1V1PB

The structure ssl from staphylococcus aureus from an orthorhombic crystal form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
191
Chain Sequence
b'HDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN 1
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
total genus 47
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
B PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1pB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1pB01
1B1ZA 4DXGA 1CQVA 4RGNA 3URYA 2O2LD 3BVZA 1RCVD 4ZYSA 1S5DD 3DWAA 1GOZA 1LTAD 2R61A 2RDHA 1RF2D 5FK9C 3EA6A 4RHSA 1KLUD 1RD9D 1TY0A 2WV6D 3KLSX 1SXTA 1QILA 1V1PA 2G9HD 2XRSD 3BYYB 1SEBD 1UUPA 1D6EC 5ELEA 1JCKB 1LTID 1KLGD 1RDPD 1S5CD 2IJ0A 1CHQD 1I4QA 1HXYD 1PRTC 1CK1A 1LT4D 3OWEB 1G8ZD 1I4PA 1V1OA 1PYWD 2RDGA 1ESFA 2ICIA 4RH6A 1AW7A 1PRTD 4Z9CB 3R8BA 1S5ED 1PTOF 2CHBD 2SEBD 2QEJC 3MC0B 3DWPA 1SE2A 1DJRD 1PTOH 1B44D 1I4GA 1LLRD 1JWSD 3R2TA 1D5XC 1F77A 1HQRD 1LT6D 1PZKD 1TS4A 3BVMA 5ELBA 2AQ1B 1S5FD 1HA5A 1EU3A 5I4DA 1ET9A 1ENFA 4OHJA 4RGTA 1STEA 1KTKA 1CHPD 4C56C 1BXTA 3O13A 2TSSA 1LTGD 1SJED 1DYQA 3BZDB 3EFXD 1D5ZC 1EEFD 1TS5A 1L0YB 1FNVA 2QILA 1D5MC 1EU4A 1BCPF 1PTOB 1FD7D 3GP7A 4RFBA 5ELCA 1PTOD 1JR0D 2J4XA 2NTSA 1SE4A 3DWQA 1YN3A 1FNUA 4O1NA 3W2DA 1LT3D 3R2IA 1I4XA 4RGOS 1I4RA 5ELDA 3BVGA 1LTSD 5ELFA 1PRTF 2NTTA 5D3DA 1EWCA 1CT1D 4NZLB 4K6LA 1S5BD 4L63B 1PZJD 2AQ2B 1T5XD 1M4VA 4BWGB 3CHBD 1AN8A 4L6TB 3TSSA 1YN4A 2Z8LA 4UDUC 3SEBA 2XNAC 1LTBD 1FNWA 2AQ3B 1SBBB 1SE3A 4RCOA 1PTOC 2XRQD 5TSSA 2XN9C 1YN5A 1MD2D 1BCPC 1LTTD 1EFID 1I4HA 1SJHD 5D3IB 1ET6A 5FKAC 3V05A 2IPKD 1TY2A 1XXGA 4DXFA 1BCPB 1V1PB 1JWMD 4RHRA 1BCPD 1UNSA 1HTLD 1LO5D 1L0XB 4TSSA 1JWUD 1TS3A 1TS2A 3BYTB 1LTRD 1XTCD 3MFGA 1PZID 4RGMA 1JQYD 1PRTB 1EEID 1FGBD 1LT5D
chains in the Genus database with same CATH superfamily
1CTMA 4LFAL 4A3EH 1EQRA 2WXGA 1UF0A 2BE5D 3ZJUA 4DK0A 2YU9B 2IT1A 2PQAB 2R61A 1E7PB 2OXPA 3I70A 2N8NA 3DM3A 4DDGD 3ZNGC 4XWWA 3NBHB 1L2NA 4LUOA 4DK6C 5BN3A 4WFN3 3J7AF 5C3EG 1Y8RC 3H3VI 4L5QA 1VQLA 4FF2A 3AV8A 3JYUA 3UF8A 1QOGA 4OZBA 1I6HB 2DX5B 2VL6A 4OWTB 3D31A 4GLXA 2VY3A 2XSCA 2EXZA 3C0RB 1PYWD 2WACA 4X65Q 1Q81C 4ASWC 4W9HA 4LF8Q 5AZFA 2K32A 1SSNA 1SFOB 4HEA1 1DONA 3UE1A 1E8XA 1ESRA 4MSQB 2B39A 2QEJC 4NDXA 5EKKA 4C3IB 1YBYA 2R7ZB 4LWCA 5GAHC 2N9XA 3DHHC 4A3PA 2PYKA 1JT8A 1HR0W 2K8BA 2JN4A 1XCTL 4FVMA 3MTNB 3VR4A 3MC9A 2IX0A 1LLRD 1Y56A 4KV2A 5AUIA 2LUEA 1JALA 3AU7A 2AWOA 1Z6HA 1GKHA 2FFKB 2K5PA 3H7SA 3GTOB 4ZHPA 4L5RC 3ZQ4A 3CC4A 3IKJA 2E2JB 3JW0X 3DM1A 4NJ6A 3GTGH 3EBEA 1UWVA 1UD7A 3PHWB 4GOCA 4LLGM 3T8MA 1ZKHA 1QF6A 4A3FB 1PLFA 1WMHA 3ABVB 1N33Q 2JZPA 1JE5A 3EFXD 2WXFA 3FEWX 3T51B 3PO0A 2A68C 2QIEB 3MHBA 1L0YB 5HI1A 2BDNA 5CBEE 3S2AA 2ASQA 4NB3A 4IFDG 1KOTA 3NWSA 4BY7H 1YHBA 3HKSA 2JUOA 1QJOA 2GVBA 4DU9A 2XWJB 3X3NA 1L1OB 1BQQT 3I9V1 3TP5A 2H1EA 3PZDA 3QK0A 2D10A 3KWLA 1AEXA 2WXNA 2K52A 2OF1A 2HQLA 2KENA 4ZHOA 4DV5L 1I6VC 4BY1B 4ME5A 3U9SA 1MJCA 4LK0M 2G3QB 2IBIB 4KY5A 3NHEB 1O7IA 4GB9A 2KQ3A 4ZUJA 4IOIE 4AYBE 2Z6KA 1QOAA 2BS2B 4GLVB 2UUBQ 1XF5L 1STAA 4I6LB 3BK2A 2SDFA 4ZQ3A 3AE2B 4K3BA 2ES2A 2WIIB 1WJ4A 1SE3A 2BYFA 1XYIA 1Q1BA 5NUCA 1ASZA 2EMTA 3I4OA 2PNRC 1E6EB 2JT4B 2KDBA 1WTRA 4P72A 2Q5WD 3V96A 1H95A 4HIMA 4K1RB 4C4VA 3QOJA 2LSSA 2KANA 2Y3AA 2J0MA 4X57B 1K0SA 5COYA 4KKIA 1FXTB 1EIGA 4XGAB 4FXCA 1OQQA 5C0XG 1HR0L 4TQUS 2X38A 1A3UA 1PFMA 1NE3A 3D8GA 2FUHB 1ZPSA 2INNE 1PFBA 2EYPA 3I2ZA 4IUVA 4DV3L 2FCNA 2GBNA 3EFCA 1SR3A 3EFUA 2K6QA 1K8GA 4ZRQA 2KX3A 3CIRB 2Y0SB 1EOVA 1AZPA 5M3FG 5LXHA 4A9AA 1NENB 4LAAA 1K9MC 4W9GA 2VB3X 5AEKB 3C8YA 3QR8A 3MAQA 1Y1VB 3P1HA 3HM3A 2OQKA 2D11A 1H9SB 2ZNVC 3SR6A 3W5OA 3PV0A 4A3MB 1V43A 1AARA 4A90A 1EIHA 1X6OA 2BH8A 3H1UA 4APVA 3PF4A 2A6HD 3I72A 3JAMi 3P4QB 3BU2A 3VYTA 3ZXVA 3QJZA 1QNUA 2MO0A 5FJ8H 1R4MI 3P63A 1KAWA 3W1SC 4HVBA 4JI2Q 3PUVA 2OWOA 4TUUA 1YIJA 1VQBA 1EWYC 5BYRA 1W3SA 2RKSA 5C4JB 1VQKA 2KFJA 4GNXC 2N9PC 1J7BA 4QMGA 4GKJL 2X6LA 3UDGA 4HCSA 2K01A 4A93B 1SYGA 4GKKL 2OJWA 4LDTD 3I4MH 1XTDA 3CCUA 1EY0A 1JOKA 2NN6H 2BB5A 2K5VA 2KC2A 3ZVVA 2PMVA 4EQOA 4HKZE 1YJIA 3FDTA 2NPTA 3RUZA 2CCZA 3K58A 3HOXG 3HOVG 1TVXA 2QF7A 2MCNB 5EE9A 2WDTB 1WYDA 2CKHB 4K8IA 1XD3B 1VF7A 2MA9B 4KDLB 1STEA 1EOTA 2BKFA 1VQJA 4YCWA 4DNRB 4JI1L 4LNKA 3EIVA 5FR3A 3CCQA 3L3OC 4B0EA 3M62B 2NVQH 1IPGA 3Q6BA 2ZW1A 2NCNA 1V81A 4J6IA 4KY6A 2BA1A 1G2TA 5IP7G 1SE9A 2HJ1A 4R4CA 2K14A 4DK3C 1T0RC 3UGBB 3R7QA 2MWSB 5J17A 2LY7A 4RG1A 3HUIA 4HSVA 3RNAC 2VQEL 3EJIA 2FCMA 3H6MA 5C3XA 1Q7YC 4JG2A 2B8GA 2J4XA 4DR7Q 4MH0E 3WCQA 1YN3A 1MG8A 4H2AA 2N1VA 1U4LA 4C7YA 2KHSA 1HUMA 1G6ZA 4FJVB 3NXWA 1MPEA 1B2TA 3ZYYX 3SFEB 1PH4A 4YIJA 2B2YA 3PREA 5IWAL 3Q3JA 4EQNA 4GLSC 3JSVB 3L54A 3OJ4B 3M85A 1B3AA 1YN4A 4UDUC 2MUYA 3AEDB 1QKZA 3MXGA 1NNXA 5CHVC 3T3OA 1ZGUB 4X3UA 1RFKA 2B3GA 1E90A 2LFNA 1IL8A 1EYGA 4HWIB 4ANWA 4FADA 3IFDA 2E2HB 5FKAC 1KABA 4KDIC 5C5LA 3L9AX 3WOFA 3NUCA 3PRPB 4K14A 1PH7A 3I4NG 1UE5A 3N30A 4NJ7A 2BDOA 3DBRI 1RLFA 1EYDA 2NBVB 4PYZA 2F0WA 1PFSA 4ZCKA 3BDOA 3TP6A 2KN5A 4CKEA 1HEZE 3HK0A 2B2TC 4NY0A 2N0SB 3H7PA 4W9CA 1DOLA 1UWXA 2MJEA 4ZLTF 1NY4A 2A19A 4FN2A 3PS6A 1CMXB 5KYIA 4DV7L 4ZYSA 2PI2E 4ANXA 4B3SL 2K4KA 1E10A 3NTHA 3HGBA 3Q24A 4G11A 5KYLA 2A8VA 5G5HA 4YWMA 4KKJA 4BBRG 3Q0AA 2GOWA 3UQBA 2K75A 4OEMB 1WFQA 4DV1L 1LGRA 4JV5L 3FILB 4ME3A 2MQHA 2KMCA 1VQDA 2HDMA 4IJHA 3AI5A 3VHTC 2WXJA 2KWUB 1HZ5A 1W6KA 1U4PA 4A3EG 3K9OB 1RM6C 1EWIA 1A70A 5IIFA 2XK5B 2KDIA 5C3EB 1E24A 3VAWA 3AMZA 3RNEC 1UE7A 4JI6Q 3OMCA 3AEEB 3D32A 4FULA 4EE2A 4RNAA 1ESFA 1RTOA 2C9OA 4EQPA 4NXMQ 2PEAA 1WI0A 2KWVB 1LFDA 2C7HA 3RFZB 1X3GA 2NVYH 1N34Q 4CO7A 4YWGG 1EF1A 4DHJB 5KGUA 1UEAB 1SE2A 3A7AB 3HRDD 3PQIA 1U5KA 2PJHA 1X3EA 3F2BA 4LW1A 4OL7A 5E7NA 1DGSA 3OTOQ 2BH2A 5IP4D 1WYWB 1LABA 1E2VA 2A69C 2F0UA 1WM3A 4X65L 3P2BA 3P1MA 4LF8L 4BA1I 4DR2L 1OTCA 1IL2A 1UGJA 1V2YA 4XYCA 3QOLA 1QE6A 1GUTA 1C8CA 3LJ3A 1ACCA 3U58A 1BBUA 3CC7A 3GDEA 3CPWA 4XZ4A 3SGIA 3SHLA 4K7SA 4UP7A 1A15A 4JYAL 3DVGY 1MSHA 4YCVA 2KXJA 2NUCA 3GE3C 4JW0A 3TS0A 4JI4Q 2UUCQ 2KHWB 1TWFH 1TTNA 1Y14B 1RODA 4DR1Q 1L1OC 2WQYB 3L2PA 4HCNB 3AB9A 3RR5A 4XC2A 2INDC 1R4QB 3H91A 4XDXA 5JPNC 4K3CA 4G57A 2EYMA 5DEHA 2KEDA 5ISRA 2F0HA 5EPJA 4F88A 2W9NA 2XTIA 1A8VA 4L2YA 5M9OA 2LKVA 1LXDA 1NYQA 5IAAC 2GB1A 4M02A 3A9KB 4FF3A 5JZEB 2MP2A 4BY7G 5D6JB 1I94Q 3B9JA 2K5WA 1G291 1B8AA 1AN8A 2LMCB 3J81c 4A3JB 2JA5G 1G91A 3K5OA 1DM0B 4U68A 1WF9A 2JQRB 2PKOA 3PV1A 5ELNA 2LXAA 3MEFA 3NQIA 3CCVA 2LGDA 3A9JB 3RZDB 1VS0A 4B9KA 1KLVA 5BMIA 4JI0Q 3J7AV 5EQ0A 4DR6Q 2O6VD 2ASBA 4PMWA 2FHTA 2ZTEA 3HFZB 3PRZA 1U0LA 1JJ2A 2IPKD 3EC8A 3A1QA 4LNIA 5HKHA 1B7YB 1XQQA 3RZWC 1JOOA 5IE8A 3KLWA 3CCMA 2MBQA 1UBIA 1LO5D 5C6AA 2MP1A 4TSSA 1J6QA 1JMLA 1CM9A 4MM3B 4OVVA 2R93H 4MJSB 3UI3A 4QY7A 2L11A 4ZK9B 1DCZA 2W82A 4A8XC 3H6NA 3M3JA 2O2LD 2IY5B 3DWAA 1QUQB 2MFIA 1TWCH 3CW2C 1EY7A 4X6AH 1IGCA 1EL0A 3AYHB 1SN8A 2Q2HA 4QB4A 4ZKCB 5K5PA 1CKNB 3GO5A 1BKBA 2KACA 2GMIC 4CDCC 1L7YA 2QDLA 5M3FB 1VDVA 3MZ5A 1Q3LA 4FF4A 3OIQA 1K0RA 1LQBA 2DZIA 1J0GA 2HTME 3M3YH 4G7ZC 1RTNA 3CCLA 3D6CA 1WRIA 2BPSA 2E3TA 4H0LC 1FXIA 4II3B 1GUAB 4L8JA 1PRTD 1DD2A 3S17H 4GXBA 1X54A 5IP9H 4QAYA 3AE4B 2ATWA 2DUDA 3JAME 3VUWA 1TIID 1NI2A 5IGGA 4AWJA 2WDRB 1KXLA 3TMPB 3VH3B 4NXNQ 3U50C 3H9DA 3PCOB 2JP1A 4KJNA 2FIDA 1H9MA 3ND9A 1A3TA 4JI2L 1MHHE 3H8HA 4DA2A 4IJLA 5IT9c 1K50A 3U4ZA 4IUTA 3P4SB 3PMFA 1VR9A 2B2VA 3A8KE 3RD2A 1FVIA 3VYUA 2KK8A 3I4MG 4D2KA 5KHQA 2NN6G 2RCNA 3ULJA 4XXEA 1E0ZA 3HOXB 2WB1G 3HOVB 4RF1A 4X3SA 2JA8H 1WWTA 1SIFA 1NR4A 3F2UA 1WTWA 2PTLA 1XLOA 2N7DA 1DYQA 2O6VB 3QX1A 1EEFD 2HUGA 5M5YH 3M7NA 3CAMA 4UPAA 4K7UA 2RF4A 1PTOB 3PIOA 4TRDA 1WGGA 5E6JA 2INPE 3E9HA 4HJGE 1SAPA 3U52E 2EJMA 1SE4A 1NVID 1J8IA 2F0FA 3IBEA 2BCOA 1GUNA 2AHOB 3KF8A 4DV4Q 3WAOA 3E0EA 2KVRA 3BVGA 5C4ZA 2NTTA 1ROEA 4ZRZA 4NAMA 1U9RA 4DV0L 2AL6A 3DVNV 3K7AH 4M1UB 1TWGH 1S1QB 3NG0A 2L83A 2NB0A 2Z0SA 3I3TB 5IYCG 3GTJB 1TBEA 4A3KH 4P74A 2K0PA 2QDFA 4KN4C 1LTBD 4XYOA 2JA7G 2K50A 4G7HC 1OEYJ 2E2DC 3TBIB 4HPPA 2LJIA 1K3RA 4JOIA 1OXUA 3MXUA 1HNWQ 4ITKA 1NMFA 3K8AA 3WIMA 1NEKB 3WDNA 4UAIA 3S16H 3MA2B 5D3IB 3AM9A 1HJPA 4A3IH 2EY1A 4EQ5A 4W9KA 5J39A 2K28A 2B8FA 2WXOA 3RULA 3ZW3A 1GB4A 1JWMD 1YVCA 3RZFA 1IYFA 3BS1A 1P7FA 2FMMA 1C76A 2EY6A 1VD2A 3T3NA 1N9WA 3A56A 3I4LA 1VRAB 4OZAA 3TUOA 4B3ML 3J81j 1J7AA 2MJ3A 4G4KA 3W5UB 4A20A 3RLFA 4A76A 1PRTB 1EEID 3AEBB 3DBHB 2WWZA 4A4IA 5C1ZA 4B3TQ 3QB3A 3I4NB 2F0VA 4K5VA 3PO2H 4AOFA 1X32A 1KAAA 1F2MA 3CCRA 2A4ZA 3OAWA 3ETRA 1CZWA 2HIVA 3PF5A 3VDYA 4E3CA 3CQZH 1JC7A 1WR6E 4F8CB 1RD9D 3NPPA 2AWNA 4J8QA 2V1YA 3J81i 5JXVA 2ENBA 1G6PA 1LUZA 1K73C 1H4RA 4DNIA 4MSMB 3NBIA 4BBNC 4CJ2C 2FNJB 4EEWA 1KLGD 2C5CA 2J0KA 5CORA 2YEPF 4WJPA 1GUGA 4W9LA 5IODA 4JPBW 2BT6A 1JRPA 2D2QA 2RDGA 3Q2AC 1GUWA 5LMUQ 4G3XB 3UIOB 3NSWA 4CYEA 1AW7A 1MJDA 4LF6Q 4BZAA 2BWES 1S5ED 5JEAH 4A3EB 2HDEA 4DGZA 1JE4A 4KLKA 4GOPB 5LMNL 2L32A 2V4IB 3RUIB 3E0JA 1PDXA 1YQBA 4R8NA 1RYJA 2KBNA 2IGDA 4XX5A 3H94A 4YCUA 1WCMH 2C60A 1ILQA 1YQ4B 1X3FA 1FFVA 3IVFA 4HDQA 5KIXA 4JI6L 5I4DA 2IO2B 4GDLA 2N7JA 3N3KB 3Q3MC 3GD7A 1SYEA 4RF0A 4NXML 4WQOB 4R9WA 4AS1A 3I5JC 1N34L 1D7QA 3D6WA 3NK9A 3H0GG 4IUUA 3CMAA 1PH8A 3GTKB 4US9A 1LTGD 3FKYA 1IXRA 2RHQB 3HOUG 4LF4Q 3OTOL 3T1HQ 2WAQG 1D5ZC 3PSEB 3PO3H 4X64Q 4G7OC 2A1AA 3AULA 1I50H 5D2MB 1KQSA 4CKCA 2Z0DB 1G51A 2VQFQ 4DK1A 2E8GA 2QDBA 5D65A 1JROA 1YHAA 1IBKL 1QVFA 2G5DA 3IAYA 2N3SA 3KYHC 2UUAQ 3VYSA 2EKIA 1EY4A 1I4XA 1F9PA 1VCBA 2BKRB 1WYGA 3LYYA 3VR9B 2NZOA 4XDDA 2BYVE 3I3CA 2A74C 2HDLA 3MXPA 1Y1WH 3WALA 4K8JA 4P2CB 2XNAC 4AJWA 2PPHA 2Y5BB 3IRBA 4BBSH 2D5DA 4BKTA 3AXCA 2L15A 4BY7B 3NHHA 3ZRCA 5EGTA 4IOAA 1OEYA 2PVOD 2QHOA 3OG5A 1SNPA 3T13A 1YJNA 2JA5B 4ZRIA 2VUMG 3QHTA 2D2CC 4KKTA 4N59A 3NTKA 1RHPA 4R3DA 2Z9HA 5DAUA 4X66L 1HTLD 2BB6A 3E9IA 1OQRA 5E6NA 2K5HA 1JWAD 4JLCA 1TS2A 5IGEA 1XTCD 1FFUA 3MHZA 4QIWB 3Q8BA 1L6VA 1PZID 4HJAA 5GAEC 3E5SA 4JBMA 4W9EA 2ZXOA 2D3BA 5JAVA 2H4OA 2KWDA 2PLPA 1I42A 2V1CC 2B2WA 2X6GA 4CBVA 4LF9Q 3AE3B 3TEXA 4C7ZA 2WYQA 1Q8KA 4KD3A 2VXWA 4R4TA 4DWFA 3K9PB 4K81A 3B6YA 2I5HA 2ZW0A 3PGZA 1ML0D 1WI5A 4K2LA 4RWSC 3DVNU 2IY1B 2PZUA 2R93G 2KJRA 3L4PA 4HROA 4FNFA 4C3JH 1TZOA 5C44H 3VR3A 3J7YW 1E1TA 1SEBD 1EYCA 3SK4A 4DAYA 1T0QC 3AEFB 1GVPA 1SNOA 4CHTB 4KZCA 1FYCA 1CHQD 3E56A 4IUNA 1IYUA 5C4HA 3AU5A 2HE7A 2PZWA 2R2QA 1V1OA 4HK2A 1QVCA 1R9TB 1EM7A 5H92C 1N36Q 5CR3A 2V4LA 3UDFA 1JICA 3CMEA 2Z59B 1KD1C 1IKLA 4IUPA 4RKBA 1Q86C 4IM2A 1BR9A 1BOSA 1XX8A 5FLMH 3I56A 4LFBQ 4IG7B 4W9JA 4N6EB 2YV5A 5EBCA 1LM8B 4WWOA 2IGHA 3EHVA 5AZHA 1JWSD 5LLIA 1F77A 1HQRD 4BKSA 4QCLA 4JBJA 1HFGA 1ZXIA 1HA5A 1VQ9A 2A6EC 1L5PA 2BOSA 2OHFA 1OGWA 4PMCA 2ZT9C 2J0TD 1UEBA 3QAQA 2EYLA 5IP9G 2WXMA 2D62A 2Y0SE 1MFWA 2RSOA 1ENCA 3HKZG 3J80L 1HHVA 4LFCQ 1KDCA 3GE8C 4NPNA 2F0MA 3FKIH 3RLOA 4NXNL 1CA6A 3NS1A 3Q14C 3G71A 1DXMA 1S3SG 4P16A 3S1NH 3I4MB 1TQOA 4K2KA 3L0OA 1AH9A 1T6BX 4DUZQ 1BCPF 2WB1B 1ZW7A 3KUPA 1K83H 4FDBA 4BBNF 1KRSA 4S3SA 1SYBA 3HHMA 1I3QH 2JA8G 2AWTA 3W3AA 3S14H 2JSVX 4KHPQ 2K1FA 3AEGB 4NJCA 5FR6A 4ACFA 4B6WA 2L0CA 2FCSA 4C3HH 2EPBA 3QIAA 2R2OA 3F2CA 2XVSA 1EZ6A 3QC8B 1MJEA 2HT1A 2I2YA 3J7ZC 2EMSA 2KZRA 4DKAC 1AP0A 2UU7A 5J2RA 2HHHL 1M4VA 5I2YA 4A3DH 4OWWB 3H7PB 3QWZB 5KRUA 2PW9A 2EYJA 1RL2A 4LNQA 5LNK1 2OT2A 2WAQE 3OIPA 4QUFA 4DV4L 4MGIE 1GUOA 1K8RB 4I6PA 2E74C 3MWYW 3I91A 1PYBA 4GLAC 1J19A 2KMMA 5BYSA 2ZM6L 1X65A 4JI3L 1WTPA 1XXGA 4A3GG 2L0TA 3M95A 4ABNA 5GMVA 3DEPA 1S40A 2JA7B 3OMGA 3IAM1 1XNRQ 4A3JG 3HRZC 2VS1A 4PZ8A 5E3FA 2RPVA 3O65B 3BYTB 3MXNA 3QWNA 1VQAA 2M17A 4JWUC 4QF4A 3ZDTA 3BJUA 5HFYA 1HNWL 1XLQA 3B08A 5AJ3L 5JJZA 2DENB 2NVTB 3MJ5A 2P5ZX 1XNQL 2D9UA 2UWQA 4FXGC 4RMFA 2O5IC 2WU5B 1ZDXA 3NZUA 1EQQA 1GOZA 1LTAD 1RF2D 2KJ6A 1JOQA 3EA6A 3MVVA 1N32L 3GOEA 1PGBA 1V86A 1PXUA 3T1YQ 2RR9A 2F0GA 1WD0A 3AE6B 2MBHA 4ICUA 5G2NA 4JL9A 1WVLA 5IYBH 2MQJA 2W55A 3I90A 1IBLQ 4B3TL 1KH0A 2LFIA 3KYCD 3LX0A 4JCVE 3V6EB 3VTWA 4BFRA 1A5RA 1IW7D 5M5XH 3FP9A 1CK1A 1N62A 1OO9B 3A4RA 4EVOA 5J18A 1EFWA 3A54A 1KJTA 4WJNA 3CWIA 1NMGA 4GOPC 3PT2B 1HQMC 2L3ZA 3P4RB 3LWEA 3KBXA 3J81E 4GNXA 2ZTCA 2ZCBA 4UHVA 1KIXA 4REZA 3RN5A 1NDDA 2QCPX 4PZ7A 4AIMA 3GTMH 2I0QA 4AJYB 4DHZB 3DWPA 2DNEA 2IWHA 1A0IA 2RQXA 4WQMA 3EN2A 5E1FA 1RJTA 5EBDA 5L83A 3TP8A 1K8OA 1SB3C 2LASA 4DR3L 1LT6D 4JI8Q 5KHOA 2AQ1B 4L1BA 3GTQB 4ZRKA 5LMUL 3UINB 3RZOB 5JEAG 3LDZE 1EZ8A 1Q5WB 4XE0A 1BUVT 1WXSA 5DPTA 3QJYA 1A2TA 1CHPD 3WA0A 4A3CG 1N63A 1PGXA 4N9F4 2PE9A 4PMBA 2MHJA 2MP2B 3RNUA 1FD6A 1IBML 2I5MX 3C1FA 3DDCB 1SJED 3Q8CA 1GD7A 2KDMA 1YNND 2YU9H 4ULLA 1WTVA 3VYRA 1TYGB 5D94A 3Q6SA 1TU2B 2O2VA 3W1YA 1PA6A 3CCJA 3H0GB 2DLBA 2NMQA 3S1RB 1JR0D 1R4NB 3HOUB 2WAQB 3A5UA 3A1QB 4HRSA 4TQ1A 2IDYA 3W2DA 4LNNA 4W9IA 3FMCA 4RA8A 1F2LA 4P71A 1KF6B 3UI2A 1C9OA 3UE0A 1F52A 1E8YA 4BOZB 3PO3G 1C78A 3T1HL 3NVZA 2NS5A 1EQTA 1TWAB 3R3MA 3TEYA 1ZEQX 2R92H 3K59A 4XT1B 3HOYG 2WLBA 4A3LG 3W9CB 2ZZPB 1SFOH 2EE1A 4IM0A 2KNBA 2K5NA 5JHAA 5IGBA 4MT5A 3B0AA 1FNWA 1TWFB 4HAEA 4HJKA 5M5WB 1ZE3D 2ZJDA 2XRQD 2D07B 2LGXA 2UUAL 1ICFB 1WJUA 1QG7A 1C3TA 1Q90A 1WJJA 2F4IA 1FXAA 2KAJA 2L1AA 2QKIC 4JI5Q 3DBLB 1ILPA 1VZ7A 3NVVA 2KJXA 1J5EL 3HOWG 4DR4Q 3S1QB 3GS2A 4LJZC 1XMQL 2KCTA 1Y1WG 3GTOH 2EYFA 1XLNA 3QIJA 1BCPD 1HNZL 1GUSA 1Y8OB 5IT9E 3RCZA 4WWNA 5M3MH 4K0KL 2KFKA 1VCIA 3KUZA 1XT9B 3NEMA 2YVCA 3P20A 4EX5A 1YJ9A 1P8LA 2GBJA 2VUMB 4YTMB 2D0PA 2UXDQ 5IGCA 2DAJA 2VZKD 4J15A 4RGMA 5EKLA 2PMZE 4A3FH 3BYYB 1VJKA 3Q3FA 3I73A 3P75A 1CQVA 3URYA 2E5LL 1FRRA 1P98A 2JA6G 2M19A 2Z4HA 2RDBC 3Q8FA 4KTAA 2GBRA 1C48A 4L23A 1KM7A 2BGFA 4OX9Q 4YY3Q 5G55A 1PHJA 4MDKE 5J3BA 2KA7A 4OO1I 1ZYRC 2C5LC 3AECB 2B63H 2ZEQA 3CPFA 5FLXL 5CHFA 5EE1A 3STBC 3TEHB 1MIUA 4BY1H 2PW7A 3CXCA 4N8X1 1TKGA 4DR5Q 1SRUA 1P7EA 2OOBB 3R66C 3DBSA 1I4QA 1HXYD 1STYA 2UU9L 3BDCA 2R93B 1VMCA 1QZGA 1VDZA 1WIAA 3M4OB 1WFYA 3Q22A 2G9DA 1C79A 3G48A 4KK7A 1HRJA 3IFWB 2BA0A 4J1MA 4LDTB 2XGTA 4CQNA 1HUNA 1Q10A 4JVZA 1FJGQ 2GI9A 1V8QA 1CKOA 1KDAA 1TWCB 3CSFA 2VNUD 1SF0A 3HIZA 3K0XA 4NQKE 1HTOA 3NS8A 2Q8IB 1WGKA 4AQYL 3BVMA 4LMQD 2RD0A 4MGKE 1S5FD 4F87A 4JGHB 3JC66 3WAPA 2OCEA 1PV4A 3MC8A 1EO6A 3V3XA 2HQEA 5FLMG 1CSQA 1KTKA 5LXIB 3M3YB 5FO7B 1F2RC 5EPKA 2L76A 3BINA 4YSYB 2CW0D 3GZNB 3L17A 4HKQA 3X23A 1VQ4A 4MH8A 1TS5A 3S17B 1PGAA 1TT5B 4ARCA 2PCFB 3D4RA 4HEDA 5JPMC 1GHJA 1TKYA 4XTCS 2VH2A 2WGSA 2PO4A 4TV3A 1Y1VH 3HKZB 1DOYA 1SMYD 1L1OA 3ZJYC 3NP8A 1FD7D 4KY7A 4PZ6A 5C4XH 4DAVA 4J6HA 1PH2A 3PIP3 5ELOA 2OTJA 4HMJA 1FNUA 3S2DH 4A3OA 3J80i 3JVZX 1GJXA 1H8CA 5IOCA 2WP8J 3FKIG 4QJFA 1QCBD 1LT3D 2LVPA 3R2IA 3T16A 3N20C 1LTSD 3K81C 4KD4A 4ANUA 4ZYNA 4POGA 4WJWA 1V49A 2G45B 2BWFA 3NENA 2WXIA 1A6XA 2JA8B 1YNJC 2OQ0A 4C80A 1E22A 1VQNA 4A93H 2JA9A 4BXXH 5M5YB 1MD2D 4AQ7A 1SSOA 1V5TA 4C3HG 2PMZB 4WJ4A 2DY7A 3ZIMA 2WU2B 4DPGA 1LTTD 4H44C 1UWMA 3IT6B 1SJHD 4MIUA 2EKEC 1ET6A 4PNYA 3K5NA 3V6CB 4DXFA 5EE0A 1IHZA 4R4OA 4DAMA 3CCEA 3OW7A 1SROA 5KEEA 2AYOB 1EQVA 1EYAA 4P6VF 1YNTE 2DYOA 3EGRA 3U30A 1C0AA 4R4QA 1N33L 2K8CA 5EPLA 4A3GB 3K7AB 3GV3A 3A33B 3KUDB 2BE5C 3NZ3A 2JWUA 4R1JA 3LGJA 1C4QA 3RMHA 3SFDB 1V6EA 4EOYA 2KC1A 3UDIA 3CKIB 3PSIA 2IO1B 2LXJA 5IYDH 1UGMA 2F0PA 2KHIA 3S15H 1XNRL 2KD0A 4IUMB 2LWPA 1H9SA 4XQNA 1W6JA 1VQ6A 1HZAA 4YSZB 1KLUD 2Q2TA 4WIPA 5CC4A 1C7YA 3S16B 2E6XA 2QW7A 3KLSX 2ZPYA 3G6EA 3TIXA 1VQPA 1R4PB 4NAWB 3C19A 2UUBL 3C2PA 2MNAA 2IW3A 5J1ZA 3Q23A 3T4AC 1SIJA 4I6NB 3TJPA 2VH1A 4OGQC 3A7LA 2JWZA 2L1BA 3GV6A 1BMLC 1I4PA 2MH7A 4GN1A 3TZUA 3T1YL 3S1MB 3MFYA 1FM0D 1NUCA 2AL3A 3RNBC 2LXKA 2Z6BA 2CHBD 3U8ZA 4R4IA 1WZ0A 2J7ZA 1E7ZA 1CA5A 2MSED 2W54A 3SR1A 3CQZB 2E2HH 1WD1A 3HVZA 1DOIA 1C4AA 3R2TA 3ZDMC 3ZJVA 5EDSA 1PZKD 1G2SA 4IZ8A 1K51A 4O2DA 2BQQA 3OSOA 2DBYA 3ONSA 4IWPA 1KRTA 1H9JA 4CDDC 1WRDB 2DGYA 5BMGA 3U2SC 3ND8A 4BKSD 4RGTA 1MG4A 2GRIA 3TL5A 4YWKA 3ZLZA 4GIVA 5GQOA 1KNEA 2FUG1 3AMUA 1L4DB 1O80A 2JY6A 2I46A 3O13A 1WTOA 2L05A 1XWEA 4KGRA 1WOCA 1YJJA 1VQEA 1UE6A 1OXVA 1GJZA 2F3IA 1D4BA 3BZDB 2N9KA 2FINB 1AE2A 3VH4B 1BBWA 1WX8A 1IBXB 3HG9A 4IFDJ 3ZO5B 1MKHA 3GP7A 3IL8A 5D14A 4LFAQ 2WKDA 5FJ8G 2RDFA 2A68D 2K5QA 2NTSA 3T9LA 3E9SA 3DHGC 3MP9A 5KNDA 3D3RA 3MEHA 2WX1A 1GC7A 1HZBA 1QZEA 1IGDA 4Y52H 1WE6A 1IYVA 1VLBA 3ZUNA 1MVKA 5C3EH 4XQJA 3GTPH 4ANVA 3S2HB 1D2BA 3K7UC 2G1EA 3JSVA 1MBYA 5IY0A 1Z5SB 4PK1A 1PZJD 2LRUA 3FC4A 5DNFA 3TSSA 4QGUA 1JJGA 3AE8B 2JXXA 1MI0A 2ZXPA 3P7JA 1Q1OA 1WM2A 2N9LA 4PS8A 1S4ZA 2L0FA 3U4EG 3X3MA 2OJRA 1SBBB 1WGRA 3PO3B 2FAZA 3D4DA 1QWYA 5TSSA 2KTRB 2L7RA 1I50B 4HXDA 2KX0A 1WXAA 1M94A 3KJOA 3HOYB 5BYQA 4YSXB 3L08A 4M8NA 2R92G 3RNGC 3CF5A 2K6DB 4TKNA 3KF6B 3PUYA 2PW5A 4KV6A 2K1BA 2LD9A 2GA4B 1YHQA 1Q8IA 2NYZD 1Y69U 2IX1A 2B2UC 4DAYB 4Y7NH 4HCPB 4A3BH 3Q8DA 2REXA 3A8IE 4JX1C 3HOWB 2KDFB 1Y1WB 4EZLA 2NR2A 3Q8AA 5JJIA 2GBMA 4DR7L 2DNCA 4BBSB 3MJWA 1RCVD 2K6AA 2H88B 2F0NA 3TRZA 1LV9A 1P0RA 5M3MG 3ZTCA 2L52A 2A6HC 3SD5A 4E71A 3FILA 3HP3A 1B3QA 1YEZA 1J7CA 1V9PA 2UXDL 2JA6B 1WXVA 4IFDH 4OWXB 2B2VC 1MHWC 2XK5A 1JCKB 1LTID 1RDPD 1S5CD 5KNBA 5AUKA 1K8MA 1KL9A 4X3TA 3OWFA 1HZ6A 2CFMA 4L5SA 3AEVA 2C7NB 3HVDA 5C3JB 3BZCA 4FF1A 4LNFA 4OX9L 4YY3L 4P1CC 4QQBX 2I5LX 2B63G 3RZDH 2JZZA 3KUCB 1TR5A 3M4YA 3A74A 1F0ZA 1MGSA 5G3LF 2KVMA 3A8JE 1GG3A 2GN5A 1JW9D 4MGZE 1B44D 2EVBA 2FJ2A 4HN7A 3S24A 4HIOA 2BS3B 2EELA 4PQXA 4DN4M 2MJDA 1GM5A 1TS4A 4QIWE 2PQEA 2ZVOA 4GMVA 3A0JA 1T9HA 4IFDI 1YX6B 4GS3A 3V2TA 2NVXB 4IWOA 4I7AA 4JQWC 4Q2JA 1RAXA 2KT7A 3DWGC 3TMEA 3NZSA 1WTXA 3ML8A 1PUTA 1PFDA 1WMHB 3U7ZA 4DBGA 1S3OA 3H15A 4B3RQ 2L9HA 3GTLH 4XT3B 2HD3A 2HCIA 5JVH3 5GXGB 4URKA 2WXQA 5CTRC 3VDZA 2AUJD 2CHWA 4U673 1DZ1A 2KQSA 4IM3A 5M3FH 3H09A 5EKIA 2WDVB 4RGOS 5ELDA 1VZ8A 5E6PA 1BDOA 1JWBD 1KC8C 3MXNB 3PHXB 1T5XD 1YNXA 1M1KC 2MJ8A 3WWVA 5C4XG 3VR5A 2LGYA 3WOEA 3FKIB 4P73A 2LGIA 1BF4A 1QNKA 3J80E 4XQQA 1GHKA 4UP8A 4K6DA 2KCNA 1WJNA 5CBAE 5C0XI 2BW2A 1I4HA 3N9YC 3KLSA 2ZJQA 2PI2A 4GKJQ 1C4CA 2WXPA 4MEMA 1QZHA 5F2DA 2JSOA 4GKKQ 4HIKA 1N5WA 3HM6X 4C4VB 1I35A 3PZ7A 3S14B 3OW2A 4MM3A 4C3HB 1YI2A 3M63B 4KHZA 4NKLA 1EIYB 4BXXG 4MJSA 4JI4L 4A6QA 2UUCL 3GTGB 5GROA 4DR1L 4XWTA 4A55A 4WORA 1VZ6A 1WTHA 4M00A 3NELA 2WB1E 2M56B 1B1ZA 2MBOA 4F7XA 4JI1Q 3M9BA 3S9WA 2IZVB 2W3RA 5CV5A 1TGZB 3PLUA 1A3VA 2RDHA 2PIAA 4OZCA 1AYFA 1NJIC 4I65A 3ZKJC 2PZTA 3DEOA 1QILA 5IP7H 5J22A 1HNXQ 4OVZA 2B29A 1GO3E 4HCEA 4KJOA 1XJVA 1I94L 3K5MA 2K25A 1D6EC 4N9PA 1W2BA 1PDQA 1L4ZB 1T0SC 1VQIA 1BO0A 2HCCA 2L55A 3N32A 4FJYA 1C1YB 4AYBG 3K5LA 1FEHA 1XPRA 2WXKA 4XIGS 4M0WA 2KOLA 3PRMB 3J9CA 2DWQA 3GTJH 4OIKA 5BO4B 4I7ZC 4JI0L 2LGSA 2Z0EB 4DR6L 2ICIA 3NRZA 4HR7B 2L8JA 4BVUC 2SOBA 4HTHA 1SNDA 5IWAQ 1TT2A 3F1ZA 1P1AA 3MC0B 1CUKA 2JK8A 3PLVA 4M01A 1DJRD 3I8ZA 3KW5B 2O2VB 2A5HA 5D7GA 3KDFA 1VQHA 2JF5A 1X3QA 2UXCQ 2VZAA 4TKOB 2ZCCA 4MTNA 2NPTB 5DPWA 1R4MB 3M4QA 3TEZA 1SMXA 1IYJB 2YTXA 5JVG3 4B95A 1E8ZA 3IXSA 1ONLA 4HJ7A 5LL6S 3PUWA 4HJ8A 1STHA 5I2XA 1S72A 2NWGA 4RCNA 4HPMB 1CI3M 2A69D 2WDQB 2MO1A 3I4NH 2QEXA 2N55A 2ALYB 4HDOA 3OOCA 2DYMA 4P7IA 1L0WA 1GXDC 1FNVA 3GTMB 5C23A 1P9DU 2QILA 1K3BC 1XLPA 3ZNID 1Y8NB 3ML9A 1EIFA 2WKCA 3Q69A 1DOXA 2KCCA 4H7BA 1HH2P 2EZVA 2QJLA 3P4PB 1GNUA 4DV7Q 4WAFA 1XPUA 4B3SQ 3AEAB 2IHEA 3UDXA 1T5EA 5G3LD 5IGFA 1JB7A 4JI7Q 1RFAA 3L10B 2N7EA 4XYQA 3G7LA 4BBRH 5D3DA 2IY0B 3DPDA 4GDKA 1CT1D 2RVLA 1IUEA 1XEEA 4JV5Q 2KFKB 3D0FA 1S5BD 2DZMA 1M90C 3K57A 4ARIA 3SDLC 4DHZE 3G4SA 1FCLA 2IO3B 4PS3A 2GLSA 1SYDA 4WJOA 3DBHI 5C2TB 1PTOC 2OTLA 2BVCA 2AEHA 2ZTDA 4C2MH 3HZXA 2MPMA 4BKGA 4IURA 3V60A 1ZUD2 3ENEA 3TP7A 1CJEA 1MHXA 3DXJC 3PIO3 2O4XA 3L16A 2LZ6A 1O7ZA 4KN7C 3SK6A 1OFFA 4FJZA 2EXDA 2JPHA 5I9PA 5HY6A 2H89B 3L0WB 2CVRA 4UY8C 3U7DA 2X8XX 2R92B 3GTKH 2FCQA 4DR2Q 2ICEC 4DV6Q 1UE1A 2UXBQ 5E4WC 2LI5A 5H8YE 2NVQB 3B2FA 1M8AA 4RGNA 4S0RA 2WXLA 4GU2A 3PIPA 4IQZA 2CH4A 4JYAQ 1ENAA 1D1IA 5IO9A 5FK9C 3HEJA 4RHSA 1K53A 2KLCA 1V9JA 5CV7A 3B2GA 1TY0A 4A3BG 3W1GA 3X0WA 1HE8A 1SXTA 3DBRB 2G9HD 4NW2A 2KQ7A 3ZNZB 2IO0B 4EFOA 1C77A 3W5VB 3E6ZX 4IPGA 2EYHA 4A3KG 1E7UA 2B76B 2BBCA 2WXHA 5M3MB 1VMPA 1ZDVA 4K5XA 3VTVA 1PRTC 3ER0A 3OWEB 2Y5CA 4AP4C 1G8ZD 2KEEA 4BA2I 3ECIA 1YJWA 2F4VQ 3PTFC 1JQ4A 5BN5A 1QOBA 5HHDG 1P3QU 1OXTA 4R8IA 1V8CA 4GOPA 3H3VC 1N5XA 3C1EA 2M0AA 4Z9CB 1WJ6A 3AH7A 4A3IG 1D1KA 1TXYA 2J7QB 3EUB2 2CQOA 2LRWA 1TWHH 3AE9B 5TR5A 2EQSA 4IKGA 4DUYQ 4IO9A 2JA5H 3EVQA 4KGSA 2E2IH 3I7FA 3HOZH 5HURA 1F9QA 1SYCA 2B63B 2TMPA 2D3AA 1D8LA 4WJQA 4IDIA 1ET9A 2F0DA 2FMCA 2IX3A 1F2ZA 3PO2G 1U4AA 3IHPC 3Q3NC 5FLXE 1FCCC 4DF7A 3NTIA 3W1SA 2AUKA 3P42A 2YEPB 2TSSA 3QCAA 1E3PA 2PNHA 1TZ1A 1BVSA 3J80c 3FPUB 4PG3A 1NSNS 2KVZA 2CU1A 4EUTA 5IOIA 2RBMA 3Q8EA 1SNQA 2DN8A 1YX5B 2JXTA 1IKMA 2K39A 3SVMA 1X9NA 2JE6I 1FIQA 4G50A 4HMIA 2G4DB 1AWDA 1OTRB 1WSPA 2RCFA 4CJ0B 1VF5C 4JC0A 1II3A 2IL8A 2JU6X 3ULLA 1RWSA 2IYDB 1CKMA 1CSPA 2H5XA 4KIKA 2N4FA 3BK1A 3OYYA 2K04A 4LF6L 2CKZB 5A2QL 2JYTA 2Z6KC 2NVUI 1R9TH 3TEWA 3FRPB 1UELA 2AQ2B 4B3RL 1UZXB 2O5JC 2SNMA 1F9JA 1WCMG 1ZKOA 1LTLA 2M00A 5L37A 4EZJA 4HSPA 3T53B 1HTPA 3BY4B 2KWCA 1EY9A 1V80A 2V3PA 2F0SA 5I9OA 1Z7TA 2NVYB 5BR8Q 1E2ZA 4DQOC 4KKSA 2A73B 1EFID 3F8TA 5DM63 4X62Q 5C4XB 4W9DA 3ZRFA 5I6WA 5CV8A 2DAFA 1PMRA 5CHWA 4LUVA 4PV1C 1ICWA 3S2DB 4IPHA 1VQGA 1NYRA 1JB3A 2C35B 4IC7B 4WWPA 4RHRA 1FRDA 1I6HH 4RM8A 1Q0WB 1L0XB 1TS3A 3TREA 2UYZB 1OXSC 2EJGC 4LF4L 2A5UA 4X64L 3MFGA 4YHHQ 1U4RA 4BOSC 1GAQB 3RLNA 5C3WA 1JORA 3HKZE 2HIXA 1H9KA 3PUXA 2KKCA 3FVQA 2F3VA 2VQFL 4DXGA 3A55A 3SE0A 4IWQA 2CWAA 3CRKC 4DV2Q 1K8AC 4C3IH 4ICVA 3RYTA 2R7ZH 5CV6A 3M7GA 2I07B 4WJ3M 4OO1H 2INCC 2NZHA 2CS4A 2M4NA 1V1PA 2ON8A 2HTHA 1L6UA 4H02A 4N9TA 1PYSB 3OHXC 2CQAA 1JRUA 2RPQA 3SU8X 1F9RA 5ELEA 1N61A 2E2JH 3ERSX 2B3AA 2LJ5A 2SNSA 3AE1B 2E76C 3VR6A 4OW0A 4BBSG 5H1SE 1VQ8A 2JJQA 5AFWA 3DOWA 3C46A 2C7MB 4N58A 1NTGA 2B2TA 2CJNA 2KMAA 5G5GA 4DV0Q 3DVGX 2N9EB 3L13A 1PTOF 2RA4A 2PQAA 1WXMA 3ZXRA 3FAHA 3S15B 4MTKA 4AYBB 3TQYA 3U4VA 1HNXL 4K7WA 4F1SA 1F2RI 5DM73 2RGFA 3NBHA 3V62A 2QCZA 5IYCH 3ZTDA 4DHJD 2L12A 4P75A 2BTEA 4CGYB 1FL0A 1D5XC 2NN6I 2JA7H 3KWVA 2K05A 3CD6A 5DCNA 4WWMA 2J53A 1SDFA 4NNJB 4WURA 1VQFA 1N6ZA 1BBXC 4OHJA 1YQ3B 1HPCA 1AE3A 4C56C 4LF9L 3PVLA 4M8MA 3RT3B 2NVTH 5CV4A 5GAGC 2NBUA 3AN1A 1HCZA 3VRBB 4RM9A 4DK5A 1UBQA 2V3NA 4CHKA 4B3MQ 4L5TA 2UXCL 4C3JG 3BG3A 2EOTA 4M8AA 5C44G 1DGJA 3ALBA 3PGEA 2X69A 3AU4A 1DOKA 2J52A 2Z1CA 4KKUA 1YJ1A 5I6YA 1IP9A 2AKWB 2EYOA 3TN2A 2MHVA 1YITA 5LL6X 3RMKC 4O1NA 1WXQA 1WZ3A 1H9RA 3VTUA 4FBJB 1YOVB 5L95C 2L00B 2K5DA 1UH6A 1STGA 1N36L 4YTNB 3KF8B 4USAA 1PRTF 3C3LA 2B2YC 4RAUC 3J81L 1WX9A 4K6LA 4LFBL 3WAMA 5BMHA 4MNOA 4BWGB 1PH3A 1XMOQ 1UAPA 2MX2A 4YXDB 4LF7Q 4MZ9A 3CC2A 1B53A 3BWUD 5CGKA 2F1MA 4WAAA 3LNNA 1C9FA 1Z9FA 2LHDA 2DNFA 4RCOA 1B50A 4JI7L 1OXXK 2XN9C 2YTYA 2KJHB 2ZPNA 4YTPB 5A35A 3MTSA 4S17A 2ZJRA 1CFMA 5DPSA 3R7RA 1WH3A 1GPXA 1TY2A 5LMNQ 4A3MH 1BCPB 2IHFA 2XIWA 3GTQH 1V97A 4LFCL 3RZOH 4Q5VA 3ICEA 3KQ4A 1V1QA 1JWUD 4P1BC 1Q46A 2KCMA 2HD5B 2VZKB 3GTPB 3RI7C 1L2FA 2Q2IA 5T8IA 3SK5A 3NOBA 5C4JH 4JPSA 5JJLA 4DUZL 2V0GA 5CV9A 2FIFA 1A2UA 1XPOA 1ISNA 1B9RA 4JIOU 5MPOA 2KDEB 3H0GH 3OPOA 3IAS1 1G6JA 4FO2A 4KHPL 1N60A 3NQTA 4K5WA 3ULPA 3S1RH 1WX7A 2WS3B 1O7YA 2XWBB 2BS4B 4HLEA 3HOUH 2WV6D 1PH5A 5CX3A 3QA8A 5AZGA 4DV6L 2UXBL 1QLBB 2GBKA 2KYWA 2QMTA 1UUPA 4A3DG 2KQ4X 5EJWA 2IJ0A 2V4DA 1TWAH 4QL5A 5FLXc 2JEBI 4O0AA 4Y7NB 1TIFA 4B0MA 3KOJA 1LT4D 4A3BB 1IBKQ 4RKLA 3T56B 3L7ZC 1I7HA 1SNCA 1TWGB 1EWHA 2JXMB 4FXDA 4A3KB 2FE8A 1MSGA 3R8BA 5M5WH 3APCA 4C1NI 1HZ9A 2SEBD 4US8A 4OIJA 4LF5Q 2EDGA 1B4OA 2V9HA 4JWSC 3VUXA 2HJ8A 2F0OA 3J7A5 4TMAB 1YIWA 1QB5D 5IT9L 3N1XC 2ZJPA 1V5OA 1NCVA 3S1QH 3AFQA 2N88A 4A3IB 4POFA 1FPYA 1TKWB 5ELBA 2JX5A 2F0IA 2F4VL 4B9WA 2ZVNA 3DWMA 2AMCB 1R4NI 2J42A 1WGDA 5K36H 4NMZA 1WE7A 2VUMH 2K3UA 2WX0A 4GDLB 1I5FA 3TCAA 2MGSA 2G4SA 3NY5A 4JBWA 4MACA 4X66Q 2LEKA 3UIPB 2A6ED 4DUYL 2L5TA 3HOZG 2PE6B 2CR5A 1B9NA 3CMMB 4FYDA 2JZ3B 5GADC 3PO2B 4AH6A 1KRHA 1VQCA 5IYBG 4GZYC 1IBLL 1MI2A 4PT5A 3SHQA 4EZKA 1PTOD 2JYOA 2R6GA 3VRAB 3DWQA 2D0OA 2XBBC 1LACA 3LWUA 2YLMA 3DHQA 3DBLI 4DAPA 1TJEA 4HPLB 3VUYA 1GB1A 4B9XA 3OLMD 4B08A 2RMMA 4KX6B 4NZLB 2OEOA 5HGQA 4V0BA 1NBWA 3R93A 2FBWB 3M4OH 3DUZA 2N78A 1X1MA 5JHBA 1X56A 2WP9B 1KHIA 4KVGB 2O6VA 3SEBA 2F0KA 3A5ZB 4XDCA 4BAXA 1JMCA 4GN4B 3WANA 2K8HA 2AX5A 5E6OA 4TVAB 4JI8L 1EY6A 1QOFA 1X3PA 1YN5A 1J8CA 1XCQL 4MGYE 3KBGA 3GTLB 1NR2A 2JVCA 4ZUIA 5KNCA 1Q82C 2K03A 3E3XA 1WCMB 3V05A 1IZ6A 3PUZA 2XEWA 4E6IA 3APFA 5CMDA 3V61A 2D3CA 1YMHE 2W3SA 2NBWB 1LTRD 1NI3A 2B2UA 3RD4A 4C1NK 3QG1A 2I38A 1F2YA 1X55A 4II2B 1JQYD 2I1JA 5BR8L 4M0WB 4IPDA 3IG3A 3IT4B 3N1ZC 4ID6A 4LTUA 3RN2A 4X62L 1C4PA 2IGGA 3FHWA 4LK1C 1F9SA 2D5GA 3BVZA 2CHZA 3VR8B 1S5DD 3AFPA 1ZP0B 3ERQA 3CP0A 4HJ9A 1VQOA 2F0EA 5LHY1 3SK8A 4WRDA 2Q2UA 3CCSA 1YD8U 1PQSA 1Z2MA 2RSUA 3APDA 1CZPA 1IW7C 3KDFB 1NBFC 3LXFA 2QC8A 2XRSD 3IFTA 4YHHL 4IALA 3VR2A 4W9FA 4FXKC 3EQLC 1D3ZA 2DY8A 1Q1EA 2MEKA 1O78A 3DLLA 4C00A 4C3IG 4DV2L 2R7ZG 3GB1A 1J9OA 4OO1G 1HZCA 1K52A 2Q8RE 5C0XJ 2C9WB 2I1KA 1KFYB 1PFNA 3QQ8B 4RH6A 2EJFC 4ZRPA 3CSTA 4JI5L 2N1WA 2DZKA 4O42A 2CH4W 5DLQE 4DR4L 2HHHQ 2ONQA 5IKCM 1FO4A 1WTQA 1FR3A 3GZNI 4EKUA 2DZJA 2F0JA 3KH0A 1HFNA 3KVFB 4KZ0A 4IUQA 4IN3A 1T0YA 4TQ0A 1I4GA 3NE5B 3KJPA 1T3QA 2DHZA 5E4XA 2D3GA 2K33A 2EY2A 2KECA 3PZ8A 4A3FG 4NP5A 5LMNW 3N1YC 1LYLA 2YYZA 3N52A 4CJ1B 1A63A 2MBBB 4AUQC 4DXAB 2ZM6Q 4JI3Q 2K22A 4GDKB 5JEAJ 3CU7A 4A3GH 3N6RA 1YNNC 3MHSD 5IN7A 2YTVA 3A4SC 5IA7A 2RHSB 4FA6A 3DHIC 5FO9B 4A3JH 1EY5A 2DYBA 4DV5Q 2PPBC 2GVAA 1EF5A 3VA7A 4LUZA 3VVWB 1KDBA 4ODGA 4IOCA 4KSKC 2LS01 2M0XA 5AJ3Q 4BY1G 4WH4A 4J3OD 1ZXHA 4N8FA 1XNQQ 2JYEA 5ELCA 4DR5L 4JBKA 2VRRB 3BIID 3NVWA 4ZDVA 4KI0A 1VQMA 4OVUA 4C3JB 1EUVB 2KO3A 1N32Q 3B1LX 5C44B 3ONAB 1KNAA 2JRIB 1BNZA 1Y8PB 4V190 2R3ZA 1EWCA 1RKNA 1CQFA 2M2LA 3NWTA 1VQ5A 1E5WA 3PPAA 2V3SA 2CJOA 1SNMA 2FXQA 2ZXRA 1BUIC 4IW0A 1FJGL 3S1MH 4YWLA 2LUMA 4OXPA 1E7VA 2SAKA 3ZJTA 5HG2A 5FOBB 1HR0Q 4JOIC 5C0XH 3KK7A 5EAYA 4F8MA 1YZ6A 4A75A 2MBEA 1BCPC 1GC6A 2KHJA 1QVGA 1PH1A 4DV3Q 4BS9A 3K6OA 5BN4A 5HGTA 3BZKA 1WGHA 4LCDE 2VB2X 2MRPA 3BDLA 1XMOL 2F0TA 2R7DA 1UNSA 4LF7L 1SLJA 2LXCA 1QQRA 3M4PA 1E9MA 2WXRA 2JQOA 4BBRB 3TS2A 3A9KA 2Y0SG 4DR3Q 1OQYA 4KSLC 2LMCA 2QSDA 4GN3B 3AB5A 1Y1VG 2K9XA 4KHVA 4ZKBB 3QARA 4MN3A 1LT5D 1ZOYB 3JAML 1WY8A 4A3MG 3A9JA 3LB8C 5T1GA 2WNMA 3Q3OC 1E8WA 4DFAA 1PVOA 4FHJA 4DNTB 2F52A 4A3CH 1AFPA 5EE3A 1HTQA 1IBMQ 2WHIA 3S1NB 1JJCB 4C2MB 2RSNA 3VFKA 3K80C 2J0JA 4ZRJA 3HS0C 3KYDD 4H13C 3UQAA 1E1OA 1PH9A 3TDQA 4NAWA 1K83B 3ZGZA 1LM0A 3U9OA 4CDEC 1HA6A 1I3QB 4QUCA 2OEDA 2ZNVB 4HJ5A 3RPFC 2MW5A 2VW9A 2NZ1D 3S2HH 1ZYRD 4A93G 4E74A 1NAPA 4YL8A 1E2WA 5T1IA 4UP9A 3EECA 2KLGA 2KTFA 3STBD 3HOXH 2PVGC 1ASYA 1SYFA 3HOVH 2DJGC 3DMUA 4X3KA 4DDID 2M8SA 4A3DB 1B9MA 4GN5A 1CZGA 1AZQA 4RMAA 1QUQA 2Y5PA 2JRHA 2NBFA 4GNXB 3I57A 2BYTA 1F1HA 2DJFC 3HOYH 3K0YA 1STBA 4A3LH 4LJOB 4NQLB 4PYUA 1PTOH 2EIFA 4PS7A 1CKNA 1FGUA 1N8RC 4EGVA 1EY8A 1STNA 4YT0B 2JEAI 2LVOA 2WFWA 1EU3A 1FMAD 1ENFA 2F0LA 2VQEQ 3I63C 5DPRA 2CW0C 4FHKA 1J5EQ 1WGYA 4IPCA 1O7LA 5IYDG 4KIKB 2CU3A 1RIPA 1XMQQ 4LF5L 3HOWH 3RNCC 3DCGA 1BXTA 2Z4IA 1Z47A 1HNZQ 2KOXA 1A62A 4LJPB 1PH6A 3SDZA 3AE7B 1SMYC 4K0KQ 5FO8B 3VQIA 2CHXA 3TZDA 5IGDA 1IBXA 5JOBA 2EY5A 4OELB 1ZXTA 1TWHB 3VA5A 3D4WA 2M9VA 3SXHA 3TBLD 1D5MC 1EU4A 4FLHA 1U4MA 5K36G 5JJKA 4KGTA 4RFBA 3ITPA 2N49A 2K7VA 4CDFC 1BT0A 2KN4A 2E5LQ 3GQBA 4MHEA 3HOZB 2E2IB 3AE5B 3CRLC 2R7FA 2JA6H 2BF8B 1L0VB 3RNFC 4NPSA 2QA4A 2MLBA 4ZOHC 1DOMA 1WR1A 4ILWA 1I4RA 1EUJA 3NVYA 5ELFA 3DQVA 4LNOA 4GSWA 2F0QA 5M5XB 5C5MA 4L63B 4JE3B 3KLRA 3VXWA 3CHBD 4L6TB 1Q12A 3FPPA 3I55A 1RRBA 3RN9C 3KFUA 2CWPA 3NJTA 1K28A 2Z8LA 4OONA 2KTRA 3G6JB 4KMUC 3W1BA 2UU9Q 1E0BA 2ACZB 2AQ3B 2QGQA 3ZNHB 1P16A 3JAMc 1QT9A 3QO2A 2M1MA 3NUHB 3OJ3A 3H3VH 3AQQA 2Q8TA 1YNJD 3EROA 4GGQA 2ID0A 4F7ZA 1B70B 4FP5D 4ZAIA 3KF6A 2KUMA 4MELA 4CKBA 5CYUA 1SE8A 4HIDA 1V1PB 1R7SA 1SGHA 2BYEA 2WINB 3R3OA 2F03A 3F2DA 4ALPA 1QOHA 4Q0FA 4DV1Q 4AQYQ 2NVXH 3CF6E 2F3WA 4G0NB 2L4NA 2LHEA 1TKEA 2LVQA 4JK1C 5JH5C 1VQ7A 1FGBD 2B2WC 2E75C 1XO3A 5A2QE
chains in the Genus database with same CATH topology
1CTMA 2WXGA 2BE5D 3ZJUA 4DK0A 2YU9B 2IT1A 2R61A 1E7PB 2OXPA 3I70A 4XWWA 5BN3A 4WFN3 3J7AF 4FF2A 3AV8A 1QOGA 4OZBA 1I6HB 3D31A 2XSCA 2EXZA 1PYWD 2WACA 2K32A 1SSNA 1SFOB 4HEA1 1DONA 1ESRA 2B39A 2QEJC 4NDXA 5EKKA 4C3IB 2R7ZB 2PYKA 1XCTL 4FVMA 5AUIA 3VR4A 2IX0A 1LLRD 1Y56A 1JALA 3AU7A 2AWOA 1Z6HA 2FFKB 2K5PA 3GTOB 4ZHPA 3ZQ4A 3IKJA 2E2JB 3DM1A 4LLGM 1QF6A 4A3FB 1PLFA 3ABVB 2JZPA 2WXFA 3EFXD 5HI1A 3FEWX 3T51B 3PO0A 2A68C 2QIEB 3MHBA 1L0YB 2BDNA 5CBEE 4IFDG 3NWSA 1QJOA 4DU9A 2XWJB 3X3NA 1BQQT 3I9V1 3TP5A 2H1EA 3KWLA 1AEXA 2WXNA 2OF1A 4ZHOA 1I6VC 4BY1B 4ME5A 3U9SA 4LK0M 4KY5A 2KQ3A 4ZUJA 4IOIE 1QOAA 2BS2B 1XF5L 1STAA 3BK2A 2SDFA 4ZQ3A 3AE2B 2WIIB 1SE3A 1XYIA 1Q1BA 5NUCA 1E6EB 2PNRC 2Q5WD 1WTRA 3V96A 3QOJA 2Y3AA 5COYA 4KKIA 1EIGA 4FXCA 1OQQA 5C0XG 4TQUS 2X38A 1A3UA 1PFMA 3D8GA 1ZPSA 2INNE 1PFBA 2EYPA 4IUVA 4ZRQA 3CIRB 2Y0SB 1AZPA 4A9AA 1NENB 4LAAA 2VB3X 3C8YA 3MAQA 1Y1VB 3P1HA 1H9SB 3SR6A 3PV0A 4A3MB 1V43A 4A90A 1EIHA 2A6HD 3I72A 3P4QB 3VYTA 1QNUA 3P63A 3PUVA 1EWYC 5BYRA 5C4JB 2RKSA 1J7BA 4QMGA 2X6LA 4HCSA 2K01A 4A93B 1SYGA 1EY0A 1JOKA 2NN6H 2BB5A 2PMVA 4EQOA 4HKZE 1YJIA 3FDTA 3RUZA 3K58A 1TVXA 2QF7A 5EE9A 4K8IA 1VF7A 1STEA 1EOTA 4DNRB 5FR3A 3L3OC 4B0EA 2ZW1A 4KY6A 2BA1A 1G2TA 2LY7A 3HUIA 4HSVA 3EJIA 3H6MA 5C3XA 2B8GA 2J4XA 3WCQA 1YN3A 4H2AA 1U4LA 4C7YA 2KHSA 1HUMA 1G6ZA 3NXWA 1MPEA 1B2TA 3ZYYX 3SFEB 4YIJA 2B2YA 4EQNA 4GLSC 3M85A 1B3AA 1YN4A 4UDUC 2MUYA 3AEDB 1QKZA 3MXGA 3T3OA 4X3UA 1RFKA 2LFNA 1IL8A 3IFDA 2E2HB 5FKAC 1KABA 5C5LA 3L9AX 3WOFA 3NUCA 4K14A 2BDOA 1EYDA 2F0WA 3BDOA 3TP6A 4CKEA 1HEZE 2B2TC 2N0SB 1DOLA 1UWXA 2MJEA 4ZLTF 5KYIA 4ZYSA 1E10A 3NTHA 3HGBA 3Q24A 5KYLA 5G5HA 4KKJA 3Q0AA 3FILB 2HDMA 2WXJA 1HZ5A 1W6KA 1U4PA 1RM6C 1A70A 5IIFA 5C3EB 3AMZA 4EE2A 3OMCA 3AEEB 4RNAA 1ESFA 1RTOA 2C9OA 4EQPA 3RFZB 4YWGG 5KGUA 1UEAB 1SE2A 3A7AB 3HRDD 4OL7A 1LABA 1E2VA 2A69C 2F0UA 3P1MA 1UGJA 4BA1I 3QOLA 1QE6A 1GUTA 1C8CA 1ACCA 3SHLA 1A15A 1MSHA 2NUCA 1RODA 2WQYB 3AB9A 1R4QB 3H91A 4XDXA 5JPNC 4G57A 2EYMA 5DEHA 2KEDA 5ISRA 2F0HA 5EPJA 4F88A 4L2YA 5M9OA 2LKVA 1NYQA 2GB1A 4FF3A 3B9JA 2K5WA 1G291 2LMCB 1AN8A 1G91A 4A3JB 2PKOA 3K5OA 1DM0B 4U68A 2JQRB 3NQIA 3RZDB 5BMIA 3J7AV 5EQ0A 4PMWA 2FHTA 2IPKD 1JOOA 1LO5D 5C6AA 2MP1A 4TSSA 4MM3B 1JMLA 1CM9A 3UI3A 2L11A 4ZK9B 1DCZA 2W82A 4A8XC 2O2LD 3DWAA 1EY7A 1IGCA 1EL0A 4QB4A 4ZKCB 5K5PA 3GO5A 2KACA 5M3FB 1VDVA 3MZ5A 1Q3LA 4FF4A 3OIQA 2HTME 4G7ZC 1RTNA 1WRIA 3D6CA 2E3TA 4H0LC 1FXIA 4L8JA 1PRTD 1DD2A 3AE4B 3JAME 1TIID 5IGGA 2WDRB 2JP1A 4KJNA 1H9MA 3ND9A 1A3TA 3H8HA 1MHHE 4DA2A 1K50A 4IUTA 3P4SB 3PMFA 1VR9A 2B2VA 3A8KE 3VYUA 4D2KA 2NN6G 1E0ZA 4XXEA 3HOXB 3HOVB 4RF1A 4X3SA 1WWTA 1NR4A 3F2UA 1WTWA 2PTLA 1XLOA 1DYQA 1EEFD 2HUGA 3M7NA 1PTOB 4TRDA 5E6JA 2INPE 4HJGE 1SAPA 3U52E 2EJMA 1SE4A 1NVID 1J8IA 2F0FA 2BCOA 1GUNA 3KF8A 3BVGA 5C4ZA 2NTTA 1ROEA 4ZRZA 4NAMA 1U9RA 4M1UB 2L83A 2NB0A 3GTJB 2K0PA 4KN4C 1LTBD 4XYOA 4G7HC 2E2DC 3TBIB 2LJIA 1OXUA 3MXUA 4ITKA 1NEKB 3WDNA 4UAIA 3MA2B 5D3IB 3AM9A 2EY1A 5J39A 2B8FA 2K28A 2WXOA 1GB4A 1JWMD 3BS1A 1P7FA 2FMMA 1C76A 2EY6A 3T3NA 3A56A 3I4LA 1VRAB 4OZAA 3TUOA 3W5UB 1J7AA 2MJ3A 4G4KA 3RLFA 1PRTB 1EEID 3AEBB 3QB3A 3I4NB 4K5VA 2F0VA 1X32A 1KAAA 1F2MA 3ETRA 1CZWA 1JC7A 1RD9D 3NPPA 2AWNA 4J8QA 5JXVA 2ENBA 3NBIA 4CJ2C 1KLGD 2C5CA 2YEPF 5CORA 1GUGA 5IODA 2BT6A 1JRPA 2RDGA 1GUWA 3NSWA 1AW7A 1S5ED 5JEAH 4A3EB 2HDEA 4DGZA 1JE4A 2L32A 2V4IB 3E0JA 1PDXA 2IGDA 4R8NA 1RYJA 3H94A 1ILQA 1YQ4B 1FFVA 5KIXA 5I4DA 2N7JA 3GD7A 1SYEA 4RF0A 4R9WA 4AS1A 3D6WA 3NK9A 4IUUA 3GTKB 4US9A 1LTGD 1D5ZC 4G7OC 4CKCA 4DK1A 2QDBA 5D65A 1JROA 3IAYA 3VYSA 2EKIA 1EY4A 1I4XA 1F9PA 1WYGA 3LYYA 3VR9B 4XDDA 3I3CA 2A74C 2HDLA 3MXPA 4K8JA 4P2CB 2XNAC 2D5DA 4BY7B 3NHHA 5EGTA 2PVOD 1SNPA 3T13A 2JA5B 2D2CC 4KKTA 4N59A 3NTKA 1RHPA 4R3DA 5DAUA 1HTLD 2BB6A 1OQRA 1JWAD 1TS2A 5IGEA 1XTCD 1FFUA 3MHZA 4QIWB 3Q8BA 1L6VA 1PZID 3E5SA 2ZXOA 5JAVA 2H4OA 2KWDA 2PLPA 2B2WA 2X6GA 4CBVA 3AE3B 3TEXA 4C7ZA 4KD3A 2VXWA 2ZW0A 1ML0D 4K2LA 4RWSC 2PZUA 3L4PA 4HROA 4FNFA 1TZOA 3J7YW 3VR3A 1SEBD 1EYCA 3SK4A 4DAYA 3AEFB 1SNOA 4CHTB 1FYCA 1CHQD 3E56A 4IUNA 1IYUA 5C4HA 2PZWA 1V1OA 1R9TB 1EM7A 5H92C 5CR3A 1JICA 1IKLA 4IUPA 4RKBA 1BR9A 1BOSA 1XX8A 4N6EB 5EBCA 2IGHA 1JWSD 1F77A 1HQRD 4QCLA 1HFGA 1ZXIA 1HA5A 2A6EC 1L5PA 2BOSA 2OHFA 4PMCA 2ZT9C 2J0TD 2EYLA 2WXMA 2D62A 2RSOA 1ENCA 1HHVA 3J80L 1KDCA 2F0MA 1CA6A 3NS1A 1DXMA 4P16A 3I4MB 1TQOA 4K2KA 1T6BX 1BCPF 2WB1B 3KUPA 4S3SA 1SYBA 4NJCA 3W3AA 3AEGB 2JSVX 2L0CA 2EPBA 3QIAA 2XVSA 1EZ6A 2I2YA 1AP0A 1M4VA 5I2YA 5KRUA 2PW9A 2EYJA 5LNK1 2OT2A 3OIPA 4QUFA 1GUOA 2E74C 3MWYW 3I91A 2KMMA 5BYSA 1WTPA 1XXGA 4ABNA 3DEPA 2JA7B 3OMGA 3IAM1 3HRZC 5E3FA 2RPVA 3BYTB 3MXNA 3QWNA 4JWUC 4QF4A 5HFYA 1XLQA 5JJZA 2NVTB 3MJ5A 2D9UA 4FXGC 2O5IC 2WU5B 1ZDXA 1GOZA 1LTAD 1RF2D 1JOQA 3EA6A 3MVVA 1PGBA 1PXUA 2F0GA 1WD0A 3AE6B 1WVLA 2W55A 3I90A 1KH0A 2LFIA 3LX0A 1IW7D 1CK1A 1N62A 1OO9B 4EVOA 3A54A 3CWIA 1HQMC 3P4RB 3LWEA 3KBXA 3J81E 4REZA 2QCPX 3DWPA 2IWHA 2DNEA 2RQXA 4WQMA 5E1FA 5EBDA 1RJTA 3TP8A 1K8OA 1SB3C 1LT6D 2AQ1B 4L1BA 3GTQB 3RZOB 5JEAG 1EZ8A 4XE0A 1BUVT 3QJYA 1A2TA 1CHPD 1N63A 1PGXA 4PMBA 1FD6A 3C1FA 1SJED 3Q8CA 2KDMA 1YNND 4ULLA 1WTVA 3VYRA 1TYGB 3Q6SA 1TU2B 3H0GB 2DLBA 2NMQA 3S1RB 1JR0D 3HOUB 2WAQB 4TQ1A 4HRSA 2IDYA 3W2DA 3FMCA 4RA8A 1F2LA 1KF6B 3UI2A 1C78A 3NVZA 1EQTA 1TWAB 3TEYA 1ZEQX 3K59A 4XT1B 2WLBA 3W9CB 2EE1A 5IGBA 4MT5A 1FNWA 1TWFB 4HAEA 5M5WB 1ZE3D 2XRQD 1QG7A 1Q90A 2F4IA 1FXAA 2KAJA 2L1AA 2QKIC 1ILPA 1VZ7A 3NVVA 2KJXA 4L23A 3S1QB 3GS2A 4LJZC 1XLNA 2EYFA 1BCPD 1GUSA 1Y8OB 5IT9E 1VCIA 3P20A 4YTMB 2VUMB 2VZKD 5IGCA 4RGMA 5EKLA 3BYYB 1VJKA 3I73A 3P75A 1CQVA 3URYA 1FRRA 3Q8FA 2M19A 2Z4HA 4KTAA 1C48A 2KA7A 4OO1I 1ZYRC 3AECB 5FLXL 5EE1A 2PW7A 1TKGA 1P7EA 1I4QA 1HXYD 1STYA 3BDCA 2R93B 1VMCA 1VDZA 3M4OB 3Q22A 2G9DA 1C79A 4KK7A 1HRJA 2BA0A 4J1MA 4CQNA 1HUNA 1Q10A 2GI9A 1V8QA 1TWCB 1KDAA 2VNUD 1SF0A 2Q8IB 1WGKA 3BVMA 4LMQD 1S5FD 4F87A 3V3XA 2HQEA 1KTKA 3M3YB 5FO7B 1F2RC 5EPKA 4YSYB 2CW0D 4HKQA 4MH8A 1TS5A 3S17B 1PGAA 4ARCA 2PCFB 5JPMC 3D4RA 4HEDA 1GHJA 1TKYA 4XTCS 3U2SC 2PO4A 3HKZB 1DOYA 1SMYD 3NP8A 1FD7D 4KY7A 4DAVA 4J6HA 3PIP3 4HMJA 1FNUA 1GJXA 5IOCA 2WP8J 1QCBD 1LT3D 3R2IA 3T16A 1LTSD 4KD4A 4WJWA 2WXIA 1A6XA 2JA8B 1YNJC 4C80A 5M5YB 1MD2D 4AQ7A 1SSOA 4C3HG 2PMZB 2DY7A 2WU2B 3IT6B 1LTTD 4H44C 1UWMA 1SJHD 4MIUA 1ET6A 4PNYA 3K5NA 4DXFA 5EE0A 1IHZA 3OW7A 5KEEA 1EQVA 1EYAA 4P6VF 1YNTE 2DYOA 3EGRA 5EPLA 4A3GB 3K7AB 3GV3A 3NZ3A 2BE5C 2JWUA 3SFDB 1C4QA 3RMHA 3CKIB 2F0PA 1H9SA 4XQNA 1W6JA 4YSZB 1KLUD 4WIPA 5CC4A 3S16B 2E6XA 3KLSX 1R4PB 4NAWB 3C2PA 2IW3A 5J1ZA 3Q23A 3T4AC 1SIJA 4OGQC 3A7LA 2L1BA 3GV6A 1BMLC 1I4PA 2MH7A 3TZUA 3S1MB 3MFYA 1FM0D 1NUCA 2CHBD 2J7ZA 1CA5A 3SR1A 3CQZB 1WD1A 3HVZA 1DOIA 1C4AA 3R2TA 3ZJVA 1PZKD 1G2SA 4IZ8A 1K51A 3OSOA 2DBYA 1H9JA 5BMGA 3ND8A 4RGTA 2GRIA 1KNEA 2FUG1 3AMUA 1L4DB 1O80A 4KGRA 2I46A 3O13A 1WTOA 1XWEA 1YJJA 1OXVA 1D4BA 3BZDB 2N9KA 2FINB 1IBXB 3HG9A 4IFDJ 3GP7A 3IL8A 5D14A 2WKDA 2A68D 2K5QA 2RDFA 2NTSA 3E9SA 3MP9A 5KNDA 3D3RA 3MEHA 1IGDA 1IYVA 1VLBA 1MVKA 4XQJA 3S2HB 1D2BA 2G1EA 1MBYA 1PZJD 3FC4A 5DNFA 3TSSA 3AE8B 1MI0A 2ZXPA 3P7JA 2N9LA 1S4ZA 3U4EG 3X3MA 1SBBB 3PO3B 3D4DA 1QWYA 5TSSA 1I50B 5BYQA 3HOYB 4YSXB 4KV6A 3PUYA 2PW5A 2K1BA 2GA4B 2IX1A 1Q8IA 2NYZD 1Y69U 2B2UC 3A8IE 4JX1C 3HOWB 1Y1WB 3Q8AA 2DNCA 4BBSB 1RCVD 2K6AA 2H88B 2F0NA 1LV9A 2L52A 2A6HC 3FILA 3HP3A 1J7CA 2JA6B 4IFDH 2B2VC 1JCKB 1S5CD 1RDPD 1LTID 5KNBA 5AUKA 1K8MA 4X3TA 3OWFA 1HZ6A 3HVDA 5C3JB 4FF1A 1TR5A 3M4YA 1F0ZA 1MGSA 5G3LF 2KVMA 3A8JE 1JW9D 1B44D 2EVBA 2FJ2A 4HN7A 2BS3B 2EELA 2MJDA 4PQXA 4DN4M 1TS4A 2PQEA 4IFDI 3V2TA 2NVXB 4Q2JA 3DWGC 3TMEA 1WTXA 1PUTA 1PFDA 3U7ZA 2L9HA 4XT3B 2HCIA 5JVH3 5GXGB 2WXQA 2AUJD 4U673 1DZ1A 3H09A 5EKIA 2WDVB 4RGOS 5ELDA 1VZ8A 1BDOA 1JWBD 1T5XD 2MJ8A 3VR5A 3WOEA 3FKIB 2LGIA 1BF4A 1QNKA 3J80E 4XQQA 1GHKA 4K6DA 2KCNA 5CBAE 5C0XI 2BW2A 1I4HA 3N9YC 3KLSA 1C4CA 2WXPA 5F2DA 2JSOA 1N5WA 3PZ7A 3S14B 4C3HB 4KHZA 4NKLA 4A6QA 3GTGB 4XWTA 4A55A 4WORA 1VZ6A 2M56B 1B1ZA 4F7XA 3S9WA 2W3RA 5CV5A 1A3VA 2RDHA 2PIAA 4OZCA 1AYFA 4I65A 2PZTA 3DEOA 1QILA 5J22A 4OVZA 4HCEA 4KJOA 3K5MA 4N9PA 1D6EC 1L4ZB 1PDQA 2HCCA 1BO0A 2L55A 3K5LA 1FEHA 2WXKA 4XIGS 4M0WA 2KOLA 3J9CA 2DWQA 4OIKA 4I7ZC 2ICIA 3NRZA 4HR7B 2SOBA 4HTHA 1SNDA 1TT2A 3MC0B 1DJRD 3I8ZA 2A5HA 5D7GA 1X3QA 4TKOB 3TEZA 5JVG3 3IXSA 1ONLA 5LL6S 3PUWA 1STHA 5I2XA 2NWGA 4RCNA 1CI3M 2A69D 2WDQB 2N55A 3OOCA 2DYMA 1GXDC 1FNVA 3GTMB 1XLPA 2QILA 1Y8NB 2WKCA 3Q69A 1DOXA 2KCCA 4H7BA 2EZVA 2QJLA 3P4PB 4WAFA 3AEAB 5IGFA 1T5EA 5G3LD 4XYQA 3G7LA 5D3DA 1CT1D 2RVLA 1IUEA 1XEEA 1S5BD 3K57A 4ARIA 1FCLA 1SYDA 5C2TB 1PTOC 3HZXA 2MPMA 4IURA 1ZUD2 3TP7A 1CJEA 1MHXA 3DXJC 3PIO3 2O4XA 1O7ZA 4KN7C 3SK6A 1OFFA 5I9PA 2H89B 2CVRA 2R92B 2ICEC 5E4WC 5H8YE 2NVQB 3B2FA 1M8AA 4RGNA 2WXLA 4IQZA 1ENAA 1D1IA 5FK9C 3HEJA 4RHSA 1K53A 5CV7A 1TY0A 1SXTA 2G9HD 4NW2A 1C77A 3W5VB 3E6ZX 2EYHA 2B76B 2BBCA 2WXHA 5M3MB 1VMPA 1ZDVA 4K5XA 1PRTC 3OWEB 2Y5CA 1G8ZD 2KEEA 4BA2I 1JQ4A 5BN5A 1QOBA 5HHDG 1OXTA 4R8IA 1V8CA 3H3VC 2M0AA 1N5XA 3C1EA 3AH7A 4Z9CB 3B2GA 3EUB2 1D1KA 3AE9B 4IKGA 4KGSA 3EVQA 5HURA 1F9QA 1SYCA 2B63B 2TMPA 4IDIA 1ET9A 2F0DA 2FMCA 2IX3A 1F2ZA 5FLXE 1FCCC 4DF7A 3NTIA 3W1SA 2AUKA 3P42A 2YEPB 2TSSA 3FPUB 1NSNS 2RBMA 3Q8EA 1SNQA 2DN8A 2JXTA 1IKMA 3SVMA 1FIQA 2JE6I 4HMIA 1AWDA 1WSPA 4CJ0B 1VF5C 1II3A 2IL8A 2JU6X 1RWSA 3BK1A 2K04A 5A2QL 2JYTA 3TEWA 3FRPB 2AQ2B 2O5JC 2SNMA 1ZKOA 2M00A 4HSPA 3T53B 1HTPA 1EY9A 2V3PA 2F0SA 5I9OA 1Z7TA 2NVYB 1E2ZA 4DQOC 4KKSA 2A73B 1EFID 5DM63 5C4XB 5I6WA 5CV8A 1PMRA 4PV1C 1ICWA 3S2DB 1NYRA 1JB3A 4RHRA 1FRDA 1L0XB 1TS3A 1OXSC 2EJGC 3MFGA 1U4RA 1GAQB 5C3WA 1JORA 1H9KA 3PUXA 3FVQA 2F3VA 4DXGA 3A55A 3SE0A 3CRKC 5CV6A 3M7GA 2I07B 4OO1H 1V1PA 2ON8A 1L6UA 4N9TA 3OHXC 2CQAA 1F9RA 5ELEA 1N61A 3AE1B 2SNSA 2E76C 3VR6A 4OW0A 5AFWA 3C46A 4N58A 2CJNA 2B2TA 5G5GA 1PTOF 2RA4A 3FAHA 3S15B 4AYBB 1F2RI 5DM73 3NBHA 2L12A 2BTEA 4CGYB 1D5XC 2NN6I 3KWVA 2K05A 4WWMA 2J53A 1SDFA 4WURA 1BBXC 4OHJA 1YQ3B 1HPCA 4C56C 5CV4A 3AN1A 3VRBB 1HCZA 2V3NA 4C3JG 3BG3A 2EOTA 4M8AA 1DGJA 2X69A 1DOKA 2J52A 2Z1CA 4KKUA 5I6YA 2EYOA 3TN2A 2MHVA 5LL6X 4O1NA 1WXQA 1H9RA 2K5DA 1STGA 4YTNB 4USAA 1PRTF 3C3LA 2B2YC 4RAUC 3J81L 4K6LA 5BMHA 4BWGB 1UAPA 4YXDB 1B53A 3BWUD 5CGKA 2F1MA 3LNNA 1C9FA 2LHDA 4RCOA 1B50A 1OXXK 2XN9C 4YTPB 5A35A 3MTSA 1CFMA 1GPXA 1TY2A 1BCPB 2XIWA 1V97A 4Q5VA 3KQ4A 1JWUD 2VZKB 3GTPB 5T8IA 3SK5A 4JPSA 2V0GA 5CV9A 1A2UA 1B9RA 5MPOA 3IAS1 3OPOA 4FO2A 1N60A 3NQTA 4K5WA 2WS3B 1O7YA 2XWBB 2BS4B 2WV6D 1QLBB 2QMTA 1UUPA 2KQ4X 5EJWA 2IJ0A 2V4DA 4B0MA 4Y7NB 2JEBI 1LT4D 4A3BB 4RKLA 3T56B 3L7ZC 1I7HA 1SNCA 1TWGB 1EWHA 2JXMB 4FXDA 4A3KB 2FE8A 1MSGA 3R8BA 4C1NI 4US8A 2SEBD 4OIJA 2EDGA 1B4OA 4JWSC 2F0OA 4TMAB 1QB5D 5IT9L 1NCVA 2N88A 4A3IB 2JX5A 1TKWB 5ELBA 2F0IA 4B9WA 3DWMA 2J42A 5K36H 4NMZA 2K3UA 4GDLB 2MGSA 4JBWA 4MACA 2LEKA 2A6ED 2L5TA 1B9NA 4FYDA 3PO2B 1KRHA 4GZYC 1MI2A 4PT5A 1PTOD 2JYOA 2R6GA 3VRAB 3DWQA 1LACA 3LWUA 3DHQA 4DAPA 1TJEA 1GB1A 4B9XA 4B08A 2RMMA 4KX6B 4NZLB 2OEOA 2FBWB 4V0BA 3R93A 3DUZA 2WP9B 3SEBA 2F0KA 4XDCA 2AX5A 1EY6A 1QOFA 1X3PA 1YN5A 1XCQL 3KBGA 3GTLB 1NR2A 4ZUIA 5KNCA 2K03A 1WCMB 3V05A 3PUZA 4E6IA 5CMDA 2W3SA 1YMHE 1LTRD 1NI3A 2B2UA 3RD4A 4C1NK 3QG1A 2I38A 1F2YA 1JQYD 3IT4B 4ID6A 4LTUA 1C4PA 2IGGA 4LK1C 1F9SA 2D5GA 3BVZA 3VR8B 1S5DD 1ZP0B 3ERQA 2W54A 2F0EA 5LHY1 3SK8A 4WRDA 1CZPA 1IW7C 3LXFA 2XRSD 3IFTA 4IALA 3VR2A 4FXKC 3EQLC 2DY8A 1Q1EA 2MEKA 1O78A 4C3IG 3GB1A 1J9OA 4OO1G 1K52A 2Q8RE 5C0XJ 1KFYB 1PFNA 4RH6A 2EJFC 4ZRPA 4O42A 2ONQA 1FO4A 1WTQA 1FR3A 2F0JA 1HFNA 4IUQA 4IN3A 4TQ0A 1I4GA 3NE5B 1T3QA 5E4XA 2K33A 2EY2A 2KECA 3PZ8A 4NP5A 2YYZA 3N52A 4CJ1B 2K22A 4GDKB 5JEAJ 3CU7A 3N6RA 1YNNC 5FO9B 1EY5A 2PPBC 3VA7A 1KDBA 4ODGA 2LS01 4WH4A 4J3OD 1ZXHA 2JYEA 3NVWA 5ELCA 3BIID 4KI0A 4C3JB 5C44B 3ONAB 1KNAA 1BNZA 1Y8PB 4V190 2R3ZA 1EWCA 1RKNA 1CQFA 2M2LA 3NWTA 2CJOA 1SNMA 2ZXRA 1BUIC 2LUMA 2SAKA 3ZJTA 5HG2A 5FOBB 5C0XH 3KK7A 4F8MA 1BCPC 4BS9A 3K6OA 5BN4A 5HGTA 2VB2X 3BDLA 2F0TA 1UNSA 1QQRA 1E9MA 2WXRA 4BBRB 2LMCA 2QSDA 3AB5A 2K9XA 4KHVA 4ZKBB 4MN3A 1LT5D 1ZOYB 3JAML 3LB8C 5T1GA 2WNMA 4DFAA 4DNTB 1AFPA 5EE3A 3S1NB 4C2MB 2RSNA 3HS0C 4H13C 3TDQA 1K83B 3ZGZA 3U9OA 1HA6A 2OEDA 1I3QB 4QUCA 3RPFC 2NZ1D 1ZYRD 1NAPA 1E2WA 5T1IA 2PVGC 1SYFA 3DMUA 4X3KA 4A3DB 1B9MA 1CZGA 1AZQA 2Y5PA 3I57A 2NBFA 2BYTA 3K0YA 1STBA 1PTOH 4EGVA 1EY8A 1STNA 4YT0B 2JEAI 1EU3A 1FMAD 1ENFA 2F0LA 2CW0C 1O7LA 2CU3A 1BXTA 2Z4IA 1Z47A 3SDZA 3AE7B 1SMYC 5FO8B 3VQIA 3TZDA 5IGDA 1IBXA 5JOBA 2EY5A 1ZXTA 1TWHB 3VA5A 3SXHA 2M9VA 3D4WA