1C77A

Staphylokinase (sak) dimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
b'GKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Crystal structure of a staphylokinase: variant a model for reduced antigenicity.
pubmed doi rcsb
total genus 22
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c77A00
2SAKA 1C79A 1C76A 1C77A 1BUIC 1C78A 1SSNA
chains in the Genus database with same CATH superfamily
1R4NB 1R4MB 1CMXB 1JROA 2K0PA 3JYUA 4YWGG 1GB1A 5T8IA 2PW9A 5JZEB 2M17A 4LJPB 3BYYB 3EHVA 3LXFA 1PQSA 2MBQA 4LDTB 4GGQA 5AZGA 1LM8B 1WR1A 2KTRA 1IGCA 1SGHA 2JWUA 3BY4B 3FKYA 3QWZB 4MEMA 4UDUC 2C60A 1N61A 1RAXA 3ZDMC 3ZJTA 2PMVA 1ZXHA 2GBJA 3ML8A 3BVZA 5CX3A 2QCZA 3QCAA 3R8BA 3ZJVA 3DPDA 2V3NA 1WRIA 4K3BA 3AEDB 2WU5B 2LHDA 3VH3B 1IP9A 2N9LA 3DCGA 3BK2A 5G2NA 4AQ7A 4ZHPA 4MGZE 4IC7B 4WIPA 3KUZA 4KX6B 2JXXA 3K9OB 1JWSD 1SIJA 2FCNA 2HJ8A 2VRRB 2PKOA 1LO5D 4M8NA 3DVGY 4BVUC 1T6BX 3RULA 1SIFA 2K8BA 1L0VB 2OHFA 1P9DU 3QK0A 1JW9D 4LTUA 2KVRA 2DYBA 1L6UA 3P4SB 2QEJC 4C4VB 1NENB 4US9A 4EZJA 2QHOA 2INCC 2LGYA 3N3KB 3ECIA 3QA8A 3RNAC 4GXBA 2KC1A 1F1HA 2DYOA 5CHFA 3AB5A 3ZNHB 4J6IA 2WXGA 3FAHA 5AUKA 2KWDA 3PHXB 3L10B 2KLCA 3ZGZA 2KXJA 2AX5A 2IGDA 3ZNGC 2KWUB 2KWVB 2KC2A 4FHJA 1MJDA 2KMCA 4M01A 1LFDA 3L13A 3P4PB 3R2IA 2INDC 4US8A 2DLBA 4KVGB 1SEBD 1MFWA 2V0GA 4JLCA 4YSYB 2N4FA 3NVZA 3A9KB 4RGMA 2GB1A 1XLQA 1AWDA 4PS8A 1RWSA 1T3QA 4WJPA 2KYWA 2K3UA 2MBBB 2JYTA 5C3JB 4DDGD 2NBUA 3DOWA 2DAJA 3Q2AC 2IJ0A 1STEA 2LVPA 4RF0A 3RNFC 2JU6X 3HM6X 3I3TB 3JSVA 1U4AA 2HTHA 3KUDB 4HLEA 2V4LA 4EZLA 2BF8B 4II3B 1UWXA 3ALBA 4MM3B 4IM3A 4KKJA 1ISNA 4KDLB 3DDCB 1TS4A 1JMLA 3EA6A 2FIDA 1SE3A 1YX5B 2Z8LA 2CHWA 1UH6A 3P42A 2LGDA 3M95A 3DBRB 4G50A 5EE1A 4USAA 1H8CA 1B9RA 1OEYJ 2JF5A 1WGYA 3AU4A 2W54A 5C23A 3D32A 3SFEB 1NDDA 4FULA 1TT5B 5CTRC 3PZDA 4C4VA 4ZYNA 2K25A 2G4SA 3ZTDA 5D3DA 1WX8A 1ZE3D 1XQQA 4DXAB 3AEAB 4F7ZA 4IUMB 4GDKB 2KDMA 3A9JB 3UINB 3WAMA 4DXGA 2LRUA 2J52A 2DYMA 2RDGA 3N1ZC 4W9LA 2WXIA 2VZKB 3CWIA 4RNAA 1V86A 1I35A 3A1QA 2DENB 4KDIC 3ZQ4A 4AP4C 3AM9A 1WJ6A 2SEBD 2BWES 2N1VA 1HZ5A 4XDDA 4FJYA 3MC0B 1L0YB 2I1JA 3BVGA 1KOTA 4IW0A 2W9NA 1K53A 3R2TA 2L7RA 2RSUA 3W5UB 1WYGA 1S3SG 4W9EA 3SD5A 4EFOA 5BYSA 1JWUD 4A55A 2GBMA 1TJEA 3ML9A 3JVZX 1R4NI 3KQ4A 4P7IA 4HPMB 2KKCA 3IAS1 2WNMA 1N62A 2W3SA 3PTFC 5J17A 4YL8A 1K8RB 1UZXB 4NPNA 2WGSA 1QZEA 3VTVA 4NJCA 4MH8A 1YJIA 2WXJA 4N9F4 1YNTE 2V4IB 1K50A 3EECA 3NZSA 2INNE 3IT4B 3TSSA 2MJ3A 4DHJD 1HTQA 1WXQA 1NVID 2KN5A 4BZAA 2FE8A 2WXOA 2MJDA 3TCAA 3VXWA 5D94A 2N9PC 4K7SA 5JH5C 1OQQA 4MACA 2MEKA 3RNGC 5KHOA 2WXNA 2WDVB 1MHHE 3AE7B 4A8XC 2MBHA 3B9JA 4RGNA 5J2RA 4P6VF 4DHZE 3H9DA 4IM2A 4Q2JA 4B6WA 3S2AA 3BYTB 3U30A 1WE6A 4HKQA 2DZKA 3W5VB 4AUQC 2JT4B 2MSED 1JRUA 1L4DB 4MT5A 3ZDTA 1EO6A 2KACA 4M02A 1KLGD 4WQMA 1F0ZA 4LLGM 2ZZPB 2NS5A 4IM0A 4WWNA 2WXMA 3RNEC 3DHHC 2G1EA 4C7YA 3VTUA 3ZNZB 3VH4B 1ROEA 2FCSA 2KQSA 1L6VA 3MJWA 3NZUA 1IGDA 1XEEA 4MGYE 4J3OD 1VDVA 2O6VB 2FUHB 2BGFA 4W9CA 4BKTA 4DQOC 3Q8CA 1J7AA 3TEWA 4OVZA 2M1MA 3PREA 2B3AA 1ET9A 3Q8EA 1OTRB 1X1MA 2MHJA 3BK1A 4ACFA 1JALA 3NVWA 2C7HA 3RNCC 4CQNA 2WS3B 4URKA 4HDQA 1Q10A 2KD0A 3EC8A 2HTME 2D2QA 2REXA 2JQRB 2MLBA 4TMAB 1VZ7A 4HROA 1L4ZB 1ZW7A 2GBKA 2OJWA 2RPQA 5IA7A 3MJ5A 4KGRA 5CHWA 4OZAA 2LUEA 3GS2A 2L32A 4FJZA 5G5GA 4XZ4A 3SFDB 3W1SC 1KJTA 4FA6A 2X8XX 3ZRFA 1FRDA 2XNAC 2KZRA 3DBSA 2NBWB 4C80A 4ZRPA 3B2GA 1ZKHA 2M8SA 4S17A 1WM3A 4LJOB 3BINA 1NI3A 1SJED 2KJ6A 3DVNU 2C5LC 2WDRB 2BWFA 2K8HA 2I1KA 2PEAA 3AE4B 1K51A 3CIRB 1VRAB 1ZDXA 3DHIC 3IFWB 2BB6A 2ZVOA 3RI7C 2NPTA 3UIPB 1XLNA 4X57B 3UQAA 2PIAA 2V1YA 1EWCA 3UGBB 1V6EA 3U52E 2NTSA 3SEBA 2WU2B 4GOCA 4XX5A 2UU7A 2MCNB 1KRHA 2BYTA 1L2NA 1TTNA 2M0AA 3DBHI 2LHEA 3UI3A 3FC4A 4E3CA 2ONQA 3PHWB 1ESFA 1V1PB 3QAQA 1TS5A 3DVGX 4YT0B 3ZXVA 1WFYA 2BS2B 1N5WA 3NZ3A 1HTOA 1JWBD 1FEHA 2JZ3B 2KANA 4GMVA 2KX0A 4RGOS 3ZLZA 2IYDB 3H7PB 3R3MA 1E5WA 1BT0A 4A20A 1I4GA 2VH1A 2L3ZA 4PYUA 3EFCA 3VDZA 3DBLI 4GDKA 4D2KA 4RMAA 1N6ZA 2ASQA 4YTPB 4MJSA 1SE4A 4OW0A 2IO2B 4JE3B 3DBLB 2AYOB 3QX1A 3RZWC 2K8CA 5HG2A 1E7VA 2IY1B 3HK0A 1V5OA 1LQBA 3LJ3A 1SXTA 5D2MB 4RCOA 1XCQL 4N59A 1WR6E 1YIWA 3HM3A 5BYRA 1WX7A 4WURA 2MH7A 2MQJA 1XXGA 1FO4A 3VUWA 2Q5WD 4ZRKA 3C19A 4ITKA 1GPXA 4IOIE 4K81A 1WGDA 1PDXA 4JX1C 4WJQA 1HQRD 1F9JA 2LJIA 1T0QC 1N63A 4REZA 1VLBA 3UIOB 3DBHB 4K7UA 3APFA 1HZ6A 1E0ZA 3ZXRA 1V1OA 2HD5B 1UGJA 5I4DA 5DPWA 3M62B 2INPE 1C4CA 1WRDB 1ZPSA 2KFJA 5EE0A 3U4EG 1A70A 4LNOA 2FCMA 4KIKA 3Q8FA 4L23A 1Y8RC 1SE2A 3B0AA 1R7SA 3HVZA 1TY0A 4MJSB 4DBGA 2AQ1B 3WAPA 3W9CB 3RUIB 5FR3A 1KFYB 2WLBA 3DWGC 2IY0B 2MWSB 2N7DA 2KX3A 3PRZA 5DPRA 3HHMA 5TR5A 4TQ1A 3ZIMA 4BOZB 3URYA 4IG7B 3PO0A 2G9HD 3PVLA 4AS1A 1P98A 4EKUA 3MFGA 1T0RC 2Y5PA 2VH2A 4FJVB 2C9WB 2N0SB 5IAAC 3ZJUA 1SJHD 2OJRA 1WYWB 1FNWA 2L8JA 1WGKA 3OG5A 2BT6A 3IHPC 1WXAA 1TZ1A 4YSZB 3FILA 4JWSC 4ZOHC 1Y56A 3MHZA 2ZCBA 2BKRB 3NVVA 2IGHA 1WIAA 2JRHA 4PS7A 5BYQA 5G5HA 2N9EB 5LLIA 5MPOA 5TSSA 1IPGA 3KW5B 1ACCA 2RDBC 2ZNVC 4HK2A 2JZPA 2JSVX 3HRDD 1H4RA 2KFKA 4MH0E 3Q3OC 4KV2A 2KLGA 3VAWA 1DGJA 1I4RA 5IO9A 2KT7A 1I4QA 1HA5A 1A5RA 2L0FA 3TBLD 2QDFA 1YMHE 2AQ2B 3V05A 4W9DA 3EFUA 3KYCD 1C9FA 4JGHB 3P2BA 3V6EB 4ZRJA 2BPSA 4HJKA 2E3TA 4TQ0A 3WANA 1GC7A 4LNNA 4KGTA 1PGXA 5D3IB 4E74A 1OFFA 2LWPA 3PLVA 2PE6B 2WXFA 1T5XD 1LGRA 4KGSA 4LNFA 2MA9B 1D5MC 1YN4A 2MW5A 3T8MA 1IUEA 1KH0A 4KIKB 2G45B 4HDOA 4XYCA 1N60A 3AE3B 3AECB 4BKSA 4ZYSA 2ZVNA 1WMHB 2PVOD 5EE3A 3R66C 1XLPA 1C3TA 4A6QA 5CHVC 4C00A 1CJEA 2KAJA 4ZHOA 4A3OA 3RMKC 2NBVB 4TV3A 1F77A 3K9PB 1VD2A 2VZKD 2R2OA 2ZEQA 3ZRCA 1DOXA 2W3RA 2B76B 2X38A 4B0MA 1QOBA 3HVDA 1XO3A 4B0EA 4JPSA 2ZPNA 1NYRA 2D5GA 4G3XB 1ZUD2 3A4RA 4AJYB 1JQ4A 1FXAA 2D07B 4FHKA 4OZBA 1UF0A 2L83A 5H8YE 5FKAC 3I9V1 3KLSX 2RPVA 4YTMB 3V60A 1WI0A 5HI1A 1KM7A 2MBEA 5IP4D 4ICVA 3AE8B 1E9MA 1B1ZA 4GDLA 1TS3A 2G3QB 2ICIA 2L00B 2Z0EB 1OGWA 3Q3FA 2XEWA 1GUAB 2KDFB 2RD0A 1YOVB 2W55A 1Z5SB 4GB9A 3TIXA 3NS1A 1L7YA 2EKIA 1V49A 4RH6A 1P0RA 1FNUA 2WXPA 2JXTA 3DVNV 4BBNC 2J0JA 3ZTCA 1FPYA 4HJGE 2WXQA 2L05A 4FBJB 3B1LX 4IKGA 1M4VA 1EF1A 1UBQA 3AXCA 1KF6B 2D10A 2ZJDA 1F2RI 4RFBA 3VQIA 2M56B 3I5JC 3HIZA 1AN8A 2KO3A 2A5UA 1FIQA 1YN5A 2J4XA 4NAMA 3DBRI 1WM2A 3KH0A 3H6NA 4GN1A 4KKIA 4CO7A 5BO4B 1NYQA 5AZFA 3H7SA 1QF6A 1E8YA 3ZNID 3JSVB 5G55A 3Q8BA 2ZCCA 4WJOA 3ZYYX 2KTRB 4WWMA 4P1CC 2FUG1 2HDEA 4M8MA 4H2AA 3AN1A 1WY8A 3AE6B 2J0MA 2DX5B 3GP7A 2DZJA 2NTTA 4OVUA 1DOYA 3ABVB 2FAZA 2MRPA 2M19A 3QQ8B 4MSMB 4ICUA 2LFIA 4N6EB 2KJRA 3VHTC 2WDTB 3VUYA 3AMZA 1D4BA 4ARIA 3ZW3A 1BUIC 3QJZA 3KWLA 2OOBB 3VR8B 4GIVA 3N20C 1WXMA 5C2TB 1D5ZC 2ON8A 1E10A 1PGBA 4XC2A 3AU5A 1PGAA 2FCQA 4YXDB 1GNUA 4GDLB 1EU4A 2PJHA 2M0XA 1BXTA 4FADA 4MDKE 2KQ7A 5JHBA 4NQKE 1ET6A 3AE1B 1V97A 2BQQA 2Y5CA 4NZLB 2O2VA 1CQVA 4NQLB 4OVVA 1HXYD 1G6JA 4TUUA 2JUOA 4OHJA 3Q3MC 1E8ZA 2RMMA 3X0WA 1XD3B 4HKZE 1M94A 1FRRA 3IXSA 5L95C 2XN9C 2BYVE 3PLUA 2ACZB 3UF8A 3T9LA 1BMLC 1E6EB 2K5PA 5D7GA 1Q5WB 5LNK1 1E8WA 4MM3A 3IT6B 2D11A 1XT9B 2WXLA 2GMIC 3TEZA 3RPFC 4N58A 2CKHB 2IO3B 2A4ZA 2CJOA 3QIJA 4K1RB 2KDEB 3EGRA 3Q3JA 1EM7A 1PYWD 1P7FA 1DOIA 1L0XB 1C79A 1YJJA 4K3CA 4NAWB 4P16A 2WXRA 1ZP0B 2WDQB 3TJPA 4L2YA 3PT2B 3P1MA 1MG4A 1OEYA 2LVQA 4K7WA 4LCDE 4A9AA 3ZO5B 4I6LB 2CR5A 1CK1A 5HKHA 1RFAA 1QT9A 4W9GA 1WJNA 2QSDA 2WQYB 3KWVA 1JWAD 3GB1A 1RRBA 4HXDA 1I7HA 2LGIA 4ASWC 1ENFA 4NJ6A 1RFKA 1QOFA 1FFUA 2LZ6A 4XWWA 2J53A 3U7DA 1C76A 1GJZA 2GLSA 5EDSA 3L0WB 3PSEB 1FFVA 3A33B 1CZPA 1WH3A 2K6QA 5LXHA 3ONSA 1F2RC 1RLFA 3AEBB 1J8CA 1EU3A 2TSSA 1WXVA 1V8CA 3OLMD 1C78A 2QILA 4LNIA 1VCBA 2CU3A 4WJNA 1TY2A 2K22A 4HWIB 1FNVA 4CHKA 1ZXIA 1D5XC 1E8XA 1QOGA 2AL6A 3ZKJC 5GXGB 5EE9A 3NJTA 3RNBC 4HCNB 2LRWA 3IBEA 2H88B 1XCTL 3V61A 1D6EC 4HRSA 5L83A 2YEPB 1IBXA 3N9YC 4M0WB 1WZ0A 4PS3A 2V9HA 4II2B 3AE2B 1EF5A 3JW0X 5HFYA 3EUB2 1FXTB 2NCNA 4BBNF 1TKYA 2LASA 2WXKA 2FBWB 1D3ZA 3Q3NC 2BBCA 4W9FA 4FLHA 3NY5A 1GG3A 4F1SA 4BOSC 4E71A 2O6VA 3MP9A 3QARA 3QHTA 3DQVA 4NJ7A 2R2QA 3CMMB 1TGZB 1WGRA 4ZRIA 3KYDD 2QJLA 3E56A 2KMAA 3V62A 1WJUA 2WXHA 4W9JA 5HHDG 2Z0DB 1I4PA 3SHQA 3L54A 1RYJA 1DYQA 3J9CA 3PZ7A 2K9XA 5BMGA 4JL9A 3ZUNA 3R7QA 2RGFA 2NPTB 1OQYA 4S0RA 1TYGB 1PFDA 1SSNA 2KFKB 1V2YA 2Y5BB 4GLSC 1UWMA 4AOFA 3OJ3A 2ZW1A 4NAWA 3SR6A 1YQBA 2KTFA 3AEFB 1UD7A 1AARA 3RT3B 5JHAA 5JXVA 2KWCA 2KK8A 2LMCA 4B9KA 2ZW0A 2D3CA 1WE7A 2MBOA 4WAFA 1AW7A 3KVFB 3VUXA 4C7ZA 1J0GA 3E9SA 3C8YA 1K52A 3AULA 1L5PA 2QIEB 3WALA 2LEKA 1J19A 3RCZA 2KOXA 3BZDB 4TKNA 2KHWB 1TKEA 3H1UA 2YVCA 1FMAD 4LK0M 2CHXA 2GOWA 4IWQA 2MJEA 4EOYA 4DDID 3AV8A 2IGGA 5IKCM 1QQRA 2V3SA 4C56C 4A3PA 4WQOB 2AEHA 2PVGC 5FR6A 3W1YA 1FM0D 2WYQA 4AWJA 4R3DA 3NS8A 4WAAA 4WWOA 4BKSD 2DBYA 2M4NA 3PPAA 3M63B 3I57A 4PT5A 4EZKA 1OQRA 3AE5B 3TUOA 2IO0B 3OAWA 1MG8A 1C1YB 4O1NA 5FK9C 4JQWC 3O13A 3AEEB 3GZNB 2L52A 2YLMA 2ZNVB 1VZ6A 2DNFA 4L1BA 5E6OA 2LGSA 1SE9A 4DXFA 3MTNB 4JIOU 4RF1A 2QMTA 3H7PA 1WWTA 2I2YA 2GI9A 2BW2A 2C7NB 2K39A 3OWEB 4XWTA 3T3OA 1V80A 5KHQA 1WX9A 2JRIB 4NY0A 2OEDA 1YX6B 5E6PA 1F52A 4TSSA 5DPTA 3R7RA 1AYFA 2JY6A 1T0SC 2DAFA 1WJ4A 3U8ZA 4OZCA 2MX2A 2FNJB 3IVFA 3OJ4B 1R4MI 2JX5A 2LJ5A 2N9XA 3P4QB 3ZVVA 1SF0A 5D6JB 1MVKA 2E6XA 1T0YA 2O2VB 2D3AA 2XBBC 1UGMA 3HUIA 2EMTA 1Z2MA 1SB3C 2BB5A 2J0KA 2WWZA 2LGXA 1QOAA 4XGAB 3RD2A 4CYEA 1WXSA 3VVWB 3KUCB 3NUHB 4MSQB 2D3BA 4PYZA 3AI5A 1Q0WB 3L08A 2I38A 5DPSA 4BFRA 2LD9A 2KDBA 2LUMA 2KQ4X 3A4SC 1IBXB 1GAQB 1WGHA 3MHSD 5J18A 4HPPA 4PK1A 2IBIB 2CHZA 2BS3B 2J42A 2YEPF 3PRMB 2H89B 5AZHA 4FXCA 4ANUA 2JYEA 3SU8X 2CJNA 3BVMA 1VJKA 2WHIA 3SDLC 3B08A 4DHJB 1HE8A 1GOZA 1UUPA 2LXCA 2L1AA 4ANVA 1MI0A 3PZ8A 5E6JA 2O6VD 4DWFA 1KLVA 1ZGUB 2EMSA 1KLUD 2GBNA 1PUTA 3Q69A 3VR9B 2C7MB 4NNJB 1TS2A 4KSKC 1V9JA 4M00A 3LDZE 2BYEA 4IWPA 1VZ8A 4MGIE 4BKGA 4QAYA 1QILA 3CF6E 2D3GA 2R61A 2BTEA 2N7EA 2PTLA 4G0NB 2V3PA 1YQ4B 1I42A 2LXAA 4AJWA 1FCLA 1QKZA 2HJ1A 4RGTA 1NEKB 2QC8A 3TMPB 1HEZE 3MC9A 5DCNA 1YJ1A 4FN2A 4BAXA 3IAM1 1IYFA 1WF9A 3N32A 1V5TA 4KZCA 2WP9B 3GZNI 4HEA1 1NBFC 1TIFA 2JWZA 5E6NA 3UQBA 2NMQA 1UNSA 2IZVB 5H92C 2Z59B 2KJHB 2N1WA 2DWQA 1I4HA 2AWTA 3APCA 4F8CB 5BMHA 3NVYA 4MGKE 3ENEA 4A90A 3VRBB 2L76A 3GE8C 2NR2A 3T3NA 1V1PA 4GU2A 3DHGC 3LYYA 3L4PA 3RFZB 1FXIA 3V6CB 1JWMD 3RYTA 1E7UA 2KN4A 2WX0A 4ANXA 2IDYA 3C0RB 3MC8A 4HCPB 4RM8A 3U2SC 3B2FA 3RZFA 4W9IA 2KMMA 1E90A 2CU1A 1JCKB 2EELA 3I63C 3AH7A 1ZOYB 3V3XA 4JWUC 2UYZB 3PRPB 1WGGA 3P4RB 1FCCC 2HE7A 2MP2A 5C1ZA 3M3JA 2N9KA 1NI2A 2LVOA 3L17A 5AUIA 4XE0A 4IWOA 4RM9A 2L0TA 3APDA 4EUTA 3A9JA 3LB8C 4YSXB 2UWQA 4GSWA 3PS6A 3GE3C 1YQ3B 3AEGB 2RR9A 1EWYC 4M0WA 1KTKA 1YD8U 4ZDVA 3WCQA 2XK5B 4WWPA 4DHZB 2XK5A 1I4XA 3DWMA 2FIFA 2PE9A 2BYFA 5IN7A 4ZRQA 3TEYA 3CSFA 4P1BC 3IG3A 3U7ZA 4W9HA 5BMIA 4I6PA 2LI5A 3NOBA 5IOIA 3BWUD 1C77A 2AQ3B 1WMHA 4LDTD 3O65B 2CS4A 1MPEA 4LNKA 4KSLC 2DZIA 3VTWA 2MP2B 1ZDVA 4MELA 3P63A 2Y3AA 4EE2A 5GMVA 1XF5L 2J7QB 3N30A 1MHXA 1TBEA 2KVZA 4ANWA 1Q1OA 2G4DB 4WH4A 3X23A 1EUVB 4EEWA 4I6NB 3A1QB 3VRAB 1QLBB 4B95A 2BS4B 2AL3A 1YN3A 3L16A 2BVCA 4HVBA 2IO1B 4YTNB 2GBRA 1P1AA 1V81A 1XLOA 3PGEA 2EKEC 2IPKD 3QC8B 2K6DB 3VFKA 3TEXA 1J7CA 2KNBA 3PV1A 2DZMA 1N5XA 1TKGA 2WX1A 5AEKB 1S1QB 4HPLB 3BIID 3GOEA 3W1SA 1JRPA 3FILB 1J7BA 3NRZA 3CSTA 1FD6A 3A9KA 3TL5A 1WSPA 3WAOA 2NVUI 2JZZA 1VR9A 2RDHA 5LXIB 1C4PA 2PLPA 2GRIA 1UELA 3Q14C 4IDIA 2K1FA 2JPHA 3Q6BA 2SAKA 3Q8AA 3NG0A 2BKFA 1WZ3A 3AE9B 4G11A 1LXDA 1P7EA 1SBBB 1RM6C 3RN9C 1UBIA 1E7PB 4KZ0A 3H8HA 3NHEB 4ARCA 2DHZA 3ETRA 3N1YC 1P3QU 2W82A 4W9KA 2PPHA 1TZOA 2N7JA 3WA0A 1GB4A 2JVCA 2ZPYA 2KDIA 1C4AA 4DK5A 3WIMA 3W2DA 1GC6A 3N1XC 4XDCA
chains in the Genus database with same CATH topology
3NS1A 2PVGC 2EKIA 4RH6A 1JROA 2K0PA 1FM0D 1FNUA 2WXPA 4YWGG 1GB1A 1NI3A 2JXTA 1SJED 2PW9A 5T8IA 4R3DA 3BYYB 2WDRB 3LXFA 2DBYA 3AE4B 1K51A 3CIRB 1VRAB 1ZDXA 3I57A 4PT5A 1OQRA 3AE5B 4HJGE 1IGCA 2BB6A 2WXQA 3TUOA 2JWUA 4O1NA 5FK9C 4IKGA 4UDUC 1M4VA 1KF6B 1N61A 1F2RI 3AEEB 3O13A 2PMVA 4RFBA 1XLNA 3ZJTA 3VQIA 2M56B 1ZXHA 2L52A 2PIAA 1VZ6A 1EWCA 3U52E 4L1BA 3BVZA 1AN8A 4DXFA 1FIQA 2NTSA 3SEBA 4RF1A 1YN5A 4C56C 2J4XA 4NAMA 2QMTA 3R8BA 3ZJVA 2WU2B 1WWTA 1WRIA 2V3NA 3AEDB 2I2YA 2GI9A 2LHDA 2BW2A 2WU5B 3OWEB 4KKIA 2N9LA 4XWTA 3T3OA 1NYQA 3BK2A 4AQ7A 4ZHPA 1KRHA 2BYTA 4WIPA 1QF6A 2M0AA 3Q8BA 4KX6B 2OEDA 2LHEA 3UI3A 1JWSD 3FC4A 1SIJA 4TSSA 1AYFA 2ONQA 3ZYYX 2PKOA 1ESFA 1V1PB 1TS5A 4WWMA 2FUG1 2HDEA 4OZCA 4H2AA 1LO5D 3AN1A 3AE6B 4YT0B 2JX5A 1T6BX 3P4QB 3GP7A 1SF0A 2NTTA 1MVKA 1DOYA 2E6XA 1L0VB 2OHFA 3ABVB 2BS2B 3NZ3A 1N5WA 1JWBD 3HUIA 2M19A 1FEHA 2BB5A 1JW9D 1SB3C 1QOAA 4LTUA 4RGOS 2LFIA 1L6UA 3P4SB 4N6EB 2QEJC 3AMZA 1D4BA 1NENB 4US9A 4ARIA 1BUIC 3NUHB 3KWLA 3VR8B 1I4GA 5C2TB 1D5ZC 2ON8A 1E10A 1PGBA 2I38A 2DYOA 1PGAA 3AB5A 2LUMA 4D2KA 4YXDB 2WXGA 2KQ4X 4GDLB 3FAHA 5AUKA 1EU4A 2KWDA 1BXTA 1IBXB 1GAQB 4YTPB 3ZGZA 2AX5A 2IGDA 1ET6A 1SE4A 3AE1B 4OW0A 2BS3B 1V97A 4JE3B 2J42A 2Y5CA 4NZLB 1CQVA 2YEPF 5HG2A 2H89B 1HXYD 3R2IA 1SXTA 3P4PB 4FXCA 4US8A 2DLBA 2JYEA 4RCOA 2CJNA 1SEBD 4OHJA 3BVMA 1XCQL 2RMMA 4N59A 1VJKA 2V0GA 4YSYB 4HKZE 3NVZA 5BYRA 4WURA 2MH7A 1GOZA 1FRRA 3IXSA 1UUPA 1XXGA 1FO4A 2L1AA 2XN9C 4RGMA 2GB1A 2ACZB 1XLQA 1AWDA 1MI0A 1RWSA 1BMLC 1E6EB 1T3QA 3PZ8A 5E6JA 2K3UA 2JYTA 2K5PA 2Q5WD 5C3JB 1KLUD 5D7GA 1PUTA 4ITKA 3Q69A 3VR9B 1GPXA 2IJ0A 4IOIE 1STEA 4RF0A 5LNK1 1TS2A 2JU6X 3IT6B 1PDXA 2WXLA 4JX1C 3TEZA 1HQRD 3RPFC 2LJIA 1VZ8A 4N58A 1QILA 1N63A 1UWXA 2R61A 2BTEA 4REZA 4MM3B 1VLBA 2CJOA 4KKJA 2PTLA 2V3PA 1HZ6A 1TS4A 1YQ4B 1E0ZA 1JMLA 3EA6A 3EGRA 1FCLA 1QKZA 1V1OA 5I4DA 1SE3A 1EM7A 1UGJA 4RGTA 1NEKB 2INPE 1C4CA 1P7FA 1PYWD 1DOIA 2Z8LA 3P42A 1L0XB 1C79A 1HEZE 1YJJA 4NAWB 1ZPSA 4P16A 3IAM1 2WXRA 4USAA 1ZP0B 5EE1A 2WDQB 1B9RA 4L2YA 5EE0A 2W54A 3U4EG 3SFEB 3P1MA 1A70A 2WP9B 4A9AA 3Q8FA 4L23A 1CK1A 4HEA1 1SE2A 1QT9A 2QSDA 2WQYB 1R7SA 1UNSA 2NMQA 5H92C 3HVZA 5D3DA 1ZE3D 3KWVA 1TY0A 2DWQA 1I4HA 3AEAB 1JWAD 3GB1A 4GDKB 2KDMA 2AQ1B 4DXGA 2J52A 2DYMA 1I7HA 3W9CB 2RDGA 3NVYA 5BMHA 5FR3A 1KFYB 2LGIA 2WLBA 1ENFA 1RFKA 1QOFA 2WXIA 4A90A 1FFUA 2VZKB 3CWIA 3VRBB 3DWGC 4RNAA 4XWWA 2J53A 3ZQ4A 3T3NA 1V1PA 1C76A 3LYYA 3L4PA 3RFZB 1FXIA 4TQ1A 1JWMD 3AM9A 1FFVA 1CZPA 2KN4A 2IDYA 2SEBD 3URYA 1HZ5A 2G9HD 3PO0A 4AS1A 1F2RC 4XDDA 3AEBB 1EU3A 3MC0B 3U2SC 3MFGA 3B2FA 1L0YB 2TSSA 2KMMA 3BVGA 2EELA 1JCKB 1V8CA 2Y5PA 3AH7A 1ZOYB 1C78A 3V3XA 2QILA 4JWUC 1K53A 2N0SB 3R2TA 3ZJUA 3W5UB 1WYGA 3P4RB 1SJHD 2CU3A 1FCCC 1TY2A 2K22A 1FNWA 2N9KA 1WGKA 1FNVA 2BT6A 5AUIA 1ZXIA 5BYSA 1JWUD 4XE0A 1D5XC 4A55A 1TJEA 1QOGA 3KQ4A 4YSZB 3FILA 4JWSC 4ZOHC 1Y56A 5GXGB 3MHZA 3LB8C 4YSXB 5EE9A 3IAS1 2WNMA 1YQ3B 3NVVA 1N62A 3AEGB 2IGHA 1EWYC 4M0WA 2W3SA 1KTKA 5BYQA 5G5HA 2H88B 5MPOA 1XCTL 5TSSA 3WCQA 1D6EC 4HRSA 1ACCA 2YEPB 1IBXA 2JZPA 3N9YC 4NJCA 1I4XA 3DWMA 2JSVX 4MH8A 3HRDD 1YJIA 3AE2B 2WXJA 4ZRQA 1DGJA 1I4RA 3TEYA 1YNTE 1I4QA 1HA5A 2V4IB 1K50A 5HFYA 3U7ZA 5BMIA 2INNE 3EUB2 3BWUD 3IT4B 3TSSA 1YMHE 1C77A 2MJ3A 2AQ3B 1TKYA 1WXQA 2AQ2B 2WXKA 2FBWB 1NVID 1MPEA 2BBCA 3V05A 2FE8A 1C9FA 2WXOA 2MJDA 1ZDVA 1OQQA 2E3TA 4MACA 2MEKA 4TQ0A 3P63A 2Y3AA 4EE2A 3MP9A 2WXNA 1XF5L 2WDVB 4KGTA 1MHHE 3AE7B 4A8XC 3B9JA 1MHXA 1PGXA 4RGNA 5D3IB 4P6VF 1OFFA 2QJLA 3E56A 4Q2JA 2WXFA 3BYTB 1T5XD 4KGSA 2WXHA 4WH4A 4HKQA 5HHDG 1D5MC 3VRAB 3W5VB 1QLBB 2BS4B 1I4PA 1YN3A 1L4DB 1YN4A 4MT5A 1RYJA 2KACA 1DYQA 3J9CA 3PZ7A 1KLGD 2K9XA 5BMGA 4WQMA 1F0ZA 4YTNB 4LLGM 1XLOA 1IUEA 1TYGB 1PFDA 2IPKD 2WXMA 1KH0A 1SSNA 2G1EA 4C7YA 4GLSC 3TEXA 1UWMA 1N60A 3AE3B 1J7CA 1ROEA 3AECB 4ZYSA 1L6VA 2ZW1A 1IGDA 1XEEA 2PVOD 5EE3A 3SR6A 3AEFB 1N5XA 4J3OD 1VDVA 1TKGA 1XLPA 3BIID 3W1SA 1JRPA 3FILB 1J7BA 3NRZA 4DQOC 1FD6A 3Q8CA 5JXVA 1J7AA 1WSPA 4A6QA 3TEWA 4OVZA 1ET9A 3Q8EA 3BK1A 1CJEA 1VR9A 1JALA 2RDHA 2KAJA 2LMCA 4ZHOA 2ZW0A 3NVWA 4CQNA 1C4PA 4WAFA 2WS3B 1AW7A 1F77A 2PLPA 1Q10A 1DOXA 2VZKD 2HTME 2GRIA 4C7ZA 2JQRB 2W3RA 2B76B 2X38A 4TMAB 4B0MA 1QOBA 3E9SA 1XO3A 3HVDA 4B0EA 1VZ7A 3C8YA 1K52A 4IDIA 1NYRA 4JPSA 1L5PA 4HROA 2D5GA 1L4ZB 2SAKA 2QIEB 3Q8AA 1ZUD2 1JQ4A 2LEKA 1FXAA 3AE9B 1P7EA 3BZDB 3MJ5A 4KGRA 4OZBA 2L83A 4OZAA 1SBBB 1RM6C 5FKAC 5H8YE 1E7PB 1TKEA 3I9V1 2RPVA 3KLSX 4YTMB 3GS2A 2L32A 5G5GA 5HI1A 3H8HA 4ARCA 3ETRA 1FMAD 4LK0M 3SFDB 2W82A 3AE8B 1TZOA 2N7JA 1E9MA 1FRDA 1B1ZA 2XNAC 1TS3A 2ICIA 2MJEA 1GB4A 3AV8A 2IGGA 1C4AA 4C80A 4ZRPA 3W2DA 1QQRA 3B2GA 2W55A 4XDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SAK A;  1C79 A;  1C76 A;  1C77 A;  1BUI C;  1C78 A;  1SSN A; 
#chains in the Genus database with same CATH topology
 1R4N B;  1R4M B;  1CMX B;  1JRO A;  2K0P A;  3JYU A;  4YWG G;  1GB1 A;  5T8I A;  2PW9 A;  5JZE B;  2M17 A;  4LJP B;  3BYY B;  3EHV A;  3LXF A;  1PQS A;  2MBQ A;  4LDT B;  4GGQ A;  5AZG A;  1LM8 B;  1WR1 A;  2KTR A;  1IGC A;  1SGH A;  2JWU A;  3BY4 B;  3FKY A;  3QWZ B;  4MEM A;  4UDU C;  2C60 A;  1N61 A;  1RAX A;  3ZDM C;  3ZJT A;  2PMV A;  1ZXH A;  2GBJ A;  3ML8 A;  3BVZ A;  5CX3 A;  2QCZ A;  3QCA A;  3R8B A;  3ZJV A;  3DPD A;  2V3N A;  1WRI A;  4K3B A;  3AED B;  2WU5 B;  2LHD A;  3VH3 B;  1IP9 A;  2N9L A;  3DCG A;  3BK2 A;  5G2N A;  4AQ7 A;  4ZHP A;  4MGZ E;  4IC7 B;  4WIP A;  3KUZ A;  4KX6 B;  2JXX A;  3K9O B;  1JWS D;  1SIJ A;  2FCN A;  2HJ8 A;  2VRR B;  2PKO A;  1LO5 D;  4M8N A;  3DVG Y;  4BVU C;  1T6B X;  3RUL A;  1SIF A;  2K8B A;  1L0V B;  2OHF A;  1P9D U;  3QK0 A;  1JW9 D;  4LTU A;  2KVR A;  2DYB A;  1L6U A;  3P4S B;  2QEJ C;  4C4V B;  1NEN B;  4US9 A;  4EZJ A;  2QHO A;  2INC C;  2LGY A;  3N3K B;  3ECI A;  3QA8 A;  3RNA C;  4GXB A;  2KC1 A;  1F1H A;  2DYO A;  5CHF A;  3AB5 A;  3ZNH B;  4J6I A;  2WXG A;  3FAH A;  5AUK A;  2KWD A;  3PHX B;  3L10 B;  2KLC A;  3ZGZ A;  2KXJ A;  2AX5 A;  2IGD A;  3ZNG C;  2KWU B;  2KWV B;  2KC2 A;  4FHJ A;  1MJD A;  2KMC A;  4M01 A;  1LFD A;  3L13 A;  3P4P B;  3R2I A;  2IND C;  4US8 A;  2DLB A;  4KVG B;  1SEB D;  1MFW A;  2V0G A;  4JLC A;  4YSY B;  2N4F A;  3NVZ A;  3A9K B;  4RGM A;  2GB1 A;  1XLQ A;  1AWD A;  4PS8 A;  1RWS A;  1T3Q A;  4WJP A;  2KYW A;  2K3U A;  2MBB B;  2JYT A;  5C3J B;  4DDG D;  2NBU A;  3DOW A;  2DAJ A;  3Q2A C;  2IJ0 A;  1STE A;  2LVP A;  4RF0 A;  3RNF C;  2JU6 X;  3HM6 X;  3I3T B;  3JSV A;  1U4A A;  2HTH A;  3KUD B;  4HLE A;  2V4L A;  4EZL A;  2BF8 B;  4II3 B;  1UWX A;  3ALB A;  4MM3 B;  4IM3 A;  4KKJ A;  1ISN A;  4KDL B;  3DDC B;  1TS4 A;  1JML A;  3EA6 A;  2FID A;  1SE3 A;  1YX5 B;  2Z8L A;  2CHW A;  1UH6 A;  3P42 A;  2LGD A;  3M95 A;  3DBR B;  4G50 A;  5EE1 A;  4USA A;  1H8C A;  1B9R A;  1OEY J;  2JF5 A;  1WGY A;  3AU4 A;  2W54 A;  5C23 A;  3D32 A;  3SFE B;  1NDD A;  4FUL A;  1TT5 B;  5CTR C;  3PZD A;  4C4V A;  4ZYN A;  2K25 A;  2G4S A;  3ZTD A;  5D3D A;  1WX8 A;  1ZE3 D;  1XQQ A;  4DXA B;  3AEA B;  4F7Z A;  4IUM B;  4GDK B;  2KDM A;  3A9J B;  3UIN B;  3WAM A;  4DXG A;  2LRU A;  2J52 A;  2DYM A;  2RDG A;  3N1Z C;  4W9L A;  2WXI A;  2VZK B;  3CWI A;  4RNA A;  1V86 A;  1I35 A;  3A1Q A;  2DEN B;  4KDI C;  3ZQ4 A;  4AP4 C;  3AM9 A;  1WJ6 A;  2SEB D;  2BWE S;  2N1V A;  1HZ5 A;  4XDD A;  4FJY A;  3MC0 B;  1L0Y B;  2I1J A;  3BVG A;  1KOT A;  4IW0 A;  2W9N A;  1K53 A;  3R2T A;  2L7R A;  2RSU A;  3W5U B;  1WYG A;  1S3S G;  4W9E A;  3SD5 A;  4EFO A;  5BYS A;  1JWU D;  4A55 A;  2GBM A;  1TJE A;  3ML9 A;  3JVZ X;  1R4N I;  3KQ4 A;  4P7I A;  4HPM B;  2KKC A;  3IAS 1;  2WNM A;  1N62 A;  2W3S A;  3PTF C;  5J17 A;  4YL8 A;  1K8R B;  1UZX B;  4NPN A;  2WGS A;  1QZE A;  3VTV A;  4NJC A;  4MH8 A;  1YJI A;  2WXJ A;  4N9F 4;  1YNT E;  2V4I B;  1K50 A;  3EEC A;  3NZS A;  2INN E;  3IT4 B;  3TSS A;  2MJ3 A;  4DHJ D;  1HTQ A;  1WXQ A;  1NVI D;  2KN5 A;  4BZA A;  2FE8 A;  2WXO A;  2MJD A;  3TCA A;  3VXW A;  5D94 A;  2N9P C;  4K7S A;  5JH5 C;  1OQQ A;  4MAC A;  2MEK A;  3RNG C;  5KHO A;  2WXN A;  2WDV B;  1MHH E;  3AE7 B;  4A8X C;  2MBH A;  3B9J A;  4RGN A;  5J2R A;  4P6V F;  4DHZ E;  3H9D A;  4IM2 A;  4Q2J A;  4B6W A;  3S2A A;  3BYT B;  3U30 A;  1WE6 A;  4HKQ A;  2DZK A;  3W5V B;  4AUQ C;  2JT4 B;  2MSE D;  1JRU A;  1L4D B;  4MT5 A;  3ZDT A;  1EO6 A;  2KAC A;  4M02 A;  1KLG D;  4WQM A;  1F0Z A;  4LLG M;  2ZZP B;  2NS5 A;  4IM0 A;  4WWN A;  2WXM A;  3RNE C;  3DHH C;  2G1E A;  4C7Y A;  3VTU A;  3ZNZ B;  3VH4 B;  1ROE A;  2FCS A;  2KQS A;  1L6V A;  3MJW A;  3NZU A;  1IGD A;  1XEE A;  4MGY E;  4J3O D;  1VDV A;  2O6V B;  2FUH B;  2BGF A;  4W9C A;  4BKT A;  4DQO C;  3Q8C A;  1J7A A;  3TEW A;  4OVZ A;  2M1M A;  3PRE A;  2B3A A;  1ET9 A;  3Q8E A;  1OTR B;  1X1M A;  2MHJ A;  3BK1 A;  4ACF A;  1JAL A;  3NVW A;  2C7H A;  3RNC C;  4CQN A;  2WS3 B;  4URK A;  4HDQ A;  1Q10 A;  2KD0 A;  3EC8 A;  2HTM E;  2D2Q A;  2REX A;  2JQR B;  2MLB A;  4TMA B;  1VZ7 A;  4HRO A;  1L4Z B;  1ZW7 A;  2GBK A;  2OJW A;  2RPQ A;  5IA7 A;  3MJ5 A;  4KGR A;  5CHW A;  4OZA A;  2LUE A;  3GS2 A;  2L32 A;  4FJZ A;  5G5G A;  4XZ4 A;  3SFD B;  3W1S C;  1KJT A;  4FA6 A;  2X8X X;  3ZRF A;  1FRD A;  2XNA C;  2KZR A;  3DBS A;  2NBW B;  4C80 A;  4ZRP A;  3B2G A;  1ZKH A;  2M8S A;  4S17 A;  1WM3 A;  4LJO B;  3BIN A;  1NI3 A;  1SJE D;  2KJ6 A;  3DVN U;  2C5L C;  2WDR B;  2BWF A;  2K8H A;  2I1K A;  2PEA A;  3AE4 B;  1K51 A;  3CIR B;  1VRA B;  1ZDX A;  3DHI C;  3IFW B;  2BB6 A;  2ZVO A;  3RI7 C;  2NPT A;  3UIP B;  1XLN A;  4X57 B;  3UQA A;  2PIA A;  2V1Y A;  1EWC A;  3UGB B;  1V6E A;  3U52 E;  2NTS A;  3SEB A;  2WU2 B;  4GOC A;  4XX5 A;  2UU7 A;  2MCN B;  1KRH A;  2BYT A;  1L2N A;  1TTN A;  2M0A A;  3DBH I;  2LHE A;  3UI3 A;  3FC4 A;  4E3C A;  2ONQ A;  3PHW B;  1ESF A;  1V1P B;  3QAQ A;  1TS5 A;  3DVG X;  4YT0 B;  3ZXV A;  1WFY A;  2BS2 B;  1N5W A;  3NZ3 A;  1HTO A;  1JWB D;  1FEH A;  2JZ3 B;  2KAN A;  4GMV A;  2KX0 A;  4RGO S;  3ZLZ A;  2IYD B;  3H7P B;  3R3M A;  1E5W A;  1BT0 A;  4A20 A;  1I4G A;  2VH1 A;  2L3Z A;  4PYU A;  3EFC A;  3VDZ A;  3DBL I;  4GDK A;  4D2K A;  4RMA A;  1N6Z A;  2ASQ A;  4YTP B;  4MJS A;  1SE4 A;  4OW0 A;  2IO2 B;  4JE3 B;  3DBL B;  2AYO B;  3QX1 A;  3RZW C;  2K8C A;  5HG2 A;  1E7V A;  2IY1 B;  3HK0 A;  1V5O A;  1LQB A;  3LJ3 A;  1SXT A;  5D2M B;  4RCO A;  1XCQ L;  4N59 A;  1WR6 E;  1YIW A;  3HM3 A;  5BYR A;  1WX7 A;  4WUR A;  2MH7 A;  2MQJ A;  1XXG A;  1FO4 A;  3VUW A;  2Q5W D;  4ZRK A;  3C19 A;  4ITK A;  1GPX A;  4IOI E;  4K81 A;  1WGD A;  1PDX A;  4JX1 C;  4WJQ A;  1HQR D;  1F9J A;  2LJI A;  1T0Q C;  1N63 A;  4REZ A;  1VLB A;  3UIO B;  3DBH B;  4K7U A;  3APF A;  1HZ6 A;  1E0Z A;  3ZXR A;  1V1O A;  2HD5 B;  1UGJ A;  5I4D A;  5DPW A;  3M62 B;  2INP E;  1C4C A;  1WRD B;  1ZPS A;  2KFJ A;  5EE0 A;  3U4E G;  1A70 A;  4LNO A;  2FCM A;  4KIK A;  3Q8F A;  4L23 A;  1Y8R C;  1SE2 A;  3B0A A;  1R7S A;  3HVZ A;  1TY0 A;  4MJS B;  4DBG A;  2AQ1 B;  3WAP A;  3W9C B;  3RUI B;  5FR3 A;  1KFY B;  2WLB A;  3DWG C;  2IY0 B;  2MWS B;  2N7D A;  2KX3 A;  3PRZ A;  5DPR A;  3HHM A;  5TR5 A;  4TQ1 A;  3ZIM A;  4BOZ B;  3URY A;  4IG7 B;  3PO0 A;  2G9H D;  3PVL A;  4AS1 A;  1P98 A;  4EKU A;  3MFG A;  1T0R C;  2Y5P A;  2VH2 A;  4FJV B;  2C9W B;  2N0S B;  5IAA C;  3ZJU A;  1SJH D;  2OJR A;  1WYW B;  1FNW A;  2L8J A;  1WGK A;  3OG5 A;  2BT6 A;  3IHP C;  1WXA A;  1TZ1 A;  4YSZ B;  3FIL A;  4JWS C;  4ZOH C;  1Y56 A;  3MHZ A;  2ZCB A;  2BKR B;  3NVV A;  2IGH A;  1WIA A;  2JRH A;  4PS7 A;  5BYQ A;  5G5H A;  2N9E B;  5LLI A;  5MPO A;  5TSS A;  1IPG A;  3KW5 B;  1ACC A;  2RDB C;  2ZNV C;  4HK2 A;  2JZP A;  2JSV X;  3HRD D;  1H4R A;  2KFK A;  4MH0 E;  3Q3O C;  4KV2 A;  2KLG A;  3VAW A;  1DGJ A;  1I4R A;  5IO9 A;  2KT7 A;  1I4Q A;  1HA5 A;  1A5R A;  2L0F A;  3TBL D;  2QDF A;  1YMH E;  2AQ2 B;  3V05 A;  4W9D A;  3EFU A;  3KYC D;  1C9F A;  4JGH B;  3P2B A;  3V6E B;  4ZRJ A;  2BPS A;  4HJK A;  2E3T A;  4TQ0 A;  3WAN A;  1GC7 A;  4LNN A;  4KGT A;  1PGX A;  5D3I B;  4E74 A;  1OFF A;  2LWP A;  3PLV A;  2PE6 B;  2WXF A;  1T5X D;  1LGR A;  4KGS A;  4LNF A;  2MA9 B;  1D5M C;  1YN4 A;  2MW5 A;  3T8M A;  1IUE A;  1KH0 A;  4KIK B;  2G45 B;  4HDO A;  4XYC A;  1N60 A;  3AE3 B;  3AEC B;  4BKS A;  4ZYS A;  2ZVN A;  1WMH B;  2PVO D;  5EE3 A;  3R66 C;  1XLP A;  1C3T A;  4A6Q A;  5CHV C;  4C00 A;  1CJE A;  2KAJ A;  4ZHO A;  4A3O A;  3RMK C;  2NBV B;  4TV3 A;  1F77 A;  3K9P B;  1VD2 A;  2VZK D;  2R2O A;  2ZEQ A;  3ZRC A;  1DOX A;  2W3R A;  2B76 B;  2X38 A;  4B0M A;  1QOB A;  3HVD A;  1XO3 A;  4B0E A;  4JPS A;  2ZPN A;  1NYR A;  2D5G A;  4G3X B;  1ZUD 2;  3A4R A;  4AJY B;  1JQ4 A;  1FXA A;  2D07 B;  4FHK A;  4OZB A;  1UF0 A;  2L83 A;  5H8Y E;  5FKA C;  3I9V 1;  3KLS X;  2RPV A;  4YTM B;  3V60 A;  1WI0 A;  5HI1 A;  1KM7 A;  2MBE A;  5IP4 D;  4ICV A;  3AE8 B;  1E9M A;  1B1Z A;  4GDL A;  1TS3 A;  2G3Q B;  2ICI A;  2L00 B;  2Z0E B;  1OGW A;  3Q3F A;  2XEW A;  1GUA B;  2KDF B;  2RD0 A;  1YOV B;  2W55 A;  1Z5S B;  4GB9 A;  3TIX A;  3NS1 A;  1L7Y A;  2EKI A;  1V49 A;  4RH6 A;  1P0R A;  1FNU A;  2WXP A;  2JXT A;  3DVN V;  4BBN C;  2J0J A;  3ZTC A;  1FPY A;  4HJG E;  2WXQ A;  2L05 A;  4FBJ B;  3B1L X;  4IKG A;  1M4V A;  1EF1 A;  1UBQ A;  3AXC A;  1KF6 B;  2D10 A;  2ZJD A;  1F2R I;  4RFB A;  3VQI A;  2M56 B;  3I5J C;  3HIZ A;  1AN8 A;  2KO3 A;  2A5U A;  1FIQ A;  1YN5 A;  2J4X A;  4NAM A;  3DBR I;  1WM2 A;  3KH0 A;  3H6N A;  4GN1 A;  4KKI A;  4CO7 A;  5BO4 B;  1NYQ A;  5AZF A;  3H7S A;  1QF6 A;  1E8Y A;  3ZNI D;  3JSV B;  5G55 A;  3Q8B A;  2ZCC A;  4WJO A;  3ZYY X;  2KTR B;  4WWM A;  4P1C C;  2FUG 1;  2HDE A;  4M8M A;  4H2A A;  3AN1 A;  1WY8 A;  3AE6 B;  2J0M A;  2DX5 B;  3GP7 A;  2DZJ A;  2NTT A;  4OVU A;  1DOY A;  3ABV B;  2FAZ A;  2MRP A;  2M19 A;  3QQ8 B;  4MSM B;  4ICU A;  2LFI A;  4N6E B;  2KJR A;  3VHT C;  2WDT B;  3VUY A;  3AMZ A;  1D4B A;  4ARI A;  3ZW3 A;  1BUI C;  3QJZ A;  3KWL A;  2OOB B;  3VR8 B;  4GIV A;  3N20 C;  1WXM A;  5C2T B;  1D5Z C;  2ON8 A;  1E10 A;  1PGB A;  4XC2 A;  3AU5 A;  1PGA A;  2FCQ A;  4YXD B;  1GNU A;  4GDL B;  1EU4 A;  2PJH A;  2M0X A;  1BXT A;  4FAD A;  4MDK E;  2KQ7 A;  5JHB A;  4NQK E;  1ET6 A;  3AE1 B;  1V97 A;  2BQQ A;  2Y5C A;  4NZL B;  2O2V A;  1CQV A;  4NQL B;  4OVV A;  1HXY D;  1G6J A;  4TUU A;  2JUO A;  4OHJ A;  3Q3M C;  1E8Z A;  2RMM A;  3X0W A;  1XD3 B;  4HKZ E;  1M94 A;  1FRR A;  3IXS A;  5L95 C;  2XN9 C;  2BYV E;  3PLU A;  2ACZ B;  3UF8 A;  3T9L A;  1BML C;  1E6E B;  2K5P A;  5D7G A;  1Q5W B;  5LNK 1;  1E8W A;  4MM3 A;  3IT6 B;  2D11 A;  1XT9 B;  2WXL A;  2GMI C;  3TEZ A;  3RPF C;  4N58 A;  2CKH B;  2IO3 B;  2A4Z A;  2CJO A;  3QIJ A;  4K1R B;  2KDE B;  3EGR A;  3Q3J A;  1EM7 A;  1PYW D;  1P7F A;  1DOI A;  1L0X B;  1C79 A;  1YJJ A;  4K3C A;  4NAW B;  4P16 A;  2WXR A;  1ZP0 B;  2WDQ B;  3TJP A;  4L2Y A;  3PT2 B;  3P1M A;  1MG4 A;  1OEY A;  2LVQ A;  4K7W A;  4LCD E;  4A9A A;  3ZO5 B;  4I6L B;  2CR5 A;  1CK1 A;  5HKH A;  1RFA A;  1QT9 A;  4W9G A;  1WJN A;  2QSD A;  2WQY B;  3KWV A;  1JWA D;  3GB1 A;  1RRB A;  4HXD A;  1I7H A;  2LGI A;  4ASW C;  1ENF A;  4NJ6 A;  1RFK A;  1QOF A;  1FFU A;  2LZ6 A;  4XWW A;  2J53 A;  3U7D A;  1C76 A;  1GJZ A;  2GLS A;  5EDS A;  3L0W B;  3PSE B;  1FFV A;  3A33 B;  1CZP A;  1WH3 A;  2K6Q A;  5LXH A;  3ONS A;  1F2R C;  1RLF A;  3AEB B;  1J8C A;  1EU3 A;  2TSS A;  1WXV A;  1V8C A;  3OLM D;  1C78 A;  2QIL A;  4LNI A;  1VCB A;  2CU3 A;  4WJN A;  1TY2 A;  2K22 A;  4HWI B;  1FNV A;  4CHK A;  1ZXI A;  1D5X C;  1E8X A;  1QOG A;  2AL6 A;  3ZKJ C;  5GXG B;  5EE9 A;  3NJT A;  3RNB C;  4HCN B;  2LRW A;  3IBE A;  2H88 B;  1XCT L;  3V61 A;  1D6E C;  4HRS A;  5L83 A;  2YEP B;  1IBX A;  3N9Y C;  4M0W B;  1WZ0 A;  4PS3 A;  2V9H A;  4II2 B;  3AE2 B;  1EF5 A;  3JW0 X;  5HFY A;  3EUB 2;  1FXT B;  2NCN A;  4BBN F;  1TKY A;  2LAS A;  2WXK A;  2FBW B;  1D3Z A;  3Q3N C;  2BBC A;  4W9F A;  4FLH A;  3NY5 A;  1GG3 A;  4F1S A;  4BOS C;  4E71 A;  2O6V A;  3MP9 A;  3QAR A;  3QHT A;  3DQV A;  4NJ7 A;  2R2Q A;  3CMM B;  1TGZ B;  1WGR A;  4ZRI A;  3KYD D;  2QJL A;  3E56 A;  2KMA A;  3V62 A;  1WJU A;  2WXH A;  4W9J A;  5HHD G;  2Z0D B;  1I4P A;  3SHQ A;  3L54 A;  1RYJ A;  1DYQ A;  3J9C A;  3PZ7 A;  2K9X A;  5BMG A;  4JL9 A;  3ZUN A;  3R7Q A;  2RGF A;  2NPT B;  1OQY A;  4S0R A;  1TYG B;  1PFD A;  1SSN A;  2KFK B;  1V2Y A;  2Y5B B;  4GLS C;  1UWM A;  4AOF A;  3OJ3 A;  2ZW1 A;  4NAW A;  3SR6 A;  1YQB A;  2KTF A;  3AEF B;  1UD7 A;  1AAR A;  3RT3 B;  5JHA A;  5JXV A;  2KWC A;  2KK8 A;  2LMC A;  4B9K A;  2ZW0 A;  2D3C A;  1WE7 A;  2MBO A;  4WAF A;  1AW7 A;  3KVF B;  3VUX A;  4C7Z A;  1J0G A;  3E9S A;  3C8Y A;  1K52 A;  3AUL A;  1L5P A;  2QIE B;  3WAL A;  2LEK A;  1J19 A;  3RCZ A;  2KOX A;  3BZD B;  4TKN A;  2KHW B;  1TKE A;  3H1U A;  2YVC A;  1FMA D;  4LK0 M;  2CHX A;  2GOW A;  4IWQ A;  2MJE A;  4EOY A;  4DDI D;  3AV8 A;  2IGG A;  5IKC M;  1QQR A;  2V3S A;  4C56 C;  4A3P A;  4WQO B;  2AEH A;  2PVG C;  5FR6 A;  3W1Y A;  1FM0 D;  2WYQ A;  4AWJ A;  4R3D A;  3NS8 A;  4WAA A;  4WWO A;  4BKS D;  2DBY A;  2M4N A;  3PPA A;  3M63 B;  3I57 A;  4PT5 A;  4EZK A;  1OQR A;  3AE5 B;  3TUO A;  2IO0 B;  3OAW A;  1MG8 A;  1C1Y B;  4O1N A;  5FK9 C;  4JQW C;  3O13 A;  3AEE B;  3GZN B;  2L52 A;  2YLM A;  2ZNV B;  1VZ6 A;  2DNF A;  4L1B A;  5E6O A;  2LGS A;  1SE9 A;  4DXF A;  3MTN B;  4JIO U;  4RF1 A;  2QMT A;  3H7P A;  1WWT A;  2I2Y A;  2GI9 A;  2BW2 A;  2C7N B;  2K39 A;  3OWE B;  4XWT A;  3T3O A;  1V80 A;  5KHQ A;  1WX9 A;  2JRI B;  4NY0 A;  2OED A;  1YX6 B;  5E6P A;  1F52 A;  4TSS A;  5DPT A;  3R7R A;  1AYF A;  2JY6 A;  1T0S C;  2DAF A;  1WJ4 A;  3U8Z A;  4OZC A;  2MX2 A;  2FNJ B;  3IVF A;  3OJ4 B;  1R4M I;  2JX5 A;  2LJ5 A;  2N9X A;  3P4Q B;  3ZVV A;  1SF0 A;  5D6J B;  1MVK A;  2E6X A;  1T0Y A;  2O2V B;  2D3A A;  2XBB C;  1UGM A;  3HUI A;  2EMT A;  1Z2M A;  1SB3 C;  2BB5 A;  2J0K A;  2WWZ A;  2LGX A;  1QOA A;  4XGA B;  3RD2 A;  4CYE A;  1WXS A;  3VVW B;  3KUC B;  3NUH B;  4MSQ B;  2D3B A;  4PYZ A;  3AI5 A;  1Q0W B;  3L08 A;  2I38 A;  5DPS A;  4BFR A;  2LD9 A;  2KDB A;  2LUM A;  2KQ4 X;  3A4S C;  1IBX B;  1GAQ B;  1WGH A;  3MHS D;  5J18 A;  4HPP A;  4PK1 A;  2IBI B;  2CHZ A;  2BS3 B;  2J42 A;  2YEP F;  3PRM B;  2H89 B;  5AZH A;  4FXC A;  4ANU A;  2JYE A;  3SU8 X;  2CJN A;  3BVM A;  1VJK A;  2WHI A;  3SDL C;  3B08 A;  4DHJ B;  1HE8 A;  1GOZ A;  1UUP A;  2LXC A;  2L1A A;  4ANV A;  1MI0 A;  3PZ8 A;  5E6J A;  2O6V D;  4DWF A;  1KLV A;  1ZGU B;  2EMS A;  1KLU D;  2GBN A;  1PUT A;  3Q69 A;  3VR9 B;  2C7M B;  4NNJ B;  1TS2 A;  4KSK C;  1V9J A;  4M00 A;  3LDZ E;  2BYE A;  4IWP A;  1VZ8 A;  4MGI E;  4BKG A;  4QAY A;  1QIL A;  3CF6 E;  2D3G A;  2R61 A;  2BTE A;  2N7E A;  2PTL A;  4G0N B;  2V3P A;  1YQ4 B;  1I42 A;  2LXA A;  4AJW A;  1FCL A;  1QKZ A;  2HJ1 A;  4RGT A;  1NEK B;  2QC8 A;  3TMP B;  1HEZ E;  3MC9 A;  5DCN A;  1YJ1 A;  4FN2 A;  4BAX A;  3IAM 1;  1IYF A;  1WF9 A;  3N32 A;  1V5T A;  4KZC A;  2WP9 B;  3GZN I;  4HEA 1;  1NBF C;  1TIF A;  2JWZ A;  5E6N A;  3UQB A;  2NMQ A;  1UNS A;  2IZV B;  5H92 C;  2Z59 B;  2KJH B;  2N1W A;  2DWQ A;  1I4H A;  2AWT A;  3APC A;  4F8C B;  5BMH A;  3NVY A;  4MGK E;  3ENE A;  4A90 A;  3VRB B;  2L76 A;  3GE8 C;  2NR2 A;  3T3N A;  1V1P A;  4GU2 A;  3DHG C;  3LYY A;  3L4P A;  3RFZ B;  1FXI A;  3V6C B;  1JWM D;  3RYT A;  1E7U A;  2KN4 A;  2WX0 A;  4ANX A;  2IDY A;  3C0R B;  3MC8 A;  4HCP B;  4RM8 A;  3U2S C;  3B2F A;  3RZF A;  4W9I A;  2KMM A;  1E90 A;  2CU1 A;  1JCK B;  2EEL A;  3I63 C;  3AH7 A;  1ZOY B;  3V3X A;  4JWU C;  2UYZ B;  3PRP B;  1WGG A;  3P4R B;  1FCC C;  2HE7 A;  2MP2 A;  5C1Z A;  3M3J A;  2N9K A;  1NI2 A;  2LVO A;  3L17 A;  5AUI A;  4XE0 A;  4IWO A;  4RM9 A;  2L0T A;  3APD A;  4EUT A;  3A9J A;  3LB8 C;  4YSX B;  2UWQ A;  4GSW A;  3PS6 A;  3GE3 C;  1YQ3 B;  3AEG B;  2RR9 A;  1EWY C;  4M0W A;  1KTK A;  1YD8 U;  4ZDV A;  3WCQ A;  2XK5 B;  4WWP A;  4DHZ B;  2XK5 A;  1I4X A;  3DWM A;  2FIF A;  2PE9 A;  2BYF A;  5IN7 A;  4ZRQ A;  3TEY A;  3CSF A;  4P1B C;  3IG3 A;  3U7Z A;  4W9H A;  5BMI A;  4I6P A;  2LI5 A;  3NOB A;  5IOI A;  3BWU D;  1C77 A;  2AQ3 B;  1WMH A;  4LDT D;  3O65 B;  2CS4 A;  1MPE A;  4LNK A;  4KSL C;  2DZI A;  3VTW A;  2MP2 B;  1ZDV A;  4MEL A;  3P63 A;  2Y3A A;  4EE2 A;  5GMV A;  1XF5 L;  2J7Q B;  3N30 A;  1MHX A;  1TBE A;  2KVZ A;  4ANW A;  1Q1O A;  2G4D B;  4WH4 A;  3X23 A;  1EUV B;  4EEW A;  4I6N B;  3A1Q B;  3VRA B;  1QLB B;  4B95 A;  2BS4 B;  2AL3 A;  1YN3 A;  3L16 A;  2BVC A;  4HVB A;  2IO1 B;  4YTN B;  2GBR A;  1P1A A;  1V81 A;  1XLO A;  3PGE A;  2EKE C;  2IPK D;  3QC8 B;  2K6D B;  3VFK A;  3TEX A;  1J7C A;  2KNB A;  3PV1 A;  2DZM A;  1N5X A;  1TKG A;  2WX1 A;  5AEK B;  1S1Q B;  4HPL B;  3BII D;  3GOE A;  3W1S A;  1JRP A;  3FIL B;  1J7B A;  3NRZ A;  3CST A;  1FD6 A;  3A9K A;  3TL5 A;  1WSP A;  3WAO A;  2NVU I;  2JZZ A;  1VR9 A;  2RDH A;  5LXI B;  1C4P A;  2PLP A;  2GRI A;  1UEL A;  3Q14 C;  4IDI A;  2K1F A;  2JPH A;  3Q6B A;  2SAK A;  3Q8A A;  3NG0 A;  2BKF A;  1WZ3 A;  3AE9 B;  4G11 A;  1LXD A;  1P7E A;  1SBB B;  1RM6 C;  3RN9 C;  1UBI A;  1E7P B;  4KZ0 A;  3H8H A;  3NHE B;  4ARC A;  2DHZ A;  3ETR A;  3N1Y C;  1P3Q U;  2W82 A;  4W9K A;  2PPH A;  1TZO A;  2N7J A;  3WA0 A;  1GB4 A;  2JVC A;  2ZPY A;  2KDI A;  1C4A A;  4DK5 A;  3WIM A;  3W2D A;  1GC6 A;  3N1X C;  4XDC A; 
#chains in the Genus database with same CATH homology
 3NS1 A;  2PVG C;  2EKI A;  4RH6 A;  1JRO A;  2K0P A;  1FM0 D;  1FNU A;  2WXP A;  4YWG G;  1GB1 A;  1NI3 A;  2JXT A;  1SJE D;  2PW9 A;  5T8I A;  4R3D A;  3BYY B;  2WDR B;  3LXF A;  2DBY A;  3AE4 B;  1K51 A;  3CIR B;  1VRA B;  1ZDX A;  3I57 A;  4PT5 A;  1OQR A;  3AE5 B;  4HJG E;  1IGC A;  2BB6 A;  2WXQ A;  3TUO A;  2JWU A;  4O1N A;  5FK9 C;  4IKG A;  4UDU C;  1M4V A;  1KF6 B;  1N61 A;  1F2R I;  3AEE B;  3O13 A;  2PMV A;  4RFB A;  1XLN A;  3ZJT A;  3VQI A;  2M56 B;  1ZXH A;  2L52 A;  2PIA A;  1VZ6 A;  1EWC A;  3U52 E;  4L1B A;  3BVZ A;  1AN8 A;  4DXF A;  1FIQ A;  2NTS A;  3SEB A;  4RF1 A;  1YN5 A;  4C56 C;  2J4X A;  4NAM A;  2QMT A;  3R8B A;  3ZJV A;  2WU2 B;  1WWT A;  1WRI A;  2V3N A;  3AED B;  2I2Y A;  2GI9 A;  2LHD A;  2BW2 A;  2WU5 B;  3OWE B;  4KKI A;  2N9L A;  4XWT A;  3T3O A;  1NYQ A;  3BK2 A;  4AQ7 A;  4ZHP A;  1KRH A;  2BYT A;  4WIP A;  1QF6 A;  2M0A A;  3Q8B A;  4KX6 B;  2OED A;  2LHE A;  3UI3 A;  1JWS D;  3FC4 A;  1SIJ A;  4TSS A;  1AYF A;  2ONQ A;  3ZYY X;  2PKO A;  1ESF A;  1V1P B;  1TS5 A;  4WWM A;  2FUG 1;  2HDE A;  4OZC A;  4H2A A;  1LO5 D;  3AN1 A;  3AE6 B;  4YT0 B;  2JX5 A;  1T6B X;  3P4Q B;  3GP7 A;  1SF0 A;  2NTT A;  1MVK A;  1DOY A;  2E6X A;  1L0V B;  2OHF A;  3ABV B;  2BS2 B;  3NZ3 A;  1N5W A;  1JWB D;  3HUI A;  2M19 A;  1FEH A;  2BB5 A;  1JW9 D;  1SB3 C;  1QOA A;  4LTU A;  4RGO S;  2LFI A;  1L6U A;  3P4S B;  4N6E B;  2QEJ C;  3AMZ A;  1D4B A;  1NEN B;  4US9 A;  4ARI A;  1BUI C;  3NUH B;  3KWL A;  3VR8 B;  1I4G A;  5C2T B;  1D5Z C;  2ON8 A;  1E10 A;  1PGB A;  2I38 A;  2DYO A;  1PGA A;  3AB5 A;  2LUM A;  4D2K A;  4YXD B;  2WXG A;  2KQ4 X;  4GDL B;  3FAH A;  5AUK A;  1EU4 A;  2KWD A;  1BXT A;  1IBX B;  1GAQ B;  4YTP B;  3ZGZ A;  2AX5 A;  2IGD A;  1ET6 A;  1SE4 A;  3AE1 B;  4OW0 A;  2BS3 B;  1V97 A;  4JE3 B;  2J42 A;  2Y5C A;  4NZL B;  1CQV A;  2YEP F;  5HG2 A;  2H89 B;  1HXY D;  3R2I A;  1SXT A;  3P4P B;  4FXC A;  4US8 A;  2DLB A;  2JYE A;  4RCO A;  2CJN A;  1SEB D;  4OHJ A;  3BVM A;  1XCQ L;  2RMM A;  4N59 A;  1VJK A;  2V0G A;  4YSY B;  4HKZ E;  3NVZ A;  5BYR A;  4WUR A;  2MH7 A;  1GOZ A;  1FRR A;  3IXS A;  1UUP A;  1XXG A;  1FO4 A;  2L1A A;  2XN9 C;  4RGM A;  2GB1 A;  2ACZ B;  1XLQ A;  1AWD A;  1MI0 A;  1RWS A;  1BML C;  1E6E B;  1T3Q A;  3PZ8 A;  5E6J A;  2K3U A;  2JYT A;  2K5P A;  2Q5W D;  5C3J B;  1KLU D;  5D7G A;  1PUT A;  4ITK A;  3Q69 A;  3VR9 B;  1GPX A;  2IJ0 A;  4IOI E;  1STE A;  4RF0 A;  5LNK 1;  1TS2 A;  2JU6 X;  3IT6 B;  1PDX A;  2WXL A;  4JX1 C;  3TEZ A;  1HQR D;  3RPF C;  2LJI A;  1VZ8 A;  4N58 A;  1QIL A;  1N63 A;  1UWX A;  2R61 A;  2BTE A;  4REZ A;  4MM3 B;  1VLB A;  2CJO A;  4KKJ A;  2PTL A;  2V3P A;  1HZ6 A;  1TS4 A;  1YQ4 B;  1E0Z A;  1JML A;  3EA6 A;  3EGR A;  1FCL A;  1QKZ A;  1V1O A;  5I4D A;  1SE3 A;  1EM7 A;  1UGJ A;  4RGT A;  1NEK B;  2INP E;  1C4C A;  1P7F A;  1PYW D;  1DOI A;  2Z8L A;  3P42 A;  1L0X B;  1C79 A;  1HEZ E;  1YJJ A;  4NAW B;  1ZPS A;  4P16 A;  3IAM 1;  2WXR A;  4USA A;  1ZP0 B;  5EE1 A;  2WDQ B;  1B9R A;  4L2Y A;  5EE0 A;  2W54 A;  3U4E G;  3SFE B;  3P1M A;  1A70 A;  2WP9 B;  4A9A A;  3Q8F A;  4L23 A;  1CK1 A;  4HEA 1;  1SE2 A;  1QT9 A;  2QSD A;  2WQY B;  1R7S A;  1UNS A;  2NMQ A;  5H92 C;  3HVZ A;  5D3D A;  1ZE3 D;  3KWV A;  1TY0 A;  2DWQ A;  1I4H A;  3AEA B;  1JWA D;  3GB1 A;  4GDK B;  2KDM A;  2AQ1 B;  4DXG A;  2J52 A;  2DYM A;  1I7H A;  3W9C B;  2RDG A;  3NVY A;  5BMH A;  5FR3 A;  1KFY B;  2LGI A;  2WLB A;  1ENF A;  1RFK A;  1QOF A;  2WXI A;  4A90 A;  1FFU A;  2VZK B;  3CWI A;  3VRB B;  3DWG C;  4RNA A;  4XWW A;  2J53 A;  3ZQ4 A;  3T3N A;  1V1P A;  1C76 A;  3LYY A;  3L4P A;  3RFZ B;  1FXI A;  4TQ1 A;  1JWM D;  3AM9 A;  1FFV A;  1CZP A;  2KN4 A;  2IDY A;  2SEB D;  3URY A;  1HZ5 A;  2G9H D;  3PO0 A;  4AS1 A;  1F2R C;  4XDD A;  3AEB B;  1EU3 A;  3MC0 B;  3U2S C;  3MFG A;  3B2F A;  1L0Y B;  2TSS A;  2KMM A;  3BVG A;  2EEL A;  1JCK B;  1V8C A;  2Y5P A;  3AH7 A;  1ZOY B;  1C78 A;  3V3X A;  2QIL A;  4JWU C;  1K53 A;  2N0S B;  3R2T A;  3ZJU A;  3W5U B;  1WYG A;  3P4R B;  1SJH D;  2CU3 A;  1FCC C;  1TY2 A;  2K22 A;  1FNW A;  2N9K A;  1WGK A;  1FNV A;  2BT6 A;  5AUI A;  1ZXI A;  5BYS A;  1JWU D;  4XE0 A;  1D5X C;  4A55 A;  1TJE A;  1QOG A;  3KQ4 A;  4YSZ B;  3FIL A;  4JWS C;  4ZOH C;  1Y56 A;  5GXG B;  3MHZ A;  3LB8 C;  4YSX B;  5EE9 A;  3IAS 1;  2WNM A;  1YQ3 B;  3NVV A;  1N62 A;  3AEG B;  2IGH A;  1EWY C;  4M0W A;  2W3S A;  1KTK A;  5BYQ A;  5G5H A;  2H88 B;  5MPO A;  1XCT L;  5TSS A;  3WCQ A;  1D6E C;  4HRS A;  1ACC A;  2YEP B;  1IBX A;  2JZP A;  3N9Y C;  4NJC A;  1I4X A;  3DWM A;  2JSV X;  4MH8 A;  3HRD D;  1YJI A;  3AE2 B;  2WXJ A;  4ZRQ A;  1DGJ A;  1I4R A;  3TEY A;  1YNT E;  1I4Q A;  1HA5 A;  2V4I B;  1K50 A;  5HFY A;  3U7Z A;  5BMI A;  2INN E;  3EUB 2;  3BWU D;  3IT4 B;  3TSS A;  1YMH E;  1C77 A;  2MJ3 A;  2AQ3 B;  1TKY A;  1WXQ A;  2AQ2 B;  2WXK A;  2FBW B;  1NVI D;  1MPE A;  2BBC A;  3V05 A;  2FE8 A;  1C9F A;  2WXO A;  2MJD A;  1ZDV A;  1OQQ A;  2E3T A;  4MAC A;  2MEK A;  4TQ0 A;  3P63 A;  2Y3A A;  4EE2 A;  3MP9 A;  2WXN A;  1XF5 L;  2WDV B;  4KGT A;  1MHH E;  3AE7 B;  4A8X C;  3B9J A;  1MHX A;  1PGX A;  4RGN A;  5D3I B;  4P6V F;  1OFF A;  2QJL A;  3E56 A;  4Q2J A;  2WXF A;  3BYT B;  1T5X D;  4KGS A;  2WXH A;  4WH4 A;  4HKQ A;  5HHD G;  1D5M C;  3VRA B;  3W5V B;  1QLB B;  2BS4 B;  1I4P A;  1YN3 A;  1L4D B;  1YN4 A;  4MT5 A;  1RYJ A;  2KAC A;  1DYQ A;  3J9C A;  3PZ7 A;  1KLG D;  2K9X A;  5BMG A;  4WQM A;  1F0Z A;  4YTN B;  4LLG M;  1XLO A;  1IUE A;  1TYG B;  1PFD A;  2IPK D;  2WXM A;  1KH0 A;  1SSN A;  2G1E A;  4C7Y A;  4GLS C;  3TEX A;  1UWM A;  1N60 A;  3AE3 B;  1J7C A;  1ROE A;  3AEC B;  4ZYS A;  1L6V A;  2ZW1 A;  1IGD A;  1XEE A;  2PVO D;  5EE3 A;  3SR6 A;  3AEF B;  1N5X A;  4J3O D;  1VDV A;  1TKG A;  1XLP A;  3BII D;  3W1S A;  1JRP A;  3FIL B;  1J7B A;  3NRZ A;  4DQO C;  1FD6 A;  3Q8C A;  5JXV A;  1J7A A;  1WSP A;  4A6Q A;  3TEW A;  4OVZ A;  1ET9 A;  3Q8E A;  3BK1 A;  1CJE A;  1VR9 A;  1JAL A;  2RDH A;  2KAJ A;  2LMC A;  4ZHO A;  2ZW0 A;  3NVW A;  4CQN A;  1C4P A;  4WAF A;  2WS3 B;  1AW7 A;  1F77 A;  2PLP A;  1Q10 A;  1DOX A;  2VZK D;  2HTM E;  2GRI A;  4C7Z A;  2JQR B;  2W3R A;  2B76 B;  2X38 A;  4TMA B;  4B0M A;  1QOB A;  3E9S A;  1XO3 A;  3HVD A;  4B0E A;  1VZ7 A;  3C8Y A;  1K52 A;  4IDI A;  1NYR A;  4JPS A;  1L5P A;  4HRO A;  2D5G A;  1L4Z B;  2SAK A;  2QIE B;  3Q8A A;  1ZUD 2;  1JQ4 A;  2LEK A;  1FXA A;  3AE9 B;  1P7E A;  3BZD B;  3MJ5 A;  4KGR A;  4OZB A;  2L83 A;  4OZA A;  1SBB B;  1RM6 C;  5FKA C;  5H8Y E;  1E7P B;  1TKE A;  3I9V 1;  2RPV A;  3KLS X;  4YTM B;  3GS2 A;  2L32 A;  5G5G A;  5HI1 A;  3H8H A;  4ARC A;  3ETR A;  1FMA D;  4LK0 M;  3SFD B;  2W82 A;  3AE8 B;  1TZO A;  2N7J A;  1E9M A;  1FRD A;  1B1Z A;  2XNA C;  1TS3 A;  2ICI A;  2MJE A;  1GB4 A;  3AV8 A;  2IGG A;  1C4A A;  4C80 A;  4ZRP A;  3W2D A;  1QQR A;  3B2G A;  2W55 A;  4XDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...