3R2TA

2.2 angstrom resolution crystal structure of superantigen-like protein from staphylococcus aureus subsp. aureus nctc 8325.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
195
structure length
195
Chain Sequence
NRLYDTNKLHQYYSGPSYELTNVSGQSQGYYDSNVLLFNQQNQKFQVFLLGKDENKYKEKTHGLDVFAVPELVDLDGRIFSVSGVTKKNVKSIFESLRTPNLLVKKIDDKDGFSIDEFFFIQKEEVSLKELDFKIRKLLIKKYKLYEGSADKGRIVINMKDENKYEIDLSDKLDFERMADVINSEQIKNIEVNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title 2.2 Angstrom Resolution Crystal Structure of Superantigen-like Protein from Staphylococcus aureus subsp. aureus NCTC 8325.
rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
total genus 56
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r2tA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3r2tA01
2SEBD 1LTTD 1S5FD 1CHPD 4RCOA 1ET6A 3BVMA 1S5DD 5D3DA 1SE4A 1SE2A 3EFXD 1I4XA 2J4XA 1PTOH 1ET9A 1RF2D 3R2TA 2RDHA 1BCPD 3O13A 4RHSA 5I4DA 4RGOS 1I4GA 2RDGA 1UNSA 2XRQD 1CK1A 1SBBB 3BZDB 4OHJA 4L63B 1PTOD 4NZLB 1D6EC 4K6LA 1M4VA 3DWQA 5D3IB 1TY0A 1BCPB 1HA5A 1KLGD 1LT3D 1QILA 1RD9D 2XN9C 4RGMA 3BYTB 1SEBD 2NTTA 3DWPA 1JWMD 2AQ2B 1CT1D 1PTOC 4TSSA 1S5ED 1RDPD 1HTLD 1SXTA 1PRTC 1FGBD 1I4PA 4BWGB 2NTSA 1L0YB 1CHQD 1EFID 2TSSA 1TS3A 5TSSA 3GP7A 1TS5A 1JCKB 1CQVA 1YN5A 1I4QA 1FNVA 1STEA 1G8ZD 2Z8LA 1S5BD 1DJRD 1T5XD 1B44D 1AN8A 1MD2D 1LO5D 1LT6D 1EEID 1FD7D 1PRTD 3BYYB 2AQ1B 4Z9CB 3V05A 1TS4A 1YN3A 1PZJD 1BCPF 1V1OA 2WV6D 1SJED 1LTBD 1HQRD 1LLRD 1PTOB 1SJHD 1KLUD 1TS2A 2QILA 2XNAC 1PTOF 1LTID 1B1ZA 2O2LD 1EEFD 1EU4A 4O1NA 1LTGD 1PRTB 1JQYD 1PZKD 4RFBA 5ELCA 1FNWA 1LTRD 1ESFA 1EU3A 2IPKD 5FKAC 1JR0D 1PYWD 3KLSX 1I4RA 4C56C 2AQ3B 3SEBA 1KTKA 3EA6A 1AW7A 1TY2A 2ICIA 1LTSD 4RH6A 1D5ZC 3BVGA 4RGTA 1D5XC 1YN4A 1LT4D 4DXFA 1V1PB 4UDUC 3DWAA 4ZYSA 1FNUA 2QEJC 5FK9C 1LTAD 2CHBD 3CHBD 3OWEB 3URYA 1PRTF 4L6TB 1XTCD 3TSSA 2IJ0A 5ELFA 4RHRA 1HXYD 1LT5D 1EWCA 1I4HA 4RGNA 5ELEA 2XRSD 1ENFA 5ELDA 1V1PA 1JWSD 1L0XB 1JWUD 1BXTA 4DXGA 3R2IA 2G9HD 1S5CD 1PZID 1XXGA 1GOZA 1BCPC 1RCVD 1D5MC 1SE3A 1UUPA 3R8BA 3BVZA 1DYQA 3MFGA 2R61A 3MC0B 1F77A 3W2DA 5ELBA
chains in the Genus database with same CATH superfamily
4YY3L 3NBHB 3DOWA 4CDDC 4ZRQA 2BYEA 4P6VF 2JPHA 3VR2A 3PV0A 1G51A 1SE2A 5D2MB 1TIFA 1U0LA 3O13A 3V62A 1F2YA 3GTPH 2N0SB 4XYCA 1IBMQ 3IG3A 4RM8A 2QGQA 5JJKA 2MEKA 1IBXB 2FJ2A 3J7A5 3RN2A 2O2VB 1A3UA 1SE8A 1W6JA 4C3IB 3F2BA 3EJIA 3DBHI 1VQBA 3G71A 4U68A 4JI1Q 2GBMA 4A20A 4HJ7A 4YWKA 5HG2A 4C7ZA 2KWUB 4BOZB 3W1GA 4EE2A 3I4MB 3I9V1 2OEOA 4RGMA 1PA6A 3T1HL 1YQ3B 4GNXC 1JWMD 1XMOL 2WU5B 3GTQH 2QKIC 1MJEA 1XTDA 2E5LL 3HRDD 2ZXRA 4JPSA 3MXUA 1CKMA 3KDFB 2VQFQ 4HJ5A 1DD2A 2BB5A 1E2ZA 1CQFA 4K3BA 2JA5G 4A3LG 3GP7A 4W9DA 2W82A 1VLBA 3I90A 5LMUQ 4GKKQ 1L5PA 3ZTDA 1DOMA 4FA6A 2E76C 3RNUA 1B44D 1AN8A 3NY5A 3QO2A 3KF6A 5AJ3L 2MP2B 4KY6A 3VH4B 4KKIA 4G3XB 1WD1A 3GV6A 1U4AA 2CKZB 3J7ZC 4GLAC 4BKSA 1LTLA 1SJHD 4KJNA 2I5MX 4A3EB 1YJNA 1UF0A 4I6PA 4A3PA 1Z7TA 3QX1A 1QZHA 4ZHOA 1ISNA 1WJ6A 2QDBA 2JA6B 4IW0A 1EUJA 4HEA1 1JR0D 1TXYA 5C0XG 1C77A 2KKCA 3RNAC 1J8CA 1FXTB 3V3XA 5C3XA 3CU7A 1STGA 4Y7NH 3M3YH 4BY1G 1AARA 3EQLC 4XTCS 2QCPX 3BVGA 2P5ZX 3A9JA 3RFZB 3TMPB 4GNXA 4JBMA 2JA9A 3NE5B 1FFVA 2ZXOA 3DWAA 1QJOA 3MEFA 3PLVA 1O7ZA 1UBIA 2KEEA 3DDCB 3K81C 1WMHA 4ZYSA 4XT1B 1FNUA 3A1QB 3QWNA 4C3JH 1PDXA 2N1VA 2RSUA 4GOPC 3N9YC 5FK9C 1HUNA 4NQLB 4PT5A 4DUZL 1ZEQX 2D0OA 2ZXPA 1Q81C 2BCOA 2PNRC 3DM1A 4A3CH 2PTLA 1C4PA 3H7PA 4BBSB 3CW2C 1XTCD 2CQOA 2Z6BA 3HOUB 2JRIB 1YNJD 3KUDB 1VR9A 3NTIA 4CDCC 2EZVA 2DAJA 3I57A 1CUKA 1E3PA 4RGNA 1ENFA 5C23A 4IFDJ 1HNXL 3CIRB 2NPTA 3TP5A 2BYVE 5DPRA 2G9HD 3CCRA 2K39A 1DGSA 2NBFA 2X6LA 5M9OA 1NEKB 2Y3AA 3WANA 1D5MC 3L0OA 3RZDH 2QEXA 2MBEA 2DYOA 2C60A 5D7GA 1GUGA 3DMUA 5M5WB 1ASYA 4A3JH 3L0WB 4EQNA 1XQQA 3RLOA 2PZTA 1ACCA 4EVOA 4LDTD 3A54A 3SK8A 1UAPA 2VQEL 3RZWC 1HJPA 2N7DA 1CZWA 1N5WA 1KNEA 3VR9B 4JBWA 4K3CA 5GADC 1UWMA 2IY1B 3CRLC 2L11A 4K6LA 4X65Q 1M4VA 4GOPA 3E5SA 1VQJA 4WJWA 1VD2A 3GO5A 3TCAA 2JA8B 1YITA 3E6ZX 1RD9D 1I6HH 1NBWA 4LFBL 2J7QB 2F0QA 1SEBD 2IGHA 3DWPA 2YV5A 4GGQA 1N8RC 1IPGA 1IZ6A 2EKIA 3MP9A 5CHWA 3SFEB 1S3SG 4EOYA 3AEGB 3MXGA 5GAHC 4IM0A 2KQ4X 1HTQA 4FF2A 2C5CA 2KDEB 3VYSA 4HIOA 1CHQD 5IP9H 1A2UA 3T1YQ 2E2IH 2KD0A 3J80L 1T0SC 2X38A 1FYCA 2LEKA 3PO2H 4WWNA 1XYIA 4HIKA 4YL8A 4EEWA 3F1ZA 2B8GA 1KF6B 4WAFA 1DJRD 3VYTA 2F03A 3ULPA 1RAXA 2ENBA 3L10B 4WWPA 3UGBB 2Z6KC 2BTEA 3CXCA 5G3LF 1WGYA 4XDCA 5LHY1 2KMCA 4QAYA 2EPBA 4XX5A 5KHOA 3ABVB 2F1MA 4LLGM 3Q3OC 4RKLA 4OXPA 1XMQQ 2WLBA 1HQRD 1KLUD 1NMFA 1PTOF 3H0GB 1K3BC 1B1ZA 2A5HA 2BB6A 2RPVA 4R1JA 3VTUA 1LTGD 1PRTB 2QC8A 1IBKL 3ZKJC 2DJGC 3VYRA 4DN4M 1Y8OB 1WTXA 1L6UA 4OWTB 1QT9A 2M4NA 4JBJA 4JGHB 4YCUA 5C4JH 1F2MA 1E6EB 1A3TA 3SEBA 4CKBA 3X0WA 2W3RA 2PPBC 1K0SA 2D10A 3K7AH 3W1BA 3QCAA 2KC2A 1LTSD 3QARA 3A0JA 2JYEA 5E6OA 2B63H 5IWAQ 5C6AA 1L4ZB 3DHHC 1ILPA 2KBNA 3PZ8A 3W9CB 2EY1A 3NUHB 4JWSC 3NPPA 3RNFC 2ZVNA 4M8MA 1L2FA 1OXUA 3A56A 4KDIC 4MSMB 3M4YA 5C4XH 5C5MA 1FGUA 2MLBA 3W1YA 4HROA 3MEHA 4ZLTF 1V8CA 1WXSA 3NZ3A 4A3OA 2KK8A 2INDC 1HNZQ 1FXAA 1MSGA 3AM9A 4FVMA 5CHVC 4YT0B 4LUVA 1U9RA 5CV8A 2KXJA 3T9LA 1WGDA 2R93H 3W5UB 3HOVH 2K1FA 2Z6KA 3K7UC 2KDFB 2LI5A 4C80A 4TMAB 4C3JG 1WY8A 2XRSD 1K8RB 3FKIH 3U50C 3HOWB 1T0YA 4YWGG 1VQIA 1X54A 4B3SQ 3PO3B 3L2PA 1NSNS 3C2PA 3QOLA 4B95A 3MC8A 4A3CG 1VQ8A 1CZGA 2ID0A 3T53B 3KYHC 5I9OA 4URKA 1GUWA 2EYOA 3TRZA 3GE8C 3UIPB 4YTPB 4JI5L 1EY5A 1DONA 2HDEA 4R8NA 4QCLA 4OELB 1ZDVA 4WWOA 4ZK9B 1J8IA 2FUG1 2KMMA 4OVZA 3H8HA 2V0GA 4DWFA 2JSVX 2NBUA 4M02A 3RZOH 4DNTB 2R92B 2KDBA 1Q7YC 3AU4A 4ZRIA 3P75A 5AUKA 3N52A 4K7WA 3CCJA 3RNCC 1F9QA 2JXMB 1Z9FA 2J0KA 1CZPA 1DOYA 4A3JG 1MHHE 1UELA 4WRDA 1EFWA 4JI6Q 4B08A 4LFCQ 1JALA 1PFNA 1BCPB 2MBQA 4P73A 2QHOA 2LJIA 4DPGA 3J81E 3M7NA 1L1OB 2ZTDA 3CCLA 2MHVA 1QOHA 1SYEA 3QOJA 1GJXA 2R7ZG 3SHQA 1KJTA 3A4SC 1HTLD 4EZLA 3J7YW 1W6KA 1GC7A 3UDIA 1WF9A 3WAMA 5FO7B 5M5XH 2JP1A 2L00B 5GXGB 1SSOA 4P74A 4N59A 1ZDXA 2WXJA 4NAMA 2B2VC 1VMPA 3TN2A 4KKTA 2F0JA 1NVID 4XWWA 4IWPA 1PUTA 3BS1A 2BVCA 4DV4L 3Q0AA 4F7ZA 1EWHA 5I9PA 2F0KA 1CMXB 1CKOA 1JRPA 2Y5PA 2V4IB 1AZPA 5IP9G 3WOFA 1KFYB 3UQAA 1N5XA 3FP9A 3PO2G 3IFTA 2QILA 5IOCA 1I42A 1EU4A 2BPSA 1XNQL 1SIFA 4DV0Q 1C3TA 1A3VA 5CR3A 4F8CB 4QMGA 2A6HC 4LF9Q 1FIQA 2JZ3B 3K5MA 3MXNB 4PMBA 3H3VC 3NBIA 4ODGA 4KSKC 3V2TA 3CPFA 4AIMA 5EAYA 1TWCB 1Q82C 2LHEA 2XEWA 2EQSA 4USAA 4ME3A 3SE0A 1HNWL 2BW2A 2O4XA 3PQIA 3TS0A 3MJ5A 1I3QB 4DR2L 4P16A 1EQRA 3X3NA 4F7XA 4KKSA 3PIP3 4NXML 1MFWA 1B8AA 3R93A 1K0RA 4R4QA 3O65B 4JG2A 4BOSC 1B9MA 4DFAA 3CHBD 4KN4C 5CV9A 1E1TA 5E4WC 3URYA 2EJFC 1PRTF 2RHSB 2B2VA 2M8SA 2B63G 5FLXL 1FFUA 1WTWA 2IJ0A 2ZM6L 3G6EA 2FCQA 2CJNA 2E75C 3H91A 5K5PA 3HOXB 3IT6B 4B9XA 4TVAB 2Z4IA 5EE0A 3TDQA 2OOBB 1JWSD 1E22A 3L16A 3RT3B 2V3NA 5C4XG 2FMCA 4EX5A 4HJ8A 1OEYA 4QY7A 2E6XA 3I3CA 1H9SA 2FHTA 2D3CA 3FC4A 3M4PA 1I35A 1WX8A 4HRSA 1CM9A 5DEHA 2ZJRA 3BVZA 1VQGA 3MFGA 3HOVG 2R93G 2VNUD 3B2FA 3FKIG 1KL9A 3GQBA 1V2YA 1S40A 2ZPNA 4P2CB 1MHXA 4IC7B 1QVGA 2INPE 4UP8A 3TP7A 1A8VA 5ISRA 4MM3A 4ZRPA 3A9KB 4CYEA 3NK9A 4CO7A 3BG3A 3A8IE 2LVPA 4N8X1 1A15A 3OWFA 2LUMA 1EQVA 1PFBA 2FBWB 2K0PA 2L05A 4E3CA 4NB3A 1A63A 2EJGC 5C3WA 3A5ZB 1YEZA 4LF8Q 3BDCA 1KLGD 5CV5A 4C2MB 3TMEA 2L12A 2RGFA 3IHPC 3HOZH 1RKNA 1WCMB 2WXIA 2Q2HA 2F0VA 1VMCA 1AE2A 1O78A 3S1RH 2H89B 4UPAA 1HTOA 4N8FA 1FGBD 2SNSA 4K8IA 2RSNA 3QB3A 2B76B 2KJRA 2WWZA 2TSSA 5TSSA 2R2OA 2IO1B 5J2RA 4CJ2C 3X23A 4OVUA 2CVRA 1PH5A 1BBWA 1BVSA 2ATWA 2QMTA 1O7YA 3K8AA 1ILQA 4FO2A 1Y1WB 4XE0A 2Y0SE 2N55A 1IGCA 4AP4C 4DDID 1N33L 2AQ1B 3M3JA 3SK4A 4ABNA 3UE0A 2LY7A 2VL6A 3MHZA 4AS1A 4BS9A 5E7NA 4LF4Q 1BCPF 1VQEA 1N36Q 4MJSB 3RN9C 1WGHA 4LJOB 4RA8A 2EELA 1SJED 4CHKA 3TBIB 3DBLB 5JH5C 3NWSA 5T8IA 1YJWA 1S1QB 5EKLA 4IUPA 2WXFA 3ML8A 1JQYD 2OTLA 2AUJD 3DHQA 1HRJA 4DV3L 1T6BX 3I7FA 1EYCA 3AE9B 5ELCA 2IWHA 1UE5A 4W9HA 2JXXA 5CV6A 1EIHA 2F4VQ 1J6QA 4G57A 3A7AB 2KJHB 4LF6Q 3CMAA 1ENAA 4HK2A 5H8YE 2WAQB 1F2ZA 4PS8A 3TZUA 2MHJA 3K5OA 2XIWA 3U52E 4J1MA 4C3HB 3BJUA 4EQPA 4RMFA 1VZ8A 1BKBA 1II3A 1S72A 3PPAA 2KDIA 1Q46A 2Q2TA 4GLSC 1V1PB 1SSNA 4DK5A 2FXQA 1FR3A 5IYBH 2UXDL 4IQZA 4JI2L 5CC4A 4P72A 4H44C 2O6VB 4LUOA 5E6NA 2V1YA 1C76A 4BBNF 1WX9A 3B9JA 1HHVA 2LXJA 3APCA 3U58A 2WX1A 1V6EA 4NJ7A 3L54A 4MGYE 5L83A 4REZA 3W3AA 4LWCA 2QCZA 1BBXC 2KECA 1VCBA 3UDFA 3AYHB 5M3FH 2L5TA 5J22A 2KHWB 3HKSA 1C79A 2L83A 1NE3A 2K75A 3A8KE 2KTRB 2L0FA 1H9MA 3EN2A 5ELDA 5M5YB 1RIPA 3NTKA 4CKEA 4W9LA 2Q8IB 1QCBD 3H94A 3OW2A 1VQMA 4DXGA 4LF5Q 1JJGA 1JWBD 2F0OA 3CAMA 2XBBC 1XWEA 3F8TA 3H9DA 3ZIMA 3B0AA 1RODA 2J53A 1TIID 4DDGD 3CC4A 4M00A 3VRAB 4IFDH 4OO1H 5BN5A 5A2QL 3NQIA 1VS0A 1EYDA 1VCIA 1L6VA 4RAUC 3DVNV 2AUKA 2RDHA 2YEPF 4JI7L 2BS4B 3ZRFA 3AE5B 4LCDE 3NJTA 4YY3Q 4JV5Q 1C4AA 2WXPA 3AFQA 4ILWA 1IYUA 1N6ZA 3SU8X 3ZVVA 3A74A 4ZKCB 2L32A 3P42A 3M4OB 1LT3D 2BQQA 2Q2UA 4L5RC 4UY8C 3C19A 4DR7L 2M2LA 1L7YA 1VDZA 3QQ8B 2F0FA 1E8ZA 4IM3A 2PE9A 1F2RI 2AHOB 4GDLB 5CMDA 2JF5A 4HSVA 1C4QA 1I4PA 3JYUA 4R4OA 1HZ6A 1TGZB 2A74C 1GJZA 4Y52H 1AWDA 2NVYB 1TJEA 4LFAL 1TWFB 1CFMA 1JC7A 2QF7A 4V0BA 1GUTA 4YHHL 3T1HQ 4LK0M 4MEMA 1TS5A 1QOGA 1XMOQ 2Q5WD 3WCQA 1ZKOA 2B2TC 4A3KB 1X1MA 3Q8FA 4AUQC 3V6CB 3T16A 3HOZG 1IHZA 1Z6HA 4B3RL 2M56B 3EGRA 4XDXA 2K1BA 4WH4A 4IDIA 1X55A 3HKZB 2HTHA 3KUCB 3GE3C 3TEYA 2A1AA 2WV6D 4X3UA 3CWIA 3AE6B 2MCNB 2KQ3A 3S2AA 2XK5A 3KYCD 3S2HH 3KYDD 5BN4A 1ONLA 2RHQB 2V3PA 4MH0E 1EEFD 2I5LX 5AJ3Q 3MZ5A 2LWPA 4IG7B 4LTUA 2K5VA 4E6IA 3FKYA 4DR6L 5LMNL 1GUSA 3NHEB 3QA8A 4II3B 5FKAC 5FR3A 5KYLA 3KLSX 4ULLA 1HTPA 4IPDA 3J80E 3U9OA 2K52A 2NVXB 1IW7C 2KX3A 4HVBA 4TKNA 5DPTA 1VQNA 4BXXH 1FMAD 3PZ7A 1XNRL 2NWGA 4MTNA 2JK8A 3PRZA 3CQZB 3MJWA 3NVWA 1Q8IA 3TIXA 2NBVB 5J3BA 2J0JA 4A55A 3N1ZC 2ZNVC 4C3IH 3LDZE 2Z59B 5JHAA 3WOEA 4DBGA 3C46A 4MGIE 1VQ4A 1YOVB 1LACA 2VUMH 1OQQA 2C7NB 4DK6C 3U30A 1F9RA 2B2TA 3I4MH 2KEDA 1HFGA 2MJ8A 3GTMB 2UU9L 2KCMA 2PE6B 1KC8C 3J7AV 4C1NK 5IYBG 1HXYD 4R4TA 4RKBA 1WJUA 4DUZQ 4DAYB 2JA7B 1RRBA 3DBHB 3W1SC 5GAGC 1KRSA 3P1MA 3SK5A 4MH8A 2BA1A 4HKZE 1RFKA 4YSXB 4X64Q 2NR2A 3PUVA 3VA7A 1NMGA 1K8AC 4CHTB 3HK0A 3PIO3 4GDKA 4K81A 1YVCA 1JMLA 1RTNA 2H5XA 3IAM1 5M3FG 3K80C 2KDMA 1HNXQ 2LMCA 3IL8A 3S15B 1PFMA 2LXAA 1GPXA 4NDXA 3I55A 5EE1A 1CHPD 3S1NB 4BY7B 3J81j 2L3ZA 2PI2E 3T51B 3QC8B 4F1SA 1WTHA 2A69D 1HCZA 2J4XA 5BR8L 3JSVA 3Q3MC 4FLHA 4A3EH 1E10A 1JQ4A 3MA2B 1IXRA 4NAWA 4RHSA 3K58A 2EYLA 1GVPA 2A6EC 4NQKE 1PH7A 4FXKC 4IFDG 4XYQA 3NENA 2D3AA 4OO1G 1QWYA 2F0WA 5JAVA 5HFYA 1KHIA 3FEWX 1SMXA 4DUYL 4A3FB 1OTCA 4KGTA 1GM5A 1YNTE 2R6GA 2KC1A 1RYJA 1XD3B 2KVRA 2BBCA 2TMPA 4RCNA 1Y14B 3HP3A 1RDPD 2AWTA 4DXAB 1KAAA 3RLNA 3W1SA 4EZJA 3VRBB 1HR0W 4K14A 4NXNL 3GD7A 5GMVA 1KDAA 4LFBQ 1SROA 3KQ4A 3LX0A 1MI0A 3P20A 3KWVA 2J0MA 5IKCM 1WM2A 1FNVA 4IUNA 4MIUA 5JVH3 3HOUH 5FJ8H 4EQOA 1RFAA 1XCQL 3BZKA 1VQKA 1SE9A 2DHZA 3JW0X 1JJ2A 5I2XA 1R9TB 2XWBB 2MRPA 3IAYA 3P7JA 3QJZA 5CBEE 1PQSA 2YVCA 2ON8A 4OO1I 1D1IA 1PTOB 1PYSB 3HG9A 3D6WA 2WFWA 3RD4A 2H4OA 3VR5A 4NPNA 2IDYA 1A5RA 2M0AA 2NVTB 1T0QC 2HCCA 1FNWA 2CW0D 4YCWA 5M5WH 3F2DA 1PYWD 3VR4A 5LMNW 2UXCL 4M0WB 3VYUA 1E7VA 1VJKA 1IBKQ 1CJEA 1TY2A 4RH6A 3VQIA 2DNEA 4A3DH 3ZLZA 2UUBL 3AB9A 3GTKB 1I50B 2Y0SG 2HJ1A 2WB1B 4DR3L 1BT0A 5IGGA 2MQJA 2V3SA 2GLSA 4KHPL 3GTJB 2DY8A 2F3IA 1PV4A 2JA8H 1V80A 2L1AA 3NOBA 4JI0L 4LNOA 4PZ8A 4BXXG 4M8AA 1J5EL 2PZUA 1GHJA 3Q3NC 4F88A 5FO8B 2N4FA 4JOIC 1SNOA 4HDQA 3U7DA 4QIWB 1EF5A 3CP0A 4C3IG 4LF7L 2C7HA 4IUMB 2KN4A 2QSDA 1P0RA 2VUMG 1BO0A 3CCEA 3PF4A 4A3BB 3K0YA 1F52A 2A69C 2M9VA 3ECIA 5EE3A 3I4MG 3TS2A 3NZUA 4HCEA 4HPPA 2ZEQA 2ZJDA 4ACFA 2GOWA 2K7VA 3R8BA 1TZ1A 3KUZA 4DV2L 1DYQA 1RL2A 2WGSA 4CJ0B 1X3GA 5IGBA 1SIJA 1DM0B 2INNE 3IFWB 1TYGB 1STBA 3I91A 3NUCA 3VUYA 4AOFA 3Q2AC 2GMIC 3OTOL 1HH2P 1EQQA 1DOXA 1STAA 3H0GH 5FLXE 3A4RA 5JEAJ 2ZTEA 2MO1A 1MBYA 3TJPA 3DEOA 2QDLA 3Q6SA 4L63B 1VQ6A 1T3QA 2KWVB 2KOXA 1F9SA 5LNK1 2F0LA 4XQQA 5C0XI 2FNJB 2LUEA 5G2NA 2DENB 1TY0A 5BMGA 3FRPB 2DZIA 3ZW3A 1Q10A 2EDGA 1OXTA 4A3EG 2X69A 3NP8A 2EJMA 3GTPB 4QUFA 1GNUA 3W5OA 4JOIA 1WXMA 2JQRB 1PYBA 4J8QA 1X32A 4DK1A 4B3ML 4QUCA 2PJHA 4X3KA 3AXCA 4KIKA 3S16B 1CKNA 2D9UA 1YJ1A 2CR5A 3VA5A 1N34L 4L23A 1NAPA 2MPMA 2LGYA 2RPQA 2O6VD 2RF4A 4LUZA 3I4NB 1I4QA 2R7ZH 4JCVE 1TVXA 1QUQB 2KANA 3Q8CA 2F0UA 3A55A 4DR4Q 1F0ZA 3TP6A 3Q69A 5I6WA 3QAQA 3JAMi 4A3GB 4QQBX 3FILB 3K0XA 3HOWH 4IALA 4B3TL 3PO3H 2JZZA 1QVCA 2WXKA 1CTMA 2PYKA 2B2YC 2OWOA 5CV7A 4BBSG 2IBIB 2K5PA 5IGDA 4DV4Q 3DXJC 3PSIA 1EYGA 3HOUG 5FJ8G 5C3EB 2M0XA 3I5JC 3K9OB 4JI8L 2B39A 1AZQA 4PYZA 4OWXB 4A3IB 4JE3B 1M1KC 3NEMA 2CKHB 1NI2A 5IGEA 1SAPA 4A3MH 4XQNA 2ZTCA 2R92H 4BAXA 5C44B 5KIXA 2JQOA 3PZDA 1Q0WB 2SOBA 4NY0A 1TZOA 3GTGB 3TEZA 3RLFA 4JX1C 3DM3A 3PGZA 2NBWB 4FXGC 3L3OC 4CKCA 1EM7A 2F0SA 2IHFA 1ZYRD 2K4KA 4ZRJA 4AWJA 1IBML 1OQRA 4JI3L 2HD5B 1GXDC 2GB1A 3EBEA 1H4RA 1HNWQ 5IP7H 3G6JB 4Y7NB 1A70A 2PW9A 4ICUA 3ZJUA 3PHXB 1P16A 2IX0A 2ASQA 5EDSA 1K53A 4A3DG 1CSQA 5LL6S 2I07B 4NXMQ 2N1WA 3QK0A 5KGUA 4KJOA 2D0PA 1EWCA 1I4HA 5NUCA 2MWSB 2KCTA 1Z47A 2IO3B 2CH4A 4L5SA 4LNQA 4GXBA 4AYBE 4ZRKA 4EQ5A 2JA8G 2L0TA 3EFUA 3HHMA 2L0CA 1JWUD 2B2YA 2ZM6Q 1P1AA 3GZNB 5E1FA 3P2BA 1S5CD 2DWQA 3QWZB 4HPLB 4K1RB 1SNDA 3ZTCA 1RCVD 1YNJC 2L76A 2F0EA 1UUPA 1Q86C 2EY2A 5EGTA 2BH8A 3A5UA 3S14B 4IPHA 3W2DA 1P9DU 2F0MA 5LMUL 5JOBA 1F2RC 1L4DB 3PUZA 1PGBA 2RD0A 1Q8KA 2DJFC 1YQ4B 3PCOB 5EBDA 3ZNID 5D3DA 2XGTA 1R7SA 2IW3A 2WAQE 3PREA 1I4XA 3R2TA 1YNND 1RF2D 3I73A 5L37A 2LZ6A 4HCNB 4BBRH 2KWDA 4WAAA 1J9OA 1VZ6A 3RZFA 3I4LA 2GBKA 1V9PA 4II2B 1IL8A 2K25A 3AH7A 1J7CA 1E90A 5HGTA 1I7HA 3PS6A 4NPSA 1D4BA 1HA5A 1GAQB 4K5XA 1K28A 4R3DA 3ALBA 3N1YC 4XDDA 1JJCB 4TQ1A 3H0GG 1UE7A 2Q2IA 3ONSA 1X6OA 1PDQA 2K03A 3KF6B 4FP5D 1G2TA 1IKMA 3DHIC 1SRUA 1STYA 1I3QH 3M95A 1H9KA 2GI9A 3BK1A 3WWVA 2HIXA 3P4PB 5A2QE 1QB5D 1TBEA 2HD3A 2E8GA 2ONQA 1QNKA 1RJTA 1C8CA 1L0YB 2AWOA 3NHHA 4K7UA 4DV5L 3AFPA 1Q1OA 4KHVA 1I6HB 3RR5A 3I63C 1DCZA 1Y1VB 4E74A 4I7AA 4DHJB 4JBKA 5CX3A 1FPYA 1FD7D 3HOXH 2NB0A 4PV1C 2NZ1D 2DZKA 3W5VB 4KHZA 1IL2A 1GUNA 4B6WA 1KD1C 4JLCA 3A9JB 1DOIA 4GNXB 1XLPA 1SYCA 1KIXA 2XNAC 2PMZB 3ZJVA 1VQ7A 1LTID 3Q8DA 2PVGC 2X8XX 1WMHB 4HKQA 1QKZA 4GSWA 1YI2A 2MJDA 3AEAB 4AQYQ 3EC8A 2EYFA 3D31A 4K5VA 1FEHA 1V86A 5GQOA 2BDOA 1Q1BA 4KLKA 4GN5A 2PZWA 3HOWG 4OONA 1PVOA 3C8YA 3H7PB 3PO0A 3PO3G 4OZAA 4YXDB 2LKVA 3EA6A 4IUVA 2IL8A 4DV3Q 2EYJA 2K6AA 4RGTA 1BBUA 1LABA 1L2NA 4LNIA 2KLGA 3SR1A 2GBJA 2NPTB 3PV1A 4EKUA 2K5HA 3I70A 3VXWA 2XSCA 1GUAB 3ZYYX 2LS01 3PHWB 2D2QA 3R7RA 3M62B 4FJZA 5HY6A 3DVGX 4WQOB 5D14A 1E9MA 5EPJA 4A3MG 1WTOA 4FXCA 3RULA 2R92G 1EY8A 3K7AB 1YJJA 3KJOA 2UXDQ 4C2MH 4JI2Q 5D94A 1MVKA 5K36H 1TWAB 3GV3A 4FNFA 1WCMH 4FYDA 1K3RA 3HKZE 1ZXTA 2B3GA 3AEBB 1TR5A 1Z5SB 4X62L 2ALYB 1BOSA 2N49A 5BYQA 2PMVA 5IP7G 2RSOA 5EKKA 2CJOA 2DZJA 4WJNA 2IY5B 4TUUA 1GKHA 5C4XB 4YTNB 1XXGA 3RMHA 4IPGA 2E2JH 2YTVA 3AQQA 3LGJA 2K22A 1A62A 4GOPB 3JAME 2D07B 1C7YA 2PVOD 2FIDA 3MC0B 1NI3A 1Y1WH 5TR5A 3Q3JA 4YTMB 3MHBA 4IJHA 1XF5L 4QB4A 2I38A 1ET6A 1EWYC 3Q8AA 4DV7L 1XLNA 1LM8B 1SE4A 1JE4A 1E0BA 1B53A 5G3LD 2YEPB 4HR7B 1IKLA 3N6RA 4BKTA 1HE8A 2ICEC 3EHVA 3BINA 5JPNC 2DLBA 2XRQD 1FCLA 1GB1A 2DZMA 4G4KA 3R3OA 4XXEA 4OHJA 5J1ZA 1PTOD 3U7ZA 1GC6A 3DBSA 1BQQT 1FD6A 2SAKA 4FULA 2WXLA 1JMCA 3DWQA 4KDLB 3FAHA 1P98A 2WDTB 1SYGA 5D3IB 3PUXA 5D6JB 1X3FA 2G5DA 3PMFA 1KRTA 2L15A 2DGYA 4IURA 5T1GA 3TP8A 3M85A 1CI3M 1STHA 3RZOB 1EUVB 5DPWA 4BBRG 3N20C 4C3HH 1E2VA 5DPSA 4HSPA 1HEZE 3M63B 1PH9A 3T13A 4JIOU 1JOOA 4K0KL 1OXXK 4KKUA 2HUGA 4PS3A 1SYFA 4W9GA 2FFKB 1YJIA 2PPHA 1QNUA 1O80A 1TWGB 4DAVA 1XCTL 3B1LX 4MGZE 2F0IA 2Q8RE 1YN5A 4OEMB 1K8GA 2ZW0A 4L8JA 1NTGA 2LGXA 2N9EB 4FBJB 2ZZPB 4B9WA 1E24A 3V6EB 4ASWC 3C3LA 5CYUA 1R4MB 4LFAQ 2NVQH 2M17A 4WJ3M 3TEXA 1D3ZA 4YHHQ 1MHWC 5M5YH 2OEDA 5L95C 3C1FA 4BY7G 1SMYD 2WACA 2VH1A 2RDBC 2K5DA 4B0EA 4HLEA 4B3RQ 1GHKA 4FADA 2N9XA 3DHGC 4TRDA 2UUAQ 4V190 1MG4A 2MQHA 4G11A 1ICFB 2A8VA 3SHLA 3HOXG 1YX5B 3E0JA 1HZBA 3R3MA 4C56C 1N63A 2FMMA 1LUZA 2F3VA 2HTME 2JUOA 1LQBA 2LXCA 2JT4B 3EUB2 1PH3A 2CU3A 3LJ3A 1EF1A 3KF8A 3Q22A 1JB7A 1RLFA 1DGJA 4HAEA 2L7RA 2F0GA 2XVSA 3NQTA 4LK1C 4ZAIA 3MAQA 1M90C 2UUCQ 1GG3A 5BO4B 5LXIB 3AMUA 2DYMA 4W9IA 2JXTA 3MTSA 4N58A 2BE5D 1LTAD 2PQAA 4IUQA 1XNRQ 4WJOA 1B4OA 5FR6A 1HZ9A 2KFKA 3BY4B 1ZXIA 4CDFC 3M4OH 1WYWB 5GAEC 1K51A 4L6TB 4L5TA 4LFCL 1VDVA 2KTFA 3OOCA 3HVZA 2B2WC 2LSSA 3GTLH 3HM6X 5ELFA 1L0WA 1MPEA 3MHSD 1MGSA 3NG0A 2YTYA 4DAMA 5H1SE 1H95A 1ZXHA 1N32Q 3J81c 2NVYH 3U9SA 4HJ9A 1F2LA 2UU9Q 1IYJB 4GKJL 3HS0C 4A6QA 3WAOA 1V5OA 2GVAA 4A3KH 5JXVA 5K36G 3VR3A 3SDLC 1AEXA 1SE3A 1WCMG 3TQYA 1NJIC 2WNMA 2WP9B 3V61A 3OAWA 1F77A 3F2UA 1WE6A 2BF8B 2L55A 4JVZA 3FMCA 1DZ1A 5IT9E 3K6OA 2CWAA 3PUYA 1KH0A 4O2DA 1L0VB 3GOEA 4DR1Q 2JRHA 1RTOA 3LWUA 2UXBQ 3E9SA 5BYRA 4RGOS 1WGKA 5JJZA 3IXSA 1K52A 1JOQA 3ZXRA 3ULLA 4O42A 1RM6C 1WZ3A 2GA4B 1Y1WG 2ACZB 2WB1E 2A5UA 4G7HC 4OVVA 3AE4B 1PH1A 5BR8Q 4GS3A 4DV0L 3TEWA 2OHFA 3T3OA 4AYBG 2NVXH 1CA5A 1K83B 2KMAA 3GS2A 3NBHA 1ZP0B 3NVVA 1LM0A 2JEBI 3H1UA 2XWJB 5JEAH 1NYRA 3TUOA 1P7EA 1T0RC 3DCGA 2B2WA 5C2TB 3CQZH 4TSSA 1E8XA 1C9OA 1S5ED 4QIWE 4DR5L 1AYFA 2HE7A 1PLFA 1IBXA 4DUYQ 1NCVA 3PIPA 2O2VA 1UE6A 2EMSA 1TS3A 3UQBA 2WAQG 1SF0A 2JVCA 4GOCA 4CDEC 4C3HG 5G55A 3GTMH 1IYVA 2AX5A 3I72A 2Z0DB 1I94L 2OXPA 4NXNQ 5FLMH 3VTWA 1LT6D 4R4CA 3HOYB 1PRTD 4IWOA 2KZRA 1KABA 2JJQA 4PMCA 2JA7H 4Z9CB 3S1RB 1PGAA 3OW7A 5IO9A 1PZJD 1E2WA 3S24A 3GTOH 2EKEC 4POFA 3AEEB 4HWIB 4US9A 4NMZA 4UP7A 3AE8B 1TQOA 3KDFA 2PO4A 4N9TA 2OT2A 2LJ5A 3DBLI 2L9HA 4LMQD 1YX6B 4K8JA 1HR0L 2C9WB 2GBRA 2GRIA 1PFDA 3AE2B 1KOTA 3OJ4B 3G48A 3OSOA 5M3MB 3S15H 1WOCA 3VAWA 5LLIA 1ROEA 2QJLA 3L9AX 2DN8A 1UH6A 1WD0A 3S1NH 5HKHA 2BE5C 3S1MB 2LFIA 5IYDH 2EYMA 4JYAL 2MP2A 4J6IA 1UWXA 5A35A 2E5LQ 3ZDTA 2V9HA 2WXQA 3M7GA 3TREA 2G3QB 5HGQA 3MWYW 2KUMA 4IWQA 1MKHA 1R4PB 3UIOB 3NS8A 2J0TD 3B6YA 3I8ZA 2QEJC 4A93B 5IY0A 3AU7A 2B8FA 2I46A 4QF4A 2K8BA 1K8MA 5EQ0A 1P8LA 4WJ4A 1H9SB 2IO2B 4A90A 4ZHPA 1J19A 2UUBQ 2C35B 2MGSA 3S1QB 4A3FH 4QJFA 2IX3A 3LNNA 1C48A 4DR3Q 2KFJA 3STBD 1F9JA 2LD9A 4KHPQ 1P3QU 3KLSA 3CC7A 3TZDA 4UAIA 2VZKB 1FL0A 1KDBA 2NUCA 4K2KA 4JI0Q 4MM3B 4I6LB 1YBYA 3PTFC 2CCZA 2JYTA 2ZT9C 1TTNA 2ZJPA 5EPKA 2DNCA 1BXTA 5GROA 4YWLA 2WKCA 4OX9L 2KT7A 2BS2B 4LF7Q 2WIIB 3JAML 5E3FA 4M8NA 3KJPA 1VQHA 4GN3B 4RWSC 1TKGA 5M3FB 2EIFA 2D3BA 4KKJA 1Q3LA 2DBYA 4MSQB 2Z4HA 4U673 2UYZB 2IX1A 1X3QA 2G45B 2AKWB 3D32A 2KCCA 2LVQA 1YZ6A 4OL7A 3RI7C 1PTOH 1V1QA 2IYDB 4RF1A 1BCPD 3S17B 3AB5A 2V4LA 4A3KG 5I4DA 4PG3A 4LF4L 2E2HB 2WXGA 1WGRA 2EYHA 3E3XA 3LWEA 1SBBB 2NVTH 3ZXVA 3HKZG 2A19A 3D8GA 1WTRA 2ASBA 1UE1A 4S17A 5JJIA 4CQNA 3OTOQ 4GLXA 2K05A 1QVFA 1SNPA 3ERSX 4WWMA 3ZO5B 4JI4L 2CQAA 3FPUB 2PEAA 2I2YA 1Q12A 4H13C 3PRPB 3IRBA 4LF6L 1FCCC 1C78A 3ZGZA 4KVGB 4KV2A 3K57A 3ICEA 1I50H 3UF8A 4Q2JA 1LGRA 3BWUD 2Y5CA 4W9CA 4R9WA 1PRTC 3S9WA 2R3ZA 3HFZB 1V9JA 5HHDG 2ES2A 4PQXA 4DA2A 1C0AA 4DK0A 3P4QB 4H2AA 3GTJH 1EO6A 1NENB 2FUHB 2KQSA 1KRHA 2WXHA 1CQVA 3IFDA 5JEAG 2XTIA 2AEHA 4IOIE 4P1BC 4FHKA 1G8ZD 2Z8LA 2JA6H 4PMWA 4B3MQ 2KHIA 3S2DB 3TEHB 3OJ3A 3VUXA 1LO5D 4F87A 2BWFA 1MIUA 5CHFA 4HJAA 2QW7A 3OHXC 3P1HA 1YIJA 1N34Q 1IBLL 3X3MA 4G7ZC 2VQEQ 3AE3B 2F0NA 4KZCA 1WWTA 2ZPYA 4AJYB 4WQMA 2KA7A 1LLRD 4A3BH 2UU7A 3PLUA 3FHWA 1YIWA 1PZKD 3E56A 5FLMG 2WINB 3DEPA 4PZ6A 3HUIA 4B3TQ 2JA7G 1I4RA 2AQ3B 2NZOA 3IVFA 3KLRA 1NUCA 5AFWA 3Q23A 4JW0A 2JA5B 5C1ZA 4IKGA 4BBSH 1SFOB 5KHQA 4LW1A 2VH2A 1LT4D 4JI8Q 2KAJA 4DXFA 3L17A 5BMIA 5FO9B 2K8CA 4FJYA 3STBC 4ANXA 3JC66 1VF5C 5CTRC 4W9EA 2IHEA 4IFDI 2K50A 1PHJA 4JV5L 1NBFC 4CJ1B 5IYDG 3RPFC 3OIQA 5DAUA 3ZNZB 4AJWA 5IP4D 3ZQ4A 4GLVB 2PI2A 3CCMA 2ZCCA 4LAAA 1VZ7A 1WI0A 4DU9A 2YU9B 4JI3Q 1G6ZA 3Q8EA 4B9KA 3D0FA 1EYAA 3U4VA 2K5NA 3HGBA 1WXQA 4N9F4 4GU2A 5KNCA 3S16H 3VUWA 4GB9A 2B29A 2KVMA 4BY1B 2PMZE 4GZYC 4EZKA 2VUMB 3G4SA 4A3FG 5CV4A 4ICVA 4EUTA 4IM2A 1BCPC 5IAAC 2EVBA 2VS1A 4AH6A 3I4NH 3CSTA 3VFKA 3DBRI 2A68D 4NJ6A 2R61A 1L1OC 1CA6A 3NWTA 3WAPA 1EZ6A 1E1OA 2NN6H 2SEBD 3NVZA 4CGYB 5ELOA 4FF1A 4A3GH 4G0NB 1AE3A 3D6CA 1BUVT 5IT9L 1QQRA 4PYUA 2BH2A 1M8AA 1SNMA 3ERQA 1ASZA 2AWNA 4Q5VA 4X3TA 2IZVB 4FF3A 1TT5B 1I4GA 2CHWA 3P4RB 1RHPA 4KMUC 1OXVA 3ZUNA 5C3EH 2OCEA 1IGDA 1N62A 1WJ4A 2WXNA 3VH3B 3H6MA 4ME5A 4MELA 1UD7A 1UGJA 1OEYJ 4MACA 1WRIA 4A3IH 2VB2X 3Q6BA 1SB3C 3SDZA 1FM0D 5JJLA 4WORA 4OIJA 1TWHB 4A8XC 3DPDA 2JY6A 4X66L 4L2YA 1D1KA 1G2SA 3D4DA 5C44H 1XT9B 2CU1A 3B2GA 1R4NI 1WI5A 4BBNC 2VY3A 1HZAA 1LYLA 3GTGH 1D2BA 1ZPSA 2JWUA 1ZW7A 2Z1CA 2C7MB 4DV1L 4POGA 2HQLA 1AP0A 2R2QA 3AULA 1FO4A 2RCNA 3J80c 2XK5B 4X57B 2A73B 4RMAA 2NTSA 1Y8NB 2MBBB 4YWMA 1JORA 1JT8A 4JI5Q 1N60A 3VDZA 1JCKB 3IAS1 4JC0A 3Q24A 1MI2A 2BYFA 2VB3X 4N9PA 4WIPA 3VHTC 1S5BD 1SNCA 4IUUA 3ZDMC 1T5XD 1L1OA 3U4ZA 2K01A 3BYYB 3J81i 4K6DA 4JQWC 2WB1G 1UWVA 1TS4A 2JX5A 1WJNA 2MX2A 4DV5Q 2WXRA 1YQBA 1XPUA 3H7SA 2MBHA 3DWGC 4ZOHC 1JROA 1E7UA 3AE1B 1SR3A 1KLVA 1SYDA 1FVIA 2PCFB 2RQXA 2NMQA 2JA6G 2WXMA 2FINB 2M00A 1VQPA 1YHAA 3PIOA 4X64L 2DX5B 2O5IC 3S14H 3IBEA 3CD6A 2D11A 1FJGL 1WJJA 4A9AA 2KO3A 1QLBB 5E6PA 3UE1A 2Z0EB 5CGKA 1U4PA 3DUZA 2OTJA 3KK7A 4R4IA 3RUZA 4A3BG 1Y8RC 4C7YA 5T1IA 4XQJA 4DV6L 2WXOA 1C9FA 3M4QA 2MJEA 3VR6A 4JL9A 3CC2A 2CW0C 4XWTA 2D5DA 4HMIA 3GTQB 4YIJA 1SN8A 3LXFA 3QIAA 4I7ZC 1SGHA 3NSWA 1GD7A 3H15A 2CHBD 1QOAA 3J7AF 4GDKB 3V60A 3MXNA 4DF7A 5IA7A 1VQCA 3KW5B 1K8OA 2LMCB 3OWEB 3SXHA 1A6XA 1G291 1WRDB 2KJXA 4A3DB 5LL6X 4M01A 1EIFA 1YJ9A 1U5KA 2CWPA 2JN4A 1PH4A 3CF6E 2A68C 4TQUS 3EECA 2K28A 3JSVB 2HT1A 2HHHL 3SVMA 1AH9A 5MPOA 1XNQQ 4NAWB 1VQ9A 3LYYA 3VVWB 2NZHA 2HCIA 3OLMD 2DNFA 4IO9A 2RKSA 2K6DB 1PZID 3CCQA 4N6EB 2ZNVB 5EPLA 4X62Q 1B3AA 1Y1VH 1NYQA 2CHXA 1KM7A 1WE7A 3DVNU 1YNXA 1Y8PB 5J39A 3LB8C 2W54A 4H7BA 1ZE3D 4P7IA 3GB1A 3ML9A 3K5NA 4RCOA 4WFN3 4ZDVA 1UZXB 4KI0A 2H1EA 4LNNA 3M3YB 1UEAB 2WS3B 4DR2Q 4KGSA 1YHBA 1IP9A 3EFCA 3EFXD 2KYWA 1ET9A 4DNIA 1V97A 3J9CA 4JI1L 1B9RA 3AEVA 3I4NG 1WYGA 1KAWA 1PXUA 4GN4B 2RDGA 5DLQE 1B9NA 1QG7A 2WDVB 2K32A 2N7JA 4MDKE 4FJVB 2QIEB 3UINB 4DV7Q 3KH0A 2JZPA 1ZKHA 3N30A 2NN6G 4C3JB 2N78A 2F0PA 1U4LA 2F52A 2AMCB 3VR8B 4A3GG 4BA2I 3CMMB 1ENCA 3QR8A 5CORA 1QOBA 2A4ZA 4JWUC 2VQFL 4ANVA 4HIDA 4NNJB 2YTXA 5JZEB 5G5GA 2XN9C 3BYTB 2NTTA 1WX7A 1T9HA 3FPPA 2LASA 3BK2A 3NS1A 2C5LC 1CT1D 4ZCKA 5C3EG 1BF4A 2WHIA 1PH2A 4GKKL 3OMCA 1SXTA 3A9KA 3AV8A 5AZHA 1WTQA 4J15A 4HJGE 4BWGB 1DOLA 5FOBB 5C0XJ 1I5FA 2EMTA 4A3IG 4KGRA 5IN7A 1OFFA 5DCNA 2JE6I 3AN1A 3MTNB 5ELNA 1B3QA 3RN5A 4W9KA 5C44G 3A8JE 3RZDB 1STEA 4K0KQ 3SD5A 2J42A 3QJYA 1TWAH 4C1NI 1X3EA 3PVLA 4L1BA 4DHZB 3KBXA 4P1CC 4A3JB 2A6HD 1IYFA 1OTRB 5EE9A 1PFSA 3V05A 1LXDA 2FCSA 1SNQA 4KY5A 4OIKA 1XLOA 4BVUC 1TWCH 2NN6I 4HMJA 1C1YB 4KZ0A 4IUTA 4ALPA 5AZFA 1V8QA 2VZKD 1FRRA 2ZJQA 4ANWA 2F0DA 4PZ7A 4QL5A 1SYBA 2R7ZB 1VF7A 5EJWA 1V5TA 3D4RA 4RFBA 1E0ZA 2X6GA 1ZUD2 3CRKC 2N88A 4FXDA 1Y56A 2JWZA 3F2CA 1H9JA 4G50A 2KJ6A 3N3KB 4US8A 4MTKA 1BNZA 3I2ZA 2ICIA 4MJSA 2D5GA 2KENA 4A4IA 1YN4A 3L13A 5IOIA 1WTVA 1I6VC 4RM9A 3TBLD 2F0TA 4K7SA 1B7YB 3ZNGC 4TV3A 5DNFA 2HJ8A 2F3WA 2RR9A 2E2IB 2KACA 5FLXc 1MJCA 1VQDA 4NP5A 2VZAA 3PO2B 1V81A 1EY9A 1N33Q 1O7LA 4A3MB 1K9MC 5KRUA 3CCVA 3P63A 5KNBA 4BA1I 2K5QA 5D65A 1YD8U 1YHQA 2ZW1A 3I56A 2F4IA 4RHRA 2DUDA 1ZYRC 2LHDA 2KX0A 1TKWB 5J17A 1V1PA 3ZJYC 2MUYA 2I1JA 3MFYA 3Q14C 2EYPA 2O6VA 1TWGH 1WXAA 1GOZA 4OZBA 1X65A 3GZNI 2HIVA 4A75A 1WVLA 2FCMA 5C5LA 4NKLA 2EXDA 2NVUI 3OMGA 2BKRB 2HDLA 2HQEA 1LTTD 5C4JB 4GKJQ 3BVMA 3I3TB 1S5DD 3HIZA 2KTRA 4X65L 1EY6A 2W9NA 4FN2A 4MGKE 1DOKA 4DR4L 2N9KA 2NYZD 2B63B 3R7QA 1Y1VG 4F8MA 1FRDA 3BZDB 1VQOA 2IY0B 2L8JA 1CKNB 4KIKB 1S3OA 3BIID 4H0LC 5IYCH 4NZLB 5BN3A 4RF0A 4MN3A 5EKIA 1GUOA 1PGXA 3KVFB 1NNXA 4EFOA 2JSOA 2B3AA 1YNNC 4ZUIA 1V49A 1QILA 2FE8A 3E0EA 3UDXA 2Q8TA 5BMHA 3T1YL 2BWES 2C9OA 4BBRB 3PGEA 4KD3A 2PW7A 2R93B 1B70B 3HOVB 2AYOB 4S0RA 1WH3A 1HPCA 3AMZA 3FKIB 3HRZC 4B0MA 1QZEA 1TT2A 1M94A 3NRZA 4XZ4A 2DY7A 3BDOA 1X3PA 1WR6E 4YSYB 4AQ7A 2BA0A 2WKDA 1WGGA 2IO0B 4DR5Q 2G4DB 1JE5A 2KLCA 1XMQL 2WYQA 1JICA 2BOSA 3CSFA 3D4WA 4KTAA 3K5LA 3VDYA 1Q90A 3UI3A 2G1EA 1EEID 1HUMA 4KK7A 4IZ8A 4JI7Q 3P4SB 3QHTA 5C4ZA 4GDLA 4UHVA 1WFQA 1VRAB 1I94Q 1W2BA 2O2LD 3ND8A 4NJCA 3SK6A 1E7ZA 1WSPA 2VRRB 4H02A 1RWSA 4MT5A 2VW9A 3WALA 1ESFA 2NS5A 3T3NA 5IWAL 1MSHA 4DR7Q 2EY6A 4X3SA 4E71A 1EZ8A 1KTKA 3A7LA 2RA4A 1HR0Q 1G6PA 2ZCBA 5COYA 1DXMA 1PH6A 1UGMA 2R7FA 4J3OD 1F1HA 2V1CC 1XJVA 2GN5A 1ZOYB 4G7OC 1SDFA 1BUIC 4RNAA 5F2DA 1HNZL 1ML0D 1JOKA 2QA4A 4JYAQ 4C4VA 1LV9A 4OWWB 3DVGY 3C1EA 2BS3B 5M5XB 1LFDA 2LVOA 2CFMA 2E74C 2L4NA 2BYTA 1G6JA 5EBCA 3ULJA 4IN3A 1K83H 4TKOB 1Q5WB 5I2YA 3MC9A 4LJPB 2Z0SA 3B08A 4LNKA 4M1UB 4B3SL 1J7BA 2D62A 5HURA 4KX6B 2K33A 3J80i 1N61A 1EY0A 1PMRA 3IKJA 4QGUA 2RMMA 4HTHA 1STNA 2LRUA 1HZCA 2MNAA 2F0HA 5ELEA 3RNBC 1ICWA 3AEFB 1UBQA 3BDLA 3Q3FA 3R66C 3N32A 4DR6Q 5LMNQ 3MVVA 3H6NA 1WTPA 2J52A 2OJWA 2MO0A 1AFPA 1EIGA 5J18A 2LRWA 5G5HA 2IGGA 3UDGA 4W9JA 5CBAE 2MP1A 1XX8A 2KCNA 4ZRZA 3HOYH 1JRUA 3AEDB 4BKGA 5ELBA 1S5FD 2RVLA 3M9BA 4I65A 1E5WA 2G4SA 3KUPA 4FHJA 4OX9Q 5JHBA 1K73C 4ZKBB 4MZ9A 3QG1A 4DAYA 2KHSA 1EQTA 4JI6L 4R8IA 3T4AC 3K59A 3V96A 5KEEA 3ZRCA 1UNSA 2MA9B 3HEJA 3OIPA 1CK1A 3NXWA 2E2JB 4HDOA 4KV6A 1VQLA 1G91A 4K5WA 4HXDA 1VQ5A 2PNHA 2KHJA 5M3MH 4UP9A 1D6EC 2I0QA 2MJ3A 3CCUA 1ESRA 1TWFH 3S1MH 5I6YA 1KNAA 2YYZA 2RDFA 3EVQA 3OPOA 4LJZC 4P75A 4AYBB 2N9LA 4AQYL 4DAPA 3TL5A 3GDEA 2K14A 1HFNA 3KBGA 4S3SA 1QOFA 4XIGS 1WR1A 1PTOC 3ND9A 3BZCA 3CPWA 1U4RA 1N9WA 3CMEA 4LNFA 3U8ZA 5IYCG 4KY7A 5DM63 3DLLA 4A93H 3H09A 5E4XA 4JI4Q 1XLQA 1EWIA 4BZAA 3ZJTA 1S4ZA 3WA0A 4GN1A 2K9XA 3VTVA 4HPMB 2BKFA 3S1QH 2MH7A 1Q1EA 3E9IA 3H3VH 3AE7B 2AL3A 1MD2D 1C4CA 4LDTB 3RD2A 4MHEA 2KWCA 3L08A 1OQYA 2IGDA 4LF9L 1R4MI 3K9PB 3L7ZC 1XPOA 2CS4A 2I1KA 3PSEB 1QE6A 1F9PA 1X9NA 4D2KA 2R7DA 2M1MA 1O7IA 1IW7D 1TS2A 2EY5A 3SR6A 2LFNA 4O0AA 2O5JC 3RMKC 4O1NA 2E2DC 4W9FA 5LXHA 1T5EA 1J0GA 2KN5A 1JWAD 1TKEA 1VQFA 2PKOA 1QF6A 4DNRB 1IBLQ 2VXWA 3RUIB 1XEEA 3APFA 2NVQB 1D8LA 4PS7A 3ETRA 1SMYC 2JU6X 2KQ7A 2LGSA 4BFRA 1FXIA 3PUWA 2ZVOA 4GIVA 4ZYNA 2SNMA 3JAMc 1EIYB 3S17H 1EL0A 3HOZB 2E2HH 1D7QA 1MJDA 2W55A 4DQOC 2MSED 2CHZA 1BDOA 4XGAB 3CCSA 4IJLA 3RCZA 3WIMA 4IOAA 2K3UA 3OYYA 3AI5A 5JPMC 4YCVA 1B50A 2KOLA 3EIVA 3N1XC 2EOTA 4A76A 1XPRA 3D3RA 4M0WA 4YSZB 3U4EG 4HCSA 1P7FA 1KDCA 1GO3E 2V4DA 4KN7C 5IODA 3T56B 3TSSA 1A2TA 3I4OA 1OXSC 4PK1A 2G9DA 4BY7H 2BGFA 2RCFA 3DWMA 3OG5A 2CH4W 2W3SA 4ID6A 1NR2A 2K5WA 3FDTA 3T8MA 1B2TA 2PIAA 3NELA 1KXLA 1E8WA 4P71A 3R2IA 2FCNA 2YLMA 5HI1A 2N3SA 3J81L 1X56A 2UXCQ 2L52A 4PNYA 3FVQA 4ITKA 2JYOA 1HZ5A 2EE1A 4HJKA 3HVDA 3NTHA 3ONAB 3ITPA 4HIMA 3GTLB 3EROA 3S2DH 4XC2A 5AUIA 2REXA 2A6ED 4HN7A 2Z9HA 1JB3A 1EY4A 1PH8A 3KFUA 2N9PC 4KD4A 3CKIB 1BMLC 2L1BA 3CF5A 2B2UC 1JW9D 2D2CC 3SFDB 4GMVA 2BDNA 2M19A 2WU2B 3PT2B 3APDA 4J6HA 3IT4B 4MNOA 4LF8L 1TU2B 1HQMC 4APVA 2JEAI 3PRMB 3NZSA 3UI2A 3PF5A 3HOYG 2KVZA 2WDQB 2GBNA 2UWQA 2UUAL 1NY4A 1J5EQ 3A1QA 3NVYA 1WM3A 1E7PB 1H9RA 2WX0A 2JA5H 2SDFA 4BKSD 4A3LH 5AZGA 1SFOH 1WFYA 2K04A 5E6JA 4WURA 4TQ0A 1HA6A 1XO3A 2AL6A 2AQ2B 5KYIA 4C4VB 2HDMA 5BYSA 1U4MA 1R9TH 5M3MG 1Y69U 2BT6A 1GB4A 4ARCA 1VQAA 4JK1C 4DHJD 4X66Q 5IGFA 2UUCL 3HZXA 4C00A 2E3TA 1EFID 4DV2Q 1H8CA 5IE8A 1J7AA 3U2SC 1N36L 2N7EA 4OW0A 1MG8A 4DV1Q 3KWLA 2K6QA 3A33B 2GVBA 4OGQC 1SLJA 2N8NA 1K50A 2QDFA 2YU9H 2PLPA 1QZGA 1R4QB 3KLWA 4KSLC 5C0XH 4A93G 1YN3A 4CBVA 1V1OA 3E9HA 2RBMA 3KF8B 5C4HA 2FIFA 2B2UA 2MW5A 2Y5BB 1EOTA 4HEDA 1LTBD 5JVG3 2F4VL 2D3GA 2WQYB 4BY1H 2LGIA 4HCPB 4WJQA 2OQ0A 1BR9A 1E8YA 2LXKA 3GTKH 2OF1A 2PQEA 4K2LA 1N32L 2WDRB 4ARIA 3G7LA 2PQAB 1NR4A 2PW5A 1LTRD 1A0IA 1EU3A 2IPKD 2J7ZA 4DK3C 1QUQA 1TKYA 2KFKB 2NCNA 1W3SA 1IUEA 3GTOB 5KNDA 5H92C 2EXZA 3RNGC 5IGCA 4OZCA 1AW7A 2MFIA 4NW2A 4XYOA 2INCC 3FILA 4DGZA 4I6NB 2I5HA 1D5ZC 4L5QA 4IOCA 1D5XC 1EOVA 5C3JB 4X6AH 3DBRB 3ENEA 1CSPA 1FJGQ 1WXVA 3RYTA 4UDUC 2LGDA 4DR1L 2UXBL 2OJRA 5IT9c 1WIAA 3SGIA 1OGWA 4DV6Q 4ANUA 4ZQ3A 5AEKB 1Z2MA 3RNEC 1WZ0A 1YMHE 1TWHH 5IIFA 1UEBA 3C0RB 4FF4A 3ZNHB 2WP8J 3MXPA 2OQKA 1WYDA 4FDBA 2KNBA 3Q8BA 4DHZE 3AECB 4DKAC 4LF5L 3KOJA 4XT3B 4EGVA 1OO9B 1LT5D 2H88B 1EY7A 3H3VI 2FAZA 4ZUJA 3L4PA 4JPBW 1V43A 3WDNA 1L0XB 3S2HB 3AU5A 3BU2A 2DAFA 3DQVA 1NDDA 4IPCA 1R4NB 2IT1A 2MBOA 3JVZX 4Q0FA 2HHHQ 3HM3A 1KQSA 5DM73 2K8HA 4WJPA 2DYBA 3ER0A 2Y0SB 3QIJA 1ZGUB 4RG1A
chains in the Genus database with same CATH topology
4ZRQA 4P6VF 3VR2A 3PV0A 1SE2A 3O13A 1F2YA 2N0SB 2MEKA 1IBXB 2FJ2A 1A3UA 1W6JA 4C3IB 3EJIA 4U68A 5HG2A 4C7ZA 4EE2A 3I4MB 3I9V1 2OEOA 4RGMA 1YQ3B 1JWMD 2WU5B 2QKIC 3HRDD 2ZXRA 4JPSA 3MXUA 1DD2A 2BB5A 1E2ZA 1CQFA 3GP7A 2W82A 1VLBA 3I90A 1L5PA 1DOMA 2E76C 1B44D 1AN8A 3QO2A 4KY6A 4KKIA 1WD1A 3GV6A 1SJHD 4KJNA 4A3EB 1Z7TA 4ZHOA 2QDBA 2JA6B 4HEA1 1JR0D 5C0XG 1C77A 3V3XA 5C3XA 3CU7A 1STGA 3EQLC 4XTCS 2QCPX 3BVGA 3RFZB 3NE5B 1FFVA 2ZXOA 3DWAA 1QJOA 1O7ZA 2KEEA 4ZYSA 4XT1B 1FNUA 3QWNA 1DOYA 1PDXA 3N9YC 4PT5A 5FK9C 1HUNA 1ZEQX 2ZXPA 2BCOA 2PNRC 3DM1A 2PTLA 1C4PA 4BBSB 1XTCD 3HOUB 1YNJD 1VR9A 3NTIA 2EZVA 3I57A 4RGNA 1ENFA 4IFDJ 3CIRB 3TP5A 2G9HD 2NBFA 2X6LA 5M9OA 2Y3AA 1NEKB 1D5MC 2DYOA 5D7GA 1GUGA 3DMUA 5M5WB 4EQNA 2PZTA 1ACCA 4EVOA 3A54A 3SK8A 1UAPA 1CZWA 1N5WA 1KNEA 3VR9B 4JBWA 1UWMA 3CRLC 2L11A 4K6LA 1M4VA 3E5SA 4WJWA 3GO5A 2JA8B 3E6ZX 1RD9D 2F0QA 1SEBD 2IGHA 3DWPA 3MP9A 2EKIA 3SFEB 3AEGB 3MXGA 2KQ4X 4FF2A 2C5CA 3VYSA 1CHQD 2X38A 1A2UA 3J80L 1FYCA 2LEKA 1XYIA 1KF6B 2B8GA 4WAFA 1DJRD 3VYTA 2F03A 2ENBA 2BTEA 5G3LF 4XDCA 5LHY1 2EPBA 3ABVB 2F1MA 4LLGM 4RKLA 2WLBA 1HQRD 1KLUD 1PTOF 3H0GB 2BB6A 1B1ZA 2A5HA 2RPVA 1LTGD 1PRTB 3VYRA 4DN4M 1Y8OB 1WTXA 1L6UA 1QT9A 1F2MA 1E6EB 1A3TA 3SEBA 4CKBA 2W3RA 2PPBC 1LTSD 2JYEA 1L4ZB 5C6AA 1ILPA 3PZ8A 3W9CB 2EY1A 3NUHB 4JWSC 3NPPA 1OXUA 3A56A 3M4YA 5C5MA 4HROA 3MEHA 4ZLTF 1V8CA 3NZ3A 1FXAA 4YT0B 1MSGA 3AM9A 4FVMA 1U9RA 5CV8A 3W5UB 4C80A 4TMAB 4C3JG 2XRSD 3HOWB 4YWGG 3PO3B 1NSNS 3C2PA 3QOLA 1CZGA 2ID0A 3T53B 5I9OA 1GUWA 2EYOA 4YTPB 1EY5A 1DONA 2HDEA 4R8NA 4QCLA 1ZDVA 4ZK9B 1J8IA 2FUG1 2KMMA 4OVZA 3H8HA 2V0GA 2JSVX 4DNTB 2R92B 3P75A 5AUKA 3N52A 1F9QA 2JXMB 1CZPA 1MHHE 4WRDA 4B08A 1JALA 1PFNA 1BCPB 2LJIA 3J81E 3M7NA 2MHVA 1QOHA 1SYEA 3QOJA 1GJXA 1HTLD 3J7YW 1W6KA 5FO7B 2JP1A 5GXGB 1SSOA 4N59A 1ZDXA 2WXJA 4NAMA 2B2VC 1VMPA 3TN2A 4KKTA 2F0JA 1NVID 4XWWA 1PUTA 3BS1A 3Q0AA 1EWHA 5I9PA 2F0KA 1JRPA 2Y5PA 2V4IB 1AZPA 3WOFA 1KFYB 1N5XA 3IFTA 2QILA 5IOCA 1EU4A 1A3VA 5CR3A 4QMGA 2A6HC 1FIQA 3K5MA 4PMBA 3H3VC 3NBIA 4ODGA 3V2TA 4USAA 2LHEA 1TWCB 3SE0A 2BW2A 2O4XA 3MJ5A 1I3QB 4P16A 3X3NA 4F7XA 4KKSA 3PIP3 3R93A 1B9MA 4DFAA 3CHBD 4KN4C 5CV9A 5E4WC 3URYA 2EJFC 1PRTF 2B2VA 5FLXL 1FFUA 1WTWA 2IJ0A 2CJNA 2E75C 3H91A 5K5PA 3HOXB 3IT6B 4B9XA 2Z4IA 5EE0A 3TDQA 1JWSD 2V3NA 2FMCA 2E6XA 3I3CA 1H9SA 2FHTA 3FC4A 4HRSA 1CM9A 5DEHA 3BVZA 3MFGA 2VNUD 3B2FA 3GQBA 4P2CB 1MHXA 2INPE 3TP7A 5ISRA 4ZRPA 3NK9A 3BG3A 3A8IE 1A15A 3OWFA 2LUMA 1EQVA 1PFBA 2FBWB 2K0PA 2EJGC 5C3WA 3BDCA 1KLGD 5CV5A 4C2MB 3TMEA 2L12A 1RKNA 1WCMB 2F0VA 1VMCA 1O78A 2H89B 1FGBD 2SNSA 4K8IA 2RSNA 3QB3A 2B76B 2TSSA 5TSSA 4CJ2C 2CVRA 2QMTA 1O7YA 1ILQA 4FO2A 1Y1WB 4XE0A 2N55A 1IGCA 2AQ1B 3MHZA 3SK4A 4ABNA 2LY7A 4AS1A 4BS9A 1BCPF 4RA8A 2EELA 1SJED 3TBIB 3NWSA 5T8IA 5EKLA 4IUPA 2WXFA 1JQYD 2AUJD 3DHQA 1HRJA 3AE9B 1T6BX 1EYCA 5ELCA 2IWHA 5CV6A 1EIHA 4G57A 3A7AB 1ENAA 5H8YE 2WAQB 1F2ZA 3TZUA 3K5OA 2XIWA 3U52E 4J1MA 4C3HB 4EQPA 1VZ8A 1II3A 4GLSC 1V1PB 1SSNA 1FR3A 4IQZA 5CC4A 4H44C 1C76A 3B9JA 1HHVA 4REZA 3W3AA 1BBXC 2KECA 2WXIA 2L83A 2L5TA 5J22A 1C79A 3A8KE 1H9MA 5ELDA 5M5YB 3NTKA 4CKEA 2Q8IB 1QCBD 3H94A 4DXGA 1JWBD 2F0OA 1XWEA 1RODA 2J53A 1TIID 3VRAB 4IFDH 4OO1H 5BN5A 5A2QL 3NQIA 1EYDA 1VCIA 1L6VA 4RAUC 2AUKA 2RDHA 2YEPF 2BS4B 3AE5B 1C4AA 2WXPA 4ILWA 1IYUA 3P42A 4ZKCB 2L32A 3M4OB 1LT3D 2M2LA 1VDZA 2F0FA 1F2RI 4GDLB 5CMDA 4HSVA 1C4QA 1I4PA 1HZ6A 2A74C 1AWDA 2NVYB 1TJEA 1TWFB 1CFMA 1JC7A 2QF7A 4V0BA 1GUTA 4LK0M 1TS5A 1QOGA 2Q5WD 3WCQA 1ZKOA 2B2TC 4A3KB 3Q8FA 3T16A 1IHZA 1Z6HA 2M56B 3EGRA 4XDXA 2K1BA 4WH4A 4IDIA 3HKZB 3TEYA 2WV6D 4X3UA 3CWIA 3AE6B 2KQ3A 5BN4A 1ONLA 2V3PA 1EEFD 3MZ5A 4LTUA 4E6IA 1GUSA 5FKAC 5FR3A 5KYLA 3KLSX 4ULLA 1HTPA 3J80E 3U9OA 2NVXB 1IW7C 1FMAD 3PZ7A 2NWGA 3CQZB 3NVWA 1Q8IA 4A55A 3WOEA 3C46A 1LACA 1OQQA 1F9RA 2B2TA 2KEDA 1HFGA 2MJ8A 3GTMB 3J7AV 4C1NK 1HXYD 4RKBA 2JA7B 3P1MA 3SK5A 4MH8A 2BA1A 4HKZE 1RFKA 4YSXB 3PUVA 3VA7A 4CHTB 3PIO3 1JMLA 1RTNA 3IAM1 2KDMA 2LMCA 3IL8A 3S15B 1PFMA 1GPXA 4NDXA 5EE1A 1CHPD 3S1NB 4BY7B 3T51B 2A69D 1HCZA 2J4XA 1E10A 1JQ4A 3MA2B 4RHSA 3K58A 2EYLA 2A6EC 4FXKC 4IFDG 4XYQA 4OO1G 1QWYA 2F0WA 5JAVA 5HFYA 3FEWX 4A3FB 4KGTA 1YNTE 2R6GA 1RYJA 2BBCA 2TMPA 4RCNA 3HP3A 1RDPD 1KAAA 3W1SA 3VRBB 4K14A 3GD7A 1KDAA 3KQ4A 3LX0A 1MI0A 3P20A 3KWVA 1FNVA 4IUNA 4MIUA 5JVH3 1XCQL 4EQOA 5I2XA 1R9TB 2XWBB 3IAYA 3P7JA 5CBEE 2ON8A 4OO1I 1D1IA 1PTOB 3HG9A 3D6WA 3RD4A 2H4OA 3VR5A 2IDYA 2M0AA 2NVTB 2HCCA 1FNWA 2CW0D 1PYWD 3VR4A 3VYUA 1VJKA 1CJEA 1TY2A 4RH6A 3VQIA 2DNEA 3AB9A 3GTKB 1I50B 2WB1B 5IGGA 3GTJB 2DY8A 2L1AA 4M8AA 2PZUA 1GHJA 4F88A 5FO8B 1SNOA 4QIWB 4C3IG 2KN4A 2QSDA 1BO0A 4A3BB 3K0YA 2A69C 2M9VA 5EE3A 4HCEA 2K7VA 3R8BA 1DYQA 4CJ0B 1SIJA 5IGBA 1DM0B 2INNE 1TYGB 1STBA 3I91A 3NUCA 1DOXA 1STAA 5FLXE 5JEAJ 1MBYA 3DEOA 3Q6SA 4L63B 1T3QA 1F9SA 5LNK1 2F0LA 4XQQA 5C0XI 5BMGA 1TY0A 3FRPB 1Q10A 2EDGA 1OXTA 2X69A 3NP8A 2EJMA 3GTPB 4QUFA 2JQRB 4J8QA 1X32A 4DK1A 4QUCA 4X3KA 3S16B 2D9UA 3VA5A 4L23A 1NAPA 2MPMA 3I4NB 1I4QA 3Q8CA 1TVXA 2F0UA 3A55A 1F0ZA 3TP6A 3Q69A 5I6WA 4A3GB 3FILB 4IALA 2WXKA 1CTMA 2PYKA 2B2YC 5CV7A 2K5PA 5IGDA 3DXJC 5C3EB 2B39A 1AZQA 4JE3B 4A3IB 5IGEA 1SAPA 4XQNA 5C44B 5KIXA 2SOBA 1TZOA 3GTGB 3TEZA 3RLFA 4JX1C 4FXGC 3L3OC 4CKCA 1EM7A 2F0SA 1ZYRD 1OQRA 1GXDC 2GB1A 3G6JB 4Y7NB 1A70A 2PW9A 3ZJUA 2IX0A 1K53A 5LL6S 2I07B 5KGUA 4KJOA 1EWCA 1I4HA 5NUCA 1Z47A 2L0CA 1JWUD 2B2YA 5E1FA 1S5CD 2DWQA 1SNDA 1RCVD 1YNJC 2F0EA 1UUPA 2EY2A 5EGTA 3S14B 3W2DA 2F0MA 1F2RC 5JOBA 1L4DB 3PUZA 1PGBA 1YQ4B 5EBDA 5D3DA 1R7SA 2IW3A 1I4XA 3R2TA 1YNND 1RF2D 3I73A 2KWDA 1J9OA 1VZ6A 3I4LA 1IL8A 3AH7A 1J7CA 1I7HA 5HGTA 1D4BA 1HA5A 1GAQB 4K5XA 4R3DA 4XDDA 4TQ1A 2K03A 1PDQA 4FP5D 1G2TA 1IKMA 1STYA 1H9KA 2GI9A 3BK1A 3P4PB 5A2QE 1QB5D 2ONQA 1QNKA 1RJTA 1C8CA 1L0YB 2AWOA 3NHHA 4KHVA 1I6HB 1DCZA 1Y1VB 1FD7D 3W5VB 2NB0A 4PV1C 2NZ1D 4KHZA 1GUNA 1DOIA 1XLPA 1SYCA 2XNAC 2PMZB 3ZJVA 2PVGC 1LTID 4HKQA 1QKZA 2MJDA 3AEAB 2EYFA 3D31A 4K5VA 1FEHA 2BDOA 1Q1BA 2PZWA 3C8YA 3PO0A 4YXDB 4OZAA 2LKVA 3EA6A 4IUVA 2IL8A 2EYJA 2K6AA 4RGTA 1LABA 3SR1A 3I70A 2XSCA 3ZYYX 2LS01 5D14A 1E9MA 5EPJA 1WTOA 4FXCA 1EY8A 3K7AB 1YJJA 1MVKA 5K36H 1TWAB 3GV3A 4FNFA 4FYDA 1ZXTA 3AEBB 1TR5A 1BOSA 5BYQA 2PMVA 2RSOA 5EKKA 2CJOA 5C4XB 4YTNB 1XXGA 3RMHA 2K22A 3JAME 4YTMB 3MC0B 1NI3A 3MHBA 1XF5L 4QB4A 2I38A 1ET6A 1EWYC 3Q8AA 1XLNA 1SE4A 1JE4A 1E0BA 1B53A 5G3LD 2YEPB 4HR7B 1IKLA 3N6RA 2ICEC 5JPNC 2DLBA 2XRQD 1FCLA 1GB1A 4G4KA 3R3OA 4XXEA 4OHJA 5J1ZA 1PTOD 3U7ZA 1BQQT 1FD6A 2SAKA 2WXLA 3DWQA 3FAHA 1SYGA 5D3IB 3PUXA 3PMFA 4IURA 5T1GA 3TP8A 3M85A 1CI3M 1STHA 3RZOB 1E2VA 4HSPA 1HEZE 3T13A 1JOOA 1OXXK 4KKUA 2HUGA 1SYFA 2FFKB 1YJIA 1QNUA 1O80A 1TWGB 4DAVA 1XCTL 2F0IA 2Q8RE 1YN5A 2ZW0A 4L8JA 4B9WA 3C3LA 5CYUA 3TEXA 2OEDA 3C1FA 1SMYD 2WACA 2K5DA 4B0EA 1GHKA 4TRDA 4V190 3SHLA 3E0JA 4C56C 1N63A 2FMMA 2HTME 2F3VA 3EUB2 2CU3A 3KF8A 3Q22A 1DGJA 4HAEA 2F0GA 2XVSA 3NQTA 4LK1C 4ZAIA 3MAQA 3AMUA 2DYMA 2JXTA 3MTSA 4N58A 2BE5D 1LTAD 4IUQA 1B4OA 1ZXIA 1K51A 4L6TB 3HVZA 1VDVA 3OOCA 2B2WC 5ELFA 1MPEA 1MGSA 1ZXHA 3U9SA 1F2LA 3HS0C 4A6QA 5JXVA 5K36G 3VR3A 1AEXA 1SE3A 2WNMA 2WP9B 1F77A 3F2UA 2L55A 3FMCA 1DZ1A 5IT9E 3K6OA 3PUYA 1KH0A 1L0VB 1RTOA 3LWUA 3E9SA 5BYRA 4RGOS 1WGKA 5JJZA 3IXSA 1K52A 1JOQA 4O42A 1RM6C 2GA4B 2ACZB 4G7HC 3AE4B 3TEWA 2OHFA 3T3OA 1CA5A 1K83B 3GS2A 3NBHA 1ZP0B 3NVVA 2JEBI 2XWJB 5JEAH 1NYRA 3TUOA 1P7EA 2B2WA 5C2TB 4TSSA 1S5ED 1AYFA 1PLFA 1IBXA 1NCVA 1TS3A 1SF0A 4C3HG 1IYVA 2AX5A 3I72A 2OXPA 1LT6D 3HOYB 1PRTD 1KABA 1PGAA 4PMCA 4Z9CB 3S1RB 3OW7A 1PZJD 1E2WA 3AEEB 4US9A 4NMZA 3AE8B 1TQOA 4N9TA 2PO4A 2OT2A 2L9HA 4LMQD 4K8JA 2GRIA 1PFDA 3AE2B 3OSOA 5M3MB 1ROEA 2QJLA 3L9AX 2DN8A 1WD0A 2BE5C 3S1MB 2LFIA 2EYMA 1UWXA 5A35A 2WXQA 3M7GA 3MWYW 2KUMA 1R4PB 2J0TD 3I8ZA 2QEJC 4A93B 3AU7A 2B8FA 2I46A 4QF4A 1K8MA 5EQ0A 4ZHPA 1H9SB 4A90A 2MGSA 3S1QB 2IX3A 3LNNA 1C48A 3KLSA 3TZDA 4UAIA 2VZKB 1KDBA 2NUCA 4K2KA 4MM3B 2JYTA 2ZT9C 5EPKA 2DNCA 1BXTA 2WKCA 2BS2B 2WIIB 3JAML 5E3FA 1TKGA 4RWSC 5M3FB 4KKJA 1Q3LA 2DBYA 2Z4HA 4U673 2IX1A 1X3QA 2KCCA 4OL7A 1PTOH 4RF1A 1BCPD 3S17B 3AB5A 5I4DA 2E2HB 2WXGA 2EYHA 3LWEA 1SBBB 3D8GA 1WTRA 4CQNA 2K05A 1SNPA 4WWMA 2CQAA 3FPUB 2I2YA 1Q12A 4H13C 1FCCC 3ZGZA 1C78A 3K57A 4Q2JA 3BWUD 2Y5CA 4R9WA 1PRTC 3S9WA 2R3ZA 5HHDG 4H2AA 4PQXA 4DA2A 4DK0A 3P4QB 1NENB 1KRHA 2WXHA 1CQVA 3IFDA 5JEAG 4IOIE 1G8ZD 2Z8LA 4PMWA 3S2DB 1LO5D 4F87A 3OHXC 3P1HA 3X3MA 4G7ZC 3AE3B 2F0NA 1WWTA 4WQMA 2KA7A 1LLRD 1PZKD 3E56A 2WINB 3DEPA 3HUIA 1I4RA 2AQ3B 3KLRA 1NUCA 5AFWA 3Q23A 2JA5B 4IKGA 1SFOB 1LT4D 2KAJA 4DXFA 5BMIA 5FO9B 1VF5C 4IFDI 3RPFC 4CJ1B 3OIQA 5DAUA 3ZQ4A 4LAAA 1VZ7A 4DU9A 2YU9B 1G6ZA 3Q8EA 1EYAA 3HGBA 1WXQA 5KNCA 2KVMA 4GZYC 4BY1B 2VUMB 5CV4A 1BCPC 2EVBA 2A68D 2R61A 1CA6A 3NWTA 1EZ6A 2NN6H 2SEBD 3NVZA 4CGYB 4FF1A 3D6CA 1BUVT 5IT9L 1QQRA 1M8AA 1SNMA 3ERQA 2AWNA 4Q5VA 4X3TA 4FF3A 1I4GA 3P4RB 1RHPA 4KMUC 1OXVA 1IGDA 1N62A 2WXNA 3H6MA 4ME5A 1UGJA 4MACA 1WRIA 2VB2X 1SB3C 3SDZA 1FM0D 4WORA 4OIJA 1TWHB 4A8XC 4L2YA 1D1KA 1G2SA 3D4DA 3B2GA 1ZPSA 1D2BA 2JWUA 2Z1CA 1FO4A 1AP0A 2A73B 2NTSA 1Y8NB 1JORA 1N60A 1JCKB 3IAS1 3Q24A 1MI2A 2VB3X 4N9PA 4WIPA 1S5BD 1SNCA 4IUUA 1T5XD 2K01A 3BYYB 4K6DA 1TS4A 2JX5A 2WXRA 3DWGC 4ZOHC 1JROA 3AE1B 1SYDA 2PCFB 2RQXA 2NMQA 2WXMA 2FINB 2M00A 2O5IC 4A9AA 1QLBB 5CGKA 1U4PA 3DUZA 3KK7A 3RUZA 4C7YA 5T1IA 4XQJA 2WXOA 1C9FA 2MJEA 3VR6A 2CW0C 4XWTA 2D5DA 4HMIA 3GTQB 4YIJA 3LXFA 3QIAA 4I7ZC 3NSWA 2CHBD 1QOAA 3J7AF 4GDKB 3MXNA 4DF7A 1K8OA 2LMCB 3OWEB 3SXHA 1A6XA 1G291 2KJXA 4A3DB 5LL6X 2A68C 4TQUS 2K28A 3SVMA 5MPOA 4NAWB 3LYYA 2HCIA 2RKSA 1PZID 4N6EB 5EPLA 1B3AA 1NYQA 3LB8C 1Y8PB 5J39A 2W54A 4H7BA 1ZE3D 3GB1A 3K5NA 4RCOA 4WFN3 4KI0A 2H1EA 3M3YB 1UEAB 2WS3B 4KGSA 3EFXD 1ET9A 1V97A 3J9CA 1B9RA 1WYGA 1PXUA 2RDGA 1B9NA 1QG7A 2WDVB 2K32A 2N7JA 2QIEB 2JZPA 2NN6G 4C3JB 2F0PA 1U4LA 3VR8B 4BA2I 1ENCA 5CORA 1QOBA 4JWUC 5G5GA 2XN9C 3BYTB 2NTTA 3NS1A 3FPPA 3BK2A 1CT1D 1BF4A 3OMCA 1SXTA 3AV8A 1WTQA 4HJGE 4BWGB 1DOLA 5FOBB 5C0XJ 4KGRA 1OFFA 2JE6I 3AN1A 3A8JE 3RZDB 1STEA 2J42A 3QJYA 4C1NI 4L1BA 3KBXA 4A3JB 2A6HD 5EE9A 3V05A 1SNQA 4KY5A 4OIKA 1XLOA 2NN6I 4HMJA 4IUTA 1V8QA 2VZKD 1FRRA 2F0DA 1SYBA 2R7ZB 1VF7A 5EJWA 3D4RA 4RFBA 1E0ZA 2X6GA 1ZUD2 3CRKC 2N88A 4FXDA 1Y56A 1H9JA 4US8A 1BNZA 2ICIA 2D5GA 1YN4A 1WTVA 1I6VC 2F0TA 5DNFA 2F3WA 2E2IB 2KACA 4NP5A 3PO2B 1EY9A 1O7LA 4A3MB 5KRUA 3P63A 5KNBA 4BA1I 2K5QA 5D65A 2ZW1A 2F4IA 4RHRA 1ZYRC 2LHDA 1TKWB 1V1PA 2MUYA 3MFYA 2EYPA 1GOZA 4OZBA 1WVLA 5C5LA 4NKLA 3OMGA 2HDLA 2HQEA 1LTTD 5C4JB 3BVMA 1S5DD 1EY6A 1DOKA 2N9KA 2NYZD 2B63B 4F8MA 1FRDA 3BZDB 3BIID 4H0LC 4NZLB 5BN3A 4RF0A 4MN3A 5EKIA 1GUOA 1PGXA 2JSOA 1YNNC 4ZUIA 1QILA 2FE8A 2Q8TA 5BMHA 2C9OA 4BBRB 4KD3A 2PW7A 2R93B 3HOVB 1HPCA 3AMZA 3FKIB 3HRZC 4B0MA 1TT2A 3NRZA 2DY7A 3BDOA 1X3PA 4YSYB 4AQ7A 2BA0A 2WKDA 1JICA 2BOSA 3D4WA 4KTAA 3K5LA 1Q90A 3UI3A 2G1EA 1EEID 1HUMA 4KK7A 4IZ8A 3P4SB 5C4ZA 1VRAB 2O2LD 3ND8A 4NJCA 3SK6A 1WSPA 1RWSA 4MT5A 1ESFA 3T3NA 1MSHA 2EY6A 4X3SA 1EZ8A 1KTKA 3A7LA 2RA4A 5COYA 1DXMA 4J3OD 1ZOYB 4RNAA 4G7OC 1SDFA 1BUIC 5F2DA 1ML0D 1JOKA 1LV9A 3C1EA 2BS3B 5M5XB 2E74C 2L4NA 2BYTA 5EBCA 4IN3A 4TKOB 5I2YA 4M1UB 1J7BA 2D62A 5HURA 4KX6B 2K33A 1N61A 1EY0A 1PMRA 3IKJA 2RMMA 4HTHA 1STNA 2F0HA 5ELEA 1ICWA 3AEFB 3BDLA 3MVVA 1WTPA 2J52A 1AFPA 1EIGA 5G5HA 2IGGA 5CBAE 2MP1A 1XX8A 2KCNA 4ZRZA 3AEDB 5ELBA 1S5FD 2RVLA 4I65A 3KUPA 4ZKBB 3QG1A 4DAYA 2KHSA 1EQTA 4R8IA 3T4AC 3K59A 3V96A 5KEEA 1UNSA 3HEJA 1CK1A 3OIPA 3NXWA 2E2JB 4KV6A 1G91A 4K5WA 1D6EC 2MJ3A 1ESRA 5I6YA 1KNAA 2YYZA 2RDFA 3EVQA 3OPOA 4LJZC 4AYBB 2N9LA 4DAPA 1HFNA 3KBGA 4S3SA 1QOFA 4XIGS 1PTOC 3ND9A 1U4RA 4KY7A 5DM63 3H09A 5E4XA 1XLQA 3ZJTA 1S4ZA 2K9XA 2MH7A 1Q1EA 3AE7B 1MD2D 1C4CA 4MHEA 2IGDA 3L7ZC 1QE6A 1F9PA 4D2KA 1IW7D 1TS2A 2EY5A 3SR6A 2LFNA 2O5JC 4O1NA 2E2DC 1T5EA 1JWAD 1TKEA 2PKOA 1QF6A 4DNRB 2VXWA 1XEEA 2NVQB 3ETRA 1SMYC 2JU6X 1FXIA 3PUWA 2SNMA 4DQOC 1EL0A 3HOZB 2W55A 1BDOA 2K3UA 5JPMC 1B50A 2KOLA 2EOTA 3D3RA 4M0WA 4YSZB 3U4EG 4HCSA 1P7FA 1KDCA 2V4DA 4KN7C 5IODA 3T56B 3TSSA 1A2TA 1OXSC 2G9DA 3DWMA 2W3SA 4ID6A 1NR2A 2K5WA 3FDTA 1B2TA 2PIAA 3R2IA 5HI1A 3J81L 2L52A 4PNYA 3FVQA 4ITKA 2JYOA 1HZ5A 2EE1A 3HVDA 3NTHA 3ONAB 3ITPA 3GTLB 3EROA 5AUIA 2A6ED 4HN7A 1JB3A 1EY4A 4KD4A 3CKIB 1BMLC 2L1BA 1JW9D 2B2UC 2D2CC 3SFDB 2BDNA 2M19A 2WU2B 4J6HA 3IT4B 1TU2B 1HQMC 2JEAI 3UI2A 2WDQB 3NVYA 1E7PB 1H9RA 2SDFA 2K04A 5E6JA 4WURA 4TQ0A 1HA6A 1XO3A 5BYSA 2AQ2B 5KYIA 2HDMA 1U4MA 1Y69U 2BT6A 1GB4A 4ARCA 4JK1C 5IGFA 3HZXA 2E3TA 1EFID 1J7AA 3U2SC 4OW0A 3KWLA 4OGQC 1K50A 2PLPA 1R4QB