1OQQA

Crystal structure of c73s/c85s mutant of putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida, at 1.47a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Putidaredoxin
publication title Crystal structure of putidaredoxin, the [2Fe-2S] component of the P450cam monooxygenase system from Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
total genus 23
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1oqqA00
2K5PA 1E0ZA 2H89B 2E3TA 1N5XA 1KRHA 1IUEA 1JRPA 1DGJA 1SIJA 4FXCA 4N58A 5AUKA 3SR6A 1DOXA 2BS2B 1L6VA 3DWMA 2AX5A 2DWQA 1FMAD 1E6EB 1NYQA 2G1EA 1UWMA 3AEDB 2N0SB 3LXFA 4C7ZA 4US8A 3LB8C 1B9RA 4C80A 2WQYB 5C3JB 1N61A 3HUIA 3AH7A 3NVWA 5EE0A 2Y5CA 2CJNA 3AE9B 5EE9A 3B9JA 3W9CB 1GPXA 4YSZB 2PVGC 3P1MA 2Q5WD 2ACZB 1FRRA 2WDQB 1ZUD2 1GAQB 2WS3B 1CJEA 2WU5B 2K9XA 2MJ3A 3P4PB 1VDVA 5G5GA 4A9AA 3AM9A 1QOFA 2W3RA 1PFDA 1FIQA 3AE4B 3NRZA 1RM6C 3P4QB 1E9MA 5MPOA 4N6EB 4US9A 1JWBD 2H88B 4ZHOA 4YT0B 3ETRA 4YSYB 1FRDA 1CZPA 1VLBA 5C2TB 1ZXIA 2BS4B 1FFUA 3AEFB 2CJOA 4JX1C 2CU3A 4WWMA 1V8CA 3SFEB 2FBWB 1J7CA 1DOYA 1JWAD 2LEKA 1FO4A 4WQMA 4YTNB 3W5VB 2MH7A 2L52A 3CIRB 1YQ3B 3AEEB 1JALA 1QOBA 1VJKA 3FAHA 3VR8B 2K22A 4N59A 4IDIA 3AE2B 1N60A 3AE6B 2WP9B 3VRBB 2EKIA 1PDXA 2PVOD 1TKEA 2WU2B 1JW9D 5H92C 4JWSC 3VRAB 3AE3B 3AV8A 1E10A 1I7HA 1J7BA 3AECB 1FXIA 1WYGA 3AE1B 3AE5B 3ZYYX 1TKYA 2KAJA 2MJDA 1OQRA 1DOIA 1AYFA 1RWSA 1XLOA 3EUB2 1QLBB 2OHFA 4P6VF 1E7PB 3B2GA 1RYJA 4HROA 1TKGA 5EE1A 1TJEA 1NEKB 4ZHPA 2WDVB 1YJJA 1FM0D 2PIAA 1L6UA 1ROEA 1PUTA 4KX6B 3ABVB 1N62A 1A70A 2BS3B 1WXQA 3HVZA 1QF6A 2B76B 4YTMB 1FFVA 1AWDA 1N63A 1YJIA 3W5UB 1QOAA 4YSXB 2W54A 2QIEB 3PO0A 1QOGA 3HRDD 2W3SA 3BIID 1RFKA 1T3QA 4JWUC 1J7AA 1NVID 2MJEA 3AEBB 2M56B 3WCQA 1WGKA 1FXAA 1NYRA 1ZOYB 5G5HA 2HTME 5AUIA 1EWYC 2L83A 2WDRB 1JQ4A 3P4SB 5GXGB 1QT9A 2DBYA 2M19A 1TYGB 3FC4A 4USAA 4ZOHC 3B2FA 5H8YE 4YXDB 3CWIA 1R7SA 3AE7B 5EE3A 1XLNA 3L4PA 3NVYA 4ITKA 4LTUA 2QJLA 3NS1A 1NI3A 4C7YA 3AEAB 1XO3A 1KFYB 1WRIA 1L5PA 2PKOA 2WLBA 1KF6B 3AEGB 3NVVA 4HRSA 2W55A 1L0VB 3AN1A 3RPFC 1V97A 1XLPA 2BT6A 3P63A 3SFDB 1OFFA 1ZP0B 1SF0A 1XLQA 2KMMA 3NVZA 3AB5A 1WWTA 1YQ4B 3DWGC 3KWLA 1SB3C 3P4RB 1JROA 2JX5A 4YTPB 1NENB 2JQRB 1OQQA 1F0ZA 1N5WA 3AE8B 3VR9B 3AMZA
chains in the Genus database with same CATH superfamily
2LJIA 3A9KB 1YOVB 4KKJA 3V62A 3BVZA 4EEWA 5HHDG 3GZNB 1P3QU 3BVMA 2C7MB 2V0GA 2JF5A 2W82A 3VRAB 3DBHI 2ZW1A 2MJ3A 2XNAC 3IVFA 1RM6C 2NPTA 2C9WB 3MC0B 3DPDA 5CHWA 3Q8FA 1WXVA 1V1PB 1CZPA 5CTRC 4XZ4A 4XWWA 3RYTA 3JSVB 3ZJUA 4WJQA 2ZJDA 3MJWA 2N9PC 3ZVVA 1V6EA 3ENEA 1FXTB 1VJKA 4RGNA 4REZA 2C7HA 5J2RA 1GC7A 4TKNA 3AE3B 5FKAC 3Q3NC 3V6EB 1DOIA 1XLOA 1JWSD 4A3PA 4MJSA 3BWUD 5EE1A 3I5JC 2JT4B 3DOWA 4AJWA 1R4NB 3ZNHB 4G50A 2NTSA 3NG0A 2C60A 3EA6A 4ZDVA 3RN9C 3QCAA 3RNAC 2JWUA 1IBXB 1P9DU 4LNFA 2CHWA 3EHVA 1WXMA 3Q3JA 4IM3A 2DZMA 1UBIA 3E56A 1ET6A 4DWFA 3Q6BA 1P1AA 1V2YA 1A5RA 1TS3A 4HPLB 1D5MC 4ITKA 2PKOA 2V3NA 1KLUD 2LGSA 2X38A 3V61A 1MG4A 3ZRFA 2LUEA 2G45B 2JX5A 2KWUB 3OG5A 1I4HA 5D6JB 5DCNA 1E0ZA 2WX1A 1SIJA 3O13A 3NHEB 4DBGA 3SR6A 3PV1A 1VRAB 3NUHB 3PHXB 2MBQA 3TMPB 4K1RB 4IWOA 1NI2A 4ICUA 4IG7B 3KW5B 1X1MA 2KDBA 5AZGA 5L83A 2QHOA 1ZUD2 1ZDVA 1STEA 4F8CB 5CHFA 2BBCA 1HTQA 5MPOA 3QAQA 1TS4A 1KTKA 2BYVE 3E9SA 1VLBA 1KOTA 1TZ1A 4W9JA 4WWMA 1V9JA 2LEKA 4W9IA 5GMVA 2YLMA 4Q2JA 4TQ0A 1I4PA 4ZYSA 2KMCA 4HJKA 1UD7A 2KLGA 4I6NB 2INNE 2HTHA 2BTEA 2WXLA 1TKYA 3BK2A 2NTTA 2QEJC 3NJTA 4ZRKA 3TEWA 1WRDB 2KWCA 1YJJA 4AJYB 4HKZE 4M0WA 1DYQA 2M0AA 2AWTA 4EFOA 4B0MA 3MC9A 4XGAB 2B3AA 5D7GA 2D5GA 1Q10A 2V3PA 2I1KA 2LXAA 3ZIMA 1OGWA 4RGOS 2IO1B 2JY6A 1EU3A 5BMHA 2DHZA 1EM7A 5KHOA 4USAA 2LI5A 3V05A 1C1YB 3H7SA 1YN3A 4F1SA 1SE3A 1F77A 2BT6A 3PZDA 4E71A 2JYTA 1K50A 3FILB 2RDBC 2FIFA 3VUWA 1YD8U 3U52E 5BYRA 2HJ8A 1UUPA 2BS2B 3HK0A 4LNOA 1FCCC 3AEDB 2WDTB 1WGGA 3LB8C 1EUVB 5BO4B 1SJED 2G4SA 3CF6E 3AE9B 3U7DA 2LGXA 2IBIB 2MQJA 3RNBC 5JH5C 2N7DA 1G6JA 3BYYB 5G5GA 4NJ7A 2LD9A 1QOFA 1UELA 2R2OA 4NAWA 3AE4B 3GE8C 1L7YA 2L00B 1MI0A 3U8ZA 5DPSA 3ZTDA 3GB1A 2D3BA 1WM3A 2N1WA 2N9LA 2CJOA 2M4NA 3W2DA 5HKHA 4AWJA 4DHZB 2WXMA 4JQWC 2YEPF 2WNMA 1UWXA 4HDQA 3V3XA 3U7ZA 2CKHB 1AYFA 2MEKA 4P6VF 1E7PB 2ONQA 4DXFA 4ZRQA 4B0EA 2JXTA 2RR9A 1R4NI 3RZFA 4FN2A 1L0XB 4J6IA 1NVID 2MJEA 2Y5PA 4IC7B 1FD6A 4EE2A 2IO0B 2IJ0A 4W9CA 3IHPC 3X23A 1QZEA 3H9DA 1D4BA 2PE9A 5HG2A 3PVLA 3SDLC 4AQ7A 5D94A 4A55A 4XC2A 2WXOA 3HVDA 4W9DA 1XLQA 2KMMA 4KSKC 1WWTA 3PREA 1OTRB 1MHXA 3PLUA 2MLBA 1J0GA 4K7SA 3PZ8A 4MEMA 1N5XA 3IBEA 1OQYA 2Z59B 3DWMA 2R2QA 2DWQA 2FUG1 1E6EB 2KWVB 2REXA 3LXFA 3EFCA 2N0SB 1HZ6A 4FJYA 1EWCA 4C80A 5EE0A 2Y5CA 4BKGA 2PW9A 4FHKA 2AEHA 3B9JA 5IN7A 2PVGC 2UWQA 2J4XA 3B08A 1WGRA 4PS8A 4P1BC 3Q8AA 1VD2A 4ZHOA 4BOZB 3KYCD 3SFEB 1C4PA 3GS2A 1MJDA 1TY0A 3RULA 5T8IA 1BXTA 3WANA 4WWPA 1HQRD 3RZWC 2BB6A 1E10A 3DQVA 4XDCA 3NY5A 1FNUA 1HXYD 1ZKHA 1EF5A 3VH4B 3RMKC 1PUTA 3Q2AC 1QILA 3RT3B 1MVKA 1JWUD 1QOAA 2GI9A 2L3ZA 2INDC 1TIFA 2BYFA 5LXIB 2W3SA 4JWUC 3M62B 4FJVB 2M56B 1WGKA 2LZ6A 1ZOYB 2PLPA 3R2IA 1EWYC 3R8BA 1TYGB 1SXTA 2I1JA 3AE7B 1D3ZA 1NI3A 4RM9A 2KJRA 1I35A 3P63A 2L8JA 1VCBA 1F2RC 1NENB 1T0YA 2A4ZA 2N4FA 3LJ3A 3IT4B 1V5TA 4IKGA 2KC1A 4N58A 3NZSA 2O6VD 3VQIA 2WGSA 1WJ4A 4C7ZA 2LUMA 3MHZA 2LGIA 2ZCBA 4LJPB 3KYDD 4WAAA 3SU8X 4YSZB 2WS3B 3P4PB 1JCKB 5JHAA 1VDVA 2BWES 3TEYA 1R4MB 4N6EB 1I4GA 2KACA 1XCQL 3PHWB 1WJNA 1IGCA 1TTNA 4RM8A 3MHSD 2XEWA 1T0RC 1DOYA 3ZXRA 3AEEB 1QOBA 3VR8B 2WXJA 3JVZX 1BUIC 4OZAA 4BBNF 2EKIA 3QX1A 2FUHB 2XK5A 1J7BA 1I7HA 4ICVA 4P16A 3X0WA 2MJDA 1OQRA 1RWSA 2JUOA 2GBNA 2OHFA 4HROA 1TKGA 2LWPA 1PGBA 4WIPA 2JRHA 3Q3MC 1S3SG 3URYA 2IGHA 3D32A 2PJHA 1N63A 3W1SC 2L76A 3N1YC 1KJTA 4MDKE 3M3JA 3JW0X 1GNUA 5E6PA 3TBLD 1WX8A 1FXAA 4R3DA 4FHJA 4S0RA 1QT9A 2BYTA 1R7SA 3NS1A 3O65B 2IO2B 3DHHC 5C23A 1KF6B 4NAMA 2D3AA 1L0VB 2KHWB 2AQ1B 2ASQA 3P42A 3N32A 2DENB 3P4RB 2JQRB 4B95A 1FEHA 3HM6X 4IWPA 3Q8BA 4BBNC 1FMAD 1B9RA 1ISNA 4HWIB 2NMQA 3AH7A 1E8WA 2G9HD 1IP9A 1NBFC 2EELA 4S17A 1Y56A 4BKSD 4M01A 3QK0A 1E9MA 1JWBD 4JGHB 3A9KA 1GJZA 3QA8A 3U30A 1C76A 3VH3B 2NVUI 4CO7A 4MGZE 4CHKA 4LCDE 3PT2B 1M4VA 4N59A 2HE7A 4BKTA 4KV2A 4G3XB 4WWNA 3N3KB 2KJHB 5JXVA 2V9HA 4MT5A 2J52A 3K9PB 1WJ6A 4EKUA 2KQ4X 3KUZA 5I4DA 4GDKB 1V1PA 1TT5B 1ET9A 3JSVA 4JPSA 4PK1A 1WYWB 3DDCB 1SJHD 2OEDA 1FNWA 2DNFA 2HTME 4WAFA 2M19A 1TZOA 5H8YE 4GDLB 5G55A 4OZCA 3NVYA 3IAS1 3BK1A 2VH2A 2HD5B 4IUMB 2J0JA 4HRSA 2W55A 4NQLB 2FIDA 1OQQA 1SBBB 1IBXA 2H89B 3DVGX 4RF0A 2IYDB 3ZNGC 2WXHA 3T3NA 4X57B 2K0PA 3PSEB 3MC8A 4LDTD 4MGYE 4F7ZA 1CMXB 5FK9C 4P7IA 1GPXA 3RNFC 1F52A 1WZ3A 1FRRA 1C77A 2KFKB 5CX3A 4W9KA 2PTLA 2N9KA 4HJGE 1PQSA 4NNJB 2BVCA 5HI1A 4US9A 3EFUA 3T3OA 3QJZA 1FRDA 3S2AA 3ML9A 1B1ZA 2RPQA 2O2VB 1FO4A 4YTNB 3CIRB 1T0QC 1YQ3B 3N1XC 3R66C 1F2RI 2J7QB 5D2MB 1KM7A 2INPE 2PVOD 1JW9D 2RD0A 3AECB 1GUAB 1E7UA 1J8CA 3B0AA 4PS7A 4ANUA 3ALBA 1SGHA 3R2TA 1WZ0A 2JZ3B 3KH0A 2BS3B 3DBLB 4GMVA 4MGIE 2AL6A 1L0YB 2BGFA 3N30A 3DBRB 3ZO5B 2BWFA 1Y8RC 4HEA1 4WJOA 3UGBB 3VDZA 4HCPB 4RMAA 2DBYA 4HDOA 3ZNZB 2L1AA 2WHIA 1UZXB 1KFYB 1L5PA 1YJ1A 2ICIA 1SF0A 3DWGC 3ZNID 4RF1A 3NS8A 4GU2A 1F0ZA 2MP2B 4XYCA 1XD3B 4BOSC 4FULA 2X8XX 3B1LX 2V1YA 2NBVB 2AX5A 1C9FA 4L2YA 4KGRA 1FNVA 4MACA 1HEZE 1UNSA 1K52A 2JXXA 2DAFA 3P1MA 4ARCA 2Q5WD 1CJEA 2AL3A 4M8NA 2MBEA 3FILA 3H6NA 3VXWA 2ZPNA 2QCZA 1FFUA 1P7FA 2M0XA 5BMGA 3BYTB 1JWAD 4DDGD 4EZKA 2MH7A 1QKZA 2SAKA 3AE6B 2JWZA 3ZUNA 3GZNI 2WXGA 3VAWA 1BMLC 2DZKA 5H92C 1YIWA 2KNBA 3L08A 3A1QB 4HPPA 1LO5D 4L1BA 4DHJD 1D5XC 3IT6B 5J18A 4DQOC 1ZW7A 2LMCA 2N7EA 2WXPA 1J19A 4L23A 1WXQA 2LJ5A 3PO0A 1KLGD 3AEBB 2AQ2B 2MHJA 3TEXA 5G5HA 3WALA 3RI7C 2D07B 3H1UA 3B2FA 1ZE3D 4K81A 3IFWB 3BZDB 1GB4A 1PGAA 2WXIA 3IAM1 3NVVA 2SEBD 3AU4A 3VVWB 3HHMA 4PS3A 1HTOA 1SB3C 1JROA 2QSDA 4BFRA 2IGGA 2KJ6A 4AUQC 2KDEB 4HLEA 2N7JA 2WXQA 1IUEA 2LVQA 3RNGC 2N9EB 1GOZA 4WURA 1N61A 1RLFA 3OAWA 1PYWD 1Q1OA 2I2YA 3WAOA 2VZKD 4IWQA 1RFAA 3AM9A 1ESFA 4KGSA 4M00A 2FCQA 1P7EA 1UBQA 2LFIA 4K3CA 3EECA 1N6ZA 1Z2MA 1C78A 3APDA 5D3DA 2KN4A 1WGHA 5IAAC 3QARA 4WQMA 3KUCB 1P98A 3FAHA 2MRPA 4IDIA 3AE2B 4BZAA 3VRBB 4KIKB 1ZGUB 1LQBA 1YN5A 3WAPA 1FXIA 2KTFA 1E8ZA 3CSTA 1E5WA 4K7UA 1JRUA 1RYJA 4II3B 2D10A 4AOFA 3C19A 3ABVB 3I63C 3HVZA 3PRMB 2LVPA 2Y3AA 4P1CC 3PS6A 4MELA 1IPGA 3VUXA 2DYBA 2GBJA 3M95A 2KMAA 4A3OA 5AUIA 2IO3B 2NBUA 5DPTA 3L16A 5EDSA 2AQ3B 3LDZE 3AEAB 3DBHB 5AEKB 3NOBA 4MM3B 1F1HA 2KVZA 2C5LC 2G4DB 2LGYA 3I57A 4YTPB 1U4AA 1T0SC 4WQOB 3DHIC 5E6OA 1V86A 4GXBA 4GGQA 1WXAA 4NJ6A 3TSSA 4M8MA 1VZ7A 4KGTA 3ZKJC 3BINA 2G1EA 2KXJA 1WE6A 3UIOB 2WQYB 1RRBA 3TIXA 2Z8LA 2CJNA 5EE9A 4FADA 4LNKA 5HFYA 3WAMA 4URKA 5BYQA 1PFDA 2QDFA 2L7RA 2O6VB 2BPSA 1ZDXA 1HZ5A 2DX5B 4CQNA 1C4CA 1XXGA 2XBBC 1TGZB 2JU6X 3FKYA 1RAXA 4JX1C 2FBWB 1WSPA 3KLSX 5KHQA 1K51A 1V5OA 3RUIB 1TKEA 4K7WA 2M1MA 4IM0A 1AW7A 3AXCA 3GP7A 3KVFB 3JYUA 1AARA 1EO6A 3AE5B 4OW0A 4GOCA 1Q5WB 1QLBB 3J9CA 2KDFB 2LASA 2K6DB 3SD5A 3N9YC 1ZPSA 4KX6B 1A70A 1WX7A 3I9V1 2UYZB 4YTMB 1FFVA 3UI3A 3W5UB 3PRZA 1J7AA 2FE8A 4ANXA 4N9F4 1L4DB 1OEYJ 4FJZA 4OVUA 2HDEA 3EC8A 1XEEA 2KTRB 3IG3A 4WJPA 2Y5BB 2KLCA 4YWGG 3Q14C 3AB5A 2ON8A 2KFJA 2WXKA 1ACCA 5G2NA 2V4IB 3DHGC 3NZUA 2WXFA 4FLHA 3VR9B 2J0MA 4RH6A 1JRPA 3EGRA 2BKFA 3ZJTA 3Q3FA 1S1QB 3L13A 3R7QA 1K53A 4EZLA 5C3JB 2KD0A 2L05A 3A4RA 2UU7A 2ZVNA 3Q8CA 3VUYA 2WU5B 2K9XA 2RDHA 2K6QA 4ARIA 3R3MA 3Q3OC 1SSNA 5BMIA 1L2NA 1H8CA 1H4RA 2KN5A 2XN9C 4ASWC 2GB1A 3BVGA 3OJ4B 1YX5B 3W1YA 1YQBA 4XDDA 2GRIA 1ENFA 2KKCA 4HXDA 3MJ5A 4AP4C 4JLCA 3W1SA 2K22A 4FA6A 2VH1A 1TS5A 2LXCA 4GB9A 4ZRIA 1WYGA 2KOXA 1SEBD 3N20C 1QQRA 4KDLB 3H8HA 3MTNB 3H7PB 1TJEA 1NEKB 3APFA 4ZHPA 4OHJA 1V80A 1ROEA 2PEAA 3RFZB 1KH0A 1WMHB 2VRRB 1L4ZB 4GSWA 1VZ8A 1WMHA 1SE2A 1RFKA 2I38A 1E8XA 2KDIA 2MSED 2WDRB 2KT7A 5GXGB 4TUUA 2D2QA 4WH4A 4LTUA 4MH0E 2GMIC 3CSFA 2KWDA 1OFFA 2NS5A 2PE6B 4A20A 3OLMD 3ZLZA 2NPTB 4IM2A 1Z5SB 3M63B 2J42A 4GDKA 3N1ZC 3VHTC 2BQQA 1N5WA 1T5XD 2E3TA 3P2BA 4A6QA 4BVUC 1DGJA 5AUKA 1UF0A 3KWVA 1C79A 2L32A 4JL9A 4OVZA 1M94A 3SEBA 1UWMA 4DHZE 4GDLA 3NVWA 3HUIA 1C4AA 5FR6A 4EOYA 2MBOA 2A5UA 1TS2A 2KDMA 3IXSA 2YVCA 2Z0DB 2E6XA 3MFGA 4TSSA 3GOEA 2CS4A 4MJSB 3T9LA 4ACFA 3RNEC 1WH3A 5E6JA 4KZ0A 1T6BX 2L0TA 1WR1A 3L0WB 2KC2A 2AYOB 4LDTB 4B9KA 1V8CA 5IA7A 3K9OB 5DPRA 2L52A 1WJUA 1CK1A 3L10B 3DVGY 1N60A 1P0RA 3GE3C 2GOWA 1LFDA 2BKRB 3AE1B 2KFKA 3DCGA 1YN4A 3B2GA 1XCTL 2PIAA 1R4MI 3UF8A 3APCA 4G0NB 3PZ7A 2DYMA 4DXAB 1WY8A 2CHZA 4PYZA 1AN8A 2CU1A 2RSUA 3RD2A 2O2VA 2J53A 1E7VA 2WX0A 4PT5A 4LJOB 3KUDB 4FBJB 2K39A 1Q0WB 2C7NB 1XLNA 2QJLA 2K8HA 2PMVA 1TY2A 2NCNA 1XLPA 2JYEA 4GN1A 4W9GA 1UGMA 3ZTCA 2N9XA 2LGDA 3AMZA 2K5PA 5IKCM 3PTFC 4B6WA 2L0FA 5J17A 2JPHA 4US8A 4XE0A 1WI0A 2BF8B 3RNCC 1NDDA 2MBHA 2GBMA 4HK2A 3U4EG 4IW0A 2KQSA 4A9AA 2RDGA 2V3SA 3DBSA 4M0WB 4UDUC 3Q69A 2MBBB 2MP2A 2JSVX 2BS4B 1GC6A 2QILA 2ZCCA 5AZHA 1WE7A 4MH8A 3ZGZA 3W5VB 3TUOA 3QC8B 3PLVA 3L54A 4GIVA 1PDXA 2WU2B 1HE8A 4NZLB 1F9JA 3SHQA 3ML8A 4OZBA 2IY0B 4H2AA 1WXSA 2HJ1A 2KX3A 1WGDA 2MA9B 4ANVA 2LVOA 4TV3A 2JZZA 2W54A 2QIEB 1JMLA 4DHJB 2LHDA 2FCMA 1I4RA 2RPVA 5E6NA 3A1QA 4YXDB 5EE3A 3AI5A 4RGTA 2Z0EB 1WRIA 2WLBA 1SE4A 3ZDMC 3TJPA 3ZDTA 3RPFC 1V97A 4NAWB 4A8XC 4GLSC 1YQ4B 5LXHA 2WWZA 4KSLC 4MSQB 3AE8B 4HVBA 1KRHA 1BT0A 3V6CB 4FXCA 2FCNA 1FPYA 2MW5A 2ZNVC 1EF1A 1L6VA 1SIFA 4RCOA 1UGJA 4YL8A 2GBKA 2NBWB 3ONSA 4DDID 2TSSA 2DZIA 5L95C 1I4XA 3QQ8B 2ACZB 2GBRA 4D2KA 2KQ7A 3NZ3A 1E90A 2W3RA 2MCNB 1FIQA 2EKEC 1XT9B 1V81A 3NRZA 4A90A 1LM8B 5IO9A 3VTVA 2K1FA 4W9FA 2H88B 5JHBA 1PGXA 5TR5A 3WA0A 1ZXIA 4HPMB 3AEFB 3CMMB 3PRPB 2WXNA 1E8YA 1WGYA 2CU3A 3R7RA 3A9JB 4LNIA 1JALA 2VZKB 2KO3A 2K8CA 3PPAA 3A9JA 4TQ1A 3AV8A 2ZNVB 4M02A 1XF5L 4II2B 1XQQA 5TSSA 4WWOA 3TEZA 2FNJB 1L6UA 1N62A 4W9HA 1K8RB 4JIOU 4KZCA 4KDIC 2RGFA 1AWDA 3UQBA 3L17A 2N1VA 1QOGA 3HRDD 3BIID 4XWTA 3ZQ4A 4DK5A 1IYFA 2EMTA 2BW2A 1NYRA 4KIKA 2JZPA 4MGKE 4RNAA 4C4VB 1MPEA 4I6PA 3CWIA 1UH6A 3HM3A 2MX2A 4C4VA 4C7YA 5AZFA 1FCLA 3I3TB 3ZW3A 1V49A 3SFDB 1ZP0B 4MSMB 4NJCA 4LK0M 3KWLA 2KX0A 4LNNA 2W9NA 3T8MA 1ZXHA 4EUTA 3DBLI 1TBEA 1GG3A 2IPKD 5LNK1 1YMHE 3WIMA 1DOXA 4HCNB 3OWEB 2V4LA 3DBRI 3MP9A 1VZ6A 1WM2A 2ZZPB 4CYEA 5IP4D 2QMTA 3W9CB 1OEYA 3ZXVA 2WDQB 1MHHE 1GAQB 3VTUA 3A4SC 4KKIA 1D5ZC 4MM3A 4I6LB 3P4QB 2YEPB 4ANWA 2QC8A 3TCAA 1GB1A 2ZPYA 3ETRA 1VR9A 5C2TB 1I42A 3C8YA 5CHVC 2BYEA 3AULA 5FR3A 1KLVA 2G3QB 3Q8EA 4TMAB 4JWSC 2KK8A 1WR6E 2M8SA 4G11A 2K8BA 3ZYYX 2D3GA 3HIZA 4EZJA 2KVRA 1HA5A 1LGRA 4RGMA 4O1NA 2O6VA 3ZJVA 4J3OD 2K25A 3UIPB 5DPWA 2D11A 1V1OA 1QF6A 3OJ3A 4YSXB 5IOIA 2RMMA 3A33B 2IDYA 3QIJA 2WXRA 2L83A 3VFKA 2CHXA 4ZOHC 3FC4A 2FAZA 5C1ZA 2OOBB 4K3BA 3LYYA 5BYSA 3KQ4A 4W9EA 1XO3A 2ZEQA 2BB5A 2K3UA 2DAJA 3AEGB 1D6EC 1LXDA 3AN1A 2ZVOA 1YNTE 2INCC 4QAYA 2MWSB 2IY1B 4E3CA 2JVCA 5D3IB 4C00A 4DXGA 2OJWA 4HKQA 1JWMD 1NYQA 5JZEB 1SE9A 3AU5A 4NQKE 3RCZA 3UQAA 2KTRA 2LRWA 2KZRA 2XK5B 2CR5A 1YX6B 1WIAA 2DLBA 4XX5A 2PPHA 1EU4A 4YT0B 2GLSA 4IOIE 4YSYB 3V60A 2ZW0A 1WX9A 1WF9A 3BY4B 4ZYNA 1J7CA 2WYQA 2DZJA 2WP9B 1MG8A 4WJNA 2IGDA 4NY0A 3QWZB 1CQVA 2NR2A 3ECIA 2LHEA 2KAJA 4AS1A 3EUB2 2IZVB 2D3CA 4ZRPA 2JRIB 2WDVB 1FM0D 3QHTA 4W9LA 3ZRCA 1IGDA 4PYUA 2EMSA 2DYOA 2FCSA 2B76B 4RFBA 3TL5A 4JE3B 1YJIA 3DVNU 2LRUA 3PGEA 4ZRJA 1T3QA 1WFYA 2R61A 2M17A 4KVGB 3WCQA 4OVVA 4BKSA 4BAXA 4LLGM 3VTWA 4NPNA 1JQ4A 3P4SB 1C3TA 2OJRA 4C56C 3L4PA 2J0KA 2KANA 3U2SC 3H7PA 3UINB 3DVNV 1I4QA 3NVZA 1MFWA 4E74A 3C0RB 5LLIA 2KYWA
chains in the Genus database with same CATH topology
2K5PA 2LJIA 2WXQA 1IUEA 4N58A 4KKJA 3VQIA 1GOZA 4C7ZA 4US8A 3BVZA 4XE0A 4WURA 5HHDG 2LUMA 3MHZA 3BVMA 1N61A 2LGIA 2V0GA 1PYWD 4YSZB 3U4EG 2W82A 3VRAB 2I2YA 2WS3B 2ZW1A 2VZKD 1JCKB 2MJ3A 2XNAC 3P4PB 1VDVA 4A9AA 3AM9A 1ESFA 4KGSA 3TEYA 2RDGA 1P7EA 1RM6C 2LFIA 4N6EB 1I4GA 3MC0B 2KACA 4UDUC 1XCQL 3Q69A 3Q8FA 2JSVX 1V1PB 1CZPA 1IGCA 1C78A 2BS4B 2QILA 4XWWA 3ZJUA 4MH8A 5D3DA 1DOYA 2KN4A 3ZGZA 4WQMA 3W5VB 3AEEB 3TUOA 1QOBA 1VJKA 3FAHA 3VR8B 2WXJA 1BUIC 4IDIA 4OZAA 3AE2B 4RGNA 4REZA 3VRBB 2EKIA 1PDXA 2WU2B 1YN5A 4NZLB 3AE3B 5FKAC 1J7BA 1I7HA 1FXIA 4P16A 4OZBA 2MJDA 4H2AA 1OQRA 1DOIA 1RWSA 1XLOA 1JWSD 2OHFA 3BWUD 4HROA 1RYJA 5EE1A 1TKGA 1PGBA 4WIPA 2NTSA 3ABVB 3URYA 3HVZA 3EA6A 2IGHA 2Y3AA 1N63A 2JWUA 2W54A 2QIEB 1IBXB 1JMLA 2LHDA 1FXAA 4R3DA 5AUIA 3E56A 1I4RA 1ET6A 2RPVA 1QT9A 4YXDB 2BYTA 1TS3A 1R7SA 5EE3A 1D5MC 4ITKA 2AQ3B 3NS1A 4RGTA 3AEAB 1WRIA 2PKOA 2WLBA 2V3NA 1KF6B 1SE4A 4NAMA 1KLUD 1L0VB 2AQ1B 3RPFC 1V97A 4NAWB 4MM3B 2X38A 4A8XC 3P42A 4GLSC 1YQ4B 3P4RB 3I57A 2JX5A 4YTPB 2JQRB 1FEHA 1I4HA 3AE8B 3Q8BA 1E0ZA 3TSSA 1KRHA 1SIJA 3O13A 4FXCA 3SR6A 1VRAB 3NUHB 1VZ7A 4KGTA 1L6VA 4RCOA 1UGJA 1FMAD 2G1EA 1B9RA 2WQYB 2TSSA 2NMQA 3AH7A 2Z8LA 2CJNA 5EE9A 2G9HD 1I4XA 2ACZB 2EELA 1Y56A 4D2KA 1ZUD2 5HFYA 3NZ3A 1ZDVA 1STEA 2W3RA 5BYQA 1PFDA 1FIQA 2BBCA 3NRZA 1E9MA 5MPOA 4A90A 1TS4A 1KTKA 1ZDXA 1JWBD 2H88B 1HZ5A 4CQNA 1PGXA 1C4CA 3E9SA 1XXGA 1VLBA 1ZXIA 2JU6X 3AEFB 2WXNA 4JX1C 1C76A 2CU3A 4WWMA 2FBWB 2LEKA 1WSPA 4Q2JA 3KLSX 1M4VA 1JALA 4TQ0A 1I4PA 2VZKB 4N59A 4ZYSA 1K51A 4TQ1A 1TKEA 1AW7A 3AV8A 2INNE 3GP7A 1XF5L 5JXVA 2BTEA 3AE5B 2WXLA 1TKYA 4OW0A 4MT5A 3BK2A 2NTTA 2QEJC 5TSSA 2J52A 1QLBB 3J9CA 3TEZA 3TEWA 1YJJA 3N9YC 1L6UA 1ZPSA 4HKZE 4M0WA 4KX6B 2KQ4X 1DYQA 1N62A 2M0AA 1A70A 5I4DA 3I9V1 4GDKB 1V1PA 4YTMB 4B0MA 1FFVA 5D7GA 3UI3A 1AWDA 2D5GA 3W5UB 1ET9A 4JPSA 1Q10A 2V3PA 1QOGA 3HRDD 3BIID 4XWTA 3ZQ4A 1J7AA 2FE8A 1SJHD 2OEDA 4RGOS 1FNWA 1EU3A 2BW2A 5BMHA 1NYRA 1L4DB 2HTME 2JZPA 4WAFA 4RNAA 1EM7A 1MPEA 2HDEA 1TZOA 2M19A 4GDLB 1XEEA 4USAA 5H8YE 3V05A 3CWIA 4OZCA 3NVYA 3IAS1 4C7YA 3BK1A 1FCLA 1YN3A 4HRSA 2W55A 4YWGG 1SE3A 1F77A 2BT6A 3SFDB 1ZP0B 4NJCA 4LK0M 3AB5A 3KWLA 2JYTA 1K50A 2ON8A 3FILB 1ZXHA 2WXKA 1ACCA 1OQQA 2V4IB 1SBBB 2WXFA 3U52E 3VR9B 2IPKD 5LNK1 5BYRA 1IBXA 4RH6A 1UUPA 1YMHE 2H89B 4RF0A 1JRPA 3EGRA 2WXHA 1DOXA 2BS2B 3OWEB 3MP9A 3ZJTA 3T3NA 1FCCC 3AEDB 1VZ6A 1K53A 2K0PA 3LB8C 5C3JB 1SJED 2QMTA 3AE9B 3W9CB 5FK9C 1GPXA 1FRRA 1MHHE 2WDQB 1C77A 1GAQB 2WU5B 3BYYB 2K9XA 2RDHA 3Q8CA 4KKIA 5G5GA 2PTLA 1QOFA 1D5ZC 2N9KA 3AE4B 4HJGE 4ARIA 1SSNA 3P4QB 2YEPB 5BMIA 1MI0A 2XN9C 5HI1A 4US9A 1GB1A 3T3OA 3ETRA 2GB1A 3GB1A 1VR9A 1FRDA 3BVGA 5C2TB 4XDDA 2N9LA 2CJOA 2GRIA 1B1ZA 3C8YA 1ENFA 3W2DA 1FO4A 4YTNB 3CIRB 3MJ5A 1YQ3B 5FR3A 3Q8EA 3W1SA 1F2RI 2K22A 2INPE 2PVOD 4TMAB 1JW9D 2WXMA 4JWSC 1TS5A 2YEPF 2WNMA 3AECB 1UWXA 3V3XA 1WYGA 1SEBD 3ZYYX 3U7ZA 1QQRA 1AYFA 1HA5A 2MEKA 3H8HA 4P6VF 4RGMA 1E7PB 2ONQA 4O1NA 4DXFA 1TJEA 1NEKB 4ZRQA 4ZHPA 3R2TA 4OHJA 1ROEA 3ZJVA 4J3OD 3RFZB 1KH0A 4B0EA 2JXTA 2BS3B 1QF6A 1V1OA 1L0XB 1L4ZB 4YSXB 1VZ8A 1SE2A 2RMMA 1RFKA 1L0YB 1NVID 2MJEA 2I38A 2Y5PA 2IDYA 1FD6A 4HEA1 4EE2A 2WXRA 2L83A 2IJ0A 2WDRB 5GXGB 2DBYA 4ZOHC 3FC4A 1D4BA 2L1AA 4WH4A 5HG2A 3LYYA 4LTUA 5BYSA 3AMZA 3KQ4A 4AQ7A 1XO3A 1KFYB 1L5PA 2BB5A 2K3UA 3AEGB 4A55A 1D6EC 2WXOA 2KWDA 3AN1A 3HVDA 1YNTE 1OFFA 2ICIA 1SF0A 1XLQA 2KMMA 1WWTA 3DWGC 4RF1A 2J42A 1MHXA 1F0ZA 5D3IB 1N5WA 4DXGA 4HKQA 1T5XD 3PZ8A 2E3TA 1N5XA 4A6QA 1DGJA 1JWMD 5AUKA 3KWVA 1C79A 2L32A 3DWMA 4OVZA 2AX5A 2DWQA 2FUG1 1C9FA 4L2YA 1E6EB 1NYQA 3SEBA 1UWMA 3LXFA 1FNVA 2N0SB 4KGRA 1HZ6A 4MACA 1EWCA 4C80A 1HEZE 1UNSA 1K52A 3HUIA 1C4AA 3NVWA 2Y5CA 5EE0A 2PW9A 3B9JA 1TS2A 2KDMA 3IXSA 2PVGC 3P1MA 2Q5WD 4ARCA 1CJEA 2E6XA 2J4XA 3MFGA 4TSSA 2DLBA 3FILA 3Q8AA 5E6JA 1EU4A 4ZHOA 4YT0B 1T6BX 4IOIE 4YSYB 1FFUA 1P7FA 2ZW0A 3SFEB 5BMGA 1V8CA 3BYTB 1C4PA 3GS2A 1J7CA 1JWAD 2MH7A 2L52A 1QKZA 1CK1A 1TY0A 2SAKA 5T8IA 1BXTA 1N60A 3AE6B 2WP9B 1HQRD 2WXGA 1BMLC 2IGDA 5H92C 2BB6A 1CQVA 1LO5D 1E10A 4L1BA 4XDCA 3AE1B 2LHEA 1FNUA 1HXYD 2KAJA 1D5XC 4AS1A 3EUB2 1YN4A 3IT6B 3B2GA 4ZRPA 1XCTL 4DQOC 2WDVB 2LMCA 1FM0D 2PIAA 2WXPA 1PUTA 3PZ7A 1QILA 1IGDA 2DYMA 4L23A 1WXQA 2DYOA 2B76B 4RFBA 1AN8A 4JE3B 1MVKA 1YJIA 1JWUD 1QOAA 2GI9A 3PO0A 2W3SA 4JWUC 1T3QA 2J53A 1KLGD 2R61A 3AEBB 2M56B 3WCQA 1WGKA 4PT5A 2AQ2B 1ZOYB 2PLPA 3R2IA 5G5HA 3TEXA 1EWYC 4LLGM 1JQ4A 3P4SB 3R8BA 1TYGB 3B2FA 1ZE3D 1SXTA 4C56C 3AE7B 1XLNA 3L4PA 2QJLA 3BZDB 1NI3A 2PMVA 1GB4A 1PGAA 1TY2A 2WXIA 3IAM1 3NVVA 3U2SC 1XLPA 2SEBD 3P63A 2JYEA 1I4QA 3NVZA 1F2RC 1SB3C 1JROA 2QSDA 1NENB 2IGGA 3IT4B 4IKGA 2N7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5P A;  1E0Z A;  2H89 B;  2E3T A;  1N5X A;  1KRH A;  1IUE A;  1JRP A;  1DGJ A;  1SIJ A;  4FXC A;  4N58 A;  5AUK A;  3SR6 A;  1DOX A;  2BS2 B;  1L6V A;  3DWM A;  2AX5 A;  2DWQ A;  1FMA D;  1E6E B;  1NYQ A;  2G1E A;  1UWM A;  3AED B;  2N0S B;  3LXF A;  4C7Z A;  4US8 A;  3LB8 C;  1B9R A;  4C80 A;  2WQY B;  5C3J B;  1N61 A;  3HUI A;  3AH7 A;  3NVW A;  5EE0 A;  2Y5C A;  2CJN A;  3AE9 B;  5EE9 A;  3B9J A;  3W9C B;  1GPX A;  4YSZ B;  2PVG C;  3P1M A;  2Q5W D;  2ACZ B;  1FRR A;  2WDQ B;  1ZUD 2;  1GAQ B;  2WS3 B;  1CJE A;  2WU5 B;  2K9X A;  2MJ3 A;  3P4P B;  1VDV A;  5G5G A;  4A9A A;  3AM9 A;  1QOF A;  2W3R A;  1PFD A;  1FIQ A;  3AE4 B;  3NRZ A;  1RM6 C;  3P4Q B;  1E9M A;  5MPO A;  4N6E B;  4US9 A;  1JWB D;  2H88 B;  4ZHO A;  4YT0 B;  3ETR A;  4YSY B;  1FRD A;  1CZP A;  1VLB A;  5C2T B;  1ZXI A;  2BS4 B;  1FFU A;  3AEF B;  2CJO A;  4JX1 C;  2CU3 A;  4WWM A;  1V8C A;  3SFE B;  2FBW B;  1J7C A;  1DOY A;  1JWA D;  2LEK A;  1FO4 A;  4WQM A;  4YTN B;  3W5V B;  2MH7 A;  2L52 A;  3CIR B;  1YQ3 B;  3AEE B;  1JAL A;  1QOB A;  1VJK A;  3FAH A;  3VR8 B;  2K22 A;  4N59 A;  4IDI A;  3AE2 B;  1N60 A;  3AE6 B;  2WP9 B;  3VRB B;  2EKI A;  1PDX A;  2PVO D;  1TKE A;  2WU2 B;  1JW9 D;  5H92 C;  4JWS C;  3VRA B;  3AE3 B;  3AV8 A;  1E10 A;  1I7H A;  1J7B A;  3AEC B;  1FXI A;  1WYG A;  3AE1 B;  3AE5 B;  3ZYY X;  1TKY A;  2KAJ A;  2MJD A;  1OQR A;  1DOI A;  1AYF A;  1RWS A;  1XLO A;  3EUB 2;  1QLB B;  2OHF A;  4P6V F;  1E7P B;  3B2G A;  1RYJ A;  4HRO A;  1TKG A;  5EE1 A;  1TJE A;  1NEK B;  4ZHP A;  2WDV B;  1YJJ A;  1FM0 D;  2PIA A;  1L6U A;  1ROE A;  1PUT A;  4KX6 B;  3ABV B;  1N62 A;  1A70 A;  2BS3 B;  1WXQ A;  3HVZ A;  1QF6 A;  2B76 B;  4YTM B;  1FFV A;  1AWD A;  1N63 A;  1YJI A;  3W5U B;  1QOA A;  4YSX B;  2W54 A;  2QIE B;  3PO0 A;  1QOG A;  3HRD D;  2W3S A;  3BII D;  1RFK A;  1T3Q A;  4JWU C;  1J7A A;  1NVI D;  2MJE A;  3AEB B;  2M56 B;  3WCQ A;  1WGK A;  1FXA A;  1NYR A;  1ZOY B;  5G5H A;  2HTM E;  5AUI A;  1EWY C;  2L83 A;  2WDR B;  1JQ4 A;  3P4S B;  5GXG B;  1QT9 A;  2DBY A;  2M19 A;  1TYG B;  3FC4 A;  4USA A;  4ZOH C;  3B2F A;  5H8Y E;  4YXD B;  3CWI A;  1R7S A;  3AE7 B;  5EE3 A;  1XLN A;  3L4P A;  3NVY A;  4ITK A;  4LTU A;  2QJL A;  3NS1 A;  1NI3 A;  4C7Y A;  3AEA B;  1XO3 A;  1KFY B;  1WRI A;  1L5P A;  2PKO A;  2WLB A;  1KF6 B;  3AEG B;  3NVV A;  4HRS A;  2W55 A;  1L0V B;  3AN1 A;  3RPF C;  1V97 A;  1XLP A;  2BT6 A;  3P63 A;  3SFD B;  1OFF A;  1ZP0 B;  1SF0 A;  1XLQ A;  2KMM A;  3NVZ A;  3AB5 A;  1WWT A;  1YQ4 B;  3DWG C;  3KWL A;  1SB3 C;  3P4R B;  1JRO A;  2JX5 A;  4YTP B;  1NEN B;  2JQR B;  1OQQ A;  1F0Z A;  1N5W A;  3AE8 B;  3VR9 B;  3AMZ A; 
#chains in the Genus database with same CATH topology
 2LJI A;  3A9K B;  1YOV B;  4KKJ A;  3V62 A;  3BVZ A;  4EEW A;  5HHD G;  3GZN B;  1P3Q U;  3BVM A;  2C7M B;  2V0G A;  2JF5 A;  2W82 A;  3VRA B;  3DBH I;  2ZW1 A;  2MJ3 A;  2XNA C;  3IVF A;  1RM6 C;  2NPT A;  2C9W B;  3MC0 B;  3DPD A;  5CHW A;  3Q8F A;  1WXV A;  1V1P B;  1CZP A;  5CTR C;  4XZ4 A;  4XWW A;  3RYT A;  3JSV B;  3ZJU A;  4WJQ A;  2ZJD A;  3MJW A;  2N9P C;  3ZVV A;  1V6E A;  3ENE A;  1FXT B;  1VJK A;  4RGN A;  4REZ A;  2C7H A;  5J2R A;  1GC7 A;  4TKN A;  3AE3 B;  5FKA C;  3Q3N C;  3V6E B;  1DOI A;  1XLO A;  1JWS D;  4A3P A;  4MJS A;  3BWU D;  5EE1 A;  3I5J C;  2JT4 B;  3DOW A;  4AJW A;  1R4N B;  3ZNH B;  4G50 A;  2NTS A;  3NG0 A;  2C60 A;  3EA6 A;  4ZDV A;  3RN9 C;  3QCA A;  3RNA C;  2JWU A;  1IBX B;  1P9D U;  4LNF A;  2CHW A;  3EHV A;  1WXM A;  3Q3J A;  4IM3 A;  2DZM A;  1UBI A;  3E56 A;  1ET6 A;  4DWF A;  3Q6B A;  1P1A A;  1V2Y A;  1A5R A;  1TS3 A;  4HPL B;  1D5M C;  4ITK A;  2PKO A;  2V3N A;  1KLU D;  2LGS A;  2X38 A;  3V61 A;  1MG4 A;  3ZRF A;  2LUE A;  2G45 B;  2JX5 A;  2KWU B;  3OG5 A;  1I4H A;  5D6J B;  5DCN A;  1E0Z A;  2WX1 A;  1SIJ A;  3O13 A;  3NHE B;  4DBG A;  3SR6 A;  3PV1 A;  1VRA B;  3NUH B;  3PHX B;  2MBQ A;  3TMP B;  4K1R B;  4IWO A;  1NI2 A;  4ICU A;  4IG7 B;  3KW5 B;  1X1M A;  2KDB A;  5AZG A;  5L83 A;  2QHO A;  1ZUD 2;  1ZDV A;  1STE A;  4F8C B;  5CHF A;  2BBC A;  1HTQ A;  5MPO A;  3QAQ A;  1TS4 A;  1KTK A;  2BYV E;  3E9S A;  1VLB A;  1KOT A;  1TZ1 A;  4W9J A;  4WWM A;  1V9J A;  2LEK A;  4W9I A;  5GMV A;  2YLM A;  4Q2J A;  4TQ0 A;  1I4P A;  4ZYS A;  2KMC A;  4HJK A;  1UD7 A;  2KLG A;  4I6N B;  2INN E;  2HTH A;  2BTE A;  2WXL A;  1TKY A;  3BK2 A;  2NTT A;  2QEJ C;  3NJT A;  4ZRK A;  3TEW A;  1WRD B;  2KWC A;  1YJJ A;  4AJY B;  4HKZ E;  4M0W A;  1DYQ A;  2M0A A;  2AWT A;  4EFO A;  4B0M A;  3MC9 A;  4XGA B;  2B3A A;  5D7G A;  2D5G A;  1Q10 A;  2V3P A;  2I1K A;  2LXA A;  3ZIM A;  1OGW A;  4RGO S;  2IO1 B;  2JY6 A;  1EU3 A;  5BMH A;  2DHZ A;  1EM7 A;  5KHO A;  4USA A;  2LI5 A;  3V05 A;  1C1Y B;  3H7S A;  1YN3 A;  4F1S A;  1SE3 A;  1F77 A;  2BT6 A;  3PZD A;  4E71 A;  2JYT A;  1K50 A;  3FIL B;  2RDB C;  2FIF A;  3VUW A;  1YD8 U;  3U52 E;  5BYR A;  2HJ8 A;  1UUP A;  2BS2 B;  3HK0 A;  4LNO A;  1FCC C;  3AED B;  2WDT B;  1WGG A;  3LB8 C;  1EUV B;  5BO4 B;  1SJE D;  2G4S A;  3CF6 E;  3AE9 B;  3U7D A;  2LGX A;  2IBI B;  2MQJ A;  3RNB C;  5JH5 C;  2N7D A;  1G6J A;  3BYY B;  5G5G A;  4NJ7 A;  2LD9 A;  1QOF A;  1UEL A;  2R2O A;  4NAW A;  3AE4 B;  3GE8 C;  1L7Y A;  2L00 B;  1MI0 A;  3U8Z A;  5DPS A;  3ZTD A;  3GB1 A;  2D3B A;  1WM3 A;  2N1W A;  2N9L A;  2CJO A;  2M4N A;  3W2D A;  5HKH A;  4AWJ A;  4DHZ B;  2WXM A;  4JQW C;  2YEP F;  2WNM A;  1UWX A;  4HDQ A;  3V3X A;  3U7Z A;  2CKH B;  1AYF A;  2MEK A;  4P6V F;  1E7P B;  2ONQ A;  4DXF A;  4ZRQ A;  4B0E A;  2JXT A;  2RR9 A;  1R4N I;  3RZF A;  4FN2 A;  1L0X B;  4J6I A;  1NVI D;  2MJE A;  2Y5P A;  4IC7 B;  1FD6 A;  4EE2 A;  2IO0 B;  2IJ0 A;  4W9C A;  3IHP C;  3X23 A;  1QZE A;  3H9D A;  1D4B A;  2PE9 A;  5HG2 A;  3PVL A;  3SDL C;  4AQ7 A;  5D94 A;  4A55 A;  4XC2 A;  2WXO A;  3HVD A;  4W9D A;  1XLQ A;  2KMM A;  4KSK C;  1WWT A;  3PRE A;  1OTR B;  1MHX A;  3PLU A;  2MLB A;  1J0G A;  4K7S A;  3PZ8 A;  4MEM A;  1N5X A;  3IBE A;  1OQY A;  2Z59 B;  3DWM A;  2R2Q A;  2DWQ A;  2FUG 1;  1E6E B;  2KWV B;  2REX A;  3LXF A;  3EFC A;  2N0S B;  1HZ6 A;  4FJY A;  1EWC A;  4C80 A;  5EE0 A;  2Y5C A;  4BKG A;  2PW9 A;  4FHK A;  2AEH A;  3B9J A;  5IN7 A;  2PVG C;  2UWQ A;  2J4X A;  3B08 A;  1WGR A;  4PS8 A;  4P1B C;  3Q8A A;  1VD2 A;  4ZHO A;  4BOZ B;  3KYC D;  3SFE B;  1C4P A;  3GS2 A;  1MJD A;  1TY0 A;  3RUL A;  5T8I A;  1BXT A;  3WAN A;  4WWP A;  1HQR D;  3RZW C;  2BB6 A;  1E10 A;  3DQV A;  4XDC A;  3NY5 A;  1FNU A;  1HXY D;  1ZKH A;  1EF5 A;  3VH4 B;  3RMK C;  1PUT A;  3Q2A C;  1QIL A;  3RT3 B;  1MVK A;  1JWU D;  1QOA A;  2GI9 A;  2L3Z A;  2IND C;  1TIF A;  2BYF A;  5LXI B;  2W3S A;  4JWU C;  3M62 B;  4FJV B;  2M56 B;  1WGK A;  2LZ6 A;  1ZOY B;  2PLP A;  3R2I A;  1EWY C;  3R8B A;  1TYG B;  1SXT A;  2I1J A;  3AE7 B;  1D3Z A;  1NI3 A;  4RM9 A;  2KJR A;  1I35 A;  3P63 A;  2L8J A;  1VCB A;  1F2R C;  1NEN B;  1T0Y A;  2A4Z A;  2N4F A;  3LJ3 A;  3IT4 B;  1V5T A;  4IKG A;  2KC1 A;  4N58 A;  3NZS A;  2O6V D;  3VQI A;  2WGS A;  1WJ4 A;  4C7Z A;  2LUM A;  3MHZ A;  2LGI A;  2ZCB A;  4LJP B;  3KYD D;  4WAA A;  3SU8 X;  4YSZ B;  2WS3 B;  3P4P B;  1JCK B;  5JHA A;  1VDV A;  2BWE S;  3TEY A;  1R4M B;  4N6E B;  1I4G A;  2KAC A;  1XCQ L;  3PHW B;  1WJN A;  1IGC A;  1TTN A;  4RM8 A;  3MHS D;  2XEW A;  1T0R C;  1DOY A;  3ZXR A;  3AEE B;  1QOB A;  3VR8 B;  2WXJ A;  3JVZ X;  1BUI C;  4OZA A;  4BBN F;  2EKI A;  3QX1 A;  2FUH B;  2XK5 A;  1J7B A;  1I7H A;  4ICV A;  4P16 A;  3X0W A;  2MJD A;  1OQR A;  1RWS A;  2JUO A;  2GBN A;  2OHF A;  4HRO A;  1TKG A;  2LWP A;  1PGB A;  4WIP A;  2JRH A;  3Q3M C;  1S3S G;  3URY A;  2IGH A;  3D32 A;  2PJH A;  1N63 A;  3W1S C;  2L76 A;  3N1Y C;  1KJT A;  4MDK E;  3M3J A;  3JW0 X;  1GNU A;  5E6P A;  3TBL D;  1WX8 A;  1FXA A;  4R3D A;  4FHJ A;  4S0R A;  1QT9 A;  2BYT A;  1R7S A;  3NS1 A;  3O65 B;  2IO2 B;  3DHH C;  5C23 A;  1KF6 B;  4NAM A;  2D3A A;  1L0V B;  2KHW B;  2AQ1 B;  2ASQ A;  3P42 A;  3N32 A;  2DEN B;  3P4R B;  2JQR B;  4B95 A;  1FEH A;  3HM6 X;  4IWP A;  3Q8B A;  4BBN C;  1FMA D;  1B9R A;  1ISN A;  4HWI B;  2NMQ A;  3AH7 A;  1E8W A;  2G9H D;  1IP9 A;  1NBF C;  2EEL A;  4S17 A;  1Y56 A;  4BKS D;  4M01 A;  3QK0 A;  1E9M A;  1JWB D;  4JGH B;  3A9K A;  1GJZ A;  3QA8 A;  3U30 A;  1C76 A;  3VH3 B;  2NVU I;  4CO7 A;  4MGZ E;  4CHK A;  4LCD E;  3PT2 B;  1M4V A;  4N59 A;  2HE7 A;  4BKT A;  4KV2 A;  4G3X B;  4WWN A;  3N3K B;  2KJH B;  5JXV A;  2V9H A;  4MT5 A;  2J52 A;  3K9P B;  1WJ6 A;  4EKU A;  2KQ4 X;  3KUZ A;  5I4D A;  4GDK B;  1V1P A;  1TT5 B;  1ET9 A;  3JSV A;  4JPS A;  4PK1 A;  1WYW B;  3DDC B;  1SJH D;  2OED A;  1FNW A;  2DNF A;  2HTM E;  4WAF A;  2M19 A;  1TZO A;  5H8Y E;  4GDL B;  5G55 A;  4OZC A;  3NVY A;  3IAS 1;  3BK1 A;  2VH2 A;  2HD5 B;  4IUM B;  2J0J A;  4HRS A;  2W55 A;  4NQL B;  2FID A;  1OQQ A;  1SBB B;  1IBX A;  2H89 B;  3DVG X;  4RF0 A;  2IYD B;  3ZNG C;  2WXH A;  3T3N A;  4X57 B;  2K0P A;  3PSE B;  3MC8 A;  4LDT D;  4MGY E;  4F7Z A;  1CMX B;  5FK9 C;  4P7I A;  1GPX A;  3RNF C;  1F52 A;  1WZ3 A;  1FRR A;  1C77 A;  2KFK B;  5CX3 A;  4W9K A;  2PTL A;  2N9K A;  4HJG E;  1PQS A;  4NNJ B;  2BVC A;  5HI1 A;  4US9 A;  3EFU A;  3T3O A;  3QJZ A;  1FRD A;  3S2A A;  3ML9 A;  1B1Z A;  2RPQ A;  2O2V B;  1FO4 A;  4YTN B;  3CIR B;  1T0Q C;  1YQ3 B;  3N1X C;  3R66 C;  1F2R I;  2J7Q B;  5D2M B;  1KM7 A;  2INP E;  2PVO D;  1JW9 D;  2RD0 A;  3AEC B;  1GUA B;  1E7U A;  1J8C A;  3B0A A;  4PS7 A;  4ANU A;  3ALB A;  1SGH A;  3R2T A;  1WZ0 A;  2JZ3 B;  3KH0 A;  2BS3 B;  3DBL B;  4GMV A;  4MGI E;  2AL6 A;  1L0Y B;  2BGF A;  3N30 A;  3DBR B;  3ZO5 B;  2BWF A;  1Y8R C;  4HEA 1;  4WJO A;  3UGB B;  3VDZ A;  4HCP B;  4RMA A;  2DBY A;  4HDO A;  3ZNZ B;  2L1A A;  2WHI A;  1UZX B;  1KFY B;  1L5P A;  1YJ1 A;  2ICI A;  1SF0 A;  3DWG C;  3ZNI D;  4RF1 A;  3NS8 A;  4GU2 A;  1F0Z A;  2MP2 B;  4XYC A;  1XD3 B;  4BOS C;  4FUL A;  2X8X X;  3B1L X;  2V1Y A;  2NBV B;  2AX5 A;  1C9F A;  4L2Y A;  4KGR A;  1FNV A;  4MAC A;  1HEZ E;  1UNS A;  1K52 A;  2JXX A;  2DAF A;  3P1M A;  4ARC A;  2Q5W D;  1CJE A;  2AL3 A;  4M8N A;  2MBE A;  3FIL A;  3H6N A;  3VXW A;  2ZPN A;  2QCZ A;  1FFU A;  1P7F A;  2M0X A;  5BMG A;  3BYT B;  1JWA D;  4DDG D;  4EZK A;  2MH7 A;  1QKZ A;  2SAK A;  3AE6 B;  2JWZ A;  3ZUN A;  3GZN I;  2WXG A;  3VAW A;  1BML C;  2DZK A;  5H92 C;  1YIW A;  2KNB A;  3L08 A;  3A1Q B;  4HPP A;  1LO5 D;  4L1B A;  4DHJ D;  1D5X C;  3IT6 B;  5J18 A;  4DQO C;  1ZW7 A;  2LMC A;  2N7E A;  2WXP A;  1J19 A;  4L23 A;  1WXQ A;  2LJ5 A;  3PO0 A;  1KLG D;  3AEB B;  2AQ2 B;  2MHJ A;  3TEX A;  5G5H A;  3WAL A;  3RI7 C;  2D07 B;  3H1U A;  3B2F A;  1ZE3 D;  4K81 A;  3IFW B;  3BZD B;  1GB4 A;  1PGA A;  2WXI A;  3IAM 1;  3NVV A;  2SEB D;  3AU4 A;  3VVW B;  3HHM A;  4PS3 A;  1HTO A;  1SB3 C;  1JRO A;  2QSD A;  4BFR A;  2IGG A;  2KJ6 A;  4AUQ C;  2KDE B;  4HLE A;  2N7J A;  2WXQ A;  1IUE A;  2LVQ A;  3RNG C;  2N9E B;  1GOZ A;  4WUR A;  1N61 A;  1RLF A;  3OAW A;  1PYW D;  1Q1O A;  2I2Y A;  3WAO A;  2VZK D;  4IWQ A;  1RFA A;  3AM9 A;  1ESF A;  4KGS A;  4M00 A;  2FCQ A;  1P7E A;  1UBQ A;  2LFI A;  4K3C A;  3EEC A;  1N6Z A;  1Z2M A;  1C78 A;  3APD A;  5D3D A;  2KN4 A;  1WGH A;  5IAA C;  3QAR A;  4WQM A;  3KUC B;  1P98 A;  3FAH A;  2MRP A;  4IDI A;  3AE2 B;  4BZA A;  3VRB B;  4KIK B;  1ZGU B;  1LQB A;  1YN5 A;  3WAP A;  1FXI A;  2KTF A;  1E8Z A;  3CST A;  1E5W A;  4K7U A;  1JRU A;  1RYJ A;  4II3 B;  2D10 A;  4AOF A;  3C19 A;  3ABV B;  3I63 C;  3HVZ A;  3PRM B;  2LVP A;  2Y3A A;  4P1C C;  3PS6 A;  4MEL A;  1IPG A;  3VUX A;  2DYB A;  2GBJ A;  3M95 A;  2KMA A;  4A3O A;  5AUI A;  2IO3 B;  2NBU A;  5DPT A;  3L16 A;  5EDS A;  2AQ3 B;  3LDZ E;  3AEA B;  3DBH B;  5AEK B;  3NOB A;  4MM3 B;  1F1H A;  2KVZ A;  2C5L C;  2G4D B;  2LGY A;  3I57 A;  4YTP B;  1U4A A;  1T0S C;  4WQO B;  3DHI C;  5E6O A;  1V86 A;  4GXB A;  4GGQ A;  1WXA A;  4NJ6 A;  3TSS A;  4M8M A;  1VZ7 A;  4KGT A;  3ZKJ C;  3BIN A;  2G1E A;  2KXJ A;  1WE6 A;  3UIO B;  2WQY B;  1RRB A;  3TIX A;  2Z8L A;  2CJN A;  5EE9 A;  4FAD A;  4LNK A;  5HFY A;  3WAM A;  4URK A;  5BYQ A;  1PFD A;  2QDF A;  2L7R A;  2O6V B;  2BPS A;  1ZDX A;  1HZ5 A;  2DX5 B;  4CQN A;  1C4C A;  1XXG A;  2XBB C;  1TGZ B;  2JU6 X;  3FKY A;  1RAX A;  4JX1 C;  2FBW B;  1WSP A;  3KLS X;  5KHQ A;  1K51 A;  1V5O A;  3RUI B;  1TKE A;  4K7W A;  2M1M A;  4IM0 A;  1AW7 A;  3AXC A;  3GP7 A;  3KVF B;  3JYU A;  1AAR A;  1EO6 A;  3AE5 B;  4OW0 A;  4GOC A;  1Q5W B;  1QLB B;  3J9C A;  2KDF B;  2LAS A;  2K6D B;  3SD5 A;  3N9Y C;  1ZPS A;  4KX6 B;  1A70 A;  1WX7 A;  3I9V 1;  2UYZ B;  4YTM B;  1FFV A;  3UI3 A;  3W5U B;  3PRZ A;  1J7A A;  2FE8 A;  4ANX A;  4N9F 4;  1L4D B;  1OEY J;  4FJZ A;  4OVU A;  2HDE A;  3EC8 A;  1XEE A;  2KTR B;  3IG3 A;  4WJP A;  2Y5B B;  2KLC A;  4YWG G;  3Q14 C;  3AB5 A;  2ON8 A;  2KFJ A;  2WXK A;  1ACC A;  5G2N A;  2V4I B;  3DHG C;  3NZU A;  2WXF A;  4FLH A;  3VR9 B;  2J0M A;  4RH6 A;  1JRP A;  3EGR A;  2BKF A;  3ZJT A;  3Q3F A;  1S1Q B;  3L13 A;  3R7Q A;  1K53 A;  4EZL A;  5C3J B;  2KD0 A;  2L05 A;  3A4R A;  2UU7 A;  2ZVN A;  3Q8C A;  3VUY A;  2WU5 B;  2K9X A;  2RDH A;  2K6Q A;  4ARI A;  3R3M A;  3Q3O C;  1SSN A;  5BMI A;  1L2N A;  1H8C A;  1H4R A;  2KN5 A;  2XN9 C;  4ASW C;  2GB1 A;  3BVG A;  3OJ4 B;  1YX5 B;  3W1Y A;  1YQB A;  4XDD A;  2GRI A;  1ENF A;  2KKC A;  4HXD A;  3MJ5 A;  4AP4 C;  4JLC A;  3W1S A;  2K22 A;  4FA6 A;  2VH1 A;  1TS5 A;  2LXC A;  4GB9 A;  4ZRI A;  1WYG A;  2KOX A;  1SEB D;  3N20 C;  1QQR A;  4KDL B;  3H8H A;  3MTN B;  3H7P B;  1TJE A;  1NEK B;  3APF A;  4ZHP A;  4OHJ A;  1V80 A;  1ROE A;  2PEA A;  3RFZ B;  1KH0 A;  1WMH B;  2VRR B;  1L4Z B;  4GSW A;  1VZ8 A;  1WMH A;  1SE2 A;  1RFK A;  2I38 A;  1E8X A;  2KDI A;  2MSE D;  2WDR B;  2KT7 A;  5GXG B;  4TUU A;  2D2Q A;  4WH4 A;  4LTU A;  4MH0 E;  2GMI C;  3CSF A;  2KWD A;  1OFF A;  2NS5 A;  2PE6 B;  4A20 A;  3OLM D;  3ZLZ A;  2NPT B;  4IM2 A;  1Z5S B;  3M63 B;  2J42 A;  4GDK A;  3N1Z C;  3VHT C;  2BQQ A;  1N5W A;  1T5X D;  2E3T A;  3P2B A;  4A6Q A;  4BVU C;  1DGJ A;  5AUK A;  1UF0 A;  3KWV A;  1C79 A;  2L32 A;  4JL9 A;  4OVZ A;  1M94 A;  3SEB A;  1UWM A;  4DHZ E;  4GDL A;  3NVW A;  3HUI A;  1C4A A;  5FR6 A;  4EOY A;  2MBO A;  2A5U A;  1TS2 A;  2KDM A;  3IXS A;  2YVC A;  2Z0D B;  2E6X A;  3MFG A;  4TSS A;  3GOE A;  2CS4 A;  4MJS B;  3T9L A;  4ACF A;  3RNE C;  1WH3 A;  5E6J A;  4KZ0 A;  1T6B X;  2L0T A;  1WR1 A;  3L0W B;  2KC2 A;  2AYO B;  4LDT B;  4B9K A;  1V8C A;  5IA7 A;  3K9O B;  5DPR A;  2L52 A;  1WJU A;  1CK1 A;  3L10 B;  3DVG Y;  1N60 A;  1P0R A;  3GE3 C;  2GOW A;  1LFD A;  2BKR B;  3AE1 B;  2KFK A;  3DCG A;  1YN4 A;  3B2G A;  1XCT L;  2PIA A;  1R4M I;  3UF8 A;  3APC A;  4G0N B;  3PZ7 A;  2DYM A;  4DXA B;  1WY8 A;  2CHZ A;  4PYZ A;  1AN8 A;  2CU1 A;  2RSU A;  3RD2 A;  2O2V A;  2J53 A;  1E7V A;  2WX0 A;  4PT5 A;  4LJO B;  3KUD B;  4FBJ B;  2K39 A;  1Q0W B;  2C7N B;  1XLN A;  2QJL A;  2K8H A;  2PMV A;  1TY2 A;  2NCN A;  1XLP A;  2JYE A;  4GN1 A;  4W9G A;  1UGM A;  3ZTC A;  2N9X A;  2LGD A;  3AMZ A;  2K5P A;  5IKC M;  3PTF C;  4B6W A;  2L0F A;  5J17 A;  2JPH A;  4US8 A;  4XE0 A;  1WI0 A;  2BF8 B;  3RNC C;  1NDD A;  2MBH A;  2GBM A;  4HK2 A;  3U4E G;  4IW0 A;  2KQS A;  4A9A A;  2RDG A;  2V3S A;  3DBS A;  4M0W B;  4UDU C;  3Q69 A;  2MBB B;  2MP2 A;  2JSV X;  2BS4 B;  1GC6 A;  2QIL A;  2ZCC A;  5AZH A;  1WE7 A;  4MH8 A;  3ZGZ A;  3W5V B;  3TUO A;  3QC8 B;  3PLV A;  3L54 A;  4GIV A;  1PDX A;  2WU2 B;  1HE8 A;  4NZL B;  1F9J A;  3SHQ A;  3ML8 A;  4OZB A;  2IY0 B;  4H2A A;  1WXS A;  2HJ1 A;  2KX3 A;  1WGD A;  2MA9 B;  4ANV A;  2LVO A;  4TV3 A;  2JZZ A;  2W54 A;  2QIE B;  1JML A;  4DHJ B;  2LHD A;  2FCM A;  1I4R A;  2RPV A;  5E6N A;  3A1Q A;  4YXD B;  5EE3 A;  3AI5 A;  4RGT A;  2Z0E B;  1WRI A;  2WLB A;  1SE4 A;  3ZDM C;  3TJP A;  3ZDT A;  3RPF C;  1V97 A;  4NAW B;  4A8X C;  4GLS C;  1YQ4 B;  5LXH A;  2WWZ A;  4KSL C;  4MSQ B;  3AE8 B;  4HVB A;  1KRH A;  1BT0 A;  3V6C B;  4FXC A;  2FCN A;  1FPY A;  2MW5 A;  2ZNV C;  1EF1 A;  1L6V A;  1SIF A;  4RCO A;  1UGJ A;  4YL8 A;  2GBK A;  2NBW B;  3ONS A;  4DDI D;  2TSS A;  2DZI A;  5L95 C;  1I4X A;  3QQ8 B;  2ACZ B;  2GBR A;  4D2K A;  2KQ7 A;  3NZ3 A;  1E90 A;  2W3R A;  2MCN B;  1FIQ A;  2EKE C;  1XT9 B;  1V81 A;  3NRZ A;  4A90 A;  1LM8 B;  5IO9 A;  3VTV A;  2K1F A;  4W9F A;  2H88 B;  5JHB A;  1PGX A;  5TR5 A;  3WA0 A;  1ZXI A;  4HPM B;  3AEF B;  3CMM B;  3PRP B;  2WXN A;  1E8Y A;  1WGY A;  2CU3 A;  3R7R A;  3A9J B;  4LNI A;  1JAL A;  2VZK B;  2KO3 A;  2K8C A;  3PPA A;  3A9J A;  4TQ1 A;  3AV8 A;  2ZNV B;  4M02 A;  1XF5 L;  4II2 B;  1XQQ A;  5TSS A;  4WWO A;  3TEZ A;  2FNJ B;  1L6U A;  1N62 A;  4W9H A;  1K8R B;  4JIO U;  4KZC A;  4KDI C;  2RGF A;  1AWD A;  3UQB A;  3L17 A;  2N1V A;  1QOG A;  3HRD D;  3BII D;  4XWT A;  3ZQ4 A;  4DK5 A;  1IYF A;  2EMT A;  2BW2 A;  1NYR A;  4KIK A;  2JZP A;  4MGK E;  4RNA A;  4C4V B;  1MPE A;  4I6P A;  3CWI A;  1UH6 A;  3HM3 A;  2MX2 A;  4C4V A;  4C7Y A;  5AZF A;  1FCL A;  3I3T B;  3ZW3 A;  1V49 A;  3SFD B;  1ZP0 B;  4MSM B;  4NJC A;  4LK0 M;  3KWL A;  2KX0 A;  4LNN A;  2W9N A;  3T8M A;  1ZXH A;  4EUT A;  3DBL I;  1TBE A;  1GG3 A;  2IPK D;  5LNK 1;  1YMH E;  3WIM A;  1DOX A;  4HCN B;  3OWE B;  2V4L A;  3DBR I;  3MP9 A;  1VZ6 A;  1WM2 A;  2ZZP B;  4CYE A;  5IP4 D;  2QMT A;  3W9C B;  1OEY A;  3ZXV A;  2WDQ B;  1MHH E;  1GAQ B;  3VTU A;  3A4S C;  4KKI A;  1D5Z C;  4MM3 A;  4I6L B;  3P4Q B;  2YEP B;  4ANW A;  2QC8 A;  3TCA A;  1GB1 A;  2ZPY A;  3ETR A;  1VR9 A;  5C2T B;  1I42 A;  3C8Y A;  5CHV C;  2BYE A;  3AUL A;  5FR3 A;  1KLV A;  2G3Q B;  3Q8E A;  4TMA B;  4JWS C;  2KK8 A;  1WR6 E;  2M8S A;  4G11 A;  2K8B A;  3ZYY X;  2D3G A;  3HIZ A;  4EZJ A;  2KVR A;  1HA5 A;  1LGR A;  4RGM A;  4O1N A;  2O6V A;  3ZJV A;  4J3O D;  2K25 A;  3UIP B;  5DPW A;  2D11 A;  1V1O A;  1QF6 A;  3OJ3 A;  4YSX B;  5IOI A;  2RMM A;  3A33 B;  2IDY A;  3QIJ A;  2WXR A;  2L83 A;  3VFK A;  2CHX A;  4ZOH C;  3FC4 A;  2FAZ A;  5C1Z A;  2OOB B;  4K3B A;  3LYY A;  5BYS A;  3KQ4 A;  4W9E A;  1XO3 A;  2ZEQ A;  2BB5 A;  2K3U A;  2DAJ A;  3AEG B;  1D6E C;  1LXD A;  3AN1 A;  2ZVO A;  1YNT E;  2INC C;  4QAY A;  2MWS B;  2IY1 B;  4E3C A;  2JVC A;  5D3I B;  4C00 A;  4DXG A;  2OJW A;  4HKQ A;  1JWM D;  1NYQ A;  5JZE B;  1SE9 A;  3AU5 A;  4NQK E;  3RCZ A;  3UQA A;  2KTR A;  2LRW A;  2KZR A;  2XK5 B;  2CR5 A;  1YX6 B;  1WIA A;  2DLB A;  4XX5 A;  2PPH A;  1EU4 A;  4YT0 B;  2GLS A;  4IOI E;  4YSY B;  3V60 A;  2ZW0 A;  1WX9 A;  1WF9 A;  3BY4 B;  4ZYN A;  1J7C A;  2WYQ A;  2DZJ A;  2WP9 B;  1MG8 A;  4WJN A;  2IGD A;  4NY0 A;  3QWZ B;  1CQV A;  2NR2 A;  3ECI A;  2LHE A;  2KAJ A;  4AS1 A;  3EUB 2;  2IZV B;  2D3C A;  4ZRP A;  2JRI B;  2WDV B;  1FM0 D;  3QHT A;  4W9L A;  3ZRC A;  1IGD A;  4PYU A;  2EMS A;  2DYO A;  2FCS A;  2B76 B;  4RFB A;  3TL5 A;  4JE3 B;  1YJI A;  3DVN U;  2LRU A;  3PGE A;  4ZRJ A;  1T3Q A;  1WFY A;  2R61 A;  2M17 A;  4KVG B;  3WCQ A;  4OVV A;  4BKS A;  4BAX A;  4LLG M;  3VTW A;  4NPN A;  1JQ4 A;  3P4S B;  1C3T A;  2OJR A;  4C56 C;  3L4P A;  2J0K A;  2KAN A;  3U2S C;  3H7P A;  3UIN B;  3DVN V;  1I4Q A;  3NVZ A;  1MFW A;  4E74 A;  3C0R B;  5LLI A;  2KYW A; 
#chains in the Genus database with same CATH homology
 2K5P A;  2LJI A;  2WXQ A;  1IUE A;  4N58 A;  4KKJ A;  3VQI A;  1GOZ A;  4C7Z A;  4US8 A;  3BVZ A;  4XE0 A;  4WUR A;  5HHD G;  2LUM A;  3MHZ A;  3BVM A;  1N61 A;  2LGI A;  2V0G A;  1PYW D;  4YSZ B;  3U4E G;  2W82 A;  3VRA B;  2I2Y A;  2WS3 B;  2ZW1 A;  2VZK D;  1JCK B;  2MJ3 A;  2XNA C;  3P4P B;  1VDV A;  4A9A A;  3AM9 A;  1ESF A;  4KGS A;  3TEY A;  2RDG A;  1P7E A;  1RM6 C;  2LFI A;  4N6E B;  1I4G A;  3MC0 B;  2KAC A;  4UDU C;  1XCQ L;  3Q69 A;  3Q8F A;  2JSV X;  1V1P B;  1CZP A;  1IGC A;  1C78 A;  2BS4 B;  2QIL A;  4XWW A;  3ZJU A;  4MH8 A;  5D3D A;  1DOY A;  2KN4 A;  3ZGZ A;  4WQM A;  3W5V B;  3AEE B;  3TUO A;  1QOB A;  1VJK A;  3FAH A;  3VR8 B;  2WXJ A;  1BUI C;  4IDI A;  4OZA A;  3AE2 B;  4RGN A;  4REZ A;  3VRB B;  2EKI A;  1PDX A;  2WU2 B;  1YN5 A;  4NZL B;  3AE3 B;  5FKA C;  1J7B A;  1I7H A;  1FXI A;  4P16 A;  4OZB A;  2MJD A;  4H2A A;  1OQR A;  1DOI A;  1RWS A;  1XLO A;  1JWS D;  2OHF A;  3BWU D;  4HRO A;  1RYJ A;  5EE1 A;  1TKG A;  1PGB A;  4WIP A;  2NTS A;  3ABV B;  3URY A;  3HVZ A;  3EA6 A;  2IGH A;  2Y3A A;  1N63 A;  2JWU A;  2W54 A;  2QIE B;  1IBX B;  1JML A;  2LHD A;  1FXA A;  4R3D A;  5AUI A;  3E56 A;  1I4R A;  1ET6 A;  2RPV A;  1QT9 A;  4YXD B;  2BYT A;  1TS3 A;  1R7S A;  5EE3 A;  1D5M C;  4ITK A;  2AQ3 B;  3NS1 A;  4RGT A;  3AEA B;  1WRI A;  2PKO A;  2WLB A;  2V3N A;  1KF6 B;  1SE4 A;  4NAM A;  1KLU D;  1L0V B;  2AQ1 B;  3RPF C;  1V97 A;  4NAW B;  4MM3 B;  2X38 A;  4A8X C;  3P42 A;  4GLS C;  1YQ4 B;  3P4R B;  3I57 A;  2JX5 A;  4YTP B;  2JQR B;  1FEH A;  1I4H A;  3AE8 B;  3Q8B A;  1E0Z A;  3TSS A;  1KRH A;  1SIJ A;  3O13 A;  4FXC A;  3SR6 A;  1VRA B;  3NUH B;  1VZ7 A;  4KGT A;  1L6V A;  4RCO A;  1UGJ A;  1FMA D;  2G1E A;  1B9R A;  2WQY B;  2TSS A;  2NMQ A;  3AH7 A;  2Z8L A;  2CJN A;  5EE9 A;  2G9H D;  1I4X A;  2ACZ B;  2EEL A;  1Y56 A;  4D2K A;  1ZUD 2;  5HFY A;  3NZ3 A;  1ZDV A;  1STE A;  2W3R A;  5BYQ A;  1PFD A;  1FIQ A;  2BBC A;  3NRZ A;  1E9M A;  5MPO A;  4A90 A;  1TS4 A;  1KTK A;  1ZDX A;  1JWB D;  2H88 B;  1HZ5 A;  4CQN A;  1PGX A;  1C4C A;  3E9S A;  1XXG A;  1VLB A;  1ZXI A;  2JU6 X;  3AEF B;  2WXN A;  4JX1 C;  1C76 A;  2CU3 A;  4WWM A;  2FBW B;  2LEK A;  1WSP A;  4Q2J A;  3KLS X;  1M4V A;  1JAL A;  4TQ0 A;  1I4P A;  2VZK B;  4N59 A;  4ZYS A;  1K51 A;  4TQ1 A;  1TKE A;  1AW7 A;  3AV8 A;  2INN E;  3GP7 A;  1XF5 L;  5JXV A;  2BTE A;  3AE5 B;  2WXL A;  1TKY A;  4OW0 A;  4MT5 A;  3BK2 A;  2NTT A;  2QEJ C;  5TSS A;  2J52 A;  1QLB B;  3J9C A;  3TEZ A;  3TEW A;  1YJJ A;  3N9Y C;  1L6U A;  1ZPS A;  4HKZ E;  4M0W A;  4KX6 B;  2KQ4 X;  1DYQ A;  1N62 A;  2M0A A;  1A70 A;  5I4D A;  3I9V 1;  4GDK B;  1V1P A;  4YTM B;  4B0M A;  1FFV A;  5D7G A;  3UI3 A;  1AWD A;  2D5G A;  3W5U B;  1ET9 A;  4JPS A;  1Q10 A;  2V3P A;  1QOG A;  3HRD D;  3BII D;  4XWT A;  3ZQ4 A;  1J7A A;  2FE8 A;  1SJH D;  2OED A;  4RGO S;  1FNW A;  1EU3 A;  2BW2 A;  5BMH A;  1NYR A;  1L4D B;  2HTM E;  2JZP A;  4WAF A;  4RNA A;  1EM7 A;  1MPE A;  2HDE A;  1TZO A;  2M19 A;  4GDL B;  1XEE A;  4USA A;  5H8Y E;  3V05 A;  3CWI A;  4OZC A;  3NVY A;  3IAS 1;  4C7Y A;  3BK1 A;  1FCL A;  1YN3 A;  4HRS A;  2W55 A;  4YWG G;  1SE3 A;  1F77 A;  2BT6 A;  3SFD B;  1ZP0 B;  4NJC A;  4LK0 M;  3AB5 A;  3KWL A;  2JYT A;  1K50 A;  2ON8 A;  3FIL B;  1ZXH A;  2WXK A;  1ACC A;  1OQQ A;  2V4I B;  1SBB B;  2WXF A;  3U52 E;  3VR9 B;  2IPK D;  5LNK 1;  5BYR A;  1IBX A;  4RH6 A;  1UUP A;  1YMH E;  2H89 B;  4RF0 A;  1JRP A;  3EGR A;  2WXH A;  1DOX A;  2BS2 B;  3OWE B;  3MP9 A;  3ZJT A;  3T3N A;  1FCC C;  3AED B;  1VZ6 A;  1K53 A;  2K0P A;  3LB8 C;  5C3J B;  1SJE D;  2QMT A;  3AE9 B;  3W9C B;  5FK9 C;  1GPX A;  1FRR A;  1MHH E;  2WDQ B;  1C77 A;  1GAQ B;  2WU5 B;  3BYY B;  2K9X A;  2RDH A;  3Q8C A;  4KKI A;  5G5G A;  2PTL A;  1QOF A;  1D5Z C;  2N9K A;  3AE4 B;  4HJG E;  4ARI A;  1SSN A;  3P4Q B;  2YEP B;  5BMI A;  1MI0 A;  2XN9 C;  5HI1 A;  4US9 A;  1GB1 A;  3T3O A;  3ETR A;  2GB1 A;  3GB1 A;  1VR9 A;  1FRD A;  3BVG A;  5C2T B;  4XDD A;  2N9L A;  2CJO A;  2GRI A;  1B1Z A;  3C8Y A;  1ENF A;  3W2D A;  1FO4 A;  4YTN B;  3CIR B;  3MJ5 A;  1YQ3 B;  5FR3 A;  3Q8E A;  3W1S A;  1F2R I;  2K22 A;  2INP E;  2PVO D;  4TMA B;  1JW9 D;  2WXM A;  4JWS C;  1TS5 A;  2YEP F;  2WNM A;  3AEC B;  1UWX A;  3V3X A;  1WYG A;  1SEB D;  3ZYY X;  3U7Z A;  1QQR A;  1AYF A;  1HA5 A;  2MEK A;  3H8H A;  4P6V F;  4RGM A;  1E7P B;  2ONQ A;  4O1N A;  4DXF A;  1TJE A;  1NEK B;  4ZRQ A;  4ZHP A;  3R2T A;  4OHJ A;  1ROE A;  3ZJV A;  4J3O D;  3RFZ B;  1KH0 A;  4B0E A;  2JXT A;  2BS3 B;  1QF6 A;  1V1O A;  1L0X B;  1L4Z B;  4YSX B;  1VZ8 A;  1SE2 A;  2RMM A;  1RFK A;  1L0Y B;  1NVI D;  2MJE A;  2I38 A;  2Y5P A;  2IDY A;  1FD6 A;  4HEA 1;  4EE2 A;  2WXR A;  2L83 A;  2IJ0 A;  2WDR B;  5GXG B;  2DBY A;  4ZOH C;  3FC4 A;  1D4B A;  2L1A A;  4WH4 A;  5HG2 A;  3LYY A;  4LTU A;  5BYS A;  3AMZ A;  3KQ4 A;  4AQ7 A;  1XO3 A;  1KFY B;  1L5P A;  2BB5 A;  2K3U A;  3AEG B;  4A55 A;  1D6E C;  2WXO A;  2KWD A;  3AN1 A;  3HVD A;  1YNT E;  1OFF A;  2ICI A;  1SF0 A;  1XLQ A;  2KMM A;  1WWT A;  3DWG C;  4RF1 A;  2J42 A;  1MHX A;  1F0Z A;  5D3I B;  1N5W A;  4DXG A;  4HKQ A;  1T5X D;  3PZ8 A;  2E3T A;  1N5X A;  4A6Q A;  1DGJ A;  1JWM D;  5AUK A;  3KWV A;  1C79 A;  2L32 A;  3DWM A;  4OVZ A;  2AX5 A;  2DWQ A;  2FUG 1;  1C9F A;  4L2Y A;  1E6E B;  1NYQ A;  3SEB A;  1UWM A;  3LXF A;  1FNV A;  2N0S B;  4KGR A;  1HZ6 A;  4MAC A;  1EWC A;  4C80 A;  1HEZ E;  1UNS A;  1K52 A;  3HUI A;  1C4A A;  3NVW A;  2Y5C A;  5EE0 A;  2PW9 A;  3B9J A;  1TS2 A;  2KDM A;  3IXS A;  2PVG C;  3P1M A;  2Q5W D;  4ARC A;  1CJE A;  2E6X A;  2J4X A;  3MFG A;  4TSS A;  2DLB A;  3FIL A;  3Q8A A;  5E6J A;  1EU4 A;  4ZHO A;  4YT0 B;  1T6B X;  4IOI E;  4YSY B;  1FFU A;  1P7F A;  2ZW0 A;  3SFE B;  5BMG A;  1V8C A;  3BYT B;  1C4P A;  3GS2 A;  1J7C A;  1JWA D;  2MH7 A;  2L52 A;  1QKZ A;  1CK1 A;  1TY0 A;  2SAK A;  5T8I A;  1BXT A;  1N60 A;  3AE6 B;  2WP9 B;  1HQR D;  2WXG A;  1BML C;  2IGD A;  5H92 C;  2BB6 A;  1CQV A;  1LO5 D;  1E10 A;  4L1B A;  4XDC A;  3AE1 B;  2LHE A;  1FNU A;  1HXY D;  2KAJ A;  1D5X C;  4AS1 A;  3EUB 2;  1YN4 A;  3IT6 B;  3B2G A;  4ZRP A;  1XCT L;  4DQO C;  2WDV B;  2LMC A;  1FM0 D;  2PIA A;  2WXP A;  1PUT A;  3PZ7 A;  1QIL A;  1IGD A;  2DYM A;  4L23 A;  1WXQ A;  2DYO A;  2B76 B;  4RFB A;  1AN8 A;  4JE3 B;  1MVK A;  1YJI A;  1JWU D;  1QOA A;  2GI9 A;  3PO0 A;  2W3S A;  4JWU C;  1T3Q A;  2J53 A;  1KLG D;  2R61 A;  3AEB B;  2M56 B;  3WCQ A;  1WGK A;  4PT5 A;  2AQ2 B;  1ZOY B;  2PLP A;  3R2I A;  5G5H A;  3TEX A;  1EWY C;  4LLG M;  1JQ4 A;  3P4S B;  3R8B A;  1TYG B;  3B2F A;  1ZE3 D;  1SXT A;  4C56 C;  3AE7 B;  1XLN A;  3L4P A;  2QJL A;  3BZD B;  1NI3 A;  2PMV A;  1GB4 A;  1PGA A;  1TY2 A;  2WXI A;  3IAM 1;  3NVV A;  3U2S C;  1XLP A;  2SEB D;  3P63 A;  2JYE A;  1I4Q A;  3NVZ A;  1F2R C;  1SB3 C;  1JRO A;  2QSD A;  1NEN B;  2IGG A;  3IT4 B;  4IKG A;  2N7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...