5HI1A

Backbone modifications in the protein gb1 helix: aib24, beta-3-lys28, beta-3-lys31, aib35
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Comparison of design strategies for alpha-helix backbone modification in a protein tertiary fold.
pubmed doi rcsb
molecule tags De novo protein
total genus 11
structure length 52
sequence length 56
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5hi1A00
3V3XA 1GB1A 1JMLA 5JXVA 2OEDA 2KDMA 1PGBA 1UWXA 3FILA 1QKZA 4OZAA 2NMQA 1HZ6A 1MHXA 1FD6A 2JWUA 5HI1A 3GB1A 2KWDA 1YNTE 2ONQA 4WH4A 2PLPA 1K51A 2JXTA 1IGCA 1IBXB 1EM7A 2LGIA 1ZXHA 4KGTA 1FCLA 2ON8A 2PW9A 2GB1A 2N7JA 2N9LA 1Q10A 4GLSC 1MI0A 2IGDA 1XCTL 2QMTA 1MPEA 1K50A 1D4BA 1P7FA 2KQ4X 2KN4A 5HG2A 2N9KA 2IGGA 1FCCC 2RPVA 2QSDA 2RMMA 5BMHA 2I2YA 5HHDG 1HZ5A 4KGSA 4OZCA 1C9FA 1GB4A 2J53A 4HJGE 5BMGA 1IGDA 5HFYA 1K53A 2IGHA 4HKZE 1KH0A 1IBXA 1P7EA 2GI9A 1YMHE 3FILB 5BMIA 3MP9A 4KGRA 1MVKA 2ZW0A 2ZW1A 2LHEA 2JSVX 2LUMA 2J52A 1XCQL 2KACA 1HEZE 2EELA 4D2KA 3UI3A 2I38A 1F2RC 1MHHE 1PGXA 1F2RI 1XF5L 4IOIE 2K0PA 4OZBA 4IKGA 1K52A 2JU6X 2PTLA 2LHDA 4MACA 1PGAA 2JZPA
chains in the Genus database with same CATH superfamily
2IO0B 4RH6A 1L2NA 1WZ3A 3VVWB 3L13A 4WURA 4W9IA 2KWDA 4LNIA 1R7SA 4DXFA 1UNSA 3BWUD 1V2YA 3M3JA 3A33B 3AU4A 1XLNA 2KD0A 4W9JA 2IDYA 2C7MB 3HRDD 5D7GA 3NUHB 1QQRA 3HHMA 2A5UA 2GRIA 4OW0A 2BT6A 3TBLD 4C7YA 2NTSA 4LNFA 2JRHA 3H7PA 3ZNZB 1ZE3D 3W1SA 1IBXA 3DBSA 3N1XC 4FLHA 2DENB 4HVBA 3JSVA 2ICIA 3I3TB 2C60A 4JWSC 4CYEA 3KQ4A 3Q8EA 1D3ZA 3KUDB 4W9CA 2G1EA 5AZHA 2IY1B 1V8CA 1V97A 3CSTA 1A5RA 4IWOA 2A4ZA 2KJ6A 3AULA 4L23A 4MACA 3ZRCA 4OVVA 3CSFA 3LJ3A 2DYBA 1ROEA 3GZNI 1WH3A 2KDMA 1QOGA 3MC8A 3UF8A 2WXRA 2SAKA 2MBHA 3H8HA 2WU2B 3C0RB 3OG5A 3VTWA 2BWES 2LI5A 1MFWA 1SXTA 1C77A 4US8A 3N1ZC 2QHOA 1ZW7A 2EKEC 4G50A 2KC2A 3H9DA 4LK0M 3VUWA 5FR6A 2PE6B 1TYGB 2BGFA 2QEJC 4HWIB 2G4DB 3ZNHB 3Q2AC 2KN4A 4GDKA 3DCGA 2UYZB 2Y3AA 4P1BC 3VR9B 4RNAA 4C00A 3DVGY 3ENEA 2L76A 4OZCA 4ZRKA 1C9FA 1UZXB 1XQQA 1L0VB 4DHZE 1IYFA 3DBLB 4DXAB 2JQRB 2FBWB 1DOIA 1WSPA 4US9A 3SD5A 4GSWA 4TUUA 1GC6A 1V9JA 3EFUA 2FUHB 4K7UA 5JH5C 4CQNA 1NEKB 1YIWA 1TTNA 1SSNA 1J7AA 5EE3A 2WXFA 2BB5A 3OJ4B 2HTHA 3P4SB 5AZGA 3RD2A 2JY6A 3B2GA 4IOIE 2XEWA 3APDA 1UBQA 2N0SB 2NVUI 3KLSX 5G2NA 3BIID 4A9AA 5CTRC 2INNE 2FCMA 2Z8LA 2K39A 2OEDA 3PREA 3S2AA 2K8HA 4YTMB 1GC7A 1JROA 3RNFC 3EGRA 3IFWB 2RDHA 3MHZA 3H7PB 3GB1A 1GNUA 3LDZE 2R2QA 1Q5WB 2VH1A 3CIRB 1SEBD 1WF9A 2JZZA 2NBUA 3WAMA 4ANWA 2EMTA 1IBXB 2LGIA 2DYOA 2KVRA 4KGTA 2C9WB 2ASQA 2WNMA 4IG7B 3JSVB 1MI0A 4LDTB 4M8NA 2V4LA 5D94A 3RZWC 2ZVNA 1L6UA 2Y5CA 3QARA 4P7IA 4ANUA 1FCCC 4W9FA 4J3OD 4NNJB 1YN5A 3IXSA 3GE3C 4WJQA 3AEGB 1KJTA 3N20C 4ZRQA 4C80A 2WXQA 4ZHOA 1N63A 5BYRA 3QX1A 1L0XB 4ZRIA 1V1OA 3R7RA 1P3QU 3DHGC 2GI9A 1Z5SB 1MJDA 2INPE 2AL3A 3WANA 3AECB 2AEHA 1E8YA 4BAXA 3SEBA 5IA7A 4EOYA 2LVQA 2MJ3A 1J7CA 3ZNGC 2KACA 4LNOA 4D2KA 1WYGA 3NG0A 3RMKC 4XDDA 1OQQA 2N1VA 2K22A 1XF5L 3PS6A 3PRZA 5IOIA 2RDBC 1VD2A 3ONSA 4TQ1A 3KYDD 3L0WB 1ZDXA 2KT7A 4A3OA 3UGBB 4X57B 4WJOA 2JZPA 4K3BA 4FADA 1CZPA 2UWQA 4GDKB 3V60A 3ZTCA 1IPGA 1QKZA 3LXFA 1FD6A 3QC8B 5HI1A 4TMAB 3R2TA 2QC8A 3HK0A 4A90A 4IC7B 3MFGA 4WH4A 2JXTA 5BYQA 2D11A 3SHQA 1F77A 3GE8C 3VAWA 1EF5A 1RM6C 3B9JA 2BYEA 1PDXA 3HIZA 3R2IA 2VRRB 2V9HA 2QDFA 3DWGC 3KW5B 1EF1A 1YX5B 3CWIA 1MPEA 5D3IB 1PYWD 4N9F4 3VH4B 2KWUB 2WWZA 1RYJA 5KHOA 2MWSB 4K7WA 1UD7A 3AE3B 2KTRA 1GG3A 4LTUA 4MM3A 1BUIC 4GGQA 1FO4A 5HKHA 1M94A 1HZ5A 4M8MA 4DHZB 5IO9A 3NRZA 2I1JA 3Q8AA 2O2VA 3ABVB 2IPKD 3ML9A 3SDLC 2JF5A 1SE4A 1UELA 3PVLA 1NYQA 4HCPB 2MRPA 5C3JB 1I35A 5IN7A 1QILA 3RNEC 4WQMA 3VTVA 2DAJA 1I42A 4HXDA 3ZDMC 2BS4B 1J0GA 4WAFA 2WXOA 2WXGA 1HTQA 1NENB 3PZDA 3AE8B 4YTPB 3TJPA 3HM3A 1E8XA 1V5OA 3A4SC 1FNWA 4MGYE 4AJYB 1NVID 4DDGD 3EUB2 3U2SC 2PIAA 1WGDA 1BT0A 5D2MB 2LUEA 2KVZA 4KZCA 1LGRA 1D5MC 2N9PC 1I4QA 4P1CC 4C4VB 2IYDB 5CX3A 2PEAA 3M63B 3VTUA 2K6DB 3LYYA 4YWGG 5MPOA 1GOZA 4DK5A 2NR2A 1YQ3B 2KFJA 2PLPA 5I4DA 1EM7A 1N5WA 4FN2A 2IJ0A 3SFEB 1GJZA 1E7PB 4PS8A 1XT9B 5AZFA 3AN1A 5GXGB 4FHJA 1EWYC 4TKNA 3U7ZA 1WRIA 2KQ4X 3UIOB 1VR9A 1FFVA 1F9JA 4EZJA 3DBHI 5DCNA 1E9MA 2YEPB 3AM9A 4WWPA 4BOSC 2E3TA 4XX5A 4W9KA 4AQ7A 4REZA 2IGHA 2GBRA 1P7EA 1TY2A 3DVNV 3Q14C 4F8CB 2W54A 4K7SA 4FHKA 2INDC 1QT9A 3Q3MC 2D3AA 4W9GA 2KYWA 1P0RA 4QAYA 2WX1A 1WGGA 2L52A 1LO5D 3NVWA 3K9PB 3MHSD 1SIFA 2FIDA 3D32A 2BKFA 3E56A 1KF6B 2DLBA 3DBRB 4S17A 2K8BA 1T3QA 4NJ6A 4E71A 1TS3A 2KTRB 1GUAB 4XWTA 3W5VB 1WX9A 2IO3B 3ETRA 3TEYA 2O2VB 1D5ZC 4YSZB 1SBBB 2KKCA 1F1HA 4NPNA 4OVZA 1YNTE 3TEZA 2CR5A 4HCNB 3NJTA 4MSMB 1WX8A 2DX5B 2FIFA 1WR1A 1F0ZA 4FJYA 4JL9A 4FJVB 2PVOD 4A20A 5L83A 3P63A 2AQ2B 5AUIA 5FR3A 2MEKA 5LXIB 3R7QA 2GBMA 3P4PB 3NZ3A 3U8ZA 5HG2A 2ZPNA 1IP9A 2RPVA 2X8XX 1F52A 2BW2A 2AX5A 4KZ0A 3PRPB 2J0MA 1N62A 2IO2B 2V1YA 4MEMA 1IGDA 5D6JB 5HFYA 4O1NA 3UQAA 2B76B 3DQVA 1UUPA 4IWPA 2WXHA 4ZRPA 5BMIA 3BVZA 2ZW0A 2WDRB 2ZW1A 1FNVA 2IBIB 2K8CA 3VR8B 2MBBB 1R4MI 1C3TA 3O13A 2RSUA 5FK9C 4ANXA 2GBKA 2CKHB 2EELA 2I38A 2LVOA 4N59A 1RAXA 1QOBA 3B0AA 4Q2JA 3ZIMA 2G4SA 3EC8A 1D5XC 3OJ3A 4JWUC 1Y56A 2M56B 5G5HA 3V3XA 4YSXB 1ZDVA 3FILA 1L5PA 1EO6A 5J2RA 2YLMA 1YQ4B 4WJPA 3RUIB 1NDDA 2JWUA 1WE6A 1ACCA 4IUMB 1B1ZA 2Y5PA 2CHWA 4ZOHC 3AE2B 3NZSA 4ICVA 1XLPA 4BBNC 2BPSA 2BKRB 5E6JA 2W82A 3KH0A 4KX6B 3SFDB 1E5WA 3A9JA 5DPSA 2N9LA 1YJIA 3DOWA 2C5LC 3C19A 2YEPF 3ZXVA 3RN9C 3EECA 4A6QA 3SU8X 3DHHC 4NQKE 2BYVE 3TEWA 2RMMA 1FM0D 4LCDE 5BYSA 1ZXIA 3HUIA 4JLCA 3NVYA 5HHDG 1P1AA 4EE2A 2MBEA 2O6VA 2YVCA 4XE0A 2N7DA 2INCC 3VRBB 4BKGA 2DZIA 2XBBC 2FNJB 4HKQA 4WWOA 3MC0B 2WGSA 3PT2B 3ZKJC 1NI2A 1YMHE 2LD9A 3N1YC 2ZEQA 1EWCA 1ZUD2 1UBIA 2J52A 1WY8A 5C2TB 2JYTA 3PLVA 4ZDVA 1TS4A 3NOBA 1V1PA 5D3DA 2LGSA 1AYFA 4HJKA 4AP4C 4RGMA 1SE2A 3X0WA 4R3DA 2L7RA 1HXYD 2GOWA 4LNKA 4W9EA 5JHAA 2PTLA 2G3QB 2QJLA 3MJWA 2KC1A 1ENFA 5LXHA 3P2BA 1JWSD 2WU5B 4PK1A 1HZ6A 4MGKE 1I4PA 1WR6E 2K25A 2MBQA 1WWTA 1T6BX 4KDIC 1M4VA 2WXMA 1RFAA 3I5JC 3V05A 2RDGA 4HK2A 1WXAA 2ON8A 2GB1A 1RWSA 1H4RA 2MA9B 2KK8A 1R4NB 2D07B 2MCNB 4DHJD 4RF1A 2ZNVB 4EZKA 1QOFA 4BVUC 1T0SC 3ALBA 3AI5A 4DBGA 2ZPYA 3H1UA 2J4XA 2KQ7A 2BB6A 1N61A 2QILA 2MW5A 3AE1B 4DDID 5J17A 3BYYB 3AMZA 4HRSA 3VQIA 1E7VA 1L6VA 3DBLI 1K53A 1QLBB 1I7HA 4MH0E 3QA8A 2AL6A 3VRAB 1JWAD 2RD0A 4AJWA 3FILB 4XWWA 1P9DU 3BY4B 4H2AA 3U30A 2LHEA 3URYA 4IM0A 4HEA1 2GBJA 5T8IA 2DZMA 1FEHA 3PTFC 3DDCB 3WA0A 4TV3A 4JPSA 4HLEA 3TSSA 1G6JA 1SGHA 3Q3NC 3BK1A 2DYMA 5GMVA 4W9LA 3ZDTA 3Q8FA 3TMPB 4KKJA 1HA5A 2C7NB 1TKEA 2VZKB 4IDIA 3TUOA 2MHJA 4HPPA 3Q8BA 4G11A 3ZJTA 4ASWC 3ZJUA 2O6VB 4GU2A 4WWMA 1FFUA 1XXGA 1MHXA 2JXXA 3QCAA 2CJOA 1P98A 1JWUD 4P6VF 1IGCA 2K3UA 2IZVB 3WALA 3AV8A 1H8CA 1Q1OA 3Q3FA 4GLSC 4NQLB 1ZOYB 1D6EC 1BMLC 3KYCD 2QMTA 5H8YE 1V1PB 3WCQA 2DZKA 2N9KA 4YXDB 2QCZA 2QSDA 4ARIA 2MX2A 1FPYA 2DAFA 2KXJA 1I4XA 3P1MA 3AEBB 1WI0A 3TEXA 1N5XA 1E90A 2C7HA 1WXSA 2WXJA 4EKUA 2D5GA 4F1SA 1VJKA 2PMVA 4AOFA 2KJRA 1IUEA 1C79A 3NY5A 2BWFA 1AW7A 4KVGB 3ZVVA 2WYQA 4PYZA 4W9HA 4BOZB 1J19A 4BKSD 3PSEB 3BYTB 4C56C 1HEZE 3ZUNA 4CO7A 4EUTA 1V81A 3R8BA 4M0WA 2J0KA 4HPMB 2LJIA 2OJWA 3LB8C 2PE9A 2WXKA 2H88B 2PPHA 2HTME 4NAMA 3OWEB 3A9KA 4JQWC 2JWZA 2FUG1 4LLGM 4TQ0A 3PRMB 2WLBA 3ZO5B 1TT5B 3NZUA 1YJ1A 2W3RA 1ET9A 4M02A 4GB9A 3O65B 1SE3A 2NPTA 3IVFA 4ACFA 2L32A 1KTKA 2WDQB 3QWZB 3EFCA 5FKAC 1FIQA 2LRWA 2BQQA 2WDTB 2KOXA 2DZJA 3IAS1 4GDLA 2DHZA 4B9KA 1RLFA 2IGDA 5CHWA 3WAPA 1I4RA 4OVUA 3KWVA 5EE1A 3Q8CA 4M01A 5E6NA 3AB5A 1FXIA 3L4PA 2V3NA 2N9EB 3FKYA 2I2YA 2L83A 2JPHA 2RR9A 3Q6BA 2V3SA 1KLUD 5KHQA 3JYUA 1GB4A 1FMAD 1ET6A 2W55A 2LJ5A 3Q3JA 1WIAA 2JYEA 4TSSA 1KLVA 1SF0A 3SR6A 1ESFA 3VUYA 3IT4B 2RGFA 1E0ZA 5CHFA 4I6NB 2KMMA 1J8CA 4GXBA 1SE9A 1C1YB 1WGKA 4MH8A 4K3CA 4UDUC 3VH3B 3AE4B 4ARCA 3L17A 4BBNF 1E6EB 2KMCA 3RCZA 4GMVA 1EU3A 2LHDA 3M62B 2XK5A 2EMSA 4AS1A 3L16A 3V6EB 3H7SA 1V6EA 2K1FA 2HD5B 1PGBA 4AWJA 4CHKA 1Z2MA 2Q5WD 2MBOA 2BS2B 3H6NA 1UWMA 2LXCA 3KUZA 3KUCB 3NVVA 2AYOB 4B6WA 4ICUA 3IT6B 2PKOA 4RGTA 1NYRA 2AQ1B 1HQRD 1FXAA 2KX0A 3HVZA 2Y5BB 2KLGA 2D2QA 3P4QB 2PW9A 2LMCA 2N7JA 2MJEA 3E9SA 2N4FA 4MM3B 2GLSA 4II2B 4HDOA 3QAQA 1K50A 2K9XA 3I57A 2L0FA 4JX1C 3NS8A 3U4EG 1JRPA 4RCOA 1JRUA 1B9RA 1S3SG 3ZRFA 4M0WB 1JCKB 5LNK1 1CQVA 2FCNA 1FRDA 2KJHB 3CMMB 2M0XA 2MP2A 5TSSA 4HJGE 5DPRA 3W1YA 1DYQA 1WGHA 2ZVOA 2J7QB 2ZZPB 4HKZE 4A3PA 3HM6X 1UGMA 1STEA 1WFYA 1S1QB 5G55A 5C1ZA 4FXCA 2AWTA 1FRRA 5LLIA 2WHIA 2CHXA 2BYFA 2NPTB 4JE3B 3VHTC 2KHWB 2V3PA 3NHEB 3DWMA 1I4HA 4MT5A 1TGZB 4GDLB 3W9CB 1VCBA 1E10A 1TS5A 1L4ZB 3A4RA 4IKGA 1SIJA 4EEWA 3DBRI 2KANA 1HE8A 2ZNVC 2NS5A 2HJ1A 1SB3C 1GPXA 4J6IA 1JMLA 1WRDB 1YN3A 1VDVA 2G45B 4RGNA 1YJJA 1LXDA 1PFDA 3I9V1 4KIKA 3GZNB 3W1SC 4NJCA 2CU1A 4P16A 2WXNA 3QHTA 2KO3A 4XYCA 1YN4A 2J42A 3BVGA 2PJHA 2Z0EB 1AARA 2JUOA 2M4NA 4YL8A 4RGOS 1WXMA 3AEFB 4MJSA 2JVCA 3APCA 4K81A 4II3B 4BKTA 3ZLZA 1FXTB 2IGGA 2FE8A 5BMHA 1TJEA 3PPAA 2HJ8A 2KDBA 1Q0WB 3TCAA 1RFKA 4EZLA 2LFIA 5BMGA 2D3CA 4YSYB 2L0TA 1XLQA 3L54A 3X23A 1XLOA 2XK5B 1WZ0A 2ACZB 2CJNA 4ANVA 5IKCM 2GBNA 3RFZB 2KTFA 4BFRA 1DOYA 1C4AA 4ZYNA 4WQOB 3V62A 1NBFC 2WDVB 4AUQC 2JX5A 2TSSA 3B2FA 2WX0A 1C4PA 1V80A 3DHIC 3KVFB 4FULA 3EHVA 1VRAB 2K6QA 2QIEB 4RM9A 2KWVB 2V4IB 1OQRA 1WYWB 1C78A 2JRIB 3M95A 5JXVA 3A1QA 3GOEA 2V0GA 1LQBA 2AQ3B 1V5TA 4DXGA 5C23A 1C76A 4F7ZA 3T3OA 2NMQA 2KDEB 2MP2B 3AE7B 1L4DB 3N3KB 3T9LA 2WXPA 3VFKA 4WWNA 5EDSA 3QK0A 1X1MA 2KX3A 4B0MA 4KSKC 1WGYA 1DOXA 1XEEA 1OTRB 3NS1A 1FCLA 3ECIA 3ZW3A 3V6CB 2NBWB 3RI7C 3GS2A 1JWMD 4XZ4A 3R3MA 2MQJA 2SEBD 1T0YA 1WM3A 3PV1A 1P7FA 1E8ZA 5TR5A 3B08A 4YTNB 2N1WA 1KFYB 4I6LB 3VUXA 2KWCA 3N32A 2J53A 2FAZA 2MLBA 3J9CA 4ZYSA 1TZ1A 1ZP0B 2N7EA 2LVPA 4ZHPA 1FNUA 2MH7A 3DPDA 3PZ7A 4KV2A 2LRUA 1ISNA 3BVMA 3C8YA 4PS3A 4KGRA 2M19A 1MVKA 2KDIA 4KIKB 2KMAA 3PZ8A 4WAAA 2DBYA 2M1MA 2LEKA 5E6PA 3B1LX 2Z0DB 4G3XB 4HPLB 2ZCBA 2KN5A 2KNBA 3Q3OC 1VZ8A 3V61A 1J7BA 2KQSA 2KDFB 1MHHE 3VDZA 5AEKB 1F2RI 3ZJVA 1ZGUB 1ZKHA 2KAJA 4JIOU 2IO1B 2K0PA 5H92C 1N6ZA 1K52A 4RM8A 3AE5B 3RNGC 4MJSB 1TZOA 1OQYA 2KZRA 2M0AA 1WJ4A 1QF6A 2ZJDA 1AN8A 3JVZX 4L2YA 4LJOB 3IAM1 5EE9A 2OOBB 1HTOA 3WAOA 4OZAA 4IM2A 1KRHA 3OLMD 4USAA 1WXQA 4EFOA 3A9JB 1QZEA 3AH7A 4ITKA 2RPQA 1K51A 2G9HD 4BZAA 2HDEA 4C4VA 2PVGC 1CK1A 4E74A 3ZGZA 2CS4A 3JW0X 1R4NI 3L10B 4MGZE 2ZCCA 2L05A 2CU3A 1Q10A 3PHWB 4PT5A 2Z59B 3GP7A 3AEAB 4N58A 4URKA 1XCTL 3AEEB 3BINA 2R61A 5JHBA 1AWDA 3PO0A 1TKGA 3ZYYX 4B0EA 4MDKE 1V86A 2J0JA 1E8WA 4GOCA 3AXCA 3EA6A 1MG4A 1U4AA 4XGAB 3L08A 2BVCA 5BO4B 2W3SA 1XD3B 2GMIC 3Q69A 1CMXB 2L8JA 3A1QB 3UINB 1L7YA 1T5XD 1PQSA 3DVGX 4PS7A 4XDCA 2L3ZA 4KDLB 2XN9C 3HVDA 2BF8B 5DPTA 3VXWA 3AU5A 3QIJA 1UF0A 3U7DA 1L0YB 4IM3A 2LASA 1WMHA 2L1AA 1C4CA 3RT3B 3RULA 4FBJB 4G0NB 1WGRA 1SJED 2D3GA 2CHZA 1YQBA 1A70A 1K8RB 2IY0B 3BK2A 3RZFA 2JU6X 1PUTA 2KFKA 2HE7A 2WQYB 2M17A 3P42A 4E3CA 2OHFA 4NZLB 1YX6B 2H89B 1NI3A 1UWXA 1MG8A 4S0RA 1OEYJ 3PLUA 4ZRJA 1TS2A 1ZPSA 2LXAA 2LGXA 2MSED 1WM2A 1WJUA 2BBCA 2DWQA 1LM8B 2FCQA 1ZXHA 3W2DA 3RNAC 3MC9A 5IP4D 4DWFA 3WIMA 1Y8RC 4NAWA 1KM7A 2WP9B 3IHPC 4RF0A 4K1RB 1OFFA 3MTNB 1DGJA 3FC4A 2FCSA 4DQOC 1VZ7A 2NTTA 4JGHB 3ZQ4A 3IBEA 2EKIA 3MJ5A 2LWPA 5CHVC 2MJDA 3DBHB 5JZEB 4LJPB 4B95A 1JWBD 2M8SA 1GAQB 1T0RC 1WX7A 1YD8U 1WJNA 3QQ8B 2L00B 3RPFC 3BZDB 2W9NA 2DNFA 3ZTDA 3RNBC 1CJEA 2BTEA 2LGDA 3PGEA 4FJZA 4WIPA 2LUMA 3ZXRA 1UH6A 2BS3B 1JALA 3T3NA 1XCQL 5DPWA 2NCNA 3UIPB 1JQ4A 2N9XA 1UGJA 4RMAA 4GIVA 1PGXA 5IAAC 2UU7A 1OEYA 2REXA 5G5GA 4OZBA 2OJRA 1T0QC 2X38A 1VZ6A 3R66C 4KSLC 3UQBA 2JZ3B 1EUVB 1GB1A 1TIFA 3TIXA 2VH2A 4MELA 1N60A 2E6XA 3IG3A 2I1KA 3DVNU 4LDTD 2WXLA 2R2OA 3ZNID 4MGIE 3N9YC 1EU4A 1BXTA 4IWQA 4FA6A 2ONQA 1QOAA 4PYUA 3ML8A 1OGWA 3APFA 3KWLA 5J18A 1LFDA 4RFBA 2BYTA 4N6EB 3PHXB 3RNCC 4GN1A 4MSQB 1WXVA 4C7ZA 3W5UB 1WE7A 5AUKA 4HDQA 1D4BA 3K9OB 1WJ6A 5EE0A 3OAWA 1KLGD 3AE9B 4W9DA 1TY0A 4KKIA 2NBVB 4I6PA 4KGSA 1WMHB 4L1BA 4IW0A 3QJZA 3T8MA 2VZKD 1JW9D 2KFKB 3AE6B 3N30A 5L95C 1KH0A 2O6VD 2D3BA 1TBEA 4BKSA 1VLBA 3NVZA 1E7UA 3MP9A 1KOTA 2LZ6A 2WS3B 4HROA 3FAHA 2JSVX 1V49A 4A55A 3U52E 2D10A 3CF6E 4DHJB 4NJ7A 1XO3A 1R4MB 2LGYA 4YT0B 3UI3A 1TKYA 3RYTA 2WXIA 4OHJA 1F2RC 3A9KB 2K5PA 2XNAC 3TL5A 2JT4B 4M00A 1YOVB 4A8XC 4NAWB 5E6OA 1RRBA 1SJHD 4LNNA 1I4GA 4XC2A 3I63C 3AEDB 4WJNA 2KLCA 2B3AA 4NY0A 3P4RB 1PGAA
chains in the Genus database with same CATH topology
2VZKB 1C78A 4IDIA 3TUOA 5JXVA 1D5MC 3Q8BA 1I4QA 2V0GA 4RH6A 2AQ3B 4DXGA 3ZJTA 3ZJUA 1C76A 4WWMA 3T3OA 1FFUA 2NMQA 4WURA 1XXGA 1MHXA 3LYYA 4YWGG 3AE7B 1L4DB 5MPOA 2CJOA 1GOZA 2KWDA 2WXPA 1JWUD 1R7SA 1YQ3B 4P6VF 2PLPA 4DXFA 5I4DA 1IGCA 1UNSA 3BWUD 2K3UA 1EM7A 1N5WA 2IJ0A 3SFEB 4B0MA 1DOXA 3AV8A 1XEEA 3NS1A 1FCLA 1E7PB 1XLNA 4GLSC 3GS2A 3AN1A 2IDYA 5GXGB 1JWMD 1ZOYB 1D6EC 1EWYC 2SEBD 1BMLC 3HRDD 3U7ZA 5D7GA 2QMTA 1WRIA 1P7FA 2KQ4X 3NUHB 5H8YE 1QQRA 1V1PB 3WCQA 2N9KA 4YXDB 2QSDA 2GRIA 4ARIA 4YTNB 4OW0A 2BT6A 1VR9A 1I4XA 1KFYB 1FFVA 4C7YA 3P1MA 2NTSA 1E9MA 3AEBB 2YEPB 3AM9A 3TEXA 2J53A 3J9CA 4ZYSA 1N5XA 1ZP0B 2E3TA 4ZHPA 1FNUA 2WXJA 1ZE3D 2D5GA 2MH7A 4AQ7A 3PZ7A 4REZA 2IGHA 1VJKA 3W1SA 1IBXA 2PMVA 1P7EA 3BVMA 1IUEA 3C8YA 1C79A 4KGRA 2M19A 1MVKA 1TY2A 3PZ8A 1AW7A 2DBYA 2ICIA 2LEKA 2W54A 1QT9A 4JWSC 3BYTB 3KQ4A 4C56C 1HEZE 1VZ8A 3Q8EA 1J7BA 2G1EA 3R8BA 1MHHE 4M0WA 2L52A 1F2RI 3ZJVA 1V8CA 1LO5D 1V97A 2KAJA 3NVWA 2LJIA 2K0PA 5H92C 3LB8C 2WXKA 1K52A 3AE5B 2H88B 4L23A 2HTME 4NAMA 1TZOA 3E56A 3OWEB 4MACA 2M0AA 1QF6A 1KF6B 2FUG1 2DLBA 1AN8A 4LLGM 4L2YA 4TQ0A 1T3QA 3IAM1 1TS3A 1ROEA 2WLBA 5EE9A 2KDMA 1QOGA 4XWTA 3W5VB 2WXRA 2W3RA 1ET9A 4OZAA 3ETRA 3TEYA 1KRHA 2SAKA 1SE3A 1D5ZC 4YSZB 4USAA 1WXQA 3H8HA 1SBBB 2WU2B 3AH7A 4ITKA 4OVZA 3TEZA 1YNTE 1SXTA 1C77A 4US8A 1K51A 2G9HD 2L32A 1KTKA 2HDEA 2WDQB 2PVGC 1CK1A 5FKAC 3ZGZA 1FIQA 4LK0M 1F0ZA 2PVOD 3IAS1 2CU3A 1TYGB 3P63A 1Q10A 2AQ2B 4PT5A 5AUIA 5FR3A 2IGDA 2QEJC 3AEAB 3GP7A 4N58A 1I4RA 1XCTL 2MEKA 3AEEB 2R61A 3KWVA 5EE1A 3Q8CA 3P4PB 2KN4A 3NZ3A 1AWDA 3AB5A 1FXIA 1TKGA 3PO0A 5HG2A 3ZYYX 4B0EA 3L4PA 2V3NA 2RPVA 2Y3AA 2I2YA 3VR9B 2BW2A 4RNAA 2AX5A 2L83A 4OZCA 1KLUD 1C9FA 1N62A 1GB4A 1FMAD 1ET6A 2W55A 3EA6A 1IGDA 2JYEA 5HFYA 4TSSA 4O1NA 2W3SA 1L0VB 2B76B 1UUPA 3Q69A 1SF0A 2JQRB 3SR6A 1ESFA 2FBWB 2WXHA 3IT4B 4ZRPA 1DOIA 1WSPA 5BMIA 4US9A 3BVZA 1T5XD 2ZW0A 2WDRB 2ZW1A 1E0ZA 1FNVA 4CQNA 2KMMA 1NEKB 3VR8B 4XDCA 3O13A 1SSNA 2XN9C 1J7AA 5EE3A 5FK9C 3HVDA 2WXFA 2BB5A 2EELA 1WGKA 4MH8A 3P4SB 2I38A 4UDUC 1L0YB 3AE4B 4ARCA 2L1AA 1C4CA 3B2GA 4IOIE 1E6EB 1SJED 2N0SB 4N59A 1A70A 1QOBA 3BK2A 1EU3A 4Q2JA 3KLSX 2JU6X 1D5XC 3BIID 1PUTA 2LHDA 4A9AA 4JWUC 1Y56A 2M56B 5G5HA 3V3XA 2INNE 2WQYB 3P42A 4YSXB 2OHFA 2Z8LA 4NZLB 4AS1A 2OEDA 2H89B 1ZDVA 1PGBA 1NI3A 1UWXA 3FILA 1L5PA 2Q5WD 4YTMB 2BS2B 1YQ4B 1UWMA 1JROA 3EGRA 2JWUA 1TS2A 1ZPSA 1ACCA 2RDHA 3MHZA 1B1ZA 3GB1A 2Y5PA 3NVVA 4ZOHC 3CIRB 1SEBD 2BBCA 2DWQA 2PKOA 3AE2B 3IT6B 1NYRA 2AQ1B 1HQRD 4RGTA 1FXAA 1IBXB 2LGIA 1XLPA 1ZXHA 2DYOA 3HVZA 3W2DA 4KGTA 3P4QB 2W82A 5E6JA 2PW9A 4KX6B 3SFDB 2LMCA 2N7JA 2MJEA 2WNMA 2N9LA 3E9SA 1YJIA 4MM3B 1MI0A 2WP9B 2YEPF 4RF0A 1L6UA 1K50A 4A6QA 2K9XA 3I57A 4JX1C 1OFFA 2Y5CA 3U4EG 1JRPA 1DGJA 4RCOA 3FC4A 1FCCC 1VZ7A 4DQOC 3TEWA 2RMMA 1FM0D 5BYSA 1B9RA 1ZXIA 2NTTA 3HUIA 4J3OD 1JCKB 5LNK1 3ZQ4A 1CQVA 3NVYA 5HHDG 4EE2A 4XE0A 1FRDA 2EKIA 3MJ5A 1YN5A 3IXSA 2MJDA 5TSSA 4HJGE 3VRBB 3AEGB 4ZRQA 1JWBD 1DYQA 4C80A 1GAQB 2WXQA 4HKZE 4HKQA 4ZHOA 1N63A 5BYRA 3MC0B 1L0XB 3RPFC 1V1OA 3BZDB 2GI9A 1YMHE 1STEA 4FXCA 1CJEA 2INPE 2BTEA 1FRRA 1EWCA 1ZUD2 3AECB 4WIPA 2LUMA 3SEBA 2J52A 5C2TB 2MJ3A 4JE3B 2JYTA 1J7CA 2BS3B 1JALA 1TS4A 3T3NA 1XCQL 2KACA 1V1PA 5D3DA 4D2KA 1WYGA 1JQ4A 2V3PA 3DWMA 1AYFA 4XDDA 1OQQA 1UGJA 4RGMA 1SE2A 1I4HA 1PGXA 2K22A 4R3DA 1XF5L 4MT5A 1HXYD 4GDLB 3W9CB 5G5GA 4TQ1A 1E10A 1TS5A 1L4ZB 4OZBA 4IKGA 1SIJA 1ZDXA 2PTLA 2X38A 1VZ6A 2JZPA 1SB3C 1GPXA 2QJLA 1CZPA 1GB1A 1JMLA 1ENFA 4GDKB 1YN3A 1VDVA 1N60A 1JWSD 1QKZA 2E6XA 3LXFA 2WU5B 4RGNA 1YJJA 1PFDA 3I9V1 1HZ6A 1FD6A 2WXLA 1I4PA 5HI1A 3N9YC 4TMAB 4NJCA 3R2TA 1EU4A 1WWTA 1T6BX 1BXTA 4A90A 1M4VA 4P16A 3MFGA 2WXNA 2ONQA 2WXMA 4WH4A 1QOAA 2JXTA 3V05A 5BYQA 1YN4A 2RDGA 2J42A 1F77A 3BVGA 3KWLA 1RM6C 3B9JA 2ON8A 2GB1A 1RWSA 4RFBA 1PDXA 4N6EB 2BYTA 3R2IA 4RF1A 4RGOS 3DWGC 4C7ZA 1QOFA 3W5UB 3AEFB 5AUKA 3CWIA 1MPEA 5D3IB 1D4BA 1PYWD 5EE0A 1RYJA 1KLGD 2IGGA 2FE8A 3AE9B 5BMHA 1TY0A 2J4XA 1TJEA 3AE3B 4LTUA 4KKIA 1BUIC 1FO4A 2BB6A 1N61A 1HZ5A 4KGSA 4L1BA 2QILA 1RFKA 3NRZA 3AE1B 3Q8AA 2LFIA 2IPKD 2VZKD 3ABVB 3BYYB 3AMZA 4HRSA 5BMGA 3VQIA 4YSYB 1L6VA 1JW9D 1XLQA 3AE6B 1SE4A 1K53A 1NYQA 1QLBB 1XLOA 5C3JB 1I7HA 1KH0A 2ACZB 3VRAB 1VLBA 2CJNA 1JWAD 3NVZA 1QILA 3FILB 4WQMA 3MP9A 4XWWA 3RFZB 1DOYA 2WS3B 4H2AA 4HROA 2LHEA 3FAHA 2BS4B 2JSVX 3URYA 4WAFA 1C4AA 4A55A 4HEA1 5T8IA 3U52E 2WXOA 2WXGA 2WDVB 1FEHA 2JX5A 1XO3A 4YT0B 3UI3A 1TKYA 4JPSA 2WXIA 4OHJA 1F2RC 1NENB 3TSSA 4YTPB 2K5PA 2TSSA 2XNAC 3AE8B 3B2FA 1C4PA 3BK1A 2DYMA 1FNWA 4A8XC 3Q8FA 1NVID 4NAWB 1VRAB 1SJHD 4KKJA 1HA5A 1I4GA 3AEDB 2QIEB 3EUB2 3U2SC 2PIAA 1TKEA 2V4IB 3P4RB 1PGAA 1OQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V3X A;  1GB1 A;  1JML A;  5JXV A;  2OED A;  2KDM A;  1PGB A;  1UWX A;  3FIL A;  1QKZ A;  4OZA A;  2NMQ A;  1HZ6 A;  1MHX A;  1FD6 A;  2JWU A;  5HI1 A;  3GB1 A;  2KWD A;  1YNT E;  2ONQ A;  4WH4 A;  2PLP A;  1K51 A;  2JXT A;  1IGC A;  1IBX B;  1EM7 A;  2LGI A;  1ZXH A;  4KGT A;  1FCL A;  2ON8 A;  2PW9 A;  2GB1 A;  2N7J A;  2N9L A;  1Q10 A;  4GLS C;  1MI0 A;  2IGD A;  1XCT L;  2QMT A;  1MPE A;  1K50 A;  1D4B A;  1P7F A;  2KQ4 X;  2KN4 A;  5HG2 A;  2N9K A;  2IGG A;  1FCC C;  2RPV A;  2QSD A;  2RMM A;  5BMH A;  2I2Y A;  5HHD G;  1HZ5 A;  4KGS A;  4OZC A;  1C9F A;  1GB4 A;  2J53 A;  4HJG E;  5BMG A;  1IGD A;  5HFY A;  1K53 A;  2IGH A;  4HKZ E;  1KH0 A;  1IBX A;  1P7E A;  2GI9 A;  1YMH E;  3FIL B;  5BMI A;  3MP9 A;  4KGR A;  1MVK A;  2ZW0 A;  2ZW1 A;  2LHE A;  2JSV X;  2LUM A;  2J52 A;  1XCQ L;  2KAC A;  1HEZ E;  2EEL A;  4D2K A;  3UI3 A;  2I38 A;  1F2R C;  1MHH E;  1PGX A;  1F2R I;  1XF5 L;  4IOI E;  2K0P A;  4OZB A;  4IKG A;  1K52 A;  2JU6 X;  2PTL A;  2LHD A;  4MAC A;  1PGA A;  2JZP A; 
#chains in the Genus database with same CATH topology
 2IO0 B;  4RH6 A;  1L2N A;  1WZ3 A;  3VVW B;  3L13 A;  4WUR A;  4W9I A;  2KWD A;  4LNI A;  1R7S A;  4DXF A;  1UNS A;  3BWU D;  1V2Y A;  3M3J A;  3A33 B;  3AU4 A;  1XLN A;  2KD0 A;  4W9J A;  2IDY A;  2C7M B;  3HRD D;  5D7G A;  3NUH B;  1QQR A;  3HHM A;  2A5U A;  2GRI A;  4OW0 A;  2BT6 A;  3TBL D;  4C7Y A;  2NTS A;  4LNF A;  2JRH A;  3H7P A;  3ZNZ B;  1ZE3 D;  3W1S A;  1IBX A;  3DBS A;  3N1X C;  4FLH A;  2DEN B;  4HVB A;  3JSV A;  2ICI A;  3I3T B;  2C60 A;  4JWS C;  4CYE A;  3KQ4 A;  3Q8E A;  1D3Z A;  3KUD B;  4W9C A;  2G1E A;  5AZH A;  2IY1 B;  1V8C A;  1V97 A;  3CST A;  1A5R A;  4IWO A;  2A4Z A;  2KJ6 A;  3AUL A;  4L23 A;  4MAC A;  3ZRC A;  4OVV A;  3CSF A;  3LJ3 A;  2DYB A;  1ROE A;  3GZN I;  1WH3 A;  2KDM A;  1QOG A;  3MC8 A;  3UF8 A;  2WXR A;  2SAK A;  2MBH A;  3H8H A;  2WU2 B;  3C0R B;  3OG5 A;  3VTW A;  2BWE S;  2LI5 A;  1MFW A;  1SXT A;  1C77 A;  4US8 A;  3N1Z C;  2QHO A;  1ZW7 A;  2EKE C;  4G50 A;  2KC2 A;  3H9D A;  4LK0 M;  3VUW A;  5FR6 A;  2PE6 B;  1TYG B;  2BGF A;  2QEJ C;  4HWI B;  2G4D B;  3ZNH B;  3Q2A C;  2KN4 A;  4GDK A;  3DCG A;  2UYZ B;  2Y3A A;  4P1B C;  3VR9 B;  4RNA A;  4C00 A;  3DVG Y;  3ENE A;  2L76 A;  4OZC A;  4ZRK A;  1C9F A;  1UZX B;  1XQQ A;  1L0V B;  4DHZ E;  1IYF A;  3DBL B;  4DXA B;  2JQR B;  2FBW B;  1DOI A;  1WSP A;  4US9 A;  3SD5 A;  4GSW A;  4TUU A;  1GC6 A;  1V9J A;  3EFU A;  2FUH B;  4K7U A;  5JH5 C;  4CQN A;  1NEK B;  1YIW A;  1TTN A;  1SSN A;  1J7A A;  5EE3 A;  2WXF A;  2BB5 A;  3OJ4 B;  2HTH A;  3P4S B;  5AZG A;  3RD2 A;  2JY6 A;  3B2G A;  4IOI E;  2XEW A;  3APD A;  1UBQ A;  2N0S B;  2NVU I;  3KLS X;  5G2N A;  3BII D;  4A9A A;  5CTR C;  2INN E;  2FCM A;  2Z8L A;  2K39 A;  2OED A;  3PRE A;  3S2A A;  2K8H A;  4YTM B;  1GC7 A;  1JRO A;  3RNF C;  3EGR A;  3IFW B;  2RDH A;  3MHZ A;  3H7P B;  3GB1 A;  1GNU A;  3LDZ E;  2R2Q A;  1Q5W B;  2VH1 A;  3CIR B;  1SEB D;  1WF9 A;  2JZZ A;  2NBU A;  3WAM A;  4ANW A;  2EMT A;  1IBX B;  2LGI A;  2DYO A;  2KVR A;  4KGT A;  2C9W B;  2ASQ A;  2WNM A;  4IG7 B;  3JSV B;  1MI0 A;  4LDT B;  4M8N A;  2V4L A;  5D94 A;  3RZW C;  2ZVN A;  1L6U A;  2Y5C A;  3QAR A;  4P7I A;  4ANU A;  1FCC C;  4W9F A;  4J3O D;  4NNJ B;  1YN5 A;  3IXS A;  3GE3 C;  4WJQ A;  3AEG B;  1KJT A;  3N20 C;  4ZRQ A;  4C80 A;  2WXQ A;  4ZHO A;  1N63 A;  5BYR A;  3QX1 A;  1L0X B;  4ZRI A;  1V1O A;  3R7R A;  1P3Q U;  3DHG C;  2GI9 A;  1Z5S B;  1MJD A;  2INP E;  2AL3 A;  3WAN A;  3AEC B;  2AEH A;  1E8Y A;  4BAX A;  3SEB A;  5IA7 A;  4EOY A;  2LVQ A;  2MJ3 A;  1J7C A;  3ZNG C;  2KAC A;  4LNO A;  4D2K A;  1WYG A;  3NG0 A;  3RMK C;  4XDD A;  1OQQ A;  2N1V A;  2K22 A;  1XF5 L;  3PS6 A;  3PRZ A;  5IOI A;  2RDB C;  1VD2 A;  3ONS A;  4TQ1 A;  3KYD D;  3L0W B;  1ZDX A;  2KT7 A;  4A3O A;  3UGB B;  4X57 B;  4WJO A;  2JZP A;  4K3B A;  4FAD A;  1CZP A;  2UWQ A;  4GDK B;  3V60 A;  3ZTC A;  1IPG A;  1QKZ A;  3LXF A;  1FD6 A;  3QC8 B;  5HI1 A;  4TMA B;  3R2T A;  2QC8 A;  3HK0 A;  4A90 A;  4IC7 B;  3MFG A;  4WH4 A;  2JXT A;  5BYQ A;  2D11 A;  3SHQ A;  1F77 A;  3GE8 C;  3VAW A;  1EF5 A;  1RM6 C;  3B9J A;  2BYE A;  1PDX A;  3HIZ A;  3R2I A;  2VRR B;  2V9H A;  2QDF A;  3DWG C;  3KW5 B;  1EF1 A;  1YX5 B;  3CWI A;  1MPE A;  5D3I B;  1PYW D;  4N9F 4;  3VH4 B;  2KWU B;  2WWZ A;  1RYJ A;  5KHO A;  2MWS B;  4K7W A;  1UD7 A;  3AE3 B;  2KTR A;  1GG3 A;  4LTU A;  4MM3 A;  1BUI C;  4GGQ A;  1FO4 A;  5HKH A;  1M94 A;  1HZ5 A;  4M8M A;  4DHZ B;  5IO9 A;  3NRZ A;  2I1J A;  3Q8A A;  2O2V A;  3ABV B;  2IPK D;  3ML9 A;  3SDL C;  2JF5 A;  1SE4 A;  1UEL A;  3PVL A;  1NYQ A;  4HCP B;  2MRP A;  5C3J B;  1I35 A;  5IN7 A;  1QIL A;  3RNE C;  4WQM A;  3VTV A;  2DAJ A;  1I42 A;  4HXD A;  3ZDM C;  2BS4 B;  1J0G A;  4WAF A;  2WXO A;  2WXG A;  1HTQ A;  1NEN B;  3PZD A;  3AE8 B;  4YTP B;  3TJP A;  3HM3 A;  1E8X A;  1V5O A;  3A4S C;  1FNW A;  4MGY E;  4AJY B;  1NVI D;  4DDG D;  3EUB 2;  3U2S C;  2PIA A;  1WGD A;  1BT0 A;  5D2M B;  2LUE A;  2KVZ A;  4KZC A;  1LGR A;  1D5M C;  2N9P C;  1I4Q A;  4P1C C;  4C4V B;  2IYD B;  5CX3 A;  2PEA A;  3M63 B;  3VTU A;  2K6D B;  3LYY A;  4YWG G;  5MPO A;  1GOZ A;  4DK5 A;  2NR2 A;  1YQ3 B;  2KFJ A;  2PLP A;  5I4D A;  1EM7 A;  1N5W A;  4FN2 A;  2IJ0 A;  3SFE B;  1GJZ A;  1E7P B;  4PS8 A;  1XT9 B;  5AZF A;  3AN1 A;  5GXG B;  4FHJ A;  1EWY C;  4TKN A;  3U7Z A;  1WRI A;  2KQ4 X;  3UIO B;  1VR9 A;  1FFV A;  1F9J A;  4EZJ A;  3DBH I;  5DCN A;  1E9M A;  2YEP B;  3AM9 A;  4WWP A;  4BOS C;  2E3T A;  4XX5 A;  4W9K A;  4AQ7 A;  4REZ A;  2IGH A;  2GBR A;  1P7E A;  1TY2 A;  3DVN V;  3Q14 C;  4F8C B;  2W54 A;  4K7S A;  4FHK A;  2IND C;  1QT9 A;  3Q3M C;  2D3A A;  4W9G A;  2KYW A;  1P0R A;  4QAY A;  2WX1 A;  1WGG A;  2L52 A;  1LO5 D;  3NVW A;  3K9P B;  3MHS D;  1SIF A;  2FID A;  3D32 A;  2BKF A;  3E56 A;  1KF6 B;  2DLB A;  3DBR B;  4S17 A;  2K8B A;  1T3Q A;  4NJ6 A;  4E71 A;  1TS3 A;  2KTR B;  1GUA B;  4XWT A;  3W5V B;  1WX9 A;  2IO3 B;  3ETR A;  3TEY A;  2O2V B;  1D5Z C;  4YSZ B;  1SBB B;  2KKC A;  1F1H A;  4NPN A;  4OVZ A;  1YNT E;  3TEZ A;  2CR5 A;  4HCN B;  3NJT A;  4MSM B;  1WX8 A;  2DX5 B;  2FIF A;  1WR1 A;  1F0Z A;  4FJY A;  4JL9 A;  4FJV B;  2PVO D;  4A20 A;  5L83 A;  3P63 A;  2AQ2 B;  5AUI A;  5FR3 A;  2MEK A;  5LXI B;  3R7Q A;  2GBM A;  3P4P B;  3NZ3 A;  3U8Z A;  5HG2 A;  2ZPN A;  1IP9 A;  2RPV A;  2X8X X;  1F52 A;  2BW2 A;  2AX5 A;  4KZ0 A;  3PRP B;  2J0M A;  1N62 A;  2IO2 B;  2V1Y A;  4MEM A;  1IGD A;  5D6J B;  5HFY A;  4O1N A;  3UQA A;  2B76 B;  3DQV A;  1UUP A;  4IWP A;  2WXH A;  4ZRP A;  5BMI A;  3BVZ A;  2ZW0 A;  2WDR B;  2ZW1 A;  1FNV A;  2IBI B;  2K8C A;  3VR8 B;  2MBB B;  1R4M I;  1C3T A;  3O13 A;  2RSU A;  5FK9 C;  4ANX A;  2GBK A;  2CKH B;  2EEL A;  2I38 A;  2LVO A;  4N59 A;  1RAX A;  1QOB A;  3B0A A;  4Q2J A;  3ZIM A;  2G4S A;  3EC8 A;  1D5X C;  3OJ3 A;  4JWU C;  1Y56 A;  2M56 B;  5G5H A;  3V3X A;  4YSX B;  1ZDV A;  3FIL A;  1L5P A;  1EO6 A;  5J2R A;  2YLM A;  1YQ4 B;  4WJP A;  3RUI B;  1NDD A;  2JWU A;  1WE6 A;  1ACC A;  4IUM B;  1B1Z A;  2Y5P A;  2CHW A;  4ZOH C;  3AE2 B;  3NZS A;  4ICV A;  1XLP A;  4BBN C;  2BPS A;  2BKR B;  5E6J A;  2W82 A;  3KH0 A;  4KX6 B;  3SFD B;  1E5W A;  3A9J A;  5DPS A;  2N9L A;  1YJI A;  3DOW A;  2C5L C;  3C19 A;  2YEP F;  3ZXV A;  3RN9 C;  3EEC A;  4A6Q A;  3SU8 X;  3DHH C;  4NQK E;  2BYV E;  3TEW A;  2RMM A;  1FM0 D;  4LCD E;  5BYS A;  1ZXI A;  3HUI A;  4JLC A;  3NVY A;  5HHD G;  1P1A A;  4EE2 A;  2MBE A;  2O6V A;  2YVC A;  4XE0 A;  2N7D A;  2INC C;  3VRB B;  4BKG A;  2DZI A;  2XBB C;  2FNJ B;  4HKQ A;  4WWO A;  3MC0 B;  2WGS A;  3PT2 B;  3ZKJ C;  1NI2 A;  1YMH E;  2LD9 A;  3N1Y C;  2ZEQ A;  1EWC A;  1ZUD 2;  1UBI A;  2J52 A;  1WY8 A;  5C2T B;  2JYT A;  3PLV A;  4ZDV A;  1TS4 A;  3NOB A;  1V1P A;  5D3D A;  2LGS A;  1AYF A;  4HJK A;  4AP4 C;  4RGM A;  1SE2 A;  3X0W A;  4R3D A;  2L7R A;  1HXY D;  2GOW A;  4LNK A;  4W9E A;  5JHA A;  2PTL A;  2G3Q B;  2QJL A;  3MJW A;  2KC1 A;  1ENF A;  5LXH A;  3P2B A;  1JWS D;  2WU5 B;  4PK1 A;  1HZ6 A;  4MGK E;  1I4P A;  1WR6 E;  2K25 A;  2MBQ A;  1WWT A;  1T6B X;  4KDI C;  1M4V A;  2WXM A;  1RFA A;  3I5J C;  3V05 A;  2RDG A;  4HK2 A;  1WXA A;  2ON8 A;  2GB1 A;  1RWS A;  1H4R A;  2MA9 B;  2KK8 A;  1R4N B;  2D07 B;  2MCN B;  4DHJ D;  4RF1 A;  2ZNV B;  4EZK A;  1QOF A;  4BVU C;  1T0S C;  3ALB A;  3AI5 A;  4DBG A;  2ZPY A;  3H1U A;  2J4X A;  2KQ7 A;  2BB6 A;  1N61 A;  2QIL A;  2MW5 A;  3AE1 B;  4DDI D;  5J17 A;  3BYY B;  3AMZ A;  4HRS A;  3VQI A;  1E7V A;  1L6V A;  3DBL I;  1K53 A;  1QLB B;  1I7H A;  4MH0 E;  3QA8 A;  2AL6 A;  3VRA B;  1JWA D;  2RD0 A;  4AJW A;  3FIL B;  4XWW A;  1P9D U;  3BY4 B;  4H2A A;  3U30 A;  2LHE A;  3URY A;  4IM0 A;  4HEA 1;  2GBJ A;  5T8I A;  2DZM A;  1FEH A;  3PTF C;  3DDC B;  3WA0 A;  4TV3 A;  4JPS A;  4HLE A;  3TSS A;  1G6J A;  1SGH A;  3Q3N C;  3BK1 A;  2DYM A;  5GMV A;  4W9L A;  3ZDT A;  3Q8F A;  3TMP B;  4KKJ A;  1HA5 A;  2C7N B;  1TKE A;  2VZK B;  4IDI A;  3TUO A;  2MHJ A;  4HPP A;  3Q8B A;  4G11 A;  3ZJT A;  4ASW C;  3ZJU A;  2O6V B;  4GU2 A;  4WWM A;  1FFU A;  1XXG A;  1MHX A;  2JXX A;  3QCA A;  2CJO A;  1P98 A;  1JWU D;  4P6V F;  1IGC A;  2K3U A;  2IZV B;  3WAL A;  3AV8 A;  1H8C A;  1Q1O A;  3Q3F A;  4GLS C;  4NQL B;  1ZOY B;  1D6E C;  1BML C;  3KYC D;  2QMT A;  5H8Y E;  1V1P B;  3WCQ A;  2DZK A;  2N9K A;  4YXD B;  2QCZ A;  2QSD A;  4ARI A;  2MX2 A;  1FPY A;  2DAF A;  2KXJ A;  1I4X A;  3P1M A;  3AEB B;  1WI0 A;  3TEX A;  1N5X A;  1E90 A;  2C7H A;  1WXS A;  2WXJ A;  4EKU A;  2D5G A;  4F1S A;  1VJK A;  2PMV A;  4AOF A;  2KJR A;  1IUE A;  1C79 A;  3NY5 A;  2BWF A;  1AW7 A;  4KVG B;  3ZVV A;  2WYQ A;  4PYZ A;  4W9H A;  4BOZ B;  1J19 A;  4BKS D;  3PSE B;  3BYT B;  4C56 C;  1HEZ E;  3ZUN A;  4CO7 A;  4EUT A;  1V81 A;  3R8B A;  4M0W A;  2J0K A;  4HPM B;  2LJI A;  2OJW A;  3LB8 C;  2PE9 A;  2WXK A;  2H88 B;  2PPH A;  2HTM E;  4NAM A;  3OWE B;  3A9K A;  4JQW C;  2JWZ A;  2FUG 1;  4LLG M;  4TQ0 A;  3PRM B;  2WLB A;  3ZO5 B;  1TT5 B;  3NZU A;  1YJ1 A;  2W3R A;  1ET9 A;  4M02 A;  4GB9 A;  3O65 B;  1SE3 A;  2NPT A;  3IVF A;  4ACF A;  2L32 A;  1KTK A;  2WDQ B;  3QWZ B;  3EFC A;  5FKA C;  1FIQ A;  2LRW A;  2BQQ A;  2WDT B;  2KOX A;  2DZJ A;  3IAS 1;  4GDL A;  2DHZ A;  4B9K A;  1RLF A;  2IGD A;  5CHW A;  3WAP A;  1I4R A;  4OVU A;  3KWV A;  5EE1 A;  3Q8C A;  4M01 A;  5E6N A;  3AB5 A;  1FXI A;  3L4P A;  2V3N A;  2N9E B;  3FKY A;  2I2Y A;  2L83 A;  2JPH A;  2RR9 A;  3Q6B A;  2V3S A;  1KLU D;  5KHQ A;  3JYU A;  1GB4 A;  1FMA D;  1ET6 A;  2W55 A;  2LJ5 A;  3Q3J A;  1WIA A;  2JYE A;  4TSS A;  1KLV A;  1SF0 A;  3SR6 A;  1ESF A;  3VUY A;  3IT4 B;  2RGF A;  1E0Z A;  5CHF A;  4I6N B;  2KMM A;  1J8C A;  4GXB A;  1SE9 A;  1C1Y B;  1WGK A;  4MH8 A;  4K3C A;  4UDU C;  3VH3 B;  3AE4 B;  4ARC A;  3L17 A;  4BBN F;  1E6E B;  2KMC A;  3RCZ A;  4GMV A;  1EU3 A;  2LHD A;  3M62 B;  2XK5 A;  2EMS A;  4AS1 A;  3L16 A;  3V6E B;  3H7S A;  1V6E A;  2K1F A;  2HD5 B;  1PGB A;  4AWJ A;  4CHK A;  1Z2M A;  2Q5W D;  2MBO A;  2BS2 B;  3H6N A;  1UWM A;  2LXC A;  3KUZ A;  3KUC B;  3NVV A;  2AYO B;  4B6W A;  4ICU A;  3IT6 B;  2PKO A;  4RGT A;  1NYR A;  2AQ1 B;  1HQR D;  1FXA A;  2KX0 A;  3HVZ A;  2Y5B B;  2KLG A;  2D2Q A;  3P4Q B;  2PW9 A;  2LMC A;  2N7J A;  2MJE A;  3E9S A;  2N4F A;  4MM3 B;  2GLS A;  4II2 B;  4HDO A;  3QAQ A;  1K50 A;  2K9X A;  3I57 A;  2L0F A;  4JX1 C;  3NS8 A;  3U4E G;  1JRP A;  4RCO A;  1JRU A;  1B9R A;  1S3S G;  3ZRF A;  4M0W B;  1JCK B;  5LNK 1;  1CQV A;  2FCN A;  1FRD A;  2KJH B;  3CMM B;  2M0X A;  2MP2 A;  5TSS A;  4HJG E;  5DPR A;  3W1Y A;  1DYQ A;  1WGH A;  2ZVO A;  2J7Q B;  2ZZP B;  4HKZ E;  4A3P A;  3HM6 X;  1UGM A;  1STE A;  1WFY A;  1S1Q B;  5G55 A;  5C1Z A;  4FXC A;  2AWT A;  1FRR A;  5LLI A;  2WHI A;  2CHX A;  2BYF A;  2NPT B;  4JE3 B;  3VHT C;  2KHW B;  2V3P A;  3NHE B;  3DWM A;  1I4H A;  4MT5 A;  1TGZ B;  4GDL B;  3W9C B;  1VCB A;  1E10 A;  1TS5 A;  1L4Z B;  3A4R A;  4IKG A;  1SIJ A;  4EEW A;  3DBR I;  2KAN A;  1HE8 A;  2ZNV C;  2NS5 A;  2HJ1 A;  1SB3 C;  1GPX A;  4J6I A;  1JML A;  1WRD B;  1YN3 A;  1VDV A;  2G45 B;  4RGN A;  1YJJ A;  1LXD A;  1PFD A;  3I9V 1;  4KIK A;  3GZN B;  3W1S C;  4NJC A;  2CU1 A;  4P16 A;  2WXN A;  3QHT A;  2KO3 A;  4XYC A;  1YN4 A;  2J42 A;  3BVG A;  2PJH A;  2Z0E B;  1AAR A;  2JUO A;  2M4N A;  4YL8 A;  4RGO S;  1WXM A;  3AEF B;  4MJS A;  2JVC A;  3APC A;  4K81 A;  4II3 B;  4BKT A;  3ZLZ A;  1FXT B;  2IGG A;  2FE8 A;  5BMH A;  1TJE A;  3PPA A;  2HJ8 A;  2KDB A;  1Q0W B;  3TCA A;  1RFK A;  4EZL A;  2LFI A;  5BMG A;  2D3C A;  4YSY B;  2L0T A;  1XLQ A;  3L54 A;  3X23 A;  1XLO A;  2XK5 B;  1WZ0 A;  2ACZ B;  2CJN A;  4ANV A;  5IKC M;  2GBN A;  3RFZ B;  2KTF A;  4BFR A;  1DOY A;  1C4A A;  4ZYN A;  4WQO B;  3V62 A;  1NBF C;  2WDV B;  4AUQ C;  2JX5 A;  2TSS A;  3B2F A;  2WX0 A;  1C4P A;  1V80 A;  3DHI C;  3KVF B;  4FUL A;  3EHV A;  1VRA B;  2K6Q A;  2QIE B;  4RM9 A;  2KWV B;  2V4I B;  1OQR A;  1WYW B;  1C78 A;  2JRI B;  3M95 A;  5JXV A;  3A1Q A;  3GOE A;  2V0G A;  1LQB A;  2AQ3 B;  1V5T A;  4DXG A;  5C23 A;  1C76 A;  4F7Z A;  3T3O A;  2NMQ A;  2KDE B;  2MP2 B;  3AE7 B;  1L4D B;  3N3K B;  3T9L A;  2WXP A;  3VFK A;  4WWN A;  5EDS A;  3QK0 A;  1X1M A;  2KX3 A;  4B0M A;  4KSK C;  1WGY A;  1DOX A;  1XEE A;  1OTR B;  3NS1 A;  1FCL A;  3ECI A;  3ZW3 A;  3V6C B;  2NBW B;  3RI7 C;  3GS2 A;  1JWM D;  4XZ4 A;  3R3M A;  2MQJ A;  2SEB D;  1T0Y A;  1WM3 A;  3PV1 A;  1P7F A;  1E8Z A;  5TR5 A;  3B08 A;  4YTN B;  2N1W A;  1KFY B;  4I6L B;  3VUX A;  2KWC A;  3N32 A;  2J53 A;  2FAZ A;  2MLB A;  3J9C A;  4ZYS A;  1TZ1 A;  1ZP0 B;  2N7E A;  2LVP A;  4ZHP A;  1FNU A;  2MH7 A;  3DPD A;  3PZ7 A;  4KV2 A;  2LRU A;  1ISN A;  3BVM A;  3C8Y A;  4PS3 A;  4KGR A;  2M19 A;  1MVK A;  2KDI A;  4KIK B;  2KMA A;  3PZ8 A;  4WAA A;  2DBY A;  2M1M A;  2LEK A;  5E6P A;  3B1L X;  2Z0D B;  4G3X B;  4HPL B;  2ZCB A;  2KN5 A;  2KNB A;  3Q3O C;  1VZ8 A;  3V61 A;  1J7B A;  2KQS A;  2KDF B;  1MHH E;  3VDZ A;  5AEK B;  1F2R I;  3ZJV A;  1ZGU B;  1ZKH A;  2KAJ A;  4JIO U;  2IO1 B;  2K0P A;  5H92 C;  1N6Z A;  1K52 A;  4RM8 A;  3AE5 B;  3RNG C;  4MJS B;  1TZO A;  1OQY A;  2KZR A;  2M0A A;  1WJ4 A;  1QF6 A;  2ZJD A;  1AN8 A;  3JVZ X;  4L2Y A;  4LJO B;  3IAM 1;  5EE9 A;  2OOB B;  1HTO A;  3WAO A;  4OZA A;  4IM2 A;  1KRH A;  3OLM D;  4USA A;  1WXQ A;  4EFO A;  3A9J B;  1QZE A;  3AH7 A;  4ITK A;  2RPQ A;  1K51 A;  2G9H D;  4BZA A;  2HDE A;  4C4V A;  2PVG C;  1CK1 A;  4E74 A;  3ZGZ A;  2CS4 A;  3JW0 X;  1R4N I;  3L10 B;  4MGZ E;  2ZCC A;  2L05 A;  2CU3 A;  1Q10 A;  3PHW B;  4PT5 A;  2Z59 B;  3GP7 A;  3AEA B;  4N58 A;  4URK A;  1XCT L;  3AEE B;  3BIN A;  2R61 A;  5JHB A;  1AWD A;  3PO0 A;  1TKG A;  3ZYY X;  4B0E A;  4MDK E;  1V86 A;  2J0J A;  1E8W A;  4GOC A;  3AXC A;  3EA6 A;  1MG4 A;  1U4A A;  4XGA B;  3L08 A;  2BVC A;  5BO4 B;  2W3S A;  1XD3 B;  2GMI C;  3Q69 A;  1CMX B;  2L8J A;  3A1Q B;  3UIN B;  1L7Y A;  1T5X D;  1PQS A;  3DVG X;  4PS7 A;  4XDC A;  2L3Z A;  4KDL B;  2XN9 C;  3HVD A;  2BF8 B;  5DPT A;  3VXW A;  3AU5 A;  3QIJ A;  1UF0 A;  3U7D A;  1L0Y B;  4IM3 A;  2LAS A;  1WMH A;  2L1A A;  1C4C A;  3RT3 B;  3RUL A;  4FBJ B;  4G0N B;  1WGR A;  1SJE D;  2D3G A;  2CHZ A;  1YQB A;  1A70 A;  1K8R B;  2IY0 B;  3BK2 A;  3RZF A;  2JU6 X;  1PUT A;  2KFK A;  2HE7 A;  2WQY B;  2M17 A;  3P42 A;  4E3C A;  2OHF A;  4NZL B;  1YX6 B;  2H89 B;  1NI3 A;  1UWX A;  1MG8 A;  4S0R A;  1OEY J;  3PLU A;  4ZRJ A;  1TS2 A;  1ZPS A;  2LXA A;  2LGX A;  2MSE D;  1WM2 A;  1WJU A;  2BBC A;  2DWQ A;  1LM8 B;  2FCQ A;  1ZXH A;  3W2D A;  3RNA C;  3MC9 A;  5IP4 D;  4DWF A;  3WIM A;  1Y8R C;  4NAW A;  1KM7 A;  2WP9 B;  3IHP C;  4RF0 A;  4K1R B;  1OFF A;  3MTN B;  1DGJ A;  3FC4 A;  2FCS A;  4DQO C;  1VZ7 A;  2NTT A;  4JGH B;  3ZQ4 A;  3IBE A;  2EKI A;  3MJ5 A;  2LWP A;  5CHV C;  2MJD A;  3DBH B;  5JZE B;  4LJP B;  4B95 A;  1JWB D;  2M8S A;  1GAQ B;  1T0R C;  1WX7 A;  1YD8 U;  1WJN A;  3QQ8 B;  2L00 B;  3RPF C;  3BZD B;  2W9N A;  2DNF A;  3ZTD A;  3RNB C;  1CJE A;  2BTE A;  2LGD A;  3PGE A;  4FJZ A;  4WIP A;  2LUM A;  3ZXR A;  1UH6 A;  2BS3 B;  1JAL A;  3T3N A;  1XCQ L;  5DPW A;  2NCN A;  3UIP B;  1JQ4 A;  2N9X A;  1UGJ A;  4RMA A;  4GIV A;  1PGX A;  5IAA C;  2UU7 A;  1OEY A;  2REX A;  5G5G A;  4OZB A;  2OJR A;  1T0Q C;  2X38 A;  1VZ6 A;  3R66 C;  4KSL C;  3UQB A;  2JZ3 B;  1EUV B;  1GB1 A;  1TIF A;  3TIX A;  2VH2 A;  4MEL A;  1N60 A;  2E6X A;  3IG3 A;  2I1K A;  3DVN U;  4LDT D;  2WXL A;  2R2O A;  3ZNI D;  4MGI E;  3N9Y C;  1EU4 A;  1BXT A;  4IWQ A;  4FA6 A;  2ONQ A;  1QOA A;  4PYU A;  3ML8 A;  1OGW A;  3APF A;  3KWL A;  5J18 A;  1LFD A;  4RFB A;  2BYT A;  4N6E B;  3PHX B;  3RNC C;  4GN1 A;  4MSQ B;  1WXV A;  4C7Z A;  3W5U B;  1WE7 A;  5AUK A;  4HDQ A;  1D4B A;  3K9O B;  1WJ6 A;  5EE0 A;  3OAW A;  1KLG D;  3AE9 B;  4W9D A;  1TY0 A;  4KKI A;  2NBV B;  4I6P A;  4KGS A;  1WMH B;  4L1B A;  4IW0 A;  3QJZ A;  3T8M A;  2VZK D;  1JW9 D;  2KFK B;  3AE6 B;  3N30 A;  5L95 C;  1KH0 A;  2O6V D;  2D3B A;  1TBE A;  4BKS A;  1VLB A;  3NVZ A;  1E7U A;  3MP9 A;  1KOT A;  2LZ6 A;  2WS3 B;  4HRO A;  3FAH A;  2JSV X;  1V49 A;  4A55 A;  3U52 E;  2D10 A;  3CF6 E;  4DHJ B;  4NJ7 A;  1XO3 A;  1R4M B;  2LGY A;  4YT0 B;  3UI3 A;  1TKY A;  3RYT A;  2WXI A;  4OHJ A;  1F2R C;  3A9K B;  2K5P A;  2XNA C;  3TL5 A;  2JT4 B;  4M00 A;  1YOV B;  4A8X C;  4NAW B;  5E6O A;  1RRB A;  1SJH D;  4LNN A;  1I4G A;  4XC2 A;  3I63 C;  3AED B;  4WJN A;  2KLC A;  2B3A A;  4NY0 A;  3P4R B;  1PGA A; 
#chains in the Genus database with same CATH homology
 2VZK B;  1C78 A;  4IDI A;  3TUO A;  5JXV A;  1D5M C;  3Q8B A;  1I4Q A;  2V0G A;  4RH6 A;  2AQ3 B;  4DXG A;  3ZJT A;  3ZJU A;  1C76 A;  4WWM A;  3T3O A;  1FFU A;  2NMQ A;  4WUR A;  1XXG A;  1MHX A;  3LYY A;  4YWG G;  3AE7 B;  1L4D B;  5MPO A;  2CJO A;  1GOZ A;  2KWD A;  2WXP A;  1JWU D;  1R7S A;  1YQ3 B;  4P6V F;  2PLP A;  4DXF A;  5I4D A;  1IGC A;  1UNS A;  3BWU D;  2K3U A;  1EM7 A;  1N5W A;  2IJ0 A;  3SFE B;  4B0M A;  1DOX A;  3AV8 A;  1XEE A;  3NS1 A;  1FCL A;  1E7P B;  1XLN A;  4GLS C;  3GS2 A;  3AN1 A;  2IDY A;  5GXG B;  1JWM D;  1ZOY B;  1D6E C;  1EWY C;  2SEB D;  1BML C;  3HRD D;  3U7Z A;  5D7G A;  2QMT A;  1WRI A;  1P7F A;  2KQ4 X;  3NUH B;  5H8Y E;  1QQR A;  1V1P B;  3WCQ A;  2N9K A;  4YXD B;  2QSD A;  2GRI A;  4ARI A;  4YTN B;  4OW0 A;  2BT6 A;  1VR9 A;  1I4X A;  1KFY B;  1FFV A;  4C7Y A;  3P1M A;  2NTS A;  1E9M A;  3AEB B;  2YEP B;  3AM9 A;  3TEX A;  2J53 A;  3J9C A;  4ZYS A;  1N5X A;  1ZP0 B;  2E3T A;  4ZHP A;  1FNU A;  2WXJ A;  1ZE3 D;  2D5G A;  2MH7 A;  4AQ7 A;  3PZ7 A;  4REZ A;  2IGH A;  1VJK A;  3W1S A;  1IBX A;  2PMV A;  1P7E A;  3BVM A;  1IUE A;  3C8Y A;  1C79 A;  4KGR A;  2M19 A;  1MVK A;  1TY2 A;  3PZ8 A;  1AW7 A;  2DBY A;  2ICI A;  2LEK A;  2W54 A;  1QT9 A;  4JWS C;  3BYT B;  3KQ4 A;  4C56 C;  1HEZ E;  1VZ8 A;  3Q8E A;  1J7B A;  2G1E A;  3R8B A;  1MHH E;  4M0W A;  2L52 A;  1F2R I;  3ZJV A;  1V8C A;  1LO5 D;  1V97 A;  2KAJ A;  3NVW A;  2LJI A;  2K0P A;  5H92 C;  3LB8 C;  2WXK A;  1K52 A;  3AE5 B;  2H88 B;  4L23 A;  2HTM E;  4NAM A;  1TZO A;  3E56 A;  3OWE B;  4MAC A;  2M0A A;  1QF6 A;  1KF6 B;  2FUG 1;  2DLB A;  1AN8 A;  4LLG M;  4L2Y A;  4TQ0 A;  1T3Q A;  3IAM 1;  1TS3 A;  1ROE A;  2WLB A;  5EE9 A;  2KDM A;  1QOG A;  4XWT A;  3W5V B;  2WXR A;  2W3R A;  1ET9 A;  4OZA A;  3ETR A;  3TEY A;  1KRH A;  2SAK A;  1SE3 A;  1D5Z C;  4YSZ B;  4USA A;  1WXQ A;  3H8H A;  1SBB B;  2WU2 B;  3AH7 A;  4ITK A;  4OVZ A;  3TEZ A;  1YNT E;  1SXT A;  1C77 A;  4US8 A;  1K51 A;  2G9H D;  2L32 A;  1KTK A;  2HDE A;  2WDQ B;  2PVG C;  1CK1 A;  5FKA C;  3ZGZ A;  1FIQ A;  4LK0 M;  1F0Z A;  2PVO D;  3IAS 1;  2CU3 A;  1TYG B;  3P63 A;  1Q10 A;  2AQ2 B;  4PT5 A;  5AUI A;  5FR3 A;  2IGD A;  2QEJ C;  3AEA B;  3GP7 A;  4N58 A;  1I4R A;  1XCT L;  2MEK A;  3AEE B;  2R61 A;  3KWV A;  5EE1 A;  3Q8C A;  3P4P B;  2KN4 A;  3NZ3 A;  1AWD A;  3AB5 A;  1FXI A;  1TKG A;  3PO0 A;  5HG2 A;  3ZYY X;  4B0E A;  3L4P A;  2V3N A;  2RPV A;  2Y3A A;  2I2Y A;  3VR9 B;  2BW2 A;  4RNA A;  2AX5 A;  2L83 A;  4OZC A;  1KLU D;  1C9F A;  1N62 A;  1GB4 A;  1FMA D;  1ET6 A;  2W55 A;  3EA6 A;  1IGD A;  2JYE A;  5HFY A;  4TSS A;  4O1N A;  2W3S A;  1L0V B;  2B76 B;  1UUP A;  3Q69 A;  1SF0 A;  2JQR B;  3SR6 A;  1ESF A;  2FBW B;  2WXH A;  3IT4 B;  4ZRP A;  1DOI A;  1WSP A;  5BMI A;  4US9 A;  3BVZ A;  1T5X D;  2ZW0 A;  2WDR B;  2ZW1 A;  1E0Z A;  1FNV A;  4CQN A;  2KMM A;  1NEK B;  3VR8 B;  4XDC A;  3O13 A;  1SSN A;  2XN9 C;  1J7A A;  5EE3 A;  5FK9 C;  3HVD A;  2WXF A;  2BB5 A;  2EEL A;  1WGK A;  4MH8 A;  3P4S B;  2I38 A;  4UDU C;  1L0Y B;  3AE4 B;  4ARC A;  2L1A A;  1C4C A;  3B2G A;  4IOI E;  1E6E B;  1SJE D;  2N0S B;  4N59 A;  1A70 A;  1QOB A;  3BK2 A;  1EU3 A;  4Q2J A;  3KLS X;  2JU6 X;  1D5X C;  3BII D;  1PUT A;  2LHD A;  4A9A A;  4JWU C;  1Y56 A;  2M56 B;  5G5H A;  3V3X A;  2INN E;  2WQY B;  3P42 A;  4YSX B;  2OHF A;  2Z8L A;  4NZL B;  4AS1 A;  2OED A;  2H89 B;  1ZDV A;  1PGB A;  1NI3 A;  1UWX A;  3FIL A;  1L5P A;  2Q5W D;  4YTM B;  2BS2 B;  1YQ4 B;  1UWM A;  1JRO A;  3EGR A;  2JWU A;  1TS2 A;  1ZPS A;  1ACC A;  2RDH A;  3MHZ A;  1B1Z A;  3GB1 A;  2Y5P A;  3NVV A;  4ZOH C;  3CIR B;  1SEB D;  2BBC A;  2DWQ A;  2PKO A;  3AE2 B;  3IT6 B;  1NYR A;  2AQ1 B;  1HQR D;  4RGT A;  1FXA A;  1IBX B;  2LGI A;  1XLP A;  1ZXH A;  2DYO A;  3HVZ A;  3W2D A;  4KGT A;  3P4Q B;  2W82 A;  5E6J A;  2PW9 A;  4KX6 B;  3SFD B;  2LMC A;  2N7J A;  2MJE A;  2WNM A;  2N9L A;  3E9S A;  1YJI A;  4MM3 B;  1MI0 A;  2WP9 B;  2YEP F;  4RF0 A;  1L6U A;  1K50 A;  4A6Q A;  2K9X A;  3I57 A;  4JX1 C;  1OFF A;  2Y5C A;  3U4E G;  1JRP A;  1DGJ A;  4RCO A;  3FC4 A;  1FCC C;  1VZ7 A;  4DQO C;  3TEW A;  2RMM A;  1FM0 D;  5BYS A;  1B9R A;  1ZXI A;  2NTT A;  3HUI A;  4J3O D;  1JCK B;  5LNK 1;  3ZQ4 A;  1CQV A;  3NVY A;  5HHD G;  4EE2 A;  4XE0 A;  1FRD A;  2EKI A;  3MJ5 A;  1YN5 A;  3IXS A;  2MJD A;  5TSS A;  4HJG E;  3VRB B;  3AEG B;  4ZRQ A;  1JWB D;  1DYQ A;  4C80 A;  1GAQ B;  2WXQ A;  4HKZ E;  4HKQ A;  4ZHO A;  1N63 A;  5BYR A;  3MC0 B;  1L0X B;  3RPF C;  1V1O A;  3BZD B;  2GI9 A;  1YMH E;  1STE A;  4FXC A;  1CJE A;  2INP E;  2BTE A;  1FRR A;  1EWC A;  1ZUD 2;  3AEC B;  4WIP A;  2LUM A;  3SEB A;  2J52 A;  5C2T B;  2MJ3 A;  4JE3 B;  2JYT A;  1J7C A;  2BS3 B;  1JAL A;  1TS4 A;  3T3N A;  1XCQ L;  2KAC A;  1V1P A;  5D3D A;  4D2K A;  1WYG A;  1JQ4 A;  2V3P A;  3DWM A;  1AYF A;  4XDD A;  1OQQ A;  1UGJ A;  4RGM A;  1SE2 A;  1I4H A;  1PGX A;  2K22 A;  4R3D A;  1XF5 L;  4MT5 A;  1HXY D;  4GDL B;  3W9C B;  5G5G A;  4TQ1 A;  1E10 A;  1TS5 A;  1L4Z B;  4OZB A;  4IKG A;  1SIJ A;  1ZDX A;  2PTL A;  2X38 A;  1VZ6 A;  2JZP A;  1SB3 C;  1GPX A;  2QJL A;  1CZP A;  1GB1 A;  1JML A;  1ENF A;  4GDK B;  1YN3 A;  1VDV A;  1N60 A;  1JWS D;  1QKZ A;  2E6X A;  3LXF A;  2WU5 B;  4RGN A;  1YJJ A;  1PFD A;  3I9V 1;  1HZ6 A;  1FD6 A;  2WXL A;  1I4P A;  5HI1 A;  3N9Y C;  4TMA B;  4NJC A;  3R2T A;  1EU4 A;  1WWT A;  1T6B X;  1BXT A;  4A90 A;  1M4V A;  4P16 A;  3MFG A;  2WXN A;  2ONQ A;  2WXM A;  4WH4 A;  1QOA A;  2JXT A;  3V05 A;  5BYQ A;  1YN4 A;  2RDG A;  2J42 A;  1F77 A;  3BVG A;  3KWL A;  1RM6 C;  3B9J A;  2ON8 A;  2GB1 A;  1RWS A;  4RFB A;  1PDX A;  4N6E B;  2BYT A;  3R2I A;  4RF1 A;  4RGO S;  3DWG C;  4C7Z A;  1QOF A;  3W5U B;  3AEF B;  5AUK A;  3CWI A;  1MPE A;  5D3I B;  1D4B A;  1PYW D;  5EE0 A;  1RYJ A;  1KLG D;  2IGG A;  2FE8 A;  3AE9 B;  5BMH A;  1TY0 A;  2J4X A;  1TJE A;  3AE3 B;  4LTU A;  4KKI A;  1BUI C;  1FO4 A;  2BB6 A;  1N61 A;  1HZ5 A;  4KGS A;  4L1B A;  2QIL A;  1RFK A;  3NRZ A;  3AE1 B;  3Q8A A;  2LFI A;  2IPK D;  2VZK D;  3ABV B;  3BYY B;  3AMZ A;  4HRS A;  5BMG A;  3VQI A;  4YSY B;  1L6V A;  1JW9 D;  1XLQ A;  3AE6 B;  1SE4 A;  1K53 A;  1NYQ A;  1QLB B;  1XLO A;  5C3J B;  1I7H A;  1KH0 A;  2ACZ B;  3VRA B;  1VLB A;  2CJN A;  1JWA D;  3NVZ A;  1QIL A;  3FIL B;  4WQM A;  3MP9 A;  4XWW A;  3RFZ B;  1DOY A;  2WS3 B;  4H2A A;  4HRO A;  2LHE A;  3FAH A;  2BS4 B;  2JSV X;  3URY A;  4WAF A;  1C4A A;  4A55 A;  4HEA 1;  5T8I A;  3U52 E;  2WXO A;  2WXG A;  2WDV B;  1FEH A;  2JX5 A;  1XO3 A;  4YT0 B;  3UI3 A;  1TKY A;  4JPS A;  2WXI A;  4OHJ A;  1F2R C;  1NEN B;  3TSS A;  4YTP B;  2K5P A;  2TSS A;  2XNA C;  3AE8 B;  3B2F A;  1C4P A;  3BK1 A;  2DYM A;  1FNW A;  4A8X C;  3Q8F A;  1NVI D;  4NAW B;  1VRA B;  1SJH D;  4KKJ A;  1HA5 A;  1I4G A;  3AED B;  2QIE B;  3EUB 2;  3U2S C;  2PIA A;  1TKE A;  2V4I B;  3P4R B;  1PGA A;  1OQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...