1OQQA

Crystal structure of c73s/c85s mutant of putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida, at 1.47a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putidaredoxin, the [2Fe-2S] component of the P450cam monooxygenase system from Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
molecule keywords Putidaredoxin
total genus 23
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1oqqA00
1PDXA 4WWMA 1KFYB 2H88B 1WXQA 2JX5A 4ZHPA 1QF6A 1QLBB 1NVID 1XLOA 3AH7A 1NYRA 3NVYA 3P1MA 2MH7A 2HTME 4N6EB 1YQ4B 1NI3A 1XLQA 5G5GA 3WCQA 3ETRA 1TKEA 1FXAA 1OQQA 2L83A 1TJEA 2Y5CA 5G5HA 2FBWB 4JWSC 1NYQA 1V8CA 1I7HA 2DWQA 1QOGA 3NVZA 3DWMA 3NRZA 2W55A 1RFKA 1JALA 5AUKA 3ZYYX 4HRSA 4ZHOA 1ZXIA 1QOAA 1CZPA 3W5VB 1AYFA 4A9AA 1N61A 2BS3B 1J7AA 4YSYB 1QT9A 1V97A 1XO3A 1YQ3B 2CJOA 2WS3B 2MJDA 1E9MA 2QJLA 3B9JA 4C7ZA 3KWLA 3L4PA 1T3QA 3CIRB 3AEDB 2CJNA 3HUIA 3P4RB 3PO0A 1DOXA 4YTPB 2PVOD 3NVWA 1WGKA 3SFDB 2W3RA 3P63A 1N5XA 2B76B 4N58A 2AX5A 1WRIA 4N59A 2WDQB 1PFDA 1VJKA 3NVVA 3AB5A 5GXGB 4USAA 1ZP0B 1FMAD 3SR6A 3VR9B 3B2FA 1E0ZA 2H89B 2W54A 3LB8C 1RM6C 1FFVA 2ACZB 2WU2B 4US9A 3LXFA 1KRHA 3AECB 3BIID 1TKYA 3P4PB 1FIQA 3AV8A 3AE1B 1N60A 3AEFB 3AM9A 4HROA 5C2TB 3VRAB 1DOYA 1ZOYB 1WYGA 2W3SA 5EE9A 5EE0A 2DBYA 2Q5WD 1JWBD 1JWAD 4YT0B 3AE4B 1AWDA 1SB3C 2KAJA 2WP9B 1NENB 1R7SA 3HRDD 3AE5B 1YJJA 2N0SB 1RWSA 2L52A 1E7PB 2WQYB 1XLNA 3W9CB 1B9RA 1ZUD2 1ROEA 2K9XA 1DGJA 1TYGB 2EKIA 1N63A 3VRBB 1VLBA 2BS2B 4WQMA 1N5WA 5AUIA 4P6VF 1JRPA 1TKGA 4KX6B 1A70A 4US8A 4ZOHC 1JQ4A 3EUB2 1CJEA 5EE3A 1EWYC 1QOFA 2WDRB 1YJIA 4ITKA 2CU3A 3SFEB 1OFFA 3W5UB 1N62A 3RPFC 1KF6B 1SIJA 5C3JB 4FXCA 3AE9B 1L6UA 3HVZA 1VDVA 2OHFA 1GAQB 3ABVB 3FAHA 5H8YE 2BT6A 3B2GA 3NS1A 2M56B 3VR8B 2MJEA 2KMMA 1JROA 2WLBA 5EE1A 1FRRA 1FRDA 1E10A 2G1EA 1PUTA 2PIAA 3AE6B 1QOBA 3AE7B 2WDVB 4YTNB 1E6EB 4LTUA 1RYJA 1J7CA 2BS4B 2LEKA 2E3TA 1NEKB 2MJ3A 1GPXA 3DWGC 5H92C 2K22A 3AE3B 1WWTA 3AEEB 1JW9D 2PKOA 3AE2B 3P4QB 4IDIA 2M19A 4YSXB 1FM0D 1OQRA 1F0ZA 3CWIA 1FXIA 2K5PA 4C80A 1FFUA 1L6VA 4C7YA 3AN1A 1IUEA 1L0VB 3AEGB 4YSZB 4JX1C 3P4SB 3AEBB 2WU5B 1FO4A 1J7BA 2JQRB 4YTMB 4JWUC 3FC4A 4YXDB 1XLPA 1L5PA 3AEAB 2PVGC 3AMZA 5MPOA 2QIEB 1UWMA 1SF0A 3AE8B 1DOIA
chains in the Genus database with same CATH superfamily
3RN9C 4I6PA 3VUYA 1SEBD 5FKAC 3WANA 5JH5C 1ZKHA 3O65B 1V9JA 1OQQA 5D7GA 1TS4A 2BQQA 2KVZA 3NVZA 4RH6A 4XZ4A 1JCKB 2IO1B 2W55A 1RFKA 2DLBA 2DYMA 2FIDA 1TBEA 1SE4A 4AS1A 4YSYB 2MBOA 1YN4A 3A9KA 2PEAA 1HEZE 4N9F4 2W3RA 4NJ7A 2NTTA 4FJYA 2WXQA 4WJQA 2A4ZA 1LO5D 4GXBA 2XEWA 1MG8A 5FR6A 3MP9A 2FCMA 2ON8A 1WYGA 1V5OA 3JSVA 1AWDA 3A9JA 2ZW0A 1XLNA 1IYFA 3VRBB 2BS2B 2INPE 4ITKA 2WXKA 1N62A 2D3CA 2K25A 3VXWA 4ZRQA 4BKSA 1UNSA 1FRDA 3ENEA 1RYJA 4PS3A 4DWFA 2EMTA 3NS8A 2J0MA 3AEEB 1QKZA 4BOZB 3OAWA 4WJNA 1L0YB 4M8MA 2QSDA 4R3DA 1WX9A 1P0RA 2WDTB 2WXPA 4MJSB 2JY6A 5E6NA 1FFUA 4BKGA 5HG2A 2M0XA 1R4MB 3SU8X 1XCTL 2QIEB 2INDC 4E3CA 1QF6A 4CO7A 2V1YA 2J0JA 2DX5B 2EELA 3DBSA 4W9GA 1CQVA 1ET9A 1C3TA 1VZ6A 3ZVVA 2MW5A 4MH8A 2ZVOA 1P7EA 2L1AA 1GC6A 4JLCA 1YQ3B 2KVRA 3I63C 1YOVB 3P4RB 2WXLA 1GC7A 3KWVA 1H8CA 2IYDB 1VRAB 4XGAB 2JF5A 1RM6C 3ZKJC 1GB4A 4TSSA 2R2OA 2ZVNA 3AE1B 3X0WA 1DOYA 2V4IB 4O1NA 4ZDVA 3DBRI 1PGXA 1L2NA 3U7ZA 3PT2B 2FAZA 2KMAA 4DDGD 3AE5B 3R8BA 2KDIA 2WGSA 4WJOA 2INCC 3GP7A 4RNAA 1NDDA 2RGFA 3EA6A 1WXSA 3LDZE 4IKGA 4IW0A 1UGJA 1SJHD 2MBQA 4S17A 2PE9A 3JSVB 3KUZA 2BT6A 2MJEA 2KMMA 3MHSD 3N9YC 2IY0B 1FNVA 2G1EA 1C4CA 4IWPA 1ISNA 2NPTA 4KSKC 5JHBA 4TV3A 4K7WA 2L3ZA 4XYCA 3K9OB 1FM0D 1WGYA 1BXTA 3AN1A 2L0TA 5AEKB 2FCSA 2JZZA 2KWVB 1TGZB 2VH1A 3MFGA 3EC8A 2E6XA 1WJ4A 4B95A 1FXAA 4M01A 3A1QA 4REZA 3M62B 3ZYYX 5KHOA 5AZGA 4PS8A 2JRHA 1J7AA 3OG5A 1SBBB 3RZFA 3AU5A 2MX2A 1DOXA 3JW0X 4KIKB 1VJKA 3RD2A 2AQ3B 5GXGB 1ZP0B 2KXJA 1P9DU 2Z59B 1L4ZB 1OQYA 3QARA 3AM9A 5BYRA 1WJ6A 2FIFA 2XN9C 4EKUA 2N9PC 2QC8A 1C4PA 1BT0A 4AP4C 3QK0A 4P16A 4FJZA 2LGIA 1HTOA 2N1VA 2JYTA 4ACFA 3BYTB 4RGTA 4IG7B 3R2IA 2CS4A 1CJEA 1C4AA 1JMLA 2KX0A 3R2TA 2GBNA 4TQ0A 3QX1A 3W1SC 4OZBA 3B0AA 4FLHA 1E8WA 3T9LA 3T3NA 3QCAA 1BUIC 1TT5B 4LNFA 1GPXA 4OHJA 2ZNVC 4W9KA 4C4VB 5CX3A 2MCNB 4DHJB 2N9LA 2Z0EB 4FHKA 3R7QA 4JX1C 3P4SB 1FO4A 2J4XA 2TSSA 5BYSA 2G3QB 5DPWA 1C1YB 3AMZA 3NZSA 4HPPA 1F77A 1WXQA 1Y8RC 1XLOA 1YQBA 3ETRA 2L83A 3KYDD 3N20C 5JZEB 2NMQA 3NRZA 1C76A 3CSFA 3ZTCA 1V81A 2HJ1A 4XE0A 5AUKA 1E8ZA 3NOBA 1UF0A 4ICVA 3R7RA 4GB9A 4EZLA 2WS3B 2N7JA 2IGDA 4PYUA 5D3IB 2KDBA 2K8BA 2DAJA 2WDQB 2LXCA 2BYEA 2ACZB 1F2RI 1PGAA 3VRAB 3N32A 3DBHB 5L95C 1WR6E 1F9JA 1MHXA 3TL5A 2R2QA 2MHJA 4L2YA 3WALA 1XD3B 4LK0M 2FNJB 4G50A 4F8CB 4AWJA 4A3OA 4HCNB 1MFWA 2HD5B 4ASWC 3AXCA 2CU3A 4HDOA 5I4DA 1LM8B 1RAXA 3WAOA 3Q3OC 2WXHA 5E6OA 3VVWB 4C56C 3RCZA 3A33B 1D6EC 3U4EG 4NAWA 3DVGY 5CHWA 3IVFA 5H92C 1F2RC 1TS2A 2V3SA 3SD5A 2NS5A 4YSXB 4HVBA 3GS2A 3J9CA 1TS3A 1FXIA 3N1ZC 3ML8A 3BINA 1QILA 4E74A 2KC2A 4JWUC 3IBEA 5G55A 3ZNZB 2GBJA 3QQ8B 2MEKA 1VZ8A 1SE2A 5DCNA 4B0MA 3Q8FA 1BMLC 4KKJA 2KNBA 1NYRA 3P1MA 1PYWD 1YQ4B 4KGRA 3UI3A 5G5GA 5G5HA 3UQBA 5G2NA 1STEA 3WAPA 2MRPA 2JRIB 1UD7A 2ASQA 1FNUA 1GB1A 2IDYA 1WGDA 1RRBA 5T8IA 5JHAA 2NTSA 4EE2A 4PYZA 3IAS1 2LGSA 1E0ZA 3L0WB 1EF1A 3LXFA 2N9XA 3JVZX 3VTVA 1SSNA 3CSTA 4HDQA 3NZ3A 4MACA 1R7SA 3HRDD 2LUMA 4MELA 2IBIB 3L16A 1WF9A 2WYQA 2D10A 4MDKE 4G3XB 3WAMA 4ZOHC 2CHXA 3SFEB 2MBBB 1KF6B 2X38A 2K1FA 4W9LA 3ML9A 4P7IA 1PGBA 3B2GA 3ZQ4A 4ZRIA 3HM6X 3GE8C 2V0GA 3QWZB 2L0FA 3Q3JA 1J7CA 4JQWC 3ZUNA 3TEZA 5AZHA 4DXGA 3T8MA 1UGMA 3T3OA 2WNMA 4RFBA 3CWIA 4JGHB 4A8XC 1AARA 1IGDA 4DQOC 1MJDA 2NBVB 3E9SA 3GE3C 1WR1A 3X23A 4WWMA 3L13A 4KIKA 2XNAC 3UIOB 3DBLI 2MH7A 1K51A 1QZEA 2L05A 3URYA 1V8CA 1D3ZA 2Y5BB 3DWMA 2KQSA 1YX5B 4TQ1A 3PV1A 4NQKE 3B9JA 1CMXB 2LWPA 1XXGA 2BYTA 4IC7B 2AX5A 4RCOA 3VR9B 2IPKD 2LGXA 1G6JA 2H89B 4M0WA 3Q8EA 3MC0B 2DZKA 1FIQA 1E7UA 3AEFB 3N1YC 4KDIC 4B9KA 4WWOA 5KHQA 2GOWA 1MPEA 2JXTA 4PK1A 1YJJA 3RNAC 1B9RA 2ZPYA 4DXFA 1Q10A 3ZRCA 4US8A 5BMGA 2UYZB 4DHZE 2ZNVB 4FXCA 3RULA 1FXTB 2RDHA 2X8XX 3U30A 1T6BX 3PHWB 1R4MI 2R61A 4XWTA 2LMCA 4FADA 1IBXB 2PIAA 3AE7B 4OVUA 1E6EB 4RGOS 1F1HA 1NEKB 2PTLA 4IDIA 3L10B 4CYEA 2AL3A 3IFWB 2CHZA 3OLMD 3A4SC 2AQ1B 2DZJA 3PRZA 2KMCA 4C80A 3HIZA 3RT3B 4M00A 1EU3A 2K8HA 4K1RB 2WU5B 3U7DA 1KLUD 3UGBB 4I6LB 3AEAB 2QILA 4RM8A 5BMHA 2JWZA 3AH7A 3NVYA 3BZDB 2RSUA 2JUOA 1I7HA 2N4FA 2KKCA 2PLPA 2BBCA 3ZJUA 4NNJB 2D11A 3N1XC 2D3BA 2JT4B 3SEBA 2JZ3B 2J53A 3PREA 4M0WB 2SAKA 2N1WA 5FK9C 4EZKA 3AB5A 1TZ1A 2LXAA 4MSMB 2KJRA 5DPTA 2QHOA 4BOSC 4HPLB 2KANA 1WX7A 4JE3B 4GN1A 4BVUC 3VQIA 4ANXA 2WP9B 1C78A 1KLGD 3H1UA 4NQLB 4ZRKA 2YEPB 2K9XA 3UIPB 3ZXVA 1N5WA 2M4NA 2D2QA 5IN7A 3EUB2 1QOFA 1FEHA 1YJIA 2WDRB 3I3TB 1XCQL 4DBGA 1VDVA 3L17A 1D4BA 3VR8B 5EE1A 2LHDA 1JWUD 1NI2A 3AE6B 1ZE3D 2WDVB 3H7PA 1ZDVA 3VH4B 1OEYA 3DWGC 3MJ5A 2DENB 1LGRA 4LCDE 1KOTA 1I42A 2LASA 2KTFA 4LJOB 1H4RA 2PW9A 4BZAA 1L6VA 4C7YA 1K53A 1HZ6A 1UBQA 1UZXB 2VH2A 2G9HD 1K50A 1YMHE 3V6CB 2XK5A 4P1BC 3TCAA 2GBMA 2WXGA 3U52E 3LJ3A 1NI3A 4GDKB 4AQ7A 5LLIA 2FBWB 4OZAA 3N3KB 3ZIMA 4NJCA 4W9JA 3TMPB 2K6DB 1EUVB 3AU4A 3OJ3A 1UUPA 1MVKA 1FCCC 2MP2A 3ZJVA 4S0RA 2GB1A 2Z0DB 3ZNID 3APCA 4HKZE 2QJLA 2RPQA 5BYQA 4ZYNA 3H9DA 2L7RA 1L7YA 2PVOD 1N5XA 2OJWA 3W2DA 2ONQA 2FE8A 2WX1A 2IGGA 1IGCA 2OEDA 3NHEB 1C9FA 1EWCA 2K8CA 3VDZA 3ZNHB 3BK2A 1V86A 1YN3A 5E6PA 4AJWA 2HE7A 2DBYA 1JWBD 3ZGZA 1MI0A 4NY0A 2AYOB 2LVPA 4LNOA 4KSLC 3V05A 5LXHA 2DZIA 5D2MB 1WY8A 1E8YA 4P6VF 3ALBA 2NPTB 3P42A 2C7HA 3SDLC 3RNCC 1Q5WB 2REXA 4RF0A 1TY2A 1L6UA 2KTRB 4HJKA 2GI9A 5J17A 4B0EA 2IJ0A 3RMKC 1WE7A 1ACCA 2O2VB 4RGNA 3KQ4A 3Q2AC 2D5GA 2I38A 2M0AA 1YD8U 3EECA 3P4QB 4DXAB 1EF5A 3A9JB 4PT5A 3MTNB 4C00A 2GBRA 2K5PA 2BWFA 2WXMA 1IUEA 4LLGM 3BWUD 4A90A 5IOIA 4EZJA 2CKHB 3QAQA 5IO9A 2V4LA 4ZHPA 1I4XA 1I4PA 2Y5CA 4PS7A 2ZEQA 1TZOA 4MGYE 4DHZB 1IBXA 2GBKA 1WX8A 2YVCA 4ZYSA 2WX0A 4NZLB 3W5VB 4A9AA 2I1JA 3S2AA 3CIRB 3MHZA 4GDKA 2MSED 3H7SA 1I4HA 4OVVA 2ZJDA 1WRIA 2DYOA 1PFDA 3NVVA 2KACA 4USAA 3U2SC 1KJTA 2V3NA 2MP2B 4IUMB 1K8RB 3QC8B 2JYEA 1TS5A 5GMVA 3B08A 3EFCA 3ECIA 4P1CC 1NENB 2BKFA 4G11A 1ZUD2 1EM7A 3M63B 3MC8A 4FA6A 3ZTDA 5CHVC 2K39A 5EE3A 1OFFA 3ZDTA 3AE9B 1L4DB 3RZWC 1YX6B 5BO4B 4KGSA 2BYVE 2JWUA 4XWWA 3NS1A 1D5MC 1A5RA 1WFYA 1YNTE 3ZLZA 2LJIA 1E8XA 1T0QC 3RUIB 4TMAB 2PKOA 1AN8A 1WGRA 1P1AA 3TUOA 2IZVB 3L54A 2RDGA 1ET6A 1UBIA 1ESFA 2MQJA 2JZPA 1WJNA 4K7UA 2LRWA 3FC4A 1GG3A 3PSEB 2Y5PA 4LJPB 4KZCA 3VH3B 1RFAA 4NJ6A 1HQRD 2QMTA 4N6EB 2LZ6A 2ZZPB 1JWSD 3Q69A 3PZDA 1NYQA 3PZ8A 4L23A 1LQBA 2KC1A 1X1MA 4ARIA 4YWGG 4BKTA 2KFJA 2ZW1A 5LXIB 1ZGUB 2BVCA 1V80A 2Z8LA 2C60A 4OZCA 3VUWA 2I2YA 3DBLB 1WM3A 1MG4A 1XO3A 3SHQA 1E7VA 1HXYD 3HUIA 3VFKA 1LXDA 1V49A 1WGKA 1I4QA 4DHJD 2KQ4X 2GLSA 1R4NB 4HLEA 1U4AA 3PS6A 3R3MA 5D3DA 4LDTD 3WA0A 3AECB 4H2AA 3OJ4B 5C2TB 2KFKB 4HROA 4W9DA 4BFRA 1HE8A 2Q5WD 4YT0B 1JWAD 1WGHA 2N0SB 4K81A 4OW0A 3TEYA 2LHEA 1ROEA 5AUIA 4WH4A 4II2B 4XDDA 1EWYC 3BVMA 2PPHA 2RPVA 1SIFA 2OHFA 3RNBC 4URKA 1WGGA 3C19A 4X57B 1JROA 4ANWA 2RMMA 5J2RA 1S3SG 1ZW7A 4KKIA 3ZW3A 1JW9D 2MBHA 3Q8BA 2M19A 2D07B 3KUDB 1WXMA 1SXTA 1DYQA 2Y3AA 4GOCA 3DDCB 4XDCA 3EGRA 4IWOA 1VR9A 4MT5A 1FD6A 4A6QA 4W9FA 2PVGC 3M95A 3IAM1 1DOIA 1PDXA 3UQAA 2H88B 1QLBB 4MEMA 3GB1A 4GGQA 3DHIC 1TKEA 3V3XA 2KTRA 1QOGA 2W82A 2O2VA 1C77A 2CHWA 1Q1OA 3FILB 3PVLA 2CJOA 2N7EA 3PO0A 4LNKA 1VD2A 4MM3B 1WMHA 4B6WA 2LD9A 3B2FA 4US9A 3EHVA 2AL6A 2WXRA 1IPGA 4GIVA 3HHMA 1XEEA 2WXFA 4W9EA 4HJGE 1E7PB 1HTQA 4AOFA 1N63A 2L8JA 4LNIA 4G0NB 2KJHB 2DZMA 1WH3A 2LJ5A 4IOIE 1SE3A 2N9KA 1KM7A 2WLBA 2MWSB 4GMVA 4EOYA 4MSQB 1WXVA 2M8SA 2C9WB 4LTUA 3VAWA 2BPSA 1WWTA 4ICUA 1EO6A 1P3QU 1KLVA 3IT4B 2EKEC 1J19A 4XC2A 3RI7C 4HWIB 2KJ6A 4GDLB 2AWTA 4DK5A 4AJYB 1KTKA 1C79A 3I57A 1IP9A 3A4RA 5TR5A 2J42A 1SE9A 1XLQA 5HHDG 4NAWB 4JWSC 3MJWA 3PZ7A 4HKQA 3PGEA 2JU6X 4Q2JA 3K9PB 1TY0A 2C7MB 2IY1B 4HRSA 3NZUA 4KVGB 3ZDMC 1T0SC 2KDFB 4BKSD 5FR3A 4YSZB 3QJZA 4WAAA 2MJDA 1E9MA 2C7NB 3VTUA 3QA8A 3V6EB 2UU7A 4FBJB 1S1QB 2C5LC 3KYCD 4N59A 5DPRA 2NCNA 4KV2A 1OGWA 1N60A 4HK2A 4A55A 1ZOYB 3N30A 4LDTB 5EE9A 2PMVA 4EFOA 3BK1A 3DHHC 4RM9A 4C4VA 3OWEB 2KOXA 3W9CB 1YIWA 3RFZB 1MHHE 4KX6B 1JRPA 1A70A 1M94A 2V3PA 3B1LX 2D3AA 3HVDA 4TKNA 2J52A 2MLBA 3NJTA 3W5UB 3ZO5B 2KDEB 5C23A 1TIFA 2KX3A 3RNEC 2WXIA 3ONSA 1B1ZA 3Q3NC 2L00B 2LGDA 4OVZA 1VZ7A 4HXDA 2BW2A 2WXOA 1N6ZA 2DYBA 3TSSA 1F0ZA 2L32A 4GDLA 1E90A 4M02A 5IKCM 3AEBB 4EEWA 1J7BA 2LVQA 1R4NI 5DPSA 4YTMB 4IM3A 5CTRC 1L5PA 3IG3A 1WE6A 2LGYA 2JX5A 1NVID 1I35A 2HTME 2IO3B 2KD0A 1P7FA 2DWQA 2SEBD 4UDUC 2KFKA 4MGZE 1GUAB 1CK1A 3TBLD 2LI5A 2HTHA 1ZXIA 2KWUB 1AYFA 1D5XC 2AQ2B 4NPNA 3R66C 1V97A 1V1OA 2LFIA 3Q8AA 3DOWA 3KWLA 3ZXRA 3NG0A 3AEDB 3A1QB 3W1SA 2GMIC 4IM0A 2L76A 1FCLA 2JXXA 2NBUA 4ANUA 2A5UA 2O6VD 1YN5A 5IP4D 2UWQA 2W54A 3LB8C 5E6JA 2FCNA 1KRHA 1TKYA 3AV8A 3PLVA 4MGKE 3ZRFA 1KH0A 1HZ5A 2W3SA 2IGHA 4JL9A 1VCBA 3AE4B 3UINB 1QQRA 2QDFA 4FHJA 2G4SA 5HFYA 1RWSA 1Q0WB 1UWXA 2WQYB 3RYTA 1OEYJ 1WMHB 1GJZA 2D3GA 4RMAA 1WI0A 1TKGA 3H7PB 3W1YA 4K3BA 1JQ4A 2NR2A 1JWMD 3KLSX 1F52A 2KZRA 3P2BA 3DCGA 1V6EA 2OOBB 3VTWA 3WIMA 4BBNF 4F7ZA 4FULA 3FAHA 3NUHB 2MA9B 4II3B 1E10A 1PUTA 2CU1A 3TIXA 4YTNB 1WM2A 2INNE 2LEKA 2XK5B 2MJ3A 1SJED 2K22A 3AE3B 2JSVX 3AE2B 2CR5A 2KWDA 2ZCBA 2QEJC 3PHXB 3Q3FA 2BB6A 1L0VB 3AEGB 4FN2A 1WZ3A 3U8ZA 1V1PA 2K6QA 1SF0A 4MM3A 2LVOA 3V60A 1WYWB 5HI1A 3DBHI 3BY4B 1J0GA 2M1MA 4YL8A 1UELA 3BYYB 1D5ZC 3C0RB 4HPMB 1JALA 4WJPA 3JYUA 3V61A 4A20A 2VRRB 3DHGC 2O6VA 1N61A 2BS3B 5IAAC 1M4VA 1QT9A 3KVFB 1Y56A 4C7ZA 1T3QA 5CHFA 1RLFA 4YTPB 1XT9B 3SFDB 3P63A 4WIPA 2YLMA 2LUEA 2KLGA 3LYYA 4J6IA 2BYFA 3I5JC 3BIID 3PRPB 1L0XB 2WXJA 2FUHB 2RR9A 3RNFC 5EE0A 1XQQA 3GZNB 4F1SA 3Q3MC 3Q8CA 4M8NA 4BAXA 2KT7A 1OTRB 2LRUA 3D32A 1TYGB 4WQMA 1AW7A 1WXAA 2ZPNA 4AUQC 2BWES 2KLCA 3RPFC 1SIJA 5C3JB 3PTFC 5D6JB 3DPDA 3IHPC 1T0RC 3L08A 3ABVB 1GAQB 4GLSC 1FPYA 2W9NA 2KWCA 4ZRPA 4WWPA 1V5TA 1QOBA 5AZFA 2DAFA 4RF1A 1LFDA 2BS4B 2NVUI 2KN4A 4IWQA 4GSWA 5BMIA 1OQRA 2VZKD 4KDLB 3UF8A 2AEHA 1UH6A 3IT6B 3FILA 3AI5A 2BF8B 2FCQA 2JQRB 3DVNU 2QCZA 2HDEA 4YXDB 4W9CA 2JVCA 4HEA1 5MPOA 2ZCCA 2WWZA 3AE8B 1KFYB 3ZJTA 1ENFA 2DHZA 2WXNA 3PLUA 3A9KB 3IXSA 4WWNA 3KUCB 4TUUA 1TTNA 3O13A 3Q6BA 2N7DA 2KDMA 3H8HA 5EDSA 5J18A 4MJSA 1QOAA 3H6NA 1CZPA 1SGHA 3VUXA 1FNWA 1ZXHA 3RNGC 4CQNA 2GRIA 1V2YA 3V62A 2B76B 3M3JA 4IM2A 2N9EB 1XF5L 3SR6A 1Z2MA 2KO3A 4CHKA 3I9V1 2HJ8A 2BTEA 1HA5A 1WSPA 4EUTA 5JXVA 1K52A 1YJ1A 3ZNGC 5HKHA 1SB3C 2KAJA 1GNUA 3PPAA 1P98A 1WIAA 2OJRA 1VLBA 2BB5A 1JRUA 3DVNV 4WURA 1E5WA 2BKRB 4A3PA 3PRMB 4BBNC 2KN5A 2KQ7A 4K3CA 5IA7A 2M56B 2JPHA 1EU4A 1FRRA 1WRDB 4W9IA 1WZ0A 2E3TA 3CMMB 3EFUA 4ZRJA 4FJVB 2K0PA 3FKYA 2MBEA 3DBRB 4QAYA 2J0KA 3APDA 4J3OD 4GU2A 4XX5A 2KYWA 2KHWB 1J8CA 3DVGX 1T0YA 2WHIA 3TEXA 4ARCA 2DNFA 4L1BA 4LNNA 1ZDXA 3CF6E 2BGFA 4I6NB 3KW5B 4D2KA 3APFA 1I4GA 2ICIA 3WCQA 1TJEA 5TSSA 2J7QB 2KK8A 2FUG1 1V1PB 5C1ZA 4WQOB 3KH0A 4ZHOA 3GZNI 2XBBC 1Z5SB 2K3UA 3L4PA 2CJNA 4NAMA 3NVWA 4K7SA 2RDBC 4N58A 4JIOU 1ZPSA 2NBWB 1FMAD 3DQVA 1FFVA 1I4RA 2WU2B 2RD0A 2IO0B 3P4PB 3VHTC 3QHTA 2V9HA 1PQSA 5L83A 4E71A 4DDID 2YEPF 2M17A 3TEWA 2G4DB 3QIJA 2G45B 4MH0E 2L52A 1NBFC 4KGTA 1DGJA 3BVGA 2EKIA 1WJUA 5LNK1 3E56A 4ANVA 4KZ0A 3HK0A 2IO2B 3HVZA 5D94A 2VZKB 5H8YE 3AULA 2EMSA 1T5XD 3BVZA 4RGMA 3MC9A 3TJPA 3Q14C 3NY5A 3GOEA 4WAFA 2I1KA 4W9HA 2PJHA 2B3AA 2O6VB 1GOZA 4HCPB 4MGIE 4JPSA 3C8YA 2PE6B 1XLPA 1UWMA 3HM3A
chains in the Genus database with same CATH topology
4B0MA 2JX5A 1BMLC 3Q8FA 4KKJA 4ZHPA 1I4XA 1NVID 1NYRA 1SEBD 3P1MA 5FKAC 2HTME 1PYWD 1I4PA 1YQ4B 4KGRA 3UI3A 5G5GA 5G5HA 1OQQA 2Y5CA 1STEA 5D7GA 1P7FA 2DWQA 1TS4A 2SEBD 3NVZA 4UDUC 4RH6A 1TZOA 1JCKB 2W55A 1RFKA 1FNUA 2DLBA 2DYMA 1IBXA 1CK1A 1GB1A 1ZXIA 2IDYA 4ZYSA 1SE4A 4NZLB 4AS1A 3W5VB 1AYFA 1D5XC 2AQ2B 4YSYB 4A9AA 1V97A 1V1OA 2LFIA 3Q8AA 1YN4A 5T8IA 3KWLA 3CIRB 3AEDB 3W1SA 3MHZA 2NTSA 1FCLA 1HEZE 1I4HA 2W3RA 4EE2A 2NTTA 1WRIA 2DYOA 2WXQA 1PFDA 3IAS1 3NVVA 2KACA 4USAA 3U2SC 1YN5A 1E0ZA 2W54A 1LO5D 3LB8C 5E6JA 2V3NA 3LXFA 1KRHA 1TKYA 2JYEA 3AV8A 3MP9A 1TS5A 1KH0A 1SSNA 1HZ5A 1WYGA 2ON8A 2W3SA 2IGHA 3AE4B 1AWDA 1QQRA 1NENB 3NZ3A 4MACA 1R7SA 3HRDD 2LUMA 5HFYA 1RWSA 1UWXA 2ZW0A 2WQYB 1XLNA 1ZUD2 1EM7A 3VRBB 2BS2B 2INPE 1TKGA 4ZOHC 1JQ4A 1JWMD 3KLSX 5EE3A 4ITKA 2WXKA 3SFEB 1OFFA 1N62A 1KF6B 2X38A 3AE9B 1L4DB 3FAHA 4KGSA 1PGBA 2JWUA 3B2GA 3NS1A 3NUHB 4ZRQA 1UNSA 3ZQ4A 4XWWA 1D5MC 1FRDA 1E10A 1PUTA 1YNTE 4YTNB 2INNE 2V0GA 2LJIA 1RYJA 1J7CA 2LEKA 3TEZA 2MJ3A 4DXGA 1SJED 2K22A 2JSVX 3AEEB 3AE3B 1QKZA 1AN8A 2PKOA 3AE2B 4TMAB 2KWDA 1L0YB 3T3OA 2QEJC 2QSDA 2WNMA 4R3DA 4RFBA 3TUOA 2WXPA 3CWIA 2RDGA 4A8XC 1FFUA 1ET6A 5HG2A 2BB6A 1IGDA 1L0VB 3AEGB 4DQOC 1ESFA 2JZPA 1V1PA 3FC4A 3E9SA 1XCTL 2Y5PA 2QIEB 1SF0A 4WWMA 1QF6A 2XNAC 2MH7A 1HQRD 2QMTA 4N6EB 1K51A 5HI1A 1JWSD 3Q69A 2EELA 3URYA 1NYQA 1V8CA 1CQVA 3PZ8A 1ET9A 3BYYB 3DWMA 4L23A 1D5ZC 4ARIA 4YWGG 1VZ6A 2ZW1A 1JALA 4MH8A 4TQ1A 1P7EA 2Z8LA 1N61A 2BS3B 2L1AA 4OZCA 2I2YA 1M4VA 1QT9A 1XO3A 1YQ3B 1Y56A 3B9JA 4C7ZA 1T3QA 1HXYD 3HUIA 3P4RB 4YTPB 1XXGA 1WGKA 3SFDB 2WXLA 1I4QA 3P63A 2BYTA 2KQ4X 2AX5A 3KWVA 4WIPA 1VRAB 4RCOA 3LYYA 3VR9B 2IPKD 5D3DA 2H89B 1RM6C 4M0WA 3Q8EA 3AECB 3MC0B 3BIID 1GB4A 4H2AA 1FIQA 1L0XB 2WXJA 4TSSA 3AE1B 3AEFB 5C2TB 4HROA 1DOYA 2V4IB 4O1NA 1PGXA 3U7ZA 5EE0A 2Q5WD 4YT0B 1JWAD 3Q8CA 1MPEA 2JXTA 3AE5B 1YJJA 2N0SB 3R8BA 4OW0A 3TEYA 2LHEA 1B9RA 1ROEA 1TYGB 4DXFA 3GP7A 4RNAA 4WQMA 5AUIA 1AW7A 1Q10A 3EA6A 4IKGA 4US8A 5BMGA 4WH4A 1UGJA 1SJHD 1EWYC 3BVMA 4XDDA 3RPFC 1SIJA 5C3JB 4FXCA 2RPVA 2RDHA 2OHFA 3ABVB 1GAQB 1T6BX 4GLSC 2BT6A 2MJEA 2KMMA 3N9YC 1JROA 2R61A 4XWTA 1FNVA 2LMCA 4ZRPA 2G1EA 2RMMA 2PIAA 1C4CA 1IBXB 1QOBA 3AE7B 1E6EB 4RGOS 4RF1A 2BS4B 1NEKB 4KKIA 2PTLA 4IDIA 1JW9D 2KN4A 3Q8BA 2M19A 5BMIA 1FM0D 1OQRA 1SXTA 1DYQA 2AQ1B 2VZKD 2Y3AA 4C80A 4XDCA 1BXTA 3AN1A 3EGRA 3IT6B 3FILA 1EU3A 1VR9A 4MT5A 2WU5B 1FD6A 1KLUD 4A6QA 2JQRB 2HDEA 4YXDB 3AEAB 2PVGC 2QILA 4HEA1 5MPOA 3IAM1 3AE8B 1DOIA 1PDXA 1KFYB 2H88B 5BMHA 3MFGA 3ZJTA 1ENFA 1QLBB 2E6XA 2WXNA 3AH7A 3NVYA 3BZDB 3GB1A 3IXSA 3V3XA 1TKEA 1FXAA 1I7HA 1QOGA 2PLPA 3O13A 4REZA 2KDMA 3H8HA 2BBCA 2W82A 3ZJUA 3ZYYX 1QOAA 1CZPA 1C77A 1J7AA 3FILB 1FNWA 2CJOA 1SBBB 1ZXHA 3SEBA 2J53A 3PO0A 1DOXA 2SAKA 4CQNA 2GRIA 5FK9C 2B76B 4MM3B 1VJKA 3AB5A 2AQ3B 5GXGB 1XF5L 1ZP0B 3SR6A 3B2FA 1L4ZB 4US9A 3I9V1 2BTEA 1HA5A 1WSPA 2WXRA 3AM9A 5BYRA 5JXVA 1K52A 2XN9C 1C4PA 4JE3B 1XEEA 3VQIA 1SB3C 2KAJA 2WP9B 2WXFA 4HJGE 4P16A 2LGIA 1C78A 1KLGD 1E7PB 2JYTA 2YEPB 2K9XA 3BYTB 1N63A 4RGTA 1VLBA 1N5WA 2BB5A 3R2IA 4WURA 3EUB2 1CJEA 1QOFA 1C4AA 1FEHA 1JMLA 1YJIA 2WDRB 3R2TA 4TQ0A 1XCQL 4IOIE 4OZBA 1SE3A 1VDVA 1D4BA 2M56B 2N9KA 3VR8B 1EU4A 2WLBA 2LHDA 1FRRA 1JWUD 5EE1A 3T3NA 3AE6B 1ZE3D 2WDVB 4LTUA 1BUIC 1ZDVA 2E3TA 1GPXA 3DWGC 3MJ5A 4OHJA 1WWTA 2K0PA 4J3OD 3IT4B 2PW9A 1L6VA 4C7YA 2N9LA 3TEXA 1K53A 4ARCA 1HZ6A 4JX1C 3P4SB 1FO4A 2J4XA 2G9HD 1K50A 4L1BA 2TSSA 5BYSA 1YMHE 4GDLB 1ZDXA 3AMZA 1F77A 1KTKA 1C79A 3I57A 2WXGA 1WXQA 4D2KA 3U52E 1XLOA 2J42A 1I4GA 2ICIA 1NI3A 1XLQA 3WCQA 4GDKB 3ETRA 5HHDG 2L83A 4NAWB 1TJEA 4AQ7A 2FBWB 4JWSC 3PZ7A 4OZAA 5TSSA 4NJCA 2NMQA 4HKQA 3NRZA 1UUPA 1C76A 1MVKA 1V1PB 2FUG1 2JU6X 4Q2JA 4XE0A 1TY0A 1FCCC 5AUKA 4HRSA 4ZHOA 3ZJVA 2GB1A 5FR3A 4HKZE 4YSZB 2WS3B 2MJDA 1E9MA 2QJLA 2K3UA 3L4PA 2N7JA 5BYQA 2CJNA 2IGDA 4NAMA 2PVOD 3NVWA 5D3IB 1N5XA 4N58A 4N59A 3W2DA 2WDQB 2ONQA 1ZPSA 2FE8A 1FMAD 2IGGA 1IGCA 2OEDA 1FFVA 1I4RA 2ACZB 2WU2B 1C9FA 1EWCA 3P4PB 3BK2A 1F2RI 1N60A 1PGAA 3VRAB 4A55A 1ZOYB 1YN3A 5EE9A 2YEPF 2PMVA 2DBYA 1JWBD 3ZGZA 1MI0A 1MHXA 3TEWA 3BK1A 4L2YA 2L52A 3OWEB 3V05A 3W9CB 4KGTA 1DGJA 3BVGA 1MHHE 4LK0M 2EKIA 3RFZB 4P6VF 1JRPA 4KX6B 1A70A 2V3PA 3P42A 5LNK1 3E56A 3HVDA 2J52A 2CU3A 3W5UB 5I4DA 4RF0A 1TY2A 1L6UA 2WXHA 3HVZA 2VZKB 2WXIA 5H8YE 2GI9A 4B0EA 2IJ0A 4C56C 1T5XD 3BVZA 1D6EC 1ACCA 1B1ZA 3U4EG 4RGNA 4RGMA 3KQ4A 2D5GA 2I38A 4OVZA 1VZ7A 2M0AA 5H92C 1F2RC 3P4QB 4WAFA 4PT5A 1TS2A 2BW2A 2WXOA 4YSXB 3TSSA 3GS2A 3J9CA 1TS3A 2L32A 1F0ZA 1FXIA 2K5PA 2WXMA 1IUEA 4LLGM 3AEBB 1QILA 1J7BA 1GOZA 4YTMB 4JWUC 4JPSA 3C8YA 3BWUD 1XLPA 1L5PA 4A90A 2MEKA 1UWMA 1VZ8A 1SE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDX A;  4WWM A;  1KFY B;  2H88 B;  1WXQ A;  2JX5 A;  4ZHP A;  1QF6 A;  1QLB B;  1NVI D;  1XLO A;  3AH7 A;  1NYR A;  3NVY A;  3P1M A;  2MH7 A;  2HTM E;  4N6E B;  1YQ4 B;  1NI3 A;  1XLQ A;  5G5G A;  3WCQ A;  3ETR A;  1TKE A;  1FXA A;  1OQQ A;  2L83 A;  1TJE A;  2Y5C A;  5G5H A;  2FBW B;  4JWS C;  1NYQ A;  1V8C A;  1I7H A;  2DWQ A;  1QOG A;  3NVZ A;  3DWM A;  3NRZ A;  2W55 A;  1RFK A;  1JAL A;  5AUK A;  3ZYY X;  4HRS A;  4ZHO A;  1ZXI A;  1QOA A;  1CZP A;  3W5V B;  1AYF A;  4A9A A;  1N61 A;  2BS3 B;  1J7A A;  4YSY B;  1QT9 A;  1V97 A;  1XO3 A;  1YQ3 B;  2CJO A;  2WS3 B;  2MJD A;  1E9M A;  2QJL A;  3B9J A;  4C7Z A;  3KWL A;  3L4P A;  1T3Q A;  3CIR B;  3AED B;  2CJN A;  3HUI A;  3P4R B;  3PO0 A;  1DOX A;  4YTP B;  2PVO D;  3NVW A;  1WGK A;  3SFD B;  2W3R A;  3P63 A;  1N5X A;  2B76 B;  4N58 A;  2AX5 A;  1WRI A;  4N59 A;  2WDQ B;  1PFD A;  1VJK A;  3NVV A;  3AB5 A;  5GXG B;  4USA A;  1ZP0 B;  1FMA D;  3SR6 A;  3VR9 B;  3B2F A;  1E0Z A;  2H89 B;  2W54 A;  3LB8 C;  1RM6 C;  1FFV A;  2ACZ B;  2WU2 B;  4US9 A;  3LXF A;  1KRH A;  3AEC B;  3BII D;  1TKY A;  3P4P B;  1FIQ A;  3AV8 A;  3AE1 B;  1N60 A;  3AEF B;  3AM9 A;  4HRO A;  5C2T B;  3VRA B;  1DOY A;  1ZOY B;  1WYG A;  2W3S A;  5EE9 A;  5EE0 A;  2DBY A;  2Q5W D;  1JWB D;  1JWA D;  4YT0 B;  3AE4 B;  1AWD A;  1SB3 C;  2KAJ A;  2WP9 B;  1NEN B;  1R7S A;  3HRD D;  3AE5 B;  1YJJ A;  2N0S B;  1RWS A;  2L52 A;  1E7P B;  2WQY B;  1XLN A;  3W9C B;  1B9R A;  1ZUD 2;  1ROE A;  2K9X A;  1DGJ A;  1TYG B;  2EKI A;  1N63 A;  3VRB B;  1VLB A;  2BS2 B;  4WQM A;  1N5W A;  5AUI A;  4P6V F;  1JRP A;  1TKG A;  4KX6 B;  1A70 A;  4US8 A;  4ZOH C;  1JQ4 A;  3EUB 2;  1CJE A;  5EE3 A;  1EWY C;  1QOF A;  2WDR B;  1YJI A;  4ITK A;  2CU3 A;  3SFE B;  1OFF A;  3W5U B;  1N62 A;  3RPF C;  1KF6 B;  1SIJ A;  5C3J B;  4FXC A;  3AE9 B;  1L6U A;  3HVZ A;  1VDV A;  2OHF A;  1GAQ B;  3ABV B;  3FAH A;  5H8Y E;  2BT6 A;  3B2G A;  3NS1 A;  2M56 B;  3VR8 B;  2MJE A;  2KMM A;  1JRO A;  2WLB A;  5EE1 A;  1FRR A;  1FRD A;  1E10 A;  2G1E A;  1PUT A;  2PIA A;  3AE6 B;  1QOB A;  3AE7 B;  2WDV B;  4YTN B;  1E6E B;  4LTU A;  1RYJ A;  1J7C A;  2BS4 B;  2LEK A;  2E3T A;  1NEK B;  2MJ3 A;  1GPX A;  3DWG C;  5H92 C;  2K22 A;  3AE3 B;  1WWT A;  3AEE B;  1JW9 D;  2PKO A;  3AE2 B;  3P4Q B;  4IDI A;  2M19 A;  4YSX B;  1FM0 D;  1OQR A;  1F0Z A;  3CWI A;  1FXI A;  2K5P A;  4C80 A;  1FFU A;  1L6V A;  4C7Y A;  3AN1 A;  1IUE A;  1L0V B;  3AEG B;  4YSZ B;  4JX1 C;  3P4S B;  3AEB B;  2WU5 B;  1FO4 A;  1J7B A;  2JQR B;  4YTM B;  4JWU C;  3FC4 A;  4YXD B;  1XLP A;  1L5P A;  3AEA B;  2PVG C;  3AMZ A;  5MPO A;  2QIE B;  1UWM A;  1SF0 A;  3AE8 B;  1DOI A; 
#chains in the Genus database with same CATH topology
 3RN9 C;  4I6P A;  3VUY A;  1SEB D;  5FKA C;  3WAN A;  5JH5 C;  1ZKH A;  3O65 B;  1V9J A;  1OQQ A;  5D7G A;  1TS4 A;  2BQQ A;  2KVZ A;  3NVZ A;  4RH6 A;  4XZ4 A;  1JCK B;  2IO1 B;  2W55 A;  1RFK A;  2DLB A;  2DYM A;  2FID A;  1TBE A;  1SE4 A;  4AS1 A;  4YSY B;  2MBO A;  1YN4 A;  3A9K A;  2PEA A;  1HEZ E;  4N9F 4;  2W3R A;  4NJ7 A;  2NTT A;  4FJY A;  2WXQ A;  4WJQ A;  2A4Z A;  1LO5 D;  4GXB A;  2XEW A;  1MG8 A;  5FR6 A;  3MP9 A;  2FCM A;  2ON8 A;  1WYG A;  1V5O A;  3JSV A;  1AWD A;  3A9J A;  2ZW0 A;  1XLN A;  1IYF A;  3VRB B;  2BS2 B;  2INP E;  4ITK A;  2WXK A;  1N62 A;  2D3C A;  2K25 A;  3VXW A;  4ZRQ A;  4BKS A;  1UNS A;  1FRD A;  3ENE A;  1RYJ A;  4PS3 A;  4DWF A;  2EMT A;  3NS8 A;  2J0M A;  3AEE B;  1QKZ A;  4BOZ B;  3OAW A;  4WJN A;  1L0Y B;  4M8M A;  2QSD A;  4R3D A;  1WX9 A;  1P0R A;  2WDT B;  2WXP A;  4MJS B;  2JY6 A;  5E6N A;  1FFU A;  4BKG A;  5HG2 A;  2M0X A;  1R4M B;  3SU8 X;  1XCT L;  2QIE B;  2IND C;  4E3C A;  1QF6 A;  4CO7 A;  2V1Y A;  2J0J A;  2DX5 B;  2EEL A;  3DBS A;  4W9G A;  1CQV A;  1ET9 A;  1C3T A;  1VZ6 A;  3ZVV A;  2MW5 A;  4MH8 A;  2ZVO A;  1P7E A;  2L1A A;  1GC6 A;  4JLC A;  1YQ3 B;  2KVR A;  3I63 C;  1YOV B;  3P4R B;  2WXL A;  1GC7 A;  3KWV A;  1H8C A;  2IYD B;  1VRA B;  4XGA B;  2JF5 A;  1RM6 C;  3ZKJ C;  1GB4 A;  4TSS A;  2R2O A;  2ZVN A;  3AE1 B;  3X0W A;  1DOY A;  2V4I B;  4O1N A;  4ZDV A;  3DBR I;  1PGX A;  1L2N A;  3U7Z A;  3PT2 B;  2FAZ A;  2KMA A;  4DDG D;  3AE5 B;  3R8B A;  2KDI A;  2WGS A;  4WJO A;  2INC C;  3GP7 A;  4RNA A;  1NDD A;  2RGF A;  3EA6 A;  1WXS A;  3LDZ E;  4IKG A;  4IW0 A;  1UGJ A;  1SJH D;  2MBQ A;  4S17 A;  2PE9 A;  3JSV B;  3KUZ A;  2BT6 A;  2MJE A;  2KMM A;  3MHS D;  3N9Y C;  2IY0 B;  1FNV A;  2G1E A;  1C4C A;  4IWP A;  1ISN A;  2NPT A;  4KSK C;  5JHB A;  4TV3 A;  4K7W A;  2L3Z A;  4XYC A;  3K9O B;  1FM0 D;  1WGY A;  1BXT A;  3AN1 A;  2L0T A;  5AEK B;  2FCS A;  2JZZ A;  2KWV B;  1TGZ B;  2VH1 A;  3MFG A;  3EC8 A;  2E6X A;  1WJ4 A;  4B95 A;  1FXA A;  4M01 A;  3A1Q A;  4REZ A;  3M62 B;  3ZYY X;  5KHO A;  5AZG A;  4PS8 A;  2JRH A;  1J7A A;  3OG5 A;  1SBB B;  3RZF A;  3AU5 A;  2MX2 A;  1DOX A;  3JW0 X;  4KIK B;  1VJK A;  3RD2 A;  2AQ3 B;  5GXG B;  1ZP0 B;  2KXJ A;  1P9D U;  2Z59 B;  1L4Z B;  1OQY A;  3QAR A;  3AM9 A;  5BYR A;  1WJ6 A;  2FIF A;  2XN9 C;  4EKU A;  2N9P C;  2QC8 A;  1C4P A;  1BT0 A;  4AP4 C;  3QK0 A;  4P16 A;  4FJZ A;  2LGI A;  1HTO A;  2N1V A;  2JYT A;  4ACF A;  3BYT B;  4RGT A;  4IG7 B;  3R2I A;  2CS4 A;  1CJE A;  1C4A A;  1JML A;  2KX0 A;  3R2T A;  2GBN A;  4TQ0 A;  3QX1 A;  3W1S C;  4OZB A;  3B0A A;  4FLH A;  1E8W A;  3T9L A;  3T3N A;  3QCA A;  1BUI C;  1TT5 B;  4LNF A;  1GPX A;  4OHJ A;  2ZNV C;  4W9K A;  4C4V B;  5CX3 A;  2MCN B;  4DHJ B;  2N9L A;  2Z0E B;  4FHK A;  3R7Q A;  4JX1 C;  3P4S B;  1FO4 A;  2J4X A;  2TSS A;  5BYS A;  2G3Q B;  5DPW A;  1C1Y B;  3AMZ A;  3NZS A;  4HPP A;  1F77 A;  1WXQ A;  1Y8R C;  1XLO A;  1YQB A;  3ETR A;  2L83 A;  3KYD D;  3N20 C;  5JZE B;  2NMQ A;  3NRZ A;  1C76 A;  3CSF A;  3ZTC A;  1V81 A;  2HJ1 A;  4XE0 A;  5AUK A;  1E8Z A;  3NOB A;  1UF0 A;  4ICV A;  3R7R A;  4GB9 A;  4EZL A;  2WS3 B;  2N7J A;  2IGD A;  4PYU A;  5D3I B;  2KDB A;  2K8B A;  2DAJ A;  2WDQ B;  2LXC A;  2BYE A;  2ACZ B;  1F2R I;  1PGA A;  3VRA B;  3N32 A;  3DBH B;  5L95 C;  1WR6 E;  1F9J A;  1MHX A;  3TL5 A;  2R2Q A;  2MHJ A;  4L2Y A;  3WAL A;  1XD3 B;  4LK0 M;  2FNJ B;  4G50 A;  4F8C B;  4AWJ A;  4A3O A;  4HCN B;  1MFW A;  2HD5 B;  4ASW C;  3AXC A;  2CU3 A;  4HDO A;  5I4D A;  1LM8 B;  1RAX A;  3WAO A;  3Q3O C;  2WXH A;  5E6O A;  3VVW B;  4C56 C;  3RCZ A;  3A33 B;  1D6E C;  3U4E G;  4NAW A;  3DVG Y;  5CHW A;  3IVF A;  5H92 C;  1F2R C;  1TS2 A;  2V3S A;  3SD5 A;  2NS5 A;  4YSX B;  4HVB A;  3GS2 A;  3J9C A;  1TS3 A;  1FXI A;  3N1Z C;  3ML8 A;  3BIN A;  1QIL A;  4E74 A;  2KC2 A;  4JWU C;  3IBE A;  5G55 A;  3ZNZ B;  2GBJ A;  3QQ8 B;  2MEK A;  1VZ8 A;  1SE2 A;  5DCN A;  4B0M A;  3Q8F A;  1BML C;  4KKJ A;  2KNB A;  1NYR A;  3P1M A;  1PYW D;  1YQ4 B;  4KGR A;  3UI3 A;  5G5G A;  5G5H A;  3UQB A;  5G2N A;  1STE A;  3WAP A;  2MRP A;  2JRI B;  1UD7 A;  2ASQ A;  1FNU A;  1GB1 A;  2IDY A;  1WGD A;  1RRB A;  5T8I A;  5JHA A;  2NTS A;  4EE2 A;  4PYZ A;  3IAS 1;  2LGS A;  1E0Z A;  3L0W B;  1EF1 A;  3LXF A;  2N9X A;  3JVZ X;  3VTV A;  1SSN A;  3CST A;  4HDQ A;  3NZ3 A;  4MAC A;  1R7S A;  3HRD D;  2LUM A;  4MEL A;  2IBI B;  3L16 A;  1WF9 A;  2WYQ A;  2D10 A;  4MDK E;  4G3X B;  3WAM A;  4ZOH C;  2CHX A;  3SFE B;  2MBB B;  1KF6 B;  2X38 A;  2K1F A;  4W9L A;  3ML9 A;  4P7I A;  1PGB A;  3B2G A;  3ZQ4 A;  4ZRI A;  3HM6 X;  3GE8 C;  2V0G A;  3QWZ B;  2L0F A;  3Q3J A;  1J7C A;  4JQW C;  3ZUN A;  3TEZ A;  5AZH A;  4DXG A;  3T8M A;  1UGM A;  3T3O A;  2WNM A;  4RFB A;  3CWI A;  4JGH B;  4A8X C;  1AAR A;  1IGD A;  4DQO C;  1MJD A;  2NBV B;  3E9S A;  3GE3 C;  1WR1 A;  3X23 A;  4WWM A;  3L13 A;  4KIK A;  2XNA C;  3UIO B;  3DBL I;  2MH7 A;  1K51 A;  1QZE A;  2L05 A;  3URY A;  1V8C A;  1D3Z A;  2Y5B B;  3DWM A;  2KQS A;  1YX5 B;  4TQ1 A;  3PV1 A;  4NQK E;  3B9J A;  1CMX B;  2LWP A;  1XXG A;  2BYT A;  4IC7 B;  2AX5 A;  4RCO A;  3VR9 B;  2IPK D;  2LGX A;  1G6J A;  2H89 B;  4M0W A;  3Q8E A;  3MC0 B;  2DZK A;  1FIQ A;  1E7U A;  3AEF B;  3N1Y C;  4KDI C;  4B9K A;  4WWO A;  5KHQ A;  2GOW A;  1MPE A;  2JXT A;  4PK1 A;  1YJJ A;  3RNA C;  1B9R A;  2ZPY A;  4DXF A;  1Q10 A;  3ZRC A;  4US8 A;  5BMG A;  2UYZ B;  4DHZ E;  2ZNV B;  4FXC A;  3RUL A;  1FXT B;  2RDH A;  2X8X X;  3U30 A;  1T6B X;  3PHW B;  1R4M I;  2R61 A;  4XWT A;  2LMC A;  4FAD A;  1IBX B;  2PIA A;  3AE7 B;  4OVU A;  1E6E B;  4RGO S;  1F1H A;  1NEK B;  2PTL A;  4IDI A;  3L10 B;  4CYE A;  2AL3 A;  3IFW B;  2CHZ A;  3OLM D;  3A4S C;  2AQ1 B;  2DZJ A;  3PRZ A;  2KMC A;  4C80 A;  3HIZ A;  3RT3 B;  4M00 A;  1EU3 A;  2K8H A;  4K1R B;  2WU5 B;  3U7D A;  1KLU D;  3UGB B;  4I6L B;  3AEA B;  2QIL A;  4RM8 A;  5BMH A;  2JWZ A;  3AH7 A;  3NVY A;  3BZD B;  2RSU A;  2JUO A;  1I7H A;  2N4F A;  2KKC A;  2PLP A;  2BBC A;  3ZJU A;  4NNJ B;  2D11 A;  3N1X C;  2D3B A;  2JT4 B;  3SEB A;  2JZ3 B;  2J53 A;  3PRE A;  4M0W B;  2SAK A;  2N1W A;  5FK9 C;  4EZK A;  3AB5 A;  1TZ1 A;  2LXA A;  4MSM B;  2KJR A;  5DPT A;  2QHO A;  4BOS C;  4HPL B;  2KAN A;  1WX7 A;  4JE3 B;  4GN1 A;  4BVU C;  3VQI A;  4ANX A;  2WP9 B;  1C78 A;  1KLG D;  3H1U A;  4NQL B;  4ZRK A;  2YEP B;  2K9X A;  3UIP B;  3ZXV A;  1N5W A;  2M4N A;  2D2Q A;  5IN7 A;  3EUB 2;  1QOF A;  1FEH A;  1YJI A;  2WDR B;  3I3T B;  1XCQ L;  4DBG A;  1VDV A;  3L17 A;  1D4B A;  3VR8 B;  5EE1 A;  2LHD A;  1JWU D;  1NI2 A;  3AE6 B;  1ZE3 D;  2WDV B;  3H7P A;  1ZDV A;  3VH4 B;  1OEY A;  3DWG C;  3MJ5 A;  2DEN B;  1LGR A;  4LCD E;  1KOT A;  1I42 A;  2LAS A;  2KTF A;  4LJO B;  1H4R A;  2PW9 A;  4BZA A;  1L6V A;  4C7Y A;  1K53 A;  1HZ6 A;  1UBQ A;  1UZX B;  2VH2 A;  2G9H D;  1K50 A;  1YMH E;  3V6C B;  2XK5 A;  4P1B C;  3TCA A;  2GBM A;  2WXG A;  3U52 E;  3LJ3 A;  1NI3 A;  4GDK B;  4AQ7 A;  5LLI A;  2FBW B;  4OZA A;  3N3K B;  3ZIM A;  4NJC A;  4W9J A;  3TMP B;  2K6D B;  1EUV B;  3AU4 A;  3OJ3 A;  1UUP A;  1MVK A;  1FCC C;  2MP2 A;  3ZJV A;  4S0R A;  2GB1 A;  2Z0D B;  3ZNI D;  3APC A;  4HKZ E;  2QJL A;  2RPQ A;  5BYQ A;  4ZYN A;  3H9D A;  2L7R A;  1L7Y A;  2PVO D;  1N5X A;  2OJW A;  3W2D A;  2ONQ A;  2FE8 A;  2WX1 A;  2IGG A;  1IGC A;  2OED A;  3NHE B;  1C9F A;  1EWC A;  2K8C A;  3VDZ A;  3ZNH B;  3BK2 A;  1V86 A;  1YN3 A;  5E6P A;  4AJW A;  2HE7 A;  2DBY A;  1JWB D;  3ZGZ A;  1MI0 A;  4NY0 A;  2AYO B;  2LVP A;  4LNO A;  4KSL C;  3V05 A;  5LXH A;  2DZI A;  5D2M B;  1WY8 A;  1E8Y A;  4P6V F;  3ALB A;  2NPT B;  3P42 A;  2C7H A;  3SDL C;  3RNC C;  1Q5W B;  2REX A;  4RF0 A;  1TY2 A;  1L6U A;  2KTR B;  4HJK A;  2GI9 A;  5J17 A;  4B0E A;  2IJ0 A;  3RMK C;  1WE7 A;  1ACC A;  2O2V B;  4RGN A;  3KQ4 A;  3Q2A C;  2D5G A;  2I38 A;  2M0A A;  1YD8 U;  3EEC A;  3P4Q B;  4DXA B;  1EF5 A;  3A9J B;  4PT5 A;  3MTN B;  4C00 A;  2GBR A;  2K5P A;  2BWF A;  2WXM A;  1IUE A;  4LLG M;  3BWU D;  4A90 A;  5IOI A;  4EZJ A;  2CKH B;  3QAQ A;  5IO9 A;  2V4L A;  4ZHP A;  1I4X A;  1I4P A;  2Y5C A;  4PS7 A;  2ZEQ A;  1TZO A;  4MGY E;  4DHZ B;  1IBX A;  2GBK A;  1WX8 A;  2YVC A;  4ZYS A;  2WX0 A;  4NZL B;  3W5V B;  4A9A A;  2I1J A;  3S2A A;  3CIR B;  3MHZ A;  4GDK A;  2MSE D;  3H7S A;  1I4H A;  4OVV A;  2ZJD A;  1WRI A;  2DYO A;  1PFD A;  3NVV A;  2KAC A;  4USA A;  3U2S C;  1KJT A;  2V3N A;  2MP2 B;  4IUM B;  1K8R B;  3QC8 B;  2JYE A;  1TS5 A;  5GMV A;  3B08 A;  3EFC A;  3ECI A;  4P1C C;  1NEN B;  2BKF A;  4G11 A;  1ZUD 2;  1EM7 A;  3M63 B;  3MC8 A;  4FA6 A;  3ZTD A;  5CHV C;  2K39 A;  5EE3 A;  1OFF A;  3ZDT A;  3AE9 B;  1L4D B;  3RZW C;  1YX6 B;  5BO4 B;  4KGS A;  2BYV E;  2JWU A;  4XWW A;  3NS1 A;  1D5M C;  1A5R A;  1WFY A;  1YNT E;  3ZLZ A;  2LJI A;  1E8X A;  1T0Q C;  3RUI B;  4TMA B;  2PKO A;  1AN8 A;  1WGR A;  1P1A A;  3TUO A;  2IZV B;  3L54 A;  2RDG A;  1ET6 A;  1UBI A;  1ESF A;  2MQJ A;  2JZP A;  1WJN A;  4K7U A;  2LRW A;  3FC4 A;  1GG3 A;  3PSE B;  2Y5P A;  4LJP B;  4KZC A;  3VH3 B;  1RFA A;  4NJ6 A;  1HQR D;  2QMT A;  4N6E B;  2LZ6 A;  2ZZP B;  1JWS D;  3Q69 A;  3PZD A;  1NYQ A;  3PZ8 A;  4L23 A;  1LQB A;  2KC1 A;  1X1M A;  4ARI A;  4YWG G;  4BKT A;  2KFJ A;  2ZW1 A;  5LXI B;  1ZGU B;  2BVC A;  1V80 A;  2Z8L A;  2C60 A;  4OZC A;  3VUW A;  2I2Y A;  3DBL B;  1WM3 A;  1MG4 A;  1XO3 A;  3SHQ A;  1E7V A;  1HXY D;  3HUI A;  3VFK A;  1LXD A;  1V49 A;  1WGK A;  1I4Q A;  4DHJ D;  2KQ4 X;  2GLS A;  1R4N B;  4HLE A;  1U4A A;  3PS6 A;  3R3M A;  5D3D A;  4LDT D;  3WA0 A;  3AEC B;  4H2A A;  3OJ4 B;  5C2T B;  2KFK B;  4HRO A;  4W9D A;  4BFR A;  1HE8 A;  2Q5W D;  4YT0 B;  1JWA D;  1WGH A;  2N0S B;  4K81 A;  4OW0 A;  3TEY A;  2LHE A;  1ROE A;  5AUI A;  4WH4 A;  4II2 B;  4XDD A;  1EWY C;  3BVM A;  2PPH A;  2RPV A;  1SIF A;  2OHF A;  3RNB C;  4URK A;  1WGG A;  3C19 A;  4X57 B;  1JRO A;  4ANW A;  2RMM A;  5J2R A;  1S3S G;  1ZW7 A;  4KKI A;  3ZW3 A;  1JW9 D;  2MBH A;  3Q8B A;  2M19 A;  2D07 B;  3KUD B;  1WXM A;  1SXT A;  1DYQ A;  2Y3A A;  4GOC A;  3DDC B;  4XDC A;  3EGR A;  4IWO A;  1VR9 A;  4MT5 A;  1FD6 A;  4A6Q A;  4W9F A;  2PVG C;  3M95 A;  3IAM 1;  1DOI A;  1PDX A;  3UQA A;  2H88 B;  1QLB B;  4MEM A;  3GB1 A;  4GGQ A;  3DHI C;  1TKE A;  3V3X A;  2KTR A;  1QOG A;  2W82 A;  2O2V A;  1C77 A;  2CHW A;  1Q1O A;  3FIL B;  3PVL A;  2CJO A;  2N7E A;  3PO0 A;  4LNK A;  1VD2 A;  4MM3 B;  1WMH A;  4B6W A;  2LD9 A;  3B2F A;  4US9 A;  3EHV A;  2AL6 A;  2WXR A;  1IPG A;  4GIV A;  3HHM A;  1XEE A;  2WXF A;  4W9E A;  4HJG E;  1E7P B;  1HTQ A;  4AOF A;  1N63 A;  2L8J A;  4LNI A;  4G0N B;  2KJH B;  2DZM A;  1WH3 A;  2LJ5 A;  4IOI E;  1SE3 A;  2N9K A;  1KM7 A;  2WLB A;  2MWS B;  4GMV A;  4EOY A;  4MSQ B;  1WXV A;  2M8S A;  2C9W B;  4LTU A;  3VAW A;  2BPS A;  1WWT A;  4ICU A;  1EO6 A;  1P3Q U;  1KLV A;  3IT4 B;  2EKE C;  1J19 A;  4XC2 A;  3RI7 C;  4HWI B;  2KJ6 A;  4GDL B;  2AWT A;  4DK5 A;  4AJY B;  1KTK A;  1C79 A;  3I57 A;  1IP9 A;  3A4R A;  5TR5 A;  2J42 A;  1SE9 A;  1XLQ A;  5HHD G;  4NAW B;  4JWS C;  3MJW A;  3PZ7 A;  4HKQ A;  3PGE A;  2JU6 X;  4Q2J A;  3K9P B;  1TY0 A;  2C7M B;  2IY1 B;  4HRS A;  3NZU A;  4KVG B;  3ZDM C;  1T0S C;  2KDF B;  4BKS D;  5FR3 A;  4YSZ B;  3QJZ A;  4WAA A;  2MJD A;  1E9M A;  2C7N B;  3VTU A;  3QA8 A;  3V6E B;  2UU7 A;  4FBJ B;  1S1Q B;  2C5L C;  3KYC D;  4N59 A;  5DPR A;  2NCN A;  4KV2 A;  1OGW A;  1N60 A;  4HK2 A;  4A55 A;  1ZOY B;  3N30 A;  4LDT B;  5EE9 A;  2PMV A;  4EFO A;  3BK1 A;  3DHH C;  4RM9 A;  4C4V A;  3OWE B;  2KOX A;  3W9C B;  1YIW A;  3RFZ B;  1MHH E;  4KX6 B;  1JRP A;  1A70 A;  1M94 A;  2V3P A;  3B1L X;  2D3A A;  3HVD A;  4TKN A;  2J52 A;  2MLB A;  3NJT A;  3W5U B;  3ZO5 B;  2KDE B;  5C23 A;  1TIF A;  2KX3 A;  3RNE C;  2WXI A;  3ONS A;  1B1Z A;  3Q3N C;  2L00 B;  2LGD A;  4OVZ A;  1VZ7 A;  4HXD A;  2BW2 A;  2WXO A;  1N6Z A;  2DYB A;  3TSS A;  1F0Z A;  2L32 A;  4GDL A;  1E90 A;  4M02 A;  5IKC M;  3AEB B;  4EEW A;  1J7B A;  2LVQ A;  1R4N I;  5DPS A;  4YTM B;  4IM3 A;  5CTR C;  1L5P A;  3IG3 A;  1WE6 A;  2LGY A;  2JX5 A;  1NVI D;  1I35 A;  2HTM E;  2IO3 B;  2KD0 A;  1P7F A;  2DWQ A;  2SEB D;  4UDU C;  2KFK A;  4MGZ E;  1GUA B;  1CK1 A;  3TBL D;  2LI5 A;  2HTH A;  1ZXI A;  2KWU B;  1AYF A;  1D5X C;  2AQ2 B;  4NPN A;  3R66 C;  1V97 A;  1V1O A;  2LFI A;  3Q8A A;  3DOW A;  3KWL A;  3ZXR A;  3NG0 A;  3AED B;  3A1Q B;  3W1S A;  2GMI C;  4IM0 A;  2L76 A;  1FCL A;  2JXX A;  2NBU A;  4ANU A;  2A5U A;  2O6V D;  1YN5 A;  5IP4 D;  2UWQ A;  2W54 A;  3LB8 C;  5E6J A;  2FCN A;  1KRH A;  1TKY A;  3AV8 A;  3PLV A;  4MGK E;  3ZRF A;  1KH0 A;  1HZ5 A;  2W3S A;  2IGH A;  4JL9 A;  1VCB A;  3AE4 B;  3UIN B;  1QQR A;  2QDF A;  4FHJ A;  2G4S A;  5HFY A;  1RWS A;  1Q0W B;  1UWX A;  2WQY B;  3RYT A;  1OEY J;  1WMH B;  1GJZ A;  2D3G A;  4RMA A;  1WI0 A;  1TKG A;  3H7P B;  3W1Y A;  4K3B A;  1JQ4 A;  2NR2 A;  1JWM D;  3KLS X;  1F52 A;  2KZR A;  3P2B A;  3DCG A;  1V6E A;  2OOB B;  3VTW A;  3WIM A;  4BBN F;  4F7Z A;  4FUL A;  3FAH A;  3NUH B;  2MA9 B;  4II3 B;  1E10 A;  1PUT A;  2CU1 A;  3TIX A;  4YTN B;  1WM2 A;  2INN E;  2LEK A;  2XK5 B;  2MJ3 A;  1SJE D;  2K22 A;  3AE3 B;  2JSV X;  3AE2 B;  2CR5 A;  2KWD A;  2ZCB A;  2QEJ C;  3PHX B;  3Q3F A;  2BB6 A;  1L0V B;  3AEG B;  4FN2 A;  1WZ3 A;  3U8Z A;  1V1P A;  2K6Q A;  1SF0 A;  4MM3 A;  2LVO A;  3V60 A;  1WYW B;  5HI1 A;  3DBH I;  3BY4 B;  1J0G A;  2M1M A;  4YL8 A;  1UEL A;  3BYY B;  1D5Z C;  3C0R B;  4HPM B;  1JAL A;  4WJP A;  3JYU A;  3V61 A;  4A20 A;  2VRR B;  3DHG C;  2O6V A;  1N61 A;  2BS3 B;  5IAA C;  1M4V A;  1QT9 A;  3KVF B;  1Y56 A;  4C7Z A;  1T3Q A;  5CHF A;  1RLF A;  4YTP B;  1XT9 B;  3SFD B;  3P63 A;  4WIP A;  2YLM A;  2LUE A;  2KLG A;  3LYY A;  4J6I A;  2BYF A;  3I5J C;  3BII D;  3PRP B;  1L0X B;  2WXJ A;  2FUH B;  2RR9 A;  3RNF C;  5EE0 A;  1XQQ A;  3GZN B;  4F1S A;  3Q3M C;  3Q8C A;  4M8N A;  4BAX A;  2KT7 A;  1OTR B;  2LRU A;  3D32 A;  1TYG B;  4WQM A;  1AW7 A;  1WXA A;  2ZPN A;  4AUQ C;  2BWE S;  2KLC A;  3RPF C;  1SIJ A;  5C3J B;  3PTF C;  5D6J B;  3DPD A;  3IHP C;  1T0R C;  3L08 A;  3ABV B;  1GAQ B;  4GLS C;  1FPY A;  2W9N A;  2KWC A;  4ZRP A;  4WWP A;  1V5T A;  1QOB A;  5AZF A;  2DAF A;  4RF1 A;  1LFD A;  2BS4 B;  2NVU I;  2KN4 A;  4IWQ A;  4GSW A;  5BMI A;  1OQR A;  2VZK D;  4KDL B;  3UF8 A;  2AEH A;  1UH6 A;  3IT6 B;  3FIL A;  3AI5 A;  2BF8 B;  2FCQ A;  2JQR B;  3DVN U;  2QCZ A;  2HDE A;  4YXD B;  4W9C A;  2JVC A;  4HEA 1;  5MPO A;  2ZCC A;  2WWZ A;  3AE8 B;  1KFY B;  3ZJT A;  1ENF A;  2DHZ A;  2WXN A;  3PLU A;  3A9K B;  3IXS A;  4WWN A;  3KUC B;  4TUU A;  1TTN A;  3O13 A;  3Q6B A;  2N7D A;  2KDM A;  3H8H A;  5EDS A;  5J18 A;  4MJS A;  1QOA A;  3H6N A;  1CZP A;  1SGH A;  3VUX A;  1FNW A;  1ZXH A;  3RNG C;  4CQN A;  2GRI A;  1V2Y A;  3V62 A;  2B76 B;  3M3J A;  4IM2 A;  2N9E B;  1XF5 L;  3SR6 A;  1Z2M A;  2KO3 A;  4CHK A;  3I9V 1;  2HJ8 A;  2BTE A;  1HA5 A;  1WSP A;  4EUT A;  5JXV A;  1K52 A;  1YJ1 A;  3ZNG C;  5HKH A;  1SB3 C;  2KAJ A;  1GNU A;  3PPA A;  1P98 A;  1WIA A;  2OJR A;  1VLB A;  2BB5 A;  1JRU A;  3DVN V;  4WUR A;  1E5W A;  2BKR B;  4A3P A;  3PRM B;  4BBN C;  2KN5 A;  2KQ7 A;  4K3C A;  5IA7 A;  2M56 B;  2JPH A;  1EU4 A;  1FRR A;  1WRD B;  4W9I A;  1WZ0 A;  2E3T A;  3CMM B;  3EFU A;  4ZRJ A;  4FJV B;  2K0P A;  3FKY A;  2MBE A;  3DBR B;  4QAY A;  2J0K A;  3APD A;  4J3O D;  4GU2 A;  4XX5 A;  2KYW A;  2KHW B;  1J8C A;  3DVG X;  1T0Y A;  2WHI A;  3TEX A;  4ARC A;  2DNF A;  4L1B A;  4LNN A;  1ZDX A;  3CF6 E;  2BGF A;  4I6N B;  3KW5 B;  4D2K A;  3APF A;  1I4G A;  2ICI A;  3WCQ A;  1TJE A;  5TSS A;  2J7Q B;  2KK8 A;  2FUG 1;  1V1P B;  5C1Z A;  4WQO B;  3KH0 A;  4ZHO A;  3GZN I;  2XBB C;  1Z5S B;  2K3U A;  3L4P A;  2CJN A;  4NAM A;  3NVW A;  4K7S A;  2RDB C;  4N58 A;  4JIO U;  1ZPS A;  2NBW B;  1FMA D;  3DQV A;  1FFV A;  1I4R A;  2WU2 B;  2RD0 A;  2IO0 B;  3P4P B;  3VHT C;  3QHT A;  2V9H A;  1PQS A;  5L83 A;  4E71 A;  4DDI D;  2YEP F;  2M17 A;  3TEW A;  2G4D B;  3QIJ A;  2G45 B;  4MH0 E;  2L52 A;  1NBF C;  4KGT A;  1DGJ A;  3BVG A;  2EKI A;  1WJU A;  5LNK 1;  3E56 A;  4ANV A;  4KZ0 A;  3HK0 A;  2IO2 B;  3HVZ A;  5D94 A;  2VZK B;  5H8Y E;  3AUL A;  2EMS A;  1T5X D;  3BVZ A;  4RGM A;  3MC9 A;  3TJP A;  3Q14 C;  3NY5 A;  3GOE A;  4WAF A;  2I1K A;  4W9H A;  2PJH A;  2B3A A;  2O6V B;  1GOZ A;  4HCP B;  4MGI E;  4JPS A;  3C8Y A;  2PE6 B;  1XLP A;  1UWM A;  3HM3 A; 
#chains in the Genus database with same CATH homology
 4B0M A;  2JX5 A;  1BML C;  3Q8F A;  4KKJ A;  4ZHP A;  1I4X A;  1NVI D;  1NYR A;  1SEB D;  3P1M A;  5FKA C;  2HTM E;  1PYW D;  1I4P A;  1YQ4 B;  4KGR A;  3UI3 A;  5G5G A;  5G5H A;  1OQQ A;  2Y5C A;  1STE A;  5D7G A;  1P7F A;  2DWQ A;  1TS4 A;  2SEB D;  3NVZ A;  4UDU C;  4RH6 A;  1TZO A;  1JCK B;  2W55 A;  1RFK A;  1FNU A;  2DLB A;  2DYM A;  1IBX A;  1CK1 A;  1GB1 A;  1ZXI A;  2IDY A;  4ZYS A;  1SE4 A;  4NZL B;  4AS1 A;  3W5V B;  1AYF A;  1D5X C;  2AQ2 B;  4YSY B;  4A9A A;  1V97 A;  1V1O A;  2LFI A;  3Q8A A;  1YN4 A;  5T8I A;  3KWL A;  3CIR B;  3AED B;  3W1S A;  3MHZ A;  2NTS A;  1FCL A;  1HEZ E;  1I4H A;  2W3R A;  4EE2 A;  2NTT A;  1WRI A;  2DYO A;  2WXQ A;  1PFD A;  3IAS 1;  3NVV A;  2KAC A;  4USA A;  3U2S C;  1YN5 A;  1E0Z A;  2W54 A;  1LO5 D;  3LB8 C;  5E6J A;  2V3N A;  3LXF A;  1KRH A;  1TKY A;  2JYE A;  3AV8 A;  3MP9 A;  1TS5 A;  1KH0 A;  1SSN A;  1HZ5 A;  1WYG A;  2ON8 A;  2W3S A;  2IGH A;  3AE4 B;  1AWD A;  1QQR A;  1NEN B;  3NZ3 A;  4MAC A;  1R7S A;  3HRD D;  2LUM A;  5HFY A;  1RWS A;  1UWX A;  2ZW0 A;  2WQY B;  1XLN A;  1ZUD 2;  1EM7 A;  3VRB B;  2BS2 B;  2INP E;  1TKG A;  4ZOH C;  1JQ4 A;  1JWM D;  3KLS X;  5EE3 A;  4ITK A;  2WXK A;  3SFE B;  1OFF A;  1N62 A;  1KF6 B;  2X38 A;  3AE9 B;  1L4D B;  3FAH A;  4KGS A;  1PGB A;  2JWU A;  3B2G A;  3NS1 A;  3NUH B;  4ZRQ A;  1UNS A;  3ZQ4 A;  4XWW A;  1D5M C;  1FRD A;  1E10 A;  1PUT A;  1YNT E;  4YTN B;  2INN E;  2V0G A;  2LJI A;  1RYJ A;  1J7C A;  2LEK A;  3TEZ A;  2MJ3 A;  4DXG A;  1SJE D;  2K22 A;  2JSV X;  3AEE B;  3AE3 B;  1QKZ A;  1AN8 A;  2PKO A;  3AE2 B;  4TMA B;  2KWD A;  1L0Y B;  3T3O A;  2QEJ C;  2QSD A;  2WNM A;  4R3D A;  4RFB A;  3TUO A;  2WXP A;  3CWI A;  2RDG A;  4A8X C;  1FFU A;  1ET6 A;  5HG2 A;  2BB6 A;  1IGD A;  1L0V B;  3AEG B;  4DQO C;  1ESF A;  2JZP A;  1V1P A;  3FC4 A;  3E9S A;  1XCT L;  2Y5P A;  2QIE B;  1SF0 A;  4WWM A;  1QF6 A;  2XNA C;  2MH7 A;  1HQR D;  2QMT A;  4N6E B;  1K51 A;  5HI1 A;  1JWS D;  3Q69 A;  2EEL A;  3URY A;  1NYQ A;  1V8C A;  1CQV A;  3PZ8 A;  1ET9 A;  3BYY B;  3DWM A;  4L23 A;  1D5Z C;  4ARI A;  4YWG G;  1VZ6 A;  2ZW1 A;  1JAL A;  4MH8 A;  4TQ1 A;  1P7E A;  2Z8L A;  1N61 A;  2BS3 B;  2L1A A;  4OZC A;  2I2Y A;  1M4V A;  1QT9 A;  1XO3 A;  1YQ3 B;  1Y56 A;  3B9J A;  4C7Z A;  1T3Q A;  1HXY D;  3HUI A;  3P4R B;  4YTP B;  1XXG A;  1WGK A;  3SFD B;  2WXL A;  1I4Q A;  3P63 A;  2BYT A;  2KQ4 X;  2AX5 A;  3KWV A;  4WIP A;  1VRA B;  4RCO A;  3LYY A;  3VR9 B;  2IPK D;  5D3D A;  2H89 B;  1RM6 C;  4M0W A;  3Q8E A;  3AEC B;  3MC0 B;  3BII D;  1GB4 A;  4H2A A;  1FIQ A;  1L0X B;  2WXJ A;  4TSS A;  3AE1 B;  3AEF B;  5C2T B;  4HRO A;  1DOY A;  2V4I B;  4O1N A;  1PGX A;  3U7Z A;  5EE0 A;  2Q5W D;  4YT0 B;  1JWA D;  3Q8C A;  1MPE A;  2JXT A;  3AE5 B;  1YJJ A;  2N0S B;  3R8B A;  4OW0 A;  3TEY A;  2LHE A;  1B9R A;  1ROE A;  1TYG B;  4DXF A;  3GP7 A;  4RNA A;  4WQM A;  5AUI A;  1AW7 A;  1Q10 A;  3EA6 A;  4IKG A;  4US8 A;  5BMG A;  4WH4 A;  1UGJ A;  1SJH D;  1EWY C;  3BVM A;  4XDD A;  3RPF C;  1SIJ A;  5C3J B;  4FXC A;  2RPV A;  2RDH A;  2OHF A;  3ABV B;  1GAQ B;  1T6B X;  4GLS C;  2BT6 A;  2MJE A;  2KMM A;  3N9Y C;  1JRO A;  2R61 A;  4XWT A;  1FNV A;  2LMC A;  4ZRP A;  2G1E A;  2RMM A;  2PIA A;  1C4C A;  1IBX B;  1QOB A;  3AE7 B;  1E6E B;  4RGO S;  4RF1 A;  2BS4 B;  1NEK B;  4KKI A;  2PTL A;  4IDI A;  1JW9 D;  2KN4 A;  3Q8B A;  2M19 A;  5BMI A;  1FM0 D;  1OQR A;  1SXT A;  1DYQ A;  2AQ1 B;  2VZK D;  2Y3A A;  4C80 A;  4XDC A;  1BXT A;  3AN1 A;  3EGR A;  3IT6 B;  3FIL A;  1EU3 A;  1VR9 A;  4MT5 A;  2WU5 B;  1FD6 A;  1KLU D;  4A6Q A;  2JQR B;  2HDE A;  4YXD B;  3AEA B;  2PVG C;  2QIL A;  4HEA 1;  5MPO A;  3IAM 1;  3AE8 B;  1DOI A;  1PDX A;  1KFY B;  2H88 B;  5BMH A;  3MFG A;  3ZJT A;  1ENF A;  1QLB B;  2E6X A;  2WXN A;  3AH7 A;  3NVY A;  3BZD B;  3GB1 A;  3IXS A;  3V3X A;  1TKE A;  1FXA A;  1I7H A;  1QOG A;  2PLP A;  3O13 A;  4REZ A;  2KDM A;  3H8H A;  2BBC A;  2W82 A;  3ZJU A;  3ZYY X;  1QOA A;  1CZP A;  1C77 A;  1J7A A;  3FIL B;  1FNW A;  2CJO A;  1SBB B;  1ZXH A;  3SEB A;  2J53 A;  3PO0 A;  1DOX A;  2SAK A;  4CQN A;  2GRI A;  5FK9 C;  2B76 B;  4MM3 B;  1VJK A;  3AB5 A;  2AQ3 B;  5GXG B;  1XF5 L;  1ZP0 B;  3SR6 A;  3B2F A;  1L4Z B;  4US9 A;  3I9V 1;  2BTE A;  1HA5 A;  1WSP A;  2WXR A;  3AM9 A;  5BYR A;  5JXV A;  1K52 A;  2XN9 C;  1C4P A;  4JE3 B;  1XEE A;  3VQI A;  1SB3 C;  2KAJ A;  2WP9 B;  2WXF A;  4HJG E;  4P16 A;  2LGI A;  1C78 A;  1KLG D;  1E7P B;  2JYT A;  2YEP B;  2K9X A;  3BYT B;  1N63 A;  4RGT A;  1VLB A;  1N5W A;  2BB5 A;  3R2I A;  4WUR A;  3EUB 2;  1CJE A;  1QOF A;  1C4A A;  1FEH A;  1JML A;  1YJI A;  2WDR B;  3R2T A;  4TQ0 A;  1XCQ L;  4IOI E;  4OZB A;  1SE3 A;  1VDV A;  1D4B A;  2M56 B;  2N9K A;  3VR8 B;  1EU4 A;  2WLB A;  2LHD A;  1FRR A;  1JWU D;  5EE1 A;  3T3N A;  3AE6 B;  1ZE3 D;  2WDV B;  4LTU A;  1BUI C;  1ZDV A;  2E3T A;  1GPX A;  3DWG C;  3MJ5 A;  4OHJ A;  1WWT A;  2K0P A;  4J3O D;  3IT4 B;  2PW9 A;  1L6V A;  4C7Y A;  2N9L A;  3TEX A;  1K53 A;  4ARC A;  1HZ6 A;  4JX1 C;  3P4S B;  1FO4 A;  2J4X A;  2G9H D;  1K50 A;  4L1B A;  2TSS A;  5BYS A;  1YMH E;  4GDL B;  1ZDX A;  3AMZ A;  1F77 A;  1KTK A;  1C79 A;  3I57 A;  2WXG A;  1WXQ A;  4D2K A;  3U52 E;  1XLO A;  2J42 A;  1I4G A;  2ICI A;  1NI3 A;  1XLQ A;  3WCQ A;  4GDK B;  3ETR A;  5HHD G;  2L83 A;  4NAW B;  1TJE A;  4AQ7 A;  2FBW B;  4JWS C;  3PZ7 A;  4OZA A;  5TSS A;  4NJC A;  2NMQ A;  4HKQ A;  3NRZ A;  1UUP A;  1C76 A;  1MVK A;  1V1P B;  2FUG 1;  2JU6 X;  4Q2J A;  4XE0 A;  1TY0 A;  1FCC C;  5AUK A;  4HRS A;  4ZHO A;  3ZJV A;  2GB1 A;  5FR3 A;  4HKZ E;  4YSZ B;  2WS3 B;  2MJD A;  1E9M A;  2QJL A;  2K3U A;  3L4P A;  2N7J A;  5BYQ A;  2CJN A;  2IGD A;  4NAM A;  2PVO D;  3NVW A;  5D3I B;  1N5X A;  4N58 A;  4N59 A;  3W2D A;  2WDQ B;  2ONQ A;  1ZPS A;  2FE8 A;  1FMA D;  2IGG A;  1IGC A;  2OED A;  1FFV A;  1I4R A;  2ACZ B;  2WU2 B;  1C9F A;  1EWC A;  3P4P B;  3BK2 A;  1F2R I;  1N60 A;  1PGA A;  3VRA B;  4A55 A;  1ZOY B;  1YN3 A;  5EE9 A;  2YEP F;  2PMV A;  2DBY A;  1JWB D;  3ZGZ A;  1MI0 A;  1MHX A;  3TEW A;  3BK1 A;  4L2Y A;  2L52 A;  3OWE B;  3V05 A;  3W9C B;  4KGT A;  1DGJ A;  3BVG A;  1MHH E;  4LK0 M;  2EKI A;  3RFZ B;  4P6V F;  1JRP A;  4KX6 B;  1A70 A;  2V3P A;  3P42 A;  5LNK 1;  3E56 A;  3HVD A;  2J52 A;  2CU3 A;  3W5U B;  5I4D A;  4RF0 A;  1TY2 A;  1L6U A;  2WXH A;  3HVZ A;  2VZK B;  2WXI A;  5H8Y E;  2GI9 A;  4B0E A;  2IJ0 A;  4C56 C;  1T5X D;  3BVZ A;  1D6E C;  1ACC A;  1B1Z A;  3U4E G;  4RGN A;  4RGM A;  3KQ4 A;  2D5G A;  2I38 A;  4OVZ A;  1VZ7 A;  2M0A A;  5H92 C;  1F2R C;  3P4Q B;  4WAF A;  4PT5 A;  1TS2 A;  2BW2 A;  2WXO A;  4YSX B;  3TSS A;  3GS2 A;  3J9C A;  1TS3 A;  2L32 A;  1F0Z A;  1FXI A;  2K5P A;  2WXM A;  1IUE A;  4LLG M;  3AEB B;  1QIL A;  1J7B A;  1GOZ A;  4YTM B;  4JWU C;  4JPS A;  3C8Y A;  3BWU D;  1XLP A;  1L5P A;  4A90 A;  2MEK A;  1UWM A;  1VZ8 A;  1SE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...