3Q3OC

Toluene 4 monooxygenase hd complex with phenol
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 24
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q3oC00
3Q3OC 3RMKC 4P1BC 3RNFC 3I5JC 3RNBC 3RNEC 3RI7C 4P1CC 3DHHC 3N1ZC 1T0SC 3GE8C 1T0QC 3RNCC 2RDBC 3RN9C 3N1XC 3GE3C 3Q3NC 3RNAC 3I63C 3RNGC 3Q14C 3N20C 3Q2AC 3N1YC 2INCC 3DHGC 2INDC 1T0RC 3Q3MC 3DHIC
chains in the Genus database with same CATH superfamily
4ZRPA 2ZCCA 2KN5A 2YVCA 1ET6A 3HRDD 3N9YC 1P7EA 5E6PA 2BS3B 3KWLA 3H9DA 3U52E 2PE9A 3HVDA 1IBXA 2LXCA 4EOYA 3QA8A 1YJ1A 1FNUA 1DGJA 2KDEB 2KOXA 3NVZA 3U8ZA 3FC4A 2KDIA 2K39A 1UH6A 4GSWA 1VR9A 2D3BA 2QCZA 3W1YA 2KT7A 1N6ZA 2RDHA 3NVVA 2HJ8A 3M3JA 3AM9A 3NHEB 5JXVA 4NQLB 2PJHA 4OW0A 5JHBA 1N61A 5LLIA 3VR9B 4FJZA 4CQNA 1ZE3D 1R7SA 4EKUA 3T8MA 4KSKC 4M0WA 1E8ZA 1CMXB 3VTUA 4IWQA 4C7ZA 4K81A 1F0ZA 3GB1A 1XXGA 2L05A 2J7QB 2OJRA 2I1JA 2NCNA 4W9FA 2GB1A 2KDBA 1P9DU 2HJ1A 4P1BC 1TS3A 3ML9A 3H6NA 1ACCA 2GRIA 4XGAB 1T0QC 1WFYA 1YN4A 2CHXA 2WDTB 3WAMA 3CF6E 3MTNB 2DENB 3AE8B 3U7ZA 2KDFB 1WMHA 4OZBA 3KQ4A 2BS2B 2K8HA 2B3AA 2ZJDA 1P7FA 4P6VF 5BO4B 4YSZB 1SJHD 1JWBD 4XWWA 2E3TA 4N59A 4ARCA 1XEEA 1P98A 2FCSA 4LDTD 5KHOA 3ZTCA 3IT4B 3MJ5A 1HA5A 3RD2A 4GXBA 1ESFA 2JT4B 4HKQA 5E6JA 1WI0A 2M4NA 2VZKD 4JWSC 4KZCA 3NS1A 3ALBA 2MBOA 3TMPB 1V86A 4N9F4 1J19A 2WXHA 3KYDD 2KACA 4LNKA 3P42A 1V2YA 5AZFA 1L4ZB 2KVRA 1WJNA 3A9KB 3GE3C 1SXTA 1SJED 1T5XD 3CSTA 1RFAA 2BF8B 3NZSA 3ONSA 2LZ6A 4M8MA 2DYOA 3RFZB 1FPYA 3VHTC 4E3CA 3AE2B 4XX5A 2K22A 1MVKA 2LVQA 1SE2A 1LM8B 4C4VB 4W9HA 4HCPB 1FMAD 2RDBC 4GU2A 1LO5D 1C76A 1WE7A 4A3PA 3EUB2 1GG3A 1VZ7A 2EKEC 2VRRB 1FFVA 3DVNV 4B9KA 2KFJA 1V1PB 5DPWA 4BZAA 4G3XB 2K5PA 3VQIA 2ZPNA 3QCAA 5J17A 4HROA 4MH8A 4MM3B 1WGHA 4I6NB 4W9GA 2Z8LA 2Y5PA 2ZZPB 3BVZA 1UBIA 1L6VA 1MG4A 3JYUA 4FLHA 1UELA 2XN9C 2LJIA 4KVGB 4MGKE 3TBLD 1N60A 1ZW7A 4JGHB 5IA7A 3ZXRA 2MP2B 4XE0A 1GAQB 4AOFA 4PS3A 3NZ3A 3RYTA 4HCNB 4NQKE 2DZKA 5H8YE 3TUOA 1P0RA 1K51A 1ZXHA 1RWSA 1SE3A 2FIFA 1FRDA 2FUHB 4FXCA 2KTFA 2DNFA 2IO0B 3AE3B 3WA0A 1UWXA 2L83A 4NY0A 4C56C 3ZGZA 4LNFA 2WS3B 3AEEB 1XQQA 1SF0A 2N4FA 1DYQA 2WP9B 1MG8A 1N63A 2B76B 5CHVC 2LGIA 1TS5A 2JY6A 4W9KA 2WXRA 2ACZB 4W9DA 1VZ8A 4HDQA 4NJ7A 2N7EA 3W9CB 1OGWA 2K6QA 4M8NA 2AX5A 3M63B 2L52A 2RD0A 3Q69A 4HRSA 1JQ4A 3IBEA 4EZLA 2BYFA 2WQYB 5FR3A 3NVWA 4YT0B 1Z2MA 3T9LA 1DOXA 5CHWA 3KH0A 3WAOA 3E9SA 2FAZA 3DHHC 4ICUA 2LGSA 3PZ8A 4B6WA 1GB4A 4DXGA 2N9PC 4RF1A 2JX5A 3BYYB 4JL9A 2O2VB 4RGOS 4REZA 3AN1A 4QAYA 1U4AA 3QAQA 2DWQA 5C2TB 2WLBA 4IKGA 4EZJA 4ZRKA 5FR6A 3P4SB 2PIAA 1ENFA 1HZ5A 1NI2A 4K1RB 1E8WA 2YLMA 2CU1A 3ZDMC 1YQBA 1PGXA 2AL6A 1TZ1A 2DX5B 3Q2AC 2KC2A 3DHGC 3DQVA 4MSQB 2WXFA 1WXAA 3VTWA 3OAWA 4OHJA 2IPKD 4GDKB 1ZXIA 2IGDA 1KF6B 4LCDE 1WX7A 4TQ1A 1PDXA 2REXA 5D3DA 2O6VD 1XLOA 3LB8C 3ZJTA 2LFIA 2WXGA 4C7YA 1NEKB 2LASA 3V6EB 3R3MA 3CSFA 3CMMB 1C78A 2AYOB 1XLPA 3DBHI 4A6QA 4E74A 3I9V1 4HJKA 1WIAA 4KZ0A 2X8XX 4F1SA 1TKGA 2W82A 1CJEA 2ASQA 2AEHA 1C1YB 1FRRA 1IYFA 5KHQA 2JF5A 3RNGC 1EWCA 2JQRB 2KYWA 1KLUD 4ZYNA 2CHWA 2NTTA 3RPFC 3ZDTA 5C23A 3SD5A 1EWYC 1UGMA 2AQ2B 1JALA 4HJGE 4BOZB 1IPGA 1KFYB 2KMCA 1UBQA 3R66C 4PK1A 2KZRA 3SFEB 1E5WA 3RZWC 4AJYB 3TIXA 3ZIMA 2JXXA 3B08A 4DHZB 4J3OD 4B95A 2QIEB 4ZHOA 1R4MI 2IJ0A 2Y5BB 5G55A 4TQ0A 2BT6A 2WDQB 3PRZA 2L0FA 5HI1A 1BT0A 2GBRA 3Q8CA 1E8YA 2JXTA 4KGSA 2PPHA 2KLGA 2XEWA 1LXDA 3ZLZA 1D3ZA 1RLFA 4KGTA 4NAWB 3VXWA 1NDDA 4FA6A 4XDDA 4IUMB 2GBMA 2L7RA 1V81A 3A9KA 3DBLI 2PE6B 2PVGC 1ET9A 2INPE 1WH3A 2FNJB 1WGYA 2L8JA 4ACFA 1N5XA 3ZW3A 1ZKHA 2ZNVC 4M00A 1K52A 4D2KA 4DDID 1UD7A 4L1BA 4HDOA 1GPXA 2BTEA 3Q8FA 4W9CA 4WAAA 1E7PB 3N3KB 3EHVA 4I6PA 3ZVVA 1QOGA 3MP9A 4OZCA 4HLEA 1ZDXA 3QHTA 1IGDA 3R2TA 1Q0WB 1E0ZA 1JRPA 3FILB 1XCQL 3N1ZC 4ZOHC 3ZKJC 2C9WB 1V8CA 3IFWB 2MJDA 4MM3A 5D94A 4K7UA 1JRUA 3ETRA 1V6EA 3VUYA 3KLSX 1ZUD2 1XT9B 5JH5C 3Q6BA 1DOYA 3DWMA 3W5UB 1J7CA 3BK1A 2IYDB 2QSDA 4KX6B 1V80A 3PS6A 5L83A 1BXTA 1R4NB 2FE8A 2MP2A 1V97A 3Q3JA 1TS2A 3RNAC 2UYZB 2LHEA 3ZO5B 4GGQA 3A9JB 4NNJB 4YXDB 1OQQA 4ANVA 1WXMA 2K3UA 2WDVB 4EE2A 3GOEA 3UF8A 3A4SC 1EF1A 4OVUA 2H89B 3URYA 4ITKA 1ZP0B 1C9FA 4GMVA 3H1UA 1I4PA 4EFOA 1H4RA 2SAKA 4NAMA 1GOZA 2LMCA 3DVGY 2KKCA 3UQAA 3P4QB 4KGRA 1XD3B 3UINB 4II2B 4LNNA 4MEMA 1OQRA 2KD0A 3MC8A 1HZ6A 1J0GA 1KRHA 1M4VA 2MHJA 1XLNA 5EE3A 3ML8A 1S1QB 4ANWA 3B9JA 2GBJA 1TS4A 2JZZA 3WIMA 4MT5A 3WALA 2Z0EB 1RAXA 5AUIA 1FFUA 3IT6B 1YQ3B 3FKYA 3NUHB 2BYTA 1EF5A 1EO6A 5HHDG 3H8HA 1QILA 2NBVB 3UI3A 2N7DA 4EEWA 2KO3A 4YSXB 1VZ6A 3PRPB 3SEBA 2O2VA 4WWNA 4W9LA 2D3AA 2W3RA 3NZUA 3Q3MC 2BYEA 3Q8EA 2C7HA 1C77A 4OVVA 2N7JA 1GUAB 4URKA 2K0PA 2DZMA 2DAFA 2FCQA 3TCAA 1LFDA 5LXHA 3GZNB 2LD9A 1QT9A 1X1MA 3KVFB 1J7BA 2OOBB 5BYRA 2NPTB 3LYYA 2NTSA 2QJLA 3NG0A 4PT5A 1T3QA 2DLBA 2K9XA 4ZRIA 3W5VB 4JE3B 4P7IA 3PSEB 3PVLA 2M1MA 2N1WA 4GDKA 1I4XA 1C79A 1MHXA 2AQ3B 2BW2A 2LHDA 2IO3B 4DHJD 3VRBB 3PHXB 1UNSA 2LEKA 4BKTA 1BUIC 4LJOB 1YMHE 4B0EA 1GJZA 4W9IA 3AE4B 2BBCA 1D4BA 5TR5A 4XWTA 1QOBA 5GMVA 3PLVA 5IOIA 2KTRB 1L7YA 4BBNC 5GXGB 4NJCA 2D3GA 2WXPA 1YJIA 4G11A 5HKHA 4JPSA 2ZVOA 1OQYA 1V9JA 2HDEA 1NVID 2XK5B 3L4PA 2RR9A 2WDRB 2NBWB 1BMLC 4YWGG 4RMAA 2ZW1A 5CHFA 3NOBA 2W55A 1I4RA 1E10A 5IO9A 1VD2A 1L2NA 1C4AA 2JRIB 4MJSB 2L32A 2MBQA 1L6UA 1Y8RC 5BMGA 2KJ6A 1S3SG 2MWSB 3QARA 2G4SA 2KXJA 2KVZA 3IG3A 2G45B 4MELA 1AWDA 2G1EA 3RNBC 4GLSC 1V49A 2YEPB 1UZXB 4K7WA 3RI7C 3NRZA 2XBBC 1RRBA 5BYQA 1FO4A 2JZPA 3RUIB 2FUG1 4N58A 3UGBB 4DDGD 2JVCA 3HK0A 1YIWA 1HE8A 2C60A 2FIDA 1T0YA 3WCQA 4JWUC 1TY2A 3DBSA 1TZOA 2UU7A 2CR5A 2LVPA 4RM9A 2V0GA 1E7UA 2CHZA 3UIPB 3ZNGC 2KHWB 5L95C 1J8CA 4NAWA 3DPDA 2MJEA 2M0XA 3N1XC 1EU3A 2MCNB 2QMTA 4TMAB 4E71A 4WJOA 3VFKA 3CIRB 3ENEA 5AUKA 3Q3FA 1YOVB 4AS1A 2QHOA 3U7DA 2J52A 4WJPA 2DBYA 3BY4B 4CHKA 2HE7A 1WSPA 2LGYA 3BZDB 3HUIA 5FK9C 1TTNA 1TY0A 4PS8A 3ECIA 2WNMA 4RGNA 1JWMD 3TEXA 4AQ7A 1FXIA 5EE9A 2Y5CA 2JZ3B 1FCCC 4DHZE 2J0KA 2M17A 3I57A 4P1CC 3ZTDA 2LGDA 2WX1A 2QILA 3FILA 2IGHA 1M94A 2N9LA 3VAWA 3L10B 3ZQ4A 1E7VA 3PREA 2UWQA 2CS4A 3EGRA 1C4PA 2BKRB 2MLBA 2PEAA 2BB6A 3V62A 1Q1OA 3T3OA 2N9XA 1FM0D 3TEZA 1DOIA 3IXSA 3NS8A 3ZRCA 3AECB 3QX1A 4C80A 3N30A 3MHSD 4HPPA 4HWIB 3AE9B 5IP4D 4Q2JA 2BPSA 1WYGA 3AH7A 1SSNA 2KNBA 4K3BA 4AWJA 1WJ4A 2MJ3A 1ROEA 4BOSC 4WIPA 3A9JA 2YEPF 4MGZE 4DK5A 4JLCA 2ICIA 2BWES 2M56B 3EA6A 3A1QB 4BVUC 5T8IA 3TL5A 3C19A 4RGMA 2IDYA 3P63A 4MGYE 3LJ3A 3DVNU 3AB5A 2I2YA 5LNK1 4GIVA 4US8A 2EMSA 3OWEB 4NZLB 1PGBA 1UF0A 4XC2A 3WAPA 3ZJUA 2HTME 1A70A 2LVOA 3DOWA 1OEYJ 1WXVA 1LGRA 3HHMA 2ZVNA 1L5PA 3QJZA 1RM6C 3U30A 3OJ3A 4IWOA 4WH4A 4MDKE 1MFWA 4RH6A 1JCKB 4DQOC 3KWVA 1HQRD 2RMMA 1XF5L 5BMHA 4W9JA 1VDVA 1L4DB 2QEJC 3UQBA 2J42A 4ZYSA 1I4HA 3VRAB 3ZJVA 4BKGA 2G9HD 1RYJA 2IO1B 1V5OA 4FHJA 2WU5B 3X0WA 1GC6A 2TSSA 5CX3A 3VR8B 2OJWA 3PTFC 1H8CA 4RNAA 2DZIA 4WAFA 4YSYB 2KWVB 1YJJA 1TKYA 3L0WB 3L08A 2MBHA 2W9NA 3DDCB 2MQJA 2VH2A 5BYSA 2KFKB 3BINA 4A3OA 2ONQA 2Y3AA 3P4RB 5JHAA 2D3CA 2NPTA 2K25A 3Q8BA 2N0SB 3SHQA 3APCA 3N32A 4EZKA 2AL3A 1K50A 2N9KA 4R3DA 2VH1A 3EC8A 2Q5WD 3JVZX 2J4XA 2LGXA 2W3SA 2MRPA 3BWUD 2G3QB 1V5TA 1QKZA 1EUVB 3GP7A 2IO2B 2NS5A 2WXQA 2D5GA 3E56A 1SIJA 2L76A 1E9MA 5LXIB 3L54A 3TSSA 2V3PA 3OG5A 1G6JA 2XK5A 2AWTA 3M95A 1SEBD 1JWUD 1WGKA 3DBRB 2KAJA 2R2QA 1L0YB 1QOFA 2WWZA 1AN8A 2J0MA 3BVMA 2L3ZA 4NJ6A 4GDLB 4LLGM 2M0AA 3HVZA 1F1HA 3QC8B 5CTRC 4MJSA 3EFUA 3U4EG 3V05A 2Z59B 4C4VA 4YTPB 1E8XA 1GC7A 2CJNA 2MBBB 2PMVA 3EFCA 3AEBB 4C00A 2PKOA 4WWOA 4A20A 4IWPA 4YTNB 3PV1A 4RCOA 2D11A 1GB1A 3MHZA 3BYTB 2JYEA 1V1PA 1R4NI 1IUEA 4A55A 5DCNA 1WX8A 1OTRB 1KLVA 1RFKA 3AE5B 1WY8A 4LJPB 4IM2A 3L17A 5I4DA 2WXLA 3APFA 2IBIB 2KQ4X 2R2OA 2W54A 3I5JC 2JYTA 3W2DA 1YNTE 3VVWB 3U2SC 2IZVB 3QK0A 2KQ7A 2O6VB 1L0VB 2HD5B 3OLMD 2OHFA 2DAJA 4MGIE 2D07B 4HXDA 4TKNA 4A9AA 2MBEA 5E6OA 2K8CA 2L1AA 5G5GA 5D2MB 1ZDVA 1WR6E 5IN7A 3A4RA 5DPRA 2FBWB 1HEZE 1C4CA 3RN9C 4HVBA 1XCTL 1IGCA 1I42A 2PVOD 3R8BA 1T0RC 1UWMA 3Q3OC 2EELA 2J0JA 1QF6A 5BMIA 2IGGA 3IVFA 4X57B 3AE1B 2A5UA 5JZEB 4KSLC 5DPTA 1I4QA 3PT2B 1Q10A 3GS2A 2NR2A 3AU5A 1YX6B 4IM0A 2WGSA 4FULA 3IAM1 3V61A 2V4IB 2BB5A 2QC8A 1Z5SB 1NENB 1WM2A 1B9RA 4K7SA 4ZRQA 3RULA 4FHKA 1MPEA 5HFYA 4BBNF 1I4GA 2ZW0A 3GZNI 3PO0A 5E6NA 3DCGA 4RGTA 3AV8A 3ZXVA 1N5WA 3MC0B 4O1NA 4ZRJA 1OEYA 2BKFA 4BKSA 3SU8X 2KX3A 2GBNA 2KC1A 4S17A 1MI0A 1AYFA 4HPLB 4A8XC 3A1QA 1WX9A 1ZOYB 1WGRA 1VJKA 3AXCA 2LWPA 3LXFA 3QWZB 1ZPSA 1WRDB 1KM7A 3Q14C 3PPAA 5MPOA 4NPNA 2C7MB 1WF9A 1E90A 3BIID 3ZNID 4P16A 2BVCA 2LRUA 2MW5A 5TSSA 3W1SA 1GNUA 2LUEA 4WJQA 3V3XA 4WQMA 4I6LB 3B2GA 2N1VA 3JSVB 3V6CB 2IY1B 1FNVA 1YX5B 2WXMA 1WRIA 1J7AA 1HTOA 3HM6X 4MH0E 4BFRA 2M8SA 4DXAB 3R7QA 5AEKB 4RFBA 4TSSA 1TGZB 1NYQA 3QQ8B 4IC7B 2NVUI 3B1LX 4FADA 1QLBB 1FNWA 3ZYYX 4K3CA 4XZ4A 2WU2B 4G0NB 2KN4A 3N20C 1F77A 1TYGB 3RNFC 3DHIC 4BKSD 1QOAA 4MSMB 2WXOA 5EE1A 2V3NA 3JW0X 1FXAA 2L0TA 2KX0A 2M19A 4IM3A 1FCLA 3R2IA 2WYQA 4XDCA 3H7PB 1XLQA 3L13A 1P1AA 2KFKA 1WM3A 2GLSA 1I7HA 5IKCM 2E6XA 4DBGA 4CO7A 1JWSD 1WXQA 4S0RA 2BS4B 1STEA 2RGFA 4KIKB 3RT3B 2V3SA 3BVGA 3FAHA 3M62B 3AU4A 2KMAA 3IHPC 3KUDB 1WXSA 2DZJA 2MEKA 1VLBA 4ICVA 2KK8A 4ANXA 1D5ZC 2EMTA 3RMKC 2KWDA 1WJ6A 3HM3A 2EKIA 4KDLB 2WHIA 1F2RC 3BK2A 4WWMA 2MA9B 1VRAB 2GBKA 4L2YA 5IAAC 3Q3NC 1KTKA 3AI5A 2KMMA 2L00B 1NYRA 4KKJA 2LI5A 4F7ZA 3KUZA 2JPHA 2N9EB 4GDLA 1ZGUB 4GN1A 3J9CA 4US9A 4G50A 5EDSA 2LXAA 3A33B 1NBFC 3RZFA 3O65B 3EECA 3KYCD 2V4LA 4B0MA 5J18A 4LTUA 4TUUA 3MJWA 4ANUA 3WANA 1SBBB 1E6EB 4J6IA 5AZGA 2JWUA 3P1MA 1FEHA 1PGAA 4W9EA 5HG2A 1TT5B 1FXTB 2KANA 2MH7A 2WXIA 3AMZA 4YL8A 2ZNVB 2G4DB 3AEFB 1IBXB 3LDZE 1KH0A 1JMLA 3APDA 1PFDA 4XYCA 3AULA 3ZNHB 2PTLA 3AE7B 4DHJB 3AEAB 2A4ZA 4FBJB 1KJTA 2LUMA 2MX2A 3ZUNA 3DVGX 2O6VA 4LDTB 1AARA 2JRHA 2PLPA 4UDUC 1P3QU 2DYMA 1Q5WB 5FKAC 2K8BA 2C5LC 2CU3A 2JUOA 2VZKB 2MSED 4PYZA 2FCMA 2CJOA 3VUXA 4JQWC 4M0WB 1OFFA 4OZAA 4AP4C 1PUTA 3PLUA 2GMIC 1SGHA 2R61A 3N1YC 3O13A 3L16A 3TEYA 3P4PB 4KDIC 2AQ1B 1IP9A 2KDMA 4WWPA 4L23A 3MC9A 1B1ZA 2H88B 2BGFA 3HIZA 2C7NB 4MACA 3CWIA 2V1YA 1WMHB 2X38A 1CK1A 1CZPA 2DHZA 1WYWB 3IAS1 1K53A 5J2RA 4IOIE 3D32A 1NI3A 3SR6A 1QZEA 1T6BX 4FN2A 3VDZA 5D7GA 2K6DB 2V9HA 3NY5A 1ISNA 1T0SC 2J53A 3VH4B 2K1FA 4LK0M 3UIOB 3PRMB 4BAXA 3TEWA 4EUTA 1D6EC 2ON8A 2XNAC 2RSUA 3AEDB 5G2NA 1F52A 4A90A 4YTMB 1TIFA 1WZ3A 4KKIA 2GI9A 4FJVB 2KWUB 3B0AA 4JX1C 1EU4A 4CYEA 1UUPA 4ZDVA 4RM8A 4DXFA 3Q8AA 1WGDA 4KV2A 3S2AA 1WR1A 4M02A 4WURA 3SDLC 4USAA 3DBHB 3H7SA 5H92C 4IW0A 1TJEA 3C0RB 1D5MC 2BWFA 4HPMB 3I3TB 4IG7B 2KLCA 5D6JB 3DBRI 4ARIA 1TKEA 1C3TA 1JWAD 2SEBD 4LNOA 3NVYA 2ZPYA 2NBUA 1MHHE 3JSVA 1QQRA 3PGEA 3R7RA 2I38A 5EE0A 1HXYD 3V60A 1WWTA 4PS7A 1JROA 5C3JB 3QIJA 3ZRFA 1SE4A 3PHWB 1K8RB 1PYWD 2KTRA 1YN3A 3PZDA 3PZ7A 4DWFA 4F8CB 3VUWA 3RNCC 1A5RA 5D3IB 4TV3A 1UGJA 2HTHA 4HKZE 2ZCBA 3I63C 4GOCA 4FJYA 4M01A 4ZHPA 4OVZA 1LQBA 2RPVA 1L0XB 1KLGD 2Z0DB 2KJHB 3NJTA 1WGGA 1D5XC 1HTQA 4WQOB 1PQSA 2WXJA 3RCZA 1JW9D 1TBEA 1WJUA 1YQ4B 4ASWC 1FD6A 1AW7A 3ABVB 3KUCB 3DWGC 1WZ0A 2GOWA 3TJPA 2QDFA 2LJ5A 1R4MB 3H7PA 4GB9A 2INCC 4WJNA 2INDC 4HK2A 5AZHA 3P2BA 2ZEQA 2LRWA 2KQSA 1SIFA 3B2FA 3T3NA 1FIQA 4LNIA 1VCBA 2PW9A 5G5HA 3RNEC 2FCNA 4KIKA 4IDIA 2JSVX 2BYVE 5DPSA 3X23A 1F2RI 3AE6B 2D10A 4AJWA 5C1ZA 1YD8U 1V1OA 3DBLB 2NMQA 3K9OB 3AEGB 3SFDB 2WXNA 2WXKA 2CKHB 1I35A 1XO3A 2I1KA 1YN5A 2INNE 2RPQA 3VTVA 1Y56A 3KW5B 2DYBA 3GE8C 2JWZA 1CQVA 4N6EB 1EM7A 1WE6A 4H2AA 1SB3C 3MFGA 2JU6X 2OEDA 1MJDA 1KOTA 3OJ4B 3VH3B 2WX0A 1F9JA 3K9PB 1N62A 2KJRA 4II3B 3C8YA 4RF0A 2BQQA 4PYUA 3ZNZB 2IY0B 4AUQC 2KWCA 2RDGA 1SE9A 4HEA1 2D2QA 4JIOU 3W1SC
chains in the Genus database with same CATH topology
3Q3OC 3RMKC 4P1BC 3RNFC 3I5JC 3RNBC 3RNEC 3RI7C 4P1CC 3DHHC 3N1ZC 1T0SC 3GE8C 1T0QC 3RNCC 2RDBC 3RN9C 3N1XC 3GE3C 3Q3NC 3RNAC 3I63C 3RNGC 3Q14C 3N20C 3Q2AC 3N1YC 2INCC 3DHGC 2INDC 1T0RC 3Q3MC 3DHIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3O C;  3RMK C;  4P1B C;  3RNF C;  3I5J C;  3RNB C;  3RNE C;  3RI7 C;  4P1C C;  3DHH C;  3N1Z C;  1T0S C;  3GE8 C;  1T0Q C;  3RNC C;  2RDB C;  3RN9 C;  3N1X C;  3GE3 C;  3Q3N C;  3RNA C;  3I63 C;  3RNG C;  3Q14 C;  3N20 C;  3Q2A C;  3N1Y C;  2INC C;  3DHG C;  2IND C;  1T0R C;  3Q3M C;  3DHI C; 
#chains in the Genus database with same CATH topology
 4ZRP A;  2ZCC A;  2KN5 A;  2YVC A;  1ET6 A;  3HRD D;  3N9Y C;  1P7E A;  5E6P A;  2BS3 B;  3KWL A;  3H9D A;  3U52 E;  2PE9 A;  3HVD A;  1IBX A;  2LXC A;  4EOY A;  3QA8 A;  1YJ1 A;  1FNU A;  1DGJ A;  2KDE B;  2KOX A;  3NVZ A;  3U8Z A;  3FC4 A;  2KDI A;  2K39 A;  1UH6 A;  4GSW A;  1VR9 A;  2D3B A;  2QCZ A;  3W1Y A;  2KT7 A;  1N6Z A;  2RDH A;  3NVV A;  2HJ8 A;  3M3J A;  3AM9 A;  3NHE B;  5JXV A;  4NQL B;  2PJH A;  4OW0 A;  5JHB A;  1N61 A;  5LLI A;  3VR9 B;  4FJZ A;  4CQN A;  1ZE3 D;  1R7S A;  4EKU A;  3T8M A;  4KSK C;  4M0W A;  1E8Z A;  1CMX B;  3VTU A;  4IWQ A;  4C7Z A;  4K81 A;  1F0Z A;  3GB1 A;  1XXG A;  2L05 A;  2J7Q B;  2OJR A;  2I1J A;  2NCN A;  4W9F A;  2GB1 A;  2KDB A;  1P9D U;  2HJ1 A;  4P1B C;  1TS3 A;  3ML9 A;  3H6N A;  1ACC A;  2GRI A;  4XGA B;  1T0Q C;  1WFY A;  1YN4 A;  2CHX A;  2WDT B;  3WAM A;  3CF6 E;  3MTN B;  2DEN B;  3AE8 B;  3U7Z A;  2KDF B;  1WMH A;  4OZB A;  3KQ4 A;  2BS2 B;  2K8H A;  2B3A A;  2ZJD A;  1P7F A;  4P6V F;  5BO4 B;  4YSZ B;  1SJH D;  1JWB D;  4XWW A;  2E3T A;  4N59 A;  4ARC A;  1XEE A;  1P98 A;  2FCS A;  4LDT D;  5KHO A;  3ZTC A;  3IT4 B;  3MJ5 A;  1HA5 A;  3RD2 A;  4GXB A;  1ESF A;  2JT4 B;  4HKQ A;  5E6J A;  1WI0 A;  2M4N A;  2VZK D;  4JWS C;  4KZC A;  3NS1 A;  3ALB A;  2MBO A;  3TMP B;  1V86 A;  4N9F 4;  1J19 A;  2WXH A;  3KYD D;  2KAC A;  4LNK A;  3P42 A;  1V2Y A;  5AZF A;  1L4Z B;  2KVR A;  1WJN A;  3A9K B;  3GE3 C;  1SXT A;  1SJE D;  1T5X D;  3CST A;  1RFA A;  2BF8 B;  3NZS A;  3ONS A;  2LZ6 A;  4M8M A;  2DYO A;  3RFZ B;  1FPY A;  3VHT C;  4E3C A;  3AE2 B;  4XX5 A;  2K22 A;  1MVK A;  2LVQ A;  1SE2 A;  1LM8 B;  4C4V B;  4W9H A;  4HCP B;  1FMA D;  2RDB C;  4GU2 A;  1LO5 D;  1C76 A;  1WE7 A;  4A3P A;  3EUB 2;  1GG3 A;  1VZ7 A;  2EKE C;  2VRR B;  1FFV A;  3DVN V;  4B9K A;  2KFJ A;  1V1P B;  5DPW A;  4BZA A;  4G3X B;  2K5P A;  3VQI A;  2ZPN A;  3QCA A;  5J17 A;  4HRO A;  4MH8 A;  4MM3 B;  1WGH A;  4I6N B;  4W9G A;  2Z8L A;  2Y5P A;  2ZZP B;  3BVZ A;  1UBI A;  1L6V A;  1MG4 A;  3JYU A;  4FLH A;  1UEL A;  2XN9 C;  2LJI A;  4KVG B;  4MGK E;  3TBL D;  1N60 A;  1ZW7 A;  4JGH B;  5IA7 A;  3ZXR A;  2MP2 B;  4XE0 A;  1GAQ B;  4AOF A;  4PS3 A;  3NZ3 A;  3RYT A;  4HCN B;  4NQK E;  2DZK A;  5H8Y E;  3TUO A;  1P0R A;  1K51 A;  1ZXH A;  1RWS A;  1SE3 A;  2FIF A;  1FRD A;  2FUH B;  4FXC A;  2KTF A;  2DNF A;  2IO0 B;  3AE3 B;  3WA0 A;  1UWX A;  2L83 A;  4NY0 A;  4C56 C;  3ZGZ A;  4LNF A;  2WS3 B;  3AEE B;  1XQQ A;  1SF0 A;  2N4F A;  1DYQ A;  2WP9 B;  1MG8 A;  1N63 A;  2B76 B;  5CHV C;  2LGI A;  1TS5 A;  2JY6 A;  4W9K A;  2WXR A;  2ACZ B;  4W9D A;  1VZ8 A;  4HDQ A;  4NJ7 A;  2N7E A;  3W9C B;  1OGW A;  2K6Q A;  4M8N A;  2AX5 A;  3M63 B;  2L52 A;  2RD0 A;  3Q69 A;  4HRS A;  1JQ4 A;  3IBE A;  4EZL A;  2BYF A;  2WQY B;  5FR3 A;  3NVW A;  4YT0 B;  1Z2M A;  3T9L A;  1DOX A;  5CHW A;  3KH0 A;  3WAO A;  3E9S A;  2FAZ A;  3DHH C;  4ICU A;  2LGS A;  3PZ8 A;  4B6W A;  1GB4 A;  4DXG A;  2N9P C;  4RF1 A;  2JX5 A;  3BYY B;  4JL9 A;  2O2V B;  4RGO S;  4REZ A;  3AN1 A;  4QAY A;  1U4A A;  3QAQ A;  2DWQ A;  5C2T B;  2WLB A;  4IKG A;  4EZJ A;  4ZRK A;  5FR6 A;  3P4S B;  2PIA A;  1ENF A;  1HZ5 A;  1NI2 A;  4K1R B;  1E8W A;  2YLM A;  2CU1 A;  3ZDM C;  1YQB A;  1PGX A;  2AL6 A;  1TZ1 A;  2DX5 B;  3Q2A C;  2KC2 A;  3DHG C;  3DQV A;  4MSQ B;  2WXF A;  1WXA A;  3VTW A;  3OAW A;  4OHJ A;  2IPK D;  4GDK B;  1ZXI A;  2IGD A;  1KF6 B;  4LCD E;  1WX7 A;  4TQ1 A;  1PDX A;  2REX A;  5D3D A;  2O6V D;  1XLO A;  3LB8 C;  3ZJT A;  2LFI A;  2WXG A;  4C7Y A;  1NEK B;  2LAS A;  3V6E B;  3R3M A;  3CSF A;  3CMM B;  1C78 A;  2AYO B;  1XLP A;  3DBH I;  4A6Q A;  4E74 A;  3I9V 1;  4HJK A;  1WIA A;  4KZ0 A;  2X8X X;  4F1S A;  1TKG A;  2W82 A;  1CJE A;  2ASQ A;  2AEH A;  1C1Y B;  1FRR A;  1IYF A;  5KHQ A;  2JF5 A;  3RNG C;  1EWC A;  2JQR B;  2KYW A;  1KLU D;  4ZYN A;  2CHW A;  2NTT A;  3RPF C;  3ZDT A;  5C23 A;  3SD5 A;  1EWY C;  1UGM A;  2AQ2 B;  1JAL A;  4HJG E;  4BOZ B;  1IPG A;  1KFY B;  2KMC A;  1UBQ A;  3R66 C;  4PK1 A;  2KZR A;  3SFE B;  1E5W A;  3RZW C;  4AJY B;  3TIX A;  3ZIM A;  2JXX A;  3B08 A;  4DHZ B;  4J3O D;  4B95 A;  2QIE B;  4ZHO A;  1R4M I;  2IJ0 A;  2Y5B B;  5G55 A;  4TQ0 A;  2BT6 A;  2WDQ B;  3PRZ A;  2L0F A;  5HI1 A;  1BT0 A;  2GBR A;  3Q8C A;  1E8Y A;  2JXT A;  4KGS A;  2PPH A;  2KLG A;  2XEW A;  1LXD A;  3ZLZ A;  1D3Z A;  1RLF A;  4KGT A;  4NAW B;  3VXW A;  1NDD A;  4FA6 A;  4XDD A;  4IUM B;  2GBM A;  2L7R A;  1V81 A;  3A9K A;  3DBL I;  2PE6 B;  2PVG C;  1ET9 A;  2INP E;  1WH3 A;  2FNJ B;  1WGY A;  2L8J A;  4ACF A;  1N5X A;  3ZW3 A;  1ZKH A;  2ZNV C;  4M00 A;  1K52 A;  4D2K A;  4DDI D;  1UD7 A;  4L1B A;  4HDO A;  1GPX A;  2BTE A;  3Q8F A;  4W9C A;  4WAA A;  1E7P B;  3N3K B;  3EHV A;  4I6P A;  3ZVV A;  1QOG A;  3MP9 A;  4OZC A;  4HLE A;  1ZDX A;  3QHT A;  1IGD A;  3R2T A;  1Q0W B;  1E0Z A;  1JRP A;  3FIL B;  1XCQ L;  3N1Z C;  4ZOH C;  3ZKJ C;  2C9W B;  1V8C A;  3IFW B;  2MJD A;  4MM3 A;  5D94 A;  4K7U A;  1JRU A;  3ETR A;  1V6E A;  3VUY A;  3KLS X;  1ZUD 2;  1XT9 B;  5JH5 C;  3Q6B A;  1DOY A;  3DWM A;  3W5U B;  1J7C A;  3BK1 A;  2IYD B;  2QSD A;  4KX6 B;  1V80 A;  3PS6 A;  5L83 A;  1BXT A;  1R4N B;  2FE8 A;  2MP2 A;  1V97 A;  3Q3J A;  1TS2 A;  3RNA C;  2UYZ B;  2LHE A;  3ZO5 B;  4GGQ A;  3A9J B;  4NNJ B;  4YXD B;  1OQQ A;  4ANV A;  1WXM A;  2K3U A;  2WDV B;  4EE2 A;  3GOE A;  3UF8 A;  3A4S C;  1EF1 A;  4OVU A;  2H89 B;  3URY A;  4ITK A;  1ZP0 B;  1C9F A;  4GMV A;  3H1U A;  1I4P A;  4EFO A;  1H4R A;  2SAK A;  4NAM A;  1GOZ A;  2LMC A;  3DVG Y;  2KKC A;  3UQA A;  3P4Q B;  4KGR A;  1XD3 B;  3UIN B;  4II2 B;  4LNN A;  4MEM A;  1OQR A;  2KD0 A;  3MC8 A;  1HZ6 A;  1J0G A;  1KRH A;  1M4V A;  2MHJ A;  1XLN A;  5EE3 A;  3ML8 A;  1S1Q B;  4ANW A;  3B9J A;  2GBJ A;  1TS4 A;  2JZZ A;  3WIM A;  4MT5 A;  3WAL A;  2Z0E B;  1RAX A;  5AUI A;  1FFU A;  3IT6 B;  1YQ3 B;  3FKY A;  3NUH B;  2BYT A;  1EF5 A;  1EO6 A;  5HHD G;  3H8H A;  1QIL A;  2NBV B;  3UI3 A;  2N7D A;  4EEW A;  2KO3 A;  4YSX B;  1VZ6 A;  3PRP B;  3SEB A;  2O2V A;  4WWN A;  4W9L A;  2D3A A;  2W3R A;  3NZU A;  3Q3M C;  2BYE A;  3Q8E A;  2C7H A;  1C77 A;  4OVV A;  2N7J A;  1GUA B;  4URK A;  2K0P A;  2DZM A;  2DAF A;  2FCQ A;  3TCA A;  1LFD A;  5LXH A;  3GZN B;  2LD9 A;  1QT9 A;  1X1M A;  3KVF B;  1J7B A;  2OOB B;  5BYR A;  2NPT B;  3LYY A;  2NTS A;  2QJL A;  3NG0 A;  4PT5 A;  1T3Q A;  2DLB A;  2K9X A;  4ZRI A;  3W5V B;  4JE3 B;  4P7I A;  3PSE B;  3PVL A;  2M1M A;  2N1W A;  4GDK A;  1I4X A;  1C79 A;  1MHX A;  2AQ3 B;  2BW2 A;  2LHD A;  2IO3 B;  4DHJ D;  3VRB B;  3PHX B;  1UNS A;  2LEK A;  4BKT A;  1BUI C;  4LJO B;  1YMH E;  4B0E A;  1GJZ A;  4W9I A;  3AE4 B;  2BBC A;  1D4B A;  5TR5 A;  4XWT A;  1QOB A;  5GMV A;  3PLV A;  5IOI A;  2KTR B;  1L7Y A;  4BBN C;  5GXG B;  4NJC A;  2D3G A;  2WXP A;  1YJI A;  4G11 A;  5HKH A;  4JPS A;  2ZVO A;  1OQY A;  1V9J A;  2HDE A;  1NVI D;  2XK5 B;  3L4P A;  2RR9 A;  2WDR B;  2NBW B;  1BML C;  4YWG G;  4RMA A;  2ZW1 A;  5CHF A;  3NOB A;  2W55 A;  1I4R A;  1E10 A;  5IO9 A;  1VD2 A;  1L2N A;  1C4A A;  2JRI B;  4MJS B;  2L32 A;  2MBQ A;  1L6U A;  1Y8R C;  5BMG A;  2KJ6 A;  1S3S G;  2MWS B;  3QAR A;  2G4S A;  2KXJ A;  2KVZ A;  3IG3 A;  2G45 B;  4MEL A;  1AWD A;  2G1E A;  3RNB C;  4GLS C;  1V49 A;  2YEP B;  1UZX B;  4K7W A;  3RI7 C;  3NRZ A;  2XBB C;  1RRB A;  5BYQ A;  1FO4 A;  2JZP A;  3RUI B;  2FUG 1;  4N58 A;  3UGB B;  4DDG D;  2JVC A;  3HK0 A;  1YIW A;  1HE8 A;  2C60 A;  2FID A;  1T0Y A;  3WCQ A;  4JWU C;  1TY2 A;  3DBS A;  1TZO A;  2UU7 A;  2CR5 A;  2LVP A;  4RM9 A;  2V0G A;  1E7U A;  2CHZ A;  3UIP B;  3ZNG C;  2KHW B;  5L95 C;  1J8C A;  4NAW A;  3DPD A;  2MJE A;  2M0X A;  3N1X C;  1EU3 A;  2MCN B;  2QMT A;  4TMA B;  4E71 A;  4WJO A;  3VFK A;  3CIR B;  3ENE A;  5AUK A;  3Q3F A;  1YOV B;  4AS1 A;  2QHO A;  3U7D A;  2J52 A;  4WJP A;  2DBY A;  3BY4 B;  4CHK A;  2HE7 A;  1WSP A;  2LGY A;  3BZD B;  3HUI A;  5FK9 C;  1TTN A;  1TY0 A;  4PS8 A;  3ECI A;  2WNM A;  4RGN A;  1JWM D;  3TEX A;  4AQ7 A;  1FXI A;  5EE9 A;  2Y5C A;  2JZ3 B;  1FCC C;  4DHZ E;  2J0K A;  2M17 A;  3I57 A;  4P1C C;  3ZTD A;  2LGD A;  2WX1 A;  2QIL A;  3FIL A;  2IGH A;  1M94 A;  2N9L A;  3VAW A;  3L10 B;  3ZQ4 A;  1E7V A;  3PRE A;  2UWQ A;  2CS4 A;  3EGR A;  1C4P A;  2BKR B;  2MLB A;  2PEA A;  2BB6 A;  3V62 A;  1Q1O A;  3T3O A;  2N9X A;  1FM0 D;  3TEZ A;  1DOI A;  3IXS A;  3NS8 A;  3ZRC A;  3AEC B;  3QX1 A;  4C80 A;  3N30 A;  3MHS D;  4HPP A;  4HWI B;  3AE9 B;  5IP4 D;  4Q2J A;  2BPS A;  1WYG A;  3AH7 A;  1SSN A;  2KNB A;  4K3B A;  4AWJ A;  1WJ4 A;  2MJ3 A;  1ROE A;  4BOS C;  4WIP A;  3A9J A;  2YEP F;  4MGZ E;  4DK5 A;  4JLC A;  2ICI A;  2BWE S;  2M56 B;  3EA6 A;  3A1Q B;  4BVU C;  5T8I A;  3TL5 A;  3C19 A;  4RGM A;  2IDY A;  3P63 A;  4MGY E;  3LJ3 A;  3DVN U;  3AB5 A;  2I2Y A;  5LNK 1;  4GIV A;  4US8 A;  2EMS A;  3OWE B;  4NZL B;  1PGB A;  1UF0 A;  4XC2 A;  3WAP A;  3ZJU A;  2HTM E;  1A70 A;  2LVO A;  3DOW A;  1OEY J;  1WXV A;  1LGR A;  3HHM A;  2ZVN A;  1L5P A;  3QJZ A;  1RM6 C;  3U30 A;  3OJ3 A;  4IWO A;  4WH4 A;  4MDK E;  1MFW A;  4RH6 A;  1JCK B;  4DQO C;  3KWV A;  1HQR D;  2RMM A;  1XF5 L;  5BMH A;  4W9J A;  1VDV A;  1L4D B;  2QEJ C;  3UQB A;  2J42 A;  4ZYS A;  1I4H A;  3VRA B;  3ZJV A;  4BKG A;  2G9H D;  1RYJ A;  2IO1 B;  1V5O A;  4FHJ A;  2WU5 B;  3X0W A;  1GC6 A;  2TSS A;  5CX3 A;  3VR8 B;  2OJW A;  3PTF C;  1H8C A;  4RNA A;  2DZI A;  4WAF A;  4YSY B;  2KWV B;  1YJJ A;  1TKY A;  3L0W B;  3L08 A;  2MBH A;  2W9N A;  3DDC B;  2MQJ A;  2VH2 A;  5BYS A;  2KFK B;  3BIN A;  4A3O A;  2ONQ A;  2Y3A A;  3P4R B;  5JHA A;  2D3C A;  2NPT A;  2K25 A;  3Q8B A;  2N0S B;  3SHQ A;  3APC A;  3N32 A;  4EZK A;  2AL3 A;  1K50 A;  2N9K A;  4R3D A;  2VH1 A;  3EC8 A;  2Q5W D;  3JVZ X;  2J4X A;  2LGX A;  2W3S A;  2MRP A;  3BWU D;  2G3Q B;  1V5T A;  1QKZ A;  1EUV B;  3GP7 A;  2IO2 B;  2NS5 A;  2WXQ A;  2D5G A;  3E56 A;  1SIJ A;  2L76 A;  1E9M A;  5LXI B;  3L54 A;  3TSS A;  2V3P A;  3OG5 A;  1G6J A;  2XK5 A;  2AWT A;  3M95 A;  1SEB D;  1JWU D;  1WGK A;  3DBR B;  2KAJ A;  2R2Q A;  1L0Y B;  1QOF A;  2WWZ A;  1AN8 A;  2J0M A;  3BVM A;  2L3Z A;  4NJ6 A;  4GDL B;  4LLG M;  2M0A A;  3HVZ A;  1F1H A;  3QC8 B;  5CTR C;  4MJS A;  3EFU A;  3U4E G;  3V05 A;  2Z59 B;  4C4V A;  4YTP B;  1E8X A;  1GC7 A;  2CJN A;  2MBB B;  2PMV A;  3EFC A;  3AEB B;  4C00 A;  2PKO A;  4WWO A;  4A20 A;  4IWP A;  4YTN B;  3PV1 A;  4RCO A;  2D11 A;  1GB1 A;  3MHZ A;  3BYT B;  2JYE A;  1V1P A;  1R4N I;  1IUE A;  4A55 A;  5DCN A;  1WX8 A;  1OTR B;  1KLV A;  1RFK A;  3AE5 B;  1WY8 A;  4LJP B;  4IM2 A;  3L17 A;  5I4D A;  2WXL A;  3APF A;  2IBI B;  2KQ4 X;  2R2O A;  2W54 A;  3I5J C;  2JYT A;  3W2D A;  1YNT E;  3VVW B;  3U2S C;  2IZV B;  3QK0 A;  2KQ7 A;  2O6V B;  1L0V B;  2HD5 B;  3OLM D;  2OHF A;  2DAJ A;  4MGI E;  2D07 B;  4HXD A;  4TKN A;  4A9A A;  2MBE A;  5E6O A;  2K8C A;  2L1A A;  5G5G A;  5D2M B;  1ZDV A;  1WR6 E;  5IN7 A;  3A4R A;  5DPR A;  2FBW B;  1HEZ E;  1C4C A;  3RN9 C;  4HVB A;  1XCT L;  1IGC A;  1I42 A;  2PVO D;  3R8B A;  1T0R C;  1UWM A;  3Q3O C;  2EEL A;  2J0J A;  1QF6 A;  5BMI A;  2IGG A;  3IVF A;  4X57 B;  3AE1 B;  2A5U A;  5JZE B;  4KSL C;  5DPT A;  1I4Q A;  3PT2 B;  1Q10 A;  3GS2 A;  2NR2 A;  3AU5 A;  1YX6 B;  4IM0 A;  2WGS A;  4FUL A;  3IAM 1;  3V61 A;  2V4I B;  2BB5 A;  2QC8 A;  1Z5S B;  1NEN B;  1WM2 A;  1B9R A;  4K7S A;  4ZRQ A;  3RUL A;  4FHK A;  1MPE A;  5HFY A;  4BBN F;  1I4G A;  2ZW0 A;  3GZN I;  3PO0 A;  5E6N A;  3DCG A;  4RGT A;  3AV8 A;  3ZXV A;  1N5W A;  3MC0 B;  4O1N A;  4ZRJ A;  1OEY A;  2BKF A;  4BKS A;  3SU8 X;  2KX3 A;  2GBN A;  2KC1 A;  4S17 A;  1MI0 A;  1AYF A;  4HPL B;  4A8X C;  3A1Q A;  1WX9 A;  1ZOY B;  1WGR A;  1VJK A;  3AXC A;  2LWP A;  3LXF A;  3QWZ B;  1ZPS A;  1WRD B;  1KM7 A;  3Q14 C;  3PPA A;  5MPO A;  4NPN A;  2C7M B;  1WF9 A;  1E90 A;  3BII D;  3ZNI D;  4P16 A;  2BVC A;  2LRU A;  2MW5 A;  5TSS A;  3W1S A;  1GNU A;  2LUE A;  4WJQ A;  3V3X A;  4WQM A;  4I6L B;  3B2G A;  2N1V A;  3JSV B;  3V6C B;  2IY1 B;  1FNV A;  1YX5 B;  2WXM A;  1WRI A;  1J7A A;  1HTO A;  3HM6 X;  4MH0 E;  4BFR A;  2M8S A;  4DXA B;  3R7Q A;  5AEK B;  4RFB A;  4TSS A;  1TGZ B;  1NYQ A;  3QQ8 B;  4IC7 B;  2NVU I;  3B1L X;  4FAD A;  1QLB B;  1FNW A;  3ZYY X;  4K3C A;  4XZ4 A;  2WU2 B;  4G0N B;  2KN4 A;  3N20 C;  1F77 A;  1TYG B;  3RNF C;  3DHI C;  4BKS D;  1QOA A;  4MSM B;  2WXO A;  5EE1 A;  2V3N A;  3JW0 X;  1FXA A;  2L0T A;  2KX0 A;  2M19 A;  4IM3 A;  1FCL A;  3R2I A;  2WYQ A;  4XDC A;  3H7P B;  1XLQ A;  3L13 A;  1P1A A;  2KFK A;  1WM3 A;  2GLS A;  1I7H A;  5IKC M;  2E6X A;  4DBG A;  4CO7 A;  1JWS D;  1WXQ A;  4S0R A;  2BS4 B;  1STE A;  2RGF A;  4KIK B;  3RT3 B;  2V3S A;  3BVG A;  3FAH A;  3M62 B;  3AU4 A;  2KMA A;  3IHP C;  3KUD B;  1WXS A;  2DZJ A;  2MEK A;  1VLB A;  4ICV A;  2KK8 A;  4ANX A;  1D5Z C;  2EMT A;  3RMK C;  2KWD A;  1WJ6 A;  3HM3 A;  2EKI A;  4KDL B;  2WHI A;  1F2R C;  3BK2 A;  4WWM A;  2MA9 B;  1VRA B;  2GBK A;  4L2Y A;  5IAA C;  3Q3N C;  1KTK A;  3AI5 A;  2KMM A;  2L00 B;  1NYR A;  4KKJ A;  2LI5 A;  4F7Z A;  3KUZ A;  2JPH A;  2N9E B;  4GDL A;  1ZGU B;  4GN1 A;  3J9C A;  4US9 A;  4G50 A;  5EDS A;  2LXA A;  3A33 B;  1NBF C;  3RZF A;  3O65 B;  3EEC A;  3KYC D;  2V4L A;  4B0M A;  5J18 A;  4LTU A;  4TUU A;  3MJW A;  4ANU A;  3WAN A;  1SBB B;  1E6E B;  4J6I A;  5AZG A;  2JWU A;  3P1M A;  1FEH A;  1PGA A;  4W9E A;  5HG2 A;  1TT5 B;  1FXT B;  2KAN A;  2MH7 A;  2WXI A;  3AMZ A;  4YL8 A;  2ZNV B;  2G4D B;  3AEF B;  1IBX B;  3LDZ E;  1KH0 A;  1JML A;  3APD A;  1PFD A;  4XYC A;  3AUL A;  3ZNH B;  2PTL A;  3AE7 B;  4DHJ B;  3AEA B;  2A4Z A;  4FBJ B;  1KJT A;  2LUM A;  2MX2 A;  3ZUN A;  3DVG X;  2O6V A;  4LDT B;  1AAR A;  2JRH A;  2PLP A;  4UDU C;  1P3Q U;  2DYM A;  1Q5W B;  5FKA C;  2K8B A;  2C5L C;  2CU3 A;  2JUO A;  2VZK B;  2MSE D;  4PYZ A;  2FCM A;  2CJO A;  3VUX A;  4JQW C;  4M0W B;  1OFF A;  4OZA A;  4AP4 C;  1PUT A;  3PLU A;  2GMI C;  1SGH A;  2R61 A;  3N1Y C;  3O13 A;  3L16 A;  3TEY A;  3P4P B;  4KDI C;  2AQ1 B;  1IP9 A;  2KDM A;  4WWP A;  4L23 A;  3MC9 A;  1B1Z A;  2H88 B;  2BGF A;  3HIZ A;  2C7N B;  4MAC A;  3CWI A;  2V1Y A;  1WMH B;  2X38 A;  1CK1 A;  1CZP A;  2DHZ A;  1WYW B;  3IAS 1;  1K53 A;  5J2R A;  4IOI E;  3D32 A;  1NI3 A;  3SR6 A;  1QZE A;  1T6B X;  4FN2 A;  3VDZ A;  5D7G A;  2K6D B;  2V9H A;  3NY5 A;  1ISN A;  1T0S C;  2J53 A;  3VH4 B;  2K1F A;  4LK0 M;  3UIO B;  3PRM B;  4BAX A;  3TEW A;  4EUT A;  1D6E C;  2ON8 A;  2XNA C;  2RSU A;  3AED B;  5G2N A;  1F52 A;  4A90 A;  4YTM B;  1TIF A;  1WZ3 A;  4KKI A;  2GI9 A;  4FJV B;  2KWU B;  3B0A A;  4JX1 C;  1EU4 A;  4CYE A;  1UUP A;  4ZDV A;  4RM8 A;  4DXF A;  3Q8A A;  1WGD A;  4KV2 A;  3S2A A;  1WR1 A;  4M02 A;  4WUR A;  3SDL C;  4USA A;  3DBH B;  3H7S A;  5H92 C;  4IW0 A;  1TJE A;  3C0R B;  1D5M C;  2BWF A;  4HPM B;  3I3T B;  4IG7 B;  2KLC A;  5D6J B;  3DBR I;  4ARI A;  1TKE A;  1C3T A;  1JWA D;  2SEB D;  4LNO A;  3NVY A;  2ZPY A;  2NBU A;  1MHH E;  3JSV A;  1QQR A;  3PGE A;  3R7R A;  2I38 A;  5EE0 A;  1HXY D;  3V60 A;  1WWT A;  4PS7 A;  1JRO A;  5C3J B;  3QIJ A;  3ZRF A;  1SE4 A;  3PHW B;  1K8R B;  1PYW D;  2KTR A;  1YN3 A;  3PZD A;  3PZ7 A;  4DWF A;  4F8C B;  3VUW A;  3RNC C;  1A5R A;  5D3I B;  4TV3 A;  1UGJ A;  2HTH A;  4HKZ E;  2ZCB A;  3I63 C;  4GOC A;  4FJY A;  4M01 A;  4ZHP A;  4OVZ A;  1LQB A;  2RPV A;  1L0X B;  1KLG D;  2Z0D B;  2KJH B;  3NJT A;  1WGG A;  1D5X C;  1HTQ A;  4WQO B;  1PQS A;  2WXJ A;  3RCZ A;  1JW9 D;  1TBE A;  1WJU A;  1YQ4 B;  4ASW C;  1FD6 A;  1AW7 A;  3ABV B;  3KUC B;  3DWG C;  1WZ0 A;  2GOW A;  3TJP A;  2QDF A;  2LJ5 A;  1R4M B;  3H7P A;  4GB9 A;  2INC C;  4WJN A;  2IND C;  4HK2 A;  5AZH A;  3P2B A;  2ZEQ A;  2LRW A;  2KQS A;  1SIF A;  3B2F A;  3T3N A;  1FIQ A;  4LNI A;  1VCB A;  2PW9 A;  5G5H A;  3RNE C;  2FCN A;  4KIK A;  4IDI A;  2JSV X;  2BYV E;  5DPS A;  3X23 A;  1F2R I;  3AE6 B;  2D10 A;  4AJW A;  5C1Z A;  1YD8 U;  1V1O A;  3DBL B;  2NMQ A;  3K9O B;  3AEG B;  3SFD B;  2WXN A;  2WXK A;  2CKH B;  1I35 A;  1XO3 A;  2I1K A;  1YN5 A;  2INN E;  2RPQ A;  3VTV A;  1Y56 A;  3KW5 B;  2DYB A;  3GE8 C;  2JWZ A;  1CQV A;  4N6E B;  1EM7 A;  1WE6 A;  4H2A A;  1SB3 C;  3MFG A;  2JU6 X;  2OED A;  1MJD A;  1KOT A;  3OJ4 B;  3VH3 B;  2WX0 A;  1F9J A;  3K9P B;  1N62 A;  2KJR A;  4II3 B;  3C8Y A;  4RF0 A;  2BQQ A;  4PYU A;  3ZNZ B;  2IY0 B;  4AUQ C;  2KWC A;  2RDG A;  1SE9 A;  4HEA 1;  2D2Q A;  4JIO U;  3W1S C; 
#chains in the Genus database with same CATH homology
 3Q3O C;  3RMK C;  4P1B C;  3RNF C;  3I5J C;  3RNB C;  3RNE C;  3RI7 C;  4P1C C;  3DHH C;  3N1Z C;  1T0S C;  3GE8 C;  1T0Q C;  3RNC C;  2RDB C;  3RN9 C;  3N1X C;  3GE3 C;  3Q3N C;  3RNA C;  3I63 C;  3RNG C;  3Q14 C;  3N20 C;  3Q2A C;  3N1Y C;  2INC C;  3DHG C;  2IND C;  1T0R C;  3Q3M C;  3DHI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...