5HI1A

Backbone modifications in the protein gb1 helix: aib24, beta-3-lys28, beta-3-lys31, aib35
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of design strategies for alpha-helix backbone modification in a protein tertiary fold.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords Immunoglobulin G-binding protein G
total genus 11
structure length 52
sequence length 56
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5hi1A00
2QSDA 1FCLA 2K0PA 2ONQA 3GB1A 1MPEA 2N9KA 1EM7A 1MHHE 1QKZA 4IKGA 2IGGA 2PW9A 2JWUA 1K50A 5BMGA 2I38A 2EELA 1P7FA 5BMIA 1K53A 1Q10A 2KACA 5BMHA 1PGAA 1GB4A 3MP9A 4KGTA 4D2KA 1XCQL 1HZ5A 1K51A 1IGCA 2RMMA 2ZW0A 2KN4A 2GI9A 1P7EA 2LUMA 1XCTL 2N7JA 1IBXB 4WH4A 2I2YA 2LGIA 1MHXA 2KQ4X 1ZXHA 1XF5L 5JXVA 4KGSA 2ZW1A 2IGDA 3FILB 1FD6A 1F2RI 4IOIE 4HKZE 4MACA 5HHDG 4OZCA 2IGHA 1JMLA 4GLSC 2JZPA 1MVKA 2QMTA 2JU6X 2GB1A 2LHDA 4KGRA 1C9FA 2KWDA 4OZAA 4HJGE 1IBXA 1FCCC 1PGBA 2KDMA 1MI0A 2ON8A 2J52A 2RPVA 1IGDA 1K52A 1YMHE 1UWXA 1GB1A 3V3XA 2J53A 1HEZE 1HZ6A 5HI1A 1YNTE 2N9LA 2LHEA 3FILA 5HG2A 1F2RC 2JSVX 2PTLA 5HFYA 2PLPA 1PGXA 3UI3A 4OZBA 2OEDA 2JXTA 2NMQA 1KH0A 1D4BA
chains in the Genus database with same CATH superfamily
4J6IA 5DPRA 1L2NA 2L1AA 3ZJUA 1TKYA 2G4DB 1D5MC 1P0RA 2MJEA 2G45B 3AE8B 1QF6A 1T0QC 3AU4A 3NZUA 5C23A 5BMHA 5KHQA 2WXIA 5C3JB 2SEBD 2FIFA 4US9A 4FJZA 1YD8U 1XCQL 2LGYA 1WJNA 3ZYYX 2LVQA 2NBVB 3DBHI 2GRIA 4K1RB 4KIKA 4XDDA 4K7UA 4HEA1 2GI9A 4DXGA 1AN8A 4H2AA 5L83A 4JQWC 3A33B 2WXMA 2JUOA 1I4HA 1A5RA 4IWOA 2Z8LA 3DDCB 4I6NB 3DVNU 2GBRA 4EZKA 4I6PA 3EHVA 3APDA 1GC7A 4HK2A 2KWVB 4BVUC 4K7SA 4TQ1A 2BS2B 2Q5WD 2BB6A 2MA9B 2LHDA 2DZIA 4KGRA 3A4SC 2L3ZA 3HRDD 3DHGC 3MTNB 3U30A 1WRDB 1WZ3A 1GJZA 2DLBA 4ITKA 4MGKE 1MI0A 3V61A 1T0RC 3BWUD 2JZ3B 1ZPSA 3SD5A 2OJWA 1BUIC 3B0AA 1UWXA 3DVGX 3HM6X 4MH8A 1R4NI 4F7ZA 1SGHA 3M63B 2D3AA 3AEGB 1WX7A 1RWSA 4AP4C 2D3CA 4N59A 1AWDA 4ICVA 4XDCA 4AJWA 4BKTA 3PRZA 1X1MA 3AEFB 3NUHB 2WGSA 2IZVB 3C19A 2FCQA 1FFUA 2MSED 1D5XC 4GU2A 5LXIB 4DDGD 2INNE 1XQQA 1MPEA 3GE8C 1Q5WB 1VR9A 1R4NB 2N7EA 3BY4B 5CHVC 2BF8B 3V6CB 2PW9A 3VR9B 4ZYNA 2KD0A 4MSMB 1LXDA 3FC4A 4DXFA 4M8NA 1QLBB 3IFWB 4YSYB 2Y5PA 4BKGA 2HJ1A 3GZNB 2LXCA 4LNOA 1N62A 4M02A 1UGMA 3ZGZA 1WM2A 2N7JA 2X38A 4KV2A 3B2FA 1KRHA 2D07B 4W9HA 2KQ4X 3DQVA 3K9OB 4IWPA 2PKOA 1UF0A 4EFOA 3QIJA 2OHFA 1OEYA 3WA0A 3KW5B 1S3SG 2MH7A 1YIWA 2WDRB 3HIZA 3AE4B 1C1YB 1V81A 1WR1A 1WJUA 4MGZE 4JIOU 4GDKA 4E71A 2O6VB 3AE5B 2M19A 2D3BA 5FR3A 2M1MA 1OQYA 1EF5A 2KKCA 3RCZA 1GUAB 3EUB2 4JWSC 4G0NB 2IO1B 2PLPA 2GOWA 4YL8A 3ZUNA 2J42A 5E6OA 1E0ZA 1VJKA 2WLBA 1C76A 2WXKA 3M3JA 5IAAC 3ZRCA 1VRAB 2LJ5A 1SE4A 2MBOA 1WWTA 1WF9A 2V0GA 1Q1OA 1UD7A 2ONQA 2MCNB 2L05A 1JW9D 1XEEA 3LB8C 3BIID 2EMTA 1VD2A 2ZPYA 4RGMA 2LGDA 1T5XD 1F0ZA 2WX0A 2JQRB 2NTSA 4USAA 3OJ3A 4LCDE 1Q10A 3APFA 2RPQA 2Z0EB 3ZRFA 2G3QB 1OGWA 2ZNVC 4MELA 3QARA 3I3TB 2MW5A 4JGHB 1OFFA 1HXYD 4GSWA 3AE6B 3RYTA 3AECB 2J0JA 1SEBD 2JT4B 1V1PB 5IKCM 3TL5A 1QZEA 2K22A 1I35A 4RFBA 2WXHA 4B95A 4NPNA 4LDTD 1FD6A 3ML9A 3R8BA 1WGRA 2W55A 1YQ3B 4IOIE 5AZFA 3SEBA 4YSXB 2N0SB 2IGHA 1L0YB 2CHWA 5AEKB 3MJ5A 2CKHB 3UINB 2YEPF 2BYTA 3W1SC 4ANWA 4BKSD 5LNK1 4HPPA 3E56A 3OWEB 4ZRJA 1XLQA 2D2QA 1E8XA 3P2BA 3RN9C 4HJKA 4DWFA 1RFKA 1AW7A 1YJ1A 2KTRA 2V9HA 3RNGC 1C3TA 3DHHC 4CHKA 1ESFA 1NBFC 2KN5A 1K52A 4W9KA 2WDVB 4MGYE 2KMCA 4EKUA 2N9XA 4XE0A 2LJIA 5T8IA 3ZNHB 1NVID 4HPMB 1WH3A 2ZPNA 2UYZB 1WE6A 2JYTA 3BINA 3TUOA 3NG0A 1EF1A 3UQAA 4OVZA 4BOSC 1BXTA 3VR8B 3Q14C 3B08A 3NHEB 2WP9B 4HVBA 2B3AA 2V3PA 2XNAC 2K8BA 3KUCB 1WYGA 3O65B 5TR5A 3VTWA 4E74A 3I9V1 2ZNVB 4W9DA 3SHQA 3IVFA 5DCNA 5JZEB 1KFYB 4B0EA 2KVRA 4KGTA 2JRHA 5AZGA 2GBJA 5G2NA 3TEYA 4IG7B 1NENB 1LFDA 1XO3A 4W9GA 3CSFA 2AWTA 3GOEA 3QCAA 5GXGB 2WDTB 3DOWA 2BS4B 1B1ZA 4CYEA 2KX0A 1E7UA 1CJEA 3DWGC 3FILB 4ZRIA 3R2TA 3MHZA 1GPXA 2DAFA 2DHZA 3L0WB 4WAFA 1IP9A 5E6JA 1UBQA 4LLGM 1J0GA 1E7VA 2WXGA 3UGBB 3PGEA 4AS1A 1QOBA 2WU5B 4G50A 5CTRC 4BOZB 4WWOA 4PS3A 2PE6B 4QAYA 2IPKD 1WYWB 1ZXIA 3Q3OC 4RGTA 2YVCA 4MSQB 1FXIA 2KANA 3HHMA 5HI1A 1TS3A 2KHWB 1HA5A 1EU3A 3N1XC 3SFEB 2NTTA 1M4VA 2KTRB 3NVVA 2L0TA 5DPWA 4WAAA 1STEA 4C00A 1B9RA 3QC8B 2LMCA 3ZNID 4L2YA 4S0RA 3AE9B 1TY0A 1QT9A 3MC8A 3ZIMA 3SDLC 4EE2A 2YLMA 3GZNI 4IM3A 2REXA 4NAWA 5JHAA 2C9WB 4K3CA 1WMHB 2J0MA 2KDEB 1DOYA 3A1QA 5BMGA 2AQ2B 1K53A 3MC0B 4L1BA 1WR6E 4DXAB 1KTKA 3I57A 3ZVVA 2NBWB 1EWCA 2WXRA 3V05A 3DCGA 1SXTA 2WDQB 4CQNA 1SJED 3H7SA 2BYVE 1K8RB 2K5PA 4LJOB 1V2YA 1QOFA 1FNWA 2ZZPB 3RI7C 4W9FA 2FIDA 1DYQA 2O6VD 3NZ3A 3H7PA 4US8A 4NQLB 4HCPB 4MACA 3U2SC 3H1UA 2KMAA 5MPOA 2DBYA 1VCBA 4N58A 4C7ZA 1LGRA 2XBBC 4O1NA 1HQRD 3DVGY 2J0KA 2FCSA 4ASWC 1T6BX 1SE2A 4WURA 2X8XX 3IG3A 4OVUA 4W9LA 3CWIA 2BWES 2CJOA 3BZDB 4II2B 2C7NB 4URKA 1TGZB 2JWZA 4BBNF 3OLMD 2W3SA 3W9CB 4GMVA 4XX5A 1N60A 3Q69A 1I4XA 4KZCA 3Q6BA 2M56B 3B9JA 2V1YA 2LHEA 3DVNV 1JROA 3CF6E 5IP4D 3GP7A 1C79A 1Z2MA 2BKRB 3ZNGC 5G5GA 3APCA 3ZXVA 2L83A 5GMVA 2PMVA 4A90A 4FADA 2LFIA 4KZ0A 1XT9B 4M00A 3IXSA 3LXFA 1L4ZB 5LXHA 2KFJA 2Y5CA 3EC8A 4OW0A 1L7YA 3W5UB 1L6UA 2W82A 1NDDA 2WX1A 4IKGA 5D2MB 1I4PA 5EE3A 2I1JA 3P1MA 1RFAA 3IBEA 3ZKJC 4F8CB 3NS8A 2KX3A 1EO6A 4WIPA 3WALA 5TSSA 4P16A 2WS3B 3AE3B 2PEAA 3QK0A 2RMMA 2GMIC 4FA6A 1UUPA 2XN9C 2WXPA 4KKIA 2FE8A 4HDQA 3ZJTA 4WQMA 4DK5A 3DBRB 2N9EB 1XLNA 3BYTB 1TZ1A 3WIMA 2AL6A 3LDZE 2JF5A 4J3OD 2H89B 2NR2A 1V1OA 1CK1A 3R7RA 4P7IA 3RULA 3EGRA 2FCNA 1P1AA 1DOIA 1MVKA 2HD5B 1MG8A 2DENB 3QAQA 2NPTA 5D3DA 5H8YE 4MDKE 3Q3MC 2DZKA 3C0RB 1LQBA 2LGXA 2C5LC 1SIFA 1WX9A 4FN2A 2M8SA 1DGJA 5LLIA 2OOBB 3SR6A 1I42A 4N9F4 2HE7A 1L0XB 2VRRB 1J7AA 4B0MA 1JRUA 4FJYA 4E3CA 3U8ZA 2R61A 1OQQA 2CHZA 1WX8A 1PGXA 4NNJB 1D5ZC 1UGJA 3FAHA 3KWVA 3N30A 4G3XB 3KVFB 5EE0A 5JHBA 3H6NA 2N7DA 1VDVA 2G9HD 2KXJA 4GDLA 4BBNC 3TJPA 2EKIA 3R3MA 1EM7A 4RM9A 1YQBA 4YWGG 2IY0B 2MX2A 4WJQA 4KKJA 2QDFA 1ACCA 2EELA 4P6VF 4NQKE 4RGNA 3MJWA 1GB4A 4TKNA 2KVZA 2KAJA 2DZJA 3U7ZA 3AMZA 2MP2B 4RF1A 5AZHA 3BVMA 4II3B 4RH6A 2PE9A 2BBCA 2I2YA 4ZYSA 3ZJVA 1M94A 2MHJA 1TTNA 3PLVA 2GLSA 2KLGA 2VH2A 4OZCA 1D3ZA 3RUIB 3X0WA 3VUWA 3K9PB 2LZ6A 3VAWA 3B1LX 4EUTA 1TJEA 3AE1B 2IYDB 5D7GA 1E5WA 3PSEB 3BK2A 2QC8A 3NVZA 2HTME 1FM0D 4MJSB 1PGBA 3BK1A 1WGDA 2KK8A 2ON8A 2V4LA 1C4PA 1TIFA 3VH3B 5FKAC 1SB3C 4ARIA 2FUG1 3PREA 4ANVA 2Y5BB 4DQOC 4I6LB 2M0AA 4C4VB 3AE7B 3NS1A 1GNUA 2PJHA 4IM2A 2A5UA 4OZBA 1KH0A 1J7CA 1YQ4B 2JY6A 1WXVA 2KZRA 3GB1A 3NY5A 3RNAC 1T0YA 1ZDXA 2IO2B 3H8HA 1L0VB 4YSZB 1ZE3D 3NZSA 4XWTA 4DHZB 2H88B 3L17A 3P4SB 3LJ3A 4WWNA 2V4IB 1PGAA 2QHOA 2KFKB 3PLUA 3VVWB 4HLEA 1F52A 1IUEA 3ZNZB 1XXGA 3V62A 2ZW0A 2L00B 5AUIA 4LNKA 1UBIA 2K8CA 3T9LA 3P4QB 3VFKA 3PT2B 1ZDVA 5IA7A 4NY0A 2ZW1A 3VUYA 2K3UA 5HHDG 1LM8B 4JPSA 3ZDMC 2G1EA 3P63A 2MJ3A 3VQIA 1TYGB 3AE2B 3CSTA 4OZAA 4G11A 3KUDB 4M01A 3N9YC 1Q0WB 1F77A 4AJYB 3Q8BA 4CO7A 2ASQA 1IGDA 4LNFA 4LK0M 2N9PC 2LUEA 3MFGA 3URYA 2EKEC 1FRRA 4YT0B 1F2RC 1E8YA 2JPHA 4NZLB 2KWUB 3EFUA 5I4DA 2BW2A 1JWBD 3N3KB 3V60A 2JYEA 2PVGC 2OEDA 1WGGA 4YTMB 2SAKA 2WYQA 4W9JA 2QSDA 2PVOD 1JWSD 2L7RA 5CX3A 1EU4A 1T3QA 3AB5A 4A8XC 3IAM1 3Q3FA 2N9KA 3ZO5B 4FJVB 1I4QA 1MJDA 1SE3A 4MGIE 1PDXA 2K6DB 3VH4B 1RRBA 3ZTDA 5CHFA 4MEMA 3X23A 4ZHPA 1GC6A 4Q2JA 4D2KA 2C60A 4TQ0A 2CU1A 1NYRA 5E6PA 4GN1A 3DBLB 1WY8A 1EWYC 1XCTL 1IBXB 4WH4A 1J19A 4ANUA 2W9NA 2KJHB 2KC2A 1KOTA 1ZXHA 2O6VA 1Z5SB 3ECIA 3Q8AA 2BKFA 1KLUD 2K25A 3PZ8A 2BGFA 4DHZE 3EECA 2PIAA 1VZ7A 3AEDB 3M95A 2D3GA 4TUUA 3JVZX 1SBBB 3RNFC 2DX5B 1WXAA 3HK0A 3UIPB 2W3RA 4KSLC 4EOYA 2MP2A 2R2QA 2BB5A 4YXDB 3ALBA 1WZ0A 1GB1A 2J53A 5EE1A 3AXCA 3MC9A 2L8JA 1FRDA 4RNAA 1YX5B 3JW0X 5DPTA 1WSPA 2DZMA 2LASA 3PRMB 2RSUA 4KVGB 5H92C 4HPLB 1HE8A 2KJRA 2MBEA 1V9JA 1NYQA 1E7PB 3Q8CA 2WHIA 3NJTA 1IYFA 2B76B 1UZXB 2YEPB 5IN7A 2XEWA 1FMAD 4IDIA 1KLGD 1SF0A 1FNVA 4W9IA 1L4DB 4F1SA 1HTOA 1TZOA 4WWMA 3TEZA 3NVWA 1ENFA 5G5HA 2IJ0A 2IY1B 3VXWA 4ACFA 4DHJD 3AI5A 1I4RA 4ARCA 1C4AA 1AYFA 1V5TA 2IBIB 3AEBB 2RGFA 2GBKA 1RAXA 3OG5A 1F9JA 4MM3B 4RGOS 5HKHA 3AULA 3B2GA 5FR6A 1RYJA 2KC1A 2DYOA 4JL9A 4NAMA 2MRPA 2WXJA 4FHKA 1VLBA 2N4FA 3MHSD 2ZCBA 4HDOA 4JE3B 1V6EA 1SJHD 3QWZB 4LJPB 2V3SA 3ZTCA 5E6NA 2J4XA 2LRWA 3N32A 2KDFB 1E8WA 2PTLA 4KIKB 3QX1A 2KNBA 1RLFA 2AQ1B 4AOFA 4K3BA 3UI3A 4ZDVA 2JRIB 1WRIA 4RF0A 1J7BA 2K6QA 3VDZA 2INCC 3VTUA 4ICUA 1JWAD 3VRBB 1V49A 3HM3A 3KLSX 5D94A 2AEHA 3RT3B 2LD9A 3DBSA 3A9KB 1A70A 4M8MA 3P4PB 4GGQA 3W2DA 2IDYA 5C1ZA 1BT0A 4BFRA 2IO0B 1EUVB 1P7FA 2RR9A 5BMIA 2KACA 3ENEA 4FXCA 1E6EB 5J18A 1KF6B 1V8CA 5BYQA 3VTVA 5L95C 1CQVA 1ZGUB 3PZ7A 3IAS1 4BKSA 3D32A 3QQ8B 2AYOB 3CIRB 2WNMA 1TKEA 2DNFA 1PUTA 5J17A 4C7YA 2E3TA 1WGYA 4IM0A 1XD3B 3W1YA 1E9MA 3NVYA 3U52E 4ZRKA 3RZFA 1PQSA 2A4ZA 3IHPC 4L23A 4KX6B 2CU3A 1F2RI 3WAPA 2QJLA 1F1HA 4XYCA 1QQRA 1JMLA 1DOXA 4A20A 3PHXB 4HWIB 3DHIC 2HTHA 2MBHA 2JU6X 4KDLB 4HXDA 1NI2A 1RM6C 3AM9A 4HJGE 3ABVB 4REZA 1ET9A 4B6WA 3OJ4B 1Y56A 3RPFC 1ZKHA 4LNIA 1QOGA 2JX5A 1HEZE 3DBHB 1Y8RC 5CHWA 3J9CA 4GDKB 4ZOHC 3Q8FA 3JSVB 2KJ6A 3RNEC 3A1QB 2KTFA 1H8CA 2N1WA 2L76A 1C78A 2OJRA 1OTRB 2CS4A 3DBLI 1OQRA 1GG3A 3TBLD 2BQQA 2BTEA 2IGGA 3L08A 1WGKA 2RD0A 3W1SA 2K1FA 3C8YA 2KLCA 3QA8A 4JLCA 1UNSA 1C4CA 2RDHA 2D11A 1E90A 3L10B 2BS3B 2NBUA 2WU2B 4A6QA 3T8MA 3QJZA 2LVPA 4XGAB 2CJNA 1ROEA 3L54A 2RDGA 1MHXA 3L4PA 4PT5A 2MQJA 2IGDA 1N61A 2BYEA 3DWMA 2WXOA 1NI3A 3L16A 3RFZB 4HKZE 4JX1C 1XLOA 3UF8A 4PYZA 3OAWA 1UH6A 1QOAA 2ZEQA 3HVDA 1BMLC 2GB1A 2IO3B 3WAMA 4EEWA 3N1YC 2KDIA 2KDBA 1N63A 1FPYA 2ACZB 2J52A 2UWQA 2K39A 3PRPB 4FLHA 5AUKA 5IO9A 2E6XA 3Q3NC 2ZCCA 3H7PB 1FFVA 2KWCA 2HJ8A 2LGSA 3JYUA 1P98A 1TS4A 4FBJB 1YJJA 4DHJB 4MT5A 3KQ4A 4GB9A 3PVLA 4ZHOA 3ZXRA 3R7QA 2JXTA 5BO4B 3E9SA 1FCLA 2AX5A 2L52A 3O13A 4YTNB 2GBMA 3BVZA 3PZDA 3Q2AC 1QILA 2I1KA 2KQSA 2QIEB 2RDBC 1N5XA 3VHTC 4P1BC 2VH1A 4ANXA 3EA6A 2R2OA 3W5VB 1MFWA 1FXTB 1P9DU 4IUMB 5DPSA 4DBGA 2QCZA 1MG4A 2MBBB 2G4SA 1JWMD 2W54A 2LUMA 2NPTB 3PO0A 2NS5A 3ZW3A 3Q3JA 4PS8A 5BYSA 5JXVA 3IT4B 2KFKA 4RM8A 1ISNA 4K81A 3T3NA 2NVUI 2ZVNA 2JZPA 4GIVA 4HKQA 3S2AA 3TEWA 2Z0DB 4WWPA 2BT6A 3KUZA 4TV3A 2KWDA 1I4GA 3AV8A 1U4AA 2JXXA 3VUXA 3KYDD 1WJ6A 2D5GA 4KSKC 1ZP0B 5FK9C 4MH0E 4W9EA 4M0WB 2DYMA 5G55A 4PS7A 1SIJA 2KMMA 1GOZA 3U4EG 1I7HA 4FULA 1HZ6A 2KYWA 4WQOB 3GS2A 1KJTA 2FAZA 2L32A 4PYUA 4B9KA 1TY2A 2VZKB 1JRPA 1J8CA 1TS2A 4WJNA 2KQ7A 4MM3A 2DWQA 1YJIA 2NMQA 1JCKB 4PK1A 3SFDB 2XK5A 1WMHA 1UWMA 1FO4A 3TSSA 1QKZA 3M62B 3RNCC 2BVCA 2KO3A 4TMAB 2WWZA 3AU5A 2MLBA 2CR5A 3RMKC 5D3IB 4OVVA 1R4MI 1V1PA 2FCMA 1E8ZA 2FNJB 3KWLA 4XZ4A 3ZDTA 1WI0A 2L0FA 4A3PA 2O2VB 4UDUC 2GBNA 4ZRQA 1P7EA 3I63C 4NAWB 1YOVB 4AWJA 2INDC 3GE3C 1T0SC 2K9XA 3ZLZA 5IOIA 1WGHA 3TIXA 3WANA 2BYFA 4MJSA 2J7QB 3IT6B 4IC7B 3UIOB 1LO5D 5EDSA 1V86A 4GLSC 2HDEA 2QMTA 1TKGA 1IPGA 1L5PA 1V5OA 3ONSA 3Q8EA 3RD2A 2INPE 4XC2A 1CZPA 2XK5B 3I5JC 4GXBA 4BAXA 4A55A 2PPHA 3PTFC 2DAJA 1IBXA 4W9CA 4LDTB 1N5WA 2RPVA 3VRAB 3TEXA 3P42A 2LXAA 4HCNB 5EE9A 2MBQA 4WJPA 2MJDA 2V3NA 4ZRPA 5HG2A 3H9DA 1AARA 5HFYA 2EMSA 1V97A 2ZVOA 2CHXA 2MWSB 1PYWD 4WJOA 3WCQA 4TSSA 4NJCA 3RZWC 4HRSA 4M0WA 1D4BA 2MEKA 1YN4A 4RMAA 2K0PA 3NRZA 3N1ZC 3TCAA 5BYRA 5D6JB 2AQ3B 4K7WA 2JZZA 1JALA 3L13A 3AN1A 3UQBA 2TSSA 3FKYA 2JVCA 3BVGA 4LTUA 1KLVA 1UELA 1R4MB 1K51A 1IGCA 1WIAA 2C7MB 1V80A 2BWFA 5J2RA 2D10A 2KN4A 1ZUD2 1SE9A 4N6EB 4IW0A 4NJ7A 2M4NA 2LVOA 1TT5B 1TBEA 1XF5L 2UU7A 1E10A 3R2IA 4AQ7A 3R66C 2O2VA 1FXAA 1C77A 2QILA 2M17A 1R7SA 1NEKB 2WQYB 1WXSA 2WXFA 1WXQA 2KOXA 3BYYB 1WFYA 2LI5A 1P3QU 3JSVA 1YN5A 1FCCC 2M0XA 4FHJA 3T3OA 2K8HA 3AEEB 4S17A 1WXMA 3WAOA 3V3XA 2KT7A 1L6VA 1YNTE 1SSNA 3ETRA 4JWUC 1JWUD 3FILA 4NJ6A 1S1QB 2JSVX 4KDIC 4R3DA 1FIQA 3DPDA 1WE7A 3V6EB 1VZ8A 3A9JB 4GDLB 1FEHA 3ZQ4A 3TMPB 1ZOYB 3PV1A 1TS5A 2LEKA 3A9KA 5JH5C 3AEAB 3LYYA 1H4RA 3N20C 3PS6A 1MHHE 2VZKD 1CMXB 3KH0A 1WM3A 1OEYJ 2JWUA 1K50A 2WXQA 1GAQB 2I38A 2WXNA 3EFCA 1JQ4A 3KYCD 5KHOA 1YN3A 3AH7A 3HUIA 1ET6A 3RNBC 4XWWA 4BZAA 3MP9A 2N1VA 1HZ5A 4GOCA 2NCNA 3ML8A 3QHTA 4X57B 2FUHB 4C80A 2LRUA 4LNNA 3PHWB 2LGIA 1XLPA 4C4VA 4KGSA 4OHJA 1VZ6A 4A3OA 5C2TB 1KM7A 2LWPA 1FNUA 3HVZA 4AUQC 1PFDA 1C9FA 2BPSA 4A9AA 4DDID 3A4RA 4EZLA 2DYBA 1D6EC 1HTQA 4RCOA 2C7HA 4IWQA 2KDMA 2ZJDA 2AL3A 3NOBA 3CMMB 1YMHE 3SU8X 4C56C 2QEJC 3P4RB 4HROA 2N9LA 3U7DA 3A9JA 2ICIA 2Z59B 2FBWB 1N6ZA 3DBRI 1YX6B 2Y3AA 1ZW7A 2WXLA 3PPAA 1WJ4A 1G6JA 4YTPB 4EZJA 4P1CC
chains in the Genus database with same CATH topology
3E9SA 2QSDA 4EE2A 2AX5A 1FCLA 2L52A 1JWSD 2PVOD 2L1AA 1EU4A 3O13A 1TKYA 1T3QA 3AB5A 4YTNB 3ZJUA 1D5MC 4A8XC 3IAM1 2MJEA 2N9KA 3BVZA 3AE8B 1I4QA 1SE3A 1QILA 1QF6A 1PDXA 2QIEB 1N5XA 1DOYA 5BMGA 3EA6A 3W5VB 2AQ2B 1K53A 3MC0B 5BMHA 4ZHPA 2WXIA 4L1BA 5C3JB 2SEBD 4US9A 4Q2JA 4D2KA 1XCQL 1KTKA 3I57A 4TQ0A 3ZYYX 1EWCA 2WXRA 3V05A 1NYRA 2GRIA 4XDDA 1SXTA 2WDQB 1JWMD 4HEA1 2GI9A 4DXGA 2W54A 4CQNA 1SJED 2LUMA 1AN8A 2K5PA 4H2AA 1EWYC 1XCTL 1IBXB 1QOFA 1FNWA 2WXMA 3PO0A 4WH4A 1I4HA 2Z8LA 1ZXHA 5BYSA 1DYQA 5JXVA 3NZ3A 3IT4B 4US8A 4MACA 3Q8AA 3T3NA 1KLUD 3U2SC 3PZ8A 2JZPA 5MPOA 4HKQA 2DBYA 2PIAA 4TQ1A 1VZ7A 3AEDB 4N58A 2BS2B 2Q5WD 2BB6A 4O1NA 1HQRD 4C7ZA 3TEWA 2LHDA 2BT6A 4KGRA 1T6BX 1SE2A 2KWDA 3HRDD 4WURA 1I4GA 3AV8A 1SBBB 3CWIA 2CJOA 3BZDB 2D5GA 2DLBA 4ITKA 1MI0A 1ZP0B 2W3RA 2W3SA 5FK9C 3BWUD 3W9CB 1ZPSA 2DYMA 1N60A 1SIJA 1BUIC 2BB5A 1GOZA 2KMMA 3Q69A 4YXDB 1UWXA 1I4XA 1I7HA 3U4EG 2M56B 4MH8A 1GB1A 2J53A 1HZ6A 3B9JA 5EE1A 2LHEA 3AEGB 1JROA 1RWSA 3GS2A 1FRDA 3GP7A 4N59A 2L32A 4RNAA 1C79A 1AWDA 5G5GA 1TY2A 4XDCA 2VZKB 1JRPA 3AEFB 3NUHB 1WSPA 1TS2A 2L83A 4A90A 2PMVA 1FFUA 2LFIA 5H92C 3IXSA 1D5XC 2DWQA 1YJIA 2NMQA 3LXFA 1L4ZB 1JCKB 2INNE 3SFDB 2Y5CA 1NYQA 4OW0A 1MPEA 1UWMA 1FO4A 3TSSA 3W5UB 1E7PB 3Q8CA 1L6UA 1VR9A 1QKZA 2W82A 2B76B 4IKGA 4TMAB 1I4PA 2PW9A 5EE3A 3VR9B 3P1MA 2YEPB 1FMAD 5D3IB 1V1PA 4IDIA 1KLGD 3FC4A 1SF0A 3KWLA 4DXFA 1FNVA 4WIPA 1L4DB 4YSYB 1QLBB 5TSSA 4P16A 2WS3B 2Y5PA 3AE3B 2RMMA 4UDUC 1TZOA 1UUPA 4WWMA 4ZRQA 1N62A 3TEZA 1P7EA 2XN9C 3NVWA 4NAWB 2WXPA 4KKIA 3ZGZA 2N7JA 2X38A 2FE8A 3ZJTA 3B2FA 1KRHA 4WQMA 1ENFA 5G5HA 2K9XA 1XLNA 2KQ4X 2IJ0A 2PKOA 4J3OD 2H89B 1V1OA 1CK1A 3IT6B 2OHFA 1LO5D 1I4RA 3EGRA 4ARCA 4GLSC 1C4AA 1AYFA 1DOIA 1MVKA 2HDEA 3AEBB 2MH7A 2QMTA 1TKGA 5D3DA 1L5PA 2WDRB 3Q8EA 5H8YE 4MM3B 4RGOS 3AE4B 3B2GA 2INPE 1CZPA 4A55A 1RYJA 2DYOA 4NAMA 2WXJA 1IBXA 1VLBA 4JE3B 1DGJA 1N5WA 2RPVA 3AE5B 3VRAB 3TEXA 2M19A 3SR6A 5FR3A 3P42A 1SJHD 5EE9A 1L0XB 1J7AA 4B0MA 2MJDA 2V3NA 4ZRPA 3EUB2 2J4XA 4JWSC 5HG2A 2PTLA 5HFYA 2PLPA 2R61A 1V97A 1OQQA 2J42A 1E0ZA 2AQ1B 1PYWD 1PGXA 1D5ZC 1VJKA 1C76A 1UGJA 2WLBA 2WXKA 3FAHA 3KWVA 4TSSA 4NJCA 3UI3A 3WCQA 1WRIA 5EE0A 1VRAB 4RF0A 1SE4A 4HRSA 4M0WA 1J7BA 1D4BA 2MEKA 1WWTA 1YN4A 1VDVA 2G9HD 2V0GA 1JWAD 2K0PA 3VRBB 2ONQA 3KLSX 2EKIA 1JW9D 3NRZA 1XEEA 1EM7A 3BIID 3LB8C 5BYRA 1A70A 4YWGG 4RGMA 3P4PB 3W2DA 1T5XD 2IDYA 4KKJA 1F0ZA 1ACCA 2JQRB 2AQ3B 2EELA 1P7FA 2NTSA 4USAA 5BMIA 1JALA 1Q10A 2KACA 3AN1A 4P6VF 2TSSA 1E6EB 4FXCA 1KF6B 1V8CA 5BYQA 4RGNA 1GB4A 3BVGA 1CQVA 4LTUA 2KAJA 3U7ZA 1K51A 1IGCA 3PZ7A 1OFFA 1HXYD 3IAS1 3AMZA 2KN4A 4RF1A 3CIRB 1ZUD2 3AE6B 2WNMA 3BVMA 4N6EB 1TKEA 4RH6A 3AECB 1PUTA 1SEBD 1V1PB 4C7YA 2BBCA 2E3TA 2I2YA 4ZYSA 3ZJVA 1E9MA 2K22A 3NVYA 3U52E 4RFBA 1XF5L 2WXHA 4L23A 4KX6B 2CU3A 1FD6A 3R8BA 2W55A 1F2RI 1YQ3B 4IOIE 4YSXB 3SEBA 2QJLA 1E10A 3R2IA 2N0SB 4OZCA 4AQ7A 2IGHA 1L0YB 1QQRA 1JMLA 3MJ5A 1DOXA 2YEPF 1FXAA 1C77A 2BYTA 2QILA 1TJEA 3AE1B 2JU6X 5D7GA 5LNK1 1R7SA 1NEKB 2WQYB 2WXFA 3E56A 3OWEB 1XLQA 1WXQA 1RM6C 3AM9A 4HJGE 3BYYB 3ABVB 3BK2A 4REZA 1ET9A 1RFKA 1AW7A 1YN5A 2HTME 1FCCC 3NVZA 1FM0D 1Y56A 1PGBA 3RPFC 3BK1A 2ON8A 3T3OA 1C4PA 1QOGA 1ESFA 1K52A 3AEEB 2JX5A 5FKAC 1SB3C 2WDVB 4ARIA 2FUG1 3V3XA 1L6VA 1HEZE 4DQOC 1YNTE 2M0AA 1SSNA 4XE0A 3ETRA 2LJIA 1JWUD 3FILA 4JWUC 3AE7B 5T8IA 3NS1A 3J9CA 2JSVX 4GDKB 4R3DA 4ZOHC 1NVID 1FIQA 3Q8FA 1VZ8A 2JYTA 4GDLB 1FEHA 4OZBA 3TUOA 3ZQ4A 1KH0A 1ZOYB 1C78A 4OVZA 1J7CA 1TS5A 2LEKA 1BXTA 1YQ4B 3VR8B 3GB1A 3AEAB 3LYYA 1OQRA 1ZDXA 1MHHE 2VZKD 2WP9B 3H8HA 1L0VB 2BTEA 2IGGA 2V3PA 2XNAC 4YSZB 1ZE3D 1WYGA 4XWTA 2JWUA 1K50A 2WXQA 1WGKA 2H88B 1GAQB 2I38A 3I9V1 2WXNA 3P4SB 3W1SA 1JQ4A 1YN3A 2V4IB 3AH7A 3C8YA 1PGAA 1KFYB 3HUIA 1ET6A 4B0EA 4XWWA 1UNSA 3MP9A 1C4CA 4KGTA 2RDHA 1IUEA 1HZ5A 3TEYA 1XXGA 1NENB 1XO3A 2ZW0A 5AUIA 2BS3B 2WU2B 4A6QA 3P4QB 5GXGB 4C80A 2BS4B 1B1ZA 2CJNA 1ROEA 2RDGA 2LGIA 1CJEA 1MHXA 3L4PA 4PT5A 1ZDVA 1XLPA 4KGSA 2ZW1A 2IGDA 3DWGC 1N61A 2K3UA 3FILB 1VZ6A 3DWMA 4OHJA 2WXOA 1NI3A 5C2TB 3RFZB 3R2TA 4HKZE 3MHZA 5HHDG 1GPXA 4JX1C 1XLOA 4WAFA 5E6JA 1FNUA 4LLGM 4JPSA 2G1EA 3P63A 3HVZA 1QOAA 3HVDA 1BMLC 2GB1A 2MJ3A 3VQIA 1PFDA 1TYGB 2WXGA 3AE2B 1C9FA 4AS1A 1QOBA 2WU5B 4A9AA 4OZAA 3N9YC 1D6EC 1F77A 4RCOA 1N63A 3Q8BA 2KDMA 2ACZB 2IPKD 2J52A 1IGDA 5AUKA 1ZXIA 4LK0M 1YMHE 4RGTA 2E6XA 4C56C 1FXIA 2QEJC 5HI1A 3MFGA 3P4RB 4HROA 1TS3A 3URYA 1HA5A 1EU3A 2N9LA 3SFEB 2NTTA 1FRRA 1M4VA 4YT0B 1FFVA 1F2RC 2ICIA 3NVVA 4NZLB 1TS4A 1YJJA 5I4DA 2FBWB 2BW2A 4MT5A 1JWBD 3KQ4A 2Y3AA 2WXLA 2JYEA 2PVGC 4ZHOA 2OEDA 1B9RA 1STEA 4YTMB 2LMCA 4YTPB 4L2YA 2JXTA 2SAKA 3BYTB 3AE9B 1TY0A 1QT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSD A;  1FCL A;  2K0P A;  2ONQ A;  3GB1 A;  1MPE A;  2N9K A;  1EM7 A;  1MHH E;  1QKZ A;  4IKG A;  2IGG A;  2PW9 A;  2JWU A;  1K50 A;  5BMG A;  2I38 A;  2EEL A;  1P7F A;  5BMI A;  1K53 A;  1Q10 A;  2KAC A;  5BMH A;  1PGA A;  1GB4 A;  3MP9 A;  4KGT A;  4D2K A;  1XCQ L;  1HZ5 A;  1K51 A;  1IGC A;  2RMM A;  2ZW0 A;  2KN4 A;  2GI9 A;  1P7E A;  2LUM A;  1XCT L;  2N7J A;  1IBX B;  4WH4 A;  2I2Y A;  2LGI A;  1MHX A;  2KQ4 X;  1ZXH A;  1XF5 L;  5JXV A;  4KGS A;  2ZW1 A;  2IGD A;  3FIL B;  1FD6 A;  1F2R I;  4IOI E;  4HKZ E;  4MAC A;  5HHD G;  4OZC A;  2IGH A;  1JML A;  4GLS C;  2JZP A;  1MVK A;  2QMT A;  2JU6 X;  2GB1 A;  2LHD A;  4KGR A;  1C9F A;  2KWD A;  4OZA A;  4HJG E;  1IBX A;  1FCC C;  1PGB A;  2KDM A;  1MI0 A;  2ON8 A;  2J52 A;  2RPV A;  1IGD A;  1K52 A;  1YMH E;  1UWX A;  1GB1 A;  3V3X A;  2J53 A;  1HEZ E;  1HZ6 A;  5HI1 A;  1YNT E;  2N9L A;  2LHE A;  3FIL A;  5HG2 A;  1F2R C;  2JSV X;  2PTL A;  5HFY A;  2PLP A;  1PGX A;  3UI3 A;  4OZB A;  2OED A;  2JXT A;  2NMQ A;  1KH0 A;  1D4B A; 
#chains in the Genus database with same CATH topology
 4J6I A;  5DPR A;  1L2N A;  2L1A A;  3ZJU A;  1TKY A;  2G4D B;  1D5M C;  1P0R A;  2MJE A;  2G45 B;  3AE8 B;  1QF6 A;  1T0Q C;  3AU4 A;  3NZU A;  5C23 A;  5BMH A;  5KHQ A;  2WXI A;  5C3J B;  2SEB D;  2FIF A;  4US9 A;  4FJZ A;  1YD8 U;  1XCQ L;  2LGY A;  1WJN A;  3ZYY X;  2LVQ A;  2NBV B;  3DBH I;  2GRI A;  4K1R B;  4KIK A;  4XDD A;  4K7U A;  4HEA 1;  2GI9 A;  4DXG A;  1AN8 A;  4H2A A;  5L83 A;  4JQW C;  3A33 B;  2WXM A;  2JUO A;  1I4H A;  1A5R A;  4IWO A;  2Z8L A;  3DDC B;  4I6N B;  3DVN U;  2GBR A;  4EZK A;  4I6P A;  3EHV A;  3APD A;  1GC7 A;  4HK2 A;  2KWV B;  4BVU C;  4K7S A;  4TQ1 A;  2BS2 B;  2Q5W D;  2BB6 A;  2MA9 B;  2LHD A;  2DZI A;  4KGR A;  3A4S C;  2L3Z A;  3HRD D;  3DHG C;  3MTN B;  3U30 A;  1WRD B;  1WZ3 A;  1GJZ A;  2DLB A;  4ITK A;  4MGK E;  1MI0 A;  3V61 A;  1T0R C;  3BWU D;  2JZ3 B;  1ZPS A;  3SD5 A;  2OJW A;  1BUI C;  3B0A A;  1UWX A;  3DVG X;  3HM6 X;  4MH8 A;  1R4N I;  4F7Z A;  1SGH A;  3M63 B;  2D3A A;  3AEG B;  1WX7 A;  1RWS A;  4AP4 C;  2D3C A;  4N59 A;  1AWD A;  4ICV A;  4XDC A;  4AJW A;  4BKT A;  3PRZ A;  1X1M A;  3AEF B;  3NUH B;  2WGS A;  2IZV B;  3C19 A;  2FCQ A;  1FFU A;  2MSE D;  1D5X C;  4GU2 A;  5LXI B;  4DDG D;  2INN E;  1XQQ A;  1MPE A;  3GE8 C;  1Q5W B;  1VR9 A;  1R4N B;  2N7E A;  3BY4 B;  5CHV C;  2BF8 B;  3V6C B;  2PW9 A;  3VR9 B;  4ZYN A;  2KD0 A;  4MSM B;  1LXD A;  3FC4 A;  4DXF A;  4M8N A;  1QLB B;  3IFW B;  4YSY B;  2Y5P A;  4BKG A;  2HJ1 A;  3GZN B;  2LXC A;  4LNO A;  1N62 A;  4M02 A;  1UGM A;  3ZGZ A;  1WM2 A;  2N7J A;  2X38 A;  4KV2 A;  3B2F A;  1KRH A;  2D07 B;  4W9H A;  2KQ4 X;  3DQV A;  3K9O B;  4IWP A;  2PKO A;  1UF0 A;  4EFO A;  3QIJ A;  2OHF A;  1OEY A;  3WA0 A;  3KW5 B;  1S3S G;  2MH7 A;  1YIW A;  2WDR B;  3HIZ A;  3AE4 B;  1C1Y B;  1V81 A;  1WR1 A;  1WJU A;  4MGZ E;  4JIO U;  4GDK A;  4E71 A;  2O6V B;  3AE5 B;  2M19 A;  2D3B A;  5FR3 A;  2M1M A;  1OQY A;  1EF5 A;  2KKC A;  3RCZ A;  1GUA B;  3EUB 2;  4JWS C;  4G0N B;  2IO1 B;  2PLP A;  2GOW A;  4YL8 A;  3ZUN A;  2J42 A;  5E6O A;  1E0Z A;  1VJK A;  2WLB A;  1C76 A;  2WXK A;  3M3J A;  5IAA C;  3ZRC A;  1VRA B;  2LJ5 A;  1SE4 A;  2MBO A;  1WWT A;  1WF9 A;  2V0G A;  1Q1O A;  1UD7 A;  2ONQ A;  2MCN B;  2L05 A;  1JW9 D;  1XEE A;  3LB8 C;  3BII D;  2EMT A;  1VD2 A;  2ZPY A;  4RGM A;  2LGD A;  1T5X D;  1F0Z A;  2WX0 A;  2JQR B;  2NTS A;  4USA A;  3OJ3 A;  4LCD E;  1Q10 A;  3APF A;  2RPQ A;  2Z0E B;  3ZRF A;  2G3Q B;  1OGW A;  2ZNV C;  4MEL A;  3QAR A;  3I3T B;  2MW5 A;  4JGH B;  1OFF A;  1HXY D;  4GSW A;  3AE6 B;  3RYT A;  3AEC B;  2J0J A;  1SEB D;  2JT4 B;  1V1P B;  5IKC M;  3TL5 A;  1QZE A;  2K22 A;  1I35 A;  4RFB A;  2WXH A;  4B95 A;  4NPN A;  4LDT D;  1FD6 A;  3ML9 A;  3R8B A;  1WGR A;  2W55 A;  1YQ3 B;  4IOI E;  5AZF A;  3SEB A;  4YSX B;  2N0S B;  2IGH A;  1L0Y B;  2CHW A;  5AEK B;  3MJ5 A;  2CKH B;  3UIN B;  2YEP F;  2BYT A;  3W1S C;  4ANW A;  4BKS D;  5LNK 1;  4HPP A;  3E56 A;  3OWE B;  4ZRJ A;  1XLQ A;  2D2Q A;  1E8X A;  3P2B A;  3RN9 C;  4HJK A;  4DWF A;  1RFK A;  1AW7 A;  1YJ1 A;  2KTR A;  2V9H A;  3RNG C;  1C3T A;  3DHH C;  4CHK A;  1ESF A;  1NBF C;  2KN5 A;  1K52 A;  4W9K A;  2WDV B;  4MGY E;  2KMC A;  4EKU A;  2N9X A;  4XE0 A;  2LJI A;  5T8I A;  3ZNH B;  1NVI D;  4HPM B;  1WH3 A;  2ZPN A;  2UYZ B;  1WE6 A;  2JYT A;  3BIN A;  3TUO A;  3NG0 A;  1EF1 A;  3UQA A;  4OVZ A;  4BOS C;  1BXT A;  3VR8 B;  3Q14 C;  3B08 A;  3NHE B;  2WP9 B;  4HVB A;  2B3A A;  2V3P A;  2XNA C;  2K8B A;  3KUC B;  1WYG A;  3O65 B;  5TR5 A;  3VTW A;  4E74 A;  3I9V 1;  2ZNV B;  4W9D A;  3SHQ A;  3IVF A;  5DCN A;  5JZE B;  1KFY B;  4B0E A;  2KVR A;  4KGT A;  2JRH A;  5AZG A;  2GBJ A;  5G2N A;  3TEY A;  4IG7 B;  1NEN B;  1LFD A;  1XO3 A;  4W9G A;  3CSF A;  2AWT A;  3GOE A;  3QCA A;  5GXG B;  2WDT B;  3DOW A;  2BS4 B;  1B1Z A;  4CYE A;  2KX0 A;  1E7U A;  1CJE A;  3DWG C;  3FIL B;  4ZRI A;  3R2T A;  3MHZ A;  1GPX A;  2DAF A;  2DHZ A;  3L0W B;  4WAF A;  1IP9 A;  5E6J A;  1UBQ A;  4LLG M;  1J0G A;  1E7V A;  2WXG A;  3UGB B;  3PGE A;  4AS1 A;  1QOB A;  2WU5 B;  4G50 A;  5CTR C;  4BOZ B;  4WWO A;  4PS3 A;  2PE6 B;  4QAY A;  2IPK D;  1WYW B;  1ZXI A;  3Q3O C;  4RGT A;  2YVC A;  4MSQ B;  1FXI A;  2KAN A;  3HHM A;  5HI1 A;  1TS3 A;  2KHW B;  1HA5 A;  1EU3 A;  3N1X C;  3SFE B;  2NTT A;  1M4V A;  2KTR B;  3NVV A;  2L0T A;  5DPW A;  4WAA A;  1STE A;  4C00 A;  1B9R A;  3QC8 B;  2LMC A;  3ZNI D;  4L2Y A;  4S0R A;  3AE9 B;  1TY0 A;  1QT9 A;  3MC8 A;  3ZIM A;  3SDL C;  4EE2 A;  2YLM A;  3GZN I;  4IM3 A;  2REX A;  4NAW A;  5JHA A;  2C9W B;  4K3C A;  1WMH B;  2J0M A;  2KDE B;  1DOY A;  3A1Q A;  5BMG A;  2AQ2 B;  1K53 A;  3MC0 B;  4L1B A;  1WR6 E;  4DXA B;  1KTK A;  3I57 A;  3ZVV A;  2NBW B;  1EWC A;  2WXR A;  3V05 A;  3DCG A;  1SXT A;  2WDQ B;  4CQN A;  1SJE D;  3H7S A;  2BYV E;  1K8R B;  2K5P A;  4LJO B;  1V2Y A;  1QOF A;  1FNW A;  2ZZP B;  3RI7 C;  4W9F A;  2FID A;  1DYQ A;  2O6V D;  3NZ3 A;  3H7P A;  4US8 A;  4NQL B;  4HCP B;  4MAC A;  3U2S C;  3H1U A;  2KMA A;  5MPO A;  2DBY A;  1VCB A;  4N58 A;  4C7Z A;  1LGR A;  2XBB C;  4O1N A;  1HQR D;  3DVG Y;  2J0K A;  2FCS A;  4ASW C;  1T6B X;  1SE2 A;  4WUR A;  2X8X X;  3IG3 A;  4OVU A;  4W9L A;  3CWI A;  2BWE S;  2CJO A;  3BZD B;  4II2 B;  2C7N B;  4URK A;  1TGZ B;  2JWZ A;  4BBN F;  3OLM D;  2W3S A;  3W9C B;  4GMV A;  4XX5 A;  1N60 A;  3Q69 A;  1I4X A;  4KZC A;  3Q6B A;  2M56 B;  3B9J A;  2V1Y A;  2LHE A;  3DVN V;  1JRO A;  3CF6 E;  5IP4 D;  3GP7 A;  1C79 A;  1Z2M A;  2BKR B;  3ZNG C;  5G5G A;  3APC A;  3ZXV A;  2L83 A;  5GMV A;  2PMV A;  4A90 A;  4FAD A;  2LFI A;  4KZ0 A;  1XT9 B;  4M00 A;  3IXS A;  3LXF A;  1L4Z B;  5LXH A;  2KFJ A;  2Y5C A;  3EC8 A;  4OW0 A;  1L7Y A;  3W5U B;  1L6U A;  2W82 A;  1NDD A;  2WX1 A;  4IKG A;  5D2M B;  1I4P A;  5EE3 A;  2I1J A;  3P1M A;  1RFA A;  3IBE A;  3ZKJ C;  4F8C B;  3NS8 A;  2KX3 A;  1EO6 A;  4WIP A;  3WAL A;  5TSS A;  4P16 A;  2WS3 B;  3AE3 B;  2PEA A;  3QK0 A;  2RMM A;  2GMI C;  4FA6 A;  1UUP A;  2XN9 C;  2WXP A;  4KKI A;  2FE8 A;  4HDQ A;  3ZJT A;  4WQM A;  4DK5 A;  3DBR B;  2N9E B;  1XLN A;  3BYT B;  1TZ1 A;  3WIM A;  2AL6 A;  3LDZ E;  2JF5 A;  4J3O D;  2H89 B;  2NR2 A;  1V1O A;  1CK1 A;  3R7R A;  4P7I A;  3RUL A;  3EGR A;  2FCN A;  1P1A A;  1DOI A;  1MVK A;  2HD5 B;  1MG8 A;  2DEN B;  3QAQ A;  2NPT A;  5D3D A;  5H8Y E;  4MDK E;  3Q3M C;  2DZK A;  3C0R B;  1LQB A;  2LGX A;  2C5L C;  1SIF A;  1WX9 A;  4FN2 A;  2M8S A;  1DGJ A;  5LLI A;  2OOB B;  3SR6 A;  1I42 A;  4N9F 4;  2HE7 A;  1L0X B;  2VRR B;  1J7A A;  4B0M A;  1JRU A;  4FJY A;  4E3C A;  3U8Z A;  2R61 A;  1OQQ A;  2CHZ A;  1WX8 A;  1PGX A;  4NNJ B;  1D5Z C;  1UGJ A;  3FAH A;  3KWV A;  3N30 A;  4G3X B;  3KVF B;  5EE0 A;  5JHB A;  3H6N A;  2N7D A;  1VDV A;  2G9H D;  2KXJ A;  4GDL A;  4BBN C;  3TJP A;  2EKI A;  3R3M A;  1EM7 A;  4RM9 A;  1YQB A;  4YWG G;  2IY0 B;  2MX2 A;  4WJQ A;  4KKJ A;  2QDF A;  1ACC A;  2EEL A;  4P6V F;  4NQK E;  4RGN A;  3MJW A;  1GB4 A;  4TKN A;  2KVZ A;  2KAJ A;  2DZJ A;  3U7Z A;  3AMZ A;  2MP2 B;  4RF1 A;  5AZH A;  3BVM A;  4II3 B;  4RH6 A;  2PE9 A;  2BBC A;  2I2Y A;  4ZYS A;  3ZJV A;  1M94 A;  2MHJ A;  1TTN A;  3PLV A;  2GLS A;  2KLG A;  2VH2 A;  4OZC A;  1D3Z A;  3RUI B;  3X0W A;  3VUW A;  3K9P B;  2LZ6 A;  3VAW A;  3B1L X;  4EUT A;  1TJE A;  3AE1 B;  2IYD B;  5D7G A;  1E5W A;  3PSE B;  3BK2 A;  2QC8 A;  3NVZ A;  2HTM E;  1FM0 D;  4MJS B;  1PGB A;  3BK1 A;  1WGD A;  2KK8 A;  2ON8 A;  2V4L A;  1C4P A;  1TIF A;  3VH3 B;  5FKA C;  1SB3 C;  4ARI A;  2FUG 1;  3PRE A;  4ANV A;  2Y5B B;  4DQO C;  4I6L B;  2M0A A;  4C4V B;  3AE7 B;  3NS1 A;  1GNU A;  2PJH A;  4IM2 A;  2A5U A;  4OZB A;  1KH0 A;  1J7C A;  1YQ4 B;  2JY6 A;  1WXV A;  2KZR A;  3GB1 A;  3NY5 A;  3RNA C;  1T0Y A;  1ZDX A;  2IO2 B;  3H8H A;  1L0V B;  4YSZ B;  1ZE3 D;  3NZS A;  4XWT A;  4DHZ B;  2H88 B;  3L17 A;  3P4S B;  3LJ3 A;  4WWN A;  2V4I B;  1PGA A;  2QHO A;  2KFK B;  3PLU A;  3VVW B;  4HLE A;  1F52 A;  1IUE A;  3ZNZ B;  1XXG A;  3V62 A;  2ZW0 A;  2L00 B;  5AUI A;  4LNK A;  1UBI A;  2K8C A;  3T9L A;  3P4Q B;  3VFK A;  3PT2 B;  1ZDV A;  5IA7 A;  4NY0 A;  2ZW1 A;  3VUY A;  2K3U A;  5HHD G;  1LM8 B;  4JPS A;  3ZDM C;  2G1E A;  3P63 A;  2MJ3 A;  3VQI A;  1TYG B;  3AE2 B;  3CST A;  4OZA A;  4G11 A;  3KUD B;  4M01 A;  3N9Y C;  1Q0W B;  1F77 A;  4AJY B;  3Q8B A;  4CO7 A;  2ASQ A;  1IGD A;  4LNF A;  4LK0 M;  2N9P C;  2LUE A;  3MFG A;  3URY A;  2EKE C;  1FRR A;  4YT0 B;  1F2R C;  1E8Y A;  2JPH A;  4NZL B;  2KWU B;  3EFU A;  5I4D A;  2BW2 A;  1JWB D;  3N3K B;  3V60 A;  2JYE A;  2PVG C;  2OED A;  1WGG A;  4YTM B;  2SAK A;  2WYQ A;  4W9J A;  2QSD A;  2PVO D;  1JWS D;  2L7R A;  5CX3 A;  1EU4 A;  1T3Q A;  3AB5 A;  4A8X C;  3IAM 1;  3Q3F A;  2N9K A;  3ZO5 B;  4FJV B;  1I4Q A;  1MJD A;  1SE3 A;  4MGI E;  1PDX A;  2K6D B;  3VH4 B;  1RRB A;  3ZTD A;  5CHF A;  4MEM A;  3X23 A;  4ZHP A;  1GC6 A;  4Q2J A;  4D2K A;  2C60 A;  4TQ0 A;  2CU1 A;  1NYR A;  5E6P A;  4GN1 A;  3DBL B;  1WY8 A;  1EWY C;  1XCT L;  1IBX B;  4WH4 A;  1J19 A;  4ANU A;  2W9N A;  2KJH B;  2KC2 A;  1KOT A;  1ZXH A;  2O6V A;  1Z5S B;  3ECI A;  3Q8A A;  2BKF A;  1KLU D;  2K25 A;  3PZ8 A;  2BGF A;  4DHZ E;  3EEC A;  2PIA A;  1VZ7 A;  3AED B;  3M95 A;  2D3G A;  4TUU A;  3JVZ X;  1SBB B;  3RNF C;  2DX5 B;  1WXA A;  3HK0 A;  3UIP B;  2W3R A;  4KSL C;  4EOY A;  2MP2 A;  2R2Q A;  2BB5 A;  4YXD B;  3ALB A;  1WZ0 A;  1GB1 A;  2J53 A;  5EE1 A;  3AXC A;  3MC9 A;  2L8J A;  1FRD A;  4RNA A;  1YX5 B;  3JW0 X;  5DPT A;  1WSP A;  2DZM A;  2LAS A;  3PRM B;  2RSU A;  4KVG B;  5H92 C;  4HPL B;  1HE8 A;  2KJR A;  2MBE A;  1V9J A;  1NYQ A;  1E7P B;  3Q8C A;  2WHI A;  3NJT A;  1IYF A;  2B76 B;  1UZX B;  2YEP B;  5IN7 A;  2XEW A;  1FMA D;  4IDI A;  1KLG D;  1SF0 A;  1FNV A;  4W9I A;  1L4D B;  4F1S A;  1HTO A;  1TZO A;  4WWM A;  3TEZ A;  3NVW A;  1ENF A;  5G5H A;  2IJ0 A;  2IY1 B;  3VXW A;  4ACF A;  4DHJ D;  3AI5 A;  1I4R A;  4ARC A;  1C4A A;  1AYF A;  1V5T A;  2IBI B;  3AEB B;  2RGF A;  2GBK A;  1RAX A;  3OG5 A;  1F9J A;  4MM3 B;  4RGO S;  5HKH A;  3AUL A;  3B2G A;  5FR6 A;  1RYJ A;  2KC1 A;  2DYO A;  4JL9 A;  4NAM A;  2MRP A;  2WXJ A;  4FHK A;  1VLB A;  2N4F A;  3MHS D;  2ZCB A;  4HDO A;  4JE3 B;  1V6E A;  1SJH D;  3QWZ B;  4LJP B;  2V3S A;  3ZTC A;  5E6N A;  2J4X A;  2LRW A;  3N32 A;  2KDF B;  1E8W A;  2PTL A;  4KIK B;  3QX1 A;  2KNB A;  1RLF A;  2AQ1 B;  4AOF A;  4K3B A;  3UI3 A;  4ZDV A;  2JRI B;  1WRI A;  4RF0 A;  1J7B A;  2K6Q A;  3VDZ A;  2INC C;  3VTU A;  4ICU A;  1JWA D;  3VRB B;  1V49 A;  3HM3 A;  3KLS X;  5D94 A;  2AEH A;  3RT3 B;  2LD9 A;  3DBS A;  3A9K B;  1A70 A;  4M8M A;  3P4P B;  4GGQ A;  3W2D A;  2IDY A;  5C1Z A;  1BT0 A;  4BFR A;  2IO0 B;  1EUV B;  1P7F A;  2RR9 A;  5BMI A;  2KAC A;  3ENE A;  4FXC A;  1E6E B;  5J18 A;  1KF6 B;  1V8C A;  5BYQ A;  3VTV A;  5L95 C;  1CQV A;  1ZGU B;  3PZ7 A;  3IAS 1;  4BKS A;  3D32 A;  3QQ8 B;  2AYO B;  3CIR B;  2WNM A;  1TKE A;  2DNF A;  1PUT A;  5J17 A;  4C7Y A;  2E3T A;  1WGY A;  4IM0 A;  1XD3 B;  3W1Y A;  1E9M A;  3NVY A;  3U52 E;  4ZRK A;  3RZF A;  1PQS A;  2A4Z A;  3IHP C;  4L23 A;  4KX6 B;  2CU3 A;  1F2R I;  3WAP A;  2QJL A;  1F1H A;  4XYC A;  1QQR A;  1JML A;  1DOX A;  4A20 A;  3PHX B;  4HWI B;  3DHI C;  2HTH A;  2MBH A;  2JU6 X;  4KDL B;  4HXD A;  1NI2 A;  1RM6 C;  3AM9 A;  4HJG E;  3ABV B;  4REZ A;  1ET9 A;  4B6W A;  3OJ4 B;  1Y56 A;  3RPF C;  1ZKH A;  4LNI A;  1QOG A;  2JX5 A;  1HEZ E;  3DBH B;  1Y8R C;  5CHW A;  3J9C A;  4GDK B;  4ZOH C;  3Q8F A;  3JSV B;  2KJ6 A;  3RNE C;  3A1Q B;  2KTF A;  1H8C A;  2N1W A;  2L76 A;  1C78 A;  2OJR A;  1OTR B;  2CS4 A;  3DBL I;  1OQR A;  1GG3 A;  3TBL D;  2BQQ A;  2BTE A;  2IGG A;  3L08 A;  1WGK A;  2RD0 A;  3W1S A;  2K1F A;  3C8Y A;  2KLC A;  3QA8 A;  4JLC A;  1UNS A;  1C4C A;  2RDH A;  2D11 A;  1E90 A;  3L10 B;  2BS3 B;  2NBU A;  2WU2 B;  4A6Q A;  3T8M A;  3QJZ A;  2LVP A;  4XGA B;  2CJN A;  1ROE A;  3L54 A;  2RDG A;  1MHX A;  3L4P A;  4PT5 A;  2MQJ A;  2IGD A;  1N61 A;  2BYE A;  3DWM A;  2WXO A;  1NI3 A;  3L16 A;  3RFZ B;  4HKZ E;  4JX1 C;  1XLO A;  3UF8 A;  4PYZ A;  3OAW A;  1UH6 A;  1QOA A;  2ZEQ A;  3HVD A;  1BML C;  2GB1 A;  2IO3 B;  3WAM A;  4EEW A;  3N1Y C;  2KDI A;  2KDB A;  1N63 A;  1FPY A;  2ACZ B;  2J52 A;  2UWQ A;  2K39 A;  3PRP B;  4FLH A;  5AUK A;  5IO9 A;  2E6X A;  3Q3N C;  2ZCC A;  3H7P B;  1FFV A;  2KWC A;  2HJ8 A;  2LGS A;  3JYU A;  1P98 A;  1TS4 A;  4FBJ B;  1YJJ A;  4DHJ B;  4MT5 A;  3KQ4 A;  4GB9 A;  3PVL A;  4ZHO A;  3ZXR A;  3R7Q A;  2JXT A;  5BO4 B;  3E9S A;  1FCL A;  2AX5 A;  2L52 A;  3O13 A;  4YTN B;  2GBM A;  3BVZ A;  3PZD A;  3Q2A C;  1QIL A;  2I1K A;  2KQS A;  2QIE B;  2RDB C;  1N5X A;  3VHT C;  4P1B C;  2VH1 A;  4ANX A;  3EA6 A;  2R2O A;  3W5V B;  1MFW A;  1FXT B;  1P9D U;  4IUM B;  5DPS A;  4DBG A;  2QCZ A;  1MG4 A;  2MBB B;  2G4S A;  1JWM D;  2W54 A;  2LUM A;  2NPT B;  3PO0 A;  2NS5 A;  3ZW3 A;  3Q3J A;  4PS8 A;  5BYS A;  5JXV A;  3IT4 B;  2KFK A;  4RM8 A;  1ISN A;  4K81 A;  3T3N A;  2NVU I;  2ZVN A;  2JZP A;  4GIV A;  4HKQ A;  3S2A A;  3TEW A;  2Z0D B;  4WWP A;  2BT6 A;  3KUZ A;  4TV3 A;  2KWD A;  1I4G A;  3AV8 A;  1U4A A;  2JXX A;  3VUX A;  3KYD D;  1WJ6 A;  2D5G A;  4KSK C;  1ZP0 B;  5FK9 C;  4MH0 E;  4W9E A;  4M0W B;  2DYM A;  5G55 A;  4PS7 A;  1SIJ A;  2KMM A;  1GOZ A;  3U4E G;  1I7H A;  4FUL A;  1HZ6 A;  2KYW A;  4WQO B;  3GS2 A;  1KJT A;  2FAZ A;  2L32 A;  4PYU A;  4B9K A;  1TY2 A;  2VZK B;  1JRP A;  1J8C A;  1TS2 A;  4WJN A;  2KQ7 A;  4MM3 A;  2DWQ A;  1YJI A;  2NMQ A;  1JCK B;  4PK1 A;  3SFD B;  2XK5 A;  1WMH A;  1UWM A;  1FO4 A;  3TSS A;  1QKZ A;  3M62 B;  3RNC C;  2BVC A;  2KO3 A;  4TMA B;  2WWZ A;  3AU5 A;  2MLB A;  2CR5 A;  3RMK C;  5D3I B;  4OVV A;  1R4M I;  1V1P A;  2FCM A;  1E8Z A;  2FNJ B;  3KWL A;  4XZ4 A;  3ZDT A;  1WI0 A;  2L0F A;  4A3P A;  2O2V B;  4UDU C;  2GBN A;  4ZRQ A;  1P7E A;  3I63 C;  4NAW B;  1YOV B;  4AWJ A;  2IND C;  3GE3 C;  1T0S C;  2K9X A;  3ZLZ A;  5IOI A;  1WGH A;  3TIX A;  3WAN A;  2BYF A;  4MJS A;  2J7Q B;  3IT6 B;  4IC7 B;  3UIO B;  1LO5 D;  5EDS A;  1V86 A;  4GLS C;  2HDE A;  2QMT A;  1TKG A;  1IPG A;  1L5P A;  1V5O A;  3ONS A;  3Q8E A;  3RD2 A;  2INP E;  4XC2 A;  1CZP A;  2XK5 B;  3I5J C;  4GXB A;  4BAX A;  4A55 A;  2PPH A;  3PTF C;  2DAJ A;  1IBX A;  4W9C A;  4LDT B;  1N5W A;  2RPV A;  3VRA B;  3TEX A;  3P42 A;  2LXA A;  4HCN B;  5EE9 A;  2MBQ A;  4WJP A;  2MJD A;  2V3N A;  4ZRP A;  5HG2 A;  3H9D A;  1AAR A;  5HFY A;  2EMS A;  1V97 A;  2ZVO A;  2CHX A;  2MWS B;  1PYW D;  4WJO A;  3WCQ A;  4TSS A;  4NJC A;  3RZW C;  4HRS A;  4M0W A;  1D4B A;  2MEK A;  1YN4 A;  4RMA A;  2K0P A;  3NRZ A;  3N1Z C;  3TCA A;  5BYR A;  5D6J B;  2AQ3 B;  4K7W A;  2JZZ A;  1JAL A;  3L13 A;  3AN1 A;  3UQB A;  2TSS A;  3FKY A;  2JVC A;  3BVG A;  4LTU A;  1KLV A;  1UEL A;  1R4M B;  1K51 A;  1IGC A;  1WIA A;  2C7M B;  1V80 A;  2BWF A;  5J2R A;  2D10 A;  2KN4 A;  1ZUD 2;  1SE9 A;  4N6E B;  4IW0 A;  4NJ7 A;  2M4N A;  2LVO A;  1TT5 B;  1TBE A;  1XF5 L;  2UU7 A;  1E10 A;  3R2I A;  4AQ7 A;  3R66 C;  2O2V A;  1FXA A;  1C77 A;  2QIL A;  2M17 A;  1R7S A;  1NEK B;  2WQY B;  1WXS A;  2WXF A;  1WXQ A;  2KOX A;  3BYY B;  1WFY A;  2LI5 A;  1P3Q U;  3JSV A;  1YN5 A;  1FCC C;  2M0X A;  4FHJ A;  3T3O A;  2K8H A;  3AEE B;  4S17 A;  1WXM A;  3WAO A;  3V3X A;  2KT7 A;  1L6V A;  1YNT E;  1SSN A;  3ETR A;  4JWU C;  1JWU D;  3FIL A;  4NJ6 A;  1S1Q B;  2JSV X;  4KDI C;  4R3D A;  1FIQ A;  3DPD A;  1WE7 A;  3V6E B;  1VZ8 A;  3A9J B;  4GDL B;  1FEH A;  3ZQ4 A;  3TMP B;  1ZOY B;  3PV1 A;  1TS5 A;  2LEK A;  3A9K A;  5JH5 C;  3AEA B;  3LYY A;  1H4R A;  3N20 C;  3PS6 A;  1MHH E;  2VZK D;  1CMX B;  3KH0 A;  1WM3 A;  1OEY J;  2JWU A;  1K50 A;  2WXQ A;  1GAQ B;  2I38 A;  2WXN A;  3EFC A;  1JQ4 A;  3KYC D;  5KHO A;  1YN3 A;  3AH7 A;  3HUI A;  1ET6 A;  3RNB C;  4XWW A;  4BZA A;  3MP9 A;  2N1V A;  1HZ5 A;  4GOC A;  2NCN A;  3ML8 A;  3QHT A;  4X57 B;  2FUH B;  4C80 A;  2LRU A;  4LNN A;  3PHW B;  2LGI A;  1XLP A;  4C4V A;  4KGS A;  4OHJ A;  1VZ6 A;  4A3O A;  5C2T B;  1KM7 A;  2LWP A;  1FNU A;  3HVZ A;  4AUQ C;  1PFD A;  1C9F A;  2BPS A;  4A9A A;  4DDI D;  3A4R A;  4EZL A;  2DYB A;  1D6E C;  1HTQ A;  4RCO A;  2C7H A;  4IWQ A;  2KDM A;  2ZJD A;  2AL3 A;  3NOB A;  3CMM B;  1YMH E;  3SU8 X;  4C56 C;  2QEJ C;  3P4R B;  4HRO A;  2N9L A;  3U7D A;  3A9J A;  2ICI A;  2Z59 B;  2FBW B;  1N6Z A;  3DBR I;  1YX6 B;  2Y3A A;  1ZW7 A;  2WXL A;  3PPA A;  1WJ4 A;  1G6J A;  4YTP B;  4EZJ A;  4P1C C; 
#chains in the Genus database with same CATH homology
 3E9S A;  2QSD A;  4EE2 A;  2AX5 A;  1FCL A;  2L52 A;  1JWS D;  2PVO D;  2L1A A;  1EU4 A;  3O13 A;  1TKY A;  1T3Q A;  3AB5 A;  4YTN B;  3ZJU A;  1D5M C;  4A8X C;  3IAM 1;  2MJE A;  2N9K A;  3BVZ A;  3AE8 B;  1I4Q A;  1SE3 A;  1QIL A;  1QF6 A;  1PDX A;  2QIE B;  1N5X A;  1DOY A;  5BMG A;  3EA6 A;  3W5V B;  2AQ2 B;  1K53 A;  3MC0 B;  5BMH A;  4ZHP A;  2WXI A;  4L1B A;  5C3J B;  2SEB D;  4US9 A;  4Q2J A;  4D2K A;  1XCQ L;  1KTK A;  3I57 A;  4TQ0 A;  3ZYY X;  1EWC A;  2WXR A;  3V05 A;  1NYR A;  2GRI A;  4XDD A;  1SXT A;  2WDQ B;  1JWM D;  4HEA 1;  2GI9 A;  4DXG A;  2W54 A;  4CQN A;  1SJE D;  2LUM A;  1AN8 A;  2K5P A;  4H2A A;  1EWY C;  1XCT L;  1IBX B;  1QOF A;  1FNW A;  2WXM A;  3PO0 A;  4WH4 A;  1I4H A;  2Z8L A;  1ZXH A;  5BYS A;  1DYQ A;  5JXV A;  3NZ3 A;  3IT4 B;  4US8 A;  4MAC A;  3Q8A A;  3T3N A;  1KLU D;  3U2S C;  3PZ8 A;  2JZP A;  5MPO A;  4HKQ A;  2DBY A;  2PIA A;  4TQ1 A;  1VZ7 A;  3AED B;  4N58 A;  2BS2 B;  2Q5W D;  2BB6 A;  4O1N A;  1HQR D;  4C7Z A;  3TEW A;  2LHD A;  2BT6 A;  4KGR A;  1T6B X;  1SE2 A;  2KWD A;  3HRD D;  4WUR A;  1I4G A;  3AV8 A;  1SBB B;  3CWI A;  2CJO A;  3BZD B;  2D5G A;  2DLB A;  4ITK A;  1MI0 A;  1ZP0 B;  2W3R A;  2W3S A;  5FK9 C;  3BWU D;  3W9C B;  1ZPS A;  2DYM A;  1N60 A;  1SIJ A;  1BUI C;  2BB5 A;  1GOZ A;  2KMM A;  3Q69 A;  4YXD B;  1UWX A;  1I4X A;  1I7H A;  3U4E G;  2M56 B;  4MH8 A;  1GB1 A;  2J53 A;  1HZ6 A;  3B9J A;  5EE1 A;  2LHE A;  3AEG B;  1JRO A;  1RWS A;  3GS2 A;  1FRD A;  3GP7 A;  4N59 A;  2L32 A;  4RNA A;  1C79 A;  1AWD A;  5G5G A;  1TY2 A;  4XDC A;  2VZK B;  1JRP A;  3AEF B;  3NUH B;  1WSP A;  1TS2 A;  2L83 A;  4A90 A;  2PMV A;  1FFU A;  2LFI A;  5H92 C;  3IXS A;  1D5X C;  2DWQ A;  1YJI A;  2NMQ A;  3LXF A;  1L4Z B;  1JCK B;  2INN E;  3SFD B;  2Y5C A;  1NYQ A;  4OW0 A;  1MPE A;  1UWM A;  1FO4 A;  3TSS A;  3W5U B;  1E7P B;  3Q8C A;  1L6U A;  1VR9 A;  1QKZ A;  2W82 A;  2B76 B;  4IKG A;  4TMA B;  1I4P A;  2PW9 A;  5EE3 A;  3VR9 B;  3P1M A;  2YEP B;  1FMA D;  5D3I B;  1V1P A;  4IDI A;  1KLG D;  3FC4 A;  1SF0 A;  3KWL A;  4DXF A;  1FNV A;  4WIP A;  1L4D B;  4YSY B;  1QLB B;  5TSS A;  4P16 A;  2WS3 B;  2Y5P A;  3AE3 B;  2RMM A;  4UDU C;  1TZO A;  1UUP A;  4WWM A;  4ZRQ A;  1N62 A;  3TEZ A;  1P7E A;  2XN9 C;  3NVW A;  4NAW B;  2WXP A;  4KKI A;  3ZGZ A;  2N7J A;  2X38 A;  2FE8 A;  3ZJT A;  3B2F A;  1KRH A;  4WQM A;  1ENF A;  5G5H A;  2K9X A;  1XLN A;  2KQ4 X;  2IJ0 A;  2PKO A;  4J3O D;  2H89 B;  1V1O A;  1CK1 A;  3IT6 B;  2OHF A;  1LO5 D;  1I4R A;  3EGR A;  4ARC A;  4GLS C;  1C4A A;  1AYF A;  1DOI A;  1MVK A;  2HDE A;  3AEB B;  2MH7 A;  2QMT A;  1TKG A;  5D3D A;  1L5P A;  2WDR B;  3Q8E A;  5H8Y E;  4MM3 B;  4RGO S;  3AE4 B;  3B2G A;  2INP E;  1CZP A;  4A55 A;  1RYJ A;  2DYO A;  4NAM A;  2WXJ A;  1IBX A;  1VLB A;  4JE3 B;  1DGJ A;  1N5W A;  2RPV A;  3AE5 B;  3VRA B;  3TEX A;  2M19 A;  3SR6 A;  5FR3 A;  3P42 A;  1SJH D;  5EE9 A;  1L0X B;  1J7A A;  4B0M A;  2MJD A;  2V3N A;  4ZRP A;  3EUB 2;  2J4X A;  4JWS C;  5HG2 A;  2PTL A;  5HFY A;  2PLP A;  2R61 A;  1V97 A;  1OQQ A;  2J42 A;  1E0Z A;  2AQ1 B;  1PYW D;  1PGX A;  1D5Z C;  1VJK A;  1C76 A;  1UGJ A;  2WLB A;  2WXK A;  3FAH A;  3KWV A;  4TSS A;  4NJC A;  3UI3 A;  3WCQ A;  1WRI A;  5EE0 A;  1VRA B;  4RF0 A;  1SE4 A;  4HRS A;  4M0W A;  1J7B A;  1D4B A;  2MEK A;  1WWT A;  1YN4 A;  1VDV A;  2G9H D;  2V0G A;  1JWA D;  2K0P A;  3VRB B;  2ONQ A;  3KLS X;  2EKI A;  1JW9 D;  3NRZ A;  1XEE A;  1EM7 A;  3BII D;  3LB8 C;  5BYR A;  1A70 A;  4YWG G;  4RGM A;  3P4P B;  3W2D A;  1T5X D;  2IDY A;  4KKJ A;  1F0Z A;  1ACC A;  2JQR B;  2AQ3 B;  2EEL A;  1P7F A;  2NTS A;  4USA A;  5BMI A;  1JAL A;  1Q10 A;  2KAC A;  3AN1 A;  4P6V F;  2TSS A;  1E6E B;  4FXC A;  1KF6 B;  1V8C A;  5BYQ A;  4RGN A;  1GB4 A;  3BVG A;  1CQV A;  4LTU A;  2KAJ A;  3U7Z A;  1K51 A;  1IGC A;  3PZ7 A;  1OFF A;  1HXY D;  3IAS 1;  3AMZ A;  2KN4 A;  4RF1 A;  3CIR B;  1ZUD 2;  3AE6 B;  2WNM A;  3BVM A;  4N6E B;  1TKE A;  4RH6 A;  3AEC B;  1PUT A;  1SEB D;  1V1P B;  4C7Y A;  2BBC A;  2E3T A;  2I2Y A;  4ZYS A;  3ZJV A;  1E9M A;  2K22 A;  3NVY A;  3U52 E;  4RFB A;  1XF5 L;  2WXH A;  4L23 A;  4KX6 B;  2CU3 A;  1FD6 A;  3R8B A;  2W55 A;  1F2R I;  1YQ3 B;  4IOI E;  4YSX B;  3SEB A;  2QJL A;  1E10 A;  3R2I A;  2N0S B;  4OZC A;  4AQ7 A;  2IGH A;  1L0Y B;  1QQR A;  1JML A;  3MJ5 A;  1DOX A;  2YEP F;  1FXA A;  1C77 A;  2BYT A;  2QIL A;  1TJE A;  3AE1 B;  2JU6 X;  5D7G A;  5LNK 1;  1R7S A;  1NEK B;  2WQY B;  2WXF A;  3E56 A;  3OWE B;  1XLQ A;  1WXQ A;  1RM6 C;  3AM9 A;  4HJG E;  3BYY B;  3ABV B;  3BK2 A;  4REZ A;  1ET9 A;  1RFK A;  1AW7 A;  1YN5 A;  2HTM E;  1FCC C;  3NVZ A;  1FM0 D;  1Y56 A;  1PGB A;  3RPF C;  3BK1 A;  2ON8 A;  3T3O A;  1C4P A;  1QOG A;  1ESF A;  1K52 A;  3AEE B;  2JX5 A;  5FKA C;  1SB3 C;  2WDV B;  4ARI A;  2FUG 1;  3V3X A;  1L6V A;  1HEZ E;  4DQO C;  1YNT E;  2M0A A;  1SSN A;  4XE0 A;  3ETR A;  2LJI A;  1JWU D;  3FIL A;  4JWU C;  3AE7 B;  5T8I A;  3NS1 A;  3J9C A;  2JSV X;  4GDK B;  4R3D A;  4ZOH C;  1NVI D;  1FIQ A;  3Q8F A;  1VZ8 A;  2JYT A;  4GDL B;  1FEH A;  4OZB A;  3TUO A;  3ZQ4 A;  1KH0 A;  1ZOY B;  1C78 A;  4OVZ A;  1J7C A;  1TS5 A;  2LEK A;  1BXT A;  1YQ4 B;  3VR8 B;  3GB1 A;  3AEA B;  3LYY A;  1OQR A;  1ZDX A;  1MHH E;  2VZK D;  2WP9 B;  3H8H A;  1L0V B;  2BTE A;  2IGG A;  2V3P A;  2XNA C;  4YSZ B;  1ZE3 D;  1WYG A;  4XWT A;  2JWU A;  1K50 A;  2WXQ A;  1WGK A;  2H88 B;  1GAQ B;  2I38 A;  3I9V 1;  2WXN A;  3P4S B;  3W1S A;  1JQ4 A;  1YN3 A;  2V4I B;  3AH7 A;  3C8Y A;  1PGA A;  1KFY B;  3HUI A;  1ET6 A;  4B0E A;  4XWW A;  1UNS A;  3MP9 A;  1C4C A;  4KGT A;  2RDH A;  1IUE A;  1HZ5 A;  3TEY A;  1XXG A;  1NEN B;  1XO3 A;  2ZW0 A;  5AUI A;  2BS3 B;  2WU2 B;  4A6Q A;  3P4Q B;  5GXG B;  4C80 A;  2BS4 B;  1B1Z A;  2CJN A;  1ROE A;  2RDG A;  2LGI A;  1CJE A;  1MHX A;  3L4P A;  4PT5 A;  1ZDV A;  1XLP A;  4KGS A;  2ZW1 A;  2IGD A;  3DWG C;  1N61 A;  2K3U A;  3FIL B;  1VZ6 A;  3DWM A;  4OHJ A;  2WXO A;  1NI3 A;  5C2T B;  3RFZ B;  3R2T A;  4HKZ E;  3MHZ A;  5HHD G;  1GPX A;  4JX1 C;  1XLO A;  4WAF A;  5E6J A;  1FNU A;  4LLG M;  4JPS A;  2G1E A;  3P63 A;  3HVZ A;  1QOA A;  3HVD A;  1BML C;  2GB1 A;  2MJ3 A;  3VQI A;  1PFD A;  1TYG B;  2WXG A;  3AE2 B;  1C9F A;  4AS1 A;  1QOB A;  2WU5 B;  4A9A A;  4OZA A;  3N9Y C;  1D6E C;  1F77 A;  4RCO A;  1N63 A;  3Q8B A;  2KDM A;  2ACZ B;  2IPK D;  2J52 A;  1IGD A;  5AUK A;  1ZXI A;  4LK0 M;  1YMH E;  4RGT A;  2E6X A;  4C56 C;  1FXI A;  2QEJ C;  5HI1 A;  3MFG A;  3P4R B;  4HRO A;  1TS3 A;  3URY A;  1HA5 A;  1EU3 A;  2N9L A;  3SFE B;  2NTT A;  1FRR A;  1M4V A;  4YT0 B;  1FFV A;  1F2R C;  2ICI A;  3NVV A;  4NZL B;  1TS4 A;  1YJJ A;  5I4D A;  2FBW B;  2BW2 A;  4MT5 A;  1JWB D;  3KQ4 A;  2Y3A A;  2WXL A;  2JYE A;  2PVG C;  4ZHO A;  2OED A;  1B9R A;  1STE A;  4YTM B;  2LMC A;  4YTP B;  4L2Y A;  2JXT A;  2SAK A;  3BYT B;  3AE9 B;  1TY0 A;  1QT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...