1C77A

Staphylokinase (sak) dimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
GKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
publication title Crystal structure of a staphylokinase: variant a model for reduced antigenicity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 22
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c77A00
1C76A 1C78A 1SSNA 2SAKA 1BUIC 1C79A 1C77A
chains in the Genus database with same CATH superfamily
4RF0A 2BWFA 2VRRB 2JPHA 2KMMA 1JWMD 2PPHA 1UGMA 1L2NA 1LGRA 5JH5C 1JWUD 4IW0A 2O2VB 3PTFC 3RNGC 1ET9A 2NMQA 1WSPA 3AXCA 2TSSA 3PRPB 5CHWA 2Y3AA 1SB3C 3VUYA 4WJPA 4XGAB 2WDTB 4PS3A 2EMSA 3EECA 4QAYA 1R4MB 3AM9A 3BINA 3P1MA 4E71A 3TEZA 1XCQL 2K6DB 4K3BA 1P9DU 3AE1B 5D6JB 1ZE3D 1EU3A 2G1EA 2I38A 1VRAB 1C4PA 4DHZB 3H6NA 2K22A 2W54A 4JWUC 3N1YC 3DHHC 4D2KA 3I9V1 2LHEA 3VQIA 4R3DA 3C0RB 1WYWB 5D3DA 2WDQB 2DYMA 2NBUA 1CZPA 1NENB 1XT9B 2C9WB 2BB5A 1XQQA 3UIOB 2VH1A 3VAWA 2LUEA 1J0GA 2R61A 5FKAC 1UGJA 5AEKB 4M0WA 1WGRA 1QOBA 4FBJB 2CHZA 5HKHA 2BS2B 3V05A 1SIFA 3NG0A 4ZDVA 3U30A 4BAXA 2OHFA 4LNIA 1HXYD 2MQJA 4EZJA 3ZUNA 1I4GA 4WWMA 3M62B 2I1KA 4FLHA 4W9FA 2FBWB 3UF8A 4WJOA 1FFVA 3KW5B 2N9PC 4WIPA 3EUB2 3RT3B 1TJEA 2XN9C 1Q5WB 4JX1C 2REXA 3ZQ4A 3RMKC 2ICIA 1KLUD 4WH4A 1C76A 3L54A 2BTEA 2KLGA 4EKUA 1G6JA 3TSSA 2WS3B 4YSXB 4PK1A 1E7VA 3Q6BA 1OQQA 3NVYA 2JZZA 1SE3A 3ABVB 3TEXA 4KX6B 1VJKA 4MH0E 1T0RC 2IJ0A 2WYQA 3RNBC 2XK5A 5C23A 1EO6A 1RWSA 2LRWA 1HE8A 1IPGA 3N3KB 3ML9A 2Z59B 2QHOA 4HPLB 3HHMA 4GN1A 5KHQA 4X57B 3WA0A 2K9XA 1FNVA 1P3QU 1PGBA 1TGZB 1WJ6A 1UNSA 3R7QA 1WWTA 4KIKA 2LD9A 1UBIA 2WXGA 2YLMA 4LK0M 3ZNHB 4A90A 3VFKA 4BKSD 2RDHA 3ZO5B 2WX1A 2WXOA 2EKIA 1PUTA 2KTRA 4JGHB 5DPRA 5BYQA 1YQBA 3DWMA 1YN5A 3AN1A 3IXSA 2D2QA 3A1QA 2DENB 2DZJA 4MELA 5BMIA 1F1HA 1N6ZA 3W5VB 2CR5A 3SFEB 4MGYE 1C4AA 4CO7A 3AE4B 3AEAB 2LVOA 4LLGM 4WQMA 3WIMA 1MHXA 3ONSA 3NZSA 2NTSA 3NVVA 5HHDG 3VDZA 1WH3A 4PT5A 2FCSA 2W55A 4RM9A 3KQ4A 4IWQA 4ZYSA 2DAJA 2KN5A 2FCQA 5L95C 3L16A 4LJPB 4A8XC 4ZHOA 2J7QB 2QJLA 2Z0DB 3HIZA 1TYGB 3BVMA 1V81A 2DX5B 2KLCA 2K1FA 3TCAA 1YN3A 2KVRA 2N7DA 3DHGC 1M4VA 4HROA 3P4PB 2XBBC 2ZNVC 4ZOHC 1Z5SB 1E8XA 3RZFA 4ACFA 3V62A 1V1PA 4UDUC 1MJDA 4OZAA 1HEZE 1E7PB 1PGXA 1YIWA 1N62A 2Y5CA 1ZUD2 3M95A 2W82A 3VR8B 2W3RA 1C4CA 2K6QA 4ZRPA 4IWPA 2G4SA 4W9CA 3P4QB 1XF5L 3NS1A 3SD5A 2WQYB 2Y5BB 1GC6A 4M01A 3RN9C 3O13A 3Q8BA 1L7YA 3IG3A 4XDCA 4W9LA 4F7ZA 4ANWA 1I42A 3P42A 1T6BX 1OGWA 4A6QA 2BF8B 4EOYA 1PGAA 4DXAB 5L83A 1QOFA 4A20A 1YN4A 2J4XA 5C1ZA 2ZCCA 1V2YA 1DOXA 2WLBA 1K52A 5GMVA 2FNJB 2LEKA 2WXLA 2LJ5A 3SU8X 3W1SC 5EDSA 4FADA 1L4ZB 1FXAA 1T0YA 2JXTA 4HJGE 3LJ3A 4L23A 1FNUA 1KFYB 5HFYA 1T5XD 1UF0A 4AJYB 3QC8B 3MHZA 4WWNA 4A3OA 1BMLC 1MFWA 3T9LA 2GBNA 1D6EC 3ZLZA 1UZXB 3ECIA 1Z2MA 4Q2JA 2UWQA 3SEBA 3QQ8B 2MJDA 2O2VA 3PVLA 3KYDD 1ENFA 2M0XA 4OVUA 4AJWA 1XD3B 4S0RA 3AB5A 3KH0A 4ITKA 4MGZE 1V8CA 1ZDXA 2KFJA 1A70A 3MJWA 1PYWD 1WX8A 3HK0A 5BO4B 4RFBA 2D3BA 2KWCA 3L08A 4N59A 4NNJB 1WJ4A 3RULA 2AWTA 4AS1A 3U2SC 1KRHA 4LNKA 2INDC 3OG5A 3GZNI 3CSFA 3EFCA 3DCGA 1FEHA 1WRDB 3KYCD 2EELA 4E3CA 2E6XA 4HDOA 4KSLC 5D2MB 1V1OA 1VZ6A 1SIJA 3ZJVA 2BW2A 1Q10A 2BYVE 3QARA 3GE3C 1WMHB 4WWOA 2B3AA 4NAMA 4K1RB 2WXFA 3BYTB 4MT5A 1NI2A 3PHXB 2Y5PA 3RPFC 5LXIB 1EWCA 4EFOA 2UU7A 3VTUA 2KJRA 2WXIA 2QSDA 2LXAA 1J7AA 2W3SA 1GB4A 2WDVB 1XO3A 1E8YA 2PLPA 4NJ6A 1QKZA 1QOAA 3Q8CA 5T8IA 2KT7A 2OEDA 2JXXA 2LGIA 2N1VA 3UI3A 3MC9A 2D3CA 2QMTA 2MJEA 2ZPYA 2JZPA 4NQLB 4WQOB 3RNAC 4TUUA 4P6VF 1HZ5A 4W9DA 2V1YA 4MJSB 1EF1A 1LO5D 4YTPB 3KLSX 3J9CA 1OQRA 3CF6E 2XNAC 2NBWB 5IP4D 1HQRD 4RM8A 1ESFA 4BFRA 4C56C 1L6VA 4NQKE 4OHJA 4FHJA 1P98A 4KZCA 3IBEA 1STEA 1YOVB 4MDKE 4KGTA 3EA6A 2DHZA 2WXHA 3PV1A 4LJOB 4K7SA 4JWSC 1X1MA 4LNOA 1SE4A 2YVCA 1AYFA 1VD2A 3H1UA 2ASQA 3ZNZB 3HUIA 4HEA1 4JPSA 2IO3B 4BKSA 4N6EB 4DBGA 2CHWA 4IUMB 2R2QA 3R2IA 1RFKA 5CX3A 3B0AA 3AE7B 4KDIC 4EZLA 4C7YA 2JT4B 3OJ3A 3A4RA 1JRUA 3GE8C 1QOGA 1F9JA 5E6JA 1DOIA 1SSNA 4NY0A 3TEYA 3LDZE 2KJ6A 1YJ1A 4FA6A 3VH3B 3B1LX 1ZW7A 2MWSB 1ET6A 2BKRB 3VXWA 3UINB 1WFYA 1BUIC 4ANXA 2LXCA 4AUQC 3U7DA 2KWVB 2LMCA 1D5XC 1NVID 1TIFA 2BBCA 1GNUA 1JW9D 2L32A 3DDCB 5J2RA 1D4BA 3WAOA 1H4RA 3BIID 3RYTA 1SEBD 2J0KA 3GZNB 1XEEA 1L0XB 3ZDMC 2JRIB 5AZHA 5G5GA 3SDLC 1GG3A 2ZNVB 5IKCM 1YQ4B 2YEPF 3Q3NC 2KWUB 3WCQA 4HVBA 1TTNA 4BBNC 4BBNF 1WGGA 4YL8A 4GDLB 2J53A 4MH8A 4IC7B 1N61A 3TUOA 2MRPA 5JHBA 4LDTD 4KZ0A 3TMPB 4TQ0A 4XWWA 1TZOA 2KC1A 2SEBD 2WXJA 2V4LA 1V5TA 3SR6A 1LFDA 3DVNV 1FPYA 2A4ZA 2MJ3A 2G4DB 3ALBA 2DLBA 3ZRCA 1HZ6A 1K50A 2WU2B 1FXTB 2L1AA 1WXAA 1ISNA 2W9NA 4LNFA 1QT9A 2K5PA 5BYRA 2VZKD 5AUKA 3H8HA 2QC8A 2KVZA 3AMZA 3DPDA 4JE3B 2KXJA 3AEFB 4G11A 4FHKA 3ZNID 2KDMA 3WANA 1HTQA 1SE9A 2LWPA 4BVUC 3ZXVA 1J7CA 3RNEC 3VRBB 1JROA 2BYEA 2G9HD 5LLIA 1WX9A 3IAM1 4KVGB 2DYBA 3Q69A 2IDYA 2JSVX 3R66C 4XC2A 3ZDTA 4A9AA 2PVGC 1VR9A 1IGDA 3AE8B 2QEJC 1RYJA 4MSMB 2V3SA 1YJIA 4G0NB 4URKA 1GB1A 4YSZB 4RMAA 1F0ZA 3RFZB 1SBBB 3N1ZC 4RNAA 3GS2A 2KWDA 4C4VB 1WY8A 1C77A 3HRDD 1WRIA 1Y8RC 3ZVVA 2CU3A 2L7RA 5BMGA 2DZMA 2MX2A 3V6CB 2IO2B 1WXSA 1ZPSA 3APCA 2BVCA 3VUXA 5IA7A 1FMAD 4FXCA 4KDLB 4DXFA 2WXKA 2RPQA 2VH2A 4XZ4A 1DYQA 4BKGA 3GOEA 2INCC 2JVCA 3P63A 4FJZA 3JVZX 5D3IB 4ASWC 2KX0A 1XCTL 3U8ZA 2LI5A 3PLUA 3DBLI 3VTVA 2ZEQA 1WX7A 3L17A 4CHKA 3Q3OC 1ZKHA 4FJVB 1C1YB 3C8YA 2ZPNA 1FFUA 2WP9B 3N20C 2PIAA 4M02A 3TIXA 1WE7A 1WJUA 1JWAD 1QLBB 3NVWA 2GBKA 2GLSA 3I3TB 3B2FA 3A9JB 2LVPA 2LJIA 2WDRB 1WMHA 1I35A 2L05A 4RGMA 2MH7A 5JHAA 1I7HA 2EKEC 1ZDVA 1KTKA 1JALA 4GSWA 4OVZA 4G3XB 1PDXA 4TKNA 4W9JA 2ZZPB 1CK1A 4P1CC 2CS4A 3AEBB 4WJQA 4B0EA 2C7NB 4B6WA 2KO3A 1RFAA 3X23A 3N1XC 2EMTA 4ANUA 3AEGB 2L76A 2MLBA 4PS7A 2AEHA 1GOZA 3AE3B 5TSSA 1YJJA 3MHSD 3OAWA 3ML8A 1FO4A 1Y56A 4A55A 2LGXA 1QF6A 2ZVNA 1VLBA 1L0VB 3VHTC 1WI0A 2A5UA 3VRAB 3IFWB 1LXDA 4MJSA 4USAA 4YSYB 4ZRIA 3NRZA 4XWTA 2IGGA 1VDVA 1UUPA 3W9CB 4I6PA 2GBMA 1F77A 3L0WB 3ZNGC 1EF5A 3BVZA 1WXQA 4ZRQA 3I5JC 3Q8FA 1MG4A 3A9KB 4M8MA 4NJ7A 2O6VB 5FR3A 3ZTDA 1SJED 2GMIC 2ZJDA 1EUVB 1C9FA 2X38A 1VZ8A 2HJ8A 1YX6B 5EE1A 2O6VD 1I4RA 3APDA 1TY0A 2NTTA 2AQ2B 2R2OA 5HG2A 3AI5A 4IM0A 2JRHA 1GC7A 1E90A 2K0PA 1OEYA 2L52A 4HCNB 4YTMB 1K53A 4N9F4 3AULA 3L4PA 1E10A 3N9YC 2KQSA 2ZVOA 2BGFA 1LM8B 2PVOD 2OOBB 2WXMA 2KMCA 1P1AA 3V6EB 1DGJA 1XXGA 1TS2A 1SGHA 1L0YB 4P7IA 1EWYC 2KD0A 2V3NA 1UD7A 1JQ4A 4NPNA 2HTME 2LGSA 3W1YA 3RD2A 4ARCA 3PGEA 4RGOS 3LYYA 2YEPB 2IY1B 3FAHA 2NPTB 4FULA 2D3AA 1JWBD 1NI3A 3DWGC 4EZKA 3BK1A 1XLOA 2KX3A 2Z0EB 3AU4A 3UIPB 4IDIA 4C7ZA 1D3ZA 1TT5B 1TY2A 3DBSA 3GB1A 3DBLB 1WJNA 1QILA 4US9A 4OW0A 1IBXB 2NR2A 2BT6A 4MACA 2L0TA 2L00B 4CYEA 4B0MA 4WAAA 3RZWC 3Q3FA 4GDLA 3PLVA 3U52E 2C7HA 2DZIA 4GOCA 2XEWA 2CKHB 2MBOA 3QK0A 2IGDA 2IBIB 3PRMB 3AV8A 1WIAA 2J42A 2E3TA 3W5UB 3C19A 4RCOA 3U7ZA 3X0WA 3VH4B 2AX5A 3PO0A 2WX0A 1KF6B 2WGSA 1S1QB 3AEEB 5D94A 3DOWA 3TL5A 1NEKB 2LFIA 5AZFA 3DVNU 4CQNA 3Q3JA 2GB1A 1K51A 2KDFB 5LNK1 3N32A 2B76B 2KOXA 3W1SA 3NY5A 2BKFA 4KV2A 4KSKC 4ZHPA 3H7PB 2BS3B 2BS4B 3ZIMA 2JYTA 1UBQA 2K8HA 3TJPA 4IG7B 1TS5A 4HPMB 3PPAA 2H88B 5HI1A 2RDGA 2KDBA 5KHOA 4DWFA 5MPOA 3PT2B 5D7GA 3VUWA 1NYRA 4A3PA 1WGHA 3BZDB 4W9KA 3QCAA 3QHTA 2IY0B 1QZEA 3TEWA 2KNBA 5EE9A 3CIRB 1D5ZC 2N1WA 5JXVA 1WZ3A 3W2DA 2MA9B 2AYOB 3R7RA 1H8CA 2JF5A 2BQQA 4C4VA 4I6NB 1FCCC 4II3B 3KUDB 3M3JA 1MVKA 4ANVA 4ARIA 4MGKE 3EC8A 3HM6X 4OZBA 1LQBA 4GMVA 3MTNB 3N30A 2JZ3B 3FKYA 1IUEA 4ICVA 3ZXRA 4XX5A 3QAQA 4WURA 2QCZA 2CJNA 2L3ZA 1YQ3B 3KUCB 3ZKJC 1VZ7A 3IT4B 2QIEB 5DPTA 2DYOA 3AU5A 2CU1A 1TS4A 4GGQA 5C2TB 2DNFA 3AEDB 4JQWC 5LXHA 4YXDB 2CHXA 5EE3A 2H89B 3H9DA 4O1NA 1IP9A 2ACZB 2X8XX 3AE2B 1KLGD 1ZXIA 3AH7A 2V4IB 2DWQA 1AARA 1V6EA 5JZEB 3RNFC 1K8RB 5FK9C 5G2NA 4AWJA 3A9JA 2AQ3B 4REZA 2BB6A 2HDEA 1JWSD 2J52A 1FIQA 2HTHA 2RD0A 2N7EA 1QQRA 1WM2A 1WYGA 3FC4A 3QWZB 2MSED 5C3JB 2L83A 3DQVA 4MM3B 1I4PA 2FUHB 1SXTA 1AWDA 1TKGA 3EHVA 5DPSA 5I4DA 3QX1A 2M17A 3DVGY 1RM6C 3A33B 3GP7A 3L13A 1P7EA 1NYQA 1ROEA 4GDKB 3QA8A 3IT6B 3UQAA 2D5GA 1ZP0B 4OZCA 3NVZA 4PS8A 1ACCA 2GI9A 1V97A 1OEYJ 2I1JA 2KFKB 2QDFA 2MP2B 5E6OA 1MPEA 3JYUA 4JL9A 3PZ7A 1F52A 1GJZA 4LDTB 4F1SA 4HJKA 1SJHD 2PEAA 1MHHE 2AQ1B 2KTFA 3MC8A 5IN7A 1I4QA 3A9KA 4M00A 1R7SA 1MI0A 2M4NA 3PZ8A 1UWXA 3NHEB 2O6VA 3MP9A 2DZKA 2FIFA 2PKOA 2GRIA 1WF9A 2GOWA 1YX5B 2N9EB 1D5MC 4IM2A 3WAPA 3ZGZA 3KWVA 2RDBC 1CMXB 3BWUD 3D32A 1OTRB 3K9PB 3VR9B 2VZKB 2KK8A 3ZJUA 1OQYA 1TS3A 1VCBA 1GUAB 4AP4C 2K39A 2BPSA 2L8JA 2K8CA 1P0RA 5AZGA 2QILA 2AL3A 4K7WA 3OLMD 2G3QB 2LGYA 3CSTA 4F8CB 5CTRC 2ZCBA 3A4SC 4XYCA 1BXTA 4HDQA 5H8YE 1N60A 3CWIA 5EE0A 5CHVC 2KAJA 1KOTA 3R2TA 4DK5A 4M8NA 1WGYA 2LASA 4PYUA 4LCDE 2AL6A 2M8SA 2WXPA 1WXVA 1C78A 3T3NA 1E5WA 2BWES 1MG8A 3AE5B 4P1BC 2OJRA 3OJ4B 4P16A 1T0QC 2MW5A 2NPTA 4DXGA 5AUIA 1L4DB 4K81A 2V3PA 3ZJTA 3BVGA 1TBEA 1RAXA 4EE2A 1SE2A 2V9HA 2NS5A 5J17A 2MBHA 2JY6A 4IOIE 2IZVB 1GPXA 1P7FA 2JWZA 2N9KA 1IBXA 1CQVA 4US8A 3R8BA 3AECB 2PE9A 3K9OB 4K3CA 3MFGA 4TV3A 1SF0A 4NAWB 5IOIA 2JU6X 3QJZA 3Q14C 4ZRKA 4KGRA 4BZAA 3HVDA 1M94A 2IYDB 4IWOA 2D11A 4K7UA 1YD8U 3SHQA 4GU2A 5FR6A 4LTUA 1V86A 1PQSA 1V5OA 1DOYA 2FIDA 1FD6A 3R3MA 2JUOA 4H2AA 5CHFA 3FILB 3KVFB 1FCLA 2FCNA 2PW9A 3Q8AA 1HA5A 1Q1OA 2C5LC 3T3OA 1V49A 1J7BA 2KQ7A 3H7PA 3AE9B 2DBYA 1KM7A 4KKJA 2HD5B 3LXFA 1TZ1A 3S2AA 3JSVB 1ZOYB 2IO0B 2L0FA 4BOSC 4EEWA 3L10B 1RLFA 2KDEB 1WZ0A 3I57A 3NZ3A 3RI7C 3HM3A 4HLEA 2RMMA 2WNMA 1J8CA 1TKYA 1E7UA 4YWGG 5J18A 5DCNA 1CJEA 1F2RC 2C60A 3DVGX 2M19A 1FM0D 4J3OD 4GXBA 3URYA 2SAKA 1C3TA 2NCNA 4HCPB 4BKTA 2WHIA 4TMAB 3DBRI 1R4NI 3NZUA 4HPPA 2J0MA 4AOFA 1FRDA 4HKZE 4DDGD 1XLNA 1JCKB 2KDIA 2KC2A 3WAMA 2NBVB 4KGSA 2PJHA 1IGCA 2GBRA 4B95A 2WWZA 3M63B 4FN2A 4HRSA 4BOZB 1YMHE 2LHDA 3DBHI 3NJTA 4YTNB 1FNWA 3BY4B 1RRBA 2LRUA 2PE6B 4W9IA 4WJNA 2N7JA 1UELA 4C80A 2MBQA 3V61A 3ENEA 3PRZA 1PFDA 4W9GA 2BYFA 1XLQA 3QIJA 4WWPA 1AW7A 4W9HA 3E9SA 3U4EG 2NVUI 1E0ZA 1V9JA 1E9MA 2Z8LA 1JRPA 1KJTA 1B9RA 4DHZE 1WM3A 4EUTA 2KZRA 3MJ5A 4YT0B 4MM3A 1WXMA 4RF1A 4PYZA 4MGIE 2M56B 3H7SA 3Q2AC 4KKIA 5DPWA 2KMAA 3IVFA 2HE7A 2LGDA 1KH0A 4M0WB 3WALA 1ZGUB 3I63C 1E6EB 4MSQB 2CJOA 1B1ZA 5GXGB 3ZTCA 1T3QA 3P2BA 4GDKA 3DHIC 2M1MA 2KQ4X 1TKEA 4GIVA 2GBJA 3UQBA 2JX5A 1NDDA 4II2B 3NS8A 3B08A 2KFKA 5TR5A 2WXNA 2MP2A 3RCZA 4MEMA 2ONQA 3ETRA 4WAFA 2V0GA 4NZLB 4B9KA 2RPVA 1GAQB 2KANA 4DDID 1E8WA 3V3XA 2D3GA 2MBBB 1F2RI 3AE6B 3KWLA 4HK2A 3RUIB 1A5RA 1C79A 2IO1B 2LZ6A 2MBEA 2PMVA 4L2YA 1JMLA 4RH6A 3BK2A 3IAS1 5BMHA 4JIOU 1HTOA 3Q8EA 4FJYA 2K25A 3P4RB 3VTWA 1UWMA 1S3SG 2INPE 3B9JA 3MC0B 5H92C 2FCMA 2HJ1A 3LB8C 1ZXHA 2D07B 2IPKD 1N63A 4OVVA 2MCNB 1UH6A 3OWEB 2XK5B 2K3UA 4JLCA 4HKQA 2IGHA 1NBFC 2N9XA 3T8MA 1OFFA 2N4FA 4ZRJA 1I4XA 1J19A 2KYWA 3CMMB 2N0SB 3SFDB 3ZW3A 1IYFA 4KIKB 4S17A 5E6PA 2G45B 1V80A 1L6UA 4J6IA 2ON8A 3PS6A 4ICUA 3DBRB 3E56A 3KUZA 1L5PA 1R4NB 4I6LB 1T0SC 1R4MI 1E8ZA 2JWUA 3VVWB 3IHPC 1WE6A 2KTRB 3P4SB 2WU5B 4W9EA 4AQ7A 3A1QB 3RNCC 3PSEB 4NJCA 1KLVA 2OJWA 3UGBB 3PREA 2KACA 4XE0A 2LVQA 1XLPA 4TSSA 3JW0X 3DBHB 4HXDA 1WGDA 3BYYB 3ZRFA 3Q3MC 5G5HA 4RGTA 1FRRA 1WR6E 3APFA 4NAWA 2UYZB 3NOBA 4GB9A 5G55A 4DHJB 2KKCA 2RR9A 3V60A 4ZYNA 2ZW1A 3EGRA 4DHJD 2FAZA 3PHWB 3PZDA 1YNTE 3EFUA 4DQOC 5E6NA 4HWIB 1V1PB 1BT0A 2MEKA 3O65B 2KN4A 2FUG1 3HVZA 3FILA 2RGFA 3B2GA 3TBLD 2RSUA 1Q0WB 1N5WA 3NUHB 1WGKA 2D10A 1FXIA 4N58A 2DAFA 4L1BA 4RGNA 3ZYYX 4XDDA 4C00A 4IM3A 4GLSC 2I2YA 2K8BA 2PTLA 2Q5WD 1N5XA 1WR1A 3JSVA 4G50A 2KJHB 5BYSA 2LUMA 2J0JA 2KHWB 2M0AA 2INNE 5IAAC 4E74A 2WXQA 1EU4A 1I4HA 2MHJA 4LNNA 5IO9A 2ZW0A 1EM7A 2JYEA 2JQRB 4TQ1A 1U4AA 4IKGA 1AN8A 2N9LA 2WXRA 2FE8A 2C7MB 2BYTA
chains in the Genus database with same CATH topology
4RF0A 3L4PA 4LTUA 1E10A 3N9YC 2KMMA 1J7AA 1JWMD 2W3SA 1GB4A 2WDVB 1XO3A 2PVOD 2PLPA 1QKZA 1DOYA 1QOAA 2WXMA 1JWUD 3Q8CA 5T8IA 1DGJA 1XXGA 1FD6A 1TS2A 1L0YB 2OEDA 4H2AA 1EWYC 1ET9A 2LGIA 2NMQA 3FILB 1WSPA 1FCLA 2TSSA 3UI3A 2QMTA 2V3NA 2MJEA 2Y3AA 1SB3C 2JZPA 1JQ4A 4P6VF 2HTME 1HZ5A 2PW9A 3Q8AA 1HA5A 3T3OA 4ARCA 1LO5D 3AM9A 3P1MA 4RGOS 3LYYA 3KLSX 4YTPB 1J7BA 2YEPB 3TEZA 3AE9B 3FAHA 2DBYA 3J9CA 1XCQL 1OQRA 3AE1B 2XNAC 1JWBD 4KKJA 1NI3A 1HQRD 3DWGC 3BK1A 1ZE3D 1XLOA 1EU3A 3LXFA 4C7ZA 4IDIA 1ESFA 2G1EA 2I38A 1VRAB 1TY2A 1C4PA 1L6VA 3GB1A 4C56C 1ZOYB 4OHJA 2K22A 1QILA 1STEA 2W54A 4JWUC 4US9A 4OW0A 4D2KA 1IBXB 4KGTA 3I57A 3NZ3A 2BT6A 2LHEA 3I9V1 3VQIA 3EA6A 4MACA 4R3DA 2RMMA 2WNMA 2WXHA 5D3DA 4B0MA 1TKYA 2WDQB 2DYMA 4JWSC 4YWGG 1CZPA 3U52E 1CJEA 1F2RC 1NENB 1SE4A 2BB5A 2M19A 1AYFA 1FM0D 4J3OD 3URYA 2R61A 5FKAC 1UGJA 2SAKA 3HUIA 4HEA1 4JPSA 4TMAB 4N6EB 2IGDA 4M0WA 1QOBA 3R2IA 3AV8A 1RFKA 2J42A 2E3TA 3W5UB 4RCOA 3U7ZA 2AX5A 3PO0A 1KF6B 2BS2B 3AEEB 3V05A 3AE7B 1FRDA 4C7YA 1NEKB 2LFIA 4HKZE 2OHFA 1QOGA 1XLNA 4CQNA 1HXYD 1JCKB 5E6JA 1DOIA 1SSNA 2GB1A 1K51A 3TEYA 1I4GA 4WWMA 5LNK1 4KGSA 2B76B 1IGCA 2FBWB 3W1SA 1FFVA 1ET6A 4ZHPA 4WIPA 3EUB2 1BUIC 1TJEA 2XN9C 2BS3B 2BS4B 4JX1C 2LMCA 2JYTA 4HRSA 3ZQ4A 1D5XC 2ICIA 1YMHE 1TS5A 2LHDA 1NVID 1KLUD 2BBCA 2L32A 1JW9D 4YTNB 1D4BA 4WH4A 1C76A 3BIID 2H88B 5HI1A 1SEBD 1FNWA 2RDGA 1XEEA 1L0XB 2N7JA 5MPOA 2BTEA 4C80A 5G5GA 5D7GA 1NYRA 3TSSA 2WS3B 4YSXB 1PFDA 3BZDB 1OQQA 3NVYA 1XLQA 1YQ4B 1SE3A 2YEPF 3ABVB 1AW7A 3TEXA 4KX6B 3E9SA 3TEWA 3U4EG 1VJKA 3WCQA 2IJ0A 1E0ZA 1RWSA 5EE9A 3CIRB 1D5ZC 1E9MA 2Z8LA 1JRPA 1B9RA 4GDLB 2J53A 4MH8A 3MJ5A 1N61A 4YT0B 3TUOA 5JXVA 3W2DA 4RF1A 2K9XA 1FNVA 2M56B 4KKIA 4TQ0A 1PGBA 4XWWA 1TZOA 1UNSA 1KH0A 1FCCC 1WWTA 1MVKA 4ARIA 1E6EB 2CJOA 1B1ZA 2SEBD 2WXJA 5GXGB 4OZBA 2WXGA 1T3QA 3SR6A 4LK0M 2MJ3A 1IUEA 2KQ4X 4A90A 1TKEA 2RDHA 2DLBA 1HZ6A 1K50A 4WURA 2JX5A 2WU2B 2L1AA 2WXOA 1QT9A 2K5PA 2EKIA 2CJNA 2WXNA 1YQ3B 5BYRA 1PUTA 2VZKD 5AUKA 3H8HA 5BYQA 2ONQA 3ETRA 4WAFA 2V0GA 1VZ7A 3AMZA 3IT4B 2QIEB 3DWMA 1YN5A 3AN1A 2DYOA 3IXSA 4NZLB 2RPVA 1GAQB 4JE3B 3AEFB 1TS4A 3V3XA 1F2RI 5C2TB 3AE6B 3AEDB 3KWLA 5BMIA 1C79A 4YXDB 5EE3A 3W5VB 2H89B 3SFEB 2PMVA 4O1NA 2KDMA 2ACZB 1C4AA 4L2YA 3AE2B 1JMLA 4RH6A 3AE4B 1J7CA 1KLGD 1ZXIA 3AEAB 3BK2A 3IAS1 5BMHA 3AH7A 2V4IB 3VRBB 2DWQA 1JROA 2G9HD 4LLGM 4WQMA 3Q8EA 1MHXA 3P4RB 5FK9C 1UWMA 3IAM1 2INPE 2NTSA 2AQ3B 3B9JA 2BB6A 3MC0B 3NVVA 4REZA 5H92C 4PT5A 2HDEA 2W55A 1JWSD 3Q69A 2J52A 3KQ4A 3LB8C 1ZXHA 1FIQA 2IDYA 2IPKD 4ZYSA 1N63A 2JSVX 1QQRA 4A9AA 3OWEB 2PVGC 2K3UA 1WYGA 1VR9A 1IGDA 3FC4A 4A8XC 4ZHOA 2QJLA 2L83A 3AE8B 5C3JB 4HKQA 1TYGB 2QEJC 2IGHA 1RYJA 3BVMA 4MM3B 1I4PA 1OFFA 1SXTA 1YJIA 1GB1A 4YSZB 1F0ZA 1I4XA 3RFZB 1SBBB 1AWDA 1TKGA 1YN3A 5I4DA 4RNAA 3GS2A 2KWDA 1M4VA 2N0SB 3SFDB 4HROA 3P4PB 1C77A 3HRDD 1RM6C 4ZOHC 1WRIA 3GP7A 1P7EA 1L6UA 2CU3A 5BMGA 1NYQA 1ROEA 1V1PA 4UDUC 2ON8A 4GDKB 3IT6B 4OZAA 3E56A 2D5GA 1HEZE 1ZPSA 1ZP0B 1E7PB 1PGXA 1L5PA 1N62A 4OZCA 1FMAD 2Y5CA 3NVZA 1ZUD2 1ACCA 2W82A 3VR8B 2W3RA 2GI9A 1V97A 4FXCA 1C4CA 4DXFA 2WXKA 4ZRPA 2JWUA 3P4QB 1DYQA 1MPEA 1XF5L 3PZ7A 3NS1A 3P4SB 3P63A 2WQYB 2WU5B 3O13A 5D3IB 1SJHD 3Q8BA 2AQ1B 1MHHE 4XDCA 4AQ7A 1XCTL 1I4QA 3P42A 1T6BX 4NJCA 1R7SA 1MI0A 3PZ8A 4A6QA 1UWXA 3MP9A 1PGAA 2KACA 2PKOA 4XE0A 2GRIA 3C8YA 1QOFA 1XLPA 1YN4A 2J4XA 1FFUA 2WP9B 1DOXA 2PIAA 2WLBA 1D5MC 1K52A 4TSSA 3ZGZA 2LEKA 1JWAD 2WXLA 3KWVA 1QLBB 3BWUD 3NVWA 3BYYB 3B2FA 5G5HA 4RGTA 3VR9B 2VZKB 1FRRA 2LJIA 2WDRB 3ZJUA 1L4ZB 1FXAA 1TS3A 2JXTA 4RGMA 4HJGE 2MH7A 4L23A 1I7HA 1FNUA 1ZDVA 1KFYB 5HFYA 1T5XD 1KTKA 3MHZA 1JALA 4OVZA 1BMLC 1PDXA 2QILA 1CK1A 3AEBB 1D6EC 4B0EA 2ZW1A 3EGRA 4Q2JA 1BXTA 5H8YE 1N60A 3AEGB 3CWIA 3SEBA 2MJDA 5EE0A 1YNTE 4DQOC 2KAJA 1V1PB 1GOZA 2MEKA 1ENFA 3AE3B 2KN4A 3R2TA 5TSSA 1YJJA 1FO4A 2FUG1 1Y56A 3FILA 3HVZA 4A55A 3AB5A 3B2GA 1QF6A 4ITKA 1VLBA 1L0VB 2WXPA 3VRAB 1V8CA 1ZDXA 1N5WA 1A70A 3NUHB 4USAA 4YSYB 1PYWD 1C78A 3NRZA 1WGKA 4XWTA 3T3NA 1FXIA 4RFBA 2IGGA 1VDVA 1UUPA 3AE5B 4N59A 4N58A 3W9CB 4L1BA 1F77A 4RGNA 4P16A 3BVZA 1WXQA 4ZRQA 3ZYYX 4XDDA 4AS1A 4DXGA 3U2SC 3Q8FA 5AUIA 1KRHA 1L4DB 4GLSC 2I2YA 2PTLA 5HHDG 1FEHA 5FR3A 2V3PA 2Q5WD 1SJED 1N5XA 2EELA 3ZJTA 3BVGA 5BYSA 2LUMA 4EE2A 2M0AA 1SE2A 1C9FA 2E6XA 2X38A 2INNE 1VZ8A 2WXQA 1EU4A 1I4HA 1V1OA 1VZ6A 4IOIE 5EE1A 1P7FA 2ZW0A 2N9KA 1GPXA 1SIJA 1EM7A 1IBXA 1CQVA 3ZJVA 1I4RA 4US8A 2BW2A 3R8BA 3AECB 2JYEA 1Q10A 1TY0A 3MFGA 2NTTA 2AQ2B 2JQRB 1SF0A 4NAWB 5HG2A 4NAMA 4TQ1A 2JU6X 2WXFA 3BYTB 4MT5A 3RPFC 2K0PA 2Y5PA 4KGRA 1EWCA 1AN8A 2N9LA 2WXRA 4IKGA 2L52A 2FE8A 3HVDA 4YTMB 2WXIA 2QSDA 1K53A 2BYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C76 A;  1C78 A;  1SSN A;  2SAK A;  1BUI C;  1C79 A;  1C77 A; 
#chains in the Genus database with same CATH topology
 4RF0 A;  2BWF A;  2VRR B;  2JPH A;  2KMM A;  1JWM D;  2PPH A;  1UGM A;  1L2N A;  1LGR A;  5JH5 C;  1JWU D;  4IW0 A;  2O2V B;  3PTF C;  3RNG C;  1ET9 A;  2NMQ A;  1WSP A;  3AXC A;  2TSS A;  3PRP B;  5CHW A;  2Y3A A;  1SB3 C;  3VUY A;  4WJP A;  4XGA B;  2WDT B;  4PS3 A;  2EMS A;  3EEC A;  4QAY A;  1R4M B;  3AM9 A;  3BIN A;  3P1M A;  4E71 A;  3TEZ A;  1XCQ L;  2K6D B;  4K3B A;  1P9D U;  3AE1 B;  5D6J B;  1ZE3 D;  1EU3 A;  2G1E A;  2I38 A;  1VRA B;  1C4P A;  4DHZ B;  3H6N A;  2K22 A;  2W54 A;  4JWU C;  3N1Y C;  3DHH C;  4D2K A;  3I9V 1;  2LHE A;  3VQI A;  4R3D A;  3C0R B;  1WYW B;  5D3D A;  2WDQ B;  2DYM A;  2NBU A;  1CZP A;  1NEN B;  1XT9 B;  2C9W B;  2BB5 A;  1XQQ A;  3UIO B;  2VH1 A;  3VAW A;  2LUE A;  1J0G A;  2R61 A;  5FKA C;  1UGJ A;  5AEK B;  4M0W A;  1WGR A;  1QOB A;  4FBJ B;  2CHZ A;  5HKH A;  2BS2 B;  3V05 A;  1SIF A;  3NG0 A;  4ZDV A;  3U30 A;  4BAX A;  2OHF A;  4LNI A;  1HXY D;  2MQJ A;  4EZJ A;  3ZUN A;  1I4G A;  4WWM A;  3M62 B;  2I1K A;  4FLH A;  4W9F A;  2FBW B;  3UF8 A;  4WJO A;  1FFV A;  3KW5 B;  2N9P C;  4WIP A;  3EUB 2;  3RT3 B;  1TJE A;  2XN9 C;  1Q5W B;  4JX1 C;  2REX A;  3ZQ4 A;  3RMK C;  2ICI A;  1KLU D;  4WH4 A;  1C76 A;  3L54 A;  2BTE A;  2KLG A;  4EKU A;  1G6J A;  3TSS A;  2WS3 B;  4YSX B;  4PK1 A;  1E7V A;  3Q6B A;  1OQQ A;  3NVY A;  2JZZ A;  1SE3 A;  3ABV B;  3TEX A;  4KX6 B;  1VJK A;  4MH0 E;  1T0R C;  2IJ0 A;  2WYQ A;  3RNB C;  2XK5 A;  5C23 A;  1EO6 A;  1RWS A;  2LRW A;  1HE8 A;  1IPG A;  3N3K B;  3ML9 A;  2Z59 B;  2QHO A;  4HPL B;  3HHM A;  4GN1 A;  5KHQ A;  4X57 B;  3WA0 A;  2K9X A;  1FNV A;  1P3Q U;  1PGB A;  1TGZ B;  1WJ6 A;  1UNS A;  3R7Q A;  1WWT A;  4KIK A;  2LD9 A;  1UBI A;  2WXG A;  2YLM A;  4LK0 M;  3ZNH B;  4A90 A;  3VFK A;  4BKS D;  2RDH A;  3ZO5 B;  2WX1 A;  2WXO A;  2EKI A;  1PUT A;  2KTR A;  4JGH B;  5DPR A;  5BYQ A;  1YQB A;  3DWM A;  1YN5 A;  3AN1 A;  3IXS A;  2D2Q A;  3A1Q A;  2DEN B;  2DZJ A;  4MEL A;  5BMI A;  1F1H A;  1N6Z A;  3W5V B;  2CR5 A;  3SFE B;  4MGY E;  1C4A A;  4CO7 A;  3AE4 B;  3AEA B;  2LVO A;  4LLG M;  4WQM A;  3WIM A;  1MHX A;  3ONS A;  3NZS A;  2NTS A;  3NVV A;  5HHD G;  3VDZ A;  1WH3 A;  4PT5 A;  2FCS A;  2W55 A;  4RM9 A;  3KQ4 A;  4IWQ A;  4ZYS A;  2DAJ A;  2KN5 A;  2FCQ A;  5L95 C;  3L16 A;  4LJP B;  4A8X C;  4ZHO A;  2J7Q B;  2QJL A;  2Z0D B;  3HIZ A;  1TYG B;  3BVM A;  1V81 A;  2DX5 B;  2KLC A;  2K1F A;  3TCA A;  1YN3 A;  2KVR A;  2N7D A;  3DHG C;  1M4V A;  4HRO A;  3P4P B;  2XBB C;  2ZNV C;  4ZOH C;  1Z5S B;  1E8X A;  3RZF A;  4ACF A;  3V62 A;  1V1P A;  4UDU C;  1MJD A;  4OZA A;  1HEZ E;  1E7P B;  1PGX A;  1YIW A;  1N62 A;  2Y5C A;  1ZUD 2;  3M95 A;  2W82 A;  3VR8 B;  2W3R A;  1C4C A;  2K6Q A;  4ZRP A;  4IWP A;  2G4S A;  4W9C A;  3P4Q B;  1XF5 L;  3NS1 A;  3SD5 A;  2WQY B;  2Y5B B;  1GC6 A;  4M01 A;  3RN9 C;  3O13 A;  3Q8B A;  1L7Y A;  3IG3 A;  4XDC A;  4W9L A;  4F7Z A;  4ANW A;  1I42 A;  3P42 A;  1T6B X;  1OGW A;  4A6Q A;  2BF8 B;  4EOY A;  1PGA A;  4DXA B;  5L83 A;  1QOF A;  4A20 A;  1YN4 A;  2J4X A;  5C1Z A;  2ZCC A;  1V2Y A;  1DOX A;  2WLB A;  1K52 A;  5GMV A;  2FNJ B;  2LEK A;  2WXL A;  2LJ5 A;  3SU8 X;  3W1S C;  5EDS A;  4FAD A;  1L4Z B;  1FXA A;  1T0Y A;  2JXT A;  4HJG E;  3LJ3 A;  4L23 A;  1FNU A;  1KFY B;  5HFY A;  1T5X D;  1UF0 A;  4AJY B;  3QC8 B;  3MHZ A;  4WWN A;  4A3O A;  1BML C;  1MFW A;  3T9L A;  2GBN A;  1D6E C;  3ZLZ A;  1UZX B;  3ECI A;  1Z2M A;  4Q2J A;  2UWQ A;  3SEB A;  3QQ8 B;  2MJD A;  2O2V A;  3PVL A;  3KYD D;  1ENF A;  2M0X A;  4OVU A;  4AJW A;  1XD3 B;  4S0R A;  3AB5 A;  3KH0 A;  4ITK A;  4MGZ E;  1V8C A;  1ZDX A;  2KFJ A;  1A70 A;  3MJW A;  1PYW D;  1WX8 A;  3HK0 A;  5BO4 B;  4RFB A;  2D3B A;  2KWC A;  3L08 A;  4N59 A;  4NNJ B;  1WJ4 A;  3RUL A;  2AWT A;  4AS1 A;  3U2S C;  1KRH A;  4LNK A;  2IND C;  3OG5 A;  3GZN I;  3CSF A;  3EFC A;  3DCG A;  1FEH A;  1WRD B;  3KYC D;  2EEL A;  4E3C A;  2E6X A;  4HDO A;  4KSL C;  5D2M B;  1V1O A;  1VZ6 A;  1SIJ A;  3ZJV A;  2BW2 A;  1Q10 A;  2BYV E;  3QAR A;  3GE3 C;  1WMH B;  4WWO A;  2B3A A;  4NAM A;  4K1R B;  2WXF A;  3BYT B;  4MT5 A;  1NI2 A;  3PHX B;  2Y5P A;  3RPF C;  5LXI B;  1EWC A;  4EFO A;  2UU7 A;  3VTU A;  2KJR A;  2WXI A;  2QSD A;  2LXA A;  1J7A A;  2W3S A;  1GB4 A;  2WDV B;  1XO3 A;  1E8Y A;  2PLP A;  4NJ6 A;  1QKZ A;  1QOA A;  3Q8C A;  5T8I A;  2KT7 A;  2OED A;  2JXX A;  2LGI A;  2N1V A;  3UI3 A;  3MC9 A;  2D3C A;  2QMT A;  2MJE A;  2ZPY A;  2JZP A;  4NQL B;  4WQO B;  3RNA C;  4TUU A;  4P6V F;  1HZ5 A;  4W9D A;  2V1Y A;  4MJS B;  1EF1 A;  1LO5 D;  4YTP B;  3KLS X;  3J9C A;  1OQR A;  3CF6 E;  2XNA C;  2NBW B;  5IP4 D;  1HQR D;  4RM8 A;  1ESF A;  4BFR A;  4C56 C;  1L6V A;  4NQK E;  4OHJ A;  4FHJ A;  1P98 A;  4KZC A;  3IBE A;  1STE A;  1YOV B;  4MDK E;  4KGT A;  3EA6 A;  2DHZ A;  2WXH A;  3PV1 A;  4LJO B;  4K7S A;  4JWS C;  1X1M A;  4LNO A;  1SE4 A;  2YVC A;  1AYF A;  1VD2 A;  3H1U A;  2ASQ A;  3ZNZ B;  3HUI A;  4HEA 1;  4JPS A;  2IO3 B;  4BKS A;  4N6E B;  4DBG A;  2CHW A;  4IUM B;  2R2Q A;  3R2I A;  1RFK A;  5CX3 A;  3B0A A;  3AE7 B;  4KDI C;  4EZL A;  4C7Y A;  2JT4 B;  3OJ3 A;  3A4R A;  1JRU A;  3GE8 C;  1QOG A;  1F9J A;  5E6J A;  1DOI A;  1SSN A;  4NY0 A;  3TEY A;  3LDZ E;  2KJ6 A;  1YJ1 A;  4FA6 A;  3VH3 B;  3B1L X;  1ZW7 A;  2MWS B;  1ET6 A;  2BKR B;  3VXW A;  3UIN B;  1WFY A;  1BUI C;  4ANX A;  2LXC A;  4AUQ C;  3U7D A;  2KWV B;  2LMC A;  1D5X C;  1NVI D;  1TIF A;  2BBC A;  1GNU A;  1JW9 D;  2L32 A;  3DDC B;  5J2R A;  1D4B A;  3WAO A;  1H4R A;  3BII D;  3RYT A;  1SEB D;  2J0K A;  3GZN B;  1XEE A;  1L0X B;  3ZDM C;  2JRI B;  5AZH A;  5G5G A;  3SDL C;  1GG3 A;  2ZNV B;  5IKC M;  1YQ4 B;  2YEP F;  3Q3N C;  2KWU B;  3WCQ A;  4HVB A;  1TTN A;  4BBN C;  4BBN F;  1WGG A;  4YL8 A;  4GDL B;  2J53 A;  4MH8 A;  4IC7 B;  1N61 A;  3TUO A;  2MRP A;  5JHB A;  4LDT D;  4KZ0 A;  3TMP B;  4TQ0 A;  4XWW A;  1TZO A;  2KC1 A;  2SEB D;  2WXJ A;  2V4L A;  1V5T A;  3SR6 A;  1LFD A;  3DVN V;  1FPY A;  2A4Z A;  2MJ3 A;  2G4D B;  3ALB A;  2DLB A;  3ZRC A;  1HZ6 A;  1K50 A;  2WU2 B;  1FXT B;  2L1A A;  1WXA A;  1ISN A;  2W9N A;  4LNF A;  1QT9 A;  2K5P A;  5BYR A;  2VZK D;  5AUK A;  3H8H A;  2QC8 A;  2KVZ A;  3AMZ A;  3DPD A;  4JE3 B;  2KXJ A;  3AEF B;  4G11 A;  4FHK A;  3ZNI D;  2KDM A;  3WAN A;  1HTQ A;  1SE9 A;  2LWP A;  4BVU C;  3ZXV A;  1J7C A;  3RNE C;  3VRB B;  1JRO A;  2BYE A;  2G9H D;  5LLI A;  1WX9 A;  3IAM 1;  4KVG B;  2DYB A;  3Q69 A;  2IDY A;  2JSV X;  3R66 C;  4XC2 A;  3ZDT A;  4A9A A;  2PVG C;  1VR9 A;  1IGD A;  3AE8 B;  2QEJ C;  1RYJ A;  4MSM B;  2V3S A;  1YJI A;  4G0N B;  4URK A;  1GB1 A;  4YSZ B;  4RMA A;  1F0Z A;  3RFZ B;  1SBB B;  3N1Z C;  4RNA A;  3GS2 A;  2KWD A;  4C4V B;  1WY8 A;  1C77 A;  3HRD D;  1WRI A;  1Y8R C;  3ZVV A;  2CU3 A;  2L7R A;  5BMG A;  2DZM A;  2MX2 A;  3V6C B;  2IO2 B;  1WXS A;  1ZPS A;  3APC A;  2BVC A;  3VUX A;  5IA7 A;  1FMA D;  4FXC A;  4KDL B;  4DXF A;  2WXK A;  2RPQ A;  2VH2 A;  4XZ4 A;  1DYQ A;  4BKG A;  3GOE A;  2INC C;  2JVC A;  3P63 A;  4FJZ A;  3JVZ X;  5D3I B;  4ASW C;  2KX0 A;  1XCT L;  3U8Z A;  2LI5 A;  3PLU A;  3DBL I;  3VTV A;  2ZEQ A;  1WX7 A;  3L17 A;  4CHK A;  3Q3O C;  1ZKH A;  4FJV B;  1C1Y B;  3C8Y A;  2ZPN A;  1FFU A;  2WP9 B;  3N20 C;  2PIA A;  4M02 A;  3TIX A;  1WE7 A;  1WJU A;  1JWA D;  1QLB B;  3NVW A;  2GBK A;  2GLS A;  3I3T B;  3B2F A;  3A9J B;  2LVP A;  2LJI A;  2WDR B;  1WMH A;  1I35 A;  2L05 A;  4RGM A;  2MH7 A;  5JHA A;  1I7H A;  2EKE C;  1ZDV A;  1KTK A;  1JAL A;  4GSW A;  4OVZ A;  4G3X B;  1PDX A;  4TKN A;  4W9J A;  2ZZP B;  1CK1 A;  4P1C C;  2CS4 A;  3AEB B;  4WJQ A;  4B0E A;  2C7N B;  4B6W A;  2KO3 A;  1RFA A;  3X23 A;  3N1X C;  2EMT A;  4ANU A;  3AEG B;  2L76 A;  2MLB A;  4PS7 A;  2AEH A;  1GOZ A;  3AE3 B;  5TSS A;  1YJJ A;  3MHS D;  3OAW A;  3ML8 A;  1FO4 A;  1Y56 A;  4A55 A;  2LGX A;  1QF6 A;  2ZVN A;  1VLB A;  1L0V B;  3VHT C;  1WI0 A;  2A5U A;  3VRA B;  3IFW B;  1LXD A;  4MJS A;  4USA A;  4YSY B;  4ZRI A;  3NRZ A;  4XWT A;  2IGG A;  1VDV A;  1UUP A;  3W9C B;  4I6P A;  2GBM A;  1F77 A;  3L0W B;  3ZNG C;  1EF5 A;  3BVZ A;  1WXQ A;  4ZRQ A;  3I5J C;  3Q8F A;  1MG4 A;  3A9K B;  4M8M A;  4NJ7 A;  2O6V B;  5FR3 A;  3ZTD A;  1SJE D;  2GMI C;  2ZJD A;  1EUV B;  1C9F A;  2X38 A;  1VZ8 A;  2HJ8 A;  1YX6 B;  5EE1 A;  2O6V D;  1I4R A;  3APD A;  1TY0 A;  2NTT A;  2AQ2 B;  2R2O A;  5HG2 A;  3AI5 A;  4IM0 A;  2JRH A;  1GC7 A;  1E90 A;  2K0P A;  1OEY A;  2L52 A;  4HCN B;  4YTM B;  1K53 A;  4N9F 4;  3AUL A;  3L4P A;  1E10 A;  3N9Y C;  2KQS A;  2ZVO A;  2BGF A;  1LM8 B;  2PVO D;  2OOB B;  2WXM A;  2KMC A;  1P1A A;  3V6E B;  1DGJ A;  1XXG A;  1TS2 A;  1SGH A;  1L0Y B;  4P7I A;  1EWY C;  2KD0 A;  2V3N A;  1UD7 A;  1JQ4 A;  4NPN A;  2HTM E;  2LGS A;  3W1Y A;  3RD2 A;  4ARC A;  3PGE A;  4RGO S;  3LYY A;  2YEP B;  2IY1 B;  3FAH A;  2NPT B;  4FUL A;  2D3A A;  1JWB D;  1NI3 A;  3DWG C;  4EZK A;  3BK1 A;  1XLO A;  2KX3 A;  2Z0E B;  3AU4 A;  3UIP B;  4IDI A;  4C7Z A;  1D3Z A;  1TT5 B;  1TY2 A;  3DBS A;  3GB1 A;  3DBL B;  1WJN A;  1QIL A;  4US9 A;  4OW0 A;  1IBX B;  2NR2 A;  2BT6 A;  4MAC A;  2L0T A;  2L00 B;  4CYE A;  4B0M A;  4WAA A;  3RZW C;  3Q3F A;  4GDL A;  3PLV A;  3U52 E;  2C7H A;  2DZI A;  4GOC A;  2XEW A;  2CKH B;  2MBO A;  3QK0 A;  2IGD A;  2IBI B;  3PRM B;  3AV8 A;  1WIA A;  2J42 A;  2E3T A;  3W5U B;  3C19 A;  4RCO A;  3U7Z A;  3X0W A;  3VH4 B;  2AX5 A;  3PO0 A;  2WX0 A;  1KF6 B;  2WGS A;  1S1Q B;  3AEE B;  5D94 A;  3DOW A;  3TL5 A;  1NEK B;  2LFI A;  5AZF A;  3DVN U;  4CQN A;  3Q3J A;  2GB1 A;  1K51 A;  2KDF B;  5LNK 1;  3N32 A;  2B76 B;  2KOX A;  3W1S A;  3NY5 A;  2BKF A;  4KV2 A;  4KSK C;  4ZHP A;  3H7P B;  2BS3 B;  2BS4 B;  3ZIM A;  2JYT A;  1UBQ A;  2K8H A;  3TJP A;  4IG7 B;  1TS5 A;  4HPM B;  3PPA A;  2H88 B;  5HI1 A;  2RDG A;  2KDB A;  5KHO A;  4DWF A;  5MPO A;  3PT2 B;  5D7G A;  3VUW A;  1NYR A;  4A3P A;  1WGH A;  3BZD B;  4W9K A;  3QCA A;  3QHT A;  2IY0 B;  1QZE A;  3TEW A;  2KNB A;  5EE9 A;  3CIR B;  1D5Z C;  2N1W A;  5JXV A;  1WZ3 A;  3W2D A;  2MA9 B;  2AYO B;  3R7R A;  1H8C A;  2JF5 A;  2BQQ A;  4C4V A;  4I6N B;  1FCC C;  4II3 B;  3KUD B;  3M3J A;  1MVK A;  4ANV A;  4ARI A;  4MGK E;  3EC8 A;  3HM6 X;  4OZB A;  1LQB A;  4GMV A;  3MTN B;  3N30 A;  2JZ3 B;  3FKY A;  1IUE A;  4ICV A;  3ZXR A;  4XX5 A;  3QAQ A;  4WUR A;  2QCZ A;  2CJN A;  2L3Z A;  1YQ3 B;  3KUC B;  3ZKJ C;  1VZ7 A;  3IT4 B;  2QIE B;  5DPT A;  2DYO A;  3AU5 A;  2CU1 A;  1TS4 A;  4GGQ A;  5C2T B;  2DNF A;  3AED B;  4JQW C;  5LXH A;  4YXD B;  2CHX A;  5EE3 A;  2H89 B;  3H9D A;  4O1N A;  1IP9 A;  2ACZ B;  2X8X X;  3AE2 B;  1KLG D;  1ZXI A;  3AH7 A;  2V4I B;  2DWQ A;  1AAR A;  1V6E A;  5JZE B;  3RNF C;  1K8R B;  5FK9 C;  5G2N A;  4AWJ A;  3A9J A;  2AQ3 B;  4REZ A;  2BB6 A;  2HDE A;  1JWS D;  2J52 A;  1FIQ A;  2HTH A;  2RD0 A;  2N7E A;  1QQR A;  1WM2 A;  1WYG A;  3FC4 A;  3QWZ B;  2MSE D;  5C3J B;  2L83 A;  3DQV A;  4MM3 B;  1I4P A;  2FUH B;  1SXT A;  1AWD A;  1TKG A;  3EHV A;  5DPS A;  5I4D A;  3QX1 A;  2M17 A;  3DVG Y;  1RM6 C;  3A33 B;  3GP7 A;  3L13 A;  1P7E A;  1NYQ A;  1ROE A;  4GDK B;  3QA8 A;  3IT6 B;  3UQA A;  2D5G A;  1ZP0 B;  4OZC A;  3NVZ A;  4PS8 A;  1ACC A;  2GI9 A;  1V97 A;  1OEY J;  2I1J A;  2KFK B;  2QDF A;  2MP2 B;  5E6O A;  1MPE A;  3JYU A;  4JL9 A;  3PZ7 A;  1F52 A;  1GJZ A;  4LDT B;  4F1S A;  4HJK A;  1SJH D;  2PEA A;  1MHH E;  2AQ1 B;  2KTF A;  3MC8 A;  5IN7 A;  1I4Q A;  3A9K A;  4M00 A;  1R7S A;  1MI0 A;  2M4N A;  3PZ8 A;  1UWX A;  3NHE B;  2O6V A;  3MP9 A;  2DZK A;  2FIF A;  2PKO A;  2GRI A;  1WF9 A;  2GOW A;  1YX5 B;  2N9E B;  1D5M C;  4IM2 A;  3WAP A;  3ZGZ A;  3KWV A;  2RDB C;  1CMX B;  3BWU D;  3D32 A;  1OTR B;  3K9P B;  3VR9 B;  2VZK B;  2KK8 A;  3ZJU A;  1OQY A;  1TS3 A;  1VCB A;  1GUA B;  4AP4 C;  2K39 A;  2BPS A;  2L8J A;  2K8C A;  1P0R A;  5AZG A;  2QIL A;  2AL3 A;  4K7W A;  3OLM D;  2G3Q B;  2LGY A;  3CST A;  4F8C B;  5CTR C;  2ZCB A;  3A4S C;  4XYC A;  1BXT A;  4HDQ A;  5H8Y E;  1N60 A;  3CWI A;  5EE0 A;  5CHV C;  2KAJ A;  1KOT A;  3R2T A;  4DK5 A;  4M8N A;  1WGY A;  2LAS A;  4PYU A;  4LCD E;  2AL6 A;  2M8S A;  2WXP A;  1WXV A;  1C78 A;  3T3N A;  1E5W A;  2BWE S;  1MG8 A;  3AE5 B;  4P1B C;  2OJR A;  3OJ4 B;  4P16 A;  1T0Q C;  2MW5 A;  2NPT A;  4DXG A;  5AUI A;  1L4D B;  4K81 A;  2V3P A;  3ZJT A;  3BVG A;  1TBE A;  1RAX A;  4EE2 A;  1SE2 A;  2V9H A;  2NS5 A;  5J17 A;  2MBH A;  2JY6 A;  4IOI E;  2IZV B;  1GPX A;  1P7F A;  2JWZ A;  2N9K A;  1IBX A;  1CQV A;  4US8 A;  3R8B A;  3AEC B;  2PE9 A;  3K9O B;  4K3C A;  3MFG A;  4TV3 A;  1SF0 A;  4NAW B;  5IOI A;  2JU6 X;  3QJZ A;  3Q14 C;  4ZRK A;  4KGR A;  4BZA A;  3HVD A;  1M94 A;  2IYD B;  4IWO A;  2D11 A;  4K7U A;  1YD8 U;  3SHQ A;  4GU2 A;  5FR6 A;  4LTU A;  1V86 A;  1PQS A;  1V5O A;  1DOY A;  2FID A;  1FD6 A;  3R3M A;  2JUO A;  4H2A A;  5CHF A;  3FIL B;  3KVF B;  1FCL A;  2FCN A;  2PW9 A;  3Q8A A;  1HA5 A;  1Q1O A;  2C5L C;  3T3O A;  1V49 A;  1J7B A;  2KQ7 A;  3H7P A;  3AE9 B;  2DBY A;  1KM7 A;  4KKJ A;  2HD5 B;  3LXF A;  1TZ1 A;  3S2A A;  3JSV B;  1ZOY B;  2IO0 B;  2L0F A;  4BOS C;  4EEW A;  3L10 B;  1RLF A;  2KDE B;  1WZ0 A;  3I57 A;  3NZ3 A;  3RI7 C;  3HM3 A;  4HLE A;  2RMM A;  2WNM A;  1J8C A;  1TKY A;  1E7U A;  4YWG G;  5J18 A;  5DCN A;  1CJE A;  1F2R C;  2C60 A;  3DVG X;  2M19 A;  1FM0 D;  4J3O D;  4GXB A;  3URY A;  2SAK A;  1C3T A;  2NCN A;  4HCP B;  4BKT A;  2WHI A;  4TMA B;  3DBR I;  1R4N I;  3NZU A;  4HPP A;  2J0M A;  4AOF A;  1FRD A;  4HKZ E;  4DDG D;  1XLN A;  1JCK B;  2KDI A;  2KC2 A;  3WAM A;  2NBV B;  4KGS A;  2PJH A;  1IGC A;  2GBR A;  4B95 A;  2WWZ A;  3M63 B;  4FN2 A;  4HRS A;  4BOZ B;  1YMH E;  2LHD A;  3DBH I;  3NJT A;  4YTN B;  1FNW A;  3BY4 B;  1RRB A;  2LRU A;  2PE6 B;  4W9I A;  4WJN A;  2N7J A;  1UEL A;  4C80 A;  2MBQ A;  3V61 A;  3ENE A;  3PRZ A;  1PFD A;  4W9G A;  2BYF A;  1XLQ A;  3QIJ A;  4WWP A;  1AW7 A;  4W9H A;  3E9S A;  3U4E G;  2NVU I;  1E0Z A;  1V9J A;  1E9M A;  2Z8L A;  1JRP A;  1KJT A;  1B9R A;  4DHZ E;  1WM3 A;  4EUT A;  2KZR A;  3MJ5 A;  4YT0 B;  4MM3 A;  1WXM A;  4RF1 A;  4PYZ A;  4MGI E;  2M56 B;  3H7S A;  3Q2A C;  4KKI A;  5DPW A;  2KMA A;  3IVF A;  2HE7 A;  2LGD A;  1KH0 A;  4M0W B;  3WAL A;  1ZGU B;  3I63 C;  1E6E B;  4MSQ B;  2CJO A;  1B1Z A;  5GXG B;  3ZTC A;  1T3Q A;  3P2B A;  4GDK A;  3DHI C;  2M1M A;  2KQ4 X;  1TKE A;  4GIV A;  2GBJ A;  3UQB A;  2JX5 A;  1NDD A;  4II2 B;  3NS8 A;  3B08 A;  2KFK A;  5TR5 A;  2WXN A;  2MP2 A;  3RCZ A;  4MEM A;  2ONQ A;  3ETR A;  4WAF A;  2V0G A;  4NZL B;  4B9K A;  2RPV A;  1GAQ B;  2KAN A;  4DDI D;  1E8W A;  3V3X A;  2D3G A;  2MBB B;  1F2R I;  3AE6 B;  3KWL A;  4HK2 A;  3RUI B;  1A5R A;  1C79 A;  2IO1 B;  2LZ6 A;  2MBE A;  2PMV A;  4L2Y A;  1JML A;  4RH6 A;  3BK2 A;  3IAS 1;  5BMH A;  4JIO U;  1HTO A;  3Q8E A;  4FJY A;  2K25 A;  3P4R B;  3VTW A;  1UWM A;  1S3S G;  2INP E;  3B9J A;  3MC0 B;  5H92 C;  2FCM A;  2HJ1 A;  3LB8 C;  1ZXH A;  2D07 B;  2IPK D;  1N63 A;  4OVV A;  2MCN B;  1UH6 A;  3OWE B;  2XK5 B;  2K3U A;  4JLC A;  4HKQ A;  2IGH A;  1NBF C;  2N9X A;  3T8M A;  1OFF A;  2N4F A;  4ZRJ A;  1I4X A;  1J19 A;  2KYW A;  3CMM B;  2N0S B;  3SFD B;  3ZW3 A;  1IYF A;  4KIK B;  4S17 A;  5E6P A;  2G45 B;  1V80 A;  1L6U A;  4J6I A;  2ON8 A;  3PS6 A;  4ICU A;  3DBR B;  3E56 A;  3KUZ A;  1L5P A;  1R4N B;  4I6L B;  1T0S C;  1R4M I;  1E8Z A;  2JWU A;  3VVW B;  3IHP C;  1WE6 A;  2KTR B;  3P4S B;  2WU5 B;  4W9E A;  4AQ7 A;  3A1Q B;  3RNC C;  3PSE B;  4NJC A;  1KLV A;  2OJW A;  3UGB B;  3PRE A;  2KAC A;  4XE0 A;  2LVQ A;  1XLP A;  4TSS A;  3JW0 X;  3DBH B;  4HXD A;  1WGD A;  3BYY B;  3ZRF A;  3Q3M C;  5G5H A;  4RGT A;  1FRR A;  1WR6 E;  3APF A;  4NAW A;  2UYZ B;  3NOB A;  4GB9 A;  5G55 A;  4DHJ B;  2KKC A;  2RR9 A;  3V60 A;  4ZYN A;  2ZW1 A;  3EGR A;  4DHJ D;  2FAZ A;  3PHW B;  3PZD A;  1YNT E;  3EFU A;  4DQO C;  5E6N A;  4HWI B;  1V1P B;  1BT0 A;  2MEK A;  3O65 B;  2KN4 A;  2FUG 1;  3HVZ A;  3FIL A;  2RGF A;  3B2G A;  3TBL D;  2RSU A;  1Q0W B;  1N5W A;  3NUH B;  1WGK A;  2D10 A;  1FXI A;  4N58 A;  2DAF A;  4L1B A;  4RGN A;  3ZYY X;  4XDD A;  4C00 A;  4IM3 A;  4GLS C;  2I2Y A;  2K8B A;  2PTL A;  2Q5W D;  1N5X A;  1WR1 A;  3JSV A;  4G50 A;  2KJH B;  5BYS A;  2LUM A;  2J0J A;  2KHW B;  2M0A A;  2INN E;  5IAA C;  4E74 A;  2WXQ A;  1EU4 A;  1I4H A;  2MHJ A;  4LNN A;  5IO9 A;  2ZW0 A;  1EM7 A;  2JYE A;  2JQR B;  4TQ1 A;  1U4A A;  4IKG A;  1AN8 A;  2N9L A;  2WXR A;  2FE8 A;  2C7M B;  2BYT A; 
#chains in the Genus database with same CATH homology
 4RF0 A;  3L4P A;  4LTU A;  1E10 A;  3N9Y C;  2KMM A;  1J7A A;  1JWM D;  2W3S A;  1GB4 A;  2WDV B;  1XO3 A;  2PVO D;  2PLP A;  1QKZ A;  1DOY A;  1QOA A;  2WXM A;  1JWU D;  3Q8C A;  5T8I A;  1DGJ A;  1XXG A;  1FD6 A;  1TS2 A;  1L0Y B;  2OED A;  4H2A A;  1EWY C;  1ET9 A;  2LGI A;  2NMQ A;  3FIL B;  1WSP A;  1FCL A;  2TSS A;  3UI3 A;  2QMT A;  2V3N A;  2MJE A;  2Y3A A;  1SB3 C;  2JZP A;  1JQ4 A;  4P6V F;  2HTM E;  1HZ5 A;  2PW9 A;  3Q8A A;  1HA5 A;  3T3O A;  4ARC A;  1LO5 D;  3AM9 A;  3P1M A;  4RGO S;  3LYY A;  3KLS X;  4YTP B;  1J7B A;  2YEP B;  3TEZ A;  3AE9 B;  3FAH A;  2DBY A;  3J9C A;  1XCQ L;  1OQR A;  3AE1 B;  2XNA C;  1JWB D;  4KKJ A;  1NI3 A;  1HQR D;  3DWG C;  3BK1 A;  1ZE3 D;  1XLO A;  1EU3 A;  3LXF A;  4C7Z A;  4IDI A;  1ESF A;  2G1E A;  2I38 A;  1VRA B;  1TY2 A;  1C4P A;  1L6V A;  3GB1 A;  4C56 C;  1ZOY B;  4OHJ A;  2K22 A;  1QIL A;  1STE A;  2W54 A;  4JWU C;  4US9 A;  4OW0 A;  4D2K A;  1IBX B;  4KGT A;  3I57 A;  3NZ3 A;  2BT6 A;  2LHE A;  3I9V 1;  3VQI A;  3EA6 A;  4MAC A;  4R3D A;  2RMM A;  2WNM A;  2WXH A;  5D3D A;  4B0M A;  1TKY A;  2WDQ B;  2DYM A;  4JWS C;  4YWG G;  1CZP A;  3U52 E;  1CJE A;  1F2R C;  1NEN B;  1SE4 A;  2BB5 A;  2M19 A;  1AYF A;  1FM0 D;  4J3O D;  3URY A;  2R61 A;  5FKA C;  1UGJ A;  2SAK A;  3HUI A;  4HEA 1;  4JPS A;  4TMA B;  4N6E B;  2IGD A;  4M0W A;  1QOB A;  3R2I A;  3AV8 A;  1RFK A;  2J42 A;  2E3T A;  3W5U B;  4RCO A;  3U7Z A;  2AX5 A;  3PO0 A;  1KF6 B;  2BS2 B;  3AEE B;  3V05 A;  3AE7 B;  1FRD A;  4C7Y A;  1NEK B;  2LFI A;  4HKZ E;  2OHF A;  1QOG A;  1XLN A;  4CQN A;  1HXY D;  1JCK B;  5E6J A;  1DOI A;  1SSN A;  2GB1 A;  1K51 A;  3TEY A;  1I4G A;  4WWM A;  5LNK 1;  4KGS A;  2B76 B;  1IGC A;  2FBW B;  3W1S A;  1FFV A;  1ET6 A;  4ZHP A;  4WIP A;  3EUB 2;  1BUI C;  1TJE A;  2XN9 C;  2BS3 B;  2BS4 B;  4JX1 C;  2LMC A;  2JYT A;  4HRS A;  3ZQ4 A;  1D5X C;  2ICI A;  1YMH E;  1TS5 A;  2LHD A;  1NVI D;  1KLU D;  2BBC A;  2L32 A;  1JW9 D;  4YTN B;  1D4B A;  4WH4 A;  1C76 A;  3BII D;  2H88 B;  5HI1 A;  1SEB D;  1FNW A;  2RDG A;  1XEE A;  1L0X B;  2N7J A;  5MPO A;  2BTE A;  4C80 A;  5G5G A;  5D7G A;  1NYR A;  3TSS A;  2WS3 B;  4YSX B;  1PFD A;  3BZD B;  1OQQ A;  3NVY A;  1XLQ A;  1YQ4 B;  1SE3 A;  2YEP F;  3ABV B;  1AW7 A;  3TEX A;  4KX6 B;  3E9S A;  3TEW A;  3U4E G;  1VJK A;  3WCQ A;  2IJ0 A;  1E0Z A;  1RWS A;  5EE9 A;  3CIR B;  1D5Z C;  1E9M A;  2Z8L A;  1JRP A;  1B9R A;  4GDL B;  2J53 A;  4MH8 A;  3MJ5 A;  1N61 A;  4YT0 B;  3TUO A;  5JXV A;  3W2D A;  4RF1 A;  2K9X A;  1FNV A;  2M56 B;  4KKI A;  4TQ0 A;  1PGB A;  4XWW A;  1TZO A;  1UNS A;  1KH0 A;  1FCC C;  1WWT A;  1MVK A;  4ARI A;  1E6E B;  2CJO A;  1B1Z A;  2SEB D;  2WXJ A;  5GXG B;  4OZB A;  2WXG A;  1T3Q A;  3SR6 A;  4LK0 M;  2MJ3 A;  1IUE A;  2KQ4 X;  4A90 A;  1TKE A;  2RDH A;  2DLB A;  1HZ6 A;  1K50 A;  4WUR A;  2JX5 A;  2WU2 B;  2L1A A;  2WXO A;  1QT9 A;  2K5P A;  2EKI A;  2CJN A;  2WXN A;  1YQ3 B;  5BYR A;  1PUT A;  2VZK D;  5AUK A;  3H8H A;  5BYQ A;  2ONQ A;  3ETR A;  4WAF A;  2V0G A;  1VZ7 A;  3AMZ A;  3IT4 B;  2QIE B;  3DWM A;  1YN5 A;  3AN1 A;  2DYO A;  3IXS A;  4NZL B;  2RPV A;  1GAQ B;  4JE3 B;  3AEF B;  1TS4 A;  3V3X A;  1F2R I;  5C2T B;  3AE6 B;  3AED B;  3KWL A;  5BMI A;  1C79 A;  4YXD B;  5EE3 A;  3W5V B;  2H89 B;  3SFE B;  2PMV A;  4O1N A;  2KDM A;  2ACZ B;  1C4A A;  4L2Y A;  3AE2 B;  1JML A;  4RH6 A;  3AE4 B;  1J7C A;  1KLG D;  1ZXI A;  3AEA B;  3BK2 A;  3IAS 1;  5BMH A;  3AH7 A;  2V4I B;  3VRB B;  2DWQ A;  1JRO A;  2G9H D;  4LLG M;  4WQM A;  3Q8E A;  1MHX A;  3P4R B;  5FK9 C;  1UWM A;  3IAM 1;  2INP E;  2NTS A;  2AQ3 B;  3B9J A;  2BB6 A;  3MC0 B;  3NVV A;  4REZ A;  5H92 C;  4PT5 A;  2HDE A;  2W55 A;  1JWS D;  3Q69 A;  2J52 A;  3KQ4 A;  3LB8 C;  1ZXH A;  1FIQ A;  2IDY A;  2IPK D;  4ZYS A;  1N63 A;  2JSV X;  1QQR A;  4A9A A;  3OWE B;  2PVG C;  2K3U A;  1WYG A;  1VR9 A;  1IGD A;  3FC4 A;  4A8X C;  4ZHO A;  2QJL A;  2L83 A;  3AE8 B;  5C3J B;  4HKQ A;  1TYG B;  2QEJ C;  2IGH A;  1RYJ A;  3BVM A;  4MM3 B;  1I4P A;  1OFF A;  1SXT A;  1YJI A;  1GB1 A;  4YSZ B;  1F0Z A;  1I4X A;  3RFZ B;  1SBB B;  1AWD A;  1TKG A;  1YN3 A;  5I4D A;  4RNA A;  3GS2 A;  2KWD A;  1M4V A;  2N0S B;  3SFD B;  4HRO A;  3P4P B;  1C77 A;  3HRD D;  1RM6 C;  4ZOH C;  1WRI A;  3GP7 A;  1P7E A;  1L6U A;  2CU3 A;  5BMG A;  1NYQ A;  1ROE A;  1V1P A;  4UDU C;  2ON8 A;  4GDK B;  3IT6 B;  4OZA A;  3E56 A;  2D5G A;  1HEZ E;  1ZPS A;  1ZP0 B;  1E7P B;  1PGX A;  1L5P A;  1N62 A;  4OZC A;  1FMA D;  2Y5C A;  3NVZ A;  1ZUD 2;  1ACC A;  2W82 A;  3VR8 B;  2W3R A;  2GI9 A;  1V97 A;  4FXC A;  1C4C A;  4DXF A;  2WXK A;  4ZRP A;  2JWU A;  3P4Q B;  1DYQ A;  1MPE A;  1XF5 L;  3PZ7 A;  3NS1 A;  3P4S B;  3P63 A;  2WQY B;  2WU5 B;  3O13 A;  5D3I B;  1SJH D;  3Q8B A;  2AQ1 B;  1MHH E;  4XDC A;  4AQ7 A;  1XCT L;  1I4Q A;  3P42 A;  1T6B X;  4NJC A;  1R7S A;  1MI0 A;  3PZ8 A;  4A6Q A;  1UWX A;  3MP9 A;  1PGA A;  2KAC A;  2PKO A;  4XE0 A;  2GRI A;  3C8Y A;  1QOF A;  1XLP A;  1YN4 A;  2J4X A;  1FFU A;  2WP9 B;  1DOX A;  2PIA A;  2WLB A;  1D5M C;  1K52 A;  4TSS A;  3ZGZ A;  2LEK A;  1JWA D;  2WXL A;  3KWV A;  1QLB B;  3BWU D;  3NVW A;  3BYY B;  3B2F A;  5G5H A;  4RGT A;  3VR9 B;  2VZK B;  1FRR A;  2LJI A;  2WDR B;  3ZJU A;  1L4Z B;  1FXA A;  1TS3 A;  2JXT A;  4RGM A;  4HJG E;  2MH7 A;  4L23 A;  1I7H A;  1FNU A;  1ZDV A;  1KFY B;  5HFY A;  1T5X D;  1KTK A;  3MHZ A;  1JAL A;  4OVZ A;  1BML C;  1PDX A;  2QIL A;  1CK1 A;  3AEB B;  1D6E C;  4B0E A;  2ZW1 A;  3EGR A;  4Q2J A;  1BXT A;  5H8Y E;  1N60 A;  3AEG B;  3CWI A;  3SEB A;  2MJD A;  5EE0 A;  1YNT E;  4DQO C;  2KAJ A;  1V1P B;  1GOZ A;  2MEK A;  1ENF A;  3AE3 B;  2KN4 A;  3R2T A;  5TSS A;  1YJJ A;  1FO4 A;  2FUG 1;  1Y56 A;  3FIL A;  3HVZ A;  4A55 A;  3AB5 A;  3B2G A;  1QF6 A;  4ITK A;  1VLB A;  1L0V B;  2WXP A;  3VRA B;  1V8C A;  1ZDX A;  1N5W A;  1A70 A;  3NUH B;  4USA A;  4YSY B;  1PYW D;  1C78 A;  3NRZ A;  1WGK A;  4XWT A;  3T3N A;  1FXI A;  4RFB A;  2IGG A;  1VDV A;  1UUP A;  3AE5 B;  4N59 A;  4N58 A;  3W9C B;  4L1B A;  1F77 A;  4RGN A;  4P16 A;  3BVZ A;  1WXQ A;  4ZRQ A;  3ZYY X;  4XDD A;  4AS1 A;  4DXG A;  3U2S C;  3Q8F A;  5AUI A;  1KRH A;  1L4D B;  4GLS C;  2I2Y A;  2PTL A;  5HHD G;  1FEH A;  5FR3 A;  2V3P A;  2Q5W D;  1SJE D;  1N5X A;  2EEL A;  3ZJT A;  3BVG A;  5BYS A;  2LUM A;  4EE2 A;  2M0A A;  1SE2 A;  1C9F A;  2E6X A;  2X38 A;  2INN E;  1VZ8 A;  2WXQ A;  1EU4 A;  1I4H A;  1V1O A;  1VZ6 A;  4IOI E;  5EE1 A;  1P7F A;  2ZW0 A;  2N9K A;  1GPX A;  1SIJ A;  1EM7 A;  1IBX A;  1CQV A;  3ZJV A;  1I4R A;  4US8 A;  2BW2 A;  3R8B A;  3AEC B;  2JYE A;  1Q10 A;  1TY0 A;  3MFG A;  2NTT A;  2AQ2 B;  2JQR B;  1SF0 A;  4NAW B;  5HG2 A;  4NAM A;  4TQ1 A;  2JU6 X;  2WXF A;  3BYT B;  4MT5 A;  3RPF C;  2K0P A;  2Y5P A;  4KGR A;  1EWC A;  1AN8 A;  2N9L A;  2WXR A;  4IKG A;  2L52 A;  2FE8 A;  3HVD A;  4YTM B;  2WXI A;  2QSD A;  1K53 A;  2BYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...