4JIOU

Bro1 v domain and ubiquitin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
75
structure length
75
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKMKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords BRO1
publication title The yeast alix homolog bro1 functions as a ubiquitin receptor for protein sorting into multivesicular endosomes.
pubmed doi rcsb
source organism Naumovozyma castellii
total genus 13
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4jioU00
1TGZB 4CYEA 2LRWA 4NAWA 1WY8A 2N1VA 4NAWB 3PSEB 1V49A 3T9LA 2LGDA 3Q3FA 2DYOA 1U4AA 2WYQA 1L7YA 2MSED 5GMVA 1HE8A 4FA6A 2BKFA 4M8NA 1E8YA 4EFOA 1YD8U 1L2NA 3X23A 1ZGUB 2MP2B 4FADA 2KNBA 2DX5B 2R2QA 4PYUA 3V60A 3UQBA 2N4FA 1OGWA 1WF9A 3GOEA 4M0WB 3VFKA 3AXCA 2KMCA 5TR5A 3ZNID 1I42A 2DENB 1R4NI 2UWQA 3A33B 3L13A 3OAWA 2V1YA 4RMAA 5IA7A 1WIAA 3M62B 2KN5A 1E8WA 3I3TB 3VAWA 3ML9A 4NY0A 2BKRB 1GC7A 4W9IA 4HJKA 2ASQA 2KDBA 2ZCCA 2ZVNA 3A9JB 3X0WA 1WXAA 2AL3A 3QHTA 4W9GA 1S3SG 2FAZA 3ECIA 2IBIB 3VTWA 3IHPC 4ICUA 4BKSA 4ANXA 2CS4A 1WGDA 1WGGA 2NBVB 2OOBB 3DPDA 3UQAA 4KDIC 2MA9B 3SDLC 3ZTDA 2M4NA 3RT3B 4II3B 2C9WB 3RYTA 3JSVB 2LXAA 3DDCB 4RM8A 2JXXA 4DHJD 4DBGA 5CX3A 2EKEC 3B1LX 1OQYA 2GMIC 3NOBA 3CMMB 2IYDB 2JZZA 3B0AA 1UBQA 1LXDA 1XT9B 2G45B 2KFKA 4G0NB 4FN2A 1LM8B 2FIDA 5JHAA 1EUVB 1WE7A 3DVNV 4K1RB 2NBUA 3VH4B 2KANA 2AYOB 4WWNA 2ZEQA 1A5RA 4KV2A 4CO7A 4E71A 4IM0A 3RD2A 4KVGB 2Z0EB 4ANWA 5J17A 5D94A 3H6NA 3RZWC 3RCZA 3PRMB 1RRBA 2B3AA 4TV3A 5G2NA 3ONSA 1V9JA 2CHWA 4K7UA 3M63B 3H1UA 2CHZA 3W1SC 1WZ0A 2DZMA 3PZDA 3PV1A 3K9PB 3QWZB 2KZRA 4GIVA 2IO0B 4BOZB 4EUTA 1RFAA 2ZPYA 4A3OA 1VD2A 2KWUB 3Q3JA 2D2QA 4GXBA 4PS8A 1WGHA 2RPQA 1TZ1A 1G6JA 5DPWA 4K7SA 2M17A 3C0RB 4DK5A 2LUEA 1NBFC 3JW0X 4E3CA 1WYWB 1WXMA 2DHZA 2PE6B 3VVWB 2NS5A 1S1QB 1VCBA 2KLGA 2EMSA 4HDOA 4HVBA 2MBHA 4MSQB 1WXSA 2AEHA 3TJPA 3A4RA 3R3MA 3NHEB 2FUHB 3UIPB 4DXAB 1V5TA 4MSMB 3ZRFA 5LXHA 3P2BA 4GDLA 4GDLB 3V62A 4DHZB 1WM3A 2ZCBA 1IPGA 2JVCA 2LGYA 3DBLI 3QCAA 4MJSB 3W1YA 2N9XA 3BY4B 1I35A 3DVGX 3KVFB 3PVLA 2N9PC 3KH0A 3QQ8B 2KDEB 3L17A 4W9LA 2KHWB 4AJWA 2JPHA 2RSUA 2C60A 2KQSA 3HK0A 4II2B 5DPSA 1WX7A 4DHJB 3DBHI 3ZDTA 2HTHA 2PE9A 3QC8B 2KTRA 2WDTB 3L54A 2KTRB 3IFWB 3N30A 3PS6A 4BBNC 1Q1OA 2XBBC 2L76A 5KHOA 1P3QU 4JL9A 3CSTA 3KUZA 4HLEA 1WJ6A 5JZEB 2C7NB 2K6DB 4TQ0A 4GU2A 3TMPB 1WX9A 3TBLD 2IO2B 3VUYA 3T8MA 4GGQA 2R2OA 3PRZA 4DDGD 2ZZPB 4XZ4A 4DHZE 1V6EA 1JRUA 2J0JA 1MG8A 5E6NA 3A1QA 3A1QB 2BGFA 4PS3A 1GUAB 4GN1A 4AUQC 3KYCD 1UELA 1Z5SB 2KLCA 2IY0B 1LFDA 3M95A 4HPMB 2L0TA 1P9DU 3SHQA 2MP2A 4TUUA 3VTVA 4KZ0A 4WJQA 3VTUA 1CMXB 4MDKE 3U8ZA 2KVRA 1SGHA 3MJWA 3ENEA 2KFJA 2MQJA 4W9DA 4ASWC 2N1WA 4FJZA 3S2AA 1LQBA 2M1MA 1E8XA 3ZNZB 2HJ8A 1F9JA 3ZTCA 3N32A 2J0MA 1ZW7A 3PRPB 4FJVB 4BKGA 3A9JA 4FHKA 1YIWA 2GBJA 1E90A 2IO3B 2K8HA 3IG3A 3L10B 4GMVA 2L0FA 4IW0A 4ZRKA 1J0GA 2A5UA 2JUOA 1GNUA 1YX6B 5JH5C 3OJ4B 2J7QB 2REXA 2BYFA 2ZNVC 4GOCA 3GZNI 4JQWC 1E5WA 2JWZA 4NQLB 3DVGY 2K8CA 4NNJB 3JSVA 2DYBA 2I1JA 4LJPB 4MH0E 4E74A 2DZJA 3DBRI 4A3PA 5DPRA 3ZUNA 2Y5BB 2LWPA 1WGYA 2DZKA 3KUCB 3TL5A 4W9EA 3ZLZA 4URKA 1WI0A 1E8ZA 1ISNA 5CHVC 2RGFA 3LJ3A 1UD7A 3JVZX 4AP4C 2D3GA 3B08A 4ZYNA 1WM2A 2KJ6A 4I6LB 2O6VD 3JYUA 4OVVA 4HDQA 4YL8A 1EO6A 2KK8A 1WZ3A 2MBEA 4AJYB 5HKHA 2D07B 2JF5A 2M8SA 2MW5A 4F1SA 3MHSD 2N7DA 3PLVA 3VH3B 2LVOA 3W1SA 4LJOB 2M0XA 4EEWA 3DBSA 2FCNA 3OLMD 4ZRJA 2QHOA 4K7WA 1Y8RC 3PREA 5AEKB 3AU5A 2GBKA 2K25A 4KSKC 1YX5B 4KDLB 1WJ4A 2AL6A 4JLCA 4IWQA 2DYMA 4FLHA 1TBEA 4LDTD 1RAXA 3WIMA 4BFRA 1GJZA 1BT0A 4FBJB 3TIXA 2WX0A 3KYDD 1R4MI 4A20A 4CHKA 4BOSC 4PYZA 3WAMA 4OVUA 4P7IA 1UGMA 2XEWA 2MX2A 3EHVA 2D11A 2BWFA 3R7QA 1C1YB 4IG7B 3CF6E 2C5LC 4WWPA 2PPHA 4MGKE 2Z0DB 4MJSA 1WMHA 3U30A 1OEYA 1WMHB 2MRPA 4IWPA 4XX5A 3V61A 2C7MB 3QIJA 5BO4B 4IM2A 1X1MA 3ZRCA 4W9FA 3M3JA 4HK2A 5J18A 3QK0A 1NI2A 5C1ZA 3WAOA 2V3SA 1V5OA 2GOWA 3A4SC 1WE6A 4GSWA 3NY5A 2FIFA 2MBOA 3H7PB 2KC2A 2PEAA 1V86A 2FCSA 3VHTC 2KX0A 3OJ3A 3WAPA 3AI5A 4EOYA 3APFA 4IM3A 2BYVE 3ZVVA 3ZIMA 4BKSD 4MEMA 1WRDB 1UH6A 2W9NA 5FR6A 2KD0A 2O6VB 3RUIB 4W9CA 4W9HA 1YJ1A 4G3XB 3ALBA 4ICVA 5L95C 5J2RA 2YVCA 2J0KA 5DCNA 3HM3A 3CSFA 2KKCA 2BPSA 3ML8A 2C7HA 4IWOA 2KMAA 4WJPA 3DVNU 2KDIA 3LDZE 2NCNA 1K8RB 3APDA 3QA8A 2MCNB 1EF5A 2KWCA 4B95A 4M8MA 2D10A 2FCQA 4EKUA 3L0WB 4HCPB 5E6PA 3L16A 3TCAA 2LVQA 4WJOA 1KLVA 4W9KA 1XQQA 3IBEA 3PTFC 1WXVA 4HPLB 1KJTA 4LDTB 2HE7A 5L83A 2VRRB 2AWTA 1M94A 2KDFB 2N7EA 3V6EB 5EDSA 2JZ3B 3KW5B 2LZ6A 4WJNA 3AU4A 4WWOA 4KSLC 3QAQA 3VDZA 2LASA 4B6WA 1KOTA 3KUDB 4ZRIA 4BVUC 1P1AA 1WFYA 2CHXA 4X57B 3H9DA 4MGZE 4EZLA 2BWES 1GG3A 4MGIE 4PS7A 4RM9A 2KO3A 2L7RA 1QZEA 2ZNVB 1FXTB 2GBMA 2NR2A 4FULA 2I1KA 5AZHA 2LVPA 3L08A 4G50A 2HD5B 4IC7B 2MBQA 4HWIB 3VUWA 1J19A 2JRIB 2RR9A 2JT4B 2L8JA 3DCGA 2L05A 1Q5WB 4WAAA 2NPTA 4ZDVA 1WR6E 2NPTB 4GDKA 3NZUA 3ZNGC 4GDKB 3PGEA 3HHMA 3AULA 2G3QB 3D32A 2DZIA 2V4LA 1XD3B 4FJYA 1J8CA 1SE9A 1TTNA 1IP9A 5KHQA 1WR1A 2CR5A 3VUXA 3O65B 4DDID 4J6IA 1V80A 3SU8X 2DAFA 2JY6A 5LLIA 3PPAA 5AZFA 1OTRB 2LJ5A 4K81A 1WH3A 3DQVA 1PQSA 3PHWB 5CHWA 1H4RA 2KFKB 2KJRA 4ANVA 5IAAC 4XC2A 3PT2B 3K9OB 3SD5A 4DWFA 1C3TA 3UIOB 1WX8A 4LCDE 2LXCA 4MELA 4TQ1A 4KIKA 2EMTA 4W9JA 1E7VA 4BBNF 4KIKB 3R66C 3WANA 2WX1A 2NVUI 4NPNA 5LXIB 1ZKHA 4EZJA 2ZJDA 3UF8A 3ZO5B 4JIOU 4KZCA 1P98A 5D6JB 2RD0A 4NJ7A 1UBIA 3ZKJC 3RULA 1OEYJ 2G4SA 2K1FA 2LI5A 4AOFA 1AARA 5E6OA 3RZFA 1GC6A 2KOXA 2LGXA 2FNJB 2G4DB 1KM7A 3NZSA 3N3KB 4NQKE 4HXDA 4F8CB 5JHBA 2NBWB 1YQBA 1Z2MA 2MBBB 3A9KA 2FCMA 2IY1B 2ZPNA 3A9KB 3PHXB 4N9F4 4TKNA 4MGYE 3R7RA 4AWJA 1WJNA 4GB9A 4I6NB 4MM3A 5D2MB 2Z59B 3U7DA 3PLUA 3MTNB 3VXWA 4BKTA 2CU1A 2IO1B 2ZVOA 3DOWA 5DPTA 3WALA 4NJ6A 1EF1A 2KQ7A 2N9EB 3QARA 5CHFA 2K6QA 2A4ZA 2L00B 2GBNA 1WJUA 4IUMB 2BF8B 3H7PA 2K8BA 2OJRA 2YLMA 4JGHB 4WQOB 5CTRC 3ZW3A 5AZGA 2K39A 3H7SA 3HM6X 2KXJA 3QX1A 2KJHB 1IYFA 2O6VA 1UZXB 2MLBA 1P0RA 1T0YA 2UYZB 2KX3A 3BINA 2JRHA 3IVFA 5G55A 3HIZA 5D7GA 2DAJA 2PJHA 3EFUA 4F7ZA 4B9KA 2KWVB 2MWSB 3ZDMC 3EECA 4EZKA 1Q0WB 1NDDA 4G11A 1V2YA 2XK5A 4HCNB 2LD9A 1H8CA 3EC8A 2XK5B 2O2VA 2BYEA 2O2VB 2WWZA 2IZVB 3QJZA 2GBRA 4I6PA 4ANUA 3NS8A 2LRUA 3WA0A 1E7UA 3APCA 1D3ZA 3UINB 3V6CB 2L3ZA 5C23A 1SIFA 2KC1A 3VQIA 2KTFA 1V81A 4FHJA 1WGRA 2CKHB 3ZNHB 1RLFA 3UGBB
chains in the Genus database with same CATH superfamily
4CYEA 1GB1A 4NAWA 3T9LA 2DYOA 2WYQA 1GPXA 1L7YA 2K5PA 1MFWA 1IBXB 1E8YA 3X23A 2MP2B 3IAS1 3Q69A 5C2TB 1WF9A 1SIJA 3GOEA 1ZPSA 5TR5A 3ZNID 3DHIC 2DENB 1I42A 3A33B 3OAWA 2K3UA 2V1YA 3SFEB 5IA7A 3MFGA 3V05A 4NY0A 2IBIB 3IHPC 2CS4A 1WGDA 1T5XD 2IJ0A 2NBVB 3DPDA 4KDIC 2K0PA 3SDLC 1QOBA 3RT3B 2C9WB 2WXFA 3DBRB 2LXAA 1D5MC 3Q8BA 2EKEC 2LHDA 1XLNA 1KTKA 1OQYA 1E7PB 2IYDB 5GXGB 1XT9B 4G0NB 4RFBA 2WXLA 1DYQA 1EUVB 1IGDA 4WWMA 4MACA 2NBUA 1MHXA 4IM0A 4ANWA 5J17A 1XLPA 3PRMB 4PK1A 4ACFA 1RRBA 5IP4D 3W1SC 1OQRA 2V0GA 1XO3A 4USAA 1SJHD 2KZRA 3Q3NC 1VD2A 2KWUB 4GXBA 5IOIA 1TZ1A 2W82A 1G6JA 2L1AA 1RM6C 2JQRB 3ABVB 1NBFC 1R4MB 1WXMA 2PE6B 4TSSA 2MBHA 3NJTA 4MSQB 2W55A 1QF6A 3NHEB 2FUHB 3UIPB 3ZRFA 1NENB 2M0AA 3W1YA 3QCAA 3DBLI 4MJSB 3Q3OC 4A9AA 3NVWA 3WCQA 2I38A 3CIRB 3AEDB 3KH0A 2WU5B 3QQ8B 2WXRA 4W9LA 1STEA 2KHWB 1YN4A 1JQ4A 3CWIA 4AJWA 1TKGA 1LGRA 1F52A 4II2B 1NVID 3QC8B 2WDTB 2J42A 2ZW1A 4L23A 5KHOA 1P3QU 4JL9A 3KUZA 4HLEA 3GE8C 4TQ0A 1HZ5A 2IO2B 2JX5A 2INNE 2ZZPB 4DHZE 1V6EA 3H8HA 1MG8A 1E6EB 2BGFA 4RGNA 4AUQC 4RF1A 1Z5SB 1L6UA 1UWMA 1LFDA 1K51A 4C7YA 4MT5A 1ZXHA 5G5HA 3VTUA 3U8ZA 2N1WA 2M1MA 2DWQA 1E8XA 1ZW7A 3PRPB 4FJVB 3A9JA 3FILB 1YIWA 1FM0D 1HA5A 2K8HA 3IG3A 3ETRA 2BT6A 4IW0A 4ZRKA 3NVYA 1N5XA 2REXA 4NQLB 2JWZA 3PO0A 4MH0E 2DYBA 1VZ6A 1ZDXA 4URKA 1TT5B 2N9KA 1ET6A 4XWWA 1UD7A 1WM2A 4I6LB 4YL8A 1BXTA 2RDHA 1ACCA 2BS3B 2IDYA 1HTQA 2FCNA 4ZRJA 4S0RA 1XF5L 4K7WA 5AEKB 3AU5A 1V1OA 1HEZE 2K25A 4KSKC 1AYFA 1EM7A 4JLCA 4BFRA 3KYDD 2LUMA 1VZ8A 3ZXRA 1UUPA 3AE2B 1SE3A 3WAMA 2XN9C 2D11A 3U4EG 2JSVX 2PKOA 3VRAB 1WMHB 1FEHA 5H92C 2MJEA 3QK0A 3T3NA 3A4SC 1YQ4B 3WAPA 4EOYA 3W5UB 2AX5A 2BYVE 2X38A 3ZIMA 4MEMA 1WRDB 3L4PA 1DGJA 5FR6A 2ON8A 4C4VB 2WNMA 1YJ1A 4ICVA 2H89B 1XXGA 2KKCA 4H2AA 2OEDA 4LNOA 1TZOA 4AS1A 1MPEA 2J52A 3LDZE 3APDA 2MCNB 5EE9A 2FCQA 1HZ6A 5E6PA 4C56C 2WXOA 1KLVA 3ZQ4A 1JWMD 5L83A 2KDFB 4ZHOA 1WSPA 1KOTA 3KUDB 4ZRIA 1P1AA 2AQ1B 2BWES 2V4IB 4MGIE 4PS7A 2LJIA 2WS3B 2KO3A 1TJEA 1FXTB 2INCC 2NR2A 3FC4A 5AZHA 4G50A 1EWCA 4QAYA 3VUWA 1NI3A 1R4NB 2L8JA 1T3QA 3ZNGC 2V3NA 3ZYYX 2KMMA 1PGAA 4M01A 1XD3B 3J9CA 4YSXB 4KKJA 1C9FA 1YNTE 3W9CB 5LLIA 2IPKD 3PPAA 3DQVA 2BVCA 3PHWB 3B2FA 2WXJA 2FE8A 2V9HA 4XWTA 1TY0A 3K9OB 1C3TA 4MELA 2LXCA 4TQ1A 3R66C 5LXIB 3EGRA 3BVZA 4EZJA 3UF8A 4KZCA 1P98A 2RMMA 2RD0A 3RULA 2K1FA 2KOXA 1PDXA 3NZSA 4XYCA 2MBBB 2OHFA 5HI1A 4DXFA 2IY1B 2ZPNA 3A9KB 4TKNA 3R7RA 1L4ZB 1WJNA 4GB9A 3U7DA 3VXWA 5T8IA 4BKTA 1C78A 3PLUA 2IO1B 3DOWA 5DPTA 1UNSA 2K6QA 1YN5A 1WJUA 3DHGC 2J4XA 5MPOA 3MJ5A 3ZW3A 1L4DB 1SB3C 3H7SA 3HM6X 2KXJA 2QCZA 3QX1A 1P0RA 1T0YA 1N63A 3BINA 3MC9A 1FNWA 1T0SC 2DLBA 1UF0A 3EFUA 1F2RI 2MWSB 3ZDMC 4EZKA 5AUIA 1NDDA 2SEBD 3UI3A 1V2YA 2D3CA 4HCNB 3EC8A 2O2VB 2WWZA 3BIID 4I6PA 2GBRA 2LRUA 3V6CB 2L3ZA 1SIFA 4FHJA 5BMHA 3ZNHB 1SJED 1SSNA 3KLSX 3PSEB 1F1HA 2LGDA 3DHHC 1U4AA 2N0SB 4FADA 2HDEA 2KNBA 2R2QA 3AECB 1JROA 5C3JB 3VFKA 2MHJA 2UWQA 3M62B 5HG2A 1KF6B 1GC7A 4W9IA 3A9JB 2JZPA 1KLGD 2AL3A 4W9GA 1S3SG 2FAZA 3VTWA 4BKSA 4ANXA 3SEBA 3GZNB 4LLGM 3UQAA 1KLUD 2LFIA 2WU2B 4OHJA 2MA9B 1AN8A 2M4NA 4II3B 3RYTA 3DDCB 4DHJD 2JXXA 3B1LX 3NOBA 1GB4A 2JZZA 1UBQA 2IGGA 3N9YC 4C80A 3DVNV 3T3OA 4BZAA 2HJ1A 1NYRA 1V9JA 1XCTL 2CHWA 3H1UA 3K9PB 2IO0B 1RFAA 3Q3JA 2D2QA 3PZ8A 2RPQA 5HFYA 4DK5A 1YMHE 3JW0X 4E3CA 1WYWB 5D3DA 1UGJA 1S1QB 1VCBA 2AEHA 3TJPA 1GAQB 4ITKA 3A4RA 5JXVA 3P2BA 3HVZA 4GDLB 3V62A 4DHZB 1WM3A 1IPGA 2Y3AA 2ZW0A 1HQRD 5AUKA 3LXFA 2N9XA 3BY4B 3DVGX 3I57A 2N9PC 2KDEB 2JPHA 2RSUA 2M19A 4DHJB 1PGXA 2KTRA 4YXDB 3LYYA 3BVGA 2XBBC 3CSTA 1I4QA 1PUTA 1WJ6A 5JZEB 2C7NB 3TMPB 3T8MA 2R2OA 3PRZA 4DDGD 2N7JA 1I4RA 1TKEA 3A1QB 2L52A 3Q8FA 5BYSA 4PS3A 1GUAB 4ARIA 3TEZA 2KLCA 2IY0B 3M95A 1MJDA 3BK1A 2L0TA 1P9DU 3VTVA 2QDFA 1YJIA 1EU4A 2KVRA 1SGHA 1L6VA 3MJWA 3AEGB 1ZP0B 2MQJA 3AMZA 4W9DA 2PW9A 3Q8CA 3ZNZB 1WYGA 3ZTCA 4BAXA 1E90A 1T0QC 3NG0A 1RYJA 5JH5C 2YEPB 4IDIA 2BYFA 4GOCA 2PTLA 1E5WA 2RPVA 2I1JA 4LJPB 3DBRI 5DPRA 2Y5BB 1WGYA 3TL5A 1E8ZA 3AEFB 1ISNA 5CHVC 3LJ3A 3JVZX 2WDRB 1YOVB 4OVVA 4HDQA 4XDDA 4RGTA 3MHSD 4RNAA 2LVOA 4LJOB 1QILA 1I7HA 1WJ4A 1XEEA 3U2SC 4IWQA 4FLHA 1TKYA 1TBEA 3Q8EA 2TSSA 1N5WA 3W5VB 1BT0A 3DWMA 2WX0A 1R4MI 4A20A 3P4RB 1JWBD 1FXAA 2KYWA 2MX2A 2G9HD 5EE1A 2C5LC 4WWPA 3U30A 1FPYA 2MRPA 3B9JA 4IWPA 2K9XA 2JWUA 1X1MA 4W9FA 3M3JA 4HK2A 5J18A 1NI2A 2BB6A 3NY5A 2FIFA 2KC2A 3VHTC 4US8A 2M56B 2J53A 4IM3A 4BKSD 2W9NA 3Q6BA 4W9HA 3ZXVA 5J2RA 2QILA 2YVCA 1CJEA 2J0KA 3AE8B 1TS3A 4KGTA 2BPSA 3ML8A 2C7HA 4WJPA 1CK1A 3DVNU 4XE0A 2CU3A 1MHHE 4WAFA 2I2YA 3QA8A 2KWCA 3BZDB 1DOYA 4B0EA 1YJJA 1VJKA 4B95A 1UWXA 4HCPB 4N58A 3TCAA 4OZAA 4WJOA 4W9KA 1KJTA 1C4CA 2VRRB 1M94A 2RDBC 5EDSA 2INDC 4WJNA 3P63A 3VDZA 3QAQA 1WFYA 3BYYB 4MGZE 4EZLA 1GG3A 3TEXA 2LHEA 4YWGG 3PZ7A 5IO9A 1QZEA 2GBMA 2I1KA 2E6XA 3I63C 4IC7B 2WXGA 4HWIB 2JT4B 3AV8A 2L05A 1Q5WB 4WAAA 1QOAA 5BYRA 2NPTB 4GDKB 4KKIA 3GE3C 1JW9D 1E9MA 3NZ3A 3PGEA 3AULA 2G3QB 3D32A 2DZIA 4FJYA 1J8CA 2CR5A 1EWYC 4ZRQA 4DDID 2NTTA 4J6IA 4B0MA 2JY6A 1GOZA 5AZFA 1OTRB 2LJ5A 3LB8C 2GI9A 1H4RA 4HEA1 3AE5B 2KJRA 4ANVA 2ICIA 3UIOB 4LCDE 4W9JA 4BBNF 1E7VA 1TS2A 4KIKB 4REZA 2WX1A 2NVUI 4NPNA 1ZKHA 1QT9A 1YQ3B 3AH7A 4NJ7A 2G4SA 2DNFA 2WXKA 1AARA 5G5GA 2G4DB 4HXDA 2NBWB 1YQBA 3MP9A 2FCMA 2GRIA 2WXPA 4MGYE 1JWUD 4MM3A 2CU1A 2ZVOA 1IUEA 3EFCA 3TEWA 1EF1A 3QARA 3RMKC 2A4ZA 3H7PA 3TEYA 5EE0A 4KGRA 4NAMA 5AZGA 1FFVA 1E10A 4YSZB 3EA6A 2O6VA 1UZXB 4RGMA 2KVZA 2KX3A 5FR3A 3IVFA 3HIZA 5D7GA 3AEEB 3B2GA 4F7ZA 2MJDA 3EECA 3DBHB 2IGHA 2ONQA 4HROA 3Q2AC 4M02A 2HTME 3MC8A 4G11A 2LD9A 2XK5B 1C4PA 2WXMA 3P4PB 3NS8A 3WA0A 3APCA 1BMLC 2FBWB 3TSSA 3VQIA 2KTFA 1V81A 1R7SA 3UGBB 2LRWA 4IOIE 2N1VA 4NAWB 4XDCA 1TIFA 1VZ7A 3Q3FA 2GB1A 4FA6A 1L0VB 4M8NA 4EFOA 1L2NA 1YD8U 1SE2A 2KN4A 4S17A 1ZGUB 2DX5B 1OGWA 2KMCA 1R4NI 2BQQA 4RMAA 3AE9B 5TSSA 3I3TB 1C79A 1I4GA 2AQ3B 3ML9A 2BKRB 3VR8B 1CQVA 2OOBB 1J7CA 4D2KA 4ZRPA 1SF0A 1J7BA 2LGIA 2WHIA 4RM8A 4DBGA 1JWSD 3IT4B 1OFFA 2INPE 4EE2A 2G45B 2KFKA 4FN2A 1LM8B 2FIDA 3W2DA 3VH4B 1XLQA 3IAM1 3P42A 2ZEQA 1VRAB 4KV2A 2BS4B 2Z0EB 4RF0A 4TV3A 4K7UA 2VH1A 2PVOD 1K52A 2DZMA 1D5ZC 3QWZB 4BOZB 4GIVA 2ZPYA 4A3OA 4YTPB 3AE1B 5DPWA 5FKAC 3C0RB 4L1BA 2DHZA 3VVWB 2NS5A 4J3OD 1ZXIA 2KLGA 4HVBA 1WXSA 3R3MA 4O1NA 1VLBA 5LXHA 1SEBD 3RNCC 4KGSA 5LNK1 3BWUD 3HVDA 1WGKA 3E56A 4C00A 5E6JA 2JYTA 1I35A 3KVFB 3PVLA 4YTNB 1C77A 5EE3A 2C60A 2KQSA 1WX7A 4HRSA 3ZDTA 3FAHA 3L54A 3N30A 2D3AA 3IFWB 4ZHPA 3ZJUA 4LK0M 2AQ2B 4N59A 1N61A 4GU2A 3TBLD 4WQMA 3MHZA 4GGQA 1T0RC 1JRUA 1F2RC 4HKQA 1PFDA 1UELA 4LTUA 4HPMB 1FCCC 3GS2A 1OQQA 4TUUA 2LGSA 4M0WA 3P1MA 5IN7A 1E0ZA 3AE3B 1I4PA 5BMGA 2KFJA 4FJZA 3S2AA 2EKIA 1QLBB 1F9JA 3N32A 2J0MA 4HPPA 4FHKA 2GBJA 2EELA 2IO3B 3AE6B 4US9A 3U7ZA 4TMAB 1J0GA 2A5UA 1YX6B 2ZNVC 4DXGA 1I4XA 3GZNI 4JQWC 2K8CA 4NNJB 3JSVA 2WXIA 4E74A 2DZJA 1C4AA 2DZKA 4P6VF 1HTOA 5IKCM 2D3GA 3B08A 3C19A 4ZYNA 2KJ6A 3N1ZC 2O6VD 3JYUA 4AJYB 1JMLA 4P16A 2D07B 4F1SA 2ACZB 2CJNA 4A8XC 4KX6B 3PLVA 4EEWA 1KFYB 1Y8RC 2GBKA 1YX5B 1ZUD2 4K3BA 2DYMA 4LDTD 1RAXA 1WRIA 2KACA 1GJZA 4BOSC 1Y56A 1EU3A 2XEWA 1SBBB 3O13A 3EHVA 3RNGC 3R7QA 4IG7B 3CF6E 1FNVA 1WMHA 1OEYA 4XX5A 1K50A 3AB5A 2PVGC 4IM2A 3R2IA 3ZRCA 2KAJA 2NMQA 1N6ZA 5C1ZA 2V3SA 4GSWA 2MBOA 4P1BC 3H7PB 2W3RA 2PEAA 3N1XC 4XGAB 1V86A 5FK9C 1ZDVA 3AI5A 3ZVVA 1UH6A 2KD0A 2O6VB 3NVVA 2GLSA 4G3XB 3ALBA 5L95C 1D4BA 4CQNA 5DCNA 3CSFA 4IWOA 2KMAA 4ARCA 1V97A 2NCNA 1K8RB 1EF5A 4M8MA 2D10A 4EKUA 3L16A 2LVQA 2JU6X 1WXVA 4LDTB 2HE7A 2AWTA 1P7EA 1B1ZA 3KW5B 2LZ6A 3AU4A 4WWOA 4KSLC 1PGBA 1ESFA 2LASA 4B6WA 4BVUC 1L0XB 4RM9A 2L7RA 1CZPA 1ZOYB 4MH8A 4GLSC 4FULA 1V1PA 2LVPA 3L08A 3SR6A 3I5JC 1J19A 3DCGA 2OJWA 3NZUA 3HHMA 2XNAC 3AE7B 4PT5A 1IP9A 1WR1A 3VUXA 3O65B 1MI0A 1V80A 4K81A 1WH3A 4RH6A 2KFKB 2BTEA 1QOFA 2Y5CA 1FXIA 2CJOA 4XC2A 5IAAC 1JRPA 1WX8A 4JWSC 4ZOHC 3I9V1 2EMTA 2ZJDA 4JIOU 4A55A 3ZKJC 1QKZA 1T6BX 4R3DA 5E6OA 3RZFA 1GC6A 2KT7A 2NTSA 4F8CB 3N3KB 5JHBA 3A9KA 4N9F4 4AWJA 1FFUA 2D5GA 4I6NB 5D2MB 2Z59B 3MTNB 3WALA 4NJ6A 2KQ7A 3Q3MC 2L00B 4IUMB 1FCLA 2YLMA 1SXTA 4JGHB 4WQOB 5CTRC 2JXTA 3DBLB 3RFZB 2RDGA 3AEBB 2KJHB 2MLBA 2PMVA 2WXNA 2JYEA 2DAJA 3E9SA 1C76A 3R8BA 1Q0WB 3ZJTA 1HXYD 1H8CA 2O2VA 1F0ZA 4ANUA 2UU7A 4C7ZA 5C23A 3P4SB 2BW2A 1RWSA 1QQRA 1TGZB 1WY8A 1V49A 2L32A 1VR9A 1VDVA 2MJ3A 2MSED 3U52E 5GMVA 1FO4A 1HE8A 2BKFA 1J7AA 4PYUA 3UQBA 3V60A 3NRZA 2N4FA 4M0WB 3AXCA 1DOXA 3L13A 1WIAA 2KN5A 1E8WA 3VAWA 1TS5A 3RPFC 4HJKA 1FD6A 2ASQA 2KDBA 2ZCCA 2ZVNA 3X0WA 1WXAA 3QHTA 3ECIA 4RCOA 4ICUA 1SE4A 1WGGA 1FIQA 4A90A 4M00A 2QC8A 4OVZA 1RFKA 3AM9A 3ZTDA 1AW7A 4HKZE 3JSVB 1JWAD 5CX3A 2GMIC 3CMMB 3B0AA 1LXDA 5JHAA 1WE7A 4K1RB 2KANA 1A70A 2AYOB 4WWNA 1A5RA 4CO7A 4E71A 4L2YA 4KVGB 3RD2A 5D94A 3H6NA 1ET9A 3RCZA 3RZWC 2B3AA 5G2NA 3ONSA 1D5XC 3M63B 4A6QA 2CHZA 2WLBA 1WZ0A 3PZDA 3PV1A 2VH2A 4EUTA 4Q2JA 4IKGA 4PS8A 5BMIA 1WGHA 4K7SA 2H88B 2M17A 4DQOC 4RGOS 1KH0A 2LUEA 3KWVA 1YN3A 2L83A 2EMSA 4HDOA 4LNNA 1F77A 3Q8AA 4P1CC 4AQ7A 4WH4A 4DXAB 1V5TA 4MSMB 4GDLA 1PYWD 2WGSA 2PLPA 3GP7A 3C8YA 2ZCBA 2JVCA 2LGYA 2KQ4X 3VRBB 3P4QB 3R2TA 3L17A 1ZE3D 3HK0A 5DPSA 3DBHI 2HTHA 2PE9A 4JE3B 3PS6A 2KTRB 1FMAD 4BBNC 1Q1OA 2L76A 2MH7A 3ZJVA 5H8YE 4N6EB 2K6DB 1WX9A 3VUYA 1TS4A 4XZ4A 1WWTA 5E6NA 2J0JA 4WURA 3A1QA 4GN1A 4K3CA 5HHDG 3KYCD 3IT6B 1IBXA 1TY2A 2FUG1 3SHQA 2MP2A 4KZ0A 2MEKA 3ZGZA 4WJQA 1CMXB 4MDKE 3V3XA 1LO5D 1MG4A 3ENEA 4ASWC 1WXQA 1LQBA 2HJ8A 4BKGA 4GMVA 3L10B 2L0FA 1Q10A 2JUOA 1GNUA 4JWUC 3OJ4B 2J7QB 1V1PB 3IXSA 3DVGY 1NYQA 4A3PA 3ZUNA 2LWPA 5D3IB 3ZLZA 3KUCB 4W9EA 1WI0A 4LNKA 2WP9B 2RGFA 4AP4C 1FRRA 1K53A 4NZLB 1EO6A 2KK8A 1WZ3A 2MBEA 5HKHA 2QSDA 2JF5A 2M8SA 2MW5A 4YT0B 2N7DA 3VH3B 3W1SA 2M0XA 4HJGE 3DBSA 3OLMD 3OWEB 2LEKA 2QHOA 3SFDB 2BB5A 3PREA 4KDLB 2AL6A 4ZYSA 3WIMA 4FBJB 3TIXA 4CHKA 4YTMB 4PYZA 4OVUA 1AWDA 2SAKA 1UGMA 4P7IA 2BWFA 1C1YB 2PPHA 4MGKE 2Z0DB 4MJSA 4WIPA 3V61A 2C7MB 3QIJA 4FXCA 5BO4B 3KQ4A 1V8CA 5I4DA 3KWLA 3WAOA 1V5OA 2GOWA 1WE6A 2V3PA 2FCSA 2KX0A 3OJ3A 3APFA 3Q14C 4OW0A 2BS2B 3RNEC 3RUIB 2WQYB 4W9CA 2QJLA 3HUIA 4LNIA 3DWGC 3MC0B 3HM3A 1XCQL 2KDIA 3EUB2 3L0WB 3NUHB 4JX1C 3AN1A 1XQQA 3IBEA 3PTFC 3RNAC 4HPLB 1N62A 2N7EA 2N9LA 3V6EB 2JZ3B 1JCKB 2CHXA 4X57B 3H9DA 1FRDA 4JPSA 5BYQA 3FILA 3RI7C 3GB1A 4YSYB 2VZKD 4OZBA 2K22A 2ZNVB 3URYA 2QEJC 2Q5WD 2WDVB 2HD5B 2MBQA 2E3TA 2JRIB 2RR9A 3BVMA 2NPTA 3TUOA 1WR6E 4ZDVA 4GDKA 4LNFA 3OG5A 3BYTB 1XLOA 1I4HA 2V4LA 2W3SA 2QMTA 2B76B 1SE9A 1TTNA 5KHQA 2WXQA 1L0YB 3SU8X 2DAFA 2KWDA 4NJCA 1L5PA 3RNFC 2IGDA 1KRHA 1TYGB 3N20C 3NS1A 1PQSA 5CHWA 1DOIA 2WXHA 1D6EC 1P7FA 3PT2B 3SD5A 4DWFA 4KIKA 3WANA 3BK2A 3ZO5B 5D6JB 1UBIA 3RN9C 2Y5PA 1OEYJ 2LI5A 4AOFA 2PIAA 2DBYA 2LGXA 2FNJB 4NQKE 1KM7A 1B9RA 3FKYA 1Z2MA 2D3BA 2X8XX 3PHXB 2BBCA 2VZKB 2G1EA 2BYTA 4MM3B 1NEKB 2N9EB 1BUIC 5CHFA 3AEAB 2GBNA 2BF8B 2K8BA 2OJRA 1ENFA 3AE4B 2Z8LA 4UDUC 1M4VA 1QOGA 1FNUA 2K39A 2WDQB 1IYFA 4C4VA 2UYZB 2JRHA 1N60A 5G55A 3N1YC 2PJHA 3HRDD 4OZCA 4B9KA 2KWVB 1ROEA 3VR9B 2YEPF 1IGCA 1JALA 2QIEB 2XK5A 2BYEA 2IZVB 2KDMA 3QJZA 2W54A 1E7UA 1D3ZA 3UINB 2LMCA 2KC1A 3NVZA 3RNBC 2R61A 1MVKA 1WGRA 2CKHB 1RLFA
chains in the Genus database with same CATH topology
1TGZB 4CYEA 2LRWA 4NAWA 1WY8A 2N1VA 4NAWB 3PSEB 1V49A 3T9LA 2LGDA 3Q3FA 2DYOA 1U4AA 2WYQA 1L7YA 2MSED 5GMVA 1HE8A 4FA6A 2BKFA 4M8NA 1E8YA 4EFOA 1YD8U 1L2NA 3X23A 1ZGUB 2MP2B 4FADA 2KNBA 2DX5B 2R2QA 4PYUA 3V60A 3UQBA 2N4FA 1OGWA 1WF9A 3GOEA 4M0WB 3VFKA 3AXCA 2KMCA 5TR5A 3ZNID 1I42A 2DENB 1R4NI 2UWQA 3A33B 3L13A 3OAWA 2V1YA 4RMAA 5IA7A 1WIAA 3M62B 2KN5A 1E8WA 3I3TB 3VAWA 3ML9A 4NY0A 2BKRB 1GC7A 4W9IA 4HJKA 2ASQA 2KDBA 2ZCCA 2ZVNA 3A9JB 3X0WA 1WXAA 2AL3A 3QHTA 4W9GA 1S3SG 2FAZA 3ECIA 2IBIB 3VTWA 3IHPC 4ICUA 4BKSA 4ANXA 2CS4A 1WGDA 1WGGA 2NBVB 2OOBB 3DPDA 3UQAA 4KDIC 2MA9B 3SDLC 3ZTDA 2M4NA 3RT3B 4II3B 2C9WB 3RYTA 3JSVB 2LXAA 3DDCB 4RM8A 2JXXA 4DHJD 4DBGA 5CX3A 2EKEC 3B1LX 1OQYA 2GMIC 3NOBA 3CMMB 2IYDB 2JZZA 3B0AA 1UBQA 1LXDA 1XT9B 2G45B 2KFKA 4G0NB 4FN2A 1LM8B 2FIDA 5JHAA 1EUVB 1WE7A 3DVNV 4K1RB 2NBUA 3VH4B 2KANA 2AYOB 4WWNA 2ZEQA 1A5RA 4KV2A 4CO7A 4E71A 4IM0A 3RD2A 4KVGB 2Z0EB 4ANWA 5J17A 5D94A 3H6NA 3RZWC 3RCZA 3PRMB 1RRBA 2B3AA 4TV3A 5G2NA 3ONSA 1V9JA 2CHWA 4K7UA 3M63B 3H1UA 2CHZA 3W1SC 1WZ0A 2DZMA 3PZDA 3PV1A 3K9PB 3QWZB 2KZRA 4GIVA 2IO0B 4BOZB 4EUTA 1RFAA 2ZPYA 4A3OA 1VD2A 2KWUB 3Q3JA 2D2QA 4GXBA 4PS8A 1WGHA 2RPQA 1TZ1A 1G6JA 5DPWA 4K7SA 2M17A 3C0RB 4DK5A 2LUEA 1NBFC 3JW0X 4E3CA 1WYWB 1WXMA 2DHZA 2PE6B 3VVWB 2NS5A 1S1QB 1VCBA 2KLGA 2EMSA 4HDOA 4HVBA 2MBHA 4MSQB 1WXSA 2AEHA 3TJPA 3A4RA 3R3MA 3NHEB 2FUHB 3UIPB 4DXAB 1V5TA 4MSMB 3ZRFA 5LXHA 3P2BA 4GDLA 4GDLB 3V62A 4DHZB 1WM3A 2ZCBA 1IPGA 2JVCA 2LGYA 3DBLI 3QCAA 4MJSB 3W1YA 2N9XA 3BY4B 1I35A 3DVGX 3KVFB 3PVLA 2N9PC 3KH0A 3QQ8B 2KDEB 3L17A 4W9LA 2KHWB 4AJWA 2JPHA 2RSUA 2C60A 2KQSA 3HK0A 4II2B 5DPSA 1WX7A 4DHJB 3DBHI 3ZDTA 2HTHA 2PE9A 3QC8B 2KTRA 2WDTB 3L54A 2KTRB 3IFWB 3N30A 3PS6A 4BBNC 1Q1OA 2XBBC 2L76A 5KHOA 1P3QU 4JL9A 3CSTA 3KUZA 4HLEA 1WJ6A 5JZEB 2C7NB 2K6DB 4TQ0A 4GU2A 3TMPB 1WX9A 3TBLD 2IO2B 3VUYA 3T8MA 4GGQA 2R2OA 3PRZA 4DDGD 2ZZPB 4XZ4A 4DHZE 1V6EA 1JRUA 2J0JA 1MG8A 5E6NA 3A1QA 3A1QB 2BGFA 4PS3A 1GUAB 4GN1A 4AUQC 3KYCD 1UELA 1Z5SB 2KLCA 2IY0B 1LFDA 3M95A 4HPMB 2L0TA 1P9DU 3SHQA 2MP2A 4TUUA 3VTVA 4KZ0A 4WJQA 3VTUA 1CMXB 4MDKE 3U8ZA 2KVRA 1SGHA 3MJWA 3ENEA 2KFJA 2MQJA 4W9DA 4ASWC 2N1WA 4FJZA 3S2AA 1LQBA 2M1MA 1E8XA 3ZNZB 2HJ8A 1F9JA 3ZTCA 3N32A 2J0MA 1ZW7A 3PRPB 4FJVB 4BKGA 3A9JA 4FHKA 1YIWA 2GBJA 1E90A 2IO3B 2K8HA 3IG3A 3L10B 4GMVA 2L0FA 4IW0A 4ZRKA 1J0GA 2A5UA 2JUOA 1GNUA 1YX6B 5JH5C 3OJ4B 2J7QB 2REXA 2BYFA 2ZNVC 4GOCA 3GZNI 4JQWC 1E5WA 2JWZA 4NQLB 3DVGY 2K8CA 4NNJB 3JSVA 2DYBA 2I1JA 4LJPB 4MH0E 4E74A 2DZJA 3DBRI 4A3PA 5DPRA 3ZUNA 2Y5BB 2LWPA 1WGYA 2DZKA 3KUCB 3TL5A 4W9EA 3ZLZA 4URKA 1WI0A 1E8ZA 1ISNA 5CHVC 2RGFA 3LJ3A 1UD7A 3JVZX 4AP4C 2D3GA 3B08A 4ZYNA 1WM2A 2KJ6A 4I6LB 2O6VD 3JYUA 4OVVA 4HDQA 4YL8A 1EO6A 2KK8A 1WZ3A 2MBEA 4AJYB 5HKHA 2D07B 2JF5A 2M8SA 2MW5A 4F1SA 3MHSD 2N7DA 3PLVA 3VH3B 2LVOA 3W1SA 4LJOB 2M0XA 4EEWA 3DBSA 2FCNA 3OLMD 4ZRJA 2QHOA 4K7WA 1Y8RC 3PREA 5AEKB 3AU5A 2GBKA 2K25A 4KSKC 1YX5B 4KDLB 1WJ4A 2AL6A 4JLCA 4IWQA 2DYMA 4FLHA 1TBEA 4LDTD 1RAXA 3WIMA 4BFRA 1GJZA 1BT0A 4FBJB 3TIXA 2WX0A 3KYDD 1R4MI 4A20A 4CHKA 4BOSC 4PYZA 3WAMA 4OVUA 4P7IA 1UGMA 2XEWA 2MX2A 3EHVA 2D11A 2BWFA 3R7QA 1C1YB 4IG7B 3CF6E 2C5LC 4WWPA 2PPHA 4MGKE 2Z0DB 4MJSA 1WMHA 3U30A 1OEYA 1WMHB 2MRPA 4IWPA 4XX5A 3V61A 2C7MB 3QIJA 5BO4B 4IM2A 1X1MA 3ZRCA 4W9FA 3M3JA 4HK2A 5J18A 3QK0A 1NI2A 5C1ZA 3WAOA 2V3SA 1V5OA 2GOWA 3A4SC 1WE6A 4GSWA 3NY5A 2FIFA 2MBOA 3H7PB 2KC2A 2PEAA 1V86A 2FCSA 3VHTC 2KX0A 3OJ3A 3WAPA 3AI5A 4EOYA 3APFA 4IM3A 2BYVE 3ZVVA 3ZIMA 4BKSD 4MEMA 1WRDB 1UH6A 2W9NA 5FR6A 2KD0A 2O6VB 3RUIB 4W9CA 4W9HA 1YJ1A 4G3XB 3ALBA 4ICVA 5L95C 5J2RA 2YVCA 2J0KA 5DCNA 3HM3A 3CSFA 2KKCA 2BPSA 3ML8A 2C7HA 4IWOA 2KMAA 4WJPA 3DVNU 2KDIA 3LDZE 2NCNA 1K8RB 3APDA 3QA8A 2MCNB 1EF5A 2KWCA 4B95A 4M8MA 2D10A 2FCQA 4EKUA 3L0WB 4HCPB 5E6PA 3L16A 3TCAA 2LVQA 4WJOA 1KLVA 4W9KA 1XQQA 3IBEA 3PTFC 1WXVA 4HPLB 1KJTA 4LDTB 2HE7A 5L83A 2VRRB 2AWTA 1M94A 2KDFB 2N7EA 3V6EB 5EDSA 2JZ3B 3KW5B 2LZ6A 4WJNA 3AU4A 4WWOA 4KSLC 3QAQA 3VDZA 2LASA 4B6WA 1KOTA 3KUDB 4ZRIA 4BVUC 1P1AA 1WFYA 2CHXA 4X57B 3H9DA 4MGZE 4EZLA 2BWES 1GG3A 4MGIE 4PS7A 4RM9A 2KO3A 2L7RA 1QZEA 2ZNVB 1FXTB 2GBMA 2NR2A 4FULA 2I1KA 5AZHA 2LVPA 3L08A 4G50A 2HD5B 4IC7B 2MBQA 4HWIB 3VUWA 1J19A 2JRIB 2RR9A 2JT4B 2L8JA 3DCGA 2L05A 1Q5WB 4WAAA 2NPTA 4ZDVA 1WR6E 2NPTB 4GDKA 3NZUA 3ZNGC 4GDKB 3PGEA 3HHMA 3AULA 2G3QB 3D32A 2DZIA 2V4LA 1XD3B 4FJYA 1J8CA 1SE9A 1TTNA 1IP9A 5KHQA 1WR1A 2CR5A 3VUXA 3O65B 4DDID 4J6IA 1V80A 3SU8X 2DAFA 2JY6A 5LLIA 3PPAA 5AZFA 1OTRB 2LJ5A 4K81A 1WH3A 3DQVA 1PQSA 3PHWB 5CHWA 1H4RA 2KFKB 2KJRA 4ANVA 5IAAC 4XC2A 3PT2B 3K9OB 3SD5A 4DWFA 1C3TA 3UIOB 1WX8A 4LCDE 2LXCA 4MELA 4TQ1A 4KIKA 2EMTA 4W9JA 1E7VA 4BBNF 4KIKB 3R66C 3WANA 2WX1A 2NVUI 4NPNA 5LXIB 1ZKHA 4EZJA 2ZJDA 3UF8A 3ZO5B 4JIOU 4KZCA 1P98A 5D6JB 2RD0A 4NJ7A 1UBIA 3ZKJC 3RULA 1OEYJ 2G4SA 2K1FA 2LI5A 4AOFA 1AARA 5E6OA 3RZFA 1GC6A 2KOXA 2LGXA 2FNJB 2G4DB 1KM7A 3NZSA 3N3KB 4NQKE 4HXDA 4F8CB 5JHBA 2NBWB 1YQBA 1Z2MA 2MBBB 3A9KA 2FCMA 2IY1B 2ZPNA 3A9KB 3PHXB 4N9F4 4TKNA 4MGYE 3R7RA 4AWJA 1WJNA 4GB9A 4I6NB 4MM3A 5D2MB 2Z59B 3U7DA 3PLUA 3MTNB 3VXWA 4BKTA 2CU1A 2IO1B 2ZVOA 3DOWA 5DPTA 3WALA 4NJ6A 1EF1A 2KQ7A 2N9EB 3QARA 5CHFA 2K6QA 2A4ZA 2L00B 2GBNA 1WJUA 4IUMB 2BF8B 3H7PA 2K8BA 2OJRA 2YLMA 4JGHB 4WQOB 5CTRC 3ZW3A 5AZGA 2K39A 3H7SA 3HM6X 2KXJA 3QX1A 2KJHB 1IYFA 2O6VA 1UZXB 2MLBA 1P0RA 1T0YA 2UYZB 2KX3A 3BINA 2JRHA 3IVFA 5G55A 3HIZA 5D7GA 2DAJA 2PJHA 3EFUA 4F7ZA 4B9KA 2KWVB 2MWSB 3ZDMC 3EECA 4EZKA 1Q0WB 1NDDA 4G11A 1V2YA 2XK5A 4HCNB 2LD9A 1H8CA 3EC8A 2XK5B 2O2VA 2BYEA 2O2VB 2WWZA 2IZVB 3QJZA 2GBRA 4I6PA 4ANUA 3NS8A 2LRUA 3WA0A 1E7UA 3APCA 1D3ZA 3UINB 3V6CB 2L3ZA 5C23A 1SIFA 2KC1A 3VQIA 2KTFA 1V81A 4FHJA 1WGRA 2CKHB 3ZNHB 1RLFA 3UGBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TGZ B;  4CYE A;  2LRW A;  4NAW A;  1WY8 A;  2N1V A;  4NAW B;  3PSE B;  1V49 A;  3T9L A;  2LGD A;  3Q3F A;  2DYO A;  1U4A A;  2WYQ A;  1L7Y A;  2MSE D;  5GMV A;  1HE8 A;  4FA6 A;  2BKF A;  4M8N A;  1E8Y A;  4EFO A;  1YD8 U;  1L2N A;  3X23 A;  1ZGU B;  2MP2 B;  4FAD A;  2KNB A;  2DX5 B;  2R2Q A;  4PYU A;  3V60 A;  3UQB A;  2N4F A;  1OGW A;  1WF9 A;  3GOE A;  4M0W B;  3VFK A;  3AXC A;  2KMC A;  5TR5 A;  3ZNI D;  1I42 A;  2DEN B;  1R4N I;  2UWQ A;  3A33 B;  3L13 A;  3OAW A;  2V1Y A;  4RMA A;  5IA7 A;  1WIA A;  3M62 B;  2KN5 A;  1E8W A;  3I3T B;  3VAW A;  3ML9 A;  4NY0 A;  2BKR B;  1GC7 A;  4W9I A;  4HJK A;  2ASQ A;  2KDB A;  2ZCC A;  2ZVN A;  3A9J B;  3X0W A;  1WXA A;  2AL3 A;  3QHT A;  4W9G A;  1S3S G;  2FAZ A;  3ECI A;  2IBI B;  3VTW A;  3IHP C;  4ICU A;  4BKS A;  4ANX A;  2CS4 A;  1WGD A;  1WGG A;  2NBV B;  2OOB B;  3DPD A;  3UQA A;  4KDI C;  2MA9 B;  3SDL C;  3ZTD A;  2M4N A;  3RT3 B;  4II3 B;  2C9W B;  3RYT A;  3JSV B;  2LXA A;  3DDC B;  4RM8 A;  2JXX A;  4DHJ D;  4DBG A;  5CX3 A;  2EKE C;  3B1L X;  1OQY A;  2GMI C;  3NOB A;  3CMM B;  2IYD B;  2JZZ A;  3B0A A;  1UBQ A;  1LXD A;  1XT9 B;  2G45 B;  2KFK A;  4G0N B;  4FN2 A;  1LM8 B;  2FID A;  5JHA A;  1EUV B;  1WE7 A;  3DVN V;  4K1R B;  2NBU A;  3VH4 B;  2KAN A;  2AYO B;  4WWN A;  2ZEQ A;  1A5R A;  4KV2 A;  4CO7 A;  4E71 A;  4IM0 A;  3RD2 A;  4KVG B;  2Z0E B;  4ANW A;  5J17 A;  5D94 A;  3H6N A;  3RZW C;  3RCZ A;  3PRM B;  1RRB A;  2B3A A;  4TV3 A;  5G2N A;  3ONS A;  1V9J A;  2CHW A;  4K7U A;  3M63 B;  3H1U A;  2CHZ A;  3W1S C;  1WZ0 A;  2DZM A;  3PZD A;  3PV1 A;  3K9P B;  3QWZ B;  2KZR A;  4GIV A;  2IO0 B;  4BOZ B;  4EUT A;  1RFA A;  2ZPY A;  4A3O A;  1VD2 A;  2KWU B;  3Q3J A;  2D2Q A;  4GXB A;  4PS8 A;  1WGH A;  2RPQ A;  1TZ1 A;  1G6J A;  5DPW A;  4K7S A;  2M17 A;  3C0R B;  4DK5 A;  2LUE A;  1NBF C;  3JW0 X;  4E3C A;  1WYW B;  1WXM A;  2DHZ A;  2PE6 B;  3VVW B;  2NS5 A;  1S1Q B;  1VCB A;  2KLG A;  2EMS A;  4HDO A;  4HVB A;  2MBH A;  4MSQ B;  1WXS A;  2AEH A;  3TJP A;  3A4R A;  3R3M A;  3NHE B;  2FUH B;  3UIP B;  4DXA B;  1V5T A;  4MSM B;  3ZRF A;  5LXH A;  3P2B A;  4GDL A;  4GDL B;  3V62 A;  4DHZ B;  1WM3 A;  2ZCB A;  1IPG A;  2JVC A;  2LGY A;  3DBL I;  3QCA A;  4MJS B;  3W1Y A;  2N9X A;  3BY4 B;  1I35 A;  3DVG X;  3KVF B;  3PVL A;  2N9P C;  3KH0 A;  3QQ8 B;  2KDE B;  3L17 A;  4W9L A;  2KHW B;  4AJW A;  2JPH A;  2RSU A;  2C60 A;  2KQS A;  3HK0 A;  4II2 B;  5DPS A;  1WX7 A;  4DHJ B;  3DBH I;  3ZDT A;  2HTH A;  2PE9 A;  3QC8 B;  2KTR A;  2WDT B;  3L54 A;  2KTR B;  3IFW B;  3N30 A;  3PS6 A;  4BBN C;  1Q1O A;  2XBB C;  2L76 A;  5KHO A;  1P3Q U;  4JL9 A;  3CST A;  3KUZ A;  4HLE A;  1WJ6 A;  5JZE B;  2C7N B;  2K6D B;  4TQ0 A;  4GU2 A;  3TMP B;  1WX9 A;  3TBL D;  2IO2 B;  3VUY A;  3T8M A;  4GGQ A;  2R2O A;  3PRZ A;  4DDG D;  2ZZP B;  4XZ4 A;  4DHZ E;  1V6E A;  1JRU A;  2J0J A;  1MG8 A;  5E6N A;  3A1Q A;  3A1Q B;  2BGF A;  4PS3 A;  1GUA B;  4GN1 A;  4AUQ C;  3KYC D;  1UEL A;  1Z5S B;  2KLC A;  2IY0 B;  1LFD A;  3M95 A;  4HPM B;  2L0T A;  1P9D U;  3SHQ A;  2MP2 A;  4TUU A;  3VTV A;  4KZ0 A;  4WJQ A;  3VTU A;  1CMX B;  4MDK E;  3U8Z A;  2KVR A;  1SGH A;  3MJW A;  3ENE A;  2KFJ A;  2MQJ A;  4W9D A;  4ASW C;  2N1W A;  4FJZ A;  3S2A A;  1LQB A;  2M1M A;  1E8X A;  3ZNZ B;  2HJ8 A;  1F9J A;  3ZTC A;  3N32 A;  2J0M A;  1ZW7 A;  3PRP B;  4FJV B;  4BKG A;  3A9J A;  4FHK A;  1YIW A;  2GBJ A;  1E90 A;  2IO3 B;  2K8H A;  3IG3 A;  3L10 B;  4GMV A;  2L0F A;  4IW0 A;  4ZRK A;  1J0G A;  2A5U A;  2JUO A;  1GNU A;  1YX6 B;  5JH5 C;  3OJ4 B;  2J7Q B;  2REX A;  2BYF A;  2ZNV C;  4GOC A;  3GZN I;  4JQW C;  1E5W A;  2JWZ A;  4NQL B;  3DVG Y;  2K8C A;  4NNJ B;  3JSV A;  2DYB A;  2I1J A;  4LJP B;  4MH0 E;  4E74 A;  2DZJ A;  3DBR I;  4A3P A;  5DPR A;  3ZUN A;  2Y5B B;  2LWP A;  1WGY A;  2DZK A;  3KUC B;  3TL5 A;  4W9E A;  3ZLZ A;  4URK A;  1WI0 A;  1E8Z A;  1ISN A;  5CHV C;  2RGF A;  3LJ3 A;  1UD7 A;  3JVZ X;  4AP4 C;  2D3G A;  3B08 A;  4ZYN A;  1WM2 A;  2KJ6 A;  4I6L B;  2O6V D;  3JYU A;  4OVV A;  4HDQ A;  4YL8 A;  1EO6 A;  2KK8 A;  1WZ3 A;  2MBE A;  4AJY B;  5HKH A;  2D07 B;  2JF5 A;  2M8S A;  2MW5 A;  4F1S A;  3MHS D;  2N7D A;  3PLV A;  3VH3 B;  2LVO A;  3W1S A;  4LJO B;  2M0X A;  4EEW A;  3DBS A;  2FCN A;  3OLM D;  4ZRJ A;  2QHO A;  4K7W A;  1Y8R C;  3PRE A;  5AEK B;  3AU5 A;  2GBK A;  2K25 A;  4KSK C;  1YX5 B;  4KDL B;  1WJ4 A;  2AL6 A;  4JLC A;  4IWQ A;  2DYM A;  4FLH A;  1TBE A;  4LDT D;  1RAX A;  3WIM A;  4BFR A;  1GJZ A;  1BT0 A;  4FBJ B;  3TIX A;  2WX0 A;  3KYD D;  1R4M I;  4A20 A;  4CHK A;  4BOS C;  4PYZ A;  3WAM A;  4OVU A;  4P7I A;  1UGM A;  2XEW A;  2MX2 A;  3EHV A;  2D11 A;  2BWF A;  3R7Q A;  1C1Y B;  4IG7 B;  3CF6 E;  2C5L C;  4WWP A;  2PPH A;  4MGK E;  2Z0D B;  4MJS A;  1WMH A;  3U30 A;  1OEY A;  1WMH B;  2MRP A;  4IWP A;  4XX5 A;  3V61 A;  2C7M B;  3QIJ A;  5BO4 B;  4IM2 A;  1X1M A;  3ZRC A;  4W9F A;  3M3J A;  4HK2 A;  5J18 A;  3QK0 A;  1NI2 A;  5C1Z A;  3WAO A;  2V3S A;  1V5O A;  2GOW A;  3A4S C;  1WE6 A;  4GSW A;  3NY5 A;  2FIF A;  2MBO A;  3H7P B;  2KC2 A;  2PEA A;  1V86 A;  2FCS A;  3VHT C;  2KX0 A;  3OJ3 A;  3WAP A;  3AI5 A;  4EOY A;  3APF A;  4IM3 A;  2BYV E;  3ZVV A;  3ZIM A;  4BKS D;  4MEM A;  1WRD B;  1UH6 A;  2W9N A;  5FR6 A;  2KD0 A;  2O6V B;  3RUI B;  4W9C A;  4W9H A;  1YJ1 A;  4G3X B;  3ALB A;  4ICV A;  5L95 C;  5J2R A;  2YVC A;  2J0K A;  5DCN A;  3HM3 A;  3CSF A;  2KKC A;  2BPS A;  3ML8 A;  2C7H A;  4IWO A;  2KMA A;  4WJP A;  3DVN U;  2KDI A;  3LDZ E;  2NCN A;  1K8R B;  3APD A;  3QA8 A;  2MCN B;  1EF5 A;  2KWC A;  4B95 A;  4M8M A;  2D10 A;  2FCQ A;  4EKU A;  3L0W B;  4HCP B;  5E6P A;  3L16 A;  3TCA A;  2LVQ A;  4WJO A;  1KLV A;  4W9K A;  1XQQ A;  3IBE A;  3PTF C;  1WXV A;  4HPL B;  1KJT A;  4LDT B;  2HE7 A;  5L83 A;  2VRR B;  2AWT A;  1M94 A;  2KDF B;  2N7E A;  3V6E B;  5EDS A;  2JZ3 B;  3KW5 B;  2LZ6 A;  4WJN A;  3AU4 A;  4WWO A;  4KSL C;  3QAQ A;  3VDZ A;  2LAS A;  4B6W A;  1KOT A;  3KUD B;  4ZRI A;  4BVU C;  1P1A A;  1WFY A;  2CHX A;  4X57 B;  3H9D A;  4MGZ E;  4EZL A;  2BWE S;  1GG3 A;  4MGI E;  4PS7 A;  4RM9 A;  2KO3 A;  2L7R A;  1QZE A;  2ZNV B;  1FXT B;  2GBM A;  2NR2 A;  4FUL A;  2I1K A;  5AZH A;  2LVP A;  3L08 A;  4G50 A;  2HD5 B;  4IC7 B;  2MBQ A;  4HWI B;  3VUW A;  1J19 A;  2JRI B;  2RR9 A;  2JT4 B;  2L8J A;  3DCG A;  2L05 A;  1Q5W B;  4WAA A;  2NPT A;  4ZDV A;  1WR6 E;  2NPT B;  4GDK A;  3NZU A;  3ZNG C;  4GDK B;  3PGE A;  3HHM A;  3AUL A;  2G3Q B;  3D32 A;  2DZI A;  2V4L A;  1XD3 B;  4FJY A;  1J8C A;  1SE9 A;  1TTN A;  1IP9 A;  5KHQ A;  1WR1 A;  2CR5 A;  3VUX A;  3O65 B;  4DDI D;  4J6I A;  1V80 A;  3SU8 X;  2DAF A;  2JY6 A;  5LLI A;  3PPA A;  5AZF A;  1OTR B;  2LJ5 A;  4K81 A;  1WH3 A;  3DQV A;  1PQS A;  3PHW B;  5CHW A;  1H4R A;  2KFK B;  2KJR A;  4ANV A;  5IAA C;  4XC2 A;  3PT2 B;  3K9O B;  3SD5 A;  4DWF A;  1C3T A;  3UIO B;  1WX8 A;  4LCD E;  2LXC A;  4MEL A;  4TQ1 A;  4KIK A;  2EMT A;  4W9J A;  1E7V A;  4BBN F;  4KIK B;  3R66 C;  3WAN A;  2WX1 A;  2NVU I;  4NPN A;  5LXI B;  1ZKH A;  4EZJ A;  2ZJD A;  3UF8 A;  3ZO5 B;  4JIO U;  4KZC A;  1P98 A;  5D6J B;  2RD0 A;  4NJ7 A;  1UBI A;  3ZKJ C;  3RUL A;  1OEY J;  2G4S A;  2K1F A;  2LI5 A;  4AOF A;  1AAR A;  5E6O A;  3RZF A;  1GC6 A;  2KOX A;  2LGX A;  2FNJ B;  2G4D B;  1KM7 A;  3NZS A;  3N3K B;  4NQK E;  4HXD A;  4F8C B;  5JHB A;  2NBW B;  1YQB A;  1Z2M A;  2MBB B;  3A9K A;  2FCM A;  2IY1 B;  2ZPN A;  3A9K B;  3PHX B;  4N9F 4;  4TKN A;  4MGY E;  3R7R A;  4AWJ A;  1WJN A;  4GB9 A;  4I6N B;  4MM3 A;  5D2M B;  2Z59 B;  3U7D A;  3PLU A;  3MTN B;  3VXW A;  4BKT A;  2CU1 A;  2IO1 B;  2ZVO A;  3DOW A;  5DPT A;  3WAL A;  4NJ6 A;  1EF1 A;  2KQ7 A;  2N9E B;  3QAR A;  5CHF A;  2K6Q A;  2A4Z A;  2L00 B;  2GBN A;  1WJU A;  4IUM B;  2BF8 B;  3H7P A;  2K8B A;  2OJR A;  2YLM A;  4JGH B;  4WQO B;  5CTR C;  3ZW3 A;  5AZG A;  2K39 A;  3H7S A;  3HM6 X;  2KXJ A;  3QX1 A;  2KJH B;  1IYF A;  2O6V A;  1UZX B;  2MLB A;  1P0R A;  1T0Y A;  2UYZ B;  2KX3 A;  3BIN A;  2JRH A;  3IVF A;  5G55 A;  3HIZ A;  5D7G A;  2DAJ A;  2PJH A;  3EFU A;  4F7Z A;  4B9K A;  2KWV B;  2MWS B;  3ZDM C;  3EEC A;  4EZK A;  1Q0W B;  1NDD A;  4G11 A;  1V2Y A;  2XK5 A;  4HCN B;  2LD9 A;  1H8C A;  3EC8 A;  2XK5 B;  2O2V A;  2BYE A;  2O2V B;  2WWZ A;  2IZV B;  3QJZ A;  2GBR A;  4I6P A;  4ANU A;  3NS8 A;  2LRU A;  3WA0 A;  1E7U A;  3APC A;  1D3Z A;  3UIN B;  3V6C B;  2L3Z A;  5C23 A;  1SIF A;  2KC1 A;  3VQI A;  2KTF A;  1V81 A;  4FHJ A;  1WGR A;  2CKH B;  3ZNH B;  1RLF A;  3UGB B; 
#chains in the Genus database with same CATH topology
 4CYE A;  1GB1 A;  4NAW A;  3T9L A;  2DYO A;  2WYQ A;  1GPX A;  1L7Y A;  2K5P A;  1MFW A;  1IBX B;  1E8Y A;  3X23 A;  2MP2 B;  3IAS 1;  3Q69 A;  5C2T B;  1WF9 A;  1SIJ A;  3GOE A;  1ZPS A;  5TR5 A;  3ZNI D;  3DHI C;  2DEN B;  1I42 A;  3A33 B;  3OAW A;  2K3U A;  2V1Y A;  3SFE B;  5IA7 A;  3MFG A;  3V05 A;  4NY0 A;  2IBI B;  3IHP C;  2CS4 A;  1WGD A;  1T5X D;  2IJ0 A;  2NBV B;  3DPD A;  4KDI C;  2K0P A;  3SDL C;  1QOB A;  3RT3 B;  2C9W B;  2WXF A;  3DBR B;  2LXA A;  1D5M C;  3Q8B A;  2EKE C;  2LHD A;  1XLN A;  1KTK A;  1OQY A;  1E7P B;  2IYD B;  5GXG B;  1XT9 B;  4G0N B;  4RFB A;  2WXL A;  1DYQ A;  1EUV B;  1IGD A;  4WWM A;  4MAC A;  2NBU A;  1MHX A;  4IM0 A;  4ANW A;  5J17 A;  1XLP A;  3PRM B;  4PK1 A;  4ACF A;  1RRB A;  5IP4 D;  3W1S C;  1OQR A;  2V0G A;  1XO3 A;  4USA A;  1SJH D;  2KZR A;  3Q3N C;  1VD2 A;  2KWU B;  4GXB A;  5IOI A;  1TZ1 A;  2W82 A;  1G6J A;  2L1A A;  1RM6 C;  2JQR B;  3ABV B;  1NBF C;  1R4M B;  1WXM A;  2PE6 B;  4TSS A;  2MBH A;  3NJT A;  4MSQ B;  2W55 A;  1QF6 A;  3NHE B;  2FUH B;  3UIP B;  3ZRF A;  1NEN B;  2M0A A;  3W1Y A;  3QCA A;  3DBL I;  4MJS B;  3Q3O C;  4A9A A;  3NVW A;  3WCQ A;  2I38 A;  3CIR B;  3AED B;  3KH0 A;  2WU5 B;  3QQ8 B;  2WXR A;  4W9L A;  1STE A;  2KHW B;  1YN4 A;  1JQ4 A;  3CWI A;  4AJW A;  1TKG A;  1LGR A;  1F52 A;  4II2 B;  1NVI D;  3QC8 B;  2WDT B;  2J42 A;  2ZW1 A;  4L23 A;  5KHO A;  1P3Q U;  4JL9 A;  3KUZ A;  4HLE A;  3GE8 C;  4TQ0 A;  1HZ5 A;  2IO2 B;  2JX5 A;  2INN E;  2ZZP B;  4DHZ E;  1V6E A;  3H8H A;  1MG8 A;  1E6E B;  2BGF A;  4RGN A;  4AUQ C;  4RF1 A;  1Z5S B;  1L6U A;  1UWM A;  1LFD A;  1K51 A;  4C7Y A;  4MT5 A;  1ZXH A;  5G5H A;  3VTU A;  3U8Z A;  2N1W A;  2M1M A;  2DWQ A;  1E8X A;  1ZW7 A;  3PRP B;  4FJV B;  3A9J A;  3FIL B;  1YIW A;  1FM0 D;  1HA5 A;  2K8H A;  3IG3 A;  3ETR A;  2BT6 A;  4IW0 A;  4ZRK A;  3NVY A;  1N5X A;  2REX A;  4NQL B;  2JWZ A;  3PO0 A;  4MH0 E;  2DYB A;  1VZ6 A;  1ZDX A;  4URK A;  1TT5 B;  2N9K A;  1ET6 A;  4XWW A;  1UD7 A;  1WM2 A;  4I6L B;  4YL8 A;  1BXT A;  2RDH A;  1ACC A;  2BS3 B;  2IDY A;  1HTQ A;  2FCN A;  4ZRJ A;  4S0R A;  1XF5 L;  4K7W A;  5AEK B;  3AU5 A;  1V1O A;  1HEZ E;  2K25 A;  4KSK C;  1AYF A;  1EM7 A;  4JLC A;  4BFR A;  3KYD D;  2LUM A;  1VZ8 A;  3ZXR A;  1UUP A;  3AE2 B;  1SE3 A;  3WAM A;  2XN9 C;  2D11 A;  3U4E G;  2JSV X;  2PKO A;  3VRA B;  1WMH B;  1FEH A;  5H92 C;  2MJE A;  3QK0 A;  3T3N A;  3A4S C;  1YQ4 B;  3WAP A;  4EOY A;  3W5U B;  2AX5 A;  2BYV E;  2X38 A;  3ZIM A;  4MEM A;  1WRD B;  3L4P A;  1DGJ A;  5FR6 A;  2ON8 A;  4C4V B;  2WNM A;  1YJ1 A;  4ICV A;  2H89 B;  1XXG A;  2KKC A;  4H2A A;  2OED A;  4LNO A;  1TZO A;  4AS1 A;  1MPE A;  2J52 A;  3LDZ E;  3APD A;  2MCN B;  5EE9 A;  2FCQ A;  1HZ6 A;  5E6P A;  4C56 C;  2WXO A;  1KLV A;  3ZQ4 A;  1JWM D;  5L83 A;  2KDF B;  4ZHO A;  1WSP A;  1KOT A;  3KUD B;  4ZRI A;  1P1A A;  2AQ1 B;  2BWE S;  2V4I B;  4MGI E;  4PS7 A;  2LJI A;  2WS3 B;  2KO3 A;  1TJE A;  1FXT B;  2INC C;  2NR2 A;  3FC4 A;  5AZH A;  4G50 A;  1EWC A;  4QAY A;  3VUW A;  1NI3 A;  1R4N B;  2L8J A;  1T3Q A;  3ZNG C;  2V3N A;  3ZYY X;  2KMM A;  1PGA A;  4M01 A;  1XD3 B;  3J9C A;  4YSX B;  4KKJ A;  1C9F A;  1YNT E;  3W9C B;  5LLI A;  2IPK D;  3PPA A;  3DQV A;  2BVC A;  3PHW B;  3B2F A;  2WXJ A;  2FE8 A;  2V9H A;  4XWT A;  1TY0 A;  3K9O B;  1C3T A;  4MEL A;  2LXC A;  4TQ1 A;  3R66 C;  5LXI B;  3EGR A;  3BVZ A;  4EZJ A;  3UF8 A;  4KZC A;  1P98 A;  2RMM A;  2RD0 A;  3RUL A;  2K1F A;  2KOX A;  1PDX A;  3NZS A;  4XYC A;  2MBB B;  2OHF A;  5HI1 A;  4DXF A;  2IY1 B;  2ZPN A;  3A9K B;  4TKN A;  3R7R A;  1L4Z B;  1WJN A;  4GB9 A;  3U7D A;  3VXW A;  5T8I A;  4BKT A;  1C78 A;  3PLU A;  2IO1 B;  3DOW A;  5DPT A;  1UNS A;  2K6Q A;  1YN5 A;  1WJU A;  3DHG C;  2J4X A;  5MPO A;  3MJ5 A;  3ZW3 A;  1L4D B;  1SB3 C;  3H7S A;  3HM6 X;  2KXJ A;  2QCZ A;  3QX1 A;  1P0R A;  1T0Y A;  1N63 A;  3BIN A;  3MC9 A;  1FNW A;  1T0S C;  2DLB A;  1UF0 A;  3EFU A;  1F2R I;  2MWS B;  3ZDM C;  4EZK A;  5AUI A;  1NDD A;  2SEB D;  3UI3 A;  1V2Y A;  2D3C A;  4HCN B;  3EC8 A;  2O2V B;  2WWZ A;  3BII D;  4I6P A;  2GBR A;  2LRU A;  3V6C B;  2L3Z A;  1SIF A;  4FHJ A;  5BMH A;  3ZNH B;  1SJE D;  1SSN A;  3KLS X;  3PSE B;  1F1H A;  2LGD A;  3DHH C;  1U4A A;  2N0S B;  4FAD A;  2HDE A;  2KNB A;  2R2Q A;  3AEC B;  1JRO A;  5C3J B;  3VFK A;  2MHJ A;  2UWQ A;  3M62 B;  5HG2 A;  1KF6 B;  1GC7 A;  4W9I A;  3A9J B;  2JZP A;  1KLG D;  2AL3 A;  4W9G A;  1S3S G;  2FAZ A;  3VTW A;  4BKS A;  4ANX A;  3SEB A;  3GZN B;  4LLG M;  3UQA A;  1KLU D;  2LFI A;  2WU2 B;  4OHJ A;  2MA9 B;  1AN8 A;  2M4N A;  4II3 B;  3RYT A;  3DDC B;  4DHJ D;  2JXX A;  3B1L X;  3NOB A;  1GB4 A;  2JZZ A;  1UBQ A;  2IGG A;  3N9Y C;  4C80 A;  3DVN V;  3T3O A;  4BZA A;  2HJ1 A;  1NYR A;  1V9J A;  1XCT L;  2CHW A;  3H1U A;  3K9P B;  2IO0 B;  1RFA A;  3Q3J A;  2D2Q A;  3PZ8 A;  2RPQ A;  5HFY A;  4DK5 A;  1YMH E;  3JW0 X;  4E3C A;  1WYW B;  5D3D A;  1UGJ A;  1S1Q B;  1VCB A;  2AEH A;  3TJP A;  1GAQ B;  4ITK A;  3A4R A;  5JXV A;  3P2B A;  3HVZ A;  4GDL B;  3V62 A;  4DHZ B;  1WM3 A;  1IPG A;  2Y3A A;  2ZW0 A;  1HQR D;  5AUK A;  3LXF A;  2N9X A;  3BY4 B;  3DVG X;  3I57 A;  2N9P C;  2KDE B;  2JPH A;  2RSU A;  2M19 A;  4DHJ B;  1PGX A;  2KTR A;  4YXD B;  3LYY A;  3BVG A;  2XBB C;  3CST A;  1I4Q A;  1PUT A;  1WJ6 A;  5JZE B;  2C7N B;  3TMP B;  3T8M A;  2R2O A;  3PRZ A;  4DDG D;  2N7J A;  1I4R A;  1TKE A;  3A1Q B;  2L52 A;  3Q8F A;  5BYS A;  4PS3 A;  1GUA B;  4ARI A;  3TEZ A;  2KLC A;  2IY0 B;  3M95 A;  1MJD A;  3BK1 A;  2L0T A;  1P9D U;  3VTV A;  2QDF A;  1YJI A;  1EU4 A;  2KVR A;  1SGH A;  1L6V A;  3MJW A;  3AEG B;  1ZP0 B;  2MQJ A;  3AMZ A;  4W9D A;  2PW9 A;  3Q8C A;  3ZNZ B;  1WYG A;  3ZTC A;  4BAX A;  1E90 A;  1T0Q C;  3NG0 A;  1RYJ A;  5JH5 C;  2YEP B;  4IDI A;  2BYF A;  4GOC A;  2PTL A;  1E5W A;  2RPV A;  2I1J A;  4LJP B;  3DBR I;  5DPR A;  2Y5B B;  1WGY A;  3TL5 A;  1E8Z A;  3AEF B;  1ISN A;  5CHV C;  3LJ3 A;  3JVZ X;  2WDR B;  1YOV B;  4OVV A;  4HDQ A;  4XDD A;  4RGT A;  3MHS D;  4RNA A;  2LVO A;  4LJO B;  1QIL A;  1I7H A;  1WJ4 A;  1XEE A;  3U2S C;  4IWQ A;  4FLH A;  1TKY A;  1TBE A;  3Q8E A;  2TSS A;  1N5W A;  3W5V B;  1BT0 A;  3DWM A;  2WX0 A;  1R4M I;  4A20 A;  3P4R B;  1JWB D;  1FXA A;  2KYW A;  2MX2 A;  2G9H D;  5EE1 A;  2C5L C;  4WWP A;  3U30 A;  1FPY A;  2MRP A;  3B9J A;  4IWP A;  2K9X A;  2JWU A;  1X1M A;  4W9F A;  3M3J A;  4HK2 A;  5J18 A;  1NI2 A;  2BB6 A;  3NY5 A;  2FIF A;  2KC2 A;  3VHT C;  4US8 A;  2M56 B;  2J53 A;  4IM3 A;  4BKS D;  2W9N A;  3Q6B A;  4W9H A;  3ZXV A;  5J2R A;  2QIL A;  2YVC A;  1CJE A;  2J0K A;  3AE8 B;  1TS3 A;  4KGT A;  2BPS A;  3ML8 A;  2C7H A;  4WJP A;  1CK1 A;  3DVN U;  4XE0 A;  2CU3 A;  1MHH E;  4WAF A;  2I2Y A;  3QA8 A;  2KWC A;  3BZD B;  1DOY A;  4B0E A;  1YJJ A;  1VJK A;  4B95 A;  1UWX A;  4HCP B;  4N58 A;  3TCA A;  4OZA A;  4WJO A;  4W9K A;  1KJT A;  1C4C A;  2VRR B;  1M94 A;  2RDB C;  5EDS A;  2IND C;  4WJN A;  3P63 A;  3VDZ A;  3QAQ A;  1WFY A;  3BYY B;  4MGZ E;  4EZL A;  1GG3 A;  3TEX A;  2LHE A;  4YWG G;  3PZ7 A;  5IO9 A;  1QZE A;  2GBM A;  2I1K A;  2E6X A;  3I63 C;  4IC7 B;  2WXG A;  4HWI B;  2JT4 B;  3AV8 A;  2L05 A;  1Q5W B;  4WAA A;  1QOA A;  5BYR A;  2NPT B;  4GDK B;  4KKI A;  3GE3 C;  1JW9 D;  1E9M A;  3NZ3 A;  3PGE A;  3AUL A;  2G3Q B;  3D32 A;  2DZI A;  4FJY A;  1J8C A;  2CR5 A;  1EWY C;  4ZRQ A;  4DDI D;  2NTT A;  4J6I A;  4B0M A;  2JY6 A;  1GOZ A;  5AZF A;  1OTR B;  2LJ5 A;  3LB8 C;  2GI9 A;  1H4R A;  4HEA 1;  3AE5 B;  2KJR A;  4ANV A;  2ICI A;  3UIO B;  4LCD E;  4W9J A;  4BBN F;  1E7V A;  1TS2 A;  4KIK B;  4REZ A;  2WX1 A;  2NVU I;  4NPN A;  1ZKH A;  1QT9 A;  1YQ3 B;  3AH7 A;  4NJ7 A;  2G4S A;  2DNF A;  2WXK A;  1AAR A;  5G5G A;  2G4D B;  4HXD A;  2NBW B;  1YQB A;  3MP9 A;  2FCM A;  2GRI A;  2WXP A;  4MGY E;  1JWU D;  4MM3 A;  2CU1 A;  2ZVO A;  1IUE A;  3EFC A;  3TEW A;  1EF1 A;  3QAR A;  3RMK C;  2A4Z A;  3H7P A;  3TEY A;  5EE0 A;  4KGR A;  4NAM A;  5AZG A;  1FFV A;  1E10 A;  4YSZ B;  3EA6 A;  2O6V A;  1UZX B;  4RGM A;  2KVZ A;  2KX3 A;  5FR3 A;  3IVF A;  3HIZ A;  5D7G A;  3AEE B;  3B2G A;  4F7Z A;  2MJD A;  3EEC A;  3DBH B;  2IGH A;  2ONQ A;  4HRO A;  3Q2A C;  4M02 A;  2HTM E;  3MC8 A;  4G11 A;  2LD9 A;  2XK5 B;  1C4P A;  2WXM A;  3P4P B;  3NS8 A;  3WA0 A;  3APC A;  1BML C;  2FBW B;  3TSS A;  3VQI A;  2KTF A;  1V81 A;  1R7S A;  3UGB B;  2LRW A;  4IOI E;  2N1V A;  4NAW B;  4XDC A;  1TIF A;  1VZ7 A;  3Q3F A;  2GB1 A;  4FA6 A;  1L0V B;  4M8N A;  4EFO A;  1L2N A;  1YD8 U;  1SE2 A;  2KN4 A;  4S17 A;  1ZGU B;  2DX5 B;  1OGW A;  2KMC A;  1R4N I;  2BQQ A;  4RMA A;  3AE9 B;  5TSS A;  3I3T B;  1C79 A;  1I4G A;  2AQ3 B;  3ML9 A;  2BKR B;  3VR8 B;  1CQV A;  2OOB B;  1J7C A;  4D2K A;  4ZRP A;  1SF0 A;  1J7B A;  2LGI A;  2WHI A;  4RM8 A;  4DBG A;  1JWS D;  3IT4 B;  1OFF A;  2INP E;  4EE2 A;  2G45 B;  2KFK A;  4FN2 A;  1LM8 B;  2FID A;  3W2D A;  3VH4 B;  1XLQ A;  3IAM 1;  3P42 A;  2ZEQ A;  1VRA B;  4KV2 A;  2BS4 B;  2Z0E B;  4RF0 A;  4TV3 A;  4K7U A;  2VH1 A;  2PVO D;  1K52 A;  2DZM A;  1D5Z C;  3QWZ B;  4BOZ B;  4GIV A;  2ZPY A;  4A3O A;  4YTP B;  3AE1 B;  5DPW A;  5FKA C;  3C0R B;  4L1B A;  2DHZ A;  3VVW B;  2NS5 A;  4J3O D;  1ZXI A;  2KLG A;  4HVB A;  1WXS A;  3R3M A;  4O1N A;  1VLB A;  5LXH A;  1SEB D;  3RNC C;  4KGS A;  5LNK 1;  3BWU D;  3HVD A;  1WGK A;  3E56 A;  4C00 A;  5E6J A;  2JYT A;  1I35 A;  3KVF B;  3PVL A;  4YTN B;  1C77 A;  5EE3 A;  2C60 A;  2KQS A;  1WX7 A;  4HRS A;  3ZDT A;  3FAH A;  3L54 A;  3N30 A;  2D3A A;  3IFW B;  4ZHP A;  3ZJU A;  4LK0 M;  2AQ2 B;  4N59 A;  1N61 A;  4GU2 A;  3TBL D;  4WQM A;  3MHZ A;  4GGQ A;  1T0R C;  1JRU A;  1F2R C;  4HKQ A;  1PFD A;  1UEL A;  4LTU A;  4HPM B;  1FCC C;  3GS2 A;  1OQQ A;  4TUU A;  2LGS A;  4M0W A;  3P1M A;  5IN7 A;  1E0Z A;  3AE3 B;  1I4P A;  5BMG A;  2KFJ A;  4FJZ A;  3S2A A;  2EKI A;  1QLB B;  1F9J A;  3N32 A;  2J0M A;  4HPP A;  4FHK A;  2GBJ A;  2EEL A;  2IO3 B;  3AE6 B;  4US9 A;  3U7Z A;  4TMA B;  1J0G A;  2A5U A;  1YX6 B;  2ZNV C;  4DXG A;  1I4X A;  3GZN I;  4JQW C;  2K8C A;  4NNJ B;  3JSV A;  2WXI A;  4E74 A;  2DZJ A;  1C4A A;  2DZK A;  4P6V F;  1HTO A;  5IKC M;  2D3G A;  3B08 A;  3C19 A;  4ZYN A;  2KJ6 A;  3N1Z C;  2O6V D;  3JYU A;  4AJY B;  1JML A;  4P16 A;  2D07 B;  4F1S A;  2ACZ B;  2CJN A;  4A8X C;  4KX6 B;  3PLV A;  4EEW A;  1KFY B;  1Y8R C;  2GBK A;  1YX5 B;  1ZUD 2;  4K3B A;  2DYM A;  4LDT D;  1RAX A;  1WRI A;  2KAC A;  1GJZ A;  4BOS C;  1Y56 A;  1EU3 A;  2XEW A;  1SBB B;  3O13 A;  3EHV A;  3RNG C;  3R7Q A;  4IG7 B;  3CF6 E;  1FNV A;  1WMH A;  1OEY A;  4XX5 A;  1K50 A;  3AB5 A;  2PVG C;  4IM2 A;  3R2I A;  3ZRC A;  2KAJ A;  2NMQ A;  1N6Z A;  5C1Z A;  2V3S A;  4GSW A;  2MBO A;  4P1B C;  3H7P B;  2W3R A;  2PEA A;  3N1X C;  4XGA B;  1V86 A;  5FK9 C;  1ZDV A;  3AI5 A;  3ZVV A;  1UH6 A;  2KD0 A;  2O6V B;  3NVV A;  2GLS A;  4G3X B;  3ALB A;  5L95 C;  1D4B A;  4CQN A;  5DCN A;  3CSF A;  4IWO A;  2KMA A;  4ARC A;  1V97 A;  2NCN A;  1K8R B;  1EF5 A;  4M8M A;  2D10 A;  4EKU A;  3L16 A;  2LVQ A;  2JU6 X;  1WXV A;  4LDT B;  2HE7 A;  2AWT A;  1P7E A;  1B1Z A;  3KW5 B;  2LZ6 A;  3AU4 A;  4WWO A;  4KSL C;  1PGB A;  1ESF A;  2LAS A;  4B6W A;  4BVU C;  1L0X B;  4RM9 A;  2L7R A;  1CZP A;  1ZOY B;  4MH8 A;  4GLS C;  4FUL A;  1V1P A;  2LVP A;  3L08 A;  3SR6 A;  3I5J C;  1J19 A;  3DCG A;  2OJW A;  3NZU A;  3HHM A;  2XNA C;  3AE7 B;  4PT5 A;  1IP9 A;  1WR1 A;  3VUX A;  3O65 B;  1MI0 A;  1V80 A;  4K81 A;  1WH3 A;  4RH6 A;  2KFK B;  2BTE A;  1QOF A;  2Y5C A;  1FXI A;  2CJO A;  4XC2 A;  5IAA C;  1JRP A;  1WX8 A;  4JWS C;  4ZOH C;  3I9V 1;  2EMT A;  2ZJD A;  4JIO U;  4A55 A;  3ZKJ C;  1QKZ A;  1T6B X;  4R3D A;  5E6O A;  3RZF A;  1GC6 A;  2KT7 A;  2NTS A;  4F8C B;  3N3K B;  5JHB A;  3A9K A;  4N9F 4;  4AWJ A;  1FFU A;  2D5G A;  4I6N B;  5D2M B;  2Z59 B;  3MTN B;  3WAL A;  4NJ6 A;  2KQ7 A;  3Q3M C;  2L00 B;  4IUM B;  1FCL A;  2YLM A;  1SXT A;  4JGH B;  4WQO B;  5CTR C;  2JXT A;  3DBL B;  3RFZ B;  2RDG A;  3AEB B;  2KJH B;  2MLB A;  2PMV A;  2WXN A;  2JYE A;  2DAJ A;  3E9S A;  1C76 A;  3R8B A;  1Q0W B;  3ZJT A;  1HXY D;  1H8C A;  2O2V A;  1F0Z A;  4ANU A;  2UU7 A;  4C7Z A;  5C23 A;  3P4S B;  2BW2 A;  1RWS A;  1QQR A;  1TGZ B;  1WY8 A;  1V49 A;  2L32 A;  1VR9 A;  1VDV A;  2MJ3 A;  2MSE D;  3U52 E;  5GMV A;  1FO4 A;  1HE8 A;  2BKF A;  1J7A A;  4PYU A;  3UQB A;  3V60 A;  3NRZ A;  2N4F A;  4M0W B;  3AXC A;  1DOX A;  3L13 A;  1WIA A;  2KN5 A;  1E8W A;  3VAW A;  1TS5 A;  3RPF C;  4HJK A;  1FD6 A;  2ASQ A;  2KDB A;  2ZCC A;  2ZVN A;  3X0W A;  1WXA A;  3QHT A;  3ECI A;  4RCO A;  4ICU A;  1SE4 A;  1WGG A;  1FIQ A;  4A90 A;  4M00 A;  2QC8 A;  4OVZ A;  1RFK A;  3AM9 A;  3ZTD A;  1AW7 A;  4HKZ E;  3JSV B;  1JWA D;  5CX3 A;  2GMI C;  3CMM B;  3B0A A;  1LXD A;  5JHA A;  1WE7 A;  4K1R B;  2KAN A;  1A70 A;  2AYO B;  4WWN A;  1A5R A;  4CO7 A;  4E71 A;  4L2Y A;  4KVG B;  3RD2 A;  5D94 A;  3H6N A;  1ET9 A;  3RCZ A;  3RZW C;  2B3A A;  5G2N A;  3ONS A;  1D5X C;  3M63 B;  4A6Q A;  2CHZ A;  2WLB A;  1WZ0 A;  3PZD A;  3PV1 A;  2VH2 A;  4EUT A;  4Q2J A;  4IKG A;  4PS8 A;  5BMI A;  1WGH A;  4K7S A;  2H88 B;  2M17 A;  4DQO C;  4RGO S;  1KH0 A;  2LUE A;  3KWV A;  1YN3 A;  2L83 A;  2EMS A;  4HDO A;  4LNN A;  1F77 A;  3Q8A A;  4P1C C;  4AQ7 A;  4WH4 A;  4DXA B;  1V5T A;  4MSM B;  4GDL A;  1PYW D;  2WGS A;  2PLP A;  3GP7 A;  3C8Y A;  2ZCB A;  2JVC A;  2LGY A;  2KQ4 X;  3VRB B;  3P4Q B;  3R2T A;  3L17 A;  1ZE3 D;  3HK0 A;  5DPS A;  3DBH I;  2HTH A;  2PE9 A;  4JE3 B;  3PS6 A;  2KTR B;  1FMA D;  4BBN C;  1Q1O A;  2L76 A;  2MH7 A;  3ZJV A;  5H8Y E;  4N6E B;  2K6D B;  1WX9 A;  3VUY A;  1TS4 A;  4XZ4 A;  1WWT A;  5E6N A;  2J0J A;  4WUR A;  3A1Q A;  4GN1 A;  4K3C A;  5HHD G;  3KYC D;  3IT6 B;  1IBX A;  1TY2 A;  2FUG 1;  3SHQ A;  2MP2 A;  4KZ0 A;  2MEK A;  3ZGZ A;  4WJQ A;  1CMX B;  4MDK E;  3V3X A;  1LO5 D;  1MG4 A;  3ENE A;  4ASW C;  1WXQ A;  1LQB A;  2HJ8 A;  4BKG A;  4GMV A;  3L10 B;  2L0F A;  1Q10 A;  2JUO A;  1GNU A;  4JWU C;  3OJ4 B;  2J7Q B;  1V1P B;  3IXS A;  3DVG Y;  1NYQ A;  4A3P A;  3ZUN A;  2LWP A;  5D3I B;  3ZLZ A;  3KUC B;  4W9E A;  1WI0 A;  4LNK A;  2WP9 B;  2RGF A;  4AP4 C;  1FRR A;  1K53 A;  4NZL B;  1EO6 A;  2KK8 A;  1WZ3 A;  2MBE A;  5HKH A;  2QSD A;  2JF5 A;  2M8S A;  2MW5 A;  4YT0 B;  2N7D A;  3VH3 B;  3W1S A;  2M0X A;  4HJG E;  3DBS A;  3OLM D;  3OWE B;  2LEK A;  2QHO A;  3SFD B;  2BB5 A;  3PRE A;  4KDL B;  2AL6 A;  4ZYS A;  3WIM A;  4FBJ B;  3TIX A;  4CHK A;  4YTM B;  4PYZ A;  4OVU A;  1AWD A;  2SAK A;  1UGM A;  4P7I A;  2BWF A;  1C1Y B;  2PPH A;  4MGK E;  2Z0D B;  4MJS A;  4WIP A;  3V61 A;  2C7M B;  3QIJ A;  4FXC A;  5BO4 B;  3KQ4 A;  1V8C A;  5I4D A;  3KWL A;  3WAO A;  1V5O A;  2GOW A;  1WE6 A;  2V3P A;  2FCS A;  2KX0 A;  3OJ3 A;  3APF A;  3Q14 C;  4OW0 A;  2BS2 B;  3RNE C;  3RUI B;  2WQY B;  4W9C A;  2QJL A;  3HUI A;  4LNI A;  3DWG C;  3MC0 B;  3HM3 A;  1XCQ L;  2KDI A;  3EUB 2;  3L0W B;  3NUH B;  4JX1 C;  3AN1 A;  1XQQ A;  3IBE A;  3PTF C;  3RNA C;  4HPL B;  1N62 A;  2N7E A;  2N9L A;  3V6E B;  2JZ3 B;  1JCK B;  2CHX A;  4X57 B;  3H9D A;  1FRD A;  4JPS A;  5BYQ A;  3FIL A;  3RI7 C;  3GB1 A;  4YSY B;  2VZK D;  4OZB A;  2K22 A;  2ZNV B;  3URY A;  2QEJ C;  2Q5W D;  2WDV B;  2HD5 B;  2MBQ A;  2E3T A;  2JRI B;  2RR9 A;  3BVM A;  2NPT A;  3TUO A;  1WR6 E;  4ZDV A;  4GDK A;  4LNF A;  3OG5 A;  3BYT B;  1XLO A;  1I4H A;  2V4L A;  2W3S A;  2QMT A;  2B76 B;  1SE9 A;  1TTN A;  5KHQ A;  2WXQ A;  1L0Y B;  3SU8 X;  2DAF A;  2KWD A;  4NJC A;  1L5P A;  3RNF C;  2IGD A;  1KRH A;  1TYG B;  3N20 C;  3NS1 A;  1PQS A;  5CHW A;  1DOI A;  2WXH A;  1D6E C;  1P7F A;  3PT2 B;  3SD5 A;  4DWF A;  4KIK A;  3WAN A;  3BK2 A;  3ZO5 B;  5D6J B;  1UBI A;  3RN9 C;  2Y5P A;  1OEY J;  2LI5 A;  4AOF A;  2PIA A;  2DBY A;  2LGX A;  2FNJ B;  4NQK E;  1KM7 A;  1B9R A;  3FKY A;  1Z2M A;  2D3B A;  2X8X X;  3PHX B;  2BBC A;  2VZK B;  2G1E A;  2BYT A;  4MM3 B;  1NEK B;  2N9E B;  1BUI C;  5CHF A;  3AEA B;  2GBN A;  2BF8 B;  2K8B A;  2OJR A;  1ENF A;  3AE4 B;  2Z8L A;  4UDU C;  1M4V A;  1QOG A;  1FNU A;  2K39 A;  2WDQ B;  1IYF A;  4C4V A;  2UYZ B;  2JRH A;  1N60 A;  5G55 A;  3N1Y C;  2PJH A;  3HRD D;  4OZC A;  4B9K A;  2KWV B;  1ROE A;  3VR9 B;  2YEP F;  1IGC A;  1JAL A;  2QIE B;  2XK5 A;  2BYE A;  2IZV B;  2KDM A;  3QJZ A;  2W54 A;  1E7U A;  1D3Z A;  3UIN B;  2LMC A;  2KC1 A;  3NVZ A;  3RNB C;  2R61 A;  1MVK A;  1WGR A;  2CKH B;  1RLF A; 
#chains in the Genus database with same CATH homology
 1TGZ B;  4CYE A;  2LRW A;  4NAW A;  1WY8 A;  2N1V A;  4NAW B;  3PSE B;  1V49 A;  3T9L A;  2LGD A;  3Q3F A;  2DYO A;  1U4A A;  2WYQ A;  1L7Y A;  2MSE D;  5GMV A;  1HE8 A;  4FA6 A;  2BKF A;  4M8N A;  1E8Y A;  4EFO A;  1YD8 U;  1L2N A;  3X23 A;  1ZGU B;  2MP2 B;  4FAD A;  2KNB A;  2DX5 B;  2R2Q A;  4PYU A;  3V60 A;  3UQB A;  2N4F A;  1OGW A;  1WF9 A;  3GOE A;  4M0W B;  3VFK A;  3AXC A;  2KMC A;  5TR5 A;  3ZNI D;  1I42 A;  2DEN B;  1R4N I;  2UWQ A;  3A33 B;  3L13 A;  3OAW A;  2V1Y A;  4RMA A;  5IA7 A;  1WIA A;  3M62 B;  2KN5 A;  1E8W A;  3I3T B;  3VAW A;  3ML9 A;  4NY0 A;  2BKR B;  1GC7 A;  4W9I A;  4HJK A;  2ASQ A;  2KDB A;  2ZCC A;  2ZVN A;  3A9J B;  3X0W A;  1WXA A;  2AL3 A;  3QHT A;  4W9G A;  1S3S G;  2FAZ A;  3ECI A;  2IBI B;  3VTW A;  3IHP C;  4ICU A;  4BKS A;  4ANX A;  2CS4 A;  1WGD A;  1WGG A;  2NBV B;  2OOB B;  3DPD A;  3UQA A;  4KDI C;  2MA9 B;  3SDL C;  3ZTD A;  2M4N A;  3RT3 B;  4II3 B;  2C9W B;  3RYT A;  3JSV B;  2LXA A;  3DDC B;  4RM8 A;  2JXX A;  4DHJ D;  4DBG A;  5CX3 A;  2EKE C;  3B1L X;  1OQY A;  2GMI C;  3NOB A;  3CMM B;  2IYD B;  2JZZ A;  3B0A A;  1UBQ A;  1LXD A;  1XT9 B;  2G45 B;  2KFK A;  4G0N B;  4FN2 A;  1LM8 B;  2FID A;  5JHA A;  1EUV B;  1WE7 A;  3DVN V;  4K1R B;  2NBU A;  3VH4 B;  2KAN A;  2AYO B;  4WWN A;  2ZEQ A;  1A5R A;  4KV2 A;  4CO7 A;  4E71 A;  4IM0 A;  3RD2 A;  4KVG B;  2Z0E B;  4ANW A;  5J17 A;  5D94 A;  3H6N A;  3RZW C;  3RCZ A;  3PRM B;  1RRB A;  2B3A A;  4TV3 A;  5G2N A;  3ONS A;  1V9J A;  2CHW A;  4K7U A;  3M63 B;  3H1U A;  2CHZ A;  3W1S C;  1WZ0 A;  2DZM A;  3PZD A;  3PV1 A;  3K9P B;  3QWZ B;  2KZR A;  4GIV A;  2IO0 B;  4BOZ B;  4EUT A;  1RFA A;  2ZPY A;  4A3O A;  1VD2 A;  2KWU B;  3Q3J A;  2D2Q A;  4GXB A;  4PS8 A;  1WGH A;  2RPQ A;  1TZ1 A;  1G6J A;  5DPW A;  4K7S A;  2M17 A;  3C0R B;  4DK5 A;  2LUE A;  1NBF C;  3JW0 X;  4E3C A;  1WYW B;  1WXM A;  2DHZ A;  2PE6 B;  3VVW B;  2NS5 A;  1S1Q B;  1VCB A;  2KLG A;  2EMS A;  4HDO A;  4HVB A;  2MBH A;  4MSQ B;  1WXS A;  2AEH A;  3TJP A;  3A4R A;  3R3M A;  3NHE B;  2FUH B;  3UIP B;  4DXA B;  1V5T A;  4MSM B;  3ZRF A;  5LXH A;  3P2B A;  4GDL A;  4GDL B;  3V62 A;  4DHZ B;  1WM3 A;  2ZCB A;  1IPG A;  2JVC A;  2LGY A;  3DBL I;  3QCA A;  4MJS B;  3W1Y A;  2N9X A;  3BY4 B;  1I35 A;  3DVG X;  3KVF B;  3PVL A;  2N9P C;  3KH0 A;  3QQ8 B;  2KDE B;  3L17 A;  4W9L A;  2KHW B;  4AJW A;  2JPH A;  2RSU A;  2C60 A;  2KQS A;  3HK0 A;  4II2 B;  5DPS A;  1WX7 A;  4DHJ B;  3DBH I;  3ZDT A;  2HTH A;  2PE9 A;  3QC8 B;  2KTR A;  2WDT B;  3L54 A;  2KTR B;  3IFW B;  3N30 A;  3PS6 A;  4BBN C;  1Q1O A;  2XBB C;  2L76 A;  5KHO A;  1P3Q U;  4JL9 A;  3CST A;  3KUZ A;  4HLE A;  1WJ6 A;  5JZE B;  2C7N B;  2K6D B;  4TQ0 A;  4GU2 A;  3TMP B;  1WX9 A;  3TBL D;  2IO2 B;  3VUY A;  3T8M A;  4GGQ A;  2R2O A;  3PRZ A;  4DDG D;  2ZZP B;  4XZ4 A;  4DHZ E;  1V6E A;  1JRU A;  2J0J A;  1MG8 A;  5E6N A;  3A1Q A;  3A1Q B;  2BGF A;  4PS3 A;  1GUA B;  4GN1 A;  4AUQ C;  3KYC D;  1UEL A;  1Z5S B;  2KLC A;  2IY0 B;  1LFD A;  3M95 A;  4HPM B;  2L0T A;  1P9D U;  3SHQ A;  2MP2 A;  4TUU A;  3VTV A;  4KZ0 A;  4WJQ A;  3VTU A;  1CMX B;  4MDK E;  3U8Z A;  2KVR A;  1SGH A;  3MJW A;  3ENE A;  2KFJ A;  2MQJ A;  4W9D A;  4ASW C;  2N1W A;  4FJZ A;  3S2A A;  1LQB A;  2M1M A;  1E8X A;  3ZNZ B;  2HJ8 A;  1F9J A;  3ZTC A;  3N32 A;  2J0M A;  1ZW7 A;  3PRP B;  4FJV B;  4BKG A;  3A9J A;  4FHK A;  1YIW A;  2GBJ A;  1E90 A;  2IO3 B;  2K8H A;  3IG3 A;  3L10 B;  4GMV A;  2L0F A;  4IW0 A;  4ZRK A;  1J0G A;  2A5U A;  2JUO A;  1GNU A;  1YX6 B;  5JH5 C;  3OJ4 B;  2J7Q B;  2REX A;  2BYF A;  2ZNV C;  4GOC A;  3GZN I;  4JQW C;  1E5W A;  2JWZ A;  4NQL B;  3DVG Y;  2K8C A;  4NNJ B;  3JSV A;  2DYB A;  2I1J A;  4LJP B;  4MH0 E;  4E74 A;  2DZJ A;  3DBR I;  4A3P A;  5DPR A;  3ZUN A;  2Y5B B;  2LWP A;  1WGY A;  2DZK A;  3KUC B;  3TL5 A;  4W9E A;  3ZLZ A;  4URK A;  1WI0 A;  1E8Z A;  1ISN A;  5CHV C;  2RGF A;  3LJ3 A;  1UD7 A;  3JVZ X;  4AP4 C;  2D3G A;  3B08 A;  4ZYN A;  1WM2 A;  2KJ6 A;  4I6L B;  2O6V D;  3JYU A;  4OVV A;  4HDQ A;  4YL8 A;  1EO6 A;  2KK8 A;  1WZ3 A;  2MBE A;  4AJY B;  5HKH A;  2D07 B;  2JF5 A;  2M8S A;  2MW5 A;  4F1S A;  3MHS D;  2N7D A;  3PLV A;  3VH3 B;  2LVO A;  3W1S A;  4LJO B;  2M0X A;  4EEW A;  3DBS A;  2FCN A;  3OLM D;  4ZRJ A;  2QHO A;  4K7W A;  1Y8R C;  3PRE A;  5AEK B;  3AU5 A;  2GBK A;  2K25 A;  4KSK C;  1YX5 B;  4KDL B;  1WJ4 A;  2AL6 A;  4JLC A;  4IWQ A;  2DYM A;  4FLH A;  1TBE A;  4LDT D;  1RAX A;  3WIM A;  4BFR A;  1GJZ A;  1BT0 A;  4FBJ B;  3TIX A;  2WX0 A;  3KYD D;  1R4M I;  4A20 A;  4CHK A;  4BOS C;  4PYZ A;  3WAM A;  4OVU A;  4P7I A;  1UGM A;  2XEW A;  2MX2 A;  3EHV A;  2D11 A;  2BWF A;  3R7Q A;  1C1Y B;  4IG7 B;  3CF6 E;  2C5L C;  4WWP A;  2PPH A;  4MGK E;  2Z0D B;  4MJS A;  1WMH A;  3U30 A;  1OEY A;  1WMH B;  2MRP A;  4IWP A;  4XX5 A;  3V61 A;  2C7M B;  3QIJ A;  5BO4 B;  4IM2 A;  1X1M A;  3ZRC A;  4W9F A;  3M3J A;  4HK2 A;  5J18 A;  3QK0 A;  1NI2 A;  5C1Z A;  3WAO A;  2V3S A;  1V5O A;  2GOW A;  3A4S C;  1WE6 A;  4GSW A;  3NY5 A;  2FIF A;  2MBO A;  3H7P B;  2KC2 A;  2PEA A;  1V86 A;  2FCS A;  3VHT C;  2KX0 A;  3OJ3 A;  3WAP A;  3AI5 A;  4EOY A;  3APF A;  4IM3 A;  2BYV E;  3ZVV A;  3ZIM A;  4BKS D;  4MEM A;  1WRD B;  1UH6 A;  2W9N A;  5FR6 A;  2KD0 A;  2O6V B;  3RUI B;  4W9C A;  4W9H A;  1YJ1 A;  4G3X B;  3ALB A;  4ICV A;  5L95 C;  5J2R A;  2YVC A;  2J0K A;  5DCN A;  3HM3 A;  3CSF A;  2KKC A;  2BPS A;  3ML8 A;  2C7H A;  4IWO A;  2KMA A;  4WJP A;  3DVN U;  2KDI A;  3LDZ E;  2NCN A;  1K8R B;  3APD A;  3QA8 A;  2MCN B;  1EF5 A;  2KWC A;  4B95 A;  4M8M A;  2D10 A;  2FCQ A;  4EKU A;  3L0W B;  4HCP B;  5E6P A;  3L16 A;  3TCA A;  2LVQ A;  4WJO A;  1KLV A;  4W9K A;  1XQQ A;  3IBE A;  3PTF C;  1WXV A;  4HPL B;  1KJT A;  4LDT B;  2HE7 A;  5L83 A;  2VRR B;  2AWT A;  1M94 A;  2KDF B;  2N7E A;  3V6E B;  5EDS A;  2JZ3 B;  3KW5 B;  2LZ6 A;  4WJN A;  3AU4 A;  4WWO A;  4KSL C;  3QAQ A;  3VDZ A;  2LAS A;  4B6W A;  1KOT A;  3KUD B;  4ZRI A;  4BVU C;  1P1A A;  1WFY A;  2CHX A;  4X57 B;  3H9D A;  4MGZ E;  4EZL A;  2BWE S;  1GG3 A;  4MGI E;  4PS7 A;  4RM9 A;  2KO3 A;  2L7R A;  1QZE A;  2ZNV B;  1FXT B;  2GBM A;  2NR2 A;  4FUL A;  2I1K A;  5AZH A;  2LVP A;  3L08 A;  4G50 A;  2HD5 B;  4IC7 B;  2MBQ A;  4HWI B;  3VUW A;  1J19 A;  2JRI B;  2RR9 A;  2JT4 B;  2L8J A;  3DCG A;  2L05 A;  1Q5W B;  4WAA A;  2NPT A;  4ZDV A;  1WR6 E;  2NPT B;  4GDK A;  3NZU A;  3ZNG C;  4GDK B;  3PGE A;  3HHM A;  3AUL A;  2G3Q B;  3D32 A;  2DZI A;  2V4L A;  1XD3 B;  4FJY A;  1J8C A;  1SE9 A;  1TTN A;  1IP9 A;  5KHQ A;  1WR1 A;  2CR5 A;  3VUX A;  3O65 B;  4DDI D;  4J6I A;  1V80 A;  3SU8 X;  2DAF A;  2JY6 A;  5LLI A;  3PPA A;  5AZF A;  1OTR B;  2LJ5 A;  4K81 A;  1WH3 A;  3DQV A;  1PQS A;  3PHW B;  5CHW A;  1H4R A;  2KFK B;  2KJR A;  4ANV A;  5IAA C;  4XC2 A;  3PT2 B;  3K9O B;  3SD5 A;  4DWF A;  1C3T A;  3UIO B;  1WX8 A;  4LCD E;  2LXC A;  4MEL A;  4TQ1 A;  4KIK A;  2EMT A;  4W9J A;  1E7V A;  4BBN F;  4KIK B;  3R66 C;  3WAN A;  2WX1 A;  2NVU I;  4NPN A;  5LXI B;  1ZKH A;  4EZJ A;  2ZJD A;  3UF8 A;  3ZO5 B;  4JIO U;  4KZC A;  1P98 A;  5D6J B;  2RD0 A;  4NJ7 A;  1UBI A;  3ZKJ C;  3RUL A;  1OEY J;  2G4S A;  2K1F A;  2LI5 A;  4AOF A;  1AAR A;  5E6O A;  3RZF A;  1GC6 A;  2KOX A;  2LGX A;  2FNJ B;  2G4D B;  1KM7 A;  3NZS A;  3N3K B;  4NQK E;  4HXD A;  4F8C B;  5JHB A;  2NBW B;  1YQB A;  1Z2M A;  2MBB B;  3A9K A;  2FCM A;  2IY1 B;  2ZPN A;  3A9K B;  3PHX B;  4N9F 4;  4TKN A;  4MGY E;  3R7R A;  4AWJ A;  1WJN A;  4GB9 A;  4I6N B;  4MM3 A;  5D2M B;  2Z59 B;  3U7D A;  3PLU A;  3MTN B;  3VXW A;  4BKT A;  2CU1 A;  2IO1 B;  2ZVO A;  3DOW A;  5DPT A;  3WAL A;  4NJ6 A;  1EF1 A;  2KQ7 A;  2N9E B;  3QAR A;  5CHF A;  2K6Q A;  2A4Z A;  2L00 B;  2GBN A;  1WJU A;  4IUM B;  2BF8 B;  3H7P A;  2K8B A;  2OJR A;  2YLM A;  4JGH B;  4WQO B;  5CTR C;  3ZW3 A;  5AZG A;  2K39 A;  3H7S A;  3HM6 X;  2KXJ A;  3QX1 A;  2KJH B;  1IYF A;  2O6V A;  1UZX B;  2MLB A;  1P0R A;  1T0Y A;  2UYZ B;  2KX3 A;  3BIN A;  2JRH A;  3IVF A;  5G55 A;  3HIZ A;  5D7G A;  2DAJ A;  2PJH A;  3EFU A;  4F7Z A;  4B9K A;  2KWV B;  2MWS B;  3ZDM C;  3EEC A;  4EZK A;  1Q0W B;  1NDD A;  4G11 A;  1V2Y A;  2XK5 A;  4HCN B;  2LD9 A;  1H8C A;  3EC8 A;  2XK5 B;  2O2V A;  2BYE A;  2O2V B;  2WWZ A;  2IZV B;  3QJZ A;  2GBR A;  4I6P A;  4ANU A;  3NS8 A;  2LRU A;  3WA0 A;  1E7U A;  3APC A;  1D3Z A;  3UIN B;  3V6C B;  2L3Z A;  5C23 A;  1SIF A;  2KC1 A;  3VQI A;  2KTF A;  1V81 A;  4FHJ A;  1WGR A;  2CKH B;  3ZNH B;  1RLF A;  3UGB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...