2IGHA

Determination of the solution structures of domains ii and iii of protein g from streptococcus by 1h nmr
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
LTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the solution structures of domains II and III of protein G from Streptococcus by 1H nuclear magnetic resonance.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
molecule tags Immunoglobulin-binding protein
molecule keywords PROTEIN G
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1992-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ighA00
4OZBA 1MHXA 2PLPA 2LGIA 1K53A 2NMQA 2I2YA 4WH4A 5HI1A 1F2RC 4HKZE 1C9FA 4D2KA 1D4BA 3FILA 5JXVA 1FD6A 5HG2A 1HZ6A 1XCQL 2N9KA 1HEZE 2KWDA 4MACA 4OZCA 2GI9A 4OZAA 2KDMA 1YNTE 1Q10A 2QSDA 2N9LA 1MVKA 2IGDA 2PTLA 1MHHE 1GB1A 4HJGE 2PW9A 2KQ4X 1P7FA 1XF5L 2QMTA 1FCCC 1XCTL 2LHDA 1P7EA 2RMMA 4IOIE 2IGGA 2ZW0A 1F2RI 1QKZA 2JSVX 2JZPA 4IKGA 2JWUA 5BMGA 1GB4A 5BMHA 1EM7A 1MI0A 1FCLA 4KGTA 2EELA 1K51A 2ZW1A 4KGSA 2ONQA 2JU6X 5HHDG 1YMHE 5BMIA 2KACA 4GLSC 2N7JA 2JXTA 3FILB 3MP9A 1IGCA 2I38A 1PGAA 1HZ5A 3UI3A 2LHEA 2J53A 2J52A 2OEDA 1IGDA 1ZXHA 2K0PA 5HFYA 1IBXB 2RPVA 1IBXA 4KGRA 2IGHA 1UWXA 1K52A 1K50A 1PGBA 2KN4A 2ON8A 2GB1A 2LUMA 1MPEA 3V3XA 3GB1A 1KH0A 1JMLA 1PGXA
chains in the Genus database with same CATH superfamily
2DZIA 3B1LX 1WXMA 2MEKA 2NMQA 2GBKA 2LFIA 2LGSA 3HVDA 4KIKA 2CHXA 4GDLB 3MTNB 4AQ7A 1HEZE 1TS5A 2EKIA 4HRSA 1TY0A 4DXAB 2CU1A 4JX1C 2LASA 3A1QA 4PS8A 3ML8A 1YN3A 1OQQA 3ZO5B 4BKGA 3PRPB 1UGMA 1PFDA 3OWEB 1OQYA 1NDDA 4HK2A 1XLNA 3URYA 3V05A 1R4NI 3MC0B 2C7NB 1JW9D 1L4DB 1V49A 1F2RI 3DDCB 3KWVA 4IKGA 4K7UA 2DYOA 2VRRB 1A70A 2JPHA 1X1MA 2WDQB 2IZVB 4G11A 2MH7A 4E74A 5HHDG 2KWUB 3R3MA 2KXJA 4XGAB 1SE2A 2MJDA 2FCSA 3VUYA 2OJWA 1UNSA 3N1XC 4NQLB 2G45B 3C0RB 4A3OA 4FULA 1F1HA 2PIAA 2A5UA 2WXIA 3RNGC 2KJRA 4OVUA 2NPTB 3TCAA 1WGRA 3Q69A 3TEYA 2CHWA 5E6JA 1L6UA 1KJTA 3ZNZB 1QT9A 2RDHA 5BYSA 3T8MA 4FXCA 4MJSB 1XO3A 1E7UA 4JLCA 2NTTA 2G3QB 1KRHA 3N20C 1E7PB 1D5MC 1QQRA 1KH0A 2LI5A 1MHXA 4XWWA 2PLPA 1V8CA 4WWNA 2N0SB 2IO2B 2ZPNA 1ZDVA 4MM3A 1Q0WB 1J7CA 2WP9B 2JRHA 3NJTA 1L0YB 2J7QB 1L7YA 3AE4B 3KQ4A 3TIXA 1B9RA 5G5GA 1EUVB 2L7RA 2DZJA 1ESFA 3PZ7A 4TQ1A 3KYCD 3V61A 1RFKA 3AH7A 4OW0A 2O2VB 2HDEA 3EC8A 3VR9B 4HPLB 2HE7A 2KVZA 2INPE 3P63A 3DWMA 1I4QA 4JWSC 5C23A 1SGHA 5FR3A 1QKZA 2ZNVC 2K8HA 1WZ0A 1MI0A 2M8SA 2NBVB 1DOXA 1TT5B 2RD0A 2PJHA 3U4EG 2WXRA 3OLMD 2N1WA 2GLSA 2N9EB 2WLBA 3MP9A 4IW0A 4M02A 1HZ5A 1V2YA 2JYEA 2ZVNA 4HKQA 3JW0X 3K9PB 1MFWA 4ICVA 2DBYA 2XN9C 2BW2A 3Q6BA 1MG8A 3FKYA 3DBLB 1WM3A 5AZFA 1KFYB 5D7GA 2N4FA 3KWLA 3WCQA 2HTME 5G55A 1CZPA 1WX9A 4G0NB 4ANXA 4X57B 1EF5A 1FXTB 2IYDB 2C9WB 3APCA 1N62A 5HI1A 4KKIA 4KSKC 2Y5BB 1EF1A 1YJ1A 2WS3B 1LXDA 4RF1A 2JZ3B 2OHFA 4M0WB 2I1JA 3SEBA 1FRRA 3LB8C 1YX5B 4RH6A 1TBEA 3APDA 2MQJA 3ABVB 2WXHA 5LXHA 2J42A 4DXGA 2QMTA 2J4XA 2ICIA 5H8YE 2MBHA 2ZW0A 4AJWA 4M01A 1C78A 2L76A 2GRIA 4BVUC 5BMHA 1EM7A 2DZMA 4KX6B 1WRDB 3KYDD 1NEKB 4W9DA 2L8JA 3AEBB 2AX5A 3SHQA 5C2TB 1XLQA 3ZXRA 1HTQA 2ZJDA 4WQOB 3SU8X 1XQQA 3N30A 1IUEA 3H7SA 3P4PB 1H4RA 3TJPA 5IKCM 1Q1OA 1FXAA 1LO5D 2J52A 2WX1A 3NVWA 1G6JA 3DPDA 4FJYA 2JQRB 1WXAA 1AYFA 2RPVA 3MJ5A 4HCPB 2XEWA 4IG7B 4AWJA 4F7ZA 1DGJA 3AEFB 4LLGM 1J0GA 1WGGA 2M0XA 3GOEA 4M00A 3EECA 4P1BC 3A9KB 4DBGA 1FIQA 5G2NA 1SIJA 2XK5B 1YD8U 2GBNA 4RFBA 1L0VB 3GB1A 1V5OA 4K3BA 2LMCA 1KLGD 1UZXB 3MHSD 4LNKA 2KWCA 2N1VA 1WMHA 2INNE 1ZPSA 4FHKA 3QHTA 1TZ1A 1SJHD 5FKAC 2CS4A 2N9KA 1OTRB 2KWDA 2LJIA 1T0YA 1WM2A 1JWMD 1V1OA 4FBJB 4WWOA 1IPGA 1R4MB 2KTRA 2H88B 3RT3B 1R4MI 2VH2A 1ROEA 1QILA 1TKGA 3R2IA 3ZDTA 1VZ6A 1BMLC 4HJGE 1OEYA 3PPAA 3WAOA 4RCOA 4BAXA 1WIAA 1S1QB 5BMGA 4GDKB 1WGHA 3PS6A 1C1YB 4IWPA 1GJZA 3RD2A 3B2GA 4CYEA 2CU3A 2O6VD 3ZIMA 1VD2A 2N9PC 1E0ZA 5BMIA 2TSSA 3L10B 3UIPB 2V4LA 2I38A 3NHEB 5GMVA 2L83A 3GS2A 2BF8B 3M3JA 1P9DU 2ZEQA 3OJ4B 4GU2A 3RNAC 1SBBB 2EKEC 1QOAA 5EE1A 2OOBB 2WXFA 2WU5B 1RFAA 4GIVA 1SSNA 4NJ7A 3X23A 1L5PA 1Z5SB 2KANA 1JQ4A 3RPFC 3RNBC 2WHIA 4ARIA 5CTRC 4W9HA 1JCKB 2ZZPB 4YTMB 4P1CC 1C4PA 3CF6E 4XE0A 4IWQA 3NS8A 2L0FA 2G4DB 3ZRFA 3JSVA 3DBHB 3JVZX 5DPWA 1V86A 2DAFA 3U2SC 2K1FA 4ZHOA 1EU4A 4IWOA 2B3AA 4KKJA 2DHZA 3UF8A 4REZA 4FHJA 1Q10A 1RRBA 4NY0A 1L6VA 3H9DA 5E6PA 2INCC 2MJ3A 3WAMA 3V6EB 1P1AA 4EKUA 4O1NA 3AXCA 3NZSA 1RAXA 2L0TA 4LNIA 2RPQA 4BKTA 4ICUA 2KN5A 5TR5A 2JZPA 1J7AA 1V1PA 1HE8A 2BWFA 1K8RB 3VTUA 5AZGA 1WZ3A 4P6VF 4DHJB 5JH5C 2LUEA 4GLSC 3SFEB 2AL3A 2JZZA 2D3AA 3WIMA 2WX0A 2JVCA 5BYRA 2J53A 2L32A 2O6VB 4ZRQA 5MPOA 4TUUA 1IGDA 3DBHI 2EMSA 1TS3A 1D5ZC 4KGRA 3DVGY 1NENB 4HROA 4TKNA 3L0WB 1YJJA 2CJOA 4ZDVA 2M1MA 4MGZE 4IM3A 1I35A 1SB3C 4XX5A 2PE9A 2PE6B 4US8A 2L3ZA 3AMZA 3B0AA 2GMIC 2I2YA 3WALA 4EE2A 1TKYA 2KTFA 3H7PA 2KNBA 4S0RA 3A9JA 1OGWA 2D11A 3KUCB 4AJYB 1E6EB 1V5TA 3VH4B 3BVZA 3ZW3A 3QA8A 1C76A 4HEA1 4MEMA 2C60A 1SJED 3AECB 3CSTA 2MJEA 4MDKE 2IGDA 3W5UB 3E56A 2PPHA 1ET9A 1D3ZA 3KUDB 4YL8A 4DDGD 2D2QA 4TSSA 3DHIC 5CHVC 2MCNB 1UD7A 1DYQA 4ASWC 2FBWB 3O13A 2NBWB 1QZEA 3I9V1 5E6OA 3W1SC 4HLEA 4HXDA 2K9XA 2EELA 4B0EA 2LXAA 1M94A 2JU6X 4MT5A 3FILB 2V1YA 1E5WA 2IO1B 1E10A 2HTHA 2Y3AA 4UDUC 3BWUD 1WJ4A 3N1YC 1QOFA 4A8XC 2N9XA 2MW5A 1XT9B 4NAWA 4M8NA 3BZDB 2J0MA 1LFDA 2NTSA 1IBXA 3RCZA 1YN5A 4GGQA 5EDSA 2ZCCA 1I4PA 3RN9C 2D3CA 1U4AA 3L08A 3AV8A 2NCNA 2HJ8A 5FR6A 3D32A 1JMLA 5AUKA 1WE7A 3Q8AA 1P0RA 4LTUA 1T0RC 4L2YA 4F8CB 4IM2A 1N6ZA 2CJNA 4MSMB 2Z0DB 3CMMB 1WJ6A 1FD6A 2KHWB 5CHFA 1XCQL 2IY1B 3L17A 1I42A 5T8IA 3DOWA 2WXJA 1YQ3B 2LVQA 4MACA 3QC8B 3PSEB 2LXCA 2KK8A 1C3TA 4K7SA 4L23A 2ASQA 3R66C 1JWSD 1ZP0B 1T5XD 2LEKA 3Q3FA 1GC7A 3ZNGC 1WR6E 3VUWA 1N63A 4RMAA 3NRZA 2PTLA 3IG3A 3KH0A 2PW9A 1WSPA 1WR1A 4W9FA 4WWPA 4WQMA 4NJCA 4ZYNA 3A33B 2RMMA 5D3DA 1V81A 4ZYSA 2FIDA 3P1MA 3VH3B 1N5XA 2LGYA 3R7QA 3W1SA 3QIJA 4NQKE 1WH3A 4ANWA 3A4SC 2X8XX 3I63C 2KFJA 3B2FA 3Q3MC 1ET6A 4C7ZA 1IP9A 5IOIA 1IGCA 3AE9B 1WF9A 5FK9C 1JROA 4ARCA 1WJNA 2G4SA 1FPYA 4XC2A 1I4RA 4ZOHC 1TTNA 2K6DB 2K8BA 1WXSA 3UIOB 1ZXHA 2BB5A 1ZW7A 5C1ZA 5KHQA 3IT4B 2IGHA 4CHKA 2H89B 2M56B 1K50A 2RSUA 2QCZA 1XD3B 1S3SG 2JWZA 2R2OA 3VRBB 4DWFA 2VZKD 3PO0A 1KLUD 2J0JA 2BWES 1UBIA 1D5XC 1GUAB 2LGIA 4C56C 2BGFA 2KDIA 4YSYB 2O2VA 1CJEA 2JX5A 4KSLC 4BFRA 4BOZB 3PHXB 1SF0A 2XNAC 3RNCC 3ENEA 1RWSA 2BYFA 1HXYD 1KTKA 3QARA 3DHGC 4RF0A 1F77A 3P4QB 1L0XB 3ALBA 2YEPB 2L1AA 4IOIE 3CIRB 2GBMA 1H8CA 3VXWA 2KFKA 3TEZA 4II3B 2JSVX 2QILA 3U52E 1JALA 4IM0A 1A5RA 4HVBA 1VJKA 4LJOB 1TKEA 3A9KA 4KGTA 1K51A 3DVGX 2ZW1A 3MHZA 3P42A 3C19A 3GZNI 3TEXA 5D94A 5DCNA 3WANA 2C7HA 4RNAA 4PK1A 1E8WA 4JWUC 1BT0A 4W9KA 4K1RB 4PT5A 3KUZA 2KKCA 4FJZA 4XYCA 1WGDA 2Z8LA 3RI7C 4JGHB 4HPMB 3H7PB 3Q3JA 2V9HA 1V9JA 1FXIA 2FCMA 1WMHB 3OAWA 1WFYA 3ZJVA 4WAAA 4IUMB 2KN4A 2JYTA 4HJKA 3AE7B 3ZRCA 3DQVA 1FFVA 3HIZA 4BKSA 1J8CA 2D3GA 3M63B 2CKHB 2FIFA 4RM8A 2DYMA 1T0SC 4A9AA 4WH4A 2NR2A 3TUOA 4GN1A 2KWVB 4MH8A 2ACZB 2VZKB 3EFCA 1J19A 2IO3B 1FMAD 3OJ3A 2O6VA 3GP7A 4E3CA 1WE6A 2AYOB 1QLBB 2Z59B 4MSQB 4W9IA 1T0QC 4WWMA 4B95A 4BKSD 4B9KA 5LXIB 1RLFA 1TGZB 3AB5A 4KVGB 1DOYA 1GB1A 1YQ4B 3V60A 2QC8A 2KZRA 1I4XA 3EFUA 1OEYJ 1ENFA 2VH1A 3AULA 3E9SA 3VAWA 4FADA 1YX6B 1V6EA 2DENB 4TV3A 2LGXA 3N1ZC 5KHOA 4XWTA 2ZCBA 2FUHB 2K8CA 1ZDXA 3BVGA 3NZUA 3Q14C 2MA9B 1WJUA 1YMHE 2KACA 2WXQA 2UWQA 1CQVA 3UGBB 4WJOA 4QAYA 1PGAA 3NVZA 2BKFA 3UI3A 1FNWA 4JPSA 4EZJA 3K9OB 2WGSA 1SE3A 1NBFC 5D6JB 3VFKA 1NYRA 3NZ3A 2K0PA 3QAQA 4YWGG 2MBOA 3JSVB 4ACFA 5JZEB 4DK5A 3Q3NC 1WX7A 4EUTA 2YLMA 1K52A 1P3QU 1ACCA 4C80A 2Y5CA 2NVUI 2GB1A 2BYTA 1F52A 1TS4A 4C7YA 2UYZB 3V62A 2PKOA 1T3QA 4LNOA 1E8ZA 3DBLI 5H92C 4YTNB 2I1KA 2A4ZA 4II2B 5JHAA 4J6IA 2WQYB 2GI9A 2PVOD 1YIWA 1ZUD2 5EE9A 4EFOA 3I5JC 2MSED 2BB6A 2W54A 2BPSA 3PZDA 3KW5B 1MHHE 4LDTB 1C79A 4M8MA 3M62B 4WJPA 3ML9A 2LHDA 3L13A 3VVWB 3C8YA 2E6XA 3NG0A 1MG4A 4B6WA 2PVGC 3QK0A 3VTVA 1GOZA 1UBQA 3RULA 3ZNHB 2QJLA 1Q5WB 3Q2AC 1TIFA 4JE3B 5TSSA 2WDTB 3GE8C 2L52A 2V3NA 2NPTA 3MFGA 2K39A 4EOYA 1AW7A 2FCNA 4YTPB 4WIPA 1OQRA 4MGIE 3ZTDA 3AEEB 4C4VB 5JHBA 4AS1A 4NPNA 1AWDA 5AEKB 1UGJA 4LJPB 4EZKA 3AE1B 1QOBA 1JWUD 2B76B 5G5HA 2DYBA 3ZUNA 3SFDB 3V3XA 4N9F4 2KLCA 4MJSA 5J2RA 2YEPF 4AP4C 4HKZE 1D4BA 1WYWB 2K6QA 1VZ8A 4IDIA 3NUHB 1ZKHA 4HDQA 4DXFA 2AL6A 3W1YA 1R7SA 4G3XB 5D3IB 1YJIA 5J17A 3HRDD 3N3KB 2KFKB 3DBRI 3PGEA 4EZLA 3R7RA 3ZLZA 1MVKA 3I3TB 4Q2JA 1UUPA 2DWQA 2WXOA 4GDLA 4OVZA 5IO9A 2KQ4X 4KDIC 2IO0B 1WXVA 1FFUA 3H8HA 2KMMA 1N60A 2IGGA 1WGKA 1E8YA 3DWGC 4A55A 2G1EA 3ZGZA 1HQRD 3GZNB 4GB9A 2KOXA 3CSFA 5AUIA 3RZFA 4ZRKA 3NY5A 2RDGA 3HHMA 3PHWB 4YT0B 1NVID 2KLGA 4P7IA 2LWPA 2KQSA 1UWMA 4LNFA 4DDID 3A1QB 3RNEC 2L05A 4K3CA 3DHHC 3ZNID 2FNJB 4FJVB 4BBNF 3BYYB 2IJ0A 4KIKB 2WDVB 2Y5PA 1GNUA 1UF0A 2LVPA 2YVCA 4US9A 3DBRB 1TS2A 2R61A 2K25A 2LUMA 2BS3B 4WAFA 3EUB2 3BVMA 3MC9A 1PGXA 2FCQA 3JYUA 4ZHPA 5L95C 1K53A 1VZ7A 1ZOYB 4B0MA 1E9MA 2WU2B 1RM6C 4D2KA 1XEEA 4NAMA 3APFA 2M4NA 1KOTA 4XDCA 3AI5A 4L1BA 1I7HA 4K81A 3N9YC 2JT4B 1YOVB 2KAJA 2WYQA 3VDZA 1E7VA 3IHPC 1VRAB 3QWZB 1TYGB 2MBBB 1FNVA 2D10A 3S2AA 2QDFA 5IAAC 1JRPA 5IP4D 2SEBD 3LJ3A 3UQAA 4JL9A 2AQ3B 2WXKA 3AE3B 1F9JA 1STEA 1RYJA 4MGKE 4W9JA 1VLBA 2K3UA 1ISNA 4E71A 2JWUA 4HPPA 1V80A 3BK2A 3VR8B 1Y56A 3DVNU 1EO6A 4PYZA 1F0ZA 3Q8BA 2Z0EB 1WX8A 4WJNA 2WXLA 4DHZB 2FE8A 2LRWA 2KDEB 2W3RA 3DBSA 1Z2MA 2AWTA 4KV2A 3M95A 3MJWA 2BS4B 4MM3B 3WAPA 2KJHB 2L00B 5HFYA 2BKRB 1L4ZB 1QF6A 1VDVA 4OHJA 1PDXA 2KMAA 3PVLA 3RYTA 3O65B 2JF5A 4HDOA 3H1UA 4TMAB 4ITKA 3I57A 2KDBA 4NZLB 1CK1A 1YQBA 2MX2A 2V3PA 2HD5B 3KLSX 2QIEB 3TMPB 1JRUA 1XLPA 1WRIA 1PQSA 2V0GA 2KD0A 3FILA 3IXSA 2FUG1 4MH0E 3KVFB 2KVRA 5JXVA 1HZ6A 3U7ZA 1EWYC 2LVOA 4OZCA 3HM6X 4TQ0A 3BINA 5LNK1 3Q8FA 2BS2B 3GE3C 2V3SA 4LCDE 3P4RB 1FO4A 2N9LA 2Q5WD 4ZRPA 3T3OA 3B08A 3PV1A 2UU7A 2CR5A 5EE3A 5J18A 4GXBA 3QCAA 3TSSA 3N32A 3SDLC 3NVVA 4ANVA 3ZTCA 4F1SA 1WY8A 4AOFA 2NBUA 3ZJTA 3AM9A 1Y8RC 5BO4B 3P2BA 1C77A 3J9CA 2SAKA 4G50A 1CMXB 3L4PA 4KDLB 4KGSA 3Q3OC 2PEAA 3TL5A 3RMKC 5BYQA 3A9JB 4XZ4A 2M17A 5L83A 2PMVA 2MBEA 1OFFA 2ZPYA 4PYUA 3AE5B 3EA6A 3ZDMC 1NI2A 1C4AA 3Q8EA 3NOBA 2OEDA 3BY4B 2AQ2B 3AU4A 3AE8B 3IVFA 1YN4A 3RNFC 4W9EA 3ZYYX 2INDC 2N7EA 1GPXA 2AEHA 4ZRIA 4MELA 1XLOA 3NS1A 3U7DA 3H6NA 4W9LA 3RZWC 3ZXVA 4ANUA 2K22A 2DNFA 3X0WA 1MPEA 4EEWA 2WXMA 4PS3A 4A6QA 2KT7A 4OZBA 3PZ8A 1NYQA 3AEGB 1EU3A 4K7WA 3W9CB 1GC6A 1KLVA 3WA0A 2MP2A 3FAHA 2MRPA 5CHWA 1MJDA 4DHZE 2WWZA 1V97A 4OZAA 2BTEA 1V1PB 2W9NA 2KDMA 1YNTE 3AEAB 1NI3A 3V6CB 3ZKJC 1KM7A 4BBNC 1T6BX 4A90A 3UQBA 3VHTC 3HM3A 2WNMA 2KDFB 3IAM1 2E3TA 4S17A 1FCCC 3PLVA 1XCTL 4DHJD 5IA7A 1P7EA 2LZ6A 2JRIB 4JIOU 2LD9A 1FCLA 4LDTD 3B9JA 2KYWA 2C5LC 2W82A 3PRMB 2EMTA 2N7JA 3DCGA 1L2NA 4RGOS 2KX3A 3W2DA 2OJRA 3PT2B 1N5WA 2X38A 2M0AA 3HUIA 2MLBA 3AE6B 1E90A 4YXDB 3ETRA 3U8ZA 4GDKA 3LYYA 5C3JB 3LXFA 3L54A 3T9LA 2LRUA 2BYEA 4N59A 4CO7A 1D6EC 2MP2B 4YSXB 1IBXB 1WXQA 2KX0A 3PREA 4R3DA 3AN1A 3UINB 5DPSA 2D3BA 2AQ1B 3TBLD 4AUQC 1AN8A 2CHZA 1FEHA 2KQ7A 2RR9A 2GBJA 1FM0D 4USAA 2XBBC 2ZVOA 3W5VB 2JUOA 3QQ8B 4GMVA 2NS5A 1DOIA 3BK1A 3OG5A 1KF6B 1C9FA 5GXGB 4OVVA 1WI0A 4BZAA 3PLUA 2GOWA 1SIFA 1FRDA 4WURA 2RGFA 4ZRJA 3QX1A 1WWTA 2KO3A 1TZOA 1R4NB 4GOCA 4NNJB 1PYWD 2IPKD 2N7DA 4CQNA 1PUTA 2QSDA 1ZE3D 4LNNA 1FNUA 4BOSC 1VR9A 1ZGUB 4RGMA 1BUIC 3R2TA 1JWAD 2KMCA 3MC8A 3CWIA 2BYVE 3AEDB 4NAWB 2BVCA 3RUIB 1P7FA 1XF5L 2K5PA 4I6LB 3ZQ4A 1VCBA 3IFWB 2HJ1A 3P4SB 2M19A 2QHOA 1LM8B 2KTRB 1IYFA 3PRZA 1GB4A 1XXGA 4A3PA 2DZKA 1I4GA 4RM9A 1WYGA 2ONQA 5E6NA 3T3NA 1C4CA 3R8BA 1UH6A 2JXTA 3IAS1 5IN7A 1N61A 2WXPA 4W9CA 1HTOA 3VTWA 2W3SA 4C4VA 1JWBD 4GSWA 4DQOC 4C00A 3LDZE 4XDDA 2FAZA 2XK5A 4N6EB 5EE0A 1E8XA 5CX3A 3ZJUA 1PGBA 2JY6A 2V4IB 4HWIB 3IT6B 4W9GA 2WDRB 3NVYA 4NJ6A 4RGTA 3SD5A 1SEBD 2DAJA 5LLIA 3BYTB 3ONSA 2R2QA 3EHVA 2REXA 3ZVVA 1F2RC 1P98A 2IBIB 4A20A 1LGRA 2DX5B 3ECIA 1TJEA 3SR6A 1TY2A 5HG2A 4LK0M 5HKHA 4YSZB 2WXNA 4JQWC 2IY0B 1B1ZA 2D07B 4KZCA 3VQIA 3AE2B 2QEJC 4FLHA 3VRAB 2GBRA 4I6PA 3PTFC 2D5GA 1HA5A 2ZNVB 1J7BA 4FN2A 1UELA 4WJQA 2BT6A 4IC7B 1SE9A 2MWSB 5D2MB 1WGYA 4RGNA 2LJ5A 3HK0A 1ZXIA 3TEWA 3AU5A 4HCNB 4N58A 3A4RA 3VUXA 4M0WA 1I4HA 4URKA 1M4VA 3U30A 3Q8CA 1GG3A 2RDBC 2DLBA 2G9HD 1GAQB 5I4DA 1AARA 1LQBA 2J0KA 3EGRA 2LHEA 2JXXA 5DPRA 2KC2A 4P16A 3FC4A 3QJZA 4FA6A 2LGDA 2MHJA 2C7MB 5DPTA 3RFZB 2BBCA 3BIID 1BXTA 1UWXA 1SXTA 4I6NB 5AZHA 2MBQA 4PS7A 4KZ0A 2BQQA 1EWCA 4MGYE 2IDYA 2ON8A 2KC1A 4H2AA 1SE4A 3HVZA 3IBEA 2WXGA 2W55A 3DVNV 1QOGA 2KJ6A 3L16A 4J3OD
chains in the Genus database with same CATH topology
2V3PA 4YTMB 2DYMA 1C4PA 3KLSX 2QIEB 2MEKA 4A9AA 2NMQA 4WH4A 1XLPA 4XE0A 2LFIA 1WRIA 3TUOA 2V0GA 3FILA 3HVDA 2FUG1 3IXSA 4GDLB 5JXVA 4AQ7A 1HZ6A 4MH8A 2ACZB 2VZKB 3U7ZA 1EWYC 1HEZE 1FMAD 1TS5A 3U2SC 3GP7A 2EKIA 4ZHOA 4OZCA 1EU4A 4TQ0A 4HRSA 4KKJA 1TY0A 5LNK1 3Q8FA 1QLBB 2BS2B 4REZA 4JX1C 4WWMA 1Q10A 1L6VA 3P4RB 1FO4A 2N9LA 2Q5WD 2MJ3A 4ZRPA 1YN3A 3AB5A 1OQQA 3T3OA 1DOYA 1GB1A 1PFDA 3OWEB 4O1NA 1YQ4B 5EE3A 1I4XA 3TSSA 3NVVA 1XLNA 3URYA 3V05A 3MC0B 1ENFA 1JW9D 1L4DB 3E9SA 3ZJTA 3AM9A 1F2RI 3KWVA 2JZPA 1J7AA 4IKGA 1C77A 1V1PA 2DYOA 3J9CA 4XWTA 2SAKA 1A70A 2WDQB 2MH7A 3L4PA 4KGSA 1ZDXA 3BVGA 4P6VF 5BYQA 5HHDG 1YMHE 2KACA 2WXQA 4GLSC 3SFEB 1CQVA 2PMVA 1SE2A 2MJDA 1PGAA 1OFFA 3NVZA 3UI3A 1UNSA 3AE5B 3EA6A 1FNWA 4JPSA 5BYRA 1SE3A 1C4AA 2J53A 2L32A 3Q8EA 4ZRQA 5MPOA 2OEDA 2AQ2B 1IGDA 2PIAA 1NYRA 3AE8B 3NZ3A 2K0PA 4YWGG 2WXIA 1YN4A 3ZYYX 1TS3A 3TEYA 1D5ZC 3Q69A 4KGRA 5E6JA 1GPXA 1L6UA 1NENB 4HROA 1K52A 1QT9A 2RDHA 5BYSA 1ACCA 4FXCA 1YJJA 1XLOA 2CJOA 1XO3A 3NS1A 4C80A 2Y5CA 2NTTA 2GB1A 1KRHA 2BYTA 2K22A 1MPEA 1SB3C 1TS4A 1E7PB 2WXMA 1D5MC 4A6QA 1QQRA 4C7YA 1KH0A 4OZBA 1MHXA 4XWWA 3PZ8A 1NYQA 2PLPA 4US8A 1V8CA 3AMZA 2PKOA 2N0SB 3AEGB 1EU3A 1T3QA 2I2YA 4EE2A 1TKYA 3W9CB 1ZDVA 3FAHA 5H92C 4YTNB 1J7CA 2WP9B 1L0YB 2WQYB 1E6EB 2GI9A 2PVOD 3AE4B 3KQ4A 3BVZA 1V97A 4OZAA 2BTEA 1V1PB 2KDMA 1ZUD2 5EE9A 1B9RA 1YNTE 1C76A 4HEA1 3AEAB 5G5GA 1NI3A 1ESFA 1SJED 2BB6A 3AECB 2W54A 3PZ7A 4TQ1A 2MJEA 1RFKA 2IGDA 3AH7A 1T6BX 4A90A 1MHHE 4OW0A 2HDEA 3E56A 3VR9B 3W5UB 1ET9A 1C79A 2WNMA 3IAM1 4TSSA 2E3TA 2LHDA 1FCCC 1XCTL 3C8YA 1P7EA 2INPE 3P63A 2E6XA 2PVGC 1DYQA 3DWMA 2FBWB 1I4QA 4JWSC 3O13A 5FR3A 1QKZA 1GOZA 3I9V1 1MI0A 1FCLA 2QJLA 2K9XA 2EELA 4JE3B 5TSSA 1DOXA 4B0EA 3B9JA 2L52A 3U4EG 2V3NA 2WXRA 2JU6X 2W82A 4MT5A 2N7JA 2WLBA 3FILB 3MP9A 4RGOS 3W2DA 3MFGA 1N5WA 2X38A 1E10A 2M0AA 3HUIA 1HZ5A 2Y3AA 3AE6B 2JYEA 4HKQA 4YXDB 4UDUC 3BWUD 3ETRA 1AW7A 1QOFA 2DBYA 2XN9C 3LYYA 4YTPB 5C3JB 3LXFA 4A8XC 4WIPA 2BW2A 1OQRA 3AEEB 4N59A 4AS1A 1D6EC 3BZDB 4YSXB 2NTSA 1WXQA 1IBXB 1IBXA 1YN5A 1AWDA 4R3DA 3AN1A 1KFYB 5D7GA 1UGJA 2AQ1B 3KWLA 3WCQA 1I4PA 1AN8A 2HTME 1FEHA 1CZPA 3AE1B 1QOBA 1FM0D 1JWUD 2B76B 4USAA 3AV8A 5G5HA 3SFDB 3W5VB 3V3XA 1JMLA 5AUKA 3Q8AA 1DOIA 4LTUA 3BK1A 1N62A 1KF6B 4L2YA 5HI1A 2YEPF 4KKIA 4HKZE 1C9FA 2CJNA 5GXGB 1D4BA 4IDIA 1VZ8A 3NUHB 4DXFA 1FD6A 2WS3B 1XCQL 5T8IA 1R7SA 2WXJA 1YQ3B 1FRDA 4MACA 4WURA 4RF1A 1WWTA 5D3IB 2OHFA 1TZOA 1YJIA 4L23A 1PYWD 2IPKD 3HRDD 4CQNA 3SEBA 1FRRA 1JWSD 1ZP0B 1T5XD 1PUTA 2LEKA 2QSDA 1ZE3D 3LB8C 1FNUA 1N63A 4RH6A 1MVKA 3NRZA 4Q2JA 1VR9A 1UUPA 2DWQA 4RGMA 1BUIC 2WXOA 3ABVB 2PTLA 3R2TA 2WXHA 1JWAD 4OVZA 3CWIA 2J42A 2PW9A 1WSPA 3AEDB 4NAWB 4WQMA 2KQ4X 1P7FA 1XF5L 2K5PA 2QMTA 4NJCA 3ZQ4A 4DXGA 2J4XA 5D3DA 2RMMA 2ICIA 5H8YE 4ZYSA 3P1MA 1FFUA 3H8HA 2KMMA 3P4SB 1N60A 2IGGA 2M19A 1WGKA 2ZW0A 1C78A 1N5XA 3W1SA 2GRIA 1GB4A 1XXGA 1EM7A 3DWGC 4A55A 5BMHA 4KX6B 2G1EA 3ZGZA 1HQRD 1NEKB 1I4GA 3AEBB 2AX5A 1WYGA 2ONQA 3T3NA 5AUIA 1C4CA 3R8BA 3B2FA 2JXTA 2RDGA 3IAS1 1ET6A 5C2TB 4C7ZA 1N61A 1XLQA 1IGCA 2WXPA 3AE9B 4YT0B 1NVID 5FK9C 1JROA 4ARCA 1UWMA 1IUEA 2W3SA 3P4PB 1FXAA 1JWBD 1LO5D 4DQOC 1I4RA 4ZOHC 2J52A 4XDDA 3BYYB 3NVWA 4N6EB 1ZXHA 2BB5A 2IJ0A 5EE0A 2JQRB 1AYFA 2RPVA 3MJ5A 3IT4B 2WDVB 2IGHA 2H89B 1DGJA 3AEFB 4LLGM 2Y5PA 3ZJUA 2M56B 1K50A 1PGBA 2V4IB 4US9A 1FIQA 3IT6B 3VRBB 1SIJA 1TS2A 2R61A 2WDRB 2VZKD 3PO0A 3NVYA 1KLUD 2LUMA 2BS3B 4RFBA 1L0VB 4WAFA 3EUB2 3BVMA 3GB1A 1PGXA 4RGTA 1SEBD 1D5XC 2LMCA 1KLGD 4ZHPA 2LGIA 4C56C 1K53A 1VZ7A 1ZOYB 3BYTB 4B0MA 2INNE 1E9MA 2WU2B 1F2RC 1ZPSA 1RM6C 4D2KA 3SR6A 1TJEA 1SJHD 1XEEA 4NAMA 1TY2A 5HG2A 4YSYB 5FKAC 4LK0M 4XDCA 2N9KA 4YSZB 2WXNA 2KWDA 2LJIA 1CJEA 2JX5A 4L1BA 1JWMD 1V1OA 1B1ZA 1I7HA 3N9YC 2KAJA 1SF0A 3VQIA 3AE2B 2QEJC 2XNAC 3VRAB 1VRAB 2H88B 1TYGB 1ROEA 1FNVA 2D5GA 1QILA 1HA5A 1J7BA 1TKGA 1RWSA 3R2IA 1HXYD 2BT6A 1KTKA 1BMLC 1JRPA 1VZ6A 4HJGE 4RF0A 1F77A 2SEBD 3P4QB 4RGNA 2AQ3B 2WXKA 1L0XB 1ZXIA 2YEPB 3TEWA 3AE3B 4RCOA 2L1AA 4IOIE 3CIRB 1STEA 1RYJA 4N58A 3TEZA 1VLBA 2JSVX 2K3UA 2QILA 2JWUA 3U52E 4M0WA 1JALA 5BMGA 4GDKB 1I4HA 1VJKA 3BK2A 1M4VA 1TKEA 4KGTA 3VR8B 3B2GA 1K51A 3Q8CA 2ZW1A 3MHZA 2CU3A 1Y56A 1E0ZA 5BMIA 1F0ZA 2TSSA 3P42A 3Q8BA 2DLBA 2G9HD 3TEXA 1GAQB 5I4DA 2WXLA 2FE8A 2I38A 4RNAA 2L83A 3GS2A 2W3RA 4JWUC 4PT5A 3EGRA 2LHEA 4P16A 1SBBB 3FC4A 1QOAA 2BS4B 2Z8LA 5EE1A 4MM3B 2WXFA 5HFYA 3RFZB 1FXIA 2BBCA 2WU5B 3BIID 1BXTA 1SSNA 1UWXA 1QF6A 1L4ZB 1SXTA 1VDVA 4OHJA 1PDXA 1L5PA 3ZJVA 2IDYA 2KN4A 1EWCA 2JYTA 2ON8A 4H2AA 3AE7B 1SE4A 1JQ4A 3RPFC 1FFVA 3HVZA 4ARIA 2WXGA 4ITKA 2W55A 4TMAB 3I57A 1QOGA 4NZLB 1CK1A 4J3OD 1JCKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZB A;  1MHX A;  2PLP A;  2LGI A;  1K53 A;  2NMQ A;  2I2Y A;  4WH4 A;  5HI1 A;  1F2R C;  4HKZ E;  1C9F A;  4D2K A;  1D4B A;  3FIL A;  5JXV A;  1FD6 A;  5HG2 A;  1HZ6 A;  1XCQ L;  2N9K A;  1HEZ E;  2KWD A;  4MAC A;  4OZC A;  2GI9 A;  4OZA A;  2KDM A;  1YNT E;  1Q10 A;  2QSD A;  2N9L A;  1MVK A;  2IGD A;  2PTL A;  1MHH E;  1GB1 A;  4HJG E;  2PW9 A;  2KQ4 X;  1P7F A;  1XF5 L;  2QMT A;  1FCC C;  1XCT L;  2LHD A;  1P7E A;  2RMM A;  4IOI E;  2IGG A;  2ZW0 A;  1F2R I;  1QKZ A;  2JSV X;  2JZP A;  4IKG A;  2JWU A;  5BMG A;  1GB4 A;  5BMH A;  1EM7 A;  1MI0 A;  1FCL A;  4KGT A;  2EEL A;  1K51 A;  2ZW1 A;  4KGS A;  2ONQ A;  2JU6 X;  5HHD G;  1YMH E;  5BMI A;  2KAC A;  4GLS C;  2N7J A;  2JXT A;  3FIL B;  3MP9 A;  1IGC A;  2I38 A;  1PGA A;  1HZ5 A;  3UI3 A;  2LHE A;  2J53 A;  2J52 A;  2OED A;  1IGD A;  1ZXH A;  2K0P A;  5HFY A;  1IBX B;  2RPV A;  1IBX A;  4KGR A;  2IGH A;  1UWX A;  1K52 A;  1K50 A;  1PGB A;  2KN4 A;  2ON8 A;  2GB1 A;  2LUM A;  1MPE A;  3V3X A;  3GB1 A;  1KH0 A;  1JML A;  1PGX A; 
#chains in the Genus database with same CATH topology
 2DZI A;  3B1L X;  1WXM A;  2MEK A;  2NMQ A;  2GBK A;  2LFI A;  2LGS A;  3HVD A;  4KIK A;  2CHX A;  4GDL B;  3MTN B;  4AQ7 A;  1HEZ E;  1TS5 A;  2EKI A;  4HRS A;  1TY0 A;  4DXA B;  2CU1 A;  4JX1 C;  2LAS A;  3A1Q A;  4PS8 A;  3ML8 A;  1YN3 A;  1OQQ A;  3ZO5 B;  4BKG A;  3PRP B;  1UGM A;  1PFD A;  3OWE B;  1OQY A;  1NDD A;  4HK2 A;  1XLN A;  3URY A;  3V05 A;  1R4N I;  3MC0 B;  2C7N B;  1JW9 D;  1L4D B;  1V49 A;  1F2R I;  3DDC B;  3KWV A;  4IKG A;  4K7U A;  2DYO A;  2VRR B;  1A70 A;  2JPH A;  1X1M A;  2WDQ B;  2IZV B;  4G11 A;  2MH7 A;  4E74 A;  5HHD G;  2KWU B;  3R3M A;  2KXJ A;  4XGA B;  1SE2 A;  2MJD A;  2FCS A;  3VUY A;  2OJW A;  1UNS A;  3N1X C;  4NQL B;  2G45 B;  3C0R B;  4A3O A;  4FUL A;  1F1H A;  2PIA A;  2A5U A;  2WXI A;  3RNG C;  2KJR A;  4OVU A;  2NPT B;  3TCA A;  1WGR A;  3Q69 A;  3TEY A;  2CHW A;  5E6J A;  1L6U A;  1KJT A;  3ZNZ B;  1QT9 A;  2RDH A;  5BYS A;  3T8M A;  4FXC A;  4MJS B;  1XO3 A;  1E7U A;  4JLC A;  2NTT A;  2G3Q B;  1KRH A;  3N20 C;  1E7P B;  1D5M C;  1QQR A;  1KH0 A;  2LI5 A;  1MHX A;  4XWW A;  2PLP A;  1V8C A;  4WWN A;  2N0S B;  2IO2 B;  2ZPN A;  1ZDV A;  4MM3 A;  1Q0W B;  1J7C A;  2WP9 B;  2JRH A;  3NJT A;  1L0Y B;  2J7Q B;  1L7Y A;  3AE4 B;  3KQ4 A;  3TIX A;  1B9R A;  5G5G A;  1EUV B;  2L7R A;  2DZJ A;  1ESF A;  3PZ7 A;  4TQ1 A;  3KYC D;  3V61 A;  1RFK A;  3AH7 A;  4OW0 A;  2O2V B;  2HDE A;  3EC8 A;  3VR9 B;  4HPL B;  2HE7 A;  2KVZ A;  2INP E;  3P63 A;  3DWM A;  1I4Q A;  4JWS C;  5C23 A;  1SGH A;  5FR3 A;  1QKZ A;  2ZNV C;  2K8H A;  1WZ0 A;  1MI0 A;  2M8S A;  2NBV B;  1DOX A;  1TT5 B;  2RD0 A;  2PJH A;  3U4E G;  2WXR A;  3OLM D;  2N1W A;  2GLS A;  2N9E B;  2WLB A;  3MP9 A;  4IW0 A;  4M02 A;  1HZ5 A;  1V2Y A;  2JYE A;  2ZVN A;  4HKQ A;  3JW0 X;  3K9P B;  1MFW A;  4ICV A;  2DBY A;  2XN9 C;  2BW2 A;  3Q6B A;  1MG8 A;  3FKY A;  3DBL B;  1WM3 A;  5AZF A;  1KFY B;  5D7G A;  2N4F A;  3KWL A;  3WCQ A;  2HTM E;  5G55 A;  1CZP A;  1WX9 A;  4G0N B;  4ANX A;  4X57 B;  1EF5 A;  1FXT B;  2IYD B;  2C9W B;  3APC A;  1N62 A;  5HI1 A;  4KKI A;  4KSK C;  2Y5B B;  1EF1 A;  1YJ1 A;  2WS3 B;  1LXD A;  4RF1 A;  2JZ3 B;  2OHF A;  4M0W B;  2I1J A;  3SEB A;  1FRR A;  3LB8 C;  1YX5 B;  4RH6 A;  1TBE A;  3APD A;  2MQJ A;  3ABV B;  2WXH A;  5LXH A;  2J42 A;  4DXG A;  2QMT A;  2J4X A;  2ICI A;  5H8Y E;  2MBH A;  2ZW0 A;  4AJW A;  4M01 A;  1C78 A;  2L76 A;  2GRI A;  4BVU C;  5BMH A;  1EM7 A;  2DZM A;  4KX6 B;  1WRD B;  3KYD D;  1NEK B;  4W9D A;  2L8J A;  3AEB B;  2AX5 A;  3SHQ A;  5C2T B;  1XLQ A;  3ZXR A;  1HTQ A;  2ZJD A;  4WQO B;  3SU8 X;  1XQQ A;  3N30 A;  1IUE A;  3H7S A;  3P4P B;  1H4R A;  3TJP A;  5IKC M;  1Q1O A;  1FXA A;  1LO5 D;  2J52 A;  2WX1 A;  3NVW A;  1G6J A;  3DPD A;  4FJY A;  2JQR B;  1WXA A;  1AYF A;  2RPV A;  3MJ5 A;  4HCP B;  2XEW A;  4IG7 B;  4AWJ A;  4F7Z A;  1DGJ A;  3AEF B;  4LLG M;  1J0G A;  1WGG A;  2M0X A;  3GOE A;  4M00 A;  3EEC A;  4P1B C;  3A9K B;  4DBG A;  1FIQ A;  5G2N A;  1SIJ A;  2XK5 B;  1YD8 U;  2GBN A;  4RFB A;  1L0V B;  3GB1 A;  1V5O A;  4K3B A;  2LMC A;  1KLG D;  1UZX B;  3MHS D;  4LNK A;  2KWC A;  2N1V A;  1WMH A;  2INN E;  1ZPS A;  4FHK A;  3QHT A;  1TZ1 A;  1SJH D;  5FKA C;  2CS4 A;  2N9K A;  1OTR B;  2KWD A;  2LJI A;  1T0Y A;  1WM2 A;  1JWM D;  1V1O A;  4FBJ B;  4WWO A;  1IPG A;  1R4M B;  2KTR A;  2H88 B;  3RT3 B;  1R4M I;  2VH2 A;  1ROE A;  1QIL A;  1TKG A;  3R2I A;  3ZDT A;  1VZ6 A;  1BML C;  4HJG E;  1OEY A;  3PPA A;  3WAO A;  4RCO A;  4BAX A;  1WIA A;  1S1Q B;  5BMG A;  4GDK B;  1WGH A;  3PS6 A;  1C1Y B;  4IWP A;  1GJZ A;  3RD2 A;  3B2G A;  4CYE A;  2CU3 A;  2O6V D;  3ZIM A;  1VD2 A;  2N9P C;  1E0Z A;  5BMI A;  2TSS A;  3L10 B;  3UIP B;  2V4L A;  2I38 A;  3NHE B;  5GMV A;  2L83 A;  3GS2 A;  2BF8 B;  3M3J A;  1P9D U;  2ZEQ A;  3OJ4 B;  4GU2 A;  3RNA C;  1SBB B;  2EKE C;  1QOA A;  5EE1 A;  2OOB B;  2WXF A;  2WU5 B;  1RFA A;  4GIV A;  1SSN A;  4NJ7 A;  3X23 A;  1L5P A;  1Z5S B;  2KAN A;  1JQ4 A;  3RPF C;  3RNB C;  2WHI A;  4ARI A;  5CTR C;  4W9H A;  1JCK B;  2ZZP B;  4YTM B;  4P1C C;  1C4P A;  3CF6 E;  4XE0 A;  4IWQ A;  3NS8 A;  2L0F A;  2G4D B;  3ZRF A;  3JSV A;  3DBH B;  3JVZ X;  5DPW A;  1V86 A;  2DAF A;  3U2S C;  2K1F A;  4ZHO A;  1EU4 A;  4IWO A;  2B3A A;  4KKJ A;  2DHZ A;  3UF8 A;  4REZ A;  4FHJ A;  1Q10 A;  1RRB A;  4NY0 A;  1L6V A;  3H9D A;  5E6P A;  2INC C;  2MJ3 A;  3WAM A;  3V6E B;  1P1A A;  4EKU A;  4O1N A;  3AXC A;  3NZS A;  1RAX A;  2L0T A;  4LNI A;  2RPQ A;  4BKT A;  4ICU A;  2KN5 A;  5TR5 A;  2JZP A;  1J7A A;  1V1P A;  1HE8 A;  2BWF A;  1K8R B;  3VTU A;  5AZG A;  1WZ3 A;  4P6V F;  4DHJ B;  5JH5 C;  2LUE A;  4GLS C;  3SFE B;  2AL3 A;  2JZZ A;  2D3A A;  3WIM A;  2WX0 A;  2JVC A;  5BYR A;  2J53 A;  2L32 A;  2O6V B;  4ZRQ A;  5MPO A;  4TUU A;  1IGD A;  3DBH I;  2EMS A;  1TS3 A;  1D5Z C;  4KGR A;  3DVG Y;  1NEN B;  4HRO A;  4TKN A;  3L0W B;  1YJJ A;  2CJO A;  4ZDV A;  2M1M A;  4MGZ E;  4IM3 A;  1I35 A;  1SB3 C;  4XX5 A;  2PE9 A;  2PE6 B;  4US8 A;  2L3Z A;  3AMZ A;  3B0A A;  2GMI C;  2I2Y A;  3WAL A;  4EE2 A;  1TKY A;  2KTF A;  3H7P A;  2KNB A;  4S0R A;  3A9J A;  1OGW A;  2D11 A;  3KUC B;  4AJY B;  1E6E B;  1V5T A;  3VH4 B;  3BVZ A;  3ZW3 A;  3QA8 A;  1C76 A;  4HEA 1;  4MEM A;  2C60 A;  1SJE D;  3AEC B;  3CST A;  2MJE A;  4MDK E;  2IGD A;  3W5U B;  3E56 A;  2PPH A;  1ET9 A;  1D3Z A;  3KUD B;  4YL8 A;  4DDG D;  2D2Q A;  4TSS A;  3DHI C;  5CHV C;  2MCN B;  1UD7 A;  1DYQ A;  4ASW C;  2FBW B;  3O13 A;  2NBW B;  1QZE A;  3I9V 1;  5E6O A;  3W1S C;  4HLE A;  4HXD A;  2K9X A;  2EEL A;  4B0E A;  2LXA A;  1M94 A;  2JU6 X;  4MT5 A;  3FIL B;  2V1Y A;  1E5W A;  2IO1 B;  1E10 A;  2HTH A;  2Y3A A;  4UDU C;  3BWU D;  1WJ4 A;  3N1Y C;  1QOF A;  4A8X C;  2N9X A;  2MW5 A;  1XT9 B;  4NAW A;  4M8N A;  3BZD B;  2J0M A;  1LFD A;  2NTS A;  1IBX A;  3RCZ A;  1YN5 A;  4GGQ A;  5EDS A;  2ZCC A;  1I4P A;  3RN9 C;  2D3C A;  1U4A A;  3L08 A;  3AV8 A;  2NCN A;  2HJ8 A;  5FR6 A;  3D32 A;  1JML A;  5AUK A;  1WE7 A;  3Q8A A;  1P0R A;  4LTU A;  1T0R C;  4L2Y A;  4F8C B;  4IM2 A;  1N6Z A;  2CJN A;  4MSM B;  2Z0D B;  3CMM B;  1WJ6 A;  1FD6 A;  2KHW B;  5CHF A;  1XCQ L;  2IY1 B;  3L17 A;  1I42 A;  5T8I A;  3DOW A;  2WXJ A;  1YQ3 B;  2LVQ A;  4MAC A;  3QC8 B;  3PSE B;  2LXC A;  2KK8 A;  1C3T A;  4K7S A;  4L23 A;  2ASQ A;  3R66 C;  1JWS D;  1ZP0 B;  1T5X D;  2LEK A;  3Q3F A;  1GC7 A;  3ZNG C;  1WR6 E;  3VUW A;  1N63 A;  4RMA A;  3NRZ A;  2PTL A;  3IG3 A;  3KH0 A;  2PW9 A;  1WSP A;  1WR1 A;  4W9F A;  4WWP A;  4WQM A;  4NJC A;  4ZYN A;  3A33 B;  2RMM A;  5D3D A;  1V81 A;  4ZYS A;  2FID A;  3P1M A;  3VH3 B;  1N5X A;  2LGY A;  3R7Q A;  3W1S A;  3QIJ A;  4NQK E;  1WH3 A;  4ANW A;  3A4S C;  2X8X X;  3I63 C;  2KFJ A;  3B2F A;  3Q3M C;  1ET6 A;  4C7Z A;  1IP9 A;  5IOI A;  1IGC A;  3AE9 B;  1WF9 A;  5FK9 C;  1JRO A;  4ARC A;  1WJN A;  2G4S A;  1FPY A;  4XC2 A;  1I4R A;  4ZOH C;  1TTN A;  2K6D B;  2K8B A;  1WXS A;  3UIO B;  1ZXH A;  2BB5 A;  1ZW7 A;  5C1Z A;  5KHQ A;  3IT4 B;  2IGH A;  4CHK A;  2H89 B;  2M56 B;  1K50 A;  2RSU A;  2QCZ A;  1XD3 B;  1S3S G;  2JWZ A;  2R2O A;  3VRB B;  4DWF A;  2VZK D;  3PO0 A;  1KLU D;  2J0J A;  2BWE S;  1UBI A;  1D5X C;  1GUA B;  2LGI A;  4C56 C;  2BGF A;  2KDI A;  4YSY B;  2O2V A;  1CJE A;  2JX5 A;  4KSL C;  4BFR A;  4BOZ B;  3PHX B;  1SF0 A;  2XNA C;  3RNC C;  3ENE A;  1RWS A;  2BYF A;  1HXY D;  1KTK A;  3QAR A;  3DHG C;  4RF0 A;  1F77 A;  3P4Q B;  1L0X B;  3ALB A;  2YEP B;  2L1A A;  4IOI E;  3CIR B;  2GBM A;  1H8C A;  3VXW A;  2KFK A;  3TEZ A;  4II3 B;  2JSV X;  2QIL A;  3U52 E;  1JAL A;  4IM0 A;  1A5R A;  4HVB A;  1VJK A;  4LJO B;  1TKE A;  3A9K A;  4KGT A;  1K51 A;  3DVG X;  2ZW1 A;  3MHZ A;  3P42 A;  3C19 A;  3GZN I;  3TEX A;  5D94 A;  5DCN A;  3WAN A;  2C7H A;  4RNA A;  4PK1 A;  1E8W A;  4JWU C;  1BT0 A;  4W9K A;  4K1R B;  4PT5 A;  3KUZ A;  2KKC A;  4FJZ A;  4XYC A;  1WGD A;  2Z8L A;  3RI7 C;  4JGH B;  4HPM B;  3H7P B;  3Q3J A;  2V9H A;  1V9J A;  1FXI A;  2FCM A;  1WMH B;  3OAW A;  1WFY A;  3ZJV A;  4WAA A;  4IUM B;  2KN4 A;  2JYT A;  4HJK A;  3AE7 B;  3ZRC A;  3DQV A;  1FFV A;  3HIZ A;  4BKS A;  1J8C A;  2D3G A;  3M63 B;  2CKH B;  2FIF A;  4RM8 A;  2DYM A;  1T0S C;  4A9A A;  4WH4 A;  2NR2 A;  3TUO A;  4GN1 A;  2KWV B;  4MH8 A;  2ACZ B;  2VZK B;  3EFC A;  1J19 A;  2IO3 B;  1FMA D;  3OJ3 A;  2O6V A;  3GP7 A;  4E3C A;  1WE6 A;  2AYO B;  1QLB B;  2Z59 B;  4MSQ B;  4W9I A;  1T0Q C;  4WWM A;  4B95 A;  4BKS D;  4B9K A;  5LXI B;  1RLF A;  1TGZ B;  3AB5 A;  4KVG B;  1DOY A;  1GB1 A;  1YQ4 B;  3V60 A;  2QC8 A;  2KZR A;  1I4X A;  3EFU A;  1OEY J;  1ENF A;  2VH1 A;  3AUL A;  3E9S A;  3VAW A;  4FAD A;  1YX6 B;  1V6E A;  2DEN B;  4TV3 A;  2LGX A;  3N1Z C;  5KHO A;  4XWT A;  2ZCB A;  2FUH B;  2K8C A;  1ZDX A;  3BVG A;  3NZU A;  3Q14 C;  2MA9 B;  1WJU A;  1YMH E;  2KAC A;  2WXQ A;  2UWQ A;  1CQV A;  3UGB B;  4WJO A;  4QAY A;  1PGA A;  3NVZ A;  2BKF A;  3UI3 A;  1FNW A;  4JPS A;  4EZJ A;  3K9O B;  2WGS A;  1SE3 A;  1NBF C;  5D6J B;  3VFK A;  1NYR A;  3NZ3 A;  2K0P A;  3QAQ A;  4YWG G;  2MBO A;  3JSV B;  4ACF A;  5JZE B;  4DK5 A;  3Q3N C;  1WX7 A;  4EUT A;  2YLM A;  1K52 A;  1P3Q U;  1ACC A;  4C80 A;  2Y5C A;  2NVU I;  2GB1 A;  2BYT A;  1F52 A;  1TS4 A;  4C7Y A;  2UYZ B;  3V62 A;  2PKO A;  1T3Q A;  4LNO A;  1E8Z A;  3DBL I;  5H92 C;  4YTN B;  2I1K A;  2A4Z A;  4II2 B;  5JHA A;  4J6I A;  2WQY B;  2GI9 A;  2PVO D;  1YIW A;  1ZUD 2;  5EE9 A;  4EFO A;  3I5J C;  2MSE D;  2BB6 A;  2W54 A;  2BPS A;  3PZD A;  3KW5 B;  1MHH E;  4LDT B;  1C79 A;  4M8M A;  3M62 B;  4WJP A;  3ML9 A;  2LHD A;  3L13 A;  3VVW B;  3C8Y A;  2E6X A;  3NG0 A;  1MG4 A;  4B6W A;  2PVG C;  3QK0 A;  3VTV A;  1GOZ A;  1UBQ A;  3RUL A;  3ZNH B;  2QJL A;  1Q5W B;  3Q2A C;  1TIF A;  4JE3 B;  5TSS A;  2WDT B;  3GE8 C;  2L52 A;  2V3N A;  2NPT A;  3MFG A;  2K39 A;  4EOY A;  1AW7 A;  2FCN A;  4YTP B;  4WIP A;  1OQR A;  4MGI E;  3ZTD A;  3AEE B;  4C4V B;  5JHB A;  4AS1 A;  4NPN A;  1AWD A;  5AEK B;  1UGJ A;  4LJP B;  4EZK A;  3AE1 B;  1QOB A;  1JWU D;  2B76 B;  5G5H A;  2DYB A;  3ZUN A;  3SFD B;  3V3X A;  4N9F 4;  2KLC A;  4MJS A;  5J2R A;  2YEP F;  4AP4 C;  4HKZ E;  1D4B A;  1WYW B;  2K6Q A;  1VZ8 A;  4IDI A;  3NUH B;  1ZKH A;  4HDQ A;  4DXF A;  2AL6 A;  3W1Y A;  1R7S A;  4G3X B;  5D3I B;  1YJI A;  5J17 A;  3HRD D;  3N3K B;  2KFK B;  3DBR I;  3PGE A;  4EZL A;  3R7R A;  3ZLZ A;  1MVK A;  3I3T B;  4Q2J A;  1UUP A;  2DWQ A;  2WXO A;  4GDL A;  4OVZ A;  5IO9 A;  2KQ4 X;  4KDI C;  2IO0 B;  1WXV A;  1FFU A;  3H8H A;  2KMM A;  1N60 A;  2IGG A;  1WGK A;  1E8Y A;  3DWG C;  4A55 A;  2G1E A;  3ZGZ A;  1HQR D;  3GZN B;  4GB9 A;  2KOX A;  3CSF A;  5AUI A;  3RZF A;  4ZRK A;  3NY5 A;  2RDG A;  3HHM A;  3PHW B;  4YT0 B;  1NVI D;  2KLG A;  4P7I A;  2LWP A;  2KQS A;  1UWM A;  4LNF A;  4DDI D;  3A1Q B;  3RNE C;  2L05 A;  4K3C A;  3DHH C;  3ZNI D;  2FNJ B;  4FJV B;  4BBN F;  3BYY B;  2IJ0 A;  4KIK B;  2WDV B;  2Y5P A;  1GNU A;  1UF0 A;  2LVP A;  2YVC A;  4US9 A;  3DBR B;  1TS2 A;  2R61 A;  2K25 A;  2LUM A;  2BS3 B;  4WAF A;  3EUB 2;  3BVM A;  3MC9 A;  1PGX A;  2FCQ A;  3JYU A;  4ZHP A;  5L95 C;  1K53 A;  1VZ7 A;  1ZOY B;  4B0M A;  1E9M A;  2WU2 B;  1RM6 C;  4D2K A;  1XEE A;  4NAM A;  3APF A;  2M4N A;  1KOT A;  4XDC A;  3AI5 A;  4L1B A;  1I7H A;  4K81 A;  3N9Y C;  2JT4 B;  1YOV B;  2KAJ A;  2WYQ A;  3VDZ A;  1E7V A;  3IHP C;  1VRA B;  3QWZ B;  1TYG B;  2MBB B;  1FNV A;  2D10 A;  3S2A A;  2QDF A;  5IAA C;  1JRP A;  5IP4 D;  2SEB D;  3LJ3 A;  3UQA A;  4JL9 A;  2AQ3 B;  2WXK A;  3AE3 B;  1F9J A;  1STE A;  1RYJ A;  4MGK E;  4W9J A;  1VLB A;  2K3U A;  1ISN A;  4E71 A;  2JWU A;  4HPP A;  1V80 A;  3BK2 A;  3VR8 B;  1Y56 A;  3DVN U;  1EO6 A;  4PYZ A;  1F0Z A;  3Q8B A;  2Z0E B;  1WX8 A;  4WJN A;  2WXL A;  4DHZ B;  2FE8 A;  2LRW A;  2KDE B;  2W3R A;  3DBS A;  1Z2M A;  2AWT A;  4KV2 A;  3M95 A;  3MJW A;  2BS4 B;  4MM3 B;  3WAP A;  2KJH B;  2L00 B;  5HFY A;  2BKR B;  1L4Z B;  1QF6 A;  1VDV A;  4OHJ A;  1PDX A;  2KMA A;  3PVL A;  3RYT A;  3O65 B;  2JF5 A;  4HDO A;  3H1U A;  4TMA B;  4ITK A;  3I57 A;  2KDB A;  4NZL B;  1CK1 A;  1YQB A;  2MX2 A;  2V3P A;  2HD5 B;  3KLS X;  2QIE B;  3TMP B;  1JRU A;  1XLP A;  1WRI A;  1PQS A;  2V0G A;  2KD0 A;  3FIL A;  3IXS A;  2FUG 1;  4MH0 E;  3KVF B;  2KVR A;  5JXV A;  1HZ6 A;  3U7Z A;  1EWY C;  2LVO A;  4OZC A;  3HM6 X;  4TQ0 A;  3BIN A;  5LNK 1;  3Q8F A;  2BS2 B;  3GE3 C;  2V3S A;  4LCD E;  3P4R B;  1FO4 A;  2N9L A;  2Q5W D;  4ZRP A;  3T3O A;  3B08 A;  3PV1 A;  2UU7 A;  2CR5 A;  5EE3 A;  5J18 A;  4GXB A;  3QCA A;  3TSS A;  3N32 A;  3SDL C;  3NVV A;  4ANV A;  3ZTC A;  4F1S A;  1WY8 A;  4AOF A;  2NBU A;  3ZJT A;  3AM9 A;  1Y8R C;  5BO4 B;  3P2B A;  1C77 A;  3J9C A;  2SAK A;  4G50 A;  1CMX B;  3L4P A;  4KDL B;  4KGS A;  3Q3O C;  2PEA A;  3TL5 A;  3RMK C;  5BYQ A;  3A9J B;  4XZ4 A;  2M17 A;  5L83 A;  2PMV A;  2MBE A;  1OFF A;  2ZPY A;  4PYU A;  3AE5 B;  3EA6 A;  3ZDM C;  1NI2 A;  1C4A A;  3Q8E A;  3NOB A;  2OED A;  3BY4 B;  2AQ2 B;  3AU4 A;  3AE8 B;  3IVF A;  1YN4 A;  3RNF C;  4W9E A;  3ZYY X;  2IND C;  2N7E A;  1GPX A;  2AEH A;  4ZRI A;  4MEL A;  1XLO A;  3NS1 A;  3U7D A;  3H6N A;  4W9L A;  3RZW C;  3ZXV A;  4ANU A;  2K22 A;  2DNF A;  3X0W A;  1MPE A;  4EEW A;  2WXM A;  4PS3 A;  4A6Q A;  2KT7 A;  4OZB A;  3PZ8 A;  1NYQ A;  3AEG B;  1EU3 A;  4K7W A;  3W9C B;  1GC6 A;  1KLV A;  3WA0 A;  2MP2 A;  3FAH A;  2MRP A;  5CHW A;  1MJD A;  4DHZ E;  2WWZ A;  1V97 A;  4OZA A;  2BTE A;  1V1P B;  2W9N A;  2KDM A;  1YNT E;  3AEA B;  1NI3 A;  3V6C B;  3ZKJ C;  1KM7 A;  4BBN C;  1T6B X;  4A90 A;  3UQB A;  3VHT C;  3HM3 A;  2WNM A;  2KDF B;  3IAM 1;  2E3T A;  4S17 A;  1FCC C;  3PLV A;  1XCT L;  4DHJ D;  5IA7 A;  1P7E A;  2LZ6 A;  2JRI B;  4JIO U;  2LD9 A;  1FCL A;  4LDT D;  3B9J A;  2KYW A;  2C5L C;  2W82 A;  3PRM B;  2EMT A;  2N7J A;  3DCG A;  1L2N A;  4RGO S;  2KX3 A;  3W2D A;  2OJR A;  3PT2 B;  1N5W A;  2X38 A;  2M0A A;  3HUI A;  2MLB A;  3AE6 B;  1E90 A;  4YXD B;  3ETR A;  3U8Z A;  4GDK A;  3LYY A;  5C3J B;  3LXF A;  3L54 A;  3T9L A;  2LRU A;  2BYE A;  4N59 A;  4CO7 A;  1D6E C;  2MP2 B;  4YSX B;  1IBX B;  1WXQ A;  2KX0 A;  3PRE A;  4R3D A;  3AN1 A;  3UIN B;  5DPS A;  2D3B A;  2AQ1 B;  3TBL D;  4AUQ C;  1AN8 A;  2CHZ A;  1FEH A;  2KQ7 A;  2RR9 A;  2GBJ A;  1FM0 D;  4USA A;  2XBB C;  2ZVO A;  3W5V B;  2JUO A;  3QQ8 B;  4GMV A;  2NS5 A;  1DOI A;  3BK1 A;  3OG5 A;  1KF6 B;  1C9F A;  5GXG B;  4OVV A;  1WI0 A;  4BZA A;  3PLU A;  2GOW A;  1SIF A;  1FRD A;  4WUR A;  2RGF A;  4ZRJ A;  3QX1 A;  1WWT A;  2KO3 A;  1TZO A;  1R4N B;  4GOC A;  4NNJ B;  1PYW D;  2IPK D;  2N7D A;  4CQN A;  1PUT A;  2QSD A;  1ZE3 D;  4LNN A;  1FNU A;  4BOS C;  1VR9 A;  1ZGU B;  4RGM A;  1BUI C;  3R2T A;  1JWA D;  2KMC A;  3MC8 A;  3CWI A;  2BYV E;  3AED B;  4NAW B;  2BVC A;  3RUI B;  1P7F A;  1XF5 L;  2K5P A;  4I6L B;  3ZQ4 A;  1VCB A;  3IFW B;  2HJ1 A;  3P4S B;  2M19 A;  2QHO A;  1LM8 B;  2KTR B;  1IYF A;  3PRZ A;  1GB4 A;  1XXG A;  4A3P A;  2DZK A;  1I4G A;  4RM9 A;  1WYG A;  2ONQ A;  5E6N A;  3T3N A;  1C4C A;  3R8B A;  1UH6 A;  2JXT A;  3IAS 1;  5IN7 A;  1N61 A;  2WXP A;  4W9C A;  1HTO A;  3VTW A;  2W3S A;  4C4V A;  1JWB D;  4GSW A;  4DQO C;  4C00 A;  3LDZ E;  4XDD A;  2FAZ A;  2XK5 A;  4N6E B;  5EE0 A;  1E8X A;  5CX3 A;  3ZJU A;  1PGB A;  2JY6 A;  2V4I B;  4HWI B;  3IT6 B;  4W9G A;  2WDR B;  3NVY A;  4NJ6 A;  4RGT A;  3SD5 A;  1SEB D;  2DAJ A;  5LLI A;  3BYT B;  3ONS A;  2R2Q A;  3EHV A;  2REX A;  3ZVV A;  1F2R C;  1P98 A;  2IBI B;  4A20 A;  1LGR A;  2DX5 B;  3ECI A;  1TJE A;  3SR6 A;  1TY2 A;  5HG2 A;  4LK0 M;  5HKH A;  4YSZ B;  2WXN A;  4JQW C;  2IY0 B;  1B1Z A;  2D07 B;  4KZC A;  3VQI A;  3AE2 B;  2QEJ C;  4FLH A;  3VRA B;  2GBR A;  4I6P A;  3PTF C;  2D5G A;  1HA5 A;  2ZNV B;  1J7B A;  4FN2 A;  1UEL A;  4WJQ A;  2BT6 A;  4IC7 B;  1SE9 A;  2MWS B;  5D2M B;  1WGY A;  4RGN A;  2LJ5 A;  3HK0 A;  1ZXI A;  3TEW A;  3AU5 A;  4HCN B;  4N58 A;  3A4R A;  3VUX A;  4M0W A;  1I4H A;  4URK A;  1M4V A;  3U30 A;  3Q8C A;  1GG3 A;  2RDB C;  2DLB A;  2G9H D;  1GAQ B;  5I4D A;  1AAR A;  1LQB A;  2J0K A;  3EGR A;  2LHE A;  2JXX A;  5DPR A;  2KC2 A;  4P16 A;  3FC4 A;  3QJZ A;  4FA6 A;  2LGD A;  2MHJ A;  2C7M B;  5DPT A;  3RFZ B;  2BBC A;  3BII D;  1BXT A;  1UWX A;  1SXT A;  4I6N B;  5AZH A;  2MBQ A;  4PS7 A;  4KZ0 A;  2BQQ A;  1EWC A;  4MGY E;  2IDY A;  2ON8 A;  2KC1 A;  4H2A A;  1SE4 A;  3HVZ A;  3IBE A;  2WXG A;  2W55 A;  3DVN V;  1QOG A;  2KJ6 A;  3L16 A;  4J3O D; 
#chains in the Genus database with same CATH homology
 2V3P A;  4YTM B;  2DYM A;  1C4P A;  3KLS X;  2QIE B;  2MEK A;  4A9A A;  2NMQ A;  4WH4 A;  1XLP A;  4XE0 A;  2LFI A;  1WRI A;  3TUO A;  2V0G A;  3FIL A;  3HVD A;  2FUG 1;  3IXS A;  4GDL B;  5JXV A;  4AQ7 A;  1HZ6 A;  4MH8 A;  2ACZ B;  2VZK B;  3U7Z A;  1EWY C;  1HEZ E;  1FMA D;  1TS5 A;  3U2S C;  3GP7 A;  2EKI A;  4ZHO A;  4OZC A;  1EU4 A;  4TQ0 A;  4HRS A;  4KKJ A;  1TY0 A;  5LNK 1;  3Q8F A;  1QLB B;  2BS2 B;  4REZ A;  4JX1 C;  4WWM A;  1Q10 A;  1L6V A;  3P4R B;  1FO4 A;  2N9L A;  2Q5W D;  2MJ3 A;  4ZRP A;  1YN3 A;  3AB5 A;  1OQQ A;  3T3O A;  1DOY A;  1GB1 A;  1PFD A;  3OWE B;  4O1N A;  1YQ4 B;  5EE3 A;  1I4X A;  3TSS A;  3NVV A;  1XLN A;  3URY A;  3V05 A;  3MC0 B;  1ENF A;  1JW9 D;  1L4D B;  3E9S A;  3ZJT A;  3AM9 A;  1F2R I;  3KWV A;  2JZP A;  1J7A A;  4IKG A;  1C77 A;  1V1P A;  2DYO A;  3J9C A;  4XWT A;  2SAK A;  1A70 A;  2WDQ B;  2MH7 A;  3L4P A;  4KGS A;  1ZDX A;  3BVG A;  4P6V F;  5BYQ A;  5HHD G;  1YMH E;  2KAC A;  2WXQ A;  4GLS C;  3SFE B;  1CQV A;  2PMV A;  1SE2 A;  2MJD A;  1PGA A;  1OFF A;  3NVZ A;  3UI3 A;  1UNS A;  3AE5 B;  3EA6 A;  1FNW A;  4JPS A;  5BYR A;  1SE3 A;  1C4A A;  2J53 A;  2L32 A;  3Q8E A;  4ZRQ A;  5MPO A;  2OED A;  2AQ2 B;  1IGD A;  2PIA A;  1NYR A;  3AE8 B;  3NZ3 A;  2K0P A;  4YWG G;  2WXI A;  1YN4 A;  3ZYY X;  1TS3 A;  3TEY A;  1D5Z C;  3Q69 A;  4KGR A;  5E6J A;  1GPX A;  1L6U A;  1NEN B;  4HRO A;  1K52 A;  1QT9 A;  2RDH A;  5BYS A;  1ACC A;  4FXC A;  1YJJ A;  1XLO A;  2CJO A;  1XO3 A;  3NS1 A;  4C80 A;  2Y5C A;  2NTT A;  2GB1 A;  1KRH A;  2BYT A;  2K22 A;  1MPE A;  1SB3 C;  1TS4 A;  1E7P B;  2WXM A;  1D5M C;  4A6Q A;  1QQR A;  4C7Y A;  1KH0 A;  4OZB A;  1MHX A;  4XWW A;  3PZ8 A;  1NYQ A;  2PLP A;  4US8 A;  1V8C A;  3AMZ A;  2PKO A;  2N0S B;  3AEG B;  1EU3 A;  1T3Q A;  2I2Y A;  4EE2 A;  1TKY A;  3W9C B;  1ZDV A;  3FAH A;  5H92 C;  4YTN B;  1J7C A;  2WP9 B;  1L0Y B;  2WQY B;  1E6E B;  2GI9 A;  2PVO D;  3AE4 B;  3KQ4 A;  3BVZ A;  1V97 A;  4OZA A;  2BTE A;  1V1P B;  2KDM A;  1ZUD 2;  5EE9 A;  1B9R A;  1YNT E;  1C76 A;  4HEA 1;  3AEA B;  5G5G A;  1NI3 A;  1ESF A;  1SJE D;  2BB6 A;  3AEC B;  2W54 A;  3PZ7 A;  4TQ1 A;  2MJE A;  1RFK A;  2IGD A;  3AH7 A;  1T6B X;  4A90 A;  1MHH E;  4OW0 A;  2HDE A;  3E56 A;  3VR9 B;  3W5U B;  1ET9 A;  1C79 A;  2WNM A;  3IAM 1;  4TSS A;  2E3T A;  2LHD A;  1FCC C;  1XCT L;  3C8Y A;  1P7E A;  2INP E;  3P63 A;  2E6X A;  2PVG C;  1DYQ A;  3DWM A;  2FBW B;  1I4Q A;  4JWS C;  3O13 A;  5FR3 A;  1QKZ A;  1GOZ A;  3I9V 1;  1MI0 A;  1FCL A;  2QJL A;  2K9X A;  2EEL A;  4JE3 B;  5TSS A;  1DOX A;  4B0E A;  3B9J A;  2L52 A;  3U4E G;  2V3N A;  2WXR A;  2JU6 X;  2W82 A;  4MT5 A;  2N7J A;  2WLB A;  3FIL B;  3MP9 A;  4RGO S;  3W2D A;  3MFG A;  1N5W A;  2X38 A;  1E10 A;  2M0A A;  3HUI A;  1HZ5 A;  2Y3A A;  3AE6 B;  2JYE A;  4HKQ A;  4YXD B;  4UDU C;  3BWU D;  3ETR A;  1AW7 A;  1QOF A;  2DBY A;  2XN9 C;  3LYY A;  4YTP B;  5C3J B;  3LXF A;  4A8X C;  4WIP A;  2BW2 A;  1OQR A;  3AEE B;  4N59 A;  4AS1 A;  1D6E C;  3BZD B;  4YSX B;  2NTS A;  1WXQ A;  1IBX B;  1IBX A;  1YN5 A;  1AWD A;  4R3D A;  3AN1 A;  1KFY B;  5D7G A;  1UGJ A;  2AQ1 B;  3KWL A;  3WCQ A;  1I4P A;  1AN8 A;  2HTM E;  1FEH A;  1CZP A;  3AE1 B;  1QOB A;  1FM0 D;  1JWU D;  2B76 B;  4USA A;  3AV8 A;  5G5H A;  3SFD B;  3W5V B;  3V3X A;  1JML A;  5AUK A;  3Q8A A;  1DOI A;  4LTU A;  3BK1 A;  1N62 A;  1KF6 B;  4L2Y A;  5HI1 A;  2YEP F;  4KKI A;  4HKZ E;  1C9F A;  2CJN A;  5GXG B;  1D4B A;  4IDI A;  1VZ8 A;  3NUH B;  4DXF A;  1FD6 A;  2WS3 B;  1XCQ L;  5T8I A;  1R7S A;  2WXJ A;  1YQ3 B;  1FRD A;  4MAC A;  4WUR A;  4RF1 A;  1WWT A;  5D3I B;  2OHF A;  1TZO A;  1YJI A;  4L23 A;  1PYW D;  2IPK D;  3HRD D;  4CQN A;  3SEB A;  1FRR A;  1JWS D;  1ZP0 B;  1T5X D;  1PUT A;  2LEK A;  2QSD A;  1ZE3 D;  3LB8 C;  1FNU A;  1N63 A;  4RH6 A;  1MVK A;  3NRZ A;  4Q2J A;  1VR9 A;  1UUP A;  2DWQ A;  4RGM A;  1BUI C;  2WXO A;  3ABV B;  2PTL A;  3R2T A;  2WXH A;  1JWA D;  4OVZ A;  3CWI A;  2J42 A;  2PW9 A;  1WSP A;  3AED B;  4NAW B;  4WQM A;  2KQ4 X;  1P7F A;  1XF5 L;  2K5P A;  2QMT A;  4NJC A;  3ZQ4 A;  4DXG A;  2J4X A;  5D3D A;  2RMM A;  2ICI A;  5H8Y E;  4ZYS A;  3P1M A;  1FFU A;  3H8H A;  2KMM A;  3P4S B;  1N60 A;  2IGG A;  2M19 A;  1WGK A;  2ZW0 A;  1C78 A;  1N5X A;  3W1S A;  2GRI A;  1GB4 A;  1XXG A;  1EM7 A;  3DWG C;  4A55 A;  5BMH A;  4KX6 B;  2G1E A;  3ZGZ A;  1HQR D;  1NEK B;  1I4G A;  3AEB B;  2AX5 A;  1WYG A;  2ONQ A;  3T3N A;  5AUI A;  1C4C A;  3R8B A;  3B2F A;  2JXT A;  2RDG A;  3IAS 1;  1ET6 A;  5C2T B;  4C7Z A;  1N61 A;  1XLQ A;  1IGC A;  2WXP A;  3AE9 B;  4YT0 B;  1NVI D;  5FK9 C;  1JRO A;  4ARC A;  1UWM A;  1IUE A;  2W3S A;  3P4P B;  1FXA A;  1JWB D;  1LO5 D;  4DQO C;  1I4R A;  4ZOH C;  2J52 A;  4XDD A;  3BYY B;  3NVW A;  4N6E B;  1ZXH A;  2BB5 A;  2IJ0 A;  5EE0 A;  2JQR B;  1AYF A;  2RPV A;  3MJ5 A;  3IT4 B;  2WDV B;  2IGH A;  2H89 B;  1DGJ A;  3AEF B;  4LLG M;  2Y5P A;  3ZJU A;  2M56 B;  1K50 A;  1PGB A;  2V4I B;  4US9 A;  1FIQ A;  3IT6 B;  3VRB B;  1SIJ A;  1TS2 A;  2R61 A;  2WDR B;  2VZK D;  3PO0 A;  3NVY A;  1KLU D;  2LUM A;  2BS3 B;  4RFB A;  1L0V B;  4WAF A;  3EUB 2;  3BVM A;  3GB1 A;  1PGX A;  4RGT A;  1SEB D;  1D5X C;  2LMC A;  1KLG D;  4ZHP A;  2LGI A;  4C56 C;  1K53 A;  1VZ7 A;  1ZOY B;  3BYT B;  4B0M A;  2INN E;  1E9M A;  2WU2 B;  1F2R C;  1ZPS A;  1RM6 C;  4D2K A;  3SR6 A;  1TJE A;  1SJH D;  1XEE A;  4NAM A;  1TY2 A;  5HG2 A;  4YSY B;  5FKA C;  4LK0 M;  4XDC A;  2N9K A;  4YSZ B;  2WXN A;  2KWD A;  2LJI A;  1CJE A;  2JX5 A;  4L1B A;  1JWM D;  1V1O A;  1B1Z A;  1I7H A;  3N9Y C;  2KAJ A;  1SF0 A;  3VQI A;  3AE2 B;  2QEJ C;  2XNA C;  3VRA B;  1VRA B;  2H88 B;  1TYG B;  1ROE A;  1FNV A;  2D5G A;  1QIL A;  1HA5 A;  1J7B A;  1TKG A;  1RWS A;  3R2I A;  1HXY D;  2BT6 A;  1KTK A;  1BML C;  1JRP A;  1VZ6 A;  4HJG E;  4RF0 A;  1F77 A;  2SEB D;  3P4Q B;  4RGN A;  2AQ3 B;  2WXK A;  1L0X B;  1ZXI A;  2YEP B;  3TEW A;  3AE3 B;  4RCO A;  2L1A A;  4IOI E;  3CIR B;  1STE A;  1RYJ A;  4N58 A;  3TEZ A;  1VLB A;  2JSV X;  2K3U A;  2QIL A;  2JWU A;  3U52 E;  4M0W A;  1JAL A;  5BMG A;  4GDK B;  1I4H A;  1VJK A;  3BK2 A;  1M4V A;  1TKE A;  4KGT A;  3VR8 B;  3B2G A;  1K51 A;  3Q8C A;  2ZW1 A;  3MHZ A;  2CU3 A;  1Y56 A;  1E0Z A;  5BMI A;  1F0Z A;  2TSS A;  3P42 A;  3Q8B A;  2DLB A;  2G9H D;  3TEX A;  1GAQ B;  5I4D A;  2WXL A;  2FE8 A;  2I38 A;  4RNA A;  2L83 A;  3GS2 A;  2W3R A;  4JWU C;  4PT5 A;  3EGR A;  2LHE A;  4P16 A;  1SBB B;  3FC4 A;  1QOA A;  2BS4 B;  2Z8L A;  5EE1 A;  4MM3 B;  2WXF A;  5HFY A;  3RFZ B;  1FXI A;  2BBC A;  2WU5 B;  3BII D;  1BXT A;  1SSN A;  1UWX A;  1QF6 A;  1L4Z B;  1SXT A;  1VDV A;  4OHJ A;  1PDX A;  1L5P A;  3ZJV A;  2IDY A;  2KN4 A;  1EWC A;  2JYT A;  2ON8 A;  4H2A A;  3AE7 B;  1SE4 A;  1JQ4 A;  3RPF C;  1FFV A;  3HVZ A;  4ARI A;  2WXG A;  4ITK A;  2W55 A;  4TMA B;  3I57 A;  1QOG A;  4NZL B;  1CK1 A;  4J3O D;  1JCK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...