5HI1A

Backbone modifications in the protein gb1 helix: aib24, beta-3-lys28, beta-3-lys31, aib35
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Immunoglobulin G-binding protein G
publication title Comparison of design strategies for alpha-helix backbone modification in a protein tertiary fold.
pubmed doi rcsb
total genus 11
structure length 52
sequence length 56
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5hi1A00
2GB1A 1Q10A 5BMGA 5BMHA 2ONQA 4KGSA 2N9LA 2QSDA 4D2KA 2JSVX 2I2YA 3UI3A 1K51A 1C9FA 4OZAA 1GB4A 2KDMA 4KGTA 5HFYA 3GB1A 1HZ6A 2QMTA 2K0PA 4HKZE 5HI1A 4KGRA 1FCCC 2IGGA 4MACA 1MI0A 4OZBA 2KQ4X 2JZPA 2KWDA 2LGIA 1MVKA 1K50A 1JMLA 2RPVA 2OEDA 1XF5L 2N7JA 2JXTA 2IGHA 5JXVA 1GB1A 2GI9A 1PGBA 2RMMA 2ON8A 1HEZE 2JWUA 1IGDA 2KN4A 1MPEA 4GLSC 2I38A 2ZW0A 2JU6X 3MP9A 1YMHE 1QKZA 1P7EA 3V3XA 1XCTL 2PLPA 1F2RI 2PW9A 1KH0A 1UWXA 5HHDG 1FD6A 1PGAA 1D4BA 1FCLA 1K52A 2LHEA 1K53A 4IKGA 1PGXA 1EM7A 4HJGE 4IOIE 1P7FA 2J53A 3FILA 2LHDA 1XCQL 4OZCA 1IGCA 2KACA 1MHXA 1IBXA 1HZ5A 2ZW1A 5HG2A 2PTLA 5BMIA 1YNTE 2IGDA 3FILB 2J52A 1MHHE 2EELA 1IBXB 4WH4A 2NMQA 2N9KA 1F2RC 1ZXHA 2LUMA
chains in the Genus database with same CATH superfamily
1YN5A 3RNEC 1D6EC 4P6VF 1GJZA 1BT0A 4JX1C 5LNK1 2D10A 4DDID 1WSPA 4K3CA 3W2DA 2MA9B 3Q3FA 1C9FA 4OZAA 3B08A 1N63A 3U8ZA 1YQ3B 3PZ8A 2AQ3B 4CO7A 5EE3A 4HLEA 1Z5SB 4YTNB 1HE8A 2RDGA 2YVCA 4J3OD 1DGJA 3WAPA 3DHHC 2O2VA 1WRDB 2KT7A 3BINA 2IPKD 4FULA 1OGWA 3QC8B 4BKSD 3X23A 3UGBB 1XF5L 3RYTA 4W9JA 2BYFA 2WXKA 4NAWA 2LJ5A 1UELA 2VZKB 2DZIA 3MFGA 4USAA 4A9AA 3NVYA 1T0SC 2PVOD 2BBCA 4WWPA 3KLSX 3ZVVA 3IG3A 5D3DA 3U2SC 2ZNVC 2KFKA 1C4PA 3W1SC 1XXGA 1I4RA 5C2TB 3B0AA 2BVCA 2ZW1A 4TSSA 3AE9B 2DENB 3B1LX 1I42A 4MELA 4C4VB 1WY8A 2JVCA 1XLNA 1VJKA 2LGDA 2IO2B 1TTNA 3ONSA 2JX5A 2JZZA 2IY1B 2MBEA 1E10A 3VVWB 3LDZE 4US9A 4WURA 2M0XA 2Y3AA 1VZ8A 1Q10A 3VDZA 1WMHB 2ZEQA 4REZA 2MH7A 3NOBA 4CQNA 4AUQC 4H2AA 2IJ0A 1E7VA 2KTRB 5BYRA 2GBMA 3AH7A 2J0JA 3U52E 3ECIA 3CSTA 3RD2A 4RGNA 3H6NA 4LK0M 4HCPB 1GPXA 2K39A 2J4XA 2IGGA 3SFDB 2WNMA 1IPGA 3ETRA 2BB6A 1N61A 4YTMB 4YSXB 1ESFA 3CF6E 4RNAA 1SGHA 2KAJA 4KKIA 4A3PA 4ZOHC 1PFDA 2DAFA 2KDFB 1EWYC 4LTUA 2WXGA 1UH6A 4KX6B 2K3UA 3SDLC 2ZPYA 4HRSA 3NVZA 4GDLB 1TZOA 3E56A 1BMLC 4AJWA 5LXIB 1UWXA 5GMVA 3W1SA 5AZGA 2D3AA 2HJ8A 5H8YE 2IYDB 5HKHA 2GBRA 2HE7A 1VR9A 3PRZA 5C23A 4L2YA 3ML8A 5HG2A 2PJHA 2V9HA 1HTOA 5BYQA 2JWZA 2E3TA 3VAWA 1ZDXA 4M02A 1STEA 2WDRB 3GOEA 2NMQA 1HTQA 4N59A 2FCQA 2E6XA 2BYTA 4C00A 3PHWB 1T0RC 2D5GA 1OTRB 1EU4A 2DLBA 1RFKA 2JYTA 3MHSD 2QSDA 3AE7B 1L7YA 4TMAB 2N9XA 4ZHOA 2JRIB 3TBLD 1VD2A 1GOZA 3HVZA 4PS7A 3ZO5B 2KWCA 1AYFA 1P98A 2Q5WD 1YJJA 1WJUA 5CHVC 1H4RA 4XDDA 1TY0A 1E90A 4GXBA 1BXTA 3W5VB 1RAXA 3DDCB 1D5XC 3RT3B 3M95A 2BQQA 2AQ1B 4HPMB 5J18A 3AE3B 2K9XA 1GC7A 1P0RA 4A20A 2N7JA 3TIXA 4YL8A 4K3BA 1WF9A 4G3XB 3ZIMA 3OJ3A 3VRAB 2KN4A 3R7RA 1VZ7A 3UIOB 2PVGC 2JF5A 2JU6X 3P4PB 2XNAC 4E74A 2K25A 1XCTL 3AMZA 1V81A 3UQBA 5EDSA 1NDDA 2R2OA 1R4MB 2MW5A 3ZJVA 2WGSA 1J7CA 4C4VA 1GC6A 1KF6B 4L1BA 3R8BA 3RPFC 2KJ6A 3A1QB 3VFKA 1SXTA 1HZ5A 4YSZB 4LNOA 1AWDA 3N1ZC 3SR6A 5FKAC 3IFWB 1ZE3D 3AU5A 3ZQ4A 2J52A 2L05A 1MHHE 1WMHA 4GDKB 4S17A 1MJDA 1OQRA 1F2RC 3RNAC 1NVID 4UDUC 4KDLB 2WU5B 3L13A 3PSEB 2KTRA 3PV1A 2ONQA 3U4EG 3WALA 4DHJD 2KOXA 2V1YA 1YJIA 3J9CA 1V2YA 3UI3A 2NS5A 4MGYE 1V1OA 3CWIA 3KW5B 3LYYA 4RM9A 2KHWB 3LB8C 3V6CB 1U4AA 1JALA 2A5UA 2HD5B 2K0PA 1F9JA 2L8JA 4KGRA 4TQ0A 2BYVE 3DHIC 3Q8AA 5IA7A 4HJKA 4DBGA 3PRPB 1WXSA 3TJPA 3N1YC 3U7DA 3OG5A 4KV2A 5L95C 2DYBA 2KDEB 4YWGG 1WIAA 2PE6B 3B9JA 3Q6BA 3NUHB 1E8WA 2W82A 4GDLA 2L0FA 4KIKB 1FEHA 2ZW0A 1B1ZA 4EE2A 4ZRIA 4RFBA 3V3XA 3IAM1 2FUHB 3ZXRA 2K8BA 2KTFA 1SEBD 3VTUA 1D4BA 3ZGZA 1UZXB 4TV3A 4W9GA 4B9KA 1WI0A 1V49A 1HXYD 2NTSA 2JY6A 2KQ7A 3R2TA 2KACA 4BKSA 2OHFA 1V97A 2QILA 1NYRA 5MPOA 1OQQA 2L3ZA 5E6JA 1ZKHA 1QQRA 4HCNB 5IOIA 2GMIC 4GU2A 2BGFA 2KN5A 1WX9A 2CHWA 2ZCCA 2LVPA 1UNSA 2PPHA 3ZNGC 1JW9D 4WAAA 3Q2AC 1A70A 1T0QC 2MP2B 4TQ1A 2WXMA 3AE2B 1EF1A 3VTVA 1JQ4A 4A90A 2D11A 1TKGA 2AX5A 1V1PB 2N7EA 3T3NA 4LNNA 5BO4B 2D3GA 4B95A 3P63A 1AARA 2WYQA 1SE2A 5IN7A 2VZKD 1AN8A 2DWQA 4MH8A 4A55A 1QOGA 4PT5A 4GN1A 2INDC 1N62A 3P4SB 1JRPA 5FK9C 2AQ2B 2INCC 1ISNA 1WR1A 3NZ3A 4BKTA 3KUCB 1C1YB 4KSLC 2HJ1A 1V5OA 4MH0E 4TKNA 2KLCA 2GI9A 3M62B 1WXAA 3AULA 1TIFA 2RMMA 3I9V1 3W9CB 5J2RA 2CJNA 4LNFA 1MPEA 1TS3A 4F1SA 1J0GA 3N9YC 4M8NA 3B2FA 4DHJB 3N3KB 1Q1OA 1F2RI 2JPHA 3A1QA 2BTEA 4P1CC 2PKOA 5G2NA 2BF8B 2K6QA 1GAQB 1I4HA 1FNWA 5DPWA 1E8YA 3Q8CA 4GDKA 1V86A 2C5LC 2L00B 4BVUC 3APCA 4WH4A 1T5XD 2BYEA 2ZCBA 5AZHA 4RGTA 2KMCA 1KOTA 3PLVA 2EKIA 2RD0A 2W3RA 5C1ZA 2EMSA 4FLHA 1TY2A 3ML9A 2FCNA 1EU3A 4WJOA 4M00A 4P16A 2M19A 5HFYA 2V4LA 1I4PA 3P42A 2ZPNA 3A4RA 2C7MB 1R4MI 4PS8A 4EZLA 2GOWA 2KDBA 5BYSA 4FA6A 4C7YA 3E9SA 2KNBA 1OEYA 3O13A 3WA0A 2WXNA 1C76A 4II2B 3V60A 2BS2B 2M17A 1V9JA 4W9IA 1KJTA 4KIKA 4WJNA 2INNE 3VH3B 1JWUD 2FBWB 5JXVA 3EA6A 3QQ8B 1NI2A 1HEZE 3WANA 2FAZA 2HTHA 1DOXA 4EZKA 3DQVA 4EOYA 3C0RB 2M0AA 3ZLZA 1PDXA 3PZ7A 1CK1A 3AECB 4PYUA 1JRUA 2L76A 1WRIA 2FCMA 3RNGC 2KFJA 4L23A 2YEPF 1MHXA 1MFWA 5D2MB 3AI5A 3C19A 4M8MA 3V05A 1ZP0B 1SIJA 3AEBB 3IAS1 3WAOA 1C4AA 2G4SA 1VRAB 4DXAB 2NBUA 2OJWA 1ZDVA 3VTWA 4HEA1 2RPQA 4RF1A 3SFEB 2Z0DB 2ZZPB 2MP2A 2Z0EB 2JUOA 1FO4A 2QC8A 5T8IA 1V1PA 1Z2MA 2G1EA 4ARIA 1J19A 2GRIA 3AE8B 2C7NB 3T9LA 4NAMA 4BOSC 3PT2B 3TUOA 2KVZA 4C56C 4HVBA 1R4NB 4P1BC 4MEMA 3K9OB 4S0RA 1FIQA 4DK5A 1L4DB 3Q69A 1N6ZA 1UBIA 3LXFA 3NS8A 2FIDA 1E6EB 3BYYB 2KQ4X 2WDTB 2XBBC 1MVKA 4AJYB 3OWEB 1Q5WB 4IM2A 3UF8A 1FM0D 2IZVB 2D2QA 4ZRKA 1GB1A 1OEYJ 1PGBA 2ON8A 3NRZA 4BBNF 3TEXA 1KLUD 2PMVA 2AEHA 4GLSC 2LZ6A 3U7ZA 3TEYA 4NZLB 4YT0B 1Y8RC 3TCAA 4GMVA 3L08A 4IM3A 3PGEA 1YJ1A 2ZVNA 2RSUA 1L6VA 2KXJA 3DBRB 5CHFA 1VCBA 2WXHA 3KYDD 4A3OA 1WFYA 1Q0WB 2WXFA 4BFRA 3FILB 1WZ3A 1F1HA 3M3JA 3W1YA 1E7UA 3BVZA 5D7GA 4O1NA 3NZUA 2C9WB 2BKRB 3PVLA 4ARCA 2KYWA 3PZDA 1QOBA 1TGZB 4PS3A 2Y5PA 3HRDD 1I4GA 4MJSB 1TBEA 4IG7B 4DXGA 1EO6A 4A6QA 3VUYA 1J8CA 5HI1A 3P2BA 2HDEA 4DDGD 1WYGA 2ZVOA 1TS5A 1FCCC 4LCDE 4MGIE 3L16A 3RZWC 2GBNA 3VH4B 3MJ5A 3AEEB 4ZRPA 4K7UA 4CHKA 1YIWA 3EECA 4G50A 1I4QA 3NZSA 2BT6A 5DPRA 2N0SB 2DZJA 2KMAA 5TR5A 2IY0B 2WXLA 2KVRA 1YN3A 4NQLB 3GE3C 1MG8A 2QEJC 3URYA 1TS2A 2GLSA 4G11A 2MHJA 3RMKC 1AW7A 4E3CA 3NJTA 3N1XC 3AXCA 1UUPA 2YLMA 3Q3JA 2LRUA 4YTPB 1VLBA 2MRPA 1ET9A 2DX5B 1PGAA 3ZRCA 4BKGA 2N7DA 3AU4A 4IOIE 4B6WA 2MCNB 2BKFA 3MC9A 1SE4A 5TSSA 4K7SA 3DCGA 4WIPA 2KZRA 4NJ7A 1XD3B 1UGMA 1P3QU 1YNTE 5CX3A 3L17A 4FJZA 2ZJDA 4GOCA 1RRBA 1XEEA 3U30A 2DYMA 4N58A 1CJEA 5IP4D 1QT9A 3UINB 5BMHA 1VZ6A 3KWVA 2WQYB 3HK0A 3BZDB 1X1MA 2CHXA 2KANA 1F52A 1WE6A 4ICUA 1SSNA 4OVVA 1BUIC 2FCSA 4AOFA 1HZ6A 4JL9A 4HPLB 4HDOA 4YXDB 1HQRD 3WCQA 1KM7A 3DBLB 1N5WA 1I35A 1MI0A 2W55A 2M4NA 1LXDA 3H8HA 1NBFC 3VUWA 2K6DB 3GZNB 2MEKA 1FFUA 2N1VA 1WM2A 4FHJA 3K9PB 4WWOA 1I4XA 1TKEA 2WDQB 4DHZE 3AE6B 1ENFA 3APFA 4N9F4 3KH0A 1JCKB 1EUVB 1IGDA 4A8XC 4K7WA 2MX2A 1PYWD 2NCNA 2W3SA 1CQVA 5IO9A 1YX5B 1YMHE 1GUAB 2WXJA 4RGMA 1QLBB 1WZ0A 1L6UA 5HHDG 4W9HA 4ANVA 3I57A 4ACFA 2FUG1 2LHEA 3DWMA 3CIRB 2BB5A 4US8A 4MM3B 2J53A 1V6EA 3FILA 1Y56A 3HVDA 1XCQL 4XDCA 2QCZA 3IT6B 4OW0A 3AE4B 5AZFA 2FE8A 1R4NI 1C78A 4ZRQA 2J0KA 3IT4B 2JZ3B 2KWUB 3BK1A 5D94A 1FNVA 2EELA 4JE3B 2CU1A 5JHAA 3ZJUA 2WXQA 3ABVB 4ANXA 5I4DA 1OQYA 1UWMA 3MHZA 2J7QB 2K5PA 2CR5A 4MJSA 1KRHA 4WJPA 2BWFA 4W9FA 1ZW7A 3H7PB 1EF5A 2XN9C 1K51A 3AEDB 2LJIA 4ANUA 4LNIA 3KQ4A 4R3DA 4GGQA 3N32A 1JWMD 1FXAA 4M01A 3SHQA 3ZTCA 4WJQA 1RWSA 1G6JA 2W54A 4HKZE 5KHQA 1V80A 1UF0A 1VDVA 2LD9A 4DQOC 1E8ZA 3A33B 4I6PA 2KWDA 3DBRI 2FNJB 2LWPA 1WJ6A 4PYZA 1JMLA 1JWSD 3TMPB 3AEFB 1WYWB 4JPSA 1ET6A 2C60A 2WS3B 1D3ZA 4IM0A 3MTNB 3SU8X 3ZW3A 1FNUA 2WLBA 2MBBB 1JROA 4RCOA 4EZJA 1GG3A 2KMMA 2KD0A 3MP9A 2KKCA 3HM6X 1QKZA 4M0WB 3P1MA 1J7BA 2L83A 2WHIA 3ZJTA 2QJLA 1UBQA 1CMXB 1K52A 5FR6A 4HWIB 1WX7A 1PGXA 4LJOB 3GE8C 3M63B 2AYOB 1FPYA 2TSSA 3B2GA 4NPNA 4KZCA 3ZTDA 3SEBA 3DWGC 5G5HA 4OZCA 1ZOYB 1P1AA 3GS2A 1XLOA 3ZNHB 2JRHA 3JYUA 3KVFB 4ITKA 2N1WA 2WXOA 5J17A 3PO0A 2N9KA 2L1AA 3A9KB 3BYTB 3H9DA 2DZMA 2IDYA 2K22A 4WAFA 3KYCD 1DYQA 3WIMA 2JSVX 3L0WB 4DHZB 3NHEB 1NYQA 3IBEA 4AWJA 2KDMA 3IVFA 2WU2B 1RLFA 2KDIA 4F7ZA 2XK5B 5G5GA 1WGGA 3R7QA 4ICVA 3I5JC 3Q8FA 3RZFA 3PTFC 1WE7A 4XC2A 1FXTB 3RNBC 2WDVB 1D5MC 4ZYNA 1JWBD 1L5PA 1ZUD2 3DBHB 3KUZA 4JLCA 3C8YA 4NNJB 2JZPA 1L2NA 4P7IA 2NTTA 1QF6A 2M1MA 1QILA 2K8CA 2Z59B 4YSYB 2Y5BB 3R2IA 2IBIB 1YQBA 5AEKB 3AEGB 4QAYA 4IWPA 4X57B 2JWUA 4IC7B 4AQ7A 4J6IA 4W9KA 2V3PA 3NS1A 1P7EA 4MM3A 4EKUA 3L54A 1K53A 2V3NA 2KWVB 1EM7A 3EUB2 1WGRA 2DHZA 2VH1A 2WXIA 3QCAA 3IXSA 3QWZB 4MGZE 1B9RA 2AWTA 4N6EB 2WX1A 4JWUC 2WP9B 2KQSA 4FBJB 1WWTA 3OAWA 1TZ1A 3UQAA 3VR9B 2Z8LA 4LJPB 1XT9B 2WXRA 1M4VA 3BY4B 2MQJA 4JQWC 3DBLI 3H7PA 3V62A 5JZEB 1OFFA 2X38A 4KKJA 3VUXA 4OVUA 1XO3A 1QOFA 2WWZA 3Q8BA 5BMGA 3GZNI 1XLPA 2MJ3A 2N9LA 3H1UA 2YEPB 4LNKA 5IKCM 4XE0A 2RDBC 4BAXA 3RNFC 3DVGX 3I3TB 2X8XX 4KDIC 4KVGB 1FMAD 2LGYA 2QMTA 3AB5A 2CJOA 1NEKB 4WWMA 2MBQA 3DHGC 3VHTC 1T0YA 1ZPSA 1GNUA 2QIEB 4RH6A 3VR8B 2NPTB 1RYJA 1SF0A 2L32A 2G4DB 2LGIA 4RGOS 3ALBA 4LLGM 4IW0A 5E6PA 3BK2A 3FC4A 2LVQA 2L0TA 1RM6C 2O6VD 1NI3A 4B0MA 4M0WA 1I7HA 3HM3A 3WAMA 3Q3MC 2IO1B 1HA5A 3ZYYX 3EC8A 3JW0X 2HTME 1RFAA 3R66C 4HROA 1S3SG 2N4FA 2PEAA 4FXCA 1ROEA 4EEWA 4RF0A 3VRBB 2MBOA 3TEWA 1QOAA 1P7FA 2QDFA 2I1JA 1QZEA 2LGXA 1KFYB 1N5XA 4PK1A 2SEBD 1WGHA 3ZNID 1FXIA 5JHBA 3ZUNA 3QHTA 2JT4B 3NY5A 3A9KA 1TS4A 5DCNA 2IGDA 3A4SC 4K1RB 2REXA 4IDIA 1JWAD 2LUEA 1LM8B 1YX6B 5CHWA 3X0WA 1E9MA 3MJWA 4OHJA 3RUIB 4W9EA 3OJ4B 2D3CA 2XK5A 2IO3B 4EFOA 2JYEA 4I6NB 3DVGY 5AUKA 2RDHA 2G9HD 3V6EB 3P4RB 2UWQA 4E71A 1EWCA 4JIOU 1H8CA 2PE9A 2GBJA 2B3AA 2BS3B 3A9JB 2NR2A 1P9DU 3PPAA 4MSMB 3PS6A 2SAKA 4II3B 3IHPC 2OJRA 3L4PA 2BWES 2R2QA 2WX0A 3AV8A 3T3OA 1D5ZC 1DOIA 2ICIA 3QJZA 4CYEA 2JQRB 4RM8A 2B76B 1J7AA 1K50A 1F0ZA 1KTKA 3BVMA 1SJHD 1M94A 3N20C 2IGHA 1WM3A 1A5RA 1YQ4B 1V8CA 2M8SA 2CS4A 2LI5A 2NBVB 5G55A 4F8CB 4IWQA 3TL5A 4I6LB 3ZXVA 3AEAB 4ZHPA 4C80A 3W5UB 1KLVA 4KZ0A 2PLPA 4MDKE 2WXPA 3AE5B 2INPE 4W9CA 1SE9A 3EGRA 1PUTA 2BS4B 2KC1A 4NY0A 2MJEA 3KUDB 1WJ4A 2MSED 3R3MA 3EFCA 4DWFA 3RFZB 5BMIA 2PTLA 4BBNC 4AP4C 2AL6A 1WGYA 1WXVA 2CKHB 2N9EB 2XEWA 1ACCA 1KLGD 2MWSB 1WGKA 3RN9C 1DOYA 2QHOA 3DBHI 2LUMA 4RMAA 1E5WA 1T6BX 2O6VB 2KX0A 2C7HA 4TUUA 5CTRC 4B0EA 4XZ4A 2J42A 3N30A 2BPSA 4ZRJA 4KGTA 4FJYA 2RR9A 3GB1A 2NPTA 1E0ZA 2CU3A 2KLGA 1ZXIA 4EUTA 3QK0A 2BW2A 4BZAA 4NQKE 3PRMB 3UIPB 5H92C 4OZBA 2Y5CA 5AUIA 3QA8A 1E7PB 1WXQA 2D3BA 3HIZA 3TSSA 1L4ZB 2V3SA 3OLMD 5IAAC 3DVNU 3BWUD 2K1FA 3ZDTA 4HKQA 3QX1A 5C3JB 1YD8U 4ANWA 2I38A 3JSVB 2K8HA 2LEKA 1LQBA 1WXMA 3SD5A 2J0MA 1FD6A 2LASA 5EE9A 1ZGUB 3APDA 4IKGA 3NVVA 4HJGE 1TJEA 3LJ3A 3Q14C 1TYGB 2LHDA 2LXCA 4LDTD 2H88B 2DBYA 4WWNA 1IGCA 1L0VB 4XWWA 1IP9A 2EMTA 3HHMA 2DYOA 3H7SA 1IBXB 3KWLA 3JVZX 1ZXHA 3V61A 3RULA 1LFDA 2FIFA 1WJNA 4GSWA 3Q3NC 4FN2A 2OOBB 2DZKA 3VXWA 4KGSA 3Q3OC 4FJVB 1FFVA 2UU7A 2R61A 2W9NA 1F77A 2N9PC 3A9JA 3ZDMC 1S1QB 3D32A 2KK8A 4JWSC 1UD7A 4KSKC 2L7RA 1FRDA 3TEZA 2KO3A 1E8XA 1YOVB 3NVWA 1L0YB 1C79A 2DAJA 3GP7A 2LGSA 4URKA 3RI7C 4DXFA 4XWTA 1SIFA 1R7SA 4MACA 2NVUI 2LXAA 3ZKJC 4AS1A 2RPVA 3ENEA 2O2VB 3HUIA 2MJDA 1SJED 5KHOA 2JXTA 3ZNZB 3AN1A 2VH2A 4JGHB 2JXXA 4FHKA 4XYCA 1N60A 2A4ZA 4XGAB 2V4IB 5D3IB 1CZPA 4HPPA 4WQOB 3L10B 5DPTA 4NAWB 2LFIA 3RNCC 1C77A 4MT5A 1C3TA 2L52A 2KX3A 4ASWC 3MC8A 5E6OA 2KFKB 1IUEA 1PQSA 1UGJA 1TT5B 1SBBB 1C4CA 3BIID 1TKYA 3DOWA 1LGRA 1MG4A 4HDQA 1T3QA 3CSFA 2D07B 1K8RB 3EFUA 2O6VA 3S2AA 3VQIA 2LMCA 5JH5C 2GB1A 2ACZB 3AE1B 3AM9A 3PHXB 3I63C 2LRWA 1IYFA 2CHZA 2G3QB 4HXDA 3EHVA 4D2KA 2I2YA 2KC2A 4MSQB 4C7ZA 3DVNV 3BVGA 4XX5A 1GB4A 1XQQA 3ZRFA 4NJ6A 5LLIA 2M56B 3DBSA 4HK2A 1XLQA 4ZDVA 4Q2JA 3QAQA 2KJHB 2LVOA 3CMMB 3FKYA 4BOZB 3PLUA 4LDTB 4IUMB 2RGFA 3O65B 2DNFA 2MLBA 3DPDA 1YN4A 3Q8EA 1WR6E 2OEDA 5D6JB 3QARA 3NG0A 4MGKE 1WGDA 3JSVA 3QIJA 1NENB 1SB3C 2KJRA 5GXGB 2G45B 5FR3A 2V0GA 4WQMA 4G0NB 2EKEC 3P4QB 1SE3A 1WX8A 1LO5D 2I1KA 2PW9A 2ASQA 1KH0A 5E6NA 2GBKA 5DPSA 1FCLA 4ZYSA 5LXHA 4W9DA 2IO0B 1WH3A 3RCZA 4NJCA 2ZNVB 3FAHA 4FADA 2PIAA 2VRRB 4W9LA 4OVZA 4GB9A 4K81A 1IBXA 3T8MA 4GIVA 2H89B 2NBWB 2UYZB 1L0XB 5L83A 3PREA 1V5TA 1FRRA 4IWOA 5EE1A 2MBHA 3MC0B 2AL3A 5EE0A
chains in the Genus database with same CATH topology
1YN5A 1E9MA 1CJEA 1D6EC 4P6VF 4OHJA 4JX1C 1QT9A 5BMHA 5LNK1 1UNSA 1VZ6A 1WSPA 1JW9D 3W2DA 3KWVA 2JYEA 1A70A 2WQYB 3BZDB 5AUKA 1C9FA 4TQ1A 2RDHA 2G9HD 4OZAA 2WXMA 1SSNA 3AE2B 1BUIC 3P4RB 4A90A 1JQ4A 1EWCA 1TKGA 2AX5A 1V1PB 1N63A 3T3NA 1YQ3B 3P63A 2BS3B 3PZ8A 2AQ3B 5EE3A 1HZ6A 1SE2A 2VZKD 4YTNB 1AN8A 2DWQA 2RDGA 4MH8A 4J3OD 4A55A 1QOGA 1DGJA 4PT5A 4YXDB 2SAKA 3L4PA 1HQRD 3AV8A 1N62A 1D5ZC 3P4SB 1DOIA 2ICIA 3WCQA 3T3OA 1JRPA 5FK9C 1N5WA 2IPKD 2JQRB 1MI0A 2W55A 2AQ2B 2B76B 3H8HA 1J7AA 1K50A 1F0ZA 1KTKA 3BVMA 2MEKA 1FFUA 3NZ3A 1SJHD 1I4XA 1TKEA 1XF5L 2WDQB 2IGHA 3AE6B 1YQ4B 1ENFA 1V8CA 2WXKA 2GI9A 1JCKB 2RMMA 3I9V1 2VZKB 3W9CB 1IGDA 3MFGA 4A8XC 2CJNA 4USAA 1PYWD 1MPEA 1TS3A 3AEAB 4A9AA 3N9YC 2W3SA 1CQVA 3NVYA 1YMHE 4ZHPA 2PVOD 3B2FA 3W5UB 2WXJA 2BBCA 2PLPA 4RGMA 4C80A 1QLBB 3KLSX 1F2RI 2WXPA 1L6UA 2INPE 3AE5B 5HHDG 3EGRA 5D3DA 3U2SC 3I57A 2BTEA 1PUTA 2BS4B 2FUG1 2LHEA 3DWMA 2PKOA 1C4PA 2MJEA 3CIRB 2BB5A 4US8A 4MM3B 2J53A 1XXGA 3FILA 1Y56A 3HVDA 1XCQL 4XDCA 1I4RA 5C2TB 1GAQB 1I4HA 1FNWA 3IT6B 4OW0A 3AE4B 2FE8A 3RFZB 2ZW1A 3Q8CA 2PTLA 3AE9B 4TSSA 5BMIA 1C78A 4ZRQA 1XLNA 1VJKA 3IT4B 3BK1A 2JX5A 1ACCA 1KLGD 1FNVA 1E10A 2EELA 4JE3B 4WH4A 1T5XD 3ZJUA 2WXQA 4WURA 4US9A 3ABVB 5I4DA 1WGKA 1DOYA 1UWMA 3MHZA 4RGTA 2LUMA 2K5PA 2Y3AA 1VZ8A 1Q10A 1T6BX 2EKIA 1KRHA 2W3RA 4REZA 2MH7A 4CQNA 1TY2A 2XN9C 1K51A 4H2AA 4B0EA 2IJ0A 1EU3A 3AEDB 2J42A 2LJIA 5BYRA 3AH7A 4P16A 3U52E 2M19A 3KQ4A 4KGTA 4R3DA 5HFYA 3GB1A 1JWMD 4RGNA 1E0ZA 1I4PA 3P42A 2CU3A 4LK0M 1FXAA 1ZXIA 1RWSA 2BW2A 1GPXA 2W54A 4HKZE 1VDVA 4DQOC 2J4XA 2IGGA 5BYSA 3SFDB 2WNMA 4C7YA 3E9SA 5H92C 4OZBA 3O13A 2Y5CA 2KWDA 3ETRA 2WXNA 1C76A 2BB6A 5AUIA 1N61A 1E7PB 4YTMB 1JMLA 1JWSD 4YSXB 2BS2B 3AEFB 4JPSA 1ET6A 2WS3B 1ESFA 1WXQA 4RNAA 3TSSA 2INNE 1L4ZB 1JWUD 2FBWB 2KAJA 4KKIA 4ZOHC 1PFDA 5JXVA 1FNUA 3EA6A 2WLBA 1HEZE 3BWUD 1EWYC 1JROA 4RCOA 4HKQA 4LTUA 2KMMA 5C3JB 2WXGA 2I38A 3MP9A 1DOXA 4KX6B 2K3UA 1QKZA 3P1MA 4HRSA 1J7BA 2L83A 3NVZA 4GDLB 2LEKA 1TZOA 2M0AA 2QJLA 1BMLC 3E56A 3ZJTA 1UWXA 1FD6A 3W1SA 1PDXA 1K52A 3PZ7A 1CK1A 3AECB 5EE9A 4IKGA 1PGXA 3NVVA 5H8YE 4HJGE 1TJEA 2TSSA 1VR9A 3B2GA 1WRIA 3SEBA 1TYGB 2LHDA 4L2YA 3DWGC 2H88B 5G5HA 2DBYA 4OZCA 1IGCA 1L0VB 1ZOYB 2YEPF 4L23A 1MHXA 4XWWA 5HG2A 3GS2A 1XLOA 5BYQA 2E3TA 1ZDXA 3V05A 1ZP0B 1SIJA 4ITKA 1STEA 3AEBB 3IAS1 1C4AA 2WDRB 1VRAB 2WXOA 2DYOA 1ZDVA 1IBXB 3KWLA 4HEA1 2NMQA 4RF1A 3SFEB 3PO0A 4N59A 2N9KA 2L1AA 1ZXHA 2E6XA 3BYTB 2BYTA 2IDYA 2D5GA 1FO4A 1EU4A 5T8IA 2K22A 2DLBA 1RFKA 4KGSA 4WAFA 2JYTA 1V1PA 1DYQA 1FFVA 2QSDA 2G1EA 2R61A 3AE7B 4ARIA 2JSVX 1F77A 4TMAB 1NYQA 2GRIA 3AE8B 4ZHOA 4NAMA 1GOZA 3HVZA 4JWSC 2KDMA 2WU2B 3TUOA 4C56C 1AYFA 1FRDA 3TEZA 5G5GA 2Q5WD 1YJJA 3Q8FA 3NVWA 1FIQA 4XDDA 1L0YB 1L4DB 1TY0A 1C79A 2WDVB 3Q69A 1BXTA 1D5MC 3W5VB 3GP7A 1D5XC 1JWBD 3LXFA 1L5PA 4DXFA 4XWTA 1ZUD2 1R7SA 4MACA 1E6EB 2AQ1B 2KQ4X 3BYYB 3C8YA 2JZPA 2NTTA 1QF6A 3AE3B 1MVKA 2K9XA 3OWEB 1QILA 4AS1A 2RPVA 3HUIA 4YSYB 2MJDA 1SJED 3R2IA 2N7JA 2JXTA 1FM0D 3AN1A 3AEGB 1GB1A 1N60A 1PGBA 5D3IB 2V4IB 1CZPA 3VRAB 2ON8A 2JWUA 3NRZA 2KN4A 1VZ7A 3TEXA 1KLUD 2PMVA 4AQ7A 2PVGC 4GLSC 2JU6X 3P4PB 2XNAC 4NAWB 2V3PA 3NS1A 1P7EA 1XCTL 3AMZA 3U7ZA 3TEYA 4NZLB 4YT0B 4N58A 2LFIA 1C77A 4MT5A 3ZJVA 1K53A 2V3NA 1J7CA 1EM7A 3EUB2 2L52A 2WXIA 1L6VA 1KF6B 4L1BA 3IXSA 1B9RA 3R8BA 4N6EB 3RPFC 4JWUC 2WP9B 1SXTA 2WXHA 1HZ5A 1IUEA 1WWTA 4YSZB 1AWDA 1UGJA 1SBBB 1C4CA 2WXFA 3SR6A 3BIID 1TKYA 5FKAC 3FILB 1ZE3D 3VR9B 3ZQ4A 2Z8LA 2J52A 1T3QA 2WXRA 1MHHE 1M4VA 4GDKB 1OQRA 1F2RC 1NVID 3BVZA 5D7GA 4UDUC 3VQIA 4O1NA 2LMCA 2WU5B 1OFFA 2X38A 4KKJA 1XO3A 1QOFA 2ACZB 2GB1A 3AE1B 3AM9A 3Q8BA 4ARCA 5BMGA 2ONQA 3U4EG 1XLPA 2MJ3A 1QOBA 1YJIA 2N9LA 4D2KA 3J9CA 2I2YA 2Y5PA 3UI3A 4C7ZA 3HRDD 2YEPB 1I4GA 3BVGA 1V1OA 1GB4A 3CWIA 4XE0A 3LYYA 4DXGA 2M56B 3LB8C 1XLQA 1JALA 4Q2JA 4A6QA 1FMAD 2QMTA 3AB5A 2CJOA 2K0PA 5HI1A 1NEKB 4WWMA 2HDEA 1ZPSA 2QIEB 1WYGA 4KGRA 4RH6A 3VR8B 1TS5A 4TQ0A 1FCCC 1RYJA 1SF0A 3MJ5A 2L32A 3Q8AA 3AEEB 4ZRPA 2LGIA 4RGOS 1YN4A 4LLGM 3Q8EA 1I4QA 2OEDA 2BT6A 4YWGG 3BK2A 3FC4A 3B9JA 2N0SB 3NUHB 1RM6C 1NI3A 2W82A 4M0WA 4B0MA 2WXLA 1YN3A 1I7HA 1NENB 1SB3C 2QEJC 5GXGB 3URYA 1HA5A 1TS2A 5FR3A 3ZYYX 1FEHA 2ZW0A 2V0GA 1B1ZA 4WQMA 4EE2A 3P4QB 4RFBA 3V3XA 1AW7A 1SE3A 2HTME 3IAM1 1LO5D 1UUPA 4HROA 2PW9A 4YTPB 1KH0A 1SEBD 1VLBA 1ET9A 1PGAA 4FXCA 1ROEA 1D4BA 4RF0A 3ZGZA 4ZYSA 1FCLA 3VRBB 3TEWA 1QOAA 4NJCA 4IOIE 1P7FA 3FAHA 2PIAA 1HXYD 2NTSA 1KFYB 1N5XA 1SE4A 2SEBD 5TSSA 3R2TA 1FXIA 4OVZA 2KACA 1IBXA 4WIPA 2H89B 2OHFA 1L0XB 1V97A 2QILA 1NYRA 1YNTE 1TS4A 2IGDA 5MPOA 1OQQA 4IDIA 1JWAD 5E6JA 1FRRA 5EE1A 1QQRA 1XEEA 3MC0B 2DYMA 5EE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GB1 A;  1Q10 A;  5BMG A;  5BMH A;  2ONQ A;  4KGS A;  2N9L A;  2QSD A;  4D2K A;  2JSV X;  2I2Y A;  3UI3 A;  1K51 A;  1C9F A;  4OZA A;  1GB4 A;  2KDM A;  4KGT A;  5HFY A;  3GB1 A;  1HZ6 A;  2QMT A;  2K0P A;  4HKZ E;  5HI1 A;  4KGR A;  1FCC C;  2IGG A;  4MAC A;  1MI0 A;  4OZB A;  2KQ4 X;  2JZP A;  2KWD A;  2LGI A;  1MVK A;  1K50 A;  1JML A;  2RPV A;  2OED A;  1XF5 L;  2N7J A;  2JXT A;  2IGH A;  5JXV A;  1GB1 A;  2GI9 A;  1PGB A;  2RMM A;  2ON8 A;  1HEZ E;  2JWU A;  1IGD A;  2KN4 A;  1MPE A;  4GLS C;  2I38 A;  2ZW0 A;  2JU6 X;  3MP9 A;  1YMH E;  1QKZ A;  1P7E A;  3V3X A;  1XCT L;  2PLP A;  1F2R I;  2PW9 A;  1KH0 A;  1UWX A;  5HHD G;  1FD6 A;  1PGA A;  1D4B A;  1FCL A;  1K52 A;  2LHE A;  1K53 A;  4IKG A;  1PGX A;  1EM7 A;  4HJG E;  4IOI E;  1P7F A;  2J53 A;  3FIL A;  2LHD A;  1XCQ L;  4OZC A;  1IGC A;  2KAC A;  1MHX A;  1IBX A;  1HZ5 A;  2ZW1 A;  5HG2 A;  2PTL A;  5BMI A;  1YNT E;  2IGD A;  3FIL B;  2J52 A;  1MHH E;  2EEL A;  1IBX B;  4WH4 A;  2NMQ A;  2N9K A;  1F2R C;  1ZXH A;  2LUM A; 
#chains in the Genus database with same CATH topology
 1YN5 A;  3RNE C;  1D6E C;  4P6V F;  1GJZ A;  1BT0 A;  4JX1 C;  5LNK 1;  2D10 A;  4DDI D;  1WSP A;  4K3C A;  3W2D A;  2MA9 B;  3Q3F A;  1C9F A;  4OZA A;  3B08 A;  1N63 A;  3U8Z A;  1YQ3 B;  3PZ8 A;  2AQ3 B;  4CO7 A;  5EE3 A;  4HLE A;  1Z5S B;  4YTN B;  1HE8 A;  2RDG A;  2YVC A;  4J3O D;  1DGJ A;  3WAP A;  3DHH C;  2O2V A;  1WRD B;  2KT7 A;  3BIN A;  2IPK D;  4FUL A;  1OGW A;  3QC8 B;  4BKS D;  3X23 A;  3UGB B;  1XF5 L;  3RYT A;  4W9J A;  2BYF A;  2WXK A;  4NAW A;  2LJ5 A;  1UEL A;  2VZK B;  2DZI A;  3MFG A;  4USA A;  4A9A A;  3NVY A;  1T0S C;  2PVO D;  2BBC A;  4WWP A;  3KLS X;  3ZVV A;  3IG3 A;  5D3D A;  3U2S C;  2ZNV C;  2KFK A;  1C4P A;  3W1S C;  1XXG A;  1I4R A;  5C2T B;  3B0A A;  2BVC A;  2ZW1 A;  4TSS A;  3AE9 B;  2DEN B;  3B1L X;  1I42 A;  4MEL A;  4C4V B;  1WY8 A;  2JVC A;  1XLN A;  1VJK A;  2LGD A;  2IO2 B;  1TTN A;  3ONS A;  2JX5 A;  2JZZ A;  2IY1 B;  2MBE A;  1E10 A;  3VVW B;  3LDZ E;  4US9 A;  4WUR A;  2M0X A;  2Y3A A;  1VZ8 A;  1Q10 A;  3VDZ A;  1WMH B;  2ZEQ A;  4REZ A;  2MH7 A;  3NOB A;  4CQN A;  4AUQ C;  4H2A A;  2IJ0 A;  1E7V A;  2KTR B;  5BYR A;  2GBM A;  3AH7 A;  2J0J A;  3U52 E;  3ECI A;  3CST A;  3RD2 A;  4RGN A;  3H6N A;  4LK0 M;  4HCP B;  1GPX A;  2K39 A;  2J4X A;  2IGG A;  3SFD B;  2WNM A;  1IPG A;  3ETR A;  2BB6 A;  1N61 A;  4YTM B;  4YSX B;  1ESF A;  3CF6 E;  4RNA A;  1SGH A;  2KAJ A;  4KKI A;  4A3P A;  4ZOH C;  1PFD A;  2DAF A;  2KDF B;  1EWY C;  4LTU A;  2WXG A;  1UH6 A;  4KX6 B;  2K3U A;  3SDL C;  2ZPY A;  4HRS A;  3NVZ A;  4GDL B;  1TZO A;  3E56 A;  1BML C;  4AJW A;  5LXI B;  1UWX A;  5GMV A;  3W1S A;  5AZG A;  2D3A A;  2HJ8 A;  5H8Y E;  2IYD B;  5HKH A;  2GBR A;  2HE7 A;  1VR9 A;  3PRZ A;  5C23 A;  4L2Y A;  3ML8 A;  5HG2 A;  2PJH A;  2V9H A;  1HTO A;  5BYQ A;  2JWZ A;  2E3T A;  3VAW A;  1ZDX A;  4M02 A;  1STE A;  2WDR B;  3GOE A;  2NMQ A;  1HTQ A;  4N59 A;  2FCQ A;  2E6X A;  2BYT A;  4C00 A;  3PHW B;  1T0R C;  2D5G A;  1OTR B;  1EU4 A;  2DLB A;  1RFK A;  2JYT A;  3MHS D;  2QSD A;  3AE7 B;  1L7Y A;  4TMA B;  2N9X A;  4ZHO A;  2JRI B;  3TBL D;  1VD2 A;  1GOZ A;  3HVZ A;  4PS7 A;  3ZO5 B;  2KWC A;  1AYF A;  1P98 A;  2Q5W D;  1YJJ A;  1WJU A;  5CHV C;  1H4R A;  4XDD A;  1TY0 A;  1E90 A;  4GXB A;  1BXT A;  3W5V B;  1RAX A;  3DDC B;  1D5X C;  3RT3 B;  3M95 A;  2BQQ A;  2AQ1 B;  4HPM B;  5J18 A;  3AE3 B;  2K9X A;  1GC7 A;  1P0R A;  4A20 A;  2N7J A;  3TIX A;  4YL8 A;  4K3B A;  1WF9 A;  4G3X B;  3ZIM A;  3OJ3 A;  3VRA B;  2KN4 A;  3R7R A;  1VZ7 A;  3UIO B;  2PVG C;  2JF5 A;  2JU6 X;  3P4P B;  2XNA C;  4E74 A;  2K25 A;  1XCT L;  3AMZ A;  1V81 A;  3UQB A;  5EDS A;  1NDD A;  2R2O A;  1R4M B;  2MW5 A;  3ZJV A;  2WGS A;  1J7C A;  4C4V A;  1GC6 A;  1KF6 B;  4L1B A;  3R8B A;  3RPF C;  2KJ6 A;  3A1Q B;  3VFK A;  1SXT A;  1HZ5 A;  4YSZ B;  4LNO A;  1AWD A;  3N1Z C;  3SR6 A;  5FKA C;  3IFW B;  1ZE3 D;  3AU5 A;  3ZQ4 A;  2J52 A;  2L05 A;  1MHH E;  1WMH A;  4GDK B;  4S17 A;  1MJD A;  1OQR A;  1F2R C;  3RNA C;  1NVI D;  4UDU C;  4KDL B;  2WU5 B;  3L13 A;  3PSE B;  2KTR A;  3PV1 A;  2ONQ A;  3U4E G;  3WAL A;  4DHJ D;  2KOX A;  2V1Y A;  1YJI A;  3J9C A;  1V2Y A;  3UI3 A;  2NS5 A;  4MGY E;  1V1O A;  3CWI A;  3KW5 B;  3LYY A;  4RM9 A;  2KHW B;  3LB8 C;  3V6C B;  1U4A A;  1JAL A;  2A5U A;  2HD5 B;  2K0P A;  1F9J A;  2L8J A;  4KGR A;  4TQ0 A;  2BYV E;  3DHI C;  3Q8A A;  5IA7 A;  4HJK A;  4DBG A;  3PRP B;  1WXS A;  3TJP A;  3N1Y C;  3U7D A;  3OG5 A;  4KV2 A;  5L95 C;  2DYB A;  2KDE B;  4YWG G;  1WIA A;  2PE6 B;  3B9J A;  3Q6B A;  3NUH B;  1E8W A;  2W82 A;  4GDL A;  2L0F A;  4KIK B;  1FEH A;  2ZW0 A;  1B1Z A;  4EE2 A;  4ZRI A;  4RFB A;  3V3X A;  3IAM 1;  2FUH B;  3ZXR A;  2K8B A;  2KTF A;  1SEB D;  3VTU A;  1D4B A;  3ZGZ A;  1UZX B;  4TV3 A;  4W9G A;  4B9K A;  1WI0 A;  1V49 A;  1HXY D;  2NTS A;  2JY6 A;  2KQ7 A;  3R2T A;  2KAC A;  4BKS A;  2OHF A;  1V97 A;  2QIL A;  1NYR A;  5MPO A;  1OQQ A;  2L3Z A;  5E6J A;  1ZKH A;  1QQR A;  4HCN B;  5IOI A;  2GMI C;  4GU2 A;  2BGF A;  2KN5 A;  1WX9 A;  2CHW A;  2ZCC A;  2LVP A;  1UNS A;  2PPH A;  3ZNG C;  1JW9 D;  4WAA A;  3Q2A C;  1A70 A;  1T0Q C;  2MP2 B;  4TQ1 A;  2WXM A;  3AE2 B;  1EF1 A;  3VTV A;  1JQ4 A;  4A90 A;  2D11 A;  1TKG A;  2AX5 A;  1V1P B;  2N7E A;  3T3N A;  4LNN A;  5BO4 B;  2D3G A;  4B95 A;  3P63 A;  1AAR A;  2WYQ A;  1SE2 A;  5IN7 A;  2VZK D;  1AN8 A;  2DWQ A;  4MH8 A;  4A55 A;  1QOG A;  4PT5 A;  4GN1 A;  2IND C;  1N62 A;  3P4S B;  1JRP A;  5FK9 C;  2AQ2 B;  2INC C;  1ISN A;  1WR1 A;  3NZ3 A;  4BKT A;  3KUC B;  1C1Y B;  4KSL C;  2HJ1 A;  1V5O A;  4MH0 E;  4TKN A;  2KLC A;  2GI9 A;  3M62 B;  1WXA A;  3AUL A;  1TIF A;  2RMM A;  3I9V 1;  3W9C B;  5J2R A;  2CJN A;  4LNF A;  1MPE A;  1TS3 A;  4F1S A;  1J0G A;  3N9Y C;  4M8N A;  3B2F A;  4DHJ B;  3N3K B;  1Q1O A;  1F2R I;  2JPH A;  3A1Q A;  2BTE A;  4P1C C;  2PKO A;  5G2N A;  2BF8 B;  2K6Q A;  1GAQ B;  1I4H A;  1FNW A;  5DPW A;  1E8Y A;  3Q8C A;  4GDK A;  1V86 A;  2C5L C;  2L00 B;  4BVU C;  3APC A;  4WH4 A;  1T5X D;  2BYE A;  2ZCB A;  5AZH A;  4RGT A;  2KMC A;  1KOT A;  3PLV A;  2EKI A;  2RD0 A;  2W3R A;  5C1Z A;  2EMS A;  4FLH A;  1TY2 A;  3ML9 A;  2FCN A;  1EU3 A;  4WJO A;  4M00 A;  4P16 A;  2M19 A;  5HFY A;  2V4L A;  1I4P A;  3P42 A;  2ZPN A;  3A4R A;  2C7M B;  1R4M I;  4PS8 A;  4EZL A;  2GOW A;  2KDB A;  5BYS A;  4FA6 A;  4C7Y A;  3E9S A;  2KNB A;  1OEY A;  3O13 A;  3WA0 A;  2WXN A;  1C76 A;  4II2 B;  3V60 A;  2BS2 B;  2M17 A;  1V9J A;  4W9I A;  1KJT A;  4KIK A;  4WJN A;  2INN E;  3VH3 B;  1JWU D;  2FBW B;  5JXV A;  3EA6 A;  3QQ8 B;  1NI2 A;  1HEZ E;  3WAN A;  2FAZ A;  2HTH A;  1DOX A;  4EZK A;  3DQV A;  4EOY A;  3C0R B;  2M0A A;  3ZLZ A;  1PDX A;  3PZ7 A;  1CK1 A;  3AEC B;  4PYU A;  1JRU A;  2L76 A;  1WRI A;  2FCM A;  3RNG C;  2KFJ A;  4L23 A;  2YEP F;  1MHX A;  1MFW A;  5D2M B;  3AI5 A;  3C19 A;  4M8M A;  3V05 A;  1ZP0 B;  1SIJ A;  3AEB B;  3IAS 1;  3WAO A;  1C4A A;  2G4S A;  1VRA B;  4DXA B;  2NBU A;  2OJW A;  1ZDV A;  3VTW A;  4HEA 1;  2RPQ A;  4RF1 A;  3SFE B;  2Z0D B;  2ZZP B;  2MP2 A;  2Z0E B;  2JUO A;  1FO4 A;  2QC8 A;  5T8I A;  1V1P A;  1Z2M A;  2G1E A;  4ARI A;  1J19 A;  2GRI A;  3AE8 B;  2C7N B;  3T9L A;  4NAM A;  4BOS C;  3PT2 B;  3TUO A;  2KVZ A;  4C56 C;  4HVB A;  1R4N B;  4P1B C;  4MEM A;  3K9O B;  4S0R A;  1FIQ A;  4DK5 A;  1L4D B;  3Q69 A;  1N6Z A;  1UBI A;  3LXF A;  3NS8 A;  2FID A;  1E6E B;  3BYY B;  2KQ4 X;  2WDT B;  2XBB C;  1MVK A;  4AJY B;  3OWE B;  1Q5W B;  4IM2 A;  3UF8 A;  1FM0 D;  2IZV B;  2D2Q A;  4ZRK A;  1GB1 A;  1OEY J;  1PGB A;  2ON8 A;  3NRZ A;  4BBN F;  3TEX A;  1KLU D;  2PMV A;  2AEH A;  4GLS C;  2LZ6 A;  3U7Z A;  3TEY A;  4NZL B;  4YT0 B;  1Y8R C;  3TCA A;  4GMV A;  3L08 A;  4IM3 A;  3PGE A;  1YJ1 A;  2ZVN A;  2RSU A;  1L6V A;  2KXJ A;  3DBR B;  5CHF A;  1VCB A;  2WXH A;  3KYD D;  4A3O A;  1WFY A;  1Q0W B;  2WXF A;  4BFR A;  3FIL B;  1WZ3 A;  1F1H A;  3M3J A;  3W1Y A;  1E7U A;  3BVZ A;  5D7G A;  4O1N A;  3NZU A;  2C9W B;  2BKR B;  3PVL A;  4ARC A;  2KYW A;  3PZD A;  1QOB A;  1TGZ B;  4PS3 A;  2Y5P A;  3HRD D;  1I4G A;  4MJS B;  1TBE A;  4IG7 B;  4DXG A;  1EO6 A;  4A6Q A;  3VUY A;  1J8C A;  5HI1 A;  3P2B A;  2HDE A;  4DDG D;  1WYG A;  2ZVO A;  1TS5 A;  1FCC C;  4LCD E;  4MGI E;  3L16 A;  3RZW C;  2GBN A;  3VH4 B;  3MJ5 A;  3AEE B;  4ZRP A;  4K7U A;  4CHK A;  1YIW A;  3EEC A;  4G50 A;  1I4Q A;  3NZS A;  2BT6 A;  5DPR A;  2N0S B;  2DZJ A;  2KMA A;  5TR5 A;  2IY0 B;  2WXL A;  2KVR A;  1YN3 A;  4NQL B;  3GE3 C;  1MG8 A;  2QEJ C;  3URY A;  1TS2 A;  2GLS A;  4G11 A;  2MHJ A;  3RMK C;  1AW7 A;  4E3C A;  3NJT A;  3N1X C;  3AXC A;  1UUP A;  2YLM A;  3Q3J A;  2LRU A;  4YTP B;  1VLB A;  2MRP A;  1ET9 A;  2DX5 B;  1PGA A;  3ZRC A;  4BKG A;  2N7D A;  3AU4 A;  4IOI E;  4B6W A;  2MCN B;  2BKF A;  3MC9 A;  1SE4 A;  5TSS A;  4K7S A;  3DCG A;  4WIP A;  2KZR A;  4NJ7 A;  1XD3 B;  1UGM A;  1P3Q U;  1YNT E;  5CX3 A;  3L17 A;  4FJZ A;  2ZJD A;  4GOC A;  1RRB A;  1XEE A;  3U30 A;  2DYM A;  4N58 A;  1CJE A;  5IP4 D;  1QT9 A;  3UIN B;  5BMH A;  1VZ6 A;  3KWV A;  2WQY B;  3HK0 A;  3BZD B;  1X1M A;  2CHX A;  2KAN A;  1F52 A;  1WE6 A;  4ICU A;  1SSN A;  4OVV A;  1BUI C;  2FCS A;  4AOF A;  1HZ6 A;  4JL9 A;  4HPL B;  4HDO A;  4YXD B;  1HQR D;  3WCQ A;  1KM7 A;  3DBL B;  1N5W A;  1I35 A;  1MI0 A;  2W55 A;  2M4N A;  1LXD A;  3H8H A;  1NBF C;  3VUW A;  2K6D B;  3GZN B;  2MEK A;  1FFU A;  2N1V A;  1WM2 A;  4FHJ A;  3K9P B;  4WWO A;  1I4X A;  1TKE A;  2WDQ B;  4DHZ E;  3AE6 B;  1ENF A;  3APF A;  4N9F 4;  3KH0 A;  1JCK B;  1EUV B;  1IGD A;  4A8X C;  4K7W A;  2MX2 A;  1PYW D;  2NCN A;  2W3S A;  1CQV A;  5IO9 A;  1YX5 B;  1YMH E;  1GUA B;  2WXJ A;  4RGM A;  1QLB B;  1WZ0 A;  1L6U A;  5HHD G;  4W9H A;  4ANV A;  3I57 A;  4ACF A;  2FUG 1;  2LHE A;  3DWM A;  3CIR B;  2BB5 A;  4US8 A;  4MM3 B;  2J53 A;  1V6E A;  3FIL A;  1Y56 A;  3HVD A;  1XCQ L;  4XDC A;  2QCZ A;  3IT6 B;  4OW0 A;  3AE4 B;  5AZF A;  2FE8 A;  1R4N I;  1C78 A;  4ZRQ A;  2J0K A;  3IT4 B;  2JZ3 B;  2KWU B;  3BK1 A;  5D94 A;  1FNV A;  2EEL A;  4JE3 B;  2CU1 A;  5JHA A;  3ZJU A;  2WXQ A;  3ABV B;  4ANX A;  5I4D A;  1OQY A;  1UWM A;  3MHZ A;  2J7Q B;  2K5P A;  2CR5 A;  4MJS A;  1KRH A;  4WJP A;  2BWF A;  4W9F A;  1ZW7 A;  3H7P B;  1EF5 A;  2XN9 C;  1K51 A;  3AED B;  2LJI A;  4ANU A;  4LNI A;  3KQ4 A;  4R3D A;  4GGQ A;  3N32 A;  1JWM D;  1FXA A;  4M01 A;  3SHQ A;  3ZTC A;  4WJQ A;  1RWS A;  1G6J A;  2W54 A;  4HKZ E;  5KHQ A;  1V80 A;  1UF0 A;  1VDV A;  2LD9 A;  4DQO C;  1E8Z A;  3A33 B;  4I6P A;  2KWD A;  3DBR I;  2FNJ B;  2LWP A;  1WJ6 A;  4PYZ A;  1JML A;  1JWS D;  3TMP B;  3AEF B;  1WYW B;  4JPS A;  1ET6 A;  2C60 A;  2WS3 B;  1D3Z A;  4IM0 A;  3MTN B;  3SU8 X;  3ZW3 A;  1FNU A;  2WLB A;  2MBB B;  1JRO A;  4RCO A;  4EZJ A;  1GG3 A;  2KMM A;  2KD0 A;  3MP9 A;  2KKC A;  3HM6 X;  1QKZ A;  4M0W B;  3P1M A;  1J7B A;  2L83 A;  2WHI A;  3ZJT A;  2QJL A;  1UBQ A;  1CMX B;  1K52 A;  5FR6 A;  4HWI B;  1WX7 A;  1PGX A;  4LJO B;  3GE8 C;  3M63 B;  2AYO B;  1FPY A;  2TSS A;  3B2G A;  4NPN A;  4KZC A;  3ZTD A;  3SEB A;  3DWG C;  5G5H A;  4OZC A;  1ZOY B;  1P1A A;  3GS2 A;  1XLO A;  3ZNH B;  2JRH A;  3JYU A;  3KVF B;  4ITK A;  2N1W A;  2WXO A;  5J17 A;  3PO0 A;  2N9K A;  2L1A A;  3A9K B;  3BYT B;  3H9D A;  2DZM A;  2IDY A;  2K22 A;  4WAF A;  3KYC D;  1DYQ A;  3WIM A;  2JSV X;  3L0W B;  4DHZ B;  3NHE B;  1NYQ A;  3IBE A;  4AWJ A;  2KDM A;  3IVF A;  2WU2 B;  1RLF A;  2KDI A;  4F7Z A;  2XK5 B;  5G5G A;  1WGG A;  3R7Q A;  4ICV A;  3I5J C;  3Q8F A;  3RZF A;  3PTF C;  1WE7 A;  4XC2 A;  1FXT B;  3RNB C;  2WDV B;  1D5M C;  4ZYN A;  1JWB D;  1L5P A;  1ZUD 2;  3DBH B;  3KUZ A;  4JLC A;  3C8Y A;  4NNJ B;  2JZP A;  1L2N A;  4P7I A;  2NTT A;  1QF6 A;  2M1M A;  1QIL A;  2K8C A;  2Z59 B;  4YSY B;  2Y5B B;  3R2I A;  2IBI B;  1YQB A;  5AEK B;  3AEG B;  4QAY A;  4IWP A;  4X57 B;  2JWU A;  4IC7 B;  4AQ7 A;  4J6I A;  4W9K A;  2V3P A;  3NS1 A;  1P7E A;  4MM3 A;  4EKU A;  3L54 A;  1K53 A;  2V3N A;  2KWV B;  1EM7 A;  3EUB 2;  1WGR A;  2DHZ A;  2VH1 A;  2WXI A;  3QCA A;  3IXS A;  3QWZ B;  4MGZ E;  1B9R A;  2AWT A;  4N6E B;  2WX1 A;  4JWU C;  2WP9 B;  2KQS A;  4FBJ B;  1WWT A;  3OAW A;  1TZ1 A;  3UQA A;  3VR9 B;  2Z8L A;  4LJP B;  1XT9 B;  2WXR A;  1M4V A;  3BY4 B;  2MQJ A;  4JQW C;  3DBL I;  3H7P A;  3V62 A;  5JZE B;  1OFF A;  2X38 A;  4KKJ A;  3VUX A;  4OVU A;  1XO3 A;  1QOF A;  2WWZ A;  3Q8B A;  5BMG A;  3GZN I;  1XLP A;  2MJ3 A;  2N9L A;  3H1U A;  2YEP B;  4LNK A;  5IKC M;  4XE0 A;  2RDB C;  4BAX A;  3RNF C;  3DVG X;  3I3T B;  2X8X X;  4KDI C;  4KVG B;  1FMA D;  2LGY A;  2QMT A;  3AB5 A;  2CJO A;  1NEK B;  4WWM A;  2MBQ A;  3DHG C;  3VHT C;  1T0Y A;  1ZPS A;  1GNU A;  2QIE B;  4RH6 A;  3VR8 B;  2NPT B;  1RYJ A;  1SF0 A;  2L32 A;  2G4D B;  2LGI A;  4RGO S;  3ALB A;  4LLG M;  4IW0 A;  5E6P A;  3BK2 A;  3FC4 A;  2LVQ A;  2L0T A;  1RM6 C;  2O6V D;  1NI3 A;  4B0M A;  4M0W A;  1I7H A;  3HM3 A;  3WAM A;  3Q3M C;  2IO1 B;  1HA5 A;  3ZYY X;  3EC8 A;  3JW0 X;  2HTM E;  1RFA A;  3R66 C;  4HRO A;  1S3S G;  2N4F A;  2PEA A;  4FXC A;  1ROE A;  4EEW A;  4RF0 A;  3VRB B;  2MBO A;  3TEW A;  1QOA A;  1P7F A;  2QDF A;  2I1J A;  1QZE A;  2LGX A;  1KFY B;  1N5X A;  4PK1 A;  2SEB D;  1WGH A;  3ZNI D;  1FXI A;  5JHB A;  3ZUN A;  3QHT A;  2JT4 B;  3NY5 A;  3A9K A;  1TS4 A;  5DCN A;  2IGD A;  3A4S C;  4K1R B;  2REX A;  4IDI A;  1JWA D;  2LUE A;  1LM8 B;  1YX6 B;  5CHW A;  3X0W A;  1E9M A;  3MJW A;  4OHJ A;  3RUI B;  4W9E A;  3OJ4 B;  2D3C A;  2XK5 A;  2IO3 B;  4EFO A;  2JYE A;  4I6N B;  3DVG Y;  5AUK A;  2RDH A;  2G9H D;  3V6E B;  3P4R B;  2UWQ A;  4E71 A;  1EWC A;  4JIO U;  1H8C A;  2PE9 A;  2GBJ A;  2B3A A;  2BS3 B;  3A9J B;  2NR2 A;  1P9D U;  3PPA A;  4MSM B;  3PS6 A;  2SAK A;  4II3 B;  3IHP C;  2OJR A;  3L4P A;  2BWE S;  2R2Q A;  2WX0 A;  3AV8 A;  3T3O A;  1D5Z C;  1DOI A;  2ICI A;  3QJZ A;  4CYE A;  2JQR B;  4RM8 A;  2B76 B;  1J7A A;  1K50 A;  1F0Z A;  1KTK A;  3BVM A;  1SJH D;  1M94 A;  3N20 C;  2IGH A;  1WM3 A;  1A5R A;  1YQ4 B;  1V8C A;  2M8S A;  2CS4 A;  2LI5 A;  2NBV B;  5G55 A;  4F8C B;  4IWQ A;  3TL5 A;  4I6L B;  3ZXV A;  3AEA B;  4ZHP A;  4C80 A;  3W5U B;  1KLV A;  4KZ0 A;  2PLP A;  4MDK E;  2WXP A;  3AE5 B;  2INP E;  4W9C A;  1SE9 A;  3EGR A;  1PUT A;  2BS4 B;  2KC1 A;  4NY0 A;  2MJE A;  3KUD B;  1WJ4 A;  2MSE D;  3R3M A;  3EFC A;  4DWF A;  3RFZ B;  5BMI A;  2PTL A;  4BBN C;  4AP4 C;  2AL6 A;  1WGY A;  1WXV A;  2CKH B;  2N9E B;  2XEW A;  1ACC A;  1KLG D;  2MWS B;  1WGK A;  3RN9 C;  1DOY A;  2QHO A;  3DBH I;  2LUM A;  4RMA A;  1E5W A;  1T6B X;  2O6V B;  2KX0 A;  2C7H A;  4TUU A;  5CTR C;  4B0E A;  4XZ4 A;  2J42 A;  3N30 A;  2BPS A;  4ZRJ A;  4KGT A;  4FJY A;  2RR9 A;  3GB1 A;  2NPT A;  1E0Z A;  2CU3 A;  2KLG A;  1ZXI A;  4EUT A;  3QK0 A;  2BW2 A;  4BZA A;  4NQK E;  3PRM B;  3UIP B;  5H92 C;  4OZB A;  2Y5C A;  5AUI A;  3QA8 A;  1E7P B;  1WXQ A;  2D3B A;  3HIZ A;  3TSS A;  1L4Z B;  2V3S A;  3OLM D;  5IAA C;  3DVN U;  3BWU D;  2K1F A;  3ZDT A;  4HKQ A;  3QX1 A;  5C3J B;  1YD8 U;  4ANW A;  2I38 A;  3JSV B;  2K8H A;  2LEK A;  1LQB A;  1WXM A;  3SD5 A;  2J0M A;  1FD6 A;  2LAS A;  5EE9 A;  1ZGU B;  3APD A;  4IKG A;  3NVV A;  4HJG E;  1TJE A;  3LJ3 A;  3Q14 C;  1TYG B;  2LHD A;  2LXC A;  4LDT D;  2H88 B;  2DBY A;  4WWN A;  1IGC A;  1L0V B;  4XWW A;  1IP9 A;  2EMT A;  3HHM A;  2DYO A;  3H7S A;  1IBX B;  3KWL A;  3JVZ X;  1ZXH A;  3V61 A;  3RUL A;  1LFD A;  2FIF A;  1WJN A;  4GSW A;  3Q3N C;  4FN2 A;  2OOB B;  2DZK A;  3VXW A;  4KGS A;  3Q3O C;  4FJV B;  1FFV A;  2UU7 A;  2R61 A;  2W9N A;  1F77 A;  2N9P C;  3A9J A;  3ZDM C;  1S1Q B;  3D32 A;  2KK8 A;  4JWS C;  1UD7 A;  4KSK C;  2L7R A;  1FRD A;  3TEZ A;  2KO3 A;  1E8X A;  1YOV B;  3NVW A;  1L0Y B;  1C79 A;  2DAJ A;  3GP7 A;  2LGS A;  4URK A;  3RI7 C;  4DXF A;  4XWT A;  1SIF A;  1R7S A;  4MAC A;  2NVU I;  2LXA A;  3ZKJ C;  4AS1 A;  2RPV A;  3ENE A;  2O2V B;  3HUI A;  2MJD A;  1SJE D;  5KHO A;  2JXT A;  3ZNZ B;  3AN1 A;  2VH2 A;  4JGH B;  2JXX A;  4FHK A;  4XYC A;  1N60 A;  2A4Z A;  4XGA B;  2V4I B;  5D3I B;  1CZP A;  4HPP A;  4WQO B;  3L10 B;  5DPT A;  4NAW B;  2LFI A;  3RNC C;  1C77 A;  4MT5 A;  1C3T A;  2L52 A;  2KX3 A;  4ASW C;  3MC8 A;  5E6O A;  2KFK B;  1IUE A;  1PQS A;  1UGJ A;  1TT5 B;  1SBB B;  1C4C A;  3BII D;  1TKY A;  3DOW A;  1LGR A;  1MG4 A;  4HDQ A;  1T3Q A;  3CSF A;  2D07 B;  1K8R B;  3EFU A;  2O6V A;  3S2A A;  3VQI A;  2LMC A;  5JH5 C;  2GB1 A;  2ACZ B;  3AE1 B;  3AM9 A;  3PHX B;  3I63 C;  2LRW A;  1IYF A;  2CHZ A;  2G3Q B;  4HXD A;  3EHV A;  4D2K A;  2I2Y A;  2KC2 A;  4MSQ B;  4C7Z A;  3DVN V;  3BVG A;  4XX5 A;  1GB4 A;  1XQQ A;  3ZRF A;  4NJ6 A;  5LLI A;  2M56 B;  3DBS A;  4HK2 A;  1XLQ A;  4ZDV A;  4Q2J A;  3QAQ A;  2KJH B;  2LVO A;  3CMM B;  3FKY A;  4BOZ B;  3PLU A;  4LDT B;  4IUM B;  2RGF A;  3O65 B;  2DNF A;  2MLB A;  3DPD A;  1YN4 A;  3Q8E A;  1WR6 E;  2OED A;  5D6J B;  3QAR A;  3NG0 A;  4MGK E;  1WGD A;  3JSV A;  3QIJ A;  1NEN B;  1SB3 C;  2KJR A;  5GXG B;  2G45 B;  5FR3 A;  2V0G A;  4WQM A;  4G0N B;  2EKE C;  3P4Q B;  1SE3 A;  1WX8 A;  1LO5 D;  2I1K A;  2PW9 A;  2ASQ A;  1KH0 A;  5E6N A;  2GBK A;  5DPS A;  1FCL A;  4ZYS A;  5LXH A;  4W9D A;  2IO0 B;  1WH3 A;  3RCZ A;  4NJC A;  2ZNV B;  3FAH A;  4FAD A;  2PIA A;  2VRR B;  4W9L A;  4OVZ A;  4GB9 A;  4K81 A;  1IBX A;  3T8M A;  4GIV A;  2H89 B;  2NBW B;  2UYZ B;  1L0X B;  5L83 A;  3PRE A;  1V5T A;  1FRR A;  4IWO A;  5EE1 A;  2MBH A;  3MC0 B;  2AL3 A;  5EE0 A; 
#chains in the Genus database with same CATH homology
 1YN5 A;  1E9M A;  1CJE A;  1D6E C;  4P6V F;  4OHJ A;  4JX1 C;  1QT9 A;  5BMH A;  5LNK 1;  1UNS A;  1VZ6 A;  1WSP A;  1JW9 D;  3W2D A;  3KWV A;  2JYE A;  1A70 A;  2WQY B;  3BZD B;  5AUK A;  1C9F A;  4TQ1 A;  2RDH A;  2G9H D;  4OZA A;  2WXM A;  1SSN A;  3AE2 B;  1BUI C;  3P4R B;  4A90 A;  1JQ4 A;  1EWC A;  1TKG A;  2AX5 A;  1V1P B;  1N63 A;  3T3N A;  1YQ3 B;  3P63 A;  2BS3 B;  3PZ8 A;  2AQ3 B;  5EE3 A;  1HZ6 A;  1SE2 A;  2VZK D;  4YTN B;  1AN8 A;  2DWQ A;  2RDG A;  4MH8 A;  4J3O D;  4A55 A;  1QOG A;  1DGJ A;  4PT5 A;  4YXD B;  2SAK A;  3L4P A;  1HQR D;  3AV8 A;  1N62 A;  1D5Z C;  3P4S B;  1DOI A;  2ICI A;  3WCQ A;  3T3O A;  1JRP A;  5FK9 C;  1N5W A;  2IPK D;  2JQR B;  1MI0 A;  2W55 A;  2AQ2 B;  2B76 B;  3H8H A;  1J7A A;  1K50 A;  1F0Z A;  1KTK A;  3BVM A;  2MEK A;  1FFU A;  3NZ3 A;  1SJH D;  1I4X A;  1TKE A;  1XF5 L;  2WDQ B;  2IGH A;  3AE6 B;  1YQ4 B;  1ENF A;  1V8C A;  2WXK A;  2GI9 A;  1JCK B;  2RMM A;  3I9V 1;  2VZK B;  3W9C B;  1IGD A;  3MFG A;  4A8X C;  2CJN A;  4USA A;  1PYW D;  1MPE A;  1TS3 A;  3AEA B;  4A9A A;  3N9Y C;  2W3S A;  1CQV A;  3NVY A;  1YMH E;  4ZHP A;  2PVO D;  3B2F A;  3W5U B;  2WXJ A;  2BBC A;  2PLP A;  4RGM A;  4C80 A;  1QLB B;  3KLS X;  1F2R I;  2WXP A;  1L6U A;  2INP E;  3AE5 B;  5HHD G;  3EGR A;  5D3D A;  3U2S C;  3I57 A;  2BTE A;  1PUT A;  2BS4 B;  2FUG 1;  2LHE A;  3DWM A;  2PKO A;  1C4P A;  2MJE A;  3CIR B;  2BB5 A;  4US8 A;  4MM3 B;  2J53 A;  1XXG A;  3FIL A;  1Y56 A;  3HVD A;  1XCQ L;  4XDC A;  1I4R A;  5C2T B;  1GAQ B;  1I4H A;  1FNW A;  3IT6 B;  4OW0 A;  3AE4 B;  2FE8 A;  3RFZ B;  2ZW1 A;  3Q8C A;  2PTL A;  3AE9 B;  4TSS A;  5BMI A;  1C78 A;  4ZRQ A;  1XLN A;  1VJK A;  3IT4 B;  3BK1 A;  2JX5 A;  1ACC A;  1KLG D;  1FNV A;  1E10 A;  2EEL A;  4JE3 B;  4WH4 A;  1T5X D;  3ZJU A;  2WXQ A;  4WUR A;  4US9 A;  3ABV B;  5I4D A;  1WGK A;  1DOY A;  1UWM A;  3MHZ A;  4RGT A;  2LUM A;  2K5P A;  2Y3A A;  1VZ8 A;  1Q10 A;  1T6B X;  2EKI A;  1KRH A;  2W3R A;  4REZ A;  2MH7 A;  4CQN A;  1TY2 A;  2XN9 C;  1K51 A;  4H2A A;  4B0E A;  2IJ0 A;  1EU3 A;  3AED B;  2J42 A;  2LJI A;  5BYR A;  3AH7 A;  4P16 A;  3U52 E;  2M19 A;  3KQ4 A;  4KGT A;  4R3D A;  5HFY A;  3GB1 A;  1JWM D;  4RGN A;  1E0Z A;  1I4P A;  3P42 A;  2CU3 A;  4LK0 M;  1FXA A;  1ZXI A;  1RWS A;  2BW2 A;  1GPX A;  2W54 A;  4HKZ E;  1VDV A;  4DQO C;  2J4X A;  2IGG A;  5BYS A;  3SFD B;  2WNM A;  4C7Y A;  3E9S A;  5H92 C;  4OZB A;  3O13 A;  2Y5C A;  2KWD A;  3ETR A;  2WXN A;  1C76 A;  2BB6 A;  5AUI A;  1N61 A;  1E7P B;  4YTM B;  1JML A;  1JWS D;  4YSX B;  2BS2 B;  3AEF B;  4JPS A;  1ET6 A;  2WS3 B;  1ESF A;  1WXQ A;  4RNA A;  3TSS A;  2INN E;  1L4Z B;  1JWU D;  2FBW B;  2KAJ A;  4KKI A;  4ZOH C;  1PFD A;  5JXV A;  1FNU A;  3EA6 A;  2WLB A;  1HEZ E;  3BWU D;  1EWY C;  1JRO A;  4RCO A;  4HKQ A;  4LTU A;  2KMM A;  5C3J B;  2WXG A;  2I38 A;  3MP9 A;  1DOX A;  4KX6 B;  2K3U A;  1QKZ A;  3P1M A;  4HRS A;  1J7B A;  2L83 A;  3NVZ A;  4GDL B;  2LEK A;  1TZO A;  2M0A A;  2QJL A;  1BML C;  3E56 A;  3ZJT A;  1UWX A;  1FD6 A;  3W1S A;  1PDX A;  1K52 A;  3PZ7 A;  1CK1 A;  3AEC B;  5EE9 A;  4IKG A;  1PGX A;  3NVV A;  5H8Y E;  4HJG E;  1TJE A;  2TSS A;  1VR9 A;  3B2G A;  1WRI A;  3SEB A;  1TYG B;  2LHD A;  4L2Y A;  3DWG C;  2H88 B;  5G5H A;  2DBY A;  4OZC A;  1IGC A;  1L0V B;  1ZOY B;  2YEP F;  4L23 A;  1MHX A;  4XWW A;  5HG2 A;  3GS2 A;  1XLO A;  5BYQ A;  2E3T A;  1ZDX A;  3V05 A;  1ZP0 B;  1SIJ A;  4ITK A;  1STE A;  3AEB B;  3IAS 1;  1C4A A;  2WDR B;  1VRA B;  2WXO A;  2DYO A;  1ZDV A;  1IBX B;  3KWL A;  4HEA 1;  2NMQ A;  4RF1 A;  3SFE B;  3PO0 A;  4N59 A;  2N9K A;  2L1A A;  1ZXH A;  2E6X A;  3BYT B;  2BYT A;  2IDY A;  2D5G A;  1FO4 A;  1EU4 A;  5T8I A;  2K22 A;  2DLB A;  1RFK A;  4KGS A;  4WAF A;  2JYT A;  1V1P A;  1DYQ A;  1FFV A;  2QSD A;  2G1E A;  2R61 A;  3AE7 B;  4ARI A;  2JSV X;  1F77 A;  4TMA B;  1NYQ A;  2GRI A;  3AE8 B;  4ZHO A;  4NAM A;  1GOZ A;  3HVZ A;  4JWS C;  2KDM A;  2WU2 B;  3TUO A;  4C56 C;  1AYF A;  1FRD A;  3TEZ A;  5G5G A;  2Q5W D;  1YJJ A;  3Q8F A;  3NVW A;  1FIQ A;  4XDD A;  1L0Y B;  1L4D B;  1TY0 A;  1C79 A;  2WDV B;  3Q69 A;  1BXT A;  1D5M C;  3W5V B;  3GP7 A;  1D5X C;  1JWB D;  3LXF A;  1L5P A;  4DXF A;  4XWT A;  1ZUD 2;  1R7S A;  4MAC A;  1E6E B;  2AQ1 B;  2KQ4 X;  3BYY B;  3C8Y A;  2JZP A;  2NTT A;  1QF6 A;  3AE3 B;  1MVK A;  2K9X A;  3OWE B;  1QIL A;  4AS1 A;  2RPV A;  3HUI A;  4YSY B;  2MJD A;  1SJE D;  3R2I A;  2N7J A;  2JXT A;  1FM0 D;  3AN1 A;  3AEG B;  1GB1 A;  1N60 A;  1PGB A;  5D3I B;  2V4I B;  1CZP A;  3VRA B;  2ON8 A;  2JWU A;  3NRZ A;  2KN4 A;  1VZ7 A;  3TEX A;  1KLU D;  2PMV A;  4AQ7 A;  2PVG C;  4GLS C;  2JU6 X;  3P4P B;  2XNA C;  4NAW B;  2V3P A;  3NS1 A;  1P7E A;  1XCT L;  3AMZ A;  3U7Z A;  3TEY A;  4NZL B;  4YT0 B;  4N58 A;  2LFI A;  1C77 A;  4MT5 A;  3ZJV A;  1K53 A;  2V3N A;  1J7C A;  1EM7 A;  3EUB 2;  2L52 A;  2WXI A;  1L6V A;  1KF6 B;  4L1B A;  3IXS A;  1B9R A;  3R8B A;  4N6E B;  3RPF C;  4JWU C;  2WP9 B;  1SXT A;  2WXH A;  1HZ5 A;  1IUE A;  1WWT A;  4YSZ B;  1AWD A;  1UGJ A;  1SBB B;  1C4C A;  2WXF A;  3SR6 A;  3BII D;  1TKY A;  5FKA C;  3FIL B;  1ZE3 D;  3VR9 B;  3ZQ4 A;  2Z8L A;  2J52 A;  1T3Q A;  2WXR A;  1MHH E;  1M4V A;  4GDK B;  1OQR A;  1F2R C;  1NVI D;  3BVZ A;  5D7G A;  4UDU C;  3VQI A;  4O1N A;  2LMC A;  2WU5 B;  1OFF A;  2X38 A;  4KKJ A;  1XO3 A;  1QOF A;  2ACZ B;  2GB1 A;  3AE1 B;  3AM9 A;  3Q8B A;  4ARC A;  5BMG A;  2ONQ A;  3U4E G;  1XLP A;  2MJ3 A;  1QOB A;  1YJI A;  2N9L A;  4D2K A;  3J9C A;  2I2Y A;  2Y5P A;  3UI3 A;  4C7Z A;  3HRD D;  2YEP B;  1I4G A;  3BVG A;  1V1O A;  1GB4 A;  3CWI A;  4XE0 A;  3LYY A;  4DXG A;  2M56 B;  3LB8 C;  1XLQ A;  1JAL A;  4Q2J A;  4A6Q A;  1FMA D;  2QMT A;  3AB5 A;  2CJO A;  2K0P A;  5HI1 A;  1NEK B;  4WWM A;  2HDE A;  1ZPS A;  2QIE B;  1WYG A;  4KGR A;  4RH6 A;  3VR8 B;  1TS5 A;  4TQ0 A;  1FCC C;  1RYJ A;  1SF0 A;  3MJ5 A;  2L32 A;  3Q8A A;  3AEE B;  4ZRP A;  2LGI A;  4RGO S;  1YN4 A;  4LLG M;  3Q8E A;  1I4Q A;  2OED A;  2BT6 A;  4YWG G;  3BK2 A;  3FC4 A;  3B9J A;  2N0S B;  3NUH B;  1RM6 C;  1NI3 A;  2W82 A;  4M0W A;  4B0M A;  2WXL A;  1YN3 A;  1I7H A;  1NEN B;  1SB3 C;  2QEJ C;  5GXG B;  3URY A;  1HA5 A;  1TS2 A;  5FR3 A;  3ZYY X;  1FEH A;  2ZW0 A;  2V0G A;  1B1Z A;  4WQM A;  4EE2 A;  3P4Q B;  4RFB A;  3V3X A;  1AW7 A;  1SE3 A;  2HTM E;  3IAM 1;  1LO5 D;  1UUP A;  4HRO A;  2PW9 A;  4YTP B;  1KH0 A;  1SEB D;  1VLB A;  1ET9 A;  1PGA A;  4FXC A;  1ROE A;  1D4B A;  4RF0 A;  3ZGZ A;  4ZYS A;  1FCL A;  3VRB B;  3TEW A;  1QOA A;  4NJC A;  4IOI E;  1P7F A;  3FAH A;  2PIA A;  1HXY D;  2NTS A;  1KFY B;  1N5X A;  1SE4 A;  2SEB D;  5TSS A;  3R2T A;  1FXI A;  4OVZ A;  2KAC A;  1IBX A;  4WIP A;  2H89 B;  2OHF A;  1L0X B;  1V97 A;  2QIL A;  1NYR A;  1YNT E;  1TS4 A;  2IGD A;  5MPO A;  1OQQ A;  4IDI A;  1JWA D;  5E6J A;  1FRR A;  5EE1 A;  1QQR A;  1XEE A;  3MC0 B;  2DYM A;  5EE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...