1V1PB

The structure ssl from staphylococcus aureus from an orthorhombic crystal form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
191
Chain Sequence
HDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
molecule keywords EXOTOXIN 1
total genus 47
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
B PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1pB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1pB01
1FD7D 1DYQA 1HA5A 1FGBD 1EFID 2QEJC 1SEBD 3EFXD 1B44D 5ELBA 1PZKD 2J4XA 1EWCA 1LTTD 4UDUC 4C56C 1LO5D 5FK9C 1BCPD 5ELFA 1JWUD 1S5FD 1JCKB 1I4QA 2O2LD 1LT4D 1KTKA 1F77A 1PTOC 1S5DD 5ELCA 1BCPF 1PTOB 2SEBD 2AQ3B 4L6TB 4O1NA 1RCVD 4RFBA 1KLUD 1TS5A 5D3DA 1ET9A 1SE3A 3TSSA 4RHRA 1MD2D 3EA6A 1PRTB 2XN9C 1XTCD 2AQ2B 3DWPA 4TSSA 4RHSA 1V1PA 2ICIA 1QILA 1STEA 5D3IB 2RDGA 1LTRD 1LT6D 2XRSD 4OHJA 5ELEA 3BVGA 1YN3A 1ENFA 1CHQD 1LTGD 4RH6A 1PTOD 1JR0D 2Z8LA 3SEBA 2XRQD 4RGTA 1LLRD 1BXTA 1EEID 1AW7A 1S5ED 2NTSA 3BZDB 1BCPC 1LT5D 1CQVA 1PRTD 2QILA 1SJHD 1PZID 4BWGB 3OWEB 2IJ0A 3BVZA 5FKAC 4DXGA 4ZYSA 1KLGD 3GP7A 3BYTB 2WV6D 1LTID 1RDPD 4Z9CB 1CK1A 1EU3A 5TSSA 2XNAC 3R8BA 1AN8A 1YN4A 1EU4A 1UUPA 1LTBD 1M4VA 1XXGA 5I4DA 1HQRD 4RGNA 1CT1D 1L0XB 1RD9D 3BYYB 1FNUA 1G8ZD 1I4RA 1PTOF 5ELDA 3R2IA 1I4GA 3O13A 3MFGA 1SE4A 4NZLB 1SE2A 2G9HD 1JWMD 2R61A 1YN5A 2NTTA 1LTSD 1EEFD 1FNVA 1PRTF 1TY2A 2CHBD 1SBBB 1SJED 1CHPD 2RDHA 1TS2A 2IPKD 4RGMA 1TS4A 1UNSA 1PTOH 1V1OA 1S5CD 1V1PB 3KLSX 1I4HA 1S5BD 1ET6A 1D6EC 1TS3A 1LT3D 2TSSA 1L0YB 1D5MC 3R2TA 4L63B 1D5XC 1T5XD 1SXTA 1B1ZA 1ESFA 1JWSD 1BCPB 1DJRD 2AQ1B 1HXYD 3V05A 1FNWA 1I4PA 1PZJD 4RCOA 3CHBD 1PYWD 3MC0B 3DWQA 3URYA 1I4XA 1LTAD 1RF2D 1JQYD 1TY0A 4K6LA 4RGOS 3W2DA 4DXFA 3BVMA 1PRTC 1GOZA 1D5ZC 3DWAA 1HTLD
chains in the Genus database with same CATH superfamily
2PI2E 3NWTA 1HA5A 1TBEA 1E90A 2IO1B 2K6QA 5MPOA 3OSOA 2GBJA 3FKYA 2E74C 1JICA 1EWCA 3TN2A 3GTLB 1PVOA 4RAUC 1WXSA 2IY5B 4FN2A 2NVYH 1CUKA 3K9PB 3S1NH 3HS0C 4A3IG 2KFKB 1MFWA 3OOCA 3NBIA 4ILWA 1XNRL 1F2YA 4DAYA 2I2YA 4KV2A 5T1GA 4CGYB 4RFBA 4X3KA 5D3DA 1SSNA 4JWSC 1YVCA 1GKHA 1QOBA 1RRBA 2NBUA 5KGUA 3PVLA 3UF8A 1IBXB 4WWNA 1BOSA 2JZ3B 5E3FA 1WTPA 2C7NB 3DWPA 4FP5D 4JC0A 5CBAE 3QG1A 2LVOA 1DOKA 2Z0DB 3C0RB 1LTRD 2XRSD 4G50A 1KLVA 4ID6A 2RSUA 3Q23A 2BCOA 2EYOA 2EXZA 4RH6A 2R7ZH 2VZKB 1T0RC 3DWGC 2KJ6A 4IWOA 2Q2TA 3RNFC 4HEDA 3H3VH 2KZRA 2LKVA 2RVLA 3P4RB 4RM8A 1HNXQ 1FCCC 3S17H 1PDXA 4H2AA 3VTVA 1OEYJ 1EWHA 3MP9A 1WD1A 4LUOA 2KC2A 4JI3L 4KGRA 1I5FA 2F4VL 3PSEB 5KYIA 2O6VB 5EDSA 4LNNA 5CORA 2N49A 2EQSA 4HJGE 3BYTB 3CQZH 2PMZB 3A8KE 2VQFQ 3N1XC 3AMUA 3KLRA 3CMEA 1LM0A 4LFBQ 1SNDA 2UYZB 1VDVA 3LXFA 1ZP0B 4E6IA 4NXML 2WXIA 2AHOB 1P9DU 4GLSC 4MJSB 2UU9L 4DV7Q 1QVGA 3NRZA 2AEHA 3QR8A 4L2YA 5JJIA 1IBXA 1ILQA 1YHQA 2ZW1A 4NJCA 1X3EA 1RJTA 1WFQA 4MTNA 3WWVA 1D8LA 1B70B 3O65B 4K6DA 3WDNA 1XLOA 4HJ9A 4HXDA 4DV5Q 1UEBA 3BYYB 1PYSB 1VQDA 3PV0A 1MHXA 2I5LX 4G11A 4PZ7A 1VQ7A 3AU4A 3AE7B 4ZCKA 3HOZG 2OOBB 1R4QB 4JI1L 1V43A 3Q3OC 4MGKE 4NZLB 3NPPA 4LCDE 1UD7A 3SR1A 1L1OA 5IT9L 1IZ6A 2PQAA 1XMOQ 4CQNA 2JA7B 1SJED 3W5UB 4LFCQ 2EKEC 1JWAD 2IPKD 5J22A 2YTYA 2FIDA 4IKGA 3Q8FA 3BY4B 1E0ZA 1X32A 4MSQB 5CHVC 3IFWB 4MJSA 2LASA 4OZBA 5CV8A 1JOKA 5HGQA 3OAWA 1UE6A 1W6KA 1N32L 4REZA 3NS1A 4IPCA 2NN6H 2KCMA 3N30A 3ZIMA 1KD1C 3UE0A 5EPKA 1IGCA 2INDC 1IW7D 1JORA 1EZ8A 3P1MA 2X38A 1SNQA 2FUG1 1JQYD 1DOMA 2HJ8A 2BWFA 1WWTA 1GOZA 2Z0SA 4WIPA 3CCVA 3ERQA 1P98A 4R4CA 4DUYL 3L10B 4LTUA 5J2RA 1FD7D 4YHHQ 1DYQA 2IGDA 5T8IA 2B2WA 2QEXA 2QEJC 3GTKB 4K7UA 1F9SA 2K05A 4FXGC 4B3MQ 3N52A 3TEYA 4XE0A 4HIOA 3ZVVA 5KYLA 4B3RL 1GUSA 4A93H 4TQUS 2D0PA 2JEBI 4DV6L 3CPWA 1C0AA 5D14A 1PGXA 2O6VA 3EN2A 5JPMC 3B2FA 5BN5A 1S5DD 4ARCA 3ND9A 2OT2A 3J81j 1PTOB 2OEOA 1STAA 1MI2A 2AQ3B 4KHVA 4XGAB 5KHOA 2Y3AA 1TWAH 1XPOA 3QJZA 3EFCA 1JOOA 3TL5A 3VR4A 3W5OA 4GNXB 1ZYRC 2VUMH 3CD6A 3B2GA 1N9WA 4IPDA 2F0GA 2XN9C 2GMIC 4J6IA 5EGTA 3CKIB 4B3TL 1SE8A 1HZAA 4R1JA 3S16H 5HI1A 1YJJA 3M95A 3OIPA 3PF4A 3W1YA 4FXKC 1MJEA 4NQLB 3W5VB 1E7ZA 3F2CA 3UQAA 2KCNA 2Z8LA 1Y1VB 3A54A 3A8JE 3P1HA 2NB0A 2NVUI 4K3CA 5L95C 1LLRD 1VQ8A 1C4CA 3R7QA 3CCLA 1LT5D 3A5UA 2FBWB 3M4OB 4B3RQ 4DR7Q 3AE1B 3VR6A 1QCBD 2DX5B 3CCJA 3PUZA 5IYDH 2L00B 2JZPA 5GMVA 1F1HA 1PH9A 2A6ED 2DYBA 1EU4A 2IZVB 4KLKA 1JE5A 1J8CA 2CKHB 3MZ5A 3KUCB 2LXJA 1Q1OA 2E75C 4FNFA 3IVFA 4IM3A 4ANUA 3SFEB 2EKIA 5IP7G 1T0SC 4GZYC 3SK6A 4C4VB 2DN8A 4B95A 2IT1A 2CQOA 3S1MH 4RGNA 4KY5A 1L0XB 2N78A 4IO9A 4EQOA 4QGUA 4A3KB 1AFPA 4C3JG 3Q3MC 4X3SA 3R2IA 4QJFA 3RN2A 1WYDA 3MFGA 2NTTA 4HCSA 3STBC 3JAMi 4UP7A 3D8GA 3NG0A 4P75A 3KWLA 3ZXVA 1SBBB 2AX5A 1PH2A 2CW0C 2RDHA 3TDQA 2BDNA 4CKEA 5C4XH 4LF4Q 2X6GA 2K50A 2J0MA 4HIDA 3H9DA 4PYUA 1WGGA 2N9XA 1V1PB 2BGFA 4BY1G 3UINB 5TR5A 3N1YC 4HCNB 4AQYL 1EUJA 2YYZA 2EIFA 4A3LG 4IFDI 5CBEE 2TSSA 3OG5A 1WMHA 3CCMA 1WXMA 2R3ZA 4DUZQ 3D4DA 1DONA 2EOTA 2K28A 3CXCA 1LQBA 4ZAIA 1C4PA 3W1SA 1YX6B 2JY6A 3N32A 2MHVA 5ELOA 3ABVB 5C3XA 4BBSH 1WJJA 3MC0B 4FXDA 4DF7A 2VUMB 2KFKA 5BN4A 5FLMG 2YTVA 1KF6B 4YXDB 2G45B 1TWFB 3H6MA 1V8CA 4QL5A 3AEAB 3J81c 2JQRB 4H7BA 2NVQH 3I57A 3RULA 4DHJB 3TREA 4QUCA 4X62Q 4BY7H 4RNAA 2WB1E 3ZYYX 1QOHA 1BNZA 4P7IA 1ZKOA 3VA5A 2MBBB 2RD0A 3GE8C 4LJZC 1C3TA 1PZKD 3UDXA 4C56C 5C44H 1J9OA 1BCPD 4NB3A 3AB5A 3B1LX 1IHZA 1JWUD 4DV3Q 1WMHB 2KDBA 3NQIA 2V4DA 4HKZE 1PFSA 1QZEA 1KTKA 1WFYA 1AE3A 4XWWA 4A3FH 3DBHI 1GB4A 3BWUD 2BS3B 2FHTA 2D5DA 2L7RA 3WALA 3PO3B 4MT5A 3EQLC 2A6HD 5FJ8G 4FLHA 1T5EA 3TRZA 2FNJB 4Q0FA 5J3BA 3NZSA 2H5XA 4JIOU 5I2XA 1KAWA 2PIAA 3U8ZA 1M8AA 4A75A 3VYSA 2KC1A 3GO5A 2A68D 3NELA 4J15A 2O2VA 1WE6A 3B9JA 1I94L 4LNOA 2O4XA 4HIMA 4PS7A 2Y5CA 1PH6A 2ASBA 3A9JB 4N8FA 3HOWB 2NMQA 4KVGB 2R7FA 4LF9L 1EYGA 4XX5A 2CKZB 4A3JH 3B0AA 2DNEA 3WAPA 1R4MI 4JI6Q 2MLBA 1PV4A 1NMFA 3S1QH 1WJ4A 2IJ0A 2RSOA 1BMLC 4IM0A 4DV4L 1DOXA 1JOQA 1EU3A 2OF1A 2B2VC 4R8IA 1Y69U 4KKJA 4MH0E 1JWBD 3D6CA 1RWSA 1AN8A 1XNQL 1MI0A 2WDTB 4XYCA 3LX0A 4FA6A 1EQVA 3ZNGC 1E8ZA 4KHPQ 5CV4A 3N9YC 2B3GA 1DM0B 4WJNA 4K2LA 1E1TA 2ZTDA 5AJ3Q 1W3SA 2ASQA 1HJPA 4RMAA 2KD0A 2LVPA 4JI8Q 1CT1D 2M17A 4HRSA 2LHEA 2LRUA 1PFBA 3ZQ4A 2RDBC 4MEMA 1I4GA 2JWZA 1CJEA 5CX3A 2E8GA 3SU8X 4HJKA 1J5EQ 4GDKA 4K2KA 4E74A 4EQ5A 5FLXL 1TT2A 2ZJQA 1SLJA 1VF5C 4YY3Q 5BMGA 3AMZA 3KUDB 5C44B 1YMHE 3GTOH 3E9SA 2JA9A 1CZWA 3RI7C 4A3BB 4ICVA 4K8IA 3TJPA 1F2RI 2CS4A 1A63A 4QIWE 2WDQB 4LDTB 1JWSD 2ZT9C 2L5TA 3GTMB 4ODGA 3H8HA 1U4AA 3CF5A 4KHPL 1WGDA 1LUZA 1Q1EA 3OW7A 1EOVA 1LXDA 2R6GA 1I4PA 2BB6A 2LD9A 2WU5B 3Q69A 3ZRCA 4KTAA 2WDVB 1BT0A 3T1HQ 1LTAD 2C35B 2Q8RE 4UPAA 2NWGA 3J80L 1EWIA 3BZKA 2FJ2A 1WOCA 2E76C 3T16A 4EQNA 1FR3A 2W3SA 1NENB 2M4NA 1M1KC 3HEJA 1XYIA 4PZ6A 1KIXA 3IFDA 5GROA 3GTOB 4DR6Q 2OTJA 1KXLA 5I6YA 1WGHA 2LFNA 2K39A 3EHVA 3GZNI 1V9JA 1VQHA 3PZ8A 4OWXB 1JQ4A 1EY0A 2UXCQ 1I4QA 3LWEA 1VQ5A 2LGSA 1JE4A 3S16B 3HRDD 3QOJA 2WAQG 1MJDA 1R9TH 3K0YA 3E3XA 4A8XC 5EPLA 2WNMA 4DV1Q 4QIWB 3VYTA 2LWPA 1XPUA 2Z0EB 2VQEL 1JALA 1U5KA 1IYUA 4IWPA 4A3DG 1BKBA 1MD2D 2K33A 1L1OC 2EY6A 2Y0SE 3TQYA 1E8YA 2KUMA 1PRTB 1DD2A 4OVVA 4W9IA 4P71A 2R92G 3I4MH 4Q2JA 4JI2L 4R4OA 1IKMA 3L0WB 1DXMA 1LTLA 2A5HA 2EYFA 5D3IB 1I42A 1HA6A 2DY8A 5H1SE 2E2DC 1WIAA 4GXBA 3K7UC 2EVBA 2I0QA 3M3YH 2FCQA 2AWNA 2F3VA 4RA8A 3ZDTA 4IUPA 2ZM6Q 3JAME 1O7LA 2IO0B 4V190 1U9RA 1XWEA 2PW7A 5I6WA 4FADA 3I4LA 3RLNA 1VQ6A 2KLGA 2FCMA 1PLFA 2WX0A 5C3EB 5M5YH 1YEZA 3N6RA 5IOIA 3RD2A 4YCVA 3IKJA 3AEEB 3OLMD 2XGTA 3GP7A 4A3JG 4XWTA 1B9MA 4JI7Q 2HQLA 1XJVA 1XQQA 4W9DA 1QB5D 4POGA 2XNAC 4X66Q 3SE0A 3NENA 2EYPA 1HR0Q 4AIMA 3QARA 2N1VA 1XMQQ 1OXUA 1BO0A 1XNQQ 1KRSA 1NE3A 4HEA1 4ZKBB 2M19A 1TVXA 2AWOA 4DR1L 2B8GA 2L0FA 1E3PA 5I2YA 2DAJA 3KVFB 2KWUB 1RD9D 3NVVA 4IUNA 4KD3A 1FNUA 2F0EA 2F0QA 1C77A 1SGHA 1UF0A 4BBNC 2SNSA 4DR5Q 3ONAB 1K83B 2M00A 3HOYG 3ZXRA 3H91A 2FFKB 3CWIA 4BBSB 4IJLA 1K8GA 4M8MA 3AH7A 3DEOA 1Y1VG 2ZJRA 3RLOA 3BJUA 1IYVA 1CHPD 2V3NA 2X8XX 3MXNA 3SFDB 2V3PA 3H94A 1WTXA 1G2TA 3GTPB 2OEDA 2K3UA 3RNGC 2L55A 2DLBA 3EVQA 1H9KA 3C2PA 2D9UA 4ZDVA 1X54A 1K28A 3SXHA 3RLFA 3P4QB 3G48A 1DGJA 1DOYA 1H95A 2RHQB 2BYVE 1A2TA 4IDIA 2NVQB 1E0BA 2XWBB 2HHHL 5K36H 2DBYA 3HUIA 5LNK1 3DVGX 4CO7A 5EBCA 4LF8Q 2WGSA 2G4DB 4WJQA 3NZ3A 4A90A 3SDLC 2R2QA 1R9TB 5IGCA 1WGKA 5IYBH 3LWUA 4WURA 3ZGZA 3TP8A 4II3B 1A2UA 3I73A 1OXSC 3PRMB 4IFDG 5KHQA 3UDGA 1S4ZA 2GBMA 3OW2A 2HT1A 4LW1A 3L9AX 3HGBA 3PO3H 5C0XH 4I6LB 3PUXA 3MXNB 1H9MA 5M5WB 4A3LH 1SF0A 1J7CA 2KAJA 2HHHQ 2WXLA 1T9HA 1YJWA 3DBRI 3D0FA 2D3BA 2HUGA 1OGWA 1GNUA 4ITKA 1IBMQ 3B6YA 4ZHPA 3M7NA 5HG2A 4C4VA 3LDZE 3Q3NC 2ZM6L 4QQBX 3S15B 1CA5A 4NMZA 4M0WB 2K8BA 5K36G 3HOZH 1FM0D 4C3JH 1T6BX 4YSYB 4JI2Q 1BUIC 4RHRA 3PIOA 4US9A 4OO1I 1SMYD 3FMCA 2PQEA 2DGYA 1A70A 2CH4A 3ITPA 3M85A 1EQRA 2EJFC 5L83A 2A6HC 5ELEA 3PO2G 4ARIA 3SDZA 3HOXB 4ZQ3A 3ZTCA 3EROA 2X6LA 2WFWA 4CDEC 3K57A 2WXHA 2LSSA 4B3ML 5E1FA 1WRDB 2BVCA 1JJGA 4RKLA 4DR4L 3Q3FA 3KF6A 5JHAA 1K73C 3AE4B 3KYCD 4OO1H 1BCPC 3H09A 1SJHD 2JSVX 4TV3A 2KT7A 3HRZC 1E1OA 5KIXA 3I70A 2M0AA 2QJLA 2RA4A 1YIJA 4JBMA 1QOGA 1CKNB 1EY8A 3BVZA 3RNCC 4DXGA 1Y1WB 3A0JA 3JSVB 3MTNB 1B3AA 1YNND 2MO0A 2NUCA 4MTKA 5I9OA 1PH3A 2KX3A 3PLUA 4DR2L 3SK5A 3P7JA 5TSSA 3RZOH 4US8A 2AWTA 1X3QA 3FDTA 3R8BA 2DYMA 4EZJA 2MBHA 3J7AF 3S2HH 2I07B 2NVYB 4ZK9B 1K52A 1QJOA 1ZGUB 2FCSA 3PO2H 3GB1A 4GS3A 2PPBC 1UEAB 3DWMA 3Q22A 4ZYNA 4A3BH 2KMAA 4P74A 4XT3B 4W9GA 5G2NA 1C7YA 3F1ZA 3K8AA 2VUMG 3NQTA 1WM2A 2LRWA 1IL8A 2AL3A 1I4RA 3RPFC 3ML8A 4JWUC 1A8VA 2K04A 4B3SL 3T8MA 1L4DB 1A3TA 2OCEA 2LY7A 2E6XA 2J53A 1YNJC 3I91A 4KIKB 1D4BA 3UI3A 4I65A 4LFCL 1EEFD 4YSZB 1QZGA 3P4SB 1KDCA 1RYJA 2EYHA 1V80A 1LABA 2G9DA 1DOLA 2UU7A 3STBD 3FPPA 3M4OH 2MBEA 2PW9A 4IUVA 2MNAA 1WD0A 3U4EG 3CCUA 4OWWB 3VRAB 2KNBA 3UDIA 3CIRB 1EIFA 4YY3L 4RF1A 2HJ1A 3OYYA 3KUZA 3VAWA 4LUZA 3DM3A 1ASYA 4FYDA 3RYTA 3VTWA 1IBML 4ME3A 1RFKA 1VZ8A 4HCPB 2I1JA 1HXYD 1Y8PB 3MEHA 2LHDA 3VYRA 2QMTA 3RFZB 3KBGA 3S2DB 3KK7A 2OQ0A 2XK5B 4NNJB 1TYGB 1SIJA 4APVA 3Q6BA 4KDLB 1R4PB 4ZRIA 3I5JC 1EY5A 1TY0A 3M4YA 3NHHA 3W2DA 1L6VA 2JZZA 2KHWB 3TEHB 3BVMA 1WE7A 1PRTC 2PQAB 2KDIA 1SB3C 2N9PC 1Z6HA 1WF9A 1KM7A 2B2VA 4YIJA 1TWHB 4JI3Q 2B2TC 3D3RA 1GVPA 4JQWC 1SEBD 5C4ZA 1ENCA 1N8RC 2UUBQ 3I4NB 1HNXL 3CF6E 3Q8EA 4HPMB 4BFRA 3DMUA 1E2WA 1UE7A 3L16A 3TBIB 4LMQD 1R4NB 5BYRA 1VQ4A 3P75A 4AQYQ 5ELCA 3Q3JA 2CJOA 2UXDQ 2N55A 4DHJD 1BBWA 3HOWH 4TUUA 5JAVA 3AULA 2G1EA 3P63A 3TSSA 4LF9Q 4HLEA 2KHSA 1E8XA 1SAPA 1E7VA 2ALYB 1QUQB 1YIWA 4C3IH 3QIAA 4G4KA 1XTCD 2JA5H 4LAAA 3K5LA 2PMZE 1JJ2A 3S24A 1PDQA 2RCNA 3A56A 1LT6D 4OHJA 2PEAA 4GIVA 1R4NI 4IUUA 4IZ8A 1JR0D 2VQEQ 2E2JH 3A8IE 2NZOA 4CKBA 4A93G 4K5VA 1HUNA 1WZ0A 5AZGA 1YBYA 2KA7A 2RHSB 3K0XA 4MH8A 5FR6A 1STGA 1I3QB 3GTQB 4S0RA 1IBKL 2GLSA 2CU1A 2QILA 2N88A 3GV6A 1F2MA 3RZWC 5EE1A 5EAYA 3DBSA 4KI0A 2UXCL 3OWEB 2LJ5A 3HIZA 3ZJVA 1LYLA 1PUTA 5FKAC 1EF5A 4R3DA 5H92C 1SR3A 1Z5SB 2JYTA 5EPJA 4A3CH 2HDLA 4GKKQ 3J80c 3GTGH 1D3ZA 3M3JA 4JI7L 1M90C 5BYQA 2NBFA 5C4JH 4GOPB 3H3VI 5C0XJ 1OEYA 2TMPA 2ONQA 3MFYA 4A3MB 4MNOA 1NY4A 5EJWA 4RWSC 5IGDA 2UUAQ 1UBQA 1AZPA 1Z9FA 3MC8A 1BBXC 3JVZX 2I46A 4NXNQ 4YWKA 1HNWL 2L32A 4X64Q 2QGQA 3ZO5B 1BDOA 2B2UC 3S2DH 3KOJA 2EYLA 5M9OA 3GTPH 4M1UB 3GS2A 3Q8BA 3WA0A 4F88A 2PNHA 1WI0A 1KNAA 1UE5A 1RTNA 4FF3A 1N34L 1GJXA 4Y7NB 4F7ZA 5E6NA 4URKA 1B2TA 1JWMD 3APDA 1N33L 4J3OD 1E22A 3F2DA 4PNYA 1FNVA 2HDMA 4DUZL 2IBIB 4XIGS 1G6ZA 1L0VB 2SNMA 1PGAA 3FKIH 1OXTA 2VB2X 2P5ZX 4BXXG 3F8TA 3MXGA 3G4SA 2VNUD 1S5BD 3A1QB 2JT4B 3BDLA 1ICFB 2WX1A 4WH4A 2PVGC 1SYFA 2MPMA 3CQZB 1SXTA 1MJCA 3HKSA 4LF6Q 1SMYC 4NXNL 1PMRA 4LDTD 3SGIA 4X62L 1VQEA 2F52A 2RSNA 3A5ZB 2ZXRA 3HKZE 4OIJA 4XQQA 3U9SA 1GHKA 1ZW7A 3DVNV 3HM6X 5LLIA 4BY7B 1VMPA 1L2FA 2KVMA 3M7GA 2Y5BB 1I4XA 4OVUA 3KF8A 4CJ1B 2BW2A 3L4PA 4WAFA 4K6LA 2KTRB 1IBLQ 5C23A 4L1BA 1CQFA 3RZFA 4JK1C 3GV3A 5BR8L 4ACFA 3HG9A 4WORA 1Q7YC 4BY7G 3HOVB 2D10A 4XYOA 4PMWA 4F87A 3A55A 4DV0Q 2BH2A 2N7JA 4F1SA 4UY8C 1C76A 2F4IA 4A3IB 4EUTA 2FINB 4P73A 1GUTA 1VRAB 1A6XA 4ZRZA 4EKUA 3GZNB 5JJKA 4JLCA 3F2UA 2EXDA 2KEDA 2K0PA 4G3XB 4WJPA 4DFAA 2KCCA 3CCRA 1XO3A 1P3QU 3DOWA 2BB5A 2RDFA 3NTHA 4FJZA 4ZOHC 4O1NA 3T3OA 2KCTA 1C9OA 1L0WA 1HZ9A 1QG7A 1ASZA 5JJLA 3PHXB 1MG4A 2DAFA 2JA7H 2V4LA 2WXPA 4PMCA 1QQRA 2KFJA 3BK2A 3BK1A 1E5WA 1SROA 3Q0AA 3Q24A 1NBWA 4R9WA 4ZRQA 3VRBB 1EY9A 1D1IA 4RHSA 1QT9A 5DM73 1STEA 4JYAL 3HOVH 2RDGA 3ZLZA 2C7HA 4DV5L 3TEXA 4W9HA 3CSFA 4WQOB 4BOZB 1L4ZB 1WR1A 5CV6A 2D2QA 1EO6A 2AUJD 1PYBA 2MO1A 1YD8U 5JPNC 1S5ED 4HVBA 1O7YA 3A4SC 4QY7A 3A7LA 1PRTD 2KQSA 4GOCA 3PREA 2RQXA 4DR1Q 2L1BA 4HTHA 4JI0L 1K53A 4JBJA 3D4RA 3J81L 4ZYSA 4NXMQ 5DEHA 4E3CA 2JN4A 1Q46A 2O6VD 1QUQA 1ZKHA 4X64L 4LUVA 1GUOA 3TUOA 4DNTB 3HM3A 2ZVOA 4E71A 1OTCA 3HOYB 3KYHC 5IYBG 2BOSA 5DAUA 1OQRA 1NCVA 2EE1A 1N61A 2VZKD 4HSVA 2DNFA 2WXMA 2R92B 1BUVT 1SIFA 1C4QA 4A3CG 1SYCA 4XQJA 1E7PB 1HZ6A 4KK7A 1XD3B 3TCAA 1W2BA 1CM9A 1WH3A 3I4MB 3AYHB 3CU7A 2M0XA 1Z2MA 2E2HB 1C79A 4YT0B 4A20A 2KDFB 1Q82C 1PFMA 1Q10A 2KX0A 4USAA 4DAYB 5LXIB 1SYDA 3C1EA 2RCFA 1K8RB 1YJ9A 5ELDA 3TEZA 1GHJA 3ZJTA 1U4RA 2KJXA 1YNJD 3WOEA 2G9HD 2CWAA 3CC2A 2MH7A 2YLMA 4FBJB 1TWGH 4N6EB 4CDCC 2PJHA 1Y1VH 5EKIA 1E2VA 2OTLA 3OHXC 1TWCH 2PCFB 5HGTA 1UWVA 4K3BA 4XYQA 4DNIA 2Z4IA 1ET6A 4HJ5A 3L54A 1TKGA 1TS3A 5CYUA 1Q8KA 3NHEB 4FULA 4UHVA 1BVSA 1ML0D 3OIQA 5COYA 1ZE3D 1D5XC 3I55A 1PH8A 2IHEA 4P1BC 3MJ5A 4AJWA 4LF5Q 1DJRD 1X9NA 3QJYA 2WHIA 4DK3C 2MBQA 2MJ8A 2F0PA 4RCOA 2N3SA 1PYWD 1GD7A 3CAMA 2F03A 3A74A 4UP8A 4IW0A 1YHBA 2N9KA 3VA7A 3S15H 4DK6C 4A3DB 5BN3A 2GVBA 1S72A 1DOIA 3HOXG 3LB8C 3HVZA 2PO4A 1FXTB 1D5ZC 3H7PB 2HD3A 5CV9A 3LNNA 4B9XA 4JI6L 1EY7A 1XF5L 2IY0B 4NW2A 2JA5B 5E7NA 1FGBD 5JEAJ 3KJOA 2EY5A 2UU9Q 4DR4Q 5E4XA 1VQGA 1K51A 3PHWB 1X65A 4C3HG 3T1HL 4S17A 4KKSA 5FK9C 2PYKA 2QF7A 4IUMB 3NXWA 3HFZB 4IC7B 4W9LA 1GC6A 4MN3A 1BCPF 1MSGA 3HOVG 4DWFA 1T0YA 2WYQA 5EE0A 4BS9A 1VCBA 2AKWB 2JU6X 2GBNA 2L0TA 1TIID 1SE3A 4DHZE 5K5PA 3E9HA 3H3VC 2M1MA 4GDLB 2C9WB 1H9JA 2F0DA 2DYOA 2ON8A 4A3PA 4JPBW 1V2YA 1P8LA 2L3ZA 1WR6E 1F9RA 1WTOA 1WTRA 3EBEA 3PGZA 1N34Q 3J7ZC 3GTMH 2MJ3A 4XC2A 3VXWA 5AJ3L 4A3GG 2F0HA 3NE5B 2F0FA 2E2HH 2EELA 3C8YA 3PPAA 1J5EL 1P1AA 3SEBA 1KC8C 4RGTA 2VS1A 2IX1A 2DZIA 1STYA 4GN3B 3ENEA 2NTSA 1GPXA 2XIWA 1PH7A 4C3IG 1EYCA 3G71A 2YEPF 2NVXH 2LXCA 2IHFA 2KECA 1H9SA 2KLCA 1HUMA 2KQ7A 3A9KB 1D1KA 4FJYA 3TIXA 1AZQA 4Z9CB 1WRIA 1CK1A 3PRPB 2MQHA 3RNAC 1NSNS 3J7YW 4MIUA 2Y5PA 1RODA 1DGSA 3S14B 3K5OA 5DM63 1FEHA 1PA6A 4TQ1A 1LTBD 3TZUA 5CMDA 1K9MC 3NSWA 5M3MB 3PF5A 2A69D 3PCOB 2MWSB 4BKTA 3W1SC 3RR5A 4KZ0A 3KQ4A 4XZ4A 5KNBA 2KJHB 4DV4Q 3RCZA 1EY4A 2BWES 3AI5A 3Q6SA 3M62B 4LF5L 1FMAD 1ZEQX 2F0TA 4KGTA 2K03A 4FF4A 2LVQA 1SE4A 3V96A 3H7PA 3V60A 4DK0A 4B3TQ 4AWJA 2BPSA 1VQJA 3Q8AA 4J6HA 4GLAC 3VH4B 3NVYA 1Q8IA 1TY2A 1VQIA 3GTJH 2KTRA 5A35A 3IG3A 3LYYA 1NMGA 1TS2A 3HHMA 1E9MA 1C1YB 5LHY1 2FIFA 4K7SA 1RIPA 1J0GA 3R3OA 1TIFA 1I4HA 3S14H 4KSLC 3ZJYC 5E6JA 4HAEA 1GB1A 3NK9A 2O2VB 5EE9A 1UAPA 4MM3B 2E2IB 1VZ7A 1J8IA 1XX8A 1Y8OB 2K5WA 3R2TA 1N60A 2JK8A 4AYBB 2IO3B 2LGIA 1EIYB 2PKOA 1SRUA 1KHIA 2AQ1B 2L12A 4KKIA 4A3IH 2IX3A 5ELNA 2CJNA 2KHJA 2YU9B 1PQSA 1UZXB 3H7SA 3IBEA 3CHBD 4DUYQ 1VJKA 1A3VA 2HTHA 3U58A 3FAHA 4JX1C 2DUDA 2N4FA 4A3GB 1Y8NB 4JE3B 1O80A 2IWHA 2K9XA 4EQPA 4C1NI 4M01A 4BVUC 5CHFA 4XDXA 4PK1A 3T4AC 3GTKH 5BR8Q 5KEEA 4A3FB 4G0NB 4NP5A 1K8AC 1YZ6A 3I56A 5AZFA 2J4XA 2JYOA 4X66L 1LTTD 4AYBG 4A93B 3ERSX 3S1RB 2B3AA 1X6OA 1HE8A 5M3FG 2BS2B 5FOBB 4GNXC 1SE9A 2JX5A 2ZCBA 4MGZE 2RGFA 3TEWA 5CV5A 2D0OA 4A3EH 2NVXB 3PLVA 3I4OA 3TMEA 1F77A 4GN5A 4H44C 3FPUB 4LK0M 1PTOC 1SNMA 1U4PA 4W9KA 3VUXA 2LZ6A 2N9EB 2VH2A 3ML9A 1F9JA 1OFFA 4OVZA 3MVVA 2K52A 3DEPA 5LL6S 5GAGC 3IXSA 2L05A 4OGQC 3MA2B 4GLXA 2KN5A 4TSSA 1AYFA 3IL8A 2RPVA 2ICIA 4M00A 2D2CC 1QILA 1U0LA 2WXOA 2CH4W 1U4LA 4LWCA 4A4IA 1MHHE 2JF5A 1B9RA 2E5LL 5D2MB 3RUZA 2VRRB 3DBHB 5HURA 3HOYH 3APCA 3W3AA 4WWOA 1TU2B 2XRQD 4PG3A 2WXGA 4KN4C 5M5WH 2GOWA 4KD4A 1F52A 1XNRQ 5JH5C 4MZ9A 1Y14B 4DV1L 2ENBA 2LUEA 3HOUH 1RL2A 3AECB 1TWFH 2WWZA 4XDCA 1FCLA 4TRDA 1OXXK 3QHTA 1GUGA 1KLGD 1Z7TA 1MG8A 5J18A 1E24A 4DNRB 5FO8B 1FFUA 2N7DA 2WXRA 2EZVA 2K8HA 3HP3A 3QX1A 5M5XH 5AZHA 1YN4A 2F3WA 3ALBA 5BMIA 2IL8A 4HR7B 1KJTA 2J7ZA 1IXRA 2HCIA 5EBDA 4P1CC 2R93B 5LL6X 3DM1A 3CCEA 2X69A 3OPOA 2KDEB 3ONSA 4S3SA 3VYUA 1H9RA 3OTOQ 5IGEA 5CGKA 2K1BA 5GQOA 5C0XG 4G57A 1PXUA 3PIP3 3J9CA 1G2SA 1G8ZD 2CWPA 2KVRA 5CTRC 2D11A 2JVCA 2W3RA 4IWQA 2MBOA 4AOFA 4O2DA 3T51B 4RM9A 3IHPC 2MRPA 2PE6B 2KO3A 3VHTC 2MEKA 3LJ3A 4AUQC 2VW9A 2FMMA 4ZUIA 4XXEA 2V3SA 5C3JB 1GM5A 1K8OA 4HJ8A 5JVH3 1FL0A 4WJ4A 1YJIA 5E6OA 3AE5B 5AEKB 4K5WA 3V61A 3CRKC 3DVGY 2JA7G 3RZOB 4QUFA 4A3EB 3A9JA 3PTFC 2OHFA 4QAYA 1X3FA 4NKLA 1LACA 1I35A 2ICEC 1Z47A 4DR5L 1Y1WH 4A3BG 5M3MG 1GO3E 4EVOA 4N9TA 3OTOL 1PH5A 5H8YE 4BBRH 3T9LA 5C2TB 5CR3A 1V97A 3WAOA 3V05A 1N5XA 1RFAA 1XEEA 3N20C 1PZJD 1YNXA 5IP9G 1HR0W 2BDOA 2EPBA 2D3AA 1HNWQ 2A73B 2Z9HA 4C7YA 1WTHA 3A4RA 5JEAG 2UUBL 3G7LA 4GOPA 1WXAA 4GKJQ 4HJ7A 1X56A 3MXUA 4N9PA 4O0AA 2YTXA 1Y1WG 2UUAL 3SHQA 1IYJB 2IYDB 3IFTA 4DR6L 1Y8RC 2CCZA 2F0VA 2NN6I 4DHZB 3AEDB 3ZNID 1YQBA 1B3QA 2DWQA 4DKAC 2LJIA 1MSHA 3P42A 1B44D 4P72A 3RZDH 3IT4B 3K5MA 4LF8L 1TGZB 5LXHA 1LO5D 1HZCA 5EKKA 1N36Q 1A5RA 4DR2Q 1F9QA 5IAAC 1JCKB 2WS3B 3IRBA 1CKMA 3QOLA 1Q1BA 1SNCA 3AEBB 3VDYA 1UELA 1KH0A 1IPGA 4WAAA 3AE2B 2BKRB 1KABA 4EZLA 5GXGB 1MVKA 5GAEC 3EA6A 2JA6B 3MWYW 3VR9B 3A1QA 1WVLA 2E5LQ 1B50A 3JAML 2NPTA 2H4OA 2NR2A 4ZKCB 4FVMA 4PQXA 1HFGA 4IURA 2NYZD 4KZCA 4N9F4 2CHZA 2DHZA 2QKIC 2JA6G 3RMHA 2YEPB 2Q2IA 3UDFA 4OX9Q 5IGGA 3RNBC 2J42A 4B6WA 2KVZA 2F0LA 1IL2A 1SFOB 2PMVA 3MHBA 1X3PA 2KOLA 3D6WA 4HSPA 1CZPA 1UWXA 4YWLA 2R92H 4QMGA 1L5PA 1V81A 4C80A 1HTOA 4KY6A 2K5PA 4WWPA 2FMCA 2EJMA 1N5WA 3GDEA 1WXVA 1RHPA 5IT9E 4C2MB 2UWQA 3AQQA 2B76B 2V1YA 4IJHA 2WV6D 2BTEA 1NNXA 2BYFA 1E7UA 2WP8J 2PTLA 1VQMA 4KY7A 2R2OA 3G6EA 1ICWA 2FXQA 2VH1A 1C48A 2CHWA 4LFBL 3PGEA 5C5MA 1ISNA 1STNA 1WM3A 4GU2A 4NY0A 2QDBA 5AUIA 4B0EA 2RMMA 4AQ7A 2JUOA 3UIPB 3BG3A 3W1BA 3GTJB 4K0KQ 2L76A 3DHGC 2WINB 3TBLD 5AFWA 3QO2A 2KK8A 3H6NA 3V2TA 1ESRA 4JV5Q 2CW0D 3KLWA 1GUAB 1PH4A 2ACZB 3ECIA 5LMUQ 4CYEA 1CKOA 4PZ8A 3FC4A 2LI5A 4I7AA 2C60A 3U7DA 2BA0A 2D3GA 3A33B 2OWOA 3NP8A 2K6DB 4C2MH 1PGBA 1D7QA 1MIUA 1WGYA 4CDFC 2JA5G 3SR6A 1UNSA 4DAPA 5C4XB 1SYGA 2JRHA 3J81E 1I3QH 3GTQH 1EQQA 2D5GA 2K8CA 2GN5A 4KN7C 5EQ0A 4FF1A 4HDOA 1D6EC 1WI5A 2B63B 2INPE 4M8NA 1L0YB 1VLBA 3CPFA 3I2ZA 2R7ZB 2BYTA 1HTQA 2EYMA 2YVCA 1ZOYB 2EY1A 2K5QA 3VDZA 1P16A 1X55A 4HPLB 3ZUNA 1BBUA 4HK2A 3DWQA 3URYA 1MPEA 3CC7A 4RGOS 1E10A 4IPGA 1ONLA 2K75A 1WCMB 3H0GB 4DXFA 1FO4A 1I7HA 2I38A 4PS3A 3U9OA 4EFOA 4GKJL 3JSVA 5HKHA 3FILA 3VH3B 3TMPB 5HHDG 4R4QA 1ZDVA 5JJZA 1PHJA 3J7AV 2JPHA 2CHXA 2VL6A 4LNFA 1DCZA 2KQ4X 2BBCA 4NAMA 3WAMA 4NJ7A 2MP1A 1J6QA 4KKTA 2DZJA 3FKIB 3AE6B 4BBSG 2K32A 3U7ZA 4AH6A 5DLQE 3NJTA 4BBNF 2MCNB 4IOIE 1JRUA 5BYSA 2K5NA 5D7GA 1K50A 4F8CB 4GNXA 3AN1A 3DCGA 1TZOA 1KLUD 3I4MG 4B08A 1ZXIA 3TP6A 4ASWC 2K4KA 2ID0A 3DUZA 2XBBC 3VR5A 2L11A 4HIKA 4EZKA 3ZJUA 3D4WA 2WAQB 2JXMB 1WTQA 4TQ0A 4FHKA 2H88B 5FLXc 1HQMC 3BVGA 2DJGC 1Q12A 2JQOA 1QVCA 1PH1A 5ISRA 1N33Q 3TP7A 4R4TA 1JC7A 2F0UA 2MP2B 4M02A 3EJIA 4P6VF 4N58A 3I3TB 2GRIA 4OWTB 3AV8A 3V6EB 4BWGB 3X23A 2XK5A 3Q14C 3QAQA 1VQPA 1ZXHA 4DK5A 1VQOA 3HZXA 3AEGB 1ROEA 2AMCB 5M3FB 4LF7Q 3M4QA 5FJ8H 3ZDMC 2HTME 2Q8IB 1MGSA 4K8JA 3EECA 2KENA 1TWHH 3C3LA 4A9AA 3EUB2 4FF2A 2DNCA 3KUPA 4YL8A 1YNNC 3CMMB 3NUHB 1JROA 4NAWA 3V6CB 1D2BA 1XXGA 4YWMA 3BIID 1E6EB 4MM3A 1Q86C 1FIQA 3QWZB 3AB9A 4U68A 3VR2A 1OQYA 4MGYE 4LJOB 3KLSA 1HQRD 2HIXA 2VXWA 1IBKQ 4X57B 4M0WA 1PTOF 1V49A 2HCCA 1EIHA 1XLNA 1HTPA 3E9IA 1QLBB 4GDKB 1YJNA 5J17A 4OL7A 5JEAH 1WCMG 3H0GG 4HKQA 2KN4A 2ZVNA 5IP9H 4YTMB 4ALPA 4JI1Q 4RG1A 3CP0A 2E2JB 2C7MB 1FYCA 2JSOA 2B2TA 4X3TA 4BBRG 1C4AA 3T13A 3AFQA 3L3OC 2ZTEA 3V3XA 2A4ZA 3J80E 2F0KA 1V8QA 4ZLTF 2A5UA 3T3NA 1EIGA 3TS0A 3I4NG 5D6JB 1IYFA 3BDOA 2Z6KC 3NTIA 2INCC 2JYEA 4MACA 1CA6A 1H9SB 1ENAA 3M4PA 2QHOA 2SOBA 3HVDA 2NVTB 2RBMA 4L5SA 3J80i 5JVG3 2LMCB 4I7ZC 3L08A 3MC9A 3K81C 1GXDC 2H89B 4JOIC 2R7DA 1V1QA 3I4NH 3PO2B 3T1YQ 3PO3G 5HY6A 2J7QB 2V9HA 1EYDA 1MHWC 4IFDH 3OJ4B 1XT9B 3PQIA 4DR3Q 4ULLA 1AE2A 1NYQA 2W82A 1M94A 1T0QC 1S5FD 2WB1B 3R66C 1VD2A 2JEAI 3Q8DA 3ICEA 1NJIC 3H1UA 2F1MA 1TWGB 1YX5B 2M9VA 4A3KG 4KX6B 4OEMB 4C3IB 2IY1B 1IUEA 4L6TB 2OJRA 2NZ1D 3SVMA 4L23A 1F9PA 2SDFA 4YWGG 1S40A 5IP4D 1VCIA 4LK1C 2LMCA 2Q5WD 3VVWB 2PZTA 3ZNHB 4P2CB 2MHJA 3IAYA 2FAZA 1WGRA 3Q8CA 5DNFA 2RPQA 2N8NA 4A3MG 2XEWA 2PW5A 1YN3A 3K6OA 4BA2I 1J7AA 4OZCA 1CHQD 2F0MA 3FVQA 5DCNA 4DQOC 3DXJC 5IA7A 5JOBA 5L37A 4X65L 2MP2A 4KJOA 2KMCA 3M63B 1EQTA 1EEID 4UAIA 2VY3A 3BZDB 5A2QL 1YI2A 2DY7A 4BY1B 3GTGB 4ME5A 1PFDA 2HE7A 2ZCCA 4NPNA 4L5TA 1HEZE 3KF6B 1S1QB 2WU2B 3DBLI 1K8MA 2F0SA 3PRZA 2B2YC 1FXIA 2QSDA 3CCSA 2EJGC 4W9EA 3MXPA 2XVSA 2REXA 1W6JA 4C3HB 4GOPC 3MTSA 4GN1A 1WJ6A 1WZ3A 4BOSC 3E0JA 1NYRA 1PFNA 1ZDXA 2KANA 1IGDA 2ZJPA 2FE8A 4KMUC 3VUWA 2O5JC 2BS4B 5DPTA 1A0IA 3I7FA 4F7XA 5G5GA 2BE5D 1HRJA 2KYWA 1I50H 2MX2A 5C0XI 1K83H 1A15A 2CFMA 4HMIA 1V86A 4IG7B 2KKCA 2CQAA 2ZJDA 5D65A 4JPSA 3DLLA 3ULJA 3E6ZX 4J8QA 1N32Q 1FRDA 4JBKA 1SE2A 2OXPA 3K58A 1YN5A 4TMAB 1YITA 4LF6L 4IOCA 1EFWA 2A74C 1QKZA 4JI5L 4JVZA 1L1OB 1I94Q 4FO2A 5LMUL 3QQ8B 4HDQA 2K5VA 2HIVA 1EM7A 2KWCA 3TS2A 1PTOH 1E8WA 1VZ6A 1V1OA 1S5CD 2I5HA 1XLQA 4AJYB 2A1AA 3PZ7A 2PLPA 4WRDA 1OQQA 4NDXA 5T1IA 2KOXA 3AM9A 1LT3D 4DXAB 4O42A 1SSOA 2RR9A 5G55A 1J7BA 3DBRB 2G4SA 1BCPB 4ABNA 1XMQL 1TKWB 2GA4B 5BMHA 2MUYA 2BH8A 3UI2A 1FNWA 1HH2P 5C4HA 3W1GA 1KFYB 3QB3A 2JRIB 4NPSA 3RD4A 2W9NA 3UQBA 5KNCA 1H4RA 1TJEA 3PT2B 1YNTE 3C1FA 1S3OA 4AS1A 4BKSA 3B08A 3NBHA 5G3LD 5M3MH 3J7A5 5IODA 4N59A 2Z1CA 3I8ZA 5GAHC 1EUVB 1UH6A 1CFMA 2J0TD 1CSQA 4JW0A 3F2BA 1EFID 1KRTA 2V4IB 3W9CB 1VS0A 4UDUC 4OX9L 4QF4A 1QE6A 1YOVB 4JI0Q 3GE3C 2O2LD 1LT4D 3RNEC 3BS1A 3PZDA 4BAXA 1CZGA 3RMKC 3HOZB 5IYCH 2WQYB 4KSKC 2Z59B 2PE9A 1B7YB 3A7AB 1WX9A 3R7RA 1GG3A 4EX5A 1VQ9A 2D3CA 1FD6A 1ET9A 2Z6BA 1B4OA 5FO7B 1ILPA 1FXAA 1E2ZA 1WYWB 1ZXTA 2YV5A 2ZNVB 5C1ZA 1O7IA 2QW7A 2OQKA 1WTVA 1A3UA 1XPRA 1RLFA 5IY0A 1VQNA 2XTIA 1QF6A 2UXDL 2PI2A 4ANVA 3NTKA 4CBVA 4A3GH 1F2RC 2JXXA 1I50B 1K3BC 5J1ZA 2AYOB 5IT9c 2L83A 3L13A 3QK0A 2O5IC 3WOFA 1NTGA 3APFA 1STBA 4DN4M 2K14A 3I63C 4KGSA 1N36L 1JMLA 4DDGD 2MFIA 1T3QA 2LFIA 3EGRA 4IUTA 3WCQA 4JV5L 5M5YB 4GMVA 4L5QA 1WYGA 2JA8B 4JBWA 3MHZA 4A3JB 2EYJA 2F0IA 2KACA 3RNUA 4DU9A 3P2BA 4K0KL 4K5XA 2K5DA 4XTCS 2R93G 1KRHA 1HR0L 1IP9A 3S1QB 2LUMA 3AXCA 3PO0A 2B2YA 3VQIA 1RAXA 1M4VA 3MHSD 1TXYA 2F3IA 5LMNW 1VQCA 4ANXA 3DDCB 3AU7A 1EWYC 3IAM1 3RN9C 1SYBA 5KRUA 2LS01 2G5DA 2RF4A 3D32A 4KIKA 1XCQL 4JYAQ 4AYBE 4CHKA 4FJVB 1KDBA 4DPGA 1SNOA 4I6NB 1EF1A 2VZAA 1OTRB 2EMSA 5DPWA 1LTSD 2EY2A 2KBNA 3KWVA 1PRTF 1X3GA 4W9FA 2AUKA 2CHBD 2IX0A 4A3EG 4HPPA 1B9NA 2IW3A 3I72A 3HOUB 2GBKA 2A68C 5F2DA 1AARA 2L52A 1N62A 2QCZA 4II2B 4PT5A 3KLSX 2EMTA 1VQFA 3EIVA 3E0EA 3WANA 2B8FA 3AEVA 3KDFA 2CR5A 2KTFA 1WX7A 4C00A 2PZWA 1Q81C 3M3YB 4OZAA 2QIEB 2M8SA 2L8JA 4NQKE 4V0BA 4DAVA 5G3LF 1L2NA 1BF4A 2I1KA 1LV9A 1WJNA 4DV0L 1JB7A 1BQQT 1QNUA 2Z6KA 2UXBL 4XQNA 1FGUA 5EKLA 3QCAA 2L1AA 1S3SG 4MGIE 1CI3M 1KNEA 3S17B 4ICUA 2A19A 3ULPA 2JXTA 2IO2B 3SD5A 3P20A 1JW9D 1XLPA 3KBXA 5ELBA 3FP9A 2DZMA 1AEXA 5ELFA 2PZUA 3TP5A 2VQFL 5IOCA 2I5MX 1BR9A 3AE3B 4ZRKA 5FO9B 2M2LA 2V1CC 2UXBQ 2C5CA 4JG2A 3U2SC 3VFKA 3DHQA 2LGDA 2JA8H 2SEBD 5CC4A 3MEFA 3U50C 2ZEQA 4EEWA 1TS5A 3AE8B 4IM2A 3L2PA 4N8X1 3T56B 4OIKA 3GTLH 2N7EA 4BY1H 1TKEA 2PPHA 1KQSA 2ES2A 3AEFB 4DV2L 1TQOA 1VF7A 1P0RA 4BBRB 2ZPNA 1FVIA 1CMXB 4KDIC 3FILB 3GQBA 1LTGD 4WWMA 1WCMH 3H0GH 2BT6A 4ZRPA 5E6PA 1K3RA 1VDZA 1AW7A 4KKUA 1STHA 4FDBA 3QIJA 4WQMA 4LLGM 3SHLA 2ZXPA 3NWSA 3HOUG 4JI4Q 4A3DH 4G7OC 2N0SB 3K59A 2ZZPB 3IT6B 1QOFA 2Q2UA 5C4JB 2K01A 4OO1G 1HFNA 1HHVA 2KWDA 1LTID 4L8JA 4JOIA 5IWAL 2KMMA 5IKCM 1I6VC 2A6EC 1NR2A 2Y0SG 2KQ3A 4YCWA 1EOTA 1UUPA 4A3FG 1RTOA 1HZ5A 4I6PA 3ZNZB 3ZW3A 4DDID 4K81A 4GB9A 4DK1A 4PYZA 4A3MH 2D07B 4LFAQ 1YHAA 2KJRA 1Q0WB 1Q90A 2ZXOA 2ZPYA 1H8CA 2WAQE 1TKYA 3VR3A 2Q2HA 4D2KA 4EOYA 4Y7NH 4DA2A 3GOEA 1C9FA 5C3EG 1Q5WB 3E56A 4WJOA 4LF4L 4DBGA 1NBFC 4QCLA 1DZ1A 3HK0A 2B39A 2L0CA 2R61A 3X3MA 5FLMH 4H02A 2B63H 2NCNA 1JMCA 3NVWA 3KYDD 4FHJA 1EYAA 1G6JA 1L6UA 3ZRFA 3PUYA 4RKBA 1FJGQ 1ZYRD 2HD5B 1G6PA 4G7HC 5DPRA 4IOAA 3PV1A 3G6JB 4POFA 1XMOL 3QWNA 5IN7A 3PIPA 1UBIA 2KWVB 3ZKJC 4R4IA 4LFAL 1T5XD 3HOXH 1B1ZA 1WJUA 2NBVB 1SN8A 4BXXH 4HMJA 3AFPA 3NUCA 2K1FA 5IO9A 5C4XG 4A3OA 5M5XB 3VTUA 2H1EA 2K7VA 3I3CA 4P16A 4WFN3 1HZBA 2MA9B 4GGQA 5D94A 4IN3A 3A9KA 2RKSA 2LGXA 3Q2AC 1CKNA 2IGGA 1KOTA 1VQKA 3CSTA 3KW5B 4K7WA 1TZ1A 3NEMA 1P7FA 1K0RA 1QNKA 1WXQA 1TT5B 3EFXD 1X1MA 5IP7H 1WY8A 3MJWA 3CRLC 4C1NK 2PVOD 3OMCA 3OMGA 1IW7C 1MBYA 2KEEA 3OWFA 1JRPA 3KJPA 4DAMA 4LNIA 5AUKA 3JYUA 4M8AA 1YQ4B 4GSWA 5IE8A 2ATWA 1KDAA 2HQEA 1I6HH 1R7SA 1B53A 2WXFA 4AP4C 4X6AH 1KL9A 1GAQB 1HNZL 1N63A 4KJNA 2GI9A 5BO4B 4F8MA 4GN4B 4OELB 3CCQA 1NR4A 2WIIB 1UGJA 4NAWB 4ANWA 3R93A 1GUWA 3C46A 5C6AA 3L0OA 5KNDA 3N3KB 3NOBA 2VB3X 4RF0A 4HROA 1VQBA 4B3SQ 2CVRA 1RM6C 4DV6Q 3EC8A 2LGYA 2DENB 1A62A 4H13C 3U4ZA 1JT8A 2LEKA 2MGSA 3FEWX 1PTOD 3GD7A 4J1MA 3HKZB 3ER0A 2F0NA 2GB1A 1N6ZA 2WXQA 4DR3L 4GLVB 4JL9A 2LXKA 2W55A 1V6EA 2QC8A 1G91A 5JXVA 1QZHA 3J81i 2NZHA 5I9PA 1CTMA 3CC4A 2WXNA 1ACCA 1XCTL 4EE2A 1WTWA 4TVAB 4X3UA 4HJAA 1GC7A 3HOWG 1AWDA 2GBRA 2N9LA 4IUQA 3RZDB 3CW2C 3N1ZC 3R3MA 2V0GA 1YQ3B 1P7EA 4RMFA 3D31A 2BE5C 4L5RC 4LF7L 5GADC 1ZPSA 2ZW0A 2M56B 3EFUA 3BINA 4JCVE 1C8CA 1FPYA 1XTDA 4WJ3M 1NAPA 4UP9A 3S1RH 3ZTDA 1L7YA 4GKKL 1RKNA 1WSPA 4XT1B 2QDFA 2F0JA 1CSPA 2DJFC 5IWAQ 4W9CA 4KHZA 4A6QA 2BF8B 1UE1A 3P4PB 3U4VA 4DR7L 4LNQA 1HPCA 2KDMA 4OXPA 2JP1A 2F0OA 5FLXE 3RN5A 1AH9A 1LM8B 1TTNA 2Z4HA 3TZDA 5DPSA 3O13A 5C3WA 2UUCL 2A8VA 4IFDJ 4B9KA 2SAKA 2WB1G 4HCEA 1F2ZA 2E3TA 2NS5A 2JA6H 2BYEA 4BKSD 4X65Q 1F2LA 4A76A 3LGJA 4PV1C 4K14A 1SMXA 5HFYA 1FJGL 4ZRJA 1TS4A 2NBWB 2NN6G 3S9WA 1U4MA 1AP0A 4DV2Q 2E2IH 4HN7A 1V5TA 2NPTB 2HDEA 3KFUA 5FR3A 2BA1A 2ZTCA 5EE3A 3RUIB 1JB3A 4MELA 3PMFA 3HKZG 2KXJA 4L63B 2J52A 5LMNL 3C19A 3WIMA 2EDGA 2UUCQ 1GJZA 1GUNA 1OO9B 2K6AA 1VQAA 3JC66 2XWJB 4CJ0B 4R8NA 5IYCG 1I6HB 1LGRA 2A69C 3MAQA 3T1YL 1O78A 3FRPB 3IAS1 3SK4A 2JWUA 2IDYA 2B2WC 5G5HA 1NDDA 1Y56A 2L4NA 1NVID 4OW0A 5IGFA 4CHTB 2WLBA 2QDLA 5C3EH 1QWYA 4MHEA 4JGHB 3ETRA 4ZHOA 1YJ1A 4YHHL 3M9BA 1II3A 3ULLA 3ND8A 1LFDA 2C5LC 3S2AA 4BZAA 3DHIC 3RT3B 3FKIG 3AE9B 3I9V1 3KH0A 1UGMA 2IGHA 1TR5A 4WJWA 3S2HB 2L15A 2F0WA 4EGVA 3K7AB 2G3QB 5LMNQ 4XDDA 2ZNVC 2Q8TA 3JAMc 3NZUA 5IYDG 1RCVD 2WACA 1VQLA 1NI2A 3OJ3A 2WP9B 2J0KA 3U30A 4GDLA 4QB4A 4H0LC 3K5NA 1EY6A 3X3NA 2NVTH 2AQ2B 1J19A 4RCNA 1V1PA 2J0JA 4MDKE 3VUYA 2Y0SB 3BU2A 1IKLA 1ENFA 2R7ZG 1OXVA 1B8AA 1TWAB 1EL0A 4B9WA 4DV3L 4YTNB 1UWMA 5C5LA 3T53B 2WXKA 1BXTA 4C3HH 2OJWA 4W9JA 1CQVA 4KV6A 4IPHA 1QOAA 3BDCA 1PZID 3PIO3 1R4MB 3S1NB 3DHHC 4LNKA 3U52E 4TKOB 1VR9A 3PUVA 2WDRB 4B0MA 3SK8A 1Q3LA 2FUHB 1IBLL 3JW0X 2WXJA 3KF8B 4PMBA 4A55A 2LXAA 1NI3A 2WKDA 3CMAA 1RDPD 2JA8G 2JJQA 1V5OA 3UGBB 2MJEA 1WX8A 4BKGA 4DV7L 5J39A 1QVFA 2BQQA 4ZUJA 1K0SA 2QCPX 4JI4L 2R93H 3DQVA 1NUCA 1F0ZA 2WKCA 3BZCA 3QA8A 4U673 1O7ZA 1ZUD2 2K5HA 2XSCA 5CV7A 4G7ZC 3H15A 1JJCB 3KDFB 4CJ2C 5I4DA 2BKFA 2C9OA 4TKNA 3K80C 1G291 4DGZA 2K25A 4YTPB 5CHWA 2F4VQ 3I90A 4Y52H 2JE6I 3VR8B 4IALA 3V62A 2PNRC 1SNPA 2K22A 5IIFA 4BA1I 5IGBA 4JI5Q 5JZEB 1HNZQ 1SYEA 1V9PA 3L7ZC 4NJ6A 2MQJA 2D62A 4HWIB 3X0WA 4C7ZA 2B63G 5E4WC 2MW5A 1FRRA 1NEKB 2MJDA 2FCNA 4RGMA 3QC8B 4C3JB 5C44G 3UIOB 3S1MB 1TWCB 4FXCA 1KAAA 1MKHA 1G51A 2CU3A 4IQZA 2QA4A 1SFOH 2DZKA 2W54A 3PS6A 3PUWA 4YCUA 2GVAA 4CKCA 1D5MC 4K1RB 3L17A 2AL6A 2L9HA 1ESFA 1SDFA 3DPDA 4CDDC 4A3KH 4JI8L 3DVNU 3K9OB 1C78A 4MSMB 3DBLB 1EZ6A 2B2UA 4LJPB 5NUCA 3UE1A 3FHWA 1VMCA 4YSXB 3NY5A 2INNE 3NS8A 3E5SA 2N1WA 2KHIA 2B29A 3K7AH 4Q5VA 5M3FH 2YU9H 5A2QE 1RF2D 2MSED 3NBHB 3NVZA 1HCZA 4OONA 3PSIA 3DWAA 1FFVA 3AU5A 4PS8A 1HTLD 5JHBA
chains in the Genus database with same CATH topology
3NWTA 1HA5A 5MPOA 3OSOA 2E74C 1JICA 1EWCA 3TN2A 3GTLB 4RAUC 3HS0C 3OOCA 3NBIA 4ILWA 1F2YA 4DAYA 2I2YA 5T1GA 4CGYB 4RFBA 4X3KA 5D3DA 1SSNA 4JWSC 1QOBA 5KGUA 1IBXB 1BOSA 5E3FA 1WTPA 3DWPA 4FP5D 5CBAE 3QG1A 1DOKA 1LTRD 2XRSD 4ID6A 3Q23A 2BCOA 2EYOA 2EXZA 4RH6A 2VZKB 3DWGC 4HEDA 2LKVA 2RVLA 3P4RB 1FCCC 1PDXA 4H2AA 1EWHA 3MP9A 1WD1A 4KGRA 5KYIA 5CORA 4HJGE 3BYTB 2PMZB 3A8KE 3AMUA 3KLRA 3LXFA 1SNDA 1VDVA 4GLSC 1ZP0B 4E6IA 2WXIA 3NRZA 4L2YA 1IBXA 1ILQA 2ZW1A 4NJCA 1RJTA 4K6DA 3WDNA 1XLOA 3BYYB 3PV0A 1MHXA 3AE7B 1R4QB 1V43A 4NZLB 3NPPA 3SR1A 5IT9L 4CQNA 2JA7B 1SJED 3W5UB 1JWAD 2IPKD 5J22A 4IKGA 3Q8FA 1E0ZA 1X32A 4OZBA 5CV8A 1JOKA 1W6KA 4REZA 3NS1A 2NN6H 5EPKA 1IGCA 1IW7D 1JORA 1EZ8A 3P1MA 2X38A 1SNQA 2FUG1 1JQYD 1DOMA 1WWTA 1GOZA 4WIPA 3ERQA 4LTUA 1FD7D 1DYQA 2IGDA 5T8IA 2B2WA 2QEJC 3GTKB 1F9SA 2K05A 4FXGC 3N52A 3TEYA 4XE0A 5KYLA 1GUSA 4TQUS 2JEBI 5D14A 1PGXA 5JPMC 3B2FA 5BN5A 1S5DD 4ARCA 3ND9A 2OT2A 1PTOB 2OEOA 1STAA 1MI2A 2AQ3B 4KHVA 2Y3AA 1JOOA 3VR4A 1ZYRC 3B2GA 2F0GA 2XN9C 5EGTA 3CKIB 5HI1A 1YJJA 3OIPA 4FXKC 3W5VB 2KCNA 2Z8LA 1Y1VB 3A54A 3A8JE 3P1HA 2NB0A 1LLRD 1C4CA 1LT5D 2FBWB 3M4OB 3AE1B 3VR6A 1QCBD 3PUZA 2JZPA 2A6ED 1EU4A 3MZ5A 2E75C 4FNFA 3SFEB 2EKIA 4GZYC 3SK6A 2DN8A 2IT1A 4RGNA 4KY5A 1L0XB 4EQOA 4A3KB 1AFPA 4C3JG 4X3SA 3R2IA 3MFGA 2NTTA 4HCSA 3D8GA 3KWLA 1SBBB 2AX5A 2CW0C 2RDHA 3TDQA 2BDNA 4CKEA 2X6GA 1V1PB 2YYZA 4IFDI 5CBEE 2TSSA 2R3ZA 3D4DA 1DONA 2EOTA 2K28A 3W1SA 4ZAIA 1C4PA 2MHVA 3ABVB 5C3XA 3MC0B 4FXDA 4DF7A 2VUMB 5BN4A 1KF6B 4YXDB 1TWFB 3H6MA 1V8CA 3AEAB 2JQRB 4H7BA 3I57A 4QUCA 4RNAA 3ZYYX 1QOHA 1BNZA 1ZKOA 3VA5A 4LJZC 1PZKD 4C56C 1J9OA 1BCPD 3AB5A 1IHZA 1JWUD 4HKZE 3NQIA 2V4DA 4XWWA 1KTKA 1GB4A 3BWUD 2BS3B 2FHTA 2D5DA 3PO3B 4MT5A 3EQLC 2A6HD 1T5EA 4Q0FA 5I2XA 2PIAA 1M8AA 3VYSA 3GO5A 2A68D 3B9JA 2O4XA 2Y5CA 3HOWB 2NMQA 2DNEA 2IJ0A 2RSOA 1BMLC 1DOXA 1JOQA 1EU3A 2OF1A 2B2VC 4R8IA 1Y69U 4KKJA 1JWBD 3D6CA 1RWSA 1AN8A 1MI0A 3LX0A 1EQVA 5CV4A 3N9YC 1DM0B 4K2LA 1CT1D 4HRSA 2LHEA 1PFBA 3ZQ4A 1I4GA 1CJEA 4K2KA 5FLXL 1TT2A 1VF5C 5BMGA 3AMZA 5C44B 1YMHE 3E9SA 1CZWA 4A3BB 4K8IA 1F2RI 2WDQB 1JWSD 2ZT9C 2L5TA 3GTMB 4ODGA 3H8HA 4WQMA 2BB6A 1Q1EA 3OW7A 2R6GA 1I4PA 2WU5B 3Q69A 4KTAA 2WDVB 1LTAD 2Q8RE 2NWGA 3J80L 2FJ2A 2E76C 4EQNA 3T16A 1FR3A 2W3SA 1NENB 3HEJA 1XYIA 3IFDA 3GTOB 5I6YA 2LFNA 3PZ8A 1JQ4A 1EY0A 1I4QA 3LWEA 1JE4A 3S16B 3HRDD 3QOJA 3K0YA 4A8XC 5EPLA 2WNMA 4QIWB 3VYTA 1JALA 1IYUA 1MD2D 2K33A 2EY6A 2KUMA 1PRTB 1DD2A 4Q2JA 1IKMA 1DXMA 2A5HA 2EYFA 5D3IB 1HA6A 2DY8A 2E2DC 2EVBA 2AWNA 2F3VA 4RA8A 4IUPA 3JAME 1O7LA 4V190 1U9RA 1XWEA 2PW7A 5I6WA 3I4LA 1PLFA 5C3EB 3N6RA 3IKJA 3AEEB 3GP7A 4XWTA 1B9MA 1QB5D 2XNAC 3SE0A 2EYPA 1OXUA 1BO0A 4HEA1 4ZKBB 2M19A 1TVXA 2AWOA 2B8GA 5I2YA 1RD9D 3NVVA 4IUNA 4KD3A 1FNUA 2F0EA 2F0QA 1C77A 2SNSA 3ONAB 1K83B 2M00A 3H91A 2FFKB 3CWIA 4BBSB 3AH7A 3DEOA 1IYVA 1CHPD 2V3NA 3SFDB 3MXNA 2V3PA 3H94A 1WTXA 1G2TA 3GTPB 2OEDA 2K3UA 2L55A 2DLBA 3EVQA 1H9KA 3C2PA 2D9UA 3SXHA 3RLFA 3P4QB 1DOYA 1DGJA 4IDIA 1A2TA 2NVQB 1E0BA 2XWBB 5K36H 2DBYA 3HUIA 5LNK1 5EBCA 3NZ3A 4A90A 1R9TB 5IGCA 1WGKA 4WURA 3LWUA 3ZGZA 3TP8A 1A2UA 3I73A 1OXSC 4IFDG 1S4ZA 3L9AX 3HGBA 5C0XH 3PUXA 1H9MA 5M5WB 1SF0A 1J7CA 2KAJA 2WXLA 2HUGA 4ITKA 4ZHPA 3M7NA 5HG2A 3S15B 1CA5A 4NMZA 5K36G 1FM0D 1T6BX 4YSYB 1BUIC 4RHRA 4US9A 4OO1I 1SMYD 3FMCA 2PQEA 1A70A 3ITPA 3M85A 2EJFC 2A6HC 5ELEA 4ARIA 3SDZA 3HOXB 4ZQ3A 3EROA 2X6LA 3K57A 2WXHA 5E1FA 4RKLA 3AE4B 4OO1H 1BCPC 3H09A 1SJHD 2JSVX 3HRZC 5KIXA 3I70A 2M0AA 2QJLA 2RA4A 1QOGA 3BVZA 1EY8A 4DXGA 1Y1WB 1B3AA 1YNND 2NUCA 5I9OA 3SK5A 3P7JA 5TSSA 4US8A 1X3QA 3FDTA 3R8BA 2DYMA 3J7AF 2I07B 2NVYB 4ZK9B 1K52A 1QJOA 3GB1A 2PPBC 1UEAB 3DWMA 3Q22A 4XT3B 3NQTA 1IL8A 1I4RA 3RPFC 4JWUC 2K04A 1L4DB 1A3TA 2J53A 2LY7A 2E6XA 1YNJC 3I91A 1D4BA 3UI3A 4I65A 4YSZB 1EEFD 3P4SB 1KDCA 1RYJA 2EYHA 1LABA 2G9DA 1DOLA 3FPPA 2PW9A 3U4EG 4IUVA 1WD0A 3VRAB 3CIRB 4RF1A 4FYDA 1RFKA 1VZ8A 1HXYD 1Y8PB 3MEHA 2LHDA 3VYRA 2QMTA 3RFZB 3KBGA 3S2DB 3KK7A 1TYGB 1SIJA 1R4PB 1EY5A 1TY0A 3M4YA 3NHHA 3W2DA 1L6VA 3BVMA 1PRTC 1SB3C 1Z6HA 2B2VA 4YIJA 1TWHB 2B2TC 3D3RA 1SEBD 5C4ZA 1ENCA 3I4NB 3Q8EA 3DMUA 1E2WA 3TBIB 4LMQD 5BYRA 3P75A 5ELCA 2CJOA 2N55A 5JAVA 2G1EA 3P63A 3TSSA 2KHSA 1SAPA 3QIAA 4G4KA 1XTCD 4LAAA 3K5LA 1PDQA 3A56A 1LT6D 4OHJA 4IUUA 1JR0D 4IZ8A 3A8IE 4CKBA 4K5VA 1HUNA 2KA7A 4MH8A 1STGA 1I3QB 3GTQB 2QILA 2N88A 3GV6A 1F2MA 5EE1A 4KI0A 3OWEB 3ZJVA 1PUTA 5FKAC 4R3DA 5H92C 2JYTA 5EPJA 2HDLA 5BYQA 2NBFA 5C0XJ 2ONQA 2TMPA 3MFYA 4A3MB 5EJWA 5IGDA 4RWSC 1AZPA 1BBXC 2I46A 2L32A 1BDOA 2B2UC 5M9OA 2EYLA 3GS2A 3Q8BA 4M1UB 4F88A 1KNAA 4FF3A 1RTNA 1GJXA 4Y7NB 1B2TA 1JWMD 4J3OD 4PNYA 1FNVA 2HDMA 4XIGS 1G6ZA 1L0VB 2SNMA 1PGAA 1OXTA 2VB2X 3MXGA 2VNUD 1S5BD 3BDLA 4WH4A 2PVGC 1SYFA 2MPMA 3CQZB 1SXTA 1SMYC 1PMRA 4OIJA 3U9SA 2RSNA 2ZXRA 4XQQA 1GHKA 4BY7B 1VMPA 2KVMA 3M7GA 1I4XA 3KF8A 4CJ1B 2BW2A 3L4PA 4WAFA 4K6LA 4L1BA 1CQFA 4JK1C 3GV3A 3HG9A 4WORA 3HOVB 4XYOA 4PMWA 4F87A 3A55A 2N7JA 1C76A 2F4IA 4A3IB 2FINB 1GUTA 1VRAB 1A6XA 4ZRZA 3F2UA 2KEDA 2K0PA 4DFAA 2KCCA 1XO3A 2BB5A 2RDFA 3NTHA 4ZOHC 3T3OA 4O1NA 1QG7A 2WXPA 4PMCA 1QQRA 3BK2A 3BK1A 3Q24A 3Q0AA 4R9WA 4ZRQA 3VRBB 1EY9A 1D1IA 4RHSA 1QT9A 5DM73 1STEA 2RDGA 3TEXA 1L4ZB 5CV6A 2AUJD 5JPNC 1S5ED 1O7YA 3A7LA 1PRTD 2RQXA 2L1BA 4HTHA 1K53A 3D4RA 3J81L 4ZYSA 5DEHA 1GUOA 3TUOA 4DNTB 3HOYB 2BOSA 5DAUA 1OQRA 1NCVA 2EE1A 1N61A 2VZKD 4HSVA 2WXMA 2R92B 1BUVT 1C4QA 1SYCA 4XQJA 1E7PB 1HZ6A 4KK7A 1CM9A 3I4MB 3CU7A 2E2HB 1C79A 4YT0B 1PFMA 1Q10A 4USAA 1SYDA 3C1EA 3TEZA 3ZJTA 5ELDA 1GHJA 1U4RA 2KJXA 1YNJD 3WOEA 2G9HD 2MH7A 4N6EB 5EKIA 1E2VA 3OHXC 2PCFB 5HGTA 4XYQA 2Z4IA 1ET6A 1TKGA 1TS3A 5CYUA 1ML0D 3OIQA 5COYA 1ZE3D 1D5XC 3MJ5A 1DJRD 3QJYA 2MJ8A 2F0PA 4RCOA 1PYWD 2F03A 2N9KA 3VA7A 4A3DB 5BN3A 1DOIA 3LB8C 3HVZA 2PO4A 1D5ZC 5CV9A 3LNNA 4B9XA 1EY7A 1XF5L 4NW2A 2JA5B 1FGBD 5JEAJ 2EY5A 5E4XA 1K51A 4C3HG 4KKSA 5FK9C 2PYKA 2QF7A 3NXWA 4MN3A 1BCPF 1MSGA 5EE0A 4BS9A 2JU6X 1TIID 1SE3A 5K5PA 3H3VC 4GDLB 1H9JA 2F0DA 2DYOA 2ON8A 1F9RA 1WTOA 1WTRA 2MJ3A 2F0HA 3NE5B 2F0FA 3C8YA 2EELA 3SEBA 4RGTA 2IX1A 1STYA 2NTSA 1GPXA 2XIWA 4C3IG 1EYCA 2YEPF 2KECA 1H9SA 1HUMA 1D1KA 1AZQA 4Z9CB 1WRIA 1CK1A 1NSNS 3J7YW 4MIUA 2Y5PA 1RODA 3S14B 3K5OA 5DM63 1FEHA 4TQ1A 1LTBD 3TZUA 5CMDA 3NSWA 5M3MB 2A69D 3KQ4A 5KNBA 1EY4A 3Q6SA 1FMAD 1ZEQX 2F0TA 4KGTA 2K03A 4FF4A 1SE4A 3V96A 4DK0A 3Q8AA 4J6HA 3NVYA 1Q8IA 1TY2A 5A35A 3LYYA 1TS2A 1E9MA 5LHY1 3R3OA 1I4HA 5E6JA 4HAEA 1GB1A 3NK9A 5EE9A 1UAPA 4MM3B 2E2IB 1VZ7A 1J8IA 1XX8A 1Y8OB 2K5WA 3R2TA 1N60A 4AYBB 2LGIA 2PKOA 2AQ1B 2L12A 4KKIA 2IX3A 2CJNA 2YU9B 3CHBD 1VJKA 1A3VA 3FAHA 4JX1C 4A3GB 1Y8NB 4JE3B 1O80A 2IWHA 2K9XA 4EQPA 4C1NI 4XDXA 3T4AC 5KEEA 4A3FB 4NP5A 2J4XA 2JYOA 1LTTD 4A93B 2BS2B 3S1RB 5FOBB 3TEWA 2JX5A 5CV5A 2NVXB 3TMEA 1F77A 4H44C 3FPUB 4LK0M 1PTOC 1SNMA 1U4PA 1OFFA 4OVZA 3MVVA 3DEPA 5LL6S 3IXSA 4OGQC 3MA2B 4TSSA 1AYFA 3IL8A 2RPVA 2ICIA 2D2CC 1QILA 2WXOA 1MHHE 1U4LA 1B9RA 3RUZA 5HURA 3W3AA 1TU2B 2XRQD 2WXGA 4KN4C 4KD4A 2ENBA 3AECB 4XDCA 1FCLA 4TRDA 1OXXK 1GUGA 1KLGD 1Z7TA 4DNRB 5FO8B 1FFUA 2WXRA 2EZVA 3HP3A 1YN4A 2F3WA 5BMIA 2IL8A 4HR7B 2J7ZA 2HCIA 5EBDA 2R93B 5LL6X 3DM1A 2X69A 3OPOA 4S3SA 3VYUA 1H9RA 5IGEA 5CGKA 2K1BA 5C0XG 4G57A 1PXUA 3PIP3 3J9CA 1G2SA 1G8ZD 2W3RA 3T51B 2MEKA 2FMMA 4ZUIA 4XXEA 5C3JB 1K8OA 5JVH3 1YJIA 3AE5B 4K5WA 3CRKC 3RZOB 4QUFA 4A3EB 2OHFA 4NKLA 1LACA 2ICEC 1Z47A 4EVOA 5H8YE 4N9TA 5C2TB 5CR3A 1V97A 3V05A 1N5XA 1XEEA 1PZJD 2BDOA 2EPBA 2A73B 4C7YA 5JEAG 3G7LA 3MXUA 4N9PA 3IFTA 2F0VA 2NN6I 3AEDB 2DWQA 2LJIA 1MSHA 3P42A 1B44D 3IT4B 3K5MA 1LO5D 5EKKA 1F9QA 1JCKB 2WS3B 3QOLA 1Q1BA 1SNCA 3AEBB 1KH0A 3AE2B 1KABA 5GXGB 1MVKA 3EA6A 2JA6B 3MWYW 3VR9B 1WVLA 1B50A 3JAML 2H4OA 4ZKCB 4FVMA 4PQXA 1HFGA 4IURA 2NYZD 2QKIC 3RMHA 2YEPB 5IGGA 2J42A 2F0LA 1SFOB 2PMVA 3MHBA 1X3PA 2KOLA 3D6WA 4HSPA 1CZPA 1UWXA 4QMGA 1L5PA 4C80A 4KY6A 2K5PA 2FMCA 2EJMA 1N5WA 1RHPA 5IT9E 4C2MB 2B76B 2BTEA 2WV6D 2WP8J 2PTLA 4KY7A 1ICWA 1C48A 5C5MA 1STNA 4B0EA 5AUIA 2QDBA 2RMMA 4AQ7A 3BG3A 3GTJB 2WINB 5AFWA 3QO2A 3V2TA 1ESRA 2CW0D 2ACZB 3FC4A 2BA0A 3NP8A 1PGBA 3SR6A 1UNSA 4DAPA 5C4XB 1SYGA 3J81E 2D5GA 4KN7C 5EQ0A 4FF1A 1D6EC 2B63B 2INPE 1L0YB 1VLBA 2R7ZB 2BYTA 2EYMA 1ZOYB 2EY1A 2K5QA 3DWQA 3URYA 1MPEA 4RGOS 1E10A 4DXFA 1ONLA 1WCMB 3H0GB 1FO4A 1I7HA 2I38A 3U9OA 3FILA 5HHDG 1ZDVA 5JJZA 3J7AV 1DCZA 2KQ4X 2BBCA 4NAMA 2MP1A 4KKTA 3FKIB 3AE6B 2K32A 3U7ZA 5BYSA 5D7GA 1K50A 3AN1A 1TZOA 1KLUD 4B08A 1ZXIA 3TP6A 2ID0A 3DUZA 3VR5A 2L11A 3ZJUA 3D4WA 2WAQB 2JXMB 1WTQA 4TQ0A 2H88B 1HQMC 3BVGA 1Q12A 5ISRA 3TP7A 1JC7A 2F0UA 3EJIA 4P6VF 4N58A 2GRIA 3AV8A 4BWGB 1ZXHA 3HZXA 3AEGB 1ROEA 5M3FB 2HTME 2Q8IB 1MGSA 4K8JA 3C3LA 4A9AA 3EUB2 4FF2A 2DNCA 3KUPA 1YNNC 3NUHB 1JROA 1D2BA 1XXGA 3BIID 1E6EB 1FIQA 3AB9A 4U68A 3VR2A 3KLSA 1HQRD 2VXWA 4M0WA 1PTOF 2HCCA 1EIHA 1XLNA 1HTPA 1QLBB 4GDKB 4OL7A 5JEAH 4HKQA 2KN4A 4YTMB 2E2JB 1FYCA 2JSOA 2B2TA 4X3TA 1C4AA 3T13A 3L3OC 3V3XA 3J80E 2F0KA 1V8QA 4ZLTF 3T3NA 1EIGA 3BDOA 3NTIA 2JYEA 4MACA 1CA6A 1H9SB 1ENAA 2SOBA 3HVDA 2NVTB 2RBMA 5JVG3 2LMCB 4I7ZC 1GXDC 2H89B 3PO2B 1EYDA 4IFDH 4ULLA 2W82A 1NYQA 1S5FD 2WB1B 2JEAI 2F1MA 1TWGB 2M9VA 4KX6B 4C3IB 1IUEA 4L6TB 2NZ1D 3SVMA 4L23A 1F9PA 2SDFA 4YWGG 1VCIA 4LK1C 2LMCA 2Q5WD 2PZTA 4P2CB 3IAYA 3Q8CA 5DNFA 2PW5A 1YN3A 3K6OA 4BA2I 1J7AA 4OZCA 1CHQD 2F0MA 3FVQA 4DQOC 3DXJC 5JOBA 4KJOA 1EQTA 5A2QL 1EEID 4UAIA 3BZDB 3GTGB 4IOIE 2DY7A 4BY1B 4ME5A 1PFDA 1HEZE 2WU2B 1K8MA 2F0SA 2B2YC 1FXIA 2QSDA 2EJGC 3MXPA 2XVSA 1W6JA 4C3HB 3MTSA 3E0JA 1NYRA 1PFNA 1ZDXA 1IGDA 2FE8A 4KMUC 2O5JC 2BS4B 4F7XA 5G5GA 2BE5D 1HRJA 5C0XI 1A15A 4HMIA 2CQAA 5D65A 4JPSA 3E6ZX 4J8QA 1FRDA 1SE2A 2OXPA 3K58A 1YN5A 4TMAB 1QKZA 2A74C 4FO2A 1EM7A 1PTOH 1VZ6A 1V1OA 1S5CD 1XLQA 3PZ7A 2PLPA 4WRDA 1OQQA 4NDXA 5T1IA 3AM9A 1LT3D 4O42A 1SSOA 1J7BA 1BCPB 4ABNA 1TKWB 2GA4B 2MUYA 3UI2A 5C4HA 1FNWA 1KFYB 3QB3A 3RD4A 5KNCA 1TJEA 1YNTE 3C1FA 4AS1A 3NBHA 5G3LD 5IODA 4N59A 2Z1CA 3I8ZA 1CFMA 2J0TD 2V4IB 1EFID 3W9CB 4UDUC 4QF4A 1QE6A 2O2LD 1LT4D 3BS1A 1CZGA 3HOZB 2WQYB 3A7AB 1FD6A 1ET9A 1B4OA 5FO7B 1ILPA 1FXAA 1E2ZA 1ZXTA 1WTVA 1A3UA 3NTKA 4CBVA 1F2RC 1I50B 5J1ZA 2L83A 2O5IC 3WOFA 1STBA 4DN4M 4KGSA 1JMLA 1T3QA 2LFIA 3EGRA 4IUTA 3WCQA 5M5YB 1WYGA 2JA8B 4JBWA 3MHZA 4A3JB 2EYJA 2F0IA 2KACA 4DU9A 4K5XA 2K5DA 4XTCS 1KRHA 3S1QB 2LUMA 3PO0A 2B2YA 3VQIA 1M4VA 3AU7A 1EWYC 3IAM1 1SYBA 5KRUA 2LS01 1XCQL 1KDBA 1SNOA 1LTSD 2EY2A 3KWVA 1PRTF 2AUKA 2CHBD 2IX0A 1B9NA 2IW3A 3I72A 3HOUB 2A68C 5F2DA 2L52A 1N62A 4PT5A 3KLSX 2B8FA 2PZWA 3M3YB 4OZAA 2QIEB 4V0BA 4DAVA 5G3LF 1BF4A 1LV9A 1BQQT 1QNUA 4XQNA 5EKLA 2L1AA 1CI3M 1KNEA 3S17B 2JXTA 3P20A 1JW9D 1XLPA 3KBXA 5ELBA 1AEXA 5ELFA 2PZUA 3TP5A 5IOCA 1BR9A 3AE3B 5FO9B 2M2LA 2C5CA 3U2SC 3DHQA 2SEBD 5CC4A 1TS5A 3AE8B 3T56B 4OIKA 1TKEA 3AEFB 1TQOA 1VF7A 4BBRB 3FILB 3GQBA 1LTGD 4WWMA 2BT6A 4ZRPA 1VDZA 1AW7A 4KKUA 1STHA 4LLGM 3SHLA 2ZXPA 3NWSA 2N0SB 4G7OC 3K59A 3IT6B 1QOFA 5C4JB 2K01A 4OO1G 1HFNA 1HHVA 2KWDA 1LTID 4L8JA 2KMMA 1I6VC 2A6EC 1NR2A 2KQ3A 1EOTA 1UUPA 1RTOA 1HZ5A 4DK1A 1Q90A 2ZXOA 1TKYA 3VR3A 4D2KA 1C9FA 4DA2A 3E56A 4QCLA 1DZ1A 2B39A 2L0CA 2R61A 3X3MA 3NVWA 1EYAA 1L6UA 3PUYA 4RKBA 1ZYRD 4G7HC 3G6JB 3QWNA 1T5XD 1B1ZA 4HMJA 3NUCA 5M5XB 2H1EA 2K7VA 3I3CA 4P16A 4WFN3 4IN3A 2RKSA 2IGGA 1P7FA 1QNKA 1WXQA 3EFXD 3CRLC 4C1NK 2PVOD 3OMCA 3OMGA 1IW7C 1MBYA 2KEEA 3OWFA 1JRPA 5AUKA 4M8AA 1YQ4B 1KDAA 2HQEA 1R7SA 1B53A 2WXFA 1GAQB 1N63A 4KJNA 2GI9A 4F8MA 1UGJA 4NAWB 1NR4A 2WIIB 3R93A 1GUWA 3C46A 5C6AA 5KNDA 2VB3X 4RF0A 4HROA 2CVRA 1RM6C 4H13C 2LEKA 2MGSA 3FEWX 1PTOD 3GD7A 4J1MA 3HKZB 2GB1A 2F0NA 2WXQA 2W55A 5JXVA 1G91A 5I9PA 1CTMA 2WXNA 1ACCA 1XCTL 4EE2A 1WTWA 4X3UA 1AWDA 2N9LA 4IUQA 3RZDB 2V0GA 1YQ3B 1P7EA 3D31A 2BE5C 2ZW0A 1ZPSA 2M56B 1C8CA 1NAPA 1RKNA 1WSPA 4XT1B 2F0JA 4KHZA 4A6QA 3P4PB 1HPCA 2KDMA 2JP1A 2F0OA 5FLXE 2Z4HA 3TZDA 3O13A 5C3WA 4IFDJ 2SAKA 2E3TA 4HCEA 1F2ZA 1F2LA 4PV1C 4K14A 5HFYA 1TS4A 2NN6G 3S9WA 1U4MA 1AP0A 4HN7A 5FR3A 2HDEA 2BA1A 5EE3A 1JB3A 3PMFA 4L63B 2J52A 2EDGA 1GUNA 1OO9B 2K6AA 4CJ0B 1QF6A 2XWJB 1I6HB 4R8NA 2A69C 3MAQA 1O78A 3FRPB 3IAS1 3SK4A 2JWUA 2IDYA 2B2WC 5G5HA 1Y56A 2L4NA 1NVID 4OW0A 5IGFA 4CHTB 2WLBA 1QWYA 4MHEA 3ETRA 4ZHOA 1II3A 3ND8A 3AE9B 3I9V1 2IGHA 1TR5A 4WJWA 3S2HB 2F0WA 4EGVA 3K7AB 4XDDA 2Q8TA 1RCVD 2WACA 2WP9B 4QB4A 4H0LC 3K5NA 1EY6A 3X3NA 2AQ2B 4RCNA 1V1PA 2Y0SB 1IKLA 1ENFA 1OXVA 1TWAB 1EL0A 4B9WA 4YTNB 1UWMA 3T53B 5C5LA 2WXKA 1BXTA 1CQVA 4KV6A 1QOAA 3BDCA 1PZID 3PIO3 3U52E 3S1NB 4TKOB 1VR9A 3PUVA 2WDRB 4B0MA 3SK8A 1Q3LA 2WXJA 4PMBA 4A55A 1NI3A 2WKDA 1RDPD 2MJEA 5J39A