3R2TA

2.2 angstrom resolution crystal structure of superantigen-like protein from staphylococcus aureus subsp. aureus nctc 8325.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
195
structure length
195
Chain Sequence
NRLYDTNKLHQYYSGPSYELTNVSGQSQGYYDSNVLLFNQQNQKFQVFLLGKDENKYKEKTHGLDVFAVPELVDLDGRIFSVSGVTKKNVKSIFESLRTPNLLVKKIDDKDGFSIDEFFFIQKEEVSLKELDFKIRKLLIKKYKLYEGSADKGRIVINMKDENKYEIDLSDKLDFERMADVINSEQIKNIEVNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.2 Angstrom Resolution Crystal Structure of Superantigen-like Protein from Staphylococcus aureus subsp. aureus NCTC 8325.
rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 56
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r2tA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3r2tA01
2R61A 1TS5A 2XNAC 2TSSA 4TSSA 4NZLB 2XN9C 1BXTA 1SJHD 3R2IA 3W2DA 1BCPB 1S5DD 4RFBA 1I4PA 1LLRD 3URYA 3V05A 2NTTA 1LTBD 1FGBD 1I4HA 1LT3D 1FNVA 1B1ZA 5D3DA 3EA6A 1LTRD 1RCVD 4RHRA 1BCPD 1CK1A 3BYTB 1LTTD 1EU4A 1JWMD 1PTOF 3MC0B 4ZYSA 1JQYD 5ELDA 5ELFA 4RGMA 1S5CD 4RCOA 1TS3A 1BCPC 2QILA 1DJRD 1I4XA 1EEID 1PTOH 1G8ZD 1L0XB 4RGOS 4RH6A 1XXGA 3GP7A 1PRTD 1YN3A 4L63B 1CHPD 1RF2D 2SEBD 1XTCD 1SE2A 5ELCA 1CT1D 1UNSA 4RHSA 1HA5A 4RGNA 1PRTF 1M4VA 1LT5D 3BVMA 1L0YB 1F77A 1PTOB 2G9HD 1PRTB 1ET6A 1S5FD 4C56C 1EWCA 1T5XD 1LTAD 4OHJA 4K6LA 3OWEB 1SJED 1PZID 1LTID 1TY2A 2ICIA 1HQRD 1PTOD 1V1PB 2QEJC 1ET9A 2RDHA 2XRQD 1BCPF 5ELBA 5FK9C 5FKAC 1CHQD 2NTSA 3O13A 1PYWD 4RGTA 2IPKD 1S5ED 1I4RA 4DXGA 1TS2A 4UDUC 3DWQA 1RD9D 1SBBB 1TY0A 1LO5D 2AQ3B 3BYYB 5TSSA 4DXFA 4L6TB 3MFGA 1TS4A 3BVZA 1GOZA 1LTSD 2XRSD 3BVGA 1AW7A 1YN5A 2AQ1B 1RDPD 1LTGD 1LT4D 4BWGB 2AQ2B 1JWUD 1SEBD 1PZJD 1SXTA 3KLSX 5I4DA 2RDGA 1EU3A 1SE3A 3R2TA 1EFID 1FD7D 1I4GA 3BZDB 1JCKB 1D5MC 1KLUD 2CHBD 3DWPA 1ENFA 1STEA 1D5ZC 1MD2D 4Z9CB 1UUPA 1ESFA 1KLGD 1YN4A 1S5BD 1FNUA 1V1PA 2WV6D 1KTKA 2IJ0A 4O1NA 1AN8A 5D3IB 1D5XC 1D6EC 1DYQA 3TSSA 1EEFD 1HXYD 1I4QA 3R8BA 1PZKD 2Z8LA 1V1OA 2J4XA 3EFXD 1PRTC 1PTOC 1SE4A 1JR0D 3CHBD 1B44D 1CQVA 1QILA 3SEBA 1JWSD 5ELEA 2O2LD 1HTLD 1FNWA 3DWAA 1LT6D
chains in the Genus database with same CATH superfamily
2GBJA 1LM8B 3V2TA 3WANA 4A3EH 4DV1L 3VA5A 4OVVA 1QB5D 3W3AA 2HE7A 3EN2A 4C2MB 3ER0A 2BQQA 3QQ8B 4RFBA 1L6UA 3S1QH 3I4NB 4GNXA 2L0CA 3L17A 1WIAA 4NAMA 3MVVA 1V86A 2AX5A 4G3XB 5JPMC 3A0JA 3I5JC 3VH3B 1N32L 2WXIA 3DVNU 3BYTB 1XQQA 1JWMD 5KHQA 2PVGC 4DN4M 3TN2A 5LMNL 5LMUQ 1Y1WG 4YWGG 3MFYA 3ZRFA 2KJHB 4FNFA 3Q3OC 2QA4A 2NUCA 3WOEA 1GUTA 4QL5A 2BE5C 3CCMA 2D07B 2IGHA 4IPHA 4HDQA 1YN3A 2EYLA 1IUEA 1UNSA 2PVOD 1OEYA 3A8IE 2OTJA 2RGFA 4BBRG 5A2QE 2HIVA 4C3JB 2GA4B 5AJ3Q 2ASBA 5C4XH 3MEHA 4ACFA 2TMPA 2LXCA 4A3LH 3D32A 5G2NA 2DYOA 3AEDB 1B9RA 2MFIA 3OG5A 4CQNA 1HR0W 1HZ5A 5CORA 2UUCQ 2UUBQ 3AE9B 2L15A 2L55A 3AULA 1B9MA 3PV0A 1N8RC 3DBSA 4IJLA 3ZUNA 1Y1VH 2NTSA 1PYSB 4JCVE 2IWHA 1Q7YC 4Q2JA 3H09A 3K7AB 3MP9A 1SNPA 3W5VB 2IY1B 3AE7B 4JPSA 1QQRA 3J7ZC 2F0UA 2M0AA 3OAWA 3DHIC 2XRSD 2F0EA 4BA2I 4K3BA 1EOVA 3KUPA 3TEXA 4HAEA 4CDEC 1S4ZA 2NVTB 4XYCA 3ZDTA 4MTNA 1SNMA 3A8JE 3Q8AA 3E9IA 4RAUC 1VZ7A 2LHEA 3TS2A 2L7RA 4X3TA 3TIXA 2NVUI 1I3QB 4N58A 1AYFA 4KZCA 5CV4A 3NTHA 3K7UC 1VMPA 3ML9A 1IBXA 2MJEA 1YNTE 5HHDG 4P73A 4JV5Q 2FCSA 4P7IA 2RR9A 1IGCA 1VQEA 1L7YA 4MGKE 4AQYQ 2R7ZG 1V1OA 1STNA 4IUUA 2EY6A 1IL2A 3S15H 1U4PA 3QOJA 3VFKA 4ZRQA 2JA6B 1VQNA 2MO0A 1EZ6A 1YHQA 1JR0D 4KDIC 1QILA 3CCJA 3S1RH 5HKHA 2UUAQ 4OZBA 4RWSC 4GN4B 3K0XA 4EUTA 5IGDA 5C5LA 4LFAQ 5IOCA 3BS1A 5D6JB 2SDFA 4EZLA 4OVUA 2QCZA 5BR8Q 4HKZE 2KECA 1QOGA 1E2ZA 1TXYA 1J7CA 4L8JA 2A68C 4AQ7A 4F7ZA 1E7UA 3ZJUA 1MBYA 2PE6B 1BXTA 1TWHH 4WAAA 2I5LX 2CH4W 2FE8A 1I4PA 1L4DB 2C7MB 2QGQA 2XGTA 3VR2A 5C0XH 5CHWA 3ZTCA 1LT3D 4XDXA 3Q24A 1ILPA 4NPNA 2N8NA 2F0PA 1Q10A 2WLBA 1V9JA 1EU4A 5D7GA 1KQSA 1YHBA 2K5QA 4YT0B 1YNJC 1GUOA 1ICFB 3NK9A 4C1NK 1J9OA 2VY3A 1TS3A 5KIXA 3WALA 3PS6A 2BE5D 2D3BA 3TJPA 2QILA 2K8HA 2ZTCA 4DNTB 1EQTA 1XMQQ 3X23A 3EGRA 2K5HA 4C3HB 1EEID 4F1SA 1LGRA 2EKEC 3BG3A 2KYWA 1ONLA 4HEA1 5JEAJ 4DAPA 1YX5B 3GD7A 4C4VA 2I38A 4BKSD 3TMEA 1NBFC 4IM0A 1Y8NB 5K5PA 5LMNW 3BIID 3PF5A 3H94A 3L13A 2F3VA 2L0FA 2E3TA 1Q1EA 1E7ZA 5FR6A 3HOUH 1HH2P 5JJIA 1L4ZB 1RHPA 3AXCA 3ZQ4A 2Q2IA 3M63B 2PZTA 3I4OA 5G3LF 4JI2Q 4CDDC 1HNXQ 1YQ3B 2WACA 3ND8A 4HEDA 1YZ6A 3OWFA 3B2GA 3G7LA 4IFDI 1IZ6A 1NY4A 2B2WC 3AEVA 4PS7A 1OFFA 4KHZA 1XPOA 5M5XB 3K6OA 4HVBA 4HKQA 2PPHA 4N9F4 2KWDA 1WXQA 1H95A 3RCZA 4GN5A 3ZO5B 2KJXA 2HHHL 2JUOA 4JOIA 1J7BA 1FRDA 1WX9A 2JZ3B 3JC66 4G7ZC 4MM3A 2F1MA 1VQ6A 4WAFA 3MJWA 4TVAB 1EYCA 2PYKA 4ASWC 4EQ5A 2GRIA 5KNCA 1DGJA 4J3OD 4WWOA 4A3KG 2JWUA 3IAM1 4HJ7A 4NJCA 3T16A 3VR6A 1I6HH 1I5FA 1JALA 1T6BX 1HJPA 2KQ4X 1D3ZA 5IAAC 3A56A 3A1QA 2NZ1D 2LXJA 3ITPA 5EE0A 4P74A 4HJAA 2IGGA 3VRAB 4DHZB 3OPOA 3R3OA 3E6ZX 1ENFA 3QWNA 1JROA 1U5KA 3KWLA 4P1CC 2LGSA 2R7ZH 2IJ0A 1Y8RC 1D6EC 4FVMA 4CO7A 3KF6A 4K8IA 3AV8A 4JI5Q 1N32Q 2YVCA 3RUIB 3RLNA 2OEOA 2D0OA 4TUUA 4DKAC 1WFYA 4DDID 5IGGA 4OO1G 3PO0A 3TP6A 4LMQD 5EJWA 3ULLA 1PH9A 4DV3L 3S2DB 5M3MG 1X55A 1K0RA 2LASA 4DUZQ 2ZTEA 2PW7A 3TRZA 1WX8A 2E75C 2VW9A 1HZ6A 3TUOA 1JQ4A 2LI5A 3QOLA 5JEAH 3AEGB 3MJ5A 1FNWA 4LF6L 5H92C 4LCDE 3IL8A 1G51A 4YTMB 2JA5H 5EAYA 1WRIA 2K28A 1J6QA 1UE1A 2XNAC 4JI5L 5DM73 1Q5WB 1K3RA 2FIDA 2KLCA 3C19A 2MP2B 3ZJTA 3BY4B 3PIO3 3VHTC 4ZCKA 4WQOB 3R2IA 2G45B 1N9WA 1SNQA 1C79A 1B9NA 3D0FA 4A93H 1EZ8A 2WXFA 1WMHB 2NBWB 3LGJA 2CJNA 1V8CA 2SOBA 2Z9HA 2UUCL 2M8SA 2NN6H 3CW2C 1IBLL 4HCPB 4CHKA 3U2SC 1TR5A 1UAPA 3MC0B 3HOXB 4M8NA 2BA1A 1EY8A 5ELFA 1NE3A 3WOFA 1WD0A 2L52A 3PPAA 1GJXA 3U4VA 3H0GB 1VQPA 1XNRQ 4ZUJA 3HOVG 3AH7A 4E3CA 4DGZA 3VR5A 5CR3A 4YSYB 1SSNA 4BOSC 3DPDA 3M4QA 4OX9Q 4HXDA 5H1SE 1BR9A 4RGOS 2HJ8A 3PO3H 4A3BB 3DBLI 2OCEA 4AYBB 1XTDA 4I65A 2RHSB 4DV1Q 1OQYA 2A73B 2K9XA 5IYBH 1E8YA 3H0GH 2SEBD 1ZPSA 3PIP3 1EM7A 1N34L 2WP9B 2XK5B 4OL7A 2R92G 1QNKA 1L0YB 2UXDQ 2G9HD 4KN7C 3C3LA 1IYJB 1ET6A 2H5XA 1YBYA 3Q8DA 5FLMH 4DV2Q 2MSED 2RPVA 3SFEB 3RN2A 5IP4D 2O6VD 1JJCB 1DM0B 4FF3A 2W54A 3OW7A 4DHJD 2A68D 3FKYA 2QDBA 3I91A 4K6DA 4CJ1B 4W9JA 1IGDA 1BCPF 3VYRA 5FK9C 5FKAC 3LXFA 2O6VA 3WAMA 4ALPA 1YITA 2UYZB 4BY1H 3S2HB 4ILWA 2NBUA 4I7ZC 2MGSA 4KVGB 1K51A 4KKJA 2MWSB 5HURA 2OJWA 5CV5A 4OEMB 1OGWA 4HPMB 5C4JB 3RNUA 1Y1WB 5HY6A 4EX5A 4GS3A 1PFSA 3MXPA 3AEAB 1MSHA 3UDFA 1XEEA 1KHIA 1UEBA 4ZRIA 2KDFB 2MRPA 4KMUC 4KJNA 4IOAA 4PS3A 3HVDA 5J17A 3M4OH 3K8AA 4LW1A 2WAQE 1NYQA 3HM3A 4GDLB 1Y8OB 5AEKB 5E1FA 1NMGA 2AUJD 1XLOA 2KK8A 1X1MA 1I94L 4NQKE 5AZFA 1IP9A 3PGZA 4J15A 1E5WA 2N7JA 3P4RB 1CKMA 1QVCA 1UBIA 2ONQA 2PTLA 3DM3A 5I2YA 2KJ6A 3HOWH 2FJ2A 1DOYA 1KAWA 1X6OA 5D3IB 4YWMA 2D10A 1VQ4A 3IAS1 2J7QB 1ZXHA 2K7VA 3UE1A 3GTLB 4QB4A 5EPKA 2NR2A 1XCTL 4ZHPA 1XWEA 4ME5A 4LUZA 4IDIA 3CRLC 1C1YB 1QZEA 3KDFA 3QG1A 1BUIC 1P1AA 1VQ7A 2JU6X 2NN6G 1NEKB 2SAKA 4FLHA 3K80C 3AYHB 1HPCA 1B3AA 2LHDA 1NI2A 3P42A 4A93B 3DMUA 4OWTB 3S16H 2G4SA 5IWAL 1W2BA 5CV7A 1MHWC 3AU4A 1XMOQ 5LNK1 4G57A 5IP7H 1UGJA 3J80c 2I5MX 4QIWE 1NR2A 4UPAA 3S1NB 4XZ4A 1RM6C 4R1JA 4W9HA 1C9FA 3HVZA 2C9WB 5HI1A 4OVZA 3ZNID 1WXVA 1V81A 3Q8FA 1RJTA 1IW7D 2VB2X 2ES2A 3KOJA 5JEAG 2A74C 3K5OA 3M4PA 4ANXA 2KQ3A 4KZ0A 3BDOA 4A3EB 1DD2A 4CYEA 3T8MA 3A7AB 3NVZA 4YWLA 1M90C 2RF4A 1S5CD 1TQOA 3TS0A 3QIJA 1JOOA 2K1BA 1K83B 3TZUA 1DJRD 1I4XA 4ZLTF 4DAYB 1Y8PB 2L9HA 2CJOA 1X3PA 1MHHE 3CC7A 2O5JC 5J39A 1WYDA 1XXGA 5KGUA 1EQQA 1MIUA 5C44H 2DGYA 4IFDJ 4Y52H 2W9NA 4UHVA 1B70B 2F3IA 1PRTD 4OZCA 1PFDA 3WA0A 5DAUA 1H9KA 1SE2A 3OYYA 2ZM6L 2F52A 3JVZX 2JK8A 1YJ1A 3ZGZA 2N1WA 2X6LA 4B9WA 1QOFA 4AS1A 3J80L 1YJNA 3RNEC 3F2UA 3KJPA 2DENB 2FUG1 2ZVNA 2FINB 4USAA 3N9YC 2NVQH 3DOWA 3RT3B 2GB1A 1V1PB 1L1OB 4A3DH 2MW5A 2Y5BB 4G7HC 3J9CA 3J7AF 1J19A 4BS9A 5BN4A 1WXSA 2MUYA 2M19A 2PI2A 1UF0A 4LAAA 1TS2A 1AEXA 5C2TB 2NVXH 1TY0A 5M5WB 4U673 4K2LA 2ENBA 3NBIA 5EE3A 1E0ZA 1NR4A 4L5QA 4JLCA 4JE3B 3GQBA 1WE6A 1Z47A 4ZQ3A 1ZOYB 1O80A 4QMGA 3NVWA 1TBEA 2PZUA 2Y0SB 2AL3A 3VRBB 4BBNF 3E5SA 3V96A 1TVXA 1WOCA 4KTAA 4QY7A 1SF0A 5CC4A 5DPTA 4HJKA 4H0LC 1MKHA 5EBDA 4IO9A 4P6VF 3NS1A 1FYCA 2HCIA 1Q3LA 1W6JA 4A3MG 4Z9CB 1VQGA 1S5BD 2WXOA 2V4IB 2NBFA 3HGBA 1TIFA 3J81j 4X66L 5M9OA 4BKTA 5K36H 3C46A 1JB7A 1MPEA 2INNE 4NJ6A 2R93G 3NP8A 4WWPA 1VD2A 4FXDA 4GNXC 2RPQA 1EQVA 4BXXG 2XK5A 1CI3M 1STAA 3LNNA 3M3YH 5GMVA 2IO1B 4HIMA 5E4XA 4HK2A 4XIGS 3SVMA 3CPWA 1H4RA 3RNBC 2O2VA 4ICUA 3DWAA 3SGIA 3N20C 4DA2A 3NG0A 2RDFA 5C23A 1G6JA 4KHVA 4X66Q 1T0YA 1V1QA 3OJ4B 2L5TA 1B4OA 1E0BA 4TSSA 4JI7Q 4NZLB 4A90A 1FR3A 1MJEA 3VH4B 2GVBA 3Q69A 3EVQA 2NCNA 2JA8G 1K83H 3V05A 4L5RC 1GG3A 3WIMA 4FULA 1B1ZA 1VZ8A 3QHTA 5AUKA 1F9PA 2BA0A 2OQ0A 1RCVD 5EKIA 4OW0A 2BYTA 1TJEA 2R93B 1L5PA 1WMHA 4MH8A 3NVYA 4ZYSA 4AWJA 2KWVB 5D2MB 1JJ2A 4LF9L 4YL8A 2DZIA 2M4NA 3GZNI 5G3LD 3U30A 1TTNA 1KABA 1B8AA 3MXNA 2F0FA 1P8LA 4JBJA 2HDLA 5T1GA 3ZIMA 4QCLA 3T3NA 4DR5Q 2VS1A 1J8CA 3H91A 3MTNB 2RSOA 3J7YW 1HA5A 1XX8A 4RGNA 4IOCA 2UU9L 3MHSD 2DYMA 3AEFB 4HLEA 2CHZA 2DNCA 3D4WA 2A6HD 2C35B 1MSGA 3DEPA 1E22A 4IPGA 4K6LA 1EIHA 4X65L 2EELA 1SJED 2VQFQ 4DR4L 2PJHA 5C1ZA 2VQEQ 1P3QU 1ET9A 2EMSA 4DUYQ 1SYGA 2M0XA 2BYFA 1G2TA 1KXLA 4DV0L 2W55A 1TZ1A 1GJZA 2XWJB 4KI0A 1WI0A 3N6RA 4MTKA 2KVZA 3DWQA 4W9IA 2F0IA 3RR5A 2KCCA 2L32A 2EY5A 4KGTA 2N49A 5D65A 1YNND 1HR0L 5T8IA 4MT5A 1MJCA 1X9NA 4EKUA 1U4RA 1OQQA 1XNQL 4FBJB 5JHAA 3HOYH 1IW7C 3W1BA 1SEBD 3EJIA 4A3BG 2MQJA 2GBMA 3NRZA 4LF8L 4ZOHC 1MI0A 3NOBA 3KF8B 3SDLC 4E74A 4HWIB 4ZKBB 4H44C 2E6XA 1A5RA 4FYDA 3GTPB 2IX0A 2WB1B 3N30A 1HTPA 4DQOC 3JSVB 4BBSH 1E90A 2IO3B 1PYBA 1A0IA 1L1OC 1NENB 1D5XC 2Q8IB 5KYIA 2XEWA 3ZYYX 1F2LA 4CKEA 2NVYB 5I2XA 1AP0A 1PGAA 4KIKB 4RF1A 3HK0A 3EQLC 4KD3A 4DR7Q 2K05A 2A1AA 4A3CH 4DHJB 1VQDA 1KDAA 5C5MA 1H9RA 3BZKA 4J8QA 1CQVA 1KL9A 3QA8A 2UU7A 4ANWA 1EL0A 4JBMA 1P16A 1VF5C 1YX6B 2BT6A 5CYUA 1X54A 4R4TA 3A5UA 3Q14C 1CM9A 2MEKA 1SLJA 2Q2UA 4GKKL 2HQEA 4HSVA 3ABVB 3A1QB 3V3XA 1WVLA 2R93H 4RMFA 2VL6A 3UI3A 1L1OA 3S1RB 4EQNA 3KYHC 3VUWA 2HD5B 1ESRA 1LLRD 3DUZA 2KDBA 4DDGD 1C4CA 4K1RB 1EY9A 2EYMA 5TR5A 1FXAA 2INDC 2KAJA 3SK6A 4MEMA 3W5OA 1YHAA 3HOZH 3KF6B 1IBLQ 3JAML 3EC8A 4X65Q 5GXGB 1PFNA 2OF1A 3OOCA 1K52A 4KY5A 4X3KA 2JP1A 1W3SA 4MIUA 2Z4HA 4H2AA 4K0KL 1BCPC 4NY0A 2EMTA 4TV3A 5LLIA 1C4AA 3L0OA 4LJPB 5JH5C 3WAOA 3AEEB 2HD3A 2B2WA 3Q3MC 3DBRI 5C4XB 2CFMA 4RH6A 3RUZA 4DAYA 1S72A 1V97A 1E24A 5CV8A 4DR2Q 2WHIA 3I9V1 1I42A 4MNOA 4A3FH 4EQPA 3KJOA 3VTUA 4LF5Q 2PW5A 3ZNZB 1XTCD 5EGTA 1KJTA 1F2RI 2GI9A 4AQYL 2CHWA 4L23A 3OLMD 1SIJA 5AZGA 4LF4L 1UE6A 2RDBC 4K0KQ 1S5FD 5IP9G 3T56B 1RL2A 3PO3B 3QIAA 4ZUIA 2M17A 3QX1A 1BF4A 2UUAL 2E74C 2EY1A 2CCZA 4A3FB 2LSSA 2IHEA 1G2SA 3GV3A 1HQRD 1WJ6A 2GVAA 5CX3A 4X62L 2KTFA 2QSDA 3KH0A 3P4SB 3O13A 4F8MA 4HCEA 4POFA 1CA5A 2W3SA 2WDVB 5A35A 4RGTA 3D31A 2O6VB 2X38A 3VDYA 3FKIH 3ZNGC 2Q2TA 2EYFA 5I9PA 1F2YA 1DONA 1VQKA 1GC7A 2ZNVB 2LEKA 5C3JB 4V0BA 4JVZA 1E1TA 2MHVA 4ZRKA 4L6TB 2DUDA 3MFGA 3QB3A 4RG1A 2KHSA 1YQ4B 3L7ZC 3E9HA 4KHPL 1RYJA 3BVGA 4IKGA 2VH1A 2WINB 2ZCBA 1NTGA 4KKIA 3I8ZA 2IX1A 1N5WA 1C3TA 1WGKA 2KQ7A 1Z9FA 1KRTA 1PH7A 3BINA 1DOKA 1N6ZA 4CJ2C 2N4FA 3S9WA 3KUDB 3P4PB 3HFZB 2LJ5A 3M7GA 2JY6A 4DR6L 3AE3B 3S15B 4GLVB 1VZ6A 1JWBD 2Z6BA 2Z4IA 2VQFL 3FMCA 1MHXA 2PE9A 2WP8J 4B3TQ 1QOHA 1CUKA 1R4MI 1VLBA 3IFWB 4C3IG 3TSSA 4JBWA 3DQVA 3HKZB 3L16A 4NAWA 1QT9A 5LXHA 1QZHA 2K33A 2ZVOA 5IE8A 5AJ3L 1TWGH 1EY6A 4IUQA 1F1HA 2PW9A 3NY5A 3EHVA 1O78A 3EFXD 4KY7A 2Y0SG 1ZXIA 3Q3JA 2IZVB 4FN2A 2LVOA 3RMKC 1X65A 2V3PA 3O65B 5DPRA 1QUQA 1TWFH 3E0JA 4JI2L 1UE5A 1EQRA 2F0KA 4B3SQ 2CKHB 1PH8A 4BBNC 3N32A 1HNWL 3CMAA 4KX6B 4JYAL 2BGFA 4WORA 4DV7L 1Y1VG 2O2LD 3TEYA 2FMMA 1XNQQ 1UWMA 3EFUA 2K5VA 3WWVA 2MX2A 2OQKA 3AQQA 1ZP0B 1SRUA 1V2YA 4BY7G 2Z0DB 1LFDA 2KJRA 1TWFB 2H88B 1N36Q 2KOXA 4FXGC 2K5DA 1NBWA 2PNHA 2ZW0A 4ARIA 3F2DA 4HPLB 3V6EB 1OXUA 3FPPA 4A9AA 3IFTA 4JI0Q 2C5LC 2DX5B 2JXXA 3B9JA 4PV1C 1LXDA 2FCQA 2JQRB 4JYAQ 3UDXA 5C4HA 4IUTA 4B9XA 4RHRA 4DR4Q 4QQBX 1BCPD 4JI8Q 3I72A 2QJLA 2HTHA 3A9JB 2WXMA 1RTNA 3RNCC 5HGTA 1EO6A 3STBD 4B0MA 4JIOU 1SNOA 2EXDA 2QW7A 3GTJH 3SDZA 1QNUA 1RTOA 2LJIA 3VTVA 5M5YB 4TQ0A 1OXVA 3M85A 1TKEA 3GE3C 2EYHA 1A62A 5M3FG 4YSZB 3KF8A 3RZDH 1FPYA 2D2CC 4WJWA 3N52A 3I4MB 4BY1G 5M5XH 5M3FH 3G6EA 3NTKA 3W1GA 1UWVA 1RFAA 2IGDA 2R3ZA 1CQFA 5GROA 1PRTB 1TWCH 4JBKA 2D2QA 2N7EA 5C0XJ 2V3NA 1F52A 3KW5B 1V5OA 1P7EA 1FJGQ 3AE6B 4KIKA 1SFOH 5MPOA 3OWEB 3UF8A 3UQBA 3I2ZA 3RN5A 5EPLA 3N1XC 5BYRA 4FP5D 3OSOA 3OHXC 5IT9L 4I6NB 1VQFA 2UUBL 1PYWD 4FF2A 5C3EH 4EZKA 1H9JA 1I6HB 5COYA 4R3DA 3E0EA 4B3TL 3M7NA 3CXCA 3IRBA 1FCCC 2L83A 4GMVA 1C4PA 3M4OB 2SNMA 3T1YQ 3NBHA 4X6AH 2WKDA 1G91A 3TEZA 1F2ZA 3GTQH 1GC6A 1OO9B 5JAVA 3Q22A 2KN5A 1FGUA 2VRRB 3RD2A 3RMHA 2DJGC 3PO3G 2ZEQA 4LFCL 1WTHA 1HFGA 3GDEA 3RNGC 4F88A 2EQSA 2AQ1B 3A55A 1E7VA 4FF1A 3KBXA 2VZAA 3ULPA 2R7ZB 1OXTA 2DYBA 3HRZC 1SYEA 5LL6X 1EY7A 4UP7A 4HCNB 1IBML 4P16A 4N8X1 1CMXB 3PVLA 2D5GA 3S14H 2BB5A 3K58A 1TGZB 1DZ1A 5FO9B 4X64Q 3ONAB 4AJWA 4IPCA 1WI5A 2K6QA 5E6JA 2K1FA 4OWWB 3PCOB 4GB9A 4NNJB 2JJQA 5H8YE 1FNUA 1Q86C 4CGYB 1AH9A 3VYSA 1Z7TA 4JI3Q 2KWCA 2M56B 3AMUA 2EOTA 3S14B 5JVH3 2Z8LA 4XGAB 4IURA 2J4XA 3CC4A 4A3GH 2JA5B 2WQYB 4W9LA 2OXPA 1SDFA 3G71A 1JOKA 5GAHC 3CCUA 2JSOA 4R8IA 3N1ZC 4NJ7A 4DV2L 4PQXA 3S1NH 2VH2A 2Q2HA 3CU7A 1EUVB 2WXPA 4TKNA 5E6PA 4PMBA 2INCC 3B6YA 5IYCH 3RPFC 4ANUA 2F03A 1JMLA 2JN4A 4WJ4A 2WXQA 2ZJDA 1HA6A 3I70A 3GV6A 1VQBA 3RYTA 4M00A 1IYUA 1STBA 4YWKA 3F2CA 1D2BA 2O2VB 4DR3L 1E2WA 1KLVA 4LWCA 3B1LX 3W2DA 1WYGA 4A20A 2KQSA 4AOFA 1RRBA 1HRJA 5DLQE 2WXNA 4BBSG 3VR9B 1LTBD 4FA6A 1FGBD 3LDZE 3W1SA 4KKSA 1WR6E 3M4YA 5D3DA 1DGSA 2YYZA 4GDLA 3RNFC 5G5GA 2HUGA 4RCNA 2KX3A 2RCFA 4KKTA 5I9OA 1PTOF 3G48A 3Q8BA 4M0WA 1HTQA 2KHIA 4XXEA 1QZGA 5ELDA 1FJGL 1KNAA 1F9SA 1YMHE 4DR3Q 2JZZA 2JEBI 2YTVA 4FDBA 4Y7NB 1ZE3D 1YJJA 2IO0B 2JPHA 4N9PA 3KVFB 3I4MG 2JT4B 4IALA 1JORA 3U7DA 5J18A 1U9RA 5EBCA 4G50A 1N62A 5L83A 4QIWB 1MI2A 3WDNA 5C4ZA 4KD4A 2GBKA 4HJGE 3UQAA 3I90A 3S1MH 1U4AA 4DV3Q 2NMQA 4DXAB 1IL8A 1QVGA 3ZRCA 3SHLA 4IZ8A 1PTOB 4XE0A 1L2NA 2M00A 3CRKC 2BH2A 2D5DA 3S2HH 4B3RL 4XDCA 1YEZA 3MHBA 3QAQA 2JA5G 3PMFA 4K5XA 4A3KB 1A70A 2N7DA 3TBLD 3AI5A 3P75A 2MJ3A 2BKRB 2MA9B 4WURA 3ERQA 3NEMA 2KKCA 2PEAA 4JQWC 1S5ED 3SR1A 2JVCA 2LXAA 1T3QA 3PT2B 4LDTB 4DPGA 4GOPB 3J7A5 4KSLC 1E1OA 1OXXK 2E5LQ 1OQRA 2KD0A 3ZXVA 3TL5A 4REZA 1V9PA 2AYOB 1HR0Q 3BVZA 3HUIA 2JX5A 1XPUA 1WJUA 3D3RA 1RDPD 1SMYC 1LTGD 1A6XA 3DEOA 2NPTA 2EVBA 4G0NB 2LMCB 5C4XG 2DJFC 1PZJD 4GLXA 2ACZB 2D9UA 1WTXA 2L0TA 2IDYA 3R2TA 4PT5A 1FD7D 1IKLA 3EIVA 1JCKB 1VR9A 3I55A 1AARA 2KT7A 2ASQA 1A3VA 2EYJA 1STEA 1D5ZC 4ULLA 1HNZL 1WE7A 1KLGD 2V1CC 1WH3A 2HT1A 1A2UA 2VUMB 2B3AA 2KTRB 1WM3A 3BWUD 4GLSC 2R6GA 2LRWA 1HXYD 4JI8L 3CWIA 1N63A 3CQZH 3ML8A 3OJ3A 1J0GA 2LWPA 1ZDVA 3IFDA 1WSPA 4QGUA 1K8GA 2X6GA 1KM7A 4QUFA 3UINB 2E2JB 2WAQG 3CHBD 4H7BA 2UXBQ 3RZFA 4E71A 5CHFA 5C0XI 4ODGA 5ELEA 2A19A 4X3SA 4F8CB 1J7AA 3JAMc 3I4LA 4A3MB 2L05A 3GTMB 1GXDC 1LT6D 2C9OA 4WRDA 3SK8A 3K59A 2RSUA 2MLBA 2XVSA 2EE1A 5CBEE 2JA6H 1E2VA 4CKBA 3I63C 2LFNA 4A3GG 3W5UB 3LWEA 2XN9C 2WGSA 3C8YA 3VDZA 3AMZA 3NTIA 2WYQA 2HIXA 2W82A 3HEJA 3IT4B 4FXCA 3KFUA 1FFVA 4A3MH 1PH3A 3ZTDA 2EJMA 4EZJA 4A4IA 2ZPYA 4BA1I 4QUCA 2D62A 4EQOA 3P1HA 2PCFB 2L11A 4IWPA 3NSWA 3PO2G 5C3WA 4HMJA 4UP8A 2JA6G 2B8GA 2GBNA 4C4VB 4LUOA 1PV4A 4NQLB 1CSPA 1PMRA 1PTOH 3NUCA 4B0EA 1TT5B 3PSIA 4KN4C 4DV6Q 1L0XB 3AB9A 1N33Q 3CAMA 2A8VA 2G1EA 2J53A 2I46A 2K5NA 4LNNA 3RZWC 1GHKA 3KLSA 3AEBB 2JA7G 3A8KE 5JZEB 1NNXA 3H7PB 3RFZB 1BDOA 4BBRH 4LFCQ 4FJYA 2GN5A 2Q5WD 1SAPA 2WWZA 4A3CG 3FILB 4W9FA 2A6HC 2WKCA 2PQAB 1N34Q 4V190 1M4VA 3AE4B 3PLUA 3BVMA 1Y1VB 4N9TA 2F0LA 3WCQA 1BT0A 1F77A 4OWXB 1HUMA 4XWWA 3CD6A 3H8HA 1MJDA 4LTUA 2Y5CA 1LTAD 3KLWA 3KK7A 4P72A 2VZKD 2XBBC 1A8VA 2AWNA 4JI6Q 5BYQA 3UIOB 3X0WA 2NVXB 3BK1A 4D2KA 4YCVA 4A3LG 1EYAA 1NYRA 4APVA 1WTVA 4C3JH 4LFAL 3A54A 1BO0A 4MACA 2EZVA 1FL0A 2MH7A 3CCEA 2ZXPA 3PHWB 3T9LA 1VQ5A 3PV1A 1HNZQ 4JI7L 1B50A 2K25A 5JVG3 1KNEA 2WDTB 3K81C 1CKOA 4XDDA 3R66C 4NMZA 4C80A 4IFDH 1PFBA 3TP7A 4IQZA 1E6EB 4W9GA 4UAIA 3IBEA 1IYVA 4JI6L 3GO5A 3M9BA 5BYSA 5KHOA 3STBC 4S3SA 2BKFA 1S40A 4WJQA 4OXPA 3EBEA 3OMGA 2JA9A 4XX5A 2REXA 1H9SB 3KLSX 1ASZA 1PXUA 2RDGA 2IO2B 4DAVA 1GUNA 1FM0D 3FEWX 1EUJA 1YNJD 3V61A 1HE8A 2X69A 1HUNA 5KNDA 4KSKC 2KVMA 1U0LA 4LFBQ 2BS2B 2EIFA 3T1HQ 1Z2MA 1YIWA 2BDNA 2VB3X 1I4QA 1WGRA 3PIPA 4C1NI 1YJWA 2PMZE 3MA2B 3VAWA 1QF6A 3ZVVA 1SYCA 2E2DC 2CW0D 4AYBE 2K4KA 3TMPB 5FR3A 2O5IC 2BS4B 5E6OA 2ZJQA 3GTPH 3KYDD 3RN9C 1EOTA 5BN5A 1YJIA 5GQOA 1VQLA 4TKOB 1TWHB 1R9TB 1Q1BA 1AFPA 3UDGA 4BKGA 1FO4A 1O7LA 3L9AX 1EWIA 3Q6SA 3P20A 1HNXL 2H1EA 2NZHA 1XF5L 1YNXA 2WS3B 3L08A 2LS01 5L37A 4HCSA 2E2IH 1GKHA 1WCMB 5EDSA 1QJOA 5CHVC 2CQAA 1EIFA 4R4OA 4R8NA 4NXNL 4PMWA 2I1JA 4WWMA 5NUCA 2EYOA 2ZW1A 4KV2A 4GSWA 4HTHA 1D1KA 5DPWA 2JXMB 3A74A 5IO9A 1LTLA 3QK0A 4DV5L 4YTPB 1D8LA 1C9OA 1FNVA 5IIFA 5IGCA 3GTOB 4GNXB 3S17B 3Q3NC 4ICVA 3X3MA 3E56A 4S17A 2DZMA 4LUVA 1Q8IA 3PIOA 1HEZE 3ENEA 4R4CA 1LTTD 2JXTA 2PO4A 4P71A 5LL6S 3FHWA 3X3NA 4F87A 3L4PA 3ZW3A 3I7FA 2N0SB 1HFNA 2BB6A 4C7ZA 4GDKA 2JEAI 3C1FA 2MQHA 1K73C 4MJSA 3V6CB 1WFQA 3HKSA 4IUPA 4K5VA 2KXJA 3DHQA 3PRZA 1O7YA 4CDCC 3PF4A 3W1YA 4C00A 4HR7B 4C7YA 5BN3A 3SE0A 1VS0A 2EPBA 5FLXL 1UELA 3Q23A 4IFDG 1SYDA 3F2BA 1V80A 1WCMG 1F2MA 1RIPA 1RF2D 1X3EA 3P4QB 3OTOQ 1GM5A 3HS0C 4BFRA 2FAZA 4A3JB 1LT5D 1PH6A 2ZJRA 2EYPA 5EQ0A 4EOYA 2K6AA 2LKVA 4HN7A 1OXSC 4ZRJA 3BZCA 1B53A 2PKOA 3CCLA 5CV9A 5IGBA 3FKIB 1SYFA 2MCNB 5KEEA 2UXCQ 5CV6A 4BY7H 2QHOA 3RD4A 4XQJA 2Y5PA 3NS8A 3R7RA 2Y0SE 4AYBG 4GOPC 3K57A 2YEPF 4YY3Q 1E3PA 5FO7B 2KC2A 3PLVA 5HFYA 2XTIA 2CS4A 2A6EC 3T53B 2JQOA 4R4IA 4XC2A 2BW2A 3KQ4A 2FXQA 4QJFA 3HOYB 4K81A 3ND9A 1N60A 2V1YA 4DXGA 1CFMA 1WZ0A 1WGGA 2RVLA 2BTEA 1VDZA 3KDFB 2L4NA 1AZPA 1R7SA 3E9SA 4LNOA 4M8MA 3S2AA 3SU8X 5IKCM 1VQJA 3AFPA 2DBYA 2WXHA 2K8CA 4DNRB 2KMCA 1C48A 2RQXA 1I50B 2BS3B 4RMAA 3DWMA 1NJIC 1KD1C 4M02A 2M2LA 5BO4B 2ZJPA 2KDEB 5I4DA 2WXKA 1GO3E 2EXZA 1XMQL 4JW0A 1PH4A 1KF6B 3QR8A 2KMAA 3NZUA 5I6YA 5L95C 2CWPA 4WH4A 2C7HA 4N6EB 1SR3A 1MD2D 2PNRC 1UUPA 3PUWA 1SROA 1K0SA 3VVWB 1SNDA 1Y56A 2QMTA 4O1NA 1NAPA 4MSMB 1EEFD 1ZGUB 3L0WB 2LXKA 3Q8CA 1JB3A 2PPBC 2C60A 3RZOH 2F0WA 1NVID 3D6CA 2WNMA 1J8IA 4AP4C 2LGXA 1ILQA 1EY5A 1X32A 4JGHB 1C8CA 2DHZA 3FILA 2B8FA 3SEBA 2PQAA 2D3AA 1CTMA 4A3JG 3CMMB 3GZNB 1ZUD2 2KO3A 2OHFA 3FRPB 3GTLH 2BBCA 2CU3A 4TRDA 4X62Q 1EWYC 2WB1G 3UDIA 1XPRA 2HQLA 1T9HA 1VQ9A 1ENCA 3IVFA 5IT9E 1ASYA 2NB0A 2WFWA 4DFAA 2Z0EB 1A15A 2VNUD 3HOZB 5IOIA 2R92H 4OO1H 1UWXA 3ECIA 1EF5A 3HOXH 2LFIA 1SJHD 2A69D 3PRPB 2AHOB 2NN6I 3H15A 4A3PA 1K8OA 3P63A 4M8AA 2L3ZA 3FKIG 4J6IA 3ULJA 5AUIA 3T1HL 3CCRA 1Q90A 1AWDA 2BPSA 1HZBA 5LMNQ 4ARCA 3P2BA 4A3BH 1EY0A 2QKIC 2UXCL 2DAFA 1IHZA 1JQYD 1DOMA 5M3FB 1WY8A 3U4ZA 3N1YC 1S3OA 2IW3A 1I94Q 3HOUB 3TEWA 4NDXA 3OIPA 1MG4A 3I4NG 1M8AA 3G6JB 3QCAA 1H9SA 2DLBA 3U7ZA 4A93G 3KLRA 2CW0C 5CBAE 4JK1C 3C2PA 1MFWA 1CA6A 5DPSA 4BY7B 1TWAH 4DK0A 1L0WA 1XLPA 3W1SC 2HJ1A 3LWUA 3I56A 5T1IA 4K14A 2JA7H 1A2TA 3NVVA 2X8XX 2B2YA 4II2B 2JRIB 4DUZL 2GBRA 3SXHA 4PYZA 3RZDB 2A5UA 4RNAA 1XJVA 2Z6KA 1HZCA 1LTID 2ICIA 1K8RB 1T0QC 3M3JA 3K0YA 1LABA 1LUZA 3GTQB 2D11A 1K9MC 2PMZB 1ZYRC 5ELBA 3PO2H 3A9KB 2JA7B 3AECB 2H4OA 3LX0A 2VQEL 3CCQA 1SGHA 2OOBB 3HOUG 3QJYA 3ONSA 1VQAA 2I0QA 2K6DB 3PGEA 4BZAA 4UDUC 3I3TB 4AUQC 1RD9D 1IYFA 2IBIB 1E8WA 4IUNA 4JI0L 2UWQA 1UEAB 2OJRA 2WAQB 4HROA 5EPJA 1TKGA 4IM3A 3H9DA 1YN5A 3T4AC 3UE0A 4HRSA 1WD1A 2BDOA 4BY1B 4BWGB 3HOWB 1C77A 3Q3FA 2PMVA 4E6IA 3SR6A 5G5HA 1V8QA 2DAJA 2R2OA 4BAXA 1MG8A 1NMFA 3BZDB 4XT3B 1II3A 4A3GB 3APCA 1D5MC 5FOBB 4OZAA 3CMEA 2DNFA 2KCNA 4O2DA 2E5LL 4X57B 3J81E 2JA8H 1O7IA 1ROEA 1ZDXA 4GDKB 4JC0A 2ZTDA 1VQ8A 5C0XG 2WDRB 5IYDG 4AIMA 2OEDA 2F0OA 5FLMG 1F9QA 1DYQA 3J7AV 2LZ6A 2MBEA 3CF6E 4LF4Q 3CSFA 1A3UA 2WIIB 2XIWA 1M94A 1PA6A 1AZQA 2ZM6Q 3H0GG 1I35A 2L12A 4KGRA 2Y3AA 4PG3A 2YV5A 3CC2A 1WTOA 4LLGM 4K7SA 4K5WA 3IG3A 2OT2A 3DHHC 1EF1A 2J42A 1E10A 3TCAA 2CWAA 3CQZB 2G4DB 2LD9A 2NWGA 3HP3A 5HGQA 1PH1A 3DBLB 1H9MA 2MJDA 3VQIA 3S24A 2N3SA 4HMIA 1YJ9A 2J7ZA 4LF6Q 2LMCA 2K32A 3BK2A 4LNFA 4ABNA 5K36G 2ON8A 4ZDVA 3DWGC 1S5DD 3A7LA 5DEHA 1GHJA 4Y7NH 5E3FA 1T0RC 4LNIA 2NTTA 3GTMH 2KOLA 1XT9B 1S1QB 4PZ6A 1KIXA 5HG2A 1ZW7A 1HTOA 1K28A 2LGYA 2B39A 4RA8A 4C2MH 4BVUC 4MZ9A 2W3RA 4O42A 2F0SA 1T5EA 1SMYD 1XLNA 3L10B 3VTWA 4X64L 1BNZA 3HG9A 1FIQA 1WJ4A 3H7SA 1G8ZD 4JWSC 1R4QB 1KC8C 2M9VA 4K2KA 1LACA 1NDDA 2CU1A 2KANA 1FRRA 1K8MA 3GP7A 2A4ZA 4L63B 5ELCA 1T0SC 1WTPA 2BYEA 2K39A 2RMMA 1WGHA 4EGVA 4LF5L 2NBVB 1DXMA 3T13A 3AFQA 1EWCA 3MAQA 4A3DG 2BVCA 4G11A 4W9DA 3VA7A 1JT8A 4PNYA 2KCTA 4MGIE 2ZNVC 1HZAA 3JSVA 4H13C 2HHHQ 1Y69U 1DOLA 4JI4Q 4FHJA 3ZJVA 2XWBB 4DK1A 1EY4A 1JRUA 2K3UA 4QAYA 4DK6C 2NZOA 2MBQA 1PGBA 2QDFA 4JX1C 2DY8A 1UE7A 4YXDB 4HPPA 1X3QA 4LDTD 3IHPC 1PHJA 1CZGA 3NWSA 3NXWA 4HIDA 2WXGA 2ATWA 3DDCB 1VJKA 3U8ZA 1TT2A 2VXWA 5DNFA 4DXFA 1G6ZA 4M0WB 4DHZE 1BBXC 1Q1OA 4RF0A 5JPNC 4G4KA 5GAEC 4XT1B 1AW7A 3NHHA 5IODA 2K75A 2RSNA 3ZXRA 3K5NA 4X3UA 3NELA 2L1AA 1LT4D 2VUMH 3L54A 2B29A 3NHEB 3H6NA 4GLAC 2WXLA 2IY0B 3I57A 3CKIB 1SE3A 5IGEA 2KX0A 4JPBW 3M95A 1VF7A 2KENA 4DK3C 3GTKH 3M62B 4US9A 1R4MB 4FJVB 4TQUS 2K52A 2PZWA 1BOSA 2J0KA 1HQMC 2IY5B 1F9JA 3TQYA 4I7AA 2F4VQ 2WV6D 1GAQB 2G9DA 3LJ3A 1PQSA 4LFBL 2PIAA 2I2YA 1NSNS 2EKIA 4IM2A 4A3EG 4WJ3M 3P1MA 3UGBB 3R8BA 2UU9Q 3PREA 3J81L 3PZ7A 4RKBA 2WXJA 4PYUA 4Q5VA 2Z6KC 2ZT9C 5IY0A 2N55A 3HRDD 4YCWA 3ETRA 4XYQA 4NW2A 5KNBA 1FXIA 3H3VC 4N59A 1GB4A 3U52E 2EJGC 1L0VB 2F4IA 5IGFA 4WJOA 1OEYJ 3I4NH 2BWFA 1HTLD 5F2DA 2LUEA 1AN8A 2FHTA 3MC9A 2JYEA 3NE5B 2R61A 1F9RA 4ZAIA 4R9WA 1WXMA 1RWSA 3T1YL 2TSSA 3NJTA 1JC7A 3RLFA 4PS8A 4C3HG 4CHTB 3SHQA 1EYDA 1XMOL 4JI1Q 1EFWA 3UI2A 3ZLZA 5FLXc 3TBIB 3URYA 2NPTB 3ZKJC 4LK0M 1PH2A 1QOAA 3LYYA 1BBUA 3GTGH 3B0AA 5G55A 1LTRD 1C7YA 2YEPB 4ZHOA 4URKA 2D3GA 3JW0X 5EE1A 3AE2B 3C0RB 1B3QA 3TP8A 3KUCB 3MEFA 3HIZA 2LRUA 3AM9A 3H3VH 2KHWB 4MN3A 3KWVA 2F0TA 5I6WA 2PLPA 3GTGB 3PZ8A 4MDKE 5D94A 4MGYE 3Q8EA 4MJSB 2RKSA 3PRMB 2AWOA 1VCBA 1B7YB 3A5ZB 4DU9A 3DVGY 1CHPD 2UXDL 2CH4A 3HOXG 3CCVA 1PVOA 1Q82C 1V43A 2KMMA 4UP9A 3BU2A 1H8CA 3NWTA 4BKSA 2F0MA 3K7AH 2KVRA 3IXSA 4GIVA 4YTNB 2KN4A 2UXBL 2V3SA 4BBRB 1Q46A 1HHVA 1PZID 4DBGA 2F0NA 4N8FA 4A3JH 4IWOA 1BQQT 2A69C 5J1ZA 1KFYB 1WJNA 3NZ3A 4PK1A 3MTSA 2NVTH 1IBKQ 2R7DA 2E2HB 4ZYNA 2N1VA 4ZK9B 3MXUA 1YD8U 3NENA 2A6ED 1SBBB 2AQ3B 3BYYB 2KDMA 1DOXA 4IW0A 3VUYA 3RLOA 2ZPNA 3F8TA 4U68A 3WAPA 2KFKA 2B2UA 1TKYA 1WGDA 1XCQL 3IKJA 2I07B 2ZZPB 1BBWA 4ANVA 1GUWA 2ALYB 3OW2A 4DWFA 1GD7A 2E76C 1JWUD 2D0PA 1Z6HA 1JJGA 2GLSA 1EU3A 4IOIE 4MHEA 4OELB 2BOSA 4BOZB 3HOZG 1IBMQ 3ZJYC 5CTRC 4JWUC 4CBVA 4KGSA 3DLLA 4A3FG 4DR5L 3DWPA 2QIEB 4EEWA 1QOBA 1I50H 2QF7A 1YN4A 4GGQA 4XWTA 1V1PA 4IUVA 2L76A 3M3YB 3DHGC 1KTKA 1SNCA 4NXNQ 1IXRA 4LK1C 1R9TH 4OX9L 3QWZB 2O4XA 3BDLA 4ME3A 3DM1A 5AFWA 2LGIA 1JWAD 1QVFA 4GZYC 4HJ8A 1I3QH 3GE8C 1PZKD 1K3BC 1QUQB 4C3IH 2MBHA 4JI3L 2MHJA 4IN3A 3HOWG 2F3WA 1CKNB 2BCOA 4OO1I 2KLGA 4WIPA 4A8XC 3R7QA 1R4NB 1PTOC 4NP5A 1WCMH 1Z5SB 4KK7A 1J5EL 4BBSB 5IT9c 4FHKA 5AZHA 3NPPA 2N9KA 3TP5A 2Z59B 2K03A 4J1MA 2IX3A 5LXIB 4H02A 1TWGB 2NVYH 5GADC 4C3IB 2N88A 3PUYA 5E7NA 5IWAQ 2VUMG 2B2VC 2ZXOA 3ICEA 3PHXB 1VQMA 1UBQA 4US8A 2J52A 4IPDA 3A4SC 3ZDMC 4K7WA 3MZ5A 4JV5L 1YNNC 3LB8C 1JE4A 1WTRA 3NUHB 3VYUA 1SN8A 3RNAC 3U50C 3A4RA 4LF7Q 3V62A 1KAAA 3MXGA 3VR4A 3G4SA 1FXTB 2ICEC 1YQBA 3V60A 4LJZC 3SFDB 1IPGA 2RBMA 3MC8A 4A75A 1Y14B 3J80E 2KNBA 3A9JA 4XQNA 5GAGC 2E2IB 1C0AA 3HKZG 2WU2B 1RFKA 2F0DA 1CK1A 3CCSA 2FBWB 1STHA 2K8BA 3CP0A 3IAYA 1UZXB 1G6PA 1BVSA 1K50A 3W9CB 1IKMA 5JJLA 1C78A 4GKJL 1TZOA 1VCIA 2KHJA 1AE2A 1WZ3A 3HOYG 4DF7A 1SMXA 1PUTA 1E8XA 4MH0E 2EY2A 1LQBA 2PI2E 4LF7L 3CF5A 1FVIA 2B76B 4OONA 3J81i 2DZJA 4IUMB 3Q6BA 1WM2A 2DNEA 4NKLA 3FAHA 5EE9A 1Q0WB 3Q2AC 4OIKA 3L3OC 2OWOA 1GUGA 4DR7L 2RHQB 1DOIA 1XO3A 1ML0D 1SE9A 4C3HH 2NS5A 3PQIA 4JI1L 4GKJQ 3KBGA 2J0TD 4PZ8A 4IWQA 1GPXA 1T5XD 2E2HH 4L2YA 2WDQB 3L2PA 4J6HA 2B2UC 4P1BC 1C4QA 3D8GA 1SSOA 1NI3A 4B08A 1CSQA 5ELNA 3ZNHB 4NPSA 2YLMA 4LNKA 2B2TA 1JMCA 3P7JA 4S0RA 4XQQA 2YTXA 3VR3A 1TIID 4KLKA 2V4LA 1WRDB 1XD3B 3A9KA 3AB5A 3DVNV 1I4RA 4HSPA 5ELOA 2AKWB 1Q81C 2N78A 4KDLB 1N36L 2JYTA 1LO5D 2GMIC 2MNAA 3A33B 4HIOA 4AJYB 2KEDA 4P75A 1LTSD 1E7PB 1X3GA 3R93A 4YHHQ 2FCMA 2RD0A 2VZKB 3GOEA 3QJZA 3RI7C 1U4LA 3T3OA 2CHXA 2YTYA 4A6QA 2AQ2B 1J5EQ 4A3IB 1BKBA 1N33L 1EFID 3TDQA 1I4GA 3HKZE 5ISRA 2Z1CA 3AE8B 2R2QA 3FPUB 1JICA 3AE1B 1IBXB 1RODA 2P5ZX 2CQOA 2FNJB 2WU5B 4ZRZA 1L2FA 1QE6A 4Q0FA 2QEXA 2N9EB 5IP9H 4B3ML 1Q12A 4XTCS 1HZ9A 4M1UB 1W6KA 2MO1A 1L6VA 1V49A 2KZRA 2G3QB 3JAME 1PRTC 1WYWB 5E6NA 2R7FA 5JHBA 4K3CA 5IYBG 1SE4A 4A55A 1VQHA 4KV6A 2OTLA 1YOVB 1KRSA 2DY7A 2AMCB 4KJOA 2MP1A 2ID0A 4WJPA 4C3JG 4R4QA 4NXMQ 1FEHA 4HJ9A 1BUVT 3F1ZA 5J3BA 3JAMi 3RZOB 1GB1A 1ACCA 1GVPA 5BR8L 5D14A 3GTOH 3S17H 4BXXH 4MGZE 4L1BA 2KBNA 2KUMA 4CKCA 1UH6A 3GS2A 2QDLA 4RM9A 3R3MA 3TEHB 3I3CA 2FIFA 3MWYW 2F4VL 4KHPQ 3EUB2 2L00B 2F0HA 4IJHA 3TZDA 1I4HA 4HJ5A 5M5YH 3EA6A 5JOBA 2C7NB 5IYCG 4LF9Q 2R92B 2JRHA 4DNIA 1YIJA 1G291 1VQCA 1WGYA 1S3SG 2J0MA 2LUMA 4MSQB 4RKLA 4WWNA 4GOCA 2AUKA 4RGMA 2KFKB 4B95A 4RCOA 1ZKHA 2B2YC 4F7XA 4RM8A 1SYBA 4ZKCB 1SE8A 2LVPA 2K14A 1WWTA 1STYA 4DR6Q 3KUZA 4HDOA 2B63G 3AE5B 3N3KB 5C6AA 2WX1A 2K01A 3CPFA 3B08A 4QF4A 3K5LA 4LNQA 4GXBA 1SFOB 5M3MH 1YI2A 2FCNA 3PUVA 4KY6A 5FJ8G 3D6WA 1WR1A 1FMAD 4CDFC 1CT1D 4RHSA 3U9OA 3APFA 3GTJB 4I6LB 3MHZA 2MBBB 2DWQA 1LYLA 3VR8B 2Z0SA 1HNWQ 1SB3C 1JE5A 4B3SL 1ZYRD 5C44B 5A2QL 1C76A 3DBHB 2HDEA 5JXVA 2CKZB 1TWAB 2B2VA 2QEJC 1PTOD 1QLBB 3DBRB 5C4JH 4DV0Q 2XRQD 4DUYL 1E8ZA 3PUZA 1DCZA 1CHQD 2D3CA 1MGSA 2E8GA 4MM3B 5BMHA 4GOPA 1YVCA 2L1BA 3TREA 4K8JA 3DVGX 2IPKD 4DV4Q 1GUAB 1D1IA 1ISNA 4JOIC 5JJKA 5J2RA 1X3FA 5EKKA 5C3XA 2K04A 3KYCD 1KRHA 5J22A 2WB1E 1SIFA 4WJNA 4A3KH 3PUXA 4A3IH 3AN1A 3C1EA 1WTWA 1WXAA 5IYDH 4W9CA 1TS4A 1GOZA 2MBOA 1O7ZA 3HHMA 1B2TA 4A3IG 2N9XA 1M1KC 3AU7A 4DAMA 1U4MA 1JRPA 1RAXA 1WJJA 2J0JA 3J81c 4IC7B 2V4DA 2B3GA 3EROA 4KKUA 4P2CB 3SK4A 1SXTA 1A63A 4LJOB 1EIYB 4DR1Q 2V9HA 2AL6A 1PFMA 2M1MA 2AEHA 1VQIA 2K22A 1TU2B 3QC8B 1PLFA 3B2FA 2CHBD 5DM63 3S2DH 3NZSA 1PH5A 2JF5A 5BMGA 5BMIA 1LV9A 1ESFA 3HM6X 4G7OC 2KWUB 4ZRPA 2JWZA 2JE6I 2QC8A 4CJ0B 4FADA 4NB3A 1MVKA 1N5XA 2L8JA 2KFJA 3PSEB 3ERSX 1R4NI 2B63B 3OIQA 4WQMA 1KDCA 3K5MA 2LVQA 3CSTA 4YSXB 1AE3A 1JOQA 3H6MA 3T51B 1GUSA 1VDVA 5FJ8H 4IG7B 2JA8B 2KA7A 2ZXRA 4DR1L 5LHY1 3VYTA 2K5PA 2LGDA 1B44D 2HCCA 3RULA 1P7FA 2XSCA 1CZWA 1Q8KA 2BF8B 2H89B 3BJUA 3Q0AA 1PDQA 4YHHL 2CR5A 2B63H 2ZCCA 5KYLA 3PTFC 1X56A 4GKKQ 3H7PA 3VUXA 4DV7Q 3PZDA 5FLXE 3K9PB 1TS5A 2KCMA 1RKNA 2G5DA 4YCUA 4UY8C 1XNRL 3E3XA 2FMCA 2I5HA 3QO2A 2AWTA 4MELA 2K0PA 3FDTA 3D4RA 1BCPB 3IT6B 1STGA 2K5WA 3U58A 4TQ1A 3S16B 4HIKA 4DV5Q 4PMCA 1K8AC 3APDA 1BMLC 1I7HA 2YU9H 2BWES 2HTME 1EWHA 1GNUA 1FCLA 2BYVE 4NAWB 4GN1A 3JYUA 4L5TA 2KEEA 4OGQC 1PDXA 3K9OB 4GN3B 1P9DU 4EFOA 5M3MB 3NQTA 3I4MH 3S1MB 4O0AA 2B2TC 4FXKC 4JG2A 5JJZA 1NUCA 1TYGB 2CVRA 3EECA 4FF4A 1ICWA 1VMCA 4XYOA 2YU9B 3AU5A 4JL9A 4LF8Q 5KRUA 1TWCB 2FFKB 2I1KA 2N9PC 4FO2A 4PZ7A 4DR2L 1UGMA 3EFCA 1I6VC 4DV4L 1V6EA 2EDGA 2LY7A 3U9SA 2NVQB 4ITKA 1CJEA 5C44G 1TKWB 1ZXTA 3FVQA 3NQIA 5EKLA 4A76A 4A3DB 1CZPA 1PRTF 1RLFA 3PO2B 5IN7A 1WTQA 1QKZA 3OTOL 2EJFC 3H3VI 1QG7A 4TMAB 5E4WC 2RCNA 5C3EB 4C56C 2QCPX 5LMUL 4OHJA 1R4PB 4B6WA 2Q8RE 2IL8A 2SNSA 1TY2A 2F0JA 1KOTA 2RDHA 3QARA 1PGXA 1Y1WH 1HCZA 4YY3L 1KDBA 4DK5A 4B3MQ 3DCGA 3U4EG 3BDCA 1JW9D 1VRAB 2WXRA 2JSVX 3VXWA 1OTRB 3J80i 2JYOA 1LM0A 1IBKL 4OIJA 5CGKA 2MPMA 3ALBA 5DCNA 1QCBD 2BH8A 5IA7A 1XYIA 4ID6A 5TSSA 1VQOA 1F0ZA 1XLQA 2HDMA 5IP7G 4II3B 4YIJA 3GTKB 1ZKOA 4B9KA 4I6PA 2IT1A 3OMCA 4NXML 3FC4A 4M01A 1OTCA 3CIRB 1V5TA 4FJZA 4GU2A 2NYZD 2F0QA 1WF9A 3HOVH 1KH0A 1EYGA 2RA4A 2FUHB 2PQEA 5C3EG 3GB1A 2DZKA 2C5CA 2INPE 4L5SA 2IHFA 5M5WH 4W9KA 1ZEQX 1P0RA 2KDIA 2N9LA 1WX7A 3DBHI 4A3OA 2GOWA 3I73A 3D4DA 1D7QA 5CMDA 1F2RC 4K7UA 1KLUD 2A5HA 2F0GA 2KTRA 3H1UA 1A3TA 3SD5A 2E2JH 1UD7A 4AH6A 3HZXA 1FD6A 1P98A 3HOVB 4DV6L 2KC1A 3MXNB 1FFUA 2DN8A 2KACA 4EVOA 4EE2A 5FO8B 1D4BA 1ENAA 2Q8TA 2WX0A 3SK5A 4POGA 2IYDB 4B3RQ 4W9EA 3UIPB 2V0GA 3NBHB 1N61A 1CKNA 1QWYA 3FP9A 2JZPA 3DXJC 1JWSD 1NCVA 3S1QB 2F0VA 2MJ8A 4WFN3 1E9MA 1K53A 2MP2A 4JI4L 2K50A 1EIGA
chains in the Genus database with same CATH topology
3V2TA 3VA5A 1QB5D 3W3AA 4C2MB 4RFBA 1L6UA 3I4NB 2L0CA 4NAMA 3MVVA 2AX5A 5JPMC 2WXIA 3BYTB 1JWMD 2PVGC 4DN4M 3TN2A 4YWGG 3MFYA 4FNFA 2NUCA 3WOEA 1GUTA 2BE5C 2IGHA 1YN3A 2EYLA 1IUEA 1UNSA 2PVOD 3A8IE 5A2QE 4C3JB 2GA4B 3MEHA 2TMPA 1B9RA 2DYOA 3AEDB 4CQNA 1HZ5A 5CORA 3AE9B 2L55A 1B9MA 3PV0A 2NTSA 2IWHA 4Q2JA 3H09A 3K7AB 3MP9A 1SNPA 3W5VB 3AE7B 4JPSA 1QQRA 2F0UA 2M0AA 2XRSD 2F0EA 4BA2I 3KUPA 3TEXA 4HAEA 1S4ZA 2NVTB 1SNMA 3A8JE 3Q8AA 4RAUC 1VZ7A 2LHEA 4X3TA 1I3QB 4N58A 1AYFA 5CV4A 3NTHA 1VMPA 1IBXA 2MJEA 1YNTE 5HHDG 1IGCA 1V1OA 1STNA 4IUUA 2EY6A 1U4PA 3QOJA 4ZRQA 2JA6B 1EZ6A 1JR0D 1QILA 4OZBA 4RWSC 5IGDA 5C5LA 5IOCA 3BS1A 2SDFA 4HKZE 2KECA 1QOGA 1E2ZA 4AQ7A 1J7CA 4L8JA 2A68C 3ZJUA 1MBYA 1BXTA 2FE8A 1I4PA 1L4DB 3VR2A 5C0XH 1LT3D 4XDXA 3Q24A 1ILPA 1Q10A 2F0PA 2WLBA 1EU4A 5D7GA 2K5QA 4YT0B 1YNJC 1GUOA 3NK9A 4C1NK 1J9OA 1TS3A 5KIXA 2BE5D 2QILA 4DNTB 1EQTA 3EGRA 4C3HB 1EEID 3BG3A 4HEA1 1ONLA 5JEAJ 4DAPA 3GD7A 2I38A 3TMEA 1Y8NB 5K5PA 3BIID 3H94A 2F3VA 2E3TA 1Q1EA 1L4ZB 1RHPA 3ZQ4A 2PZTA 5G3LF 1YQ3B 2WACA 3ND8A 4HEDA 3B2GA 3OWFA 3G7LA 4IFDI 2B2WC 1OFFA 4KHZA 5M5XB 3K6OA 4HKQA 2KWDA 1WXQA 2KJXA 1J7BA 1FRDA 4G7ZC 2F1MA 4WAFA 1EYCA 2PYKA 2GRIA 5KNCA 1DGJA 4J3OD 2JWUA 3IAM1 4NJCA 3T16A 3VR6A 1JALA 2KQ4X 1T6BX 3A56A 2NZ1D 3ITPA 5EE0A 2IGGA 3VRAB 3OPOA 3R3OA 3E6ZX 1ENFA 3QWNA 1JROA 3KWLA 2IJ0A 1D6EC 4FVMA 4K8IA 3AV8A 2OEOA 5IGGA 4OO1G 3PO0A 3TP6A 4LMQD 5EJWA 3S2DB 2PW7A 2E75C 1JQ4A 1HZ6A 3TUOA 3QOLA 5JEAH 3AEGB 3MJ5A 1FNWA 5H92C 3IL8A 4YTMB 1WRIA 2K28A 2XNAC 3ZJTA 5DM73 3PIO3 3R2IA 1SNQA 1C79A 1B9NA 2WXFA 1EZ8A 2CJNA 1V8CA 2SOBA 2NN6H 3U2SC 3HOXB 1TR5A 1UAPA 3MC0B 2BA1A 1EY8A 5ELFA 3WOFA 1WD0A 2L52A 1GJXA 3H0GB 4ZUJA 3AH7A 4DGZA 3VR5A 5CR3A 4YSYB 1SSNA 1BR9A 4RGOS 4A3BB 4AYBB 4I65A 2A73B 2K9XA 1ZPSA 2SEBD 3PIP3 1EM7A 2WP9B 4OL7A 1QNKA 1L0YB 2G9HD 4KN7C 3C3LA 2RPVA 1ET6A 3E9SA 3SFEB 1DM0B 4FF3A 2W54A 3OW7A 2A68D 2QDBA 3I91A 4K6DA 4CJ1B 1IGDA 3VYRA 1BCPF 5FKAC 5FK9C 3LXFA 3S2HB 4ILWA 4I7ZC 2MGSA 1K51A 4KKJA 5HURA 5CV5A 5C4JB 1Y1WB 3MXPA 3AEAB 1MSHA 1XEEA 4KMUC 4KJNA 3HVDA 1NYQA 4GDLB 1Y8OB 5E1FA 2AUJD 1XLOA 2N7JA 3P4RB 2PTLA 2ONQA 5I2YA 2FJ2A 1DOYA 5D3IB 3IAS1 1ZXHA 2K7VA 3GTLB 4QB4A 5EPKA 1XCTL 4ZHPA 1XWEA 4ME5A 4IDIA 3CRLC 3QG1A 1BUIC 2JU6X 2SAKA 2NN6G 1NEKB 1HPCA 1B3AA 2LHDA 3P42A 1EIGA 3DMUA 4A93B 5CV7A 5LNK1 4G57A 1UGJA 3S1NB 1NR2A 1RM6C 1C9FA 3HVZA 5HI1A 4OVZA 3Q8FA 1RJTA 1IW7D 2VB2X 5JEAG 2A74C 3K5OA 2KQ3A 3BDOA 4A3EB 1DD2A 3A7AB 3NVZA 1S5CD 1TQOA 1JOOA 3TZUA 1K83B 2K1BA 1DJRD 1I4XA 4ZLTF 1Y8PB 2L9HA 2CJOA 1X3PA 1MHHE 2O5JC 5J39A 1XXGA 4IFDJ 5KGUA 4OZCA 1PRTD 1PFDA 5DAUA 1H9KA 1SE2A 3ZGZA 2X6LA 4B9WA 1QOFA 4AS1A 3J80L 3F2UA 2FUG1 2FINB 4USAA 3N9YC 2GB1A 1V1PB 4G7HC 3J9CA 3J7AF 4BS9A 5BN4A 2MUYA 2M19A 4LAAA 1TS2A 1AEXA 5C2TB 1TY0A 5M5WB 4U673 4K2LA 2ENBA 3NBIA 5EE3A 1E0ZA 1NR4A 4JE3B 3GQBA 1Z47A 4ZQ3A 1ZOYB 1O80A 4QMGA 3NVWA 2PZUA 2Y0SB 3VRBB 3E5SA 3V96A 1TVXA 4KTAA 1SF0A 5CC4A 4H0LC 5EBDA 4P6VF 3NS1A 1FYCA 2HCIA 1Q3LA 1W6JA 4Z9CB 1S5BD 2WXOA 2V4IB 2NBFA 3HGBA 5M9OA 5K36H 3C46A 1MPEA 2INNE 3NP8A 4FXDA 1EQVA 1CI3M 1STAA 3LNNA 5E4XA 4XIGS 3SVMA 3DWAA 4DA2A 2RDFA 4KHVA 2L5TA 1B4OA 1E0BA 4TSSA 4NZLB 4A90A 1FR3A 3Q69A 3EVQA 3V05A 1B1ZA 1VZ8A 5AUKA 1F9PA 2BA0A 1RCVD 5EKIA 4OW0A 2BYTA 1TJEA 2R93B 1L5PA 4MH8A 3NVYA 4ZYSA 5G3LD 1KABA 3MXNA 2F0FA 2HDLA 5T1GA 4QCLA 3T3NA 3H91A 2RSOA 3J7YW 1HA5A 1XX8A 4RGNA 2DYMA 3AEFB 2DNCA 3D4WA 2A6HD 1MSGA 3DEPA 4K6LA 1EIHA 2EELA 1SJED 1ET9A 1SYGA 1G2TA 2W55A 2XWJB 4KI0A 3N6RA 3DWQA 2F0IA 2KCCA 2L32A 2EY5A 4KGTA 5D65A 1YNND 5T8IA 4MT5A 1U4RA 1OQQA 1IW7C 1SEBD 3EJIA 3NRZA 4ZOHC 1MI0A 4ZKBB 4H44C 2E6XA 4FYDA 3GTPB 2IX0A 2WB1B 4DQOC 1HTPA 1NENB 1D5XC 2Q8IB 5KYIA 3ZYYX 1F2LA 4CKEA 2NVYB 5I2XA 1AP0A 1PGAA 4RF1A 3EQLC 4KD3A 2K05A 5C5MA 1KDAA 1H9RA 4J8QA 1CQVA 1EL0A 1VF5C 2BT6A 5CYUA 1CM9A 2MEKA 3V3XA 3ABVB 2HQEA 4HSVA 1WVLA 3UI3A 3S1RB 4EQNA 1ESRA 1LLRD 3DUZA 1C4CA 1EY9A 2EYMA 1FXAA 2KAJA 3SK6A 3JAML 5GXGB 1PFNA 2OF1A 3OOCA 1K52A 4KY5A 4X3KA 2JP1A 4MIUA 4H2AA 2Z4HA 1BCPC 1C4AA 3AEEB 2B2WA 5C4XB 4RH6A 3RUZA 4DAYA 1V97A 3I9V1 5CV8A 4EQPA 2PW5A 1XTCD 5EGTA 1F2RI 2GI9A 4L23A 1SIJA 1S5FD 3T56B 3PO3B 3QIAA 4ZUIA 1BF4A 2E74C 2EY1A 4A3FB 1G2SA 3GV3A 1HQRD 2QSDA 3P4SB 3O13A 4F8MA 4HCEA 1CA5A 2W3SA 2WDVB 5A35A 4RGTA 3D31A 2X38A 2EYFA 5I9PA 1F2YA 1DONA 5C3JB 2LEKA 4V0BA 2MHVA 4L6TB 3MFGA 3QB3A 4B0EA 1YQ4B 2KHSA 3L7ZC 1RYJA 3BVGA 4IKGA 2WINB 4KKIA 3I8ZA 2IX1A 1N5WA 1WGKA 1DOKA 4CJ2C 3P4PB 3S9WA 3M7GA 3AE3B 3S15B 1VZ6A 1JWBD 2Z4IA 1MHXA 3FMCA 2WP8J 1QOHA 1VLBA 4C3IG 3TSSA 4JBWA 3HKZB 1QT9A 2K33A 1EY6A 4IUQA 2PW9A 1O78A 3EFXD 4KY7A 1ZXIA 2V3PA 3E0JA 2F0KA 4KX6B 4WORA 3TEYA 2O2LD 2FMMA 1UWMA 1ZP0B 1TWFB 2H88B 4FXGC 2K5DA 2ZW0A 4ARIA 4A9AA 1OXUA 3FPPA 3IFTA 3B9JA 4PV1C 2JQRB 5C4HA 4IUTA 4B9XA 4RHRA 1BCPD 3I72A 2QJLA 2WXMA 1RTNA 5HGTA 4B0MA 1SNOA 3SDZA 1QNUA 1RTOA 2LJIA 5M5YB 4TQ0A 1OXVA 3M85A 1TKEA 2EYHA 4YSZB 3KF8A 2D2CC 4WJWA 3N52A 3I4MB 3NTKA 2IGDA 2R3ZA 1CQFA 1PRTB 2V3NA 5C0XJ 1P7EA 3AE6B 5MPOA 3OWEB 5EPLA 5BYRA 4FP5D 3OSOA 3OHXC 5IT9L 1PYWD 4FF2A 1H9JA 1I6HB 5COYA 4R3DA 3M7NA 1FCCC 2L83A 1C4PA 3M4OB 2SNMA 3NBHA 1G91A 2WKDA 3TEZA 1F2ZA 1OO9B 5JAVA 3Q22A 3RMHA 1HFGA 4F88A 2AQ1B 3A55A 4FF1A 3KBXA 2R7ZB 1OXTA 3HRZC 1SYEA 5LL6X 1EY7A 4P16A 2D5GA 2BB5A 3K58A 1DZ1A 5FO9B 3ONAB 5E6JA 5H8YE 1FNUA 4CGYB 3VYSA 1Z7TA 2M56B 3AMUA 2EOTA 3S14B 5JVH3 2Z8LA 4IURA 2J4XA 2JA5B 2WQYB 2OXPA 1SDFA 1JOKA 2JSOA 4R8IA 4PQXA 3CU7A 2WXPA 3RPFC 4PMBA 2F03A 1JMLA 2WXQA 1HA6A 3I70A 3GV6A 1IYUA 1STBA 1D2BA 1E2WA 3W2DA 1WYGA 1HRJA 2WXNA 3VR9B 1LTBD 1FGBD 3W1SA 4KKSA 3M4YA 5D3DA 2YYZA 5G5GA 2HUGA 4RCNA 4KKTA 5I9OA 1PTOF 3Q8BA 4M0WA 4XXEA 5ELDA 1KNAA 1F9SA 1YMHE 2JEBI 4Y7NB 1ZE3D 1YJJA 4N9PA 4IALA 1JORA 1U9RA 5EBCA 1N62A 4QIWB 1MI2A 3WDNA 5C4ZA 4KD4A 4HJGE 3I90A 2NMQA 1IL8A 3SHLA 4IZ8A 1PTOB 4XE0A 2M00A 3CRKC 2D5DA 4XDCA 3MHBA 3PMFA 4K5XA 4A3KB 1A70A 3P75A 2MJ3A 4WURA 3ERQA 1S5ED 3SR1A 1T3QA 1OXXK 1OQRA 4REZA 3BVZA 3HUIA 2JX5A 3D3RA 1RDPD 1SMYC 1LTGD 1A6XA 3DEOA 2EVBA 2LMCB 1PZJD 2ACZB 2D9UA 1WTXA 2IDYA 3R2TA 4PT5A 1FD7D 1IKLA 1JCKB 1VR9A 1A3VA 2EYJA 1STEA 1D5ZC 4ULLA 1KLGD 1A2UA 2VUMB 3BWUD 4GLSC 2R6GA 1HXYD 3CWIA 1N63A 1ZDVA 3IFDA 1WSPA 2X6GA 4QUFA 2E2JB 3CHBD 4H7BA 5C0XI 4ODGA 5ELEA 4X3SA 1J7AA 3I4LA 4A3MB 3GTMB 4WRDA 3K59A 1GXDC 1LT6D 2C9OA 2XVSA 2EE1A 5CBEE 1E2VA 4CKBA 2LFNA 3W5UB 3LWEA 2XN9C 3C8YA 3AMZA 3NTIA 2W82A 3HEJA 3IT4B 4FXCA 1FFVA 2EJMA 4BA1I 4QUCA 2D62A 4EQOA 3P1HA 2PCFB 2L11A 3NSWA 5C3WA 4HMJA 2B8GA 1PMRA 1PTOH 3NUCA 4KN4C 2G1EA 1L0XB 3AB9A 2J53A 2I46A 1GHKA 3KLSA 3AEBB 3A8KE 3RFZB 1BDOA 2Q5WD 1SAPA 3FILB 2A6HC 2WKCA 4V190 1M4VA 3AE4B 3WCQA 3BVMA 1Y1VB 4N9TA 2F0LA 1F77A 1HUMA 4XWWA 3H8HA 4LTUA 2Y5CA 1LTAD 3KK7A 2VZKD 2AWNA 5BYQA 2NVXB 3BK1A 4D2KA 1EYAA 1NYRA 1WTVA 3A54A 1BO0A 4MACA 2EZVA 2MH7A 2ZXPA 1B50A 5JVG3 1KNEA 4XDDA 4C80A 4NMZA 4IFDH 1PFBA 3TP7A 4IQZA 1E6EB 4UAIA 1IYVA 3GO5A 5BYSA 4S3SA 3OMGA 1H9SB 3KLSX 1PXUA 2RDGA 4DAVA 1GUNA 1FM0D 3FEWX 1YNJD 2X69A 1HUNA 5KNDA 2KVMA 2BS2B 2BDNA 2VB3X 1I4QA 4C1NI 1QF6A 3MA2B 1SYCA 2E2DC 2CW0D 5FR3A 2O5IC 2BS4B 1EOTA 5BN5A 1YJIA 4TKOB 1TWHB 1R9TB 1Q1BA 1AFPA 1FO4A 1O7LA 3L9AX 3Q6SA 1XF5L 3P20A 2WS3B 2H1EA 2LS01 4HCSA 1WCMB 1QJOA 2CQAA 4R8NA 4PMWA 4WWMA 5NUCA 2EYOA 2ZW1A 4HTHA 1D1KA 2JXMB 4YTPB 3GTOB 5IGCA 1FNVA 5IIFA 3S17B 3X3MA 3E56A 1Q8IA 1HEZE 2JXTA 1LTTD 2PO4A 5LL6S 3X3NA 4F87A 3L4PA 2N0SB 1HFNA 2BB6A 4C7ZA 2JEAI 3C1FA 4IUPA 4K5VA 3DHQA 1O7YA 4C7YA 4HR7B 5BN3A 3SE0A 2EPBA 5FLXL 3Q23A 4IFDG 1SYDA 1F2MA 1RF2D 3P4QB 3HS0C 4A3JB 1LT5D 2EYPA 5EQ0A 2K6AA 2LKVA 4HN7A 1OXSC 1B53A 2PKOA 5CV9A 5IGBA 3FKIB 1SYFA 5KEEA 5CV6A 3RD4A 4XQJA 2Y5PA 3K57A 2YEPF 5FO7B 5HFYA 2A6EC 3T53B 2BW2A 3KQ4A 3HOYB 3ND9A 1N60A 4DXGA 1CFMA 2RVLA 2BTEA 1VDZA 1AZPA 2L4NA 1R7SA 2DBYA 2WXHA 4DNRB 1C48A 2RQXA 1I50B 2BS3B 3DWMA 2M2LA 2WXKA 5I4DA 2EXZA 1KF6B 5I6YA 4WH4A 4N6EB 1MD2D 2PNRC 1UUPA 3PUWA 1SNDA 1Y56A 2QMTA 4O1NA 1NAPA 1EEFD 3Q8CA 1JB3A 2PPBC 2WNMA 2F0WA 1NVID 3D6CA 1J8IA 1ILQA 1EY5A 1X32A 1C8CA 3FILA 2B8FA 3SEBA 1CTMA 1ZUD2 2OHFA 3FRPB 2CU3A 2BBCA 4TRDA 1EWYC 1ENCA 5IT9E 2NB0A 4DFAA 1A15A 2VNUD 3HOZB 1UWXA 4OO1H 2LFIA 1SJHD 2A69D 2NN6I 1K8OA 3P63A 4M8AA 5AUIA 1Q90A 1AWDA 4ARCA 1EY0A 2QKIC 1IHZA 1JQYD 1DOMA 5M3FB 2IW3A 3HOUB 3TEWA 4NDXA 3OIPA 1M8AA 3G6JB 1H9SA 2DLBA 3U7ZA 3KLRA 2CW0C 5CBAE 4JK1C 3C2PA 1CA6A 4BY7B 4DK0A 1XLPA 3LWUA 5T1IA 4K14A 1A2TA 3NVVA 2B2YA 3SXHA 3RZDB 4RNAA 1LTID 2ICIA 3GTQB 1LABA 3K0YA 2PMZB 1ZYRC 5ELBA 3AECB 2JA7B 2H4OA 3LX0A 3QJYA 4UDUC 1RD9D 4IUNA 1UEAB 2WAQB 4HROA 5EPJA 1TKGA 1YN5A 3T4AC 4HRSA 1WD1A 2BDOA 4BY1B 4BWGB 3HOWB 1C77A 2PMVA 4E6IA 3SR6A 5G5HA 1V8QA 3BZDB 4XT3B 1II3A 4A3GB 1D5MC 5FOBB 4OZAA 2KCNA 3J81E 1ZDXA 1ROEA 4GDKB 2WDRB 5C0XG 2OEDA 2F0OA 1F9QA 1DYQA 3J7AV 1A3UA 2WIIB 2XIWA 1AZQA 2L12A 4KGRA 2Y3AA 1WTOA 4LLGM 4K5WA 2OT2A 2J42A 1E10A 3CQZB 2NWGA 3HP3A 1H9MA 2MJDA 3VQIA 4HMIA 2J7ZA 2LMCA 2K32A 3BK2A 4ABNA 5K36G 2ON8A 3DWGC 1S5DD 3A7LA 5DEHA 1GHJA 5E3FA 2NTTA 2KOLA 5HG2A 2B39A 4RA8A 2W3RA 2F0SA 4O42A 1T5EA 1SMYD 1XLNA 1BNZA 3HG9A 1FIQA 1G8ZD 4JWSC 1R4QB 2M9VA 4K2KA 1LACA 1FRRA 1K8MA 3GP7A 4L63B 5ELCA 1WTPA 2RMMA 4EGVA 1DXMA 3T13A 1EWCA 3MAQA 3VA7A 4PNYA 4H13C 1Y69U 1DOLA 3ZJVA 2XWBB 4DK1A 1EY4A 2K3UA 4YXDB 1PGBA 4JX1C 2DY8A 1X3QA 1CZGA 3NWSA 3NXWA 2WXGA 1VJKA 1TT2A 2VXWA 5DNFA 4DXFA 1G6ZA 1BBXC 4RF0A 5JPNC 4G4KA 4XT1B 1AW7A 3NHHA 5IODA 2RSNA 3K5NA 4X3UA 2L1AA 1LT4D 2WXLA 3I57A 3CKIB 1SE3A 5IGEA 1VF7A 4US9A 4TQUS 2PZWA 1BOSA 1HQMC 1GAQB 2WV6D 2I2YA 2G9DA 2PIAA 1NSNS 2EKIA 3P1MA 3R8BA 3J81L 3PZ7A 4RKBA 2WXJA 4Q5VA 2ZT9C 2N55A 3HRDD 3ETRA 4XYQA 4NW2A 5KNBA 1FXIA 3H3VC 4N59A 1GB4A 3U52E 2EJGC 1L0VB 2F4IA 5IGFA 1HTLD 5F2DA 1AN8A 2FHTA 2JYEA 3NE5B 2R61A 1F9RA 4ZAIA 4R9WA 1RWSA 2TSSA 1JC7A 3RLFA 4C3HG 4CHTB 1EYDA 3UI2A 3TBIB 3URYA 4LK0M 1QOAA 3LYYA 1LTRD 2YEPB 4ZHOA 5EE1A 3AE2B 3TP8A 3AM9A 4MN3A 3KWVA 2F0TA 5I6WA 2PLPA 3GTGB 3PZ8A 3Q8EA 2RKSA 2AWOA 4DU9A 1CHPD 1V43A 2KMMA 3NWTA 2F0MA 4YTNB 3IXSA 2KN4A 4BBRB 1HHVA 1PZID 2F0NA 1BQQT 2A69C 5J1ZA 1KFYB 3NZ3A 3MTSA 2E2HB 4ZK9B 3MXUA 2A6ED 1SBBB 2AQ3B 3BYYB 2KDMA 1DOXA 4U68A 2B2UA 1TKYA 1XCQL 3IKJA 2I07B 1GUWA 2E76C 1JWUD 4IOIE 1Z6HA 1EU3A 4MHEA 2BOSA 4JWUC 4CBVA 4KGSA 2QIEB 3DWPA 1QOBA 1YN4A 2QF7A 4XWTA 1V1PA 4IUVA 3M3YB 1KTKA 1SNCA 4LK1C 2O4XA 3BDLA 3DM1A 5AFWA 2LGIA 1JWAD 4GZYC 1PZKD 4IN3A 2F3WA 4OO1I 2BCOA 4WIPA 4A8XC 1PTOC 4NP5A 4KK7A 4BBSB 3NPPA 2N9KA 3TP5A 2K03A 4J1MA 2IX3A 1TWGB 4C3IB 2N88A 3PUYA 2B2VC 2ZXOA 4US8A 2J52A 3MZ5A 1YNNC 3LB8C 1JE4A 1WTRA 3NUHB 3VYUA 1KAAA 3MXGA 3VR4A 2ICEC 4LJZC 3SFDB 2RBMA 3J80E 4XQNA 2E2IB 2WU2B 1RFKA 2F0DA 1CK1A 2FBWB 1STHA 3IAYA 1K50A 3W9CB 1IKMA 1C78A 1TZOA 1VCIA 4DF7A 1PUTA 2EY2A 2B76B 2DNEA 4NKLA 3FAHA 5EE9A 4OIKA 3L3OC 1GUGA 1DOIA 1XO3A 1ML0D 3KBGA 2J0TD 1GPXA 1T5XD 4L2YA 2WDQB 4J6HA 2B2UC 1C4QA 3D8GA 1SSOA 1NI3A 4B08A 2B2TA 3P7JA 4XQQA 3VR3A 1TIID 3AB5A 1I4RA 4HSPA 2JYTA 1LO5D 2KEDA 1LTSD 1E7PB 3R93A 2VZKB 1U4LA 3T3OA 4A6QA 2AQ2B 4A3IB 1EFID 3TDQA 1I4GA 5ISRA 2Z1CA 3AE8B 3AE1B 3FPUB 1JICA 1IBXB 1RODA 2WU5B 4ZRZA 1QE6A 4Q0FA 1Q12A 4XTCS 4M1UB 1W6KA 1L6VA 3JAME 1PRTC 4A55A 1SE4A 4KV6A 2DY7A 4KJOA 2MP1A 2ID0A 4C3JG 1FEHA 1BUVT 3RZOB 1GB1A 1ACCA 4L1BA 5D14A 2KUMA 4CKCA 3GS2A 3I3CA 3MWYW 3EUB2 2F0HA 3TZDA 1I4HA 3EA6A 5JOBA 2R92B 1G291 2LUMA 4RKLA 2AUKA 4RGMA 4RCOA 2B2YC 4F7XA 1SYBA 4ZKCB 1WWTA 1STYA 3AE5B 5C6AA 2K01A 4QF4A 3K5LA 1SFOB 3PUVA 4KY6A 3D6WA 1FMAD 1CT1D 4RHSA 3U9OA 3GTJB 3MHZA 2DWQA 3VR8B 1SB3C 1ZYRD 5C44B 5A2QL 1C76A 2HDEA 5JXVA 1TWAB 2B2VA 2QEJC 1PTOD 1QLBB 2XRQD 3PUZA 1DCZA 1CHQD 1MGSA 4MM3B 5BMHA 2L1BA 4K8JA 2IPKD 1D1IA 5EKKA 5C3XA 2K04A 1KRHA 5J22A 3PUXA 3AN1A 3C1EA 1WTWA 1TS4A 1GOZA 1O7ZA 1B2TA 3AU7A 1U4MA 1JRPA 2V4DA 4KKUA 3EROA 4P2CB 3SK4A 1SXTA 1PFMA 2K22A 1TU2B 1PLFA 3B2FA 2CHBD 5DM63 5BMGA 5BMIA 1LV9A 1ESFA 4G7OC 4ZRPA 2JE6I 4CJ0B 1N5XA 1MVKA 2B63B 3OIQA 4WQMA 1KDCA 3K5MA 4YSXB 1JOQA 3H6MA 3T51B 1GUSA 1VDVA 2JA8B 2KA7A 2ZXRA 5LHY1 3VYTA 2K5PA 1B44D 2HCCA 1P7FA 2XSCA 1CZWA 2H89B 3Q0AA 1PDQA 5KYLA 5FLXE 1TS5A 1RKNA 2FMCA 3QO2A 2K0PA 3FDTA 3D4RA 1BCPB 3IT6B 1STGA 2K5WA 4TQ1A 3S16B 4PMCA 1BMLC 1I7HA 2HTME 1EWHA 1FCLA 4NAWB 2KEEA 4OGQC 1PDXA 5M3MB 3NQTA 3S1MB 1TYGB 2B2TC 4FXKC 5JJZA 1NUCA 2CVRA 4FF4A 1ICWA 1VMCA 4XYOA 2YU9B 5KRUA 1TWCB 2FFKB 4FO2A 1I6VC 2EDGA 2LY7A 3U9SA 2NVQB 4ITKA 1CJEA 1TKWB 1ZXTA 3FVQA 3NQIA 5EKLA 4A3DB 1CZPA 1PRTF 3PO2B 1WTQA 1QKZA 2EJFC 1QG7A 4TMAB 5E4WC 5C3EB 4C56C 2QCPX 4OHJA 1R4PB 2Q8RE 2IL8A 2SNSA 1TY2A 2F0JA 2RDHA 1PGXA 1HCZA 1KDBA 3U4EG