1V1PB

The structure ssl from staphylococcus aureus from an orthorhombic crystal form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
191
Chain Sequence
HDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN 1
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
total genus 47
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
B PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1pB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1pB01
1PRTC 1PYWD 1QILA 1PTOH 2AQ2B 4RGOS 1YN4A 1CHPD 1SBBB 2ICIA 3MC0B 1PTOD 1LT3D 5ELCA 5FK9C 1B1ZA 1JWMD 1T5XD 1SEBD 1S5CD 2NTTA 3O13A 2XN9C 4TSSA 1TS5A 1DYQA 1SE3A 1BXTA 5ELEA 4ZYSA 5ELBA 1FD7D 1ESFA 1D6EC 4O1NA 1FGBD 1FNUA 1CHQD 1LT6D 1B44D 1S5DD 1UUPA 4RFBA 1SJED 1LTAD 1CK1A 1RDPD 3DWAA 1YN5A 3SEBA 2J4XA 1EEID 2IJ0A 2R61A 3BVMA 1JR0D 3KLSX 1FNWA 3DWPA 1I4QA 4L6TB 1D5MC 1EU4A 1TY2A 1MD2D 1D5ZC 4DXFA 1LTGD 3W2DA 1JQYD 1STEA 2Z8LA 4RGTA 4UDUC 1L0XB 3BYYB 1L0YB 1EFID 3GP7A 3BVZA 2G9HD 1SJHD 1CQVA 5ELDA 3EFXD 3OWEB 3BZDB 1EU3A 1LTID 1D5XC 1I4HA 2WV6D 1KLGD 2RDHA 1I4PA 3URYA 1BCPB 3CHBD 4RGMA 1AN8A 1F77A 4RHRA 1V1OA 1EWCA 1PTOB 1JWUD 1EEFD 2XRQD 1PRTD 1BCPF 3V05A 1LT5D 1JCKB 1YN3A 1M4VA 1TS4A 1LO5D 1I4RA 1XXGA 2QEJC 1KTKA 1PTOF 2XRSD 3R2IA 2TSSA 1V1PA 1LTBD 1HTLD 1BCPC 4K6LA 4C56C 1TS3A 4RHSA 5FKAC 1G8ZD 1HXYD 1PTOC 1ENFA 4L63B 4RH6A 1FNVA 1PZJD 2RDGA 1AW7A 1ET6A 2SEBD 3TSSA 1SE4A 1HQRD 3R8BA 1TS2A 2AQ1B 1LLRD 5TSSA 1CT1D 1I4XA 1LTRD 2O2LD 4RGNA 1S5BD 1RCVD 5ELFA 1TY0A 2NTSA 4BWGB 1SXTA 4NZLB 1KLUD 1PZKD 1S5FD 5D3DA 2CHBD 5D3IB 1PZID 1HA5A 5I4DA 1UNSA 4Z9CB 2QILA 3BVGA 1JWSD 1LTSD 1I4GA 1DJRD 3MFGA 1PRTB 1GOZA 2XNAC 4OHJA 2IPKD 2AQ3B 3R2TA 1RD9D 1V1PB 3DWQA 1PRTF 1ET9A 1LTTD 4RCOA 4DXGA 1LT4D 1RF2D 1S5ED 1SE2A 3BYTB 1XTCD 3EA6A 1BCPD
chains in the Genus database with same CATH superfamily
4EQPA 4BKSA 5IP4D 3M3YH 4OO1I 3ETRA 2LKVA 2PZWA 3N32A 2J42A 3AFPA 1JWMD 4CO7A 1B50A 4PNYA 4TSSA 3T1YQ 3TBLD 5G2NA 2NVXH 3KLRA 4JG2A 2K3UA 2Z4HA 2PIAA 4KZCA 4KHZA 3VUYA 4F8CB 4ME5A 3MXNB 3W1BA 1VS0A 2NZOA 3ND8A 4X3UA 4C2MH 5KIXA 4DV1L 3M4OH 1EIHA 2CR5A 2QCZA 3AEGB 5CHWA 1H9KA 3U4EG 2IY1B 2K1BA 1AFPA 4A3FH 4K3CA 5EKIA 1XPUA 2M9VA 1NENB 3P1HA 1PLFA 5IWAQ 1VQNA 3AEVA 3VR2A 2ENBA 3B2GA 1I50B 5LMNL 3NHEB 1D5ZC 3AE5B 1NTGA 1WCMH 4HSVA 1FGUA 3FPUB 5C4JH 3HRZC 1OTRB 1JQYD 3NOBA 2Z59B 1DGJA 3AEFB 2HHHL 2Z0DB 4FADA 3LX0A 2LZ6A 1T0SC 2DN8A 4DR7L 3TMPB 1DOYA 1YJIA 4OO1G 3HOZH 5ELDA 1T5EA 2LFIA 2K5NA 4MM3B 3TEXA 3EN2A 1M90C 1AP0A 4NXML 1WX8A 2K25A 2KCTA 1KLVA 1I4HA 1WJ6A 3QCAA 2QA4A 5E4XA 4ZKCB 3ZJYC 1TT5B 4G3XB 4FXDA 1L2NA 4YCVA 1Y8OB 3RNBC 2ZXOA 3MHBA 1F77A 3C3LA 1JC7A 3DBHB 1TWFB 2X69A 2M0AA 1M4VA 4XQJA 1JROA 2ZCCA 4UP8A 4A93B 4GZYC 4WURA 4WRDA 2ASBA 1V1PA 4DAVA 3QOJA 4GN4B 3AM9A 1O78A 1N62A 2RCNA 2REXA 2W9NA 2KNBA 4FF4A 1E2WA 1HXYD 2QC8A 2MP2B 4AH6A 1E0ZA 2ALYB 3UDIA 4LK0M 4C7YA 5HFYA 2Q2IA 5IYDH 1PZJD 1EQVA 1Q8KA 4NMZA 5IE8A 3QB3A 3LDZE 3OIQA 2CVRA 4GIVA 2SEBD 5CTRC 4YTMB 1NBWA 2VY3A 2JA6B 3GZNI 5HURA 1V97A 2C35B 1K8AC 3M3JA 1IGDA 2UUAQ 1ZKHA 2M8SA 2WU2B 3KF8B 3RCZA 4BKTA 2JP1A 4XYCA 3RPFC 2A5HA 4BY1H 3IT6B 3LXFA 3MEFA 4RGNA 4A3EH 4XDDA 1S5BD 5KGUA 1WE7A 2JQRB 2K0PA 3OJ4B 3SHLA 1WTRA 1QZHA 3QX1A 3PHWB 4XQQA 2XEWA 2W82A 1J8IA 4B3RQ 3RNGC 3NY5A 2N7DA 4PYUA 3K5MA 4W9KA 3X0WA 2L83A 3S1MH 4KZ0A 3N1XC 3GTLB 2EJGC 1AEXA 3D6WA 3TP7A 5GQOA 1E5WA 1WTOA 2IO3B 3R93A 3J7YW 2RHQB 1GG3A 3CCRA 4JX1C 4P75A 4NB3A 1E7UA 4OL7A 4AS1A 3M85A 1RD9D 2AWOA 4DV5L 1ICWA 2JK8A 4K0KQ 1VQFA 3L16A 3HVZA 2DUDA 3AE4B 3J7AV 1STAA 2NVYH 1UWMA 3CC4A 2R7ZB 2JYOA 2NVQB 3MXNA 2DGYA 4RGOS 1EY7A 4YCUA 4HMIA 3MJ5A 5C23A 4A3GG 2JA8B 4JYAL 5I6WA 5FOBB 2FMCA 4A90A 4MTNA 4AQYQ 3R3OA 3HK0A 1BXTA 1A2UA 4TKNA 3K57A 1SMYC 3UE0A 2VB3X 3T4AC 1NI3A 2UXCQ 3KDFB 2KQ7A 4FULA 3AB5A 3VR3A 1ENCA 3JAMi 4WH4A 2PMVA 2ZCBA 1PYSB 5C4XH 2WWZA 1XLPA 1VQKA 1FNWA 1CKNB 4JI8Q 3JAMc 2KD0A 2MRPA 2QJLA 2I2YA 3TDQA 4L6TB 4LFCQ 1YX5B 4GMVA 3QR8A 1HNXQ 3PO2B 1E8ZA 1Y56A 4PZ8A 1JJ2A 5T8IA 4RWSC 1YIJA 3PUYA 4K5XA 1FXTB 1STEA 3VR9B 3J81j 1TKYA 2EKEC 3W3AA 2G45B 4GDKB 4HPPA 1J9OA 1HR0W 2F4VQ 1KRSA 3HKZE 4DK6C 4HKZE 2B2UA 4JQWC 1J7CA 1GB4A 3Q2AC 1DXMA 1ZOYB 1IYVA 2EQSA 3BZDB 4HWIB 4UY8C 3PF5A 1N32Q 3DWGC 2JY6A 4DBGA 1Y8RC 3NP8A 1VQDA 1VR9A 1UGJA 2F0NA 4GLXA 1PH3A 4F87A 3Q8AA 4JI1Q 3GB1A 3Q69A 4DNTB 2IW3A 5E7NA 2JA6H 1OGWA 3MXUA 2A8VA 1NMFA 3HOUB 1KD1C 4X66L 1FJGQ 2DZIA 2MCNB 1QOHA 3MJWA 3T1YL 4BBSG 4BFRA 4TMAB 2E3TA 3GV6A 1V1QA 2NWGA 3NVYA 3Q6BA 3A55A 3KF8A 1SMYD 4IKGA 5FKAC 3AN1A 4WJNA 3IL8A 1D3ZA 2MO0A 4HIOA 4C3HG 3EHVA 1E22A 3EBEA 3C1FA 5EGTA 3UDFA 3V6CB 3TRZA 5IY0A 2L9HA 2VRRB 3NZSA 4DV4Q 2L8JA 2YTYA 3A56A 2N7EA 4HPLB 4EUTA 4CJ0B 1R4NB 4XZ4A 1HQRD 2KJ6A 1CZWA 3EFCA 2R7DA 3C0RB 3Q3OC 2RF4A 1K73C 4US8A 4HAEA 2GN5A 1HNZL 2BVCA 2JUOA 3S1QH 3AU5A 1VF7A 3DVNV 2F0EA 2KWDA 1PH2A 2BWFA 1VQMA 1UD7A 1C48A 2ZVOA 1OTCA 3SR1A 1B2TA 3HUIA 1WTXA 2EYPA 5JH5C 2BTEA 2B2WA 4Z9CB 4K14A 1QVFA 1Q86C 5DEHA 1VRAB 4W9LA 4ZK9B 4UP9A 5IP9H 4PZ6A 2KMMA 2F3IA 2Q2UA 3ZNZB 2E2HH 4UAIA 1HHVA 2JU6X 1PRTF 1J8CA 3GTJH 1XPRA 5COYA 4GN1A 3A0JA 2Z0EB 1SE2A 2JX5A 1SIJA 4BKGA 1C3TA 4MZ9A 3PIO3 4GNXB 3GTKB 1YN4A 4X6AH 4A3DH 5FK9C 4BA1I 3IHPC 2WHIA 4I65A 4KIKB 4RAUC 3PO2H 1VZ8A 4XTCS 3BK2A 2MBOA 2GRIA 1V81A 2OOBB 3RNCC 1K8MA 3SU8X 1MJDA 1WX7A 1CHQD 2W55A 4S3SA 4RFBA 2K8HA 1S3OA 1XLNA 4XYOA 2D11A 3E9HA 4YIJA 2HD3A 5FJ8H 1SFOB 2OWOA 3UI3A 5C5MA 4KLKA 1WSPA 2HIXA 3PLVA 1IBMQ 2EMSA 4UHVA 4MGIE 5M5YB 4BY7B 4B3RL 1KQSA 3NWSA 3WANA 3K8AA 5LXHA 3KJOA 1N61A 1R7SA 1VQJA 1G6PA 2KT7A 4YTNB 3HOWH 4KY7A 3DHGC 1UZXB 1I35A 3U2SC 1U4LA 1OQYA 1FMAD 1E8WA 1Y1VH 4DAMA 3AMUA 2A19A 3PSEB 2CJOA 4C7ZA 2BA1A 1O7ZA 3TEWA 3MC9A 2PO4A 1SB3C 4JI4Q 1IBXB 2YU9H 1Z5SB 1D4BA 4QJFA 4XWWA 3IVFA 2Y5CA 5BO4B 4EZKA 2N1WA 3NELA 3M7NA 2KMAA 4RF1A 5C0XI 1TGZB 1ONLA 3GZNB 3PT2B 3GDEA 1JB7A 2L76A 1J0GA 3FAHA 4RHRA 4A3GB 2FHTA 1WVLA 4KGTA 4DV2Q 4WJQA 3IAS1 3V05A 3ZYYX 5M3MH 2H88B 3S16B 5BMIA 1K51A 2KX0A 3U9OA 3KF6B 4FXGC 2BYFA 2MWSB 5CHFA 1LTBD 2WNMA 3CCLA 4ULLA 1P1AA 1XLQA 4S0RA 4BS9A 1UGMA 2BE5C 1TVXA 2F0OA 3N30A 3SVMA 2KFKB 2DAFA 2MJ3A 3S14H 1CSPA 1I3QB 2PCFB 3VQIA 4JOIA 1X9NA 3MA2B 2JEAI 2LGDA 4B3MQ 1SE4A 4LFCL 1YNTE 4DF7A 2KLGA 4AYBG 2AQ1B 4DKAC 1E24A 5KNCA 4JI7Q 2EKIA 4PZ7A 1XLOA 5M5WB 2LI5A 3TCAA 3PRPB 1XNRL 1BQQT 2RVLA 3A9KB 4TQ1A 1F0ZA 1WYWB 1N9WA 5JEAH 5C0XG 1IBLQ 5LHY1 1L1OC 1ZXTA 2UXDQ 1P98A 4TRDA 1ILPA 4DWFA 1JE5A 1TY0A 3K0YA 2F0KA 2LS01 1Z7TA 1Z9FA 1YIWA 4ACFA 3EROA 2RKSA 5D3DA 1N32L 1K3BC 2L0TA 2OF1A 3GTKH 2OEDA 1W3SA 1RAXA 1HA5A 1ZPSA 3PZDA 4G0NB 1IYJB 2IZVB 2QILA 3E3XA 1B3QA 1HZAA 2AHOB 1XCTL 2I46A 2LJIA 5CV4A 2EY6A 4X3KA 2V4DA 3ZDMC 2ZNVC 3VUXA 3QAQA 2Y0SE 3WDNA 1FJGL 3Q8DA 4MT5A 2KEEA 1BUIC 5M3FB 2D5GA 2K8CA 1E7ZA 1K3RA 1X3GA 5J17A 3U30A 4K81A 4LWCA 4I6LB 4QY7A 3OSOA 1MSGA 5ELCA 4A75A 3O65B 4DV4L 4BOSC 1SAPA 2CFMA 2F0HA 4NAWB 1S5CD 2K4KA 3PZ8A 1TS5A 3TQYA 2E6XA 1C7YA 2EY5A 3AULA 5IGGA 1D6EC 4C4VA 4DHJB 1FNUA 3NUHB 1SLJA 3Q23A 4A3PA 1SJED 2PYKA 3F2DA 1VQBA 2JRHA 1RDPD 2KCMA 1NAPA 1C78A 2WGSA 2D3BA 1Q90A 4A3CH 4IM3A 1KHIA 4P71A 4EX5A 2MBQA 3AMZA 4G11A 3Q8BA 2A6ED 2PQEA 1Y1WH 2IGGA 3J7ZC 4F88A 1NY4A 1Q46A 1PFSA 4P1CC 4AJWA 4A3FG 1JJCB 4YHHL 2N9PC 3GTPB 2K22A 1N6ZA 1F2RC 3ND9A 1Q81C 2B29A 2M2LA 3AE3B 4II3B 3ZXRA 2GA4B 2E2JH 3QOLA 2PE6B 2OCEA 5I9OA 1WCMG 2NYZD 4QGUA 3W5VB 4KD4A 2OJWA 1UE6A 3MEHA 3JVZX 4WQMA 5J18A 3DVNU 1MHWC 4OW0A 2K75A 5LL6X 1GJZA 1G6ZA 2ID0A 3AXCA 1PH9A 4N9TA 2LUEA 1WFQA 1FO4A 4HJ9A 2J0KA 1L2FA 1DOMA 2PTLA 3A9JA 3MTNB 3OYYA 1C77A 1KLGD 4ZHOA 2L52A 1WGGA 4ME3A 3H94A 2AUKA 1OFFA 1PTOB 5CORA 1P0RA 2K50A 3CMMB 4FHKA 3NENA 4ZRKA 1PFBA 1QF6A 3BU2A 2YTVA 2XK5B 3J81i 3CW2C 3CMAA 3BWUD 4HJ5A 3APDA 1B9NA 3J81c 3VAWA 1KXLA 3I70A 2KACA 2NR2A 2KVMA 4A3KB 1WGHA 1RTNA 2DX5B 3ERQA 5HI1A 5IYDG 5CHVC 3W5OA 2OEOA 4B9WA 3LWUA 1ESRA 1JT8A 2H1EA 2RCFA 3CCVA 3P63A 4KGRA 3RUZA 4BBNF 4DV3Q 3I63C 2J52A 4FN2A 2BS3B 1PQSA 2XGTA 1I4XA 4A76A 1U4AA 4M1UB 4K7WA 2QF7A 3RD4A 2R93B 4HIDA 5M3FH 4IJLA 2ZW1A 2JEBI 1GAQB 4A3EG 1Q1BA 4AYBE 2VB2X 3I8ZA 1HFNA 3H15A 1NVID 2V4LA 2IY5B 3EC8A 3VYSA 1PZKD 2ZT9C 3Q0AA 4LNOA 1N33Q 4IZ8A 2D2QA 3PV0A 2MNAA 4B0MA 1UNSA 3KJPA 2HQEA 1YBYA 5JOBA 4JWSC 3BVGA 2K05A 3PF4A 1PMRA 2F0GA 3VR5A 1VQPA 4IPHA 1MIUA 3KK7A 2WX0A 3AECB 3E9SA 4K1RB 4ARCA 1VF5C 4O42A 2LGYA 2N9EB 2IPKD 5IAAC 5E6JA 1PDXA 3Q3NC 2IHFA 2CW0C 2SNMA 1HA6A 3DBHI 2J7QB 2K5PA 4QUFA 4DR4L 3JAME 4ZAIA 2Y3AA 3BYTB 5D6JB 4DV1Q 1R9TB 5I2YA 2AQ2B 2RMMA 1TR5A 3L3OC 2V3PA 3RLNA 1WGKA 3N9YC 3NVWA 2KX3A 2MQHA 1X3QA 4BBRH 2HCCA 4GKJL 3NRZA 1ZW7A 3GTOB 1DYQA 4QIWB 1XD3B 3H6MA 3RLFA 1ESFA 1TWCB 2HE7A 4JI7L 3RNUA 3DHHC 4LNQA 1N34L 1LM8B 1MKHA 2RSNA 2HHHQ 3H7PB 4X62L 1F9PA 3DWAA 2M17A 4DR7Q 4GN3B 4E3CA 2J4XA 3KLSA 3BK1A 1EQQA 2UXDL 4MH8A 1JR0D 1EY4A 2F0DA 5C4XG 1BT0A 4MGYE 2VUMH 1D5MC 1KNAA 2AUJD 4HMJA 5IT9c 1JWAD 2JQOA 4EZLA 2CKZB 1NYQA 2O2VB 1SRUA 4LF6L 2O4XA 2V0GA 3VA5A 2CWPA 2WAQG 3TP6A 1EFID 1FM0D 5HG2A 3P4QB 2KC2A 5IA7A 1A3UA 2N55A 4OXPA 2K9XA 4MJSA 1OQRA 2KJRA 5F2DA 2B2VA 2GLSA 2NPTB 5CV6A 1E3PA 2LXKA 1F2YA 2CW0D 1IP9A 2D5DA 4XDXA 3S1NH 5ELOA 2D62A 3PIPA 4ODGA 2D9UA 4ZCKA 3UE1A 4A3KH 3M4PA 1YHQA 2XRQD 1TYGB 3UGBB 1JCKB 3DBLB 2MPMA 4OZAA 1AE2A 2JA6G 4NQLB 4W9EA 1KDCA 1IXRA 2YEPB 2TSSA 3D32A 3LWEA 2B76B 2D3GA 5FR6A 2EE1A 2N3SA 4K6LA 1WJUA 5FR3A 3I55A 2JA9A 3I72A 2YTXA 3L9AX 4P73A 4R4TA 1K8GA 1HFGA 1MJCA 1YZ6A 2HCIA 3TZUA 1YI2A 4C2MB 3M4OB 5EE1A 4RH6A 4KHPL 2H5XA 5FLXc 2IDYA 4J1MA 2L32A 2I5HA 1V2YA 4IURA 1XJVA 5T1IA 2A69C 4DHZE 3FRPB 4ZQ3A 3CF5A 1WCMB 2I1JA 4KKIA 2DLBA 4HCNB 5C4JB 3CCSA 2IGDA 3PGZA 5D2MB 1JICA 2FAZA 1GD7A 3KUCB 4NZLB 2NVUI 3S17B 1TKEA 2CQOA 3PREA 4J6IA 4R8IA 3RLOA 3T13A 1R9TH 3HOZB 4ITKA 2UUBL 1EUJA 3N1YC 1XNQQ 1ZGUB 2RDFA 2KDBA 4ZUJA 2L00B 4K6DA 3ZXVA 4OIKA 4GDLA 4JYAQ 1CKMA 4P16A 3NEMA 3HP3A 4NXNQ 1JRPA 3STBD 3GTOH 2DZJA 2RA4A 2GBJA 4MEMA 1KJTA 5IP9G 4X57B 5CV9A 2VL6A 1A5RA 2KAJA 1V1PB 3VHTC 3WCQA 5E3FA 1I5FA 3PPAA 3BDLA 4MACA 3ML9A 1RF2D 3G6JB 3I4MB 2O5JC 1I6HH 3AEAB 3VRAB 2F3VA 3I4OA 2BDOA 2XIWA 3PO0A 4BBNC 2ZPNA 3BDOA 1MJEA 5CMDA 4DR5Q 1PH7A 3FKYA 1A62A 1DM0B 5M5XH 4A3DG 2WP8J 3KUZA 4KSLC 4OZBA 3RULA 5IKCM 1UE7A 5H1SE 4TQ0A 3PO2G 4Q0FA 3ZJTA 2QEXA 4JV5Q 2BWES 2HDLA 2PW7A 3TIXA 3CCUA 4L5QA 2O2VA 4DV3L 1V8CA 2PZUA 3SE0A 2KBNA 3IFWB 2QW7A 4TVAB 2A69D 1R4NI 3DM3A 3PGEA 5AZHA 4RMFA 4FO2A 4HJ8A 1V43A 1Q82C 2J53A 2H89B 4BY1B 3W1SA 2MHVA 3QIAA 5FJ8G 1EEID 4K7SA 4TKOB 1YNNC 3ZNID 3PRZA 1RM6C 3UDXA 3S2HH 2HDMA 2RBMA 1Q12A 3BJUA 5C4ZA 2ZJQA 4B9KA 1WTWA 4YWKA 4DXFA 4F1SA 3S1MB 2L11A 5BN4A 4UDUC 3HOWG 1YQ3B 3QQ8B 3BYYB 3HOUG 1Y1VG 2G9HD 4X66Q 3HRDD 1L4ZB 3ZNGC 1SJHD 1SE9A 3Q6SA 2N49A 1VD2A 4ZKBB 1KC8C 1SNCA 4GLAC 4A4IA 3EFXD 1YJ9A 2F0VA 3B9JA 3ZTCA 1UE5A 4FXKC 4GLSC 4OWTB 4IM2A 5E1FA 3ALBA 4D2KA 2NVYB 3KBGA 3KYHC 4GS3A 2KTRA 1VZ7A 1AN8A 1QVGA 4DR6Q 3AE6B 1C8CA 1A2TA 5L83A 5GAGC 2E5LQ 4M02A 4GN5A 1WM2A 3DVGY 5M3MG 3APCA 3P20A 1GUWA 1B53A 1V49A 2KWVB 3SD5A 1BO0A 5EDSA 2D3CA 3P4RB 4CBVA 1MFWA 1GNUA 2JF5A 4C56C 4JCVE 5DLQE 1E7VA 3JSVB 2KCNA 3WOEA 1HNZQ 2QCPX 1G8ZD 1UE1A 1WOCA 4C1NK 1F9RA 4WJWA 2FNJB 4FLHA 4L63B 3U50C 1STNA 3M4YA 2FJ2A 4DPGA 2VQFQ 3S17H 4WJ3M 1FXIA 1HZ9A 5C4XB 2BKRB 1ET6A 3HM3A 3CMEA 2F0QA 2FIDA 1O80A 1YNND 3H3VH 2MEKA 2LVQA 1PH1A 3V3XA 4IDIA 2QMTA 2FCSA 2KTFA 3KWVA 1SIFA 4EOYA 4ZHPA 1HCZA 3KBXA 4L1BA 2J0TD 3HOXB 1PVOA 4GB9A 2X6GA 2WAQB 1M1KC 2ZW0A 3HOVH 2N8NA 2E2DC 5CV7A 1LYLA 1SR3A 1E2ZA 5JEAG 4WFN3 1NBFC 5I2XA 3PUVA 3I4MH 1E8YA 1O7YA 2PI2E 1FIQA 1UBIA 1XTDA 4LCDE 3UQBA 2M00A 3FKIB 2BQQA 1XQQA 3ULJA 2O6VA 5FLMH 1LTSD 1QVCA 4KN4C 5HHDG 2BF8B 2MGSA 2KVRA 4OHJA 4IWOA 3PO3H 1DCZA 5IGCA 3WA0A 4B6WA 4JK1C 3UQAA 3ONSA 2XBBC 1L6UA 3DOWA 2O5IC 1HUMA 1BKBA 3ZW3A 2K6AA 2B2YC 2OT2A 1TJEA 4ZOHC 1FFUA 4BY7G 3S2AA 1FR3A 1H9RA 4PMWA 4OEMB 2C5LC 2LJ5A 4R3DA 3OW7A 2QDBA 2WDTB 1XWEA 4R4IA 4LFBL 3P4PB 4W9CA 3H6NA 4N9F4 1FD7D 4PV1C 2JXXA 4GNXC 1FGBD 2MO1A 1X1MA 1PUTA 3OMGA 5IOIA 3NK9A 3DEOA 3V96A 1PA6A 2KOLA 2LY7A 2ZJPA 1F9QA 2UUCL 3S1QB 4R4OA 4YWLA 4A3CG 2ZTDA 3RZDH 4C80A 5ISRA 1Y1WG 1BDOA 3IFTA 4JBJA 1HRJA 2RSUA 4MELA 2ZPYA 1N63A 4BOZB 1XNQL 4EVOA 2BGFA 2KECA 2N88A 3KQ4A 3J80c 4N9PA 3DDCB 4QB4A 1XEEA 5KYIA 2Q5WD 1D7QA 4Y7NB 2C7MB 1TKGA 4NXNL 3GTQH 3CAMA 2LRWA 5JPMC 2F0UA 3DHQA 1CSQA 5ELNA 4KKUA 1YD8U 2E2HB 2IT1A 2K5DA 2XSCA 1GC6A 1ZE3D 3JSVA 3GTJB 4HRSA 1FCLA 2WV6D 4DAYA 1CZGA 2XTIA 3MZ5A 4KHVA 1WGDA 4IOAA 3H0GH 2AL3A 4RGMA 2WXMA 2VZKB 2LSSA 1FRRA 1GB1A 3SDZA 3OIPA 4DR5L 4A3BH 4B3SL 1PYBA 3B0AA 3KUDB 4FA6A 3BDCA 3J81L 4A3DB 1QWYA 2IYDB 1OXXK 1H95A 4PS3A 1PV4A 1W6KA 3M9BA 5DPRA 4PS8A 3T56B 3ZKJC 4URKA 3HOXH 3C46A 4JV5L 3A4RA 3ABVB 2KC1A 1XNRQ 1JQ4A 1SSNA 1UWXA 3K9OB 1GVPA 3A54A 3SK8A 5KEEA 1EY5A 2SOBA 5JJZA 3S9WA 4JIOU 5G5HA 1Q5WB 3V61A 3U4VA 4YWGG 1CUKA 1PH8A 1DOIA 1O7IA 1I42A 3FKIH 1GUNA 2JSOA 1ZP0B 2BW2A 2WXFA 3HOYH 5BYSA 1T0QC 3R8BA 4MIUA 5A2QL 2WXHA 1VQ9A 3PZ7A 5EJWA 2SNSA 1SNMA 3GS2A 1II3A 3HOWB 1YJNA 4QQBX 3L13A 4MN3A 4A3OA 4OWWB 1CMXB 1IW7C 1Y1VB 1ILQA 2K28A 3NBHB 4DDID 3MHSD 4IPCA 4DK0A 2KDMA 4PK1A 5M3FG 5EBDA 3B08A 2A1AA 3K80C 3Q3FA 2YU9B 1S5FD 4P74A 4B08A 1HJPA 3I73A 1YEZA 2LFNA 3I91A 2L4NA 4XDCA 2IHEA 1OXUA 1GUAB 2F0MA 4UP7A 2E74C 3I9V1 5J22A 4CDEC 3RZOH 3MVVA 4DR6L 2IBIB 3QC8B 1H8CA 4QAYA 4PG3A 4II2B 3K5OA 2K33A 2E5LL 1HNWQ 4YTPB 2AQ3B 2IY0B 5M3MB 1EUVB 1QNUA 4JI3L 4ICVA 1WZ0A 1X32A 3PQIA 1D1IA 1V5TA 2B8FA 4DXGA 2CH4W 1OXSC 4LW1A 1S5ED 4PS7A 1JJGA 3SK4A 4JI0Q 3GTMB 1B9RA 3ZJUA 3A7AB 2ICIA 1EOTA 2Z6KA 3APFA 3L08A 1LT3D 3UIOB 3S14B 4FJYA 5K36H 1H9JA 2VQFL 5LMNW 3KOJA 5E6OA 4YHHQ 3HS0C 4BBRG 4KJOA 1QKZA 1SN8A 1A15A 1S4ZA 1Y14B 2WDRB 2I07B 1E0BA 4Y7NH 5IT9L 1AWDA 3RT3B 4C3IH 3ITPA 3P2BA 3CPFA 3MC8A 1AZPA 1JOKA 4JPSA 4HKQA 1EIGA 3X3NA 3TREA 3CXCA 2DAJA 3RNEC 2NBVB 1YOVB 1A63A 3DWPA 1IW7D 1I4QA 1JE4A 2JJQA 1GC7A 1WF9A 2WXKA 2NZHA 3E0JA 4DFAA 3J9CA 1E90A 2VUMG 4ZLTF 3CRLC 1VLBA 1GJXA 5BN3A 4IW0A 5CC4A 2WDVB 3IT4B 3K5LA 4RGTA 5C3JB 1STHA 1QT9A 4HK2A 1MG4A 3SDLC 4M8AA 4K8JA 1Z47A 5JJIA 1P8LA 1QE6A 4G57A 2GBNA 3WAPA 1B70B 2Q8IB 5GAEC 1QUQA 3FILA 3HFZB 4KI0A 2FCQA 4RNAA 2KHWB 5IYBG 5HGQA 4HJGE 3TMEA 1G2TA 3K9PB 4DAPA 2KXJA 1BCPB 1R4MB 3M95A 3BY4B 4W9FA 2NN6H 4A3KG 4DXAB 4M01A 2JSVX 1XXGA 1VQ4A 4IFDJ 3DBRB 3IRBA 4HEA1 3TEYA 1YQ4B 5TR5A 3WAMA 5FLXL 4C4VB 4RG1A 2EYOA 1K53A 2YLMA 1TS3A 1FEHA 4R9WA 4FDBA 1VDVA 3FMCA 2V9HA 1PTOC 1UEBA 2K01A 2R93G 4CQNA 3NBHA 3RZWC 1V9JA 1FNVA 1I94L 3A4SC 1Y1WB 1BBWA 5BMHA 3IAYA 5H8YE 4W9HA 5DAUA 1EQRA 5KRUA 4FF1A 4FJZA 2LASA 4DHJD 1STBA 1ZYRC 3LB8C 2I5MX 1RIPA 3BG3A 3KYCD 4I6NB 3ULLA 3EJIA 2NCNA 2E2JB 4LFAQ 2Y5BB 3UI2A 1RKNA 3PMFA 3ZLZA 5C6AA 3FPPA 3D4DA 3RFZB 1MHHE 3K81C 5J2RA 3VYUA 2M4NA 4WJOA 3MP9A 4DR4Q 4JW0A 3A9JB 3VXWA 1E2VA 3GTMH 2KOXA 3RD2A 3TEHB 2FBWB 1TTNA 2DYMA 1C4AA 3M4QA 2OQKA 2WB1G 2F0SA 4US9A 4GKJQ 2WXGA 2K5WA 4MSQB 2KMCA 2VS1A 3DEPA 2UU7A 4NW2A 1WWTA 1AYFA 2DNCA 2Z0SA 1TQOA 2F0IA 1LTTD 2K5HA 3AE9B 1N34Q 2F0FA 4IQZA 3CP0A 2PNHA 1EIYB 4X62Q 3DBLI 1EL0A 2OJRA 3EFUA 1QILA 2VH1A 5G3LF 3GOEA 1CHPD 1PTOD 1YNJC 1PH6A 2MJ8A 1WMHB 1MGSA 2HQLA 3AYHB 4OO1H 2ONQA 3G6EA 4CJ2C 1XPOA 1EO6A 1KH0A 2DJFC 4LF6Q 1UAPA 5DCNA 4CKEA 5CBAE 5EE3A 4MH0E 4EFOA 4LF5L 1ZYRD 3MWYW 1WJ4A 2KHIA 1VQGA 2EYMA 3RN9C 5JZEB 2A68C 2B2TC 2EDGA 4EQOA 3U8ZA 1X3PA 3AQQA 3KFUA 4LJPB 3QJYA 1K8OA 5G5GA 4JVZA 2BE5D 1SSOA 3VVWB 2L15A 4EZJA 4GXBA 3G4SA 2UU9Q 1J19A 4AQ7A 1HNWL 1FRDA 4G7ZC 3I5JC 3NS8A 3BS1A 2JYEA 3OWEB 3NVZA 3L0OA 2GOWA 2BPSA 4BXXH 1D8LA 2NZ1D 1SE8A 1PHJA 1D5XC 2PMZB 4KVGB 4B0EA 2ATWA 3ENEA 2Z9HA 5IIFA 1HZBA 3VR4A 3GQBA 4JI0L 2FE8A 3P4SB 4RKLA 4TV3A 3FHWA 3I4NB 4KSKC 2EY1A 4KHPQ 2LGSA 2A74C 5KNDA 4USAA 1IL8A 2FMMA 4IUQA 2BT6A 1EY0A 2HJ1A 3RN5A 4BVUC 1C9OA 4RKBA 4BBRB 1N36L 1NEKB 3EUB2 4LF7Q 1WY8A 2DYBA 1QZEA 1WXMA 1WIAA 5IYCH 1EWIA 2QKIC 5BR8Q 2OHFA 1CQFA 3EIVA 1EWHA 1F2ZA 4HPMB 2M19A 3TN2A 1FFVA 2RDGA 1EY8A 1AW7A 3HOZG 1LTLA 2A68D 2UUBQ 2UYZB 2NVTH 1VQCA 3OG5A 2VUMB 2ZTEA 3D3RA 4HCSA 2DNEA 5DNFA 2K6QA 2MLBA 4G4KA 2CQAA 4K3BA 3EECA 2KHJA 2EELA 4KD3A 1YJWA 1RRBA 3LNNA 1U4RA 3OMCA 5EPLA 4C1NI 4MJSB 4L8JA 4QUCA 4BWGB 2WFWA 1SXTA 3I7FA 4LNIA 1CM9A 5C2TB 1KLUD 1CZPA 3I4MG 3EGRA 2KN5A 2JRIB 1GUSA 4CHTB 3RNAC 5J39A 2JWZA 4HEDA 3QK0A 1Y8PB 1OXTA 3AFQA 3NXWA 2G4SA 3AEDB 3S1NB 4LDTB 1J7BA 5FLMG 4QL5A 3S1RH 3BZKA 1WMHA 2DNFA 4NPNA 3MXGA 2XWBB 4OWXB 1VQ5A 5AJ3Q 1ZXIA 2F1MA 3PO3G 1CTMA 3A7LA 4PYZA 4ANXA 1F2MA 1LT4D 2WB1E 3W1GA 3DPDA 2ZXPA 4A8XC 4BKSD 4APVA 1PYWD 4QIWE 4BY1G 1X54A 3RR5A 2VNUD 1EZ8A 2EJFC 3K58A 1T5XD 2VW9A 3PUXA 4OVUA 4YL8A 2JN4A 4IUPA 2CHWA 2W3RA 1IYFA 4OGQC 1BR9A 2F4IA 3AB9A 1JMCA 1ENAA 1Q8IA 1YJ1A 4CKBA 1HR0Q 2WP9B 4LTUA 4YY3L 1GPXA 3WALA 4DGZA 2GMIC 1EF5A 3QO2A 2ICEC 4DU9A 2FCMA 1KL9A 3R7RA 4LFAL 1J6QA 4NNJB 3K7UC 3OOCA 4KV6A 5HY6A 3J80L 4LF8Q 1D1KA 4HIKA 4A6QA 2M0XA 1GXDC 3PHXB 2AEHA 1BBXC 3DWMA 3NTKA 4BBSH 3VTVA 2C7NB 4ARIA 2LXAA 1KFYB 3I4NH 4KTAA 4P2CB 2PPBC 1SYBA 2L0CA 2MW5A 4HJAA 4GDLB 5C5LA 4DV0Q 2INDC 4ANVA 2WB1B 4LUZA 1P9DU 1P16A 1RL2A 1K50A 2HD5B 2PVOD 2AWNA 5KYLA 1GKHA 2VXWA 1XCQL 5AFWA 1DOXA 3RMKC 1ML0D 4HJKA 1EU3A 3MFYA 4GOPB 3QJZA 2TMPA 4A9AA 3ER0A 1N5XA 2LWPA 2RDHA 2L55A 4KKTA 1DD2A 1S1QB 4KDIC 3I56A 1RODA 2KA7A 1I6HB 2DZKA 1K83H 2K52A 5EKKA 2KLCA 3W5UB 2RPVA 3S2DH 4EQ5A 1CFMA 5GADC 5EAYA 2FUG1 1NDDA 2JWUA 1LO5D 1I4RA 2QEJC 4H44C 4JPBW 1C76A 2GBKA 5M5XB 5BN5A 2XWJB 1FD6A 2EJMA 3CPWA 3N1ZC 2ZM6Q 2CKHB 1WTVA 4JC0A 3HOXG 2C9WB 2KEDA 4Y52H 1T0RC 3DLLA 4A3JH 2BH2A 1NI2A 2FIFA 3QARA 2ES2A 2NBFA 3OHXC 1A70A 1EM7A 1ZUD2 1YMHE 4DV6L 4L5TA 2MQJA 2D10A 2KK8A 3G71A 3TP5A 2CS4A 3FKIG 3RMHA 3S2HB 4MGZE 2BBCA 4OONA 3HOYG 5FO8B 1LLRD 4N8FA 4NJ6A 2IO1B 3IBEA 3K0XA 3LJ3A 1LTRD 3N20C 3M62B 1KNEA 4HVBA 1MVKA 1HQMC 2UU9L 4X3TA 1HZCA 1DOLA 2N0SB 2W3SA 4DDGD 3C1EA 1X3FA 4B9XA 1MG8A 4H13C 4TQUS 5EE0A 2AKWB 5G3LD 3OTOQ 1FXAA 2K7VA 2K8BA 4RMAA 1QOAA 5I4DA 4HCEA 2OTJA 1TIFA 1F9JA 2KTRB 2B2UC 4DUZL 4LAAA 2PQAB 1VZ6A 1PRTB 3MTSA 4P72A 5GROA 3F2BA 2RQXA 3SFEB 1C4QA 1IKLA 3T53B 4LFBQ 2IGHA 3NTHA 3D8GA 1J5EQ 2WU5B 2FXQA 4LF7L 1R4QB 4WAFA 3CRKC 1MI0A 3HM6X 4FF3A 4IJHA 1K0SA 2WIIB 4DNIA 1QLBB 2MBHA 5BR8L 1WZ3A 2UUCQ 3F2UA 3ONAB 2KKCA 5IGBA 2C60A 2L3ZA 1NUCA 4R8NA 2D0PA 2F3WA 1LUZA 2XN9C 3D4RA 4XIGS 3E6ZX 4I7AA 4J6HA 3KUPA 1SYCA 2SAKA 2KFJA 2HUGA 1RJTA 1WM3A 2Q2TA 2Z4IA 4JI2Q 2B3GA 4C3JH 3AEBB 2PE9A 3HHMA 4GGQA 3R3MA 3VTUA 4C3IG 2NN6I 2VQEQ 2YVCA 4PT5A 2CJNA 3X23A 3B6YA 4K5WA 4MSMB 4HTHA 1XO3A 2L1AA 3KLSX 3HOVB 2CCZA 1JRUA 2AYOB 4M8NA 1TWHH 4W9GA 2Q8TA 4NQKE 1L1OA 4GOPA 1FCCC 4KY6A 2WX1A 1VJKA 2N9XA 2O6VB 4M0WA 1JW9D 2IX0A 1U9RA 4XC2A 2HTHA 1E1TA 2DWQA 2LUMA 4WJPA 1L0XB 4B3SQ 4FBJB 2N78A 3CKIB 4A3IH 2MJEA 2R6GA 5T1GA 5AJ3L 1WTPA 4Q2JA 2B2WC 1G2SA 3AV8A 4NPSA 3CC2A 3PO3B 1NMGA 2K14A 5GXGB 3E0EA 1C79A 2NMQA 4JI5Q 4Q5VA 1SF0A 1ZEQX 4POFA 3K5NA 2L12A 1O7LA 4QCLA 4X64Q 2QSDA 3NTIA 1KRHA 3CCEA 4FF2A 1OO9B 2IWHA 4DR1Q 4A3LH 3B1LX 3CCJA 1PXUA 5LLIA 3TS0A 1A0IA 1F2RI 1UEAB 1YN3A 1FVIA 2NN6G 2RGFA 4PMBA 2KHSA 1Y69U 4YSYB 2N7JA 1SYFA 3OAWA 1HR0L 4XE0A 4MTKA 2QHOA 1WXQA 4AOFA 1K8RB 5JVH3 4A3MB 1UBQA 1Q0WB 1S3SG 5EPJA 5AEKB 4LF8L 4YXDB 3BINA 2N9KA 2L1BA 3I4LA 2QIEB 3ERSX 3VFKA 2V4IB 2A73B 2D0OA 1IZ6A 2MFIA 4HN7A 3RZDB 4LF4L 1SYEA 1VMPA 2DHZA 3AE1B 3TUOA 2WAQE 3A8KE 3KLWA 4LK1C 1F2LA 4DNRB 1DONA 1GUGA 2KN4A 3NVVA 4N6EB 3LGJA 3A1QB 2IL8A 2BYVE 4W9JA 4DV0L 2C7HA 4L5RC 4IUUA 2PQAA 3NJTA 1B8AA 2NBUA 1V8QA 4R4CA 4JI3Q 3GTQB 1E8XA 5ELFA 1R4PB 2HDEA 2JXTA 4CKCA 3UF8A 5BYQA 3PRMB 4DAYB 5GAHC 3DVGX 1FL0A 2KZRA 3ML8A 3G7LA 4PQXA 2N1VA 4JI6L 2W54A 3P42A 1X6OA 3H0GB 5D14A 4CJ1B 2FINB 2XNAC 4A3BB 1TWAH 3F8TA 3DWQA 1R4MI 1EIFA 2RSOA 3NQIA 3PIOA 4HCPB 4P7IA 3DQVA 2OTLA 5IO9A 2ZM6L 4RA8A 3QHTA 3SHQA 4AWJA 3HKZG 2BS4B 4ID6A 3DBRI 2MBBB 4DR2L 3JW0X 4J3OD 1G291 5LXIB 1WYDA 2B63H 2VZKD 3W1YA 1TWGH 5KNBA 3OW2A 5L37A 4IWQA 1M8AA 1B1ZA 2EYFA 4ZUIA 3ZRFA 4FNFA 2EOTA 2BS2B 1SEBD 4IUVA 1VQIA 5CV5A 4CDFC 1YQBA 2LHEA 2DY8A 2V3SA 2LMCB 3CIRB 2Q8RE 4CGYB 5ELEA 1TKWB 3P7JA 3T16A 5IGEA 4ZYSA 4HJ7A 1VQLA 1U5KA 4PMCA 2A6HC 2R2OA 3HOYB 4B95A 2EVBA 1A6XA 1MHXA 4JOIC 1EWYC 2EMTA 3KYDD 5CV8A 1W2BA 1K0RA 1YN5A 3VDZA 2JA5H 2K03A 4N8X1 2ZEQA 1UF0A 1H9MA 4AIMA 1FPYA 3Q8EA 1VQEA 5M9OA 2V1YA 3AI5A 1TY2A 3OTOL 3ZJVA 1PFDA 4IWPA 4L5SA 1LTGD 1DZ1A 5CGKA 3NS1A 1NR4A 3VRBB 3RZOB 4E6IA 1L7YA 5JPNC 5LMUQ 1T9HA 2NBWB 3VYTA 1CQVA 2P5ZX 2JA7H 1C4PA 1N5WA 1X56A 1J5EL 1WI5A 4LF9Q 1XMOL 4A3MH 3V60A 3D31A 3CU7A 2MUYA 2R92H 3CD6A 2IX3A 2X38A 4BAXA 3A33B 1TXYA 4BXXG 1KM7A 2KYWA 1SMXA 4OVZA 1DOKA 1L6VA 3DUZA 3CHBD 3ZIMA 2X6LA 1IKMA 3AU4A 4XXEA 2HJ8A 5D94A 1I94Q 1W6JA 3V62A 1EEFD 4F8MA 1G6JA 2ACZB 1H9SA 2EYJA 1KTKA 3K7AH 1PTOF 3QWNA 3J80i 2XRSD 3R2IA 3PIP3 3SR6A 1OXVA 2KQ3A 1YITA 1KRTA 5C0XJ 1BCPC 1HZ5A 4JI2L 2WXLA 3U7ZA 3A1QA 4I7ZC 4RHSA 2KVZA 5C44B 1C1YB 1Y8NB 2A6HD 4KK7A 4K2KA 4C3IB 2VQEL 3CCQA 1KF6B 3VR6A 4M8MA 2MH7A 2ZJDA 3MXPA 5IYCG 4NY0A 4X65L 3GO5A 3IXSA 2K6DB 5IP7H 3J81E 2EYLA 3NWTA 1QQRA 3A5ZB 2GBMA 4XT1B 3U58A 3OLMD 4IPGA 4IFDH 3UIPB 1A8VA 4DR3L 4JGHB 3ZO5B 2ZXRA 1JWBD 3L0WB 1YNXA 2O2LD 3CQZB 2UWQA 1RWSA 3H8HA 1VQOA 1V80A 1PFMA 5G55A 2M56B 3W9CB 2BB5A 1QUQB 3FILB 1EYAA 3RUIB 4KN7C 2RR9A 1I50H 3E9IA 1WR6E 4FJVB 3AE7B 4WQOB 5C3EB 1HZ6A 4IUMB 1RFKA 2GVAA 3C2PA 4JI5L 5A2QE 3VYRA 1E9MA 1WX9A 4MGKE 1HUNA 1GUTA 1YHBA 3TJPA 4JWUC 3SXHA 4X64L 4H0LC 1I4GA 4DR1L 1HTOA 5JJLA 2JT4B 4B3TL 3MFGA 4MNOA 1WTQA 4EEWA 1EYGA 1BBUA 1D2BA 2LMCA 2AMCB 4OIJA 4AP4C 1WH3A 4W9DA 4O0AA 3U9SA 1TT2A 4MM3A 1BF4A 1G91A 1KAWA 1WRDB 3GE8C 2CH4A 4LF5Q 5C1ZA 4M00A 4XYQA 1BCPD 3AH7A 1TWFH 2KCCA 2RHSB 4FP5D 3CSTA 2K5QA 1AARA 4BZAA 4CDCC 2PEAA 4HDOA 4NAMA 2WXOA 4A93H 3UINB 4XT3B 1PGXA 3O13A 1M94A 1IGCA 4F7XA 1ROEA 2WXNA 4K7UA 4WWOA 3T3OA 5ELBA 2BYTA 1NSNS 1TZ1A 3A74A 4O2DA 4NP5A 2WKDA 4YT0B 1IL2A 3IKJA 2X8XX 1UUPA 2V1CC 5IOCA 2QGQA 3IG3A 1KDAA 1XMQQ 4JBKA 4LJOB 3ZNHB 1SNOA 2MP2A 5DM73 4KMUC 2K5VA 3SGIA 5CYUA 2ASQA 2D2CC 2LVOA 2UXBQ 2R2QA 4ZYNA 1MD2D 5IT9E 1LABA 3I4NG 2A5UA 1WR1A 1P3QU 3L10B 2CU1A 2IO0B 3RYTA 3HEJA 4NJCA 3ULPA 1ACCA 2I1KA 3Q14C 3ZDTA 1N36Q 2N9LA 1ISNA 3Q8CA 3GV3A 1WD0A 4JL9A 3RZFA 3D4WA 5C44H 4FHJA 3GTLH 5IWAL 1YJJA 1E7PB 2WS3B 3H7SA 3HKZB 1QB5D 1QJOA 3SK6A 3T1HQ 2D07B 4POGA 2LRUA 4EGVA 3PV1A 3G48A 2PI2A 4KV2A 1XYIA 4HROA 2GI9A 3NPPA 1OEYA 3PS6A 3VUWA 4UPAA 3T8MA 1I6VC 4V190 2JZ3B 5AZFA 2R7ZH 1LGRA 1ICFB 1K9MC 2NVQH 2YYZA 3CQZH 1F52A 1DGSA 2YEPF 2Y0SG 1EYDA 3I57A 2Q2HA 2XVSA 2OQ0A 2JA8H 4A3JG 4WJ4A 2H4OA 2L7RA 4WWNA 2B39A 1B3AA 1CI3M 5C3EH 3OWFA 2BDNA 4IN3A 4ZRQA 2KWUB 1LFDA 4P1BC 1T0YA 2KQSA 5FLXE 1B9MA 3TZDA 4H02A 4G50A 4BA2I 2DZMA 1LV9A 2DENB 4HSPA 3KDFA 2JZPA 3CCMA 1SNPA 4ZRJA 1CA5A 5C3XA 1BVSA 4LUOA 2G3QB 2D3AA 4HLEA 1RCVD 1MSHA 1GM5A 2N4FA 5LMUL 4WAAA 3F1ZA 4NJ7A 2PW5A 1CKNA 2I0QA 4LF9L 4NKLA 3X3MA 5IODA 4J8QA 5D3IB 3U52E 3E56A 5E6PA 3FP9A 4YWMA 4LNNA 1TZOA 2UUAL 2K04A 2PPHA 1F1HA 3DMUA 1VCIA 1V5OA 1NE3A 4IUNA 1QCBD 1NYRA 2B2VC 4K2LA 4GDKA 2Y5PA 2HIVA 3HZXA 1GUOA 4LNFA 2G1EA 3DM1A 4YY3Q 1XF5L 1J7AA 3FC4A 3GE3C 3EA6A 5EPKA 2BB6A 1VMCA 1SDFA 2EXZA 2KDEB 3H1UA 5I6YA 1WJNA 3HOUH 1VDZA 2F0LA 4QMGA 4KJNA 2E75C 3UDGA 1EY6A 2NTTA 5EKLA 4A55A 2BOSA 5MPOA 2FCNA 3KH0A 1SE3A 2JVCA 4JE3B 4F7ZA 1VQ7A 4K0KL 1E10A 2CHXA 2RPQA 2F0PA 2NVTB 1NR2A 4E71A 4ASWC 1B44D 3PSIA 1CA6A 1QOBA 1GHJA 1JALA 1XX8A 2ZJRA 2DYOA 1LTAD 2INNE 4C3JG 1CK1A 1YX6B 5IN7A 3SEBA 3T3NA 1UELA 5D7GA 2R61A 2SDFA 3BVMA 4IO9A 1PH5A 1VQ8A 1N60A 3ZRCA 2K32A 1QOGA 3QWZB 5JHBA 4AQYL 4FYDA 1RTOA 3MAQA 4DK1A 2KDIA 2WXIA 2WQYB 3M63B 1YVCA 2E2IB 3HGBA 3W2DA 4N58A 2UXCL 2BA0A 4AUQC 3M7GA 2Z8LA 4DV7Q 1EF1A 3WIMA 1C9FA 2LEKA 2PMZE 2PVGC 3HKSA 3S1RB 5AZGA 1WTHA 4A3IG 3VR8B 1A3TA 4JI8L 2A4ZA 5E6NA 5DPWA 2MX2A 1LTID 2EZVA 1HNXL 3K59A 1I4PA 2WINB 4R1JA 4RM8A 3URYA 4JLCA 5AUIA 3L4PA 1C0AA 3NSWA 5L95C 2JPHA 5GMVA 3JC66 4LDTD 1EWCA 4AJYB 4DV6Q 1JWUD 2A6EC 1NNXA 3CF6E 3A5UA 4A3LG 4ICUA 1TS4A 2F4VL 4GOPC 1OEYJ 2L0FA 3L17A 2NB0A 2B2YA 3KVFB 1HTLD 1HTPA 3FVQA 3D0FA 4ANUA 4FVMA 1L0WA 1V6EA 2WDQB 2BKFA 1SNDA 2BH8A 4FXCA 3PCOB 1ENFA 1XMQL 3ICEA 4LLGM 2MP1A 4JI1L 4GNXA 4XX5A 1G51A 1HEZE 3VDYA 3ZGZA 1AH9A 3H3VI 1YHAA 3SK5A 3AE2B 3DXJC 4ABNA 3LYYA 2E8GA 1HH2P 4KIKA 3GTGB 2UXBL 3TL5A 4BBSB 3VH4B 3W1SC 4EKUA 5TSSA 4IG7B 4DUZQ 4GLVB 4LUVA 4KKJA 1SFOH 1BMLC 2R7FA 4HIMA 2F0JA 4IPDA 5I9PA 4C3HB 2B8GA 4WWMA 4HXDA 1AE3A 1YNJD 5M5YH 2K39A 4BY7H 2J0MA 4K8IA 2LHDA 4OZCA 5FO7B 3Q3MC 4N59A 3J7A5 1PZID 3Q22A 3ZQ4A 2ZTCA 3T1HL 1PH4A 4RM9A 2M1MA 2KJXA 1K83B 1U4MA 2KO3A 1GOZA 4JBWA 3S2DB 1E6EB 2KUMA 1WGYA 4X3SA 2B3AA 2MA9B 1B7YB 3NE5B 3BIID 1VQHA 1IBXA 1EZ6A 3HVDA 2Z1CA 3IFDA 2CWAA 4KDLB 1UWVA 2Y0SB 2BYEA 4DK5A 1U4PA 4A3GH 1PRTC 1UH6A 3RNFC 4A3JB 2KJHB 4KY5A 3MC0B 3CWIA 4U68A 3TBIB 3HOVG 1STYA 2B63G 2ZVNA 4GSWA 1RLFA 3S16H 4HDQA 1E1OA 2Z6BA 4WWPA 3T9LA 3RN2A 1RHPA 4CHKA 3L2PA 1WD1A 1ZKOA 2E2IH 5H92C 3OPOA 3KF6A 4O1NA 5D65A 1Z6HA 5A35A 1LT6D 3C19A 1SNQA 3TP8A 4W9IA 1X65A 1L5PA 2RD0A 2LXCA 2KFKA 4C00A 2EXDA 1F9SA 1I3QH 5DPTA 5KHQA 4ZRZA 1PGBA 4YCWA 3CC7A 2JZZA 2JA5G 2PKOA 2G5DA 1TU2B 3H3VC 1WGRA 1EOVA 4GKKQ 4KX6B 3MHZA 1CJEA 1P7EA 4GU2A 5IGFA 5M5WH 1AZQA 4DUYQ 3KWLA 3NZUA 3AE8B 3RI7C 2KENA 1QZGA 3T51B 3PLUA 3I3CA 1MBYA 3A9KA 4L23A 3J80E 2MBEA 2LD9A 2WXRA 5LNK1 4OX9Q 1IBML 3PVLA 4IFDI 2JA7G 2VZAA 3I90A 2WYQA 3DCGA 3VH3B 3P1MA 4A3MG 2F0TA 3I3TB 2DBYA 3U4ZA 4XQNA 1ASYA 2R92G 5FO9B 2HT1A 3WWVA 1IBKQ 1V1OA 3PUWA 4ALPA 5C4HA 1RFAA 1PRTD 3P75A 3QG1A 1LT5D 3GTGH 2F03A 4LF4Q 5AUKA 4J15A 2EYHA 4JI4L 4CYEA 1EQTA 4V0BA 1LQBA 3FDTA 1IUEA 2G4DB 3ECIA 1WE6A 5JEAJ 3U7DA 4YSXB 4C3HH 2PZTA 1HE8A 3WAOA 4C3JB 1KAAA 3VA7A 4IUTA 4IOCA 4A20A 2EIFA 2FFKB 2KDFB 2L05A 3TEZA 5EBCA 4DV2L 2PLPA 1L1OB 4NAWA 5IP7G 1TWHB 3C8YA 3NZ3A 5J1ZA 1TS2A 1S72A 3GD7A 4M0WB 3ZUNA 5JHAA 4JI6Q 4IFDG 2PJHA 1VQAA 2FUHB 3N6RA 3H0GG 4HR7B 4DV7L 1WI0A 1MI2A 4E74A 3KW5B 1EFWA 5JJKA 3SFDB 4H7BA 4A3BG 4XWTA 2MHJA 4YSZB 2JXMB 1RYJA 4A3IB 3PTFC 3GTPH 2NTSA 4RCNA 3QIJA 5DM63 1QG7A 2ZNVB 3PUZA 1HTQA 2C5CA 4B3ML 2WXPA 1JORA 4R4QA 2CHBD 3JAML 5LMNQ 5CX3A 3S24A 4DR2Q 1KIXA 4AYBB 4LJZC 2O6VD 4U673 1BNZA 2DJGC 2LGXA 4CDDC 5JAVA 4P6VF 1IHZA 1WFYA 3NG0A 5CR3A 1IBLL 1P7FA 4IOIE 2AX5A 2IO2B 3R7QA 5E4WC 2WACA 1ET9A 1WYGA 3HIZA 4NXMQ 1V9PA 2LXJA 2CHZA 3D6CA 1XTCD 3S15B 1L0VB 2E76C 2WXQA 4ILWA 1PTOH 1SBBB 3AEEB 3EVQA 1Z2MA 1SYGA 2AWTA 3V2TA 1X3EA 1MPEA 2MJDA 3A8IE 2PW9A 1HPCA 1JB3A 3CSFA 1GO3E 4A93G 1BOSA 3NUCA 1Q3LA 4DN4M 1LXDA 4OELB 2RDBC 4IM0A 5IYBH 1Q1OA 1S5DD 3DHIC 1JOQA 2XK5A 3JYUA 3ZTDA 5JXVA 1KOTA 4WORA 3STBC 4IALA 2IJ0A 1V86A 4MHEA 1T6BX 2J7ZA 3M3YB 5EE9A 1XMOQ 1CKOA 3I2ZA 1EU4A 4JBMA 1NCVA 1ZDXA 1I7HA 1PGAA 3E5SA 4WIPA 1SROA 4EQNA 2KANA 2I5LX 2JE6I 4NDXA 4G7HC 2DY7A 2C9OA 1Q10A 3VTWA 2NVXB 5LL6S 2R93H 5CBEE 1K28A 1L0YB 3BZCA 3GP7A 4DA2A 4DK3C 3BVZA 4ZRIA 5K36G 2F0WA 4GOCA 4KKSA 2QDLA 2ZZPB 3Q3JA 2I38A 1B4OA 1TWAB 2J0JA 1GHKA 3ZVVA 4A3FB 1H4RA 1C4CA 3IAM1 5C44G 1BUVT 4RF0A 2V3NA 1STGA 2GVBA 2CU3A 4IC7B 4REZA 4K5VA 2ON8A 4ZDVA 4X65Q 3DBSA 4I6PA 3QA8A 2NUCA 5BYRA 2B63B 4KGSA 2GBRA 1BCPF 1TWGB 3FEWX 2K1FA 3Q8FA 3NBIA 4OVVA 3NHHA 3Q24A 4DV5Q 1KDBA 4LMQD 3H9DA 1IYUA 1Q7YC 3NQTA 2YV5A 1SGHA 4DR3Q 2NS5A 3B2FA 4ZRPA 2Z6KC 2HTME 3L7ZC 2G9DA 1PFNA 2R7ZG 2BCOA 4MDKE 3AU7A 1JMLA 2WLBA 4G7OC 1L4DB 4S17A 2JA8G 1OQQA 5HGTA 4L2YA 3H91A 3J7AF 4H2AA 2JA5B 5BMGA 5J3BA 1T3QA 3N52A 3TSSA 5C3EG 1NJIC 5EQ0A 5C3WA 3TS2A 2JYTA 4GKKL 1TWCH 3WOFA 1VCBA 2INCC 2KWCA 3R66C 1WRIA 1LM0A 2B2TA 3F2CA 4DUYL 1CT1D 1PDQA 1XT9B 1ZDVA 1K52A 1WXSA 2KQ4X 1QNKA 3N3KB 5C0XH 4B3TQ 2AL6A 2WXJA 2F52A 3H7PA 4DQOC 1N8RC 1WXAA 2OXPA 2PNRC 5NUCA 4DHZB 3L54A 4XGAB 2EY2A 2LGIA 1A3VA 4OX9L 1U0LA 1EY9A 5K5PA 2JA7B 1TIID 4QF4A 1TBEA 3S15H 2QDFA 1JOOA 1QOFA 1Q1EA 2LVPA 1X55A 2WKCA 1SYDA 5JVG3 4LNKA 2R92B 1KABA 2L5TA 2IX1A 1ZXHA 1WJJA 1JWSD 1IBKL 2EPBA 1DJRD 2INPE 5KHOA 3V6EB 4ANWA 4EE2A 3EQLC 1S40A 1IPGA 1WXVA 1H9SB 3H09A 5HKHA 5DPSA 2VH2A 3K6OA 3R2TA 4A3EB 2R3ZA 3OJ3A 3K7AB 1FYCA 2MSED 1LACA 4RCOA 1ASZA 1EYCA 5IGDA 1VQ6A 3A8JE 2NPTA 1N33L 3HG9A 4TUUA 2GB1A
chains in the Genus database with same CATH topology
4EQPA 4OO1I 3ETRA 2LKVA 2PZWA 2J42A 1JWMD 1B50A 4PNYA 4TSSA 3KLRA 2K3UA 2Z4HA 2PIAA 4KHZA 4ME5A 3ND8A 4X3UA 5KIXA 1EIHA 3AEGB 1H9KA 3U4EG 2K1BA 1AFPA 5EKIA 2M9VA 1NENB 3P1HA 1PLFA 3VR2A 2ENBA 3B2GA 1I50B 1D5ZC 3AE5B 4HSVA 3FPUB 3HRZC 1JQYD 1DGJA 3AEFB 3LX0A 2DN8A 1DOYA 1YJIA 4OO1G 2LFIA 5ELDA 1T5EA 4MM3B 3TEXA 1AP0A 1I4HA 5E4XA 4ZKCB 4FXDA 1Y8OB 2ZXOA 3MHBA 1F77A 3C3LA 1JC7A 1TWFB 2X69A 2M0AA 1M4VA 4XQJA 1JROA 4WURA 4A93B 4GZYC 4WRDA 1V1PA 4DAVA 3QOJA 3AM9A 1O78A 1N62A 4FF4A 1E2WA 1HXYD 1E0ZA 4LK0M 4C7YA 5HFYA 1PZJD 1EQVA 4NMZA 3QB3A 3OIQA 2CVRA 4YTMB 2SEBD 2JA6B 5HURA 1V97A 1IGDA 2WU2B 2JP1A 3RPFC 2A5HA 3LXFA 3IT6B 4RGNA 4XDDA 1S5BD 5KGUA 2JQRB 2K0PA 3SHLA 1WTRA 4XQQA 2W82A 1J8IA 3K5MA 2L83A 3GTLB 2EJGC 1AEXA 3D6WA 3TP7A 1WTOA 3R93A 3J7YW 4JX1C 4OL7A 4AS1A 3M85A 1RD9D 2AWOA 1ICWA 3HVZA 3AE4B 3J7AV 1STAA 1UWMA 2R7ZB 2JYOA 2NVQB 3MXNA 4RGOS 1EY7A 4HMIA 3MJ5A 2JA8B 5I6WA 5FOBB 2FMCA 4A90A 3R3OA 1BXTA 1A2UA 3K57A 1SMYC 2VB3X 3T4AC 1NI3A 3AB5A 3VR3A 1ENCA 4WH4A 2PMVA 1XLPA 2QJLA 1FNWA 2I2YA 3TDQA 4L6TB 3PO2B 1Y56A 5T8IA 4RWSC 3VR9B 3PUYA 4K5XA 1STEA 1TKYA 3W3AA 4GDKB 1J9OA 4HKZE 2B2UA 1J7CA 1GB4A 1DXMA 1ZOYB 1IYVA 3BZDB 3DWGC 3NP8A 1VR9A 1UGJA 2F0NA 4F87A 3Q8AA 3GB1A 3Q69A 4DNTB 2IW3A 3MXUA 3HOUB 1QOHA 4TMAB 2E3TA 3GV6A 2NWGA 3NVYA 3A55A 3KF8A 1SMYD 4IKGA 5FKAC 3AN1A 3IL8A 4C3HG 3C1FA 5EGTA 2L9HA 3A56A 4CJ0B 1HQRD 1CZWA 4US8A 4HAEA 1VF7A 2F0EA 2KWDA 1C48A 3SR1A 1B2TA 3HUIA 1WTXA 2EYPA 2BTEA 2B2WA 4Z9CB 4K14A 5DEHA 1VRAB 4ZK9B 2KMMA 1HHVA 4UAIA 2JU6X 1PRTF 5COYA 1SE2A 2JX5A 1SIJA 3PIO3 3GTKB 1YN4A 5FK9C 4BA1I 4I65A 4RAUC 1VZ8A 4XTCS 3BK2A 2GRIA 1K8MA 2W55A 1CHQD 4S3SA 4RFBA 1XLNA 4XYOA 4YIJA 1SFOB 3UI3A 5C5MA 1WSPA 5M5YB 4BY7B 3NWSA 1N61A 1R7SA 4YTNB 4KY7A 3U2SC 1U4LA 1FMAD 3AMUA 2CJOA 4C7ZA 2BA1A 1O7ZA 3TEWA 2PO4A 1SB3C 1IBXB 1D4BA 4XWWA 2Y5CA 3M7NA 4RF1A 5C0XI 1ONLA 3FAHA 4RHRA 4A3GB 2FHTA 1WVLA 4KGTA 3IAS1 3V05A 3ZYYX 2H88B 3S16B 5BMIA 1K51A 3U9OA 4FXGC 1LTBD 2WNMA 4ULLA 1XLQA 4BS9A 2BE5C 1TVXA 2F0OA 3SVMA 2MJ3A 1I3QB 2PCFB 3VQIA 3MA2B 2JEAI 1SE4A 1YNTE 4DF7A 2AQ1B 5KNCA 2EKIA 1XLOA 5M5WB 1BQQT 2RVLA 4TQ1A 1F0ZA 5JEAH 5C0XG 5LHY1 1ZXTA 4TRDA 1ILPA 1TY0A 3K0YA 2F0KA 2LS01 1Z7TA 3EROA 2RKSA 5D3DA 2OF1A 2OEDA 1ZPSA 1HA5A 2QILA 1XCTL 2I46A 2LJIA 5CV4A 2EY6A 4X3KA 2V4DA 3WDNA 4MT5A 2KEEA 1BUIC 5M3FB 2D5GA 3OSOA 1MSGA 5ELCA 1SAPA 2F0HA 4NAWB 1S5CD 3PZ8A 1TS5A 2E6XA 2EY5A 5IGGA 1D6EC 1FNUA 3NUHB 3Q23A 1SJED 2PYKA 1RDPD 1NAPA 1C78A 1Q90A 3AMZA 3Q8BA 2A6ED 2PQEA 2IGGA 4F88A 3GTPB 2K22A 3ND9A 2M2LA 3AE3B 2GA4B 3QOLA 5I9OA 2NYZD 3W5VB 4KD4A 3MEHA 4WQMA 4OW0A 5LL6X 1G6ZA 2ID0A 4N9TA 1FO4A 2PTLA 1DOMA 1C77A 4ZHOA 1KLGD 2L52A 3H94A 2AUKA 1OFFA 1PTOB 5CORA 1PFBA 1QF6A 3BWUD 1B9NA 3I70A 2KACA 2KVMA 4A3KB 5HI1A 1RTNA 3ERQA 2OEOA 4B9WA 3LWUA 1ESRA 4KGRA 2H1EA 3P63A 3RUZA 2J52A 2BS3B 1I4XA 4M1UB 2QF7A 3RD4A 2R93B 2ZW1A 2JEBI 1GAQB 1Q1BA 2VB2X 3I8ZA 1HFNA 1NVID 3VYSA 1PZKD 2ZT9C 3Q0AA 4IZ8A 3PV0A 4B0MA 1UNSA 2HQEA 5JOBA 4JWSC 3BVGA 2K05A 1PMRA 2F0GA 3VR5A 3KK7A 3E9SA 3AECB 4ARCA 1VF5C 4O42A 2IPKD 5E6JA 1PDXA 2CW0C 2SNMA 1HA6A 2K5PA 4QUFA 3JAME 4ZAIA 2Y3AA 3BYTB 1R9TB 5I2YA 2AQ2B 2RMMA 1TR5A 3L3OC 2V3PA 1WGKA 3N9YC 3NVWA 3NRZA 1X3QA 2HCCA 3GTOB 1DYQA 4QIWB 3H6MA 3RLFA 1ESFA 1TWCB 2RSNA 1F9PA 3DWAA 2J4XA 3KLSA 3BK1A 4MH8A 1JR0D 1EY4A 2F0DA 1D5MC 1KNAA 2AUJD 4HMJA 1JWAD 1NYQA 2O4XA 2V0GA 3VA5A 3TP6A 1EFID 1FM0D 5HG2A 3P4QB 1A3UA 2N55A 2K9XA 1OQRA 5F2DA 2B2VA 5CV6A 1F2YA 2CW0D 2D5DA 4XDXA 2D62A 4ODGA 2D9UA 2XRQD 1TYGB 1JCKB 2MPMA 4OZAA 1KDCA 2YEPB 2TSSA 3LWEA 2B76B 2EE1A 4K6LA 5FR3A 3I72A 3L9AX 1HFGA 2HCIA 3TZUA 4C2MB 3M4OB 5EE1A 4RH6A 2IDYA 4J1MA 2L32A 4IURA 5T1IA 2A69C 3FRPB 4ZQ3A 1WCMB 4KKIA 2DLBA 5C4JB 2IGDA 1JICA 4NZLB 3S17B 1TKEA 4R8IA 3T13A 3HOZB 4ITKA 2RDFA 4ZUJA 4K6DA 4OIKA 4P16A 3HP3A 1JRPA 2RA4A 5CV9A 2KAJA 1V1PB 3WCQA 5E3FA 3BDLA 4MACA 1RF2D 3G6JB 3I4MB 2O5JC 3AEAB 3VRAB 2F3VA 2BDOA 2XIWA 3PO0A 3BDOA 5CMDA 1DM0B 2WP8J 4OZBA 4TQ0A 4Q0FA 3ZJTA 2HDLA 2PW7A 1V8CA 2PZUA 3SE0A 2A69D 4FO2A 1V43A 3W1SA 2J53A 2H89B 4BY1B 2MHVA 3QIAA 1EEID 4TKOB 1YNNC 1RM6C 2HDMA 2RBMA 1Q12A 5C4ZA 1WTWA 4DXFA 3S1MB 2L11A 5BN4A 4UDUC 1YQ3B 3BYYB 3HRDD 2G9HD 1L4ZB 1SJHD 3Q6SA 4ZKBB 1SNCA 3B9JA 3EFXD 2F0VA 4FXKC 4GLSC 5E1FA 4D2KA 2NVYB 3KBGA 1VZ7A 1AN8A 3AE6B 1C8CA 1A2TA 3P20A 1GUWA 1B53A 1BO0A 3P4RB 4CBVA 4C56C 3WOEA 2KCNA 2QCPX 1G8ZD 4C1NK 1F9RA 4WJWA 4L63B 1FXIA 1STNA 3M4YA 2FJ2A 5C4XB 1ET6A 2F0QA 1O80A 1YNND 2MEKA 3V3XA 4IDIA 2QMTA 3KWVA 4ZHPA 1HCZA 3KBXA 4L1BA 2J0TD 3HOXB 2X6GA 2WAQB 2ZW0A 2E2DC 5CV7A 5JEAG 1E2ZA 4WFN3 5I2XA 3PUVA 1FIQA 1O7YA 2M00A 3FKIB 1LTSD 4KN4C 5HHDG 2MGSA 4OHJA 1DCZA 5IGCA 4JK1C 1L6UA 2O5IC 1HUMA 2K6AA 2B2YC 2OT2A 1TJEA 4ZOHC 1FFUA 4PMWA 1FR3A 1H9RA 4R3DA 3OW7A 2QDBA 1XWEA 3P4PB 1FD7D 4PV1C 1FGBD 1PUTA 3OMGA 3NK9A 3DEOA 3V96A 2KOLA 2LY7A 1F9QA 3S1QB 4C80A 5ISRA 1BDOA 3IFTA 1HRJA 1N63A 4EVOA 2KECA 2N88A 3KQ4A 4N9PA 4QB4A 1XEEA 5KYIA 2Q5WD 4Y7NB 1TKGA 5JPMC 2F0UA 3DHQA 4KKUA 2E2HB 2IT1A 2K5DA 2XSCA 1ZE3D 4HRSA 1FCLA 3GTJB 2WV6D 4DAYA 1CZGA 3MZ5A 4KHVA 4RGMA 2WXMA 2VZKB 1GB1A 1FRRA 3SDZA 3OIPA 1B9RA 3BDCA 3J81L 4A3DB 1QWYA 1OXXK 1W6KA 3T56B 3C46A 3ABVB 1JQ4A 1SSNA 1UWXA 3A54A 3SK8A 5KEEA 1EY5A 2SOBA 5JJZA 3S9WA 5G5HA 4YWGG 1DOIA 1GUNA 2JSOA 1ZP0B 2BW2A 2WXFA 5BYSA 3R8BA 4MIUA 5A2QL 2WXHA 3PZ7A 5EJWA 2SNSA 1SNMA 3GS2A 1II3A 3HOWB 4MN3A 1IW7C 1Y1VB 1ILQA 2K28A 4DK0A 2KDMA 5EBDA 2YU9B 1S5FD 4B08A 3I73A 2LFNA 3I91A 2L4NA 4XDCA 1OXUA 2F0MA 3I9V1 2E74C 5J22A 3MVVA 3K5OA 2K33A 4YTPB 2AQ3B 5M3MB 1QNUA 1X32A 1D1IA 2B8FA 4DXGA 1OXSC 1S5ED 3SK4A 3GTMB 3ZJUA 3A7AB 2ICIA 1EOTA 1LT3D 3S14B 5K36H 1H9JA 3HS0C 4KJOA 1QKZA 1A15A 1S4ZA 2WDRB 2I07B 1E0BA 5IT9L 1AWDA 3ITPA 1AZPA 1JOKA 4JPSA 4HKQA 1EIGA 3X3NA 3DWPA 1IW7D 1I4QA 1JE4A 2WXKA 4DFAA 3E0JA 3J9CA 4ZLTF 3CRLC 1VLBA 1GJXA 5BN3A 5CC4A 2WDVB 3IT4B 3K5LA 4RGTA 5C3JB 1STHA 1QT9A 4M8AA 4K8JA 1Z47A 1QE6A 4G57A 2Q8IB 3FILA 4RNAA 4KI0A 4HJGE 3TMEA 1G2TA 4DAPA 1BCPB 2NN6H 2JSVX 1XXGA 4IFDJ 4HEA1 3TEYA 1YQ4B 5FLXL 2EYOA 1K53A 1TS3A 1FEHA 4R9WA 1VDVA 3FMCA 1PTOC 2K01A 4CQNA 3NBHA 1FNVA 1Y1WB 5BMHA 3IAYA 5H8YE 5DAUA 5KRUA 4FF1A 1STBA 1ZYRC 3LB8C 3BG3A 3EJIA 2E2JB 3UI2A 1RKNA 3PMFA 5C6AA 3FPPA 3D4DA 3RFZB 1MHHE 3VYUA 3MP9A 1E2VA 2FBWB 2DYMA 1C4AA 4US9A 2F0SA 2WXGA 2K5WA 3DEPA 4NW2A 1WWTA 1AYFA 2DNCA 1TQOA 2F0IA 1LTTD 3AE9B 2F0FA 4IQZA 1EL0A 1QILA 5G3LF 1CHPD 1PTOD 1YNJC 2MJ8A 1MGSA 4OO1H 2ONQA 4CJ2C 1KH0A 5EE3A 1UAPA 4CKEA 5CBAE 1ZYRD 3MWYW 2EYMA 2A68C 2B2TC 2EDGA 4EQOA 1X3PA 3QJYA 1K8OA 5G5GA 2BE5D 1SSOA 4AQ7A 1FRDA 4G7ZC 3BS1A 2JYEA 3OWEB 3NVZA 2NZ1D 1D5XC 2PMZB 4B0EA 5IIFA 3VR4A 3GQBA 2FE8A 3P4SB 4RKLA 3I4NB 2EY1A 2A74C 5KNDA 4USAA 1IL8A 2FMMA 4IUQA 2BT6A 1EY0A 4RKBA 4BBRB 1NEKB 3EUB2 2QKIC 2OHFA 1CQFA 1EWHA 1F2ZA 2M19A 3TN2A 1FFVA 2RDGA 1EY8A 1AW7A 2A68D 2VUMB 3D3RA 4HCSA 2DNEA 5DNFA 4G4KA 2CQAA 2EELA 4KD3A 3LNNA 1U4RA 3OMCA 5EPLA 4C1NI 4L8JA 4QUCA 4BWGB 5C2TB 1SXTA 1CM9A 1KLUD 1CZPA 3EGRA 1GUSA 4CHTB 5J39A 4HEDA 1Y8PB 1OXTA 3NXWA 3AEDB 3S1NB 1J7BA 3MXGA 2XWBB 1ZXIA 2F1MA 1CTMA 3A7LA 1F2MA 1LT4D 2ZXPA 4A8XC 1PYWD 2VNUD 1EZ8A 2EJFC 3K58A 1T5XD 3PUXA 2W3RA 4IUPA 4OGQC 1BR9A 2F4IA 3AB9A 1ENAA 1Q8IA 4CKBA 2WP9B 4LTUA 1GPXA 4DGZA 3QO2A 2ICEC 4DU9A 4A6QA 3J80L 3OOCA 4KV6A 1D1KA 1GXDC 1BBXC 3DWMA 3NTKA 4ARIA 1KFYB 4KTAA 4P2CB 2PPBC 1SYBA 2L0CA 4GDLB 5C5LA 2WB1B 1K50A 2PVOD 2AWNA 5KYLA 1XCQL 2VXWA 5AFWA 1DOXA 1ML0D 1EU3A 3MFYA 4A9AA 2TMPA 1N5XA 2RDHA 2L55A 4KKTA 1DD2A 1RODA 2KA7A 1I6HB 5EKKA 3W5UB 2RPVA 1CFMA 2FUG1 2JWUA 1LO5D 1I4RA 2QEJC 4H44C 1C76A 5M5XB 5BN5A 2XWJB 1FD6A 2EJMA 1WTVA 2KEDA 2NBFA 3OHXC 1A70A 1EM7A 1ZUD2 1YMHE 3TP5A 3RMHA 3S2HB 2BBCA 5FO8B 1LLRD 1LTRD 1KNEA 1MVKA 1HQMC 4X3TA 2N0SB 1DOLA 2W3SA 3C1EA 4B9XA 4H13C 4TQUS 5EE0A 5G3LD 1FXAA 2K7VA 1QOAA 5I4DA 4HCEA 2B2UC 4LAAA 1VZ6A 1PRTB 3MTSA 3SFEB 2RQXA 1C4QA 1IKLA 3T53B 2IGHA 3NTHA 3D8GA 2WU5B 1R4QB 4WAFA 3CRKC 1MI0A 4FF3A 2WIIB 1QLBB 3F2UA 3ONAB 5IGBA 1NUCA 4R8NA 2F3WA 2XN9C 3D4RA 4XIGS 3E6ZX 4J6HA 3KUPA 1SYCA 2SAKA 2HUGA 1RJTA 2Z4IA 3AEBB 4C3IG 2NN6I 4PT5A 2CJNA 4K5WA 4HTHA 1XO3A 2L1AA 3KLSX 3HOVB 2Q8TA 1FCCC 4KY6A 1VJKA 4M0WA 1JW9D 2IX0A 1U9RA 2DWQA 2LUMA 1L0XB 3CKIB 2MJEA 2R6GA 5T1GA 4Q2JA 1WTPA 2B2WC 1G2SA 3AV8A 3PO3B 5GXGB 1C79A 2NMQA 4Q5VA 1SF0A 1ZEQX 3K5NA 2L12A 1O7LA 4QCLA 2QSDA 3NTIA 1KRHA 4FF2A 1OO9B 2IWHA 1PXUA 1F2RI 1UEAB 1YN3A 2NN6G 4PMBA 2KHSA 1Y69U 4YSYB 2N7JA 1SYFA 4XE0A 1WXQA 5JVH3 4A3MB 5EPJA 4YXDB 2N9KA 2L1BA 3I4LA 2QIEB 2V4IB 2A73B 4HN7A 3RZDB 1SYEA 1VMPA 3AE1B 3A8KE 4LK1C 4DNRB 1F2LA 2KN4A 1DONA 1GUGA 3NVVA 4N6EB 2IL8A 4IUUA 1V8QA 2HDEA 3GTQB 2JXTA 5ELFA 1R4PB 4CKCA 5BYQA 3G7LA 4PQXA 2W54A 3P42A 3H0GB 5D14A 4CJ1B 2FINB 2XNAC 4A3BB 3DWQA 2RSOA 3NQIA 4RA8A 2BS4B 4ID6A 4J3OD 1G291 2VZKD 5KNBA 1M8AA 1B1ZA 4ZUIA 2EYFA 2EOTA 4FNFA 2BS2B 1SEBD 4IUVA 5CV5A 2LHEA 4YT0B 3CIRB 2DY8A 2LMCB 2Q8RE 4CGYB 3T16A 5IGEA 1TKWB 3P7JA 5ELEA 4ZYSA 1F2RC 4KX6B 4PMCA 2A6HC 3HOYB 2EVBA 1A6XA 1MHXA 1EWYC 5CV8A 1YN5A 2K03A 1H9MA 3Q8EA 5M9OA 1TY2A 3ZJVA 1PFDA 1LTGD 1DZ1A 5CGKA 3NS1A 1NR4A 3VRBB 3RZOB 4E6IA 5JPNC 3VYTA 1CQVA 1C4PA 1N5WA 3D31A 3CU7A 2MUYA 2X38A 2IX3A 4OVZA 1DOKA 1L6VA 3DUZA 3CHBD 2X6LA 1IKMA 4XXEA 1W6JA 1EEFD 4F8MA 2ACZB 1H9SA 2EYJA 1KTKA 3PIP3 1PTOF 3QWNA 2XRSD 3R2IA 3SR6A 1OXVA 2KQ3A 5C0XJ 1BCPC 1HZ5A 2WXLA 3U7ZA 4I7ZC 4RHSA 5C44B 1Y8NB 2A6HD 4KK7A 4K2KA 4C3IB 1KF6B 3VR6A 2MH7A 3MXPA 3GO5A 3IXSA 3J81E 2EYLA 3NWTA 1QQRA 4XT1B 4IFDH 2ZXRA 1JWBD 2O2LD 3CQZB 1RWSA 3H8HA 1PFMA 2M56B 3W9CB 2BB5A 3FILB 1EYAA 4KN7C 3AE7B 5C3EB 1HZ6A 1RFKA 3C2PA 1E9MA 5A2QE 3VYRA 1HUNA 1GUTA 4JWUC 3SXHA 4H0LC 1I4GA 3MFGA 1WTQA 1D2BA 2LMCA 4OIJA 3U9SA 3TUOA 1TT2A 1BF4A 1G91A 4XYQA 1BCPD 3AH7A 2KCCA 4FP5D 2K5QA 4NAMA 2WXOA 4XT3B 1PGXA 3O13A 1IGCA 4F7XA 1ROEA 2WXNA 3T3OA 5ELBA 2BYTA 1NSNS 4NP5A 2WKDA 3IKJA 1UUPA 5IOCA 1KDAA 1SNOA 5DM73 4KMUC 5CYUA 2D2CC 1MD2D 5IT9E 1LABA 3HEJA 4NJCA 1ACCA 2N9LA 3Q8CA 3GV3A 1WD0A 3D4WA 1YJJA 1E7PB 2WS3B 3HKZB 1QB5D 1QJOA 3SK6A 4EGVA 1XYIA 4HROA 2GI9A 3NPPA 1I6VC 4V190 2YYZA 2YEPF 1EYDA 3I57A 2XVSA 2H4OA 2B39A 1B3AA 1CI3M 3OWFA 2BDNA 4IN3A 4ZRQA 5FLXE 1B9MA 3TZDA 4BA2I 1LV9A 2JZPA 4HSPA 1SNPA 1CA5A 5C3XA 1RCVD 1MSHA 2PW5A 4NKLA 3X3MA 5IODA 4J8QA 5D3IB 3U52E 3E56A 1TZOA 2K04A 3DMUA 1VCIA 4IUNA 1QCBD 1NYRA 2B2VC 4K2LA 2Y5PA 3HZXA 1GUOA 2G1EA 3DM1A 1XF5L 1J7AA 3FC4A 3EA6A 5EPKA 2BB6A 1VMCA 1SDFA 2EXZA 5I6YA 1VDZA 2F0LA 4QMGA 4KJNA 2E75C 1EY6A 2NTTA 5EKLA 4A55A 2BOSA 5MPOA 4JE3B 1SE3A 1E10A 2F0PA 2NVTB 1NR2A 1B44D 2DYOA 1CA6A 1QOBA 1GHJA 1JALA 1XX8A 1LTAD 2INNE 4C3JG 1CK1A 3SEBA 3T3NA 5D7GA 2R61A 2SDFA 3BVMA 1N60A 2K32A 1QOGA 4FYDA 1RTOA 3MAQA 4DK1A 2WXIA 2WQYB 2E2IB 3HGBA 3W2DA 4N58A 2BA0A 3M7GA 2Z8LA 1C9FA 2LEKA 2PVGC 3S1RB 3VR8B 1A3TA 1LTID 2EZVA 3K59A 1I4PA 2WINB 3URYA 5AUIA 3L4PA 3NSWA 1EWCA 1JWUD 2A6EC 1TS4A 2NB0A 2B2YA 1HTLD 1HTPA 3FVQA 4FVMA 2WDQB 4FXCA 1SNDA 1ENFA 4LLGM 2MP1A 1HEZE 3ZGZA 3SK5A 3AE2B 3DXJC 4ABNA 3LYYA 3GTGB 4BBSB 5TSSA 4KKJA 1BMLC 2F0JA 5I9PA 4C3HB 2B8GA 4WWMA 1YNJD 4K8IA 2LHDA 4OZCA 5FO7B 4N59A 1PZID 3Q22A 3ZQ4A 2KJXA 1K83B 1U4MA 1GOZA 4JBWA 3S2DB 1E6EB 2KUMA 1IBXA 4X3SA 3NE5B 3BIID 1EZ6A 3HVDA 2Z1CA 3IFDA 2Y0SB 1U4PA 1PRTC 4A3JB 4KY5A 3MC0B 3CWIA 4U68A 3TBIB 1STYA 1RHPA 1WD1A 1ZKOA 5H92C 3OPOA 4O1NA 5D65A 1Z6HA 5A35A 1LT6D 1SNQA 3TP8A 1L5PA 1F9SA 4ZRZA 1PGBA 2PKOA 1TU2B 3H3VC 3MHZA 1CJEA 1P7EA 5IGFA 1AZQA 3KWLA 3AE8B 3T51B 3I3CA 1MBYA 4L23A 3J80E 2WXRA 5LNK1 4IFDI 3I90A 3P1MA 2F0TA 2DBYA 4XQNA 5FO9B 1V1OA 3PUWA 5C4HA 1PRTD 3P75A 3QG1A 1LT5D 2F03A 5AUKA 2EYHA 1EQTA 4V0BA 3FDTA 1IUEA 4YSXB 5JEAJ 2PZTA 4C3JB 1KAAA 3VA7A 4IUTA 2FFKB 3TEZA 5EBCA 2PLPA 1TWHB 3C8YA 3NZ3A 5J1ZA 1TS2A 3GD7A 4IFDG 3N6RA 4HR7B 1MI2A 3SFDB 4H7BA 4XWTA 4YSZB 2JXMB 1RYJA 4A3IB 2NTSA 4RCNA 5DM63 1QG7A 3PUZA 2C5CA 2WXPA 1JORA 2CHBD 3JAML 4AYBB 4LJZC 4U673 1BNZA 5JAVA 4P6VF 1IHZA 5CR3A 1P7FA 4IOIE 2AX5A 5E4WC 2WACA 1ET9A 1WYGA 3D6CA 1XTCD 3S15B 1L0VB 2E76C 2WXQA 4ILWA 1PTOH 1SBBB 3AEEB 3EVQA 1SYGA 3V2TA 1MPEA 2MJDA 3A8IE 2PW9A 1HPCA 1JB3A 1BOSA 3NUCA 1Q3LA 4DN4M 1S5DD 1JOQA 5JXVA 4WORA 4IALA 2IJ0A 4MHEA 1T6BX 2J7ZA 3M3YB 5EE9A 1EU4A 1NCVA 1ZDXA 1I7HA 1PGAA 3E5SA 4WIPA 4EQNA 2JE6I 4NDXA 4G7HC 2DY7A 2C9OA 1Q10A 2NVXB 5LL6S 5CBEE 1L0YB 3GP7A 4DA2A 3BVZA 5K36G 2F0WA 4KKSA 2I38A 1B4OA 1TWAB 1GHKA 4A3FB 1C4CA 3IAM1 1BUVT 4RF0A 2V3NA 1STGA 2CU3A 4REZA 4K5VA 2ON8A 2NUCA 5BYRA 2B63B 4KGSA 1BCPF 1TWGB 3FEWX 3Q8FA 3NBIA 3NHHA 3Q24A 1KDBA 4LMQD 1IYUA 3NQTA 3B2FA 4ZRPA 2HTME 3L7ZC 2G9DA 1PFNA 2BCOA 3AU7A 1JMLA 2WLBA 4G7OC 1L4DB 1OQQA 5HGTA