1C77A

Staphylokinase (sak) dimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
GKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOKINASE
publication title Crystal structure of a staphylokinase: variant a model for reduced antigenicity.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 22
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c77A00
1BUIC 1C79A 1C78A 1C76A 2SAKA 1C77A 1SSNA
chains in the Genus database with same CATH superfamily
1WRIA 2N1WA 1F2RC 4OZBA 1ZXIA 2D11A 2DENB 3P63A 2ZEQA 1WGGA 5DPWA 2K39A 4HLEA 2RPQA 1V1PA 1L4DB 3QJZA 1QOFA 1RRBA 1C79A 2IGGA 4KKJA 2FE8A 1S1QB 4PS7A 2K6DB 2FBWB 1XO3A 1WJ6A 1SEBD 2NTTA 4RM9A 2MEKA 3PZ7A 1ZE3D 1FD6A 3RN9C 4NQKE 4ITKA 3AULA 5TSSA 5DPTA 2LHEA 1WGYA 1WRDB 2OHFA 1DYQA 2RGFA 4US9A 3MC8A 2JU6X 4W9IA 1YIWA 1V86A 4JQWC 4ZRJA 2L83A 2BF8B 5C3JB 1VDVA 2V3NA 4M8NA 4W9JA 2ICIA 4X57B 4RGMA 1QLBB 2JWUA 1K50A 5H8YE 3ZO5B 4MACA 2KAJA 2LJ5A 3DVNV 3NVYA 4IDIA 4NJ6A 4WJOA 2WXKA 4EOYA 3GE3C 1JWAD 3FAHA 3S2AA 2H89B 2QEJC 3PREA 4LNFA 4AJWA 2V0GA 1TZOA 2LHDA 3ALBA 3K9PB 2BTEA 3BY4B 2WQYB 4C7ZA 4IC7B 4OVZA 2DWQA 4FXCA 4Q2JA 3HIZA 2YEPB 1KLVA 1Y8RC 2O2VA 5LNK1 3Q3JA 4MGYE 3DBRI 3AECB 1FXIA 3NRZA 1OGWA 3P42A 1RYJA 3DVGY 2CS4A 4ZHOA 4PK1A 1T6BX 3PS6A 2K9XA 2MJDA 2WU5B 2MP2B 2AYOB 3KQ4A 1KH0A 4A20A 2DYOA 1SIJA 1WFYA 2X8XX 1S3SG 3UQBA 1EF1A 3QHTA 2KO3A 2JZPA 3CF6E 4BBNF 1SJED 4JWSC 4OW0A 1JALA 3BK2A 4TSSA 5E6PA 2MW5A 3X0WA 1MFWA 3SR6A 3L4PA 1XXGA 4P7IA 2LJIA 1E7UA 4RF1A 2WXQA 1WMHB 4K7WA 2KJHB 3SFEB 5IAAC 1J7CA 2Z59B 4JIOU 2EMTA 5JXVA 2JRIB 3I9V1 5E6OA 1R7SA 2YLMA 4MGIE 1ET6A 2R2QA 3Q8FA 3OAWA 4CQNA 4YSZB 2R2OA 3ZJTA 3RI7C 1TYGB 3ZW3A 3ZYYX 3PRMB 4B95A 3KLSX 1DOXA 4OZAA 3MC0B 1FFUA 1WJ4A 5J2RA 2QCZA 5BYSA 2KFJA 3TSSA 2XK5B 1FRDA 1L0VB 3PSEB 3AM9A 1V81A 1GC7A 3H7SA 1NI2A 4HPPA 1E6EB 5D94A 2M8SA 3B2FA 1BMLC 5GXGB 3NZUA 3AE2B 4FLHA 4L23A 2PMVA 3EUB2 4RFBA 2FNJB 4BKGA 4OVUA 5EE9A 4MDKE 1LXDA 3Q14C 3AV8A 2IGHA 1RLFA 3B2GA 4GN1A 3DBSA 3SFDB 1KLGD 1YJIA 2KJRA 4BZAA 4GU2A 1IUEA 1V5TA 2MBEA 1AARA 2VH2A 3WAMA 4DDGD 3ML8A 1KF6B 2HDEA 4K1RB 4YT0B 5FKAC 4MJSB 3H6NA 1WWTA 3H9DA 4GDKA 4YTPB 1WZ3A 3N1YC 4WWOA 2RDGA 2FCSA 4ARIA 3PLVA 2BKFA 3N3KB 2I38A 4YSXB 1V80A 3A1QA 3EFCA 4IW0A 1LQBA 5BYRA 2AL3A 4FA6A 1IGCA 4KVGB 1HZ5A 5IOIA 2L0FA 5EE3A 2KXJA 3OJ4B 5BMIA 2AL6A 2N9LA 2N7EA 2XNAC 1AW7A 2HD5B 1I4RA 4WAAA 1ZP0B 4BOSC 3PVLA 2EELA 2ONQA 3A9JA 2LGYA 1L6UA 5EE0A 5D3DA 5AZFA 1VZ8A 2LUEA 4LNNA 4HEA1 2M17A 2NS5A 3UQAA 1I4GA 1MHHE 1P9DU 2BYFA 4I6PA 3B08A 2CJNA 3SD5A 2INCC 4MM3B 3I5JC 1V2YA 2G3QB 3CIRB 5HG2A 1UWMA 3WAOA 5CX3A 2V1YA 4PT5A 3L0WB 1WE6A 3MTNB 2EKIA 5JHAA 3AEFB 2KX3A 2JPHA 2PKOA 3BINA 2BWES 3TUOA 1E7VA 2KK8A 5HFYA 3JVZX 2SAKA 2WXGA 1FCCC 1L0XB 2C7NB 2Q5WD 1T0QC 3HM3A 3ZNHB 2CKHB 3GB1A 4GOCA 2QMTA 2UWQA 2LD9A 5AUKA 4CYEA 1J0GA 2GI9A 2FCMA 5FR6A 5AUIA 2CHZA 2WHIA 2QILA 2E3TA 2AQ1B 3L10B 2HJ8A 1TT5B 1WM2A 1WJNA 2IPKD 2ASQA 4N58A 2L1AA 4S17A 1HZ6A 4FJZA 3I63C 4GLSC 1D3ZA 4KGSA 5J17A 2QHOA 3V05A 2WXPA 4ICUA 4ZHPA 1GJZA 3SDLC 1FCLA 3BVZA 2WGSA 1Q1OA 5H92C 2SEBD 1H4RA 3HM6X 2K0PA 3LB8C 5BMGA 1VD2A 2PEAA 3AU5A 1C78A 1HA5A 1FFVA 3MJ5A 5G55A 1WYWB 3VUXA 4WWNA 2PVGC 3AE3B 3EECA 2CU1A 2RDHA 4P6VF 3AI5A 2MBOA 3WCQA 4IM2A 3SHQA 1N5XA 4BOZB 4USAA 3B9JA 4M0WA 3EC8A 1AN8A 4IM3A 3AE5B 4TKNA 1F9JA 1D5ZC 1IP9A 3NS8A 5BO4B 2KVZA 1GB1A 1SE2A 2KQ4X 4NNJB 2LXCA 5TR5A 1K8RB 1WXMA 2V4LA 4PYUA 4JWUC 1IPGA 2KN4A 3RYTA 2C5LC 3W5UB 3RNCC 3N30A 1QOGA 4RGOS 1IYFA 3KUDB 1C1YB 4BKTA 3A9KB 3TCAA 2L32A 3BYTB 3VQIA 4KZ0A 4DQOC 3ZUNA 3IFWB 3ZKJC 2FIDA 2AX5A 2DAJA 2JT4B 3EFUA 3QK0A 1JWBD 2IGDA 3WALA 2MJ3A 4P1CC 2XBBC 4EE2A 3ZDMC 2KNBA 3DBLI 2XEWA 3R7RA 3ABVB 3E9SA 1RFAA 2BGFA 2DZIA 2O6VD 3DPDA 3DBHI 4P1BC 3HHMA 4AP4C 4BKSD 3I57A 1N60A 4DXFA 3IHPC 5DPRA 2QIEB 2KT7A 3PZDA 2KTRB 3RNEC 3ZRCA 1PYWD 1V9JA 1M94A 1E10A 3MJWA 2HTME 3ZJUA 4HPMB 4ZRKA 2HJ1A 3V60A 2CHWA 1QILA 3ENEA 3R2TA 1WE7A 2KZRA 1C77A 1YX6B 1GAQB 2DZMA 1WX7A 3UINB 3VR9B 3HUIA 2ZVOA 4HDOA 2ZNVB 1I7HA 3RCZA 3SEBA 3QARA 4HK2A 3GOEA 2D3GA 4OHJA 1YJJA 2BT6A 1XLOA 1C76A 4KGTA 3DHHC 4IWQA 3ONSA 2J0JA 1P1AA 4HXDA 1YN3A 3UGBB 3RFZB 4ZOHC 2WNMA 4KIKA 3QAQA 2BVCA 3H7PB 3M3JA 3NJTA 3NZ3A 1ZPSA 1OEYJ 2KANA 2FUHB 2J4XA 2IO3B 2G45B 1D6EC 3ZJVA 2M1MA 3E56A 3IAM1 4K7UA 2K6QA 4J6IA 4JLCA 1MI0A 2O6VB 2KC1A 1F77A 3BIID 1WGDA 2KFKB 4ACFA 4FBJB 4FHKA 4AOFA 3WAPA 2LWPA 2M56B 1P3QU 2V3SA 1GPXA 3A33B 1XLNA 1KM7A 2DAFA 1ZXHA 3RT3B 3B0AA 1ZKHA 3PTFC 3IXSA 2GBKA 2N7DA 5D3IB 2LMCA 1J7AA 2L05A 1F52A 2M19A 5HHDG 5GMVA 2Y3AA 4K3BA 3APFA 1NEKB 3DHGC 1WXQA 2G1EA 1L2NA 1NBFC 4MSQB 3JSVB 1ET9A 4MT5A 4NAWA 1KJTA 4G11A 4A8XC 3MHZA 1IBXA 5CTRC 3ZNZB 3Q3MC 1UF0A 2DX5B 2W3SA 1JWUD 2NVUI 4TV3A 2LUMA 2I1JA 4MH0E 2DYMA 2EMSA 4RGNA 2NMQA 1K52A 3EGRA 3Q69A 1RM6C 2FIFA 4JX1C 4GXBA 2K1FA 2KD0A 4REZA 2N9EB 1E8XA 2M4NA 2RD0A 3V6EB 1V6EA 3ZNGC 4BVUC 2KX0A 4CO7A 1SIFA 2PLPA 3IG3A 1N61A 1KRHA 5LXIB 2BYTA 4E71A 2KQ7A 2G9HD 2J0MA 1ACCA 2L52A 4KDIC 1CK1A 4GDLA 3AMZA 3X23A 2D5GA 3KUCB 2GBJA 5FR3A 3AEGB 1ZW7A 1RWSA 4E3CA 3QC8B 3ZTDA 1FM0D 5C23A 2QC8A 1MG4A 3QQ8B 4US8A 5C2TB 2OJWA 1F1HA 5G5GA 1MPEA 3L54A 3N9YC 4AUQC 3RZWC 4W9LA 1WJUA 2NPTA 4GGQA 1T0YA 2N1VA 1E8WA 3L17A 1XCTL 4GMVA 1TS2A 4WQMA 1YQBA 1KLUD 1SGHA 2KWUB 1HE8A 2W3RA 4M02A 4TMAB 2W55A 2LASA 4LTUA 1N63A 3ZIMA 1UWXA 4FADA 4HVBA 3VH4B 1I4HA 2FCNA 2WXNA 4W9KA 4DHJD 3AN1A 4BBNC 1RAXA 1KTKA 3WIMA 2A4ZA 1E7PB 3RD2A 4XZ4A 2CR5A 5BYQA 1NVID 1FO4A 1FNWA 2ZW1A 1SBBB 1V8CA 1IGDA 3TEZA 1GUAB 4JPSA 3OG5A 3ZNID 1UBQA 3PHWB 1Y56A 3NOBA 2K8CA 1WGKA 1EWYC 1D4BA 2TSSA 2KN5A 5LLIA 3ZXVA 2KDIA 1F2RI 1L6VA 1V49A 1X1MA 5AEKB 1EO6A 3KH0A 1QF6A 3HVZA 3MHSD 3AEAB 2J0KA 4FJYA 2LGSA 2BPSA 5JHBA 1A5RA 1Q0WB 2KOXA 4MH8A 1XLPA 2RSUA 3TIXA 1ISNA 5BMHA 3LDZE 2CJOA 1KOTA 3JW0X 3NUHB 4CHKA 1I42A 2LXAA 1WH3A 3U2SC 5KHOA 3QCAA 2VRRB 1OTRB 5AZHA 2JXTA 3KWLA 4IWOA 4L1BA 5D6JB 3P2BA 5IA7A 2Z0DB 2YVCA 1YX5B 4HWIB 2AQ3B 3Q6BA 1V1PB 2B76B 3DVNU 1V5OA 2E6XA 4N6EB 2LRUA 2WYQA 3L08A 2PTLA 4C4VA 1OEYA 4DHJB 3FILA 5MPOA 3AE8B 3VUWA 2C7MB 3R3MA 1TTNA 1JRUA 3GZNB 2RDBC 1TKGA 2JRHA 4A55A 1WZ0A 5HI1A 2ZCCA 2LFIA 3MFGA 3R66C 4PS3A 1D5MC 4N9F4 4HJGE 4LJOB 1H8CA 2BWFA 2KQSA 2ON8A 4O1NA 3VAWA 3WANA 4NJCA 1XEEA 2MX2A 3H1UA 3CMMB 3W9CB 4MGZE 3TEWA 2MBQA 2LZ6A 2KMMA 2NBUA 2EKEC 4HCPB 3W1SA 2BYEA 3ZRFA 5IP4D 2VH1A 4FJVB 4L2YA 1XCQL 2WWZA 1YNTE 1RFKA 3P4RB 3AH7A 2IO2B 4NPNA 3WA0A 3QX1A 4P16A 2JX5A 5JH5C 4ARCA 3AE7B 2O2VB 1YQ4B 2GRIA 3RUIB 4NAMA 1PDXA 1JWSD 3MC9A 2DHZA 2BS3B 4E74A 4LLGM 5EDSA 1I4QA 4NZLB 4I6NB 3BVMA 1VLBA 2N9KA 3EHVA 2IZVB 4WWMA 5G2NA 4GB9A 2BB5A 1XD3B 4C7YA 4ZRQA 1BXTA 1ZDVA 1XQQA 3W1SC 4WJPA 4QAYA 2ZVNA 1TJEA 3N32A 1D5XC 2MBHA 4A9AA 1DOYA 3C8YA 2INPE 2J42A 2W82A 1WXAA 2MLBA 4XWWA 1QZEA 3KYCD 4EKUA 4HPLB 3IVFA 1WR1A 1FRRA 2LRWA 3RNFC 2KC2A 2BQQA 2LGDA 1NENB 2AQ2B 2KDBA 4KV2A 4K3CA 3RNBC 2D10A 1QKZA 1TS5A 2KDEB 2MHJA 3JYUA 1WI0A 4WJQA 2D2QA 1ZOYB 2N4FA 3IT4B 3KUZA 4M00A 2QSDA 2LGXA 1TS3A 2MP2A 5C1ZA 1VZ7A 1C4AA 3DQVA 3RNGC 3I3TB 1E9MA 3CWIA 4LDTD 3M63B 3AXCA 4LK0M 3Q3OC 5LXHA 1PQSA 1I4PA 4II2B 1R4NB 4EEWA 1A70A 1XF5L 1YQ3B 4M01A 1R4NI 3RNAC 2GBRA 1UUPA 1TGZB 4MEMA 4EFOA 2BYVE 1FMAD 3T3OA 1ESFA 1VZ6A 1SSNA 1TS4A 4XDCA 2KVRA 1C3TA 4FULA 2LVQA 2N9PC 4HROA 2UU7A 4D2KA 2K5PA 1F0ZA 1WMHA 5FK9C 1FNVA 1UD7A 2PJHA 3A4RA 2KMCA 1CJEA 3M95A 4F1SA 1NYQA 4YTMB 3EA6A 3D32A 1N6ZA 3Q3NC 4HDQA 2KMAA 2J7QB 4I6LB 2MA9B 4IM0A 2KWCA 2WXLA 4YSYB 3N1ZC 1HQRD 1AWDA 2GBMA 2I2YA 3VUYA 4GDKB 4F7ZA 2DZKA 5EE1A 1JW9D 4HJKA 3ZVVA 3AE4B 2N7JA 2LVOA 2K22A 4XX5A 1R4MB 2FUG1 2XK5A 2IDYA 3A1QB 5D2MB 1L7YA 3PRZA 2L0TA 1LGRA 2WXIA 1UGJA 2Z8LA 3AE9B 3W1YA 5HKHA 3ZDTA 4RCOA 3MP9A 4LDTB 2NBWB 3RULA 3AB5A 1LFDA 1LO5D 3VFKA 1C4PA 5DPSA 3LXFA 2L3ZA 5L83A 2RMMA 4XGAB 1STEA 3VRBB 2M0XA 4IWPA 2INDC 3A9JB 1HEZE 1WR6E 1WGHA 2K8BA 3PHXB 4WWPA 5I4DA 4MELA 4PS8A 4MJSA 3OJ3A 3W2DA 2LEKA 4LJPB 1UNSA 5CHFA 1J19A 3TMPB 2ZJDA 3OWEB 2W9NA 1YOVB 3CSTA 2PPHA 2KTFA 2WS3B 2WXJA 1EU3A 3IBEA 4OZCA 2KYWA 1B1ZA 2KLCA 4C56C 4FHJA 2BB6A 2L7RA 1OQQA 3PRPB 3VVWB 1EUVB 5J18A 4WJNA 1V1OA 3N20C 2BW2A 2GOWA 2JF5A 5G5HA 2D3CA 1ROEA 3VTWA 2NCNA 2MBBB 1T5XD 3AE1B 2UYZB 1PFDA 2Z0EB 2DBYA 1NDDA 4N59A 3HK0A 3PPAA 4LNKA 3DWGC 4IG7B 2PW9A 1QQRA 1JMLA 4MM3A 1CQVA 3Q8EA 3QWZB 3NVZA 2HTHA 1YMHE 3BK1A 3PT2B 3P4PB 3LYYA 3BVGA 2KWDA 3PV1A 3FKYA 4WQOB 2ACZB 4IUMB 2A5UA 2J52A 3RMKC 2LI5A 2K8HA 2WU2B 2IY0B 3U7ZA 1TBEA 2JSVX 1E8ZA 5KHQA 1TZ1A 3HVDA 3NHEB 3M62B 2JXXA 3VRAB 2JYEA 4YWGG 3VXWA 1OFFA 2MQJA 2KKCA 4JE3B 2L76A 2B3AA 1NYRA 4M0WB 3IAS1 3DBRB 3OLMD 1JWMD 2V4IB 3PGEA 3R8BA 2I1KA 3U4EG 1TKYA 2MH7A 1WY8A 4KDLB 2WDQB 3T9LA 3AEBB 2Y5PA 2BS4B 3C0RB 3L16A 1E5WA 4C00A 1DGJA 4ZYNA 1T0SC 3UF8A 3V62A 3ML9A 3NZSA 1M4VA 3AU4A 2ZCBA 4YTNB 4YL8A 1GG3A 3H8HA 2WXHA 4RGTA 3BWUD 4LNOA 3DCGA 5E6NA 3B1LX 2IY1B 3VR8B 3DOWA 1C4CA 1K51A 2HE7A 1EM7A 1UGMA 3APCA 1E0ZA 4K81A 1FXAA 4UDUC 4URKA 4M8MA 1DOIA 4ZDVA 3KYDD 1P98A 1WYGA 1QOBA 1AYFA 2N0SB 3QIJA 1Q10A 4ZRIA 3UIOB 3P4QB 1WXVA 3O13A 4IKGA 3T3NA 3VHTC 2G4SA 4MGKE 2D3BA 4A6QA 2DYBA 4ANWA 2WDTB 2LGIA 1P7FA 4ANVA 4BFRA 3RPFC 3URYA 1WSPA 2L8JA 3TL5A 3ZTCA 3GS2A 2BS2B 4FN2A 2KJ6A 3VTVA 4J3OD 3P1MA 3A9KA 3Q8BA 2WX0A 2ZZPB 5JZEB 2H88B 4HRSA 4RMAA 1MJDA 2DZJA 2ZW0A 2MWSB 1SJHD 3AE6B 4KSLC 4C80A 1CMXB 2Y5CA 3ZQ4A 1SXTA 1VR9A 3TBLD 3Q8AA 4TUUA 2DNFA 4NJ7A 1TKEA 3V61A 4ASWC 3U8ZA 5L95C 1I35A 4EZKA 1OQRA 3ECIA 4DWFA 1ZUD2 4DXGA 4EUTA 2OOBB 3U52E 4JGHB 1ZGUB 2V3PA 4GIVA 1L0YB 4EZLA 4RF0A 4A90A 4II3B 2BBCA 3NS1A 4MSMB 4HKQA 4AQ7A 3Q8CA 4KIKB 4PYZA 2KTRA 4OVVA 4S0RA 1Z5SB 3Q3FA 1YN4A 1WX8A 3AEDB 4XE0A 2NBVB 2KLGA 2JVCA 4EZJA 2ZPNA 2INNE 3IT6B 2REXA 3ZGZA 2PE9A 1TY2A 4AJYB 5CHWA 1WX9A 3Q2AC 3R7QA 1YN5A 3TEYA 1SE9A 1E90A 4B0EA 1EF5A 4TQ0A 1QT9A 3W5VB 4A3OA 2GLSA 4AS1A 4ANXA 1P0RA 4W9HA 3K9OB 3KW5B 3CSFA 3GZNI 3HRDD 1QOAA 4DDID 2K25A 2WDVB 3L13A 3VH3B 1G6JA 4KGRA 1TY0A 2ZPYA 3H7PA 4NQLB 2AEHA 2PVOD 4NAWB 2RPVA 2Y5BB 2ZNVC 4WH4A 1HTQA 4F8CB 1SE3A 2JQRB 1FIQA 1IBXB 4DBGA 2MSED 1BUIC 2O6VA 3R2IA 1N5WA 1I4XA 3ETRA 1TIFA 4WAFA 3BZDB 2KFKA 4BKSA 1PGBA 2KWVB 4XC2A 4G0NB 2R61A 3P4SB 1ZDXA 1E8YA 2MJEA 5IO9A 1UH6A 1L5PA 2KDFB 4W9FA 1V97A 2V9HA 4WURA 1U4AA 4ICVA 4W9CA 2RR9A 2OJRA 1L4ZB 1SE4A 2OEDA 3JSVA 2JWZA 1CZPA 1WM3A 4HCNB 3ZLZA 2JZ3B 2JZZA 2WXMA 4GDLB 2CU3A 2D3AA 3ZXRA 3PLUA 3TJPA 3VTUA 2FAZA 4KKIA 5T8IA 3GP7A 3DVGX 4BAXA 2KACA 4A3PA 1JQ4A 1VCBA 1N62A 4B0MA 4W9EA 3KVFB 3UI3A 3NVVA 1PUTA 2M0AA 1EU4A 2GMIC 3J9CA 2WXOA 4XDDA 4W9GA 2FCQA 1VRAB 4KX6B 1FPYA 4LCDE 2YEPF 2NPTB 1PGAA 2N9XA 4JL9A 2VZKD 4KZCA 4AWJA 1OQYA 4DHZB 2G4DB 3QA8A 3FC4A 1T0RC 4G3XB 3PO0A 1JRPA 2J53A 4NY0A 1YJ1A 3U30A 1VJKA 4H2AA 1J8CA 2QDFA 3V6CB 5CHVC 1Z2MA 1LM8B 2WLBA 3VDZA 2K3UA 1WGRA 1GB4A 3UIPB 2NR2A 1GOZA 4W9DA 1EWCA 5IKCM 2BKRB 1UBIA 1Q5WB 3V3XA 1XT9B 1P7EA 1KFYB 3DDCB 1UELA 2QJLA 2KHWB 3SU8X 3A4SC 2W54A 1MHXA 3O65B 4K7SA 4IOIE 1FNUA 3C19A 2GB1A 3DBLB 5E6JA 2L00B 5AZGA 4HKZE 2WXRA 2PIAA 1SF0A 4RM8A 3DBHB 2JYTA 2IYDB 3PZ8A 1WIAA 2IO1B 2WP9B 4DXAB 4XWTA 5IN7A 4ANUA 1XLQA 2IBIB 1J7BA 4ZYSA 4B9KA 2IO0B 3GE8C 1GC6A 2WX1A 1BT0A 1HTOA 2C7HA 2NTSA 1UZXB 4B6WA 2D07B 2JY6A 2PE6B 4R3DA 4YXDB 2C60A 3T8MA 2VZKB 2JUOA 5D7GA 1JROA 1R4MI 5DCNA 3RZFA 3U7DA 4TQ1A 1T3QA 3TEXA 4RNAA 2GBNA 3N1XC 3NG0A 4DK5A 3NY5A 1ENFA 2LVPA 1FXTB 1NI3A 3KWVA 2CHXA 1GNUA 3BYYB 2IJ0A 3LJ3A 3DHIC 4XYCA 1C9FA 1B9RA 1FEHA 2KDMA 2X38A 4RH6A 4GSWA 3DWMA 4C4VB 2WXFA 3FILB 1PGXA 4G50A 1MG8A 1K53A 1WXSA 3APDA 3AEEB 2XN9C 4LNIA 1HXYD 3NVWA 2AWTA 4ZRPA 2MRPA 4KSKC 1SB3C 1YD8U 2C9WB 4DHZE 1WF9A 2DLBA 4WIPA 2WDRB 1MVKA 2MCNB 1JCKB
chains in the Genus database with same CATH topology
3AE5B 3H8HA 1WRIA 3FILA 1F2RC 2WXHA 5MPOA 3AE8B 4RGTA 3BWUD 1D5ZC 4OZBA 1GB1A 1ZXIA 1SE2A 2KQ4X 3VR8B 1TKGA 3P63A 4A55A 5HI1A 1C4CA 1K51A 2LFIA 1EM7A 4JWUC 2KN4A 3MFGA 3W5UB 1E0ZA 1V1PA 1L4DB 1FXAA 1QOFA 4UDUC 1QOGA 1DOIA 1C79A 1D5MC 4RGOS 2IGGA 1WYGA 1QOBA 1AYFA 2N0SB 2FE8A 4HJGE 4KKJA 1Q10A 2FBWB 2L32A 3BYTB 3VQIA 1XO3A 4DQOC 3P4QB 1SEBD 2NTTA 2MEKA 2AX5A 3PZ7A 3O13A 1ZE3D 2ON8A 4IKGA 4O1NA 3T3NA 1FD6A 4ITKA 4A6QA 5TSSA 4NJCA 2LHEA 2OHFA 1DYQA 1JWBD 1XEEA 2LGIA 4US9A 1P7FA 2IGDA 2JU6X 2MJ3A 4EE2A 3W9CB 3TEWA 2KMMA 3RPFC 3URYA 2L83A 1WSPA 3ABVB 5C3JB 3GS2A 3W1SA 2BS2B 3E9SA 1VDVA 4J3OD 2V3NA 4L2YA 1XCQL 2ICIA 3P1MA 3Q8BA 1YNTE 1QLBB 2JWUA 4RGMA 1K50A 1RFKA 3P4RB 3AH7A 5H8YE 4MACA 2H88B 4HRSA 2KAJA 2ZW0A 3NVYA 1SJHD 3AE6B 3I57A 1N60A 4DXFA 4IDIA 4C80A 4P16A 2JX5A 2QIEB 4ARCA 3AE7B 2Y5CA 3ZQ4A 2WXKA 1SXTA 1VR9A 1YQ4B 1JWAD 3FAHA 3Q8AA 1PYWD 2GRIA 2H89B 4NAMA 1PDXA 1JWSD 1TKEA 2QEJC 1E10A 2BS3B 2HTME 3ZJUA 4LLGM 1I4QA 1OQRA 1TZOA 4NZLB 2LHDA 2V0GA 1QILA 3R2TA 3BVMA 1ZUD2 2BTEA 1C77A 4DXGA 1VLBA 1GAQB 2WQYB 4C7ZA 2N9KA 3U52E 4OVZA 4WWMA 2DWQA 2V3PA 4FXCA 1L0YB 2BB5A 4Q2JA 4C7YA 4ZRQA 3VR9B 1BXTA 1ZDVA 3HUIA 4RF0A 2YEPB 4A90A 2BBCA 3NS1A 1TJEA 1I7HA 4HKQA 4AQ7A 3Q8CA 3SEBA 5LNK1 1D5XC 4A9AA 1DOYA 3C8YA 4OHJA 3AECB 1FXIA 2INPE 3NRZA 1YJJA 1YN4A 2BT6A 2J42A 2W82A 3P42A 1XLOA 1RYJA 3AEDB 4XWWA 4ZHOA 1C76A 4KGTA 4XE0A 1T6BX 2K9XA 2MJDA 2WU5B 3KQ4A 1FRRA 2INNE 1KH0A 3IT6B 2DYOA 3ZGZA 1SIJA 1YN3A 1NENB 1TY2A 2AQ2B 3RFZB 4ZOHC 1QKZA 1TS5A 1YN5A 3TEYA 2WNMA 4B0EA 1ZOYB 2JZPA 4TQ0A 1QT9A 1SJED 3NZ3A 3IT4B 3W5VB 1ZPSA 4JWSC 4OW0A 1JALA 3BK2A 2QSDA 4TSSA 2J4XA 1TS3A 4AS1A 1VZ7A 1C4AA 1D6EC 3SR6A 3ZJVA 3L4PA 3E56A 1E9MA 3IAM1 1XXGA 3CWIA 2LJIA 1MI0A 3HRDD 4LK0M 1QOAA 1F77A 4RF1A 1I4PA 2WXQA 2WDVB 3SFEB 3BIID 1A70A 1XF5L 1YQ3B 4KGRA 1TY0A 1UUPA 2M56B 1GPXA 1J7CA 1FMAD 2PVOD 4NAWB 5JXVA 1XLNA 3T3OA 2RPVA 1ZXHA 1ESFA 1VZ6A 1SSNA 3I9V1 1R7SA 1TS4A 4XDCA 4WH4A 3IXSA 1ET6A 5D3IB 2LMCA 1SE3A 2JQRB 1FIQA 1J7AA 4HROA 1IBXB 3Q8FA 2M19A 1BUIC 5HHDG 4D2KA 3R2IA 4CQNA 4YSZB 2Y3AA 1N5WA 2K5PA 3ZJTA 1NEKB 1F0ZA 1I4XA 1TYGB 3ZYYX 3ETRA 5FK9C 4WAFA 1FNVA 1WXQA 3KLSX 2G1EA 3BZDB 1PGBA 1DOXA 1CJEA 1ET9A 4OZAA 4MT5A 1NYQA 4YTMB 3MC0B 1FFUA 3EA6A 5BYSA 3TSSA 1FRDA 1L0VB 2R61A 3AM9A 1ZDXA 2MJEA 3P4SB 4A8XC 1L5PA 3MHZA 1E6EB 1IBXA 2WXLA 4YSYB 1V97A 1HQRD 3B2FA 1BMLC 5GXGB 1AWDA 4WURA 3AE2B 4L23A 2PMVA 2W3SA 1JWUD 2I2YA 3EUB2 2LUMA 4RFBA 1L4ZB 4GDKB 1SE4A 5EE9A 2OEDA 5EE1A 1JW9D 2DYMA 3AV8A 4RGNA 2IGHA 1CZPA 3B2GA 2NMQA 1K52A 3AE4B 2N7JA 3SFDB 1KLGD 1YJIA 3EGRA 2K22A 3Q69A 1RM6C 2FUG1 1IUEA 2IDYA 2WXMA 4GDLB 4JX1C 2CU3A 4REZA 2WXIA 1KF6B 2HDEA 1UGJA 3GP7A 4KKIA 5T8IA 2Z8LA 3AE9B 2KACA 1JQ4A 4RCOA 4YT0B 5FKAC 3MP9A 2PLPA 1N62A 1N61A 4B0MA 1WWTA 4YTPB 3AB5A 1KRHA 3UI3A 1LO5D 2RDGA 3NVVA 2BYTA 1PUTA 4ARIA 2G9HD 2M0AA 1C4PA 1EU4A 1ACCA 3LXFA 3J9CA 2L52A 2WXOA 2I38A 2RMMA 4XDDA 1STEA 4YSXB 3VRBB 1CK1A 1VRAB 3AMZA 4KX6B 1HEZE 2YEPF 5BYRA 2D5GA 1PGAA 2VZKD 1IGCA 5FR3A 3AEGB 1HZ5A 5I4DA 1RWSA 5EE3A 3W2DA 2LEKA 5BMIA 1FM0D 3FC4A 2N9LA 2XNAC 3PO0A 1AW7A 1JRPA 1I4RA 1UNSA 1ZP0B 2J53A 4US8A 3OWEB 2EELA 5C2TB 5G5GA 1VJKA 4H2AA 1MPEA 3N9YC 2WS3B 2ONQA 2WXJA 1EU3A 4OZCA 2WLBA 2K3UA 1L6UA 5EE0A 1B1ZA 4C56C 5D3DA 1VZ8A 2BB6A 4HEA1 1GB4A 1XCTL 1GOZA 1OQQA 1EWCA 1TS2A 1I4GA 4WQMA 1V1OA 1KLUD 3V3XA 1MHHE 1P7EA 1KFYB 2CJNA 2W3RA 4MM3B 4TMAB 2W55A 2BW2A 3CIRB 4LTUA 2QJLA 1UWMA 1N63A 5HG2A 1UWXA 1I4HA 2W54A 4PT5A 5G5HA 1ROEA 1MHXA 2WXNA 4IOIE 1FNUA 3AN1A 2GB1A 2EKIA 3AEFB 1KTKA 1T5XD 2PKOA 3AE1B 5E6JA 1PFDA 1E7PB 3TUOA 5BYQA 2DBYA 1NVID 4HKZE 5HFYA 2WXRA 1FO4A 2PIAA 1SF0A 4N59A 1FNWA 2ZW1A 1SBBB 1V8CA 1IGDA 3TEZA 2JYTA 3DWGC 4JPSA 2PW9A 1QQRA 1JMLA 2SAKA 3PZ8A 2WXGA 1FCCC 2WP9B 1L0XB 2Q5WD 4XWTA 1Y56A 1CQVA 3Q8EA 1WGKA 1EWYC 1D4BA 1XLQA 3NVZA 3GB1A 2TSSA 2QMTA 1J7BA 1YMHE 5AUKA 3BK1A 4ZYSA 3P4PB 2GI9A 1F2RI 5AUIA 3LYYA 1L6VA 2NTSA 3BVGA 2QILA 2KWDA 2E3TA 2AQ1B 1QF6A 3HVZA 3AEAB 2IPKD 2ACZB 4R3DA 4YXDB 4N58A 2L1AA 2J52A 2VZKB 5D7GA 1HZ6A 1JROA 4TQ1A 1T3QA 2WU2B 3TEXA 4GLSC 4MH8A 3U7ZA 4RNAA 2JSVX 4KGSA 1XLPA 3HVDA 3V05A 2WXPA 1ENFA 4ZHPA 1NI3A 3KWVA 3VRAB 2JYEA 5BMHA 1FCLA 2CJOA 4YWGG 1OFFA 3BYYB 2IJ0A 3NUHB 3BVZA 1C9FA 4JE3B 1B9RA 1FEHA 1NYRA 2KDMA 2X38A 5H92C 4RH6A 2SEBD 3IAS1 1JWMD 5BMGA 2K0PA 3LB8C 3DWMA 2V4IB 3R8BA 1C78A 1HA5A 1FFVA 2WXFA 3MJ5A 3FILB 1PGXA 3U4EG 1TKYA 2MH7A 3U2SC 1K53A 3AEEB 2WDQB 2XN9C 1HXYD 3NVWA 2PVGC 3AE3B 2JXTA 3KWLA 4L1BA 3AEBB 2Y5PA 2BS4B 2RDHA 4P6VF 4ZRPA 1SB3C 3WCQA 1DGJA 2AQ3B 1M4VA 1V1PB 1N5XA 2B76B 4USAA 4YTNB 2DLBA 4WIPA 2E6XA 4N6EB 2WDRB 3B9JA 4M0WA 1MVKA 1JCKB 2PTLA 1AN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUI C;  1C79 A;  1C78 A;  1C76 A;  2SAK A;  1C77 A;  1SSN A; 
#chains in the Genus database with same CATH topology
 1WRI A;  2N1W A;  1F2R C;  4OZB A;  1ZXI A;  2D11 A;  2DEN B;  3P63 A;  2ZEQ A;  1WGG A;  5DPW A;  2K39 A;  4HLE A;  2RPQ A;  1V1P A;  1L4D B;  3QJZ A;  1QOF A;  1RRB A;  1C79 A;  2IGG A;  4KKJ A;  2FE8 A;  1S1Q B;  4PS7 A;  2K6D B;  2FBW B;  1XO3 A;  1WJ6 A;  1SEB D;  2NTT A;  4RM9 A;  2MEK A;  3PZ7 A;  1ZE3 D;  1FD6 A;  3RN9 C;  4NQK E;  4ITK A;  3AUL A;  5TSS A;  5DPT A;  2LHE A;  1WGY A;  1WRD B;  2OHF A;  1DYQ A;  2RGF A;  4US9 A;  3MC8 A;  2JU6 X;  4W9I A;  1YIW A;  1V86 A;  4JQW C;  4ZRJ A;  2L83 A;  2BF8 B;  5C3J B;  1VDV A;  2V3N A;  4M8N A;  4W9J A;  2ICI A;  4X57 B;  4RGM A;  1QLB B;  2JWU A;  1K50 A;  5H8Y E;  3ZO5 B;  4MAC A;  2KAJ A;  2LJ5 A;  3DVN V;  3NVY A;  4IDI A;  4NJ6 A;  4WJO A;  2WXK A;  4EOY A;  3GE3 C;  1JWA D;  3FAH A;  3S2A A;  2H89 B;  2QEJ C;  3PRE A;  4LNF A;  4AJW A;  2V0G A;  1TZO A;  2LHD A;  3ALB A;  3K9P B;  2BTE A;  3BY4 B;  2WQY B;  4C7Z A;  4IC7 B;  4OVZ A;  2DWQ A;  4FXC A;  4Q2J A;  3HIZ A;  2YEP B;  1KLV A;  1Y8R C;  2O2V A;  5LNK 1;  3Q3J A;  4MGY E;  3DBR I;  3AEC B;  1FXI A;  3NRZ A;  1OGW A;  3P42 A;  1RYJ A;  3DVG Y;  2CS4 A;  4ZHO A;  4PK1 A;  1T6B X;  3PS6 A;  2K9X A;  2MJD A;  2WU5 B;  2MP2 B;  2AYO B;  3KQ4 A;  1KH0 A;  4A20 A;  2DYO A;  1SIJ A;  1WFY A;  2X8X X;  1S3S G;  3UQB A;  1EF1 A;  3QHT A;  2KO3 A;  2JZP A;  3CF6 E;  4BBN F;  1SJE D;  4JWS C;  4OW0 A;  1JAL A;  3BK2 A;  4TSS A;  5E6P A;  2MW5 A;  3X0W A;  1MFW A;  3SR6 A;  3L4P A;  1XXG A;  4P7I A;  2LJI A;  1E7U A;  4RF1 A;  2WXQ A;  1WMH B;  4K7W A;  2KJH B;  3SFE B;  5IAA C;  1J7C A;  2Z59 B;  4JIO U;  2EMT A;  5JXV A;  2JRI B;  3I9V 1;  5E6O A;  1R7S A;  2YLM A;  4MGI E;  1ET6 A;  2R2Q A;  3Q8F A;  3OAW A;  4CQN A;  4YSZ B;  2R2O A;  3ZJT A;  3RI7 C;  1TYG B;  3ZW3 A;  3ZYY X;  3PRM B;  4B95 A;  3KLS X;  1DOX A;  4OZA A;  3MC0 B;  1FFU A;  1WJ4 A;  5J2R A;  2QCZ A;  5BYS A;  2KFJ A;  3TSS A;  2XK5 B;  1FRD A;  1L0V B;  3PSE B;  3AM9 A;  1V81 A;  1GC7 A;  3H7S A;  1NI2 A;  4HPP A;  1E6E B;  5D94 A;  2M8S A;  3B2F A;  1BML C;  5GXG B;  3NZU A;  3AE2 B;  4FLH A;  4L23 A;  2PMV A;  3EUB 2;  4RFB A;  2FNJ B;  4BKG A;  4OVU A;  5EE9 A;  4MDK E;  1LXD A;  3Q14 C;  3AV8 A;  2IGH A;  1RLF A;  3B2G A;  4GN1 A;  3DBS A;  3SFD B;  1KLG D;  1YJI A;  2KJR A;  4BZA A;  4GU2 A;  1IUE A;  1V5T A;  2MBE A;  1AAR A;  2VH2 A;  3WAM A;  4DDG D;  3ML8 A;  1KF6 B;  2HDE A;  4K1R B;  4YT0 B;  5FKA C;  4MJS B;  3H6N A;  1WWT A;  3H9D A;  4GDK A;  4YTP B;  1WZ3 A;  3N1Y C;  4WWO A;  2RDG A;  2FCS A;  4ARI A;  3PLV A;  2BKF A;  3N3K B;  2I38 A;  4YSX B;  1V80 A;  3A1Q A;  3EFC A;  4IW0 A;  1LQB A;  5BYR A;  2AL3 A;  4FA6 A;  1IGC A;  4KVG B;  1HZ5 A;  5IOI A;  2L0F A;  5EE3 A;  2KXJ A;  3OJ4 B;  5BMI A;  2AL6 A;  2N9L A;  2N7E A;  2XNA C;  1AW7 A;  2HD5 B;  1I4R A;  4WAA A;  1ZP0 B;  4BOS C;  3PVL A;  2EEL A;  2ONQ A;  3A9J A;  2LGY A;  1L6U A;  5EE0 A;  5D3D A;  5AZF A;  1VZ8 A;  2LUE A;  4LNN A;  4HEA 1;  2M17 A;  2NS5 A;  3UQA A;  1I4G A;  1MHH E;  1P9D U;  2BYF A;  4I6P A;  3B08 A;  2CJN A;  3SD5 A;  2INC C;  4MM3 B;  3I5J C;  1V2Y A;  2G3Q B;  3CIR B;  5HG2 A;  1UWM A;  3WAO A;  5CX3 A;  2V1Y A;  4PT5 A;  3L0W B;  1WE6 A;  3MTN B;  2EKI A;  5JHA A;  3AEF B;  2KX3 A;  2JPH A;  2PKO A;  3BIN A;  2BWE S;  3TUO A;  1E7V A;  2KK8 A;  5HFY A;  3JVZ X;  2SAK A;  2WXG A;  1FCC C;  1L0X B;  2C7N B;  2Q5W D;  1T0Q C;  3HM3 A;  3ZNH B;  2CKH B;  3GB1 A;  4GOC A;  2QMT A;  2UWQ A;  2LD9 A;  5AUK A;  4CYE A;  1J0G A;  2GI9 A;  2FCM A;  5FR6 A;  5AUI A;  2CHZ A;  2WHI A;  2QIL A;  2E3T A;  2AQ1 B;  3L10 B;  2HJ8 A;  1TT5 B;  1WM2 A;  1WJN A;  2IPK D;  2ASQ A;  4N58 A;  2L1A A;  4S17 A;  1HZ6 A;  4FJZ A;  3I63 C;  4GLS C;  1D3Z A;  4KGS A;  5J17 A;  2QHO A;  3V05 A;  2WXP A;  4ICU A;  4ZHP A;  1GJZ A;  3SDL C;  1FCL A;  3BVZ A;  2WGS A;  1Q1O A;  5H92 C;  2SEB D;  1H4R A;  3HM6 X;  2K0P A;  3LB8 C;  5BMG A;  1VD2 A;  2PEA A;  3AU5 A;  1C78 A;  1HA5 A;  1FFV A;  3MJ5 A;  5G55 A;  1WYW B;  3VUX A;  4WWN A;  2PVG C;  3AE3 B;  3EEC A;  2CU1 A;  2RDH A;  4P6V F;  3AI5 A;  2MBO A;  3WCQ A;  4IM2 A;  3SHQ A;  1N5X A;  4BOZ B;  4USA A;  3B9J A;  4M0W A;  3EC8 A;  1AN8 A;  4IM3 A;  3AE5 B;  4TKN A;  1F9J A;  1D5Z C;  1IP9 A;  3NS8 A;  5BO4 B;  2KVZ A;  1GB1 A;  1SE2 A;  2KQ4 X;  4NNJ B;  2LXC A;  5TR5 A;  1K8R B;  1WXM A;  2V4L A;  4PYU A;  4JWU C;  1IPG A;  2KN4 A;  3RYT A;  2C5L C;  3W5U B;  3RNC C;  3N30 A;  1QOG A;  4RGO S;  1IYF A;  3KUD B;  1C1Y B;  4BKT A;  3A9K B;  3TCA A;  2L32 A;  3BYT B;  3VQI A;  4KZ0 A;  4DQO C;  3ZUN A;  3IFW B;  3ZKJ C;  2FID A;  2AX5 A;  2DAJ A;  2JT4 B;  3EFU A;  3QK0 A;  1JWB D;  2IGD A;  3WAL A;  2MJ3 A;  4P1C C;  2XBB C;  4EE2 A;  3ZDM C;  2KNB A;  3DBL I;  2XEW A;  3R7R A;  3ABV B;  3E9S A;  1RFA A;  2BGF A;  2DZI A;  2O6V D;  3DPD A;  3DBH I;  4P1B C;  3HHM A;  4AP4 C;  4BKS D;  3I57 A;  1N60 A;  4DXF A;  3IHP C;  5DPR A;  2QIE B;  2KT7 A;  3PZD A;  2KTR B;  3RNE C;  3ZRC A;  1PYW D;  1V9J A;  1M94 A;  1E10 A;  3MJW A;  2HTM E;  3ZJU A;  4HPM B;  4ZRK A;  2HJ1 A;  3V60 A;  2CHW A;  1QIL A;  3ENE A;  3R2T A;  1WE7 A;  2KZR A;  1C77 A;  1YX6 B;  1GAQ B;  2DZM A;  1WX7 A;  3UIN B;  3VR9 B;  3HUI A;  2ZVO A;  4HDO A;  2ZNV B;  1I7H A;  3RCZ A;  3SEB A;  3QAR A;  4HK2 A;  3GOE A;  2D3G A;  4OHJ A;  1YJJ A;  2BT6 A;  1XLO A;  1C76 A;  4KGT A;  3DHH C;  4IWQ A;  3ONS A;  2J0J A;  1P1A A;  4HXD A;  1YN3 A;  3UGB B;  3RFZ B;  4ZOH C;  2WNM A;  4KIK A;  3QAQ A;  2BVC A;  3H7P B;  3M3J A;  3NJT A;  3NZ3 A;  1ZPS A;  1OEY J;  2KAN A;  2FUH B;  2J4X A;  2IO3 B;  2G45 B;  1D6E C;  3ZJV A;  2M1M A;  3E56 A;  3IAM 1;  4K7U A;  2K6Q A;  4J6I A;  4JLC A;  1MI0 A;  2O6V B;  2KC1 A;  1F77 A;  3BII D;  1WGD A;  2KFK B;  4ACF A;  4FBJ B;  4FHK A;  4AOF A;  3WAP A;  2LWP A;  2M56 B;  1P3Q U;  2V3S A;  1GPX A;  3A33 B;  1XLN A;  1KM7 A;  2DAF A;  1ZXH A;  3RT3 B;  3B0A A;  1ZKH A;  3PTF C;  3IXS A;  2GBK A;  2N7D A;  5D3I B;  2LMC A;  1J7A A;  2L05 A;  1F52 A;  2M19 A;  5HHD G;  5GMV A;  2Y3A A;  4K3B A;  3APF A;  1NEK B;  3DHG C;  1WXQ A;  2G1E A;  1L2N A;  1NBF C;  4MSQ B;  3JSV B;  1ET9 A;  4MT5 A;  4NAW A;  1KJT A;  4G11 A;  4A8X C;  3MHZ A;  1IBX A;  5CTR C;  3ZNZ B;  3Q3M C;  1UF0 A;  2DX5 B;  2W3S A;  1JWU D;  2NVU I;  4TV3 A;  2LUM A;  2I1J A;  4MH0 E;  2DYM A;  2EMS A;  4RGN A;  2NMQ A;  1K52 A;  3EGR A;  3Q69 A;  1RM6 C;  2FIF A;  4JX1 C;  4GXB A;  2K1F A;  2KD0 A;  4REZ A;  2N9E B;  1E8X A;  2M4N A;  2RD0 A;  3V6E B;  1V6E A;  3ZNG C;  4BVU C;  2KX0 A;  4CO7 A;  1SIF A;  2PLP A;  3IG3 A;  1N61 A;  1KRH A;  5LXI B;  2BYT A;  4E71 A;  2KQ7 A;  2G9H D;  2J0M A;  1ACC A;  2L52 A;  4KDI C;  1CK1 A;  4GDL A;  3AMZ A;  3X23 A;  2D5G A;  3KUC B;  2GBJ A;  5FR3 A;  3AEG B;  1ZW7 A;  1RWS A;  4E3C A;  3QC8 B;  3ZTD A;  1FM0 D;  5C23 A;  2QC8 A;  1MG4 A;  3QQ8 B;  4US8 A;  5C2T B;  2OJW A;  1F1H A;  5G5G A;  1MPE A;  3L54 A;  3N9Y C;  4AUQ C;  3RZW C;  4W9L A;  1WJU A;  2NPT A;  4GGQ A;  1T0Y A;  2N1V A;  1E8W A;  3L17 A;  1XCT L;  4GMV A;  1TS2 A;  4WQM A;  1YQB A;  1KLU D;  1SGH A;  2KWU B;  1HE8 A;  2W3R A;  4M02 A;  4TMA B;  2W55 A;  2LAS A;  4LTU A;  1N63 A;  3ZIM A;  1UWX A;  4FAD A;  4HVB A;  3VH4 B;  1I4H A;  2FCN A;  2WXN A;  4W9K A;  4DHJ D;  3AN1 A;  4BBN C;  1RAX A;  1KTK A;  3WIM A;  2A4Z A;  1E7P B;  3RD2 A;  4XZ4 A;  2CR5 A;  5BYQ A;  1NVI D;  1FO4 A;  1FNW A;  2ZW1 A;  1SBB B;  1V8C A;  1IGD A;  3TEZ A;  1GUA B;  4JPS A;  3OG5 A;  3ZNI D;  1UBQ A;  3PHW B;  1Y56 A;  3NOB A;  2K8C A;  1WGK A;  1EWY C;  1D4B A;  2TSS A;  2KN5 A;  5LLI A;  3ZXV A;  2KDI A;  1F2R I;  1L6V A;  1V49 A;  1X1M A;  5AEK B;  1EO6 A;  3KH0 A;  1QF6 A;  3HVZ A;  3MHS D;  3AEA B;  2J0K A;  4FJY A;  2LGS A;  2BPS A;  5JHB A;  1A5R A;  1Q0W B;  2KOX A;  4MH8 A;  1XLP A;  2RSU A;  3TIX A;  1ISN A;  5BMH A;  3LDZ E;  2CJO A;  1KOT A;  3JW0 X;  3NUH B;  4CHK A;  1I42 A;  2LXA A;  1WH3 A;  3U2S C;  5KHO A;  3QCA A;  2VRR B;  1OTR B;  5AZH A;  2JXT A;  3KWL A;  4IWO A;  4L1B A;  5D6J B;  3P2B A;  5IA7 A;  2Z0D B;  2YVC A;  1YX5 B;  4HWI B;  2AQ3 B;  3Q6B A;  1V1P B;  2B76 B;  3DVN U;  1V5O A;  2E6X A;  4N6E B;  2LRU A;  2WYQ A;  3L08 A;  2PTL A;  4C4V A;  1OEY A;  4DHJ B;  3FIL A;  5MPO A;  3AE8 B;  3VUW A;  2C7M B;  3R3M A;  1TTN A;  1JRU A;  3GZN B;  2RDB C;  1TKG A;  2JRH A;  4A55 A;  1WZ0 A;  5HI1 A;  2ZCC A;  2LFI A;  3MFG A;  3R66 C;  4PS3 A;  1D5M C;  4N9F 4;  4HJG E;  4LJO B;  1H8C A;  2BWF A;  2KQS A;  2ON8 A;  4O1N A;  3VAW A;  3WAN A;  4NJC A;  1XEE A;  2MX2 A;  3H1U A;  3CMM B;  3W9C B;  4MGZ E;  3TEW A;  2MBQ A;  2LZ6 A;  2KMM A;  2NBU A;  2EKE C;  4HCP B;  3W1S A;  2BYE A;  3ZRF A;  5IP4 D;  2VH1 A;  4FJV B;  4L2Y A;  1XCQ L;  2WWZ A;  1YNT E;  1RFK A;  3P4R B;  3AH7 A;  2IO2 B;  4NPN A;  3WA0 A;  3QX1 A;  4P16 A;  2JX5 A;  5JH5 C;  4ARC A;  3AE7 B;  2O2V B;  1YQ4 B;  2GRI A;  3RUI B;  4NAM A;  1PDX A;  1JWS D;  3MC9 A;  2DHZ A;  2BS3 B;  4E74 A;  4LLG M;  5EDS A;  1I4Q A;  4NZL B;  4I6N B;  3BVM A;  1VLB A;  2N9K A;  3EHV A;  2IZV B;  4WWM A;  5G2N A;  4GB9 A;  2BB5 A;  1XD3 B;  4C7Y A;  4ZRQ A;  1BXT A;  1ZDV A;  1XQQ A;  3W1S C;  4WJP A;  4QAY A;  2ZVN A;  1TJE A;  3N32 A;  1D5X C;  2MBH A;  4A9A A;  1DOY A;  3C8Y A;  2INP E;  2J42 A;  2W82 A;  1WXA A;  2MLB A;  4XWW A;  1QZE A;  3KYC D;  4EKU A;  4HPL B;  3IVF A;  1WR1 A;  1FRR A;  2LRW A;  3RNF C;  2KC2 A;  2BQQ A;  2LGD A;  1NEN B;  2AQ2 B;  2KDB A;  4KV2 A;  4K3C A;  3RNB C;  2D10 A;  1QKZ A;  1TS5 A;  2KDE B;  2MHJ A;  3JYU A;  1WI0 A;  4WJQ A;  2D2Q A;  1ZOY B;  2N4F A;  3IT4 B;  3KUZ A;  4M00 A;  2QSD A;  2LGX A;  1TS3 A;  2MP2 A;  5C1Z A;  1VZ7 A;  1C4A A;  3DQV A;  3RNG C;  3I3T B;  1E9M A;  3CWI A;  4LDT D;  3M63 B;  3AXC A;  4LK0 M;  3Q3O C;  5LXH A;  1PQS A;  1I4P A;  4II2 B;  1R4N B;  4EEW A;  1A70 A;  1XF5 L;  1YQ3 B;  4M01 A;  1R4N I;  3RNA C;  2GBR A;  1UUP A;  1TGZ B;  4MEM A;  4EFO A;  2BYV E;  1FMA D;  3T3O A;  1ESF A;  1VZ6 A;  1SSN A;  1TS4 A;  4XDC A;  2KVR A;  1C3T A;  4FUL A;  2LVQ A;  2N9P C;  4HRO A;  2UU7 A;  4D2K A;  2K5P A;  1F0Z A;  1WMH A;  5FK9 C;  1FNV A;  1UD7 A;  2PJH A;  3A4R A;  2KMC A;  1CJE A;  3M95 A;  4F1S A;  1NYQ A;  4YTM B;  3EA6 A;  3D32 A;  1N6Z A;  3Q3N C;  4HDQ A;  2KMA A;  2J7Q B;  4I6L B;  2MA9 B;  4IM0 A;  2KWC A;  2WXL A;  4YSY B;  3N1Z C;  1HQR D;  1AWD A;  2GBM A;  2I2Y A;  3VUY A;  4GDK B;  4F7Z A;  2DZK A;  5EE1 A;  1JW9 D;  4HJK A;  3ZVV A;  3AE4 B;  2N7J A;  2LVO A;  2K22 A;  4XX5 A;  1R4M B;  2FUG 1;  2XK5 A;  2IDY A;  3A1Q B;  5D2M B;  1L7Y A;  3PRZ A;  2L0T A;  1LGR A;  2WXI A;  1UGJ A;  2Z8L A;  3AE9 B;  3W1Y A;  5HKH A;  3ZDT A;  4RCO A;  3MP9 A;  4LDT B;  2NBW B;  3RUL A;  3AB5 A;  1LFD A;  1LO5 D;  3VFK A;  1C4P A;  5DPS A;  3LXF A;  2L3Z A;  5L83 A;  2RMM A;  4XGA B;  1STE A;  3VRB B;  2M0X A;  4IWP A;  2IND C;  3A9J B;  1HEZ E;  1WR6 E;  1WGH A;  2K8B A;  3PHX B;  4WWP A;  5I4D A;  4MEL A;  4PS8 A;  4MJS A;  3OJ3 A;  3W2D A;  2LEK A;  4LJP B;  1UNS A;  5CHF A;  1J19 A;  3TMP B;  2ZJD A;  3OWE B;  2W9N A;  1YOV B;  3CST A;  2PPH A;  2KTF A;  2WS3 B;  2WXJ A;  1EU3 A;  3IBE A;  4OZC A;  2KYW A;  1B1Z A;  2KLC A;  4C56 C;  4FHJ A;  2BB6 A;  2L7R A;  1OQQ A;  3PRP B;  3VVW B;  1EUV B;  5J18 A;  4WJN A;  1V1O A;  3N20 C;  2BW2 A;  2GOW A;  2JF5 A;  5G5H A;  2D3C A;  1ROE A;  3VTW A;  2NCN A;  2MBB B;  1T5X D;  3AE1 B;  2UYZ B;  1PFD A;  2Z0E B;  2DBY A;  1NDD A;  4N59 A;  3HK0 A;  3PPA A;  4LNK A;  3DWG C;  4IG7 B;  2PW9 A;  1QQR A;  1JML A;  4MM3 A;  1CQV A;  3Q8E A;  3QWZ B;  3NVZ A;  2HTH A;  1YMH E;  3BK1 A;  3PT2 B;  3P4P B;  3LYY A;  3BVG A;  2KWD A;  3PV1 A;  3FKY A;  4WQO B;  2ACZ B;  4IUM B;  2A5U A;  2J52 A;  3RMK C;  2LI5 A;  2K8H A;  2WU2 B;  2IY0 B;  3U7Z A;  1TBE A;  2JSV X;  1E8Z A;  5KHQ A;  1TZ1 A;  3HVD A;  3NHE B;  3M62 B;  2JXX A;  3VRA B;  2JYE A;  4YWG G;  3VXW A;  1OFF A;  2MQJ A;  2KKC A;  4JE3 B;  2L76 A;  2B3A A;  1NYR A;  4M0W B;  3IAS 1;  3DBR B;  3OLM D;  1JWM D;  2V4I B;  3PGE A;  3R8B A;  2I1K A;  3U4E G;  1TKY A;  2MH7 A;  1WY8 A;  4KDL B;  2WDQ B;  3T9L A;  3AEB B;  2Y5P A;  2BS4 B;  3C0R B;  3L16 A;  1E5W A;  4C00 A;  1DGJ A;  4ZYN A;  1T0S C;  3UF8 A;  3V62 A;  3ML9 A;  3NZS A;  1M4V A;  3AU4 A;  2ZCB A;  4YTN B;  4YL8 A;  1GG3 A;  3H8H A;  2WXH A;  4RGT A;  3BWU D;  4LNO A;  3DCG A;  5E6N A;  3B1L X;  2IY1 B;  3VR8 B;  3DOW A;  1C4C A;  1K51 A;  2HE7 A;  1EM7 A;  1UGM A;  3APC A;  1E0Z A;  4K81 A;  1FXA A;  4UDU C;  4URK A;  4M8M A;  1DOI A;  4ZDV A;  3KYD D;  1P98 A;  1WYG A;  1QOB A;  1AYF A;  2N0S B;  3QIJ A;  1Q10 A;  4ZRI A;  3UIO B;  3P4Q B;  1WXV A;  3O13 A;  4IKG A;  3T3N A;  3VHT C;  2G4S A;  4MGK E;  2D3B A;  4A6Q A;  2DYB A;  4ANW A;  2WDT B;  2LGI A;  1P7F A;  4ANV A;  4BFR A;  3RPF C;  3URY A;  1WSP A;  2L8J A;  3TL5 A;  3ZTC A;  3GS2 A;  2BS2 B;  4FN2 A;  2KJ6 A;  3VTV A;  4J3O D;  3P1M A;  3A9K A;  3Q8B A;  2WX0 A;  2ZZP B;  5JZE B;  2H88 B;  4HRS A;  4RMA A;  1MJD A;  2DZJ A;  2ZW0 A;  2MWS B;  1SJH D;  3AE6 B;  4KSL C;  4C80 A;  1CMX B;  2Y5C A;  3ZQ4 A;  1SXT A;  1VR9 A;  3TBL D;  3Q8A A;  4TUU A;  2DNF A;  4NJ7 A;  1TKE A;  3V61 A;  4ASW C;  3U8Z A;  5L95 C;  1I35 A;  4EZK A;  1OQR A;  3ECI A;  4DWF A;  1ZUD 2;  4DXG A;  4EUT A;  2OOB B;  3U52 E;  4JGH B;  1ZGU B;  2V3P A;  4GIV A;  1L0Y B;  4EZL A;  4RF0 A;  4A90 A;  4II3 B;  2BBC A;  3NS1 A;  4MSM B;  4HKQ A;  4AQ7 A;  3Q8C A;  4KIK B;  4PYZ A;  2KTR A;  4OVV A;  4S0R A;  1Z5S B;  3Q3F A;  1YN4 A;  1WX8 A;  3AED B;  4XE0 A;  2NBV B;  2KLG A;  2JVC A;  4EZJ A;  2ZPN A;  2INN E;  3IT6 B;  2REX A;  3ZGZ A;  2PE9 A;  1TY2 A;  4AJY B;  5CHW A;  1WX9 A;  3Q2A C;  3R7Q A;  1YN5 A;  3TEY A;  1SE9 A;  1E90 A;  4B0E A;  1EF5 A;  4TQ0 A;  1QT9 A;  3W5V B;  4A3O A;  2GLS A;  4AS1 A;  4ANX A;  1P0R A;  4W9H A;  3K9O B;  3KW5 B;  3CSF A;  3GZN I;  3HRD D;  1QOA A;  4DDI D;  2K25 A;  2WDV B;  3L13 A;  3VH3 B;  1G6J A;  4KGR A;  1TY0 A;  2ZPY A;  3H7P A;  4NQL B;  2AEH A;  2PVO D;  4NAW B;  2RPV A;  2Y5B B;  2ZNV C;  4WH4 A;  1HTQ A;  4F8C B;  1SE3 A;  2JQR B;  1FIQ A;  1IBX B;  4DBG A;  2MSE D;  1BUI C;  2O6V A;  3R2I A;  1N5W A;  1I4X A;  3ETR A;  1TIF A;  4WAF A;  3BZD B;  2KFK A;  4BKS A;  1PGB A;  2KWV B;  4XC2 A;  4G0N B;  2R61 A;  3P4S B;  1ZDX A;  1E8Y A;  2MJE A;  5IO9 A;  1UH6 A;  1L5P A;  2KDF B;  4W9F A;  1V97 A;  2V9H A;  4WUR A;  1U4A A;  4ICV A;  4W9C A;  2RR9 A;  2OJR A;  1L4Z B;  1SE4 A;  2OED A;  3JSV A;  2JWZ A;  1CZP A;  1WM3 A;  4HCN B;  3ZLZ A;  2JZ3 B;  2JZZ A;  2WXM A;  4GDL B;  2CU3 A;  2D3A A;  3ZXR A;  3PLU A;  3TJP A;  3VTU A;  2FAZ A;  4KKI A;  5T8I A;  3GP7 A;  3DVG X;  4BAX A;  2KAC A;  4A3P A;  1JQ4 A;  1VCB A;  1N62 A;  4B0M A;  4W9E A;  3KVF B;  3UI3 A;  3NVV A;  1PUT A;  2M0A A;  1EU4 A;  2GMI C;  3J9C A;  2WXO A;  4XDD A;  4W9G A;  2FCQ A;  1VRA B;  4KX6 B;  1FPY A;  4LCD E;  2YEP F;  2NPT B;  1PGA A;  2N9X A;  4JL9 A;  2VZK D;  4KZC A;  4AWJ A;  1OQY A;  4DHZ B;  2G4D B;  3QA8 A;  3FC4 A;  1T0R C;  4G3X B;  3PO0 A;  1JRP A;  2J53 A;  4NY0 A;  1YJ1 A;  3U30 A;  1VJK A;  4H2A A;  1J8C A;  2QDF A;  3V6C B;  5CHV C;  1Z2M A;  1LM8 B;  2WLB A;  3VDZ A;  2K3U A;  1WGR A;  1GB4 A;  3UIP B;  2NR2 A;  1GOZ A;  4W9D A;  1EWC A;  5IKC M;  2BKR B;  1UBI A;  1Q5W B;  3V3X A;  1XT9 B;  1P7E A;  1KFY B;  3DDC B;  1UEL A;  2QJL A;  2KHW B;  3SU8 X;  3A4S C;  2W54 A;  1MHX A;  3O65 B;  4K7S A;  4IOI E;  1FNU A;  3C19 A;  2GB1 A;  3DBL B;  5E6J A;  2L00 B;  5AZG A;  4HKZ E;  2WXR A;  2PIA A;  1SF0 A;  4RM8 A;  3DBH B;  2JYT A;  2IYD B;  3PZ8 A;  1WIA A;  2IO1 B;  2WP9 B;  4DXA B;  4XWT A;  5IN7 A;  4ANU A;  1XLQ A;  2IBI B;  1J7B A;  4ZYS A;  4B9K A;  2IO0 B;  3GE8 C;  1GC6 A;  2WX1 A;  1BT0 A;  1HTO A;  2C7H A;  2NTS A;  1UZX B;  4B6W A;  2D07 B;  2JY6 A;  2PE6 B;  4R3D A;  4YXD B;  2C60 A;  3T8M A;  2VZK B;  2JUO A;  5D7G A;  1JRO A;  1R4M I;  5DCN A;  3RZF A;  3U7D A;  4TQ1 A;  1T3Q A;  3TEX A;  4RNA A;  2GBN A;  3N1X C;  3NG0 A;  4DK5 A;  3NY5 A;  1ENF A;  2LVP A;  1FXT B;  1NI3 A;  3KWV A;  2CHX A;  1GNU A;  3BYY B;  2IJ0 A;  3LJ3 A;  3DHI C;  4XYC A;  1C9F A;  1B9R A;  1FEH A;  2KDM A;  2X38 A;  4RH6 A;  4GSW A;  3DWM A;  4C4V B;  2WXF A;  3FIL B;  1PGX A;  4G50 A;  1MG8 A;  1K53 A;  1WXS A;  3APD A;  3AEE B;  2XN9 C;  4LNI A;  1HXY D;  3NVW A;  2AWT A;  4ZRP A;  2MRP A;  4KSK C;  1SB3 C;  1YD8 U;  2C9W B;  4DHZ E;  1WF9 A;  2DLB A;  4WIP A;  2WDR B;  1MVK A;  2MCN B;  1JCK B; 
#chains in the Genus database with same CATH homology
 3AE5 B;  3H8H A;  1WRI A;  3FIL A;  1F2R C;  2WXH A;  5MPO A;  3AE8 B;  4RGT A;  3BWU D;  1D5Z C;  4OZB A;  1GB1 A;  1ZXI A;  1SE2 A;  2KQ4 X;  3VR8 B;  1TKG A;  3P63 A;  4A55 A;  5HI1 A;  1C4C A;  1K51 A;  2LFI A;  1EM7 A;  4JWU C;  2KN4 A;  3MFG A;  3W5U B;  1E0Z A;  1V1P A;  1L4D B;  1FXA A;  1QOF A;  4UDU C;  1QOG A;  1DOI A;  1C79 A;  1D5M C;  4RGO S;  2IGG A;  1WYG A;  1QOB A;  1AYF A;  2N0S B;  2FE8 A;  4HJG E;  4KKJ A;  1Q10 A;  2FBW B;  2L32 A;  3BYT B;  3VQI A;  1XO3 A;  4DQO C;  3P4Q B;  1SEB D;  2NTT A;  2MEK A;  2AX5 A;  3PZ7 A;  3O13 A;  1ZE3 D;  2ON8 A;  4IKG A;  4O1N A;  3T3N A;  1FD6 A;  4ITK A;  4A6Q A;  5TSS A;  4NJC A;  2LHE A;  2OHF A;  1DYQ A;  1JWB D;  1XEE A;  2LGI A;  4US9 A;  1P7F A;  2IGD A;  2JU6 X;  2MJ3 A;  4EE2 A;  3W9C B;  3TEW A;  2KMM A;  3RPF C;  3URY A;  2L83 A;  1WSP A;  3ABV B;  5C3J B;  3GS2 A;  3W1S A;  2BS2 B;  3E9S A;  1VDV A;  4J3O D;  2V3N A;  4L2Y A;  1XCQ L;  2ICI A;  3P1M A;  3Q8B A;  1YNT E;  1QLB B;  2JWU A;  4RGM A;  1K50 A;  1RFK A;  3P4R B;  3AH7 A;  5H8Y E;  4MAC A;  2H88 B;  4HRS A;  2KAJ A;  2ZW0 A;  3NVY A;  1SJH D;  3AE6 B;  3I57 A;  1N60 A;  4DXF A;  4IDI A;  4C80 A;  4P16 A;  2JX5 A;  2QIE B;  4ARC A;  3AE7 B;  2Y5C A;  3ZQ4 A;  2WXK A;  1SXT A;  1VR9 A;  1YQ4 B;  1JWA D;  3FAH A;  3Q8A A;  1PYW D;  2GRI A;  2H89 B;  4NAM A;  1PDX A;  1JWS D;  1TKE A;  2QEJ C;  1E10 A;  2BS3 B;  2HTM E;  3ZJU A;  4LLG M;  1I4Q A;  1OQR A;  1TZO A;  4NZL B;  2LHD A;  2V0G A;  1QIL A;  3R2T A;  3BVM A;  1ZUD 2;  2BTE A;  1C77 A;  4DXG A;  1VLB A;  1GAQ B;  2WQY B;  4C7Z A;  2N9K A;  3U52 E;  4OVZ A;  4WWM A;  2DWQ A;  2V3P A;  4FXC A;  1L0Y B;  2BB5 A;  4Q2J A;  4C7Y A;  4ZRQ A;  3VR9 B;  1BXT A;  1ZDV A;  3HUI A;  4RF0 A;  2YEP B;  4A90 A;  2BBC A;  3NS1 A;  1TJE A;  1I7H A;  4HKQ A;  4AQ7 A;  3Q8C A;  3SEB A;  5LNK 1;  1D5X C;  4A9A A;  1DOY A;  3C8Y A;  4OHJ A;  3AEC B;  1FXI A;  2INP E;  3NRZ A;  1YJJ A;  1YN4 A;  2BT6 A;  2J42 A;  2W82 A;  3P42 A;  1XLO A;  1RYJ A;  3AED B;  4XWW A;  4ZHO A;  1C76 A;  4KGT A;  4XE0 A;  1T6B X;  2K9X A;  2MJD A;  2WU5 B;  3KQ4 A;  1FRR A;  2INN E;  1KH0 A;  3IT6 B;  2DYO A;  3ZGZ A;  1SIJ A;  1YN3 A;  1NEN B;  1TY2 A;  2AQ2 B;  3RFZ B;  4ZOH C;  1QKZ A;  1TS5 A;  1YN5 A;  3TEY A;  2WNM A;  4B0E A;  1ZOY B;  2JZP A;  4TQ0 A;  1QT9 A;  1SJE D;  3NZ3 A;  3IT4 B;  3W5V B;  1ZPS A;  4JWS C;  4OW0 A;  1JAL A;  3BK2 A;  2QSD A;  4TSS A;  2J4X A;  1TS3 A;  4AS1 A;  1VZ7 A;  1C4A A;  1D6E C;  3SR6 A;  3ZJV A;  3L4P A;  3E56 A;  1E9M A;  3IAM 1;  1XXG A;  3CWI A;  2LJI A;  1MI0 A;  3HRD D;  4LK0 M;  1QOA A;  1F77 A;  4RF1 A;  1I4P A;  2WXQ A;  2WDV B;  3SFE B;  3BII D;  1A70 A;  1XF5 L;  1YQ3 B;  4KGR A;  1TY0 A;  1UUP A;  2M56 B;  1GPX A;  1J7C A;  1FMA D;  2PVO D;  4NAW B;  5JXV A;  1XLN A;  3T3O A;  2RPV A;  1ZXH A;  1ESF A;  1VZ6 A;  1SSN A;  3I9V 1;  1R7S A;  1TS4 A;  4XDC A;  4WH4 A;  3IXS A;  1ET6 A;  5D3I B;  2LMC A;  1SE3 A;  2JQR B;  1FIQ A;  1J7A A;  4HRO A;  1IBX B;  3Q8F A;  2M19 A;  1BUI C;  5HHD G;  4D2K A;  3R2I A;  4CQN A;  4YSZ B;  2Y3A A;  1N5W A;  2K5P A;  3ZJT A;  1NEK B;  1F0Z A;  1I4X A;  1TYG B;  3ZYY X;  3ETR A;  5FK9 C;  4WAF A;  1FNV A;  1WXQ A;  3KLS X;  2G1E A;  3BZD B;  1PGB A;  1DOX A;  1CJE A;  1ET9 A;  4OZA A;  4MT5 A;  1NYQ A;  4YTM B;  3MC0 B;  1FFU A;  3EA6 A;  5BYS A;  3TSS A;  1FRD A;  1L0V B;  2R61 A;  3AM9 A;  1ZDX A;  2MJE A;  3P4S B;  4A8X C;  1L5P A;  3MHZ A;  1E6E B;  1IBX A;  2WXL A;  4YSY B;  1V97 A;  1HQR D;  3B2F A;  1BML C;  5GXG B;  1AWD A;  4WUR A;  3AE2 B;  4L23 A;  2PMV A;  2W3S A;  1JWU D;  2I2Y A;  3EUB 2;  2LUM A;  4RFB A;  1L4Z B;  4GDK B;  1SE4 A;  5EE9 A;  2OED A;  5EE1 A;  1JW9 D;  2DYM A;  3AV8 A;  4RGN A;  2IGH A;  1CZP A;  3B2G A;  2NMQ A;  1K52 A;  3AE4 B;  2N7J A;  3SFD B;  1KLG D;  1YJI A;  3EGR A;  2K22 A;  3Q69 A;  1RM6 C;  2FUG 1;  1IUE A;  2IDY A;  2WXM A;  4GDL B;  4JX1 C;  2CU3 A;  4REZ A;  2WXI A;  1KF6 B;  2HDE A;  1UGJ A;  3GP7 A;  4KKI A;  5T8I A;  2Z8L A;  3AE9 B;  2KAC A;  1JQ4 A;  4RCO A;  4YT0 B;  5FKA C;  3MP9 A;  2PLP A;  1N62 A;  1N61 A;  4B0M A;  1WWT A;  4YTP B;  3AB5 A;  1KRH A;  3UI3 A;  1LO5 D;  2RDG A;  3NVV A;  2BYT A;  1PUT A;  4ARI A;  2G9H D;  2M0A A;  1C4P A;  1EU4 A;  1ACC A;  3LXF A;  3J9C A;  2L52 A;  2WXO A;  2I38 A;  2RMM A;  4XDD A;  1STE A;  4YSX B;  3VRB B;  1CK1 A;  1VRA B;  3AMZ A;  4KX6 B;  1HEZ E;  2YEP F;  5BYR A;  2D5G A;  1PGA A;  2VZK D;  1IGC A;  5FR3 A;  3AEG B;  1HZ5 A;  5I4D A;  1RWS A;  5EE3 A;  3W2D A;  2LEK A;  5BMI A;  1FM0 D;  3FC4 A;  2N9L A;  2XNA C;  3PO0 A;  1AW7 A;  1JRP A;  1I4R A;  1UNS A;  1ZP0 B;  2J53 A;  4US8 A;  3OWE B;  2EEL A;  5C2T B;  5G5G A;  1VJK A;  4H2A A;  1MPE A;  3N9Y C;  2WS3 B;  2ONQ A;  2WXJ A;  1EU3 A;  4OZC A;  2WLB A;  2K3U A;  1L6U A;  5EE0 A;  1B1Z A;  4C56 C;  5D3D A;  1VZ8 A;  2BB6 A;  4HEA 1;  1GB4 A;  1XCT L;  1GOZ A;  1OQQ A;  1EWC A;  1TS2 A;  1I4G A;  4WQM A;  1V1O A;  1KLU D;  3V3X A;  1MHH E;  1P7E A;  1KFY B;  2CJN A;  2W3R A;  4MM3 B;  4TMA B;  2W55 A;  2BW2 A;  3CIR B;  4LTU A;  2QJL A;  1UWM A;  1N63 A;  5HG2 A;  1UWX A;  1I4H A;  2W54 A;  4PT5 A;  5G5H A;  1ROE A;  1MHX A;  2WXN A;  4IOI E;  1FNU A;  3AN1 A;  2GB1 A;  2EKI A;  3AEF B;  1KTK A;  1T5X D;  2PKO A;  3AE1 B;  5E6J A;  1PFD A;  1E7P B;  3TUO A;  5BYQ A;  2DBY A;  1NVI D;  4HKZ E;  5HFY A;  2WXR A;  1FO4 A;  2PIA A;  1SF0 A;  4N59 A;  1FNW A;  2ZW1 A;  1SBB B;  1V8C A;  1IGD A;  3TEZ A;  2JYT A;  3DWG C;  4JPS A;  2PW9 A;  1QQR A;  1JML A;  2SAK A;  3PZ8 A;  2WXG A;  1FCC C;  2WP9 B;  1L0X B;  2Q5W D;  4XWT A;  1Y56 A;  1CQV A;  3Q8E A;  1WGK A;  1EWY C;  1D4B A;  1XLQ A;  3NVZ A;  3GB1 A;  2TSS A;  2QMT A;  1J7B A;  1YMH E;  5AUK A;  3BK1 A;  4ZYS A;  3P4P B;  2GI9 A;  1F2R I;  5AUI A;  3LYY A;  1L6V A;  2NTS A;  3BVG A;  2QIL A;  2KWD A;  2E3T A;  2AQ1 B;  1QF6 A;  3HVZ A;  3AEA B;  2IPK D;  2ACZ B;  4R3D A;  4YXD B;  4N58 A;  2L1A A;  2J52 A;  2VZK B;  5D7G A;  1HZ6 A;  1JRO A;  4TQ1 A;  1T3Q A;  2WU2 B;  3TEX A;  4GLS C;  4MH8 A;  3U7Z A;  4RNA A;  2JSV X;  4KGS A;  1XLP A;  3HVD A;  3V05 A;  2WXP A;  1ENF A;  4ZHP A;  1NI3 A;  3KWV A;  3VRA B;  2JYE A;  5BMH A;  1FCL A;  2CJO A;  4YWG G;  1OFF A;  3BYY B;  2IJ0 A;  3NUH B;  3BVZ A;  1C9F A;  4JE3 B;  1B9R A;  1FEH A;  1NYR A;  2KDM A;  2X38 A;  5H92 C;  4RH6 A;  2SEB D;  3IAS 1;  1JWM D;  5BMG A;  2K0P A;  3LB8 C;  3DWM A;  2V4I B;  3R8B A;  1C78 A;  1HA5 A;  1FFV A;  2WXF A;  3MJ5 A;  3FIL B;  1PGX A;  3U4E G;  1TKY A;  2MH7 A;  3U2S C;  1K53 A;  3AEE B;  2WDQ B;  2XN9 C;  1HXY D;  3NVW A;  2PVG C;  3AE3 B;  2JXT A;  3KWL A;  4L1B A;  3AEB B;  2Y5P A;  2BS4 B;  2RDH A;  4P6V F;  4ZRP A;  1SB3 C;  3WCQ A;  1DGJ A;  2AQ3 B;  1M4V A;  1V1P B;  1N5X A;  2B76 B;  4USA A;  4YTN B;  2DLB A;  4WIP A;  2E6X A;  4N6E B;  2WDR B;  3B9J A;  4M0W A;  1MVK A;  1JCK B;  2PTL A;  1AN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...