3Q3OC

Toluene 4 monooxygenase hd complex with phenol
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 24
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q3oC00
3RNFC 4P1CC 3Q3NC 2INCC 3RNCC 3Q3MC 3RMKC 3N1ZC 2INDC 3RNEC 3Q2AC 3DHHC 3DHIC 3N1XC 1T0RC 4P1BC 3Q14C 3RNAC 3RI7C 3RNGC 3N20C 3RNBC 3DHGC 1T0SC 3RN9C 3I5JC 3GE8C 1T0QC 3GE3C 3N1YC 2RDBC 3Q3OC 3I63C
chains in the Genus database with same CATH superfamily
2RDGA 2NBWB 1L6UA 4UDUC 4IM2A 1C4AA 2I38A 2WXIA 1BMLC 2INNE 4FBJB 1NENB 2YLMA 1R4NB 2MW5A 1R4MI 4JE3B 2DENB 2LUMA 2Y5BB 2PVOD 4P16A 4DK5A 2MBBB 1LM8B 4W9KA 2FAZA 1PQSA 3FKYA 1HZ5A 1LQBA 4XGAB 5JXVA 1MI0A 3KYCD 1SE2A 1OTRB 4F8CB 1STEA 1C3TA 1YQ4B 2ZVNA 3A4RA 2AQ3B 2CHXA 1WX9A 4WJQA 2WXJA 1V97A 1XCQL 1WXQA 3JYUA 4RH6A 1EF5A 3B08A 3GZNI 4FJYA 3AEFB 2L32A 5CTRC 2V4IB 5IO9A 3EECA 1J7AA 4BAXA 1A70A 2QIEB 2QC8A 2LASA 3RUIB 2BQQA 4S0RA 2LUEA 3PHWB 2KTRA 4XDCA 3T8MA 4C56C 4AWJA 5BMGA 1UZXB 4WWNA 4GIVA 1FRRA 2CHWA 2AL3A 1V5OA 2W3SA 3NRZA 2PJHA 2ZCBA 2PPHA 4TV3A 4YWGG 1FXTB 3N1ZC 5HFYA 1L5PA 2D10A 4A9AA 3WIMA 3APFA 3QX1A 3R2TA 3ZLZA 5D94A 5IA7A 2LZ6A 1MFWA 2KWUB 2JT4B 3H1UA 1YD8U 2HTME 4W9HA 1Q1OA 2NTSA 1F2RI 4K1RB 2MWSB 3FILB 4M8MA 1AYFA 5D2MB 1JCKB 1YX6B 3A9KA 2PMVA 2GOWA 1E90A 1K8RB 2WDQB 1QQRA 3IFWB 4LJPB 3S2AA 3TIXA 2OOBB 1KLUD 2LFIA 3EA6A 1VJKA 4AJYB 2I1JA 2JZPA 2DYMA 3RNBC 3RYTA 1AW7A 4TMAB 3RN9C 1PDXA 1D4BA 3SHQA 2BKRB 2QCZA 2UWQA 3BZDB 2GRIA 2O2VA 4ZHOA 1L0YB 3AI5A 1WJUA 4IM3A 4N6EB 1C1YB 3BIID 1AN8A 2MBHA 3ALBA 1ZDXA 4B0MA 1UBIA 2NBVB 2WXQA 3D32A 1YMHE 4DDID 2V3NA 5E6JA 2ASQA 1VDVA 5H92C 1SJHD 2EKIA 3EHVA 1H4RA 1TYGB 1VD2A 2ZPNA 1TKGA 4ZRKA 4ANXA 4JLCA 3GE3C 1PGBA 1B9RA 2LI5A 2OEDA 3KVFB 3DVGY 1EF1A 1JWAD 3M95A 4B0EA 2BYVE 2W3RA 5CHWA 3VXWA 3B0AA 5I4DA 2MEKA 4GDLA 2ZZPB 1P1AA 4HPLB 3BVMA 3Q6BA 4HXDA 3VUXA 5FR3A 3N3KB 4HKZE 1B1ZA 3FAHA 1R4MB 2G4SA 3WAMA 2KFKB 2KJ6A 2M0AA 1BUIC 3AEBB 2BB5A 4AQ7A 1G6JA 1FPYA 1SE4A 1SXTA 2RDHA 2LGXA 2D07B 4GOCA 3AEAB 3LYYA 4MGIE 4ZRQA 4A6QA 4KZCA 4OW0A 3I57A 3ETRA 1ISNA 2KZRA 2W82A 1WXMA 2WU5B 4W9FA 2IGGA 4KKJA 2D11A 1RM6C 2WHIA 2DZIA 1SIFA 3MJWA 1FIQA 2K6DB 2BWFA 3Q3OC 5FR6A 1XT9B 2KX0A 3RMKC 2XK5A 2N1WA 4GGQA 5AZHA 5TSSA 1QOAA 3DBLI 3DHHC 2IGDA 3SDLC 2UYZB 4M0WB 1IBXB 2GI9A 4KIKA 2BT6A 3U52E 2RPVA 4NQKE 3MC0B 3Q8BA 2K8CA 1H8CA 3UI3A 1TS4A 2INDC 2IZVB 1KTKA 4NJ6A 3TCAA 4US8A 4NJCA 4N59A 3N30A 2ZW1A 4DHJD 2NPTB 2J53A 1MJDA 3NVVA 4BVUC 1WMHA 4IWQA 1L4DB 1CQVA 3H7SA 3RNEC 1NYRA 3Q2AC 3BYYB 1NVID 3VTVA 1RRBA 2WXPA 1ZUD2 4IWPA 3H7PB 3R7QA 5JZEB 1ENFA 4JPSA 2WXMA 2BBCA 2SAKA 2WQYB 4MGZE 4BKSD 5JHBA 1P0RA 1WE7A 2RMMA 1L0XB 1YN4A 4MJSA 2HE7A 4CYEA 4EFOA 4YSZB 2OJWA 4LNIA 3BK2A 3B2GA 4MT5A 2JYTA 1OFFA 2N7JA 3P4SB 2AQ1B 3I5JC 4MM3A 1V49A 2JZZA 4S17A 3A1QB 3LXFA 3W9CB 3QCAA 5HI1A 5C1ZA 3QQ8B 3OJ3A 3LJ3A 1A5RA 2IBIB 2PKOA 4KV2A 2HJ8A 2L00B 4P6VF 2GLSA 1TS3A 4WJNA 1FFUA 1KLGD 5IP4D 1GG3A 1L0VB 4BKTA 1HXYD 2L76A 1V1PB 2H89B 1K52A 2LEKA 1BT0A 3SFEB 1E6EB 2FCQA 2KOXA 3JW0X 2EELA 2BTEA 4PS8A 4M8NA 3IAM1 2MCNB 3WAPA 2LXAA 2QMTA 2KT7A 2GBRA 2PE6B 1WGKA 3DPDA 3TL5A 2ZEQA 2BYFA 4MACA 1WR1A 1FM0D 1KF6B 4LJOB 1WXAA 4KSLC 1TTNA 4KDLB 3ECIA 2BS4B 4J6IA 2L52A 2ZVOA 1F2RC 1KM7A 1WJ4A 3L13A 3AE4B 3RCZA 2D3BA 5BYRA 2KDEB 4JWUC 1Q0WB 4W9DA 3NVYA 1D5XC 2BVCA 2YVCA 4AUQC 2WX0A 5DPWA 1TY2A 2JPHA 4R3DA 4EZJA 1U4AA 4CHKA 1WSPA 4YL8A 2KK8A 2IO2B 1SB3C 1LFDA 1T0QC 1QT9A 1C79A 2KDIA 4PS7A 3M62B 1N60A 3AULA 4ARIA 2INCC 1VLBA 2EKEC 4LK0M 4JIOU 1RAXA 5EE1A 3UQAA 1E5WA 1ZPSA 3NZUA 2J52A 3TEXA 5AUIA 4URKA 2DX5B 1XLPA 3M63B 4I6PA 3ZW3A 1YJ1A 1LGRA 4ANWA 4FJZA 4II3B 3DBLB 4PS3A 1ZXIA 4GMVA 4L2YA 1LXDA 1IGDA 1WWTA 4KSKC 4LNFA 3Q3MC 1WZ3A 2M4NA 1C78A 1UUPA 3L17A 3JSVA 4G0NB 1GC7A 1TT5B 1FXAA 3EUB2 3VVWB 3MHZA 3IXSA 4JWSC 2JX5A 2B76B 1GB1A 2AEHA 4EOYA 3ONSA 1HTQA 1TJEA 1ESFA 2BS2B 3FC4A 1TIFA 4XX5A 2MBOA 5E6OA 3IT4B 4AS1A 1WY8A 2K25A 1VZ7A 3DQVA 4K7SA 4XZ4A 3ZXRA 4C7YA 2FE8A 5L83A 1XXGA 4HPPA 1UD7A 1K51A 4A3OA 4FN2A 1HQRD 1N5WA 3KLSX 4YXDB 3IVFA 3RI7C 2G1EA 3APCA 4AP4C 4WQOB 4ZRIA 5IKCM 4DHJB 4KZ0A 4MGKE 4NZLB 3I63C 4G50A 3EGRA 1WYWB 2KHWB 3MHSD 3RZWC 3Q8AA 3HIZA 4IKGA 3U7DA 2M56B 3QHTA 3DBHB 5G55A 2V0GA 4FXCA 1K50A 3ZTDA 2EMTA 3B9JA 2HTHA 3AH7A 3W1SA 2RPQA 2Z0EB 3A9JB 2X38A 5D6JB 4D2KA 2KQSA 1P98A 4E74A 2KVZA 2M0XA 4C00A 2WDVB 1I42A 4GDKB 1F1HA 3U2SC 2KDMA 2XBBC 3RFZB 1D5MC 2WWZA 1QZEA 4B95A 2JQRB 4P7IA 3P42A 5G2NA 1FNWA 2WXRA 1CMXB 2WP9B 2XNAC 1TZ1A 2G45B 3O13A 1N63A 1KLVA 2O6VA 2IGHA 1JWUD 4YSXB 2L83A 4ANUA 2K3UA 1S1QB 3DBSA 3WAOA 4XYCA 4BOZB 4WAAA 2MP2A 3N20C 2KD0A 1J8CA 3ZNGC 4ZDVA 2MBQA 3NVZA 2WDRB 2KVRA 4MDKE 2KXJA 1N5XA 3Q3JA 3R2IA 5G5GA 3KUCB 2B3AA 5DCNA 1UH6A 1SSNA 2K0PA 1WM3A 2CKHB 1WFYA 1WRIA 5BMIA 4TUUA 4ZHPA 2R2OA 2VZKD 2LVQA 1KJTA 2G9HD 1HEZE 1WZ0A 2LGIA 3UIOB 3A4SC 2BB6A 1AARA 4IWOA 1KRHA 5CHVC 4KIKB 4M02A 4P1BC 3QARA 1RLFA 2FNJB 3VHTC 2I2YA 1ZP0B 1WX8A 2FUG1 1ZXHA 4A20A 4MSQB 3VTWA 3BWUD 4NAWB 4WAFA 4P1CC 1KFYB 3V6EB 3PGEA 3TBLD 5C2TB 4IC7B 2WXNA 4F1SA 1JMLA 1N61A 5EE9A 1C77A 2ZNVB 5FK9C 2N1VA 3KUDB 4DXGA 2BGFA 1Z5SB 4ASWC 2MJDA 3CSFA 3AE5B 1F77A 3AMZA 1XLNA 3U7ZA 2D3CA 5C3JB 2CU3A 1ZGUB 1NYQA 4BKGA 2XN9C 2WXFA 3ZGZA 3NS1A 5HKHA 2LVOA 2JZ3B 4DWFA 5E6NA 3KWLA 4AJWA 3RULA 3Q8EA 1OEYA 4C4VA 3PLUA 4XWWA 4Q2JA 1I4PA 2WNMA 1Q10A 3AU4A 1FNUA 2M8SA 3NOBA 2KNBA 2MX2A 2ON8A 1FO4A 2KWVB 1PYWD 2DZMA 4LNKA 4YTNB 3OJ4B 3RNCC 1IPGA 5BYQA 1J7BA 2I1KA 4FA6A 1OEYJ 2ACZB 2WGSA 4HPMB 1FRDA 2NS5A 3SEBA 2CJOA 1J7CA 1L6VA 4IOIE 4K3CA 3QWZB 4GXBA 4I6LB 2D3GA 4K81A 2KJHB 2W9NA 1YJJA 1LO5D 2DWQA 2ZPYA 4ICVA 4HCPB 3VH3B 2HJ1A 1V2YA 3L10B 1MPEA 5EDSA 2CU1A 2C5LC 2ZNVC 3HHMA 1IP9A 1BXTA 4RF1A 1PFDA 5CX3A 4XC2A 5TR5A 1RFAA 3VR8B 1C76A 1MG4A 3PRZA 3HVDA 1XLOA 3ZQ4A 2FUHB 4YT0B 2WX1A 3CSTA 2LHEA 2WDTB 2KJRA 4OVZA 4LNOA 1OGWA 3AN1A 1P9DU 2KQ7A 1EU3A 3GZNB 2FCMA 2L8JA 3HK0A 3I9V1 4A3PA 2CR5A 1GUAB 3ZYYX 4YTPB 4RM9A 4HJGE 1ACCA 4DHZB 4G3XB 2IJ0A 4LDTD 3P4QB 1MG8A 3RD2A 4MSMB 4K7UA 3L16A 4RGNA 4X57B 3TJPA 3AE2B 3P1MA 1JQ4A 2M17A 5AEKB 2Z59B 4HROA 3DBRI 2LD9A 3OWEB 3AXCA 4BZAA 5BMHA 2JRIB 3V62A 2C7HA 1GOZA 3T9LA 2KN4A 2SEBD 3GP7A 4K7WA 4KVGB 1JRUA 2HD5B 4JGHB 4NAMA 2GBJA 2WXGA 1C9FA 4HJKA 2ICIA 3OAWA 3ML9A 1XLQA 3RNFC 4FULA 1JWSD 2DYBA 3DVNU 3ZXVA 1WI0A 1X1MA 1S3SG 3B2FA 1WR6E 4DQOC 3AEEB 4DXFA 2C7NB 2KMCA 1PGAA 5D3DA 3APDA 3AE8B 1JW9D 2VZKB 2JWZA 3ZO5B 4MGYE 3GS2A 1JALA 3AM9A 1QOBA 1UELA 1I4RA 1GB4A 3ML8A 4NNJB 2LRWA 3IHPC 4FADA 4IG7B 1FCCC 2FIDA 2FCNA 2QILA 3DHIC 1Q5WB 2DAFA 2NR2A 1VR9A 3AE6B 5LXHA 3LDZE 4W9LA 4BBNF 1MHHE 3AV8A 1ET6A 3ZJUA 1HZ6A 4MEMA 4DHZE 3JVZX 2WU2B 5DPTA 2JVCA 5FKAC 2JF5A 3BYTB 1WGDA 3C0RB 2V1YA 4LLGM 4LNNA 3P4PB 3NG0A 2IPKD 4WJPA 3AE3B 4RGTA 1L4ZB 3O65B 4ARCA 1YNTE 3H6NA 1NDDA 1HTOA 3A33B 3SU8X 2GBKA 4B6WA 3NJTA 2DBYA 3OG5A 4ZOHC 3RNGC 1V80A 2DAJA 2J7QB 4PYZA 2E3TA 3V6CB 3L08A 4L1BA 2GB1A 4B9KA 1D5ZC 2XEWA 4WJOA 4W9GA 1E8XA 3P2BA 1JWBD 2RSUA 5AZGA 2J0MA 3NZSA 1DOYA 3VR9B 2KFKA 4KGSA 1RFKA 1V5TA 2QSDA 1ZW7A 4MELA 5HG2A 2D2QA 3VTUA 4ZRJA 1F9JA 5BO4B 5IN7A 5J17A 3H9DA 3VFKA 5EE0A 1TZOA 1IYFA 3RZFA 1E9MA 3P63A 1XEEA 3AE7B 4L23A 2KTRB 5T8IA 2MLBA 3ZJVA 2J4XA 1UGJA 2K8BA 1IBXA 3ZDMC 4M01A 3GE8C 2KACA 1N62A 1WRDB 2N7DA 3V3XA 3VRBB 1J19A 1WF9A 1WXVA 2BW2A 1WJ6A 2WXKA 1NI2A 4WWOA 3URYA 3ZRCA 1UGMA 5DPSA 1E0ZA 2J0KA 3J9CA 2JU6X 4ZYNA 1C4CA 3K9OB 2K9XA 5D3IB 2KLCA 2FCSA 1FEHA 1HE8A 2NPTA 1XCTL 1M94A 2PLPA 2KQ4X 4II2B 3Q3NC 2LGYA 3L54A 5LLIA 1EWYC 2KMAA 3A9KB 1YOVB 3QC8B 4PK1A 3HUIA 3M3JA 4RCOA 3TSSA 4FJVB 3H7PA 1DGJA 3V60A 4LDTB 1YJIA 1JWMD 4PYUA 4KKIA 3AEGB 3CIRB 3KYDD 2D3AA 3TMPB 2J42A 2GBMA 4ICUA 4XWTA 3RT3B 3HM6X 5J18A 3BVGA 4KDIC 4C7ZA 4E3CA 2ZW0A 1T6BX 1SF0A 3W1YA 4HLEA 4J3OD 2KDBA 3PRMB 1V6EA 3QAQA 2K6QA 1Y8RC 2O2VB 1GC6A 2L7RA 2PVGC 3ENEA 3PZDA 5AUKA 4GU2A 2MRPA 3W5VB 3ZRFA 1HA5A 4RNAA 2PW9A 2AWTA 2MBEA 1E8ZA 1V1PA 2PEAA 2UU7A 4C4VB 4EZKA 4JX1C 1OQYA 2REXA 2KWCA 1I35A 4LTUA 3NZ3A 1EUVB 3H8HA 1P3QU 1ROEA 4BFRA 3PPAA 1SEBD 3DHGC 2L05A 3KH0A 3R8BA 1P7EA 3QK0A 2WXLA 3EFUA 2V4LA 3TEYA 1RYJA 4WIPA 2YEPF 1QOFA 2ZJDA 4I6NB 4ANVA 2EMSA 3Q69A 4GDLB 4KGTA 3R3MA 3U30A 4HRSA 4CO7A 4ACFA 2JUOA 3AE1B 1NEKB 3DOWA 2GMIC 2LVPA 1E7VA 1YIWA 4EZLA 5J2RA 4WURA 4LCDE 1GAQB 2WXOA 2IO1B 3NVWA 2K5PA 1TS5A 1TBEA 2L0TA 4USAA 4IM0A 2KLGA 4BOSC 3DVGX 2BKFA 1WXSA 2NVUI 3L0WB 4FHKA 3Q8FA 2HDEA 2V9HA 3RNAC 1F52A 5LXIB 4C80A 4JQWC 3KQ4A 5JHAA 2N9XA 4FHJA 1QF6A 2OHFA 3VAWA 4W9IA 2IO0B 2LWPA 3PSEB 4N9F4 2BWES 2XK5B 2LGSA 1V81A 2JYEA 2LJ5A 2BYTA 4WWPA 1UBQA 1AWDA 2DZJA 2RGFA 3MP9A 3N1XC 1DOIA 3UQBA 2JRHA 3MTNB 5JH5C 2C9WB 2QEJC 3ZNID 5HHDG 3VRAB 4W9JA 4IW0A 2L3ZA 2N9LA 3SD5A 3UGBB 1WGHA 1ZE3D 2BF8B 2IDYA 4DXAB 2RR9A 2BYEA 1NI3A 1E8WA 1XQQA 5E6PA 1RWSA 2DLBA 2K1FA 1SIJA 3MFGA 3IAS1 1Y56A 1ZDVA 1E7UA 1WMHB 2DNFA 4HKQA 2N9KA 4OVUA 3DCGA 1L7YA 1P7FA 2X8XX 1D6EC 2LRUA 1WYGA 2VH2A 3KUZA 2N9EB 4A90A 5GMVA 2Q5WD 4DDGD 5BYSA 1VZ8A 1XD3B 1YX5B 3Q8CA 1PGXA 2K8HA 4MJSB 2KFJA 4GN1A 1EM7A 2MJEA 1TKEA 2Y5PA 3E56A 2AL6A 4O1NA 2KN5A 3PVLA 4RFBA 3DDCB 1NBFC 1EO6A 3PO0A 2KTFA 4MM3B 4TSSA 3PLVA 3B1LX 3A9JA 2KDFB 2O6VD 5LNK1 2IY0B 2J0JA 4EKUA 4OZCA 3ZDTA 1MHXA 4BKSA 5KHOA 1IGCA 1UNSA 4GDKA 4RGOS 1E7PB 1SBBB 3AE9B 3IT6B 1YN3A 3X0WA 2TSSA 4M00A 2DHZA 5L95C 1WGYA 4NJ7A 1WGRA 4HVBA 4A8XC 2IY1B 4NPNA 2KANA 2WLBA 1TKYA 3X23A 3T3OA 2NTTA 1TS2A 3KW5B 4HCNB 1VRAB 3E9SA 3CWIA 3ZJTA 1I7HA 3U8ZA 4RMAA 2MA9B 3DVNV 3PS6A 1R7SA 2M19A 4GSWA 5H8YE 4HK2A 3AB5A 4WWMA 3Q3FA 2DZKA 1WM2A 3L4PA 3N32A 4XDDA 5EE3A 4RM8A 3CF6E 5G5HA 4KGRA 4K3BA 1L2NA 3PZ7A 1V9JA 1QKZA 2WXHA 3ABVB 2MHJA 3UIPB 3EC8A 2KC1A 5D7GA 4JL9A 2AQ2B 2MSED 2OJRA 1JRPA 3TEZA 2JXXA 4GB9A 1T5XD 3BVZA 2FIFA 4OVVA 2NMQA 3I3TB 1XO3A 3W5UB 2LGDA 1GNUA 3QJZA 2KYWA 2ZCCA 3FILA 1J0GA 3BINA 4FLHA 5DPRA 1DYQA 2IO3B 1VCBA 2JXTA 3Q14C 2C7MB 3PV1A 3TEWA 1E10A 3V61A 3ZNZB 3PZ8A 1SE9A 3AECB 4NAWA 3PHXB 3PT2B 3WA0A 1CZPA 4US9A 4RF0A 5C23A 4NQLB 4TQ1A 1JROA 1OQQA 2CHZA 2V3SA 3WANA 4E71A 2H88B 3SR6A 3RPFC 4REZA 2KO3A 1WE6A 3CMMB 2AYOB 3GOEA 3JSVB 2PE9A 4WQMA 1EU4A 1YN5A 3ZTCA 3GB1A 1I4QA 2NCNA 2K39A 3MC8A 1FXIA 3PTFC 4MH8A 3ZIMA 3P4RB 3IG3A 3BY4B 3VUYA 3W2DA 4EUTA 1K53A 2W55A 1CJEA 4MH0E 4BBNC 2IYDB 2D5GA 3BK1A 3DBHI 3ZNHB 1SJED 1R4NI 1FCLA 1V8CA 4F7ZA 2L0FA 2LMCA 2WYQA 3VDZA 2KX3A 1KH0A 3HRDD 2PTLA 4XE0A 1Z2MA 2VRRB 2BPSA 4IDIA 1UWXA 2GBNA 1YQBA 4TQ0A 2DYOA 2N4FA 1M4VA 3OLMD 4OZBA 4OZAA 3N9YC 2JWUA 1GJZA 3SFDB 3NS8A 3ZVVA 1FD6A 3R7RA 1SE3A 1T0RC 2KC2A 1QILA 1WX7A 1I4HA 1T0YA 3R66C 3HM3A 4W9CA 3AEDB 4G11A 3NUHB 2N0SB 3VQIA 1I4XA 2LJIA 4CQNA 4A55A 1WH3A 2BS3B 3C19A 5KHQA 3ZUNA 1WIAA 1QOGA 2Z0DB 4EEWA 4EE2A 1GPXA 5AZFA 4DBGA 3WCQA 4TKNA 2RDBC 1E8YA 2O6VB 4ITKA 2JSVX 4RGMA 5CHFA 4YSYB 3AU5A 2M1MA 3HVZA 3LB8C 2QHOA 1WJNA 5IOIA 2N9PC 1TY0A 1V1OA 3EFCA 2KKCA 4KX6B 2G3QB 1I4GA 1VZ6A 2MP2B 4QAYA 2NBUA 4M0WA 3IBEA 2MJ3A 2K22A 2C60A 3QA8A 4NY0A 2KAJA 1FNVA 2L1AA 2WS3B 3MC9A 2QDFA 3UF8A 3WALA 4AOFA 2MH7A 4ZYSA 3T3NA 4PT5A 1N6ZA 1SGHA 5MPOA 2LXCA 3ZKJC 4N58A 1XF5L 1OQRA 3PRPB 5IAAC 2FBWB 3C8YA 2MQJA 2RD0A 4W9EA 2W54A 2V3PA 3N1YC 2YEPB 2A4ZA 2E6XA 3K9PB 1V86A 4HEA1 1T3QA 3MJ5A 1MVKA 3PREA 1IUEA 1UF0A 2ONQA 3NY5A 1ZKHA 2VH1A 2R61A 2CJNA 2AX5A 3TUOA 3W1SC 2CS4A 3DBRB 1C4PA 2Y3AA 1QLBB 1ZOYB 1YQ3B 1DOXA 3DWGC 3QIJA 1UWMA 3UINB 4YTMB 2PIAA 4HDOA 2N7EA 2QJLA 4WH4A 2Y5CA 2Z8LA 4HDQA 1ET9A 3VUWA 2G4DB 1T0SC 3KWVA 4OHJA 1WGGA 2JY6A 4H2AA 3NHEB 2INPE 3V05A 3A1QA 1EWCA 2KMMA 1FMAD 4IUMB 1KOTA 5GXGB 1FFVA 1TGZB 4GLSC 2A5UA 1CK1A 1F0ZA 4HWIB 3DWMA 2LHDA 3U4EG 1D3ZA 3VH4B 4ZRPA 1PUTA 2KWDA 2R2QA
chains in the Genus database with same CATH topology
3RNFC 4P1CC 3Q3NC 2INCC 3RNCC 3Q3MC 3RMKC 3N1ZC 2INDC 3RNEC 3Q2AC 3DHHC 3DHIC 3N1XC 1T0RC 4P1BC 3Q14C 3RNAC 3RI7C 3RNGC 3N20C 3RNBC 3DHGC 1T0SC 3RN9C 3I5JC 3GE8C 1T0QC 3GE3C 3N1YC 2RDBC 3Q3OC 3I63C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNF C;  4P1C C;  3Q3N C;  2INC C;  3RNC C;  3Q3M C;  3RMK C;  3N1Z C;  2IND C;  3RNE C;  3Q2A C;  3DHH C;  3DHI C;  3N1X C;  1T0R C;  4P1B C;  3Q14 C;  3RNA C;  3RI7 C;  3RNG C;  3N20 C;  3RNB C;  3DHG C;  1T0S C;  3RN9 C;  3I5J C;  3GE8 C;  1T0Q C;  3GE3 C;  3N1Y C;  2RDB C;  3Q3O C;  3I63 C; 
#chains in the Genus database with same CATH topology
 2RDG A;  2NBW B;  1L6U A;  4UDU C;  4IM2 A;  1C4A A;  2I38 A;  2WXI A;  1BML C;  2INN E;  4FBJ B;  1NEN B;  2YLM A;  1R4N B;  2MW5 A;  1R4M I;  4JE3 B;  2DEN B;  2LUM A;  2Y5B B;  2PVO D;  4P16 A;  4DK5 A;  2MBB B;  1LM8 B;  4W9K A;  2FAZ A;  1PQS A;  3FKY A;  1HZ5 A;  1LQB A;  4XGA B;  5JXV A;  1MI0 A;  3KYC D;  1SE2 A;  1OTR B;  4F8C B;  1STE A;  1C3T A;  1YQ4 B;  2ZVN A;  3A4R A;  2AQ3 B;  2CHX A;  1WX9 A;  4WJQ A;  2WXJ A;  1V97 A;  1XCQ L;  1WXQ A;  3JYU A;  4RH6 A;  1EF5 A;  3B08 A;  3GZN I;  4FJY A;  3AEF B;  2L32 A;  5CTR C;  2V4I B;  5IO9 A;  3EEC A;  1J7A A;  4BAX A;  1A70 A;  2QIE B;  2QC8 A;  2LAS A;  3RUI B;  2BQQ A;  4S0R A;  2LUE A;  3PHW B;  2KTR A;  4XDC A;  3T8M A;  4C56 C;  4AWJ A;  5BMG A;  1UZX B;  4WWN A;  4GIV A;  1FRR A;  2CHW A;  2AL3 A;  1V5O A;  2W3S A;  3NRZ A;  2PJH A;  2ZCB A;  2PPH A;  4TV3 A;  4YWG G;  1FXT B;  3N1Z C;  5HFY A;  1L5P A;  2D10 A;  4A9A A;  3WIM A;  3APF A;  3QX1 A;  3R2T A;  3ZLZ A;  5D94 A;  5IA7 A;  2LZ6 A;  1MFW A;  2KWU B;  2JT4 B;  3H1U A;  1YD8 U;  2HTM E;  4W9H A;  1Q1O A;  2NTS A;  1F2R I;  4K1R B;  2MWS B;  3FIL B;  4M8M A;  1AYF A;  5D2M B;  1JCK B;  1YX6 B;  3A9K A;  2PMV A;  2GOW A;  1E90 A;  1K8R B;  2WDQ B;  1QQR A;  3IFW B;  4LJP B;  3S2A A;  3TIX A;  2OOB B;  1KLU D;  2LFI A;  3EA6 A;  1VJK A;  4AJY B;  2I1J A;  2JZP A;  2DYM A;  3RNB C;  3RYT A;  1AW7 A;  4TMA B;  3RN9 C;  1PDX A;  1D4B A;  3SHQ A;  2BKR B;  2QCZ A;  2UWQ A;  3BZD B;  2GRI A;  2O2V A;  4ZHO A;  1L0Y B;  3AI5 A;  1WJU A;  4IM3 A;  4N6E B;  1C1Y B;  3BII D;  1AN8 A;  2MBH A;  3ALB A;  1ZDX A;  4B0M A;  1UBI A;  2NBV B;  2WXQ A;  3D32 A;  1YMH E;  4DDI D;  2V3N A;  5E6J A;  2ASQ A;  1VDV A;  5H92 C;  1SJH D;  2EKI A;  3EHV A;  1H4R A;  1TYG B;  1VD2 A;  2ZPN A;  1TKG A;  4ZRK A;  4ANX A;  4JLC A;  3GE3 C;  1PGB A;  1B9R A;  2LI5 A;  2OED A;  3KVF B;  3DVG Y;  1EF1 A;  1JWA D;  3M95 A;  4B0E A;  2BYV E;  2W3R A;  5CHW A;  3VXW A;  3B0A A;  5I4D A;  2MEK A;  4GDL A;  2ZZP B;  1P1A A;  4HPL B;  3BVM A;  3Q6B A;  4HXD A;  3VUX A;  5FR3 A;  3N3K B;  4HKZ E;  1B1Z A;  3FAH A;  1R4M B;  2G4S A;  3WAM A;  2KFK B;  2KJ6 A;  2M0A A;  1BUI C;  3AEB B;  2BB5 A;  4AQ7 A;  1G6J A;  1FPY A;  1SE4 A;  1SXT A;  2RDH A;  2LGX A;  2D07 B;  4GOC A;  3AEA B;  3LYY A;  4MGI E;  4ZRQ A;  4A6Q A;  4KZC A;  4OW0 A;  3I57 A;  3ETR A;  1ISN A;  2KZR A;  2W82 A;  1WXM A;  2WU5 B;  4W9F A;  2IGG A;  4KKJ A;  2D11 A;  1RM6 C;  2WHI A;  2DZI A;  1SIF A;  3MJW A;  1FIQ A;  2K6D B;  2BWF A;  3Q3O C;  5FR6 A;  1XT9 B;  2KX0 A;  3RMK C;  2XK5 A;  2N1W A;  4GGQ A;  5AZH A;  5TSS A;  1QOA A;  3DBL I;  3DHH C;  2IGD A;  3SDL C;  2UYZ B;  4M0W B;  1IBX B;  2GI9 A;  4KIK A;  2BT6 A;  3U52 E;  2RPV A;  4NQK E;  3MC0 B;  3Q8B A;  2K8C A;  1H8C A;  3UI3 A;  1TS4 A;  2IND C;  2IZV B;  1KTK A;  4NJ6 A;  3TCA A;  4US8 A;  4NJC A;  4N59 A;  3N30 A;  2ZW1 A;  4DHJ D;  2NPT B;  2J53 A;  1MJD A;  3NVV A;  4BVU C;  1WMH A;  4IWQ A;  1L4D B;  1CQV A;  3H7S A;  3RNE C;  1NYR A;  3Q2A C;  3BYY B;  1NVI D;  3VTV A;  1RRB A;  2WXP A;  1ZUD 2;  4IWP A;  3H7P B;  3R7Q A;  5JZE B;  1ENF A;  4JPS A;  2WXM A;  2BBC A;  2SAK A;  2WQY B;  4MGZ E;  4BKS D;  5JHB A;  1P0R A;  1WE7 A;  2RMM A;  1L0X B;  1YN4 A;  4MJS A;  2HE7 A;  4CYE A;  4EFO A;  4YSZ B;  2OJW A;  4LNI A;  3BK2 A;  3B2G A;  4MT5 A;  2JYT A;  1OFF A;  2N7J A;  3P4S B;  2AQ1 B;  3I5J C;  4MM3 A;  1V49 A;  2JZZ A;  4S17 A;  3A1Q B;  3LXF A;  3W9C B;  3QCA A;  5HI1 A;  5C1Z A;  3QQ8 B;  3OJ3 A;  3LJ3 A;  1A5R A;  2IBI B;  2PKO A;  4KV2 A;  2HJ8 A;  2L00 B;  4P6V F;  2GLS A;  1TS3 A;  4WJN A;  1FFU A;  1KLG D;  5IP4 D;  1GG3 A;  1L0V B;  4BKT A;  1HXY D;  2L76 A;  1V1P B;  2H89 B;  1K52 A;  2LEK A;  1BT0 A;  3SFE B;  1E6E B;  2FCQ A;  2KOX A;  3JW0 X;  2EEL A;  2BTE A;  4PS8 A;  4M8N A;  3IAM 1;  2MCN B;  3WAP A;  2LXA A;  2QMT A;  2KT7 A;  2GBR A;  2PE6 B;  1WGK A;  3DPD A;  3TL5 A;  2ZEQ A;  2BYF A;  4MAC A;  1WR1 A;  1FM0 D;  1KF6 B;  4LJO B;  1WXA A;  4KSL C;  1TTN A;  4KDL B;  3ECI A;  2BS4 B;  4J6I A;  2L52 A;  2ZVO A;  1F2R C;  1KM7 A;  1WJ4 A;  3L13 A;  3AE4 B;  3RCZ A;  2D3B A;  5BYR A;  2KDE B;  4JWU C;  1Q0W B;  4W9D A;  3NVY A;  1D5X C;  2BVC A;  2YVC A;  4AUQ C;  2WX0 A;  5DPW A;  1TY2 A;  2JPH A;  4R3D A;  4EZJ A;  1U4A A;  4CHK A;  1WSP A;  4YL8 A;  2KK8 A;  2IO2 B;  1SB3 C;  1LFD A;  1T0Q C;  1QT9 A;  1C79 A;  2KDI A;  4PS7 A;  3M62 B;  1N60 A;  3AUL A;  4ARI A;  2INC C;  1VLB A;  2EKE C;  4LK0 M;  4JIO U;  1RAX A;  5EE1 A;  3UQA A;  1E5W A;  1ZPS A;  3NZU A;  2J52 A;  3TEX A;  5AUI A;  4URK A;  2DX5 B;  1XLP A;  3M63 B;  4I6P A;  3ZW3 A;  1YJ1 A;  1LGR A;  4ANW A;  4FJZ A;  4II3 B;  3DBL B;  4PS3 A;  1ZXI A;  4GMV A;  4L2Y A;  1LXD A;  1IGD A;  1WWT A;  4KSK C;  4LNF A;  3Q3M C;  1WZ3 A;  2M4N A;  1C78 A;  1UUP A;  3L17 A;  3JSV A;  4G0N B;  1GC7 A;  1TT5 B;  1FXA A;  3EUB 2;  3VVW B;  3MHZ A;  3IXS A;  4JWS C;  2JX5 A;  2B76 B;  1GB1 A;  2AEH A;  4EOY A;  3ONS A;  1HTQ A;  1TJE A;  1ESF A;  2BS2 B;  3FC4 A;  1TIF A;  4XX5 A;  2MBO A;  5E6O A;  3IT4 B;  4AS1 A;  1WY8 A;  2K25 A;  1VZ7 A;  3DQV A;  4K7S A;  4XZ4 A;  3ZXR A;  4C7Y A;  2FE8 A;  5L83 A;  1XXG A;  4HPP A;  1UD7 A;  1K51 A;  4A3O A;  4FN2 A;  1HQR D;  1N5W A;  3KLS X;  4YXD B;  3IVF A;  3RI7 C;  2G1E A;  3APC A;  4AP4 C;  4WQO B;  4ZRI A;  5IKC M;  4DHJ B;  4KZ0 A;  4MGK E;  4NZL B;  3I63 C;  4G50 A;  3EGR A;  1WYW B;  2KHW B;  3MHS D;  3RZW C;  3Q8A A;  3HIZ A;  4IKG A;  3U7D A;  2M56 B;  3QHT A;  3DBH B;  5G55 A;  2V0G A;  4FXC A;  1K50 A;  3ZTD A;  2EMT A;  3B9J A;  2HTH A;  3AH7 A;  3W1S A;  2RPQ A;  2Z0E B;  3A9J B;  2X38 A;  5D6J B;  4D2K A;  2KQS A;  1P98 A;  4E74 A;  2KVZ A;  2M0X A;  4C00 A;  2WDV B;  1I42 A;  4GDK B;  1F1H A;  3U2S C;  2KDM A;  2XBB C;  3RFZ B;  1D5M C;  2WWZ A;  1QZE A;  4B95 A;  2JQR B;  4P7I A;  3P42 A;  5G2N A;  1FNW A;  2WXR A;  1CMX B;  2WP9 B;  2XNA C;  1TZ1 A;  2G45 B;  3O13 A;  1N63 A;  1KLV A;  2O6V A;  2IGH A;  1JWU D;  4YSX B;  2L83 A;  4ANU A;  2K3U A;  1S1Q B;  3DBS A;  3WAO A;  4XYC A;  4BOZ B;  4WAA A;  2MP2 A;  3N20 C;  2KD0 A;  1J8C A;  3ZNG C;  4ZDV A;  2MBQ A;  3NVZ A;  2WDR B;  2KVR A;  4MDK E;  2KXJ A;  1N5X A;  3Q3J A;  3R2I A;  5G5G A;  3KUC B;  2B3A A;  5DCN A;  1UH6 A;  1SSN A;  2K0P A;  1WM3 A;  2CKH B;  1WFY A;  1WRI A;  5BMI A;  4TUU A;  4ZHP A;  2R2O A;  2VZK D;  2LVQ A;  1KJT A;  2G9H D;  1HEZ E;  1WZ0 A;  2LGI A;  3UIO B;  3A4S C;  2BB6 A;  1AAR A;  4IWO A;  1KRH A;  5CHV C;  4KIK B;  4M02 A;  4P1B C;  3QAR A;  1RLF A;  2FNJ B;  3VHT C;  2I2Y A;  1ZP0 B;  1WX8 A;  2FUG 1;  1ZXH A;  4A20 A;  4MSQ B;  3VTW A;  3BWU D;  4NAW B;  4WAF A;  4P1C C;  1KFY B;  3V6E B;  3PGE A;  3TBL D;  5C2T B;  4IC7 B;  2WXN A;  4F1S A;  1JML A;  1N61 A;  5EE9 A;  1C77 A;  2ZNV B;  5FK9 C;  2N1V A;  3KUD B;  4DXG A;  2BGF A;  1Z5S B;  4ASW C;  2MJD A;  3CSF A;  3AE5 B;  1F77 A;  3AMZ A;  1XLN A;  3U7Z A;  2D3C A;  5C3J B;  2CU3 A;  1ZGU B;  1NYQ A;  4BKG A;  2XN9 C;  2WXF A;  3ZGZ A;  3NS1 A;  5HKH A;  2LVO A;  2JZ3 B;  4DWF A;  5E6N A;  3KWL A;  4AJW A;  3RUL A;  3Q8E A;  1OEY A;  4C4V A;  3PLU A;  4XWW A;  4Q2J A;  1I4P A;  2WNM A;  1Q10 A;  3AU4 A;  1FNU A;  2M8S A;  3NOB A;  2KNB A;  2MX2 A;  2ON8 A;  1FO4 A;  2KWV B;  1PYW D;  2DZM A;  4LNK A;  4YTN B;  3OJ4 B;  3RNC C;  1IPG A;  5BYQ A;  1J7B A;  2I1K A;  4FA6 A;  1OEY J;  2ACZ B;  2WGS A;  4HPM B;  1FRD A;  2NS5 A;  3SEB A;  2CJO A;  1J7C A;  1L6V A;  4IOI E;  4K3C A;  3QWZ B;  4GXB A;  4I6L B;  2D3G A;  4K81 A;  2KJH B;  2W9N A;  1YJJ A;  1LO5 D;  2DWQ A;  2ZPY A;  4ICV A;  4HCP B;  3VH3 B;  2HJ1 A;  1V2Y A;  3L10 B;  1MPE A;  5EDS A;  2CU1 A;  2C5L C;  2ZNV C;  3HHM A;  1IP9 A;  1BXT A;  4RF1 A;  1PFD A;  5CX3 A;  4XC2 A;  5TR5 A;  1RFA A;  3VR8 B;  1C76 A;  1MG4 A;  3PRZ A;  3HVD A;  1XLO A;  3ZQ4 A;  2FUH B;  4YT0 B;  2WX1 A;  3CST A;  2LHE A;  2WDT B;  2KJR A;  4OVZ A;  4LNO A;  1OGW A;  3AN1 A;  1P9D U;  2KQ7 A;  1EU3 A;  3GZN B;  2FCM A;  2L8J A;  3HK0 A;  3I9V 1;  4A3P A;  2CR5 A;  1GUA B;  3ZYY X;  4YTP B;  4RM9 A;  4HJG E;  1ACC A;  4DHZ B;  4G3X B;  2IJ0 A;  4LDT D;  3P4Q B;  1MG8 A;  3RD2 A;  4MSM B;  4K7U A;  3L16 A;  4RGN A;  4X57 B;  3TJP A;  3AE2 B;  3P1M A;  1JQ4 A;  2M17 A;  5AEK B;  2Z59 B;  4HRO A;  3DBR I;  2LD9 A;  3OWE B;  3AXC A;  4BZA A;  5BMH A;  2JRI B;  3V62 A;  2C7H A;  1GOZ A;  3T9L A;  2KN4 A;  2SEB D;  3GP7 A;  4K7W A;  4KVG B;  1JRU A;  2HD5 B;  4JGH B;  4NAM A;  2GBJ A;  2WXG A;  1C9F A;  4HJK A;  2ICI A;  3OAW A;  3ML9 A;  1XLQ A;  3RNF C;  4FUL A;  1JWS D;  2DYB A;  3DVN U;  3ZXV A;  1WI0 A;  1X1M A;  1S3S G;  3B2F A;  1WR6 E;  4DQO C;  3AEE B;  4DXF A;  2C7N B;  2KMC A;  1PGA A;  5D3D A;  3APD A;  3AE8 B;  1JW9 D;  2VZK B;  2JWZ A;  3ZO5 B;  4MGY E;  3GS2 A;  1JAL A;  3AM9 A;  1QOB A;  1UEL A;  1I4R A;  1GB4 A;  3ML8 A;  4NNJ B;  2LRW A;  3IHP C;  4FAD A;  4IG7 B;  1FCC C;  2FID A;  2FCN A;  2QIL A;  3DHI C;  1Q5W B;  2DAF A;  2NR2 A;  1VR9 A;  3AE6 B;  5LXH A;  3LDZ E;  4W9L A;  4BBN F;  1MHH E;  3AV8 A;  1ET6 A;  3ZJU A;  1HZ6 A;  4MEM A;  4DHZ E;  3JVZ X;  2WU2 B;  5DPT A;  2JVC A;  5FKA C;  2JF5 A;  3BYT B;  1WGD A;  3C0R B;  2V1Y A;  4LLG M;  4LNN A;  3P4P B;  3NG0 A;  2IPK D;  4WJP A;  3AE3 B;  4RGT A;  1L4Z B;  3O65 B;  4ARC A;  1YNT E;  3H6N A;  1NDD A;  1HTO A;  3A33 B;  3SU8 X;  2GBK A;  4B6W A;  3NJT A;  2DBY A;  3OG5 A;  4ZOH C;  3RNG C;  1V80 A;  2DAJ A;  2J7Q B;  4PYZ A;  2E3T A;  3V6C B;  3L08 A;  4L1B A;  2GB1 A;  4B9K A;  1D5Z C;  2XEW A;  4WJO A;  4W9G A;  1E8X A;  3P2B A;  1JWB D;  2RSU A;  5AZG A;  2J0M A;  3NZS A;  1DOY A;  3VR9 B;  2KFK A;  4KGS A;  1RFK A;  1V5T A;  2QSD A;  1ZW7 A;  4MEL A;  5HG2 A;  2D2Q A;  3VTU A;  4ZRJ A;  1F9J A;  5BO4 B;  5IN7 A;  5J17 A;  3H9D A;  3VFK A;  5EE0 A;  1TZO A;  1IYF A;  3RZF A;  1E9M A;  3P63 A;  1XEE A;  3AE7 B;  4L23 A;  2KTR B;  5T8I A;  2MLB A;  3ZJV A;  2J4X A;  1UGJ A;  2K8B A;  1IBX A;  3ZDM C;  4M01 A;  3GE8 C;  2KAC A;  1N62 A;  1WRD B;  2N7D A;  3V3X A;  3VRB B;  1J19 A;  1WF9 A;  1WXV A;  2BW2 A;  1WJ6 A;  2WXK A;  1NI2 A;  4WWO A;  3URY A;  3ZRC A;  1UGM A;  5DPS A;  1E0Z A;  2J0K A;  3J9C A;  2JU6 X;  4ZYN A;  1C4C A;  3K9O B;  2K9X A;  5D3I B;  2KLC A;  2FCS A;  1FEH A;  1HE8 A;  2NPT A;  1XCT L;  1M94 A;  2PLP A;  2KQ4 X;  4II2 B;  3Q3N C;  2LGY A;  3L54 A;  5LLI A;  1EWY C;  2KMA A;  3A9K B;  1YOV B;  3QC8 B;  4PK1 A;  3HUI A;  3M3J A;  4RCO A;  3TSS A;  4FJV B;  3H7P A;  1DGJ A;  3V60 A;  4LDT B;  1YJI A;  1JWM D;  4PYU A;  4KKI A;  3AEG B;  3CIR B;  3KYD D;  2D3A A;  3TMP B;  2J42 A;  2GBM A;  4ICU A;  4XWT A;  3RT3 B;  3HM6 X;  5J18 A;  3BVG A;  4KDI C;  4C7Z A;  4E3C A;  2ZW0 A;  1T6B X;  1SF0 A;  3W1Y A;  4HLE A;  4J3O D;  2KDB A;  3PRM B;  1V6E A;  3QAQ A;  2K6Q A;  1Y8R C;  2O2V B;  1GC6 A;  2L7R A;  2PVG C;  3ENE A;  3PZD A;  5AUK A;  4GU2 A;  2MRP A;  3W5V B;  3ZRF A;  1HA5 A;  4RNA A;  2PW9 A;  2AWT A;  2MBE A;  1E8Z A;  1V1P A;  2PEA A;  2UU7 A;  4C4V B;  4EZK A;  4JX1 C;  1OQY A;  2REX A;  2KWC A;  1I35 A;  4LTU A;  3NZ3 A;  1EUV B;  3H8H A;  1P3Q U;  1ROE A;  4BFR A;  3PPA A;  1SEB D;  3DHG C;  2L05 A;  3KH0 A;  3R8B A;  1P7E A;  3QK0 A;  2WXL A;  3EFU A;  2V4L A;  3TEY A;  1RYJ A;  4WIP A;  2YEP F;  1QOF A;  2ZJD A;  4I6N B;  4ANV A;  2EMS A;  3Q69 A;  4GDL B;  4KGT A;  3R3M A;  3U30 A;  4HRS A;  4CO7 A;  4ACF A;  2JUO A;  3AE1 B;  1NEK B;  3DOW A;  2GMI C;  2LVP A;  1E7V A;  1YIW A;  4EZL A;  5J2R A;  4WUR A;  4LCD E;  1GAQ B;  2WXO A;  2IO1 B;  3NVW A;  2K5P A;  1TS5 A;  1TBE A;  2L0T A;  4USA A;  4IM0 A;  2KLG A;  4BOS C;  3DVG X;  2BKF A;  1WXS A;  2NVU I;  3L0W B;  4FHK A;  3Q8F A;  2HDE A;  2V9H A;  3RNA C;  1F52 A;  5LXI B;  4C80 A;  4JQW C;  3KQ4 A;  5JHA A;  2N9X A;  4FHJ A;  1QF6 A;  2OHF A;  3VAW A;  4W9I A;  2IO0 B;  2LWP A;  3PSE B;  4N9F 4;  2BWE S;  2XK5 B;  2LGS A;  1V81 A;  2JYE A;  2LJ5 A;  2BYT A;  4WWP A;  1UBQ A;  1AWD A;  2DZJ A;  2RGF A;  3MP9 A;  3N1X C;  1DOI A;  3UQB A;  2JRH A;  3MTN B;  5JH5 C;  2C9W B;  2QEJ C;  3ZNI D;  5HHD G;  3VRA B;  4W9J A;  4IW0 A;  2L3Z A;  2N9L A;  3SD5 A;  3UGB B;  1WGH A;  1ZE3 D;  2BF8 B;  2IDY A;  4DXA B;  2RR9 A;  2BYE A;  1NI3 A;  1E8W A;  1XQQ A;  5E6P A;  1RWS A;  2DLB A;  2K1F A;  1SIJ A;  3MFG A;  3IAS 1;  1Y56 A;  1ZDV A;  1E7U A;  1WMH B;  2DNF A;  4HKQ A;  2N9K A;  4OVU A;  3DCG A;  1L7Y A;  1P7F A;  2X8X X;  1D6E C;  2LRU A;  1WYG A;  2VH2 A;  3KUZ A;  2N9E B;  4A90 A;  5GMV A;  2Q5W D;  4DDG D;  5BYS A;  1VZ8 A;  1XD3 B;  1YX5 B;  3Q8C A;  1PGX A;  2K8H A;  4MJS B;  2KFJ A;  4GN1 A;  1EM7 A;  2MJE A;  1TKE A;  2Y5P A;  3E56 A;  2AL6 A;  4O1N A;  2KN5 A;  3PVL A;  4RFB A;  3DDC B;  1NBF C;  1EO6 A;  3PO0 A;  2KTF A;  4MM3 B;  4TSS A;  3PLV A;  3B1L X;  3A9J A;  2KDF B;  2O6V D;  5LNK 1;  2IY0 B;  2J0J A;  4EKU A;  4OZC A;  3ZDT A;  1MHX A;  4BKS A;  5KHO A;  1IGC A;  1UNS A;  4GDK A;  4RGO S;  1E7P B;  1SBB B;  3AE9 B;  3IT6 B;  1YN3 A;  3X0W A;  2TSS A;  4M00 A;  2DHZ A;  5L95 C;  1WGY A;  4NJ7 A;  1WGR A;  4HVB A;  4A8X C;  2IY1 B;  4NPN A;  2KAN A;  2WLB A;  1TKY A;  3X23 A;  3T3O A;  2NTT A;  1TS2 A;  3KW5 B;  4HCN B;  1VRA B;  3E9S A;  3CWI A;  3ZJT A;  1I7H A;  3U8Z A;  4RMA A;  2MA9 B;  3DVN V;  3PS6 A;  1R7S A;  2M19 A;  4GSW A;  5H8Y E;  4HK2 A;  3AB5 A;  4WWM A;  3Q3F A;  2DZK A;  1WM2 A;  3L4P A;  3N32 A;  4XDD A;  5EE3 A;  4RM8 A;  3CF6 E;  5G5H A;  4KGR A;  4K3B A;  1L2N A;  3PZ7 A;  1V9J A;  1QKZ A;  2WXH A;  3ABV B;  2MHJ A;  3UIP B;  3EC8 A;  2KC1 A;  5D7G A;  4JL9 A;  2AQ2 B;  2MSE D;  2OJR A;  1JRP A;  3TEZ A;  2JXX A;  4GB9 A;  1T5X D;  3BVZ A;  2FIF A;  4OVV A;  2NMQ A;  3I3T B;  1XO3 A;  3W5U B;  2LGD A;  1GNU A;  3QJZ A;  2KYW A;  2ZCC A;  3FIL A;  1J0G A;  3BIN A;  4FLH A;  5DPR A;  1DYQ A;  2IO3 B;  1VCB A;  2JXT A;  3Q14 C;  2C7M B;  3PV1 A;  3TEW A;  1E10 A;  3V61 A;  3ZNZ B;  3PZ8 A;  1SE9 A;  3AEC B;  4NAW A;  3PHX B;  3PT2 B;  3WA0 A;  1CZP A;  4US9 A;  4RF0 A;  5C23 A;  4NQL B;  4TQ1 A;  1JRO A;  1OQQ A;  2CHZ A;  2V3S A;  3WAN A;  4E71 A;  2H88 B;  3SR6 A;  3RPF C;  4REZ A;  2KO3 A;  1WE6 A;  3CMM B;  2AYO B;  3GOE A;  3JSV B;  2PE9 A;  4WQM A;  1EU4 A;  1YN5 A;  3ZTC A;  3GB1 A;  1I4Q A;  2NCN A;  2K39 A;  3MC8 A;  1FXI A;  3PTF C;  4MH8 A;  3ZIM A;  3P4R B;  3IG3 A;  3BY4 B;  3VUY A;  3W2D A;  4EUT A;  1K53 A;  2W55 A;  1CJE A;  4MH0 E;  4BBN C;  2IYD B;  2D5G A;  3BK1 A;  3DBH I;  3ZNH B;  1SJE D;  1R4N I;  1FCL A;  1V8C A;  4F7Z A;  2L0F A;  2LMC A;  2WYQ A;  3VDZ A;  2KX3 A;  1KH0 A;  3HRD D;  2PTL A;  4XE0 A;  1Z2M A;  2VRR B;  2BPS A;  4IDI A;  1UWX A;  2GBN A;  1YQB A;  4TQ0 A;  2DYO A;  2N4F A;  1M4V A;  3OLM D;  4OZB A;  4OZA A;  3N9Y C;  2JWU A;  1GJZ A;  3SFD B;  3NS8 A;  3ZVV A;  1FD6 A;  3R7R A;  1SE3 A;  1T0R C;  2KC2 A;  1QIL A;  1WX7 A;  1I4H A;  1T0Y A;  3R66 C;  3HM3 A;  4W9C A;  3AED B;  4G11 A;  3NUH B;  2N0S B;  3VQI A;  1I4X A;  2LJI A;  4CQN A;  4A55 A;  1WH3 A;  2BS3 B;  3C19 A;  5KHQ A;  3ZUN A;  1WIA A;  1QOG A;  2Z0D B;  4EEW A;  4EE2 A;  1GPX A;  5AZF A;  4DBG A;  3WCQ A;  4TKN A;  2RDB C;  1E8Y A;  2O6V B;  4ITK A;  2JSV X;  4RGM A;  5CHF A;  4YSY B;  3AU5 A;  2M1M A;  3HVZ A;  3LB8 C;  2QHO A;  1WJN A;  5IOI A;  2N9P C;  1TY0 A;  1V1O A;  3EFC A;  2KKC A;  4KX6 B;  2G3Q B;  1I4G A;  1VZ6 A;  2MP2 B;  4QAY A;  2NBU A;  4M0W A;  3IBE A;  2MJ3 A;  2K22 A;  2C60 A;  3QA8 A;  4NY0 A;  2KAJ A;  1FNV A;  2L1A A;  2WS3 B;  3MC9 A;  2QDF A;  3UF8 A;  3WAL A;  4AOF A;  2MH7 A;  4ZYS A;  3T3N A;  4PT5 A;  1N6Z A;  1SGH A;  5MPO A;  2LXC A;  3ZKJ C;  4N58 A;  1XF5 L;  1OQR A;  3PRP B;  5IAA C;  2FBW B;  3C8Y A;  2MQJ A;  2RD0 A;  4W9E A;  2W54 A;  2V3P A;  3N1Y C;  2YEP B;  2A4Z A;  2E6X A;  3K9P B;  1V86 A;  4HEA 1;  1T3Q A;  3MJ5 A;  1MVK A;  3PRE A;  1IUE A;  1UF0 A;  2ONQ A;  3NY5 A;  1ZKH A;  2VH1 A;  2R61 A;  2CJN A;  2AX5 A;  3TUO A;  3W1S C;  2CS4 A;  3DBR B;  1C4P A;  2Y3A A;  1QLB B;  1ZOY B;  1YQ3 B;  1DOX A;  3DWG C;  3QIJ A;  1UWM A;  3UIN B;  4YTM B;  2PIA A;  4HDO A;  2N7E A;  2QJL A;  4WH4 A;  2Y5C A;  2Z8L A;  4HDQ A;  1ET9 A;  3VUW A;  2G4D B;  1T0S C;  3KWV A;  4OHJ A;  1WGG A;  2JY6 A;  4H2A A;  3NHE B;  2INP E;  3V05 A;  3A1Q A;  1EWC A;  2KMM A;  1FMA D;  4IUM B;  1KOT A;  5GXG B;  1FFV A;  1TGZ B;  4GLS C;  2A5U A;  1CK1 A;  1F0Z A;  4HWI B;  3DWM A;  2LHD A;  3U4E G;  1D3Z A;  3VH4 B;  4ZRP A;  1PUT A;  2KWD A;  2R2Q A; 
#chains in the Genus database with same CATH homology
 3RNF C;  4P1C C;  3Q3N C;  2INC C;  3RNC C;  3Q3M C;  3RMK C;  3N1Z C;  2IND C;  3RNE C;  3Q2A C;  3DHH C;  3DHI C;  3N1X C;  1T0R C;  4P1B C;  3Q14 C;  3RNA C;  3RI7 C;  3RNG C;  3N20 C;  3RNB C;  3DHG C;  1T0S C;  3RN9 C;  3I5J C;  3GE8 C;  1T0Q C;  3GE3 C;  3N1Y C;  2RDB C;  3Q3O C;  3I63 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...