1C77A

Staphylokinase (sak) dimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
GKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a staphylokinase: variant a model for reduced antigenicity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOKINASE
total genus 22
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c77A00
1C77A 1SSNA 1C79A 1C78A 1BUIC 1C76A 2SAKA
chains in the Genus database with same CATH superfamily
1TYGB 3R3MA 2O6VD 2QC8A 3RNGC 3ZO5B 2JRIB 2KVZA 3PGEA 3R7QA 4NJ6A 2G4DB 3TSSA 2D10A 3KYCD 1SJHD 1SSNA 5BYQA 1V97A 1CQVA 1A70A 2BYFA 3H7SA 2OEDA 4DK5A 3PTFC 2L83A 3DVGX 1XEEA 1I4GA 1MFWA 2GBRA 1WXAA 3VH3B 1ZPSA 2AX5A 2KC1A 2KFKA 2H88B 2M0XA 4I6NB 4GDLA 3DWMA 1IGDA 3C19A 2YEPB 2WU5B 4MM3A 4XGAB 2PE6B 1I4QA 2JZ3B 3JVZX 3HRDD 1SE3A 1LGRA 2KWVB 4K7WA 4RMAA 3AULA 4W9DA 1LFDA 1SIFA 1SIJA 1EM7A 4JWUC 3UIOB 1A5RA 4NQKE 4OW0A 3MJWA 2YLMA 3IFWB 3KQ4A 2X38A 1UBIA 3VXWA 1N60A 2MJEA 1KFYB 2JVCA 2DENB 4PS3A 2BGFA 2INNE 3V61A 2WXNA 3BYTB 1ISNA 2ON8A 2KKCA 1JMLA 4MGIE 1FRDA 4JLCA 3NRZA 4II3B 2BYTA 3UQBA 2KK8A 2MBQA 2W55A 5CHWA 1QOAA 2PKOA 3ZW3A 4KZCA 1M4VA 5HI1A 2KN5A 1KH0A 2QHOA 3N1YC 2NS5A 4JIOU 5AZGA 3D32A 1FNUA 3BYYB 4C7ZA 4HDQA 4ARIA 2WHIA 1PGAA 3BIID 3I63C 4NJCA 1L0VB 3HK0A 4DHJB 2ZEQA 2BB5A 4ASWC 4KKJA 1QLBB 5E6OA 4S0RA 2NVUI 1WGYA 2KANA 4WAFA 3GE3C 5IOIA 2G45B 2KDBA 2MBBB 4HCPB 4YL8A 3A1QB 3QQ8B 4E71A 4NPNA 4W9HA 4A3PA 1JWBD 5AZFA 5BMIA 3MC0B 2RD0A 1UWMA 2PTLA 3FILB 3TEYA 4M8NA 1EF5A 1N5WA 1F2RC 3N3KB 5BMHA 5FR3A 3DBLB 4YTMB 3FILA 4K1RB 4IM2A 2K8BA 1UWXA 2RSUA 3B2GA 1GB4A 1HA5A 5D6JB 4WJPA 1FNVA 3TEZA 1XLOA 2Z0DB 2J0KA 3O13A 4E3CA 1F9JA 2W3RA 4YTPB 2V3PA 1GAQB 3JSVB 1T5XD 4ANXA 4LNNA 4WJOA 3GZNB 3WAOA 3L4PA 3NY5A 3RFZB 2CS4A 2ZVOA 2ZW1A 5CHFA 2LGIA 4DHZE 1C79A 3ZIMA 4XZ4A 1YNTE 1FCCC 1ESFA 3AE3B 3ZUNA 1IUEA 2M0AA 2K3UA 1C4CA 4LDTD 5C3JB 2SAKA 2CHZA 3AE5B 1TGZB 4WQMA 1SGHA 3A4SC 1E0ZA 1MG4A 4RFBA 1F77A 2CU1A 3AN1A 1YOVB 4TKNA 3C8YA 2LASA 4MH0E 4XDCA 2I2YA 4MEMA 2EKIA 2JQRB 5GXGB 1OQYA 3VR9B 5EDSA 5H92C 1Q1OA 2TSSA 2ZW0A 3OLMD 4IWPA 4OZBA 5BO4B 3C0RB 4YSZB 2IO3B 4LCDE 1JRPA 3X23A 1UELA 2GBJA 2K22A 2LGYA 1KJTA 2CU3A 2PE9A 4LLGM 3BY4B 2MW5A 1TY0A 1V5TA 2INCC 1IYFA 4GDLB 4HDOA 1J8CA 1Q5WB 1LQBA 1C9FA 2MA9B 2K39A 2KN4A 2MJ3A 2YVCA 2ASQA 5IAAC 3CWIA 2FCSA 2JY6A 3Q8BA 3MFGA 2WS3B 1L4DB 3QARA 4L2YA 4CYEA 4IM3A 2Z59B 1D6EC 3RNBC 2LJ5A 2LI5A 3V6EB 3MHZA 1T3QA 4ITKA 2O2VA 2KTFA 1J19A 4IWOA 2Z0EB 4XYCA 4BFRA 2KO3A 3NG0A 3NHEB 2CHXA 3DCGA 1S3SG 1PFDA 3L0WB 1OGWA 2WXHA 4FA6A 3A4RA 1JRUA 3N1XC 5D94A 1ZE3D 2DZIA 1V5OA 1R4MB 5LNK1 2LVOA 2DX5B 2KC2A 3RNAC 2IDYA 1Q10A 2OOBB 1EU3A 4ANWA 2WXMA 2HD5B 1JWMD 2D5GA 4M00A 1L0YB 3AV8A 4LNIA 4W9FA 3VR8B 2GMIC 4B9KA 4AS1A 3JW0X 3Q8CA 2KDMA 3ZNZB 1OFFA 4MJSA 1EUVB 1TS2A 2VH2A 1VD2A 1WYWB 1FIQA 3AH7A 3AE4B 3ZTCA 4RH6A 3E56A 3Q8EA 4KVGB 4W9IA 2D2QA 2VZKD 2DZKA 1NI2A 4AP4C 3P4RB 4N9F4 4K3BA 2JYEA 4ZRIA 1H8CA 4LNKA 3L10B 1QOBA 2WXQA 4PS7A 1KLUD 3A9JA 4AQ7A 1C1YB 1VR9A 4YWGG 2L00B 2QJLA 4USAA 3DBSA 1V1PA 3NUHB 1ENFA 4FJYA 2XK5B 2W9NA 2MBEA 1AWDA 2RMMA 4MACA 4GU2A 3RNFC 3U7ZA 3DBRB 1J7CA 1D3ZA 3UF8A 1UNSA 4GIVA 3DVNU 2AWTA 1P98A 1ET9A 3WIMA 2DYMA 2HJ8A 2NTSA 2WU2B 5D7GA 5AUIA 1F2RI 5BYSA 3MC8A 4ANUA 4LNOA 1E8WA 2J53A 1B1ZA 1SEBD 2JXTA 2JYTA 3APCA 3NVZA 4IWQA 2KDIA 2LXCA 3ABVB 1QOFA 4GSWA 2BT6A 4JX1C 3ML8A 2UU7A 3M95A 1V86A 4W9LA 3W5VB 3GOEA 4A8XC 3H7PA 2O6VB 2J0MA 1KF6B 2QSDA 4BKSA 1YJJA 2J7QB 3ETRA 1ZGUB 3B2FA 5CTRC 1TZ1A 1F1HA 1WJUA 4W9KA 4CQNA 1VZ7A 4BKGA 4KDLB 1NYQA 1I4RA 3L08A 2D3AA 2KDEB 2GB1A 3DWGC 4RCOA 1LM8B 4ICUA 2BWES 1E8YA 1RYJA 1AW7A 3K9PB 2AQ1B 4KGTA 2ONQA 1GG3A 3CMMB 3VUXA 5J2RA 1TS5A 1JW9D 1VZ8A 5CHVC 3P4SB 1PQSA 3RULA 3TBLD 2CHWA 3DBHI 4C4VB 1SE2A 1MVKA 3MP9A 3DBHB 3DOWA 4JGHB 1ZUD2 2UYZB 2L05A 2LMCA 3OJ4B 1P1AA 2FIFA 4ICVA 1R4NI 1ACCA 2LGXA 1C76A 4MELA 3JYUA 4HK2A 3MHSD 4WWPA 1BT0A 2WX1A 3HM3A 4N58A 3ALBA 2JZPA 5IP4D 2V3NA 3S2AA 1VJKA 2RDGA 3PT2B 3TCAA 1XCTL 4J6IA 3VVWB 1WRDB 1QILA 2MSED 1FPYA 2LUEA 3ZJUA 2XN9C 3RZWC 4YSXB 2GBNA 2KT7A 3DQVA 4OZAA 4M8MA 2A5UA 2M8SA 3AE8B 4RM9A 5J17A 3AI5A 2ZCCA 2ZJDA 4NJ7A 1ZKHA 4EZLA 5HFYA 4REZA 4W9EA 3VFKA 1J7BA 2VH1A 3SFEB 1V81A 3T3OA 1D5MC 3BK1A 4FN2A 3PV1A 3ZNGC 2V3SA 2KOXA 2BPSA 1C4AA 2M4NA 3AEBB 4EUTA 2M1MA 4NZLB 3ZTDA 3W1YA 3PS6A 4WWMA 2G3QB 3TUOA 2LVQA 2GRIA 4KIKB 2AL3A 2V1YA 4FBJB 4II2B 3W2DA 3SFDB 2KDFB 5AUKA 2BYEA 5T8IA 1HZ5A 3P4PB 1Y8RC 2NR2A 1NEKB 1XO3A 4D2KA 1QZEA 1RLFA 4BAXA 4KX6B 3IAS1 2JRHA 4XC2A 1IGCA 5JHAA 3NOBA 2WYQA 3GB1A 3BVGA 3IT6B 1XD3B 1TS3A 3N30A 3KH0A 4ZDVA 1V8CA 3MC9A 3Q3JA 1QOGA 1NYRA 2JUOA 2WXJA 2BF8B 3DPDA 4DQOC 3AE6B 1OQRA 4CHKA 1I4PA 3M3JA 4KDIC 3ZJVA 3W1SA 3N20C 4P16A 2RPVA 4A90A 3RYTA 2WXOA 1N63A 2CJNA 2G4SA 5KHQA 2AQ2B 4WJQA 1YQ4B 1E90A 1K51A 4L23A 1DGJA 1MJDA 3KVFB 4MGKE 4TUUA 1WE7A 1TKEA 1V2YA 3M63B 3KUZA 3W5UB 2NBUA 4DBGA 1WMHB 2PEAA 1HEZE 4HLEA 2CJOA 4EOYA 4C00A 2K25A 2L0FA 3SU8X 3WA0A 1E5WA 3Q3FA 4CO7A 3L17A 3OWEB 1SB3C 2XBBC 3DVNV 1JROA 2L32A 3BZDB 3QWZB 1E7UA 3ZRFA 3ZDMC 1HTQA 1TJEA 4FXCA 1YN4A 4ZRQA 3BVMA 1YX5B 1TY2A 2SEBD 3TIXA 5JH5C 2BW2A 1ZXIA 2W3SA 4NAWB 4EE2A 3RI7C 3T8MA 4KSLC 3Q3MC 3QA8A 5IN7A 3B0AA 1IPGA 3P1MA 5DPSA 2IPKD 1NVID 4DXAB 3NVWA 5E6NA 2EELA 1RM6C 1YJIA 2MHJA 3V60A 2KLCA 2FBWB 4C7YA 2NMQA 3ZJTA 1KLVA 1F0ZA 2DAJA 1JWUD 3R2TA 2X8XX 2D11A 3NS8A 1PYWD 1EWCA 3NVVA 1T0RC 2MJDA 2MEKA 1YIWA 3EFUA 3U2SC 1WM2A 2NTTA 2RDBC 4PYUA 4EEWA 3DVGY 4WURA 5L95C 2QIEB 1N61A 2W54A 3WCQA 2KMAA 4F1SA 5FKAC 3B1LX 2Q5WD 4C80A 1KM7A 2KYWA 2LGSA 2MWSB 3L16A 3SR6A 3QX1A 1WJNA 1Z5SB 4JWSC 1VLBA 2INDC 2DWQA 4GGQA 5C2TB 1I4HA 2XNAC 2DNFA 3U7DA 4NAMA 2FUG1 3A33B 3E9SA 1I7HA 1XT9B 1YN3A 3CSTA 4TV3A 1UUPA 3RCZA 3UQAA 4G11A 3J9CA 1TIFA 1AARA 2RDHA 2V4IB 2PPHA 4RGMA 2FCNA 1YQBA 1M94A 5BYRA 4F7ZA 4ZRJA 3V05A 3NZSA 4A55A 4OVVA 3RUIB 4E74A 2UWQA 1GOZA 2C60A 1VZ6A 3OG5A 4HWIB 2K8CA 1XCQL 3PRPB 2C5LC 3N9YC 4R3DA 2AYOB 2QCZA 4BKTA 3QJZA 4RF1A 3NJTA 2V9HA 3T3NA 2M56B 4GN1A 1F52A 3T9LA 2N7DA 1R7SA 2WQYB 3AU4A 4G3XB 1J0GA 4GMVA 1Q0WB 2QDFA 1BUIC 5EE0A 4A9AA 1CZPA 2KJ6A 4FADA 1Y56A 3P42A 4KZ0A 3DHGC 4MGZE 1I4XA 1YJ1A 4IG7B 2LXAA 3L13A 2KACA 4FHJA 1WWTA 1FNWA 2HTME 2PIAA 3Q69A 4DWFA 2KQ4X 3PLVA 2ACZB 4A6QA 2IY0B 3MJ5A 3DHIC 2WGSA 3AM9A 2KHWB 2L1AA 1WH3A 2L3ZA 5AZHA 4XWTA 2N9EB 2BKRB 1GPXA 2IO1B 2GLSA 4YT0B 2BS3B 3HM6X 3Q6BA 2N9LA 2B3AA 1L2NA 3I57A 4UDUC 3AEGB 5TR5A 4LJOB 4XDDA 2WNMA 4WWNA 2I1JA 1WXQA 1FO4A 1UF0A 3QHTA 3OAWA 3VTVA 1EF1A 4FLHA 4EZKA 1CK1A 4LNFA 1N5XA 4MH8A 3LXFA 3U4EG 1WGKA 4JE3B 4B0MA 2WX0A 2LHEA 5CX3A 4HKZE 4AWJA 5EE9A 3P4QB 4ZYNA 3DHHC 1L4ZB 2N0SB 3GE8C 2BKFA 3H9DA 2IBIB 1GJZA 3LB8C 1T0QC 4I6LB 4W9GA 4BKSD 4BVUC 2PJHA 1D5XC 4OHJA 3Q8FA 4HJKA 4US8A 1C78A 2MLBA 4HPLB 1IBXA 3ML9A 2FNJB 3VTWA 3ZXVA 5IA7A 2XEWA 1UGJA 2R2QA 2WLBA 1UGMA 4GXBA 1SF0A 4A3OA 2H89B 2LZ6A 4MT5A 1WJ6A 3PHWB 1S1QB 2PLPA 2KJRA 2OJRA 3VRAB 1WFYA 4Q2JA 3ZGZA 4A20A 1VCBA 1WGGA 4GB9A 2JWZA 1WGHA 4HVBA 2ZNVB 3DBLI 3GP7A 4B6WA 3SEBA 4KIKA 4JQWC 4KV2A 2WDRB 3R2IA 4N59A 1LXDA 2ZZPB 1WX9A 2L52A 3ONSA 2DYOA 1FRRA 1FM0D 3IVFA 4XWWA 3QK0A 2OJWA 1FFUA 3ZDTA 3PRZA 2Y5CA 5JXVA 2W82A 3GZNI 4ZRKA 1I35A 2PMVA 2MRPA 2WXPA 3IT4B 2KWUB 2MP2A 4WWOA 2AL6A 2Y5BB 2AEHA 3ZXRA 1IP9A 2E6XA 1XLQA 3AE1B 4W9CA 2QILA 1E7VA 3PLUA 1SXTA 4DDID 4ZYSA 4PK1A 2JF5A 2L76A 4URKA 2WWZA 3ZYYX 3Q3NC 5D2MB 3RN9C 4O1NA 2WXIA 2V0GA 4AUQC 1SE4A 5EE3A 1NDDA 4MM3B 3EGRA 4RNAA 4HPMB 4BBNF 4ZHOA 2RGFA 1WGRA 2NPTA 5D3DA 4FJZA 1V80A 3AB5A 3HVZA 2M19A 2IGGA 4PYZA 1KOTA 2VRRB 4WH4A 5IO9A 4AJWA 3AE7B 1FXTB 4YXDB 1U4AA 3SD5A 3V3XA 3APDA 1L7YA 1TZOA 1L6VA 4K7SA 4ZRPA 3DBRI 3VDZA 1EU4A 1MHXA 1GNUA 2N7JA 2WDTB 1ZOYB 1GC7A 1K52A 5FK9C 3EUB2 5L83A 4NNJB 1DOYA 3HIZA 2C7MB 2IGHA 3ZVVA 4RM8A 1K50A 4F8CB 1P0RA 1QKZA 2KFJA 2NBVB 3I5JC 2J4XA 1I42A 2I38A 2Y3AA 1R4MI 1K53A 3Q2AC 3P2BA 1C77A 3VUWA 1YD8U 1D5ZC 3QIJA 2C7NB 2BQQA 2WXLA 1TBEA 5E6PA 2EMSA 2FCQA 1OTRB 2MX2A 3GS2A 2D07B 3FC4A 3ZNID 3CSFA 3RZFA 3PZ8A 2LD9A 3AU5A 1V1PB 1XQQA 1X1MA 4BZAA 3I3TB 4GLSC 3PO0A 3LYYA 1K8RB 3A9JB 4ZHPA 3ZLZA 2ICIA 1BMLC 3VH4B 1V1OA 3RNCC 1STEA 1HZ6A 3V6CB 1ZDVA 1QQRA 2ZCBA 3DDCB 4RF0A 2D3CA 2KQSA 2LJIA 4P1BC 1NENB 1SJED 1EWYC 1FFVA 4FULA 5LXHA 3NZ3A 1MG8A 2M17A 3QC8B 1WY8A 1ZDXA 3W1SC 4MJSB 1FEHA 2WXRA 2JSVX 2RR9A 1ZP0B 1ET6A 3CF6E 5C1ZA 1TT5B 3IHPC 1JCKB 2FAZA 2DLBA 4BBNC 1FXIA 3B08A 3SHQA 3TEXA 1WXVA 4M0WA 2N7EA 4LTUA 4BOZB 4EZJA 1P7EA 2KTRB 1BXTA 1LO5D 4IM0A 1FCLA 3IXSA 2REXA 5C23A 2D3BA 2BTEA 3LDZE 2L7RA 1J7AA 4ANVA 4KGSA 1KLGD 4IW0A 4YTNB 5E6JA 1RWSA 3MTNB 2LWPA 1WZ3A 4HEA1 3M62B 4TSSA 1E9MA 2K6QA 3Q14C 4JPSA 1XF5L 3IG3A 3KWLA 4TQ0A 3QCAA 2IY1B 1DOIA 3UGBB 4W9JA 1N6ZA 4QAYA 4GDKA 4NAWA 3VRBB 4FHKA 1T6BX 3RMKC 1Z2MA 2BS4B 4IOIE 1WX8A 3WANA 1WM3A 4KKIA 3UIPB 2IO0B 1MI0A 4OVUA 1FXAA 1FD6A 2EMTA 4ACFA 2LHDA 2WXKA 2J52A 4RGNA 2Z8LA 1TKGA 1UD7A 2CR5A 2YEPF 4C56C 4WAAA 2KX0A 3TMPB 2KAJA 3R7RA 2HTHA 3Q8AA 2N4FA 2G9HD 4JL9A 1RFKA 2ZVNA 1V9JA 5LXIB 4XE0A 3BWUD 4NY0A 4DHJD 3TEWA 2JU6X 2KQ7A 1JALA 2R2OA 2LRWA 4I6PA 3KUCB 4C4VA 5JHBA 4OVZA 4G50A 1R4NB 2B76B 1TS4A 1V6EA 4K3CA 3RNEC 4DXFA 2DHZA 3BINA 1ZW7A 2L0TA 4KSKC 4M0WB 1E10A 1L6UA 2DYBA 1ROEA 2XK5A 1NI3A 3APFA 3VHTC 2GOWA 1P3QU 2WDVB 3NVYA 3V62A 4MSQB 5G5GA 2E3TA 2DBYA 1HE8A 4IC7B 2IO2B 2MP2B 2G1EA 4MGYE 2K0PA 3VAWA 4N6EB 3PSEB 5LLIA 1AYFA 4MDKE 5IKCM 1VRAB 2PVOD 3WAPA 1WF9A 1CMXB 1V49A 4RGOS 1C3TA 1EO6A 1T0SC 3VUYA 1XLPA 1XLNA 3EFCA 5G2NA 3OJ3A 4HROA 2IZVB 2WXGA 5J18A 1UH6A 1TTNA 1MPEA 5HKHA 1VDVA 2ZNVC 1YX6B 1E6EB 1XXGA 2K1FA 1WGDA 4M01A 5G55A 3X0WA 1SE9A 1L0XB 3NZUA 1HQRD 2ZPNA 1OEYA 2LUMA 1PGBA 3K9OB 1PUTA 3IAM1 1UZXB 3A9KA 3EA6A 1HXYD 1TKYA 1GC6A 2L8JA 3ECIA 3AMZA 1H4RA 3HUIA 2LVPA 2OHFA 4H2AA 2KWDA 4ARCA 1YQ3B 3BK2A 2JXXA 1E8ZA 3ZNHB 1RRBA 2KMMA 1RFAA 3WAMA 2WXFA 2KNBA 1D4BA 3PVLA 1JWSD 2K5PA 2KZRA 3I9V1 2K6DB 1WIAA 2N9PC 1GB1A 4L1BA 3FAHA 1SBBB 4FJVB 2A4ZA 2NCNA 5KHOA 3BVZA 4G0NB 2BWFA 1E7PB 2AQ3B 5TSSA 4K7UA 1WYGA 3PRMB 1WJ4A 4TMAB 4GOCA 1CJEA 3RPFC 4HKQA 2MH7A 2O2VB 3H6NA 2GBKA 2CKHB 2I1KA 2MBOA 2N1WA 5FR6A 1MHHE 3ENEA 3AEFB 3N32A 3U52E 4HJGE 2LEKA 5MPOA 1GUAB 3UINB 2JPHA 5GMVA 4M02A 2NBWB 5JZEB 2BBCA 2KWCA 2QEJC 3KYDD 2LGDA 4HRSA 2IYDB 2HDEA 2LFIA 1B9RA 4US9A 1FMAD 4IDIA 1OQQA 1YN5A 5I4DA 3AEAB 3QAQA 2C7HA 2JZZA 4J3OD 2WDQB 1WMHA 1JQ4A 4KGRA 4PS8A 1KRHA 4P6VF 4NQLB 3EC8A 1WR1A 1OEYJ 1KTKA 3R8BA 1WXSA 3RT3B 2KD0A 3KLSX 3HHMA 3P63A 4WIPA 4EKUA 1DOXA 1RAXA 1WRIA 4RGTA 2WP9B 4HCNB 3H7PB 2FIDA 3KUDB 4TQ1A 2KFKB 3H8HA 4LJPB 3VTUA 3N1ZC 2KMCA 4AOFA 3IBEA 1YMHE 2VZKB 4P1CC 2V4LA 2JX5A 2BYVE 2JT4B 5D3IB 3JSVA 2JWUA 3ZKJC 2DAFA 2PVGC 2O6VA 4YSYB 2NPTB 2LRUA 2MBHA 1WX7A 4GDKB 5HG2A 2KVRA 3WALA 2FCMA 4WJNA 3VQIA 3EECA 3PZDA 3U8ZA 1AN8A 1WE6A 5EE1A 2FUHB 1NBFC 4LK0M 5DCNA 3ZRCA 4DDGD 2K8HA 2GBMA 3PHXB 4DXGA 3U30A 3HVDA 2RPQA 4WQOB 2N1VA 2DZJA 2MCNB 3TL5A 5HHDG 2FE8A 4HPPA 3H1UA 4MSMB 2N9XA 5DPWA 1WR6E 2KTRA 3NS1A 2ZPYA 2MQJA 2BVCA 2QMTA 3AEEB 4IKGA 4XX5A 3AECB 4ZOHC 3KW5B 4DHZB 2PW9A 3Q3OC 2EKEC 1N62A 3URYA 3FKYA 1HTOA 1IBXB 2HE7A 2J42A 3TJPA 4PT5A 4P7IA 1C4PA 2KXJA 4BOSC 1E8XA 1WI0A 2J0JA 3LJ3A 5G5HA 4X57B 2C9WB 2DZMA 1QF6A 1G6JA 3AEDB 4AJYB 3ZQ4A 4S17A 1T0YA 1P9DU 1WSPA 5H8YE 3EHVA 2HJ1A 3SDLC 1UBQA 2KJHB 2R61A 3PPAA 1QT9A 3A9KB 4HXDA 4K81A 3PZ7A 4EFOA 2KLGA 3UI3A 5DPTA 2INPE 3KWVA 3O65B 2K9XA 1WZ0A 2D3GA 3A1QA 1JWAD 4LDTB 3AE9B 1PDXA 3B9JA 3R66C 3CIRB 1L5PA 3L54A 4OZCA 3RD2A 1DYQA 1P7FA 2IGDA 3PREA 1PGXA 5BMGA 2GI9A 2BB6A 2Y5PA 5DPRA 1WXMA 2BS2B 2KX3A 3AXCA 3W9CB 3AE2B 2N9KA 4IUMB 4B95A 4B0EA 5AEKB 1ZXHA 2IJ0A
chains in the Genus database with same CATH topology
3VRBB 1TYGB 5EE0A 4A9AA 1CZPA 3TSSA 1T6BX 3W5VB 1Y56A 3P42A 4A8XC 2BS4B 4IOIE 2QSDA 1KF6B 1SJHD 4KKIA 1YJJA 3ETRA 1SSNA 3B2FA 5BYQA 1I4XA 1MI0A 1V97A 1CQVA 1FXAA 1A70A 1FD6A 2KACA 4CQNA 1VZ7A 2LHDA 2WXKA 2J52A 1WWTA 1FNWA 1NYQA 2HTME 1I4RA 2Z8LA 4RGNA 2OEDA 1TKGA 2PIAA 2YEPF 2GB1A 2L83A 4C56C 3Q69A 1XEEA 1I4GA 2KQ4X 2ACZB 4A6QA 3DWGC 1ZPSA 4RCOA 2AX5A 3MJ5A 1RYJA 2KAJA 1AW7A 2H88B 3Q8AA 2AQ1B 3DWMA 3AM9A 1IGDA 4KGTA 2ONQA 2YEPB 1TS5A 2G9HD 2WU5B 1JW9D 1VZ8A 1RFKA 1I4QA 3P4SB 3HRDD 1SE3A 2L1AA 4XWTA 4XE0A 3BWUD 1GPXA 1SE2A 4YT0B 1SIJA 1MVKA 3MP9A 3TEWA 1EM7A 2JU6X 1JALA 4JWUC 2BS3B 2N9LA 4OW0A 1ZUD2 3I57A 4UDUC 4OVZA 2LMCA 3AEGB 2B76B 1TS4A 4XDDA 2WNMA 3KQ4A 1ACCA 1WXQA 1FO4A 2X38A 4DXFA 1C76A 1N60A 2MJEA 1KFYB 2INNE 2WXNA 1CK1A 4MH8A 1N5XA 3BYTB 2ON8A 3LXFA 3U4EG 1JMLA 4N58A 1E10A 1L6UA 1WGKA 2JZPA 1FRDA 2V3NA 3NRZA 1ROEA 4JE3B 1VJKA 2RDGA 1NI3A 4B0MA 2BYTA 2LHEA 4HKZE 2W55A 2WDVB 1XCTL 5EE9A 1QOAA 3NVYA 3P4QB 2PKOA 1QILA 1M4VA 5HI1A 1L4ZB 5G5GA 1KH0A 2E3TA 2DBYA 2N0SB 3ZJUA 2XN9C 2G1EA 4YSXB 3LB8C 2K0PA 4OZAA 3AE8B 4N6EB 5HFYA 1AYFA 1VRAB 1FNUA 2PVOD 1D5XC 4REZA 3BYYB 4C7ZA 4ARIA 1J7BA 4OHJA 3Q8FA 4US8A 1PGAA 1C78A 4RGOS 3SFEB 3BIID 1IBXA 4NJCA 3T3OA 1XLPA 1D5MC 3BK1A 1XLNA 1L0VB 4HROA 2WXGA 2BB5A 4KKJA 1QLBB 1MPEA 1VDVA 1C4AA 1UGJA 3AEBB 4WAFA 4NZLB 1E6EB 1XXGA 2WLBA 4WWMA 3TUOA 1L0XB 1SF0A 2GRIA 2H89B 1HQRD 4MT5A 1JWBD 5BMIA 3MC0B 2LUMA 2PLPA 1UWMA 2PTLA 3FILB 1PGBA 3VRAB 3W2DA 3TEYA 1PUTA 3IAM1 4Q2JA 3ZGZA 1N5WA 3EA6A 3SFDB 1HXYD 1F2RC 5AUKA 5BMHA 1TKYA 5FR3A 4YTMB 3FILA 5T8IA 1HZ5A 3AMZA 3P4PB 3HUIA 3GP7A 2OHFA 4H2AA 1NEKB 1XO3A 2KWDA 4D2KA 4ARCA 1YQ3B 3SEBA 1UWXA 3B2GA 1GB4A 1HA5A 3BK2A 2WDRB 4KX6B 3IAS1 3R2IA 4N59A 2L52A 2KMMA 1FNVA 2DYOA 2WXFA 1FRRA 1FM0D 1XLOA 3TEZA 4XWWA 1D4BA 1JWSD 1IGCA 2K5PA 1FFUA 3O13A 3I9V1 3GB1A 1GB1A 4L1BA 3BVGA 2Y5CA 1SBBB 2W3RA 3FAHA 3IT6B 4YTPB 1TS3A 5JXVA 2V3PA 1GAQB 2W82A 1T5XD 1V8CA 3BVZA 3L4PA 1QOGA 1NYRA 2WXJA 3RFZB 1E7PB 2AQ3B 2ZW1A 5TSSA 2LGIA 1C79A 1WYGA 1YNTE 2PMVA 4TMAB 4DQOC 1CJEA 3AE6B 3RPFC 4HKQA 1OQRA 2MH7A 1FCCC 1ESFA 3AE3B 2M0AA 1IUEA 2WXPA 2K3UA 1I4PA 1C4CA 3IT4B 3ZJVA 5C3JB 2SAKA 3W1SA 1MHHE 3AE5B 4P16A 4WQMA 2RPVA 4A90A 2WXOA 3AEFB 1E0ZA 3U52E 4HJGE 2LEKA 2E6XA 1N63A 2CJNA 1XLQA 3AE1B 5MPOA 2AQ2B 2QILA 4RFBA 1F77A 1YQ4B 3AN1A 1K51A 3C8YA 4L23A 2BBCA 4XDCA 1DGJA 2I2YA 2QEJC 1SXTA 4ZYSA 2EKIA 2JQRB 5GXGB 3VR9B 5H92C 4HRSA 3ZYYX 2TSSA 2ZW0A 2HDEA 2LFIA 4OZBA 1B9RA 4US9A 1FMAD 4O1NA 4IDIA 1TKEA 2WXIA 2V0GA 1OQQA 3W5UB 4YSZB 1YN5A 5I4DA 1JRPA 1SE4A 3AEAB 2K22A 5EE3A 2CU3A 4LLGM 3EGRA 1HEZE 1TY0A 2CJOA 4J3OD 4MM3B 4RNAA 4ZHOA 2WDQB 4GDLB 1JQ4A 5D3DA 4KGRA 3AB5A 3HVZA 2M19A 2IGGA 1KRHA 1C9FA 4P6VF 3OWEB 4WH4A 2KN4A 1SB3C 2MJ3A 3AE7B 1JROA 2L32A 3BZDB 4YXDB 3V3XA 1KTKA 3CWIA 3R8BA 1TJEA 3KLSX 3Q8BA 4FXCA 1YN4A 3P63A 1TZOA 3MFGA 4WIPA 1L6VA 4ZRQA 4ZRPA 3BVMA 2WS3B 1L4DB 4L2YA 1DOXA 1TY2A 2SEBD 1WRIA 4RGTA 1D6EC 2WP9B 1EU4A 1MHXA 2N7JA 2BW2A 1ZOYB 4TQ1A 3MHZA 1ZXIA 1T3QA 3H8HA 4ITKA 2W3SA 1K52A 4NAWB 4EE2A 5FK9C 3EUB2 1YMHE 2VZKB 2JX5A 5D3IB 1DOYA 2IGHA 2JWUA 1K50A 3P1MA 1PFDA 1QKZA 2IPKD 2WXHA 1NVID 2J4XA 2PVGC 2I38A 3NVWA 2EELA 2Y3AA 4YSYB 1K53A 1ZE3D 1RM6C 5LNK1 4GDKB 1C77A 1YJIA 1D5ZC 5HG2A 2FBWB 2WXLA 4C7YA 2IDYA 2NMQA 1Q10A 1EU3A 3VQIA 3ZJTA 1AN8A 3GS2A 5EE1A 1F0ZA 1JWUD 2WXMA 4LK0M 3R2TA 1JWMD 2D5GA 3FC4A 1PYWD 3PZ8A 1L0YB 3AV8A 1EWCA 1V1PB 3NVVA 4DXGA 3VR8B 3HVDA 4AS1A 2MJDA 2MEKA 3Q8CA 5HHDG 2KDMA 4GLSC 2FE8A 3PO0A 3LYYA 3U2SC 2NTTA 1OFFA 4ZHPA 4WURA 2QIEB 2ICIA 3NS1A 1BMLC 1N61A 2W54A 1TS2A 3WCQA 1V1OA 2QMTA 3AEEB 4IKGA 1STEA 1HZ6A 5FKAC 2Q5WD 1FIQA 3AECB 1ZDVA 1QQRA 3AH7A 3AE4B 4ZOHC 4C80A 4RF0A 4RH6A 2PW9A 3SR6A 1N62A 3E56A 2LJIA 3URYA 3Q8EA 1NENB 1IBXB 1SJED 2VZKD 4JWSC 1EWYC 1FFVA 1VLBA 2J42A 2DWQA 3P4RB 5C2TB 3NZ3A 4PT5A 1I4HA 1C4PA 2JYEA 2XNAC 4NAMA 2FUG1 1ZDXA 3E9SA 1I7HA 5G5HA 1YN3A 1UUPA 1QOBA 2WXQA 4AQ7A 1KLUD 3AEDB 3J9CA 1QF6A 1FEHA 1VR9A 3ZQ4A 2WXRA 2JSVX 4YWGG 2RDHA 2V4IB 4RGMA 1ZP0B 1ET6A 1WSPA 2QJLA 5H8YE 4USAA 1JCKB 1V1PA 3NUHB 5BYRA 1ENFA 2R61A 3V05A 2DLBA 1QT9A 4A55A 1AWDA 1FXIA 2RMMA 3PZ7A 3TEXA 1GOZA 4M0WA 3UI3A 4LTUA 4MACA 2INPE 1VZ6A 1P7EA 3KWVA 2K9XA 1BXTA 1XCQL 1LO5D 3U7ZA 1FCLA 1J7CA 3IXSA 1JWAD 3AE9B 3B9JA 1PDXA 1UNSA 2BTEA 3CIRB 1J7AA 3N9YC 4KGSA 1L5PA 4OZCA 1KLGD 4R3DA 1DYQA 1P7FA 2IGDA 4YTNB 5E6JA 1PGXA 1ET9A 4RF1A 1RWSA 5BMGA 2GI9A 2BB6A 2Y5PA 2DYMA 3T3NA 2NTSA 2WU2B 4HEA1 2M56B 5D7GA 4TSSA 5AUIA 1F2RI 2BS2B 5BYSA 1E9MA 4JPSA 1XF5L 3KWLA 3W9CB 1R7SA 2J53A 1B1ZA 1SEBD 2JXTA 2JYTA 2N9KA 3AE2B 4TQ0A 3NVZA 2WQYB 1DOIA 3ABVB 1QOFA 4B0EA 2BT6A 4JX1C 1ZXHA 2IJ0A 1BUIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C77 A;  1SSN A;  1C79 A;  1C78 A;  1BUI C;  1C76 A;  2SAK A; 
#chains in the Genus database with same CATH topology
 1TYG B;  3R3M A;  2O6V D;  2QC8 A;  3RNG C;  3ZO5 B;  2JRI B;  2KVZ A;  3PGE A;  3R7Q A;  4NJ6 A;  2G4D B;  3TSS A;  2D10 A;  3KYC D;  1SJH D;  1SSN A;  5BYQ A;  1V97 A;  1CQV A;  1A70 A;  2BYF A;  3H7S A;  2OED A;  4DK5 A;  3PTF C;  2L83 A;  3DVG X;  1XEE A;  1I4G A;  1MFW A;  2GBR A;  1WXA A;  3VH3 B;  1ZPS A;  2AX5 A;  2KC1 A;  2KFK A;  2H88 B;  2M0X A;  4I6N B;  4GDL A;  3DWM A;  1IGD A;  3C19 A;  2YEP B;  2WU5 B;  4MM3 A;  4XGA B;  2PE6 B;  1I4Q A;  2JZ3 B;  3JVZ X;  3HRD D;  1SE3 A;  1LGR A;  2KWV B;  4K7W A;  4RMA A;  3AUL A;  4W9D A;  1LFD A;  1SIF A;  1SIJ A;  1EM7 A;  4JWU C;  3UIO B;  1A5R A;  4NQK E;  4OW0 A;  3MJW A;  2YLM A;  3IFW B;  3KQ4 A;  2X38 A;  1UBI A;  3VXW A;  1N60 A;  2MJE A;  1KFY B;  2JVC A;  2DEN B;  4PS3 A;  2BGF A;  2INN E;  3V61 A;  2WXN A;  3BYT B;  1ISN A;  2ON8 A;  2KKC A;  1JML A;  4MGI E;  1FRD A;  4JLC A;  3NRZ A;  4II3 B;  2BYT A;  3UQB A;  2KK8 A;  2MBQ A;  2W55 A;  5CHW A;  1QOA A;  2PKO A;  3ZW3 A;  4KZC A;  1M4V A;  5HI1 A;  2KN5 A;  1KH0 A;  2QHO A;  3N1Y C;  2NS5 A;  4JIO U;  5AZG A;  3D32 A;  1FNU A;  3BYY B;  4C7Z A;  4HDQ A;  4ARI A;  2WHI A;  1PGA A;  3BII D;  3I63 C;  4NJC A;  1L0V B;  3HK0 A;  4DHJ B;  2ZEQ A;  2BB5 A;  4ASW C;  4KKJ A;  1QLB B;  5E6O A;  4S0R A;  2NVU I;  1WGY A;  2KAN A;  4WAF A;  3GE3 C;  5IOI A;  2G45 B;  2KDB A;  2MBB B;  4HCP B;  4YL8 A;  3A1Q B;  3QQ8 B;  4E71 A;  4NPN A;  4W9H A;  4A3P A;  1JWB D;  5AZF A;  5BMI A;  3MC0 B;  2RD0 A;  1UWM A;  2PTL A;  3FIL B;  3TEY A;  4M8N A;  1EF5 A;  1N5W A;  1F2R C;  3N3K B;  5BMH A;  5FR3 A;  3DBL B;  4YTM B;  3FIL A;  4K1R B;  4IM2 A;  2K8B A;  1UWX A;  2RSU A;  3B2G A;  1GB4 A;  1HA5 A;  5D6J B;  4WJP A;  1FNV A;  3TEZ A;  1XLO A;  2Z0D B;  2J0K A;  3O13 A;  4E3C A;  1F9J A;  2W3R A;  4YTP B;  2V3P A;  1GAQ B;  3JSV B;  1T5X D;  4ANX A;  4LNN A;  4WJO A;  3GZN B;  3WAO A;  3L4P A;  3NY5 A;  3RFZ B;  2CS4 A;  2ZVO A;  2ZW1 A;  5CHF A;  2LGI A;  4DHZ E;  1C79 A;  3ZIM A;  4XZ4 A;  1YNT E;  1FCC C;  1ESF A;  3AE3 B;  3ZUN A;  1IUE A;  2M0A A;  2K3U A;  1C4C A;  4LDT D;  5C3J B;  2SAK A;  2CHZ A;  3AE5 B;  1TGZ B;  4WQM A;  1SGH A;  3A4S C;  1E0Z A;  1MG4 A;  4RFB A;  1F77 A;  2CU1 A;  3AN1 A;  1YOV B;  4TKN A;  3C8Y A;  2LAS A;  4MH0 E;  4XDC A;  2I2Y A;  4MEM A;  2EKI A;  2JQR B;  5GXG B;  1OQY A;  3VR9 B;  5EDS A;  5H92 C;  1Q1O A;  2TSS A;  2ZW0 A;  3OLM D;  4IWP A;  4OZB A;  5BO4 B;  3C0R B;  4YSZ B;  2IO3 B;  4LCD E;  1JRP A;  3X23 A;  1UEL A;  2GBJ A;  2K22 A;  2LGY A;  1KJT A;  2CU3 A;  2PE9 A;  4LLG M;  3BY4 B;  2MW5 A;  1TY0 A;  1V5T A;  2INC C;  1IYF A;  4GDL B;  4HDO A;  1J8C A;  1Q5W B;  1LQB A;  1C9F A;  2MA9 B;  2K39 A;  2KN4 A;  2MJ3 A;  2YVC A;  2ASQ A;  5IAA C;  3CWI A;  2FCS A;  2JY6 A;  3Q8B A;  3MFG A;  2WS3 B;  1L4D B;  3QAR A;  4L2Y A;  4CYE A;  4IM3 A;  2Z59 B;  1D6E C;  3RNB C;  2LJ5 A;  2LI5 A;  3V6E B;  3MHZ A;  1T3Q A;  4ITK A;  2O2V A;  2KTF A;  1J19 A;  4IWO A;  2Z0E B;  4XYC A;  4BFR A;  2KO3 A;  3NG0 A;  3NHE B;  2CHX A;  3DCG A;  1S3S G;  1PFD A;  3L0W B;  1OGW A;  2WXH A;  4FA6 A;  3A4R A;  1JRU A;  3N1X C;  5D94 A;  1ZE3 D;  2DZI A;  1V5O A;  1R4M B;  5LNK 1;  2LVO A;  2DX5 B;  2KC2 A;  3RNA C;  2IDY A;  1Q10 A;  2OOB B;  1EU3 A;  4ANW A;  2WXM A;  2HD5 B;  1JWM D;  2D5G A;  4M00 A;  1L0Y B;  3AV8 A;  4LNI A;  4W9F A;  3VR8 B;  2GMI C;  4B9K A;  4AS1 A;  3JW0 X;  3Q8C A;  2KDM A;  3ZNZ B;  1OFF A;  4MJS A;  1EUV B;  1TS2 A;  2VH2 A;  1VD2 A;  1WYW B;  1FIQ A;  3AH7 A;  3AE4 B;  3ZTC A;  4RH6 A;  3E56 A;  3Q8E A;  4KVG B;  4W9I A;  2D2Q A;  2VZK D;  2DZK A;  1NI2 A;  4AP4 C;  3P4R B;  4N9F 4;  4K3B A;  2JYE A;  4ZRI A;  1H8C A;  4LNK A;  3L10 B;  1QOB A;  2WXQ A;  4PS7 A;  1KLU D;  3A9J A;  4AQ7 A;  1C1Y B;  1VR9 A;  4YWG G;  2L00 B;  2QJL A;  4USA A;  3DBS A;  1V1P A;  3NUH B;  1ENF A;  4FJY A;  2XK5 B;  2W9N A;  2MBE A;  1AWD A;  2RMM A;  4MAC A;  4GU2 A;  3RNF C;  3U7Z A;  3DBR B;  1J7C A;  1D3Z A;  3UF8 A;  1UNS A;  4GIV A;  3DVN U;  2AWT A;  1P98 A;  1ET9 A;  3WIM A;  2DYM A;  2HJ8 A;  2NTS A;  2WU2 B;  5D7G A;  5AUI A;  1F2R I;  5BYS A;  3MC8 A;  4ANU A;  4LNO A;  1E8W A;  2J53 A;  1B1Z A;  1SEB D;  2JXT A;  2JYT A;  3APC A;  3NVZ A;  4IWQ A;  2KDI A;  2LXC A;  3ABV B;  1QOF A;  4GSW A;  2BT6 A;  4JX1 C;  3ML8 A;  2UU7 A;  3M95 A;  1V86 A;  4W9L A;  3W5V B;  3GOE A;  4A8X C;  3H7P A;  2O6V B;  2J0M A;  1KF6 B;  2QSD A;  4BKS A;  1YJJ A;  2J7Q B;  3ETR A;  1ZGU B;  3B2F A;  5CTR C;  1TZ1 A;  1F1H A;  1WJU A;  4W9K A;  4CQN A;  1VZ7 A;  4BKG A;  4KDL B;  1NYQ A;  1I4R A;  3L08 A;  2D3A A;  2KDE B;  2GB1 A;  3DWG C;  4RCO A;  1LM8 B;  4ICU A;  2BWE S;  1E8Y A;  1RYJ A;  1AW7 A;  3K9P B;  2AQ1 B;  4KGT A;  2ONQ A;  1GG3 A;  3CMM B;  3VUX A;  5J2R A;  1TS5 A;  1JW9 D;  1VZ8 A;  5CHV C;  3P4S B;  1PQS A;  3RUL A;  3TBL D;  2CHW A;  3DBH I;  4C4V B;  1SE2 A;  1MVK A;  3MP9 A;  3DBH B;  3DOW A;  4JGH B;  1ZUD 2;  2UYZ B;  2L05 A;  2LMC A;  3OJ4 B;  1P1A A;  2FIF A;  4ICV A;  1R4N I;  1ACC A;  2LGX A;  1C76 A;  4MEL A;  3JYU A;  4HK2 A;  3MHS D;  4WWP A;  1BT0 A;  2WX1 A;  3HM3 A;  4N58 A;  3ALB A;  2JZP A;  5IP4 D;  2V3N A;  3S2A A;  1VJK A;  2RDG A;  3PT2 B;  3TCA A;  1XCT L;  4J6I A;  3VVW B;  1WRD B;  1QIL A;  2MSE D;  1FPY A;  2LUE A;  3ZJU A;  2XN9 C;  3RZW C;  4YSX B;  2GBN A;  2KT7 A;  3DQV A;  4OZA A;  4M8M A;  2A5U A;  2M8S A;  3AE8 B;  4RM9 A;  5J17 A;  3AI5 A;  2ZCC A;  2ZJD A;  4NJ7 A;  1ZKH A;  4EZL A;  5HFY A;  4REZ A;  4W9E A;  3VFK A;  1J7B A;  2VH1 A;  3SFE B;  1V81 A;  3T3O A;  1D5M C;  3BK1 A;  4FN2 A;  3PV1 A;  3ZNG C;  2V3S A;  2KOX A;  2BPS A;  1C4A A;  2M4N A;  3AEB B;  4EUT A;  2M1M A;  4NZL B;  3ZTD A;  3W1Y A;  3PS6 A;  4WWM A;  2G3Q B;  3TUO A;  2LVQ A;  2GRI A;  4KIK B;  2AL3 A;  2V1Y A;  4FBJ B;  4II2 B;  3W2D A;  3SFD B;  2KDF B;  5AUK A;  2BYE A;  5T8I A;  1HZ5 A;  3P4P B;  1Y8R C;  2NR2 A;  1NEK B;  1XO3 A;  4D2K A;  1QZE A;  1RLF A;  4BAX A;  4KX6 B;  3IAS 1;  2JRH A;  4XC2 A;  1IGC A;  5JHA A;  3NOB A;  2WYQ A;  3GB1 A;  3BVG A;  3IT6 B;  1XD3 B;  1TS3 A;  3N30 A;  3KH0 A;  4ZDV A;  1V8C A;  3MC9 A;  3Q3J A;  1QOG A;  1NYR A;  2JUO A;  2WXJ A;  2BF8 B;  3DPD A;  4DQO C;  3AE6 B;  1OQR A;  4CHK A;  1I4P A;  3M3J A;  4KDI C;  3ZJV A;  3W1S A;  3N20 C;  4P16 A;  2RPV A;  4A90 A;  3RYT A;  2WXO A;  1N63 A;  2CJN A;  2G4S A;  5KHQ A;  2AQ2 B;  4WJQ A;  1YQ4 B;  1E90 A;  1K51 A;  4L23 A;  1DGJ A;  1MJD A;  3KVF B;  4MGK E;  4TUU A;  1WE7 A;  1TKE A;  1V2Y A;  3M63 B;  3KUZ A;  3W5U B;  2NBU A;  4DBG A;  1WMH B;  2PEA A;  1HEZ E;  4HLE A;  2CJO A;  4EOY A;  4C00 A;  2K25 A;  2L0F A;  3SU8 X;  3WA0 A;  1E5W A;  3Q3F A;  4CO7 A;  3L17 A;  3OWE B;  1SB3 C;  2XBB C;  3DVN V;  1JRO A;  2L32 A;  3BZD B;  3QWZ B;  1E7U A;  3ZRF A;  3ZDM C;  1HTQ A;  1TJE A;  4FXC A;  1YN4 A;  4ZRQ A;  3BVM A;  1YX5 B;  1TY2 A;  2SEB D;  3TIX A;  5JH5 C;  2BW2 A;  1ZXI A;  2W3S A;  4NAW B;  4EE2 A;  3RI7 C;  3T8M A;  4KSL C;  3Q3M C;  3QA8 A;  5IN7 A;  3B0A A;  1IPG A;  3P1M A;  5DPS A;  2IPK D;  1NVI D;  4DXA B;  3NVW A;  5E6N A;  2EEL A;  1RM6 C;  1YJI A;  2MHJ A;  3V60 A;  2KLC A;  2FBW B;  4C7Y A;  2NMQ A;  3ZJT A;  1KLV A;  1F0Z A;  2DAJ A;  1JWU D;  3R2T A;  2X8X X;  2D11 A;  3NS8 A;  1PYW D;  1EWC A;  3NVV A;  1T0R C;  2MJD A;  2MEK A;  1YIW A;  3EFU A;  3U2S C;  1WM2 A;  2NTT A;  2RDB C;  4PYU A;  4EEW A;  3DVG Y;  4WUR A;  5L95 C;  2QIE B;  1N61 A;  2W54 A;  3WCQ A;  2KMA A;  4F1S A;  5FKA C;  3B1L X;  2Q5W D;  4C80 A;  1KM7 A;  2KYW A;  2LGS A;  2MWS B;  3L16 A;  3SR6 A;  3QX1 A;  1WJN A;  1Z5S B;  4JWS C;  1VLB A;  2IND C;  2DWQ A;  4GGQ A;  5C2T B;  1I4H A;  2XNA C;  2DNF A;  3U7D A;  4NAM A;  2FUG 1;  3A33 B;  3E9S A;  1I7H A;  1XT9 B;  1YN3 A;  3CST A;  4TV3 A;  1UUP A;  3RCZ A;  3UQA A;  4G11 A;  3J9C A;  1TIF A;  1AAR A;  2RDH A;  2V4I B;  2PPH A;  4RGM A;  2FCN A;  1YQB A;  1M94 A;  5BYR A;  4F7Z A;  4ZRJ A;  3V05 A;  3NZS A;  4A55 A;  4OVV A;  3RUI B;  4E74 A;  2UWQ A;  1GOZ A;  2C60 A;  1VZ6 A;  3OG5 A;  4HWI B;  2K8C A;  1XCQ L;  3PRP B;  2C5L C;  3N9Y C;  4R3D A;  2AYO B;  2QCZ A;  4BKT A;  3QJZ A;  4RF1 A;  3NJT A;  2V9H A;  3T3N A;  2M56 B;  4GN1 A;  1F52 A;  3T9L A;  2N7D A;  1R7S A;  2WQY B;  3AU4 A;  4G3X B;  1J0G A;  4GMV A;  1Q0W B;  2QDF A;  1BUI C;  5EE0 A;  4A9A A;  1CZP A;  2KJ6 A;  4FAD A;  1Y56 A;  3P42 A;  4KZ0 A;  3DHG C;  4MGZ E;  1I4X A;  1YJ1 A;  4IG7 B;  2LXA A;  3L13 A;  2KAC A;  4FHJ A;  1WWT A;  1FNW A;  2HTM E;  2PIA A;  3Q69 A;  4DWF A;  2KQ4 X;  3PLV A;  2ACZ B;  4A6Q A;  2IY0 B;  3MJ5 A;  3DHI C;  2WGS A;  3AM9 A;  2KHW B;  2L1A A;  1WH3 A;  2L3Z A;  5AZH A;  4XWT A;  2N9E B;  2BKR B;  1GPX A;  2IO1 B;  2GLS A;  4YT0 B;  2BS3 B;  3HM6 X;  3Q6B A;  2N9L A;  2B3A A;  1L2N A;  3I57 A;  4UDU C;  3AEG B;  5TR5 A;  4LJO B;  4XDD A;  2WNM A;  4WWN A;  2I1J A;  1WXQ A;  1FO4 A;  1UF0 A;  3QHT A;  3OAW A;  3VTV A;  1EF1 A;  4FLH A;  4EZK A;  1CK1 A;  4LNF A;  1N5X A;  4MH8 A;  3LXF A;  3U4E G;  1WGK A;  4JE3 B;  4B0M A;  2WX0 A;  2LHE A;  5CX3 A;  4HKZ E;  4AWJ A;  5EE9 A;  3P4Q B;  4ZYN A;  3DHH C;  1L4Z B;  2N0S B;  3GE8 C;  2BKF A;  3H9D A;  2IBI B;  1GJZ A;  3LB8 C;  1T0Q C;  4I6L B;  4W9G A;  4BKS D;  4BVU C;  2PJH A;  1D5X C;  4OHJ A;  3Q8F A;  4HJK A;  4US8 A;  1C78 A;  2MLB A;  4HPL B;  1IBX A;  3ML9 A;  2FNJ B;  3VTW A;  3ZXV A;  5IA7 A;  2XEW A;  1UGJ A;  2R2Q A;  2WLB A;  1UGM A;  4GXB A;  1SF0 A;  4A3O A;  2H89 B;  2LZ6 A;  4MT5 A;  1WJ6 A;  3PHW B;  1S1Q B;  2PLP A;  2KJR A;  2OJR A;  3VRA B;  1WFY A;  4Q2J A;  3ZGZ A;  4A20 A;  1VCB A;  1WGG A;  4GB9 A;  2JWZ A;  1WGH A;  4HVB A;  2ZNV B;  3DBL I;  3GP7 A;  4B6W A;  3SEB A;  4KIK A;  4JQW C;  4KV2 A;  2WDR B;  3R2I A;  4N59 A;  1LXD A;  2ZZP B;  1WX9 A;  2L52 A;  3ONS A;  2DYO A;  1FRR A;  1FM0 D;  3IVF A;  4XWW A;  3QK0 A;  2OJW A;  1FFU A;  3ZDT A;  3PRZ A;  2Y5C A;  5JXV A;  2W82 A;  3GZN I;  4ZRK A;  1I35 A;  2PMV A;  2MRP A;  2WXP A;  3IT4 B;  2KWU B;  2MP2 A;  4WWO A;  2AL6 A;  2Y5B B;  2AEH A;  3ZXR A;  1IP9 A;  2E6X A;  1XLQ A;  3AE1 B;  4W9C A;  2QIL A;  1E7V A;  3PLU A;  1SXT A;  4DDI D;  4ZYS A;  4PK1 A;  2JF5 A;  2L76 A;  4URK A;  2WWZ A;  3ZYY X;  3Q3N C;  5D2M B;  3RN9 C;  4O1N A;  2WXI A;  2V0G A;  4AUQ C;  1SE4 A;  5EE3 A;  1NDD A;  4MM3 B;  3EGR A;  4RNA A;  4HPM B;  4BBN F;  4ZHO A;  2RGF A;  1WGR A;  2NPT A;  5D3D A;  4FJZ A;  1V80 A;  3AB5 A;  3HVZ A;  2M19 A;  2IGG A;  4PYZ A;  1KOT A;  2VRR B;  4WH4 A;  5IO9 A;  4AJW A;  3AE7 B;  1FXT B;  4YXD B;  1U4A A;  3SD5 A;  3V3X A;  3APD A;  1L7Y A;  1TZO A;  1L6V A;  4K7S A;  4ZRP A;  3DBR I;  3VDZ A;  1EU4 A;  1MHX A;  1GNU A;  2N7J A;  2WDT B;  1ZOY B;  1GC7 A;  1K52 A;  5FK9 C;  3EUB 2;  5L83 A;  4NNJ B;  1DOY A;  3HIZ A;  2C7M B;  2IGH A;  3ZVV A;  4RM8 A;  1K50 A;  4F8C B;  1P0R A;  1QKZ A;  2KFJ A;  2NBV B;  3I5J C;  2J4X A;  1I42 A;  2I38 A;  2Y3A A;  1R4M I;  1K53 A;  3Q2A C;  3P2B A;  1C77 A;  3VUW A;  1YD8 U;  1D5Z C;  3QIJ A;  2C7N B;  2BQQ A;  2WXL A;  1TBE A;  5E6P A;  2EMS A;  2FCQ A;  1OTR B;  2MX2 A;  3GS2 A;  2D07 B;  3FC4 A;  3ZNI D;  3CSF A;  3RZF A;  3PZ8 A;  2LD9 A;  3AU5 A;  1V1P B;  1XQQ A;  1X1M A;  4BZA A;  3I3T B;  4GLS C;  3PO0 A;  3LYY A;  1K8R B;  3A9J B;  4ZHP A;  3ZLZ A;  2ICI A;  1BML C;  3VH4 B;  1V1O A;  3RNC C;  1STE A;  1HZ6 A;  3V6C B;  1ZDV A;  1QQR A;  2ZCB A;  3DDC B;  4RF0 A;  2D3C A;  2KQS A;  2LJI A;  4P1B C;  1NEN B;  1SJE D;  1EWY C;  1FFV A;  4FUL A;  5LXH A;  3NZ3 A;  1MG8 A;  2M17 A;  3QC8 B;  1WY8 A;  1ZDX A;  3W1S C;  4MJS B;  1FEH A;  2WXR A;  2JSV X;  2RR9 A;  1ZP0 B;  1ET6 A;  3CF6 E;  5C1Z A;  1TT5 B;  3IHP C;  1JCK B;  2FAZ A;  2DLB A;  4BBN C;  1FXI A;  3B08 A;  3SHQ A;  3TEX A;  1WXV A;  4M0W A;  2N7E A;  4LTU A;  4BOZ B;  4EZJ A;  1P7E A;  2KTR B;  1BXT A;  1LO5 D;  4IM0 A;  1FCL A;  3IXS A;  2REX A;  5C23 A;  2D3B A;  2BTE A;  3LDZ E;  2L7R A;  1J7A A;  4ANV A;  4KGS A;  1KLG D;  4IW0 A;  4YTN B;  5E6J A;  1RWS A;  3MTN B;  2LWP A;  1WZ3 A;  4HEA 1;  3M62 B;  4TSS A;  1E9M A;  2K6Q A;  3Q14 C;  4JPS A;  1XF5 L;  3IG3 A;  3KWL A;  4TQ0 A;  3QCA A;  2IY1 B;  1DOI A;  3UGB B;  4W9J A;  1N6Z A;  4QAY A;  4GDK A;  4NAW A;  3VRB B;  4FHK A;  1T6B X;  3RMK C;  1Z2M A;  2BS4 B;  4IOI E;  1WX8 A;  3WAN A;  1WM3 A;  4KKI A;  3UIP B;  2IO0 B;  1MI0 A;  4OVU A;  1FXA A;  1FD6 A;  2EMT A;  4ACF A;  2LHD A;  2WXK A;  2J52 A;  4RGN A;  2Z8L A;  1TKG A;  1UD7 A;  2CR5 A;  2YEP F;  4C56 C;  4WAA A;  2KX0 A;  3TMP B;  2KAJ A;  3R7R A;  2HTH A;  3Q8A A;  2N4F A;  2G9H D;  4JL9 A;  1RFK A;  2ZVN A;  1V9J A;  5LXI B;  4XE0 A;  3BWU D;  4NY0 A;  4DHJ D;  3TEW A;  2JU6 X;  2KQ7 A;  1JAL A;  2R2O A;  2LRW A;  4I6P A;  3KUC B;  4C4V A;  5JHB A;  4OVZ A;  4G50 A;  1R4N B;  2B76 B;  1TS4 A;  1V6E A;  4K3C A;  3RNE C;  4DXF A;  2DHZ A;  3BIN A;  1ZW7 A;  2L0T A;  4KSK C;  4M0W B;  1E10 A;  1L6U A;  2DYB A;  1ROE A;  2XK5 A;  1NI3 A;  3APF A;  3VHT C;  2GOW A;  1P3Q U;  2WDV B;  3NVY A;  3V62 A;  4MSQ B;  5G5G A;  2E3T A;  2DBY A;  1HE8 A;  4IC7 B;  2IO2 B;  2MP2 B;  2G1E A;  4MGY E;  2K0P A;  3VAW A;  4N6E B;  3PSE B;  5LLI A;  1AYF A;  4MDK E;  5IKC M;  1VRA B;  2PVO D;  3WAP A;  1WF9 A;  1CMX B;  1V49 A;  4RGO S;  1C3T A;  1EO6 A;  1T0S C;  3VUY A;  1XLP A;  1XLN A;  3EFC A;  5G2N A;  3OJ3 A;  4HRO A;  2IZV B;  2WXG A;  5J18 A;  1UH6 A;  1TTN A;  1MPE A;  5HKH A;  1VDV A;  2ZNV C;  1YX6 B;  1E6E B;  1XXG A;  2K1F A;  1WGD A;  4M01 A;  5G55 A;  3X0W A;  1SE9 A;  1L0X B;  3NZU A;  1HQR D;  2ZPN A;  1OEY A;  2LUM A;  1PGB A;  3K9O B;  1PUT A;  3IAM 1;  1UZX B;  3A9K A;  3EA6 A;  1HXY D;  1TKY A;  1GC6 A;  2L8J A;  3ECI A;  3AMZ A;  1H4R A;  3HUI A;  2LVP A;  2OHF A;  4H2A A;  2KWD A;  4ARC A;  1YQ3 B;  3BK2 A;  2JXX A;  1E8Z A;  3ZNH B;  1RRB A;  2KMM A;  1RFA A;  3WAM A;  2WXF A;  2KNB A;  1D4B A;  3PVL A;  1JWS D;  2K5P A;  2KZR A;  3I9V 1;  2K6D B;  1WIA A;  2N9P C;  1GB1 A;  4L1B A;  3FAH A;  1SBB B;  4FJV B;  2A4Z A;  2NCN A;  5KHO A;  3BVZ A;  4G0N B;  2BWF A;  1E7P B;  2AQ3 B;  5TSS A;  4K7U A;  1WYG A;  3PRM B;  1WJ4 A;  4TMA B;  4GOC A;  1CJE A;  3RPF C;  4HKQ A;  2MH7 A;  2O2V B;  3H6N A;  2GBK A;  2CKH B;  2I1K A;  2MBO A;  2N1W A;  5FR6 A;  1MHH E;  3ENE A;  3AEF B;  3N32 A;  3U52 E;  4HJG E;  2LEK A;  5MPO A;  1GUA B;  3UIN B;  2JPH A;  5GMV A;  4M02 A;  2NBW B;  5JZE B;  2BBC A;  2KWC A;  2QEJ C;  3KYD D;  2LGD A;  4HRS A;  2IYD B;  2HDE A;  2LFI A;  1B9R A;  4US9 A;  1FMA D;  4IDI A;  1OQQ A;  1YN5 A;  5I4D A;  3AEA B;  3QAQ A;  2C7H A;  2JZZ A;  4J3O D;  2WDQ B;  1WMH A;  1JQ4 A;  4KGR A;  4PS8 A;  1KRH A;  4P6V F;  4NQL B;  3EC8 A;  1WR1 A;  1OEY J;  1KTK A;  3R8B A;  1WXS A;  3RT3 B;  2KD0 A;  3KLS X;  3HHM A;  3P63 A;  4WIP A;  4EKU A;  1DOX A;  1RAX A;  1WRI A;  4RGT A;  2WP9 B;  4HCN B;  3H7P B;  2FID A;  3KUD B;  4TQ1 A;  2KFK B;  3H8H A;  4LJP B;  3VTU A;  3N1Z C;  2KMC A;  4AOF A;  3IBE A;  1YMH E;  2VZK B;  4P1C C;  2V4L A;  2JX5 A;  2BYV E;  2JT4 B;  5D3I B;  3JSV A;  2JWU A;  3ZKJ C;  2DAF A;  2PVG C;  2O6V A;  4YSY B;  2NPT B;  2LRU A;  2MBH A;  1WX7 A;  4GDK B;  5HG2 A;  2KVR A;  3WAL A;  2FCM A;  4WJN A;  3VQI A;  3EEC A;  3PZD A;  3U8Z A;  1AN8 A;  1WE6 A;  5EE1 A;  2FUH B;  1NBF C;  4LK0 M;  5DCN A;  3ZRC A;  4DDG D;  2K8H A;  2GBM A;  3PHX B;  4DXG A;  3U30 A;  3HVD A;  2RPQ A;  4WQO B;  2N1V A;  2DZJ A;  2MCN B;  3TL5 A;  5HHD G;  2FE8 A;  4HPP A;  3H1U A;  4MSM B;  2N9X A;  5DPW A;  1WR6 E;  2KTR A;  3NS1 A;  2ZPY A;  2MQJ A;  2BVC A;  2QMT A;  3AEE B;  4IKG A;  4XX5 A;  3AEC B;  4ZOH C;  3KW5 B;  4DHZ B;  2PW9 A;  3Q3O C;  2EKE C;  1N62 A;  3URY A;  3FKY A;  1HTO A;  1IBX B;  2HE7 A;  2J42 A;  3TJP A;  4PT5 A;  4P7I A;  1C4P A;  2KXJ A;  4BOS C;  1E8X A;  1WI0 A;  2J0J A;  3LJ3 A;  5G5H A;  4X57 B;  2C9W B;  2DZM A;  1QF6 A;  1G6J A;  3AED B;  4AJY B;  3ZQ4 A;  4S17 A;  1T0Y A;  1P9D U;  1WSP A;  5H8Y E;  3EHV A;  2HJ1 A;  3SDL C;  1UBQ A;  2KJH B;  2R61 A;  3PPA A;  1QT9 A;  3A9K B;  4HXD A;  4K81 A;  3PZ7 A;  4EFO A;  2KLG A;  3UI3 A;  5DPT A;  2INP E;  3KWV A;  3O65 B;  2K9X A;  1WZ0 A;  2D3G A;  3A1Q A;  1JWA D;  4LDT B;  3AE9 B;  1PDX A;  3B9J A;  3R66 C;  3CIR B;  1L5P A;  3L54 A;  4OZC A;  3RD2 A;  1DYQ A;  1P7F A;  2IGD A;  3PRE A;  1PGX A;  5BMG A;  2GI9 A;  2BB6 A;  2Y5P A;  5DPR A;  1WXM A;  2BS2 B;  2KX3 A;  3AXC A;  3W9C B;  3AE2 B;  2N9K A;  4IUM B;  4B95 A;  4B0E A;  5AEK B;  1ZXH A;  2IJ0 A; 
#chains in the Genus database with same CATH homology
 3VRB B;  1TYG B;  5EE0 A;  4A9A A;  1CZP A;  3TSS A;  1T6B X;  3W5V B;  1Y56 A;  3P42 A;  4A8X C;  2BS4 B;  4IOI E;  2QSD A;  1KF6 B;  1SJH D;  4KKI A;  1YJJ A;  3ETR A;  1SSN A;  3B2F A;  5BYQ A;  1I4X A;  1MI0 A;  1V97 A;  1CQV A;  1FXA A;  1A70 A;  1FD6 A;  2KAC A;  4CQN A;  1VZ7 A;  2LHD A;  2WXK A;  2J52 A;  1WWT A;  1FNW A;  1NYQ A;  2HTM E;  1I4R A;  2Z8L A;  4RGN A;  2OED A;  1TKG A;  2PIA A;  2YEP F;  2GB1 A;  2L83 A;  4C56 C;  3Q69 A;  1XEE A;  1I4G A;  2KQ4 X;  2ACZ B;  4A6Q A;  3DWG C;  1ZPS A;  4RCO A;  2AX5 A;  3MJ5 A;  1RYJ A;  2KAJ A;  1AW7 A;  2H88 B;  3Q8A A;  2AQ1 B;  3DWM A;  3AM9 A;  1IGD A;  4KGT A;  2ONQ A;  2YEP B;  1TS5 A;  2G9H D;  2WU5 B;  1JW9 D;  1VZ8 A;  1RFK A;  1I4Q A;  3P4S B;  3HRD D;  1SE3 A;  2L1A A;  4XWT A;  4XE0 A;  3BWU D;  1GPX A;  1SE2 A;  4YT0 B;  1SIJ A;  1MVK A;  3MP9 A;  3TEW A;  1EM7 A;  2JU6 X;  1JAL A;  4JWU C;  2BS3 B;  2N9L A;  4OW0 A;  1ZUD 2;  3I57 A;  4UDU C;  4OVZ A;  2LMC A;  3AEG B;  2B76 B;  1TS4 A;  4XDD A;  2WNM A;  3KQ4 A;  1ACC A;  1WXQ A;  1FO4 A;  2X38 A;  4DXF A;  1C76 A;  1N60 A;  2MJE A;  1KFY B;  2INN E;  2WXN A;  1CK1 A;  4MH8 A;  1N5X A;  3BYT B;  2ON8 A;  3LXF A;  3U4E G;  1JML A;  4N58 A;  1E10 A;  1L6U A;  1WGK A;  2JZP A;  1FRD A;  2V3N A;  3NRZ A;  1ROE A;  4JE3 B;  1VJK A;  2RDG A;  1NI3 A;  4B0M A;  2BYT A;  2LHE A;  4HKZ E;  2W55 A;  2WDV B;  1XCT L;  5EE9 A;  1QOA A;  3NVY A;  3P4Q B;  2PKO A;  1QIL A;  1M4V A;  5HI1 A;  1L4Z B;  5G5G A;  1KH0 A;  2E3T A;  2DBY A;  2N0S B;  3ZJU A;  2XN9 C;  2G1E A;  4YSX B;  3LB8 C;  2K0P A;  4OZA A;  3AE8 B;  4N6E B;  5HFY A;  1AYF A;  1VRA B;  1FNU A;  2PVO D;  1D5X C;  4REZ A;  3BYY B;  4C7Z A;  4ARI A;  1J7B A;  4OHJ A;  3Q8F A;  4US8 A;  1PGA A;  1C78 A;  4RGO S;  3SFE B;  3BII D;  1IBX A;  4NJC A;  3T3O A;  1XLP A;  1D5M C;  3BK1 A;  1XLN A;  1L0V B;  4HRO A;  2WXG A;  2BB5 A;  4KKJ A;  1QLB B;  1MPE A;  1VDV A;  1C4A A;  1UGJ A;  3AEB B;  4WAF A;  4NZL B;  1E6E B;  1XXG A;  2WLB A;  4WWM A;  3TUO A;  1L0X B;  1SF0 A;  2GRI A;  2H89 B;  1HQR D;  4MT5 A;  1JWB D;  5BMI A;  3MC0 B;  2LUM A;  2PLP A;  1UWM A;  2PTL A;  3FIL B;  1PGB A;  3VRA B;  3W2D A;  3TEY A;  1PUT A;  3IAM 1;  4Q2J A;  3ZGZ A;  1N5W A;  3EA6 A;  3SFD B;  1HXY D;  1F2R C;  5AUK A;  5BMH A;  1TKY A;  5FR3 A;  4YTM B;  3FIL A;  5T8I A;  1HZ5 A;  3AMZ A;  3P4P B;  3HUI A;  3GP7 A;  2OHF A;  4H2A A;  1NEK B;  1XO3 A;  2KWD A;  4D2K A;  4ARC A;  1YQ3 B;  3SEB A;  1UWX A;  3B2G A;  1GB4 A;  1HA5 A;  3BK2 A;  2WDR B;  4KX6 B;  3IAS 1;  3R2I A;  4N59 A;  2L52 A;  2KMM A;  1FNV A;  2DYO A;  2WXF A;  1FRR A;  1FM0 D;  1XLO A;  3TEZ A;  4XWW A;  1D4B A;  1JWS D;  1IGC A;  2K5P A;  1FFU A;  3O13 A;  3I9V 1;  3GB1 A;  1GB1 A;  4L1B A;  3BVG A;  2Y5C A;  1SBB B;  2W3R A;  3FAH A;  3IT6 B;  4YTP B;  1TS3 A;  5JXV A;  2V3P A;  1GAQ B;  2W82 A;  1T5X D;  1V8C A;  3BVZ A;  3L4P A;  1QOG A;  1NYR A;  2WXJ A;  3RFZ B;  1E7P B;  2AQ3 B;  2ZW1 A;  5TSS A;  2LGI A;  1C79 A;  1WYG A;  1YNT E;  2PMV A;  4TMA B;  4DQO C;  1CJE A;  3AE6 B;  3RPF C;  4HKQ A;  1OQR A;  2MH7 A;  1FCC C;  1ESF A;  3AE3 B;  2M0A A;  1IUE A;  2WXP A;  2K3U A;  1I4P A;  1C4C A;  3IT4 B;  3ZJV A;  5C3J B;  2SAK A;  3W1S A;  1MHH E;  3AE5 B;  4P16 A;  4WQM A;  2RPV A;  4A90 A;  2WXO A;  3AEF B;  1E0Z A;  3U52 E;  4HJG E;  2LEK A;  2E6X A;  1N63 A;  2CJN A;  1XLQ A;  3AE1 B;  5MPO A;  2AQ2 B;  2QIL A;  4RFB A;  1F77 A;  1YQ4 B;  3AN1 A;  1K51 A;  3C8Y A;  4L23 A;  2BBC A;  4XDC A;  1DGJ A;  2I2Y A;  2QEJ C;  1SXT A;  4ZYS A;  2EKI A;  2JQR B;  5GXG B;  3VR9 B;  5H92 C;  4HRS A;  3ZYY X;  2TSS A;  2ZW0 A;  2HDE A;  2LFI A;  4OZB A;  1B9R A;  4US9 A;  1FMA D;  4O1N A;  4IDI A;  1TKE A;  2WXI A;  2V0G A;  1OQQ A;  3W5U B;  4YSZ B;  1YN5 A;  5I4D A;  1JRP A;  1SE4 A;  3AEA B;  2K22 A;  5EE3 A;  2CU3 A;  4LLG M;  3EGR A;  1HEZ E;  1TY0 A;  2CJO A;  4J3O D;  4MM3 B;  4RNA A;  4ZHO A;  2WDQ B;  4GDL B;  1JQ4 A;  5D3D A;  4KGR A;  3AB5 A;  3HVZ A;  2M19 A;  2IGG A;  1KRH A;  1C9F A;  4P6V F;  3OWE B;  4WH4 A;  2KN4 A;  1SB3 C;  2MJ3 A;  3AE7 B;  1JRO A;  2L32 A;  3BZD B;  4YXD B;  3V3X A;  1KTK A;  3CWI A;  3R8B A;  1TJE A;  3KLS X;  3Q8B A;  4FXC A;  1YN4 A;  3P63 A;  1TZO A;  3MFG A;  4WIP A;  1L6V A;  4ZRQ A;  4ZRP A;  3BVM A;  2WS3 B;  1L4D B;  4L2Y A;  1DOX A;  1TY2 A;  2SEB D;  1WRI A;  4RGT A;  1D6E C;  2WP9 B;  1EU4 A;  1MHX A;  2N7J A;  2BW2 A;  1ZOY B;  4TQ1 A;  3MHZ A;  1ZXI A;  1T3Q A;  3H8H A;  4ITK A;  2W3S A;  1K52 A;  4NAW B;  4EE2 A;  5FK9 C;  3EUB 2;  1YMH E;  2VZK B;  2JX5 A;  5D3I B;  1DOY A;  2IGH A;  2JWU A;  1K50 A;  3P1M A;  1PFD A;  1QKZ A;  2IPK D;  2WXH A;  1NVI D;  2J4X A;  2PVG C;  2I38 A;  3NVW A;  2EEL A;  2Y3A A;  4YSY B;  1K53 A;  1ZE3 D;  1RM6 C;  5LNK 1;  4GDK B;  1C77 A;  1YJI A;  1D5Z C;  5HG2 A;  2FBW B;  2WXL A;  4C7Y A;  2IDY A;  2NMQ A;  1Q10 A;  1EU3 A;  3VQI A;  3ZJT A;  1AN8 A;  3GS2 A;  5EE1 A;  1F0Z A;  1JWU D;  2WXM A;  4LK0 M;  3R2T A;  1JWM D;  2D5G A;  3FC4 A;  1PYW D;  3PZ8 A;  1L0Y B;  3AV8 A;  1EWC A;  1V1P B;  3NVV A;  4DXG A;  3VR8 B;  3HVD A;  4AS1 A;  2MJD A;  2MEK A;  3Q8C A;  5HHD G;  2KDM A;  4GLS C;  2FE8 A;  3PO0 A;  3LYY A;  3U2S C;  2NTT A;  1OFF A;  4ZHP A;  4WUR A;  2QIE B;  2ICI A;  3NS1 A;  1BML C;  1N61 A;  2W54 A;  1TS2 A;  3WCQ A;  1V1O A;  2QMT A;  3AEE B;  4IKG A;  1STE A;  1HZ6 A;  5FKA C;  2Q5W D;  1FIQ A;  3AEC B;  1ZDV A;  1QQR A;  3AH7 A;  3AE4 B;  4ZOH C;  4C80 A;  4RF0 A;  4RH6 A;  2PW9 A;  3SR6 A;  1N62 A;  3E56 A;  2LJI A;  3URY A;  3Q8E A;  1NEN B;  1IBX B;  1SJE D;  2VZK D;  4JWS C;  1EWY C;  1FFV A;  1VLB A;  2J42 A;  2DWQ A;  3P4R B;  5C2T B;  3NZ3 A;  4PT5 A;  1I4H A;  1C4P A;  2JYE A;  2XNA C;  4NAM A;  2FUG 1;  1ZDX A;  3E9S A;  1I7H A;  5G5H A;  1YN3 A;  1UUP A;  1QOB A;  2WXQ A;  4AQ7 A;  1KLU D;  3AED B;  3J9C A;  1QF6 A;  1FEH A;  1VR9 A;  3ZQ4 A;  2WXR A;  2JSV X;  4YWG G;  2RDH A;  2V4I B;  4RGM A;  1ZP0 B;  1ET6 A;  1WSP A;  2QJL A;  5H8Y E;  4USA A;  1JCK B;  1V1P A;  3NUH B;  5BYR A;  1ENF A;  2R61 A;  3V05 A;  2DLB A;  1QT9 A;  4A55 A;  1AWD A;  1FXI A;  2RMM A;  3PZ7 A;  3TEX A;  1GOZ A;  4M0W A;  3UI3 A;  4LTU A;  4MAC A;  2INP E;  1VZ6 A;  1P7E A;  3KWV A;  2K9X A;  1BXT A;  1XCQ L;  1LO5 D;  3U7Z A;  1FCL A;  1J7C A;  3IXS A;  1JWA D;  3AE9 B;  3B9J A;  1PDX A;  1UNS A;  2BTE A;  3CIR B;  1J7A A;  3N9Y C;  4KGS A;  1L5P A;  4OZC A;  1KLG D;  4R3D A;  1DYQ A;  1P7F A;  2IGD A;  4YTN B;  5E6J A;  1PGX A;  1ET9 A;  4RF1 A;  1RWS A;  5BMG A;  2GI9 A;  2BB6 A;  2Y5P A;  2DYM A;  3T3N A;  2NTS A;  2WU2 B;  4HEA 1;  2M56 B;  5D7G A;  4TSS A;  5AUI A;  1F2R I;  2BS2 B;  5BYS A;  1E9M A;  4JPS A;  1XF5 L;  3KWL A;  3W9C B;  1R7S A;  2J53 A;  1B1Z A;  1SEB D;  2JXT A;  2JYT A;  2N9K A;  3AE2 B;  4TQ0 A;  3NVZ A;  2WQY B;  1DOI A;  3ABV B;  1QOF A;  4B0E A;  2BT6 A;  4JX1 C;  1ZXH A;  2IJ0 A;  1BUI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...