1ZP0B

Crystal structure of mitochondrial respiratory complex ii bound with 3-nitropropionate and 2-thenoyltrifluoroacetone
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FAD-binding protein
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
total genus 59
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1zp0B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zp0B01
4LTUA 1IUEA 1XLQA 3W5VB 1QOGA 4JWSC 4YTNB 1FIQA 1UWMA 2WU5B 1SB3C 3VR9B 1QOFA 1B9RA 1TKGA 1SIJA 3SFEB 1FRDA 2FBWB 2MJ3A 2MJDA 5EE9A 1A70A 4C80A 4US8A 4ZHPA 1J7CA 1CJEA 5H92C 3AEGB 3DWMA 1RFKA 1EWYC 2L83A 1TKYA 1NI3A 1CZPA 2JQRB 4YSXB 1V8CA 1ROEA 2N0SB 2K22A 2B76B 3AECB 1YQ4B 1KFYB 1OFFA 4ZHOA 1N63A 4N58A 1ZOYB 1JALA 3KWLA 4A9AA 3AE8B 3CIRB 1YQ3B 1DOXA 2WDVB 1SF0A 3P63A 3B9JA 3P4QB 4YTMB 3SR6A 1L5PA 1JROA 2DWQA 3VR8B 3AE6B 1T3QA 3NS1A 2CJNA 3W9CB 1FO4A 1AYFA 4N59A 3B2FA 2BS4B 2QJLA 1N5XA 1XO3A 1KF6B 2WS3B 1FFVA 1OQQA 1V97A 1VLBA 2KMMA 1PUTA 4YSZB 2OHFA 3AN1A 5AUKA 3W5UB 2W3RA 1NVID 1RYJA 1FM0D 3NVYA 4ZOHC 5G5GA 4YXDB 1TKEA 3AV8A 1F0ZA 4ITKA 3LB8C 3AE7B 1WYGA 1YJIA 1L6UA 4KX6B 3SFDB 2Q5WD 3B2GA 5MPOA 2PVGC 1QF6A 5H8YE 1JQ4A 1GTEA 2CJOA 2DBYA 3CF4A 1I7HA 2M56B 5EE3A 1WWTA 3ETRA 1PDXA 1L6VA 2WLBA 3CWIA 3AB5A 4P6VF 1E6EB 1RWSA 1RM6C 4IDIA 3DWGC 4HROA 3NVZA 3AEBB 1YJJA 1ZUD2 2CU3A 1JW9D 2BS3B 3AE4B 3AEDB 1ZXIA 1QOBA 5C3JB 3AH7A 1NENB 2PKOA 2ACZB 2W55A 4HRSA 2JX5A 3AMZA 5GXGB 5C2TB 2G1EA 1FXIA 2WQYB 3AE1B 4C7ZA 1NEKB 1FFUA 1JWAD 1WRIA 1OQRA 1KRHA 1WXQA 2E3TA 1FXAA 1NYQA 2QIEB 1DGJA 1FRRA 2Y5CA 3HRDD 2EKIA 1AWDA 3L4PA 4YSYB 2WP9B 1TJEA 4JWUC 4YT0B 1N61A 5AUIA 3P4RB 1GAQB 2HTME 3NVVA 4FXCA 1XLOA 2PVOD 1N60A 3AE9B 3LXFA 3AE3B 3NRZA 1H7XA 1GT8A 3NVWA 2LEKA 4N6EB 3P4SB 1QOAA 4YTPB 2MH7A 3HUIA 2W54A 5G5HA 1FMAD 5EE1A 3WCQA 1E9MA 1H7WA 4USAA 1ZP0B 4WWMA 4US9A 4C7YA 1J7BA 2K9XA 3PO0A 2M19A 1PFDA 2K5PA 1N5WA 1J7AA 3ABVB 2H88B 1R7SA 2H89B 4WQMA 5EE0A 1E7PB 2L52A 1QLBB 2KAJA 2WU2B 3ZYYX 2WDRB 3FC4A 2MJEA 3BIID 3FAHA 1DOYA 4JX1C 2WDQB 3VRAB 1XLPA 1JWBD 3AM9A 1JRPA 1VJKA 3AE2B 2PIAA 3EUB2 3RPFC 3VRBB 3AEEB 2BT6A 2W3SA 1N62A 1NYRA 1E10A 1E0ZA 2AX5A 3HVZA 1DOIA 1VDVA 1WGKA 2BS2B 3P4PB 3AE5B 3P1MA 1L0VB 1TYGB 1XLNA 3AEAB 3AEFB 1GPXA 1GTHA 1QT9A
chains in the Genus database with same CATH superfamily
4RGMA 2HDEA 1C4PA 1WJUA 3KYCD 1WMHB 3H8HA 2YEPB 5J2RA 4JL9A 2ZW1A 1QZEA 4OZAA 1CZPA 3DBSA 1ROEA 1YN3A 3B1LX 2FE8A 4IOIE 5IO9A 3P63A 2FAZA 2N9XA 1J8CA 1TY0A 2Z0EB 1MHHE 3N9YC 1C4CA 3OG5A 4NY0A 2Z59B 5AUKA 3Q3JA 3KWVA 3JYUA 1LXDA 2WHIA 2O2VA 4FHKA 3T3OA 3MTNB 2JYEA 4XGAB 3IXSA 5AZGA 3DWGC 3KH0A 2GBKA 1IP9A 3UI3A 1TS5A 2IBIB 1VZ8A 2K39A 2D3AA 2INPE 1R4MB 4AS1A 1S1QB 4WWPA 3UIPB 3TEYA 2O2VB 3I63C 2KWVB 2ZVNA 4RGNA 3AE3B 4W9LA 1ZKHA 1WJ4A 4NAWA 3Q8AA 4II3B 3EHVA 4MGIE 5D3DA 2KQ4X 2M19A 4XZ4A 1C3TA 1R7SA 4GIVA 3M3JA 2GMIC 3PRPB 3URYA 3FAHA 1WGHA 4PK1A 2REXA 4M0WA 1WR6E 2MWSB 1WGKA 3DBLI 1V1OA 3D32A 2JRHA 1GPXA 5E6JA 1OGWA 1WXSA 2IGGA 5E6NA 1UWMA 1A5RA 4NAWB 2ZPYA 2A5UA 2IO0B 3NJTA 2MSED 3IHPC 3ZRFA 2Z8LA 1SSNA 4KKJA 3ALBA 4JQWC 4YTMB 4M0WB 1YMHE 1ZXHA 3Q8CA 2QJLA 4GN1A 1SE3A 3KW5B 2BYEA 1WYGA 2MP2A 5IAAC 3SFDB 2BW2A 1ESFA 3FKYA 5EE3A 4HJKA 4IW0A 1PDXA 2K8BA 3CWIA 2GBRA 3PRMB 4DK5A 3NVZA 3AEBB 3WAPA 1UWXA 2J52A 3AE4B 4LDTD 4D2KA 3EGRA 3RCZA 4ASWC 1OQRA 2QIEB 3HM3A 4TUUA 2KDFB 4YT0B 2PLPA 2K6DB 2WXHA 3FILA 4BOZB 2L00B 3VUYA 4XC2A 2WGSA 1LGRA 2MP2B 3ZXVA 4LNNA 4XDCA 2PPHA 3O13A 1MHXA 4WURA 4B95A 4C7YA 2L76A 2LJIA 1Z2MA 3TBLD 1E8WA 3QARA 3V3XA 1V81A 2DX5B 1RAXA 2JWUA 4C56C 5AZFA 2PIAA 1E10A 1DOIA 5EDSA 2KK8A 3AI5A 4NQKE 3VTWA 2WX1A 1D6EC 3UGBB 3IAM1 5H92C 3BYYB 2BWFA 2KWDA 1KJTA 1GC6A 4FN2A 1HEZE 3AECB 2J42A 2KT7A 2QC8A 2BKRB 5C1ZA 2LXCA 2NR2A 1EF1A 4P7IA 3ZJTA 2LRUA 2PE6B 4EFOA 1JROA 5DCNA 2DZKA 2RSUA 1PUTA 4OVUA 2DZIA 2LUEA 2KD0A 3ECIA 2AQ3B 4OVZA 2M4NA 4NZLB 5G5GA 3TMPB 1AN8A 1I4GA 2PJHA 2WXIA 1VZ6A 1UH6A 4KX6B 2PVGC 1UGJA 1P7EA 2FUHB 2MBQA 1FNWA 1FCLA 1RM6C 1V2YA 2QEJC 2ZCCA 4GDLA 4MSQB 4CHKA 1WI0A 3AE1B 4ZRJA 3MC9A 3RUIB 4QAYA 2Y5CA 1YX5B 5IOIA 4RMAA 3H9DA 2LGYA 4JWUC 2WXPA 4A6QA 2JZZA 2BGFA 2C5LC 2FIFA 1TT5B 1TBEA 2PVOD 4TV3A 5J18A 4IC7B 2LFIA 4NJCA 1F77A 1ZP0B 3BINA 4EKUA 2JRIB 2LVQA 2LVOA 1C4AA 1E90A 2L52A 1OEYA 2O6VD 3Q14C 3EA6A 3A1QB 4W9DA 3PPAA 1B1ZA 4O1NA 4GDKB 3AEAB 3AEFB 4MEMA 3RZWC 2FCSA 2N9EB 1PGBA 2VZKD 4E3CA 2LASA 3BY4B 4C80A 4AJYB 3OAWA 1XF5L 4FADA 2ZPNA 4F1SA 3HHMA 2AL3A 2L83A 2WWZA 1WGYA 2R2QA 5DPWA 1AW7A 5D7GA 1XQQA 1OFFA 4N58A 3APCA 3V62A 5LXIB 4K7UA 2QDFA 3DHIC 4II2B 2G4SA 4N59A 2IGDA 3W5UB 2KOXA 3ML9A 4G0NB 3L16A 1RFAA 4YXDB 1YQBA 2KKCA 4BAXA 3KUCB 1L6UA 3HIZA 5L83A 2Q5WD 3B0AA 2N1WA 2NTSA 2C7NB 2LUMA 3BK1A 1CK1A 2LJ5A 4RM9A 3IG3A 2KO3A 2CU3A 1JW9D 2KFJA 3UINB 1U4AA 3AMZA 4PYZA 2KNBA 2DZMA 4NJ7A 1UUPA 3SEBA 2HE7A 2D3CA 1K53A 2MA9B 3I57A 3L4PA 3R3MA 2PTLA 2NS5A 1WX9A 1N61A 1MJDA 3PHXB 2KWUB 4ICVA 4HCPB 3HK0A 1F1HA 1GT8A 4K3BA 2KLCA 2N9LA 5D94A 1L4ZB 2NVUI 3L08A 4MM3B 1V86A 3TCAA 1I4RA 1PFDA 2NBVB 2KYWA 4I6NB 4F8CB 1GNUA 2D3GA 4RFBA 4MJSB 3O65B 5D6JB 1UGMA 4A8XC 1J19A 1MFWA 2PEAA 3WAMA 4BKGA 1XLPA 4W9GA 3DBHI 1C9FA 2MRPA 3LDZE 4AJWA 3PV1A 3L13A 4JGHB 2KTRA 2RGFA 2N9PC 2EELA 3ZNHB 2GRIA 2OJRA 1TZ1A 1TKGA 4ZHPA 3AEGB 3APDA 1UELA 4KKIA 1V1PA 1EWYC 4AOFA 1YOVB 4BZAA 2BYTA 3OWEB 1YQ3B 2KWCA 2KXJA 1HQRD 1GUAB 1K8RB 3NS1A 4EZLA 2RPVA 5CX3A 2QSDA 4KDLB 2KTRB 5HFYA 1SJHD 5JHBA 2I1JA 2NBUA 3JVZX 4P1CC 2MLBA 3V6CB 1P1AA 2CU1A 5C23A 2JXTA 2DYBA 1FCCC 3RNEC 3VUWA 3CMMB 1V1PB 1XCQL 3UF8A 2NPTA 3RN9C 3PLUA 3PHWB 2RPQA 3AB5A 4HPLB 1SIFA 3QAQA 3TEZA 4N9F4 2BS3B 2ZCBA 4C7ZA 1L7YA 4DQOC 3ZRCA 2J0KA 5IKCM 4XWWA 4HDQA 5HI1A 4ANXA 1TGZB 3DBRB 3RD2A 4DHJD 1C76A 1D5XC 1H7XA 3NVWA 4N6EB 2SAKA 2DHZA 2V3NA 3RZFA 3PRZA 1H7WA 4XX5A 4XDDA 4BKSD 3T3NA 4NJ6A 2AQ1B 2D5GA 2H89B 1E7PB 2KAJA 2L3ZA 3BK2A 1C78A 2MHJA 3AM9A 1HXYD 2CHWA 2M17A 5IP4D 2LGDA 4OVVA 3VRBB 1WM2A 2GOWA 4H2AA 1FNVA 4IM2A 3RNCC 2EKEC 1YD8U 4FLHA 2KQ7A 3HM6X 4B0EA 5BMHA 4LLGM 1V5OA 4JWSC 2FBWB 1A70A 1BXTA 3R7RA 4YSXB 1WE7A 4KIKA 3KWLA 1JALA 1GG3A 2NMQA 3AE8B 4W9FA 1L0XB 1L5PA 4K7SA 2KC2A 3ZJVA 1WXVA 1T5XD 3B2FA 3NOBA 1KF6B 2K6QA 3A9JA 3R66C 3ZTCA 3DDCB 2GBJA 1PYWD 3LB8C 3NG0A 1AARA 5H8YE 2JF5A 4WAFA 1NBFC 2KC1A 5CHWA 1R4NI 3U2SC 1BUIC 4ZRIA 2LWPA 1QOBA 2R2OA 1C1YB 3V05A 2K8CA 3WANA 1Y56A 3A9JB 4DBGA 1FRRA 1LFDA 2XEWA 2KZRA 2L8JA 4LNFA 2HTME 2X8XX 4MH0E 5FR3A 2ZEQA 3U7ZA 1F2RI 3MP9A 4B0MA 1VCBA 5FR6A 4IKGA 4IM0A 2MJEA 1GJZA 3W1YA 2G3QB 2KDIA 3R2TA 1Z5SB 4OHJA 1VRAB 3GZNB 2AEHA 2WXGA 1MG8A 3VVWB 1NYQA 2MW5A 2MBHA 3J9CA 1IUEA 5KHOA 4JIOU 2MJ3A 3P2BA 3C8YA 3ZQ4A 1WH3A 2D3BA 4WJQA 2IO2B 2OOBB 2B76B 2NTTA 1WX8A 3DVNV 3UIOB 3MJ5A 3MC0B 1ZOYB 1DOXA 3A4SC 1ENFA 1EM7A 2LI5A 2MCNB 1VLBA 3IVFA 4HXDA 1S3SG 4M01A 3AV8A 1E7VA 1HA5A 5IA7A 1KH0A 2K3UA 1GTEA 2DBYA 2JWZA 2JYTA 2Y5PA 4IDIA 4HROA 1XXGA 1ZUD2 4GSWA 2YLMA 2B3AA 4GMVA 3Q3MC 2ACZB 4EE2A 3SHQA 4ANWA 2MQJA 3A9KA 5JZEB 3LJ3A 2IPKD 1TIFA 1K50A 4K81A 1XEEA 4TKNA 2LEKA 4HKQA 3W2DA 2WXOA 3WCQA 4OZCA 3KQ4A 1KLUD 2WXNA 4AWJA 4L23A 1SGHA 3ABVB 2PMVA 4J6IA 5EE0A 1GB4A 5E6PA 2FCMA 5HKHA 3GOEA 4EZKA 3QHTA 3EUB2 2L0FA 3PSEB 3AEEB 1FNUA 1LM8B 3AE5B 4W9EA 4BFRA 1RLFA 4M8MA 2KN4A 5BYRA 2N7EA 2XK5A 5EE9A 4US8A 2K1FA 4REZA 5L95C 4DXGA 4MT5A 2WDVB 2L0TA 4HVBA 2G45B 5JXVA 3E9SA 5BMGA 4KGTA 3FILB 3AE6B 3VQIA 3W9CB 1AYFA 2IY0B 2WXRA 1ET9A 4Q2JA 2X38A 3L17A 2KDEB 3C0RB 4YL8A 1T0YA 2RDGA 2XK5B 1NI2A 3DBLB 4LK0M 3NZSA 3B08A 2DENB 1JQ4A 2M0AA 3GE8C 2D10A 2ZNVC 2EMTA 3RULA 3ONSA 2D2QA 1IBXA 2J4XA 4HKZE 1PQSA 2PKOA 4PS7A 2LGXA 2WQYB 1PGAA 5HG2A 3P4RB 4RGOS 4FXCA 4HJGE 3RFZB 3CF6E 2YEPF 2TSSA 4GU2A 2I2YA 1ACCA 3ZDMC 4ZDVA 1UF0A 4GLSC 4W9JA 1D4BA 1YIWA 1V5TA 1EU4A 4USAA 3PZ8A 3UQAA 4ZYNA 2V4LA 1EWCA 4ZRPA 2AYOB 4XYCA 3BIID 3QA8A 1QQRA 2C9WB 3ENEA 3PTFC 5LLIA 3I9V1 1WR1A 4M02A 1P98A 3BVGA 2L05A 1L0YB 5DPTA 3VR9B 2LXAA 5BMIA 3UQBA 1ZW7A 1XCTL 4GDLB 4WQOB 2RR9A 2YVCA 3VTVA 3QQ8B 5DPRA 4MACA 4ANVA 4ZRKA 3LYYA 4DXFA 2IZVB 3QIJA 2DWQA 4DHZB 3NY5A 3PT2B 5HHDG 2MX2A 2M8SA 1UBQA 3U52E 5BYQA 3X0WA 3Q3FA 2LGIA 3TJPA 4ZOHC 1TS3A 1KLVA 2KVZA 2IDYA 2BTEA 3H7PA 3KUDB 4A90A 2CHXA 2WXFA 1T0SC 1YJJA 3PREA 2WDTB 1ZDXA 5C3JB 4HRSA 5E6OA 2FCNA 4LDTB 1KLGD 3ZNGC 3HRDD 1IGCA 1Q0WB 3BWUD 1TS2A 1FPYA 4ZRQA 2I38A 2RD0A 4B9KA 2WXJA 1E8YA 3LXFA 2Y3AA 1JRUA 1K51A 3P4SB 1QOAA 3ZNID 3N1YC 1WSPA 5EE1A 5LXHA 1J7BA 4P16A 3RI7C 3L54A 2WU2B 2V4IB 3ZYYX 1DOYA 3V60A 2WDQB 3VRAB 2DYMA 2BYFA 2A4ZA 1YNTE 3I3TB 4W9HA 1EUVB 4K7WA 2K25A 3P4PB 3ZGZA 2GB1A 1XLNA 4MGYE 1Q1OA 3N1ZC 3OLMD 4FJVB 1QOFA 1VD2A 2QILA 4KSKC 1CJEA 1KM7A 3N1XC 2BBCA 3RNAC 2JQRB 2N0SB 4RM8A 1UZXB 1MPEA 2BWES 4G3XB 2BYVE 4HLEA 3B9JA 4LJOB 3VR8B 4W9KA 4I6PA 2KMMA 2WS3B 3V6EB 3AN1A 2W3RA 2L32A 2GBMA 1C77A 3TIXA 4EOYA 5FKAC 3VAWA 2DZJA 3U7DA 3OJ4B 4HPMB 3B2GA 2HJ1A 2XN9C 1HTQA 3APFA 3TEWA 4IG7B 4NNJB 1P3QU 3ZW3A 3Q6BA 4NPNA 1ZXIA 4L1BA 4YWGG 2I1KA 2QHOA 2O6VA 5I4DA 3N3KB 3WALA 4KZCA 1WRIA 2E3TA 4LNOA 4TQ0A 1HZ6A 4FBJB 2KJ6A 2K0PA 3ZXRA 2KFKA 3QWZB 3VHTC 3BYTB 2LVPA 2W54A 1BT0A 4CQNA 2J0JA 1EF5A 1Y8RC 2K9XA 3N30A 3OJ3A 4DDGD 1D5ZC 2K5PA 1F2RC 2ASQA 2INNE 2ZNVB 4WQMA 1IPGA 2J7QB 1WJNA 3KYDD 2O6VB 3ZUNA 2SEBD 3M95A 1DYQA 1JWMD 3RPFC 2J53A 4FULA 3TUOA 2GBNA 2QCZA 1J0GA 2WXMA 4S17A 1YN5A 3ML8A 2NPTB 2VH2A 2CHZA 2KFKB 2VZKB 3GB1A 3EECA 1SB3C 4HPPA 3A33B 2V3SA 4RCOA 3RNFC 1NI3A 4GB9A 1EO6A 3PS6A 3WAOA 4EZJA 2IGHA 4HDOA 4ICUA 1JMLA 2PE9A 3HVDA 4ZHOA 1WYWB 1R4MI 2BQQA 5GMVA 4CYEA 2KMCA 4G11A 4W9IA 2BPSA 1FXTB 4F7ZA 2BS4B 1N5XA 2KHWB 2GI9A 1RYJA 3AULA 5G55A 1TKEA 3NHEB 2KX0A 3QC8B 4RNAA 1QF6A 4RF0A 1WWTA 2HTHA 2DLBA 2KACA 4NAMA 2E6XA 1FD6A 4C00A 3Q8BA 3SU8X 1VR9A 1E8ZA 4BOSC 1NEKB 3EFUA 1OTRB 1WXQA 2NCNA 2C7HA 4MGZE 4HEA1 1ZE3D 3NZUA 2JPHA 4KIKB 2KMAA 2MH7A 2Z0DB 1HZ5A 1D5MC 1E9MA 2LGSA 4US9A 1HTOA 2LHEA 1I4XA 3SDLC 3FC4A 2WXKA 2BB6A 2ONQA 2IY1B 1JRPA 2G9HD 2ZW0A 3AE2B 4WAAA 2JT4B 4LCDE 1JWSD 1P9DU 1N62A 4PS8A 1E0ZA 1BMLC 2AX5A 3ZLZA 3PVLA 1L4DB 1WF9A 3P1MA 4KGRA 1CQVA 2M1MA 1X1MA 1XLQA 2BB5A 3W5VB 1TY2A 4YTNB 2WU5B 4B6WA 1TZOA 2QMTA 3U8ZA 2FUG1 3DWMA 3TSSA 1T0QC 3RT3B 2JUOA 1V8CA 1MI0A 2K22A 1QKZA 3CSTA 3DQVA 1KFYB 5LNK1 1N63A 1K52A 1E7UA 2DYOA 4FHJA 1STEA 3PGEA 2CJNA 2IO1B 3DHGC 1XO3A 1V97A 2CR5A 3A4RA 1NVID 2M0XA 1IYFA 3TL5A 3AE7B 4WJPA 1WM3A 5MPOA 1KTKA 1I42A 3P42A 1L6VA 4NQLB 4DHZE 4UDUC 4TMAB 4BKSA 3AEDB 3BVZA 1LO5D 2NBWB 3ZJUA 1JWAD 2BVCA 3W1SC 4MELA 1HE8A 1F9JA 2KQSA 2D07B 2OJWA 3TEXA 3MFGA 1GAQB 3NVVA 4DHJB 3U4EG 2PW9A 1KOTA 4PT5A 4WWMA 3ZDTA 4R3DA 3BZDB 3IT6B 2INCC 1SE2A 5CHFA 1J7AA 3QJZA 2G4DB 4IUMB 2CKHB 1IGDA 1JWBD 1R4NB 2KX3A 2JY6A 3JW0X 5FK9C 4G50A 1SE4A 3IBEA 2WYQA 4A20A 1TYGB 3VUXA 5J17A 5AEKB 2AL6A 1GTHA 2OEDA 4WIPA 3M63B 4RGTA 4FA6A 2CS4A 2MJDA 4K3CA 2JSVX 2C7MB 3R2IA 1Q5WB 4GOCA 2ZJDA 2JZ3B 1M4VA 4ACFA 4GGQA 4AP4C 2AQ2B 3A9KB 4MGKE 4WH4A 4X57B 1I4HA 2JU6X 4JLCA 4KVGB 3NVYA 1FFVA 4BKTA 3AU5A 2LRWA 1WZ3A 3VXWA 2XBBC 2KN5A 4ARIA 3M62B 3CF4A 2W82A 1I7HA 4LJPB 1WY8A 4BBNF 3MHSD 1YX6B 2GLSA 2KDBA 2IYDB 2LD9A 4KGSA 2XNAC 4CO7A 1E5WA 4IWOA 4PS3A 3AH7A 2DNFA 4LNIA 2JZPA 4TQ1A 4DDID 3MC8A 4IWPA 5T8IA 1KRHA 3VH3B 3PLVA 4MDKE 4YSYB 2WP9B 1Q10A 5IN7A 1SEBD 3VTUA 3H7SA 3PZDA 2FIDA 1UBIA 2INDC 3EFCA 4YTPB 3HUIA 1XD3B 1N6ZA 3DHHC 4K1RB 3VFKA 1P0RA 3PO0A 2MBBB 1SE9A 4MSMB 1OQYA 3JSVA 1XT9B 1NYRA 4A3OA 3HVZA 4PYUA 3DVGY 1GOZA 2RDBC 3AU4A 1G6JA 3X23A 1B9RA 1UNSA 1IBXB 1VZ7A 4KDIC 1SBBB 1I4PA 1MVKA 2LZ6A 1H8CA 1YQ4B 1P7FA 3JSVB 4BBNC 3SR6A 4OZBA 3V61A 1WRDB 1FO4A 3E56A 1OQQA 2FCQA 3A1QA 2HJ8A 2ICIA 1FM0D 3BVMA 3AXCA 4MH8A 1OEYJ 1JCKB 4GDKA 4KSLC 2BF8B 2J0MA 1V6EA 3S2AA 4KZ0A 2V1YA 4HCNB 2KJHB 2ZZPB 4EEWA 3Q3NC 1QILA 2RDHA 3ZNZB 2G1EA 3PZ7A 1FFUA 3GP7A 2DAFA 1DGJA 1AWDA 3WA0A 3GS2A 3QK0A 3VH4B 1T0RC 1TJEA 1WE6A 1WFYA 3W1SA 1FEHA 2V0GA 1XLOA 1ZPSA 5BYSA 3IT4B 4HK2A 3KLSX 3KUZA 4A55A 1FMAD 3CSFA 4BVUC 1JWUD 2KANA 1ISNA 4W9CA 4ARCA 2N7JA 1CMXB 2BT6A 4J3OD 1VDVA 2BS2B 1YN4A 2FNJB 2K8HA 3H7PB 3GE3C 4XE0A 1QOGA 3RYTA 1SIJA 3R8BA 1RRBA 1J7CA 2JVCA 2MEKA 1RFKA 4WWOA 5TR5A 3ZTDA 4LNKA 1TKYA 4P1BC 1C79A 4A3PA 4E74A 2L7RA 1LQBA 4MM3A 5D2MB 3EC8A 4A9AA 4M00A 3CIRB 1E8XA 3DCGA 1SF0A 3P4QB 3Q2AC 3L0WB 4E71A 1WGDA 1PGXA 1I35A 4WJOA 2ON8A 1T3QA 2LHDA 3DBRI 3I5JC 4MJSA 1H4RA 2UWQA 2WXQA 1L2NA 2ZVOA 2KTFA 1ZGUB 4M8NA 5BO4B 1F0ZA 3Q69A 2VRRB 2CJOA 2M56B 2AWTA 1TS4A 1RWSA 4S0RA 3U30A 3DVNU 4WWNA 1F52A 3IAS1 5GXGB 5JH5C 3DVGX 5C2TB 3QCAA 1ZDVA 3ETRA 2KVRA 2IO3B 2UYZB 2WXLA 1EU3A 4DWFA 1WXMA 2N9KA 2W9NA 3N32A 3Q8FA 4FJYA 3NRZA 3H6NA 1GC7A 3RMKC 3T9LA 2DAJA 2MBOA 4OW0A 1N5WA 2H88B 1QLBB 4TSSA 3DPDA 3Q3OC 1VJKA 2C60A 2D11A 3H1UA 5TSSA 2HD5B 2IJ0A 3C19A 2W3SA 2KJRA 3ZVVA 2MBEA 2V9HA 2WX0A 2R61A 1D3ZA 1QT9A 4LTUA 5DPSA 1GB1A 1FIQA 1YJ1A 4JPSA 4FJZA 3SFEB 1FRDA 3R7QA 3ZO5B 2EMSA 3L10B 3KVFB 4DXAB 2WNMA 1TTNA 3ZKJC 3ZIMA 4EUTA 4RH6A 1V49A 1I4QA 4GXBA 3T8MA 4C4VA 3WIMA 4KV2A 2BKFA 3VDZA 2N4FA 1NDDA 2OHFA 4YSZB 5CTRC 1SJED 4ITKA 4HWIB 4JE3B 1YJIA 1V80A 2KDMA 2Y5BB 2JXXA 4IWQA 2VH1A 2WLBA 4XWTA 4P6VF 1E6EB 3IFWB 1T6BX 1WZ0A 4IM3A 3GZNI 1NENB 2UU7A 2W55A 4ZYSA 2JX5A 3MHZA 3N20C 1FXIA 4C4VB 4RF1A 1WX7A 3DBHB 1WGGA 1FXAA 2EKIA 3RNBC 2N7DA 2V3PA 3NUHB 5AZHA 5AUIA 4I6LB 2LMCA 1N60A 3AE9B 2L1AA 1WGRA 4AQ7A 5G5HA 4L2YA 4WJNA 2RMMA 4ANUA 1WMHA 1MG4A 3Q8EA 1V9JA 3MJWA 3NS8A 5CHVC 1ET6A 5JHAA 2WDRB 1M94A 2N1VA 4URKA 5D3IB 3NZ3A 4JX1C 3QX1A 5KHQA 1SXTA 3K9OB 1WXAA 2KLGA 1WJ6A 4AUQC 3K9PB 1WIAA 5G2NA 1L0VB 3SD5A 3DOWA 1UD7A 3RNGC
chains in the Genus database with same CATH topology
4RGMA 2OEDA 2HDEA 2EELA 4WIPA 4RGTA 3VR9B 2GRIA 1TKGA 2MJDA 1C4PA 2JSVX 4ZHPA 5BMIA 3R2IA 3H8HA 2YEPB 1XCTL 3AEGB 4GDLB 4KKIA 1V1PA 2ZW1A 1EWYC 4OZAA 1CZPA 1ROEA 1YN3A 1M4VA 2FE8A 2BYTA 4IOIE 4MACA 3OWEB 2AQ2B 1YQ3B 3LYYA 3P63A 1HQRD 4WH4A 4DXFA 1I4HA 2DWQA 2JU6X 3NS1A 5HHDG 2RPVA 1TY0A 2QSDA 3U52E 3N9YC 1MHHE 1C4CA 5BYQA 5HFYA 1SJHD 1FFVA 3NVYA 5AUKA 3KWVA 2JXTA 2LGIA 4ZOHC 1TS3A 2IDYA 2BTEA 1FCCC 3T3OA 2JYEA 1V1PB 3IXSA 1XCQL 4ARIA 3CF4A 2W82A 1I7HA 4A90A 4KGSA 3AB5A 2WXFA 2XNAC 3DWGC 1YJJA 3TEZA 2BS3B 1ZDXA 5C3JB 3AH7A 3UI3A 1TS5A 4HRSA 2JZPA 1VZ8A 4TQ1A 4C7ZA 1KLGD 5T8IA 4DQOC 1KRHA 3HRDD 2INPE 1IGCA 4XWWA 3BWUD 4AS1A 5HI1A 4YSYB 2WP9B 1Q10A 3TEYA 1TS2A 4ZRQA 2I38A 1SEBD 1C76A 2WXJA 1D5XC 3LXFA 3AE3B 2Y3AA 4RGNA 1H7XA 3NVWA 4N6EB 1K51A 2SAKA 3P4SB 1QOAA 4YTPB 2V3NA 3HUIA 3Q8AA 1WSPA 5EE1A 1H7WA 5D3DA 1J7BA 3PO0A 2KQ4X 2M19A 4P16A 4XDDA 3T3NA 2AQ1B 1R7SA 2D5GA 2H89B 1E7PB 2KAJA 2WU2B 2V4IB 3ZYYX 3BK2A 3URYA 3FAHA 1DOYA 2WDQB 3VRAB 1C78A 3AM9A 2DYMA 1HXYD 1YNTE 3VRBB 1NYRA 4H2AA 1FNVA 3HVZA 4M0WA 1WGKA 3P4PB 3ZGZA 1V1OA 2GB1A 1XLNA 5E6JA 1GPXA 4B0EA 1GOZA 4LLGM 5BMHA 2IGGA 4JWSC 1UWMA 1QOFA 1B9RA 4NAWB 2FBWB 1A70A 2QILA 1BXTA 1UNSA 1IBXB 1VZ7A 1CJEA 2BBCA 2JQRB 4YSXB 1SBBB 1I4PA 1MVKA 2N0SB 2Z8LA 1MPEA 1SSNA 1YQ4B 1P7FA 4KKJA 1JALA 2NMQA 3KWLA 3AE8B 1L0XB 3B9JA 4YTMB 3SR6A 1L5PA 3ZJVA 4OZBA 3VR8B 1YMHE 1ZXHA 1FO4A 1T5XD 3Q8CA 3B2FA 3E56A 2QJLA 2KMMA 1KF6B 2WS3B 1OQQA 3AN1A 2ICIA 2W3RA 2L32A 1C77A 1FM0D 1SE3A 3BVMA 5FKAC 1PYWD 3LB8C 1WYGA 4MH8A 1JCKB 3B2GA 3SFDB 2BW2A 5H8YE 1ESFA 4WAFA 2XN9C 5EE3A 1PDXA 3TEWA 3CWIA 3NVZA 3AEBB 3U2SC 1BUIC 1UWXA 2J52A 3AE4B 1ZXIA 1QOBA 4L1BA 4YWGG 1QILA 2RDHA 2G1EA 5I4DA 3PZ7A 4D2KA 3V05A 3EGRA 1FFUA 1WRIA 1OQRA 2E3TA 2QIEB 3GP7A 1Y56A 1DGJA 1FRRA 4TQ0A 1AWDA 1HZ6A 3GS2A 1TJEA 4YT0B 3W1SA 2PLPA 2K0PA 1FEHA 2WXHA 3FILA 2HTME 2V0GA 1XLOA 1ZPSA 5BYSA 3IT4B 4XDCA 3BYTB 5FR3A 3KLSX 3O13A 1MHXA 4WURA 2W54A 4CQNA 4A55A 3U7ZA 1FMAD 1F2RI 4C7YA 2LJIA 3MP9A 2K9XA 4B0MA 1JWUD 1D5ZC 2K5PA 1F2RC 2INNE 4WQMA 4ARCA 4IKGA 3V3XA 2MJEA 2SEBD 2JWUA 4C56C 1DYQA 2PIAA 3R2TA 1JWMD 2N7JA 3RPFC 2BT6A 1E10A 4J3OD 4OHJA 2J53A 1VRAB 1DOIA 1VDVA 3TUOA 2BS2B 1YN4A 2WXGA 2WXMA 1NYQA 1YN5A 3J9CA 1IUEA 4XE0A 1QOGA 2VZKB 3GB1A 1SB3C 1SIJA 2MJ3A 1D6EC 3C8YA 3R8BA 3ZQ4A 1J7CA 3IAM1 5H92C 2MEKA 3BYYB 1RFKA 4RCOA 2KWDA 1TKYA 1NI3A 1HEZE 1C79A 2B76B 3AECB 2IGHA 2NTTA 1JMLA 2J42A 4ZHOA 3HVDA 3MJ5A 3MC0B 1ZOYB 4A9AA 3CIRB 1DOXA 1SF0A 3ZJTA 3P4QB 1ENFA 1JROA 1PGXA 1EM7A 2ON8A 1T3QA 2LHDA 2BS4B 1N5XA 1VLBA 1PUTA 2WXQA 2GI9A 1RYJA 4OVZA 5G5GA 2AQ3B 4NZLB 1TKEA 3AV8A 1AN8A 1I4GA 1F0ZA 3Q69A 4RNAA 2WXIA 1VZ6A 4KX6B 1HA5A 1KH0A 2PVGC 1QF6A 2K3UA 1GTEA 2CJOA 4RF0A 2DBYA 1UGJA 2M56B 1WWTA 1P7EA 1FNWA 2JYTA 1FCLA 2Y5PA 2DLBA 1TS4A 2KACA 1RWSA 4NAMA 1RM6C 4IDIA 2E6XA 4HROA 1FD6A 1XXGA 1ZUD2 2QEJC 3Q8BA 3IAS1 2ACZB 1VR9A 5GXGB 5C2TB 3AE1B 4EE2A 1ZDVA 1NEKB 3ETRA 1WXQA 2Y5CA 2WXLA 1EU3A 4JWUC 2WXPA 4A6QA 2N9KA 4HEA1 2IPKD 1ZE3D 3Q8FA 2PVOD 1K50A 1XEEA 3NRZA 2LEKA 2MH7A 2LFIA 1HZ5A 4OW0A 2WXOA 1D5MC 3W2DA 3WCQA 4OZCA 1E9MA 4HKQA 3KQ4A 1F77A 1KLUD 1ZP0B 2WXNA 4NJCA 4US9A 4L23A 2LHEA 1N5WA 3ABVB 2H88B 2PMVA 5EE0A 1C4AA 1I4XA 2L52A 1QLBB 1GB4A 3FC4A 4TSSA 2WXKA 2BB6A 3EA6A 2ONQA 1JRPA 1VJKA 2G9HD 3AE2B 2ZW0A 3EUB2 5TSSA 1JWSD 2IJ0A 3AEEB 2W3SA 1B1ZA 1N62A 1E0ZA 1BMLC 2AX5A 4O1NA 1FNUA 1L4DB 3AE5B 3P1MA 4KGRA 1CQVA 4GDKB 3AEAB 3AEFB 2R61A 1QT9A 4LTUA 1XLQA 1PGBA 2BB5A 1TY2A 2KN4A 4YTNB 2VZKD 3W5VB 1GB1A 1FIQA 4JPSA 2WU5B 5BYRA 1TZOA 4C80A 3SFEB 1FRDA 5EE9A 4US8A 2QMTA 1XF5L 2FUG1 4REZA 3DWMA 3TSSA 2L83A 4DXGA 1V8CA 2WNMA 1AW7A 5D7GA 1MI0A 2K22A 1QKZA 1KFYB 1OFFA 5LNK1 1N63A 4N58A 4MT5A 1K52A 4RH6A 2DYOA 2WDVB 5JXVA 3E9SA 5BMGA 1STEA 4KGTA 3FILB 3AE6B 1I4QA 3VQIA 2CJNA 3W9CB 1AYFA 4N59A 1XO3A 1V97A 2WXRA 2OHFA 2IGDA 1ET9A 4Q2JA 4YSZB 2X38A 3W5UB 1NVID 2RDGA 4YXDB 1SJED 4ITKA 3AE7B 4JE3B 4LK0M 1YJIA 1L6UA 2KDMA 2Q5WD 1JQ4A 5MPOA 2M0AA 2NTSA 1KTKA 2LUMA 3BK1A 3P42A 1CK1A 1L6VA 2WLBA 4XWTA 4P6VF 1E6EB 4UDUC 4TMAB 1T6BX 1IBXA 2CU3A 2J4XA 1JW9D 4HKZE 3AEDB 3BVZA 1LO5D 1NENB 2PKOA 4ZYSA 2W55A 2JX5A 3AMZA 3MHZA 1UUPA 3SEBA 1FXIA 2WQYB 4RF1A 1PGAA 3ZJUA 1JWAD 1K53A 1FXAA 3I57A 3L4PA 2EKIA 2PTLA 5HG2A 3TEXA 2V3PA 3NUHB 1N61A 3MFGA 5AUIA 3P4RB 1GAQB 4RGOS 3NVVA 4FXCA 4HJGE 3RFZB 2LMCA 2TSSA 2YEPF 1N60A 2I2YA 3AE9B 2L1AA 3U4EG 1ACCA 2PW9A 4GLSC 1GT8A 2N9LA 4AQ7A 1L4ZB 1D4BA 4MM3B 4L2YA 5G5HA 4PT5A 2RMMA 1EU4A 4WWMA 3Q8EA 4USAA 3PZ8A 4R3DA 3BZDB 3IT6B 1I4RA 1PFDA 1SE2A 1J7AA 1EWCA 1ET6A 4RFBA 4ZRPA 2WDRB 4A8XC 3BIID 5D3IB 3NZ3A 4JX1C 1QQRA 1XLPA 1IGDA 1JWBD 5FK9C 1SXTA 1SE4A 3I9V1 1C9FA 3BVGA 1L0VB 1TYGB 1L0YB 1GTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LTU A;  1IUE A;  1XLQ A;  3W5V B;  1QOG A;  4JWS C;  4YTN B;  1FIQ A;  1UWM A;  2WU5 B;  1SB3 C;  3VR9 B;  1QOF A;  1B9R A;  1TKG A;  1SIJ A;  3SFE B;  1FRD A;  2FBW B;  2MJ3 A;  2MJD A;  5EE9 A;  1A70 A;  4C80 A;  4US8 A;  4ZHP A;  1J7C A;  1CJE A;  5H92 C;  3AEG B;  3DWM A;  1RFK A;  1EWY C;  2L83 A;  1TKY A;  1NI3 A;  1CZP A;  2JQR B;  4YSX B;  1V8C A;  1ROE A;  2N0S B;  2K22 A;  2B76 B;  3AEC B;  1YQ4 B;  1KFY B;  1OFF A;  4ZHO A;  1N63 A;  4N58 A;  1ZOY B;  1JAL A;  3KWL A;  4A9A A;  3AE8 B;  3CIR B;  1YQ3 B;  1DOX A;  2WDV B;  1SF0 A;  3P63 A;  3B9J A;  3P4Q B;  4YTM B;  3SR6 A;  1L5P A;  1JRO A;  2DWQ A;  3VR8 B;  3AE6 B;  1T3Q A;  3NS1 A;  2CJN A;  3W9C B;  1FO4 A;  1AYF A;  4N59 A;  3B2F A;  2BS4 B;  2QJL A;  1N5X A;  1XO3 A;  1KF6 B;  2WS3 B;  1FFV A;  1OQQ A;  1V97 A;  1VLB A;  2KMM A;  1PUT A;  4YSZ B;  2OHF A;  3AN1 A;  5AUK A;  3W5U B;  2W3R A;  1NVI D;  1RYJ A;  1FM0 D;  3NVY A;  4ZOH C;  5G5G A;  4YXD B;  1TKE A;  3AV8 A;  1F0Z A;  4ITK A;  3LB8 C;  3AE7 B;  1WYG A;  1YJI A;  1L6U A;  4KX6 B;  3SFD B;  2Q5W D;  3B2G A;  5MPO A;  2PVG C;  1QF6 A;  5H8Y E;  1JQ4 A;  1GTE A;  2CJO A;  2DBY A;  3CF4 A;  1I7H A;  2M56 B;  5EE3 A;  1WWT A;  3ETR A;  1PDX A;  1L6V A;  2WLB A;  3CWI A;  3AB5 A;  4P6V F;  1E6E B;  1RWS A;  1RM6 C;  4IDI A;  3DWG C;  4HRO A;  3NVZ A;  3AEB B;  1YJJ A;  1ZUD 2;  2CU3 A;  1JW9 D;  2BS3 B;  3AE4 B;  3AED B;  1ZXI A;  1QOB A;  5C3J B;  3AH7 A;  1NEN B;  2PKO A;  2ACZ B;  2W55 A;  4HRS A;  2JX5 A;  3AMZ A;  5GXG B;  5C2T B;  2G1E A;  1FXI A;  2WQY B;  3AE1 B;  4C7Z A;  1NEK B;  1FFU A;  1JWA D;  1WRI A;  1OQR A;  1KRH A;  1WXQ A;  2E3T A;  1FXA A;  1NYQ A;  2QIE B;  1DGJ A;  1FRR A;  2Y5C A;  3HRD D;  2EKI A;  1AWD A;  3L4P A;  4YSY B;  2WP9 B;  1TJE A;  4JWU C;  4YT0 B;  1N61 A;  5AUI A;  3P4R B;  1GAQ B;  2HTM E;  3NVV A;  4FXC A;  1XLO A;  2PVO D;  1N60 A;  3AE9 B;  3LXF A;  3AE3 B;  3NRZ A;  1H7X A;  1GT8 A;  3NVW A;  2LEK A;  4N6E B;  3P4S B;  1QOA A;  4YTP B;  2MH7 A;  3HUI A;  2W54 A;  5G5H A;  1FMA D;  5EE1 A;  3WCQ A;  1E9M A;  1H7W A;  4USA A;  1ZP0 B;  4WWM A;  4US9 A;  4C7Y A;  1J7B A;  2K9X A;  3PO0 A;  2M19 A;  1PFD A;  2K5P A;  1N5W A;  1J7A A;  3ABV B;  2H88 B;  1R7S A;  2H89 B;  4WQM A;  5EE0 A;  1E7P B;  2L52 A;  1QLB B;  2KAJ A;  2WU2 B;  3ZYY X;  2WDR B;  3FC4 A;  2MJE A;  3BII D;  3FAH A;  1DOY A;  4JX1 C;  2WDQ B;  3VRA B;  1XLP A;  1JWB D;  3AM9 A;  1JRP A;  1VJK A;  3AE2 B;  2PIA A;  3EUB 2;  3RPF C;  3VRB B;  3AEE B;  2BT6 A;  2W3S A;  1N62 A;  1NYR A;  1E10 A;  1E0Z A;  2AX5 A;  3HVZ A;  1DOI A;  1VDV A;  1WGK A;  2BS2 B;  3P4P B;  3AE5 B;  3P1M A;  1L0V B;  1TYG B;  1XLN A;  3AEA B;  3AEF B;  1GPX A;  1GTH A;  1QT9 A; 
#chains in the Genus database with same CATH topology
 4RGM A;  2HDE A;  1C4P A;  1WJU A;  3KYC D;  1WMH B;  3H8H A;  2YEP B;  5J2R A;  4JL9 A;  2ZW1 A;  1QZE A;  4OZA A;  1CZP A;  3DBS A;  1ROE A;  1YN3 A;  3B1L X;  2FE8 A;  4IOI E;  5IO9 A;  3P63 A;  2FAZ A;  2N9X A;  1J8C A;  1TY0 A;  2Z0E B;  1MHH E;  3N9Y C;  1C4C A;  3OG5 A;  4NY0 A;  2Z59 B;  5AUK A;  3Q3J A;  3KWV A;  3JYU A;  1LXD A;  2WHI A;  2O2V A;  4FHK A;  3T3O A;  3MTN B;  2JYE A;  4XGA B;  3IXS A;  5AZG A;  3DWG C;  3KH0 A;  2GBK A;  1IP9 A;  3UI3 A;  1TS5 A;  2IBI B;  1VZ8 A;  2K39 A;  2D3A A;  2INP E;  1R4M B;  4AS1 A;  1S1Q B;  4WWP A;  3UIP B;  3TEY A;  2O2V B;  3I63 C;  2KWV B;  2ZVN A;  4RGN A;  3AE3 B;  4W9L A;  1ZKH A;  1WJ4 A;  4NAW A;  3Q8A A;  4II3 B;  3EHV A;  4MGI E;  5D3D A;  2KQ4 X;  2M19 A;  4XZ4 A;  1C3T A;  1R7S A;  4GIV A;  3M3J A;  2GMI C;  3PRP B;  3URY A;  3FAH A;  1WGH A;  4PK1 A;  2REX A;  4M0W A;  1WR6 E;  2MWS B;  1WGK A;  3DBL I;  1V1O A;  3D32 A;  2JRH A;  1GPX A;  5E6J A;  1OGW A;  1WXS A;  2IGG A;  5E6N A;  1UWM A;  1A5R A;  4NAW B;  2ZPY A;  2A5U A;  2IO0 B;  3NJT A;  2MSE D;  3IHP C;  3ZRF A;  2Z8L A;  1SSN A;  4KKJ A;  3ALB A;  4JQW C;  4YTM B;  4M0W B;  1YMH E;  1ZXH A;  3Q8C A;  2QJL A;  4GN1 A;  1SE3 A;  3KW5 B;  2BYE A;  1WYG A;  2MP2 A;  5IAA C;  3SFD B;  2BW2 A;  1ESF A;  3FKY A;  5EE3 A;  4HJK A;  4IW0 A;  1PDX A;  2K8B A;  3CWI A;  2GBR A;  3PRM B;  4DK5 A;  3NVZ A;  3AEB B;  3WAP A;  1UWX A;  2J52 A;  3AE4 B;  4LDT D;  4D2K A;  3EGR A;  3RCZ A;  4ASW C;  1OQR A;  2QIE B;  3HM3 A;  4TUU A;  2KDF B;  4YT0 B;  2PLP A;  2K6D B;  2WXH A;  3FIL A;  4BOZ B;  2L00 B;  3VUY A;  4XC2 A;  2WGS A;  1LGR A;  2MP2 B;  3ZXV A;  4LNN A;  4XDC A;  2PPH A;  3O13 A;  1MHX A;  4WUR A;  4B95 A;  4C7Y A;  2L76 A;  2LJI A;  1Z2M A;  3TBL D;  1E8W A;  3QAR A;  3V3X A;  1V81 A;  2DX5 B;  1RAX A;  2JWU A;  4C56 C;  5AZF A;  2PIA A;  1E10 A;  1DOI A;  5EDS A;  2KK8 A;  3AI5 A;  4NQK E;  3VTW A;  2WX1 A;  1D6E C;  3UGB B;  3IAM 1;  5H92 C;  3BYY B;  2BWF A;  2KWD A;  1KJT A;  1GC6 A;  4FN2 A;  1HEZ E;  3AEC B;  2J42 A;  2KT7 A;  2QC8 A;  2BKR B;  5C1Z A;  2LXC A;  2NR2 A;  1EF1 A;  4P7I A;  3ZJT A;  2LRU A;  2PE6 B;  4EFO A;  1JRO A;  5DCN A;  2DZK A;  2RSU A;  1PUT A;  4OVU A;  2DZI A;  2LUE A;  2KD0 A;  3ECI A;  2AQ3 B;  4OVZ A;  2M4N A;  4NZL B;  5G5G A;  3TMP B;  1AN8 A;  1I4G A;  2PJH A;  2WXI A;  1VZ6 A;  1UH6 A;  4KX6 B;  2PVG C;  1UGJ A;  1P7E A;  2FUH B;  2MBQ A;  1FNW A;  1FCL A;  1RM6 C;  1V2Y A;  2QEJ C;  2ZCC A;  4GDL A;  4MSQ B;  4CHK A;  1WI0 A;  3AE1 B;  4ZRJ A;  3MC9 A;  3RUI B;  4QAY A;  2Y5C A;  1YX5 B;  5IOI A;  4RMA A;  3H9D A;  2LGY A;  4JWU C;  2WXP A;  4A6Q A;  2JZZ A;  2BGF A;  2C5L C;  2FIF A;  1TT5 B;  1TBE A;  2PVO D;  4TV3 A;  5J18 A;  4IC7 B;  2LFI A;  4NJC A;  1F77 A;  1ZP0 B;  3BIN A;  4EKU A;  2JRI B;  2LVQ A;  2LVO A;  1C4A A;  1E90 A;  2L52 A;  1OEY A;  2O6V D;  3Q14 C;  3EA6 A;  3A1Q B;  4W9D A;  3PPA A;  1B1Z A;  4O1N A;  4GDK B;  3AEA B;  3AEF B;  4MEM A;  3RZW C;  2FCS A;  2N9E B;  1PGB A;  2VZK D;  4E3C A;  2LAS A;  3BY4 B;  4C80 A;  4AJY B;  3OAW A;  1XF5 L;  4FAD A;  2ZPN A;  4F1S A;  3HHM A;  2AL3 A;  2L83 A;  2WWZ A;  1WGY A;  2R2Q A;  5DPW A;  1AW7 A;  5D7G A;  1XQQ A;  1OFF A;  4N58 A;  3APC A;  3V62 A;  5LXI B;  4K7U A;  2QDF A;  3DHI C;  4II2 B;  2G4S A;  4N59 A;  2IGD A;  3W5U B;  2KOX A;  3ML9 A;  4G0N B;  3L16 A;  1RFA A;  4YXD B;  1YQB A;  2KKC A;  4BAX A;  3KUC B;  1L6U A;  3HIZ A;  5L83 A;  2Q5W D;  3B0A A;  2N1W A;  2NTS A;  2C7N B;  2LUM A;  3BK1 A;  1CK1 A;  2LJ5 A;  4RM9 A;  3IG3 A;  2KO3 A;  2CU3 A;  1JW9 D;  2KFJ A;  3UIN B;  1U4A A;  3AMZ A;  4PYZ A;  2KNB A;  2DZM A;  4NJ7 A;  1UUP A;  3SEB A;  2HE7 A;  2D3C A;  1K53 A;  2MA9 B;  3I57 A;  3L4P A;  3R3M A;  2PTL A;  2NS5 A;  1WX9 A;  1N61 A;  1MJD A;  3PHX B;  2KWU B;  4ICV A;  4HCP B;  3HK0 A;  1F1H A;  1GT8 A;  4K3B A;  2KLC A;  2N9L A;  5D94 A;  1L4Z B;  2NVU I;  3L08 A;  4MM3 B;  1V86 A;  3TCA A;  1I4R A;  1PFD A;  2NBV B;  2KYW A;  4I6N B;  4F8C B;  1GNU A;  2D3G A;  4RFB A;  4MJS B;  3O65 B;  5D6J B;  1UGM A;  4A8X C;  1J19 A;  1MFW A;  2PEA A;  3WAM A;  4BKG A;  1XLP A;  4W9G A;  3DBH I;  1C9F A;  2MRP A;  3LDZ E;  4AJW A;  3PV1 A;  3L13 A;  4JGH B;  2KTR A;  2RGF A;  2N9P C;  2EEL A;  3ZNH B;  2GRI A;  2OJR A;  1TZ1 A;  1TKG A;  4ZHP A;  3AEG B;  3APD A;  1UEL A;  4KKI A;  1V1P A;  1EWY C;  4AOF A;  1YOV B;  4BZA A;  2BYT A;  3OWE B;  1YQ3 B;  2KWC A;  2KXJ A;  1HQR D;  1GUA B;  1K8R B;  3NS1 A;  4EZL A;  2RPV A;  5CX3 A;  2QSD A;  4KDL B;  2KTR B;  5HFY A;  1SJH D;  5JHB A;  2I1J A;  2NBU A;  3JVZ X;  4P1C C;  2MLB A;  3V6C B;  1P1A A;  2CU1 A;  5C23 A;  2JXT A;  2DYB A;  1FCC C;  3RNE C;  3VUW A;  3CMM B;  1V1P B;  1XCQ L;  3UF8 A;  2NPT A;  3RN9 C;  3PLU A;  3PHW B;  2RPQ A;  3AB5 A;  4HPL B;  1SIF A;  3QAQ A;  3TEZ A;  4N9F 4;  2BS3 B;  2ZCB A;  4C7Z A;  1L7Y A;  4DQO C;  3ZRC A;  2J0K A;  5IKC M;  4XWW A;  4HDQ A;  5HI1 A;  4ANX A;  1TGZ B;  3DBR B;  3RD2 A;  4DHJ D;  1C76 A;  1D5X C;  1H7X A;  3NVW A;  4N6E B;  2SAK A;  2DHZ A;  2V3N A;  3RZF A;  3PRZ A;  1H7W A;  4XX5 A;  4XDD A;  4BKS D;  3T3N A;  4NJ6 A;  2AQ1 B;  2D5G A;  2H89 B;  1E7P B;  2KAJ A;  2L3Z A;  3BK2 A;  1C78 A;  2MHJ A;  3AM9 A;  1HXY D;  2CHW A;  2M17 A;  5IP4 D;  2LGD A;  4OVV A;  3VRB B;  1WM2 A;  2GOW A;  4H2A A;  1FNV A;  4IM2 A;  3RNC C;  2EKE C;  1YD8 U;  4FLH A;  2KQ7 A;  3HM6 X;  4B0E A;  5BMH A;  4LLG M;  1V5O A;  4JWS C;  2FBW B;  1A70 A;  1BXT A;  3R7R A;  4YSX B;  1WE7 A;  4KIK A;  3KWL A;  1JAL A;  1GG3 A;  2NMQ A;  3AE8 B;  4W9F A;  1L0X B;  1L5P A;  4K7S A;  2KC2 A;  3ZJV A;  1WXV A;  1T5X D;  3B2F A;  3NOB A;  1KF6 B;  2K6Q A;  3A9J A;  3R66 C;  3ZTC A;  3DDC B;  2GBJ A;  1PYW D;  3LB8 C;  3NG0 A;  1AAR A;  5H8Y E;  2JF5 A;  4WAF A;  1NBF C;  2KC1 A;  5CHW A;  1R4N I;  3U2S C;  1BUI C;  4ZRI A;  2LWP A;  1QOB A;  2R2O A;  1C1Y B;  3V05 A;  2K8C A;  3WAN A;  1Y56 A;  3A9J B;  4DBG A;  1FRR A;  1LFD A;  2XEW A;  2KZR A;  2L8J A;  4LNF A;  2HTM E;  2X8X X;  4MH0 E;  5FR3 A;  2ZEQ A;  3U7Z A;  1F2R I;  3MP9 A;  4B0M A;  1VCB A;  5FR6 A;  4IKG A;  4IM0 A;  2MJE A;  1GJZ A;  3W1Y A;  2G3Q B;  2KDI A;  3R2T A;  1Z5S B;  4OHJ A;  1VRA B;  3GZN B;  2AEH A;  2WXG A;  1MG8 A;  3VVW B;  1NYQ A;  2MW5 A;  2MBH A;  3J9C A;  1IUE A;  5KHO A;  4JIO U;  2MJ3 A;  3P2B A;  3C8Y A;  3ZQ4 A;  1WH3 A;  2D3B A;  4WJQ A;  2IO2 B;  2OOB B;  2B76 B;  2NTT A;  1WX8 A;  3DVN V;  3UIO B;  3MJ5 A;  3MC0 B;  1ZOY B;  1DOX A;  3A4S C;  1ENF A;  1EM7 A;  2LI5 A;  2MCN B;  1VLB A;  3IVF A;  4HXD A;  1S3S G;  4M01 A;  3AV8 A;  1E7V A;  1HA5 A;  5IA7 A;  1KH0 A;  2K3U A;  1GTE A;  2DBY A;  2JWZ A;  2JYT A;  2Y5P A;  4IDI A;  4HRO A;  1XXG A;  1ZUD 2;  4GSW A;  2YLM A;  2B3A A;  4GMV A;  3Q3M C;  2ACZ B;  4EE2 A;  3SHQ A;  4ANW A;  2MQJ A;  3A9K A;  5JZE B;  3LJ3 A;  2IPK D;  1TIF A;  1K50 A;  4K81 A;  1XEE A;  4TKN A;  2LEK A;  4HKQ A;  3W2D A;  2WXO A;  3WCQ A;  4OZC A;  3KQ4 A;  1KLU D;  2WXN A;  4AWJ A;  4L23 A;  1SGH A;  3ABV B;  2PMV A;  4J6I A;  5EE0 A;  1GB4 A;  5E6P A;  2FCM A;  5HKH A;  3GOE A;  4EZK A;  3QHT A;  3EUB 2;  2L0F A;  3PSE B;  3AEE B;  1FNU A;  1LM8 B;  3AE5 B;  4W9E A;  4BFR A;  1RLF A;  4M8M A;  2KN4 A;  5BYR A;  2N7E A;  2XK5 A;  5EE9 A;  4US8 A;  2K1F A;  4REZ A;  5L95 C;  4DXG A;  4MT5 A;  2WDV B;  2L0T A;  4HVB A;  2G45 B;  5JXV A;  3E9S A;  5BMG A;  4KGT A;  3FIL B;  3AE6 B;  3VQI A;  3W9C B;  1AYF A;  2IY0 B;  2WXR A;  1ET9 A;  4Q2J A;  2X38 A;  3L17 A;  2KDE B;  3C0R B;  4YL8 A;  1T0Y A;  2RDG A;  2XK5 B;  1NI2 A;  3DBL B;  4LK0 M;  3NZS A;  3B08 A;  2DEN B;  1JQ4 A;  2M0A A;  3GE8 C;  2D10 A;  2ZNV C;  2EMT A;  3RUL A;  3ONS A;  2D2Q A;  1IBX A;  2J4X A;  4HKZ E;  1PQS A;  2PKO A;  4PS7 A;  2LGX A;  2WQY B;  1PGA A;  5HG2 A;  3P4R B;  4RGO S;  4FXC A;  4HJG E;  3RFZ B;  3CF6 E;  2YEP F;  2TSS A;  4GU2 A;  2I2Y A;  1ACC A;  3ZDM C;  4ZDV A;  1UF0 A;  4GLS C;  4W9J A;  1D4B A;  1YIW A;  1V5T A;  1EU4 A;  4USA A;  3PZ8 A;  3UQA A;  4ZYN A;  2V4L A;  1EWC A;  4ZRP A;  2AYO B;  4XYC A;  3BII D;  3QA8 A;  1QQR A;  2C9W B;  3ENE A;  3PTF C;  5LLI A;  3I9V 1;  1WR1 A;  4M02 A;  1P98 A;  3BVG A;  2L05 A;  1L0Y B;  5DPT A;  3VR9 B;  2LXA A;  5BMI A;  3UQB A;  1ZW7 A;  1XCT L;  4GDL B;  4WQO B;  2RR9 A;  2YVC A;  3VTV A;  3QQ8 B;  5DPR A;  4MAC A;  4ANV A;  4ZRK A;  3LYY A;  4DXF A;  2IZV B;  3QIJ A;  2DWQ A;  4DHZ B;  3NY5 A;  3PT2 B;  5HHD G;  2MX2 A;  2M8S A;  1UBQ A;  3U52 E;  5BYQ A;  3X0W A;  3Q3F A;  2LGI A;  3TJP A;  4ZOH C;  1TS3 A;  1KLV A;  2KVZ A;  2IDY A;  2BTE A;  3H7P A;  3KUD B;  4A90 A;  2CHX A;  2WXF A;  1T0S C;  1YJJ A;  3PRE A;  2WDT B;  1ZDX A;  5C3J B;  4HRS A;  5E6O A;  2FCN A;  4LDT B;  1KLG D;  3ZNG C;  3HRD D;  1IGC A;  1Q0W B;  3BWU D;  1TS2 A;  1FPY A;  4ZRQ A;  2I38 A;  2RD0 A;  4B9K A;  2WXJ A;  1E8Y A;  3LXF A;  2Y3A A;  1JRU A;  1K51 A;  3P4S B;  1QOA A;  3ZNI D;  3N1Y C;  1WSP A;  5EE1 A;  5LXH A;  1J7B A;  4P16 A;  3RI7 C;  3L54 A;  2WU2 B;  2V4I B;  3ZYY X;  1DOY A;  3V60 A;  2WDQ B;  3VRA B;  2DYM A;  2BYF A;  2A4Z A;  1YNT E;  3I3T B;  4W9H A;  1EUV B;  4K7W A;  2K25 A;  3P4P B;  3ZGZ A;  2GB1 A;  1XLN A;  4MGY E;  1Q1O A;  3N1Z C;  3OLM D;  4FJV B;  1QOF A;  1VD2 A;  2QIL A;  4KSK C;  1CJE A;  1KM7 A;  3N1X C;  2BBC A;  3RNA C;  2JQR B;  2N0S B;  4RM8 A;  1UZX B;  1MPE A;  2BWE S;  4G3X B;  2BYV E;  4HLE A;  3B9J A;  4LJO B;  3VR8 B;  4W9K A;  4I6P A;  2KMM A;  2WS3 B;  3V6E B;  3AN1 A;  2W3R A;  2L32 A;  2GBM A;  1C77 A;  3TIX A;  4EOY A;  5FKA C;  3VAW A;  2DZJ A;  3U7D A;  3OJ4 B;  4HPM B;  3B2G A;  2HJ1 A;  2XN9 C;  1HTQ A;  3APF A;  3TEW A;  4IG7 B;  4NNJ B;  1P3Q U;  3ZW3 A;  3Q6B A;  4NPN A;  1ZXI A;  4L1B A;  4YWG G;  2I1K A;  2QHO A;  2O6V A;  5I4D A;  3N3K B;  3WAL A;  4KZC A;  1WRI A;  2E3T A;  4LNO A;  4TQ0 A;  1HZ6 A;  4FBJ B;  2KJ6 A;  2K0P A;  3ZXR A;  2KFK A;  3QWZ B;  3VHT C;  3BYT B;  2LVP A;  2W54 A;  1BT0 A;  4CQN A;  2J0J A;  1EF5 A;  1Y8R C;  2K9X A;  3N30 A;  3OJ3 A;  4DDG D;  1D5Z C;  2K5P A;  1F2R C;  2ASQ A;  2INN E;  2ZNV B;  4WQM A;  1IPG A;  2J7Q B;  1WJN A;  3KYD D;  2O6V B;  3ZUN A;  2SEB D;  3M95 A;  1DYQ A;  1JWM D;  3RPF C;  2J53 A;  4FUL A;  3TUO A;  2GBN A;  2QCZ A;  1J0G A;  2WXM A;  4S17 A;  1YN5 A;  3ML8 A;  2NPT B;  2VH2 A;  2CHZ A;  2KFK B;  2VZK B;  3GB1 A;  3EEC A;  1SB3 C;  4HPP A;  3A33 B;  2V3S A;  4RCO A;  3RNF C;  1NI3 A;  4GB9 A;  1EO6 A;  3PS6 A;  3WAO A;  4EZJ A;  2IGH A;  4HDO A;  4ICU A;  1JML A;  2PE9 A;  3HVD A;  4ZHO A;  1WYW B;  1R4M I;  2BQQ A;  5GMV A;  4CYE A;  2KMC A;  4G11 A;  4W9I A;  2BPS A;  1FXT B;  4F7Z A;  2BS4 B;  1N5X A;  2KHW B;  2GI9 A;  1RYJ A;  3AUL A;  5G55 A;  1TKE A;  3NHE B;  2KX0 A;  3QC8 B;  4RNA A;  1QF6 A;  4RF0 A;  1WWT A;  2HTH A;  2DLB A;  2KAC A;  4NAM A;  2E6X A;  1FD6 A;  4C00 A;  3Q8B A;  3SU8 X;  1VR9 A;  1E8Z A;  4BOS C;  1NEK B;  3EFU A;  1OTR B;  1WXQ A;  2NCN A;  2C7H A;  4MGZ E;  4HEA 1;  1ZE3 D;  3NZU A;  2JPH A;  4KIK B;  2KMA A;  2MH7 A;  2Z0D B;  1HZ5 A;  1D5M C;  1E9M A;  2LGS A;  4US9 A;  1HTO A;  2LHE A;  1I4X A;  3SDL C;  3FC4 A;  2WXK A;  2BB6 A;  2ONQ A;  2IY1 B;  1JRP A;  2G9H D;  2ZW0 A;  3AE2 B;  4WAA A;  2JT4 B;  4LCD E;  1JWS D;  1P9D U;  1N62 A;  4PS8 A;  1E0Z A;  1BML C;  2AX5 A;  3ZLZ A;  3PVL A;  1L4D B;  1WF9 A;  3P1M A;  4KGR A;  1CQV A;  2M1M A;  1X1M A;  1XLQ A;  2BB5 A;  3W5V B;  1TY2 A;  4YTN B;  2WU5 B;  4B6W A;  1TZO A;  2QMT A;  3U8Z A;  2FUG 1;  3DWM A;  3TSS A;  1T0Q C;  3RT3 B;  2JUO A;  1V8C A;  1MI0 A;  2K22 A;  1QKZ A;  3CST A;  3DQV A;  1KFY B;  5LNK 1;  1N63 A;  1K52 A;  1E7U A;  2DYO A;  4FHJ A;  1STE A;  3PGE A;  2CJN A;  2IO1 B;  3DHG C;  1XO3 A;  1V97 A;  2CR5 A;  3A4R A;  1NVI D;  2M0X A;  1IYF A;  3TL5 A;  3AE7 B;  4WJP A;  1WM3 A;  5MPO A;  1KTK A;  1I42 A;  3P42 A;  1L6V A;  4NQL B;  4DHZ E;  4UDU C;  4TMA B;  4BKS A;  3AED B;  3BVZ A;  1LO5 D;  2NBW B;  3ZJU A;  1JWA D;  2BVC A;  3W1S C;  4MEL A;  1HE8 A;  1F9J A;  2KQS A;  2D07 B;  2OJW A;  3TEX A;  3MFG A;  1GAQ B;  3NVV A;  4DHJ B;  3U4E G;  2PW9 A;  1KOT A;  4PT5 A;  4WWM A;  3ZDT A;  4R3D A;  3BZD B;  3IT6 B;  2INC C;  1SE2 A;  5CHF A;  1J7A A;  3QJZ A;  2G4D B;  4IUM B;  2CKH B;  1IGD A;  1JWB D;  1R4N B;  2KX3 A;  2JY6 A;  3JW0 X;  5FK9 C;  4G50 A;  1SE4 A;  3IBE A;  2WYQ A;  4A20 A;  1TYG B;  3VUX A;  5J17 A;  5AEK B;  2AL6 A;  1GTH A;  2OED A;  4WIP A;  3M63 B;  4RGT A;  4FA6 A;  2CS4 A;  2MJD A;  4K3C A;  2JSV X;  2C7M B;  3R2I A;  1Q5W B;  4GOC A;  2ZJD A;  2JZ3 B;  1M4V A;  4ACF A;  4GGQ A;  4AP4 C;  2AQ2 B;  3A9K B;  4MGK E;  4WH4 A;  4X57 B;  1I4H A;  2JU6 X;  4JLC A;  4KVG B;  3NVY A;  1FFV A;  4BKT A;  3AU5 A;  2LRW A;  1WZ3 A;  3VXW A;  2XBB C;  2KN5 A;  4ARI A;  3M62 B;  3CF4 A;  2W82 A;  1I7H A;  4LJP B;  1WY8 A;  4BBN F;  3MHS D;  1YX6 B;  2GLS A;  2KDB A;  2IYD B;  2LD9 A;  4KGS A;  2XNA C;  4CO7 A;  1E5W A;  4IWO A;  4PS3 A;  3AH7 A;  2DNF A;  4LNI A;  2JZP A;  4TQ1 A;  4DDI D;  3MC8 A;  4IWP A;  5T8I A;  1KRH A;  3VH3 B;  3PLV A;  4MDK E;  4YSY B;  2WP9 B;  1Q10 A;  5IN7 A;  1SEB D;  3VTU A;  3H7S A;  3PZD A;  2FID A;  1UBI A;  2IND C;  3EFC A;  4YTP B;  3HUI A;  1XD3 B;  1N6Z A;  3DHH C;  4K1R B;  3VFK A;  1P0R A;  3PO0 A;  2MBB B;  1SE9 A;  4MSM B;  1OQY A;  3JSV A;  1XT9 B;  1NYR A;  4A3O A;  3HVZ A;  4PYU A;  3DVG Y;  1GOZ A;  2RDB C;  3AU4 A;  1G6J A;  3X23 A;  1B9R A;  1UNS A;  1IBX B;  1VZ7 A;  4KDI C;  1SBB B;  1I4P A;  1MVK A;  2LZ6 A;  1H8C A;  1YQ4 B;  1P7F A;  3JSV B;  4BBN C;  3SR6 A;  4OZB A;  3V61 A;  1WRD B;  1FO4 A;  3E56 A;  1OQQ A;  2FCQ A;  3A1Q A;  2HJ8 A;  2ICI A;  1FM0 D;  3BVM A;  3AXC A;  4MH8 A;  1OEY J;  1JCK B;  4GDK A;  4KSL C;  2BF8 B;  2J0M A;  1V6E A;  3S2A A;  4KZ0 A;  2V1Y A;  4HCN B;  2KJH B;  2ZZP B;  4EEW A;  3Q3N C;  1QIL A;  2RDH A;  3ZNZ B;  2G1E A;  3PZ7 A;  1FFU A;  3GP7 A;  2DAF A;  1DGJ A;  1AWD A;  3WA0 A;  3GS2 A;  3QK0 A;  3VH4 B;  1T0R C;  1TJE A;  1WE6 A;  1WFY A;  3W1S A;  1FEH A;  2V0G A;  1XLO A;  1ZPS A;  5BYS A;  3IT4 B;  4HK2 A;  3KLS X;  3KUZ A;  4A55 A;  1FMA D;  3CSF A;  4BVU C;  1JWU D;  2KAN A;  1ISN A;  4W9C A;  4ARC A;  2N7J A;  1CMX B;  2BT6 A;  4J3O D;  1VDV A;  2BS2 B;  1YN4 A;  2FNJ B;  2K8H A;  3H7P B;  3GE3 C;  4XE0 A;  1QOG A;  3RYT A;  1SIJ A;  3R8B A;  1RRB A;  1J7C A;  2JVC A;  2MEK A;  1RFK A;  4WWO A;  5TR5 A;  3ZTD A;  4LNK A;  1TKY A;  4P1B C;  1C79 A;  4A3P A;  4E74 A;  2L7R A;  1LQB A;  4MM3 A;  5D2M B;  3EC8 A;  4A9A A;  4M00 A;  3CIR B;  1E8X A;  3DCG A;  1SF0 A;  3P4Q B;  3Q2A C;  3L0W B;  4E71 A;  1WGD A;  1PGX A;  1I35 A;  4WJO A;  2ON8 A;  1T3Q A;  2LHD A;  3DBR I;  3I5J C;  4MJS A;  1H4R A;  2UWQ A;  2WXQ A;  1L2N A;  2ZVO A;  2KTF A;  1ZGU B;  4M8N A;  5BO4 B;  1F0Z A;  3Q69 A;  2VRR B;  2CJO A;  2M56 B;  2AWT A;  1TS4 A;  1RWS A;  4S0R A;  3U30 A;  3DVN U;  4WWN A;  1F52 A;  3IAS 1;  5GXG B;  5JH5 C;  3DVG X;  5C2T B;  3QCA A;  1ZDV A;  3ETR A;  2KVR A;  2IO3 B;  2UYZ B;  2WXL A;  1EU3 A;  4DWF A;  1WXM A;  2N9K A;  2W9N A;  3N32 A;  3Q8F A;  4FJY A;  3NRZ A;  3H6N A;  1GC7 A;  3RMK C;  3T9L A;  2DAJ A;  2MBO A;  4OW0 A;  1N5W A;  2H88 B;  1QLB B;  4TSS A;  3DPD A;  3Q3O C;  1VJK A;  2C60 A;  2D11 A;  3H1U A;  5TSS A;  2HD5 B;  2IJ0 A;  3C19 A;  2W3S A;  2KJR A;  3ZVV A;  2MBE A;  2V9H A;  2WX0 A;  2R61 A;  1D3Z A;  1QT9 A;  4LTU A;  5DPS A;  1GB1 A;  1FIQ A;  1YJ1 A;  4JPS A;  4FJZ A;  3SFE B;  1FRD A;  3R7Q A;  3ZO5 B;  2EMS A;  3L10 B;  3KVF B;  4DXA B;  2WNM A;  1TTN A;  3ZKJ C;  3ZIM A;  4EUT A;  4RH6 A;  1V49 A;  1I4Q A;  4GXB A;  3T8M A;  4C4V A;  3WIM A;  4KV2 A;  2BKF A;  3VDZ A;  2N4F A;  1NDD A;  2OHF A;  4YSZ B;  5CTR C;  1SJE D;  4ITK A;  4HWI B;  4JE3 B;  1YJI A;  1V80 A;  2KDM A;  2Y5B B;  2JXX A;  4IWQ A;  2VH1 A;  2WLB A;  4XWT A;  4P6V F;  1E6E B;  3IFW B;  1T6B X;  1WZ0 A;  4IM3 A;  3GZN I;  1NEN B;  2UU7 A;  2W55 A;  4ZYS A;  2JX5 A;  3MHZ A;  3N20 C;  1FXI A;  4C4V B;  4RF1 A;  1WX7 A;  3DBH B;  1WGG A;  1FXA A;  2EKI A;  3RNB C;  2N7D A;  2V3P A;  3NUH B;  5AZH A;  5AUI A;  4I6L B;  2LMC A;  1N60 A;  3AE9 B;  2L1A A;  1WGR A;  4AQ7 A;  5G5H A;  4L2Y A;  4WJN A;  2RMM A;  4ANU A;  1WMH A;  1MG4 A;  3Q8E A;  1V9J A;  3MJW A;  3NS8 A;  5CHV C;  1ET6 A;  5JHA A;  2WDR B;  1M94 A;  2N1V A;  4URK A;  5D3I B;  3NZ3 A;  4JX1 C;  3QX1 A;  5KHQ A;  1SXT A;  3K9O B;  1WXA A;  2KLG A;  1WJ6 A;  4AUQ C;  3K9P B;  1WIA A;  5G2N A;  1L0V B;  3SD5 A;  3DOW A;  1UD7 A;  3RNG C; 
#chains in the Genus database with same CATH homology
 4RGM A;  2OED A;  2HDE A;  2EEL A;  4WIP A;  4RGT A;  3VR9 B;  2GRI A;  1TKG A;  2MJD A;  1C4P A;  2JSV X;  4ZHP A;  5BMI A;  3R2I A;  3H8H A;  2YEP B;  1XCT L;  3AEG B;  4GDL B;  4KKI A;  1V1P A;  2ZW1 A;  1EWY C;  4OZA A;  1CZP A;  1ROE A;  1YN3 A;  1M4V A;  2FE8 A;  2BYT A;  4IOI E;  4MAC A;  3OWE B;  2AQ2 B;  1YQ3 B;  3LYY A;  3P63 A;  1HQR D;  4WH4 A;  4DXF A;  1I4H A;  2DWQ A;  2JU6 X;  3NS1 A;  5HHD G;  2RPV A;  1TY0 A;  2QSD A;  3U52 E;  3N9Y C;  1MHH E;  1C4C A;  5BYQ A;  5HFY A;  1SJH D;  1FFV A;  3NVY A;  5AUK A;  3KWV A;  2JXT A;  2LGI A;  4ZOH C;  1TS3 A;  2IDY A;  2BTE A;  1FCC C;  3T3O A;  2JYE A;  1V1P B;  3IXS A;  1XCQ L;  4ARI A;  3CF4 A;  2W82 A;  1I7H A;  4A90 A;  4KGS A;  3AB5 A;  2WXF A;  2XNA C;  3DWG C;  1YJJ A;  3TEZ A;  2BS3 B;  1ZDX A;  5C3J B;  3AH7 A;  3UI3 A;  1TS5 A;  4HRS A;  2JZP A;  1VZ8 A;  4TQ1 A;  4C7Z A;  1KLG D;  5T8I A;  4DQO C;  1KRH A;  3HRD D;  2INP E;  1IGC A;  4XWW A;  3BWU D;  4AS1 A;  5HI1 A;  4YSY B;  2WP9 B;  1Q10 A;  3TEY A;  1TS2 A;  4ZRQ A;  2I38 A;  1SEB D;  1C76 A;  2WXJ A;  1D5X C;  3LXF A;  3AE3 B;  2Y3A A;  4RGN A;  1H7X A;  3NVW A;  4N6E B;  1K51 A;  2SAK A;  3P4S B;  1QOA A;  4YTP B;  2V3N A;  3HUI A;  3Q8A A;  1WSP A;  5EE1 A;  1H7W A;  5D3D A;  1J7B A;  3PO0 A;  2KQ4 X;  2M19 A;  4P16 A;  4XDD A;  3T3N A;  2AQ1 B;  1R7S A;  2D5G A;  2H89 B;  1E7P B;  2KAJ A;  2WU2 B;  2V4I B;  3ZYY X;  3BK2 A;  3URY A;  3FAH A;  1DOY A;  2WDQ B;  3VRA B;  1C78 A;  3AM9 A;  2DYM A;  1HXY D;  1YNT E;  3VRB B;  1NYR A;  4H2A A;  1FNV A;  3HVZ A;  4M0W A;  1WGK A;  3P4P B;  3ZGZ A;  1V1O A;  2GB1 A;  1XLN A;  5E6J A;  1GPX A;  4B0E A;  1GOZ A;  4LLG M;  5BMH A;  2IGG A;  4JWS C;  1UWM A;  1QOF A;  1B9R A;  4NAW B;  2FBW B;  1A70 A;  2QIL A;  1BXT A;  1UNS A;  1IBX B;  1VZ7 A;  1CJE A;  2BBC A;  2JQR B;  4YSX B;  1SBB B;  1I4P A;  1MVK A;  2N0S B;  2Z8L A;  1MPE A;  1SSN A;  1YQ4 B;  1P7F A;  4KKJ A;  1JAL A;  2NMQ A;  3KWL A;  3AE8 B;  1L0X B;  3B9J A;  4YTM B;  3SR6 A;  1L5P A;  3ZJV A;  4OZB A;  3VR8 B;  1YMH E;  1ZXH A;  1FO4 A;  1T5X D;  3Q8C A;  3B2F A;  3E56 A;  2QJL A;  2KMM A;  1KF6 B;  2WS3 B;  1OQQ A;  3AN1 A;  2ICI A;  2W3R A;  2L32 A;  1C77 A;  1FM0 D;  1SE3 A;  3BVM A;  5FKA C;  1PYW D;  3LB8 C;  1WYG A;  4MH8 A;  1JCK B;  3B2G A;  3SFD B;  2BW2 A;  5H8Y E;  1ESF A;  4WAF A;  2XN9 C;  5EE3 A;  1PDX A;  3TEW A;  3CWI A;  3NVZ A;  3AEB B;  3U2S C;  1BUI C;  1UWX A;  2J52 A;  3AE4 B;  1ZXI A;  1QOB A;  4L1B A;  4YWG G;  1QIL A;  2RDH A;  2G1E A;  5I4D A;  3PZ7 A;  4D2K A;  3V05 A;  3EGR A;  1FFU A;  1WRI A;  1OQR A;  2E3T A;  2QIE B;  3GP7 A;  1Y56 A;  1DGJ A;  1FRR A;  4TQ0 A;  1AWD A;  1HZ6 A;  3GS2 A;  1TJE A;  4YT0 B;  3W1S A;  2PLP A;  2K0P A;  1FEH A;  2WXH A;  3FIL A;  2HTM E;  2V0G A;  1XLO A;  1ZPS A;  5BYS A;  3IT4 B;  4XDC A;  3BYT B;  5FR3 A;  3KLS X;  3O13 A;  1MHX A;  4WUR A;  2W54 A;  4CQN A;  4A55 A;  3U7Z A;  1FMA D;  1F2R I;  4C7Y A;  2LJI A;  3MP9 A;  2K9X A;  4B0M A;  1JWU D;  1D5Z C;  2K5P A;  1F2R C;  2INN E;  4WQM A;  4ARC A;  4IKG A;  3V3X A;  2MJE A;  2SEB D;  2JWU A;  4C56 C;  1DYQ A;  2PIA A;  3R2T A;  1JWM D;  2N7J A;  3RPF C;  2BT6 A;  1E10 A;  4J3O D;  4OHJ A;  2J53 A;  1VRA B;  1DOI A;  1VDV A;  3TUO A;  2BS2 B;  1YN4 A;  2WXG A;  2WXM A;  1NYQ A;  1YN5 A;  3J9C A;  1IUE A;  4XE0 A;  1QOG A;  2VZK B;  3GB1 A;  1SB3 C;  1SIJ A;  2MJ3 A;  1D6E C;  3C8Y A;  3R8B A;  3ZQ4 A;  1J7C A;  3IAM 1;  5H92 C;  2MEK A;  3BYY B;  1RFK A;  4RCO A;  2KWD A;  1TKY A;  1NI3 A;  1HEZ E;  1C79 A;  2B76 B;  3AEC B;  2IGH A;  2NTT A;  1JML A;  2J42 A;  4ZHO A;  3HVD A;  3MJ5 A;  3MC0 B;  1ZOY B;  4A9A A;  3CIR B;  1DOX A;  1SF0 A;  3ZJT A;  3P4Q B;  1ENF A;  1JRO A;  1PGX A;  1EM7 A;  2ON8 A;  1T3Q A;  2LHD A;  2BS4 B;  1N5X A;  1VLB A;  1PUT A;  2WXQ A;  2GI9 A;  1RYJ A;  4OVZ A;  5G5G A;  2AQ3 B;  4NZL B;  1TKE A;  3AV8 A;  1AN8 A;  1I4G A;  1F0Z A;  3Q69 A;  4RNA A;  2WXI A;  1VZ6 A;  4KX6 B;  1HA5 A;  1KH0 A;  2PVG C;  1QF6 A;  2K3U A;  1GTE A;  2CJO A;  4RF0 A;  2DBY A;  1UGJ A;  2M56 B;  1WWT A;  1P7E A;  1FNW A;  2JYT A;  1FCL A;  2Y5P A;  2DLB A;  1TS4 A;  2KAC A;  1RWS A;  4NAM A;  1RM6 C;  4IDI A;  2E6X A;  4HRO A;  1FD6 A;  1XXG A;  1ZUD 2;  2QEJ C;  3Q8B A;  3IAS 1;  2ACZ B;  1VR9 A;  5GXG B;  5C2T B;  3AE1 B;  4EE2 A;  1ZDV A;  1NEK B;  3ETR A;  1WXQ A;  2Y5C A;  2WXL A;  1EU3 A;  4JWU C;  2WXP A;  4A6Q A;  2N9K A;  4HEA 1;  2IPK D;  1ZE3 D;  3Q8F A;  2PVO D;  1K50 A;  1XEE A;  3NRZ A;  2LEK A;  2MH7 A;  2LFI A;  1HZ5 A;  4OW0 A;  2WXO A;  1D5M C;  3W2D A;  3WCQ A;  4OZC A;  1E9M A;  4HKQ A;  3KQ4 A;  1F77 A;  1KLU D;  1ZP0 B;  2WXN A;  4NJC A;  4US9 A;  4L23 A;  2LHE A;  1N5W A;  3ABV B;  2H88 B;  2PMV A;  5EE0 A;  1C4A A;  1I4X A;  2L52 A;  1QLB B;  1GB4 A;  3FC4 A;  4TSS A;  2WXK A;  2BB6 A;  3EA6 A;  2ONQ A;  1JRP A;  1VJK A;  2G9H D;  3AE2 B;  2ZW0 A;  3EUB 2;  5TSS A;  1JWS D;  2IJ0 A;  3AEE B;  2W3S A;  1B1Z A;  1N62 A;  1E0Z A;  1BML C;  2AX5 A;  4O1N A;  1FNU A;  1L4D B;  3AE5 B;  3P1M A;  4KGR A;  1CQV A;  4GDK B;  3AEA B;  3AEF B;  2R61 A;  1QT9 A;  4LTU A;  1XLQ A;  1PGB A;  2BB5 A;  1TY2 A;  2KN4 A;  4YTN B;  2VZK D;  3W5V B;  1GB1 A;  1FIQ A;  4JPS A;  2WU5 B;  5BYR A;  1TZO A;  4C80 A;  3SFE B;  1FRD A;  5EE9 A;  4US8 A;  2QMT A;  1XF5 L;  2FUG 1;  4REZ A;  3DWM A;  3TSS A;  2L83 A;  4DXG A;  1V8C A;  2WNM A;  1AW7 A;  5D7G A;  1MI0 A;  2K22 A;  1QKZ A;  1KFY B;  1OFF A;  5LNK 1;  1N63 A;  4N58 A;  4MT5 A;  1K52 A;  4RH6 A;  2DYO A;  2WDV B;  5JXV A;  3E9S A;  5BMG A;  1STE A;  4KGT A;  3FIL B;  3AE6 B;  1I4Q A;  3VQI A;  2CJN A;  3W9C B;  1AYF A;  4N59 A;  1XO3 A;  1V97 A;  2WXR A;  2OHF A;  2IGD A;  1ET9 A;  4Q2J A;  4YSZ B;  2X38 A;  3W5U B;  1NVI D;  2RDG A;  4YXD B;  1SJE D;  4ITK A;  3AE7 B;  4JE3 B;  4LK0 M;  1YJI A;  1L6U A;  2KDM A;  2Q5W D;  1JQ4 A;  5MPO A;  2M0A A;  2NTS A;  1KTK A;  2LUM A;  3BK1 A;  3P42 A;  1CK1 A;  1L6V A;  2WLB A;  4XWT A;  4P6V F;  1E6E B;  4UDU C;  4TMA B;  1T6B X;  1IBX A;  2CU3 A;  2J4X A;  1JW9 D;  4HKZ E;  3AED B;  3BVZ A;  1LO5 D;  1NEN B;  2PKO A;  4ZYS A;  2W55 A;  2JX5 A;  3AMZ A;  3MHZ A;  1UUP A;  3SEB A;  1FXI A;  2WQY B;  4RF1 A;  1PGA A;  3ZJU A;  1JWA D;  1K53 A;  1FXA A;  3I57 A;  3L4P A;  2EKI A;  2PTL A;  5HG2 A;  3TEX A;  2V3P A;  3NUH B;  1N61 A;  3MFG A;  5AUI A;  3P4R B;  1GAQ B;  4RGO S;  3NVV A;  4FXC A;  4HJG E;  3RFZ B;  2LMC A;  2TSS A;  2YEP F;  1N60 A;  2I2Y A;  3AE9 B;  2L1A A;  3U4E G;  1ACC A;  2PW9 A;  4GLS C;  1GT8 A;  2N9L A;  4AQ7 A;  1L4Z B;  1D4B A;  4MM3 B;  4L2Y A;  5G5H A;  4PT5 A;  2RMM A;  1EU4 A;  4WWM A;  3Q8E A;  4USA A;  3PZ8 A;  4R3D A;  3BZD B;  3IT6 B;  1I4R A;  1PFD A;  1SE2 A;  1J7A A;  1EWC A;  1ET6 A;  4RFB A;  4ZRP A;  2WDR B;  4A8X C;  3BII D;  5D3I B;  3NZ3 A;  4JX1 C;  1QQR A;  1XLP A;  1IGD A;  1JWB D;  5FK9 C;  1SXT A;  1SE4 A;  3I9V 1;  1C9F A;  3BVG A;  1L0V B;  1TYG B;  1L0Y B;  1GTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...