3R2TA

2.2 angstrom resolution crystal structure of superantigen-like protein from staphylococcus aureus subsp. aureus nctc 8325.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
195
structure length
195
Chain Sequence
NRLYDTNKLHQYYSGPSYELTNVSGQSQGYYDSNVLLFNQQNQKFQVFLLGKDENKYKEKTHGLDVFAVPELVDLDGRIFSVSGVTKKNVKSIFESLRTPNLLVKKIDDKDGFSIDEFFFIQKEEVSLKELDFKIRKLLIKKYKLYEGSADKGRIVINMKDENKYEIDLSDKLDFERMADVINSEQIKNIEVNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title 2.2 Angstrom Resolution Crystal Structure of Superantigen-like Protein from Staphylococcus aureus subsp. aureus NCTC 8325.
rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
total genus 56
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r2tA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3r2tA01
2RDHA 1CK1A 1YN3A 2TSSA 4RHSA 1TS3A 3DWAA 2CHBD 1EU3A 1I4RA 1GOZA 1LT4D 1PZJD 1D5XC 3R2IA 1KLUD 1SJED 1RD9D 5ELCA 1ET6A 1B1ZA 1JWMD 1V1PB 1EEID 4L63B 4RGOS 1PTOD 5ELFA 3MFGA 1HQRD 1I4QA 1S5DD 2AQ1B 1PTOH 1PTOB 4O1NA 2XRSD 4K6LA 3V05A 1L0XB 1L0YB 1EWCA 1YN4A 1STEA 3EFXD 4RGNA 1G8ZD 3DWPA 4Z9CB 1PTOC 5D3IB 1TY0A 1LO5D 1RF2D 3GP7A 1PRTF 1LTRD 1D5MC 1BCPF 2XRQD 5FK9C 4NZLB 1HXYD 1S5CD 1T5XD 1TY2A 1TS5A 1RDPD 1SE2A 1XXGA 1V1OA 3BYTB 1EEFD 2AQ2B 1MD2D 4RGTA 4RGMA 1CHQD 2Z8LA 1HA5A 1RCVD 5I4DA 1LTAD 5TSSA 2NTSA 1I4PA 3DWQA 1S5BD 2WV6D 3CHBD 5ELDA 3BZDB 1LTGD 1D6EC 3MC0B 4BWGB 1CT1D 1I4XA 3URYA 1DJRD 1AN8A 1SEBD 3BVMA 2SEBD 1SE4A 1TS2A 2NTTA 2QILA 1EU4A 1SBBB 3O13A 1CHPD 1PZID 1BCPC 4RCOA 1I4GA 1I4HA 1PYWD 4C56C 1PZKD 1DYQA 1SJHD 2RDGA 2R61A 3R8BA 3BVGA 1FNVA 4RFBA 5ELBA 1LT6D 1FD7D 1JQYD 1PTOF 4RHRA 1LTBD 1PRTD 3BYYB 4DXFA 1S5ED 1S5FD 1HTLD 2QEJC 2IJ0A 1BCPD 1F77A 1LT5D 2G9HD 1KLGD 1LTTD 1ESFA 1PRTB 1BXTA 1YN5A 1M4VA 4DXGA 1BCPB 1CQVA 1JR0D 1SE3A 1FNUA 3BVZA 2IPKD 1PRTC 5D3DA 3W2DA 1KTKA 2J4XA 1LTID 2ICIA 1JWSD 1JWUD 3OWEB 5FKAC 4UDUC 2XN9C 4OHJA 3SEBA 1SXTA 1JCKB 1XTCD 2XNAC 2AQ3B 3EA6A 1ET9A 3KLSX 1LT3D 4RH6A 3R2TA 1LTSD 5ELEA 1UNSA 4L6TB 1TS4A 1UUPA 1FNWA 4ZYSA 1QILA 3TSSA 2O2LD 1FGBD 1ENFA 4TSSA 1AW7A 1B44D 1V1PA 1EFID 1D5ZC 1LLRD
chains in the Genus database with same CATH superfamily
1K52A 1YQ3B 2TSSA 1Q81C 2R93G 1VQKA 2CHBD 1JWAD 1STGA 5JEAG 5C4XG 5J2RA 1TWFH 3HOUB 2ACZB 1E8ZA 2AUKA 2B2YC 1GO3E 3A7AB 3E9IA 5ELNA 3A55A 2WXFA 3AECB 5CV9A 4ME5A 1NDDA 4PZ8A 4B3SQ 2MW5A 4M02A 5LMNQ 1R4QB 3H0GH 3QWNA 1ZW7A 5C5MA 3DHGC 2ALYB 4DUZL 2PZWA 4JV5Q 1ZPSA 4DAMA 2M9VA 1ZKHA 4MGZE 3RI7C 1TWGH 1TWGB 1PTOC 2K33A 4OX9L 2MBHA 3M9BA 4W9GA 2KECA 5C4JH 3RUIB 2WKDA 4H2AA 1N9WA 3AEVA 2QKIC 4IFDG 2E2JH 1A15A 1HPCA 2WXRA 4NZLB 3HZXA 1FRDA 2KJXA 4GOPB 2MP2A 5M5YB 1MIUA 1XMOL 4LJOB 4LNKA 3SR1A 3A8JE 3CXCA 1E9MA 4YSZB 5IGEA 2G45B 2WU2B 1LFDA 2RF4A 2PW9A 2KQ7A 3TUOA 2L12A 2FINB 4JI8Q 1JQ4A 4O42A 1F2ZA 1BUVT 3N20C 2E74C 1Y8RC 1K9MC 2BH8A 3KF8B 3CCEA 4MSQB 4F1SA 3UDXA 1X3QA 3H3VC 2YU9H 2YU9B 1N62A 1JORA 1C1YB 2E6XA 1GB1A 1ASYA 2GVBA 2JU6X 5DPSA 3PV1A 2RPQA 2DN8A 5JJIA 3AB9A 1BOSA 2EKIA 2I5HA 5FOBB 3S1RH 3S1RB 3I3CA 1V9JA 2XVSA 5ELBA 1LT6D 2F0IA 4QIWB 4RHRA 2JXMB 5IWAL 1C8CA 3I4MH 4QAYA 2KA7A 2NVXH 2NVXB 3IAM1 4DV0Q 4DF7A 4DUYL 2C9WB 3OG5A 2L11A 2NZ1D 2P5ZX 4LFAQ 3NG0A 3UI3A 4A90A 1TXYA 2FIFA 1IL8A 5M3MH 5M3MB 3PVLA 4PS3A 3JSVA 2Z0DB 1CQVA 4B3TL 1JJCB 2N7EA 3WDNA 4KJOA 3NZSA 2Z6BA 2OJRA 1RHPA 2WXNA 4OHJA 4IPHA 4US8A 2EQSA 3Q3FA 1UBQA 2UUAL 1HZBA 3K58A 2KQSA 1BQQT 2HUGA 3N52A 3M3YB 4ZYSA 3MJWA 4XQNA 1VZ8A 2KK8A 2BH2A 2L7RA 3W1YA 5DAUA 2J42A 4HPMB 2RKSA 4LFCQ 1GUWA 3N9YC 3A74A 1Q1OA 1KH0A 2EY2A 3H6MA 2RBMA 5C3EB 4B95A 1IBLQ 3V96A 4HIOA 1XYIA 2VQFL 1NI2A 2B76B 4E74A 1G291 3GDEA 1VQCA 2EMTA 3SDLC 3QWZB 2I5MX 1H9SA 1WF9A 4MM3B 2A68C 3HIZA 2ZVOA 1TQOA 1R4NI 4K7SA 4JLCA 2QEXA 1UWMA 1SNOA 4REZA 1P98A 1V1PB 1PTOD 4C1NK 2CJOA 2KDBA 4YIJA 4LF9Q 5BMHA 1UEAB 4NY0A 4W9DA 4BY1H 4BY1B 1HZ5A 3NTKA 1ZXTA 3NSWA 1T3QA 5AUIA 1PTOH 1PTOB 4O1NA 4RMAA 4DV3L 4JOIC 1EL0A 4IUQA 1KRSA 2QJLA 1N5XA 4GNXC 4LAAA 3U9OA 3KYHC 3A9JA 2CKHB 4A93B 3PHXB 4IOIE 4GN1A 2R7FA 2ASQA 3L10B 2B3AA 2H88B 4R4TA 3GO5A 3UE0A 4A3IH 4A3IB 4C3JH 3HOWG 2XSCA 3D4RA 1V8QA 3VDZA 1HXYD 2PIAA 3NQTA 1VQEA 3TEHB 3EHVA 1KAAA 1SNQA 5ELOA 3J7A5 1STBA 4B3SL 5EJWA 2A4ZA 4LF4Q 5LMNL 4G7ZC 2JA5H 1Q10A 4K3CA 1E0ZA 4EQ5A 3J81i 3M3JA 2XWBB 4KTAA 3L16A 4RF1A 1YX6B 4JI0L 1LTAD 3OTOQ 2CH4A 3I90A 3Q3JA 1EY5A 3MXNA 4FN2A 5DCNA 5J39A 3NENA 4A3BH 4A3BB 1EQVA 3S2HB 2ASBA 5C0XJ 4A3MH 2GBJA 1YHBA 1K8OA 4KKTA 2KFJA 4USAA 2K5DA 5L95C 1SMYD 2M17A 1TS2A 1KXLA 3TDQA 3PUWA 2AWTA 3QC8B 4JWSC 3BY4B 5E4XA 1DOKA 5IODA 3WA0A 1BNZA 3S2DH 3S2DB 4RCOA 4AQYQ 1VQPA 1A6XA 1I4HA 1RODA 3M4QA 4HSVA 3M62B 3MP9A 3SE0A 5J1ZA 1PGAA 3HOXG 2DUDA 5BN4A 1IBMQ 3BVGA 3Q3MC 1WMHB 2KQ4X 3ENEA 4JI8L 1ACCA 1KAWA 3T13A 3DVNV 2VB3X 4G11A 3WWVA 3MEHA 3X0WA 1DGJA 4WAFA 4FJZA 4TUUA 2LVQA 1F9PA 1HTLD 1SR3A 3NWSA 3RN2A 1PH7A 3MXPA 3ZRCA 4P1BC 1A3VA 1F2RC 1LYLA 4BBRG 1BXTA 4ZK9B 3DBSA 1MBYA 2WB1B 4JBJA 3DPDA 4FF1A 3HM3A 2R93H 3H91A 2R93B 3K6OA 1VMPA 5IOCA 1GVPA 2D9UA 2BGFA 4KGTA 5JEAH 1EIHA 4IALA 5C4XB 2N9XA 1SYGA 4IPGA 1QQRA 4X62Q 4TRDA 2VZKD 2XTIA 3CSFA 4G7HC 2GBMA 5HG2A 4MSMB 1IGCA 2WDTB 5GADC 3MHZA 1VQLA 1H9KA 1H95A 3CMEA 4W9FA 2LXKA 4LFAL 2B2TA 2VZAA 2YYZA 1X54A 1QCBD 3AU5A 4DDID 4JBKA 2DNCA 2FFKB 2KCMA 1F52A 4HR7B 4CKBA 3KF6A 1I7HA 4FLHA 4J6IA 2D3AA 3VHTC 1WD0A 1I4RA 3S1QH 3S1QB 3IFWB 4QL5A 1YD8U 1TR5A 2I46A 4GDLB 1S1QB 1RD9D 2MP1A 4P6VF 2EY6A 4JWUC 4HMIA 4IFDH 1VLBA 4Y7NB 2IHEA 1N8RC 1J7AA 3I7FA 2IX1A 4K81A 3CC4A 3MZ5A 5JJKA 4GNXB 4MH0E 4LFCL 3H15A 3HHMA 4JI6L 1L6VA 1OGWA 1WIAA 2R6GA 4GLXA 2G3QB 2K22A 2I1JA 1FMAD 2KN5A 4DR7Q 1QE6A 1CJEA 5JH5C 2XEWA 4KV2A 1TKGA 2A73B 4DK0A 2AHOB 2V1CC 1F2YA 3PT2B 1J0GA 5HGTA 2WDQB 3HK0A 4LK0M 5J3BA 2ATWA 3U7DA 3RLFA 1ZGUB 4ZHOA 1H9RA 1V49A 3DVGY 5G5HA 5LMNW 2O5JC 1BBUA 1RCVD 3A9KA 3WOEA 1CM9A 1E7ZA 1WSPA 2ZCCA 4PYUA 3NUHB 3RMKC 4W9HA 5DM63 4C7ZA 4ME3A 1B70B 4HTHA 4MJSA 3P20A 5IY0A 5IGDA 2JZZA 3E56A 1EY4A 1IP9A 3P4PB 2GN5A 4JW0A 4QGUA 2M19A 5E6NA 3DWGC 3TEWA 1Z47A 2WNMA 2Y5BB 2L0FA 3RNEC 5EE3A 4NDXA 1LQBA 2L15A 4LF4L 1U5KA 1BCPC 1J5EL 1HA6A 1FXAA 1S3SG 1JW9D 1TZ1A 4B6WA 3PO3B 3PTFC 3J81L 1VQGA 1HH2P 2B2UC 1IGDA 1WVLA 3OTOL 3W9CB 1GC6A 2L0TA 5C3JB 1XMQQ 1H9MA 4DV2Q 3MEFA 1X55A 2GA4B 3QB3A 3SD5A 4RKBA 4DV6L 4ZUIA 4XC2A 4FNFA 2CWAA 2BOSA 1YIJA 4A4IA 4DAPA 2JRHA 2WX1A 3J7AF 4WWOA 3STBC 1ESFA 3N30A 3DUZA 2KOXA 1XPUA 1HJPA 1VDVA 2JA9A 4LF6Q 1WTRA 3GTOH 1CKNA 4P71A 2J0KA 4PYZA 4RA8A 1FXTB 4AQYL 2V9HA 1WJ4A 1WR6E 3CSTA 3LWUA 2LUEA 1CZPA 4CYEA 2XGTA 5CORA 5BO4B 1F9SA 2EDGA 4TKNA 1NMFA 1IBKL 5I2XA 1SNMA 3IRBA 1B4OA 1BBXC 1D2BA 2ZNVC 1N33Q 2KWUB 4FXCA 4WURA 1WGHA 4BBNC 1B3AA 3ZO5B 4M8NA 4C00A 4ZKBB 5NUCA 3URYA 4EX5A 2QDFA 3BK1A 3KUDB 4NJCA 1EY8A 3KDFA 4A3CG 2KN4A 1DOYA 5CYUA 1CK1A 4B08A 3PZ8A 4RHSA 1AZQA 4HCPB 4WWMA 1ZYRD 2DJGC 4QB4A 1EU3A 2D2QA 1LT4D 4KV6A 2IY1B 1PZJD 2LXCA 4GB9A 5BYRA 3K57A 4DV7Q 2FHTA 1F2LA 3QJYA 2LEKA 1DOLA 2JA7B 4M0WA 5T1IA 1YJ9A 2YEPB 1L0WA 1P3QU 2LS01 2CW0C 3BU2A 5IP9G 4X62L 1KNEA 2FE8A 4C3IG 2KDFB 1FO4A 4ARIA 3HOWH 1OXXK 3HOWB 4QIWE 1I6HH 4QF4A 3OSOA 4ACFA 2UXBL 3P1MA 4GDKA 4GIVA 3ZTCA 2ZZPB 4DHZB 1PA6A 2NN6I 4DXAB 1SIFA 3BZKA 4OO1G 4QQBX 1VQAA 2XRSD 5KNCA 1G6PA 3WIMA 2J0TD 3X23A 4JVZA 4G57A 1Y1VG 3U4VA 2EYJA 1K8AC 1QZEA 2GBRA 4C7YA 2A19A 1ZE3D 5DPWA 2F0SA 4JIOU 2KJRA 3LB8C 3HKSA 4KD4A 3J7ZC 1XEEA 4A8XC 1R4PB 1MI0A 1RLFA 3UIOB 4ARCA 1PDXA 5IIFA 1P7FA 1KABA 3PF4A 4L8JA 4WWNA 2F3VA 2KUMA 1B3QA 3FEWX 5IT9c 1EYCA 2QC8A 3QARA 2K75A 5D65A 4A3FG 1FFVA 3EC8A 2MLBA 4ZOHC 1SYEA 3BINA 3M7GA 4I6PA 2ZPNA 3AXCA 2YTYA 5C6AA 4EZLA 2LRUA 5AZFA 3EQLC 3PCOB 1KDAA 2J7ZA 3HOXH 2MFIA 3HOXB 2MQJA 4LDTB 3H1UA 2R2OA 2R92B 1VQFA 3CMAA 2KFKA 5E6PA 2EXZA 4XE0A 3RNAC 3HOUG 1SNDA 1VQ5A 3A1QB 5JPMC 2KO3A 2QILA 3VYUA 3M7NA 4IO9A 3QIJA 3ZKJC 1XO3A 3APCA 2K52A 3S1NH 3NBIA 4BBRH 4BBRB 2FNJB 4XWWA 1MG4A 5FLXc 3MC9A 2JVCA 2LVOA 3V6EB 3BK2A 3LJ3A 3STBD 2NVUI 3NOBA 1X3GA 2PKOA 3N1ZC 2OJWA 1WTXA 1E3PA 4JI4Q 1GKHA 1TKWB 4JG2A 4GKJL 1YZ6A 4HEA1 2B2VA 4CHTB 3RZOB 3DXJC 3AE2B 3BYYB 1NCVA 4ZRJA 3SGIA 3TBLD 2AUJD 1HNZL 3DBLI 3UDFA 2K3UA 1MHHE 2G9HD 3I4LA 1XWEA 3QIAA 4PZ6A 5I2YA 2F3WA 3T1YQ 3GTJB 1TJEA 2IGGA 2MWSB 1MHWC 3RZDH 3TQYA 3S15H 5FLMG 3DQVA 4HKZE 4WAAA 4F88A 3DVNU 4BA1I 3LWEA 1F9RA 1LTID 5I4DA 2MJEA 4C2MH 1VQBA 1SXTA 2XNAC 2ZNVB 2A69C 2QCZA 2OCEA 3KLSX 3GD7A 3RLNA 5MPOA 1Y56A 3CCMA 4DV2L 1PH3A 5CX3A 1YNJC 4OVZA 4IM3A 1YJWA 2PQAB 2HCIA 3A4SC 1SNCA 4LFBL 2YVCA 2KLGA 3RULA 3FP9A 2RDFA 1ENFA 1KRTA 1EYAA 1AZPA 1GC7A 3Q8EA 1R4MB 4P16A 2MGSA 1DCZA 3R3OA 1LLRD 2CW0D 2WWZA 1P7EA 2RGFA 2NUCA 4C4VB 2WYQA 1NNXA 2PLPA 2W3SA 4NAWA 2RQXA 1KD1C 3KWLA 2QGQA 4FF4A 4K8IA 3TZUA 1PYSB 5GROA 2KWDA 2KVRA 1P8LA 2JSOA 3FILB 1VF7A 3NBHA 1RTOA 4YHHQ 4KKIA 4FADA 3EJIA 4MTNA 2R2QA 1CSQA 1UGJA 4DR4Q 1V81A 2A8VA 1CFMA 2OQKA 2KC1A 5FJ8G 2WINB 1TGZB 3KVFB 3DWPA 3TP5A 2IX3A 4L5SA 2AL6A 5D3IB 4MN3A 3VA5A 3DLLA 3AE3B 4HCNB 1O7LA 2FCSA 1GHKA 4LF7L 4OX9Q 3DWMA 4BVUC 3KUPA 1BCPF 3ER0A 4JK1C 3E0JA 3H7PA 4IZ8A 5C44H 2CR5A 2JE6I 2UU9L 1NY4A 5AFWA 1GAQB 4N8X1 2LGXA 2PTLA 4BY7H 1H8CA 1ASZA 2VNUD 2E3TA 4CKEA 5TSSA 1I4PA 4P1CC 4V0BA 1K53A 2WV6D 1NSNS 2F0DA 2K50A 1QOHA 2F0KA 4QJFA 3GTGH 4WWPA 1V97A 2N9PC 1C77A 3I72A 1FJGQ 3P4SB 3RMHA 3K5NA 1C4QA 2JA7H 1IBXA 2N4FA 3T9LA 4NB3A 4AYBB 1PGBA 5FR6A 1QUQA 2V1YA 4DA2A 4EFOA 1ROEA 3BG3A 5EGTA 1EU4A 2F0VA 1E90A 3U7ZA 1PZID 4LCDE 3KH0A 1QOGA 4CHKA 1G2SA 3E9HA 2WGSA 4HCEA 2FXQA 1SGHA 5AEKB 2L1AA 3GZNI 3RZFA 3Q2AC 4BXXG 3R7RA 4OL7A 1L5PA 1AFPA 2MA9B 4M1UB 1VQ6A 3DBHI 5BMGA 1E6EB 3OOCA 2Y0SB 1NR2A 4TQUS 3V6CB 1CSPA 4HLEA 1TT5B 4A93G 2LGYA 4NW2A 3K8AA 2UUCL 1FR3A 5C3WA 2C7NB 3B2FA 2GVAA 5L83A 4DUYQ 2J7QB 2RSOA 2D3BA 3KJOA 2UWQA 3IT4B 2HTHA 1YNJD 1TIID 2WXPA 4RF0A 4A3CH 3ZJTA 4F87A 2UXDQ 4HMJA 4A3EG 1QOFA 2A5UA 2WXMA 2WXQA 2ICIA 4B3TQ 1UBIA 3Q8FA 3DMUA 4MT5A 3TP8A 1JCKB 1P9DU 3CIRB 1ET9A 4R3DA 4DK1A 4RM9A 3R2TA 3U8ZA 1SE8A 3KLWA 3GZNB 1EY6A 4KK7A 5IP9H 3U9SA 4CDFC 4C3IB 2M0AA 3SFEB 4CJ2C 5KGUA 2UUAQ 3T3NA 4HN7A 3U30A 4PK1A 4PZ7A 5EDSA 4NMZA 1D5ZC 4FJVB 4KHVA 4YCVA 3T1YL 2XBBC 2WFWA 3S16H 3I63C 4O2DA 4OO1H 3D32A 2W54A 2ON8A 2WXLA 4MGYE 3VR2A 2KHSA 1MG8A 2B2WA 4K8JA 1Y1VH 1Y1VB 2CVRA 1RRBA 3H9DA 3L3OC 2L52A 3RNGC 1O7IA 2UXCL 2VQFQ 1CA6A 1IUEA 5ELCA 3NS8A 3CRKC 3MFGA 2JUOA 1DD2A 2Q8RE 1S5DD 2BTEA 4DWFA 3Q8CA 3L7ZC 4ID6A 2VS1A 2X6LA 2Z6KC 4A3FH 3ZNID 2ZJPA 3A7LA 2KD0A 2MEKA 4BOZB 1PH8A 1WJNA 2WB1G 1LO5D 3J80c 4G7OC 1C9FA 3CU7A 4X64L 4HJKA 3T16A 2O5IC 3CCLA 2QIEB 1KDBA 1TWHH 1TWHB 1TY2A 4I6NB 1TS5A 4URKA 2KEDA 3HOUH 1L2NA 1XXGA 3UIPB 1VCIA 2I1KA 4YHHL 1GNUA 2NZOA 3M4OH 3M4OB 4FJYA 3DEOA 1XLNA 1I5FA 2PQEA 1O80A 4DR4L 2DX5B 4DR2L 1FCLA 3I4NB 2WX0A 4JX1C 1ENAA 2JK8A 1T9HA 3I57A 1MFWA 1E5WA 2DAFA 4JI0Q 4U673 4GLAC 4FHKA 2V4DA 2LJIA 1EY9A 1PYBA 4KI0A 5GXGB 2KVMA 2ONQA 2OEOA 4ODGA 1TTNA 2KCNA 2Z9HA 4NPSA 2K5QA 1BVSA 2SEBD 2G4SA 3ZW3A 1HNXQ 5EPLA 2DY7A 3CKIB 2BPSA 2N9LA 2NZHA 1VZ7A 4HKQA 2EKEC 1T6BX 5JZEB 3JAMc 4CBVA 4A3JB 3T3OA 1JJ2A 1NMGA 5M5YH 4C56C 1KJTA 4HWIB 1FFUA 4DHZE 2IY5B 1FCCC 3X3MA 4UP7A 1PZKD 3J81E 1C9OA 2EYLA 3F2CA 3T1HQ 1GPXA 2I5LX 3A0JA 2BQQA 4AP4C 3FDTA 3KBXA 3CF5A 2SNMA 1K73C 1FJGL 3IAYA 1VQ4A 4ZLTF 2L83A 4R4IA 2Q2IA 4KN4C 1LTTD 3W3AA 4H7BA 2K8BA 3D6CA 4J8QA 3ZNHB 1JR0D 3FPPA 1EQTA 5CBAE 4ZRZA 1JB7A 5I6WA 4WJPA 2BYTA 3PV0A 2K4KA 4P73A 3VUYA 4GLVB 2K1FA 1LT3D 2FMMA 3NWTA 1TYGB 5KEEA 4O0AA 1XCQL 3F2DA 1PGXA 2G1EA 4EVOA 3H7SA 3B08A 1VQJA 1UUPA 1C4PA 4QUCA 5IYBG 3SHLA 1QG7A 1FGBD 4X65Q 2DYBA 3SU8X 1WY8A 2IGHA 2RR9A 4IFDI 3GTQB 1UH6A 3RZWC 2D3CA 1C3TA 2DZMA 2KZRA 1GD7A 2KKCA 4K6DA 2KDMA 5FJ8H 3GQBA 3M4YA 4GN4B 2K6QA 2UXDL 4RG1A 2KWCA 1V5TA 4YCWA 2RPVA 5TR5A 1VD2A 1CZGA 3PO3G 1J8CA 1PUTA 1PDQA 1C0AA 4MDKE 2A6ED 5BR8L 4GKKL 1VR9A 1ZUD2 2VRRB 2K5HA 3Q6SA 1JWMD 5JXVA 4L63B 4HK2A 3SFDB 2D62A 4ILWA 5CMDA 4KKUA 5D2MB 3S9WA 1G91A 4JC0A 1VZ6A 1CTMA 3IBEA 4C80A 1WYGA 3GE8C 4G4KA 3HP3A 3KFUA 2WXHA 1IL2A 3M3YH 1PQSA 1T0QC 2C9OA 5J22A 1WJUA 2NBVB 3HM6X 3V05A 1KL9A 1L0YB 4A76A 3AEFB 3IFDA 3S1MB 4YTPB 2L3ZA 4JI6Q 1ZP0B 3ZXRA 4HJGE 4Q0FA 4B9KA 1WGYA 5IKCM 1J9OA 3AU7A 1JE5A 4IJLA 5LL6X 5C3EH 1GJXA 1G6JA 4WJ3M 3AI5A 3QHTA 4NAMA 3ERQA 1S72A 1IW7C 5EPKA 2WDVB 5LL6S 4X66L 1MSGA 3O65B 3WOFA 4DFAA 2BW2A 2NBWB 3C46A 4GU2A 5CV7A 1T0RC 3ITPA 3VYTA 3A4RA 1WD1A 2NB0A 2L4NA 4OEMB 3C0RB 2YTXA 1HA5A 1MKHA 2VXWA 3GS2A 4DDGD 4WIPA 2OHFA 5HHDG 1GXDC 5KIXA 3EIVA 2Q2UA 4BXXH 3PZDA 5IA7A 4HJ9A 2VUMG 3M63B 2QCPX 3D0FA 3VR8B 1QOAA 4ZKCB 1XPOA 2JX5A 1T5EA 2B8GA 1KC8C 4P7IA 2JZ3B 3P63A 4X6AH 3HOZB 3I2ZA 1B2TA 4A93H 1ICFB 4YY3L 2JA7G 3SK4A 1QVFA 3I5JC 1YITA 1F2RI 1WFYA 4DR6L 1UE6A 3KUCB 4OZAA 1HUMA 3FRPB 1HR0L 3ULJA 5KYIA 1IKMA 1NYQA 4DAYA 3U4ZA 4NJ7A 1Q5WB 1J5EQ 4A3EH 4A3EB 3IVFA 5J18A 5JVH3 2MO1A 3L54A 3TEZA 4LNFA 4BKTA 3IL8A 2OTJA 4DXFA 3DBRB 1VF5C 1PVOA 1PFDA 2W55A 2LI5A 4XXEA 3H3VH 2ZTDA 4IOAA 2KJHB 1F77A 4DV6Q 3S2HH 3NPPA 1QLBB 1HNXL 1WTHA 2KQ3A 3HOVG 2DBYA 1JOKA 3AE9B 5CV4A 1J6QA 1HHVA 4LJZC 1WGGA 2Q8IB 1WGDA 3N1YC 4EGVA 1N34L 1YHQA 1KF6B 2INCC 2EELA 3A8IE 1GB4A 5I9OA 4APVA 1GM5A 2V4LA 3B1LX 5JHBA 3T1HL 4RCNA 4K0KL 2O6VB 3F1ZA 4AJYB 4DAVA 3K59A 2V3NA 1XJVA 2R92G 1QILA 4HDOA 5K36G 1IBKQ 3TREA 4KVGB 2JP1A 4AYBE 4CDCC 4OW0A 4DHJD 4GGQA 3H94A 2PJHA 1R9TH 1LUZA 1R9TB 4FA6A 1YJ1A 1Y8OB 5A2QL 1TS3A 2OOBB 4B0MA 2NVTB 4BZAA 3Q24A 2BYEA 1YBYA 1UD7A 4DHJB 1D5XC 2WU5B 1GUSA 4DNTB 1E2ZA 1A2TA 3DHIC 4LMQD 1ZDXA 3N1XC 1UE7A 5D7GA 4DK3C 5DPTA 2HCCA 3DDCB 2XK5A 2GBNA 3PGZA 4CO7A 5KRUA 2F0MA 1OXTA 2D0OA 1NE3A 5C4XH 2E2IB 3H8HA 1Q12A 2LUMA 2WXKA 3WAOA 1V8CA 4JPSA 3R3MA 4W9JA 3OPOA 4X65L 1VQ8A 1UE1A 2AQ1B 4B9WA 1WGRA 2UXBQ 2PE6B 3KLSA 2NPTA 3PO0A 4WJWA 3Q3NC 4IUMB 2A68D 4IURA 2CHZA 4LJPB 1CI3M 1U4PA 2V3PA 3F2UA 1VQNA 4PG3A 1JC7A 4B0EA 3E3XA 3MJ5A 1VDZA 1X3EA 1OXVA 4GMVA 2G9DA 1RDPD 2N88A 3NK9A 4W9KA 2K6AA 3FKIB 4PT5A 2A6HC 1BF4A 4NXML 4EOYA 3BYTB 2AQ2B 1GUAB 5IP4D 4Y7NH 2NVYH 2NVYB 1RYJA 4N9F4 2KTRA 3ZJVA 3I55A 1L1OA 1G51A 2QW7A 3KWVA 3NTIA 1KHIA 2NTSA 1B7YB 4OONA 2DHZA 3MC8A 5CTRC 4KMUC 1SFOB 3DEPA 4HVBA 5DNFA 1OQRA 4EUTA 1B53A 4XYQA 2PVOD 4P74A 3MTNB 1JRUA 2MP2B 3K5OA 1WH3A 1EY7A 4OVUA 2VQEL 3NVYA 4IUVA 3BVMA 2F4VL 2AKWB 4JI1Q 1C78A 2JXTA 2IYDB 1C7YA 2PEAA 1XQQA 3K5LA 1U4MA 1K0SA 3P42A 3GTLB 2FUHB 3HVDA 2CS4A 3K0XA 1HNWQ 4K7UA 1UGMA 3LGJA 3PSIA 4J3OD 4CJ0B 1E7UA 1DM0B 4NP5A 1MGSA 1SRUA 3NVWA 2LFIA 2R3ZA 3KUZA 2F0GA 1GHJA 3OHXC 1YI2A 1OQQA 4OXPA 5FO8B 1GUTA 4WFN3 4GKJQ 5CHWA 5IYBH 3LNNA 3FAHA 3NE5B 4P75A 5IT9L 1X9NA 3T8MA 3P4RB 1HNZQ 4NXNQ 2WXIA 2B63B 1V6EA 2IDYA 1M4VA 1JB3A 4IUUA 3KLRA 4N8FA 1WWTA 1R4MI 3AB5A 3KW5B 2J0MA 4HCSA 3U58A 5C4HA 4IW0A 4LNOA 1V1QA 2EYOA 1HCZA 3CCUA 5FKAC 1E7PB 1KRHA 1C4AA 3K9OB 2NBUA 3QX1A 3NUCA 3PO3H 3HS0C 3GV3A 1STYA 1F9QA 2K32A 2Y5CA 3C19A 3I9V1 4IC7B 2CU3A 5J17A 2BWFA 3PUVA 4K5VA 3PUYA 1EIGA 2ZM6L 1IPGA 3PSEB 1I50B 5CV8A 2ZCBA 3APFA 2ZT9C 3JSVB 2FJ2A 4IWQA 1XF5L 1K3BC 4ALPA 3A54A 3HFZB 4AYBG 3GV6A 4LFBQ 4W9LA 1Q82C 1R4NB 5FLXL 1N6ZA 5IO9A 3PLVA 1X3FA 5CGKA 2BE5C 3DWAA 1C79A 1WZ0A 4KIKA 3KYDD 1WCMG 1X3PA 2K6DB 2MX2A 3VYRA 5D14A 3EGRA 4ZHPA 3Q14C 4RGOS 2Y0SG 1JOOA 4GXBA 4HXDA 1XNQL 1SYBA 2B2TC 4ABNA 4A3GG 2VH1A 4M8MA 3U2SC 1O78A 1YHAA 5EKLA 1WX8A 2O2VA 1H9SB 3HOYG 2WAQB 1N32Q 1YN4A 4E3CA 1Q1EA 1CQFA 1WFQA 2AEHA 5IGGA 2VUMH 2VUMB 1NYRA 2MPMA 2WDRB 3NZUA 5HKHA 1B9RA 1IZ6A 1VQMA 3TBIB 1PLFA 1PH1A 5G3LD 3PO2G 3UE1A 4LF7Q 3LYYA 1YX5B 4YTNB 4CGYB 1SE2A 1MSHA 2EVBA 5JOBA 4FO2A 3ZYYX 4CKCA 4PMCA 5EBDA 1EFWA 3S14B 3NRZA 2PPBC 4S0RA 1SNPA 3C2PA 2LMCA 5CHFA 5C0XG 2UU9Q 3OLMD 2KOLA 2C5LC 2Z8LA 3P75A 4GZYC 2KCTA 3J80i 3UF8A 4ASWC 1S5BD 2JXXA 3IHPC 5ELDA 2D5GA 1JICA 1KDCA 3ND9A 4AH6A 2DYMA 1B8AA 3V2TA 5HURA 1E8XA 2MSED 2D07B 2MUYA 5EBCA 4JGHB 3FKYA 4A3DG 3SK8A 3CQZH 2L55A 3CQZB 3NXWA 1XPRA 3S17B 1H4RA 1HZ6A 2N0SB 2CQOA 5C3XA 1Q0WB 2JRIB 2K5NA 3AMZA 2WXJA 3ONAB 3HOVB 1N60A 2H1EA 3MHSD 4YSXB 3MXNB 2D10A 2HHHQ 3ERSX 1RFAA 2DY8A 3PUZA 1YNXA 3R8BA 1W6KA 4XT3B 4V190 3G4SA 3KOJA 3R7QA 3OAWA 4YCUA 4LDTD 3QOJA 3ZXVA 4BOSC 2B3GA 1I6VC 1L2FA 2O4XA 1WR1A 1SYCA 2DLBA 3RD4A 1NI3A 2KHWB 4WH4A 2NWGA 2AMCB 1B50A 3Q3OC 4TQ1A 2QDLA 4GLSC 1S5FD 3Q23A 5D6JB 2R92H 4R9WA 1BCPD 3JAMi 3GE3C 3QG1A 1VRAB 2HJ1A 4B3MQ 5K36H 1HTPA 4JI1L 4HIDA 4FF2A 2LASA 2UUCQ 2K1BA 2Z4HA 2Y3AA 2BYFA 2DJFC 3LDZE 5JJZA 1LTLA 3DM1A 1HRJA 1BCPB 1NBWA 3BVZA 1HNWL 1RTNA 2R7DA 2X8XX 1KTKA 3W1SA 2MBEA 2J4XA 3BDLA 2ZW0A 2MCNB 3SEBA 2F03A 4OO1I 4UDUC 2XN9C 1QWYA 1XTCD 3I4NG 5LMUL 2AQ3B 2J0JA 1HZAA 1SYFA 3RR5A 1JMCA 4A3PA 4FBJB 4PV1C 2EY5A 1UNSA 2F0NA 1TS4A 4L6TB 4A3LG 1Y8NB 4XQJA 3L4PA 2E75C 2O2LD 3IKJA 2JYOA 2WXOA 1STAA 4UP9A 3RZOH 3WAMA 3BIID 4BKSD 1FYCA 3GTPB 3OIQA 2FMCA 4NXNL 1C4CA 3VYSA 3GTJH 4POFA 1D4BA 4K5XA 4A3JG 4AUQC 1Q7YC 4LNQA 1XLQA 1D1KA 4GN3B 4BBSG 2YV5A 2A5HA 3A33B 2UXCQ 3PPAA 4YTMB 4A3OA 5ELFA 3M95A 2RDBC 3KF6B 1RWSA 2KBNA 5DM73 3CAMA 2FCNA 3MVVA 4GOPA 2PCFB 4LNNA 1HTOA 3AQQA 2HTME 3RCZA 4U68A 1MHXA 2KNBA 1G8ZD 1U9RA 1XX8A 2OEDA 3FMCA 2EMSA 4H0LC 2CFMA 3HUIA 1TY0A 2V0GA 5BYSA 1PRTF 4IWPA 1F9JA 2REXA 4LF8L 2WQYB 2I2YA 5L37A 3CCVA 4A75A 2MNAA 1BMLC 4Y52H 3KYCD 2E8GA 4LNIA 3A5UA 1EZ8A 4X64Q 2N55A 1T5XD 3NEMA 4DR3Q 1EWYC 1E1TA 4HDQA 2FCQA 2KANA 3AN1A 1SSNA 3AE7B 5FO7B 3KF8A 4X3TA 5IYCG 2F0TA 2IO0B 3PUXA 2ES2A 3RNFC 3UGBB 3B0AA 1A3UA 1J8IA 1A5RA 1M90C 2EYHA 1HFNA 3AFQA 2CHWA 2D11A 3UDGA 1OEYA 1AARA 2F52A 2K03A 4IFDJ 3P7JA 1EWIA 1FL0A 2QF7A 1N32L 1FD6A 3VR6A 2K05A 3TP6A 3CCJA 4DR2Q 1P1AA 2L8JA 1F0ZA 1NVID 1LTGD 4UHVA 4NKLA 2JEAI 4BWGB 1N36Q 1CT1D 1I4XA 3FHWA 3N6RA 3S2AA 2VL6A 2WB1E 1AN8A 4GSWA 4JYAQ 2K28A 2IZVB 3ZLZA 2Q8TA 1W3SA 2BDOA 1V80A 1TT2A 4HEDA 2JA6B 3A9KB 4IDIA 1GG3A 1HFGA 2I07B 1QZGA 1D1IA 1Y1WB 1PH4A 4KY6A 5G2NA 4ZQ3A 2UU7A 3HEJA 2K7VA 1PYWD 2EOTA 3J80L 5BN5A 2M2LA 4XIGS 1WJ6A 4MJSB 3N32A 4RWSC 3Q6BA 1T0YA 5JPNC 3C1EA 2N9KA 1K51A 3F8TA 2Z4IA 3TP7A 4KY5A 1HUNA 1X65A 4FHJA 1XNRL 3CMMB 4TVAB 4DBGA 1K83H 1K83B 2PI2E 2N1VA 5DEHA 2AYOB 3N3KB 4DV1L 3ONSA 5LXIB 4BS9A 2KXJA 4MELA 4EKUA 1CMXB 1E0BA 2LHDA 3FVQA 2WXGA 4KDIC 3E9SA 3UINB 1FM0D 4JQWC 1WE7A 1JWSD 2HHHL 1WCMH 1WCMB 1L4DB 3L2PA 1K0RA 2ZJQA 2LY7A 2BBCA 2B2VC 2F0JA 3ZJYC 2B2YA 4Q2JA 4N9PA 3CC2A 4M00A 1RAXA 4MM3A 1A0IA 1CKNB 4R1JA 4UAIA 3DM3A 4TSSA 5M3FB 1B44D 3HOZG 1PFNA 3BDCA 2M8SA 1DGSA 1V1PA 1EFID 4F8MA 3JAML 4A3GH 4A3GB 1DOMA 4B3ML 1IYVA 2WP9B 4IM2A 4X3SA 1YQBA 4ITKA 4EZKA 1XCTL 2LJ5A 2LD9A 3AEDB 2A69D 3CC7A 1U0LA 1Q46A 2A1AA 3MAQA 3HOYB 4A55A 5A2QE 2BYVE 2G4DB 4J6HA 5CBEE 2HIVA 3PIO3 3UQAA 4XX5A 4D2KA 3K7UC 1WTPA 3J7YW 3AEEB 1EYDA 5EAYA 1E2VA 3M85A 1ET6A 1IKLA 3SXHA 1KQSA 2VW9A 4X3KA 1C48A 1SROA 3HKZG 1EY0A 2SOBA 3KDFB 3PO2H 3PO2B 5BR8Q 4GKKQ 1K28A 1WI5A 2QDBA 1A63A 3VR4A 2N9EB 4ZDVA 4WJOA 3FC4A 1QJOA 4C3IH 5C0XH 4JI3L 3OJ3A 1L0XB 1EIFA 3AH7A 1STEA 4M0WB 2GOWA 4QY7A 2X6GA 4C3JG 2PE9A 4EZJA 5EKIA 1SIJA 1RF2D 5H1SE 2KLCA 1LTRD 2KX3A 1N61A 1WTQA 2E2HB 4ZRKA 2K04A 2EYMA 2JA5G 4OELB 2C60A 4GDKB 2FCMA 5T1GA 2JQOA 1OTRB 1S5CD 3Q8DA 2YTVA 5M5XH 5M5XB 4S17A 4OVVA 4A3DB 2M1MA 1J19A 2JWUA 1QVGA 1EEFD 1SN8A 5E1FA 4AIMA 1M1KC 1LV9A 2I0QA 1DONA 2N7JA 4X66Q 1I94L 1EUVB 1Z2MA 1CHQD 1UAPA 4JI7Q 1JWBD 1VQ9A 3L17A 4PNYA 5IOIA 1Z9FA 3MC0B 4DV4Q 2J52A 1OFFA 3TL5A 1I3QH 1I3QB 2Y5PA 1WXQA 1DOIA 1TWAH 1TWAB 3IFTA 1XD3B 1SEBD 1WMHA 2B8FA 5ISRA 2QSDA 1YJNA 1SE4A 2F0PA 5CC4A 4RNAA 4DR3L 2IY0B 2IO3B 3DBRI 3PRMB 4YY3Q 4IM0A 4ANWA 1NTGA 3EBEA 1PXUA 3ML9A 3PLUA 2M00A 1KM7A 2K25A 3H3VI 3PREA 4E71A 4DR6Q 3I4OA 3W5UB 4CJ1B 2UYZB 3TIXA 4R4OA 2KFKB 1X6OA 1HR0Q 2ZEQA 1GJZA 5FR3A 2KCCA 2WAQE 1YVCA 4PMWA 3I4NH 1YJJA 1JQYD 3CPWA 3SHQA 2JQRB 2INPE 3PQIA 1N36L 3QR8A 1WX7A 2BWES 4CQNA 4A3LH 4I6LB 3WAPA 1ZKOA 1WXVA 2CQAA 4JYAL 2ZXPA 1L7YA 1EUJA 2VY3A 4MTKA 2HD3A 2FAZA 2KYWA 1BDOA 5IT9E 1UZXB 1YN5A 4BKGA 1TWFB 3FKIG 3PIOA 1WTWA 2BS2B 2LVPA 4MGKE 2AWOA 2IPKD 2JEBI 1YJIA 2ZXRA 3QCAA 1Q8KA 2KX0A 2QMTA 2MQHA 4A3JH 3Q22A 4OWWB 1JMLA 3AU4A 1EQQA 1N34Q 1HZCA 3OIPA 2V4IB 2PI2A 4DK6C 5FLMH 2VB2X 5IGFA 5AJ3L 4BBSH 4BBSB 3H0GB 2PMZB 1NAPA 1SYDA 2JA8G 2RSUA 4HRSA 4GDLA 4RAUC 1P16A 1CZWA 2MJ8A 4HJ8A 4KD3A 1K3RA 4K0KQ 1MPEA 4DV5Q 3WALA 2J53A 2QA4A 5HFYA 1EQRA 5BMIA 4IPCA 4HROA 2PZTA 4N6EB 4AS1A 2NCNA 4P72A 5C4JB 4TQ0A 4JOIA 1UE5A 5EPJA 4UPAA 3J81j 5FLXE 1WOCA 4GNXA 5JJLA 1WRDB 1CKMA 2KMAA 1E24A 4DN4M 4HJ7A 2E2JB 2XIWA 1VQIA 4K2LA 1WXAA 1SJED 2RMMA 1X56A 1V5OA 3TEXA 4BAXA 5JVG3 1LGRA 1D7QA 1BT0A 2CKZB 5JHAA 3CP0A 1AE3A 2L05A 3PS6A 3TCAA 3AM9A 2C5CA 1L4ZB 1WTVA 2SAKA 1S3OA 1OO9B 4IPDA 5IYCH 4KHPL 3I91A 3TJPA 3T53B 3F2BA 2UUBL 3ZUNA 4RKLA 3UDIA 3HVZA 1PFSA 4NAWB 4IJHA 4II3B 3ZVVA 2F3IA 3NP8A 2KT7A 1RIPA 3EFXD 5LXHA 2B63G 2B2WC 3GTQH 2KJ6A 5C23A 3NBHB 1WI0A 1D5MC 4LF5Q 1LABA 3GB1A 4J15A 3VRBB 2XRQD 3D4WA 5FK9C 3PRZA 5C2TB 4MIUA 2PYKA 5FO9B 4EQNA 3VTVA 2N78A 2L32A 2BKRB 3V60A 1PFMA 2ZPYA 1SMXA 2EYFA 4LTUA 2MBBB 4A20A 1JE4A 4RGMA 2BF8B 1SMYC 3KBGA 4NXMQ 3I4MB 3P2BA 2WIIB 3T51B 2KTFA 1F2MA 2DNFA 3NJTA 4JI5L 2C7HA 1XT9B 3H7PB 1D6EC 1ZOYB 1Q8IA 4DNRB 3S1MH 4LUOA 2R7ZG 1EM7A 1FRRA 4DGZA 1XLOA 4MH8A 4DPGA 1Z6HA 1IYFA 1HE8A 4XT1B 3EECA 5KNBA 1D8LA 4Q5VA 2Q5WD 3VAWA 2EZVA 5AUKA 2L1BA 3DBHB 2VQEQ 1OXUA 3B2GA 1SAPA 4DNIA 2F4VQ 4R8IA 2JPHA 1QF6A 2HDLA 3TMEA 1EF5A 2K14A 4C3HG 4P2CB 1WXSA 2K01A 2YLMA 4JBMA 4FXKC 5H92C 5C1ZA 5EE0A 5IAAC 1PMRA 4JI7L 2R61A 2N7DA 4HJ5A 1LM0A 2BCOA 2WAQG 5KNDA 2M0XA 1QUQB 1R7SA 2KAJA 2LXAA 5IE8A 3RLOA 2BKFA 4X3UA 5C4ZA 4JE3B 4DV4L 3AE4B 2ZVNA 2N1WA 2Z59B 1X32A 4L1BA 5HI1A 3VTUA 3D8GA 3TS2A 2KDEB 2ID0A 2AL3A 3I3TB 3U50C 1MJCA 3BZCA 2EY1A 1VQOA 2PPHA 3HOZH 1E1OA 1B9NA 1ZXHA 3CD6A 5EE1A 1S4ZA 4N58A 1U4LA 1Y8PB 2HDEA 2WKCA 1NENB 3NVZA 5D3DA 3W2DA 2QHOA 1FEHA 1CUKA 4ICVA 1JWUD 2D2CC 2GB1A 1TWCH 1TWCB 1FXIA 3QOLA 3D4DA 1M94A 1BO0A 2AX5A 5CR3A 5GAHC 1FNWA 3HKZB 1K8GA 1H9JA 4XTCS 2DGYA 5BYQA 2ZM6Q 2GMIC 2E5LQ 1HTQA 4G50A 1GUOA 1YN3A 4MGIE 1WRIA 4PMBA 1W6JA 3KK7A 3JYUA 3VH3B 4FULA 1G6ZA 4ZUJA 4HPPA 2HIXA 1AH9A 4C3JB 3JW0X 2NBFA 2ZTEA 4FVMA 1SF0A 3ZRFA 3C8YA 1JRPA 1ONLA 1WM3A 3A8KE 2JYTA 2CU1A 2O6VD 1ZDVA 3LX0A 1VQHA 2MH7A 3AE5B 2JA5B 1T0SC 4KY7A 5C5LA 4OIKA 1I4QA 4JV5L 1WXMA 4PS8A 5CV5A 3DHQA 4DV5L 4US9A 2KEEA 5KYLA 4KGRA 4K14A 1A70A 1XNQQ 1UWXA 3MTSA 3EVQA 2EE1A 4K6LA 2LZ6A 2BA0A 4Z9CB 3PF5A 4A3MB 4EQPA 3AULA 4XGAB 1C76A 2IT1A 1KIXA 2F0WA 2C7MB 2BS4B 4KN7C 3KJPA 4N9TA 1ILPA 1W2BA 3NVVA 3PGEA 3RT3B 3VQIA 3X3NA 2DENB 1F1HA 4XDDA 2NVTH 4JL9A 5I6YA 4E6IA 1EZ6A 4KLKA 2H4OA 4I65A 5DPRA 1DXMA 2IX0A 2HT1A 4QCLA 1YEZA 3MXGA 1V1OA 3VXWA 3A1QA 1RL2A 3OW7A 2E2IH 4OZBA 3AEAB 2Y0SE 3OWFA 3OMCA 2JF5A 3BWUD 4N59A 4ANUA 2B2UA 2SNSA 2K9XA 4DQOC 4J1MA 5GAEC 2GRIA 1FVIA 3C3LA 4JCVE 4KJNA 3P4QB 4AJWA 2Z1CA 2KWVB 2INNE 2CCZA 1IW7D 1K50A 3H6NA 2Q2TA 1PH2A 3CCQA 4UY8C 3JC66 4DU9A 4LF5L 1K8MA 1EOVA 4YWMA 3VH4B 3IXSA 2NTTA 4OWTB 3S24A 1CHPD 3RN5A 1WX9A 1VQ7A 1VQDA 1B9MA 1JROA 3PMFA 4ZRQA 4H44C 2JSVX 3FKIH 4BKSA 3K9PB 3CRLC 5IYDG 4XWTA 3RD2A 1EO6A 2FIDA 1YMHE 4DV0L 3G48A 1FNVA 2I38A 1UF0A 3VRAB 1FD7D 3J80E 1PTOF 3SDZA 3GTMH 3GTMB 2VZKB 3VR9B 1SFOH 1TIFA 2D3GA 3VFKA 1U4AA 3ZDTA 2GI9A 2JA8H 2JA8B 3ULPA 4WQOB 2QEJC 2IO2B 3K7AH 3K7AB 1NJIC 1KLGD 4NPNA 2PQAA 3G6EA 1YOVB 4K5WA 3PIP3 2MJ3A 1PRTC 3CW2C 5IGCA 2K0PA 4F7ZA 2EIFA 3GTLH 2JT4B 1AE2A 1V2YA 2HE7A 4ANXA 4C4VA 1ZYRC 3ZGZA 2M56B 2OXPA 2ZXOA 1HR0W 4RH6A 4W9EA 1TVXA 1Q90A 1A2UA 4XZ4A 1LTSD 3VUXA 2CWPA 5LMUQ 3RNCC 3V62A 3VVWB 2IBIB 3I56A 4HJAA 3TSSA 1ISNA 1P0RA 4NQLB 1XLPA 2DYOA 1EYGA 3OMGA 4IWOA 2GBKA 5CHVC 4QUFA 4NQKE 1PHJA 1IBLL 3FILA 3T4AC 1IYUA 4ULLA 3A56A 1AYFA 2RDHA 3JAME 3V3XA 1AWDA 3RNBC 1WTOA 2JA6G 2K8HA 1RM6C 4H02A 1NR4A 1GOZA 1Y1WG 1FIQA 2B63H 3TS0A 3L0WB 5LNK1 1KLUD 2AWNA 2ZTCA 1VJKA 1CKOA 5E7NA 2CHXA 2JYEA 4KZ0A 4NNJB 1LXDA 4LF9L 1RJTA 2F0LA 1YNNC 5M9OA 1ENCA 4DR1Q 4XDXA 3EFUA 2PO4A 1ESRA 2PZUA 4UP8A 1OEYJ 1HQRD 4DR5Q 2D5DA 2PNRC 2E2DC 4LLGM 4TKOB 2TMPA 1U4RA 2RVLA 1EWHA 1I50H 2E5LL 3PZ7A 4II2B 1TZOA 4MACA 4RGNA 2JJQA 2DNEA 2D0PA 2BB6A 3RPFC 5C44G 3GP7A 2KHIA 1UELA 4W9IA 1I35A 4I7ZC 2G5DA 2RSNA 4IUNA 4RM8A 4NJ6A 3TN2A 2R7ZH 2R7ZB 3ZTDA 2F1MA 2B39A 3B9JA 4G0NB 3I73A 5GQOA 4LF8Q 4BY7G 2KENA 1WGKA 4S3SA 1N5WA 4W9CA 2KC2A 2LXJA 2PMZE 2M4NA 3W5VB 2LKVA 3D3RA 5M3FG 3A5ZB 2EXDA 4C3HH 4C3HB 2KACA 2C35B 4LUVA 2MHVA 1FPYA 3K80C 4QMGA 1PH9A 5COYA 2PVGC 4KSLC 2PNHA 2MJDA 1STNA 4M01A 4L5TA 2A6HD 2NN6G 5IP7G 1A62A 2HJ8A 3IT6B 2BVCA 5JAVA 2F4IA 3PIPA 3GTOB 4YT0B 5EE9A 3G6JB 2WLBA 1QNUA 3O13A 5DLQE 3RYTA 1BR9A 2L9HA 3RUZA 3Q0AA 3ML8A 1KOTA 3S14H 1L1OC 1PH6A 2FUG1 4TV3A 4K7WA 1IBML 3P1HA 1EF1A 1II3A 1TU2B 4BA2I 1E2WA 4WORA 4K3BA 3HG9A 4KDLB 4GS3A 4CDEC 3H09A 4WJQA 3A9JB 1FGUA 3AFPA 3EN2A 1ZEQX 3OW2A 3MWYW 4IKGA 3IG3A 4K1RB 5IN7A 1RFKA 3GOEA 1PRTD 2Z0SA 1X1MA 4A3KG 4XQQA 1Y14B 2L00B 3QQ8B 4ZRPA 3TMPB 1GUGA 2K5WA 1E8WA 5HY6A 1IYJB 3ICEA 1QT9A 4DAYB 1PRTB 4M8AA 1XNRQ 1YIWA 1QB5D 2F0QA 1KLVA 1O7ZA 1OQYA 3WCQA 4DXGA 4A6QA 2W3RA 4OGQC 3MA2B 1A3TA 3E0EA 4I7AA 4DV1Q 4POGA 3J7AV 3S17H 2H5XA 1A8VA 4WRDA 3ZNZB 3NQIA 1CA5A 5M5WH 1QVCA 5M5WB 3HOVH 4HPLB 3DVGX 1I6HB 4ZRIA 1MJDA 1J7BA 1EOTA 4DK5A 3C1FA 1SSOA 1WJJA 4BFRA 3APDA 1ZXIA 1AW7A 1MI2A 3MXUA 2KVZA 1AP0A 3TEYA 1OXSC 1YNND 2EJFC 4FYDA 2ZJRA 1MVKA 5AZHA 4ANVA 3JVZX 3ND8A 2MRPA 2IW3A 1OTCA 1YNTE 1Q1BA 1EIYB 3AE1B 4LWCA 3W1BA 5C0XI 2A74C 2OQ0A 2BDNA 1WE6A 3W5OA 3AV8A 3MFYA 3ZDMC 2NMQA 2W9NA 4HIKA 3KQ4A 2N8NA 3E6ZX 2RD0A 2L0CA 1EEID 3T56B 2OWOA 4B3RQ 4YWLA 3GTKH 3GTKB 3CPFA 3RNUA 3AEGB 4OIJA 2BE5D 4L5QA 2N3SA 1V9PA 1JALA 1E22A 4KKSA 4EEWA 2EPBA 2F0UA 2EYPA 4F7XA 3CCRA 2FBWB 5T8IA 3J81c 2KMCA 4DR7L 4K2KA 3EUB2 3GTPH 4JI3Q 2XK5B 1IHZA 1KFYB 1M8AA 4AQ7A 4R4QA 4LUZA 3PHWB 3QK0A 4FP5D 2BA1A 1HZ9A 1Y69U 3QO2A 2CH4W 2ZJDA 3L08A 3CF6E 4EE2A 1GUNA 3TZDA 3RN9C 3S1NB 2NS5A 4DR1L 1L6UA 3IAS1 5K5PA 1KNAA 1S40A 3H0GG 2NPTB 4DR5L 4JI2Q 2INDC 2ZW1A 2RCNA 3G7LA 4X57B 2LGIA 3HKZE 2BS3B 4HSPA 4L2YA 4PQXA 5JEAJ 1BKBA 2KMMA 1I94Q 4FDBA 5G5GA 3W1GA 5IYDH 3K0YA 1V43A 5EQ0A 2V3SA 3DHHC 2BB5A 1JT8A 4OWXB 2DWQA 2MBOA 1JOQA 2N49A 3MHBA 1ILQA 3RZDB 3RFZB 2KTRB 3S15B 1L1OB 4XDCA 2YEPF 4C2MB 2F0EA 4KGSA 5G3LF 4EQOA 4WJNA 4AOFA 1I4GA 3AEBB 4XYCA 3SK5A 2NVQH 1XMQL 1Z7TA 2NVQB 1WYWB 2IGDA 4MNOA 5GAGC 2RDGA 5A35A 2NYZD 3NELA 2K5PA 4FXGC 4RFBA 2WHIA 4YXDB 3V61A 1UEBA 4YWKA 1LTBD 1SDFA 3NZ3A 2MBQA 3D31A 3QAQA 2SDFA 1PH5A 3B6YA 5D94A 2IJ0A 1LT5D 2KHJA 4LF6L 2LHEA 3BS1A 2OF1A 1NEKB 2LWPA 3VUWA 3L9AX 1WM2A 2K5VA 4WJ4A 3ULLA 3ZNGC 2RHSB 1WYDA 1SE3A 1FNUA 2JA6H 4C1NI 5KHQA 3OWEB 3HGBA 1Y1WH 2WS3B 5HGQA 3I4MG 2JZPA 2CJNA 4PS7A 5AZGA 4F8CB 2LRWA 1N33L 3BJUA 2B29A 1O7YA 1LM8B 2HQLA 3HRZC 2PMVA 3R93A 1QNKA 3WANA 2K39A 3VR3A 5AJ3Q 2RA4A 3NTHA 5KHOA 5LHY1 4DUZQ 5CV6A 5M3MG 1IBXB 4IOCA 1JJGA 4AWJA 3R66C 2Z6KA 3DCGA 4DV7L 4H13C 3DOWA 1Q86C 3W1SC 5GMVA 1N63A 3R2IA 3OYYA 2LGDA 5C44B 1L0VB 1LACA 4FXDA 2HDMA 1RKNA 4HIMA 4L5RC 3L13A 1SLJA 5G55A 3OJ4B 5E6OA 2MO0A 3VR5A 1B1ZA 2X69A 1VS0A 2EJGC 2W82A 4KHZA 3G71A 3Q8AA 4BY7B 3ZIMA 3CWIA 4JBWA 1XMOQ 2DZJA 2Z0EB 1I42A 1YQ4B 3SVMA 4OZCA 3LXFA 4HAEA 4KIKB 1AEXA 1NBFC 1ICWA 2Q2HA 5C3EG 4KZCA 3NHHA 3GTGB 4R8NA 4G3XB 5M3FH 4KHPQ 1EWCA 1V86A 4LK1C 2LGSA 1STHA 3I70A 2UUBQ 2DAJA 1BBWA 2RCFA 3UI2A 3ALBA 3AE6B 4IN3A 3TRZA 3ETRA 2OT2A 2JY6A 4WQMA 1BUIC 3K81C 3NS1A 4LW1A 3SK6A 3HOYH 4TMAB 1G2TA 2ENBA 1IXRA 3AE8B 3NHEB 3Q69A 1DZ1A 4YSYB 3SR6A 3ZQ4A 4ZAIA 2VH2A 2NN6H 5E4WC 3K5MA 5IP7H 4BY1G 4B3RL 2O2VB 4JPBW 1TKEA 1QKZA 4R4CA 3QJZA 2EJMA 3L0OA 5IGBA 1MD2D 1SE9A 4RGTA 4GOPC 3J9CA 4BBNF 5EKKA 1HEZE 4KSKC 2HQEA 2E76C 4KX6B 3DWQA 5E6JA 3NY5A 3U52E 3CHBD 2PW7A 3BZDB 2IWHA 3VA7A 2OTLA 2X38A 4IG7B 5IWAQ 3UQBA 3ECIA 4DKAC 4A3IG 1ML0D 2XWJB 4JI5Q 4MEMA 1DJRD 2L76A 2LMCB 1XTDA 1E8YA 2IL8A 4A3KH 4A3KB 2DZIA 2DZKA 2L5TA 4GOCA 2E2HH 1SBBB 1Q3LA 4GN5A 5I9PA 1WZ3A 2JWZA 3EROA 2IHFA 4JI2L 2KDIA 2F0FA 4IUTA 4KKJA 2BT6A 2RHQB 2JN4A 1TKYA 4A3DH 4IUPA 2K8CA 2MHJA 1K8RB 1DYQA 1SJHD 4RMFA 4JI4L 1J7CA 2WP8J 1QZHA 4MZ9A 3VDYA 4A3BG 1D3ZA 2LFNA 4YL8A 1E10A 1HQMC 3E5SA 4A3MG 3QA8A 1UWVA 2WACA 3AMUA 1QOBA 1DOXA 1S5ED 4ZCKA 3S16B 2F0HA 1Z5SB 5F2DA 2O6VA 4CDDC 1VCBA 3CCSA 3PRPB 2GLSA 3ABVB 5E3FA 4YWGG 4XYOA 4MHEA 3FPUB 3VTWA 2LSSA 1TBEA 1MJEA 3M4PA 3HRDD 1NUCA 3Q8BA 4ZYNA 2PW5A 4L23A 4IQZA 3EA6A 1PFBA 1VMCA 2ICEC 3D6WA 3DBLB 5BN3A 4A9AA 4FF3A 5ELEA 4B9XA 1PV4A 1E7VA 2IO1B 2H89B 3AYHB 1SB3C 2NR2A 4ICUA 3ZJUA 5LLIA 3U4EG 2A6EC 4A3FB 3BDOA 2F0OA 3EFCA 5H8YE 4DV3Q 3I8ZA 2HD5B
chains in the Genus database with same CATH topology
1K52A 1YQ3B 2TSSA 2CHBD 1JWAD 1STGA 5JEAG 3HOUB 2ACZB 2AUKA 2B2YC 3A7AB 2WXFA 3A55A 3AECB 5CV9A 4ME5A 1R4QB 3QWNA 5C5MA 2PZWA 1ZPSA 2M9VA 1TWGB 1PTOC 2K33A 2KECA 2WKDA 4H2AA 2QKIC 4IFDG 1A15A 1HPCA 2WXRA 4NZLB 3HZXA 1FRDA 2KJXA 5M5YB 3SR1A 3A8JE 1E9MA 4YSZB 5IGEA 2WU2B 2PW9A 3TUOA 2L12A 2FINB 1JQ4A 4O42A 1F2ZA 1BUVT 2E74C 1X3QA 3H3VC 2YU9B 1N62A 1JORA 2E6XA 1GB1A 2JU6X 2DN8A 3AB9A 1BOSA 2EKIA 5FOBB 3S1RB 3I3CA 2XVSA 5ELBA 1LT6D 2F0IA 4QIWB 4RHRA 2JXMB 1C8CA 2KA7A 2NVXB 3IAM1 4DF7A 2L11A 2NZ1D 4A90A 3UI3A 1IL8A 5M3MB 1CQVA 3WDNA 4KJOA 1RHPA 2WXNA 4OHJA 4US8A 3K58A 1BQQT 2HUGA 3N52A 3M3YB 4ZYSA 4XQNA 1VZ8A 5DAUA 2J42A 2RKSA 3N9YC 1GUWA 1KH0A 2EY2A 3H6MA 2RBMA 5C3EB 3V96A 1XYIA 2B76B 1G291 1H9SA 4MM3B 2A68C 1TQOA 1UWMA 1SNOA 4REZA 1V1PB 1PTOD 4C1NK 2CJOA 4YIJA 5BMHA 1UEAB 4BY1B 1HZ5A 3NTKA 1ZXTA 3NSWA 1T3QA 5AUIA 1PTOH 1PTOB 4O1NA 1EL0A 4IUQA 2QJLA 1N5XA 4LAAA 3U9OA 4A93B 4IOIE 2H88B 3GO5A 4A3IB 2XSCA 3D4RA 1V8QA 1HXYD 2PIAA 3NQTA 1KAAA 1SNQA 1STBA 5EJWA 4G7ZC 1Q10A 1E0ZA 2XWBB 4KTAA 4RF1A 1LTAD 3I90A 1EY5A 3MXNA 5J39A 4A3BB 1EQVA 3S2HB 5C0XJ 1K8OA 4KKTA 4USAA 2K5DA 1SMYD 1TS2A 4JWSC 3TDQA 3PUWA 5E4XA 1DOKA 5IODA 1BNZA 3S2DB 4RCOA 1A6XA 1I4HA 1RODA 4HSVA 3MP9A 3SE0A 5J1ZA 1PGAA 5BN4A 3BVGA 2KQ4X 1ACCA 3T13A 2VB3X 3MEHA 1DGJA 4WAFA 1F9PA 1HTLD 3NWSA 3MXPA 1A3VA 1F2RC 1BXTA 4ZK9B 1MBYA 2WB1B 4FF1A 3H91A 2R93B 3K6OA 1VMPA 5IOCA 2D9UA 4KGTA 5JEAH 1EIHA 4IALA 5C4XB 1SYGA 1QQRA 4TRDA 2VZKD 4G7HC 5HG2A 1IGCA 3MHZA 1H9KA 2B2TA 2YYZA 1QCBD 2DNCA 2FFKB 1I7HA 4HR7B 4CKBA 1WD0A 1I4RA 3S1QB 1TR5A 2I46A 4GDLB 1RD9D 2MP1A 4P6VF 2EY6A 4JWUC 4HMIA 4IFDH 1VLBA 4Y7NB 1J7AA 2IX1A 3MZ5A 1L6VA 2R6GA 2K22A 1FMAD 1QE6A 1CJEA 1TKGA 2A73B 4DK0A 1F2YA 5HGTA 2WDQB 4LK0M 3RLFA 4ZHOA 1H9RA 5G5HA 2O5JC 1RCVD 3WOEA 1CM9A 1WSPA 3NUHB 5DM63 4C7ZA 4HTHA 3P20A 5IGDA 3E56A 1EY4A 3P4PB 2M19A 3DWGC 3TEWA 1Z47A 2WNMA 5EE3A 4NDXA 1BCPC 1HA6A 1FXAA 1JW9D 3PO3B 3J81L 2B2UC 1IGDA 1WVLA 3W9CB 5C3JB 1H9MA 2GA4B 3QB3A 4RKBA 4ZUIA 4FNFA 2BOSA 4DAPA 3J7AF 1ESFA 3DUZA 1VDVA 1WTRA 4RA8A 3LWUA 1CZPA 5CORA 1F9SA 2EDGA 5I2XA 1SNMA 1BBXC 1B4OA 1D2BA 4FXCA 4WURA 1B3AA 4ZKBB 5NUCA 3URYA 4NJCA 3BK1A 1EY8A 2KN4A 1DOYA 5CYUA 1CK1A 4B08A 3PZ8A 4RHSA 1AZQA 4WWMA 1ZYRD 4QB4A 1EU3A 1LT4D 4KV6A 1PZJD 5BYRA 3K57A 2FHTA 1F2LA 3QJYA 2LEKA 1DOLA 2JA7B 4M0WA 5T1IA 2YEPB 2LS01 2CW0C 2FE8A 1FO4A 1KNEA 4C3IG 4ARIA 1OXXK 3HOWB 4QF4A 3OSOA 3P1MA 2NN6I 4OO1G 5KNCA 2XRSD 2J0TD 4G57A 2EYJA 4C7YA 1ZE3D 2F0SA 3LB8C 1XEEA 4KD4A 4A8XC 1R4PB 1MI0A 4ARCA 1PDXA 5IIFA 1P7FA 1KABA 4L8JA 2F3VA 2KUMA 3FEWX 1EYCA 5D65A 1FFVA 4ZOHC 1SYEA 3M7GA 5C6AA 3EQLC 1KDAA 2J7ZA 3HOXB 2R92B 2EXZA 4XE0A 1SNDA 5JPMC 2QILA 3VYUA 3M7NA 1XO3A 4XWWA 3NBIA 4BBRB 3BK2A 2PKOA 1WTXA 1TKWB 4HEA1 2B2VA 4CHTB 3RZOB 3DXJC 3AE2B 3BYYB 1NCVA 2AUJD 2K3UA 1MHHE 2G9HD 3I4LA 1XWEA 3QIAA 5I2YA 3GTJB 2F3WA 1TJEA 2IGGA 4HKZE 4F88A 4BA1I 3LWEA 1F9RA 1LTID 5I4DA 2MJEA 1SXTA 2XNAC 2A69C 3KLSX 3GD7A 5MPOA 1Y56A 1YNJC 4OVZA 2HCIA 1SNCA 2RDFA 1ENFA 1EYAA 1AZPA 3Q8EA 4P16A 2MGSA 1DCZA 3R3OA 1LLRD 2CW0D 1P7EA 2NUCA 2PLPA 2W3SA 2RQXA 3KWLA 4FF4A 4K8IA 3TZUA 2KWDA 2JSOA 3FILB 1VF7A 3NBHA 1RTOA 4KKIA 3EJIA 1UGJA 1CFMA 2WINB 3DWPA 3TP5A 2IX3A 5D3IB 4MN3A 3VA5A 3AE3B 1O7LA 1GHKA 3DWMA 3KUPA 1BCPF 4JK1C 3E0JA 4IZ8A 2JE6I 5AFWA 1GAQB 2PTLA 2VNUD 2E3TA 4CKEA 5TSSA 1I4PA 4V0BA 1K53A 2WV6D 1NSNS 2F0DA 1QOHA 2F0KA 1V97A 1C77A 3I72A 3P4SB 3RMHA 3K5NA 1C4QA 4AYBB 1PGBA 4DA2A 1ROEA 3BG3A 5EGTA 1EU4A 2F0VA 3U7ZA 1PZID 1QOGA 1G2SA 4HCEA 2L1AA 4OL7A 1L5PA 1AFPA 4M1UB 5BMGA 1E6EB 3OOCA 1NR2A 2Y0SB 4TQUS 4NW2A 1FR3A 5C3WA 3B2FA 2RSOA 3IT4B 4RF0A 1YNJD 1TIID 2WXPA 3ZJTA 4F87A 4HMJA 1QOFA 2WXMA 2WXQA 2ICIA 3Q8FA 3DMUA 4MT5A 3TP8A 1JCKB 3CIRB 1ET9A 4R3DA 4DK1A 3R2TA 1EY6A 4KK7A 3U9SA 2M0AA 4C3IB 3T3NA 3SFEB 4CJ2C 5KGUA 4HN7A 4NMZA 1D5ZC 4KHVA 4OO1H 2W54A 2ON8A 2WXLA 3VR2A 2KHSA 2B2WA 4K8JA 1Y1VB 2CVRA 3L3OC 2L52A 1CA6A 1IUEA 5ELCA 3CRKC 3MFGA 1DD2A 2Q8RE 1S5DD 2BTEA 3Q8CA 3L7ZC 4ID6A 2X6LA 2MEKA 3A7LA 1LO5D 4G7OC 1C9FA 3CU7A 3T16A 2O5IC 2QIEB 1KDBA 1TWHB 1TY2A 1TS5A 2KEDA 1XXGA 1VCIA 3M4OB 3DEOA 1XLNA 2PQEA 1O80A 1FCLA 3I4NB 4JX1C 1ENAA 3I57A 4U673 2V4DA 2LJIA 1EY9A 4KI0A 2KVMA 2ONQA 2OEOA 4ODGA 2KCNA 2K5QA 2SEBD 5EPLA 2DY7A 3CKIB 2N9LA 4HKQA 1VZ7A 1T6BX 4CBVA 4A3JB 3T3OA 4C56C 1FFUA 1FCCC 3X3MA 1PZKD 3J81E 2EYLA 1GPXA 3FDTA 3KBXA 2SNMA 3IAYA 4ZLTF 2L83A 4KN4C 1LTTD 3W3AA 4H7BA 3D6CA 4J8QA 1JR0D 3FPPA 1EQTA 5CBAE 4ZRZA 5I6WA 2BYTA 3PV0A 1LT3D 2FMMA 3NWTA 1TYGB 5KEEA 1XCQL 2G1EA 1PGXA 4EVOA 1UUPA 1C4PA 4QUCA 3SHLA 1QG7A 1FGBD 2IGHA 4IFDI 3GTQB 4K6DA 2KDMA 3GQBA 3M4YA 2RPVA 1CZGA 1PUTA 1PDQA 2A6ED 1ZUD2 1VR9A 3Q6SA 1JWMD 5JXVA 4L63B 3SFDB 2D62A 4ILWA 5CMDA 4KKUA 3S9WA 1G91A 1VZ6A 4C80A 1CTMA 1WYGA 4G4KA 3HP3A 2WXHA 2C9OA 5J22A 3V05A 1L0YB 3AEFB 3IFDA 3S1MB 4YTPB 1ZP0B 4HJGE 4Q0FA 1J9OA 3AU7A 5LL6X 1GJXA 4NAMA 3ERQA 1IW7C 5EPKA 2WDVB 5LL6S 1MSGA 3WOFA 4DFAA 2BW2A 3C46A 5CV7A 3ITPA 3VYTA 1WD1A 2NB0A 2L4NA 1HA5A 3GS2A 2VXWA 4WIPA 2OHFA 5HHDG 1GXDC 5KIXA 2QCPX 3VR8B 1QOAA 4ZKCB 2JX5A 1T5EA 2B8GA 3P63A 3HOZB 1B2TA 3SK4A 1F2RI 4OZAA 1HUMA 3FRPB 1IKMA 5KYIA 1NYQA 4DAYA 4A3EB 5JVH3 3TEZA 3IL8A 4DXFA 1VF5C 1PFDA 2W55A 4XXEA 1F77A 3NPPA 1QLBB 2KQ3A 2DBYA 1JOKA 3AE9B 5CV4A 1HHVA 4LJZC 2Q8IB 4EGVA 1KF6B 2EELA 3A8IE 1GB4A 5I9OA 4RCNA 4DAVA 3K59A 2V3NA 1QILA 5K36G 2JP1A 4OW0A 3H94A 1R9TB 1Y8OB 5A2QL 1TS3A 4B0MA 2NVTB 3Q24A 1D5XC 2WU5B 1GUSA 4DNTB 1E2ZA 1A2TA 4LMQD 1ZDXA 5D7GA 2HCCA 5KRUA 2F0MA 1OXTA 2E2IB 3H8HA 1Q12A 2LUMA 2WXKA 1V8CA 4JPSA 3OPOA 2AQ1B 4B9WA 3KLSA 3PO0A 4WJWA 2A68D 4IURA 1CI3M 1U4PA 2V3PA 3F2UA 1JC7A 4B0EA 3MJ5A 1VDZA 1OXVA 2G9DA 1RDPD 2N88A 3NK9A 2K6AA 3FKIB 4PT5A 2A6HC 1BF4A 3BYTB 2AQ2B 2NVYB 1RYJA 3ZJVA 3KWVA 3NTIA 2NTSA 4KMUC 1SFOB 3DEPA 5DNFA 1OQRA 1B53A 4XYQA 2PVOD 3K5OA 1EY7A 3NVYA 4IUVA 3BVMA 1C78A 2JXTA 3K5LA 1U4MA 3P42A 3GTLB 3HVDA 4J3OD 4CJ0B 1DM0B 4NP5A 1MGSA 3NVWA 2LFIA 2R3ZA 2F0GA 1GHJA 3OHXC 1OQQA 5FO8B 1GUTA 4WFN3 3LNNA 3FAHA 3NE5B 5IT9L 3P4RB 2WXIA 2B63B 2IDYA 1M4VA 1JB3A 4IUUA 3KLRA 1WWTA 3AB5A 4HCSA 5C4HA 1E7PB 2EYOA 1HCZA 1IBXA 5FKAC 1KRHA 1C4AA 3NUCA 2Y5CA 3HS0C 3GV3A 1STYA 1F9QA 2K32A 3I9V1 2CU3A 3PUVA 4K5VA 3PUYA 1EIGA 1I50B 5CV8A 2ZT9C 2FJ2A 1XF5L 3A54A 3GV6A 5FLXL 5CGKA 2BE5C 3DWAA 1C79A 1X3PA 3VYRA 5D14A 3EGRA 4ZHPA 4RGOS 1JOOA 1SYBA 2B2TC 4ABNA 3U2SC 1O78A 5EKLA 1H9SB 2WAQB 1YN4A 1Q1EA 1CQFA 5IGGA 2VUMB 1NYRA 2MPMA 2WDRB 1B9RA 3TBIB 1PLFA 5G3LD 3LYYA 4YTNB 4CGYB 1SE2A 1MSHA 2EVBA 5JOBA 4FO2A 3ZYYX 4CKCA 4PMCA 5EBDA 3S14B 3NRZA 2PPBC 1SNPA 3C2PA 2LMCA 5C0XG 2KOLA 2Z8LA 3P75A 4GZYC 1S5BD 5ELDA 2D5GA 1JICA 1KDCA 3ND9A 2DYMA 3V2TA 5HURA 2MUYA 5EBCA 3SK8A 2L55A 3CQZB 3NXWA 3S17B 1HZ6A 2N0SB 5C3XA 3AMZA 2WXJA 3ONAB 3HOVB 1N60A 2H1EA 4YSXB 2DY8A 3PUZA 3R8BA 1W6KA 4XT3B 4V190 3QOJA 1I6VC 2O4XA 2DLBA 1SYCA 4WH4A 3RD4A 1NI3A 4XDDA 2NWGA 1B50A 4TQ1A 4GLSC 1S5FD 3Q23A 4R9WA 1BCPD 3QG1A 1VRAB 5K36H 1HTPA 4FF2A 2Y3AA 2K1BA 2Z4HA 5JJZA 3DM1A 1HRJA 1BCPB 3BVZA 1RTNA 1KTKA 3W1SA 2J4XA 3BDLA 2ZW0A 3SEBA 2F03A 4OO1I 4UDUC 2XN9C 1QWYA 1XTCD 2AQ3B 1SYFA 4PV1C 2EY5A 1UNSA 2F0NA 1TS4A 4L6TB 3ZGZA 1Y8NB 4XQJA 3L4PA 2E75C 2O2LD 3IKJA 2JYOA 2WXOA 1STAA 3BIID 1FYCA 3GTPB 3OIQA 2FMCA 1C4CA 3VYSA 1D4BA 4K5XA 1XLQA 1D1KA 2A5HA 4YTMB 5ELFA 1RWSA 5DM73 3MVVA 2PCFB 2HTME 4U68A 1MHXA 1G8ZD 1U9RA 1XX8A 2OEDA 3FMCA 4H0LC 3HUIA 1TY0A 2V0GA 5BYSA 1PRTF 2WQYB 2I2YA 1BMLC 1EZ8A 2N55A 1T5XD 1EWYC 3AN1A 1SSNA 3AE7B 5FO7B 3KF8A 4X3TA 2F0TA 3PUXA 1A3UA 1J8IA 2EYHA 1HFNA 4IFDJ 2K03A 3P7JA 1FD6A 2QF7A 3VR6A 2K05A 3TP6A 1F0ZA 1NVID 1LTGD 4NKLA 2JEAI 4BWGB 1CT1D 1I4XA 3N6RA 1AN8A 2K28A 2Q8TA 2BDOA 4IDIA 1TT2A 4HEDA 2JA6B 1HFGA 2I07B 1D1IA 1Y1WB 4KY6A 4ZQ3A 3HEJA 2K7VA 1PYWD 2EOTA 3J80L 5BN5A 2M2LA 4XIGS 4RWSC 5JPNC 3C1EA 2N9KA 1K51A 2Z4IA 3TP7A 4KY5A 1HUNA 1K83B 5DEHA 4BS9A 2LHDA 1E0BA 2WXGA 3FVQA 3E9SA 1FM0D 1JWSD 1WCMB 1L4DB 2LY7A 2BBCA 2B2VC 2F0JA 2B2YA 4Q2JA 4N9PA 4UAIA 4TSSA 5M3FB 1B44D 1PFNA 3BDCA 1V1PA 3JAML 1EFID 4F8MA 4A3GB 2WP9B 1DOMA 1IYVA 4X3SA 4ITKA 1XCTL 3AEDB 2A69D 3HOYB 3MAQA 4A55A 5A2QE 4J6HA 5CBEE 3PIO3 4D2KA 1WTPA 3J7YW 3AEEB 1EYDA 1E2VA 3M85A 1ET6A 1IKLA 3SXHA 4X3KA 1C48A 3PO2B 1EY0A 2SOBA 2QDBA 3VR4A 3FC4A 1QJOA 5C0XH 1L0XB 3AH7A 1STEA 2X6GA 4C3JG 5EKIA 1SIJA 1RF2D 1LTRD 1N61A 1WTQA 2E2HB 2K04A 2EYMA 4GDKB 5T1GA 1S5CD 5M5XB 4A3DB 2JWUA 1EEFD 5E1FA 2N7JA 1LV9A 1DONA 1CHQD 1UAPA 1JWBD 4PNYA 3MC0B 2J52A 1OFFA 1I3QB 2Y5PA 1WXQA 1DOIA 1TWAB 3IFTA 1SEBD 2B8FA 5ISRA 2QSDA 1SE4A 2F0PA 5CC4A 4RNAA 1PXUA 2M00A 3W5UB 4CJ1B 5FR3A 2KCCA 1YJJA 4PMWA 1JQYD 2JQRB 2INPE 4CQNA 1ZKOA 2CQAA 2ZXPA 1BDOA 5IT9E 1YN5A 1TWFB 2BS2B 1WTWA 2AWOA 2IPKD 2JEBI 1YJIA 2ZXRA 2QMTA 3Q22A 1JMLA 2V4IB 3OIPA 2VB2X 5IGFA 4BBSB 3H0GB 2PMZB 1NAPA 1SYDA 5GXGB 4HRSA 4RAUC 1MPEA 1CZWA 2MJ8A 4KD3A 2J53A 5HFYA 5BMIA 4HROA 2PZTA 4N6EB 4AS1A 5C4JB 4TQ0A 5EPJA 5FLXE 4DN4M 2E2JB 2XIWA 2RMMA 4K2LA 1SJED 3TEXA 5JVG3 3AM9A 2C5CA 1L4ZB 1WTVA 2SAKA 1OO9B 3I91A 3T53B 4RKLA 3HVZA 4NAWB 3NP8A 3EFXD 2B2WC 1D5MC 3GB1A 1LABA 3VRBB 2XRQD 3D4WA 5FK9C 5C2TB 4MIUA 2PYKA 5FO9B 4EQNA 2L32A 1PFMA 2EYFA 4LTUA 1JE4A 4RGMA 1SMYC 3KBGA 3I4MB 2WIIB 3T51B 1F2MA 1D6EC 1ZOYB 1Q8IA 4DNRB 1EM7A 1FRRA 1XLOA 4DGZA 4MH8A 1Z6HA 4XT1B 5KNBA 4Q5VA 2Q5WD 2EZVA 5AUKA 2L1BA 3B2GA 1OXUA 1SAPA 4R8IA 1QF6A 2HDLA 3TMEA 4C3HG 4P2CB 2K01A 4FXKC 5H92C 5EE0A 1PMRA 2R61A 2BCOA 5KNDA 1R7SA 2KAJA 4JE3B 4X3UA 5C4ZA 3AE4B 4L1BA 1X32A 5HI1A 3D8GA 2ID0A 2EY1A 1B9NA 1ZXHA 5EE1A 1S4ZA 4N58A 1U4LA 1Y8PB 2HDEA 2WKCA 1NENB 3NVZA 5D3DA 3W2DA 1FEHA 1JWUD 2D2CC 2GB1A 1TWCB 1FXIA 3QOLA 3D4DA 1BO0A 2AX5A 5CR3A 1FNWA 3HKZB 1H9JA 4XTCS 5BYQA 1GUOA 1YN3A 1WRIA 4PMBA 1W6JA 3KK7A 1G6ZA 4ZUJA 4C3JB 2NBFA 4FVMA 1SF0A 3C8YA 1JRPA 1ONLA 3A8KE 2JYTA 3AE5B 1ZDVA 3LX0A 2MH7A 2JA5B 4KY7A 5C5LA 4OIKA 1I4QA 5CV5A 3DHQA 4US9A 2KEEA 5KYLA 4KGRA 4K14A 1A70A 1UWXA 3MTSA 3EVQA 2EE1A 4K6LA 2BA0A 4Z9CB 4A3MB 4EQPA 1C76A 2IT1A 2F0WA 3NVVA 2BS4B 4KN7C 1ILPA 4N9TA 3VQIA 3X3NA 5I6YA 4E6IA 1EZ6A 2H4OA 4I65A 1DXMA 2IX0A 4QCLA 3MXGA 1V1OA 3OW7A 4OZBA 3AEAB 3OWFA 3OMCA 3BWUD 4N59A 2B2UA 2SNSA 2K9XA 4DQOC 4J1MA 2GRIA 3C3LA 4KJNA 3P4QB 2Z1CA 2INNE 1IW7D 1K50A 4DU9A 1K8MA 3IXSA 2NTTA 1CHPD 1JROA 1B9MA 3PMFA 4ZRQA 4H44C 2JSVX 3CRLC 4XWTA 1YMHE 2I38A 1FNVA 3VRAB 1FD7D 3J80E 1PTOF 3SDZA 3GTMB 2VZKB 3VR9B 2GI9A 2JA8B 2QEJC 3K7AB 1KLGD 4K5WA 3PIP3 2MJ3A 1PRTC 2K0PA 5IGCA 1ZYRC 2M56B 2OXPA 2ZXOA 4RH6A 1TVXA 1Q90A 1A2UA 1LTSD 3TSSA 1XLPA 2DYOA 3OMGA 4QUFA 3FILA 3T4AC 1IYUA 4ULLA 3A56A 1AYFA 2RDHA 3JAME 3V3XA 1AWDA 1WTOA 1RM6C 1NR4A 1GOZA 1FIQA 5LNK1 1KLUD 2AWNA 1VJKA 2JYEA 1RJTA 2F0LA 1YNNC 5M9OA 1ENCA 4XDXA 2PO4A 1ESRA 2PZUA 1HQRD 2D5DA 2PNRC 2E2DC 4LLGM 4TKOB 2TMPA 1U4RA 2RVLA 1EWHA 3PZ7A 1TZOA 4MACA 4RGNA 2DNEA 2BB6A 3RPFC 3GP7A 4I7ZC 2RSNA 4IUNA 3TN2A 2R7ZB 2F1MA 2B39A 3B9JA 3I73A 1WGKA 4S3SA 1N5WA 3W5VB 2LKVA 3D3RA 2KACA 4C3HB 2MHVA 4QMGA 5COYA 2PVGC 2MJDA 1STNA 2A6HD 2NN6G 3IT6B 5JAVA 2F4IA 3GTOB 4YT0B 5EE9A 3G6JB 2WLBA 1QNUA 3O13A 1BR9A 2L9HA 3RUZA 3Q0AA 2FUG1 3P1HA 1II3A 1TU2B 4BA2I 1E2WA 4WORA 3HG9A 3H09A 1ZEQX 3MWYW 4IKGA 1RFKA 1PRTD 4XQQA 4ZRPA 1GUGA 2K5WA 1QT9A 1PRTB 4M8AA 1QB5D 2F0QA 1O7ZA 3WCQA 4DXGA 4A6QA 2W3RA 4OGQC 3MA2B 1A3TA 3J7AV 4WRDA 3NQIA 1CA5A 5M5WB 1I6HB 1J7BA 1EOTA 3C1FA 1SSOA 1ZXIA 1AW7A 1MI2A 3MXUA 3TEYA 1AP0A 1OXSC 1YNND 2EJFC 4FYDA 1MVKA 3ND8A 2IW3A 1YNTE 1Q1BA 3AE1B 5C0XI 2A74C 2BDNA 3AV8A 3MFYA 2NMQA 3KQ4A 3E6ZX 2L0CA 1EEID 3T56B 3GTKB 3AEGB 4OIJA 2BE5D 1JALA 4KKSA 2EPBA 2F0UA 2EYPA 4F7XA 2FBWB 5T8IA 4K2KA 3EUB2 1IHZA 1KFYB 1M8AA 4AQ7A 4FP5D 2BA1A 1Y69U 3QO2A 4EE2A 1GUNA 3TZDA 3S1NB 1L6UA 3IAS1 5K5PA 1KNAA 2ZW1A 3G7LA 2LGIA 2BS3B 4HSPA 4L2YA 4PQXA 5JEAJ 2KMMA 5G5GA 3K0YA 1V43A 5EQ0A 2BB5A 2DWQA 1JOQA 3MHBA 1ILQA 3RZDB 3RFZB 3S15B 4XDCA 2YEPF 4C2MB 2F0EA 4KGSA 5G3LF 4EQOA 1I4GA 3AEBB 3SK5A 2NVQB 1Z7TA 2IGDA 2RDGA 5A35A 2NYZD 2K5PA 4FXGC 4RFBA 4YXDB 1LTBD 1SDFA 3NZ3A 3D31A 2SDFA 2IJ0A 1LT5D 2LHEA 3BS1A 2OF1A 1NEKB 3L9AX 1SE3A 1FNUA 4C1NI 3OWEB 3HGBA 2WS3B 2JZPA 2CJNA 1O7YA 2PMVA 3HRZC 3R93A 1QNKA 3VR3A 2RA4A 3NTHA 5LHY1 5CV6A 1IBXB 4H13C 1N63A 3R2IA 5C44B 1L0VB 1LACA 4FXDA 2HDMA 1RKNA 3VR5A 1B1ZA 2X69A 2EJGC 2W82A 4KHZA 3Q8AA 4BY7B 3CWIA 4JBWA 1YQ4B 3SVMA 4OZCA 3LXFA 4HAEA 1AEXA 1ICWA 3NHHA 3GTGB 4R8NA 1EWCA 4LK1C 1STHA 3I70A 3UI2A 3ETRA 3AE6B 4IN3A 2OT2A 4WQMA 1BUIC 3NS1A 3SK6A 4TMAB 1G2TA 2ENBA 3AE8B 3Q69A 4YSYB 1DZ1A 3ZQ4A 3SR6A 4ZAIA 2NN6H 5E4WC 3K5MA 1TKEA 1QKZA 2EJMA 5IGBA 1MD2D 4RGTA 3J9CA 5EKKA 1HEZE 2HQEA 2E76C 4KX6B 3DWQA 5E6JA 3U52E 3CHBD 2PW7A 3BZDB