5HI1A

Backbone modifications in the protein gb1 helix: aib24, beta-3-lys28, beta-3-lys31, aib35
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Comparison of design strategies for alpha-helix backbone modification in a protein tertiary fold.
pubmed doi rcsb
molecule tags De novo protein
total genus 11
structure length 52
sequence length 56
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5hi1A00
5HG2A 2IGGA 2J53A 5BMHA 4MACA 1P7EA 5HI1A 1D4BA 2RMMA 1IBXB 2KWDA 2JXTA 1UWXA 1YNTE 1K50A 2EELA 1PGBA 1PGAA 1ZXHA 4KGSA 2PTLA 2LHDA 2N9KA 4KGTA 2J52A 1MI0A 2OEDA 5HFYA 2QMTA 3FILA 1IGCA 1HZ5A 2LGIA 1C9FA 1MVKA 1MHHE 2RPVA 4OZCA 1XCQL 2JWUA 2I2YA 2JSVX 1P7FA 1XF5L 4KGRA 1FCCC 3GB1A 2KDMA 3MP9A 3V3XA 4OZAA 4IKGA 2GB1A 2LUMA 1FCLA 2NMQA 3FILB 1QKZA 5BMIA 1KH0A 2N9LA 1HEZE 2GI9A 2K0PA 4IOIE 5JXVA 1PGXA 4HKZE 1K52A 1IBXA 2KN4A 1XCTL 2IGDA 2ON8A 2ONQA 1Q10A 2IGHA 2ZW1A 1IGDA 4WH4A 1GB4A 3UI3A 2PW9A 1K53A 2KACA 2KQ4X 1YMHE 1F2RI 2JU6X 1K51A 1MHXA 4HJGE 4GLSC 4OZBA 2I38A 2QSDA 2PLPA 2LHEA 2JZPA 5HHDG 1GB1A 1JMLA 1FD6A 1F2RC 5BMGA 1MPEA 1HZ6A 2N7JA 2ZW0A 1EM7A 4D2KA
chains in the Genus database with same CATH superfamily
1F1HA 2KKCA 4RM8A 2L1AA 1VZ8A 1NVID 1PDXA 3HUIA 4TUUA 2IY0B 3APCA 3HVDA 1YNTE 4FJVB 3DVNV 5KHQA 2ACZB 1FNVA 3N32A 3VTVA 4PYUA 3DQVA 2WU2B 2MBQA 1HA5A 2KT7A 4JGHB 1ESFA 3W5VB 3DBSA 3ZLZA 2LZ6A 1MG8A 2J0MA 4HKQA 1WX7A 2DENB 5AZFA 2WXJA 3BY4B 4OVVA 3VVWB 4JWSC 4NPNA 2FCMA 1TJEA 2W55A 3RCZA 3VR9B 1N5WA 1SBBB 3Q8AA 4BVUC 5IO9A 4I6LB 3ZO5B 1XLNA 2V4LA 1D6EC 4WWOA 2FCQA 2K8BA 4K7SA 2Z0EB 3EFCA 1M94A 2DAFA 3P42A 3ZRFA 3DVGX 4A3PA 5IKCM 3GP7A 5G2NA 1TBEA 4WJPA 2CJNA 1GUAB 2KFJA 3LB8C 5DPSA 3ENEA 3Q3FA 3ZW3A 5BMGA 3R8BA 3ZYYX 1I4XA 3AEBB 3H7SA 2NCNA 3VUXA 4EOYA 2AWTA 1YN5A 3CSFA 2LGXA 1TZOA 4WJNA 3M62B 2FE8A 3BYTB 2V4IB 4L2YA 1E8XA 2UU7A 1UELA 4RFBA 1N61A 4HDOA 4ZHPA 5JHBA 1UUPA 2CHZA 5DPRA 4TSSA 4W9CA 2PE6B 1E8YA 2PIAA 1D3ZA 4FADA 1YN3A 1AYFA 1GAQB 3NVYA 1BMLC 1WMHA 3SR6A 4N59A 5AZHA 1KTKA 3M95A 1C9FA 4FXCA 2KJHB 4RNAA 4WQOB 3TSSA 1LFDA 4RF0A 5D6JB 2BGFA 5G55A 1WX8A 2MSED 3VQIA 3DBRB 2QILA 3GB1A 3RNGC 3AEFB 2MQJA 1WRIA 1NI3A 1WM3A 2D11A 2HJ1A 5BO4B 2L0FA 3UGBB 2GBNA 2AEHA 2BYEA 3ZNID 4NAWA 3QWZB 2WXNA 2BB5A 2BT6A 2XK5B 4ASWC 1IUEA 1P0RA 1XCTL 1J7CA 3GZNI 2JYEA 1SXTA 3V61A 3EECA 4EKUA 1TS3A 4TV3A 5D94A 4IW0A 1YQBA 2BKRB 2G45B 2ZCCA 4EZKA 4HJGE 2UWQA 3Q8CA 3Q8FA 5DPTA 4Q2JA 4W9FA 3ZJVA 4P16A 3R7QA 4II2B 3U4EG 2C9WB 2GLSA 1RFAA 4FN2A 4D2KA 2KXJA 3MC8A 2KWUB 1TKEA 3Q3NC 3U52E 4GSWA 4KSLC 3ZQ4A 3NZSA 4MJSB 4WURA 3PSEB 1TYGB 2AYOB 4S17A 3BVZA 2FUG1 2INCC 1S1QB 1RYJA 4DK5A 3Q69A 1SE3A 1AARA 1VZ6A 3GS2A 5E6JA 2KTFA 2V3PA 1FNWA 2X8XX 4MT5A 5DPWA 4P1BC 1B1ZA 2RPVA 1C4CA 1JRUA 1SEBD 2DNFA 1WGDA 3BWUD 1V86A 2ZNVC 1KJTA 3RN9C 1F52A 2K8CA 4DWFA 3FILB 1C3TA 3TEXA 3UIPB 1QKZA 5H8YE 4MGZE 4XGAB 1V1PA 4B6WA 2R2QA 4MH8A 4GDLB 1PGXA 3PZ7A 4I6NB 3DHIC 2WXKA 2WXQA 3NUHB 4NQKE 2BKFA 2PKOA 2ZPNA 2FIFA 1VD2A 2BVCA 4R3DA 1J0GA 3PLUA 2ZW1A 4K1RB 4W9KA 1OTRB 5AUIA 4F7ZA 2PW9A 1N6ZA 3QHTA 1K8RB 5BYQA 3UINB 4USAA 2BF8B 2MJEA 4DDID 4MEMA 2JZPA 1JMLA 5D3DA 2PVGC 2DLBA 3V60A 5CTRC 3AEEB 1WX9A 3W1SA 3NRZA 3V6CB 2V3NA 4L1BA 3PS6A 2DYOA 1ZXIA 1OEYA 4KDIC 2X38A 4GB9A 5G5GA 3R66C 1SE9A 1LQBA 2OJWA 4MACA 1JCKB 3Q8BA 4M0WA 3H9DA 4W9DA 4XDDA 2KWDA 1FIQA 3P63A 2PTLA 1RM6C 4RMAA 2FBWB 3IG3A 4MDKE 4AP4C 3TL5A 2LD9A 1Q1OA 3AE2B 1C79A 2DZJA 3A33B 2PEAA 2LVQA 3B08A 2XN9C 3K9PB 4ZRJA 2WGSA 4B0EA 1SJHD 4UDUC 1AWDA 2LJ5A 3B0AA 2AQ3B 2JVCA 3V3XA 1FRDA 1P98A 2NMQA 2PPHA 4P1CC 3T3NA 4GN1A 2KDIA 5GMVA 4M00A 3PVLA 3N30A 1K52A 3L54A 3DBHB 4GOCA 3PO0A 2LI5A 2GBJA 5IN7A 3QCAA 2IPKD 3VR8B 3X23A 1DOYA 1YMHE 1F2RI 3W9CB 3K9OB 3W5UB 2WU5B 3FAHA 4EZJA 4GLSC 3MFGA 1ZP0B 4F1SA 2O6VB 1JWBD 3MHSD 1E10A 1XT9B 2JZ3B 3NHEB 1SJED 3HK0A 1E9MA 4II3B 1LM8B 3RZWC 3QIJA 5AZGA 5J2RA 3UQBA 2RSUA 2M4NA 1WXSA 4E74A 1FFVA 1ZPSA 1D4BA 3LYYA 2LUEA 1T0RC 2J42A 1JWMD 1N62A 3A4SC 2ZVNA 3NS8A 3TEYA 2KTRB 4MSMB 2MX2A 2RGFA 2SAKA 4HCNB 4ANVA 2LHDA 4NAMA 2M0XA 1OGWA 4M8NA 2N9EB 2NS5A 1T6BX 2VH1A 3VAWA 4B9KA 3QX1A 3N1ZC 2LGIA 1E90A 3JVZX 3TUOA 1BUIC 4NY0A 4RGMA 1BXTA 1WFYA 2GMIC 3N1XC 3PZDA 4JL9A 5LXIB 3W2DA 5JH5C 3U8ZA 1WZ3A 5TSSA 2KMMA 1GJZA 1TTNA 1Y8RC 4WAFA 2O6VD 2N7DA 3T3OA 4IOIE 2BWFA 2HJ8A 3L08A 2KHWB 1IBXA 4HK2A 3MC9A 3H1UA 2JPHA 3DWMA 1ACCA 1I4RA 3ZTCA 3KW5B 2FIDA 3U30A 3RNEC 2FUHB 1NYRA 2L0TA 5L95C 2FAZA 1YJIA 4C80A 2BYTA 5J17A 2LGDA 1MHXA 2INNE 2AL6A 3N20C 2ZZPB 2KC2A 4GGQA 4WAAA 4KV2A 3AU5A 2EKEC 3MJWA 1RLFA 3H6NA 1PQSA 1IYFA 3DBLB 2MW5A 1XO3A 1RWSA 1CJEA 4M01A 2XBBC 2MBBB 2JXXA 4DHZE 2L83A 1GOZA 1XXGA 3RD2A 1LXDA 1JQ4A 1FXIA 3WAPA 1VJKA 2L52A 5KHOA 3U2SC 4G3XB 2BPSA 2LRUA 2N9KA 4DXAB 1HQRD 2YEPF 2ZNVB 2Y5CA 3UIOB 4C7YA 4WJQA 3QJZA 2D3CA 1L5PA 2MWSB 1HZ5A 2C7MB 4IUMB 1UH6A 3ML9A 4AJYB 1C4AA 1JWAD 3PHXB 2LRWA 3O13A 2BB6A 1H4RA 4YL8A 3OJ4B 4LDTB 2BWES 2MRPA 3RFZB 2JWZA 1YX6B 2JSVX 1T0YA 4W9HA 2TSSA 5FR3A 2D3BA 2Q5WD 1F0ZA 4AWJA 4KZ0A 5AUKA 1B9RA 1MJDA 2LVPA 1WMHB 3H8HA 4OVZA 2MBEA 4C00A 3R2IA 1FXTB 1RAXA 3DOWA 1WWTA 3A1QA 1AW7A 2OJRA 2N9XA 2KWCA 3AE5B 1NBFC 3DBLI 2M17A 2CU1A 1K53A 5IAAC 1I35A 2GBRA 4NAWB 2WDQB 3MC0B 3OG5A 3I57A 2GOWA 3S2AA 2B3AA 2RDBC 3AU4A 2RDHA 3Q8EA 5FKAC 2AQ2B 2BQQA 2Y5BB 3JSVA 3RMKC 1Y56A 4O1NA 4TKNA 3T9LA 2LEKA 4ZYNA 3KUDB 4NZLB 1S3SG 1EM7A 3AI5A 2BW2A 2J4XA 2VRRB 4LDTD 5BMHA 4NNJB 2K3UA 3AV8A 3C19A 1QOAA 2D07B 2NBVB 2B76B 1UF0A 1YQ3B 1UWXA 4P7IA 1ZXHA 2WLBA 4HPLB 4BBNC 1J8CA 1IPGA 4HCPB 3TEWA 4TMAB 1EWYC 3HM6X 3SD5A 2M8SA 2MJ3A 4P6VF 1AN8A 1KLGD 1CZPA 4DBGA 5GXGB 2IO0B 2KMCA 1WYGA 2C60A 4TQ1A 2MLBA 2KVRA 1DYQA 2H89B 1QQRA 4CQNA 5JHAA 3JW0X 3P4PB 1C4PA 2LUMA 2KMAA 3SHQA 3L17A 5FK9C 1J7BA 2C7NB 2LXAA 1NI2A 4HEA1 4TQ0A 1GNUA 4DHZB 3KH0A 1WRDB 3P1MA 2ZVOA 1WJ4A 4OHJA 4C4VA 4FULA 2LJIA 2JT4B 1GB4A 3GOEA 4C56C 1JROA 3KWLA 5HKHA 4HPMB 2AL3A 4A8XC 4XDCA 1L6UA 1FRRA 4IC7B 2D3GA 1H8CA 2WXPA 1WH3A 3PREA 3ZDMC 1KM7A 2WXRA 4QAYA 3RYTA 2KX3A 4YTPB 2NBWB 1I7HA 3VH3B 1R4NB 3DHGC 3FC4A 2JY6A 2KN5A 4KZCA 4NJ6A 1U4AA 1LO5D 1WSPA 4H2AA 3VTWA 3KLSX 4JQWC 1KOTA 1WXMA 2W54A 2KDBA 4FJZA 2G9HD 4KIKB 3OJ3A 1VZ7A 3KUCB 1TY0A 5JZEB 1WI0A 2QJLA 2KJRA 4CO7A 4LLGM 3N3KB 2WDTB 1ZOYB 3L16A 1E5WA 2JQRB 2JUOA 5E6OA 1TS4A 2AX5A 4KGTA 1V80A 2QMTA 1FMAD 3AE4B 3IT6B 4B0MA 3I63C 1R7SA 4K7UA 3H7PA 4LNKA 3DCGA 2CKHB 3ETRA 1NENB 2I2YA 3IAM1 1WYWB 3APFA 2OHFA 4DXFA 5EE1A 3DBRI 1DOIA 1GPXA 5T8IA 4REZA 1UGMA 2KDEB 4K7WA 4ICVA 4MGKE 2GI9A 3ZIMA 2NTSA 4ZHOA 4ZRQA 2K25A 3I3TB 2HTHA 2ON8A 3CF6E 3P4QB 1V8CA 2C7HA 2NR2A 4GXBA 2HE7A 4RH6A 3WAMA 2DX5B 3MHZA 4URKA 3M63B 1K51A 3AN1A 4BZAA 3EUB2 3E56A 2DAJA 1ZW7A 1X1MA 3ML8A 4N9F4 2ZJDA 2QC8A 2WXIA 1PUTA 3TBLD 5H92C 2PLPA 3A4RA 3AEAB 3LJ3A 2W3RA 2N7EA 1ZKHA 4JWUC 3PHWB 2N7JA 4IDIA 3P4SB 4PS3A 1FXAA 3BYYB 4OVUA 3AMZA 2IGGA 2MP2A 2J53A 3Q3JA 1L6VA 4A3OA 2KYWA 3IXSA 2XK5A 2KDFB 3RULA 2LXCA 3AE6B 2K8HA 2NPTB 1QZEA 2JXTA 2WS3B 1RFKA 4XX5A 3NG0A 4HWIB 3ECIA 4LTUA 2J52A 2MHJA 2UYZB 5C23A 3PV1A 2MBHA 3D32A 3SU8X 1TS2A 4RCOA 1QF6A 4HVBA 1WGKA 3HRDD 4OZCA 1V49A 5CX3A 3Q3MC 1JW9D 3NZ3A 1T5XD 3L0WB 2V1YA 2IJ0A 2KLCA 1XF5L 4ARIA 3M3JA 1FCLA 5IOIA 1YOVB 3HIZA 3B2GA 3AEDB 1EU3A 2O2VB 3WALA 3N1YC 2YLMA 4BKSA 3WANA 3WCQA 4MM3B 3ZGZA 4LNIA 3IHPC 2REXA 2AQ1B 1WR6E 2KOXA 1V9JA 2WXGA 5C3JB 3UI3A 2A4ZA 3IT4B 2CJOA 3L13A 3A9JB 3AE3B 2G3QB 5LLIA 2K1FA 1L4DB 1GB1A 3APDA 4YT0B 3BK1A 1CQVA 1R4MB 2QIEB 1EF1A 1JALA 2INDC 1T3QA 4LNFA 3NVZA 4W9LA 4A55A 4ANXA 5EE0A 1GC7A 2LVOA 3R2TA 4A90A 2CR5A 1JWSD 2RMMA 4KX6B 4JPSA 1QOFA 2MA9B 4I6PA 2J0JA 2WXMA 4RGOS 3PLVA 1WGHA 1TZ1A 4CHKA 1SIJA 2WDVB 2ZPYA 2QHOA 2NTTA 4ZOHC 2V0GA 2L00B 1HTQA 1N60A 2JRHA 3SFEB 1HTOA 3DHHC 3NY5A 4M8MA 1GG3A 1MVKA 1WXQA 4N58A 4GDKB 4MGIE 5EE9A 4YXDB 1IP9A 2GBMA 3CMMB 1P7FA 3AECB 4AJWA 3J9CA 4ZYSA 2XEWA 4AUQC 2RPQA 1V97A 4WIPA 1ISNA 1FNUA 1V5OA 1D5ZC 5JXVA 3DVNU 2K22A 2BTEA 4JLCA 2N9PC 1VR9A 3W1SC 2M19A 3DBHI 4RGNA 4PK1A 2WHIA 5CHVC 4XE0A 4MSQB 1R4MI 2KQ4X 2JYTA 4YSXB 1E7VA 3R7RA 2IZVB 3DWGC 2OOBB 2QSDA 3RUIB 2KQ7A 5HHDG 1L2NA 1OQRA 5LNK1 1WF9A 4EUTA 2WNMA 4S0RA 2EKIA 3AE7B 3I5JC 4B95A 1MG4A 5HG2A 3VUWA 2JF5A 1Z5SB 3DPDA 4BBNF 2JRIB 4HLEA 3VXWA 1OEYJ 2WXOA 3BZDB 1QT9A 1E6EB 4YSYB 4AQ7A 2OEDA 1A70A 3GE3C 2K6DB 1IGCA 4ZRPA 2V3SA 4ITKA 2N4FA 4IM0A 2DWQA 1F9JA 1TKYA 1QOGA 1LGRA 1RRBA 2KX0A 2PMVA 2IO2B 3Q3OC 1C76A 2DZKA 4ZRIA 4JX1C 3WIMA 1CK1A 1OFFA 2KFKA 2WYQA 4XWWA 1OQYA 2J7QB 2L05A 2E3TA 1TIFA 4EZLA 4HXDA 4XYCA 2D3AA 2M0AA 3O65B 2ZCBA 3OLMD 5D2MB 2CU3A 2KTRA 4HDQA 1TGZB 3AULA 1QLBB 3KVFB 1SSNA 2W82A 2N1VA 3PZ8A 1VRAB 4IM2A 3I9V1 4EFOA 3QA8A 5CHFA 1E8ZA 2L32A 3ZVVA 1L0XB 4C7ZA 4OZBA 1WJ6A 4ZDVA 2LHEA 4C4VB 4BFRA 1ET9A 1F2RC 3RNCC 3QAQA 2MBOA 2MCNB 4NJCA 2D2QA 2L3ZA 3QARA 4FHJA 3A9KA 1V2YA 1N63A 2LFIA 2ZW0A 2N0SB 2KAJA 1CMXB 1WXAA 2KK8A 1FPYA 1OQQA 1YJ1A 3EHVA 4KKJA 3ONSA 2D5GA 1YJJA 2Z59B 2KWVB 1ET6A 2WDRB 4DXGA 1D5MC 2IO3B 1VLBA 4G0NB 2I1KA 4W9JA 4YTNB 1WGRA 4US9A 2JX5A 2KLGA 2WX0A 2K9XA 2W9NA 3T8MA 3VUYA 3C0RB 3ZUNA 2WXLA 4ICUA 4A9AA 1EUVB 2MEKA 4G11A 1N5XA 4HROA 2RD0A 3E9SA 3ZNHB 3SEBA 4XZ4A 3TIXA 4JIOU 3BK2A 2KNBA 2GBKA 2KDMA 2W3SA 4OZAA 1SE2A 3KYDD 4IWPA 4YWGG 3SFDB 3Q6BA 4HJKA 3OAWA 4FBJB 3R3MA 3H7PB 3PRPB 1WJUA 4OW0A 3TJPA 2WX1A 3GZNB 4K3CA 2IGDA 3WA0A 3ZJTA 2ONQA 2QCZA 5C2TB 2HD5B 2WQYB 3RPFC 1TKGA 1I4PA 2HDEA 3WAOA 3IAS1 3VRAB 2K39A 1TY2A 1ZE3D 3OWEB 3AE8B 4IM3A 5IP4D 1YD8U 3PRMB 3RNAC 4A6QA 3VDZA 3EC8A 3NVWA 1WE6A 1HXYD 3GE8C 1UZXB 3ZDTA 4XWTA 3CSTA 3RI7C 2IDYA 2BYVE 1J7AA 3B1LX 4ZRKA 1I4HA 5BYSA 3PPAA 1V1PB 2FCNA 2HTME 1YN4A 1V6EA 2LGSA 4KVGB 3AEGB 2FCSA 2LWPA 4HPPA 1PGAA 1NDDA 2CHXA 5L83A 1E7UA 2DBYA 5C1ZA 2MP2B 2JZZA 2PJHA 1NEKB 2IO1B 3BVMA 3L4PA 3NJTA 4KSKC 2CHWA 1WGGA 4FA6A 3SDLC 1WZ0A 2VZKB 2JWUA 1L0YB 2D10A 3VHTC 1C1YB 4JE3B 3IFWB 3HVZA 4PYZA 3ZTDA 4NJ7A 1KH0A 1HE8A 1L4ZB 2N9LA 3KUZA 2V9HA 4GMVA 2K0PA 5D3IB 4HKZE 1ZUD2 2KANA 1UD7A 2DZIA 4M0WB 1UWMA 2FNJB 2KJ6A 3P4RB 4MELA 1WE7A 4RGTA 4RF1A 3QK0A 4WJOA 3ZXRA 2VH2A 1E7PB 4W9IA 5MPOA 3B9JA 3QQ8B 4CYEA 2IY1B 3HHMA 1FD6A 2QEJC 4J6IA 5FR6A 3NS1A 1MPEA 1HZ6A 2NBUA 2LGYA 1I4QA 4BAXA 4LK0M 1R4NI 2Y3AA 5TR5A 1WGYA 2H88B 5E6NA 4E71A 5DCNA 1KFYB 2K6QA 1UNSA 1ROEA 2VZKD 4FHKA 4HRSA 4J3OD 2E6XA 1FFUA 3AE1B 2MJDA 2CS4A 1A5RA 2G1EA 4KKIA 1ZDVA 1SF0A 4KGSA 2WXHA 1D5XC 2BBCA 2EMSA 4ACFA 1I42A 2M56B 3QC8B 3JYUA 4MGYE 5EDSA 1MFWA 3TMPB 3PTFC 2BS4B 4WWMA 4XC2A 1VDVA 1EWCA 1XCQL 1T0QC 2ZEQA 1XQQA 3NVVA 3KYCD 2XNAC 3NZUA 2R61A 3VRBB 4NQLB 1JRPA 3AB5A 2GB1A 4BKSD 1XLQA 3ABVB 3AM9A 3V62A 5BMIA 1NYQA 1WM2A 1HEZE 3PT2B 3BIID 3RNBC 4KIKA 1F77A 5D7GA 5AEKB 1C77A 1XLPA 2C5LC 1Q10A 2RR9A 2DYBA 2Z8LA 2IGHA 1Q5WB 1DGJA 4ANWA 1IGDA 1XLOA 3NOBA 3BINA 2KACA 3DDCB 2WP9B 3LDZE 1WXVA 1G6JA 5E6PA 3KWVA 1ENFA 1QOBA 3UQAA 4ARCA 3VFKA 1V1OA 4N6EB 5EE3A 4PS8A 2I38A 2MH7A 1PYWD 4MJSA 3RZFA 2J0KA 3P2BA 1E8WA 4M02A 1I4GA 3ZRCA 4DQOC 1KLVA 3CWIA 2PVOD 4GIVA 3ZXVA 1P7EA 1Z2MA 5HI1A 1IBXB 2L7RA 3W1YA 2KQSA 2WWZA 3V05A 4PT5A 3TCAA 1K50A 2EELA 1PGBA 4AS1A 4WWNA 1STEA 4WQMA 2QDFA 1XEEA 5HFYA 2YVCA 4YSZB 3FILA 5G5HA 1XD3B 1WY8A 3EGRA 4GDLA 4BOSC 2BS2B 4GU2A 5CHWA 1QILA 4IG7B 2Z0DB 1EF5A 2LMCA 2EMTA 4K3BA 1FCCC 1V5TA 3MP9A 3U7DA 2PE9A 3DVGY 1YIWA 3TEZA 2L8JA 2KZRA 4A20A 4E3CA 4W9EA 4EEWA 4W9GA 2INPE 1YQ4B 1L7YA 3ALBA 3MJ5A 2K5PA 2NPTA 4LJOB 1WIAA 1TT5B 2A5UA 2DHZA 1BT0A 4F8CB 3Q14C 4LNNA 4WH4A 2KO3A 2BYFA 1UGJA 3HM3A 2KFKB 2ASQA 1WR1A 3MTNB 4DHJB 2M1MA 1J19A 2YEPB 2WXFA 3CIRB 2IYDB 3V6EB 3LXFA 3FKYA 1P1AA 1ZDXA 2KVZA 2R2OA 2BS3B 1WJNA 1EO6A 3PRZA 4BKTA 4MH0E 2ICIA 1UBQA 1JWUD 1GC6A 1DOXA 3C8YA 4X57B 2O2VA 3Q2AC 1P9DU 4MM3A 3B2FA 2G4DB 2Y5PA 3VH4B 1M4VA 5LXHA 2I1JA 3EFUA 3A1QB 3IBEA 1VCBA 1ZGUB 3X0WA 4BKGA 1MI0A 3A9KB 1KRHA 3RT3B 1YX5B 2DZMA 3AXCA 1SE4A 2N1WA 2G4SA 2IBIB 3A9JA 3AH7A 4EE2A 1MHHE 1SGHA 5IA7A 4K81A 4KGRA 1E0ZA 5J18A 4IKGA 3JSVB 4AOFA 2LASA 4DHJD 2RDGA 3IVFA 4PS7A 4ANUA 5BYRA 1TS5A 1FO4A 2GRIA 3EA6A 4LNOA 4WWPA 2O6VA 3N9YC 2KN4A 1SIFA 4FJYA 1PFDA 3ZNZB 4RM9A 1EU4A 1FEHA 4BOZB 3BVGA 4IWQA 2SEBD 5I4DA 1KLUD 2JU6X 1T0SC 2NVUI 3ZNGC 1L0VB 4YTMB 3RNFC 4LJPB 4KDLB 1KF6B 2L76A 2KD0A 3L10B 4IWOA 1SB3C 3KQ4A 4G50A 4GDKA 4L23A 1FM0D 3U7ZA 4FLHA 4US8A 3ZJUA 3VTUA 4DDGD 2DYMA 3URYA 1C78A 1Q0WB 1V81A 4LCDE 2KC1A 1P3QU 1UBIA 3AE9B 3ZKJC 3UF8A 3PGEA
chains in the Genus database with same CATH topology
1I4HA 5BYSA 3AMZA 1V1PB 2IGGA 2J53A 1L6VA 2L1AA 1FFVA 1ZPSA 1VZ8A 1NVID 3IXSA 1PDXA 1D4BA 3LYYA 2HTME 3HUIA 1YN4A 2J42A 1JWMD 3AE6B 1N62A 3AEGB 2JXTA 2WS3B 3HVDA 3TEYA 1YNTE 1RFKA 2SAKA 1PGAA 2ACZB 1FNVA 2LHDA 4LTUA 4NAMA 2J52A 2WU2B 1T6BX 1HA5A 2DBYA 1TS2A 2LGIA 1ESFA 4RCOA 3W5VB 1QF6A 3TUOA 1BUIC 4RGMA 1NEKB 1BXTA 1WGKA 3HRDD 4HKQA 3BVMA 3L4PA 4OZCA 1JW9D 2VZKB 2JWUA 1L0YB 2WXJA 3W2DA 3NZ3A 1T5XD 2IJ0A 4JE3B 1XF5L 4JWSC 5TSSA 4ARIA 2KMMA 1FCLA 4WAFA 3HVZA 1TJEA 2W55A 3VR9B 1N5WA 3B2GA 3AEDB 1KH0A 1SBBB 1EU3A 1L4ZB 3T3OA 2N9LA 3Q8AA 2K0PA 4IOIE 3WCQA 5D3IB 4HKZE 1ZUD2 4MM3B 3ZGZA 1IBXA 1XLNA 1D6EC 1UWMA 3P4RB 3DWMA 1ACCA 1I4RA 2AQ1B 2WXGA 5C3JB 3UI3A 3P42A 4RGTA 4RF1A 1NYRA 3IT4B 1YJIA 2CJOA 4C80A 2BYTA 1MHXA 2INNE 1E7PB 5MPOA 3B9JA 3GP7A 3AE3B 2CJNA 1L4DB 1GB1A 3LB8C 4YT0B 1FD6A 2QEJC 5BMGA 3R8BA 3NS1A 1MPEA 3ZYYX 1HZ6A 1I4XA 3AEBB 1CQVA 3BK1A 1I4QA 4LK0M 2QIEB 1YN5A 2Y3AA 1XO3A 1RWSA 2H88B 1JALA 1T3QA 1CJEA 1TZOA 3NVZA 2FE8A 4A55A 3BYTB 2V4IB 1KFYB 4L2YA 5EE0A 1UNSA 1ROEA 2VZKD 4HRSA 3R2TA 4A90A 2L83A 1JWSD 2RMMA 4RFBA 1GOZA 1N61A 4KX6B 4JPSA 1XXGA 1QOFA 4ZHPA 1FXIA 4J3OD 2E6XA 1JQ4A 1VJKA 1FFUA 1UUPA 2MJDA 2WXMA 2L52A 3AE1B 4RGOS 2G1EA 4KKIA 4TSSA 3U2SC 1ZDVA 1SF0A 4KGSA 2N9KA 2WXHA 1D5XC 2BBCA 1HQRD 1SIJA 2YEPF 2PIAA 2Y5CA 4C7YA 2M56B 1YN3A 2WDVB 1AYFA 1GAQB 2NTTA 3NVYA 4ZOHC 1BMLC 1L5PA 2V0GA 3SR6A 1HZ5A 4N59A 1N60A 3SFEB 1KTKA 1C9FA 1C4AA 1MVKA 4FXCA 1JWAD 1WXQA 2BB6A 3O13A 2BS4B 4N58A 4WWMA 1VDVA 4GDKB 1EWCA 4RNAA 5EE9A 1XCQL 4YXDB 3TSSA 3RFZB 4RF0A 3NVVA 2XNAC 2JSVX 1P7FA 3VQIA 2QILA 2R61A 3AECB 2TSSA 3GB1A 5FR3A 3VRBB 2Q5WD 1JRPA 1F0ZA 3AB5A 2GB1A 3AEFB 3J9CA 5AUKA 4ZYSA 1WRIA 1NI3A 1XLQA 3ABVB 3AM9A 1B9RA 5BMIA 1V97A 3H8HA 1NYQA 4OVZA 1HEZE 4WIPA 1FNUA 3BIID 1D5ZC 5JXVA 2WXNA 2BB5A 3R2IA 2BT6A 2K22A 2BTEA 1IUEA 1F77A 5D7GA 1XCTL 1J7CA 1C77A 1WWTA 1VR9A 1XLPA 1AW7A 2JYEA 2M19A 1SXTA 1Q10A 4RGNA 2Z8LA 2IGHA 1DGJA 3AE5B 1TS3A 1IGDA 4XE0A 1XLOA 1K53A 2KACA 2KQ4X 2WP9B 2JYTA 4YSXB 3KWVA 1ENFA 1QOBA 4ARCA 4HJGE 3Q8CA 4NAWB 2WDQB 3MC0B 1V1OA 3DWGC 3I57A 4N6EB 3Q8FA 5EE3A 2I38A 2MH7A 2QSDA 5HHDG 1PYWD 2RDHA 3Q8EA 1OQRA 4Q2JA 5FKAC 3ZJVA 2AQ2B 4P16A 3U4EG 1I4GA 5LNK1 1Y56A 4O1NA 4DQOC 2WNMA 2EKIA 2LEKA 2PVOD 3CWIA 3AE7B 4NZLB 1EM7A 4D2KA 2BW2A 5HG2A 2J4XA 5BMHA 1TKEA 1P7EA 5HI1A 3U52E 2K3UA 3AV8A 1IBXB 1QOAA 3ZQ4A 2B76B 3V05A 1YQ3B 4PT5A 2WXOA 3BZDB 1UWXA 1QT9A 4WURA 1E6EB 1K50A 1TYGB 1PGBA 1ZXHA 2EELA 2WLBA 4YSYB 4AS1A 1STEA 4WQMA 3BVZA 1XEEA 2FUG1 1A70A 2OEDA 5HFYA 3TEWA 4AQ7A 4TMAB 4YSZB 1RYJA 1EWYC 3FILA 5G5HA 3Q69A 2MJ3A 1IGCA 4ZRPA 1SE3A 4ITKA 3EGRA 4P6VF 1VZ6A 3GS2A 5E6JA 1AN8A 2V3PA 1FNWA 4MT5A 1KLGD 1B1ZA 2RPVA 1C4CA 1CZPA 2BS2B 2DWQA 5GXGB 1SEBD 1QILA 1WYGA 4TQ1A 1TKYA 3BWUD 1DYQA 2H89B 2LMCA 1QOGA 1QQRA 4CQNA 1FCCC 2PMVA 3P4PB 1C4PA 3MP9A 3TEZA 2LUMA 1C76A 3FILB 5FK9C 1J7BA 3TEXA 1QKZA 5H8YE 4JX1C 4HEA1 1CK1A 4TQ0A 1V1PA 1OFFA 4MH8A 4XWWA 2E3TA 1PGXA 2INPE 3PZ7A 4GDLB 1YQ4B 2WXKA 2WXQA 3NUHB 3P1MA 2PKOA 2M0AA 3MJ5A 4OHJA 2K5PA 2CU3A 2LJIA 4R3DA 2ZW1A 1QLBB 5AUIA 4WH4A 1GB4A 1SSNA 2PW9A 2W82A 3PZ8A 4C56C 1VRAB 1JROA 3KWLA 3I9V1 1UGJA 2L32A 4A8XC 4XDCA 1L6UA 5BYQA 1L0XB 1FRRA 4USAA 4C7ZA 4OZBA 2WXPA 2YEPB 2WXFA 2MJEA 2LHEA 2JZPA 2WXRA 3CIRB 1ET9A 1JMLA 3LXFA 5D3DA 1F2RC 1ZDXA 2PVGC 2DLBA 4YTPB 2BS3B 4NJCA 1I7HA 3AEEB 3W1SA 3NRZA 3FC4A 2V3NA 4L1BA 2DYOA 1LO5D 1ZXIA 2ICIA 1N63A 1JWUD 2LFIA 1DOXA 1WSPA 2X38A 2ZW0A 3C8YA 4H2AA 2N0SB 5G5GA 3KLSX 2KAJA 2W54A 4MACA 1JCKB 3B2FA 1OQQA 2Y5PA 2G9HD 4KKJA 2D5GA 3Q8BA 1YJJA 1M4VA 4M0WA 1VZ7A 1ET6A 1TY0A 2WDRB 4DXGA 1D5MC 2QJLA 4XDDA 4LLGM 2KWDA 1ZOYB 1VLBA 1FIQA 2JQRB 3P63A 2PTLA 1TS4A 2AX5A 1RM6C 2FBWB 4YTNB 4KGTA 1MI0A 1KRHA 2QMTA 1FMAD 4US9A 3AE4B 2JX5A 3AE2B 3IT6B 1C79A 2K9XA 4B0MA 1SE4A 1R7SA 2XN9C 2WXLA 3AH7A 4B0EA 4EE2A 1MHHE 4A9AA 3ETRA 1SJHD 2MEKA 4UDUC 1N5XA 4HROA 1NENB 3E9SA 3SEBA 2I2YA 1AWDA 3IAM1 2OHFA 3BK2A 4DXFA 5EE1A 4KGRA 1E0ZA 2AQ3B 2KDMA 2W3SA 3V3XA 1FRDA 1DOIA 4IKGA 4OZAA 1SE2A 2NMQA 1GPXA 5T8IA 2RDGA 4REZA 3T3NA 4YWGG 5BYRA 1TS5A 1FO4A 2GRIA 3EA6A 3SFDB 2GI9A 1K52A 2NTSA 3N9YC 2KN4A 4ZRQA 4ZHOA 4OW0A 1PFDA 3ZJTA 2IGDA 3PO0A 2ON8A 2ONQA 5C2TB 3P4QB 1V8CA 1EU4A 1FEHA 2WQYB 3BVGA 4RH6A 2IPKD 3VR8B 1DOYA 3RPFC 3MHZA 1YMHE 1F2RI 2SEBD 3W9CB 1KLUD 1TKGA 1I4PA 2HDEA 2JU6X 5I4DA 1K51A 3AN1A 3IAS1 3VRAB 1L0VB 3EUB2 3E56A 3W5UB 1TY2A 1ZE3D 2WU5B 4YTMB 3FAHA 4GLSC 3MFGA 1ZP0B 1KF6B 3OWEB 3AE8B 2WXIA 1JWBD 1PUTA 1SB3C 3KQ4A 4A6QA 5H92C 2PLPA 4L23A 1FM0D 3AEAB 3U7ZA 4US8A 3NVWA 3ZJUA 2W3RA 1E10A 1SJED 1HXYD 4JWUC 2DYMA 3URYA 1C78A 4XWTA 2N7JA 1E9MA 2IDYA 4IDIA 3P4SB 1J7AA 3AE9B 1FXAA 3BYYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HG2 A;  2IGG A;  2J53 A;  5BMH A;  4MAC A;  1P7E A;  5HI1 A;  1D4B A;  2RMM A;  1IBX B;  2KWD A;  2JXT A;  1UWX A;  1YNT E;  1K50 A;  2EEL A;  1PGB A;  1PGA A;  1ZXH A;  4KGS A;  2PTL A;  2LHD A;  2N9K A;  4KGT A;  2J52 A;  1MI0 A;  2OED A;  5HFY A;  2QMT A;  3FIL A;  1IGC A;  1HZ5 A;  2LGI A;  1C9F A;  1MVK A;  1MHH E;  2RPV A;  4OZC A;  1XCQ L;  2JWU A;  2I2Y A;  2JSV X;  1P7F A;  1XF5 L;  4KGR A;  1FCC C;  3GB1 A;  2KDM A;  3MP9 A;  3V3X A;  4OZA A;  4IKG A;  2GB1 A;  2LUM A;  1FCL A;  2NMQ A;  3FIL B;  1QKZ A;  5BMI A;  1KH0 A;  2N9L A;  1HEZ E;  2GI9 A;  2K0P A;  4IOI E;  5JXV A;  1PGX A;  4HKZ E;  1K52 A;  1IBX A;  2KN4 A;  1XCT L;  2IGD A;  2ON8 A;  2ONQ A;  1Q10 A;  2IGH A;  2ZW1 A;  1IGD A;  4WH4 A;  1GB4 A;  3UI3 A;  2PW9 A;  1K53 A;  2KAC A;  2KQ4 X;  1YMH E;  1F2R I;  2JU6 X;  1K51 A;  1MHX A;  4HJG E;  4GLS C;  4OZB A;  2I38 A;  2QSD A;  2PLP A;  2LHE A;  2JZP A;  5HHD G;  1GB1 A;  1JML A;  1FD6 A;  1F2R C;  5BMG A;  1MPE A;  1HZ6 A;  2N7J A;  2ZW0 A;  1EM7 A;  4D2K A; 
#chains in the Genus database with same CATH topology
 1F1H A;  2KKC A;  4RM8 A;  2L1A A;  1VZ8 A;  1NVI D;  1PDX A;  3HUI A;  4TUU A;  2IY0 B;  3APC A;  3HVD A;  1YNT E;  4FJV B;  3DVN V;  5KHQ A;  2ACZ B;  1FNV A;  3N32 A;  3VTV A;  4PYU A;  3DQV A;  2WU2 B;  2MBQ A;  1HA5 A;  2KT7 A;  4JGH B;  1ESF A;  3W5V B;  3DBS A;  3ZLZ A;  2LZ6 A;  1MG8 A;  2J0M A;  4HKQ A;  1WX7 A;  2DEN B;  5AZF A;  2WXJ A;  3BY4 B;  4OVV A;  3VVW B;  4JWS C;  4NPN A;  2FCM A;  1TJE A;  2W55 A;  3RCZ A;  3VR9 B;  1N5W A;  1SBB B;  3Q8A A;  4BVU C;  5IO9 A;  4I6L B;  3ZO5 B;  1XLN A;  2V4L A;  1D6E C;  4WWO A;  2FCQ A;  2K8B A;  4K7S A;  2Z0E B;  3EFC A;  1M94 A;  2DAF A;  3P42 A;  3ZRF A;  3DVG X;  4A3P A;  5IKC M;  3GP7 A;  5G2N A;  1TBE A;  4WJP A;  2CJN A;  1GUA B;  2KFJ A;  3LB8 C;  5DPS A;  3ENE A;  3Q3F A;  3ZW3 A;  5BMG A;  3R8B A;  3ZYY X;  1I4X A;  3AEB B;  3H7S A;  2NCN A;  3VUX A;  4EOY A;  2AWT A;  1YN5 A;  3CSF A;  2LGX A;  1TZO A;  4WJN A;  3M62 B;  2FE8 A;  3BYT B;  2V4I B;  4L2Y A;  1E8X A;  2UU7 A;  1UEL A;  4RFB A;  1N61 A;  4HDO A;  4ZHP A;  5JHB A;  1UUP A;  2CHZ A;  5DPR A;  4TSS A;  4W9C A;  2PE6 B;  1E8Y A;  2PIA A;  1D3Z A;  4FAD A;  1YN3 A;  1AYF A;  1GAQ B;  3NVY A;  1BML C;  1WMH A;  3SR6 A;  4N59 A;  5AZH A;  1KTK A;  3M95 A;  1C9F A;  4FXC A;  2KJH B;  4RNA A;  4WQO B;  3TSS A;  1LFD A;  4RF0 A;  5D6J B;  2BGF A;  5G55 A;  1WX8 A;  2MSE D;  3VQI A;  3DBR B;  2QIL A;  3GB1 A;  3RNG C;  3AEF B;  2MQJ A;  1WRI A;  1NI3 A;  1WM3 A;  2D11 A;  2HJ1 A;  5BO4 B;  2L0F A;  3UGB B;  2GBN A;  2AEH A;  2BYE A;  3ZNI D;  4NAW A;  3QWZ B;  2WXN A;  2BB5 A;  2BT6 A;  2XK5 B;  4ASW C;  1IUE A;  1P0R A;  1XCT L;  1J7C A;  3GZN I;  2JYE A;  1SXT A;  3V61 A;  3EEC A;  4EKU A;  1TS3 A;  4TV3 A;  5D94 A;  4IW0 A;  1YQB A;  2BKR B;  2G45 B;  2ZCC A;  4EZK A;  4HJG E;  2UWQ A;  3Q8C A;  3Q8F A;  5DPT A;  4Q2J A;  4W9F A;  3ZJV A;  4P16 A;  3R7Q A;  4II2 B;  3U4E G;  2C9W B;  2GLS A;  1RFA A;  4FN2 A;  4D2K A;  2KXJ A;  3MC8 A;  2KWU B;  1TKE A;  3Q3N C;  3U52 E;  4GSW A;  4KSL C;  3ZQ4 A;  3NZS A;  4MJS B;  4WUR A;  3PSE B;  1TYG B;  2AYO B;  4S17 A;  3BVZ A;  2FUG 1;  2INC C;  1S1Q B;  1RYJ A;  4DK5 A;  3Q69 A;  1SE3 A;  1AAR A;  1VZ6 A;  3GS2 A;  5E6J A;  2KTF A;  2V3P A;  1FNW A;  2X8X X;  4MT5 A;  5DPW A;  4P1B C;  1B1Z A;  2RPV A;  1C4C A;  1JRU A;  1SEB D;  2DNF A;  1WGD A;  3BWU D;  1V86 A;  2ZNV C;  1KJT A;  3RN9 C;  1F52 A;  2K8C A;  4DWF A;  3FIL B;  1C3T A;  3TEX A;  3UIP B;  1QKZ A;  5H8Y E;  4MGZ E;  4XGA B;  1V1P A;  4B6W A;  2R2Q A;  4MH8 A;  4GDL B;  1PGX A;  3PZ7 A;  4I6N B;  3DHI C;  2WXK A;  2WXQ A;  3NUH B;  4NQK E;  2BKF A;  2PKO A;  2ZPN A;  2FIF A;  1VD2 A;  2BVC A;  4R3D A;  1J0G A;  3PLU A;  2ZW1 A;  4K1R B;  4W9K A;  1OTR B;  5AUI A;  4F7Z A;  2PW9 A;  1N6Z A;  3QHT A;  1K8R B;  5BYQ A;  3UIN B;  4USA A;  2BF8 B;  2MJE A;  4DDI D;  4MEM A;  2JZP A;  1JML A;  5D3D A;  2PVG C;  2DLB A;  3V60 A;  5CTR C;  3AEE B;  1WX9 A;  3W1S A;  3NRZ A;  3V6C B;  2V3N A;  4L1B A;  3PS6 A;  2DYO A;  1ZXI A;  1OEY A;  4KDI C;  2X38 A;  4GB9 A;  5G5G A;  3R66 C;  1SE9 A;  1LQB A;  2OJW A;  4MAC A;  1JCK B;  3Q8B A;  4M0W A;  3H9D A;  4W9D A;  4XDD A;  2KWD A;  1FIQ A;  3P63 A;  2PTL A;  1RM6 C;  4RMA A;  2FBW B;  3IG3 A;  4MDK E;  4AP4 C;  3TL5 A;  2LD9 A;  1Q1O A;  3AE2 B;  1C79 A;  2DZJ A;  3A33 B;  2PEA A;  2LVQ A;  3B08 A;  2XN9 C;  3K9P B;  4ZRJ A;  2WGS A;  4B0E A;  1SJH D;  4UDU C;  1AWD A;  2LJ5 A;  3B0A A;  2AQ3 B;  2JVC A;  3V3X A;  1FRD A;  1P98 A;  2NMQ A;  2PPH A;  4P1C C;  3T3N A;  4GN1 A;  2KDI A;  5GMV A;  4M00 A;  3PVL A;  3N30 A;  1K52 A;  3L54 A;  3DBH B;  4GOC A;  3PO0 A;  2LI5 A;  2GBJ A;  5IN7 A;  3QCA A;  2IPK D;  3VR8 B;  3X23 A;  1DOY A;  1YMH E;  1F2R I;  3W9C B;  3K9O B;  3W5U B;  2WU5 B;  3FAH A;  4EZJ A;  4GLS C;  3MFG A;  1ZP0 B;  4F1S A;  2O6V B;  1JWB D;  3MHS D;  1E10 A;  1XT9 B;  2JZ3 B;  3NHE B;  1SJE D;  3HK0 A;  1E9M A;  4II3 B;  1LM8 B;  3RZW C;  3QIJ A;  5AZG A;  5J2R A;  3UQB A;  2RSU A;  2M4N A;  1WXS A;  4E74 A;  1FFV A;  1ZPS A;  1D4B A;  3LYY A;  2LUE A;  1T0R C;  2J42 A;  1JWM D;  1N62 A;  3A4S C;  2ZVN A;  3NS8 A;  3TEY A;  2KTR B;  4MSM B;  2MX2 A;  2RGF A;  2SAK A;  4HCN B;  4ANV A;  2LHD A;  4NAM A;  2M0X A;  1OGW A;  4M8N A;  2N9E B;  2NS5 A;  1T6B X;  2VH1 A;  3VAW A;  4B9K A;  3QX1 A;  3N1Z C;  2LGI A;  1E90 A;  3JVZ X;  3TUO A;  1BUI C;  4NY0 A;  4RGM A;  1BXT A;  1WFY A;  2GMI C;  3N1X C;  3PZD A;  4JL9 A;  5LXI B;  3W2D A;  5JH5 C;  3U8Z A;  1WZ3 A;  5TSS A;  2KMM A;  1GJZ A;  1TTN A;  1Y8R C;  4WAF A;  2O6V D;  2N7D A;  3T3O A;  4IOI E;  2BWF A;  2HJ8 A;  3L08 A;  2KHW B;  1IBX A;  4HK2 A;  3MC9 A;  3H1U A;  2JPH A;  3DWM A;  1ACC A;  1I4R A;  3ZTC A;  3KW5 B;  2FID A;  3U30 A;  3RNE C;  2FUH B;  1NYR A;  2L0T A;  5L95 C;  2FAZ A;  1YJI A;  4C80 A;  2BYT A;  5J17 A;  2LGD A;  1MHX A;  2INN E;  2AL6 A;  3N20 C;  2ZZP B;  2KC2 A;  4GGQ A;  4WAA A;  4KV2 A;  3AU5 A;  2EKE C;  3MJW A;  1RLF A;  3H6N A;  1PQS A;  1IYF A;  3DBL B;  2MW5 A;  1XO3 A;  1RWS A;  1CJE A;  4M01 A;  2XBB C;  2MBB B;  2JXX A;  4DHZ E;  2L83 A;  1GOZ A;  1XXG A;  3RD2 A;  1LXD A;  1JQ4 A;  1FXI A;  3WAP A;  1VJK A;  2L52 A;  5KHO A;  3U2S C;  4G3X B;  2BPS A;  2LRU A;  2N9K A;  4DXA B;  1HQR D;  2YEP F;  2ZNV B;  2Y5C A;  3UIO B;  4C7Y A;  4WJQ A;  3QJZ A;  2D3C A;  1L5P A;  2MWS B;  1HZ5 A;  2C7M B;  4IUM B;  1UH6 A;  3ML9 A;  4AJY B;  1C4A A;  1JWA D;  3PHX B;  2LRW A;  3O13 A;  2BB6 A;  1H4R A;  4YL8 A;  3OJ4 B;  4LDT B;  2BWE S;  2MRP A;  3RFZ B;  2JWZ A;  1YX6 B;  2JSV X;  1T0Y A;  4W9H A;  2TSS A;  5FR3 A;  2D3B A;  2Q5W D;  1F0Z A;  4AWJ A;  4KZ0 A;  5AUK A;  1B9R A;  1MJD A;  2LVP A;  1WMH B;  3H8H A;  4OVZ A;  2MBE A;  4C00 A;  3R2I A;  1FXT B;  1RAX A;  3DOW A;  1WWT A;  3A1Q A;  1AW7 A;  2OJR A;  2N9X A;  2KWC A;  3AE5 B;  1NBF C;  3DBL I;  2M17 A;  2CU1 A;  1K53 A;  5IAA C;  1I35 A;  2GBR A;  4NAW B;  2WDQ B;  3MC0 B;  3OG5 A;  3I57 A;  2GOW A;  3S2A A;  2B3A A;  2RDB C;  3AU4 A;  2RDH A;  3Q8E A;  5FKA C;  2AQ2 B;  2BQQ A;  2Y5B B;  3JSV A;  3RMK C;  1Y56 A;  4O1N A;  4TKN A;  3T9L A;  2LEK A;  4ZYN A;  3KUD B;  4NZL B;  1S3S G;  1EM7 A;  3AI5 A;  2BW2 A;  2J4X A;  2VRR B;  4LDT D;  5BMH A;  4NNJ B;  2K3U A;  3AV8 A;  3C19 A;  1QOA A;  2D07 B;  2NBV B;  2B76 B;  1UF0 A;  1YQ3 B;  1UWX A;  4P7I A;  1ZXH A;  2WLB A;  4HPL B;  4BBN C;  1J8C A;  1IPG A;  4HCP B;  3TEW A;  4TMA B;  1EWY C;  3HM6 X;  3SD5 A;  2M8S A;  2MJ3 A;  4P6V F;  1AN8 A;  1KLG D;  1CZP A;  4DBG A;  5GXG B;  2IO0 B;  2KMC A;  1WYG A;  2C60 A;  4TQ1 A;  2MLB A;  2KVR A;  1DYQ A;  2H89 B;  1QQR A;  4CQN A;  5JHA A;  3JW0 X;  3P4P B;  1C4P A;  2LUM A;  2KMA A;  3SHQ A;  3L17 A;  5FK9 C;  1J7B A;  2C7N B;  2LXA A;  1NI2 A;  4HEA 1;  4TQ0 A;  1GNU A;  4DHZ B;  3KH0 A;  1WRD B;  3P1M A;  2ZVO A;  1WJ4 A;  4OHJ A;  4C4V A;  4FUL A;  2LJI A;  2JT4 B;  1GB4 A;  3GOE A;  4C56 C;  1JRO A;  3KWL A;  5HKH A;  4HPM B;  2AL3 A;  4A8X C;  4XDC A;  1L6U A;  1FRR A;  4IC7 B;  2D3G A;  1H8C A;  2WXP A;  1WH3 A;  3PRE A;  3ZDM C;  1KM7 A;  2WXR A;  4QAY A;  3RYT A;  2KX3 A;  4YTP B;  2NBW B;  1I7H A;  3VH3 B;  1R4N B;  3DHG C;  3FC4 A;  2JY6 A;  2KN5 A;  4KZC A;  4NJ6 A;  1U4A A;  1LO5 D;  1WSP A;  4H2A A;  3VTW A;  3KLS X;  4JQW C;  1KOT A;  1WXM A;  2W54 A;  2KDB A;  4FJZ A;  2G9H D;  4KIK B;  3OJ3 A;  1VZ7 A;  3KUC B;  1TY0 A;  5JZE B;  1WI0 A;  2QJL A;  2KJR A;  4CO7 A;  4LLG M;  3N3K B;  2WDT B;  1ZOY B;  3L16 A;  1E5W A;  2JQR B;  2JUO A;  5E6O A;  1TS4 A;  2AX5 A;  4KGT A;  1V80 A;  2QMT A;  1FMA D;  3AE4 B;  3IT6 B;  4B0M A;  3I63 C;  1R7S A;  4K7U A;  3H7P A;  4LNK A;  3DCG A;  2CKH B;  3ETR A;  1NEN B;  2I2Y A;  3IAM 1;  1WYW B;  3APF A;  2OHF A;  4DXF A;  5EE1 A;  3DBR I;  1DOI A;  1GPX A;  5T8I A;  4REZ A;  1UGM A;  2KDE B;  4K7W A;  4ICV A;  4MGK E;  2GI9 A;  3ZIM A;  2NTS A;  4ZHO A;  4ZRQ A;  2K25 A;  3I3T B;  2HTH A;  2ON8 A;  3CF6 E;  3P4Q B;  1V8C A;  2C7H A;  2NR2 A;  4GXB A;  2HE7 A;  4RH6 A;  3WAM A;  2DX5 B;  3MHZ A;  4URK A;  3M63 B;  1K51 A;  3AN1 A;  4BZA A;  3EUB 2;  3E56 A;  2DAJ A;  1ZW7 A;  1X1M A;  3ML8 A;  4N9F 4;  2ZJD A;  2QC8 A;  2WXI A;  1PUT A;  3TBL D;  5H92 C;  2PLP A;  3A4R A;  3AEA B;  3LJ3 A;  2W3R A;  2N7E A;  1ZKH A;  4JWU C;  3PHW B;  2N7J A;  4IDI A;  3P4S B;  4PS3 A;  1FXA A;  3BYY B;  4OVU A;  3AMZ A;  2IGG A;  2MP2 A;  2J53 A;  3Q3J A;  1L6V A;  4A3O A;  2KYW A;  3IXS A;  2XK5 A;  2KDF B;  3RUL A;  2LXC A;  3AE6 B;  2K8H A;  2NPT B;  1QZE A;  2JXT A;  2WS3 B;  1RFK A;  4XX5 A;  3NG0 A;  4HWI B;  3ECI A;  4LTU A;  2J52 A;  2MHJ A;  2UYZ B;  5C23 A;  3PV1 A;  2MBH A;  3D32 A;  3SU8 X;  1TS2 A;  4RCO A;  1QF6 A;  4HVB A;  1WGK A;  3HRD D;  4OZC A;  1V49 A;  5CX3 A;  3Q3M C;  1JW9 D;  3NZ3 A;  1T5X D;  3L0W B;  2V1Y A;  2IJ0 A;  2KLC A;  1XF5 L;  4ARI A;  3M3J A;  1FCL A;  5IOI A;  1YOV B;  3HIZ A;  3B2G A;  3AED B;  1EU3 A;  2O2V B;  3WAL A;  3N1Y C;  2YLM A;  4BKS A;  3WAN A;  3WCQ A;  4MM3 B;  3ZGZ A;  4LNI A;  3IHP C;  2REX A;  2AQ1 B;  1WR6 E;  2KOX A;  1V9J A;  2WXG A;  5C3J B;  3UI3 A;  2A4Z A;  3IT4 B;  2CJO A;  3L13 A;  3A9J B;  3AE3 B;  2G3Q B;  5LLI A;  2K1F A;  1L4D B;  1GB1 A;  3APD A;  4YT0 B;  3BK1 A;  1CQV A;  1R4M B;  2QIE B;  1EF1 A;  1JAL A;  2IND C;  1T3Q A;  4LNF A;  3NVZ A;  4W9L A;  4A55 A;  4ANX A;  5EE0 A;  1GC7 A;  2LVO A;  3R2T A;  4A90 A;  2CR5 A;  1JWS D;  2RMM A;  4KX6 B;  4JPS A;  1QOF A;  2MA9 B;  4I6P A;  2J0J A;  2WXM A;  4RGO S;  3PLV A;  1WGH A;  1TZ1 A;  4CHK A;  1SIJ A;  2WDV B;  2ZPY A;  2QHO A;  2NTT A;  4ZOH C;  2V0G A;  2L00 B;  1HTQ A;  1N60 A;  2JRH A;  3SFE B;  1HTO A;  3DHH C;  3NY5 A;  4M8M A;  1GG3 A;  1MVK A;  1WXQ A;  4N58 A;  4GDK B;  4MGI E;  5EE9 A;  4YXD B;  1IP9 A;  2GBM A;  3CMM B;  1P7F A;  3AEC B;  4AJW A;  3J9C A;  4ZYS A;  2XEW A;  4AUQ C;  2RPQ A;  1V97 A;  4WIP A;  1ISN A;  1FNU A;  1V5O A;  1D5Z C;  5JXV A;  3DVN U;  2K22 A;  2BTE A;  4JLC A;  2N9P C;  1VR9 A;  3W1S C;  2M19 A;  3DBH I;  4RGN A;  4PK1 A;  2WHI A;  5CHV C;  4XE0 A;  4MSQ B;  1R4M I;  2KQ4 X;  2JYT A;  4YSX B;  1E7V A;  3R7R A;  2IZV B;  3DWG C;  2OOB B;  2QSD A;  3RUI B;  2KQ7 A;  5HHD G;  1L2N A;  1OQR A;  5LNK 1;  1WF9 A;  4EUT A;  2WNM A;  4S0R A;  2EKI A;  3AE7 B;  3I5J C;  4B95 A;  1MG4 A;  5HG2 A;  3VUW A;  2JF5 A;  1Z5S B;  3DPD A;  4BBN F;  2JRI B;  4HLE A;  3VXW A;  1OEY J;  2WXO A;  3BZD B;  1QT9 A;  1E6E B;  4YSY B;  4AQ7 A;  2OED A;  1A70 A;  3GE3 C;  2K6D B;  1IGC A;  4ZRP A;  2V3S A;  4ITK A;  2N4F A;  4IM0 A;  2DWQ A;  1F9J A;  1TKY A;  1QOG A;  1LGR A;  1RRB A;  2KX0 A;  2PMV A;  2IO2 B;  3Q3O C;  1C76 A;  2DZK A;  4ZRI A;  4JX1 C;  3WIM A;  1CK1 A;  1OFF A;  2KFK A;  2WYQ A;  4XWW A;  1OQY A;  2J7Q B;  2L05 A;  2E3T A;  1TIF A;  4EZL A;  4HXD A;  4XYC A;  2D3A A;  2M0A A;  3O65 B;  2ZCB A;  3OLM D;  5D2M B;  2CU3 A;  2KTR A;  4HDQ A;  1TGZ B;  3AUL A;  1QLB B;  3KVF B;  1SSN A;  2W82 A;  2N1V A;  3PZ8 A;  1VRA B;  4IM2 A;  3I9V 1;  4EFO A;  3QA8 A;  5CHF A;  1E8Z A;  2L32 A;  3ZVV A;  1L0X B;  4C7Z A;  4OZB A;  1WJ6 A;  4ZDV A;  2LHE A;  4C4V B;  4BFR A;  1ET9 A;  1F2R C;  3RNC C;  3QAQ A;  2MBO A;  2MCN B;  4NJC A;  2D2Q A;  2L3Z A;  3QAR A;  4FHJ A;  3A9K A;  1V2Y A;  1N63 A;  2LFI A;  2ZW0 A;  2N0S B;  2KAJ A;  1CMX B;  1WXA A;  2KK8 A;  1FPY A;  1OQQ A;  1YJ1 A;  3EHV A;  4KKJ A;  3ONS A;  2D5G A;  1YJJ A;  2Z59 B;  2KWV B;  1ET6 A;  2WDR B;  4DXG A;  1D5M C;  2IO3 B;  1VLB A;  4G0N B;  2I1K A;  4W9J A;  4YTN B;  1WGR A;  4US9 A;  2JX5 A;  2KLG A;  2WX0 A;  2K9X A;  2W9N A;  3T8M A;  3VUY A;  3C0R B;  3ZUN A;  2WXL A;  4ICU A;  4A9A A;  1EUV B;  2MEK A;  4G11 A;  1N5X A;  4HRO A;  2RD0 A;  3E9S A;  3ZNH B;  3SEB A;  4XZ4 A;  3TIX A;  4JIO U;  3BK2 A;  2KNB A;  2GBK A;  2KDM A;  2W3S A;  4OZA A;  1SE2 A;  3KYD D;  4IWP A;  4YWG G;  3SFD B;  3Q6B A;  4HJK A;  3OAW A;  4FBJ B;  3R3M A;  3H7P B;  3PRP B;  1WJU A;  4OW0 A;  3TJP A;  2WX1 A;  3GZN B;  4K3C A;  2IGD A;  3WA0 A;  3ZJT A;  2ONQ A;  2QCZ A;  5C2T B;  2HD5 B;  2WQY B;  3RPF C;  1TKG A;  1I4P A;  2HDE A;  3WAO A;  3IAS 1;  3VRA B;  2K39 A;  1TY2 A;  1ZE3 D;  3OWE B;  3AE8 B;  4IM3 A;  5IP4 D;  1YD8 U;  3PRM B;  3RNA C;  4A6Q A;  3VDZ A;  3EC8 A;  3NVW A;  1WE6 A;  1HXY D;  3GE8 C;  1UZX B;  3ZDT A;  4XWT A;  3CST A;  3RI7 C;  2IDY A;  2BYV E;  1J7A A;  3B1L X;  4ZRK A;  1I4H A;  5BYS A;  3PPA A;  1V1P B;  2FCN A;  2HTM E;  1YN4 A;  1V6E A;  2LGS A;  4KVG B;  3AEG B;  2FCS A;  2LWP A;  4HPP A;  1PGA A;  1NDD A;  2CHX A;  5L83 A;  1E7U A;  2DBY A;  5C1Z A;  2MP2 B;  2JZZ A;  2PJH A;  1NEK B;  2IO1 B;  3BVM A;  3L4P A;  3NJT A;  4KSK C;  2CHW A;  1WGG A;  4FA6 A;  3SDL C;  1WZ0 A;  2VZK B;  2JWU A;  1L0Y B;  2D10 A;  3VHT C;  1C1Y B;  4JE3 B;  3IFW B;  3HVZ A;  4PYZ A;  3ZTD A;  4NJ7 A;  1KH0 A;  1HE8 A;  1L4Z B;  2N9L A;  3KUZ A;  2V9H A;  4GMV A;  2K0P A;  5D3I B;  4HKZ E;  1ZUD 2;  2KAN A;  1UD7 A;  2DZI A;  4M0W B;  1UWM A;  2FNJ B;  2KJ6 A;  3P4R B;  4MEL A;  1WE7 A;  4RGT A;  4RF1 A;  3QK0 A;  4WJO A;  3ZXR A;  2VH2 A;  1E7P B;  4W9I A;  5MPO A;  3B9J A;  3QQ8 B;  4CYE A;  2IY1 B;  3HHM A;  1FD6 A;  2QEJ C;  4J6I A;  5FR6 A;  3NS1 A;  1MPE A;  1HZ6 A;  2NBU A;  2LGY A;  1I4Q A;  4BAX A;  4LK0 M;  1R4N I;  2Y3A A;  5TR5 A;  1WGY A;  2H88 B;  5E6N A;  4E71 A;  5DCN A;  1KFY B;  2K6Q A;  1UNS A;  1ROE A;  2VZK D;  4FHK A;  4HRS A;  4J3O D;  2E6X A;  1FFU A;  3AE1 B;  2MJD A;  2CS4 A;  1A5R A;  2G1E A;  4KKI A;  1ZDV A;  1SF0 A;  4KGS A;  2WXH A;  1D5X C;  2BBC A;  2EMS A;  4ACF A;  1I42 A;  2M56 B;  3QC8 B;  3JYU A;  4MGY E;  5EDS A;  1MFW A;  3TMP B;  3PTF C;  2BS4 B;  4WWM A;  4XC2 A;  1VDV A;  1EWC A;  1XCQ L;  1T0Q C;  2ZEQ A;  1XQQ A;  3NVV A;  3KYC D;  2XNA C;  3NZU A;  2R61 A;  3VRB B;  4NQL B;  1JRP A;  3AB5 A;  2GB1 A;  4BKS D;  1XLQ A;  3ABV B;  3AM9 A;  3V62 A;  5BMI A;  1NYQ A;  1WM2 A;  1HEZ E;  3PT2 B;  3BII D;  3RNB C;  4KIK A;  1F77 A;  5D7G A;  5AEK B;  1C77 A;  1XLP A;  2C5L C;  1Q10 A;  2RR9 A;  2DYB A;  2Z8L A;  2IGH A;  1Q5W B;  1DGJ A;  4ANW A;  1IGD A;  1XLO A;  3NOB A;  3BIN A;  2KAC A;  3DDC B;  2WP9 B;  3LDZ E;  1WXV A;  1G6J A;  5E6P A;  3KWV A;  1ENF A;  1QOB A;  3UQA A;  4ARC A;  3VFK A;  1V1O A;  4N6E B;  5EE3 A;  4PS8 A;  2I38 A;  2MH7 A;  1PYW D;  4MJS A;  3RZF A;  2J0K A;  3P2B A;  1E8W A;  4M02 A;  1I4G A;  3ZRC A;  4DQO C;  1KLV A;  3CWI A;  2PVO D;  4GIV A;  3ZXV A;  1P7E A;  1Z2M A;  5HI1 A;  1IBX B;  2L7R A;  3W1Y A;  2KQS A;  2WWZ A;  3V05 A;  4PT5 A;  3TCA A;  1K50 A;  2EEL A;  1PGB A;  4AS1 A;  4WWN A;  1STE A;  4WQM A;  2QDF A;  1XEE A;  5HFY A;  2YVC A;  4YSZ B;  3FIL A;  5G5H A;  1XD3 B;  1WY8 A;  3EGR A;  4GDL A;  4BOS C;  2BS2 B;  4GU2 A;  5CHW A;  1QIL A;  4IG7 B;  2Z0D B;  1EF5 A;  2LMC A;  2EMT A;  4K3B A;  1FCC C;  1V5T A;  3MP9 A;  3U7D A;  2PE9 A;  3DVG Y;  1YIW A;  3TEZ A;  2L8J A;  2KZR A;  4A20 A;  4E3C A;  4W9E A;  4EEW A;  4W9G A;  2INP E;  1YQ4 B;  1L7Y A;  3ALB A;  3MJ5 A;  2K5P A;  2NPT A;  4LJO B;  1WIA A;  1TT5 B;  2A5U A;  2DHZ A;  1BT0 A;  4F8C B;  3Q14 C;  4LNN A;  4WH4 A;  2KO3 A;  2BYF A;  1UGJ A;  3HM3 A;  2KFK B;  2ASQ A;  1WR1 A;  3MTN B;  4DHJ B;  2M1M A;  1J19 A;  2YEP B;  2WXF A;  3CIR B;  2IYD B;  3V6E B;  3LXF A;  3FKY A;  1P1A A;  1ZDX A;  2KVZ A;  2R2O A;  2BS3 B;  1WJN A;  1EO6 A;  3PRZ A;  4BKT A;  4MH0 E;  2ICI A;  1UBQ A;  1JWU D;  1GC6 A;  1DOX A;  3C8Y A;  4X57 B;  2O2V A;  3Q2A C;  1P9D U;  4MM3 A;  3B2F A;  2G4D B;  2Y5P A;  3VH4 B;  1M4V A;  5LXH A;  2I1J A;  3EFU A;  3A1Q B;  3IBE A;  1VCB A;  1ZGU B;  3X0W A;  4BKG A;  1MI0 A;  3A9K B;  1KRH A;  3RT3 B;  1YX5 B;  2DZM A;  3AXC A;  1SE4 A;  2N1W A;  2G4S A;  2IBI B;  3A9J A;  3AH7 A;  4EE2 A;  1MHH E;  1SGH A;  5IA7 A;  4K81 A;  4KGR A;  1E0Z A;  5J18 A;  4IKG A;  3JSV B;  4AOF A;  2LAS A;  4DHJ D;  2RDG A;  3IVF A;  4PS7 A;  4ANU A;  5BYR A;  1TS5 A;  1FO4 A;  2GRI A;  3EA6 A;  4LNO A;  4WWP A;  2O6V A;  3N9Y C;  2KN4 A;  1SIF A;  4FJY A;  1PFD A;  3ZNZ B;  4RM9 A;  1EU4 A;  1FEH A;  4BOZ B;  3BVG A;  4IWQ A;  2SEB D;  5I4D A;  1KLU D;  2JU6 X;  1T0S C;  2NVU I;  3ZNG C;  1L0V B;  4YTM B;  3RNF C;  4LJP B;  4KDL B;  1KF6 B;  2L76 A;  2KD0 A;  3L10 B;  4IWO A;  1SB3 C;  3KQ4 A;  4G50 A;  4GDK A;  4L23 A;  1FM0 D;  3U7Z A;  4FLH A;  4US8 A;  3ZJU A;  3VTU A;  4DDG D;  2DYM A;  3URY A;  1C78 A;  1Q0W B;  1V81 A;  4LCD E;  2KC1 A;  1P3Q U;  1UBI A;  3AE9 B;  3ZKJ C;  3UF8 A;  3PGE A; 
#chains in the Genus database with same CATH homology
 1I4H A;  5BYS A;  3AMZ A;  1V1P B;  2IGG A;  2J53 A;  1L6V A;  2L1A A;  1FFV A;  1ZPS A;  1VZ8 A;  1NVI D;  3IXS A;  1PDX A;  1D4B A;  3LYY A;  2HTM E;  3HUI A;  1YN4 A;  2J42 A;  1JWM D;  3AE6 B;  1N62 A;  3AEG B;  2JXT A;  2WS3 B;  3HVD A;  3TEY A;  1YNT E;  1RFK A;  2SAK A;  1PGA A;  2ACZ B;  1FNV A;  2LHD A;  4LTU A;  4NAM A;  2J52 A;  2WU2 B;  1T6B X;  1HA5 A;  2DBY A;  1TS2 A;  2LGI A;  1ESF A;  4RCO A;  3W5V B;  1QF6 A;  3TUO A;  1BUI C;  4RGM A;  1NEK B;  1BXT A;  1WGK A;  3HRD D;  4HKQ A;  3BVM A;  3L4P A;  4OZC A;  1JW9 D;  2VZK B;  2JWU A;  1L0Y B;  2WXJ A;  3W2D A;  3NZ3 A;  1T5X D;  2IJ0 A;  4JE3 B;  1XF5 L;  4JWS C;  5TSS A;  4ARI A;  2KMM A;  1FCL A;  4WAF A;  3HVZ A;  1TJE A;  2W55 A;  3VR9 B;  1N5W A;  3B2G A;  3AED B;  1KH0 A;  1SBB B;  1EU3 A;  1L4Z B;  3T3O A;  2N9L A;  3Q8A A;  2K0P A;  4IOI E;  3WCQ A;  5D3I B;  4HKZ E;  1ZUD 2;  4MM3 B;  3ZGZ A;  1IBX A;  1XLN A;  1D6E C;  1UWM A;  3P4R B;  3DWM A;  1ACC A;  1I4R A;  2AQ1 B;  2WXG A;  5C3J B;  3UI3 A;  3P42 A;  4RGT A;  4RF1 A;  1NYR A;  3IT4 B;  1YJI A;  2CJO A;  4C80 A;  2BYT A;  1MHX A;  2INN E;  1E7P B;  5MPO A;  3B9J A;  3GP7 A;  3AE3 B;  2CJN A;  1L4D B;  1GB1 A;  3LB8 C;  4YT0 B;  1FD6 A;  2QEJ C;  5BMG A;  3R8B A;  3NS1 A;  1MPE A;  3ZYY X;  1HZ6 A;  1I4X A;  3AEB B;  1CQV A;  3BK1 A;  1I4Q A;  4LK0 M;  2QIE B;  1YN5 A;  2Y3A A;  1XO3 A;  1RWS A;  2H88 B;  1JAL A;  1T3Q A;  1CJE A;  1TZO A;  3NVZ A;  2FE8 A;  4A55 A;  3BYT B;  2V4I B;  1KFY B;  4L2Y A;  5EE0 A;  1UNS A;  1ROE A;  2VZK D;  4HRS A;  3R2T A;  4A90 A;  2L83 A;  1JWS D;  2RMM A;  4RFB A;  1GOZ A;  1N61 A;  4KX6 B;  4JPS A;  1XXG A;  1QOF A;  4ZHP A;  1FXI A;  4J3O D;  2E6X A;  1JQ4 A;  1VJK A;  1FFU A;  1UUP A;  2MJD A;  2WXM A;  2L52 A;  3AE1 B;  4RGO S;  2G1E A;  4KKI A;  4TSS A;  3U2S C;  1ZDV A;  1SF0 A;  4KGS A;  2N9K A;  2WXH A;  1D5X C;  2BBC A;  1HQR D;  1SIJ A;  2YEP F;  2PIA A;  2Y5C A;  4C7Y A;  2M56 B;  1YN3 A;  2WDV B;  1AYF A;  1GAQ B;  2NTT A;  3NVY A;  4ZOH C;  1BML C;  1L5P A;  2V0G A;  3SR6 A;  1HZ5 A;  4N59 A;  1N60 A;  3SFE B;  1KTK A;  1C9F A;  1C4A A;  1MVK A;  4FXC A;  1JWA D;  1WXQ A;  2BB6 A;  3O13 A;  2BS4 B;  4N58 A;  4WWM A;  1VDV A;  4GDK B;  1EWC A;  4RNA A;  5EE9 A;  1XCQ L;  4YXD B;  3TSS A;  3RFZ B;  4RF0 A;  3NVV A;  2XNA C;  2JSV X;  1P7F A;  3VQI A;  2QIL A;  2R61 A;  3AEC B;  2TSS A;  3GB1 A;  5FR3 A;  3VRB B;  2Q5W D;  1JRP A;  1F0Z A;  3AB5 A;  2GB1 A;  3AEF B;  3J9C A;  5AUK A;  4ZYS A;  1WRI A;  1NI3 A;  1XLQ A;  3ABV B;  3AM9 A;  1B9R A;  5BMI A;  1V97 A;  3H8H A;  1NYQ A;  4OVZ A;  1HEZ E;  4WIP A;  1FNU A;  3BII D;  1D5Z C;  5JXV A;  2WXN A;  2BB5 A;  3R2I A;  2BT6 A;  2K22 A;  2BTE A;  1IUE A;  1F77 A;  5D7G A;  1XCT L;  1J7C A;  1C77 A;  1WWT A;  1VR9 A;  1XLP A;  1AW7 A;  2JYE A;  2M19 A;  1SXT A;  1Q10 A;  4RGN A;  2Z8L A;  2IGH A;  1DGJ A;  3AE5 B;  1TS3 A;  1IGD A;  4XE0 A;  1XLO A;  1K53 A;  2KAC A;  2KQ4 X;  2WP9 B;  2JYT A;  4YSX B;  3KWV A;  1ENF A;  1QOB A;  4ARC A;  4HJG E;  3Q8C A;  4NAW B;  2WDQ B;  3MC0 B;  1V1O A;  3DWG C;  3I57 A;  4N6E B;  3Q8F A;  5EE3 A;  2I38 A;  2MH7 A;  2QSD A;  5HHD G;  1PYW D;  2RDH A;  3Q8E A;  1OQR A;  4Q2J A;  5FKA C;  3ZJV A;  2AQ2 B;  4P16 A;  3U4E G;  1I4G A;  5LNK 1;  1Y56 A;  4O1N A;  4DQO C;  2WNM A;  2EKI A;  2LEK A;  2PVO D;  3CWI A;  3AE7 B;  4NZL B;  1EM7 A;  4D2K A;  2BW2 A;  5HG2 A;  2J4X A;  5BMH A;  1TKE A;  1P7E A;  5HI1 A;  3U52 E;  2K3U A;  3AV8 A;  1IBX B;  1QOA A;  3ZQ4 A;  2B76 B;  3V05 A;  1YQ3 B;  4PT5 A;  2WXO A;  3BZD B;  1UWX A;  1QT9 A;  4WUR A;  1E6E B;  1K50 A;  1TYG B;  1PGB A;  1ZXH A;  2EEL A;  2WLB A;  4YSY B;  4AS1 A;  1STE A;  4WQM A;  3BVZ A;  1XEE A;  2FUG 1;  1A70 A;  2OED A;  5HFY A;  3TEW A;  4AQ7 A;  4TMA B;  4YSZ B;  1RYJ A;  1EWY C;  3FIL A;  5G5H A;  3Q69 A;  2MJ3 A;  1IGC A;  4ZRP A;  1SE3 A;  4ITK A;  3EGR A;  4P6V F;  1VZ6 A;  3GS2 A;  5E6J A;  1AN8 A;  2V3P A;  1FNW A;  4MT5 A;  1KLG D;  1B1Z A;  2RPV A;  1C4C A;  1CZP A;  2BS2 B;  2DWQ A;  5GXG B;  1SEB D;  1QIL A;  1WYG A;  4TQ1 A;  1TKY A;  3BWU D;  1DYQ A;  2H89 B;  2LMC A;  1QOG A;  1QQR A;  4CQN A;  1FCC C;  2PMV A;  3P4P B;  1C4P A;  3MP9 A;  3TEZ A;  2LUM A;  1C76 A;  3FIL B;  5FK9 C;  1J7B A;  3TEX A;  1QKZ A;  5H8Y E;  4JX1 C;  4HEA 1;  1CK1 A;  4TQ0 A;  1V1P A;  1OFF A;  4MH8 A;  4XWW A;  2E3T A;  1PGX A;  2INP E;  3PZ7 A;  4GDL B;  1YQ4 B;  2WXK A;  2WXQ A;  3NUH B;  3P1M A;  2PKO A;  2M0A A;  3MJ5 A;  4OHJ A;  2K5P A;  2CU3 A;  2LJI A;  4R3D A;  2ZW1 A;  1QLB B;  5AUI A;  4WH4 A;  1GB4 A;  1SSN A;  2PW9 A;  2W82 A;  3PZ8 A;  4C56 C;  1VRA B;  1JRO A;  3KWL A;  3I9V 1;  1UGJ A;  2L32 A;  4A8X C;  4XDC A;  1L6U A;  5BYQ A;  1L0X B;  1FRR A;  4USA A;  4C7Z A;  4OZB A;  2WXP A;  2YEP B;  2WXF A;  2MJE A;  2LHE A;  2JZP A;  2WXR A;  3CIR B;  1ET9 A;  1JML A;  3LXF A;  5D3D A;  1F2R C;  1ZDX A;  2PVG C;  2DLB A;  4YTP B;  2BS3 B;  4NJC A;  1I7H A;  3AEE B;  3W1S A;  3NRZ A;  3FC4 A;  2V3N A;  4L1B A;  2DYO A;  1LO5 D;  1ZXI A;  2ICI A;  1N63 A;  1JWU D;  2LFI A;  1DOX A;  1WSP A;  2X38 A;  2ZW0 A;  3C8Y A;  4H2A A;  2N0S B;  5G5G A;  3KLS X;  2KAJ A;  2W54 A;  4MAC A;  1JCK B;  3B2F A;  1OQQ A;  2Y5P A;  2G9H D;  4KKJ A;  2D5G A;  3Q8B A;  1YJJ A;  1M4V A;  4M0W A;  1VZ7 A;  1ET6 A;  1TY0 A;  2WDR B;  4DXG A;  1D5M C;  2QJL A;  4XDD A;  4LLG M;  2KWD A;  1ZOY B;  1VLB A;  1FIQ A;  2JQR B;  3P63 A;  2PTL A;  1TS4 A;  2AX5 A;  1RM6 C;  2FBW B;  4YTN B;  4KGT A;  1MI0 A;  1KRH A;  2QMT A;  1FMA D;  4US9 A;  3AE4 B;  2JX5 A;  3AE2 B;  3IT6 B;  1C79 A;  2K9X A;  4B0M A;  1SE4 A;  1R7S A;  2XN9 C;  2WXL A;  3AH7 A;  4B0E A;  4EE2 A;  1MHH E;  4A9A A;  3ETR A;  1SJH D;  2MEK A;  4UDU C;  1N5X A;  4HRO A;  1NEN B;  3E9S A;  3SEB A;  2I2Y A;  1AWD A;  3IAM 1;  2OHF A;  3BK2 A;  4DXF A;  5EE1 A;  4KGR A;  1E0Z A;  2AQ3 B;  2KDM A;  2W3S A;  3V3X A;  1FRD A;  1DOI A;  4IKG A;  4OZA A;  1SE2 A;  2NMQ A;  1GPX A;  5T8I A;  2RDG A;  4REZ A;  3T3N A;  4YWG G;  5BYR A;  1TS5 A;  1FO4 A;  2GRI A;  3EA6 A;  3SFD B;  2GI9 A;  1K52 A;  2NTS A;  3N9Y C;  2KN4 A;  4ZRQ A;  4ZHO A;  4OW0 A;  1PFD A;  3ZJT A;  2IGD A;  3PO0 A;  2ON8 A;  2ONQ A;  5C2T B;  3P4Q B;  1V8C A;  1EU4 A;  1FEH A;  2WQY B;  3BVG A;  4RH6 A;  2IPK D;  3VR8 B;  1DOY A;  3RPF C;  3MHZ A;  1YMH E;  1F2R I;  2SEB D;  3W9C B;  1KLU D;  1TKG A;  1I4P A;  2HDE A;  2JU6 X;  5I4D A;  1K51 A;  3AN1 A;  3IAS 1;  3VRA B;  1L0V B;  3EUB 2;  3E56 A;  3W5U B;  1TY2 A;  1ZE3 D;  2WU5 B;  4YTM B;  3FAH A;  4GLS C;  3MFG A;  1ZP0 B;  1KF6 B;  3OWE B;  3AE8 B;  2WXI A;  1JWB D;  1PUT A;  1SB3 C;  3KQ4 A;  4A6Q A;  5H92 C;  2PLP A;  4L23 A;  1FM0 D;  3AEA B;  3U7Z A;  4US8 A;  3NVW A;  3ZJU A;  2W3R A;  1E10 A;  1SJE D;  1HXY D;  4JWU C;  2DYM A;  3URY A;  1C78 A;  4XWT A;  2N7J A;  1E9M A;  2IDY A;  4IDI A;  3P4S B;  1J7A A;  3AE9 B;  1FXA A;  3BYY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...