3Q3OC

Toluene 4 monooxygenase hd complex with phenol
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 24
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q3oC00
2INDC 3N1ZC 3N1YC 3Q2AC 3GE3C 4P1CC 3N20C 3Q3OC 2INCC 3Q14C 4P1BC 3RMKC 3I5JC 3RNFC 3DHIC 3RNAC 3GE8C 3RNEC 3N1XC 3Q3NC 3RN9C 3RNCC 3DHGC 1T0SC 3RNBC 1T0RC 3RNGC 3I63C 3RI7C 3Q3MC 3DHHC 2RDBC 1T0QC
chains in the Genus database with same CATH superfamily
2RGFA 2KMCA 4MH8A 3QHTA 1WM2A 4KDLB 2X38A 2KDEB 2OJRA 3PV1A 1TYGB 1VDVA 1GJZA 1N5XA 1V5TA 3ZLZA 3V3XA 1E8YA 1UWXA 1J0GA 4RNAA 4MJSB 1OTRB 3KUZA 5E6NA 4MACA 2GBRA 2N4FA 1ZOYB 1KRHA 1VLBA 2CU3A 3BVZA 4HPPA 4II2B 4P16A 2LUMA 3PGEA 3VTUA 2LD9A 1G6JA 2WXNA 4L1BA 3V61A 3WAOA 1VD2A 2BYVE 2LGDA 4XE0A 1VZ6A 4I6LB 4M00A 2KFJA 5H8YE 3EFUA 1E10A 3ZNID 4DK5A 4BFRA 3WALA 4EZJA 3U30A 3NOBA 2JVCA 2L32A 3N1XC 3M63B 1QOFA 2LGIA 1GC6A 4Q2JA 5C23A 4R3DA 2MBQA 1D5ZC 1JCKB 1XCQL 3HVDA 3I57A 4NQKE 1WXSA 2Z8LA 2ZVOA 3CSFA 4WQOB 2ZZPB 4J6IA 5CHWA 3WANA 1R4NB 2X8XX 3A4RA 2BYEA 2DYMA 1D6EC 1JROA 1WJ6A 2KN5A 2KWCA 2MA9B 3Q3OC 1UGMA 3AV8A 4H2AA 1LFDA 1UWMA 4OHJA 4M01A 3J9CA 3AB5A 4LNOA 3P4RB 2BT6A 4NJ7A 2K22A 4OW0A 1JWMD 3PRMB 3TMPB 4F8CB 3TBLD 3OLMD 2MHJA 1CZPA 2KNBA 2D3BA 2RPVA 2UU7A 5HKHA 3EFCA 2V3NA 3Q8EA 4LJPB 3U2SC 3EECA 3FAHA 4EUTA 5D2MB 1I7HA 2BF8B 2IZVB 3RFZB 5DPSA 5IAAC 4W9GA 1F0ZA 2JF5A 3DHHC 3NZSA 5IKCM 2JZZA 1JWBD 2C7NB 1WGYA 2N7DA 4HCPB 4ZRQA 1L0VB 1ACCA 1WY8A 2FCNA 3KH0A 2MWSB 3CF6E 3PRPB 3QARA 1HTQA 3PHXB 4N58A 1MJDA 3VH3B 1I42A 4O1NA 1T0QC 4ZHPA 2IGDA 2BB6A 1KH0A 1SIFA 4WJPA 3L13A 3U7DA 4C80A 2IYDB 3QIJA 3JW0X 3SU8X 1TY0A 3Q14C 2RPQA 2RD0A 1ZKHA 1E9MA 4AWJA 1Q1OA 3PREA 1JWUD 4HPMB 3W1YA 2BYTA 4FULA 1WRDB 3NVZA 2XNAC 4F7ZA 3NZUA 1RLFA 2N9XA 2BS2B 1EWCA 4E3CA 3N30A 4B95A 1V81A 2KTRB 1E7UA 3PTFC 3UQBA 3WIMA 4K3CA 3MTNB 1I4XA 1GB4A 1V5OA 4HJGE 4ZHOA 4MSQB 4KV2A 4KDIC 3PO0A 4MGZE 2H88B 3NHEB 4GMVA 2MBBB 2JXXA 1QLBB 5E6OA 2ASQA 3IVFA 4YSYB 1N63A 1M4VA 2ACZB 3VVWB 1ET6A 2KQSA 1V1OA 1TT5B 1AARA 4TKNA 2WXRA 1UBIA 2GB1A 3RNEC 4PS7A 2A5UA 2W9NA 1BT0A 3U8ZA 4ZOHC 2IY0B 5TSSA 4NAWA 2HJ8A 1HQRD 3DBHB 1BMLC 4P6VF 4DXAB 2J52A 1JRUA 2HD5B 2LI5A 4ARIA 3P4SB 3DWGC 3RNFC 2LUEA 4KX6B 3MC8A 4A90A 1GNUA 3DBLB 3P2BA 2KC2A 1IP9A 4GSWA 2J42A 1A70A 3W2DA 3KYCD 4IC7B 1ISNA 4NAMA 4FN2A 4YL8A 3VXWA 1BXTA 4X57B 3C8YA 2CHZA 1WGDA 2INCC 2L7RA 4DQOC 3I5JC 1DGJA 4A55A 1SJED 1KTKA 2KX0A 1TZOA 1P7EA 2K25A 2QHOA 1SSNA 4RFBA 1RFKA 1D5MC 1Q0WB 1QT9A 4NPNA 1UF0A 3B08A 2AQ3B 2IO2B 1L0YB 4IM2A 2XK5A 3VR8B 3N1YC 3BIID 3NVWA 2ZJDA 3VTVA 2D10A 2PVGC 2J0MA 1WIAA 1IUEA 1D4BA 3NS1A 3FKYA 1LGRA 1EO6A 2BBCA 1TJEA 2UYZB 4GOCA 1PUTA 4ZRKA 2BKRB 3Q3FA 2WXPA 4N59A 1FCLA 4KGSA 3O13A 4WWOA 4DHZE 1QOBA 2KYWA 1OQQA 1D3ZA 2DYOA 2PE9A 4D2KA 4HXDA 4GN1A 2V3PA 1A5RA 1WMHA 3VUWA 3AEGB 3DCGA 2NS5A 4NY0A 2KDIA 4DDGD 5TR5A 1WJ4A 2LEKA 2HE7A 3T3OA 4GLSC 2LJ5A 2D07B 4AUQC 1K50A 1NI2A 3W1SC 2V4IB 4JWUC 4LNNA 1SJHD 3AEBB 5EE1A 3S2AA 5FR6A 1IGCA 2FUHB 1V6EA 1RFAA 3P1MA 4NJCA 1SF0A 1JALA 4P7IA 3ZNGC 3BK1A 2PLPA 1WR6E 2GBJA 2DAJA 1MG8A 1QQRA 4IKGA 5DPWA 3H6NA 3ZKJC 3DBRB 3KVFB 1KOTA 1OEYJ 2FCQA 4TSSA 3PHWB 2BB5A 2N0SB 5D94A 2FIDA 5EE0A 2BWFA 4ACFA 2I38A 1PGXA 3ZQ4A 1PGBA 3QAQA 4F1SA 2KJHB 1C4AA 4W9DA 2JU6X 1E7PB 4ZRPA 4WAFA 2KWDA 1KJTA 3P4QB 3WCQA 3C19A 1CMXB 4AJWA 3IFWB 4XDCA 1TBEA 4A20A 3A9JA 1MG4A 4MM3B 3ZYYX 3B1LX 3B2FA 4M8MA 1QOGA 1H8CA 2XK5B 2JY6A 3L0WB 1V8CA 4HWIB 2LWPA 1WR1A 1HXYD 4A9AA 5J17A 1XLQA 5CX3A 1YD8U 1I4PA 1C9FA 2TSSA 3ZRFA 3DVNU 4NNJB 1J7BA 1FXIA 5IOIA 1KLGD 3PZ8A 4DBGA 3W9CB 3GP7A 3H7PB 1L7YA 3L54A 2VRRB 1FCCC 2MP2A 1V49A 3PVLA 4M8NA 5BYSA 3WAMA 2ZW0A 4FA6A 1YX5B 4RM9A 1FFUA 4W9IA 1FXAA 2KDBA 3U4EG 2I1JA 2M17A 3IG3A 4FJZA 1GC7A 4W9CA 4W9EA 3VHTC 3ECIA 2GOWA 1E6EB 4LDTB 3ABVB 3KWVA 1AW7A 4ASWC 1V2YA 3BYTB 4IDIA 1F1HA 2KMAA 1NEKB 2KACA 3H9DA 2KQ7A 2RDBC 1I4HA 4W9HA 1P3QU 1SB3C 1LM8B 3RUIB 4C7ZA 4BZAA 2QILA 3C0RB 3VH4B 3W5VB 1GG3A 3RNCC 4DXFA 1PQSA 2D11A 1T5XD 2PTLA 1M94A 4TQ1A 1XCTL 2BPSA 3A1QA 1EUVB 2N1VA 1ENFA 2QC8A 3QJZA 2M1MA 4OVVA 2FCMA 1R4MI 1ZE3D 4DHZB 2EKIA 2KFKA 3GZNB 3VQIA 1WX8A 1NDDA 4EE2A 2BKFA 4OZAA 3Q6BA 2WYQA 4GDKB 4TV3A 5CTRC 3IAM1 1F2RC 2AX5A 2BYFA 3NVVA 3K9OB 4ZYNA 3V05A 1V1PB 1YN4A 1YJIA 4IM0A 4NJ6A 4MJSA 1E5WA 1TS4A 2K1FA 2JUOA 1KLUD 4KKIA 5DCNA 3BINA 4P1CC 3QQ8B 3ZIMA 1ZDXA 3EUB2 3N3KB 3MHSD 2LMCA 3SR6A 3MHZA 2MRPA 2XN9C 2WXLA 2R2QA 5HHDG 2D2QA 1NENB 4XX5A 2CR5A 1WM3A 2QIEB 3H7PA 2QJLA 1PGAA 2WXQA 3ZNHB 3BK2A 5KHQA 2J0JA 1K52A 1WSPA 4FJYA 1N6ZA 2GBNA 4ANVA 4QAYA 5CHVC 2PJHA 3RNAC 3RN9C 4REZA 3N32A 1OEYA 3HM6X 2H89B 1WZ0A 2JX5A 4CQNA 4OZCA 2WU5B 1OQRA 2B76B 2MX2A 3W5UB 4W9FA 1OQYA 3U7ZA 5FR3A 3I9V1 4MDKE 4FADA 2WP9B 2HDEA 4ZRIA 3RZWC 4TUUA 4GDLA 3I3TB 4OZBA 2EELA 4KSKC 3AULA 2Z0DB 2FNJB 2IGGA 1SBBB 3I63C 3JYUA 3HVZA 1C3TA 5AUIA 1HZ6A 5AUKA 2I2YA 1ZDVA 1OGWA 1GOZA 2N7JA 1UD7A 1C76A 2UWQA 3P42A 1WGRA 4LTUA 2M0XA 3H8HA 4ANUA 4JIOU 2V4LA 2CJNA 4AQ7A 1YJ1A 4YT0B 1TS2A 3B9JA 4JGHB 4MSMB 1FNUA 2FAZA 2PPHA 2L3ZA 1WXQA 4KKJA 5I4DA 3MFGA 3GE8C 1WYGA 1JMLA 4MELA 1UNSA 1WF9A 2WDVB 3AU5A 1D5XC 2IO0B 3FILB 2IY1B 1EWYC 2Y5CA 2FCSA 4XWWA 3BVMA 1XD3B 1WXMA 1KM7A 3SHQA 2KK8A 3A33B 5FK9C 2KLGA 3AM9A 3AEAB 3DBSA 1EM7A 2M0AA 4WAAA 1EU3A 2LZ6A 4HDQA 4IWQA 2Z0EB 4DXGA 4LNIA 2MBEA 2CU1A 2DZIA 5AEKB 1C79A 3R66C 1YN5A 2VZKB 1U4AA 1I35A 4KSLC 2PMVA 3HUIA 3AH7A 1YMHE 3DVNV 4W9LA 4RH6A 3VUXA 4LNFA 1YNTE 2LVOA 1DOXA 1WJUA 1FNVA 3IT4B 1I4RA 3KQ4A 1F2RI 2INDC 2W82A 1WMHB 2L0TA 2OEDA 5JZEB 3BWUD 1SE4A 3JSVA 2G9HD 4RCOA 4MH0E 5J2RA 4ICUA 4JQWC 1C1YB 2KANA 5JH5C 5HI1A 3P63A 1L2NA 3AXCA 3Q3MC 1ZP0B 3QCAA 1UH6A 1F52A 2Y3AA 3TEXA 3TEYA 2KJRA 3WAPA 5C1ZA 2J53A 2MP2B 2BGFA 2KFKB 2NTSA 2WDTB 4HCNB 1WZ3A 4PYUA 2W3SA 4C4VB 4MGYE 2Y5PA 1XLPA 2QDFA 1K53A 1B9RA 5J18A 1P98A 4WWPA 1HE8A 3N20C 4CHKA 5EE3A 3ZJVA 2C7HA 1J8CA 3VFKA 3ZRCA 1Y56A 5E6JA 2DZMA 2L05A 2QEJC 4RGNA 4WJNA 5AZHA 3QK0A 2MH7A 4GDKA 4IUMB 5G5GA 5JHAA 1E7VA 3M95A 4CO7A 2E3TA 2W54A 1YQBA 1FIQA 1NBFC 1SE9A 1ZXIA 1CJEA 4A3PA 1SIJA 2AWTA 2LHDA 2PEAA 1P7FA 1YQ4B 4IOIE 3CSTA 1FEHA 1KLVA 4BKTA 4W9KA 3AE2B 1MHHE 2J4XA 1QZEA 1R4MB 3LXFA 3KWLA 5D7GA 5AZGA 2AL3A 4FHJA 3AECB 3E9SA 5MPOA 3DOWA 1WFYA 1RRBA 3Q8FA 3QA8A 3SDLC 2DZJA 4L2YA 5D3IB 1TKYA 1VCBA 5G55A 1WI0A 1J7AA 3GS2A 3X23A 1XT9B 1RM6C 5BMGA 4HEA1 1F9JA 3ZO5B 2M19A 3WA0A 2ZPYA 3AMZA 2I1KA 4XC2A 2QMTA 4HLEA 1XF5L 4YSZB 2V1YA 2YVCA 1S3SG 2CKHB 1XEEA 2WXIA 2LXAA 3VAWA 4JL9A 4ITKA 1P9DU 1L0XB 1E8ZA 5BYQA 1GAQB 2K9XA 1N5WA 2W55A 4BKGA 3BY4B 2YLMA 4P1BC 4B0MA 3A1QB 1E0ZA 1S1QB 3KLSX 3PS6A 2L83A 4WWMA 3UI3A 4MGIE 1VZ8A 3UF8A 2IPKD 2G4DB 3VRAB 1JWSD 1N62A 2AL6A 1MPEA 4B0EA 3U52E 2ZCCA 2JYTA 2DLBA 2VH1A 3L10B 2K8CA 1QILA 2DBYA 2Q5WD 1Q10A 4MGKE 4BOZB 2OJWA 4NQLB 4AS1A 2JSVX 1EF1A 2L52A 4C00A 4HDOA 3R3MA 3V60A 4LJOB 2AQ2B 1R7SA 3APFA 5IN7A 4KZCA 2W3RA 2G3QB 2EMSA 2KO3A 3H1UA 4WQMA 3ZVVA 3ZW3A 2PVOD 1FRDA 1YIWA 4FHKA 4LK0M 5EDSA 2LVPA 4BVUC 2JRHA 5T8IA 2WDRB 1FM0D 5FKAC 1TIFA 3B0AA 4MT5A 1CQVA 2R61A 4G3XB 1XXGA 3R7RA 4NAWB 1Z5SB 2NBVB 2KVRA 2INNE 2SEBD 4WWNA 3HHMA 1FO4A 1L4ZB 4XGAB 1T0YA 3DVGX 2KTFA 3MC0B 2KWUB 2O2VB 4N9F4 4USAA 5H92C 1ZUD2 4L23A 1L6VA 1HA5A 1XLOA 3NS8A 4BOSC 1KF6B 3V6EB 2WQYB 4HRSA 3EA6A 2Z59B 2KMMA 3GE3C 3OAWA 3LB8C 4N6EB 2AYOB 2AEHA 2NBUA 2WXMA 5IP4D 3A9KB 3HRDD 1JRPA 4WIPA 3OJ3A 2ONQA 2LRWA 5HG2A 3ZXVA 3RCZA 1JQ4A 2MJDA 5C2TB 1UGJA 2MEKA 1XLNA 2NCNA 3UINB 4WH4A 1IBXA 3GB1A 4HJKA 1SE2A 2IO3B 2NPTB 1ET9A 4ANXA 2C5LC 3GZNI 3X0WA 2WXGA 3EHVA 3NRZA 2KT7A 1P1AA 1GUAB 1QF6A 2LJIA 5G2NA 3HK0A 3OWEB 3OJ4B 4K3BA 5AZFA 1NI3A 1AN8A 2MSED 1Z2MA 4DWFA 4IG7B 2LVQA 3QWZB 4S0RA 2LASA 2PIAA 4BBNF 3TUOA 1XQQA 2IBIB 4EFOA 2G1EA 2JWUA 1V80A 4US8A 1EU4A 3TIXA 3AN1A 2N9PC 2WGSA 3AI5A 2ON8A 2XEWA 2WLBA 2KXJA 3RT3B 4RGMA 1ZPSA 2GI9A 1SXTA 2WXHA 2M56B 4II3B 4YTMB 2KVZA 3TL5A 2ICIA 3T8MA 1P0RA 1RYJA 4K7UA 3AU4A 3LDZE 1NYRA 1V86A 3ML8A 4JLCA 1UBQA 2NBWB 3GOEA 2A4ZA 1C4PA 1BUIC 2GMIC 3Q2AC 5HFYA 4KZ0A 4LCDE 4EZKA 2KD0A 2FE8A 1TKGA 1LXDA 1NVID 1QOAA 4FJVB 1UELA 4EOYA 2WU2B 2BTEA 1STEA 2G45B 3AE6B 1N61A 2JYEA 3UIOB 1I4GA 3DBHI 4E71A 1WGGA 1C77A 2KOXA 2KQ4X 4XDDA 3L16A 3PLVA 3T9LA 5G5HA 2N7EA 2NMQA 3E56A 2L0FA 3Q8CA 4XZ4A 2WDQB 3SFDB 2PW9A 5BYRA 1IBXB 2C9WB 2E6XA 2WX0A 4TMAB 4BBNC 1WXAA 5GXGB 1EF5A 1L5PA 2BS3B 4ZDVA 2V0GA 4OVZA 3ZGZA 3Q3NC 3L4PA 3N9YC 2MW5A 2WXKA 3TEZA 3QC8B 4KIKA 2EMTA 1J7CA 3AE9B 1IYFA 3UGBB 1FNWA 1YJJA 4BAXA 4GDLB 2KTRA 1DOYA 3PT2B 1OFFA 4YTPB 4HVBA 2RDHA 2DYBA 2CS4A 1AYFA 1K51A 5L83A 1T3QA 3APDA 4RGTA 3W1SA 3RYTA 3MJ5A 2RR9A 4YWGG 2LGYA 2BQQA 1AWDA 3DWMA 4YSXB 2DWQA 4C56C 4NZLB 1YX6B 2K5PA 4K1RB 1C4CA 1Y8RC 2KX3A 2L76A 2LFIA 3P4PB 1WWTA 4URKA 1C78A 2FUG1 4IW0A 2MLBA 1R4NI 1KFYB 4TQ0A 5IO9A 1JWAD 2BS4B 4ZYSA 3CIRB 4YTNB 4GXBA 2RMMA 2K8HA 1L4DB 3DHGC 2K6DB 4PK1A 1PFDA 1ZXHA 1YQ3B 2KN4A 2V3SA 2K6QA 1WJNA 2WXOA 1V1PA 3Q3JA 3AE1B 2DNFA 3IXSA 3NZ3A 1NYQA 2KZRA 3KW5B 1SE3A 1HEZE 3RMKC 1FFVA 1V9JA 3AE5B 1TS3A 4EEWA 3SD5A 2JRIB 3R8BA 4AJYB 2GBKA 5GMVA 4HK2A 3SFEB 4AOFA 4AP4C 4BKSD 5LNK1 1MHXA 2JWZA 4FBJB 3A9KA 2DHZA 2L1AA 2KDMA 2FIFA 4ZRJA 3TCAA 1RAXA 3UIPB 1FPYA 1SGHA 2IJ0A 3ZUNA 1FMAD 2YEPF 4C7YA 4IWPA 2IGHA 3VUYA 3ETRA 2O6VA 2KJ6A 2ZPNA 5LLIA 4KGTA 3ZJTA 3ZNZB 3DDCB 2ZNVC 3ZTDA 3IAS1 2IDYA 3KUDB 2LGSA 2REXA 3URYA 2JQRB 1L6UA 3MC9A 4J3OD 2O6VD 3TEWA 4W9JA 4HKQA 4JWSC 2HTME 4C4VA 2FBWB 3AE4B 2L8JA 4UDUC 3PZDA 3ZDTA 3ZXRA 1J19A 2INPE 3Q69A 4DHJB 1IPGA 4YXDB 1LO5D 1TTNA 3ZDMC 2C7MB 4XWTA 1XO3A 1F77A 3RNGC 2R2OA 1H4RA 5D6JB 2ZW1A 2J7QB 3VRBB 3Q8AA 4M0WB 3KUCB 3FILA 3TSSA 3AEDB 4WURA 4G0NB 4EKUA 2HJ1A 2QSDA 2RSUA 2GBMA 1TZ1A 1WH3A 1FXTB 5KHOA 1FD6A 3R7QA 4A6QA 4PS8A 2MQJA 4B9KA 4E74A 4OVUA 2WXFA 2PKOA 1WGKA 1VR9A 2G4SA 4PT5A 5DPRA 3ZJUA 1GB1A 1VJKA 4M02A 2MBHA 4M0WA 4B6WA 1PDXA 1RWSA 2OOBB 2OHFA 3ALBA 2JZ3B 3EC8A 2GRIA 3AEEB 1VZ7A 3NG0A 4ARCA 2DZKA 4GIVA 2NR2A 1WE6A 4RMAA 3PZ7A 2M4NA 2VZKD 4K7SA 2DENB 2ZNVB 4MEMA 1E90A 1PYWD 2Y5BB 2JT4B 4I6PA 1WX7A 2GLSA 4I6NB 3R2TA 5LXIB 1DYQA 2JPHA 3D32A 3V62A 2VH2A 2N9KA 1ZW7A 3JSVB 2O2VA 1E8XA 3ENEA 5CHFA 3A4SC 3RNBC 2QCZA 2ZCBA 5C3JB 2WHIA 4JPSA 1Q5WB 5BMHA 1K8RB 1T0RC 5BMIA 3DQVA 1V97A 3OG5A 2XBBC 3BVGA 4JX1C 3PRZA 1WX9A 2C60A 2K0PA 1WYWB 3AE7B 4MM3A 4HPLB 1MI0A 1ROEA 2K8BA 2KDFB 1X1MA 2DX5B 3Q8BA 5BO4B 3L17A 1UZXB 4WJQA 3AE3B 2AQ1B 2KLCA 2N9EB 3CWIA 3IBEA 5D3DA 4DDID 4HKZE 2WXJA 4HROA 2D5GA 4RM8A 1TGZB 4XYCA 5DPTA 2N9LA 1FRRA 1DOIA 3VR9B 3HM3A 2NPTA 3DPDA 3VDZA 4G11A 3NJTA 2O6VB 1JW9D 2DAFA 4LDTD 2YEPB 3A9JB 3LYYA 2LRUA 4K7WA 3ZTCA 4KVGB 2D3AA 2KKCA 1ESFA 1SEBD 2WWZA 3RD2A 5E6PA 1E8WA 2KHWB 2WS3B 2BVCA 4BKSA 2RDGA 4ANWA 1WE7A 2LHEA 1I4QA 2ZVNA 1GPXA 3PLUA 3VTWA 3RPFC 5EE9A 1CK1A 1T0SC 2PE6B 3PSEB 2NVUI 2CHWA 3DBLI 3IT6B 2KC1A 3MP9A 2L00B 2MCNB 2K39A 3M62B 4GU2A 2HTHA 4KIKB 3HIZA 1WGHA 3R2IA 3QX1A 3V6CB 3B2GA 2V9HA 4LLGM 3H7SA 3NUHB 4RGOS 3PPAA 4PS3A 2SAKA 1TY2A 3RI7C 1WRIA 1WXVA 2N1WA 3KYDD 4A3OA 5L95C 2KWVB 3CMMB 3L08A 5IA7A 3DVGY 3T3NA 2CHXA 4PYZA 2WNMA 2LGXA 2JZPA 3EGRA 2KAJA 4FLHA 4RF0A 1T6BX 4KGRA 3JVZX 4WJOA 3ML9A 1TS5A 3MJWA 3M3JA 2CJOA 4CYEA 2IO1B 2NTTA 4EZLA 3IHPC 2K3UA 2D3GA 3BZDB 3AE8B 4JE3B 3APCA 2B3AA 4GB9A 2J0KA 4ICVA 1ZGUB 2M8SA 3NY5A 2MJ3A 4IWOA 2BWES 3ONSA 3K9PB 4FXCA 4DHJD 1MVKA 5JXVA 3AEFB 3DBRI 3DHIC 4IM3A 1B1ZA 1N60A 3UQAA 1HTOA 2D3CA 2WX1A 3SEBA 1YOVB 4G50A 1LQBA 3BYYB 3RZFA 5LXHA 3RULA 2LXCA 3LJ3A 4US9A 1QKZA 3N1ZC 1TKEA 2BW2A 4LNKA 1YN3A 4GGQA 3O65B 1MFWA 1HZ5A 2ZEQA 3FC4A 4RF1A 4A8XC 4K81A 1UUPA 2EKEC 1VRAB 5JHBA 2JXTA 3NVYA 1IGDA 2MBOA 4S17A 2MJEA 3TJPA
chains in the Genus database with same CATH topology
2INDC 3N1ZC 3N1YC 3Q2AC 3GE3C 4P1CC 3N20C 3Q3OC 2INCC 3Q14C 4P1BC 3RMKC 3I5JC 3RNFC 3DHIC 3RNAC 3GE8C 3RNEC 3N1XC 3Q3NC 3RN9C 3RNCC 3DHGC 1T0SC 3RNBC 1T0RC 3RNGC 3I63C 3RI7C 3Q3MC 3DHHC 2RDBC 1T0QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IND C;  3N1Z C;  3N1Y C;  3Q2A C;  3GE3 C;  4P1C C;  3N20 C;  3Q3O C;  2INC C;  3Q14 C;  4P1B C;  3RMK C;  3I5J C;  3RNF C;  3DHI C;  3RNA C;  3GE8 C;  3RNE C;  3N1X C;  3Q3N C;  3RN9 C;  3RNC C;  3DHG C;  1T0S C;  3RNB C;  1T0R C;  3RNG C;  3I63 C;  3RI7 C;  3Q3M C;  3DHH C;  2RDB C;  1T0Q C; 
#chains in the Genus database with same CATH topology
 2RGF A;  2KMC A;  4MH8 A;  3QHT A;  1WM2 A;  4KDL B;  2X38 A;  2KDE B;  2OJR A;  3PV1 A;  1TYG B;  1VDV A;  1GJZ A;  1N5X A;  1V5T A;  3ZLZ A;  3V3X A;  1E8Y A;  1UWX A;  1J0G A;  4RNA A;  4MJS B;  1OTR B;  3KUZ A;  5E6N A;  4MAC A;  2GBR A;  2N4F A;  1ZOY B;  1KRH A;  1VLB A;  2CU3 A;  3BVZ A;  4HPP A;  4II2 B;  4P16 A;  2LUM A;  3PGE A;  3VTU A;  2LD9 A;  1G6J A;  2WXN A;  4L1B A;  3V61 A;  3WAO A;  1VD2 A;  2BYV E;  2LGD A;  4XE0 A;  1VZ6 A;  4I6L B;  4M00 A;  2KFJ A;  5H8Y E;  3EFU A;  1E10 A;  3ZNI D;  4DK5 A;  4BFR A;  3WAL A;  4EZJ A;  3U30 A;  3NOB A;  2JVC A;  2L32 A;  3N1X C;  3M63 B;  1QOF A;  2LGI A;  1GC6 A;  4Q2J A;  5C23 A;  4R3D A;  2MBQ A;  1D5Z C;  1JCK B;  1XCQ L;  3HVD A;  3I57 A;  4NQK E;  1WXS A;  2Z8L A;  2ZVO A;  3CSF A;  4WQO B;  2ZZP B;  4J6I A;  5CHW A;  3WAN A;  1R4N B;  2X8X X;  3A4R A;  2BYE A;  2DYM A;  1D6E C;  1JRO A;  1WJ6 A;  2KN5 A;  2KWC A;  2MA9 B;  3Q3O C;  1UGM A;  3AV8 A;  4H2A A;  1LFD A;  1UWM A;  4OHJ A;  4M01 A;  3J9C A;  3AB5 A;  4LNO A;  3P4R B;  2BT6 A;  4NJ7 A;  2K22 A;  4OW0 A;  1JWM D;  3PRM B;  3TMP B;  4F8C B;  3TBL D;  3OLM D;  2MHJ A;  1CZP A;  2KNB A;  2D3B A;  2RPV A;  2UU7 A;  5HKH A;  3EFC A;  2V3N A;  3Q8E A;  4LJP B;  3U2S C;  3EEC A;  3FAH A;  4EUT A;  5D2M B;  1I7H A;  2BF8 B;  2IZV B;  3RFZ B;  5DPS A;  5IAA C;  4W9G A;  1F0Z A;  2JF5 A;  3DHH C;  3NZS A;  5IKC M;  2JZZ A;  1JWB D;  2C7N B;  1WGY A;  2N7D A;  4HCP B;  4ZRQ A;  1L0V B;  1ACC A;  1WY8 A;  2FCN A;  3KH0 A;  2MWS B;  3CF6 E;  3PRP B;  3QAR A;  1HTQ A;  3PHX B;  4N58 A;  1MJD A;  3VH3 B;  1I42 A;  4O1N A;  1T0Q C;  4ZHP A;  2IGD A;  2BB6 A;  1KH0 A;  1SIF A;  4WJP A;  3L13 A;  3U7D A;  4C80 A;  2IYD B;  3QIJ A;  3JW0 X;  3SU8 X;  1TY0 A;  3Q14 C;  2RPQ A;  2RD0 A;  1ZKH A;  1E9M A;  4AWJ A;  1Q1O A;  3PRE A;  1JWU D;  4HPM B;  3W1Y A;  2BYT A;  4FUL A;  1WRD B;  3NVZ A;  2XNA C;  4F7Z A;  3NZU A;  1RLF A;  2N9X A;  2BS2 B;  1EWC A;  4E3C A;  3N30 A;  4B95 A;  1V81 A;  2KTR B;  1E7U A;  3PTF C;  3UQB A;  3WIM A;  4K3C A;  3MTN B;  1I4X A;  1GB4 A;  1V5O A;  4HJG E;  4ZHO A;  4MSQ B;  4KV2 A;  4KDI C;  3PO0 A;  4MGZ E;  2H88 B;  3NHE B;  4GMV A;  2MBB B;  2JXX A;  1QLB B;  5E6O A;  2ASQ A;  3IVF A;  4YSY B;  1N63 A;  1M4V A;  2ACZ B;  3VVW B;  1ET6 A;  2KQS A;  1V1O A;  1TT5 B;  1AAR A;  4TKN A;  2WXR A;  1UBI A;  2GB1 A;  3RNE C;  4PS7 A;  2A5U A;  2W9N A;  1BT0 A;  3U8Z A;  4ZOH C;  2IY0 B;  5TSS A;  4NAW A;  2HJ8 A;  1HQR D;  3DBH B;  1BML C;  4P6V F;  4DXA B;  2J52 A;  1JRU A;  2HD5 B;  2LI5 A;  4ARI A;  3P4S B;  3DWG C;  3RNF C;  2LUE A;  4KX6 B;  3MC8 A;  4A90 A;  1GNU A;  3DBL B;  3P2B A;  2KC2 A;  1IP9 A;  4GSW A;  2J42 A;  1A70 A;  3W2D A;  3KYC D;  4IC7 B;  1ISN A;  4NAM A;  4FN2 A;  4YL8 A;  3VXW A;  1BXT A;  4X57 B;  3C8Y A;  2CHZ A;  1WGD A;  2INC C;  2L7R A;  4DQO C;  3I5J C;  1DGJ A;  4A55 A;  1SJE D;  1KTK A;  2KX0 A;  1TZO A;  1P7E A;  2K25 A;  2QHO A;  1SSN A;  4RFB A;  1RFK A;  1D5M C;  1Q0W B;  1QT9 A;  4NPN A;  1UF0 A;  3B08 A;  2AQ3 B;  2IO2 B;  1L0Y B;  4IM2 A;  2XK5 A;  3VR8 B;  3N1Y C;  3BII D;  3NVW A;  2ZJD A;  3VTV A;  2D10 A;  2PVG C;  2J0M A;  1WIA A;  1IUE A;  1D4B A;  3NS1 A;  3FKY A;  1LGR A;  1EO6 A;  2BBC A;  1TJE A;  2UYZ B;  4GOC A;  1PUT A;  4ZRK A;  2BKR B;  3Q3F A;  2WXP A;  4N59 A;  1FCL A;  4KGS A;  3O13 A;  4WWO A;  4DHZ E;  1QOB A;  2KYW A;  1OQQ A;  1D3Z A;  2DYO A;  2PE9 A;  4D2K A;  4HXD A;  4GN1 A;  2V3P A;  1A5R A;  1WMH A;  3VUW A;  3AEG B;  3DCG A;  2NS5 A;  4NY0 A;  2KDI A;  4DDG D;  5TR5 A;  1WJ4 A;  2LEK A;  2HE7 A;  3T3O A;  4GLS C;  2LJ5 A;  2D07 B;  4AUQ C;  1K50 A;  1NI2 A;  3W1S C;  2V4I B;  4JWU C;  4LNN A;  1SJH D;  3AEB B;  5EE1 A;  3S2A A;  5FR6 A;  1IGC A;  2FUH B;  1V6E A;  1RFA A;  3P1M A;  4NJC A;  1SF0 A;  1JAL A;  4P7I A;  3ZNG C;  3BK1 A;  2PLP A;  1WR6 E;  2GBJ A;  2DAJ A;  1MG8 A;  1QQR A;  4IKG A;  5DPW A;  3H6N A;  3ZKJ C;  3DBR B;  3KVF B;  1KOT A;  1OEY J;  2FCQ A;  4TSS A;  3PHW B;  2BB5 A;  2N0S B;  5D94 A;  2FID A;  5EE0 A;  2BWF A;  4ACF A;  2I38 A;  1PGX A;  3ZQ4 A;  1PGB A;  3QAQ A;  4F1S A;  2KJH B;  1C4A A;  4W9D A;  2JU6 X;  1E7P B;  4ZRP A;  4WAF A;  2KWD A;  1KJT A;  3P4Q B;  3WCQ A;  3C19 A;  1CMX B;  4AJW A;  3IFW B;  4XDC A;  1TBE A;  4A20 A;  3A9J A;  1MG4 A;  4MM3 B;  3ZYY X;  3B1L X;  3B2F A;  4M8M A;  1QOG A;  1H8C A;  2XK5 B;  2JY6 A;  3L0W B;  1V8C A;  4HWI B;  2LWP A;  1WR1 A;  1HXY D;  4A9A A;  5J17 A;  1XLQ A;  5CX3 A;  1YD8 U;  1I4P A;  1C9F A;  2TSS A;  3ZRF A;  3DVN U;  4NNJ B;  1J7B A;  1FXI A;  5IOI A;  1KLG D;  3PZ8 A;  4DBG A;  3W9C B;  3GP7 A;  3H7P B;  1L7Y A;  3L54 A;  2VRR B;  1FCC C;  2MP2 A;  1V49 A;  3PVL A;  4M8N A;  5BYS A;  3WAM A;  2ZW0 A;  4FA6 A;  1YX5 B;  4RM9 A;  1FFU A;  4W9I A;  1FXA A;  2KDB A;  3U4E G;  2I1J A;  2M17 A;  3IG3 A;  4FJZ A;  1GC7 A;  4W9C A;  4W9E A;  3VHT C;  3ECI A;  2GOW A;  1E6E B;  4LDT B;  3ABV B;  3KWV A;  1AW7 A;  4ASW C;  1V2Y A;  3BYT B;  4IDI A;  1F1H A;  2KMA A;  1NEK B;  2KAC A;  3H9D A;  2KQ7 A;  2RDB C;  1I4H A;  4W9H A;  1P3Q U;  1SB3 C;  1LM8 B;  3RUI B;  4C7Z A;  4BZA A;  2QIL A;  3C0R B;  3VH4 B;  3W5V B;  1GG3 A;  3RNC C;  4DXF A;  1PQS A;  2D11 A;  1T5X D;  2PTL A;  1M94 A;  4TQ1 A;  1XCT L;  2BPS A;  3A1Q A;  1EUV B;  2N1V A;  1ENF A;  2QC8 A;  3QJZ A;  2M1M A;  4OVV A;  2FCM A;  1R4M I;  1ZE3 D;  4DHZ B;  2EKI A;  2KFK A;  3GZN B;  3VQI A;  1WX8 A;  1NDD A;  4EE2 A;  2BKF A;  4OZA A;  3Q6B A;  2WYQ A;  4GDK B;  4TV3 A;  5CTR C;  3IAM 1;  1F2R C;  2AX5 A;  2BYF A;  3NVV A;  3K9O B;  4ZYN A;  3V05 A;  1V1P B;  1YN4 A;  1YJI A;  4IM0 A;  4NJ6 A;  4MJS A;  1E5W A;  1TS4 A;  2K1F A;  2JUO A;  1KLU D;  4KKI A;  5DCN A;  3BIN A;  4P1C C;  3QQ8 B;  3ZIM A;  1ZDX A;  3EUB 2;  3N3K B;  3MHS D;  2LMC A;  3SR6 A;  3MHZ A;  2MRP A;  2XN9 C;  2WXL A;  2R2Q A;  5HHD G;  2D2Q A;  1NEN B;  4XX5 A;  2CR5 A;  1WM3 A;  2QIE B;  3H7P A;  2QJL A;  1PGA A;  2WXQ A;  3ZNH B;  3BK2 A;  5KHQ A;  2J0J A;  1K52 A;  1WSP A;  4FJY A;  1N6Z A;  2GBN A;  4ANV A;  4QAY A;  5CHV C;  2PJH A;  3RNA C;  3RN9 C;  4REZ A;  3N32 A;  1OEY A;  3HM6 X;  2H89 B;  1WZ0 A;  2JX5 A;  4CQN A;  4OZC A;  2WU5 B;  1OQR A;  2B76 B;  2MX2 A;  3W5U B;  4W9F A;  1OQY A;  3U7Z A;  5FR3 A;  3I9V 1;  4MDK E;  4FAD A;  2WP9 B;  2HDE A;  4ZRI A;  3RZW C;  4TUU A;  4GDL A;  3I3T B;  4OZB A;  2EEL A;  4KSK C;  3AUL A;  2Z0D B;  2FNJ B;  2IGG A;  1SBB B;  3I63 C;  3JYU A;  3HVZ A;  1C3T A;  5AUI A;  1HZ6 A;  5AUK A;  2I2Y A;  1ZDV A;  1OGW A;  1GOZ A;  2N7J A;  1UD7 A;  1C76 A;  2UWQ A;  3P42 A;  1WGR A;  4LTU A;  2M0X A;  3H8H A;  4ANU A;  4JIO U;  2V4L A;  2CJN A;  4AQ7 A;  1YJ1 A;  4YT0 B;  1TS2 A;  3B9J A;  4JGH B;  4MSM B;  1FNU A;  2FAZ A;  2PPH A;  2L3Z A;  1WXQ A;  4KKJ A;  5I4D A;  3MFG A;  3GE8 C;  1WYG A;  1JML A;  4MEL A;  1UNS A;  1WF9 A;  2WDV B;  3AU5 A;  1D5X C;  2IO0 B;  3FIL B;  2IY1 B;  1EWY C;  2Y5C A;  2FCS A;  4XWW A;  3BVM A;  1XD3 B;  1WXM A;  1KM7 A;  3SHQ A;  2KK8 A;  3A33 B;  5FK9 C;  2KLG A;  3AM9 A;  3AEA B;  3DBS A;  1EM7 A;  2M0A A;  4WAA A;  1EU3 A;  2LZ6 A;  4HDQ A;  4IWQ A;  2Z0E B;  4DXG A;  4LNI A;  2MBE A;  2CU1 A;  2DZI A;  5AEK B;  1C79 A;  3R66 C;  1YN5 A;  2VZK B;  1U4A A;  1I35 A;  4KSL C;  2PMV A;  3HUI A;  3AH7 A;  1YMH E;  3DVN V;  4W9L A;  4RH6 A;  3VUX A;  4LNF A;  1YNT E;  2LVO A;  1DOX A;  1WJU A;  1FNV A;  3IT4 B;  1I4R A;  3KQ4 A;  1F2R I;  2IND C;  2W82 A;  1WMH B;  2L0T A;  2OED A;  5JZE B;  3BWU D;  1SE4 A;  3JSV A;  2G9H D;  4RCO A;  4MH0 E;  5J2R A;  4ICU A;  4JQW C;  1C1Y B;  2KAN A;  5JH5 C;  5HI1 A;  3P63 A;  1L2N A;  3AXC A;  3Q3M C;  1ZP0 B;  3QCA A;  1UH6 A;  1F52 A;  2Y3A A;  3TEX A;  3TEY A;  2KJR A;  3WAP A;  5C1Z A;  2J53 A;  2MP2 B;  2BGF A;  2KFK B;  2NTS A;  2WDT B;  4HCN B;  1WZ3 A;  4PYU A;  2W3S A;  4C4V B;  4MGY E;  2Y5P A;  1XLP A;  2QDF A;  1K53 A;  1B9R A;  5J18 A;  1P98 A;  4WWP A;  1HE8 A;  3N20 C;  4CHK A;  5EE3 A;  3ZJV A;  2C7H A;  1J8C A;  3VFK A;  3ZRC A;  1Y56 A;  5E6J A;  2DZM A;  2L05 A;  2QEJ C;  4RGN A;  4WJN A;  5AZH A;  3QK0 A;  2MH7 A;  4GDK A;  4IUM B;  5G5G A;  5JHA A;  1E7V A;  3M95 A;  4CO7 A;  2E3T A;  2W54 A;  1YQB A;  1FIQ A;  1NBF C;  1SE9 A;  1ZXI A;  1CJE A;  4A3P A;  1SIJ A;  2AWT A;  2LHD A;  2PEA A;  1P7F A;  1YQ4 B;  4IOI E;  3CST A;  1FEH A;  1KLV A;  4BKT A;  4W9K A;  3AE2 B;  1MHH E;  2J4X A;  1QZE A;  1R4M B;  3LXF A;  3KWL A;  5D7G A;  5AZG A;  2AL3 A;  4FHJ A;  3AEC B;  3E9S A;  5MPO A;  3DOW A;  1WFY A;  1RRB A;  3Q8F A;  3QA8 A;  3SDL C;  2DZJ A;  4L2Y A;  5D3I B;  1TKY A;  1VCB A;  5G55 A;  1WI0 A;  1J7A A;  3GS2 A;  3X23 A;  1XT9 B;  1RM6 C;  5BMG A;  4HEA 1;  1F9J A;  3ZO5 B;  2M19 A;  3WA0 A;  2ZPY A;  3AMZ A;  2I1K A;  4XC2 A;  2QMT A;  4HLE A;  1XF5 L;  4YSZ B;  2V1Y A;  2YVC A;  1S3S G;  2CKH B;  1XEE A;  2WXI A;  2LXA A;  3VAW A;  4JL9 A;  4ITK A;  1P9D U;  1L0X B;  1E8Z A;  5BYQ A;  1GAQ B;  2K9X A;  1N5W A;  2W55 A;  4BKG A;  3BY4 B;  2YLM A;  4P1B C;  4B0M A;  3A1Q B;  1E0Z A;  1S1Q B;  3KLS X;  3PS6 A;  2L83 A;  4WWM A;  3UI3 A;  4MGI E;  1VZ8 A;  3UF8 A;  2IPK D;  2G4D B;  3VRA B;  1JWS D;  1N62 A;  2AL6 A;  1MPE A;  4B0E A;  3U52 E;  2ZCC A;  2JYT A;  2DLB A;  2VH1 A;  3L10 B;  2K8C A;  1QIL A;  2DBY A;  2Q5W D;  1Q10 A;  4MGK E;  4BOZ B;  2OJW A;  4NQL B;  4AS1 A;  2JSV X;  1EF1 A;  2L52 A;  4C00 A;  4HDO A;  3R3M A;  3V60 A;  4LJO B;  2AQ2 B;  1R7S A;  3APF A;  5IN7 A;  4KZC A;  2W3R A;  2G3Q B;  2EMS A;  2KO3 A;  3H1U A;  4WQM A;  3ZVV A;  3ZW3 A;  2PVO D;  1FRD A;  1YIW A;  4FHK A;  4LK0 M;  5EDS A;  2LVP A;  4BVU C;  2JRH A;  5T8I A;  2WDR B;  1FM0 D;  5FKA C;  1TIF A;  3B0A A;  4MT5 A;  1CQV A;  2R61 A;  4G3X B;  1XXG A;  3R7R A;  4NAW B;  1Z5S B;  2NBV B;  2KVR A;  2INN E;  2SEB D;  4WWN A;  3HHM A;  1FO4 A;  1L4Z B;  4XGA B;  1T0Y A;  3DVG X;  2KTF A;  3MC0 B;  2KWU B;  2O2V B;  4N9F 4;  4USA A;  5H92 C;  1ZUD 2;  4L23 A;  1L6V A;  1HA5 A;  1XLO A;  3NS8 A;  4BOS C;  1KF6 B;  3V6E B;  2WQY B;  4HRS A;  3EA6 A;  2Z59 B;  2KMM A;  3GE3 C;  3OAW A;  3LB8 C;  4N6E B;  2AYO B;  2AEH A;  2NBU A;  2WXM A;  5IP4 D;  3A9K B;  3HRD D;  1JRP A;  4WIP A;  3OJ3 A;  2ONQ A;  2LRW A;  5HG2 A;  3ZXV A;  3RCZ A;  1JQ4 A;  2MJD A;  5C2T B;  1UGJ A;  2MEK A;  1XLN A;  2NCN A;  3UIN B;  4WH4 A;  1IBX A;  3GB1 A;  4HJK A;  1SE2 A;  2IO3 B;  2NPT B;  1ET9 A;  4ANX A;  2C5L C;  3GZN I;  3X0W A;  2WXG A;  3EHV A;  3NRZ A;  2KT7 A;  1P1A A;  1GUA B;  1QF6 A;  2LJI A;  5G2N A;  3HK0 A;  3OWE B;  3OJ4 B;  4K3B A;  5AZF A;  1NI3 A;  1AN8 A;  2MSE D;  1Z2M A;  4DWF A;  4IG7 B;  2LVQ A;  3QWZ B;  4S0R A;  2LAS A;  2PIA A;  4BBN F;  3TUO A;  1XQQ A;  2IBI B;  4EFO A;  2G1E A;  2JWU A;  1V80 A;  4US8 A;  1EU4 A;  3TIX A;  3AN1 A;  2N9P C;  2WGS A;  3AI5 A;  2ON8 A;  2XEW A;  2WLB A;  2KXJ A;  3RT3 B;  4RGM A;  1ZPS A;  2GI9 A;  1SXT A;  2WXH A;  2M56 B;  4II3 B;  4YTM B;  2KVZ A;  3TL5 A;  2ICI A;  3T8M A;  1P0R A;  1RYJ A;  4K7U A;  3AU4 A;  3LDZ E;  1NYR A;  1V86 A;  3ML8 A;  4JLC A;  1UBQ A;  2NBW B;  3GOE A;  2A4Z A;  1C4P A;  1BUI C;  2GMI C;  3Q2A C;  5HFY A;  4KZ0 A;  4LCD E;  4EZK A;  2KD0 A;  2FE8 A;  1TKG A;  1LXD A;  1NVI D;  1QOA A;  4FJV B;  1UEL A;  4EOY A;  2WU2 B;  2BTE A;  1STE A;  2G45 B;  3AE6 B;  1N61 A;  2JYE A;  3UIO B;  1I4G A;  3DBH I;  4E71 A;  1WGG A;  1C77 A;  2KOX A;  2KQ4 X;  4XDD A;  3L16 A;  3PLV A;  3T9L A;  5G5H A;  2N7E A;  2NMQ A;  3E56 A;  2L0F A;  3Q8C A;  4XZ4 A;  2WDQ B;  3SFD B;  2PW9 A;  5BYR A;  1IBX B;  2C9W B;  2E6X A;  2WX0 A;  4TMA B;  4BBN C;  1WXA A;  5GXG B;  1EF5 A;  1L5P A;  2BS3 B;  4ZDV A;  2V0G A;  4OVZ A;  3ZGZ A;  3Q3N C;  3L4P A;  3N9Y C;  2MW5 A;  2WXK A;  3TEZ A;  3QC8 B;  4KIK A;  2EMT A;  1J7C A;  3AE9 B;  1IYF A;  3UGB B;  1FNW A;  1YJJ A;  4BAX A;  4GDL B;  2KTR A;  1DOY A;  3PT2 B;  1OFF A;  4YTP B;  4HVB A;  2RDH A;  2DYB A;  2CS4 A;  1AYF A;  1K51 A;  5L83 A;  1T3Q A;  3APD A;  4RGT A;  3W1S A;  3RYT A;  3MJ5 A;  2RR9 A;  4YWG G;  2LGY A;  2BQQ A;  1AWD A;  3DWM A;  4YSX B;  2DWQ A;  4C56 C;  4NZL B;  1YX6 B;  2K5P A;  4K1R B;  1C4C A;  1Y8R C;  2KX3 A;  2L76 A;  2LFI A;  3P4P B;  1WWT A;  4URK A;  1C78 A;  2FUG 1;  4IW0 A;  2MLB A;  1R4N I;  1KFY B;  4TQ0 A;  5IO9 A;  1JWA D;  2BS4 B;  4ZYS A;  3CIR B;  4YTN B;  4GXB A;  2RMM A;  2K8H A;  1L4D B;  3DHG C;  2K6D B;  4PK1 A;  1PFD A;  1ZXH A;  1YQ3 B;  2KN4 A;  2V3S A;  2K6Q A;  1WJN A;  2WXO A;  1V1P A;  3Q3J A;  3AE1 B;  2DNF A;  3IXS A;  3NZ3 A;  1NYQ A;  2KZR A;  3KW5 B;  1SE3 A;  1HEZ E;  3RMK C;  1FFV A;  1V9J A;  3AE5 B;  1TS3 A;  4EEW A;  3SD5 A;  2JRI B;  3R8B A;  4AJY B;  2GBK A;  5GMV A;  4HK2 A;  3SFE B;  4AOF A;  4AP4 C;  4BKS D;  5LNK 1;  1MHX A;  2JWZ A;  4FBJ B;  3A9K A;  2DHZ A;  2L1A A;  2KDM A;  2FIF A;  4ZRJ A;  3TCA A;  1RAX A;  3UIP B;  1FPY A;  1SGH A;  2IJ0 A;  3ZUN A;  1FMA D;  2YEP F;  4C7Y A;  4IWP A;  2IGH A;  3VUY A;  3ETR A;  2O6V A;  2KJ6 A;  2ZPN A;  5LLI A;  4KGT A;  3ZJT A;  3ZNZ B;  3DDC B;  2ZNV C;  3ZTD A;  3IAS 1;  2IDY A;  3KUD B;  2LGS A;  2REX A;  3URY A;  2JQR B;  1L6U A;  3MC9 A;  4J3O D;  2O6V D;  3TEW A;  4W9J A;  4HKQ A;  4JWS C;  2HTM E;  4C4V A;  2FBW B;  3AE4 B;  2L8J A;  4UDU C;  3PZD A;  3ZDT A;  3ZXR A;  1J19 A;  2INP E;  3Q69 A;  4DHJ B;  1IPG A;  4YXD B;  1LO5 D;  1TTN A;  3ZDM C;  2C7M B;  4XWT A;  1XO3 A;  1F77 A;  3RNG C;  2R2O A;  1H4R A;  5D6J B;  2ZW1 A;  2J7Q B;  3VRB B;  3Q8A A;  4M0W B;  3KUC B;  3FIL A;  3TSS A;  3AED B;  4WUR A;  4G0N B;  4EKU A;  2HJ1 A;  2QSD A;  2RSU A;  2GBM A;  1TZ1 A;  1WH3 A;  1FXT B;  5KHO A;  1FD6 A;  3R7Q A;  4A6Q A;  4PS8 A;  2MQJ A;  4B9K A;  4E74 A;  4OVU A;  2WXF A;  2PKO A;  1WGK A;  1VR9 A;  2G4S A;  4PT5 A;  5DPR A;  3ZJU A;  1GB1 A;  1VJK A;  4M02 A;  2MBH A;  4M0W A;  4B6W A;  1PDX A;  1RWS A;  2OOB B;  2OHF A;  3ALB A;  2JZ3 B;  3EC8 A;  2GRI A;  3AEE B;  1VZ7 A;  3NG0 A;  4ARC A;  2DZK A;  4GIV A;  2NR2 A;  1WE6 A;  4RMA A;  3PZ7 A;  2M4N A;  2VZK D;  4K7S A;  2DEN B;  2ZNV B;  4MEM A;  1E90 A;  1PYW D;  2Y5B B;  2JT4 B;  4I6P A;  1WX7 A;  2GLS A;  4I6N B;  3R2T A;  5LXI B;  1DYQ A;  2JPH A;  3D32 A;  3V62 A;  2VH2 A;  2N9K A;  1ZW7 A;  3JSV B;  2O2V A;  1E8X A;  3ENE A;  5CHF A;  3A4S C;  3RNB C;  2QCZ A;  2ZCB A;  5C3J B;  2WHI A;  4JPS A;  1Q5W B;  5BMH A;  1K8R B;  1T0R C;  5BMI A;  3DQV A;  1V97 A;  3OG5 A;  2XBB C;  3BVG A;  4JX1 C;  3PRZ A;  1WX9 A;  2C60 A;  2K0P A;  1WYW B;  3AE7 B;  4MM3 A;  4HPL B;  1MI0 A;  1ROE A;  2K8B A;  2KDF B;  1X1M A;  2DX5 B;  3Q8B A;  5BO4 B;  3L17 A;  1UZX B;  4WJQ A;  3AE3 B;  2AQ1 B;  2KLC A;  2N9E B;  3CWI A;  3IBE A;  5D3D A;  4DDI D;  4HKZ E;  2WXJ A;  4HRO A;  2D5G A;  4RM8 A;  1TGZ B;  4XYC A;  5DPT A;  2N9L A;  1FRR A;  1DOI A;  3VR9 B;  3HM3 A;  2NPT A;  3DPD A;  3VDZ A;  4G11 A;  3NJT A;  2O6V B;  1JW9 D;  2DAF A;  4LDT D;  2YEP B;  3A9J B;  3LYY A;  2LRU A;  4K7W A;  3ZTC A;  4KVG B;  2D3A A;  2KKC A;  1ESF A;  1SEB D;  2WWZ A;  3RD2 A;  5E6P A;  1E8W A;  2KHW B;  2WS3 B;  2BVC A;  4BKS A;  2RDG A;  4ANW A;  1WE7 A;  2LHE A;  1I4Q A;  2ZVN A;  1GPX A;  3PLU A;  3VTW A;  3RPF C;  5EE9 A;  1CK1 A;  1T0S C;  2PE6 B;  3PSE B;  2NVU I;  2CHW A;  3DBL I;  3IT6 B;  2KC1 A;  3MP9 A;  2L00 B;  2MCN B;  2K39 A;  3M62 B;  4GU2 A;  2HTH A;  4KIK B;  3HIZ A;  1WGH A;  3R2I A;  3QX1 A;  3V6C B;  3B2G A;  2V9H A;  4LLG M;  3H7S A;  3NUH B;  4RGO S;  3PPA A;  4PS3 A;  2SAK A;  1TY2 A;  3RI7 C;  1WRI A;  1WXV A;  2N1W A;  3KYD D;  4A3O A;  5L95 C;  2KWV B;  3CMM B;  3L08 A;  5IA7 A;  3DVG Y;  3T3N A;  2CHX A;  4PYZ A;  2WNM A;  2LGX A;  2JZP A;  3EGR A;  2KAJ A;  4FLH A;  4RF0 A;  1T6B X;  4KGR A;  3JVZ X;  4WJO A;  3ML9 A;  1TS5 A;  3MJW A;  3M3J A;  2CJO A;  4CYE A;  2IO1 B;  2NTT A;  4EZL A;  3IHP C;  2K3U A;  2D3G A;  3BZD B;  3AE8 B;  4JE3 B;  3APC A;  2B3A A;  4GB9 A;  2J0K A;  4ICV A;  1ZGU B;  2M8S A;  3NY5 A;  2MJ3 A;  4IWO A;  2BWE S;  3ONS A;  3K9P B;  4FXC A;  4DHJ D;  1MVK A;  5JXV A;  3AEF B;  3DBR I;  3DHI C;  4IM3 A;  1B1Z A;  1N60 A;  3UQA A;  1HTO A;  2D3C A;  2WX1 A;  3SEB A;  1YOV B;  4G50 A;  1LQB A;  3BYY B;  3RZF A;  5LXH A;  3RUL A;  2LXC A;  3LJ3 A;  4US9 A;  1QKZ A;  3N1Z C;  1TKE A;  2BW2 A;  4LNK A;  1YN3 A;  4GGQ A;  3O65 B;  1MFW A;  1HZ5 A;  2ZEQ A;  3FC4 A;  4RF1 A;  4A8X C;  4K81 A;  1UUP A;  2EKE C;  1VRA B;  5JHB A;  2JXT A;  3NVY A;  1IGD A;  2MBO A;  4S17 A;  2MJE A;  3TJP A; 
#chains in the Genus database with same CATH homology
 2IND C;  3N1Z C;  3N1Y C;  3Q2A C;  3GE3 C;  4P1C C;  3N20 C;  3Q3O C;  2INC C;  3Q14 C;  4P1B C;  3RMK C;  3I5J C;  3RNF C;  3DHI C;  3RNA C;  3GE8 C;  3RNE C;  3N1X C;  3Q3N C;  3RN9 C;  3RNC C;  3DHG C;  1T0S C;  3RNB C;  1T0R C;  3RNG C;  3I63 C;  3RI7 C;  3Q3M C;  3DHH C;  2RDB C;  1T0Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...