3R2TA

2.2 angstrom resolution crystal structure of superantigen-like protein from staphylococcus aureus subsp. aureus nctc 8325.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
195
structure length
195
Chain Sequence
b'NRLYDTNKLHQYYSGPSYELTNVSGQSQGYYDSNVLLFNQQNQKFQVFLLGKDENKYKEKTHGLDVFAVPELVDLDGRIFSVSGVTKKNVKSIFESLRTPNLLVKKIDDKDGFSIDEFFFIQKEEVSLKELDFKIRKLLIKKYKLYEGSADKGRIVINMKDENKYEIDLSDKLDFERMADVINSEQIKNIEVNLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title 2.2 Angstrom Resolution Crystal Structure of Superantigen-like Protein from Staphylococcus aureus subsp. aureus NCTC 8325.
rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
total genus 56
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r2tA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3r2tA01
1D5MC 1FNVA 4BWGB 2NTSA 1PTOC 1SBBB 1KLGD 2R61A 3DWPA 3EFXD 1UNSA 3R2IA 4RHSA 2WV6D 1LLRD 1I4HA 1RCVD 1EU3A 1QILA 2TSSA 2ICIA 1LT6D 1ET9A 1I4XA 3KLSX 5FK9C 2AQ3B 1CT1D 1SE4A 1L0YB 1S5CD 4ZYSA 1CK1A 4RGMA 5ELBA 4C56C 1ENFA 1D6EC 5D3DA 4Z9CB 1SJHD 2XRSD 1M4VA 5FKAC 1ET6A 1I4PA 1TS3A 1D5XC 1PTOD 4UDUC 3OWEB 3CHBD 4RH6A 1S5BD 4K6LA 1ESFA 1TY0A 3R8BA 1S5ED 1LT5D 2QILA 2Z8LA 1BCPB 1PTOF 3BYYB 4O1NA 1TS5A 2NTTA 2QEJC 1YN3A 1LT3D 3BVZA 3DWQA 4L6TB 1PRTB 1SJED 1SEBD 1T5XD 1LTGD 1EEFD 5ELFA 1I4QA 1FGBD 1S5DD 1TS2A 1DJRD 1JWSD 1I4GA 3DWAA 1RF2D 2IPKD 3URYA 1RD9D 1TY2A 1FNWA 3BZDB 1PYWD 4RFBA 1D5ZC 1UUPA 1EU4A 1BCPC 3BVMA 3MC0B 1LTID 4L63B 1YN5A 2XN9C 2CHBD 3O13A 1G8ZD 1V1PB 1TS4A 2RDHA 3GP7A 1PRTC 2G9HD 1HA5A 1BCPF 1RDPD 1CHQD 3EA6A 5ELEA 4NZLB 1PRTF 1HXYD 1XXGA 1JR0D 1LTAD 1PZID 1AW7A 4TSSA 1YN4A 4DXFA 2XNAC 1XTCD 1EWCA 3SEBA 1KTKA 4RHRA 2O2LD 5ELDA 1FNUA 1LTSD 1V1OA 4RGNA 1AN8A 1LTTD 1B1ZA 5ELCA 1B44D 1PZKD 2XRQD 3V05A 1LTBD 1S5FD 2J4XA 1BCPD 3MFGA 1EEID 1SE2A 1FD7D 1V1PA 2SEBD 4OHJA 4RCOA 1KLUD 1PTOH 3TSSA 1PRTD 3R2TA 3BYTB 1BXTA 1LT4D 1JQYD 2AQ1B 4RGTA 1GOZA 1DYQA 1PZJD 4DXGA 1MD2D 1L0XB 3W2DA 2IJ0A 1PTOB 1JCKB 1EFID 1F77A 1HTLD 3BVGA 4RGOS 5TSSA 1STEA 5D3IB 1SE3A 1HQRD 5I4DA 2AQ2B 1CHPD 1LTRD 1JWUD 1I4RA 1JWMD 1SXTA 1LO5D 1CQVA 2RDGA
chains in the Genus database with same CATH superfamily
3A9KA 1VJKA 1C77A 4AQYL 3PT2B 2ZJQA 3VTWA 1K3RA 1RRBA 2N9EB 4ICVA 1B8AA 5H8YE 1TT2A 2VQFQ 2NYZD 2NVTB 3KWVA 3FILB 3B2GA 1MBYA 1SROA 3V2TA 2IX3A 3ZUNA 3D4WA 4JCVE 4DFAA 3N3KB 4HPLB 1ICFB 1YEZA 2HUGA 2Z6KA 4TKOB 3CXCA 3UDGA 1YIJA 3ZTCA 4U673 3S2HB 2QCZA 3FKIB 3MXGA 3ZJYC 2WACA 2ASBA 2A5HA 3NENA 3BK2A 1T9HA 3J81E 2F0VA 1BOSA 1KDAA 4HWIB 1T0RC 4PS8A 2A68D 3U2SC 2ZJPA 2IZVB 3VYRA 4DV6Q 1PH2A 2JZ3B 4J6IA 2BYEA 4JI7L 2L5TA 2JVCA 2B2TA 2LUEA 4KMUC 4NPNA 3APFA 4MH0E 3S14H 3HVDA 5ISRA 1D5XC 1AE3A 3MVVA 4A3GB 2KFKB 2OJRA 1RKNA 4QJFA 4UAIA 1VQOA 3G48A 5CV5A 1TY0A 4F8CB 2L0CA 2MJ3A 4JIOU 4HIKA 4OVVA 1PTOF 2DX5B 1PMRA 3NTKA 3BINA 3DWMA 4IC7B 4YSZB 1E22A 3O65B 2RCFA 3HS0C 1ONLA 4ULLA 1VQMA 4YWGG 4OO1H 1Y8NB 3ML8A 1FGBD 1S5DD 4ZLTF 4DR7L 5FOBB 3JC66 3M4QA 4LK1C 2WXMA 5JZEB 2I5HA 4AYBE 1WR6E 1QUQB 2WXRA 2MJ8A 4ITKA 5C1ZA 3J7AF 2GBJA 1N8RC 1LTID 1F2LA 3D6CA 3K59A 2CHBD 4IPGA 4N8X1 1U4AA 3NQIA 4X62Q 2F3VA 1EOVA 4KHZA 1MJEA 4BY7B 1T0YA 2KN4A 1BCPF 1BO0A 3FP9A 1QVFA 3RI7C 2A19A 3EA6A 4I7AA 4IQZA 4GIVA 1SMYD 2L1BA 2PQAB 4KZCA 4KI0A 1H9SB 2ZM6Q 2JZZA 3C3LA 4P72A 1F2RC 2N7DA 4MHEA 4Q5VA 4RAUC 2NWGA 1HJPA 2N7EA 2YVCA 2HD5B 2B63H 3PIP3 3PUWA 3R3OA 4RGNA 5C3EB 1WXQA 4W9EA 5M3FH 3TZUA 5FO8B 3RN9C 1TWAH 3OIPA 2L4NA 4IO9A 1Y8RC 4FHJA 2BH2A 2EYOA 4KIKB 1E1OA 3RZFA 2A6EC 1ZP0B 2PTLA 4DNIA 3LWEA 2JSOA 4L5QA 2FINB 4YCVA 5DM63 2Q5WD 3OSOA 3NTIA 4A3LH 1C4PA 4IOAA 2NN6G 2EYMA 1NY4A 1STNA 2LMCA 3IT4B 2L05A 1F9PA 3RNAC 2LXAA 3CD6A 5D14A 1RTOA 2XVSA 3BVGA 2D11A 5D3IB 1LQBA 2EKEC 1TZ1A 4LNNA 3VAWA 4C4VB 2VQEQ 2WXNA 3SR6A 4ZHOA 3HOYB 1FFUA 2B63G 1Q46A 3NPPA 2ZVNA 3QK0A 5M3FG 1SXTA 4KHPQ 4G3XB 3A1QA 1K50A 4CHTB 4DGZA 1FNVA 3TEZA 4OWXB 4NAWB 5D6JB 1Y8OB 5BMIA 1X3QA 3OPOA 4FJVB 2JT4B 3T53B 5LMUQ 1EF5A 1MHXA 2N9KA 1K8GA 5AZFA 3NHEB 1F2MA 1VZ6A 3HRZC 2KZRA 3P63A 3GTOB 1VQ7A 3I5JC 4DR2Q 5EE0A 4PYZA 5KIXA 4LUOA 2K22A 4KKUA 4C3JH 3M4YA 5HFYA 1CK1A 3M4OB 4WFN3 2DY8A 1QG7A 4HJ7A 1TT5B 3KUZA 1BVSA 4F7XA 4BBNF 2DYBA 4MJSB 1EYGA 2W54A 3S1MB 4A8XC 5FKAC 1ET6A 4YY3L 1TU2B 4MTNA 1V43A 2WKCA 4CKBA 4A93H 2M1MA 4HK2A 2EY5A 4USAA 2L55A 2IBIB 1SGHA 1DOYA 4GN3B 2R2OA 1ESFA 3QOLA 4TUUA 2J53A 2C7MB 3I90A 3U4EG 1HA6A 3QB3A 4C00A 3I4LA 4A3EB 2ON8A 1Q7YC 2NTTA 2DUDA 4DAYA 2VH2A 1NYRA 3EVQA 3CCLA 1WX7A 4A6QA 2QKIC 4DV6L 2VRRB 3AEVA 1BUVT 3RN2A 2KT7A 5C5MA 2KHWB 4KX6B 5FLMH 4BBSH 1IL8A 1RF2D 1F9SA 2IGDA 5C4XH 4DUZQ 3CQZH 2BTEA 2JA6H 1Y1VH 4ZAIA 1FM0D 3UI2A 3HIZA 3V61A 3DEPA 1JWBD 4DKAC 4L63B 4POFA 2BW2A 4L5TA 4OELB 2KDBA 2R93B 1JB7A 1WFQA 3MHZA 3ML9A 4WIPA 4NB3A 5BYSA 1S3OA 5IOCA 5J39A 2MA9B 1WJ4A 1SYCA 1N63A 1EIGA 3HP3A 3D4DA 5IKCM 1LTAD 2KDFB 3J81c 4LDTD 1YNJC 5GMVA 1HNWQ 1Y1WB 3PO0A 1QF6A 2VUMH 1NYQA 4YTMB 4KKTA 1FO4A 4BBSG 2ES2A 1N5WA 5C4XG 1EY7A 2JA6G 5JJZA 3I4MB 3KDFA 2FAZA 3M3YB 1SNCA 4II3B 4YT0B 1Q5WB 2MLBA 1EF1A 2R92H 3DM1A 2CR5A 2OJWA 3VUXA 1BCPD 2JX5A 1UE6A 2ZM6L 4GDLA 1JWAD 4P73A 1WXAA 3DCGA 4B3TQ 1AP0A 4KJNA 3OJ4B 2VZAA 3BS1A 2GBRA 4MDKE 4M8AA 3VQIA 1X56A 3AE7B 3G71A 5C2TB 5C0XI 2K5WA 2EJMA 2H5XA 1IYFA 1XCQL 2PW5A 1YQ3B 3PLUA 1OEYA 1SE3A 1KRSA 2DAFA 3VR8B 1TKYA 1NAPA 2NUCA 2JA7G 2WHIA 1I4RA 1TQOA 4AYBG 2EPBA 2Q8TA 1VQKA 1WRIA 3E9SA 3AEBB 1PH5A 4JI5Q 3H1UA 4NNJB 5CHFA 3K81C 1A6XA 1YI2A 3D6WA 2ATWA 4LCDE 1GB4A 1PH3A 4RF0A 5DLQE 1I6HH 4HIMA 3DXJC 3CPWA 2LJ5A 3DWPA 3OMGA 4DHZE 1XEEA 2H88B 2VNUD 4UPAA 1PQSA 3JW0X 1LT6D 4KD4A 2JYEA 3VTUA 2XWJB 2W82A 4KKJA 1G91A 4DV3Q 2F0OA 5L83A 4WJNA 2F0LA 4LJZC 4APVA 2UXBQ 4JI6L 3QIJA 1I5FA 1AYFA 3TS2A 2MQJA 2QSDA 5M5YB 5CTRC 4BY1G 1WTQA 2NPTB 1VF7A 2MNAA 4LF6Q 3RNCC 5KHQA 3GTLH 4IUQA 4Z9CB 4CDCC 2R2QA 3AXCA 4PV1C 3KH0A 1M4VA 4IUUA 5LMNL 2YEPB 1NDDA 1PFMA 1BDOA 1BQQT 1EL0A 5LXIB 4WWOA 4AUQC 1PFDA 2D9UA 3PREA 4K6LA 3H8HA 1WH3A 2L00B 2F4VL 4N58A 2LHDA 2Q2IA 4MH8A 4X64Q 2E74C 4A3OA 1O7YA 4PMBA 4G57A 1A3UA 5C44H 1T3QA 2ZVOA 2Z4IA 3BG3A 1Q1EA 3ICEA 1K9MC 1LV9A 3QWZB 1NNXA 3I56A 1FCCC 1NR2A 4LF7L 2ZJDA 3DHGC 2EYFA 4JE3B 1VQEA 1Z5SB 2IPKD 3OW7A 2K5PA 3MC8A 5BR8Q 1HTQA 2DENB 4XQNA 3KLRA 3EHVA 1FNWA 1TKWB 3BZDB 3EFUA 1VCBA 4QMGA 4UY8C 2E2IB 5J2RA 2XN9C 1Q82C 1GJXA 3NJTA 4XTCS 4CJ2C 2KCTA 1L4ZB 1G6JA 2PPBC 2YTYA 4LAAA 2HDMA 1WE7A 4CO7A 1ICWA 2K28A 1STGA 3OYYA 1V5TA 2BF8B 2E2DC 1CKNA 1RIPA 2MJEA 1PRTF 4EQPA 2HCIA 2BDNA 1JR0D 2C7HA 4TSSA 5C44G 2O5JC 3KBXA 4GOPC 1IGDA 1PGAA 1WXSA 2D3CA 3NY5A 2QF7A 4HCSA 4FJYA 1IYUA 1YNNC 1OEYJ 1JOKA 2VS1A 1YOVB 5KHOA 2Q2HA 3NUHB 2K7VA 4RG1A 4R4OA 1CA6A 2DWQA 1SSNA 2ZPYA 1JB3A 3WAMA 2E2JH 3W1BA 1WM3A 4ME5A 2DGYA 3V05A 3K5LA 1ML0D 1K8RB 1KH0A 1GD7A 2K50A 5C4JB 2YTXA 1WF9A 5K5PA 1FD7D 5G5HA 2DNCA 4A75A 1IBKL 5CGKA 1AARA 1EWHA 2RR9A 1LT4D 3CC2A 4OONA 4DV1Q 1UWMA 1XO3A 5CV8A 3IAYA 1G6ZA 2RD0A 3ZNGC 4E71A 3VDZA 2L3ZA 4K14A 4GDKA 2KMCA 1N34L 3CRKC 1PTOB 1LM0A 2DN8A 1J9OA 1JCKB 4CJ1B 2JN4A 2GN5A 1HTLD 2KJRA 5TSSA 1PGBA 3I9V1 5T1GA 3VFKA 2WS3B 4BKGA 4S0RA 4LFCQ 1NI3A 1LTLA 4G7HC 1CHPD 3ZVVA 3C2PA 2BE5D 4X3TA 1QNUA 1XPRA 4PNYA 2EDGA 1WX8A 3C0RB 1JJCB 2NVTH 1ROEA 2H89B 2C5CA 1HZ5A 3UI3A 4K7SA 3DOWA 2RVLA 4JI8Q 2LGSA 1MVKA 3IFTA 4OEMB 4JI2L 2WV6D 2OTJA 1WTHA 3S2HH 1QILA 3M7GA 4KGTA 1UE1A 2DYMA 2MP2B 3PV0A 3ULLA 1P8LA 3I7FA 2X6LA 4NP5A 4DAVA 4IN3A 1VDVA 3STBD 1C76A 2WDVB 2ZT9C 4A3GH 4JI1L 2DAJA 1WOCA 4XYCA 3QR8A 1V81A 2O6VA 3DLLA 5CHWA 1X3EA 3KLSA 2PI2A 3WAPA 3MFYA 1I4PA 1Q90A 2F3IA 3U9OA 3R3MA 3HOXB 2BA1A 4C7ZA 2XWBB 3SFDB 3EECA 3H7PA 1XMOQ 1DGJA 1WYDA 1KJTA 4YCWA 4NXNQ 2F0SA 2AMCB 2OTLA 4XIGS 1MJDA 3C19A 4LF6L 1YD8U 1STYA 2IX1A 2QHOA 1T0QC 3NVYA 2A69D 4F1SA 1NSNS 2E6XA 2G5DA 1ZKOA 5J22A 1Q86C 2MX2A 1E8XA 1ZEQX 3VDYA 3IBEA 4BY7H 4OW0A 2F4IA 4N9TA 2K4KA 2KQ7A 4RFBA 1EU4A 3RR5A 1L1OA 1LABA 2PMVA 1MHHE 4AWJA 2VW9A 1W6JA 1XYIA 2BVCA 2J0MA 5HI1A 3GE8C 3Q8DA 1I94L 1SYGA 1BT0A 2M00A 4FNFA 3NG0A 3K57A 3R93A 1IXRA 1J7CA 2B39A 3HOVB 5A2QL 5GAGC 4IURA 4HCPB 2REXA 3FPUB 4DR1Q 2FHTA 2KMMA 4MIUA 3KUPA 5ELDA 2NVQB 2L8JA 2MQHA 2BA0A 4XT1B 4LF5L 1QZEA 2LI5A 2RSUA 2MBEA 2ZW1A 3AE5B 3I63C 1E3PA 2J7QB 3A4RA 5IT9L 1DM0B 1X1MA 3PZ7A 4UP7A 1SRUA 3S16B 5JEAH 1G6PA 1VRAB 5G5GA 2J4XA 4PS3A 3MTNB 4IOIE 3AN1A 2BT6A 4YWMA 1EQRA 1TIID 1Z2MA 3SFEB 1PRTD 4WRDA 4A3FB 1GKHA 1TWGB 4WWPA 3MXUA 3FAHA 2C9OA 1I6VC 4TV3A 2DJFC 2IW3A 3GOEA 2RCNA 1V80A 2QJLA 5IWAL 3J80L 1KOTA 2ALYB 1EFID 1E6EB 3A9JA 1GG3A 3JYUA 5L37A 1KXLA 2KJ6A 2DHZA 3DVGY 1E0BA 2BS2B 3S1RH 3RULA 4DK1A 3IAM1 1JWUD 2N1VA 4JV5Q 3KYCD 3P20A 2JYOA 5AJ3L 4BBRB 1CQVA 4A3DG 1K8MA 1VQ9A 2UUCL 3P4PB 3NBHA 3BZKA 4DR3Q 2NBVB 3A4SC 1U4RA 5DNFA 1KAWA 3RLNA 4YHHL 3AEEB 1TJEA 1WTOA 3GTOH 2RF4A 2LRUA 4KDLB 2EXZA 3MXNB 1RHPA 3ZYYX 5IAAC 3VUYA 3ITPA 5C3WA 3OLMD 2WDRB 1RCVD 1QLBB 5IP7G 4DHJB 4E6IA 4HJGE 3ALBA 3LGJA 4IPDA 3SK4A 4CDFC 2IO1B 4IWPA 3PO2G 1E7ZA 3H3VI 2ZW0A 3KYHC 4IUTA 3X3NA 4G4KA 1X6OA 3S1MH 4E3CA 4K5VA 3B2FA 2WAQB 1HFNA 3MTSA 5IO9A 3T3NA 1N6ZA 2KENA 3I8ZA 1P3QU 3M63B 2JY6A 4K6DA 1P98A 4DV0L 4XXEA 3DQVA 2I5MX 4A3EH 1K8AC 1K28A 3IVFA 4WURA 4IZ8A 5JPNC 1WFYA 3B08A 1CA5A 3VHTC 4OX9Q 2V1CC 4IFDI 1DXMA 1JC7A 2A6HD 1S5ED 4E74A 1E0ZA 1QVCA 1J8CA 4ZYNA 3TBIB 4JI7Q 2JXTA 3PPAA 4U68A 2DJGC 3EN2A 3AU7A 4X3SA 4A3BB 4MTKA 2JRHA 3BJUA 2D3GA 1K83B 1LTGD 3Q6SA 4JG2A 4N6EB 4XT3B 2AYOB 3X3MA 1K52A 4B3RL 2SNMA 5BYRA 4FXGC 3QX1A 3K8AA 2IT1A 5KEEA 1I3QH 1PH9A 3PUYA 2MPMA 2JA5B 3VYTA 1TS4A 1WE6A 1PFBA 5JJLA 3VH3B 1H9JA 4JI0L 3SK5A 4DR7Q 3LXFA 1WZ0A 2JA9A 3ABVB 3RNEC 2ACZB 3K7AB 1HUMA 2WP8J 2JWZA 1Y1WH 3ER0A 1RAXA 1WYWB 3BU2A 1S1QB 1UGMA 4US9A 4BXXH 3JSVB 3RZOH 1FIQA 3A8KE 5G3LF 5EAYA 4C3IH 1STBA 1JICA 2J0TD 4KJOA 5HY6A 4AH6A 3Q23A 1EWCA 3I4MH 4LF4L 2R7ZG 3SEBA 2K25A 3L16A 2XK5A 2HIVA 5JHBA 1N33L 3AEDB 3WALA 2F0NA 2QDLA 3T1YL 3A33B 2K39A 3CMMB 1LTTD 5I2XA 2E5LL 4JGHB 1ESRA 4XQQA 1OTRB 2FCNA 3MFGA 2EOTA 3J80c 1FXAA 4KSKC 4OHJA 5J18A 3NK9A 4JC0A 4K2KA 3I55A 1WMHB 1B3AA 4WJ3M 2CHWA 2KTRA 4MM3B 1FCLA 2FUHB 1X3GA 1R4NB 4LF9L 1ENAA 5AEKB 1EFWA 4TQ0A 4BXXG 2M0AA 2F03A 4HJ8A 4C3IG 2HHHL 3I3CA 1XCTL 3TIXA 2F52A 3GDEA 1L0VB 2FIFA 1EQVA 2L32A 4GNXA 4ZRPA 4LFAL 2HE7A 3VR2A 3C1EA 2AKWB 4BFRA 2LWPA 4K3CA 3S15B 1D1IA 2XSCA 3KJOA 3CKIB 3AULA 2O2VB 2BCOA 4QIWE 5EKKA 1SFOB 3S17B 3W3AA 3SHQA 5EBDA 3QQ8B 5JOBA 4CBVA 1CTMA 1VLBA 2KLCA 2LHEA 3E0EA 3N1ZC 4OZAA 3FILA 1EU3A 1AE2A 3CMAA 4X65L 4HPPA 4AS1A 1VQ5A 3J81i 2B3AA 3KLSX 4CJ0B 2KEDA 3ZDTA 4BS9A 1XQQA 1F2ZA 2HDLA 1S5CD 2KD0A 5FLXE 1E8WA 4CGYB 1QOAA 2MBHA 4OVZA 1O78A 5FJ8G 4NXML 1WGKA 2KQSA 3VR9B 1Z9FA 3LNNA 4FADA 1K0SA 2Q2TA 1EUJA 1EZ6A 4P7IA 1TS3A 1NBFC 3PZ8A 1PA6A 2KFKA 1PYBA 4MELA 3FC4A 4DDGD 5I9PA 3CP0A 5IGGA 3AEFB 1LT5D 3TREA 4JI4L 4W9HA 1E2VA 4KVGB 5IP9G 5J3BA 4YY3Q 2RSOA 3C46A 1CZGA 1BUIC 3DM3A 3ULPA 2IO3B 2LD9A 1EY8A 3H9DA 1SEBD 2F0FA 2KNBA 1CUKA 4EVOA 2E2IH 3Q2AC 4BKTA 4II2B 1AEXA 4OX9L 1QUQA 1V8CA 1TY2A 2KCMA 2BS3B 5LL6X 1D4BA 1E2WA 3ERQA 2OF1A 4NW2A 1YITA 3V6CB 3SXHA 4CDEC 3H91A 2B2WC 4GZYC 2HTME 1U4MA 3S1NB 1V86A 2MEKA 5C3JB 2NZOA 4RWSC 2V3NA 4K3BA 4YSXB 4GN1A 1QQRA 1MG8A 2KX3A 1V1QA 2VZKD 3DWGC 3N30A 4OL7A 4PMCA 2PQAA 1XJVA 3AMUA 2LASA 2M17A 1H9SA 2P5ZX 1YHQA 3KJPA 5HGTA 2UUAQ 3DMUA 5G2NA 2K5HA 3RUZA 5D65A 3WDNA 2IO2B 3HK0A 5C4JH 3OAWA 2DNEA 5FLXL 2RHSB 1ZDXA 5L95C 4XDXA 1UGJA 1UWXA 4KIKA 4QGUA 2K6QA 1YNXA 2W3SA 3A9KB 3UQBA 1WTWA 3MAQA 1MG4A 2EY1A 1WD1A 1B50A 1SE2A 3F8TA 3CF6E 4RA8A 3HKZE 1RODA 2RGFA 2K0PA 1PTOH 5GROA 4BA1I 4NMZA 4DN4M 1TBEA 1HZBA 3IKJA 1X65A 2Q2UA 3K0XA 1JJ2A 4RGTA 1H4RA 3KWLA 2WB1B 5G3LD 3A7LA 1E7UA 2G3QB 4WH4A 1R4NI 5H92C 1EY9A 5KNCA 1QKZA 4N8FA 4ALPA 4MT5A 1NJIC 5J1ZA 5IYCH 5JJIA 2L0FA 1F77A 1LYLA 2QA4A 4NJ7A 2CW0C 3VR6A 3RNBC 4C4VA 1EYCA 1GO3E 4OO1G 5KRUA 1KFYB 2WINB 2GBKA 4ID6A 2CJNA 4HCEA 3F2DA 3A7AB 1WRDB 1NBWA 5LNK1 3RZWC 2LXCA 1RL2A 3J81L 1IZ6A 2M9VA 4X66L 1TWHH 1JRUA 4IW0A 4JVZA 2CH4A 2BKFA 4NAWA 2EMTA 1WR1A 2R61A 3H3VH 1ISNA 1UWVA 3PMFA 4F8MA 2FFKB 4ZRKA 2X69A 4RHSA 4GN5A 2YYZA 5DM73 2AX5A 2IO0B 2KWUB 2V3PA 1T6BX 2ZNVB 4A20A 5IYCG 2BWES 2AQ3B 2Z0SA 3Q8FA 4XC2A 1WGDA 2LY7A 3FEWX 4JYAQ 5CV4A 4G7ZC 1EY5A 4IFDH 1N32L 2ZXOA 2YTVA 3FPPA 4F7ZA 4MJSA 2NZ1D 5JVG3 4C2MB 3GTQB 2PJHA 3CIRB 3E5SA 3Q3OC 4JI6Q 3HOWB 1XLNA 3K9PB 3P75A 3CHBD 3HOUB 4YWLA 3QCAA 3QJZA 3RD4A 2B2YC 3ZNID 1W6KA 4A3LG 3T8MA 3A74A 4A3IB 4RNAA 3NXWA 5IN7A 1DOIA 5LMNQ 1OQQA 2MJDA 1DCZA 2B2WA 3J7ZC 4A3CH 4PG3A 3ZJUA 2KHIA 3HUIA 1IUEA 1WTPA 1EEFD 2EYHA 4N9PA 2B29A 1KNEA 1SMXA 1VQGA 1K0RA 2GA4B 4R4QA 3T56B 4A3JB 2F4VQ 5K36H 3TL5A 3AEAB 3J9CA 2UXCQ 1L6VA 4S3SA 5MPOA 1SSOA 4I65A 4KY5A 1NMFA 1PH8A 4WQOB 4M8MA 4A3PA 2FNJB 3O13A 3G6EA 3MHBA 1FRRA 2EY2A 3L7ZC 4LF7Q 2WXIA 3GZNI 1HA5A 1KDBA 1DOLA 5JEAJ 3ZO5B 2KDIA 2R3ZA 2AEHA 3HOVH 2LMCB 1C8CA 5C0XJ 4FA6A 2A73B 1FL0A 5FLXc 1Q81C 1GPXA 2NVQH 1IBML 2NVUI 1G51A 3V96A 1PH6A 3QG1A 1EZ8A 2MSED 3ETRA 3W1SA 1Q1BA 4IM0A 3M4PA 3S1QB 2WXKA 3W1SC 2VH1A 3AFQA 1U4PA 4C3JG 2UU9L 5K36G 1V9JA 1ZOYB 2B8FA 3ERSX 2JA8B 5ELCA 2FE8A 2WQYB 3SK8A 3A1QB 5CHVC 2RPQA 3Q3JA 3NBIA 1GAQB 3I70A 3K7UC 4A93G 2UUAL 2J52A 2JYTA 2E8GA 3NVVA 3T9LA 1IHZA 2WXLA 2DLBA 4QL5A 4HIDA 5C4HA 1CSPA 2AHOB 2R6GA 4H44C 4N9F4 1MD2D 3QO2A 1EO6A 3RNFC 2IJ0A 2NBUA 2INCC 1JMLA 3EC8A 4G7OC 2MO0A 1RJTA 3HOZB 1J19A 2PNRC 4BAXA 1IBKQ 4LUVA 4BBRH 2WU5B 1YNJD 4G50A 2IYDB 4XX5A 3GTPB 5FLMG 1KF6B 2K33A 1LTRD 1SNDA 4LWCA 5AZGA 2HIXA 3UINB 3E3XA 3NTHA 2N8NA 1N34Q 4DXAB 1Y1VG 2N9LA 3H0GB 3GTJB 2RA4A 1HZAA 1LACA 2OEOA 4Y7NH 1KHIA 1PTOC 1T0SC 3Q8CA 3VUWA 2LXKA 4B0EA 3TP8A 3AE4B 3DBLB 1EIYB 4H2AA 2BDOA 2RDFA 5KGUA 1HFGA 2NVYB 2Y0SB 1N36Q 1N9WA 2LXJA 1QE6A 3EFXD 2ASQA 4IWQA 4DAYB 3KLWA 4JL9A 4ZKCB 4EOYA 3PIPA 5T1IA 2FCSA 2VXWA 5M3MB 2FBWB 4ASWC 4KGRA 3W1GA 1ASYA 2V1YA 4OVUA 1E9MA 2GVAA 5E4XA 2VUMG 2KYWA 1EYAA 3K9OB 2KCNA 4JI2Q 3S9WA 1ZDVA 3UDIA 1TR5A 2C5LC 1B9MA 2MFIA 5ELBA 2NPTA 2X38A 3S2AA 2PLPA 1OFFA 4JPBW 1HTOA 1VS0A 2XRSD 3H94A 1QVGA 1UEAB 2DZKA 2KTFA 1EQQA 2QW7A 3L54A 3RLOA 3MHSD 3MC9A 2R92G 3H3VC 3B9JA 1WX9A 4LLGM 3HKZG 4UDUC 3OWEB 3E0JA 3I4NB 1IBLL 4JYAL 4HAEA 2INDC 2BYVE 2F0GA 1TWCB 2Z8LA 4JI1Q 3EFCA 2VL6A 5JAVA 1ZUD2 2QEJC 5J17A 3W5OA 2KHJA 4TQUS 3QHTA 3BVZA 2WAQG 4IKGA 4QAYA 1CJEA 4R9WA 4FJZA 5GAEC 2IL8A 3SDZA 5AUKA 4URKA 4O0AA 3GTGB 4HVBA 1TS2A 2IWHA 4QF4A 2L76A 1U0LA 4RCNA 3IFDA 2MP1A 3KDFB 3PUVA 5IYBH 1HR0Q 1C4AA 1D1KA 5G55A 3OWFA 1UUPA 1S72A 1SNPA 3K7AH 3MEFA 1D2BA 1J7AA 4KKIA 2PNHA 5IOIA 3ZW3A 2WXFA 4GDLB 1EIFA 1VDZA 2K5DA 5IYDH 3WA0A 4H02A 1R7SA 2Q8RE 4DR6L 1D3ZA 1PUTA 1RLFA 4ABNA 2I38A 2RHQB 3TZDA 5AZHA 1QOHA 1N60A 2CS4A 4GXBA 4EZJA 1BMLC 1W3SA 4C3HH 2UXCL 2V4IB 4WWNA 4DXFA 4IDIA 2MO1A 1UELA 1XTCD 3EGRA 3G6JB 3U9SA 4I6NB 2O6VD 3F2UA 1E8YA 5CX3A 5HURA 1GJZA 1I94Q 1ZYRC 1GUTA 1WIAA 2JZPA 3U4VA 5IYBG 4ZHPA 5LXHA 3ZJVA 2I2YA 2Y5PA 3HM3A 1WD0A 2H4OA 2L9HA 1G2SA 2SEBD 1HHVA 4A3KB 4K81A 4LJOB 3TSSA 2CKHB 4DV7Q 4LF5Q 5D7GA 4NPSA 5CV7A 1VZ8A 1FGUA 1PH7A 2F0UA 2KXJA 4ANVA 5EE1A 3MWYW 2AUKA 3F2CA 3Q22A 3JVZX 2B3GA 2WXGA 4C3HG 2L52A 3RD2A 1X3PA 3ZQ4A 3PSEB 2EELA 2BB6A 2PKOA 5DPWA 4HMIA 2B76B 5TR5A 1VD2A 4EKUA 4O2DA 3V60A 1MSHA 1P16A 2AQ2B 1SFOH 3S17H 3OW2A 5EPKA 3V6EB 1BR9A 1XLQA 1QOFA 4QB4A 4N59A 1DOMA 5IWAQ 1C4QA 1D5MC 2O5IC 1VQLA 1HNZL 5EKIA 1U5KA 3BWUD 3VVWB 1B9NA 1SBBB 1J0GA 1SN8A 1Q0WB 1TWFH 5E1FA 2KAJA 3DBLI 1PFSA 5AJ3Q 3A5ZB 3KF8B 4KZ0A 4GKJL 2UUCQ 1EUVB 2GVBA 2Z0DB 4FYDA 3V3XA 4MGZE 2PYKA 1VQBA 2A8VA 3ZRFA 3TEXA 5DPTA 2KOXA 5FK9C 4YHHQ 1E90A 1MPEA 3P1MA 3RUIB 4YXDB 1WGHA 3KF6B 4XWWA 4IJLA 1QB5D 1E8ZA 3OJ3A 4LDTB 4ZRJA 2OEDA 2KWVB 4C56C 2V4LA 3M7NA 1Q8IA 5GAHC 1N36L 2Z9HA 4KD3A 2F0JA 3NZ3A 4ARCA 1DOXA 3DBSA 4PZ8A 2MRPA 3QIAA 3J80i 1EY0A 4H7BA 2J42A 2K8CA 3WIMA 4KY7A 1BCPB 4B9WA 1TS5A 3LYYA 3IFWB 4DV0Q 1KNAA 3FKIH 2Y5CA 2IY1B 1CFMA 2HJ8A 4P16A 4MN3A 2CU1A 2VY3A 3CCQA 2HT1A 2K1BA 3T3OA 3QOJA 2R7FA 1SYEA 3L3OC 3A5UA 2QMTA 3BK1A 2CWAA 2D10A 1P9DU 4DV4L 3PLVA 3S1NH 1SIJA 4TQ1A 2DY7A 1QNKA 3E9IA 1D5ZC 1OQYA 1YN5A 4A55A 1YZ6A 4I7ZC 2B63B 4DK5A 1OO9B 1PYSB 5M3FB 2XTIA 5EE9A 3GP7A 2LZ6A 4L5RC 1TWAB 2QIEB 2WU2B 1YBYA 3ENEA 4C80A 2GMIC 4B3RQ 1WTRA 1Y56A 4JWUC 4YWKA 1ZKHA 3AQQA 4GSWA 4RF1A 4B3ML 3A55A 4GDKB 2KC2A 5IGFA 1B70B 4HKQA 3FKIG 5E6OA 1HR0L 4C7YA 4JI0Q 2Y3AA 1CKMA 5DEHA 1IKLA 1HTPA 1SLJA 1J8IA 2LGYA 3FMCA 5IY0A 4HEDA 1AN8A 3VR4A 1XNQQ 4WWMA 3NEMA 2UUBQ 5ELOA 4K8JA 4A3GG 4XDCA 4GOPA 2HQLA 3SK6A 1DD2A 2INNE 1YVCA 5E6NA 4LF4Q 2D0PA 4CKEA 3CC7A 4ME3A 1N33Q 4QIWB 5DPSA 4M0WA 3X0WA 4LNFA 3BYTB 3SR1A 1BXTA 3T1YQ 1VQ4A 5KNDA 1OXTA 2AQ1B 5GQOA 1PZJD 2MHVA 4DNTB 1E7PB 4R8IA 4C1NI 2E5LQ 3Q0AA 1Y14B 5BN5A 5C3EH 3PIO3 4JX1C 2EQSA 2IHFA 1EYDA 4LF9Q 1JW9D 2RSNA 3K80C 4DV7L 4DR4L 2K14A 1LO5D 4BY7G 1ZPSA 4ZUIA 2AL6A 3QAQA 2PMZE 3TMEA 1S40A 3B6YA 4EQ5A 4DNRB 2HHHQ 4IFDJ 5EE3A 1A62A 3DDCB 3CCRA 1LFDA 4W9JA 4CHKA 4LFAQ 1KLGD 3RLFA 5C6AA 5C0XH 2BBCA 3QWNA 4LMQD 2KQ4X 3H7PB 3AECB 4DAPA 1GUNA 3ZTDA 4CYEA 3NQTA 1TYGB 3Q8AA 3CAMA 1K73C 2BWFA 2KC1A 1V49A 3OOCA 1WGGA 1H9KA 1IW7C 3HOYH 1LGRA 2F3WA 2PW9A 3L9AX 5C3EG 2J0KA 2NB0A 4IM3A 2ZJRA 4C2MH 1CZPA 1CKOA 4QUFA 2QCPX 4MZ9A 5I6WA 1O80A 1DONA 3HOWH 2I07B 4HR7B 2JSVX 2F0HA 1MFWA 4X65Q 4WAFA 4BBSB 5HHDG 3ZGZA 1L1OB 2F1MA 2WKDA 5EPJA 1WXMA 1HE8A 4XWTA 1JRPA 5C4XB 4GLSC 5JEAG 2JA6B 3P4RB 3ONAB 3EUB2 3A8JE 5JXVA 4ZUJA 5C0XG 3A8IE 4IALA 3J7YW 4NXMQ 1FR3A 4ODGA 3NSWA 4DV5Q 3T51B 3AV8A 3BYYB 3I72A 4DUYQ 3VRAB 2VB2X 5JH5C 1MHWC 4A3JH 1Y8PB 3A0JA 4FXDA 5M5WB 2L83A 4POGA 3HOYG 4BKSA 3M4OH 4A3MB 4FN2A 1JORA 1FD6A 1K8OA 1AZQA 3OTOQ 1G2TA 2JPHA 2OHFA 2CHZA 2NN6I 1OTCA 1U4LA 2HJ1A 3AMZA 4KGSA 3Q3MC 4GB9A 3TEYA 4JI4Q 1E10A 2LUMA 3NOBA 2NBWB 3IAS1 3MA2B 2O4XA 4HXDA 2JA7B 2OCEA 1F9JA 4ZOHC 1KABA 3GO5A 4UHVA 4AYBB 1TTNA 4OZCA 5BN4A 2M56B 2LVPA 2KJHB 2ICEC 4B95A 4HSPA 1CHQD 4KN4C 1SIFA 2EKIA 4S17A 4FF4A 3SHLA 3NVWA 1XXGA 2K03A 1SYDA 1I35A 3JAME 1NTGA 3F2BA 2KJXA 4CKCA 4GLVB 2PCFB 3TS0A 1BNZA 2KACA 1XPUA 3A9JB 1UE5A 2OXPA 3PGZA 1WJ6A 3KW5B 1I50B 4P1BC 3UIOB 1WI0A 2R93H 3VYSA 4US8A 4R1JA 2B2UC 1C3TA 4NQKE 2L12A 2VB3X 3NBHB 1TZOA 4BY1B 2LEKA 4HSVA 1V1PA 3J7AV 5JPMC 2L1AA 4A3EG 2K1FA 2R7DA 2BYFA 2MW5A 3GTMB 5CV9A 3N20C 2FXQA 1WMHA 1A0IA 4MM3A 1FXTB 3HOZH 4KN7C 3VA7A 4OWWB 1JQYD 1WJNA 3GE3C 2IHEA 1GOZA 1C7YA 1I6HB 2QEXA 1FFVA 3AH7A 3QARA 4GU2A 1PDQA 2KOLA 1XNQL 3NHHA 5A35A 1IL2A 1AH9A 2UUBL 5BO4B 5IIFA 2DBYA 3SDLC 3ZJTA 1PH4A 1AZPA 4X57B 2G4DB 2UXDL 4DR5L 1WZ3A 2WXHA 2N3SA 3ZKJC 2QDFA 3H0GH 4A4IA 1A2TA 3GTJH 2BOSA 3M3YH 2R93G 1YQ4B 1ZE3D 1T5EA 4DWFA 3U4ZA 1YMHE 4FF2A 2NVYH 2O2VA 1WYGA 2KDMA 5BN3A 2D5DA 2I1JA 2I46A 1XT9B 2D0OA 2PW7A 1C1YB 2D5GA 3B0AA 1GM5A 3KUDB 5M3MH 4R4CA 3PIOA 4WQMA 4PZ7A 1A3TA 2ZCCA 3V62A 4NDXA 1V8QA 1NR4A 1Y1WG 2YU9B 2SOBA 3MEHA 1V5OA 4X66Q 1EY4A 4KK7A 3Q69A 2CH4W 2TMPA 4JBKA 1VCIA 3AYHB 2AWOA 2D62A 2KN5A 3K5MA 1AWDA 5CR3A 2DZIA 5DAUA 1SE4A 3H09A 3I4MG 3M62B 1F2YA 5FR6A 1RFAA 1N61A 1CQFA 4LK0M 1ENFA 1R4MB 3CCVA 1Q3LA 3I4NH 1VQNA 3J7A5 1SE9A 1A5RA 1ZXHA 3GS2A 5HKHA 2FUG1 1TWCH 1Q8KA 1CI3M 2WIIB 2IY0B 3BY4B 3ZXRA 2ZNVC 2GBNA 4LFBL 4QUCA 1IYJB 1BBWA 4QY7A 4YL8A 2HQEA 2UU7A 4TRDA 1N32Q 1E24A 2KBNA 2KVZA 4EZKA 1XWEA 2J7ZA 4ZK9B 3K5NA 3GTGH 4EUTA 4XGAB 2KCCA 4UP9A 1VF5C 4FHKA 4G11A 2WFWA 3DHQA 4J6HA 4R3DA 1IBXB 2WX0A 1PRTB 5M5YH 3T1HL 2KA7A 2JF5A 2NS5A 2PVGC 4DAMA 5IGBA 3NS8A 1XF5L 3CU7A 2YEPF 4GLAC 4JOIC 1BKBA 2LSSA 2WXQA 4HROA 1C9FA 2Z1CA 4DV5L 1R9TB 4IWOA 3U52E 1KLVA 4DUYL 3QC8B 4X6AH 4ACFA 1G8ZD 2RDHA 3SD5A 4EFOA 2NVXB 2G9HD 2BQQA 1FXIA 3FVQA 3PGEA 3OTOL 4GN4B 1HQMC 5E6PA 1KD1C 4A76A 2KO3A 2EY6A 1PFNA 2ZTEA 4FVMA 2ZTDA 1PZID 4YIJA 3OG5A 1C78A 2DNFA 1KL9A 4GNXB 4XQJA 5LLIA 2ZEQA 4RKLA 2O2LD 4EZLA 1YHBA 1FNUA 2KVRA 2WGSA 3AI5A 4A3KH 4BOSC 1F0ZA 1B44D 3CW2C 1A15A 1IBMQ 3LX0A 2EXDA 1M1KC 2D07B 1OXVA 1VQFA 4K5XA 4K0KL 1LTBD 4HJAA 3NE5B 1HUNA 1IGCA 3GZNB 1EY6A 4CDDC 2UU9Q 1V6EA 2HTHA 3PZDA 2X8XX 3FDTA 4IJHA 4K8IA 3PSIA 5C5LA 2C60A 3W2DA 5I9OA 5IGCA 4JQWC 4HCNB 3L0WB 3D8GA 1J7BA 2KMAA 4LJPB 4HTHA 1ZXIA 2F0EA 3M85A 4HEA1 1FMAD 4B6WA 1V9PA 3Q3FA 1L4DB 4R4IA 2A68C 2Z6BA 1NCVA 3BDCA 4R8NA 5CBEE 1UF0A 2E3TA 1FVIA 4A3KG 2K3UA 5FR3A 2UWQA 4GKKL 1TIFA 4BWGB 4OXPA 1X55A 2NTSA 3CPFA 3S2DB 1PGXA 3JAMc 4ZCKA 3AE1B 3DBHI 1IP9A 1SYBA 2W55A 2XIWA 3NWTA 1P7EA 1XLPA 4FXKC 3OMCA 2E2HB 1JALA 1X9NA 1UNSA 2PZWA 3T16A 5KYIA 4IUMB 3TDQA 3K58A 3DHHC 4K2LA 4JBMA 4B3SL 1J6QA 5M5XB 1TKGA 4DA2A 4AP4C 4DHZB 4ARIA 2WAQE 1YJ1A 4P6VF 5COYA 1L7YA 2MHJA 2OOBB 2F0QA 3EROA 1VQAA 2WP9B 3DVNU 3M95A 2CW0D 1TGZB 1E7VA 4RGMA 1PV4A 2K04A 3GV6A 1TXYA 3EBEA 2I0QA 1CM9A 2PZUA 1I42A 1R4MI 2LS01 2EMSA 1QWYA 2KHSA 1B7YB 4OZBA 2A6ED 4KSLC 2V3SA 1SMYC 2NN6H 4JOIA 4WJWA 3RFZB 3BIID 1J5EL 2EZVA 2D3BA 4O1NA 3WWVA 3PTFC 1QOBA 1HZ6A 1NE3A 4L6TB 3RMHA 2G45B 4NY0A 3AU5A 1QCBD 4LTUA 5E6JA 5IE8A 2JU6X 3ONSA 4HJKA 4PT5A 5CV6A 3Q24A 3RZDB 1IBLQ 2WLBA 3H6MA 1B2TA 3NZSA 2JP1A 1JWSD 2RBMA 1UD7A 1JOOA 1EIHA 1RD9D 1XD3B 3HOXH 1VQ8A 5C4ZA 1CZWA 1GC7A 1ZXTA 4M01A 1XMQL 4A3DB 3R7RA 4EQOA 3IT6B 4WJPA 2JQOA 1SNQA 2KANA 3G7LA 2RMMA 4AQ7A 3GTKB 1HNXQ 2FMMA 1ASZA 4W9KA 1HRJA 1X32A 2OQKA 2K8BA 2WNMA 4FLHA 4AJWA 4PK1A 1E1TA 4Q0FA 3CCJA 3TJPA 1SDFA 4DR6Q 3SE0A 4JW0A 4OGQC 4RHRA 4P75A 4NKLA 4ANUA 1LTSD 3GD7A 3TQYA 1PDXA 4LNIA 1V1OA 1Z47A 3CF5A 3PO2B 1NEKB 4K7UA 1A2UA 4IFDG 3HOXG 1XNRQ 3AM9A 3W1YA 1MGSA 2A1AA 3S1RB 4MSQB 1VQCA 1PVOA 1FJGQ 2OQ0A 3VRBB 4J15A 3N32A 3ZXVA 1Q12A 1KC8C 3HM6X 1BBUA 1RFKA 3PUZA 2NBFA 1VR9A 2L0TA 3LDZE 4DXGA 1GVPA 2A4ZA 3PVLA 4Y52H 1NENB 3H6NA 3HHMA 1Y69U 1PXUA 1F9RA 1GUAB 3WCQA 4A3CG 4PS7A 2MBBB 1STEA 2K9XA 4J8QA 2G9DA 4KKSA 3SGIA 1OXUA 2IGHA 3U7ZA 1JE5A 3S16H 1MI2A 3KYDD 4W9FA 2JXMB 1YJNA 2VQFL 1G291 1VQJA 1WWTA 1YJIA 1K51A 1FPYA 2M4NA 4YSYB 1L2NA 1JROA 4A3FH 4ANWA 4B0MA 1TWGH 3PS6A 4JPSA 2LGXA 3SU8X 1SAPA 4ICUA 1KQSA 2C35B 3OIQA 5HGQA 1OQRA 2AL3A 2RQXA 2N7JA 3KVFB 2MH7A 4PQXA 2Z59B 1GB1A 3HOVG 1LLRD 1IPGA 1CMXB 3W9CB 3Q8EA 1SF0A 2JRIB 1HNZQ 2NMQA 1I4XA 3AE9B 4UP8A 1VQPA 3DVNV 2M8SA 2VZKB 4ZKBB 1YJWA 3FKYA 3LWUA 2LRWA 5BYQA 3TMPB 4IUPA 3U8ZA 2LGDA 1STAA 4GKJQ 2C9WB 2R7ZB 2L7RA 2CWPA 3EQLC 3L08A 2F0WA 4AOFA 2K75A 2K01A 3J81j 4A3FG 2PPHA 2INPE 4WJQA 3ZNZB 3N9YC 2H1EA 3ZLZA 3WAOA 1X54A 1PTOD 1I3QB 5M5WH 2PQEA 3VYUA 4A3MH 2QILA 3HFZB 4G0NB 2JUOA 4FO2A 2YV5A 2K32A 4RMFA 3DWQA 4JLCA 3Q3NC 1SJED 1HPCA 1T5XD 2LJIA 1II3A 3Q8BA 5BMGA 2OWOA 4X62L 4BBRG 3RZOB 1GUGA 1F1HA 3D3RA 2B2YA 2JA7H 3VH4B 1DJRD 3I57A 2MBOA 3IXSA 3ZDMC 4C3IB 3Q14C 2LFIA 1WCMB 5EPLA 4EX5A 3TUOA 3PHWB 2N55A 1BCPC 1R4QB 4IG7B 1VQIA 3H15A 4X3KA 3I3TB 3KK7A 5IP4D 2KFJA 4M02A 3TBLD 1R4PB 4A3BH 4DV4Q 1YX5B 4A3MG 5EDSA 5KNBA 1WI5A 1K83H 2A5UA 2XGTA 1L0WA 1HXYD 1I50H 2ENBA 4HMJA 3ECIA 3CRLC 3TP6A 1NI2A 1WJUA 1B4OA 1X3FA 3DBRB 3HRDD 1LXDA 3TP7A 5CBAE 3TRZA 1KTKA 5E7NA 4DU9A 4HDOA 5EQ0A 4BY1H 4B3MQ 3LJ3A 2JA5H 3I73A 2CHXA 1Q10A 3I91A 3GTMH 2JQRB 1HNXL 4DBGA 2KWCA 1M94A 3MZ5A 3U50C 3PO3B 1M8AA 4HPMB 3ULJA 2PMZB 2WB1E 4Q2JA 2LVOA 3R2TA 2SDFA 4A3BG 2PVOD 2VQEL 1WGRA 2W9NA 1IBXA 1DYQA 2K8HA 5LL6S 2BGFA 5H1SE 4KHPL 1P7FA 5CYUA 5E4WC 4JI3Q 1XNRL 5JHAA 5C23A 1KRTA 1A70A 3PV1A 4HKZE 1S4ZA 2KX0A 4DK3C 4PMWA 1FJGL 3R7QA 2AUJD 5I4DA 4LF8Q 3VXWA 3S24A 5LMUL 3X23A 2JA5G 1PLFA 2BPSA 3K6OA 4I6LB 5JVH3 1H8CA 5AFWA 1ZYRD 3CSTA 2RDGA 4F88A 5GADC 3MJ5A 1Z6HA 2EYPA 2ZXPA 2KQ3A 2ZTCA 3MXPA 3D31A 1DZ1A 4DR2L 2YU9H 1YJ9A 4WAAA 3TEWA 3K0YA 5IYDG 3AB9A 1A8VA 4H13C 4MACA 2WDTB 1WTXA 3BDLA 3R2IA 5EBCA 4PZ6A 4DR4Q 3KF8A 3CCEA 4KV2A 1P1AA 4NJ6A 2TSSA 4K5WA 1BBXC 2BYTA 3CCMA 1QZGA 1E2ZA 4BZAA 3KF6A 3S15H 4BBNC 1O7LA 4P71A 1L0YB 2HDEA 5NUCA 3I4OA 2HCCA 1YNND 4MGYE 2KUMA 3E9HA 5D3DA 1KIXA 2DZMA 3KFUA 4FP5D 1KRHA 2G4SA 1UBIA 1B53A 3PRMB 3RN5A 4J3OD 4XZ4A 3D4RA 3ND9A 2GOWA 1HZ9A 3AE8B 3DHIC 1YHAA 1K3BC 2N4FA 2WYQA 3UE1A 4ZQ3A 1B3QA 4L2YA 3S14B 2V0GA 1H9MA 2JK8A 4DUZL 3PHXB 2GI9A 3RCZA 1SB3C 3WANA 1YQBA 1A63A 4ANXA 3APCA 4OIKA 2PE9A 1L1OC 2M19A 2WXOA 2SNSA 2MP2A 2ZPNA 1R9TH 4M8NA 3HG9A 3EJIA 1MSGA 1VQ6A 3DWAA 2X6GA 2N9PC 4KLKA 2E76C 2EE1A 2BH8A 2NVXH 2FCQA 2CQOA 1L6UA 1GUWA 1E5WA 3BVMA 2RDBC 2ONQA 1F2RI 4IM2A 1YJJA 3RNGC 4DHJD 1HNWL 1K53A 2PIAA 2FMCA 3T4AC 2N9XA 4BOZB 2HD3A 4JBWA 1CKNB 4O42A 4YCUA 1P0RA 4EEWA 3RYTA 1MI0A 1GHKA 1WTVA 1EM7A 2NZHA 1O7IA 1AW7A 1YN4A 2WWZA 3ZIMA 2I5LX 5KYLA 1JE4A 1JJGA 3EIVA 1I7HA 4V190 2AWTA 2DYOA 4IUVA 3NS1A 4CQNA 2FJ2A 3DUZA 2B2VC 5I6YA 1C0AA 1Z7TA 2N0SB 1F9QA 2K5VA 2PE6B 2BE5C 3DBRI 1S3SG 4A90A 2JEAI 3VA5A 1GHJA 2EVBA 1PHJA 1UAPA 4B3TL 1UH6A 3KUCB 1VMCA 1PZKD 2F0KA 2EYLA 2K6AA 2MCNB 4JK1C 1NVID 3N6RA 2LGIA 1MIUA 3CCSA 1S5FD 4GLXA 4WJ4A 2K05A 1ZW7A 2D3AA 4QQBX 4DK0A 3UGBB 3ZNHB 1RWSA 4LW1A 2RKSA 4AIMA 1N5XA 1D8LA 4BKSD 1TWHB 3E56A 1UZXB 3NZUA 2G1EA 2PZTA 3BDOA 3E6ZX 5A2QE 3AU4A 5CORA 2KK8A 2ID0A 4JI5L 4GOCA 3VTVA 1FYCA 2EIFA 3P1HA 4RGOS 2XBBC 3PCOB 3STBC 1STHA 2OT2A 2XEWA 3VR5A 3W5VB 1ZGUB 5IT9E 1RM6C 3S2DH 3MJWA 4MGKE 5F2DA 2YLMA 2V4DA 3P4SB 4M00A 4FXCA 2Z0EB 1C9OA 2E2HH 4B9KA 2EYJA 3NP8A 2Y0SE 3UE0A 5LHY1 1CSQA 2UXDQ 4DR5Q 4W9IA 5CC4A 1O7ZA 4WORA 4JI3L 4DV3L 2KEEA 5D94A 4LNQA 5M5XH 2UXBL 4LNOA 1QZHA 1I4HA 1PH1A 3J80E 1L2FA 1KAAA 2F0PA 3PUXA 4LF8L 4FBJB 3IL8A 4REZA 2A69C 2ZXRA 3WOEA 2L15A 2JE6I 1CT1D 3NUCA 1JT8A 3L2PA 2KLGA 5IODA 4YTNB 4BVUC 3PQIA 4DPGA 2BKRB 5DPRA 1U9RA 1WGYA 1SJHD 4X64L 2K52A 4C3JB 2O6VB 2WXPA 1SR3A 5ELNA 4MGIE 2J0JA 3RMKC 1EQTA 2WB1G 3Q6BA 4M1UB 2KVMA 2CJOA 4RH6A 3TP5A 3R8BA 2N78A 3U58A 3MXNA 4ZRIA 4A93B 5BR8L 4B08A 4DV2Q 3RZDH 4R4TA 4PYUA 1TVXA 5T8IA 1LT3D 1VQHA 1NUCA 1BF4A 4MSMB 5D2MB 2K6DB 2CFMA 2FCMA 4LFBQ 2F0MA 1GNUA 3C8YA 1IW7D 2FIDA 5ELFA 1MJCA 3BZCA 4FDBA 4IOCA 1C4CA 3GTQH 3URYA 3UIPB 3MP9A 2KDEB 3TN2A 3ZRCA 3KBGA 4A3DH 3RPFC 4GOPB 3MC0B 3HOUH 4ZRZA 5AUIA 2B2VA 3T1HQ 3VR3A 1GUSA 1XTDA 4IPHA 3GTKH 3CQZB 4OO1I 1PRTC 2DZJA 1Y1VB 3JAMi 4A3IH 4M0WB 4FULA 4OWTB 4HRSA 2JEBI 3M9BA 2LVQA 5FO7B 1UE7A 1SE8A 2UYZB 1UEBA 5IP7H 1IYVA 2I1KA 1AFPA 4KV6A 1EWYC 4EQNA 2IDYA 5LMNW 2MUYA 4GGQA 1QJOA 3PO2H 1V2YA 4H0LC 3IHPC 3N1XC 1XPOA 2SAKA 4NQLB 4YTPB 3TEHB 1YNTE 2GBMA 5IA7A 3C1FA 4P2CB 1VZ7A 2MWSB 4DV1L 3IG3A 3HOWG 2VUMB 1XLOA 3HEJA 2XRQD 1ENCA 3DVGX 3N52A 3NWSA 5FO9B 4K7WA 3HOUG 4BA2I 5IGDA 3SVMA 2N1WA 5IGEA 2V9HA 1B9RA 4A3IG 1W2BA 4ZRQA 4WJOA 4W9CA 3CCUA 1JOQA 2N49A 4GNXC 3UF8A 4Y7NB 4LFCL 3AE6B 4KY6A 2R92B 5E3FA 3HKZB 1L0XB 2E75C 1ACCA 3S1QH 2JXXA 3NVZA 4AQYQ 1GUOA 4K0KQ 3PRPB 3JSVA 4NAMA 4A3JG 3D32A 1FRDA 4TVAB 4DF7A 2JA8H 3FHWA 1QT9A 1DGSA 2C7NB 4EGVA 1MKHA 2IX0A 5JJKA 1HQRD 3P4QB 3L4PA 1OXXK 1OXSC 1VQDA 4JI8L 4RM8A 4FF1A 4GS3A 1A3VA 2ZZPB 3QJYA 2IGGA 2MGSA 3IRBA 3DPDA 4L5SA 2KKCA 4AJYB 2CQAA 4OIJA 2Y5BB 1TKEA 2A74C 1KDCA 4IUNA 1ILPA 4HJ9A 1QOGA 5M9OA 2D2CC 3I2ZA 4LUZA 4P74A 3T13A 3HGBA 2QGQA 2A6HC 2NCNA 4RMAA 4NJCA 2PO4A 1YX6B 4W9LA 4V0BA 1HH2P 1GXDC 4GMVA 3HZXA 5EGTA 1XX8A 4GKKQ 4B9XA 2CVRA 2Z4HA 3A54A 2ICIA 4HIOA 4DQOC 2WXJA 2CCZA 3GTPH 2D2QA 1V97A 3H7SA 4TKNA 1ET9A 3U7DA 3APDA 3CMEA 2R7ZH 2LFNA 3LB8C 2JA8G 4XYOA 4DK6C 3ND8A 1D7QA 5EKLA 5EJWA 4ZYSA 4MNOA 1SNOA 1XMOL 1WY8A 3HVZA 3L0OA 1D6EC 1C79A 4B3SQ 1DOKA 4NXNL 3W5UB 4P1CC 3DBHB 1JQ4A 1C48A 4FF3A 2PEAA 2KWDA 3NELA 4TMAB 1Q1OA 2L11A 2WX1A 5C3XA 2GRIA 2Z6KC 2K5NA 3GTLB 5CMDA 3A56A 1IKMA 1WJJA 1FEHA 1S5BD 2W3RA 3AE2B 3D0FA 3CWIA 3HOZG 4X3UA 1EOTA 3M3JA 1VMPA 3B1LX 4LNKA 4C1NK 5IT9c 1YN3A 4F87A 4QCLA 3R66C 1KM7A 2EJFC 4RKBA 1WCMH 2B2TC 3JAML 1RYJA 1RTNA 1I4QA 4C3HB 4IPCA 2QDBA 4XDDA 1UBQA 1I4GA 5C44B 4HJ5A 1EWIA 3H0GG 1J5EQ 1HZCA 4KTAA 1HEZE 4XYQA 3DEOA 2NR2A 1PYWD 3KQ4A 4JWSC 4ILWA 2Y0SG 4DV2L 5I2YA 1L5PA 4HDQA 3TCAA 1V1PB 4JBJA 2QC8A 4HN7A 3L13A 2ZCBA 3UDFA 5BMHA 3NRZA 4DR1L 1RDPD 1JMCA 5M3MG 3PF4A 2EJGC 1H95A 5ELEA 1LM8B 2GLSA 2MBQA 4NZLB 2IY5B 1F52A 3PF5A 2JWUA 3CSFA 4KDIC 3OHXC 4W9DA 4EE2A 3HKSA 2XNAC 1WCMG 3RNUA 2BB5A 4L8JA 1XMQQ 3QA8A 3AEGB 3L17A 2RPVA 3RT3B 5GXGB 3P42A 3UQAA 2XK5B 1SYFA 1ILQA 1WSPA 5FJ8H 2M0XA 3G4SA 3PO3H 4A9AA 3N1YC 1B1ZA 1HR0W 4I6PA 2LKVA 4DDID 2CU3A 3GB1A 4XE0A 3I4NG 2AWNA 2F0IA 2KECA 3UDXA 5HG2A 1EEID 2E2JB 4RM9A 5DCNA 4RCOA 1KLUD 1WM2A 4ZDVA 2CKZB 4MEMA 2KTRB 1GC6A 3L10B 2F0TA 1SNMA 2B2UA 1WVLA 3AFPA 2B8GA 5IP9H 2F0DA 4JV5L 1M90C 3AB5A 4W9GA 1TWFB 3KOJA 3P2BA 3WOFA 1OGWA 1LUZA 2K5QA 1H9RA 2GB1A 4L1BA 4D2KA 4DR3L 3CC4A 4HLEA 3FRPB 3GQBA 3PRZA 1N62A 3P7JA 2M2LA 2N88A 4KHVA 2Q8IB 1WXVA 2PI2E 3U30A 2JJQA 2BS4B 4L23A 4J1MA 2WDQB 1JWMD 3PO3G 3K5OA 1YIWA 4K1RB 3GV3A 3AE3B 1HCZA 1NMGA 3F1ZA
chains in the Genus database with same CATH topology
1VJKA 1C77A 5H8YE 1TT2A 2NYZD 2NVTB 3KWVA 3FILB 3B2GA 1MBYA 3V2TA 2IX3A 3D4WA 4DFAA 2HUGA 4TKOB 4U673 3S2HB 3FKIB 3MXGA 2WACA 2A5HA 3BK2A 3J81E 2F0VA 1BOSA 1KDAA 3U2SC 2A68D 3VYRA 2L5TA 2B2TA 4KMUC 3HVDA 5ISRA 1D5XC 3MVVA 4A3GB 1RKNA 4UAIA 5CV5A 1TY0A 2L0CA 2MJ3A 1PTOF 1PMRA 3NTKA 3DWMA 4YSZB 3HS0C 1ONLA 4ULLA 4YWGG 4OO1H 1Y8NB 1FGBD 1S5DD 4ZLTF 5FOBB 4LK1C 2WXMA 2WXRA 2MJ8A 4ITKA 3J7AF 1LTID 1F2LA 3D6CA 3K59A 2CHBD 3NQIA 2F3VA 4KHZA 4BY7B 2KN4A 1BCPF 1BO0A 3EA6A 4IQZA 1SMYD 2L1BA 4KI0A 1H9SB 3C3LA 1F2RC 4MHEA 4Q5VA 4RAUC 2NWGA 3PIP3 3PUWA 3R3OA 4RGNA 5C3EB 1WXQA 3TZUA 5FO8B 3OIPA 2L4NA 2EYOA 2A6EC 1ZP0B 2PTLA 3LWEA 2JSOA 2FINB 2Q5WD 5DM63 3OSOA 3NTIA 1C4PA 2NN6G 2EYMA 1STNA 2LMCA 3IT4B 1F9PA 5D14A 1RTOA 2XVSA 3BVGA 5D3IB 4ZHOA 2WXNA 3SR6A 3HOYB 1FFUA 3NPPA 1SXTA 1K50A 4CHTB 4DGZA 1FNVA 3TEZA 4NAWB 1Y8OB 5BMIA 1X3QA 3OPOA 3T53B 2N9KA 1MHXA 1F2MA 1VZ6A 3HRZC 3P63A 3GTOB 5EE0A 5KIXA 2K22A 4KKUA 3M4YA 5HFYA 1CK1A 3M4OB 4WFN3 2DY8A 1QG7A 4F7XA 2W54A 3S1MB 4A8XC 5FKAC 1ET6A 1TU2B 4CKBA 1V43A 2WKCA 4USAA 2EY5A 2L55A 1DOYA 1ESFA 3QOLA 2J53A 3I90A 3U4EG 1HA6A 3QB3A 3I4LA 4A3EB 2ON8A 2NTTA 4DAYA 1NYRA 3EVQA 4A6QA 2QKIC 1BUVT 5C5MA 4KX6B 1IL8A 1RF2D 1F9SA 2IGDA 2BTEA 4ZAIA 1FM0D 3UI2A 3DEPA 1JWBD 5EE3A 4L63B 2BW2A 2R93B 3MHZA 5BYSA 5IOCA 5J39A 1SYCA 1N63A 1EIGA 3HP3A 3D4DA 1LTAD 1YNJC 1Y1WB 3PO0A 1QF6A 1NYQA 4YTMB 4KKTA 1FO4A 1N5WA 1EY7A 5JJZA 3I4MB 3M3YB 1SNCA 4YT0B 3DM1A 1BCPD 2JX5A 1JWAD 1AP0A 4KJNA 3BS1A 3VQIA 4M8AA 3AE7B 5C2TB 5C0XI 2K5WA 2EJMA 1XCQL 2PW5A 1YQ3B 3VR8B 1SE3A 1TKYA 1NAPA 2NUCA 1I4RA 1TQOA 1WRIA 2EPBA 2Q8TA 3E9SA 3AEBB 1A6XA 3D6WA 1GB4A 4RF0A 3DXJC 3DWPA 3OMGA 1XEEA 2H88B 2VNUD 1LT6D 4KD4A 2JYEA 2XWJB 2W82A 4KKJA 1G91A 2F0OA 2F0LA 4LJZC 1AYFA 2QSDA 5M5YB 1WTQA 1VF7A 4IUQA 4Z9CB 4PV1C 1M4VA 4IUUA 2YEPB 1PFMA 1BDOA 1BQQT 1EL0A 1PFDA 2D9UA 4K6LA 3H8HA 4N58A 2LHDA 4MH8A 2E74C 1O7YA 4PMBA 1A3UA 4G57A 1T3QA 2Z4IA 3BG3A 1Q1EA 1LV9A 1FCCC 1NR2A 2EYFA 4JE3B 2K5PA 2IPKD 3OW7A 4XQNA 3KLRA 1FNWA 1TKWB 3BZDB 4QMGA 2E2IB 2XN9C 1GJXA 4CJ2C 4XTCS 1L4ZB 2PPBC 4LAAA 2HDMA 1ICWA 2K28A 1STGA 2E2DC 2MJEA 1PRTF 4EQPA 2HCIA 2BDNA 1JR0D 4TSSA 2O5JC 3KBXA 1IGDA 1PGAA 2QF7A 4HCSA 1IYUA 1YNNC 1JOKA 3NUHB 2K7VA 1CA6A 2DWQA 1SSNA 1JB3A 4ME5A 3V05A 3K5LA 1ML0D 1KH0A 5C4JB 5K5PA 1FD7D 5G5HA 2DNCA 5CGKA 1EWHA 1LT4D 1XO3A 1UWMA 5CV8A 3IAYA 1G6ZA 4K14A 3CRKC 1PTOB 2DN8A 1J9OA 1JCKB 4CJ1B 1HTLD 5TSSA 1PGBA 3I9V1 5T1GA 2WS3B 1NI3A 4G7HC 1CHPD 3C2PA 2BE5D 4X3TA 1QNUA 4PNYA 2EDGA 1ROEA 2H89B 2C5CA 1HZ5A 3UI3A 2RVLA 1MVKA 3IFTA 2WV6D 1QILA 3M7GA 4KGTA 2DYMA 3PV0A 2X6LA 4NP5A 4DAVA 4IN3A 1VDVA 2WDVB 1C76A 2ZT9C 3KLSA 3MFYA 1I4PA 1Q90A 3U9OA 3HOXB 2BA1A 4C7ZA 2XWBB 3SFDB 1DGJA 2F0SA 4XIGS 1STYA 2IX1A 3NVYA 2A69D 1NSNS 2E6XA 1ZKOA 5J22A 1ZEQX 4OW0A 2F4IA 4N9TA 4RFBA 1EU4A 1LABA 2PMVA 1MHHE 1W6JA 1XYIA 5HI1A 1SYGA 2M00A 4FNFA 3K57A 3R93A 1J7CA 2B39A 3HOVB 5A2QL 4IURA 3FPUB 2FHTA 2KMMA 4MIUA 3KUPA 5ELDA 2NVQB 2BA0A 4XT1B 3AE5B 2ZW1A 5IT9L 1DM0B 3PZ7A 3S16B 5JEAH 1VRAB 5G5GA 2J4XA 4IOIE 3AN1A 2BT6A 1TIID 3SFEB 1PRTD 4WRDA 4A3FB 1TWGB 3MXUA 3FAHA 2C9OA 1I6VC 2IW3A 2QJLA 3J80L 1EFID 1E6EB 1E0BA 2BS2B 4DK1A 3IAM1 1JWUD 3P20A 2JYOA 4BBRB 1CQVA 3P4PB 1K8MA 3NBHA 1U4RA 5DNFA 3AEEB 1TJEA 1WTOA 2EXZA 1RHPA 3ZYYX 3ITPA 5C3WA 2WDRB 1RCVD 1QLBB 4E6IA 4HJGE 3SK4A 2ZW0A 4IUTA 3X3NA 4G4KA 4K5VA 3B2FA 2WAQB 1HFNA 3MTSA 3T3NA 3I8ZA 4K6DA 4XXEA 4WURA 4IZ8A 5JPNC 1CA5A 4IFDI 1DXMA 1JC7A 2A6HD 1S5ED 1E0ZA 3TBIB 2JXTA 4U68A 4A3BB 3AU7A 4X3SA 1K83B 1LTGD 3Q6SA 4N6EB 4XT3B 3X3MA 1K52A 2SNMA 5BYRA 4FXGC 2IT1A 5KEEA 3PUYA 2MPMA 2JA5B 3VYTA 1TS4A 1PFBA 1H9JA 3SK5A 3LXFA 3ABVB 2ACZB 3K7AB 1HUMA 2WP8J 4US9A 1FIQA 3A8KE 5G3LF 1IBXA 1STBA 1JICA 2J0TD 4KJOA 3Q23A 1EWCA 3SEBA 3AEDB 2F0NA 1LTTD 5I2XA 1ESRA 4XQQA 3MFGA 2EOTA 1FXAA 4OHJA 3NK9A 4K2KA 1B3AA 4MM3B 1FCLA 1ENAA 4TQ0A 2M0AA 2F03A 4C3IG 3I3CA 1XCTL 1L0VB 1EQVA 2L32A 4ZRPA 3VR2A 3C1EA 3S15B 1D1IA 2XSCA 3CKIB 2BCOA 5EKKA 1SFOB 3S17B 3W3AA 5EBDA 5JOBA 4CBVA 1CTMA 1VLBA 2LHEA 4OZAA 3FILA 1EU3A 4AS1A 3KLSX 4CJ0B 2KEDA 4BS9A 1F2ZA 2HDLA 1S5CD 5FLXE 4CGYB 1QOAA 4OVZA 1O78A 1WGKA 3VR9B 3LNNA 1EZ6A 1TS3A 3PZ8A 3FC4A 5I9PA 5IGGA 3AEFB 1LT5D 1E2VA 2RSOA 3C46A 1CZGA 1BUIC 4WIPA 1EY8A 1SEBD 2F0FA 4EVOA 1AEXA 1V8CA 1TY2A 2BS3B 5LL6X 1D4BA 1E2WA 3ERQA 2OF1A 4NW2A 3SXHA 3H91A 2B2WC 4GZYC 2HTME 1U4MA 3S1NB 2MEKA 5C3JB 4RWSC 4YSXB 2V3NA 1QQRA 3DWGC 2VZKD 4OL7A 4PMCA 3AMUA 1H9SA 5HGTA 3DMUA 3RUZA 5D65A 3WDNA 2DNEA 5FLXL 1ZDXA 4XDXA 1UGJA 1UWXA 1WTWA 3MAQA 2EY1A 1WD1A 1B50A 1SE2A 4RA8A 1RODA 2K0PA 1PTOH 4DN4M 4BA1I 4NMZA 3IKJA 4RGTA 3KWLA 2WB1B 5G3LD 3A7LA 4WH4A 5H92C 1EY9A 5KNCA 1QKZA 4MT5A 5J1ZA 1F77A 2CW0C 3VR6A 1EYCA 4OO1G 5KRUA 1KFYB 2WINB 4ID6A 2CJNA 4HCEA 3A7AB 5LNK1 3J81L 2M9VA 2R61A 3PMFA 4F8MA 2FFKB 2X69A 4RHSA 5DM73 2YYZA 2AX5A 2V3PA 1T6BX 2AQ3B 3Q8FA 2LY7A 3FEWX 5CV4A 4G7ZC 1EY5A 4IFDH 2ZXOA 3FPPA 2NZ1D 5JVG3 4C2MB 3GTQB 3CIRB 3E5SA 3HOWB 1XLNA 3P75A 3CHBD 3HOUB 3RD4A 2B2YC 1W6KA 4A3IB 4RNAA 3NXWA 1DOIA 1OQQA 2MJDA 1DCZA 2B2WA 3ZJUA 3HUIA 1IUEA 1WTPA 1EEFD 2EYHA 4N9PA 1KNEA 2GA4B 3T56B 5K36H 4A3JB 3AEAB 3J9CA 1L6VA 5MPOA 4S3SA 1SSOA 4I65A 4KY5A 3O13A 3MHBA 1FRRA 2EY2A 3L7ZC 2WXIA 1HA5A 1KDBA 1DOLA 5JEAJ 2R3ZA 2LMCB 1C8CA 5C0XJ 2A73B 1GPXA 3W1SA 3V96A 3QG1A 1EZ8A 3ETRA 1Q1BA 3S1QB 2WXKA 1U4PA 4C3JG 5K36G 1ZOYB 2B8FA 2JA8B 5ELCA 2FE8A 2WQYB 3SK8A 3NBIA 1GAQB 3I70A 2JYTA 2J52A 3NVVA 1IHZA 2WXLA 2DLBA 5C4HA 2R6GA 4H44C 1MD2D 3QO2A 2IJ0A 1JMLA 4G7OC 3HOZB 1RJTA 2PNRC 2WU5B 1YNJD 3GTPB 1KF6B 2K33A 1LTRD 1SNDA 3NTHA 2N9LA 3H0GB 3GTJB 2RA4A 1LACA 2OEOA 1PTOC 3Q8CA 4B0EA 3TP8A 3AE4B 4H2AA 2BDOA 2RDFA 5KGUA 1HFGA 2NVYB 2Y0SB 3EFXD 1QE6A 4ZKCB 5T1IA 2VXWA 5M3MB 2FBWB 4KGRA 1E9MA 5E4XA 1EYAA 2KCNA 3S9WA 1ZDVA 2X38A 1TR5A 1B9MA 5ELBA 2PLPA 1OFFA 3H94A 2XRSD 1UEAB 3H3VC 3B9JA 4LLGM 4UDUC 3OWEB 3E0JA 3I4NB 4HAEA 2F0GA 1TWCB 2Z8LA 5JAVA 1ZUD2 2QEJC 4TQUS 4IKGA 3BVZA 1CJEA 4R9WA 5AUKA 2IL8A 3SDZA 3GTGB 1TS2A 2IWHA 4QF4A 4RCNA 3IFDA 2MP1A 3PUVA 1C4AA 1D1KA 3OWFA 1UUPA 1SNPA 1D2BA 1J7AA 4KKIA 2WXFA 4GDLB 1VDZA 2K5DA 1R7SA 2Q8RE 1PUTA 4ABNA 2I38A 3TZDA 1QOHA 1N60A 1BMLC 2V4IB 4DXFA 4IDIA 1XTCD 3EGRA 3G6JB 3U9SA 3F2UA 5HURA 1ZYRC 1GUTA 2JZPA 4ZHPA 3ZJVA 2I2YA 2Y5PA 1WD0A 2H4OA 2L9HA 1G2SA 2SEBD 1HHVA 4A3KB 3TSSA 5D7GA 5CV7A 1VZ8A 2F0UA 5EE1A 3MWYW 2AUKA 3Q22A 2WXGA 4C3HG 2L52A 3ZQ4A 1X3PA 2EELA 2BB6A 2PKOA 4HMIA 2B76B 1MSHA 2AQ2B 5EPKA 1BR9A 1XLQA 1QOFA 4QB4A 4N59A 1DOMA 1C4QA 1D5MC 2O5IC 5EKIA 3BWUD 1B9NA 1SBBB 5E1FA 2KAJA 3V3XA 4FYDA 2PYKA 3TEXA 5FK9C 1MPEA 3P1MA 4XWWA 4YXDB 1QB5D 2OEDA 4C56C 3M7NA 1Q8IA 4KD3A 2F0JA 3NZ3A 4ARCA 1DOXA 3QIAA 1EY0A 4H7BA 2J42A 4KY7A 1BCPB 4B9WA 1TS5A 3LYYA 1KNAA 2Y5CA 1CFMA 4P16A 4MN3A 2K1BA 3T3OA 3QOJA 1SYEA 3L3OC 2QMTA 3BK1A 1SIJA 4TQ1A 2DY7A 1QNKA 1YN5A 1D5ZC 4A55A 4I7ZC 2B63B 1OO9B 5M3FB 5EE9A 3GP7A 1TWAB 2QIEB 2WU2B 4C80A 1WTRA 1Y56A 4JWUC 4RF1A 3A55A 4GDKB 5IGFA 4HKQA 4C7YA 2Y3AA 5DEHA 1IKLA 1HTPA 1J8IA 3FMCA 4HEDA 1AN8A 3VR4A 4WWMA 4XDCA 4K8JA 3SK6A 1DD2A 2INNE 4CKEA 4QIWB 4M0WA 3BYTB 3SR1A 1BXTA 5KNDA 1OXTA 2AQ1B 1PZJD 2MHVA 4DNTB 1E7PB 4R8IA 4C1NI 3Q0AA 5BN5A 3PIO3 4JX1C 1EYDA 1JW9D 2RSNA 1LO5D 1ZPSA 4ZUIA 3TMEA 4DNRB 4IFDJ 5C6AA 1KLGD 3RLFA 5C0XH 2BBCA 2KQ4X 3QWNA 4LMQD 3AECB 4DAPA 1GUNA 3NQTA 1TYGB 3Q8AA 3OOCA 1H9KA 1IW7C 2F3WA 2PW9A 3L9AX 2NB0A 1CZPA 4QUFA 2QCPX 5I6WA 1DONA 1O80A 2I07B 4HR7B 2JSVX 2F0HA 5HHDG 4WAFA 3ZGZA 4BBSB 1E10A 2WKDA 2F1MA 5EPJA 4XWTA 1JRPA 5C4XB 4GLSC 5JEAG 2JA6B 3P4RB 3ONAB 3EUB2 3A8JE 5JXVA 4ZUJA 5C0XG 3A8IE 4IALA 3J7YW 1FR3A 4ODGA 3NSWA 3T51B 3AV8A 3BYYB 3I72A 3VRAB 2VB2X 1Y8PB 4FXDA 2L83A 5M5WB 4A3MB 1FD6A 1JORA 1K8OA 1AZQA 1G2TA 2OHFA 2NN6I 1U4LA 3AMZA 4KGSA 3TEYA 2LUMA 3IAS1 3MA2B 2O4XA 2JA7B 4ZOHC 1KABA 3GO5A 4AYBB 4OZCA 5BN4A 2M56B 2ICEC 4HSPA 1CHQD 4KN4C 2EKIA 4FF4A 3SHLA 3NVWA 1XXGA 2K03A 1SYDA 3JAME 2KJXA 4CKCA 1BNZA 2PCFB 2KACA 2OXPA 1I50B 3VYSA 4US8A 2B2UC 2L12A 2VB3X 1TZOA 4BY1B 2LEKA 4HSVA 1V1PA 3J7AV 5JPMC 2L1AA 3GTMB 5CV9A 4KN7C 3VA7A 1JQYD 3AH7A 1GOZA 1I6HB 1FFVA 1PDQA 2KOLA 3NHHA 5A35A 3ZJTA 5IIFA 2DBYA 1AZPA 2WXHA 1A2TA 2BOSA 1YQ4B 1ZE3D 1T5EA 1YMHE 4FF2A 1WYGA 2KDMA 5BN3A 2D5DA 2I46A 2PW7A 2D5GA 4WQMA 1A3TA 4NDXA 1V8QA 1NR4A 2YU9B 2SOBA 3MEHA 1EY4A 4KK7A 3Q69A 2TMPA 1VCIA 2AWOA 2D62A 3K5MA 1AWDA 5CR3A 5DAUA 1SE4A 3H09A 1F2YA 1N61A 1CQFA 4LK0M 1ENFA 1Q3LA 1ZXHA 3GS2A 2FUG1 1CI3M 2WIIB 4QUCA 2HQEA 4TRDA 1XWEA 2J7ZA 4ZK9B 3K5NA 2KCCA 1VF5C 3DHQA 4J6HA 4R3DA 1IBXB 1PRTB 2KA7A 2PVGC 5IGBA 1XF5L 3CU7A 2YEPF 2WXQA 1C9FA 4HROA 2Z1CA 3U52E 1R9TB 1G8ZD 2RDHA 2NVXB 2G9HD 1FXIA 3FVQA 1HQMC 2EY6A 1PFNA 4FVMA 4YIJA 1PZID 1C78A 4XQJA 4RKLA 2O2LD 1FNUA 1F0ZA 1B44D 1A15A 3LX0A 1OXVA 4K5XA 1LTBD 3NE5B 1HUNA 1IGCA 1EY6A 3FDTA 4K8IA 5C5LA 3W2DA 5I9OA 5IGCA 3D8GA 1J7BA 4HTHA 1ZXIA 2F0EA 3M85A 4HEA1 1FMAD 1L4DB 2A68C 1NCVA 3BDCA 4R8NA 5CBEE 2E3TA 5FR3A 2K3UA 4BWGB 2NTSA 3S2DB 1PGXA 3AE1B 1SYBA 2W55A 2XIWA 3NWTA 1P7EA 1XLPA 4FXKC 3OMCA 2E2HB 1JALA 1UNSA 2PZWA 3T16A 5KYIA 3TDQA 3K58A 4K2LA 1TKGA 5M5XB 4ARIA 4DA2A 4P6VF 5COYA 2F0QA 3EROA 2WP9B 2CW0D 4RGMA 2K04A 3GV6A 1CM9A 2PZUA 2LS01 1QWYA 2KHSA 4OZBA 2A6ED 1SMYC 2NN6H 4WJWA 3RFZB 3BIID 2EZVA 4O1NA 1QOBA 1HZ6A 3RMHA 4L6TB 5E6JA 1QCBD 4LTUA 2JU6X 4PT5A 5CV6A 3Q24A 3RZDB 2WLBA 3H6MA 1B2TA 2JP1A 1JWSD 2RBMA 1JOOA 1EIHA 1RD9D 5C4ZA 1CZWA 1ZXTA 4A3DB 4EQOA 3IT6B 1SNQA 2RMMA 3G7LA 4AQ7A 3GTKB 2FMMA 1HRJA 1X32A 2WNMA 4Q0FA 1SDFA 3SE0A 4OGQC 4RHRA 4NKLA 1LTSD 3GD7A 1PDXA 1V1OA 1Z47A 3PO2B 1NEKB 1A2UA 4IFDG 3AM9A 1MGSA 3S1RB 3VRBB 1Q12A 1RFKA 3PUZA 2NBFA 1VR9A 4DXGA 1NENB 1Y69U 1PXUA 1F9RA 3WCQA 1STEA 2K9XA 4J8QA 2G9DA 4KKSA 2IGHA 1OXUA 3U7ZA 1MI2A 2JXMB 1G291 1WWTA 1YJIA 1K51A 4YSYB 1JROA 4B0MA 4JPSA 1SAPA 3OIQA 1OQRA 2RQXA 2N7JA 1GB1A 2MH7A 4PQXA 1LLRD 3W9CB 3Q8EA 1SF0A 2NMQA 1I4XA 3AE9B 2VZKB 4ZKBB 3LWUA 5BYQA 4IUPA 1STAA 2R7ZB 3EQLC 2F0WA 2K01A 2INPE 3N9YC 2H1EA 1PTOD 1I3QB 2PQEA 3VYUA 2QILA 4FO2A 2K32A 3DWQA 1SJED 1HPCA 1T5XD 2LJIA 1II3A 3Q8BA 5BMGA 3RZOB 1GUGA 3D3RA 2B2YA 1DJRD 3I57A 3IXSA 4C3IB 2LFIA 1WCMB 5EPLA 3TUOA 2N55A 1BCPC 1R4QB 4X3KA 3KK7A 1R4PB 5KNBA 1HXYD 2ENBA 4HMJA 3CRLC 3TP6A 1B4OA 3HRDD 3TP7A 5CBAE 1KTKA 4DU9A 5EQ0A 3I73A 1Q10A 3I91A 2JQRB 3MZ5A 3PO3B 1M8AA 2PMZB 4Q2JA 3R2TA 2SDFA 2PVOD 1DYQA 5LL6S 1P7FA 5CYUA 5E4WC 1A70A 4HKZE 1S4ZA 4PMWA 2AUJD 5I4DA 1PLFA 3K6OA 5JVH3 5AFWA 1ZYRD 2RDGA 4F88A 3MJ5A 1Z6HA 2EYPA 2ZXPA 2KQ3A 3MXPA 3D31A 1DZ1A 3TEWA 3K0YA 3AB9A 4H13C 4MACA 1WTXA 3BDLA 3R2IA 5EBCA 3KF8A 2TSSA 4K5WA 1BBXC 2BYTA 1E2ZA 1O7LA 1L0YB 2HDEA 5NUCA 2HCCA 1YNND 2KUMA 5D3DA 4FP5D 1KRHA 1B53A 4J3OD 3D4RA 3ND9A 3AE8B 4ZQ3A 4L2YA 3S14B 2V0GA 1H9MA 2GI9A 1SB3C 4OIKA 2M19A 2WXOA 2SNSA 3HG9A 3EJIA 1MSGA 3DWAA 2X6GA 2E76C 2EE1A 1L6UA 1GUWA 3BVMA 2ONQA 1F2RI 1YJJA 1K53A 2PIAA 2FMCA 3T4AC 4JBWA 4O42A 1MI0A 1GHKA 1WTVA 1EM7A 1AW7A 1YN4A 5KYLA 1I7HA 1JE4A 3NS1A 4CQNA 4V190 2DYOA 4IUVA 2FJ2A 3DUZA 2B2VC 5I6YA 2N0SB 1Z7TA 2W3SA 1F9QA 2BE5C 4A90A 2JEAI 3VA5A 1GHJA 2EVBA 1UAPA 1VMCA 1PZKD 2F0KA 2EYLA 2K6AA 4JK1C 1NVID 3N6RA 2LGIA 1S5FD 2K05A 4DK0A 1RWSA 1N5XA 2RKSA 1TWHB 3E56A 2G1EA 2PZTA 3BDOA 3E6ZX 5A2QE 5CORA 2ID0A 1FYCA 3P1HA 4RGOS 1STHA 2OT2A 3VR5A 3W5VB 5IT9E 1RM6C 5F2DA 2V4DA 3P4SB 4FXCA 2EYJA 3NP8A 5LHY1 5CC4A 1O7ZA 4WORA 2KEEA 1I4HA 3J80E 2F0PA 1KAAA 3PUXA 3IL8A 4REZA 2A69C 2ZXRA 3WOEA 2JE6I 1CT1D 3NUCA 4YTNB 5IODA 1U9RA 1SJHD 4C3JB 2WXPA 1EQTA 4M1UB 2KVMA 2CJOA 4RH6A 3TP5A 3R8BA 3MXNA 4A93B 4B08A 1TVXA 5T8IA 1LT3D 1NUCA 1BF4A 2F0MA 3C8YA 1IW7D 5ELFA 1C4CA 3URYA 3MP9A 3TN2A 3KBGA 3RPFC 3MC0B 4ZRZA 5AUIA 2B2VA 4OO1I 3VR3A 1GUSA 3CQZB 1PRTC 1Y1VB 4HRSA 2JEBI 5FO7B 1IYVA 1AFPA 4KV6A 1EWYC 4EQNA 2IDYA 2MUYA 1QJOA 4H0LC 2SAKA 4YTPB 1YNTE 3C1FA 4P2CB 1VZ7A 2VUMB 1XLOA 3HEJA 2XRQD 1ENCA 3N52A 3NWSA 5FO9B 4BA2I 5IGDA 3SVMA 1B9RA 5IGEA 4ZRQA 1JOQA 4Y7NB 3AE6B 4KY6A 2R92B 5E3FA 3HKZB 1L0XB 2E75C 1ACCA 3NVZA 4NAMA 1GUOA 1FRDA 4DF7A 1QT9A 4EGVA 2IX0A 1HQRD 3P4QB 3L4PA 1OXXK 1OXSC 4FF1A 1A3VA 3QJYA 2IGGA 2MGSA 2CQAA 4OIJA 1TKEA 2A74C 1KDCA 4IUNA 1ILPA 1QOGA 5M9OA 2D2CC 3T13A 3HGBA 2A6HC 4NJCA 2PO4A 4V0BA 1GXDC 3HZXA 5EGTA 1XX8A 4B9XA 2CVRA 2Z4HA 3A54A 2ICIA 4DQOC 2WXJA 1V97A 1ET9A 2LFNA 3LB8C 4XYOA 3ND8A 5EKLA 5EJWA 4ZYSA 1SNOA 3HVZA 1D6EC 1C79A 1DOKA 3W5UB 1JQ4A 1C48A 4FF3A 2KWDA 4TMAB 2L11A 5C3XA 2GRIA 3GTLB 5CMDA 3A56A 1IKMA 1FEHA 2W3RA 1S5BD 3AE2B 3CWIA 4X3UA 1EOTA 1VMPA 4C1NK 1YN3A 4F87A 4QCLA 2EJFC 4RKBA 2B2TC 3JAML 1RYJA 1RTNA 1I4QA 4C3HB 2QDBA 4XDDA 1I4GA 5C44B 4KTAA 1HEZE 4XYQA 3DEOA 1PYWD 3KQ4A 4JWSC 4ILWA