  2QCZ A;  3Q3M C;  3H9D A;  1S3S G;  1P9D U;  2L52 A;  2BS4 B;  1BML C;  1WR1 A;  3PS6 A;  3AE2 B;  4AQ7 A;  3DHG C;  4ARI A;  2WGS A;  3VVW B;  5CTR C;  2L0T A;  2QSD A;  2J0J A;  1C78 A;  3AXC A;  3GS2 A;  4GSW A;  2X38 A;  4S0R A;  5L95 C;  3K9O B;  2NBU A;  3TMP B;  4W9D A;  3A33 B;  3P4Q B;  3PSE B;  4J3O D;  2LGX A;  4D2K A;  2LRW A;  2KX0 A;  1QT9 A;  3VUX A;  2LWP A;  4ZYS A;  1L4Z B;  2RDB C;  1I42 A;  1PGX A;  3N20 C;  2GB1 A;  2KFK B;  3Q3J A;  4GDL A;  1Q10 A;  5D7G A;  5L83 A;  2ZW1 A;  1LFD A;  1WGK A;  4FUL A;  2MBO A;  2WX0 A;  2DHZ A;  1MFW A;  1WM2 A;  2RGF A;  3O65 B;  1MPE A;  3UF8 A;  1I7H A;  3GOE A;  2KLG A;  2CU1 A;  3APC A;  2PKO A;  2MWS B;  1B9R A;  3NVZ A;  1VCB A;  4WWM A;  1HA5 A;  2W54 A;  4ZRQ A;  1D5M C;  1RRB A;  1WGR A;  3URY A;  2WXI A;  1R4N B;  4GDK A;  2D3A A;  2K6D B;  1V1O A;  4KSL C;  4R3D A;  2ZZP B;  1SE4 A;  1TKE A;  1OFF A;  1ENF A;  1S1Q B;  4L23 A;  2JYT A;  4XWW A;  3PTF C;  3D32 A;  4JX1 C;  1SJH D;  2W9N A;  1ET6 A;  1AAR A;  2O6V B;  1SF0 A;  2J53 A;  3QWZ B;  5MPO A;  2MH7 A;  3DBL B;  3ZTC A;  3Q14 C;  2AEH A;  2D3G A;  2NVU I;  3VTV A;  1UZX B;  2PVO D;  1TZO A;  4XWT A;  1V86 A;  1NDD A;  2MCN B;  4E71 A;  2DZK A;  4DK5 A;  1YQ4 B;  1ET9 A;  4EOY A;  2N4F A;  3P63 A;  4M01 A;  2DEN B;  4L2Y A;  2HE7 A;  2YVC A;  3IFW B;  3DBH B;  2WXK A;  1E9M A;  4LK0 M;  1DOX A;  1YX5 B;  2M0X A;  4HCP B;  3ENE A;  2IGH A;  3H1U A;  1EF5 A;  4GDK B;  2IBI B;  5GXG B;  1SEB D;  2DZM A;  2JZ3 B;  4XZ4 A;  4FJZ A;  1WX7 A;  2LJI A;  4XDC A;  3V6E B;  1FFU A;  1XCT L;  2KFJ A;  1MG4 A;  2Z8L A;  1V8C A;  2C7M B;  3GE8 C;  4FXC A;  2WP9 B;  4AP4 C;  1QOA A;  3ZJV A;  4NZL B;  5TSS A;  4PT5 A;  3RNG C;  1P0R A;  4LDT D;  4I6N B;  3O13 A;  3OJ4 B;  4GN1 A;  4WAF A;  4YSX B;  3L4P A;  4YWG G;  4MGI E;  2VZK D;  4IWP A;  4WH4 A;  1E90 A;  1WGD A;  2DNF A;  2V1Y A;  4HPM B;  3SEB A;  3A9K A;  4MGK E;  2ZJD A;  2OHF A;  2WHI A;  2KTR A;  2BKR B;  3RNE C;  3P4S B;  3I5J C;  5D3I B;  1FPY A;  1Q0W B;  1JRU A;  3E56 A;  1TKG A;  3NG0 A;  3A4R A;  3Q69 A;  1LM8 B;  2W82 A;  4RGO S;  3ZNH B;  2KDE B;  2XK5 A;  4G11 A;  2X8X X;  1H8C A;  1GOZ A;  2BGF A;  1M4V A;  2GOW A;  4TKN A;  4ZRP A;  3VH4 B;  2QMT A;  3NUH B;  4YSZ B;  3I9V 1;  4KDL B;  2WWZ A;  1FD6 A;  4AOF A;  1IGD A;  2W55 A;  1E8Y A;  2IY0 B;  4NJC A;  3EFC A;  3SDL C;  3LXF A;  1YN3 A;  3ZGZ A;  2NCN A;  4MM3 B;  3U7D A;  1UBQ A;  1NEK B;  3WA0 A;  4B95 A;  1V6E A;  4AJW A;  2CJO A;  1N5X A;  2RD0 A;  1HTO A;  1P7E A;  3NOB A;  1GAQ B;  5E6J A;  2MQJ A;  3A9K B;  4YSY B;  2CHW A;  3ZUN A;  4OVU A;  1V1P A;  3MP9 A;  5D94 A;  1QQR A;  2KTR B;  1UGJ A;  1K51 A;  2KWC A;  1N62 A;  5CX3 A;  4L1B A;  1KH0 A;  1J7C A;  3Q8A A;  3AE8 B;  1WM3 A;  3NVV A;  3QHT A;  4AJY B;  3U52 E;  4HLE A;  1FXA A;  3BVM A;  3ZTD A;  3I57 A;  1GC7 A;  2I1K A;  4DHJ B;  2IO1 B;  4F1S A;  1KLV A;  2KQ4 X;  2C9W B;  4TSS A;  2G4S A;  4RF1 A;  1I35 A;  2KNB A;  3KH0 A;  3AUL A;  3OWE B;  2AWT A;  2ZCC A;  5DPT A;  4FN2 A;  2M0A A;  4A9A A;  2KX3 A;  5LLI A;  4JIO U;  5IO9 A;  1V81 A;  3MFG A;  5HG2 A;  4WQM A;  2N7D A;  2KWD A;  1YQB A;  2WXM A;  1TBE A;  4WQO B;  4DHZ E;  3M63 B;  3NZU A;  3ABV B;  4XE0 A;  2WNM A;  4M8M A;  2JWU A;  1N6Z A;  3RPF C;  2WXQ A;  1Y56 A;  2JWZ A;  3H7S A;  3TEZ A;  4A55 A;  2UYZ B;  4ZYN A;  4W9J A;  1T6B X;  1XLQ A;  3L54 A;  2CS4 A;  1PDX A;  4M0W A;  3P2B A;  3KVF B;  2N7J A;  4W9K A;  3NZS A;  5AUK A;  1F9J A;  3GZN B;  4TQ1 A;  3DCG A;  2ZVO A;  5G5G A;  3H7P B;  2KWV B;  3QJZ A;  1ZXI A;  4HJG E;  1L0V B;  5CHW A;  3PRZ A;  2IY1 B;  2NPT A;  4DBG A;  4WIP A;  4CHK A;  4LJP B;  4HXD A;  2D2Q A;  2RDG A;  3UGB B;  2DX5 B;  4C7Z A;  3Q6B A;  1OGW A;  2JF5 A;  3BY4 B;  1FCC C;  2BWF A;  2BTE A;  1SXT A;  2XBB C;  2PEA A;  3BZD B;  2KAC A;  2KC2 A;  4ARC A;  3SR6 A;  2KQ7 A;  3DVN U;  2K0P A;  1TS5 A;  2G45 B;  3VRB B;  2LFI A;  1D3Z A;  3ZXR A;  3LJ3 A;  1KJT A;  4HPL B;  2GMI C;  4GIV A;  1DGJ A;  3V6C B;  2BF8 B;  1IP9 A;  4M0W B;  1WGY A;  1VZ7 A;  2VH2 A;  4MT5 A;  2I1J A;  3VR9 B;  3VRA B;  2LUE A;  2N9P C;  4US9 A;  2KTF A;  1UBI A;  3IAS 1;  1TIF A;  2IJ0 A;  4NQL B;  4P7I A;  1I4G A;  1XXG A;  2MSE D;  1GG3 A;  2JY6 A;  4A6Q A;  2DZJ A;  2NPT B;  1G6J A;  4IM3 A;  2KDB A;  3B0A A;  4LNI A;  2RPQ A;  1YQ3 B;  3KYD D;  4BKS D;  2DAF A;  4BKG A;  3M95 A;  1FM0 D;  1OTR B;  3VUW A;  1E7U A;  2JXT A;  4MJS A;  1F1H A;  1RAX A;  4AWJ A;  3W1S A;  1WH3 A;  1T0R C;  2WDR B;  1TYG B;  2LXA A;  2NMQ A;  3MC8 A;  2NTS A;  5IAA C;  2GBR A;  5BYR A;  1ZUD 2;  1Z5S B;  3JYU A;  5EE1 A;  4ICV A;  3TEY A;  3DHI C;  2BQQ A;  1L4D B;  1GB1 A;  1RYJ A;  3AE5 B;  1TTN A;  3AMZ A;  2O6V D;  4C56 C;  4RGT A;  4W9I A;  4HK2 A;  4IM0 A;  5LNK 1;  3W1Y A;  4DDI D;  1N60 A;  1HZ5 A;  4LNN A;  2LD9 A;  4KZ0 A;  3DHH C;  1SE2 A;  2J0M A;  1NI2 A;  2FCS A;  5E6O A;  4KKJ A;  4II3 B;  1E7P B;  5BYQ A;  4BOS C;  4I6P A;  1RFK A;  3ZQ4 A;  3KUD B;  2C5L C;  2ZPN A;  2KDM A;  3SD5 A;  4PS7 A;  2YEP F;  3PV1 A;  4OZC A;  1K50 A;  1VD2 A;  4IKG A;  4PYU A;  1PQS A;  4FHK A;  3DBS A;  2KFK A;  2MBE A;  4AUQ C;  4MSQ B;  3AEC B;  4GOC A;  4BKS A;  2CHX A;  2LVO A;  3U30 A;  3RMK C;  2BYV E;  1GNU A;  4YT0 B;  3V62 A;  1FXI A;  3R2I A;  3X23 A;  4KSK C;  1FFV A;  2AQ2 B;  1F0Z A;  1SIJ A;  1GUA B;  4RF0 A;  2L00 B;  5AZF A;  3AU4 A;  2PVG C;  2BW2 A;  3RN9 C;  4GU2 A;  3I63 C;  1VJK A;  2PLP A;  3V60 A;  1WRD B;  4GGQ A;  3VH3 B;  2JUO A;  1EU3 A;  1XLO A;  2KYW A;  4K81 A;  3FAH A;  3VUY A;  3ZDT A;  3T8M A;  2WU2 B;  4N58 A;  5JHB A;  2QIE B;  4HDO A;  2B76 B;  5LXH A;  2Z0E B;  2AL3 A;  2O6V A;  3TUO A;  2GRI A;  1V5T A;  4US8 A;  5EE9 A;  4YXD B;  4RNA A;  3QQ8 B;  2Y5C A;  4GMV A;  3P42 A;  3Q8E A;  2LHE A;  1RWS A;  5FKA C;  2V4I B;  3AI5 A;  2I2Y A;  4DHZ B;  4JLC A;  4M00 A;  5J18 A;  4KZC A;  1K53 A;  2W3R A;  4RM8 A;  3T3O A;  3AEG B;  1GC6 A;  3C0R B;  2MBB B;  1UGM A;  1EU4 A;  1E8Z A;  3TL5 A;  4RMA A;  2OED A;  2N1W A;  2EMT A;  3ZLZ A;  2O2V B;  1AWD A;  2LHD A;  1SSN A;  1C79 A;  1E5W A;  2CU3 A;  5HI1 A;  3WAO A;  1CK1 A;  4ZRJ A;  2JXX A;  5HFY A;  2PJH A;  3ZNG C;  2IO2 B;  2PTL A;  3B2G A;  3AE4 B;  2RDH A;  4X57 B;  1NVI D;  3SFD B;  1V97 A;  3N3K B;  4KIK B;  1ZDV A;  2H89 B;  4FJV B;  2HD5 B;  2RSU A;  2JSV X;  4ANX A;  1AYF A;  1DOY A;  1HXY D;  1PFD A;  4OZB A;  5FK9 C;  2GBJ A;  3QIJ A;  3KW5 B;  4WWO A;  2JPH A;  2XN9 C;  2L8J A;  2LI5 A;  1J0G A;  1NYQ A;  3ZNZ B;  1BT0 A;  1JW9 D;  4NAW B;  4DHJ D;  2WXP A;  4M8N A;  4KDI C;  2KVZ A;  4EE2 A; 
#chains in the Genus database with same CATH homology
 4W9C A;  3V61 A;  1WXV A;  4A20 A;  2KJR A;  3UIO B;  4OVV A;  5J2R A;  4JQW C;  4EKU A;  3RD2 A;  1WM3 A;  2RR9 A;  4NNJ B;  2O2V A;  5JHA A;  4MGZ E;  2R2O A;  1E8W A;  2ZPY A;  4E74 A;  2J7Q B;  3QHT A;  3GZN I;  4AJY B;  1E7V A;  4HLE A;  3ZTD A;  2ZNV C;  1V5O A;  1UH6 A;  3EEC A;  3JW0 X;  2Z59 B;  2AL6 A;  2HJ8 A;  1YX6 B;  3UIN B;  3WAP A;  4KV2 A;  3ZNI D;  2Y5B B;  1GC7 A;  3RCZ A;  3ZVV A;  2I1K A;  2GBM A;  4DHJ B;  4BKT A;  2VRR B;  3RUL A;  4MH0 E;  2YLM A;  1P98 A;  2KOX A;  3R7R A;  5JH5 C;  2IO1 B;  1M94 A;  4F1S A;  1KLV A;  2MRP A;  1WE7 A;  1FXT B;  3S2A A;  1WF9 A;  2C9W B;  2G4S A;  5J17 A;  1I35 A;  4K7W A;  5CHF A;  4B9K A;  2KAN A;  2KNB A;  1UD7 A;  3KH0 A;  2A4Z A;  2B3A A;  3AUL A;  4KIK A;  2L76 A;  3PVL A;  4MEM A;  3KYC D;  2AWT A;  2ZCC A;  4HJK A;  2KN5 A;  4E3C A;  4ZDV A;  5DPT A;  3VFK A;  4FN2 A;  1ZGU B;  4YL8 A;  2N9X A;  4MM3 A;  4WJN A;  2D11 A;  2KZR A;  2KJH B;  2KX3 A;  2HTH A;  5LLI A;  2FCQ A;  4N9F 4;  2AYO B;  3RZW C;  3L16 A;  4JIO U;  4IW0 A;  1V81 A;  5G55 A;  2G4D B;  2M1M A;  3EHV A;  3H6N A;  3ZO5 B;  2K8B A;  4HVB A;  2N7D A;  1KOT A;  1YQB A;  2WYQ A;  5C23 A;  4WQO B;  1TBE A;  2DZI A;  3IBE A;  1WXS A;  2Z0D B;  3QA8 A;  4DHZ E;  3L17 A;  2D07 B;  3M63 B;  3NZU A;  4ZRI A;  2KJ6 A;  2WX1 A;  4II2 B;  2ASQ A;  4BFR A;  4NAW A;  3TJP A;  1WX8 A;  3VTW A;  4F7Z A;  4M8M A;  3BIN A;  4DXA B;  3DVG X;  2JRI B;  4GB9 A;  3NHE B;  4ANW A;  2UWQ A;  3QAQ A;  1Q1O A;  2MP2 B;  1WYW B;  1OQY A;  3PPA A;  1SE9 A;  4WAA A;  4CO7 A;  3ZIM A;  4A3P A;  3ZW3 A;  4I6L B;  2JWZ A;  3H7S A;  3PLU A;  4W9G A;  4EUT A;  4IWQ A;  2LXC A;  1A5R A;  4K7U A;  3ECI A;  3ALB A;  4EZL A;  4TV3 A;  2KDI A;  4PS8 A;  2UYZ B;  2JVC A;  4W9J A;  4ZYN A;  4JL9 A;  4FAD A;  2KMC A;  3OAW A;  1L2N A;  4G3X B;  2DAJ A;  2KLC A;  3PHX B;  1V9J A;  2PE9 A;  2WDT B;  4HDQ A;  4LJO B;  2EKE C;  2KC1 A;  3L54 A;  2CS4 A;  4J6I A;  3P2B A;  2BWE S;  1WGH A;  3QK0 A;  4FLH A;  3KVF B;  4ICU A;  4FHJ A;  4W9K A;  1SIF A;  3KUZ A;  4G0N B;  2K8H A;  3NZS A;  5GMV A;  3RZF A;  1F9J A;  3HK0 A;  3NS8 A;  3RYT A;  4TQ1 A;  3DCG A;  3TCA A;  2ZVO A;  2KO3 A;  2C60 A;  5CHV C;  4XX5 A;  3H7P B;  3SU8 X;  2KWV B;  1WFY A;  2DYM A;  2KVR A;  3M62 B;  4DWF A;  1WXA A;  3QJZ A;  4EFO A;  4URK A;  2L05 A;  4BVU C;  4FA6 A;  1C1Y B;  5CHW A;  3PRZ A;  2M8S A;  3PZD A;  4ANV A;  5D6J B;  3KUC B;  2IY1 B;  2NPT A;  4TUU A;  4DBG A;  5AEK B;  4ANU A;  4IWO A;  4CHK A;  2MBH A;  4LJP B;  3N32 A;  3R3M A;  2D2Q A;  4HXD A;  3ZRC A;  3UGB B;  2DX5 B;  3UQA A;  3L13 A;  3RT3 B;  5DCN A;  1OGW A;  2JF5 A;  1WMH A;  3BY4 B;  2BYF A;  4LCD E;  3W1S C;  2BWF A;  4MJS B;  3TIX A;  1E8X A;  3DOW A;  3MJW A;  3ML9 A;  3EC8 A;  5DPW A;  1Q5W B;  1NBF C;  2V3S A;  2XBB C;  2FID A;  4GDL B;  3JSV B;  3CSF A;  2PEA A;  4IUM B;  5FR6 A;  2BYE A;  2KHW B;  2LGY A;  2KC2 A;  3PRE A;  4K7S A;  2LGD A;  2MP2 A;  3PT2 B;  5DPS A;  1WY8 A;  2KQ7 A;  3DVN U;  2DYB A;  1IYF A;  1ISN A;  2G45 B;  2N7E A;  2KK8 A;  2JRH A;  1P3Q U;  1R4N I;  1D3Z A;  3LJ3 A;  1KJT A;  4HPL B;  5TR5 A;  1KM7 A;  2GMI C;  4GIV A;  1WJN A;  4NJ7 A;  1WX9 A;  3V6C B;  3H9D A;  2R2Q A;  2BF8 B;  1WR6 E;  1IP9 A;  1S3S G;  4M0W B;  1WGY A;  1P9D U;  2I1J A;  2KKC A;  3QCA A;  2ZNV B;  1WR1 A;  3PS6 A;  4IG7 B;  1IPG A;  2LUE A;  2N9P C;  4WJQ A;  3TBL D;  2BPS A;  3DVG Y;  1RLF A;  2KTF A;  1UBI A;  4B6W A;  2JZZ A;  4WWP A;  3VVW B;  1SGH A;  4MDK E;  5CTR C;  5G2N A;  2L0T A;  2FUH B;  5EDS A;  2KMA A;  3DBL I;  2FIF A;  4NQL B;  4P7I A;  2J0J A;  2MSE D;  1LXD A;  3DQV A;  1GG3 A;  2JY6 A;  3H7P A;  3I3T B;  2DZJ A;  2NPT B;  1G6J A;  4IM3 A;  1V49 A;  2KDB A;  1K8R B;  2KWU B;  2MBQ A;  2CHZ A;  2RPQ A;  1RFA A;  3AXC A;  2MLB A;  3B0A A;  3CF6 E;  3KYD D;  3L08 A;  4WJO A;  1YIW A;  4EEW A;  4GSW A;  1H4R A;  1UEL A;  2ZCB A;  3ML8 A;  4HWI B;  5L95 C;  3HHM A;  4BKS D;  2DAF A;  1WMH B;  2NBU A;  3K9O B;  2M4N A;  4PS3 A;  1J8C A;  3TMP B;  4RM9 A;  4BKG A;  3M95 A;  1OTR B;  2ZVN A;  4W9D A;  4TQ0 A;  3A33 B;  1E7U A;  3PSE B;  3VTU A;  3VUW A;  1WI0 A;  2LGX A;  2LRW A;  2KX0 A;  3DBR I;  4MJS A;  3VUX A;  2LWP A;  3PGE A;  2K25 A;  1RAX A;  3ZKJ C;  3DBH I;  4G50 A;  1Y8R C;  3B1L X;  1I42 A;  4IC7 B;  2KFK B;  2IO3 B;  3B08 A;  3JSV A;  3Q3J A;  4GDL A;  4AWJ A;  1WZ0 A;  3W1S A;  3WAM A;  1WH3 A;  2GBN A;  2KXJ A;  2G3Q B;  3ONS A;  1EO6 A;  5D7G A;  3LDZ E;  3VHT C;  5E6N A;  5L83 A;  2IYD B;  3SHQ A;  1LFD A;  4FUL A;  2LXA A;  2D10 A;  4HCN B;  1WXM A;  2MBO A;  2WX0 A;  2DHZ A;  1WM2 A;  2RGF A;  2IO0 B;  3O65 B;  5DPR A;  3UF8 A;  4EZJ A;  3GOE A;  5IAA C;  2KLG A;  2GBR A;  2CU1 A;  3AU5 A;  3APC A;  3K9P B;  1Z5S B;  2FCM A;  3JYU A;  2K1F A;  2MWS B;  1V2Y A;  3ZDM C;  1VCB A;  4ICV A;  1OEY J;  5AZH A;  3WAL A;  1RRB A;  1LQB A;  1WGG A;  1U4A A;  2ZEQ A;  4W9E A;  2LAS A;  3QC8 B;  4NJ6 A;  1TTN A;  4NPN A;  1WGR A;  2O6V D;  4WJP A;  2LZ6 A;  3DVN V;  4W9I A;  4GDK A;  4HK2 A;  5C1Z A;  2K6D B;  1C3T A;  3CMM B;  4KSL C;  2L3Z A;  4KVG B;  2ZZP B;  3EFU A;  1S1Q B;  4IM0 A;  3W1Y A;  2FAZ A;  1EUV B;  2KD0 A;  4DDI D;  3PTF C;  3A1Q A;  5KHQ A;  2LD9 A;  3D32 A;  4KZ0 A;  2J0M A;  1NI2 A;  1WE6 A;  5BO4 B;  2FCS A;  5E6O A;  2LJ5 A;  2W9N A;  1AAR A;  4II3 B;  2O6V B;  1L7Y A;  4W9L A;  4BOS C;  3QWZ B;  4I6P A;  3KUD B;  3OJ3 A;  4W9F A;  2C5L C;  3R7Q A;  2ZPN A;  3ZTC A;  2AEH A;  2D3G A;  2NVU I;  4ZRK A;  3SD5 A;  4FJY A;  3VTV A;  1UZX B;  2OOB B;  4PS7 A;  3PV1 A;  2V4L A;  1HE8 A;  1VD2 A;  2DYO A;  4PYU A;  1PQS A;  1NDD A;  1V86 A;  3MHS D;  4FHK A;  4PYZ A;  3DBS A;  2MCN B;  4E71 A;  2KFK A;  2L0F A;  5IA7 A;  2NBV B;  4EZK A;  2MBE A;  2LVQ A;  4MSQ B;  1TGZ B;  3DPD A;  4AUQ C;  2DZK A;  4GOC A;  2NR2 A;  4DK5 A;  4EOY A;  4BKS A;  2N4F A;  2CHX A;  2LVO A;  1XQQ A;  4K1R B;  3DDC B;  2DEN B;  3U30 A;  2BKF A;  3X0W A;  2HE7 A;  2REX A;  2YVC A;  2BYV E;  3IFW B;  1GNU A;  3V62 A;  3WIM A;  2A5U A;  3X23 A;  1XT9 B;  4KSK C;  3U8Z A;  4JGH B;  2QHO A;  1QZE A;  1GUA B;  2L00 B;  1XD3 B;  1YX5 B;  1X1M A;  2M0X A;  4HCP B;  5AZF A;  2XK5 B;  3A4S C;  3AU4 A;  2NBW B;  1WJ6 A;  3ENE A;  2J0K A;  3IVF A;  4MEL A;  3VAW A;  3APD A;  4GU2 A;  3H1U A;  1EF5 A;  4GDK B;  3V60 A;  1WRD B;  2IBI B;  2K6Q A;  4GGQ A;  2N9E B;  3PLV A;  2PPH A;  1EF1 A;  3VH3 B;  2DZM A;  3M3J A;  2JZ3 B;  3T9L A;  2JUO A;  4XZ4 A;  2MW5 A;  3QX1 A;  4FJZ A;  1P1A A;  1WX7 A;  3HM6 X;  4K81 A;  4WWN A;  3V6E B;  3A1Q B;  3VUY A;  2KFJ A;  3ZDT A;  3T8M A;  2CR5 A;  2C7M B;  5JHB A;  2LRU A;  5JZE B;  2KDF B;  4AP4 C;  5KHO A;  4HDO A;  4GXB A;  1R4M I;  3CST A;  5LXH A;  2Z0E B;  2AL3 A;  1P0R A;  2MA9 B;  2O6V A;  3A9J B;  1WJU A;  2K8C A;  3L0W B;  1V5T A;  4LDT D;  2KQS A;  4W9H A;  3Q3F A;  3QQ8 B;  4I6N B;  4GMV A;  3RUI B;  3OJ4 B;  1GJZ A;  4GN1 A;  3AI5 A;  1ZKH A;  5E6P A;  4MGI E;  3MTN B;  3NY5 A;  2IZV B;  3VQI A;  5HKH A;  3WAN A;  4DHZ B;  4IWP A;  2CKH B;  4JLC A;  2JT4 B;  1MG8 A;  5J18 A;  3UIP B;  4KZC A;  2FCN A;  1E90 A;  4RM8 A;  1WGD A;  1J19 A;  2MX2 A;  4HPM B;  2V1Y A;  1GC6 A;  1TZ1 A;  3C0R B;  3A9K A;  2MBB B;  1UGM A;  4MGK E;  2ZJD A;  4MSM B;  1E8Z A;  3TL5 A;  3VDZ A;  2KTR A;  2BKR B;  4RMA A;  4A3O A;  4LDT B;  4F8C B;  4DDG D;  2N1W A;  2EMT A;  3ZLZ A;  2C7N B;  1Q0W B;  1T0Y A;  1JRU A;  2O2V B;  4BOZ B;  3A4R A;  1LM8 B;  3R66 C;  2OJR A;  2PE6 B;  3ZNH B;  2KDE B;  1E5W A;  2XK5 A;  4G11 A;  3WAO A;  2LVP A;  2NS5 A;  2EMS A;  5AZG A;  1H8C A;  2BGF A;  4NY0 A;  4BBN F;  4ZRJ A;  4FBJ B;  2GOW A;  2JXX A;  5D2M B;  3L10 B;  3IG3 A;  2PJH A;  3PRM B;  4TKN A;  3ZNG C;  1WZ3 A;  2IO2 B;  3VH4 B;  3JVZ X;  5LXI B;  1WIA A;  2N1V A;  3OLM D;  4KDL B;  1Z2M A;  4CYE A;  3APF A;  4X57 B;  2WWZ A;  4AOF A;  2GBK A;  3UQB A;  4XC2 A;  2K39 A;  1E8Y A;  2IY0 B;  3N3K B;  4KIK B;  2L7R A;  4FJV B;  1YJ1 A;  4MGY E;  2HD5 B;  3HM3 A;  2RSU A;  3SDL C;  3A9J A;  3ZRF A;  4ANX A;  2NCN A;  3U7D A;  3VXW A;  1UBQ A;  3WA0 A;  4B95 A;  2C7H A;  1OEY A;  2FNJ B;  1V6E A;  4AJW A;  1V80 A;  2XEW A;  3HIZ A;  1CMX B;  2RD0 A;  1ZW7 A;  4IM2 A;  1YD8 U;  3NOB A;  1WJ4 A;  2GBJ A;  2MQJ A;  2M17 A;  3A9K B;  3KW5 B;  3PHW B;  3QIJ A;  4NQK E;  2CHW A;  3QAR A;  4WWO A;  3ZUN A;  2JPH A;  4OVU A;  2L8J A;  2LI5 A;  1J0G A;  5D94 A;  2KTR B;  3IHP C;  3PRP B;  3ZNZ B;  1BT0 A;  4BBN C;  4NAW B;  4DHJ D;  3N30 A;  4M8N A;  2KWC A;  4ASW C;  4KDI C;  5CX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...