3RT3B

Complex of influenza virus protein with host anti-viral factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
b'WDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKSDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ISG15
publication title Crystal structure of human ISG15 in complex with influenza B virus NS1B
rcsb
source organism Homo sapiens
molecule tags Antiviral protein/viral protein
total genus 36
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rt3B02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rt3B01
2KTFA 3B1LX 4KSLC 2GOWA 2KNBA 2L3ZA 4AP4C 3NHEB 2MBBB 3VHTC 3H9DA 4HDQA 2K8BA 1P3QU 2JY6A 2LWPA 2R2QA 4NPNA 1R4NI 3QAQA 4N9F4 2YLMA 2UWQA 1WX9A 3R7QA 3N32A 2L00B 2MX2A 4GXBA 3VTUA 2PPHA 2K6DB 2REXA 3A9JA 1D3ZA 1G6JA 5CTRC 2K6QA 1IYFA 2GMIC 1V6EA 1Y8RC 3RCZA 3AULA 3M62B 4HCNB 2KOXA 4DXAB 3QHTA 4DWFA 2HD5B 4PS8A 2IBIB 1ISNA 1WXAA 4A20A 3A9KA 2BGFA 4TQ1A 1SE9A 3A4RA 2V4LA 3A1QA 3NS8A 3PLUA 4CYEA 4EZJA 1PQSA 1V49A 2WDTB 3Q3JA 4ANWA 3BY4B 4W9DA 1TGZB 5G55A 4ZYNA 1MG8A 2BWFA 1UELA 2IZVB 4HPMB 5CX3A 2O6VB 4W9FA 3ZIMA 2JZ3B 2MWSB 5D94A 2LI5A 2G4DB 3VQIA 5CHVC 4W9EA 2XEWA 2J0KA 4FULA 2A5UA 1IP9A 2ASQA 2BYEA 3V61A 1KLVA 1WIAA 5DPRA 3DVGY 3DBRI 3LDZE 4LDTB 4W9JA 1C1YB 5J17A 3ZKJC 2M17A 1WGYA 5E6PA 1HE8A 4JIOU 2CHWA 4DHJD 5AEKB 1KJTA 4MELA 1WR1A 2J7QB 4JQWC 4MSQB 2JXXA 2MBOA 2W9NA 4KDIC 4M8NA 4W9HA 3WANA 3X0WA 3ZRCA 3WAOA 4FJVB 2G3QB 3UQAA 3ZNHB 3L13A 4GDKB 4IW0A 2DZKA 1I42A 2JWZA 5IA7A 1RAXA 1WFYA 3TBLD 1VCBA 2J0MA 5IAAC 2N7DA 4W9KA 3RD2A 2ZPNA 4KV2A 1WH3A 3PRPB 3CSTA 4BOZB 2GBKA 4BFRA 4WAAA 4I6NB 1I35A 2AWTA 3R7RA 3VTVA 3QARA 4BBNC 4TQ0A 4OVUA 1WYWB 2EMSA 4I6PA 1IPGA 3T9LA 3ZNZB 2DZMA 4EZLA 2BYVE 1WXVA 3ZRFA 2N4FA 3PT2B 3MJWA 1WXMA 2NVUI 3VAWA 3CF6E 4IC7B 2LVOA 2DZJA 4FBJB 3PREA 1S3SG 3QC8B 2C7MB 2MRPA 2FNJB 1RFAA 1Z5SB 2AL3A 1WJ6A 4ICUA 4PS7A 3ZTCA 1NBFC 3QIJA 2AYOB 2XK5A 3T8MA 2JZZA 1UH6A 5G2NA 3V62A 2MW5A 3M95A 1WJ4A 4F8CB 4A3OA 5DPWA 2I1JA 3DBLI 2K25A 1TTNA 2KD0A 4MSMB 2CR5A 1WGGA 5AZFA 4ANVA 5JZEB 3H1UA 2N1VA 3ONSA 1UBQA 1WJUA 1WF9A 3C0RB 4ANUA 1NDDA 2O6VA 4HJKA 1SGHA 3B0AA 1T0YA 1WE7A 2AEHA 1OGWA 2GBJA 4GIVA 5LLIA 3TMPB 1EF1A 3NOBA 2KWUB 3H6NA 3VH3B 2KJHB 2WWZA 1WY8A 2GBNA 3L10B 2YVCA 5KHQA 2D11A 4II3B 3ALBA 4ZRKA 1YQBA 1NI2A 1WR6E 4ANXA 2G4SA 2Z59B 2KFKB 4EKUA 5J2RA 1WZ0A 4HCPB 3V6EB 1WJNA 4B9KA 2D10A 4GU2A 1XQQA 4BKSA 2M4NA 4NJ6A 1TBEA 2NBWB 4GDKA 4WJQA 1P9DU 2VRRB 1EF5A 3UINB 4PYZA 3L16A 4MGYE 4ZRIA 2CHZA 2L8JA 3LJ3A 3PHWB 2ZCCA 3MTNB 2NPTA 4KZCA 2KHWB 1GJZA 2KJ6A 1OEYA 3DOWA 1OTRB 1V80A 2MSED 3ZNGC 1Q1OA 4FN2A 2LVPA 2N1WA 4J6IA 4MH0E 3QA8A 2HJ8A 2XK5B 2ZEQA 2FCSA 2PE6B 3OJ3A 4PS3A 1RRBA 4HVBA 1GC6A 4K7SA 2O6VD 2QHOA 4TV3A 4XZ4A 4B95A 2LGXA 3HM3A 2C7NB 3QQ8B 3U30A 3TIXA 4KSKC 3V6CB 4K7WA 3VUWA 2OOBB 4RM8A 5L95C 2LGDA 4E71A 4M0WB 4X57B 2ZNVB 3D32A 2JPHA 2KLCA 2UYZB 5KHOA 2KX0A 2XBBC 4LDTD 3EHVA 1L2NA 1OQYA 4NQKE 2OJRA 5D2MB 2ZJDA 1V81A 2C7HA 2JUOA 3B08A 3IHPC 1A5RA 1ZKHA 3NZSA 2K8HA 2EKEC 3PRMB 1E8WA 4ZRJA 2DAFA 4BKGA 2HTHA 2Z0DB 2ZVOA 3PLVA 2DX5B 2MBEA 2DYBA 3KVFB 3TL5A 2HE7A 2KXJA 3KUCB 3M63B 3WA0A 3UF8A 2KDEB 2KJRA 1X1MA 3L0WB 2KZRA 2JF5A 4GMVA 3N3KB 4PYUA 5JHAA 3ZLZA 2NCNA 3L54A 4A3PA 2NPTB 3I3TB 3VVWB 5JH5C 5JHBA 2KTRB 1E7VA 4E74A 3CMMB 2CU1A 3A33B 4NNJB 3HHMA 4IWPA 4XX5A 3UIOB 2KDBA 2DYOA 4WQOB 2KKCA 2DZIA 3DQVA 5L83A 1WGRA 3W1SC 3TCAA 1V9JA 3QWZB 3JSVA 1ZW7A 2IO0B 3RULA 2JRIB 1WRDB 2KFKA 2L0FA 1FXTB 3ZNID 2K39A 1OEYJ 2K8CA 4HPLB 4EUTA 1LFDA 4IM3A 5C1ZA 3EECA 4KDLB 5EDSA 2LASA 4TKNA 3U7DA 4BVUC 2K1FA 2FIDA 5DCNA 3RT3B 4FJZA 1WE6A 1J8CA 3R3MA 2D3GA 3KUDB 1E8YA 2JVCA 3IVFA 2LXAA 4GGQA 4K81A 3M3JA 1P98A 2B3AA 1BT0A 3SHQA 3UGBB 3KUZA 2IO3B 2N9XA 2ZVNA 3PHXB 4II2B 3PS6A 5LXHA 3KYDD 3ZW3A 3GOEA 4GB9A 2KDFB 2CKHB 2N9EB 3S2AA 3UIPB 3PZDA 4NJ7A 3IBEA 3EFUA 4NY0A 5D6JB 5DPTA 2KC1A 4KVGB 2BKFA 2JRHA 1F9JA 4AJWA 2WYQA 2KLGA 2RSUA 3ECIA 2N9PC 5CHFA 4FADA 3SU8X 4AOFA 4CO7A 3DCGA 1J19A 1LQBA 1WGHA 2KFJA 3PPAA 3QK0A 4FJYA 2PJHA 1H4RA 4I6LB 2GBRA 2GBMA 4WJPA 1R4MI 1YIWA 2KMAA 1L7YA 2WX1A 1C3TA 4G0NB 4GDLB 4HWIB 3V60A 2M1MA 3H7PB 3ZTDA 3PGEA 4BKTA 3JSVB 1WMHA 2D07B 4IWQA 2KMCA 3SD5A 3VFKA 4F1SA 3OAWA 3APCA 5HKHA 2FCNA 2CS4A 4DHZB 4G50A 2LD9A 3KW5B 2RR9A 4BOSC 2LJ5A 2NR2A 3AI5A 2IO2B 2ZNVC 5C23A 1K8RB 3NZUA 3PTFC 5DPSA 1Z2MA 4GSWA 4MM3A 3WAPA 2KC2A 2KO3A 2R2OA 4ICVA 1YX6B 3X23A 4W9IA 2A4ZA 1UGMA 1UD7A 2L76A 4GOCA 1GC7A 1QZEA 2KTRA 2BKRB 2LXCA 2I1KA 4W9LA 3QX1A 1P1AA 2KN5A 4KIKB 3TJPA 3AU5A 4NAWB 3ZUNA 2L05A 1WGDA 1LXDA 1E8ZA 4HXDA 2MP2A 2DYMA 2Y5BB 2M8SA 3VH4B 3RUIB 2KQ7A 4JL9A 4ZDVA 4G11A 1WM3A 3JVZX 4DBGA 2KX3A 1E8XA 2DENB 3IG3A 4FLHA 1E7UA 3K9OB 3ENEA 3HIZA 4URKA 2DHZA 4EEWA 3K9PB 3RZWC 3APDA 1V86A 3PV1A 2FCMA 2JT4B 4E3CA 2RD0A 4EZKA 2Z0EB 3NY5A 5FR6A 2IY0B 1EO6A 2IYDB 3ZO5B 4LJOB 1H8CA 1XD3B 1U4AA 3VUXA 5D7GA 4MJSA 1YD8U 1WZ3A 2IO1B 4HDOA 2WX0A 4K1RB 2MCNB 2RGFA 2KVRA 1WMHB 2O2VB 1KM7A 3CSFA 1XT9B 4BKSD 1WX8A 3DVNU 3VXWA 5AZGA 3RYTA 2G45B 1M94A 2V1YA 4XC2A 2IY1B 2C9WB 3APFA 4WJOA 5TR5A 3SDLC 3N30A 2KDIA 3ZDMC 3DPDA 4DDGD 3OLMD 2LUEA 3MHSD 3DBHI 1V5OA 3IFWB 2KK8A 1GG3A 4ASWC 2BWES 4AJYB 3HK0A 3W1YA 2BYFA 4HK2A 2LGYA 2MA9B 2MLBA 4FHKA 4WWNA 4DK5A 2NBVB 4JGHB 4GDLA 4IG7B 3W1SA 2MP2B 3AU4A 1Q0WB 2AL6A 3H7PA 4DHJB 5LXIB 3H7SA 4AUQC 2L7RA 4M8MA 3GZNI 2KQSA 3VUYA 1P0RA 4RM9A 2FAZA 2FCQA 3L08A 3KH0A 3A9JB 1TZ1A 1ZGUB 1SIFA 5AZHA 1LM8B 3WALA 3WIMA 2MQJA 3HM6X 2KANA 4AWJA 3DBSA 1GUAB 1WX7A 2MBQA 4RMAA 4WJNA 4DDID 3BINA 2FUHB 4IWOA 3DDCB 3ZVVA 1YX5B 4CHKA 4GN1A 3A9KB 4HLEA 2NS5A 2C5LC 2J0JA 4JLCA 4MJSB 4WWPA 2C60A 3A1QB 4MDKE 5BO4B 4MGZE 4IUMB 4K7UA 4KIKA 2D2QA 4NQLB 4NAWA 3R66C 2FIFA 4EFOA 1E5WA 4MGIE 4MEMA 2MBHA 5E6NA 4LJPB 1Q5WB 2BPSA 1UBIA 2LRWA 3QJZA 4FHJA 4W9CA 2BF8B 1V5TA 4B6WA 4BBNF 1WM2A 3DVNV 2M0XA 3UQBA 2KWCA 1EUVB 1WXSA 2LVQA 1CMXB 4W9GA 3Q3FA 3AXCA 3A4SC 2KWVB 4LCDE 1GNUA 1WI0A 2NBUA 3OJ4B 1UZXB 3ML8A 1E90A 3U8ZA 3WAMA 2RPQA 2PEAA 3JYUA 2V3SA 1S1QB 3L17A 4MGKE 3PRZA 3VTWA 3ZDTA 2ZZPB 2O2VA 4WWOA 2LZ6A 2CHXA 3PVLA 3EC8A 2ZPYA 3ML9A 4KZ0A 4F7ZA 3VDZA 2DAJA 3P2BA 1JRUA 1J0GA 2LRUA 4DHZE 1YJ1A 2EMTA 3QCAA 4G3XB 4TUUA 5J18A 3O65B 3PSEB 2PE9A 4OVVA 1AARA 3DVGX 3KYCD 1V2YA 4YL8A 4IM2A 3JW0X 4EOYA 5E6OA 5GMVA 5CHWA 1KOTA 4IM0A 3RZFA 2N7EA 1VD2A 2ZCBA 1RLFA 2L0TA 4P7IA 4FA6A
chains in the Genus database with same CATH superfamily
1ESFA 4KSLC 3BYTB 2GOWA 3NHEB 2MBBB 4H2AA 3H9DA 3V3XA 2LWPA 3AEFB 1JWAD 1WX9A 4KGTA 3N32A 2MX2A 2REXA 1G6JA 5CTRC 1IYFA 2GMIC 3M62B 2KOXA 1WYGA 3U2SC 1TJEA 1WXAA 3NS8A 1JWBD 3N1YC 3AEDB 1FPYA 3I9V1 4ZYNA 1MG8A 2BWFA 1UELA 1TYGB 2WXPA 5CX3A 2JX5A 2MWSB 2LI5A 3VQIA 4W9EA 3DWMA 2A5UA 3V61A 2BYEA 1KLVA 1FCLA 1IGCA 5DPRA 3LDZE 4DQOC 4W9JA 2J53A 1C1YB 2KDMA 5J17A 1WGYA 1HE8A 4RGMA 1HTOA 4ARCA 5BYSA 4KDIC 2G1EA 3X0WA 4LLGM 2I2YA 4ZOHC 4IW0A 2JWZA 4P16A 1VCBA 2LMCA 2ZPNA 5G5GA 3CSTA 4BFRA 1YOVB 1M4VA 3R7RA 3VTVA 3QARA 1YN3A 1TIFA 1KH0A 1HQRD 4I6PA 4KKIA 3ZNZB 2DZMA 4EZLA 2WDRB 2X38A 2BYVE 1WXVA 2KT7A 4DXFA 2N4FA 3PT2B 1KLUD 2IDYA 3PREA 3I57A 2C7MB 2WDQB 2FNJB 3ZXVA 1D5ZC 1L6VA 3ZYYX 3T8MA 3M95A 1YQ3B 1WJ4A 4A3OA 2GRIA 2I1JA 5DPWA 2QCZA 2KD0A 5AZFA 2CR5A 4ANVA 2N1VA 4MH8A 4WAFA 1JWSD 3GP7A 1STEA 2WXKA 3L10B 1C9FA 5KHQA 1TZOA 3ALBA 2G4SA 2Z59B 3EGRA 1D5MC 3V6EB 2D10A 5IP4D 2M4NA 4GDKA 4WJQA 4DXGA 3UINB 2VH2A 4K3CA 4QAYA 1R4MB 3ZXRA 1UWXA 2NPTA 3HRDD 2W54A 4XWTA 1V80A 3OG5A 2D3BA 3TEYA 1SXTA 4RF0A 4PS3A 4A6QA 2O6VD 4TV3A 2LGXA 2WXHA 2C7NB 1FRRA 3NVYA 3T3NA 2WU5B 2WXOA 4X57B 2AQ3B 3N9YC 2UYZB 2H89B 1MI0A 2OEDA 1K52A 2OJRA 3P4QB 3Q3OC 4RCOA 2JUOA 2KN4A 1KTKA 3LB8C 3AE9B 2K8HA 1TS3A 1IUEA 4P6VF 2ICIA 3RPFC 2KVZA 2ZVOA 2DX5B 3KVFB 3TL5A 2HE7A 2KXJA 3WA0A 3TSSA 2BBCA 4GMVA 2WXRA 2NCNA 2NPTB 2KTRB 3CMMB 1JROA 2CU1A 1F0ZA 3VR8B 4S17A 4WQOB 2KKCA 1WGRA 3AV8A 5JXVA 1V9JA 3BVZA 1SE4A 5GXGB 1N60A 2K39A 4HPLB 1VLBA 3DBHB 3EECA 4XGAB 5DCNA 4RF1A 4FJZA 2BS2B 4GLSC 2D3GA 3IVFA 1QT9A 4GGQA 3M3JA 5H8YE 2B3AA 3SHQA 3KUZA 3URYA 3PS6A 3GOEA 2KDFB 2N9EB 3PZDA 5D6JB 4KVGB 2PIAA 4AJWA 2RSUA 4RFBA 3ECIA 4C7ZA 2PMVA 3DCGA 2KFJA 1WGHA 2GBMA 4WJPA 3RI7C 1L7YA 4XYCA 3AM9A 1P7EA 3PGEA 4BKTA 4IWQA 2KMCA 2Y5PA 3AB5A 3SD5A 3OAWA 4LNOA 1QOBA 2ONQA 4HROA 4LNNA 3KW5B 2LJ5A 2IO2B 2ZNVC 4P1BC 3PTFC 1AWDA 3R2TA 3Q14C 4ICVA 1C78A 3BWUD 1UD7A 1UGMA 2L76A 4W9LA 1QZEA 2BKRB 2I1KA 1P1AA 3ZUNA 2NTTA 4YSZB 1LXDA 1MHXA 4ZHPA 5I4DA 1YMHE 4DBGA 3RNFC 5EE0A 1ZP0B 3K9OB 3ENEA 4URKA 4IDIA 1NENB 4EEWA 3P4PB 1V86A 3PV1A 4R3DA 1EO6A 2MJEA 1WZ3A 4HEA1 2MCNB 3MFGA 1XT9B 3DVNU 2G45B 1M94A 2INNE 4WJOA 3AEAB 2LEKA 4NJCA 3ZDMC 3DPDA 4DDGD 1V5OA 2BWES 1ET6A 4AJYB 3HK0A 2LGYA 2MLBA 4FHKA 4WWNA 3I5JC 2SEBD 4DK5A 2BB5A 2PKOA 4JGHB 4GDLA 3AU4A 2AL6A 1DGJA 1LO5D 2L7RA 4HKZE 3VUYA 1YN5A 2INCC 5AZHA 1LM8B 3WIMA 2Y3AA 4J3OD 2KANA 4AWJA 3DBSA 1WX7A 1TY2A 2MBQA 1KLGD 3BINA 2FUHB 3DDCB 1YX5B 4GN1A 3A9KB 4HLEA 2NS5A 2C5LC 4JLCA 4BAXA 4MDKE 5BO4B 4KIKA 5FKAC 3BZDB 4NAWA 2WGSA 3MP9A 1WGKA 4MGIE 2W3RA 4MEMA 3GS2A 5E6NA 1D4BA 3ETRA 1HZ5A 4B0MA 1V5TA 2PVOD 3DVNV 4WQMA 3UQBA 2KWCA 1WWTA 3AXCA 4K3BA 2NBUA 5TSSA 1A70A 1NYQA 1S1QB 3GE8C 4L1BA 4MGKE 1NYRA 3MHZA 3ZDTA 2ZZPB 2JXTA 2O2VA 3NRZA 3PVLA 1PYWD 1IGDA 3ML9A 3P2BA 4HPPA 3R8BA 3H8HA 4P1CC 1XLNA 3AH7A 1GOZA 1YJ1A 4TUUA 5EE9A 5J18A 2PE9A 1AARA 4YL8A 2L32A 2E3TA 3UI3A 2N7EA 1VD2A 4DHZB 2QC8A 4FA6A 2KTFA 5BMIA 3VHTC 2BS3B 1P3QU 2R61A 1R4NI 1RWSA 3R7QA 2L00B 4WURA 1J7BA 3DHHC 5HHDG 1JALA 3RCZA 4HCNB 2M56B 1ISNA 4M02A 3PLUA 3MC9A 4EZJA 5G55A 1N63A 2BQQA 1V1OA 2O6VB 2LHEA 2ASQA 2DLBA 3IAS1 1WIAA 1OFFA 3DVGY 3DBRI 2MJDA 4JIOU 2CHWA 4MELA 3Q8AA 2J7QB 4MSQB 2K3UA 2MBOA 3WANA 4NZLB 4FJVB 3L13A 2GB1A 1RYJA 2GI9A 5IA7A 1I4XA 4JWUC 1FNWA 4C56C 4AS1A 2WDVB 4HJGE 1WXQA 4BOZB 2GBKA 4WAAA 4I6NB 2WU2B 1TS4A 1ZUD2 1SE2A 4TQ0A 2N9LA 1WYWB 2Z8LA 4N6EB 1ZOYB 3ZRFA 2K22A 3GB1A 1PUTA 4US9A 2E6XA 2DZJA 1S3SG 2TSSA 2MRPA 2AL3A 1Z5SB 4ICUA 1FEHA 1WJ6A 4PS7A 2AYOB 3TEWA 1UH6A 2MW5A 3DBLI 5JZEB 3CWIA 2WXMA 1UBQA 1WJUA 2AQ2B 3C0RB 4ANUA 3I63C 3FC4A 3B0AA 1WE7A 2AEHA 3TMPB 1EF1A 5D3DA 2WWZA 4KX6B 3SR6A 1C4PA 1EU4A 3P42A 5BYRA 1NI2A 4S0RA 4ANXA 2KFKB 4EKUA 1WZ0A 4B9KA 1DOIA 3RMKC 1XQQA 4NJ6A 1NVID 3TEXA 4PYZA 3L16A 1QKZA 3U4EG 3MTNB 4OZCA 2KHWB 2KJ6A 3FAHA 3DOWA 1OTRB 2MSED 2ZW1A 2LVPA 4MH0E 3QA8A 2VH1A 1D5XC 2ZEQA 2PE6B 5C2TB 1SJED 1RRBA 4HVBA 3TUOA 1GC6A 2QHOA 4XZ4A 2FE8A 3U30A 4LTUA 2ZNVB 2KLCA 3EHVA 3W5UB 3PO0A 1EWYC 5D2MB 1VRAB 2RDBC 1UGJA 3NZSA 4ZRJA 1AN8A 4C7YA 2V0GA 4BKGA 4M00A 3PLVA 2MBEA 2DYBA 3KUCB 1X1MA 3L0WB 2JF5A 4JPSA 3ZLZA 3L54A 3I3TB 5JH5C 5JHBA 4E74A 3A33B 4XX5A 5HG2A 3BK2A 1TKEA 1ZDXA 4N59A 4ZRQA 1FD6A 2J52A 1VZ7A 3IT4B 4PK1A 3QWZB 4YT0B 1OQQA 1ZW7A 2JRIB 1WRDB 1FNVA 2L0FA 1HZ6A 5C1ZA 1EU3A 3IXSA 3U7DA 2K1FA 2FIDA 3RT3B 2YEPB 1LGRA 3NVZA 5LNK1 2M19A 3KWLA 3UGBB 2N9XA 2ZVNA 3AE5B 1SBBB 4LK0M 3S2AA 2KYWA 5IOIA 1F9JA 2QEJC 1E9MA 3HUIA 1EWCA 5CHFA 2LUMA 3SU8X 3ZGZA 2OJWA 4FJYA 2PJHA 4I6LB 2GBRA 4G0NB 2WXFA 1TKYA 1T0RC 3AMZA 1FFVA 3H7PB 4F1SA 4KGRA 1JWUD 2CS4A 2FCNA 4G50A 4BOSC 5C23A 3NZUA 3RNEC 1Z2MA 4MM3A 3X23A 1YX6B 1GC7A 2KTRA 3QX1A 3BVMA 3VH4B 2KQ7A 4OW0A 3P1MA 4YXDB 1TKGA 1WM3A 1E8XA 2DENB 2LHDA 4LNKA 3W5VB 2DHZA 2FCMA 2JT4B 4ZHOA 2RD0A 2IYDB 1U4AA 4MJSA 1YD8U 2CJNA 2IO1B 1Q10A 4LNFA 2WX0A 4K1RB 2D3CA 2KAJA 2RGFA 2KVRA 1KM7A 1R4NB 4BKSD 1WX8A 4RNAA 5AZGA 3RYTA 2IY1B 3SDLC 3APFA 3N30A 2X8XX 4MM3B 2WXJA 1TY0A 3RNBC 3IFWB 3KQ4A 2YEPF 1YN4A 2MA9B 2NBVB 1Q0WB 4OHJA 4AUQC 2QJLA 4M8MA 4US8A 2KQSA 4RM9A 4B0EA 2FAZA 3L08A 3A9JB 1TZ1A 3DBRB 2MQJA 3HM6X 1F52A 5BMGA 2J42A 1K53A 2XNAC 4MJSB 2W82A 2C60A 3A1QB 4MACA 3AE4B 2RDHA 4NQLB 3R66C 1E5WA 2EKIA 2LFIA 1L0XB 1Q5WB 2LRWA 1UBIA 4FHJA 2DBYA 3U7ZA 2EELA 1EUVB 1T3QA 1T6BX 3A4SC 4LCDE 1GNUA 1ET9A 3WAMA 2RPQA 3C19A 3JYUA 1C76A 2N0SB 1GB1A 2IGDA 2L83A 3VTWA 4YSYB 1XLPA 2FBWB 1QILA 1I4HA 3AE2B 2LRUA 1FFUA 4DHZE 2EMTA 3O65B 3PSEB 3KYCD 1V2YA 4IM0A 3DBLB 4WIPA 4P7IA 3B1LX 2KNBA 2L3ZA 1ZXHA 1B1ZA 2JY6A 3QAQA 4N9F4 2YLMA 3VTUA 5T8IA 2PPHA 2K6DB 1D3ZA 1V6EA 4KGSA 2LGIA 2IBIB 4A20A 3A9KA 2BGFA 4TQ1A 3NUHB 2V4LA 4CYEA 1FXAA 1XCTL 1SE3A 4C4VA 3AE7B 1V49A 3Q3JA 4ANWA 1VJKA 4W9DA 2IZVB 4HPMB 2L1AA 3FILB 5AUKA 1K50A 1F1HA 5D94A 2G4DB 5CHVC 3Q2AC 2XEWA 2J0KA 3E56A 3E9SA 3SEBA 1NEKB 2M17A 3ZKJC 5MPOA 4DHJD 2K5PA 1KJTA 1T0QC 1L4ZB 2JXXA 4DDID 4M8NA 2DNFA 2G3QB 2DZKA 1J7AA 1F2RI 4WWMA 4BZAA 4HKQA 3VRAB 1ZXIA 1RAXA 1WFYA 3BK1A 4WH4A 3RD2A 2IPKD 1MJDA 1UF0A 4KV2A 1TT5B 3PRPB 1I4PA 4C4VB 3PZ8A 1I35A 2WHIA 3B2FA 4OVUA 3U52E 2EMSA 3Q3NC 3T9LA 2MH7A 1YQ4B 2W3SA 1WXMA 2WNMA 3CF6E 4IC7B 4FBJB 5AUIA 3QC8B 1RFAA 3ZTCA 3QIJA 2BYTA 4LNIA 2JZZA 5G2NA 3V62A 3VRBB 1TTNA 2MJ3A 4MSMB 1WGGA 1WF9A 1NDDA 2O6VA 1SGHA 1T0YA 1OGWA 2KWUB 1PGBA 1JWMD 1L0YB 2KJHB 2D3AA 1WY8A 2YVCA 2D11A 4YWGG 4II3B 1YQBA 1WR6E 5J2RA 4RGNA 1WJNA 4GU2A 2INPE 4BKSA 2NBWB 2VRRB 3B9JA 3W9CB 2CHZA 2L8JA 3LJ3A 2ZCCA 4KZCA 1GJZA 3HVZA 3IAM1 1NI3A 3ZNGC 4XDDA 4FN2A 4J6IA 2HJ8A 3ZJUA 2FCSA 2AQ1B 3DWGC 3HM3A 4KSKC 3V6CB 4K7WA 3VUWA 2OOBB 4RM8A 5L95C 2KQ4X 2LGDA 1CZPA 5KHOA 1L2NA 2XBBC 4LDTD 1JMLA 1OQYA 2M0AA 4NQKE 2CJOA 3B08A 3IHPC 1ZKHA 2EKEC 3NVVA 1E8WA 1PGAA 2Z0DB 2BS4B 3UF8A 2KJRA 3N1ZC 2BB6A 3MC0B 3N3KB 1PFDA 4PYUA 5HFYA 2RDGA 1WSPA 2LJIA 2KDBA 2DYOA 5L83A 2DZIA 1TS2A 2N7JA 2JWUA 3JSVA 1SJHD 2IO0B 3RULA 1XXGA 2KFKA 1FXTB 3ZNID 1OEYJ 1RFKA 4EUTA 1LFDA 2LASA 4ARIA 1QOGA 2IGGA 1I4RA 3KUDB 2JVCA 3ZJTA 4K81A 1P98A 1VZ8A 4KKJA 2IO3B 4II2B 2OHFA 2AX5A 1BXTA 2QDFA 5LXHA 4GB9A 3UIPB 4NY0A 1E6EB 2K9XA 5DPTA 2BKFA 5C3JB 2KLGA 2HJ1A 3PZ7A 4FADA 3PPAA 1N5WA 1YIWA 2KMAA 5IKCM 4HWIB 2MEKA 3V05A 3JSVB 1WMHA 2D07B 3VFKA 5IO9A 1EM7A 4OVZA 4D2KA 1N62A 2LD9A 3O13A 2RR9A 1C77A 3P4SB 5DPSA 3AE3B 1E10A 1P7FA 4GSWA 4NAMA 2R2OA 1XLOA 5BMHA 4REZA 2A4ZA 4GOCA 2LXCA 4TSSA 5G5HA 3TJPA 2L05A 1SIJA 2BVCA 1E8ZA 2L52A 1B9RA 2DYMA 2M8SA 4G11A 3JVZX 3IG3A 3K9PB 3RZWC 1SEBD 1L4DB 3ABVB 4JWSC 3ZO5B 4LJOB 1WRIA 3VUXA 1D6EC 4AQ7A 1WMHB 2PLPA 3NS1A 5TR5A 3NZ3A 2UU7A 4C80A 2XN9C 2JQRB 1ZPSA 2JYTA 3MHSD 3OLMD 4USAA 4ASWC 1RM6C 1MG4A 3W1YA 2BYFA 1QOAA 4ACFA 4ZYSA 3FKYA 3W1SA 2WXIA 4DHJB 3H7PA 1T0SC 3H7SA 3AEEB 3GZNI 3B2GA 1ZGUB 4OZAA 2SAKA 3WALA 3BYYB 1C79A 1CJEA 1SB3C 4WJNA 3W2DA 2V3NA 3ZVVA 1QF6A 1K51A 4WWPA 1UNSA 4MGZE 1IBXA 3KLSX 2FIFA 4RH6A 4EFOA 1V1PA 5E6JA 2MBHA 1XCQL 1FM0D 4JE3B 1FXIA 4C00A 2BPSA 3MJ5A 4YTMB 3LXFA 4BBNF 2M0XA 1N5XA 4W9GA 1QOFA 2KWVB 1WI0A 3U8ZA 1PGXA 3ML8A 1E90A 2Q5WD 1ACCA 1HXYD 2V3SA 3L17A 3Q6BA 3PRZA 3EUB2 4A55A 2DWQA 2KMMA 4WWOA 2JYEA 3EC8A 2JSVX 4F7ZA 3VDZA 1ZE3D 2DAJA 1JRUA 1J0GA 3R2IA 1V97A 4OVVA 3DVGX 4EOYA 2HTME 2QIEB 5E6OA 5GMVA 2WP9B 1KOTA 2D5GA 1IBXB 4JX1C 1RLFA 2L0TA 4PT5A 1V1PB 4AP4C 4HDQA 2K8BA 2R2QA 4NPNA 3ZJVA 4ZRPA 2UWQA 4GXBA 3A9JA 2K6QA 1AYFA 1Y8RC 3AULA 4DXAB 2WXQA 3QHTA 4DWFA 2HD5B 4PS8A 3P63A 1SE9A 3A4RA 3A1QA 1PQSA 2WDTB 1BMLC 3BY4B 4IKGA 1TGZB 1L0VB 1CK1A 1FNUA 3TEZA 4W9FA 3ZIMA 1TS5A 2JZ3B 1MVKA 5HI1A 2VZKD 2I38A 1HEZE 2WS3B 3RFZB 4FULA 1JW9D 1IP9A 1FIQA 4LDTB 2IGHA 5E6PA 5AEKB 3N20C 1FRDA 1WR1A 4JQWC 2HDEA 1E7PB 2W9NA 3ZRCA 4W9HA 3WAOA 3UQAA 1BUIC 2KWDA 4GDKB 3ZNHB 5FR3A 1I42A 1MHHE 3TBLD 2J0MA 4XE0A 1ZDVA 5IAAC 2N7DA 1V8CA 4W9KA 1L5PA 3VR9B 1WH3A 4A9AA 1I4QA 2ON8A 3AE1B 2AWTA 4BBNC 4A8XC 4HRSA 3DHGC 2LGSA 1IPGA 1JCKB 2GLSA 3MJWA 3VAWA 2NVUI 1C4CA 1ROEA 2LVOA 4RGTA 1J7CA 1NBFC 2PW9A 2N9KA 2BTEA 2XK5A 4YTNB 4F8CB 2K25A 1N6ZA 3H1UA 3ONSA 2RMMA 3FILA 1T5XD 2QSDA 4HJKA 2GBJA 4GIVA 4M0WA 5LLIA 3NOBA 3H6NA 1KFYB 3VH3B 3EA6A 2RPVA 1QLBB 2GBNA 1HTQA 1XO3A 3Q8EA 4ZRKA 1JRPA 4HCPB 2K0PA 2ZW0A 3LYYA 1TBEA 3Q3MC 4CQNA 1P9DU 1EF5A 4MGYE 4ZRIA 4EE2A 2ACZB 3PHWB 4A90A 3BIID 4FXCA 4M01A 1KF6B 3AE6B 1OEYA 3HVDA 1Q1OA 3RNAC 2N1WA 1XEEA 2XK5B 3OJ3A 4K7SA 1YNTE 3AN1A 4B95A 3QQ8B 1VDVA 3TIXA 3Q8FA 2H88B 1CQVA 2WXNA 4XDCA 4E71A 4M0WB 3D32A 2JPHA 1JQ4A 1VZ6A 2BT6A 2KX0A 4L2YA 5IN7A 3RN9C 1YJIA 2ZJDA 1V81A 2QMTA 2C7HA 2W55A 3KWVA 1FCCC 1A5RA 4IOIE 3PRMB 2DAFA 1L6UA 1F2RC 4RGOS 2HTHA 3L4PA 3M63B 2KDEB 2V4IB 1MPEA 2KZRA 3ZQ4A 1YJJA 5JHAA 4A3PA 3VVWB 3IT6B 1E7VA 2WXLA 3RNGC 3NG0A 4NNJB 3HHMA 1GAQB 4IWPA 3UIOB 3DQVA 4Q2JA 3W1SC 1I7HA 4XWWA 3TCAA 3OWEB 1OQRA 2K8CA 4IM3A 4KDLB 5EDSA 3BVGA 4TKNA 1MFWA 4BVUC 2PVGC 1WE6A 1J8CA 3R3MA 3SFDB 1E8YA 5EE1A 2LXAA 5EE3A 4YSXB 4OZBA 1VR9A 1BT0A 3GZNB 1QQRA 1C4AA 1F77A 3PHXB 1XF5L 3KYDD 3ZW3A 2CKHB 1SSNA 4NJ7A 3IBEA 3EFUA 2KC1A 3AECB 2JRHA 2WYQA 3AEGB 2IJ0A 2WXGA 2N9PC 3NJTA 4AOFA 4CO7A 2NMQA 1J19A 1LQBA 3QK0A 1H4RA 1R7SA 3SFEB 1R4MI 2QILA 2WX1A 1C3TA 4GDLB 3V60A 3DHIC 2M1MA 3ZTDA 4N58A 3APCA 5HKHA 5D3IB 2KACA 2NR2A 3AI5A 1K8RB 1UUPA 3AEBB 1GB4A 3Q8CA 3WAPA 2G9HD 2KC2A 2KO3A 4UDUC 4W9IA 1AW7A 2KN5A 4KIKB 1DYQA 3AU5A 4NAWB 4YTPB 2INDC 2JZPA 1WGDA 1HA5A 3C8YA 3NVWA 4HXDA 2MP2A 2Y5BB 1ENFA 2FUG1 3RUIB 4JL9A 4ZDVA 2KX3A 4FLHA 1E7UA 3HIZA 3APDA 1FO4A 4E3CA 2B76B 3RNCC 4EZKA 2Z0EB 3NY5A 5FR6A 2IY0B 2Y5CA 1UWMA 1H8CA 1XD3B 2JU6X 5D7GA 5H92C 4HDOA 3P4RB 2O2VB 2NTSA 3CSFA 3VXWA 1PDXA 2V1YA 3Q69A 4XC2A 2C9WB 2KDIA 2LUEA 3DBHI 2KK8A 2VZKB 1GG3A 3Q8BA 4HK2A 1XLQA 2CU3A 4L23A 4IG7B 2MP2B 1SF0A 5LXIB 1DOXA 2MHJA 3EFCA 1P0RA 2V3PA 1FMAD 2FCQA 3KH0A 3T3OA 1SIFA 1KRHA 1GUAB 2PTLA 4RMAA 3N1XC 4IWOA 4CHKA 2BW2A 2J0JA 4IUMB 4K7UA 2D2QA 1I4GA 4O1NA 1DOYA 4LJPB 2WLBA 4W9CA 3QJZA 2BF8B 4B6WA 3WCQA 1WM2A 3CIRB 1WXSA 2LVQA 1CMXB 3Q3FA 2WQYB 3OJ4B 1UZXB 2PEAA 1E0ZA 3MC8A 4ITKA 2LZ6A 2CHXA 4TMAB 2ZPYA 5FK9C 4KZ0A 1Y56A 1GPXA 3AE8B 3J9CA 2V9HA 3QCAA 4G3XB 2J4XA 3GE3C 4IM2A 3JW0X 5CHWA 5BYQA 3RZFA 2ZCBA 1N61A 4MT5A
chains in the Genus database with same CATH topology
2KTFA 3B1LX 4KSLC 2GOWA 2KNBA 2L3ZA 4AP4C 3NHEB 2MBBB 3VHTC 3H9DA 4HDQA 2K8BA 1P3QU 2JY6A 2LWPA 2R2QA 4NPNA 1R4NI 3QAQA 4N9F4 2YLMA 2UWQA 1WX9A 3R7QA 3N32A 2L00B 2MX2A 4GXBA 3VTUA 2PPHA 2K6DB 2REXA 3A9JA 1D3ZA 1G6JA 5CTRC 2K6QA 1IYFA 2GMIC 1V6EA 1Y8RC 3RCZA 3AULA 3M62B 4HCNB 2KOXA 4DXAB 3QHTA 4DWFA 2HD5B 4PS8A 2IBIB 1ISNA 1WXAA 4A20A 3A9KA 2BGFA 4TQ1A 1SE9A 3A4RA 2V4LA 3A1QA 3NS8A 3PLUA 4CYEA 4EZJA 1PQSA 1V49A 2WDTB 3Q3JA 4ANWA 3BY4B 4W9DA 1TGZB 5G55A 4ZYNA 1MG8A 2BWFA 1UELA 2IZVB 4HPMB 5CX3A 2O6VB 4W9FA 3ZIMA 2JZ3B 2MWSB 5D94A 2LI5A 2G4DB 3VQIA 5CHVC 4W9EA 2XEWA 2J0KA 4FULA 2A5UA 1IP9A 2ASQA 2BYEA 3V61A 1KLVA 1WIAA 5DPRA 3DVGY 3DBRI 3LDZE 4LDTB 4W9JA 1C1YB 5J17A 3ZKJC 2M17A 1WGYA 5E6PA 1HE8A 4JIOU 2CHWA 4DHJD 5AEKB 1KJTA 4MELA 1WR1A 2J7QB 4JQWC 4MSQB 2JXXA 2MBOA 2W9NA 4KDIC 4M8NA 4W9HA 3WANA 3X0WA 3ZRCA 3WAOA 4FJVB 2G3QB 3UQAA 3ZNHB 3L13A 4GDKB 4IW0A 2DZKA 1I42A 2JWZA 5IA7A 1RAXA 1WFYA 3TBLD 1VCBA 2J0MA 5IAAC 2N7DA 4W9KA 3RD2A 2ZPNA 4KV2A 1WH3A 3PRPB 3CSTA 4BOZB 2GBKA 4BFRA 4WAAA 4I6NB 1I35A 2AWTA 3R7RA 3VTVA 3QARA 4BBNC 4TQ0A 4OVUA 1WYWB 2EMSA 4I6PA 1IPGA 3T9LA 3ZNZB 2DZMA 4EZLA 2BYVE 1WXVA 3ZRFA 2N4FA 3PT2B 3MJWA 1WXMA 2NVUI 3VAWA 3CF6E 4IC7B 2LVOA 2DZJA 4FBJB 3PREA 1S3SG 3QC8B 2C7MB 2MRPA 2FNJB 1RFAA 1Z5SB 2AL3A 1WJ6A 4ICUA 4PS7A 3ZTCA 1NBFC 3QIJA 2AYOB 2XK5A 3T8MA 2JZZA 1UH6A 5G2NA 3V62A 2MW5A 3M95A 1WJ4A 4F8CB 4A3OA 5DPWA 2I1JA 3DBLI 2K25A 1TTNA 2KD0A 4MSMB 2CR5A 1WGGA 5AZFA 4ANVA 5JZEB 3H1UA 2N1VA 3ONSA 1UBQA 1WJUA 1WF9A 3C0RB 4ANUA 1NDDA 2O6VA 4HJKA 1SGHA 3B0AA 1T0YA 1WE7A 2AEHA 1OGWA 2GBJA 4GIVA 5LLIA 3TMPB 1EF1A 3NOBA 2KWUB 3H6NA 3VH3B 2KJHB 2WWZA 1WY8A 2GBNA 3L10B 2YVCA 5KHQA 2D11A 4II3B 3ALBA 4ZRKA 1YQBA 1NI2A 1WR6E 4ANXA 2G4SA 2Z59B 2KFKB 4EKUA 5J2RA 1WZ0A 4HCPB 3V6EB 1WJNA 4B9KA 2D10A 4GU2A 1XQQA 4BKSA 2M4NA 4NJ6A 1TBEA 2NBWB 4GDKA 4WJQA 1P9DU 2VRRB 1EF5A 3UINB 4PYZA 3L16A 4MGYE 4ZRIA 2CHZA 2L8JA 3LJ3A 3PHWB 2ZCCA 3MTNB 2NPTA 4KZCA 2KHWB 1GJZA 2KJ6A 1OEYA 3DOWA 1OTRB 1V80A 2MSED 3ZNGC 1Q1OA 4FN2A 2LVPA 2N1WA 4J6IA 4MH0E 3QA8A 2HJ8A 2XK5B 2ZEQA 2FCSA 2PE6B 3OJ3A 4PS3A 1RRBA 4HVBA 1GC6A 4K7SA 2O6VD 2QHOA 4TV3A 4XZ4A 4B95A 2LGXA 3HM3A 2C7NB 3QQ8B 3U30A 3TIXA 4KSKC 3V6CB 4K7WA 3VUWA 2OOBB 4RM8A 5L95C 2LGDA 4E71A 4M0WB 4X57B 2ZNVB 3D32A 2JPHA 2KLCA 2UYZB 5KHOA 2KX0A 2XBBC 4LDTD 3EHVA 1L2NA 1OQYA 4NQKE 2OJRA 5D2MB 2ZJDA 1V81A 2C7HA 2JUOA 3B08A 3IHPC 1A5RA 1ZKHA 3NZSA 2K8HA 2EKEC 3PRMB 1E8WA 4ZRJA 2DAFA 4BKGA 2HTHA 2Z0DB 2ZVOA 3PLVA 2DX5B 2MBEA 2DYBA 3KVFB 3TL5A 2HE7A 2KXJA 3KUCB 3M63B 3WA0A 3UF8A 2KDEB 2KJRA 1X1MA 3L0WB 2KZRA 2JF5A 4GMVA 3N3KB 4PYUA 5JHAA 3ZLZA 2NCNA 3L54A 4A3PA 2NPTB 3I3TB 3VVWB 5JH5C 5JHBA 2KTRB 1E7VA 4E74A 3CMMB 2CU1A 3A33B 4NNJB 3HHMA 4IWPA 4XX5A 3UIOB 2KDBA 2DYOA 4WQOB 2KKCA 2DZIA 3DQVA 5L83A 1WGRA 3W1SC 3TCAA 1V9JA 3QWZB 3JSVA 1ZW7A 2IO0B 3RULA 2JRIB 1WRDB 2KFKA 2L0FA 1FXTB 3ZNID 2K39A 1OEYJ 2K8CA 4HPLB 4EUTA 1LFDA 4IM3A 5C1ZA 3EECA 4KDLB 5EDSA 2LASA 4TKNA 3U7DA 4BVUC 2K1FA 2FIDA 5DCNA 3RT3B 4FJZA 1WE6A 1J8CA 3R3MA 2D3GA 3KUDB 1E8YA 2JVCA 3IVFA 2LXAA 4GGQA 4K81A 3M3JA 1P98A 2B3AA 1BT0A 3SHQA 3UGBB 3KUZA 2IO3B 2N9XA 2ZVNA 3PHXB 4II2B 3PS6A 5LXHA 3KYDD 3ZW3A 3GOEA 4GB9A 2KDFB 2CKHB 2N9EB 3S2AA 3UIPB 3PZDA 4NJ7A 3IBEA 3EFUA 4NY0A 5D6JB 5DPTA 2KC1A 4KVGB 2BKFA 2JRHA 1F9JA 4AJWA 2WYQA 2KLGA 2RSUA 3ECIA 2N9PC 5CHFA 4FADA 3SU8X 4AOFA 4CO7A 3DCGA 1J19A 1LQBA 1WGHA 2KFJA 3PPAA 3QK0A 4FJYA 2PJHA 1H4RA 4I6LB 2GBRA 2GBMA 4WJPA 1R4MI 1YIWA 2KMAA 1L7YA 2WX1A 1C3TA 4G0NB 4GDLB 4HWIB 3V60A 2M1MA 3H7PB 3ZTDA 3PGEA 4BKTA 3JSVB 1WMHA 2D07B 4IWQA 2KMCA 3SD5A 3VFKA 4F1SA 3OAWA 3APCA 5HKHA 2FCNA 2CS4A 4DHZB 4G50A 2LD9A 3KW5B 2RR9A 4BOSC 2LJ5A 2NR2A 3AI5A 2IO2B 2ZNVC 5C23A 1K8RB 3NZUA 3PTFC 5DPSA 1Z2MA 4GSWA 4MM3A 3WAPA 2KC2A 2KO3A 2R2OA 4ICVA 1YX6B 3X23A 4W9IA 2A4ZA 1UGMA 1UD7A 2L76A 4GOCA 1GC7A 1QZEA 2KTRA 2BKRB 2LXCA 2I1KA 4W9LA 3QX1A 1P1AA 2KN5A 4KIKB 3TJPA 3AU5A 4NAWB 3ZUNA 2L05A 1WGDA 1LXDA 1E8ZA 4HXDA 2MP2A 2DYMA 2Y5BB 2M8SA 3VH4B 3RUIB 2KQ7A 4JL9A 4ZDVA 4G11A 1WM3A 3JVZX 4DBGA 2KX3A 1E8XA 2DENB 3IG3A 4FLHA 1E7UA 3K9OB 3ENEA 3HIZA 4URKA 2DHZA 4EEWA 3K9PB 3RZWC 3APDA 1V86A 3PV1A 2FCMA 2JT4B 4E3CA 2RD0A 4EZKA 2Z0EB 3NY5A 5FR6A 2IY0B 1EO6A 2IYDB 3ZO5B 4LJOB 1H8CA 1XD3B 1U4AA 3VUXA 5D7GA 4MJSA 1YD8U 1WZ3A 2IO1B 4HDOA 2WX0A 4K1RB 2MCNB 2RGFA 2KVRA 1WMHB 2O2VB 1KM7A 3CSFA 1XT9B 4BKSD 1WX8A 3DVNU 3VXWA 5AZGA 3RYTA 2G45B 1M94A 2V1YA 4XC2A 2IY1B 2C9WB 3APFA 4WJOA 5TR5A 3SDLC 3N30A 2KDIA 3ZDMC 3DPDA 4DDGD 3OLMD 2LUEA 3MHSD 3DBHI 1V5OA 3IFWB 2KK8A 1GG3A 4ASWC 2BWES 4AJYB 3HK0A 3W1YA 2BYFA 4HK2A 2LGYA 2MA9B 2MLBA 4FHKA 4WWNA 4DK5A 2NBVB 4JGHB 4GDLA 4IG7B 3W1SA 2MP2B 3AU4A 1Q0WB 2AL6A 3H7PA 4DHJB 5LXIB 3H7SA 4AUQC 2L7RA 4M8MA 3GZNI 2KQSA 3VUYA 1P0RA 4RM9A 2FAZA 2FCQA 3L08A 3KH0A 3A9JB 1TZ1A 1ZGUB 1SIFA 5AZHA 1LM8B 3WALA 3WIMA 2MQJA 3HM6X 2KANA 4AWJA 3DBSA 1GUAB 1WX7A 2MBQA 4RMAA 4WJNA 4DDID 3BINA 2FUHB 4IWOA 3DDCB 3ZVVA 1YX5B 4CHKA 4GN1A 3A9KB 4HLEA 2NS5A 2C5LC 2J0JA 4JLCA 4MJSB 4WWPA 2C60A 3A1QB 4MDKE 5BO4B 4MGZE 4IUMB 4K7UA 4KIKA 2D2QA 4NQLB 4NAWA 3R66C 2FIFA 4EFOA 1E5WA 4MGIE 4MEMA 2MBHA 5E6NA 4LJPB 1Q5WB 2BPSA 1UBIA 2LRWA 3QJZA 4FHJA 4W9CA 2BF8B 1V5TA 4B6WA 4BBNF 1WM2A 3DVNV 2M0XA 3UQBA 2KWCA 1EUVB 1WXSA 2LVQA 1CMXB 4W9GA 3Q3FA 3AXCA 3A4SC 2KWVB 4LCDE 1GNUA 1WI0A 2NBUA 3OJ4B 1UZXB 3ML8A 1E90A 3U8ZA 3WAMA 2RPQA 2PEAA 3JYUA 2V3SA 1S1QB 3L17A 4MGKE 3PRZA 3VTWA 3ZDTA 2ZZPB 2O2VA 4WWOA 2LZ6A 2CHXA 3PVLA 3EC8A 2ZPYA 3ML9A 4KZ0A 4F7ZA 3VDZA 2DAJA 3P2BA 1JRUA 1J0GA 2LRUA 4DHZE 1YJ1A 2EMTA 3QCAA 4G3XB 4TUUA 5J18A 3O65B 3PSEB 2PE9A 4OVVA 1AARA 3DVGX 3KYCD 1V2YA 4YL8A 4IM2A 3JW0X 4EOYA 5E6OA 5GMVA 5CHWA 1KOTA 4IM0A 3RZFA 2N7EA 1VD2A 2ZCBA 1RLFA 2L0TA 4P7IA 4FA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KTF A;  3B1L X;  4KSL C;  2GOW A;  2KNB A;  2L3Z A;  4AP4 C;  3NHE B;  2MBB B;  3VHT C;  3H9D A;  4HDQ A;  2K8B A;  1P3Q U;  2JY6 A;  2LWP A;  2R2Q A;  4NPN A;  1R4N I;  3QAQ A;  4N9F 4;  2YLM A;  2UWQ A;  1WX9 A;  3R7Q A;  3N32 A;  2L00 B;  2MX2 A;  4GXB A;  3VTU A;  2PPH A;  2K6D B;  2REX A;  3A9J A;  1D3Z A;  1G6J A;  5CTR C;  2K6Q A;  1IYF A;  2GMI C;  1V6E A;  1Y8R C;  3RCZ A;  3AUL A;  3M62 B;  4HCN B;  2KOX A;  4DXA B;  3QHT A;  4DWF A;  2HD5 B;  4PS8 A;  2IBI B;  1ISN A;  1WXA A;  4A20 A;  3A9K A;  2BGF A;  4TQ1 A;  1SE9 A;  3A4R A;  2V4L A;  3A1Q A;  3NS8 A;  3PLU A;  4CYE A;  4EZJ A;  1PQS A;  1V49 A;  2WDT B;  3Q3J A;  4ANW A;  3BY4 B;  4W9D A;  1TGZ B;  5G55 A;  4ZYN A;  1MG8 A;  2BWF A;  1UEL A;  2IZV B;  4HPM B;  5CX3 A;  2O6V B;  4W9F A;  3ZIM A;  2JZ3 B;  2MWS B;  5D94 A;  2LI5 A;  2G4D B;  3VQI A;  5CHV C;  4W9E A;  2XEW A;  2J0K A;  4FUL A;  2A5U A;  1IP9 A;  2ASQ A;  2BYE A;  3V61 A;  1KLV A;  1WIA A;  5DPR A;  3DVG Y;  3DBR I;  3LDZ E;  4LDT B;  4W9J A;  1C1Y B;  5J17 A;  3ZKJ C;  2M17 A;  1WGY A;  5E6P A;  1HE8 A;  4JIO U;  2CHW A;  4DHJ D;  5AEK B;  1KJT A;  4MEL A;  1WR1 A;  2J7Q B;  4JQW C;  4MSQ B;  2JXX A;  2MBO A;  2W9N A;  4KDI C;  4M8N A;  4W9H A;  3WAN A;  3X0W A;  3ZRC A;  3WAO A;  4FJV B;  2G3Q B;  3UQA A;  3ZNH B;  3L13 A;  4GDK B;  4IW0 A;  2DZK A;  1I42 A;  2JWZ A;  5IA7 A;  1RAX A;  1WFY A;  3TBL D;  1VCB A;  2J0M A;  5IAA C;  2N7D A;  4W9K A;  3RD2 A;  2ZPN A;  4KV2 A;  1WH3 A;  3PRP B;  3CST A;  4BOZ B;  2GBK A;  4BFR A;  4WAA A;  4I6N B;  1I35 A;  2AWT A;  3R7R A;  3VTV A;  3QAR A;  4BBN C;  4TQ0 A;  4OVU A;  1WYW B;  2EMS A;  4I6P A;  1IPG A;  3T9L A;  3ZNZ B;  2DZM A;  4EZL A;  2BYV E;  1WXV A;  3ZRF A;  2N4F A;  3PT2 B;  3MJW A;  1WXM A;  2NVU I;  3VAW A;  3CF6 E;  4IC7 B;  2LVO A;  2DZJ A;  4FBJ B;  3PRE A;  1S3S G;  3QC8 B;  2C7M B;  2MRP A;  2FNJ B;  1RFA A;  1Z5S B;  2AL3 A;  1WJ6 A;  4ICU A;  4PS7 A;  3ZTC A;  1NBF C;  3QIJ A;  2AYO B;  2XK5 A;  3T8M A;  2JZZ A;  1UH6 A;  5G2N A;  3V62 A;  2MW5 A;  3M95 A;  1WJ4 A;  4F8C B;  4A3O A;  5DPW A;  2I1J A;  3DBL I;  2K25 A;  1TTN A;  2KD0 A;  4MSM B;  2CR5 A;  1WGG A;  5AZF A;  4ANV A;  5JZE B;  3H1U A;  2N1V A;  3ONS A;  1UBQ A;  1WJU A;  1WF9 A;  3C0R B;  4ANU A;  1NDD A;  2O6V A;  4HJK A;  1SGH A;  3B0A A;  1T0Y A;  1WE7 A;  2AEH A;  1OGW A;  2GBJ A;  4GIV A;  5LLI A;  3TMP B;  1EF1 A;  3NOB A;  2KWU B;  3H6N A;  3VH3 B;  2KJH B;  2WWZ A;  1WY8 A;  2GBN A;  3L10 B;  2YVC A;  5KHQ A;  2D11 A;  4II3 B;  3ALB A;  4ZRK A;  1YQB A;  1NI2 A;  1WR6 E;  4ANX A;  2G4S A;  2Z59 B;  2KFK B;  4EKU A;  5J2R A;  1WZ0 A;  4HCP B;  3V6E B;  1WJN A;  4B9K A;  2D10 A;  4GU2 A;  1XQQ A;  4BKS A;  2M4N A;  4NJ6 A;  1TBE A;  2NBW B;  4GDK A;  4WJQ A;  1P9D U;  2VRR B;  1EF5 A;  3UIN B;  4PYZ A;  3L16 A;  4MGY E;  4ZRI A;  2CHZ A;  2L8J A;  3LJ3 A;  3PHW B;  2ZCC A;  3MTN B;  2NPT A;  4KZC A;  2KHW B;  1GJZ A;  2KJ6 A;  1OEY A;  3DOW A;  1OTR B;  1V80 A;  2MSE D;  3ZNG C;  1Q1O A;  4FN2 A;  2LVP A;  2N1W A;  4J6I A;  4MH0 E;  3QA8 A;  2HJ8 A;  2XK5 B;  2ZEQ A;  2FCS A;  2PE6 B;  3OJ3 A;  4PS3 A;  1RRB A;  4HVB A;  1GC6 A;  4K7S A;  2O6V D;  2QHO A;  4TV3 A;  4XZ4 A;  4B95 A;  2LGX A;  3HM3 A;  2C7N B;  3QQ8 B;  3U30 A;  3TIX A;  4KSK C;  3V6C B;  4K7W A;  3VUW A;  2OOB B;  4RM8 A;  5L95 C;  2LGD A;  4E71 A;  4M0W B;  4X57 B;  2ZNV B;  3D32 A;  2JPH A;  2KLC A;  2UYZ B;  5KHO A;  2KX0 A;  2XBB C;  4LDT D;  3EHV A;  1L2N A;  1OQY A;  4NQK E;  2OJR A;  5D2M B;  2ZJD A;  1V81 A;  2C7H A;  2JUO A;  3B08 A;  3IHP C;  1A5R A;  1ZKH A;  3NZS A;  2K8H A;  2EKE C;  3PRM B;  1E8W A;  4ZRJ A;  2DAF A;  4BKG A;  2HTH A;  2Z0D B;  2ZVO A;  3PLV A;  2DX5 B;  2MBE A;  2DYB A;  3KVF B;  3TL5 A;  2HE7 A;  2KXJ A;  3KUC B;  3M63 B;  3WA0 A;  3UF8 A;  2KDE B;  2KJR A;  1X1M A;  3L0W B;  2KZR A;  2JF5 A;  4GMV A;  3N3K B;  4PYU A;  5JHA A;  3ZLZ A;  2NCN A;  3L54 A;  4A3P A;  2NPT B;  3I3T B;  3VVW B;  5JH5 C;  5JHB A;  2KTR B;  1E7V A;  4E74 A;  3CMM B;  2CU1 A;  3A33 B;  4NNJ B;  3HHM A;  4IWP A;  4XX5 A;  3UIO B;  2KDB A;  2DYO A;  4WQO B;  2KKC A;  2DZI A;  3DQV A;  5L83 A;  1WGR A;  3W1S C;  3TCA A;  1V9J A;  3QWZ B;  3JSV A;  1ZW7 A;  2IO0 B;  3RUL A;  2JRI B;  1WRD B;  2KFK A;  2L0F A;  1FXT B;  3ZNI D;  2K39 A;  1OEY J;  2K8C A;  4HPL B;  4EUT A;  1LFD A;  4IM3 A;  5C1Z A;  3EEC A;  4KDL B;  5EDS A;  2LAS A;  4TKN A;  3U7D A;  4BVU C;  2K1F A;  2FID A;  5DCN A;  3RT3 B;  4FJZ A;  1WE6 A;  1J8C A;  3R3M A;  2D3G A;  3KUD B;  1E8Y A;  2JVC A;  3IVF A;  2LXA A;  4GGQ A;  4K81 A;  3M3J A;  1P98 A;  2B3A A;  1BT0 A;  3SHQ A;  3UGB B;  3KUZ A;  2IO3 B;  2N9X A;  2ZVN A;  3PHX B;  4II2 B;  3PS6 A;  5LXH A;  3KYD D;  3ZW3 A;  3GOE A;  4GB9 A;  2KDF B;  2CKH B;  2N9E B;  3S2A A;  3UIP B;  3PZD A;  4NJ7 A;  3IBE A;  3EFU A;  4NY0 A;  5D6J B;  5DPT A;  2KC1 A;  4KVG B;  2BKF A;  2JRH A;  1F9J A;  4AJW A;  2WYQ A;  2KLG A;  2RSU A;  3ECI A;  2N9P C;  5CHF A;  4FAD A;  3SU8 X;  4AOF A;  4CO7 A;  3DCG A;  1J19 A;  1LQB A;  1WGH A;  2KFJ A;  3PPA A;  3QK0 A;  4FJY A;  2PJH A;  1H4R A;  4I6L B;  2GBR A;  2GBM A;  4WJP A;  1R4M I;  1YIW A;  2KMA A;  1L7Y A;  2WX1 A;  1C3T A;  4G0N B;  4GDL B;  4HWI B;  3V60 A;  2M1M A;  3H7P B;  3ZTD A;  3PGE A;  4BKT A;  3JSV B;  1WMH A;  2D07 B;  4IWQ A;  2KMC A;  3SD5 A;  3VFK A;  4F1S A;  3OAW A;  3APC A;  5HKH A;  2FCN A;  2CS4 A;  4DHZ B;  4G50 A;  2LD9 A;  3KW5 B;  2RR9 A;  4BOS C;  2LJ5 A;  2NR2 A;  3AI5 A;  2IO2 B;  2ZNV C;  5C23 A;  1K8R B;  3NZU A;  3PTF C;  5DPS A;  1Z2M A;  4GSW A;  4MM3 A;  3WAP A;  2KC2 A;  2KO3 A;  2R2O A;  4ICV A;  1YX6 B;  3X23 A;  4W9I A;  2A4Z A;  1UGM A;  1UD7 A;  2L76 A;  4GOC A;  1GC7 A;  1QZE A;  2KTR A;  2BKR B;  2LXC A;  2I1K A;  4W9L A;  3QX1 A;  1P1A A;  2KN5 A;  4KIK B;  3TJP A;  3AU5 A;  4NAW B;  3ZUN A;  2L05 A;  1WGD A;  1LXD A;  1E8Z A;  4HXD A;  2MP2 A;  2DYM A;  2Y5B B;  2M8S A;  3VH4 B;  3RUI B;  2KQ7 A;  4JL9 A;  4ZDV A;  4G11 A;  1WM3 A;  3JVZ X;  4DBG A;  2KX3 A;  1E8X A;  2DEN B;  3IG3 A;  4FLH A;  1E7U A;  3K9O B;  3ENE A;  3HIZ A;  4URK A;  2DHZ A;  4EEW A;  3K9P B;  3RZW C;  3APD A;  1V86 A;  3PV1 A;  2FCM A;  2JT4 B;  4E3C A;  2RD0 A;  4EZK A;  2Z0E B;  3NY5 A;  5FR6 A;  2IY0 B;  1EO6 A;  2IYD B;  3ZO5 B;  4LJO B;  1H8C A;  1XD3 B;  1U4A A;  3VUX A;  5D7G A;  4MJS A;  1YD8 U;  1WZ3 A;  2IO1 B;  4HDO A;  2WX0 A;  4K1R B;  2MCN B;  2RGF A;  2KVR A;  1WMH B;  2O2V B;  1KM7 A;  3CSF A;  1XT9 B;  4BKS D;  1WX8 A;  3DVN U;  3VXW A;  5AZG A;  3RYT A;  2G45 B;  1M94 A;  2V1Y A;  4XC2 A;  2IY1 B;  2C9W B;  3APF A;  4WJO A;  5TR5 A;  3SDL C;  3N30 A;  2KDI A;  3ZDM C;  3DPD A;  4DDG D;  3OLM D;  2LUE A;  3MHS D;  3DBH I;  1V5O A;  3IFW B;  2KK8 A;  1GG3 A;  4ASW C;  2BWE S;  4AJY B;  3HK0 A;  3W1Y A;  2BYF A;  4HK2 A;  2LGY A;  2MA9 B;  2MLB A;  4FHK A;  4WWN A;  4DK5 A;  2NBV B;  4JGH B;  4GDL A;  4IG7 B;  3W1S A;  2MP2 B;  3AU4 A;  1Q0W B;  2AL6 A;  3H7P A;  4DHJ B;  5LXI B;  3H7S A;  4AUQ C;  2L7R A;  4M8M A;  3GZN I;  2KQS A;  3VUY A;  1P0R A;  4RM9 A;  2FAZ A;  2FCQ A;  3L08 A;  3KH0 A;  3A9J B;  1TZ1 A;  1ZGU B;  1SIF A;  5AZH A;  1LM8 B;  3WAL A;  3WIM A;  2MQJ A;  3HM6 X;  2KAN A;  4AWJ A;  3DBS A;  1GUA B;  1WX7 A;  2MBQ A;  4RMA A;  4WJN A;  4DDI D;  3BIN A;  2FUH B;  4IWO A;  3DDC B;  3ZVV A;  1YX5 B;  4CHK A;  4GN1 A;  3A9K B;  4HLE A;  2NS5 A;  2C5L C;  2J0J A;  4JLC A;  4MJS B;  4WWP A;  2C60 A;  3A1Q B;  4MDK E;  5BO4 B;  4MGZ E;  4IUM B;  4K7U A;  4KIK A;  2D2Q A;  4NQL B;  4NAW A;  3R66 C;  2FIF A;  4EFO A;  1E5W A;  4MGI E;  4MEM A;  2MBH A;  5E6N A;  4LJP B;  1Q5W B;  2BPS A;  1UBI A;  2LRW A;  3QJZ A;  4FHJ A;  4W9C A;  2BF8 B;  1V5T A;  4B6W A;  4BBN F;  1WM2 A;  3DVN V;  2M0X A;  3UQB A;  2KWC A;  1EUV B;  1WXS A;  2LVQ A;  1CMX B;  4W9G A;  3Q3F A;  3AXC A;  3A4S C;  2KWV B;  4LCD E;  1GNU A;  1WI0 A;  2NBU A;  3OJ4 B;  1UZX B;  3ML8 A;  1E90 A;  3U8Z A;  3WAM A;  2RPQ A;  2PEA A;  3JYU A;  2V3S A;  1S1Q B;  3L17 A;  4MGK E;  3PRZ A;  3VTW A;  3ZDT A;  2ZZP B;  2O2V A;  4WWO A;  2LZ6 A;  2CHX A;  3PVL A;  3EC8 A;  2ZPY A;  3ML9 A;  4KZ0 A;  4F7Z A;  3VDZ A;  2DAJ A;  3P2B A;  1JRU A;  1J0G A;  2LRU A;  4DHZ E;  1YJ1 A;  2EMT A;  3QCA A;  4G3X B;  4TUU A;  5J18 A;  3O65 B;  3PSE B;  2PE9 A;  4OVV A;  1AAR A;  3DVG X;  3KYC D;  1V2Y A;  4YL8 A;  4IM2 A;  3JW0 X;  4EOY A;  5E6O A;  5GMV A;  5CHW A;  1KOT A;  4IM0 A;  3RZF A;  2N7E A;  1VD2 A;  2ZCB A;  1RLF A;  2L0T A;  4P7I A;  4FA6 A; 
#chains in the Genus database with same CATH topology
 1ESF A;  4KSL C;  3BYT B;  2GOW A;  3NHE B;  2MBB B;  4H2A A;  3H9D A;  3V3X A;  2LWP A;  3AEF B;  1JWA D;  1WX9 A;  4KGT A;  3N32 A;  2MX2 A;  2REX A;  1G6J A;  5CTR C;  1IYF A;  2GMI C;  3M62 B;  2KOX A;  1WYG A;  3U2S C;  1TJE A;  1WXA A;  3NS8 A;  1JWB D;  3N1Y C;  3AED B;  1FPY A;  3I9V 1;  4ZYN A;  1MG8 A;  2BWF A;  1UEL A;  1TYG B;  2WXP A;  5CX3 A;  2JX5 A;  2MWS B;  2LI5 A;  3VQI A;  4W9E A;  3DWM A;  2A5U A;  3V61 A;  2BYE A;  1KLV A;  1FCL A;  1IGC A;  5DPR A;  3LDZ E;  4DQO C;  4W9J A;  2J53 A;  1C1Y B;  2KDM A;  5J17 A;  1WGY A;  1HE8 A;  4RGM A;  1HTO A;  4ARC A;  5BYS A;  4KDI C;  2G1E A;  3X0W A;  4LLG M;  2I2Y A;  4ZOH C;  4IW0 A;  2JWZ A;  4P16 A;  1VCB A;  2LMC A;  2ZPN A;  5G5G A;  3CST A;  4BFR A;  1YOV B;  1M4V A;  3R7R A;  3VTV A;  3QAR A;  1YN3 A;  1TIF A;  1KH0 A;  1HQR D;  4I6P A;  4KKI A;  3ZNZ B;  2DZM A;  4EZL A;  2WDR B;  2X38 A;  2BYV E;  1WXV A;  2KT7 A;  4DXF A;  2N4F A;  3PT2 B;  1KLU D;  2IDY A;  3PRE A;  3I57 A;  2C7M B;  2WDQ B;  2FNJ B;  3ZXV A;  1D5Z C;  1L6V A;  3ZYY X;  3T8M A;  3M95 A;  1YQ3 B;  1WJ4 A;  4A3O A;  2GRI A;  2I1J A;  5DPW A;  2QCZ A;  2KD0 A;  5AZF A;  2CR5 A;  4ANV A;  2N1V A;  4MH8 A;  4WAF A;  1JWS D;  3GP7 A;  1STE A;  2WXK A;  3L10 B;  1C9F A;  5KHQ A;  1TZO A;  3ALB A;  2G4S A;  2Z59 B;  3EGR A;  1D5M C;  3V6E B;  2D10 A;  5IP4 D;  2M4N A;  4GDK A;  4WJQ A;  4DXG A;  3UIN B;  2VH2 A;  4K3C A;  4QAY A;  1R4M B;  3ZXR A;  1UWX A;  2NPT A;  3HRD D;  2W54 A;  4XWT A;  1V80 A;  3OG5 A;  2D3B A;  3TEY A;  1SXT A;  4RF0 A;  4PS3 A;  4A6Q A;  2O6V D;  4TV3 A;  2LGX A;  2WXH A;  2C7N B;  1FRR A;  3NVY A;  3T3N A;  2WU5 B;  2WXO A;  4X57 B;  2AQ3 B;  3N9Y C;  2UYZ B;  2H89 B;  1MI0 A;  2OED A;  1K52 A;  2OJR A;  3P4Q B;  3Q3O C;  4RCO A;  2JUO A;  2KN4 A;  1KTK A;  3LB8 C;  3AE9 B;  2K8H A;  1TS3 A;  1IUE A;  4P6V F;  2ICI A;  3RPF C;  2KVZ A;  2ZVO A;  2DX5 B;  3KVF B;  3TL5 A;  2HE7 A;  2KXJ A;  3WA0 A;  3TSS A;  2BBC A;  4GMV A;  2WXR A;  2NCN A;  2NPT B;  2KTR B;  3CMM B;  1JRO A;  2CU1 A;  1F0Z A;  3VR8 B;  4S17 A;  4WQO B;  2KKC A;  1WGR A;  3AV8 A;  5JXV A;  1V9J A;  3BVZ A;  1SE4 A;  5GXG B;  1N60 A;  2K39 A;  4HPL B;  1VLB A;  3DBH B;  3EEC A;  4XGA B;  5DCN A;  4RF1 A;  4FJZ A;  2BS2 B;  4GLS C;  2D3G A;  3IVF A;  1QT9 A;  4GGQ A;  3M3J A;  5H8Y E;  2B3A A;  3SHQ A;  3KUZ A;  3URY A;  3PS6 A;  3GOE A;  2KDF B;  2N9E B;  3PZD A;  5D6J B;  4KVG B;  2PIA A;  4AJW A;  2RSU A;  4RFB A;  3ECI A;  4C7Z A;  2PMV A;  3DCG A;  2KFJ A;  1WGH A;  2GBM A;  4WJP A;  3RI7 C;  1L7Y A;  4XYC A;  3AM9 A;  1P7E A;  3PGE A;  4BKT A;  4IWQ A;  2KMC A;  2Y5P A;  3AB5 A;  3SD5 A;  3OAW A;  4LNO A;  1QOB A;  2ONQ A;  4HRO A;  4LNN A;  3KW5 B;  2LJ5 A;  2IO2 B;  2ZNV C;  4P1B C;  3PTF C;  1AWD A;  3R2T A;  3Q14 C;  4ICV A;  1C78 A;  3BWU D;  1UD7 A;  1UGM A;  2L76 A;  4W9L A;  1QZE A;  2BKR B;  2I1K A;  1P1A A;  3ZUN A;  2NTT A;  4YSZ B;  1LXD A;  1MHX A;  4ZHP A;  5I4D A;  1YMH E;  4DBG A;  3RNF C;  5EE0 A;  1ZP0 B;  3K9O B;  3ENE A;  4URK A;  4IDI A;  1NEN B;  4EEW A;  3P4P B;  1V86 A;  3PV1 A;  4R3D A;  1EO6 A;  2MJE A;  1WZ3 A;  4HEA 1;  2MCN B;  3MFG A;  1XT9 B;  3DVN U;  2G45 B;  1M94 A;  2INN E;  4WJO A;  3AEA B;  2LEK A;  4NJC A;  3ZDM C;  3DPD A;  4DDG D;  1V5O A;  2BWE S;  1ET6 A;  4AJY B;  3HK0 A;  2LGY A;  2MLB A;  4FHK A;  4WWN A;  3I5J C;  2SEB D;  4DK5 A;  2BB5 A;  2PKO A;  4JGH B;  4GDL A;  3AU4 A;  2AL6 A;  1DGJ A;  1LO5 D;  2L7R A;  4HKZ E;  3VUY A;  1YN5 A;  2INC C;  5AZH A;  1LM8 B;  3WIM A;  2Y3A A;  4J3O D;  2KAN A;  4AWJ A;  3DBS A;  1WX7 A;  1TY2 A;  2MBQ A;  1KLG D;  3BIN A;  2FUH B;  3DDC B;  1YX5 B;  4GN1 A;  3A9K B;  4HLE A;  2NS5 A;  2C5L C;  4JLC A;  4BAX A;  4MDK E;  5BO4 B;  4KIK A;  5FKA C;  3BZD B;  4NAW A;  2WGS A;  3MP9 A;  1WGK A;  4MGI E;  2W3R A;  4MEM A;  3GS2 A;  5E6N A;  1D4B A;  3ETR A;  1HZ5 A;  4B0M A;  1V5T A;  2PVO D;  3DVN V;  4WQM A;  3UQB A;  2KWC A;  1WWT A;  3AXC A;  4K3B A;  2NBU A;  5TSS A;  1A70 A;  1NYQ A;  1S1Q B;  3GE8 C;  4L1B A;  4MGK E;  1NYR A;  3MHZ A;  3ZDT A;  2ZZP B;  2JXT A;  2O2V A;  3NRZ A;  3PVL A;  1PYW D;  1IGD A;  3ML9 A;  3P2B A;  4HPP A;  3R8B A;  3H8H A;  4P1C C;  1XLN A;  3AH7 A;  1GOZ A;  1YJ1 A;  4TUU A;  5EE9 A;  5J18 A;  2PE9 A;  1AAR A;  4YL8 A;  2L32 A;  2E3T A;  3UI3 A;  2N7E A;  1VD2 A;  4DHZ B;  2QC8 A;  4FA6 A;  2KTF A;  5BMI A;  3VHT C;  2BS3 B;  1P3Q U;  2R61 A;  1R4N I;  1RWS A;  3R7Q A;  2L00 B;  4WUR A;  1J7B A;  3DHH C;  5HHD G;  1JAL A;  3RCZ A;  4HCN B;  2M56 B;  1ISN A;  4M02 A;  3PLU A;  3MC9 A;  4EZJ A;  5G55 A;  1N63 A;  2BQQ A;  1V1O A;  2O6V B;  2LHE A;  2ASQ A;  2DLB A;  3IAS 1;  1WIA A;  1OFF A;  3DVG Y;  3DBR I;  2MJD A;  4JIO U;  2CHW A;  4MEL A;  3Q8A A;  2J7Q B;  4MSQ B;  2K3U A;  2MBO A;  3WAN A;  4NZL B;  4FJV B;  3L13 A;  2GB1 A;  1RYJ A;  2GI9 A;  5IA7 A;  1I4X A;  4JWU C;  1FNW A;  4C56 C;  4AS1 A;  2WDV B;  4HJG E;  1WXQ A;  4BOZ B;  2GBK A;  4WAA A;  4I6N B;  2WU2 B;  1TS4 A;  1ZUD 2;  1SE2 A;  4TQ0 A;  2N9L A;  1WYW B;  2Z8L A;  4N6E B;  1ZOY B;  3ZRF A;  2K22 A;  3GB1 A;  1PUT A;  4US9 A;  2E6X A;  2DZJ A;  1S3S G;  2TSS A;  2MRP A;  2AL3 A;  1Z5S B;  4ICU A;  1FEH A;  1WJ6 A;  4PS7 A;  2AYO B;  3TEW A;  1UH6 A;  2MW5 A;  3DBL I;  5JZE B;  3CWI A;  2WXM A;  1UBQ A;  1WJU A;  2AQ2 B;  3C0R B;  4ANU A;  3I63 C;  3FC4 A;  3B0A A;  1WE7 A;  2AEH A;  3TMP B;  1EF1 A;  5D3D A;  2WWZ A;  4KX6 B;  3SR6 A;  1C4P A;  1EU4 A;  3P42 A;  5BYR A;  1NI2 A;  4S0R A;  4ANX A;  2KFK B;  4EKU A;  1WZ0 A;  4B9K A;  1DOI A;  3RMK C;  1XQQ A;  4NJ6 A;  1NVI D;  3TEX A;  4PYZ A;  3L16 A;  1QKZ A;  3U4E G;  3MTN B;  4OZC A;  2KHW B;  2KJ6 A;  3FAH A;  3DOW A;  1OTR B;  2MSE D;  2ZW1 A;  2LVP A;  4MH0 E;  3QA8 A;  2VH1 A;  1D5X C;  2ZEQ A;  2PE6 B;  5C2T B;  1SJE D;  1RRB A;  4HVB A;  3TUO A;  1GC6 A;  2QHO A;  4XZ4 A;  2FE8 A;  3U30 A;  4LTU A;  2ZNV B;  2KLC A;  3EHV A;  3W5U B;  3PO0 A;  1EWY C;  5D2M B;  1VRA B;  2RDB C;  1UGJ A;  3NZS A;  4ZRJ A;  1AN8 A;  4C7Y A;  2V0G A;  4BKG A;  4M00 A;  3PLV A;  2MBE A;  2DYB A;  3KUC B;  1X1M A;  3L0W B;  2JF5 A;  4JPS A;  3ZLZ A;  3L54 A;  3I3T B;  5JH5 C;  5JHB A;  4E74 A;  3A33 B;  4XX5 A;  5HG2 A;  3BK2 A;  1TKE A;  1ZDX A;  4N59 A;  4ZRQ A;  1FD6 A;  2J52 A;  1VZ7 A;  3IT4 B;  4PK1 A;  3QWZ B;  4YT0 B;  1OQQ A;  1ZW7 A;  2JRI B;  1WRD B;  1FNV A;  2L0F A;  1HZ6 A;  5C1Z A;  1EU3 A;  3IXS A;  3U7D A;  2K1F A;  2FID A;  3RT3 B;  2YEP B;  1LGR A;  3NVZ A;  5LNK 1;  2M19 A;  3KWL A;  3UGB B;  2N9X A;  2ZVN A;  3AE5 B;  1SBB B;  4LK0 M;  3S2A A;  2KYW A;  5IOI A;  1F9J A;  2QEJ C;  1E9M A;  3HUI A;  1EWC A;  5CHF A;  2LUM A;  3SU8 X;  3ZGZ A;  2OJW A;  4FJY A;  2PJH A;  4I6L B;  2GBR A;  4G0N B;  2WXF A;  1TKY A;  1T0R C;  3AMZ A;  1FFV A;  3H7P B;  4F1S A;  4KGR A;  1JWU D;  2CS4 A;  2FCN A;  4G50 A;  4BOS C;  5C23 A;  3NZU A;  3RNE C;  1Z2M A;  4MM3 A;  3X23 A;  1YX6 B;  1GC7 A;  2KTR A;  3QX1 A;  3BVM A;  3VH4 B;  2KQ7 A;  4OW0 A;  3P1M A;  4YXD B;  1TKG A;  1WM3 A;  1E8X A;  2DEN B;  2LHD A;  4LNK A;  3W5V B;  2DHZ A;  2FCM A;  2JT4 B;  4ZHO A;  2RD0 A;  2IYD B;  1U4A A;  4MJS A;  1YD8 U;  2CJN A;  2IO1 B;  1Q10 A;  4LNF A;  2WX0 A;  4K1R B;  2D3C A;  2KAJ A;  2RGF A;  2KVR A;  1KM7 A;  1R4N B;  4BKS D;  1WX8 A;  4RNA A;  5AZG A;  3RYT A;  2IY1 B;  3SDL C;  3APF A;  3N30 A;  2X8X X;  4MM3 B;  2WXJ A;  1TY0 A;  3RNB C;  3IFW B;  3KQ4 A;  2YEP F;  1YN4 A;  2MA9 B;  2NBV B;  1Q0W B;  4OHJ A;  4AUQ C;  2QJL A;  4M8M A;  4US8 A;  2KQS A;  4RM9 A;  4B0E A;  2FAZ A;  3L08 A;  3A9J B;  1TZ1 A;  3DBR B;  2MQJ A;  3HM6 X;  1F52 A;  5BMG A;  2J42 A;  1K53 A;  2XNA C;  4MJS B;  2W82 A;  2C60 A;  3A1Q B;  4MAC A;  3AE4 B;  2RDH A;  4NQL B;  3R66 C;  1E5W A;  2EKI A;  2LFI A;  1L0X B;  1Q5W B;  2LRW A;  1UBI A;  4FHJ A;  2DBY A;  3U7Z A;  2EEL A;  1EUV B;  1T3Q A;  1T6B X;  3A4S C;  4LCD E;  1GNU A;  1ET9 A;  3WAM A;  2RPQ A;  3C19 A;  3JYU A;  1C76 A;  2N0S B;  1GB1 A;  2IGD A;  2L83 A;  3VTW A;  4YSY B;  1XLP A;  2FBW B;  1QIL A;  1I4H A;  3AE2 B;  2LRU A;  1FFU A;  4DHZ E;  2EMT A;  3O65 B;  3PSE B;  3KYC D;  1V2Y A;  4IM0 A;  3DBL B;  4WIP A;  4P7I A;  3B1L X;  2KNB A;  2L3Z A;  1ZXH A;  1B1Z A;  2JY6 A;  3QAQ A;  4N9F 4;  2YLM A;  3VTU A;  5T8I A;  2PPH A;  2K6D B;  1D3Z A;  1V6E A;  4KGS A;  2LGI A;  2IBI B;  4A20 A;  3A9K A;  2BGF A;  4TQ1 A;  3NUH B;  2V4L A;  4CYE A;  1FXA A;  1XCT L;  1SE3 A;  4C4V A;  3AE7 B;  1V49 A;  3Q3J A;  4ANW A;  1VJK A;  4W9D A;  2IZV B;  4HPM B;  2L1A A;  3FIL B;  5AUK A;  1K50 A;  1F1H A;  5D94 A;  2G4D B;  5CHV C;  3Q2A C;  2XEW A;  2J0K A;  3E56 A;  3E9S A;  3SEB A;  1NEK B;  2M17 A;  3ZKJ C;  5MPO A;  4DHJ D;  2K5P A;  1KJT A;  1T0Q C;  1L4Z B;  2JXX A;  4DDI D;  4M8N A;  2DNF A;  2G3Q B;  2DZK A;  1J7A A;  1F2R I;  4WWM A;  4BZA A;  4HKQ A;  3VRA B;  1ZXI A;  1RAX A;  1WFY A;  3BK1 A;  4WH4 A;  3RD2 A;  2IPK D;  1MJD A;  1UF0 A;  4KV2 A;  1TT5 B;  3PRP B;  1I4P A;  4C4V B;  3PZ8 A;  1I35 A;  2WHI A;  3B2F A;  4OVU A;  3U52 E;  2EMS A;  3Q3N C;  3T9L A;  2MH7 A;  1YQ4 B;  2W3S A;  1WXM A;  2WNM A;  3CF6 E;  4IC7 B;  4FBJ B;  5AUI A;  3QC8 B;  1RFA A;  3ZTC A;  3QIJ A;  2BYT A;  4LNI A;  2JZZ A;  5G2N A;  3V62 A;  3VRB B;  1TTN A;  2MJ3 A;  4MSM B;  1WGG A;  1WF9 A;  1NDD A;  2O6V A;  1SGH A;  1T0Y A;  1OGW A;  2KWU B;  1PGB A;  1JWM D;  1L0Y B;  2KJH B;  2D3A A;  1WY8 A;  2YVC A;  2D11 A;  4YWG G;  4II3 B;  1YQB A;  1WR6 E;  5J2R A;  4RGN A;  1WJN A;  4GU2 A;  2INP E;  4BKS A;  2NBW B;  2VRR B;  3B9J A;  3W9C B;  2CHZ A;  2L8J A;  3LJ3 A;  2ZCC A;  4KZC A;  1GJZ A;  3HVZ A;  3IAM 1;  1NI3 A;  3ZNG C;  4XDD A;  4FN2 A;  4J6I A;  2HJ8 A;  3ZJU A;  2FCS A;  2AQ1 B;  3DWG C;  3HM3 A;  4KSK C;  3V6C B;  4K7W A;  3VUW A;  2OOB B;  4RM8 A;  5L95 C;  2KQ4 X;  2LGD A;  1CZP A;  5KHO A;  1L2N A;  2XBB C;  4LDT D;  1JML A;  1OQY A;  2M0A A;  4NQK E;  2CJO A;  3B08 A;  3IHP C;  1ZKH A;  2EKE C;  3NVV A;  1E8W A;  1PGA A;  2Z0D B;  2BS4 B;  3UF8 A;  2KJR A;  3N1Z C;  2BB6 A;  3MC0 B;  3N3K B;  1PFD A;  4PYU A;  5HFY A;  2RDG A;  1WSP A;  2LJI A;  2KDB A;  2DYO A;  5L83 A;  2DZI A;  1TS2 A;  2N7J A;  2JWU A;  3JSV A;  1SJH D;  2IO0 B;  3RUL A;  1XXG A;  2KFK A;  1FXT B;  3ZNI D;  1OEY J;  1RFK A;  4EUT A;  1LFD A;  2LAS A;  4ARI A;  1QOG A;  2IGG A;  1I4R A;  3KUD B;  2JVC A;  3ZJT A;  4K81 A;  1P98 A;  1VZ8 A;  4KKJ A;  2IO3 B;  4II2 B;  2OHF A;  2AX5 A;  1BXT A;  2QDF A;  5LXH A;  4GB9 A;  3UIP B;  4NY0 A;  1E6E B;  2K9X A;  5DPT A;  2BKF A;  5C3J B;  2KLG A;  2HJ1 A;  3PZ7 A;  4FAD A;  3PPA A;  1N5W A;  1YIW A;  2KMA A;  5IKC M;  4HWI B;  2MEK A;  3V05 A;  3JSV B;  1WMH A;  2D07 B;  3VFK A;  5IO9 A;  1EM7 A;  4OVZ A;  4D2K A;  1N62 A;  2LD9 A;  3O13 A;  2RR9 A;  1C77 A;  3P4S B;  5DPS A;  3AE3 B;  1E10 A;  1P7F A;  4GSW A;  4NAM A;  2R2O A;  1XLO A;  5BMH A;  4REZ A;  2A4Z A;  4GOC A;  2LXC A;  4TSS A;  5G5H A;  3TJP A;  2L05 A;  1SIJ A;  2BVC A;  1E8Z A;  2L52 A;  1B9R A;  2DYM A;  2M8S A;  4G11 A;  3JVZ X;  3IG3 A;  3K9P B;  3RZW C;  1SEB D;  1L4D B;  3ABV B;  4JWS C;  3ZO5 B;  4LJO B;  1WRI A;  3VUX A;  1D6E C;  4AQ7 A;  1WMH B;  2PLP A;  3NS1 A;  5TR5 A;  3NZ3 A;  2UU7 A;  4C80 A;  2XN9 C;  2JQR B;  1ZPS A;  2JYT A;  3MHS D;  3OLM D;  4USA A;  4ASW C;  1RM6 C;  1MG4 A;  3W1Y A;  2BYF A;  1QOA A;  4ACF A;  4ZYS A;  3FKY A;  3W1S A;  2WXI A;  4DHJ B;  3H7P A;  1T0S C;  3H7S A;  3AEE B;  3GZN I;  3B2G A;  1ZGU B;  4OZA A;  2SAK A;  3WAL A;  3BYY B;  1C79 A;  1CJE A;  1SB3 C;  4WJN A;  3W2D A;  2V3N A;  3ZVV A;  1QF6 A;  1K51 A;  4WWP A;  1UNS A;  4MGZ E;  1IBX A;  3KLS X;  2FIF A;  4RH6 A;  4EFO A;  1V1P A;  5E6J A;  2MBH A;  1XCQ L;  1FM0 D;  4JE3 B;  1FXI A;  4C00 A;  2BPS A;  3MJ5 A;  4YTM B;  3LXF A;  4BBN F;  2M0X A;  1N5X A;  4W9G A;  1QOF A;  2KWV B;  1WI0 A;  3U8Z A;  1PGX A;  3ML8 A;  1E90 A;  2Q5W D;  1ACC A;  1HXY D;  2V3S A;  3L17 A;  3Q6B A;  3PRZ A;  3EUB 2;  4A55 A;  2DWQ A;  2KMM A;  4WWO A;  2JYE A;  3EC8 A;  2JSV X;  4F7Z A;  3VDZ A;  1ZE3 D;  2DAJ A;  1JRU A;  1J0G A;  3R2I A;  1V97 A;  4OVV A;  3DVG X;  4EOY A;  2HTM E;  2QIE B;  5E6O A;  5GMV A;  2WP9 B;  1KOT A;  2D5G A;  1IBX B;  4JX1 C;  1RLF A;  2L0T A;  4PT5 A;  1V1P B;  4AP4 C;  4HDQ A;  2K8B A;  2R2Q A;  4NPN A;  3ZJV A;  4ZRP A;  2UWQ A;  4GXB A;  3A9J A;  2K6Q A;  1AYF A;  1Y8R C;  3AUL A;  4DXA B;  2WXQ A;  3QHT A;  4DWF A;  2HD5 B;  4PS8 A;  3P63 A;  1SE9 A;  3A4R A;  3A1Q A;  1PQS A;  2WDT B;  1BML C;  3BY4 B;  4IKG A;  1TGZ B;  1L0V B;  1CK1 A;  1FNU A;  3TEZ A;  4W9F A;  3ZIM A;  1TS5 A;  2JZ3 B;  1MVK A;  5HI1 A;  2VZK D;  2I38 A;  1HEZ E;  2WS3 B;  3RFZ B;  4FUL A;  1JW9 D;  1IP9 A;  1FIQ A;  4LDT B;  2IGH A;  5E6P A;  5AEK B;  3N20 C;  1FRD A;  1WR1 A;  4JQW C;  2HDE A;  1E7P B;  2W9N A;  3ZRC A;  4W9H A;  3WAO A;  3UQA A;  1BUI C;  2KWD A;  4GDK B;  3ZNH B;  5FR3 A;  1I42 A;  1MHH E;  3TBL D;  2J0M A;  4XE0 A;  1ZDV A;  5IAA C;  2N7D A;  1V8C A;  4W9K A;  1L5P A;  3VR9 B;  1WH3 A;  4A9A A;  1I4Q A;  2ON8 A;  3AE1 B;  2AWT A;  4BBN C;  4A8X C;  4HRS A;  3DHG C;  2LGS A;  1IPG A;  1JCK B;  2GLS A;  3MJW A;  3VAW A;  2NVU I;  1C4C A;  1ROE A;  2LVO A;  4RGT A;  1J7C A;  1NBF C;  2PW9 A;  2N9K A;  2BTE A;  2XK5 A;  4YTN B;  4F8C B;  2K25 A;  1N6Z A;  3H1U A;  3ONS A;  2RMM A;  3FIL A;  1T5X D;  2QSD A;  4HJK A;  2GBJ A;  4GIV A;  4M0W A;  5LLI A;  3NOB A;  3H6N A;  1KFY B;  3VH3 B;  3EA6 A;  2RPV A;  1QLB B;  2GBN A;  1HTQ A;  1XO3 A;  3Q8E A;  4ZRK A;  1JRP A;  4HCP B;  2K0P A;  2ZW0 A;  3LYY A;  1TBE A;  3Q3M C;  4CQN A;  1P9D U;  1EF5 A;  4MGY E;  4ZRI A;  4EE2 A;  2ACZ B;  3PHW B;  4A90 A;  3BII D;  4FXC A;  4M01 A;  1KF6 B;  3AE6 B;  1OEY A;  3HVD A;  1Q1O A;  3RNA C;  2N1W A;  1XEE A;  2XK5 B;  3OJ3 A;  4K7S A;  1YNT E;  3AN1 A;  4B95 A;  3QQ8 B;  1VDV A;  3TIX A;  3Q8F A;  2H88 B;  1CQV A;  2WXN A;  4XDC A;  4E71 A;  4M0W B;  3D32 A;  2JPH A;  1JQ4 A;  1VZ6 A;  2BT6 A;  2KX0 A;  4L2Y A;  5IN7 A;  3RN9 C;  1YJI A;  2ZJD A;  1V81 A;  2QMT A;  2C7H A;  2W55 A;  3KWV A;  1FCC C;  1A5R A;  4IOI E;  3PRM B;  2DAF A;  1L6U A;  1F2R C;  4RGO S;  2HTH A;  3L4P A;  3M63 B;  2KDE B;  2V4I B;  1MPE A;  2KZR A;  3ZQ4 A;  1YJJ A;  5JHA A;  4A3P A;  3VVW B;  3IT6 B;  1E7V A;  2WXL A;  3RNG C;  3NG0 A;  4NNJ B;  3HHM A;  1GAQ B;  4IWP A;  3UIO B;  3DQV A;  4Q2J A;  3W1S C;  1I7H A;  4XWW A;  3TCA A;  3OWE B;  1OQR A;  2K8C A;  4IM3 A;  4KDL B;  5EDS A;  3BVG A;  4TKN A;  1MFW A;  4BVU C;  2PVG C;  1WE6 A;  1J8C A;  3R3M A;  3SFD B;  1E8Y A;  5EE1 A;  2LXA A;  5EE3 A;  4YSX B;  4OZB A;  1VR9 A;  1BT0 A;  3GZN B;  1QQR A;  1C4A A;  1F77 A;  3PHX B;  1XF5 L;  3KYD D;  3ZW3 A;  2CKH B;  1SSN A;  4NJ7 A;  3IBE A;  3EFU A;  2KC1 A;  3AEC B;  2JRH A;  2WYQ A;  3AEG B;  2IJ0 A;  2WXG A;  2N9P C;  3NJT A;  4AOF A;  4CO7 A;  2NMQ A;  1J19 A;  1LQB A;  3QK0 A;  1H4R A;  1R7S A;  3SFE B;  1R4M I;  2QIL A;  2WX1 A;  1C3T A;  4GDL B;  3V60 A;  3DHI C;  2M1M A;  3ZTD A;  4N58 A;  3APC A;  5HKH A;  5D3I B;  2KAC A;  2NR2 A;  3AI5 A;  1K8R B;  1UUP A;  3AEB B;  1GB4 A;  3Q8C A;  3WAP A;  2G9H D;  2KC2 A;  2KO3 A;  4UDU C;  4W9I A;  1AW7 A;  2KN5 A;  4KIK B;  1DYQ A;  3AU5 A;  4NAW B;  4YTP B;  2IND C;  2JZP A;  1WGD A;  1HA5 A;  3C8Y A;  3NVW A;  4HXD A;  2MP2 A;  2Y5B B;  1ENF A;  2FUG 1;  3RUI B;  4JL9 A;  4ZDV A;  2KX3 A;  4FLH A;  1E7U A;  3HIZ A;  3APD A;  1FO4 A;  4E3C A;  2B76 B;  3RNC C;  4EZK A;  2Z0E B;  3NY5 A;  5FR6 A;  2IY0 B;  2Y5C A;  1UWM A;  1H8C A;  1XD3 B;  2JU6 X;  5D7G A;  5H92 C;  4HDO A;  3P4R B;  2O2V B;  2NTS A;  3CSF A;  3VXW A;  1PDX A;  2V1Y A;  3Q69 A;  4XC2 A;  2C9W B;  2KDI A;  2LUE A;  3DBH I;  2KK8 A;  2VZK B;  1GG3 A;  3Q8B A;  4HK2 A;  1XLQ A;  2CU3 A;  4L23 A;  4IG7 B;  2MP2 B;  1SF0 A;  5LXI B;  1DOX A;  2MHJ A;  3EFC A;  1P0R A;  2V3P A;  1FMA D;  2FCQ A;  3KH0 A;  3T3O A;  1SIF A;  1KRH A;  1GUA B;  2PTL A;  4RMA A;  3N1X C;  4IWO A;  4CHK A;  2BW2 A;  2J0J A;  4IUM B;  4K7U A;  2D2Q A;  1I4G A;  4O1N A;  1DOY A;  4LJP B;  2WLB A;  4W9C A;  3QJZ A;  2BF8 B;  4B6W A;  3WCQ A;  1WM2 A;  3CIR B;  1WXS A;  2LVQ A;  1CMX B;  3Q3F A;  2WQY B;  3OJ4 B;  1UZX B;  2PEA A;  1E0Z A;  3MC8 A;  4ITK A;  2LZ6 A;  2CHX A;  4TMA B;  2ZPY A;  5FK9 C;  4KZ0 A;  1Y56 A;  1GPX A;  3AE8 B;  3J9C A;  2V9H A;  3QCA A;  4G3X B;  2J4X A;  3GE3 C;  4IM2 A;  3JW0 X;  5CHW A;  5BYQ A;  3RZF A;  2ZCB A;  1N61 A;  4MT5 A; 
#chains in the Genus database with same CATH homology
 2KTF A;  3B1L X;  4KSL C;  2GOW A;  2KNB A;  2L3Z A;  4AP4 C;  3NHE B;  2MBB B;  3VHT C;  3H9D A;  4HDQ A;  2K8B A;  1P3Q U;  2JY6 A;  2LWP A;  2R2Q A;  4NPN A;  1R4N I;  3QAQ A;  4N9F 4;  2YLM A;  2UWQ A;  1WX9 A;  3R7Q A;  3N32 A;  2L00 B;  2MX2 A;  4GXB A;  3VTU A;  2PPH A;  2K6D B;  2REX A;  3A9J A;  1D3Z A;  1G6J A;  5CTR C;  2K6Q A;  1IYF A;  2GMI C;  1V6E A;  1Y8R C;  3RCZ A;  3AUL A;  3M62 B;  4HCN B;  2KOX A;  4DXA B;  3QHT A;  4DWF A;  2HD5 B;  4PS8 A;  2IBI B;  1ISN A;  1WXA A;  4A20 A;  3A9K A;  2BGF A;  4TQ1 A;  1SE9 A;  3A4R A;  2V4L A;  3A1Q A;  3NS8 A;  3PLU A;  4CYE A;  4EZJ A;  1PQS A;  1V49 A;  2WDT B;  3Q3J A;  4ANW A;  3BY4 B;  4W9D A;  1TGZ B;  5G55 A;  4ZYN A;  1MG8 A;  2BWF A;  1UEL A;  2IZV B;  4HPM B;  5CX3 A;  2O6V B;  4W9F A;  3ZIM A;  2JZ3 B;  2MWS B;  5D94 A;  2LI5 A;  2G4D B;  3VQI A;  5CHV C;  4W9E A;  2XEW A;  2J0K A;  4FUL A;  2A5U A;  1IP9 A;  2ASQ A;  2BYE A;  3V61 A;  1KLV A;  1WIA A;  5DPR A;  3DVG Y;  3DBR I;  3LDZ E;  4LDT B;  4W9J A;  1C1Y B;  5J17 A;  3ZKJ C;  2M17 A;  1WGY A;  5E6P A;  1HE8 A;  4JIO U;  2CHW A;  4DHJ D;  5AEK B;  1KJT A;  4MEL A;  1WR1 A;  2J7Q B;  4JQW C;  4MSQ B;  2JXX A;  2MBO A;  2W9N A;  4KDI C;  4M8N A;  4W9H A;  3WAN A;  3X0W A;  3ZRC A;  3WAO A;  4FJV B;  2G3Q B;  3UQA A;  3ZNH B;  3L13 A;  4GDK B;  4IW0 A;  2DZK A;  1I42 A;  2JWZ A;  5IA7 A;  1RAX A;  1WFY A;  3TBL D;  1VCB A;  2J0M A;  5IAA C;  2N7D A;  4W9K A;  3RD2 A;  2ZPN A;  4KV2 A;  1WH3 A;  3PRP B;  3CST A;  4BOZ B;  2GBK A;  4BFR A;  4WAA A;  4I6N B;  1I35 A;  2AWT A;  3R7R A;  3VTV A;  3QAR A;  4BBN C;  4TQ0 A;  4OVU A;  1WYW B;  2EMS A;  4I6P A;  1IPG A;  3T9L A;  3ZNZ B;  2DZM A;  4EZL A;  2BYV E;  1WXV A;  3ZRF A;  2N4F A;  3PT2 B;  3MJW A;  1WXM A;  2NVU I;  3VAW A;  3CF6 E;  4IC7 B;  2LVO A;  2DZJ A;  4FBJ B;  3PRE A;  1S3S G;  3QC8 B;  2C7M B;  2MRP A;  2FNJ B;  1RFA A;  1Z5S B;  2AL3 A;  1WJ6 A;  4ICU A;  4PS7 A;  3ZTC A;  1NBF C;  3QIJ A;  2AYO B;  2XK5 A;  3T8M A;  2JZZ A;  1UH6 A;  5G2N A;  3V62 A;  2MW5 A;  3M95 A;  1WJ4 A;  4F8C B;  4A3O A;  5DPW A;  2I1J A;  3DBL I;  2K25 A;  1TTN A;  2KD0 A;  4MSM B;  2CR5 A;  1WGG A;  5AZF A;  4ANV A;  5JZE B;  3H1U A;  2N1V A;  3ONS A;  1UBQ A;  1WJU A;  1WF9 A;  3C0R B;  4ANU A;  1NDD A;  2O6V A;  4HJK A;  1SGH A;  3B0A A;  1T0Y A;  1WE7 A;  2AEH A;  1OGW A;  2GBJ A;  4GIV A;  5LLI A;  3TMP B;  1EF1 A;  3NOB A;  2KWU B;  3H6N A;  3VH3 B;  2KJH B;  2WWZ A;  1WY8 A;  2GBN A;  3L10 B;  2YVC A;  5KHQ A;  2D11 A;  4II3 B;  3ALB A;  4ZRK A;  1YQB A;  1NI2 A;  1WR6 E;  4ANX A;  2G4S A;  2Z59 B;  2KFK B;  4EKU A;  5J2R A;  1WZ0 A;  4HCP B;  3V6E B;  1WJN A;  4B9K A;  2D10 A;  4GU2 A;  1XQQ A;  4BKS A;  2M4N A;  4NJ6 A;  1TBE A;  2NBW B;  4GDK A;  4WJQ A;  1P9D U;  2VRR B;  1EF5 A;  3UIN B;  4PYZ A;  3L16 A;  4MGY E;  4ZRI A;  2CHZ A;  2L8J A;  3LJ3 A;  3PHW B;  2ZCC A;  3MTN B;  2NPT A;  4KZC A;  2KHW B;  1GJZ A;  2KJ6 A;  1OEY A;  3DOW A;  1OTR B;  1V80 A;  2MSE D;  3ZNG C;  1Q1O A;  4FN2 A;  2LVP A;  2N1W A;  4J6I A;  4MH0 E;  3QA8 A;  2HJ8 A;  2XK5 B;  2ZEQ A;  2FCS A;  2PE6 B;  3OJ3 A;  4PS3 A;  1RRB A;  4HVB A;  1GC6 A;  4K7S A;  2O6V D;  2QHO A;  4TV3 A;  4XZ4 A;  4B95 A;  2LGX A;  3HM3 A;  2C7N B;  3QQ8 B;  3U30 A;  3TIX A;  4KSK C;  3V6C B;  4K7W A;  3VUW A;  2OOB B;  4RM8 A;  5L95 C;  2LGD A;  4E71 A;  4M0W B;  4X57 B;  2ZNV B;  3D32 A;  2JPH A;  2KLC A;  2UYZ B;  5KHO A;  2KX0 A;  2XBB C;  4LDT D;  3EHV A;  1L2N A;  1OQY A;  4NQK E;  2OJR A;  5D2M B;  2ZJD A;  1V81 A;  2C7H A;  2JUO A;  3B08 A;  3IHP C;  1A5R A;  1ZKH A;  3NZS A;  2K8H A;  2EKE C;  3PRM B;  1E8W A;  4ZRJ A;  2DAF A;  4BKG A;  2HTH A;  2Z0D B;  2ZVO A;  3PLV A;  2DX5 B;  2MBE A;  2DYB A;  3KVF B;  3TL5 A;  2HE7 A;  2KXJ A;  3KUC B;  3M63 B;  3WA0 A;  3UF8 A;  2KDE B;  2KJR A;  1X1M A;  3L0W B;  2KZR A;  2JF5 A;  4GMV A;  3N3K B;  4PYU A;  5JHA A;  3ZLZ A;  2NCN A;  3L54 A;  4A3P A;  2NPT B;  3I3T B;  3VVW B;  5JH5 C;  5JHB A;  2KTR B;  1E7V A;  4E74 A;  3CMM B;  2CU1 A;  3A33 B;  4NNJ B;  3HHM A;  4IWP A;  4XX5 A;  3UIO B;  2KDB A;  2DYO A;  4WQO B;  2KKC A;  2DZI A;  3DQV A;  5L83 A;  1WGR A;  3W1S C;  3TCA A;  1V9J A;  3QWZ B;  3JSV A;  1ZW7 A;  2IO0 B;  3RUL A;  2JRI B;  1WRD B;  2KFK A;  2L0F A;  1FXT B;  3ZNI D;  2K39 A;  1OEY J;  2K8C A;  4HPL B;  4EUT A;  1LFD A;  4IM3 A;  5C1Z A;  3EEC A;  4KDL B;  5EDS A;  2LAS A;  4TKN A;  3U7D A;  4BVU C;  2K1F A;  2FID A;  5DCN A;  3RT3 B;  4FJZ A;  1WE6 A;  1J8C A;  3R3M A;  2D3G A;  3KUD B;  1E8Y A;  2JVC A;  3IVF A;  2LXA A;  4GGQ A;  4K81 A;  3M3J A;  1P98 A;  2B3A A;  1BT0 A;  3SHQ A;  3UGB B;  3KUZ A;  2IO3 B;  2N9X A;  2ZVN A;  3PHX B;  4II2 B;  3PS6 A;  5LXH A;  3KYD D;  3ZW3 A;  3GOE A;  4GB9 A;  2KDF B;  2CKH B;  2N9E B;  3S2A A;  3UIP B;  3PZD A;  4NJ7 A;  3IBE A;  3EFU A;  4NY0 A;  5D6J B;  5DPT A;  2KC1 A;  4KVG B;  2BKF A;  2JRH A;  1F9J A;  4AJW A;  2WYQ A;  2KLG A;  2RSU A;  3ECI A;  2N9P C;  5CHF A;  4FAD A;  3SU8 X;  4AOF A;  4CO7 A;  3DCG A;  1J19 A;  1LQB A;  1WGH A;  2KFJ A;  3PPA A;  3QK0 A;  4FJY A;  2PJH A;  1H4R A;  4I6L B;  2GBR A;  2GBM A;  4WJP A;  1R4M I;  1YIW A;  2KMA A;  1L7Y A;  2WX1 A;  1C3T A;  4G0N B;  4GDL B;  4HWI B;  3V60 A;  2M1M A;  3H7P B;  3ZTD A;  3PGE A;  4BKT A;  3JSV B;  1WMH A;  2D07 B;  4IWQ A;  2KMC A;  3SD5 A;  3VFK A;  4F1S A;  3OAW A;  3APC A;  5HKH A;  2FCN A;  2CS4 A;  4DHZ B;  4G50 A;  2LD9 A;  3KW5 B;  2RR9 A;  4BOS C;  2LJ5 A;  2NR2 A;  3AI5 A;  2IO2 B;  2ZNV C;  5C23 A;  1K8R B;  3NZU A;  3PTF C;  5DPS A;  1Z2M A;  4GSW A;  4MM3 A;  3WAP A;  2KC2 A;  2KO3 A;  2R2O A;  4ICV A;  1YX6 B;  3X23 A;  4W9I A;  2A4Z A;  1UGM A;  1UD7 A;  2L76 A;  4GOC A;  1GC7 A;  1QZE A;  2KTR A;  2BKR B;  2LXC A;  2I1K A;  4W9L A;  3QX1 A;  1P1A A;  2KN5 A;  4KIK B;  3TJP A;  3AU5 A;  4NAW B;  3ZUN A;  2L05 A;  1WGD A;  1LXD A;  1E8Z A;  4HXD A;  2MP2 A;  2DYM A;  2Y5B B;  2M8S A;  3VH4 B;  3RUI B;  2KQ7 A;  4JL9 A;  4ZDV A;  4G11 A;  1WM3 A;  3JVZ X;  4DBG A;  2KX3 A;  1E8X A;  2DEN B;  3IG3 A;  4FLH A;  1E7U A;  3K9O B;  3ENE A;  3HIZ A;  4URK A;  2DHZ A;  4EEW A;  3K9P B;  3RZW C;  3APD A;  1V86 A;  3PV1 A;  2FCM A;  2JT4 B;  4E3C A;  2RD0 A;  4EZK A;  2Z0E B;  3NY5 A;  5FR6 A;  2IY0 B;  1EO6 A;  2IYD B;  3ZO5 B;  4LJO B;  1H8C A;  1XD3 B;  1U4A A;  3VUX A;  5D7G A;  4MJS A;  1YD8 U;  1WZ3 A;  2IO1 B;  4HDO A;  2WX0 A;  4K1R B;  2MCN B;  2RGF A;  2KVR A;  1WMH B;  2O2V B;  1KM7 A;  3CSF A;  1XT9 B;  4BKS D;  1WX8 A;  3DVN U;  3VXW A;  5AZG A;  3RYT A;  2G45 B;  1M94 A;  2V1Y A;  4XC2 A;  2IY1 B;  2C9W B;  3APF A;  4WJO A;  5TR5 A;  3SDL C;  3N30 A;  2KDI A;  3ZDM C;  3DPD A;  4DDG D;  3OLM D;  2LUE A;  3MHS D;  3DBH I;  1V5O A;  3IFW B;  2KK8 A;  1GG3 A;  4ASW C;  2BWE S;  4AJY B;  3HK0 A;  3W1Y A;  2BYF A;  4HK2 A;  2LGY A;  2MA9 B;  2MLB A;  4FHK A;  4WWN A;  4DK5 A;  2NBV B;  4JGH B;  4GDL A;  4IG7 B;  3W1S A;  2MP2 B;  3AU4 A;  1Q0W B;  2AL6 A;  3H7P A;  4DHJ B;  5LXI B;  3H7S A;  4AUQ C;  2L7R A;  4M8M A;  3GZN I;  2KQS A;  3VUY A;  1P0R A;  4RM9 A;  2FAZ A;  2FCQ A;  3L08 A;  3KH0 A;  3A9J B;  1TZ1 A;  1ZGU B;  1SIF A;  5AZH A;  1LM8 B;  3WAL A;  3WIM A;  2MQJ A;  3HM6 X;  2KAN A;  4AWJ A;  3DBS A;  1GUA B;  1WX7 A;  2MBQ A;  4RMA A;  4WJN A;  4DDI D;  3BIN A;  2FUH B;  4IWO A;  3DDC B;  3ZVV A;  1YX5 B;  4CHK A;  4GN1 A;  3A9K B;  4HLE A;  2NS5 A;  2C5L C;  2J0J A;  4JLC A;  4MJS B;  4WWP A;  2C60 A;  3A1Q B;  4MDK E;  5BO4 B;  4MGZ E;  4IUM B;  4K7U A;  4KIK A;  2D2Q A;  4NQL B;  4NAW A;  3R66 C;  2FIF A;  4EFO A;  1E5W A;  4MGI E;  4MEM A;  2MBH A;  5E6N A;  4LJP B;  1Q5W B;  2BPS A;  1UBI A;  2LRW A;  3QJZ A;  4FHJ A;  4W9C A;  2BF8 B;  1V5T A;  4B6W A;  4BBN F;  1WM2 A;  3DVN V;  2M0X A;  3UQB A;  2KWC A;  1EUV B;  1WXS A;  2LVQ A;  1CMX B;  4W9G A;  3Q3F A;  3AXC A;  3A4S C;  2KWV B;  4LCD E;  1GNU A;  1WI0 A;  2NBU A;  3OJ4 B;  1UZX B;  3ML8 A;  1E90 A;  3U8Z A;  3WAM A;  2RPQ A;  2PEA A;  3JYU A;  2V3S A;  1S1Q B;  3L17 A;  4MGK E;  3PRZ A;  3VTW A;  3ZDT A;  2ZZP B;  2O2V A;  4WWO A;  2LZ6 A;  2CHX A;  3PVL A;  3EC8 A;  2ZPY A;  3ML9 A;  4KZ0 A;  4F7Z A;  3VDZ A;  2DAJ A;  3P2B A;  1JRU A;  1J0G A;  2LRU A;  4DHZ E;  1YJ1 A;  2EMT A;  3QCA A;  4G3X B;  4TUU A;  5J18 A;  3O65 B;  3PSE B;  2PE9 A;  4OVV A;  1AAR A;  3DVG X;  3KYC D;  1V2Y A;  4YL8 A;  4IM2 A;  3JW0 X;  4EOY A;  5E6O A;  5GMV A;  5CHW A;  1KOT A;  4IM0 A;  3RZF A;  2N7E A;  1VD2 A;  2ZCB A;  1RLF A;  2L0T A;  4P7I A;  4FA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...