3RT3B

Complex of influenza virus protein with host anti-viral factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
WDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKSDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein/viral protein
molecule keywords Ubiquitin-like protein ISG15
publication title Crystal structure of human ISG15 in complex with influenza B virus NS1B
rcsb
source organism Homo sapiens
total genus 36
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rt3B02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rt3B01
1KOTA 3W1SC 1GG3A 2KZRA 1GUAB 2KFKB 2HJ8A 2NCNA 2C7HA 4MSQB 2BYVE 2JPHA 1GNUA 2KFKA 5G55A 4IG7B 4TUUA 1TTNA 3KVFB 1T0YA 1WXMA 3AU4A 3R7RA 1YX5B 3AXCA 3UIPB 2GBKA 3T9LA 3KYCD 4EKUA 3IBEA 2M8SA 4WJNA 1LQBA 4FJVB 4A3OA 3U7DA 4EFOA 3K9OB 2FCMA 4BKGA 4FULA 4G3XB 4DDID 3PGEA 5IAAC 1OGWA 4FJYA 1YIWA 2NPTB 1WGGA 4FLHA 5TR5A 3LJ3A 2LRUA 3VH4B 4KZ0A 5AZFA 3AU5A 4KVGB 4W9HA 1LFDA 2AL6A 1UGMA 2JF5A 4K7UA 4CYEA 2J0KA 2LXAA 1LXDA 1KJTA 4MJSB 4DK5A 1A5RA 4GDLB 4MDKE 3HIZA 4MJSA 3DVGX 4W9KA 1WJ4A 2K6QA 2WX0A 2AEHA 2BF8B 2KN5A 1WGHA 1E8YA 3PRMB 4J6IA 2M4NA 4GIVA 4LJOB 1WFYA 1RLFA 2G4DB 1FXTB 3PVLA 2KHWB 1Q0WB 3B0AA 4DHZE 2UWQA 3N3KB 4WJOA 4DWFA 1WE6A 4G0NB 3VVWB 2L7RA 1UH6A 2LXCA 3VHTC 2M1MA 4FJZA 4HPMB 4DXAB 1I42A 5CTRC 1Z2MA 4BFRA 3TBLD 1IYFA 3KUCB 2DAFA 3RT3B 5CHWA 1WX7A 2DZKA 1WXAA 1KM7A 2KLGA 2IZVB 3C0RB 3NS8A 3ZVVA 4ZRJA 1UBQA 2KTFA 1L2NA 2MSED 4KZCA 4W9FA 1UELA 2N1WA 3T8MA 2MBBB 5EDSA 3VQIA 2V3SA 3A1QA 4JLCA 4KDIC 1E8ZA 5DPRA 4FA6A 2DZJA 2MA9B 2KTRA 2D3GA 3VUYA 3B1LX 4G50A 3V6EB 2KMCA 4IWPA 3TJPA 5JHAA 4MGZE 1WX8A 1WZ0A 3ZO5B 2XEWA 1ISNA 3DDCB 2FIDA 1VCBA 2L00B 3M95A 1LM8B 3QWZB 1UBIA 2ASQA 3HK0A 4M8NA 3SDLC 2D11A 2EMSA 2ZCBA 1WX9A 1YD8U 1WGRA 3ONSA 2NBWB 3L10B 2M0XA 1CMXB 4I6PA 3M62B 4F7ZA 5JZEB 1GJZA 4GB9A 2C60A 1WRDB 3GOEA 1RFAA 3TIXA 2LZ6A 3ZNZB 1P1AA 4I6NB 1EF5A 3SD5A 3RZFA 4BKSD 3ALBA 3UGBB 4E3CA 2J7QB 3QHTA 4F1SA 1WMHB 3VUXA 3R3MA 2DYMA 4HWIB 2KDEB 2HE7A 3L0WB 5BO4B 3APDA 3R7QA 2O2VB 2N9XA 3H1UA 5LXIB 3CMMB 4ZRKA 3RULA 3UQBA 3ZTCA 3WA0A 2K6DB 3A9KB 3TMPB 1XT9B 5L83A 2LASA 3CSTA 1Z5SB 3ZRFA 3A9KA 4YL8A 2D2QA 4K81A 3DBLI 4OVVA 3PSEB 5D2MB 5E6OA 2GMIC 1PQSA 2N9EB 4HXDA 2C7NB 4WJPA 3VTWA 4IWOA 1ZGUB 4NQLB 2VRRB 1WJNA 3W1YA 4AOFA 4B6WA 1WR6E 4ANXA 4PYUA 4JQWC 3A33B 1YX6B 1SIFA 2KWUB 4IM0A 3VAWA 4FN2A 4NQKE 2GOWA 3DVNU 4W9JA 1SGHA 2FAZA 1V49A 5G2NA 3EC8A 3WANA 3ZLZA 2ZZPB 4W9CA 4HVBA 4W9DA 4E74A 3BY4B 3CF6E 1NDDA 4HK2A 1RAXA 3PLVA 2N7EA 3RD2A 4MELA 2NBVB 2KO3A 3PS6A 2ZPNA 4RMAA 4LDTD 4KIKB 1E90A 3ZDTA 4EZKA 4KIKA 3VH3B 3NY5A 4WWNA 4RM9A 2KWVB 1WGDA 5C1ZA 1XQQA 2BKRB 1C1YB 2ZVNA 4HCNB 1C3TA 3OLMD 1V80A 1EUVB 4KV2A 3KYDD 2IY1B 2K1FA 3H6NA 1EF1A 3ECIA 4MM3A 1WH3A 1V2YA 2I1KA 2KC2A 3WIMA 2CS4A 2L8JA 4MH0E 2KVRA 1VD2A 2IYDB 4II3B 4K1RB 4OVUA 1TGZB 2WX1A 3U30A 4B9KA 2KXJA 3NZUA 2DX5B 2WDTB 3DBHI 3WALA 2IO1B 1F9JA 2JUOA 3DBSA 3IHPC 1P9DU 2NR2A 4NNJB 1XD3B 3VTVA 3VTUA 2FCSA 2RPQA 1S3SG 3SHQA 4ANUA 3ML9A 3Q3FA 3RCZA 4K7SA 3X23A 2BWES 2R2QA 1ZW7A 2JRIB 2PJHA 2KDFB 1E7VA 2GBNA 3QQ8B 2PPHA 4PS3A 1HE8A 3DOWA 4FADA 2LJ5A 3JW0X 5FR6A 2ZPYA 3VFKA 2LVPA 3JSVA 3ZTDA 1NI2A 2LD9A 2LGYA 2MBEA 1Y8RC 2KD0A 1TBEA 2R2OA 3PLUA 4TQ0A 5AZGA 4GXBA 4HJKA 4WQOB 1MG8A 4JIOU 4MEMA 3PPAA 2KDIA 3A1QB 1R4MI 1P3QU 2C5LC 2DENB 2KTRB 3IVFA 1IP9A 5L95C 3SU8X 3EHVA 2I1JA 4GMVA 3HM6X 5KHOA 1V81A 4BOSC 2B3AA 5DPSA 4BKSA 5LXHA 3ZNID 4W9IA 4I6LB 2FCNA 2MBOA 1IPGA 2MWSB 3KW5B 1QZEA 3PHXB 4KSKC 4ANWA 2XBBC 2NBUA 1WM3A 2NS5A 3MHSD 4PS8A 5J2RA 2O6VD 5D7GA 4NJ6A 5CHFA 2MRPA 2N9PC 2KOXA 3PRZA 2PE9A 1V9JA 3A4RA 2FNJB 4FHJA 1H8CA 2JRHA 4MSMB 1E5WA 4X57B 2KC1A 2WYQA 3PREA 1GC7A 5GMVA 2PEAA 4EOYA 2G3QB 2JXXA 2YVCA 3UIOB 1SE9A 3DBRI 4JGHB 4LCDE 2W9NA 3JVZX 2N7DA 2BYEA 4MGKE 2RR9A 3L16A 4IM2A 4DHJD 3OJ4B 3BINA 5IA7A 3H9DA 3HM3A 4JL9A 4K7WA 1I35A 1RRBA 2PE6B 3K9PB 3OJ3A 3GZNI 3ZRCA 4URKA 4W9EA 1OEYA 2KX3A 2OOBB 2KANA 3IG3A 4EUTA 1OTRB 4WWPA 3KUDB 2DHZA 1UZXB 2JWZA 4AJWA 5D94A 3JYUA 3D32A 3PTFC 4M8MA 2IY0B 3WAOA 1WJ6A 3NHEB 3CSFA 1WR1A 3DVGY 3M3JA 2K39A 4DBGA 4B95A 4DHZB 3MJWA 3ZNHB 1WE7A 2DZIA 4ICUA 1G6JA 4GU2A 3ZKJC 3UINB 3ENEA 2AL3A 1J8CA 3X0WA 1P98A 2Z59B 4NAWB 3QARA 1J0GA 2L0FA 1ZKHA 3QAQA 4NAWA 3VUWA 2FUHB 3QA8A 4HPLB 4IW0A 2EKEC 2KX0A 3EECA 4F8CB 2MP2B 3W1SA 3MTNB 2LUEA 3OAWA 3O65B 2JT4B 2MP2A 3NOBA 1V6EA 2IBIB 4HDOA 3VXWA 4WWOA 1V5OA 2G4SA 2KDBA 3S2AA 4AUQC 4HLEA 3H7PB 1E8XA 4LJPB 4A20A 5AZHA 3N32A 3H7PA 4NPNA 3UQAA 4GOCA 1WGYA 2JZ3B 2KJHB 3QK0A 4G11A 1WM2A 4ZDVA 2KFJA 3PT2B 3M63B 1M94A 2FCQA 1JRUA 1WZ3A 4IUMB 3A9JB 4BOZB 5KHQA 2IO0B 3ZNGC 2RD0A 2AYOB 2FIFA 3A9JA 4GSWA 4BBNC 3P2BA 3QIJA 2J0JA 1R4NI 2Y5BB 3RYTA 2RSUA 4AJYB 2ZVOA 2CU1A 2UYZB 2LVQA 3PV1A 2WWZA 2MBQA 1E7UA 4TV3A 4NY0A 2CR5A 2KWCA 2ZNVB 2DYOA 5JH5C 4HCPB 2V4LA 3AI5A 4E71A 2KK8A 4II2B 1WF9A 3PZDA 2KKCA 3VDZA 3U8ZA 4ANVA 1WIAA 2NPTA 3PHWB 2C9WB 2ZNVC 1OEYJ 5HKHA 3ZUNA 1J19A 2A5UA 2A4ZA 4XX5A 4EZLA 2MBHA 3QC8B 1P0RA 4ZRIA 5C23A 1Q1OA 4PYZA 4TKNA 2L05A 2QHOA 2EMTA 4MGYE 4ICVA 3ZW3A 4IC7B 5J18A 2LRWA 2K8HA 2CHZA 4GDLA 5E6PA 4ASWC 2O6VB 3JSVB 4CO7A 2LWPA 2IO3B 2HD5B 4XZ4A 2O6VA 3V6CB 3WAPA 3V60A 1EO6A 3I3TB 2C7MB 4GDKB 5J17A 2LGXA 5CX3A 4DDGD 4GDKA 1TZ1A 2BGFA 1WY8A 3AULA 4W9GA 3ZIMA 3DQVA 2J0MA 3DVNV 3NZSA 4IM3A 4CHKA 1KLVA 1H4RA 2CHWA 2BWFA 3KH0A 2L0TA 2KNBA 4AWJA 2V1YA 4DHJB 3R66C 2AWTA 4AP4C 2REXA 4FBJB 1AARA 2LGDA 3UF8A 1BT0A 4EZJA 3TL5A 1GC6A 2YLMA 1UD7A 2MCNB 5AEKB 5JHBA 2MQJA 1WXSA 2LI5A 3L54A 4P7IA 2KQ7A 2OJRA 3PRPB 2BYFA 4GN1A 3RUIB 2K25A 2GBMA 1U4AA 4A3PA 3B08A 5DCNA 3RZWC 2ZJDA 2N1VA 2L76A 2MW5A 3DPDA 2DAJA 3EFUA 2Z0DB 2BKFA 2G45B 5LLIA 2XK5B 2KLCA 2JVCA 2K8CA 2M17A 2XK5A 4FHKA 2D10A 1E8WA 2HTHA 2DZMA 4NJ7A 1D3ZA 3HHMA 1V5TA 4HDQA 3A4SC 1V86A 5CHVC 1WYWB 1WJUA 2D07B 3QCAA 3KUZA 3APFA 1WXVA 5DPWA 4KSLC 2GBRA 3V62A 2RGFA 5DPTA 3QX1A 4WJQA 2Z0EB 3ML8A 2JZZA 3ZDMC 4BBNF 4EEWA 3WAMA 4KDLB 4TQ1A 2ZEQA 1S1QB 4BVUC 3QJZA 4ZYNA 4LDTB 2N4FA 1Q5WB 2KMAA 3APCA 2L3ZA 2CKHB 1L7YA 3N30A 1YQBA 4XC2A 3V61A 2KJ6A 5E6NA 3TCAA 4GGQA 3Q3JA 3L08A 2CHXA 2KQSA 2LVOA 4WAAA 5D6JB 3IFWB 1WMHA 3LDZE 2K8BA 1OQYA 1WI0A 2IO2B 2BPSA 1YJ1A 2GBJA 1NBFC 4RM8A 2O2VA 4PS7A 4N9F4 4BKTA 2JY6A 2NVUI 3L17A 4MGIE 3H7SA 1K8RB 3L13A 4M0WB 2MX2A 2ZCCA 2DYBA 3DCGA 2KJRA 4W9LA 1X1MA 2MLBA 4IWQA
chains in the Genus database with same CATH superfamily
1TS4A 1GUAB 2E6XA 2KFKA 5G55A 1FD6A 3AE2B 2KVZA 1NYRA 1GB4A 3Q14C 1WXMA 3AU4A 1PGXA 1YN4A 3AEDB 3UIPB 2GLSA 3ZJVA 3KYCD 5FK9C 4A3OA 3K9OB 4BKGA 1T0RC 3PGEA 3AE1B 1YIWA 2NPTB 3L4PA 1WGGA 3LJ3A 5AZFA 4KVGB 4W9HA 1UGMA 4K7UA 3BYTB 1LXDA 4MDKE 3PZ7A 1WJ4A 1N60A 2BF8B 2H89B 1FM0D 1TZOA 1E8YA 1IBXB 4GIVA 4LJOB 1SJHD 2KHWB 4DHZE 4DWFA 3VHTC 1UH6A 4DXAB 2IGDA 5CTRC 4MACA 1IYFA 3KUCB 2DAFA 4J3OD 2DZKA 2KLGA 1SB3C 2W82A 1IGCA 1VZ7A 1HTOA 3VQIA 4KDIC 1GPXA 2MHJA 2MA9B 2KTRA 3FC4A 2D3GA 3NJTA 5BYRA 1UUPA 2XEWA 2FIDA 1E0ZA 3M95A 4LK0M 2ASQA 1I4QA 3W5UB 3SDLC 3TEYA 1KF6B 1CMXB 3M62B 2QCZA 5JZEB 3Q3MC 4B0EA 2C60A 1I4RA 2LZ6A 3SD5A 4HJGE 3AB5A 3EA6A 1FXIA 2JQRB 2J7QB 4RH6A 4F1SA 2JYEA 2YEPF 2OEDA 3HRDD 3C19A 1JWBD 3L0WB 5BO4B 1FPYA 2O2VB 5LXIB 3VRAB 3ZTCA 2K6DB 3AEBB 1XT9B 2AQ2B 1JWAD 3ZRFA 1ZE3D 3A9KA 2D2QA 2NTTA 3PSEB 1RM6C 5D2MB 2GMIC 4IWOA 3GZNB 2DWQA 4PYUA 1CJEA 2KWUB 4FN2A 5FR3A 2GOWA 1Y56A 2K9XA 3EC8A 4HVBA 1SF0A 1QOBA 3PLVA 2WXHA 2N7EA 3RD2A 1OQRA 2NBVB 4XGAB 3AMZA 3PS6A 3W5VB 4RMAA 5JXVA 4LDTD 1E90A 1JWUD 1SE4A 4EZKA 1J7AA 4KIKA 4KGSA 3VH3B 3AE5B 4YT0B 1FIQA 2PIAA 5C1ZA 2BKRB 1MG4A 2BTEA 3OG5A 1NENB 1WH3A 1V2YA 2I1KA 3N9YC 2L8JA 3BVZA 1WRIA 4K1RB 4MH0E 4OVUA 2WX1A 3U30A 2K22A 4B9KA 2KXJA 1L6VA 1ZPSA 2PTLA 2HJ1A 3KQ4A 4ARIA 3VTUA 4KKIA 1S3SG 3ML9A 2BWES 2PJHA 1E7VA 2QC8A 4PS3A 1HE8A 2LJ5A 3JW0X 4MH8A 3VFKA 3JSVA 4YTPB 3ZTDA 5BYQA 1Y8RC 1TBEA 4TQ0A 3R2TA 4WQOB 1MG8A 4XE0A 3AM9A 2V3PA 2KDIA 1R4MI 4C7ZA 3P63A 3TEWA 3EHVA 1UNSA 1C79A 3RNGC 1V81A 5DPSA 5IO9A 4BKSA 5LXHA 3PO0A 2MWSB 1MHHE 4ANWA 2NS5A 1R4MB 1A70A 2WP9B 5J2RA 2KOXA 3PRZA 4FHJA 3A4RA 1H8CA 2FNJB 2WXNA 1E5WA 2KC1A 4EOYA 2G3QB 3UIOB 1SE9A 2AQ1B 3DBRI 4JGHB 3JVZX 5EE0A 3H9DA 4K7WA 1I4XA 4ZRPA 1RRBA 2PE6B 3K9PB 3OJ3A 1TY0A 4NJCA 1I4HA 2KX3A 3DBRB 1E10A 4WWPA 1UZXB 5D94A 1T5XD 2LGIA 2Y5CA 3D32A 3PTFC 4M8MA 3WAOA 4DBGA 2WNMA 3I63C 4B95A 4OZAA 3V3XA 1G6JA 2GB1A 3ZKJC 3Q2AC 3X0WA 3U52E 4NAWB 3QAQA 2EKEC 2KX0A 3NG0A 3W1SA 1JCKB 3MTNB 4US9A 3AE9B 1V6EA 3LXFA 2BYTA 3H7PB 4LJPB 3NVVA 3UQAA 4GOCA 1WGYA 3QK0A 4ZDVA 1JRUA 4D2KA 1QILA 3BVMA 1KRHA 1R4NI 2J0JA 2LHEA 3RYTA 4KX6B 2CU1A 2UYZB 3GB1A 2WWZA 3NRZA 1E7UA 4LNKA 2ZNVB 2LFIA 2QMTA 3DWGC 2V4LA 3GE8C 3AI5A 4A9AA 2KKCA 1R4NB 1MJDA 2NPTA 4AQ7A 1OEYJ 3KWVA 2BQQA 3TUOA 3ZUNA 3QC8B 1Q1OA 4TKNA 4ICVA 4IC7B 4A55A 5E6PA 2HD5B 1HZ5A 2O6VA 3WAPA 3V60A 1EO6A 3AE4B 2C7MB 1PGAA 2WDQB 2LGXA 4TSSA 5CX3A 5HG2A 1IBXA 3ZIMA 3DQVA 2IPKD 3DVNV 1K52A 4HKZE 2KNBA 2V1YA 2GI9A 4DHJB 3R66C 2AWTA 3MC0B 4AP4C 3TL5A 1XLQA 5C2TB 5JHBA 2KQ7A 2BYFA 4GN1A 1AN8A 3RUIB 1U4AA 3B08A 5DCNA 1T0QC 2ZJDA 1FCCC 2DAJA 2K5PA 3MFGA 1WSPA 2WU2B 1EWCA 2D3AA 2KLCA 2JVCA 1T6BX 2L83A 1WJUA 4L2YA 4RCOA 3VR9B 3QX1A 4WJQA 3ZDMC 2JZZA 5MPOA 4RGMA 1IUEA 1S1QB 2Y3AA 3MC9A 4BVUC 2KMAA 1HEZE 1L7YA 2ON8A 5E6NA 4ITKA 3Q3JA 1RYJA 2CHXA 2KQSA 3IFWB 2GBJA 3RFZB 2WXRA 2O2VA 3NZ3A 1YJIA 2M56B 2JY6A 3L17A 4H2AA 1K8RB 3L13A 2ZCCA 2K3UA 2PKOA 1HTQA 2MEKA 2KJRA 1C76A 1X1MA 2MLBA 1GG3A 1I7HA 2C7HA 1GNUA 1MFWA 3R7RA 1YX5B 3AXCA 1KFYB 3IBEA 2M8SA 5LNK1 4EFOA 5IAAC 2OHFA 5TR5A 1YQ4B 3P4QB 3AN1A 1LFDA 3FILB 1A5RA 1DYQA 4MJSA 4P16A 4KGTA 2K6QA 2KN5A 2Z8LA 4UDUC 1N61A 2M4NA 3PVLA 4WJOA 3IAS1 2M1MA 4HPMB 5E6JA 1SE2A 2N7JA 4BFRA 2CJNA 2PLPA 5BYSA 3RMKC 3C0RB 4HROA 1UBQA 2V0GA 2MSED 2IDYA 1F0ZA 2N1WA 4RF1A 2MBBB 5EDSA 3I57A 3B2GA 1XLNA 4FA6A 4L1BA 3B1LX 4G50A 1YN5A 1XO3A 3V6EB 1GB1A 4MGZE 2WXIA 4B0MA 2D3CA 1TS3A 1OFFA 3ZO5B 3DDCB 1VCBA 1LM8B 3QWZB 4M8NA 2EMSA 2ZCBA 2ZW1A 1WX9A 1YD8U 2WDVB 4P6VF 2NBWB 2M0XA 1QQRA 2G9HD 1WRDB 3GOEA 3ZNZB 1EF5A 3SFDB 3RZFA 4BKSD 3QHTA 1WMHB 1AYFA 5H92C 2KDEB 2JYTA 3APDA 4C4VA 2N0SB 3LYYA 4C56C 2LASA 1Z5SB 2W55A 4K81A 3DBLI 4OVVA 5E6OA 3VTWA 4WJPA 5D3IB 1HZ6A 1ZGUB 1WJNA 4AOFA 4B6WA 1WR6E 3CIRB 1SIFA 1B1ZA 4IM0A 4NQKE 1TS2A 3DVNU 5G2NA 1SGHA 3DBLB 3AEGB 3ZLZA 4KKJA 3BIID 4E74A 1NDDA 3AECB 4MELA 3UI3A 2KO3A 2KQ4X 1MHXA 3IT4B 3ZDTA 4WWNA 2N9KA 4RM9A 4A8XC 4Q2JA 1C1YB 2ZVNA 1C3TA 3OLMD 1V80A 3BYYB 3KYDD 2IY1B 2K1FA 1JWMD 3H6NA 1L0YB 4MM3B 3VR8B 3WCQA 1MI0A 4NZLB 1LGRA 1STEA 1VDVA 2LEKA 3U7ZA 1L5PA 1VD2A 2IYDB 4DXGA 2BS2B 1TGZB 2WDTB 5T8IA 2JUOA 4WAFA 2BVCA 2NR2A 1XD3B 3VTVA 1SBBB 1NYQA 2FCSA 3SHQA 4ZHOA 3Q3FA 3RCZA 2R2QA 1QT9A 2JRIB 3RN9C 2WXMA 2PPHA 4FADA 3KWLA 1NI2A 2KD0A 2WXOA 1DOYA 2VZKB 1C4CA 1TT5B 4JIOU 4AS1A 4MEMA 2BT6A 1P3QU 2DENB 4GMVA 3HM6X 1I4PA 3ETRA 4BOSC 3TSSA 4I6LB 2FCNA 3PHXB 3MHSD 1WM3A 2QEJC 3CWIA 2O6VD 3AV8A 5HI1A 2N9PC 2EELA 3IT6B 1SSNA 4LNNA 4X57B 1UGJA 1GC7A 2PEAA 1LO5D 3GP7A 4LCDE 3H8HA 4MGKE 2RR9A 4IM2A 4JL9A 1TS5A 2WS3B 5BMIA 3GZNI 2L32A 3ZRCA 4ZHPA 4OW0A 4W9EA 4URKA 3O13A 4EUTA 3KUDB 2HDEA 2DHZA 2JWZA 4AJWA 2JX5A 3JYUA 1TIFA 2XN9C 3ZXRA 2IY0B 1WJ6A 3M3JA 2K39A 3ZNHB 4YTNB 4GU2A 3U2SC 2AL3A 1PYWD 3RNAC 4XWTA 2Z59B 3V05A 3QARA 1J0GA 2L0FA 3AE6B 2INPE 2FUHB 4F8CB 2LUEA 2MP2A 3NOBA 2LMCA 3VXWA 4WWOA 2KDBA 4A20A 5AZHA 1QKZA 2KJHB 1WM2A 4ZYSA 1K53A 1YJJA 3A9JB 2G1EA 5KHQA 3ZNGC 1FFVA 2RD0A 4BBNC 3P2BA 2RSUA 3FKYA 4AJYB 3PV1A 4ARCA 4TV3A 4CQNA 3NUHB 2DYOA 2EKIA 5IP4D 4QAYA 3I5JC 3VDZA 1N62A 3U8ZA 1WIAA 2L52A 5HKHA 1J19A 4XX5A 2MBHA 1P0RA 3ZQ4A 3FILA 4PYZA 2L05A 4C00A 1XXGA 4ASWC 2CHZA 1HXYD 3V6CB 4GDKB 1L0VB 2BGFA 3AULA 2DBYA 2K0PA 4YSZB 3NZSA 1ZDVA 4IM3A 4N59A 1KLVA 2CHWA 2BWFA 4FBJB 1FO4A 2BS4B 2LGSA 2KMMA 2LGDA 4WURA 5AEKB 1WXSA 2K25A 2GBMA 1ZDXA 1E9MA 3RZWC 4YTMB 1FRDA 2BKFA 5LLIA 2M17A 1VZ8A 4NJ7A 2XK5A 3HHMA 1V5TA 3A4SC 3PZ8A 5CHVC 1SJED 1WYWB 1ESFA 1JALA 2QIEB 3QCAA 2JXTA 4JWUC 2KWDA 5H8YE 5DPTA 2Z0EB 4EEWA 4TQ1A 2ZEQA 2QDFA 2BS3B 2N4FA 1Q5WB 3V61A 1JW9D 2KJ6A 4YSYB 2LVOA 2INNE 1WMHA 2K8BA 3B2FA 1NBFC 2JZPA 3HVZA 3SEBA 4M0WB 4ACFA 2MX2A 1JROA 1KOTA 5AUIA 2KFKB 4MSQB 2JPHA 4IG7B 1TTNA 3KVFB 2FE8A 3NVZA 2GBKA 3T3NA 1PGBA 3T9LA 1PFDA 3AEAB 4EKUA 4WJNA 2PW9A 4FJVB 5HFYA 4C7YA 3SFEB 2FCMA 4FULA 1NI3A 4G3XB 1FCLA 3P4SB 4FJYA 4OVZA 1PUTA 3AU5A 1QOGA 2AL6A 1IGDA 1V97A 3LB8C 2JF5A 2PVOD 2LXAA 2RDGA 1D5ZC 4GDLB 4KGRA 4W9KA 2AEHA 2KYWA 3MJ5A 5I4DA 4J6IA 5GXGB 1RLFA 1FXTB 2UWQA 3N3KB 4YXDB 4G0NB 1YN3A 2L7RA 3RNCC 1I42A 3B9JA 3TBLD 4HEA1 4XWWA 5CHWA 1WXAA 1KM7A 2IZVB 1B9RA 1CZPA 3NS8A 3ZVVA 4ZRJA 1L2NA 3T3OA 4NAMA 4JLCA 5DPRA 2DZJA 2KMCA 4GLSC 3TJPA 1WZ0A 1F52A 1C9FA 2L00B 3Q3OC 1QOAA 1UBIA 3R8BA 5D3DA 4LLGM 1N5XA 3ONSA 3Q8FA 2VH2A 1ZUD2 3AE3B 3FAHA 4I6PA 4F7ZA 1GJZA 4GB9A 2WLBA 1RFAA 1MPEA 2SAKA 1K51A 1ACCA 3ALBA 3N1ZC 3UGBB 4E3CA 2QJLA 3VUXA 3R3MA 4US8A 3TEZA 4ZRKA 3RULA 3UQBA 1RWSA 3WA0A 3A9KB 5L83A 3CSTA 1V1OA 2C7NB 3BVGA 3NS1A 4NQLB 2VRRB 3EUB2 3IAM1 3W1YA 4ANXA 3A33B 4JX1C 3AE8B 2ZZPB 4W9CA 3CF6E 1D4BA 2ZPNA 3Q6BA 4KIKB 2WQYB 1DOIA 4O1NA 1XQQA 4ZOHC 4HCNB 2BBCA 2WXGA 3RNBC 4KV2A 2ACZB 3ECIA 2RPVA 1SIJA 4LTUA 2KC2A 3SR6A 2KVRA 4II3B 4N58A 1VRAB 3DBHI 3WALA 3DBSA 1P9DU 4WH4A 2RPQA 4ANUA 4XYCA 4K7SA 1EU4A 3AE7B 3DBHB 3DOWA 1C77A 2W54A 1VR9A 2LVPA 2KN4A 2LD9A 2LGYA 2MBEA 1V8CA 1L6UA 5AZGA 4HJKA 4A90A 1MVKA 4BZAA 3PPAA 3DWMA 4HRSA 3A1QB 2AX5A 2C5LC 2WXQA 2J42A 3SU8X 2I1JA 5KHOA 3ZNID 4W9IA 2CU3A 2MBOA 4IKGA 2XBBC 2NBUA 5EE1A 1SEBD 4LNFA 5D7GA 1F2RC 4NJ6A 5CHFA 2MRPA 3R2IA 2JRHA 2R61A 2LHDA 3P4RB 3PREA 1DGJA 5GMVA 2JXXA 2YVCA 2KDMA 5BMHA 1YNTE 2W9NA 1QOFA 2BYEA 2INCC 3OJ4B 1F77A 1ENFA 3MC8A 2XNAC 1FEHA 4YWGG 2WXPA 2ONQA 1HA5A 4M01A 2OOBB 2KANA 4XDDA 2ICIA 1OTRB 3MHZA 3E56A 1QF6A 2J52A 2GRIA 4S17A 3CSFA 3DVGY 4DHZB 3MJWA 1WE7A 2DZIA 1C4AA 1J8CA 1JRPA 3Q8BA 1P98A 1ZKHA 4NAWA 4IW0A 4C80A 1P7EA 3EECA 2BB6A 3OAWA 3O65B 2IBIB 4HLEA 2G4SA 4AUQC 3AH7A 3N32A 3H7PA 4LNIA 1WGKA 2KFJA 3PT2B 1M94A 2FCQA 3BWUD 3E9SA 4OZCA 3AEFB 2AYOB 3QIJA 1N6ZA 3Q3NC 2KAJA 2ZVOA 2YEPB 1XLPA 4JPSA 1R7SA 2MBQA 1VZ6A 2QILA 3URYA 4NY0A 5JH5C 4HCPB 4II2B 3PZDA 4RGOS 1FNUA 3P4PB 4PK1A 3ABVB 3PHWB 3RI7C 2C9WB 2WHIA 4BAXA 1FNVA 4ZRIA 1EU3A 5C23A 2B76B 2ZW0A 1NVID 4MGYE 3ZW3A 1FRRA 5J18A 4GDLA 2O6VB 4CO7A 2LWPA 2IO3B 1XLOA 4XZ4A 2NTSA 1RFKA 1XCTL 2WXKA 3ZYYX 4DDGD 2DLBA 1EM7A 2D5GA 1N5WA 1H4RA 3KH0A 2L0TA 4P1BC 1ZXHA 2REXA 3HUIA 3UF8A 1GC6A 2YLMA 1UD7A 3DHGC 2MCNB 1T3QA 2LI5A 4DQOC 3PRPB 3RNFC 1FFUA 4A3PA 3GS2A 2N1VA 2V9HA 2L76A 2MW5A 3EFUA 2Z0DB 3RPFC 2BB5A 3I9V1 5AUKA 1D3ZA 2D10A 1E8WA 1V86A 1WXVA 5DPWA 4KSLC 2GBRA 3V62A 2RGFA 2BW2A 2VZKD 1WYGA 4BBNF 3WAMA 1FNWA 1SE3A 3QJZA 4LDTB 2I38A 3APCA 2L3ZA 2CKHB 3N30A 2IGGA 3ZJTA 3L08A 4WAAA 2M0AA 1OQYA 1WI0A 1E6EB 2IO2B 4HPPA 1YJ1A 4RM8A 4N9F4 4BKTA 4K3CA 3P42A 3DCGA 4W9LA 4IWQA 3W1SC 2KZRA 2LJIA 2HJ8A 3BZDB 2NCNA 3ZXVA 2BYVE 4TUUA 1T0YA 3GE3C 3BK2A 1BXTA 2WU5B 5EE3A 1J7BA 1J7CA 1LQBA 3U7DA 1ET9A 3Q8EA 4DDID 1OGWA 1KLGD 1VJKA 4FLHA 2LRUA 3VH4B 4KZ0A 1P7FA 4CYEA 2J0KA 5FKAC 1KJTA 4MJSB 4DK5A 3HIZA 3Q8CA 3DVGX 2L1AA 3MP9A 2WX0A 2MJDA 4TMAB 4OHJA 1WGHA 3PRMB 2CJOA 1WFYA 2G4DB 1QLBB 3B0AA 1Q0WB 1WE6A 1JWSD 3VVWB 2LXCA 4FJZA 2LUMA 1Z2MA 2V3NA 4RFBA 3RT3B 4M00A 4K3BA 1JQ4A 1WX7A 4HKQA 2J53A 2KTFA 4KZCA 1YOVB 1N63A 4W9FA 1V1PB 1UELA 3T8MA 2W3SA 2V3SA 3A1QA 4FXCA 2J4XA 2AQ3B 1E8ZA 3U4EG 3VUYA 3P1MA 2QSDA 4IWPA 5JHAA 2W3RA 1WX8A 1CQVA 1ISNA 3VRBB 3HK0A 2D11A 1WGRA 3L10B 3N1XC 4A6QA 2FUG1 3TIXA 1P1AA 2Q5WD 4I6NB 1YMHE 1BMLC 2OJWA 4WIPA 1I4GA 1Q10A 2UU7A 2DYMA 4HWIB 2HE7A 2MH7A 3R7QA 1GOZA 1PDXA 4C4VB 2N9XA 3H1UA 1YQ3B 3CMMB 4IOIE 2PVGC 4M02A 3TMPB 5G5HA 4YL8A 1BUIC 3EFCA 1PQSA 2N9EB 4HXDA 3N1YC 4JQWC 1YX6B 3VAWA 4W9JA 3WANA 2FAZA 1V49A 3ZGZA 1FXAA 4W9DA 3BY4B 3KLSX 4HK2A 3IXSA 1RAXA 2Y5PA 3W2DA 4ZRQA 2RMMA 4YSXB 2FBWB 3NY5A 2KWVB 1WGDA 2JSVX 1ROEA 1KH0A 2JWUA 1EUVB 2NMQA 5IKCM 1EF1A 4MM3A 2HTME 3WIMA 2CS4A 3NVYA 5G5GA 3NZUA 2DX5B 1JMLA 1L0XB 2IO1B 1F9JA 3IHPC 4NNJB 1AWDA 1L4DB 3N20C 3X23A 2MJEA 2JU6X 1ZW7A 2KDFB 2GBNA 3QQ8B 1M4VA 5FR6A 2ZPYA 4JWSC 2R2OA 3PLUA 1F2RI 4GXBA 4REZA 3Q69A 1TKYA 3RNEC 4EE2A 2RDHA 1F1HA 1IP9A 2KTRB 3IVFA 5L95C 5BMGA 2RDBC 4USAA 2B3AA 1HQRD 1IPGA 3KW5B 1QZEA 4KSKC 1D5XC 4PS8A 4RGNA 2X38A 1GAQB 3OWEB 2KT7A 2PE9A 1V9JA 4MSMB 4PT5A 2WYQA 2IGHA 3TEXA 2IJ0A 4RF0A 4RNAA 1SXTA 1TKEA 2N7DA 3L16A 4DHJD 2I2YA 2WXFA 3BINA 5IA7A 3HM3A 1I35A 2E3TA 4DXFA 3NVWA 3ZJUA 5TSSA 1OEYA 3IG3A 2KACA 4RGTA 1NEKB 1TYGB 2WDRB 2H88B 3NHEB 1WR1A 3BK1A 5EE9A 2INDC 4ICUA 3UINB 3ENEA 1ZXIA 2V4IB 3VUWA 3QA8A 4HPLB 2MP2B 4JE3B 2JT4B 4HDOA 1D5MC 1TY2A 1V5OA 1WXQA 3S2AA 1CK1A 1E8XA 1EWYC 4NPNA 1UF0A 1T0SC 2JZ3B 4G11A 4L23A 3M63B 1WZ3A 4IUMB 4BOZB 1L4ZB 2IO0B 4GSWA 2FIFA 1ZP0B 3A9JA 2Y5BB 3EGRA 2LVQA 4N6EB 1UWXA 2CR5A 2KWCA 3DHHC 4E71A 2KK8A 1WF9A 2X8XX 4ANVA 2ZNVC 1ET6A 2A4ZA 2A5UA 4EZLA 2VH1A 4IDIA 1E7PB 4WWMA 2WXJA 3HVDA 2QHOA 2EMTA 1K50A 2LRWA 2K8HA 1TKGA 3JSVB 3DHIC 2DNFA 2MJ3A 2WXLA 3I3TB 5J17A 3C8YA 4GDKA 1ZOYB 1TZ1A 1TJEA 1WY8A 4W9GA 2J0MA 1XEEA 4CHKA 1DOXA 4XDCA 1AW7A 3AEEB 4AWJA 1AARA 1BT0A 2TSSA 4EZJA 2MQJA 2SEBD 2WGSA 3L54A 4P7IA 2OJRA 4S0RA 1D6EC 1V1PA 3DPDA 3W9CB 1C78A 4WQMA 5IN7A 2G45B 3Q8AA 2XK5B 2K8CA 4FHKA 2HTHA 2DZMA 2M19A 4HDQA 2D07B 1KTKA 3KUZA 4OZBA 2D3BA 3APFA 4R3DA 5HHDG 1KLUD 4P1CC 3ML8A 1OQQA 4MT5A 4KDLB 4ZYNA 3J9CA 1C4PA 1XF5L 4LNOA 2N9LA 1FMAD 1YQBA 4XC2A 3TCAA 4GGQA 5D6JB 3LDZE 1WWTA 1UWMA 5IOIA 2BPSA 4PS7A 2PMVA 2NVUI 4MGIE 3H7SA 1VLBA 1XCQL 2DYBA 4M0WA 5C3JB
chains in the Genus database with same CATH topology
1KOTA 3W1SC 1GG3A 2KZRA 1GUAB 2KFKB 2HJ8A 2NCNA 2C7HA 4MSQB 2BYVE 2JPHA 1GNUA 2KFKA 5G55A 4IG7B 4TUUA 1TTNA 3KVFB 1T0YA 1WXMA 3AU4A 3R7RA 1YX5B 3AXCA 3UIPB 2GBKA 3T9LA 3KYCD 4EKUA 3IBEA 2M8SA 4WJNA 1LQBA 4FJVB 4A3OA 3U7DA 4EFOA 3K9OB 2FCMA 4BKGA 4FULA 4G3XB 4DDID 3PGEA 5IAAC 1OGWA 4FJYA 1YIWA 2NPTB 1WGGA 4FLHA 5TR5A 3LJ3A 2LRUA 3VH4B 4KZ0A 5AZFA 3AU5A 4KVGB 4W9HA 1LFDA 2AL6A 1UGMA 2JF5A 4K7UA 4CYEA 2J0KA 2LXAA 1LXDA 1KJTA 4MJSB 4DK5A 1A5RA 4GDLB 4MDKE 3HIZA 4MJSA 3DVGX 4W9KA 1WJ4A 2K6QA 2WX0A 2AEHA 2BF8B 2KN5A 1WGHA 1E8YA 3PRMB 4J6IA 2M4NA 4GIVA 4LJOB 1WFYA 1RLFA 2G4DB 1FXTB 3PVLA 2KHWB 1Q0WB 3B0AA 4DHZE 2UWQA 3N3KB 4WJOA 4DWFA 1WE6A 4G0NB 3VVWB 2L7RA 1UH6A 2LXCA 3VHTC 2M1MA 4FJZA 4HPMB 4DXAB 1I42A 5CTRC 1Z2MA 4BFRA 3TBLD 1IYFA 3KUCB 2DAFA 3RT3B 5CHWA 1WX7A 2DZKA 1WXAA 1KM7A 2KLGA 2IZVB 3C0RB 3NS8A 3ZVVA 4ZRJA 1UBQA 2KTFA 1L2NA 2MSED 4KZCA 4W9FA 1UELA 2N1WA 3T8MA 2MBBB 5EDSA 3VQIA 2V3SA 3A1QA 4JLCA 4KDIC 1E8ZA 5DPRA 4FA6A 2DZJA 2MA9B 2KTRA 2D3GA 3VUYA 3B1LX 4G50A 3V6EB 2KMCA 4IWPA 3TJPA 5JHAA 4MGZE 1WX8A 1WZ0A 3ZO5B 2XEWA 1ISNA 3DDCB 2FIDA 1VCBA 2L00B 3M95A 1LM8B 3QWZB 1UBIA 2ASQA 3HK0A 4M8NA 3SDLC 2D11A 2EMSA 2ZCBA 1WX9A 1YD8U 1WGRA 3ONSA 2NBWB 3L10B 2M0XA 1CMXB 4I6PA 3M62B 4F7ZA 5JZEB 1GJZA 4GB9A 2C60A 1WRDB 3GOEA 1RFAA 3TIXA 2LZ6A 3ZNZB 1P1AA 4I6NB 1EF5A 3SD5A 3RZFA 4BKSD 3ALBA 3UGBB 4E3CA 2J7QB 3QHTA 4F1SA 1WMHB 3VUXA 3R3MA 2DYMA 4HWIB 2KDEB 2HE7A 3L0WB 5BO4B 3APDA 3R7QA 2O2VB 2N9XA 3H1UA 5LXIB 3CMMB 4ZRKA 3RULA 3UQBA 3ZTCA 3WA0A 2K6DB 3A9KB 3TMPB 1XT9B 5L83A 2LASA 3CSTA 1Z5SB 3ZRFA 3A9KA 4YL8A 2D2QA 4K81A 3DBLI 4OVVA 3PSEB 5D2MB 5E6OA 2GMIC 1PQSA 2N9EB 4HXDA 2C7NB 4WJPA 3VTWA 4IWOA 1ZGUB 4NQLB 2VRRB 1WJNA 3W1YA 4AOFA 4B6WA 1WR6E 4ANXA 4PYUA 4JQWC 3A33B 1YX6B 1SIFA 2KWUB 4IM0A 3VAWA 4FN2A 4NQKE 2GOWA 3DVNU 4W9JA 1SGHA 2FAZA 1V49A 5G2NA 3EC8A 3WANA 3ZLZA 2ZZPB 4W9CA 4HVBA 4W9DA 4E74A 3BY4B 3CF6E 1NDDA 4HK2A 1RAXA 3PLVA 2N7EA 3RD2A 4MELA 2NBVB 2KO3A 3PS6A 2ZPNA 4RMAA 4LDTD 4KIKB 1E90A 3ZDTA 4EZKA 4KIKA 3VH3B 3NY5A 4WWNA 4RM9A 2KWVB 1WGDA 5C1ZA 1XQQA 2BKRB 1C1YB 2ZVNA 4HCNB 1C3TA 3OLMD 1V80A 1EUVB 4KV2A 3KYDD 2IY1B 2K1FA 3H6NA 1EF1A 3ECIA 4MM3A 1WH3A 1V2YA 2I1KA 2KC2A 3WIMA 2CS4A 2L8JA 4MH0E 2KVRA 1VD2A 2IYDB 4II3B 4K1RB 4OVUA 1TGZB 2WX1A 3U30A 4B9KA 2KXJA 3NZUA 2DX5B 2WDTB 3DBHI 3WALA 2IO1B 1F9JA 2JUOA 3DBSA 3IHPC 1P9DU 2NR2A 4NNJB 1XD3B 3VTVA 3VTUA 2FCSA 2RPQA 1S3SG 3SHQA 4ANUA 3ML9A 3Q3FA 3RCZA 4K7SA 3X23A 2BWES 2R2QA 1ZW7A 2JRIB 2PJHA 2KDFB 1E7VA 2GBNA 3QQ8B 2PPHA 4PS3A 1HE8A 3DOWA 4FADA 2LJ5A 3JW0X 5FR6A 2ZPYA 3VFKA 2LVPA 3JSVA 3ZTDA 1NI2A 2LD9A 2LGYA 2MBEA 1Y8RC 2KD0A 1TBEA 2R2OA 3PLUA 4TQ0A 5AZGA 4GXBA 4HJKA 4WQOB 1MG8A 4JIOU 4MEMA 3PPAA 2KDIA 3A1QB 1R4MI 1P3QU 2C5LC 2DENB 2KTRB 3IVFA 1IP9A 5L95C 3SU8X 3EHVA 2I1JA 4GMVA 3HM6X 5KHOA 1V81A 4BOSC 2B3AA 5DPSA 4BKSA 5LXHA 3ZNID 4W9IA 4I6LB 2FCNA 2MBOA 1IPGA 2MWSB 3KW5B 1QZEA 3PHXB 4KSKC 4ANWA 2XBBC 2NBUA 1WM3A 2NS5A 3MHSD 4PS8A 5J2RA 2O6VD 5D7GA 4NJ6A 5CHFA 2MRPA 2N9PC 2KOXA 3PRZA 2PE9A 1V9JA 3A4RA 2FNJB 4FHJA 1H8CA 2JRHA 4MSMB 1E5WA 4X57B 2KC1A 2WYQA 3PREA 1GC7A 5GMVA 2PEAA 4EOYA 2G3QB 2JXXA 2YVCA 3UIOB 1SE9A 3DBRI 4JGHB 4LCDE 2W9NA 3JVZX 2N7DA 2BYEA 4MGKE 2RR9A 3L16A 4IM2A 4DHJD 3OJ4B 3BINA 5IA7A 3H9DA 3HM3A 4JL9A 4K7WA 1I35A 1RRBA 2PE6B 3K9PB 3OJ3A 3GZNI 3ZRCA 4URKA 4W9EA 1OEYA 2KX3A 2OOBB 2KANA 3IG3A 4EUTA 1OTRB 4WWPA 3KUDB 2DHZA 1UZXB 2JWZA 4AJWA 5D94A 3JYUA 3D32A 3PTFC 4M8MA 2IY0B 3WAOA 1WJ6A 3NHEB 3CSFA 1WR1A 3DVGY 3M3JA 2K39A 4DBGA 4B95A 4DHZB 3MJWA 3ZNHB 1WE7A 2DZIA 4ICUA 1G6JA 4GU2A 3ZKJC 3UINB 3ENEA 2AL3A 1J8CA 3X0WA 1P98A 2Z59B 4NAWB 3QARA 1J0GA 2L0FA 1ZKHA 3QAQA 4NAWA 3VUWA 2FUHB 3QA8A 4HPLB 4IW0A 2EKEC 2KX0A 3EECA 4F8CB 2MP2B 3W1SA 3MTNB 2LUEA 3OAWA 3O65B 2JT4B 2MP2A 3NOBA 1V6EA 2IBIB 4HDOA 3VXWA 4WWOA 1V5OA 2G4SA 2KDBA 3S2AA 4AUQC 4HLEA 3H7PB 1E8XA 4LJPB 4A20A 5AZHA 3N32A 3H7PA 4NPNA 3UQAA 4GOCA 1WGYA 2JZ3B 2KJHB 3QK0A 4G11A 1WM2A 4ZDVA 2KFJA 3PT2B 3M63B 1M94A 2FCQA 1JRUA 1WZ3A 4IUMB 3A9JB 4BOZB 5KHQA 2IO0B 3ZNGC 2RD0A 2AYOB 2FIFA 3A9JA 4GSWA 4BBNC 3P2BA 3QIJA 2J0JA 1R4NI 2Y5BB 3RYTA 2RSUA 4AJYB 2ZVOA 2CU1A 2UYZB 2LVQA 3PV1A 2WWZA 2MBQA 1E7UA 4TV3A 4NY0A 2CR5A 2KWCA 2ZNVB 2DYOA 5JH5C 4HCPB 2V4LA 3AI5A 4E71A 2KK8A 4II2B 1WF9A 3PZDA 2KKCA 3VDZA 3U8ZA 4ANVA 1WIAA 2NPTA 3PHWB 2C9WB 2ZNVC 1OEYJ 5HKHA 3ZUNA 1J19A 2A5UA 2A4ZA 4XX5A 4EZLA 2MBHA 3QC8B 1P0RA 4ZRIA 5C23A 1Q1OA 4PYZA 4TKNA 2L05A 2QHOA 2EMTA 4MGYE 4ICVA 3ZW3A 4IC7B 5J18A 2LRWA 2K8HA 2CHZA 4GDLA 5E6PA 4ASWC 2O6VB 3JSVB 4CO7A 2LWPA 2IO3B 2HD5B 4XZ4A 2O6VA 3V6CB 3WAPA 3V60A 1EO6A 3I3TB 2C7MB 4GDKB 5J17A 2LGXA 5CX3A 4DDGD 4GDKA 1TZ1A 2BGFA 1WY8A 3AULA 4W9GA 3ZIMA 3DQVA 2J0MA 3DVNV 3NZSA 4IM3A 4CHKA 1KLVA 1H4RA 2CHWA 2BWFA 3KH0A 2L0TA 2KNBA 4AWJA 2V1YA 4DHJB 3R66C 2AWTA 4AP4C 2REXA 4FBJB 1AARA 2LGDA 3UF8A 1BT0A 4EZJA 3TL5A 1GC6A 2YLMA 1UD7A 2MCNB 5AEKB 5JHBA 2MQJA 1WXSA 2LI5A 3L54A 4P7IA 2KQ7A 2OJRA 3PRPB 2BYFA 4GN1A 3RUIB 2K25A 2GBMA 1U4AA 4A3PA 3B08A 5DCNA 3RZWC 2ZJDA 2N1VA 2L76A 2MW5A 3DPDA 2DAJA 3EFUA 2Z0DB 2BKFA 2G45B 5LLIA 2XK5B 2KLCA 2JVCA 2K8CA 2M17A 2XK5A 4FHKA 2D10A 1E8WA 2HTHA 2DZMA 4NJ7A 1D3ZA 3HHMA 1V5TA 4HDQA 3A4SC 1V86A 5CHVC 1WYWB 1WJUA 2D07B 3QCAA 3KUZA 3APFA 1WXVA 5DPWA 4KSLC 2GBRA 3V62A 2RGFA 5DPTA 3QX1A 4WJQA 2Z0EB 3ML8A 2JZZA 3ZDMC 4BBNF 4EEWA 3WAMA 4KDLB 4TQ1A 2ZEQA 1S1QB 4BVUC 3QJZA 4ZYNA 4LDTB 2N4FA 1Q5WB 2KMAA 3APCA 2L3ZA 2CKHB 1L7YA 3N30A 1YQBA 4XC2A 3V61A 2KJ6A 5E6NA 3TCAA 4GGQA 3Q3JA 3L08A 2CHXA 2KQSA 2LVOA 4WAAA 5D6JB 3IFWB 1WMHA 3LDZE 2K8BA 1OQYA 1WI0A 2IO2B 2BPSA 1YJ1A 2GBJA 1NBFC 4RM8A 2O2VA 4PS7A 4N9F4 4BKTA 2JY6A 2NVUI 3L17A 4MGIE 3H7SA 1K8RB 3L13A 4M0WB 2MX2A 2ZCCA 2DYBA 3DCGA 2KJRA 4W9LA 1X1MA 2MLBA 4IWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KOT A;  3W1S C;  1GG3 A;  2KZR A;  1GUA B;  2KFK B;  2HJ8 A;  2NCN A;  2C7H A;  4MSQ B;  2BYV E;  2JPH A;  1GNU A;  2KFK A;  5G55 A;  4IG7 B;  4TUU A;  1TTN A;  3KVF B;  1T0Y A;  1WXM A;  3AU4 A;  3R7R A;  1YX5 B;  3AXC A;  3UIP B;  2GBK A;  3T9L A;  3KYC D;  4EKU A;  3IBE A;  2M8S A;  4WJN A;  1LQB A;  4FJV B;  4A3O A;  3U7D A;  4EFO A;  3K9O B;  2FCM A;  4BKG A;  4FUL A;  4G3X B;  4DDI D;  3PGE A;  5IAA C;  1OGW A;  4FJY A;  1YIW A;  2NPT B;  1WGG A;  4FLH A;  5TR5 A;  3LJ3 A;  2LRU A;  3VH4 B;  4KZ0 A;  5AZF A;  3AU5 A;  4KVG B;  4W9H A;  1LFD A;  2AL6 A;  1UGM A;  2JF5 A;  4K7U A;  4CYE A;  2J0K A;  2LXA A;  1LXD A;  1KJT A;  4MJS B;  4DK5 A;  1A5R A;  4GDL B;  4MDK E;  3HIZ A;  4MJS A;  3DVG X;  4W9K A;  1WJ4 A;  2K6Q A;  2WX0 A;  2AEH A;  2BF8 B;  2KN5 A;  1WGH A;  1E8Y A;  3PRM B;  4J6I A;  2M4N A;  4GIV A;  4LJO B;  1WFY A;  1RLF A;  2G4D B;  1FXT B;  3PVL A;  2KHW B;  1Q0W B;  3B0A A;  4DHZ E;  2UWQ A;  3N3K B;  4WJO A;  4DWF A;  1WE6 A;  4G0N B;  3VVW B;  2L7R A;  1UH6 A;  2LXC A;  3VHT C;  2M1M A;  4FJZ A;  4HPM B;  4DXA B;  1I42 A;  5CTR C;  1Z2M A;  4BFR A;  3TBL D;  1IYF A;  3KUC B;  2DAF A;  3RT3 B;  5CHW A;  1WX7 A;  2DZK A;  1WXA A;  1KM7 A;  2KLG A;  2IZV B;  3C0R B;  3NS8 A;  3ZVV A;  4ZRJ A;  1UBQ A;  2KTF A;  1L2N A;  2MSE D;  4KZC A;  4W9F A;  1UEL A;  2N1W A;  3T8M A;  2MBB B;  5EDS A;  3VQI A;  2V3S A;  3A1Q A;  4JLC A;  4KDI C;  1E8Z A;  5DPR A;  4FA6 A;  2DZJ A;  2MA9 B;  2KTR A;  2D3G A;  3VUY A;  3B1L X;  4G50 A;  3V6E B;  2KMC A;  4IWP A;  3TJP A;  5JHA A;  4MGZ E;  1WX8 A;  1WZ0 A;  3ZO5 B;  2XEW A;  1ISN A;  3DDC B;  2FID A;  1VCB A;  2L00 B;  3M95 A;  1LM8 B;  3QWZ B;  1UBI A;  2ASQ A;  3HK0 A;  4M8N A;  3SDL C;  2D11 A;  2EMS A;  2ZCB A;  1WX9 A;  1YD8 U;  1WGR A;  3ONS A;  2NBW B;  3L10 B;  2M0X A;  1CMX B;  4I6P A;  3M62 B;  4F7Z A;  5JZE B;  1GJZ A;  4GB9 A;  2C60 A;  1WRD B;  3GOE A;  1RFA A;  3TIX A;  2LZ6 A;  3ZNZ B;  1P1A A;  4I6N B;  1EF5 A;  3SD5 A;  3RZF A;  4BKS D;  3ALB A;  3UGB B;  4E3C A;  2J7Q B;  3QHT A;  4F1S A;  1WMH B;  3VUX A;  3R3M A;  2DYM A;  4HWI B;  2KDE B;  2HE7 A;  3L0W B;  5BO4 B;  3APD A;  3R7Q A;  2O2V B;  2N9X A;  3H1U A;  5LXI B;  3CMM B;  4ZRK A;  3RUL A;  3UQB A;  3ZTC A;  3WA0 A;  2K6D B;  3A9K B;  3TMP B;  1XT9 B;  5L83 A;  2LAS A;  3CST A;  1Z5S B;  3ZRF A;  3A9K A;  4YL8 A;  2D2Q A;  4K81 A;  3DBL I;  4OVV A;  3PSE B;  5D2M B;  5E6O A;  2GMI C;  1PQS A;  2N9E B;  4HXD A;  2C7N B;  4WJP A;  3VTW A;  4IWO A;  1ZGU B;  4NQL B;  2VRR B;  1WJN A;  3W1Y A;  4AOF A;  4B6W A;  1WR6 E;  4ANX A;  4PYU A;  4JQW C;  3A33 B;  1YX6 B;  1SIF A;  2KWU B;  4IM0 A;  3VAW A;  4FN2 A;  4NQK E;  2GOW A;  3DVN U;  4W9J A;  1SGH A;  2FAZ A;  1V49 A;  5G2N A;  3EC8 A;  3WAN A;  3ZLZ A;  2ZZP B;  4W9C A;  4HVB A;  4W9D A;  4E74 A;  3BY4 B;  3CF6 E;  1NDD A;  4HK2 A;  1RAX A;  3PLV A;  2N7E A;  3RD2 A;  4MEL A;  2NBV B;  2KO3 A;  3PS6 A;  2ZPN A;  4RMA A;  4LDT D;  4KIK B;  1E90 A;  3ZDT A;  4EZK A;  4KIK A;  3VH3 B;  3NY5 A;  4WWN A;  4RM9 A;  2KWV B;  1WGD A;  5C1Z A;  1XQQ A;  2BKR B;  1C1Y B;  2ZVN A;  4HCN B;  1C3T A;  3OLM D;  1V80 A;  1EUV B;  4KV2 A;  3KYD D;  2IY1 B;  2K1F A;  3H6N A;  1EF1 A;  3ECI A;  4MM3 A;  1WH3 A;  1V2Y A;  2I1K A;  2KC2 A;  3WIM A;  2CS4 A;  2L8J A;  4MH0 E;  2KVR A;  1VD2 A;  2IYD B;  4II3 B;  4K1R B;  4OVU A;  1TGZ B;  2WX1 A;  3U30 A;  4B9K A;  2KXJ A;  3NZU A;  2DX5 B;  2WDT B;  3DBH I;  3WAL A;  2IO1 B;  1F9J A;  2JUO A;  3DBS A;  3IHP C;  1P9D U;  2NR2 A;  4NNJ B;  1XD3 B;  3VTV A;  3VTU A;  2FCS A;  2RPQ A;  1S3S G;  3SHQ A;  4ANU A;  3ML9 A;  3Q3F A;  3RCZ A;  4K7S A;  3X23 A;  2BWE S;  2R2Q A;  1ZW7 A;  2JRI B;  2PJH A;  2KDF B;  1E7V A;  2GBN A;  3QQ8 B;  2PPH A;  4PS3 A;  1HE8 A;  3DOW A;  4FAD A;  2LJ5 A;  3JW0 X;  5FR6 A;  2ZPY A;  3VFK A;  2LVP A;  3JSV A;  3ZTD A;  1NI2 A;  2LD9 A;  2LGY A;  2MBE A;  1Y8R C;  2KD0 A;  1TBE A;  2R2O A;  3PLU A;  4TQ0 A;  5AZG A;  4GXB A;  4HJK A;  4WQO B;  1MG8 A;  4JIO U;  4MEM A;  3PPA A;  2KDI A;  3A1Q B;  1R4M I;  1P3Q U;  2C5L C;  2DEN B;  2KTR B;  3IVF A;  1IP9 A;  5L95 C;  3SU8 X;  3EHV A;  2I1J A;  4GMV A;  3HM6 X;  5KHO A;  1V81 A;  4BOS C;  2B3A A;  5DPS A;  4BKS A;  5LXH A;  3ZNI D;  4W9I A;  4I6L B;  2FCN A;  2MBO A;  1IPG A;  2MWS B;  3KW5 B;  1QZE A;  3PHX B;  4KSK C;  4ANW A;  2XBB C;  2NBU A;  1WM3 A;  2NS5 A;  3MHS D;  4PS8 A;  5J2R A;  2O6V D;  5D7G A;  4NJ6 A;  5CHF A;  2MRP A;  2N9P C;  2KOX A;  3PRZ A;  2PE9 A;  1V9J A;  3A4R A;  2FNJ B;  4FHJ A;  1H8C A;  2JRH A;  4MSM B;  1E5W A;  4X57 B;  2KC1 A;  2WYQ A;  3PRE A;  1GC7 A;  5GMV A;  2PEA A;  4EOY A;  2G3Q B;  2JXX A;  2YVC A;  3UIO B;  1SE9 A;  3DBR I;  4JGH B;  4LCD E;  2W9N A;  3JVZ X;  2N7D A;  2BYE A;  4MGK E;  2RR9 A;  3L16 A;  4IM2 A;  4DHJ D;  3OJ4 B;  3BIN A;  5IA7 A;  3H9D A;  3HM3 A;  4JL9 A;  4K7W A;  1I35 A;  1RRB A;  2PE6 B;  3K9P B;  3OJ3 A;  3GZN I;  3ZRC A;  4URK A;  4W9E A;  1OEY A;  2KX3 A;  2OOB B;  2KAN A;  3IG3 A;  4EUT A;  1OTR B;  4WWP A;  3KUD B;  2DHZ A;  1UZX B;  2JWZ A;  4AJW A;  5D94 A;  3JYU A;  3D32 A;  3PTF C;  4M8M A;  2IY0 B;  3WAO A;  1WJ6 A;  3NHE B;  3CSF A;  1WR1 A;  3DVG Y;  3M3J A;  2K39 A;  4DBG A;  4B95 A;  4DHZ B;  3MJW A;  3ZNH B;  1WE7 A;  2DZI A;  4ICU A;  1G6J A;  4GU2 A;  3ZKJ C;  3UIN B;  3ENE A;  2AL3 A;  1J8C A;  3X0W A;  1P98 A;  2Z59 B;  4NAW B;  3QAR A;  1J0G A;  2L0F A;  1ZKH A;  3QAQ A;  4NAW A;  3VUW A;  2FUH B;  3QA8 A;  4HPL B;  4IW0 A;  2EKE C;  2KX0 A;  3EEC A;  4F8C B;  2MP2 B;  3W1S A;  3MTN B;  2LUE A;  3OAW A;  3O65 B;  2JT4 B;  2MP2 A;  3NOB A;  1V6E A;  2IBI B;  4HDO A;  3VXW A;  4WWO A;  1V5O A;  2G4S A;  2KDB A;  3S2A A;  4AUQ C;  4HLE A;  3H7P B;  1E8X A;  4LJP B;  4A20 A;  5AZH A;  3N32 A;  3H7P A;  4NPN A;  3UQA A;  4GOC A;  1WGY A;  2JZ3 B;  2KJH B;  3QK0 A;  4G11 A;  1WM2 A;  4ZDV A;  2KFJ A;  3PT2 B;  3M63 B;  1M94 A;  2FCQ A;  1JRU A;  1WZ3 A;  4IUM B;  3A9J B;  4BOZ B;  5KHQ A;  2IO0 B;  3ZNG C;  2RD0 A;  2AYO B;  2FIF A;  3A9J A;  4GSW A;  4BBN C;  3P2B A;  3QIJ A;  2J0J A;  1R4N I;  2Y5B B;  3RYT A;  2RSU A;  4AJY B;  2ZVO A;  2CU1 A;  2UYZ B;  2LVQ A;  3PV1 A;  2WWZ A;  2MBQ A;  1E7U A;  4TV3 A;  4NY0 A;  2CR5 A;  2KWC A;  2ZNV B;  2DYO A;  5JH5 C;  4HCP B;  2V4L A;  3AI5 A;  4E71 A;  2KK8 A;  4II2 B;  1WF9 A;  3PZD A;  2KKC A;  3VDZ A;  3U8Z A;  4ANV A;  1WIA A;  2NPT A;  3PHW B;  2C9W B;  2ZNV C;  1OEY J;  5HKH A;  3ZUN A;  1J19 A;  2A5U A;  2A4Z A;  4XX5 A;  4EZL A;  2MBH A;  3QC8 B;  1P0R A;  4ZRI A;  5C23 A;  1Q1O A;  4PYZ A;  4TKN A;  2L05 A;  2QHO A;  2EMT A;  4MGY E;  4ICV A;  3ZW3 A;  4IC7 B;  5J18 A;  2LRW A;  2K8H A;  2CHZ A;  4GDL A;  5E6P A;  4ASW C;  2O6V B;  3JSV B;  4CO7 A;  2LWP A;  2IO3 B;  2HD5 B;  4XZ4 A;  2O6V A;  3V6C B;  3WAP A;  3V60 A;  1EO6 A;  3I3T B;  2C7M B;  4GDK B;  5J17 A;  2LGX A;  5CX3 A;  4DDG D;  4GDK A;  1TZ1 A;  2BGF A;  1WY8 A;  3AUL A;  4W9G A;  3ZIM A;  3DQV A;  2J0M A;  3DVN V;  3NZS A;  4IM3 A;  4CHK A;  1KLV A;  1H4R A;  2CHW A;  2BWF A;  3KH0 A;  2L0T A;  2KNB A;  4AWJ A;  2V1Y A;  4DHJ B;  3R66 C;  2AWT A;  4AP4 C;  2REX A;  4FBJ B;  1AAR A;  2LGD A;  3UF8 A;  1BT0 A;  4EZJ A;  3TL5 A;  1GC6 A;  2YLM A;  1UD7 A;  2MCN B;  5AEK B;  5JHB A;  2MQJ A;  1WXS A;  2LI5 A;  3L54 A;  4P7I A;  2KQ7 A;  2OJR A;  3PRP B;  2BYF A;  4GN1 A;  3RUI B;  2K25 A;  2GBM A;  1U4A A;  4A3P A;  3B08 A;  5DCN A;  3RZW C;  2ZJD A;  2N1V A;  2L76 A;  2MW5 A;  3DPD A;  2DAJ A;  3EFU A;  2Z0D B;  2BKF A;  2G45 B;  5LLI A;  2XK5 B;  2KLC A;  2JVC A;  2K8C A;  2M17 A;  2XK5 A;  4FHK A;  2D10 A;  1E8W A;  2HTH A;  2DZM A;  4NJ7 A;  1D3Z A;  3HHM A;  1V5T A;  4HDQ A;  3A4S C;  1V86 A;  5CHV C;  1WYW B;  1WJU A;  2D07 B;  3QCA A;  3KUZ A;  3APF A;  1WXV A;  5DPW A;  4KSL C;  2GBR A;  3V62 A;  2RGF A;  5DPT A;  3QX1 A;  4WJQ A;  2Z0E B;  3ML8 A;  2JZZ A;  3ZDM C;  4BBN F;  4EEW A;  3WAM A;  4KDL B;  4TQ1 A;  2ZEQ A;  1S1Q B;  4BVU C;  3QJZ A;  4ZYN A;  4LDT B;  2N4F A;  1Q5W B;  2KMA A;  3APC A;  2L3Z A;  2CKH B;  1L7Y A;  3N30 A;  1YQB A;  4XC2 A;  3V61 A;  2KJ6 A;  5E6N A;  3TCA A;  4GGQ A;  3Q3J A;  3L08 A;  2CHX A;  2KQS A;  2LVO A;  4WAA A;  5D6J B;  3IFW B;  1WMH A;  3LDZ E;  2K8B A;  1OQY A;  1WI0 A;  2IO2 B;  2BPS A;  1YJ1 A;  2GBJ A;  1NBF C;  4RM8 A;  2O2V A;  4PS7 A;  4N9F 4;  4BKT A;  2JY6 A;  2NVU I;  3L17 A;  4MGI E;  3H7S A;  1K8R B;  3L13 A;  4M0W B;  2MX2 A;  2ZCC A;  2DYB A;  3DCG A;  2KJR A;  4W9L A;  1X1M A;  2MLB A;  4IWQ A; 
#chains in the Genus database with same CATH topology
 1TS4 A;  1GUA B;  2E6X A;  2KFK A;  5G55 A;  1FD6 A;  3AE2 B;  2KVZ A;  1NYR A;  1GB4 A;  3Q14 C;  1WXM A;  3AU4 A;  1PGX A;  1YN4 A;  3AED B;  3UIP B;  2GLS A;  3ZJV A;  3KYC D;  5FK9 C;  4A3O A;  3K9O B;  4BKG A;  1T0R C;  3PGE A;  3AE1 B;  1YIW A;  2NPT B;  3L4P A;  1WGG A;  3LJ3 A;  5AZF A;  4KVG B;  4W9H A;  1UGM A;  4K7U A;  3BYT B;  1LXD A;  4MDK E;  3PZ7 A;  1WJ4 A;  1N60 A;  2BF8 B;  2H89 B;  1FM0 D;  1TZO A;  1E8Y A;  1IBX B;  4GIV A;  4LJO B;  1SJH D;  2KHW B;  4DHZ E;  4DWF A;  3VHT C;  1UH6 A;  4DXA B;  2IGD A;  5CTR C;  4MAC A;  1IYF A;  3KUC B;  2DAF A;  4J3O D;  2DZK A;  2KLG A;  1SB3 C;  2W82 A;  1IGC A;  1VZ7 A;  1HTO A;  3VQI A;  4KDI C;  1GPX A;  2MHJ A;  2MA9 B;  2KTR A;  3FC4 A;  2D3G A;  3NJT A;  5BYR A;  1UUP A;  2XEW A;  2FID A;  1E0Z A;  3M95 A;  4LK0 M;  2ASQ A;  1I4Q A;  3W5U B;  3SDL C;  3TEY A;  1KF6 B;  1CMX B;  3M62 B;  2QCZ A;  5JZE B;  3Q3M C;  4B0E A;  2C60 A;  1I4R A;  2LZ6 A;  3SD5 A;  4HJG E;  3AB5 A;  3EA6 A;  1FXI A;  2JQR B;  2J7Q B;  4RH6 A;  4F1S A;  2JYE A;  2YEP F;  2OED A;  3HRD D;  3C19 A;  1JWB D;  3L0W B;  5BO4 B;  1FPY A;  2O2V B;  5LXI B;  3VRA B;  3ZTC A;  2K6D B;  3AEB B;  1XT9 B;  2AQ2 B;  1JWA D;  3ZRF A;  1ZE3 D;  3A9K A;  2D2Q A;  2NTT A;  3PSE B;  1RM6 C;  5D2M B;  2GMI C;  4IWO A;  3GZN B;  2DWQ A;  4PYU A;  1CJE A;  2KWU B;  4FN2 A;  5FR3 A;  2GOW A;  1Y56 A;  2K9X A;  3EC8 A;  4HVB A;  1SF0 A;  1QOB A;  3PLV A;  2WXH A;  2N7E A;  3RD2 A;  1OQR A;  2NBV B;  4XGA B;  3AMZ A;  3PS6 A;  3W5V B;  4RMA A;  5JXV A;  4LDT D;  1E90 A;  1JWU D;  1SE4 A;  4EZK A;  1J7A A;  4KIK A;  4KGS A;  3VH3 B;  3AE5 B;  4YT0 B;  1FIQ A;  2PIA A;  5C1Z A;  2BKR B;  1MG4 A;  2BTE A;  3OG5 A;  1NEN B;  1WH3 A;  1V2Y A;  2I1K A;  3N9Y C;  2L8J A;  3BVZ A;  1WRI A;  4K1R B;  4MH0 E;  4OVU A;  2WX1 A;  3U30 A;  2K22 A;  4B9K A;  2KXJ A;  1L6V A;  1ZPS A;  2PTL A;  2HJ1 A;  3KQ4 A;  4ARI A;  3VTU A;  4KKI A;  1S3S G;  3ML9 A;  2BWE S;  2PJH A;  1E7V A;  2QC8 A;  4PS3 A;  1HE8 A;  2LJ5 A;  3JW0 X;  4MH8 A;  3VFK A;  3JSV A;  4YTP B;  3ZTD A;  5BYQ A;  1Y8R C;  1TBE A;  4TQ0 A;  3R2T A;  4WQO B;  1MG8 A;  4XE0 A;  3AM9 A;  2V3P A;  2KDI A;  1R4M I;  4C7Z A;  3P63 A;  3TEW A;  3EHV A;  1UNS A;  1C79 A;  3RNG C;  1V81 A;  5DPS A;  5IO9 A;  4BKS A;  5LXH A;  3PO0 A;  2MWS B;  1MHH E;  4ANW A;  2NS5 A;  1R4M B;  1A70 A;  2WP9 B;  5J2R A;  2KOX A;  3PRZ A;  4FHJ A;  3A4R A;  1H8C A;  2FNJ B;  2WXN A;  1E5W A;  2KC1 A;  4EOY A;  2G3Q B;  3UIO B;  1SE9 A;  2AQ1 B;  3DBR I;  4JGH B;  3JVZ X;  5EE0 A;  3H9D A;  4K7W A;  1I4X A;  4ZRP A;  1RRB A;  2PE6 B;  3K9P B;  3OJ3 A;  1TY0 A;  4NJC A;  1I4H A;  2KX3 A;  3DBR B;  1E10 A;  4WWP A;  1UZX B;  5D94 A;  1T5X D;  2LGI A;  2Y5C A;  3D32 A;  3PTF C;  4M8M A;  3WAO A;  4DBG A;  2WNM A;  3I63 C;  4B95 A;  4OZA A;  3V3X A;  1G6J A;  2GB1 A;  3ZKJ C;  3Q2A C;  3X0W A;  3U52 E;  4NAW B;  3QAQ A;  2EKE C;  2KX0 A;  3NG0 A;  3W1S A;  1JCK B;  3MTN B;  4US9 A;  3AE9 B;  1V6E A;  3LXF A;  2BYT A;  3H7P B;  4LJP B;  3NVV A;  3UQA A;  4GOC A;  1WGY A;  3QK0 A;  4ZDV A;  1JRU A;  4D2K A;  1QIL A;  3BVM A;  1KRH A;  1R4N I;  2J0J A;  2LHE A;  3RYT A;  4KX6 B;  2CU1 A;  2UYZ B;  3GB1 A;  2WWZ A;  3NRZ A;  1E7U A;  4LNK A;  2ZNV B;  2LFI A;  2QMT A;  3DWG C;  2V4L A;  3GE8 C;  3AI5 A;  4A9A A;  2KKC A;  1R4N B;  1MJD A;  2NPT A;  4AQ7 A;  1OEY J;  3KWV A;  2BQQ A;  3TUO A;  3ZUN A;  3QC8 B;  1Q1O A;  4TKN A;  4ICV A;  4IC7 B;  4A55 A;  5E6P A;  2HD5 B;  1HZ5 A;  2O6V A;  3WAP A;  3V60 A;  1EO6 A;  3AE4 B;  2C7M B;  1PGA A;  2WDQ B;  2LGX A;  4TSS A;  5CX3 A;  5HG2 A;  1IBX A;  3ZIM A;  3DQV A;  2IPK D;  3DVN V;  1K52 A;  4HKZ E;  2KNB A;  2V1Y A;  2GI9 A;  4DHJ B;  3R66 C;  2AWT A;  3MC0 B;  4AP4 C;  3TL5 A;  1XLQ A;  5C2T B;  5JHB A;  2KQ7 A;  2BYF A;  4GN1 A;  1AN8 A;  3RUI B;  1U4A A;  3B08 A;  5DCN A;  1T0Q C;  2ZJD A;  1FCC C;  2DAJ A;  2K5P A;  3MFG A;  1WSP A;  2WU2 B;  1EWC A;  2D3A A;  2KLC A;  2JVC A;  1T6B X;  2L83 A;  1WJU A;  4L2Y A;  4RCO A;  3VR9 B;  3QX1 A;  4WJQ A;  3ZDM C;  2JZZ A;  5MPO A;  4RGM A;  1IUE A;  1S1Q B;  2Y3A A;  3MC9 A;  4BVU C;  2KMA A;  1HEZ E;  1L7Y A;  2ON8 A;  5E6N A;  4ITK A;  3Q3J A;  1RYJ A;  2CHX A;  2KQS A;  3IFW B;  2GBJ A;  3RFZ B;  2WXR A;  2O2V A;  3NZ3 A;  1YJI A;  2M56 B;  2JY6 A;  3L17 A;  4H2A A;  1K8R B;  3L13 A;  2ZCC A;  2K3U A;  2PKO A;  1HTQ A;  2MEK A;  2KJR A;  1C76 A;  1X1M A;  2MLB A;  1GG3 A;  1I7H A;  2C7H A;  1GNU A;  1MFW A;  3R7R A;  1YX5 B;  3AXC A;  1KFY B;  3IBE A;  2M8S A;  5LNK 1;  4EFO A;  5IAA C;  2OHF A;  5TR5 A;  1YQ4 B;  3P4Q B;  3AN1 A;  1LFD A;  3FIL B;  1A5R A;  1DYQ A;  4MJS A;  4P16 A;  4KGT A;  2K6Q A;  2KN5 A;  2Z8L A;  4UDU C;  1N61 A;  2M4N A;  3PVL A;  4WJO A;  3IAS 1;  2M1M A;  4HPM B;  5E6J A;  1SE2 A;  2N7J A;  4BFR A;  2CJN A;  2PLP A;  5BYS A;  3RMK C;  3C0R B;  4HRO A;  1UBQ A;  2V0G A;  2MSE D;  2IDY A;  1F0Z A;  2N1W A;  4RF1 A;  2MBB B;  5EDS A;  3I57 A;  3B2G A;  1XLN A;  4FA6 A;  4L1B A;  3B1L X;  4G50 A;  1YN5 A;  1XO3 A;  3V6E B;  1GB1 A;  4MGZ E;  2WXI A;  4B0M A;  2D3C A;  1TS3 A;  1OFF A;  3ZO5 B;  3DDC B;  1VCB A;  1LM8 B;  3QWZ B;  4M8N A;  2EMS A;  2ZCB A;  2ZW1 A;  1WX9 A;  1YD8 U;  2WDV B;  4P6V F;  2NBW B;  2M0X A;  1QQR A;  2G9H D;  1WRD B;  3GOE A;  3ZNZ B;  1EF5 A;  3SFD B;  3RZF A;  4BKS D;  3QHT A;  1WMH B;  1AYF A;  5H92 C;  2KDE B;  2JYT A;  3APD A;  4C4V A;  2N0S B;  3LYY A;  4C56 C;  2LAS A;  1Z5S B;  2W55 A;  4K81 A;  3DBL I;  4OVV A;  5E6O A;  3VTW A;  4WJP A;  5D3I B;  1HZ6 A;  1ZGU B;  1WJN A;  4AOF A;  4B6W A;  1WR6 E;  3CIR B;  1SIF A;  1B1Z A;  4IM0 A;  4NQK E;  1TS2 A;  3DVN U;  5G2N A;  1SGH A;  3DBL B;  3AEG B;  3ZLZ A;  4KKJ A;  3BII D;  4E74 A;  1NDD A;  3AEC B;  4MEL A;  3UI3 A;  2KO3 A;  2KQ4 X;  1MHX A;  3IT4 B;  3ZDT A;  4WWN A;  2N9K A;  4RM9 A;  4A8X C;  4Q2J A;  1C1Y B;  2ZVN A;  1C3T A;  3OLM D;  1V80 A;  3BYY B;  3KYD D;  2IY1 B;  2K1F A;  1JWM D;  3H6N A;  1L0Y B;  4MM3 B;  3VR8 B;  3WCQ A;  1MI0 A;  4NZL B;  1LGR A;  1STE A;  1VDV A;  2LEK A;  3U7Z A;  1L5P A;  1VD2 A;  2IYD B;  4DXG A;  2BS2 B;  1TGZ B;  2WDT B;  5T8I A;  2JUO A;  4WAF A;  2BVC A;  2NR2 A;  1XD3 B;  3VTV A;  1SBB B;  1NYQ A;  2FCS A;  3SHQ A;  4ZHO A;  3Q3F A;  3RCZ A;  2R2Q A;  1QT9 A;  2JRI B;  3RN9 C;  2WXM A;  2PPH A;  4FAD A;  3KWL A;  1NI2 A;  2KD0 A;  2WXO A;  1DOY A;  2VZK B;  1C4C A;  1TT5 B;  4JIO U;  4AS1 A;  4MEM A;  2BT6 A;  1P3Q U;  2DEN B;  4GMV A;  3HM6 X;  1I4P A;  3ETR A;  4BOS C;  3TSS A;  4I6L B;  2FCN A;  3PHX B;  3MHS D;  1WM3 A;  2QEJ C;  3CWI A;  2O6V D;  3AV8 A;  5HI1 A;  2N9P C;  2EEL A;  3IT6 B;  1SSN A;  4LNN A;  4X57 B;  1UGJ A;  1GC7 A;  2PEA A;  1LO5 D;  3GP7 A;  4LCD E;  3H8H A;  4MGK E;  2RR9 A;  4IM2 A;  4JL9 A;  1TS5 A;  2WS3 B;  5BMI A;  3GZN I;  2L32 A;  3ZRC A;  4ZHP A;  4OW0 A;  4W9E A;  4URK A;  3O13 A;  4EUT A;  3KUD B;  2HDE A;  2DHZ A;  2JWZ A;  4AJW A;  2JX5 A;  3JYU A;  1TIF A;  2XN9 C;  3ZXR A;  2IY0 B;  1WJ6 A;  3M3J A;  2K39 A;  3ZNH B;  4YTN B;  4GU2 A;  3U2S C;  2AL3 A;  1PYW D;  3RNA C;  4XWT A;  2Z59 B;  3V05 A;  3QAR A;  1J0G A;  2L0F A;  3AE6 B;  2INP E;  2FUH B;  4F8C B;  2LUE A;  2MP2 A;  3NOB A;  2LMC A;  3VXW A;  4WWO A;  2KDB A;  4A20 A;  5AZH A;  1QKZ A;  2KJH B;  1WM2 A;  4ZYS A;  1K53 A;  1YJJ A;  3A9J B;  2G1E A;  5KHQ A;  3ZNG C;  1FFV A;  2RD0 A;  4BBN C;  3P2B A;  2RSU A;  3FKY A;  4AJY B;  3PV1 A;  4ARC A;  4TV3 A;  4CQN A;  3NUH B;  2DYO A;  2EKI A;  5IP4 D;  4QAY A;  3I5J C;  3VDZ A;  1N62 A;  3U8Z A;  1WIA A;  2L52 A;  5HKH A;  1J19 A;  4XX5 A;  2MBH A;  1P0R A;  3ZQ4 A;  3FIL A;  4PYZ A;  2L05 A;  4C00 A;  1XXG A;  4ASW C;  2CHZ A;  1HXY D;  3V6C B;  4GDK B;  1L0V B;  2BGF A;  3AUL A;  2DBY A;  2K0P A;  4YSZ B;  3NZS A;  1ZDV A;  4IM3 A;  4N59 A;  1KLV A;  2CHW A;  2BWF A;  4FBJ B;  1FO4 A;  2BS4 B;  2LGS A;  2KMM A;  2LGD A;  4WUR A;  5AEK B;  1WXS A;  2K25 A;  2GBM A;  1ZDX A;  1E9M A;  3RZW C;  4YTM B;  1FRD A;  2BKF A;  5LLI A;  2M17 A;  1VZ8 A;  4NJ7 A;  2XK5 A;  3HHM A;  1V5T A;  3A4S C;  3PZ8 A;  5CHV C;  1SJE D;  1WYW B;  1ESF A;  1JAL A;  2QIE B;  3QCA A;  2JXT A;  4JWU C;  2KWD A;  5H8Y E;  5DPT A;  2Z0E B;  4EEW A;  4TQ1 A;  2ZEQ A;  2QDF A;  2BS3 B;  2N4F A;  1Q5W B;  3V61 A;  1JW9 D;  2KJ6 A;  4YSY B;  2LVO A;  2INN E;  1WMH A;  2K8B A;  3B2F A;  1NBF C;  2JZP A;  3HVZ A;  3SEB A;  4M0W B;  4ACF A;  2MX2 A;  1JRO A;  1KOT A;  5AUI A;  2KFK B;  4MSQ B;  2JPH A;  4IG7 B;  1TTN A;  3KVF B;  2FE8 A;  3NVZ A;  2GBK A;  3T3N A;  1PGB A;  3T9L A;  1PFD A;  3AEA B;  4EKU A;  4WJN A;  2PW9 A;  4FJV B;  5HFY A;  4C7Y A;  3SFE B;  2FCM A;  4FUL A;  1NI3 A;  4G3X B;  1FCL A;  3P4S B;  4FJY A;  4OVZ A;  1PUT A;  3AU5 A;  1QOG A;  2AL6 A;  1IGD A;  1V97 A;  3LB8 C;  2JF5 A;  2PVO D;  2LXA A;  2RDG A;  1D5Z C;  4GDL B;  4KGR A;  4W9K A;  2AEH A;  2KYW A;  3MJ5 A;  5I4D A;  4J6I A;  5GXG B;  1RLF A;  1FXT B;  2UWQ A;  3N3K B;  4YXD B;  4G0N B;  1YN3 A;  2L7R A;  3RNC C;  1I42 A;  3B9J A;  3TBL D;  4HEA 1;  4XWW A;  5CHW A;  1WXA A;  1KM7 A;  2IZV B;  1B9R A;  1CZP A;  3NS8 A;  3ZVV A;  4ZRJ A;  1L2N A;  3T3O A;  4NAM A;  4JLC A;  5DPR A;  2DZJ A;  2KMC A;  4GLS C;  3TJP A;  1WZ0 A;  1F52 A;  1C9F A;  2L00 B;  3Q3O C;  1QOA A;  1UBI A;  3R8B A;  5D3D A;  4LLG M;  1N5X A;  3ONS A;  3Q8F A;  2VH2 A;  1ZUD 2;  3AE3 B;  3FAH A;  4I6P A;  4F7Z A;  1GJZ A;  4GB9 A;  2WLB A;  1RFA A;  1MPE A;  2SAK A;  1K51 A;  1ACC A;  3ALB A;  3N1Z C;  3UGB B;  4E3C A;  2QJL A;  3VUX A;  3R3M A;  4US8 A;  3TEZ A;  4ZRK A;  3RUL A;  3UQB A;  1RWS A;  3WA0 A;  3A9K B;  5L83 A;  3CST A;  1V1O A;  2C7N B;  3BVG A;  3NS1 A;  4NQL B;  2VRR B;  3EUB 2;  3IAM 1;  3W1Y A;  4ANX A;  3A33 B;  4JX1 C;  3AE8 B;  2ZZP B;  4W9C A;  3CF6 E;  1D4B A;  2ZPN A;  3Q6B A;  4KIK B;  2WQY B;  1DOI A;  4O1N A;  1XQQ A;  4ZOH C;  4HCN B;  2BBC A;  2WXG A;  3RNB C;  4KV2 A;  2ACZ B;  3ECI A;  2RPV A;  1SIJ A;  4LTU A;  2KC2 A;  3SR6 A;  2KVR A;  4II3 B;  4N58 A;  1VRA B;  3DBH I;  3WAL A;  3DBS A;  1P9D U;  4WH4 A;  2RPQ A;  4ANU A;  4XYC A;  4K7S A;  1EU4 A;  3AE7 B;  3DBH B;  3DOW A;  1C77 A;  2W54 A;  1VR9 A;  2LVP A;  2KN4 A;  2LD9 A;  2LGY A;  2MBE A;  1V8C A;  1L6U A;  5AZG A;  4HJK A;  4A90 A;  1MVK A;  4BZA A;  3PPA A;  3DWM A;  4HRS A;  3A1Q B;  2AX5 A;  2C5L C;  2WXQ A;  2J42 A;  3SU8 X;  2I1J A;  5KHO A;  3ZNI D;  4W9I A;  2CU3 A;  2MBO A;  4IKG A;  2XBB C;  2NBU A;  5EE1 A;  1SEB D;  4LNF A;  5D7G A;  1F2R C;  4NJ6 A;  5CHF A;  2MRP A;  3R2I A;  2JRH A;  2R61 A;  2LHD A;  3P4R B;  3PRE A;  1DGJ A;  5GMV A;  2JXX A;  2YVC A;  2KDM A;  5BMH A;  1YNT E;  2W9N A;  1QOF A;  2BYE A;  2INC C;  3OJ4 B;  1F77 A;  1ENF A;  3MC8 A;  2XNA C;  1FEH A;  4YWG G;  2WXP A;  2ONQ A;  1HA5 A;  4M01 A;  2OOB B;  2KAN A;  4XDD A;  2ICI A;  1OTR B;  3MHZ A;  3E56 A;  1QF6 A;  2J52 A;  2GRI A;  4S17 A;  3CSF A;  3DVG Y;  4DHZ B;  3MJW A;  1WE7 A;  2DZI A;  1C4A A;  1J8C A;  1JRP A;  3Q8B A;  1P98 A;  1ZKH A;  4NAW A;  4IW0 A;  4C80 A;  1P7E A;  3EEC A;  2BB6 A;  3OAW A;  3O65 B;  2IBI B;  4HLE A;  2G4S A;  4AUQ C;  3AH7 A;  3N32 A;  3H7P A;  4LNI A;  1WGK A;  2KFJ A;  3PT2 B;  1M94 A;  2FCQ A;  3BWU D;  3E9S A;  4OZC A;  3AEF B;  2AYO B;  3QIJ A;  1N6Z A;  3Q3N C;  2KAJ A;  2ZVO A;  2YEP B;  1XLP A;  4JPS A;  1R7S A;  2MBQ A;  1VZ6 A;  2QIL A;  3URY A;  4NY0 A;  5JH5 C;  4HCP B;  4II2 B;  3PZD A;  4RGO S;  1FNU A;  3P4P B;  4PK1 A;  3ABV B;  3PHW B;  3RI7 C;  2C9W B;  2WHI A;  4BAX A;  1FNV A;  4ZRI A;  1EU3 A;  5C23 A;  2B76 B;  2ZW0 A;  1NVI D;  4MGY E;  3ZW3 A;  1FRR A;  5J18 A;  4GDL A;  2O6V B;  4CO7 A;  2LWP A;  2IO3 B;  1XLO A;  4XZ4 A;  2NTS A;  1RFK A;  1XCT L;  2WXK A;  3ZYY X;  4DDG D;  2DLB A;  1EM7 A;  2D5G A;  1N5W A;  1H4R A;  3KH0 A;  2L0T A;  4P1B C;  1ZXH A;  2REX A;  3HUI A;  3UF8 A;  1GC6 A;  2YLM A;  1UD7 A;  3DHG C;  2MCN B;  1T3Q A;  2LI5 A;  4DQO C;  3PRP B;  3RNF C;  1FFU A;  4A3P A;  3GS2 A;  2N1V A;  2V9H A;  2L76 A;  2MW5 A;  3EFU A;  2Z0D B;  3RPF C;  2BB5 A;  3I9V 1;  5AUK A;  1D3Z A;  2D10 A;  1E8W A;  1V86 A;  1WXV A;  5DPW A;  4KSL C;  2GBR A;  3V62 A;  2RGF A;  2BW2 A;  2VZK D;  1WYG A;  4BBN F;  3WAM A;  1FNW A;  1SE3 A;  3QJZ A;  4LDT B;  2I38 A;  3APC A;  2L3Z A;  2CKH B;  3N30 A;  2IGG A;  3ZJT A;  3L08 A;  4WAA A;  2M0A A;  1OQY A;  1WI0 A;  1E6E B;  2IO2 B;  4HPP A;  1YJ1 A;  4RM8 A;  4N9F 4;  4BKT A;  4K3C A;  3P42 A;  3DCG A;  4W9L A;  4IWQ A;  3W1S C;  2KZR A;  2LJI A;  2HJ8 A;  3BZD B;  2NCN A;  3ZXV A;  2BYV E;  4TUU A;  1T0Y A;  3GE3 C;  3BK2 A;  1BXT A;  2WU5 B;  5EE3 A;  1J7B A;  1J7C A;  1LQB A;  3U7D A;  1ET9 A;  3Q8E A;  4DDI D;  1OGW A;  1KLG D;  1VJK A;  4FLH A;  2LRU A;  3VH4 B;  4KZ0 A;  1P7F A;  4CYE A;  2J0K A;  5FKA C;  1KJT A;  4MJS B;  4DK5 A;  3HIZ A;  3Q8C A;  3DVG X;  2L1A A;  3MP9 A;  2WX0 A;  2MJD A;  4TMA B;  4OHJ A;  1WGH A;  3PRM B;  2CJO A;  1WFY A;  2G4D B;  1QLB B;  3B0A A;  1Q0W B;  1WE6 A;  1JWS D;  3VVW B;  2LXC A;  4FJZ A;  2LUM A;  1Z2M A;  2V3N A;  4RFB A;  3RT3 B;  4M00 A;  4K3B A;  1JQ4 A;  1WX7 A;  4HKQ A;  2J53 A;  2KTF A;  4KZC A;  1YOV B;  1N63 A;  4W9F A;  1V1P B;  1UEL A;  3T8M A;  2W3S A;  2V3S A;  3A1Q A;  4FXC A;  2J4X A;  2AQ3 B;  1E8Z A;  3U4E G;  3VUY A;  3P1M A;  2QSD A;  4IWP A;  5JHA A;  2W3R A;  1WX8 A;  1CQV A;  1ISN A;  3VRB B;  3HK0 A;  2D11 A;  1WGR A;  3L10 B;  3N1X C;  4A6Q A;  2FUG 1;  3TIX A;  1P1A A;  2Q5W D;  4I6N B;  1YMH E;  1BML C;  2OJW A;  4WIP A;  1I4G A;  1Q10 A;  2UU7 A;  2DYM A;  4HWI B;  2HE7 A;  2MH7 A;  3R7Q A;  1GOZ A;  1PDX A;  4C4V B;  2N9X A;  3H1U A;  1YQ3 B;  3CMM B;  4IOI E;  2PVG C;  4M02 A;  3TMP B;  5G5H A;  4YL8 A;  1BUI C;  3EFC A;  1PQS A;  2N9E B;  4HXD A;  3N1Y C;  4JQW C;  1YX6 B;  3VAW A;  4W9J A;  3WAN A;  2FAZ A;  1V49 A;  3ZGZ A;  1FXA A;  4W9D A;  3BY4 B;  3KLS X;  4HK2 A;  3IXS A;  1RAX A;  2Y5P A;  3W2D A;  4ZRQ A;  2RMM A;  4YSX B;  2FBW B;  3NY5 A;  2KWV B;  1WGD A;  2JSV X;  1ROE A;  1KH0 A;  2JWU A;  1EUV B;  2NMQ A;  5IKC M;  1EF1 A;  4MM3 A;  2HTM E;  3WIM A;  2CS4 A;  3NVY A;  5G5G A;  3NZU A;  2DX5 B;  1JML A;  1L0X B;  2IO1 B;  1F9J A;  3IHP C;  4NNJ B;  1AWD A;  1L4D B;  3N20 C;  3X23 A;  2MJE A;  2JU6 X;  1ZW7 A;  2KDF B;  2GBN A;  3QQ8 B;  1M4V A;  5FR6 A;  2ZPY A;  4JWS C;  2R2O A;  3PLU A;  1F2R I;  4GXB A;  4REZ A;  3Q69 A;  1TKY A;  3RNE C;  4EE2 A;  2RDH A;  1F1H A;  1IP9 A;  2KTR B;  3IVF A;  5L95 C;  5BMG A;  2RDB C;  4USA A;  2B3A A;  1HQR D;  1IPG A;  3KW5 B;  1QZE A;  4KSK C;  1D5X C;  4PS8 A;  4RGN A;  2X38 A;  1GAQ B;  3OWE B;  2KT7 A;  2PE9 A;  1V9J A;  4MSM B;  4PT5 A;  2WYQ A;  2IGH A;  3TEX A;  2IJ0 A;  4RF0 A;  4RNA A;  1SXT A;  1TKE A;  2N7D A;  3L16 A;  4DHJ D;  2I2Y A;  2WXF A;  3BIN A;  5IA7 A;  3HM3 A;  1I35 A;  2E3T A;  4DXF A;  3NVW A;  3ZJU A;  5TSS A;  1OEY A;  3IG3 A;  2KAC A;  4RGT A;  1NEK B;  1TYG B;  2WDR B;  2H88 B;  3NHE B;  1WR1 A;  3BK1 A;  5EE9 A;  2IND C;  4ICU A;  3UIN B;  3ENE A;  1ZXI A;  2V4I B;  3VUW A;  3QA8 A;  4HPL B;  2MP2 B;  4JE3 B;  2JT4 B;  4HDO A;  1D5M C;  1TY2 A;  1V5O A;  1WXQ A;  3S2A A;  1CK1 A;  1E8X A;  1EWY C;  4NPN A;  1UF0 A;  1T0S C;  2JZ3 B;  4G11 A;  4L23 A;  3M63 B;  1WZ3 A;  4IUM B;  4BOZ B;  1L4Z B;  2IO0 B;  4GSW A;  2FIF A;  1ZP0 B;  3A9J A;  2Y5B B;  3EGR A;  2LVQ A;  4N6E B;  1UWX A;  2CR5 A;  2KWC A;  3DHH C;  4E71 A;  2KK8 A;  1WF9 A;  2X8X X;  4ANV A;  2ZNV C;  1ET6 A;  2A4Z A;  2A5U A;  4EZL A;  2VH1 A;  4IDI A;  1E7P B;  4WWM A;  2WXJ A;  3HVD A;  2QHO A;  2EMT A;  1K50 A;  2LRW A;  2K8H A;  1TKG A;  3JSV B;  3DHI C;  2DNF A;  2MJ3 A;  2WXL A;  3I3T B;  5J17 A;  3C8Y A;  4GDK A;  1ZOY B;  1TZ1 A;  1TJE A;  1WY8 A;  4W9G A;  2J0M A;  1XEE A;  4CHK A;  1DOX A;  4XDC A;  1AW7 A;  3AEE B;  4AWJ A;  1AAR A;  1BT0 A;  2TSS A;  4EZJ A;  2MQJ A;  2SEB D;  2WGS A;  3L54 A;  4P7I A;  2OJR A;  4S0R A;  1D6E C;  1V1P A;  3DPD A;  3W9C B;  1C78 A;  4WQM A;  5IN7 A;  2G45 B;  3Q8A A;  2XK5 B;  2K8C A;  4FHK A;  2HTH A;  2DZM A;  2M19 A;  4HDQ A;  2D07 B;  1KTK A;  3KUZ A;  4OZB A;  2D3B A;  3APF A;  4R3D A;  5HHD G;  1KLU D;  4P1C C;  3ML8 A;  1OQQ A;  4MT5 A;  4KDL B;  4ZYN A;  3J9C A;  1C4P A;  1XF5 L;  4LNO A;  2N9L A;  1FMA D;  1YQB A;  4XC2 A;  3TCA A;  4GGQ A;  5D6J B;  3LDZ E;  1WWT A;  1UWM A;  5IOI A;  2BPS A;  4PS7 A;  2PMV A;  2NVU I;  4MGI E;  3H7S A;  1VLB A;  1XCQ L;  2DYB A;  4M0W A;  5C3J B; 
#chains in the Genus database with same CATH homology
 1KOT A;  3W1S C;  1GG3 A;  2KZR A;  1GUA B;  2KFK B;  2HJ8 A;  2NCN A;  2C7H A;  4MSQ B;  2BYV E;  2JPH A;  1GNU A;  2KFK A;  5G55 A;  4IG7 B;  4TUU A;  1TTN A;  3KVF B;  1T0Y A;  1WXM A;  3AU4 A;  3R7R A;  1YX5 B;  3AXC A;  3UIP B;  2GBK A;  3T9L A;  3KYC D;  4EKU A;  3IBE A;  2M8S A;  4WJN A;  1LQB A;  4FJV B;  4A3O A;  3U7D A;  4EFO A;  3K9O B;  2FCM A;  4BKG A;  4FUL A;  4G3X B;  4DDI D;  3PGE A;  5IAA C;  1OGW A;  4FJY A;  1YIW A;  2NPT B;  1WGG A;  4FLH A;  5TR5 A;  3LJ3 A;  2LRU A;  3VH4 B;  4KZ0 A;  5AZF A;  3AU5 A;  4KVG B;  4W9H A;  1LFD A;  2AL6 A;  1UGM A;  2JF5 A;  4K7U A;  4CYE A;  2J0K A;  2LXA A;  1LXD A;  1KJT A;  4MJS B;  4DK5 A;  1A5R A;  4GDL B;  4MDK E;  3HIZ A;  4MJS A;  3DVG X;  4W9K A;  1WJ4 A;  2K6Q A;  2WX0 A;  2AEH A;  2BF8 B;  2KN5 A;  1WGH A;  1E8Y A;  3PRM B;  4J6I A;  2M4N A;  4GIV A;  4LJO B;  1WFY A;  1RLF A;  2G4D B;  1FXT B;  3PVL A;  2KHW B;  1Q0W B;  3B0A A;  4DHZ E;  2UWQ A;  3N3K B;  4WJO A;  4DWF A;  1WE6 A;  4G0N B;  3VVW B;  2L7R A;  1UH6 A;  2LXC A;  3VHT C;  2M1M A;  4FJZ A;  4HPM B;  4DXA B;  1I42 A;  5CTR C;  1Z2M A;  4BFR A;  3TBL D;  1IYF A;  3KUC B;  2DAF A;  3RT3 B;  5CHW A;  1WX7 A;  2DZK A;  1WXA A;  1KM7 A;  2KLG A;  2IZV B;  3C0R B;  3NS8 A;  3ZVV A;  4ZRJ A;  1UBQ A;  2KTF A;  1L2N A;  2MSE D;  4KZC A;  4W9F A;  1UEL A;  2N1W A;  3T8M A;  2MBB B;  5EDS A;  3VQI A;  2V3S A;  3A1Q A;  4JLC A;  4KDI C;  1E8Z A;  5DPR A;  4FA6 A;  2DZJ A;  2MA9 B;  2KTR A;  2D3G A;  3VUY A;  3B1L X;  4G50 A;  3V6E B;  2KMC A;  4IWP A;  3TJP A;  5JHA A;  4MGZ E;  1WX8 A;  1WZ0 A;  3ZO5 B;  2XEW A;  1ISN A;  3DDC B;  2FID A;  1VCB A;  2L00 B;  3M95 A;  1LM8 B;  3QWZ B;  1UBI A;  2ASQ A;  3HK0 A;  4M8N A;  3SDL C;  2D11 A;  2EMS A;  2ZCB A;  1WX9 A;  1YD8 U;  1WGR A;  3ONS A;  2NBW B;  3L10 B;  2M0X A;  1CMX B;  4I6P A;  3M62 B;  4F7Z A;  5JZE B;  1GJZ A;  4GB9 A;  2C60 A;  1WRD B;  3GOE A;  1RFA A;  3TIX A;  2LZ6 A;  3ZNZ B;  1P1A A;  4I6N B;  1EF5 A;  3SD5 A;  3RZF A;  4BKS D;  3ALB A;  3UGB B;  4E3C A;  2J7Q B;  3QHT A;  4F1S A;  1WMH B;  3VUX A;  3R3M A;  2DYM A;  4HWI B;  2KDE B;  2HE7 A;  3L0W B;  5BO4 B;  3APD A;  3R7Q A;  2O2V B;  2N9X A;  3H1U A;  5LXI B;  3CMM B;  4ZRK A;  3RUL A;  3UQB A;  3ZTC A;  3WA0 A;  2K6D B;  3A9K B;  3TMP B;  1XT9 B;  5L83 A;  2LAS A;  3CST A;  1Z5S B;  3ZRF A;  3A9K A;  4YL8 A;  2D2Q A;  4K81 A;  3DBL I;  4OVV A;  3PSE B;  5D2M B;  5E6O A;  2GMI C;  1PQS A;  2N9E B;  4HXD A;  2C7N B;  4WJP A;  3VTW A;  4IWO A;  1ZGU B;  4NQL B;  2VRR B;  1WJN A;  3W1Y A;  4AOF A;  4B6W A;  1WR6 E;  4ANX A;  4PYU A;  4JQW C;  3A33 B;  1YX6 B;  1SIF A;  2KWU B;  4IM0 A;  3VAW A;  4FN2 A;  4NQK E;  2GOW A;  3DVN U;  4W9J A;  1SGH A;  2FAZ A;  1V49 A;  5G2N A;  3EC8 A;  3WAN A;  3ZLZ A;  2ZZP B;  4W9C A;  4HVB A;  4W9D A;  4E74 A;  3BY4 B;  3CF6 E;  1NDD A;  4HK2 A;  1RAX A;  3PLV A;  2N7E A;  3RD2 A;  4MEL A;  2NBV B;  2KO3 A;  3PS6 A;  2ZPN A;  4RMA A;  4LDT D;  4KIK B;  1E90 A;  3ZDT A;  4EZK A;  4KIK A;  3VH3 B;  3NY5 A;  4WWN A;  4RM9 A;  2KWV B;  1WGD A;  5C1Z A;  1XQQ A;  2BKR B;  1C1Y B;  2ZVN A;  4HCN B;  1C3T A;  3OLM D;  1V80 A;  1EUV B;  4KV2 A;  3KYD D;  2IY1 B;  2K1F A;  3H6N A;  1EF1 A;  3ECI A;  4MM3 A;  1WH3 A;  1V2Y A;  2I1K A;  2KC2 A;  3WIM A;  2CS4 A;  2L8J A;  4MH0 E;  2KVR A;  1VD2 A;  2IYD B;  4II3 B;  4K1R B;  4OVU A;  1TGZ B;  2WX1 A;  3U30 A;  4B9K A;  2KXJ A;  3NZU A;  2DX5 B;  2WDT B;  3DBH I;  3WAL A;  2IO1 B;  1F9J A;  2JUO A;  3DBS A;  3IHP C;  1P9D U;  2NR2 A;  4NNJ B;  1XD3 B;  3VTV A;  3VTU A;  2FCS A;  2RPQ A;  1S3S G;  3SHQ A;  4ANU A;  3ML9 A;  3Q3F A;  3RCZ A;  4K7S A;  3X23 A;  2BWE S;  2R2Q A;  1ZW7 A;  2JRI B;  2PJH A;  2KDF B;  1E7V A;  2GBN A;  3QQ8 B;  2PPH A;  4PS3 A;  1HE8 A;  3DOW A;  4FAD A;  2LJ5 A;  3JW0 X;  5FR6 A;  2ZPY A;  3VFK A;  2LVP A;  3JSV A;  3ZTD A;  1NI2 A;  2LD9 A;  2LGY A;  2MBE A;  1Y8R C;  2KD0 A;  1TBE A;  2R2O A;  3PLU A;  4TQ0 A;  5AZG A;  4GXB A;  4HJK A;  4WQO B;  1MG8 A;  4JIO U;  4MEM A;  3PPA A;  2KDI A;  3A1Q B;  1R4M I;  1P3Q U;  2C5L C;  2DEN B;  2KTR B;  3IVF A;  1IP9 A;  5L95 C;  3SU8 X;  3EHV A;  2I1J A;  4GMV A;  3HM6 X;  5KHO A;  1V81 A;  4BOS C;  2B3A A;  5DPS A;  4BKS A;  5LXH A;  3ZNI D;  4W9I A;  4I6L B;  2FCN A;  2MBO A;  1IPG A;  2MWS B;  3KW5 B;  1QZE A;  3PHX B;  4KSK C;  4ANW A;  2XBB C;  2NBU A;  1WM3 A;  2NS5 A;  3MHS D;  4PS8 A;  5J2R A;  2O6V D;  5D7G A;  4NJ6 A;  5CHF A;  2MRP A;  2N9P C;  2KOX A;  3PRZ A;  2PE9 A;  1V9J A;  3A4R A;  2FNJ B;  4FHJ A;  1H8C A;  2JRH A;  4MSM B;  1E5W A;  4X57 B;  2KC1 A;  2WYQ A;  3PRE A;  1GC7 A;  5GMV A;  2PEA A;  4EOY A;  2G3Q B;  2JXX A;  2YVC A;  3UIO B;  1SE9 A;  3DBR I;  4JGH B;  4LCD E;  2W9N A;  3JVZ X;  2N7D A;  2BYE A;  4MGK E;  2RR9 A;  3L16 A;  4IM2 A;  4DHJ D;  3OJ4 B;  3BIN A;  5IA7 A;  3H9D A;  3HM3 A;  4JL9 A;  4K7W A;  1I35 A;  1RRB A;  2PE6 B;  3K9P B;  3OJ3 A;  3GZN I;  3ZRC A;  4URK A;  4W9E A;  1OEY A;  2KX3 A;  2OOB B;  2KAN A;  3IG3 A;  4EUT A;  1OTR B;  4WWP A;  3KUD B;  2DHZ A;  1UZX B;  2JWZ A;  4AJW A;  5D94 A;  3JYU A;  3D32 A;  3PTF C;  4M8M A;  2IY0 B;  3WAO A;  1WJ6 A;  3NHE B;  3CSF A;  1WR1 A;  3DVG Y;  3M3J A;  2K39 A;  4DBG A;  4B95 A;  4DHZ B;  3MJW A;  3ZNH B;  1WE7 A;  2DZI A;  4ICU A;  1G6J A;  4GU2 A;  3ZKJ C;  3UIN B;  3ENE A;  2AL3 A;  1J8C A;  3X0W A;  1P98 A;  2Z59 B;  4NAW B;  3QAR A;  1J0G A;  2L0F A;  1ZKH A;  3QAQ A;  4NAW A;  3VUW A;  2FUH B;  3QA8 A;  4HPL B;  4IW0 A;  2EKE C;  2KX0 A;  3EEC A;  4F8C B;  2MP2 B;  3W1S A;  3MTN B;  2LUE A;  3OAW A;  3O65 B;  2JT4 B;  2MP2 A;  3NOB A;  1V6E A;  2IBI B;  4HDO A;  3VXW A;  4WWO A;  1V5O A;  2G4S A;  2KDB A;  3S2A A;  4AUQ C;  4HLE A;  3H7P B;  1E8X A;  4LJP B;  4A20 A;  5AZH A;  3N32 A;  3H7P A;  4NPN A;  3UQA A;  4GOC A;  1WGY A;  2JZ3 B;  2KJH B;  3QK0 A;  4G11 A;  1WM2 A;  4ZDV A;  2KFJ A;  3PT2 B;  3M63 B;  1M94 A;  2FCQ A;  1JRU A;  1WZ3 A;  4IUM B;  3A9J B;  4BOZ B;  5KHQ A;  2IO0 B;  3ZNG C;  2RD0 A;  2AYO B;  2FIF A;  3A9J A;  4GSW A;  4BBN C;  3P2B A;  3QIJ A;  2J0J A;  1R4N I;  2Y5B B;  3RYT A;  2RSU A;  4AJY B;  2ZVO A;  2CU1 A;  2UYZ B;  2LVQ A;  3PV1 A;  2WWZ A;  2MBQ A;  1E7U A;  4TV3 A;  4NY0 A;  2CR5 A;  2KWC A;  2ZNV B;  2DYO A;  5JH5 C;  4HCP B;  2V4L A;  3AI5 A;  4E71 A;  2KK8 A;  4II2 B;  1WF9 A;  3PZD A;  2KKC A;  3VDZ A;  3U8Z A;  4ANV A;  1WIA A;  2NPT A;  3PHW B;  2C9W B;  2ZNV C;  1OEY J;  5HKH A;  3ZUN A;  1J19 A;  2A5U A;  2A4Z A;  4XX5 A;  4EZL A;  2MBH A;  3QC8 B;  1P0R A;  4ZRI A;  5C23 A;  1Q1O A;  4PYZ A;  4TKN A;  2L05 A;  2QHO A;  2EMT A;  4MGY E;  4ICV A;  3ZW3 A;  4IC7 B;  5J18 A;  2LRW A;  2K8H A;  2CHZ A;  4GDL A;  5E6P A;  4ASW C;  2O6V B;  3JSV B;  4CO7 A;  2LWP A;  2IO3 B;  2HD5 B;  4XZ4 A;  2O6V A;  3V6C B;  3WAP A;  3V60 A;  1EO6 A;  3I3T B;  2C7M B;  4GDK B;  5J17 A;  2LGX A;  5CX3 A;  4DDG D;  4GDK A;  1TZ1 A;  2BGF A;  1WY8 A;  3AUL A;  4W9G A;  3ZIM A;  3DQV A;  2J0M A;  3DVN V;  3NZS A;  4IM3 A;  4CHK A;  1KLV A;  1H4R A;  2CHW A;  2BWF A;  3KH0 A;  2L0T A;  2KNB A;  4AWJ A;  2V1Y A;  4DHJ B;  3R66 C;  2AWT A;  4AP4 C;  2REX A;  4FBJ B;  1AAR A;  2LGD A;  3UF8 A;  1BT0 A;  4EZJ A;  3TL5 A;  1GC6 A;  2YLM A;  1UD7 A;  2MCN B;  5AEK B;  5JHB A;  2MQJ A;  1WXS A;  2LI5 A;  3L54 A;  4P7I A;  2KQ7 A;  2OJR A;  3PRP B;  2BYF A;  4GN1 A;  3RUI B;  2K25 A;  2GBM A;  1U4A A;  4A3P A;  3B08 A;  5DCN A;  3RZW C;  2ZJD A;  2N1V A;  2L76 A;  2MW5 A;  3DPD A;  2DAJ A;  3EFU A;  2Z0D B;  2BKF A;  2G45 B;  5LLI A;  2XK5 B;  2KLC A;  2JVC A;  2K8C A;  2M17 A;  2XK5 A;  4FHK A;  2D10 A;  1E8W A;  2HTH A;  2DZM A;  4NJ7 A;  1D3Z A;  3HHM A;  1V5T A;  4HDQ A;  3A4S C;  1V86 A;  5CHV C;  1WYW B;  1WJU A;  2D07 B;  3QCA A;  3KUZ A;  3APF A;  1WXV A;  5DPW A;  4KSL C;  2GBR A;  3V62 A;  2RGF A;  5DPT A;  3QX1 A;  4WJQ A;  2Z0E B;  3ML8 A;  2JZZ A;  3ZDM C;  4BBN F;  4EEW A;  3WAM A;  4KDL B;  4TQ1 A;  2ZEQ A;  1S1Q B;  4BVU C;  3QJZ A;  4ZYN A;  4LDT B;  2N4F A;  1Q5W B;  2KMA A;  3APC A;  2L3Z A;  2CKH B;  1L7Y A;  3N30 A;  1YQB A;  4XC2 A;  3V61 A;  2KJ6 A;  5E6N A;  3TCA A;  4GGQ A;  3Q3J A;  3L08 A;  2CHX A;  2KQS A;  2LVO A;  4WAA A;  5D6J B;  3IFW B;  1WMH A;  3LDZ E;  2K8B A;  1OQY A;  1WI0 A;  2IO2 B;  2BPS A;  1YJ1 A;  2GBJ A;  1NBF C;  4RM8 A;  2O2V A;  4PS7 A;  4N9F 4;  4BKT A;  2JY6 A;  2NVU I;  3L17 A;  4MGI E;  3H7S A;  1K8R B;  3L13 A;  4M0W B;  2MX2 A;  2ZCC A;  2DYB A;  3DCG A;  2KJR A;  4W9L A;  1X1M A;  2MLB A;  4IWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...