1V1PB

The structure ssl from staphylococcus aureus from an orthorhombic crystal form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
191
Chain Sequence
HDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN 1
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
total genus 47
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
B PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1pB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1pB01
4K6LA 1D5ZC 1SE3A 1PTOB 1SE2A 1S5CD 4RGMA 2O2LD 2Z8LA 1G8ZD 2J4XA 3CHBD 1EFID 1RDPD 1TY0A 1EEFD 3O13A 1STEA 1PRTB 1S5FD 2SEBD 3BZDB 1LT6D 3OWEB 1EEID 1M4VA 1PTOD 1LTAD 1ESFA 1YN5A 2CHBD 1PYWD 1JR0D 1SE4A 2IPKD 2XRQD 1TS3A 4UDUC 1LO5D 1I4XA 2R61A 1CHQD 1D5MC 1L0YB 3DWQA 5TSSA 1B1ZA 1XTCD 1L0XB 1TS4A 3BYYB 1CHPD 1DYQA 2NTSA 1V1PB 5I4DA 1KLUD 1GOZA 1PTOF 4RGNA 2AQ3B 3R8BA 1FGBD 2XNAC 1RF2D 5ELFA 1SJED 2QILA 3KLSX 2RDHA 3DWPA 1TY2A 1PRTF 2ICIA 1V1OA 1KTKA 1LT3D 5FK9C 1PRTC 4BWGB 5ELDA 1BCPD 1TS2A 1JWMD 3URYA 1FNUA 3BVMA 5D3DA 5D3IB 1AN8A 2G9HD 2QEJC 1BXTA 1SXTA 2XRSD 1ET9A 4C56C 1D5XC 1FNVA 1I4GA 1DJRD 1JCKB 3GP7A 4ZYSA 1HQRD 1QILA 1TS5A 1EWCA 1HXYD 1AW7A 1I4PA 1BCPB 1LTSD 1XXGA 1PTOC 5ELBA 1PZID 1UNSA 3MFGA 1V1PA 1FD7D 1LTGD 2AQ1B 3BYTB 1ENFA 4OHJA 3R2IA 1JWUD 1PZKD 3EA6A 3MC0B 1ET6A 1JQYD 4L6TB 1YN3A 2NTTA 4RHSA 1S5DD 4RHRA 3V05A 1SEBD 1RCVD 1HA5A 2RDGA 1SBBB 4RCOA 1D6EC 3W2DA 1LTBD 1I4HA 1LT4D 4L63B 4RGOS 1MD2D 1I4RA 2IJ0A 1PZJD 2AQ2B 4O1NA 1JWSD 1LTTD 4DXGA 4NZLB 1S5ED 1LT5D 1YN4A 1CT1D 4RGTA 1PTOH 1HTLD 1LLRD 2XN9C 1BCPF 3DWAA 4RFBA 4Z9CB 5ELCA 1KLGD 1BCPC 1EU4A 2WV6D 1B44D 3BVZA 1FNWA 1I4QA 1EU3A 1S5BD 1T5XD 3BVGA 1F77A 4TSSA 1LTRD 1RD9D 1CK1A 1SJHD 3EFXD 2TSSA 5ELEA 3TSSA 1LTID 5FKAC 1PRTD 4RH6A 3R2TA 4DXFA 1CQVA 1UUPA 3SEBA
chains in the Genus database with same CATH superfamily
3PIPA 1HRJA 1K83B 3KYCD 5KNCA 1E9MA 2DZKA 3FC4A 3S9WA 1Z47A 1L6UA 1KDCA 3KUPA 1HTOA 4K7UA 4JI7Q 3GTOH 2KT7A 3LB8C 3KYDD 2BQQA 3BZDB 1WRIA 3M7GA 4K5XA 3ZW3A 2B2TC 1V9JA 2EOTA 2ZPNA 5DEHA 2ZJPA 4F87A 1V86A 3KWVA 2W54A 1C4AA 1VQEA 5EKKA 1SE4A 4LFCL 4EQNA 1GAQB 1DXMA 3L3OC 1KM7A 1MI2A 3GTQH 3IKJA 3K80C 1C0AA 4Y7NH 2F0MA 1LO5D 1D5MC 1U5KA 1L0YB 5DCNA 5TSSA 1XTCD 1CM9A 3SDLC 3NUHB 1ZGUB 3ZO5B 3HVDA 3MC9A 2QMTA 3A4RA 3U30A 2M00A 4R4IA 1JJ2A 1STBA 4JCVE 2LKVA 3S17B 4PT5A 2V3NA 3KLRA 3DWMA 4CJ1B 2ZJRA 2Q8RE 4AQYL 3KLSX 2LMCA 3AU5A 2RDBC 4LF8Q 2E75C 4DV1L 3MEFA 5FK9C 5EPJA 2K8HA 2L1BA 2ZW1A 3VVWB 1YITA 1X3QA 2EDGA 4ZRZA 3NVWA 1A63A 1R4NB 4E3CA 2XVSA 4K2LA 4ALPA 4DDGD 1O7IA 1WJ4A 1CUKA 2KFJA 1OO9B 4MM3A 1NI3A 2L00B 1WCMB 1FVIA 1NBFC 1ZYRC 3NBIA 1WTOA 1Q7YC 3I4NB 2WXFA 1W2BA 2CCZA 1FR3A 2QIEB 4KHVA 4DR5Q 4B9WA 1HQRD 2N9XA 4CJ0B 1X56A 2ZVOA 1QILA 3APDA 3KQ4A 4MGZE 4DPGA 4ANUA 1MHHE 5E1FA 2WS3B 3K8AA 4IALA 2F0LA 4JI6L 1WF9A 5ELBA 3GTLB 1PZID 3R7QA 2J0JA 1GUNA 3VH3B 1ENFA 3PT2B 4KSLC 4GOCA 3ERQA 5IP9H 3AE6B 1E24A 1I7HA 4NAMA 1SNOA 1HHVA 4HSVA 4KKIA 5JPNC 4QIWB 4GNXC 4M00A 3K7UC 5AZFA 3PCOB 4E74A 4JG2A 4A3GH 4LLGM 3BK1A 4XZ4A 2BYVE 4KMUC 3RMKC 1QUQB 3IAM1 1LTBD 2CS4A 3L4PA 3UF8A 1LM8B 4GKJQ 3V62A 1Y69U 3D31A 2KENA 1O7ZA 4I65A 4BY1H 3PPAA 4ICVA 2SNSA 4IN3A 4BFRA 4II2B 2J7QB 3VUYA 4LF9L 4A93G 4HJ5A 4NAWA 3VUXA 2BDNA 1WJ6A 4M8NA 2EIFA 4F8CB 1GB1A 2V4DA 4W9GA 2NCNA 4R4QA 4XYQA 1STHA 5HURA 4DR6Q 4JPSA 1A3UA 3FKIG 2WQYB 3E9HA 3HKZE 4B95A 4C7YA 1EU3A 2HHHQ 4R9WA 2ES2A 2L15A 3M4OH 3SU8X 1BUIC 3L08A 4B3RQ 2Z6KC 4A3IH 1HZAA 4HJGE 5CHFA 3CMMB 5FKAC 2ATWA 2O5IC 4A76A 2DYMA 4BXXH 4HIDA 4LF4L 4DXFA 3K81C 1PXUA 3J80c 1TKYA 4LF6L 4G50A 2KDMA 5HHDG 4JI5Q 2MEKA 2X8XX 4MH8A 2LFNA 4K0KL 5IOIA 3ZIMA 5IA7A 3BG3A 4RGMA 2K5PA 3TREA 1F2ZA 2YTVA 3CCMA 1U4AA 3I2ZA 5C3EG 3AMZA 4PNYA 4YSXB 3PIP3 2B63H 2K5HA 2EKIA 1VQAA 2CH4W 1O7YA 4A9AA 2SEBD 4DHJB 2K01A 4FHJA 3OWEB 5CV7A 5IN7A 3V60A 3CCLA 5J3BA 4BKGA 2VH1A 4A3JH 4ZUIA 3V3XA 4JI2Q 2ZNVB 3C2PA 1SNMA 1OQQA 3Q3NC 2IL8A 2RBMA 4QJFA 3STBD 2KMCA 4QUCA 2PPHA 3L17A 3N1YC 1I5FA 3I91A 3K58A 1BF4A 2F3WA 3S15B 1D7QA 5FO9B 5EE0A 1XMOL 4FULA 4JI8Q 3CC4A 3L13A 3CU7A 5CHVC 1CHPD 3RZWC 4K3BA 5LXHA 1A62A 3H3VI 2UXBL 1SYBA 2EYMA 2CVRA 4A3BH 1J8IA 4LDTD 4NQKE 3VH4B 1E3PA 2B2YC 2VB2X 1HZBA 2RF4A 1DOKA 1LABA 1SJED 3AFQA 1Q1EA 2PVOD 4A3CH 4UP8A 4PZ8A 4B3TQ 2ICIA 3OIPA 1WYGA 4A93B 1YQBA 1I50B 2H88B 3QHTA 5D3IB 4C3IH 4PMBA 3SFEB 3FKIB 1YNTE 1E1TA 2G9HD 2K05A 2RVLA 4YHHQ 4HR7B 1Y1WG 2X6LA 3KUDB 2KZRA 4H13C 2KLCA 3GTPH 3U4VA 1DJRD 1RIPA 4EZJA 4C1NK 1BBWA 2BWFA 1CA5A 3S1RB 2ZTDA 5CGKA 3VYUA 1XEEA 1PFNA 1WR1A 2Y5BB 1ZOYB 3TEXA 2F4VQ 2HD3A 3AE1B 1HTQA 3H7PA 2EYOA 3M85A 5ELNA 2XTIA 3ZGZA 4DV2Q 3S2DH 1WZ3A 1GG3A 4ZQ3A 4A4IA 1QOAA 4XQJA 4DV3Q 1IYJB 3WAMA 4WWMA 4RAUC 1HE8A 2LXCA 5IGEA 1E2VA 2CKHB 1PH5A 5BR8Q 3T56B 2I5MX 4NKLA 3UI3A 4URKA 1SEBD 4X3SA 4K7WA 1RL2A 3G4SA 2GN5A 3AE2B 3HOUB 4L63B 4YTNB 3VTWA 1ZYRD 5CTRC 1LTTD 4KN4C 5A35A 5CBEE 5AZGA 1GO3E 1VQJA 1STAA 1GNUA 3RNCC 3CQZH 3K6OA 4HJ9A 3D32A 2KCTA 5CC4A 2WV6D 5BN5A 2E5LL 4JV5L 2DAFA 2AX5A 1I4QA 1S5BD 1YNNC 3VR8B 3MC8A 3ZRFA 4X57B 3RZDB 2VZKD 3FILB 5JZEB 3KJPA 4HCEA 3DBHB 4MJSB 2PZUA 3FDTA 1PRTD 2KK8A 2QGQA 3OYYA 5FLXc 4DAVA 1PH2A 1TWGB 2NZ1D 2KVRA 4ZRQA 2GBMA 3D4DA 3HEJA 3ZLZA 1IHZA 4WQMA 4A3LH 4KV6A 2EELA 1H95A 4E6IA 1STNA 4POFA 2C35B 3OTOQ 1U9RA 1FIQA 5M3FH 1G8ZD 2J4XA 2PI2E 4W9FA 4LAAA 1ICFB 1Y1WB 1QT9A 3J7A5 1ZPSA 2EXZA 2MBEA 1HH2P 4XYOA 2HIXA 4R4TA 4OIJA 4XT3B 3AQQA 3I56A 4HXDA 1HUMA 5JVG3 1TBEA 1U4RA 3QIAA 3UGBB 3PHWB 1ESFA 2LXJA 3ZJVA 5EDSA 2AUJD 2K5VA 2UUCL 1JMLA 3RNAC 4BZAA 3VTVA 1WJJA 1QF6A 3PO2H 1MIUA 2IPKD 3IFTA 1S3OA 4HJ8A 3LXFA 3R93A 2DX5B 1TS3A 1ML0D 2EPBA 1J6QA 2MQHA 2ZXPA 2LGYA 2SAKA 1YEZA 3V6CB 4F1SA 4C2MH 1VDVA 4CDCC 3ULPA 2AWTA 4CKEA 5I4DA 4EFOA 1BQQT 2JZZA 5D6JB 3FPUB 3KF8B 4A3FB 4HPMB 3VRBB 2QF7A 1IBMQ 2EY6A 1FL0A 5IGGA 3PUYA 3TUOA 4DAYA 3GTGH 1L5PA 3J81L 3HZXA 4W9KA 4JI3Q 4GOPA 4WAAA 4L8JA 5EBCA 1H8CA 4DKAC 2HDEA 4DFAA 5G5GA 4WIPA 3R3MA 1SYGA 5IO9A 4C1NI 1WE7A 3FMCA 2E2IH 3JAMi 1XJVA 4LW1A 4DV5L 4PS7A 3T13A 2R93G 4R8IA 2JZ3B 1KDAA 1X54A 2CJNA 1UBIA 1WCMH 3F2CA 1EIYB 1WJUA 2WKDA 4ODGA 1N6ZA 1ZEQX 1VQHA 3PMFA 3A9JA 4YSZB 2PZTA 1L1OB 4BOZB 1HZ6A 2WX1A 4K2KA 1QVFA 1LTGD 2X6GA 1QOFA 5IP4D 3SK6A 1IYVA 2B2UC 1VDZA 3P42A 2Z9HA 3S16B 5JJLA 1T0YA 2IX0A 1H9MA 2JWUA 1IXRA 2BKRB 3TBLD 4IURA 2L9HA 2L76A 5JVH3 1W6JA 2FAZA 1YJWA 5I9PA 4KTAA 4DV4Q 2OTJA 3J80E 4AIMA 4IUQA 2Q2UA 1R4PB 1I35A 1K8AC 2K1BA 4DV7L 2CQAA 1PFMA 1SIFA 4DN4M 1JWSD 1TU2B 2PO4A 3KJOA 3DWGC 3RI7C 4RKBA 5EAYA 2MHJA 5EBDA 3GE3C 5CX3A 4A6QA 4FDBA 4QL5A 1CT1D 3A9KB 1VQDA 1QNUA 2F0FA 2WAQE 3M9BA 4DV6L 2HTHA 4KGTA 3CD6A 3X0WA 2R2QA 1PH8A 3D0FA 1A70A 1PH4A 3OSOA 4CKCA 2R7ZG 3ZVVA 2KJ6A 1LTLA 2RSNA 2GBRA 1UH6A 3ITPA 3DM1A 1HR0L 1K28A 3I8ZA 1WTQA 1UUPA 5BN4A 4HWIB 1RTOA 1BR9A 1HZ5A 3VXWA 4MGIE 4RG1A 4HIMA 5TR5A 1FFUA 4H0LC 3PZDA 2K6DB 2F0PA 3PV0A 1EFWA 2PCFB 2R93B 1P7EA 1F2MA 2SOBA 2B2VC 3P63A 4OGQC 1V5OA 1I6HB 5JJIA 2I1JA 4GSWA 3MXNA 4P73A 2B2TA 2L5TA 2BYTA 4Q0FA 1YNND 2FXQA 2CHBD 2ZTEA 1RAXA 4KX6B 1VJKA 3EUB2 2L11A 2JXXA 2IWHA 2MJDA 4GLXA 1AYFA 2R2OA 4XWWA 2R61A 2IGHA 1CHQD 4WWPA 5IP9G 5G3LD 5CMDA 3S1QH 1IGDA 5C4HA 1V8CA 1HA6A 3GTOB 3H6NA 4IUNA 2RGFA 4LNFA 2JRIB 1TT2A 1IYUA 1S3SG 4B3MQ 1YMHE 3ETRA 2KO3A 5EE9A 2F3IA 1WGKA 4BKSD 5T1GA 2Y0SG 3T9LA 5AUIA 4BWGB 2BF8B 4QQBX 4BKTA 3QQ8B 3A55A 3G71A 3E0EA 3GTQB 4JOIC 1XO3A 2AWNA 4BBRH 3MA2B 3HGBA 3PZ8A 5L95C 1XWEA 5JOBA 1F9RA 4Y7NB 2N9LA 3A1QA 1CFMA 1AN8A 4LDTB 3PTFC 1B3AA 1SXTA 3TS0A 3KYHC 1FNVA 1P9DU 1V1QA 5IGCA 1KQSA 2O2VA 2WDRB 3U50C 2O6VA 2ICEC 4R4CA 1L0WA 2UXDQ 2H89B 4IO9A 2I38A 3A8IE 4BXXG 1ZUD2 1PTOC 2I5LX 2VB3X 1UNSA 1NCVA 4Q5VA 1OQYA 1RLFA 3CCRA 2VQEL 3HKZB 2AQ1B 1B50A 4KKJA 3T1YL 2ZVNA 1BUVT 2A1AA 4JBMA 3QX1A 4W9JA 3U7DA 3I63C 4D2KA 4QUFA 1NVID 1FGUA 3TP5A 2KQ4X 4N59A 1XQQA 3RPFC 5LL6X 3AMUA 4DUZL 4EZKA 5LMUL 2NZHA 2KJXA 5FLXE 1VZ7A 4GNXA 1C77A 2ZT9C 2A73B 5C3EH 2AHOB 1VQKA 3UINB 3IVFA 4NJ7A 5AJ3L 1SNDA 2IGDA 1WSPA 2C9WB 2IJ0A 2DAJA 4ANXA 1WXMA 1HZCA 1WOCA 1SFOH 3PO3H 2IDYA 1K3BC 1VQPA 1GUWA 4LNNA 1PTOH 2XN9C 3DWAA 2PVGC 4KSKC 5D7GA 1BO0A 2K33A 1BT0A 2DZJA 4MGKE 4TVAB 3C19A 3U9OA 3CXCA 3CCEA 3PRZA 2GA4B 3J7ZC 3HOYH 3ER0A 2KNBA 4A3GB 1JW9D 3EFXD 1EQVA 2PQAA 3TSSA 1UGMA 1YX6B 2JA9A 1FJGQ 5CV6A 2VQFL 3A5ZB 2Z6KA 2K7VA 3EBEA 3OW2A 1SSOA 2Y0SB 2JSVX 3RT3B 1UBQA 4UPAA 4BY1B 4A3DH 4P6VF 3D8GA 2N7DA 4HTHA 1R4NI 4G3XB 1T6BX 1BVSA 3BDOA 1SE3A 1EOVA 1SE2A 2YYZA 3QO2A 3W5OA 1M94A 1E8WA 2CJOA 2O2LD 3GZNI 1XTDA 4W9EA 3L54A 3IFWB 1JALA 3TP8A 3M4OB 1E8XA 4IWOA 4GB9A 4C80A 1PRTB 1A0IA 2OEOA 5C5LA 2N4FA 3WIMA 3TRZA 4A3IB 3B9JA 1M4VA 3J7AV 2WXMA 1KL9A 3WANA 5HY6A 4HIOA 3RCZA 4H02A 4NB3A 2NVXH 5A2QL 4ZK9B 4LJZC 1J9OA 5NUCA 3SDZA 3VR6A 4C3JH 1IBLL 2ZW0A 1WGGA 4FLHA 4S17A 3VR2A 2HDMA 3S1NH 1XPRA 1P1AA 1G91A 2WKCA 2DNCA 5JH5C 5M3MH 1EY4A 4B6WA 2A8VA 2WHIA 4QB4A 1DYQA 4MN3A 3PQIA 2WP9B 2B63B 4LJPB 3F1ZA 3QJZA 5KYIA 1V81A 3DQVA 1T9HA 1ACCA 1FGBD 1M90C 3KLSA 2M4NA 3TCAA 3TEYA 3X3NA 1RRBA 3ULJA 2B2YA 1F2RI 4B0EA 3KDFA 5FO8B 1SN8A 4A3JB 2KUMA 3WWVA 2GI9A 2EJGC 3K9OB 1LT3D 1XNQQ 3TZDA 3CF6E 1UE5A 2A68C 5LL6S 1ZKHA 5EGTA 2KFKB 4WURA 2F0NA 4W9LA 5E6PA 2EMSA 4CQNA 4C4VA 1B9MA 4C3HG 4ZHPA 2XRSD 1OEYA 4S3SA 1C76A 2REXA 1IUEA 4G11A 5K36G 1PA6A 3NTKA 4A3BB 2RSUA 3CPWA 1WD0A 1Y8PB 2LGDA 4MELA 2R7DA 2FIFA 3CWIA 3ML9A 1C7YA 3QC8B 4F7ZA 2JA6H 1Y8OB 5CORA 3TDQA 1NY4A 3DLLA 4GOPC 3N6RA 4JI1Q 4L5SA 1J8CA 2EJFC 3WDNA 2LY7A 1PZKD 2JK8A 3B6YA 3RR5A 2L0FA 3H1UA 1LXDA 3I72A 4C3IB 1NI2A 3NVZA 4KZ0A 4DR3Q 5T8IA 2VNUD 2BB5A 1ZE3D 5M3FG 3L7ZC 4MH0E 2MFIA 2KD0A 3HHMA 3A7AB 4A3MH 2NBWB 1RCVD 2ZM6Q 3GTPB 4OXPA 2LZ6A 1SBBB 2LWPA 3QCAA 5I6YA 4RGOS 5IYDG 3GE8C 1IL2A 1PZJD 1WVLA 3KDFB 1V49A 3PREA 2NVYB 1C4PA 2AKWB 5C5MA 4J6IA 2WDTB 3JSVB 5BYQA 3S2DB 1T0SC 1JRUA 4Z9CB 1DGSA 2RHSB 4LWCA 3DEOA 1ISNA 1C8CA 3GOEA 3IAYA 5IYBH 1JE4A 3IL8A 5JXVA 4I7AA 4K6DA 2BS2B 4KHPQ 3Q3OC 4JW0A 4K5WA 3R2TA 4GIVA 1CQVA 3NTHA 1HUNA 4EQ5A 1GPXA 5IOCA 1YHBA 3N1XC 2F0IA 2CWPA 1T5EA 2RHQB 3CQZB 2H5XA 4YCVA 4ZOHC 3W5UB 2BDOA 3I90A 1EFID 2DY7A 3AM9A 5IGDA 1SF0A 3A74A 4A90A 1SLJA 1FXIA 4X65Q 1JOQA 2KHSA 2Z6BA 2CU3A 1QE6A 2RCNA 1OTCA 2RR9A 2UXCL 1N36Q 3ZXVA 1Q10A 1V97A 1SYEA 1D1IA 3W3AA 4GDKA 5J2RA 2K1FA 3DXJC 4IWQA 5M5WH 1VQLA 2LHEA 1XYIA 3TN2A 3RN5A 2WXLA 1RJTA 3F2BA 1VQOA 2IO3B 1BDOA 1Z6HA 5IP7G 4FNFA 2NN6G 5GQOA 1FXAA 2FCMA 5BO4B 4DK5A 2WNMA 4XYCA 4EZLA 1IGCA 3K9PB 3Q6SA 1TIFA 3F2UA 1Y1VG 2D62A 3FP9A 2UUAQ 5M3FB 2C60A 2VZAA 4KDIC 4K8IA 1DGJA 2CHZA 3DDCB 1QB5D 3TL5A 2Z4HA 2DHZA 3PUVA 4RGNA 1QKZA 3PS6A 1TVXA 2NUCA 4G4KA 3A8KE 4R1JA 2XK5A 2BOSA 4ZKCB 3GD7A 5D2MB 1SNPA 3JAML 5BMIA 2PQEA 1CQFA 4ILWA 5EE3A 1X65A 3PO2B 4FXDA 2PE9A 3D4WA 2JP1A 4DF7A 3DBRB 1Z2MA 3BVMA 5LMNL 1XNRL 2D2QA 1SMXA 4PQXA 5C0XG 3ZJUA 3DBLB 4C2MB 3P75A 2QHOA 2ENBA 2QDFA 4IWPA 1CKNB 1KAWA 1DOYA 3L10B 2DWQA 5IWAQ 1JCKB 2ZCBA 4JYAQ 4ZRIA 3SR6A 5C23A 2F0EA 1L4ZB 1QJOA 3SGIA 3SD5A 1PH7A 3DBHI 1KABA 2R7ZH 3UDXA 3GTGB 1RFAA 1TZ1A 1ENCA 4HLEA 3AV8A 1ZXTA 4IPHA 2WAQB 3K5LA 1A3VA 3A8JE 2C5LC 2INPE 2EYJA 3HM6X 4LK1C 3ABVB 3A56A 3BYTB 1XLNA 3KF6A 5CR3A 2ZEQA 2F0TA 5IKCM 1EQTA 2B2UA 4GDLA 2KTRA 2E2IB 3BU2A 1J7AA 2N9PC 3QA8A 3CSFA 2RKSA 2A68D 1V8QA 4U68A 3GZNB 4RCOA 4OZBA 1D6EC 2D10A 4C00A 1LYLA 4DWFA 2YTXA 4GGQA 4O0AA 3SHLA 4IUTA 1XPOA 2BS4B 5EQ0A 2Q2HA 3LWEA 4AYBG 1Y56A 2WXPA 1EY0A 2A6ED 5IGBA 2MNAA 3A5UA 4ULLA 4RGTA 4OIKA 4LFBL 1OGWA 4MSMB 4RFBA 3HOWG 2YTYA 2WINB 4LFCQ 1WH3A 4CDDC 5GADC 4NXML 3KUCB 3BVZA 1K73C 4RM9A 1R9TH 3H94A 1VF7A 1P8LA 4TQUS 1YIWA 1YNJC 3TJPA 3A4SC 1QG7A 4J15A 5DLQE 2BA0A 4A3EG 4DR6L 2FNJB 3J81c 2PW9A 3P20A 4P72A 3RD4A 1PGBA 4L23A 3VYSA 4LNKA 4A8XC 1E22A 4KK7A 2EQSA 2M1MA 5J17A 3M63B 4BOSC 1ASZA 4AQYQ 4BVUC 1STYA 5L37A 5C3XA 1VQ5A 2JA8G 2OQ0A 4DV1Q 4BBRG 2LFIA 1D2BA 2LMCB 4GXBA 4WJ3M 2JA5H 4KY5A 3Q2AC 1J5EL 4PYUA 1SYFA 2M2LA 1TY0A 4J1MA 2WXJA 2EVBA 4GZYC 3NRZA 2JYOA 3MZ5A 1VQBA 2L32A 2DZMA 1YQ3B 4MM3B 2YEPB 2G3QB 2B2VA 3PSIA 4DV0L 3KW5B 1A15A 3Q0AA 2BBCA 2MO1A 5E7NA 4DR2L 1G2TA 1WI0A 4YWGG 3VHTC 1IBKL 4JC0A 1G6PA 4FVMA 4OONA 2A69C 3D4RA 4JI6Q 3I7FA 1P7FA 1H9RA 1BOSA 2K39A 3OIQA 1F1HA 3SHQA 4BY7G 2NVTH 1TZOA 1Z5SB 1GOZA 4TMAB 3TIXA 1GHKA 1GUOA 5COYA 5M5YH 1AARA 2MX2A 2PYKA 4JI8L 5BN3A 4ZRKA 1WR6E 1NYRA 1UE6A 2OJWA 3RNGC 3HOVG 1HPCA 2TMPA 2LRUA 4NXNQ 4M02A 2XGTA 1MHWC 2HDLA 1G51A 2HQLA 2V1CC 2NVUI 1IL8A 3NP8A 3Q8BA 4N6EB 1BCPD 2CW0C 2RDFA 3PO3G 1CKOA 3QB3A 4GN1A 4OVUA 4W9CA 3RNFC 1NTGA 3K5NA 3IBEA 4LFAL 3MTNB 4TQ0A 4US8A 1TYGB 4JOIA 4KKTA 2MBBB 2JX5A 3H91A 2Y0SE 3MWYW 3UDIA 4LF9Q 2R92H 3S1QB 3IXSA 4X64L 4C56C 1I4GA 3H6MA 4IJLA 3UE1A 4NAWB 2B3GA 3HOYG 1HNWL 3K57A 1T3QA 2CQOA 1YQ4B 3NVYA 4ZCKA 2MGSA 1RM6C 4IZ8A 4YSYB 5IYCH 4X62Q 2L4NA 2WDQB 1DCZA 1VQIA 3KBXA 4H2AA 4PS3A 5EPKA 2K28A 1V1PA 2WXRA 1E7VA 4IDIA 4A3DG 2FMCA 1VR9A 2QSDA 5IAAC 1O78A 4OL7A 4OVVA 4BBRB 4LF4Q 2MRPA 3MJWA 3MC0B 1ET6A 1HR0W 4GU2A 1JC7A 5EE1A 2QDLA 1YBYA 1YZ6A 4K0KQ 2NTTA 1YN3A 3TQYA 4UP7A 3L16A 1SAPA 3NHHA 3ZNID 3DUZA 2LGXA 5CHWA 4YT0B 1MJDA 2ZZPB 3R7RA 1Y14B 3B0AA 3VDZA 1U4LA 3WOEA 4X3KA 3HOXG 1ROEA 3CIRB 4J6HA 1EOTA 5HG2A 1FXTB 1WMHA 1EYCA 1U4MA 1GUAB 3Q8AA 1LT5D 3LX0A 1DOIA 2WLBA 3AECB 4X66L 3EQLC 4C3JG 1KRHA 5H92C 4JBJA 1I6VC 2K0PA 3ONSA 2N55A 1ILQA 2NVYH 2NMQA 3VAWA 5M3MG 1JICA 1GKHA 2B8GA 5M9OA 2EMTA 1XMOQ 4TKOB 1JWAD 5ELEA 1MVKA 1NEKB 5C3EB 1F2LA 4KGRA 1LTID 1E90A 5LHY1 1C78A 3FEWX 4L5TA 3A0JA 3Q22A 2UXBQ 3J81j 1E1OA 3Q8EA 1WFQA 3NK9A 2C7HA 1WXAA 1SFOB 3ND9A 1ONLA 2IX1A 1WM2A 1X32A 3PO3B 4UAIA 2J0KA 2E3TA 3AFPA 4P2CB 5D14A 1X9NA 1PTOB 2L0TA 1VZ8A 1Y8NB 3GS2A 2KA7A 4F7XA 1SNCA 3HKSA 3ZTCA 4KV2A 3CHBD 1M1KC 2O6VD 4X3UA 1NNXA 1Q12A 1WIAA 1K0SA 3HOYB 5FLMH 5JJZA 3UE0A 4C3HH 2JYEA 4ZYNA 4AUQC 4I6NB 2LGSA 4OO1G 5K36H 3FKYA 4NPNA 1FFVA 3PSEB 3OOCA 2JA6G 2D3AA 2HTME 3AE9B 4A3DB 1K9MC 4O2DA 1NBWA 2ALYB 4AJYB 5K5PA 4XGAB 4FP5D 1IKLA 3PGEA 2OTLA 2BH8A 4OWWB 4Y52H 3K0YA 1QLBB 4OZCA 1H9SA 3ZQ4A 2UUBL 3H7PB 3V6EB 4KJOA 3WOFA 3UQBA 4N58A 4WJOA 3RULA 3T1HL 5JPMC 2G4SA 4A3MG 2LI5A 1QOGA 2XNAC 1PH6A 1WZ0A 3PF5A 1IW7C 4BBSH 1G2SA 2VY3A 1SGHA 2JZPA 3I3TB 1FD6A 3DWPA 1YI2A 5JAVA 2KHJA 2NVXB 5IYDH 2KX0A 3I55A 4NQLB 2UWQA 4C3JB 5I9OA 1QCBD 4DBGA 4JI0L 3S1NB 5IT9c 3NTIA 2WWZA 4GKKQ 2C7NB 2W9NA 1SYCA 5M3MB 4FJVB 2M17A 2Z4IA 4M0WA 1KOTA 5C3JB 4FBJB 3L9AX 2EY1A 2E5LQ 4B3SL 3AI5A 3PLVA 1X3PA 4WJWA 4JV5Q 3ZNGC 2V4IB 5IYBG 2NWGA 4BS9A 2JXTA 3B08A 2I07B 2MP1A 1HJPA 1MHXA 4AH6A 1SRUA 1E7UA 3LGJA 5FJ8G 4IW0A 1K50A 2IGGA 5JHBA 4OHJA 4LF7L 4FJZA 3ICEA 1WE6A 4DK6C 3MTSA 1AWDA 3AH7A 5CV5A 5FO7B 1NR4A 3J81E 1VQ9A 3ML8A 1HNXL 1UEAB 2CW0D 1SMYC 1X3GA 3EFUA 4KKSA 2F0VA 2WB1G 3D3RA 1VQNA 3EJIA 2GLSA 1X55A 4DR7L 3WCQA 2JEAI 5C0XJ 2JA6B 2K75A 2WGSA 4DV4L 4KY7A 1HCZA 3I4LA 1J7CA 5HKHA 4V190 3G48A 4EGVA 4HCNB 4F88A 1LUZA 1D1KA 1TWHH 4GN3B 3OMGA 5IP7H 1FNWA 2NN6H 3SK5A 5JEAH 5KHQA 3BDCA 1ZKOA 2BE5C 2HCIA 1SNQA 1C9OA 2K6AA 5DAUA 2K9XA 2MBOA 1CK1A 1Y1VH 4A3MB 2LD9A 2F4IA 4HJAA 3UDGA 1G6ZA 5CV9A 1Q1OA 1F0ZA 1B9RA 3F8TA 3CC7A 4HDOA 4ACFA 1B70B 3A7LA 1E6EB 3OJ4B 3H15A 3RZOH 4ICUA 3W1SA 4FA6A 4G57A 1HTPA 2F52A 3E5SA 3AE5B 3PVLA 4DAYB 1D5ZC 4HROA 2BA1A 3KFUA 5AZHA 1E5WA 2LXKA 2WFWA 3QOLA 4GOPB 4DR4L 2Q5WD 4G0NB 5T1IA 4AWJA 1SDFA 5J22A 1C48A 4K14A 2L7RA 4FXGC 2G5DA 2OCEA 5C0XH 1C4QA 2EY2A 4CYEA 1UWMA 1AE3A 3I70A 1ASYA 4DV5Q 3SR1A 1VZ6A 3P4PB 4AS1A 1PGAA 5DNFA 3OW7A 1K3RA 1PUTA 3PUWA 1RHPA 5C4XH 4KHZA 2JXMB 3QWNA 3U58A 1WTVA 2MJEA 1VRAB 4YTMB 2MO0A 2KAJA 2K04A 5I2XA 1O7LA 2IY0B 2XIWA 4JK1C 2XRQD 3HOZG 2KWDA 1KNEA 4UDUC 1Q82C 2NR2A 3AEFB 3A9JB 5GXGB 2H1EA 2LASA 2LVQA 2B29A 2DYBA 2K52A 3KBGA 2HJ1A 1E8YA 1OXVA 4APVA 2WXGA 2D07B 2PIAA 2CHWA 2PMVA 2JRHA 2WB1B 1Y8RC 2D2CC 1RF2D 3HS0C 4QF4A 4RF1A 3NBHA 1WTXA 3AU7A 2E2JH 4KD4A 4ABNA 1C79A 4DXAB 5LXIB 1TY2A 1PRTF 5D65A 1WGYA 1KTKA 2M0XA 3PGZA 3P4SB 4OZAA 2KYWA 4FF1A 3ZDTA 1S4ZA 5M5WB 2BS3B 5DPWA 2F0WA 1TS2A 2R6GA 5M5XH 1RWSA 4DV7Q 3S2HH 3URYA 2HT1A 2J0MA 2HIVA 2RA4A 1V80A 3DVGY 1IBXA 4EKUA 3ND8A 2UYZB 2ZNVC 2LVPA 1KRSA 4OELB 4MDKE 3K7AH 4LNQA 3HOWH 2ON8A 3RLFA 2GVAA 4DV6Q 1TTNA 2M19A 4OX9Q 1MG4A 1TKEA 3GP7A 1PVOA 3WALA 2FCNA 4R4OA 2YV5A 2D3CA 4DUYL 3T51B 1AW7A 1BCPB 4A3EH 4TQ1A 1Q1BA 3RNBC 4K8JA 4GLVB 2GBJA 3QK0A 2IO1B 4L5QA 2E76C 1YOVB 2WXIA 3AE7B 3UIPB 1HR0Q 3D6WA 1B53A 1JWUD 2QKIC 1MJEA 4MEMA 1IW7D 1CTMA 4IFDH 2GOWA 2W3SA 1GB4A 2JA5G 4L6TB 2JA8H 2OEDA 1EUJA 3AB5A 2IY1B 1PV4A 2LRWA 3V05A 3CCJA 4JI4L 3LNNA 3NZ3A 5DM63 2I5HA 2IY5B 1YX5B 4IQZA 1LT4D 2PMZB 3DEPA 4LMQD 4WORA 2FUG1 2KXJA 2R7ZB 1VD2A 2AQ2B 2HUGA 5HI1A 1C1YB 3Q8FA 4JLCA 1PDQA 4XXEA 2HCCA 2NVQH 1TGZB 1QWYA 2AWOA 2QA4A 1PHJA 1MI0A 2DENB 2NS5A 2JSOA 2A19A 2Q2TA 2R3ZA 4KI0A 3MXNB 4AJWA 2BW2A 3MAQA 1SE9A 2L8JA 1CSQA 3H09A 1B44D 2M0AA 4HK2A 3NXWA 4QAYA 2KC1A 4MSQB 2Z0SA 4AYBE 4WWOA 4LCDE 2D3BA 1P3QU 4OWTB 3GTJH 4LNIA 4MNOA 2EYPA 5CV4A 3TMEA 4BY7H 2KLGA 2D0OA 3RN2A 1WY8A 2NZOA 2MJ3A 4DU9A 3JAMc 2BCOA 4PMWA 1GC7A 4HCPB 2FE8A 3DM3A 4PMCA 3HOVH 5KEEA 2KEDA 5EKIA 2KTFA 1F9QA 4YCWA 1N32L 3BDLA 2C7MB 2K6QA 2RMMA 3DBRI 2DY8A 2I1KA 4DR1L 2CR5A 4LK0M 2Z8LA 3AN1A 2KCCA 2ASQA 2WACA 4W9HA 3DBLI 2KACA 1ZXHA 3T53B 2R92G 2MJ8A 1KC8C 1STEA 1R9TB 1N5XA 4YY3L 1N33L 3I4MG 3NVVA 1XLPA 2WYQA 1A6XA 3AEGB 3C8YA 1EEID 5L83A 5LMNW 3A1QB 2G1EA 1II3A 3FHWA 1CMXB 1XMQL 4CO7A 1E2ZA 2Y5CA 2G4DB 4P71A 5IYCG 1JR0D 5IT9E 2BE5D 2OQKA 3MHZA 1TWFH 3VQIA 2O2VB 4HJKA 4HKQA 4IPDA 2LJ5A 2O6VB 1PGXA 3MXUA 2ZPYA 3BYYB 1WX7A 2JA5B 3TS2A 2I2YA 1X3FA 2NTSA 2VQEQ 1J7BA 1ZP0B 1TIID 4N8FA 4YWKA 1R4MB 2L0CA 1V5TA 3RD2A 3WA0A 2R7FA 5GAEC 1PFSA 1WYDA 3C1FA 4IJHA 4MZ9A 3R8BA 2MW5A 3DMUA 3IAS1 4NPSA 5C44G 3PO0A 3RLNA 4DUZQ 5LMUQ 3J7YW 2PNRC 1HNZQ 3GB1A 2JYTA 4L2YA 1IPGA 2JE6I 2E2DC 4GNXB 3MVVA 3HRDD 3PHXB 1MSHA 3CRLC 4KVGB 3C1EA 3U4EG 3I4OA 5AJ3Q 3HOXH 2OWOA 1VQGA 2NN6I 3VA7A 1N34L 2N7EA 3J9CA 3I3CA 5D3DA 3P2BA 4IM3A 2GRIA 2QDBA 2PLPA 4I6LB 1PH1A 1XNQL 2BGFA 2WXNA 2K25A 1WTWA 2A4ZA 1VQ4A 1D5XC 5A2QE 2NVTB 3DOWA 5G5HA 4WJPA 3G7LA 4XQQA 4A75A 5M5YB 3UQAA 2BYFA 1QNKA 1EWCA 1B2TA 1F2YA 1I4PA 1G6JA 1MG8A 1XD3B 1WTHA 3NQIA 1MFWA 1B7YB 1CSPA 2PQAB 2VQFQ 1Q81C 2FMMA 5F2DA 2E2HH 2D3GA 2MWSB 3A33B 4RA8A 2AEHA 3M7NA 1J19A 2D0PA 2L83A 2NPTA 5KIXA 4MHEA 3A54A 1NE3A 2XBBC 4RCNA 3MP9A 5C0XI 4BA2I 4NY0A 2UU9L 2R92B 5G3LF 4RHRA 5C2TB 3HK0A 5HFYA 3W2DA 5FLMG 2MP2A 1NYQA 4EVOA 4HCSA 4O1NA 1ESRA 1TWCH 5DPSA 4XTCS 3BINA 1JQ4A 4OO1H 2D5GA 1S5ED 1QZHA 2FBWB 1UAPA 2DJGC 2RPQA 2KQ3A 4S0RA 3AEVA 3ZRCA 1MPEA 3C46A 1Q8KA 2WXKA 1WWTA 4P1CC 1VQ6A 1IBLQ 2IO2B 4IM0A 1YJ9A 1T5XD 4LF5L 4ZUJA 1UD7A 3NOBA 3RNUA 2A74C 2BTEA 1WM3A 1I94Q 4ZAIA 1P98A 1VLBA 2EE1A 1PYSB 3CC2A 2YLMA 4JPBW 3UIOB 1RFKA 4RH6A 4BBSG 1UGJA 5J1ZA 1P16A 2ZTCA 4M8AA 1Q3LA 4YXDB 1K8OA 1OXTA 1J0GA 4K6LA 2IYDB 1BBUA 4QY7A 4FYDA 3I9V1 4HVBA 3RFZB 3DHHC 3FPPA 3HG9A 3J7AF 5CYUA 1AFPA 3NHEB 1YHAA 4XX5A 2X69A 1RDPD 4UY8C 4BAXA 4QGUA 3NS8A 2ZJQA 2VW9A 1LT6D 1JMCA 3NG0A 5G2NA 1C9FA 1NAPA 3B1LX 5E6NA 2GVBA 1PTOD 4C4VB 2MPMA 4KLKA 5FR6A 1IP9A 2F0DA 4XQNA 4X65L 3CF5A 2MBHA 3TEHB 1QZGA 1Z9FA 3JYUA 4GN5A 1T0QC 3CCQA 3H3VC 3W1SC 4YWMA 2KDEB 2JEBI 3NSWA 5FJ8H 2ID0A 3H9DA 1E10A 4JGHB 4AOFA 3U4ZA 3VRAB 3S14H 4WWNA 4B9XA 4DNRB 1EQRA 2VXWA 2K4KA 4C3HB 2DUDA 2DLBA 2LHDA 2B76B 3CCUA 4HIKA 2QILA 3S1MH 2V3PA 2MCNB 2O4XA 5AFWA 2AL6A 2HJ8A 5GAHC 2MBQA 3CCSA 2YEPF 3W1BA 3TP7A 4JI7L 4ZRPA 3VUWA 5I2YA 2INNE 1CKMA 4ANWA 2BT6A 4P16A 3H3VH 1ILPA 1EY5A 4V0BA 1MSGA 5J39A 3NZUA 3PLUA 1ET9A 5JEAG 4DHZB 3J80i 2OT2A 4P1BC 5BYSA 4ZYSA 3ZDMC 5KYLA 1DOMA 4BBSB 2KOLA 1HFGA 3VDYA 3AE3B 5EKLA 4CHKA 1SR3A 3HP3A 3CSTA 2V9HA 1WTRA 2UU7A 1TKGA 1KXLA 3NWTA 3C3LA 3DVNV 5D94A 1F9JA 3EA6A 5C4JH 2JPHA 2CHXA 3R66C 2IX3A 4CHTB 3JAME 5BMGA 4MACA 4IUVA 4LF8L 4XC2A 3M3YB 2MLBA 1YHQA 3ENEA 1A8VA 1UWVA 2KKCA 3V96A 3GTMH 4ID6A 3VYTA 1F9SA 4IPGA 4BBNF 1OFFA 4ME3A 2UXCQ 4DXGA 2QCZA 3MXGA 2JA7H 5C4XG 4DQOC 3KWLA 4IUMB 5H8YE 3WAOA 2ACZB 1DZ1A 2KBNA 4GDKB 4OEMB 3TMPB 2WB1E 4DR5L 2NBVB 2KC2A 3HOZH 1K53A 4OW0A 2KECA 3BVGA 1F77A 4TSSA 2B3AA 3AE8B 4P7IA 1R4QB 3K59A 2NBUA 2AMCB 1E0ZA 3SVMA 3VYRA 2INDC 4MTKA 1L2NA 1WGDA 1KFYB 3Q69A 4DNTB 3PRMB 4PYZA 1QQRA 2F0HA 1QUQA 4HN7A 2XK5B 3ALBA 4ARIA 1K51A 4A3PA 3DVNU 1TWHB 1Q5WB 3RNEC 2D9UA 3Q24A 4GKJL 2BYEA 5LMNQ 1S5FD 1XNRQ 2Z1CA 2KWVB 3Q3FA 1LM0A 1JROA 2N7JA 2B2WC 1Y1VB 5H1SE 1H9KA 1A5RA 3PF4A 2OOBB 4N9F4 1W6KA 4CDEC 1DD2A 4B0MA 3PV1A 1NMGA 3M4YA 1CA6A 3AE4B 4IKGA 1VMCA 1N60A 4JX1C 3OHXC 1K8GA 2HHHL 4FF3A 3RZOB 1JWBD 3SE0A 5J18A 1YJ1A 3QAQA 5DPRA 3Q3JA 4HPPA 4B3RL 1I42A 2N8NA 5FOBB 2O5JC 2PMZE 1L0XB 1TS4A 4LUVA 4IFDG 3B2FA 1L2FA 1QVCA 2QEXA 3BZKA 4KIKA 1KLUD 1N9WA 2KDFB 1EYGA 3W1YA 1HQMC 2V1YA 1PTOF 2E8GA 1FEHA 2PEAA 3KF6B 3NPPA 2PE6B 4EUTA 4JI5L 2K5WA 1RTNA 1LFDA 4HPLB 4CBVA 2KTRB 2LUMA 4OO1I 4GDLB 4IOIE 2L05A 4MT5A 4PS8A 3VR5A 3KVFB 3P1MA 1PRTC 4CJ2C 5ELOA 1DOLA 1MBYA 2C5CA 5C4XB 4G7OC 2WXQA 1QZEA 4WJNA 4N9TA 4C7ZA 2X38A 4FJYA 3L0OA 4NXNL 1GC6A 3JVZX 3ZUNA 2K5DA 3IFDA 2E74C 1D4BA 2QEJC 2PPBC 1RKNA 2VUMH 1OXXK 1T0RC 4LFBQ 1X3EA 4JI2L 1A2UA 2N88A 4NXMQ 1OQRA 1PQSA 4DA2A 4B9KA 3H0GH 1HXYD 2XEWA 2KN5A 1X6OA 2PW7A 2E2JB 3RLOA 4NNJB 2W82A 4GLSC 2JT4B 3GTKH 4G7HC 1FD7D 4L5RC 2KCNA 5M5XB 4FADA 3S2HB 4X62L 2KOXA 2Z0DB 2IT1A 2CU1A 4II3B 4AYBB 1JT8A 2KWUB 3H8HA 2KCMA 4U673 5E3FA 4HSPA 3K7AB 2DBYA 3HOWB 4FN2A 4RHSA 5C3WA 2INCC 1JB7A 4B3TL 4KIKB 1E0BA 1K0RA 4TRDA 1V9PA 1NDDA 1EQQA 3CCVA 3KUZA 1J5EQ 1I4HA 4HMJA 1MD2D 2VH2A 1BNZA 3I4MH 2YVCA 3EROA 1XPUA 4A3EB 5BMHA 4XDCA 4JIOU 2NB0A 3E56A 4WQOB 1AZQA 4HMIA 2Y5PA 4YHHL 4DV0Q 1D3ZA 2MUYA 1MKHA 1KLGD 4JVZA 4DR2Q 2WP8J 2PNHA 3AEAB 4CDFC 3ONAB 1IBKQ 1LQBA 1OEYJ 3HOUG 1V2YA 2JA8B 3X3MA 4DK0A 2K22A 3AULA 2F4VL 3DHQA 1KJTA 3CRKC 4LF6Q 1N63A 1TWAH 4L1BA 3G6EA 1WGRA 2WDVB 4DV2L 2GBKA 4A3KH 2QCPX 4DV3L 5C44H 2DZIA 2AYOB 4KY6A 2G45B 2NVQB 2RD0A 5BR8L 4DK1A 4J8QA 2ZJDA 3RZFA 3EGRA 1TXYA 4P75A 2E6XA 3Q6BA 4FF4A 1I3QH 4IPCA 1UZXB 1V6EA 3EFCA 3EHVA 1STGA 2ASBA 4LFAQ 1YVCA 1EUVB 2WX0A 1WX9A 4EOYA 2JY6A 1FPYA 2LJIA 1H9JA 2IHEA 3GTJB 1B9NA 1EWIA 3CKIB 3TP6A 4BY7B 1UELA 4X64Q 1LTAD 3AU4A 3TBIB 3PRPB 1HNWQ 4POGA 4FXKC 1KAAA 5E4WC 3HOVB 5HGTA 4UHVA 5ISRA 2N9KA 2WU2B 3FILA 5BYRA 1DONA 1WRDB 1GUSA 1I4XA 3NUCA 3OWFA 1KH0A 2EXDA 2IZVB 2L52A 4LJOB 4MJSA 3ZJTA 1EIFA 5I6WA 4LUOA 3VR9B 1L4DB 2HE7A 1V1PB 2YU9H 4F8MA 3M95A 1PH3A 2K8BA 1ICWA 3M62B 1VQMA 2JVCA 2AQ3B 3BIID 4A55A 3CAMA 2KX3A 3N20C 1JE5A 5ELFA 4XE0A 4KZCA 1XF5L 1B3QA 3W9CB 3MFYA 2HD5B 1EL0A 2J42A 3OTOL 2A5UA 2N9EB 5ELDA 1H4RA 3OJ3A 5G55A 1TWFB 1WXSA 2JWZA 2KJHB 2P5ZX 3KLWA 1CJEA 2KDIA 4A3FG 2RCFA 2K14A 3Q23A 1ZDXA 3P4QB 1YNJD 1NUCA 2ZCCA 2F0UA 2LSSA 1WMHB 2OHFA 4X66Q 3BWUD 1L0VB 1EY9A 2EJMA 3RUZA 4KJNA 1K8RB 4HKZE 4TV3A 4K81A 3VFKA 4K7SA 2OJRA 2EYFA 2J7ZA 4IUUA 4GKKL 1L7YA 1TJEA 3DVGX 3NZSA 4KDLB 4LTUA 2F3VA 4LUZA 1LTSD 2W3RA 3DHGC 1WGHA 5KHOA 4EQOA 3T3OA 4M1UB 4IG7B 3MHBA 1VQFA 3W5VB 3KF8A 4X3TA 3DPDA 3HOXB 3R2IA 4FO2A 1F52A 3EECA 4GMVA 2N3SA 1IBML 4JE3B 3BS1A 2KDBA 1KD1C 5C1ZA 1NSNS 2D11A 1S5DD 3E3XA 4JI3L 4ZLTF 5HGQA 3ZXRA 4IC7B 1HA5A 4PK1A 3ZNZB 1WTPA 1JB3A 1N5WA 3N1ZC 5GMVA 3N32A 3M3YH 4GLAC 1BMLC 1VF5C 2A69D 1VMPA 1EYDA 4K5VA 4MIUA 4BA1I 3HVZA 3SK4A 1GM5A 1K83H 5JEAJ 1L6VA 5IE8A 1YN4A 4RKLA 1UF0A 2V0GA 2E2HB 1PMRA 1BCPF 5KRUA 1OXUA 2NYZD 1EWHA 3T16A 1XLQA 1GJZA 4GS3A 1VQCA 3W1GA 3IT6B 4REZA 3GV3A 3ULLA 2MQJA 1L1OA 1JOOA 3EIVA 1R4MI 1LTRD 1R7SA 1XT9B 1ZDVA 1ZXIA 1SJHD 3FRPB 1YJJA 4KGSA 2UUBQ 3ZKJC 4A3OA 3NS1A 2ZXOA 1H9SB 4ANVA 2KVZA 1KNAA 3QOJA 1A3TA 5C6AA 3T1HQ 3PUXA 3R3OA 1TWCB 1YJNA 3SEBA 1S40A 4DHZE 1EY6A 1AH9A 2VS1A 2LEKA 4ZDVA 2FFKB 5GROA 1SIJA 4FF2A 4WJQA 4RF0A 4OVZA 1C3TA 2F0OA 3U9SA 3RUIB 1EEFD 3OPOA 3NY5A 3S17H 1EF5A 2L12A 2UUCQ 4JI0Q 1HFNA 2I46A 2L1AA 1AP0A 3NJTA 4X6AH 3A9KA 2IHFA 3QJYA 2BVCA 1G291 4RMAA 2K3UA 2KN4A 2LGIA 1YN5A 4M0WB 4QMGA 4B3SQ 3PIOA 2J53A 1F9PA 2AUKA 4RWSC 1IYFA 4XIGS 2N1WA 4A20A 1PH9A 3VR3A 2ONQA 4FHKA 3NEMA 1GUGA 4HJ7A 2F0SA 3DWQA 4P74A 4IM2A 3RMHA 4ITKA 3I4NH 2Q8TA 1F2RC 2K32A 4LF7Q 3H7SA 4TUUA 2MHVA 3QWZB 1HZ9A 2F0KA 3EVQA 2XSCA 1IZ6A 1HNXQ 1MJCA 2VRRB 2JU6X 4EEWA 4NJCA 1ENAA 1V1OA 3GTLH 1SB3C 1ZW7A 3ECIA 1OXSC 1TT5B 2PKOA 1A2TA 3J80L 3E9SA 1NR2A 2JA7G 4JL9A 4RMFA 4DR7Q 3M3JA 4NJ6A 4H7BA 1M8AA 5CBAE 2CFMA 1HEZE 5EPLA 3APFA 4W9IA 2KJRA 2RQXA 3LWUA 4KKUA 5C4ZA 2EKEC 3QIJA 4H44C 1LACA 2JN4A 3S14B 2RPVA 4AP4C 1GXDC 2BWES 2PJHA 4K1RB 1E2WA 3MEHA 2EY5A 1FYCA 2XWBB 2B8FA 3Q8DA 3S1MB 2Z0EB 2K50A 3AEBB 1CZGA 1XXGA 1CZPA 4IFDJ 1YD8U 4OX9L 3AEEB 3DBSA 1PDXA 2N0SB 1WJNA 1PFDA 3GQBA 3NELA 2JUOA 3FAHA 3DCGA 1JJCB 3U8ZA 4DNIA 4B3ML 4IOCA 1WXVA 4WJ4A 4DAMA 2C9OA 3APCA 4ARCA 1FCCC 4DR4Q 5IODA 4B08A 4CGYB 1EZ6A 2IO0B 2RDGA 4DGZA 2WXOA 5DPTA 5E4XA 3MJ5A 3K5OA 3G6JB 3HRZC 4NDXA 3HKZG 3U52E 4PZ6A 3VA5A 2N1VA 4HRSA 1KLVA 2B39A 3N3KB 3GO5A 2KHIA 3IT4B 4ME5A 4BBNC 2FJ2A 2W55A 3I57A 4NZLB 2KEEA 2PZWA 2PTLA 4US9A 1EU4A 3SXHA 3WAPA 2FHTA 5C4JB 3T4AC 4HEA1 1E7PB 2J52A 2F0JA 2UXDL 4XDXA 1RD9D 4QIWE 2TSSA 3P7JA 3CPFA 2BB6A 1SSNA 2LUEA 1WFYA 3GTMB 2BPSA 3T3NA 3D6CA 1Q46A 3UI2A 1EIGA 1VQ7A 1TKWB 1EY8A 1VCBA 3S15H 2LS01 2JA7B 1E7ZA 3NBHB 2WU5B 3X23A 1S5CD 4PZ7A 4A3GG 4YL8A 5DM73 1CI3M 1P0RA 1DOXA 4YWLA 4OWXB 3PZ7A 2JJQA 2VUMG 3O13A 3HOZB 1WXQA 1B4OA 2KVMA 5LLIA 5KNDA 3CMEA 4UP9A 1EIHA 2Y3AA 2J0TD 4BY1G 1IBXB 3Q14C 2A5HA 2I0QA 3GDEA 3OG5A 1CZWA 2B2WA 3H0GG 2RSOA 4DAPA 3N52A 3V2TA 4DK3C 1NENB 1N8RC 2LVOA 1PYWD 5CV8A 4A93H 3E0JA 1I50H 4PV1C 2K5QA 1EY7A 4DUYQ 1GVPA 3FKIH 4JBWA 3PIO3 2K8CA 1SMYD 2D5DA 4A3IG 1OTRB 1FJGL 3BY4B 1YNXA 1QOBA 4ASWC 3ZNHB 2EYHA 2Q8IB 2F1MA 3TZUA 3S1RH 4ZKBB 1Q8IA 5IIFA 1GHJA 2EZVA 2FIDA 1XLOA 2RDHA 4JI4Q 3V61A 3HM3A 3I73A 3KH0A 1YJIA 5EJWA 2FINB 5FLXL 1EO6A 1LV9A 1JOKA 1LGRA 2VL6A 1JWMD 2B63G 1FNUA 2LXAA 1HNZL 4JBKA 3KK7A 4HDQA 2K5NA 3GV6A 1BXTA 4G7ZC 1UWXA 1FCLA 3LDZE 3PUZA 4WFN3 3VR4A 4A3JG 5MPOA 1FRRA 1S72A 1U0LA 2A6HC 5JHAA 5FR3A 3HOUH 1KRTA 2BH2A 4HAEA 3T1YQ 2BKFA 5IY0A 3AXCA 1AE2A 2H4OA 3JC66 4A3KG 2F0QA 4NMZA 2G9DA 3MFGA 3N30A 4IOAA 5IT9L 1PLFA 2GB1A 4I6PA 4WH4A 4R3DA 4KD3A 3IRBA 4O42A 1KF6B 4R8NA 1N61A 2WXHA 2OF1A 4M01A 3K5MA 1UE7A 4A3BG 1JRPA 4USAA 2IBIB 1JQYD 3T8MA 1N32Q 2XWJB 3RZDH 2VUMB 1N62A 4ZHOA 4AQ7A 2KHWB 2DNEA 3F2DA 5JJKA 2KMMA 5E6JA 4A3CG 4DR1Q 3BJUA 4JQWC 2IW3A 1BKBA 1EYAA 2QJLA 1VS0A 2FCSA 1WI5A 1FO4A 3NQTA 3H0GB 1TWGH 4YTPB 1I4RA 3NWSA 4YY3Q 5IGFA 2Q2IA 1N33Q 2KFKA 2SDFA 2CKZB 2M8SA 3SK8A 2VZKB 1VQ8A 1WYWB 4C3IG 4Q2JA 3GTKB 1XMQQ 2M9VA 3TEZA 3HFZB 2OXPA 4LNOA 3AEDB 5AUKA 1Y1WH 1NMFA 2HQEA 2N49A 5AEKB 3U7ZA 2KQSA 2QC8A 3RN9C 1KHIA 1IKMA 1FMAD 2K03A 4W9DA 4E71A 4JI1L 3QARA 4DHJD 3OMCA 3OAWA 2Z59B 3I4MB 1E8ZA 2GMIC 1KIXA 1I94L 1TQOA 3OLMD 3NE5B 4DR3L 2WIIB 4EQPA 1K52A 1B8AA 1UEBA 4GN4B 3RYTA 1VCIA 3QG1A 1Q86C 2F03A 4DDID 2KMAA 5E6OA 1SYDA 2ZM6L 3TEWA 3CP0A 3ERSX 1YIJA 3JW0X 4MTNA 1SE8A 3MXPA 4A3FH 1C4CA 1AEXA 1U4PA 1N34Q 1S1QB 1O80A 2V4LA 2GBNA 3O65B 1EM7A 2DJFC 1L1OC 4EE2A 3JSVA 2PI2A 4M8MA 1TWAB 1XCTL 4MGYE 3S24A 4JWUC 1QVGA 1PYBA 3L0WB 4A3KB 5C44B 2MH7A 3BK2A 3FVQA 3UDFA 4N9PA 3VTUA 1V43A 1XX8A 3CMAA 4XDDA 1Q90A 1KDBA 2A6EC 1EF1A 1B1ZA 4HEDA 3U2SC 3B2GA 3IHPC 1I3QB 3Q3MC 4KHPL 2DGYA 1WX8A 2SNMA 3BZCA 2NPTB 3M4QA 2N78A 2ZXRA 4I7ZC 4RNAA 2UU9Q 3CW2C 2FUHB 2EYLA 4A3LG 3EC8A 2JQOA 3C0RB 4WAFA 1PFBA 2KWCA 4PG3A 2MP2B 2MSED 1GUTA 1RODA 3J81i 3S16H 2AL3A 3ZTDA 4NP5A 1WD1A 4IFDI 1N36L 3LYYA 4TKNA 3AYHB 4QCLA 2PW5A 3P1HA 2YU9B 3I5JC 3P4RB 2CWAA 1K8MA 1DM0B 1TR5A 3N9YC 1TS5A 2MA9B 4FXCA 4LF5Q 3PO2G 3LJ3A 4KN7C 3K0XA 1EWYC 3NENA 1AZPA 1Q0WB 2M56B 2UUAL 2FCQA 1BBXC 3KOJA 1FM0D 3QR8A 2QW7A 2JQRB 4CKBA 2V3SA 1QOHA 1GD7A 5GAGC 4JWSC 1D8LA 3S2AA 1GJXA 2DNFA 1MGSA 2WAQG 4YCUA 3E6ZX 1JORA 1JJGA 1UE1A 2NBFA 2KANA 2KQ7A 4K3CA 2JF5A 5LNK1 4NW2A 2CH4A 3DHIC 4EX5A 3SFDB 1CKNA 4XWTA 2A6HD 2L55A 1W3SA 3L2PA 4BKSA 5ELCA 1HTLD 1LLRD 4N8X1 3HIZA 3EN2A 1BCPC 4YIJA 5IWAL 1WCMG 4JYAL 2R93H 4ZRJA 2L3ZA 5KNBA 4WRDA 3HUIA 1EZ8A 4IUPA 3MHSD 2F0GA 3I4NG 2DYOA 2DN8A 3Q8CA 3STBC 1Z7TA 1FRDA 3IG3A 5KGUA 3M4PA 1I6HH 4J3OD 3E9IA 3ZJYC 4RM8A 4XT1B 1X1MA 1NJIC 3AB9A 1RYJA 1XCQL 3ZYYX 1SROA
chains in the Genus database with same CATH topology
1HRJA 1K83B 5KNCA 1E9MA 3FC4A 3S9WA 1Z47A 1L6UA 1KDCA 3KUPA 3LB8C 3BZDB 1WRIA 3M7GA 4K5XA 2B2TC 2EOTA 5DEHA 4F87A 3KWVA 2W54A 1C4AA 5EKKA 1SE4A 1GAQB 4EQNA 1DXMA 3L3OC 1MI2A 3IKJA 2F0MA 1LO5D 1D5MC 1L0YB 5TSSA 1XTCD 1CM9A 3NUHB 3HVDA 2QMTA 2M00A 1STBA 2LKVA 3S17B 4PT5A 2V3NA 3KLRA 3DWMA 4CJ1B 2Q8RE 3KLSX 2LMCA 2E75C 5FK9C 2ZW1A 5EPJA 2L1BA 1X3QA 2EDGA 4ZRZA 3NVWA 2XVSA 4K2LA 1OO9B 1NI3A 1WCMB 1ZYRC 3NBIA 1WTOA 3I4NB 2WXFA 1FR3A 2QIEB 4KHVA 4B9WA 1HQRD 4CJ0B 1QILA 3KQ4A 1MHHE 5E1FA 2WS3B 4IALA 2F0LA 5ELBA 3GTLB 1PZID 1GUNA 1ENFA 3ERQA 3AE6B 1I7HA 4NAMA 1SNOA 1HHVA 4HSVA 4KKIA 5JPNC 4QIWB 4LLGM 3BK1A 4KMUC 3IAM1 1LTBD 3L4PA 1Y69U 3D31A 1O7ZA 4I65A 2SNSA 4IN3A 2BDNA 1GB1A 2V4DA 4XYQA 1STHA 5HURA 4JPSA 4C7YA 1A3UA 2WQYB 1EU3A 4R9WA 1BUIC 4HJGE 5FKAC 2O5IC 2DYMA 4DXFA 1PXUA 1TKYA 2KDMA 5HHDG 2MEKA 4MH8A 2LFNA 3BG3A 4RGMA 2K5PA 1F2ZA 3AMZA 4PNYA 4YSXB 3PIP3 2EKIA 1O7YA 4A9AA 2SEBD 2K01A 3OWEB 5CV7A 4ZUIA 3V3XA 3C2PA 1SNMA 1OQQA 2IL8A 2RBMA 4QUCA 3I91A 3K58A 1BF4A 2F3WA 3S15B 5FO9B 5EE0A 3CU7A 1CHPD 1SYBA 2EYMA 2CVRA 1J8IA 2B2YC 2VB2X 1DOKA 1LABA 1SJED 1Q1EA 2PVOD 2ICIA 3OIPA 1WYGA 4A93B 1I50B 2H88B 5D3IB 4PMBA 3SFEB 3FKIB 1YNTE 2G9HD 2K05A 2RVLA 4HR7B 2X6LA 4H13C 1DJRD 4C1NK 1CA5A 3S1RB 5CGKA 3VYUA 1XEEA 1PFNA 3TEXA 1ZOYB 3AE1B 2EYOA 3M85A 3ZGZA 4ZQ3A 1QOAA 4XQJA 4WWMA 4RAUC 5IGEA 1E2VA 3T56B 3UI3A 4NKLA 1SEBD 4X3SA 3AE2B 3HOUB 4L63B 4YTNB 1ZYRD 1LTTD 4KN4C 5A35A 5CBEE 1STAA 3K6OA 5CC4A 2WV6D 5BN5A 2AX5A 1I4QA 1S5BD 1YNNC 3VR8B 3RZDB 2VZKD 3FILB 4HCEA 2PZUA 3FDTA 1PRTD 4DAVA 1TWGB 2NZ1D 4ZRQA 3D4DA 3HEJA 1IHZA 4WQMA 4KV6A 2EELA 4E6IA 1STNA 1FIQA 4XWTA 1U9RA 4XE0A 1G8ZD 2J4XA 4LAAA 1Y1WB 1ZPSA 1QT9A 2EXZA 4XYOA 4OIJA 4XT3B 1HUMA 5JVG3 1U4RA 3QIAA 1ESFA 3ZJVA 2AUJD 1JMLA 1QF6A 2IPKD 3IFTA 3LXFA 3R93A 1TS3A 1ML0D 2EPBA 2ZXPA 2SAKA 1VDVA 4CKEA 5I4DA 1BQQT 3FPUB 4A3FB 3VRBB 2QF7A 2EY6A 5IGGA 3PUYA 3TUOA 4DAYA 1L5PA 3J81L 3HZXA 4L8JA 5EBCA 2HDEA 4DFAA 5G5GA 4WIPA 1SYGA 4C1NI 3FMCA 3T13A 4R8IA 1KDAA 2CJNA 2WKDA 4ODGA 1ZEQX 3PMFA 4YSZB 2PZTA 1HZ6A 4K2KA 1LTGD 2X6GA 1QOFA 3SK6A 1IYVA 2B2UC 1VDZA 3P42A 3S16B 2JWUA 2IX0A 1H9MA 4IURA 2L9HA 5JVH3 1W6JA 5I9PA 4KTAA 3J80E 4IUQA 1R4PB 2K1BA 2CQAA 1PFMA 4DN4M 1JWSD 1TU2B 2PO4A 3DWGC 4RKBA 5EBDA 4A6QA 1CT1D 1QNUA 2F0FA 4KGTA 1A70A 3OSOA 4CKCA 2RSNA 3ITPA 3DM1A 3I8ZA 1WTQA 1UUPA 5BN4A 1RTOA 1BR9A 1HZ5A 1FFUA 4H0LC 2F0PA 3PV0A 2R93B 2PCFB 1P7EA 1F2MA 2SOBA 2B2VC 3P63A 4OGQC 1I6HB 3MXNA 2B2TA 2L5TA 2BYTA 4Q0FA 1YNND 2CHBD 4KX6B 1VJKA 3EUB2 2L11A 2IWHA 2MJDA 1AYFA 4XWWA 2R61A 2IGHA 1CHQD 5G3LD 5CMDA 1IGDA 5C4HA 1V8CA 1HA6A 3GTOB 4IUNA 1TT2A 1IYUA 1YMHE 3ETRA 5EE9A 1WGKA 5T1GA 5AUIA 4BWGB 3A55A 3GTQB 1XO3A 2AWNA 3MA2B 3HGBA 3PZ8A 1XWEA 5JOBA 1F9RA 4Y7NB 2N9LA 1CFMA 1AN8A 1B3AA 1SXTA 1FNVA 5IGCA 2WDRB 2ICEC 2I38A 2H89B 3A8IE 1ZUD2 1PTOC 2VB3X 1UNSA 1NCVA 4Q5VA 1B50A 3HKZB 2AQ1B 4KKJA 1BUVT 4D2KA 4QUFA 1NVID 3TP5A 2KQ4X 4N59A 3RPFC 5LL6X 3AMUA 2KJXA 5FLXE 1VZ7A 1C77A 2ZT9C 2A73B 1SNDA 2IGDA 1WSPA 2IJ0A 2IDYA 1GUWA 1PTOH 2XN9C 3DWAA 2PVGC 5D7GA 1BO0A 2K33A 3U9OA 2GA4B 4A3GB 1JW9D 3EFXD 1EQVA 3TSSA 5CV6A 2K7VA 1SSOA 2Y0SB 2JSVX 4BY1B 4P6VF 3D8GA 4HTHA 1T6BX 3BDOA 1SE3A 1SE2A 2YYZA 2CJOA 3QO2A 2O2LD 1JALA 3TP8A 3M4OB 4C80A 1PRTB 2OEOA 5C5LA 4A3IB 3B9JA 1M4VA 3J7AV 2WXMA 5A2QL 4ZK9B 4LJZC 1J9OA 5NUCA 3SDZA 3VR6A 2ZW0A 3VR2A 2HDMA 1G91A 2WKCA 2DNCA 1EY4A 4QB4A 1DYQA 4MN3A 2WP9B 2B63B 5KYIA 1ACCA 1FGBD 3TEYA 3KLSA 3X3NA 1F2RI 2B2YA 4B0EA 5FO8B 4A3JB 2KUMA 2GI9A 2EJGC 1LT3D 3TZDA 2A68C 5LL6S 5EGTA 4WURA 2F0NA 4CQNA 1B9MA 4C3HG 4ZHPA 2XRSD 4S3SA 1C76A 1IUEA 5K36G 3NTKA 4A3BB 1WD0A 1Y8PB 3CWIA 1Y8OB 5CORA 3TDQA 3N6RA 2EJFC 3WDNA 2LY7A 1PZKD 3I72A 4C3IB 3NVZA 5T8IA 2VNUD 2BB5A 1ZE3D 3L7ZC 3A7AB 1RCVD 3GTPB 1SBBB 5I6YA 4RGOS 1PZJD 1WVLA 2NVYB 1C4PA 5C5MA 5BYQA 3S2DB 4Z9CB 3DEOA 1C8CA 3IAYA 1JE4A 3IL8A 5JXVA 4K6DA 2BS2B 4K5WA 3R2TA 1CQVA 3NTHA 1HUNA 1GPXA 5IOCA 2F0IA 1T5EA 3CQZB 4ZOHC 3W5UB 2BDOA 3I90A 1EFID 2DY7A 3AM9A 5IGDA 1SF0A 4A90A 1FXIA 1JOQA 2KHSA 2CU3A 1QE6A 1Q10A 1V97A 1SYEA 1D1IA 3W3AA 3DXJC 2LHEA 1XYIA 3TN2A 2WXLA 1RJTA 1BDOA 1Z6HA 4FNFA 2NN6G 1FXAA 2WNMA 1IGCA 3Q6SA 3F2UA 2D62A 5M3FB 4K8IA 1DGJA 1QB5D 2Z4HA 3PUVA 4RGNA 1QKZA 1TVXA 2NUCA 4G4KA 3A8KE 2BOSA 4ZKCB 3GD7A 1SNPA 3JAML 5BMIA 2PQEA 1CQFA 4ILWA 5EE3A 3PO2B 4FXDA 3D4WA 2JP1A 4DF7A 3BVMA 4PQXA 5C0XG 3ZJUA 4C2MB 3P75A 2ENBA 1DOYA 2DWQA 1JCKB 3SR6A 2F0EA 1L4ZB 1QJOA 1KABA 3GTGB 1ENCA 3AV8A 1ZXTA 2WAQB 3K5LA 1A3VA 3A8JE 2INPE 2EYJA 4LK1C 3ABVB 3A56A 3BYTB 1XLNA 5CR3A 2F0TA 1EQTA 2B2UA 2E2IB 1J7AA 2RKSA 2A68D 1V8QA 4U68A 4RCOA 4OZBA 1D6EC 3SHLA 4IUTA 2BS4B 5EQ0A 3LWEA 1Y56A 2WXPA 1EY0A 2A6ED 5IGBA 4ULLA 4RGTA 4OIKA 4RFBA 2WINB 3BVZA 3H94A 1VF7A 4TQUS 1YNJC 1QG7A 2BA0A 2PW9A 3P20A 3RD4A 1PGBA 4L23A 3VYSA 4A8XC 4KK7A 1STYA 5C3XA 2LFIA 1D2BA 2LMCB 4KY5A 1SYFA 2M2LA 1TY0A 4J1MA 2WXJA 2EVBA 4GZYC 3NRZA 2JYOA 3MZ5A 2L32A 1YQ3B 4MM3B 2YEPB 2B2VA 1A15A 3Q0AA 2BBCA 4YWGG 1G2TA 4FVMA 2A69C 3D4RA 1P7FA 1H9RA 1BOSA 3OIQA 1TZOA 1GOZA 4TMAB 1GHKA 1GUOA 5COYA 2PYKA 5BN3A 1NYRA 1HPCA 2TMPA 2HDLA 1IL8A 3NP8A 3Q8BA 4N6EB 1BCPD 2CW0C 2RDFA 3QB3A 4TQ0A 3K5NA 4US8A 1TYGB 4KKTA 2JX5A 3H91A 3MWYW 3S1QB 3IXSA 4C56C 1I4GA 3H6MA 4NAWB 3K57A 1T3QA 1YQ4B 3NVYA 2MGSA 1RM6C 4IZ8A 4YSYB 2WDQB 2L4NA 1DCZA 3KBXA 4H2AA 5EPKA 2K28A 1V1PA 2WXRA 4IDIA 1VR9A 2FMCA 2QSDA 1O78A 4OL7A 4BBRB 3MC0B 1ET6A 1JC7A 5EE1A 1YN3A 2NTTA 1SAPA 3NHHA 3DUZA 4YT0B 1U4LA 3WOEA 4X3KA 1ROEA 3CIRB 4J6HA 1EOTA 5HG2A 1EYCA 1U4MA 3Q8AA 1LT5D 3LX0A 1DOIA 2WLBA 3AECB 4C3JG 3EQLC 1KRHA 5H92C 1I6VC 2K0PA 2N55A 1ILQA 2NMQA 1JICA 2B8GA 5M9OA 4TKOB 1JWAD 5ELEA 1MVKA 1NEKB 5C3EB 1F2LA 4KGRA 1LTID 5LHY1 1C78A 3FEWX 3Q22A 3Q8EA 3NK9A 1SFOB 3ND9A 1ONLA 2IX1A 1X32A 3PO3B 4UAIA 2E3TA 4P2CB 5D14A 1PTOB 1VZ8A 1Y8NB 3GS2A 2KA7A 4F7XA 1SNCA 3CHBD 4X3UA 1Q12A 3HOYB 5JJZA 2JYEA 4OO1G 5K36H 1FFVA 3OOCA 2HTME 3AE9B 4A3DB 5K5PA 4FP5D 1IKLA 3K0YA 1QLBB 4OZCA 1H9SA 3ZQ4A 4KJOA 3WOFA 4N58A 5JPMC 1QOGA 2XNAC 1IW7C 1G2SA 2JZPA 1FD6A 3DWPA 5JAVA 2NVXB 4C3JB 5I9OA 1QCBD 3S1NB 3NTIA 1SYCA 5M3MB 2Z4IA 4M0WA 5C3JB 3L9AX 2EY1A 1X3PA 4WJWA 2V4IB 2NWGA 4BS9A 2JXTA 2I07B 2MP1A 1MHXA 1K50A 2IGGA 4OHJA 1AWDA 3MTSA 3AH7A 5CV5A 5FO7B 1NR4A 3J81E 1UEAB 2CW0D 1SMYC 4KKSA 2F0VA 3D3RA 3EJIA 3WCQA 2JEAI 5C0XJ 2JA6B 4KY7A 1HCZA 3I4LA 1J7CA 4V190 4EGVA 4F88A 1D1KA 3OMGA 1FNWA 2NN6H 3SK5A 5JEAH 3BDCA 1ZKOA 2BE5C 2HCIA 1SNQA 5DAUA 2K6AA 2K9XA 1CK1A 4A3MB 2F4IA 1G6ZA 5CV9A 1F0ZA 1B9RA 3A7LA 1E6EB 3W1SA 4G57A 1HTPA 3E5SA 3AE5B 4HROA 1D5ZC 2BA1A 3QOLA 2Q5WD 5T1IA 1SDFA 5J22A 1C48A 4K14A 4FXGC 5C0XH 1C4QA 2EY2A 1UWMA 3I70A 1VZ6A 3SR1A 3P4PB 4AS1A 1PGAA 5DNFA 3OW7A 1PUTA 3PUWA 1RHPA 4KHZA 2JXMB 3QWNA 1WTVA 2MJEA 1VRAB 4YTMB 2KAJA 2K04A 5I2XA 1O7LA 3Q8FA 2XIWA 4JK1C 2XRQD 2KWDA 5GXGB 1KNEA 4UDUC 3AEFB 2H1EA 3KBGA 1OXVA 2WXGA 2PIAA 2PMVA 2WB1B 2D2CC 1RF2D 3HS0C 4QF4A 4RF1A 3NBHA 1WTXA 3AU7A 4KD4A 4ABNA 1C79A 1TY2A 1PRTF 5D65A 1KTKA 3P4SB 4OZAA 4FF1A 1S4ZA 5M5WB 2BS3B 2F0WA 1TS2A 2R6GA 1RWSA 3URYA 2RA4A 1IBXA 3ND8A 2ON8A 3RLFA 2M19A 1TKEA 3GP7A 3T51B 1AW7A 1BCPB 4TQ1A 1Q1BA 4K8JA 2E76C 2WXIA 3AE7B 3D6WA 1B53A 1JWUD 2QKIC 1IW7D 1CTMA 4IFDH 2W3SA 1GB4A 4L6TB 2OEDA 3AB5A 3V05A 3LNNA 3NZ3A 5DM63 4IQZA 1LT4D 2PMZB 3DEPA 4LMQD 4WORA 2FUG1 2R7ZB 2AQ2B 2HUGA 5HI1A 1PDQA 4XXEA 2HCCA 1QWYA 2AWOA 1MI0A 2JSOA 2R3ZA 4KI0A 2BW2A 3MAQA 1E0ZA 3H09A 2M0AA 1B44D 3NXWA 2EYPA 5CV4A 3TMEA 2MJ3A 4DU9A 2BCOA 4PMWA 2FE8A 4PMCA 5KEEA 2KEDA 5EKIA 1F9QA 3BDLA 2RMMA 2DY8A 4LK0M 2Z8LA 3AN1A 2KCCA 2WACA 2KACA 1ZXHA 3T53B 2MJ8A 1R9TB 1STEA 1N5XA 3NVVA 1XLPA 3AEGB 1A6XA 3C8YA 1EEID 2G1EA 1II3A 1E2ZA 2Y5CA 1JR0D 5IT9E 2BE5D 3MHZA 3VQIA 4HKQA 1PGXA 3MXUA 3BYYB 2JA5B 2I2YA 2NTSA 1J7BA 1ZP0B 1TIID 2L0CA 3C1FA 3R8BA 3IAS1 3DMUA 3PO0A 3J7YW 2PNRC 3GB1A 2JYTA 4L2YA 2JE6I 2E2DC 3MVVA 3HRDD 1MSHA 3CRLC 3C1EA 3U4EG 3VA7A 2NN6I 3J9CA 3I3CA 5D3DA 2GRIA 2QDBA 2PLPA 2WXNA 1WTWA 1D5XC 5A2QE 2NVTB 5G5HA 3G7LA 4XQQA 5M5YB 1QNKA 1EWCA 1B2TA 1F2YA 1I4PA 3NQIA 2FMMA 5F2DA 4RA8A 3M7NA 2L83A 5KIXA 4MHEA 3A54A 4RCNA 3MP9A 5C0XI 4BA2I 2R92B 5G3LF 4RHRA 5C2TB 5HFYA 3W2DA 1NYQA 4EVOA 4HCSA 4O1NA 1ESRA 4XTCS 1JQ4A 4OO1H 2D5GA 1S5ED 2FBWB 1UAPA 2KQ3A 1MPEA 3C46A 2WXKA 1WWTA 1T5XD 4ZUJA 2A74C 2BTEA 4ZAIA 1VLBA 2EE1A 1RFKA 4RH6A 1UGJA 5J1ZA 4M8AA 1Q3LA 4YXDB 1K8OA 1OXTA 4K6LA 3I9V1 4FYDA 3RFZB 3FPPA 3HG9A 3J7AF 5CYUA 1AFPA 2X69A 1RDPD 1LT6D 1C9FA 1NAPA 1PTOD 2MPMA 2F0DA 4XQNA 3H3VC 2JEBI 3NSWA 2ID0A 1E10A 3VRAB 4B9XA 4DNRB 2VXWA 4C3HB 2DLBA 2LHDA 2B76B 2V3PA 2QILA 2O4XA 5AFWA 2YEPF 3TP7A 4ZRPA 5I2YA 2INNE 2BT6A 4P16A 1ILPA 1EY5A 4V0BA 1MSGA 5J39A 1ET9A 5JEAG 2OT2A 5BYSA 4ZYSA 5KYLA 1DOMA 4BBSB 2KOLA 1HFGA 3AE3B 5EKLA 3HP3A 1WTRA 1TKGA 3NWTA 3C3LA 3EA6A 2IX3A 4CHTB 3JAME 5BMGA 4MACA 4IUVA 3M3YB 3V96A 4ID6A 3VYTA 1F9SA 1OFFA 4DXGA 3MXGA 4DQOC 3KWLA 5H8YE 2ACZB 1DZ1A 4GDKB 1K53A 4OW0A 2KECA 3BVGA 1F77A 4TSSA 3AE8B 1R4QB 3K59A 3SVMA 3VYRA 1KFYB 3Q69A 4DNTB 1QQRA 2F0HA 4HN7A 4ARIA 1K51A 1TWHB 2D9UA 3Q24A 1S5FD 2Z1CA 1JROA 2N7JA 2B2WC 1Y1VB 1H9KA 1W6KA 1DD2A 4B0MA 3M4YA 1CA6A 4IKGA 3AE4B 4JX1C 1VMCA 1N60A 3OHXC 4FF3A 3RZOB 1JWBD 3SE0A 5FOBB 2O5JC 1L0XB 1TS4A 4IFDG 3B2FA 1KLUD 1HQMC 1PTOF 1FEHA 3NPPA 2K5WA 1RTNA 4CBVA 4GDLB 2LUMA 4OO1I 4IOIE 4MT5A 3VR5A 3P1MA 1PRTC 4CJ2C 1DOLA 1MBYA 2C5CA 5C4XB 4G7OC 2WXQA 4N9TA 4C7ZA 2X38A 2K5DA 3IFDA 2E74C 1D4BA 2QEJC 2PPBC 1RKNA 1OXXK 1A2UA 2N88A 1OQRA 4DA2A 1HXYD 2PW7A 2E2JB 2W82A 4GLSC 4G7HC 1FD7D 2KCNA 5M5XB 3S2HB 2IT1A 4AYBB 3H8HA 4U673 5E3FA 4HSPA 3K7AB 2DBYA 3HOWB 5C3WA 4RHSA 1E0BA 4TRDA 1I4HA 4HMJA 1MD2D 1BNZA 3EROA 4A3EB 5BMHA 4XDCA 2NB0A 3E56A 1AZQA 4HMIA 2Y5PA 2MUYA 1KLGD 2WP8J 3AEAB 3ONAB 2JA8B 3X3MA 4DK0A 2K22A 3DHQA 3CRKC 1N63A 4L1BA 2WDVB 2QCPX 4KY6A 2NVQB 4DK1A 4J8QA 3EGRA 2E6XA 4FF4A 1STGA 2LJIA 1H9JA 3GTJB 1B9NA 3CKIB 4BY7B 3TP6A 1LTAD 3TBIB 4FXKC 1KAAA 5E4WC 3HOVB 5HGTA 5ISRA 2N9KA 2WU2B 3FILA 5BYRA 1DONA 1GUSA 1I4XA 3NUCA 3OWFA 1KH0A 2L52A 3ZJTA 5I6WA 3VR9B 1L4DB 1V1PB 4F8MA 1ICWA 2AQ3B 3BIID 4A55A 5ELFA 1XF5L 3W9CB 3MFYA 1EL0A 2J42A 5ELDA 1TWFB 1CJEA 3P4QB 3Q23A 1ZDXA 1YNJD 1NUCA 2F0UA 2OHFA 3BWUD 4HKZE 1L0VB 1EY9A 2EJMA 3RUZA 4KJNA 2EYFA 2J7ZA 4IUUA 1TJEA 4LTUA 2F3VA 1LTSD 2W3RA 4EQOA 3T3OA 4M1UB 3MHBA 3W5VB 3KF8A 4X3TA 3HOXB 3R2IA 4FO2A 4JE3B 3BS1A 1NSNS 1S5DD 4ZLTF 1HA5A 1WTPA 1JB3A 1N5WA 1BMLC 1VF5C 2A69D 1VMPA 1EYDA 4K5VA 4MIUA 4BA1I 3HVZA 3SK4A 1L6VA 5JEAJ 1YN4A 4RKLA 2V0GA 2E2HB 1PMRA 1BCPF 5KRUA 1OXUA 2NYZD 1EWHA 3T16A 1XLQA 3IT6B 4REZA 3GV3A 1R7SA 1JOOA 1LTRD 1ZDVA 1ZXIA 1SJHD 3FRPB 1YJJA 4KGSA 3NS1A 2ZXOA 1H9SB 1KNAA 3QOJA 1A3TA 5C6AA 3PUXA 3R3OA 1TWCB 3SEBA 1EY6A 2LEKA 2FFKB 1SIJA 4FF2A 4RF0A 4OVZA 2F0OA 3U9SA 1EEFD 3OPOA 2L12A 1HFNA 2I46A 2L1AA 1AP0A 3QJYA 1G291 2K3UA 2KN4A 2LGIA 1YN5A 4QMGA 2J53A 1F9PA 2AUKA 4RWSC 4XIGS 3VR3A 2ONQA 1GUGA 2F0SA 3DWQA 3RMHA 4ITKA 2Q8TA 1F2RC 2K32A 2MHVA 2F0KA 3EVQA 2XSCA 2JU6X 4NJCA 1ENAA 1V1OA 1SB3C 1OXSC 2PKOA 1A2TA 3J80L 3E9SA 1NR2A 4H7BA 1M8AA 5CBAE 1HEZE 5EPLA 2RQXA 3LWUA 4KKUA 5C4ZA 4H44C 1LACA 3S14B 2RPVA 1GXDC 1E2WA 3MEHA 2EY5A 1FYCA 2XWBB 2B8FA 3S1MB 3AEBB 1CZGA 1XXGA 1CZPA 4IFDJ 3AEEB 1PDXA 2N0SB 1PFDA 3GQBA 3FAHA 2C9OA 4ARCA 1FCCC 5IODA 4B08A 4CGYB 1EZ6A 2RDGA 4DGZA 2WXOA 5E4XA 3MJ5A 3K5OA 3G6JB 3HRZC 4NDXA 3U52E 3VA5A 4HRSA 2B39A 3GO5A 3IT4B 4ME5A 2FJ2A 2W55A 3I57A 4NZLB 2KEEA 2PZWA 2PTLA 4US9A 1EU4A 3SXHA 2FHTA 5C4JB 3T4AC 4HEA1 1E7PB 2J52A 2F0JA 4XDXA 1RD9D 2TSSA 3P7JA 2BB6A 1SSNA 3GTMB 3T3NA 3D6CA 3UI2A 1EIGA 1TKWB 1EY8A 2LS01 2JA7B 2WU5B 1S5CD 5DM73 1CI3M 1DOXA 3PZ7A 3HOZB 3O13A 1WXQA 1B4OA 2KVMA 5KNDA 1EIHA 2Y3AA 2J0TD 1IBXB 2A5HA 1CZWA 2B2WA 4DAPA 2RSOA 3N52A 3V2TA 1NENB 1PYWD 5CV8A 3E0JA 4PV1C 2K5QA 1EY7A 3PIO3 4JBWA 1SMYD 2D5DA 1QOBA 2EYHA 2Q8IB 2F1MA 3TZUA 4ZKBB 1Q8IA 5IIFA 1GHJA 2EZVA 1XLOA 2RDHA 3I73A 1YJIA 5EJWA 2FINB 5FLXL 1LV9A 1JOKA 1JWMD 1FNUA 3KK7A 3GV6A 1BXTA 4G7ZC 1UWXA 1FCLA 3PUZA 4WFN3 3VR4A 5MPOA 1FRRA 2A6HC 5FR3A 4HAEA 2H4OA 2F0QA 4NMZA 2G9DA 3MFGA 5IT9L 1PLFA 2GB1A 4WH4A 4R3DA 4KD3A 4O42A 1KF6B 4R8NA 1N61A 2WXHA 2OF1A 3K5MA 1JRPA 4USAA 1JQYD 2VUMB 2XWJB 4ZHOA 4AQ7A 1N62A 2DNEA 2KMMA 5E6JA 2IW3A 1EYAA 2QJLA 1FO4A 3NQTA 3H0GB 4YTPB 1I4RA 3NWSA 5IGFA 2SDFA 3SK8A 2VZKB 4C3IG 4Q2JA 3GTKB 2M9VA 3TEZA 2OXPA 3AEDB 5AUKA 2HQEA 3U7ZA 1IKMA 1FMAD 2K03A 3OMCA 3I4MB 1TQOA 3NE5B 2WIIB 4EQPA 1K52A 1VCIA 3QG1A 2F03A 1SYDA 3TEWA 3MXPA 1C4CA 1AEXA 1U4PA 1O80A 1EM7A 4EE2A 1TWAB 1XCTL 4JWUC 4A3KB 5C44B 2MH7A 3BK2A 3FVQA 4N9PA 1V43A 1XX8A 4XDDA 1Q90A 1KDBA 2A6EC 1B1ZA 4HEDA 3U2SC 3B2GA 1I3QB