1OQQA

Crystal structure of c73s/c85s mutant of putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida, at 1.47a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin
publication title Crystal structure of putidaredoxin, the [2Fe-2S] component of the P450cam monooxygenase system from Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
total genus 23
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1oqqA00
1KRHA 1FRRA 4YSXB 3AEBB 2N0SB 2PKOA 1F0ZA 4YT0B 1OQQA 2QIEB 3W5UB 1IUEA 1NYQA 2W54A 3ETRA 3RPFC 3P4QB 2CJNA 4C7YA 2WQYB 1NENB 1JWBD 1L5PA 1N5XA 1UWMA 3AH7A 3NVZA 1E10A 1YQ4B 1FRDA 1QOBA 1CZPA 3SFEB 2QJLA 5AUIA 1WYGA 5EE9A 3ABVB 3AEGB 3NVVA 5H8YE 1FFUA 2ACZB 3NVWA 3NRZA 1NEKB 5H92C 3ZYYX 4YTMB 3VRAB 2BS2B 1NVID 1JALA 4N6EB 3CWIA 3KWLA 1YJJA 2Q5WD 3NS1A 1PDXA 3W5VB 1GPXA 1QF6A 1N60A 3HUIA 4C80A 3WCQA 2L83A 3NVYA 3AECB 3P4SB 2W55A 1VJKA 4YSZB 1ZP0B 2K22A 2WS3B 2MJDA 3AEFB 2M56B 1FM0D 1GAQB 2FBWB 1WGKA 3FAHA 4KX6B 1QLBB 1FXAA 1XLOA 3AEEB 3LB8C 4US8A 3VRBB 3P1MA 1XLQA 2EKIA 3P4RB 1RYJA 4IDIA 1RM6C 1TKEA 3AE1B 3VR8B 3AE3B 1E9MA 1XLPA 2AX5A 4WQMA 2WU5B 2Y5CA 4ITKA 3AN1A 2BT6A 1SF0A 4P6VF 2K5PA 1N63A 1VDVA 4LTUA 3SFDB 1JWAD 4HROA 5G5HA 3LXFA 1FIQA 2K9XA 2E3TA 2L52A 3AM9A 2WP9B 1DOYA 1NYRA 2W3RA 1PUTA 2HTME 2MH7A 1VLBA 4USAA 1NI3A 4ZHOA 2OHFA 1DGJA 1QOAA 3SR6A 3AE7B 2BS4B 1WRIA 2WU2B 1XLNA 1ZUD2 2MJEA 5G5GA 3AE8B 1J7CA 3P4PB 5EE3A 4HRSA 2BS3B 5EE1A 1QOGA 1JRPA 3EUB2 1RFKA 2H89B 1J7BA 3AEAB 1WWTA 4ZHPA 1L6UA 2MJ3A 4WWMA 1SIJA 1RWSA 2WLBA 3CIRB 1JROA 4JWSC 1E0ZA 1JQ4A 1SB3C 1E6EB 3HRDD 3P63A 1QT9A 1WXQA 1FXIA 1N61A 5GXGB 1I7HA 1V8CA 1AYFA 1YJIA 4ZOHC 1CJEA 3AE2B 4JX1C 1OQRA 3W9CB 3AE6B 4N58A 2JQRB 4YSYB 4YTNB 1L6VA 3AE4B 5EE0A 3VR9B 2KAJA 1JW9D 3B2GA 4JWUC 2H88B 3DWMA 3AMZA 4C7ZA 1PFDA 1YQ3B 4FXCA 3FC4A 1J7AA 1L0VB 2DWQA 1FMAD 1N62A 3AEDB 3B2FA 1ROEA 3AV8A 3HVZA 2DBYA 4US9A 2CU3A 4YTPB 2B76B 2PVGC 1DOXA 1T3QA 2KMMA 2LEKA 1TKYA 1ZXIA 1R7SA 1V97A 2M19A 5MPOA 1EWYC 2W3SA 1XO3A 2PVOD 3AE5B 3DWGC 2CJOA 3AB5A 2WDVB 1N5WA 3B9JA 1E7PB 2PIAA 3BIID 1AWDA 1ZOYB 3AE9B 3L4PA 4N59A 1KF6B 1KFYB 2G1EA 1B9RA 1DOIA 5C2TB 4YXDB 1QOFA 1TYGB 2JX5A 1TKGA 3PO0A 1FFVA 5C3JB 2WDRB 4A9AA 1FO4A 2WDQB 1OFFA 5AUKA 1TJEA 1A70A
chains in the Genus database with same CATH superfamily
4TUUA 2Z0DB 1PQSA 1V1PA 4YT0B 2D2QA 1V1OA 2J42A 3DCGA 4RFBA 1KLUD 1WX7A 5AZFA 4GB9A 2L05A 3ML9A 1L5PA 1UBQA 3V61A 4AJYB 4K3BA 1YQ4B 1CZPA 1I4XA 2BKFA 4QAYA 4FADA 1FFUA 2AYOB 4K81A 5AZHA 5CHVC 3Q8EA 4XWTA 2G4DB 2I1JA 1UUPA 2KFKB 2NPTB 1N60A 1GUAB 3GS2A 1UGJA 1EF1A 3VTVA 3PSEB 4EOYA 3PRZA 1UBIA 1XD3B 4US8A 3W1SA 2ZPNA 3OWEB 2DNFA 2AX5A 3ZJTA 2FUG1 3Q8FA 2PEAA 1L0XB 1OEYA 1FIQA 3RN9C 2WP9B 5C1ZA 2V9HA 1VLBA 1QQRA 2PPHA 2BKRB 1HZ5A 2GBJA 2BS4B 2NTTA 1ZUD2 3RUIB 5G5GA 2IBIB 3WAPA 4JWSC 3DBHI 1WJ4A 2JPHA 3R3MA 3VR9B 3DWMA 4FXCA 5L95C 1WR1A 4I6LB 2DWQA 1VR9A 5CHFA 4J3OD 2D11A 1R4NI 2KDIA 2BVCA 4C4VA 4ACFA 1XO3A 3MC8A 4AS1A 4DBGA 3BK2A 4B0EA 2HJ1A 2FE8A 4AP4C 1WXSA 1PYWD 3U30A 3RCZA 1WIAA 4A9AA 3APCA 1ET6A 1WJ6A 3IVFA 3Q8AA 3V62A 1F0ZA 1CMXB 3W5UB 1Z5SB 1GG3A 1V1PB 1FO4A 3AH7A 2XEWA 3DBRI 4PS8A 4RGMA 2WGSA 1NEKB 3NRZA 4NJ6A 3VRAB 1JALA 2KX0A 1T0QC 4S0RA 2WX1A 3KVFB 3N1YC 1C9FA 3HUIA 2INDC 3C19A 2AEHA 1QLBB 1AW7A 4L2YA 3AE1B 4GIVA 2IGDA 2KWVB 1GJZA 2MCNB 4LTUA 2D3BA 2L52A 1UH6A 2KANA 3MFGA 1LM8B 3O13A 2ZW0A 4ZYNA 2JZZA 3ZTDA 4NNJB 1XXGA 3TIXA 4WWMA 5E6OA 1P7FA 1FXIA 2IPKD 4BOZB 1AYFA 2HJ8A 1TTNA 3AE6B 4YSYB 3T3NA 4C7ZA 4WJQA 4ZRJA 3AV8A 3NUHB 1ENFA 2KMMA 4X57B 1V97A 3ZDTA 3AE5B 2A4ZA 1N5WA 3JSVA 4C4VB 2IO2B 1IGDA 4FLHA 4KDLB 1VZ8A 1QOFA 2WXFA 3CSTA 2JYTA 3PO0A 2G45B 3IG3A 4YSXB 4EZKA 4FULA 2D5GA 1C79A 1F77A 1E10A 1HXYD 4BKSD 5LXHA 4ICVA 3QHTA 1HTOA 1YNTE 2YLMA 4DWFA 3MC9A 1C78A 1SGHA 2PLPA 2BYTA 4ASWC 4DDGD 2EKEC 1FD6A 2OOBB 3NOBA 1F2RC 1SEBD 4HXDA 1GPXA 2RMMA 3PLUA 3AEFB 3BWUD 1K50A 1HZ6A 1SE2A 1YQBA 2V4IB 3P1MA 3P4RB 3R8BA 3UQAA 1JWSD 3TJPA 1E9MA 1XLPA 2KHWB 4KSLC 5J2RA 2LGXA 4ANUA 1N63A 3Q3JA 1PGAA 4HROA 3KLSX 3WIMA 3AM9A 1YN5A 4EE2A 3V60A 1ET9A 4M02A 1XF5L 1Z2MA 3MJWA 3L17A 3D32A 3AEAB 4KGSA 4ZRIA 2X38A 3CIRB 2L1AA 2KDEB 1ZGUB 4MH8A 2KJHB 3DVGY 4A20A 3AE2B 4FHKA 3LDZE 1E8ZA 2R61A 3MHSD 3GE3C 4NAWA 1P1AA 2LASA 3HVZA 1XCTL 5AEKB 1YN3A 2MEKA 4K7WA 1SE4A 1ZXIA 2AQ1B 4TV3A 4JGHB 5MPOA 1G6JA 3U8ZA 4HDOA 4WJOA 1AWDA 4IWOA 2D07B 3JSVB 3Q8CA 1MVKA 1A70A 4RMAA 4HPPA 3V6CB 1OQQA 2QIEB 1Q0WB 3ETRA 3ZQ4A 4XYCA 1FRDA 4JQWC 5AUIA 5FR6A 1I42A 1OEYJ 2YEPF 4IOIE 3H9DA 2PJHA 2Y5PA 5H92C 1AN8A 4HJKA 1UWXA 2LHDA 4FJZA 1V9JA 2XBBC 4DK5A 3GE8C 2C7NB 3U4EG 3NHEB 4AJWA 2KWUB 3VQIA 2WXOA 2MJDA 3U7DA 1C77A 1UNSA 3ENEA 3H6NA 3NJTA 4RGTA 1KOTA 4ZYSA 2QSDA 2KWDA 3MHZA 2BWES 2E3TA 5DPTA 2L76A 1WX9A 1E7VA 4K1RB 4ZRKA 5KHQA 2GBRA 1NI3A 2QMTA 2BYEA 4G11A 5CHWA 2WXQA 3EFCA 3EHVA 4ANVA 4MH0E 1QOGA 3DBLI 1TY0A 4W9CA 1SIJA 1UZXB 3J9CA 3K9OB 2G9HD 3A9KA 3HRDD 2M8SA 1P9DU 2MLBA 2MHJA 1RFAA 1L0YB 3TCAA 4FJVB 3AXCA 4B9KA 5KHOA 2BPSA 5GMVA 2JZPA 2ASQA 3PTFC 2LI5A 4NAWB 5BYQA 2DAJA 2M19A 3NZSA 2MBOA 2CJOA 1ZXHA 4XGAB 4W9EA 5CTRC 2V3SA 4N59A 4MGIE 4ICUA 1DOIA 2N1WA 3IBEA 3VAWA 1C4PA 1CQVA 1YJ1A 2EELA 3ZW3A 4JE3B 1E8WA 1FXTB 2WXPA 1FRRA 4TQ1A 1OTRB 3BY4B 2NBWB 2KFJA 2L0FA 4M01A 3SEBA 1TS2A 2J53A 3E56A 4KGRA 4KSKC 2OJWA 4LLGM 1NENB 1N5XA 2FCQA 4LDTB 5G2NA 3M95A 4EFOA 3A33B 3A1QA 3L10B 5EE9A 4BBNF 2K6QA 1WGGA 4H2AA 4N6EB 2DLBA 4C00A 2WHIA 4W9KA 2Q5WD 3IAM1 1I4HA 4C80A 2LVOA 2JF5A 1SE3A 1D5XC 2M56B 3ZNZB 1L2NA 3AEEB 3ZXVA 1WGYA 3JVZX 4FA6A 2RDGA 2K5PA 4MDKE 4EKUA 2QILA 2C9WB 3R66C 2NPTA 5TR5A 3VH4B 2QEJC 4HWIB 3UI3A 2IZVB 4A6QA 2OEDA 3ZJUA 1MHXA 4HJGE 2KC2A 4GDLA 3NY5A 1E6EB 3DHGC 2MQJA 4TMAB 2WYQA 3CMMB 1I7HA 3GB1A 3A9KB 2LRWA 2N1VA 3DPDA 1T0SC 1I4RA 1YQ3B 5L83A 1SXTA 3KW5B 3EC8A 2K1FA 2D10A 4URKA 2XNAC 4XWWA 2C5LC 4YTPB 3Q14C 2IY0B 2GRIA 4HDQA 4RGNA 3UIPB 2FUHB 3IHPC 3O65B 4KVGB 2Z8LA 3DQVA 3ZTCA 2MP2A 3EECA 3TBLD 1QZEA 1OFFA 3ZVVA 1N6ZA 4E71A 4PS3A 1FPYA 1KM7A 3KUZA 2LVQA 3VTUA 4WURA 2ZJDA 4P16A 2CJNA 2WXGA 2VZKB 3GP7A 4ZRPA 3RZWC 4II3B 2N7EA 5H8YE 4F7ZA 3N1XC 2V0GA 3TEZA 1MG8A 1NVID 3A1QB 5G55A 2RD0A 2KOXA 4A3OA 1NI2A 2KLGA 2ZEQA 3ALBA 1QF6A 4CQNA 1D5ZC 3BK1A 3ZLZA 2L83A 3AECB 5BYRA 3DVNU 3KH0A 3RMKC 3T9LA 1TS3A 3MP9A 3LB8C 3ZNHB 2LRUA 2M4NA 5C23A 3AE3B 2JWZA 1UGMA 2OJRA 4AUQC 2J0KA 2PE9A 2W3RA 2MBHA 4ANXA 4XC2A 4JIOU 1WXVA 2NMQA 5IP4D 1WRIA 3L16A 3ZNID 2KVZA 5HFYA 2JZ3B 1C1YB 4OZCA 3B08A 3DBHB 4GDLB 4GXBA 4EZLA 2NVUI 4HPMB 3APDA 1P98A 1D5MC 3UIOB 1ZKHA 2J4XA 5EE0A 3Q3FA 3N3KB 4HKQA 1YX5B 5D3DA 2MRPA 2RPQA 3PRPB 1FMAD 2L32A 4WWPA 2WNMA 3I57A 1R4NB 2WDTB 1MFWA 2DZIA 4W9IA 4LK0M 4HPLB 4RCOA 3QWZB 2AWTA 1EWYC 4IUMB 3WANA 3GOEA 2NR2A 1HA5A 2FIDA 4G0NB 1TJEA 4HK2A 2MP2B 3E9SA 4XE0A 4FBJB 2N7JA 1YIWA 3DBRB 3IT4B 4YWGG 2NBVB 3VVWB 3DOWA 5FR3A 3PHWB 3M3JA 1K51A 2KDFB 2KX3A 1VJKA 2CS4A 3A4SC 2WXIA 1YOVB 2DYMA 4G3XB 4MACA 2L8JA 1UD7A 2R2OA 1MHHE 3VRBB 2K8HA 2C7MB 4J6IA 4LJOB 2MSED 2ZVNA 3H7PA 2JVCA 3RULA 4NQKE 1WSPA 1U4AA 2MW5A 4NZLB 2IO3B 4XDCA 4OVZA 2MH7A 5BYSA 3PV1A 2OHFA 2LD9A 1DGJA 2M0AA 2RGFA 3AE7B 1STEA 4P7IA 1WXAA 4XDDA 5EE3A 5JH5C 4BZAA 2BS3B 3PZ8A 1F1HA 2ONQA 4DHJB 1R4MI 3BVMA 1WXQA 1N61A 2DENB 3OAWA 3PLVA 5GXGB 1LFDA 4W9DA 4JX1C 4N58A 1LQBA 2ZVOA 4K7UA 3RT3B 4AQ7A 2FAZA 4DQOC 4LNIA 2ZW1A 1J7AA 4TQ0A 3TEYA 2AQ2B 3KYDD 2CHXA 3QCAA 4BOSC 1ZDXA 1NDDA 1R7SA 2LFIA 3A9JA 4WAAA 5CX3A 3QAQA 3OJ4B 2KN5A 1K53A 4IWPA 2IYDB 1Y56A 2KK8A 3RZFA 2MBBB 4R3DA 4RM9A 3HK0A 3U52E 5IAAC 1E90A 1JWUD 1WGRA 3A4RA 5J18A 3P42A 3AEBB 4KKJA 1BUIC 1IGCA 4RF1A 1L4DB 2INCC 1WF9A 2GBNA 2A5UA 2J7QB 2D3AA 2JYEA 1MG4A 2ACZB 2GLSA 1V49A 3S2AA 3W5VB 2O2VA 2KZRA 2C7HA 1T6BX 4IM2A 3ZKJC 4B0MA 3LJ3A 2EMSA 1M94A 4ZRQA 2KO3A 4W9FA 1K8RB 3ECIA 3VUXA 1GB1A 1JWAD 5EDSA 3H7PB 2CU1A 4ANWA 4ZHOA 3ZGZA 2PTLA 4IKGA 2MJEA 3B0AA 3PS6A 4HRSA 5E6NA 5EE1A 1RFKA 2KACA 4O1NA 2KQ7A 1KLVA 1V6EA 2ICIA 1E0ZA 4M8NA 1QT9A 2CHZA 1YJIA 1H4RA 1WZ3A 1BT0A 2FCMA 1M4VA 4JWUC 1X1MA 2K8CA 3IAS1 3HM6X 3N9YC 1PFDA 3FC4A 5HKHA 2KKCA 4XX5A 1IYFA 5IA7A 2BWFA 3RFZB 4LDTD 4PYZA 1FNUA 1P7EA 3SU8X 2WXHA 2HE7A 3AULA 2LMCA 2WXKA 3B9JA 2NTSA 4RM8A 3A9JB 3SD5A 3PPAA 1B9RA 1YD8U 1JMLA 2QCZA 1WI0A 5LXIB 1TYGB 3AI5A 1VRAB 2G3QB 2WDQB 4PK1A 3L13A 3KQ4A 2M0XA 2LUMA 4K3CA 3QA8A 4B95A 5IOIA 2QC8A 1IUEA 3BVGA 1J19A 4MGKE 4BKSA 4EZJA 1C76A 4WIPA 2WQYB 4A8XC 2JUOA 4HEA1 2V3PA 3C8YA 2IDYA 3Q3OC 4A90A 2GBKA 3NVVA 4F1SA 1T0YA 1TBEA 2MA9B 1KH0A 2KJRA 2K3UA 3IT6B 3NVYA 2O2VB 3MTNB 2DHZA 1YN4A 1XLOA 2IO1B 1ZPSA 2RSUA 1K52A 2JWUA 1EUVB 1VZ7A 2HTHA 4WWOA 1VDVA 1WXMA 1V2YA 2LJ5A 5JHBA 3RNBC 4F8CB 3R7QA 5JZEB 1HEZE 4A3PA 1LGRA 2KNBA 3QARA 3DBLB 2BB6A 2WLBA 3TEWA 1GC7A 2YVCA 1WGDA 4KDIC 5E6JA 4AOFA 2KC1A 1IPGA 2GB1A 2KAJA 3OJ3A 2N9PC 4NQLB 4JL9A 3Q8BA 2ZCCA 2LUEA 2DBYA 2WXLA 2I2YA 2VZKD 1DOXA 2WWZA 1SBBB 2PIAA 3FILA 3DHIC 1ZOYB 3W2DA 1Q10A 2O6VA 3PZDA 5DPSA 5C2TB 2KTRB 1FFVA 2IGHA 4NY0A 2W54A 1OQYA 3NVZA 1SSNA 3NVWA 3GZNI 3RNCC 3CSFA 1A5RA 2UU7A 4NPNA 1S3SG 3P4SB 2BYVE 2KJ6A 2RR9A 2WXMA 2HD5B 1WYWB 1XLQA 4A55A 1QKZA 4WQMA 2WU5B 3UINB 2KD0A 4ARIA 1L4ZB 3BINA 3ZNGC 4WAFA 4YL8A 4USAA 2L00B 2J0MA 3PGEA 3KUCB 4BFRA 4IWQA 4ZHPA 3U7ZA 5BMGA 4K7SA 4KKIA 1YMHE 2N7DA 1EM7A 1EU4A 4L23A 1ZDVA 2AQ3B 3WAMA 1OQRA 2GI9A 2KMAA 4MSQB 4XZ4A 3H8HA 3DHHC 2C60A 1TZ1A 3VUYA 1WZ0A 4MELA 3AEDB 1N62A 1Y8RC 3BYYB 1ISNA 5BO4B 2KXJA 3U2SC 4PS7A 4WWNA 4ARCA 1ZE3D 3L4PA 2INNE 3FILB 2KYWA 3Q3NC 2O6VB 2LJIA 1XEEA 1NBFC 1J8CA 2KLCA 2GBMA 1E8XA 2N4FA 1WGHA 4MEMA 5D7GA 1ACCA 1LO5D 1WE6A 4JPSA 4B6WA 1QOBA 3T8MA 1WYGA 1V86A 1V5OA 2BS2B 2BYFA 1T0RC 4E3CA 1C3TA 2FIFA 3RNAC 4NJCA 1FCCC 1CK1A 4M0WA 2ZCBA 4M00A 3BVZA 1OGWA 2W82A 2UWQA 1E7UA 2Y5CA 4I6NB 2BT6A 3APFA 3DDCB 1WMHA 2CHWA 4PT5A 2N9LA 4C56C 2MBQA 3RNGC 2VH2A 1JCKB 1J7BA 1WWTA 1RWSA 1SE9A 3P63A 4IC7B 4RH6A 3W9CB 4WH4A 2JQRB 2Y5BB 3AMZA 4FN2A 4KIKA 5D6JB 1FNVA 3C0RB 4UDUC 3TSSA 2BGFA 1EU3A 2VH1A 3ZXRA 2PE6B 2INPE 2PVOD 3DWGC 3I5JC 3BIID 1HTQA 3AE9B 4HKZE 1KF6B 1S1QB 2K25A 2E6XA 3IXSA 1IBXA 3RPFC 2VRRB 4REZA 4GDKA 1JWBD 1UWMA 4MM3A 3NZUA 1HQRD 3AEGB 4W9GA 3N1ZC 3ZYYX 2ZZPB 4OVVA 1FNWA 1YJJA 1P3QU 4L1BA 3RI7C 4MGYE 4LNNA 1RRBA 2V1YA 1ZP0B 4TKNA 4KX6B 4M0WB 4GOCA 2X8XX 4LNFA 4JLCA 4IDIA 1RM6C 2J52A 3NZ3A 4MJSB 2IY1B 2LZ6A 5BMHA 5E6PA 4W9LA 4P6VF 3VUWA 5IO9A 2IGGA 2Y3AA 4OW0A 3UGBB 1D4BA 4DXGA 4GMVA 4IG7B 1F9JA 3VH3B 4E74A 2MX2A 2HTME 4CO7A 3PRMB 3W1SC 3VTWA 1WMHB 1ZW7A 2DZKA 5BMIA 2L7RA 3ML8A 1GNUA 3NG0A 1JRUA 3W1YA 4GN1A 4DXAB 2AL6A 1R4MB 3B1LX 3H1UA 3VXWA 4BKTA 1V81A 4KZ0A 2H88B 1TZOA 3M62B 3HHMA 3HIZA 3Q6BA 1GC6A 4KIKB 3PREA 1BXTA 4HCNB 1T3QA 2LVPA 3I9V1 1B1ZA 4DHZB 1KFYB 3P2BA 4GLSC 4HVBA 3L0WB 1JWMD 1E8YA 2AL3A 3X23A 3VFKA 1XCQL 3PZ7A 4MGZE 2FCNA 1WM3A 4CHKA 2KMCA 4HCPB 4S17A 1WR6E 2NCNA 1NYQA 2L0TA 3P4QB 1IBXB 3SFEB 4KGTA 3ABVB 4GDKB 4Q2JA 3L54A 2M1MA 4MM3B 4KV2A 3UQBA 2JT4B 3NS8A 3KWLA 4EEWA 3V05A 2K22A 1D3ZA 2FNJB 1RYJA 1TKEA 3ZO5B 5AZGA 3AN1A 1SF0A 1WY8A 1LXDA 4WJNA 3LXFA 3RD2A 1WH3A 2K9XA 2N9KA 1PUTA 1SJHD 3SR6A 1XLNA 4OVUA 2KDBA 2J0JA 1JRPA 2KT7A 5FKAC 2IO0B 1L6UA 1C4CA 1V80A 3N20C 4RNAA 2REXA 4BVUC 4TSSA 2I1KA 4ZOHC 1FEHA 1J0GA 1HE8A 3WAOA 1L6VA 3AE4B 3M63B 1D6EC 1TY2A 2NS5A 5T8IA 2JXTA 2ZPYA 4I6PA 4MT5A 4CYEA 4RF0A 4WQOB 3ZDMC 3BYTB 3Q3MC 3L08A 1QILA 2WXNA 4KZCA 3IFWB 3AB5A 1GOZA 3BZDB 2EMTA 3RYTA 2KTFA 3K9PB 2G1EA 5HG2A 5I4DA 2JX5A 4D2KA 3OLMD 1Q1OA 3Q2AC 4DDID 2QDFA 1SIFA 4FJYA 4LNKA 2PKOA 2ZNVC 1WRDB 3R2IA 4GSWA 3KYCD 1SJED 2QJLA 4ZDVA 2KTRA 3EA6A 1FCLA 4RGOS 4OHJA 1AARA 1WX8A 1PDXA 3R2TA 4BAXA 2W55A 4WJPA 2DYBA 3I3TB 3VHTC 1FM0D 1GAQB 2FBWB 3DBSA 4GU2A 4DHZE 1KLGD 2NBUA 3JYUA 3R7RA 2PW9A 4ITKA 1PGXA 3PVLA 3SFDB 5G5HA 1DOYA 2XK5A 2KDMA 2LWPA 1KTKA 2BTEA 2WU2B 4P1CC 3CF6E 4IM3A 3ZRCA 5JHAA 3AE8B 2JU6X 3QK0A 3TMPB 2JRIB 2DYOA 2KN4A 5FK9C 3FKYA 3HVDA 1L7YA 2YEPB 4LJPB 1CJEA 2O6VD 3ZUNA 3ZIMA 2ZNVB 2IJ0A 3EFUA 2V4LA 2GMIC 3UF8A 4NJ7A 2K0PA 2FCSA 3B2FA 1TKYA 5TSSA 2SEBD 2LGSA 1BMLC 3QIJA 1F2RI 3AU5A 3URYA 2DX5B 4YXDB 1RAXA 2KQ4X 1WJUA 2KWCA 3V6EB 2WDRB 2DAFA 2BBCA 4NAMA 3MC0B 5AUKA 4BBNC 1KRHA 2JY6A 2BW2A 2Z0EB 2K39A 4C7YA 3LYYA 4II2B 4OZBA 2MWSB 4N9F4 3T3OA 1PGBA 2L3ZA 3GZNB 4YTMB 4FHJA 2JRHA 1WFYA 1EWCA 3N32A 2KVRA 2LGDA 3PT2B 3WCQA 2Z59B 2WS3B 2CKHB 1WGKA 3FAHA 1DYQA 1FXAA 2R2QA 3Q69A 2RDBC 2ON8A 2I38A 2JSVX 3VR8B 1UF0A 3TEXA 2N9EB 1MPEA 2MBEA 3JW0X 2KQSA 3TL5A 2XK5B 1QOAA 4DXFA 1J7CA 3P4PB 4BKGA 2BF8B 3EGRA 3AU4A 2LGYA 2XN9C 4EUTA 4MSMB 1JQ4A 1SB3C 1WM2A 1XQQA 3I63C 1Q5WB 3H7SA 4YTNB 5HHDG 5JXVA 1JW9D 3B2GA 1P0RA 5HI1A 1TGZB 1L0VB 1T5XD 1VZ6A 5IN7A 3QJZA 4US9A 4P1BC 2D3CA 2CU3A 3RNEC 3SDLC 1H8CA 1I4QA 2W3SA 4LCDE 2K6DB 1TKGA 4G50A 4W9JA 5DCNA 4M8MA 1WE7A 3QC8B 1I35A 1MI0A 1UELA 2N0SB 5J17A 1VCBA 1EO6A 2HDEA 2M17A 3V3XA 3KUDB 1I4GA 4HLEA 1TS4A 2KFKA 1I4PA 2DZMA 3CWIA 1GB4A 3N30A 3MJ5A 3NS1A 1MJDA 2LGIA 3ZJVA 3TUOA 5D2MB 4YSZB 4IW0A 2N9XA 1ESFA 5IKCM 3HM3A 2EKIA 2PMVA 4PYUA 1E5WA 1YX6B 2G4SA 2JXXA 2CR5A 2DZJA 2WX0A 5DPRA 2D3GA 1RLFA 3DVNV 2V3NA 3VDZA 1TS5A 5LLIA 2B3AA 1V5TA 1VD2A 1NYRA 1IP9A 2WXJA 3PHXB 2BQQA 2LXAA 1EF5A 1WJNA 2QHOA 3EUB2 2H89B 2BB5A 4DHJD 2MJ3A 4MJSA 1JROA 3WALA 2LHEA 1V8CA 2UYZB 2W9NA 1TT5B 5LNK1 2RDHA 3RNFC 3ZRFA 4GGQA 4AWJA 3DVGX 1ROEA 2GOWA 3KWVA 1C4AA 3OG5A 4LNOA 5D3IB 2B76B 2PVGC 4IM0A 2LEKA 3QQ8B 4OZAA 2WXRA 3X0WA 2K8BA 1KJTA 2WDVB 5D94A 1E7PB 3WA0A 2SAKA 2TSSA 3QX1A 3SHQA 3ONSA 1TIFA 1XT9B 5DPWA 5C3JB 2LXCA 1F52A 4W9HA 2RPVA
chains in the Genus database with same CATH topology
1FRRA 2LUMA 1V1PA 4TQ1A 4YT0B 1V1OA 2J42A 4RFBA 1IUEA 1NYQA 3SEBA 1TS2A 3BVGA 1KLUD 2J53A 3E56A 4KGRA 1C76A 3P4QB 4WIPA 4LLGM 2WQYB 1NENB 1L5PA 1N5XA 4A8XC 4HEA1 1YQ4B 2V3PA 3C8YA 1CZPA 1I4XA 3SFEB 1IBXB 2IDYA 4KGTA 4A90A 5EE9A 3ABVB 3NVVA 4GDKB 4Q2JA 1FFUA 4MM3B 3Q8EA 4XWTA 4H2AA 4N6EB 2DLBA 3KWLA 2Q5WD 1UUPA 3IAM1 1KH0A 1I4HA 1N60A 4C80A 3GS2A 2K3UA 3IT6B 3NVYA 1UGJA 3V05A 2K22A 1SE3A 1D5XC 2M56B 1YN4A 1XLOA 3AEEB 1ZPSA 4US8A 3W1SA 1RYJA 3OWEB 1TKEA 1K52A 2JWUA 2AX5A 3ZJTA 2FUG1 3AN1A 3Q8FA 1SF0A 1VZ7A 2RDGA 2K5PA 1VDVA 1L0XB 2QILA 3LXFA 1FIQA 2K9XA 2WP9B 2N9KA 1PUTA 1VLBA 1QQRA 1HEZE 2QEJC 3UI3A 1HZ5A 1SJHD 3SR6A 4A6QA 2BS4B 2OEDA 2NTTA 1XLNA 1ZUD2 3ZJUA 5G5GA 1MHXA 4HJGE 1JRPA 5FKAC 1L6UA 2BB6A 1C4CA 2WLBA 4JWSC 3TEWA 1E6EB 4RNAA 4TSSA 4TMAB 1I7HA 4ZOHC 3GB1A 5E6JA 1FEHA 2GB1A 3VR9B 1L6VA 3AE4B 2KAJA 1D6EC 1TY2A 3DWMA 1I4RA 5T8IA 2JXTA 1YQ3B 4FXCA 2DWQA 3Q8BA 1SXTA 1VR9A 2DBYA 2WXLA 4J3OD 2I2YA 4MT5A 2XNAC 4RF0A 4XWWA 2VZKD 4YTPB 1DOXA 3BYTB 2GRIA 1QILA 2WXNA 1XO3A 4RGNA 3AB5A 4AS1A 1SBBB 1GOZA 2PIAA 3BK2A 3BZDB 3FILA 4B0EA 1ZOYB 3W2DA 2FE8A 1Q10A 2G1EA 5C2TB 2Z8LA 5HG2A 5I4DA 1PYWD 2JX5A 4D2KA 1FFVA 4A9AA 1ET6A 1OFFA 3Q8AA 2PKOA 1F0ZA 3R2IA 3W5UB 2IGHA 4WURA 2W54A 4P16A 1V1PB 2CJNA 2WXGA 2VZKB 1SJED 1FO4A 3GP7A 3NVZA 3AH7A 4ZRPA 1SSNA 2QJLA 3EA6A 5H8YE 4RGMA 1FCLA 3NVWA 4OHJA 3NRZA 1NEKB 4RGOS 2V0GA 3VRAB 3TEZA 1NVID 1JALA 1PDXA 3R2TA 1QF6A 1C9FA 4CQNA 3HUIA 1D5ZC 3BK1A 2L83A 3AECB 3P4SB 2W55A 5BYRA 1FM0D 1GAQB 2FBWB 1QLBB 1TS3A 1AW7A 3MP9A 3LB8C 2WXMA 1XLQA 4A55A 1KLGD 4L2YA 3AE1B 3AE3B 1QKZA 2PW9A 4WQMA 2WU5B 4ITKA 4ARIA 2IGDA 1L4ZB 1PGXA 4LTUA 3SFDB 5G5HA 2L52A 1DOYA 4WAFA 3MFGA 2W3RA 3O13A 2KDMA 4USAA 1KTKA 2NMQA 2BTEA 2ZW0A 1WRIA 2WU2B 3AE8B 2JU6X 5HFYA 4OZCA 2DYOA 4ZHPA 1XXGA 2KN4A 3U7ZA 5BMGA 4WWMA 4KKIA 5FK9C 1P7FA 1YMHE 3HVDA 4GDLB 1EM7A 1EU4A 1FXIA 2IPKD 4L23A 1AYFA 2YEPB 1D5MC 1CJEA 1ZDVA 2AQ3B 1OQRA 2J4XA 3AE6B 4YSYB 5EE0A 2GI9A 2IJ0A 3T3NA 4HKQA 3H8HA 5D3DA 4C7ZA 2K0PA 1FMAD 1N62A 2L32A 3AEDB 3B2FA 3AV8A 3NUHB 2WNMA 3BYYB 3I57A 1ENFA 2KMMA 1TKYA 4LK0M 5TSSA 4RCOA 1V97A 2SEBD 3U2SC 1EWYC 3AE5B 1BMLC 1N5WA 4ARCA 1F2RI 1ZE3D 1IGDA 3L4PA 1HA5A 3URYA 1VZ8A 4YXDB 1QOFA 2INNE 2WXFA 3FILB 2JYTA 2KQ4X 3PO0A 2LJIA 1XEEA 2WDRB 2BBCA 4NAMA 3MC0B 5AUKA 1TJEA 1KRHA 4YSXB 3E9SA 2BW2A 4XE0A 2D5GA 5D7GA 1C79A 1ACCA 1LO5D 2N7JA 4JPSA 1F77A 4C7YA 1E10A 1HXYD 3LYYA 1QOBA 1WYGA 1YNTE 3IT4B 4OZBA 4YWGG 3T3OA 1PGBA 1C78A 2PLPA 2BYTA 4YTMB 2BS2B 5FR3A 1FD6A 1F2RC 1SEBD 1EWCA 4NJCA 1FCCC 1K51A 1GPXA 1CK1A 4M0WA 3WCQA 2RMMA 3BVZA 1VJKA 2WS3B 3AEFB 3BWUD 1WGKA 2WXIA 3FAHA 1K50A 1DYQA 1FXAA 2DYMA 2W82A 4MACA 1HZ6A 1SE2A 3Q69A 2V4IB 2ON8A 1MHHE 3P1MA 3VRBB 3P4RB 2I38A 2JSVX 3R8BA 3VR8B 1JWSD 1E9MA 1XLPA 2Y5CA 2BT6A 1N63A 1WSPA 3TEXA 1PGAA 4HROA 3KLSX 4NZLB 4XDCA 3AM9A 4PT5A 4C56C 2N9LA 1MPEA 1YN5A 4OVZA 2MH7A 5BYSA 4EE2A 2OHFA 1DGJA 2M0AA 1QOAA 3AE7B 1ET9A 1STEA 1XF5L 4DXFA 1J7CA 3P4PB 4XDDA 1JCKB 5EE3A 2BS3B 3EGRA 4KGSA 3AEAB 1J7BA 1WWTA 2XN9C 3PZ8A 2X38A 1RWSA 3CIRB 2L1AA 2ONQA 1JQ4A 1SB3C 3BVMA 3P63A 4RH6A 1WXQA 4MH8A 1N61A 5GXGB 3AE2B 4JX1C 3W9CB 4N58A 4WH4A 2JQRB 4YTNB 2R61A 5HHDG 5JXVA 1JW9D 3B2GA 5HI1A 3AMZA 4AQ7A 4DQOC 2ZW1A 1J7AA 1L0VB 1T5XD 1FNVA 1VZ6A 4TQ0A 4UDUC 3TEYA 2AQ2B 1XCTL 3HVZA 1YN3A 2MEKA 3TSSA 4US9A 2CU3A 1EU3A 1ZDXA 1SE4A 1ZXIA 2AQ1B 1R7SA 2LFIA 1I4QA 5MPOA 2W3SA 2PVOD 2INPE 3DWGC 1K53A 3BIID 1AWDA 3AE9B 4HKZE 1KF6B 1Y56A 4R3DA 1TKGA 3Q8CA 3U52E 1MVKA 1JWUD 1A70A 2E6XA 3P42A 3AEBB 1MI0A 2N0SB 3IXSA 1OQQA 2QIEB 4KKJA 3ETRA 1BUIC 1IGCA 3RPFC 1IBXA 2HDEA 4REZA 3ZQ4A 1JWBD 1UWMA 4RF1A 1L4DB 3V3XA 1FRDA 5AUIA 1HQRD 3AEGB 2YEPF 2JYEA 4IOIE 1I4GA 2ACZB 2Y5PA 5H92C 3ZYYX 1AN8A 1TS4A 1UWXA 2LHDA 1I4PA 3CWIA 1GB4A 1FNWA 1YJJA 3MJ5A 3NS1A 4L1BA 3W5VB 3U4EG 2LGIA 3ZJVA 3TUOA 1T6BX 3VQIA 2WXOA 4YSZB 1ZP0B 1ESFA 2MJDA 4KX6B 1C77A 4B0MA 1UNSA 2EKIA 2PMVA 4IDIA 1RM6C 4RGTA 4ZRQA 2J52A 3NZ3A 2QSDA 4ZYSA 2KWDA 5BMHA 4P6VF 3MHZA 2V3NA 1TS5A 1GB1A 1JWAD 2IGGA 2Y3AA 4OW0A 2E3TA 1D4BA 4DXGA 1NYRA 2HTME 2WXJA 1NI3A 2QMTA 4ZHOA 3ZGZA 5BMIA 2WXQA 2PTLA 4IKGA 2MJEA 4HRSA 5EE1A 1QOGA 3EUB2 1RFKA 2H89B 2BB5A 2KACA 1TY0A 4O1NA 2MJ3A 1SIJA 2ICIA 1E0ZA 3J9CA 1JROA 2LHEA 2G9HD 3HRDD 1QT9A 1V8CA 1YJIA 1M4VA 5LNK1 4JWUC 2RDHA 2H88B 3IAS1 1L0YB 3N9YC 1PFDA 3FC4A 1TZOA 1ROEA 2JZPA 3KWVA 1C4AA 4NAWB 5D3IB 5BYQA 3RFZB 1BXTA 2B76B 2PVGC 1FNUA 1P7EA 1T3QA 2LEKA 2WXHA 2M19A 3I9V1 2LMCA 1B1ZA 4OZAA 2WXRA 2CJOA 1ZXHA 2WXKA 2WDVB 3B9JA 1E7PB 2NTSA 4N59A 1KFYB 2SAKA 2TSSA 1B9RA 1DOIA 1JMLA 4GLSC 1C4PA 1CQVA 1JWMD 1TYGB 2EELA 1VRAB 5C3JB 4JE3B 1XCQL 2WDQB 3PZ7A 3KQ4A 2RPVA 2WXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRH A;  1FRR A;  4YSX B;  3AEB B;  2N0S B;  2PKO A;  1F0Z A;  4YT0 B;  1OQQ A;  2QIE B;  3W5U B;  1IUE A;  1NYQ A;  2W54 A;  3ETR A;  3RPF C;  3P4Q B;  2CJN A;  4C7Y A;  2WQY B;  1NEN B;  1JWB D;  1L5P A;  1N5X A;  1UWM A;  3AH7 A;  3NVZ A;  1E10 A;  1YQ4 B;  1FRD A;  1QOB A;  1CZP A;  3SFE B;  2QJL A;  5AUI A;  1WYG A;  5EE9 A;  3ABV B;  3AEG B;  3NVV A;  5H8Y E;  1FFU A;  2ACZ B;  3NVW A;  3NRZ A;  1NEK B;  5H92 C;  3ZYY X;  4YTM B;  3VRA B;  2BS2 B;  1NVI D;  1JAL A;  4N6E B;  3CWI A;  3KWL A;  1YJJ A;  2Q5W D;  3NS1 A;  1PDX A;  3W5V B;  1GPX A;  1QF6 A;  1N60 A;  3HUI A;  4C80 A;  3WCQ A;  2L83 A;  3NVY A;  3AEC B;  3P4S B;  2W55 A;  1VJK A;  4YSZ B;  1ZP0 B;  2K22 A;  2WS3 B;  2MJD A;  3AEF B;  2M56 B;  1FM0 D;  1GAQ B;  2FBW B;  1WGK A;  3FAH A;  4KX6 B;  1QLB B;  1FXA A;  1XLO A;  3AEE B;  3LB8 C;  4US8 A;  3VRB B;  3P1M A;  1XLQ A;  2EKI A;  3P4R B;  1RYJ A;  4IDI A;  1RM6 C;  1TKE A;  3AE1 B;  3VR8 B;  3AE3 B;  1E9M A;  1XLP A;  2AX5 A;  4WQM A;  2WU5 B;  2Y5C A;  4ITK A;  3AN1 A;  2BT6 A;  1SF0 A;  4P6V F;  2K5P A;  1N63 A;  1VDV A;  4LTU A;  3SFD B;  1JWA D;  4HRO A;  5G5H A;  3LXF A;  1FIQ A;  2K9X A;  2E3T A;  2L52 A;  3AM9 A;  2WP9 B;  1DOY A;  1NYR A;  2W3R A;  1PUT A;  2HTM E;  2MH7 A;  1VLB A;  4USA A;  1NI3 A;  4ZHO A;  2OHF A;  1DGJ A;  1QOA A;  3SR6 A;  3AE7 B;  2BS4 B;  1WRI A;  2WU2 B;  1XLN A;  1ZUD 2;  2MJE A;  5G5G A;  3AE8 B;  1J7C A;  3P4P B;  5EE3 A;  4HRS A;  2BS3 B;  5EE1 A;  1QOG A;  1JRP A;  3EUB 2;  1RFK A;  2H89 B;  1J7B A;  3AEA B;  1WWT A;  4ZHP A;  1L6U A;  2MJ3 A;  4WWM A;  1SIJ A;  1RWS A;  2WLB A;  3CIR B;  1JRO A;  4JWS C;  1E0Z A;  1JQ4 A;  1SB3 C;  1E6E B;  3HRD D;  3P63 A;  1QT9 A;  1WXQ A;  1FXI A;  1N61 A;  5GXG B;  1I7H A;  1V8C A;  1AYF A;  1YJI A;  4ZOH C;  1CJE A;  3AE2 B;  4JX1 C;  1OQR A;  3W9C B;  3AE6 B;  4N58 A;  2JQR B;  4YSY B;  4YTN B;  1L6V A;  3AE4 B;  5EE0 A;  3VR9 B;  2KAJ A;  1JW9 D;  3B2G A;  4JWU C;  2H88 B;  3DWM A;  3AMZ A;  4C7Z A;  1PFD A;  1YQ3 B;  4FXC A;  3FC4 A;  1J7A A;  1L0V B;  2DWQ A;  1FMA D;  1N62 A;  3AED B;  3B2F A;  1ROE A;  3AV8 A;  3HVZ A;  2DBY A;  4US9 A;  2CU3 A;  4YTP B;  2B76 B;  2PVG C;  1DOX A;  1T3Q A;  2KMM A;  2LEK A;  1TKY A;  1ZXI A;  1R7S A;  1V97 A;  2M19 A;  5MPO A;  1EWY C;  2W3S A;  1XO3 A;  2PVO D;  3AE5 B;  3DWG C;  2CJO A;  3AB5 A;  2WDV B;  1N5W A;  3B9J A;  1E7P B;  2PIA A;  3BII D;  1AWD A;  1ZOY B;  3AE9 B;  3L4P A;  4N59 A;  1KF6 B;  1KFY B;  2G1E A;  1B9R A;  1DOI A;  5C2T B;  4YXD B;  1QOF A;  1TYG B;  2JX5 A;  1TKG A;  3PO0 A;  1FFV A;  5C3J B;  2WDR B;  4A9A A;  1FO4 A;  2WDQ B;  1OFF A;  5AUK A;  1TJE A;  1A70 A; 
#chains in the Genus database with same CATH topology
 4TUU A;  2Z0D B;  1PQS A;  1V1P A;  4YT0 B;  2D2Q A;  1V1O A;  2J42 A;  3DCG A;  4RFB A;  1KLU D;  1WX7 A;  5AZF A;  4GB9 A;  2L05 A;  3ML9 A;  1L5P A;  1UBQ A;  3V61 A;  4AJY B;  4K3B A;  1YQ4 B;  1CZP A;  1I4X A;  2BKF A;  4QAY A;  4FAD A;  1FFU A;  2AYO B;  4K81 A;  5AZH A;  5CHV C;  3Q8E A;  4XWT A;  2G4D B;  2I1J A;  1UUP A;  2KFK B;  2NPT B;  1N60 A;  1GUA B;  3GS2 A;  1UGJ A;  1EF1 A;  3VTV A;  3PSE B;  4EOY A;  3PRZ A;  1UBI A;  1XD3 B;  4US8 A;  3W1S A;  2ZPN A;  3OWE B;  2DNF A;  2AX5 A;  3ZJT A;  2FUG 1;  3Q8F A;  2PEA A;  1L0X B;  1OEY A;  1FIQ A;  3RN9 C;  2WP9 B;  5C1Z A;  2V9H A;  1VLB A;  1QQR A;  2PPH A;  2BKR B;  1HZ5 A;  2GBJ A;  2BS4 B;  2NTT A;  1ZUD 2;  3RUI B;  5G5G A;  2IBI B;  3WAP A;  4JWS C;  3DBH I;  1WJ4 A;  2JPH A;  3R3M A;  3VR9 B;  3DWM A;  4FXC A;  5L95 C;  1WR1 A;  4I6L B;  2DWQ A;  1VR9 A;  5CHF A;  4J3O D;  2D11 A;  1R4N I;  2KDI A;  2BVC A;  4C4V A;  4ACF A;  1XO3 A;  3MC8 A;  4AS1 A;  4DBG A;  3BK2 A;  4B0E A;  2HJ1 A;  2FE8 A;  4AP4 C;  1WXS A;  1PYW D;  3U30 A;  3RCZ A;  1WIA A;  4A9A A;  3APC A;  1ET6 A;  1WJ6 A;  3IVF A;  3Q8A A;  3V62 A;  1F0Z A;  1CMX B;  3W5U B;  1Z5S B;  1GG3 A;  1V1P B;  1FO4 A;  3AH7 A;  2XEW A;  3DBR I;  4PS8 A;  4RGM A;  2WGS A;  1NEK B;  3NRZ A;  4NJ6 A;  3VRA B;  1JAL A;  2KX0 A;  1T0Q C;  4S0R A;  2WX1 A;  3KVF B;  3N1Y C;  1C9F A;  3HUI A;  2IND C;  3C19 A;  2AEH A;  1QLB B;  1AW7 A;  4L2Y A;  3AE1 B;  4GIV A;  2IGD A;  2KWV B;  1GJZ A;  2MCN B;  4LTU A;  2D3B A;  2L52 A;  1UH6 A;  2KAN A;  3MFG A;  1LM8 B;  3O13 A;  2ZW0 A;  4ZYN A;  2JZZ A;  3ZTD A;  4NNJ B;  1XXG A;  3TIX A;  4WWM A;  5E6O A;  1P7F A;  1FXI A;  2IPK D;  4BOZ B;  1AYF A;  2HJ8 A;  1TTN A;  3AE6 B;  4YSY B;  3T3N A;  4C7Z A;  4WJQ A;  4ZRJ A;  3AV8 A;  3NUH B;  1ENF A;  2KMM A;  4X57 B;  1V97 A;  3ZDT A;  3AE5 B;  2A4Z A;  1N5W A;  3JSV A;  4C4V B;  2IO2 B;  1IGD A;  4FLH A;  4KDL B;  1VZ8 A;  1QOF A;  2WXF A;  3CST A;  2JYT A;  3PO0 A;  2G45 B;  3IG3 A;  4YSX B;  4EZK A;  4FUL A;  2D5G A;  1C79 A;  1F77 A;  1E10 A;  1HXY D;  4BKS D;  5LXH A;  4ICV A;  3QHT A;  1HTO A;  1YNT E;  2YLM A;  4DWF A;  3MC9 A;  1C78 A;  1SGH A;  2PLP A;  2BYT A;  4ASW C;  4DDG D;  2EKE C;  1FD6 A;  2OOB B;  3NOB A;  1F2R C;  1SEB D;  4HXD A;  1GPX A;  2RMM A;  3PLU A;  3AEF B;  3BWU D;  1K50 A;  1HZ6 A;  1SE2 A;  1YQB A;  2V4I B;  3P1M A;  3P4R B;  3R8B A;  3UQA A;  1JWS D;  3TJP A;  1E9M A;  1XLP A;  2KHW B;  4KSL C;  5J2R A;  2LGX A;  4ANU A;  1N63 A;  3Q3J A;  1PGA A;  4HRO A;  3KLS X;  3WIM A;  3AM9 A;  1YN5 A;  4EE2 A;  3V60 A;  1ET9 A;  4M02 A;  1XF5 L;  1Z2M A;  3MJW A;  3L17 A;  3D32 A;  3AEA B;  4KGS A;  4ZRI A;  2X38 A;  3CIR B;  2L1A A;  2KDE B;  1ZGU B;  4MH8 A;  2KJH B;  3DVG Y;  4A20 A;  3AE2 B;  4FHK A;  3LDZ E;  1E8Z A;  2R61 A;  3MHS D;  3GE3 C;  4NAW A;  1P1A A;  2LAS A;  3HVZ A;  1XCT L;  5AEK B;  1YN3 A;  2MEK A;  4K7W A;  1SE4 A;  1ZXI A;  2AQ1 B;  4TV3 A;  4JGH B;  5MPO A;  1G6J A;  3U8Z A;  4HDO A;  4WJO A;  1AWD A;  4IWO A;  2D07 B;  3JSV B;  3Q8C A;  1MVK A;  1A70 A;  4RMA A;  4HPP A;  3V6C B;  1OQQ A;  2QIE B;  1Q0W B;  3ETR A;  3ZQ4 A;  4XYC A;  1FRD A;  4JQW C;  5AUI A;  5FR6 A;  1I42 A;  1OEY J;  2YEP F;  4IOI E;  3H9D A;  2PJH A;  2Y5P A;  5H92 C;  1AN8 A;  4HJK A;  1UWX A;  2LHD A;  4FJZ A;  1V9J A;  2XBB C;  4DK5 A;  3GE8 C;  2C7N B;  3U4E G;  3NHE B;  4AJW A;  2KWU B;  3VQI A;  2WXO A;  2MJD A;  3U7D A;  1C77 A;  1UNS A;  3ENE A;  3H6N A;  3NJT A;  4RGT A;  1KOT A;  4ZYS A;  2QSD A;  2KWD A;  3MHZ A;  2BWE S;  2E3T A;  5DPT A;  2L76 A;  1WX9 A;  1E7V A;  4K1R B;  4ZRK A;  5KHQ A;  2GBR A;  1NI3 A;  2QMT A;  2BYE A;  4G11 A;  5CHW A;  2WXQ A;  3EFC A;  3EHV A;  4ANV A;  4MH0 E;  1QOG A;  3DBL I;  1TY0 A;  4W9C A;  1SIJ A;  1UZX B;  3J9C A;  3K9O B;  2G9H D;  3A9K A;  3HRD D;  2M8S A;  1P9D U;  2MLB A;  2MHJ A;  1RFA A;  1L0Y B;  3TCA A;  4FJV B;  3AXC A;  4B9K A;  5KHO A;  2BPS A;  5GMV A;  2JZP A;  2ASQ A;  3PTF C;  2LI5 A;  4NAW B;  5BYQ A;  2DAJ A;  2M19 A;  3NZS A;  2MBO A;  2CJO A;  1ZXH A;  4XGA B;  4W9E A;  5CTR C;  2V3S A;  4N59 A;  4MGI E;  4ICU A;  1DOI A;  2N1W A;  3IBE A;  3VAW A;  1C4P A;  1CQV A;  1YJ1 A;  2EEL A;  3ZW3 A;  4JE3 B;  1E8W A;  1FXT B;  2WXP A;  1FRR A;  4TQ1 A;  1OTR B;  3BY4 B;  2NBW B;  2KFJ A;  2L0F A;  4M01 A;  3SEB A;  1TS2 A;  2J53 A;  3E56 A;  4KGR A;  4KSK C;  2OJW A;  4LLG M;  1NEN B;  1N5X A;  2FCQ A;  4LDT B;  5G2N A;  3M95 A;  4EFO A;  3A33 B;  3A1Q A;  3L10 B;  5EE9 A;  4BBN F;  2K6Q A;  1WGG A;  4H2A A;  4N6E B;  2DLB A;  4C00 A;  2WHI A;  4W9K A;  2Q5W D;  3IAM 1;  1I4H A;  4C80 A;  2LVO A;  2JF5 A;  1SE3 A;  1D5X C;  2M56 B;  3ZNZ B;  1L2N A;  3AEE B;  3ZXV A;  1WGY A;  3JVZ X;  4FA6 A;  2RDG A;  2K5P A;  4MDK E;  4EKU A;  2QIL A;  2C9W B;  3R66 C;  2NPT A;  5TR5 A;  3VH4 B;  2QEJ C;  4HWI B;  3UI3 A;  2IZV B;  4A6Q A;  2OED A;  3ZJU A;  1MHX A;  4HJG E;  2KC2 A;  4GDL A;  3NY5 A;  1E6E B;  3DHG C;  2MQJ A;  4TMA B;  2WYQ A;  3CMM B;  1I7H A;  3GB1 A;  3A9K B;  2LRW A;  2N1V A;  3DPD A;  1T0S C;  1I4R A;  1YQ3 B;  5L83 A;  1SXT A;  3KW5 B;  3EC8 A;  2K1F A;  2D10 A;  4URK A;  2XNA C;  4XWW A;  2C5L C;  4YTP B;  3Q14 C;  2IY0 B;  2GRI A;  4HDQ A;  4RGN A;  3UIP B;  2FUH B;  3IHP C;  3O65 B;  4KVG B;  2Z8L A;  3DQV A;  3ZTC A;  2MP2 A;  3EEC A;  3TBL D;  1QZE A;  1OFF A;  3ZVV A;  1N6Z A;  4E71 A;  4PS3 A;  1FPY A;  1KM7 A;  3KUZ A;  2LVQ A;  3VTU A;  4WUR A;  2ZJD A;  4P16 A;  2CJN A;  2WXG A;  2VZK B;  3GP7 A;  4ZRP A;  3RZW C;  4II3 B;  2N7E A;  5H8Y E;  4F7Z A;  3N1X C;  2V0G A;  3TEZ A;  1MG8 A;  1NVI D;  3A1Q B;  5G55 A;  2RD0 A;  2KOX A;  4A3O A;  1NI2 A;  2KLG A;  2ZEQ A;  3ALB A;  1QF6 A;  4CQN A;  1D5Z C;  3BK1 A;  3ZLZ A;  2L83 A;  3AEC B;  5BYR A;  3DVN U;  3KH0 A;  3RMK C;  3T9L A;  1TS3 A;  3MP9 A;  3LB8 C;  3ZNH B;  2LRU A;  2M4N A;  5C23 A;  3AE3 B;  2JWZ A;  1UGM A;  2OJR A;  4AUQ C;  2J0K A;  2PE9 A;  2W3R A;  2MBH A;  4ANX A;  4XC2 A;  4JIO U;  1WXV A;  2NMQ A;  5IP4 D;  1WRI A;  3L16 A;  3ZNI D;  2KVZ A;  5HFY A;  2JZ3 B;  1C1Y B;  4OZC A;  3B08 A;  3DBH B;  4GDL B;  4GXB A;  4EZL A;  2NVU I;  4HPM B;  3APD A;  1P98 A;  1D5M C;  3UIO B;  1ZKH A;  2J4X A;  5EE0 A;  3Q3F A;  3N3K B;  4HKQ A;  1YX5 B;  5D3D A;  2MRP A;  2RPQ A;  3PRP B;  1FMA D;  2L32 A;  4WWP A;  2WNM A;  3I57 A;  1R4N B;  2WDT B;  1MFW A;  2DZI A;  4W9I A;  4LK0 M;  4HPL B;  4RCO A;  3QWZ B;  2AWT A;  1EWY C;  4IUM B;  3WAN A;  3GOE A;  2NR2 A;  1HA5 A;  2FID A;  4G0N B;  1TJE A;  4HK2 A;  2MP2 B;  3E9S A;  4XE0 A;  4FBJ B;  2N7J A;  1YIW A;  3DBR B;  3IT4 B;  4YWG G;  2NBV B;  3VVW B;  3DOW A;  5FR3 A;  3PHW B;  3M3J A;  1K51 A;  2KDF B;  2KX3 A;  1VJK A;  2CS4 A;  3A4S C;  2WXI A;  1YOV B;  2DYM A;  4G3X B;  4MAC A;  2L8J A;  1UD7 A;  2R2O A;  1MHH E;  3VRB B;  2K8H A;  2C7M B;  4J6I A;  4LJO B;  2MSE D;  2ZVN A;  3H7P A;  2JVC A;  3RUL A;  4NQK E;  1WSP A;  1U4A A;  2MW5 A;  4NZL B;  2IO3 B;  4XDC A;  4OVZ A;  2MH7 A;  5BYS A;  3PV1 A;  2OHF A;  2LD9 A;  1DGJ A;  2M0A A;  2RGF A;  3AE7 B;  1STE A;  4P7I A;  1WXA A;  4XDD A;  5EE3 A;  5JH5 C;  4BZA A;  2BS3 B;  3PZ8 A;  1F1H A;  2ONQ A;  4DHJ B;  1R4M I;  3BVM A;  1WXQ A;  1N61 A;  2DEN B;  3OAW A;  3PLV A;  5GXG B;  1LFD A;  4W9D A;  4JX1 C;  4N58 A;  1LQB A;  2ZVO A;  4K7U A;  3RT3 B;  4AQ7 A;  2FAZ A;  4DQO C;  4LNI A;  2ZW1 A;  1J7A A;  4TQ0 A;  3TEY A;  2AQ2 B;  3KYD D;  2CHX A;  3QCA A;  4BOS C;  1ZDX A;  1NDD A;  1R7S A;  2LFI A;  3A9J A;  4WAA A;  5CX3 A;  3QAQ A;  3OJ4 B;  2KN5 A;  1K53 A;  4IWP A;  2IYD B;  1Y56 A;  2KK8 A;  3RZF A;  2MBB B;  4R3D A;  4RM9 A;  3HK0 A;  3U52 E;  5IAA C;  1E90 A;  1JWU D;  1WGR A;  3A4R A;  5J18 A;  3P42 A;  3AEB B;  4KKJ A;  1BUI C;  1IGC A;  4RF1 A;  1L4D B;  2INC C;  1WF9 A;  2GBN A;  2A5U A;  2J7Q B;  2D3A A;  2JYE A;  1MG4 A;  2ACZ B;  2GLS A;  1V49 A;  3S2A A;  3W5V B;  2O2V A;  2KZR A;  2C7H A;  1T6B X;  4IM2 A;  3ZKJ C;  4B0M A;  3LJ3 A;  2EMS A;  1M94 A;  4ZRQ A;  2KO3 A;  4W9F A;  1K8R B;  3ECI A;  3VUX A;  1GB1 A;  1JWA D;  5EDS A;  3H7P B;  2CU1 A;  4ANW A;  4ZHO A;  3ZGZ A;  2PTL A;  4IKG A;  2MJE A;  3B0A A;  3PS6 A;  4HRS A;  5E6N A;  5EE1 A;  1RFK A;  2KAC A;  4O1N A;  2KQ7 A;  1KLV A;  1V6E A;  2ICI A;  1E0Z A;  4M8N A;  1QT9 A;  2CHZ A;  1YJI A;  1H4R A;  1WZ3 A;  1BT0 A;  2FCM A;  1M4V A;  4JWU C;  1X1M A;  2K8C A;  3IAS 1;  3HM6 X;  3N9Y C;  1PFD A;  3FC4 A;  5HKH A;  2KKC A;  4XX5 A;  1IYF A;  5IA7 A;  2BWF A;  3RFZ B;  4LDT D;  4PYZ A;  1FNU A;  1P7E A;  3SU8 X;  2WXH A;  2HE7 A;  3AUL A;  2LMC A;  2WXK A;  3B9J A;  2NTS A;  4RM8 A;  3A9J B;  3SD5 A;  3PPA A;  1B9R A;  1YD8 U;  1JML A;  2QCZ A;  1WI0 A;  5LXI B;  1TYG B;  3AI5 A;  1VRA B;  2G3Q B;  2WDQ B;  4PK1 A;  3L13 A;  3KQ4 A;  2M0X A;  2LUM A;  4K3C A;  3QA8 A;  4B95 A;  5IOI A;  2QC8 A;  1IUE A;  3BVG A;  1J19 A;  4MGK E;  4BKS A;  4EZJ A;  1C76 A;  4WIP A;  2WQY B;  4A8X C;  2JUO A;  4HEA 1;  2V3P A;  3C8Y A;  2IDY A;  3Q3O C;  4A90 A;  2GBK A;  3NVV A;  4F1S A;  1T0Y A;  1TBE A;  2MA9 B;  1KH0 A;  2KJR A;  2K3U A;  3IT6 B;  3NVY A;  2O2V B;  3MTN B;  2DHZ A;  1YN4 A;  1XLO A;  2IO1 B;  1ZPS A;  2RSU A;  1K52 A;  2JWU A;  1EUV B;  1VZ7 A;  2HTH A;  4WWO A;  1VDV A;  1WXM A;  1V2Y A;  2LJ5 A;  5JHB A;  3RNB C;  4F8C B;  3R7Q A;  5JZE B;  1HEZ E;  4A3P A;  1LGR A;  2KNB A;  3QAR A;  3DBL B;  2BB6 A;  2WLB A;  3TEW A;  1GC7 A;  2YVC A;  1WGD A;  4KDI C;  5E6J A;  4AOF A;  2KC1 A;  1IPG A;  2GB1 A;  2KAJ A;  3OJ3 A;  2N9P C;  4NQL B;  4JL9 A;  3Q8B A;  2ZCC A;  2LUE A;  2DBY A;  2WXL A;  2I2Y A;  2VZK D;  1DOX A;  2WWZ A;  1SBB B;  2PIA A;  3FIL A;  3DHI C;  1ZOY B;  3W2D A;  1Q10 A;  2O6V A;  3PZD A;  5DPS A;  5C2T B;  2KTR B;  1FFV A;  2IGH A;  4NY0 A;  2W54 A;  1OQY A;  3NVZ A;  1SSN A;  3NVW A;  3GZN I;  3RNC C;  3CSF A;  1A5R A;  2UU7 A;  4NPN A;  1S3S G;  3P4S B;  2BYV E;  2KJ6 A;  2RR9 A;  2WXM A;  2HD5 B;  1WYW B;  1XLQ A;  4A55 A;  1QKZ A;  4WQM A;  2WU5 B;  3UIN B;  2KD0 A;  4ARI A;  1L4Z B;  3BIN A;  3ZNG C;  4WAF A;  4YL8 A;  4USA A;  2L00 B;  2J0M A;  3PGE A;  3KUC B;  4BFR A;  4IWQ A;  4ZHP A;  3U7Z A;  5BMG A;  4K7S A;  4KKI A;  1YMH E;  2N7D A;  1EM7 A;  1EU4 A;  4L23 A;  1ZDV A;  2AQ3 B;  3WAM A;  1OQR A;  2GI9 A;  2KMA A;  4MSQ B;  4XZ4 A;  3H8H A;  3DHH C;  2C60 A;  1TZ1 A;  3VUY A;  1WZ0 A;  4MEL A;  3AED B;  1N62 A;  1Y8R C;  3BYY B;  1ISN A;  5BO4 B;  2KXJ A;  3U2S C;  4PS7 A;  4WWN A;  4ARC A;  1ZE3 D;  3L4P A;  2INN E;  3FIL B;  2KYW A;  3Q3N C;  2O6V B;  2LJI A;  1XEE A;  1NBF C;  1J8C A;  2KLC A;  2GBM A;  1E8X A;  2N4F A;  1WGH A;  4MEM A;  5D7G A;  1ACC A;  1LO5 D;  1WE6 A;  4JPS A;  4B6W A;  1QOB A;  3T8M A;  1WYG A;  1V86 A;  1V5O A;  2BS2 B;  2BYF A;  1T0R C;  4E3C A;  1C3T A;  2FIF A;  3RNA C;  4NJC A;  1FCC C;  1CK1 A;  4M0W A;  2ZCB A;  4M00 A;  3BVZ A;  1OGW A;  2W82 A;  2UWQ A;  1E7U A;  2Y5C A;  4I6N B;  2BT6 A;  3APF A;  3DDC B;  1WMH A;  2CHW A;  4PT5 A;  2N9L A;  4C56 C;  2MBQ A;  3RNG C;  2VH2 A;  1JCK B;  1J7B A;  1WWT A;  1RWS A;  1SE9 A;  3P63 A;  4IC7 B;  4RH6 A;  3W9C B;  4WH4 A;  2JQR B;  2Y5B B;  3AMZ A;  4FN2 A;  4KIK A;  5D6J B;  1FNV A;  3C0R B;  4UDU C;  3TSS A;  2BGF A;  1EU3 A;  2VH1 A;  3ZXR A;  2PE6 B;  2INP E;  2PVO D;  3DWG C;  3I5J C;  3BII D;  1HTQ A;  3AE9 B;  4HKZ E;  1KF6 B;  1S1Q B;  2K25 A;  2E6X A;  3IXS A;  1IBX A;  3RPF C;  2VRR B;  4REZ A;  4GDK A;  1JWB D;  1UWM A;  4MM3 A;  3NZU A;  1HQR D;  3AEG B;  4W9G A;  3N1Z C;  3ZYY X;  2ZZP B;  4OVV A;  1FNW A;  1YJJ A;  1P3Q U;  4L1B A;  3RI7 C;  4MGY E;  4LNN A;  1RRB A;  2V1Y A;  1ZP0 B;  4TKN A;  4KX6 B;  4M0W B;  4GOC A;  2X8X X;  4LNF A;  4JLC A;  4IDI A;  1RM6 C;  2J52 A;  3NZ3 A;  4MJS B;  2IY1 B;  2LZ6 A;  5BMH A;  5E6P A;  4W9L A;  4P6V F;  3VUW A;  5IO9 A;  2IGG A;  2Y3A A;  4OW0 A;  3UGB B;  1D4B A;  4DXG A;  4GMV A;  4IG7 B;  1F9J A;  3VH3 B;  4E74 A;  2MX2 A;  2HTM E;  4CO7 A;  3PRM B;  3W1S C;  3VTW A;  1WMH B;  1ZW7 A;  2DZK A;  5BMI A;  2L7R A;  3ML8 A;  1GNU A;  3NG0 A;  1JRU A;  3W1Y A;  4GN1 A;  4DXA B;  2AL6 A;  1R4M B;  3B1L X;  3H1U A;  3VXW A;  4BKT A;  1V81 A;  4KZ0 A;  2H88 B;  1TZO A;  3M62 B;  3HHM A;  3HIZ A;  3Q6B A;  1GC6 A;  4KIK B;  3PRE A;  1BXT A;  4HCN B;  1T3Q A;  2LVP A;  3I9V 1;  1B1Z A;  4DHZ B;  1KFY B;  3P2B A;  4GLS C;  4HVB A;  3L0W B;  1JWM D;  1E8Y A;  2AL3 A;  3X23 A;  3VFK A;  1XCQ L;  3PZ7 A;  4MGZ E;  2FCN A;  1WM3 A;  4CHK A;  2KMC A;  4HCP B;  4S17 A;  1WR6 E;  2NCN A;  1NYQ A;  2L0T A;  3P4Q B;  1IBX B;  3SFE B;  4KGT A;  3ABV B;  4GDK B;  4Q2J A;  3L54 A;  2M1M A;  4MM3 B;  4KV2 A;  3UQB A;  2JT4 B;  3NS8 A;  3KWL A;  4EEW A;  3V05 A;  2K22 A;  1D3Z A;  2FNJ B;  1RYJ A;  1TKE A;  3ZO5 B;  5AZG A;  3AN1 A;  1SF0 A;  1WY8 A;  1LXD A;  4WJN A;  3LXF A;  3RD2 A;  1WH3 A;  2K9X A;  2N9K A;  1PUT A;  1SJH D;  3SR6 A;  1XLN A;  4OVU A;  2KDB A;  2J0J A;  1JRP A;  2KT7 A;  5FKA C;  2IO0 B;  1L6U A;  1C4C A;  1V80 A;  3N20 C;  4RNA A;  2REX A;  4BVU C;  4TSS A;  2I1K A;  4ZOH C;  1FEH A;  1J0G A;  1HE8 A;  3WAO A;  1L6V A;  3AE4 B;  3M63 B;  1D6E C;  1TY2 A;  2NS5 A;  5T8I A;  2JXT A;  2ZPY A;  4I6P A;  4MT5 A;  4CYE A;  4RF0 A;  4WQO B;  3ZDM C;  3BYT B;  3Q3M C;  3L08 A;  1QIL A;  2WXN A;  4KZC A;  3IFW B;  3AB5 A;  1GOZ A;  3BZD B;  2EMT A;  3RYT A;  2KTF A;  3K9P B;  2G1E A;  5HG2 A;  5I4D A;  2JX5 A;  4D2K A;  3OLM D;  1Q1O A;  3Q2A C;  4DDI D;  2QDF A;  1SIF A;  4FJY A;  4LNK A;  2PKO A;  2ZNV C;  1WRD B;  3R2I A;  4GSW A;  3KYC D;  1SJE D;  2QJL A;  4ZDV A;  2KTR A;  3EA6 A;  1FCL A;  4RGO S;  4OHJ A;  1AAR A;  1WX8 A;  1PDX A;  3R2T A;  4BAX A;  2W55 A;  4WJP A;  2DYB A;  3I3T B;  3VHT C;  1FM0 D;  1GAQ B;  2FBW B;  3DBS A;  4GU2 A;  4DHZ E;  1KLG D;  2NBU A;  3JYU A;  3R7R A;  2PW9 A;  4ITK A;  1PGX A;  3PVL A;  3SFD B;  5G5H A;  1DOY A;  2XK5 A;  2KDM A;  2LWP A;  1KTK A;  2BTE A;  2WU2 B;  4P1C C;  3CF6 E;  4IM3 A;  3ZRC A;  5JHA A;  3AE8 B;  2JU6 X;  3QK0 A;  3TMP B;  2JRI B;  2DYO A;  2KN4 A;  5FK9 C;  3FKY A;  3HVD A;  1L7Y A;  2YEP B;  4LJP B;  1CJE A;  2O6V D;  3ZUN A;  3ZIM A;  2ZNV B;  2IJ0 A;  3EFU A;  2V4L A;  2GMI C;  3UF8 A;  4NJ7 A;  2K0P A;  2FCS A;  3B2F A;  1TKY A;  5TSS A;  2SEB D;  2LGS A;  1BML C;  3QIJ A;  1F2R I;  3AU5 A;  3URY A;  2DX5 B;  4YXD B;  1RAX A;  2KQ4 X;  1WJU A;  2KWC A;  3V6E B;  2WDR B;  2DAF A;  2BBC A;  4NAM A;  3MC0 B;  5AUK A;  4BBN C;  1KRH A;  2JY6 A;  2BW2 A;  2Z0E B;  2K39 A;  4C7Y A;  3LYY A;  4II2 B;  4OZB A;  2MWS B;  4N9F 4;  3T3O A;  1PGB A;  2L3Z A;  3GZN B;  4YTM B;  4FHJ A;  2JRH A;  1WFY A;  1EWC A;  3N32 A;  2KVR A;  2LGD A;  3PT2 B;  3WCQ A;  2Z59 B;  2WS3 B;  2CKH B;  1WGK A;  3FAH A;  1DYQ A;  1FXA A;  2R2Q A;  3Q69 A;  2RDB C;  2ON8 A;  2I38 A;  2JSV X;  3VR8 B;  1UF0 A;  3TEX A;  2N9E B;  1MPE A;  2MBE A;  3JW0 X;  2KQS A;  3TL5 A;  2XK5 B;  1QOA A;  4DXF A;  1J7C A;  3P4P B;  4BKG A;  2BF8 B;  3EGR A;  3AU4 A;  2LGY A;  2XN9 C;  4EUT A;  4MSM B;  1JQ4 A;  1SB3 C;  1WM2 A;  1XQQ A;  3I63 C;  1Q5W B;  3H7S A;  4YTN B;  5HHD G;  5JXV A;  1JW9 D;  3B2G A;  1P0R A;  5HI1 A;  1TGZ B;  1L0V B;  1T5X D;  1VZ6 A;  5IN7 A;  3QJZ A;  4US9 A;  4P1B C;  2D3C A;  2CU3 A;  3RNE C;  3SDL C;  1H8C A;  1I4Q A;  2W3S A;  4LCD E;  2K6D B;  1TKG A;  4G50 A;  4W9J A;  5DCN A;  4M8M A;  1WE7 A;  3QC8 B;  1I35 A;  1MI0 A;  1UEL A;  2N0S B;  5J17 A;  1VCB A;  1EO6 A;  2HDE A;  2M17 A;  3V3X A;  3KUD B;  1I4G A;  4HLE A;  1TS4 A;  2KFK A;  1I4P A;  2DZM A;  3CWI A;  1GB4 A;  3N30 A;  3MJ5 A;  3NS1 A;  1MJD A;  2LGI A;  3ZJV A;  3TUO A;  5D2M B;  4YSZ B;  4IW0 A;  2N9X A;  1ESF A;  5IKC M;  3HM3 A;  2EKI A;  2PMV A;  4PYU A;  1E5W A;  1YX6 B;  2G4S A;  2JXX A;  2CR5 A;  2DZJ A;  2WX0 A;  5DPR A;  2D3G A;  1RLF A;  3DVN V;  2V3N A;  3VDZ A;  1TS5 A;  5LLI A;  2B3A A;  1V5T A;  1VD2 A;  1NYR A;  1IP9 A;  2WXJ A;  3PHX B;  2BQQ A;  2LXA A;  1EF5 A;  1WJN A;  2QHO A;  3EUB 2;  2H89 B;  2BB5 A;  4DHJ D;  2MJ3 A;  4MJS A;  1JRO A;  3WAL A;  2LHE A;  1V8C A;  2UYZ B;  2W9N A;  1TT5 B;  5LNK 1;  2RDH A;  3RNF C;  3ZRF A;  4GGQ A;  4AWJ A;  3DVG X;  1ROE A;  2GOW A;  3KWV A;  1C4A A;  3OG5 A;  4LNO A;  5D3I B;  2B76 B;  2PVG C;  4IM0 A;  2LEK A;  3QQ8 B;  4OZA A;  2WXR A;  3X0W A;  2K8B A;  1KJT A;  2WDV B;  5D94 A;  1E7P B;  3WA0 A;  2SAK A;  2TSS A;  3QX1 A;  3SHQ A;  3ONS A;  1TIF A;  1XT9 B;  5DPW A;  5C3J B;  2LXC A;  1F52 A;  4W9H A;  2RPV A; 
#chains in the Genus database with same CATH homology
 1FRR A;  2LUM A;  1V1P A;  4TQ1 A;  4YT0 B;  1V1O A;  2J42 A;  4RFB A;  1IUE A;  1NYQ A;  3SEB A;  1TS2 A;  3BVG A;  1KLU D;  2J53 A;  3E56 A;  4KGR A;  1C76 A;  3P4Q B;  4WIP A;  4LLG M;  2WQY B;  1NEN B;  1L5P A;  1N5X A;  4A8X C;  4HEA 1;  1YQ4 B;  2V3P A;  3C8Y A;  1CZP A;  1I4X A;  3SFE B;  1IBX B;  2IDY A;  4KGT A;  4A90 A;  5EE9 A;  3ABV B;  3NVV A;  4GDK B;  4Q2J A;  1FFU A;  4MM3 B;  3Q8E A;  4XWT A;  4H2A A;  4N6E B;  2DLB A;  3KWL A;  2Q5W D;  1UUP A;  3IAM 1;  1KH0 A;  1I4H A;  1N60 A;  4C80 A;  3GS2 A;  2K3U A;  3IT6 B;  3NVY A;  1UGJ A;  3V05 A;  2K22 A;  1SE3 A;  1D5X C;  2M56 B;  1YN4 A;  1XLO A;  3AEE B;  1ZPS A;  4US8 A;  3W1S A;  1RYJ A;  3OWE B;  1TKE A;  1K52 A;  2JWU A;  2AX5 A;  3ZJT A;  2FUG 1;  3AN1 A;  3Q8F A;  1SF0 A;  1VZ7 A;  2RDG A;  2K5P A;  1VDV A;  1L0X B;  2QIL A;  3LXF A;  1FIQ A;  2K9X A;  2WP9 B;  2N9K A;  1PUT A;  1VLB A;  1QQR A;  1HEZ E;  2QEJ C;  3UI3 A;  1HZ5 A;  1SJH D;  3SR6 A;  4A6Q A;  2BS4 B;  2OED A;  2NTT A;  1XLN A;  1ZUD 2;  3ZJU A;  5G5G A;  1MHX A;  4HJG E;  1JRP A;  5FKA C;  1L6U A;  2BB6 A;  1C4C A;  2WLB A;  4JWS C;  3TEW A;  1E6E B;  4RNA A;  4TSS A;  4TMA B;  1I7H A;  4ZOH C;  3GB1 A;  5E6J A;  1FEH A;  2GB1 A;  3VR9 B;  1L6V A;  3AE4 B;  2KAJ A;  1D6E C;  1TY2 A;  3DWM A;  1I4R A;  5T8I A;  2JXT A;  1YQ3 B;  4FXC A;  2DWQ A;  3Q8B A;  1SXT A;  1VR9 A;  2DBY A;  2WXL A;  4J3O D;  2I2Y A;  4MT5 A;  2XNA C;  4RF0 A;  4XWW A;  2VZK D;  4YTP B;  1DOX A;  3BYT B;  2GRI A;  1QIL A;  2WXN A;  1XO3 A;  4RGN A;  3AB5 A;  4AS1 A;  1SBB B;  1GOZ A;  2PIA A;  3BK2 A;  3BZD B;  3FIL A;  4B0E A;  1ZOY B;  3W2D A;  2FE8 A;  1Q10 A;  2G1E A;  5C2T B;  2Z8L A;  5HG2 A;  5I4D A;  1PYW D;  2JX5 A;  4D2K A;  1FFV A;  4A9A A;  1ET6 A;  1OFF A;  3Q8A A;  2PKO A;  1F0Z A;  3R2I A;  3W5U B;  2IGH A;  4WUR A;  2W54 A;  4P16 A;  1V1P B;  2CJN A;  2WXG A;  2VZK B;  1SJE D;  1FO4 A;  3GP7 A;  3NVZ A;  3AH7 A;  4ZRP A;  1SSN A;  2QJL A;  3EA6 A;  5H8Y E;  4RGM A;  1FCL A;  3NVW A;  4OHJ A;  3NRZ A;  1NEK B;  4RGO S;  2V0G A;  3VRA B;  3TEZ A;  1NVI D;  1JAL A;  1PDX A;  3R2T A;  1QF6 A;  1C9F A;  4CQN A;  3HUI A;  1D5Z C;  3BK1 A;  2L83 A;  3AEC B;  3P4S B;  2W55 A;  5BYR A;  1FM0 D;  1GAQ B;  2FBW B;  1QLB B;  1TS3 A;  1AW7 A;  3MP9 A;  3LB8 C;  2WXM A;  1XLQ A;  4A55 A;  1KLG D;  4L2Y A;  3AE1 B;  3AE3 B;  1QKZ A;  2PW9 A;  4WQM A;  2WU5 B;  4ITK A;  4ARI A;  2IGD A;  1L4Z B;  1PGX A;  4LTU A;  3SFD B;  5G5H A;  2L52 A;  1DOY A;  4WAF A;  3MFG A;  2W3R A;  3O13 A;  2KDM A;  4USA A;  1KTK A;  2NMQ A;  2BTE A;  2ZW0 A;  1WRI A;  2WU2 B;  3AE8 B;  2JU6 X;  5HFY A;  4OZC A;  2DYO A;  4ZHP A;  1XXG A;  2KN4 A;  3U7Z A;  5BMG A;  4WWM A;  4KKI A;  5FK9 C;  1P7F A;  1YMH E;  3HVD A;  4GDL B;  1EM7 A;  1EU4 A;  1FXI A;  2IPK D;  4L23 A;  1AYF A;  2YEP B;  1D5M C;  1CJE A;  1ZDV A;  2AQ3 B;  1OQR A;  2J4X A;  3AE6 B;  4YSY B;  5EE0 A;  2GI9 A;  2IJ0 A;  3T3N A;  4HKQ A;  3H8H A;  5D3D A;  4C7Z A;  2K0P A;  1FMA D;  1N62 A;  2L32 A;  3AED B;  3B2F A;  3AV8 A;  3NUH B;  2WNM A;  3BYY B;  3I57 A;  1ENF A;  2KMM A;  1TKY A;  4LK0 M;  5TSS A;  4RCO A;  1V97 A;  2SEB D;  3U2S C;  1EWY C;  3AE5 B;  1BML C;  1N5W A;  4ARC A;  1F2R I;  1ZE3 D;  1IGD A;  3L4P A;  1HA5 A;  3URY A;  1VZ8 A;  4YXD B;  1QOF A;  2INN E;  2WXF A;  3FIL B;  2JYT A;  2KQ4 X;  3PO0 A;  2LJI A;  1XEE A;  2WDR B;  2BBC A;  4NAM A;  3MC0 B;  5AUK A;  1TJE A;  1KRH A;  4YSX B;  3E9S A;  2BW2 A;  4XE0 A;  2D5G A;  5D7G A;  1C79 A;  1ACC A;  1LO5 D;  2N7J A;  4JPS A;  1F77 A;  4C7Y A;  1E10 A;  1HXY D;  3LYY A;  1QOB A;  1WYG A;  1YNT E;  3IT4 B;  4OZB A;  4YWG G;  3T3O A;  1PGB A;  1C78 A;  2PLP A;  2BYT A;  4YTM B;  2BS2 B;  5FR3 A;  1FD6 A;  1F2R C;  1SEB D;  1EWC A;  4NJC A;  1FCC C;  1K51 A;  1GPX A;  1CK1 A;  4M0W A;  3WCQ A;  2RMM A;  3BVZ A;  1VJK A;  2WS3 B;  3AEF B;  3BWU D;  1WGK A;  2WXI A;  3FAH A;  1K50 A;  1DYQ A;  1FXA A;  2DYM A;  2W82 A;  4MAC A;  1HZ6 A;  1SE2 A;  3Q69 A;  2V4I B;  2ON8 A;  1MHH E;  3P1M A;  3VRB B;  3P4R B;  2I38 A;  2JSV X;  3R8B A;  3VR8 B;  1JWS D;  1E9M A;  1XLP A;  2Y5C A;  2BT6 A;  1N63 A;  1WSP A;  3TEX A;  1PGA A;  4HRO A;  3KLS X;  4NZL B;  4XDC A;  3AM9 A;  4PT5 A;  4C56 C;  2N9L A;  1MPE A;  1YN5 A;  4OVZ A;  2MH7 A;  5BYS A;  4EE2 A;  2OHF A;  1DGJ A;  2M0A A;  1QOA A;  3AE7 B;  1ET9 A;  1STE A;  1XF5 L;  4DXF A;  1J7C A;  3P4P B;  4XDD A;  1JCK B;  5EE3 A;  2BS3 B;  3EGR A;  4KGS A;  3AEA B;  1J7B A;  1WWT A;  2XN9 C;  3PZ8 A;  2X38 A;  1RWS A;  3CIR B;  2L1A A;  2ONQ A;  1JQ4 A;  1SB3 C;  3BVM A;  3P63 A;  4RH6 A;  1WXQ A;  4MH8 A;  1N61 A;  5GXG B;  3AE2 B;  4JX1 C;  3W9C B;  4N58 A;  4WH4 A;  2JQR B;  4YTN B;  2R61 A;  5HHD G;  5JXV A;  1JW9 D;  3B2G A;  5HI1 A;  3AMZ A;  4AQ7 A;  4DQO C;  2ZW1 A;  1J7A A;  1L0V B;  1T5X D;  1FNV A;  1VZ6 A;  4TQ0 A;  4UDU C;  3TEY A;  2AQ2 B;  1XCT L;  3HVZ A;  1YN3 A;  2MEK A;  3TSS A;  4US9 A;  2CU3 A;  1EU3 A;  1ZDX A;  1SE4 A;  1ZXI A;  2AQ1 B;  1R7S A;  2LFI A;  1I4Q A;  5MPO A;  2W3S A;  2PVO D;  2INP E;  3DWG C;  1K53 A;  3BII D;  1AWD A;  3AE9 B;  4HKZ E;  1KF6 B;  1Y56 A;  4R3D A;  1TKG A;  3Q8C A;  3U52 E;  1MVK A;  1JWU D;  1A70 A;  2E6X A;  3P42 A;  3AEB B;  1MI0 A;  2N0S B;  3IXS A;  1OQQ A;  2QIE B;  4KKJ A;  3ETR A;  1BUI C;  1IGC A;  3RPF C;  1IBX A;  2HDE A;  4REZ A;  3ZQ4 A;  1JWB D;  1UWM A;  4RF1 A;  1L4D B;  3V3X A;  1FRD A;  5AUI A;  1HQR D;  3AEG B;  2YEP F;  2JYE A;  4IOI E;  1I4G A;  2ACZ B;  2Y5P A;  5H92 C;  3ZYY X;  1AN8 A;  1TS4 A;  1UWX A;  2LHD A;  1I4P A;  3CWI A;  1GB4 A;  1FNW A;  1YJJ A;  3MJ5 A;  3NS1 A;  4L1B A;  3W5V B;  3U4E G;  2LGI A;  3ZJV A;  3TUO A;  1T6B X;  3VQI A;  2WXO A;  4YSZ B;  1ZP0 B;  1ESF A;  2MJD A;  4KX6 B;  1C77 A;  4B0M A;  1UNS A;  2EKI A;  2PMV A;  4IDI A;  1RM6 C;  4RGT A;  4ZRQ A;  2J52 A;  3NZ3 A;  2QSD A;  4ZYS A;  2KWD A;  5BMH A;  4P6V F;  3MHZ A;  2V3N A;  1TS5 A;  1GB1 A;  1JWA D;  2IGG A;  2Y3A A;  4OW0 A;  2E3T A;  1D4B A;  4DXG A;  1NYR A;  2HTM E;  2WXJ A;  1NI3 A;  2QMT A;  4ZHO A;  3ZGZ A;  5BMI A;  2WXQ A;  2PTL A;  4IKG A;  2MJE A;  4HRS A;  5EE1 A;  1QOG A;  3EUB 2;  1RFK A;  2H89 B;  2BB5 A;  2KAC A;  1TY0 A;  4O1N A;  2MJ3 A;  1SIJ A;  2ICI A;  1E0Z A;  3J9C A;  1JRO A;  2LHE A;  2G9H D;  3HRD D;  1QT9 A;  1V8C A;  1YJI A;  1M4V A;  5LNK 1;  4JWU C;  2RDH A;  2H88 B;  3IAS 1;  1L0Y B;  3N9Y C;  1PFD A;  3FC4 A;  1TZO A;  1ROE A;  2JZP A;  3KWV A;  1C4A A;  4NAW B;  5D3I B;  5BYQ A;  3RFZ B;  1BXT A;  2B76 B;  2PVG C;  1FNU A;  1P7E A;  1T3Q A;  2LEK A;  2WXH A;  2M19 A;  3I9V 1;  2LMC A;  1B1Z A;  4OZA A;  2WXR A;  2CJO A;  1ZXH A;  2WXK A;  2WDV B;  3B9J A;  1E7P B;  2NTS A;  4N59 A;  1KFY B;  2SAK A;  2TSS A;  1B9R A;  1DOI A;  1JML A;  4GLS C;  1C4P A;  1CQV A;  1JWM D;  1TYG B;  2EEL A;  1VRA B;  5C3J B;  4JE3 B;  1XCQ L;  2WDQ B;  3PZ7 A;  3KQ4 A;  2RPV A;  2WXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...