1ZP0B

Crystal structure of mitochondrial respiratory complex ii bound with 3-nitropropionate and 2-thenoyltrifluoroacetone
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-binding protein
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 59
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1zp0B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zp0B01
1YQ4B 3AE9B 1KFYB 3AEGB 1T3QA 2H88B 1I7HA 3HUIA 1OQQA 1E10A 3CIRB 1VLBA 2G1EA 2H89B 1ZOYB 3AE1B 3P4PB 4YTMB 3AE4B 3AE2B 1IUEA 1ZUD2 2MJ3A 2OHFA 1TYGB 1JWAD 4N6EB 2QIEB 2QJLA 2PIAA 1DOXA 1GAQB 1L5PA 1J7AA 4P6VF 1CJEA 1J7BA 1N5WA 3P63A 4WWMA 3B2FA 2KMMA 1L6VA 1RYJA 3ABVB 3NS1A 1PFDA 3AE6B 3AECB 1N60A 1TJEA 3KWLA 2Y5CA 1JWBD 4YT0B 1N5XA 1FO4A 3P4SB 1R7SA 3NVVA 4C7YA 3DWMA 2M56B 3NVYA 1A70A 4KX6B 1WWTA 2JX5A 1FFUA 1E0ZA 4YSZB 4LTUA 2K22A 2K5PA 1XLOA 1DGJA 1JRPA 3AB5A 2WDRB 5C2TB 1GPXA 1L6UA 1NYQA 2DWQA 2N0SB 1PDXA 1YQ3B 5H8YE 1FM0D 4ZOHC 3CWIA 3L4PA 4C80A 4YXDB 3B2GA 1QOBA 1FXAA 1J7CA 2ACZB 1FFVA 3AEFB 4ITKA 1JW9D 4YTNB 1N61A 4YSXB 1V97A 1FIQA 2CU3A 3VR9B 2CJOA 3SFDB 1ROEA 3SFEB 1ZXIA 2WS3B 1E9MA 1NVID 2WLBA 3AEDB 1TKGA 1JALA 1VJKA 4USAA 5AUKA 5C3JB 3ETRA 5H92C 5G5GA 1FXIA 4N59A 3AV8A 2Q5WD 5AUIA 2E3TA 5EE3A 2MJEA 1V8CA 5EE1A 3CF4A 4A9AA 1F0ZA 1E6EB 1KRHA 2HTME 1RWSA 3FC4A 2EKIA 3P1MA 3HVZA 1UWMA 1XO3A 3VRBB 3AE8B 1YJIA 5G5HA 3AH7A 3VR8B 1N62A 4WQMA 1AWDA 3SR6A 3AE7B 1YJJA 3AMZA 1JROA 1WGKA 1DOYA 1NYRA 2W54A 4JWUC 2K9XA 2M19A 1FRDA 2BS3B 3AM9A 1SB3C 1QOAA 2L83A 4ZHPA 1B9RA 2BS2B 3ZYYX 1XLQA 2WDQB 3P4RB 2DBYA 1RFKA 1N63A 3LXFA 3WCQA 1QOFA 3RPFC 4JX1C 1QT9A 2MH7A 4YSYB 1ZP0B 1NI3A 2PKOA 2MJDA 3NVZA 4HRSA 4JWSC 1WRIA 2KAJA 2WP9B 2WU5B 3P4QB 5EE0A 5EE9A 3HRDD 1GTEA 2L52A 1TKEA 4HROA 5GXGB 2BS4B 1OFFA 3EUB2 4IDIA 4N58A 1SIJA 1XLPA 2W55A 1EWYC 1VDVA 2PVOD 2W3RA 3W5VB 4FXCA 1NENB 2WQYB 1QOGA 1XLNA 1QLBB 2B76B 1GTHA 3AEAB 3AE3B 2JQRB 3B9JA 2LEKA 1H7XA 3VRAB 1L0VB 1NEKB 3AE5B 1RM6C 2PVGC 1OQRA 1KF6B 2WU2B 3AEBB 1GT8A 1AYFA 2BT6A 1WYGA 1WXQA 1PUTA 1JQ4A 4US9A 5MPOA 3W9CB 1CZPA 1SF0A 3FAHA 3W5UB 1FRRA 4ZHOA 2W3SA 1QF6A 1TKYA 3AN1A 1H7WA 2AX5A 3NRZA 1DOIA 2FBWB 3PO0A 2WDVB 2CJNA 1E7PB 1FMAD 3LB8C 3BIID 4US8A 4YTPB 3NVWA 3DWGC 4C7ZA 3AEEB
chains in the Genus database with same CATH superfamily
1JRUA 5FR6A 1SJHD 1TS2A 4ASWC 1JMLA 4TV3A 1Z2MA 1WMHB 2BYVE 3BY4B 5D7GA 2K6DB 2Y5CA 4YT0B 1N5XA 2KJHB 3NY5A 3H6NA 3ZJTA 3NVYA 1YX6B 1WWTA 2K0PA 3RNFC 3RULA 3RNBC 2WXRA 2IDYA 3KUCB 2JZPA 2O2VB 4XC2A 5E6NA 2L1AA 4OVZA 3VTWA 1KJTA 2DYOA 3H8HA 1N61A 3CSFA 2JZ3B 4YSXB 3DHHC 2D10A 4USAA 2HDEA 4C4VA 3ETRA 5D6JB 3UGBB 1ZXHA 3PS6A 2NPTB 1C78A 3VH4B 3GE8C 1MVKA 4XWWA 3Q8AA 1OEYA 1WR1A 3L16A 2J0JA 5DPSA 4KSLC 4K7UA 2BS2B 2K8HA 1WXMA 3WCQA 4MH8A 2MX2A 1ZE3D 2JF5A 4KKIA 3HIZA 2KAJA 5EE9A 2KD0A 1MI0A 1TGZB 4AJYB 5HKHA 3DBSA 1DYQA 2PVOD 4BKGA 3WALA 2LMCA 2LASA 2J52A 2LD9A 5CHWA 2NVUI 1NEKB 3R3MA 1OQRA 2LZ6A 1WX8A 1MG4A 3AU5A 2J4XA 3QK0A 1R4MI 2CR5A 5AZHA 1VZ8A 4OZAA 1UNSA 4ZRPA 1V81A 4KGSA 3QIJA 1GB4A 4US8A 2M4NA 4C7ZA 2YEPB 1YJJA 4B9KA 2E6XA 5D94A 1UUPA 3WAMA 4XWTA 2D11A 3WAPA 5FKAC 3NJTA 2KX0A 3O13A 3AECB 4IM2A 4KDLB 1JWBD 1K50A 1E0ZA 3AXCA 1QILA 2J0MA 2L05A 4JE3B 1L6UA 3R7RA 4ZOHC 4C4VB 1CMXB 3AEFB 1FCLA 2D3AA 4YTNB 4JPSA 1V97A 3ENEA 1E90A 1TKGA 2KVZA 1UH6A 5EE3A 2WXHA 2K3UA 4A9AA 3Q8EA 4G0NB 1VD2A 1ESFA 3PRZA 3L0WB 4W9DA 1UD7A 4ICVA 4W9LA 3ZYYX 3UF8A 4NQKE 2AWTA 1VCBA 1PGXA 3RPFC 4RGTA 1V1OA 5HFYA 4JX1C 4OZBA 5IO9A 2PE6B 1NI3A 1ZP0B 3R8BA 1I42A 3V6EB 2VZKB 4FADA 2Z8LA 1VZ7A 3SD5A 4EZLA 4M8MA 3BYTB 2ZCCA 1GTHA 1WE6A 1ISNA 3UINB 1D6EC 1TT5B 1B1ZA 2V3PA 3IBEA 3FAHA 1QF6A 1GUAB 1H7WA 1TZ1A 2C5LC 3RNEC 2N7JA 1L2NA 1UELA 3AEEB 3V6CB 3HM6X 4EFOA 2CHXA 3W2DA 1TYGB 5CHVC 4LLGM 1P1AA 4WWMA 2KMMA 4HK2A 4F8CB 2KANA 2B3AA 2K5PA 4HPMB 4GGQA 1GPXA 2K8CA 1GB1A 3TIXA 4L2YA 2HD5B 1P7FA 3ZLZA 4JL9A 4YWGG 2WXGA 1NVID 2WDTB 3U30A 2LGSA 2KQ4X 2KWDA 4FLHA 1FNWA 3N32A 2VZKD 1F1HA 4LDTD 2ZNVC 3HVZA 4OVVA 3AE8B 1XT9B 1GOZA 1WH3A 5AZFA 1SEBD 2LGXA 1FEHA 2MLBA 2IO3B 2W54A 2K9XA 4E74A 2FIFA 4QAYA 1LXDA 4I6PA 3ZTDA 2RGFA 2BYFA 4PS8A 1UGMA 1RAXA 4PS7A 4M01A 5E6OA 2PEAA 2L52A 1ENFA 1K52A 1IP9A 2BS4B 4KIKA 4LJOB 1EU4A 4J6IA 5DPTA 3VTUA 3TEXA 3U2SC 1WX7A 3N1XC 3AEBB 3BK1A 3ECIA 4IUMB 3KVFB 2XK5A 3N1ZC 4W9JA 3BVGA 4NAMA 1D4BA 3NOBA 1MJDA 2UU7A 3T3NA 1L4ZB 1V5OA 1JWSD 4RM8A 4WWOA 3GB1A 2G4DB 1ZUD2 3QCAA 2EMSA 3DHIC 2L8JA 4FBJB 1KLGD 1OQYA 2O6VA 1YMHE 4ZYNA 3D32A 5D3IB 4RNAA 4MGZE 2C9WB 1FFUA 5AZGA 2Z0EB 2JVCA 1RFAA 4R3DA 2WDRB 1LQBA 5HHDG 1IPGA 2BF8B 1UGJA 4GOCA 2ZW0A 2WHIA 4II3B 2PJHA 4KSKC 3SFDB 1E9MA 1GJZA 3OG5A 2BKRB 2R2QA 4KGTA 3PZ7A 1WGHA 5FR3A 3J9CA 1SE9A 2JRIB 2PLPA 4MDKE 3W1SA 3N1YC 2L7RA 4ZRQA 1KLVA 1XO3A 4GDLA 1ZDVA 3Q2AC 1TS3A 3AM9A 3ML8A 1NI2A 1N63A 4MGKE 2VH2A 4KGRA 4KIKB 3ZUNA 2KC1A 1IYFA 2MA9B 3C8YA 2R2OA 3SEBA 2LUEA 2KOXA 3TBLD 1FD6A 2JQRB 2IGHA 3AE5B 1RM6C 2XK5B 1XCQL 4IG7B 2MP2A 5MPOA 3DDCB 2KXJA 1FRRA 1TKYA 2EELA 3GOEA 5J17A 2WDVB 2UYZB 4RGNA 4YTPB 4EUTA 3ZRCA 2O6VB 4B0MA 5TR5A 3VXWA 3I9V1 4HKQA 2RDHA 2IZVB 2LVPA 1CJEA 1QZEA 1V49A 2M0XA 3P63A 2LVQA 2J7QB 5CX3A 3ABVB 5LLIA 3N20C 1SGHA 3U7ZA 4ZDVA 2NCNA 1XLOA 3GZNB 4GU2A 2MBEA 3VVWB 1QKZA 4BOZB 2W82A 3N3KB 4GIVA 2BWFA 3MC0B 1I4PA 3UQAA 4II2B 2LRWA 1VRAB 4HEA1 5AEKB 2MEKA 2IYDB 2LXCA 4MSMB 4GDLB 3RZWC 2X8XX 3DVGX 4LNIA 4WAAA 1F0ZA 4WAFA 2HTME 5BMGA 2LXAA 4YL8A 5KHOA 4NAWA 3VR8B 1WJ6A 3JSVA 2XN9C 2ZEQA 1EUVB 3PZDA 2WXPA 1QOAA 2KDIA 2FCMA 2N1VA 4TSSA 3RZFA 2DENB 3Q14C 1T0QC 4IM0A 2D5GA 4HRSA 2WGSA 2LGIA 2GOWA 3HRDD 1F52A 3DVNV 4DQOC 2BGFA 4WJNA 1ACCA 2DAFA 1NDDA 2MP2B 4N9F4 2KN5A 2O6VD 2BKFA 4LNKA 1ZGUB 2CHWA 5IA7A 2GB1A 1WYGA 1R4NB 4OW0A 3MHZA 1HXYD 1SE2A 4ZHOA 2WXIA 4GLSC 5E6PA 4FJVB 1ZPSA 2DLBA 3T8MA 3LB8C 2UWQA 3KUDB 1TIFA 1WJNA 4WWPA 1T3QA 1GC6A 2G1EA 2H89B 1WYWB 1YNTE 4N6EB 1L5PA 5BMIA 3JW0X 2EKEC 3NS1A 3IXSA 2LHEA 4C7YA 1EU3A 4IOIE 1A70A 5HG2A 2IO2B 3M95A 1DGJA 1HA5A 2PMVA 1Y8RC 4X57B 5DPWA 3NZ3A 2QILA 1YOVB 3L4PA 2WX0A 3IAS1 3PGEA 2ACZB 4FJZA 1RLFA 3QX1A 2CJOA 4EOYA 4BKSD 3SFEB 2WLBA 4E3CA 4TKNA 1GNUA 4MGIE 3AV8A 3JSVB 4ACFA 4W9CA 3IHPC 2J53A 2EKIA 4I6LB 5CTRC 4UDUC 1M94A 2REXA 3OAWA 3UIPB 2GBJA 1WGDA 2OJWA 4FN2A 3I63C 3P4RB 4BBNF 5KHQA 3WIMA 4K7WA 4AQ7A 2BVCA 3W5VB 3ZNID 2WQYB 2QC8A 3IVFA 2B76B 1IBXA 4KKJA 3MFGA 2NTTA 2BW2A 1F77A 2V1YA 4CO7A 2A5UA 3TCAA 4W9GA 5J2RA 3Q3JA 3W5UB 4DDGD 2KHWB 2L3ZA 2FBWB 2Y5PA 4DK5A 4LNFA 2G3QB 2DYMA 3APCA 1CK1A 2L32A 1VLBA 3LDZE 4HPLB 1JWAD 1DOXA 3I57A 2I1KA 3I5JC 1CQVA 2ASQA 4I6NB 1JRPA 2DX5B 1YN5A 4A3PA 3BK2A 3OWEB 5H8YE 4BOSC 1FPYA 3B2GA 4IWOA 1FXAA 4FA6A 2QCZA 2QSDA 3DBRB 4A20A 4EZKA 2WS3B 4JIOU 5C3JB 1YX5B 3E9SA 2KN4A 3SU8X 3NUHB 5HI1A 1L0XB 3Q8CA 3RN9C 4WJQA 3QWZB 4REZA 4C00A 1D3ZA 1C4AA 4S17A 2YEPF 3B1LX 2BPSA 3KH0A 2KTFA 1Q1OA 3LXFA 4DXFA 3NHEB 1A5RA 2CKHB 2D07B 1WRIA 2DAJA 4W9HA 1IBXB 3ZXRA 1TY0A 4ZRJA 2RD0A 1QOGA 2NBVB 5BYQA 1H7XA 1PGAA 4XYCA 2LI5A 3DQVA 1D5ZC 1PUTA 1P7EA 5LXIB 4FHKA 3L08A 3TUOA 1WRDB 3KYDD 3C19A 1ZW7A 2JXXA 1EO6A 2DZKA 3BIID 2AQ2B 2IO0B 3B08A 3WANA 1UBIA 3HUIA 3ZNZB 1SBBB 3RI7C 2QJLA 3RUIB 3B0AA 3U7DA 4MJSA 3RMKC 2X38A 3A4SC 1I4XA 1H8CA 4LCDE 2KACA 4YSZB 2IGGA 2VRRB 4LTUA 4JQWC 4MEMA 2GBRA 2DNFA 2JYTA 4A55A 4K3BA 3PSEB 5IN7A 3WAOA 2ZJDA 3Q3NC 3QA8A 2K6QA 2V3SA 4NJ6A 3KLSX 4HJGE 2G45B 2Q5WD 5AUIA 1JCKB 4IM3A 2ZPNA 3FC4A 2WXQA 2MBQA 1TBEA 1V9JA 1WXVA 2AYOB 2WXNA 3TSSA 2M19A 3ZVVA 2IPKD 4A3OA 4NY0A 1HZ5A 1QOFA 3Q8FA 2ZVOA 1K53A 2XEWA 5JHAA 1LGRA 2ONQA 3BINA 5LNK1 4PS3A 2W55A 1F2RC 1MHHE 1WIAA 1C9FA 2L0FA 4GN1A 4ZRIA 3VRAB 3Q8BA 4TQ0A 3QAQA 1M4VA 2KTRA 2WU2B 2BB6A 2KO3A 1GT8A 4ANWA 1WXQA 1TS4A 3L10B 1C77A 1CZPA 1GC7A 1EWCA 3RNCC 2BTEA 1WM3A 3ZGZA 2KWVB 3QJZA 1C1YB 4O1NA 1FMAD 2EMTA 4WJPA 3DWGC 2JYEA 1HE8A 3JYUA 4MJSB 5JH5C 1KFYB 2H88B 2V9HA 2MJ3A 1ZOYB 1ET6A 4KVGB 2OEDA 2BWES 2PIAA 3WA0A 1YN4A 1WXSA 3H1UA 1RYJA 4HWIB 3KUZA 3M62B 1P9DU 2WXKA 1J19A 2KNBA 3E56A 1EF1A 4BAXA 4TQ1A 2GMIC 4DBGA 4OVUA 4GB9A 2KWUB 1HTOA 2FAZA 1UF0A 4RFBA 4ANUA 5JZEB 2NS5A 1QOBA 2LVOA 2KVRA 2CU3A 3X23A 1PGBA 3ZIMA 1Q10A 3H7PA 5EE1A 5G55A 4M8NA 2BYEA 2AL3A 1RWSA 3TEYA 4AJWA 5D2MB 1UWMA 1WE7A 3VRBB 5FK9C 3ML9A 3P42A 4BVUC 3AMZA 1DOYA 2INNE 3PLVA 1OEYJ 1SB3C 3A1QA 5C1ZA 2FE8A 4Q2JA 2KX3A 3R2IA 2AEHA 1E5WA 2WX1A 2PKOA 2MJDA 4JWSC 2WP9B 3DCGA 4NQLB 1UZXB 2KQ7A 4M0WA 5J18A 2JWZA 1EF5A 3DBLI 2KTRB 3S2AA 1NBFC 3U4EG 1E7VA 1V6EA 2RPVA 3OJ3A 1LFDA 2LEKA 1YN3A 3ZKJC 3CSTA 2WWZA 2WXJA 1YQBA 2Z59B 4IWPA 3DOWA 4EEWA 3FILA 1OGWA 4XE0A 3BWUD 2NBUA 1P98A 4K81A 4L23A 3NVWA 1K51A 4PYUA 2Z0DB 1OQQA 3A9JA 1E10A 2JRHA 5BYSA 1Z5SB 4URKA 1QQRA 5BYRA 1F9JA 3P4SB 4KX6B 4RF0A 2BBCA 3VFKA 2K22A 2DHZA 2MBOA 3L17A 1IGDA 5C2TB 2ZPYA 2N0SB 2JT4B 4ANXA 1FM0D 2N9XA 4MH0E 4ITKA 1UBQA 3H7PB 5E6JA 3U8ZA 3EC8A 2J42A 1WI0A 3VHTC 5G5GA 1TTNA 1V8CA 3V3XA 2XNAC 1KRHA 4LNNA 1I4GA 5C23A 2XBBC 3A1QB 3KYCD 3PPAA 3AE7B 1JROA 1YJ1A 1I4QA 4EE2A 3KW5B 1WR6E 4AOFA 4AUQC 1RFKA 4M0WB 3QHTA 2KFJA 1I4HA 1D5MC 2MH7A 2Y3AA 4RM9A 3X0WA 3NVZA 5I4DA 1OTRB 2D3BA 2MHJA 3EFUA 4HCNB 2INDC 4HROA 1SIJA 1EWYC 4AWJA 3ZJVA 1QLBB 3B9JA 3AE3B 1ET9A 3MJWA 3FILB 1V5TA 1L7YA 2KFKA 3W9CB 1U4AA 1SF0A 1T0YA 3ALBA 3PZ8A 2D3CA 2KQSA 2M8SA 1DOIA 2KLCA 3A9JB 2KWCA 1I4RA 4EZJA 1T0RC 3R7QA 4HXDA 5BMHA 1WJ4A 1EM7A 3CIRB 1L4DB 2HJ1A 3PHXB 3KWVA 2MBBB 3RCZA 1WM2A 1T6BX 4P6VF 1L6VA 1MHXA 1C4PA 1X1MA 1IGCA 4NPNA 3EHVA 3DVNU 1LM8B 3A4RA 1C79A 3DBHI 3ZXVA 3DHGC 3LJ3A 4G50A 4D2KA 2GLSA 2N9LA 1NYQA 1SE4A 2LRUA 5IOIA 2M0AA 4DHJB 3L54A 4DHZE 4C80A 3W1SC 5CHFA 1JW9D 3HK0A 2V0GA 2A4ZA 3AEDB 1E8YA 2MJEA 5GMVA 4HKZE 4GMVA 2INPE 3RYTA 5EDSA 2OJRA 1YJIA 1JWUD 2MWSB 3AH7A 1XF5L 2KZRA 3SR6A 2YLMA 2ZCBA 1WGKA 2RR9A 3ZRFA 1SIFA 1T5XD 3MC8A 3EGRA 2KK8A 2K39A 3R66C 3DVGY 2WXOA 2ICIA 2KJRA 4NAWB 1WGRA 4RGOS 3ZNGC 1HTQA 1WX9A 5GXGB 4IDIA 4CYEA 1S1QB 1XLNA 2KFKB 2K25A 4CQNA 1HZ6A 4B0EA 1TZOA 2W9NA 1BUIC 4XX5A 1JQ4A 4FULA 2AQ3B 2FCSA 4RCOA 3LYYA 2KJ6A 3UIOB 1TS5A 2D2QA 5BO4B 1H4RA 4G3XB 1SJED 2MSED 1XQQA 1YD8U 4NJ7A 1MFWA 4L1BA 1YQ4B 3AEGB 2L76A 2V3NA 1I7HA 2WNMA 2PE9A 2MRPA 3ZDTA 3P4PB 3AE4B 4BFRA 3SHQA 2I38A 4MACA 4DHJD 1SXTA 4LK0M 1J7BA 3B2FA 4HPPA 3W1YA 4B95A 1TJEA 1FO4A 1KH0A 2KYWA 3NVVA 4PYZA 5G2NA 2WXLA 1FNUA 4AS1A 4PK1A 4BBNC 1YQ3B 2JZZA 4HCPB 3IT6B 1FFVA 3QARA 1R4MB 2K1FA 2ZZPB 5TSSA 3TMPB 1VJKA 5AUKA 4MM3A 3VUYA 4WIPA 4A6QA 1FXIA 1V1PA 2E3TA 4P16A 3AULA 1BXTA 2N9KA 5DPRA 2MQJA 2JUOA 3ZDMC 3ZO5B 1AWDA 2QEJC 1AARA 1E7UA 4M02A 5IKCM 1WGGA 3ZQ4A 2WDQB 2GI9A 2QMTA 1J8CA 2KDFB 2BYTA 4ARIA 1WY8A 1P0RA 2N9EB 1GTEA 1Q0WB 4E71A 1VDVA 1VZ6A 3IAM1 3GP7A 4MGYE 4PT5A 2NTSA 2PTLA 2FNJB 4H2AA 1Q5WB 4J3OD 4ZRKA 3ZTCA 1MPEA 3R2TA 1WZ0A 2RPQA 3DBRI 4G11A 2ZW1A 2AX5A 3NRZA 2SAKA 2LGDA 1E7PB 5L83A 1WXAA 1C4CA 3PV1A 3AE9B 1G6JA 2QDFA 1KOTA 4MT5A 3UQBA 2QIEB 1WSPA 3EECA 1GG3A 3O65B 3VTVA 4RH6A 3AE6B 1N60A 4FHJA 3APFA 2L00B 2N7DA 3DWMA 2JX5A 2FCNA 2V4IB 3BYYB 4CHKA 4ZYSA 2JXTA 2RDGA 2C7HA 4HLEA 2BQQA 2G4SA 4MM3B 3BZDB 3V60A 1V1PB 3RFZB 3U52E 1KLUD 2LHDA 4DDID 1UWXA 1N6ZA 1K8RB 1FIQA 3DPDA 2RSUA 2C7NB 2Y5BB 2K8BA 4N59A 4LDTB 1WGYA 2NMQA 1E6EB 1KTKA 2FIDA 2MW5A 4W9EA 1N62A 1C76A 2PPHA 2ZNVB 2HTHA 2V4LA 2L83A 2GBMA 2IY1B 2DBYA 4KZ0A 3RNGC 1F2RI 4IWQA 1SE3A 1HQRD 2KDBA 3A33B 3TL5A 3EFCA 3EUB2 3BVMA 2W3RA 3TJPA 4FXCA 2FUG1 4JLCA 4DXAB 1WFYA 3V62A 1Y56A 3I3TB 2IY0B 2KMAA 1WF9A 4LJPB 1AYFA 2AL6A 1SSNA 2KMCA 3K9PB 5LXHA 4DWFA 2G9HD 1BT0A 1MG8A 4FJYA 2W3SA 2DZMA 2ZVNA 1V86A 1XXGA 1ZDXA 1TY2A 2FCQA 2CHZA 4DXGA 2DZJA 2LJIA 3MJ5A 4ARCA 5L95C 1E8XA 2KDEB 3QQ8B 2KLGA 3PRPB 4YTMB 3Q69A 3PREA 2MCNB 4P1BC 4DHZB 4OZCA 4GSWA 1PFDA 3KWLA 1R7SA 3VDZA 1WZ3A 3P2BA 4A90A 3PVLA 3NZUA 3PHWB 3CWIA 2GBKA 1FXTB 4IC7B 5JHBA 3VR9B 3ONSA 3FKYA 2JSVX 1PYWD 2KDMA 2D3GA 4WURA 3CF4A 1E8ZA 3IG3A 3AU4A 4K7SA 5G5HA 2N7EA 1NYRA 3MC9A 2L0TA 1XLQA 3T9LA 3UI3A 3K9OB 2NR2A 2C7MB 4HDOA 3SDLC 4YSYB 3H7SA 2BB5A 4TUUA 3C0RB 3V61A 2WU5B 3NS8A 5EE0A 4RMAA 3NG0A 4B6WA 2MBHA 2KT7A 4WQOB 2GBNA 1VR9A 1XLPA 3Q3MC 2VH1A 3A9KA 3PLUA 5JXVA 2C60A 4MSQB 1L0VB 4IW0A 4F1SA 3VQIA 1KF6B 2HE7A 2BT6A 4ANVA 1XD3B 3PTFC 1BMLC 2WYQA 2DYBA 5T8IA 3ZJUA 3DBLB 3MTNB 2OOBB 4LNOA 2FUHB 3GS2A 2I2YA 3N30A 3L13A 1E8WA 2JWUA 2LJ5A 1FNVA 4XZ4A 3AE1B 1IUEA 3JVZX 1C3TA 2GRIA 4HDQA 1LO5D 4GXBA 3Q3FA 1N5WA 4BKTA 2PW9A 3VUXA 3M3JA 4IKGA 4KDIC 1AN8A 2R61A 2DZIA 2CU1A 3AI5A 4XDDA 4M00A 2N1WA 1P3QU 2YVCA 2IJ0A 1ZXIA 3T3OA 1JALA 4XDCA 3VH3B 3IFWB 4C56C 3RNAC 3HM3A 4BKSA 1HEZE 4JGHB 4HVBA 3HVDA 2INCC 1YIWA 2AQ1B 3M63B 3P1MA 3RT3B 5DCNA 4F7ZA 3IT4B 4WQMA 3ZW3A 3H9DA 2BS3B 1D5XC 3BVZA 4ZHPA 2IBIB 1QT9A 4GDKA 2N4FA 4RGMA 3A9KB 3P4QB 2KKCA 4K3CA 4OHJA 4N58A 1B9RA 3RD2A 4NNJB 3Q6BA 4HJKA 2PVGC 1KM7A 2LUMA 3Q3OC 2NBWB 3MHSD 4US9A 1V2YA 3URYA 1AW7A 3ZNHB 3PT2B 3PO0A 2CJNA 2M17A 4P7IA 3GZNI 2M1MA 1RRBA 4A8XC 4TMAB 4W9KA 2OHFA 2WXFA 3AE2B 4K1RB 2N9PC 4AP4C 1FCCC 1GAQB 1J7AA 1WJUA 2LGYA 2JY6A 3APDA 2M56B 3N9YC 4KV2A 5D3DA 2RMMA 1WMHA 3AB5A 2TSSA 1XEEA 3HHMA 1ZKHA 4ICUA 1JWMD 2DWQA 1PDXA 2IGDA 3OJ4B 1L0YB 3MP9A 4YXDB 3KQ4A 1J7CA 4W9IA 2O2VA 2SEBD 1ROEA 2IO1B 5H92C 3DBHB 2JPHA 4W9FA 1S3SG 3V05A 3CF6E 2I1JA 4WH4A 3VUWA 2LFIA 1I35A 3PRMB 5IP4D 4S0RA 4NJCA 1J0GA 4JWUC 1FRDA 2NPTA 4GDKB 2CS4A 3TEZA 1STEA 4RF1A 1R4NI 4BZAA 3NZSA 3EA6A 1PQSA 2LWPA 2ON8A 1TKEA 4P1CC 2JU6X 1OFFA 3OLMD 3TEWA 4EKUA 1NENB 3AEAB 2KC2A 4NZLB 4WJOA 4MELA 2QHOA 3GE3C 3VAWA 2RDBC 4KZCA 3QC8B 1V80A 2HJ8A 3AN1A 2WXMA 3CMMB 4WWNA 5IAAC 1T0SC 2J0KA 4XGAB 1XCTL
chains in the Genus database with same CATH topology
3AE9B 1KFYB 4B0MA 2H88B 1SJHD 4MT5A 2MJ3A 1ZOYB 2QIEB 1TS2A 3I9V1 1ET6A 1WSPA 1JMLA 4HKQA 2RDHA 2OEDA 2PIAA 1CJEA 1YN4A 3P63A 4RH6A 1RYJA 3ABVB 5D7GA 3AE6B 1N60A 2Y5CA 4YT0B 1N5XA 3U7ZA 2WXKA 3DWMA 3ZJTA 3NVYA 1WWTA 2K0PA 2JX5A 3E56A 2V4IB 1XLOA 3BYYB 4ZYSA 2WXRA 4TQ1A 2IDYA 1QKZA 2JZPA 2JXTA 2W82A 2L1AA 2RDGA 4RFBA 4OVZA 4MM3B 3BZDB 1QOBA 1V1PB 3RFZB 3MC0B 3U52E 1KLUD 1I4PA 2LHDA 2DYOA 3H8HA 1UWXA 1N61A 4YSXB 1FIQA 2CU3A 1VRAB 4HEA1 4USAA 2HDEA 2MEKA 1PGBA 3ETRA 4N59A 1Q10A 4GDLB 1ZXHA 5EE1A 2NMQA 1F0ZA 4WAFA 1E6EB 1KTKA 2HTME 5BMGA 1RWSA 3TEYA 1UWMA 3VRBB 1C78A 3VR8B 1N62A 3P42A 5FK9C 2XN9C 3AMZA 1DOYA 1C76A 1MVKA 3Q8AA 4XWWA 2INNE 2WXPA 1SB3C 1QOAA 2L83A 2BS2B 4TSSA 2FE8A 4Q2JA 2DBYA 3R2IA 3WCQA 1F2RI 4MH8A 1ZE3D 1HQRD 1SE3A 2D5GA 4KKIA 2PKOA 4HRSA 2MJDA 4JWSC 2KAJA 2WP9B 5EE9A 2LGIA 3HRDD 1MI0A 4M0WA 3EUB2 1DYQA 3BVMA 3U4EG 2W3RA 2PVOD 2LMCA 4DQOC 4FXCA 2FUG1 1ACCA 2J52A 2RPVA 1Y56A 2LEKA 1YN3A 1NEKB 1OQRA 2WXJA 1AYFA 1WYGA 2GB1A 2J4XA 1SSNA 4OW0A 2G9HD 3MHZA 1HXYD 1SE2A 4ZHOA 2W3SA 1VZ8A 3FILA 1XXGA 1ZDXA 1UNSA 4OZAA 4XE0A 1TY2A 3BWUD 2WXIA 4GLSC 4DXGA 4ZRPA 1ZPSA 2DLBA 4KGSA 1GB4A 2LJIA 3LB8C 4US8A 4L23A 3NVWA 3MJ5A 1K51A 4C7ZA 2YEPB 1YJJA 4ARCA 1T3QA 2E6XA 1OQQA 1E10A 2G1EA 2H89B 1UUPA 4YTMB 3Q69A 1YNTE 4XWTA 4N6EB 5BYSA 1L5PA 4OZCA 5FKAC 1QQRA 5BMIA 3O13A 3NS1A 5BYRA 3IXSA 1PFDA 3AECB 2LHEA 3KWLA 1JWBD 3P4SB 1R7SA 4C7YA 1EU3A 4IOIE 1K50A 1A70A 4KX6B 4RF0A 2BBCA 5HG2A 1E0ZA 2K22A 1QILA 1IGDA 1DGJA 4A90A 1HA5A 5C2TB 4JE3B 1L6UA 2PMVA 2N0SB 3NZ3A 1FM0D 2QILA 4ZOHC 3CWIA 3L4PA 3IAS1 2ACZB 3AEFB 4ITKA 1FCLA 4YTNB 4JPSA 1V97A 5E6JA 3VR9B 2CJOA 3SFEB 2J42A 2WLBA 1TKGA 2JSVX 1PYWD 5G5GA 3AV8A 2KDMA 5EE3A 2WXHA 1V8CA 4WURA 3CF4A 2K3UA 4A9AA 3V3XA 2XNAC 1KRHA 3Q8EA 2J53A 1I4GA 2EKIA 5G5HA 1ESFA 3AE7B 4UDUC 1JROA 1NYRA 1I4QA 4EE2A 3ZYYX 1XLQA 3P4RB 3UI3A 1RFKA 1PGXA 3RPFC 4RGTA 1V1OA 5HFYA 4JX1C 4OZBA 1I4HA 1D5MC 2MH7A 2Y3AA 5I4DA 4YSYB 1ZP0B 1NI3A 3NVZA 3R8BA 2VZKB 2BB5A 2Z8LA 2WU5B 5EE0A 4HROA 1VR9A 1VZ7A 1SIJA 1XLPA 4AQ7A 1EWYC 3W5VB 2WQYB 3BYTB 3ZJVA 1QLBB 2B76B 1GTHA 3AE3B 3B9JA 5JXVA 4KKJA 1IBXA 1L0VB 1ET9A 3MFGA 2NTTA 2BW2A 3FILB 3VQIA 1KF6B 1F77A 1D6EC 2BT6A 1B1ZA 3W9CB 2V3PA 1SF0A 3FAHA 3W5UB 1BMLC 1QF6A 5T8IA 3ZJUA 3PZ8A 1H7WA 1DOIA 3GS2A 2FBWB 2Y5PA 1I4RA 2I2YA 2N7JA 2JWUA 1FNVA 2DYMA 3AEEB 5BMHA 1CK1A 2L32A 1EM7A 3CIRB 1L4DB 1VLBA 3AE1B 1IUEA 3KWVA 3W2DA 2GRIA 1TYGB 1JWAD 1LO5D 1DOXA 1T6BX 3I57A 4LLGM 4P6VF 1N5WA 4WWMA 2KMMA 1L6VA 1MHXA 2PW9A 1C4PA 1IGCA 4IKGA 1C79A 1CQVA 1AN8A 2K5PA 1JRPA 4D2KA 2N9LA 1YN5A 1GPXA 1NYQA 1SE4A 2R61A 3BK2A 1GB1A 3OWEB 2M0AA 4L2YA 5H8YE 1P7FA 4C80A 3B2GA 4XDDA 1FXAA 4YWGG 2QSDA 1JW9D 2IJ0A 2V0GA 2WXGA 1ZXIA 2WS3B 1NVID 3T3OA 3AEDB 1JALA 4XDCA 5C3JB 4C56C 3E9SA 2KN4A 1HEZE 2KQ4X 2KWDA 2MJEA 3HVDA 4HKZE 1FNWA 2INPE 3NUHB 2VZKD 2AQ1B 5HI1A 1L0XB 3Q8CA 3P1MA 3HVZA 4REZA 1YJIA 1JWUD 3AE8B 3IT4B 1GOZA 1XF5L 3AH7A 4WQMA 1SEBD 3SR6A 1FEHA 1WGKA 2W54A 2K9XA 1T5XD 2BS3B 1D5XC 1C4AA 3BVZA 4ZHPA 3EGRA 2YEPF 4DXFA 3LXFA 2WXOA 2ICIA 1QT9A 4RGMA 1WRIA 3P4QB 4NAWB 1IBXB 4RGOS 3DWGC 2L52A 4OHJA 1ENFA 1K52A 5GXGB 2BS4B 1TY0A 4IDIA 4N58A 1B9RA 1QOGA 1XLNA 4CQNA 1EU4A 1HZ6A 5BYQA 3TEXA 1H7XA 1PGAA 3U2SC 2PVGC 4B0EA 1TZOA 1BUIC 3AEBB 1D5ZC 2LUMA 3BK1A 1PUTA 1P7EA 4US9A 1JQ4A 2AQ3B 4RCOA 3URYA 3LYYA 1AW7A 3TUOA 1TS5A 3BVGA 4NAMA 1D4BA 3PO0A 1SJED 2CJNA 3BIID 3T3NA 2AQ2B 1L4ZB 4L1BA 1YQ4B 3HUIA 3AEGB 1JWSD 2V3NA 1I7HA 2WNMA 4A8XC 4TMAB 3GB1A 3P4PB 1ZUD2 2OHFA 3AE4B 3AE2B 1SBBB 2WXFA 2I38A 4MACA 1KLGD 2QJLA 1FCCC 1GAQB 1J7AA 1SXTA 4LK0M 1J7BA 1YMHE 3B2FA 5D3IB 1TJEA 4RNAA 2X38A 1FO4A 1KH0A 1I4XA 3NVVA 2M56B 3N9YC 1FFUA 2KACA 4YSZB 2IGGA 4LTUA 2RMMA 5D3DA 2WXLA 1FNUA 4AS1A 3AB5A 2TSSA 4R3DA 2WDRB 1XEEA 2JYTA 1JWMD 2DWQA 5HHDG 4A55A 1PDXA 1YQ3B 1UGJA 2IGDA 1L0YB 3MP9A 4YXDB 2ZW0A 3KQ4A 3IT6B 1J7CA 1FFVA 2SEBD 3KLSX 3SFDB 5TSSA 1ROEA 1E9MA 4HJGE 5H92C 1VJKA 5AUKA 4WIPA 4A6QA 1FXIA 1V1PA 4KGTA 2Q5WD 5AUIA 2E3TA 1JCKB 3PZ7A 4P16A 3V05A 5FR3A 1BXTA 4WH4A 3J9CA 2LFIA 2N9KA 2PLPA 3W1SA 3FC4A 2WXQA 4ZRQA 1XO3A 1ZDVA 1AWDA 4NJCA 2WXNA 1TS3A 2QEJC 4JWUC 3TSSA 2M19A 3AM9A 1FRDA 2IPKD 4GDKB 3ZQ4A 2WDQB 2GI9A 2QMTA 3TEZA 1N63A 1HZ5A 1STEA 1QOFA 3Q8FA 4RF1A 4KGRA 1K53A 2BYTA 4ARIA 1GTEA 2ON8A 3EA6A 3C8YA 2ONQA 1TKEA 3SEBA 5LNK1 2JU6X 1OFFA 3TEWA 2W55A 1VDVA 1VZ6A 3IAM1 1NENB 1F2RC 1MHHE 3GP7A 1C9FA 1FD6A 4PT5A 3AEAB 2JQRB 2NTSA 2IGHA 2PTLA 4NZLB 4H2AA 3VRAB 3Q8BA 3AE5B 1RM6C 4TQ0A 1M4VA 4J3OD 2WU2B 2BB6A 1GT8A 1XCQL 1MPEA 1WXQA 1TS4A 3R2TA 5MPOA 1C77A 1CZPA 1FRRA 1TKYA 3AN1A 2WXMA 1EWCA 2ZW1A 2EELA 2BTEA 2AX5A 3NRZA 2SAKA 2WDVB 3ZGZA 4RGNA 1E7PB 4O1NA 1FMAD 4YTPB 1C4CA 2JYEA 1XCTL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ4 B;  3AE9 B;  1KFY B;  3AEG B;  1T3Q A;  2H88 B;  1I7H A;  3HUI A;  1OQQ A;  1E10 A;  3CIR B;  1VLB A;  2G1E A;  2H89 B;  1ZOY B;  3AE1 B;  3P4P B;  4YTM B;  3AE4 B;  3AE2 B;  1IUE A;  1ZUD 2;  2MJ3 A;  2OHF A;  1TYG B;  1JWA D;  4N6E B;  2QIE B;  2QJL A;  2PIA A;  1DOX A;  1GAQ B;  1L5P A;  1J7A A;  4P6V F;  1CJE A;  1J7B A;  1N5W A;  3P63 A;  4WWM A;  3B2F A;  2KMM A;  1L6V A;  1RYJ A;  3ABV B;  3NS1 A;  1PFD A;  3AE6 B;  3AEC B;  1N60 A;  1TJE A;  3KWL A;  2Y5C A;  1JWB D;  4YT0 B;  1N5X A;  1FO4 A;  3P4S B;  1R7S A;  3NVV A;  4C7Y A;  3DWM A;  2M56 B;  3NVY A;  1A70 A;  4KX6 B;  1WWT A;  2JX5 A;  1FFU A;  1E0Z A;  4YSZ B;  4LTU A;  2K22 A;  2K5P A;  1XLO A;  1DGJ A;  1JRP A;  3AB5 A;  2WDR B;  5C2T B;  1GPX A;  1L6U A;  1NYQ A;  2DWQ A;  2N0S B;  1PDX A;  1YQ3 B;  5H8Y E;  1FM0 D;  4ZOH C;  3CWI A;  3L4P A;  4C80 A;  4YXD B;  3B2G A;  1QOB A;  1FXA A;  1J7C A;  2ACZ B;  1FFV A;  3AEF B;  4ITK A;  1JW9 D;  4YTN B;  1N61 A;  4YSX B;  1V97 A;  1FIQ A;  2CU3 A;  3VR9 B;  2CJO A;  3SFD B;  1ROE A;  3SFE B;  1ZXI A;  2WS3 B;  1E9M A;  1NVI D;  2WLB A;  3AED B;  1TKG A;  1JAL A;  1VJK A;  4USA A;  5AUK A;  5C3J B;  3ETR A;  5H92 C;  5G5G A;  1FXI A;  4N59 A;  3AV8 A;  2Q5W D;  5AUI A;  2E3T A;  5EE3 A;  2MJE A;  1V8C A;  5EE1 A;  3CF4 A;  4A9A A;  1F0Z A;  1E6E B;  1KRH A;  2HTM E;  1RWS A;  3FC4 A;  2EKI A;  3P1M A;  3HVZ A;  1UWM A;  1XO3 A;  3VRB B;  3AE8 B;  1YJI A;  5G5H A;  3AH7 A;  3VR8 B;  1N62 A;  4WQM A;  1AWD A;  3SR6 A;  3AE7 B;  1YJJ A;  3AMZ A;  1JRO A;  1WGK A;  1DOY A;  1NYR A;  2W54 A;  4JWU C;  2K9X A;  2M19 A;  1FRD A;  2BS3 B;  3AM9 A;  1SB3 C;  1QOA A;  2L83 A;  4ZHP A;  1B9R A;  2BS2 B;  3ZYY X;  1XLQ A;  2WDQ B;  3P4R B;  2DBY A;  1RFK A;  1N63 A;  3LXF A;  3WCQ A;  1QOF A;  3RPF C;  4JX1 C;  1QT9 A;  2MH7 A;  4YSY B;  1ZP0 B;  1NI3 A;  2PKO A;  2MJD A;  3NVZ A;  4HRS A;  4JWS C;  1WRI A;  2KAJ A;  2WP9 B;  2WU5 B;  3P4Q B;  5EE0 A;  5EE9 A;  3HRD D;  1GTE A;  2L52 A;  1TKE A;  4HRO A;  5GXG B;  2BS4 B;  1OFF A;  3EUB 2;  4IDI A;  4N58 A;  1SIJ A;  1XLP A;  2W55 A;  1EWY C;  1VDV A;  2PVO D;  2W3R A;  3W5V B;  4FXC A;  1NEN B;  2WQY B;  1QOG A;  1XLN A;  1QLB B;  2B76 B;  1GTH A;  3AEA B;  3AE3 B;  2JQR B;  3B9J A;  2LEK A;  1H7X A;  3VRA B;  1L0V B;  1NEK B;  3AE5 B;  1RM6 C;  2PVG C;  1OQR A;  1KF6 B;  2WU2 B;  3AEB B;  1GT8 A;  1AYF A;  2BT6 A;  1WYG A;  1WXQ A;  1PUT A;  1JQ4 A;  4US9 A;  5MPO A;  3W9C B;  1CZP A;  1SF0 A;  3FAH A;  3W5U B;  1FRR A;  4ZHO A;  2W3S A;  1QF6 A;  1TKY A;  3AN1 A;  1H7W A;  2AX5 A;  3NRZ A;  1DOI A;  2FBW B;  3PO0 A;  2WDV B;  2CJN A;  1E7P B;  1FMA D;  3LB8 C;  3BII D;  4US8 A;  4YTP B;  3NVW A;  3DWG C;  4C7Z A;  3AEE B; 
#chains in the Genus database with same CATH topology
 1JRU A;  5FR6 A;  1SJH D;  1TS2 A;  4ASW C;  1JML A;  4TV3 A;  1Z2M A;  1WMH B;  2BYV E;  3BY4 B;  5D7G A;  2K6D B;  2Y5C A;  4YT0 B;  1N5X A;  2KJH B;  3NY5 A;  3H6N A;  3ZJT A;  3NVY A;  1YX6 B;  1WWT A;  2K0P A;  3RNF C;  3RUL A;  3RNB C;  2WXR A;  2IDY A;  3KUC B;  2JZP A;  2O2V B;  4XC2 A;  5E6N A;  2L1A A;  4OVZ A;  3VTW A;  1KJT A;  2DYO A;  3H8H A;  1N61 A;  3CSF A;  2JZ3 B;  4YSX B;  3DHH C;  2D10 A;  4USA A;  2HDE A;  4C4V A;  3ETR A;  5D6J B;  3UGB B;  1ZXH A;  3PS6 A;  2NPT B;  1C78 A;  3VH4 B;  3GE8 C;  1MVK A;  4XWW A;  3Q8A A;  1OEY A;  1WR1 A;  3L16 A;  2J0J A;  5DPS A;  4KSL C;  4K7U A;  2BS2 B;  2K8H A;  1WXM A;  3WCQ A;  4MH8 A;  2MX2 A;  1ZE3 D;  2JF5 A;  4KKI A;  3HIZ A;  2KAJ A;  5EE9 A;  2KD0 A;  1MI0 A;  1TGZ B;  4AJY B;  5HKH A;  3DBS A;  1DYQ A;  2PVO D;  4BKG A;  3WAL A;  2LMC A;  2LAS A;  2J52 A;  2LD9 A;  5CHW A;  2NVU I;  1NEK B;  3R3M A;  1OQR A;  2LZ6 A;  1WX8 A;  1MG4 A;  3AU5 A;  2J4X A;  3QK0 A;  1R4M I;  2CR5 A;  5AZH A;  1VZ8 A;  4OZA A;  1UNS A;  4ZRP A;  1V81 A;  4KGS A;  3QIJ A;  1GB4 A;  4US8 A;  2M4N A;  4C7Z A;  2YEP B;  1YJJ A;  4B9K A;  2E6X A;  5D94 A;  1UUP A;  3WAM A;  4XWT A;  2D11 A;  3WAP A;  5FKA C;  3NJT A;  2KX0 A;  3O13 A;  3AEC B;  4IM2 A;  4KDL B;  1JWB D;  1K50 A;  1E0Z A;  3AXC A;  1QIL A;  2J0M A;  2L05 A;  4JE3 B;  1L6U A;  3R7R A;  4ZOH C;  4C4V B;  1CMX B;  3AEF B;  1FCL A;  2D3A A;  4YTN B;  4JPS A;  1V97 A;  3ENE A;  1E90 A;  1TKG A;  2KVZ A;  1UH6 A;  5EE3 A;  2WXH A;  2K3U A;  4A9A A;  3Q8E A;  4G0N B;  1VD2 A;  1ESF A;  3PRZ A;  3L0W B;  4W9D A;  1UD7 A;  4ICV A;  4W9L A;  3ZYY X;  3UF8 A;  4NQK E;  2AWT A;  1VCB A;  1PGX A;  3RPF C;  4RGT A;  1V1O A;  5HFY A;  4JX1 C;  4OZB A;  5IO9 A;  2PE6 B;  1NI3 A;  1ZP0 B;  3R8B A;  1I42 A;  3V6E B;  2VZK B;  4FAD A;  2Z8L A;  1VZ7 A;  3SD5 A;  4EZL A;  4M8M A;  3BYT B;  2ZCC A;  1GTH A;  1WE6 A;  1ISN A;  3UIN B;  1D6E C;  1TT5 B;  1B1Z A;  2V3P A;  3IBE A;  3FAH A;  1QF6 A;  1GUA B;  1H7W A;  1TZ1 A;  2C5L C;  3RNE C;  2N7J A;  1L2N A;  1UEL A;  3AEE B;  3V6C B;  3HM6 X;  4EFO A;  2CHX A;  3W2D A;  1TYG B;  5CHV C;  4LLG M;  1P1A A;  4WWM A;  2KMM A;  4HK2 A;  4F8C B;  2KAN A;  2B3A A;  2K5P A;  4HPM B;  4GGQ A;  1GPX A;  2K8C A;  1GB1 A;  3TIX A;  4L2Y A;  2HD5 B;  1P7F A;  3ZLZ A;  4JL9 A;  4YWG G;  2WXG A;  1NVI D;  2WDT B;  3U30 A;  2LGS A;  2KQ4 X;  2KWD A;  4FLH A;  1FNW A;  3N32 A;  2VZK D;  1F1H A;  4LDT D;  2ZNV C;  3HVZ A;  4OVV A;  3AE8 B;  1XT9 B;  1GOZ A;  1WH3 A;  5AZF A;  1SEB D;  2LGX A;  1FEH A;  2MLB A;  2IO3 B;  2W54 A;  2K9X A;  4E74 A;  2FIF A;  4QAY A;  1LXD A;  4I6P A;  3ZTD A;  2RGF A;  2BYF A;  4PS8 A;  1UGM A;  1RAX A;  4PS7 A;  4M01 A;  5E6O A;  2PEA A;  2L52 A;  1ENF A;  1K52 A;  1IP9 A;  2BS4 B;  4KIK A;  4LJO B;  1EU4 A;  4J6I A;  5DPT A;  3VTU A;  3TEX A;  3U2S C;  1WX7 A;  3N1X C;  3AEB B;  3BK1 A;  3ECI A;  4IUM B;  3KVF B;  2XK5 A;  3N1Z C;  4W9J A;  3BVG A;  4NAM A;  1D4B A;  3NOB A;  1MJD A;  2UU7 A;  3T3N A;  1L4Z B;  1V5O A;  1JWS D;  4RM8 A;  4WWO A;  3GB1 A;  2G4D B;  1ZUD 2;  3QCA A;  2EMS A;  3DHI C;  2L8J A;  4FBJ B;  1KLG D;  1OQY A;  2O6V A;  1YMH E;  4ZYN A;  3D32 A;  5D3I B;  4RNA A;  4MGZ E;  2C9W B;  1FFU A;  5AZG A;  2Z0E B;  2JVC A;  1RFA A;  4R3D A;  2WDR B;  1LQB A;  5HHD G;  1IPG A;  2BF8 B;  1UGJ A;  4GOC A;  2ZW0 A;  2WHI A;  4II3 B;  2PJH A;  4KSK C;  3SFD B;  1E9M A;  1GJZ A;  3OG5 A;  2BKR B;  2R2Q A;  4KGT A;  3PZ7 A;  1WGH A;  5FR3 A;  3J9C A;  1SE9 A;  2JRI B;  2PLP A;  4MDK E;  3W1S A;  3N1Y C;  2L7R A;  4ZRQ A;  1KLV A;  1XO3 A;  4GDL A;  1ZDV A;  3Q2A C;  1TS3 A;  3AM9 A;  3ML8 A;  1NI2 A;  1N63 A;  4MGK E;  2VH2 A;  4KGR A;  4KIK B;  3ZUN A;  2KC1 A;  1IYF A;  2MA9 B;  3C8Y A;  2R2O A;  3SEB A;  2LUE A;  2KOX A;  3TBL D;  1FD6 A;  2JQR B;  2IGH A;  3AE5 B;  1RM6 C;  2XK5 B;  1XCQ L;  4IG7 B;  2MP2 A;  5MPO A;  3DDC B;  2KXJ A;  1FRR A;  1TKY A;  2EEL A;  3GOE A;  5J17 A;  2WDV B;  2UYZ B;  4RGN A;  4YTP B;  4EUT A;  3ZRC A;  2O6V B;  4B0M A;  5TR5 A;  3VXW A;  3I9V 1;  4HKQ A;  2RDH A;  2IZV B;  2LVP A;  1CJE A;  1QZE A;  1V49 A;  2M0X A;  3P63 A;  2LVQ A;  2J7Q B;  5CX3 A;  3ABV B;  5LLI A;  3N20 C;  1SGH A;  3U7Z A;  4ZDV A;  2NCN A;  1XLO A;  3GZN B;  4GU2 A;  2MBE A;  3VVW B;  1QKZ A;  4BOZ B;  2W82 A;  3N3K B;  4GIV A;  2BWF A;  3MC0 B;  1I4P A;  3UQA A;  4II2 B;  2LRW A;  1VRA B;  4HEA 1;  5AEK B;  2MEK A;  2IYD B;  2LXC A;  4MSM B;  4GDL B;  3RZW C;  2X8X X;  3DVG X;  4LNI A;  4WAA A;  1F0Z A;  4WAF A;  2HTM E;  5BMG A;  2LXA A;  4YL8 A;  5KHO A;  4NAW A;  3VR8 B;  1WJ6 A;  3JSV A;  2XN9 C;  2ZEQ A;  1EUV B;  3PZD A;  2WXP A;  1QOA A;  2KDI A;  2FCM A;  2N1V A;  4TSS A;  3RZF A;  2DEN B;  3Q14 C;  1T0Q C;  4IM0 A;  2D5G A;  4HRS A;  2WGS A;  2LGI A;  2GOW A;  3HRD D;  1F52 A;  3DVN V;  4DQO C;  2BGF A;  4WJN A;  1ACC A;  2DAF A;  1NDD A;  2MP2 B;  4N9F 4;  2KN5 A;  2O6V D;  2BKF A;  4LNK A;  1ZGU B;  2CHW A;  5IA7 A;  2GB1 A;  1WYG A;  1R4N B;  4OW0 A;  3MHZ A;  1HXY D;  1SE2 A;  4ZHO A;  2WXI A;  4GLS C;  5E6P A;  4FJV B;  1ZPS A;  2DLB A;  3T8M A;  3LB8 C;  2UWQ A;  3KUD B;  1TIF A;  1WJN A;  4WWP A;  1T3Q A;  1GC6 A;  2G1E A;  2H89 B;  1WYW B;  1YNT E;  4N6E B;  1L5P A;  5BMI A;  3JW0 X;  2EKE C;  3NS1 A;  3IXS A;  2LHE A;  4C7Y A;  1EU3 A;  4IOI E;  1A70 A;  5HG2 A;  2IO2 B;  3M95 A;  1DGJ A;  1HA5 A;  2PMV A;  1Y8R C;  4X57 B;  5DPW A;  3NZ3 A;  2QIL A;  1YOV B;  3L4P A;  2WX0 A;  3IAS 1;  3PGE A;  2ACZ B;  4FJZ A;  1RLF A;  3QX1 A;  2CJO A;  4EOY A;  4BKS D;  3SFE B;  2WLB A;  4E3C A;  4TKN A;  1GNU A;  4MGI E;  3AV8 A;  3JSV B;  4ACF A;  4W9C A;  3IHP C;  2J53 A;  2EKI A;  4I6L B;  5CTR C;  4UDU C;  1M94 A;  2REX A;  3OAW A;  3UIP B;  2GBJ A;  1WGD A;  2OJW A;  4FN2 A;  3I63 C;  3P4R B;  4BBN F;  5KHQ A;  3WIM A;  4K7W A;  4AQ7 A;  2BVC A;  3W5V B;  3ZNI D;  2WQY B;  2QC8 A;  3IVF A;  2B76 B;  1IBX A;  4KKJ A;  3MFG A;  2NTT A;  2BW2 A;  1F77 A;  2V1Y A;  4CO7 A;  2A5U A;  3TCA A;  4W9G A;  5J2R A;  3Q3J A;  3W5U B;  4DDG D;  2KHW B;  2L3Z A;  2FBW B;  2Y5P A;  4DK5 A;  4LNF A;  2G3Q B;  2DYM A;  3APC A;  1CK1 A;  2L32 A;  1VLB A;  3LDZ E;  4HPL B;  1JWA D;  1DOX A;  3I57 A;  2I1K A;  3I5J C;  1CQV A;  2ASQ A;  4I6N B;  1JRP A;  2DX5 B;  1YN5 A;  4A3P A;  3BK2 A;  3OWE B;  5H8Y E;  4BOS C;  1FPY A;  3B2G A;  4IWO A;  1FXA A;  4FA6 A;  2QCZ A;  2QSD A;  3DBR B;  4A20 A;  4EZK A;  2WS3 B;  4JIO U;  5C3J B;  1YX5 B;  3E9S A;  2KN4 A;  3SU8 X;  3NUH B;  5HI1 A;  1L0X B;  3Q8C A;  3RN9 C;  4WJQ A;  3QWZ B;  4REZ A;  4C00 A;  1D3Z A;  1C4A A;  4S17 A;  2YEP F;  3B1L X;  2BPS A;  3KH0 A;  2KTF A;  1Q1O A;  3LXF A;  4DXF A;  3NHE B;  1A5R A;  2CKH B;  2D07 B;  1WRI A;  2DAJ A;  4W9H A;  1IBX B;  3ZXR A;  1TY0 A;  4ZRJ A;  2RD0 A;  1QOG A;  2NBV B;  5BYQ A;  1H7X A;  1PGA A;  4XYC A;  2LI5 A;  3DQV A;  1D5Z C;  1PUT A;  1P7E A;  5LXI B;  4FHK A;  3L08 A;  3TUO A;  1WRD B;  3KYD D;  3C19 A;  1ZW7 A;  2JXX A;  1EO6 A;  2DZK A;  3BII D;  2AQ2 B;  2IO0 B;  3B08 A;  3WAN A;  1UBI A;  3HUI A;  3ZNZ B;  1SBB B;  3RI7 C;  2QJL A;  3RUI B;  3B0A A;  3U7D A;  4MJS A;  3RMK C;  2X38 A;  3A4S C;  1I4X A;  1H8C A;  4LCD E;  2KAC A;  4YSZ B;  2IGG A;  2VRR B;  4LTU A;  4JQW C;  4MEM A;  2GBR A;  2DNF A;  2JYT A;  4A55 A;  4K3B A;  3PSE B;  5IN7 A;  3WAO A;  2ZJD A;  3Q3N C;  3QA8 A;  2K6Q A;  2V3S A;  4NJ6 A;  3KLS X;  4HJG E;  2G45 B;  2Q5W D;  5AUI A;  1JCK B;  4IM3 A;  2ZPN A;  3FC4 A;  2WXQ A;  2MBQ A;  1TBE A;  1V9J A;  1WXV A;  2AYO B;  2WXN A;  3TSS A;  2M19 A;  3ZVV A;  2IPK D;  4A3O A;  4NY0 A;  1HZ5 A;  1QOF A;  3Q8F A;  2ZVO A;  1K53 A;  2XEW A;  5JHA A;  1LGR A;  2ONQ A;  3BIN A;  5LNK 1;  4PS3 A;  2W55 A;  1F2R C;  1MHH E;  1WIA A;  1C9F A;  2L0F A;  4GN1 A;  4ZRI A;  3VRA B;  3Q8B A;  4TQ0 A;  3QAQ A;  1M4V A;  2KTR A;  2WU2 B;  2BB6 A;  2KO3 A;  1GT8 A;  4ANW A;  1WXQ A;  1TS4 A;  3L10 B;  1C77 A;  1CZP A;  1GC7 A;  1EWC A;  3RNC C;  2BTE A;  1WM3 A;  3ZGZ A;  2KWV B;  3QJZ A;  1C1Y B;  4O1N A;  1FMA D;  2EMT A;  4WJP A;  3DWG C;  2JYE A;  1HE8 A;  3JYU A;  4MJS B;  5JH5 C;  1KFY B;  2H88 B;  2V9H A;  2MJ3 A;  1ZOY B;  1ET6 A;  4KVG B;  2OED A;  2BWE S;  2PIA A;  3WA0 A;  1YN4 A;  1WXS A;  3H1U A;  1RYJ A;  4HWI B;  3KUZ A;  3M62 B;  1P9D U;  2WXK A;  1J19 A;  2KNB A;  3E56 A;  1EF1 A;  4BAX A;  4TQ1 A;  2GMI C;  4DBG A;  4OVU A;  4GB9 A;  2KWU B;  1HTO A;  2FAZ A;  1UF0 A;  4RFB A;  4ANU A;  5JZE B;  2NS5 A;  1QOB A;  2LVO A;  2KVR A;  2CU3 A;  3X23 A;  1PGB A;  3ZIM A;  1Q10 A;  3H7P A;  5EE1 A;  5G55 A;  4M8N A;  2BYE A;  2AL3 A;  1RWS A;  3TEY A;  4AJW A;  5D2M B;  1UWM A;  1WE7 A;  3VRB B;  5FK9 C;  3ML9 A;  3P42 A;  4BVU C;  3AMZ A;  1DOY A;  2INN E;  3PLV A;  1OEY J;  1SB3 C;  3A1Q A;  5C1Z A;  2FE8 A;  4Q2J A;  2KX3 A;  3R2I A;  2AEH A;  1E5W A;  2WX1 A;  2PKO A;  2MJD A;  4JWS C;  2WP9 B;  3DCG A;  4NQL B;  1UZX B;  2KQ7 A;  4M0W A;  5J18 A;  2JWZ A;  1EF5 A;  3DBL I;  2KTR B;  3S2A A;  1NBF C;  3U4E G;  1E7V A;  1V6E A;  2RPV A;  3OJ3 A;  1LFD A;  2LEK A;  1YN3 A;  3ZKJ C;  3CST A;  2WWZ A;  2WXJ A;  1YQB A;  2Z59 B;  4IWP A;  3DOW A;  4EEW A;  3FIL A;  1OGW A;  4XE0 A;  3BWU D;  2NBU A;  1P98 A;  4K81 A;  4L23 A;  3NVW A;  1K51 A;  4PYU A;  2Z0D B;  1OQQ A;  3A9J A;  1E10 A;  2JRH A;  5BYS A;  1Z5S B;  4URK A;  1QQR A;  5BYR A;  1F9J A;  3P4S B;  4KX6 B;  4RF0 A;  2BBC A;  3VFK A;  2K22 A;  2DHZ A;  2MBO A;  3L17 A;  1IGD A;  5C2T B;  2ZPY A;  2N0S B;  2JT4 B;  4ANX A;  1FM0 D;  2N9X A;  4MH0 E;  4ITK A;  1UBQ A;  3H7P B;  5E6J A;  3U8Z A;  3EC8 A;  2J42 A;  1WI0 A;  3VHT C;  5G5G A;  1TTN A;  1V8C A;  3V3X A;  2XNA C;  1KRH A;  4LNN A;  1I4G A;  5C23 A;  2XBB C;  3A1Q B;  3KYC D;  3PPA A;  3AE7 B;  1JRO A;  1YJ1 A;  1I4Q A;  4EE2 A;  3KW5 B;  1WR6 E;  4AOF A;  4AUQ C;  1RFK A;  4M0W B;  3QHT A;  2KFJ A;  1I4H A;  1D5M C;  2MH7 A;  2Y3A A;  4RM9 A;  3X0W A;  3NVZ A;  5I4D A;  1OTR B;  2D3B A;  2MHJ A;  3EFU A;  4HCN B;  2IND C;  4HRO A;  1SIJ A;  1EWY C;  4AWJ A;  3ZJV A;  1QLB B;  3B9J A;  3AE3 B;  1ET9 A;  3MJW A;  3FIL B;  1V5T A;  1L7Y A;  2KFK A;  3W9C B;  1U4A A;  1SF0 A;  1T0Y A;  3ALB A;  3PZ8 A;  2D3C A;  2KQS A;  2M8S A;  1DOI A;  2KLC A;  3A9J B;  2KWC A;  1I4R A;  4EZJ A;  1T0R C;  3R7Q A;  4HXD A;  5BMH A;  1WJ4 A;  1EM7 A;  3CIR B;  1L4D B;  2HJ1 A;  3PHX B;  3KWV A;  2MBB B;  3RCZ A;  1WM2 A;  1T6B X;  4P6V F;  1L6V A;  1MHX A;  1C4P A;  1X1M A;  1IGC A;  4NPN A;  3EHV A;  3DVN U;  1LM8 B;  3A4R A;  1C79 A;  3DBH I;  3ZXV A;  3DHG C;  3LJ3 A;  4G50 A;  4D2K A;  2GLS A;  2N9L A;  1NYQ A;  1SE4 A;  2LRU A;  5IOI A;  2M0A A;  4DHJ B;  3L54 A;  4DHZ E;  4C80 A;  3W1S C;  5CHF A;  1JW9 D;  3HK0 A;  2V0G A;  2A4Z A;  3AED B;  1E8Y A;  2MJE A;  5GMV A;  4HKZ E;  4GMV A;  2INP E;  3RYT A;  5EDS A;  2OJR A;  1YJI A;  1JWU D;  2MWS B;  3AH7 A;  1XF5 L;  2KZR A;  3SR6 A;  2YLM A;  2ZCB A;  1WGK A;  2RR9 A;  3ZRF A;  1SIF A;  1T5X D;  3MC8 A;  3EGR A;  2KK8 A;  2K39 A;  3R66 C;  3DVG Y;  2WXO A;  2ICI A;  2KJR A;  4NAW B;  1WGR A;  4RGO S;  3ZNG C;  1HTQ A;  1WX9 A;  5GXG B;  4IDI A;  4CYE A;  1S1Q B;  1XLN A;  2KFK B;  2K25 A;  4CQN A;  1HZ6 A;  4B0E A;  1TZO A;  2W9N A;  1BUI C;  4XX5 A;  1JQ4 A;  4FUL A;  2AQ3 B;  2FCS A;  4RCO A;  3LYY A;  2KJ6 A;  3UIO B;  1TS5 A;  2D2Q A;  5BO4 B;  1H4R A;  4G3X B;  1SJE D;  2MSE D;  1XQQ A;  1YD8 U;  4NJ7 A;  1MFW A;  4L1B A;  1YQ4 B;  3AEG B;  2L76 A;  2V3N A;  1I7H A;  2WNM A;  2PE9 A;  2MRP A;  3ZDT A;  3P4P B;  3AE4 B;  4BFR A;  3SHQ A;  2I38 A;  4MAC A;  4DHJ D;  1SXT A;  4LK0 M;  1J7B A;  3B2F A;  4HPP A;  3W1Y A;  4B95 A;  1TJE A;  1FO4 A;  1KH0 A;  2KYW A;  3NVV A;  4PYZ A;  5G2N A;  2WXL A;  1FNU A;  4AS1 A;  4PK1 A;  4BBN C;  1YQ3 B;  2JZZ A;  4HCP B;  3IT6 B;  1FFV A;  3QAR A;  1R4M B;  2K1F A;  2ZZP B;  5TSS A;  3TMP B;  1VJK A;  5AUK A;  4MM3 A;  3VUY A;  4WIP A;  4A6Q A;  1FXI A;  1V1P A;  2E3T A;  4P16 A;  3AUL A;  1BXT A;  2N9K A;  5DPR A;  2MQJ A;  2JUO A;  3ZDM C;  3ZO5 B;  1AWD A;  2QEJ C;  1AAR A;  1E7U A;  4M02 A;  5IKC M;  1WGG A;  3ZQ4 A;  2WDQ B;  2GI9 A;  2QMT A;  1J8C A;  2KDF B;  2BYT A;  4ARI A;  1WY8 A;  1P0R A;  2N9E B;  1GTE A;  1Q0W B;  4E71 A;  1VDV A;  1VZ6 A;  3IAM 1;  3GP7 A;  4MGY E;  4PT5 A;  2NTS A;  2PTL A;  2FNJ B;  4H2A A;  1Q5W B;  4J3O D;  4ZRK A;  3ZTC A;  1MPE A;  3R2T A;  1WZ0 A;  2RPQ A;  3DBR I;  4G11 A;  2ZW1 A;  2AX5 A;  3NRZ A;  2SAK A;  2LGD A;  1E7P B;  5L83 A;  1WXA A;  1C4C A;  3PV1 A;  3AE9 B;  1G6J A;  2QDF A;  1KOT A;  4MT5 A;  3UQB A;  2QIE B;  1WSP A;  3EEC A;  1GG3 A;  3O65 B;  3VTV A;  4RH6 A;  3AE6 B;  1N60 A;  4FHJ A;  3APF A;  2L00 B;  2N7D A;  3DWM A;  2JX5 A;  2FCN A;  2V4I B;  3BYY B;  4CHK A;  4ZYS A;  2JXT A;  2RDG A;  2C7H A;  4HLE A;  2BQQ A;  2G4S A;  4MM3 B;  3BZD B;  3V60 A;  1V1P B;  3RFZ B;  3U52 E;  1KLU D;  2LHD A;  4DDI D;  1UWX A;  1N6Z A;  1K8R B;  1FIQ A;  3DPD A;  2RSU A;  2C7N B;  2Y5B B;  2K8B A;  4N59 A;  4LDT B;  1WGY A;  2NMQ A;  1E6E B;  1KTK A;  2FID A;  2MW5 A;  4W9E A;  1N62 A;  1C76 A;  2PPH A;  2ZNV B;  2HTH A;  2V4L A;  2L83 A;  2GBM A;  2IY1 B;  2DBY A;  4KZ0 A;  3RNG C;  1F2R I;  4IWQ A;  1SE3 A;  1HQR D;  2KDB A;  3A33 B;  3TL5 A;  3EFC A;  3EUB 2;  3BVM A;  2W3R A;  3TJP A;  4FXC A;  2FUG 1;  4JLC A;  4DXA B;  1WFY A;  3V62 A;  1Y56 A;  3I3T B;  2IY0 B;  2KMA A;  1WF9 A;  4LJP B;  1AYF A;  2AL6 A;  1SSN A;  2KMC A;  3K9P B;  5LXH A;  4DWF A;  2G9H D;  1BT0 A;  1MG8 A;  4FJY A;  2W3S A;  2DZM A;  2ZVN A;  1V86 A;  1XXG A;  1ZDX A;  1TY2 A;  2FCQ A;  2CHZ A;  4DXG A;  2DZJ A;  2LJI A;  3MJ5 A;  4ARC A;  5L95 C;  1E8X A;  2KDE B;  3QQ8 B;  2KLG A;  3PRP B;  4YTM B;  3Q69 A;  3PRE A;  2MCN B;  4P1B C;  4DHZ B;  4OZC A;  4GSW A;  1PFD A;  3KWL A;  1R7S A;  3VDZ A;  1WZ3 A;  3P2B A;  4A90 A;  3PVL A;  3NZU A;  3PHW B;  3CWI A;  2GBK A;  1FXT B;  4IC7 B;  5JHB A;  3VR9 B;  3ONS A;  3FKY A;  2JSV X;  1PYW D;  2KDM A;  2D3G A;  4WUR A;  3CF4 A;  1E8Z A;  3IG3 A;  3AU4 A;  4K7S A;  5G5H A;  2N7E A;  1NYR A;  3MC9 A;  2L0T A;  1XLQ A;  3T9L A;  3UI3 A;  3K9O B;  2NR2 A;  2C7M B;  4HDO A;  3SDL C;  4YSY B;  3H7S A;  2BB5 A;  4TUU A;  3C0R B;  3V61 A;  2WU5 B;  3NS8 A;  5EE0 A;  4RMA A;  3NG0 A;  4B6W A;  2MBH A;  2KT7 A;  4WQO B;  2GBN A;  1VR9 A;  1XLP A;  3Q3M C;  2VH1 A;  3A9K A;  3PLU A;  5JXV A;  2C60 A;  4MSQ B;  1L0V B;  4IW0 A;  4F1S A;  3VQI A;  1KF6 B;  2HE7 A;  2BT6 A;  4ANV A;  1XD3 B;  3PTF C;  1BML C;  2WYQ A;  2DYB A;  5T8I A;  3ZJU A;  3DBL B;  3MTN B;  2OOB B;  4LNO A;  2FUH B;  3GS2 A;  2I2Y A;  3N30 A;  3L13 A;  1E8W A;  2JWU A;  2LJ5 A;  1FNV A;  4XZ4 A;  3AE1 B;  1IUE A;  3JVZ X;  1C3T A;  2GRI A;  4HDQ A;  1LO5 D;  4GXB A;  3Q3F A;  1N5W A;  4BKT A;  2PW9 A;  3VUX A;  3M3J A;  4IKG A;  4KDI C;  1AN8 A;  2R61 A;  2DZI A;  2CU1 A;  3AI5 A;  4XDD A;  4M00 A;  2N1W A;  1P3Q U;  2YVC A;  2IJ0 A;  1ZXI A;  3T3O A;  1JAL A;  4XDC A;  3VH3 B;  3IFW B;  4C56 C;  3RNA C;  3HM3 A;  4BKS A;  1HEZ E;  4JGH B;  4HVB A;  3HVD A;  2INC C;  1YIW A;  2AQ1 B;  3M63 B;  3P1M A;  3RT3 B;  5DCN A;  4F7Z A;  3IT4 B;  4WQM A;  3ZW3 A;  3H9D A;  2BS3 B;  1D5X C;  3BVZ A;  4ZHP A;  2IBI B;  1QT9 A;  4GDK A;  2N4F A;  4RGM A;  3A9K B;  3P4Q B;  2KKC A;  4K3C A;  4OHJ A;  4N58 A;  1B9R A;  3RD2 A;  4NNJ B;  3Q6B A;  4HJK A;  2PVG C;  1KM7 A;  2LUM A;  3Q3O C;  2NBW B;  3MHS D;  4US9 A;  1V2Y A;  3URY A;  1AW7 A;  3ZNH B;  3PT2 B;  3PO0 A;  2CJN A;  2M17 A;  4P7I A;  3GZN I;  2M1M A;  1RRB A;  4A8X C;  4TMA B;  4W9K A;  2OHF A;  2WXF A;  3AE2 B;  4K1R B;  2N9P C;  4AP4 C;  1FCC C;  1GAQ B;  1J7A A;  1WJU A;  2LGY A;  2JY6 A;  3APD A;  2M56 B;  3N9Y C;  4KV2 A;  5D3D A;  2RMM A;  1WMH A;  3AB5 A;  2TSS A;  1XEE A;  3HHM A;  1ZKH A;  4ICU A;  1JWM D;  2DWQ A;  1PDX A;  2IGD A;  3OJ4 B;  1L0Y B;  3MP9 A;  4YXD B;  3KQ4 A;  1J7C A;  4W9I A;  2O2V A;  2SEB D;  1ROE A;  2IO1 B;  5H92 C;  3DBH B;  2JPH A;  4W9F A;  1S3S G;  3V05 A;  3CF6 E;  2I1J A;  4WH4 A;  3VUW A;  2LFI A;  1I35 A;  3PRM B;  5IP4 D;  4S0R A;  4NJC A;  1J0G A;  4JWU C;  1FRD A;  2NPT A;  4GDK B;  2CS4 A;  3TEZ A;  1STE A;  4RF1 A;  1R4N I;  4BZA A;  3NZS A;  3EA6 A;  1PQS A;  2LWP A;  2ON8 A;  1TKE A;  4P1C C;  2JU6 X;  1OFF A;  3OLM D;  3TEW A;  4EKU A;  1NEN B;  3AEA B;  2KC2 A;  4NZL B;  4WJO A;  4MEL A;  2QHO A;  3GE3 C;  3VAW A;  2RDB C;  4KZC A;  3QC8 B;  1V80 A;  2HJ8 A;  3AN1 A;  2WXM A;  3CMM B;  4WWN A;  5IAA C;  1T0S C;  2J0K A;  4XGA B;  1XCT L; 
#chains in the Genus database with same CATH homology
 3AE9 B;  1KFY B;  4B0M A;  2H88 B;  1SJH D;  4MT5 A;  2MJ3 A;  1ZOY B;  2QIE B;  1TS2 A;  3I9V 1;  1ET6 A;  1WSP A;  1JML A;  4HKQ A;  2RDH A;  2OED A;  2PIA A;  1CJE A;  1YN4 A;  3P63 A;  4RH6 A;  1RYJ A;  3ABV B;  5D7G A;  3AE6 B;  1N60 A;  2Y5C A;  4YT0 B;  1N5X A;  3U7Z A;  2WXK A;  3DWM A;  3ZJT A;  3NVY A;  1WWT A;  2K0P A;  2JX5 A;  3E56 A;  2V4I B;  1XLO A;  3BYY B;  4ZYS A;  2WXR A;  4TQ1 A;  2IDY A;  1QKZ A;  2JZP A;  2JXT A;  2W82 A;  2L1A A;  2RDG A;  4RFB A;  4OVZ A;  4MM3 B;  3BZD B;  1QOB A;  1V1P B;  3RFZ B;  3MC0 B;  3U52 E;  1KLU D;  1I4P A;  2LHD A;  2DYO A;  3H8H A;  1UWX A;  1N61 A;  4YSX B;  1FIQ A;  2CU3 A;  1VRA B;  4HEA 1;  4USA A;  2HDE A;  2MEK A;  1PGB A;  3ETR A;  4N59 A;  1Q10 A;  4GDL B;  1ZXH A;  5EE1 A;  2NMQ A;  1F0Z A;  4WAF A;  1E6E B;  1KTK A;  2HTM E;  5BMG A;  1RWS A;  3TEY A;  1UWM A;  3VRB B;  1C78 A;  3VR8 B;  1N62 A;  3P42 A;  5FK9 C;  2XN9 C;  3AMZ A;  1DOY A;  1C76 A;  1MVK A;  3Q8A A;  4XWW A;  2INN E;  2WXP A;  1SB3 C;  1QOA A;  2L83 A;  2BS2 B;  4TSS A;  2FE8 A;  4Q2J A;  2DBY A;  3R2I A;  3WCQ A;  1F2R I;  4MH8 A;  1ZE3 D;  1HQR D;  1SE3 A;  2D5G A;  4KKI A;  2PKO A;  4HRS A;  2MJD A;  4JWS C;  2KAJ A;  2WP9 B;  5EE9 A;  2LGI A;  3HRD D;  1MI0 A;  4M0W A;  3EUB 2;  1DYQ A;  3BVM A;  3U4E G;  2W3R A;  2PVO D;  2LMC A;  4DQO C;  4FXC A;  2FUG 1;  1ACC A;  2J52 A;  2RPV A;  1Y56 A;  2LEK A;  1YN3 A;  1NEK B;  1OQR A;  2WXJ A;  1AYF A;  1WYG A;  2GB1 A;  2J4X A;  1SSN A;  4OW0 A;  2G9H D;  3MHZ A;  1HXY D;  1SE2 A;  4ZHO A;  2W3S A;  1VZ8 A;  3FIL A;  1XXG A;  1ZDX A;  1UNS A;  4OZA A;  4XE0 A;  1TY2 A;  3BWU D;  2WXI A;  4GLS C;  4DXG A;  4ZRP A;  1ZPS A;  2DLB A;  4KGS A;  1GB4 A;  2LJI A;  3LB8 C;  4US8 A;  4L23 A;  3NVW A;  3MJ5 A;  1K51 A;  4C7Z A;  2YEP B;  1YJJ A;  4ARC A;  1T3Q A;  2E6X A;  1OQQ A;  1E10 A;  2G1E A;  2H89 B;  1UUP A;  4YTM B;  3Q69 A;  1YNT E;  4XWT A;  4N6E B;  5BYS A;  1L5P A;  4OZC A;  5FKA C;  1QQR A;  5BMI A;  3O13 A;  3NS1 A;  5BYR A;  3IXS A;  1PFD A;  3AEC B;  2LHE A;  3KWL A;  1JWB D;  3P4S B;  1R7S A;  4C7Y A;  1EU3 A;  4IOI E;  1K50 A;  1A70 A;  4KX6 B;  4RF0 A;  2BBC A;  5HG2 A;  1E0Z A;  2K22 A;  1QIL A;  1IGD A;  1DGJ A;  4A90 A;  1HA5 A;  5C2T B;  4JE3 B;  1L6U A;  2PMV A;  2N0S B;  3NZ3 A;  1FM0 D;  2QIL A;  4ZOH C;  3CWI A;  3L4P A;  3IAS 1;  2ACZ B;  3AEF B;  4ITK A;  1FCL A;  4YTN B;  4JPS A;  1V97 A;  5E6J A;  3VR9 B;  2CJO A;  3SFE B;  2J42 A;  2WLB A;  1TKG A;  2JSV X;  1PYW D;  5G5G A;  3AV8 A;  2KDM A;  5EE3 A;  2WXH A;  1V8C A;  4WUR A;  3CF4 A;  2K3U A;  4A9A A;  3V3X A;  2XNA C;  1KRH A;  3Q8E A;  2J53 A;  1I4G A;  2EKI A;  5G5H A;  1ESF A;  3AE7 B;  4UDU C;  1JRO A;  1NYR A;  1I4Q A;  4EE2 A;  3ZYY X;  1XLQ A;  3P4R B;  3UI3 A;  1RFK A;  1PGX A;  3RPF C;  4RGT A;  1V1O A;  5HFY A;  4JX1 C;  4OZB A;  1I4H A;  1D5M C;  2MH7 A;  2Y3A A;  5I4D A;  4YSY B;  1ZP0 B;  1NI3 A;  3NVZ A;  3R8B A;  2VZK B;  2BB5 A;  2Z8L A;  2WU5 B;  5EE0 A;  4HRO A;  1VR9 A;  1VZ7 A;  1SIJ A;  1XLP A;  4AQ7 A;  1EWY C;  3W5V B;  2WQY B;  3BYT B;  3ZJV A;  1QLB B;  2B76 B;  1GTH A;  3AE3 B;  3B9J A;  5JXV A;  4KKJ A;  1IBX A;  1L0V B;  1ET9 A;  3MFG A;  2NTT A;  2BW2 A;  3FIL B;  3VQI A;  1KF6 B;  1F77 A;  1D6E C;  2BT6 A;  1B1Z A;  3W9C B;  2V3P A;  1SF0 A;  3FAH A;  3W5U B;  1BML C;  1QF6 A;  5T8I A;  3ZJU A;  3PZ8 A;  1H7W A;  1DOI A;  3GS2 A;  2FBW B;  2Y5P A;  1I4R A;  2I2Y A;  2N7J A;  2JWU A;  1FNV A;  2DYM A;  3AEE B;  5BMH A;  1CK1 A;  2L32 A;  1EM7 A;  3CIR B;  1L4D B;  1VLB A;  3AE1 B;  1IUE A;  3KWV A;  3W2D A;  2GRI A;  1TYG B;  1JWA D;  1LO5 D;  1DOX A;  1T6B X;  3I57 A;  4LLG M;  4P6V F;  1N5W A;  4WWM A;  2KMM A;  1L6V A;  1MHX A;  2PW9 A;  1C4P A;  1IGC A;  4IKG A;  1C79 A;  1CQV A;  1AN8 A;  2K5P A;  1JRP A;  4D2K A;  2N9L A;  1YN5 A;  1GPX A;  1NYQ A;  1SE4 A;  2R61 A;  3BK2 A;  1GB1 A;  3OWE B;  2M0A A;  4L2Y A;  5H8Y E;  1P7F A;  4C80 A;  3B2G A;  4XDD A;  1FXA A;  4YWG G;  2QSD A;  1JW9 D;  2IJ0 A;  2V0G A;  2WXG A;  1ZXI A;  2WS3 B;  1NVI D;  3T3O A;  3AED B;  1JAL A;  4XDC A;  5C3J B;  4C56 C;  3E9S A;  2KN4 A;  1HEZ E;  2KQ4 X;  2KWD A;  2MJE A;  3HVD A;  4HKZ E;  1FNW A;  2INP E;  3NUH B;  2VZK D;  2AQ1 B;  5HI1 A;  1L0X B;  3Q8C A;  3P1M A;  3HVZ A;  4REZ A;  1YJI A;  1JWU D;  3AE8 B;  3IT4 B;  1GOZ A;  1XF5 L;  3AH7 A;  4WQM A;  1SEB D;  3SR6 A;  1FEH A;  1WGK A;  2W54 A;  2K9X A;  1T5X D;  2BS3 B;  1D5X C;  1C4A A;  3BVZ A;  4ZHP A;  3EGR A;  2YEP F;  4DXF A;  3LXF A;  2WXO A;  2ICI A;  1QT9 A;  4RGM A;  1WRI A;  3P4Q B;  4NAW B;  1IBX B;  4RGO S;  3DWG C;  2L52 A;  4OHJ A;  1ENF A;  1K52 A;  5GXG B;  2BS4 B;  1TY0 A;  4IDI A;  4N58 A;  1B9R A;  1QOG A;  1XLN A;  4CQN A;  1EU4 A;  1HZ6 A;  5BYQ A;  3TEX A;  1H7X A;  1PGA A;  3U2S C;  2PVG C;  4B0E A;  1TZO A;  1BUI C;  3AEB B;  1D5Z C;  2LUM A;  3BK1 A;  1PUT A;  1P7E A;  4US9 A;  1JQ4 A;  2AQ3 B;  4RCO A;  3URY A;  3LYY A;  1AW7 A;  3TUO A;  1TS5 A;  3BVG A;  4NAM A;  1D4B A;  3PO0 A;  1SJE D;  2CJN A;  3BII D;  3T3N A;  2AQ2 B;  1L4Z B;  4L1B A;  1YQ4 B;  3HUI A;  3AEG B;  1JWS D;  2V3N A;  1I7H A;  2WNM A;  4A8X C;  4TMA B;  3GB1 A;  3P4P B;  1ZUD 2;  2OHF A;  3AE4 B;  3AE2 B;  1SBB B;  2WXF A;  2I38 A;  4MAC A;  1KLG D;  2QJL A;  1FCC C;  1GAQ B;  1J7A A;  1SXT A;  4LK0 M;  1J7B A;  1YMH E;  3B2F A;  5D3I B;  1TJE A;  4RNA A;  2X38 A;  1FO4 A;  1KH0 A;  1I4X A;  3NVV A;  2M56 B;  3N9Y C;  1FFU A;  2KAC A;  4YSZ B;  2IGG A;  4LTU A;  2RMM A;  5D3D A;  2WXL A;  1FNU A;  4AS1 A;  3AB5 A;  2TSS A;  4R3D A;  2WDR B;  1XEE A;  2JYT A;  1JWM D;  2DWQ A;  5HHD G;  4A55 A;  1PDX A;  1YQ3 B;  1UGJ A;  2IGD A;  1L0Y B;  3MP9 A;  4YXD B;  2ZW0 A;  3KQ4 A;  3IT6 B;  1J7C A;  1FFV A;  2SEB D;  3KLS X;  3SFD B;  5TSS A;  1ROE A;  1E9M A;  4HJG E;  5H92 C;  1VJK A;  5AUK A;  4WIP A;  4A6Q A;  1FXI A;  1V1P A;  4KGT A;  2Q5W D;  5AUI A;  2E3T A;  1JCK B;  3PZ7 A;  4P16 A;  3V05 A;  5FR3 A;  1BXT A;  4WH4 A;  3J9C A;  2LFI A;  2N9K A;  2PLP A;  3W1S A;  3FC4 A;  2WXQ A;  4ZRQ A;  1XO3 A;  1ZDV A;  1AWD A;  4NJC A;  2WXN A;  1TS3 A;  2QEJ C;  4JWU C;  3TSS A;  2M19 A;  3AM9 A;  1FRD A;  2IPK D;  4GDK B;  3ZQ4 A;  2WDQ B;  2GI9 A;  2QMT A;  3TEZ A;  1N63 A;  1HZ5 A;  1STE A;  1QOF A;  3Q8F A;  4RF1 A;  4KGR A;  1K53 A;  2BYT A;  4ARI A;  1GTE A;  2ON8 A;  3EA6 A;  3C8Y A;  2ONQ A;  1TKE A;  3SEB A;  5LNK 1;  2JU6 X;  1OFF A;  3TEW A;  2W55 A;  1VDV A;  1VZ6 A;  3IAM 1;  1NEN B;  1F2R C;  1MHH E;  3GP7 A;  1C9F A;  1FD6 A;  4PT5 A;  3AEA B;  2JQR B;  2NTS A;  2IGH A;  2PTL A;  4NZL B;  4H2A A;  3VRA B;  3Q8B A;  3AE5 B;  1RM6 C;  4TQ0 A;  1M4V A;  4J3O D;  2WU2 B;  2BB6 A;  1GT8 A;  1XCQ L;  1MPE A;  1WXQ A;  1TS4 A;  3R2T A;  5MPO A;  1C77 A;  1CZP A;  1FRR A;  1TKY A;  3AN1 A;  2WXM A;  1EWC A;  2ZW1 A;  2EEL A;  2BTE A;  2AX5 A;  3NRZ A;  2SAK A;  2WDV B;  3ZGZ A;  4RGN A;  1E7P B;  4O1N A;  1FMA D;  4YTP B;  1C4C A;  2JYE A;  1XCT L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...