4JIOU

Bro1 v domain and ubiquitin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
75
structure length
75
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKMKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The yeast alix homolog bro1 functions as a ubiquitin receptor for protein sorting into multivesicular endosomes.
pubmed doi rcsb
source organism Naumovozyma castellii
molecule tags Protein binding
molecule keywords BRO1
total genus 13
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4jioU00
3ZRFA 2REXA 2YVCA 1Z5SB 2FCMA 4LJOB 4JIOU 3VAWA 3A1QB 3CSTA 4ZRKA 4K7WA 2QHOA 2D07B 4DK5A 4JL9A 3ML9A 2DAFA 2MQJA 2D2QA 3LJ3A 5G55A 1RLFA 3NZUA 4HXDA 4MSQB 3L10B 1Q1OA 1WGGA 3T8MA 2IO3B 2KWUB 4IWOA 4MJSA 1UBQA 2AL6A 2ZCCA 2MSED 3AULA 5JZEB 1GNUA 1X1MA 3W1SC 2DZMA 2PPHA 3X0WA 2C7HA 2IO0B 4DWFA 2DZIA 2MX2A 3EC8A 1J19A 1P0RA 4GN1A 5LLIA 2LVOA 3PLUA 4B95A 4B6WA 4PYZA 3ENEA 4FJYA 2G45B 1V9JA 1WE7A 2MBEA 4WQOB 1PQSA 1OEYJ 2BF8B 2KLGA 3C0RB 4KSKC 3ZTDA 5DCNA 3AXCA 3R66C 2K8HA 4I6PA 4W9JA 2ZZPB 4GB9A 2O6VD 2LGYA 2DENB 2IBIB 1WH3A 2RR9A 1UD7A 3VUYA 3TL5A 1EUVB 2FAZA 4KZCA 3QX1A 1WIAA 1RRBA 2KFJA 3PGEA 3RZWC 4EKUA 4DDID 2G4DB 2LASA 2HJ8A 3ML8A 2LJ5A 4CHKA 3ZRCA 2L76A 4PYUA 3S2AA 1YIWA 3AI5A 2CHXA 3ZTCA 4KIKA 1G6JA 4J6IA 3MJWA 3PRPB 2KWCA 4KSLC 3IG3A 2LUEA 4A20A 3Q3FA 1I42A 3CMMB 1YJ1A 2D11A 4NNJB 4HLEA 3EHVA 3H1UA 1WMHB 2AEHA 3K9OB 5GMVA 3ZKJC 2LD9A 3UIPB 2KFKB 1WXSA 2C60A 2WX0A 5DPSA 2KJRA 2K6QA 1OQYA 2LVQA 3TJPA 3QCAA 4K7UA 3QHTA 4FJVB 2KXJA 1KOTA 4K81A 4M8MA 3ZNID 4RM8A 1V2YA 3PTFC 3GZNI 2MA9B 2O6VA 2I1JA 4TKNA 3OJ3A 1WGHA 2BWFA 1CMXB 5TR5A 3KUZA 1IYFA 2DZKA 3M63B 2HE7A 2O2VA 2D10A 2BYVE 2Z0DB 3B08A 1R4NI 3ZDMC 2C7NB 3DQVA 1TZ1A 2BYFA 4ZRIA 1IPGA 4DHZE 5CHWA 1E8WA 2ZVNA 3APCA 5E6PA 2MCNB 2L3ZA 2W9NA 3N30A 1WRDB 2KDEB 2N7EA 2ZPYA 5DPRA 1LXDA 3HK0A 4MGKE 3I3TB 3A4RA 3GOEA 1WZ3A 5CHVC 4HPMB 2JRHA 2L7RA 1GJZA 2MWSB 4IUMB 2KC1A 3CF6E 3TMPB 1C1YB 1P98A 1WGRA 2EMSA 3PS6A 4LJPB 4HVBA 3PHWB 3BY4B 2L8JA 2XBBC 2NR2A 2PE6B 4MEMA 3VH3B 1V81A 3ZUNA 3DBHI 4ANWA 4MELA 2KVRA 2R2OA 3VVWB 4WJPA 2ZJDA 2JF5A 1LQBA 2M0XA 5D6JB 3M95A 2R2QA 2V4LA 4WWPA 1NI2A 1WE6A 1P3QU 4M0WB 4G11A 4W9FA 2DHZA 4LDTB 2JWZA 2GOWA 1AARA 4BFRA 4JLCA 3UIOB 3H7PA 4JGHB 4F1SA 2KMAA 3BINA 4BOSC 5KHQA 4RMAA 3JSVB 1WGDA 1XQQA 2FCSA 2JY6A 2G4SA 2JZZA 3DBLI 5D2MB 4XX5A 4BVUC 4II3B 2DAJA 2Z59B 1Q5WB 4EUTA 4IM3A 2XK5B 2N9EB 3NS8A 1WZ0A 1F9JA 1Y8RC 2HTHA 3DVNU 4G0NB 4ZDVA 1VCBA 2LXCA 3HHMA 1GC6A 2KJ6A 2FUHB 4HPLB 1WJNA 2EKEC 2K25A 2KOXA 2OOBB 4I6LB 3HIZA 3KUCB 2V1YA 1WXVA 4TQ0A 1SIFA 1UH6A 2KJHB 3A9JB 3VH4B 2JRIB 1WJ6A 5C23A 2A4ZA 3RT3B 2XEWA 4AUQC 1UELA 2NPTB 4M8NA 3L08A 1K8RB 4GU2A 4ZYNA 5JH5C 3HM3A 2BGFA 5E6OA 2KANA 3V62A 4GMVA 1WXAA 2N9XA 4HCPB 4FADA 4KZ0A 4CYEA 3A9JA 3ZVVA 3APDA 1WMHA 2JT4B 1UZXB 2J0JA 1KM7A 1L7YA 1M94A 2CS4A 2LZ6A 4ZRJA 4ANUA 1WI0A 5J2RA 1RAXA 4A3OA 2M4NA 2Z0EB 5IAAC 3WAPA 2IY1B 1ZGUB 3RULA 3RZFA 4BBNF 2ZVOA 2OJRA 4KIKB 2RGFA 4NJ7A 4EFOA 2FNJB 2GBRA 1H4RA 1GG3A 4NQLB 2DYMA 3RYTA 3UQAA 2FCNA 2MBHA 3K9PB 3D32A 4LCDE 5LXIB 1WXMA 2WWZA 2JXXA 1ISNA 3QC8B 4IW0A 2VRRB 1HE8A 2MBOA 2MW5A 2KX0A 2KDFB 4MGZE 3WA0A 4DHJD 1E8XA 1YX6B 5G2NA 4II2B 1NBFC 1U4AA 2KFKA 2KDBA 2D3GA 2KQSA 3L0WB 2BKFA 4F8CB 1WR6E 2FCQA 4BKTA 2IO1B 2N1WA 2V3SA 4JQWC 4PS8A 3U8ZA 3VHTC 2LVPA 2KDIA 3WIMA 4DHZB 4GXBA 3UF8A 1OTRB 2KO3A 3R7QA 2PJHA 4BKSD 1J0GA 3QK0A 1TBEA 3RCZA 4DBGA 2NBWB 3UGBB 3ZNGC 3L16A 2KTRA 4WWNA 2KQ7A 1TTNA 1V6EA 4W9KA 4E71A 2DYBA 1BT0A 2JUOA 2GBJA 1GUAB 1V80A 4KVGB 5IA7A 3VXWA 2K39A 2MP2A 4DXAB 3PRZA 1E7VA 4P7IA 3A33B 4FBJB 1OEYA 1WX8A 2O6VB 2B3AA 3DPDA 3PHXB 4EOYA 4AWJA 3QQ8B 3A1QA 3NHEB 3B0AA 3PPAA 4ANVA 4FA6A 2KC2A 4PS7A 2ZPNA 1WR1A 4FHJA 3CSFA 2RPQA 2GBKA 4XC2A 1YD8U 3ECIA 4DHJB 3DVNV 2KK8A 3SHQA 2ZCBA 2KX3A 2K8CA 1WM3A 4W9IA 4E3CA 1I35A 1SGHA 2O2VB 3PSEB 3QWZB 5C1ZA 1J8CA 3WALA 2BYEA 2L00B 2WX1A 3AU5A 1QZEA 3HM6X 2K1FA 2Y5BB 4N9F4 2LGDA 3JW0X 3KYDD 4HWIB 2GBNA 3TCAA 1E8ZA 1LFDA 2AYOB 2A5UA 2DYOA 4W9DA 3QA8A 5D94A 4EZKA 2AL3A 3KUDB 4EZLA 3ALBA 3O65B 3ZNHB 2LRUA 2J0MA 3ZW3A 5J17A 2IZVB 1V86A 2NCNA 4ASWC 2IO2B 4G50A 4GIVA 4HCNB 3VUXA 1R4MI 4MGIE 4RM9A 4W9LA 5FR6A 2M17A 5CHFA 1UBIA 4HJKA 2C9WB 2M8SA 4K1RB 4MH0E 5AZHA 4ICVA 2FIDA 3V60A 2KWVB 4E74A 2KTRB 5CX3A 1OGWA 3JYUA 1KJTA 2KMCA 4OVUA 4EZJA 5JHBA 2LXAA 4NY0A 5BO4B 3L54A 3SDLC 3DBSA 2RD0A 1ZKHA 2LI5A 3IBEA 3NY5A 3OAWA 2DX5B 4NAWB 3A9KB 3P2BA 1KLVA 1TGZB 1ZW7A 2KHWB 4WAAA 1SE9A 1E8YA 4W9CA 2GBMA 3VTWA 4F7ZA 3EFUA 2KD0A 3DOWA 4FJZA 2BKRB 5L83A 1V5TA 4W9HA 3V61A 1LM8B 3DVGX 3JVZX 2UWQA 3SU8X 3QIJA 2KTFA 3OJ4B 3PZDA 3W1SA 4HK2A 1E7UA 4W9EA 2L0FA 2ZNVC 2ZEQA 3DCGA 3R7RA 1S1QB 3VFKA 2LWPA 1D3ZA 1V5OA 1YX5B 3OLMD 4GDKB 4GGQA 3UINB 2KNBA 1UGMA 1WM2A 3KW5B 3VTVA 3VTUA 3N32A 4IC7B 3AU4A 1EO6A 2YLMA 5JHAA 2KLCA 2K6DB 3L17A 4GOCA 1WF9A 5AEKB 1E90A 2KN5A 2CU1A 5J18A 1GC7A 4IWPA 4PS3A 1S3SG 4I6NB 3U30A 5EDSA 4AJWA 4FN2A 4GDLB 1EF1A 1VD2A 2MBQA 2CHZA 3QARA 3TIXA 5DPTA 3M62B 5CTRC 5AZFA 4BKSA 2NPTA 2C5LC 3NOBA 3T9LA 1A5RA 3VUWA 2AWTA 2CR5A 4WJOA 1YQBA 2MBBB 2NBVB 2FIFA 3PV1A 4AJYB 4FHKA 1JRUA 2MP2B 2N9PC 4IM2A 4KDIC 5LXHA 4NJ6A 3L13A 2N7DA 1NDDA 2J7QB 3ZNZB 4XZ4A 1P9DU 1WGYA 4FULA 3ZLZA 2L0TA 4ICUA 4NPNA 3U7DA 2EMTA 3MTNB 3VQIA 1IP9A 1E5WA 3DVGY 4AP4C 3EECA 3TBLD 3B1LX 3VDZA 1WJUA 2L05A 3WAOA 2UYZB 3PT2B 4URKA 2WYQA 2M1MA 2ASQA 3JSVA 4MDKE 3ZO5B 2BWES 2KZRA 3H7SA 4KDLB 4BBNC 3X23A 2N1VA 3H6NA 2PEAA 2PE9A 3V6EB 2IYDB 4GDLA 2WDTB 3KYCD 2GMIC 2ZNVB 2MLBA 2KKCA 3H7PB 1EF5A 4HDOA 4MM3A 4B9KA 1H8CA 2J0KA 4FLHA 4NQKE 1WX9A 3UQBA 3IHPC 3M3JA 3QAQA 4NAWA 4EEWA 5AZGA 2K8BA 3N3KB 3H9DA 5L95C 5D7GA 4CO7A 1RFAA 4WJNA 3ZIMA 4BOZB 1WX7A 2JZ3B 4BKGA 3PVLA 4X57B 2G3QB 2N4FA 1T0YA 2NBUA 2HD5B 3KVFB 3LDZE 2IY0B 2JPHA 2BPSA 3RUIB 2C7MB 1MG8A 1FXTB 2LGXA 2MRPA 3APFA 2I1KA 3RD2A 3ZDTA 3PLVA 2LRWA 2NS5A 4IM0A 2CHWA 1WFYA 1WYWB 3KH0A 3QJZA 4GSWA 3DBRI 3A9KA 2DZJA 3WAMA 4OVVA 3MHSD 1WY8A 4HDQA 1XT9B 4LDTD 4WJQA 2NVUI 3WANA 5E6NA 4AOFA 1Q0WB 3ONSA 4YL8A 3IVFA 2JVCA 2CKHB 3Q3JA 3SD5A 3R3MA 4GDKA 4IWQA 4MSMB 4TUUA 1XD3B 1C3TA 4MJSB 3IFWB 1P1AA 3V6CB 3A4SC 4W9GA 5DPWA 5KHOA 4ANXA 3DDCB 1Z2MA 5HKHA 4WWOA 4G3XB 4A3PA 4DDGD 4IG7B 1WJ4A 3NZSA 2XK5A 4TV3A 4MGYE 1V49A 3PRMB 4K7SA 4KV2A 3W1YA 1L2NA 2RSUA 4TQ1A 3PREA
chains in the Genus database with same CATH superfamily
3ZRFA 1Z5SB 1JMLA 3VAWA 4B0MA 3ML9A 3N1YC 3LJ3A 3NZUA 3L10B 3PZ8A 1F1HA 1YN5A 2IO3B 2MSED 4ZHOA 3MHZA 1KFYB 2MX2A 2JSVX 2V4IB 4PYZA 3ENEA 1K53A 1V9JA 3SR6A 1WE7A 2MBEA 4KSKC 4BAXA 4W9JA 4I6PA 2O6VD 2LGYA 2FAZA 1MI0A 1C4AA 4JWUC 4DDID 2IGHA 2LASA 4CHKA 4N6EB 4EE2A 2WXKA 4PYUA 1G6JA 3PRPB 1SEBD 3IG3A 3Q3FA 3GB1A 3CMMB 1YJ1A 4NNJB 1N5WA 2E6XA 3FAHA 4CQNA 4K7UA 3QHTA 1V2YA 3PTFC 3Q8CA 1YOVB 2I1JA 1CMXB 1IYFA 2O2VA 2D10A 3B08A 4KGSA 1R4NI 3ZDMC 2C7NB 3V05A 1DOXA 1ET6A 1IPGA 1V97A 4DHZE 5CHWA 5E6PA 2L3ZA 3LXFA 2BS3B 2W9NA 2N7EA 4MGKE 1WZ3A 2BB6A 4IUMB 3CF6E 1P98A 4HVBA 4LJPB 3AE1B 4MEMA 5FKAC 4MELA 3VVWB 1MJDA 4WJPA 3BVGA 5D3IB 2JF5A 1LQBA 2R2QA 2V4LA 2CU3A 1ET9A 4C80A 1AARA 3UIOB 2KMAA 3FILB 1EU3A 1C77A 2JY6A 3DBLI 2XNAC 4II3B 2KVZA 2LFIA 1JROA 2N9EB 1PDXA 2HTHA 4G0NB 4RFBA 1GC6A 3MC9A 1WJNA 1KH0A 4LNIA 4TQ0A 1QOBA 3W5VB 3B9JA 3A9JB 2JRIB 4PT5A 2A4ZA 2IGGA 3RT3B 1Y56A 1UELA 4M8NA 3HM3A 1TZOA 2BGFA 2BVCA 3J9CA 4GMVA 1GOZA 4C4VB 1SBBB 1I4XA 3APDA 1WMHA 2J0JA 4WH4A 1D5ZC 1EWCA 4ZRJA 2L1AA 2ON8A 2EKIA 2ZVOA 2RGFA 1QT9A 2FNJB 2Y3AA 2FCNA 2MBHA 3K9PB 3D32A 4LCDE 1WXMA 2WWZA 2JXXA 1ISNA 3RN9C 2MW5A 2KDFB 4MGZE 2W3RA 3NRZA 3AN1A 1NBFC 2KFKA 4HEA1 1IUEA 2BKFA 1WR6E 4BKTA 1AN8A 2RDHA 1TY0A 4GXBA 2X38A 3R7QA 2K3UA 3ZNGC 3L16A 4RCOA 1V6EA 1JWUD 4W9KA 2DYBA 5BYQA 1GUAB 1V80A 1YJJA 3VXWA 2MP2A 4DXAB 3E9SA 3A33B 2O6VB 2E3TA 1BUIC 3P4SB 4OZAA 2KC2A 4ARIA 2ONQA 1WXQA 1BMLC 4DHJB 1KLGD 3DVNV 2KK8A 3SHQA 3ZJUA 1I35A 3PSEB 3QWZB 3WALA 1SE3A 3BIID 3AEDB 3AU5A 3HM6X 2K1FA 4XGAB 4RGNA 3TEYA 4EZLA 5D94A 2AL3A 3B2GA 2NTTA 2TSSA 3ZW3A 5J17A 1QOAA 2PVGC 2IZVB 2NCNA 4ASWC 4HCNB 1R4MI 4W9LA 3FC4A 1UWXA 2FIDA 1V1OA 3BZDB 1C4CA 2KWVB 3T3NA 4IOIE 2KTRB 1OGWA 3JYUA 2KMCA 2LXAA 1I7HA 2D3BA 4WWMA 2DX5B 2WLBA 4TMAB 3MP9A 3P2BA 3Q8AA 1FD6A 1ZW7A 2KT7A 2KHWB 1SE9A 1E9MA 2GBMA 2BKRB 4LNNA 3V61A 1LM8B 3SU8X 3QIJA 2KTFA 5C2TB 3DCGA 3R7RA 3VFKA 2LWPA 1D3ZA 1JWBD 2RDBC 3OG5A 3AEEB 4GDKB 4IC7B 3AU4A 5JHAA 4HPPA 4GOCA 2CJOA 1F2RI 1E90A 2KN5A 5AEKB 2CU1A 5J18A 4PS3A 1S3SG 1EF1A 4XYCA 3RNGC 1VD2A 1YJIA 1LO5D 5DPTA 5CTRC 5AZFA 3T9LA 2CR5A 4WJOA 3FKYA 2NBVB 2FIFA 4AJYB 1JRUA 2N9PC 4KDIC 2MJ3A 2J7QB 3CWIA 3ZNZB 4XZ4A 4FULA 3MC0B 1E5WA 1JWMD 3EECA 2WXRA 3B1LX 2L05A 3T3OA 3PT2B 4URKA 1A70A 1PGBA 1FNUA 2M1MA 4O1NA 2G9HD 2J53A 4MDKE 2INPE 2N1VA 3H6NA 2PEAA 1HTQA 3V6EB 4XWTA 2J42A 4MM3A 4B9KA 2ICIA 4FLHA 4OZCA 2V9HA 4EEWA 3GP7A 5L95C 1TS5A 2VH1A 2VH2A 1TJEA 4BKGA 3PVLA 1T0YA 2NBUA 1HXYD 2PIAA 3KVFB 2WNMA 2BPSA 2JWUA 1NYRA 1K51A 2MRPA 1KLUD 2KMMA 3RD2A 1NEKB 3KH0A 1WFYA 3Q8FA 2DZJA 4Q2JA 3WAMA 1ZPSA 1WY8A 4HRSA 4REZA 4LDTD 2LJIA 3WANA 5E6NA 3ONSA 1RYJA 2JVCA 3IVFA 3SD5A 3R3MA 4TUUA 4C00A 1JWAD 4IDIA 4W9GA 1N61A 4ANXA 1Z2MA 1UWMA 4DDGD 1VJKA 3NZSA 5I4DA 2WXJA 4TV3A 1V49A 2WDQB 4K7SA 1L2NA 4JWSC 2REXA 1FNWA 1P7FA 2YVCA 4LJOB 2JQRB 1Q10A 3CSTA 4ZRKA 1VZ8A 4K7WA 2QHOA 5GXGB 1L4DB 3KWVA 3IAS1 4HXDA 4MSQB 1CZPA 1EU4A 4P1CC 2X8XX 5JZEB 2LUMA 1GNUA 4DQOC 2PPHA 2QC8A 4ZOHC 4FJYA 1YN4A 4WQOB 3ZTDA 4LK0M 3GE3C 3L4PA 2Q5WD 5DCNA 1PUTA 3AH7A 2WXIA 2IBIB 2BS2B 1UD7A 1L0VB 3TL5A 1EUVB 2MHJA 2GB1A 3QX1A 4HROA 1WIAA 3RZWC 4D2KA 3ML8A 3AI5A 3RNCC 2I2YA 3ZTCA 4MH8A 1ZXHA 2V3NA 4DXGA 4C56C 2INDC 3H1UA 3N1XC 2AEHA 2FBWB 4H2AA 4L1BA 5EE0A 5GMVA 3UIPB 3ZKJC 2KFKB 3Q6BA 1L0XB 2WX0A 2KJRA 1PGAA 2K6QA 3QCAA 1KOTA 4FJVB 2KQ4X 4K81A 4M8MA 2VZKD 3UI3A 3GZNI 2MA9B 1UUPA 3AMZA 2BQQA 3U2SC 2Z0DB 1PYWD 2BYFA 2M19A 2NTSA 1R4NB 1XLQA 1PGXA 5FK9C 2ZVNA 2J52A 5D3DA 1XLNA 2KDEB 1LXDA 2Y5PA 3HK0A 1RWSA 2RMMA 2M56B 5CHVC 2L7RA 2MWSB 4US9A 1MFWA 4RF0A 3BYYB 3HRDD 3TMPB 2EMSA 3PS6A 3PHWB 1YNTE 2PE6B 3ZXVA 5AUKA 4RNAA 4LTUA 2W82A 4XDDA 2ZJDA 5D6JB 4WWPA 1WE6A 4M0WB 1VRAB 2LGSA 5BMHA 2H89B 4BFRA 1C9FA 4JLCA 4JGHB 2JYEA 2AQ2B 4BOSC 1HQRD 1XQQA 2FCSA 2G4SA 2JZZA 4XX5A 4IM3A 2XK5B 3DVNU 3DWGC 2LXCA 4HPLB 1IBXB 2QMTA 1ZOYB 2EKEC 2KOXA 4RGMA 5LNK1 3HIZA 1WGKA 3ZXRA 3U7ZA 3KQ4A 1I4GA 1JQ4A 1HTOA 1QQRA 1K8RB 4GU2A 1FRRA 5JH5C 4CYEA 1M94A 2LZ6A 4ANUA 4LNFA 1FMAD 1RAXA 4A3OA 1SE2A 2M4NA 5IAAC 1SJED 2IY1B 2PKOA 3RULA 2K9XA 4BBNF 1IBXA 4NJ7A 4EFOA 4NQLB 3RYTA 3R8BA 3NVVA 3Q2AC 1MHHE 4OVZA 3QC8B 4IW0A 1HE8A 2MBOA 1JCKB 1E8XA 5G2NA 4ZHPA 2MEKA 2KQSA 2D3GA 2WXQA 2FCQA 2V3SA 3U8ZA 4M0WA 1XLPA 3RNBC 2KDIA 4DHZB 3NVYA 2PJHA 4BKSD 4MACA 3QK0A 3RCZA 1ZDXA 3KWLA 2KTRA 2Y5CA 1M4VA 2JUOA 4KVGB 3PRZA 4P7IA 4TSSA 1J7BA 1ESFA 1OEYA 1WX8A 1I4RA 3DPDA 4EOYA 1IGCA 1GAQB 2ZPNA 4GLSC 3CSFA 5MPOA 2RPQA 1VR9A 4XC2A 1YD8U 1BXTA 4W9IA 5EE9A 1J8CA 2KAJA 1QZEA 2Y5BB 4N9F4 2EELA 3KYDD 4HWIB 1E8ZA 1GB4A 2A5UA 2WXHA 3KUDB 3ALBA 3O65B 3ZNHB 2J0MA 1TKGA 2D3CA 1V86A 2IO2B 4GIVA 2WDVB 3VUXA 4MGIE 2YEPF 3RFZB 2M17A 4XDCA 5CHFA 3SEBA 3DBHB 1QOGA 1WYGA 4ICVA 3V60A 3GS2A 4NZLB 4E74A 1KJTA 4OVUA 1YQ3B 2KDMA 2RD0A 1ROEA 3NY5A 3OAWA 4N58A 3ZJVA 3Q3OC 3A9KB 2WXMA 3AE9B 1JRPA 1E8YA 4W9CA 1E10A 4F7ZA 5BYRA 1DOYA 4FJZA 5L83A 1B1ZA 3DVGX 3JVZX 3W1SA 4HK2A 1E7UA 3W9CB 2L0FA 1ZXIA 2ZEQA 3VR9B 1S1QB 3LB8C 2PMVA 3R2TA 1YX5B 1UGMA 1WM2A 1L0YB 1EO6A 2YLMA 2KLCA 1QKZA 2K6DB 3L17A 3TUOA 3U30A 4AJWA 2G1EA 1OQRA 3HVZA 3QARA 4KGTA 3M62B 3NOBA 1A5RA 3EUB2 3V3XA 3BYTB 4IM2A 3N1ZC 4NJ6A 1TY2A 4OZBA 3URYA 1P9DU 1WGYA 3PO0A 3ZLZA 2L0TA 3U7DA 2WHIA 4AS1A 4L23A 1T3QA 2WU5B 3H7SA 1QOFA 2W3SA 3FILA 3X23A 2JYTA 3GE8C 2PE9A 4RH6A 3UQBA 3IHPC 1NENB 4J3OD 1FFUA 1FIQA 1NYQA 2G3QB 2N4FA 4YT0B 4WQMA 4UDUC 3RUIB 2C7MB 2RDGA 1MG8A 1FXTB 3Q69A 3APFA 3ZDTA 2BS4B 2NS5A 1WWTA 4GSWA 2HJ1A 2WU2B 3DBRI 5HG2A 4OVVA 1XT9B 4USAA 3ABVB 1L5PA 2INCC 2NVUI 2NMQA 1I4QA 4YL8A 2CKHB 1P7EA 5BYSA 3IXSA 4S0RA 4MJSB 5DPWA 5KHOA 1XEEA 1FM0D 1JWSD 3DBRB 4A3PA 1CJEA 1WJ4A 2SEBD 3ZQ4A 4TQ1A 1E6EB 1SF0A 4YSYB 5HI1A 3MC8A 4KKIA 4JL9A 4DK5A 3RNEC 2DAFA 2D2QA 4RGOS 1QILA 3BK2A 5G55A 1RLFA 1Q1OA 1MPEA 1WGGA 2KWUB 4DXFA 2ZCCA 3AULA 3W1SC 5E6JA 3X0WA 2C7HA 2IO0B 2DZIA 1P0RA 1CQVA 4GN1A 4B6WA 2MJDA 2G45B 2JXTA 1OEYJ 2BF8B 2KLGA 3C0RB 2D5GA 2CJNA 1TKEA 2K8HA 2ZZPB 4GB9A 2DENB 2RR9A 3VUYA 4KZCA 3PGEA 1CK1A 1RRBA 2QCZA 2OEDA 2LJ5A 1FNVA 2CHXA 1D5MC 2N0SB 4HKZE 1C76A 4J6IA 3MJWA 4A20A 3MJ5A 3N9YC 3EHVA 1FEHA 1WMHB 5G5GA 3K9OB 1XCTL 2BT6A 1WXSA 2BW2A 2C60A 1OQYA 2LVQA 3CIRB 1DYQA 3OJ3A 5TR5A 2WXFA 2JX5A 1L6UA 3M63B 5IO9A 4YTNB 2BYVE 3RNFC 1K50A 1ZP0B 4IKGA 2MCNB 2LHEA 2K22A 2WXLA 3N30A 2ZPYA 4A9AA 3I3TB 4HPMB 2OJWA 4AQ7A 1GJZA 1I4HA 3ZGZA 3BY4B 2XBBC 3KLSX 3DBHI 4ANWA 2R2OA 2Z8LA 2DBYA 3EFCA 2GI9A 3M95A 1P3QU 4KX6B 2GOWA 1OFFA 4MM3B 3VR8B 4RMAA 5D2MB 2ACZB 4OHJA 2UU7A 1B9RA 2WGSA 4BVUC 3U52E 3NS8A 1WZ0A 1F9JA 1Y8RC 4ZDVA 3W2DA 2KJ6A 2FUHB 4A6QA 2K25A 2JU6X 4WURA 4PK1A 2V1YA 1WXVA 2MJEA 1SIFA 4WAFA 2KJHB 1ZE3D 4C4VA 2J4XA 1E0ZA 4JE3B 2XEWA 4AUQC 3L08A 4ZYNA 2KANA 1SE4A 4ITKA 1WXAA 2YEPB 1QLBB 2QILA 3A9JA 1KM7A 2CS4A 5HFYA 3AEFB 5J2RA 2V3PA 3IAM1 3DHGC 2OJRA 2GBRA 1GG3A 2PVOD 5EE3A 4RF1A 3OWEB 4C7ZA 2BB5A 1XXGA 2KDBA 4JPSA 3L0WB 3AEAB 4F8CB 2IO1B 4JQWC 2QEJC 3VHTC 1F2RC 3C8YA 2WS3B 4DBGA 2NBWB 3UGBB 4WWNA 2KQ7A 1TTNA 4M02A 2GBJA 2K39A 3ZYYX 2KYWA 1E7VA 1STEA 2B3AA 4JX1C 3PHXB 3QQ8B 1C4PA 5JXVA 5G5HA 1F77A 4M01A 3NHEB 3B0AA 3PPAA 3VRAB 4ANVA 4PS7A 4FA6A 1WR1A 4HJGE 2GBKA 4LNKA 3ECIA 4E3CA 1WM3A 1T0SC 2O2VB 5C1ZA 4WIPA 5BMGA 4A55A 2BYEA 2L00B 2GRIA 1AW7A 3NZ3A 5IKCM 2K5PA 1L4ZB 2LGDA 3JW0X 4HKQA 2GBNA 1LFDA 2W54A 3P42A 4W9DA 4N59A 4EZKA 2LRUA 3P4PB 2I38A 3AECB 3BWUD 1VLBA 4G50A 3EA6A 1EWYC 3Q8BA 4RM9A 5FR6A 1GB1A 1D4BA 1DOIA 1UBIA 2DLBA 4HJKA 4NJCA 4K1RB 4MH0E 1SXTA 5AZHA 5CX3A 3HVDA 4EZJA 1T5XD 3L54A 3IBEA 1ZKHA 2LEKA 4FXCA 1UGJA 1KLVA 5HHDG 2W55A 1TGZB 1FFVA 3EFUA 2KD0A 4XE0A 3DOWA 2UWQA 1IGDA 3OJ4B 2PLPA 4W9EA 4P6VF 2ZNVC 3GZNB 3NG0A 3OLMD 3VTVA 3KW5B 1VZ6A 3AE6B 4LNOA 1XCQL 1WF9A 4GDLB 4M00A 3BK1A 3EGRA 2CHZA 3TIXA 3ZJTA 2NPTA 2C5LC 3VUWA 3AE4B 2MBBB 4FHKA 3BVMA 3L13A 2LGIA 3AM9A 2RPVA 3U4EG 2QDFA 4ICUA 1IP9A 2EMTA 3DVGY 4AP4C 3HUIA 3IT4B 3NUHB 3TEZA 3B2FA 1TS4A 2ASQA 3JSVA 2BWES 1TS3A 1ENFA 4GDLA 3KYCD 2IJ0A 2GMIC 2ZNVB 2KKCA 4HDOA 1N60A 2J0KA 1H8CA 3M3JA 4NAWA 5AZGA 1HZ6A 3N3KB 2KWDA 3BVZA 1VDVA 1LGRA 3H9DA 4CO7A 3ZIMA 4BOZB 2JZ3B 2HD5B 5H92C 3ETRA 3LDZE 2IY0B 2JPHA 2PTLA 3TEXA 1UF0A 3PLVA 3QJZA 3I57A 4BZAA 2QSDA 1EM7A 4HDQA 1C78A 1YMHE 4WJQA 1QF6A 1DGJA 4AOFA 4YTMB 2INNE 4ZRQA 4GDKA 4IWQA 2N9LA 4MSMB 1XD3B 1P1AA 3DDCB 3DWMA 5HKHA 4WWOA 4IG7B 1FCCC 2XK5A 4KV2A 3W1YA 1AWDA 3P4QB 1KTKA 2KACA 2FCMA 4JIOU 1YQ4B 3A1QB 2D07B 3AE8B 2MQJA 2WXNA 3T8MA 4RGTA 4IWOA 4MJSA 1UBQA 2AL6A 3I5JC 1X1MA 3NJTA 4P16A 3Q3MC 2DZMA 1ACCA 4C7YA 1E7PB 2L52A 4DWFA 3EC8A 1J19A 1WSPA 1SIJA 5LLIA 2LVOA 3PLUA 4B95A 1PQSA 3W5UB 3AXCA 3R66C 2D3AA 1KRHA 1WH3A 2IDYA 1T6BX 2DNFA 3DHIC 3E56A 4YSXB 2KFJA 4EKUA 2WXPA 2ZW1A 2G4DB 2HJ8A 3ZRCA 1XF5L 2L76A 3S2AA 1YIWA 4P1BC 4KIKA 4KSLC 2KWCA 2LUEA 1I42A 1XLOA 2D11A 4HLEA 1FO4A 2LD9A 1V8CA 4QAYA 5DPSA 3TJPA 2SAKA 2KXJA 3ZNID 3NS1A 1AYFA 4RM8A 2WXOA 1XO3A 1K52A 2O6VA 4TKNA 1WGHA 2BWFA 3KUZA 2DZKA 2HE7A 5T8IA 3DHHC 3DQVA 1TZ1A 4ZRIA 1C79A 1E8WA 3APCA 1V1PB 1WRIA 1WRDB 2BTEA 5DPRA 2HTME 3A4RA 3GOEA 1UNSA 4XWWA 2JRHA 2H88B 1MVKA 2ZW0A 2KC1A 1C1YB 1WGRA 1OQQA 2L8JA 4YTPB 4YSZB 2NR2A 1SSNA 4NAMA 3VH3B 1V81A 3ZUNA 2KVRA 1L6VA 1R4MB 2M0XA 3H8HA 1NI2A 2QJLA 4G11A 4W9FA 1N62A 2DHZA 4LDTB 2JWZA 1I4PA 3H7PA 1HEZE 4F1SA 3BINA 5KHQA 3JSVB 1WGDA 1SJHD 1JALA 3AE2B 2LHDA 2DAJA 2Z59B 1Q5WB 4EUTA 1JW9D 1VCBA 3HHMA 3WCQA 2XN9C 2OOBB 4I6LB 3KUCB 3MFGA 1RFKA 1UH6A 4US8A 3Q3NC 3N20C 1FPYA 2IGDA 3VH4B 1WJ6A 5C23A 1FRDA 2NPTB 5EE1A 2WQYB 4K3BA 5E6OA 3V62A 4HCPB 2N9XA 4FADA 4KZ0A 2OHFA 3ZVVA 2JT4B 1UZXB 1L7YA 1WI0A 3NVWA 2Z0EB 3WAPA 5FR3A 1ZGUB 3RZFA 4YWGG 4KIKB 2JZPA 4KKJA 4OW0A 1H4RA 1TS2A 2DYMA 3UQAA 3PZ7A 1PFDA 5LXIB 4ZYSA 2VRRB 4L2YA 1N6ZA 2KX0A 3WA0A 4DHJD 4YXDB 1YX6B 4II2B 1U4AA 3LYYA 1HA5A 3AE7B 4B0EA 2N1WA 4PS8A 2V0GA 4ACFA 4A90A 2LVPA 3WIMA 2N9KA 3UF8A 1OTRB 2KO3A 1J0GA 1TBEA 3C19A 3Q8EA 2HDEA 3RMKC 4E71A 1BT0A 1FXIA 4KGRA 5IA7A 5IOIA 2BYTA 4ZRPA 2B76B 4FBJB 2FUG1 4R3DA 4AWJA 3A1QA 1F52A 4FHJA 1ZUD2 1V1PA 2L83A 2DWQA 5TSSA 2ZCBA 4A8XC 2KX3A 2K8CA 1SGHA 2KN4A 3NVZA 1TKYA 1NI3A 1KF6B 2WX1A 3DBLB 5AUIA 3TCAA 2AYOB 2DYOA 1VZ7A 3QA8A 1R7SA 3TEWA 4LLGM 3AE3B 2M0AA 2LMCA 1F0ZA 2C9WB 2M8SA 1J7CA 1YN3A 5JHBA 1D6EC 4MT5A 4NY0A 5BO4B 3SFDB 1N63A 3SDLC 3DBSA 2LI5A 4NAWB 1HZ5A 2WDRB 2WP9B 1MG4A 1T0RC 3P4RB 3P1MA 4WAAA 3VTWA 4K3CA 1V5TA 4W9HA 3I63C 2GLSA 3PZDA 3P63A 2K0PA 4ARCA 1V5OA 3UINB 3VTUA 4GGQA 2KNBA 3N32A 3R2IA 1GC7A 4IWPA 3I9V1 4I6NB 5EDSA 3RI7C 4FN2A 2IPKD 2BBCA 2MBQA 2AQ3B 4BKSA 2AWTA 1YQBA 3AV8A 3AEGB 3PV1A 5LXHA 2MP2B 1T0QC 2N7DA 1NDDA 1D5XC 1TIFA 4NPNA 3VQIA 3MTNB 3AB5A 3TBLD 3VDZA 1WJUA 1J7AA 3WAOA 2UYZB 2WYQA 5H8YE 5C3JB 3ZO5B 2KZRA 4KDLB 5BMIA 4BBNC 2MH7A 2R61A 2IYDB 2WDTB 3IT6B 2MLBA 3H7PB 1EF5A 1FCLA 4NQKE 1WX9A 3QAQA 2K8BA 3AEBB 1GPXA 5D7GA 5IN7A 1RFAA 4WJNA 1WX7A 4X57B 3RNAC 3RPFC 3Q14C 3O13A 2LGXA 1NVID 2I1KA 3VRBB 1MHXA 2N7JA 1RM6C 2LRWA 1N5XA 2WXGA 4IM0A 2CHWA 1SB3C 1WYWB 2FE8A 2L32A 2QIEB 1TT5B 3A9KA 3MHSD 4S17A 2AQ1B 1Q0WB 3AE5B 5IP4D 1ZDVA 3Q3JA 3TSSA 1FXAA 3SFEB 1C3TA 3IFWB 3V6CB 2PW9A 3A4SC 2VZKB 1TYGB 4G3XB 2AX5A 4MGYE 3PRMB 2RSUA 3PREA
chains in the Genus database with same CATH topology
3ZRFA 2REXA 2YVCA 1Z5SB 2FCMA 4LJOB 4JIOU 3VAWA 3A1QB 3CSTA 4ZRKA 4K7WA 2QHOA 2D07B 4DK5A 4JL9A 3ML9A 2DAFA 2MQJA 2D2QA 3LJ3A 5G55A 1RLFA 3NZUA 4HXDA 4MSQB 3L10B 1Q1OA 1WGGA 3T8MA 2IO3B 2KWUB 4IWOA 4MJSA 1UBQA 2AL6A 2ZCCA 2MSED 3AULA 5JZEB 1GNUA 1X1MA 3W1SC 2DZMA 2PPHA 3X0WA 2C7HA 2IO0B 4DWFA 2DZIA 2MX2A 3EC8A 1J19A 1P0RA 4GN1A 5LLIA 2LVOA 3PLUA 4B95A 4B6WA 4PYZA 3ENEA 4FJYA 2G45B 1V9JA 1WE7A 2MBEA 4WQOB 1PQSA 1OEYJ 2BF8B 2KLGA 3C0RB 4KSKC 3ZTDA 5DCNA 3AXCA 3R66C 2K8HA 4I6PA 4W9JA 2ZZPB 4GB9A 2O6VD 2LGYA 2DENB 2IBIB 1WH3A 2RR9A 1UD7A 3VUYA 3TL5A 1EUVB 2FAZA 4KZCA 3QX1A 1WIAA 1RRBA 2KFJA 3PGEA 3RZWC 4EKUA 4DDID 2G4DB 2LASA 2HJ8A 3ML8A 2LJ5A 4CHKA 3ZRCA 2L76A 4PYUA 3S2AA 1YIWA 3AI5A 2CHXA 3ZTCA 4KIKA 1G6JA 4J6IA 3MJWA 3PRPB 2KWCA 4KSLC 3IG3A 2LUEA 4A20A 3Q3FA 1I42A 3CMMB 1YJ1A 2D11A 4NNJB 4HLEA 3EHVA 3H1UA 1WMHB 2AEHA 3K9OB 5GMVA 3ZKJC 2LD9A 3UIPB 2KFKB 1WXSA 2C60A 2WX0A 5DPSA 2KJRA 2K6QA 1OQYA 2LVQA 3TJPA 3QCAA 4K7UA 3QHTA 4FJVB 2KXJA 1KOTA 4K81A 4M8MA 3ZNID 4RM8A 1V2YA 3PTFC 3GZNI 2MA9B 2O6VA 2I1JA 4TKNA 3OJ3A 1WGHA 2BWFA 1CMXB 5TR5A 3KUZA 1IYFA 2DZKA 3M63B 2HE7A 2O2VA 2D10A 2BYVE 2Z0DB 3B08A 1R4NI 3ZDMC 2C7NB 3DQVA 1TZ1A 2BYFA 4ZRIA 1IPGA 4DHZE 5CHWA 1E8WA 2ZVNA 3APCA 5E6PA 2MCNB 2L3ZA 2W9NA 3N30A 1WRDB 2KDEB 2N7EA 2ZPYA 5DPRA 1LXDA 3HK0A 4MGKE 3I3TB 3A4RA 3GOEA 1WZ3A 5CHVC 4HPMB 2JRHA 2L7RA 1GJZA 2MWSB 4IUMB 2KC1A 3CF6E 3TMPB 1C1YB 1P98A 1WGRA 2EMSA 3PS6A 4LJPB 4HVBA 3PHWB 3BY4B 2L8JA 2XBBC 2NR2A 2PE6B 4MEMA 3VH3B 1V81A 3ZUNA 3DBHI 4ANWA 4MELA 2KVRA 2R2OA 3VVWB 4WJPA 2ZJDA 2JF5A 1LQBA 2M0XA 5D6JB 3M95A 2R2QA 2V4LA 4WWPA 1NI2A 1WE6A 1P3QU 4M0WB 4G11A 4W9FA 2DHZA 4LDTB 2JWZA 2GOWA 1AARA 4BFRA 4JLCA 3UIOB 3H7PA 4JGHB 4F1SA 2KMAA 3BINA 4BOSC 5KHQA 4RMAA 3JSVB 1WGDA 1XQQA 2FCSA 2JY6A 2G4SA 2JZZA 3DBLI 5D2MB 4XX5A 4BVUC 4II3B 2DAJA 2Z59B 1Q5WB 4EUTA 4IM3A 2XK5B 2N9EB 3NS8A 1WZ0A 1F9JA 1Y8RC 2HTHA 3DVNU 4G0NB 4ZDVA 1VCBA 2LXCA 3HHMA 1GC6A 2KJ6A 2FUHB 4HPLB 1WJNA 2EKEC 2K25A 2KOXA 2OOBB 4I6LB 3HIZA 3KUCB 2V1YA 1WXVA 4TQ0A 1SIFA 1UH6A 2KJHB 3A9JB 3VH4B 2JRIB 1WJ6A 5C23A 2A4ZA 3RT3B 2XEWA 4AUQC 1UELA 2NPTB 4M8NA 3L08A 1K8RB 4GU2A 4ZYNA 5JH5C 3HM3A 2BGFA 5E6OA 2KANA 3V62A 4GMVA 1WXAA 2N9XA 4HCPB 4FADA 4KZ0A 4CYEA 3A9JA 3ZVVA 3APDA 1WMHA 2JT4B 1UZXB 2J0JA 1KM7A 1L7YA 1M94A 2CS4A 2LZ6A 4ZRJA 4ANUA 1WI0A 5J2RA 1RAXA 4A3OA 2M4NA 2Z0EB 5IAAC 3WAPA 2IY1B 1ZGUB 3RULA 3RZFA 4BBNF 2ZVOA 2OJRA 4KIKB 2RGFA 4NJ7A 4EFOA 2FNJB 2GBRA 1H4RA 1GG3A 4NQLB 2DYMA 3RYTA 3UQAA 2FCNA 2MBHA 3K9PB 3D32A 4LCDE 5LXIB 1WXMA 2WWZA 2JXXA 1ISNA 3QC8B 4IW0A 2VRRB 1HE8A 2MBOA 2MW5A 2KX0A 2KDFB 4MGZE 3WA0A 4DHJD 1E8XA 1YX6B 5G2NA 4II2B 1NBFC 1U4AA 2KFKA 2KDBA 2D3GA 2KQSA 3L0WB 2BKFA 4F8CB 1WR6E 2FCQA 4BKTA 2IO1B 2N1WA 2V3SA 4JQWC 4PS8A 3U8ZA 3VHTC 2LVPA 2KDIA 3WIMA 4DHZB 4GXBA 3UF8A 1OTRB 2KO3A 3R7QA 2PJHA 4BKSD 1J0GA 3QK0A 1TBEA 3RCZA 4DBGA 2NBWB 3UGBB 3ZNGC 3L16A 2KTRA 4WWNA 2KQ7A 1TTNA 1V6EA 4W9KA 4E71A 2DYBA 1BT0A 2JUOA 2GBJA 1GUAB 1V80A 4KVGB 5IA7A 3VXWA 2K39A 2MP2A 4DXAB 3PRZA 1E7VA 4P7IA 3A33B 4FBJB 1OEYA 1WX8A 2O6VB 2B3AA 3DPDA 3PHXB 4EOYA 4AWJA 3QQ8B 3A1QA 3NHEB 3B0AA 3PPAA 4ANVA 4FA6A 2KC2A 4PS7A 2ZPNA 1WR1A 4FHJA 3CSFA 2RPQA 2GBKA 4XC2A 1YD8U 3ECIA 4DHJB 3DVNV 2KK8A 3SHQA 2ZCBA 2KX3A 2K8CA 1WM3A 4W9IA 4E3CA 1I35A 1SGHA 2O2VB 3PSEB 3QWZB 5C1ZA 1J8CA 3WALA 2BYEA 2L00B 2WX1A 3AU5A 1QZEA 3HM6X 2K1FA 2Y5BB 4N9F4 2LGDA 3JW0X 3KYDD 4HWIB 2GBNA 3TCAA 1E8ZA 1LFDA 2AYOB 2A5UA 2DYOA 4W9DA 3QA8A 5D94A 4EZKA 2AL3A 3KUDB 4EZLA 3ALBA 3O65B 3ZNHB 2LRUA 2J0MA 3ZW3A 5J17A 2IZVB 1V86A 2NCNA 4ASWC 2IO2B 4G50A 4GIVA 4HCNB 3VUXA 1R4MI 4MGIE 4RM9A 4W9LA 5FR6A 2M17A 5CHFA 1UBIA 4HJKA 2C9WB 2M8SA 4K1RB 4MH0E 5AZHA 4ICVA 2FIDA 3V60A 2KWVB 4E74A 2KTRB 5CX3A 1OGWA 3JYUA 1KJTA 2KMCA 4OVUA 4EZJA 5JHBA 2LXAA 4NY0A 5BO4B 3L54A 3SDLC 3DBSA 2RD0A 1ZKHA 2LI5A 3IBEA 3NY5A 3OAWA 2DX5B 4NAWB 3A9KB 3P2BA 1KLVA 1TGZB 1ZW7A 2KHWB 4WAAA 1SE9A 1E8YA 4W9CA 2GBMA 3VTWA 4F7ZA 3EFUA 2KD0A 3DOWA 4FJZA 2BKRB 5L83A 1V5TA 4W9HA 3V61A 1LM8B 3DVGX 3JVZX 2UWQA 3SU8X 3QIJA 2KTFA 3OJ4B 3PZDA 3W1SA 4HK2A 1E7UA 4W9EA 2L0FA 2ZNVC 2ZEQA 3DCGA 3R7RA 1S1QB 3VFKA 2LWPA 1D3ZA 1V5OA 1YX5B 3OLMD 4GDKB 4GGQA 3UINB 2KNBA 1UGMA 1WM2A 3KW5B 3VTVA 3VTUA 3N32A 4IC7B 3AU4A 1EO6A 2YLMA 5JHAA 2KLCA 2K6DB 3L17A 4GOCA 1WF9A 5AEKB 1E90A 2KN5A 2CU1A 5J18A 1GC7A 4IWPA 4PS3A 1S3SG 4I6NB 3U30A 5EDSA 4AJWA 4FN2A 4GDLB 1EF1A 1VD2A 2MBQA 2CHZA 3QARA 3TIXA 5DPTA 3M62B 5CTRC 5AZFA 4BKSA 2NPTA 2C5LC 3NOBA 3T9LA 1A5RA 3VUWA 2AWTA 2CR5A 4WJOA 1YQBA 2MBBB 2NBVB 2FIFA 3PV1A 4AJYB 4FHKA 1JRUA 2MP2B 2N9PC 4IM2A 4KDIC 5LXHA 4NJ6A 3L13A 2N7DA 1NDDA 2J7QB 3ZNZB 4XZ4A 1P9DU 1WGYA 4FULA 3ZLZA 2L0TA 4ICUA 4NPNA 3U7DA 2EMTA 3MTNB 3VQIA 1IP9A 1E5WA 3DVGY 4AP4C 3EECA 3TBLD 3B1LX 3VDZA 1WJUA 2L05A 3WAOA 2UYZB 3PT2B 4URKA 2WYQA 2M1MA 2ASQA 3JSVA 4MDKE 3ZO5B 2BWES 2KZRA 3H7SA 4KDLB 4BBNC 3X23A 2N1VA 3H6NA 2PEAA 2PE9A 3V6EB 2IYDB 4GDLA 2WDTB 3KYCD 2GMIC 2ZNVB 2MLBA 2KKCA 3H7PB 1EF5A 4HDOA 4MM3A 4B9KA 1H8CA 2J0KA 4FLHA 4NQKE 1WX9A 3UQBA 3IHPC 3M3JA 3QAQA 4NAWA 4EEWA 5AZGA 2K8BA 3N3KB 3H9DA 5L95C 5D7GA 4CO7A 1RFAA 4WJNA 3ZIMA 4BOZB 1WX7A 2JZ3B 4BKGA 3PVLA 4X57B 2G3QB 2N4FA 1T0YA 2NBUA 2HD5B 3KVFB 3LDZE 2IY0B 2JPHA 2BPSA 3RUIB 2C7MB 1MG8A 1FXTB 2LGXA 2MRPA 3APFA 2I1KA 3RD2A 3ZDTA 3PLVA 2LRWA 2NS5A 4IM0A 2CHWA 1WFYA 1WYWB 3KH0A 3QJZA 4GSWA 3DBRI 3A9KA 2DZJA 3WAMA 4OVVA 3MHSD 1WY8A 4HDQA 1XT9B 4LDTD 4WJQA 2NVUI 3WANA 5E6NA 4AOFA 1Q0WB 3ONSA 4YL8A 3IVFA 2JVCA 2CKHB 3Q3JA 3SD5A 3R3MA 4GDKA 4IWQA 4MSMB 4TUUA 1XD3B 1C3TA 4MJSB 3IFWB 1P1AA 3V6CB 3A4SC 4W9GA 5DPWA 5KHOA 4ANXA 3DDCB 1Z2MA 5HKHA 4WWOA 4G3XB 4A3PA 4DDGD 4IG7B 1WJ4A 3NZSA 2XK5A 4TV3A 4MGYE 1V49A 3PRMB 4K7SA 4KV2A 3W1YA 1L2NA 2RSUA 4TQ1A 3PREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRF A;  2REX A;  2YVC A;  1Z5S B;  2FCM A;  4LJO B;  4JIO U;  3VAW A;  3A1Q B;  3CST A;  4ZRK A;  4K7W A;  2QHO A;  2D07 B;  4DK5 A;  4JL9 A;  3ML9 A;  2DAF A;  2MQJ A;  2D2Q A;  3LJ3 A;  5G55 A;  1RLF A;  3NZU A;  4HXD A;  4MSQ B;  3L10 B;  1Q1O A;  1WGG A;  3T8M A;  2IO3 B;  2KWU B;  4IWO A;  4MJS A;  1UBQ A;  2AL6 A;  2ZCC A;  2MSE D;  3AUL A;  5JZE B;  1GNU A;  1X1M A;  3W1S C;  2DZM A;  2PPH A;  3X0W A;  2C7H A;  2IO0 B;  4DWF A;  2DZI A;  2MX2 A;  3EC8 A;  1J19 A;  1P0R A;  4GN1 A;  5LLI A;  2LVO A;  3PLU A;  4B95 A;  4B6W A;  4PYZ A;  3ENE A;  4FJY A;  2G45 B;  1V9J A;  1WE7 A;  2MBE A;  4WQO B;  1PQS A;  1OEY J;  2BF8 B;  2KLG A;  3C0R B;  4KSK C;  3ZTD A;  5DCN A;  3AXC A;  3R66 C;  2K8H A;  4I6P A;  4W9J A;  2ZZP B;  4GB9 A;  2O6V D;  2LGY A;  2DEN B;  2IBI B;  1WH3 A;  2RR9 A;  1UD7 A;  3VUY A;  3TL5 A;  1EUV B;  2FAZ A;  4KZC A;  3QX1 A;  1WIA A;  1RRB A;  2KFJ A;  3PGE A;  3RZW C;  4EKU A;  4DDI D;  2G4D B;  2LAS A;  2HJ8 A;  3ML8 A;  2LJ5 A;  4CHK A;  3ZRC A;  2L76 A;  4PYU A;  3S2A A;  1YIW A;  3AI5 A;  2CHX A;  3ZTC A;  4KIK A;  1G6J A;  4J6I A;  3MJW A;  3PRP B;  2KWC A;  4KSL C;  3IG3 A;  2LUE A;  4A20 A;  3Q3F A;  1I42 A;  3CMM B;  1YJ1 A;  2D11 A;  4NNJ B;  4HLE A;  3EHV A;  3H1U A;  1WMH B;  2AEH A;  3K9O B;  5GMV A;  3ZKJ C;  2LD9 A;  3UIP B;  2KFK B;  1WXS A;  2C60 A;  2WX0 A;  5DPS A;  2KJR A;  2K6Q A;  1OQY A;  2LVQ A;  3TJP A;  3QCA A;  4K7U A;  3QHT A;  4FJV B;  2KXJ A;  1KOT A;  4K81 A;  4M8M A;  3ZNI D;  4RM8 A;  1V2Y A;  3PTF C;  3GZN I;  2MA9 B;  2O6V A;  2I1J A;  4TKN A;  3OJ3 A;  1WGH A;  2BWF A;  1CMX B;  5TR5 A;  3KUZ A;  1IYF A;  2DZK A;  3M63 B;  2HE7 A;  2O2V A;  2D10 A;  2BYV E;  2Z0D B;  3B08 A;  1R4N I;  3ZDM C;  2C7N B;  3DQV A;  1TZ1 A;  2BYF A;  4ZRI A;  1IPG A;  4DHZ E;  5CHW A;  1E8W A;  2ZVN A;  3APC A;  5E6P A;  2MCN B;  2L3Z A;  2W9N A;  3N30 A;  1WRD B;  2KDE B;  2N7E A;  2ZPY A;  5DPR A;  1LXD A;  3HK0 A;  4MGK E;  3I3T B;  3A4R A;  3GOE A;  1WZ3 A;  5CHV C;  4HPM B;  2JRH A;  2L7R A;  1GJZ A;  2MWS B;  4IUM B;  2KC1 A;  3CF6 E;  3TMP B;  1C1Y B;  1P98 A;  1WGR A;  2EMS A;  3PS6 A;  4LJP B;  4HVB A;  3PHW B;  3BY4 B;  2L8J A;  2XBB C;  2NR2 A;  2PE6 B;  4MEM A;  3VH3 B;  1V81 A;  3ZUN A;  3DBH I;  4ANW A;  4MEL A;  2KVR A;  2R2O A;  3VVW B;  4WJP A;  2ZJD A;  2JF5 A;  1LQB A;  2M0X A;  5D6J B;  3M95 A;  2R2Q A;  2V4L A;  4WWP A;  1NI2 A;  1WE6 A;  1P3Q U;  4M0W B;  4G11 A;  4W9F A;  2DHZ A;  4LDT B;  2JWZ A;  2GOW A;  1AAR A;  4BFR A;  4JLC A;  3UIO B;  3H7P A;  4JGH B;  4F1S A;  2KMA A;  3BIN A;  4BOS C;  5KHQ A;  4RMA A;  3JSV B;  1WGD A;  1XQQ A;  2FCS A;  2JY6 A;  2G4S A;  2JZZ A;  3DBL I;  5D2M B;  4XX5 A;  4BVU C;  4II3 B;  2DAJ A;  2Z59 B;  1Q5W B;  4EUT A;  4IM3 A;  2XK5 B;  2N9E B;  3NS8 A;  1WZ0 A;  1F9J A;  1Y8R C;  2HTH A;  3DVN U;  4G0N B;  4ZDV A;  1VCB A;  2LXC A;  3HHM A;  1GC6 A;  2KJ6 A;  2FUH B;  4HPL B;  1WJN A;  2EKE C;  2K25 A;  2KOX A;  2OOB B;  4I6L B;  3HIZ A;  3KUC B;  2V1Y A;  1WXV A;  4TQ0 A;  1SIF A;  1UH6 A;  2KJH B;  3A9J B;  3VH4 B;  2JRI B;  1WJ6 A;  5C23 A;  2A4Z A;  3RT3 B;  2XEW A;  4AUQ C;  1UEL A;  2NPT B;  4M8N A;  3L08 A;  1K8R B;  4GU2 A;  4ZYN A;  5JH5 C;  3HM3 A;  2BGF A;  5E6O A;  2KAN A;  3V62 A;  4GMV A;  1WXA A;  2N9X A;  4HCP B;  4FAD A;  4KZ0 A;  4CYE A;  3A9J A;  3ZVV A;  3APD A;  1WMH A;  2JT4 B;  1UZX B;  2J0J A;  1KM7 A;  1L7Y A;  1M94 A;  2CS4 A;  2LZ6 A;  4ZRJ A;  4ANU A;  1WI0 A;  5J2R A;  1RAX A;  4A3O A;  2M4N A;  2Z0E B;  5IAA C;  3WAP A;  2IY1 B;  1ZGU B;  3RUL A;  3RZF A;  4BBN F;  2ZVO A;  2OJR A;  4KIK B;  2RGF A;  4NJ7 A;  4EFO A;  2FNJ B;  2GBR A;  1H4R A;  1GG3 A;  4NQL B;  2DYM A;  3RYT A;  3UQA A;  2FCN A;  2MBH A;  3K9P B;  3D32 A;  4LCD E;  5LXI B;  1WXM A;  2WWZ A;  2JXX A;  1ISN A;  3QC8 B;  4IW0 A;  2VRR B;  1HE8 A;  2MBO A;  2MW5 A;  2KX0 A;  2KDF B;  4MGZ E;  3WA0 A;  4DHJ D;  1E8X A;  1YX6 B;  5G2N A;  4II2 B;  1NBF C;  1U4A A;  2KFK A;  2KDB A;  2D3G A;  2KQS A;  3L0W B;  2BKF A;  4F8C B;  1WR6 E;  2FCQ A;  4BKT A;  2IO1 B;  2N1W A;  2V3S A;  4JQW C;  4PS8 A;  3U8Z A;  3VHT C;  2LVP A;  2KDI A;  3WIM A;  4DHZ B;  4GXB A;  3UF8 A;  1OTR B;  2KO3 A;  3R7Q A;  2PJH A;  4BKS D;  1J0G A;  3QK0 A;  1TBE A;  3RCZ A;  4DBG A;  2NBW B;  3UGB B;  3ZNG C;  3L16 A;  2KTR A;  4WWN A;  2KQ7 A;  1TTN A;  1V6E A;  4W9K A;  4E71 A;  2DYB A;  1BT0 A;  2JUO A;  2GBJ A;  1GUA B;  1V80 A;  4KVG B;  5IA7 A;  3VXW A;  2K39 A;  2MP2 A;  4DXA B;  3PRZ A;  1E7V A;  4P7I A;  3A33 B;  4FBJ B;  1OEY A;  1WX8 A;  2O6V B;  2B3A A;  3DPD A;  3PHX B;  4EOY A;  4AWJ A;  3QQ8 B;  3A1Q A;  3NHE B;  3B0A A;  3PPA A;  4ANV A;  4FA6 A;  2KC2 A;  4PS7 A;  2ZPN A;  1WR1 A;  4FHJ A;  3CSF A;  2RPQ A;  2GBK A;  4XC2 A;  1YD8 U;  3ECI A;  4DHJ B;  3DVN V;  2KK8 A;  3SHQ A;  2ZCB A;  2KX3 A;  2K8C A;  1WM3 A;  4W9I A;  4E3C A;  1I35 A;  1SGH A;  2O2V B;  3PSE B;  3QWZ B;  5C1Z A;  1J8C A;  3WAL A;  2BYE A;  2L00 B;  2WX1 A;  3AU5 A;  1QZE A;  3HM6 X;  2K1F A;  2Y5B B;  4N9F 4;  2LGD A;  3JW0 X;  3KYD D;  4HWI B;  2GBN A;  3TCA A;  1E8Z A;  1LFD A;  2AYO B;  2A5U A;  2DYO A;  4W9D A;  3QA8 A;  5D94 A;  4EZK A;  2AL3 A;  3KUD B;  4EZL A;  3ALB A;  3O65 B;  3ZNH B;  2LRU A;  2J0M A;  3ZW3 A;  5J17 A;  2IZV B;  1V86 A;  2NCN A;  4ASW C;  2IO2 B;  4G50 A;  4GIV A;  4HCN B;  3VUX A;  1R4M I;  4MGI E;  4RM9 A;  4W9L A;  5FR6 A;  2M17 A;  5CHF A;  1UBI A;  4HJK A;  2C9W B;  2M8S A;  4K1R B;  4MH0 E;  5AZH A;  4ICV A;  2FID A;  3V60 A;  2KWV B;  4E74 A;  2KTR B;  5CX3 A;  1OGW A;  3JYU A;  1KJT A;  2KMC A;  4OVU A;  4EZJ A;  5JHB A;  2LXA A;  4NY0 A;  5BO4 B;  3L54 A;  3SDL C;  3DBS A;  2RD0 A;  1ZKH A;  2LI5 A;  3IBE A;  3NY5 A;  3OAW A;  2DX5 B;  4NAW B;  3A9K B;  3P2B A;  1KLV A;  1TGZ B;  1ZW7 A;  2KHW B;  4WAA A;  1SE9 A;  1E8Y A;  4W9C A;  2GBM A;  3VTW A;  4F7Z A;  3EFU A;  2KD0 A;  3DOW A;  4FJZ A;  2BKR B;  5L83 A;  1V5T A;  4W9H A;  3V61 A;  1LM8 B;  3DVG X;  3JVZ X;  2UWQ A;  3SU8 X;  3QIJ A;  2KTF A;  3OJ4 B;  3PZD A;  3W1S A;  4HK2 A;  1E7U A;  4W9E A;  2L0F A;  2ZNV C;  2ZEQ A;  3DCG A;  3R7R A;  1S1Q B;  3VFK A;  2LWP A;  1D3Z A;  1V5O A;  1YX5 B;  3OLM D;  4GDK B;  4GGQ A;  3UIN B;  2KNB A;  1UGM A;  1WM2 A;  3KW5 B;  3VTV A;  3VTU A;  3N32 A;  4IC7 B;  3AU4 A;  1EO6 A;  2YLM A;  5JHA A;  2KLC A;  2K6D B;  3L17 A;  4GOC A;  1WF9 A;  5AEK B;  1E90 A;  2KN5 A;  2CU1 A;  5J18 A;  1GC7 A;  4IWP A;  4PS3 A;  1S3S G;  4I6N B;  3U30 A;  5EDS A;  4AJW A;  4FN2 A;  4GDL B;  1EF1 A;  1VD2 A;  2MBQ A;  2CHZ A;  3QAR A;  3TIX A;  5DPT A;  3M62 B;  5CTR C;  5AZF A;  4BKS A;  2NPT A;  2C5L C;  3NOB A;  3T9L A;  1A5R A;  3VUW A;  2AWT A;  2CR5 A;  4WJO A;  1YQB A;  2MBB B;  2NBV B;  2FIF A;  3PV1 A;  4AJY B;  4FHK A;  1JRU A;  2MP2 B;  2N9P C;  4IM2 A;  4KDI C;  5LXH A;  4NJ6 A;  3L13 A;  2N7D A;  1NDD A;  2J7Q B;  3ZNZ B;  4XZ4 A;  1P9D U;  1WGY A;  4FUL A;  3ZLZ A;  2L0T A;  4ICU A;  4NPN A;  3U7D A;  2EMT A;  3MTN B;  3VQI A;  1IP9 A;  1E5W A;  3DVG Y;  4AP4 C;  3EEC A;  3TBL D;  3B1L X;  3VDZ A;  1WJU A;  2L05 A;  3WAO A;  2UYZ B;  3PT2 B;  4URK A;  2WYQ A;  2M1M A;  2ASQ A;  3JSV A;  4MDK E;  3ZO5 B;  2BWE S;  2KZR A;  3H7S A;  4KDL B;  4BBN C;  3X23 A;  2N1V A;  3H6N A;  2PEA A;  2PE9 A;  3V6E B;  2IYD B;  4GDL A;  2WDT B;  3KYC D;  2GMI C;  2ZNV B;  2MLB A;  2KKC A;  3H7P B;  1EF5 A;  4HDO A;  4MM3 A;  4B9K A;  1H8C A;  2J0K A;  4FLH A;  4NQK E;  1WX9 A;  3UQB A;  3IHP C;  3M3J A;  3QAQ A;  4NAW A;  4EEW A;  5AZG A;  2K8B A;  3N3K B;  3H9D A;  5L95 C;  5D7G A;  4CO7 A;  1RFA A;  4WJN A;  3ZIM A;  4BOZ B;  1WX7 A;  2JZ3 B;  4BKG A;  3PVL A;  4X57 B;  2G3Q B;  2N4F A;  1T0Y A;  2NBU A;  2HD5 B;  3KVF B;  3LDZ E;  2IY0 B;  2JPH A;  2BPS A;  3RUI B;  2C7M B;  1MG8 A;  1FXT B;  2LGX A;  2MRP A;  3APF A;  2I1K A;  3RD2 A;  3ZDT A;  3PLV A;  2LRW A;  2NS5 A;  4IM0 A;  2CHW A;  1WFY A;  1WYW B;  3KH0 A;  3QJZ A;  4GSW A;  3DBR I;  3A9K A;  2DZJ A;  3WAM A;  4OVV A;  3MHS D;  1WY8 A;  4HDQ A;  1XT9 B;  4LDT D;  4WJQ A;  2NVU I;  3WAN A;  5E6N A;  4AOF A;  1Q0W B;  3ONS A;  4YL8 A;  3IVF A;  2JVC A;  2CKH B;  3Q3J A;  3SD5 A;  3R3M A;  4GDK A;  4IWQ A;  4MSM B;  4TUU A;  1XD3 B;  1C3T A;  4MJS B;  3IFW B;  1P1A A;  3V6C B;  3A4S C;  4W9G A;  5DPW A;  5KHO A;  4ANX A;  3DDC B;  1Z2M A;  5HKH A;  4WWO A;  4G3X B;  4A3P A;  4DDG D;  4IG7 B;  1WJ4 A;  3NZS A;  2XK5 A;  4TV3 A;  4MGY E;  1V49 A;  3PRM B;  4K7S A;  4KV2 A;  3W1Y A;  1L2N A;  2RSU A;  4TQ1 A;  3PRE A; 
#chains in the Genus database with same CATH topology
 3ZRF A;  1Z5S B;  1JML A;  3VAW A;  4B0M A;  3ML9 A;  3N1Y C;  3LJ3 A;  3NZU A;  3L10 B;  3PZ8 A;  1F1H A;  1YN5 A;  2IO3 B;  2MSE D;  4ZHO A;  3MHZ A;  1KFY B;  2MX2 A;  2JSV X;  2V4I B;  4PYZ A;  3ENE A;  1K53 A;  1V9J A;  3SR6 A;  1WE7 A;  2MBE A;  4KSK C;  4BAX A;  4W9J A;  4I6P A;  2O6V D;  2LGY A;  2FAZ A;  1MI0 A;  1C4A A;  4JWU C;  4DDI D;  2IGH A;  2LAS A;  4CHK A;  4N6E B;  4EE2 A;  2WXK A;  4PYU A;  1G6J A;  3PRP B;  1SEB D;  3IG3 A;  3Q3F A;  3GB1 A;  3CMM B;  1YJ1 A;  4NNJ B;  1N5W A;  2E6X A;  3FAH A;  4CQN A;  4K7U A;  3QHT A;  1V2Y A;  3PTF C;  3Q8C A;  1YOV B;  2I1J A;  1CMX B;  1IYF A;  2O2V A;  2D10 A;  3B08 A;  4KGS A;  1R4N I;  3ZDM C;  2C7N B;  3V05 A;  1DOX A;  1ET6 A;  1IPG A;  1V97 A;  4DHZ E;  5CHW A;  5E6P A;  2L3Z A;  3LXF A;  2BS3 B;  2W9N A;  2N7E A;  4MGK E;  1WZ3 A;  2BB6 A;  4IUM B;  3CF6 E;  1P98 A;  4HVB A;  4LJP B;  3AE1 B;  4MEM A;  5FKA C;  4MEL A;  3VVW B;  1MJD A;  4WJP A;  3BVG A;  5D3I B;  2JF5 A;  1LQB A;  2R2Q A;  2V4L A;  2CU3 A;  1ET9 A;  4C80 A;  1AAR A;  3UIO B;  2KMA A;  3FIL B;  1EU3 A;  1C77 A;  2JY6 A;  3DBL I;  2XNA C;  4II3 B;  2KVZ A;  2LFI A;  1JRO A;  2N9E B;  1PDX A;  2HTH A;  4G0N B;  4RFB A;  1GC6 A;  3MC9 A;  1WJN A;  1KH0 A;  4LNI A;  4TQ0 A;  1QOB A;  3W5V B;  3B9J A;  3A9J B;  2JRI B;  4PT5 A;  2A4Z A;  2IGG A;  3RT3 B;  1Y56 A;  1UEL A;  4M8N A;  3HM3 A;  1TZO A;  2BGF A;  2BVC A;  3J9C A;  4GMV A;  1GOZ A;  4C4V B;  1SBB B;  1I4X A;  3APD A;  1WMH A;  2J0J A;  4WH4 A;  1D5Z C;  1EWC A;  4ZRJ A;  2L1A A;  2ON8 A;  2EKI A;  2ZVO A;  2RGF A;  1QT9 A;  2FNJ B;  2Y3A A;  2FCN A;  2MBH A;  3K9P B;  3D32 A;  4LCD E;  1WXM A;  2WWZ A;  2JXX A;  1ISN A;  3RN9 C;  2MW5 A;  2KDF B;  4MGZ E;  2W3R A;  3NRZ A;  3AN1 A;  1NBF C;  2KFK A;  4HEA 1;  1IUE A;  2BKF A;  1WR6 E;  4BKT A;  1AN8 A;  2RDH A;  1TY0 A;  4GXB A;  2X38 A;  3R7Q A;  2K3U A;  3ZNG C;  3L16 A;  4RCO A;  1V6E A;  1JWU D;  4W9K A;  2DYB A;  5BYQ A;  1GUA B;  1V80 A;  1YJJ A;  3VXW A;  2MP2 A;  4DXA B;  3E9S A;  3A33 B;  2O6V B;  2E3T A;  1BUI C;  3P4S B;  4OZA A;  2KC2 A;  4ARI A;  2ONQ A;  1WXQ A;  1BML C;  4DHJ B;  1KLG D;  3DVN V;  2KK8 A;  3SHQ A;  3ZJU A;  1I35 A;  3PSE B;  3QWZ B;  3WAL A;  1SE3 A;  3BII D;  3AED B;  3AU5 A;  3HM6 X;  2K1F A;  4XGA B;  4RGN A;  3TEY A;  4EZL A;  5D94 A;  2AL3 A;  3B2G A;  2NTT A;  2TSS A;  3ZW3 A;  5J17 A;  1QOA A;  2PVG C;  2IZV B;  2NCN A;  4ASW C;  4HCN B;  1R4M I;  4W9L A;  3FC4 A;  1UWX A;  2FID A;  1V1O A;  3BZD B;  1C4C A;  2KWV B;  3T3N A;  4IOI E;  2KTR B;  1OGW A;  3JYU A;  2KMC A;  2LXA A;  1I7H A;  2D3B A;  4WWM A;  2DX5 B;  2WLB A;  4TMA B;  3MP9 A;  3P2B A;  3Q8A A;  1FD6 A;  1ZW7 A;  2KT7 A;  2KHW B;  1SE9 A;  1E9M A;  2GBM A;  2BKR B;  4LNN A;  3V61 A;  1LM8 B;  3SU8 X;  3QIJ A;  2KTF A;  5C2T B;  3DCG A;  3R7R A;  3VFK A;  2LWP A;  1D3Z A;  1JWB D;  2RDB C;  3OG5 A;  3AEE B;  4GDK B;  4IC7 B;  3AU4 A;  5JHA A;  4HPP A;  4GOC A;  2CJO A;  1F2R I;  1E90 A;  2KN5 A;  5AEK B;  2CU1 A;  5J18 A;  4PS3 A;  1S3S G;  1EF1 A;  4XYC A;  3RNG C;  1VD2 A;  1YJI A;  1LO5 D;  5DPT A;  5CTR C;  5AZF A;  3T9L A;  2CR5 A;  4WJO A;  3FKY A;  2NBV B;  2FIF A;  4AJY B;  1JRU A;  2N9P C;  4KDI C;  2MJ3 A;  2J7Q B;  3CWI A;  3ZNZ B;  4XZ4 A;  4FUL A;  3MC0 B;  1E5W A;  1JWM D;  3EEC A;  2WXR A;  3B1L X;  2L05 A;  3T3O A;  3PT2 B;  4URK A;  1A70 A;  1PGB A;  1FNU A;  2M1M A;  4O1N A;  2G9H D;  2J53 A;  4MDK E;  2INP E;  2N1V A;  3H6N A;  2PEA A;  1HTQ A;  3V6E B;  4XWT A;  2J42 A;  4MM3 A;  4B9K A;  2ICI A;  4FLH A;  4OZC A;  2V9H A;  4EEW A;  3GP7 A;  5L95 C;  1TS5 A;  2VH1 A;  2VH2 A;  1TJE A;  4BKG A;  3PVL A;  1T0Y A;  2NBU A;  1HXY D;  2PIA A;  3KVF B;  2WNM A;  2BPS A;  2JWU A;  1NYR A;  1K51 A;  2MRP A;  1KLU D;  2KMM A;  3RD2 A;  1NEK B;  3KH0 A;  1WFY A;  3Q8F A;  2DZJ A;  4Q2J A;  3WAM A;  1ZPS A;  1WY8 A;  4HRS A;  4REZ A;  4LDT D;  2LJI A;  3WAN A;  5E6N A;  3ONS A;  1RYJ A;  2JVC A;  3IVF A;  3SD5 A;  3R3M A;  4TUU A;  4C00 A;  1JWA D;  4IDI A;  4W9G A;  1N61 A;  4ANX A;  1Z2M A;  1UWM A;  4DDG D;  1VJK A;  3NZS A;  5I4D A;  2WXJ A;  4TV3 A;  1V49 A;  2WDQ B;  4K7S A;  1L2N A;  4JWS C;  2REX A;  1FNW A;  1P7F A;  2YVC A;  4LJO B;  2JQR B;  1Q10 A;  3CST A;  4ZRK A;  1VZ8 A;  4K7W A;  2QHO A;  5GXG B;  1L4D B;  3KWV A;  3IAS 1;  4HXD A;  4MSQ B;  1CZP A;  1EU4 A;  4P1C C;  2X8X X;  5JZE B;  2LUM A;  1GNU A;  4DQO C;  2PPH A;  2QC8 A;  4ZOH C;  4FJY A;  1YN4 A;  4WQO B;  3ZTD A;  4LK0 M;  3GE3 C;  3L4P A;  2Q5W D;  5DCN A;  1PUT A;  3AH7 A;  2WXI A;  2IBI B;  2BS2 B;  1UD7 A;  1L0V B;  3TL5 A;  1EUV B;  2MHJ A;  2GB1 A;  3QX1 A;  4HRO A;  1WIA A;  3RZW C;  4D2K A;  3ML8 A;  3AI5 A;  3RNC C;  2I2Y A;  3ZTC A;  4MH8 A;  1ZXH A;  2V3N A;  4DXG A;  4C56 C;  2IND C;  3H1U A;  3N1X C;  2AEH A;  2FBW B;  4H2A A;  4L1B A;  5EE0 A;  5GMV A;  3UIP B;  3ZKJ C;  2KFK B;  3Q6B A;  1L0X B;  2WX0 A;  2KJR A;  1PGA A;  2K6Q A;  3QCA A;  1KOT A;  4FJV B;  2KQ4 X;  4K81 A;  4M8M A;  2VZK D;  3UI3 A;  3GZN I;  2MA9 B;  1UUP A;  3AMZ A;  2BQQ A;  3U2S C;  2Z0D B;  1PYW D;  2BYF A;  2M19 A;  2NTS A;  1R4N B;  1XLQ A;  1PGX A;  5FK9 C;  2ZVN A;  2J52 A;  5D3D A;  1XLN A;  2KDE B;  1LXD A;  2Y5P A;  3HK0 A;  1RWS A;  2RMM A;  2M56 B;  5CHV C;  2L7R A;  2MWS B;  4US9 A;  1MFW A;  4RF0 A;  3BYY B;  3HRD D;  3TMP B;  2EMS A;  3PS6 A;  3PHW B;  1YNT E;  2PE6 B;  3ZXV A;  5AUK A;  4RNA A;  4LTU A;  2W82 A;  4XDD A;  2ZJD A;  5D6J B;  4WWP A;  1WE6 A;  4M0W B;  1VRA B;  2LGS A;  5BMH A;  2H89 B;  4BFR A;  1C9F A;  4JLC A;  4JGH B;  2JYE A;  2AQ2 B;  4BOS C;  1HQR D;  1XQQ A;  2FCS A;  2G4S A;  2JZZ A;  4XX5 A;  4IM3 A;  2XK5 B;  3DVN U;  3DWG C;  2LXC A;  4HPL B;  1IBX B;  2QMT A;  1ZOY B;  2EKE C;  2KOX A;  4RGM A;  5LNK 1;  3HIZ A;  1WGK A;  3ZXR A;  3U7Z A;  3KQ4 A;  1I4G A;  1JQ4 A;  1HTO A;  1QQR A;  1K8R B;  4GU2 A;  1FRR A;  5JH5 C;  4CYE A;  1M94 A;  2LZ6 A;  4ANU A;  4LNF A;  1FMA D;  1RAX A;  4A3O A;  1SE2 A;  2M4N A;  5IAA C;  1SJE D;  2IY1 B;  2PKO A;  3RUL A;  2K9X A;  4BBN F;  1IBX A;  4NJ7 A;  4EFO A;  4NQL B;  3RYT A;  3R8B A;  3NVV A;  3Q2A C;  1MHH E;  4OVZ A;  3QC8 B;  4IW0 A;  1HE8 A;  2MBO A;  1JCK B;  1E8X A;  5G2N A;  4ZHP A;  2MEK A;  2KQS A;  2D3G A;  2WXQ A;  2FCQ A;  2V3S A;  3U8Z A;  4M0W A;  1XLP A;  3RNB C;  2KDI A;  4DHZ B;  3NVY A;  2PJH A;  4BKS D;  4MAC A;  3QK0 A;  3RCZ A;  1ZDX A;  3KWL A;  2KTR A;  2Y5C A;  1M4V A;  2JUO A;  4KVG B;  3PRZ A;  4P7I A;  4TSS A;  1J7B A;  1ESF A;  1OEY A;  1WX8 A;  1I4R A;  3DPD A;  4EOY A;  1IGC A;  1GAQ B;  2ZPN A;  4GLS C;  3CSF A;  5MPO A;  2RPQ A;  1VR9 A;  4XC2 A;  1YD8 U;  1BXT A;  4W9I A;  5EE9 A;  1J8C A;  2KAJ A;  1QZE A;  2Y5B B;  4N9F 4;  2EEL A;  3KYD D;  4HWI B;  1E8Z A;  1GB4 A;  2A5U A;  2WXH A;  3KUD B;  3ALB A;  3O65 B;  3ZNH B;  2J0M A;  1TKG A;  2D3C A;  1V86 A;  2IO2 B;  4GIV A;  2WDV B;  3VUX A;  4MGI E;  2YEP F;  3RFZ B;  2M17 A;  4XDC A;  5CHF A;  3SEB A;  3DBH B;  1QOG A;  1WYG A;  4ICV A;  3V60 A;  3GS2 A;  4NZL B;  4E74 A;  1KJT A;  4OVU A;  1YQ3 B;  2KDM A;  2RD0 A;  1ROE A;  3NY5 A;  3OAW A;  4N58 A;  3ZJV A;  3Q3O C;  3A9K B;  2WXM A;  3AE9 B;  1JRP A;  1E8Y A;  4W9C A;  1E10 A;  4F7Z A;  5BYR A;  1DOY A;  4FJZ A;  5L83 A;  1B1Z A;  3DVG X;  3JVZ X;  3W1S A;  4HK2 A;  1E7U A;  3W9C B;  2L0F A;  1ZXI A;  2ZEQ A;  3VR9 B;  1S1Q B;  3LB8 C;  2PMV A;  3R2T A;  1YX5 B;  1UGM A;  1WM2 A;  1L0Y B;  1EO6 A;  2YLM A;  2KLC A;  1QKZ A;  2K6D B;  3L17 A;  3TUO A;  3U30 A;  4AJW A;  2G1E A;  1OQR A;  3HVZ A;  3QAR A;  4KGT A;  3M62 B;  3NOB A;  1A5R A;  3EUB 2;  3V3X A;  3BYT B;  4IM2 A;  3N1Z C;  4NJ6 A;  1TY2 A;  4OZB A;  3URY A;  1P9D U;  1WGY A;  3PO0 A;  3ZLZ A;  2L0T A;  3U7D A;  2WHI A;  4AS1 A;  4L23 A;  1T3Q A;  2WU5 B;  3H7S A;  1QOF A;  2W3S A;  3FIL A;  3X23 A;  2JYT A;  3GE8 C;  2PE9 A;  4RH6 A;  3UQB A;  3IHP C;  1NEN B;  4J3O D;  1FFU A;  1FIQ A;  1NYQ A;  2G3Q B;  2N4F A;  4YT0 B;  4WQM A;  4UDU C;  3RUI B;  2C7M B;  2RDG A;  1MG8 A;  1FXT B;  3Q69 A;  3APF A;  3ZDT A;  2BS4 B;  2NS5 A;  1WWT A;  4GSW A;  2HJ1 A;  2WU2 B;  3DBR I;  5HG2 A;  4OVV A;  1XT9 B;  4USA A;  3ABV B;  1L5P A;  2INC C;  2NVU I;  2NMQ A;  1I4Q A;  4YL8 A;  2CKH B;  1P7E A;  5BYS A;  3IXS A;  4S0R A;  4MJS B;  5DPW A;  5KHO A;  1XEE A;  1FM0 D;  1JWS D;  3DBR B;  4A3P A;  1CJE A;  1WJ4 A;  2SEB D;  3ZQ4 A;  4TQ1 A;  1E6E B;  1SF0 A;  4YSY B;  5HI1 A;  3MC8 A;  4KKI A;  4JL9 A;  4DK5 A;  3RNE C;  2DAF A;  2D2Q A;  4RGO S;  1QIL A;  3BK2 A;  5G55 A;  1RLF A;  1Q1O A;  1MPE A;  1WGG A;  2KWU B;  4DXF A;  2ZCC A;  3AUL A;  3W1S C;  5E6J A;  3X0W A;  2C7H A;  2IO0 B;  2DZI A;  1P0R A;  1CQV A;  4GN1 A;  4B6W A;  2MJD A;  2G45 B;  2JXT A;  1OEY J;  2BF8 B;  2KLG A;  3C0R B;  2D5G A;  2CJN A;  1TKE A;  2K8H A;  2ZZP B;  4GB9 A;  2DEN B;  2RR9 A;  3VUY A;  4KZC A;  3PGE A;  1CK1 A;  1RRB A;  2QCZ A;  2OED A;  2LJ5 A;  1FNV A;  2CHX A;  1D5M C;  2N0S B;  4HKZ E;  1C76 A;  4J6I A;  3MJW A;  4A20 A;  3MJ5 A;  3N9Y C;  3EHV A;  1FEH A;  1WMH B;  5G5G A;  3K9O B;  1XCT L;  2BT6 A;  1WXS A;  2BW2 A;  2C60 A;  1OQY A;  2LVQ A;  3CIR B;  1DYQ A;  3OJ3 A;  5TR5 A;  2WXF A;  2JX5 A;  1L6U A;  3M63 B;  5IO9 A;  4YTN B;  2BYV E;  3RNF C;  1K50 A;  1ZP0 B;  4IKG A;  2MCN B;  2LHE A;  2K22 A;  2WXL A;  3N30 A;  2ZPY A;  4A9A A;  3I3T B;  4HPM B;  2OJW A;  4AQ7 A;  1GJZ A;  1I4H A;  3ZGZ A;  3BY4 B;  2XBB C;  3KLS X;  3DBH I;  4ANW A;  2R2O A;  2Z8L A;  2DBY A;  3EFC A;  2GI9 A;  3M95 A;  1P3Q U;  4KX6 B;  2GOW A;  1OFF A;  4MM3 B;  3VR8 B;  4RMA A;  5D2M B;  2ACZ B;  4OHJ A;  2UU7 A;  1B9R A;  2WGS A;  4BVU C;  3U52 E;  3NS8 A;  1WZ0 A;  1F9J A;  1Y8R C;  4ZDV A;  3W2D A;  2KJ6 A;  2FUH B;  4A6Q A;  2K25 A;  2JU6 X;  4WUR A;  4PK1 A;  2V1Y A;  1WXV A;  2MJE A;  1SIF A;  4WAF A;  2KJH B;  1ZE3 D;  4C4V A;  2J4X A;  1E0Z A;  4JE3 B;  2XEW A;  4AUQ C;  3L08 A;  4ZYN A;  2KAN A;  1SE4 A;  4ITK A;  1WXA A;  2YEP B;  1QLB B;  2QIL A;  3A9J A;  1KM7 A;  2CS4 A;  5HFY A;  3AEF B;  5J2R A;  2V3P A;  3IAM 1;  3DHG C;  2OJR A;  2GBR A;  1GG3 A;  2PVO D;  5EE3 A;  4RF1 A;  3OWE B;  4C7Z A;  2BB5 A;  1XXG A;  2KDB A;  4JPS A;  3L0W B;  3AEA B;  4F8C B;  2IO1 B;  4JQW C;  2QEJ C;  3VHT C;  1F2R C;  3C8Y A;  2WS3 B;  4DBG A;  2NBW B;  3UGB B;  4WWN A;  2KQ7 A;  1TTN A;  4M02 A;  2GBJ A;  2K39 A;  3ZYY X;  2KYW A;  1E7V A;  1STE A;  2B3A A;  4JX1 C;  3PHX B;  3QQ8 B;  1C4P A;  5JXV A;  5G5H A;  1F77 A;  4M01 A;  3NHE B;  3B0A A;  3PPA A;  3VRA B;  4ANV A;  4PS7 A;  4FA6 A;  1WR1 A;  4HJG E;  2GBK A;  4LNK A;  3ECI A;  4E3C A;  1WM3 A;  1T0S C;  2O2V B;  5C1Z A;  4WIP A;  5BMG A;  4A55 A;  2BYE A;  2L00 B;  2GRI A;  1AW7 A;  3NZ3 A;  5IKC M;  2K5P A;  1L4Z B;  2LGD A;  3JW0 X;  4HKQ A;  2GBN A;  1LFD A;  2W54 A;  3P42 A;  4W9D A;  4N59 A;  4EZK A;  2LRU A;  3P4P B;  2I38 A;  3AEC B;  3BWU D;  1VLB A;  4G50 A;  3EA6 A;  1EWY C;  3Q8B A;  4RM9 A;  5FR6 A;  1GB1 A;  1D4B A;  1DOI A;  1UBI A;  2DLB A;  4HJK A;  4NJC A;  4K1R B;  4MH0 E;  1SXT A;  5AZH A;  5CX3 A;  3HVD A;  4EZJ A;  1T5X D;  3L54 A;  3IBE A;  1ZKH A;  2LEK A;  4FXC A;  1UGJ A;  1KLV A;  5HHD G;  2W55 A;  1TGZ B;  1FFV A;  3EFU A;  2KD0 A;  4XE0 A;  3DOW A;  2UWQ A;  1IGD A;  3OJ4 B;  2PLP A;  4W9E A;  4P6V F;  2ZNV C;  3GZN B;  3NG0 A;  3OLM D;  3VTV A;  3KW5 B;  1VZ6 A;  3AE6 B;  4LNO A;  1XCQ L;  1WF9 A;  4GDL B;  4M00 A;  3BK1 A;  3EGR A;  2CHZ A;  3TIX A;  3ZJT A;  2NPT A;  2C5L C;  3VUW A;  3AE4 B;  2MBB B;  4FHK A;  3BVM A;  3L13 A;  2LGI A;  3AM9 A;  2RPV A;  3U4E G;  2QDF A;  4ICU A;  1IP9 A;  2EMT A;  3DVG Y;  4AP4 C;  3HUI A;  3IT4 B;  3NUH B;  3TEZ A;  3B2F A;  1TS4 A;  2ASQ A;  3JSV A;  2BWE S;  1TS3 A;  1ENF A;  4GDL A;  3KYC D;  2IJ0 A;  2GMI C;  2ZNV B;  2KKC A;  4HDO A;  1N60 A;  2J0K A;  1H8C A;  3M3J A;  4NAW A;  5AZG A;  1HZ6 A;  3N3K B;  2KWD A;  3BVZ A;  1VDV A;  1LGR A;  3H9D A;  4CO7 A;  3ZIM A;  4BOZ B;  2JZ3 B;  2HD5 B;  5H92 C;  3ETR A;  3LDZ E;  2IY0 B;  2JPH A;  2PTL A;  3TEX A;  1UF0 A;  3PLV A;  3QJZ A;  3I57 A;  4BZA A;  2QSD A;  1EM7 A;  4HDQ A;  1C78 A;  1YMH E;  4WJQ A;  1QF6 A;  1DGJ A;  4AOF A;  4YTM B;  2INN E;  4ZRQ A;  4GDK A;  4IWQ A;  2N9L A;  4MSM B;  1XD3 B;  1P1A A;  3DDC B;  3DWM A;  5HKH A;  4WWO A;  4IG7 B;  1FCC C;  2XK5 A;  4KV2 A;  3W1Y A;  1AWD A;  3P4Q B;  1KTK A;  2KAC A;  2FCM A;  4JIO U;  1YQ4 B;  3A1Q B;  2D07 B;  3AE8 B;  2MQJ A;  2WXN A;  3T8M A;  4RGT A;  4IWO A;  4MJS A;  1UBQ A;  2AL6 A;  3I5J C;  1X1M A;  3NJT A;  4P16 A;  3Q3M C;  2DZM A;  1ACC A;  4C7Y A;  1E7P B;  2L52 A;  4DWF A;  3EC8 A;  1J19 A;  1WSP A;  1SIJ A;  5LLI A;  2LVO A;  3PLU A;  4B95 A;  1PQS A;  3W5U B;  3AXC A;  3R66 C;  2D3A A;  1KRH A;  1WH3 A;  2IDY A;  1T6B X;  2DNF A;  3DHI C;  3E56 A;  4YSX B;  2KFJ A;  4EKU A;  2WXP A;  2ZW1 A;  2G4D B;  2HJ8 A;  3ZRC A;  1XF5 L;  2L76 A;  3S2A A;  1YIW A;  4P1B C;  4KIK A;  4KSL C;  2KWC A;  2LUE A;  1I42 A;  1XLO A;  2D11 A;  4HLE A;  1FO4 A;  2LD9 A;  1V8C A;  4QAY A;  5DPS A;  3TJP A;  2SAK A;  2KXJ A;  3ZNI D;  3NS1 A;  1AYF A;  4RM8 A;  2WXO A;  1XO3 A;  1K52 A;  2O6V A;  4TKN A;  1WGH A;  2BWF A;  3KUZ A;  2DZK A;  2HE7 A;  5T8I A;  3DHH C;  3DQV A;  1TZ1 A;  4ZRI A;  1C79 A;  1E8W A;  3APC A;  1V1P B;  1WRI A;  1WRD B;  2BTE A;  5DPR A;  2HTM E;  3A4R A;  3GOE A;  1UNS A;  4XWW A;  2JRH A;  2H88 B;  1MVK A;  2ZW0 A;  2KC1 A;  1C1Y B;  1WGR A;  1OQQ A;  2L8J A;  4YTP B;  4YSZ B;  2NR2 A;  1SSN A;  4NAM A;  3VH3 B;  1V81 A;  3ZUN A;  2KVR A;  1L6V A;  1R4M B;  2M0X A;  3H8H A;  1NI2 A;  2QJL A;  4G11 A;  4W9F A;  1N62 A;  2DHZ A;  4LDT B;  2JWZ A;  1I4P A;  3H7P A;  1HEZ E;  4F1S A;  3BIN A;  5KHQ A;  3JSV B;  1WGD A;  1SJH D;  1JAL A;  3AE2 B;  2LHD A;  2DAJ A;  2Z59 B;  1Q5W B;  4EUT A;  1JW9 D;  1VCB A;  3HHM A;  3WCQ A;  2XN9 C;  2OOB B;  4I6L B;  3KUC B;  3MFG A;  1RFK A;  1UH6 A;  4US8 A;  3Q3N C;  3N20 C;  1FPY A;  2IGD A;  3VH4 B;  1WJ6 A;  5C23 A;  1FRD A;  2NPT B;  5EE1 A;  2WQY B;  4K3B A;  5E6O A;  3V62 A;  4HCP B;  2N9X A;  4FAD A;  4KZ0 A;  2OHF A;  3ZVV A;  2JT4 B;  1UZX B;  1L7Y A;  1WI0 A;  3NVW A;  2Z0E B;  3WAP A;  5FR3 A;  1ZGU B;  3RZF A;  4YWG G;  4KIK B;  2JZP A;  4KKJ A;  4OW0 A;  1H4R A;  1TS2 A;  2DYM A;  3UQA A;  3PZ7 A;  1PFD A;  5LXI B;  4ZYS A;  2VRR B;  4L2Y A;  1N6Z A;  2KX0 A;  3WA0 A;  4DHJ D;  4YXD B;  1YX6 B;  4II2 B;  1U4A A;  3LYY A;  1HA5 A;  3AE7 B;  4B0E A;  2N1W A;  4PS8 A;  2V0G A;  4ACF A;  4A90 A;  2LVP A;  3WIM A;  2N9K A;  3UF8 A;  1OTR B;  2KO3 A;  1J0G A;  1TBE A;  3C19 A;  3Q8E A;  2HDE A;  3RMK C;  4E71 A;  1BT0 A;  1FXI A;  4KGR A;  5IA7 A;  5IOI A;  2BYT A;  4ZRP A;  2B76 B;  4FBJ B;  2FUG 1;  4R3D A;  4AWJ A;  3A1Q A;  1F52 A;  4FHJ A;  1ZUD 2;  1V1P A;  2L83 A;  2DWQ A;  5TSS A;  2ZCB A;  4A8X C;  2KX3 A;  2K8C A;  1SGH A;  2KN4 A;  3NVZ A;  1TKY A;  1NI3 A;  1KF6 B;  2WX1 A;  3DBL B;  5AUI A;  3TCA A;  2AYO B;  2DYO A;  1VZ7 A;  3QA8 A;  1R7S A;  3TEW A;  4LLG M;  3AE3 B;  2M0A A;  2LMC A;  1F0Z A;  2C9W B;  2M8S A;  1J7C A;  1YN3 A;  5JHB A;  1D6E C;  4MT5 A;  4NY0 A;  5BO4 B;  3SFD B;  1N63 A;  3SDL C;  3DBS A;  2LI5 A;  4NAW B;  1HZ5 A;  2WDR B;  2WP9 B;  1MG4 A;  1T0R C;  3P4R B;  3P1M A;  4WAA A;  3VTW A;  4K3C A;  1V5T A;  4W9H A;  3I63 C;  2GLS A;  3PZD A;  3P63 A;  2K0P A;  4ARC A;  1V5O A;  3UIN B;  3VTU A;  4GGQ A;  2KNB A;  3N32 A;  3R2I A;  1GC7 A;  4IWP A;  3I9V 1;  4I6N B;  5EDS A;  3RI7 C;  4FN2 A;  2IPK D;  2BBC A;  2MBQ A;  2AQ3 B;  4BKS A;  2AWT A;  1YQB A;  3AV8 A;  3AEG B;  3PV1 A;  5LXH A;  2MP2 B;  1T0Q C;  2N7D A;  1NDD A;  1D5X C;  1TIF A;  4NPN A;  3VQI A;  3MTN B;  3AB5 A;  3TBL D;  3VDZ A;  1WJU A;  1J7A A;  3WAO A;  2UYZ B;  2WYQ A;  5H8Y E;  5C3J B;  3ZO5 B;  2KZR A;  4KDL B;  5BMI A;  4BBN C;  2MH7 A;  2R61 A;  2IYD B;  2WDT B;  3IT6 B;  2MLB A;  3H7P B;  1EF5 A;  1FCL A;  4NQK E;  1WX9 A;  3QAQ A;  2K8B A;  3AEB B;  1GPX A;  5D7G A;  5IN7 A;  1RFA A;  4WJN A;  1WX7 A;  4X57 B;  3RNA C;  3RPF C;  3Q14 C;  3O13 A;  2LGX A;  1NVI D;  2I1K A;  3VRB B;  1MHX A;  2N7J A;  1RM6 C;  2LRW A;  1N5X A;  2WXG A;  4IM0 A;  2CHW A;  1SB3 C;  1WYW B;  2FE8 A;  2L32 A;  2QIE B;  1TT5 B;  3A9K A;  3MHS D;  4S17 A;  2AQ1 B;  1Q0W B;  3AE5 B;  5IP4 D;  1ZDV A;  3Q3J A;  3TSS A;  1FXA A;  3SFE B;  1C3T A;  3IFW B;  3V6C B;  2PW9 A;  3A4S C;  2VZK B;  1TYG B;  4G3X B;  2AX5 A;  4MGY E;  3PRM B;  2RSU A;  3PRE A; 
#chains in the Genus database with same CATH homology
 3ZRF A;  2REX A;  2YVC A;  1Z5S B;  2FCM A;  4LJO B;  4JIO U;  3VAW A;  3A1Q B;  3CST A;  4ZRK A;  4K7W A;  2QHO A;  2D07 B;  4DK5 A;  4JL9 A;  3ML9 A;  2DAF A;  2MQJ A;  2D2Q A;  3LJ3 A;  5G55 A;  1RLF A;  3NZU A;  4HXD A;  4MSQ B;  3L10 B;  1Q1O A;  1WGG A;  3T8M A;  2IO3 B;  2KWU B;  4IWO A;  4MJS A;  1UBQ A;  2AL6 A;  2ZCC A;  2MSE D;  3AUL A;  5JZE B;  1GNU A;  1X1M A;  3W1S C;  2DZM A;  2PPH A;  3X0W A;  2C7H A;  2IO0 B;  4DWF A;  2DZI A;  2MX2 A;  3EC8 A;  1J19 A;  1P0R A;  4GN1 A;  5LLI A;  2LVO A;  3PLU A;  4B95 A;  4B6W A;  4PYZ A;  3ENE A;  4FJY A;  2G45 B;  1V9J A;  1WE7 A;  2MBE A;  4WQO B;  1PQS A;  1OEY J;  2BF8 B;  2KLG A;  3C0R B;  4KSK C;  3ZTD A;  5DCN A;  3AXC A;  3R66 C;  2K8H A;  4I6P A;  4W9J A;  2ZZP B;  4GB9 A;  2O6V D;  2LGY A;  2DEN B;  2IBI B;  1WH3 A;  2RR9 A;  1UD7 A;  3VUY A;  3TL5 A;  1EUV B;  2FAZ A;  4KZC A;  3QX1 A;  1WIA A;  1RRB A;  2KFJ A;  3PGE A;  3RZW C;  4EKU A;  4DDI D;  2G4D B;  2LAS A;  2HJ8 A;  3ML8 A;  2LJ5 A;  4CHK A;  3ZRC A;  2L76 A;  4PYU A;  3S2A A;  1YIW A;  3AI5 A;  2CHX A;  3ZTC A;  4KIK A;  1G6J A;  4J6I A;  3MJW A;  3PRP B;  2KWC A;  4KSL C;  3IG3 A;  2LUE A;  4A20 A;  3Q3F A;  1I42 A;  3CMM B;  1YJ1 A;  2D11 A;  4NNJ B;  4HLE A;  3EHV A;  3H1U A;  1WMH B;  2AEH A;  3K9O B;  5GMV A;  3ZKJ C;  2LD9 A;  3UIP B;  2KFK B;  1WXS A;  2C60 A;  2WX0 A;  5DPS A;  2KJR A;  2K6Q A;  1OQY A;  2LVQ A;  3TJP A;  3QCA A;  4K7U A;  3QHT A;  4FJV B;  2KXJ A;  1KOT A;  4K81 A;  4M8M A;  3ZNI D;  4RM8 A;  1V2Y A;  3PTF C;  3GZN I;  2MA9 B;  2O6V A;  2I1J A;  4TKN A;  3OJ3 A;  1WGH A;  2BWF A;  1CMX B;  5TR5 A;  3KUZ A;  1IYF A;  2DZK A;  3M63 B;  2HE7 A;  2O2V A;  2D10 A;  2BYV E;  2Z0D B;  3B08 A;  1R4N I;  3ZDM C;  2C7N B;  3DQV A;  1TZ1 A;  2BYF A;  4ZRI A;  1IPG A;  4DHZ E;  5CHW A;  1E8W A;  2ZVN A;  3APC A;  5E6P A;  2MCN B;  2L3Z A;  2W9N A;  3N30 A;  1WRD B;  2KDE B;  2N7E A;  2ZPY A;  5DPR A;  1LXD A;  3HK0 A;  4MGK E;  3I3T B;  3A4R A;  3GOE A;  1WZ3 A;  5CHV C;  4HPM B;  2JRH A;  2L7R A;  1GJZ A;  2MWS B;  4IUM B;  2KC1 A;  3CF6 E;  3TMP B;  1C1Y B;  1P98 A;  1WGR A;  2EMS A;  3PS6 A;  4LJP B;  4HVB A;  3PHW B;  3BY4 B;  2L8J A;  2XBB C;  2NR2 A;  2PE6 B;  4MEM A;  3VH3 B;  1V81 A;  3ZUN A;  3DBH I;  4ANW A;  4MEL A;  2KVR A;  2R2O A;  3VVW B;  4WJP A;  2ZJD A;  2JF5 A;  1LQB A;  2M0X A;  5D6J B;  3M95 A;  2R2Q A;  2V4L A;  4WWP A;  1NI2 A;  1WE6 A;  1P3Q U;  4M0W B;  4G11 A;  4W9F A;  2DHZ A;  4LDT B;  2JWZ A;  2GOW A;  1AAR A;  4BFR A;  4JLC A;  3UIO B;  3H7P A;  4JGH B;  4F1S A;  2KMA A;  3BIN A;  4BOS C;  5KHQ A;  4RMA A;  3JSV B;  1WGD A;  1XQQ A;  2FCS A;  2JY6 A;  2G4S A;  2JZZ A;  3DBL I;  5D2M B;  4XX5 A;  4BVU C;  4II3 B;  2DAJ A;  2Z59 B;  1Q5W B;  4EUT A;  4IM3 A;  2XK5 B;  2N9E B;  3NS8 A;  1WZ0 A;  1F9J A;  1Y8R C;  2HTH A;  3DVN U;  4G0N B;  4ZDV A;  1VCB A;  2LXC A;  3HHM A;  1GC6 A;  2KJ6 A;  2FUH B;  4HPL B;  1WJN A;  2EKE C;  2K25 A;  2KOX A;  2OOB B;  4I6L B;  3HIZ A;  3KUC B;  2V1Y A;  1WXV A;  4TQ0 A;  1SIF A;  1UH6 A;  2KJH B;  3A9J B;  3VH4 B;  2JRI B;  1WJ6 A;  5C23 A;  2A4Z A;  3RT3 B;  2XEW A;  4AUQ C;  1UEL A;  2NPT B;  4M8N A;  3L08 A;  1K8R B;  4GU2 A;  4ZYN A;  5JH5 C;  3HM3 A;  2BGF A;  5E6O A;  2KAN A;  3V62 A;  4GMV A;  1WXA A;  2N9X A;  4HCP B;  4FAD A;  4KZ0 A;  4CYE A;  3A9J A;  3ZVV A;  3APD A;  1WMH A;  2JT4 B;  1UZX B;  2J0J A;  1KM7 A;  1L7Y A;  1M94 A;  2CS4 A;  2LZ6 A;  4ZRJ A;  4ANU A;  1WI0 A;  5J2R A;  1RAX A;  4A3O A;  2M4N A;  2Z0E B;  5IAA C;  3WAP A;  2IY1 B;  1ZGU B;  3RUL A;  3RZF A;  4BBN F;  2ZVO A;  2OJR A;  4KIK B;  2RGF A;  4NJ7 A;  4EFO A;  2FNJ B;  2GBR A;  1H4R A;  1GG3 A;  4NQL B;  2DYM A;  3RYT A;  3UQA A;  2FCN A;  2MBH A;  3K9P B;  3D32 A;  4LCD E;  5LXI B;  1WXM A;  2WWZ A;  2JXX A;  1ISN A;  3QC8 B;  4IW0 A;  2VRR B;  1HE8 A;  2MBO A;  2MW5 A;  2KX0 A;  2KDF B;  4MGZ E;  3WA0 A;  4DHJ D;  1E8X A;  1YX6 B;  5G2N A;  4II2 B;  1NBF C;  1U4A A;  2KFK A;  2KDB A;  2D3G A;  2KQS A;  3L0W B;  2BKF A;  4F8C B;  1WR6 E;  2FCQ A;  4BKT A;  2IO1 B;  2N1W A;  2V3S A;  4JQW C;  4PS8 A;  3U8Z A;  3VHT C;  2LVP A;  2KDI A;  3WIM A;  4DHZ B;  4GXB A;  3UF8 A;  1OTR B;  2KO3 A;  3R7Q A;  2PJH A;  4BKS D;  1J0G A;  3QK0 A;  1TBE A;  3RCZ A;  4DBG A;  2NBW B;  3UGB B;  3ZNG C;  3L16 A;  2KTR A;  4WWN A;  2KQ7 A;  1TTN A;  1V6E A;  4W9K A;  4E71 A;  2DYB A;  1BT0 A;  2JUO A;  2GBJ A;  1GUA B;  1V80 A;  4KVG B;  5IA7 A;  3VXW A;  2K39 A;  2MP2 A;  4DXA B;  3PRZ A;  1E7V A;  4P7I A;  3A33 B;  4FBJ B;  1OEY A;  1WX8 A;  2O6V B;  2B3A A;  3DPD A;  3PHX B;  4EOY A;  4AWJ A;  3QQ8 B;  3A1Q A;  3NHE B;  3B0A A;  3PPA A;  4ANV A;  4FA6 A;  2KC2 A;  4PS7 A;  2ZPN A;  1WR1 A;  4FHJ A;  3CSF A;  2RPQ A;  2GBK A;  4XC2 A;  1YD8 U;  3ECI A;  4DHJ B;  3DVN V;  2KK8 A;  3SHQ A;  2ZCB A;  2KX3 A;  2K8C A;  1WM3 A;  4W9I A;  4E3C A;  1I35 A;  1SGH A;  2O2V B;  3PSE B;  3QWZ B;  5C1Z A;  1J8C A;  3WAL A;  2BYE A;  2L00 B;  2WX1 A;  3AU5 A;  1QZE A;  3HM6 X;  2K1F A;  2Y5B B;  4N9F 4;  2LGD A;  3JW0 X;  3KYD D;  4HWI B;  2GBN A;  3TCA A;  1E8Z A;  1LFD A;  2AYO B;  2A5U A;  2DYO A;  4W9D A;  3QA8 A;  5D94 A;  4EZK A;  2AL3 A;  3KUD B;  4EZL A;  3ALB A;  3O65 B;  3ZNH B;  2LRU A;  2J0M A;  3ZW3 A;  5J17 A;  2IZV B;  1V86 A;  2NCN A;  4ASW C;  2IO2 B;  4G50 A;  4GIV A;  4HCN B;  3VUX A;  1R4M I;  4MGI E;  4RM9 A;  4W9L A;  5FR6 A;  2M17 A;  5CHF A;  1UBI A;  4HJK A;  2C9W B;  2M8S A;  4K1R B;  4MH0 E;  5AZH A;  4ICV A;  2FID A;  3V60 A;  2KWV B;  4E74 A;  2KTR B;  5CX3 A;  1OGW A;  3JYU A;  1KJT A;  2KMC A;  4OVU A;  4EZJ A;  5JHB A;  2LXA A;  4NY0 A;  5BO4 B;  3L54 A;  3SDL C;  3DBS A;  2RD0 A;  1ZKH A;  2LI5 A;  3IBE A;  3NY5 A;  3OAW A;  2DX5 B;  4NAW B;  3A9K B;  3P2B A;  1KLV A;  1TGZ B;  1ZW7 A;  2KHW B;  4WAA A;  1SE9 A;  1E8Y A;  4W9C A;  2GBM A;  3VTW A;  4F7Z A;  3EFU A;  2KD0 A;  3DOW A;  4FJZ A;  2BKR B;  5L83 A;  1V5T A;  4W9H A;  3V61 A;  1LM8 B;  3DVG X;  3JVZ X;  2UWQ A;  3SU8 X;  3QIJ A;  2KTF A;  3OJ4 B;  3PZD A;  3W1S A;  4HK2 A;  1E7U A;  4W9E A;  2L0F A;  2ZNV C;  2ZEQ A;  3DCG A;  3R7R A;  1S1Q B;  3VFK A;  2LWP A;  1D3Z A;  1V5O A;  1YX5 B;  3OLM D;  4GDK B;  4GGQ A;  3UIN B;  2KNB A;  1UGM A;  1WM2 A;  3KW5 B;  3VTV A;  3VTU A;  3N32 A;  4IC7 B;  3AU4 A;  1EO6 A;  2YLM A;  5JHA A;  2KLC A;  2K6D B;  3L17 A;  4GOC A;  1WF9 A;  5AEK B;  1E90 A;  2KN5 A;  2CU1 A;  5J18 A;  1GC7 A;  4IWP A;  4PS3 A;  1S3S G;  4I6N B;  3U30 A;  5EDS A;  4AJW A;  4FN2 A;  4GDL B;  1EF1 A;  1VD2 A;  2MBQ A;  2CHZ A;  3QAR A;  3TIX A;  5DPT A;  3M62 B;  5CTR C;  5AZF A;  4BKS A;  2NPT A;  2C5L C;  3NOB A;  3T9L A;  1A5R A;  3VUW A;  2AWT A;  2CR5 A;  4WJO A;  1YQB A;  2MBB B;  2NBV B;  2FIF A;  3PV1 A;  4AJY B;  4FHK A;  1JRU A;  2MP2 B;  2N9P C;  4IM2 A;  4KDI C;  5LXH A;  4NJ6 A;  3L13 A;  2N7D A;  1NDD A;  2J7Q B;  3ZNZ B;  4XZ4 A;  1P9D U;  1WGY A;  4FUL A;  3ZLZ A;  2L0T A;  4ICU A;  4NPN A;  3U7D A;  2EMT A;  3MTN B;  3VQI A;  1IP9 A;  1E5W A;  3DVG Y;  4AP4 C;  3EEC A;  3TBL D;  3B1L X;  3VDZ A;  1WJU A;  2L05 A;  3WAO A;  2UYZ B;  3PT2 B;  4URK A;  2WYQ A;  2M1M A;  2ASQ A;  3JSV A;  4MDK E;  3ZO5 B;  2BWE S;  2KZR A;  3H7S A;  4KDL B;  4BBN C;  3X23 A;  2N1V A;  3H6N A;  2PEA A;  2PE9 A;  3V6E B;  2IYD B;  4GDL A;  2WDT B;  3KYC D;  2GMI C;  2ZNV B;  2MLB A;  2KKC A;  3H7P B;  1EF5 A;  4HDO A;  4MM3 A;  4B9K A;  1H8C A;  2J0K A;  4FLH A;  4NQK E;  1WX9 A;  3UQB A;  3IHP C;  3M3J A;  3QAQ A;  4NAW A;  4EEW A;  5AZG A;  2K8B A;  3N3K B;  3H9D A;  5L95 C;  5D7G A;  4CO7 A;  1RFA A;  4WJN A;  3ZIM A;  4BOZ B;  1WX7 A;  2JZ3 B;  4BKG A;  3PVL A;  4X57 B;  2G3Q B;  2N4F A;  1T0Y A;  2NBU A;  2HD5 B;  3KVF B;  3LDZ E;  2IY0 B;  2JPH A;  2BPS A;  3RUI B;  2C7M B;  1MG8 A;  1FXT B;  2LGX A;  2MRP A;  3APF A;  2I1K A;  3RD2 A;  3ZDT A;  3PLV A;  2LRW A;  2NS5 A;  4IM0 A;  2CHW A;  1WFY A;  1WYW B;  3KH0 A;  3QJZ A;  4GSW A;  3DBR I;  3A9K A;  2DZJ A;  3WAM A;  4OVV A;  3MHS D;  1WY8 A;  4HDQ A;  1XT9 B;  4LDT D;  4WJQ A;  2NVU I;  3WAN A;  5E6N A;  4AOF A;  1Q0W B;  3ONS A;  4YL8 A;  3IVF A;  2JVC A;  2CKH B;  3Q3J A;  3SD5 A;  3R3M A;  4GDK A;  4IWQ A;  4MSM B;  4TUU A;  1XD3 B;  1C3T A;  4MJS B;  3IFW B;  1P1A A;  3V6C B;  3A4S C;  4W9G A;  5DPW A;  5KHO A;  4ANX A;  3DDC B;  1Z2M A;  5HKH A;  4WWO A;  4G3X B;  4A3P A;  4DDG D;  4IG7 B;  1WJ4 A;  3NZS A;  2XK5 A;  4TV3 A;  4MGY E;  1V49 A;  3PRM B;  4K7S A;  4KV2 A;  3W1Y A;  1L2N A;  2RSU A;  4TQ1 A;  3PRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...