3RT3B

Complex of influenza virus protein with host anti-viral factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
WDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKSDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ISG15
publication title Crystal structure of human ISG15 in complex with influenza B virus NS1B
rcsb
source organism Homo sapiens
molecule tags Antiviral protein/viral protein
total genus 36
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rt3B02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rt3B01
3U8ZA 2J0MA 3KYDD 4MGZE 3A33B 2JVCA 2MBHA 3VDZA 1TTNA 4I6NB 1V49A 1SE9A 1Z5SB 2KTRB 3IHPC 4IWOA 2KFKB 3WAMA 1I42A 1XT9B 2ZPYA 3ZDMC 2NPTA 1UH6A 2KWCA 3D32A 3L54A 4HWIB 3PRZA 3A4RA 2DX5B 5JHAA 2BKFA 2FAZA 2WX1A 4GMVA 4I6LB 3JW0X 2ZCBA 2LASA 3X23A 3ZNGC 1IYFA 2FIFA 1SGHA 1ZW7A 1IPGA 4GDLA 2CHZA 3ALBA 3ZIMA 1Z2MA 4DHZB 4WJPA 2K8BA 1HE8A 2OJRA 1E8ZA 4II2B 3VTVA 4AJWA 4MGYE 2DZKA 3KUDB 4F8CB 4AWJA 2KLGA 2NCNA 2HD5B 2KC1A 2NR2A 4KSKC 1LXDA 1MG8A 4ZRJA 3H7PB 2D2QA 4EZKA 1TZ1A 4IWPA 1H8CA 3NS8A 2AL6A 3SU8X 2KO3A 1WY8A 2QHOA 2IO2B 3N30A 2UYZB 3A9JA 3QA8A 3A1QB 2KFJA 4IG7B 3APDA 2N1VA 3RCZA 5AZGA 4ICVA 2MSED 4GDKB 1X1MA 4K7UA 3DVGY 3T8MA 3ZUNA 3JYUA 3KVFB 1WFYA 3PRMB 2O2VA 4NQKE 1Q5WB 3ZDTA 2CS4A 4IWQA 4NQLB 1WXAA 2KWUB 3R66C 5HKHA 2K6DB 1E8XA 3H6NA 2FCQA 4HDQA 4NPNA 3W1YA 4W9HA 1NI2A 1OTRB 2BPSA 4E74A 5L83A 2WDTB 5AZHA 4ANVA 1UBIA 2BYEA 3QQ8B 4NAWB 3QHTA 5G55A 3L08A 4LCDE 1R4MI 4X57B 2G3QB 3PREA 4AP4C 4LJOB 1H4RA 3AU4A 3CMMB 4RM8A 3WAOA 2XK5B 4E3CA 4ZRKA 3V6CB 3WIMA 2RSUA 3WANA 4AJYB 3RYTA 2C7NB 3VVWB 3B1LX 3H1UA 4JGHB 4ASWC 1P1AA 2RR9A 3V62A 4KIKA 2V3SA 3M3JA 4XX5A 2ZZPB 1P0RA 4ZRIA 3PT2B 4W9EA 3VTUA 2LI5A 2L0FA 3B0AA 2IO0B 2MBQA 3VTWA 2I1JA 3LDZE 5AZFA 2KTRA 2KQ7A 2DENB 2KFKA 2M1MA 3MJWA 5DPRA 3VUWA 1A5RA 1J19A 2G45B 1XQQA 3V61A 4MELA 1VD2A 5DPSA 1WXMA 3QCAA 2K8HA 2DYBA 2UWQA 4TQ1A 2MQJA 4HCPB 4DHJB 4ZYNA 2KDFB 1WGHA 1P3QU 2GMIC 5AEKB 1WX8A 3ZLZA 3PVLA 2IY0B 2K1FA 1V5TA 2KWVB 2EMTA 2MA9B 3ZKJC 1UELA 3PHXB 4WWOA 4FULA 5D7GA 5J2RA 4PS8A 3KYCD 3ZRCA 2OOBB 2REXA 4F7ZA 2NBVB 4KVGB 4HDOA 4URKA 1WR1A 2C9WB 2KK8A 4WQOB 4CHKA 3L10B 4A3PA 1E7UA 2DZJA 2KOXA 1F9JA 2A5UA 2DZIA 3PV1A 3K9PB 1RFAA 5EDSA 2ZCCA 2IBIB 4G11A 1WE6A 3RULA 2DAJA 2LUEA 3R7RA 5JHBA 3A1QA 5GMVA 5G2NA 2RPQA 3NOBA 4DDGD 2KJ6A 4AUQC 3ENEA 2JUOA 2CR5A 2LGDA 4BBNC 3W1SA 2GBMA 1UBQA 3ZTDA 3PS6A 3HHMA 4GDKA 4MJSB 3AXCA 2LD9A 3JSVB 4FN2A 4NY0A 3QARA 4MSQB 4PS3A 1UD7A 4FADA 4IC7B 4CYEA 2M8SA 4FJVB 3VUXA 3VH3B 2LRWA 3PRPB 4ANWA 1E7VA 1V5OA 2K6QA 2Z59B 3AU5A 2M17A 1WI0A 1E5WA 5IAAC 2FNJB 4NAWA 2AL3A 2C7MB 3KUCB 5J17A 2L76A 4P7IA 2FCMA 4F1SA 3QAQA 5J18A 2BWFA 3ZO5B 4BOSC 4ANUA 1YJ1A 1GUAB 1G6JA 4W9CA 1WRDB 3HM3A 1WGGA 5L95C 4M0WB 4FJZA 2XBBC 1KLVA 1CMXB 4A20A 2KHWB 2KDBA 2JRHA 2XEWA 3ZVVA 3V6EB 1RAXA 3AULA 4J6IA 3T9LA 1V80A 3PGEA 2JWZA 4PS7A 2V4LA 3CSTA 5C23A 2KQSA 2KLCA 4BVUC 1TGZB 2FCNA 4XC2A 3RUIB 1EUVB 1OGWA 1WYWB 2D11A 2D3GA 1ZGUB 2ZPNA 2R2OA 4BKTA 2Y5BB 2C60A 2KNBA 2LGXA 2NBUA 3I3TB 5D6JB 2KDEB 3ZNZB 2MP2B 3PPAA 3DBHI 3HIZA 4DXAB 4KSLC 2W9NA 4ICUA 3VAWA 2MBOA 4GN1A 2JZ3B 4K81A 4ZDVA 2JXXA 2PPHA 3TBLD 1P98A 1GC7A 2ZEQA 3VH4B 3L13A 1L2NA 1Q1OA 1R4NI 1TBEA 2L7RA 4IM2A 2GBJA 2AYOB 1D3ZA 4RM9A 1AARA 2BWES 3U7DA 4DHJD 3DVNU 4JL9A 4HPMB 3GZNI 1WIAA 3RD2A 2BF8B 3P2BA 2KANA 3EFUA 2M4NA 3RZFA 3TIXA 1C1YB 2KX0A 3APCA 3TCAA 3DDCB 2N1WA 4AOFA 3GOEA 3A9KB 1Q0WB 3DQVA 1V6EA 2JZZA 4KV2A 1J0GA 4TKNA 3HK0A 3TMPB 1WMHB 2R2QA 3UQAA 3QIJA 4TQ0A 5FR6A 4B95A 1WJNA 1J8CA 2J0KA 3CF6E 1WZ3A 3KH0A 4DWFA 2O6VD 4G50A 1K8RB 5KHQA 3DPDA 1WM2A 2J7QB 1NDDA 4K7SA 4KZCA 5DPTA 3OLMD 2N9PC 2ZNVC 3OJ4B 5CHVC 4ANXA 1QZEA 2LZ6A 5BO4B 4NJ6A 2K25A 1V86A 3DVNV 4N9F4 3RZWC 4MJSA 3M63B 3JSVA 4GIVA 2MCNB 1ZKHA 5JZEB 1XD3B 1Y8RC 2KVRA 4WJNA 4W9FA 4GSWA 3VUYA 3DBLI 3WA0A 4NNJB 1L7YA 2Z0EB 2KC2A 2LWPA 3ECIA 2LXCA 4PYZA 2N7EA 2VRRB 2MRPA 3L17A 3UIOB 2GOWA 3DBSA 1M94A 4BKSD 1WXVA 2N9EB 2MWSB 2DAFA 3H7SA 2IYDB 1IP9A 3S2AA 4OVUA 1WM3A 4IM0A 3IFWB 1C3TA 5E6NA 1S1QB 2IO1B 3TL5A 2EMSA 4FJYA 3NY5A 4LJPB 2O6VB 4XZ4A 3PZDA 4DDID 3UQBA 1KM7A 2MLBA 3B08A 3H7PA 3H9DA 2LVOA 4W9IA 3L0WB 4K1RB 2KMAA 4WAAA 5LXHA 3QX1A 4MGIE 1V9JA 2N7DA 5CX3A 3SDLC 3JVZX 4EZLA 2NVUI 2KX3A 5D94A 3R3MA 1GG3A 4M8NA 2WYQA 2IZVB 3ZW3A 1BT0A 3EHVA 1FXTB 3KUZA 2FUHB 1WX7A 2JT4B 3WAPA 1LFDA 3UGBB 2C5LC 2MP2A 1YIWA 1WGDA 3ONSA 4JQWC 4KIKB 4WJQA 3PSEB 5LLIA 4EZJA 2Z0DB 2HE7A 4MEMA 3SHQA 3PLVA 2KN5A 5LXIB 3BY4B 3DCGA 1WGYA 3APFA 2AEHA 2C7HA 2J0JA 4LDTB 1V81A 1YX6B 1KOTA 2YVCA 4K7WA 3UIPB 2KJRA 4W9LA 4FHKA 5TR5A 3HM6X 2KXJA 2CKHB 2KTFA 1U4AA 3M62B 4HJKA 3DVGX 4E71A 2A4ZA 2GBNA 2XK5A 3QK0A 5CHWA 3NZUA 2D07B 4IW0A 1I35A 3O65B 2MBBB 2BGFA 1RRBA 3A9KA 3N32A 3K9OB 3C0RB 4HCNB 1EF5A 2ZVOA 2GBRA 2JRIB 2JY6A 4KDIC 1WMHA 1UGMA 1WE7A 2K8CA 4TV3A 1WF9A 1LM8B 1VCBA 3MHSD 3N3KB 4M8MA 4EKUA 4B6WA 2LXAA 4TUUA 5E6PA 4DK5A 2BYVE 3QWZB 3IVFA 2LVPA 2KZRA 1JRUA 3L16A 3M95A 4MH0E 4GOCA 4HXDA 5IA7A 4KZ0A 3V60A 3PTFC 2PE9A 2V1YA 4DBGA 4WWPA 1EF1A 2M0XA 2KMCA 5C1ZA 2K39A 3AI5A 3SD5A 4HPLB 5CHFA 2L0TA 5D2MB 4EUTA 2L00B 2PEAA 3EC8A 3VFKA 1WGRA 3R7QA 2KD0A 2NPTB 1SIFA 4MSMB 4JIOU 3U30A 3DBRI 4A3OA 3X0WA 4II3B 2WWZA 4OVVA 3RT3B 2L8JA 1S3SG 2PE6B 2ZNVB 2KJHB 1YX5B 4W9JA 2CU1A 2DYMA 2MBEA 3NZSA 3IG3A 4HLEA 2GBKA 2NS5A 1OQYA 2O6VA 3VQIA 3ZTCA 1OEYJ 5DPWA 4B9KA 4CO7A 4GDLB 4BBNF 3ML8A 5E6OA 1LQBA 1UZXB 3Q3JA 2BKRB 3W1SC 4HK2A 2FCSA 4RMAA 3KW5B 2ZJDA 4G3XB 2B3AA 2I1KA 3OAWA 4GU2A 1GC6A 5KHOA 2JPHA 4MDKE 3ZNID 4W9GA 4YL8A 4WWNA 3EECA 2LJ5A 1E90A 2EKEC 4FLHA 2L05A 2MX2A 2ZVNA 4GB9A 4IUMB 4EFOA 4BOZB 1WZ0A 2LVQA 1T0YA 4KDLB 4BKSA 4EEWA 4NJ7A 3A9JB 3ZNHB 4WJOA 4W9DA 2LRUA 2DHZA 2KDIA 3TJPA 1YD8U 3UINB 3ML9A 2PJHA 2BYFA 1KJTA 2WX0A 3WALA 4MGKE 2RD0A 2DZMA 3ZRFA 1GNUA 2G4DB 1WXSA 3MTNB 2N9XA 3A4SC 3PLUA 2L3ZA 3VXWA 1WJUA 3Q3FA 2N4FA 4DHZE 2ASQA 2O2VB 3DOWA 4LDTD 4BKGA 3NHEB 2FIDA 3QC8B 1YQBA 1WH3A 3IBEA 3VHTC 4JLCA 2CHWA 2HJ8A 4GGQA 4W9KA 2IY1B 2RGFA 4FBJB 3CSFA 4MM3A 1OEYA 1PQSA 2JF5A 4G0NB 2DYOA 3UF8A 4FA6A 3LJ3A 1P9DU 1NBFC 1E8WA 1ISNA 4PYUA 5JH5C 2CHXA 2LGYA 2IO3B 3BINA 1GJZA 2MW5A 2KKCA 2NBWB 1WX9A 2HTHA 1E8YA 2YLMA 3QJZA 2AWTA 2G4SA 3PHWB 1EO6A 1V2YA 1WJ4A 4BFRA 4IM3A 4FHJA 1WJ6A 1WR6E 1RLFA 4I6PA 5CTRC 4HVBA 5DCNA 4EOYA 4GXBA 3OJ3A 2D10A
chains in the Genus database with same CATH superfamily
3KYDD 3A33B 3DBLB 2JVCA 3VDZA 3WAMA 2KFKB 3AB5A 1I42A 3BVZA 1F1HA 3P63A 3OWEB 2WQYB 1V1PB 3P42A 3JW0X 4FXCA 1DOYA 2LASA 3X23A 3ZNGC 1SGHA 2CHZA 4LNIA 3ABVB 2OJRA 3J9CA 1E8ZA 4II2B 4AWJA 1HZ6A 1R7SA 1KLGD 2WXIA 1H8CA 3NS8A 3SU8X 2UYZB 3A9JA 3LB8C 2D3CA 4ZYSA 2KACA 1T5XD 5AZGA 3PZ7A 4K3BA 3DVGY 2CS4A 4NQLB 3MC8A 1WXAA 2K6DB 1OTRB 1GB1A 3QQ8B 1SBBB 3QHTA 2JYEA 3L08A 4LCDE 3PREA 2CU3A 1JALA 4AP4C 1H4RA 3CMMB 2XK5B 2INNE 3WIMA 5G5HA 3AMZA 2C7NB 3VVWB 1E7PB 2K5PA 3C19A 1WXQA 4ASWC 2L1AA 1XLOA 3M3JA 4XX5A 4C4VA 1TS3A 1R4NB 3B0AA 3BYYB 2KFKA 1J19A 1VD2A 4O1NA 5DPSA 3BYTB 4NAMA 1V1PA 2UWQA 4TQ1A 2MQJA 1P3QU 2GMIC 2LMCA 3AEEB 3NG0A 4US9A 3PVLA 3ZJVA 2KWVB 4TMAB 2EKIA 2M0AA 1YQ4B 1J7AA 5J2RA 3HUIA 4URKA 1LGRA 2KK8A 1EU3A 3EFCA 3L10B 1E7UA 5BMGA 1MG4A 4YXDB 2VH2A 3PV1A 4L2YA 3R7RA 1VZ8A 2QEJC 3ENEA 2CR5A 2IDYA 2LD9A 1RWSA 3N1ZC 4MSQB 1UD7A 1N5XA 2GRIA 4ANWA 1ET9A 1JROA 2K6QA 2Z59B 3Q8FA 1WI0A 1E5WA 5IAAC 5H92C 2FNJB 2JQRB 1V8CA 2AL3A 2L76A 4F1SA 1MI0A 3QAQA 2VZKD 1XCTL 3HM3A 1WGGA 3Q3NC 4M0WB 2XBBC 3TEWA 5H8YE 4HKZE 3T9LA 4PS7A 2JWZA 2V4LA 4BVUC 5MPOA 4XC2A 4IOIE 1WYWB 2D11A 3BIID 2KVZA 3BWUD 4BKTA 2KNBA 4P1CC 3ZNZB 5FKAC 3MC9A 1QT9A 1SXTA 3HIZA 4ICUA 4GN1A 1PGBA 2PPHA 1P98A 3VH4B 3TEYA 1NYQA 1Q1OA 1R4NI 1TBEA 1UWMA 3ZQ4A 5C2TB 2AYOB 3IT6B 1WWTA 1AARA 3U7DA 4JL9A 4HPMB 4M02A 2R61A 3B2GA 3GOEA 3HRDD 4KV2A 1MFWA 1WMHB 4B95A 4WWMA 1K8RB 5KHQA 2XNAC 5DPTA 5IP4D 4ANXA 5BO4B 3RZWC 1D6EC 4GIVA 1Y8RC 2KVRA 3VUYA 3NRZA 3ECIA 2LXCA 2GOWA 3DBSA 2N9EB 1IUEA 5AUKA 2LHEA 4A55A 3IXSA 3H7SA 2IYDB 1WM3A 3TL5A 3NY5A 3UQBA 3H8HA 1KM7A 3FKYA 4M0WA 3H9DA 4QAYA 1SSNA 2BBCA 1TY2A 4A8XC 2JZPA 1WSPA 2NVUI 3ETRA 3R3MA 1GG3A 2WYQA 1P7EA 2IZVB 2PVOD 1P7FA 1A70A 2JT4B 3AE2B 1LFDA 4RGMA 2G1EA 5LLIA 4MT5A 2HE7A 3NVZA 5LXIB 4KX6B 2AEHA 1K51A 2YVCA 2BB6A 2KJRA 1T0QC 4FHKA 5TR5A 2BQQA 1F2RC 2CKHB 3TUOA 5CHWA 3U2SC 1JMLA 2D07B 2J4XA 2MBBB 1MPEA 3V05A 2GBRA 4B0MA 1FXAA 1WMHA 4RCOA 3KWVA 1QF6A 1WGKA 1LM8B 4M8MA 1DGJA 4DK5A 1XLNA 2BYVE 3IVFA 1YJJA 4MH0E 4GOCA 2L52A 5IA7A 2KDMA 2SEBD 1SE4A 2PE9A 2IGHA 1EF1A 1I4QA 4HPLB 5CHFA 2JSVX 4EUTA 2L00B 1EWCA 3VFKA 3FILB 3IAS1 2KD0A 3Q14C 1FM0D 4MSMB 1VZ6A 3MHZA 1N61A 1OQRA 4A3OA 3X0WA 1BUIC 4XYCA 2ZNVB 1YX5B 4HROA 2CU1A 2CJNA 1OQYA 3ZTCA 1OEYJ 4GDLB 2BKRB 4P1BC 4G3XB 1UWXA 2I1KA 4GU2A 5KHOA 1I4PA 2MX2A 2ZVNA 4EFOA 3PZ8A 2V3NA 2LVQA 1T0YA 4BKSA 4EEWA 1XO3A 1GB4A 5FR3A 3ZNHB 4W9DA 2FE8A 2LRUA 3TJPA 1YD8U 2WX0A 4MGKE 4WURA 1KFYB 2GLSA 3MTNB 2KQ4X 3PLUA 2N9XA 1DYQA 3VXWA 1QOBA 3Q3FA 4DQOC 1SEBD 1WH3A 3IBEA 3VHTC 2HJ8A 4W9KA 2RGFA 3GE8C 2OJWA 1FFUA 4MM3A 3UF8A 3LJ3A 2WS3B 1ISNA 1GJZA 3QJZA 1WJ6A 1WR6E 1RYJA 2HTME 4GXBA 3MC0B 2W3RA 3U8ZA 2V9HA 1TTNA 2MJDA 1V49A 1SE9A 3IHPC 2KTRB 3GS2A 4WQMA 1UH6A 3SFDB 4HWIB 1F77A 2DX5B 2FAZA 4LNOA 2DLBA 2ZCBA 4RF0A 4GDLA 1UF0A 3ALBA 3ZIMA 1Z2MA 4DHZB 1V97A 2K8BA 2WXMA 4AJWA 2DZKA 4WAFA 2KLGA 2NR2A 4KSKC 3RNFC 1PYWD 2MEKA 1TZ1A 2D3BA 1V1OA 1L0VB 2KO3A 2JXTA 3NJTA 2IO2B 3QA8A 3A1QB 1C79A 2J52A 3E56A 1X1MA 4K7UA 4YSYB 3T8MA 2BB5A 3JYUA 1WFYA 2WXLA 3PRMB 1Q5WB 4H2AA 2K9XA 5HKHA 4N58A 2FCQA 4HDQA 2LFIA 4NPNA 2GB1A 4W9HA 4ANVA 2BYEA 4NAWB 5G55A 1EM7A 4LJOB 1BMLC 3AU4A 3WAOA 4C7ZA 3V6CB 4JGHB 2RR9A 1XF5L 4KIKA 1P0RA 4ZRIA 4W9EA 3AE8B 4PK1A 2AQ2B 3LDZE 2INDC 2KTRA 2KQ7A 2DENB 3MJWA 1A5RA 3GZNB 1XQQA 4MELA 4Q2JA 4XDCA 1CZPA 1XLQA 3DWGC 3QCAA 3AECB 4NJCA 4HCPB 1IGCA 1Y56A 1ACCA 5AEKB 1WX8A 3ZLZA 3MFGA 2IY0B 3AM9A 1L4ZB 4P6VF 2W82A 5D7GA 4PS8A 4F7ZA 1QLBB 4XWTA 1GOZA 2NBVB 2MHJA 5I4DA 1QQRA 4XWWA 1VDVA 3N20C 2Z8LA 1F9JA 2A5UA 1RFAA 2ZCCA 2IBIB 3A1QA 5G2NA 2H89B 2RPQA 4AUQC 2JUOA 3SEBA 1UBQA 3AXCA 1ROEA 3JSVB 2WGSA 2MH7A 4ZOHC 4NY0A 2JX5A 4PS3A 1YOVB 2M8SA 4FJVB 3HVZA 3PRPB 1V5OA 1OQQA 3AE1B 3AU5A 1MHXA 5EE3A 4NAWA 3KUCB 4P7IA 1KH0A 2QILA 1YJ1A 3AEGB 1WRDB 4KKJA 4FJZA 4KKIA 4YT0B 3V6EB 4J6IA 5C23A 2JU6X 2KLCA 2K0PA 2FCNA 5IKCM 3RUIB 1OGWA 2D3GA 2ZPNA 3Q3OC 1XXGA 2C60A 3I3TB 2L83A 2KDEB 1IBXA 2MP2B 2W9NA 2MBOA 2JZ3B 1NYRA 2JXXA 3AE5B 3TBLD 1L2NA 1JCKB 4IM2A 3W9CB 3GE3C 4DHJD 1ZXHA 3GZNI 1WIAA 4M00A 1SF0A 3RD2A 3EFUA 3RZFA 4RH6A 2KX0A 4AOFA 4AQ7A 2WXJA 3RNCC 4OHJA 2JZZA 1UNSA 3TMPB 1J7BA 3QIJA 1I4XA 4KGRA 2O6VD 4G50A 3RFZB 2J7QB 4KZCA 1C78A 2N9PC 4HRSA 5CHVC 3DBRB 1WRIA 1UGJA 4IDIA 1V86A 3DVNV 1YJIA 3RNEC 1SE3A 2W54A 3M63B 3JSVA 1FO4A 1ZKHA 3N9YC 2BTEA 4WJNA 3WA0A 4FBJB 3DBLI 2Z0EB 4J3OD 1TIFA 2MWSB 1F0ZA 1HTQA 3S2AA 2JYTA 4IM0A 3IFWB 5AUIA 1C3TA 1S1QB 2IO1B 2RDHA 4W9IA 2IGDA 3RPFC 1XLPA 5LXHA 3AH7A 1WYGA 3SDLC 3JVZX 2D5GA 2KX3A 4M8NA 2INCC 3ZW3A 5HI1A 1BT0A 4HKQA 3BK2A 5EE1A 1TKYA 1TS2A 1IGDA 1K53A 2VH1A 5IN7A 1ZDVA 4OZAA 2MP2A 1JWUD 3SHQA 3Q8BA 3APFA 2J0JA 5T8IA 4K7WA 3UIPB 4YTMB 5HHDG 3HM6X 2DBYA 4HJKA 3DVGX 3M62B 4E71A 2XK5A 3QK0A 4IW0A 4AS1A 2WDQB 3N32A 3RNBC 3LYYA 1KF6B 2LJIA 1EF5A 2JRIB 4KDIC 1PGXA 1WF9A 3N3KB 4EKUA 4B6WA 1ET6A 1PDXA 1FMAD 3L16A 3ZXVA 4KZ0A 2ZW1A 3PTFC 3N1XC 2V1YA 2M0XA 3AI5A 3SD5A 1WGRA 3CWIA 2RPVA 2CJOA 4IKGA 2QCZA 3DBRI 4JWUC 4II3B 2WWZA 4OVVA 3RT3B 2L8JA 3AEAB 4W9JA 2KJHB 2PVGC 3NZSA 2K22A 2NS5A 3VQIA 5DPWA 3P1MA 5GXGB 3VRAB 4BBNF 1L6UA 1YMHE 4REZA 3W1SC 5C3JB 2IGGA 1VRAB 3KW5B 3B9JA 1HA5A 1ESFA 4WWNA 4C80A 1E90A 2EKEC 3U52E 1L4DB 2PW9A 4DXGA 4WJOA 1ZXIA 2DHZA 3UINB 1VJKA 4XE0A 2DZMA 3ZRFA 1GNUA 2G4DB 3DHIC 3NVVA 2L3ZA 2KMMA 2O2VB 3DOWA 2WXQA 3NHEB 4L23A 4DXFA 2KT7A 2QSDA 4K3CA 4LNFA 2N7JA 2INPE 2IY1B 3CSFA 4EE2A 3R2TA 2DYOA 4YSXB 3EUB2 2Y5PA 1XCQL 2IO3B 4JX1C 1WX9A 2AWTA 2RDGA 1EO6A 1WJ4A 5BYSA 4IM3A 1MJDA 4US8A 4I6PA 1D5MC 5DCNA 1N6ZA 3TEXA 4LLGM 2FUG1 4ACFA 4WH4A 4I6NB 4ARCA 4IWOA 1XT9B 2ZPYA 4USAA 1SJHD 2MJEA 2KWCA 3L54A 3Q69A 1N5WA 3Q8AA 4GLSC 1IYFA 2I38A 2LHDA 3AE7B 3KWLA 1TKEA 1HE8A 2V4IB 4F8CB 1NI3A 2HD5B 1FNWA 1L5PA 1LXDA 1MG8A 5JXVA 3P4PB 3H7PB 1QKZA 3I9V1 4EZKA 3ZGZA 2WU5B 2AL6A 1WY8A 4JWSC 1JWSD 3N30A 3IT4B 1HQRD 2KFJA 2ICIA 4IG7B 2E3TA 3BK1A 1FRRA 1C9FA 4ARIA 4GDKB 3IAM1 2BYTA 2KWDA 2O2VA 4BAXA 4IWQA 2PMVA 2KWUB 3GB1A 2N0SB 1NI2A 4YTNB 4X57B 2G3QB 1KLUD 2D3AA 4RM8A 4E3CA 4TSSA 4ZRKA 5EE9A 4AJYB 3RYTA 3DBHB 4OVZA 3B1LX 3H1UA 3V62A 2V3SA 3UI3A 3GP7A 2MBQA 2BVCA 1I4RA 4YSZB 2ZW0A 5DPRA 3VUWA 2G45B 3V61A 1F2RI 1WXMA 1CK1A 2DYBA 1B9RA 2X8XX 4DHJB 2K1FA 3AV8A 4A6QA 3ZKJC 1UELA 2FBWB 3MJ5A 3PHXB 4WWOA 4FULA 2LUMA 3KYCD 2OOBB 2REXA 4PT5A 1WR1A 2C9WB 3RNAC 2HDEA 4A3PA 3K9PB 2DNFA 2QJLA 4G11A 1QILA 1WE6A 3RULA 5BMHA 5JHBA 5GMVA 3FILA 3NOBA 2KJ6A 1KTKA 1QOFA 1JWAD 2GBMA 3HHMA 4GDKA 2WXHA 3O13A 3QARA 4FADA 4IC7B 4CYEA 4B0EA 3VUXA 3VH3B 2LRWA 2M17A 2IPKD 3V3XA 1FCCC 4XGAB 3KLSX 2J53A 4BOSC 3BVMA 4ANUA 1GUAB 2PKOA 3ZJTA 1HZ5A 1KLVA 4A20A 2KHWB 2KDBA 2JRHA 2XEWA 3P4QB 4CQNA 3ZVVA 1RAXA 1V80A 3CSTA 3TEZA 2WLBA 1EUVB 3TSSA 2R2OA 2H88B 2XN9C 2M56B 2LGXA 2WDVB 1RM6C 3DBHI 1D4BA 5HFYA 4KSLC 3VAWA 1BXTA 4ZDVA 1C4AA 1GC7A 3L13A 2VZKB 3AE4B 4D2KA 4HJGE 4RM9A 2BWES 2N9KA 2M4NA 1C1YB 1E6EB 3TCAA 3DDCB 4ZHOA 4HPPA 4ZHPA 2PLPA 1ZDXA 1PFDA 3A9KB 4ZRPA 1Q0WB 3Q8EA 1J0GA 4TKNA 4NZLB 2R2QA 5FR6A 1WJNA 1J8CA 2J0KA 3CF6E 3I57A 1JWBD 3DPDA 1WM2A 3OLMD 4MACA 5FK9C 4NJ6A 2K25A 4N9F4 1XD3B 2QIEB 4NNJB 1L7YA 2KC2A 2VRRB 3BZDB 3L17A 3UIOB 1TY0A 1M94A 4BKSD 1Q10A 4OVUA 4FJYA 1E0ZA 2MLBA 3B08A 3AE6B 2KMAA 4WAAA 3QX1A 4MGIE 1V9JA 2N7DA 3EGRA 4JE3B 1FIQA 3AE3B 1FNVA 3EHVA 3VR9B 2FUHB 3WAPA 3UGBB 3ONSA 1T0SC 1WGDA 4WJQA 2Z0DB 4OZBA 4JPSA 1FCLA 1WGYA 2C7HA 3B2FA 1V81A 1YX6B 1KOTA 4L1BA 3SFEB 1D5XC 1AW7A 2KTFA 3Q2AC 2WXKA 2GBNA 3O65B 3P4RB 2BGFA 2G9HD 3A9KA 3K9OB 4RNAA 3C0RB 1MHHE 4HCNB 2ZVOA 2JY6A 4WIPA 2K8CA 1WE7A 2LGSA 3SR6A 4TV3A 1I7HA 2DWQA 2LXAA 3KQ4A 3W2DA 1T3QA 3M95A 3DHGC 3V60A 4WWPA 1EWYC 3P4SB 3RNGC 5C1ZA 2K39A 5D2MB 3EC8A 1HXYD 3OG5A 2NPTB 1SIFA 2YEPF 1CQVA 5D3DA 2PE6B 3N1YC 2PIAA 2MBEA 3IG3A 2GBKA 1XEEA 4A90A 4CO7A 3ML8A 2M19A 3L4PA 4N59A 2JWUA 2Q5WD 3Q3JA 4HK2A 2FCSA 2ZJDA 1K52A 1GC6A 3ZNID 4MDKE 3EECA 4FLHA 4IUMB 4BOZB 2KN4A 1WZ0A 4KDLB 1YQ3B 2WP9B 4S0RA 2YEPB 3E9SA 3ML9A 2PJHA 2BYFA 1KJTA 1R4MB 1JQ4A 1DOIA 2N4FA 2Y5CA 1KRHA 4LDTD 2FIDA 3QC8B 4LK0M 3Q6BA 4JLCA 2CHWA 1PQSA 2JF5A 1ZPSA 1E10A 4FA6A 5BMIA 1P9DU 2LGYA 5LNK1 2MW5A 2KKCA 2HTHA 1E8YA 2YLMA 2KAJA 4A9AA 4FHJA 1YN3A 4ITKA 3URYA 1RLFA 1J7CA 3BVGA 5CTRC 4HVBA 4EOYA 1ZE3D 3PT2B 2J0MA 4MGZE 2EELA 2MBHA 3T3NA 2ONQA 1DOXA 1Z5SB 3T3OA 1JWMD 3ZDMC 2NPTA 3D32A 1MVKA 4P16A 3PRZA 1QOAA 3A4RA 5JHAA 2BKFA 2WX1A 4GMVA 4I6LB 5BYQA 4LNKA 3NZ3A 2FIFA 1I4GA 1ZW7A 1IPGA 1C4CA 4C56C 1I4HA 4WJPA 3Q3MC 3VTVA 1FEHA 4MGYE 3KUDB 2NCNA 2KC1A 1FXIA 1M4VA 4ZRJA 1L6VA 2D2QA 4IWPA 5EE0A 3AEBB 3U4EG 1HTOA 2QHOA 3U7ZA 3APDA 2N1VA 3RCZA 1PGAA 4ICVA 2MSED 3FAHA 3ZUNA 3KVFB 1NENB 4NQKE 2OHFA 3ZDTA 1OFFA 3CIRB 2BS4B 3R66C 1E8XA 3H6NA 3W1YA 2BPSA 4E74A 5L83A 2WDTB 5AZHA 1UBIA 3I5JC 1R4MI 1TT5B 1FD6A 1JRPA 3WCQA 1SJED 2RSUA 3WANA 3NVWA 1AN8A 1SB3C 1P1AA 1N60A 2ZZPB 3ZYYX 2BS3B 2TSSA 3VTUA 2LI5A 2L0FA 2IO0B 3VTWA 2I1JA 3RMKC 5AZFA 2M1MA 4RGNA 2N9LA 2K8HA 1JW9D 4ZYNA 2KDFB 2QDFA 3DWMA 1WGHA 3C8YA 3NS1A 1TYGB 2WU2B 1V5TA 2EMTA 2HJ1A 2MA9B 1N62A 2I2YA 3ZRCA 2V0GA 2KYWA 4KVGB 3NVYA 4HDOA 1FRDA 3LXFA 4WQOB 4CHKA 1SIJA 3R8BA 2DZJA 2KOXA 2DZIA 5EDSA 2WXPA 4YTPB 3W5UB 2DAJA 2LUEA 1ENFA 4DDGD 1CJEA 2LGDA 4BBNC 3ZJUA 3W1SA 4S17A 5E6JA 3ZTDA 3PS6A 3Q8CA 4MJSB 4FN2A 2WXGA 1ZUD2 1E7VA 2WXFA 5G5GA 2QMTA 1VLBA 2WXOA 2L32A 1C77A 4LNNA 3I63C 2C7MB 5J17A 1UUPA 2FCMA 5J18A 2BWFA 3ZO5B 2Y3AA 1G6JA 4W9CA 5L95C 1CMXB 4MM3B 2X38A 3VR8B 3AULA 4KGSA 3PGEA 2KQSA 1TGZB 2PTLA 3AEDB 3ZXRA 1ZGUB 2Y5BB 2NBUA 1NEKB 2OEDA 5D6JB 1TS4A 3PPAA 4DXAB 4RGOS 4RFBA 4K81A 2ZEQA 1FNUA 2BS2B 2L7RA 2GBJA 1D3ZA 1VR9A 3DVNU 2BF8B 3P2BA 2KANA 3TIXA 1K50A 3APCA 2N1WA 3DQVA 1V6EA 5HG2A 1QOGA 2BW2A 3HK0A 3UQAA 4TQ0A 2ON8A 4OW0A 4DWFA 1WZ3A 2QC8A 3KH0A 3PO0A 2B76B 3RN9C 3R2IA 1ZOYB 2RMMA 1NDDA 4K7SA 5TSSA 2ZNVC 3OJ4B 1AWDA 4LTUA 1D5ZC 1QZEA 2LZ6A 4KGTA 5IO9A 4MJSA 2W3SA 2MCNB 5JZEB 4C00A 4W9FA 4GSWA 2LWPA 4PYZA 2N7EA 2MRPA 1GAQB 1RFKA 1C76A 1WXVA 5BYRA 2DAFA 1FPYA 4UDUC 1IP9A 2WXNA 3HVDA 5E6NA 1FFVA 2EMSA 4LJPB 1L0YB 2O6VB 3PZDA 4XZ4A 4DDID 3H7PA 2J42A 2LVOA 3L0WB 4K1RB 1EU4A 5CX3A 1T0RC 4EZLA 2NTTA 5D94A 2WNMA 2UU7A 3EA6A 2V3PA 1C4PA 1FXTB 3KUZA 1WX7A 1LO5D 3NUHB 2AX5A 2C5LC 1YIWA 4JQWC 4KIKB 4YWGG 3PSEB 4EZJA 3VRBB 4MEMA 3PLVA 2KN5A 2WXRA 3BY4B 3DCGA 2AQ3B 1PUTA 3RI7C 4LDTB 4BZAA 1YN5A 4MH8A 4W9LA 1YN4A 4RGTA 1TKGA 2GI9A 2KXJA 1U4AA 1SE2A 1YNTE 2A4ZA 3NZUA 1I35A 4XDDA 1GPXA 1RRBA 2K3UA 2AQ1B 2WHIA 5IOIA 4M01A 1UGMA 1ZP0B 3FC4A 1VCBA 3MHSD 4TUUA 5E6PA 3QWZB 2LVPA 3AN1A 2KZRA 1JRUA 2MJ3A 1F52A 1TS5A 2LGIA 4HXDA 2SAKA 4DBGA 4OZCA 2KMCA 2E6XA 2L0TA 2PEAA 4HEA1 1N63A 3R7QA 1STEA 4JIOU 3U30A 2ACZB 1S3SG 2DYMA 4HLEA 3AEFB 2O6VA 3W5VB 4B9KA 4RF1A 2LEKA 5E6OA 1LQBA 1UZXB 2W55A 4RMAA 1TZOA 1T6BX 2B3AA 3OAWA 2JPHA 2RDBC 4W9GA 4YL8A 1HEZE 1TJEA 2LJ5A 2L05A 4GB9A 4R3DA 4ZRQA 4NJ7A 3A9JB 5D3IB 1NVID 4C7YA 2KDIA 2BT6A 1AYFA 3WALA 2RD0A 1WXSA 3A4SC 4N6EB 4DHZE 1WJUA 2ASQA 1IBXB 2WDRB 4BKGA 1YQBA 2IJ0A 1E9MA 4GGQA 3AE9B 1B1ZA 1OEYA 3MP9A 2NTSA 1L0XB 4G0NB 1NBFC 1E8WA 4PYUA 5JH5C 2CHXA 3BINA 2NBWB 2G4SA 3PHWB 1V2YA 4BFRA 2NMQA 1VZ7A 4C4VB 3DHHC 3OJ3A 2D10A
chains in the Genus database with same CATH topology
3U8ZA 2J0MA 3KYDD 4MGZE 3A33B 2JVCA 2MBHA 3VDZA 1TTNA 4I6NB 1V49A 1SE9A 1Z5SB 2KTRB 3IHPC 4IWOA 2KFKB 3WAMA 1I42A 1XT9B 2ZPYA 3ZDMC 2NPTA 1UH6A 2KWCA 3D32A 3L54A 4HWIB 3PRZA 3A4RA 2DX5B 5JHAA 2BKFA 2FAZA 2WX1A 4GMVA 4I6LB 3JW0X 2ZCBA 2LASA 3X23A 3ZNGC 1IYFA 2FIFA 1SGHA 1ZW7A 1IPGA 4GDLA 2CHZA 3ALBA 3ZIMA 1Z2MA 4DHZB 4WJPA 2K8BA 1HE8A 2OJRA 1E8ZA 4II2B 3VTVA 4AJWA 4MGYE 2DZKA 3KUDB 4F8CB 4AWJA 2KLGA 2NCNA 2HD5B 2KC1A 2NR2A 4KSKC 1LXDA 1MG8A 4ZRJA 3H7PB 2D2QA 4EZKA 1TZ1A 4IWPA 1H8CA 3NS8A 2AL6A 3SU8X 2KO3A 1WY8A 2QHOA 2IO2B 3N30A 2UYZB 3A9JA 3QA8A 3A1QB 2KFJA 4IG7B 3APDA 2N1VA 3RCZA 5AZGA 4ICVA 2MSED 4GDKB 1X1MA 4K7UA 3DVGY 3T8MA 3ZUNA 3JYUA 3KVFB 1WFYA 3PRMB 2O2VA 4NQKE 1Q5WB 3ZDTA 2CS4A 4IWQA 4NQLB 1WXAA 2KWUB 3R66C 5HKHA 2K6DB 1E8XA 3H6NA 2FCQA 4HDQA 4NPNA 3W1YA 4W9HA 1NI2A 1OTRB 2BPSA 4E74A 5L83A 2WDTB 5AZHA 4ANVA 1UBIA 2BYEA 3QQ8B 4NAWB 3QHTA 5G55A 3L08A 4LCDE 1R4MI 4X57B 2G3QB 3PREA 4AP4C 4LJOB 1H4RA 3AU4A 3CMMB 4RM8A 3WAOA 2XK5B 4E3CA 4ZRKA 3V6CB 3WIMA 2RSUA 3WANA 4AJYB 3RYTA 2C7NB 3VVWB 3B1LX 3H1UA 4JGHB 4ASWC 1P1AA 2RR9A 3V62A 4KIKA 2V3SA 3M3JA 4XX5A 2ZZPB 1P0RA 4ZRIA 3PT2B 4W9EA 3VTUA 2LI5A 2L0FA 3B0AA 2IO0B 2MBQA 3VTWA 2I1JA 3LDZE 5AZFA 2KTRA 2KQ7A 2DENB 2KFKA 2M1MA 3MJWA 5DPRA 3VUWA 1A5RA 1J19A 2G45B 1XQQA 3V61A 4MELA 1VD2A 5DPSA 1WXMA 3QCAA 2K8HA 2DYBA 2UWQA 4TQ1A 2MQJA 4HCPB 4DHJB 4ZYNA 2KDFB 1WGHA 1P3QU 2GMIC 5AEKB 1WX8A 3ZLZA 3PVLA 2IY0B 2K1FA 1V5TA 2KWVB 2EMTA 2MA9B 3ZKJC 1UELA 3PHXB 4WWOA 4FULA 5D7GA 5J2RA 4PS8A 3KYCD 3ZRCA 2OOBB 2REXA 4F7ZA 2NBVB 4KVGB 4HDOA 4URKA 1WR1A 2C9WB 2KK8A 4WQOB 4CHKA 3L10B 4A3PA 1E7UA 2DZJA 2KOXA 1F9JA 2A5UA 2DZIA 3PV1A 3K9PB 1RFAA 5EDSA 2ZCCA 2IBIB 4G11A 1WE6A 3RULA 2DAJA 2LUEA 3R7RA 5JHBA 3A1QA 5GMVA 5G2NA 2RPQA 3NOBA 4DDGD 2KJ6A 4AUQC 3ENEA 2JUOA 2CR5A 2LGDA 4BBNC 3W1SA 2GBMA 1UBQA 3ZTDA 3PS6A 3HHMA 4GDKA 4MJSB 3AXCA 2LD9A 3JSVB 4FN2A 4NY0A 3QARA 4MSQB 4PS3A 1UD7A 4FADA 4IC7B 4CYEA 2M8SA 4FJVB 3VUXA 3VH3B 2LRWA 3PRPB 4ANWA 1E7VA 1V5OA 2K6QA 2Z59B 3AU5A 2M17A 1WI0A 1E5WA 5IAAC 2FNJB 4NAWA 2AL3A 2C7MB 3KUCB 5J17A 2L76A 4P7IA 2FCMA 4F1SA 3QAQA 5J18A 2BWFA 3ZO5B 4BOSC 4ANUA 1YJ1A 1GUAB 1G6JA 4W9CA 1WRDB 3HM3A 1WGGA 5L95C 4M0WB 4FJZA 2XBBC 1KLVA 1CMXB 4A20A 2KHWB 2KDBA 2JRHA 2XEWA 3ZVVA 3V6EB 1RAXA 3AULA 4J6IA 3T9LA 1V80A 3PGEA 2JWZA 4PS7A 2V4LA 3CSTA 5C23A 2KQSA 2KLCA 4BVUC 1TGZB 2FCNA 4XC2A 3RUIB 1EUVB 1OGWA 1WYWB 2D11A 2D3GA 1ZGUB 2ZPNA 2R2OA 4BKTA 2Y5BB 2C60A 2KNBA 2LGXA 2NBUA 3I3TB 5D6JB 2KDEB 3ZNZB 2MP2B 3PPAA 3DBHI 3HIZA 4DXAB 4KSLC 2W9NA 4ICUA 3VAWA 2MBOA 4GN1A 2JZ3B 4K81A 4ZDVA 2JXXA 2PPHA 3TBLD 1P98A 1GC7A 2ZEQA 3VH4B 3L13A 1L2NA 1Q1OA 1R4NI 1TBEA 2L7RA 4IM2A 2GBJA 2AYOB 1D3ZA 4RM9A 1AARA 2BWES 3U7DA 4DHJD 3DVNU 4JL9A 4HPMB 3GZNI 1WIAA 3RD2A 2BF8B 3P2BA 2KANA 3EFUA 2M4NA 3RZFA 3TIXA 1C1YB 2KX0A 3APCA 3TCAA 3DDCB 2N1WA 4AOFA 3GOEA 3A9KB 1Q0WB 3DQVA 1V6EA 2JZZA 4KV2A 1J0GA 4TKNA 3HK0A 3TMPB 1WMHB 2R2QA 3UQAA 3QIJA 4TQ0A 5FR6A 4B95A 1WJNA 1J8CA 2J0KA 3CF6E 1WZ3A 3KH0A 4DWFA 2O6VD 4G50A 1K8RB 5KHQA 3DPDA 1WM2A 2J7QB 1NDDA 4K7SA 4KZCA 5DPTA 3OLMD 2N9PC 2ZNVC 3OJ4B 5CHVC 4ANXA 1QZEA 2LZ6A 5BO4B 4NJ6A 2K25A 1V86A 3DVNV 4N9F4 3RZWC 4MJSA 3M63B 3JSVA 4GIVA 2MCNB 1ZKHA 5JZEB 1XD3B 1Y8RC 2KVRA 4WJNA 4W9FA 4GSWA 3VUYA 3DBLI 3WA0A 4NNJB 1L7YA 2Z0EB 2KC2A 2LWPA 3ECIA 2LXCA 4PYZA 2N7EA 2VRRB 2MRPA 3L17A 3UIOB 2GOWA 3DBSA 1M94A 4BKSD 1WXVA 2N9EB 2MWSB 2DAFA 3H7SA 2IYDB 1IP9A 3S2AA 4OVUA 1WM3A 4IM0A 3IFWB 1C3TA 5E6NA 1S1QB 2IO1B 3TL5A 2EMSA 4FJYA 3NY5A 4LJPB 2O6VB 4XZ4A 3PZDA 4DDID 3UQBA 1KM7A 2MLBA 3B08A 3H7PA 3H9DA 2LVOA 4W9IA 3L0WB 4K1RB 2KMAA 4WAAA 5LXHA 3QX1A 4MGIE 1V9JA 2N7DA 5CX3A 3SDLC 3JVZX 4EZLA 2NVUI 2KX3A 5D94A 3R3MA 1GG3A 4M8NA 2WYQA 2IZVB 3ZW3A 1BT0A 3EHVA 1FXTB 3KUZA 2FUHB 1WX7A 2JT4B 3WAPA 1LFDA 3UGBB 2C5LC 2MP2A 1YIWA 1WGDA 3ONSA 4JQWC 4KIKB 4WJQA 3PSEB 5LLIA 4EZJA 2Z0DB 2HE7A 4MEMA 3SHQA 3PLVA 2KN5A 5LXIB 3BY4B 3DCGA 1WGYA 3APFA 2AEHA 2C7HA 2J0JA 4LDTB 1V81A 1YX6B 1KOTA 2YVCA 4K7WA 3UIPB 2KJRA 4W9LA 4FHKA 5TR5A 3HM6X 2KXJA 2CKHB 2KTFA 1U4AA 3M62B 4HJKA 3DVGX 4E71A 2A4ZA 2GBNA 2XK5A 3QK0A 5CHWA 3NZUA 2D07B 4IW0A 1I35A 3O65B 2MBBB 2BGFA 1RRBA 3A9KA 3N32A 3K9OB 3C0RB 4HCNB 1EF5A 2ZVOA 2GBRA 2JRIB 2JY6A 4KDIC 1WMHA 1UGMA 1WE7A 2K8CA 4TV3A 1WF9A 1LM8B 1VCBA 3MHSD 3N3KB 4M8MA 4EKUA 4B6WA 2LXAA 4TUUA 5E6PA 4DK5A 2BYVE 3QWZB 3IVFA 2LVPA 2KZRA 1JRUA 3L16A 3M95A 4MH0E 4GOCA 4HXDA 5IA7A 4KZ0A 3V60A 3PTFC 2PE9A 2V1YA 4DBGA 4WWPA 1EF1A 2M0XA 2KMCA 5C1ZA 2K39A 3AI5A 3SD5A 4HPLB 5CHFA 2L0TA 5D2MB 4EUTA 2L00B 2PEAA 3EC8A 3VFKA 1WGRA 3R7QA 2KD0A 2NPTB 1SIFA 4MSMB 4JIOU 3U30A 3DBRI 4A3OA 3X0WA 4II3B 2WWZA 4OVVA 3RT3B 2L8JA 1S3SG 2PE6B 2ZNVB 2KJHB 1YX5B 4W9JA 2CU1A 2DYMA 2MBEA 3NZSA 3IG3A 4HLEA 2GBKA 2NS5A 1OQYA 2O6VA 3VQIA 3ZTCA 1OEYJ 5DPWA 4B9KA 4CO7A 4GDLB 4BBNF 3ML8A 5E6OA 1LQBA 1UZXB 3Q3JA 2BKRB 3W1SC 4HK2A 2FCSA 4RMAA 3KW5B 2ZJDA 4G3XB 2B3AA 2I1KA 3OAWA 4GU2A 1GC6A 5KHOA 2JPHA 4MDKE 3ZNID 4W9GA 4YL8A 4WWNA 3EECA 2LJ5A 1E90A 2EKEC 4FLHA 2L05A 2MX2A 2ZVNA 4GB9A 4IUMB 4EFOA 4BOZB 1WZ0A 2LVQA 1T0YA 4KDLB 4BKSA 4EEWA 4NJ7A 3A9JB 3ZNHB 4WJOA 4W9DA 2LRUA 2DHZA 2KDIA 3TJPA 1YD8U 3UINB 3ML9A 2PJHA 2BYFA 1KJTA 2WX0A 3WALA 4MGKE 2RD0A 2DZMA 3ZRFA 1GNUA 2G4DB 1WXSA 3MTNB 2N9XA 3A4SC 3PLUA 2L3ZA 3VXWA 1WJUA 3Q3FA 2N4FA 4DHZE 2ASQA 2O2VB 3DOWA 4LDTD 4BKGA 3NHEB 2FIDA 3QC8B 1YQBA 1WH3A 3IBEA 3VHTC 4JLCA 2CHWA 2HJ8A 4GGQA 4W9KA 2IY1B 2RGFA 4FBJB 3CSFA 4MM3A 1OEYA 1PQSA 2JF5A 4G0NB 2DYOA 3UF8A 4FA6A 3LJ3A 1P9DU 1NBFC 1E8WA 1ISNA 4PYUA 5JH5C 2CHXA 2LGYA 2IO3B 3BINA 1GJZA 2MW5A 2KKCA 2NBWB 1WX9A 2HTHA 1E8YA 2YLMA 3QJZA 2AWTA 2G4SA 3PHWB 1EO6A 1V2YA 1WJ4A 4BFRA 4IM3A 4FHJA 1WJ6A 1WR6E 1RLFA 4I6PA 5CTRC 4HVBA 5DCNA 4EOYA 4GXBA 3OJ3A 2D10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8Z A;  2J0M A;  3KYD D;  4MGZ E;  3A33 B;  2JVC A;  2MBH A;  3VDZ A;  1TTN A;  4I6N B;  1V49 A;  1SE9 A;  1Z5S B;  2KTR B;  3IHP C;  4IWO A;  2KFK B;  3WAM A;  1I42 A;  1XT9 B;  2ZPY A;  3ZDM C;  2NPT A;  1UH6 A;  2KWC A;  3D32 A;  3L54 A;  4HWI B;  3PRZ A;  3A4R A;  2DX5 B;  5JHA A;  2BKF A;  2FAZ A;  2WX1 A;  4GMV A;  4I6L B;  3JW0 X;  2ZCB A;  2LAS A;  3X23 A;  3ZNG C;  1IYF A;  2FIF A;  1SGH A;  1ZW7 A;  1IPG A;  4GDL A;  2CHZ A;  3ALB A;  3ZIM A;  1Z2M A;  4DHZ B;  4WJP A;  2K8B A;  1HE8 A;  2OJR A;  1E8Z A;  4II2 B;  3VTV A;  4AJW A;  4MGY E;  2DZK A;  3KUD B;  4F8C B;  4AWJ A;  2KLG A;  2NCN A;  2HD5 B;  2KC1 A;  2NR2 A;  4KSK C;  1LXD A;  1MG8 A;  4ZRJ A;  3H7P B;  2D2Q A;  4EZK A;  1TZ1 A;  4IWP A;  1H8C A;  3NS8 A;  2AL6 A;  3SU8 X;  2KO3 A;  1WY8 A;  2QHO A;  2IO2 B;  3N30 A;  2UYZ B;  3A9J A;  3QA8 A;  3A1Q B;  2KFJ A;  4IG7 B;  3APD A;  2N1V A;  3RCZ A;  5AZG A;  4ICV A;  2MSE D;  4GDK B;  1X1M A;  4K7U A;  3DVG Y;  3T8M A;  3ZUN A;  3JYU A;  3KVF B;  1WFY A;  3PRM B;  2O2V A;  4NQK E;  1Q5W B;  3ZDT A;  2CS4 A;  4IWQ A;  4NQL B;  1WXA A;  2KWU B;  3R66 C;  5HKH A;  2K6D B;  1E8X A;  3H6N A;  2FCQ A;  4HDQ A;  4NPN A;  3W1Y A;  4W9H A;  1NI2 A;  1OTR B;  2BPS A;  4E74 A;  5L83 A;  2WDT B;  5AZH A;  4ANV A;  1UBI A;  2BYE A;  3QQ8 B;  4NAW B;  3QHT A;  5G55 A;  3L08 A;  4LCD E;  1R4M I;  4X57 B;  2G3Q B;  3PRE A;  4AP4 C;  4LJO B;  1H4R A;  3AU4 A;  3CMM B;  4RM8 A;  3WAO A;  2XK5 B;  4E3C A;  4ZRK A;  3V6C B;  3WIM A;  2RSU A;  3WAN A;  4AJY B;  3RYT A;  2C7N B;  3VVW B;  3B1L X;  3H1U A;  4JGH B;  4ASW C;  1P1A A;  2RR9 A;  3V62 A;  4KIK A;  2V3S A;  3M3J A;  4XX5 A;  2ZZP B;  1P0R A;  4ZRI A;  3PT2 B;  4W9E A;  3VTU A;  2LI5 A;  2L0F A;  3B0A A;  2IO0 B;  2MBQ A;  3VTW A;  2I1J A;  3LDZ E;  5AZF A;  2KTR A;  2KQ7 A;  2DEN B;  2KFK A;  2M1M A;  3MJW A;  5DPR A;  3VUW A;  1A5R A;  1J19 A;  2G45 B;  1XQQ A;  3V61 A;  4MEL A;  1VD2 A;  5DPS A;  1WXM A;  3QCA A;  2K8H A;  2DYB A;  2UWQ A;  4TQ1 A;  2MQJ A;  4HCP B;  4DHJ B;  4ZYN A;  2KDF B;  1WGH A;  1P3Q U;  2GMI C;  5AEK B;  1WX8 A;  3ZLZ A;  3PVL A;  2IY0 B;  2K1F A;  1V5T A;  2KWV B;  2EMT A;  2MA9 B;  3ZKJ C;  1UEL A;  3PHX B;  4WWO A;  4FUL A;  5D7G A;  5J2R A;  4PS8 A;  3KYC D;  3ZRC A;  2OOB B;  2REX A;  4F7Z A;  2NBV B;  4KVG B;  4HDO A;  4URK A;  1WR1 A;  2C9W B;  2KK8 A;  4WQO B;  4CHK A;  3L10 B;  4A3P A;  1E7U A;  2DZJ A;  2KOX A;  1F9J A;  2A5U A;  2DZI A;  3PV1 A;  3K9P B;  1RFA A;  5EDS A;  2ZCC A;  2IBI B;  4G11 A;  1WE6 A;  3RUL A;  2DAJ A;  2LUE A;  3R7R A;  5JHB A;  3A1Q A;  5GMV A;  5G2N A;  2RPQ A;  3NOB A;  4DDG D;  2KJ6 A;  4AUQ C;  3ENE A;  2JUO A;  2CR5 A;  2LGD A;  4BBN C;  3W1S A;  2GBM A;  1UBQ A;  3ZTD A;  3PS6 A;  3HHM A;  4GDK A;  4MJS B;  3AXC A;  2LD9 A;  3JSV B;  4FN2 A;  4NY0 A;  3QAR A;  4MSQ B;  4PS3 A;  1UD7 A;  4FAD A;  4IC7 B;  4CYE A;  2M8S A;  4FJV B;  3VUX A;  3VH3 B;  2LRW A;  3PRP B;  4ANW A;  1E7V A;  1V5O A;  2K6Q A;  2Z59 B;  3AU5 A;  2M17 A;  1WI0 A;  1E5W A;  5IAA C;  2FNJ B;  4NAW A;  2AL3 A;  2C7M B;  3KUC B;  5J17 A;  2L76 A;  4P7I A;  2FCM A;  4F1S A;  3QAQ A;  5J18 A;  2BWF A;  3ZO5 B;  4BOS C;  4ANU A;  1YJ1 A;  1GUA B;  1G6J A;  4W9C A;  1WRD B;  3HM3 A;  1WGG A;  5L95 C;  4M0W B;  4FJZ A;  2XBB C;  1KLV A;  1CMX B;  4A20 A;  2KHW B;  2KDB A;  2JRH A;  2XEW A;  3ZVV A;  3V6E B;  1RAX A;  3AUL A;  4J6I A;  3T9L A;  1V80 A;  3PGE A;  2JWZ A;  4PS7 A;  2V4L A;  3CST A;  5C23 A;  2KQS A;  2KLC A;  4BVU C;  1TGZ B;  2FCN A;  4XC2 A;  3RUI B;  1EUV B;  1OGW A;  1WYW B;  2D11 A;  2D3G A;  1ZGU B;  2ZPN A;  2R2O A;  4BKT A;  2Y5B B;  2C60 A;  2KNB A;  2LGX A;  2NBU A;  3I3T B;  5D6J B;  2KDE B;  3ZNZ B;  2MP2 B;  3PPA A;  3DBH I;  3HIZ A;  4DXA B;  4KSL C;  2W9N A;  4ICU A;  3VAW A;  2MBO A;  4GN1 A;  2JZ3 B;  4K81 A;  4ZDV A;  2JXX A;  2PPH A;  3TBL D;  1P98 A;  1GC7 A;  2ZEQ A;  3VH4 B;  3L13 A;  1L2N A;  1Q1O A;  1R4N I;  1TBE A;  2L7R A;  4IM2 A;  2GBJ A;  2AYO B;  1D3Z A;  4RM9 A;  1AAR A;  2BWE S;  3U7D A;  4DHJ D;  3DVN U;  4JL9 A;  4HPM B;  3GZN I;  1WIA A;  3RD2 A;  2BF8 B;  3P2B A;  2KAN A;  3EFU A;  2M4N A;  3RZF A;  3TIX A;  1C1Y B;  2KX0 A;  3APC A;  3TCA A;  3DDC B;  2N1W A;  4AOF A;  3GOE A;  3A9K B;  1Q0W B;  3DQV A;  1V6E A;  2JZZ A;  4KV2 A;  1J0G A;  4TKN A;  3HK0 A;  3TMP B;  1WMH B;  2R2Q A;  3UQA A;  3QIJ A;  4TQ0 A;  5FR6 A;  4B95 A;  1WJN A;  1J8C A;  2J0K A;  3CF6 E;  1WZ3 A;  3KH0 A;  4DWF A;  2O6V D;  4G50 A;  1K8R B;  5KHQ A;  3DPD A;  1WM2 A;  2J7Q B;  1NDD A;  4K7S A;  4KZC A;  5DPT A;  3OLM D;  2N9P C;  2ZNV C;  3OJ4 B;  5CHV C;  4ANX A;  1QZE A;  2LZ6 A;  5BO4 B;  4NJ6 A;  2K25 A;  1V86 A;  3DVN V;  4N9F 4;  3RZW C;  4MJS A;  3M63 B;  3JSV A;  4GIV A;  2MCN B;  1ZKH A;  5JZE B;  1XD3 B;  1Y8R C;  2KVR A;  4WJN A;  4W9F A;  4GSW A;  3VUY A;  3DBL I;  3WA0 A;  4NNJ B;  1L7Y A;  2Z0E B;  2KC2 A;  2LWP A;  3ECI A;  2LXC A;  4PYZ A;  2N7E A;  2VRR B;  2MRP A;  3L17 A;  3UIO B;  2GOW A;  3DBS A;  1M94 A;  4BKS D;  1WXV A;  2N9E B;  2MWS B;  2DAF A;  3H7S A;  2IYD B;  1IP9 A;  3S2A A;  4OVU A;  1WM3 A;  4IM0 A;  3IFW B;  1C3T A;  5E6N A;  1S1Q B;  2IO1 B;  3TL5 A;  2EMS A;  4FJY A;  3NY5 A;  4LJP B;  2O6V B;  4XZ4 A;  3PZD A;  4DDI D;  3UQB A;  1KM7 A;  2MLB A;  3B08 A;  3H7P A;  3H9D A;  2LVO A;  4W9I A;  3L0W B;  4K1R B;  2KMA A;  4WAA A;  5LXH A;  3QX1 A;  4MGI E;  1V9J A;  2N7D A;  5CX3 A;  3SDL C;  3JVZ X;  4EZL A;  2NVU I;  2KX3 A;  5D94 A;  3R3M A;  1GG3 A;  4M8N A;  2WYQ A;  2IZV B;  3ZW3 A;  1BT0 A;  3EHV A;  1FXT B;  3KUZ A;  2FUH B;  1WX7 A;  2JT4 B;  3WAP A;  1LFD A;  3UGB B;  2C5L C;  2MP2 A;  1YIW A;  1WGD A;  3ONS A;  4JQW C;  4KIK B;  4WJQ A;  3PSE B;  5LLI A;  4EZJ A;  2Z0D B;  2HE7 A;  4MEM A;  3SHQ A;  3PLV A;  2KN5 A;  5LXI B;  3BY4 B;  3DCG A;  1WGY A;  3APF A;  2AEH A;  2C7H A;  2J0J A;  4LDT B;  1V81 A;  1YX6 B;  1KOT A;  2YVC A;  4K7W A;  3UIP B;  2KJR A;  4W9L A;  4FHK A;  5TR5 A;  3HM6 X;  2KXJ A;  2CKH B;  2KTF A;  1U4A A;  3M62 B;  4HJK A;  3DVG X;  4E71 A;  2A4Z A;  2GBN A;  2XK5 A;  3QK0 A;  5CHW A;  3NZU A;  2D07 B;  4IW0 A;  1I35 A;  3O65 B;  2MBB B;  2BGF A;  1RRB A;  3A9K A;  3N32 A;  3K9O B;  3C0R B;  4HCN B;  1EF5 A;  2ZVO A;  2GBR A;  2JRI B;  2JY6 A;  4KDI C;  1WMH A;  1UGM A;  1WE7 A;  2K8C A;  4TV3 A;  1WF9 A;  1LM8 B;  1VCB A;  3MHS D;  3N3K B;  4M8M A;  4EKU A;  4B6W A;  2LXA A;  4TUU A;  5E6P A;  4DK5 A;  2BYV E;  3QWZ B;  3IVF A;  2LVP A;  2KZR A;  1JRU A;  3L16 A;  3M95 A;  4MH0 E;  4GOC A;  4HXD A;  5IA7 A;  4KZ0 A;  3V60 A;  3PTF C;  2PE9 A;  2V1Y A;  4DBG A;  4WWP A;  1EF1 A;  2M0X A;  2KMC A;  5C1Z A;  2K39 A;  3AI5 A;  3SD5 A;  4HPL B;  5CHF A;  2L0T A;  5D2M B;  4EUT A;  2L00 B;  2PEA A;  3EC8 A;  3VFK A;  1WGR A;  3R7Q A;  2KD0 A;  2NPT B;  1SIF A;  4MSM B;  4JIO U;  3U30 A;  3DBR I;  4A3O A;  3X0W A;  4II3 B;  2WWZ A;  4OVV A;  3RT3 B;  2L8J A;  1S3S G;  2PE6 B;  2ZNV B;  2KJH B;  1YX5 B;  4W9J A;  2CU1 A;  2DYM A;  2MBE A;  3NZS A;  3IG3 A;  4HLE A;  2GBK A;  2NS5 A;  1OQY A;  2O6V A;  3VQI A;  3ZTC A;  1OEY J;  5DPW A;  4B9K A;  4CO7 A;  4GDL B;  4BBN F;  3ML8 A;  5E6O A;  1LQB A;  1UZX B;  3Q3J A;  2BKR B;  3W1S C;  4HK2 A;  2FCS A;  4RMA A;  3KW5 B;  2ZJD A;  4G3X B;  2B3A A;  2I1K A;  3OAW A;  4GU2 A;  1GC6 A;  5KHO A;  2JPH A;  4MDK E;  3ZNI D;  4W9G A;  4YL8 A;  4WWN A;  3EEC A;  2LJ5 A;  1E90 A;  2EKE C;  4FLH A;  2L05 A;  2MX2 A;  2ZVN A;  4GB9 A;  4IUM B;  4EFO A;  4BOZ B;  1WZ0 A;  2LVQ A;  1T0Y A;  4KDL B;  4BKS A;  4EEW A;  4NJ7 A;  3A9J B;  3ZNH B;  4WJO A;  4W9D A;  2LRU A;  2DHZ A;  2KDI A;  3TJP A;  1YD8 U;  3UIN B;  3ML9 A;  2PJH A;  2BYF A;  1KJT A;  2WX0 A;  3WAL A;  4MGK E;  2RD0 A;  2DZM A;  3ZRF A;  1GNU A;  2G4D B;  1WXS A;  3MTN B;  2N9X A;  3A4S C;  3PLU A;  2L3Z A;  3VXW A;  1WJU A;  3Q3F A;  2N4F A;  4DHZ E;  2ASQ A;  2O2V B;  3DOW A;  4LDT D;  4BKG A;  3NHE B;  2FID A;  3QC8 B;  1YQB A;  1WH3 A;  3IBE A;  3VHT C;  4JLC A;  2CHW A;  2HJ8 A;  4GGQ A;  4W9K A;  2IY1 B;  2RGF A;  4FBJ B;  3CSF A;  4MM3 A;  1OEY A;  1PQS A;  2JF5 A;  4G0N B;  2DYO A;  3UF8 A;  4FA6 A;  3LJ3 A;  1P9D U;  1NBF C;  1E8W A;  1ISN A;  4PYU A;  5JH5 C;  2CHX A;  2LGY A;  2IO3 B;  3BIN A;  1GJZ A;  2MW5 A;  2KKC A;  2NBW B;  1WX9 A;  2HTH A;  1E8Y A;  2YLM A;  3QJZ A;  2AWT A;  2G4S A;  3PHW B;  1EO6 A;  1V2Y A;  1WJ4 A;  4BFR A;  4IM3 A;  4FHJ A;  1WJ6 A;  1WR6 E;  1RLF A;  4I6P A;  5CTR C;  4HVB A;  5DCN A;  4EOY A;  4GXB A;  3OJ3 A;  2D10 A; 
#chains in the Genus database with same CATH topology
 3KYD D;  3A33 B;  3DBL B;  2JVC A;  3VDZ A;  3WAM A;  2KFK B;  3AB5 A;  1I42 A;  3BVZ A;  1F1H A;  3P63 A;  3OWE B;  2WQY B;  1V1P B;  3P42 A;  3JW0 X;  4FXC A;  1DOY A;  2LAS A;  3X23 A;  3ZNG C;  1SGH A;  2CHZ A;  4LNI A;  3ABV B;  2OJR A;  3J9C A;  1E8Z A;  4II2 B;  4AWJ A;  1HZ6 A;  1R7S A;  1KLG D;  2WXI A;  1H8C A;  3NS8 A;  3SU8 X;  2UYZ B;  3A9J A;  3LB8 C;  2D3C A;  4ZYS A;  2KAC A;  1T5X D;  5AZG A;  3PZ7 A;  4K3B A;  3DVG Y;  2CS4 A;  4NQL B;  3MC8 A;  1WXA A;  2K6D B;  1OTR B;  1GB1 A;  3QQ8 B;  1SBB B;  3QHT A;  2JYE A;  3L08 A;  4LCD E;  3PRE A;  2CU3 A;  1JAL A;  4AP4 C;  1H4R A;  3CMM B;  2XK5 B;  2INN E;  3WIM A;  5G5H A;  3AMZ A;  2C7N B;  3VVW B;  1E7P B;  2K5P A;  3C19 A;  1WXQ A;  4ASW C;  2L1A A;  1XLO A;  3M3J A;  4XX5 A;  4C4V A;  1TS3 A;  1R4N B;  3B0A A;  3BYY B;  2KFK A;  1J19 A;  1VD2 A;  4O1N A;  5DPS A;  3BYT B;  4NAM A;  1V1P A;  2UWQ A;  4TQ1 A;  2MQJ A;  1P3Q U;  2GMI C;  2LMC A;  3AEE B;  3NG0 A;  4US9 A;  3PVL A;  3ZJV A;  2KWV B;  4TMA B;  2EKI A;  2M0A A;  1YQ4 B;  1J7A A;  5J2R A;  3HUI A;  4URK A;  1LGR A;  2KK8 A;  1EU3 A;  3EFC A;  3L10 B;  1E7U A;  5BMG A;  1MG4 A;  4YXD B;  2VH2 A;  3PV1 A;  4L2Y A;  3R7R A;  1VZ8 A;  2QEJ C;  3ENE A;  2CR5 A;  2IDY A;  2LD9 A;  1RWS A;  3N1Z C;  4MSQ B;  1UD7 A;  1N5X A;  2GRI A;  4ANW A;  1ET9 A;  1JRO A;  2K6Q A;  2Z59 B;  3Q8F A;  1WI0 A;  1E5W A;  5IAA C;  5H92 C;  2FNJ B;  2JQR B;  1V8C A;  2AL3 A;  2L76 A;  4F1S A;  1MI0 A;  3QAQ A;  2VZK D;  1XCT L;  3HM3 A;  1WGG A;  3Q3N C;  4M0W B;  2XBB C;  3TEW A;  5H8Y E;  4HKZ E;  3T9L A;  4PS7 A;  2JWZ A;  2V4L A;  4BVU C;  5MPO A;  4XC2 A;  4IOI E;  1WYW B;  2D11 A;  3BII D;  2KVZ A;  3BWU D;  4BKT A;  2KNB A;  4P1C C;  3ZNZ B;  5FKA C;  3MC9 A;  1QT9 A;  1SXT A;  3HIZ A;  4ICU A;  4GN1 A;  1PGB A;  2PPH A;  1P98 A;  3VH4 B;  3TEY A;  1NYQ A;  1Q1O A;  1R4N I;  1TBE A;  1UWM A;  3ZQ4 A;  5C2T B;  2AYO B;  3IT6 B;  1WWT A;  1AAR A;  3U7D A;  4JL9 A;  4HPM B;  4M02 A;  2R61 A;  3B2G A;  3GOE A;  3HRD D;  4KV2 A;  1MFW A;  1WMH B;  4B95 A;  4WWM A;  1K8R B;  5KHQ A;  2XNA C;  5DPT A;  5IP4 D;  4ANX A;  5BO4 B;  3RZW C;  1D6E C;  4GIV A;  1Y8R C;  2KVR A;  3VUY A;  3NRZ A;  3ECI A;  2LXC A;  2GOW A;  3DBS A;  2N9E B;  1IUE A;  5AUK A;  2LHE A;  4A55 A;  3IXS A;  3H7S A;  2IYD B;  1WM3 A;  3TL5 A;  3NY5 A;  3UQB A;  3H8H A;  1KM7 A;  3FKY A;  4M0W A;  3H9D A;  4QAY A;  1SSN A;  2BBC A;  1TY2 A;  4A8X C;  2JZP A;  1WSP A;  2NVU I;  3ETR A;  3R3M A;  1GG3 A;  2WYQ A;  1P7E A;  2IZV B;  2PVO D;  1P7F A;  1A70 A;  2JT4 B;  3AE2 B;  1LFD A;  4RGM A;  2G1E A;  5LLI A;  4MT5 A;  2HE7 A;  3NVZ A;  5LXI B;  4KX6 B;  2AEH A;  1K51 A;  2YVC A;  2BB6 A;  2KJR A;  1T0Q C;  4FHK A;  5TR5 A;  2BQQ A;  1F2R C;  2CKH B;  3TUO A;  5CHW A;  3U2S C;  1JML A;  2D07 B;  2J4X A;  2MBB B;  1MPE A;  3V05 A;  2GBR A;  4B0M A;  1FXA A;  1WMH A;  4RCO A;  3KWV A;  1QF6 A;  1WGK A;  1LM8 B;  4M8M A;  1DGJ A;  4DK5 A;  1XLN A;  2BYV E;  3IVF A;  1YJJ A;  4MH0 E;  4GOC A;  2L52 A;  5IA7 A;  2KDM A;  2SEB D;  1SE4 A;  2PE9 A;  2IGH A;  1EF1 A;  1I4Q A;  4HPL B;  5CHF A;  2JSV X;  4EUT A;  2L00 B;  1EWC A;  3VFK A;  3FIL B;  3IAS 1;  2KD0 A;  3Q14 C;  1FM0 D;  4MSM B;  1VZ6 A;  3MHZ A;  1N61 A;  1OQR A;  4A3O A;  3X0W A;  1BUI C;  4XYC A;  2ZNV B;  1YX5 B;  4HRO A;  2CU1 A;  2CJN A;  1OQY A;  3ZTC A;  1OEY J;  4GDL B;  2BKR B;  4P1B C;  4G3X B;  1UWX A;  2I1K A;  4GU2 A;  5KHO A;  1I4P A;  2MX2 A;  2ZVN A;  4EFO A;  3PZ8 A;  2V3N A;  2LVQ A;  1T0Y A;  4BKS A;  4EEW A;  1XO3 A;  1GB4 A;  5FR3 A;  3ZNH B;  4W9D A;  2FE8 A;  2LRU A;  3TJP A;  1YD8 U;  2WX0 A;  4MGK E;  4WUR A;  1KFY B;  2GLS A;  3MTN B;  2KQ4 X;  3PLU A;  2N9X A;  1DYQ A;  3VXW A;  1QOB A;  3Q3F A;  4DQO C;  1SEB D;  1WH3 A;  3IBE A;  3VHT C;  2HJ8 A;  4W9K A;  2RGF A;  3GE8 C;  2OJW A;  1FFU A;  4MM3 A;  3UF8 A;  3LJ3 A;  2WS3 B;  1ISN A;  1GJZ A;  3QJZ A;  1WJ6 A;  1WR6 E;  1RYJ A;  2HTM E;  4GXB A;  3MC0 B;  2W3R A;  3U8Z A;  2V9H A;  1TTN A;  2MJD A;  1V49 A;  1SE9 A;  3IHP C;  2KTR B;  3GS2 A;  4WQM A;  1UH6 A;  3SFD B;  4HWI B;  1F77 A;  2DX5 B;  2FAZ A;  4LNO A;  2DLB A;  2ZCB A;  4RF0 A;  4GDL A;  1UF0 A;  3ALB A;  3ZIM A;  1Z2M A;  4DHZ B;  1V97 A;  2K8B A;  2WXM A;  4AJW A;  2DZK A;  4WAF A;  2KLG A;  2NR2 A;  4KSK C;  3RNF C;  1PYW D;  2MEK A;  1TZ1 A;  2D3B A;  1V1O A;  1L0V B;  2KO3 A;  2JXT A;  3NJT A;  2IO2 B;  3QA8 A;  3A1Q B;  1C79 A;  2J52 A;  3E56 A;  1X1M A;  4K7U A;  4YSY B;  3T8M A;  2BB5 A;  3JYU A;  1WFY A;  2WXL A;  3PRM B;  1Q5W B;  4H2A A;  2K9X A;  5HKH A;  4N58 A;  2FCQ A;  4HDQ A;  2LFI A;  4NPN A;  2GB1 A;  4W9H A;  4ANV A;  2BYE A;  4NAW B;  5G55 A;  1EM7 A;  4LJO B;  1BML C;  3AU4 A;  3WAO A;  4C7Z A;  3V6C B;  4JGH B;  2RR9 A;  1XF5 L;  4KIK A;  1P0R A;  4ZRI A;  4W9E A;  3AE8 B;  4PK1 A;  2AQ2 B;  3LDZ E;  2IND C;  2KTR A;  2KQ7 A;  2DEN B;  3MJW A;  1A5R A;  3GZN B;  1XQQ A;  4MEL A;  4Q2J A;  4XDC A;  1CZP A;  1XLQ A;  3DWG C;  3QCA A;  3AEC B;  4NJC A;  4HCP B;  1IGC A;  1Y56 A;  1ACC A;  5AEK B;  1WX8 A;  3ZLZ A;  3MFG A;  2IY0 B;  3AM9 A;  1L4Z B;  4P6V F;  2W82 A;  5D7G A;  4PS8 A;  4F7Z A;  1QLB B;  4XWT A;  1GOZ A;  2NBV B;  2MHJ A;  5I4D A;  1QQR A;  4XWW A;  1VDV A;  3N20 C;  2Z8L A;  1F9J A;  2A5U A;  1RFA A;  2ZCC A;  2IBI B;  3A1Q A;  5G2N A;  2H89 B;  2RPQ A;  4AUQ C;  2JUO A;  3SEB A;  1UBQ A;  3AXC A;  1ROE A;  3JSV B;  2WGS A;  2MH7 A;  4ZOH C;  4NY0 A;  2JX5 A;  4PS3 A;  1YOV B;  2M8S A;  4FJV B;  3HVZ A;  3PRP B;  1V5O A;  1OQQ A;  3AE1 B;  3AU5 A;  1MHX A;  5EE3 A;  4NAW A;  3KUC B;  4P7I A;  1KH0 A;  2QIL A;  1YJ1 A;  3AEG B;  1WRD B;  4KKJ A;  4FJZ A;  4KKI A;  4YT0 B;  3V6E B;  4J6I A;  5C23 A;  2JU6 X;  2KLC A;  2K0P A;  2FCN A;  5IKC M;  3RUI B;  1OGW A;  2D3G A;  2ZPN A;  3Q3O C;  1XXG A;  2C60 A;  3I3T B;  2L83 A;  2KDE B;  1IBX A;  2MP2 B;  2W9N A;  2MBO A;  2JZ3 B;  1NYR A;  2JXX A;  3AE5 B;  3TBL D;  1L2N A;  1JCK B;  4IM2 A;  3W9C B;  3GE3 C;  4DHJ D;  1ZXH A;  3GZN I;  1WIA A;  4M00 A;  1SF0 A;  3RD2 A;  3EFU A;  3RZF A;  4RH6 A;  2KX0 A;  4AOF A;  4AQ7 A;  2WXJ A;  3RNC C;  4OHJ A;  2JZZ A;  1UNS A;  3TMP B;  1J7B A;  3QIJ A;  1I4X A;  4KGR A;  2O6V D;  4G50 A;  3RFZ B;  2J7Q B;  4KZC A;  1C78 A;  2N9P C;  4HRS A;  5CHV C;  3DBR B;  1WRI A;  1UGJ A;  4IDI A;  1V86 A;  3DVN V;  1YJI A;  3RNE C;  1SE3 A;  2W54 A;  3M63 B;  3JSV A;  1FO4 A;  1ZKH A;  3N9Y C;  2BTE A;  4WJN A;  3WA0 A;  4FBJ B;  3DBL I;  2Z0E B;  4J3O D;  1TIF A;  2MWS B;  1F0Z A;  1HTQ A;  3S2A A;  2JYT A;  4IM0 A;  3IFW B;  5AUI A;  1C3T A;  1S1Q B;  2IO1 B;  2RDH A;  4W9I A;  2IGD A;  3RPF C;  1XLP A;  5LXH A;  3AH7 A;  1WYG A;  3SDL C;  3JVZ X;  2D5G A;  2KX3 A;  4M8N A;  2INC C;  3ZW3 A;  5HI1 A;  1BT0 A;  4HKQ A;  3BK2 A;  5EE1 A;  1TKY A;  1TS2 A;  1IGD A;  1K53 A;  2VH1 A;  5IN7 A;  1ZDV A;  4OZA A;  2MP2 A;  1JWU D;  3SHQ A;  3Q8B A;  3APF A;  2J0J A;  5T8I A;  4K7W A;  3UIP B;  4YTM B;  5HHD G;  3HM6 X;  2DBY A;  4HJK A;  3DVG X;  3M62 B;  4E71 A;  2XK5 A;  3QK0 A;  4IW0 A;  4AS1 A;  2WDQ B;  3N32 A;  3RNB C;  3LYY A;  1KF6 B;  2LJI A;  1EF5 A;  2JRI B;  4KDI C;  1PGX A;  1WF9 A;  3N3K B;  4EKU A;  4B6W A;  1ET6 A;  1PDX A;  1FMA D;  3L16 A;  3ZXV A;  4KZ0 A;  2ZW1 A;  3PTF C;  3N1X C;  2V1Y A;  2M0X A;  3AI5 A;  3SD5 A;  1WGR A;  3CWI A;  2RPV A;  2CJO A;  4IKG A;  2QCZ A;  3DBR I;  4JWU C;  4II3 B;  2WWZ A;  4OVV A;  3RT3 B;  2L8J A;  3AEA B;  4W9J A;  2KJH B;  2PVG C;  3NZS A;  2K22 A;  2NS5 A;  3VQI A;  5DPW A;  3P1M A;  5GXG B;  3VRA B;  4BBN F;  1L6U A;  1YMH E;  4REZ A;  3W1S C;  5C3J B;  2IGG A;  1VRA B;  3KW5 B;  3B9J A;  1HA5 A;  1ESF A;  4WWN A;  4C80 A;  1E90 A;  2EKE C;  3U52 E;  1L4D B;  2PW9 A;  4DXG A;  4WJO A;  1ZXI A;  2DHZ A;  3UIN B;  1VJK A;  4XE0 A;  2DZM A;  3ZRF A;  1GNU A;  2G4D B;  3DHI C;  3NVV A;  2L3Z A;  2KMM A;  2O2V B;  3DOW A;  2WXQ A;  3NHE B;  4L23 A;  4DXF A;  2KT7 A;  2QSD A;  4K3C A;  4LNF A;  2N7J A;  2INP E;  2IY1 B;  3CSF A;  4EE2 A;  3R2T A;  2DYO A;  4YSX B;  3EUB 2;  2Y5P A;  1XCQ L;  2IO3 B;  4JX1 C;  1WX9 A;  2AWT A;  2RDG A;  1EO6 A;  1WJ4 A;  5BYS A;  4IM3 A;  1MJD A;  4US8 A;  4I6P A;  1D5M C;  5DCN A;  1N6Z A;  3TEX A;  4LLG M;  2FUG 1;  4ACF A;  4WH4 A;  4I6N B;  4ARC A;  4IWO A;  1XT9 B;  2ZPY A;  4USA A;  1SJH D;  2MJE A;  2KWC A;  3L54 A;  3Q69 A;  1N5W A;  3Q8A A;  4GLS C;  1IYF A;  2I38 A;  2LHD A;  3AE7 B;  3KWL A;  1TKE A;  1HE8 A;  2V4I B;  4F8C B;  1NI3 A;  2HD5 B;  1FNW A;  1L5P A;  1LXD A;  1MG8 A;  5JXV A;  3P4P B;  3H7P B;  1QKZ A;  3I9V 1;  4EZK A;  3ZGZ A;  2WU5 B;  2AL6 A;  1WY8 A;  4JWS C;  1JWS D;  3N30 A;  3IT4 B;  1HQR D;  2KFJ A;  2ICI A;  4IG7 B;  2E3T A;  3BK1 A;  1FRR A;  1C9F A;  4ARI A;  4GDK B;  3IAM 1;  2BYT A;  2KWD A;  2O2V A;  4BAX A;  4IWQ A;  2PMV A;  2KWU B;  3GB1 A;  2N0S B;  1NI2 A;  4YTN B;  4X57 B;  2G3Q B;  1KLU D;  2D3A A;  4RM8 A;  4E3C A;  4TSS A;  4ZRK A;  5EE9 A;  4AJY B;  3RYT A;  3DBH B;  4OVZ A;  3B1L X;  3H1U A;  3V62 A;  2V3S A;  3UI3 A;  3GP7 A;  2MBQ A;  2BVC A;  1I4R A;  4YSZ B;  2ZW0 A;  5DPR A;  3VUW A;  2G45 B;  3V61 A;  1F2R I;  1WXM A;  1CK1 A;  2DYB A;  1B9R A;  2X8X X;  4DHJ B;  2K1F A;  3AV8 A;  4A6Q A;  3ZKJ C;  1UEL A;  2FBW B;  3MJ5 A;  3PHX B;  4WWO A;  4FUL A;  2LUM A;  3KYC D;  2OOB B;  2REX A;  4PT5 A;  1WR1 A;  2C9W B;  3RNA C;  2HDE A;  4A3P A;  3K9P B;  2DNF A;  2QJL A;  4G11 A;  1QIL A;  1WE6 A;  3RUL A;  5BMH A;  5JHB A;  5GMV A;  3FIL A;  3NOB A;  2KJ6 A;  1KTK A;  1QOF A;  1JWA D;  2GBM A;  3HHM A;  4GDK A;  2WXH A;  3O13 A;  3QAR A;  4FAD A;  4IC7 B;  4CYE A;  4B0E A;  3VUX A;  3VH3 B;  2LRW A;  2M17 A;  2IPK D;  3V3X A;  1FCC C;  4XGA B;  3KLS X;  2J53 A;  4BOS C;  3BVM A;  4ANU A;  1GUA B;  2PKO A;  3ZJT A;  1HZ5 A;  1KLV A;  4A20 A;  2KHW B;  2KDB A;  2JRH A;  2XEW A;  3P4Q B;  4CQN A;  3ZVV A;  1RAX A;  1V80 A;  3CST A;  3TEZ A;  2WLB A;  1EUV B;  3TSS A;  2R2O A;  2H88 B;  2XN9 C;  2M56 B;  2LGX A;  2WDV B;  1RM6 C;  3DBH I;  1D4B A;  5HFY A;  4KSL C;  3VAW A;  1BXT A;  4ZDV A;  1C4A A;  1GC7 A;  3L13 A;  2VZK B;  3AE4 B;  4D2K A;  4HJG E;  4RM9 A;  2BWE S;  2N9K A;  2M4N A;  1C1Y B;  1E6E B;  3TCA A;  3DDC B;  4ZHO A;  4HPP A;  4ZHP A;  2PLP A;  1ZDX A;  1PFD A;  3A9K B;  4ZRP A;  1Q0W B;  3Q8E A;  1J0G A;  4TKN A;  4NZL B;  2R2Q A;  5FR6 A;  1WJN A;  1J8C A;  2J0K A;  3CF6 E;  3I57 A;  1JWB D;  3DPD A;  1WM2 A;  3OLM D;  4MAC A;  5FK9 C;  4NJ6 A;  2K25 A;  4N9F 4;  1XD3 B;  2QIE B;  4NNJ B;  1L7Y A;  2KC2 A;  2VRR B;  3BZD B;  3L17 A;  3UIO B;  1TY0 A;  1M94 A;  4BKS D;  1Q10 A;  4OVU A;  4FJY A;  1E0Z A;  2MLB A;  3B08 A;  3AE6 B;  2KMA A;  4WAA A;  3QX1 A;  4MGI E;  1V9J A;  2N7D A;  3EGR A;  4JE3 B;  1FIQ A;  3AE3 B;  1FNV A;  3EHV A;  3VR9 B;  2FUH B;  3WAP A;  3UGB B;  3ONS A;  1T0S C;  1WGD A;  4WJQ A;  2Z0D B;  4OZB A;  4JPS A;  1FCL A;  1WGY A;  2C7H A;  3B2F A;  1V81 A;  1YX6 B;  1KOT A;  4L1B A;  3SFE B;  1D5X C;  1AW7 A;  2KTF A;  3Q2A C;  2WXK A;  2GBN A;  3O65 B;  3P4R B;  2BGF A;  2G9H D;  3A9K A;  3K9O B;  4RNA A;  3C0R B;  1MHH E;  4HCN B;  2ZVO A;  2JY6 A;  4WIP A;  2K8C A;  1WE7 A;  2LGS A;  3SR6 A;  4TV3 A;  1I7H A;  2DWQ A;  2LXA A;  3KQ4 A;  3W2D A;  1T3Q A;  3M95 A;  3DHG C;  3V60 A;  4WWP A;  1EWY C;  3P4S B;  3RNG C;  5C1Z A;  2K39 A;  5D2M B;  3EC8 A;  1HXY D;  3OG5 A;  2NPT B;  1SIF A;  2YEP F;  1CQV A;  5D3D A;  2PE6 B;  3N1Y C;  2PIA A;  2MBE A;  3IG3 A;  2GBK A;  1XEE A;  4A90 A;  4CO7 A;  3ML8 A;  2M19 A;  3L4P A;  4N59 A;  2JWU A;  2Q5W D;  3Q3J A;  4HK2 A;  2FCS A;  2ZJD A;  1K52 A;  1GC6 A;  3ZNI D;  4MDK E;  3EEC A;  4FLH A;  4IUM B;  4BOZ B;  2KN4 A;  1WZ0 A;  4KDL B;  1YQ3 B;  2WP9 B;  4S0R A;  2YEP B;  3E9S A;  3ML9 A;  2PJH A;  2BYF A;  1KJT A;  1R4M B;  1JQ4 A;  1DOI A;  2N4F A;  2Y5C A;  1KRH A;  4LDT D;  2FID A;  3QC8 B;  4LK0 M;  3Q6B A;  4JLC A;  2CHW A;  1PQS A;  2JF5 A;  1ZPS A;  1E10 A;  4FA6 A;  5BMI A;  1P9D U;  2LGY A;  5LNK 1;  2MW5 A;  2KKC A;  2HTH A;  1E8Y A;  2YLM A;  2KAJ A;  4A9A A;  4FHJ A;  1YN3 A;  4ITK A;  3URY A;  1RLF A;  1J7C A;  3BVG A;  5CTR C;  4HVB A;  4EOY A;  1ZE3 D;  3PT2 B;  2J0M A;  4MGZ E;  2EEL A;  2MBH A;  3T3N A;  2ONQ A;  1DOX A;  1Z5S B;  3T3O A;  1JWM D;  3ZDM C;  2NPT A;  3D32 A;  1MVK A;  4P16 A;  3PRZ A;  1QOA A;  3A4R A;  5JHA A;  2BKF A;  2WX1 A;  4GMV A;  4I6L B;  5BYQ A;  4LNK A;  3NZ3 A;  2FIF A;  1I4G A;  1ZW7 A;  1IPG A;  1C4C A;  4C56 C;  1I4H A;  4WJP A;  3Q3M C;  3VTV A;  1FEH A;  4MGY E;  3KUD B;  2NCN A;  2KC1 A;  1FXI A;  1M4V A;  4ZRJ A;  1L6V A;  2D2Q A;  4IWP A;  5EE0 A;  3AEB B;  3U4E G;  1HTO A;  2QHO A;  3U7Z A;  3APD A;  2N1V A;  3RCZ A;  1PGA A;  4ICV A;  2MSE D;  3FAH A;  3ZUN A;  3KVF B;  1NEN B;  4NQK E;  2OHF A;  3ZDT A;  1OFF A;  3CIR B;  2BS4 B;  3R66 C;  1E8X A;  3H6N A;  3W1Y A;  2BPS A;  4E74 A;  5L83 A;  2WDT B;  5AZH A;  1UBI A;  3I5J C;  1R4M I;  1TT5 B;  1FD6 A;  1JRP A;  3WCQ A;  1SJE D;  2RSU A;  3WAN A;  3NVW A;  1AN8 A;  1SB3 C;  1P1A A;  1N60 A;  2ZZP B;  3ZYY X;  2BS3 B;  2TSS A;  3VTU A;  2LI5 A;  2L0F A;  2IO0 B;  3VTW A;  2I1J A;  3RMK C;  5AZF A;  2M1M A;  4RGN A;  2N9L A;  2K8H A;  1JW9 D;  4ZYN A;  2KDF B;  2QDF A;  3DWM A;  1WGH A;  3C8Y A;  3NS1 A;  1TYG B;  2WU2 B;  1V5T A;  2EMT A;  2HJ1 A;  2MA9 B;  1N62 A;  2I2Y A;  3ZRC A;  2V0G A;  2KYW A;  4KVG B;  3NVY A;  4HDO A;  1FRD A;  3LXF A;  4WQO B;  4CHK A;  1SIJ A;  3R8B A;  2DZJ A;  2KOX A;  2DZI A;  5EDS A;  2WXP A;  4YTP B;  3W5U B;  2DAJ A;  2LUE A;  1ENF A;  4DDG D;  1CJE A;  2LGD A;  4BBN C;  3ZJU A;  3W1S A;  4S17 A;  5E6J A;  3ZTD A;  3PS6 A;  3Q8C A;  4MJS B;  4FN2 A;  2WXG A;  1ZUD 2;  1E7V A;  2WXF A;  5G5G A;  2QMT A;  1VLB A;  2WXO A;  2L32 A;  1C77 A;  4LNN A;  3I63 C;  2C7M B;  5J17 A;  1UUP A;  2FCM A;  5J18 A;  2BWF A;  3ZO5 B;  2Y3A A;  1G6J A;  4W9C A;  5L95 C;  1CMX B;  4MM3 B;  2X38 A;  3VR8 B;  3AUL A;  4KGS A;  3PGE A;  2KQS A;  1TGZ B;  2PTL A;  3AED B;  3ZXR A;  1ZGU B;  2Y5B B;  2NBU A;  1NEK B;  2OED A;  5D6J B;  1TS4 A;  3PPA A;  4DXA B;  4RGO S;  4RFB A;  4K81 A;  2ZEQ A;  1FNU A;  2BS2 B;  2L7R A;  2GBJ A;  1D3Z A;  1VR9 A;  3DVN U;  2BF8 B;  3P2B A;  2KAN A;  3TIX A;  1K50 A;  3APC A;  2N1W A;  3DQV A;  1V6E A;  5HG2 A;  1QOG A;  2BW2 A;  3HK0 A;  3UQA A;  4TQ0 A;  2ON8 A;  4OW0 A;  4DWF A;  1WZ3 A;  2QC8 A;  3KH0 A;  3PO0 A;  2B76 B;  3RN9 C;  3R2I A;  1ZOY B;  2RMM A;  1NDD A;  4K7S A;  5TSS A;  2ZNV C;  3OJ4 B;  1AWD A;  4LTU A;  1D5Z C;  1QZE A;  2LZ6 A;  4KGT A;  5IO9 A;  4MJS A;  2W3S A;  2MCN B;  5JZE B;  4C00 A;  4W9F A;  4GSW A;  2LWP A;  4PYZ A;  2N7E A;  2MRP A;  1GAQ B;  1RFK A;  1C76 A;  1WXV A;  5BYR A;  2DAF A;  1FPY A;  4UDU C;  1IP9 A;  2WXN A;  3HVD A;  5E6N A;  1FFV A;  2EMS A;  4LJP B;  1L0Y B;  2O6V B;  3PZD A;  4XZ4 A;  4DDI D;  3H7P A;  2J42 A;  2LVO A;  3L0W B;  4K1R B;  1EU4 A;  5CX3 A;  1T0R C;  4EZL A;  2NTT A;  5D94 A;  2WNM A;  2UU7 A;  3EA6 A;  2V3P A;  1C4P A;  1FXT B;  3KUZ A;  1WX7 A;  1LO5 D;  3NUH B;  2AX5 A;  2C5L C;  1YIW A;  4JQW C;  4KIK B;  4YWG G;  3PSE B;  4EZJ A;  3VRB B;  4MEM A;  3PLV A;  2KN5 A;  2WXR A;  3BY4 B;  3DCG A;  2AQ3 B;  1PUT A;  3RI7 C;  4LDT B;  4BZA A;  1YN5 A;  4MH8 A;  4W9L A;  1YN4 A;  4RGT A;  1TKG A;  2GI9 A;  2KXJ A;  1U4A A;  1SE2 A;  1YNT E;  2A4Z A;  3NZU A;  1I35 A;  4XDD A;  1GPX A;  1RRB A;  2K3U A;  2AQ1 B;  2WHI A;  5IOI A;  4M01 A;  1UGM A;  1ZP0 B;  3FC4 A;  1VCB A;  3MHS D;  4TUU A;  5E6P A;  3QWZ B;  2LVP A;  3AN1 A;  2KZR A;  1JRU A;  2MJ3 A;  1F52 A;  1TS5 A;  2LGI A;  4HXD A;  2SAK A;  4DBG A;  4OZC A;  2KMC A;  2E6X A;  2L0T A;  2PEA A;  4HEA 1;  1N63 A;  3R7Q A;  1STE A;  4JIO U;  3U30 A;  2ACZ B;  1S3S G;  2DYM A;  4HLE A;  3AEF B;  2O6V A;  3W5V B;  4B9K A;  4RF1 A;  2LEK A;  5E6O A;  1LQB A;  1UZX B;  2W55 A;  4RMA A;  1TZO A;  1T6B X;  2B3A A;  3OAW A;  2JPH A;  2RDB C;  4W9G A;  4YL8 A;  1HEZ E;  1TJE A;  2LJ5 A;  2L05 A;  4GB9 A;  4R3D A;  4ZRQ A;  4NJ7 A;  3A9J B;  5D3I B;  1NVI D;  4C7Y A;  2KDI A;  2BT6 A;  1AYF A;  3WAL A;  2RD0 A;  1WXS A;  3A4S C;  4N6E B;  4DHZ E;  1WJU A;  2ASQ A;  1IBX B;  2WDR B;  4BKG A;  1YQB A;  2IJ0 A;  1E9M A;  4GGQ A;  3AE9 B;  1B1Z A;  1OEY A;  3MP9 A;  2NTS A;  1L0X B;  4G0N B;  1NBF C;  1E8W A;  4PYU A;  5JH5 C;  2CHX A;  3BIN A;  2NBW B;  2G4S A;  3PHW B;  1V2Y A;  4BFR A;  2NMQ A;  1VZ7 A;  4C4V B;  3DHH C;  3OJ3 A;  2D10 A; 
#chains in the Genus database with same CATH homology
 3U8Z A;  2J0M A;  3KYD D;  4MGZ E;  3A33 B;  2JVC A;  2MBH A;  3VDZ A;  1TTN A;  4I6N B;  1V49 A;  1SE9 A;  1Z5S B;  2KTR B;  3IHP C;  4IWO A;  2KFK B;  3WAM A;  1I42 A;  1XT9 B;  2ZPY A;  3ZDM C;  2NPT A;  1UH6 A;  2KWC A;  3D32 A;  3L54 A;  4HWI B;  3PRZ A;  3A4R A;  2DX5 B;  5JHA A;  2BKF A;  2FAZ A;  2WX1 A;  4GMV A;  4I6L B;  3JW0 X;  2ZCB A;  2LAS A;  3X23 A;  3ZNG C;  1IYF A;  2FIF A;  1SGH A;  1ZW7 A;  1IPG A;  4GDL A;  2CHZ A;  3ALB A;  3ZIM A;  1Z2M A;  4DHZ B;  4WJP A;  2K8B A;  1HE8 A;  2OJR A;  1E8Z A;  4II2 B;  3VTV A;  4AJW A;  4MGY E;  2DZK A;  3KUD B;  4F8C B;  4AWJ A;  2KLG A;  2NCN A;  2HD5 B;  2KC1 A;  2NR2 A;  4KSK C;  1LXD A;  1MG8 A;  4ZRJ A;  3H7P B;  2D2Q A;  4EZK A;  1TZ1 A;  4IWP A;  1H8C A;  3NS8 A;  2AL6 A;  3SU8 X;  2KO3 A;  1WY8 A;  2QHO A;  2IO2 B;  3N30 A;  2UYZ B;  3A9J A;  3QA8 A;  3A1Q B;  2KFJ A;  4IG7 B;  3APD A;  2N1V A;  3RCZ A;  5AZG A;  4ICV A;  2MSE D;  4GDK B;  1X1M A;  4K7U A;  3DVG Y;  3T8M A;  3ZUN A;  3JYU A;  3KVF B;  1WFY A;  3PRM B;  2O2V A;  4NQK E;  1Q5W B;  3ZDT A;  2CS4 A;  4IWQ A;  4NQL B;  1WXA A;  2KWU B;  3R66 C;  5HKH A;  2K6D B;  1E8X A;  3H6N A;  2FCQ A;  4HDQ A;  4NPN A;  3W1Y A;  4W9H A;  1NI2 A;  1OTR B;  2BPS A;  4E74 A;  5L83 A;  2WDT B;  5AZH A;  4ANV A;  1UBI A;  2BYE A;  3QQ8 B;  4NAW B;  3QHT A;  5G55 A;  3L08 A;  4LCD E;  1R4M I;  4X57 B;  2G3Q B;  3PRE A;  4AP4 C;  4LJO B;  1H4R A;  3AU4 A;  3CMM B;  4RM8 A;  3WAO A;  2XK5 B;  4E3C A;  4ZRK A;  3V6C B;  3WIM A;  2RSU A;  3WAN A;  4AJY B;  3RYT A;  2C7N B;  3VVW B;  3B1L X;  3H1U A;  4JGH B;  4ASW C;  1P1A A;  2RR9 A;  3V62 A;  4KIK A;  2V3S A;  3M3J A;  4XX5 A;  2ZZP B;  1P0R A;  4ZRI A;  3PT2 B;  4W9E A;  3VTU A;  2LI5 A;  2L0F A;  3B0A A;  2IO0 B;  2MBQ A;  3VTW A;  2I1J A;  3LDZ E;  5AZF A;  2KTR A;  2KQ7 A;  2DEN B;  2KFK A;  2M1M A;  3MJW A;  5DPR A;  3VUW A;  1A5R A;  1J19 A;  2G45 B;  1XQQ A;  3V61 A;  4MEL A;  1VD2 A;  5DPS A;  1WXM A;  3QCA A;  2K8H A;  2DYB A;  2UWQ A;  4TQ1 A;  2MQJ A;  4HCP B;  4DHJ B;  4ZYN A;  2KDF B;  1WGH A;  1P3Q U;  2GMI C;  5AEK B;  1WX8 A;  3ZLZ A;  3PVL A;  2IY0 B;  2K1F A;  1V5T A;  2KWV B;  2EMT A;  2MA9 B;  3ZKJ C;  1UEL A;  3PHX B;  4WWO A;  4FUL A;  5D7G A;  5J2R A;  4PS8 A;  3KYC D;  3ZRC A;  2OOB B;  2REX A;  4F7Z A;  2NBV B;  4KVG B;  4HDO A;  4URK A;  1WR1 A;  2C9W B;  2KK8 A;  4WQO B;  4CHK A;  3L10 B;  4A3P A;  1E7U A;  2DZJ A;  2KOX A;  1F9J A;  2A5U A;  2DZI A;  3PV1 A;  3K9P B;  1RFA A;  5EDS A;  2ZCC A;  2IBI B;  4G11 A;  1WE6 A;  3RUL A;  2DAJ A;  2LUE A;  3R7R A;  5JHB A;  3A1Q A;  5GMV A;  5G2N A;  2RPQ A;  3NOB A;  4DDG D;  2KJ6 A;  4AUQ C;  3ENE A;  2JUO A;  2CR5 A;  2LGD A;  4BBN C;  3W1S A;  2GBM A;  1UBQ A;  3ZTD A;  3PS6 A;  3HHM A;  4GDK A;  4MJS B;  3AXC A;  2LD9 A;  3JSV B;  4FN2 A;  4NY0 A;  3QAR A;  4MSQ B;  4PS3 A;  1UD7 A;  4FAD A;  4IC7 B;  4CYE A;  2M8S A;  4FJV B;  3VUX A;  3VH3 B;  2LRW A;  3PRP B;  4ANW A;  1E7V A;  1V5O A;  2K6Q A;  2Z59 B;  3AU5 A;  2M17 A;  1WI0 A;  1E5W A;  5IAA C;  2FNJ B;  4NAW A;  2AL3 A;  2C7M B;  3KUC B;  5J17 A;  2L76 A;  4P7I A;  2FCM A;  4F1S A;  3QAQ A;  5J18 A;  2BWF A;  3ZO5 B;  4BOS C;  4ANU A;  1YJ1 A;  1GUA B;  1G6J A;  4W9C A;  1WRD B;  3HM3 A;  1WGG A;  5L95 C;  4M0W B;  4FJZ A;  2XBB C;  1KLV A;  1CMX B;  4A20 A;  2KHW B;  2KDB A;  2JRH A;  2XEW A;  3ZVV A;  3V6E B;  1RAX A;  3AUL A;  4J6I A;  3T9L A;  1V80 A;  3PGE A;  2JWZ A;  4PS7 A;  2V4L A;  3CST A;  5C23 A;  2KQS A;  2KLC A;  4BVU C;  1TGZ B;  2FCN A;  4XC2 A;  3RUI B;  1EUV B;  1OGW A;  1WYW B;  2D11 A;  2D3G A;  1ZGU B;  2ZPN A;  2R2O A;  4BKT A;  2Y5B B;  2C60 A;  2KNB A;  2LGX A;  2NBU A;  3I3T B;  5D6J B;  2KDE B;  3ZNZ B;  2MP2 B;  3PPA A;  3DBH I;  3HIZ A;  4DXA B;  4KSL C;  2W9N A;  4ICU A;  3VAW A;  2MBO A;  4GN1 A;  2JZ3 B;  4K81 A;  4ZDV A;  2JXX A;  2PPH A;  3TBL D;  1P98 A;  1GC7 A;  2ZEQ A;  3VH4 B;  3L13 A;  1L2N A;  1Q1O A;  1R4N I;  1TBE A;  2L7R A;  4IM2 A;  2GBJ A;  2AYO B;  1D3Z A;  4RM9 A;  1AAR A;  2BWE S;  3U7D A;  4DHJ D;  3DVN U;  4JL9 A;  4HPM B;  3GZN I;  1WIA A;  3RD2 A;  2BF8 B;  3P2B A;  2KAN A;  3EFU A;  2M4N A;  3RZF A;  3TIX A;  1C1Y B;  2KX0 A;  3APC A;  3TCA A;  3DDC B;  2N1W A;  4AOF A;  3GOE A;  3A9K B;  1Q0W B;  3DQV A;  1V6E A;  2JZZ A;  4KV2 A;  1J0G A;  4TKN A;  3HK0 A;  3TMP B;  1WMH B;  2R2Q A;  3UQA A;  3QIJ A;  4TQ0 A;  5FR6 A;  4B95 A;  1WJN A;  1J8C A;  2J0K A;  3CF6 E;  1WZ3 A;  3KH0 A;  4DWF A;  2O6V D;  4G50 A;  1K8R B;  5KHQ A;  3DPD A;  1WM2 A;  2J7Q B;  1NDD A;  4K7S A;  4KZC A;  5DPT A;  3OLM D;  2N9P C;  2ZNV C;  3OJ4 B;  5CHV C;  4ANX A;  1QZE A;  2LZ6 A;  5BO4 B;  4NJ6 A;  2K25 A;  1V86 A;  3DVN V;  4N9F 4;  3RZW C;  4MJS A;  3M63 B;  3JSV A;  4GIV A;  2MCN B;  1ZKH A;  5JZE B;  1XD3 B;  1Y8R C;  2KVR A;  4WJN A;  4W9F A;  4GSW A;  3VUY A;  3DBL I;  3WA0 A;  4NNJ B;  1L7Y A;  2Z0E B;  2KC2 A;  2LWP A;  3ECI A;  2LXC A;  4PYZ A;  2N7E A;  2VRR B;  2MRP A;  3L17 A;  3UIO B;  2GOW A;  3DBS A;  1M94 A;  4BKS D;  1WXV A;  2N9E B;  2MWS B;  2DAF A;  3H7S A;  2IYD B;  1IP9 A;  3S2A A;  4OVU A;  1WM3 A;  4IM0 A;  3IFW B;  1C3T A;  5E6N A;  1S1Q B;  2IO1 B;  3TL5 A;  2EMS A;  4FJY A;  3NY5 A;  4LJP B;  2O6V B;  4XZ4 A;  3PZD A;  4DDI D;  3UQB A;  1KM7 A;  2MLB A;  3B08 A;  3H7P A;  3H9D A;  2LVO A;  4W9I A;  3L0W B;  4K1R B;  2KMA A;  4WAA A;  5LXH A;  3QX1 A;  4MGI E;  1V9J A;  2N7D A;  5CX3 A;  3SDL C;  3JVZ X;  4EZL A;  2NVU I;  2KX3 A;  5D94 A;  3R3M A;  1GG3 A;  4M8N A;  2WYQ A;  2IZV B;  3ZW3 A;  1BT0 A;  3EHV A;  1FXT B;  3KUZ A;  2FUH B;  1WX7 A;  2JT4 B;  3WAP A;  1LFD A;  3UGB B;  2C5L C;  2MP2 A;  1YIW A;  1WGD A;  3ONS A;  4JQW C;  4KIK B;  4WJQ A;  3PSE B;  5LLI A;  4EZJ A;  2Z0D B;  2HE7 A;  4MEM A;  3SHQ A;  3PLV A;  2KN5 A;  5LXI B;  3BY4 B;  3DCG A;  1WGY A;  3APF A;  2AEH A;  2C7H A;  2J0J A;  4LDT B;  1V81 A;  1YX6 B;  1KOT A;  2YVC A;  4K7W A;  3UIP B;  2KJR A;  4W9L A;  4FHK A;  5TR5 A;  3HM6 X;  2KXJ A;  2CKH B;  2KTF A;  1U4A A;  3M62 B;  4HJK A;  3DVG X;  4E71 A;  2A4Z A;  2GBN A;  2XK5 A;  3QK0 A;  5CHW A;  3NZU A;  2D07 B;  4IW0 A;  1I35 A;  3O65 B;  2MBB B;  2BGF A;  1RRB A;  3A9K A;  3N32 A;  3K9O B;  3C0R B;  4HCN B;  1EF5 A;  2ZVO A;  2GBR A;  2JRI B;  2JY6 A;  4KDI C;  1WMH A;  1UGM A;  1WE7 A;  2K8C A;  4TV3 A;  1WF9 A;  1LM8 B;  1VCB A;  3MHS D;  3N3K B;  4M8M A;  4EKU A;  4B6W A;  2LXA A;  4TUU A;  5E6P A;  4DK5 A;  2BYV E;  3QWZ B;  3IVF A;  2LVP A;  2KZR A;  1JRU A;  3L16 A;  3M95 A;  4MH0 E;  4GOC A;  4HXD A;  5IA7 A;  4KZ0 A;  3V60 A;  3PTF C;  2PE9 A;  2V1Y A;  4DBG A;  4WWP A;  1EF1 A;  2M0X A;  2KMC A;  5C1Z A;  2K39 A;  3AI5 A;  3SD5 A;  4HPL B;  5CHF A;  2L0T A;  5D2M B;  4EUT A;  2L00 B;  2PEA A;  3EC8 A;  3VFK A;  1WGR A;  3R7Q A;  2KD0 A;  2NPT B;  1SIF A;  4MSM B;  4JIO U;  3U30 A;  3DBR I;  4A3O A;  3X0W A;  4II3 B;  2WWZ A;  4OVV A;  3RT3 B;  2L8J A;  1S3S G;  2PE6 B;  2ZNV B;  2KJH B;  1YX5 B;  4W9J A;  2CU1 A;  2DYM A;  2MBE A;  3NZS A;  3IG3 A;  4HLE A;  2GBK A;  2NS5 A;  1OQY A;  2O6V A;  3VQI A;  3ZTC A;  1OEY J;  5DPW A;  4B9K A;  4CO7 A;  4GDL B;  4BBN F;  3ML8 A;  5E6O A;  1LQB A;  1UZX B;  3Q3J A;  2BKR B;  3W1S C;  4HK2 A;  2FCS A;  4RMA A;  3KW5 B;  2ZJD A;  4G3X B;  2B3A A;  2I1K A;  3OAW A;  4GU2 A;  1GC6 A;  5KHO A;  2JPH A;  4MDK E;  3ZNI D;  4W9G A;  4YL8 A;  4WWN A;  3EEC A;  2LJ5 A;  1E90 A;  2EKE C;  4FLH A;  2L05 A;  2MX2 A;  2ZVN A;  4GB9 A;  4IUM B;  4EFO A;  4BOZ B;  1WZ0 A;  2LVQ A;  1T0Y A;  4KDL B;  4BKS A;  4EEW A;  4NJ7 A;  3A9J B;  3ZNH B;  4WJO A;  4W9D A;  2LRU A;  2DHZ A;  2KDI A;  3TJP A;  1YD8 U;  3UIN B;  3ML9 A;  2PJH A;  2BYF A;  1KJT A;  2WX0 A;  3WAL A;  4MGK E;  2RD0 A;  2DZM A;  3ZRF A;  1GNU A;  2G4D B;  1WXS A;  3MTN B;  2N9X A;  3A4S C;  3PLU A;  2L3Z A;  3VXW A;  1WJU A;  3Q3F A;  2N4F A;  4DHZ E;  2ASQ A;  2O2V B;  3DOW A;  4LDT D;  4BKG A;  3NHE B;  2FID A;  3QC8 B;  1YQB A;  1WH3 A;  3IBE A;  3VHT C;  4JLC A;  2CHW A;  2HJ8 A;  4GGQ A;  4W9K A;  2IY1 B;  2RGF A;  4FBJ B;  3CSF A;  4MM3 A;  1OEY A;  1PQS A;  2JF5 A;  4G0N B;  2DYO A;  3UF8 A;  4FA6 A;  3LJ3 A;  1P9D U;  1NBF C;  1E8W A;  1ISN A;  4PYU A;  5JH5 C;  2CHX A;  2LGY A;  2IO3 B;  3BIN A;  1GJZ A;  2MW5 A;  2KKC A;  2NBW B;  1WX9 A;  2HTH A;  1E8Y A;  2YLM A;  3QJZ A;  2AWT A;  2G4S A;  3PHW B;  1EO6 A;  1V2Y A;  1WJ4 A;  4BFR A;  4IM3 A;  4FHJ A;  1WJ6 A;  1WR6 E;  1RLF A;  4I6P A;  5CTR C;  4HVB A;  5DCN A;  4EOY A;  4GXB A;  3OJ3 A;  2D10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...