2IGHA

Determination of the solution structures of domains ii and iii of protein g from streptococcus by 1h nmr
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
LTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the solution structures of domains II and III of protein G from Streptococcus by 1H nuclear magnetic resonance.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
molecule tags Immunoglobulin-binding protein
molecule keywords PROTEIN G
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1992-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ighA00
2KDMA 1FD6A 2NMQA 1YMHE 3FILB 2I2YA 1UWXA 2RMMA 1KH0A 2N9LA 1YNTE 1FCLA 1PGBA 5BMHA 3GB1A 2J52A 4HJGE 2PLPA 2JWUA 2K0PA 5JXVA 2LUMA 2ZW1A 1HZ6A 1EM7A 2JXTA 5BMGA 2J53A 2N9KA 4WH4A 4OZAA 4HKZE 2PTLA 1HZ5A 2IGDA 1MHHE 1GB4A 2JU6X 1HEZE 1D4BA 2LGIA 1XCTL 2LHDA 1QKZA 4KGSA 2ON8A 4KGRA 5HFYA 2OEDA 1MVKA 2IGHA 1MI0A 1F2RC 1IGCA 4OZCA 1JMLA 2EELA 1IGDA 2GI9A 5HI1A 2QMTA 3V3XA 1XF5L 2KACA 1K52A 1MPEA 2KN4A 1ZXHA 2ZW0A 2KWDA 2N7JA 1K51A 1PGAA 5HG2A 2LHEA 1K50A 1MHXA 3UI3A 1Q10A 2JSVX 2PW9A 3FILA 1P7FA 4D2KA 1C9FA 1IBXA 4OZBA 2RPVA 2JZPA 5HHDG 2I38A 2IGGA 1XCQL 1F2RI 1FCCC 4IKGA 1K53A 4MACA 4KGTA 4GLSC 1IBXB 4IOIE 5BMIA 1P7EA 1GB1A 2GB1A 2KQ4X 2QSDA 3MP9A 2ONQA 1PGXA
chains in the Genus database with same CATH superfamily
1YN3A 2X38A 2KNBA 2MA9B 1YMHE 4ZRQA 1UWXA 1EU4A 2EMTA 2RMMA 2WXOA 2LVPA 1YQBA 4MELA 1ZUD2 1E5WA 4RMAA 4E3CA 3NZSA 2LUMA 3QARA 1ZXIA 2D2QA 1ZW7A 2WXHA 3PO0A 3NS8A 3AU5A 3ZIMA 4OHJA 2PE6B 4MJSB 2M4NA 2E3TA 1Y56A 1BMLC 4DXFA 2CHZA 2J7QB 3RNGC 3KYDD 1V6EA 1F9JA 3BINA 2L0FA 5DPTA 4K7WA 1R4MB 3IAM1 3W5UB 4HPMB 5HFYA 1P1AA 4TV3A 5LNK1 1IGCA 4ICUA 2BB5A 2ICIA 3N32A 2AEHA 5E6PA 2JX5A 3LYYA 2M17A 3Q14C 4HROA 4XWWA 2D3BA 1QOGA 3U8ZA 1XLQA 4HCNB 5DPRA 4US8A 3K9OB 1UD7A 3TEZA 1GG3A 1UZXB 3KWVA 2W82A 1WH3A 1P7FA 4D2KA 3NVZA 3U7ZA 3NZUA 2WXLA 2WXRA 4IWOA 1VZ8A 1TGZB 1YQ4B 2PIAA 2KKCA 4BVUC 1C3TA 4WWMA 2FIDA 1CZPA 1UBQA 4RF0A 3R7QA 2XK5A 4IOIE 2NPTB 4S0RA 4BOSC 5IA7A 2N1WA 3MJ5A 2L52A 5AZGA 2QJLA 1R4NI 2KMCA 4FLHA 3GE8C 4RGTA 2FCQA 3R2TA 1L0XB 2K6QA 2PVGC 3ZNHB 1DOXA 4XYCA 4LNNA 1FPYA 3AM9A 3IT6B 1WGKA 4C80A 3Q8AA 2RDGA 3UINB 2DENB 4BKGA 1D6EC 2JXTA 4L23A 2J53A 1R4NB 4HVBA 4LJOB 1OQRA 2CU3A 1WSPA 1OTRB 2XBBC 2AWTA 1K8RB 3H7SA 4RF1A 2KX0A 4A90A 1JROA 2OJWA 1U4AA 3JSVA 3ZJVA 2DZMA 4GMVA 2OEDA 2JPHA 1OEYJ 4YWGG 5EE1A 1XT9B 3B08A 3BIID 3BVMA 4JPSA 1IGDA 4NAWB 4C7YA 2WXIA 4LCDE 2HJ8A 3WAMA 3ZYYX 3DBHI 4KDIC 2ZJDA 1V8CA 1MPEA 1TYGB 1EF5A 2Q5WD 1UNSA 3FILA 1I42A 1KTKA 5LXHA 2K5PA 2JT4B 3MJWA 1GUAB 3BZDB 3C0RB 1PDXA 2BVCA 1PFDA 1JALA 2MCNB 3M62B 4XE0A 2KDEB 3A4SC 3EFCA 1V1PA 4NQLB 1JWAD 1X1MA 2ONQA 4M01A 2M1MA 2AL3A 3AE2B 3PZDA 2KVRA 1XLOA 2XN9C 1KH0A 3PHXB 2O2VB 3PRPB 1E90A 2AQ2B 2OJRA 2V3NA 3JW0X 2KQ7A 1KOTA 2W55A 3EFUA 1ET6A 2MP2A 1ENFA 1ZOYB 4WIPA 4F8CB 3AECB 4WH4A 3H6NA 1D5MC 2RGFA 4W9EA 2Z8LA 2BS2B 4BBNF 1IUEA 1QILA 4F7ZA 1L5PA 3ONSA 2B3AA 3P63A 2OHFA 2JU6X 2RSUA 4TQ0A 2LZ6A 1D3ZA 2NBWB 3WAPA 1WE6A 5AUIA 3PZ7A 4KIKB 1MVKA 2LGSA 3MFGA 3E56A 1WJ4A 3CMMB 1E9MA 1JW9D 2XK5B 4FULA 1T0QC 1L0YB 1T3QA 4BFRA 1WRDB 3Q69A 1TT5B 4JWSC 3V3XA 4LDTD 3V05A 4ICVA 4XDCA 1SIJA 2N7EA 2GBJA 1I7HA 3SEBA 5E6JA 1QQRA 1FM0D 2HDEA 3BK1A 3BYTB 4WJNA 4C4VB 3HM6X 3U2SC 4I6PA 2IO1B 1JWMD 2JSVX 2PW9A 2V3PA 2G45B 4N9F4 1C9FA 2R61A 1HA5A 3S2AA 4GDKA 3RN9C 1WMHB 3DCGA 4G3XB 5CX3A 1HTQA 1PUTA 3KW5B 1F2RI 1RFKA 1UBIA 4JWUC 3AE8B 3KWLA 1P7EA 1J7AA 4G11A 3ZXVA 2IY1B 4DHZB 1F1HA 1PGXA 3C19A 2JUOA 2C7NB 3BVGA 2HTHA 1E6EB 2INDC 2LGDA 1E8ZA 1QOFA 4XX5A 1NBFC 3MTNB 1WGDA 4AJWA 4ACFA 2A4ZA 3ENEA 3DHIC 5FK9C 3DDCB 4KIKA 2KMMA 2FAZA 1DGJA 3JSVB 1BUIC 1EF1A 3TEXA 3RNCC 5FR3A 3NG0A 4REZA 1E7VA 1S3SG 2LVQA 3DVGY 1WZ3A 3NS1A 3KUZA 1HTOA 3MHZA 3DBRB 3H1UA 2FIFA 2WP9B 3I9V1 3O13A 4C4VA 3UF8A 4G50A 1L0VB 1BXTA 2J0KA 4NPNA 2BKFA 1XF5L 1F52A 1NYRA 3PLVA 2LJIA 2IZVB 4TQ1A 1KF6B 3PSEB 3R7RA 1MJDA 4IC7B 1N63A 4PS3A 1Q0WB 2LASA 4RCOA 3ML8A 2DAJA 2M56B 3HRDD 1SBBB 3PS6A 2IO3B 1QOAA 3PRZA 2BS3B 4MSMB 2ASQA 2H89B 2WDVB 4DWFA 3B0AA 4K7UA 4NJ6A 4JGHB 3N3KB 2E6XA 2ZZPB 2WHIA 3OJ3A 4KGTA 2JRIB 2O6VD 1IBXB 4GGQA 4M0WA 4AQ7A 1SJED 1YX6B 1J7BA 5G5GA 3HM3A 4RM9A 1FD6A 3NVVA 3W1SC 2MSED 1AW7A 4ZHOA 2Y5CA 1YIWA 4ANWA 3IBEA 3GS2A 1WM3A 3TL5A 2KC1A 2V1YA 4F1SA 1T6BX 5G55A 1KRHA 2K1FA 4OVUA 2KOXA 2AYOB 3L16A 4OZAA 3ZRFA 4E71A 1RFAA 3SD5A 2HJ1A 4JE3B 1A5RA 4BKSD 5J18A 1ET9A 1E8XA 4A8XC 4AOFA 4TMAB 1JCKB 3A9KA 4XC2A 2HE7A 1L4ZB 5GXGB 1MI0A 4DHZE 3AEFB 2WX1A 3A9JB 3IAS1 1I4RA 4GIVA 4ZRKA 1V2YA 1TIFA 3IVFA 1VRAB 3X23A 4C00A 3QIJA 3T9LA 1TS4A 4M02A 1I4HA 2KQSA 4GOCA 4IM3A 1WIAA 2INCC 4MH0E 3OG5A 4LNKA 1OFFA 3WA0A 2DHZA 1OQYA 5BYRA 3EGRA 1B9RA 1N5WA 3VTVA 1NDDA 2O2VA 4G0NB 2QIEB 3PPAA 3VRAB 4CYEA 4DXAB 1V5OA 4L1BA 2LWPA 4IKGA 2INNE 4JL9A 4EZLA 4OW0A 5I4DA 3IHPC 2WDTB 3GZNI 4NQKE 3U52E 1CK1A 2BYVE 3PLUA 4HEA1 3P4QB 4HDQA 4WWPA 1SE3A 3APDA 3VUXA 1MG4A 4DQOC 3B1LX 1ISNA 4LNOA 3NOBA 3Q2AC 2NTSA 5H92C 1L6UA 4AS1A 1FIQA 2WDRB 4S17A 3U30A 2L00B 2C60A 3JVZX 3N20C 3JYUA 3MC0B 2D5GA 1Q5WB 3ZO5B 1XCTL 4KGSA 2ON8A 1ZE3D 4W9IA 2IGHA 2DZIA 1XQQA 4JIOU 4AUQC 4OZCA 3A1QA 1QLBB 3LJ3A 2EELA 2KN5A 1ZKHA 4P1BC 2KDBA 1UUPA 2C7HA 3AE4B 3UGBB 2L3ZA 2RPQA 1R4MI 4CO7A 5MPOA 2FUG1 4BAXA 2KANA 2ZW0A 1WR1A 3VR9B 5J2RA 1IYFA 5E6NA 5HG2A 3AI5A 1I4XA 1OQQA 3NVWA 2Z0DB 5CTRC 3HIZA 3UI3A 1C78A 3PREA 4ARCA 5FKAC 4EFOA 2JY6A 3ZNZB 2DZJA 3MHSD 5IN7A 4GDLA 2MJDA 2IGGA 3MC9A 2BYEA 4DDGD 3I5JC 4ZYNA 4A9AA 5T8IA 1ROEA 2Y5BB 4LDTB 2C9WB 1FFUA 3R8BA 3QAQA 3UIPB 2BW2A 2PJHA 2IYDB 1STEA 1N62A 4EUTA 1G6JA 3GOEA 4MSQB 2BTEA 2NMQA 4B95A 3VDZA 4K1RB 2DAFA 4LLGM 3DVNV 2BKRB 2DYBA 4Q2JA 1Y8RC 4M0WB 1WX7A 3CSTA 1EWYC 3WANA 4II3B 3EHVA 3RD2A 2INPE 3KQ4A 1HXYD 3VRBB 2N9KA 3L4PA 1V80A 4MM3B 4RFBA 3GE3C 1WRIA 1IPGA 2L1AA 3NVYA 2LRUA 4HKZE 2IDYA 5GMVA 3AE1B 4AJYB 2NS5A 2KFJA 3L17A 3RPFC 1D4BA 1WWTA 3KUCB 4XZ4A 1KLVA 3ZXRA 2QILA 1VJKA 3HHMA 4DDID 2LXCA 3QC8B 3AEGB 2GBMA 2ZPNA 1F2RC 2WXMA 3AE6B 1VLBA 3LB8C 1SIFA 1UF0A 1PQSA 3QK0A 1SB3C 3DOWA 3Q3NC 4W9FA 5G5HA 1FNWA 1NI2A 1JWBD 3VTUA 2BF8B 4XWTA 4YTMB 5KHQA 2LHEA 5J17A 3V60A 1L4DB 1SE9A 3EC8A 5BYQA 4P7IA 3WCQA 5C1ZA 4JQWC 2IO0B 3ZJUA 2MBBB 3KUDB 3Q6BA 2LXAA 4MGYE 1P98A 4MACA 2YEPF 4GLSC 2LGXA 3Q8FA 2WDQB 5BMIA 4US9A 5IO9A 4FJVB 1WFYA 2GB1A 2N9PC 3NUHB 4KZCA 5AZFA 1QT9A 3ZDMC 4YL8A 4NAMA 1WMHA 1MG8A 1ZP0B 2DNFA 3B9JA 3WAOA 3PRMB 1PGBA 4O1NA 2WU5B 3QJZA 3SHQA 2LMCA 4YXDB 3RYTA 4H2AA 1RM6C 2JWZA 1EUVB 2K0PA 4WQMA 5JXVA 3ZLZA 2JQRB 1AN8A 2WXFA 3N30A 5TSSA 3IG3A 2WLBA 3M95A 2MH7A 2FBWB 2WQYB 1GJZA 4FHJA 3TCAA 3GZNB 3Q8CA 3VR8B 2OOBB 2UYZB 5L95C 1KLUD 3DHHC 5EE0A 4ZHPA 4BOZB 1FXTB 2KK8A 3AE3B 2LHDA 1CJEA 3AE5B 1TKEA 1N60A 1FNUA 1QF6A 2R2OA 3O65B 2C5LC 1HQRD 1TKGA 3Q3FA 1JQ4A 2CR5A 4A3OA 4I6LB 2WS3B 3NJTA 3DBHB 4M8NA 3QA8A 4YTNB 1XXGA 3H7PB 4HLEA 2RR9A 4UDUC 3RUIB 2YLMA 4RGMA 3P2BA 3ZTCA 1DOYA 1T5XD 2ZPYA 1YD8U 1M4VA 3V6EB 2CHXA 1TKYA 2KTRB 2WXQA 1TZOA 2JYTA 2K39A 1XO3A 5G2NA 4N6EB 3VHTC 2K8BA 2FCMA 3WALA 3RI7C 1GAQB 1T0RC 3VTWA 3OWEB 4HRSA 3APFA 2REXA 4W9KA 2L83A 3H8HA 4K3CA 4P1CC 4YSZB 3J9CA 4HJGE 4W9DA 3V6CB 4PT5A 4HKQA 4FN2A 4FBJB 1HZ6A 4GB9A 5KHOA 4LJPB 1KJTA 4W9CA 1ZGUB 4OVZA 3ECIA 3U7DA 5LLIA 2D3CA 1FRDA 1UELA 3KLSX 3AEDB 2AL6A 1QKZA 4MH8A 1WZ0A 3IFWB 4KKJA 2VH2A 3H9DA 4HPPA 4B0MA 4IM0A 2KAJA 3OJ4B 2MBQA 3R3MA 3DWMA 1V97A 2PEAA 1V5TA 2JXXA 5C2TB 5IP4D 2L05A 2N7JA 2NVUI 1SE2A 2N4FA 3DBRI 3TMPB 5EDSA 3BVZA 3AE7B 1K50A 3AEAB 5LXIB 2LI5A 3P4PB 4ANUA 2IPKD 1B1ZA 3L0WB 3N1XC 1FO4A 4EOYA 1FCCC 1GB1A 3ZJTA 2KVZA 3L10B 2LVOA 1AARA 4N59A 4KX6B 4FHKA 1WXSA 1WX8A 4HDOA 1TTNA 4FJZA 4TSSA 1C4PA 1WGHA 4FADA 2CKHB 4ANVA 3Q8EA 1RRBA 2VH1A 5JHAA 3NZ3A 3Q3MC 5BMGA 4PYZA 4IWPA 3TUOA 3EA6A 5C23A 3M63B 1OEYA 3RNAC 1GC6A 1D5XC 5IKCM 4MEMA 4W9GA 4DXGA 2PVOD 4W9HA 2MWSB 2NBUA 4WAAA 3B2GA 1JMLA 1C77A 4HK2A 1JWSD 4MJSA 1P0RA 5IAAC 3ZRCA 2M0AA 2GBKA 4B6WA 1FXIA 2G4SA 2Z59B 2FE8A 4GU2A 1JWUD 3AU4A 2KWDA 1TS2A 4IM2A 2N0SB 1RWSA 3QX1A 2AX5A 2G1EA 1GPXA 5HHDG 3ML9A 4K7SA 1DOIA 5DPSA 3DBLI 1BT0A 1K53A 2KX3A 4JLCA 2KO3A 3BWUD 2BT6A 3ZW3A 2KHWB 1SGHA 3X0WA 3SU8X 4KVGB 1I4GA 1Z2MA 3IT4B 1N61A 4A20A 1E8YA 3BY4B 4RNAA 2BWFA 1YJIA 2KXJA 5EE3A 1FCLA 5BMHA 4WJQA 2CU1A 3A9JA 2N9XA 4AP4C 4WQOB 4ZOHC 3VH4B 1WE7A 1JRUA 3DBSA 2LFIA 4MGKE 1V9JA 2ZVOA 3VFKA 2BBCA 1HZ5A 1KLGD 5D7GA 1MHHE 4ZRPA 3RNEC 4GXBA 3HUIA 1YOVB 4FA6A 2J4XA 3GP7A 1GC7A 1E7PB 3RNBC 4IUMB 2IBIB 2LD9A 2YVCA 1VZ6A 3ZGZA 4ARIA 1C4AA 1I4PA 4MDKE 4L2YA 2X8XX 1TBEA 1T0SC 2BWES 2PE9A 4WJOA 3SDLC 1WM2A 1ZXHA 2CJNA 4KSLC 4EZKA 2BYFA 2KC2A 2D11A 4CQNA 1YJ1A 2O6VA 2MJ3A 3ZKJC 4GSWA 2KFKA 1IBXA 2K22A 2J0JA 2WX0A 2QDFA 1I4QA 2D3GA 3DPDA 3VH3B 1UGJA 3ZNGC 3PTFC 2NBVB 5AEKB 2MRPA 3RZWC 2H88B 2KYWA 1C79A 1E10A 5DPWA 1WYGA 2KMAA 2YEPB 2MLBA 3CWIA 2KDMA 4ZYSA 3DHGC 4BBNC 3L08A 5C3JB 2DBYA 5D6JB 4DHJB 3KVFB 3R66C 4OVVA 1L2NA 2UWQA 2FUHB 3PGEA 4TUUA 1F0ZA 5TR5A 2ZEQA 1D5ZC 2LJ5A 1V86A 3QWZB 2PLPA 1FFVA 4URKA 3QCAA 3UQBA 2W54A 1TZ1A 1LO5D 2Y3AA 2ZW1A 3D32A 2N7DA 1E7UA 2WWZA 3HVDA 1WJNA 1LXDA 2MBHA 1RYJA 3TSSA 1XLNA 2ZNVC 3RNFC 3ZUNA 1VDVA 3W5VB 3T3OA 2PTLA 3PV1A 4NJCA 1GOZA 4IG7B 2V4LA 1GB4A 3TEWA 1ESFA 4TKNA 2IY0B 2K9XA 2I1JA 3AULA 2CHWA 2O6VB 4ANXA 1XEEA 2HD5B 2MJEA 1A70A 1HE8A 2GLSA 2KFKB 1LM8B 3EUB2 4LNIA 2QHOA 4BKTA 1FMAD 1XLPA 2KLCA 3FKYA 4LNFA 4IDIA 4ZRJA 1UH6A 1GNUA 2V0GA 1MFWA 2KZRA 3Q3OC 3VUWA 2D07B 4M00A 1E8WA 4PYUA 2RD0A 3RT3B 1IP9A 2DLBA 2KT7A 3ZDTA 2JYEA 1MHXA 2AQ3B 2ACZB 4ZDVA 2RPVA 1FNVA 3BK2A 1SF0A 2JZPA 2WXGA 3L54A 2MX2A 2WNMA 2L8JA 1WGYA 1TJEA 2KWUB 1XD3B 3RFZB 2KQ4X 3MP9A 4QAYA 2GRIA 3RULA 2KWCA 1N6ZA 2K3UA 1P9DU 1YNTE 3ZQ4A 4B0EA 1WXMA 4GDKB 3I63C 5H8YE 3CSFA 1YQ3B 3SR6A 1AYFA 3V62A 3ABVB 4MGIE 1ZDXA 2A5UA 3AB5A 1V81A 2NTTA 2BQQA 4EZJA 5FR6A 2KJHB 4KSKC 3NHEB 5L83A 5CHVC 1UWMA 2KJRA 3RZFA 2IGDA 3N1YC 3DWGC 1HEZE 5IOIA 1TS3A 3WIMA 1C1YB 2LGIA 1H8CA 1F77A 1UGMA 3APCA 1LGRA 4KGRA 2VZKB 5D94A 3N9YC 3A33B 2PMVA 2Z0EB 2NPTA 2D10A 3P1MA 4E74A 3QHTA 5HI1A 3AN1A 2DYOA 3PHWB 3OAWA 5JH5C 4NNJB 2Y5PA 3NRZA 1K51A 1PGAA 4M8MA 4PS8A 2K8HA 3AEEB 2BS4B 2I1KA 3AE9B 4HCPB 4YT0B 2KD0A 2PKOA 2I38A 2KTFA 2R2QA 4IWQA 1XCQL 4FJYA 4A6QA 4HPLB 5JZEB 1J0GA 1P3QU 2CJOA 3CIRB 1H4RA 5AUKA 2QSDA 4RM8A 3M3JA 4MT5A 2J42A 1NEKB 2I2YA 1OGWA 2QC8A 5BO4B 2RDBC 1FXAA 2TSSA 3LDZE 2ZVNA 4EEWA 1WXAA 2NCNA 4X57B 4K3BA 2AQ1B 4DK5A 3FC4A 1YX5B 2V9HA 1SJHD 2W3RA 4J6IA 1WJ6A 5EE9A 1SXTA 2XEWA 1L6VA 3U4EG 4A3PA 3LXFA 3L13A 2ZCBA 3AV8A 1Q1OA 2IO2B 4EE2A 2BGFA 3UIOB 2L76A 2M8SA 2QEJC 2MW5A 4FXCA 2KLGA 2EMSA 3VQIA 4R3DA 3A9KB 1FRRA 2JZZA 3Q8BA 2KACA 4GDLB 1K52A 1SSNA 3W1YA 2WU2B 5BYSA 1J7CA 5CHFA 4AWJA 3AEBB 3A1QB 4I6NB 1ZPSA 1Q10A 2K6DB 4BKSA 3FAHA 3P4RB 4KDLB 2LEKA 1R7SA 1TY0A 4OZBA 2K25A 5D2MB 1QZEA 2K8CA 3ETRA 4PK1A 5CHWA 3VAWA 1C76A 2WYQA 1VZ7A 1YN4A 3UQAA 3T3NA 2G9HD 2KDIA 3EECA 5HKHA 4W9JA 1AWDA 2RDHA 2VZKD 4XGAB 1C4CA 4RGNA 2GOWA 2FNJB 3I57A 2MHJA 4BZAA 2D3AA 4RGOS 1ZDVA 4W9LA 5AZHA 1CMXB 2N9LA 2XNAC 3AMZA 3NY5A 4HXDA 1RAXA 4YTPB 2JF5A 3W9CB 2J52A 4A55A 1KM7A 4LK0M 2IJ0A 1NVID 1WJUA 1I35A 1WR6E 3MC8A 4DBGA 5D3DA 1V1OA 4K81A 4NAWA 3SFEB 2UU7A 4J3OD 3W1SA 2PPHA 1RLFA 1ACCA 4YSYB 3AXCA 2ZCCA 3KYCD 2BYTA 2L0TA 4C56C 2N1VA 1NI3A 1YJJA 4ITKA 4N58A 4II2B 1NENB 2L32A 4P16A 3A4RA 3E9SA 1S1QB 2WXJA 1WY8A 3URYA 3TEYA 2BPSA 4KKIA 1WGRA 4KZ0A 3PZ8A 3T8MA 2GI9A 2KTRA 2DWQA 2V3SA 3SFDB 4NY0A 1Z5SB 2GBNA 2HTME 2LUEA 4WWNA 3BYYB 4C7ZA 2QCZA 2KN4A 3VUYA 3VXWA 4EKUA 1FEHA 2WXNA 3TBLD 3RCZA 1YN5A 2WGSA 3B2FA 3Q3JA 2JVCA 3RMKC 1CQVA 1EO6A 2DZKA 2FCNA 3ALBA 4WWOA 4MGZE 1L7YA 4HWIB 2DX5B 3W2DA 4USAA 3DVGX 2CS4A 4WJPA 1DYQA 4B9KA 3AH7A 4PS7A 1E0ZA 2M0XA 1PYWD 3TJPA 4IW0A 3PT2B 4NZLB 3FILB 3P42A 4JX1C 2V4IB 1WXVA 4RH6A 3GB1A 2NR2A 2LGYA 3KH0A 2W9NA 4MM3A 3K9PB 5JHBA 1JRPA 3ZNID 4WAFA 2JWUA 1EU3A 3DBLB 5E6OA 1EM7A 1V1PB 2VRRB 2G3QB 4HJKA 4NJ7A 3HK0A 4ASWC 1J8CA 4ZRIA 2J0MA 1N5XA 2LRWA 2MBEA 2DYMA 3QQ8B 1M94A 2L7RA 3PVLA 4DHJD 1TY2A 4P6VF 3HVZA 1WI0A 3V61A 2G4DB 4XDDA 3R2IA 3C8YA 2ZNVB 2MQJA 4GN1A 2SEBD 5D3IB 4CHKA 1LFDA 2MBOA 3ZVVA 2BB6A 1WYWB 1QOBA 2WXKA 2N9EB 2SAKA 1V49A 1VD2A 2KWVB 1WGGA 4YSXB 4WURA 3ZTDA 2QMTA 1KFYB 5DCNA 1EWCA 3VVWB 2EKEC 1SEBD 3P4SB 3DQVA 1J19A 3CF6E 2M19A 2GMIC 3IXSA 2JRHA 1T0YA 1LQBA 2C7MB 1WX9A 1TS5A 1SE4A 2KJ6A 3TIXA 2B76B 2KDFB 3I3TB 1WXQA 3OLMD 1VR9A 1NYQA 2WXPA 3H7PA 3DVNU 2JZ3B 2MEKA 2W3SA 1VCBA 2FCSA 1WF9A 2EKIA 4KV2A 2MP2B 2GBRA 3N1ZC 4LTUA
chains in the Genus database with same CATH topology
1YN3A 2GRIA 2X38A 5G5GA 1GAQB 1FD6A 3NVVA 1YMHE 3OWEB 4HRSA 4ZRQA 1UWXA 1AW7A 1EU4A 2K3UA 2L83A 2RMMA 4ZHOA 2WXOA 1YNTE 3ZQ4A 4B0EA 3H8HA 4GDKB 2Y5CA 4YSZB 1ZUD2 5H8YE 1YQ3B 3GS2A 3J9CA 4HJGE 3SR6A 1AYFA 3ABVB 4PT5A 4HKQA 1ZDXA 1T6BX 2LUMA 1KRHA 3AB5A 1HZ6A 1ZXIA 2WXHA 2NTTA 3PO0A 4OZAA 4OHJA 1UWMA 2E3TA 1Y56A 1BMLC 4OVZA 4DXFA 2IGDA 4JE3B 3DWGC 1HEZE 1TS3A 1ET9A 1FRDA 2LGIA 3KLSX 3AEDB 4A8XC 1F77A 3IAM1 3W5UB 1QKZA 4TMAB 1JCKB 4MH8A 5HFYA 4KGRA 2VZKB 4KKJA 1L4ZB 3N9YC 5GXGB 1MI0A 2PMVA 3AEFB 5LNK1 1IGCA 3IAS1 1I4RA 4B0MA 2BB5A 2KAJA 2ICIA 3P1MA 1VRAB 5HI1A 3AN1A 3DWMA 1V97A 2JX5A 3LYYA 4HROA 2DYOA 4XWWA 1TS4A 5C2TB 1QOGA 2N7JA 1XLQA 1I4HA 1K51A 2Y5PA 1PGAA 3NRZA 4US8A 1SE2A 3BVZA 3TEZA 3AE7B 1K50A 1OFFA 3AEAB 3KWVA 2W82A 5BYRA 1P7FA 2BS4B 3AEEB 3EGRA 3NVZA 3U7ZA 4D2KA 2WXLA 1B9RA 1N5WA 3P4PB 3AE9B 2WXRA 4YT0B 2QIEB 2PKOA 1VZ8A 1YQ4B 2IPKD 2PIAA 2I38A 1B1ZA 3VRAB 1FO4A 1XCQL 4L1BA 4WWMA 4A6QA 4IKGA 2INNE 1FCCC 1CZPA 4OW0A 4RF0A 5I4DA 2CJOA 4IOIE 3CIRB 3MJ5A 5AUKA 1GB1A 2QSDA 3ZJTA 2L52A 3U52E 1CK1A 2QJLA 4MT5A 4N59A 4KX6B 2J42A 1NEKB 4HEA1 3P4QB 4RGTA 2I2YA 1FXAA 2TSSA 1SE3A 4TSSA 1C4PA 3R2TA 1L0XB 2PVGC 1DOXA 3Q8EA 3AM9A 3IT6B 1WGKA 4DQOC 4C80A 2AQ1B 3Q8AA 2RDGA 3FC4A 1D6EC 2JXTA 3NZ3A 5BMGA 1SJHD 2J53A 4L23A 3TUOA 3EA6A 2W3RA 2NTSA 5H92C 1OQRA 2CU3A 5EE9A 1L6UA 4AS1A 1FIQA 1SXTA 1WSPA 2WDRB 1L6VA 3U4EG 1D5XC 4RF1A 3LXFA 3MC0B 2D5GA 3AV8A 4A90A 1JROA 4DXGA 4EE2A 1XCTL 3ZJVA 2PVOD 4KGSA 2QEJC 2ON8A 2OEDA 1ZE3D 2IGHA 4FXCA 5EE1A 4YWGG 3B2GA 4OZCA 1JMLA 1C77A 1QLBB 3BIID 3BVMA 2EELA 4JPSA 3VQIA 1IGDA 4R3DA 4NAWB 4C7YA 1FRRA 1UUPA 2WXIA 1JWSD 3AE4B 3Q8BA 2M0AA 2KACA 1FXIA 3ZYYX 4GDLB 1K52A 1SSNA 2WU2B 5MPOA 1V8CA 2FE8A 1MPEA 2FUG1 5BYSA 1JWUD 2ZW0A 2KWDA 3VR9B 1J7CA 1TYGB 1TS2A 3AEBB 5HG2A 1I4XA 1OQQA 2Q5WD 3NVWA 1ZPSA 3UI3A 1Q10A 1C78A 1UNSA 2N0SB 3FAHA 3P4RB 3FILA 4ARCA 1RWSA 2LEKA 1R7SA 1TY0A 5FKAC 1KTKA 2AX5A 2K5PA 4OZBA 2G1EA 1GPXA 3BZDB 5HHDG 2MJDA 1PDXA 1DOIA 2IGGA 3ETRA 1PFDA 1JALA 1C76A 1VZ7A 4XE0A 1K53A 1YN4A 3T3NA 2G9HD 4A9AA 5T8IA 1ROEA 1V1PA 1AWDA 2RDHA 2VZKD 3BWUD 2BT6A 1FFUA 3R8BA 1JWAD 1C4CA 4RGNA 1I4GA 2ONQA 2BW2A 3I57A 3IT4B 1STEA 1N62A 3AE2B 4RGOS 1ZDVA 2BTEA 2NMQA 1N61A 1XLOA 4RNAA 2XN9C 1KH0A 2N9LA 1YJIA 2XNAC 4LLGM 5EE3A 1FCLA 5BMHA 3AMZA 4YTPB 2AQ2B 3W9CB 2V3NA 4Q2JA 2J52A 2W55A 4ZOHC 4A55A 4LK0M 1ET6A 1EWYC 2IJ0A 1NVID 1ENFA 1ZOYB 2INPE 3KQ4A 4WIPA 1HXYD 3VRBB 5D3DA 2LFIA 2N9KA 1V1OA 3AECB 3L4PA 4WH4A 4MM3B 1D5MC 3SFEB 4RFBA 1WRIA 2L1AA 3NVYA 2Z8LA 4HKZE 2BS2B 4J3OD 3W1SA 2IDYA 1ACCA 1IUEA 1QILA 2BBCA 4YSYB 1HZ5A 3AE1B 1L5PA 1KLGD 5D7GA 2BYTA 1MHHE 4ZRPA 3P63A 2OHFA 2JU6X 3RPFC 4C56C 1D4BA 1WWTA 1NI3A 1YJJA 4TQ0A 3HUIA 2QILA 4ITKA 4N58A 1VJKA 2J4XA 1NENB 3GP7A 2L32A 3AEGB 1E7PB 4P16A 3E9SA 3PZ7A 5AUIA 1MVKA 3MFGA 1F2RC 2WXJA 2WXMA 3E56A 3URYA 3TEYA 3AE6B 1E9MA 1JW9D 4KKIA 3PZ8A 1VLBA 3LB8C 1VZ6A 1L0YB 1T3QA 3Q69A 2GI9A 3ZGZA 4ARIA 4JWSC 1C4AA 1I4PA 3V3XA 3V05A 1SB3C 2DWQA 4XDCA 3SFDB 1SIJA 5G5HA 1FNWA 4L2YA 2HTME 1I7HA 1JWBD 3BYYB 4C7ZA 2KN4A 1ZXHA 3SEBA 2CJNA 4XWTA 5E6JA 1QQRA 4YTMB 1FM0D 2HDEA 3BK1A 4CQNA 3BYTB 2LHEA 1FEHA 2WXNA 3U2SC 1JWMD 2MJ3A 2JSVX 2PW9A 1L4DB 2V3PA 1YN5A 1C9FA 3B2FA 5BYQA 2R61A 1HA5A 1IBXA 3WCQA 1CQVA 2K22A 3ZJUA 1I4QA 1UGJA 1PUTA 3W2DA 4USAA 1F2RI 1RFKA 4MACA 2H88B 2YEPF 4GLSC 4JWUC 3Q8FA 3AE8B 3KWLA 2WDQB 1C79A 1DYQA 4US9A 5BMIA 1E10A 1P7EA 1WYGA 3AH7A 1J7AA 2GB1A 3NUHB 2YEPB 1E0ZA 1QT9A 3CWIA 1PYWD 2KDMA 4ZYSA 3BVGA 4NAMA 1ZP0B 1E6EB 5C3JB 2DBYA 4NZLB 3FILB 1QOFA 3P42A 3B9JA 4JX1C 1PGBA 2V4IB 4O1NA 2WU5B 1F0ZA 4RH6A 3GB1A 1D5ZC 2PLPA 1FFVA 2LMCA 4YXDB 1JRPA 2W54A 5FK9C 4H2AA 2JWUA 1RM6C 1EU3A 4WAFA 2K0PA 4WQMA 5JXVA 1LO5D 2Y3AA 2ZW1A 2KMMA 1AN8A 1EM7A 1V1PB 2JQRB 2WXFA 5TSSA 1DGJA 1BUIC 3HVDA 2WLBA 2MH7A 3TEXA 2FBWB 1RYJA 5FR3A 3TSSA 1XLNA 1VDVA 2WQYB 3W5VB 1N5XA 4REZA 2DYMA 3T3OA 2PTLA 4NJCA 3Q8CA 3VR8B 1GOZA 3NS1A 1TY2A 4P6VF 1GB4A 3HVZA 3MHZA 3TEWA 4XDDA 1ESFA 3R2IA 1KLUD 2K9XA 3C8YA 2WP9B 3I9V1 3O13A 5EE0A 4ZHPA 2SEBD 5D3IB 1XEEA 3AE3B 2LHDA 1CJEA 1L0VB 1TKEA 2MJEA 3AE5B 1BXTA 1A70A 2BB6A 1QOBA 2WXKA 2SAKA 1N60A 1FNUA 3EUB2 1QF6A 4YSXB 1FMAD 1HQRD 1XLPA 1TKGA 4WURA 1JQ4A 4IDIA 2QMTA 1XF5L 1KFYB 2V0GA 1EWCA 1NYRA 2WS3B 2LJIA 4TQ1A 4YTNB 1KF6B 1SEBD 3P4SB 1XXGA 2DLBA 1N63A 2M19A 2JYEA 3IXSA 1MHXA 4RCOA 2AQ3B 2M56B 3HRDD 4UDUC 1SBBB 2ACZB 4RGMA 1QOAA 2BS3B 2RPVA 1FNVA 1SE4A 1TS5A 3BK2A 1DOYA 2H89B 2B76B 1SF0A 2WDVB 2JZPA 1T5XD 1WXQA 2WXGA 1M4VA 1VR9A 1NYQA 1TKYA 2E6XA 2WXQA 2WXPA 1TZOA 2JYTA 2WNMA 1XO3A 4KGTA 1IBXB 4N6EB 2MEKA 2W3SA 1TJEA 4M0WA 2EKIA 4AQ7A 3RFZB 2KQ4X 3MP9A 1SJED 4LTUA 1J7BA 1PGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDM A;  1FD6 A;  2NMQ A;  1YMH E;  3FIL B;  2I2Y A;  1UWX A;  2RMM A;  1KH0 A;  2N9L A;  1YNT E;  1FCL A;  1PGB A;  5BMH A;  3GB1 A;  2J52 A;  4HJG E;  2PLP A;  2JWU A;  2K0P A;  5JXV A;  2LUM A;  2ZW1 A;  1HZ6 A;  1EM7 A;  2JXT A;  5BMG A;  2J53 A;  2N9K A;  4WH4 A;  4OZA A;  4HKZ E;  2PTL A;  1HZ5 A;  2IGD A;  1MHH E;  1GB4 A;  2JU6 X;  1HEZ E;  1D4B A;  2LGI A;  1XCT L;  2LHD A;  1QKZ A;  4KGS A;  2ON8 A;  4KGR A;  5HFY A;  2OED A;  1MVK A;  2IGH A;  1MI0 A;  1F2R C;  1IGC A;  4OZC A;  1JML A;  2EEL A;  1IGD A;  2GI9 A;  5HI1 A;  2QMT A;  3V3X A;  1XF5 L;  2KAC A;  1K52 A;  1MPE A;  2KN4 A;  1ZXH A;  2ZW0 A;  2KWD A;  2N7J A;  1K51 A;  1PGA A;  5HG2 A;  2LHE A;  1K50 A;  1MHX A;  3UI3 A;  1Q10 A;  2JSV X;  2PW9 A;  3FIL A;  1P7F A;  4D2K A;  1C9F A;  1IBX A;  4OZB A;  2RPV A;  2JZP A;  5HHD G;  2I38 A;  2IGG A;  1XCQ L;  1F2R I;  1FCC C;  4IKG A;  1K53 A;  4MAC A;  4KGT A;  4GLS C;  1IBX B;  4IOI E;  5BMI A;  1P7E A;  1GB1 A;  2GB1 A;  2KQ4 X;  2QSD A;  3MP9 A;  2ONQ A;  1PGX A; 
#chains in the Genus database with same CATH topology
 1YN3 A;  2X38 A;  2KNB A;  2MA9 B;  1YMH E;  4ZRQ A;  1UWX A;  1EU4 A;  2EMT A;  2RMM A;  2WXO A;  2LVP A;  1YQB A;  4MEL A;  1ZUD 2;  1E5W A;  4RMA A;  4E3C A;  3NZS A;  2LUM A;  3QAR A;  1ZXI A;  2D2Q A;  1ZW7 A;  2WXH A;  3PO0 A;  3NS8 A;  3AU5 A;  3ZIM A;  4OHJ A;  2PE6 B;  4MJS B;  2M4N A;  2E3T A;  1Y56 A;  1BML C;  4DXF A;  2CHZ A;  2J7Q B;  3RNG C;  3KYD D;  1V6E A;  1F9J A;  3BIN A;  2L0F A;  5DPT A;  4K7W A;  1R4M B;  3IAM 1;  3W5U B;  4HPM B;  5HFY A;  1P1A A;  4TV3 A;  5LNK 1;  1IGC A;  4ICU A;  2BB5 A;  2ICI A;  3N32 A;  2AEH A;  5E6P A;  2JX5 A;  3LYY A;  2M17 A;  3Q14 C;  4HRO A;  4XWW A;  2D3B A;  1QOG A;  3U8Z A;  1XLQ A;  4HCN B;  5DPR A;  4US8 A;  3K9O B;  1UD7 A;  3TEZ A;  1GG3 A;  1UZX B;  3KWV A;  2W82 A;  1WH3 A;  1P7F A;  4D2K A;  3NVZ A;  3U7Z A;  3NZU A;  2WXL A;  2WXR A;  4IWO A;  1VZ8 A;  1TGZ B;  1YQ4 B;  2PIA A;  2KKC A;  4BVU C;  1C3T A;  4WWM A;  2FID A;  1CZP A;  1UBQ A;  4RF0 A;  3R7Q A;  2XK5 A;  4IOI E;  2NPT B;  4S0R A;  4BOS C;  5IA7 A;  2N1W A;  3MJ5 A;  2L52 A;  5AZG A;  2QJL A;  1R4N I;  2KMC A;  4FLH A;  3GE8 C;  4RGT A;  2FCQ A;  3R2T A;  1L0X B;  2K6Q A;  2PVG C;  3ZNH B;  1DOX A;  4XYC A;  4LNN A;  1FPY A;  3AM9 A;  3IT6 B;  1WGK A;  4C80 A;  3Q8A A;  2RDG A;  3UIN B;  2DEN B;  4BKG A;  1D6E C;  2JXT A;  4L23 A;  2J53 A;  1R4N B;  4HVB A;  4LJO B;  1OQR A;  2CU3 A;  1WSP A;  1OTR B;  2XBB C;  2AWT A;  1K8R B;  3H7S A;  4RF1 A;  2KX0 A;  4A90 A;  1JRO A;  2OJW A;  1U4A A;  3JSV A;  3ZJV A;  2DZM A;  4GMV A;  2OED A;  2JPH A;  1OEY J;  4YWG G;  5EE1 A;  1XT9 B;  3B08 A;  3BII D;  3BVM A;  4JPS A;  1IGD A;  4NAW B;  4C7Y A;  2WXI A;  4LCD E;  2HJ8 A;  3WAM A;  3ZYY X;  3DBH I;  4KDI C;  2ZJD A;  1V8C A;  1MPE A;  1TYG B;  1EF5 A;  2Q5W D;  1UNS A;  3FIL A;  1I42 A;  1KTK A;  5LXH A;  2K5P A;  2JT4 B;  3MJW A;  1GUA B;  3BZD B;  3C0R B;  1PDX A;  2BVC A;  1PFD A;  1JAL A;  2MCN B;  3M62 B;  4XE0 A;  2KDE B;  3A4S C;  3EFC A;  1V1P A;  4NQL B;  1JWA D;  1X1M A;  2ONQ A;  4M01 A;  2M1M A;  2AL3 A;  3AE2 B;  3PZD A;  2KVR A;  1XLO A;  2XN9 C;  1KH0 A;  3PHX B;  2O2V B;  3PRP B;  1E90 A;  2AQ2 B;  2OJR A;  2V3N A;  3JW0 X;  2KQ7 A;  1KOT A;  2W55 A;  3EFU A;  1ET6 A;  2MP2 A;  1ENF A;  1ZOY B;  4WIP A;  4F8C B;  3AEC B;  4WH4 A;  3H6N A;  1D5M C;  2RGF A;  4W9E A;  2Z8L A;  2BS2 B;  4BBN F;  1IUE A;  1QIL A;  4F7Z A;  1L5P A;  3ONS A;  2B3A A;  3P63 A;  2OHF A;  2JU6 X;  2RSU A;  4TQ0 A;  2LZ6 A;  1D3Z A;  2NBW B;  3WAP A;  1WE6 A;  5AUI A;  3PZ7 A;  4KIK B;  1MVK A;  2LGS A;  3MFG A;  3E56 A;  1WJ4 A;  3CMM B;  1E9M A;  1JW9 D;  2XK5 B;  4FUL A;  1T0Q C;  1L0Y B;  1T3Q A;  4BFR A;  1WRD B;  3Q69 A;  1TT5 B;  4JWS C;  3V3X A;  4LDT D;  3V05 A;  4ICV A;  4XDC A;  1SIJ A;  2N7E A;  2GBJ A;  1I7H A;  3SEB A;  5E6J A;  1QQR A;  1FM0 D;  2HDE A;  3BK1 A;  3BYT B;  4WJN A;  4C4V B;  3HM6 X;  3U2S C;  4I6P A;  2IO1 B;  1JWM D;  2JSV X;  2PW9 A;  2V3P A;  2G45 B;  4N9F 4;  1C9F A;  2R61 A;  1HA5 A;  3S2A A;  4GDK A;  3RN9 C;  1WMH B;  3DCG A;  4G3X B;  5CX3 A;  1HTQ A;  1PUT A;  3KW5 B;  1F2R I;  1RFK A;  1UBI A;  4JWU C;  3AE8 B;  3KWL A;  1P7E A;  1J7A A;  4G11 A;  3ZXV A;  2IY1 B;  4DHZ B;  1F1H A;  1PGX A;  3C19 A;  2JUO A;  2C7N B;  3BVG A;  2HTH A;  1E6E B;  2IND C;  2LGD A;  1E8Z A;  1QOF A;  4XX5 A;  1NBF C;  3MTN B;  1WGD A;  4AJW A;  4ACF A;  2A4Z A;  3ENE A;  3DHI C;  5FK9 C;  3DDC B;  4KIK A;  2KMM A;  2FAZ A;  1DGJ A;  3JSV B;  1BUI C;  1EF1 A;  3TEX A;  3RNC C;  5FR3 A;  3NG0 A;  4REZ A;  1E7V A;  1S3S G;  2LVQ A;  3DVG Y;  1WZ3 A;  3NS1 A;  3KUZ A;  1HTO A;  3MHZ A;  3DBR B;  3H1U A;  2FIF A;  2WP9 B;  3I9V 1;  3O13 A;  4C4V A;  3UF8 A;  4G50 A;  1L0V B;  1BXT A;  2J0K A;  4NPN A;  2BKF A;  1XF5 L;  1F52 A;  1NYR A;  3PLV A;  2LJI A;  2IZV B;  4TQ1 A;  1KF6 B;  3PSE B;  3R7R A;  1MJD A;  4IC7 B;  1N63 A;  4PS3 A;  1Q0W B;  2LAS A;  4RCO A;  3ML8 A;  2DAJ A;  2M56 B;  3HRD D;  1SBB B;  3PS6 A;  2IO3 B;  1QOA A;  3PRZ A;  2BS3 B;  4MSM B;  2ASQ A;  2H89 B;  2WDV B;  4DWF A;  3B0A A;  4K7U A;  4NJ6 A;  4JGH B;  3N3K B;  2E6X A;  2ZZP B;  2WHI A;  3OJ3 A;  4KGT A;  2JRI B;  2O6V D;  1IBX B;  4GGQ A;  4M0W A;  4AQ7 A;  1SJE D;  1YX6 B;  1J7B A;  5G5G A;  3HM3 A;  4RM9 A;  1FD6 A;  3NVV A;  3W1S C;  2MSE D;  1AW7 A;  4ZHO A;  2Y5C A;  1YIW A;  4ANW A;  3IBE A;  3GS2 A;  1WM3 A;  3TL5 A;  2KC1 A;  2V1Y A;  4F1S A;  1T6B X;  5G55 A;  1KRH A;  2K1F A;  4OVU A;  2KOX A;  2AYO B;  3L16 A;  4OZA A;  3ZRF A;  4E71 A;  1RFA A;  3SD5 A;  2HJ1 A;  4JE3 B;  1A5R A;  4BKS D;  5J18 A;  1ET9 A;  1E8X A;  4A8X C;  4AOF A;  4TMA B;  1JCK B;  3A9K A;  4XC2 A;  2HE7 A;  1L4Z B;  5GXG B;  1MI0 A;  4DHZ E;  3AEF B;  2WX1 A;  3A9J B;  3IAS 1;  1I4R A;  4GIV A;  4ZRK A;  1V2Y A;  1TIF A;  3IVF A;  1VRA B;  3X23 A;  4C00 A;  3QIJ A;  3T9L A;  1TS4 A;  4M02 A;  1I4H A;  2KQS A;  4GOC A;  4IM3 A;  1WIA A;  2INC C;  4MH0 E;  3OG5 A;  4LNK A;  1OFF A;  3WA0 A;  2DHZ A;  1OQY A;  5BYR A;  3EGR A;  1B9R A;  1N5W A;  3VTV A;  1NDD A;  2O2V A;  4G0N B;  2QIE B;  3PPA A;  3VRA B;  4CYE A;  4DXA B;  1V5O A;  4L1B A;  2LWP A;  4IKG A;  2INN E;  4JL9 A;  4EZL A;  4OW0 A;  5I4D A;  3IHP C;  2WDT B;  3GZN I;  4NQK E;  3U52 E;  1CK1 A;  2BYV E;  3PLU A;  4HEA 1;  3P4Q B;  4HDQ A;  4WWP A;  1SE3 A;  3APD A;  3VUX A;  1MG4 A;  4DQO C;  3B1L X;  1ISN A;  4LNO A;  3NOB A;  3Q2A C;  2NTS A;  5H92 C;  1L6U A;  4AS1 A;  1FIQ A;  2WDR B;  4S17 A;  3U30 A;  2L00 B;  2C60 A;  3JVZ X;  3N20 C;  3JYU A;  3MC0 B;  2D5G A;  1Q5W B;  3ZO5 B;  1XCT L;  4KGS A;  2ON8 A;  1ZE3 D;  4W9I A;  2IGH A;  2DZI A;  1XQQ A;  4JIO U;  4AUQ C;  4OZC A;  3A1Q A;  1QLB B;  3LJ3 A;  2EEL A;  2KN5 A;  1ZKH A;  4P1B C;  2KDB A;  1UUP A;  2C7H A;  3AE4 B;  3UGB B;  2L3Z A;  2RPQ A;  1R4M I;  4CO7 A;  5MPO A;  2FUG 1;  4BAX A;  2KAN A;  2ZW0 A;  1WR1 A;  3VR9 B;  5J2R A;  1IYF A;  5E6N A;  5HG2 A;  3AI5 A;  1I4X A;  1OQQ A;  3NVW A;  2Z0D B;  5CTR C;  3HIZ A;  3UI3 A;  1C78 A;  3PRE A;  4ARC A;  5FKA C;  4EFO A;  2JY6 A;  3ZNZ B;  2DZJ A;  3MHS D;  5IN7 A;  4GDL A;  2MJD A;  2IGG A;  3MC9 A;  2BYE A;  4DDG D;  3I5J C;  4ZYN A;  4A9A A;  5T8I A;  1ROE A;  2Y5B B;  4LDT B;  2C9W B;  1FFU A;  3R8B A;  3QAQ A;  3UIP B;  2BW2 A;  2PJH A;  2IYD B;  1STE A;  1N62 A;  4EUT A;  1G6J A;  3GOE A;  4MSQ B;  2BTE A;  2NMQ A;  4B95 A;  3VDZ A;  4K1R B;  2DAF A;  4LLG M;  3DVN V;  2BKR B;  2DYB A;  4Q2J A;  1Y8R C;  4M0W B;  1WX7 A;  3CST A;  1EWY C;  3WAN A;  4II3 B;  3EHV A;  3RD2 A;  2INP E;  3KQ4 A;  1HXY D;  3VRB B;  2N9K A;  3L4P A;  1V80 A;  4MM3 B;  4RFB A;  3GE3 C;  1WRI A;  1IPG A;  2L1A A;  3NVY A;  2LRU A;  4HKZ E;  2IDY A;  5GMV A;  3AE1 B;  4AJY B;  2NS5 A;  2KFJ A;  3L17 A;  3RPF C;  1D4B A;  1WWT A;  3KUC B;  4XZ4 A;  1KLV A;  3ZXR A;  2QIL A;  1VJK A;  3HHM A;  4DDI D;  2LXC A;  3QC8 B;  3AEG B;  2GBM A;  2ZPN A;  1F2R C;  2WXM A;  3AE6 B;  1VLB A;  3LB8 C;  1SIF A;  1UF0 A;  1PQS A;  3QK0 A;  1SB3 C;  3DOW A;  3Q3N C;  4W9F A;  5G5H A;  1FNW A;  1NI2 A;  1JWB D;  3VTU A;  2BF8 B;  4XWT A;  4YTM B;  5KHQ A;  2LHE A;  5J17 A;  3V60 A;  1L4D B;  1SE9 A;  3EC8 A;  5BYQ A;  4P7I A;  3WCQ A;  5C1Z A;  4JQW C;  2IO0 B;  3ZJU A;  2MBB B;  3KUD B;  3Q6B A;  2LXA A;  4MGY E;  1P98 A;  4MAC A;  2YEP F;  4GLS C;  2LGX A;  3Q8F A;  2WDQ B;  5BMI A;  4US9 A;  5IO9 A;  4FJV B;  1WFY A;  2GB1 A;  2N9P C;  3NUH B;  4KZC A;  5AZF A;  1QT9 A;  3ZDM C;  4YL8 A;  4NAM A;  1WMH A;  1MG8 A;  1ZP0 B;  2DNF A;  3B9J A;  3WAO A;  3PRM B;  1PGB A;  4O1N A;  2WU5 B;  3QJZ A;  3SHQ A;  2LMC A;  4YXD B;  3RYT A;  4H2A A;  1RM6 C;  2JWZ A;  1EUV B;  2K0P A;  4WQM A;  5JXV A;  3ZLZ A;  2JQR B;  1AN8 A;  2WXF A;  3N30 A;  5TSS A;  3IG3 A;  2WLB A;  3M95 A;  2MH7 A;  2FBW B;  2WQY B;  1GJZ A;  4FHJ A;  3TCA A;  3GZN B;  3Q8C A;  3VR8 B;  2OOB B;  2UYZ B;  5L95 C;  1KLU D;  3DHH C;  5EE0 A;  4ZHP A;  4BOZ B;  1FXT B;  2KK8 A;  3AE3 B;  2LHD A;  1CJE A;  3AE5 B;  1TKE A;  1N60 A;  1FNU A;  1QF6 A;  2R2O A;  3O65 B;  2C5L C;  1HQR D;  1TKG A;  3Q3F A;  1JQ4 A;  2CR5 A;  4A3O A;  4I6L B;  2WS3 B;  3NJT A;  3DBH B;  4M8N A;  3QA8 A;  4YTN B;  1XXG A;  3H7P B;  4HLE A;  2RR9 A;  4UDU C;  3RUI B;  2YLM A;  4RGM A;  3P2B A;  3ZTC A;  1DOY A;  1T5X D;  2ZPY A;  1YD8 U;  1M4V A;  3V6E B;  2CHX A;  1TKY A;  2KTR B;  2WXQ A;  1TZO A;  2JYT A;  2K39 A;  1XO3 A;  5G2N A;  4N6E B;  3VHT C;  2K8B A;  2FCM A;  3WAL A;  3RI7 C;  1GAQ B;  1T0R C;  3VTW A;  3OWE B;  4HRS A;  3APF A;  2REX A;  4W9K A;  2L83 A;  3H8H A;  4K3C A;  4P1C C;  4YSZ B;  3J9C A;  4HJG E;  4W9D A;  3V6C B;  4PT5 A;  4HKQ A;  4FN2 A;  4FBJ B;  1HZ6 A;  4GB9 A;  5KHO A;  4LJP B;  1KJT A;  4W9C A;  1ZGU B;  4OVZ A;  3ECI A;  3U7D A;  5LLI A;  2D3C A;  1FRD A;  1UEL A;  3KLS X;  3AED B;  2AL6 A;  1QKZ A;  4MH8 A;  1WZ0 A;  3IFW B;  4KKJ A;  2VH2 A;  3H9D A;  4HPP A;  4B0M A;  4IM0 A;  2KAJ A;  3OJ4 B;  2MBQ A;  3R3M A;  3DWM A;  1V97 A;  2PEA A;  1V5T A;  2JXX A;  5C2T B;  5IP4 D;  2L05 A;  2N7J A;  2NVU I;  1SE2 A;  2N4F A;  3DBR I;  3TMP B;  5EDS A;  3BVZ A;  3AE7 B;  1K50 A;  3AEA B;  5LXI B;  2LI5 A;  3P4P B;  4ANU A;  2IPK D;  1B1Z A;  3L0W B;  3N1X C;  1FO4 A;  4EOY A;  1FCC C;  1GB1 A;  3ZJT A;  2KVZ A;  3L10 B;  2LVO A;  1AAR A;  4N59 A;  4KX6 B;  4FHK A;  1WXS A;  1WX8 A;  4HDO A;  1TTN A;  4FJZ A;  4TSS A;  1C4P A;  1WGH A;  4FAD A;  2CKH B;  4ANV A;  3Q8E A;  1RRB A;  2VH1 A;  5JHA A;  3NZ3 A;  3Q3M C;  5BMG A;  4PYZ A;  4IWP A;  3TUO A;  3EA6 A;  5C23 A;  3M63 B;  1OEY A;  3RNA C;  1GC6 A;  1D5X C;  5IKC M;  4MEM A;  4W9G A;  4DXG A;  2PVO D;  4W9H A;  2MWS B;  2NBU A;  4WAA A;  3B2G A;  1JML A;  1C77 A;  4HK2 A;  1JWS D;  4MJS A;  1P0R A;  5IAA C;  3ZRC A;  2M0A A;  2GBK A;  4B6W A;  1FXI A;  2G4S A;  2Z59 B;  2FE8 A;  4GU2 A;  1JWU D;  3AU4 A;  2KWD A;  1TS2 A;  4IM2 A;  2N0S B;  1RWS A;  3QX1 A;  2AX5 A;  2G1E A;  1GPX A;  5HHD G;  3ML9 A;  4K7S A;  1DOI A;  5DPS A;  3DBL I;  1BT0 A;  1K53 A;  2KX3 A;  4JLC A;  2KO3 A;  3BWU D;  2BT6 A;  3ZW3 A;  2KHW B;  1SGH A;  3X0W A;  3SU8 X;  4KVG B;  1I4G A;  1Z2M A;  3IT4 B;  1N61 A;  4A20 A;  1E8Y A;  3BY4 B;  4RNA A;  2BWF A;  1YJI A;  2KXJ A;  5EE3 A;  1FCL A;  5BMH A;  4WJQ A;  2CU1 A;  3A9J A;  2N9X A;  4AP4 C;  4WQO B;  4ZOH C;  3VH4 B;  1WE7 A;  1JRU A;  3DBS A;  2LFI A;  4MGK E;  1V9J A;  2ZVO A;  3VFK A;  2BBC A;  1HZ5 A;  1KLG D;  5D7G A;  1MHH E;  4ZRP A;  3RNE C;  4GXB A;  3HUI A;  1YOV B;  4FA6 A;  2J4X A;  3GP7 A;  1GC7 A;  1E7P B;  3RNB C;  4IUM B;  2IBI B;  2LD9 A;  2YVC A;  1VZ6 A;  3ZGZ A;  4ARI A;  1C4A A;  1I4P A;  4MDK E;  4L2Y A;  2X8X X;  1TBE A;  1T0S C;  2BWE S;  2PE9 A;  4WJO A;  3SDL C;  1WM2 A;  1ZXH A;  2CJN A;  4KSL C;  4EZK A;  2BYF A;  2KC2 A;  2D11 A;  4CQN A;  1YJ1 A;  2O6V A;  2MJ3 A;  3ZKJ C;  4GSW A;  2KFK A;  1IBX A;  2K22 A;  2J0J A;  2WX0 A;  2QDF A;  1I4Q A;  2D3G A;  3DPD A;  3VH3 B;  1UGJ A;  3ZNG C;  3PTF C;  2NBV B;  5AEK B;  2MRP A;  3RZW C;  2H88 B;  2KYW A;  1C79 A;  1E10 A;  5DPW A;  1WYG A;  2KMA A;  2YEP B;  2MLB A;  3CWI A;  2KDM A;  4ZYS A;  3DHG C;  4BBN C;  3L08 A;  5C3J B;  2DBY A;  5D6J B;  4DHJ B;  3KVF B;  3R66 C;  4OVV A;  1L2N A;  2UWQ A;  2FUH B;  3PGE A;  4TUU A;  1F0Z A;  5TR5 A;  2ZEQ A;  1D5Z C;  2LJ5 A;  1V86 A;  3QWZ B;  2PLP A;  1FFV A;  4URK A;  3QCA A;  3UQB A;  2W54 A;  1TZ1 A;  1LO5 D;  2Y3A A;  2ZW1 A;  3D32 A;  2N7D A;  1E7U A;  2WWZ A;  3HVD A;  1WJN A;  1LXD A;  2MBH A;  1RYJ A;  3TSS A;  1XLN A;  2ZNV C;  3RNF C;  3ZUN A;  1VDV A;  3W5V B;  3T3O A;  2PTL A;  3PV1 A;  4NJC A;  1GOZ A;  4IG7 B;  2V4L A;  1GB4 A;  3TEW A;  1ESF A;  4TKN A;  2IY0 B;  2K9X A;  2I1J A;  3AUL A;  2CHW A;  2O6V B;  4ANX A;  1XEE A;  2HD5 B;  2MJE A;  1A70 A;  1HE8 A;  2GLS A;  2KFK B;  1LM8 B;  3EUB 2;  4LNI A;  2QHO A;  4BKT A;  1FMA D;  1XLP A;  2KLC A;  3FKY A;  4LNF A;  4IDI A;  4ZRJ A;  1UH6 A;  1GNU A;  2V0G A;  1MFW A;  2KZR A;  3Q3O C;  3VUW A;  2D07 B;  4M00 A;  1E8W A;  4PYU A;  2RD0 A;  3RT3 B;  1IP9 A;  2DLB A;  2KT7 A;  3ZDT A;  2JYE A;  1MHX A;  2AQ3 B;  2ACZ B;  4ZDV A;  2RPV A;  1FNV A;  3BK2 A;  1SF0 A;  2JZP A;  2WXG A;  3L54 A;  2MX2 A;  2WNM A;  2L8J A;  1WGY A;  1TJE A;  2KWU B;  1XD3 B;  3RFZ B;  2KQ4 X;  3MP9 A;  4QAY A;  2GRI A;  3RUL A;  2KWC A;  1N6Z A;  2K3U A;  1P9D U;  1YNT E;  3ZQ4 A;  4B0E A;  1WXM A;  4GDK B;  3I63 C;  5H8Y E;  3CSF A;  1YQ3 B;  3SR6 A;  1AYF A;  3V62 A;  3ABV B;  4MGI E;  1ZDX A;  2A5U A;  3AB5 A;  1V81 A;  2NTT A;  2BQQ A;  4EZJ A;  5FR6 A;  2KJH B;  4KSK C;  3NHE B;  5L83 A;  5CHV C;  1UWM A;  2KJR A;  3RZF A;  2IGD A;  3N1Y C;  3DWG C;  1HEZ E;  5IOI A;  1TS3 A;  3WIM A;  1C1Y B;  2LGI A;  1H8C A;  1F77 A;  1UGM A;  3APC A;  1LGR A;  4KGR A;  2VZK B;  5D94 A;  3N9Y C;  3A33 B;  2PMV A;  2Z0E B;  2NPT A;  2D10 A;  3P1M A;  4E74 A;  3QHT A;  5HI1 A;  3AN1 A;  2DYO A;  3PHW B;  3OAW A;  5JH5 C;  4NNJ B;  2Y5P A;  3NRZ A;  1K51 A;  1PGA A;  4M8M A;  4PS8 A;  2K8H A;  3AEE B;  2BS4 B;  2I1K A;  3AE9 B;  4HCP B;  4YT0 B;  2KD0 A;  2PKO A;  2I38 A;  2KTF A;  2R2Q A;  4IWQ A;  1XCQ L;  4FJY A;  4A6Q A;  4HPL B;  5JZE B;  1J0G A;  1P3Q U;  2CJO A;  3CIR B;  1H4R A;  5AUK A;  2QSD A;  4RM8 A;  3M3J A;  4MT5 A;  2J42 A;  1NEK B;  2I2Y A;  1OGW A;  2QC8 A;  5BO4 B;  2RDB C;  1FXA A;  2TSS A;  3LDZ E;  2ZVN A;  4EEW A;  1WXA A;  2NCN A;  4X57 B;  4K3B A;  2AQ1 B;  4DK5 A;  3FC4 A;  1YX5 B;  2V9H A;  1SJH D;  2W3R A;  4J6I A;  1WJ6 A;  5EE9 A;  1SXT A;  2XEW A;  1L6V A;  3U4E G;  4A3P A;  3LXF A;  3L13 A;  2ZCB A;  3AV8 A;  1Q1O A;  2IO2 B;  4EE2 A;  2BGF A;  3UIO B;  2L76 A;  2M8S A;  2QEJ C;  2MW5 A;  4FXC A;  2KLG A;  2EMS A;  3VQI A;  4R3D A;  3A9K B;  1FRR A;  2JZZ A;  3Q8B A;  2KAC A;  4GDL B;  1K52 A;  1SSN A;  3W1Y A;  2WU2 B;  5BYS A;  1J7C A;  5CHF A;  4AWJ A;  3AEB B;  3A1Q B;  4I6N B;  1ZPS A;  1Q10 A;  2K6D B;  4BKS A;  3FAH A;  3P4R B;  4KDL B;  2LEK A;  1R7S A;  1TY0 A;  4OZB A;  2K25 A;  5D2M B;  1QZE A;  2K8C A;  3ETR A;  4PK1 A;  5CHW A;  3VAW A;  1C76 A;  2WYQ A;  1VZ7 A;  1YN4 A;  3UQA A;  3T3N A;  2G9H D;  2KDI A;  3EEC A;  5HKH A;  4W9J A;  1AWD A;  2RDH A;  2VZK D;  4XGA B;  1C4C A;  4RGN A;  2GOW A;  2FNJ B;  3I57 A;  2MHJ A;  4BZA A;  2D3A A;  4RGO S;  1ZDV A;  4W9L A;  5AZH A;  1CMX B;  2N9L A;  2XNA C;  3AMZ A;  3NY5 A;  4HXD A;  1RAX A;  4YTP B;  2JF5 A;  3W9C B;  2J52 A;  4A55 A;  1KM7 A;  4LK0 M;  2IJ0 A;  1NVI D;  1WJU A;  1I35 A;  1WR6 E;  3MC8 A;  4DBG A;  5D3D A;  1V1O A;  4K81 A;  4NAW A;  3SFE B;  2UU7 A;  4J3O D;  3W1S A;  2PPH A;  1RLF A;  1ACC A;  4YSY B;  3AXC A;  2ZCC A;  3KYC D;  2BYT A;  2L0T A;  4C56 C;  2N1V A;  1NI3 A;  1YJJ A;  4ITK A;  4N58 A;  4II2 B;  1NEN B;  2L32 A;  4P16 A;  3A4R A;  3E9S A;  1S1Q B;  2WXJ A;  1WY8 A;  3URY A;  3TEY A;  2BPS A;  4KKI A;  1WGR A;  4KZ0 A;  3PZ8 A;  3T8M A;  2GI9 A;  2KTR A;  2DWQ A;  2V3S A;  3SFD B;  4NY0 A;  1Z5S B;  2GBN A;  2HTM E;  2LUE A;  4WWN A;  3BYY B;  4C7Z A;  2QCZ A;  2KN4 A;  3VUY A;  3VXW A;  4EKU A;  1FEH A;  2WXN A;  3TBL D;  3RCZ A;  1YN5 A;  2WGS A;  3B2F A;  3Q3J A;  2JVC A;  3RMK C;  1CQV A;  1EO6 A;  2DZK A;  2FCN A;  3ALB A;  4WWO A;  4MGZ E;  1L7Y A;  4HWI B;  2DX5 B;  3W2D A;  4USA A;  3DVG X;  2CS4 A;  4WJP A;  1DYQ A;  4B9K A;  3AH7 A;  4PS7 A;  1E0Z A;  2M0X A;  1PYW D;  3TJP A;  4IW0 A;  3PT2 B;  4NZL B;  3FIL B;  3P42 A;  4JX1 C;  2V4I B;  1WXV A;  4RH6 A;  3GB1 A;  2NR2 A;  2LGY A;  3KH0 A;  2W9N A;  4MM3 A;  3K9P B;  5JHB A;  1JRP A;  3ZNI D;  4WAF A;  2JWU A;  1EU3 A;  3DBL B;  5E6O A;  1EM7 A;  1V1P B;  2VRR B;  2G3Q B;  4HJK A;  4NJ7 A;  3HK0 A;  4ASW C;  1J8C A;  4ZRI A;  2J0M A;  1N5X A;  2LRW A;  2MBE A;  2DYM A;  3QQ8 B;  1M94 A;  2L7R A;  3PVL A;  4DHJ D;  1TY2 A;  4P6V F;  3HVZ A;  1WI0 A;  3V61 A;  2G4D B;  4XDD A;  3R2I A;  3C8Y A;  2ZNV B;  2MQJ A;  4GN1 A;  2SEB D;  5D3I B;  4CHK A;  1LFD A;  2MBO A;  3ZVV A;  2BB6 A;  1WYW B;  1QOB A;  2WXK A;  2N9E B;  2SAK A;  1V49 A;  1VD2 A;  2KWV B;  1WGG A;  4YSX B;  4WUR A;  3ZTD A;  2QMT A;  1KFY B;  5DCN A;  1EWC A;  3VVW B;  2EKE C;  1SEB D;  3P4S B;  3DQV A;  1J19 A;  3CF6 E;  2M19 A;  2GMI C;  3IXS A;  2JRH A;  1T0Y A;  1LQB A;  2C7M B;  1WX9 A;  1TS5 A;  1SE4 A;  2KJ6 A;  3TIX A;  2B76 B;  2KDF B;  3I3T B;  1WXQ A;  3OLM D;  1VR9 A;  1NYQ A;  2WXP A;  3H7P A;  3DVN U;  2JZ3 B;  2MEK A;  2W3S A;  1VCB A;  2FCS A;  1WF9 A;  2EKI A;  4KV2 A;  2MP2 B;  2GBR A;  3N1Z C;  4LTU A; 
#chains in the Genus database with same CATH homology
 1YN3 A;  2GRI A;  2X38 A;  5G5G A;  1GAQ B;  1FD6 A;  3NVV A;  1YMH E;  3OWE B;  4HRS A;  4ZRQ A;  1UWX A;  1AW7 A;  1EU4 A;  2K3U A;  2L83 A;  2RMM A;  4ZHO A;  2WXO A;  1YNT E;  3ZQ4 A;  4B0E A;  3H8H A;  4GDK B;  2Y5C A;  4YSZ B;  1ZUD 2;  5H8Y E;  1YQ3 B;  3GS2 A;  3J9C A;  4HJG E;  3SR6 A;  1AYF A;  3ABV B;  4PT5 A;  4HKQ A;  1ZDX A;  1T6B X;  2LUM A;  1KRH A;  3AB5 A;  1HZ6 A;  1ZXI A;  2WXH A;  2NTT A;  3PO0 A;  4OZA A;  4OHJ A;  1UWM A;  2E3T A;  1Y56 A;  1BML C;  4OVZ A;  4DXF A;  2IGD A;  4JE3 B;  3DWG C;  1HEZ E;  1TS3 A;  1ET9 A;  1FRD A;  2LGI A;  3KLS X;  3AED B;  4A8X C;  1F77 A;  3IAM 1;  3W5U B;  1QKZ A;  4TMA B;  1JCK B;  4MH8 A;  5HFY A;  4KGR A;  2VZK B;  4KKJ A;  1L4Z B;  3N9Y C;  5GXG B;  1MI0 A;  2PMV A;  3AEF B;  5LNK 1;  1IGC A;  3IAS 1;  1I4R A;  4B0M A;  2BB5 A;  2KAJ A;  2ICI A;  3P1M A;  1VRA B;  5HI1 A;  3AN1 A;  3DWM A;  1V97 A;  2JX5 A;  3LYY A;  4HRO A;  2DYO A;  4XWW A;  1TS4 A;  5C2T B;  1QOG A;  2N7J A;  1XLQ A;  1I4H A;  1K51 A;  2Y5P A;  1PGA A;  3NRZ A;  4US8 A;  1SE2 A;  3BVZ A;  3TEZ A;  3AE7 B;  1K50 A;  1OFF A;  3AEA B;  3KWV A;  2W82 A;  5BYR A;  1P7F A;  2BS4 B;  3AEE B;  3EGR A;  3NVZ A;  3U7Z A;  4D2K A;  2WXL A;  1B9R A;  1N5W A;  3P4P B;  3AE9 B;  2WXR A;  4YT0 B;  2QIE B;  2PKO A;  1VZ8 A;  1YQ4 B;  2IPK D;  2PIA A;  2I38 A;  1B1Z A;  3VRA B;  1FO4 A;  1XCQ L;  4L1B A;  4WWM A;  4A6Q A;  4IKG A;  2INN E;  1FCC C;  1CZP A;  4OW0 A;  4RF0 A;  5I4D A;  2CJO A;  4IOI E;  3CIR B;  3MJ5 A;  5AUK A;  1GB1 A;  2QSD A;  3ZJT A;  2L52 A;  3U52 E;  1CK1 A;  2QJL A;  4MT5 A;  4N59 A;  4KX6 B;  2J42 A;  1NEK B;  4HEA 1;  3P4Q B;  4RGT A;  2I2Y A;  1FXA A;  2TSS A;  1SE3 A;  4TSS A;  1C4P A;  3R2T A;  1L0X B;  2PVG C;  1DOX A;  3Q8E A;  3AM9 A;  3IT6 B;  1WGK A;  4DQO C;  4C80 A;  2AQ1 B;  3Q8A A;  2RDG A;  3FC4 A;  1D6E C;  2JXT A;  3NZ3 A;  5BMG A;  1SJH D;  2J53 A;  4L23 A;  3TUO A;  3EA6 A;  2W3R A;  2NTS A;  5H92 C;  1OQR A;  2CU3 A;  5EE9 A;  1L6U A;  4AS1 A;  1FIQ A;  1SXT A;  1WSP A;  2WDR B;  1L6V A;  3U4E G;  1D5X C;  4RF1 A;  3LXF A;  3MC0 B;  2D5G A;  3AV8 A;  4A90 A;  1JRO A;  4DXG A;  4EE2 A;  1XCT L;  3ZJV A;  2PVO D;  4KGS A;  2QEJ C;  2ON8 A;  2OED A;  1ZE3 D;  2IGH A;  4FXC A;  5EE1 A;  4YWG G;  3B2G A;  4OZC A;  1JML A;  1C77 A;  1QLB B;  3BII D;  3BVM A;  2EEL A;  4JPS A;  3VQI A;  1IGD A;  4R3D A;  4NAW B;  4C7Y A;  1FRR A;  1UUP A;  2WXI A;  1JWS D;  3AE4 B;  3Q8B A;  2M0A A;  2KAC A;  1FXI A;  3ZYY X;  4GDL B;  1K52 A;  1SSN A;  2WU2 B;  5MPO A;  1V8C A;  2FE8 A;  1MPE A;  2FUG 1;  5BYS A;  1JWU D;  2ZW0 A;  2KWD A;  3VR9 B;  1J7C A;  1TYG B;  1TS2 A;  3AEB B;  5HG2 A;  1I4X A;  1OQQ A;  2Q5W D;  3NVW A;  1ZPS A;  3UI3 A;  1Q10 A;  1C78 A;  1UNS A;  2N0S B;  3FAH A;  3P4R B;  3FIL A;  4ARC A;  1RWS A;  2LEK A;  1R7S A;  1TY0 A;  5FKA C;  1KTK A;  2AX5 A;  2K5P A;  4OZB A;  2G1E A;  1GPX A;  3BZD B;  5HHD G;  2MJD A;  1PDX A;  1DOI A;  2IGG A;  3ETR A;  1PFD A;  1JAL A;  1C76 A;  1VZ7 A;  4XE0 A;  1K53 A;  1YN4 A;  3T3N A;  2G9H D;  4A9A A;  5T8I A;  1ROE A;  1V1P A;  1AWD A;  2RDH A;  2VZK D;  3BWU D;  2BT6 A;  1FFU A;  3R8B A;  1JWA D;  1C4C A;  4RGN A;  1I4G A;  2ONQ A;  2BW2 A;  3I57 A;  3IT4 B;  1STE A;  1N62 A;  3AE2 B;  4RGO S;  1ZDV A;  2BTE A;  2NMQ A;  1N61 A;  1XLO A;  4RNA A;  2XN9 C;  1KH0 A;  2N9L A;  1YJI A;  2XNA C;  4LLG M;  5EE3 A;  1FCL A;  5BMH A;  3AMZ A;  4YTP B;  2AQ2 B;  3W9C B;  2V3N A;  4Q2J A;  2J52 A;  2W55 A;  4ZOH C;  4A55 A;  4LK0 M;  1ET6 A;  1EWY C;  2IJ0 A;  1NVI D;  1ENF A;  1ZOY B;  2INP E;  3KQ4 A;  4WIP A;  1HXY D;  3VRB B;  5D3D A;  2LFI A;  2N9K A;  1V1O A;  3AEC B;  3L4P A;  4WH4 A;  4MM3 B;  1D5M C;  3SFE B;  4RFB A;  1WRI A;  2L1A A;  3NVY A;  2Z8L A;  4HKZ E;  2BS2 B;  4J3O D;  3W1S A;  2IDY A;  1ACC A;  1IUE A;  1QIL A;  2BBC A;  4YSY B;  1HZ5 A;  3AE1 B;  1L5P A;  1KLG D;  5D7G A;  2BYT A;  1MHH E;  4ZRP A;  3P63 A;  2OHF A;  2JU6 X;  3RPF C;  4C56 C;  1D4B A;  1WWT A;  1NI3 A;  1YJJ A;  4TQ0 A;  3HUI A;  2QIL A;  4ITK A;  4N58 A;  1VJK A;  2J4X A;  1NEN B;  3GP7 A;  2L32 A;  3AEG B;  1E7P B;  4P16 A;  3E9S A;  3PZ7 A;  5AUI A;  1MVK A;  3MFG A;  1F2R C;  2WXJ A;  2WXM A;  3E56 A;  3URY A;  3TEY A;  3AE6 B;  1E9M A;  1JW9 D;  4KKI A;  3PZ8 A;  1VLB A;  3LB8 C;  1VZ6 A;  1L0Y B;  1T3Q A;  3Q69 A;  2GI9 A;  3ZGZ A;  4ARI A;  4JWS C;  1C4A A;  1I4P A;  3V3X A;  3V05 A;  1SB3 C;  2DWQ A;  4XDC A;  3SFD B;  1SIJ A;  5G5H A;  1FNW A;  4L2Y A;  2HTM E;  1I7H A;  1JWB D;  3BYY B;  4C7Z A;  2KN4 A;  1ZXH A;  3SEB A;  2CJN A;  4XWT A;  5E6J A;  1QQR A;  4YTM B;  1FM0 D;  2HDE A;  3BK1 A;  4CQN A;  3BYT B;  2LHE A;  1FEH A;  2WXN A;  3U2S C;  1JWM D;  2MJ3 A;  2JSV X;  2PW9 A;  1L4D B;  2V3P A;  1YN5 A;  1C9F A;  3B2F A;  5BYQ A;  2R61 A;  1HA5 A;  1IBX A;  3WCQ A;  1CQV A;  2K22 A;  3ZJU A;  1I4Q A;  1UGJ A;  1PUT A;  3W2D A;  4USA A;  1F2R I;  1RFK A;  4MAC A;  2H88 B;  2YEP F;  4GLS C;  4JWU C;  3Q8F A;  3AE8 B;  3KWL A;  2WDQ B;  1C79 A;  1DYQ A;  4US9 A;  5BMI A;  1E10 A;  1P7E A;  1WYG A;  3AH7 A;  1J7A A;  2GB1 A;  3NUH B;  2YEP B;  1E0Z A;  1QT9 A;  3CWI A;  1PYW D;  2KDM A;  4ZYS A;  3BVG A;  4NAM A;  1ZP0 B;  1E6E B;  5C3J B;  2DBY A;  4NZL B;  3FIL B;  1QOF A;  3P42 A;  3B9J A;  4JX1 C;  1PGB A;  2V4I B;  4O1N A;  2WU5 B;  1F0Z A;  4RH6 A;  3GB1 A;  1D5Z C;  2PLP A;  1FFV A;  2LMC A;  4YXD B;  1JRP A;  2W54 A;  5FK9 C;  4H2A A;  2JWU A;  1RM6 C;  1EU3 A;  4WAF A;  2K0P A;  4WQM A;  5JXV A;  1LO5 D;  2Y3A A;  2ZW1 A;  2KMM A;  1AN8 A;  1EM7 A;  1V1P B;  2JQR B;  2WXF A;  5TSS A;  1DGJ A;  1BUI C;  3HVD A;  2WLB A;  2MH7 A;  3TEX A;  2FBW B;  1RYJ A;  5FR3 A;  3TSS A;  1XLN A;  1VDV A;  2WQY B;  3W5V B;  1N5X A;  4REZ A;  2DYM A;  3T3O A;  2PTL A;  4NJC A;  3Q8C A;  3VR8 B;  1GOZ A;  3NS1 A;  1TY2 A;  4P6V F;  1GB4 A;  3HVZ A;  3MHZ A;  3TEW A;  4XDD A;  1ESF A;  3R2I A;  1KLU D;  2K9X A;  3C8Y A;  2WP9 B;  3I9V 1;  3O13 A;  5EE0 A;  4ZHP A;  2SEB D;  5D3I B;  1XEE A;  3AE3 B;  2LHD A;  1CJE A;  1L0V B;  1TKE A;  2MJE A;  3AE5 B;  1BXT A;  1A70 A;  2BB6 A;  1QOB A;  2WXK A;  2SAK A;  1N60 A;  1FNU A;  3EUB 2;  1QF6 A;  4YSX B;  1FMA D;  1HQR D;  1XLP A;  1TKG A;  4WUR A;  1JQ4 A;  4IDI A;  2QMT A;  1XF5 L;  1KFY B;  2V0G A;  1EWC A;  1NYR A;  2WS3 B;  2LJI A;  4TQ1 A;  4YTN B;  1KF6 B;  1SEB D;  3P4S B;  1XXG A;  2DLB A;  1N63 A;  2M19 A;  2JYE A;  3IXS A;  1MHX A;  4RCO A;  2AQ3 B;  2M56 B;  3HRD D;  4UDU C;  1SBB B;  2ACZ B;  4RGM A;  1QOA A;  2BS3 B;  2RPV A;  1FNV A;  1SE4 A;  1TS5 A;  3BK2 A;  1DOY A;  2H89 B;  2B76 B;  1SF0 A;  2WDV B;  2JZP A;  1T5X D;  1WXQ A;  2WXG A;  1M4V A;  1VR9 A;  1NYQ A;  1TKY A;  2E6X A;  2WXQ A;  2WXP A;  1TZO A;  2JYT A;  2WNM A;  1XO3 A;  4KGT A;  1IBX B;  4N6E B;  2MEK A;  2W3S A;  1TJE A;  4M0W A;  2EKI A;  4AQ7 A;  3RFZ B;  2KQ4 X;  3MP9 A;  1SJE D;  4LTU A;  1J7B A;  1PGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...