2IGHA

Determination of the solution structures of domains ii and iii of protein g from streptococcus by 1h nmr
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
LTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title Determination of the solution structures of domains II and III of protein G from Streptococcus by 1H nuclear magnetic resonance.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
molecule tags Immunoglobulin-binding protein
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1992-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ighA00
2KDMA 5JXVA 2ZW1A 3FILA 5BMGA 4GLSC 1HZ6A 3MP9A 2LHEA 2OEDA 2KWDA 1MI0A 2LHDA 4KGTA 2JSVX 2RPVA 4OZBA 3V3XA 1HEZE 4D2KA 5HG2A 2I2YA 1D4BA 1PGXA 1K50A 1K53A 4IOIE 1MVKA 2KN4A 2QMTA 1P7FA 2GB1A 1K51A 2IGDA 1HZ5A 2PW9A 1FD6A 1GB4A 1MPEA 4MACA 2N7JA 4KGRA 1IBXB 2N9LA 2J53A 1QKZA 2GI9A 2ZW0A 1IGDA 4OZAA 2K0PA 1FCCC 5HI1A 2PLPA 4OZCA 2PTLA 1YNTE 5BMHA 2ONQA 2RMMA 1MHHE 2QSDA 1KH0A 1JMLA 1XF5L 2I38A 1MHXA 3UI3A 1YMHE 2NMQA 5HHDG 2JXTA 4HJGE 1XCTL 3GB1A 2KQ4X 1EM7A 2LUMA 3FILB 1IBXA 2JU6X 1K52A 1P7EA 2IGGA 1GB1A 4KGSA 1F2RI 1UWXA 2LGIA 1FCLA 1IGCA 2J52A 1ZXHA 2IGHA 2KACA 1C9FA 4WH4A 1XCQL 1Q10A 1PGAA 4HKZE 4IKGA 2N9KA 1PGBA 1F2RC 2EELA 2JZPA 2JWUA 5BMIA 2ON8A 5HFYA
chains in the Genus database with same CATH superfamily
3KWVA 3Q2AC 1JRUA 2KDMA 2ZPYA 5JXVA 2BS3B 2OOBB 4PS8A 1Y8RC 2WXFA 5J18A 5JHBA 4KIKB 1HXYD 1XEEA 2C7HA 1E7UA 4HEA1 4LDTD 3MP9A 2KFKA 1XLOA 4MJSA 2JT4B 3GZNB 3M95A 2MBEA 4KGTA 1L0VB 2KYWA 1KJTA 5IAAC 2LEKA 1S3SG 2O2VA 3I5JC 3KLSX 2SEBD 2I2YA 2KANA 1NI2A 1D4BA 2FBWB 1P7FA 1RFKA 1VZ8A 3DBHI 1KLUD 3CIRB 4DWFA 4LNNA 1GUAB 1J8CA 2L7RA 4IM3A 1VZ6A 2RDGA 1BXTA 2L0FA 2LVQA 4OZAA 4JQWC 3RZFA 4P7IA 1J19A 4WURA 1WSPA 4KX6B 3PT2B 2K5PA 5C3JB 3RNGC 2I38A 2FE8A 2IO1B 2NMQA 3AXCA 1QF6A 1SE2A 4KDIC 2ACZB 4EZJA 3Q69A 1G6JA 3E56A 1EUVB 2NVUI 3N9YC 4A20A 3QC8B 4G11A 1XXGA 2EKEC 4C7YA 3A9JB 2KJ6A 3H7PB 1ZXHA 1C4CA 4IWOA 1C9FA 2WXHA 4LK0M 1H4RA 1JWMD 3BY4B 2KLGA 3RN9C 4OVZA 4RH6A 4LTUA 2EELA 4TQ1A 5G55A 1KLGD 2MSED 2WXGA 4XYCA 3AE7B 3FILA 5C1ZA 3ZNID 2L32A 1FNWA 1UGJA 4W9FA 2FCQA 4PK1A 3APFA 3MFGA 4GOCA 4DHJD 3WA0A 5BYSA 3L08A 1N6ZA 2MHJA 1SBBB 1E9MA 1DOXA 2MEKA 2BWFA 2KAJA 2J0MA 2PJHA 2KTRA 4ZRKA 2CU1A 2KWCA 1C1YB 1PGXA 4EEWA 2BS2B 3IAS1 4NAWB 3RD2A 2NPTA 2K25A 4MT5A 4B9KA 3PRPB 4MACA 2LXAA 1E8YA 4K7SA 2N9LA 2KQ7A 3RNFC 5G5GA 2D10A 4GU2A 1V49A 1SE3A 2DENB 2FCSA 2J4XA 4BZAA 3UGBB 5AZHA 1STEA 3R8BA 4E3CA 2PE9A 4P1CC 3H1UA 1DGJA 4WQOB 3ZJTA 2ZVOA 1FM0D 4Q2JA 3Q8FA 4ASWC 3LJ3A 5D3DA 4OVVA 4EOYA 1AWDA 1L0XB 3RI7C 4ANWA 4US8A 2RR9A 3GB1A 2AL6A 2Y5BB 2N9XA 3PLUA 3DVGX 1I4QA 3L4PA 1UGMA 3AE3B 3U7DA 3UF8A 1F2RI 1RAXA 1Y56A 1YJJA 2BB5A 5CHWA 3NRZA 1XCQL 1TKYA 3ENEA 3DHIC 3PV1A 4N58A 1FO4A 4IW0A 3ECIA 1YQ3B 2RPQA 3KW5B 3AEFB 3VHTC 4LNFA 2ZW1A 4GMVA 5EE9A 2WDQB 4L1BA 2KZRA 4GLSC 4GB9A 4KSKC 4FA6A 3KYDD 1E90A 2K3UA 3EGRA 4B6WA 1ZPSA 1A70A 3U52E 3AE9B 3U7ZA 5DPSA 2W9NA 4D2KA 2Z0DB 3C8YA 3ZGZA 1KRHA 1MVKA 4M02A 1V1OA 1WGGA 4IUMB 1ZKHA 3ABVB 2INNE 1YJIA 2JZZA 2NS5A 3K9OB 2W82A 1TIFA 1P9DU 1JROA 1T5XD 1V5TA 4RF0A 2GBNA 2QDFA 1C4AA 3ZJVA 1GG3A 2ZJDA 5AEKB 1YNTE 1PQSA 3NVZA 2IO2B 4K1RB 1JMLA 4W9LA 3BYYB 2DLBA 4C4VB 3MJWA 5E6PA 3ZXRA 5GXGB 3WANA 2KMCA 1ESFA 3NY5A 2V3SA 2EMSA 4MSQB 2SAKA 1Q5WB 4G50A 1LFDA 2DWQA 1V1PB 4NY0A 2JWUA 2N7DA 5BMIA 3V61A 2DYOA 1TGZB 1YQBA 2ON8A 1FEHA 1GC7A 3N1YC 2KMAA 4R3DA 1S1QB 3GE8C 4HKQA 3VAWA 4XC2A 4HJKA 4LLGM 3EFCA 3IXSA 3WALA 2WX1A 1SB3C 3Q3FA 3BVGA 2V1YA 2BTEA 4GDKB 2ZNVB 2BPSA 4OZBA 5E6NA 3ALBA 4XWTA 1C4PA 5HG2A 3VTUA 1A5RA 4GSWA 1LQBA 3I3TB 3L10B 2ZNVC 2I1KA 4ZRIA 2J42A 2OJWA 4KZ0A 1ET9A 1WXMA 4FBJB 1HQRD 3QQ8B 3APCA 3W1SA 2K8CA 1IBXB 1TS3A 4NNJB 2IY1B 3L13A 1CQVA 3KYCD 4PS3A 2BKRB 1ISNA 2LMCA 2B76B 3RUIB 3ZNGC 4C56C 1L4DB 1E8ZA 2VH1A 3R3MA 3ZNHB 1TY2A 5EE3A 4AJYB 4CHKA 3N1ZC 2DNFA 3TEZA 1IPGA 1DOIA 4NJ6A 2NBWB 2JU6X 3VVWB 5D3IB 3IFWB 1T0RC 4C80A 1P98A 1GPXA 3HVZA 2V3NA 3IBEA 1KM7A 1OEYJ 2WP9B 4G3XB 1WGKA 2DX5B 2DAJA 2IDYA 3Q8EA 3NZSA 1BT0A 4LJPB 3RULA 2KDIA 4L23A 1J7CA 2JZPA 4BOZB 1WF9A 4URKA 2CHZA 4TUUA 3U2SC 2GBKA 3DVNU 4JLCA 1E6EB 3LXFA 3SFEB 1F9JA 3JSVA 4YWGG 1SE4A 4NQKE 2ASQA 4B0EA 2WXIA 4M0WA 3HM6X 3GE3C 3NJTA 1TS4A 3AM9A 1PDXA 1E8XA 3MHSD 5H92C 4GDLA 5KHOA 3TJPA 3R7QA 5BYRA 4ZRQA 4YT0B 2AWTA 3QJZA 2HE7A 2BGFA 2ICIA 2M19A 3A9KB 1FRRA 2L05A 2L00B 1UNSA 4IWQA 1WXAA 3TSSA 4USAA 3T3OA 3OJ3A 2W55A 4LNKA 2I1JA 4ZYNA 3AEAB 5JZEB 1QKZA 3JVZX 4TSSA 1GOZA 3A4RA 1V81A 4BVUC 2CHXA 2BYTA 1P3QU 2WDRB 1U4AA 1WGRA 2Q5WD 3VTWA 3APDA 1YIWA 5EE0A 3NZUA 1QOAA 3AEGB 1HE8A 3H6NA 2GBJA 2N9EB 4BKGA 3V60A 3QARA 2YEPB 2KX0A 4OHJA 4RMAA 1CMXB 2WQYB 1NDDA 5DCNA 4MGIE 2XEWA 1GAQB 3W5VB 3NZ3A 1CZPA 1T0SC 3PGEA 1FCLA 4AOFA 5I4DA 2IGHA 1D6EC 2KN5A 2V3PA 2D3BA 4TMAB 5LLIA 1K8RB 3RZWC 3UIPB 2K9XA 5D7GA 2B3AA 2CR5A 1V5OA 4KV2A 1L2NA 2AX5A 2MH7A 4MDKE 1J7BA 4AUQC 3ZW3A 2PIAA 2E3TA 1MG8A 2BW2A 2MJEA 4KVGB 2AEHA 4YSYB 2KDEB 2JY6A 3I9V1 1LM8B 2OEDA 3KQ4A 4HDOA 3RNCC 4HCNB 4YSXB 1EWCA 2BVCA 3IVFA 2PKOA 3TUOA 1SXTA 1XLPA 4JL9A 1QZEA 4BOSC 4ZHOA 2WXQA 2K1FA 3NUHB 3DBHB 4EE2A 2MA9B 3TEXA 4FJZA 2XK5B 3P4SB 3QX1A 3SR6A 2GI9A 4BBNF 1N5XA 1VD2A 3ZO5B 3RT3B 1TTNA 1FNVA 2ZVNA 5J2RA 1WYWB 4RGOS 4JX1C 2N1VA 2V0GA 3N32A 2IY0B 2KJHB 3X23A 3H7SA 3C0RB 3HK0A 4HPLB 3VUWA 1YMHE 4JIOU 1CK1A 1XCTL 3A1QB 4N6EB 3B9JA 3OLMD 3KWLA 1KFYB 1KOTA 2PVOD 4RGMA 3L0WB 2MCNB 2FCMA 2JX5A 2AYOB 3KUDB 1XLQA 4HCPB 1XT9B 1OQYA 1M94A 2IZVB 1C77A 3IHPC 3QWZB 3AE8B 2KC1A 3AEDB 4XX5A 1N5WA 3PRZA 2AL3A 2N9KA 3CMMB 3ZTDA 1GJZA 2N9PC 1B9RA 4DQOC 1YX5B 3TL5A 1MG4A 1NEKB 1F0ZA 5BMGA 5D94A 3P1MA 4P6VF 2WXKA 2LJIA 1WY8A 5JHAA 2KO3A 2MBOA 5CX3A 1ZUD2 2M0AA 3A33B 3BVZA 4MM3B 4WJPA 5TR5A 1R4NI 2D3AA 4II3B 4J3OD 4GN1A 2KDBA 3MJ5A 1MFWA 1QOGA 3ZLZA 4M8MA 1H8CA 4EFOA 1JWSD 2D07B 1I4RA 4US9A 2CJNA 4MH0E 4DDGD 4W9CA 2G4DB 4YTMB 2WXPA 1Z5SB 3DWMA 2O6VB 1AYFA 2KVZA 4NPNA 1J7AA 2INPE 1IGDA 2DHZA 2QIEB 4PS7A 2K0PA 3PHWB 3CSTA 5BYQA 4EZKA 1TYGB 1WMHB 1WM3A 4WJNA 2IO0B 2EKIA 2FUHB 1KH0A 3RCZA 1WR1A 3L54A 3QIJA 2LXCA 3JYUA 1J0GA 3I63C 3KH0A 1TJEA 2JXTA 2D11A 4XGAB 1TS5A 3VRAB 2LI5A 4JGHB 4HK2A 1JCKB 1EM7A 4ZHPA 1T0YA 4UDUC 3WAMA 2MX2A 3HRDD 2VH2A 4M01A 2KFKB 3KVFB 4MJSB 3WCQA 1EF5A 3OWEB 3DOWA 3AE1B 2H89B 3D32A 4YTPB 2D2QA 4FN2A 2QILA 1FMAD 1XLNA 2O2VB 1F2RC 1F77A 1UH6A 3VQIA 1WXQA 2CHWA 3UQBA 3DHGC 3A4SC 1SE9A 4ZDVA 3QK0A 2VZKD 1HZ6A 3VUYA 2X8XX 3K9PB 3HM3A 5IP4D 1OFFA 5DPWA 2KWDA 4KZCA 1GNUA 1TKGA 2KJRA 1TY0A 4L2YA 2RDBC 3ZIMA 2BYVE 3PREA 1FXTB 1QT9A 2KN4A 3Q8AA 3DHHC 3ZRFA 3T8MA 1RLFA 2WX0A 2G3QB 4ZOHC 5FKAC 1V97A 2N7EA 4N59A 1E0ZA 3J9CA 2JF5A 1I4GA 1MPEA 2JXXA 2KC2A 3HVDA 5IN7A 3O65B 2GLSA 2WU2B 1Z2MA 2W3SA 2WWZA 4A8XC 5KHQA 5MPOA 1I7HA 2PLPA 2PE6B 2FNJB 2KT7A 3AEEB 4OZCA 4GIVA 3VXWA 4BKSD 2BB6A 3ZXVA 1JWUD 3EC8A 2GBMA 2NTSA 1T6BX 4ZYSA 3HIZA 1VLBA 2MW5A 1HA5A 2JPHA 4EUTA 2PPHA 2BT6A 3AB5A 3UIOB 3FILB 3PTFC 1NI3A 3B08A 4ARIA 2L0TA 1YJ1A 2YVCA 4LNIA 2PMVA 1IGCA 1RFAA 3PPAA 3MC9A 4PYUA 4DXAB 3RNBC 2DZMA 2UYZB 2Z0EB 5AZGA 2M56B 1Q10A 3NS8A 4A3PA 4B95A 4RGTA 2KTRB 1EF1A 3URYA 3RMKC 4MSMB 2E6XA 2M0XA 4WWPA 4BKTA 4CQNA 2NPTB 3T9LA 3L17A 3EECA 2TSSA 1L5PA 1SEBD 3PHXB 1WH3A 2PVGC 2LHEA 2WXNA 4K7WA 4CYEA 2G4SA 1VJKA 2L52A 3H9DA 2KLCA 2K8HA 2NTTA 3V6EB 1C76A 4XDCA 1TT5B 1MJDA 3RNEC 3DBRI 3DBLI 3AE6B 5J17A 1YN3A 1VRAB 2N7JA 2K39A 5CHVC 3IG3A 2KD0A 4KSLC 2J53A 1E10A 3VR8B 4FXCA 2LFIA 5HKHA 2KTFA 1UWMA 3B0AA 2JVCA 2DZKA 1I42A 3S2AA 2PTLA 2L83A 4FADA 1UELA 2RMMA 4MH8A 3B1LX 4WWOA 3PRMB 2QSDA 4XE0A 2OJRA 3VR9B 1B1ZA 4HJGE 3QCAA 3CF6E 2FUG1 2KQ4X 1KTKA 1RWSA 5BO4B 2K22A 2WU5B 1D3ZA 1LGRA 1UWXA 4BFRA 3OG5A 2KACA 2KWVB 1DYQA 2WDTB 4WH4A 1WXVA 1N61A 3AN1A 4HKZE 2N4FA 1PGBA 2MJDA 1FRDA 2LVPA 4H2AA 2QC8A 1C79A 2WYQA 4LDTB 3VRBB 3ETRA 4KKJA 1GC6A 3Q3NC 3FC4A 4K3CA 3WIMA 4P16A 3WAOA 4LCDE 3R2IA 1I4PA 1ZW7A 4EKUA 3UQAA 2MP2A 2KVRA 2JRHA 1QILA 2DBYA 4PT5A 1KF6B 2LUEA 2GBRA 2MBQA 3SU8X 1EO6A 4WJOA 3AULA 4IOIE 5CTRC 3PZ8A 1ZOYB 4XDDA 4BBNC 4FJYA 1ZXIA 4HWIB 4KIKA 1TS2A 3ZRCA 2BQQA 4TKNA 3LDZE 4RM9A 3NHEB 2IBIB 4W9JA 1XO3A 4IC7B 1PUTA 4S0RA 1HTQA 1YD8U 2GRIA 3TIXA 2A5UA 1TBEA 3HUIA 1WJ6A 1N62A 2LRWA 4LJOB 2NBUA 3W1YA 1LO5D 1ENFA 2R2OA 3AECB 1JWBD 5IO9A 1E7VA 2LUMA 4BKSA 3SD5A 1WX8A 1GB1A 5C2TB 2PEAA 2LGIA 2K6QA 1SGHA 3ZYYX 2J52A 2LGDA 3ML9A 3Q8CA 3JW0X 4JWUC 3AEBB 1C78A 3GP7A 3AMZA 3BK1A 4CO7A 1WRDB 3U30A 2N0SB 2IPKD 5C23A 3PZDA 4AP4C 1QOBA 4DHJB 3U4EG 3VUXA 1WXSA 2BKFA 3M63B 4M8NA 2M17A 2QCZA 1T3QA 3MC0B 5E6JA 4A9AA 4FJVB 1SSNA 2R61A 4WWNA 3A9JA 3H7PA 2UWQA 1R4MI 1V8CA 5DPTA 1YQ4B 4G0NB 3W1SC 1UUPA 3Q3MC 3TEYA 3LYYA 3RPFC 4OVUA 1P1AA 3GS2A 3W9CB 1F52A 4IM2A 3BWUD 2LWPA 3VH4B 1K53A 2LZ6A 4HDQA 2QMTA 4RNAA 4BAXA 2IGDA 4FULA 2VRRB 3V6CB 1FD6A 5AUIA 3RNAC 5G5HA 4I6PA 3P42A 1EU3A 4AWJA 1WJUA 2V4LA 3P4RB 1M4VA 3EUB2 2MQJA 2WHIA 4DK5A 3FKYA 4W9HA 4W9DA 5D2MB 5HI1A 2JUOA 2K6DB 1I35A 4WQMA 1MHHE 2DZJA 2W3RA 2V4IB 1F1HA 4NAWA 2XNAC 1ZE3D 3TMPB 1JW9D 2BYEA 4N9F4 1RRBA 2HJ1A 2JZ3B 3JSVB 2CKHB 1QLBB 5L95C 1P7EA 1ET6A 4M0WB 4IDIA 4ANUA 3NVVA 1D5XC 3H8HA 2ZCCA 5L83A 2LVOA 5G2NA 4YL8A 4GDLB 2R2QA 2KXJA 4IKGA 1QQRA 2UU7A 2J0JA 2XN9C 5LNK1 1OQQA 2RGFA 1DOYA 1AW7A 4WAAA 2KNBA 3M62B 5EDSA 1ZDVA 3T3NA 3GZNI 4PYZA 3ZTCA 4A3OA 2N1WA 2WXJA 1BMLC 4MEMA 4W9GA 2HD5B 3EA6A 1CJEA 1R4NB 3V3XA 3Q14C 5H8YE 1QOFA 1WJNA 1UZXB 3N3KB 3BK2A 4NJCA 2FIFA 4MELA 2PW9A 1C3TA 3MHZA 1RM6C 1AN8A 4P1BC 4DDID 3C19A 4DBGA 4RFBA 2ZW0A 3ZDTA 2MRPA 2WXOA 1E8WA 4DHZB 3O13A 2KKCA 3VFKA 3BIID 3DWGC 3OJ4B 3Q8BA 4K81A 3PSEB 2BS4B 2GMIC 3IT4B 2C9WB 2YEPF 3AH7A 1MHXA 3R7RA 5JH5C 2WS3B 1V86A 1UD7A 2Z8LA 4MGYE 3QA8A 4JPSA 1K52A 1SIJA 2IGGA 4HLEA 1WGDA 4FLHA 1TKEA 4I6NB 2RDHA 4YXDB 3SFDB 2HTME 3N1XC 2H88B 4YSZB 1NYRA 5EE1A 4AQ7A 1WYGA 2MJ3A 4C4VA 2RD0A 2L8JA 2M1MA 3R2TA 4FHKA 3P2BA 2JQRB 2LGSA 2L1AA 3BZDB 4DXGA 3Q6BA 1L6VA 1OEYA 1N60A 2Y3AA 3OAWA 4HROA 2MLBA 2WDVB 3N30A 1E5WA 2WLBA 1YN5A 2JSVX 2AQ2B 3DBSA 3AI5A 3DQVA 1P0RA 4S17A 3NG0A 4IWPA 1V1PA 2D3CA 2MBHA 4AS1A 2QEJC 1N63A 2OHFA 2IJ0A 1K51A 4NJ7A 1D5MC 4RF1A 2A4ZA 2AQ3B 2JWZA 2JYEA 4K7UA 4GDKA 1V6EA 2KQSA 1SJHD 3AE2B 3AV8A 2KWUB 4JE3B 4F8CB 3PLVA 3W5UB 4NQLB 3HHMA 3X0WA 1I4XA 3DVNV 4W9EA 3IT6B 2Z59B 2GOWA 1IBXA 4AJWA 1JALA 1L7YA 3KUZA 1ZDXA 1VZ7A 2LRUA 2D3GA 1V80A 1FXAA 1WZ3A 3RFZB 2KX3A 2L76A 3CSFA 4I6LB 1SF0A 2KFJA 3CWIA 4C7ZA 3V62A 2CS4A 2FIDA 1PGAA 2WXLA 2RSUA 5TSSA 1WFYA 2WGSA 3QHTA 3PVLA 5IOIA 1YN4A 2LGXA 2LGYA 2C7MB 3TBLD 4ARCA 4NAMA 1NBFC 2HTHA 2KHWB 3P63A 2ZPNA 4HRSA 4ANVA 2LD9A 1AARA 1SIFA 1FIQA 4J6IA 2G1EA 1L0YB 2RPVA 4E74A 2Y5PA 1FFVA 1TZOA 5IKCM 2QJLA 2JYTA 1HEZE 2X38A 3SEBA 2G9HD 1YOVB 1K50A 2C5LC 3DBRB 1HZ5A 2INCC 3DBLB 3RYTA 4ANXA 1PFDA 2CJOA 5GMVA 3E9SA 3ZNZB 5LXHA 2FAZA 1NENB 4ZRPA 1ACCA 4GGQA 1VCBA 2CU3A 4F7ZA 2W54A 4REZA 3AU5A 5AUKA 1L6UA 4QAYA 4A55A 1OQRA 2O6VD 2ONQA 1OTRB 4ICUA 4LNOA 3UI3A 2JRIB 3A9KA 3ONSA 1WI0A 2REXA 1JQ4A 4X57B 3LB8C 3L16A 2ZCBA 2IYDB 3Q3OC 1WJ4A 3UINB 1UBQA 4XWWA 4YTNB 1LXDA 4ICVA 2Y5CA 4HVBA 3PO0A 3KUCB 2BBCA 2KK8A 4RM8A 4W9IA 4W9KA 4MGZE 3ZUNA 1WGHA 2BYFA 1UBIA 1WM2A 1NYQA 1RYJA 4TQ0A 5HFYA 1IP9A 4HPPA 2WXRA 2HJ8A 4E71A 1WE6A 4WIPA 2BWES 1FPYA 1WE7A 4EZLA 3VDZA 2ZEQA 4DHZE 3BINA 5FK9C 2ZZPB 3ML8A 1ZGUB 3B2GA 1WWTA 1MI0A 1WX7A 2INDC 1T0QC 3AU4A 3ZQ4A 4B0MA 1WGYA 3V05A 1WRIA 2D5GA 2GB1A 2L3ZA 1ZP0B 2C7NB 4MGKE 4NZLB 2C60A 3NS1A 1GB4A 2XBBC 1Q0WB 4WAFA 2NBVB 4JWSC 4KGRA 3QAQA 3NVYA 3TCAA 2AQ1B 3WAPA 4HPMB 1V2YA 3BVMA 3IAM1 3DCGA 4XZ4A 1WZ0A 3NVWA 1UF0A 2MBBB 2LJ5A 4IG7B 5T8IA 3DDCB 1XF5L 2KDFB 4RCOA 3M3JA 3N20C 4C00A 4DXFA 4ACFA 4II2B 3VTVA 1KLVA 2DZIA 1NVID 1WR6E 1X1MA 2EMTA 2HDEA 1XQQA 4IM0A 1IUEA 1R7SA 2XK5A 3VH3B 3MTNB 3I57A 3PS6A 4RGNA 1D5ZC 3DVGY 3ZJUA 3AE4B 2G45B 2DYMA 1SJED 1ROEA 2NCNA 2QHOA 2KOXA 3A1QA 5D6JB 5IA7A 2J0KA 3R66C 4HXDA 5LXIB 3U8ZA 2MWSB 5E6OA 3MC8A 4ZRJA 3FAHA 1I4HA 2M8SA 2V9HA 3SDLC 1IYFA 3SHQA 2LHDA 1FNUA 1R4MB 2LASA 2J7QB 1XD3B 4GXBA 1TZ1A 4KDLB 3PZ7A 3NOBA 4OW0A 1L4ZB 5FR3A 2IO3B 3P4QB 4KKIA 1VR9A 3BYTB 2K8BA 5FR6A 1E7PB 4A6QA 3Q3JA 5DPRA 4TV3A 2M4NA 2WNMA 4WJQA 3W2DA 1PYWD 4MM3A 4ITKA 3ZDMC 2WXMA 1FCCC 1JRPA 1EU4A 2FCNA 2NR2A 5BMHA 1Q1OA 4M00A 3DPDA 1HTOA 5HHDG 3AE5B 1BUIC 3TEWA 1FXIA 1WIAA 1JWAD 1YX6B 2KMMA 1WX9A 1V9JA 2O6VA 5CHFA 1EWYC 4K3BA 4KGSA 3ZVVA 3EFUA 2DYBA 3ZKJC 2MP2B 4O1NA 3EHVA 4WWMA 1WMHA 5AZFA 2YLMA 4FHJA 1OGWA 2DAFA 3GOEA 3B2FA 2BF8B 2VZKB 3P4PB 1FFUA 4A90A 4F1SA 1VDVA
chains in the Genus database with same CATH topology
3LXFA 3KWVA 3R2TA 4CQNA 3SFEB 2KDMA 5JXVA 4YWGG 1SE4A 2BS3B 2WXFA 2JQRB 4B0EA 2TSSA 2WXIA 1HXYD 1XEEA 2L1AA 4M0WA 3BZDB 4DXGA 1L5PA 4HEA1 1SEBD 1L6VA 3MP9A 2PVGC 2LHEA 1N60A 2WXNA 1XLOA 2Y3AA 1TS4A 3AM9A 4HROA 1PDXA 1VJKA 2WDVB 2L52A 2WLBA 1YN5A 4KGTA 5H92C 1L0VB 2AQ2B 2JSVX 2NTTA 2LEKA 1C76A 5BYRA 3KLSX 4ZRQA 2SEBD 1V1PA 4XDCA 4YT0B 4AS1A 2I2YA 1D4BA 2ICIA 3AE6B 2FBWB 1N63A 1P7FA 2M19A 2OHFA 2IJ0A 2QEJC 1RFKA 1K51A 1VZ8A 1D5MC 1FRRA 1KLUD 3CIRB 1UNSA 1YN3A 3TSSA 1VRAB 2N7JA 4USAA 3T3OA 2W55A 4RF1A 2J53A 1E10A 3VR8B 1VZ6A 2LFIA 3AEAB 2AQ3B 2RDGA 1BXTA 4FXCA 1QKZA 4TSSA 1UWMA 1GOZA 2JYEA 4OZAA 2BYTA 1SJHD 2WDRB 3AE2B 3AV8A 4JE3B 4WURA 2PTLA 2L83A 1WSPA 2Q5WD 4KX6B 2RMMA 2K5PA 3W5UB 4MH8A 5C3JB 2QSDA 4XE0A 5EE0A 1QOAA 2I38A 3AEGB 3VR9B 2FE8A 1I4XA 2NMQA 1B1ZA 1QF6A 1SE2A 2YEPB 4OHJA 3IT6B 2ACZB 2WQYB 4HJGE 3Q69A 2FUG1 2KQ4X 3E56A 1KTKA 1RWSA 1IBXA 1JALA 1GAQB 1ZDXA 3N9YC 2K22A 3W5VB 3NZ3A 2WU5B 1VZ7A 1XXGA 1CZPA 1FXAA 4C7YA 1UWXA 1FCLA 3RFZB 5I4DA 1ZXHA 2IGHA 1C4CA 1D6EC 2KACA 1C9FA 2WXHA 1DYQA 1SF0A 4WH4A 2V3PA 3CWIA 4LK0M 4C7ZA 1JWMD 1N61A 4TMAB 1PGAA 3AN1A 4HKZE 2WXLA 5TSSA 1PGBA 2MJDA 1FRDA 2K9XA 4OVZA 5D7GA 4H2AA 4RH6A 4LTUA 2EELA 1YN4A 1C79A 4TQ1A 1KLGD 2AX5A 2MH7A 3VRBB 4ARCA 1J7BA 2WXGA 3ETRA 4NAMA 4KKJA 3AE7B 3P63A 3FILA 3FC4A 4HRSA 2PIAA 2L32A 1FNWA 2E3TA 1UGJA 2BW2A 2MJEA 4P16A 3MFGA 4YSYB 3I9V1 2OEDA 5BYSA 3R2IA 1I4PA 1FIQA 3KQ4A 1QILA 1SBBB 2DBYA 2G1EA 4PT5A 1KF6B 1L0YB 2RPVA 2Y5PA 4YSXB 1E9MA 1FFVA 1TZOA 1DOXA 1EWCA 2MEKA 2QJLA 2JYTA 1HEZE 2KAJA 2X38A 2G9HD 3SEBA 2PKOA 3TUOA 1SXTA 1PGXA 1K50A 4IOIE 1XLPA 2BS2B 3IAS1 4NAWB 4ZHOA 3PZ8A 1ZOYB 1HZ5A 4XDDA 4MT5A 1PFDA 2WXQA 2CJOA 1ZXIA 3NUHB 4EE2A 4MACA 3TEXA 1TS2A 3E9SA 2N9LA 1NENB 4ZRPA 1ACCA 5G5GA 3P4SB 3SR6A 2CU3A 1XO3A 1SE3A 2GI9A 2J4XA 2W54A 1PUTA 4REZA 1N5XA 5AUKA 1FNVA 1L6UA 1STEA 2GRIA 3R8BA 4A55A 4RGOS 1OQRA 4JX1C 3HUIA 1DGJA 2V0GA 2ONQA 3ZJTA 1N62A 1FM0D 4Q2JA 3Q8FA 3UI3A 1YMHE 5D3DA 1LO5D 1ENFA 1AWDA 1L0XB 4US8A 1JQ4A 1CK1A 1XCTL 3AECB 3GB1A 4N6EB 3B9JA 1JWBD 2LUMA 3LB8C 3KWLA 1KFYB 1I4QA 3L4PA 2PVOD 4RGMA 3AE3B 1GB1A 2JX5A 1F2RI 5C2TB 1Y56A 1YJJA 4XWWA 2LGIA 3ZYYX 2J52A 4YTNB 1XLQA 3Q8CA 2BB5A 3NRZA 1C77A 1XCQL 4JWUC 1TKYA 3AEBB 3AE8B 2Y5CA 1C78A 3AEDB 3GP7A 1N5WA 4N58A 3PO0A 3AMZA 1FO4A 2BBCA 2N9KA 3BK1A 1YQ3B 2N0SB 2IPKD 1QOBA 1NYQA 1RYJA 1B9RA 4DQOC 4TQ0A 3AEFB 3U4EG 5HFYA 2WXRA 1NEKB 1F0ZA 2ZW1A 5BMGA 5EE9A 2WDQB 4L1BA 1T3QA 4WIPA 3MC0B 5E6JA 3P1MA 4P6VF 4GLSC 4A9AA 2WXKA 1SSNA 2LJIA 1ZUD2 2M0AA 2K3UA 2R61A 5FK9C 3EGRA 3B2GA 1WWTA 3BVZA 1V8CA 1ZPSA 1MI0A 1YQ4B 4MM3B 1UUPA 3TEYA 3LYYA 1A70A 3U52E 3RPFC 4J3OD 3MJ5A 1QOGA 3AE9B 3U7ZA 4D2KA 1JWSD 3GS2A 3ZQ4A 3W9CB 3C8YA 4B0MA 3BWUD 3V05A 3ZGZA 1KRHA 1I4RA 1K53A 2CJNA 1MVKA 4US9A 1WRIA 2QMTA 4RNAA 2D5GA 2GB1A 1V1OA 1ZP0B 2IGDA 3ABVB 2INNE 1YJIA 1FD6A 5AUIA 4NZLB 5G5HA 3NS1A 4YTMB 1GB4A 2WXPA 2W82A 4WAFA 4JWSC 3DWMA 3P42A 4KGRA 1EU3A 1JROA 3NVYA 1T5XD 2AQ1B 3P4RB 1AYFA 1M4VA 3EUB2 1J7AA 4RF0A 2INPE 1IGDA 3BVMA 3IAM1 2QIEB 2K0PA 1C4AA 3ZJVA 5HI1A 3NVWA 5BYQA 1YNTE 1TYGB 3NVZA 4WQMA 1MHHE 2W3RA 2EKIA 5T8IA 1KH0A 1JMLA 2V4IB 1XF5L 4RCOA 3BYYB 2DLBA 2XNAC 4DXFA 1TJEA 2JXTA 1ZE3D 1TS5A 1JW9D 3VRAB 1NVID 1JCKB 1EM7A 4ZHPA 4UDUC 2HDEA 1QLBB 1IUEA 1R7SA 1P7EA 3HRDD 1ET6A 5GXGB 4IDIA 3I57A 4RGNA 1D5ZC 3NVVA 1D5XC 3H8HA 3WCQA 1ESFA 3OWEB 3ZJUA 3AE4B 4GDLB 2DYMA 1SJED 2SAKA 3AE1B 2H89B 1ROEA 4YTPB 4IKGA 2DWQA 1FMAD 1QQRA 1XLNA 1F2RC 1F77A 2QILA 1V1PB 2JWUA 5BMIA 2DYOA 3VQIA 2ON8A 1WXQA 2XN9C 1FEHA 5LNK1 1OQQA 1DOYA 4R3DA 1AW7A 2VZKD 1HZ6A 1ZDVA 4HKQA 3T3NA 4LLGM 3FAHA 1OFFA 3IXSA 1I4HA 2KWDA 1SB3C 2WXJA 1BMLC 2LHDA 1FNUA 3BVGA 4GDKB 2BTEA 1TKGA 3EA6A 4OZBA 1CJEA 1TY0A 4L2YA 4XWTA 1C4PA 5H8YE 3V3XA 3PZ7A 5HG2A 4OW0A 1L4ZB 5FR3A 1QOFA 1QT9A 3P4QB 4KKIA 3BK2A 2KN4A 3Q8AA 1VR9A 2J42A 3BYTB 4NJCA 4ZOHC 2PW9A 5FKAC 3MHZA 1RM6C 1V97A 1AN8A 1E7PB 4N59A 4A6QA 1ET9A 1E0ZA 3J9CA 1I4GA 1HQRD 1MPEA 3W1SA 3HVDA 1IBXB 4RFBA 1TS3A 2WU2B 2W3SA 2WNMA 2ZW0A 4A8XC 2WXOA 3W2DA 1CQVA 1PYWD 5MPOA 3O13A 4ITKA 2WXMA 1FCCC 1I7HA 3BIID 2LMCA 2PLPA 3AEEB 2B76B 3DWGC 4OZCA 1JRPA 1EU4A 5BMHA 3Q8BA 1L4DB 4C56C 2BB6A 1JWUD 2BS4B 3IT4B 1TY2A 2YEPF 3AH7A 5EE3A 2NTSA 1T6BX 1MHXA 4ZYSA 1VLBA 5HHDG 1HA5A 3AE5B 1BUIC 3TEWA 2WS3B 3TEZA 2BT6A 1DOIA 3AB5A 1FXIA 1JWAD 2KMMA 2Z8LA 3FILB 1NI3A 4JPSA 4ARIA 2JU6X 1K52A 5D3IB 1SIJA 2IGGA 1EWYC 4C80A 4KGSA 1GPXA 3HVZA 1TKEA 2PMVA 1IGCA 2V3NA 2WP9B 4O1NA 2RDHA 1WGKA 4YXDB 4WWMA 2IDYA 3Q8EA 3SFDB 2M56B 2HTME 4YSZB 1Q10A 2H88B 3B2FA 1NYRA 5EE1A 4L23A 2VZKB 4RGTA 4AQ7A 1J7CA 3P4PB 1FFUA 2JZPA 4A90A 3URYA 1WYGA 2MJ3A 3U2SC 2E6XA 1VDVA 1E6EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDM A;  5JXV A;  2ZW1 A;  3FIL A;  5BMG A;  4GLS C;  1HZ6 A;  3MP9 A;  2LHE A;  2OED A;  2KWD A;  1MI0 A;  2LHD A;  4KGT A;  2JSV X;  2RPV A;  4OZB A;  3V3X A;  1HEZ E;  4D2K A;  5HG2 A;  2I2Y A;  1D4B A;  1PGX A;  1K50 A;  1K53 A;  4IOI E;  1MVK A;  2KN4 A;  2QMT A;  1P7F A;  2GB1 A;  1K51 A;  2IGD A;  1HZ5 A;  2PW9 A;  1FD6 A;  1GB4 A;  1MPE A;  4MAC A;  2N7J A;  4KGR A;  1IBX B;  2N9L A;  2J53 A;  1QKZ A;  2GI9 A;  2ZW0 A;  1IGD A;  4OZA A;  2K0P A;  1FCC C;  5HI1 A;  2PLP A;  4OZC A;  2PTL A;  1YNT E;  5BMH A;  2ONQ A;  2RMM A;  1MHH E;  2QSD A;  1KH0 A;  1JML A;  1XF5 L;  2I38 A;  1MHX A;  3UI3 A;  1YMH E;  2NMQ A;  5HHD G;  2JXT A;  4HJG E;  1XCT L;  3GB1 A;  2KQ4 X;  1EM7 A;  2LUM A;  3FIL B;  1IBX A;  2JU6 X;  1K52 A;  1P7E A;  2IGG A;  1GB1 A;  4KGS A;  1F2R I;  1UWX A;  2LGI A;  1FCL A;  1IGC A;  2J52 A;  1ZXH A;  2IGH A;  2KAC A;  1C9F A;  4WH4 A;  1XCQ L;  1Q10 A;  1PGA A;  4HKZ E;  4IKG A;  2N9K A;  1PGB A;  1F2R C;  2EEL A;  2JZP A;  2JWU A;  5BMI A;  2ON8 A;  5HFY A; 
#chains in the Genus database with same CATH topology
 3KWV A;  3Q2A C;  1JRU A;  2KDM A;  2ZPY A;  5JXV A;  2BS3 B;  2OOB B;  4PS8 A;  1Y8R C;  2WXF A;  5J18 A;  5JHB A;  4KIK B;  1HXY D;  1XEE A;  2C7H A;  1E7U A;  4HEA 1;  4LDT D;  3MP9 A;  2KFK A;  1XLO A;  4MJS A;  2JT4 B;  3GZN B;  3M95 A;  2MBE A;  4KGT A;  1L0V B;  2KYW A;  1KJT A;  5IAA C;  2LEK A;  1S3S G;  2O2V A;  3I5J C;  3KLS X;  2SEB D;  2I2Y A;  2KAN A;  1NI2 A;  1D4B A;  2FBW B;  1P7F A;  1RFK A;  1VZ8 A;  3DBH I;  1KLU D;  3CIR B;  4DWF A;  4LNN A;  1GUA B;  1J8C A;  2L7R A;  4IM3 A;  1VZ6 A;  2RDG A;  1BXT A;  2L0F A;  2LVQ A;  4OZA A;  4JQW C;  3RZF A;  4P7I A;  1J19 A;  4WUR A;  1WSP A;  4KX6 B;  3PT2 B;  2K5P A;  5C3J B;  3RNG C;  2I38 A;  2FE8 A;  2IO1 B;  2NMQ A;  3AXC A;  1QF6 A;  1SE2 A;  4KDI C;  2ACZ B;  4EZJ A;  3Q69 A;  1G6J A;  3E56 A;  1EUV B;  2NVU I;  3N9Y C;  4A20 A;  3QC8 B;  4G11 A;  1XXG A;  2EKE C;  4C7Y A;  3A9J B;  2KJ6 A;  3H7P B;  1ZXH A;  1C4C A;  4IWO A;  1C9F A;  2WXH A;  4LK0 M;  1H4R A;  1JWM D;  3BY4 B;  2KLG A;  3RN9 C;  4OVZ A;  4RH6 A;  4LTU A;  2EEL A;  4TQ1 A;  5G55 A;  1KLG D;  2MSE D;  2WXG A;  4XYC A;  3AE7 B;  3FIL A;  5C1Z A;  3ZNI D;  2L32 A;  1FNW A;  1UGJ A;  4W9F A;  2FCQ A;  4PK1 A;  3APF A;  3MFG A;  4GOC A;  4DHJ D;  3WA0 A;  5BYS A;  3L08 A;  1N6Z A;  2MHJ A;  1SBB B;  1E9M A;  1DOX A;  2MEK A;  2BWF A;  2KAJ A;  2J0M A;  2PJH A;  2KTR A;  4ZRK A;  2CU1 A;  2KWC A;  1C1Y B;  1PGX A;  4EEW A;  2BS2 B;  3IAS 1;  4NAW B;  3RD2 A;  2NPT A;  2K25 A;  4MT5 A;  4B9K A;  3PRP B;  4MAC A;  2LXA A;  1E8Y A;  4K7S A;  2N9L A;  2KQ7 A;  3RNF C;  5G5G A;  2D10 A;  4GU2 A;  1V49 A;  1SE3 A;  2DEN B;  2FCS A;  2J4X A;  4BZA A;  3UGB B;  5AZH A;  1STE A;  3R8B A;  4E3C A;  2PE9 A;  4P1C C;  3H1U A;  1DGJ A;  4WQO B;  3ZJT A;  2ZVO A;  1FM0 D;  4Q2J A;  3Q8F A;  4ASW C;  3LJ3 A;  5D3D A;  4OVV A;  4EOY A;  1AWD A;  1L0X B;  3RI7 C;  4ANW A;  4US8 A;  2RR9 A;  3GB1 A;  2AL6 A;  2Y5B B;  2N9X A;  3PLU A;  3DVG X;  1I4Q A;  3L4P A;  1UGM A;  3AE3 B;  3U7D A;  3UF8 A;  1F2R I;  1RAX A;  1Y56 A;  1YJJ A;  2BB5 A;  5CHW A;  3NRZ A;  1XCQ L;  1TKY A;  3ENE A;  3DHI C;  3PV1 A;  4N58 A;  1FO4 A;  4IW0 A;  3ECI A;  1YQ3 B;  2RPQ A;  3KW5 B;  3AEF B;  3VHT C;  4LNF A;  2ZW1 A;  4GMV A;  5EE9 A;  2WDQ B;  4L1B A;  2KZR A;  4GLS C;  4GB9 A;  4KSK C;  4FA6 A;  3KYD D;  1E90 A;  2K3U A;  3EGR A;  4B6W A;  1ZPS A;  1A70 A;  3U52 E;  3AE9 B;  3U7Z A;  5DPS A;  2W9N A;  4D2K A;  2Z0D B;  3C8Y A;  3ZGZ A;  1KRH A;  1MVK A;  4M02 A;  1V1O A;  1WGG A;  4IUM B;  1ZKH A;  3ABV B;  2INN E;  1YJI A;  2JZZ A;  2NS5 A;  3K9O B;  2W82 A;  1TIF A;  1P9D U;  1JRO A;  1T5X D;  1V5T A;  4RF0 A;  2GBN A;  2QDF A;  1C4A A;  3ZJV A;  1GG3 A;  2ZJD A;  5AEK B;  1YNT E;  1PQS A;  3NVZ A;  2IO2 B;  4K1R B;  1JML A;  4W9L A;  3BYY B;  2DLB A;  4C4V B;  3MJW A;  5E6P A;  3ZXR A;  5GXG B;  3WAN A;  2KMC A;  1ESF A;  3NY5 A;  2V3S A;  2EMS A;  4MSQ B;  2SAK A;  1Q5W B;  4G50 A;  1LFD A;  2DWQ A;  1V1P B;  4NY0 A;  2JWU A;  2N7D A;  5BMI A;  3V61 A;  2DYO A;  1TGZ B;  1YQB A;  2ON8 A;  1FEH A;  1GC7 A;  3N1Y C;  2KMA A;  4R3D A;  1S1Q B;  3GE8 C;  4HKQ A;  3VAW A;  4XC2 A;  4HJK A;  4LLG M;  3EFC A;  3IXS A;  3WAL A;  2WX1 A;  1SB3 C;  3Q3F A;  3BVG A;  2V1Y A;  2BTE A;  4GDK B;  2ZNV B;  2BPS A;  4OZB A;  5E6N A;  3ALB A;  4XWT A;  1C4P A;  5HG2 A;  3VTU A;  1A5R A;  4GSW A;  1LQB A;  3I3T B;  3L10 B;  2ZNV C;  2I1K A;  4ZRI A;  2J42 A;  2OJW A;  4KZ0 A;  1ET9 A;  1WXM A;  4FBJ B;  1HQR D;  3QQ8 B;  3APC A;  3W1S A;  2K8C A;  1IBX B;  1TS3 A;  4NNJ B;  2IY1 B;  3L13 A;  1CQV A;  3KYC D;  4PS3 A;  2BKR B;  1ISN A;  2LMC A;  2B76 B;  3RUI B;  3ZNG C;  4C56 C;  1L4D B;  1E8Z A;  2VH1 A;  3R3M A;  3ZNH B;  1TY2 A;  5EE3 A;  4AJY B;  4CHK A;  3N1Z C;  2DNF A;  3TEZ A;  1IPG A;  1DOI A;  4NJ6 A;  2NBW B;  2JU6 X;  3VVW B;  5D3I B;  3IFW B;  1T0R C;  4C80 A;  1P98 A;  1GPX A;  3HVZ A;  2V3N A;  3IBE A;  1KM7 A;  1OEY J;  2WP9 B;  4G3X B;  1WGK A;  2DX5 B;  2DAJ A;  2IDY A;  3Q8E A;  3NZS A;  1BT0 A;  4LJP B;  3RUL A;  2KDI A;  4L23 A;  1J7C A;  2JZP A;  4BOZ B;  1WF9 A;  4URK A;  2CHZ A;  4TUU A;  3U2S C;  2GBK A;  3DVN U;  4JLC A;  1E6E B;  3LXF A;  3SFE B;  1F9J A;  3JSV A;  4YWG G;  1SE4 A;  4NQK E;  2ASQ A;  4B0E A;  2WXI A;  4M0W A;  3HM6 X;  3GE3 C;  3NJT A;  1TS4 A;  3AM9 A;  1PDX A;  1E8X A;  3MHS D;  5H92 C;  4GDL A;  5KHO A;  3TJP A;  3R7Q A;  5BYR A;  4ZRQ A;  4YT0 B;  2AWT A;  3QJZ A;  2HE7 A;  2BGF A;  2ICI A;  2M19 A;  3A9K B;  1FRR A;  2L05 A;  2L00 B;  1UNS A;  4IWQ A;  1WXA A;  3TSS A;  4USA A;  3T3O A;  3OJ3 A;  2W55 A;  4LNK A;  2I1J A;  4ZYN A;  3AEA B;  5JZE B;  1QKZ A;  3JVZ X;  4TSS A;  1GOZ A;  3A4R A;  1V81 A;  4BVU C;  2CHX A;  2BYT A;  1P3Q U;  2WDR B;  1U4A A;  1WGR A;  2Q5W D;  3VTW A;  3APD A;  1YIW A;  5EE0 A;  3NZU A;  1QOA A;  3AEG B;  1HE8 A;  3H6N A;  2GBJ A;  2N9E B;  4BKG A;  3V60 A;  3QAR A;  2YEP B;  2KX0 A;  4OHJ A;  4RMA A;  1CMX B;  2WQY B;  1NDD A;  5DCN A;  4MGI E;  2XEW A;  1GAQ B;  3W5V B;  3NZ3 A;  1CZP A;  1T0S C;  3PGE A;  1FCL A;  4AOF A;  5I4D A;  2IGH A;  1D6E C;  2KN5 A;  2V3P A;  2D3B A;  4TMA B;  5LLI A;  1K8R B;  3RZW C;  3UIP B;  2K9X A;  5D7G A;  2B3A A;  2CR5 A;  1V5O A;  4KV2 A;  1L2N A;  2AX5 A;  2MH7 A;  4MDK E;  1J7B A;  4AUQ C;  3ZW3 A;  2PIA A;  2E3T A;  1MG8 A;  2BW2 A;  2MJE A;  4KVG B;  2AEH A;  4YSY B;  2KDE B;  2JY6 A;  3I9V 1;  1LM8 B;  2OED A;  3KQ4 A;  4HDO A;  3RNC C;  4HCN B;  4YSX B;  1EWC A;  2BVC A;  3IVF A;  2PKO A;  3TUO A;  1SXT A;  1XLP A;  4JL9 A;  1QZE A;  4BOS C;  4ZHO A;  2WXQ A;  2K1F A;  3NUH B;  3DBH B;  4EE2 A;  2MA9 B;  3TEX A;  4FJZ A;  2XK5 B;  3P4S B;  3QX1 A;  3SR6 A;  2GI9 A;  4BBN F;  1N5X A;  1VD2 A;  3ZO5 B;  3RT3 B;  1TTN A;  1FNV A;  2ZVN A;  5J2R A;  1WYW B;  4RGO S;  4JX1 C;  2N1V A;  2V0G A;  3N32 A;  2IY0 B;  2KJH B;  3X23 A;  3H7S A;  3C0R B;  3HK0 A;  4HPL B;  3VUW A;  1YMH E;  4JIO U;  1CK1 A;  1XCT L;  3A1Q B;  4N6E B;  3B9J A;  3OLM D;  3KWL A;  1KFY B;  1KOT A;  2PVO D;  4RGM A;  3L0W B;  2MCN B;  2FCM A;  2JX5 A;  2AYO B;  3KUD B;  1XLQ A;  4HCP B;  1XT9 B;  1OQY A;  1M94 A;  2IZV B;  1C77 A;  3IHP C;  3QWZ B;  3AE8 B;  2KC1 A;  3AED B;  4XX5 A;  1N5W A;  3PRZ A;  2AL3 A;  2N9K A;  3CMM B;  3ZTD A;  1GJZ A;  2N9P C;  1B9R A;  4DQO C;  1YX5 B;  3TL5 A;  1MG4 A;  1NEK B;  1F0Z A;  5BMG A;  5D94 A;  3P1M A;  4P6V F;  2WXK A;  2LJI A;  1WY8 A;  5JHA A;  2KO3 A;  2MBO A;  5CX3 A;  1ZUD 2;  2M0A A;  3A33 B;  3BVZ A;  4MM3 B;  4WJP A;  5TR5 A;  1R4N I;  2D3A A;  4II3 B;  4J3O D;  4GN1 A;  2KDB A;  3MJ5 A;  1MFW A;  1QOG A;  3ZLZ A;  4M8M A;  1H8C A;  4EFO A;  1JWS D;  2D07 B;  1I4R A;  4US9 A;  2CJN A;  4MH0 E;  4DDG D;  4W9C A;  2G4D B;  4YTM B;  2WXP A;  1Z5S B;  3DWM A;  2O6V B;  1AYF A;  2KVZ A;  4NPN A;  1J7A A;  2INP E;  1IGD A;  2DHZ A;  2QIE B;  4PS7 A;  2K0P A;  3PHW B;  3CST A;  5BYQ A;  4EZK A;  1TYG B;  1WMH B;  1WM3 A;  4WJN A;  2IO0 B;  2EKI A;  2FUH B;  1KH0 A;  3RCZ A;  1WR1 A;  3L54 A;  3QIJ A;  2LXC A;  3JYU A;  1J0G A;  3I63 C;  3KH0 A;  1TJE A;  2JXT A;  2D11 A;  4XGA B;  1TS5 A;  3VRA B;  2LI5 A;  4JGH B;  4HK2 A;  1JCK B;  1EM7 A;  4ZHP A;  1T0Y A;  4UDU C;  3WAM A;  2MX2 A;  3HRD D;  2VH2 A;  4M01 A;  2KFK B;  3KVF B;  4MJS B;  3WCQ A;  1EF5 A;  3OWE B;  3DOW A;  3AE1 B;  2H89 B;  3D32 A;  4YTP B;  2D2Q A;  4FN2 A;  2QIL A;  1FMA D;  1XLN A;  2O2V B;  1F2R C;  1F77 A;  1UH6 A;  3VQI A;  1WXQ A;  2CHW A;  3UQB A;  3DHG C;  3A4S C;  1SE9 A;  4ZDV A;  3QK0 A;  2VZK D;  1HZ6 A;  3VUY A;  2X8X X;  3K9P B;  3HM3 A;  5IP4 D;  1OFF A;  5DPW A;  2KWD A;  4KZC A;  1GNU A;  1TKG A;  2KJR A;  1TY0 A;  4L2Y A;  2RDB C;  3ZIM A;  2BYV E;  3PRE A;  1FXT B;  1QT9 A;  2KN4 A;  3Q8A A;  3DHH C;  3ZRF A;  3T8M A;  1RLF A;  2WX0 A;  2G3Q B;  4ZOH C;  5FKA C;  1V97 A;  2N7E A;  4N59 A;  1E0Z A;  3J9C A;  2JF5 A;  1I4G A;  1MPE A;  2JXX A;  2KC2 A;  3HVD A;  5IN7 A;  3O65 B;  2GLS A;  2WU2 B;  1Z2M A;  2W3S A;  2WWZ A;  4A8X C;  5KHQ A;  5MPO A;  1I7H A;  2PLP A;  2PE6 B;  2FNJ B;  2KT7 A;  3AEE B;  4OZC A;  4GIV A;  3VXW A;  4BKS D;  2BB6 A;  3ZXV A;  1JWU D;  3EC8 A;  2GBM A;  2NTS A;  1T6B X;  4ZYS A;  3HIZ A;  1VLB A;  2MW5 A;  1HA5 A;  2JPH A;  4EUT A;  2PPH A;  2BT6 A;  3AB5 A;  3UIO B;  3FIL B;  3PTF C;  1NI3 A;  3B08 A;  4ARI A;  2L0T A;  1YJ1 A;  2YVC A;  4LNI A;  2PMV A;  1IGC A;  1RFA A;  3PPA A;  3MC9 A;  4PYU A;  4DXA B;  3RNB C;  2DZM A;  2UYZ B;  2Z0E B;  5AZG A;  2M56 B;  1Q10 A;  3NS8 A;  4A3P A;  4B95 A;  4RGT A;  2KTR B;  1EF1 A;  3URY A;  3RMK C;  4MSM B;  2E6X A;  2M0X A;  4WWP A;  4BKT A;  4CQN A;  2NPT B;  3T9L A;  3L17 A;  3EEC A;  2TSS A;  1L5P A;  1SEB D;  3PHX B;  1WH3 A;  2PVG C;  2LHE A;  2WXN A;  4K7W A;  4CYE A;  2G4S A;  1VJK A;  2L52 A;  3H9D A;  2KLC A;  2K8H A;  2NTT A;  3V6E B;  1C76 A;  4XDC A;  1TT5 B;  1MJD A;  3RNE C;  3DBR I;  3DBL I;  3AE6 B;  5J17 A;  1YN3 A;  1VRA B;  2N7J A;  2K39 A;  5CHV C;  3IG3 A;  2KD0 A;  4KSL C;  2J53 A;  1E10 A;  3VR8 B;  4FXC A;  2LFI A;  5HKH A;  2KTF A;  1UWM A;  3B0A A;  2JVC A;  2DZK A;  1I42 A;  3S2A A;  2PTL A;  2L83 A;  4FAD A;  1UEL A;  2RMM A;  4MH8 A;  3B1L X;  4WWO A;  3PRM B;  2QSD A;  4XE0 A;  2OJR A;  3VR9 B;  1B1Z A;  4HJG E;  3QCA A;  3CF6 E;  2FUG 1;  2KQ4 X;  1KTK A;  1RWS A;  5BO4 B;  2K22 A;  2WU5 B;  1D3Z A;  1LGR A;  1UWX A;  4BFR A;  3OG5 A;  2KAC A;  2KWV B;  1DYQ A;  2WDT B;  4WH4 A;  1WXV A;  1N61 A;  3AN1 A;  4HKZ E;  2N4F A;  1PGB A;  2MJD A;  1FRD A;  2LVP A;  4H2A A;  2QC8 A;  1C79 A;  2WYQ A;  4LDT B;  3VRB B;  3ETR A;  4KKJ A;  1GC6 A;  3Q3N C;  3FC4 A;  4K3C A;  3WIM A;  4P16 A;  3WAO A;  4LCD E;  3R2I A;  1I4P A;  1ZW7 A;  4EKU A;  3UQA A;  2MP2 A;  2KVR A;  2JRH A;  1QIL A;  2DBY A;  4PT5 A;  1KF6 B;  2LUE A;  2GBR A;  2MBQ A;  3SU8 X;  1EO6 A;  4WJO A;  3AUL A;  4IOI E;  5CTR C;  3PZ8 A;  1ZOY B;  4XDD A;  4BBN C;  4FJY A;  1ZXI A;  4HWI B;  4KIK A;  1TS2 A;  3ZRC A;  2BQQ A;  4TKN A;  3LDZ E;  4RM9 A;  3NHE B;  2IBI B;  4W9J A;  1XO3 A;  4IC7 B;  1PUT A;  4S0R A;  1HTQ A;  1YD8 U;  2GRI A;  3TIX A;  2A5U A;  1TBE A;  3HUI A;  1WJ6 A;  1N62 A;  2LRW A;  4LJO B;  2NBU A;  3W1Y A;  1LO5 D;  1ENF A;  2R2O A;  3AEC B;  1JWB D;  5IO9 A;  1E7V A;  2LUM A;  4BKS A;  3SD5 A;  1WX8 A;  1GB1 A;  5C2T B;  2PEA A;  2LGI A;  2K6Q A;  1SGH A;  3ZYY X;  2J52 A;  2LGD A;  3ML9 A;  3Q8C A;  3JW0 X;  4JWU C;  3AEB B;  1C78 A;  3GP7 A;  3AMZ A;  3BK1 A;  4CO7 A;  1WRD B;  3U30 A;  2N0S B;  2IPK D;  5C23 A;  3PZD A;  4AP4 C;  1QOB A;  4DHJ B;  3U4E G;  3VUX A;  1WXS A;  2BKF A;  3M63 B;  4M8N A;  2M17 A;  2QCZ A;  1T3Q A;  3MC0 B;  5E6J A;  4A9A A;  4FJV B;  1SSN A;  2R61 A;  4WWN A;  3A9J A;  3H7P A;  2UWQ A;  1R4M I;  1V8C A;  5DPT A;  1YQ4 B;  4G0N B;  3W1S C;  1UUP A;  3Q3M C;  3TEY A;  3LYY A;  3RPF C;  4OVU A;  1P1A A;  3GS2 A;  3W9C B;  1F52 A;  4IM2 A;  3BWU D;  2LWP A;  3VH4 B;  1K53 A;  2LZ6 A;  4HDQ A;  2QMT A;  4RNA A;  4BAX A;  2IGD A;  4FUL A;  2VRR B;  3V6C B;  1FD6 A;  5AUI A;  3RNA C;  5G5H A;  4I6P A;  3P42 A;  1EU3 A;  4AWJ A;  1WJU A;  2V4L A;  3P4R B;  1M4V A;  3EUB 2;  2MQJ A;  2WHI A;  4DK5 A;  3FKY A;  4W9H A;  4W9D A;  5D2M B;  5HI1 A;  2JUO A;  2K6D B;  1I35 A;  4WQM A;  1MHH E;  2DZJ A;  2W3R A;  2V4I B;  1F1H A;  4NAW A;  2XNA C;  1ZE3 D;  3TMP B;  1JW9 D;  2BYE A;  4N9F 4;  1RRB A;  2HJ1 A;  2JZ3 B;  3JSV B;  2CKH B;  1QLB B;  5L95 C;  1P7E A;  1ET6 A;  4M0W B;  4IDI A;  4ANU A;  3NVV A;  1D5X C;  3H8H A;  2ZCC A;  5L83 A;  2LVO A;  5G2N A;  4YL8 A;  4GDL B;  2R2Q A;  2KXJ A;  4IKG A;  1QQR A;  2UU7 A;  2J0J A;  2XN9 C;  5LNK 1;  1OQQ A;  2RGF A;  1DOY A;  1AW7 A;  4WAA A;  2KNB A;  3M62 B;  5EDS A;  1ZDV A;  3T3N A;  3GZN I;  4PYZ A;  3ZTC A;  4A3O A;  2N1W A;  2WXJ A;  1BML C;  4MEM A;  4W9G A;  2HD5 B;  3EA6 A;  1CJE A;  1R4N B;  3V3X A;  3Q14 C;  5H8Y E;  1QOF A;  1WJN A;  1UZX B;  3N3K B;  3BK2 A;  4NJC A;  2FIF A;  4MEL A;  2PW9 A;  1C3T A;  3MHZ A;  1RM6 C;  1AN8 A;  4P1B C;  4DDI D;  3C19 A;  4DBG A;  4RFB A;  2ZW0 A;  3ZDT A;  2MRP A;  2WXO A;  1E8W A;  4DHZ B;  3O13 A;  2KKC A;  3VFK A;  3BII D;  3DWG C;  3OJ4 B;  3Q8B A;  4K81 A;  3PSE B;  2BS4 B;  2GMI C;  3IT4 B;  2C9W B;  2YEP F;  3AH7 A;  1MHX A;  3R7R A;  5JH5 C;  2WS3 B;  1V86 A;  1UD7 A;  2Z8L A;  4MGY E;  3QA8 A;  4JPS A;  1K52 A;  1SIJ A;  2IGG A;  4HLE A;  1WGD A;  4FLH A;  1TKE A;  4I6N B;  2RDH A;  4YXD B;  3SFD B;  2HTM E;  3N1X C;  2H88 B;  4YSZ B;  1NYR A;  5EE1 A;  4AQ7 A;  1WYG A;  2MJ3 A;  4C4V A;  2RD0 A;  2L8J A;  2M1M A;  3R2T A;  4FHK A;  3P2B A;  2JQR B;  2LGS A;  2L1A A;  3BZD B;  4DXG A;  3Q6B A;  1L6V A;  1OEY A;  1N60 A;  2Y3A A;  3OAW A;  4HRO A;  2MLB A;  2WDV B;  3N30 A;  1E5W A;  2WLB A;  1YN5 A;  2JSV X;  2AQ2 B;  3DBS A;  3AI5 A;  3DQV A;  1P0R A;  4S17 A;  3NG0 A;  4IWP A;  1V1P A;  2D3C A;  2MBH A;  4AS1 A;  2QEJ C;  1N63 A;  2OHF A;  2IJ0 A;  1K51 A;  4NJ7 A;  1D5M C;  4RF1 A;  2A4Z A;  2AQ3 B;  2JWZ A;  2JYE A;  4K7U A;  4GDK A;  1V6E A;  2KQS A;  1SJH D;  3AE2 B;  3AV8 A;  2KWU B;  4JE3 B;  4F8C B;  3PLV A;  3W5U B;  4NQL B;  3HHM A;  3X0W A;  1I4X A;  3DVN V;  4W9E A;  3IT6 B;  2Z59 B;  2GOW A;  1IBX A;  4AJW A;  1JAL A;  1L7Y A;  3KUZ A;  1ZDX A;  1VZ7 A;  2LRU A;  2D3G A;  1V80 A;  1FXA A;  1WZ3 A;  3RFZ B;  2KX3 A;  2L76 A;  3CSF A;  4I6L B;  1SF0 A;  2KFJ A;  3CWI A;  4C7Z A;  3V62 A;  2CS4 A;  2FID A;  1PGA A;  2WXL A;  2RSU A;  5TSS A;  1WFY A;  2WGS A;  3QHT A;  3PVL A;  5IOI A;  1YN4 A;  2LGX A;  2LGY A;  2C7M B;  3TBL D;  4ARC A;  4NAM A;  1NBF C;  2HTH A;  2KHW B;  3P63 A;  2ZPN A;  4HRS A;  4ANV A;  2LD9 A;  1AAR A;  1SIF A;  1FIQ A;  4J6I A;  2G1E A;  1L0Y B;  2RPV A;  4E74 A;  2Y5P A;  1FFV A;  1TZO A;  5IKC M;  2QJL A;  2JYT A;  1HEZ E;  2X38 A;  3SEB A;  2G9H D;  1YOV B;  1K50 A;  2C5L C;  3DBR B;  1HZ5 A;  2INC C;  3DBL B;  3RYT A;  4ANX A;  1PFD A;  2CJO A;  5GMV A;  3E9S A;  3ZNZ B;  5LXH A;  2FAZ A;  1NEN B;  4ZRP A;  1ACC A;  4GGQ A;  1VCB A;  2CU3 A;  4F7Z A;  2W54 A;  4REZ A;  3AU5 A;  5AUK A;  1L6U A;  4QAY A;  4A55 A;  1OQR A;  2O6V D;  2ONQ A;  1OTR B;  4ICU A;  4LNO A;  3UI3 A;  2JRI B;  3A9K A;  3ONS A;  1WI0 A;  2REX A;  1JQ4 A;  4X57 B;  3LB8 C;  3L16 A;  2ZCB A;  2IYD B;  3Q3O C;  1WJ4 A;  3UIN B;  1UBQ A;  4XWW A;  4YTN B;  1LXD A;  4ICV A;  2Y5C A;  4HVB A;  3PO0 A;  3KUC B;  2BBC A;  2KK8 A;  4RM8 A;  4W9I A;  4W9K A;  4MGZ E;  3ZUN A;  1WGH A;  2BYF A;  1UBI A;  1WM2 A;  1NYQ A;  1RYJ A;  4TQ0 A;  5HFY A;  1IP9 A;  4HPP A;  2WXR A;  2HJ8 A;  4E71 A;  1WE6 A;  4WIP A;  2BWE S;  1FPY A;  1WE7 A;  4EZL A;  3VDZ A;  2ZEQ A;  4DHZ E;  3BIN A;  5FK9 C;  2ZZP B;  3ML8 A;  1ZGU B;  3B2G A;  1WWT A;  1MI0 A;  1WX7 A;  2IND C;  1T0Q C;  3AU4 A;  3ZQ4 A;  4B0M A;  1WGY A;  3V05 A;  1WRI A;  2D5G A;  2GB1 A;  2L3Z A;  1ZP0 B;  2C7N B;  4MGK E;  4NZL B;  2C60 A;  3NS1 A;  1GB4 A;  2XBB C;  1Q0W B;  4WAF A;  2NBV B;  4JWS C;  4KGR A;  3QAQ A;  3NVY A;  3TCA A;  2AQ1 B;  3WAP A;  4HPM B;  1V2Y A;  3BVM A;  3IAM 1;  3DCG A;  4XZ4 A;  1WZ0 A;  3NVW A;  1UF0 A;  2MBB B;  2LJ5 A;  4IG7 B;  5T8I A;  3DDC B;  1XF5 L;  2KDF B;  4RCO A;  3M3J A;  3N20 C;  4C00 A;  4DXF A;  4ACF A;  4II2 B;  3VTV A;  1KLV A;  2DZI A;  1NVI D;  1WR6 E;  1X1M A;  2EMT A;  2HDE A;  1XQQ A;  4IM0 A;  1IUE A;  1R7S A;  2XK5 A;  3VH3 B;  3MTN B;  3I57 A;  3PS6 A;  4RGN A;  1D5Z C;  3DVG Y;  3ZJU A;  3AE4 B;  2G45 B;  2DYM A;  1SJE D;  1ROE A;  2NCN A;  2QHO A;  2KOX A;  3A1Q A;  5D6J B;  5IA7 A;  2J0K A;  3R66 C;  4HXD A;  5LXI B;  3U8Z A;  2MWS B;  5E6O A;  3MC8 A;  4ZRJ A;  3FAH A;  1I4H A;  2M8S A;  2V9H A;  3SDL C;  1IYF A;  3SHQ A;  2LHD A;  1FNU A;  1R4M B;  2LAS A;  2J7Q B;  1XD3 B;  4GXB A;  1TZ1 A;  4KDL B;  3PZ7 A;  3NOB A;  4OW0 A;  1L4Z B;  5FR3 A;  2IO3 B;  3P4Q B;  4KKI A;  1VR9 A;  3BYT B;  2K8B A;  5FR6 A;  1E7P B;  4A6Q A;  3Q3J A;  5DPR A;  4TV3 A;  2M4N A;  2WNM A;  4WJQ A;  3W2D A;  1PYW D;  4MM3 A;  4ITK A;  3ZDM C;  2WXM A;  1FCC C;  1JRP A;  1EU4 A;  2FCN A;  2NR2 A;  5BMH A;  1Q1O A;  4M00 A;  3DPD A;  1HTO A;  5HHD G;  3AE5 B;  1BUI C;  3TEW A;  1FXI A;  1WIA A;  1JWA D;  1YX6 B;  2KMM A;  1WX9 A;  1V9J A;  2O6V A;  5CHF A;  1EWY C;  4K3B A;  4KGS A;  3ZVV A;  3EFU A;  2DYB A;  3ZKJ C;  2MP2 B;  4O1N A;  3EHV A;  4WWM A;  1WMH A;  5AZF A;  2YLM A;  4FHJ A;  1OGW A;  2DAF A;  3GOE A;  3B2F A;  2BF8 B;  2VZK B;  3P4P B;  1FFU A;  4A90 A;  4F1S A;  1VDV A; 
#chains in the Genus database with same CATH homology
 3LXF A;  3KWV A;  3R2T A;  4CQN A;  3SFE B;  2KDM A;  5JXV A;  4YWG G;  1SE4 A;  2BS3 B;  2WXF A;  2JQR B;  4B0E A;  2TSS A;  2WXI A;  1HXY D;  1XEE A;  2L1A A;  4M0W A;  3BZD B;  4DXG A;  1L5P A;  4HEA 1;  1SEB D;  1L6V A;  3MP9 A;  2PVG C;  2LHE A;  1N60 A;  2WXN A;  1XLO A;  2Y3A A;  1TS4 A;  3AM9 A;  4HRO A;  1PDX A;  1VJK A;  2WDV B;  2L52 A;  2WLB A;  1YN5 A;  4KGT A;  5H92 C;  1L0V B;  2AQ2 B;  2JSV X;  2NTT A;  2LEK A;  1C76 A;  5BYR A;  3KLS X;  4ZRQ A;  2SEB D;  1V1P A;  4XDC A;  4YT0 B;  4AS1 A;  2I2Y A;  1D4B A;  2ICI A;  3AE6 B;  2FBW B;  1N63 A;  1P7F A;  2M19 A;  2OHF A;  2IJ0 A;  2QEJ C;  1RFK A;  1K51 A;  1VZ8 A;  1D5M C;  1FRR A;  1KLU D;  3CIR B;  1UNS A;  1YN3 A;  3TSS A;  1VRA B;  2N7J A;  4USA A;  3T3O A;  2W55 A;  4RF1 A;  2J53 A;  1E10 A;  3VR8 B;  1VZ6 A;  2LFI A;  3AEA B;  2AQ3 B;  2RDG A;  1BXT A;  4FXC A;  1QKZ A;  4TSS A;  1UWM A;  1GOZ A;  2JYE A;  4OZA A;  2BYT A;  1SJH D;  2WDR B;  3AE2 B;  3AV8 A;  4JE3 B;  4WUR A;  2PTL A;  2L83 A;  1WSP A;  2Q5W D;  4KX6 B;  2RMM A;  2K5P A;  3W5U B;  4MH8 A;  5C3J B;  2QSD A;  4XE0 A;  5EE0 A;  1QOA A;  2I38 A;  3AEG B;  3VR9 B;  2FE8 A;  1I4X A;  2NMQ A;  1B1Z A;  1QF6 A;  1SE2 A;  2YEP B;  4OHJ A;  3IT6 B;  2ACZ B;  2WQY B;  4HJG E;  3Q69 A;  2FUG 1;  2KQ4 X;  3E56 A;  1KTK A;  1RWS A;  1IBX A;  1JAL A;  1GAQ B;  1ZDX A;  3N9Y C;  2K22 A;  3W5V B;  3NZ3 A;  2WU5 B;  1VZ7 A;  1XXG A;  1CZP A;  1FXA A;  4C7Y A;  1UWX A;  1FCL A;  3RFZ B;  5I4D A;  1ZXH A;  2IGH A;  1C4C A;  1D6E C;  2KAC A;  1C9F A;  2WXH A;  1DYQ A;  1SF0 A;  4WH4 A;  2V3P A;  3CWI A;  4LK0 M;  4C7Z A;  1JWM D;  1N61 A;  4TMA B;  1PGA A;  3AN1 A;  4HKZ E;  2WXL A;  5TSS A;  1PGB A;  2MJD A;  1FRD A;  2K9X A;  4OVZ A;  5D7G A;  4H2A A;  4RH6 A;  4LTU A;  2EEL A;  1YN4 A;  1C79 A;  4TQ1 A;  1KLG D;  2AX5 A;  2MH7 A;  3VRB B;  4ARC A;  1J7B A;  2WXG A;  3ETR A;  4NAM A;  4KKJ A;  3AE7 B;  3P63 A;  3FIL A;  3FC4 A;  4HRS A;  2PIA A;  2L32 A;  1FNW A;  2E3T A;  1UGJ A;  2BW2 A;  2MJE A;  4P16 A;  3MFG A;  4YSY B;  3I9V 1;  2OED A;  5BYS A;  3R2I A;  1I4P A;  1FIQ A;  3KQ4 A;  1QIL A;  1SBB B;  2DBY A;  2G1E A;  4PT5 A;  1KF6 B;  1L0Y B;  2RPV A;  2Y5P A;  4YSX B;  1E9M A;  1FFV A;  1TZO A;  1DOX A;  1EWC A;  2MEK A;  2QJL A;  2JYT A;  1HEZ E;  2KAJ A;  2X38 A;  2G9H D;  3SEB A;  2PKO A;  3TUO A;  1SXT A;  1PGX A;  1K50 A;  4IOI E;  1XLP A;  2BS2 B;  3IAS 1;  4NAW B;  4ZHO A;  3PZ8 A;  1ZOY B;  1HZ5 A;  4XDD A;  4MT5 A;  1PFD A;  2WXQ A;  2CJO A;  1ZXI A;  3NUH B;  4EE2 A;  4MAC A;  3TEX A;  1TS2 A;  3E9S A;  2N9L A;  1NEN B;  4ZRP A;  1ACC A;  5G5G A;  3P4S B;  3SR6 A;  2CU3 A;  1XO3 A;  1SE3 A;  2GI9 A;  2J4X A;  2W54 A;  1PUT A;  4REZ A;  1N5X A;  5AUK A;  1FNV A;  1L6U A;  1STE A;  2GRI A;  3R8B A;  4A55 A;  4RGO S;  1OQR A;  4JX1 C;  3HUI A;  1DGJ A;  2V0G A;  2ONQ A;  3ZJT A;  1N62 A;  1FM0 D;  4Q2J A;  3Q8F A;  3UI3 A;  1YMH E;  5D3D A;  1LO5 D;  1ENF A;  1AWD A;  1L0X B;  4US8 A;  1JQ4 A;  1CK1 A;  1XCT L;  3AEC B;  3GB1 A;  4N6E B;  3B9J A;  1JWB D;  2LUM A;  3LB8 C;  3KWL A;  1KFY B;  1I4Q A;  3L4P A;  2PVO D;  4RGM A;  3AE3 B;  1GB1 A;  2JX5 A;  1F2R I;  5C2T B;  1Y56 A;  1YJJ A;  4XWW A;  2LGI A;  3ZYY X;  2J52 A;  4YTN B;  1XLQ A;  3Q8C A;  2BB5 A;  3NRZ A;  1C77 A;  1XCQ L;  4JWU C;  1TKY A;  3AEB B;  3AE8 B;  2Y5C A;  1C78 A;  3AED B;  3GP7 A;  1N5W A;  4N58 A;  3PO0 A;  3AMZ A;  1FO4 A;  2BBC A;  2N9K A;  3BK1 A;  1YQ3 B;  2N0S B;  2IPK D;  1QOB A;  1NYQ A;  1RYJ A;  1B9R A;  4DQO C;  4TQ0 A;  3AEF B;  3U4E G;  5HFY A;  2WXR A;  1NEK B;  1F0Z A;  2ZW1 A;  5BMG A;  5EE9 A;  2WDQ B;  4L1B A;  1T3Q A;  4WIP A;  3MC0 B;  5E6J A;  3P1M A;  4P6V F;  4GLS C;  4A9A A;  2WXK A;  1SSN A;  2LJI A;  1ZUD 2;  2M0A A;  2K3U A;  2R61 A;  5FK9 C;  3EGR A;  3B2G A;  1WWT A;  3BVZ A;  1V8C A;  1ZPS A;  1MI0 A;  1YQ4 B;  4MM3 B;  1UUP A;  3TEY A;  3LYY A;  1A70 A;  3U52 E;  3RPF C;  4J3O D;  3MJ5 A;  1QOG A;  3AE9 B;  3U7Z A;  4D2K A;  1JWS D;  3GS2 A;  3ZQ4 A;  3W9C B;  3C8Y A;  4B0M A;  3BWU D;  3V05 A;  3ZGZ A;  1KRH A;  1I4R A;  1K53 A;  2CJN A;  1MVK A;  4US9 A;  1WRI A;  2QMT A;  4RNA A;  2D5G A;  2GB1 A;  1V1O A;  1ZP0 B;  2IGD A;  3ABV B;  2INN E;  1YJI A;  1FD6 A;  5AUI A;  4NZL B;  5G5H A;  3NS1 A;  4YTM B;  1GB4 A;  2WXP A;  2W82 A;  4WAF A;  4JWS C;  3DWM A;  3P42 A;  4KGR A;  1EU3 A;  1JRO A;  3NVY A;  1T5X D;  2AQ1 B;  3P4R B;  1AYF A;  1M4V A;  3EUB 2;  1J7A A;  4RF0 A;  2INP E;  1IGD A;  3BVM A;  3IAM 1;  2QIE B;  2K0P A;  1C4A A;  3ZJV A;  5HI1 A;  3NVW A;  5BYQ A;  1YNT E;  1TYG B;  3NVZ A;  4WQM A;  1MHH E;  2W3R A;  2EKI A;  5T8I A;  1KH0 A;  1JML A;  2V4I B;  1XF5 L;  4RCO A;  3BYY B;  2DLB A;  2XNA C;  4DXF A;  1TJE A;  2JXT A;  1ZE3 D;  1TS5 A;  1JW9 D;  3VRA B;  1NVI D;  1JCK B;  1EM7 A;  4ZHP A;  4UDU C;  2HDE A;  1QLB B;  1IUE A;  1R7S A;  1P7E A;  3HRD D;  1ET6 A;  5GXG B;  4IDI A;  3I57 A;  4RGN A;  1D5Z C;  3NVV A;  1D5X C;  3H8H A;  3WCQ A;  1ESF A;  3OWE B;  3ZJU A;  3AE4 B;  4GDL B;  2DYM A;  1SJE D;  2SAK A;  3AE1 B;  2H89 B;  1ROE A;  4YTP B;  4IKG A;  2DWQ A;  1FMA D;  1QQR A;  1XLN A;  1F2R C;  1F77 A;  2QIL A;  1V1P B;  2JWU A;  5BMI A;  2DYO A;  3VQI A;  2ON8 A;  1WXQ A;  2XN9 C;  1FEH A;  5LNK 1;  1OQQ A;  1DOY A;  4R3D A;  1AW7 A;  2VZK D;  1HZ6 A;  1ZDV A;  4HKQ A;  3T3N A;  4LLG M;  3FAH A;  1OFF A;  3IXS A;  1I4H A;  2KWD A;  1SB3 C;  2WXJ A;  1BML C;  2LHD A;  1FNU A;  3BVG A;  4GDK B;  2BTE A;  1TKG A;  3EA6 A;  4OZB A;  1CJE A;  1TY0 A;  4L2Y A;  4XWT A;  1C4P A;  5H8Y E;  3V3X A;  3PZ7 A;  5HG2 A;  4OW0 A;  1L4Z B;  5FR3 A;  1QOF A;  1QT9 A;  3P4Q B;  4KKI A;  3BK2 A;  2KN4 A;  3Q8A A;  1VR9 A;  2J42 A;  3BYT B;  4NJC A;  4ZOH C;  2PW9 A;  5FKA C;  3MHZ A;  1RM6 C;  1V97 A;  1AN8 A;  1E7P B;  4N59 A;  4A6Q A;  1ET9 A;  1E0Z A;  3J9C A;  1I4G A;  1HQR D;  1MPE A;  3W1S A;  3HVD A;  1IBX B;  4RFB A;  1TS3 A;  2WU2 B;  2W3S A;  2WNM A;  2ZW0 A;  4A8X C;  2WXO A;  3W2D A;  1CQV A;  1PYW D;  5MPO A;  3O13 A;  4ITK A;  2WXM A;  1FCC C;  1I7H A;  3BII D;  2LMC A;  2PLP A;  3AEE B;  2B76 B;  3DWG C;  4OZC A;  1JRP A;  1EU4 A;  5BMH A;  3Q8B A;  1L4D B;  4C56 C;  2BB6 A;  1JWU D;  2BS4 B;  3IT4 B;  1TY2 A;  2YEP F;  3AH7 A;  5EE3 A;  2NTS A;  1T6B X;  1MHX A;  4ZYS A;  1VLB A;  5HHD G;  1HA5 A;  3AE5 B;  1BUI C;  3TEW A;  2WS3 B;  3TEZ A;  2BT6 A;  1DOI A;  3AB5 A;  1FXI A;  1JWA D;  2KMM A;  2Z8L A;  3FIL B;  1NI3 A;  4JPS A;  4ARI A;  2JU6 X;  1K52 A;  5D3I B;  1SIJ A;  2IGG A;  1EWY C;  4C80 A;  4KGS A;  1GPX A;  3HVZ A;  1TKE A;  2PMV A;  1IGC A;  2V3N A;  2WP9 B;  4O1N A;  2RDH A;  1WGK A;  4YXD B;  4WWM A;  2IDY A;  3Q8E A;  3SFD B;  2M56 B;  2HTM E;  4YSZ B;  1Q10 A;  2H88 B;  3B2F A;  1NYR A;  5EE1 A;  4L23 A;  2VZK B;  4RGT A;  4AQ7 A;  1J7C A;  3P4P B;  1FFU A;  2JZP A;  4A90 A;  3URY A;  1WYG A;  2MJ3 A;  3U2S C;  2E6X A;  1VDV A;  1E6E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...