4JIOU

Bro1 v domain and ubiquitin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
75
structure length
75
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKMKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRO1
publication title The yeast alix homolog bro1 functions as a ubiquitin receptor for protein sorting into multivesicular endosomes.
pubmed doi rcsb
source organism Naumovozyma castellii
molecule tags Protein binding
total genus 13
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4jioU00
3T9LA 1WY8A 4NPNA 3PTFC 4J6IA 4K7UA 4NJ6A 3DCGA 1KJTA 2D11A 4ANUA 2BPSA 3CF6E 1YX6B 3ALBA 3ONSA 3M95A 4IM2A 4M8NA 3ZLZA 3PZDA 5JH5C 2EMTA 3NOBA 3R3MA 3P2BA 4WJQA 4ICVA 3PLVA 1WJ6A 5LXIB 3PV1A 3VUXA 5G55A 2JRIB 2K6DB 1Z5SB 3PPAA 4ANXA 3WAPA 4M0WB 4EKUA 1V6EA 4GGQA 1V5TA 1G6JA 2KFJA 4BVUC 1WYWB 4IG7B 2JZZA 2KMAA 1U4AA 2JVCA 4G50A 4MH0E 2AL3A 1Q1OA 4AUQC 4IWOA 5AZGA 2C7HA 3PHXB 2KN5A 2LVPA 4G3XB 2L76A 1EF1A 2PJHA 3V61A 2EKEC 2MA9B 4II2B 3VQIA 1Z2MA 3EECA 2JUOA 2C5LC 3GZNI 1VCBA 3W1SC 1R4NI 4IWQA 1GJZA 4E74A 2Y5BB 2K1FA 3BY4B 4TUUA 4DHZE 4W9IA 1WF9A 5HKHA 5KHQA 3RZWC 4JIOU 4DXAB 1WX8A 3UF8A 4BBNC 3JYUA 4F7ZA 3KYCD 2LGDA 2NCNA 3L13A 5DPTA 4W9DA 4B95A 1GUAB 4ZRJA 3T8MA 5D2MB 2OOBB 3OJ4B 2R2QA 3PREA 3HIZA 4FULA 4W9HA 3LJ3A 4I6LB 4F8CB 4B9KA 4FADA 3NY5A 3WAMA 1RAXA 3KUDB 5CX3A 2KKCA 1ZW7A 4W9GA 3DBLI 3DVNU 4KSKC 3QA8A 3VVWB 4FJVB 3L17A 3L54A 1WGGA 3L0WB 4ASWC 1WM3A 4MSMB 1M94A 2K39A 3CSTA 4XC2A 4IM0A 4LJOB 4LJPB 2LVQA 3SU8X 2GMIC 2KLCA 4ICUA 3RCZA 3RZFA 1WXVA 2JT4B 2FIFA 2KTRA 5CTRC 1EO6A 3A1QA 4GN1A 4WWPA 3KUCB 1UGMA 3KVFB 2DYBA 4EFOA 2KTRB 1WXMA 3UIOB 3VUYA 3A1QB 4BFRA 2LWPA 4GB9A 2WDTB 1I42A 2RSUA 4HPLB 4JL9A 4ANVA 3QX1A 1MG8A 2JWZA 4BKGA 3A33B 3H9DA 1QZEA 1UELA 4FJZA 2K8HA 2AYOB 3H6NA 2MRPA 1TBEA 3KH0A 2MBEA 3JW0X 4KSLC 4TQ1A 2G4SA 5L95C 2ZJDA 4EUTA 3U8ZA 4KZCA 2UYZB 2KLGA 1WGDA 2NBUA 3ZIMA 5J2RA 2AEHA 2D2QA 3KUZA 1P98A 2V4LA 4IC7B 3UQBA 4HDOA 4WQOB 3PSEB 4DWFA 2LXAA 2KWUB 3Q3JA 4GIVA 2KNBA 3HM3A 4A3OA 1OQYA 4TKNA 3H7SA 1UZXB 2NBWB 5E6PA 4YL8A 2WWZA 2L0TA 3QAQA 4PYZA 1Q0WB 5C1ZA 1H8CA 2KDIA 1E8ZA 2I1KA 2KQSA 3IVFA 4XZ4A 3PVLA 4HPMB 4RM9A 2GBNA 2D3GA 3TJPA 4MELA 2FCNA 4EZLA 3CMMB 4K81A 1WR1A 3ZNHB 4PYUA 2ZCBA 2AWTA 3PT2B 2JZ3B 3APFA 2LRWA 2DYMA 2O6VD 3MHSD 1CMXB 4XX5A 1LFDA 3DBRI 5BO4B 5G2NA 4EOYA 2IO3B 1J8CA 3W1YA 4AOFA 5DPWA 4GSWA 3WIMA 4ZDVA 1L7YA 1WZ0A 2VRRB 3V6CB 2HE7A 3EHVA 1BT0A 3QHTA 4FN2A 4IUMB 2L3ZA 3ZVVA 1IYFA 2KX3A 2V3SA 3QWZB 3W1SA 3ZTCA 1WX9A 2BYVE 4PS7A 2J0KA 4ZRKA 1NI2A 1P9DU 1SGHA 2ZEQA 1E8YA 3AI5A 4KZ0A 2ZPNA 4I6NB 4WJNA 3UIPB 3TIXA 2KTFA 5IAAC 2A4ZA 2RR9A 4KV2A 2OJRA 3RT3B 2BKRB 3U30A 4BKSA 5JHBA 2N7EA 3TL5A 2Z0EB 3H1UA 5E6NA 3MJWA 1EF5A 5TR5A 3VUWA 3ZTDA 3TMPB 2PPHA 2NBVB 4GDKA 4F1SA 2LZ6A 1D3ZA 2FAZA 5JZEB 4JGHB 2JPHA 2L0FA 2N4FA 4HCPB 3H7PA 4A20A 4DHZB 2BF8B 1FXTB 4FLHA 2C60A 4GDKB 4G11A 3APDA 3RYTA 2BKFA 1S3SG 1WIAA 3H7PB 4WAAA 3TBLD 2LVOA 4NAWB 2WYQA 5DCNA 2O6VB 2M1MA 4DDID 4HLEA 1L2NA 2R2OA 3HM6X 4TV3A 2KK8A 2CR5A 1GNUA 2DZMA 2KVRA 2XBBC 2DENB 4LCDE 2C9WB 1UH6A 4AJYB 2DHZA 2CU1A 3PRMB 3PGEA 2NS5A 4E71A 3SHQA 5JHAA 2RGFA 3VXWA 4MGIE 2NVUI 1YIWA 3ENEA 3KW5B 4II3B 3NZSA 1E5WA 1GC7A 2PE9A 1SE9A 5D6JB 4OVVA 3V62A 2ZCCA 5CHVC 1WI0A 2EMSA 1WZ3A 4MGZE 1YQBA 2LJ5A 1NDDA 3CSFA 5CHFA 3ZW3A 2LUEA 2FUHB 1H4RA 5KHOA 1WXAA 1V86A 2DYOA 4DHJB 2UWQA 2MBBB 1WH3A 2K25A 1R4MI 4TQ0A 3DBHI 2LGYA 1V2YA 5AZFA 2K8BA 1GG3A 4W9KA 1PQSA 1OGWA 2DAFA 3I3TB 3RULA 1P3QU 3LDZE 3OJ3A 3WALA 4W9JA 3AU5A 2GOWA 4ZYNA 3JVZX 5FR6A 3ZDMC 2KANA 3IHPC 2I1JA 4N9F4 3ZNZB 3L10B 4JQWC 4KVGB 2KFKB 3QK0A 3ECIA 1TGZB 1F9JA 1J19A 2LRUA 4CHKA 2IY0B 4W9LA 5J17A 2CHXA 3K9OB 2L7RA 4LDTB 3K9PB 3IFWB 3Q3FA 2W9NA 3ZNID 4HJKA 4HXDA 5EDSA 3OLMD 2N9PC 2IYDB 4G0NB 2MBHA 3UGBB 5LXHA 2A5UA 4IM3A 1P1AA 3DOWA 2GBRA 2LI5A 1Q5WB 1TTNA 3A9JA 3N32A 4HCNB 4IWPA 3WANA 4K7WA 1LXDA 1VD2A 2B3AA 3A9JB 3VH3B 2ASQA 1XQQA 4HVBA 1WR6E 1J0GA 4B6WA 5D94A 4P7IA 2IZVB 2IY1B 4GDLA 2ZVOA 2GBMA 2HJ8A 1WJUA 2PEAA 1V80A 3B08A 4DDGD 2M0XA 2L05A 4NJ7A 1OEYA 3DPDA 3B1LX 2HD5B 2LXCA 1SIFA 3QARA 4GDLB 4M8MA 3ZUNA 2XK5A 1P0RA 2CS4A 2JXXA 2ZZPB 3A4SC 2BWFA 3ZNGC 2C7NB 2BYFA 4GOCA 1ZKHA 2WX1A 1RLFA 3UQAA 1OEYJ 2KHWB 1GC6A 3M63B 1OTRB 2DX5B 2XK5B 4I6PA 3SD5A 3ML8A 2MQJA 4E3CA 3DBSA 3HHMA 1UBQA 1X1MA 1WM2A 2KOXA 1WX7A 1YJ1A 3MTNB 5IA7A 5DPRA 3PLUA 4FJYA 3N30A 2FCQA 4FBJB 2Z59B 2KJHB 3D32A 1C3TA 2KDEB 5C23A 2MSED 2J7QB 2PE6B 4HDQA 1AARA 2IBIB 4NY0A 4MM3A 1RFAA 4K7SA 1KOTA 1HE8A 5D7GA 1Y8RC 3DQVA 2DZIA 4RMAA 3AXCA 1ISNA 1E7UA 2LGXA 5J18A 2L8JA 2KMCA 2LASA 2JF5A 1IP9A 2KWCA 1WRDB 1LM8B 3ZDTA 2ZNVC 2KO3A 3L16A 3PS6A 3SDLC 2JY6A 4W9CA 3RD2A 5AEKB 2KDBA 2V1YA 1WE6A 1NBFC 4WJOA 4FA6A 1JRUA 3GOEA 2KWVB 5CHWA 2WX0A 1WXSA 4DK5A 1K8RB 1WMHA 2IO0B 2KX0A 1TZ1A 4RM8A 4NQKE 2MBOA 4EZKA 2KXJA 3B0AA 2REXA 4EEWA 3C0RB 1WMHB 3NZUA 3X23A 2M17A 3TCAA 1UBIA 3QQ8B 2QHOA 3AULA 4NAWA 2G45B 2DZJA 4KDIC 2KJ6A 4MGYE 5L83A 1A5RA 2NR2A 2MLBA 4BKSD 5AZHA 2CHWA 4AP4C 4MSQB 3NS8A 2MW5A 3KYDD 2DAJA 5GMVA 3V60A 3VHTC 3ZRFA 2KJRA 2ZVNA 2HTHA 2N7DA 4BOZB 4CYEA 4WJPA 5E6OA 3DVGX 2LD9A 4KDLB 3HK0A 3ZKJC 3VTUA 2YVCA 3JSVA 2GBKA 3PHWB 3R7QA 2XEWA 2GBJA 2JRHA 2O2VA 2RPQA 3VDZA 3M3JA 3JSVB 2L00B 2D10A 3DVGY 4HK2A 3M62B 4W9EA 4URKA 2O2VB 2IO1B 2FCSA 1E7VA 3R7RA 2BGFA 2NPTA 3S2AA 3X0WA 2KC1A 4WWNA 1V49A 1WE7A 2AL6A 4W9FA 3U7DA 3APCA 2FIDA 2K8CA 2IO2B 4GXBA 3VH4B 2MX2A 1WGYA 3A9KA 3ML9A 2G3QB 2NPTB 4HWIB 2KFKA 3NHEB 4CO7A 4DHJD 4A3PA 1WJ4A 4JLCA 1WGRA 4BKTA 3A4RA 3EC8A 1WGHA 2KZRA 3A9KB 3PRPB 1I35A 2DZKA 3O65B 4PS3A 1E8WA 2MBQA 2Z0DB 4KIKA 2KC2A 3R66C 1UD7A 1KLVA 3DVNV 1T0YA 1ZGUB 2N1VA 3N3KB 3VTVA 4DBGA 2M8SA 4KIKB 2N9EB 3DDCB 3PRZA 2MCNB 3UINB 3IG3A 4AJWA 2J0MA 1WFYA 2RD0A 3WA0A 3VTWA 5LLIA 2YLMA 4MEMA 2KDFB 3BINA 4PS8A 4OVUA 4LDTD 1WJNA 2CHZA 2FNJB 4MDKE 4WWOA 3L08A 5DPSA 4ZRIA 2J0JA 4MGKE 3VFKA 3OAWA 1YX5B 2MP2A 1EUVB 1E90A 3ZRCA 4BOSC 2FCMA 4NQLB 2N1WA 2D07B 3EFUA 3QIJA 4ANWA 2MWSB 2KD0A 2MP2B 4GU2A 3ZO5B 2M4NA 1XT9B 4K1RB 3V6EB 3IBEA 4MJSA 1LQBA 2CKHB 3AU4A 4BBNF 4NNJB 1V81A 4MJSB 4FHKA 1XD3B 3QCAA 1RRBA 3QC8B 1S1QB 1YD8U 3VAWA 1KM7A 2KQ7A 3RUIB 2BYEA 4IW0A 4AWJA 2ZPYA 2ZNVB 2N9XA 3QJZA 1E8XA 2G4DB 1V9JA 3WAOA 2O6VA 4FHJA 4EZJA 2K6QA 1C1YB 1IPGA 2C7MB 4X57B 1V5OA 2BWES 4GMVA
chains in the Genus database with same CATH superfamily
3T9LA 3PTFC 1JWAD 3TEWA 2AQ1B 4US9A 1KJTA 4HPPA 4ANUA 2XN9C 1EU3A 1YX6B 2PIAA 3ONSA 1L0VB 2B76B 2LGIA 4M8NA 3ZLZA 5JH5C 1GAQB 3B2FA 1VDVA 1PGBA 3W2DA 2WXNA 3VUXA 3Q8EA 2IPKD 4ANXA 1OQQA 4DXFA 2LHDA 1V6EA 4GGQA 3BZDB 1WYWB 4IG7B 1U4AA 2JVCA 1MFWA 4MH0E 1NENB 2PMVA 4AUQC 3PHXB 4JWUC 4R3DA 1EF1A 2PJHA 3V61A 3I9V1 2MA9B 4II2B 4YWGG 1Z2MA 2JYEA 4RH6A 3EECA 1ZXHA 1HEZE 2C5LC 3AE7B 2Y3AA 2NTSA 2K1FA 2WXLA 1JQ4A 4JIOU 3L4PA 3UF8A 3MHZA 3DWMA 1GUAB 4K3BA 2OOBB 3BYTB 4B9KA 3KQ4A 2KKCA 1E7PB 4FJVB 3H8HA 1WM3A 2K39A 4P6VF 2LVQA 2J42A 2KACA 4M02A 1WXVA 1FCLA 2MEKA 1EO6A 3HVDA 3IAM1 3KUCB 4XWWA 2KT7A 3VUYA 4IDIA 2ON8A 2RSUA 4HPLB 4ANVA 2LUMA 3A33B 1DGJA 3NVYA 3H6NA 3GE3C 2ZJDA 4KZCA 2UYZB 1P7EA 3C19A 2W3SA 1FD6A 4WIPA 4WQOB 4YSZB 4DWFA 2V0GA 2KNBA 1JALA 1QLBB 5E6PA 5H8YE 2WWZA 3QAQA 4PYZA 2LFIA 2KDIA 1E8ZA 2I1KA 3PVLA 4HPMB 1AYFA 4YTMB 1FO4A 2LHEA 4MELA 4P1BC 3FAHA 3O13A 2ZCBA 2NTTA 3IT6B 4XX5A 4TMAB 4EOYA 2WXMA 1J8CA 3W1YA 1L0YB 3WIMA 3PO0A 2VRRB 1FFVA 1QQRA 2HE7A 1BT0A 3QHTA 3RI7C 3KLSX 1IYFA 2K0PA 1N61A 2V3SA 3W1SA 2EKIA 1WX9A 2J0KA 4ZRKA 2PTLA 1P9DU 3CWIA 2ZEQA 5BMHA 1XO3A 2WLBA 1I4QA 4WJNA 1YQ4B 3CIRB 2KTFA 3NG0A 5IAAC 4KV2A 5JHBA 1NI3A 5E6NA 5TR5A 3VUWA 4ITKA 2NBVB 2LZ6A 1XF5L 2FAZA 4JGHB 2V3PA 3H7PA 4IOIE 4FLHA 3H7PB 1WIAA 3TBLD 3EFCA 2RDHA 3BWUD 4NAWB 4DDID 4RF0A 2R2OA 2XBBC 4A6QA 2C9WB 1BXTA 4AJYB 2CU1A 1F2RC 3VXWA 3ZJVA 4MGIE 1E10A 3KW5B 1E5WA 2PE9A 4LNNA 1SE9A 1KLGD 3V62A 2K9XA 1WI0A 3AEBB 2HDEA 1SE2A 4DHJB 2MBBB 2K25A 4TQ0A 1V2YA 2L52A 5AZFA 2K8BA 1GG3A 1PQSA 3I3TB 3WALA 1P3QU 3W5UB 3JVZX 1YNTE 3ZDMC 3DBLB 3Q14C 1MPEA 1TKGA 4KX6B 3ECIA 1TGZB 5J17A 1NYQA 2BB6A 1MHHE 4HJKA 4HXDA 2N9PC 1UNSA 4G0NB 2MBHA 2A5UA 1P1AA 1FNWA 2JU6X 1LXDA 3RNAC 5C3JB 1XQQA 2YEPB 4HVBA 4GDLA 2L05A 3B1LX 4GDLB 1V97A 3ZUNA 2V9HA 2JXXA 1DOXA 1ROEA 1ZKHA 1C76A 3M63B 1GC6A 1OTRB 4E3CA 3DBSA 4MACA 1ZUD2 1C4PA 1WX7A 1YJ1A 4PK1A 5DPRA 1HZ5A 2Z59B 3D32A 2KVZA 2KDEB 3ZXVA 4HDQA 1E0ZA 1AARA 2IBIB 1KOTA 1HE8A 3MP9A 2I2YA 3AXCA 3N20C 2LASA 2KWCA 3P4PB 1TS5A 3PS6A 4C7YA 4YSYB 3VR9B 2V1YA 1JRUA 1WSPA 2DLBA 3GOEA 1WXSA 2QJLA 4A9AA 3Q8CA 2IO0B 2KX0A 2HJ1A 4RM8A 2KXJA 3C0RB 4WQMA 1UBIA 2G45B 5L83A 5AZHA 2CHWA 2WXHA 3AEFB 4L1BA 2WXFA 4AP4C 4MSQB 5GMVA 3VHTC 3AE2B 4CYEA 5E6OA 3DVGX 4KDLB 1EWCA 3PHWB 1KH0A 2GBJA 3VDZA 3M3JA 4MH8A 2QIEB 4W9EA 2IO1B 1DOYA 2N9KA 2BGFA 2KC1A 1C78A 1V49A 3U7DA 4S17A 1HXYD 3VH4B 3AN1A 5D3IB 4CQNA 4HWIB 1XXGA 3NHEB 3EC8A 1WGHA 1I35A 4PS3A 1E8WA 3DHIC 5HG2A 3DWGC 1KLVA 2WHIA 1T0YA 1ZGUB 2AQ2B 3UINB 4H2AA 4AJWA 3SFDB 2RD0A 3VTWA 1PFDA 3LYYA 5MPOA 1E6EB 4LDTD 4C7ZA 1WJNA 3VFKA 1WXQA 2WP9B 1EUVB 2N1WA 2D07B 3EFUA 2MWSB 4FXCA 1YOVB 2MJ3A 2OEDA 1AN8A 2M4NA 2WXQA 4ARCA 1RYJA 5EE9A 4C4VA 2CKHB 3AU4A 1SF0A 4BBNF 1V81A 1TIFA 4C4VB 2BYEA 3QJZA 5D3DA 2G4DB 3SFEB 2JXTA 1XLPA 2K6QA 1IBXA 1C1YB 1J7BA 1UWXA 3Q8AA 4NPNA 1IBXB 4K7UA 4NJ6A 3DCGA 2BT6A 3EUB2 2BPSA 4KKIA 3RNEC 1SB3C 4KGRA 3ALBA 5LNK1 4IM2A 1R7SA 3BVMA 3NOBA 2MHJA 1ZE3D 1CQVA 4WJQA 3PLVA 4HRSA 4DXGA 1XLQA 4JWSC 4M0WA 1Z5SB 3PPAA 3WAPA 4M0WB 4M01A 1V5TA 2KFJA 4OZBA 4HEA1 3RNGC 4G50A 1M4VA 1FCCC 5I4DA 2AL3A 1N6ZA 2L76A 2BBCA 1PGAA 2JUOA 1VCBA 1UUPA 3FKYA 4ARIA 1GJZA 4E74A 1SIJA 4TUUA 4DHZE 1K53A 4A90A 2LGDA 1VR9A 4ZRJA 3T8MA 2R2QA 3Q8BA 3HIZA 3LJ3A 3NY5A 3KUDB 4W9GA 3DBLI 4YTPB 1R4NB 3ZJTA 3AEGB 2INDC 3L17A 3L54A 1WGGA 4ASWC 4MSMB 1NEKB 1M94A 3AEEB 2ACZB 3CSTA 4XC2A 4LJOB 4LJPB 2KLCA 4ICUA 3RZFA 4B0MA 5GXGB 2INNE 4HROA 2JX5A 4GN1A 4JPSA 1XEEA 4BZAA 2UU7A 3KVFB 2DYBA 4BFRA 2SEBD 2WDTB 4JL9A 4N6EB 4D2KA 2G9HD 3H9DA 1UELA 2AYOB 3Q69A 1TBEA 4KSLC 4TQ1A 5L95C 1WGDA 3HVZA 3KUZA 3PZ8A 1SJHD 1VZ8A 4IC7B 3ZJUA 1OQYA 2NBWB 3R8BA 4JE3B 4LLGM 2L0TA 3RN9C 1XLNA 3IVFA 4RM9A 2GBNA 4O1NA 4EZLA 3CMMB 1WR1A 3ZNHB 4PYUA 1AWDA 2AWTA 1D5MC 3KWLA 4RF1A 1YN3A 2IO3B 3NJTA 1MI0A 4GSWA 3V6CB 1ZPSA 4C80A 2L3ZA 3P42A 3QWZB 3MFGA 3AI5A 3RFZB 2ZPNA 4I6NB 2Z8LA 2W55A 3TIXA 1C9FA 1OFFA 2A4ZA 2RR9A 5BMGA 4WURA 3TL5A 3H1UA 3TEZA 3MJWA 2PPHA 4F1SA 1FEHA 4YT0B 2N4FA 4DHZB 2BF8B 4ZYSA 1FXTB 4G11A 1KFYB 1UGJA 3RYTA 4WAAA 3GB1A 1MVKA 1L2NA 2JSVX 3HM6X 1GNUA 1JWBD 2DZMA 2KVRA 2DENB 4LCDE 5C2TB 1UH6A 2DHZA 3PRMB 4E71A 3I57A 2RGFA 3AV8A 2E3TA 1YIWA 3ENEA 1GC7A 4OVVA 3GZNB 2EMSA 4WWMA 3R2IA 1YQBA 2LJ5A 3CSFA 3ZW3A 2LUEA 3I5JC 1H4RA 4XGAB 5KHOA 1V86A 4RGMA 1ET6A 1WH3A 3AE9B 3DBHI 4W9KA 3RNBC 3RULA 2DAFA 1K51A 5FK9C 5EE1A 4ZYNA 1WGKA 3AEDB 2I1JA 1I4GA 3L10B 4JQWC 2KFKB 1KF6B 2IY0B 4W9LA 2L7RA 4LDTB 1R4MB 3IFWB 3Q3FA 2W9NA 4USAA 3UGBB 4L2YA 3AH7A 4IM3A 2KQ4X 3DOWA 3A9JA 1Q5WB 3EGRA 3N32A 3NRZA 3WANA 1C4CA 2WGSA 3A9JB 3ZXRA 5D94A 2IZVB 2IY1B 2ZVOA 2HJ8A 1SIFA 2RMMA 2CS4A 2ZZPB 2WX1A 1FRDA 3UQAA 2JYTA 3TUOA 4HJGE 3RPFC 2DX5B 3ML8A 3HHMA 1UBQA 1X1MA 5AUIA 2WXGA 3W9CB 3PLUA 2FCQA 1C3TA 2BTEA 5C23A 4XDCA 4NY0A 3B2GA 4K7SA 2DWQA 3DQVA 1E7UA 2ZW1A 1WRDB 3ZDTA 1TS3A 2KDBA 4WJOA 3TEYA 1D5XC 1K8RB 1WMHA 2AX5A 1TZ1A 3P4RB 3B0AA 1P7FA 1WMHB 4NAMA 3X23A 3NZ3A 1GB4A 1J7AA 3QQ8B 4NAWA 4KDIC 2BS3B 2KJ6A 4BKSD 3KYDD 2DAJA 3BVGA 2KJRA 2ZVNA 4P1CC 1TYGB 2LD9A 3ZKJC 1EWYC 3JSVA 2GBKA 4RGNA 2XEWA 2O2VA 1XLOA 2QCZA 1SSNA 3JSVB 4LNOA 1TY2A 2O2VB 2QDFA 2G1EA 1E7VA 3KWVA 1WE7A 2IO2B 2MX2A 1WGYA 3A9KA 3ML9A 4JLCA 4BKTA 3A9KB 5EE3A 1FM0D 2Z0DB 3N3KB 1T0QC 3VTVA 4DBGA 1YJJA 2D5GA 1VZ6A 1D6EC 5LLIA 2YLMA 2W3RA 2KDFB 3BINA 3NVVA 5G5GA 5DPSA 1JWMD 2J0JA 4JX1C 1YX5B 1E90A 3NUHB 4NQLB 3QIJA 2V3NA 1WYGA 4LTUA 3V6EB 1ZP0B 2CJNA 2PKOA 2LMCA 4NNJB 5HFYA 4FHKA 1A70A 2E6XA 3QC8B 1UF0A 2KQ7A 2ZPYA 1TT5B 2KYWA 1V9JA 1N62A 1F52A 2CU3A 2GB1A 1IPGA 4LNFA 4GMVA 1WY8A 2WQYB 1D4BA 2K22A 4J6IA 3MC8A 2D11A 2J53A 3CF6E 1MJDA 3IXSA 3M95A 2PW9A 1PGXA 1WJ6A 3DHHC 5LXIB 2WXRA 4N59A 5G55A 2K6DB 1FRRA 5EE0A 1XCTL 1N5XA 3SEBA 1G6JA 4BVUC 4Q2JA 1BUIC 2JZZA 4OVZA 3AE4B 1Q10A 1Q1OA 2KN4A 5AZGA 2C7HA 2ONQA 2EKEC 1JWSD 3U7ZA 1HA5A 5IN7A 3GZNI 3VRBB 4OZCA 2WDRB 4L23A 4W9IA 1WF9A 1ZXIA 3Q6BA 2DNFA 1WX8A 4BBNC 2IJ0A 2NCNA 5DPTA 4OZAA 4B95A 2L32A 4US8A 5BYSA 3OJ4B 4W9HA 2YEPF 2QC8A 4FADA 4AQ7A 1JWUD 2BQQA 1YJIA 4REZA 5HI1A 3N1XC 3MJ5A 2GMIC 1VLBA 2FIFA 5CTRC 1MHXA 2MH7A 2QEJC 3A1QA 4WWPA 2VZKD 1UGMA 4EFOA 3BK1A 1WXMA 3UIOB 3A1QB 2LWPA 4AS1A 1CJEA 4BKGA 4FJZA 1HTQA 4LK0M 3NVZA 2MRPA 2W82A 2MBEA 3JW0X 1SE4A 2G4SA 1ZOYB 4EUTA 3U8ZA 1C79A 3U52E 2KLGA 2AEHA 1QT9A 4HDOA 3PSEB 3N1YC 2VH1A 3Q3JA 1MG4A 4A3OA 1JW9D 2W54A 2IGHA 1WWTA 4TKNA 2BB5A 5BMIA 1UZXB 5AUKA 1DYQA 1T3QA 1Q0WB 2KQSA 4XYCA 2D3GA 3PT2B 2PLPA 3APFA 2DYMA 1KLUD 2O6VD 5IOIA 5G2NA 4RFBA 5FR3A 3RNCC 5DPWA 4ZDVA 1L7YA 1SJED 1NYRA 3EHVA 5T8IA 1QILA 1F2RI 3ZVVA 5HHDG 2KX3A 3ZTCA 4PS7A 2K3UA 1NI2A 1SGHA 3NS1A 3UIPB 1YN5A 2MJDA 3RT3B 4NJCA 2OJRA 2BKRB 4BKSA 2N7EA 2Z0EB 3TEXA 3BYYB 4GDKA 3SR6A 3ETRA 1D3ZA 2JPHA 2GI9A 3MC9A 4GDKB 3N1ZC 3APDA 2BKFA 1S3SG 1I4XA 2LVOA 4HLEA 5DCNA 1YN4A 3LXFA 4TV3A 2CR5A 1JCKB 2NS5A 1CK1A 1IGDA 2NVUI 2HTME 1L5PA 5D6JB 5G5HA 2ZCCA 5CHVC 4C00A 1WZ3A 2WNMA 2FUHB 2DYOA 2UWQA 2FUG1 4B0EA 3AE5B 1OGWA 5IO9A 2GLSA 2H89B 4KKJA 3AU5A 2GOWA 5FR6A 2KANA 4KVGB 3QK0A 2LRUA 3K9OB 1TJEA 3W5VB 2KDMA 2IDYA 2TSSA 2L1AA 3EA6A 3ZNID 5EDSA 1LGRA 4OW0A 2GBRA 2LI5A 4HCNB 4K7WA 4K3CA 1VD2A 2B3AA 3VH3B 4C56C 1J0GA 4P7IA 1WJUA 1V80A 3B08A 4DDGD 2M0XA 2INPE 4NJ7A 3DPDA 2HD5B 4M8MA 3ZNGC 1RLFA 2KHWB 4I6PA 2MQJA 1FFUA 2CJOA 3DHGC 4RGOS 2KOXA 3AM9A 2KJHB 2MSED 4YXDB 3GP7A 4MM3A 1RFAA 1QOGA 3ABVB 1Y8RC 5D7GA 5H92C 2DZIA 3DBRB 4MM3B 1IP9A 2INCC 1F1HA 2ZNVC 2KO3A 3SDLC 3AECB 2JY6A 4W9CA 2WXKA 1WE6A 1NBFC 2KWVB 5CHWA 4DK5A 1RM6C 4BAXA 3GS2A 4NQKE 2MBOA 1STEA 3P63A 4EEWA 2QSDA 3NZUA 2M17A 2DZJA 4MGYE 1A5RA 1FXIA 2MLBA 3C8YA 4OHJA 3NS8A 2MW5A 3ZRFA 1ET9A 2N7DA 1I4HA 2YVCA 4P16A 3R7QA 1SEBD 1LO5D 1V1PA 1L4DB 1JRPA 2D10A 3U4EG 4HK2A 4RGTA 4URKA 2FCSA 1V1PB 4ZHOA 3S2AA 4WWNA 2AL6A 3ZGZA 2G3QB 2KFKA 4A3PA 1WJ4A 1WGRA 2KZRA 4YSXB 1L6UA 3PRPB 2DZKA 1HZ6A 2MBQA 1I4RA 1UD7A 4RNAA 2WS3B 2N1VA 2M8SA 2MCNB 2VZKB 1FNUA 2J0MA 5FKAC 3HUIA 2BS4B 3RNFC 3UI3A 1K50A 2PVOD 1ACCA 4PS8A 4OVUA 2K5PA 2CHZA 2FNJB 4WWOA 4ZRIA 4MGKE 2H88B 1FMAD 3OAWA 4GLSC 2FCMA 4ANWA 4GU2A 4HKZE 1XT9B 3IBEA 4MJSA 2KMMA 4QAYA 2D3AA 4RCOA 1LQBA 4J3OD 3OG5A 4MJSB 3BVZA 1Y56A 3QCAA 1KM7A 2QMTA 2WXJA 4IW0A 1OQRA 3BIID 4AWJA 3OWEB 2N9XA 1E8XA 1QKZA 2WU5B 3WAOA 2O6VA 4EZJA 1VJKA 2C7MB 4X57B 2O6VB 1V5OA 2BWES 3IT4B 2AQ3B 1KRHA 1FNVA 3R2TA 2FE8A 4KGTA 1FPYA 1I4PA 1L4ZB 3B9JA 3PZDA 2EMTA 1XCQL 2M0AA 3R3MA 3P2BA 4ICVA 3NVWA 2QILA 3U2SC 3BK2A 3PV1A 1E9MA 2JRIB 2LEKA 2PVGC 1GPXA 1N60A 1F77A 4EKUA 1IUEA 2KMAA 2L83A 1N63A 1T5XD 4IWOA 2KN5A 2LVPA 4G3XB 3VQIA 3AE3B 2SAKA 3W1SC 1R4NI 4IWQA 1NVID 2Y5BB 3BY4B 5HKHA 5KHQA 3RZWC 4DXAB 4F7ZA 4YTNB 3JYUA 3KYCD 3ZQ4A 3L13A 4WAFA 2RDGA 4W9DA 1TY0A 5D2MB 2Y5CA 3PREA 4FULA 1QOAA 4I6LB 4F8CB 5BYQA 2X8XX 1RAXA 5CX3A 1ZW7A 3VR8B 3DVNU 4KSKC 2KWDA 1F0ZA 3QA8A 3VVWB 1ZDVA 5BYRA 3L0WB 4IM0A 3SU8X 3RCZA 2JT4B 1SBBB 2OHFA 2KTRA 3P4SB 3ZYYX 1V1OA 2KTRB 4GB9A 1I42A 3E9SA 3WCQA 3QX1A 1MG8A 2JWZA 1QZEA 2K8HA 3Q3NC 3KH0A 2I38A 2NBUA 3ZIMA 5J2RA 4MT5A 2D2QA 1P98A 2V4LA 3UQBA 4ZRQA 1VZ7A 2LXAA 1FIQA 2KWUB 4GIVA 3HM3A 2XNAC 2IGDA 2IGGA 3H7SA 1JROA 1QF6A 4YL8A 5C1ZA 1H8CA 3FILA 2WU2B 4XZ4A 2Q5WD 3TJPA 2M19A 2FCNA 4K81A 1SE3A 3FILB 2MJEA 2JZ3B 2LRWA 2WXOA 3MHSD 1CMXB 1LFDA 3DBRI 5BO4B 5IKCM 4XE0A 4AOFA 3PZ7A 1WZ0A 1J7CA 4IUMB 4FN2A 3T3OA 3GE8C 2BYVE 4N58A 4ACFA 2V4IB 1IGCA 1E8YA 2N9LA 4KZ0A 4A8XC 1GB1A 3U30A 2WXPA 5JXVA 2OJWA 4LNIA 1EF5A 3URYA 3ZTDA 3TMPB 1HQRD 5JZEB 2L0FA 4A20A 4HCPB 2BW2A 3P1MA 2C60A 1HTOA 2JQRB 1TKEA 2WYQA 1SXTA 2BVCA 2M1MA 2KK8A 2LJIA 1TS2A 4XDDA 3PGEA 5JHAA 4ZHPA 3SHQA 2RPVA 2BS2B 1ZDXA 4II3B 3WAMA 3NZSA 4DQOC 3IAS1 3TSSA 1T0RC 4MGZE 5IP4D 1NDDA 5CHFA 5TSSA 1WXAA 3I63C 3VRAB 1R4MI 2LGYA 3Q3MC 1YMHE 4S0RA 3LDZE 3OJ3A 4W9JA 3HRDD 3IHPC 2EELA 4N9F4 3ZNZB 1QOBA 1TZOA 1F9JA 1J19A 3AE8B 4CHKA 4NZLB 2J4XA 2CHXA 3K9PB 2N0SB 3DBHB 1B1ZA 1T6BX 3OLMD 4EE2A 3MC0B 3Q2AC 2IYDB 5LXHA 1C4AA 1TTNA 4IWPA 1VRAB 2ASQA 1WR6E 4B6WA 2M56B 3V3XA 1PUTA 1D5ZC 2GBMA 4XWTA 2PEAA 3V05A 1OEYA 3QARA 2LXCA 4WH4A 2ICIA 2XK5A 1P0RA 3A4SC 1ENFA 2BWFA 2C7NB 2BYFA 4GOCA 1OEYJ 2XK5B 1PYWD 4UDUC 3LB8C 3SD5A 3T3NA 1DOIA 2D3CA 1WM2A 3AEAB 3MTNB 5IA7A 4M00A 1QOFA 1T0SC 4FJYA 3N30A 2WDVB 4FBJB 2PE6B 2J7QB 4KGSA 4TSSA 1AW7A 4RMAA 1ISNA 2LGXA 3AE1B 4ZOHC 2L8JA 5J18A 1EM7A 2KMCA 2BYTA 2JF5A 1LM8B 4HKQA 3L16A 1UWMA 3RD2A 4A55A 3Q8FA 5AEKB 4FA6A 2WX0A 4EZKA 1B9RA 2REXA 1N5WA 1L6VA 1RFKA 1ESFA 3N9YC 3TCAA 2QHOA 3AULA 2ZW0A 1I7HA 2NR2A 3AB5A 2JWUA 1RWSA 1PDXA 3V60A 1FXAA 3AE6B 2HTHA 4BOZB 4WJPA 3HK0A 2R61A 3VTUA 2LGSA 2RDBC 4ZRPA 2JRHA 2RPQA 2FBWB 1TKYA 2L00B 4IKGA 2GRIA 3DVGY 3M62B 3Q3OC 3R7RA 2NPTA 3X0WA 4W9FA 3APCA 1GOZA 2FIDA 2K8CA 4GXBA 2N7JA 1KTKA 2NPTB 4CO7A 4DHJD 3A4RA 4PT5A 3O65B 3AMZA 2VH2A 4KIKA 1CZPA 2WDQB 2KC2A 2Y5PA 3R66C 3DVNV 4KIKB 2N9EB 3DDCB 3PRZA 1EU4A 3IG3A 2J52A 1WFYA 3WA0A 3E56A 3J9CA 4MEMA 4MDKE 3L08A 2X38A 2WXIA 2MP2A 3ZRCA 4BOSC 2D3BA 3P4QB 1L0XB 2KD0A 2MP2B 1K52A 3ZO5B 4K1RB 2NMQA 1WRIA 4LNKA 2JZPA 3RMKC 5E6JA 1TS4A 2KAJA 1XD3B 1RRBA 1BMLC 1S1QB 1C77A 1YD8U 3VAWA 3RUIB 1YQ3B 2ZNVB 1JMLA 3FC4A 2DBYA 4FHJA 1V8CA
chains in the Genus database with same CATH topology
3T9LA 1WY8A 4NPNA 3PTFC 4J6IA 4K7UA 4NJ6A 3DCGA 1KJTA 2D11A 4ANUA 2BPSA 3CF6E 1YX6B 3ALBA 3ONSA 3M95A 4IM2A 4M8NA 3ZLZA 3PZDA 5JH5C 2EMTA 3NOBA 3R3MA 3P2BA 4WJQA 4ICVA 3PLVA 1WJ6A 5LXIB 3PV1A 3VUXA 5G55A 2JRIB 2K6DB 1Z5SB 3PPAA 4ANXA 3WAPA 4M0WB 4EKUA 1V6EA 4GGQA 1V5TA 1G6JA 2KFJA 4BVUC 1WYWB 4IG7B 2JZZA 2KMAA 1U4AA 2JVCA 4G50A 4MH0E 2AL3A 1Q1OA 4AUQC 4IWOA 5AZGA 2C7HA 3PHXB 2KN5A 2LVPA 4G3XB 2L76A 1EF1A 2PJHA 3V61A 2EKEC 2MA9B 4II2B 3VQIA 1Z2MA 3EECA 2JUOA 2C5LC 3GZNI 1VCBA 3W1SC 1R4NI 4IWQA 1GJZA 4E74A 2Y5BB 2K1FA 3BY4B 4TUUA 4DHZE 4W9IA 1WF9A 5HKHA 5KHQA 3RZWC 4JIOU 4DXAB 1WX8A 3UF8A 4BBNC 3JYUA 4F7ZA 3KYCD 2LGDA 2NCNA 3L13A 5DPTA 4W9DA 4B95A 1GUAB 4ZRJA 3T8MA 5D2MB 2OOBB 3OJ4B 2R2QA 3PREA 3HIZA 4FULA 4W9HA 3LJ3A 4I6LB 4F8CB 4B9KA 4FADA 3NY5A 3WAMA 1RAXA 3KUDB 5CX3A 2KKCA 1ZW7A 4W9GA 3DBLI 3DVNU 4KSKC 3QA8A 3VVWB 4FJVB 3L17A 3L54A 1WGGA 3L0WB 4ASWC 1WM3A 4MSMB 1M94A 2K39A 3CSTA 4XC2A 4IM0A 4LJOB 4LJPB 2LVQA 3SU8X 2GMIC 2KLCA 4ICUA 3RCZA 3RZFA 1WXVA 2JT4B 2FIFA 2KTRA 5CTRC 1EO6A 3A1QA 4GN1A 4WWPA 3KUCB 1UGMA 3KVFB 2DYBA 4EFOA 2KTRB 1WXMA 3UIOB 3VUYA 3A1QB 4BFRA 2LWPA 4GB9A 2WDTB 1I42A 2RSUA 4HPLB 4JL9A 4ANVA 3QX1A 1MG8A 2JWZA 4BKGA 3A33B 3H9DA 1QZEA 1UELA 4FJZA 2K8HA 2AYOB 3H6NA 2MRPA 1TBEA 3KH0A 2MBEA 3JW0X 4KSLC 4TQ1A 2G4SA 5L95C 2ZJDA 4EUTA 3U8ZA 4KZCA 2UYZB 2KLGA 1WGDA 2NBUA 3ZIMA 5J2RA 2AEHA 2D2QA 3KUZA 1P98A 2V4LA 4IC7B 3UQBA 4HDOA 4WQOB 3PSEB 4DWFA 2LXAA 2KWUB 3Q3JA 4GIVA 2KNBA 3HM3A 4A3OA 1OQYA 4TKNA 3H7SA 1UZXB 2NBWB 5E6PA 4YL8A 2WWZA 2L0TA 3QAQA 4PYZA 1Q0WB 5C1ZA 1H8CA 2KDIA 1E8ZA 2I1KA 2KQSA 3IVFA 4XZ4A 3PVLA 4HPMB 4RM9A 2GBNA 2D3GA 3TJPA 4MELA 2FCNA 4EZLA 3CMMB 4K81A 1WR1A 3ZNHB 4PYUA 2ZCBA 2AWTA 3PT2B 2JZ3B 3APFA 2LRWA 2DYMA 2O6VD 3MHSD 1CMXB 4XX5A 1LFDA 3DBRI 5BO4B 5G2NA 4EOYA 2IO3B 1J8CA 3W1YA 4AOFA 5DPWA 4GSWA 3WIMA 4ZDVA 1L7YA 1WZ0A 2VRRB 3V6CB 2HE7A 3EHVA 1BT0A 3QHTA 4FN2A 4IUMB 2L3ZA 3ZVVA 1IYFA 2KX3A 2V3SA 3QWZB 3W1SA 3ZTCA 1WX9A 2BYVE 4PS7A 2J0KA 4ZRKA 1NI2A 1P9DU 1SGHA 2ZEQA 1E8YA 3AI5A 4KZ0A 2ZPNA 4I6NB 4WJNA 3UIPB 3TIXA 2KTFA 5IAAC 2A4ZA 2RR9A 4KV2A 2OJRA 3RT3B 2BKRB 3U30A 4BKSA 5JHBA 2N7EA 3TL5A 2Z0EB 3H1UA 5E6NA 3MJWA 1EF5A 5TR5A 3VUWA 3ZTDA 3TMPB 2PPHA 2NBVB 4GDKA 4F1SA 2LZ6A 1D3ZA 2FAZA 5JZEB 4JGHB 2JPHA 2L0FA 2N4FA 4HCPB 3H7PA 4A20A 4DHZB 2BF8B 1FXTB 4FLHA 2C60A 4GDKB 4G11A 3APDA 3RYTA 2BKFA 1S3SG 1WIAA 3H7PB 4WAAA 3TBLD 2LVOA 4NAWB 2WYQA 5DCNA 2O6VB 2M1MA 4DDID 4HLEA 1L2NA 2R2OA 3HM6X 4TV3A 2KK8A 2CR5A 1GNUA 2DZMA 2KVRA 2XBBC 2DENB 4LCDE 2C9WB 1UH6A 4AJYB 2DHZA 2CU1A 3PRMB 3PGEA 2NS5A 4E71A 3SHQA 5JHAA 2RGFA 3VXWA 4MGIE 2NVUI 1YIWA 3ENEA 3KW5B 4II3B 3NZSA 1E5WA 1GC7A 2PE9A 1SE9A 5D6JB 4OVVA 3V62A 2ZCCA 5CHVC 1WI0A 2EMSA 1WZ3A 4MGZE 1YQBA 2LJ5A 1NDDA 3CSFA 5CHFA 3ZW3A 2LUEA 2FUHB 1H4RA 5KHOA 1WXAA 1V86A 2DYOA 4DHJB 2UWQA 2MBBB 1WH3A 2K25A 1R4MI 4TQ0A 3DBHI 2LGYA 1V2YA 5AZFA 2K8BA 1GG3A 4W9KA 1PQSA 1OGWA 2DAFA 3I3TB 3RULA 1P3QU 3LDZE 3OJ3A 3WALA 4W9JA 3AU5A 2GOWA 4ZYNA 3JVZX 5FR6A 3ZDMC 2KANA 3IHPC 2I1JA 4N9F4 3ZNZB 3L10B 4JQWC 4KVGB 2KFKB 3QK0A 3ECIA 1TGZB 1F9JA 1J19A 2LRUA 4CHKA 2IY0B 4W9LA 5J17A 2CHXA 3K9OB 2L7RA 4LDTB 3K9PB 3IFWB 3Q3FA 2W9NA 3ZNID 4HJKA 4HXDA 5EDSA 3OLMD 2N9PC 2IYDB 4G0NB 2MBHA 3UGBB 5LXHA 2A5UA 4IM3A 1P1AA 3DOWA 2GBRA 2LI5A 1Q5WB 1TTNA 3A9JA 3N32A 4HCNB 4IWPA 3WANA 4K7WA 1LXDA 1VD2A 2B3AA 3A9JB 3VH3B 2ASQA 1XQQA 4HVBA 1WR6E 1J0GA 4B6WA 5D94A 4P7IA 2IZVB 2IY1B 4GDLA 2ZVOA 2GBMA 2HJ8A 1WJUA 2PEAA 1V80A 3B08A 4DDGD 2M0XA 2L05A 4NJ7A 1OEYA 3DPDA 3B1LX 2HD5B 2LXCA 1SIFA 3QARA 4GDLB 4M8MA 3ZUNA 2XK5A 1P0RA 2CS4A 2JXXA 2ZZPB 3A4SC 2BWFA 3ZNGC 2C7NB 2BYFA 4GOCA 1ZKHA 2WX1A 1RLFA 3UQAA 1OEYJ 2KHWB 1GC6A 3M63B 1OTRB 2DX5B 2XK5B 4I6PA 3SD5A 3ML8A 2MQJA 4E3CA 3DBSA 3HHMA 1UBQA 1X1MA 1WM2A 2KOXA 1WX7A 1YJ1A 3MTNB 5IA7A 5DPRA 3PLUA 4FJYA 3N30A 2FCQA 4FBJB 2Z59B 2KJHB 3D32A 1C3TA 2KDEB 5C23A 2MSED 2J7QB 2PE6B 4HDQA 1AARA 2IBIB 4NY0A 4MM3A 1RFAA 4K7SA 1KOTA 1HE8A 5D7GA 1Y8RC 3DQVA 2DZIA 4RMAA 3AXCA 1ISNA 1E7UA 2LGXA 5J18A 2L8JA 2KMCA 2LASA 2JF5A 1IP9A 2KWCA 1WRDB 1LM8B 3ZDTA 2ZNVC 2KO3A 3L16A 3PS6A 3SDLC 2JY6A 4W9CA 3RD2A 5AEKB 2KDBA 2V1YA 1WE6A 1NBFC 4WJOA 4FA6A 1JRUA 3GOEA 2KWVB 5CHWA 2WX0A 1WXSA 4DK5A 1K8RB 1WMHA 2IO0B 2KX0A 1TZ1A 4RM8A 4NQKE 2MBOA 4EZKA 2KXJA 3B0AA 2REXA 4EEWA 3C0RB 1WMHB 3NZUA 3X23A 2M17A 3TCAA 1UBIA 3QQ8B 2QHOA 3AULA 4NAWA 2G45B 2DZJA 4KDIC 2KJ6A 4MGYE 5L83A 1A5RA 2NR2A 2MLBA 4BKSD 5AZHA 2CHWA 4AP4C 4MSQB 3NS8A 2MW5A 3KYDD 2DAJA 5GMVA 3V60A 3VHTC 3ZRFA 2KJRA 2ZVNA 2HTHA 2N7DA 4BOZB 4CYEA 4WJPA 5E6OA 3DVGX 2LD9A 4KDLB 3HK0A 3ZKJC 3VTUA 2YVCA 3JSVA 2GBKA 3PHWB 3R7QA 2XEWA 2GBJA 2JRHA 2O2VA 2RPQA 3VDZA 3M3JA 3JSVB 2L00B 2D10A 3DVGY 4HK2A 3M62B 4W9EA 4URKA 2O2VB 2IO1B 2FCSA 1E7VA 3R7RA 2BGFA 2NPTA 3S2AA 3X0WA 2KC1A 4WWNA 1V49A 1WE7A 2AL6A 4W9FA 3U7DA 3APCA 2FIDA 2K8CA 2IO2B 4GXBA 3VH4B 2MX2A 1WGYA 3A9KA 3ML9A 2G3QB 2NPTB 4HWIB 2KFKA 3NHEB 4CO7A 4DHJD 4A3PA 1WJ4A 4JLCA 1WGRA 4BKTA 3A4RA 3EC8A 1WGHA 2KZRA 3A9KB 3PRPB 1I35A 2DZKA 3O65B 4PS3A 1E8WA 2MBQA 2Z0DB 4KIKA 2KC2A 3R66C 1UD7A 1KLVA 3DVNV 1T0YA 1ZGUB 2N1VA 3N3KB 3VTVA 4DBGA 2M8SA 4KIKB 2N9EB 3DDCB 3PRZA 2MCNB 3UINB 3IG3A 4AJWA 2J0MA 1WFYA 2RD0A 3WA0A 3VTWA 5LLIA 2YLMA 4MEMA 2KDFB 3BINA 4PS8A 4OVUA 4LDTD 1WJNA 2CHZA 2FNJB 4MDKE 4WWOA 3L08A 5DPSA 4ZRIA 2J0JA 4MGKE 3VFKA 3OAWA 1YX5B 2MP2A 1EUVB 1E90A 3ZRCA 4BOSC 2FCMA 4NQLB 2N1WA 2D07B 3EFUA 3QIJA 4ANWA 2MWSB 2KD0A 2MP2B 4GU2A 3ZO5B 2M4NA 1XT9B 4K1RB 3V6EB 3IBEA 4MJSA 1LQBA 2CKHB 3AU4A 4BBNF 4NNJB 1V81A 4MJSB 4FHKA 1XD3B 3QCAA 1RRBA 3QC8B 1S1QB 1YD8U 3VAWA 1KM7A 2KQ7A 3RUIB 2BYEA 4IW0A 4AWJA 2ZPYA 2ZNVB 2N9XA 3QJZA 1E8XA 2G4DB 1V9JA 3WAOA 2O6VA 4FHJA 4EZJA 2K6QA 1C1YB 1IPGA 2C7MB 4X57B 1V5OA 2BWES 4GMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9L A;  1WY8 A;  4NPN A;  3PTF C;  4J6I A;  4K7U A;  4NJ6 A;  3DCG A;  1KJT A;  2D11 A;  4ANU A;  2BPS A;  3CF6 E;  1YX6 B;  3ALB A;  3ONS A;  3M95 A;  4IM2 A;  4M8N A;  3ZLZ A;  3PZD A;  5JH5 C;  2EMT A;  3NOB A;  3R3M A;  3P2B A;  4WJQ A;  4ICV A;  3PLV A;  1WJ6 A;  5LXI B;  3PV1 A;  3VUX A;  5G55 A;  2JRI B;  2K6D B;  1Z5S B;  3PPA A;  4ANX A;  3WAP A;  4M0W B;  4EKU A;  1V6E A;  4GGQ A;  1V5T A;  1G6J A;  2KFJ A;  4BVU C;  1WYW B;  4IG7 B;  2JZZ A;  2KMA A;  1U4A A;  2JVC A;  4G50 A;  4MH0 E;  2AL3 A;  1Q1O A;  4AUQ C;  4IWO A;  5AZG A;  2C7H A;  3PHX B;  2KN5 A;  2LVP A;  4G3X B;  2L76 A;  1EF1 A;  2PJH A;  3V61 A;  2EKE C;  2MA9 B;  4II2 B;  3VQI A;  1Z2M A;  3EEC A;  2JUO A;  2C5L C;  3GZN I;  1VCB A;  3W1S C;  1R4N I;  4IWQ A;  1GJZ A;  4E74 A;  2Y5B B;  2K1F A;  3BY4 B;  4TUU A;  4DHZ E;  4W9I A;  1WF9 A;  5HKH A;  5KHQ A;  3RZW C;  4JIO U;  4DXA B;  1WX8 A;  3UF8 A;  4BBN C;  3JYU A;  4F7Z A;  3KYC D;  2LGD A;  2NCN A;  3L13 A;  5DPT A;  4W9D A;  4B95 A;  1GUA B;  4ZRJ A;  3T8M A;  5D2M B;  2OOB B;  3OJ4 B;  2R2Q A;  3PRE A;  3HIZ A;  4FUL A;  4W9H A;  3LJ3 A;  4I6L B;  4F8C B;  4B9K A;  4FAD A;  3NY5 A;  3WAM A;  1RAX A;  3KUD B;  5CX3 A;  2KKC A;  1ZW7 A;  4W9G A;  3DBL I;  3DVN U;  4KSK C;  3QA8 A;  3VVW B;  4FJV B;  3L17 A;  3L54 A;  1WGG A;  3L0W B;  4ASW C;  1WM3 A;  4MSM B;  1M94 A;  2K39 A;  3CST A;  4XC2 A;  4IM0 A;  4LJO B;  4LJP B;  2LVQ A;  3SU8 X;  2GMI C;  2KLC A;  4ICU A;  3RCZ A;  3RZF A;  1WXV A;  2JT4 B;  2FIF A;  2KTR A;  5CTR C;  1EO6 A;  3A1Q A;  4GN1 A;  4WWP A;  3KUC B;  1UGM A;  3KVF B;  2DYB A;  4EFO A;  2KTR B;  1WXM A;  3UIO B;  3VUY A;  3A1Q B;  4BFR A;  2LWP A;  4GB9 A;  2WDT B;  1I42 A;  2RSU A;  4HPL B;  4JL9 A;  4ANV A;  3QX1 A;  1MG8 A;  2JWZ A;  4BKG A;  3A33 B;  3H9D A;  1QZE A;  1UEL A;  4FJZ A;  2K8H A;  2AYO B;  3H6N A;  2MRP A;  1TBE A;  3KH0 A;  2MBE A;  3JW0 X;  4KSL C;  4TQ1 A;  2G4S A;  5L95 C;  2ZJD A;  4EUT A;  3U8Z A;  4KZC A;  2UYZ B;  2KLG A;  1WGD A;  2NBU A;  3ZIM A;  5J2R A;  2AEH A;  2D2Q A;  3KUZ A;  1P98 A;  2V4L A;  4IC7 B;  3UQB A;  4HDO A;  4WQO B;  3PSE B;  4DWF A;  2LXA A;  2KWU B;  3Q3J A;  4GIV A;  2KNB A;  3HM3 A;  4A3O A;  1OQY A;  4TKN A;  3H7S A;  1UZX B;  2NBW B;  5E6P A;  4YL8 A;  2WWZ A;  2L0T A;  3QAQ A;  4PYZ A;  1Q0W B;  5C1Z A;  1H8C A;  2KDI A;  1E8Z A;  2I1K A;  2KQS A;  3IVF A;  4XZ4 A;  3PVL A;  4HPM B;  4RM9 A;  2GBN A;  2D3G A;  3TJP A;  4MEL A;  2FCN A;  4EZL A;  3CMM B;  4K81 A;  1WR1 A;  3ZNH B;  4PYU A;  2ZCB A;  2AWT A;  3PT2 B;  2JZ3 B;  3APF A;  2LRW A;  2DYM A;  2O6V D;  3MHS D;  1CMX B;  4XX5 A;  1LFD A;  3DBR I;  5BO4 B;  5G2N A;  4EOY A;  2IO3 B;  1J8C A;  3W1Y A;  4AOF A;  5DPW A;  4GSW A;  3WIM A;  4ZDV A;  1L7Y A;  1WZ0 A;  2VRR B;  3V6C B;  2HE7 A;  3EHV A;  1BT0 A;  3QHT A;  4FN2 A;  4IUM B;  2L3Z A;  3ZVV A;  1IYF A;  2KX3 A;  2V3S A;  3QWZ B;  3W1S A;  3ZTC A;  1WX9 A;  2BYV E;  4PS7 A;  2J0K A;  4ZRK A;  1NI2 A;  1P9D U;  1SGH A;  2ZEQ A;  1E8Y A;  3AI5 A;  4KZ0 A;  2ZPN A;  4I6N B;  4WJN A;  3UIP B;  3TIX A;  2KTF A;  5IAA C;  2A4Z A;  2RR9 A;  4KV2 A;  2OJR A;  3RT3 B;  2BKR B;  3U30 A;  4BKS A;  5JHB A;  2N7E A;  3TL5 A;  2Z0E B;  3H1U A;  5E6N A;  3MJW A;  1EF5 A;  5TR5 A;  3VUW A;  3ZTD A;  3TMP B;  2PPH A;  2NBV B;  4GDK A;  4F1S A;  2LZ6 A;  1D3Z A;  2FAZ A;  5JZE B;  4JGH B;  2JPH A;  2L0F A;  2N4F A;  4HCP B;  3H7P A;  4A20 A;  4DHZ B;  2BF8 B;  1FXT B;  4FLH A;  2C60 A;  4GDK B;  4G11 A;  3APD A;  3RYT A;  2BKF A;  1S3S G;  1WIA A;  3H7P B;  4WAA A;  3TBL D;  2LVO A;  4NAW B;  2WYQ A;  5DCN A;  2O6V B;  2M1M A;  4DDI D;  4HLE A;  1L2N A;  2R2O A;  3HM6 X;  4TV3 A;  2KK8 A;  2CR5 A;  1GNU A;  2DZM A;  2KVR A;  2XBB C;  2DEN B;  4LCD E;  2C9W B;  1UH6 A;  4AJY B;  2DHZ A;  2CU1 A;  3PRM B;  3PGE A;  2NS5 A;  4E71 A;  3SHQ A;  5JHA A;  2RGF A;  3VXW A;  4MGI E;  2NVU I;  1YIW A;  3ENE A;  3KW5 B;  4II3 B;  3NZS A;  1E5W A;  1GC7 A;  2PE9 A;  1SE9 A;  5D6J B;  4OVV A;  3V62 A;  2ZCC A;  5CHV C;  1WI0 A;  2EMS A;  1WZ3 A;  4MGZ E;  1YQB A;  2LJ5 A;  1NDD A;  3CSF A;  5CHF A;  3ZW3 A;  2LUE A;  2FUH B;  1H4R A;  5KHO A;  1WXA A;  1V86 A;  2DYO A;  4DHJ B;  2UWQ A;  2MBB B;  1WH3 A;  2K25 A;  1R4M I;  4TQ0 A;  3DBH I;  2LGY A;  1V2Y A;  5AZF A;  2K8B A;  1GG3 A;  4W9K A;  1PQS A;  1OGW A;  2DAF A;  3I3T B;  3RUL A;  1P3Q U;  3LDZ E;  3OJ3 A;  3WAL A;  4W9J A;  3AU5 A;  2GOW A;  4ZYN A;  3JVZ X;  5FR6 A;  3ZDM C;  2KAN A;  3IHP C;  2I1J A;  4N9F 4;  3ZNZ B;  3L10 B;  4JQW C;  4KVG B;  2KFK B;  3QK0 A;  3ECI A;  1TGZ B;  1F9J A;  1J19 A;  2LRU A;  4CHK A;  2IY0 B;  4W9L A;  5J17 A;  2CHX A;  3K9O B;  2L7R A;  4LDT B;  3K9P B;  3IFW B;  3Q3F A;  2W9N A;  3ZNI D;  4HJK A;  4HXD A;  5EDS A;  3OLM D;  2N9P C;  2IYD B;  4G0N B;  2MBH A;  3UGB B;  5LXH A;  2A5U A;  4IM3 A;  1P1A A;  3DOW A;  2GBR A;  2LI5 A;  1Q5W B;  1TTN A;  3A9J A;  3N32 A;  4HCN B;  4IWP A;  3WAN A;  4K7W A;  1LXD A;  1VD2 A;  2B3A A;  3A9J B;  3VH3 B;  2ASQ A;  1XQQ A;  4HVB A;  1WR6 E;  1J0G A;  4B6W A;  5D94 A;  4P7I A;  2IZV B;  2IY1 B;  4GDL A;  2ZVO A;  2GBM A;  2HJ8 A;  1WJU A;  2PEA A;  1V80 A;  3B08 A;  4DDG D;  2M0X A;  2L05 A;  4NJ7 A;  1OEY A;  3DPD A;  3B1L X;  2HD5 B;  2LXC A;  1SIF A;  3QAR A;  4GDL B;  4M8M A;  3ZUN A;  2XK5 A;  1P0R A;  2CS4 A;  2JXX A;  2ZZP B;  3A4S C;  2BWF A;  3ZNG C;  2C7N B;  2BYF A;  4GOC A;  1ZKH A;  2WX1 A;  1RLF A;  3UQA A;  1OEY J;  2KHW B;  1GC6 A;  3M63 B;  1OTR B;  2DX5 B;  2XK5 B;  4I6P A;  3SD5 A;  3ML8 A;  2MQJ A;  4E3C A;  3DBS A;  3HHM A;  1UBQ A;  1X1M A;  1WM2 A;  2KOX A;  1WX7 A;  1YJ1 A;  3MTN B;  5IA7 A;  5DPR A;  3PLU A;  4FJY A;  3N30 A;  2FCQ A;  4FBJ B;  2Z59 B;  2KJH B;  3D32 A;  1C3T A;  2KDE B;  5C23 A;  2MSE D;  2J7Q B;  2PE6 B;  4HDQ A;  1AAR A;  2IBI B;  4NY0 A;  4MM3 A;  1RFA A;  4K7S A;  1KOT A;  1HE8 A;  5D7G A;  1Y8R C;  3DQV A;  2DZI A;  4RMA A;  3AXC A;  1ISN A;  1E7U A;  2LGX A;  5J18 A;  2L8J A;  2KMC A;  2LAS A;  2JF5 A;  1IP9 A;  2KWC A;  1WRD B;  1LM8 B;  3ZDT A;  2ZNV C;  2KO3 A;  3L16 A;  3PS6 A;  3SDL C;  2JY6 A;  4W9C A;  3RD2 A;  5AEK B;  2KDB A;  2V1Y A;  1WE6 A;  1NBF C;  4WJO A;  4FA6 A;  1JRU A;  3GOE A;  2KWV B;  5CHW A;  2WX0 A;  1WXS A;  4DK5 A;  1K8R B;  1WMH A;  2IO0 B;  2KX0 A;  1TZ1 A;  4RM8 A;  4NQK E;  2MBO A;  4EZK A;  2KXJ A;  3B0A A;  2REX A;  4EEW A;  3C0R B;  1WMH B;  3NZU A;  3X23 A;  2M17 A;  3TCA A;  1UBI A;  3QQ8 B;  2QHO A;  3AUL A;  4NAW A;  2G45 B;  2DZJ A;  4KDI C;  2KJ6 A;  4MGY E;  5L83 A;  1A5R A;  2NR2 A;  2MLB A;  4BKS D;  5AZH A;  2CHW A;  4AP4 C;  4MSQ B;  3NS8 A;  2MW5 A;  3KYD D;  2DAJ A;  5GMV A;  3V60 A;  3VHT C;  3ZRF A;  2KJR A;  2ZVN A;  2HTH A;  2N7D A;  4BOZ B;  4CYE A;  4WJP A;  5E6O A;  3DVG X;  2LD9 A;  4KDL B;  3HK0 A;  3ZKJ C;  3VTU A;  2YVC A;  3JSV A;  2GBK A;  3PHW B;  3R7Q A;  2XEW A;  2GBJ A;  2JRH A;  2O2V A;  2RPQ A;  3VDZ A;  3M3J A;  3JSV B;  2L00 B;  2D10 A;  3DVG Y;  4HK2 A;  3M62 B;  4W9E A;  4URK A;  2O2V B;  2IO1 B;  2FCS A;  1E7V A;  3R7R A;  2BGF A;  2NPT A;  3S2A A;  3X0W A;  2KC1 A;  4WWN A;  1V49 A;  1WE7 A;  2AL6 A;  4W9F A;  3U7D A;  3APC A;  2FID A;  2K8C A;  2IO2 B;  4GXB A;  3VH4 B;  2MX2 A;  1WGY A;  3A9K A;  3ML9 A;  2G3Q B;  2NPT B;  4HWI B;  2KFK A;  3NHE B;  4CO7 A;  4DHJ D;  4A3P A;  1WJ4 A;  4JLC A;  1WGR A;  4BKT A;  3A4R A;  3EC8 A;  1WGH A;  2KZR A;  3A9K B;  3PRP B;  1I35 A;  2DZK A;  3O65 B;  4PS3 A;  1E8W A;  2MBQ A;  2Z0D B;  4KIK A;  2KC2 A;  3R66 C;  1UD7 A;  1KLV A;  3DVN V;  1T0Y A;  1ZGU B;  2N1V A;  3N3K B;  3VTV A;  4DBG A;  2M8S A;  4KIK B;  2N9E B;  3DDC B;  3PRZ A;  2MCN B;  3UIN B;  3IG3 A;  4AJW A;  2J0M A;  1WFY A;  2RD0 A;  3WA0 A;  3VTW A;  5LLI A;  2YLM A;  4MEM A;  2KDF B;  3BIN A;  4PS8 A;  4OVU A;  4LDT D;  1WJN A;  2CHZ A;  2FNJ B;  4MDK E;  4WWO A;  3L08 A;  5DPS A;  4ZRI A;  2J0J A;  4MGK E;  3VFK A;  3OAW A;  1YX5 B;  2MP2 A;  1EUV B;  1E90 A;  3ZRC A;  4BOS C;  2FCM A;  4NQL B;  2N1W A;  2D07 B;  3EFU A;  3QIJ A;  4ANW A;  2MWS B;  2KD0 A;  2MP2 B;  4GU2 A;  3ZO5 B;  2M4N A;  1XT9 B;  4K1R B;  3V6E B;  3IBE A;  4MJS A;  1LQB A;  2CKH B;  3AU4 A;  4BBN F;  4NNJ B;  1V81 A;  4MJS B;  4FHK A;  1XD3 B;  3QCA A;  1RRB A;  3QC8 B;  1S1Q B;  1YD8 U;  3VAW A;  1KM7 A;  2KQ7 A;  3RUI B;  2BYE A;  4IW0 A;  4AWJ A;  2ZPY A;  2ZNV B;  2N9X A;  3QJZ A;  1E8X A;  2G4D B;  1V9J A;  3WAO A;  2O6V A;  4FHJ A;  4EZJ A;  2K6Q A;  1C1Y B;  1IPG A;  2C7M B;  4X57 B;  1V5O A;  2BWE S;  4GMV A; 
#chains in the Genus database with same CATH topology
 3T9L A;  3PTF C;  1JWA D;  3TEW A;  2AQ1 B;  4US9 A;  1KJT A;  4HPP A;  4ANU A;  2XN9 C;  1EU3 A;  1YX6 B;  2PIA A;  3ONS A;  1L0V B;  2B76 B;  2LGI A;  4M8N A;  3ZLZ A;  5JH5 C;  1GAQ B;  3B2F A;  1VDV A;  1PGB A;  3W2D A;  2WXN A;  3VUX A;  3Q8E A;  2IPK D;  4ANX A;  1OQQ A;  4DXF A;  2LHD A;  1V6E A;  4GGQ A;  3BZD B;  1WYW B;  4IG7 B;  1U4A A;  2JVC A;  1MFW A;  4MH0 E;  1NEN B;  2PMV A;  4AUQ C;  3PHX B;  4JWU C;  4R3D A;  1EF1 A;  2PJH A;  3V61 A;  3I9V 1;  2MA9 B;  4II2 B;  4YWG G;  1Z2M A;  2JYE A;  4RH6 A;  3EEC A;  1ZXH A;  1HEZ E;  2C5L C;  3AE7 B;  2Y3A A;  2NTS A;  2K1F A;  2WXL A;  1JQ4 A;  4JIO U;  3L4P A;  3UF8 A;  3MHZ A;  3DWM A;  1GUA B;  4K3B A;  2OOB B;  3BYT B;  4B9K A;  3KQ4 A;  2KKC A;  1E7P B;  4FJV B;  3H8H A;  1WM3 A;  2K39 A;  4P6V F;  2LVQ A;  2J42 A;  2KAC A;  4M02 A;  1WXV A;  1FCL A;  2MEK A;  1EO6 A;  3HVD A;  3IAM 1;  3KUC B;  4XWW A;  2KT7 A;  3VUY A;  4IDI A;  2ON8 A;  2RSU A;  4HPL B;  4ANV A;  2LUM A;  3A33 B;  1DGJ A;  3NVY A;  3H6N A;  3GE3 C;  2ZJD A;  4KZC A;  2UYZ B;  1P7E A;  3C19 A;  2W3S A;  1FD6 A;  4WIP A;  4WQO B;  4YSZ B;  4DWF A;  2V0G A;  2KNB A;  1JAL A;  1QLB B;  5E6P A;  5H8Y E;  2WWZ A;  3QAQ A;  4PYZ A;  2LFI A;  2KDI A;  1E8Z A;  2I1K A;  3PVL A;  4HPM B;  1AYF A;  4YTM B;  1FO4 A;  2LHE A;  4MEL A;  4P1B C;  3FAH A;  3O13 A;  2ZCB A;  2NTT A;  3IT6 B;  4XX5 A;  4TMA B;  4EOY A;  2WXM A;  1J8C A;  3W1Y A;  1L0Y B;  3WIM A;  3PO0 A;  2VRR B;  1FFV A;  1QQR A;  2HE7 A;  1BT0 A;  3QHT A;  3RI7 C;  3KLS X;  1IYF A;  2K0P A;  1N61 A;  2V3S A;  3W1S A;  2EKI A;  1WX9 A;  2J0K A;  4ZRK A;  2PTL A;  1P9D U;  3CWI A;  2ZEQ A;  5BMH A;  1XO3 A;  2WLB A;  1I4Q A;  4WJN A;  1YQ4 B;  3CIR B;  2KTF A;  3NG0 A;  5IAA C;  4KV2 A;  5JHB A;  1NI3 A;  5E6N A;  5TR5 A;  3VUW A;  4ITK A;  2NBV B;  2LZ6 A;  1XF5 L;  2FAZ A;  4JGH B;  2V3P A;  3H7P A;  4IOI E;  4FLH A;  3H7P B;  1WIA A;  3TBL D;  3EFC A;  2RDH A;  3BWU D;  4NAW B;  4DDI D;  4RF0 A;  2R2O A;  2XBB C;  4A6Q A;  2C9W B;  1BXT A;  4AJY B;  2CU1 A;  1F2R C;  3VXW A;  3ZJV A;  4MGI E;  1E10 A;  3KW5 B;  1E5W A;  2PE9 A;  4LNN A;  1SE9 A;  1KLG D;  3V62 A;  2K9X A;  1WI0 A;  3AEB B;  2HDE A;  1SE2 A;  4DHJ B;  2MBB B;  2K25 A;  4TQ0 A;  1V2Y A;  2L52 A;  5AZF A;  2K8B A;  1GG3 A;  1PQS A;  3I3T B;  3WAL A;  1P3Q U;  3W5U B;  3JVZ X;  1YNT E;  3ZDM C;  3DBL B;  3Q14 C;  1MPE A;  1TKG A;  4KX6 B;  3ECI A;  1TGZ B;  5J17 A;  1NYQ A;  2BB6 A;  1MHH E;  4HJK A;  4HXD A;  2N9P C;  1UNS A;  4G0N B;  2MBH A;  2A5U A;  1P1A A;  1FNW A;  2JU6 X;  1LXD A;  3RNA C;  5C3J B;  1XQQ A;  2YEP B;  4HVB A;  4GDL A;  2L05 A;  3B1L X;  4GDL B;  1V97 A;  3ZUN A;  2V9H A;  2JXX A;  1DOX A;  1ROE A;  1ZKH A;  1C76 A;  3M63 B;  1GC6 A;  1OTR B;  4E3C A;  3DBS A;  4MAC A;  1ZUD 2;  1C4P A;  1WX7 A;  1YJ1 A;  4PK1 A;  5DPR A;  1HZ5 A;  2Z59 B;  3D32 A;  2KVZ A;  2KDE B;  3ZXV A;  4HDQ A;  1E0Z A;  1AAR A;  2IBI B;  1KOT A;  1HE8 A;  3MP9 A;  2I2Y A;  3AXC A;  3N20 C;  2LAS A;  2KWC A;  3P4P B;  1TS5 A;  3PS6 A;  4C7Y A;  4YSY B;  3VR9 B;  2V1Y A;  1JRU A;  1WSP A;  2DLB A;  3GOE A;  1WXS A;  2QJL A;  4A9A A;  3Q8C A;  2IO0 B;  2KX0 A;  2HJ1 A;  4RM8 A;  2KXJ A;  3C0R B;  4WQM A;  1UBI A;  2G45 B;  5L83 A;  5AZH A;  2CHW A;  2WXH A;  3AEF B;  4L1B A;  2WXF A;  4AP4 C;  4MSQ B;  5GMV A;  3VHT C;  3AE2 B;  4CYE A;  5E6O A;  3DVG X;  4KDL B;  1EWC A;  3PHW B;  1KH0 A;  2GBJ A;  3VDZ A;  3M3J A;  4MH8 A;  2QIE B;  4W9E A;  2IO1 B;  1DOY A;  2N9K A;  2BGF A;  2KC1 A;  1C78 A;  1V49 A;  3U7D A;  4S17 A;  1HXY D;  3VH4 B;  3AN1 A;  5D3I B;  4CQN A;  4HWI B;  1XXG A;  3NHE B;  3EC8 A;  1WGH A;  1I35 A;  4PS3 A;  1E8W A;  3DHI C;  5HG2 A;  3DWG C;  1KLV A;  2WHI A;  1T0Y A;  1ZGU B;  2AQ2 B;  3UIN B;  4H2A A;  4AJW A;  3SFD B;  2RD0 A;  3VTW A;  1PFD A;  3LYY A;  5MPO A;  1E6E B;  4LDT D;  4C7Z A;  1WJN A;  3VFK A;  1WXQ A;  2WP9 B;  1EUV B;  2N1W A;  2D07 B;  3EFU A;  2MWS B;  4FXC A;  1YOV B;  2MJ3 A;  2OED A;  1AN8 A;  2M4N A;  2WXQ A;  4ARC A;  1RYJ A;  5EE9 A;  4C4V A;  2CKH B;  3AU4 A;  1SF0 A;  4BBN F;  1V81 A;  1TIF A;  4C4V B;  2BYE A;  3QJZ A;  5D3D A;  2G4D B;  3SFE B;  2JXT A;  1XLP A;  2K6Q A;  1IBX A;  1C1Y B;  1J7B A;  1UWX A;  3Q8A A;  4NPN A;  1IBX B;  4K7U A;  4NJ6 A;  3DCG A;  2BT6 A;  3EUB 2;  2BPS A;  4KKI A;  3RNE C;  1SB3 C;  4KGR A;  3ALB A;  5LNK 1;  4IM2 A;  1R7S A;  3BVM A;  3NOB A;  2MHJ A;  1ZE3 D;  1CQV A;  4WJQ A;  3PLV A;  4HRS A;  4DXG A;  1XLQ A;  4JWS C;  4M0W A;  1Z5S B;  3PPA A;  3WAP A;  4M0W B;  4M01 A;  1V5T A;  2KFJ A;  4OZB A;  4HEA 1;  3RNG C;  4G50 A;  1M4V A;  1FCC C;  5I4D A;  2AL3 A;  1N6Z A;  2L76 A;  2BBC A;  1PGA A;  2JUO A;  1VCB A;  1UUP A;  3FKY A;  4ARI A;  1GJZ A;  4E74 A;  1SIJ A;  4TUU A;  4DHZ E;  1K53 A;  4A90 A;  2LGD A;  1VR9 A;  4ZRJ A;  3T8M A;  2R2Q A;  3Q8B A;  3HIZ A;  3LJ3 A;  3NY5 A;  3KUD B;  4W9G A;  3DBL I;  4YTP B;  1R4N B;  3ZJT A;  3AEG B;  2IND C;  3L17 A;  3L54 A;  1WGG A;  4ASW C;  4MSM B;  1NEK B;  1M94 A;  3AEE B;  2ACZ B;  3CST A;  4XC2 A;  4LJO B;  4LJP B;  2KLC A;  4ICU A;  3RZF A;  4B0M A;  5GXG B;  2INN E;  4HRO A;  2JX5 A;  4GN1 A;  4JPS A;  1XEE A;  4BZA A;  2UU7 A;  3KVF B;  2DYB A;  4BFR A;  2SEB D;  2WDT B;  4JL9 A;  4N6E B;  4D2K A;  2G9H D;  3H9D A;  1UEL A;  2AYO B;  3Q69 A;  1TBE A;  4KSL C;  4TQ1 A;  5L95 C;  1WGD A;  3HVZ A;  3KUZ A;  3PZ8 A;  1SJH D;  1VZ8 A;  4IC7 B;  3ZJU A;  1OQY A;  2NBW B;  3R8B A;  4JE3 B;  4LLG M;  2L0T A;  3RN9 C;  1XLN A;  3IVF A;  4RM9 A;  2GBN A;  4O1N A;  4EZL A;  3CMM B;  1WR1 A;  3ZNH B;  4PYU A;  1AWD A;  2AWT A;  1D5M C;  3KWL A;  4RF1 A;  1YN3 A;  2IO3 B;  3NJT A;  1MI0 A;  4GSW A;  3V6C B;  1ZPS A;  4C80 A;  2L3Z A;  3P42 A;  3QWZ B;  3MFG A;  3AI5 A;  3RFZ B;  2ZPN A;  4I6N B;  2Z8L A;  2W55 A;  3TIX A;  1C9F A;  1OFF A;  2A4Z A;  2RR9 A;  5BMG A;  4WUR A;  3TL5 A;  3H1U A;  3TEZ A;  3MJW A;  2PPH A;  4F1S A;  1FEH A;  4YT0 B;  2N4F A;  4DHZ B;  2BF8 B;  4ZYS A;  1FXT B;  4G11 A;  1KFY B;  1UGJ A;  3RYT A;  4WAA A;  3GB1 A;  1MVK A;  1L2N A;  2JSV X;  3HM6 X;  1GNU A;  1JWB D;  2DZM A;  2KVR A;  2DEN B;  4LCD E;  5C2T B;  1UH6 A;  2DHZ A;  3PRM B;  4E71 A;  3I57 A;  2RGF A;  3AV8 A;  2E3T A;  1YIW A;  3ENE A;  1GC7 A;  4OVV A;  3GZN B;  2EMS A;  4WWM A;  3R2I A;  1YQB A;  2LJ5 A;  3CSF A;  3ZW3 A;  2LUE A;  3I5J C;  1H4R A;  4XGA B;  5KHO A;  1V86 A;  4RGM A;  1ET6 A;  1WH3 A;  3AE9 B;  3DBH I;  4W9K A;  3RNB C;  3RUL A;  2DAF A;  1K51 A;  5FK9 C;  5EE1 A;  4ZYN A;  1WGK A;  3AED B;  2I1J A;  1I4G A;  3L10 B;  4JQW C;  2KFK B;  1KF6 B;  2IY0 B;  4W9L A;  2L7R A;  4LDT B;  1R4M B;  3IFW B;  3Q3F A;  2W9N A;  4USA A;  3UGB B;  4L2Y A;  3AH7 A;  4IM3 A;  2KQ4 X;  3DOW A;  3A9J A;  1Q5W B;  3EGR A;  3N32 A;  3NRZ A;  3WAN A;  1C4C A;  2WGS A;  3A9J B;  3ZXR A;  5D94 A;  2IZV B;  2IY1 B;  2ZVO A;  2HJ8 A;  1SIF A;  2RMM A;  2CS4 A;  2ZZP B;  2WX1 A;  1FRD A;  3UQA A;  2JYT A;  3TUO A;  4HJG E;  3RPF C;  2DX5 B;  3ML8 A;  3HHM A;  1UBQ A;  1X1M A;  5AUI A;  2WXG A;  3W9C B;  3PLU A;  2FCQ A;  1C3T A;  2BTE A;  5C23 A;  4XDC A;  4NY0 A;  3B2G A;  4K7S A;  2DWQ A;  3DQV A;  1E7U A;  2ZW1 A;  1WRD B;  3ZDT A;  1TS3 A;  2KDB A;  4WJO A;  3TEY A;  1D5X C;  1K8R B;  1WMH A;  2AX5 A;  1TZ1 A;  3P4R B;  3B0A A;  1P7F A;  1WMH B;  4NAM A;  3X23 A;  3NZ3 A;  1GB4 A;  1J7A A;  3QQ8 B;  4NAW A;  4KDI C;  2BS3 B;  2KJ6 A;  4BKS D;  3KYD D;  2DAJ A;  3BVG A;  2KJR A;  2ZVN A;  4P1C C;  1TYG B;  2LD9 A;  3ZKJ C;  1EWY C;  3JSV A;  2GBK A;  4RGN A;  2XEW A;  2O2V A;  1XLO A;  2QCZ A;  1SSN A;  3JSV B;  4LNO A;  1TY2 A;  2O2V B;  2QDF A;  2G1E A;  1E7V A;  3KWV A;  1WE7 A;  2IO2 B;  2MX2 A;  1WGY A;  3A9K A;  3ML9 A;  4JLC A;  4BKT A;  3A9K B;  5EE3 A;  1FM0 D;  2Z0D B;  3N3K B;  1T0Q C;  3VTV A;  4DBG A;  1YJJ A;  2D5G A;  1VZ6 A;  1D6E C;  5LLI A;  2YLM A;  2W3R A;  2KDF B;  3BIN A;  3NVV A;  5G5G A;  5DPS A;  1JWM D;  2J0J A;  4JX1 C;  1YX5 B;  1E90 A;  3NUH B;  4NQL B;  3QIJ A;  2V3N A;  1WYG A;  4LTU A;  3V6E B;  1ZP0 B;  2CJN A;  2PKO A;  2LMC A;  4NNJ B;  5HFY A;  4FHK A;  1A70 A;  2E6X A;  3QC8 B;  1UF0 A;  2KQ7 A;  2ZPY A;  1TT5 B;  2KYW A;  1V9J A;  1N62 A;  1F52 A;  2CU3 A;  2GB1 A;  1IPG A;  4LNF A;  4GMV A;  1WY8 A;  2WQY B;  1D4B A;  2K22 A;  4J6I A;  3MC8 A;  2D11 A;  2J53 A;  3CF6 E;  1MJD A;  3IXS A;  3M95 A;  2PW9 A;  1PGX A;  1WJ6 A;  3DHH C;  5LXI B;  2WXR A;  4N59 A;  5G55 A;  2K6D B;  1FRR A;  5EE0 A;  1XCT L;  1N5X A;  3SEB A;  1G6J A;  4BVU C;  4Q2J A;  1BUI C;  2JZZ A;  4OVZ A;  3AE4 B;  1Q10 A;  1Q1O A;  2KN4 A;  5AZG A;  2C7H A;  2ONQ A;  2EKE C;  1JWS D;  3U7Z A;  1HA5 A;  5IN7 A;  3GZN I;  3VRB B;  4OZC A;  2WDR B;  4L23 A;  4W9I A;  1WF9 A;  1ZXI A;  3Q6B A;  2DNF A;  1WX8 A;  4BBN C;  2IJ0 A;  2NCN A;  5DPT A;  4OZA A;  4B95 A;  2L32 A;  4US8 A;  5BYS A;  3OJ4 B;  4W9H A;  2YEP F;  2QC8 A;  4FAD A;  4AQ7 A;  1JWU D;  2BQQ A;  1YJI A;  4REZ A;  5HI1 A;  3N1X C;  3MJ5 A;  2GMI C;  1VLB A;  2FIF A;  5CTR C;  1MHX A;  2MH7 A;  2QEJ C;  3A1Q A;  4WWP A;  2VZK D;  1UGM A;  4EFO A;  3BK1 A;  1WXM A;  3UIO B;  3A1Q B;  2LWP A;  4AS1 A;  1CJE A;  4BKG A;  4FJZ A;  1HTQ A;  4LK0 M;  3NVZ A;  2MRP A;  2W82 A;  2MBE A;  3JW0 X;  1SE4 A;  2G4S A;  1ZOY B;  4EUT A;  3U8Z A;  1C79 A;  3U52 E;  2KLG A;  2AEH A;  1QT9 A;  4HDO A;  3PSE B;  3N1Y C;  2VH1 A;  3Q3J A;  1MG4 A;  4A3O A;  1JW9 D;  2W54 A;  2IGH A;  1WWT A;  4TKN A;  2BB5 A;  5BMI A;  1UZX B;  5AUK A;  1DYQ A;  1T3Q A;  1Q0W B;  2KQS A;  4XYC A;  2D3G A;  3PT2 B;  2PLP A;  3APF A;  2DYM A;  1KLU D;  2O6V D;  5IOI A;  5G2N A;  4RFB A;  5FR3 A;  3RNC C;  5DPW A;  4ZDV A;  1L7Y A;  1SJE D;  1NYR A;  3EHV A;  5T8I A;  1QIL A;  1F2R I;  3ZVV A;  5HHD G;  2KX3 A;  3ZTC A;  4PS7 A;  2K3U A;  1NI2 A;  1SGH A;  3NS1 A;  3UIP B;  1YN5 A;  2MJD A;  3RT3 B;  4NJC A;  2OJR A;  2BKR B;  4BKS A;  2N7E A;  2Z0E B;  3TEX A;  3BYY B;  4GDK A;  3SR6 A;  3ETR A;  1D3Z A;  2JPH A;  2GI9 A;  3MC9 A;  4GDK B;  3N1Z C;  3APD A;  2BKF A;  1S3S G;  1I4X A;  2LVO A;  4HLE A;  5DCN A;  1YN4 A;  3LXF A;  4TV3 A;  2CR5 A;  1JCK B;  2NS5 A;  1CK1 A;  1IGD A;  2NVU I;  2HTM E;  1L5P A;  5D6J B;  5G5H A;  2ZCC A;  5CHV C;  4C00 A;  1WZ3 A;  2WNM A;  2FUH B;  2DYO A;  2UWQ A;  2FUG 1;  4B0E A;  3AE5 B;  1OGW A;  5IO9 A;  2GLS A;  2H89 B;  4KKJ A;  3AU5 A;  2GOW A;  5FR6 A;  2KAN A;  4KVG B;  3QK0 A;  2LRU A;  3K9O B;  1TJE A;  3W5V B;  2KDM A;  2IDY A;  2TSS A;  2L1A A;  3EA6 A;  3ZNI D;  5EDS A;  1LGR A;  4OW0 A;  2GBR A;  2LI5 A;  4HCN B;  4K7W A;  4K3C A;  1VD2 A;  2B3A A;  3VH3 B;  4C56 C;  1J0G A;  4P7I A;  1WJU A;  1V80 A;  3B08 A;  4DDG D;  2M0X A;  2INP E;  4NJ7 A;  3DPD A;  2HD5 B;  4M8M A;  3ZNG C;  1RLF A;  2KHW B;  4I6P A;  2MQJ A;  1FFU A;  2CJO A;  3DHG C;  4RGO S;  2KOX A;  3AM9 A;  2KJH B;  2MSE D;  4YXD B;  3GP7 A;  4MM3 A;  1RFA A;  1QOG A;  3ABV B;  1Y8R C;  5D7G A;  5H92 C;  2DZI A;  3DBR B;  4MM3 B;  1IP9 A;  2INC C;  1F1H A;  2ZNV C;  2KO3 A;  3SDL C;  3AEC B;  2JY6 A;  4W9C A;  2WXK A;  1WE6 A;  1NBF C;  2KWV B;  5CHW A;  4DK5 A;  1RM6 C;  4BAX A;  3GS2 A;  4NQK E;  2MBO A;  1STE A;  3P63 A;  4EEW A;  2QSD A;  3NZU A;  2M17 A;  2DZJ A;  4MGY E;  1A5R A;  1FXI A;  2MLB A;  3C8Y A;  4OHJ A;  3NS8 A;  2MW5 A;  3ZRF A;  1ET9 A;  2N7D A;  1I4H A;  2YVC A;  4P16 A;  3R7Q A;  1SEB D;  1LO5 D;  1V1P A;  1L4D B;  1JRP A;  2D10 A;  3U4E G;  4HK2 A;  4RGT A;  4URK A;  2FCS A;  1V1P B;  4ZHO A;  3S2A A;  4WWN A;  2AL6 A;  3ZGZ A;  2G3Q B;  2KFK A;  4A3P A;  1WJ4 A;  1WGR A;  2KZR A;  4YSX B;  1L6U A;  3PRP B;  2DZK A;  1HZ6 A;  2MBQ A;  1I4R A;  1UD7 A;  4RNA A;  2WS3 B;  2N1V A;  2M8S A;  2MCN B;  2VZK B;  1FNU A;  2J0M A;  5FKA C;  3HUI A;  2BS4 B;  3RNF C;  3UI3 A;  1K50 A;  2PVO D;  1ACC A;  4PS8 A;  4OVU A;  2K5P A;  2CHZ A;  2FNJ B;  4WWO A;  4ZRI A;  4MGK E;  2H88 B;  1FMA D;  3OAW A;  4GLS C;  2FCM A;  4ANW A;  4GU2 A;  4HKZ E;  1XT9 B;  3IBE A;  4MJS A;  2KMM A;  4QAY A;  2D3A A;  4RCO A;  1LQB A;  4J3O D;  3OG5 A;  4MJS B;  3BVZ A;  1Y56 A;  3QCA A;  1KM7 A;  2QMT A;  2WXJ A;  4IW0 A;  1OQR A;  3BII D;  4AWJ A;  3OWE B;  2N9X A;  1E8X A;  1QKZ A;  2WU5 B;  3WAO A;  2O6V A;  4EZJ A;  1VJK A;  2C7M B;  4X57 B;  2O6V B;  1V5O A;  2BWE S;  3IT4 B;  2AQ3 B;  1KRH A;  1FNV A;  3R2T A;  2FE8 A;  4KGT A;  1FPY A;  1I4P A;  1L4Z B;  3B9J A;  3PZD A;  2EMT A;  1XCQ L;  2M0A A;  3R3M A;  3P2B A;  4ICV A;  3NVW A;  2QIL A;  3U2S C;  3BK2 A;  3PV1 A;  1E9M A;  2JRI B;  2LEK A;  2PVG C;  1GPX A;  1N60 A;  1F77 A;  4EKU A;  1IUE A;  2KMA A;  2L83 A;  1N63 A;  1T5X D;  4IWO A;  2KN5 A;  2LVP A;  4G3X B;  3VQI A;  3AE3 B;  2SAK A;  3W1S C;  1R4N I;  4IWQ A;  1NVI D;  2Y5B B;  3BY4 B;  5HKH A;  5KHQ A;  3RZW C;  4DXA B;  4F7Z A;  4YTN B;  3JYU A;  3KYC D;  3ZQ4 A;  3L13 A;  4WAF A;  2RDG A;  4W9D A;  1TY0 A;  5D2M B;  2Y5C A;  3PRE A;  4FUL A;  1QOA A;  4I6L B;  4F8C B;  5BYQ A;  2X8X X;  1RAX A;  5CX3 A;  1ZW7 A;  3VR8 B;  3DVN U;  4KSK C;  2KWD A;  1F0Z A;  3QA8 A;  3VVW B;  1ZDV A;  5BYR A;  3L0W B;  4IM0 A;  3SU8 X;  3RCZ A;  2JT4 B;  1SBB B;  2OHF A;  2KTR A;  3P4S B;  3ZYY X;  1V1O A;  2KTR B;  4GB9 A;  1I42 A;  3E9S A;  3WCQ A;  3QX1 A;  1MG8 A;  2JWZ A;  1QZE A;  2K8H A;  3Q3N C;  3KH0 A;  2I38 A;  2NBU A;  3ZIM A;  5J2R A;  4MT5 A;  2D2Q A;  1P98 A;  2V4L A;  3UQB A;  4ZRQ A;  1VZ7 A;  2LXA A;  1FIQ A;  2KWU B;  4GIV A;  3HM3 A;  2XNA C;  2IGD A;  2IGG A;  3H7S A;  1JRO A;  1QF6 A;  4YL8 A;  5C1Z A;  1H8C A;  3FIL A;  2WU2 B;  4XZ4 A;  2Q5W D;  3TJP A;  2M19 A;  2FCN A;  4K81 A;  1SE3 A;  3FIL B;  2MJE A;  2JZ3 B;  2LRW A;  2WXO A;  3MHS D;  1CMX B;  1LFD A;  3DBR I;  5BO4 B;  5IKC M;  4XE0 A;  4AOF A;  3PZ7 A;  1WZ0 A;  1J7C A;  4IUM B;  4FN2 A;  3T3O A;  3GE8 C;  2BYV E;  4N58 A;  4ACF A;  2V4I B;  1IGC A;  1E8Y A;  2N9L A;  4KZ0 A;  4A8X C;  1GB1 A;  3U30 A;  2WXP A;  5JXV A;  2OJW A;  4LNI A;  1EF5 A;  3URY A;  3ZTD A;  3TMP B;  1HQR D;  5JZE B;  2L0F A;  4A20 A;  4HCP B;  2BW2 A;  3P1M A;  2C60 A;  1HTO A;  2JQR B;  1TKE A;  2WYQ A;  1SXT A;  2BVC A;  2M1M A;  2KK8 A;  2LJI A;  1TS2 A;  4XDD A;  3PGE A;  5JHA A;  4ZHP A;  3SHQ A;  2RPV A;  2BS2 B;  1ZDX A;  4II3 B;  3WAM A;  3NZS A;  4DQO C;  3IAS 1;  3TSS A;  1T0R C;  4MGZ E;  5IP4 D;  1NDD A;  5CHF A;  5TSS A;  1WXA A;  3I63 C;  3VRA B;  1R4M I;  2LGY A;  3Q3M C;  1YMH E;  4S0R A;  3LDZ E;  3OJ3 A;  4W9J A;  3HRD D;  3IHP C;  2EEL A;  4N9F 4;  3ZNZ B;  1QOB A;  1TZO A;  1F9J A;  1J19 A;  3AE8 B;  4CHK A;  4NZL B;  2J4X A;  2CHX A;  3K9P B;  2N0S B;  3DBH B;  1B1Z A;  1T6B X;  3OLM D;  4EE2 A;  3MC0 B;  3Q2A C;  2IYD B;  5LXH A;  1C4A A;  1TTN A;  4IWP A;  1VRA B;  2ASQ A;  1WR6 E;  4B6W A;  2M56 B;  3V3X A;  1PUT A;  1D5Z C;  2GBM A;  4XWT A;  2PEA A;  3V05 A;  1OEY A;  3QAR A;  2LXC A;  4WH4 A;  2ICI A;  2XK5 A;  1P0R A;  3A4S C;  1ENF A;  2BWF A;  2C7N B;  2BYF A;  4GOC A;  1OEY J;  2XK5 B;  1PYW D;  4UDU C;  3LB8 C;  3SD5 A;  3T3N A;  1DOI A;  2D3C A;  1WM2 A;  3AEA B;  3MTN B;  5IA7 A;  4M00 A;  1QOF A;  1T0S C;  4FJY A;  3N30 A;  2WDV B;  4FBJ B;  2PE6 B;  2J7Q B;  4KGS A;  4TSS A;  1AW7 A;  4RMA A;  1ISN A;  2LGX A;  3AE1 B;  4ZOH C;  2L8J A;  5J18 A;  1EM7 A;  2KMC A;  2BYT A;  2JF5 A;  1LM8 B;  4HKQ A;  3L16 A;  1UWM A;  3RD2 A;  4A55 A;  3Q8F A;  5AEK B;  4FA6 A;  2WX0 A;  4EZK A;  1B9R A;  2REX A;  1N5W A;  1L6V A;  1RFK A;  1ESF A;  3N9Y C;  3TCA A;  2QHO A;  3AUL A;  2ZW0 A;  1I7H A;  2NR2 A;  3AB5 A;  2JWU A;  1RWS A;  1PDX A;  3V60 A;  1FXA A;  3AE6 B;  2HTH A;  4BOZ B;  4WJP A;  3HK0 A;  2R61 A;  3VTU A;  2LGS A;  2RDB C;  4ZRP A;  2JRH A;  2RPQ A;  2FBW B;  1TKY A;  2L00 B;  4IKG A;  2GRI A;  3DVG Y;  3M62 B;  3Q3O C;  3R7R A;  2NPT A;  3X0W A;  4W9F A;  3APC A;  1GOZ A;  2FID A;  2K8C A;  4GXB A;  2N7J A;  1KTK A;  2NPT B;  4CO7 A;  4DHJ D;  3A4R A;  4PT5 A;  3O65 B;  3AMZ A;  2VH2 A;  4KIK A;  1CZP A;  2WDQ B;  2KC2 A;  2Y5P A;  3R66 C;  3DVN V;  4KIK B;  2N9E B;  3DDC B;  3PRZ A;  1EU4 A;  3IG3 A;  2J52 A;  1WFY A;  3WA0 A;  3E56 A;  3J9C A;  4MEM A;  4MDK E;  3L08 A;  2X38 A;  2WXI A;  2MP2 A;  3ZRC A;  4BOS C;  2D3B A;  3P4Q B;  1L0X B;  2KD0 A;  2MP2 B;  1K52 A;  3ZO5 B;  4K1R B;  2NMQ A;  1WRI A;  4LNK A;  2JZP A;  3RMK C;  5E6J A;  1TS4 A;  2KAJ A;  1XD3 B;  1RRB A;  1BML C;  1S1Q B;  1C77 A;  1YD8 U;  3VAW A;  3RUI B;  1YQ3 B;  2ZNV B;  1JML A;  3FC4 A;  2DBY A;  4FHJ A;  1V8C A; 
#chains in the Genus database with same CATH homology
 3T9L A;  1WY8 A;  4NPN A;  3PTF C;  4J6I A;  4K7U A;  4NJ6 A;  3DCG A;  1KJT A;  2D11 A;  4ANU A;  2BPS A;  3CF6 E;  1YX6 B;  3ALB A;  3ONS A;  3M95 A;  4IM2 A;  4M8N A;  3ZLZ A;  3PZD A;  5JH5 C;  2EMT A;  3NOB A;  3R3M A;  3P2B A;  4WJQ A;  4ICV A;  3PLV A;  1WJ6 A;  5LXI B;  3PV1 A;  3VUX A;  5G55 A;  2JRI B;  2K6D B;  1Z5S B;  3PPA A;  4ANX A;  3WAP A;  4M0W B;  4EKU A;  1V6E A;  4GGQ A;  1V5T A;  1G6J A;  2KFJ A;  4BVU C;  1WYW B;  4IG7 B;  2JZZ A;  2KMA A;  1U4A A;  2JVC A;  4G50 A;  4MH0 E;  2AL3 A;  1Q1O A;  4AUQ C;  4IWO A;  5AZG A;  2C7H A;  3PHX B;  2KN5 A;  2LVP A;  4G3X B;  2L76 A;  1EF1 A;  2PJH A;  3V61 A;  2EKE C;  2MA9 B;  4II2 B;  3VQI A;  1Z2M A;  3EEC A;  2JUO A;  2C5L C;  3GZN I;  1VCB A;  3W1S C;  1R4N I;  4IWQ A;  1GJZ A;  4E74 A;  2Y5B B;  2K1F A;  3BY4 B;  4TUU A;  4DHZ E;  4W9I A;  1WF9 A;  5HKH A;  5KHQ A;  3RZW C;  4JIO U;  4DXA B;  1WX8 A;  3UF8 A;  4BBN C;  3JYU A;  4F7Z A;  3KYC D;  2LGD A;  2NCN A;  3L13 A;  5DPT A;  4W9D A;  4B95 A;  1GUA B;  4ZRJ A;  3T8M A;  5D2M B;  2OOB B;  3OJ4 B;  2R2Q A;  3PRE A;  3HIZ A;  4FUL A;  4W9H A;  3LJ3 A;  4I6L B;  4F8C B;  4B9K A;  4FAD A;  3NY5 A;  3WAM A;  1RAX A;  3KUD B;  5CX3 A;  2KKC A;  1ZW7 A;  4W9G A;  3DBL I;  3DVN U;  4KSK C;  3QA8 A;  3VVW B;  4FJV B;  3L17 A;  3L54 A;  1WGG A;  3L0W B;  4ASW C;  1WM3 A;  4MSM B;  1M94 A;  2K39 A;  3CST A;  4XC2 A;  4IM0 A;  4LJO B;  4LJP B;  2LVQ A;  3SU8 X;  2GMI C;  2KLC A;  4ICU A;  3RCZ A;  3RZF A;  1WXV A;  2JT4 B;  2FIF A;  2KTR A;  5CTR C;  1EO6 A;  3A1Q A;  4GN1 A;  4WWP A;  3KUC B;  1UGM A;  3KVF B;  2DYB A;  4EFO A;  2KTR B;  1WXM A;  3UIO B;  3VUY A;  3A1Q B;  4BFR A;  2LWP A;  4GB9 A;  2WDT B;  1I42 A;  2RSU A;  4HPL B;  4JL9 A;  4ANV A;  3QX1 A;  1MG8 A;  2JWZ A;  4BKG A;  3A33 B;  3H9D A;  1QZE A;  1UEL A;  4FJZ A;  2K8H A;  2AYO B;  3H6N A;  2MRP A;  1TBE A;  3KH0 A;  2MBE A;  3JW0 X;  4KSL C;  4TQ1 A;  2G4S A;  5L95 C;  2ZJD A;  4EUT A;  3U8Z A;  4KZC A;  2UYZ B;  2KLG A;  1WGD A;  2NBU A;  3ZIM A;  5J2R A;  2AEH A;  2D2Q A;  3KUZ A;  1P98 A;  2V4L A;  4IC7 B;  3UQB A;  4HDO A;  4WQO B;  3PSE B;  4DWF A;  2LXA A;  2KWU B;  3Q3J A;  4GIV A;  2KNB A;  3HM3 A;  4A3O A;  1OQY A;  4TKN A;  3H7S A;  1UZX B;  2NBW B;  5E6P A;  4YL8 A;  2WWZ A;  2L0T A;  3QAQ A;  4PYZ A;  1Q0W B;  5C1Z A;  1H8C A;  2KDI A;  1E8Z A;  2I1K A;  2KQS A;  3IVF A;  4XZ4 A;  3PVL A;  4HPM B;  4RM9 A;  2GBN A;  2D3G A;  3TJP A;  4MEL A;  2FCN A;  4EZL A;  3CMM B;  4K81 A;  1WR1 A;  3ZNH B;  4PYU A;  2ZCB A;  2AWT A;  3PT2 B;  2JZ3 B;  3APF A;  2LRW A;  2DYM A;  2O6V D;  3MHS D;  1CMX B;  4XX5 A;  1LFD A;  3DBR I;  5BO4 B;  5G2N A;  4EOY A;  2IO3 B;  1J8C A;  3W1Y A;  4AOF A;  5DPW A;  4GSW A;  3WIM A;  4ZDV A;  1L7Y A;  1WZ0 A;  2VRR B;  3V6C B;  2HE7 A;  3EHV A;  1BT0 A;  3QHT A;  4FN2 A;  4IUM B;  2L3Z A;  3ZVV A;  1IYF A;  2KX3 A;  2V3S A;  3QWZ B;  3W1S A;  3ZTC A;  1WX9 A;  2BYV E;  4PS7 A;  2J0K A;  4ZRK A;  1NI2 A;  1P9D U;  1SGH A;  2ZEQ A;  1E8Y A;  3AI5 A;  4KZ0 A;  2ZPN A;  4I6N B;  4WJN A;  3UIP B;  3TIX A;  2KTF A;  5IAA C;  2A4Z A;  2RR9 A;  4KV2 A;  2OJR A;  3RT3 B;  2BKR B;  3U30 A;  4BKS A;  5JHB A;  2N7E A;  3TL5 A;  2Z0E B;  3H1U A;  5E6N A;  3MJW A;  1EF5 A;  5TR5 A;  3VUW A;  3ZTD A;  3TMP B;  2PPH A;  2NBV B;  4GDK A;  4F1S A;  2LZ6 A;  1D3Z A;  2FAZ A;  5JZE B;  4JGH B;  2JPH A;  2L0F A;  2N4F A;  4HCP B;  3H7P A;  4A20 A;  4DHZ B;  2BF8 B;  1FXT B;  4FLH A;  2C60 A;  4GDK B;  4G11 A;  3APD A;  3RYT A;  2BKF A;  1S3S G;  1WIA A;  3H7P B;  4WAA A;  3TBL D;  2LVO A;  4NAW B;  2WYQ A;  5DCN A;  2O6V B;  2M1M A;  4DDI D;  4HLE A;  1L2N A;  2R2O A;  3HM6 X;  4TV3 A;  2KK8 A;  2CR5 A;  1GNU A;  2DZM A;  2KVR A;  2XBB C;  2DEN B;  4LCD E;  2C9W B;  1UH6 A;  4AJY B;  2DHZ A;  2CU1 A;  3PRM B;  3PGE A;  2NS5 A;  4E71 A;  3SHQ A;  5JHA A;  2RGF A;  3VXW A;  4MGI E;  2NVU I;  1YIW A;  3ENE A;  3KW5 B;  4II3 B;  3NZS A;  1E5W A;  1GC7 A;  2PE9 A;  1SE9 A;  5D6J B;  4OVV A;  3V62 A;  2ZCC A;  5CHV C;  1WI0 A;  2EMS A;  1WZ3 A;  4MGZ E;  1YQB A;  2LJ5 A;  1NDD A;  3CSF A;  5CHF A;  3ZW3 A;  2LUE A;  2FUH B;  1H4R A;  5KHO A;  1WXA A;  1V86 A;  2DYO A;  4DHJ B;  2UWQ A;  2MBB B;  1WH3 A;  2K25 A;  1R4M I;  4TQ0 A;  3DBH I;  2LGY A;  1V2Y A;  5AZF A;  2K8B A;  1GG3 A;  4W9K A;  1PQS A;  1OGW A;  2DAF A;  3I3T B;  3RUL A;  1P3Q U;  3LDZ E;  3OJ3 A;  3WAL A;  4W9J A;  3AU5 A;  2GOW A;  4ZYN A;  3JVZ X;  5FR6 A;  3ZDM C;  2KAN A;  3IHP C;  2I1J A;  4N9F 4;  3ZNZ B;  3L10 B;  4JQW C;  4KVG B;  2KFK B;  3QK0 A;  3ECI A;  1TGZ B;  1F9J A;  1J19 A;  2LRU A;  4CHK A;  2IY0 B;  4W9L A;  5J17 A;  2CHX A;  3K9O B;  2L7R A;  4LDT B;  3K9P B;  3IFW B;  3Q3F A;  2W9N A;  3ZNI D;  4HJK A;  4HXD A;  5EDS A;  3OLM D;  2N9P C;  2IYD B;  4G0N B;  2MBH A;  3UGB B;  5LXH A;  2A5U A;  4IM3 A;  1P1A A;  3DOW A;  2GBR A;  2LI5 A;  1Q5W B;  1TTN A;  3A9J A;  3N32 A;  4HCN B;  4IWP A;  3WAN A;  4K7W A;  1LXD A;  1VD2 A;  2B3A A;  3A9J B;  3VH3 B;  2ASQ A;  1XQQ A;  4HVB A;  1WR6 E;  1J0G A;  4B6W A;  5D94 A;  4P7I A;  2IZV B;  2IY1 B;  4GDL A;  2ZVO A;  2GBM A;  2HJ8 A;  1WJU A;  2PEA A;  1V80 A;  3B08 A;  4DDG D;  2M0X A;  2L05 A;  4NJ7 A;  1OEY A;  3DPD A;  3B1L X;  2HD5 B;  2LXC A;  1SIF A;  3QAR A;  4GDL B;  4M8M A;  3ZUN A;  2XK5 A;  1P0R A;  2CS4 A;  2JXX A;  2ZZP B;  3A4S C;  2BWF A;  3ZNG C;  2C7N B;  2BYF A;  4GOC A;  1ZKH A;  2WX1 A;  1RLF A;  3UQA A;  1OEY J;  2KHW B;  1GC6 A;  3M63 B;  1OTR B;  2DX5 B;  2XK5 B;  4I6P A;  3SD5 A;  3ML8 A;  2MQJ A;  4E3C A;  3DBS A;  3HHM A;  1UBQ A;  1X1M A;  1WM2 A;  2KOX A;  1WX7 A;  1YJ1 A;  3MTN B;  5IA7 A;  5DPR A;  3PLU A;  4FJY A;  3N30 A;  2FCQ A;  4FBJ B;  2Z59 B;  2KJH B;  3D32 A;  1C3T A;  2KDE B;  5C23 A;  2MSE D;  2J7Q B;  2PE6 B;  4HDQ A;  1AAR A;  2IBI B;  4NY0 A;  4MM3 A;  1RFA A;  4K7S A;  1KOT A;  1HE8 A;  5D7G A;  1Y8R C;  3DQV A;  2DZI A;  4RMA A;  3AXC A;  1ISN A;  1E7U A;  2LGX A;  5J18 A;  2L8J A;  2KMC A;  2LAS A;  2JF5 A;  1IP9 A;  2KWC A;  1WRD B;  1LM8 B;  3ZDT A;  2ZNV C;  2KO3 A;  3L16 A;  3PS6 A;  3SDL C;  2JY6 A;  4W9C A;  3RD2 A;  5AEK B;  2KDB A;  2V1Y A;  1WE6 A;  1NBF C;  4WJO A;  4FA6 A;  1JRU A;  3GOE A;  2KWV B;  5CHW A;  2WX0 A;  1WXS A;  4DK5 A;  1K8R B;  1WMH A;  2IO0 B;  2KX0 A;  1TZ1 A;  4RM8 A;  4NQK E;  2MBO A;  4EZK A;  2KXJ A;  3B0A A;  2REX A;  4EEW A;  3C0R B;  1WMH B;  3NZU A;  3X23 A;  2M17 A;  3TCA A;  1UBI A;  3QQ8 B;  2QHO A;  3AUL A;  4NAW A;  2G45 B;  2DZJ A;  4KDI C;  2KJ6 A;  4MGY E;  5L83 A;  1A5R A;  2NR2 A;  2MLB A;  4BKS D;  5AZH A;  2CHW A;  4AP4 C;  4MSQ B;  3NS8 A;  2MW5 A;  3KYD D;  2DAJ A;  5GMV A;  3V60 A;  3VHT C;  3ZRF A;  2KJR A;  2ZVN A;  2HTH A;  2N7D A;  4BOZ B;  4CYE A;  4WJP A;  5E6O A;  3DVG X;  2LD9 A;  4KDL B;  3HK0 A;  3ZKJ C;  3VTU A;  2YVC A;  3JSV A;  2GBK A;  3PHW B;  3R7Q A;  2XEW A;  2GBJ A;  2JRH A;  2O2V A;  2RPQ A;  3VDZ A;  3M3J A;  3JSV B;  2L00 B;  2D10 A;  3DVG Y;  4HK2 A;  3M62 B;  4W9E A;  4URK A;  2O2V B;  2IO1 B;  2FCS A;  1E7V A;  3R7R A;  2BGF A;  2NPT A;  3S2A A;  3X0W A;  2KC1 A;  4WWN A;  1V49 A;  1WE7 A;  2AL6 A;  4W9F A;  3U7D A;  3APC A;  2FID A;  2K8C A;  2IO2 B;  4GXB A;  3VH4 B;  2MX2 A;  1WGY A;  3A9K A;  3ML9 A;  2G3Q B;  2NPT B;  4HWI B;  2KFK A;  3NHE B;  4CO7 A;  4DHJ D;  4A3P A;  1WJ4 A;  4JLC A;  1WGR A;  4BKT A;  3A4R A;  3EC8 A;  1WGH A;  2KZR A;  3A9K B;  3PRP B;  1I35 A;  2DZK A;  3O65 B;  4PS3 A;  1E8W A;  2MBQ A;  2Z0D B;  4KIK A;  2KC2 A;  3R66 C;  1UD7 A;  1KLV A;  3DVN V;  1T0Y A;  1ZGU B;  2N1V A;  3N3K B;  3VTV A;  4DBG A;  2M8S A;  4KIK B;  2N9E B;  3DDC B;  3PRZ A;  2MCN B;  3UIN B;  3IG3 A;  4AJW A;  2J0M A;  1WFY A;  2RD0 A;  3WA0 A;  3VTW A;  5LLI A;  2YLM A;  4MEM A;  2KDF B;  3BIN A;  4PS8 A;  4OVU A;  4LDT D;  1WJN A;  2CHZ A;  2FNJ B;  4MDK E;  4WWO A;  3L08 A;  5DPS A;  4ZRI A;  2J0J A;  4MGK E;  3VFK A;  3OAW A;  1YX5 B;  2MP2 A;  1EUV B;  1E90 A;  3ZRC A;  4BOS C;  2FCM A;  4NQL B;  2N1W A;  2D07 B;  3EFU A;  3QIJ A;  4ANW A;  2MWS B;  2KD0 A;  2MP2 B;  4GU2 A;  3ZO5 B;  2M4N A;  1XT9 B;  4K1R B;  3V6E B;  3IBE A;  4MJS A;  1LQB A;  2CKH B;  3AU4 A;  4BBN F;  4NNJ B;  1V81 A;  4MJS B;  4FHK A;  1XD3 B;  3QCA A;  1RRB A;  3QC8 B;  1S1Q B;  1YD8 U;  3VAW A;  1KM7 A;  2KQ7 A;  3RUI B;  2BYE A;  4IW0 A;  4AWJ A;  2ZPY A;  2ZNV B;  2N9X A;  3QJZ A;  1E8X A;  2G4D B;  1V9J A;  3WAO A;  2O6V A;  4FHJ A;  4EZJ A;  2K6Q A;  1C1Y B;  1IPG A;  2C7M B;  4X57 B;  1V5O A;  2BWE S;  4GMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...