1V1PB

The structure ssl from staphylococcus aureus from an orthorhombic crystal form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
191
Chain Sequence
HDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virulence factor
molecule keywords EXOTOXIN 1
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 47
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
B PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1pB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1pB01
1FNUA 1I4XA 1JR0D 1CHQD 1SJED 1LT3D 2TSSA 1I4HA 1XTCD 4RGTA 4ZYSA 4C56C 1BCPF 1KLGD 1PRTC 3BVMA 1L0XB 2XN9C 1T5XD 1EWCA 1ET9A 1SEBD 1PTOD 3EA6A 1UUPA 3MC0B 2AQ1B 5FK9C 3URYA 1HA5A 1TS5A 1EU4A 1I4GA 1STEA 2RDGA 1PRTB 1LTBD 2NTTA 1SJHD 2ICIA 2XRQD 1FNWA 4RHSA 4RGMA 1PZKD 1PRTF 4OHJA 1CQVA 2R61A 3OWEB 2IJ0A 1CHPD 1V1OA 4DXFA 1BCPC 5ELDA 3R8BA 1JWSD 3R2IA 1DYQA 1LTSD 5ELEA 3BYYB 5FKAC 1V1PA 1JWUD 5D3DA 1BCPB 3R2TA 1LTTD 3MFGA 3O13A 1L0YB 2XRSD 4L6TB 3DWAA 4L63B 1JCKB 3BZDB 2QILA 1GOZA 1EU3A 1B44D 1KTKA 1YN4A 2XNAC 1S5CD 1ET6A 2O2LD 1SE4A 1G8ZD 1I4QA 1PZJD 1HTLD 3BVGA 1CK1A 1F77A 1SE3A 1LLRD 1LTGD 1S5FD 3BVZA 1DJRD 1D5MC 1FNVA 1HXYD 1M4VA 1RD9D 1SBBB 1UNSA 2Z8LA 3DWQA 4BWGB 5TSSA 2AQ3B 1YN5A 1D6EC 1RDPD 2J4XA 2RDHA 1TS4A 1HQRD 1ESFA 1PZID 2WV6D 1TS3A 5ELFA 1CT1D 1XXGA 2CHBD 1BCPD 1LO5D 5D3IB 3CHBD 1LT4D 1FGBD 1LT5D 4RCOA 3EFXD 4RFBA 1RF2D 1S5ED 5I4DA 3DWPA 5ELBA 1LTRD 1PTOC 1RCVD 1TS2A 4K6LA 1AW7A 4O1NA 1PTOH 4UDUC 3TSSA 1EEFD 1I4RA 4TSSA 1PRTD 4RHRA 1S5DD 1B1ZA 1TY0A 3KLSX 3SEBA 3W2DA 1PTOB 4Z9CB 1V1PB 2NTSA 1TY2A 1AN8A 1LTAD 1D5ZC 1PTOF 1JWMD 1I4PA 1PYWD 3BYTB 4DXGA 1BXTA 1S5BD 1KLUD 5ELCA 1LTID 4RGNA 2G9HD 3V05A 1QILA 2AQ2B 1JQYD 1D5XC 2QEJC 1ENFA 1FD7D 3GP7A 4NZLB 1MD2D 2IPKD 1LT6D 1EFID 2SEBD 1SXTA 1EEID 1SE2A 4RH6A 1YN3A 4RGOS
chains in the Genus database with same CATH superfamily
4M8AA 5LNK1 4JI8Q 1I42A 1VQ9A 3HOUH 5IP4D 4FA6A 1CHQD 2RPQA 3AU7A 2V4LA 5C23A 1XTCD 1I94Q 3U52E 3W5VB 4A3KH 4A3EB 1HQMC 3IRBA 3TZDA 3NSWA 4L5SA 4JI8L 4A3IG 1ZEQX 3VYRA 2UXBQ 4MH8A 4G57A 1QOFA 1E8WA 2LZ6A 3NZSA 4HXDA 4R3DA 4OELB 1TWHH 3EA6A 2LXCA 3UE0A 5J2RA 3KF6B 2CWAA 3K0XA 2JA5H 2QC8A 2IGGA 3D6CA 3AFQA 1V2YA 3H15A 4OHJA 4Q5VA 1E90A 3KH0A 5DNFA 2KC2A 2WXIA 2UU7A 1WYDA 2OTLA 3AE2B 2J0TD 3CCJA 3P1MA 3MEFA 3S1NB 1LTSD 1MSGA 1YEZA 3NELA 1VQLA 4B6WA 2NPTB 4LNOA 4KGTA 4BS9A 3ETRA 4MGKE 3ER0A 5BN3A 3NRZA 4L6TB 4C4VB 4KJOA 1JCKB 5EKKA 1C0AA 1EUJA 4K1RB 4WIPA 4BBNC 5IIFA 3SXHA 2Z59B 4NAWB 2IO3B 3TDQA 2VZKD 3Q22A 2N8NA 1SNMA 3RUIB 4NW2A 3D3RA 5EJWA 3B1LX 3CAMA 3TP8A 4JBKA 2HIXA 1F77A 4GLSC 2EKEC 5C2TB 4OW0A 3NQTA 2O6VD 1DJRD 1UNSA 3C46A 5H1SE 2VL6A 4ASWC 4RWSC 4OX9L 2PW7A 3GZNB 1QOBA 2J4XA 4XYOA 1ENCA 1SNCA 3A55A 2DLBA 2HD3A 1HA6A 1I35A 1N32Q 2B8FA 3FVQA 3AH7A 2KMMA 2CH4A 2L1AA 2LWPA 5BMIA 3S1QB 4OXPA 1OQRA 1B9NA 3I90A 2A68D 1BCPD 2CHWA 4A93H 1GXDC 2RSUA 3U7DA 3CHBD 1WX8A 3OIQA 1TXYA 3ZGZA 4UHVA 2JWUA 1FCLA 3A0JA 4QIWE 2RA4A 1IP9A 5I4DA 5GAGC 5G3LD 3QB3A 1Q1EA 2CR5A 3A9KA 4JX1C 4NY0A 1AW7A 1PH9A 3DM3A 3DBHI 1S4ZA 4FHJA 4XZ4A 4BKSA 2MLBA 1TY0A 2ZJQA 2WACA 3DOWA 1HZBA 1P16A 1JW9D 1WTVA 1EF5A 1PLFA 1P1AA 4IUNA 4R4CA 1JICA 1WOCA 3HS0C 4MNOA 2KDFB 3QJZA 1EQVA 3W3AA 2KLCA 2UUAQ 2JE6I 1BMLC 2B3AA 4LF9L 2PMZE 2EY6A 3OTOL 2L76A 4O0AA 2PTLA 5AZGA 3AEFB 1FD7D 1GHJA 2IX0A 1PA6A 3PT2B 4S17A 3H9DA 1BO0A 3IAM1 3Q14C 3EN2A 1AP0A 4WJOA 3QJYA 1TKWB 2UUAL 2D2QA 3DVGX 3VUWA 1JJGA 4RF0A 1WJJA 4HCNB 4WRDA 4OO1H 2FXQA 2W9NA 3MZ5A 3N1YC 2FMCA 4LFCQ 4LNQA 1UELA 1D4BA 4RGTA 2AEHA 4YL8A 5BO4B 3WAPA 3HOUB 4XGAB 2OF1A 1CSPA 1E8YA 4AP4C 5C1ZA 1CI3M 1VMCA 4WWPA 1C8CA 1EWCA 1YVCA 2OQ0A 4GLVB 4LFCL 1KXLA 1JOKA 4HSPA 3B2FA 5DPWA 1TS5A 1GC6A 1TWFB 3CKIB 4XQNA 1ZW7A 3TQYA 3K5MA 2KX3A 4B9WA 4ZRIA 3CCVA 3OLMD 1PGAA 1CQVA 1TWHB 2B2WC 3RLFA 1WIAA 2L9HA 4CHKA 2JA5B 2E2JH 1WRIA 5DPTA 4CDCC 1TIFA 1YHQA 2CWPA 3UF8A 3RUZA 1C9OA 1VMPA 1VR9A 4J6HA 2F0MA 3TS2A 1KNAA 4MIUA 4JI0L 3PZ8A 5CGKA 4DV4Q 3PREA 3S16H 4BKGA 1K53A 3CXCA 4WAFA 2JUOA 1FRRA 1A0IA 2WB1G 1EOTA 3PO2H 1B44D 2MHVA 2N9LA 4CO7A 3KLRA 1YHBA 4CKCA 4DV4L 2CKHB 3VUXA 2O2LD 5CYUA 5GADC 1WXSA 1WFQA 3M63B 1ZGUB 3BVGA 2KDMA 4G50A 1HZAA 4MDKE 4P7IA 4NP5A 1IBXB 3T1YQ 2R7DA 1L2FA 3FP9A 5M3FH 4C3HG 4H13C 2WB1B 4A3MG 1HXYD 2BVCA 3H3VH 3N3KB 1Y56A 2PPHA 2LVQA 2RR9A 1Q3LA 3ALBA 3WALA 5TSSA 2NVXH 3ZNID 4QJFA 3A56A 3AFPA 3D0FA 3F2CA 2AWOA 3T1YL 3I2ZA 1YD8U 5EPKA 1AZPA 4JI6Q 1XXGA 5C3EH 2J52A 4IC7B 3SHQA 1VQJA 1TIID 2RCNA 4A3MB 5D3IB 2OEDA 1GB1A 3U9OA 4WAAA 4RCOA 3AE9B 3T4AC 3QR8A 4JI6L 3MTSA 4A93B 1TS2A 4DNTB 2LGXA 1NSNS 3U2SC 4CDFC 4J8QA 2DWQA 2EMTA 1WXQA 2PJHA 4NJ6A 1U4LA 5HY6A 1UE6A 4J15A 3J80E 2ONQA 1KIXA 2INNE 4DXGA 4E71A 2WFWA 4MM3A 4ZRKA 1VF7A 4RGNA 2ZCCA 2D2CC 4MZ9A 1EO6A 2LUEA 1XYIA 4M0WB 2K28A 4AJWA 3NTKA 1HTOA 3C2PA 3V62A 1EFID 1NAPA 1QNUA 2I38A 2CVRA 2R93G 3GTQB 3I73A 3T9LA 2ACZB 3U50C 2FMMA 3P1HA 3OYYA 4L1BA 2B63G 1E0BA 4GDLB 3W1YA 2VUMH 1EQTA 3QQ8B 2N0SB 1LT3D 3BS1A 4ZQ3A 1TR5A 1J8CA 3NTIA 3L0OA 2C7HA 3Q3OC 1OXTA 1FFVA 4ZYSA 4C56C 1QZGA 1BCPF 3JYUA 2A5HA 5BN4A 3Q6SA 4DV6Q 1A2TA 4DR1Q 1YBYA 3AEBB 1ET9A 3K58A 1VS0A 1F2RC 5CV8A 5G3LF 2B63B 3KFUA 3CMAA 5EAYA 2N7JA 3C8YA 3RULA 2CHZA 3HRZC 1WY8A 1KRTA 2F4VQ 4A3BG 2BPSA 5JHBA 4LF7Q 5IP9H 4DV6L 4IWOA 1S72A 3MXGA 2R7ZG 2DNFA 4LF5Q 5LXHA 1E7UA 3K5NA 2PW9A 3BZKA 4TQ1A 3M3YB 3T8MA 2F4VL 3D4DA 3T1HQ 1QVGA 2ASBA 2A6HC 1L7YA 5C44H 2KFKB 5FKAC 2YTXA 4BXXH 4GXBA 3TP5A 2NBUA 3K7AB 3OMGA 3ZJTA 1YNJD 4EX5A 1M8AA 3CP0A 4Q0FA 2NZHA 3O13A 1DD2A 5I9OA 2JVCA 1J0GA 3T3NA 3T1HL 3GO5A 2J0MA 2L15A 4ARCA 3C0RB 3NVYA 5DCNA 3D4RA 2X6LA 5LMNW 2BKRB 2XNAC 3K81C 2JA6G 1HH2P 2INCC 3DBRB 3FILA 2E5LL 1I4QA 2J53A 2W3SA 1HTLD 2IX1A 1YX5B 1KOTA 1BNZA 1WM3A 1BVSA 2B2TA 1L1OB 2IX3A 2V0GA 1ROEA 3DLLA 4E6IA 1LLRD 2JJQA 3IFTA 1EUVB 3U4EG 3R3OA 1KRHA 4YHHQ 3K7UC 2LRUA 1H9RA 4GB9A 2F52A 1E22A 4LF4Q 4ZDVA 2A8VA 2V3PA 2D3CA 5IGGA 3I5JC 1VZ6A 1YJ9A 1BDOA 5M3FB 3DQVA 1SYCA 3NG0A 3O65B 1E7PB 2ZTCA 2PZTA 1G6PA 1I6VC 4HIMA 1H9MA 1CFMA 4LF4L 4DK3C 3AB5A 5DM73 5D6JB 1NI2A 2QDFA 3EGRA 1BT0A 2OJWA 5M5WB 3J7AF 1VQKA 3GOEA 4JGHB 2BT6A 3PIP3 2G45B 4JOIA 2EZVA 4CDEC 1NR4A 2EQSA 3S1RH 2BS4B 2LGSA 4KSLC 1K52A 1YNND 2K75A 2ZZPB 3CCSA 2EYPA 2JA9A 2Z0SA 1WE6A 3UINB 3D6WA 3NS8A 3N9YC 3BZCA 2WLBA 2Y5BB 2F0UA 4KMUC 1L4ZB 1TWGH 2V3SA 3ABVB 3L10B 3KLSX 4B9XA 2Q2UA 3KF8B 1K9MC 2FINB 4LNNA 1L2NA 4EFOA 4JI4Q 2VZKB 5BYSA 4X6AH 4TMAB 4ME3A 2XBBC 5KNCA 4QMGA 1PDQA 2LY7A 5D65A 1A15A 2AQ2B 2FUHB 4NB3A 4JI4L 4WQOB 4WFN3 2EXDA 4C7ZA 3CIRB 2HE7A 4BZAA 3SDZA 3RLNA 2R92H 3GTOH 1X1MA 3N1XC 1NYQA 4GDKA 5C4XH 1M90C 1IBKL 2KHJA 2BDNA 2FFKB 1IW7D 2MX2A 1VQAA 1P3QU 4C1NK 1WGDA 2QIEB 3HK0A 1WWTA 1GJZA 2MJDA 1BUIC 4LTUA 2J7QB 3BIID 2VUMB 5IWAQ 1VCBA 1EIGA 2XN9C 2RHSB 5KRUA 2L7RA 1H9JA 4GLXA 2N1VA 1F9RA 1WTHA 5BMHA 1Q12A 2QCZA 3DHHC 3AEAB 1SN8A 3U9SA 5IWAL 2KMCA 1M94A 1UWXA 2HD5B 2IO1B 1HPCA 2HDMA 3GD7A 2R7FA 1FXAA 3TL5A 1NE3A 2K5HA 1LTLA 1I5FA 1XCTL 4PQXA 1QLBB 1ZXHA 5J17A 2MA9B 1V8QA 3MJ5A 2JEAI 4K0KQ 1JWSD 3GTPH 1YIWA 3A1QB 1PH7A 4HCEA 1GUNA 1E1OA 1SE8A 4BY1H 4M01A 2LUMA 3DWMA 2PNRC 4HPLB 4OWWB 3HM6X 3VUYA 3T56B 3CSTA 5BMGA 2RKSA 2J7ZA 5KNBA 3R66C 4K0KL 1PH6A 5C44B 4W9HA 1L1OC 2WDQB 2Y0SE 4L2YA 4JOIC 4B3SQ 1XQQA 3W1GA 1E1TA 2HCIA 3JC66 5J1ZA 1QWYA 3ZNHB 3JW0X 3RR5A 3TEYA 3PS6A 5JHAA 4H02A 4IUPA 5M5YH 3R7RA 5E6OA 4EQNA 1CZWA 4NQLB 3RNCC 3H3VC 3S15H 3PUVA 3H7PA 3Q8EA 1NY4A 4W9KA 3PSEB 2F0LA 4ANXA 1XTDA 1TKGA 2RMMA 2WIIB 3ZDMC 2AQ3B 4JYAQ 1Y1VH 4A3GG 3K9PB 4ALPA 3DBHB 3ZLZA 2BA1A 3PO3G 4ZCKA 3RN5A 3OWFA 4DV1L 2NBWB 1PH3A 4HJKA 3MHBA 3ZKJC 4EUTA 2EDGA 1D1KA 1JOQA 1R9TH 1P98A 3NVVA 1ASZA 4BKSD 3UQAA 1PVOA 1ZKHA 2Q2TA 4DK5A 2M9VA 5C5LA 2HHHQ 4ITKA 1VQNA 4HKZE 3GV6A 2BYFA 1X3GA 2LMCB 3V60A 4A3GB 4I7AA 2DGYA 2NN6I 4JV5L 1JMCA 4LJOB 1SYGA 2KENA 1Y1WG 4UDUC 4DR6Q 2HHHL 4DHZB 3PZ7A 3DVGY 4DUYL 3L7ZC 1L4DB 3S1RB 2ZPYA 2GBKA 2JA7H 1PH5A 2WGSA 4MGZE 1LYLA 1SYFA 1KDAA 3W2DA 5JJIA 2LKVA 4HIDA 2FUG1 2IW3A 2WU2B 3EECA 2INDC 4DR6L 4NNJB 4JI3Q 3AE6B 4EKUA 3AE5B 2NWGA 1PV4A 1TTNA 1TWGB 4QB4A 5I2YA 2MSED 3W1BA 3A33B 2F0IA 2CU1A 4IPDA 2X69A 4KK7A 4JI3L 3I57A 4KN7C 1GG3A 2BW2A 4R8IA 4ZHPA 3K0YA 4ZLTF 1W3SA 4KD4A 1YN3A 1Z2MA 1BUVT 5LMNQ 3AB9A 4A8XC 5AZFA 5EE9A 4MEMA 2WXJA 4K3BA 2F0VA 3CMMB 3RMKC 2R92B 2BGFA 3GTOB 3AEGB 4KTAA 4IQZA 2MUYA 2D10A 1WTQA 5LMNL 5C4XB 4KY7A 1CSQA 1VQHA 5IT9E 3WANA 4CGYB 5FLXE 1R4QB 3HRDD 3M4OH 4K6DA 1JWAD 3AN1A 3VH3B 1NTGA 3HOXH 2CFMA 2AQ1B 4OONA 1HA5A 2KTRB 5EQ0A 3KW5B 1EU4A 1LTBD 3TREA 2BB6A 2F0PA 2KFJA 3RFZB 4YXDB 4HIKA 5A2QE 3J7A5 3VA5A 2IJ0A 5MPOA 2YTYA 1YHAA 4NPSA 5GQOA 4JG2A 3T53B 1JQ4A 4FLHA 3ZTDA 1DYQA 5EBCA 4IPCA 3B0AA 1V1PA 3W5OA 1E2WA 2I5HA 1I3QB 4XDXA 4GKKQ 2ID0A 3K9OB 3GTPB 3PUYA 1PGXA 4HMIA 2DZMA 4L63B 5EDSA 3ZNZB 1H8CA 1X56A 4BY1B 5M9OA 1PUTA 3PLUA 2IGHA 2E76C 1K0RA 2K5DA 2DHZA 3NXWA 3PF4A 1S5CD 2F3VA 4DN4M 3MA2B 3RLOA 4A3IH 1L0VB 1YOVB 1YQ4B 2KJ6A 4PS3A 3VR2A 1HNZQ 3UDXA 2DZJA 1B50A 2XIWA 2AUKA 1F2ZA 3UDIA 5DLQE 2WDTB 1CK1A 3S1NH 5JVH3 1N63A 1RFKA 4YCVA 1C7YA 2B2UA 4K14A 4K5WA 4JK1C 2JZ3B 5KIXA 1RD9D 1T0YA 3FKYA 3NZUA 3K6OA 2F0JA 2R2OA 2EKIA 2A74C 4YTPB 3KBGA 4X62Q 2D62A 2KBNA 4JCVE 5M5YB 3J81L 3UDGA 1HQRD 2EY1A 3E6ZX 1WYGA 3S15B 4IFDG 1WTWA 3CWIA 2I5LX 1TYGB 1Y1VB 2EJFC 1IBMQ 1T9HA 1V8CA 5DAUA 1WFYA 1SMXA 3J81j 4R4TA 1LO5D 1STYA 3UE1A 1G91A 3S2DH 2A4ZA 5CV6A 4LW1A 1WD0A 1Z6HA 1RF2D 1JE4A 1KQSA 1R9TB 2M2LA 3N52A 1IBML 3SR1A 3ONSA 3M7NA 3TSSA 3T51B 4OVVA 4RM9A 3MTNB 3EC8A 2ALYB 4I6LB 1FYCA 4BBSG 1AYFA 4B3TQ 2KUMA 5HG2A 3F8TA 2NB0A 1Q10A 3RT3B 4Z9CB 4NMZA 3I8ZA 1D5ZC 1E8ZA 3OJ3A 4N8X1 3JSVA 2JA7B 4HK2A 4LF8L 4AIMA 1Q82C 2K03A 3DXJC 2PVGC 1F9JA 3A7LA 4NXNQ 1V80A 4LJZC 2FAZA 5FO9B 3OJ4B 1MHWC 3PTFC 2PI2E 4XDDA 3STBC 1RM6C 1TZOA 4P75A 2KCNA 3RNGC 4RH6A 3IL8A 2ZJDA 5BR8Q 4TRDA 2K5WA 1STBA 3B08A 5LL6S 2F0OA 4N8FA 1T3QA 1EIHA 3BK2A 2GA4B 1U4MA 4DR2Q 1EFWA 2WKCA 2KTFA 4P72A 4G0NB 3ULJA 5BR8L 4YCWA 2DX5B 2FBWB 3EHVA 4DR3Q 1FXTB 3AE8B 2JYOA 3MP9A 2JP1A 1UAPA 1A3VA 1SSOA 4QIWB 5E4XA 1X9NA 1WXVA 1UGMA 1L0WA 4ZUJA 1VQ6A 3PHWB 4IM3A 4A6QA 2UYZB 4B3MQ 1SJHD 4BKTA 4LFBQ 1KRSA 4OL7A 2ZM6L 1HNXQ 2I0QA 2UUBQ 3HOXB 4IG7B 2K33A 2BWES 3CCUA 1B9MA 2UWQA 4PMWA 1I7HA 2V3NA 4WWNA 2AX5A 1HFNA 2M8SA 3VAWA 1TGZB 5G5HA 4B3ML 4LFBL 2CW0D 3NBHA 1HNXL 3H6NA 3H8HA 3VQIA 3M3JA 3ZVVA 3GTKH 3KDFB 3ZO5B 2UXCL 1JJCB 3MC9A 3GDEA 3R2TA 2DJGC 4DAPA 4A3DG 2UU9Q 4IZ8A 4M02A 2PMZB 1TWFH 1WCMG 4IJHA 4CBVA 2O5IC 4RKBA 2PQAB 1YN4A 1I94L 1STAA 2HJ8A 4DV7L 1FR3A 2GLSA 2UU9L 1K51A 4LK0M 4NJ7A 2EELA 2UXBL 5IYBG 1WTXA 1XLOA 3AULA 4MTNA 1YJWA 5JH5C 5C5MA 2LXKA 3RN2A 3JAME 4A3IB 1FM0D 1II3A 4YIJA 1M4VA 5AUKA 5JJZA 1V49A 3L17A 4P1BC 1H9SB 1DCZA 2KK8A 4ZRPA 1HR0W 2RDHA 1TS4A 4AQYQ 3QHTA 1ESFA 3OW2A 1E3PA 1OXXK 4LK1C 4DUZQ 1FPYA 3NEMA 1EYGA 1XF5L 2HTHA 4JQWC 1W6JA 3L13A 4BBRG 3KF6A 3ND9A 3Q2AC 1CA6A 2LXAA 4H7BA 1F52A 2IGDA 2KHSA 3P75A 1CUKA 4DUZL 1Z47A 1GNUA 5DPSA 2DY8A 3MXNB 1J8IA 1DGSA 3K5LA 1BOSA 2ZW0A 2B3GA 1LTRD 3TBIB 1RCVD 4O1NA 1ICFB 4CKEA 3F2UA 1PTOH 5D14A 5FOBB 1Q7YC 3S2DB 2H88B 1NMFA 2MO0A 3LNNA 1U4PA 1LXDA 2LFIA 3AMUA 2B2WA 3E5SA 2NPTA 1YI2A 2JK8A 1UF0A 1SMYD 4C80A 5GAHC 1PH1A 2MP2B 1Z7TA 2GBNA 4W9GA 3ML8A 5GROA 3A9JB 3VXWA 1SDFA 4C4VA 1PTOF 1JWMD 4C3HH 3CD6A 4A3MH 2K14A 4NPNA 5CBAE 4NAWA 2RF4A 1FRDA 4S3SA 2J0JA 1QILA 1D5XC 3PUZA 2YYZA 2C9OA 3FHWA 1MFWA 2LEKA 1SR3A 2VRRB 1I50B 3ICEA 1KLVA 3MHSD 1RYJA 2DYOA 1WX9A 1N32L 2JPHA 2M1MA 1X3FA 2R3ZA 4ZRJA 1Y14B 4H2AA 3K57A 2KJXA 5AEKB 4IUUA 1PXUA 2WDRB 4KN4C 3SHLA 3TP7A 4TKNA 4A3FG 3RN9C 3FKIG 5BN5A 3NVWA 3UI3A 2DY7A 3RD4A 4Y7NB 2F0NA 1MJEA 1NR2A 3HVZA 1WR6E 3VTVA 2KNBA 2KEDA 2M0AA 1SEBD 3PLVA 2D9UA 3KWLA 4ARIA 4K7SA 4MJSB 4CDDC 3RCZA 2WKDA 3GTQH 1STEA 1KNEA 1VDZA 3D31A 2BKFA 3Q23A 2ICIA 3NPPA 1TT2A 3A8IE 1S40A 2KYWA 1JORA 4DF7A 3HOVG 3Q6BA 4JPSA 4PMCA 1PYBA 1Q90A 2MW5A 1XCQL 3HOYG 5KYIA 5JPNC 5M3MG 2Q2HA 2VNUD 4B95A 4HLEA 3ZYYX 3ZJVA 1EWIA 2R93H 4FJYA 3GTGB 1SIJA 3AM9A 1D8LA 2RDBC 1MG8A 1Z5SB 1TWCH 1QF6A 1STGA 2B63H 2QSDA 3L16A 3SGIA 4P6VF 1QOHA 4TQ0A 5D94A 3RPFC 3BZDB 4N9TA 3UI2A 3GTKB 4QCLA 1L5PA 2A69D 3HOYB 1V6EA 3BY4B 2NN6G 5M3MB 4DR7Q 3ENEA 5KEEA 4KV2A 1G8ZD 3M3YH 5C3XA 2DYBA 4IURA 4JLCA 4XYQA 2W3RA 5HURA 1BR9A 2E74C 4N9PA 3TIXA 1ML0D 2F3WA 3W9CB 2MFIA 2REXA 3K7AH 4A3BH 1QVCA 1OXSC 2MGSA 1FNVA 2YEPF 2W54A 2N3SA 1NDDA 2R7ZH 1NENB 2NMQA 1U5KA 2CH4W 3PPAA 1K28A 2KT7A 3KUDB 1LV9A 2I2YA 2HT1A 1UE1A 2JF5A 2JQRB 1WH3A 2K5QA 2L5TA 3B2GA 2Q2IA 3DHIC 4MGYE 1A62A 2B2VC 4ZKCB 2LJ5A 2FJ2A 4JW0A 5LL6X 3T16A 1EZ8A 1WGHA 3R7QA 3TZUA 4R4IA 2X38A 4DNRB 4OWTB 4DV3Q 1OEYA 5ISRA 3MHZA 3GTLB 1JC7A 4JI7Q 3M95A 2CKZB 2Z1CA 5IYCG 1WF9A 2JT4B 2NZOA 1YNTE 2MP1A 2TMPA 2XWBB 4C7YA 2MBQA 2JA6H 4P74A 5FO7B 1ISNA 4DV3L 3AI5A 2L4NA 2F0GA 2MQHA 4DA2A 2LVOA 3P4PB 4YY3Q 1J6QA 1PTOB 2D5DA 3LYYA 3RNAC 3CSFA 1WM2A 3WAMA 1TY2A 4GNXB 2KVRA 2K25A 4UP9A 3IAS1 5JVG3 2FCSA 1KLUD 5M5WH 2GVBA 1V5OA 1RIPA 3AE1B 4YY3L 4KHPQ 1EYAA 3V96A 2I46A 3RNUA 1GAQB 2HTME 4GGQA 4KKTA 1W2BA 4FULA 4C3HB 4GN5A 3PIOA 2IYDB 1Y69U 1SE2A 2LD9A 4Q2JA 3WOFA 5CR3A 2KZRA 4FJZA 1XPRA 2EOTA 2PW5A 4KHPL 4HDOA 1PFSA 2KOLA 3A54A 4KKIA 5FJ8G 4XQJA 1SRUA 2Q8RE 1NUCA 2BDOA 5I2XA 2KWUB 5HHDG 4B0MA 4HVBA 2A6EC 3ZRFA 4HRSA 1VQ7A 4FYDA 2RCFA 4OZAA 4U673 5L83A 1QOAA 5M5XH 2KN5A 1J5EQ 2K04A 2EXZA 2WWZA 4W9JA 4NKLA 2L1BA 1KJTA 3NP8A 3IVFA 1HR0Q 4PYUA 4DKAC 1N60A 1RL2A 4DAYB 4IFDI 1H95A 1B3QA 2KHIA 3AEDB 4FF3A 2EYHA 4X65Q 1RHPA 2LASA 1DGJA 1WX7A 3G7LA 1GKHA 3IFDA 4YCUA 1HR0L 2C7NB 4HCPB 1EF1A 3WAOA 1YITA 3AE4B 1CTMA 4HROA 3FC4A 1SROA 3GS2A 1BKBA 3KUZA 3OIPA 2HIVA 1C48A 2MJ8A 2F0QA 4X65L 1D2BA 1VZ8A 5G5GA 3KJOA 4K3CA 4ILWA 1WRDB 4G4KA 5E3FA 3CCQA 1IGDA 2N9XA 1LTTD 3DEPA 1N34Q 3TRZA 2WNMA 3ZRCA 2K0PA 4M0WA 5IGBA 1DOMA 2R93B 3UIPB 5EKLA 1VQOA 2NVQH 3DBLI 4WH4A 2ZW1A 3E0EA 4DDID 3KWVA 2C7MB 5I9PA 1TWCB 1MJCA 2IWHA 3BDOA 4OIKA 5IGEA 2OHFA 3HM3A 4KI0A 3PMFA 1ET6A 3L9AX 3AE3B 1SLJA 4JBJA 3E56A 3MEHA 4PZ8A 4P1CC 1F9PA 1HRJA 1UH6A 1E2VA 4DV2Q 3OHXC 4DR1L 4B0EA 4GDLA 4HJ7A 1CMXB 2AUJD 1ZYRC 1EQQA 4HN7A 1EIYB 1G6ZA 2ZCBA 2OWOA 4MSQB 4BA2I 4KHVA 3KYDD 4X64Q 4LF7L 4FXDA 2ZVOA 3M4PA 4R8NA 3H0GG 4PT5A 3GQBA 4PYZA 5EE3A 3CF5A 1N33Q 4A3BB 4LF5L 4CQNA 1DONA 1PZID 2WV6D 1TS3A 1VQ5A 3HOWG 5EE1A 1A3UA 1IBLQ 2WU5B 2R7ZB 4OWXB 4X64L 4JI5Q 2Z6KC 1L6VA 4WQMA 1C9FA 3L4PA 4YWKA 3Q3NC 1FGBD 3VA7A 3QO2A 1O7LA 3P42A 2M17A 4PK1A 4IPHA 1PYSB 5A35A 2JSVX 2ZPNA 2Y0SG 3K59A 1IBLL 3NQIA 3WCQA 2HQLA 4JI5L 1PTOC 4UP7A 1ASYA 4GNXC 1EEFD 1ZKOA 3APFA 4TSSA 4ZRQA 4LCDE 1CKOA 2WXFA 3RNEC 2BE5C 1C78A 4IWPA 4HJGE 3SEBA 3J81i 1RWSA 4FJVB 5HFYA 3G6EA 1Y8RC 3DWGC 1Q81C 4W9CA 3CC4A 2JA6B 1AN8A 1IKMA 1IPGA 2IY1B 2EE1A 2Y0SB 5CX3A 1PYWD 3BYTB 5ELCA 3ND8A 4CYEA 3T13A 2O2VB 1NYRA 1D3ZA 2G9HD 4YHHL 4G7HC 4A3GH 4XQQA 2F0KA 5JEAG 4FF2A 3PO3H 4KJNA 1VJKA 2K5VA 4AOFA 3RMHA 1VDVA 4ZHOA 3BDCA 4LF6Q 1L1OA 5LXIB 2NVYB 4RGOS 3I4MG 4WJ4A 2KQSA 2N7DA 2ZEQA 4KIKB 1PH2A 1NBFC 2OXPA 4MJSA 3EBEA 2LHDA 2VXWA 2V1CC 4HSVA 2BYEA 1QZHA 3AXCA 1Y1WH 2BF8B 3IKJA 3LWUA 4FP5D 1SB3C 3I4NG 1XO3A 1RTNA 3WOEA 4YTMB 1GUAB 1DXMA 3J80c 3TEWA 1AE2A 3IG3A 3IT6B 1LFDA 1WTPA 1KF6B 2PEAA 5HGTA 5M5XB 1KD1C 1B2TA 1XLNA 2RGFA 2K32A 1UE7A 2ICEC 1G2TA 2O6VB 1RJTA 4DPGA 2NR2A 4A76A 2LGDA 2KC1A 4GS3A 1DZ1A 1RAXA 4DXFA 2F3IA 2V9HA 2BWFA 3VRBB 4C3IG 4ZAIA 2WX0A 2DAFA 3PZDA 3QWNA 2EMSA 5H92C 2SOBA 3HOZG 2GBMA 1MGSA 1E7VA 3GE8C 3L0WB 3PO0A 2DN8A 3M62B 1MKHA 4K81A 1JALA 3E9IA 3NE5B 4NDXA 1N9WA 2XWJB 1SAPA 1BCPB 3IHPC 1NI3A 2KO3A 5DEHA 2QDBA 4NXMQ 2KJHB 4W9IA 3RYTA 3T3OA 3A4RA 5IGCA 2MBHA 1FJGQ 3HOZB 4BFRA 2UUCQ 1ILPA 2QW7A 1QUQB 3Q8CA 3EROA 1HTQA 2EJGC 2NVQB 2EJMA 4DU9A 4NXML 4C00A 2PCFB 1Y8OB 4CKBA 4H44C 1YMHE 1SE3A 2LXJA 3I70A 2RSOA 1UEAB 1I3QH 2GOWA 1PHJA 2L3ZA 1P9DU 1GC7A 3FDTA 1GB4A 3GTMH 3SDLC 1ILQA 3VTUA 1DM0B 4ANUA 5G2NA 3J80L 4TKOB 1V5TA 3KVFB 2HJ1A 3X3NA 1LT4D 2HDEA 2LI5A 1X54A 1IYFA 2NBFA 3L3OC 4IJLA 4J1MA 4ICUA 1F1HA 1UD7A 4RNAA 4LJPB 1Q8KA 2D0PA 3P63A 4HPMB 4EQPA 1B4OA 5IAAC 3X23A 4B3SL 2EPBA 3A1QA 1XMQQ 4HJ9A 1LGRA 1AFPA 1MPEA 1V43A 2BYTA 3GV3A 3NJTA 3ZNGC 2XK5B 2IO2B 1LTAD 2IY0B 1WJNA 4EZJA 2JA8G 3NUCA 2BBCA 5C0XI 3NK9A 1TQOA 1Q86C 1HJPA 1AE3A 1EY0A 2C60A 1JQYD 2JN4A 1EY6A 1JRPA 1RFAA 4FN2A 2ES2A 4JYAL 4F8CB 3DHQA 5CHWA 3BJUA 4IFDH 4HPPA 4OVUA 3A4SC 2JRIB 1J7BA 3G71A 2J42A 4V0BA 1WGRA 1PFNA 4R4OA 3PO3B 2MBBB 3AYHB 4DR5Q 1Q8IA 3Q8DA 3HEJA 2LFNA 1GUSA 3C1EA 1JR0D 1U0LA 4DNIA 1UZXB 2MJEA 1C4QA 2JRHA 4A75A 4PZ7A 3VRAB 2OTJA 3CC7A 3UIOB 4DR5L 4ZOHC 1KLGD 2QHOA 2K39A 5IOIA 1JB3A 1EQRA 1K73C 1F2LA 4JBMA 4BBSH 1P7EA 1VQIA 2RDFA 4DV0Q 1Y1WB 4IDIA 5FK9C 1HEZE 3VVWB 4K7WA 2WP8J 2H89B 1K8AC 3MWYW 3PV0A 4UPAA 4HJAA 3KK7A 4F87A 1T0QC 1N5XA 2LMCA 3DCGA 1HZCA 4RHSA 2D0OA 1PZKD 1J19A 1N61A 1PMRA 1QOGA 2KJRA 5EKIA 2J0KA 2ZNVB 3VR9B 1OTCA 1ACCA 4DV0L 4G7OC 2A68C 1BCPC 2PVOD 4NAMA 1C4PA 1UEBA 4DK1A 2EYLA 1FEHA 4OIJA 3BDLA 1B70B 3ZQ4A 1WMHB 2KANA 2I07B 3BU2A 4AYBE 3J81c 3PCOB 2GBJA 4URKA 3ERQA 1ZUD2 3VR8B 1EWYC 2VZAA 3V6EB 5IOCA 1QB5D 3CPWA 2OJRA 3N32A 1XPUA 5TR5A 3PRPB 1RODA 1C3TA 2K9XA 1PFBA 1WYWB 5IE8A 5CV9A 3I55A 2JYEA 1X32A 4GKJQ 2E8GA 4DHJD 4JWUC 4MTKA 3M9BA 4YTNB 3WA0A 3TMPB 1XEEA 4A3CG 2CJNA 1E0ZA 4IALA 5K36H 4O42A 3Q3MC 2D5GA 2H1EA 1LTGD 4GKJL 3MFYA 3WIMA 2GBRA 2M0XA 3TP6A 1OTRB 3NBIA 1YN5A 4QL5A 2DJFC 3E3XA 4CHTB 1STHA 3P4RB 3VDZA 1TU2B 3P4SB 4AUQC 1UGJA 2C9WB 3VR3A 1CT1D 3PGEA 2KD0A 3Q8BA 1E2ZA 1JRUA 5HGQA 2KTRA 3UGBB 2CJOA 3GTMB 1E8XA 4A3DH 1VZ7A 2K8HA 2WXNA 4I6PA 4A3JG 2IBIB 1OXUA 4GOPB 1LT5D 3EFXD 1WCMH 4GKKL 2A5UA 1A2UA 3I4LA 4J3OD 5J22A 4JC0A 2K6AA 1N5WA 3N30A 1DOXA 1PRTD 2KA7A 1YJ1A 1CM9A 4IFDJ 4QUFA 3DEOA 2A1AA 1YZ6A 3LWEA 5IYBH 1HNZL 3HKZG 3HVDA 4PS7A 4A3JB 1OQYA 3DVNV 5C3WA 3PIPA 4XC2A 4YSXB 2B29A 3E0JA 4EGVA 2PO4A 4GN4B 4HR7B 1PH4A 2KXJA 2E3TA 3I9V1 5D2MB 1B3AA 3W1SC 1SNOA 2K8BA 3S24A 5AUIA 4LMQD 1V9JA 1JB7A 2YU9B 1R4NI 2FCNA 4X62L 2FE8A 2AYOB 5AJ3Q 2OT2A 1SXTA 2DAJA 4BBRH 4KX6B 1WGKA 1O80A 1XMOQ 5IGFA 1U9RA 4C3JG 1MI0A 1FNUA 3I56A 3U7ZA 4ID6A 2L05A 2Y5PA 3CCRA 4OO1I 2ZXPA 4PNYA 3S17B 4FXKC 2AWTA 5AJ3L 2JXTA 4KSKC 4IUMB 4S0RA 1GD7A 4DHZE 3K5OA 2KACA 4WURA 3DMUA 1XMOL 4TUUA 1QE6A 4TV3A 5JXVA 3P4QB 4GN1A 2MQJA 4KLKA 2MRPA 3TCAA 4GIVA 1EY8A 4IM2A 2OEOA 3BVMA 1L0XB 3MXUA 2ASQA 2ZNVC 1FD6A 1I50H 4C3JB 3SFDB 1NEKB 4B3TL 3HFZB 1G291 1KAWA 3I72A 2WDVB 3EIVA 2RDGA 3A8JE 4RGMA 1S3SG 3ZJUA 4FDBA 4BBSB 3KJPA 4RMAA 4IN3A 4KV6A 5J39A 1SF0A 4KKJA 4BVUC 1GPXA 2YVCA 2EYFA 4F88A 1Z9FA 2DNEA 5KGUA 1CKMA 4ZK9B 3G6JB 4NXNL 3NUHB 4BY7G 4US9A 1GUGA 4Y7NH 2KDIA 1ZXTA 2EYMA 2IZVB 1PFMA 1E10A 3BYYB 1CJEA 1VQBA 4UAIA 3F2BA 1QQRA 2N7EA 3PHXB 1CKNB 5J18A 1B9RA 4HCSA 2KN4A 3DBRI 4IOAA 1T0RC 2VH1A 1Y8PB 4A3FH 4WJQA 1P0RA 3GTJH 3FKIH 1IKLA 1JOOA 5FLXc 1BQQT 3LGJA 4P73A 1NNXA 4BY7B 4MSMB 1C4CA 4DR2L 5LHY1 5K36G 1QG7A 4G3XB 4K2LA 1EL0A 4W9EA 2KQ4X 1K3RA 4DR3L 4ULLA 3TUOA 1XT9B 3AE7B 3SD5A 3NHEB 3GTGH 1YJNA 3AEVA 2WHIA 2KWVB 3H3VI 3BVZA 4F7XA 2WXPA 3I3TB 4XXEA 1SFOH 3DWQA 2K3UA 3HOVH 1WZ0A 2UUBL 1STNA 3QOLA 2M4NA 3H1UA 3HOYH 1OO9B 2QEXA 5IN7A 1X3QA 4GOPC 5M3MH 5GMVA 1EY5A 2MWSB 2ZTEA 5C3JB 4P16A 3MXPA 2M00A 1H4RA 2KMAA 1VRAB 3KYCD 5BYRA 4AS1A 4A3EG 4WWOA 4XE0A 3LJ3A 5D7GA 4RFBA 5FLMG 1J7AA 1G51A 4ZKBB 1S5ED 1B8AA 3B6YA 2BQQA 3DWPA 4HJ8A 3J7AV 4RF1A 2NN6H 2YV5A 2Z6BA 1M1KC 4A3DB 2MCNB 1WJUA 3HKZE 1OFFA 1VCIA 2YTVA 4KHZA 1WCMB 5IKCM 2JY6A 4KGSA 4M1UB 1EM7A 2NZ1D 1K8MA 1VQFA 3M4YA 3KDFA 3VYSA 1TZ1A 1NMGA 5H8YE 5HI1A 4R4QA 3ECIA 1MHXA 3BWUD 1MVKA 2K1FA 3IBEA 2DZKA 2NTSA 3KOJA 3PSIA 4EE2A 2D3BA 4H0LC 2B2YC 1QVFA 1ZE3D 3BINA 4WJWA 2PQAA 4R1JA 2K5NA 3GTLH 5IP7G 5IT9L 2RBMA 2BB5A 3P7JA 3OPOA 5FLXL 3LXFA 5E6NA 2D07B 1YNJC 4XTCS 3APCA 3TJPA 4NZLB 4AQYL 5GXGB 3ML9A 1EY9A 4A90A 1U4RA 1F2MA 1N6ZA 4QY7A 3V2TA 5L95C 2P5ZX 2AL3A 3FAHA 2WAQE 3PF5A 3QOJA 4ZYNA 1VQDA 1GVPA 2ZTDA 5JOBA 1RRBA 1I4XA 5A2QL 1LM0A 2O5JC 4BBRB 1JMLA 4LLGM 2SNSA 4A9AA 1H9SA 3SVMA 3OOCA 2CQOA 5KHQA 2F4IA 1I4HA 5IYCH 2WYQA 2QF7A 4N6EB 2CU3A 2L8JA 4YSYB 2RSNA 1IYUA 1LUZA 1RKNA 3OG5A 4A3LG 5LLIA 1I6HH 4DWFA 2K5PA 4QAYA 1GO3E 2VQEQ 2DNCA 1FO4A 3I91A 1IGCA 3K8AA 5IY0A 3MVVA 3URYA 1EOVA 4IUQA 4IUVA 4AH6A 2IHFA 2G1EA 4W9LA 2JSOA 3MXNA 1I4GA 4LWCA 2B2VA 3R8BA 1K0SA 2GMIC 2QMTA 4EQOA 1P8LA 4OX9Q 4A3OA 1PRTF 2VQEL 1U4AA 2R61A 1EY4A 2DUDA 3DPDA 3F1ZA 3ULPA 3J7ZC 4RKLA 3A9KB 4X57B 4MH0E 4C1NI 3R2IA 5CV4A 4HTHA 2MP2A 1ONLA 2MH7A 4FXCA 4RAUC 3H09A 5ELEA 3SK6A 1N62A 1PFDA 1A8VA 1YNNC 3A9JA 5D3DA 5FR3A 3QARA 4IPGA 1S3OA 5FJ8H 1WD1A 1L0YB 1UE5A 2XRSD 5IGDA 1XLPA 2VS1A 1GOZA 3SR6A 2PZUA 1VQEA 1EU3A 2MBOA 2KOXA 3ZDTA 5J3BA 1XLQA 1ZPSA 4LNKA 2F03A 3KBXA 2W55A 4A3FB 3VR4A 1YQ3B 1WJ6A 3GTJB 2MEKA 3FKIB 2WXQA 5C0XJ 5C4ZA 2D3GA 2Q8TA 4B08A 3C3LA 2JZPA 2MHJA 5IYDG 4A20A 4EEWA 2BS2B 1R4MI 2I5MX 5C6AA 2N1WA 1EY7A 4BWGB 1SIFA 3LDZE 4XDCA 4LF9Q 5C0XG 3OTOQ 3KUCB 4N58A 4II2B 2ATWA 5T8IA 1EYCA 3I63C 2LGIA 3CF6E 1R7SA 3M7GA 1O7ZA 4OZBA 1SFOB 1IW7C 1A5RA 3HOVB 4QGUA 1TJEA 3U30A 4DK0A 3WDNA 4FHKA 1OGWA 1J9OA 5DPRA 1BBUA 1NVID 1K3BC 2Z9HA 3HOUG 3Q3FA 1G2SA 2KEEA 4JI2Q 1OEYJ 2F0SA 2WXHA 2L11A 4A3KG 3Q24A 4LUVA 1B53A 5CORA 2CCZA 3DUZA 3AU5A 4DR7L 3KUPA 1CZPA 4RHRA 3QX1A 1D1IA 1XPOA 3ZTCA 3JAMc 4JI2L 3KLWA 1TKEA 2MJ3A 2D11A 4EQ5A 3NWSA 2JA5G 4IOIE 4OZCA 3J80i 2QA4A 1BXTA 4KKSA 2R2QA 2KKCA 4DHJB 4DQOC 2WXGA 3HUIA 4A3KB 4HJ5A 3ZXRA 3ULLA 2KQ7A 3RNBC 1LACA 3H0GH 1E5WA 1SGHA 1P7FA 4DBGA 3HOWH 3SE0A 2L52A 4JI0Q 2PE9A 4F8MA 1VQ4A 4V190 1WJ4A 1YNXA 3CW2C 2DBYA 1DOLA 1ZDXA 3EFUA 3N6RA 4A4IA 5CBEE 2KDBA 2JXXA 3U8ZA 2KVMA 3G4SA 1FCCC 2NVUI 1XWEA 1SYDA 2FIDA 3KYHC 4JI7L 2QJLA 4MELA 2L0CA 1A6XA 1HUNA 1AEXA 2DZIA 2N55A 3UQBA 2JXMB 4MN3A 3QAQA 1GUTA 2K4KA 5IA7A 3IAYA 1CZGA 1T5XD 4P2CB 1KABA 4RG1A 1BF4A 3DVNU 3MC0B 4B9KA 1E24A 4ANWA 1N8RC 1GJXA 2NVYH 1IUEA 3N20C 5EE0A 3VDYA 1I6HB 1PRTB 2XRQD 5LMUQ 4JE3B 2Z6KA 4GU2A 3S9WA 4REZA 4O2DA 4AWJA 2KECA 1IBXA 2XSCA 5JEAH 1CHPD 1V1OA 4ABNA 2KX0A 4LDTD 4LNIA 3IXSA 5BYQA 1E9MA 4BAXA 1VQPA 5LMUL 1QT9A 3S1MH 1DOKA 4ME5A 4K5XA 2H4OA 2PLPA 3H91A 3JAML 4FNFA 1CQFA 2IL8A 4GNXA 3I4MH 2JX5A 4HDQA 1QNKA 3X0WA 4A93G 2LVPA 3V61A 3RZFA 4KKUA 4U68A 4DFAA 5I6WA 4LFAQ 3STBD 3DWAA 4DAMA 2L0TA 3TS0A 1VD2A 4MM3B 1Y8NB 5JZEB 4YWMA 3P20A 1PH8A 1AZQA 4TQUS 1KHIA 2LRWA 4JPBW 4MHEA 4JI1Q 1KTKA 5CTRC 4I65A 1V81A 1G6JA 4IUTA 3I4NH 2IY5B 1SE4A 1WXMA 1K83H 5T1IA 2N49A 1SYEA 1PZJD 2CQAA 4FVMA 4LFAL 1MG4A 1T5EA 4ODGA 4PMBA 1J5EL 3A5ZB 3J7YW 3U4VA 1C79A 3EJIA 1DOIA 2N9KA 4JI1L 4W9FA 1WTRA 1QZEA 3PQIA 4L5QA 1WTOA 5C4JH 4QQBX 1HZ6A 2KHWB 2RPVA 2LGYA 4KDLB 2ZXRA 4Y52H 4IW0A 4JVZA 3M85A 2SDFA 2NVTH 2WXMA 2A19A 4NJCA 2WXKA 1HNWQ 4C3IH 2GVAA 5CC4A 3RZDH 5KHOA 4G7ZC 5FO8B 3HOZH 2CHXA 2VB2X 3UDFA 4US8A 4DAYA 3C19A 2WX1A 3LX0A 2NYZD 1HNWL 4WJ3M 3AMZA 4N9F4 4D2KA 4M8NA 1ZXIA 1N34L 3GB1A 4OO1G 2ZT9C 2XGTA 4OEMB 3A7AB 1VQCA 5JJLA 1R4NB 2E6XA 2QGQA 2FIFA 3CCEA 2F0WA 1E6EB 4PG3A 1RTOA 4DAVA 2GB1A 1VF5C 3ONAB 2YEPB 1AARA 1HTPA 1B1ZA 2KCCA 1C76A 2PMVA 4G11A 3NVZA 2GN5A 2PQEA 2FCMA 4DV2L 4RMFA 4FF4A 3DM1A 2JQOA 3U4ZA 2PE6B 5EPJA 1EYDA 1S5BD 3ITPA 2Q5WD 3I4OA 3EVQA 1O78A 3HKSA 4DXAB 1NBWA 3QK0A 1VQMA 2JEBI 1V1QA 4WJPA 2QEJC 2QCPX 4K8JA 2Z0EB 1MD2D 3M4QA 1N33L 2G9DA 3F2DA 3H94A 4NQKE 3FILB 3H0GB 2BA0A 4HIOA 3AECB 1L6UA 2E2HH 2LS01 5C4HA 2L83A 1D7QA 3AU4A 1GUWA 2FCQA 2Z4IA 3HOWB 1H9KA 4WORA 1XX8A 1X55A 1YX6B 2KFKA 2Q8IB 2E2JB 2KAJA 3LB8C 1HZ5A 4CJ1B 3PO2G 2WB1E 5JEAJ 2E5LQ 3QG1A 1LM8B 5G55A 1PRTC 2F0EA 3A5UA 1HFGA 4DV5Q 4DDGD 2WINB 3E9HA 3H6MA 3L2PA 2AMCB 3ZIMA 1KC8C 3QIAA 1MJDA 3S16B 2RQXA 4K8IA 2SNMA 4DV5L 5M3FG 2JA8H 2ON8A 3A74A 4FO2A 1TVXA 3PO2B 2DYMA 2QKIC 1WGYA 3ZJYC 1BBWA 2KWCA 2N4FA 3S2AA 4YWLA 4LF6L 5C3EG 4LUZA 1TKYA 2L12A 2HDLA 3CCLA 2H5XA 1YQBA 1XNRQ 3Q0AA 3MFGA 3MAQA 1V86A 2KDEB 4KY6A 1O7IA 4EVOA 3S1MB 2NVXB 3S14H 2O2VA 2EVBA 2G4SA 2WXRA 2OOBB 2MO1A 4BA1I 5IO9A 1TWAH 2GRIA 3I4MB 1ZOYB 3VR6A 3GE3C 3ZUNA 1Q1BA 4XT1B 4HEDA 5K5PA 1WGGA 2K22A 1XNRL 1AH9A 2MPMA 5C3EB 1WXAA 3Q3JA 3QA8A 2KLGA 4KIKA 2NUCA 3QCAA 2VY3A 4JL9A 1N36Q 3MC8A 2L32A 3HP3A 3CMEA 4M8MA 3I4NB 2AL6A 1PQSA 4GDKB 1K83B 4APVA 2G3QB 4TVAB 2FHTA 4JWSC 4AQ7A 1FL0A 1SBBB 3KF8A 4POGA 3D8GA 4ZUIA 3QIJA 5GAEC 4HWIB 1KFYB 4I7ZC 1T6BX 5AFWA 1D6EC 1N36L 1KH0A 2ZJRA 1FFUA 1S1QB 3RZWC 3NWTA 5C4JB 1IYVA 1YIJA 4GOCA 2K52A 4GMVA 2NVTB 3TBLD 1X6OA 1IBKQ 2FNJB 1YJIA 3J9CA 4AYBG 2F0DA 4C3IB 3CRLC 4N59A 2O6VA 1IYJB 3TMEA 3RZDB 2QDLA 1ZDVA 3DHGC 2N9PC 4YWGG 2VUMG 3L08A 1F9QA 3SFEB 2VB3X 3I7FA 5ELBA 1QKZA 3RI7C 3C1FA 3HG9A 3TEXA 1MI2A 3GZNI 4UP8A 2OQKA 2PNHA 1I4RA 4HKQA 3J81E 1FJGL 2VQFQ 2UUCL 4AYBB 1WE7A 4A3CH 2PYKA 2IT1A 4IOCA 5JPMC 2HUGA 2G5DA 1SYBA 3CRKC 3QC8B 1UBIA 5IP9G 2K1BA 2VQFL 2CW0C 3S2HH 1C77A 3AV8A 3D32A 2RVLA 1JT8A 1DOYA 2B2TC 3U58A 3FRPB 1QUQA 3FEWX 3GP7A 2SEBD 2NCNA 1UWMA 3HGBA 2KVZA 4BOZB 3X3MA 2WXOA 5C44G 2K8CA 4IO9A 4BXXG 1O7YA 1PGBA 4JBWA 3WWVA 4A3JH 3PGZA 1F0ZA 2F0HA 4FXGC 4EOYA 4A55A 4W9DA 2JU6X 2IHEA 2EY5A 2X8XX 2Y5CA 3H7PB 4X66Q 2E2HB 1SE9A 3DBSA 3SK5A 4DK6C 2YU9H 3PUWA 2LHEA 2E2IH 1ICWA 2WP9B 3L54A 4L5TA 1XMQL 2SAKA 1SSNA 5CV5A 2K6DB 2EYJA 3EUB2 1UUPA 4X66L 1UBQA 4J6IA 2X6GA 2F0FA 4PV1C 4DGZA 2M56B 5CV7A 4FBJB 1QJOA 2CS4A 5IODA 1K8OA 3S17H 5CHFA 3OWEB 1WSPA 2W82A 3Q8FA 1TBEA 1FGUA 2A73B 2BOSA 4DV1Q 4GLAC 1TT5B 5ELDA 2JWZA 2JA8B 4QF4A 4POFA 1T0SC 1PDXA 4M00A 2XK5A 5JAVA 4GN3B 3VR5A 4F7ZA 4ICVA 4ANVA 1JWUD 4C3JH 1CA5A 3RZOH 2PIAA 2INPE 1OXVA 1R4MB 3Q69A 3AQQA 4JV5Q 2K6QA 1JJ2A 2QILA 1K8RB 1SMYC 2BYVE 1V9PA 5DM63 4DUYQ 4C2MH 1F2RI 2M19A 2YLMA 3W1SA 4F1SA 3SK8A 3CQZH 4HEA1 5COYA 3S14B 3BG3A 1RLFA 2A6ED 1ZP0B 2G4DB 3Q8AA 1TWAB 4K5VA 4E3CA 2C5LC 1IL8A 1OQQA 1GM5A 3PRZA 4A3PA 5EGTA 4BBNF 4OVZA 1S5FD 1FIQA 5ELOA 2B8GA 2HCCA 1E7ZA 3B9JA 4R9WA 4KZCA 4OGQC 1C4AA 1IL2A 5E6JA 1K8GA 4HAEA 5EBDA 1RDPD 5L37A 1VLBA 2LJIA 1NCVA 2AKWB 4BY7H 2BH8A 3ERSX 1HE8A 5CMDA 1SNPA 4GSWA 2R92G 2EY2A 4I6NB 1Q46A 2CHBD 4XWTA 1KAAA 4KZ0A 4XWWA 4K2KA 2E2DC 1WR1A 1Q5WB 2PKOA 4LDTB 5C4XG 4RCNA 2UXDQ 2WS3B 4DR4Q 2BS3B 3QWZB 3CU7A 3PV1A 5ELNA 3VYUA 1A70A 1JROA 4KY5A 2B76B 3RD2A 3V3XA 4X3TA 1WVLA 1WI5A 2UXDL 4DR4L 2KCTA 1S5DD 5F2DA 2GI9A 2N9EB 4L8JA 3CCMA 1WMHA 3BK1A 2IO0B 1GHKA 3N1ZC 4ACFA 1JWBD 3VHTC 1V1PB 4FF1A 2JZZA 1X65A 2V4IB 2V1YA 3NZ3A 2KWDA 3RNFC 1VQ8A 1Q0WB 4KDIC 2PI2A 1HUMA 3H7SA 2KCMA 3V05A 4UY8C 4L5RC 2KQ3A 1LQBA 3OSOA 1KDCA 5E4WC 2L55A 3P2BA 1ZYRD 1ENFA 1GUOA 2IPKD 5HKHA 1MBYA 3JVZX 2R6GA 1EEID 3NENA 3S2HB 5FR6A 4KVGB 2A6HD 4MGIE 4GZYC 3IFWB 2A69C 4BY1G 4A3EH 1Q1OA 4EZKA 4PS8A 2NS5A 1XJVA 5FLMH 3I3CA 2JYTA 4FADA 1SJED 3A8KE 4YSZB 3HIZA 3EFCA 5JJKA 2TSSA 2XVSA 4XIGS 4CJ2C 1A63A 3APDA 4EZLA 5CHVC 3CC2A 3AEEB 2MBEA 2RHQB 2IDYA 1QCBD 2BTEA 3NHHA 1IHZA 2N78A 1HCZA 4HMJA 3TEZA 1C1YB 1PTOD 3W5UB 4GOPA 4YT0B 1KDBA 2V4DA 2E2IB 3HZXA 3TN2A 2Z0DB 1MSHA 2HQEA 2NTTA 2B39A 2BE5D 1FNWA 2VW9A 1BBXC 4B3RQ 3IT4B 4BOSC 3HKZB 5E7NA 4X3KA 3DDCB 3NOBA 5IP7H 5E1FA 1JE5A 1Y1VG 3FPPA 2Z4HA 1EIFA 3NS1A 4QUCA 5KNDA 2BH2A 2OCEA 1YJJA 3K80C 2WAQG 4B3RL 2WXLA 3ZW3A 2DENB 4II3B 4MACA 2ZVNA 3VH4B 4RA8A 4USAA 1EWHA 1J7CA 2PPBC 3E9SA 4X3UA 1K50A 2AWNA 1KM7A 3CPFA 1FMAD 2ENBA 4XYCA 3JSVB 4XT3B 3RZOB 4XX5A 2ZXOA 2C5CA 1SNDA 2K05A 2B2YA 3SK4A 2F1MA 2WAQB 3FMCA 3TEHB 1XNQQ 4A3LH 2JA7G 2I1JA 2VH2A 2LSSA 4JIOU 4KGRA 2K7VA 4LUOA 1NJIC 2NBVB 3DBLB 4E74A 3R93A 2XTIA 3FPUB 4C2MB 3CQZB 1XNQL 1HHVA 5KYLA 4LF8Q 1D5MC 2Z8LA 4P71A 3JAMi 4X3SA 1FXIA 4WWMA 1WZ3A 1HZ9A 3S1QH 1WI0A 1SNQA 5NUCA 3PVLA 2ZJPA 2K50A 3OAWA 4LNFA 5I6YA 1XD3B 4K7UA 4CJ0B 4LAAA 5ELFA 5EPLA 2BCOA 3OMCA 5IT9c 3ZXVA 2C35B 2N88A 2K01A 3G48A 4L23A 4IWQA 2RD0A 1MIUA 1MHHE 1IXRA 2I1KA 3SU8X 2E75C 2EYOA 1ENAA 4RM8A 1R4PB 3VFKA 4K6LA 3NY5A 2PZWA 2D3AA 5E6PA 3V6CB 2MNAA 1KL9A 1V97A 3PUXA 4ZRZA 2Y3AA 2WQYB 1B7YB 1X3EA 1CKNA 2F0TA 3PIO3 3HOXG 5IYDH 3NBHB 3OW7A 3R3MA 1ESRA 2EIFA 1LABA 4MT5A 1EZ6A 2AHOB 1I4PA 2ZM6Q 3MJWA 1W6KA 1LTID 4IM0A 4PZ6A 2XEWA 5AZHA 5C0XH 4IKGA 3KLSA 1IZ6A 4DV7Q 3HHMA 3VTWA 1A3TA 2L00B 3D4WA 3EQLC 3NTHA 5T1GA 1FVIA 3M4OB 1LT6D 2B2UC 2O4XA 4KD3A 1AWDA 3KQ4A 1F2YA 1F9SA 2UXCQ 3PRMB 1VQGA 4WJNA 1UWVA 3VYTA 4AJYB 1X3PA 2L0FA
chains in the Genus database with same CATH topology
4M8AA 5LNK1 1CHQD 3AU7A 1XTCD 3U52E 3W5VB 4A3EB 1HQMC 3TZDA 3NSWA 1ZEQX 3VYRA 4MH8A 4G57A 1QOFA 4R3DA 3EA6A 2IGGA 3D6CA 4OHJA 4Q5VA 5DNFA 2WXIA 3AE2B 2J0TD 3P1MA 3S1NB 1LTSD 1MSGA 4KGTA 4BS9A 3ETRA 3NRZA 5BN3A 4L6TB 4KJOA 1JCKB 5EKKA 4WIPA 5IIFA 3SXHA 4NAWB 3TDQA 2VZKD 3Q22A 1SNMA 4NW2A 3D3RA 5EJWA 3TP8A 1F77A 4GLSC 5C2TB 4OW0A 3NQTA 1DJRD 1UNSA 3C46A 4RWSC 2PW7A 1QOBA 2J4XA 4XYOA 1ENCA 1SNCA 3A55A 2DLBA 1HA6A 2B8FA 3FVQA 3AH7A 2KMMA 2L1AA 5BMIA 3S1QB 1OQRA 1B9NA 3I90A 2A68D 1BCPD 1GXDC 3CHBD 3OIQA 3ZGZA 2JWUA 1FCLA 2RA4A 5I4DA 5G3LD 3QB3A 1Q1EA 1AW7A 1S4ZA 1TY0A 2WACA 1JW9D 1WTVA 1PLFA 4IUNA 1JICA 3HS0C 1EQVA 3W3AA 1BMLC 2JE6I 2EY6A 2PTLA 3AEFB 1FD7D 1GHJA 2IX0A 1BO0A 3IAM1 1AP0A 3QJYA 1TKWB 4RF0A 4WRDA 4OO1H 3MZ5A 2FMCA 1D4BA 4RGTA 3HOUB 2OF1A 1CI3M 1VMCA 1C8CA 1EWCA 1JOKA 4HSPA 3B2FA 1TS5A 1TWFB 3CKIB 4XQNA 3K5MA 4B9WA 1PGAA 1CQVA 1TWHB 2B2WC 3RLFA 2L9HA 2JA5B 1WRIA 3RUZA 1VMPA 1VR9A 4J6HA 2F0MA 1KNAA 4MIUA 3PZ8A 5CGKA 1K53A 4WAFA 1FRRA 1EOTA 1B44D 2MHVA 2N9LA 3KLRA 4CKCA 2O2LD 5CYUA 3BVGA 2KDMA 1IBXB 4NP5A 4C3HG 4H13C 2WB1B 1HXYD 1Y56A 1Q3LA 5TSSA 3A56A 2AWOA 5EPKA 1AZPA 1XXGA 2J52A 1TIID 2OEDA 4A3MB 5D3IB 1GB1A 3U9OA 4RCOA 3T4AC 3MTSA 4A93B 1TS2A 4DNTB 1NSNS 3U2SC 4J8QA 2DWQA 1WXQA 1U4LA 3J80E 2ONQA 2INNE 4DXGA 1VF7A 4RGNA 2D2CC 1XYIA 2K28A 3NTKA 3C2PA 1EFID 1NAPA 1QNUA 2I38A 2CVRA 3GTQB 3I73A 2ACZB 2FMMA 3P1HA 4L1BA 4GDLB 1E0BA 1EQTA 2N0SB 1LT3D 3BS1A 4ZQ3A 1TR5A 3NTIA 1OXTA 1FFVA 4ZYSA 4C56C 1BCPF 2A5HA 5BN4A 3Q6SA 1A2TA 3AEBB 1ET9A 3K58A 1F2RC 5CV8A 5G3LF 2B63B 3C8YA 2N7JA 3HRZC 3MXGA 3K5NA 2PW9A 4TQ1A 3M3YB 3D4DA 2A6HC 5FKAC 3TP5A 3K7AB 3OMGA 3ZJTA 1YNJD 1M8AA 4Q0FA 3O13A 1DD2A 5I9OA 3T3NA 3GO5A 4ARCA 3NVYA 3D4RA 2X6LA 2XNAC 3FILA 1I4QA 2J53A 2W3SA 1HTLD 2IX1A 1BNZA 2B2TA 2IX3A 2V0GA 1ROEA 4E6IA 1LLRD 3IFTA 3U4EG 3R3OA 1KRHA 1H9RA 2V3PA 5IGGA 1VZ6A 1BDOA 5M3FB 1SYCA 1E7PB 2PZTA 1I6VC 1H9MA 1CFMA 3AB5A 5DM73 3EGRA 5M5WB 3J7AF 2BT6A 3PIP3 2EZVA 2BS4B 1NR4A 1K52A 1YNND 2EYPA 3D6WA 3N9YC 2WLBA 2F0UA 4KMUC 1L4ZB 3ABVB 3KLSX 4B9XA 2FINB 2VZKB 5BYSA 4TMAB 5KNCA 4QMGA 1PDQA 2LY7A 5D65A 1A15A 2AQ2B 4WFN3 4C7ZA 3CIRB 3SDZA 1NYQA 2BDNA 2FFKB 1IW7D 4C1NK 2QIEB 1WWTA 2MJDA 1BUIC 4LTUA 3BIID 2VUMB 1EIGA 2XN9C 5KRUA 1H9JA 1F9RA 5BMHA 1Q12A 3AEAB 3U9SA 1UWXA 1HPCA 2HDMA 3GD7A 1FXAA 1XCTL 4PQXA 1QLBB 1ZXHA 1V8QA 3MJ5A 2JEAI 1JWSD 4HCEA 1GUNA 2LUMA 3DWMA 2PNRC 3T56B 5BMGA 2RKSA 2J7ZA 5KNBA 5C44B 2WDQB 4L2YA 2HCIA 5J1ZA 1QWYA 3TEYA 4IUPA 4EQNA 1CZWA 3H3VC 3PUVA 3Q8EA 2F0LA 1TKGA 2RMMA 2WIIB 2AQ3B 2BA1A 3OWFA 3MHBA 2EDGA 1D1KA 1JOQA 3NVVA 2M9VA 5C5LA 4ITKA 4HKZE 3GV6A 2LMCB 4A3GB 2NN6I 1SYGA 4UDUC 3PZ7A 3L7ZC 1L4DB 3S1RB 1SYFA 1KDAA 3W2DA 2FUG1 2LKVA 2IW3A 2WU2B 3AE6B 3AE5B 2NWGA 1TWGB 4QB4A 5I2YA 2F0IA 2X69A 4KK7A 3I57A 4KN7C 2BW2A 4R8IA 4ZHPA 3K0YA 4ZLTF 4KD4A 1YN3A 1BUVT 3AB9A 4A8XC 5EE9A 2WXJA 2F0VA 2R92B 3GTOB 3AEGB 4KTAA 4IQZA 2MUYA 1WTQA 5C4XB 4KY7A 5IT9E 4CGYB 5FLXE 1R4QB 3HRDD 4K6DA 1JWAD 3AN1A 2AQ1B 1HA5A 5EQ0A 1EU4A 1LTBD 2BB6A 3RFZB 2F0PA 4YXDB 5A2QE 3VA5A 2IJ0A 5MPOA 3T53B 1JQ4A 1DYQA 5EBCA 1V1PA 1E2WA 1I3QB 4XDXA 2ID0A 3GTPB 3PUYA 1PGXA 4HMIA 4L63B 4BY1B 1PUTA 5M9OA 2IGHA 2E76C 2K5DA 3NXWA 1S5CD 2F3VA 4DN4M 3MA2B 1L0VB 1YQ4B 3VR2A 1B50A 2XIWA 2AUKA 1F2ZA 1CK1A 1N63A 5JVH3 1RFKA 2B2UA 4K14A 4K5WA 4JK1C 5KIXA 1RD9D 3K6OA 2F0JA 2EKIA 2A74C 4YTPB 3KBGA 2D62A 5M5YB 3J81L 1HQRD 2EY1A 3E6ZX 1WYGA 3S15B 4IFDG 1WTWA 3CWIA 1TYGB 1Y1VB 2EJFC 1V8CA 5DAUA 1LO5D 1STYA 1G91A 5CV6A 1WD0A 1Z6HA 1RF2D 1JE4A 1R9TB 2M2LA 3N52A 3SR1A 3M7NA 3TSSA 3T51B 1FYCA 1AYFA 2KUMA 5HG2A 2NB0A 1Q10A 4Z9CB 4NMZA 3I8ZA 1D5ZC 2JA7B 2K03A 3DXJC 2PVGC 3A7LA 4LJZC 5FO9B 4XDDA 1RM6C 1TZOA 2KCNA 4RH6A 3IL8A 4TRDA 2K5WA 1STBA 5LL6S 2F0OA 1T3QA 1EIHA 3BK2A 2GA4B 1U4MA 2WKCA 2FBWB 3AE8B 2JYOA 3MP9A 2JP1A 1UAPA 1A3VA 1SSOA 4QIWB 5E4XA 4A6QA 4ZUJA 1SJHD 4OL7A 3HOXB 2K33A 1B9MA 4PMWA 1I7HA 2V3NA 2AX5A 1HFNA 5G5HA 2CW0D 3NBHA 3H8HA 3VQIA 3R2TA 4DAPA 4IZ8A 2PMZB 4CBVA 2O5IC 4RKBA 1YN4A 1STAA 1FR3A 1K51A 4LK0M 2EELA 1WTXA 1XLOA 5C5MA 1FM0D 3JAME 4A3IB 1II3A 4YIJA 1M4VA 5AUKA 5JJZA 1H9SB 1DCZA 4ZRPA 2RDHA 1TS4A 1ESFA 1XF5L 1OXXK 4LK1C 1W6JA 3ND9A 1CA6A 4H7BA 2IGDA 2KHSA 3P75A 1Z47A 2DY8A 1J8IA 3K5LA 1BOSA 2ZW0A 1LTRD 5FOBB 3TBIB 1RCVD 4O1NA 4CKEA 3F2UA 1PTOH 5D14A 3S2DB 2H88B 3LNNA 2LFIA 1U4PA 3AMUA 2B2WA 3E5SA 4C80A 1SMYD 1Z7TA 1SDFA 1PTOF 1JWMD 5CBAE 1FRDA 4S3SA 1QILA 1D5XC 3PUZA 2YYZA 2C9OA 2LEKA 1I50B 1RYJA 2DYOA 2R3ZA 4H2AA 3K57A 2KJXA 4IUUA 1PXUA 2WDRB 4KN4C 3SHLA 3TP7A 5BN5A 3NVWA 3UI3A 2DY7A 3RD4A 4Y7NB 2F0NA 1NR2A 3HVZA 2KEDA 2M0AA 1SEBD 4ARIA 2D9UA 3KWLA 2WKDA 1STEA 1KNEA 1VDZA 3D31A 3Q23A 2ICIA 3NPPA 1TT2A 3A8IE 1JORA 4DF7A 4JPSA 4PMCA 1Q90A 1XCQL 5KYIA 5JPNC 2VNUD 3ZYYX 3ZJVA 3GTGB 1SIJA 3AM9A 1QF6A 1STGA 2QSDA 4P6VF 4TQ0A 1QOHA 3RPFC 3BZDB 4N9TA 3UI2A 3GTKB 4QCLA 1L5PA 2A69D 3HOYB 2NN6G 5M3MB 5KEEA 1G8ZD 5C3XA 4IURA 4XYQA 2W3RA 5HURA 1BR9A 2E74C 4N9PA 3W9CB 1ML0D 2F3WA 1OXSC 2MGSA 1FNVA 2YEPF 2W54A 1NENB 2NMQA 2I2YA 1LV9A 2JQRB 2K5QA 2L5TA 3B2GA 2B2VC 4ZKCB 2FJ2A 5LL6X 3T16A 1EZ8A 3TZUA 2X38A 4DNRB 5ISRA 3MHZA 3GTLB 1JC7A 2Z1CA 1YNTE 2MP1A 2TMPA 2XWBB 4C7YA 5FO7B 2L4NA 2F0GA 4DA2A 3P4PB 1PTOB 2D5DA 3LYYA 1TY2A 3IAS1 5JVG3 1KLUD 3AE1B 1EYAA 3V96A 2I46A 1GAQB 2HTME 4KKTA 4C3HB 1Y69U 1SE2A 4Q2JA 3WOFA 5CR3A 2EOTA 2PW5A 2KOLA 3A54A 4KKIA 4XQJA 2Q8RE 1NUCA 2BDOA 5I2XA 5HHDG 4B0MA 2A6EC 4HRSA 4FYDA 4OZAA 4U673 1QOAA 2K04A 2EXZA 4NKLA 2L1BA 3NP8A 1N60A 4IFDI 3AEDB 4FF3A 2EYHA 1RHPA 1DGJA 3G7LA 3IFDA 3AE4B 1CTMA 4HROA 3FC4A 3GS2A 3OIPA 1C48A 2MJ8A 2F0QA 1D2BA 1VZ8A 5G5GA 4ILWA 4G4KA 5E3FA 1IGDA 1LTTD 3DEPA 2WNMA 2K0PA 4M0WA 5IGBA 1DOMA 2R93B 5EKLA 4WH4A 2ZW1A 3KWVA 5I9PA 1TWCB 2IWHA 5IGEA 3BDOA 4OIKA 2OHFA 4KI0A 3PMFA 1ET6A 3L9AX 3AE3B 3E56A 3MEHA 1F9PA 1HRJA 1E2VA 3OHXC 4B0EA 2AUJD 1ZYRC 4HN7A 1G6ZA 4BA2I 4KHVA 4FXDA 4R8NA 4PT5A 3GQBA 5EE3A 4A3BB 4CQNA 1DONA 1PZID 2WV6D 1TS3A 5EE1A 1A3UA 2WU5B 2R7ZB 1L6VA 4WQMA 1C9FA 3L4PA 1FGBD 3VA7A 3QO2A 1O7LA 3P42A 5A35A 2JSVX 3K59A 3NQIA 3WCQA 1PTOC 1EEFD 1ZKOA 4TSSA 4ZRQA 2WXFA 2BE5C 1C78A 4HJGE 3SEBA 1RWSA 5HFYA 3DWGC 2JA6B 1IKMA 1AN8A 2EE1A 2Y0SB 1PYWD 3BYTB 5ELCA 3ND8A 3T13A 1NYRA 2G9HD 4G7HC 4XQQA 2F0KA 5JEAG 4FF2A 1VJKA 4KJNA 3RMHA 1VDVA 4ZHOA 3BDCA 2NVYB 4RGOS 2OXPA 2LHDA 2VXWA 4HSVA 3IKJA 3LWUA 4FP5D 1SB3C 1XO3A 1RTNA 3WOEA 4YTMB 1DXMA 3TEWA 3IT6B 1WTPA 1KF6B 5HGTA 5M5XB 1B2TA 1XLNA 2K32A 2ICEC 1G2TA 1RJTA 1DZ1A 4DXFA 3VRBB 4C3IG 4ZAIA 3QWNA 5H92C 2SOBA 4JX1C 1MGSA 3PO0A 2DN8A 1JALA 3NE5B 4NDXA 2XWJB 1SAPA 1BCPB 1NI3A 5DEHA 2QDBA 3T3OA 5IGCA 3HOZB 1ILPA 3Q8CA 3EROA 2EJGC 2NVQB 2EJMA 4DU9A 2PCFB 1Y8OB 4CKBA 4H44C 1YMHE 1SE3A 3I70A 2RSOA 1UEAB 3FDTA 1GB4A 1ILQA 1DM0B 3J80L 4TKOB 3X3NA 1LT4D 2HDEA 2NBFA 3L3OC 4J1MA 4RNAA 3P63A 4EQPA 1B4OA 2EPBA 1AFPA 1MPEA 1V43A 2BYTA 3GV3A 1LTAD 3NUCA 2BBCA 5C0XI 3NK9A 1TQOA 1EY0A 1JQYD 1JRPA 1EY6A 3DHQA 4IFDH 1J7BA 2J42A 4V0BA 1PFNA 3PO3B 1Q8IA 3HEJA 2LFNA 1GUSA 3C1EA 1JR0D 2MJEA 1C4QA 3VRAB 4ZOHC 1KLGD 1JB3A 1F2LA 1P7EA 2RDFA 4IDIA 1Y1WB 5FK9C 1HEZE 2WP8J 2H89B 3MWYW 3PV0A 2LMCA 3KK7A 4F87A 1N5XA 4RHSA 1QOGA 1PZKD 1N61A 1PMRA 3VR9B 5EKIA 1ACCA 4G7OC 2A68C 1BCPC 2PVOD 4NAMA 1C4PA 4DK1A 2EYLA 1FEHA 4OIJA 3BDLA 3ZQ4A 2I07B 3ERQA 1ZUD2 3VR8B 1EWYC 5IOCA 1QB5D 1RODA 2K9XA 1PFBA 5CV9A 2JYEA 1X32A 4JWUC 4YTNB 1XEEA 2CJNA 1E0ZA 4IALA 5K36H 4O42A 2D5GA 2H1EA 1LTGD 3MFYA 3TP6A 3NBIA 1YN5A 4CHTB 1STHA 3P4RB 1TU2B 3P4SB 1UGJA 3VR3A 1CT1D 3Q8BA 1E2ZA 2CJOA 3GTMB 1VZ7A 2WXNA 1OXUA 1LT5D 3EFXD 1A2UA 3I4LA 4J3OD 5J22A 2K6AA 1N5WA 1DOXA 1PRTD 2KA7A 1CM9A 4IFDJ 4QUFA 3DEOA 3LWEA 3HVDA 4A3JB 5C3WA 4YSXB 3E0JA 4EGVA 2PO4A 3I9V1 4HR7B 2E3TA 1B3AA 1SNOA 5AUIA 4LMQD 2YU9B 2FE8A 2OT2A 1SXTA 4KX6B 1WGKA 1O80A 5IGFA 1U9RA 4C3JG 1MI0A 1FNUA 3U7ZA 4ID6A 2Y5PA 4OO1I 2JXTA 2ZXPA 4PNYA 3S17B 4FXKC 3K5OA 2KACA 4WURA 3DMUA 1QE6A 5JXVA 3P4QB 1EY8A 2OEOA 3BVMA 1L0XB 3MXUA 1FD6A 4C3JB 3SFDB 1NEKB 1G291 3I72A 2WDVB 2RDGA 3A8JE 4RGMA 3ZJUA 4BBSB 4IN3A 4KV6A 5J39A 1SF0A 4KKJA 1GPXA 2EYFA 4F88A 2DNEA 5KGUA 4ZK9B 3G6JB 3NUHB 4US9A 1GUGA 1ZXTA 2EYMA 1PFMA 1E10A 3BYYB 1CJEA 4UAIA 1QQRA 1B9RA 4HCSA 2KN4A 1Y8PB 1IKLA 1JOOA 1BQQT 4BY7B 1C4CA 5LHY1 5K36G 1QG7A 4K2LA 1EL0A 2KQ4X 4ULLA 3TUOA 3AE7B 3BVZA 4F7XA 2WXPA 4XXEA 3DWQA 2K3UA 1STNA 3QOLA 1OO9B 1X3QA 1EY5A 5C3JB 4P16A 3MXPA 2M00A 1VRAB 5BYRA 4AS1A 4XE0A 5D7GA 4RFBA 1J7AA 4ZKBB 1S5ED 3DWPA 3J7AV 4RF1A 2NN6H 4A3DB 1OFFA 1VCIA 4KHZA 1WCMB 4KGSA 4M1UB 1EM7A 2NZ1D 1K8MA 3VYSA 3M4YA 5H8YE 4HKQA 5HI1A 1MHXA 3BWUD 1MVKA 2NTSA 4EE2A 4H0LC 2B2YC 1ZE3D 4WJWA 5IT9L 2RBMA 2BB5A 3P7JA 3OPOA 5FLXL 3LXFA 1YNJC 4XTCS 4NZLB 5GXGB 1EY9A 4A90A 1U4RA 1F2MA 3V2TA 3FAHA 3QOJA 5JOBA 1I4XA 5A2QL 2O5JC 4BBRB 1JMLA 4LLGM 2SNSA 4A9AA 1H9SA 3SVMA 3OOCA 2F4IA 1I4HA 2QF7A 4N6EB 2CU3A 4YSYB 2RSNA 1IYUA 1RKNA 2K5PA 2DNCA 1FO4A 3I91A 1IGCA 3MVVA 3URYA 4IUQA 4IUVA 2G1EA 2JSOA 1I4GA 3MXNA 3R8BA 2B2VA 2QMTA 4EQOA 1PRTF 2R61A 1EY4A 4RKLA 4C1NI 3R2IA 5CV4A 4HTHA 4FXCA 1ONLA 2MH7A 4RAUC 3H09A 5ELEA 3SK6A 1N62A 1PFDA 1YNNC 5D3DA 5FR3A 1WD1A 1L0YB 2XRSD 5IGDA 1XLPA 1GOZA 3SR6A 2PZUA 1EU3A 1XLQA 1ZPSA 2F03A 3KBXA 2W55A 4A3FB 3VR4A 1YQ3B 2MEKA 3GTJB 3FKIB 2WXQA 5C0XJ 5C4ZA 2Q8TA 4B08A 3C3LA 2JZPA 2BS2B 5C6AA 1EY7A 4BWGB 4XDCA 5C0XG 4N58A 5T8IA 1EYCA 2LGIA 1R7SA 3M7GA 1O7ZA 4OZBA 1SFOB 1IW7C 3HOVB 1TJEA 4DK0A 3WDNA 1J9OA 1NVID 1G2SA 2KEEA 2WXHA 2F0SA 2L11A 3Q24A 1B53A 5CORA 3DUZA 3KUPA 1CZPA 4RHRA 1D1IA 1TKEA 2MJ3A 3NWSA 4IOIE 4OZCA 1BXTA 4KKSA 4DQOC 2WXGA 3HUIA 4A3KB 1LACA 1P7FA 3SE0A 2L52A 4F8MA 4V190 2DBYA 1DOLA 1ZDXA 3N6RA 5CBEE 2KVMA 1FCCC 1XWEA 1SYDA 2QJLA 2L0CA 1A6XA 1HUNA 1AEXA 2N55A 2JXMB 4MN3A 1GUTA 3IAYA 1T5XD 1CZGA 4P2CB 1KABA 1BF4A 3MC0B 1GJXA 1IUEA 5EE0A 1I6HB 1PRTB 2XRQD 4JE3B 3S9WA 4REZA 2KECA 1IBXA 2XSCA 5JEAH 1CHPD 1V1OA 4ABNA 3IXSA 5BYQA 1E9MA 1QT9A 1DOKA 4ME5A 4K5XA 2H4OA 2PLPA 3H91A 3JAML 4FNFA 1CQFA 2IL8A 2JX5A 1QNKA 4KKUA 4U68A 4DFAA 5I6WA 3DWAA 4MM3B 1Y8NB 3P20A 1AZQA 4TQUS 4MHEA 1KTKA 4I65A 4IUTA 1SE4A 5T1IA 4FVMA 1SYEA 1PZJD 2CQAA 1T5EA 4ODGA 4PMBA 1DOIA 3J7YW 1C79A 2N9KA 3EJIA 1WTRA 1WTOA 1HZ6A 2RPVA 2ZXRA 4NJCA 3M85A 2WXMA 2SDFA 2WXKA 5CC4A 4G7ZC 5FO8B 4US8A 2VB2X 4DAYA 3LX0A 2NYZD 3AMZA 4D2KA 1ZXIA 3GB1A 4OO1G 2ZT9C 3A7AB 2E6XA 2F0WA 1E6EB 2GB1A 1RTOA 4DAVA 1VF5C 3ONAB 2YEPB 1HTPA 1B1ZA 2KCCA 1C76A 2PMVA 3NVZA 2PQEA 4FF4A 3DM1A 5EPJA 1EYDA 1S5BD 3ITPA 2Q5WD 3EVQA 1O78A 2JEBI 2QEJC 2QCPX 4K8JA 1MD2D 2G9DA 3H94A 3FILB 3H0GB 2BA0A 3AECB 1L6UA 2LS01 5C4HA 2L83A 1GUWA 2Z4IA 3HOWB 1H9KA 4WORA 1XX8A 2Q8IB 2E2JB 2KAJA 3LB8C 1HZ5A 4CJ1B 5JEAJ 3QG1A 1PRTC 2F0EA 1HFGA 2WINB 3H6MA 3QIAA 3S16B 2RQXA 4K8IA 2SNMA 2ON8A 4FO2A 1TVXA 3PO2B 2DYMA 2QKIC 1TKYA 2L12A 2HDLA 3Q0AA 3MFGA 3MAQA 3AE9B 4KY6A 4EVOA 3S1MB 2NVXB 2EVBA 2WXRA 4BA1I 2GRIA 3I4MB 1ZOYB 3VR6A 1Q1BA 4XT1B 4HEDA 5K5PA 2K22A 2MPMA 5C3EB 2NUCA 2L32A 3HP3A 3I4NB 4GDKB 1K83B 2FHTA 4JWSC 4AQ7A 1SBBB 3KF8A 3D8GA 4ZUIA 1KFYB 4I7ZC 1T6BX 5AFWA 1D6EC 1KH0A 1FFUA 3NWTA 5C4JB 1IYVA 2NVTB 3J9CA 1YJIA 2F0DA 4C3IB 3CRLC 4N59A 4YWGG 3TMEA 3RZDB 1ZDVA 1F9QA 3SFEB 2VB3X 1QKZA 5ELBA 3C1FA 3HG9A 3TEXA 1MI2A 1I4RA 3J81E 4AYBB 2PYKA 2IT1A 5JPMC 2HUGA 1SYBA 3CRKC 2K1BA 2CW0C 1C77A 3AV8A 2RVLA 1DOYA 2B2TC 3FRPB 3FEWX 3GP7A 2SEBD 1UWMA 3HGBA 3X3MA 2WXOA 1O7YA 1PGBA 4JBWA 1F0ZA 2F0HA 4FXGC 4A55A 2JU6X 2EY5A 2Y5CA 2E2HB 3SK5A 3PUWA 2LHEA 1ICWA 2WP9B 2SAKA 1SSNA 5CV5A 2EYJA 3EUB2 1UUPA 2X6GA 2F0FA 4PV1C 4DGZA 2M56B 5CV7A 1QJOA 5IODA 1K8OA 3OWEB 1WSPA 2W82A 3Q8FA 2A73B 2BOSA 5ELDA 2JA8B 4QF4A 1PDXA 5JAVA 3VR5A 1JWUD 1CA5A 2PIAA 2INPE 1OXVA 3Q69A 2QILA 1SMYC 5DM63 1F2RI 2M19A 3W1SA 3SK8A 4HEA1 5COYA 3S14B 3BG3A 2A6ED 1ZP0B 3Q8AA 1TWAB 4K5VA 1IL8A 1OQQA 5EGTA 4OVZA 1S5FD 1FIQA 2B8GA 2HCCA 3B9JA 4R9WA 4OGQC 1C4AA 5E6JA 4HAEA 5EBDA 1RDPD 1VLBA 2LJIA 1NCVA 5CMDA 1SNPA 2EY2A 2CHBD 4XWTA 1KAAA 4XWWA 4K2KA 2E2DC 2PKOA 4RCNA 2WS3B 2BS3B 3CU7A 1A70A 3VYUA 1JROA 4KY5A 2B76B 3V3XA 4X3TA 1WVLA 1S5DD 5F2DA 2GI9A 3BK1A 4L8JA 1GHKA 1JWBD 1V1PB 4FF1A 2V4IB 3NZ3A 2KWDA 1HUMA 3V05A 2KQ3A 3OSOA 1KDCA 5E4WC 2L55A 1ZYRD 1ENFA 1GUOA 2IPKD 1MBYA 2R6GA 1EEID 3S2HB 2A6HD 4GZYC 2A69C 3I3CA 2JYTA 1SJED 3A8KE 4YSZB 2TSSA 2XVSA 4XIGS 4CJ2C 3AEEB 2IDYA 1QCBD 2BTEA 3NHHA 1IHZA 1HCZA 4HMJA 3TEZA 3W5UB 1PTOD 4YT0B 1KDBA 2V4DA 2E2IB 3HZXA 3TN2A 1MSHA 2HQEA 2NTTA 2B39A 2BE5D 1FNWA 1BBXC 3IT4B 3HKZB 4X3KA 5E1FA 3FPPA 2Z4HA 3NS1A 4QUCA 5KNDA 1YJJA 2WXLA 4MACA 4RA8A 4USAA 1EWHA 1J7CA 2PPBC 3E9SA 4X3UA 1K50A 2AWNA 1FMAD 2ENBA 4XT3B 3RZOB 2ZXOA 2C5CA 1SNDA 2K05A 2B2YA 3SK4A 2F1MA 2WAQ<