1OQQA

Crystal structure of c73s/c85s mutant of putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida, at 1.47a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putidaredoxin, the [2Fe-2S] component of the P450cam monooxygenase system from Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
molecule keywords Putidaredoxin
total genus 23
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1oqqA00
3KWLA 2M19A 1NYQA 1QT9A 3AE7B 2HTME 1QOFA 1N60A 1L0VB 3AE5B 3P63A 4P6VF 4USAA 4A9AA 1L6VA 1JWBD 1J7CA 3NVZA 2M56B 2BT6A 4JX1C 3NS1A 3EUB2 1JROA 2K22A 2WQYB 1RM6C 2BS3B 2N0SB 2WP9B 1N62A 2H88B 4ZHPA 3AEBB 3AE6B 5EE9A 1NYRA 2JX5A 3B9JA 3LXFA 2Y5CA 1FFVA 1KFYB 2H89B 2L52A 3P4QB 1E0ZA 3FAHA 2PVOD 3NVWA 4YSZB 2DBYA 5MPOA 2EKIA 2BS2B 3AEGB 1WGKA 3AEDB 3AEFB 2W3SA 1XLOA 2CU3A 1JW9D 3W5UB 4YTNB 5AUIA 3AECB 3AM9A 5C2TB 1PUTA 3B2FA 1FXIA 1ROEA 2LEKA 3CIRB 1WXQA 1R7SA 2WDVB 2K9XA 1DOXA 2MJEA 2PKOA 1IUEA 1FXAA 1YQ4B 1WWTA 1FMAD 2CJNA 5H8YE 3VR8B 5GXGB 1E6EB 1J7AA 3AN1A 1JRPA 4C80A 3BIID 2ACZB 3AE1B 4ITKA 1E9MA 1YJIA 3PO0A 5EE0A 3AE3B 1WRIA 1FO4A 2MJ3A 2W55A 1E7PB 3SFEB 1QOGA 1FIQA 5EE1A 2QJLA 1F0ZA 4US9A 1QF6A 4ZOHC 2WLBA 4JWSC 4N59A 4YXDB 2MH7A 3VRBB 3NRZA 5EE3A 1SIJA 1FFUA 3HUIA 4KX6B 3ZYYX 1JWAD 1RYJA 1WYGA 2JQRB 3AE8B 2WU5B 3VR9B 1NENB 3LB8C 1J7BA 1DGJA 3NVYA 1N5WA 2MJDA 4YSXB 2FBWB 1JQ4A 1NEKB 1TKYA 2PIAA 1VLBA 4YTMB 1V97A 4C7ZA 1VJKA 1XLPA 1YJJA 2G1EA 2W3RA 4FXCA 4LTUA 1RWSA 1SF0A 1RFKA 3P1MA 1YQ3B 3AEEB 2E3TA 4HRSA 1OFFA 2Q5WD 3SFDB 4C7YA 1AYFA 2L83A 3DWGC 4US8A 1NVID 1A70A 2AX5A 3FC4A 1FM0D 3AB5A 3AV8A 1ZXIA 3P4RB 4ZHOA 3AE9B 1E10A 1JALA 1DOYA 2K5PA 1B9RA 1ZOYB 3AH7A 1ZUD2 2DWQA 1N63A 1V8CA 2KAJA 1KF6B 1I7HA 3AE2B 1NI3A 3CWIA 2OHFA 3DWMA 3HVZA 3L4PA 4YSYB 1GPXA 2B76B 3AE4B 1TJEA 1ZP0B 2WDQB 5G5GA 1N61A 5H92C 3SR6A 4WWMA 3VRAB 3P4PB 1TKEA 5AUKA 4N58A 1FRDA 3NVVA 1TYGB 2CJOA 1SB3C 4IDIA 3W5VB 1QOBA 2WS3B 1CJEA 1L6UA 1TKGA 2PVGC 2BS4B 2WU2B 3P4SB 2QIEB 3W9CB 1XLQA 5G5HA 1QOAA 3B2GA 1EWYC 1FRRA 3ETRA 1QLBB 1OQQA 1L5PA 3WCQA 2WDRB 1N5XA 3AMZA 1AWDA 3ABVB 3HRDD 2KMMA 1PFDA 3AEAB 1UWMA 1OQRA 4YT0B 4YTPB 1GAQB 1PDXA 4HROA 5C3JB 1XLNA 1XO3A 1CZPA 1VDVA 1DOIA 4JWUC 1KRHA 2W54A 1T3QA 3RPFC 4WQMA 4N6EB
chains in the Genus database with same CATH superfamily
1C79A 4X57B 2ZPNA 2DZKA 2CU1A 2JVCA 4XWTA 4M00A 4JE3B 4GXBA 2MW5A 4URKA 4FADA 2Z59B 4MELA 2WHIA 1V81A 2K8BA 3IFWB 2N9XA 4YTNB 1PUTA 2GBRA 1TS3A 2QMTA 2XK5B 1CMXB 3GOEA 1N6ZA 3JYUA 5HG2A 2L00B 3FILB 3AN1A 4JIOU 2D10A 2REXA 1QILA 1PGBA 3AE3B 1K53A 2RPVA 2C9WB 3MC0B 4MSMB 2QJLA 2G3QB 3R2TA 2NBWB 2GBKA 1SIJA 5FR3A 2I38A 5E6JA 2RD0A 4B6WA 3Q8FA 1C78A 3L0WB 2TSSA 1TKYA 2PIAA 3ZO5B 5AZFA 1UGMA 3ECIA 2K8HA 2BKRB 2ZW0A 2Q5WD 4C4VB 2UYZB 1IBXA 1UUPA 1YX6B 1XCTL 4HXDA 1TZOA 1JALA 3MC8A 3WAOA 3AH7A 4XX5A 1ET6A 2KWCA 4TSSA 2HJ1A 2WDQB 2M8SA 2GRIA 2LVQA 1L4DB 4KDLB 4N9F4 1RRBA 3H1UA 1D5ZC 1L4ZB 4HCPB 1QOAA 2V0GA 4K1RB 2K6QA 3ZNID 2AQ2B 3RCZA 4RGOS 1C1YB 2LHDA 2YLMA 3NS8A 1CZPA 3C8YA 1KRHA 1YNTE 4DXFA 2FCSA 3U7ZA 1F2RI 3KYCD 3QARA 4A8XC 4L23A 4EUTA 3TMPB 2ZCBA 2PEAA 5BYSA 3IAS1 3NS1A 3UF8A 1N62A 2NMQA 1HE8A 5FKAC 3H8HA 4BZAA 2ZJDA 4AJYB 2JYEA 1TZ1A 2LXCA 3ZDMC 2LRWA 4LJPB 3Q8EA 1FXAA 1T5XD 3RZWC 4REZA 1T0RC 1GC7A 1WGGA 4W9FA 1R4NB 1ZE3D 2W55A 1KOTA 4G11A 1WXSA 1QOGA 3RUIB 5EE1A 2WLBA 1OQYA 4W9DA 3DHIC 2B3AA 1S1QB 1SGHA 2N9LA 3N9YC 3MFGA 3HUIA 5JH5C 2WDTB 2KJHB 5TSSA 1ZDXA 4FULA 1XXGA 1AW7A 3I3TB 3NUHB 3ML8A 4JLCA 2N7JA 4TV3A 3QQ8B 1R4NI 2M4NA 3W1YA 3LYYA 4DDID 2MCNB 1JWSD 1J0GA 2FIFA 2O2VB 3H6NA 3AB5A 1Q5WB 3AV8A 3P4RB 4HLEA 1PGAA 3URYA 1B9RA 3AE2B 4BKGA 3DWMA 2JZZA 5G5GA 2C60A 1X1MA 3O13A 1TYGB 1SB3C 3WA0A 2K25A 4AOFA 5BMHA 4LNIA 1XLQA 1RFAA 5J17A 2KK8A 2K1FA 2ON8A 3UIOB 4A55A 4XWWA 3BK1A 2NPTA 4KZCA 3BYYB 4RF1A 5CHFA 4ACFA 3KWLA 2KHWB 1DYQA 5T8IA 2XK5A 3P63A 1L0VB 3VQIA 4A9AA 2GBNA 3PLVA 1CK1A 1J7CA 3W1SC 4WQOB 3PHXB 4FBJB 4W9CA 1JROA 3UQBA 2L52A 3SEBA 4ANXA 2I1JA 4UDUC 1L0YB 1GJZA 1XLOA 2BW2A 3CIRB 1K50A 3DVNV 2MJEA 2CJNA 4IWOA 2I1KA 4GDKB 1SE9A 1E9MA 4ITKA 4BBNF 2WXKA 3RN9C 3SFEB 3OJ3A 3RNCC 4CO7A 4NJCA 2AWTA 1JWAD 3BWUD 2JQRB 5BYQA 2WU5B 1E90A 1WRDB 4I6LB 3BINA 2KLGA 2QCZA 4KDIC 4ZDVA 2E6XA 3T8MA 3FC4A 1ZXIA 4PT5A 2ZNVC 2MQJA 3C19A 3X23A 3KQ4A 5IA7A 4PS7A 1PGXA 4WURA 3N3KB 3SR6A 3SU8X 5FK9C 1M94A 1TY0A 2D11A 4XDDA 1IGDA 2JYTA 3DHHC 2WDRB 4OHJA 3I9V1 2KMMA 1PFDA 1SSNA 2K39A 4HROA 2YEPF 3A1QA 4I6PA 3TEWA 5DCNA 2HTME 1MPEA 1N60A 3S2AA 3Q69A 4JX1C 3K9PB 2VH2A 4AWJA 1GG3A 2N7EA 4HWIB 3E56A 3MHSD 1HZ6A 3HM3A 5DPWA 4R3DA 3PRPB 1WH3A 4GB9A 5LXHA 2XN9C 3ZNGC 1WF9A 1E8YA 4S17A 5E6PA 2IJ0A 2IO0B 1E5WA 2KDFB 2LVOA 4C00A 2K8CA 3HK0A 1VR9A 1SEBD 3T3OA 1I4GA 2G45B 3DBSA 4WWNA 3NRZA 4QAYA 4KX6B 3KH0A 1T0SC 3TEYA 5D94A 4YSXB 1Q1OA 2OJWA 4JQWC 3PREA 2V3NA 3VUYA 2LASA 2EMSA 2KMCA 3TEZA 3AEEB 2E3TA 1P7FA 4M01A 1E7UA 3K9OB 2NS5A 2IPKD 4BKSA 1WJ4A 2KO3A 3NY5A 2NVUI 4MDKE 3L13A 3PS6A 2OOBB 5AUKA 2CJOA 3KLSX 1YN5A 4W9HA 2WU2B 2CHWA 3W2DA 4O1NA 1E8XA 5G5HA 4IC7B 3B2GA 1HTQA 4TKNA 2L05A 3A4RA 3MP9A 1F1HA 3M62B 2RDBC 2D3AA 4YT0B 3OG5A 1VCBA 3AI5A 4S0RA 3A1QB 4OVVA 2W54A 1T3QA 1TGZB 3L10B 4KIKA 2JRIB 5E6NA 3NHEB 5KHOA 4HPLB 1KLUD 1P9DU 3PHWB 1JWBD 2BT6A 4XE0A 2GMIC 2SAKA 2LVPA 4GDKA 3TUOA 3CF6E 1D3ZA 1RM6C 1B1ZA 1PYWD 4MH8A 1ESFA 3PLUA 1ZXHA 1ZDVA 3PTFC 1D4BA 3W5UB 2LEKA 4ARIA 2LRUA 3KW5B 2LGXA 2EELA 2M0AA 3KWVA 3VR8B 2LJ5A 4OW0A 3ZTCA 4FHKA 3ZTDA 5IAAC 4B0MA 3UGBB 2L1AA 3U2SC 3CSTA 3DBLI 1WFYA 2DAJA 2FUHB 2W82A 3P2BA 3TBLD 1WI0A 1WIAA 5G2NA 3DBRI 3RFZB 4NQKE 3MJWA 3DVNU 5BO4B 2W3RA 3R2IA 2IBIB 3Q2AC 3V61A 4OZBA 2ASQA 3DVGX 1IGCA 1JWUD 3L08A 4NNJB 4W9KA 3QHTA 3IT4B 1QQRA 1I4XA 2DWQA 2WXMA 1E8ZA 2MBEA 1R4MI 1ZP0B 5H92C 1V49A 4HPPA 1TKEA 1CJEA 3RNAC 2MBHA 2V9HA 2AQ3B 2M0XA 2HE7A 1WYWB 4TQ0A 1L5PA 3BVMA 5IN7A 3LJ3A 2C7MB 2FUG1 1GAQB 2ZPYA 4HVBA 2SEBD 3APCA 1I35A 3AE7B 2MWSB 2BTEA 5C1ZA 2FCQA 2J7QB 4ANWA 4EKUA 4IWQA 3RNEC 1GUAB 1J8CA 2Y5CA 3DHGC 1V86A 3R8BA 3FKYA 3I63C 1JW9D 2V4LA 2LJIA 4KGSA 3PSEB 1OEYA 5CTRC 1YQ4B 2R2OA 4RFBA 1Q0WB 4PYUA 1HA5A 2AL6A 3BIID 3AE1B 3APFA 2N9EB 1QZEA 1WE6A 3JSVB 1XEEA 2D07B 4OZAA 1TY2A 3ZYYX 4DHJB 3QIJA 4WAAA 2BB6A 3JVZX 3GZNI 3DBLB 4FXCA 5BMIA 1V1OA 4G3XB 2LGIA 3TEXA 3P1MA 1Y8RC 3VUWA 1SE3A 4US8A 1EF5A 1OEYJ 1YOVB 3IAM1 4PS8A 3PRMB 2LFIA 4ZYNA 3GZNB 1WY8A 2PPHA 3EGRA 1XCQL 4M8NA 2JPHA 3QWZB 3EHVA 2AQ1B 3PT2B 2WX0A 4GDLB 2D2QA 3ETRA 2KXJA 1XF5L 3I57A 4GIVA 3PV1A 1AWDA 4JGHB 1YN4A 1MFWA 3QAQA 1E7VA 2X8XX 3RD2A 4ICVA 2HJ8A 4N6EB 2JZPA 1LFDA 2QEJC 1JCKB 1SIFA 2KQ4X 5TR5A 2RDHA 2WQYB 4MJSB 2KC1A 2CS4A 3HVDA 3MC9A 4MEMA 4YSZB 4K3BA 3AM9A 3B2FA 1ROEA 3ZNZB 2EKEC 2K9XA 3RNBC 4DHJD 1GNUA 1AARA 1UBQA 3NOBA 2GI9A 2QHOA 2Z0DB 4FJZA 1K51A 3NJTA 3B1LX 5HKHA 3SDLC 1V80A 3NZUA 3ZRFA 4US9A 4GSWA 4N59A 2KVZA 4NZLB 4BVUC 1IPGA 1ZW7A 3N20C 1WGYA 4BFRA 4YL8A 1WX9A 4RGTA 3E9SA 2KX3A 1A5RA 3H9DA 1WZ0A 1TS2A 3UQAA 3DWGC 3RULA 5E6OA 2DENB 4BKTA 2MA9B 4A20A 1BT0A 4B0EA 1RAXA 4LLGM 3R7QA 3OJ4B 2OEDA 1I4QA 2D3GA 1TKGA 2PVGC 3ZDTA 4AJWA 4II3B 1MI0A 1YD8U 1KTKA 1WMHA 4GOCA 2I2YA 1R4MB 3BZDB 1VD2A 1D6EC 1F52A 2KFKB 3V6EB 4E71A 3X0WA 2LGDA 1BMLC 1WSPA 3VTWA 4DXGA 3R66C 2KWDA 1V1PA 2PW9A 3H7PA 1RLFA 5BYRA 3JW0X 3AE5B 3V05A 3ZLZA 3EC8A 3ZVVA 3Q3OC 4EEWA 4DHZB 4MJSA 1JMLA 2Y5BB 2XNAC 5DPRA 2INPE 1FFVA 1WX7A 4MGKE 5GMVA 2EKIA 2BS2B 2CR5A 3AEDB 3RNGC 4B9KA 1HZ5A 2J0MA 2W3SA 5AUIA 2J0JA 1FXIA 2XEWA 1L2NA 4AP4C 1HQRD 1V1PB 3H7PB 2BYFA 2MLBA 3ZJUA 4C80A 4FJVB 4M0WA 1TIFA 2MJ3A 2WXJA 3KVFB 4TMAB 2KWVB 2IO2B 2OJRA 2AL3A 2FBWB 1WXVA 4BOZB 4C7ZA 1ZKHA 1YJJA 3DVGY 2JZ3B 1RFKA 3V6CB 1KLVA 1WZ3A 3ZW3A 2RSUA 3EFCA 1A70A 1EM7A 4TUUA 4ZHOA 4G50A 4L1BA 2M17A 1ZOYB 4PK1A 1SXTA 4MACA 3OAWA 4WWMA 5AEKB 4RM9A 4F1SA 3HIZA 4GDLA 2MX2A 2JWUA 4WWOA 1OQQA 4B95A 2WX1A 1SJHD 3ABVB 1KJTA 3ALBA 2N4FA 2V3PA 2IYDB 3BVGA 4AS1A 5J18A 1XO3A 3AULA 5KHQA 4ICUA 1WJUA 2WXRA 2MP2B 2L32A 3QJZA 2WXHA 4USAA 1V5TA 1SE4A 2IDYA 3M3JA 1UGJA 2N9KA 2N0SB 2N1VA 2CHXA 3AEBB 3ZUNA 3LXFA 4ZRJA 4MM3A 2QILA 5MPOA 4EZJA 1SBBB 2JRHA 2KOXA 2KT7A 2KC2A 2MHJA 4E74A 2NCNA 2IO3B 2AYOB 1HTOA 1JRPA 2PMVA 4HCNB 4IKGA 1EWCA 3BYTB 2DZMA 4JPSA 4Q2JA 4HDOA 3Q6BA 5JXVA 4MM3B 4AUQC 1VZ6A 3TSSA 2RMMA 4NAWA 3AE8B 2KQ7A 1P3QU 1Q10A 4ZYSA 1J7BA 1DGJA 1N5WA 2QC8A 2RDGA 1V97A 4LTUA 3U52E 5IOIA 3DPDA 4IG7B 2L83A 3M63B 1IBXB 1NVID 4KIKB 5J2RA 4PYZA 1MHHE 2WXGA 3IG3A 3RI7C 4XDCA 2KYWA 1BXTA 4IOIE 3W1SA 2B76B 3AE4B 2JU6X 4EZKA 4DBGA 4NAWB 2LUEA 5LNK1 1MG8A 4MH0E 2HD5B 3VUXA 3N1XC 2LHEA 3N1ZC 1N5XA 3DOWA 2KN4A 2KZRA 4M8MA 2IZVB 4YTPB 2KJ6A 3QA8A 1SE2A 4EFOA 1EO6A 3IBEA 2O6VA 1VRAB 4JWUC 2KFJA 5D6JB 3UI3A 3WAMA 4MGZE 1QT9A 5G55A 2ICIA 1T0QC 2GB1A 1UWXA 3B0AA 2MBBB 2JUOA 2AEHA 1OGWA 3T9LA 4L2YA 1NI2A 4LJOB 5HFYA 3I5JC 4HKZE 4ZHPA 2KD0A 3AE6B 5EE9A 1I4RA 1GC6A 2NTTA 2QSDA 5JHBA 3L54A 2ZCCA 1V9JA 1LM8B 2L3ZA 4OZCA 2WXOA 2MP2A 3IXSA 4XZ4A 1UZXB 3A9KA 2KX0A 2N7DA 4J3OD 1P7EA 1WJNA 2J4XA 2KWUB 2V3SA 3EFUA 1J19A 1ET9A 2PE6B 4W9LA 1AN8A 1WR6E 1C3TA 2K6DB 4YXDB 4RF0A 2J52A 1NENB 2D3BA 3IHPC 3NVYA 1MVKA 2NBVB 5IO9A 1QKZA 2WYQA 1TS4A 2WXLA 3O65B 2O6VD 2Z0EB 2JF5A 1SF0A 4HRSA 1OFFA 3Q14C 3SFDB 2BWFA 2MRPA 4C7YA 1AYFA 1F9JA 3AE9B 2L0FA 1VZ8A 2WXPA 3HVZA 1KH0A 2PTLA 2A4ZA 2OHFA 2BB5A 2KVRA 3ZXVA 3VXWA 3VRAB 1N61A 3W5VB 1TS5A 4W9GA 1L6UA 5L95C 4NJ6A 3EECA 4EOYA 4BAXA 2RGFA 2FCMA 2LD9A 4M0WB 3ZQ4A 1GB4A 4ANVA 1FCLA 1Z2MA 4IM3A 3U7DA 3J9CA 3RNFC 1E8WA 3PRZA 2KN5A 4WQMA 3A33B 1NYQA 4NJ7A 3OWEB 5EDSA 4P7IA 3EUB2 5CHVC 2ZW1A 2BS3B 3ZGZA 2N9PC 1CQVA 3FAHA 5JHAA 1V5OA 2KLCA 4P1CC 1OTRB 4XC2A 2Z8LA 2M1MA 5C23A 4KGTA 4ARCA 3GE8C 3RYTA 4J6IA 2KTRB 2ACZB 3L16A 4KZ0A 3PO0A 1I42A 1T6BX 3LDZE 3Q3NC 3B08A 3MTNB 3UIPB 1ISNA 4OVZA 4M02A 3UINB 1IYFA 4HKQA 3ML9A 4C4VA 2DX5B 1FCCC 3DBRB 3LB8C 2J42A 3RZFA 2J53A 4KKJA 2G1EA 3RT3B 3A9JB 2Y5PA 4A3OA 4HJGE 1FD6A 2G4DB 3AU5A 2RR9A 2A5UA 1FEHA 1TTNA 4KV2A 3VTVA 4FHJA 4YSYB 1D5XC 4GGQA 1T0YA 2INCC 1C4PA 2VH1A 4N58A 1FRDA 3NVVA 2UWQA 2LWPA 2QIEB 2BVCA 3W9CB 3VTUA 3GS2A 3R7RA 1FPYA 3PGEA 1ENFA 4HDQA 4NY0A 2MBQA 4WH4A 2CKHB 1C77A 3AMZA 2ZVOA 3HRDD 3V60A 4IM2A 4K81A 3C0RB 5L83A 1GB1A 1XLNA 1VDVA 4FA6A 4I6NB 2MSED 5AZGA 1L7YA 3PVLA 4XGAB 3V62A 4MT5A 3VH4B 1I4HA 3VVWB 1MG4A 2UU7A 2M56B 3D32A 3BVZA 1H8CA 3BK2A 4DHZE 2KDBA 1WGDA 3B9JA 1E0ZA 2H89B 3WALA 1PQSA 2PVOD 3NVWA 3ZIMA 2IY0B 3DDCB 1UH6A 4P16A 2WDVB 4W9IA 4ZRIA 4KGRA 3QX1A 2G4SA 5H8YE 1ACCA 1UELA 5EE0A 5D7GA 3KYDD 5CHWA 1HXYD 4II2B 4ASWC 3ONSA 3VFKA 3APDA 3GB1A 4PS3A 1WMHB 1WXMA 2L0TA 1WYGA 3QK0A 4EZLA 1VLBA 2CHZA 3MJ5A 2KANA 2X38A 2IO1B 1YQ3B 2KQSA 3U8ZA 2HTHA 3A9KB 5DPTA 1NBFC 2IY1B 3TL5A 4MGIE 4K3CA 1N63A 2LGYA 4OVUA 3WANA 2J0KA 1F77A 3ENEA 1YJ1A 4IDIA 4A3PA 1STEA 2GBMA 4WIPA 1EWYC 3U4EG 4WJQA 4AQ7A 2V4IB 2C7NB 2PE9A 2IGHA 1LO5D 3HHMA 3T3NA 4LCDE 1WX8A 4HEA1 4KVGB 2GLSA 4P6VF 2K0PA 2D3CA 1WE7A 3Q3JA 1K8RB 2JT4B 2WP9B 3HM6X 2H88B 4A90A 4ANUA 3PPAA 3P4QB 2PJHA 4FN2A 3AU4A 3Q3MC 3TIXA 2G9HD 3OLMD 5C2TB 4IWPA 1GOZA 1DOXA 1WWTA 3ZJVA 2K3UA 4K7UA 3GE3C 1E6EB 3Q3FA 1V6EA 4NPNA 4D2KA 3A9JA 3CMMB 2KNBA 5FR6A 4LDTD 2JSVX 4ZOHC 4GMVA 2WNMA 4K7WA 3R3MA 2NR2A 4RGNA 1FFUA 4TQ1A 2NBUA 4K7SA 2KMAA 2MJDA 1NEKB 4NQLB 2IGGA 2JY6A 5HI1A 2LUMA 4G0NB 2DAFA 3GP7A 1V2YA 2K5PA 4LNOA 2WXIA 4HK2A 1ZUD2 2KAJA 1I7HA 3L4PA 1YMHE 2DYOA 2Y3AA 4RMAA 1S3SG 4MSQB 2KACA 3VAWA 2RPQA 4WJOA 3PZ8A 1FRRA 4KKIA 4GN1A 4CQNA 1XD3B 1OQRA 2JXXA 4RNAA 5D3IB 3KUDB 2IGDA 1EUVB 1UF0A 2M19A 4BBNC 3N32A 1IP9A 1Z5SB 2ONQA 1FNVA 3NVZA 4FJYA 2DZIA 4LDTB 2QDFA 2JXTA 3DBHB 2KDEB 2KDMA 2NPTB 4CYEA 3FILA 4WJNA 3AEGB 1WGKA 3AEFB 2CU3A 1XT9B 3NZ3A 3Q8AA 1R7SA 2INNE 2FNJB 4P1BC 1M4VA 2LGSA 2FE8A 2BWES 5GXGB 4C56C 1J7AA 5D3DA 1ZGUB 2O6VB 2INDC 3ZXRA 1WRIA 3V3XA 1YX5B 1F0ZA 2EMTA 1KLGD 5CX3A 3SHQA 3VRBB 5EE3A 1JRUA 2LZ6A 1RYJA 1D5MC 4IUMB 1NDDA 4F7ZA 1JQ4A 3VHTC 1VJKA 4W9JA 3N30A 1RWSA 4IW0A 4DDGD 2XBBC 4RCOA 1MHXA 2BQQA 2D5GA 4W9EA 2ZEQA 1V8CA 4LK0M 3DCGA 2FAZA 3ZRCA 5LLIA 1TJEA 1Y56A 4LNKA 4WWPA 1ZPSA 2FIDA 2MEKA 3QCAA 1C4CA 3TJPA 2KTRA 1WR1A 4CHKA 4GU2A 2L76A 3ZNHB 4E3CA 4F8CB 3IT6B 2BYVE 3NG0A 3WIMA 1JWMD 2VZKB 3VH3B 2LMCA 4IM0A 1HEZE 1QOFA 3MHZA 1P98A 1WM3A 2LXAA 3PZDA 5IKCM 1NYRA 1TBEA 2YVCA 4DXAB 1KFYB 1K52A 2C7HA 2DLBA 4WAFA 3DBHI 4MGYE 3KUCB 3NZSA 3RMKC 4LNFA 1IUEA 1FMAD 1WXAA 4DWFA 2DHZA 2DYMA 2ZZPB 2MBOA 3M95A 4RM8A 1WGRA 1FO4A 4ZRQA 1E7PB 3EA6A 4RH6A 1YIWA 4JWSC 2W9NA 3ZKJC 1MJDA 2MH7A 4XYCA 3L17A 1SJED 4ZRKA 3BY4B 5BMGA 3PZ7A 1P0RA 2O2VA 2R2QA 2V1YA 2WGSA 1XLPA 1LXDA 5DPSA 2BGFA 1WM2A 2HDEA 1LQBA 4LNNA 2KKCA 2LI5A 2GBJA 5LXIB 4EE2A 2KTFA 2DNFA 1FM0D 1YQBA 1E10A 2N1WA 4DK5A 2VZKD 3H7SA 2WXQA 1KF6B 1YN3A 4DQOC 3IVFA 1UBIA 3P4PB 1L0XB 2BBCA 1QOBA 2WS3B 1XQQA 5AZHA 2BKFA 2BPSA 1P1AA 2VRRB 5D2MB 3Q8BA 3QC8B 3KUZA 2L7RA 3WCQA 3A4SC 3AXCA 2GOWA 4JL9A 3AEAB 1U4AA 1WGHA 4YWGG 1DOIA 4BOSC 3RPFC 2DYBA 2PLPA 1L6VA 1C4AA 2ZVNA 2KJRA 2ZNVB 2K22A 4FLHA 4HPMB 2DZJA 2WWZA 1TT5B 2JX5A 1UNSA 1VZ7A 3DQVA 2DBYA 5HHDG 2KDIA 4KSLC 3AECB 1FNWA 3U30A 1WXQA 3ZJTA 2PKOA 2NTSA 1LGRA 5IP4D 2WXFA 3JSVA 1EF1A 1C9FA 3WAPA 2KFKA 1YJIA 2YEPB 1FIQA 1QF6A 1H4RA 3VDZA 1F2RC 4H2AA 4BKSD 3VR9B 1WJ6A 3P42A 1I4PA 3CSFA 1EU4A 4YTMB 2BYTA 4NAMA 4ZRPA 3SD5A 1KM7A 4A6QA 1BUIC 4RGMA 1UD7A 2BF8B 1FXTB 2AX5A 1EU3A 4HJKA 3TCAA 4KSKC 2R61A 2FCNA 1DOYA 4WJPA 3CWIA 1NI3A 1GPXA 2L8JA 2WXNA 1G6JA 5I4DA 4GLSC 2BS4B 3P4SB 2JWZA 1QLBB 3Q8CA 3N1YC 2BYEA 1UWMA 1FNUA 1PDXA 5C3JB 1C76A 5JZEB 2C5LC
chains in the Genus database with same CATH topology
2L32A 1C79A 2WXHA 4P6VF 4USAA 1KLUD 2K0PA 1SE4A 1JWBD 2IDYA 2BT6A 4XE0A 4XWTA 2SAKA 1UGJA 4JE3B 3TUOA 2N9KA 1RM6C 2N0SB 1B1ZA 2WP9B 2H88B 4A90A 3AEBB 3LXFA 1PYWD 3P4QB 4MH8A 2QILA 1ESFA 5MPOA 1ZXHA 1ZDVA 2G9HD 1D4BA 3W5UB 4YTNB 5C2TB 1PUTA 1GOZA 1SBBB 2LEKA 1TS3A 2QMTA 4ARIA 2EELA 1DOXA 2M0AA 1WWTA 3KWVA 3ZJVA 2K3UA 3VR8B 5HG2A 1E6EB 3FILB 3AN1A 4OW0A 1JRPA 4D2KA 1QILA 2PMVA 4IKGA 1EWCA 1PGBA 3BYTB 3AE3B 1K53A 4B0MA 2RPVA 3MC0B 4JPSA 2JSVX 2QJLA 3R2TA 4ZOHC 2WNMA 4Q2JA 5JXVA 4MM3B 2L1AA 1SIJA 4RGNA 3U2SC 5FR3A 1FFUA 1VZ6A 2I38A 2RMMA 2W82A 4TQ1A 5E6JA 3TSSA 3AE8B 3Q8FA 1C78A 1Q10A 4ZYSA 1J7BA 1DGJA 1N5WA 2MJDA 3RFZB 2TSSA 1NEKB 1TKYA 2PIAA 2RDGA 1V97A 2W3RA 3R2IA 4LTUA 3U52E 2IGGA 4OZBA 5HI1A 2ZW0A 2Q5WD 2LUMA 1IGCA 1IBXA 1JWUD 2L83A 1UUPA 1IBXB 1NVID 3IT4B 1XCTL 1QQRA 3GP7A 1TZOA 1MHHE 1JALA 2WXGA 2K5PA 2WXIA 1I4XA 1ZUD2 2KAJA 2DWQA 2WXMA 3AH7A 4XDCA 1I7HA 3L4PA 1ET6A 1BXTA 1YMHE 4IOIE 4TSSA 2B76B 3AE4B 3W1SA 2DYOA 1ZP0B 2WDQB 5H92C 2JU6X 2GRIA 2Y3AA 1TKEA 4NAWB 1L4DB 5LNK1 1CJEA 2KACA 1D5ZC 1L4ZB 1QOAA 2LHEA 3PZ8A 2AQ3B 2V0GA 1FRRA 4TQ0A 1L5PA 3BVMA 1N5XA 2FUG1 2AQ2B 2KN4A 4KKIA 4RGOS 4CQNA 4YTPB 1OQRA 2LHDA 1SE2A 1GAQB 4RNAA 5D3IB 1VRAB 1CZPA 3C8YA 4JWUC 1KRHA 1YNTE 2IGDA 4DXFA 3UI3A 3U7ZA 1F2RI 2SEBD 2M19A 1QT9A 2ICIA 2GB1A 3AE7B 1UWXA 4L23A 4A8XC 2BTEA 5BYSA 2ONQA 3IAS1 1FNVA 3NVZA 4L2YA 3NS1A 5HFYA 2JXTA 4HKZE 4ZHPA 1N62A 2KDMA 3AE6B 5EE9A 1I4RA 2NMQA 2QSDA 2NTTA 2Y5CA 5FKAC 3FILA 3H8HA 3R8BA 3AEGB 1WGKA 3AEFB 4OZCA 2CU3A 1JW9D 2JYEA 2WXOA 3IXSA 3NZ3A 3Q8AA 2LJIA 4KGSA 1R7SA 2INNE 3Q8EA 1FXAA 1YQ4B 1M4VA 1T5XD 2FE8A 4REZA 4J3OD 4RFBA 5GXGB 4C56C 1P7EA 2J4XA 1J7AA 5D3DA 1HA5A 3BIID 3AE1B 1ET9A 1WRIA 3V3XA 2W55A 1ZE3D 1AN8A 1QOGA 1F0ZA 5EE1A 1KLGD 2WLBA 4YXDB 4RF0A 3VRBB 1XEEA 2N9LA 5EE3A 4OZAA 2J52A 3N9YC 3MFGA 3HUIA 1TY2A 3ZYYX 1RYJA 1D5MC 5TSSA 1NENB 1ZDXA 2BB6A 3NVYA 1XXGA 1AW7A 1MVKA 1JQ4A 1QKZA 3NUHB 1TS4A 2WXLA 1VJKA 4FXCA 5BMIA 1V1OA 1RWSA 1SF0A 2N7JA 2LGIA 3TEXA 3P1MA 3LYYA 4RCOA 4HRSA 1OFFA 1JWSD 3SFDB 4C7YA 1SE3A 1MHXA 1AYFA 4US8A 2D5GA 3AB5A 3AV8A 3P4RB 3AE9B 3IAM1 1PGAA 3URYA 1B9RA 2LFIA 1VZ8A 2WXPA 3AE2B 1V8CA 3HVZA 4LK0M 1KH0A 2PTLA 3DWMA 2OHFA 2BB5A 1TJEA 3VRAB 3EGRA 5G5GA 1N61A 1Y56A 1XCQL 3O13A 1ZPSA 1TYGB 3W5VB 1SB3C 1TS5A 2AQ1B 2MEKA 1L6UA 1C4CA 5BMHA 1XLQA 4GDLB 3ETRA 1XF5L 3I57A 2ON8A 3ZQ4A 1GB4A 1AWDA 1FCLA 4A55A 4XWWA 1YN4A 3IT6B 3BK1A 3J9CA 1JWMD 2VZKB 3BYYB 4RF1A 4WQMA 4N6EB 2JZPA 3KWLA 5T8IA 1DYQA 2LMCA 2QEJC 1NYQA 1JCKB 1HEZE 3OWEB 2KQ4X 1QOFA 3P63A 1L0VB 3VQIA 3MHZA 4A9AA 1CK1A 1J7CA 3EUB2 1JROA 2RDHA 2WQYB 2ZW1A 2BS3B 3ZGZA 3HVDA 1CQVA 1NYRA 1KFYB 2L52A 3FAHA 4YSZB 3SEBA 1K52A 4UDUC 2DLBA 1L0YB 4WAFA 1XLOA 3AM9A 3B2FA 2BW2A 1ROEA 2Z8LA 3CIRB 4KGTA 1K50A 4ARCA 2K9XA 2MJEA 1IUEA 1FMAD 2CJNA 2GI9A 2DYMA 4GDKB 2ACZB 4ITKA 1E9MA 3PO0A 1K51A 1T6BX 1FO4A 2WXKA 4ZRQA 1E7PB 3EA6A 3SFEB 4US9A 4RH6A 4JWSC 4N59A 4NZLB 2MH7A 4OVZA 4NJCA 4HKQA 1JWAD 1FCCC 2JQRB 3BWUD 5BYQA 2WU5B 1SJED 3LB8C 4RGTA 5BMGA 3E9SA 2J42A 3PZ7A 2J53A 4KKJA 1XLPA 2G1EA 2HDEA 1TS2A 2E6XA 2Y5PA 4HJGE 3DWGC 4EE2A 1FD6A 3FC4A 1FM0D 1ZXIA 4PT5A 1E10A 1FEHA 2VZKD 3KQ4A 2WXQA 1KF6B 1PGXA 1YN3A 4WURA 4B0EA 4YSYB 1D5XC 4DQOC 3SR6A 4LLGM 1C4PA 3P4PB 4N58A 1FRDA 3NVVA 1L0XB 2BBCA 2OEDA 1I4QA 1QOBA 2WS3B 1TKGA 2PVGC 5FK9C 1TY0A 2QIEB 3W9CB 4XDDA 3GS2A 1IGDA 3Q8BA 1ENFA 1MI0A 1KTKA 2JYTA 4WH4A 3WCQA 1C77A 2WDRB 3AMZA 4OHJA 2I2YA 3I9V1 3BZDB 3HRDD 2KMMA 1D6EC 1PFDA 1SSNA 3AEAB 4HROA 1GB1A 1XLNA 2YEPF 1VDVA 4YWGG 1DOIA 1BMLC 1WSPA 3RPFC 4MT5A 4DXGA 3TEWA 2KWDA 1V1PA 2PW9A 1I4HA 2HTME 5BYRA 1MPEA 2PLPA 3AE5B 1N60A 3V05A 1L6VA 1C4AA 3Q69A 2M56B 4JX1C 3BVZA 3BK2A 2K22A 1JMLA 2XNAC 2INPE 3E56A 2JX5A 3B9JA 1E0ZA 1FFVA 1UNSA 2H89B 1HZ6A 1VZ7A 2PVOD 3NVWA 5HHDG 2DBYA 2EKIA 2BS2B 3AEDB 4R3DA 1HZ5A 2W3SA 5AUIA 3AECB 1FXIA 1FNWA 1WXQA 3ZJTA 4P16A 2WDVB 1HQRD 2PKOA 4KGRA 2NTSA 2WXFA 5H8YE 1V1PB 2XN9C 1C9FA 3ZJUA 2IJ0A 1ACCA 4C80A 1YJIA 5EE0A 4M0WA 1VR9A 5D7GA 2MJ3A 2YEPB 1SEBD 3T3OA 1HXYD 2WXJA 1FIQA 1I4GA 1QF6A 4TMAB 1F2RC 3GB1A 4H2AA 3NRZA 4KX6B 3VR9B 1WYGA 3TEYA 3P42A 1I4PA 4YSXB 2FBWB 1EU4A 1VLBA 4YTMB 2V3NA 3MJ5A 4C7ZA 1YJJA 4NAMA 2BYTA 4ZRPA 2X38A 4A6QA 3TEZA 1BUIC 4RGMA 1RFKA 1YQ3B 3AEEB 2E3TA 1P7FA 1A70A 1EM7A 2AX5A 1EU3A 4ZHOA 2IPKD 2R61A 4L1BA 1DOYA 1ZOYB 1SXTA 4MACA 1N63A 3CWIA 1NI3A 1GPXA 2WXNA 4WWMA 1F77A 5I4DA 4GLSC 5AUKA 2CJOA 4IDIA 3KLSX 1YN5A 1STEA 2BS4B 2WU2B 3P4SB 4WIPA 3W2DA 4O1NA 5G5HA 3B2GA 1EWYC 2JWUA 3U4EG 1QLBB 3Q8CA 1OQQA 4AQ7A 2V4IB 1SJHD 3ABVB 3MP9A 2IGHA 1LO5D 1UWMA 4YT0B 2V3PA 1FNUA 3BVGA 1PDXA 5C3JB 4AS1A 1C76A 1XO3A 3T3NA 2W54A 4HEA1 1T3QA 2WXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWL A;  2M19 A;  1NYQ A;  1QT9 A;  3AE7 B;  2HTM E;  1QOF A;  1N60 A;  1L0V B;  3AE5 B;  3P63 A;  4P6V F;  4USA A;  4A9A A;  1L6V A;  1JWB D;  1J7C A;  3NVZ A;  2M56 B;  2BT6 A;  4JX1 C;  3NS1 A;  3EUB 2;  1JRO A;  2K22 A;  2WQY B;  1RM6 C;  2BS3 B;  2N0S B;  2WP9 B;  1N62 A;  2H88 B;  4ZHP A;  3AEB B;  3AE6 B;  5EE9 A;  1NYR A;  2JX5 A;  3B9J A;  3LXF A;  2Y5C A;  1FFV A;  1KFY B;  2H89 B;  2L52 A;  3P4Q B;  1E0Z A;  3FAH A;  2PVO D;  3NVW A;  4YSZ B;  2DBY A;  5MPO A;  2EKI A;  2BS2 B;  3AEG B;  1WGK A;  3AED B;  3AEF B;  2W3S A;  1XLO A;  2CU3 A;  1JW9 D;  3W5U B;  4YTN B;  5AUI A;  3AEC B;  3AM9 A;  5C2T B;  1PUT A;  3B2F A;  1FXI A;  1ROE A;  2LEK A;  3CIR B;  1WXQ A;  1R7S A;  2WDV B;  2K9X A;  1DOX A;  2MJE A;  2PKO A;  1IUE A;  1FXA A;  1YQ4 B;  1WWT A;  1FMA D;  2CJN A;  5H8Y E;  3VR8 B;  5GXG B;  1E6E B;  1J7A A;  3AN1 A;  1JRP A;  4C80 A;  3BII D;  2ACZ B;  3AE1 B;  4ITK A;  1E9M A;  1YJI A;  3PO0 A;  5EE0 A;  3AE3 B;  1WRI A;  1FO4 A;  2MJ3 A;  2W55 A;  1E7P B;  3SFE B;  1QOG A;  1FIQ A;  5EE1 A;  2QJL A;  1F0Z A;  4US9 A;  1QF6 A;  4ZOH C;  2WLB A;  4JWS C;  4N59 A;  4YXD B;  2MH7 A;  3VRB B;  3NRZ A;  5EE3 A;  1SIJ A;  1FFU A;  3HUI A;  4KX6 B;  3ZYY X;  1JWA D;  1RYJ A;  1WYG A;  2JQR B;  3AE8 B;  2WU5 B;  3VR9 B;  1NEN B;  3LB8 C;  1J7B A;  1DGJ A;  3NVY A;  1N5W A;  2MJD A;  4YSX B;  2FBW B;  1JQ4 A;  1NEK B;  1TKY A;  2PIA A;  1VLB A;  4YTM B;  1V97 A;  4C7Z A;  1VJK A;  1XLP A;  1YJJ A;  2G1E A;  2W3R A;  4FXC A;  4LTU A;  1RWS A;  1SF0 A;  1RFK A;  3P1M A;  1YQ3 B;  3AEE B;  2E3T A;  4HRS A;  1OFF A;  2Q5W D;  3SFD B;  4C7Y A;  1AYF A;  2L83 A;  3DWG C;  4US8 A;  1NVI D;  1A70 A;  2AX5 A;  3FC4 A;  1FM0 D;  3AB5 A;  3AV8 A;  1ZXI A;  3P4R B;  4ZHO A;  3AE9 B;  1E10 A;  1JAL A;  1DOY A;  2K5P A;  1B9R A;  1ZOY B;  3AH7 A;  1ZUD 2;  2DWQ A;  1N63 A;  1V8C A;  2KAJ A;  1KF6 B;  1I7H A;  3AE2 B;  1NI3 A;  3CWI A;  2OHF A;  3DWM A;  3HVZ A;  3L4P A;  4YSY B;  1GPX A;  2B76 B;  3AE4 B;  1TJE A;  1ZP0 B;  2WDQ B;  5G5G A;  1N61 A;  5H92 C;  3SR6 A;  4WWM A;  3VRA B;  3P4P B;  1TKE A;  5AUK A;  4N58 A;  1FRD A;  3NVV A;  1TYG B;  2CJO A;  1SB3 C;  4IDI A;  3W5V B;  1QOB A;  2WS3 B;  1CJE A;  1L6U A;  1TKG A;  2PVG C;  2BS4 B;  2WU2 B;  3P4S B;  2QIE B;  3W9C B;  1XLQ A;  5G5H A;  1QOA A;  3B2G A;  1EWY C;  1FRR A;  3ETR A;  1QLB B;  1OQQ A;  1L5P A;  3WCQ A;  2WDR B;  1N5X A;  3AMZ A;  1AWD A;  3ABV B;  3HRD D;  2KMM A;  1PFD A;  3AEA B;  1UWM A;  1OQR A;  4YT0 B;  4YTP B;  1GAQ B;  1PDX A;  4HRO A;  5C3J B;  1XLN A;  1XO3 A;  1CZP A;  1VDV A;  1DOI A;  4JWU C;  1KRH A;  2W54 A;  1T3Q A;  3RPF C;  4WQM A;  4N6E B; 
#chains in the Genus database with same CATH topology
 1C79 A;  4X57 B;  2ZPN A;  2DZK A;  2CU1 A;  2JVC A;  4XWT A;  4M00 A;  4JE3 B;  4GXB A;  2MW5 A;  4URK A;  4FAD A;  2Z59 B;  4MEL A;  2WHI A;  1V81 A;  2K8B A;  3IFW B;  2N9X A;  4YTN B;  1PUT A;  2GBR A;  1TS3 A;  2QMT A;  2XK5 B;  1CMX B;  3GOE A;  1N6Z A;  3JYU A;  5HG2 A;  2L00 B;  3FIL B;  3AN1 A;  4JIO U;  2D10 A;  2REX A;  1QIL A;  1PGB A;  3AE3 B;  1K53 A;  2RPV A;  2C9W B;  3MC0 B;  4MSM B;  2QJL A;  2G3Q B;  3R2T A;  2NBW B;  2GBK A;  1SIJ A;  5FR3 A;  2I38 A;  5E6J A;  2RD0 A;  4B6W A;  3Q8F A;  1C78 A;  3L0W B;  2TSS A;  1TKY A;  2PIA A;  3ZO5 B;  5AZF A;  1UGM A;  3ECI A;  2K8H A;  2BKR B;  2ZW0 A;  2Q5W D;  4C4V B;  2UYZ B;  1IBX A;  1UUP A;  1YX6 B;  1XCT L;  4HXD A;  1TZO A;  1JAL A;  3MC8 A;  3WAO A;  3AH7 A;  4XX5 A;  1ET6 A;  2KWC A;  4TSS A;  2HJ1 A;  2WDQ B;  2M8S A;  2GRI A;  2LVQ A;  1L4D B;  4KDL B;  4N9F 4;  1RRB A;  3H1U A;  1D5Z C;  1L4Z B;  4HCP B;  1QOA A;  2V0G A;  4K1R B;  2K6Q A;  3ZNI D;  2AQ2 B;  3RCZ A;  4RGO S;  1C1Y B;  2LHD A;  2YLM A;  3NS8 A;  1CZP A;  3C8Y A;  1KRH A;  1YNT E;  4DXF A;  2FCS A;  3U7Z A;  1F2R I;  3KYC D;  3QAR A;  4A8X C;  4L23 A;  4EUT A;  3TMP B;  2ZCB A;  2PEA A;  5BYS A;  3IAS 1;  3NS1 A;  3UF8 A;  1N62 A;  2NMQ A;  1HE8 A;  5FKA C;  3H8H A;  4BZA A;  2ZJD A;  4AJY B;  2JYE A;  1TZ1 A;  2LXC A;  3ZDM C;  2LRW A;  4LJP B;  3Q8E A;  1FXA A;  1T5X D;  3RZW C;  4REZ A;  1T0R C;  1GC7 A;  1WGG A;  4W9F A;  1R4N B;  1ZE3 D;  2W55 A;  1KOT A;  4G11 A;  1WXS A;  1QOG A;  3RUI B;  5EE1 A;  2WLB A;  1OQY A;  4W9D A;  3DHI C;  2B3A A;  1S1Q B;  1SGH A;  2N9L A;  3N9Y C;  3MFG A;  3HUI A;  5JH5 C;  2WDT B;  2KJH B;  5TSS A;  1ZDX A;  4FUL A;  1XXG A;  1AW7 A;  3I3T B;  3NUH B;  3ML8 A;  4JLC A;  2N7J A;  4TV3 A;  3QQ8 B;  1R4N I;  2M4N A;  3W1Y A;  3LYY A;  4DDI D;  2MCN B;  1JWS D;  1J0G A;  2FIF A;  2O2V B;  3H6N A;  3AB5 A;  1Q5W B;  3AV8 A;  3P4R B;  4HLE A;  1PGA A;  3URY A;  1B9R A;  3AE2 B;  4BKG A;  3DWM A;  2JZZ A;  5G5G A;  2C60 A;  1X1M A;  3O13 A;  1TYG B;  1SB3 C;  3WA0 A;  2K25 A;  4AOF A;  5BMH A;  4LNI A;  1XLQ A;  1RFA A;  5J17 A;  2KK8 A;  2K1F A;  2ON8 A;  3UIO B;  4A55 A;  4XWW A;  3BK1 A;  2NPT A;  4KZC A;  3BYY B;  4RF1 A;  5CHF A;  4ACF A;  3KWL A;  2KHW B;  1DYQ A;  5T8I A;  2XK5 A;  3P63 A;  1L0V B;  3VQI A;  4A9A A;  2GBN A;  3PLV A;  1CK1 A;  1J7C A;  3W1S C;  4WQO B;  3PHX B;  4FBJ B;  4W9C A;  1JRO A;  3UQB A;  2L52 A;  3SEB A;  4ANX A;  2I1J A;  4UDU C;  1L0Y B;  1GJZ A;  1XLO A;  2BW2 A;  3CIR B;  1K50 A;  3DVN V;  2MJE A;  2CJN A;  4IWO A;  2I1K A;  4GDK B;  1SE9 A;  1E9M A;  4ITK A;  4BBN F;  2WXK A;  3RN9 C;  3SFE B;  3OJ3 A;  3RNC C;  4CO7 A;  4NJC A;  2AWT A;  1JWA D;  3BWU D;  2JQR B;  5BYQ A;  2WU5 B;  1E90 A;  1WRD B;  4I6L B;  3BIN A;  2KLG A;  2QCZ A;  4KDI C;  4ZDV A;  2E6X A;  3T8M A;  3FC4 A;  1ZXI A;  4PT5 A;  2ZNV C;  2MQJ A;  3C19 A;  3X23 A;  3KQ4 A;  5IA7 A;  4PS7 A;  1PGX A;  4WUR A;  3N3K B;  3SR6 A;  3SU8 X;  5FK9 C;  1M94 A;  1TY0 A;  2D11 A;  4XDD A;  1IGD A;  2JYT A;  3DHH C;  2WDR B;  4OHJ A;  3I9V 1;  2KMM A;  1PFD A;  1SSN A;  2K39 A;  4HRO A;  2YEP F;  3A1Q A;  4I6P A;  3TEW A;  5DCN A;  2HTM E;  1MPE A;  1N60 A;  3S2A A;  3Q69 A;  4JX1 C;  3K9P B;  2VH2 A;  4AWJ A;  1GG3 A;  2N7E A;  4HWI B;  3E56 A;  3MHS D;  1HZ6 A;  3HM3 A;  5DPW A;  4R3D A;  3PRP B;  1WH3 A;  4GB9 A;  5LXH A;  2XN9 C;  3ZNG C;  1WF9 A;  1E8Y A;  4S17 A;  5E6P A;  2IJ0 A;  2IO0 B;  1E5W A;  2KDF B;  2LVO A;  4C00 A;  2K8C A;  3HK0 A;  1VR9 A;  1SEB D;  3T3O A;  1I4G A;  2G45 B;  3DBS A;  4WWN A;  3NRZ A;  4QAY A;  4KX6 B;  3KH0 A;  1T0S C;  3TEY A;  5D94 A;  4YSX B;  1Q1O A;  2OJW A;  4JQW C;  3PRE A;  2V3N A;  3VUY A;  2LAS A;  2EMS A;  2KMC A;  3TEZ A;  3AEE B;  2E3T A;  1P7F A;  4M01 A;  1E7U A;  3K9O B;  2NS5 A;  2IPK D;  4BKS A;  1WJ4 A;  2KO3 A;  3NY5 A;  2NVU I;  4MDK E;  3L13 A;  3PS6 A;  2OOB B;  5AUK A;  2CJO A;  3KLS X;  1YN5 A;  4W9H A;  2WU2 B;  2CHW A;  3W2D A;  4O1N A;  1E8X A;  5G5H A;  4IC7 B;  3B2G A;  1HTQ A;  4TKN A;  2L05 A;  3A4R A;  3MP9 A;  1F1H A;  3M62 B;  2RDB C;  2D3A A;  4YT0 B;  3OG5 A;  1VCB A;  3AI5 A;  4S0R A;  3A1Q B;  4OVV A;  2W54 A;  1T3Q A;  1TGZ B;  3L10 B;  4KIK A;  2JRI B;  5E6N A;  3NHE B;  5KHO A;  4HPL B;  1KLU D;  1P9D U;  3PHW B;  1JWB D;  2BT6 A;  4XE0 A;  2GMI C;  2SAK A;  2LVP A;  4GDK A;  3TUO A;  3CF6 E;  1D3Z A;  1RM6 C;  1B1Z A;  1PYW D;  4MH8 A;  1ESF A;  3PLU A;  1ZXH A;  1ZDV A;  3PTF C;  1D4B A;  3W5U B;  2LEK A;  4ARI A;  2LRU A;  3KW5 B;  2LGX A;  2EEL A;  2M0A A;  3KWV A;  3VR8 B;  2LJ5 A;  4OW0 A;  3ZTC A;  4FHK A;  3ZTD A;  5IAA C;  4B0M A;  3UGB B;  2L1A A;  3U2S C;  3CST A;  3DBL I;  1WFY A;  2DAJ A;  2FUH B;  2W82 A;  3P2B A;  3TBL D;  1WI0 A;  1WIA A;  5G2N A;  3DBR I;  3RFZ B;  4NQK E;  3MJW A;  3DVN U;  5BO4 B;  2W3R A;  3R2I A;  2IBI B;  3Q2A C;  3V61 A;  4OZB A;  2ASQ A;  3DVG X;  1IGC A;  1JWU D;  3L08 A;  4NNJ B;  4W9K A;  3QHT A;  3IT4 B;  1QQR A;  1I4X A;  2DWQ A;  2WXM A;  1E8Z A;  2MBE A;  1R4M I;  1ZP0 B;  5H92 C;  1V49 A;  4HPP A;  1TKE A;  1CJE A;  3RNA C;  2MBH A;  2V9H A;  2AQ3 B;  2M0X A;  2HE7 A;  1WYW B;  4TQ0 A;  1L5P A;  3BVM A;  5IN7 A;  3LJ3 A;  2C7M B;  2FUG 1;  1GAQ B;  2ZPY A;  4HVB A;  2SEB D;  3APC A;  1I35 A;  3AE7 B;  2MWS B;  2BTE A;  5C1Z A;  2FCQ A;  2J7Q B;  4ANW A;  4EKU A;  4IWQ A;  3RNE C;  1GUA B;  1J8C A;  2Y5C A;  3DHG C;  1V86 A;  3R8B A;  3FKY A;  3I63 C;  1JW9 D;  2V4L A;  2LJI A;  4KGS A;  3PSE B;  1OEY A;  5CTR C;  1YQ4 B;  2R2O A;  4RFB A;  1Q0W B;  4PYU A;  1HA5 A;  2AL6 A;  3BII D;  3AE1 B;  3APF A;  2N9E B;  1QZE A;  1WE6 A;  3JSV B;  1XEE A;  2D07 B;  4OZA A;  1TY2 A;  3ZYY X;  4DHJ B;  3QIJ A;  4WAA A;  2BB6 A;  3JVZ X;  3GZN I;  3DBL B;  4FXC A;  5BMI A;  1V1O A;  4G3X B;  2LGI A;  3TEX A;  3P1M A;  1Y8R C;  3VUW A;  1SE3 A;  4US8 A;  1EF5 A;  1OEY J;  1YOV B;  3IAM 1;  4PS8 A;  3PRM B;  2LFI A;  4ZYN A;  3GZN B;  1WY8 A;  2PPH A;  3EGR A;  1XCQ L;  4M8N A;  2JPH A;  3QWZ B;  3EHV A;  2AQ1 B;  3PT2 B;  2WX0 A;  4GDL B;  2D2Q A;  3ETR A;  2KXJ A;  1XF5 L;  3I57 A;  4GIV A;  3PV1 A;  1AWD A;  4JGH B;  1YN4 A;  1MFW A;  3QAQ A;  1E7V A;  2X8X X;  3RD2 A;  4ICV A;  2HJ8 A;  4N6E B;  2JZP A;  1LFD A;  2QEJ C;  1JCK B;  1SIF A;  2KQ4 X;  5TR5 A;  2RDH A;  2WQY B;  4MJS B;  2KC1 A;  2CS4 A;  3HVD A;  3MC9 A;  4MEM A;  4YSZ B;  4K3B A;  3AM9 A;  3B2F A;  1ROE A;  3ZNZ B;  2EKE C;  2K9X A;  3RNB C;  4DHJ D;  1GNU A;  1AAR A;  1UBQ A;  3NOB A;  2GI9 A;  2QHO A;  2Z0D B;  4FJZ A;  1K51 A;  3NJT A;  3B1L X;  5HKH A;  3SDL C;  1V80 A;  3NZU A;  3ZRF A;  4US9 A;  4GSW A;  4N59 A;  2KVZ A;  4NZL B;  4BVU C;  1IPG A;  1ZW7 A;  3N20 C;  1WGY A;  4BFR A;  4YL8 A;  1WX9 A;  4RGT A;  3E9S A;  2KX3 A;  1A5R A;  3H9D A;  1WZ0 A;  1TS2 A;  3UQA A;  3DWG C;  3RUL A;  5E6O A;  2DEN B;  4BKT A;  2MA9 B;  4A20 A;  1BT0 A;  4B0E A;  1RAX A;  4LLG M;  3R7Q A;  3OJ4 B;  2OED A;  1I4Q A;  2D3G A;  1TKG A;  2PVG C;  3ZDT A;  4AJW A;  4II3 B;  1MI0 A;  1YD8 U;  1KTK A;  1WMH A;  4GOC A;  2I2Y A;  1R4M B;  3BZD B;  1VD2 A;  1D6E C;  1F52 A;  2KFK B;  3V6E B;  4E71 A;  3X0W A;  2LGD A;  1BML C;  1WSP A;  3VTW A;  4DXG A;  3R66 C;  2KWD A;  1V1P A;  2PW9 A;  3H7P A;  1RLF A;  5BYR A;  3JW0 X;  3AE5 B;  3V05 A;  3ZLZ A;  3EC8 A;  3ZVV A;  3Q3O C;  4EEW A;  4DHZ B;  4MJS A;  1JML A;  2Y5B B;  2XNA C;  5DPR A;  2INP E;  1FFV A;  1WX7 A;  4MGK E;  5GMV A;  2EKI A;  2BS2 B;  2CR5 A;  3AED B;  3RNG C;  4B9K A;  1HZ5 A;  2J0M A;  2W3S A;  5AUI A;  2J0J A;  1FXI A;  2XEW A;  1L2N A;  4AP4 C;  1HQR D;  1V1P B;  3H7P B;  2BYF A;  2MLB A;  3ZJU A;  4C80 A;  4FJV B;  4M0W A;  1TIF A;  2MJ3 A;  2WXJ A;  3KVF B;  4TMA B;  2KWV B;  2IO2 B;  2OJR A;  2AL3 A;  2FBW B;  1WXV A;  4BOZ B;  4C7Z A;  1ZKH A;  1YJJ A;  3DVG Y;  2JZ3 B;  1RFK A;  3V6C B;  1KLV A;  1WZ3 A;  3ZW3 A;  2RSU A;  3EFC A;  1A70 A;  1EM7 A;  4TUU A;  4ZHO A;  4G50 A;  4L1B A;  2M17 A;  1ZOY B;  4PK1 A;  1SXT A;  4MAC A;  3OAW A;  4WWM A;  5AEK B;  4RM9 A;  4F1S A;  3HIZ A;  4GDL A;  2MX2 A;  2JWU A;  4WWO A;  1OQQ A;  4B95 A;  2WX1 A;  1SJH D;  3ABV B;  1KJT A;  3ALB A;  2N4F A;  2V3P A;  2IYD B;  3BVG A;  4AS1 A;  5J18 A;  1XO3 A;  3AUL A;  5KHQ A;  4ICU A;  1WJU A;  2WXR A;  2MP2 B;  2L32 A;  3QJZ A;  2WXH A;  4USA A;  1V5T A;  1SE4 A;  2IDY A;  3M3J A;  1UGJ A;  2N9K A;  2N0S B;  2N1V A;  2CHX A;  3AEB B;  3ZUN A;  3LXF A;  4ZRJ A;  4MM3 A;  2QIL A;  5MPO A;  4EZJ A;  1SBB B;  2JRH A;  2KOX A;  2KT7 A;  2KC2 A;  2MHJ A;  4E74 A;  2NCN A;  2IO3 B;  2AYO B;  1HTO A;  1JRP A;  2PMV A;  4HCN B;  4IKG A;  1EWC A;  3BYT B;  2DZM A;  4JPS A;  4Q2J A;  4HDO A;  3Q6B A;  5JXV A;  4MM3 B;  4AUQ C;  1VZ6 A;  3TSS A;  2RMM A;  4NAW A;  3AE8 B;  2KQ7 A;  1P3Q U;  1Q10 A;  4ZYS A;  1J7B A;  1DGJ A;  1N5W A;  2QC8 A;  2RDG A;  1V97 A;  4LTU A;  3U52 E;  5IOI A;  3DPD A;  4IG7 B;  2L83 A;  3M63 B;  1IBX B;  1NVI D;  4KIK B;  5J2R A;  4PYZ A;  1MHH E;  2WXG A;  3IG3 A;  3RI7 C;  4XDC A;  2KYW A;  1BXT A;  4IOI E;  3W1S A;  2B76 B;  3AE4 B;  2JU6 X;  4EZK A;  4DBG A;  4NAW B;  2LUE A;  5LNK 1;  1MG8 A;  4MH0 E;  2HD5 B;  3VUX A;  3N1X C;  2LHE A;  3N1Z C;  1N5X A;  3DOW A;  2KN4 A;  2KZR A;  4M8M A;  2IZV B;  4YTP B;  2KJ6 A;  3QA8 A;  1SE2 A;  4EFO A;  1EO6 A;  3IBE A;  2O6V A;  1VRA B;  4JWU C;  2KFJ A;  5D6J B;  3UI3 A;  3WAM A;  4MGZ E;  1QT9 A;  5G55 A;  2ICI A;  1T0Q C;  2GB1 A;  1UWX A;  3B0A A;  2MBB B;  2JUO A;  2AEH A;  1OGW A;  3T9L A;  4L2Y A;  1NI2 A;  4LJO B;  5HFY A;  3I5J C;  4HKZ E;  4ZHP A;  2KD0 A;  3AE6 B;  5EE9 A;  1I4R A;  1GC6 A;  2NTT A;  2QSD A;  5JHB A;  3L54 A;  2ZCC A;  1V9J A;  1LM8 B;  2L3Z A;  4OZC A;  2WXO A;  2MP2 A;  3IXS A;  4XZ4 A;  1UZX B;  3A9K A;  2KX0 A;  2N7D A;  4J3O D;  1P7E A;  1WJN A;  2J4X A;  2KWU B;  2V3S A;  3EFU A;  1J19 A;  1ET9 A;  2PE6 B;  4W9L A;  1AN8 A;  1WR6 E;  1C3T A;  2K6D B;  4YXD B;  4RF0 A;  2J52 A;  1NEN B;  2D3B A;  3IHP C;  3NVY A;  1MVK A;  2NBV B;  5IO9 A;  1QKZ A;  2WYQ A;  1TS4 A;  2WXL A;  3O65 B;  2O6V D;  2Z0E B;  2JF5 A;  1SF0 A;  4HRS A;  1OFF A;  3Q14 C;  3SFD B;  2BWF A;  2MRP A;  4C7Y A;  1AYF A;  1F9J A;  3AE9 B;  2L0F A;  1VZ8 A;  2WXP A;  3HVZ A;  1KH0 A;  2PTL A;  2A4Z A;  2OHF A;  2BB5 A;  2KVR A;  3ZXV A;  3VXW A;  3VRA B;  1N61 A;  3W5V B;  1TS5 A;  4W9G A;  1L6U A;  5L95 C;  4NJ6 A;  3EEC A;  4EOY A;  4BAX A;  2RGF A;  2FCM A;  2LD9 A;  4M0W B;  3ZQ4 A;  1GB4 A;  4ANV A;  1FCL A;  1Z2M A;  4IM3 A;  3U7D A;  3J9C A;  3RNF C;  1E8W A;  3PRZ A;  2KN5 A;  4WQM A;  3A33 B;  1NYQ A;  4NJ7 A;  3OWE B;  5EDS A;  4P7I A;  3EUB 2;  5CHV C;  2ZW1 A;  2BS3 B;  3ZGZ A;  2N9P C;  1CQV A;  3FAH A;  5JHA A;  1V5O A;  2KLC A;  4P1C C;  1OTR B;  4XC2 A;  2Z8L A;  2M1M A;  5C23 A;  4KGT A;  4ARC A;  3GE8 C;  3RYT A;  4J6I A;  2KTR B;  2ACZ B;  3L16 A;  4KZ0 A;  3PO0 A;  1I42 A;  1T6B X;  3LDZ E;  3Q3N C;  3B08 A;  3MTN B;  3UIP B;  1ISN A;  4OVZ A;  4M02 A;  3UIN B;  1IYF A;  4HKQ A;  3ML9 A;  4C4V A;  2DX5 B;  1FCC C;  3DBR B;  3LB8 C;  2J42 A;  3RZF A;  2J53 A;  4KKJ A;  2G1E A;  3RT3 B;  3A9J B;  2Y5P A;  4A3O A;  4HJG E;  1FD6 A;  2G4D B;  3AU5 A;  2RR9 A;  2A5U A;  1FEH A;  1TTN A;  4KV2 A;  3VTV A;  4FHJ A;  4YSY B;  1D5X C;  4GGQ A;  1T0Y A;  2INC C;  1C4P A;  2VH1 A;  4N58 A;  1FRD A;  3NVV A;  2UWQ A;  2LWP A;  2QIE B;  2BVC A;  3W9C B;  3VTU A;  3GS2 A;  3R7R A;  1FPY A;  3PGE A;  1ENF A;  4HDQ A;  4NY0 A;  2MBQ A;  4WH4 A;  2CKH B;  1C77 A;  3AMZ A;  2ZVO A;  3HRD D;  3V60 A;  4IM2 A;  4K81 A;  3C0R B;  5L83 A;  1GB1 A;  1XLN A;  1VDV A;  4FA6 A;  4I6N B;  2MSE D;  5AZG A;  1L7Y A;  3PVL A;  4XGA B;  3V62 A;  4MT5 A;  3VH4 B;  1I4H A;  3VVW B;  1MG4 A;  2UU7 A;  2M56 B;  3D32 A;  3BVZ A;  1H8C A;  3BK2 A;  4DHZ E;  2KDB A;  1WGD A;  3B9J A;  1E0Z A;  2H89 B;  3WAL A;  1PQS A;  2PVO D;  3NVW A;  3ZIM A;  2IY0 B;  3DDC B;  1UH6 A;  4P16 A;  2WDV B;  4W9I A;  4ZRI A;  4KGR A;  3QX1 A;  2G4S A;  5H8Y E;  1ACC A;  1UEL A;  5EE0 A;  5D7G A;  3KYD D;  5CHW A;  1HXY D;  4II2 B;  4ASW C;  3ONS A;  3VFK A;  3APD A;  3GB1 A;  4PS3 A;  1WMH B;  1WXM A;  2L0T A;  1WYG A;  3QK0 A;  4EZL A;  1VLB A;  2CHZ A;  3MJ5 A;  2KAN A;  2X38 A;  2IO1 B;  1YQ3 B;  2KQS A;  3U8Z A;  2HTH A;  3A9K B;  5DPT A;  1NBF C;  2IY1 B;  3TL5 A;  4MGI E;  4K3C A;  1N63 A;  2LGY A;  4OVU A;  3WAN A;  2J0K A;  1F77 A;  3ENE A;  1YJ1 A;  4IDI A;  4A3P A;  1STE A;  2GBM A;  4WIP A;  1EWY C;  3U4E G;  4WJQ A;  4AQ7 A;  2V4I B;  2C7N B;  2PE9 A;  2IGH A;  1LO5 D;  3HHM A;  3T3N A;  4LCD E;  1WX8 A;  4HEA 1;  4KVG B;  2GLS A;  4P6V F;  2K0P A;  2D3C A;  1WE7 A;  3Q3J A;  1K8R B;  2JT4 B;  2WP9 B;  3HM6 X;  2H88 B;  4A90 A;  4ANU A;  3PPA A;  3P4Q B;  2PJH A;  4FN2 A;  3AU4 A;  3Q3M C;  3TIX A;  2G9H D;  3OLM D;  5C2T B;  4IWP A;  1GOZ A;  1DOX A;  1WWT A;  3ZJV A;  2K3U A;  4K7U A;  3GE3 C;  1E6E B;  3Q3F A;  1V6E A;  4NPN A;  4D2K A;  3A9J A;  3CMM B;  2KNB A;  5FR6 A;  4LDT D;  2JSV X;  4ZOH C;  4GMV A;  2WNM A;  4K7W A;  3R3M A;  2NR2 A;  4RGN A;  1FFU A;  4TQ1 A;  2NBU A;  4K7S A;  2KMA A;  2MJD A;  1NEK B;  4NQL B;  2IGG A;  2JY6 A;  5HI1 A;  2LUM A;  4G0N B;  2DAF A;  3GP7 A;  1V2Y A;  2K5P A;  4LNO A;  2WXI A;  4HK2 A;  1ZUD 2;  2KAJ A;  1I7H A;  3L4P A;  1YMH E;  2DYO A;  2Y3A A;  4RMA A;  1S3S G;  4MSQ B;  2KAC A;  3VAW A;  2RPQ A;  4WJO A;  3PZ8 A;  1FRR A;  4KKI A;  4GN1 A;  4CQN A;  1XD3 B;  1OQR A;  2JXX A;  4RNA A;  5D3I B;  3KUD B;  2IGD A;  1EUV B;  1UF0 A;  2M19 A;  4BBN C;  3N32 A;  1IP9 A;  1Z5S B;  2ONQ A;  1FNV A;  3NVZ A;  4FJY A;  2DZI A;  4LDT B;  2QDF A;  2JXT A;  3DBH B;  2KDE B;  2KDM A;  2NPT B;  4CYE A;  3FIL A;  4WJN A;  3AEG B;  1WGK A;  3AEF B;  2CU3 A;  1XT9 B;  3NZ3 A;  3Q8A A;  1R7S A;  2INN E;  2FNJ B;  4P1B C;  1M4V A;  2LGS A;  2FE8 A;  2BWE S;  5GXG B;  4C56 C;  1J7A A;  5D3D A;  1ZGU B;  2O6V B;  2IND C;  3ZXR A;  1WRI A;  3V3X A;  1YX5 B;  1F0Z A;  2EMT A;  1KLG D;  5CX3 A;  3SHQ A;  3VRB B;  5EE3 A;  1JRU A;  2LZ6 A;  1RYJ A;  1D5M C;  4IUM B;  1NDD A;  4F7Z A;  1JQ4 A;  3VHT C;  1VJK A;  4W9J A;  3N30 A;  1RWS A;  4IW0 A;  4DDG D;  2XBB C;  4RCO A;  1MHX A;  2BQQ A;  2D5G A;  4W9E A;  2ZEQ A;  1V8C A;  4LK0 M;  3DCG A;  2FAZ A;  3ZRC A;  5LLI A;  1TJE A;  1Y56 A;  4LNK A;  4WWP A;  1ZPS A;  2FID A;  2MEK A;  3QCA A;  1C4C A;  3TJP A;  2KTR A;  1WR1 A;  4CHK A;  4GU2 A;  2L76 A;  3ZNH B;  4E3C A;  4F8C B;  3IT6 B;  2BYV E;  3NG0 A;  3WIM A;  1JWM D;  2VZK B;  3VH3 B;  2LMC A;  4IM0 A;  1HEZ E;  1QOF A;  3MHZ A;  1P98 A;  1WM3 A;  2LXA A;  3PZD A;  5IKC M;  1NYR A;  1TBE A;  2YVC A;  4DXA B;  1KFY B;  1K52 A;  2C7H A;  2DLB A;  4WAF A;  3DBH I;  4MGY E;  3KUC B;  3NZS A;  3RMK C;  4LNF A;  1IUE A;  1FMA D;  1WXA A;  4DWF A;  2DHZ A;  2DYM A;  2ZZP B;  2MBO A;  3M95 A;  4RM8 A;  1WGR A;  1FO4 A;  4ZRQ A;  1E7P B;  3EA6 A;  4RH6 A;  1YIW A;  4JWS C;  2W9N A;  3ZKJ C;  1MJD A;  2MH7 A;  4XYC A;  3L17 A;  1SJE D;  4ZRK A;  3BY4 B;  5BMG A;  3PZ7 A;  1P0R A;  2O2V A;  2R2Q A;  2V1Y A;  2WGS A;  1XLP A;  1LXD A;  5DPS A;  2BGF A;  1WM2 A;  2HDE A;  1LQB A;  4LNN A;  2KKC A;  2LI5 A;  2GBJ A;  5LXI B;  4EE2 A;  2KTF A;  2DNF A;  1FM0 D;  1YQB A;  1E10 A;  2N1W A;  4DK5 A;  2VZK D;  3H7S A;  2WXQ A;  1KF6 B;  1YN3 A;  4DQO C;  3IVF A;  1UBI A;  3P4P B;  1L0X B;  2BBC A;  1QOB A;  2WS3 B;  1XQQ A;  5AZH A;  2BKF A;  2BPS A;  1P1A A;  2VRR B;  5D2M B;  3Q8B A;  3QC8 B;  3KUZ A;  2L7R A;  3WCQ A;  3A4S C;  3AXC A;  2GOW A;  4JL9 A;  3AEA B;  1U4A A;  1WGH A;  4YWG G;  1DOI A;  4BOS C;  3RPF C;  2DYB A;  2PLP A;  1L6V A;  1C4A A;  2ZVN A;  2KJR A;  2ZNV B;  2K22 A;  4FLH A;  4HPM B;  2DZJ A;  2WWZ A;  1TT5 B;  2JX5 A;  1UNS A;  1VZ7 A;  3DQV A;  2DBY A;  5HHD G;  2KDI A;  4KSL C;  3AEC B;  1FNW A;  3U30 A;  1WXQ A;  3ZJT A;  2PKO A;  2NTS A;  1LGR A;  5IP4 D;  2WXF A;  3JSV A;  1EF1 A;  1C9F A;  3WAP A;  2KFK A;  1YJI A;  2YEP B;  1FIQ A;  1QF6 A;  1H4R A;  3VDZ A;  1F2R C;  4H2A A;  4BKS D;  3VR9 B;  1WJ6 A;  3P42 A;  1I4P A;  3CSF A;  1EU4 A;  4YTM B;  2BYT A;  4NAM A;  4ZRP A;  3SD5 A;  1KM7 A;  4A6Q A;  1BUI C;  4RGM A;  1UD7 A;  2BF8 B;  1FXT B;  2AX5 A;  1EU3 A;  4HJK A;  3TCA A;  4KSK C;  2R61 A;  2FCN A;  1DOY A;  4WJP A;  3CWI A;  1NI3 A;  1GPX A;  2L8J A;  2WXN A;  1G6J A;  5I4D A;  4GLS C;  2BS4 B;  3P4S B;  2JWZ A;  1QLB B;  3Q8C A;  3N1Y C;  2BYE A;  1UWM A;  1FNU A;  1PDX A;  5C3J B;  1C76 A;  5JZE B;  2C5L C; 
#chains in the Genus database with same CATH homology
 2L32 A;  1C79 A;  2WXH A;  4P6V F;  4USA A;  1KLU D;  2K0P A;  1SE4 A;  1JWB D;  2IDY A;  2BT6 A;  4XE0 A;  4XWT A;  2SAK A;  1UGJ A;  4JE3 B;  3TUO A;  2N9K A;  1RM6 C;  2N0S B;  1B1Z A;  2WP9 B;  2H88 B;  4A90 A;  3AEB B;  3LXF A;  1PYW D;  3P4Q B;  4MH8 A;  2QIL A;  1ESF A;  5MPO A;  1ZXH A;  1ZDV A;  2G9H D;  1D4B A;  3W5U B;  4YTN B;  5C2T B;  1PUT A;  1GOZ A;  1SBB B;  2LEK A;  1TS3 A;  2QMT A;  4ARI A;  2EEL A;  1DOX A;  2M0A A;  1WWT A;  3KWV A;  3ZJV A;  2K3U A;  3VR8 B;  5HG2 A;  1E6E B;  3FIL B;  3AN1 A;  4OW0 A;  1JRP A;  4D2K A;  1QIL A;  2PMV A;  4IKG A;  1EWC A;  1PGB A;  3BYT B;  3AE3 B;  1K53 A;  4B0M A;  2RPV A;  3MC0 B;  4JPS A;  2JSV X;  2QJL A;  3R2T A;  4ZOH C;  2WNM A;  4Q2J A;  5JXV A;  4MM3 B;  2L1A A;  1SIJ A;  4RGN A;  3U2S C;  5FR3 A;  1FFU A;  1VZ6 A;  2I38 A;  2RMM A;  2W82 A;  4TQ1 A;  5E6J A;  3TSS A;  3AE8 B;  3Q8F A;  1C78 A;  1Q10 A;  4ZYS A;  1J7B A;  1DGJ A;  1N5W A;  2MJD A;  3RFZ B;  2TSS A;  1NEK B;  1TKY A;  2PIA A;  2RDG A;  1V97 A;  2W3R A;  3R2I A;  4LTU A;  3U52 E;  2IGG A;  4OZB A;  5HI1 A;  2ZW0 A;  2Q5W D;  2LUM A;  1IGC A;  1IBX A;  1JWU D;  2L83 A;  1UUP A;  1IBX B;  1NVI D;  3IT4 B;  1XCT L;  1QQR A;  3GP7 A;  1TZO A;  1MHH E;  1JAL A;  2WXG A;  2K5P A;  2WXI A;  1I4X A;  1ZUD 2;  2KAJ A;  2DWQ A;  2WXM A;  3AH7 A;  4XDC A;  1I7H A;  3L4P A;  1ET6 A;  1BXT A;  1YMH E;  4IOI E;  4TSS A;  2B76 B;  3AE4 B;  3W1S A;  2DYO A;  1ZP0 B;  2WDQ B;  5H92 C;  2JU6 X;  2GRI A;  2Y3A A;  1TKE A;  4NAW B;  1L4D B;  5LNK 1;  1CJE A;  2KAC A;  1D5Z C;  1L4Z B;  1QOA A;  2LHE A;  3PZ8 A;  2AQ3 B;  2V0G A;  1FRR A;  4TQ0 A;  1L5P A;  3BVM A;  1N5X A;  2FUG 1;  2AQ2 B;  2KN4 A;  4KKI A;  4RGO S;  4CQN A;  4YTP B;  1OQR A;  2LHD A;  1SE2 A;  1GAQ B;  4RNA A;  5D3I B;  1VRA B;  1CZP A;  3C8Y A;  4JWU C;  1KRH A;  1YNT E;  2IGD A;  4DXF A;  3UI3 A;  3U7Z A;  1F2R I;  2SEB D;  2M19 A;  1QT9 A;  2ICI A;  2GB1 A;  3AE7 B;  1UWX A;  4L23 A;  4A8X C;  2BTE A;  5BYS A;  2ONQ A;  3IAS 1;  1FNV A;  3NVZ A;  4L2Y A;  3NS1 A;  5HFY A;  2JXT A;  4HKZ E;  4ZHP A;  1N62 A;  2KDM A;  3AE6 B;  5EE9 A;  1I4R A;  2NMQ A;  2QSD A;  2NTT A;  2Y5C A;  5FKA C;  3FIL A;  3H8H A;  3R8B A;  3AEG B;  1WGK A;  3AEF B;  4OZC A;  2CU3 A;  1JW9 D;  2JYE A;  2WXO A;  3IXS A;  3NZ3 A;  3Q8A A;  2LJI A;  4KGS A;  1R7S A;  2INN E;  3Q8E A;  1FXA A;  1YQ4 B;  1M4V A;  1T5X D;  2FE8 A;  4REZ A;  4J3O D;  4RFB A;  5GXG B;  4C56 C;  1P7E A;  2J4X A;  1J7A A;  5D3D A;  1HA5 A;  3BII D;  3AE1 B;  1ET9 A;  1WRI A;  3V3X A;  2W55 A;  1ZE3 D;  1AN8 A;  1QOG A;  1F0Z A;  5EE1 A;  1KLG D;  2WLB A;  4YXD B;  4RF0 A;  3VRB B;  1XEE A;  2N9L A;  5EE3 A;  4OZA A;  2J52 A;  3N9Y C;  3MFG A;  3HUI A;  1TY2 A;  3ZYY X;  1RYJ A;  1D5M C;  5TSS A;  1NEN B;  1ZDX A;  2BB6 A;  3NVY A;  1XXG A;  1AW7 A;  1MVK A;  1JQ4 A;  1QKZ A;  3NUH B;  1TS4 A;  2WXL A;  1VJK A;  4FXC A;  5BMI A;  1V1O A;  1RWS A;  1SF0 A;  2N7J A;  2LGI A;  3TEX A;  3P1M A;  3LYY A;  4RCO A;  4HRS A;  1OFF A;  1JWS D;  3SFD B;  4C7Y A;  1SE3 A;  1MHX A;  1AYF A;  4US8 A;  2D5G A;  3AB5 A;  3AV8 A;  3P4R B;  3AE9 B;  3IAM 1;  1PGA A;  3URY A;  1B9R A;  2LFI A;  1VZ8 A;  2WXP A;  3AE2 B;  1V8C A;  3HVZ A;  4LK0 M;  1KH0 A;  2PTL A;  3DWM A;  2OHF A;  2BB5 A;  1TJE A;  3VRA B;  3EGR A;  5G5G A;  1N61 A;  1Y56 A;  1XCQ L;  3O13 A;  1ZPS A;  1TYG B;  3W5V B;  1SB3 C;  1TS5 A;  2AQ1 B;  2MEK A;  1L6U A;  1C4C A;  5BMH A;  1XLQ A;  4GDL B;  3ETR A;  1XF5 L;  3I57 A;  2ON8 A;  3ZQ4 A;  1GB4 A;  1AWD A;  1FCL A;  4A55 A;  4XWW A;  1YN4 A;  3IT6 B;  3BK1 A;  3J9C A;  1JWM D;  2VZK B;  3BYY B;  4RF1 A;  4WQM A;  4N6E B;  2JZP A;  3KWL A;  5T8I A;  1DYQ A;  2LMC A;  2QEJ C;  1NYQ A;  1JCK B;  1HEZ E;  3OWE B;  2KQ4 X;  1QOF A;  3P63 A;  1L0V B;  3VQI A;  3MHZ A;  4A9A A;  1CK1 A;  1J7C A;  3EUB 2;  1JRO A;  2RDH A;  2WQY B;  2ZW1 A;  2BS3 B;  3ZGZ A;  3HVD A;  1CQV A;  1NYR A;  1KFY B;  2L52 A;  3FAH A;  4YSZ B;  3SEB A;  1K52 A;  4UDU C;  2DLB A;  1L0Y B;  4WAF A;  1XLO A;  3AM9 A;  3B2F A;  2BW2 A;  1ROE A;  2Z8L A;  3CIR B;  4KGT A;  1K50 A;  4ARC A;  2K9X A;  2MJE A;  1IUE A;  1FMA D;  2CJN A;  2GI9 A;  2DYM A;  4GDK B;  2ACZ B;  4ITK A;  1E9M A;  3PO0 A;  1K51 A;  1T6B X;  1FO4 A;  2WXK A;  4ZRQ A;  1E7P B;  3EA6 A;  3SFE B;  4US9 A;  4RH6 A;  4JWS C;  4N59 A;  4NZL B;  2MH7 A;  4OVZ A;  4NJC A;  4HKQ A;  1JWA D;  1FCC C;  2JQR B;  3BWU D;  5BYQ A;  2WU5 B;  1SJE D;  3LB8 C;  4RGT A;  5BMG A;  3E9S A;  2J42 A;  3PZ7 A;  2J53 A;  4KKJ A;  1XLP A;  2G1E A;  2HDE A;  1TS2 A;  2E6X A;  2Y5P A;  4HJG E;  3DWG C;  4EE2 A;  1FD6 A;  3FC4 A;  1FM0 D;  1ZXI A;  4PT5 A;  1E10 A;  1FEH A;  2VZK D;  3KQ4 A;  2WXQ A;  1KF6 B;  1PGX A;  1YN3 A;  4WUR A;  4B0E A;  4YSY B;  1D5X C;  4DQO C;  3SR6 A;  4LLG M;  1C4P A;  3P4P B;  4N58 A;  1FRD A;  3NVV A;  1L0X B;  2BBC A;  2OED A;  1I4Q A;  1QOB A;  2WS3 B;  1TKG A;  2PVG C;  5FK9 C;  1TY0 A;  2QIE B;  3W9C B;  4XDD A;  3GS2 A;  1IGD A;  3Q8B A;  1ENF A;  1MI0 A;  1KTK A;  2JYT A;  4WH4 A;  3WCQ A;  1C77 A;  2WDR B;  3AMZ A;  4OHJ A;  2I2Y A;  3I9V 1;  3BZD B;  3HRD D;  2KMM A;  1D6E C;  1PFD A;  1SSN A;  3AEA B;  4HRO A;  1GB1 A;  1XLN A;  2YEP F;  1VDV A;  4YWG G;  1DOI A;  1BML C;  1WSP A;  3RPF C;  4MT5 A;  4DXG A;  3TEW A;  2KWD A;  1V1P A;  2PW9 A;  1I4H A;  2HTM E;  5BYR A;  1MPE A;  2PLP A;  3AE5 B;  1N60 A;  3V05 A;  1L6V A;  1C4A A;  3Q69 A;  2M56 B;  4JX1 C;  3BVZ A;  3BK2 A;  2K22 A;  1JML A;  2XNA C;  2INP E;  3E56 A;  2JX5 A;  3B9J A;  1E0Z A;  1FFV A;  1UNS A;  2H89 B;  1HZ6 A;  1VZ7 A;  2PVO D;  3NVW A;  5HHD G;  2DBY A;  2EKI A;  2BS2 B;  3AED B;  4R3D A;  1HZ5 A;  2W3S A;  5AUI A;  3AEC B;  1FXI A;  1FNW A;  1WXQ A;  3ZJT A;  4P16 A;  2WDV B;  1HQR D;  2PKO A;  4KGR A;  2NTS A;  2WXF A;  5H8Y E;  1V1P B;  2XN9 C;  1C9F A;  3ZJU A;  2IJ0 A;  1ACC A;  4C80 A;  1YJI A;  5EE0 A;  4M0W A;  1VR9 A;  5D7G A;  2MJ3 A;  2YEP B;  1SEB D;  3T3O A;  1HXY D;  2WXJ A;  1FIQ A;  1I4G A;  1QF6 A;  4TMA B;  1F2R C;  3GB1 A;  4H2A A;  3NRZ A;  4KX6 B;  3VR9 B;  1WYG A;  3TEY A;  3P42 A;  1I4P A;  4YSX B;  2FBW B;  1EU4 A;  1VLB A;  4YTM B;  2V3N A;  3MJ5 A;  4C7Z A;  1YJJ A;  4NAM A;  2BYT A;  4ZRP A;  2X38 A;  4A6Q A;  3TEZ A;  1BUI C;  4RGM A;  1RFK A;  1YQ3 B;  3AEE B;  2E3T A;  1P7F A;  1A70 A;  1EM7 A;  2AX5 A;  1EU3 A;  4ZHO A;  2IPK D;  2R61 A;  4L1B A;  1DOY A;  1ZOY B;  1SXT A;  4MAC A;  1N63 A;  3CWI A;  1NI3 A;  1GPX A;  2WXN A;  4WWM A;  1F77 A;  5I4D A;  4GLS C;  5AUK A;  2CJO A;  4IDI A;  3KLS X;  1YN5 A;  1STE A;  2BS4 B;  2WU2 B;  3P4S B;  4WIP A;  3W2D A;  4O1N A;  5G5H A;  3B2G A;  1EWY C;  2JWU A;  3U4E G;  1QLB B;  3Q8C A;  1OQQ A;  4AQ7 A;  2V4I B;  1SJH D;  3ABV B;  3MP9 A;  2IGH A;  1LO5 D;  1UWM A;  4YT0 B;  2V3P A;  1FNU A;  3BVG A;  1PDX A;  5C3J B;  4AS1 A;  1C76 A;  1XO3 A;  3T3N A;  2W54 A;  4HEA 1;  1T3Q A;  2WXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...