3R2TA

2.2 angstrom resolution crystal structure of superantigen-like protein from staphylococcus aureus subsp. aureus nctc 8325.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
195
structure length
195
Chain Sequence
NRLYDTNKLHQYYSGPSYELTNVSGQSQGYYDSNVLLFNQQNQKFQVFLLGKDENKYKEKTHGLDVFAVPELVDLDGRIFSVSGVTKKNVKSIFESLRTPNLLVKKIDDKDGFSIDEFFFIQKEEVSLKELDFKIRKLLIKKYKLYEGSADKGRIVINMKDENKYEIDLSDKLDFERMADVINSEQIKNIEVNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title 2.2 Angstrom Resolution Crystal Structure of Superantigen-like Protein from Staphylococcus aureus subsp. aureus NCTC 8325.
rcsb
source organism Staphylococcus aureus
total genus 56
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r2tA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3r2tA01
5I4DA 1KLUD 1XXGA 3DWAA 2QILA 4UDUC 5ELCA 1FNUA 1ET6A 1TY0A 2CHBD 1PTOF 4OHJA 1L0YB 2XRSD 4RCOA 1JWMD 1LLRD 1XTCD 1TS3A 5FK9C 1PYWD 2TSSA 1STEA 1MD2D 3MFGA 3BYYB 2Z8LA 2RDGA 1TS2A 1BCPC 2AQ1B 1LTGD 1I4RA 1FGBD 5ELDA 1EU3A 2WV6D 1JWUD 1CQVA 3BVZA 1LTBD 1T5XD 2IJ0A 2AQ2B 1YN3A 1I4HA 5ELFA 1EEFD 1PRTD 2ICIA 1BXTA 3GP7A 4L63B 2SEBD 1DYQA 1YN5A 1LT5D 1YN4A 1D6EC 1UNSA 1FNVA 4K6LA 1BCPB 1S5FD 1CT1D 1EFID 1TY2A 1ET9A 1GOZA 2AQ3B 1SEBD 1CHPD 1JCKB 5D3IB 1S5DD 4RGNA 1FNWA 1PTOD 2J4XA 3O13A 1KTKA 1HTLD 1SJHD 3OWEB 3R2IA 5D3DA 1ESFA 1BCPF 2G9HD 4RGMA 1SE2A 4DXGA 4DXFA 2O2LD 1B44D 3EA6A 5ELBA 3BVMA 1JR0D 1PRTC 1SBBB 1SE3A 4BWGB 1HQRD 1RDPD 4O1NA 2RDHA 1LTSD 3BZDB 2XN9C 1PZJD 1F77A 1ENFA 1LT4D 1RD9D 2NTSA 1FD7D 1D5XC 1QILA 3BVGA 1D5ZC 1TS5A 3R2TA 1M4VA 1LT3D 1I4GA 1S5ED 3EFXD 1V1PB 1DJRD 1JQYD 3CHBD 1EWCA 4RH6A 2IPKD 4RHSA 1I4PA 3DWQA 1V1PA 3TSSA 5TSSA 4TSSA 1AW7A 2NTTA 2QEJC 4C56C 3URYA 3KLSX 1V1OA 1PRTB 1UUPA 4RGOS 1KLGD 1S5BD 1D5MC 4L6TB 1PZID 3V05A 1I4XA 1CHQD 1CK1A 2XNAC 1RF2D 4Z9CB 4NZLB 1AN8A 4RGTA 1LTTD 1S5CD 1TS4A 3W2DA 3BYTB 3SEBA 1JWSD 1B1ZA 1L0XB 1LTID 1EEID 1G8ZD 1BCPD 1HXYD 1EU4A 2R61A 1HA5A 3R8BA 3DWPA 1LTRD 1PRTF 3MC0B 2XRQD 1SE4A 1RCVD 1LT6D 1LO5D 1SJED 1PTOB 1PTOH 1LTAD 4RFBA 5ELEA 1SXTA 5FKAC 4ZYSA 1PTOC 1I4QA 4RHRA 1PZKD
chains in the Genus database with same CATH superfamily
1L5PA 4DXAB 3QWNA 1R9TB 1YJIA 2MQHA 1WFQA 1EO6A 5A35A 3OWFA 1PVOA 1LUZA 4WFN3 5C3EB 3SFEB 2P5ZX 1L0YB 3HOYB 1V8CA 1WJJA 2KDMA 1R4NI 3N1ZC 1U9RA 4TVAB 2KJXA 3RNUA 1Y69U 3A7LA 3H91A 4CHTB 1JWBD 3MVVA 1BCPC 1I4RA 4X65L 3ENEA 3HM6X 3AEDB 1CQVA 1NR2A 2WB1E 5CC4A 2J0KA 3W1GA 1A8VA 1F9RA 2LEKA 2AQ2B 4A3LH 2VY3A 3RZOH 4BVUC 1G2SA 3R66C 1GB4A 3L0OA 1SSNA 1FFVA 1JMCA 1R4MB 3MJ5A 4HJKA 5BMHA 3A5ZB 2O2VA 5M9OA 1MJCA 1LT5D 3FHWA 4XDCA 4WRDA 2YYZA 1QZGA 1TWGB 4UAIA 1S5FD 2K5WA 1JB7A 2J52A 4YY3L 1GJZA 4OX9L 1KHIA 3WAMA 2WXLA 3T1HQ 2KN4A 2KQSA 1V6EA 1OEYJ 1OXXK 1SYDA 1HUNA 2Y5CA 5K5PA 2A4ZA 2KVZA 3GS2A 1JALA 3GTJB 1EZ6A 2KJ6A 3H1UA 2E6XA 2CH4A 2DHZA 1WI5A 3IXSA 2MA9B 4BBNF 3VYRA 5K36H 2C60A 2N7EA 3X23A 4F88A 3I70A 4P7IA 3K5NA 1AYFA 2O2LD 5IAAC 4JV5L 3Q8AA 5LNK1 2K1BA 3HK0A 4KN4C 3CF5A 4LLGM 4M0WA 3NUCA 1QLBB 5KYIA 4ZRQA 4EE2A 4M1UB 1STBA 2M56B 3DWMA 1LT4D 5E1FA 4JBWA 1WXSA 3UDFA 2E2JB 1RJTA 3T9LA 2EYHA 2UXDQ 2LXAA 2FMMA 2QMTA 1GNUA 1CSPA 2F0OA 1CTMA 1K51A 2IX3A 1K8AC 2N9XA 1H9SB 3CW2C 3FPPA 4JI1L 4A3IH 2QEJC 3TZUA 2K6QA 4N9TA 3I73A 3ZNZB 1Q8IA 3J80i 2KJRA 2D62A 4KVGB 2ZZPB 1KLGD 5J39A 1P9DU 1RODA 5C3WA 4A3DB 2F0KA 4HKQA 4K0KQ 3PF5A 2IY1B 4DK5A 3V2TA 2XK5B 4TMAB 4A3GH 2PCFB 2ZVNA 3SDLC 3R93A 1SNDA 2MO0A 4HJ5A 4OO1I 4OELB 1GJXA 3N52A 4R8IA 3ZNGC 3OHXC 4BKSD 5IE8A 1K83B 5M5XH 4A6QA 1F2YA 2ALYB 1SFOH 3MC0B 1VQ7A 1SE4A 1A6XA 2K22A 2VH1A 2DENB 3A1QB 3IHPC 2KK8A 2WXQA 1L0WA 1MI0A 2MO1A 3T51B 4KTAA 4XQQA 4GS3A 4DKAC 2BH8A 1IBKQ 4BBSH 2WLBA 1TZ1A 2BYVE 4GXBA 1GXDC 3T3OA 4C3JB 1EOVA 1ZYRC 1IYJB 1SNCA 4P75A 3JAML 3MAQA 2YU9B 1E7UA 4DR1L 2UUBL 1SLJA 5GMVA 3H09A 4AYBE 3K8AA 4KKSA 2B3GA 2ASQA 2KYWA 1STAA 1UEBA 2FFKB 4DK0A 4KHVA 4DV7Q 1QOAA 1SF0A 2DZKA 4M01A 1YZ6A 3RFZB 1E1TA 3BJUA 3TQYA 5D2MB 2SNSA 4M00A 2PE6B 3E0EA 4DR5Q 1QOHA 4M8AA 2N8NA 4PT5A 4WJOA 5GAEC 1V5OA 4ARCA 3PRPB 5JH5C 1TT2A 2JYTA 5BN5A 4P6VF 4ARIA 1AFPA 2K5HA 1S4ZA 1VQGA 1JRUA 5CHVC 3NXWA 4ABNA 1UF0A 1I94Q 3WALA 1GUTA 3KLWA 4XT1B 5CMDA 2L0CA 2UXBL 4IPCA 3ZIMA 4C1NI 4QMGA 2JEBI 2HT1A 5IODA 4AUQC 1L1OB 1EY4A 1X6OA 3S17B 1QJOA 2J0TD 1Y1WH 1RL2A 1FJGL 2KZRA 4DV5Q 2K4KA 3S2DH 1SDFA 3BDLA 1S72A 2J0JA 3WA0A 4JYAL 2Q2UA 2R7ZH 2BE5C 3BDOA 3A5UA 2M0AA 2RSUA 5KHQA 1EYGA 1JE5A 3U58A 4HLEA 2EYMA 2FIFA 5D3IB 3PO3B 1S5DD 4A3BH 1TWCB 4LFBL 5IOCA 2LUEA 1VQDA 5DM73 2DGYA 3L2PA 2KX0A 1B8AA 3A9JA 1O7LA 4B08A 1K8GA 1M94A 4ZRZA 1KXLA 1PH8A 1WXAA 2NN6G 4NAWA 2DAJA 4NQLB 3KF6A 2F0IA 4CDCC 2GBRA 2YLMA 3NS8A 1WYWB 1EL0A 1SE3A 1C78A 2BVCA 2IGHA 1MSGA 4QF4A 1WX9A 3BZDB 3LWUA 3TJPA 1BBWA 3OJ4B 3BDCA 1Q0WB 4MGZE 3CCLA 4JI8L 2B63B 1M4VA 2V4IB 1LT3D 4X3UA 2AUJD 1M8AA 2KWUB 3CKIB 3C1FA 3RT3B 3TMEA 1D2BA 2K6AA 3X3NA 4IURA 1QE6A 4JI7L 4A93B 3KJOA 3NTKA 3GOEA 4OWTB 1XNQQ 1YBYA 4FF2A 3IVFA 5FLXE 3I9V1 1H95A 2WQYB 3QJYA 1E8ZA 2V9HA 2XNAC 4LFCQ 3ABVB 3RPFC 1MJDA 4ASWC 4I65A 3KWLA 1VCIA 2MGSA 3UDXA 1WTXA 2IO0B 3HOZG 3HOUG 2R61A 1PGBA 4DV0L 2OJWA 4S3SA 3IAS1 1SMYC 3HGBA 1VQAA 2XIWA 1LQBA 3T53B 4NY0A 2F0VA 3PO2G 3OTOQ 5IT9E 2BS2B 2XSCA 4IWOA 1F9PA 3GTKB 3PUYA 2BT6A 1IP9A 3HKZG 5IY0A 2HTME 4ACFA 4PS8A 5H1SE 1XXGA 5BMGA 1ENCA 4O0AA 1WZ3A 1Z9FA 2QILA 2RR9A 3AQQA 4DUZL 2MFIA 2EJGC 4G4KA 5CV9A 4AQ7A 2QEXA 3K6OA 3QC8B 3R7QA 1K3BC 1SNQA 2BF8B 3AU7A 4IPGA 5LLIA 2KVMA 1DONA 1RIPA 1GUNA 4KK7A 5IYBH 3H15A 4LMQD 3DBRI 3K59A 1UWVA 2CHZA 2BW2A 4B3SL 1YNXA 2X38A 1BDOA 4HMJA 1EFWA 1ZEQX 1QOFA 2LFNA 4N59A 4ZRJA 1T5XD 3GTOH 1IZ6A 1E0ZA 3NZSA 3I3CA 3HS0C 2IYDB 5HG2A 2EKEC 2NZ1D 1XLQA 2RD0A 4K3CA 3DBHI 2LXJA 2N88A 5DEHA 4LUOA 4R9WA 5CBEE 3IBEA 5JVG3 2K5VA 2NBVB 4AS1A 5C44H 4DV2Q 1V8QA 3BK2A 4OZAA 4OGQC 4CBVA 2EY6A 1NJIC 3QAQA 1XLNA 2VUMG 2JZZA 2VQFL 1WE7A 2NVXB 1PV4A 4R8NA 2EYOA 4UP7A 2JXTA 1CFMA 2B2UA 1OTCA 4ZRIA 3GB1A 4ZLTF 4A3KH 4HWIB 2KMAA 4LF6Q 1DZ1A 2LWPA 3AI5A 4PQXA 1IYUA 1T9HA 5EBCA 4EQOA 1WCMG 3VR5A 3W5UB 4TRDA 1I6VC 5ELOA 3AN1A 1E22A 1ZYRD 4ZKBB 1O7ZA 3S14H 4YIJA 5NUCA 2KBNA 3N3KB 3PZDA 1B44D 1XMQL 4FBJB 1ZKOA 4DUYQ 3HIZA 3VA7A 3QOJA 2LHEA 4IQZA 2K04A 1VQHA 2XN9C 2CCZA 5C3EG 4R4TA 4X66Q 4XT3B 3PO0A 1V80A 1PZJD 2EYJA 2HDEA 3P7JA 1HR0L 2UXCQ 1D5ZC 1IHZA 2E2IH 3JVZX 1UE1A 1N36Q 2MBEA 4TQ0A 3RUIB 4IN3A 5FLXc 1N34Q 4DR4L 5M5WH 5GAGC 2NZOA 3CHBD 4PV1C 1EQQA 3SE0A 5IGBA 2I1JA 4A4IA 2GRIA 3H7PB 3GTPB 1FD6A 1YNJD 3GTMH 3AV8A 4LK0M 3ITPA 2KTRB 2MWSB 1H9SA 1HNWL 4KI0A 4FXDA 3F2UA 4HJ9A 4BA2I 1RF2D 4BOZB 4IZ8A 5IT9c 2BE5D 3Q23A 1RHPA 3D0FA 2PZTA 4KDLB 2FIDA 2BKFA 2XK5A 1WGDA 1XWEA 2JEAI 1UWXA 1ASYA 4R4OA 2ONQA 4DV1L 2CHXA 3SHLA 1X3GA 5MPOA 2XEWA 2DBYA 2G3QB 1HNZQ 3A1QA 1SMXA 4A3EH 1FVIA 2OQKA 5KRUA 4NAMA 1KRTA 2K5PA 1NSNS 1PYBA 1B9MA 5M3FG 3MEFA 5COYA 3KOJA 2CJOA 1EY8A 3PF4A 4GKKQ 1VQFA 2CH4W 2DNCA 4GNXC 2PMVA 4AIMA 3GTLH 5EPLA 1ZP0B 2BYFA 1EQRA 1E9MA 2IW3A 4C7ZA 3W5OA 1J7BA 4FYDA 3H8HA 3PIOA 3IFDA 4PZ8A 5EQ0A 4BBNC 2KWCA 3E6ZX 3A33B 4CKBA 2BPSA 5HY6A 3L13A 1IYFA 1CA6A 3PZ8A 3MEHA 5I2XA 4BKTA 1LTGD 3TEYA 3ND8A 3TMPB 4AOFA 1CKNB 2YEPF 4ZUJA 1X65A 1PH4A 3BVZA 4JI0L 3IT6B 4APVA 5D65A 3M85A 5C0XG 2MLBA 1EY9A 5BYQA 5C4XH 5GQOA 4EX5A 3GTQH 4W9HA 4DBGA 4J1MA 2QDFA 2OHFA 3AEBB 4MJSA 4UP8A 5BYRA 1Q12A 2OXPA 1J9OA 3T1YQ 1KF6B 2F3WA 2MJEA 3ZNID 1U4LA 1A63A 2R93H 5KNCA 3PV1A 1Q90A 2N49A 5EKLA 2JZPA 4O2DA 4WORA 1HH2P 4A3DG 2WDQB 1L1OA 4LNOA 3RYTA 3GQBA 3AB5A 4UPAA 3MWYW 1C0AA 2SOBA 2K0PA 1QVCA 3NJTA 4G7HC 2WX0A 1MGSA 5A2QL 4LJPB 5AZGA 1IBML 1NAPA 1NVID 2EQSA 4F7XA 3ZW3A 2Z6KC 2IGGA 1VQIA 1UGMA 3WDNA 4X6AH 1IPGA 4JIOU 5JXVA 3S2AA 4NDXA 2L0FA 3EIVA 4C2MB 3EC8A 3Q3JA 4OVUA 4WAAA 4ALPA 3KDFA 4JK1C 1DOLA 3H0GG 3J80L 2B8GA 3CCSA 4C3JG 4JI3Q 2C7MB 2FAZA 4LF5Q 3DBLB 1JOKA 4IFDH 5IGFA 4QIWB 2JSOA 3G48A 3HOXB 5EE1A 5BN3A 1F77A 3F2CA 1V9PA 1C4CA 3K7AB 1FL0A 1L7YA 2Y5BB 4LNQA 2KHWB 2WU5B 3C0RB 2LRUA 2BDOA 5FOBB 3HFZB 1WGRA 3KJPA 3OPOA 3EFXD 5D6JB 1EUJA 1WR6E 1P98A 1Q3LA 1DJRD 4JOIC 4LCDE 2L7RA 2D3BA 4AJYB 2FE8A 3J7AV 2JU6X 4FF4A 1Z6HA 1N63A 4DDGD 4HPPA 1PXUA 2Q2TA 3EFCA 1NY4A 3AEAB 2LI5A 4HN7A 2WB1B 4YWGG 2K50A 4W9FA 2DX5B 4FHKA 2K32A 1YX5B 2PTLA 5IGCA 3PIO3 3H3VI 1WJ6A 1A5RA 2RA4A 3OOCA 1UE6A 1QQRA 1TJEA 2GOWA 1S1QB 3DWPA 4MGKE 3I4MH 1C3TA 2M17A 5IGGA 1DOKA 1UE7A 4LF7Q 4HIDA 1VRAB 4J8QA 1TQOA 1WTPA 2MHJA 3AU4A 3EJIA 5FKAC 3PO3G 2I0QA 2INDC 2D3AA 3UE0A 3RZWC 2D0PA 1ZDXA 3NG0A 1WGHA 2DJFC 4QY7A 3HOVB 3GV6A 5I4DA 1WIAA 3PCOB 3M3JA 3K9OB 4GDLB 1Q1BA 3KF8B 3VA5A 2RKSA 3NQIA 4C3HB 3AE3B 1B9NA 2NYZD 1OO9B 1Q86C 4R1JA 3DBSA 4HR7B 1JWMD 1KDCA 3FKYA 3ZJVA 4XIGS 3DMUA 1D1IA 1BNZA 1XPRA 1LFDA 3EBEA 4DAYA 4DFAA 1N60A 2BYEA 3B2FA 3PLVA 4QAYA 5AJ3Q 2KQ4X 2ICEC 3CCRA 1HR0W 1ML0D 5J22A 1TTNA 1HTQA 3PRMB 4B3ML 1WGGA 4DHJD 1VS0A 1ESRA 2N78A 2HHHQ 3FKIB 2B63G 1LTBD 1VQ6A 5HGTA 2V4LA 3TDQA 1B53A 2KLGA 2K39A 4JBMA 1YN3A 4LWCA 4WJPA 3HRZC 3HOWB 1IYVA 4GGQA 5EE9A 3S9WA 3J81L 3PMFA 3OW2A 1PMRA 4JI5L 2F0SA 3S1RH 1IBLL 2JA8H 2D2QA 4A93G 4GU2A 1N32L 2PZUA 1SYBA 5IKCM 1MKHA 4WJ4A 4B3TL 3CCJA 2BBCA 4RM8A 2Y0SE 1CKOA 4IPDA 4HCSA 3P1MA 5IOIA 5GROA 2K6DB 3LNNA 1E8YA 5EPKA 3R3OA 5E3FA 3FC4A 4CJ0B 4CO7A 1QCBD 3RUZA 2ZPNA 4US9A 2GN5A 4RGNA 3ICEA 5C1ZA 5KEEA 4ZAIA 1CJEA 1CZWA 1P7EA 2W3SA 2J0MA 3DHQA 4N8FA 3K5LA 4LFAL 3L9AX 4MZ9A 5HHDG 3I72A 1PFMA 1SBBB 4KKJA 1GM5A 1RTOA 1O80A 1TU2B 1Y8OB 4KY5A 2DYBA 4FXCA 3QG1A 3W3AA 1XPUA 4A9AA 5I9OA 1J0GA 2WP9B 2B2TC 4FLHA 2JZ3B 3CCQA 2I07B 1XTDA 4X3TA 2BA1A 4B9WA 5J18A 5HFYA 1E24A 4DGZA 4GN5A 1DOXA 4DHJB 3MXNA 1AARA 3RNEC 4WQOB 2HTHA 4RH6A 3U8ZA 3VR4A 4BA1I 4OL7A 4A3FB 2EOTA 2E5LL 2PVGC 4IM3A 1G51A 1GUAB 3Q8DA 4LF8L 2L32A 4A3JB 4WAFA 3ZGZA 1CM9A 1SYGA 3HP3A 3DVGY 4YL8A 2WS3B 3MTSA 1JOQA 5M3MB 1D5MC 1XQQA 2KTRA 2RCNA 3P4SB 3S1NH 1UBQA 5G3LF 3PIPA 2IDYA 3PVLA 3ZRFA 2MCNB 1OXSC 4ME5A 3MXPA 4RWSC 3TP7A 1AN8A 1IXRA 4A76A 1FPYA 4Y52H 2KVRA 3AEGB 3MP9A 3SEBA 3VR2A 3QQ8B 1F9QA 1TWHB 1STYA 4DK3C 1G8ZD 5IYCG 2CU3A 3ZTCA 1C4AA 1HA5A 4R4CA 4US8A 2KKCA 3QOLA 1PRTF 3I91A 3LB8C 2W3RA 1B4OA 2KQ3A 3RZDB 1T6BX 1J5EL 1LTAD 3K58A 3VR8B 2FNJB 2LRWA 1FCCC 5EE0A 4X65Q 3D4DA 3I8ZA 2EYPA 2JQRB 3B6YA 2EJFC 2GVAA 2JVCA 1PFBA 3WIMA 3DWAA 1R4NB 4XX5A 4DR6L 1TZOA 4YSYB 2WXGA 1HPCA 1DOMA 1STNA 2G5DA 1PTOF 2N1VA 3M4OH 1K50A 2O5JC 5D14A 5BN4A 3MJWA 5HI1A 4BAXA 3ULJA 4BBRB 4FP5D 1M90C 3K0XA 3ONSA 1FGBD 5C0XJ 2L4NA 4GKJL 4G7OC 2GBNA 1KDAA 1L4ZB 2WV6D 2DAFA 2QDLA 1BF4A 2V3NA 2D0OA 5DAUA 3G6EA 4OX9Q 1V97A 2QIEB 1OQQA 4DV6L 3Q69A 4PMBA 4OZBA 1CKNA 1WTWA 4TKOB 3CQZB 2DJGC 1E90A 1L0VB 3OMCA 1PQSA 2MH7A 2ZCBA 3T8MA 3VH3B 2W55A 3HZXA 3EQLC 1AP0A 2KCMA 2IX1A 2DZJA 2M19A 1VD2A 1YN5A 3VH4B 3VTVA 1TXYA 4LF9L 2C5LC 4JV5Q 1LACA 4MN3A 2GMIC 4HVBA 3VDYA 3NVVA 4IM2A 1EWHA 2CQOA 4FXKC 3OSOA 4K6LA 4RKBA 3TRZA 4DV4Q 4QGUA 1ET9A 2Z0SA 2L1BA 1UD7A 1SEBD 1JROA 5BO4B 4A8XC 3CPFA 4WJWA 4KZ0A 2JRIB 1L2NA 4GB9A 4ANVA 2L11A 4R4IA 1IKMA 4GLVB 2HCCA 5D3DA 2K03A 4I6NB 2ZTCA 1Y14B 5CORA 3DVNV 4PG3A 3W1SC 3DEOA 4JBJA 2QA4A 3L10B 4Q0FA 4ZRPA 2WINB 1Q46A 1SR3A 1WTQA 1VR9A 4JI6L 3NZ3A 2BA0A 4EEWA 5FLMG 3BVMA 1V81A 2FUHB 3W1YA 1WTHA 4JI1Q 3T13A 4TKNA 1E7PB 2OTLA 2QKIC 4HRSA 3PQIA 2KCTA 3PIP3 2LS01 2UUCL 3TBLD 3SK5A 1E6EB 3FVQA 2NMQA 1EF1A 4G11A 1EYDA 5JJKA 2Q8TA 1TR5A 1I4GA 1TWAH 1Z2MA 3M9BA 2GBJA 2NZHA 1JQYD 3E5SA 3KYCD 2PPHA 1P7FA 3BIID 1A2TA 3S1MB 5M3FB 1YJ9A 4JVZA 2D10A 3UIPB 3LWEA 1VQOA 3AB9A 4WJ3M 4BXXG 3QO2A 3CD6A 2KACA 4Z9CB 2WXOA 1CZGA 5JVH3 1FRDA 4KKIA 4B6WA 1JT8A 4DR1Q 2NVYB 2UUBQ 4RMAA 1EEID 2O5IC 1MI2A 3TEXA 3A8JE 1NMGA 4KV6A 2YTYA 5JJLA 2KUMA 4FO2A 3ZRCA 1PTOH 1SYFA 3NWSA 3GTOB 2GA4B 1Y8PB 4DR7Q 2OJRA 1A15A 2PKOA 3JAMc 3A4RA 3NWTA 3U30A 2BTEA 1I50H 2NN6H 5I6WA 4W9IA 2JWUA 3QARA 2LZ6A 1H9JA 2F1MA 3S15H 3HKSA 2W9NA 3PLUA 4GDLA 4IOIE 5C44B 3KF8A 4YCWA 3M3YH 3C2PA 4RCOA 4A3MB 2DLBA 4ZYNA 3C19A 2CWAA 4YTNB 4QL5A 4ID6A 2D5DA 4HIOA 1ZXHA 2IO2B 1TBEA 3GTGH 2DYMA 4EOYA 1PGXA 2KOLA 3MHBA 3HOXG 5JHBA 2Q2IA 1IW7D 1GG3A 1VF7A 2KECA 1RM6C 1WX8A 1D8LA 1FJGQ 3NS1A 4H7BA 1E7ZA 2AQ1B 2D2CC 5ELDA 4I7AA 3VFKA 4JYAQ 1E1OA 1K8OA 3LGJA 1VQ9A 2EELA 1WFYA 1X3PA 4EZJA 1F2RI 2Y3AA 3TS2A 2UU7A 5DNFA 4LFBQ 4YSZB 3UQBA 2AHOB 1LM0A 4E74A 1T5EA 1X56A 5FO9B 5LMNL 1EEFD 2WNMA 3K81C 3H0GB 3ZJUA 4X3KA 4A3CG 3D31A 2RSOA 3RLOA 2VNUD 5E6PA 1WGYA 2BDNA 3S1QH 2YTVA 1JJ2A 4JQWC 3H6NA 5HURA 4KHZA 4IFDJ 3L17A 2F0EA 1YNTE 4DA2A 1YN4A 5EKIA 3HOZH 2WB1G 3SK8A 3I4NB 3HOUH 1JOOA 2WXHA 3VYSA 1XLPA 2ZTDA 1ZE3D 2L52A 4M8MA 4GOPC 2NUCA 2E2IB 2DNEA 4PK1A 4C1NK 3PO2H 1JORA 2L15A 2WXIA 2Z59B 3U7ZA 4C80A 1GUOA 4NXMQ 4JI8Q 3DM1A 3P1HA 5C0XI 3TREA 5GAHC 3D6WA 3IAM1 1A3TA 4MJSB 5BMIA 1AZQA 4G3XB 1KJTA 1X9NA 4DXFA 1SE9A 5G5GA 1VMCA 1TVXA 1LM8B 4PMWA 3HOVG 1HZAA 2OCEA 2EZVA 4K3BA 1JR0D 1O7YA 3VAWA 5BYSA 1GUWA 4NJCA 4JI7Q 2A68C 2A6HC 4LNIA 2XWJB 3RLFA 4C3HG 1KM7A 3F2BA 2VZAA 5LL6X 4N6EB 1GKHA 4K8JA 2KFJA 2QC8A 1GC6A 1DCZA 4IUVA 3B2GA 4W9LA 2ACZB 2RVLA 1WSPA 1F9JA 3NK9A 2PLPA 2D3CA 5IYDG 2HE7A 4NXNL 3NZUA 3IRBA 3I90A 4YCUA 1E2WA 1DOIA 4Y7NB 3KH0A 1MSHA 1K3RA 1Q81C 3ZUNA 4DV0Q 3M4YA 2KEEA 3R3MA 1MHHE 1Q7YC 3FKIG 5EJWA 3MXUA 1PDQA 5DPTA 1QF6A 3KDFB 2CHWA 3URYA 3A0JA 3HOWG 3VRAB 3VYTA 2JA7B 4L23A 2NPTB 4K6DA 2R92B 3RN9C 3S16B 4OWXB 4B95A 5I9PA 5C6AA 1E5WA 4KIKB 3AMUA 4MNOA 1I4XA 2E2DC 1SSOA 4AH6A 4EVOA 2KJHB 2E2HB 2VUMH 4JWUC 3H3VC 4NZLB 4XYCA 4DUZQ 2BS4B 3SHQA 3BYTB 2F3VA 2QSDA 3AYHB 1B1ZA 1L0XB 1HJPA 2ZNVC 1BCPD 1HXYD 3QIAA 2ZXOA 5M5YH 1ONLA 4K5VA 2V3SA 4FNFA 3UE1A 3CCMA 3G7LA 4KGTA 1SJED 1WCMH 4K2LA 4KSKC 5LMUL 2R3ZA 4PYZA 3ND9A 5FR3A 2A69C 4WQMA 1HZCA 2BCOA 1R9TH 2NVQB 4P2CB 2VW9A 2G4SA 2DZMA 3P2BA 3VR6A 4UDUC 2ID0A 3N6RA 1G6PA 2F0GA 3QK0A 4HPLB 4YTPB 4LK1C 3RNGC 5C3EH 3RN2A 3OIQA 4WJQA 4JG2A 4LUZA 4KHPL 4QCLA 3HOYH 3KYDD 2D07B 3PGEA 1LLRD 2PMZE 4CGYB 5C4JB 4G50A 3DBRB 4IWQA 1IBXB 2A19A 1QVFA 3RMKC 1HCZA 4NPNA 3C8YA 3TBIB 1D7QA 2UU9L 4I6LB 1K53A 3H94A 2VQFQ 1KH0A 1I94L 4PNYA 5AFWA 3E9SA 1HZ5A 3CP0A 1I6HH 2B2WC 2FHTA 1WOCA 1X3EA 2K3UA 2N0SB 1IL2A 3PUVA 4H2AA 4BBSG 2EMTA 2A74C 5CR3A 5J1ZA 1NI2A 2JF5A 3LYYA 4M8NA 4DNIA 1FXTB 2A6EC 2IHFA 4A3FG 3PTFC 4WH4A 2C9WB 2ICIA 1NBWA 1BXTA 1N8RC 4A3JG 2JA6B 4II2B 1K8MA 3N20C 4FF3A 1SRUA 2KHIA 1S3SG 2X8XX 5M3MG 1XMQQ 4GMVA 3U9SA 4DAYB 3ZVVA 4LAAA 2WKDA 4JW0A 4NB3A 4HCNB 1NUCA 4DR3L 1TWGH 1BCPB 3K0YA 3NHEB 1QB5D 1EYAA 2JSVX 1TY2A 4U68A 3Q3NC 1HHVA 1OTRB 1BQQT 5E4XA 2MJ8A 1HR0Q 2WDVB 3SFDB 3NELA 2Q2HA 3TN2A 5FO8B 3GTJH 2Z6KA 1PUTA 1BUVT 3W5VB 1YX6B 3OYYA 2JA9A 2A73B 2JE6I 1ICFB 4DR4Q 4KD3A 3I5JC 2M9VA 2EE1A 2K5DA 1PRTC 3A4SC 4ILWA 2MP1A 3DXJC 1LTSD 2D9UA 4JC0A 2X6LA 5HKHA 3WCQA 1OXTA 1Y1WG 3DDCB 4F7ZA 4IFDI 1V49A 4OIJA 2UUAL 2R2OA 2K05A 3KFUA 3Q8EA 1VQ4A 2JXMB 2L83A 1B2TA 5DLQE 4BBRG 5CX3A 2E2JH 4MSQB 5T1GA 3V61A 5C0XH 3M95A 2LGXA 1EM7A 3DEPA 1FRRA 2LXKA 2LFIA 2WXNA 1JICA 1B50A 2KENA 4I6PA 1EWCA 1SNOA 4JOIA 4DV1Q 3DWQA 2QHOA 3KUDB 5TSSA 4FF1A 3DWGC 3QX1A 3T4AC 4B9XA 3KLSX 2SAKA 5GADC 1F0ZA 1B9RA 4RA8A 4BKSA 1U4MA 2K7VA 4MTKA 5LMNW 3TS0A 5ISRA 4RKLA 5C3JB 4A3DH 2LGIA 1WH3A 1CQFA 2BKRB 3DQVA 1KNAA 2WXJA 1R7SA 2I5LX 1QUQA 2EDGA 4MIUA 3W2DA 2NWGA 1N33L 2PI2E 1W6KA 1E2ZA 4POFA 1R4PB 4WJNA 1K83H 5DPRA 2QGQA 3MXNB 5KNBA 2ZJQA 3BWUD 4P71A 3D8GA 4HIKA 3VUYA 1HNXQ 2EYLA 1P1AA 1PA6A 3OIPA 4ULLA 2MX2A 2AMCB 2EXDA 1BBUA 2LASA 2PVOD 2Y0SB 4ZYSA 3KLSA 2ZXRA 1QZHA 3MA2B 2I38A 3AEEB 1PZKD 1RYJA 3AEFB 3KLRA 4JI0Q 2NVTB 5CHFA 3GDEA 4C3JH 1FYCA 2LVPA 4XYOA 3CU7A 2AL3A 2IZVB 2A68D 2A6HD 1WYGA 2YU9H 1Q1OA 1SYCA 3UF8A 1TY0A 2CHBD 2LGSA 3SXHA 3DPDA 2WAQE 2ZXPA 3MHZA 4UY8C 3ZQ4A 2FBWB 4BY1B 1EY7A 1MD2D 3MFGA 1WXMA 2ZPYA 4TUUA 1RFKA 4ANUA 1TWFB 3MZ5A 1EWIA 2R7DA 2LD9A 4BZAA 1ILQA 1N61A 2Z1CA 5LHY1 4ME3A 1S40A 1L6VA 4LNFA 3N1YC 3KW5B 1ZGUB 3B08A 2KXJA 1XD3B 4KD4A 1B7YB 4XE0A 2VXWA 3GO5A 3BY4B 4HXDA 4H13C 2IT1A 2JA5B 2KC1A 2SEBD 2C7HA 2KAJA 4BS9A 5IGEA 1PH6A 2EVBA 3S17H 1XPOA 4GOPB 1I42A 4OO1G 1YMHE 3BG3A 3EHVA 4LF6L 2WX1A 3CAMA 4DNTB 2DY7A 2VQEL 4HCEA 3CCVA 1HEZE 3ER0A 3CSFA 3DCGA 3PO3H 1D3ZA 1X55A 1TWCH 5IP7H 4IM0A 4PS3A 1G291 4C3IB 5H8YE 3ZDTA 3J80c 3MC9A 1MPEA 4DN4M 2K9XA 2KO3A 3NPPA 2PQEA 3FAHA 1TKEA 5BR8L 1SE2A 1Y1VB 3KVFB 2K28A 1XJVA 4DHZB 2Q8RE 4KY6A 4DV3L 2ENBA 1UAPA 3L54A 1A2UA 2OQ0A 2L0TA 1X32A 5C44G 3U4VA 2NS5A 2RPQA 1AH9A 4A3MG 2KCNA 3Q8BA 2O6VD 1ENFA 2WP8J 1H9MA 3A54A 3VYUA 3Q8CA 1FD7D 4MEMA 1SMYD 2E75C 3Q24A 2MP2B 1G2TA 1VQ5A 1XX8A 1XLOA 1VJKA 3PHXB 4GDKA 4CKCA 4CDEC 2B63H 4DK1A 2ZM6L 2DYOA 4EZLA 3OLMD 3A8KE 1V5TA 2FCNA 2PJHA 4GN4B 4CJ1B 3RULA 4IUQA 1OEYA 2Y5PA 3WAOA 3WOEA 2H89B 4TSSA 2KANA 2B8FA 4WWNA 4C4VA 2K5QA 4A93H 3ULPA 3VUWA 4LJZC 1PH2A 2L00B 3C1EA 2HDLA 4PZ7A 4RGOS 3VR9B 4WURA 5DCNA 1WMHB 1XNRL 2JY6A 3V05A 2RQXA 4KMUC 1NTGA 1CK1A 4RCNA 2NPTA 5IN7A 2JYEA 2ZTEA 4KIKA 3B1LX 4W9KA 1Q8KA 4IPHA 4OZCA 3I4NG 1H9KA 2WDRB 2PW7A 4OWWB 2REXA 3W9CB 1NE3A 2XRQD 1T0QC 5G3LD 2KLCA 4UHVA 4JLCA 3UDIA 4B3RL 3AE9B 3U2SC 2IY5B 1EIHA 4P74A 3TCAA 3VTUA 3A7AB 4AQYL 3GTKH 5I6YA 2RCFA 4B3MQ 3I57A 3PT2B 1J19A 3NY5A 3JAMi 3UQAA 1DXMA 1WJNA 2E76C 3H6MA 2NBUA 2LY7A 3L7ZC 4HMIA 3GV3A 1QVGA 2RDBC 3HRDD 5EDSA 2DZIA 1LV9A 4NJ6A 1C4QA 3AEVA 4JI5Q 1IBLQ 1XTCD 2JK8A 2F0FA 1TS3A 2JJQA 1OXUA 2TSSA 1N32Q 3HG9A 4P1BC 2CVRA 2RDGA 1TS2A 1IBXA 1UELA 2JWZA 3NTIA 4EKUA 1JJCB 3J81c 1P3QU 1JMLA 1HFNA 1F2RC 4XWWA 1KRHA 2F0JA 1SNMA 3M4PA 4KJNA 1RTNA 4KSLC 3C46A 1YHBA 3RZOB 1I4HA 1XMOQ 5DPSA 4BY7H 1QWYA 2FCSA 1II3A 3V6EB 4EQPA 4GSWA 2HIVA 3ZDMC 4Q5VA 3J7A5 1VQ8A 1HUMA 3MTNB 2WXFA 4KY7A 4A55A 2NVUI 4LFAQ 2JA7G 2LJ5A 2R92G 3PUZA 5IYCH 1MG4A 2F0PA 4MH8A 5FR6A 5FO7B 1WVLA 4XWTA 1FNVA 1KNEA 2MQJA 4B9KA 2NVXH 2G9DA 2IHEA 1EFID 1C7YA 1HZ9A 1WR1A 1EY5A 3NBIA 4JCVE 3Q22A 1QT9A 2K25A 1GB1A 4LNKA 2A5UA 3PREA 3DUZA 4PZ6A 1PHJA 4XGAB 2F03A 3A55A 3GE3C 3W1SA 1FIQA 3UDGA 4CYEA 3EUB2 2G9HD 4P72A 4HKZE 2E5LQ 1YQ3B 3OJ3A 1ZXIA 1NR4A 4LF8Q 1P0RA 3QR8A 5CGKA 2MJ3A 1JE4A 1BKBA 2I46A 1BT0A 2F0DA 2A8VA 2EY1A 1Q82C 4MHEA 4JE3B 3KUPA 1DGJA 4ANXA 2NTSA 1U0LA 3U52E 3ZTDA 1QILA 4X64L 3Q14C 4MACA 5E4WC 2ZCCA 1YNNC 1BOSA 1EY0A 1KQSA 5C5MA 3M7NA 4K7WA 4HJGE 4E71A 2RHQB 5IA7A 2WXMA 4RM9A 1GVPA 1N5XA 1CI3M 4X57B 2IPKD 2N9PC 2WXPA 3A8IE 3WANA 1PGAA 4A3IB 1J5EQ 3GTPH 3Q6SA 5ELNA 3P4QB 3SVMA 2F0QA 1UUPA 4IOCA 2GBMA 3P20A 2BQQA 1W6JA 3I7FA 2AX5A 5FJ8G 1PZID 2Z6BA 5C4HA 2JA6G 4ZHOA 4NMZA 1J7CA 1NENB 4DR6Q 4A3GB 2B2VC 1S5CD 2AWNA 5EGTA 1PFDA 4MM3B 5E6OA 2F0UA 2F4VL 4FADA 3CMEA 1AZPA 2INPE 1LTLA 2E8GA 2OT2A 5M5XB 3PRZA 4K7SA 1SFOB 3UI2A 3AE7B 1DOYA 4HSVA 1RCVD 3L16A 1JC7A 4S0RA 1ENAA 4AYBB 4CDDC 5CV8A 4X62L 4BBSB 1TYGB 4JBKA 3PZ7A 4MGIE 1C9FA 3J81j 4GKJQ 4RAUC 5FLMH 2JRHA 4P16A 1KLUD 2AL6A 2NN6I 4CKEA 1CKMA 4DV6Q 2R2QA 4KX6B 3RD4A 5JEAG 1NBFC 4WIPA 2JN4A 4OHJA 1I3QH 1CSQA 1L1OC 2XRSD 5F2DA 1WZ0A 3ETRA 2AUKA 2INCC 2HD3A 2K01A 1PYWD 3TIXA 1WY8A 1SAPA 2M2LA 4LF9Q 2F3IA 4LF4L 3VQIA 2ZW0A 2FCMA 2N9LA 1A70A 2MBBB 1EU3A 2LJIA 3AE6B 3DLLA 3HVZA 2KHJA 1MHWC 2LMCA 2WFWA 4B0EA 1E10A 4BXXH 2KCCA 1M1KC 4V190 2K33A 1ICWA 3NRZA 4GNXB 3NBHA 2KC2A 3JC66 5EKKA 4JI6Q 3GZNI 5E7NA 3JAME 1Y1WB 3QWZB 2IO3B 3UINB 1D6EC 3S2DB 3FRPB 1R4QB 1ACCA 1VZ6A 4L5RC 2R7ZB 2N9EB 3AE4B 3CCEA 1TKYA 3V62A 5C5LA 4GOPA 1CMXB 4J15A 4B0MA 2KMCA 1SNPA 1B3QA 2UUCQ 3AE8B 3A74A 4DR2L 4A3BB 4YTMB 2J4XA 1VQCA 3O13A 2C35B 1KABA 3KUZA 3PHWB 3GD7A 1W3SA 4HIMA 4YY3Q 1L4DB 2C9OA 3ERSX 2IY0B 2PEAA 3PGZA 3GE8C 4GLAC 1DM0B 2Y0SG 3AE1B 3R7RA 2F4IA 3T16A 4C2MH 1ESFA 1F2MA 2Q8IB 2KDBA 2KOXA 3CWIA 5ELBA 1GC7A 2K75A 5IWAL 2BH2A 2WACA 1A62A 4E6IA 1ZUD2 3SR6A 2GI9A 3I63C 4U673 4OVZA 5D7GA 3HOXH 4W9DA 1WJ4A 4L5QA 2OWOA 5J3BA 2LHDA 3SGIA 1WTVA 2PZWA 2B3AA 4LW1A 3K7AH 3IAYA 4KN7C 4BY1G 4K14A 2PIAA 3L0WB 1S5ED 1A0IA 3OMGA 2MP2A 3DHHC 1V1PB 4K7UA 2PMZB 4EQNA 1OGWA 3KWVA 5J2RA 3CMAA 2IL8A 2NBWB 1H8CA 4A3OA 4A3CH 3RNAC 2LSSA 1V86A 4JI4L 1E8WA 2KNBA 3X0WA 1VF5C 4IW0A 2A5HA 1QNUA 3LJ3A 1RAXA 2KWVB 4L6TB 1X3QA 1WRIA 5TR5A 2JA5G 5E6JA 1VQEA 2RGFA 2EXZA 1WMHA 2VB3X 1GUGA 3TP5A 1YJJA 2HD5B 4JWSC 3A9KA 3QJZA 4JI2L 1V2YA 4IWPA 5D94A 5CV7A 4PMCA 2IGDA 1I6HB 3RCZA 2MUYA 2OTJA 1K28A 1JRPA 3X3MA 3RLNA 2K1FA 3CCUA 4YHHL 1G6JA 4C3IG 2UWQA 3HOVH 2LGDA 3Q3FA 4PYUA 2YTXA 1VCBA 4YSXB 4QJFA 4ZK9B 4GN3B 1Y8RC 4C3HH 1Y1VG 5LMNQ 4GLXA 4USAA 1QUQB 1FR3A 4URKA 1MVKA 5JJZA 1JQ4A 3Q3OC 3SR1A 5IYDH 1MHXA 3BINA 1YNND 3P4RB 4DK6C 2Z8LA 2M8SA 2O6VA 2J42A 1UWMA 3PSEB 4ANWA 2L76A 1K9MC 3T3NA 2Z9HA 2BWFA 3E0JA 3SDZA 3FKIH 4K5WA 4ICVA 2IJ0A 2MPMA 4H0LC 2B2WA 2X69A 1UGJA 2K14A 1RFAA 3HOWH 1WXQA 4W9GA 2MBQA 4BOSC 2EJMA 4R4QA 2CU1A 1V1QA 2Z4IA 3O65B 3APFA 2V1YA 4EFOA 5DPWA 1VQKA 4FDBA 4DV4L 3U7DA 5IP9G 3DOWA 2UXBQ 2RSNA 1R4MI 4MELA 5G2NA 1KRSA 2KEDA 5I2YA 1AE3A 1BUIC 2GBKA 2HJ1A 2L9HA 1B3AA 3BZCA 4QB4A 3P4PB 2JPHA 1CHPD 1PLFA 1EIGA 4A3KB 1HTLD 2I1KA 4NXNQ 1YOVB 3J7AF 3TEWA 1F52A 2OEOA 1VQLA 4DQOC 3S14B 3NENA 1K73C 3DHIC 3LX0A 4HEDA 3F2DA 1SIFA 1T0SC 2VRRB 1C76A 4G7ZC 4N8X1 4P73A 4EGVA 3ALBA 1VZ7A 1BR9A 2GLSA 3S2HH 4QUCA 1EYCA 4MT5A 4O42A 3RNFC 1EIFA 3VXWA 3U4ZA 2B2YC 5HGQA 3T1HL 2BGFA 3FILA 2L5TA 1C9OA 2G45B 1NNXA 3W1BA 1TS5A 1NYQA 2BOSA 2B29A 3R2TA 1XT9B 3M7GA 4GLSC 2WDTB 3ML9A 2NB0A 4DWFA 2WAQB 2K5NA 4IDIA 5C3XA 5M5WB 4WWPA 1EQTA 1WE6A 1OXVA 1VQNA 3TSSA 3CXCA 3HM3A 4A3FH 2I5MX 2EPBA 1UZXB 5GXGB 5LMUQ 4C56C 4A3JH 3GTMB 4A3LG 4FJYA 4FJVB 4IUTA 3RD2A 5KYLA 4OVVA 4HJ8A 2FINB 3IL8A 1MG8A 1N62A 5CV4A 5M3MH 4JPBW 2Q5WD 3AH7A 1CHQD 3K7UC 2MNAA 3BU2A 1YJNA 1Y56A 5H92C 3HKZE 4RGTA 2WXKA 1LTTD 3KUCB 1YIJA 3CC4A 1TWHH 4KHPQ 3J9CA 2UXDL 4DR7L 1O78A 4GDKB 3NEMA 1YQBA 2YVCA 3AMZA 3P42A 4L5TA 4MM3A 1LT6D 2KN5A 3IFTA 1LO5D 1U4AA 2G1EA 3RZDH 2C7NB 3TL5A 4RFBA 1HTPA 4A3EB 1N5WA 1NEKB 1QNKA 4K8IA 2R7FA 2UU9Q 1I4QA 3I55A 4W9CA 4C4VB 5AZFA 3H9DA 3ZKJC 2PNHA 5JEAJ 4K0KL 2QCZA 3JW0X 2W82A 1YNJC 5K36G 4GN1A 2KFKB 3OAWA 3NUHB 1XYIA 4ODGA 3GTLB 1P16A 5CV5A 5E6NA 3N9YC 4OXPA 2PW9A 2MW5A 1B70B 5AUKA 3SK4A 1XCTL 1FM0D 3VDZA 4BBRH 1CUKA 3PV0A 2RBMA 3J7YW 3CC7A 3D6CA 1IBKL 4DR3Q 1ILPA 3CF6E 1K52A 2QW7A 1ASZA 3J81i 1PH7A 2CW0C 5C4XB 3GTQB 1GUSA 2ZT9C 3CQZH 4B3SQ 3PS6A 2V1CC 2PO4A 1RLFA 4WWMA 2ON8A 1T0YA 4J6HA 4XQJA 3D4RA 5C2TB 1VQPA 4A3IG 2QJLA 1HZBA 1TKWB 4LJOB 4DV7L 2R93B 4CQNA 1XO3A 1E7VA 1EOTA 4GNXA 2DNFA 1GO3E 4DR5L 1PH5A 3K5MA 1AWDA 1STHA 5C23A 3STBC 4TQ1A 3CRLC 4A3GG 2V0GA 4NXML 2HQEA 3CC2A 4R3DA 1PDXA 3ZLZA 4RMFA 1Z7TA 4F1SA 2D3GA 2E74C 2UUAQ 4OEMB 1FXIA 1CA5A 2KDEB 3AE5B 3R2IA 1SJHD 4AP4C 1HA6A 2K8HA 1TGZB 4C7YA 1RWSA 4YCVA 1SGHA 2RHSB 4AYBG 3DBHB 2WU2B 3JSVB 2VL6A 2AWTA 2HQLA 2H1EA 1X3FA 1C48A 2K52A 2ATWA 1WTOA 1C1YB 1T0RC 1A3UA 4NP5A 1X1MA 4DV5L 1Q10A 4KZCA 3TUOA 1OQRA 2MBOA 3CSTA 2V4DA 5IP4D 4G0NB 4EZKA 4M02A 1J8IA 1HQMC 3AULA 2XTIA 2N7JA 4DDID 4DAMA 1G91A 1SN8A 2N55A 4OIKA 1PH3A 3V3XA 3M62B 1ZOYB 1L2FA 2FJ2A 3RI7C 1WD0A 4HDOA 2I2YA 2PQAB 5IIFA 4ZOHC 1N33Q 4QQBX 2MHVA 5A2QE 4ITKA 2EY5A 1C77A 3B0AA 4RHSA 5JAVA 1E8XA 1V1PA 2F0WA 5L95C 2VH2A 2KMMA 3BZKA 3S1MH 5M3FH 5JHAA 4ZHPA 4NNJB 3E56A 1WI0A 3G6JB 1V1OA 3NTHA 1X54A 2WXRA 2JX5A 3QHTA 4F8MA 3I3TB 2AKWB 3TP6A 4OO1H 2Z4HA 3J80E 3K5OA 1XEEA 1HNWQ 2N1WA 3TEZA 1NYRA 4IJHA 3HEJA 2KDIA 2NVYH 1LTID 1JWSD 5KGUA 3FMCA 1WXVA 3I4LA 2K8CA 1KIXA 2BS3B 1LTRD 2CQAA 5EPJA 2R7ZG 3I4MB 3PUXA 1HZ6A 2VS1A 1EIYB 2JXXA 1TIID 2VZKD 1EF5A 4RF1A 1U4RA 3AXCA 4ZUIA 3WAPA 1SXTA 4A3BG 1PTOC 2PPBC 4BY7B 2IBIB 2SNMA 1XNQL 4RHRA 2RPVA 3IKJA 4IO9A 1QKZA 5CTRC 2NBFA 4AJWA 3EN2A 1NCVA 4LFCL 5ELCA 5LXIB 2XVSA 3L3OC 5C4ZA 3QCAA 4HSPA 3L08A 3NVWA 1ET6A 3U50C 5CBAE 3N32A 2BYTA 2YEPB 4A3MH 3TEHB 2EMSA 3QA8A 4K5XA 2NR2A 1ZPSA 3D3RA 1STEA 4G57A 1TKGA 3RR5A 1WWTA 3BYYB 3NVZA 3OTOL 4EQ5A 2Z0DB 1UBIA 3K57A 2KDFB 1YQ4B 2VQEQ 4K1RB 1EUVB 2GVBA 1P8LA 2L55A 4XDXA 4HCPB 2JUOA 4XYQA 3AE2B 4F87A 1DGSA 4HJAA 1QG7A 1KC8C 2EIFA 3H0GH 3S1RB 2L3ZA 3DHGC 2JA8B 5IGDA 1E2VA 3EECA 1NMFA 1QOBA 4L63B 1KD1C 2MBHA 2SDFA 4NQKE 1FO4A 2EYFA 2JT4B 5BR8Q 2J7QB 2HIXA 3ECIA 3HOYG 5KIXA 2Z0EB 3I4NH 3D32A 2D5GA 5KHOA 2C5CA 3WOFA 4DV3Q 3OW7A 3U9OA 1ISNA 3N1XC 1CT1D 5G5HA 2BB6A 1JB3A 3JYUA 1GOZA 2L1AA 2VZKB 4IUNA 1JCKB 4MH0E 3ONAB 1EZ8A 2HUGA 2FCQA 1EY6A 2B76B 2LMCB 2OOBB 4GOCA 3FEWX 2AWOA 3ZXRA 2ZM6Q 1YJ1A 1IBMQ 2IX0A 3LXFA 2M4NA 4RG1A 4KKUA 1KFYB 1BCPF 4K2KA 4DV2L 2PI2A 3NBHB 4DXGA 2KA7A 2FUG1 4NKLA 2FMCA 2L05A 4KGRA 4II3B 5CHWA 3J81E 2RMMA 1HQRD 5DM63 1JW9D 4E3CA 1Z47A 2QDBA 1J6QA 1WM3A 4DAVA 2LUMA 2HDMA 1XNRQ 4A90A 1J8CA 1EQVA 1D5XC 4X3SA 3I4OA 4BKGA 4ZRKA 1FFUA 2QCPX 3IG3A 2N7DA 4OW0A 1PFSA 1F2ZA 4YWMA 2G4DB 2WYQA 3S24A 5IYBG 4Y7NH 3M63B 3G4SA 5L37A 3U4EG 2CW0D 4FVMA 2A69D 4ZCKA 2JYOA 2JQOA 4WWOA 4DUYL 4B3RQ 1V9JA 2J7ZA 2NTTA 4ZQ3A 4IUPA 4AQYQ 3RNCC 3UI3A 2GB1A 5FLXL 2JA7H 4X66L 2R92H 5AEKB 3S16H 3MC8A 1SYEA 1I3QB 3ZXVA 3NP8A 2ZW1A 3S1NB 3AU5A 3APCA 1OFFA 3STBD 2E2HH 3ERQA 2UXCL 1KAWA 4POGA 1I7HA 3V96A 3ZJYC 1HNXL 2B2VA 1ROEA 3MXGA 1IUEA 1N36L 2L8JA 4KJOA 2MEKA 1FMAD 2B2TA 3KYHC 4LNNA 3R8BA 4MDKE 3VTWA 2H4OA 5JZEB 1N34L 5JJIA 2BB5A 2WWZA 2L12A 4HTHA 3KBGA 5IT9L 1KAAA 2KX3A 4DPGA 1Q1EA 1JJGA 3P75A 1SB3C 1SIJA 4MSMB 1YVCA 2IO1B 5ELEA 4A3KG 3ZJTA 2WGSA 3K9PB 3CPWA 1Y8NB 2A6ED 2HCIA 2XBBC 1FGUA 4F8CB 2F0TA 2NVQH 3Q8FA 4FULA 2O4XA 1N9WA 1PH9A 2LVOA 4H44C 1MBYA 4K81A 5CV6A 2KHSA 2KFKA 1VQJA 1C8CA 3NSWA 2CJNA 3A9KB 5C4JH 1UE5A 2LKVA 3M4OB 2ZNVB 3NVYA 2KT7A 2F0NA 1VLBA 4PS7A 4N58A 2ASBA 2WHIA 1HNZL 4IG7B 1BO0A 3I56A 2AYOB 2DY8A 1KL9A 5LL6S 3RNBC 4KDIC 3G71A 2N4FA 1IGCA 3OG5A 3ZYYX 3BS1A 3RN5A 1I35A 2ES2A 2WAQG 4GKKL 2INNE 1D1KA 5ELFA 2QF7A 3ULLA 4YWKA 2N9KA 1VDVA 2EKIA 4FHJA 3KBXA 1PRTD 4DAPA 2O2VB 5FJ8H 4TV3A 3GP7A 2JA6H 4L1BA 1MIUA 3UGBB 2OF1A 3Q2AC 1WRDB 1SROA 3DM3A 1STGA 1ZDVA 3DVGX 3KQ4A 4JX1C 1UNSA 1YEZA 2WKCA 4IKGA 1LXDA 5G55A 2O6VB 4B3TQ 2DUDA 3VUXA 2B2UC 4NW2A 2ZJDA 4QUFA 2AQ3B 1YHQA 5AUIA 4LDTD 1FNWA 1PTOD 1JWAD 2AEHA 4REZA 3HHMA 1KTKA 2VB2X 4NPSA 4X64Q 3VVWB 2DN8A 3ML8A 1K0RA 3F1ZA 3T1YL 4GIVA 4HROA 1QOGA 3A56A 4A3EG 4HDQA 4BFRA 5JEAH 1A3VA 2EY2A 2PE9A 1PH1A 1WTRA 2V3PA 3EA6A 4IUMB 4M0WB 3MFYA 3JSVA 2M1MA 4BWGB 4FJZA 2RDHA 3FPUB 1BBXC 1VDZA 1Z5SB 3QIJA 1YITA 3WWVA 1XF5L 3DBLI 4N9F4 3FP9A 1FXAA 4ZDVA 1N6ZA 1K8RB 4DU9A 2RDFA 3BVGA 3SU8X 1GPXA 2N3SA 4I7ZC 3Q6BA 2F4VQ 1TWAB 3EGRA 2PQAA 5IP7G 4FXGC 4HK2A 1VMPA 1WD1A 1H9RA 4JI3L 1HE8A 4YXDB 1AW7A 4LF5L 5C4XG 4X62Q 1F2LA 4HAEA 3Q0AA 5IO9A 4L8JA 4J6IA 1KDBA 1PRTB 3L4PA 2LVQA 1S5BD 4EUTA 3BK1A 1YJWA 4MTNA 1LABA 2LGYA 2R93G 4NJ7A 1V43A 5JOBA 1IGDA 3FILB 1RKNA 2DWQA 4JPSA 3ZNHB 3RMHA 1RRBA 4YT0B 1EU4A 5T1IA 2PYKA 2CFMA 2X6GA 3APDA 2F0HA 3N30A 4RNAA 1F1HA 3NHHA 2CS4A 4LF4Q 4LDTB 1PTOB 1TT5B 4JGHB 5T8IA 1HFGA 1I50B 3AM9A 4UP9A 1OQYA 2M00A 2J53A 4FN2A 4P1CC 4CDFC 2NVTH 1GAQB 4C00A 1TIFA 3EVQA 3AFPA 1NI3A 3M4QA 3S15B 3CIRB 1YHAA 1FNUA 4IUUA 3KK7A 4OONA 4ZKCB 1ZW7A 3M3YB 1EWYC 2ZJRA 2KTFA 4IJLA 1XCQL 1VZ8A 1KOTA 5FK9C 3GTGB 4IFDG 1C79A 1UH6A 2NCNA 4BY1H 1D4BA 1PFNA 3E3XA 4A75A 4LF7L 3PPAA 3E9HA 4LTUA 5L83A 3HUIA 4N9PA 1CZPA 2ZVOA 3MHSD 1TWFH 2K8BA 2RF4A 1XMOL 3VR3A 1K0SA 1WYDA 3NE5B 1LGRA 1VQBA 4IOAA 1JWUD 1H4RA 1T3QA 3H7SA 4RF0A 1IKLA 2F52A 5EE3A 1LYLA 3F8TA 3LDZE 4YWLA 2D11A 3HVDA 3PUWA 4DR2Q 1L6UA 4H02A 4HEA1 4KV2A 4LUVA 1PYSB 3PSIA 1S3OA 1U4PA 4CJ2C 3GZNB 2JA5H 4CHKA 2XGTA 3EROA 3S1QB 1Q5WB 2JP1A 3EFUA 2OEDA 3VHTC 3V6CB 1DYQA 3S2HB 1FEHA 3UIOB 5KNDA 4GZYC 2W54A 5IWAQ 1ZXTA 2B39A 2PW5A 2CKZB 2R6GA 2PNRC 3E9IA 5AJ3L 3HOUB 3HOZB 1BMLC 3P63A 1KLVA 2MRPA 1YI2A 4TQUS 2HHHL 1WJUA 1IW7C 1IL8A 2IWHA 1BVSA 3PO2B 1MFWA 2LXCA 1VQMA 2E3TA 2CWPA 5JPMC 1QZEA 3SK6A 3A9JB 1HRJA 3J7ZC 3I4MG 3T56B 3OWEB 5EBDA 3HKZB 4C3IH 4IC7B 4NAWB 2F0LA 2I5HA 5LXHA 1GHJA 3KF6B 2ZEQA 4A20A 3D4WA 1WX7A 4BY7G 3VRBB 3ZO5B 4RGMA 1U5KA 3H7PA 4S17A 4KKTA 4AWJA 5J17A 1Y1VH 3CMMB 4XTCS 4HJ7A 2H88B 3DVNU 1RDPD 4W9EA 1O7IA 2F0MA 2TMPA 4O1NA 2KQ7A 1HTOA 4JI4Q 3FDTA 2ZJPA 1ZKHA 1W2BA 3IT4B 4L2YA 2M0XA 1J7AA 1DD2A 4MGYE 1E0BA 1RD9D 4W9JA 1MJEA 2KWDA 2MJDA 2B2YA 5AZHA 3TZDA 5CYUA 1WM2A 2WIIB 4DHZE 1C4PA 4HPMB 1YIWA 4XXEA 2HJ8A 4XC2A 4JI2Q 3RZFA 1FCLA 2BWES 2UYZB 4J3OD 3C3LA 1AEXA 1I4PA 3K80C 1GHKA 3AECB 4JL9A 2XWBB 1WF9A 4DF7A 3AFQA 4XQNA 3SD5A 3I2ZA 4Q2JA 4YHHQ 5EAYA 1AE2A 5IP9H 1F9SA 3H3VH 1YD8U 2JA8G 2CR5A 2CKHB 2VUMB 1I5FA 4V0BA 1NDDA 3B9JA 3QB3A 3Q3MC 4XZ4A 5JPNC 1TS4A 4D2KA 4FA6A 4KGSA 1G6ZA 1SE8A 1UEAB 2FXQA 2KD0A 4ICUA 4KLKA 3V60A 1GD7A 1WGKA 5M5YB 3NOBA 2H5XA 1E3PA 3NQTA 4IALA 4DNRB 3IFWB 4L5SA 1WCMB 3TP8A 3CRKC 4QIWE 4XDDA 2MSED 2A1AA 2YV5A 4A3PA
chains in the Genus database with same CATH topology
1L5PA 3QWNA 1R9TB 1YJIA 5A35A 3OWFA 4WFN3 5C3EB 3SFEB 1L0YB 3HOYB 1V8CA 2KDMA 1U9RA 2KJXA 1Y69U 3A7LA 3H91A 4CHTB 1JWBD 3MVVA 1BCPC 1I4RA 3AEDB 1CQVA 1NR2A 5CC4A 1F9RA 2LEKA 2AQ2B 1G2SA 1GB4A 1SSNA 1FFVA 3MJ5A 5BMHA 5M9OA 1LT5D 4XDCA 4WRDA 2YYZA 1TWGB 4UAIA 1S5FD 2K5WA 2J52A 2WXLA 2KN4A 1OXXK 1SYDA 1HUNA 2Y5CA 5K5PA 3GS2A 1JALA 3GTJB 1EZ6A 2E6XA 3IXSA 3VYRA 5K36H 4F88A 3I70A 3K5NA 1AYFA 2O2LD 5LNK1 3Q8AA 2K1BA 4KN4C 4LLGM 4M0WA 3NUCA 1QLBB 5KYIA 4ZRQA 4EE2A 4M1UB 1STBA 2M56B 3DWMA 1LT4D 5E1FA 4JBWA 2E2JB 1RJTA 2EYHA 2FMMA 2QMTA 2F0OA 1CTMA 1K51A 2IX3A 1H9SB 3FPPA 2QEJC 3TZUA 4N9TA 3I73A 1Q8IA 2D62A 1KLGD 5J39A 1RODA 5C3WA 4A3DB 2F0KA 4HKQA 3V2TA 4TMAB 2PCFB 3R93A 1SNDA 4OO1I 1GJXA 3N52A 4R8IA 3OHXC 1K83B 4A6QA 1F2YA 2K22A 1A6XA 3MC0B 1SE4A 2WXQA 1MI0A 3T51B 4KTAA 4XQQA 2WLBA 1GXDC 3T3OA 4C3JB 1ZYRC 1SNCA 3JAML 3MAQA 2YU9B 3H09A 4KKSA 1STAA 2FFKB 4DK0A 1QOAA 4KHVA 3RFZB 1SF0A 2SNSA 1QOHA 4M8AA 4PT5A 4ARCA 1TT2A 2JYTA 5BN5A 4P6VF 4ARIA 1AFPA 1S4ZA 3NXWA 4ABNA 1GUTA 4XT1B 5CMDA 2L0CA 4C1NI 4QMGA 2JEBI 5IODA 1EY4A 3S17B 1QJOA 2J0TD 1SDFA 3BDLA 2BE5C 3BDOA 2M0AA 2EYMA 5D3IB 3PO3B 1S5DD 1TWCB 5IOCA 5DM73 1O7LA 4B08A 4ZRZA 2NN6G 2F0IA 1EL0A 1SE3A 1C78A 2IGHA 1MSGA 4QF4A 3BZDB 3LWUA 3BDCA 2B63B 1M4VA 2V4IB 1LT3D 4X3UA 2AUJD 1M8AA 3CKIB 3C1FA 3TMEA 1D2BA 2K6AA 3X3NA 4IURA 1QE6A 4A93B 3NTKA 4FF2A 5FLXE 3I9V1 2WQYB 3QJYA 2XNAC 3ABVB 3RPFC 4I65A 3KWLA 1VCIA 2MGSA 1WTXA 2R61A 1PGBA 4S3SA 3IAS1 1SMYC 3HGBA 2XIWA 3T53B 2F0VA 2BS2B 5IT9E 2XSCA 1F9PA 3GTKB 3PUYA 2BT6A 2HTME 1XXGA 5BMGA 1ENCA 2QILA 4G4KA 2EJGC 5CV9A 4AQ7A 3K6OA 1SNQA 3AU7A 2KVMA 1DONA 1GUNA 4KK7A 4LMQD 3K59A 2BW2A 2X38A 1BDOA 4HMJA 1ZEQX 1QOFA 2LFNA 4N59A 1T5XD 1E0ZA 3I3CA 3HS0C 5HG2A 2NZ1D 1XLQA 5DEHA 2N88A 4R9WA 5CBEE 5JVG3 4AS1A 1V8QA 3BK2A 4OZAA 4OGQC 4CBVA 2EY6A 1XLNA 2NVXB 4R8NA 2EYOA 2JXTA 1CFMA 2B2UA 3GB1A 4ZLTF 1DZ1A 4PQXA 1IYUA 5EBCA 4EQOA 3VR5A 3W5UB 4TRDA 1I6VC 3AN1A 1ZYRD 4ZKBB 1O7ZA 4YIJA 5NUCA 1B44D 1ZKOA 3VA7A 3QOJA 2LHEA 4IQZA 2K04A 2XN9C 4XT3B 3PO0A 1PZJD 2EYJA 2HDEA 3P7JA 1D5ZC 1IHZA 4TQ0A 4IN3A 3CHBD 4PV1C 3SE0A 5IGBA 2GRIA 3GTPB 1FD6A 1YNJD 3AV8A 4LK0M 3ITPA 1H9SA 4KI0A 4FXDA 3F2UA 4BA2I 1RF2D 4IZ8A 3Q23A 2BE5D 1RHPA 2PZTA 1XWEA 2JEAI 1UWXA 2ONQA 3SHLA 5MPOA 2DBYA 5KRUA 4NAMA 2K5PA 1NSNS 1B9MA 5COYA 2CJOA 1EY8A 2DNCA 2PMVA 5EPLA 1ZP0B 1E9MA 2IW3A 4C7ZA 3H8HA 1J7BA 4FYDA 3IFDA 5EQ0A 3E6ZX 4CKBA 1CA6A 3PZ8A 3MEHA 5I2XA 1LTGD 3TEYA 3ND8A 2YEPF 4ZUJA 5D7GA 3BVZA 3IT6B 3M85A 5D65A 5C0XG 1EY9A 5BYQA 4J1MA 3AEBB 5BYRA 1Q12A 2OXPA 1J9OA 1KF6B 2MJEA 2F3WA 1U4LA 5KNCA 1Q90A 5EKLA 2JZPA 4WORA 2WDQB 3GQBA 3AB5A 3MWYW 2K0PA 2SOBA 4G7HC 1MGSA 5A2QL 1NAPA 1NVID 4F7XA 2IGGA 3WDNA 5JXVA 4NDXA 4C2MB 4JK1C 1DOLA 3J80L 2B8GA 4C3JG 1JOKA 4IFDH 5IGFA 4QIWB 2JSOA 3HOXB 5EE1A 5BN3A 1F77A 1C4CA 3K7AB 2WU5B 2BDOA 5FOBB 3OPOA 3EFXD 1Q3LA 1DJRD 2FE8A 3J7AV 2JU6X 4FF4A 1Z6HA 1N63A 1PXUA 3AEAB 4HN7A 2WB1B 4YWGG 2K32A 2PTLA 5IGCA 3PIO3 2RA4A 3OOCA 1QQRA 1TJEA 3DWPA 5IGGA 1DOKA 1VRAB 4J8QA 1TQOA 1WTPA 3EJIA 5FKAC 1ZDXA 4GDLB 3HOVB 3GV6A 5I4DA 1Q1BA 3VA5A 2RKSA 3NQIA 4C3HB 3AE3B 1B9NA 2NYZD 1OO9B 4HR7B 1JWMD 1KDCA 3ZJVA 4XIGS 3DMUA 1D1IA 1BNZA 4DAYA 4DFAA 1N60A 3B2FA 2KQ4X 2ICEC 1ML0D 5J22A 1ESRA 3FKIB 1LTBD 5HGTA 3TDQA 1B53A 1YN3A 5EE9A 3HRZC 3HOWB 1IYVA 3S9WA 3J81L 3PMFA 1PMRA 2F0SA 2PZUA 1SYBA 2BBCA 3P1MA 4HCSA 3LNNA 5EPKA 3R3OA 5E3FA 3FC4A 4CJ0B 1QCBD 3RUZA 4US9A 4RGNA 5KEEA 4ZAIA 1CJEA 1CZWA 1P7EA 2W3SA 3DHQA 3K5LA 3L9AX 5HHDG 3I72A 1PFMA 1SBBB 4KKJA 1RTOA 1O80A 1TU2B 1Y8OB 4KY5A 4FXCA 4A9AA 3QG1A 3W3AA 5I9OA 2WP9B 2B2TC 2I07B 4X3TA 2BA1A 4B9WA 5HFYA 4DGZA 1DOXA 3MXNA 4RH6A 3VR4A 4BA1I 4OL7A 4A3FB 2EOTA 2PVGC 4WAFA 2L32A 4A3JB 3ZGZA 1CM9A 1SYGA 3HP3A 2WS3B 3MTSA 1JOQA 5M3MB 1D5MC 3P4SB 2IDYA 5G3LF 1OXSC 4ME5A 3MXPA 4RWSC 3TP7A 1AN8A 3AEGB 3MP9A 4RF1A 3SEBA 3VR2A 1F9QA 1TWHB 1STYA 2CU3A 1G8ZD 1C4AA 1HA5A 4US8A 3QOLA 1PRTF 3I91A 3LB8C 2W3RA 1B4OA 2KQ3A 3RZDB 1T6BX 1LTAD 3K58A 3VR8B 1FCCC 5EE0A 3D4DA 3I8ZA 2EYPA 2JQRB 2EJFC 1PFBA 3DWAA 4YSYB 1TZOA 2WXGA 1HPCA 1DOMA 1STNA 1PTOF 1K50A 2O5JC 5D14A 5BN4A 5HI1A 4BBRB 4FP5D 1FGBD 5C0XJ 2L4NA 4G7OC 1KDAA 1L4ZB 2WV6D 1BF4A 2V3NA 5DAUA 1V97A 2QIEB 3Q69A 4OZBA 1OQQA 4PMBA 1WTWA 4TKOB 3CQZB 1L0VB 2MH7A 3OMCA 2W55A 3HZXA 3EQLC 1AP0A 2IX1A 2M19A 1YN5A 1LACA 4MN3A 3NVVA 1EWHA 4FXKC 4RKBA 3OSOA 4K6LA 1ET9A 2L1BA 1SEBD 1JROA 4A8XC 4WJWA 2L11A 1IKMA 5D3DA 2HCCA 2K03A 5CORA 3DEOA 4ZRPA 4Q0FA 2WINB 1WTQA 1VR9A 3NZ3A 2BA0A 3BVMA 3T13A 1E7PB 2QKIC 4HRSA 3PIP3 2LS01 3SK5A 1E6EB 3FVQA 2NMQA 1EYDA 2Q8TA 1TR5A 1I4GA 3E5SA 1JQYD 1P7FA 3BIID 1A2TA 3S1MB 5M3FB 3LWEA 3AB9A 3QO2A 2KACA 4Z9CB 2WXOA 1CZGA 5JVH3 1FRDA 4KKIA 2NVYB 1EEID 2O5IC 1MI2A 3TEXA 3A8JE 4KV6A 2KUMA 4FO2A 1PTOH 1SYFA 3NWSA 3GTOB 2GA4B 1Y8PB 2BTEA 1A15A 2PKOA 3NWTA 2NN6H 5I6WA 2JWUA 1H9JA 2F1MA 4IOIE 5C44B 3KF8A 3C2PA 4RCOA 4A3MB 2DLBA 4YTNB 4ID6A 2D5DA 1ZXHA 2DYMA 1PGXA 2KOLA 3MHBA 1IW7D 1VF7A 2KECA 1RM6C 3NS1A 4H7BA 2AQ1B 2D2CC 5ELDA 1K8OA 2EELA 1X3PA 1F2RI 2Y3AA 5DNFA 4YSZB 1T5EA 5FO9B 1EEFD 2WNMA 3H0GB 3ZJUA 4X3KA 2VNUD 3D31A 2RSOA 2BDNA 5HURA 4KHZA 4IFDJ 2F0EA 1YNTE 4DA2A 1YN4A 5EKIA 3SK8A 3I4NB 1JOOA 2WXHA 3VYSA 1XLPA 2L52A 1ZE3D 2NUCA 2E2IB 2DNEA 4C1NK 1JORA 2WXIA 3U7ZA 4C80A 1GUOA 5C0XI 3DM1A 3P1HA 3IAM1 3D6WA 1A3TA 5BMIA 1AZQA 4DXFA 5H92C 5G5GA 1VMCA 1TVXA 4PMWA 2EZVA 1JR0D 1O7YA 5BYSA 1GUWA 4NJCA 2A68C 2A6HC 2XWJB 3RLFA 4C3HG 5LL6X 4N6EB 4K8JA 1DCZA 4IUVA 3B2GA 2ACZB 2RVLA 1WSPA 2PLPA 3NK9A 3I90A 1DOIA 1E2WA 4Y7NB 1MSHA 3M4YA 2KEEA 1MHHE 5EJWA 3MXUA 1PDQA 1QF6A 3URYA 3VRAB 3VYTA 2JA7B 4L23A 4K6DA 2R92B 3S16B 5I9PA 5C6AA 3AMUA 1I4XA 2E2DC 1SSOA 4EVOA 2E2HB 4JWUC 3H3VC 4NZLB 2BS4B 3BYTB 2F3VA 2QSDA 1B1ZA 1L0XB 1BCPD 1HXYD 3QIAA 2ZXOA 1ONLA 4K5VA 4FNFA 3G7LA 4KGTA 1SJED 4K2LA 2R3ZA 3ND9A 5FR3A 2A69C 4WQMA 2BCOA 2NVQB 4P2CB 3VR6A 4UDUC 2ID0A 3N6RA 4YTPB 2F0GA 4LK1C 3OIQA 4QCLA 1LLRD 4CGYB 5C4JB 1IBXB 1HCZA 3C8YA 3TBIB 1K53A 3H94A 1KH0A 4PNYA 5AFWA 3E9SA 1HZ5A 2N0SB 2B2WC 2FHTA 2K3UA 3PUVA 4H2AA 2A74C 5CR3A 5J1ZA 3LYYA 2A6EC 4WH4A 2ICIA 1BXTA 2JA6B 1K8MA 4FF3A 3U9SA 4LAAA 2WKDA 1NUCA 1BCPB 3K0YA 1QB5D 1EYAA 2JSVX 1TY2A 4U68A 1HHVA 1BQQT 5E4XA 2MJ8A 2WDVB 3SFDB 3TN2A 5FO8B 1PUTA 1BUVT 3W5VB 2A73B 2JE6I 4KD3A 2M9VA 2EE1A 2K5DA 1PRTC 4ILWA 2MP1A 3DXJC 1LTSD 2D9UA 2X6LA 3WCQA 1OXTA 4IFDI 4OIJA 2K05A 3Q8EA 2JXMB 2L83A 1B2TA 5T1GA 5C0XH 1EM7A 3DEPA 1FRRA 2LFIA 2WXNA 1JICA 1B50A 1EWCA 1SNOA 3DWQA 5TSSA 4FF1A 3DWGC 3T4AC 4B9XA 3KLSX 2SAKA 1F0ZA 1B9RA 4RA8A 1U4MA 2K7VA 5ISRA 4RKLA 5C3JB 2LGIA 1CQFA 1KNAA 2WXJA 1R7SA 2EDGA 4MIUA 3W2DA 2NWGA 1W6KA 1E2ZA 1R4PB 5KNBA 3BWUD 3D8GA 2EYLA 3OIPA 4ULLA 2PVOD 2Y0SB 4ZYSA 3KLSA 2ZXRA 3MA2B 2I38A 3AEEB 1PZKD 1RYJA 3AEFB 3KLRA 2NVTB 1FYCA 4XYOA 3CU7A 2A68D 2A6HD 1WYGA 1SYCA 1TY0A 2CHBD 3SXHA 2ZXPA 3MHZA 3ZQ4A 2FBWB 4BY1B 1EY7A 1MD2D 3MFGA 1RFKA 1TWFB 3MZ5A 1ILQA 1N61A 2Z1CA 5LHY1 1L6VA 4KD4A 4XE0A 2VXWA 3GO5A 4H13C 2IT1A 2JA5B 2SEBD 2KAJA 4BS9A 5IGEA 2EVBA 4OO1G 1YMHE 3BG3A 4DNTB 2DY7A 4HCEA 1HEZE 1G291 4C3IB 5H8YE 1MPEA 4DN4M 2K9XA 3NPPA 2PQEA 3FAHA 1TKEA 1SE2A 1Y1VB 2K28A 2Q8RE 4KY6A 2ENBA 1UAPA 1A2UA 1X32A 2KCNA 3Q8BA 1ENFA 2WP8J 1H9MA 3A54A 3VYUA 3Q8CA 1FD7D 1SMYD 2E75C 3Q24A 1G2TA 1XX8A 1XLOA 1VJKA 4CKCA 2DYOA 4DK1A 3A8KE 4CJ1B 4IUQA 2Y5PA 3WOEA 2H89B 4TSSA 2B8FA 2K5QA 4LJZC 3C1EA 2HDLA 4RGOS 3VR9B 4WURA 3V05A 2RQXA 4KMUC 4RCNA 1CK1A 2JYEA 4OZCA 1H9KA 2WDRB 2PW7A 3W9CB 2XRQD 5G3LD 3U2SC 3AE9B 1EIHA 3A7AB 5I6YA 3I57A 1DXMA 2E76C 3H6MA 2LY7A 3L7ZC 4HMIA 3GV3A 3HRDD 1LV9A 1C4QA 1XTCD 2F0FA 1TS3A 1OXUA 2TSSA 3HG9A 2CVRA 2RDGA 1TS2A 1IBXA 3NTIA 1JMLA 1HFNA 1F2RC 4XWWA 1KRHA 2F0JA 1SNMA 4KJNA 1RTNA 3C46A 3RZOB 1I4HA 1QWYA 1II3A 4EQPA 4Q5VA 1HUMA 2WXFA 4KY7A 4A55A 3PUZA 2F0PA 4MH8A 5FO7B 1WVLA 4XWTA 1FNVA 1KNEA 2G9DA 1EFID 1EY5A 3NBIA 3Q22A 1QT9A 1GB1A 3DUZA 2F03A 3A55A 3W1SA 1FIQA 3EUB2 2G9HD 4HKZE 1YQ3B 1ZXIA 1NR4A 5CGKA 2MJ3A 1JE4A 2I46A 2F0DA 2EY1A 4MHEA 4JE3B 3KUPA 1DGJA 2NTSA 3U52E 1QILA 4MACA 5E4WC 1YNNC 1BOSA 1EY0A 3M7NA 5C5MA 4HJGE 2WXMA 1N5XA 1CI3M 2IPKD 2WXPA 3A8IE 1PGAA 4A3IB 3P4QB 3Q6SA 3SVMA 2F0QA 1UUPA 3P20A 1W6JA 2AX5A 1PZID 5C4HA 4ZHOA 4NMZA 1J7CA 1NENB 4A3GB 2B2VC 1S5CD 2AWNA 5EGTA 1PFDA 4MM3B 2F0UA 1AZPA 2INPE 2OT2A 5M5XB 1SFOB 3UI2A 3AE7B 1DOYA 4HSVA 1RCVD 1JC7A 1ENAA 4AYBB 5CV8A 4BBSB 1TYGB 1C9FA 3PZ7A 4RAUC 4P16A 1KLUD 2NN6I 4CKEA 4KX6B 3RD4A 5JEAG 4WIPA 4OHJA 2XRSD 5F2DA 3ETRA 2AUKA 2K01A 1PYWD 1SAPA 2M2LA 3VQIA 2ZW0A 2N9LA 1A70A 1EU3A 2LJIA 3AE6B 3HVZA 2LMCA 4B0EA 1E10A 2KCCA 4V190 2K33A 1ICWA 3NRZA 3NBHA 5EKKA 3JAME 1Y1WB 1D6EC 3S2DB 3FRPB 1R4QB 1ACCA 1VZ6A 2R7ZB 3AE4B 1TKYA 5C5LA 4B0MA 1SNPA 3AE8B 4A3BB 4YTMB 2J4XA 3O13A 1KABA 3GD7A 1L4DB 2C9OA 1DM0B 3AE1B 2F4IA 3T16A 1ESFA 1F2MA 2Q8IB 3CWIA 5ELBA 2WACA 4E6IA 1ZUD2 3SR6A 2GI9A 4U673 4OVZA 2LHDA 1WTVA 2PZWA 3IAYA 4KN7C 2PIAA 4K14A 1S5ED 3OMGA 1V1PB 2PMZB 4EQNA 3KWVA 2IL8A 1VF5C 2A5HA 1QNUA 4L6TB 1X3QA 1WRIA 5E6JA 2EXZA 2VB3X 1GUGA 3TP5A 1YJJA 4JWSC 5CV7A 4PMCA 2IGDA 1I6HB 2MUYA 1JRPA 3X3MA 4C3IG 4YSXB 4ZK9B 4USAA 1FR3A 1MVKA 5JJZA 1JQ4A 3SR1A 1MHXA 1YNND 3P4RB 2Z8LA 2J42A 1UWMA 3T3NA 3E0JA 3SDZA 4K5WA 2IJ0A 2MPMA 4H0LC 2B2WA 2X69A 1UGJA 1WXQA 2EJMA 2Z4IA 2RSNA 2KEDA 5I2YA 1BUIC 2L9HA 1B3AA 3P4PB 4QB4A 1CHPD 1PLFA 1EIGA 4A3KB 1HTLD 3J7AF 3TEWA 2OEOA 4DQOC 3S14B 3LX0A 4HEDA 1C76A 4G7ZC 4EGVA 1VZ7A 1BR9A 4QUCA 1EYCA 4MT5A 4O42A 2B2YC 3FILA 2L5TA 1TS5A 1NYQA 2BOSA 3R2TA 4GLSC 3M7GA 2NB0A 2WAQB 4IDIA 5C3XA 5M5WB 1EQTA 1OXVA 3TSSA 2EPBA 5GXGB 4C56C 3GTMB 4IUTA 5KYLA 2FINB 3IL8A 1N62A 5CV4A 2Q5WD 3AH7A 1CHQD 1Y56A 4RGTA 2WXKA 1LTTD 3J9CA 4GDKB 1O78A 3AMZA 3P42A 1LT6D 3IFTA 1LO5D 2G1EA 4RFBA 1HTPA 4A3EB 1N5WA 1NEKB 1QNKA 4K8IA 1I4QA 5JEAJ 2W82A 1YNJC 5K36G 3NUHB 1XYIA 4ODGA 3GTLB 5CV5A 3N9YC 2PW9A 5AUKA 3SK4A 1XCTL 1FM0D 3PV0A 2RBMA 3J7YW 3D6CA 1ILPA 1K52A 2CW0C 5C4XB 3GTQB 1GUSA 2ZT9C 4WWMA 2PO4A 2ON8A 4J6HA 4XQJA 3D4RA 5C2TB 2QJLA 1TKWB 2R93B 4CQNA 1XO3A 1EOTA 3K5MA 1AWDA 1STHA 4TQ1A 3CRLC 2V0GA 2HQEA 4R3DA 1PDXA 1Z7TA 2E74C 1FXIA 1CA5A 3AE5B 3R2IA 1SJHD 1HA6A 4C7YA 1RWSA 2WU2B 2H1EA 1C48A 1WTOA 3TUOA 1A3UA 4NP5A 1Q10A 1OQRA 2V4DA 1J8IA 1HQMC 2N7JA 1G91A 2N55A 4OIKA 3V3XA 1ZOYB 2FJ2A 1WD0A 2I2YA 5IIFA 4ZOHC 2MHVA 5A2QE 4ITKA 2EY5A 1C77A 4RHSA 5JAVA 1V1PA 2F0WA 2KMMA 4ZHPA 3E56A 3G6JB 1V1OA 3NTHA 2WXRA 2JX5A 4F8MA 3TP6A 4OO1H 2Z4HA 3J80E 3K5OA 1XEEA 3TEZA 1NYRA 3HEJA 1JWSD 1LTID 5KGUA 3FMCA 3I4LA 2BS3B 1LTRD 2CQAA 5EPJA 3I4MB 3PUXA 1HZ6A 2VZKD 1TIID 1U4RA 4ZUIA 1SXTA 1PTOC 2PPBC 4BY7B 2SNMA 2RPVA 4RHRA 3IKJA 1QKZA 2NBFA 1NCVA 5ELCA 2XVSA 3L3OC 5C4ZA 4HSPA 3NVWA 1ET6A 5CBAE 2BYTA 2YEPB 4K5XA 1ZPSA 3D3RA 1STEA 4G57A 1TKGA 1WWTA 3BYYB 3NVZA 3K57A 1YQ4B 2L55A 4XDXA 4XYQA 3AE2B 4F87A 1QG7A 3S1RB 2JA8B 5IGDA 1E2VA 1QOBA 4L63B 2SDFA 1FO4A 2EYFA 5KIXA 2D5GA 2C5CA 3WOFA 3OW7A 3U9OA 1CT1D 5G5HA 2BB6A 1JB3A 1GOZA 2L1AA 2VZKB 4IUNA 1JCKB 3ONAB 1EZ8A 2HUGA 1EY6A 2B76B 2LMCB 3FEWX 2AWOA 2IX0A 3LXFA 4KKUA 1KFYB 1BCPF 4K2KA 4DXGA 2KA7A 2FUG1 4NKLA 2FMCA 4KGRA 3J81E 2RMMA 1HQRD 5DM63 1JW9D 1Z47A 2QDBA 4DAVA 2LUMA 2HDMA 4A90A 1EQVA 1D5XC 4X3SA 1FFUA 2QCPX 4OW0A 1F2ZA 3U4EG 2CW0D 4FVMA 2A69D 2JYOA 2J7ZA 2NTTA 4ZQ3A 4IUPA 3UI3A 2GB1A 5FLXL 1SYEA 1I3QB 3NP8A 2ZW1A 3S1NB 1OFFA 3ERQA 1I7HA 3V96A 2OHFA 2MEKA 2B2VA 1ROEA 3MXGA 1IUEA 4KJOA 1FMAD 2B2TA 3R8BA 2H4OA 2BB5A 2L12A 4HTHA 3KBGA 5IT9L 1KAAA 1Q1EA 3P75A 1SB3C 1SIJA 5ELEA 3ZJTA 1Y8NB 2A6ED 2HCIA 2F0TA 3Q8FA 2O4XA 4H44C 1MBYA 5CV6A 2KHSA 1C8CA 3NSWA 2CJNA 2LKVA 3M4OB 3NVYA 2F0NA 1VLBA 4N58A 1BO0A 2DY8A 5LL6S 1IGCA 3ZYYX 3BS1A 2INNE 1D1KA 5ELFA 2QF7A 2N9KA 1VDVA 2EKIA 3KBXA 4DAPA 1PRTD 3GP7A 4L1BA 2OF1A 3KQ4A 1STGA 1ZDVA 4JX1C 1UNSA 2WKCA 4IKGA 2B2UC 4NW2A 4QUFA 2AQ3B 5AUIA 1FNWA 1PTOD 1JWAD 4REZA 1KTKA 2VB2X 2DN8A 4HROA 1QOGA 3A56A 5JEAH 1A3VA 2EY2A 2V3PA 1WTRA 3EA6A 3MFYA 4BWGB 2RDHA 3FPUB 1BBXC 1VDZA 1XF5L 1FXAA 4DU9A 2RDFA 3BVGA 1GPXA 4I7ZC 1TWAB 3EGRA 4FXGC 1VMPA 1WD1A 1H9RA 4YXDB 1AW7A 3Q0AA 1F2LA 4HAEA 4L8JA 1KDBA 1PRTB 3L4PA 1S5BD 3BK1A 1LABA 1V43A 5JOBA 1IGDA 3FILB 1RKNA 2DWQA 4JPSA 3RMHA 4YT0B 1EU4A 5T1IA 2PYKA 2X6GA 2F0HA 4RNAA 3NHHA 1PTOB 5T8IA 1HFGA 1I50B 3AM9A 2M00A 2J53A 1GAQB 3EVQA 1NI3A 3S15B 3CIRB 1FNUA 4IUUA 3KK7A 4ZKCB 3M3YB 1EWYC 1XCQL 1VZ8A 5FK9C 3GTGB 4IFDG 1C79A 1D4BA 1PFNA 4LTUA 3HUIA 4N9PA 1CZPA 3VR3A 3NE5B 1T3QA 1JWUD 5EE3A 4RF0A 1IKLA 3HVDA 3PUWA 1L6UA 4HEA1 1U4PA 4CJ2C 3EROA 3S1QB 2JP1A 2OEDA 1DYQA 3S2HB 1FEHA 5KNDA 4GZYC 2W54A 1ZXTA 2B39A 2PW5A 2R6GA 3HOUB 2PNRC 3HOZB 1BMLC 3P63A 4TQUS 1IW7C 1IL8A 2IWHA