2IGHA

Determination of the solution structures of domains ii and iii of protein g from streptococcus by 1h nmr
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
LTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin-binding protein
molecule keywords PROTEIN G
publication title Determination of the solution structures of domains II and III of protein G from Streptococcus by 1H nuclear magnetic resonance.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1992-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ighA00
2LHDA 5HI1A 3UI3A 1HZ6A 1XF5L 4MACA 4KGRA 2K0PA 2IGHA 5JXVA 2GI9A 2J53A 1XCQL 1FCCC 2KN4A 2KACA 2PW9A 1PGAA 4WH4A 1ZXHA 2I38A 1MHHE 5HG2A 2ZW1A 1MPEA 2LHEA 1P7FA 1PGXA 3MP9A 3GB1A 1HEZE 2N9KA 1YNTE 1P7EA 1MHXA 1FCLA 2N9LA 4HKZE 2PLPA 3V3XA 5BMHA 2PTLA 2JWUA 1UWXA 1PGBA 2ZW0A 5BMIA 1GB4A 4D2KA 1K53A 1MI0A 2IGGA 1JMLA 1K51A 1C9FA 4OZAA 1GB1A 4KGSA 2JSVX 1KH0A 2ON8A 1IGCA 1K50A 1FD6A 2EELA 2ONQA 4KGTA 1QKZA 1IBXB 2RMMA 3FILB 4HJGE 2JZPA 4OZCA 2RPVA 1MVKA 4GLSC 2NMQA 1IBXA 4IOIE 5HFYA 2I2YA 1F2RI 4IKGA 2KWDA 3FILA 2OEDA 1EM7A 1XCTL 1F2RC 2GB1A 2KDMA 1Q10A 1YMHE 4OZBA 2LGIA 2J52A 2KQ4X 2JXTA 2QMTA 2LUMA 2N7JA 1HZ5A 2IGDA 1K52A 2JU6X 5HHDG 1D4BA 1IGDA 5BMGA 2QSDA
chains in the Genus database with same CATH superfamily
1YN5A 2KDFB 2K0PA 2LI5A 3PRZA 1D3ZA 4ICVA 1Q1OA 3L13A 5DPWA 3P4RB 4NQLB 4K7SA 4S0RA 3AEFB 2M8SA 2ZNVB 4A6QA 1E7VA 2KMMA 1PUTA 4FN2A 1MHXA 4B95A 1FM0D 2KTFA 2ZCCA 3CSFA 1TT5B 1DOIA 3L16A 2BB6A 1EU3A 1K53A 2MA9B 2BS3B 2WP9B 4LNOA 4MH0E 5L83A 1WSPA 4A9AA 1SSNA 1V2YA 3NY5A 2OHFA 2BYVE 1C9FA 3WALA 2N1WA 1E6EB 2KMAA 2MCNB 2BB5A 1MG8A 3H7SA 4LJOB 4LNKA 4M8MA 3JVZX 2BKRB 3W5VB 4M0WB 5E6JA 1NVID 4BKSD 1IBXB 2DYOA 3ENEA 4K3CA 3DQVA 4EKUA 1SB3C 2WU5B 4ICUA 1I7HA 3DHGC 1L0VB 1UWMA 1F2RI 1JWUD 1S1QB 1VJKA 4C4VA 5CHFA 4OZBA 1WI0A 3AULA 4MGYE 1SE9A 1SE2A 3NVYA 2GBJA 4J6IA 4E71A 2O6VA 1QOGA 3FAHA 3RULA 3ZXRA 5FK9C 2KC2A 2REXA 3BYYB 2QSDA 1FO4A 4II3B 2DZMA 4NAMA 2KVRA 3UIPB 1T3QA 1VD2A 4FJVB 3K9OB 2FIDA 1RFAA 1QOAA 4LTUA 4EOYA 2C7MB 1E10A 4MT5A 1FCCC 2CHWA 4KIKB 5KHOA 1SE4A 1SIJA 2DAFA 5DPRA 2PW9A 4DBGA 4E3CA 3KW5B 2D3GA 2AEHA 4R3DA 2KKCA 2LHEA 3A9JB 1P7FA 3EA6A 1PGXA 2BW2A 2GOWA 2VH2A 3I5JC 1XLOA 2ICIA 4JGHB 1N63A 4KZ0A 1SE3A 2KTRB 3Q3OC 3ZUNA 4RH6A 1WY8A 4LDTB 1PGBA 2D5GA 5GXGB 3R7RA 2LD9A 4HJKA 3MHZA 3IAM1 1N6ZA 4TQ1A 1JMLA 2QDFA 2WXLA 5D2MB 3BWUD 2EMSA 1YQ4B 4FA6A 1I4PA 1FD6A 4WWOA 3ZO5B 1E8XA 4KGTA 4AJYB 3RT3B 1WR1A 2PVOD 1IUEA 4RGNA 3U30A 4OZCA 1ZXIA 2RPVA 4KSLC 2QEJC 3DVNU 2LXAA 1YJIA 2MLBA 3RZFA 3ZW3A 1UGMA 5HKHA 2NS5A 3OG5A 2GB1A 2KDMA 2ZVOA 3A33B 4I6PA 5IP4D 3PHXB 2CU1A 4QAYA 3U7DA 3ZVVA 3H8HA 3NZ3A 3C8YA 1YX6B 1E5WA 4KKIA 3R3MA 2AX5A 1D6EC 1FNWA 2K5PA 4GDKB 2HE7A 5BYQA 4RF1A 4W9KA 4BKGA 2V3PA 3NVWA 2IO0B 1JRUA 4HDQA 1X1MA 1WXAA 5BYSA 1IYFA 2KDEB 2KN4A 1QF6A 3RPFC 5AUIA 1T0YA 3ZTDA 1MHHE 2L7RA 4M02A 2KDBA 3ZNGC 3W1YA 1SGHA 3TEWA 1MPEA 4HKQA 2KX3A 2BS2B 3PLUA 3AU4A 4NPNA 4CYEA 3N3KB 3AE7B 4BAXA 2O2VA 3Q3JA 4HKZE 2V1YA 1WGGA 1WX8A 1AARA 1I35A 3W9CB 3KYCD 4HXDA 4IWOA 4BKTA 2INDC 3AE2B 3RZWC 4Q2JA 3IBEA 2IPKD 3ABVB 4OZAA 4K7WA 1V1PB 2XN9C 5MPOA 2NTSA 3HVZA 3ZDTA 1ZDVA 3E56A 4PK1A 1FXTB 1VLBA 3HM3A 2WNMA 2L32A 5EDSA 1PFDA 2MBEA 2BYFA 5AUKA 3H6NA 1Z2MA 3BZDB 2G9HD 4ANVA 3APDA 3IT6B 3B1LX 4GLSC 1UZXB 2ACZB 2KWDA 4GGQA 1V86A 2YEPF 2KX0A 5D3DA 2K3UA 2KJ6A 3VVWB 4B6WA 1WX7A 2M1MA 3PV1A 1J7CA 1E9MA 3GZNB 2WS3B 1N61A 1IGDA 1CZPA 4PYUA 2V3SA 2QIEB 2LHDA 3Q3MC 1WXVA 2L52A 2WX0A 1B1ZA 2MX2A 3VUWA 2JWZA 2W3SA 2FAZA 2K22A 3EFCA 3NJTA 3K9PB 3B2GA 1V6EA 4PYZA 1JWMD 2QCZA 3Q8BA 3QC8B 1JROA 3UQBA 3QK0A 4UDUC 2KJRA 4AQ7A 4W9JA 3V61A 5J18A 5DPTA 1YOVB 1R4MB 1TY2A 4TSSA 3AECB 1HTOA 1OEYJ 5BMIA 2LVPA 4MGIE 1MJDA 2L05A 4MM3A 1WM2A 4DDGD 3MHSD 4WWMA 1OQYA 1NYRA 3JYUA 2RR9A 2JSVX 4B9KA 2LASA 3IG3A 4IC7B 1WFYA 2W55A 1XLQA 2ONQA 2C7NB 1DOXA 2LMCA 4WJOA 1TKYA 3VUYA 4RM8A 2UYZB 2WXQA 3O13A 4NAWB 5C1ZA 2W3RA 4MGKE 4GXBA 4CHKA 2KWVB 2PMVA 1HXYD 4MJSA 1NBFC 2WGSA 2C7HA 4P1CC 1K8RB 1CK1A 4N6EB 3VR9B 3DWMA 1YMHE 2LGIA 2SAKA 2K8HA 3MC0B 2V0GA 3T3NA 2LGDA 1MG4A 4FULA 4XWWA 3AN1A 1P3QU 2M0XA 4F1SA 4PS8A 2MJEA 4GOCA 5JH5C 3PZDA 2WYQA 4EUTA 2OJWA 1FXIA 2QILA 5HI1A 2LVQA 4KGRA 5JXVA 1TKEA 1SF0A 3I57A 5H8YE 2C9WB 3LXFA 4OVUA 1GC6A 5AZHA 4DK5A 2KACA 3TIXA 4FBJB 3KVFB 3HUIA 4BOSC 5LLIA 3L4PA 1Y8RC 4ZRKA 2LJ5A 2RSUA 2I1KA 2N9KA 1F52A 3ZIMA 3IT4B 3V3XA 3QCAA 3SU8X 2B76B 3X0WA 3Q2AC 4HPMB 2UU7A 2IDYA 3L08A 1ROEA 2WX1A 2KLGA 5IAAC 1KH0A 2BGFA 4URKA 1ET9A 3VXWA 2J0KA 4IDIA 2EELA 3NRZA 1OQRA 2BF8B 4EEWA 2WXMA 5J2RA 2DWQA 4JLCA 2XK5A 1TZ1A 4MH8A 2N9XA 3PPAA 2MH7A 4RNAA 4JL9A 1WXSA 2AYOB 1V80A 3BY4B 4RF0A 4AOFA 4C4VB 3TSSA 1TTNA 4KV2A 2JVCA 5CTRC 4XDCA 4I6NB 4C56C 3Q8FA 1JQ4A 2AL3A 3P1MA 1V97A 3U4EG 4W9HA 2WDVB 4B0MA 3N1XC 1U4AA 2L3ZA 3ZRFA 4TV3A 1RRBA 3PVLA 2J4XA 1EF1A 1D4BA 3RN9C 3RCZA 3B08A 1E0ZA 3WA0A 3RUIB 4YSZB 3T3OA 4ZHPA 4C80A 1XF5L 5G55A 1FFUA 1N5WA 1FFVA 1FRRA 2M4NA 4CQNA 3Q14C 2V9HA 3JW0X 1TJEA 2NBVB 1V1OA 2BWFA 2FNJB 2I38A 4IM2A 2FCNA 3PHWB 3PSEB 1Y56A 3TEZA 4WIPA 2KVZA 2QJLA 1AYFA 3GOEA 1F1HA 4MEMA 1UBQA 1C77A 3ZNHB 1NYQA 5EE9A 4BBNF 2K8BA 1R4NB 2WWZA 3PT2B 3DHIC 3P42A 1SEBD 1GOZA 5AZFA 4WJPA 4GSWA 3PZ7A 4ZRQA 4NJCA 2LZ6A 2KK8A 2ZPNA 3QAQA 3AI5A 1RM6C 1J0GA 1VR9A 3VR8B 2GMIC 2KWUB 3TMPB 1OEYA 1I42A 4TQ0A 1WGRA 1C79A 1KM7A 4ANUA 2NPTA 2UWQA 4EFOA 2FE8A 2INCC 2G1EA 5TR5A 4YT0B 1TZOA 3DVGX 1MVKA 1WGHA 1LQBA 5BYRA 1C78A 3DCGA 3CMMB 3M95A 1J19A 4RGMA 2L1AA 2YEPB 4ACFA 2KQ4X 4HVBA 4MSQB 2V4LA 3N30A 1KLVA 4G11A 1E7PB 3AH7A 3KLSX 2XBBC 2BKFA 2KN5A 2KD0A 1UGJA 4YSXB 4DHZE 2WXGA 1GPXA 2SEBD 1F9JA 4DHZB 2MEKA 3VFKA 2O2VB 1VZ7A 2ZW1A 1EU4A 2L83A 4N9F4 2MW5A 1WZ3A 3URYA 4YWGG 1YNTE 4JWSC 3DDCB 3AEDB 2Q5WD 4HCPB 1YJ1A 2PEAA 2VZKB 3HRDD 4GMVA 2WXIA 2NCNA 2CR5A 5G5HA 2WQYB 3IFWB 2MSED 3BYTB 1HTQA 2DX5B 1SJED 3AEEB 3V62A 2ON8A 3W1SA 2WXOA 4KSKC 4ARIA 1WIAA 3TUOA 3AXCA 2KWCA 4IM3A 3DBHB 4BBNC 4HJGE 2DBYA 4ZRPA 4WQMA 3RNFC 3OLMD 2G3QB 2DYBA 4HK2A 1C4AA 4LJPB 3HIZA 3WAMA 3EGRA 4PT5A 1WWTA 2K9XA 1UH6A 2DLBA 1L2NA 4HWIB 1EM7A 1XQQA 1XLPA 2GBRA 3P4PB 1WMHA 4JQWC 4FJZA 2PVGC 2QHOA 3ZJUA 1CQVA 3CF6E 3OJ3A 2ZJDA 4K81A 1JWBD 2YVCA 2GLSA 3CWIA 4A20A 2KC1A 1XO3A 2JXXA 3AE3B 4AJWA 2Y5PA 3NZUA 4W9EA 1HZ6A 2E3TA 3C0RB 1T0RC 4HCNB 4MGZE 1DOYA 2LFIA 3AE4B 4K1RB 2E6XA 2K8CA 3QA8A 2M19A 5HG2A 4KZCA 4W9LA 1B9RA 2IJ0A 4P7IA 3H1UA 2EMTA 1HE8A 2L0FA 1ZOYB 2V3NA 1TYGB 3GB1A 4ZRJA 3U2SC 1OGWA 2WXRA 4MM3B 2Z8LA 1L0XB 4AUQC 3BVMA 3EUB2 5GMVA 4US8A 3PRPB 1M4VA 2K6QA 3IXSA 1JALA 4KGSA 4RGTA 3ZYYX 3WCQA 1N62A 5IKCM 3NOBA 4FXCA 1WJUA 3U52E 4E74A 4H2AA 4MJSB 2ZEQA 2KFKA 4ZOHC 1E90A 1D5ZC 1L6UA 1JCKB 1WJNA 3UINB 3BVZA 3OJ4B 1BT0A 1TS3A 4NJ7A 4II2B 1IP9A 4HROA 5DPSA 5IOIA 1GUAB 2NBUA 2KT7A 5L95C 4J3OD 2FUG1 4XZ4A 4NNJB 4WJQA 1VZ8A 3E9SA 2BPSA 1E8YA 3APFA 2AQ1B 2TSSA 4EE2A 2IO3B 2JRHA 4P1BC 4RFBA 3AB5A 4HRSA 2A4ZA 3QHTA 3P63A 2IGHA 2N7DA 3NVZA 2L76A 4LNNA 2FUHB 2CU3A 2JY6A 4WH4A 4YXDB 2KDIA 1V8CA 2LGSA 2CHZA 1LXDA 3MJWA 2LUEA 1P7EA 3M62B 3BK1A 1I4GA 2KQSA 3ML8A 4AS1A 1P9DU 1TIFA 3QARA 3ZGZA 3HHMA 1IPGA 2J7QB 2K39A 3IHPC 4ITKA 2HTME 1K51A 2CHXA 1GB1A 1WJ4A 2XK5B 1K50A 3OAWA 4NQKE 2R2OA 3JSVA 2IYDB 3IVFA 4YTPB 3AU5A 1WRIA 1N60A 5C3JB 5I4DA 1LM8B 1YN4A 2JZPA 3PS6A 2MBHA 3LJ3A 3QQ8B 3W1SC 2HTHA 3OWEB 4X57B 1TGZB 2IY1B 2I2YA 2LGYA 2LWPA 2MJ3A 3MFGA 3VRAB 3ALBA 1HA5A 3DVNV 2OOBB 3ETRA 2J52A 1WE6A 4A8XC 2A5UA 3KYDD 4A55A 3VTUA 2FBWB 3H7PA 3X23A 1KTKA 1P0RA 1UELA 4F8CB 3PRMB 2ZCBA 2MP2A 1FMAD 4EZJA 1XXGA 2D10A 2JF5A 1CMXB 2JPHA 4IM0A 1YX5B 3SFEB 3P2BA 1NI2A 5C2TB 4C7YA 2FIFA 2WXKA 4GDLA 2LRWA 1T6BX 3ZNID 2L0TA 3DBSA 3MTNB 3HM6X 1FEHA 1T5XD 2MBBB 1QLBB 2Y3AA 2DYMA 1WGKA 2WXPA 2BWES 4FLHA 3DBLB 5FKAC 1DGJA 3UGBB 5BMHA 1ENFA 2V4IB 1EO6A 2JWUA 3VH4B 4IG7B 3PTFC 2G45B 2C5LC 1SXTA 1FRDA 3R66C 2BTEA 2NPTB 3UF8A 1YQBA 2MBOA 3D32A 4ASWC 4ZDVA 5LXIB 1IGCA 2PIAA 3SDLC 3SD5A 3MJ5A 5E6NA 5JHBA 1OFFA 3LYYA 3DVGY 3N1ZC 1RYJA 1V5TA 3MC8A 1SBBB 1V5OA 2JQRB 1GG3A 1HQRD 5HFYA 1KRHA 3VTWA 1J7BA 4EZLA 3AMZA 3DBRB 1F2RC 2GBNA 1WX9A 4NJ6A 3TEXA 3N1YC 5IA7A 1EF5A 2RGFA 4US9A 2R61A 1XD3B 2GRIA 2KZRA 3ZKJC 2WDRB 3KUDB 2PPHA 3NS8A 2D07B 2IZVB 3R8BA 1L7YA 1PQSA 2FCQA 2MBQA 1H8CA 4DWFA 2PE9A 2G4SA 2AQ3B 3AE1B 1VCBA 3AEBB 4ZYNA 1RWSA 1L6VA 3DHHC 4XC2A 1TS2A 1GC7A 3AE5B 1E8ZA 4GU2A 3TBLD 4TMAB 1XT9B 1RAXA 4KX6B 4XDDA 2H88B 1YJJA 3QX1A 3NG0A 4AP4C 1GB4A 1I4HA 3R2IA 3M3JA 3KUZA 1Q0WB 3W5UB 3TEYA 1ESFA 1ET6A 3PO0A 4DXFA 4G0NB 4FHJA 4AWJA 4LDTD 4I6LB 2JUOA 2JT4B 1R4NI 4W9IA 4XGAB 3CIRB 4ZRIA 4WJNA 4ANXA 1NENB 1TBEA 4HEA1 1KOTA 3NZSA 1WMHB 2LXCA 2K1FA 3A9KB 4JPSA 1QZEA 2KHWB 1V81A 1GAQB 5FR3A 4G50A 5J17A 2AQ2B 1FPYA 3NVVA 5LXHA 1XCTL 2MRPA 1SIFA 4N59A 3BK2A 2Y5BB 5TSSA 1YN3A 2RDGA 1QOFA 3SFDB 5CHVC 3MC9A 4JWUC 1LFDA 2K6DB 3AEAB 2VRRB 4JIOU 1VZ6A 4REZA 2PE6B 1WJ6A 5D94A 3B0AA 3BVGA 4XX5A 3APCA 1V49A 5E6OA 2ZVNA 1UBIA 1G6JA 2WXHA 4W9DA 4MELA 3U8ZA 2L8JA 3SEBA 1YQ3B 2HJ8A 4A3PA 1VDVA 4BZAA 1WXQA 4XYCA 1UF0A 3QWZB 4DXGA 4FJYA 3L0WB 1STEA 2BYEA 1T0SC 3MP9A 1WH3A 4YSYB 5IO9A 3T9LA 4OHJA 4WURA 2AWTA 3ZRCA 2N9LA 1YIWA 4G3XB 3B9JA 3EECA 3Q8EA 2PTLA 2WDQB 3CSTA 1J7AA 3UQAA 1AWDA 4HDOA 5AZGA 2IGGA 4M8NA 2GBMA 2DHZA 3LDZE 4LK0M 3ZNZB 4DHJD 1P98A 3VQIA 2N0SB 3M63B 2KFKB 2LVOA 3QIJA 3N9YC 1KLUD 1UNSA 4ZYSA 3A1QA 3FC4A 3T8MA 4W9FA 3A4SC 1QT9A 2W54A 3TJPA 4DDID 2M56B 3L10B 1XLNA 2Z0EB 2BBCA 2IO2B 2GBKA 4FHKA 3FILA 1Z5SB 2OEDA 1R7SA 2KQ7A 3VDZA 2NR2A 3DBHI 1CJEA 2X38A 1HZ5A 3KH0A 2JU6X 1WR6E 2RDHA 5BMGA 1F77A 3DOWA 3KUCB 3VTVA 3V05A 4WWNA 1C4CA 1C4PA 1L4ZB 3TCAA 3AV8A 5G5GA 2INPE 1DYQA 3A9KA 4C00A 2D3BA 1XCQL 3DWGC 3RNCC 3LB8C 1WF9A 2WXJA 3PGEA 3V6EB 1PGAA 1ZXHA 3ZDMC 4YTNB 5DCNA 1KF6B 2JYEA 3AEGB 3PZ8A 2J0MA 1QOBA 4GN1A 2D3CA 1HEZE 3ZJVA 1L5PA 4ANWA 4M00A 3NS1A 1FCLA 1AW7A 2RPQA 4WWPA 1FIQA 4RMAA 3EFUA 2YLMA 2EKEC 3P4QB 2ASQA 3WAOA 1QILA 3JSVB 1ZW7A 4OVZA 1V9JA 2LGXA 5D7GA 4O1NA 3Q8AA 3I9V1 4HLEA 2HJ1A 3RMKC 1QKZA 1QQRA 2WDTB 3J9CA 4YL8A 1N5XA 3L17A 3Q3FA 4K7UA 1J8CA 2LEKA 1I4RA 3H9DA 3B2FA 4M0WA 3WAPA 3NHEB 4LNIA 1IBXA 4K3BA 2PJHA 3VUXA 2HDEA 2JX5A 3BIID 2KXJA 1WGDA 2JRIB 1RLFA 3H7PB 4CO7A 1Q10A 4ARCA 4N58A 3O65B 1AN8A 1L0YB 1I4XA 2MP2B 4GB9A 3FKYA 1JWAD 1KLGD 1WYWB 3RYTA 2NVUI 2LUMA 4OW0A 2IGDA 3UIOB 2VH1A 3WIMA 4B0EA 4HPPA 3AE8B 1YD8U 4L1BA 1F0ZA 1WRDB 2KMCA 1P1AA 3UI3A 1NDDA 4GDLB 3RNGC 4DHJB 2MHJA 2Y5CA 2WXNA 3AM9A 2BVCA 4IUMB 5EE1A 1ISNA 1C3TA 3VHTC 3R2TA 3VRBB 2PKOA 1S3SG 3VH3B 4XE0A 4KIKA 4A90A 1I4QA 2N1VA 3A9JA 2Z59B 4EZKA 3ZQ4A 4OVVA 1ACCA 1JRPA 3GZNI 2ZW0A 5EE0A 3VAWA 2KTRA 2NTTA 5G2NA 2CJNA 4W9GA 2IBIB 1OTRB 4RGOS 5C23A 1JWSD 2DNFA 2N9EB 2INNE 2DZKA 2KOXA 2FCMA 1C1YB 5T8IA 2D2QA 1TS5A 2H89B 3W2DA 1D5XC 2OJRA 1D5MC 1UD7A 2J42A 2FCSA 4RCOA 3SHQA 3N32A 4IOIE 1EWCA 1TY0A 1H4RA 2L00B 3ZXVA 1GJZA 1ZDXA 5AEKB 4JE3B 4LCDE 2NBWB 3R7QA 4L23A 1R4MI 3PLVA 3GS2A 1GNUA 1LGRA 4BFRA 5IN7A 1M94A 5LNK1 2ZPYA 2D3AA 5FR6A 2M17A 1OQQA 2BS4B 4IW0A 5EE3A 2BYTA 5H92C 1ZUD2 4F7ZA 1LO5D 3C19A 3HVDA 5KHQA 2EKIA 2O6VD 2K25A 2N9PC 4DXAB 1PDXA 4MACA 4NZLB 1RFKA 1A70A 3RD2A 2CS4A 3QJZA 4GDKA 3RI7C 1Q5WB 4TKNA 3Q6BA 1FXAA 4P16A 1ZGUB 2KO3A 4C7ZA 2BQQA 5E6PA 4GIVA 3A4RA 2N7EA 4JX1C 4BVUC 3AE6B 1TKGA 2KFJA 3N20C 3RNBC 4KKJA 3KQ4A 4WAFA 4BKSA 1NEKB 2JZ3B 1WM3A 1UWXA 5D6JB 4P6VF 2X8XX 3SR6A 2R2QA 4A3OA 3ZLZA 3I3TB 2HD5B 4LNFA 1XEEA 2ZNVC 3DBLI 4FADA 2W9NA 4RM9A 2C60A 4IWQA 1FNUA 2RDBC 3AE9B 3HK0A 1V1PA 1A5RA 1WE7A 3RNEC 5CHWA 4WAAA 2LRUA 5CX3A 1KJTA 3ZJTA 1E8WA 1WGYA 1VRAB 1WYGA 1ZKHA 3Q69A 1BUIC 4IKGA 4TUUA 2CKHB 2KYWA 3Q8CA 2N4FA 2DENB 2WXFA 1BMLC 2JXTA 4PS3A 2RD0A 4USAA 3I63C 2KJHB 3V60A 4W9CA 3P4SB 5HHDG 1PYWD 2QC8A 2W82A 3GE8C 2MQJA 3GP7A 2WLBA 3BINA 3DBRI 2XNAC 3GE3C 3RFZB 2GI9A 2DZJA 2J53A 2DAJA 1BXTA 4KDIC 2WU2B 3KWVA 4S17A 1FNVA 1ZE3D 3S2AA 4DQOC 2XEWA 2JZZA 1KFYB 2AL6A 3PREA 1NI3A 3Q3NC 3U7ZA 4BOZB 3NUHB 4PS7A 4MSMB 1TS4A 2WHIA 5D3IB 2PLPA 4ZHOA 1WZ0A 5BO4B 4MDKE 2KNBA 2D11A 4D2KA 3TL5A 1ZPSA 1MI0A 1MFWA 3V6CB 4LLGM 4XWTA 2MWSB 2BT6A 4M01A 4L2YA 3WANA 3A1QB 1JW9D 2VZKD 4HPLB 2Z0DB 2O6VB 2KANA 3EHVA 3ZTCA 3ML9A 1ZP0B 1E7UA 3RNAC 2LJIA 3L54A 2KAJA 1EWYC 1C76A 2KLCA 4WQOB 2RMMA 3FILB 2M0AA 1SJHD 2JYTA 4IWPA 3DPDA 2B3AA 2NMQA 3ECIA 2DZIA 5JHAA 4NAWA 1WXMA 2I1JA 4YTMB 2CJOA 1L4DB 3EC8A 2ZZPB 2IO1B 1UUPA 2QMTA 3IAS1 4KVGB 1EUVB 2N7JA 2J0JA 1K52A 3KWLA 1T0QC 4KDLB 5JZEB 2G4DB 4NY0A 3ONSA 2IY0B 2MJDA
chains in the Genus database with same CATH topology
5HI1A 1YN5A 3P63A 3V05A 1C4CA 1C4PA 4KGRA 2K0PA 2IGHA 1L4ZB 3AV8A 1TKEA 1SF0A 5JXVA 5G5GA 2INPE 1DYQA 3NVZA 3I57A 5H8YE 3LXFA 1XCQL 3DWGC 3LB8C 2KACA 2WXJA 1PGAA 2CU3A 4WH4A 4YXDB 3P4RB 1ZXHA 3HUIA 4YTNB 1V8CA 1KF6B 2JYEA 3AEGB 3L4PA 3PZ8A 1QOBA 3AEFB 4A6QA 1HEZE 2KMMA 3ZJVA 1PUTA 2N9KA 1L5PA 1P7EA 3NS1A 1MHXA 1FCLA 3BK1A 1FM0D 1AW7A 1I4GA 3IT4B 3V3XA 2B76B 4AS1A 1DOIA 2BB6A 1EU3A 1K53A 1FIQA 3ZGZA 2BS3B 2WP9B 2IDYA 3P4QB 1WSPA 4ITKA 4A9AA 1SSNA 2HTME 1K51A 1ROEA 2OHFA 1QILA 1C9FA 1E6EB 4OVZA 1GB1A 5D7GA 1KH0A 2BB5A 4O1NA 1K50A 1ET9A 3Q8AA 3W5VB 3I9V1 4IDIA 2EELA 3NRZA 1OQRA 4YTPB 5E6JA 1NVID 1WRIA 1N60A 2DWQA 1QKZA 1QQRA 2WXMA 3J9CA 4MH8A 5C3JB 1N5XA 5I4DA 1IBXB 2DYOA 1YN4A 2MH7A 4RNAA 2JZPA 2LEKA 4RF0A 1I4RA 1SB3C 2WU5B 3B2FA 3TSSA 4M0WA 1I7HA 3OWEB 1L0VB 1UWMA 4XDCA 1IBXA 2I2YA 1F2RI 1JWUD 2MJ3A 3MFGA 2HDEA 4C56C 1VJKA 2JX5A 3BIID 3Q8FA 3VRAB 1JQ4A 3P1MA 1V97A 1HA5A 3U4EG 3ETRA 1Q10A 4ARCA 4N58A 2WDVB 4OZBA 2J52A 4B0MA 4A8XC 1AN8A 1L0YB 1I4XA 1SE2A 3NVYA 4A55A 1JWAD 1KLGD 2LUMA 4OW0A 2FBWB 2IGDA 1KTKA 3FAHA 1QOGA 2J4XA 1D4BA 4B0EA 3AE8B 5FK9C 1FMAD 4L1BA 1E0ZA 1F0ZA 3BYYB 2QSDA 4YSZB 4ZHPA 3T3OA 1XXGA 1FO4A 3UI3A 4NAMA 4C80A 1XF5L 4GDLB 1T3QA 1FFUA 1N5WA 1QOAA 1FFVA 4LTUA 2Y5CA 1FRRA 3SFEB 2WXNA 1E10A 4MT5A 5C2TB 4CQNA 1FCCC 4C7YA 1TJEA 3AM9A 1SE4A 1SIJA 5EE1A 2WXKA 3R2TA 1V1OA 2PW9A 1T6BX 2I38A 3VRBB 2PKOA 4R3DA 1Y56A 3TEZA 4WIPA 1FEHA 1T5XD 2LHEA 1QLBB 1P7FA 2Y3AA 1PGXA 3EA6A 4XE0A 2BW2A 2QJLA 2DYMA 1XLOA 2ICIA 1AYFA 1WGKA 2WXPA 4A90A 1I4QA 1N63A 5FKAC 1DGJA 1SE3A 1C77A 5BMHA 1NYQA 4RH6A 1ENFA 3ZQ4A 1ACCA 2V4IB 2JWUA 5EE9A 1JRPA 1PGBA 2ZW0A 2D5GA 5GXGB 5EE0A 3MHZA 3IAM1 3P42A 1SEBD 1SXTA 1GOZA 4TQ1A 2NTTA 1JMLA 1FRDA 2CJNA 2WXLA 2BTEA 3PZ7A 4ZRQA 4NJCA 3BWUD 4RGOS 1JWSD 1RM6C 1VR9A 1YQ4B 3VR8B 1IGCA 1I4PA 2INNE 2PIAA 1FD6A 4TQ0A 3MJ5A 1C79A 5T8IA 4KGTA 1TS5A 1OFFA 2H89B 3LYYA 1D5XC 3W2DA 2PVOD 1IUEA 1D5MC 2FE8A 2G1EA 4RGNA 2J42A 4OZCA 1ZXIA 4YT0B 2RPVA 1RYJA 1TZOA 1SBBB 2JQRB 4RCOA 1MVKA 2QEJC 1HQRD 4IOIE 1EWCA 5HFYA 1KRHA 1TY0A 1YJIA 5BYRA 1C78A 1ZDXA 4JE3B 4L23A 1J7BA 4RGMA 3AMZA 2L1AA 3GS2A 1F2RC 2GB1A 2KDMA 2YEPB 5LNK1 2KQ4X 3TEXA 1OQQA 2BS4B 3H8HA 5EE3A 1E7PB 2BYTA 5H92C 3AH7A 3NZ3A 1ZUD2 3KLSX 3C8YA 4KKIA 1LO5D 2AX5A 1D6EC 1FNWA 3HVDA 2K5PA 2EKIA 1UGJA 4US9A 2R61A 2GRIA 4GDKB 4YSXB 5BYQA 4RF1A 2WDRB 2V3PA 2WXGA 3NVWA 1PDXA 4MACA 4NZLB 1GPXA 3R8BA 1RFKA 1A70A 2SEBD 2MEKA 2AQ3B 3AE1B 5BYSA 3AEBB 1RWSA 2KN4A 1QF6A 3RPFC 1FXAA 5AUIA 1L6VA 4P16A 4C7ZA 1MHHE 1TS2A 1VZ7A 2ZW1A 3TEWA 1EU4A 2L83A 4JX1C 1MPEA 4HKQA 3AE6B 1TKGA 3AE5B 2BS2B 4KKJA 3KQ4A 3URYA 4YWGG 3AE7B 4WAFA 1YNTE 4TMAB 1NEKB 4HKZE 4JWSC 4KX6B 4XDDA 2H88B 3AEDB 2Q5WD 1YJJA 1UWXA 3W9CB 2VZKB 4P6VF 1GB4A 3HRDD 1I4HA 3R2IA 3SR6A 2WXIA 3AE2B 3W5UB 3TEYA 5G5HA 1ESFA 2WQYB 1ET6A 4Q2JA 2IPKD 3PO0A 4DXFA 3ABVB 1XEEA 4OZAA 1V1PB 3BYTB 2XN9C 5MPOA 1SJED 2NTSA 3HVZA 1FNUA 1ZDVA 3AEEB 3E56A 2ON8A 3W1SA 1VLBA 2WXOA 3AE9B 2WNMA 4ARIA 2L32A 1V1PA 3CIRB 3TUOA 1PFDA 5AUKA 1NENB 4HJGE 2DBYA 4HEA1 4ZRPA 4WQMA 3BZDB 2G9HD 1C4AA 3ZJTA 3IT6B 4GLSC 1VRAB 4JPSA 1WYGA 3Q69A 2ACZB 1BUIC 3EGRA 4IKGA 1WWTA 4PT5A 2KWDA 1GAQB 5FR3A 2K9XA 2DLBA 2YEPF 2AQ2B 5D3DA 2K3UA 3NVVA 3Q8CA 1EM7A 1XCTL 1XLPA 3P4PB 4N59A 3BK2A 2PVGC 2WXFA 1BMLC 3ZJUA 2JXTA 5TSSA 1YN3A 1CQVA 2RDGA 1QOFA 3SFDB 4USAA 1JWBD 1J7CA 1E9MA 3CWIA 2WS3B 4JWUC 1N61A 3P4SB 5HHDG 1XO3A 1PYWD 3AEAB 1IGDA 2W82A 1CZPA 3AE3B 1VZ6A 3GP7A 2WLBA 4REZA 2QIEB 2XNAC 2Y5PA 2LHDA 1DOXA 1HZ6A 2E3TA 3BVGA 3RFZB 2L52A 1B1ZA 2W3SA 2LFIA 2GI9A 1DOYA 2K22A 2J53A 2WXHA 3AE4B 1BXTA 2E6XA 3SEBA 2M19A 2WU2B 3KWVA 1YQ3B 1FNVA 3B2GA 1ZE3D 1JWMD 1VDVA 1WXQA 4DQOC 3Q8BA 1JROA 5HG2A 4DXGA 1B9RA 2IJ0A 1KFYB 1NI3A 1STEA 3MP9A 1ZOYB 4YSYB 2V3NA 4UDUC 3U7ZA 1TYGB 3GB1A 3NUHB 3U2SC 4OHJA 4WURA 4AQ7A 1TS4A 2WXRA 4MM3B 5D3IB 2N9LA 2PLPA 2Z8LA 4ZHOA 3B9JA 1L0XB 1TY2A 2PTLA 2WDQB 3Q8EA 4TSSA 3BVMA 3AECB 3EUB2 5BMIA 4D2KA 4US8A 1J7AA 1ZPSA 1AWDA 1MI0A 1M4VA 4LLGM 2IGGA 3IXSA 4XWTA 4WWMA 4LK0M 2BT6A 1NYRA 1JALA 4L2YA 4KGSA 4RGTA 3VQIA 3ZYYX 3WCQA 2JSVX 2N0SB 1JW9D 2VZKD 1N62A 2W55A 1XLQA 3N9YC 1ZP0B 2ONQA 1KLUD 2LJIA 1UNSA 2LMCA 4FXCA 3U52E 1TKYA 4ZYSA 4H2AA 2KAJA 3FC4A 1EWYC 1C76A 2RMMA 4ZOHC 2WXQA 3FILB 3O13A 4NAWB 2M0AA 1D5ZC 1L6UA 1QT9A 2W54A 1SJHD 2JYTA 1JCKB 2W3RA 2M56B 2PMVA 1HXYD 1XLNA 2NMQA 2BBCA 3BVZA 3FILA 2OEDA 1CK1A 4YTMB 1R7SA 1TS3A 4N6EB 3VR9B 3DWMA 4HROA 1YMHE 1CJEA 2CJOA 2LGIA 1L4DB 2SAKA 3MC0B 1UUPA 2V0GA 4J3OD 3T3NA 2FUG1 2QMTA 1VZ8A 2X38A 3E9SA 2N7JA 3IAS1 1HZ5A 4XWWA 3AN1A 1K52A 2JU6X 2AQ1B 2MJEA 2TSSA 3KWLA 4EE2A 4RFBA 3AB5A 4HRSA 2RDHA 5BMGA 2MJDA 1FXIA 2QILA 1F77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHD A;  5HI1 A;  3UI3 A;  1HZ6 A;  1XF5 L;  4MAC A;  4KGR A;  2K0P A;  2IGH A;  5JXV A;  2GI9 A;  2J53 A;  1XCQ L;  1FCC C;  2KN4 A;  2KAC A;  2PW9 A;  1PGA A;  4WH4 A;  1ZXH A;  2I38 A;  1MHH E;  5HG2 A;  2ZW1 A;  1MPE A;  2LHE A;  1P7F A;  1PGX A;  3MP9 A;  3GB1 A;  1HEZ E;  2N9K A;  1YNT E;  1P7E A;  1MHX A;  1FCL A;  2N9L A;  4HKZ E;  2PLP A;  3V3X A;  5BMH A;  2PTL A;  2JWU A;  1UWX A;  1PGB A;  2ZW0 A;  5BMI A;  1GB4 A;  4D2K A;  1K53 A;  1MI0 A;  2IGG A;  1JML A;  1K51 A;  1C9F A;  4OZA A;  1GB1 A;  4KGS A;  2JSV X;  1KH0 A;  2ON8 A;  1IGC A;  1K50 A;  1FD6 A;  2EEL A;  2ONQ A;  4KGT A;  1QKZ A;  1IBX B;  2RMM A;  3FIL B;  4HJG E;  2JZP A;  4OZC A;  2RPV A;  1MVK A;  4GLS C;  2NMQ A;  1IBX A;  4IOI E;  5HFY A;  2I2Y A;  1F2R I;  4IKG A;  2KWD A;  3FIL A;  2OED A;  1EM7 A;  1XCT L;  1F2R C;  2GB1 A;  2KDM A;  1Q10 A;  1YMH E;  4OZB A;  2LGI A;  2J52 A;  2KQ4 X;  2JXT A;  2QMT A;  2LUM A;  2N7J A;  1HZ5 A;  2IGD A;  1K52 A;  2JU6 X;  5HHD G;  1D4B A;  1IGD A;  5BMG A;  2QSD A; 
#chains in the Genus database with same CATH topology
 1YN5 A;  2KDF B;  2K0P A;  2LI5 A;  3PRZ A;  1D3Z A;  4ICV A;  1Q1O A;  3L13 A;  5DPW A;  3P4R B;  4NQL B;  4K7S A;  4S0R A;  3AEF B;  2M8S A;  2ZNV B;  4A6Q A;  1E7V A;  2KMM A;  1PUT A;  4FN2 A;  1MHX A;  4B95 A;  1FM0 D;  2KTF A;  2ZCC A;  3CSF A;  1TT5 B;  1DOI A;  3L16 A;  2BB6 A;  1EU3 A;  1K53 A;  2MA9 B;  2BS3 B;  2WP9 B;  4LNO A;  4MH0 E;  5L83 A;  1WSP A;  4A9A A;  1SSN A;  1V2Y A;  3NY5 A;  2OHF A;  2BYV E;  1C9F A;  3WAL A;  2N1W A;  1E6E B;  2KMA A;  2MCN B;  2BB5 A;  1MG8 A;  3H7S A;  4LJO B;  4LNK A;  4M8M A;  3JVZ X;  2BKR B;  3W5V B;  4M0W B;  5E6J A;  1NVI D;  4BKS D;  1IBX B;  2DYO A;  3ENE A;  4K3C A;  3DQV A;  4EKU A;  1SB3 C;  2WU5 B;  4ICU A;  1I7H A;  3DHG C;  1L0V B;  1UWM A;  1F2R I;  1JWU D;  1S1Q B;  1VJK A;  4C4V A;  5CHF A;  4OZB A;  1WI0 A;  3AUL A;  4MGY E;  1SE9 A;  1SE2 A;  3NVY A;  2GBJ A;  4J6I A;  4E71 A;  2O6V A;  1QOG A;  3FAH A;  3RUL A;  3ZXR A;  5FK9 C;  2KC2 A;  2REX A;  3BYY B;  2QSD A;  1FO4 A;  4II3 B;  2DZM A;  4NAM A;  2KVR A;  3UIP B;  1T3Q A;  1VD2 A;  4FJV B;  3K9O B;  2FID A;  1RFA A;  1QOA A;  4LTU A;  4EOY A;  2C7M B;  1E10 A;  4MT5 A;  1FCC C;  2CHW A;  4KIK B;  5KHO A;  1SE4 A;  1SIJ A;  2DAF A;  5DPR A;  2PW9 A;  4DBG A;  4E3C A;  3KW5 B;  2D3G A;  2AEH A;  4R3D A;  2KKC A;  2LHE A;  3A9J B;  1P7F A;  3EA6 A;  1PGX A;  2BW2 A;  2GOW A;  2VH2 A;  3I5J C;  1XLO A;  2ICI A;  4JGH B;  1N63 A;  4KZ0 A;  1SE3 A;  2KTR B;  3Q3O C;  3ZUN A;  4RH6 A;  1WY8 A;  4LDT B;  1PGB A;  2D5G A;  5GXG B;  3R7R A;  2LD9 A;  4HJK A;  3MHZ A;  3IAM 1;  1N6Z A;  4TQ1 A;  1JML A;  2QDF A;  2WXL A;  5D2M B;  3BWU D;  2EMS A;  1YQ4 B;  4FA6 A;  1I4P A;  1FD6 A;  4WWO A;  3ZO5 B;  1E8X A;  4KGT A;  4AJY B;  3RT3 B;  1WR1 A;  2PVO D;  1IUE A;  4RGN A;  3U30 A;  4OZC A;  1ZXI A;  2RPV A;  4KSL C;  2QEJ C;  3DVN U;  2LXA A;  1YJI A;  2MLB A;  3RZF A;  3ZW3 A;  1UGM A;  5HKH A;  2NS5 A;  3OG5 A;  2GB1 A;  2KDM A;  2ZVO A;  3A33 B;  4I6P A;  5IP4 D;  3PHX B;  2CU1 A;  4QAY A;  3U7D A;  3ZVV A;  3H8H A;  3NZ3 A;  3C8Y A;  1YX6 B;  1E5W A;  4KKI A;  3R3M A;  2AX5 A;  1D6E C;  1FNW A;  2K5P A;  4GDK B;  2HE7 A;  5BYQ A;  4RF1 A;  4W9K A;  4BKG A;  2V3P A;  3NVW A;  2IO0 B;  1JRU A;  4HDQ A;  1X1M A;  1WXA A;  5BYS A;  1IYF A;  2KDE B;  2KN4 A;  1QF6 A;  3RPF C;  5AUI A;  1T0Y A;  3ZTD A;  1MHH E;  2L7R A;  4M02 A;  2KDB A;  3ZNG C;  3W1Y A;  1SGH A;  3TEW A;  1MPE A;  4HKQ A;  2KX3 A;  2BS2 B;  3PLU A;  3AU4 A;  4NPN A;  4CYE A;  3N3K B;  3AE7 B;  4BAX A;  2O2V A;  3Q3J A;  4HKZ E;  2V1Y A;  1WGG A;  1WX8 A;  1AAR A;  1I35 A;  3W9C B;  3KYC D;  4HXD A;  4IWO A;  4BKT A;  2IND C;  3AE2 B;  3RZW C;  4Q2J A;  3IBE A;  2IPK D;  3ABV B;  4OZA A;  4K7W A;  1V1P B;  2XN9 C;  5MPO A;  2NTS A;  3HVZ A;  3ZDT A;  1ZDV A;  3E56 A;  4PK1 A;  1FXT B;  1VLB A;  3HM3 A;  2WNM A;  2L32 A;  5EDS A;  1PFD A;  2MBE A;  2BYF A;  5AUK A;  3H6N A;  1Z2M A;  3BZD B;  2G9H D;  4ANV A;  3APD A;  3IT6 B;  3B1L X;  4GLS C;  1UZX B;  2ACZ B;  2KWD A;  4GGQ A;  1V86 A;  2YEP F;  2KX0 A;  5D3D A;  2K3U A;  2KJ6 A;  3VVW B;  4B6W A;  1WX7 A;  2M1M A;  3PV1 A;  1J7C A;  1E9M A;  3GZN B;  2WS3 B;  1N61 A;  1IGD A;  1CZP A;  4PYU A;  2V3S A;  2QIE B;  2LHD A;  3Q3M C;  1WXV A;  2L52 A;  2WX0 A;  1B1Z A;  2MX2 A;  3VUW A;  2JWZ A;  2W3S A;  2FAZ A;  2K22 A;  3EFC A;  3NJT A;  3K9P B;  3B2G A;  1V6E A;  4PYZ A;  1JWM D;  2QCZ A;  3Q8B A;  3QC8 B;  1JRO A;  3UQB A;  3QK0 A;  4UDU C;  2KJR A;  4AQ7 A;  4W9J A;  3V61 A;  5J18 A;  5DPT A;  1YOV B;  1R4M B;  1TY2 A;  4TSS A;  3AEC B;  1HTO A;  1OEY J;  5BMI A;  2LVP A;  4MGI E;  1MJD A;  2L05 A;  4MM3 A;  1WM2 A;  4DDG D;  3MHS D;  4WWM A;  1OQY A;  1NYR A;  3JYU A;  2RR9 A;  2JSV X;  4B9K A;  2LAS A;  3IG3 A;  4IC7 B;  1WFY A;  2W55 A;  1XLQ A;  2ONQ A;  2C7N B;  1DOX A;  2LMC A;  4WJO A;  1TKY A;  3VUY A;  4RM8 A;  2UYZ B;  2WXQ A;  3O13 A;  4NAW B;  5C1Z A;  2W3R A;  4MGK E;  4GXB A;  4CHK A;  2KWV B;  2PMV A;  1HXY D;  4MJS A;  1NBF C;  2WGS A;  2C7H A;  4P1C C;  1K8R B;  1CK1 A;  4N6E B;  3VR9 B;  3DWM A;  1YMH E;  2LGI A;  2SAK A;  2K8H A;  3MC0 B;  2V0G A;  3T3N A;  2LGD A;  1MG4 A;  4FUL A;  4XWW A;  3AN1 A;  1P3Q U;  2M0X A;  4F1S A;  4PS8 A;  2MJE A;  4GOC A;  5JH5 C;  3PZD A;  2WYQ A;  4EUT A;  2OJW A;  1FXI A;  2QIL A;  5HI1 A;  2LVQ A;  4KGR A;  5JXV A;  1TKE A;  1SF0 A;  3I57 A;  5H8Y E;  2C9W B;  3LXF A;  4OVU A;  1GC6 A;  5AZH A;  4DK5 A;  2KAC A;  3TIX A;  4FBJ B;  3KVF B;  3HUI A;  4BOS C;  5LLI A;  3L4P A;  1Y8R C;  4ZRK A;  2LJ5 A;  2RSU A;  2I1K A;  2N9K A;  1F52 A;  3ZIM A;  3IT4 B;  3V3X A;  3QCA A;  3SU8 X;  2B76 B;  3X0W A;  3Q2A C;  4HPM B;  2UU7 A;  2IDY A;  3L08 A;  1ROE A;  2WX1 A;  2KLG A;  5IAA C;  1KH0 A;  2BGF A;  4URK A;  1ET9 A;  3VXW A;  2J0K A;  4IDI A;  2EEL A;  3NRZ A;  1OQR A;  2BF8 B;  4EEW A;  2WXM A;  5J2R A;  2DWQ A;  4JLC A;  2XK5 A;  1TZ1 A;  4MH8 A;  2N9X A;  3PPA A;  2MH7 A;  4RNA A;  4JL9 A;  1WXS A;  2AYO B;  1V80 A;  3BY4 B;  4RF0 A;  4AOF A;  4C4V B;  3TSS A;  1TTN A;  4KV2 A;  2JVC A;  5CTR C;  4XDC A;  4I6N B;  4C56 C;  3Q8F A;  1JQ4 A;  2AL3 A;  3P1M A;  1V97 A;  3U4E G;  4W9H A;  2WDV B;  4B0M A;  3N1X C;  1U4A A;  2L3Z A;  3ZRF A;  4TV3 A;  1RRB A;  3PVL A;  2J4X A;  1EF1 A;  1D4B A;  3RN9 C;  3RCZ A;  3B08 A;  1E0Z A;  3WA0 A;  3RUI B;  4YSZ B;  3T3O A;  4ZHP A;  4C80 A;  1XF5 L;  5G55 A;  1FFU A;  1N5W A;  1FFV A;  1FRR A;  2M4N A;  4CQN A;  3Q14 C;  2V9H A;  3JW0 X;  1TJE A;  2NBV B;  1V1O A;  2BWF A;  2FNJ B;  2I38 A;  4IM2 A;  2FCN A;  3PHW B;  3PSE B;  1Y56 A;  3TEZ A;  4WIP A;  2KVZ A;  2QJL A;  1AYF A;  3GOE A;  1F1H A;  4MEM A;  1UBQ A;  1C77 A;  3ZNH B;  1NYQ A;  5EE9 A;  4BBN F;  2K8B A;  1R4N B;  2WWZ A;  3PT2 B;  3DHI C;  3P42 A;  1SEB D;  1GOZ A;  5AZF A;  4WJP A;  4GSW A;  3PZ7 A;  4ZRQ A;  4NJC A;  2LZ6 A;  2KK8 A;  2ZPN A;  3QAQ A;  3AI5 A;  1RM6 C;  1J0G A;  1VR9 A;  3VR8 B;  2GMI C;  2KWU B;  3TMP B;  1OEY A;  1I42 A;  4TQ0 A;  1WGR A;  1C79 A;  1KM7 A;  4ANU A;  2NPT A;  2UWQ A;  4EFO A;  2FE8 A;  2INC C;  2G1E A;  5TR5 A;  4YT0 B;  1TZO A;  3DVG X;  1MVK A;  1WGH A;  1LQB A;  5BYR A;  1C78 A;  3DCG A;  3CMM B;  3M95 A;  1J19 A;  4RGM A;  2L1A A;  2YEP B;  4ACF A;  2KQ4 X;  4HVB A;  4MSQ B;  2V4L A;  3N30 A;  1KLV A;  4G11 A;  1E7P B;  3AH7 A;  3KLS X;  2XBB C;  2BKF A;  2KN5 A;  2KD0 A;  1UGJ A;  4YSX B;  4DHZ E;  2WXG A;  1GPX A;  2SEB D;  1F9J A;  4DHZ B;  2MEK A;  3VFK A;  2O2V B;  1VZ7 A;  2ZW1 A;  1EU4 A;  2L83 A;  4N9F 4;  2MW5 A;  1WZ3 A;  3URY A;  4YWG G;  1YNT E;  4JWS C;  3DDC B;  3AED B;  2Q5W D;  4HCP B;  1YJ1 A;  2PEA A;  2VZK B;  3HRD D;  4GMV A;  2WXI A;  2NCN A;  2CR5 A;  5G5H A;  2WQY B;  3IFW B;  2MSE D;  3BYT B;  1HTQ A;  2DX5 B;  1SJE D;  3AEE B;  3V62 A;  2ON8 A;  3W1S A;  2WXO A;  4KSK C;  4ARI A;  1WIA A;  3TUO A;  3AXC A;  2KWC A;  4IM3 A;  3DBH B;  4BBN C;  4HJG E;  2DBY A;  4ZRP A;  4WQM A;  3RNF C;  3OLM D;  2G3Q B;  2DYB A;  4HK2 A;  1C4A A;  4LJP B;  3HIZ A;  3WAM A;  3EGR A;  4PT5 A;  1WWT A;  2K9X A;  1UH6 A;  2DLB A;  1L2N A;  4HWI B;  1EM7 A;  1XQQ A;  1XLP A;  2GBR A;  3P4P B;  1WMH A;  4JQW C;  4FJZ A;  2PVG C;  2QHO A;  3ZJU A;  1CQV A;  3CF6 E;  3OJ3 A;  2ZJD A;  4K81 A;  1JWB D;  2YVC A;  2GLS A;  3CWI A;  4A20 A;  2KC1 A;  1XO3 A;  2JXX A;  3AE3 B;  4AJW A;  2Y5P A;  3NZU A;  4W9E A;  1HZ6 A;  2E3T A;  3C0R B;  1T0R C;  4HCN B;  4MGZ E;  1DOY A;  2LFI A;  3AE4 B;  4K1R B;  2E6X A;  2K8C A;  3QA8 A;  2M19 A;  5HG2 A;  4KZC A;  4W9L A;  1B9R A;  2IJ0 A;  4P7I A;  3H1U A;  2EMT A;  1HE8 A;  2L0F A;  1ZOY B;  2V3N A;  1TYG B;  3GB1 A;  4ZRJ A;  3U2S C;  1OGW A;  2WXR A;  4MM3 B;  2Z8L A;  1L0X B;  4AUQ C;  3BVM A;  3EUB 2;  5GMV A;  4US8 A;  3PRP B;  1M4V A;  2K6Q A;  3IXS A;  1JAL A;  4KGS A;  4RGT A;  3ZYY X;  3WCQ A;  1N62 A;  5IKC M;  3NOB A;  4FXC A;  1WJU A;  3U52 E;  4E74 A;  4H2A A;  4MJS B;  2ZEQ A;  2KFK A;  4ZOH C;  1E90 A;  1D5Z C;  1L6U A;  1JCK B;  1WJN A;  3UIN B;  3BVZ A;  3OJ4 B;  1BT0 A;  1TS3 A;  4NJ7 A;  4II2 B;  1IP9 A;  4HRO A;  5DPS A;  5IOI A;  1GUA B;  2NBU A;  2KT7 A;  5L95 C;  4J3O D;  2FUG 1;  4XZ4 A;  4NNJ B;  4WJQ A;  1VZ8 A;  3E9S A;  2BPS A;  1E8Y A;  3APF A;  2AQ1 B;  2TSS A;  4EE2 A;  2IO3 B;  2JRH A;  4P1B C;  4RFB A;  3AB5 A;  4HRS A;  2A4Z A;  3QHT A;  3P63 A;  2IGH A;  2N7D A;  3NVZ A;  2L76 A;  4LNN A;  2FUH B;  2CU3 A;  2JY6 A;  4WH4 A;  4YXD B;  2KDI A;  1V8C A;  2LGS A;  2CHZ A;  1LXD A;  3MJW A;  2LUE A;  1P7E A;  3M62 B;  3BK1 A;  1I4G A;  2KQS A;  3ML8 A;  4AS1 A;  1P9D U;  1TIF A;  3QAR A;  3ZGZ A;  3HHM A;  1IPG A;  2J7Q B;  2K39 A;  3IHP C;  4ITK A;  2HTM E;  1K51 A;  2CHX A;  1GB1 A;  1WJ4 A;  2XK5 B;  1K50 A;  3OAW A;  4NQK E;  2R2O A;  3JSV A;  2IYD B;  3IVF A;  4YTP B;  3AU5 A;  1WRI A;  1N60 A;  5C3J B;  5I4D A;  1LM8 B;  1YN4 A;  2JZP A;  3PS6 A;  2MBH A;  3LJ3 A;  3QQ8 B;  3W1S C;  2HTH A;  3OWE B;  4X57 B;  1TGZ B;  2IY1 B;  2I2Y A;  2LGY A;  2LWP A;  2MJ3 A;  3MFG A;  3VRA B;  3ALB A;  1HA5 A;  3DVN V;  2OOB B;  3ETR A;  2J52 A;  1WE6 A;  4A8X C;  2A5U A;  3KYD D;  4A55 A;  3VTU A;  2FBW B;  3H7P A;  3X23 A;  1KTK A;  1P0R A;  1UEL A;  4F8C B;  3PRM B;  2ZCB A;  2MP2 A;  1FMA D;  4EZJ A;  1XXG A;  2D10 A;  2JF5 A;  1CMX B;  2JPH A;  4IM0 A;  1YX5 B;  3SFE B;  3P2B A;  1NI2 A;  5C2T B;  4C7Y A;  2FIF A;  2WXK A;  4GDL A;  2LRW A;  1T6B X;  3ZNI D;  2L0T A;  3DBS A;  3MTN B;  3HM6 X;  1FEH A;  1T5X D;  2MBB B;  1QLB B;  2Y3A A;  2DYM A;  1WGK A;  2WXP A;  2BWE S;  4FLH A;  3DBL B;  5FKA C;  1DGJ A;  3UGB B;  5BMH A;  1ENF A;  2V4I B;  1EO6 A;  2JWU A;  3VH4 B;  4IG7 B;  3PTF C;  2G45 B;  2C5L C;  1SXT A;  1FRD A;  3R66 C;  2BTE A;  2NPT B;  3UF8 A;  1YQB A;  2MBO A;  3D32 A;  4ASW C;  4ZDV A;  5LXI B;  1IGC A;  2PIA A;  3SDL C;  3SD5 A;  3MJ5 A;  5E6N A;  5JHB A;  1OFF A;  3LYY A;  3DVG Y;  3N1Z C;  1RYJ A;  1V5T A;  3MC8 A;  1SBB B;  1V5O A;  2JQR B;  1GG3 A;  1HQR D;  5HFY A;  1KRH A;  3VTW A;  1J7B A;  4EZL A;  3AMZ A;  3DBR B;  1F2R C;  2GBN A;  1WX9 A;  4NJ6 A;  3TEX A;  3N1Y C;  5IA7 A;  1EF5 A;  2RGF A;  4US9 A;  2R61 A;  1XD3 B;  2GRI A;  2KZR A;  3ZKJ C;  2WDR B;  3KUD B;  2PPH A;  3NS8 A;  2D07 B;  2IZV B;  3R8B A;  1L7Y A;  1PQS A;  2FCQ A;  2MBQ A;  1H8C A;  4DWF A;  2PE9 A;  2G4S A;  2AQ3 B;  3AE1 B;  1VCB A;  3AEB B;  4ZYN A;  1RWS A;  1L6V A;  3DHH C;  4XC2 A;  1TS2 A;  1GC7 A;  3AE5 B;  1E8Z A;  4GU2 A;  3TBL D;  4TMA B;  1XT9 B;  1RAX A;  4KX6 B;  4XDD A;  2H88 B;  1YJJ A;  3QX1 A;  3NG0 A;  4AP4 C;  1GB4 A;  1I4H A;  3R2I A;  3M3J A;  3KUZ A;  1Q0W B;  3W5U B;  3TEY A;  1ESF A;  1ET6 A;  3PO0 A;  4DXF A;  4G0N B;  4FHJ A;  4AWJ A;  4LDT D;  4I6L B;  2JUO A;  2JT4 B;  1R4N I;  4W9I A;  4XGA B;  3CIR B;  4ZRI A;  4WJN A;  4ANX A;  1NEN B;  1TBE A;  4HEA 1;  1KOT A;  3NZS A;  1WMH B;  2LXC A;  2K1F A;  3A9K B;  4JPS A;  1QZE A;  2KHW B;  1V81 A;  1GAQ B;  5FR3 A;  4G50 A;  5J17 A;  2AQ2 B;  1FPY A;  3NVV A;  5LXH A;  1XCT L;  2MRP A;  1SIF A;  4N59 A;  3BK2 A;  2Y5B B;  5TSS A;  1YN3 A;  2RDG A;  1QOF A;  3SFD B;  5CHV C;  3MC9 A;  4JWU C;  1LFD A;  2K6D B;  3AEA B;  2VRR B;  4JIO U;  1VZ6 A;  4REZ A;  2PE6 B;  1WJ6 A;  5D94 A;  3B0A A;  3BVG A;  4XX5 A;  3APC A;  1V49 A;  5E6O A;  2ZVN A;  1UBI A;  1G6J A;  2WXH A;  4W9D A;  4MEL A;  3U8Z A;  2L8J A;  3SEB A;  1YQ3 B;  2HJ8 A;  4A3P A;  1VDV A;  4BZA A;  1WXQ A;  4XYC A;  1UF0 A;  3QWZ B;  4DXG A;  4FJY A;  3L0W B;  1STE A;  2BYE A;  1T0S C;  3MP9 A;  1WH3 A;  4YSY B;  5IO9 A;  3T9L A;  4OHJ A;  4WUR A;  2AWT A;  3ZRC A;  2N9L A;  1YIW A;  4G3X B;  3B9J A;  3EEC A;  3Q8E A;  2PTL A;  2WDQ B;  3CST A;  1J7A A;  3UQA A;  1AWD A;  4HDO A;  5AZG A;  2IGG A;  4M8N A;  2GBM A;  2DHZ A;  3LDZ E;  4LK0 M;  3ZNZ B;  4DHJ D;  1P98 A;  3VQI A;  2N0S B;  3M63 B;  2KFK B;  2LVO A;  3QIJ A;  3N9Y C;  1KLU D;  1UNS A;  4ZYS A;  3A1Q A;  3FC4 A;  3T8M A;  4W9F A;  3A4S C;  1QT9 A;  2W54 A;  3TJP A;  4DDI D;  2M56 B;  3L10 B;  1XLN A;  2Z0E B;  2BBC A;  2IO2 B;  2GBK A;  4FHK A;  3FIL A;  1Z5S B;  2OED A;  1R7S A;  2KQ7 A;  3VDZ A;  2NR2 A;  3DBH I;  1CJE A;  2X38 A;  1HZ5 A;  3KH0 A;  2JU6 X;  1WR6 E;  2RDH A;  5BMG A;  1F77 A;  3DOW A;  3KUC B;  3VTV A;  3V05 A;  4WWN A;  1C4C A;  1C4P A;  1L4Z B;  3TCA A;  3AV8 A;  5G5G A;  2INP E;  1DYQ A;  3A9K A;  4C00 A;  2D3B A;  1XCQ L;  3DWG C;  3RNC C;  3LB8 C;  1WF9 A;  2WXJ A;  3PGE A;  3V6E B;  1PGA A;  1ZXH A;  3ZDM C;  4YTN B;  5DCN A;  1KF6 B;  2JYE A;  3AEG B;  3PZ8 A;  2J0M A;  1QOB A;  4GN1 A;  2D3C A;  1HEZ E;  3ZJV A;  1L5P A;  4ANW A;  4M00 A;  3NS1 A;  1FCL A;  1AW7 A;  2RPQ A;  4WWP A;  1FIQ A;  4RMA A;  3EFU A;  2YLM A;  2EKE C;  3P4Q B;  2ASQ A;  3WAO A;  1QIL A;  3JSV B;  1ZW7 A;  4OVZ A;  1V9J A;  2LGX A;  5D7G A;  4O1N A;  3Q8A A;  3I9V 1;  4HLE A;  2HJ1 A;  3RMK C;  1QKZ A;  1QQR A;  2WDT B;  3J9C A;  4YL8 A;  1N5X A;  3L17 A;  3Q3F A;  4K7U A;  1J8C A;  2LEK A;  1I4R A;  3H9D A;  3B2F A;  4M0W A;  3WAP A;  3NHE B;  4LNI A;  1IBX A;  4K3B A;  2PJH A;  3VUX A;  2HDE A;  2JX5 A;  3BII D;  2KXJ A;  1WGD A;  2JRI B;  1RLF A;  3H7P B;  4CO7 A;  1Q10 A;  4ARC A;  4N58 A;  3O65 B;  1AN8 A;  1L0Y B;  1I4X A;  2MP2 B;  4GB9 A;  3FKY A;  1JWA D;  1KLG D;  1WYW B;  3RYT A;  2NVU I;  2LUM A;  4OW0 A;  2IGD A;  3UIO B;  2VH1 A;  3WIM A;  4B0E A;  4HPP A;  3AE8 B;  1YD8 U;  4L1B A;  1F0Z A;  1WRD B;  2KMC A;  1P1A A;  3UI3 A;  1NDD A;  4GDL B;  3RNG C;  4DHJ B;  2MHJ A;  2Y5C A;  2WXN A;  3AM9 A;  2BVC A;  4IUM B;  5EE1 A;  1ISN A;  1C3T A;  3VHT C;  3R2T A;  3VRB B;  2PKO A;  1S3S G;  3VH3 B;  4XE0 A;  4KIK A;  4A90 A;  1I4Q A;  2N1V A;  3A9J A;  2Z59 B;  4EZK A;  3ZQ4 A;  4OVV A;  1ACC A;  1JRP A;  3GZN I;  2ZW0 A;  5EE0 A;  3VAW A;  2KTR A;  2NTT A;  5G2N A;  2CJN A;  4W9G A;  2IBI B;  1OTR B;  4RGO S;  5C23 A;  1JWS D;  2DNF A;  2N9E B;  2INN E;  2DZK A;  2KOX A;  2FCM A;  1C1Y B;  5T8I A;  2D2Q A;  1TS5 A;  2H89 B;  3W2D A;  1D5X C;  2OJR A;  1D5M C;  1UD7 A;  2J42 A;  2FCS A;  4RCO A;  3SHQ A;  3N32 A;  4IOI E;  1EWC A;  1TY0 A;  1H4R A;  2L00 B;  3ZXV A;  1GJZ A;  1ZDX A;  5AEK B;  4JE3 B;  4LCD E;  2NBW B;  3R7Q A;  4L23 A;  1R4M I;  3PLV A;  3GS2 A;  1GNU A;  1LGR A;  4BFR A;  5IN7 A;  1M94 A;  5LNK 1;  2ZPY A;  2D3A A;  5FR6 A;  2M17 A;  1OQQ A;  2BS4 B;  4IW0 A;  5EE3 A;  2BYT A;  5H92 C;  1ZUD 2;  4F7Z A;  1LO5 D;  3C19 A;  3HVD A;  5KHQ A;  2EKI A;  2O6V D;  2K25 A;  2N9P C;  4DXA B;  1PDX A;  4MAC A;  4NZL B;  1RFK A;  1A70 A;  3RD2 A;  2CS4 A;  3QJZ A;  4GDK A;  3RI7 C;  1Q5W B;  4TKN A;  3Q6B A;  1FXA A;  4P16 A;  1ZGU B;  2KO3 A;  4C7Z A;  2BQQ A;  5E6P A;  4GIV A;  3A4R A;  2N7E A;  4JX1 C;  4BVU C;  3AE6 B;  1TKG A;  2KFJ A;  3N20 C;  3RNB C;  4KKJ A;  3KQ4 A;  4WAF A;  4BKS A;  1NEK B;  2JZ3 B;  1WM3 A;  1UWX A;  5D6J B;  4P6V F;  2X8X X;  3SR6 A;  2R2Q A;  4A3O A;  3ZLZ A;  3I3T B;  2HD5 B;  4LNF A;  1XEE A;  2ZNV C;  3DBL I;  4FAD A;  2W9N A;  4RM9 A;  2C60 A;  4IWQ A;  1FNU A;  2RDB C;  3AE9 B;  3HK0 A;  1V1P A;  1A5R A;  1WE7 A;  3RNE C;  5CHW A;  4WAA A;  2LRU A;  5CX3 A;  1KJT A;  3ZJT A;  1E8W A;  1WGY A;  1VRA B;  1WYG A;  1ZKH A;  3Q69 A;  1BUI C;  4IKG A;  4TUU A;  2CKH B;  2KYW A;  3Q8C A;  2N4F A;  2DEN B;  2WXF A;  1BML C;  2JXT A;  4PS3 A;  2RD0 A;  4USA A;  3I63 C;  2KJH B;  3V60 A;  4W9C A;  3P4S B;  5HHD G;  1PYW D;  2QC8 A;  2W82 A;  3GE8 C;  2MQJ A;  3GP7 A;  2WLB A;  3BIN A;  3DBR I;  2XNA C;  3GE3 C;  3RFZ B;  2GI9 A;  2DZJ A;  2J53 A;  2DAJ A;  1BXT A;  4KDI C;  2WU2 B;  3KWV A;  4S17 A;  1FNV A;  1ZE3 D;  3S2A A;  4DQO C;  2XEW A;  2JZZ A;  1KFY B;  2AL6 A;  3PRE A;  1NI3 A;  3Q3N C;  3U7Z A;  4BOZ B;  3NUH B;  4PS7 A;  4MSM B;  1TS4 A;  2WHI A;  5D3I B;  2PLP A;  4ZHO A;  1WZ0 A;  5BO4 B;  4MDK E;  2KNB A;  2D11 A;  4D2K A;  3TL5 A;  1ZPS A;  1MI0 A;  1MFW A;  3V6C B;  4LLG M;  4XWT A;  2MWS B;  2BT6 A;  4M01 A;  4L2Y A;  3WAN A;  3A1Q B;  1JW9 D;  2VZK D;  4HPL B;  2Z0D B;  2O6V B;  2KAN A;  3EHV A;  3ZTC A;  3ML9 A;  1ZP0 B;  1E7U A;  3RNA C;  2LJI A;  3L54 A;  2KAJ A;  1EWY C;  1C76 A;  2KLC A;  4WQO B;  2RMM A;  3FIL B;  2M0A A;  1SJH D;  2JYT A;  4IWP A;  3DPD A;  2B3A A;  2NMQ A;  3ECI A;  2DZI A;  5JHA A;  4NAW A;  1WXM A;  2I1J A;  4YTM B;  2CJO A;  1L4D B;  3EC8 A;  2ZZP B;  2IO1 B;  1UUP A;  2QMT A;  3IAS 1;  4KVG B;  1EUV B;  2N7J A;  2J0J A;  1K52 A;  3KWL A;  1T0Q C;  4KDL B;  5JZE B;  2G4D B;  4NY0 A;  3ONS A;  2IY0 B;  2MJD A; 
#chains in the Genus database with same CATH homology
 5HI1 A;  1YN5 A;  3P63 A;  3V05 A;  1C4C A;  1C4P A;  4KGR A;  2K0P A;  2IGH A;  1L4Z B;  3AV8 A;  1TKE A;  1SF0 A;  5JXV A;  5G5G A;  2INP E;  1DYQ A;  3NVZ A;  3I57 A;  5H8Y E;  3LXF A;  1XCQ L;  3DWG C;  3LB8 C;  2KAC A;  2WXJ A;  1PGA A;  2CU3 A;  4WH4 A;  4YXD B;  3P4R B;  1ZXH A;  3HUI A;  4YTN B;  1V8C A;  1KF6 B;  2JYE A;  3AEG B;  3L4P A;  3PZ8 A;  1QOB A;  3AEF B;  4A6Q A;  1HEZ E;  2KMM A;  3ZJV A;  1PUT A;  2N9K A;  1L5P A;  1P7E A;  3NS1 A;  1MHX A;  1FCL A;  3BK1 A;  1FM0 D;  1AW7 A;  1I4G A;  3IT4 B;  3V3X A;  2B76 B;  4AS1 A;  1DOI A;  2BB6 A;  1EU3 A;  1K53 A;  1FIQ A;  3ZGZ A;  2BS3 B;  2WP9 B;  2IDY A;  3P4Q B;  1WSP A;  4ITK A;  4A9A A;  1SSN A;  2HTM E;  1K51 A;  1ROE A;  2OHF A;  1QIL A;  1C9F A;  1E6E B;  4OVZ A;  1GB1 A;  5D7G A;  1KH0 A;  2BB5 A;  4O1N A;  1K50 A;  1ET9 A;  3Q8A A;  3W5V B;  3I9V 1;  4IDI A;  2EEL A;  3NRZ A;  1OQR A;  4YTP B;  5E6J A;  1NVI D;  1WRI A;  1N60 A;  2DWQ A;  1QKZ A;  1QQR A;  2WXM A;  3J9C A;  4MH8 A;  5C3J B;  1N5X A;  5I4D A;  1IBX B;  2DYO A;  1YN4 A;  2MH7 A;  4RNA A;  2JZP A;  2LEK A;  4RF0 A;  1I4R A;  1SB3 C;  2WU5 B;  3B2F A;  3TSS A;  4M0W A;  1I7H A;  3OWE B;  1L0V B;  1UWM A;  4XDC A;  1IBX A;  2I2Y A;  1F2R I;  1JWU D;  2MJ3 A;  3MFG A;  2HDE A;  4C56 C;  1VJK A;  2JX5 A;  3BII D;  3Q8F A;  3VRA B;  1JQ4 A;  3P1M A;  1V97 A;  1HA5 A;  3U4E G;  3ETR A;  1Q10 A;  4ARC A;  4N58 A;  2WDV B;  4OZB A;  2J52 A;  4B0M A;  4A8X C;  1AN8 A;  1L0Y B;  1I4X A;  1SE2 A;  3NVY A;  4A55 A;  1JWA D;  1KLG D;  2LUM A;  4OW0 A;  2FBW B;  2IGD A;  1KTK A;  3FAH A;  1QOG A;  2J4X A;  1D4B A;  4B0E A;  3AE8 B;  5FK9 C;  1FMA D;  4L1B A;  1E0Z A;  1F0Z A;  3BYY B;  2QSD A;  4YSZ B;  4ZHP A;  3T3O A;  1XXG A;  1FO4 A;  3UI3 A;  4NAM A;  4C80 A;  1XF5 L;  4GDL B;  1T3Q A;  1FFU A;  1N5W A;  1QOA A;  1FFV A;  4LTU A;  2Y5C A;  1FRR A;  3SFE B;  2WXN A;  1E10 A;  4MT5 A;  5C2T B;  4CQN A;  1FCC C;  4C7Y A;  1TJE A;  3AM9 A;  1SE4 A;  1SIJ A;  5EE1 A;  2WXK A;  3R2T A;  1V1O A;  2PW9 A;  1T6B X;  2I38 A;  3VRB B;  2PKO A;  4R3D A;  1Y56 A;  3TEZ A;  4WIP A;  1FEH A;  1T5X D;  2LHE A;  1QLB B;  1P7F A;  2Y3A A;  1PGX A;  3EA6 A;  4XE0 A;  2BW2 A;  2QJL A;  2DYM A;  1XLO A;  2ICI A;  1AYF A;  1WGK A;  2WXP A;  4A90 A;  1I4Q A;  1N63 A;  5FKA C;  1DGJ A;  1SE3 A;  1C77 A;  5BMH A;  1NYQ A;  4RH6 A;  1ENF A;  3ZQ4 A;  1ACC A;  2V4I B;  2JWU A;  5EE9 A;  1JRP A;  1PGB A;  2ZW0 A;  2D5G A;  5GXG B;  5EE0 A;  3MHZ A;  3IAM 1;  3P42 A;  1SEB D;  1SXT A;  1GOZ A;  4TQ1 A;  2NTT A;  1JML A;  1FRD A;  2CJN A;  2WXL A;  2BTE A;  3PZ7 A;  4ZRQ A;  4NJC A;  3BWU D;  4RGO S;  1JWS D;  1RM6 C;  1VR9 A;  1YQ4 B;  3VR8 B;  1IGC A;  1I4P A;  2INN E;  2PIA A;  1FD6 A;  4TQ0 A;  3MJ5 A;  1C79 A;  5T8I A;  4KGT A;  1TS5 A;  1OFF A;  2H89 B;  3LYY A;  1D5X C;  3W2D A;  2PVO D;  1IUE A;  1D5M C;  2FE8 A;  2G1E A;  4RGN A;  2J42 A;  4OZC A;  1ZXI A;  4YT0 B;  2RPV A;  1RYJ A;  1TZO A;  1SBB B;  2JQR B;  4RCO A;  1MVK A;  2QEJ C;  1HQR D;  4IOI E;  1EWC A;  5HFY A;  1KRH A;  1TY0 A;  1YJI A;  5BYR A;  1C78 A;  1ZDX A;  4JE3 B;  4L23 A;  1J7B A;  4RGM A;  3AMZ A;  2L1A A;  3GS2 A;  1F2R C;  2GB1 A;  2KDM A;  2YEP B;  5LNK 1;  2KQ4 X;  3TEX A;  1OQQ A;  2BS4 B;  3H8H A;  5EE3 A;  1E7P B;  2BYT A;  5H92 C;  3AH7 A;  3NZ3 A;  1ZUD 2;  3KLS X;  3C8Y A;  4KKI A;  1LO5 D;  2AX5 A;  1D6E C;  1FNW A;  3HVD A;  2K5P A;  2EKI A;  1UGJ A;  4US9 A;  2R61 A;  2GRI A;  4GDK B;  4YSX B;  5BYQ A;  4RF1 A;  2WDR B;  2V3P A;  2WXG A;  3NVW A;  1PDX A;  4MAC A;  4NZL B;  1GPX A;  3R8B A;  1RFK A;  1A70 A;  2SEB D;  2MEK A;  2AQ3 B;  3AE1 B;  5BYS A;  3AEB B;  1RWS A;  2KN4 A;  1QF6 A;  3RPF C;  1FXA A;  5AUI A;  1L6V A;  4P16 A;  4C7Z A;  1MHH E;  1TS2 A;  1VZ7 A;  2ZW1 A;  3TEW A;  1EU4 A;  2L83 A;  4JX1 C;  1MPE A;  4HKQ A;  3AE6 B;  1TKG A;  3AE5 B;  2BS2 B;  4KKJ A;  3KQ4 A;  3URY A;  4YWG G;  3AE7 B;  4WAF A;  1YNT E;  4TMA B;  1NEK B;  4HKZ E;  4JWS C;  4KX6 B;  4XDD A;  2H88 B;  3AED B;  2Q5W D;  1YJJ A;  1UWX A;  3W9C B;  2VZK B;  4P6V F;  1GB4 A;  3HRD D;  1I4H A;  3R2I A;  3SR6 A;  2WXI A;  3AE2 B;  3W5U B;  3TEY A;  5G5H A;  1ESF A;  2WQY B;  1ET6 A;  4Q2J A;  2IPK D;  3PO0 A;  4DXF A;  3ABV B;  1XEE A;  4OZA A;  1V1P B;  3BYT B;  2XN9 C;  5MPO A;  1SJE D;  2NTS A;  3HVZ A;  1FNU A;  1ZDV A;  3AEE B;  3E56 A;  2ON8 A;  3W1S A;  1VLB A;  2WXO A;  3AE9 B;  2WNM A;  4ARI A;  2L32 A;  1V1P A;  3CIR B;  3TUO A;  1PFD A;  5AUK A;  1NEN B;  4HJG E;  2DBY A;  4HEA 1;  4ZRP A;  4WQM A;  3BZD B;  2G9H D;  1C4A A;  3ZJT A;  3IT6 B;  4GLS C;  1VRA B;  4JPS A;  1WYG A;  3Q69 A;  2ACZ B;  1BUI C;  3EGR A;  4IKG A;  1WWT A;  4PT5 A;  2KWD A;  1GAQ B;  5FR3 A;  2K9X A;  2DLB A;  2YEP F;  2AQ2 B;  5D3D A;  2K3U A;  3NVV A;  3Q8C A;  1EM7 A;  1XCT L;  1XLP A;  3P4P B;  4N59 A;  3BK2 A;  2PVG C;  2WXF A;  1BML C;  3ZJU A;  2JXT A;  5TSS A;  1YN3 A;  1CQV A;  2RDG A;  1QOF A;  3SFD B;  4USA A;  1JWB D;  1J7C A;  1E9M A;  3CWI A;  2WS3 B;  4JWU C;  1N61 A;  3P4S B;  5HHD G;  1XO3 A;  1PYW D;  3AEA B;  1IGD A;  2W82 A;  1CZP A;  3AE3 B;  1VZ6 A;  3GP7 A;  2WLB A;  4REZ A;  2QIE B;  2XNA C;  2Y5P A;  2LHD A;  1DOX A;  1HZ6 A;  2E3T A;  3BVG A;  3RFZ B;  2L52 A;  1B1Z A;  2W3S A;  2LFI A;  2GI9 A;  1DOY A;  2K22 A;  2J53 A;  2WXH A;  3AE4 B;  1BXT A;  2E6X A;  3SEB A;  2M19 A;  2WU2 B;  3KWV A;  1YQ3 B;  1FNV A;  3B2G A;  1ZE3 D;  1JWM D;  1VDV A;  1WXQ A;  4DQO C;  3Q8B A;  1JRO A;  5HG2 A;  4DXG A;  1B9R A;  2IJ0 A;  1KFY B;  1NI3 A;  1STE A;  3MP9 A;  1ZOY B;  4YSY B;  2V3N A;  4UDU C;  3U7Z A;  1TYG B;  3GB1 A;  3NUH B;  3U2S C;  4OHJ A;  4WUR A;  4AQ7 A;  1TS4 A;  2WXR A;  4MM3 B;  5D3I B;  2N9L A;  2PLP A;  2Z8L A;  4ZHO A;  3B9J A;  1L0X B;  1TY2 A;  2PTL A;  2WDQ B;  3Q8E A;  4TSS A;  3BVM A;  3AEC B;  3EUB 2;  5BMI A;  4D2K A;  4US8 A;  1J7A A;  1ZPS A;  1AWD A;  1MI0 A;  1M4V A;  4LLG M;  2IGG A;  3IXS A;  4XWT A;  4WWM A;  4LK0 M;  2BT6 A;  1NYR A;  1JAL A;  4L2Y A;  4KGS A;  4RGT A;  3VQI A;  3ZYY X;  3WCQ A;  2JSV X;  2N0S B;  1JW9 D;  2VZK D;  1N62 A;  2W55 A;  1XLQ A;  3N9Y C;  1ZP0 B;  2ONQ A;  1KLU D;  2LJI A;  1UNS A;  2LMC A;  4FXC A;  3U52 E;  1TKY A;  4ZYS A;  4H2A A;  2KAJ A;  3FC4 A;  1EWY C;  1C76 A;  2RMM A;  4ZOH C;  2WXQ A;  3FIL B;  3O13 A;  4NAW B;  2M0A A;  1D5Z C;  1L6U A;  1QT9 A;  2W54 A;  1SJH D;  2JYT A;  1JCK B;  2W3R A;  2M56 B;  2PMV A;  1HXY D;  1XLN A;  2NMQ A;  2BBC A;  3BVZ A;  3FIL A;  2OED A;  1CK1 A;  4YTM B;  1R7S A;  1TS3 A;  4N6E B;  3VR9 B;  3DWM A;  4HRO A;  1YMH E;  1CJE A;  2CJO A;  2LGI A;  1L4D B;  2SAK A;  3MC0 B;  1UUP A;  2V0G A;  4J3O D;  3T3N A;  2FUG 1;  2QMT A;  1VZ8 A;  2X38 A;  3E9S A;  2N7J A;  3IAS 1;  1HZ5 A;  4XWW A;  3AN1 A;  1K52 A;  2JU6 X;  2AQ1 B;  2MJE A;  2TSS A;  3KWL A;  4EE2 A;  4RFB A;  3AB5 A;  4HRS A;  2RDH A;  5BMG A;  2MJD A;  1FXI A;  2QIL A;  1F77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...