2LXCA

Solution structure of the complex between the sgt2 homodimerization domain and the get5 ubl domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/protein binding
molecule keywords Ubiquitin-like protein MDY2
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lxcA00
2IO3B 1EF1A 3ECIA 5FR6A 1UZXB 2B3AA 4DDID 4B9KA 2DYOA 1IP9A 1GNUA 3KUDB 1V5OA 2PE6B 2XEWA 4XC2A 3UINB 2OOBB 2YLMA 2K8CA 4FULA 1V6EA 1WGHA 2KDBA 4DXAB 1G6JA 4RM9A 2UWQA 4WJPA 3MHSD 1XD3B 4FLHA 3TBLD 4KSLC 1E8WA 2A5UA 3EECA 2LRUA 2JZZA 3DVNU 4B6WA 2AWTA 2O6VA 2RGFA 1WMHA 1LQBA 2G45B 3TL5A 2K39A 4IUMB 4KDLB 1Q0WB 3APCA 1T0YA 3HK0A 2KQSA 4MGZE 2DZIA 4NAWB 2C60A 4NY0A 3QX1A 1GG3A 4TQ1A 4W9LA 2MBHA 1WMHB 2KFKB 3ENEA 4RMAA 1P98A 2N1VA 4ICVA 4ZYNA 3A4RA 4NJ6A 2MLBA 4ANXA 2LGYA 1UBIA 2XBBC 2JWZA 4M0WB 5G2NA 2WDTB 1F9JA 2L7RA 2D10A 2MWSB 4MEMA 1GC6A 5AEKB 2I1JA 4MSQB 5D6JB 3JVZX 2AL3A 3K9PB 3V61A 3RZWC 3R7RA 3CMMB 2LGXA 3A9KB 2KOXA 3IHPC 1BT0A 2LVOA 2ZPYA 2CHWA 5HKHA 2MBOA 2JUOA 4DHJB 3L08A 3ZNHB 3B1LX 2G4SA 4GDKA 2IZVB 4WAAA 2WYQA 4HVBA 2O6VD 2KJHB 4BOZB 2L05A 1YJ1A 4WWOA 5CHWA 2KZRA 1V49A 2A4ZA 4M8MA 2J0JA 4FHKA 3PT2B 5BO4B 3RYTA 2RPQA 3ML9A 1GJZA 4W9JA 2ASQA 2NS5A 4EEWA 4IG7B 5DPSA 2V3SA 1EUVB 2LD9A 4GU2A 4HLEA 2VRRB 4K7WA 2BKRB 3NHEB 3ZNGC 3ZO5B 4GOCA 2PE9A 4OVVA 4LDTB 1HE8A 4IWPA 4BKSA 3TIXA 4DBGA 4BKGA 1QZEA 3I3TB 1WX8A 4W9CA 2CS4A 2L76A 4GDLA 4K7SA 2Z0EB 4K81A 3VXWA 1RRBA 2KLGA 4GIVA 4IC7B 3V6EB 2LASA 1LM8B 2O2VB 5CX3A 3QWZB 2ZEQA 3ZNZB 3EHVA 2MCNB 3VHTC 1WGGA 2KVRA 4FJZA 2KWCA 2KMCA 4IM2A 2RR9A 3WANA 1UGMA 4MJSA 4W9HA 2JVCA 2KMAA 1WJNA 4G50A 4I6PA 4LCDE 4ICUA 5DPTA 3DBHI 3B0AA 3U30A 1JRUA 3GOEA 4ANWA 4CO7A 3W1YA 1KM7A 3DDCB 3VUXA 2CHXA 4F8CB 4N9F4 2BKFA 1TTNA 3WA0A 2L00B 2KQ7A 2EKEC 2NPTB 2IO2B 3L13A 4IWQA 4E3CA 2BYFA 2D07B 3DBLI 3L16A 2FIDA 2LVPA 2DZKA 2IO0B 2KANA 2R2QA 3ONSA 3DOWA 3M3JA 4ANVA 1WFYA 2LZ6A 3QAQA 2K6QA 2PPHA 3L0WB 4WJNA 2N7DA 4EZKA 2KHWB 4AOFA 2N9XA 3IBEA 3PHXB 3UQAA 2M8SA 4JLCA 4W9KA 4URKA 1IYFA 1WIAA 3QIJA 4JIOU 1J19A 3DVGY 1ZKHA 1E8XA 3ZRCA 3PSEB 4IW0A 4EZLA 2FCMA 4ASWC 4ZDVA 3DVGX 2FNJB 4W9EA 2LWPA 4AJWA 2ZZPB 4EZJA 2DAFA 4KIKB 3KUZA 4TUUA 5AZGA 5EDSA 2LXAA 3P2BA 3A9JB 3B08A 2GMIC 4DHZB 2R2OA 5KHQA 1WXVA 4MDKE 5JHAA 5AZFA 3VTUA 3DPDA 3ZTDA 1FXTB 2O2VA 2ZPNA 3HM3A 2GBMA 3H1UA 5J17A 3ALBA 3IFWB 5DPRA 1D3ZA 1H4RA 1WYWB 3ZDTA 2BYVE 1R4NI 1OQYA 1XT9B 1WR6E 1WJ4A 3ZUNA 1P1AA 3WAPA 2N1WA 4G0NB 2KC1A 2KDIA 2J7QB 3ZIMA 4KDIC 5D7GA 4JGHB 4F7ZA 1C1YB 2IY0B 2V1YA 2BPSA 3APFA 1RAXA 1I35A 1YX6B 3LDZE 4BKSD 4ANUA 4FADA 4DWFA 1YD8U 1WF9A 3PLUA 3QCAA 4ZRJA 4TKNA 4AUQC 1E8ZA 2LJ5A 3S2AA 1WR1A 2IYDB 2J0MA 3BINA 4GXBA 4MGIE 3HIZA 2BGFA 3AI5A 4E74A 3PRPB 4HDOA 2FIFA 2KO3A 4NAWA 2L0FA 3AU5A 4II3B 1E90A 2DENB 2ZCBA 4FBJB 3UF8A 2Z59B 4FA6A 1ISNA 2N4FA 4NJ7A 3PREA 3H7PA 2K1FA 1S3SG 3JW0X 2JF5A 1ZGUB 2LGDA 1EO6A 3CSTA 2BF8B 1TGZB 2YVCA 2IY1B 2M0XA 4KZCA 1MG8A 3VVWB 3QHTA 2G4DB 2GBRA 2KX3A 4HJKA 1UD7A 4GN1A 3KW5B 3KUCB 3X0WA 5LLIA 2C9WB 2CU1A 4GDLB 3VH4B 1H8CA 2AEHA 2MSED 4F1SA 1IPGA 4NPNA 2W9NA 4J6IA 3VQIA 2MBQA 4II2B 2BYEA 4GMVA 3V62A 3VUWA 1S1QB 3SD5A 2KN5A 2KWVB 3UIPB 4BVUC 1V5TA 2K8BA 4MSMB 3MJWA 5JHBA 3ZDMC 2WX0A 2IBIB 1Y8RC 1M94A 3OJ4B 1RLFA 1WX9A 4WJOA 2KDEB 2GBKA 2NBWB 3PPAA 4HCNB 5CTRC 3QC8B 2Z0DB 4PS8A 5LXIB 2KJRA 5TR5A 4MGKE 3L10B 1KLVA 2KC2A 1UH6A 5CHFA 2KXJA 4GGQA 4XZ4A 5DCNA 3RUIB 4BBNC 2KKCA 2RSUA 3DVNV 4XX5A 3W1SC 4BBNF 1NDDA 2BWES 3N3KB 1OEYA 4A3OA 2L8JA 1P9DU 5JH5C 4HXDA 2MX2A 2LI5A 4W9GA 3SDLC 4CHKA 2EMSA 1CMXB 3APDA 1WRDB 4P7IA 3H6NA 3ZRFA 2KX0A 4WWNA 3U7DA 4IM3A 2RD0A 1E8YA 3VUYA 2LRWA 3V6CB 5DPWA 3AU4A 2HD5B 3ZKJC 1P3QU 4MJSB 3PHWB 5JZEB 1WH3A 2KTFA 1KJTA 2C7NB 3KH0A 4KVGB 4OVUA 1Q5WB 4I6NB 3SHQA 4LJOB 2JY6A 3M95A 2V4LA 4K1RB 3WALA 3JSVB 2MP2A 3UIOB 4FN2A 2KLCA 3PVLA 2MRPA 3A9JA 4G11A 1WZ0A 4HCPB 4TQ0A 1X1MA 3EC8A 2K6DB 1A5RA 2NVUI 3IG3A 2DAJA 2NR2A 3ZTCA 3A1QB 2N7EA 2GOWA 3KYCD 4PYUA 3T9LA 1KOTA 3VDZA 2FUHB 2KNBA 3Q3FA 3VTVA 2AYOB 4YL8A 2KD0A 2LXCA 4IM0A 3DBRI 4WJQA 1SE9A 2JRHA 4NQKE 4BOSC 4EUTA 2ZCCA 5L83A 2JPHA 1WGYA 5CHVC 4ZRIA 1SGHA 2ZVNA 4W9IA 4DHZE 2D11A 3WAOA 1ZW7A 3BY4B 2M17A 4K7UA 4EKUA 1SIFA 1V81A 4MH0E 4LJPB 3AULA 4HK2A 2GBNA 4EOYA 4E71A 1WX7A 1WI0A 3EFUA 3VFKA 1TZ1A 2PJHA 3H7PB 5E6NA 3GZNI 5AZHA 1WGDA 5J2RA 1UELA 2BWFA 3L17A 2FAZA 2KTRA 4FJYA 3T8MA 1WM2A 1V86A 4MELA 3ZW3A 3RCZA 3VTWA 1GUAB 2DZJA 1TBEA 2MBEA 2Y5BB 2KFKA 4FJVB 3NS8A 3VAWA 4FHJA 3RD2A 1R4MI 3L54A 2DX5B 3WIMA 4PS7A 3A1QA 2DZMA 2C7HA 4GB9A 1NBFC 5IA7A 2XK5B 3NY5A 2JZ3B 3X23A 4HPLB 1XQQA 2NBVB 2GBJA 2QHOA 4W9DA 3R7QA 5KHOA 1NI2A 3PLVA 3OAWA 1WGRA 2CKHB 1EF5A 2L0TA 2ZJDA 3DCGA 3NOBA 4DK5A 4GSWA 3D32A 2NCNA 2KK8A 1GC7A 1VCBA 3CF6E 2M1MA 3NZUA 2N9EB 3M62B 1P0RA 3QQ8B 3NZSA 3H9DA 2MBBB 4CYEA 4NNJB 2MW5A 3OJ3A 2NBUA 1C3TA 1AARA 4MGYE 3N32A 2MQJA 1E7UA 2AL6A 4WWPA 1VD2A 1LXDA 1L7YA 2WWZA 1PQSA 1WJUA 2JRIB 1OGWA 5C23A 5C1ZA 5GMVA 2LVQA 4AP4C 3VH3B 1I42A 3N30A 2M4NA 1J0GA 2K25A 3QARA 3OLMD 3IVFA 4JL9A 3WAMA 4PS3A 4A3PA 4BFRA 2D2QA 2PEAA 3Q3JA 3PGEA 5D2MB 4KIKA 1WJ6A 3RT3B 3RULA 2L3ZA 3ZVVA 1E7VA 1WY8A 3A33B 2KFJA 5L95C 2ZNVC 3TCAA 2C5LC 4B95A 4IWOA 4AJYB 5E6OA 1U4AA 3O65B 4HWIB 1K8RB 3TJPA 2G3QB 1Z2MA 3C0RB 2MP2B 2HJ8A 2REXA 4JQWC 1Q1OA 5J18A 2XK5A 2FCNA 1V9JA 3K9OB 3R3MA 2K8HA 2ZNVB 2OJRA 3ZLZA 5IAAC 4WQOB 4M8NA 1L2NA 2FCQA 4PYZA 3AXCA 3A4SC 3QK0A 4RM8A 4KZ0A 4GDKB 1Z5SB 2KWUB 3PV1A 4HDQA 1V2YA 2I1KA 2KJ6A 1WE6A 4ZRKA 3ML8A 1OTRB 4NQLB 3SU8X 2UYZB 4MM3A 1YX5B 2EMTA 3QA8A 4DDGD 4DHJD 3HHMA 3MTNB 2NPTA 3PZDA 1OEYJ 4W9FA 1E5WA 4KSKC 2N9PC 1UBQA 2CHZA 3ZNID 2KDFB 3LJ3A 2HE7A 1WE7A 4HPMB 3PTFC 4TV3A 2D3GA 1YIWA 1V80A 3KYDD 2MA9B 3M63B 3V60A 4I6LB 2C7MB 3PRZA 3CSFA 2O6VB 3TMPB 2IO1B 3DBSA 4KV2A 4BKTA 4A20A 2WX1A 3UGBB 1WM3A 3KVFB 3UQBA 3RZFA 2DYMA 4X57B 3R66C 5G55A 3W1SA 3H7SA 3HM6X 5D94A 4AWJA 3PRMB 3JSVA 1WXMA 2DHZA 3QJZA 1J8CA 2LUEA 2DYBA 1LFDA 4LDTD 2KTRB 2CR5A 5E6PA 3U8ZA 1YQBA 1WXSA 3PS6A 5LXHA 1RFAA 4G3XB 2FCSA 3JYUA 1WXAA 2HTHA 2JT4B 2JXXA 4EFOA 1WZ3A 3DQVA 2ZVOA 2J0KA 3A9KA
chains in the Genus database with same CATH superfamily
3ECIA 1ZOYB 4B9KA 2Q5WD 4JX1C 3NRZA 1JWSD 2XEWA 4XC2A 1XLPA 4FULA 3W5UB 2L32A 1N63A 1WGHA 2KDBA 2BT6A 2N0SB 3TBLD 4M01A 2AWTA 2RGFA 2WXOA 2G45B 4KDLB 1Q0WB 1T0YA 3HK0A 2JQRB 4NAWB 2C60A 2QDFA 4YSXB 4W9LA 2MBHA 1KRHA 1V97A 3I57A 4ZYNA 1RWSA 4YT0B 2LGYA 1HA5A 2IDYA 4L2YA 1FD6A 3GP7A 4M0WB 5G2NA 2D5GA 2LHDA 1F9JA 2MWSB 1QILA 5AEKB 3V61A 4ZHOA 1ENFA 1LO5D 3A9KB 1TKGA 4OZBA 2KT7A 1TS3A 1E0ZA 3FKYA 1DGJA 3L08A 1WSPA 2PW9A 2IZVB 4WAAA 1VZ8A 2KJHB 1C4CA 1V49A 2A4ZA 5MPOA 3Q8BA 3RYTA 2RPQA 2ASQA 3ZJTA 3NVVA 4EEWA 4GU2A 4HLEA 2VRRB 3NZ3A 3NHEB 2J4XA 4OVVA 4BKSA 4DBGA 1QZEA 3BK1A 3R8BA 2CS4A 4RGMA 4GDLA 2Z0EB 1B1ZA 2MH7A 3E56A 1TS4A 2LASA 2O2VB 3QWZB 3ZNZB 1WGGA 3AM9A 2KWCA 3Q3OC 4FJZA 2B76B 3TSSA 5AUKA 4C7YA 1EM7A 1F77A 1CJEA 1QF6A 3BYYB 3DDCB 4F8CB 2BKFA 3WA0A 4AS1A 2KQ7A 3L13A 3DBLI 3L16A 4RFBA 1FNUA 3M3JA 1WFYA 3AB5A 1TYGB 3Q2AC 3LB8C 1T3QA 3IBEA 3PHXB 4URKA 1IYFA 1WIAA 4NZLB 3AE1B 2YEPF 3ZRCA 3PSEB 4EZLA 3DVGX 1L0XB 2ZZPB 2FUG1 4EZJA 4KIKB 4TUUA 3B08A 2GMIC 1RM6C 1WXVA 3I5JC 3MHZA 2GBMA 5J17A 5EE1A 1MG4A 1R4NI 1OQYA 3U4EG 1MPEA 3ETRA 2J7QB 3ZIMA 2BPSA 1PFDA 2RDBC 1I4QA 1I35A 1YX6B 4RF0A 4FADA 1YD8U 3PLUA 3QCAA 1MFWA 4AUQC 1C78A 1WR1A 3BINA 4GXBA 3AEGB 3PRPB 1L5PA 1TJEA 2DENB 2WXNA 4D2KA 1F2RC 4WURA 2K1FA 2JX5A 1JWAD 2ACZB 1TGZB 2IY1B 3VVWB 3QHTA 4HJKA 4GN1A 1SIJA 3BVMA 2MSED 4F1SA 1XCTL 4J6IA 1XEEA 4II2B 2WU5B 2KN5A 1SF0A 4BVUC 5JHBA 2IBIB 1WWTA 1M94A 3OJ4B 1RLFA 4HCNB 2GBKA 2E3TA 2LGSA 3AEFB 4MGKE 4OW0A 3R2TA 4BBNC 2KKCA 2RSUA 2AX5A 1VZ7A 1XCQL 1BXTA 4A3OA 4YTMB 5JH5C 2MX2A 4JPSA 4CHKA 1CMXB 1QOFA 4P7IA 3H6NA 3ZRFA 2KX0A 1FO4A 4IM3A 1E8YA 2LRWA 1P3QU 3Q8AA 1I4PA 3NUHB 1WH3A 2KTFA 1XF5L 2JY6A 1FXAA 2V4LA 3Q8CA 3WALA 2INNE 4C00A 4FN2A 2MRPA 3A9JA 4REZA 3SFDB 5I4DA 1KFYB 4HCPB 1X1MA 2NVUI 3ABVB 2NR2A 1ZUD2 3WCQA 2GOWA 3AE6B 4PYUA 4YL8A 2JRHA 4BOSC 1WGKA 1K51A 1HEZE 1I4HA 5CHVC 1TY2A 4K7UA 4USAA 1WYGA 1OQQA 3AULA 2GBNA 1QT9A 1SE4A 1WX7A 1EWYC 3H7PB 5E6NA 1V1OA 3GZNI 5AZHA 4US8A 3RNBC 4HKZE 2KTRA 3AEDB 1WM2A 4MELA 2MBEA 2Y5BB 3PZ8A 4GB9A 1NBFC 5IA7A 1L0VB 1FEHA 5BMHA 2JZ3B 1XQQA 4W9DA 5KHOA 2J52A 3PLVA 3AEEB 3OAWA 5EE9A 2IGHA 2NCNA 2KK8A 3EUB2 2JSVX 4J3OD 2BTEA 1D5XC 4JWSC 1AYFA 3T3OA 2WQYB 3DWGC 5C1ZA 4AP4C 3VH3B 4S0RA 2K25A 3QARA 3OLMD 3FAHA 3IVFA 5T8IA 4PS3A 2PEAA 3PGEA 4KIKA 1FIQA 1WJ6A 3EA6A 3RNEC 1IGDA 1WY8A 3A33B 2KFJA 2TSSA 3FILB 1JW9D 4LNKA 3DHHC 2R61A 2KDMA 3C0RB 2MP2B 4YXDB 1Q1OA 2FCNA 3B2GA 3BZDB 2IGGA 4M8NA 1L2NA 2BQQA 2KACA 1F2RI 1TKYA 3QK0A 4GDKB 2KWUB 2QSDA 2KJ6A 4C4VA 3DBHB 1OTRB 4NQLB 2UYZB 3VRAB 2INPE 2RDHA 1DYQA 3O13A 3MTNB 1OEYJ 1E5WA 1QOGA 1UBQA 2CHZA 1B9RA 1YJIA 4HPMB 4C4VB 4MT5A 3KYDD 3I63C 3MC8A 2C7MB 3PRZA 3CSFA 2IO1B 2RDGA 5IN7A 1J7AA 3UQBA 3KVFB 3P42A 3RZFA 3R66C 3AE5B 3HM6X 1XO3A 3PRMB 1J8CA 3RNAC 2V0GA 2DYBA 1FFVA 4YTPB 1YQBA 3N1YC 2Y5CA 1ESFA 1RFAA 4RCOA 1TT5B 2HTHA 2JT4B 1WZ3A 1GB1A 1ACCA 1F0ZA 2B3AA 1IP9A 1R4NB 3UINB 2OOBB 1PGAA 3GS2A 2UWQA 1XD3B 1JALA 2UU7A 3GZNB 2A5UA 4YSYB 1YJJA 3DVNU 4MACA 2IPKD 3TL5A 2WU2B 3APCA 2DZIA 4CQNA 4NJCA 2N9KA 4TQ1A 1R4MB 4PK1A 2MJDA 4RMAA 4ZRPA 3Q8EA 1SSNA 4NJ6A 2XBBC 1D6EC 2PTLA 4MEMA 2I1JA 3ZJUA 4MSQB 4ZOHC 2AL3A 3K9PB 3CMMB 2ZPYA 4R3DA 2INDC 1YOVB 2MBOA 5GXGB 1JMLA 3B1LX 2G4SA 4HVBA 2WYQA 2O6VD 5CHWA 4WWOA 4ZRQA 3N1XC 1OFFA 1QOAA 2BVCA 2JZPA 4FHKA 1QOBA 1GJZA 4OZCA 4PT5A 2NS5A 1V1PA 1C9FA 1NVID 1E9MA 5FKAC 2BS4B 4GOCA 4LDTB 1HE8A 2G9HD 5D3DA 3VXWA 3ZXVA 4XWWA 5CX3A 2MCNB 4RNAA 1N60A 2RR9A 3WANA 2KMAA 4G50A 4LCDE 2YEPB 3DBHI 1ZXIA 3B0AA 2FBWB 2M56B 1KM7A 3FC4A 1E10A 2SEBD 4N9F4 4LTUA 1NYRA 2NPTB 2IO2B 4IWQA 5IKCM 1N61A 3VRBB 2LZ6A 2K6QA 4K3BA 2N7DA 4LNIA 2KHWB 1MHHE 3UQAA 3MJ5A 4JLCA 4JIOU 1ZKHA 1E8XA 4ZDVA 4IW0A 2FCMA 1Y56A 3NVZA 5HHDG 2LWPA 5AZGA 3A9JB 4DHZB 2R2OA 5KHQA 1JROA 4MDKE 1GOZA 2ZPNA 1I4XA 3H1UA 3ALBA 1D3ZA 2AQ3B 1NENB 1WYWB 4KKJA 1XT9B 3MC9A 4YTNB 1PGBA 2N1WA 1VJKA 1ET6A 2HDEA 2W55A 4F7ZA 2V1YA 4ANUA 2XN9C 4TKNA 1E8ZA 2J0MA 1JWMD 4E74A 4HDOA 1CZPA 2DNFA 2KO3A 4ARCA 2L0FA 2CJNA 4LNNA 1YN5A 4FBJB 2N4FA 4NJ7A 3B9JA 1FNWA 3JW0X 2JF5A 1ZGUB 4OZAA 5LNK1 3URYA 2YVCA 2M0XA 2XNAC 2KX3A 3KW5B 3KUCB 3X0WA 5LLIA 2CU1A 4GDLB 1XLOA 4A55A 2AEHA 1MI0A 3I9V1 2PKOA 4NAMA 3VUWA 4WH4A 3SD5A 4L23A 2VH1A 2CJOA 2BB6A 4S17A 3ZDMC 2M19A 1Y8RC 5CTRC 4KGRA 2Z0DB 4PS8A 5LXIB 2KJRA 3U52E 5CHFA 4GGQA 3RUIB 3DVNV 1OEYA 2ON8A 4HXDA 2LI5A 3KWVA 1C79A 1AWDA 3R2IA 3APDA 3KWLA 1E7PB 3NJTA 3J9CA 4HJGE 3IT4B 3P1MA 2HD5B 5DPWA 1K52A 2WNMA 1IGCA 3NVWA 3KH0A 4DXGA 2C7NB 3EGRA 3M95A 4P6VF 3UIOB 2KLCA 4G11A 1HQRD 4TQ0A 1A5RA 2DAJA 4C56C 2VZKB 3VDZA 3VTVA 2AYOB 5AUIA 4WJQA 3DBRI 1SE9A 4EUTA 3V05A 2ZCCA 1C4PA 5IOIA 2JPHA 1WGYA 1UUPA 5L83A 2D11A 3PO0A 3BY4B 2M17A 3Q69A 1V81A 4A6QA 1M4VA 4HK2A 1K50A 2E6XA 3EFUA 2PJHA 3ZQ4A 3AE7B 1UELA 1N6ZA 2FAZA 3MC0B 3BWUD 1QLBB 1GUAB 4FJVB 5D3IB 3L54A 2DX5B 4PS7A 2DZMA 2C7HA 2XK5B 4A9AA 2ONQA 2X38A 2QHOA 2WXJA 2CKHB 1EF5A 3GB1A 3CF6E 4RF1A 1SXTA 5FR3A 3M62B 3QQ8B 3NZSA 4CYEA 4KGTA 1FXIA 3TEYA 3OJ3A 2NBUA 4LNFA 1AARA 3N32A 1HZ6A 4LK0M 1E7UA 2AL6A 1PQSA 3DBRB 5C23A 1VZ6A 3N30A 1J0GA 3ZYYX 2BYTA 1UF0A 5D2MB 3NG0A 2G1EA 1YQ4B 1XXGA 3TCAA 2C5LC 4AJYB 5E6OA 3ZXRA 1GPXA 4IKGA 2G3QB 1Z2MA 3KLSX 4C7ZA 5J18A 1JWUD 1V9JA 3R3MA 2PIAA 2ZNVB 2QIEB 2WXPA 2MJEA 2JWUA 2QJLA 4KZ0A 3IAS1 1Z5SB 3P4PB 4DXFA 4MM3A 1KTKA 4DDGD 4HRSA 4DHJD 2NPTA 3PZDA 3ZNID 2KDFB 2WXMA 3DBLB 1YIWA 1IUEA 3AECB 2WXGA 1ZXHA 4I6LB 1FCLA 2O6VB 4A20A 2WX1A 1WM3A 3W1SA 2DYMA 5G55A 5D94A 4AWJA 3GE8C 3JSVA 1WXMA 1HTOA 2KTRB 2CR5A 3PS6A 4G3XB 4O1NA 1TS5A 2JXXA 4LJPB 2J0KA 3A9KA 1L0YB 1P7EA 4EOYA 1EF1A 1UZXB 1J7BA 5C3JB 1GNUA 1V5OA 2PE6B 2M0AA 3RNFC 4N6EB 2K8CA 4TMAB 1KLGD 3RNGC 4DXAB 4RM9A 2K22A 4WJPA 4P16A 4FLHA 3NS1A 1E8WA 3EECA 4DQOC 2O6VA 1WMHA 1PUTA 3RPFC 1LQBA 4IUMB 1FPYA 1CK1A 1DOYA 2PVOD 4ZHPA 4OVZA 4ITKA 4M02A 1DOXA 1PDXA 4NY0A 3QX1A 1WMHB 2KVZA 1P98A 1BMLC 2N1VA 4ICVA 4XGAB 3A4RA 2MLBA 4RGNA 3ZJVA 1V8CA 2JWZA 2OHFA 2AQ2B 2H89B 2WDTB 2MJ3A 2D10A 1C4AA 4WAFA 5D6JB 3CWIA 3JVZX 5E6JA 3RZWC 2LGXA 3IHPC 2LVOA 5HKHA 1T6BX 1ET9A 2JUOA 1OQRA 3ZNHB 1D5MC 4GDKA 2WS3B 1ZP0B 4BOZB 2L05A 1YJ1A 1EU3A 3SR6A 2J0JA 3PT2B 5BO4B 2WGSA 4W9JA 1EUVB 4RGTA 2LD9A 5BMIA 2BKRB 1JWBD 4IWPA 5H8YE 3I3TB 4W9CA 4K7SA 5EE0A 1RRBA 4IC7B 3Q3NC 1LM8B 1ZPSA 1UGJA 2KVRA 4IM2A 1FM0D 4W9HA 2JVCA 5DPTA 1WJNA 4I6PA 4ICUA 5BMGA 3U30A 1CQVA 3GOEA 4ANWA 4CO7A 3W1YA 2DWQA 3VUXA 1TTNA 5H92C 2L00B 1NI3A 2EKEC 3P4QB 2BYFA 2KMMA 2D07B 3Q8FA 2FIDA 2DZKA 2IO0B 3DOWA 3QAQA 3HVZA 3L0WB 2V9HA 4EZKA 4AOFA 3U2SC 2M8SA 2J53A 3QIJA 1J19A 4ASWC 2FNJB 2LMCA 4W9EA 2DAFA 3RNCC 5EDSA 2LXAA 3P2BA 5JHAA 5AZFA 1Q10A 3VTUA 3DPDA 3ZTDA 1FXTB 2IJ0A 2O2VA 3HVDA 2KN4A 3IFWB 5DPRA 1L4ZB 1H4RA 1I4RA 3ZDTA 5EE3A 2EELA 2BYVE 1ROEA 1K53A 1WR6E 1WJ4A 3ZUNA 1FMAD 3WAPA 2KC1A 5IO9A 4JGHB 1C1YB 1E6EB 1VDVA 4P1BC 4WIPA 3KQ4A 2LJ5A 3S2AA 2IYDB 4N59A 1ZDXA 2FIFA 2L52A 3P4SB 3AU5A 4HKQA 3GE3C 3UF8A 2Z59B 4FA6A 1ISNA 4L1BA 1S3SG 1V1PB 2H88B 1MG8A 1T0SC 2G4DB 2GBRA 2ZW0A 2NMQA 4HEA1 3VH4B 1SE2A 2SAKA 3EFCA 4NPNA 1IPGA 2K5PA 2RPVA 5BYQA 2W9NA 3VQIA 2V3NA 3V62A 2KWVB 3UIPB 1V5TA 4MSMB 1SJED 1NYQA 4EE2A 2JYTA 4P1CC 1A70A 1I7HA 3N1ZC 3QC8B 5TR5A 3L10B 2KC2A 3H8HA 5DCNA 1UWXA 2GRIA 4BBNF 3SDLC 2EMSA 3W2DA 2D3AA 4WWNA 3ZGZA 3V6CB 3C8YA 4OHJA 4MJSB 3PHWB 5JZEB 4LLGM 4KVGB 4OVUA 2WXHA 4LJOB 2VH2A 3VR8B 3AE9B 3JSVB 4KX6B 3RMKC 3W9CB 4A90A 3PVLA 4XE0A 4XDDA 4JWUC 1WZ0A 1VRAB 3AV8A 3ZTCA 2N7EA 3KYCD 3T9LA 1KOTA 1FCCC 2L1AA 2FUHB 2KNBA 5HG2A 2KD0A 4IM0A 1AW7A 2BS3B 4DHZE 2LEKA 3AE8B 3WAOA 4MH0E 3BVZA 4ZYSA 2DLBA 3LXFA 1JRPA 4E71A 2N9LA 1J7CA 1TZ1A 4IOIE 2I2YA 1STEA 2BWFA 2LJIA 4FJYA 3T8MA 1V86A 3ZW3A 3VTWA 2DZJA 3VAWA 1R4MI 4BAXA 1TZOA 5G5HA 1LGRA 2CU3A 4HPLB 1NI2A 3DCGA 2OJWA 4GSWA 3D32A 2Y3AA 1VCBA 3NZUA 2M1MA 4B0EA 1P0RA 5JXVA 2PMVA 2BW2A 4NNJB 1C3TA 2QC8A 4MGYE 2IGDA 2MQJA 4YWGG 4WWPA 2K0PA 2JRIB 1YN4A 1FNVA 4RH6A 2NTTA 1UNSA 1I42A 2NTSA 1QKZA 4JL9A 2BS2B 3SFEB 2GI9A 2D2QA 3Q3JA 3RULA 1E7VA 3CIRB 1MVKA 1KLUD 5L95C 3IXSA 3AN1A 4B95A 3P63A 4IWOA 1PGXA 3P4RB 1U4AA 2WLBA 3O65B 2HJ8A 2REXA 2V4IB 1MJDA 3K9OB 2K8HA 5IAAC 2DBYA 2FCQA 2QMTA 2V3PA 4N58A 3A4SC 1SB3C 1V2YA 3AE2B 1MHXA 3ML8A 4ZRKA 3LYYA 1YX5B 3DHGC 2EMTA 3QA8A 3HHMA 2W82A 4KSKC 3LJ3A 3C19A 1WE7A 3PTFC 4TV3A 2WXQA 1V80A 2MA9B 4AQ7A 4X57B 3Q14C 3QJZA 2LUEA 2K3UA 2JYEA 4LDTD 5C2TB 5BYRA 5E6PA 3U8ZA 3FILA 3Q6BA 1ZE3D 1EWCA 2MHJA 4LNOA 4M0WA 5LXHA 4H2AA 3L4PA 4EFOA 2Z8LA 4KKIA 2IO3B 5FR6A 3UI3A 2OEDA 4DDID 2DYOA 1SEBD 2BBCA 3KUDB 4ACFA 1L6VA 2YLMA 3VR9B 1V6EA 2QCZA 3OG5A 1G6JA 3MHSD 1HXYD 1R7SA 4KSLC 2LRUA 2JZZA 1KH0A 4B6WA 2K39A 4A8XC 3BIID 2KQSA 4MGZE 4HPPA 2PVGC 1GG3A 4XYCA 2KFKB 3ENEA 4QAYA 3IAM1 4ANXA 1UBIA 2L7RA 4XWTA 1GC6A 3R7RA 1IBXB 2KOXA 1BT0A 2CHWA 3AMZA 4DHJB 1P7FA 1JCKB 4RGOS 2KZRA 2KYWA 1N5XA 4M8MA 2RMMA 2LFIA 2WXKA 3ML9A 5HI1A 4IG7B 1GB4A 5DPSA 2V3SA 2W54A 2LUMA 4K7WA 3T3NA 3ZNGC 3ZO5B 2PE9A 1N62A 1QQRA 3TIXA 4BKGA 1TIFA 2ZW1A 1WX8A 3AE3B 2L76A 4K81A 2KLGA 4GIVA 3V6EB 1XLQA 1YMHE 4TSSA 2ZEQA 2JU6X 3EHVA 3VHTC 2KMCA 1UGMA 4MJSA 1VLBA 2KWDA 1YN3A 1JRUA 1TS2A 2CHXA 3OWEB 4XDCA 4E3CA 1L4DB 2WXIA 2LVPA 2R2QA 2KANA 3ONSA 4ANVA 2PPHA 4WJNA 2N9XA 4W9KA 3AE4B 3DVGY 4ARIA 2BB5A 3IT6B 4AJWA 1RYJA 2ICIA 2EKIA 3KUZA 1N5WA 3BK2A 4UDUC 1YNTE 2KAJA 3HRDD 3HM3A 2WHIA 1T0QC 5FK9C 3AEAB 1P1AA 3B2FA 2WDVB 3Q3MC 4G0NB 1VR9A 2I38A 2KDIA 4KDIC 5D7GA 1SJHD 2IY0B 3BVGA 3APFA 1RAXA 3LDZE 4BKSD 3TEWA 4DWFA 1WF9A 3AEBB 3MFGA 4ZRJA 2HTME 1XLNA 4MGIE 1I4GA 3HIZA 2BGFA 3AI5A 4NAWA 4II3B 2N7JA 1E90A 2ZCBA 3PREA 3H7PA 1KF6B 1C77A 2LGDA 1EO6A 3CSTA 2BF8B 4KZCA 2QEJC 3PZ7A 1UD7A 2PLPA 2C9WB 4US9A 3HUIA 1H8CA 2MBQA 3SEBA 2BYEA 4GMVA 5HFYA 1S1QB 2K8BA 3MJWA 3N20C 2AQ1B 2WX0A 1WX9A 4WJOA 2KDEB 2NBWB 3PPAA 2Y5PA 4IDIA 1T0RC 1C76A 1KLVA 1UH6A 2KXJA 4XZ4A 2W3SA 4XX5A 2HJ1A 3W1SC 1NDDA 2BWES 2WP9B 3N3KB 3U7ZA 2L8JA 1P9DU 3NVYA 4YSZB 4W9GA 1WRDB 1ZDVA 2GLSA 3MP9A 4M00A 1NEKB 3U7DA 4Q2JA 2RD0A 1GAQB 3V3XA 3VUYA 3AU4A 3ZKJC 1TY0A 1KJTA 3RN9C 1Q5WB 4I6NB 3SHQA 4K1RB 2D3CA 1WXQA 2MP2A 1HTQA 2WXFA 4BZAA 2LGIA 3EC8A 2K6DB 3IG3A 3RFZB 3A1QB 1SBBB 1TKEA 3Q3FA 1L6UA 2LXCA 2VZKD 3W5VB 1FFUA 1PYWD 4NQKE 1F1HA 2X8XX 4ZRIA 1SGHA 2ZVNA 4W9IA 4FXCA 1ZW7A 4EKUA 1SIFA 2D3BA 4MH8A 1WI0A 3VFKA 1JQ4A 1WGDA 5J2RA 3BYTB 2WXRA 3L17A 1FRDA 4KGSA 2QILA 3RCZA 1TBEA 2KFKA 3NS8A 4FHJA 3TEXA 3RD2A 1UWMA 3WIMA 1RFKA 3A1QA 3AH7A 3NY5A 3RI7C 1FRRA 3X23A 1F52A 2NBVB 2GBJA 3R7QA 1WGRA 2L0TA 2ZJDA 3NOBA 4DK5A 1GC7A 1YQ3B 2N9EB 1IBXA 3H9DA 4MM3B 2MBBB 2K9XA 2MW5A 1VD2A 1LXDA 1L7YA 2J42A 2WWZA 2W3RA 4WWMA 1WJUA 4C80A 3TUOA 1OGWA 5GMVA 2L83A 2LVQA 2M4NA 3E9SA 5TSSA 4WQMA 3DHIC 3WAMA 4A3PA 4BFRA 3RT3B 2L3ZA 3ZVVA 4K3CA 1D4BA 4B0MA 1D5ZC 2ZNVC 2GB1A 4HWIB 1K8RB 3TJPA 2INCC 1EU4A 5BYSA 4JQWC 2XK5A 2WDRB 2JXTA 2OJRA 3ZLZA 4WQOB 4PYZA 3DWMA 3AXCA 1BUIC 1DOIA 4RM8A 4HROA 3PV1A 2MEKA 4HDQA 2I1KA 2WXLA 1WE6A 3SU8X 1WRIA 4W9FA 2N9PC 1HZ5A 2FE8A 2HE7A 1T5XD 2D3GA 3V60A 1SE3A 3M63B 3TMPB 3DBSA 4KV2A 4BKTA 5IP4D 3N9YC 3UGBB 4JE3B 5G5GA 3H7SA 2KQ4X 2DHZA 1LFDA 2WDQB 2LHEA 4GLSC 1WXSA 3TEZA 3JYUA 2FCSA 1AN8A 1WXAA 3DQVA 2ZVOA
chains in the Genus database with same CATH topology
2IO3B 1EF1A 3ECIA 5FR6A 1UZXB 2B3AA 4DDID 4B9KA 2DYOA 1IP9A 1GNUA 3KUDB 1V5OA 2PE6B 2XEWA 4XC2A 3UINB 2OOBB 2YLMA 2K8CA 4FULA 1V6EA 1WGHA 2KDBA 4DXAB 1G6JA 4RM9A 2UWQA 4WJPA 3MHSD 1XD3B 4FLHA 3TBLD 4KSLC 1E8WA 2A5UA 3EECA 2LRUA 2JZZA 3DVNU 4B6WA 2AWTA 2O6VA 2RGFA 1WMHA 1LQBA 2G45B 3TL5A 2K39A 4IUMB 4KDLB 1Q0WB 3APCA 1T0YA 3HK0A 2KQSA 4MGZE 2DZIA 4NAWB 2C60A 4NY0A 3QX1A 1GG3A 4TQ1A 4W9LA 2MBHA 1WMHB 2KFKB 3ENEA 4RMAA 1P98A 2N1VA 4ICVA 4ZYNA 3A4RA 4NJ6A 2MLBA 4ANXA 2LGYA 1UBIA 2XBBC 2JWZA 4M0WB 5G2NA 2WDTB 1F9JA 2L7RA 2D10A 2MWSB 4MEMA 1GC6A 5AEKB 2I1JA 4MSQB 5D6JB 3JVZX 2AL3A 3K9PB 3V61A 3RZWC 3R7RA 3CMMB 2LGXA 3A9KB 2KOXA 3IHPC 1BT0A 2LVOA 2ZPYA 2CHWA 5HKHA 2MBOA 2JUOA 4DHJB 3L08A 3ZNHB 3B1LX 2G4SA 4GDKA 2IZVB 4WAAA 2WYQA 4HVBA 2O6VD 2KJHB 4BOZB 2L05A 1YJ1A 4WWOA 5CHWA 2KZRA 1V49A 2A4ZA 4M8MA 2J0JA 4FHKA 3PT2B 5BO4B 3RYTA 2RPQA 3ML9A 1GJZA 4W9JA 2ASQA 2NS5A 4EEWA 4IG7B 5DPSA 2V3SA 1EUVB 2LD9A 4GU2A 4HLEA 2VRRB 4K7WA 2BKRB 3NHEB 3ZNGC 3ZO5B 4GOCA 2PE9A 4OVVA 4LDTB 1HE8A 4IWPA 4BKSA 3TIXA 4DBGA 4BKGA 1QZEA 3I3TB 1WX8A 4W9CA 2CS4A 2L76A 4GDLA 4K7SA 2Z0EB 4K81A 3VXWA 1RRBA 2KLGA 4GIVA 4IC7B 3V6EB 2LASA 1LM8B 2O2VB 5CX3A 3QWZB 2ZEQA 3ZNZB 3EHVA 2MCNB 3VHTC 1WGGA 2KVRA 4FJZA 2KWCA 2KMCA 4IM2A 2RR9A 3WANA 1UGMA 4MJSA 4W9HA 2JVCA 2KMAA 1WJNA 4G50A 4I6PA 4LCDE 4ICUA 5DPTA 3DBHI 3B0AA 3U30A 1JRUA 3GOEA 4ANWA 4CO7A 3W1YA 1KM7A 3DDCB 3VUXA 2CHXA 4F8CB 4N9F4 2BKFA 1TTNA 3WA0A 2L00B 2KQ7A 2EKEC 2NPTB 2IO2B 3L13A 4IWQA 4E3CA 2BYFA 2D07B 3DBLI 3L16A 2FIDA 2LVPA 2DZKA 2IO0B 2KANA 2R2QA 3ONSA 3DOWA 3M3JA 4ANVA 1WFYA 2LZ6A 3QAQA 2K6QA 2PPHA 3L0WB 4WJNA 2N7DA 4EZKA 2KHWB 4AOFA 2N9XA 3IBEA 3PHXB 3UQAA 2M8SA 4JLCA 4W9KA 4URKA 1IYFA 1WIAA 3QIJA 4JIOU 1J19A 3DVGY 1ZKHA 1E8XA 3ZRCA 3PSEB 4IW0A 4EZLA 2FCMA 4ASWC 4ZDVA 3DVGX 2FNJB 4W9EA 2LWPA 4AJWA 2ZZPB 4EZJA 2DAFA 4KIKB 3KUZA 4TUUA 5AZGA 5EDSA 2LXAA 3P2BA 3A9JB 3B08A 2GMIC 4DHZB 2R2OA 5KHQA 1WXVA 4MDKE 5JHAA 5AZFA 3VTUA 3DPDA 3ZTDA 1FXTB 2O2VA 2ZPNA 3HM3A 2GBMA 3H1UA 5J17A 3ALBA 3IFWB 5DPRA 1D3ZA 1H4RA 1WYWB 3ZDTA 2BYVE 1R4NI 1OQYA 1XT9B 1WR6E 1WJ4A 3ZUNA 1P1AA 3WAPA 2N1WA 4G0NB 2KC1A 2KDIA 2J7QB 3ZIMA 4KDIC 5D7GA 4JGHB 4F7ZA 1C1YB 2IY0B 2V1YA 2BPSA 3APFA 1RAXA 1I35A 1YX6B 3LDZE 4BKSD 4ANUA 4FADA 4DWFA 1YD8U 1WF9A 3PLUA 3QCAA 4ZRJA 4TKNA 4AUQC 1E8ZA 2LJ5A 3S2AA 1WR1A 2IYDB 2J0MA 3BINA 4GXBA 4MGIE 3HIZA 2BGFA 3AI5A 4E74A 3PRPB 4HDOA 2FIFA 2KO3A 4NAWA 2L0FA 3AU5A 4II3B 1E90A 2DENB 2ZCBA 4FBJB 3UF8A 2Z59B 4FA6A 1ISNA 2N4FA 4NJ7A 3PREA 3H7PA 2K1FA 1S3SG 3JW0X 2JF5A 1ZGUB 2LGDA 1EO6A 3CSTA 2BF8B 1TGZB 2YVCA 2IY1B 2M0XA 4KZCA 1MG8A 3VVWB 3QHTA 2G4DB 2GBRA 2KX3A 4HJKA 1UD7A 4GN1A 3KW5B 3KUCB 3X0WA 5LLIA 2C9WB 2CU1A 4GDLB 3VH4B 1H8CA 2AEHA 2MSED 4F1SA 1IPGA 4NPNA 2W9NA 4J6IA 3VQIA 2MBQA 4II2B 2BYEA 4GMVA 3V62A 3VUWA 1S1QB 3SD5A 2KN5A 2KWVB 3UIPB 4BVUC 1V5TA 2K8BA 4MSMB 3MJWA 5JHBA 3ZDMC 2WX0A 2IBIB 1Y8RC 1M94A 3OJ4B 1RLFA 1WX9A 4WJOA 2KDEB 2GBKA 2NBWB 3PPAA 4HCNB 5CTRC 3QC8B 2Z0DB 4PS8A 5LXIB 2KJRA 5TR5A 4MGKE 3L10B 1KLVA 2KC2A 1UH6A 5CHFA 2KXJA 4GGQA 4XZ4A 5DCNA 3RUIB 4BBNC 2KKCA 2RSUA 3DVNV 4XX5A 3W1SC 4BBNF 1NDDA 2BWES 3N3KB 1OEYA 4A3OA 2L8JA 1P9DU 5JH5C 4HXDA 2MX2A 2LI5A 4W9GA 3SDLC 4CHKA 2EMSA 1CMXB 3APDA 1WRDB 4P7IA 3H6NA 3ZRFA 2KX0A 4WWNA 3U7DA 4IM3A 2RD0A 1E8YA 3VUYA 2LRWA 3V6CB 5DPWA 3AU4A 2HD5B 3ZKJC 1P3QU 4MJSB 3PHWB 5JZEB 1WH3A 2KTFA 1KJTA 2C7NB 3KH0A 4KVGB 4OVUA 1Q5WB 4I6NB 3SHQA 4LJOB 2JY6A 3M95A 2V4LA 4K1RB 3WALA 3JSVB 2MP2A 3UIOB 4FN2A 2KLCA 3PVLA 2MRPA 3A9JA 4G11A 1WZ0A 4HCPB 4TQ0A 1X1MA 3EC8A 2K6DB 1A5RA 2NVUI 3IG3A 2DAJA 2NR2A 3ZTCA 3A1QB 2N7EA 2GOWA 3KYCD 4PYUA 3T9LA 1KOTA 3VDZA 2FUHB 2KNBA 3Q3FA 3VTVA 2AYOB 4YL8A 2KD0A 2LXCA 4IM0A 3DBRI 4WJQA 1SE9A 2JRHA 4NQKE 4BOSC 4EUTA 2ZCCA 5L83A 2JPHA 1WGYA 5CHVC 4ZRIA 1SGHA 2ZVNA 4W9IA 4DHZE 2D11A 3WAOA 1ZW7A 3BY4B 2M17A 4K7UA 4EKUA 1SIFA 1V81A 4MH0E 4LJPB 3AULA 4HK2A 2GBNA 4EOYA 4E71A 1WX7A 1WI0A 3EFUA 3VFKA 1TZ1A 2PJHA 3H7PB 5E6NA 3GZNI 5AZHA 1WGDA 5J2RA 1UELA 2BWFA 3L17A 2FAZA 2KTRA 4FJYA 3T8MA 1WM2A 1V86A 4MELA 3ZW3A 3RCZA 3VTWA 1GUAB 2DZJA 1TBEA 2MBEA 2Y5BB 2KFKA 4FJVB 3NS8A 3VAWA 4FHJA 3RD2A 1R4MI 3L54A 2DX5B 3WIMA 4PS7A 3A1QA 2DZMA 2C7HA 4GB9A 1NBFC 5IA7A 2XK5B 3NY5A 2JZ3B 3X23A 4HPLB 1XQQA 2NBVB 2GBJA 2QHOA 4W9DA 3R7QA 5KHOA 1NI2A 3PLVA 3OAWA 1WGRA 2CKHB 1EF5A 2L0TA 2ZJDA 3DCGA 3NOBA 4DK5A 4GSWA 3D32A 2NCNA 2KK8A 1GC7A 1VCBA 3CF6E 2M1MA 3NZUA 2N9EB 3M62B 1P0RA 3QQ8B 3NZSA 3H9DA 2MBBB 4CYEA 4NNJB 2MW5A 3OJ3A 2NBUA 1C3TA 1AARA 4MGYE 3N32A 2MQJA 1E7UA 2AL6A 4WWPA 1VD2A 1LXDA 1L7YA 2WWZA 1PQSA 1WJUA 2JRIB 1OGWA 5C23A 5C1ZA 5GMVA 2LVQA 4AP4C 3VH3B 1I42A 3N30A 2M4NA 1J0GA 2K25A 3QARA 3OLMD 3IVFA 4JL9A 3WAMA 4PS3A 4A3PA 4BFRA 2D2QA 2PEAA 3Q3JA 3PGEA 5D2MB 4KIKA 1WJ6A 3RT3B 3RULA 2L3ZA 3ZVVA 1E7VA 1WY8A 3A33B 2KFJA 5L95C 2ZNVC 3TCAA 2C5LC 4B95A 4IWOA 4AJYB 5E6OA 1U4AA 3O65B 4HWIB 1K8RB 3TJPA 2G3QB 1Z2MA 3C0RB 2MP2B 2HJ8A 2REXA 4JQWC 1Q1OA 5J18A 2XK5A 2FCNA 1V9JA 3K9OB 3R3MA 2K8HA 2ZNVB 2OJRA 3ZLZA 5IAAC 4WQOB 4M8NA 1L2NA 2FCQA 4PYZA 3AXCA 3A4SC 3QK0A 4RM8A 4KZ0A 4GDKB 1Z5SB 2KWUB 3PV1A 4HDQA 1V2YA 2I1KA 2KJ6A 1WE6A 4ZRKA 3ML8A 1OTRB 4NQLB 3SU8X 2UYZB 4MM3A 1YX5B 2EMTA 3QA8A 4DDGD 4DHJD 3HHMA 3MTNB 2NPTA 3PZDA 1OEYJ 4W9FA 1E5WA 4KSKC 2N9PC 1UBQA 2CHZA 3ZNID 2KDFB 3LJ3A 2HE7A 1WE7A 4HPMB 3PTFC 4TV3A 2D3GA 1YIWA 1V80A 3KYDD 2MA9B 3M63B 3V60A 4I6LB 2C7MB 3PRZA 3CSFA 2O6VB 3TMPB 2IO1B 3DBSA 4KV2A 4BKTA 4A20A 2WX1A 3UGBB 1WM3A 3KVFB 3UQBA 3RZFA 2DYMA 4X57B 3R66C 5G55A 3W1SA 3H7SA 3HM6X 5D94A 4AWJA 3PRMB 3JSVA 1WXMA 2DHZA 3QJZA 1J8CA 2LUEA 2DYBA 1LFDA 4LDTD 2KTRB 2CR5A 5E6PA 3U8ZA 1YQBA 1WXSA 3PS6A 5LXHA 1RFAA 4G3XB 2FCSA 3JYUA 1WXAA 2HTHA 2JT4B 2JXXA 4EFOA 1WZ3A 3DQVA 2ZVOA 2J0KA 3A9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO3 B;  1EF1 A;  3ECI A;  5FR6 A;  1UZX B;  2B3A A;  4DDI D;  4B9K A;  2DYO A;  1IP9 A;  1GNU A;  3KUD B;  1V5O A;  2PE6 B;  2XEW A;  4XC2 A;  3UIN B;  2OOB B;  2YLM A;  2K8C A;  4FUL A;  1V6E A;  1WGH A;  2KDB A;  4DXA B;  1G6J A;  4RM9 A;  2UWQ A;  4WJP A;  3MHS D;  1XD3 B;  4FLH A;  3TBL D;  4KSL C;  1E8W A;  2A5U A;  3EEC A;  2LRU A;  2JZZ A;  3DVN U;  4B6W A;  2AWT A;  2O6V A;  2RGF A;  1WMH A;  1LQB A;  2G45 B;  3TL5 A;  2K39 A;  4IUM B;  4KDL B;  1Q0W B;  3APC A;  1T0Y A;  3HK0 A;  2KQS A;  4MGZ E;  2DZI A;  4NAW B;  2C60 A;  4NY0 A;  3QX1 A;  1GG3 A;  4TQ1 A;  4W9L A;  2MBH A;  1WMH B;  2KFK B;  3ENE A;  4RMA A;  1P98 A;  2N1V A;  4ICV A;  4ZYN A;  3A4R A;  4NJ6 A;  2MLB A;  4ANX A;  2LGY A;  1UBI A;  2XBB C;  2JWZ A;  4M0W B;  5G2N A;  2WDT B;  1F9J A;  2L7R A;  2D10 A;  2MWS B;  4MEM A;  1GC6 A;  5AEK B;  2I1J A;  4MSQ B;  5D6J B;  3JVZ X;  2AL3 A;  3K9P B;  3V61 A;  3RZW C;  3R7R A;  3CMM B;  2LGX A;  3A9K B;  2KOX A;  3IHP C;  1BT0 A;  2LVO A;  2ZPY A;  2CHW A;  5HKH A;  2MBO A;  2JUO A;  4DHJ B;  3L08 A;  3ZNH B;  3B1L X;  2G4S A;  4GDK A;  2IZV B;  4WAA A;  2WYQ A;  4HVB A;  2O6V D;  2KJH B;  4BOZ B;  2L05 A;  1YJ1 A;  4WWO A;  5CHW A;  2KZR A;  1V49 A;  2A4Z A;  4M8M A;  2J0J A;  4FHK A;  3PT2 B;  5BO4 B;  3RYT A;  2RPQ A;  3ML9 A;  1GJZ A;  4W9J A;  2ASQ A;  2NS5 A;  4EEW A;  4IG7 B;  5DPS A;  2V3S A;  1EUV B;  2LD9 A;  4GU2 A;  4HLE A;  2VRR B;  4K7W A;  2BKR B;  3NHE B;  3ZNG C;  3ZO5 B;  4GOC A;  2PE9 A;  4OVV A;  4LDT B;  1HE8 A;  4IWP A;  4BKS A;  3TIX A;  4DBG A;  4BKG A;  1QZE A;  3I3T B;  1WX8 A;  4W9C A;  2CS4 A;  2L76 A;  4GDL A;  4K7S A;  2Z0E B;  4K81 A;  3VXW A;  1RRB A;  2KLG A;  4GIV A;  4IC7 B;  3V6E B;  2LAS A;  1LM8 B;  2O2V B;  5CX3 A;  3QWZ B;  2ZEQ A;  3ZNZ B;  3EHV A;  2MCN B;  3VHT C;  1WGG A;  2KVR A;  4FJZ A;  2KWC A;  2KMC A;  4IM2 A;  2RR9 A;  3WAN A;  1UGM A;  4MJS A;  4W9H A;  2JVC A;  2KMA A;  1WJN A;  4G50 A;  4I6P A;  4LCD E;  4ICU A;  5DPT A;  3DBH I;  3B0A A;  3U30 A;  1JRU A;  3GOE A;  4ANW A;  4CO7 A;  3W1Y A;  1KM7 A;  3DDC B;  3VUX A;  2CHX A;  4F8C B;  4N9F 4;  2BKF A;  1TTN A;  3WA0 A;  2L00 B;  2KQ7 A;  2EKE C;  2NPT B;  2IO2 B;  3L13 A;  4IWQ A;  4E3C A;  2BYF A;  2D07 B;  3DBL I;  3L16 A;  2FID A;  2LVP A;  2DZK A;  2IO0 B;  2KAN A;  2R2Q A;  3ONS A;  3DOW A;  3M3J A;  4ANV A;  1WFY A;  2LZ6 A;  3QAQ A;  2K6Q A;  2PPH A;  3L0W B;  4WJN A;  2N7D A;  4EZK A;  2KHW B;  4AOF A;  2N9X A;  3IBE A;  3PHX B;  3UQA A;  2M8S A;  4JLC A;  4W9K A;  4URK A;  1IYF A;  1WIA A;  3QIJ A;  4JIO U;  1J19 A;  3DVG Y;  1ZKH A;  1E8X A;  3ZRC A;  3PSE B;  4IW0 A;  4EZL A;  2FCM A;  4ASW C;  4ZDV A;  3DVG X;  2FNJ B;  4W9E A;  2LWP A;  4AJW A;  2ZZP B;  4EZJ A;  2DAF A;  4KIK B;  3KUZ A;  4TUU A;  5AZG A;  5EDS A;  2LXA A;  3P2B A;  3A9J B;  3B08 A;  2GMI C;  4DHZ B;  2R2O A;  5KHQ A;  1WXV A;  4MDK E;  5JHA A;  5AZF A;  3VTU A;  3DPD A;  3ZTD A;  1FXT B;  2O2V A;  2ZPN A;  3HM3 A;  2GBM A;  3H1U A;  5J17 A;  3ALB A;  3IFW B;  5DPR A;  1D3Z A;  1H4R A;  1WYW B;  3ZDT A;  2BYV E;  1R4N I;  1OQY A;  1XT9 B;  1WR6 E;  1WJ4 A;  3ZUN A;  1P1A A;  3WAP A;  2N1W A;  4G0N B;  2KC1 A;  2KDI A;  2J7Q B;  3ZIM A;  4KDI C;  5D7G A;  4JGH B;  4F7Z A;  1C1Y B;  2IY0 B;  2V1Y A;  2BPS A;  3APF A;  1RAX A;  1I35 A;  1YX6 B;  3LDZ E;  4BKS D;  4ANU A;  4FAD A;  4DWF A;  1YD8 U;  1WF9 A;  3PLU A;  3QCA A;  4ZRJ A;  4TKN A;  4AUQ C;  1E8Z A;  2LJ5 A;  3S2A A;  1WR1 A;  2IYD B;  2J0M A;  3BIN A;  4GXB A;  4MGI E;  3HIZ A;  2BGF A;  3AI5 A;  4E74 A;  3PRP B;  4HDO A;  2FIF A;  2KO3 A;  4NAW A;  2L0F A;  3AU5 A;  4II3 B;  1E90 A;  2DEN B;  2ZCB A;  4FBJ B;  3UF8 A;  2Z59 B;  4FA6 A;  1ISN A;  2N4F A;  4NJ7 A;  3PRE A;  3H7P A;  2K1F A;  1S3S G;  3JW0 X;  2JF5 A;  1ZGU B;  2LGD A;  1EO6 A;  3CST A;  2BF8 B;  1TGZ B;  2YVC A;  2IY1 B;  2M0X A;  4KZC A;  1MG8 A;  3VVW B;  3QHT A;  2G4D B;  2GBR A;  2KX3 A;  4HJK A;  1UD7 A;  4GN1 A;  3KW5 B;  3KUC B;  3X0W A;  5LLI A;  2C9W B;  2CU1 A;  4GDL B;  3VH4 B;  1H8C A;  2AEH A;  2MSE D;  4F1S A;  1IPG A;  4NPN A;  2W9N A;  4J6I A;  3VQI A;  2MBQ A;  4II2 B;  2BYE A;  4GMV A;  3V62 A;  3VUW A;  1S1Q B;  3SD5 A;  2KN5 A;  2KWV B;  3UIP B;  4BVU C;  1V5T A;  2K8B A;  4MSM B;  3MJW A;  5JHB A;  3ZDM C;  2WX0 A;  2IBI B;  1Y8R C;  1M94 A;  3OJ4 B;  1RLF A;  1WX9 A;  4WJO A;  2KDE B;  2GBK A;  2NBW B;  3PPA A;  4HCN B;  5CTR C;  3QC8 B;  2Z0D B;  4PS8 A;  5LXI B;  2KJR A;  5TR5 A;  4MGK E;  3L10 B;  1KLV A;  2KC2 A;  1UH6 A;  5CHF A;  2KXJ A;  4GGQ A;  4XZ4 A;  5DCN A;  3RUI B;  4BBN C;  2KKC A;  2RSU A;  3DVN V;  4XX5 A;  3W1S C;  4BBN F;  1NDD A;  2BWE S;  3N3K B;  1OEY A;  4A3O A;  2L8J A;  1P9D U;  5JH5 C;  4HXD A;  2MX2 A;  2LI5 A;  4W9G A;  3SDL C;  4CHK A;  2EMS A;  1CMX B;  3APD A;  1WRD B;  4P7I A;  3H6N A;  3ZRF A;  2KX0 A;  4WWN A;  3U7D A;  4IM3 A;  2RD0 A;  1E8Y A;  3VUY A;  2LRW A;  3V6C B;  5DPW A;  3AU4 A;  2HD5 B;  3ZKJ C;  1P3Q U;  4MJS B;  3PHW B;  5JZE B;  1WH3 A;  2KTF A;  1KJT A;  2C7N B;  3KH0 A;  4KVG B;  4OVU A;  1Q5W B;  4I6N B;  3SHQ A;  4LJO B;  2JY6 A;  3M95 A;  2V4L A;  4K1R B;  3WAL A;  3JSV B;  2MP2 A;  3UIO B;  4FN2 A;  2KLC A;  3PVL A;  2MRP A;  3A9J A;  4G11 A;  1WZ0 A;  4HCP B;  4TQ0 A;  1X1M A;  3EC8 A;  2K6D B;  1A5R A;  2NVU I;  3IG3 A;  2DAJ A;  2NR2 A;  3ZTC A;  3A1Q B;  2N7E A;  2GOW A;  3KYC D;  4PYU A;  3T9L A;  1KOT A;  3VDZ A;  2FUH B;  2KNB A;  3Q3F A;  3VTV A;  2AYO B;  4YL8 A;  2KD0 A;  2LXC A;  4IM0 A;  3DBR I;  4WJQ A;  1SE9 A;  2JRH A;  4NQK E;  4BOS C;  4EUT A;  2ZCC A;  5L83 A;  2JPH A;  1WGY A;  5CHV C;  4ZRI A;  1SGH A;  2ZVN A;  4W9I A;  4DHZ E;  2D11 A;  3WAO A;  1ZW7 A;  3BY4 B;  2M17 A;  4K7U A;  4EKU A;  1SIF A;  1V81 A;  4MH0 E;  4LJP B;  3AUL A;  4HK2 A;  2GBN A;  4EOY A;  4E71 A;  1WX7 A;  1WI0 A;  3EFU A;  3VFK A;  1TZ1 A;  2PJH A;  3H7P B;  5E6N A;  3GZN I;  5AZH A;  1WGD A;  5J2R A;  1UEL A;  2BWF A;  3L17 A;  2FAZ A;  2KTR A;  4FJY A;  3T8M A;  1WM2 A;  1V86 A;  4MEL A;  3ZW3 A;  3RCZ A;  3VTW A;  1GUA B;  2DZJ A;  1TBE A;  2MBE A;  2Y5B B;  2KFK A;  4FJV B;  3NS8 A;  3VAW A;  4FHJ A;  3RD2 A;  1R4M I;  3L54 A;  2DX5 B;  3WIM A;  4PS7 A;  3A1Q A;  2DZM A;  2C7H A;  4GB9 A;  1NBF C;  5IA7 A;  2XK5 B;  3NY5 A;  2JZ3 B;  3X23 A;  4HPL B;  1XQQ A;  2NBV B;  2GBJ A;  2QHO A;  4W9D A;  3R7Q A;  5KHO A;  1NI2 A;  3PLV A;  3OAW A;  1WGR A;  2CKH B;  1EF5 A;  2L0T A;  2ZJD A;  3DCG A;  3NOB A;  4DK5 A;  4GSW A;  3D32 A;  2NCN A;  2KK8 A;  1GC7 A;  1VCB A;  3CF6 E;  2M1M A;  3NZU A;  2N9E B;  3M62 B;  1P0R A;  3QQ8 B;  3NZS A;  3H9D A;  2MBB B;  4CYE A;  4NNJ B;  2MW5 A;  3OJ3 A;  2NBU A;  1C3T A;  1AAR A;  4MGY E;  3N32 A;  2MQJ A;  1E7U A;  2AL6 A;  4WWP A;  1VD2 A;  1LXD A;  1L7Y A;  2WWZ A;  1PQS A;  1WJU A;  2JRI B;  1OGW A;  5C23 A;  5C1Z A;  5GMV A;  2LVQ A;  4AP4 C;  3VH3 B;  1I42 A;  3N30 A;  2M4N A;  1J0G A;  2K25 A;  3QAR A;  3OLM D;  3IVF A;  4JL9 A;  3WAM A;  4PS3 A;  4A3P A;  4BFR A;  2D2Q A;  2PEA A;  3Q3J A;  3PGE A;  5D2M B;  4KIK A;  1WJ6 A;  3RT3 B;  3RUL A;  2L3Z A;  3ZVV A;  1E7V A;  1WY8 A;  3A33 B;  2KFJ A;  5L95 C;  2ZNV C;  3TCA A;  2C5L C;  4B95 A;  4IWO A;  4AJY B;  5E6O A;  1U4A A;  3O65 B;  4HWI B;  1K8R B;  3TJP A;  2G3Q B;  1Z2M A;  3C0R B;  2MP2 B;  2HJ8 A;  2REX A;  4JQW C;  1Q1O A;  5J18 A;  2XK5 A;  2FCN A;  1V9J A;  3K9O B;  3R3M A;  2K8H A;  2ZNV B;  2OJR A;  3ZLZ A;  5IAA C;  4WQO B;  4M8N A;  1L2N A;  2FCQ A;  4PYZ A;  3AXC A;  3A4S C;  3QK0 A;  4RM8 A;  4KZ0 A;  4GDK B;  1Z5S B;  2KWU B;  3PV1 A;  4HDQ A;  1V2Y A;  2I1K A;  2KJ6 A;  1WE6 A;  4ZRK A;  3ML8 A;  1OTR B;  4NQL B;  3SU8 X;  2UYZ B;  4MM3 A;  1YX5 B;  2EMT A;  3QA8 A;  4DDG D;  4DHJ D;  3HHM A;  3MTN B;  2NPT A;  3PZD A;  1OEY J;  4W9F A;  1E5W A;  4KSK C;  2N9P C;  1UBQ A;  2CHZ A;  3ZNI D;  2KDF B;  3LJ3 A;  2HE7 A;  1WE7 A;  4HPM B;  3PTF C;  4TV3 A;  2D3G A;  1YIW A;  1V80 A;  3KYD D;  2MA9 B;  3M63 B;  3V60 A;  4I6L B;  2C7M B;  3PRZ A;  3CSF A;  2O6V B;  3TMP B;  2IO1 B;  3DBS A;  4KV2 A;  4BKT A;  4A20 A;  2WX1 A;  3UGB B;  1WM3 A;  3KVF B;  3UQB A;  3RZF A;  2DYM A;  4X57 B;  3R66 C;  5G55 A;  3W1S A;  3H7S A;  3HM6 X;  5D94 A;  4AWJ A;  3PRM B;  3JSV A;  1WXM A;  2DHZ A;  3QJZ A;  1J8C A;  2LUE A;  2DYB A;  1LFD A;  4LDT D;  2KTR B;  2CR5 A;  5E6P A;  3U8Z A;  1YQB A;  1WXS A;  3PS6 A;  5LXH A;  1RFA A;  4G3X B;  2FCS A;  3JYU A;  1WXA A;  2HTH A;  2JT4 B;  2JXX A;  4EFO A;  1WZ3 A;  3DQV A;  2ZVO A;  2J0K A;  3A9K A; 
#chains in the Genus database with same CATH topology
 3ECI A;  1ZOY B;  4B9K A;  2Q5W D;  4JX1 C;  3NRZ A;  1JWS D;  2XEW A;  4XC2 A;  1XLP A;  4FUL A;  3W5U B;  2L32 A;  1N63 A;  1WGH A;  2KDB A;  2BT6 A;  2N0S B;  3TBL D;  4M01 A;  2AWT A;  2RGF A;  2WXO A;  2G45 B;  4KDL B;  1Q0W B;  1T0Y A;  3HK0 A;  2JQR B;  4NAW B;  2C60 A;  2QDF A;  4YSX B;  4W9L A;  2MBH A;  1KRH A;  1V97 A;  3I57 A;  4ZYN A;  1RWS A;  4YT0 B;  2LGY A;  1HA5 A;  2IDY A;  4L2Y A;  1FD6 A;  3GP7 A;  4M0W B;  5G2N A;  2D5G A;  2LHD A;  1F9J A;  2MWS B;  1QIL A;  5AEK B;  3V61 A;  4ZHO A;  1ENF A;  1LO5 D;  3A9K B;  1TKG A;  4OZB A;  2KT7 A;  1TS3 A;  1E0Z A;  3FKY A;  1DGJ A;  3L08 A;  1WSP A;  2PW9 A;  2IZV B;  4WAA A;  1VZ8 A;  2KJH B;  1C4C A;  1V49 A;  2A4Z A;  5MPO A;  3Q8B A;  3RYT A;  2RPQ A;  2ASQ A;  3ZJT A;  3NVV A;  4EEW A;  4GU2 A;  4HLE A;  2VRR B;  3NZ3 A;  3NHE B;  2J4X A;  4OVV A;  4BKS A;  4DBG A;  1QZE A;  3BK1 A;  3R8B A;  2CS4 A;  4RGM A;  4GDL A;  2Z0E B;  1B1Z A;  2MH7 A;  3E56 A;  1TS4 A;  2LAS A;  2O2V B;  3QWZ B;  3ZNZ B;  1WGG A;  3AM9 A;  2KWC A;  3Q3O C;  4FJZ A;  2B76 B;  3TSS A;  5AUK A;  4C7Y A;  1EM7 A;  1F77 A;  1CJE A;  1QF6 A;  3BYY B;  3DDC B;  4F8C B;  2BKF A;  3WA0 A;  4AS1 A;  2KQ7 A;  3L13 A;  3DBL I;  3L16 A;  4RFB A;  1FNU A;  3M3J A;  1WFY A;  3AB5 A;  1TYG B;  3Q2A C;  3LB8 C;  1T3Q A;  3IBE A;  3PHX B;  4URK A;  1IYF A;  1WIA A;  4NZL B;  3AE1 B;  2YEP F;  3ZRC A;  3PSE B;  4EZL A;  3DVG X;  1L0X B;  2ZZP B;  2FUG 1;  4EZJ A;  4KIK B;  4TUU A;  3B08 A;  2GMI C;  1RM6 C;  1WXV A;  3I5J C;  3MHZ A;  2GBM A;  5J17 A;  5EE1 A;  1MG4 A;  1R4N I;  1OQY A;  3U4E G;  1MPE A;  3ETR A;  2J7Q B;  3ZIM A;  2BPS A;  1PFD A;  2RDB C;  1I4Q A;  1I35 A;  1YX6 B;  4RF0 A;  4FAD A;  1YD8 U;  3PLU A;  3QCA A;  1MFW A;  4AUQ C;  1C78 A;  1WR1 A;  3BIN A;  4GXB A;  3AEG B;  3PRP B;  1L5P A;  1TJE A;  2DEN B;  2WXN A;  4D2K A;  1F2R C;  4WUR A;  2K1F A;  2JX5 A;  1JWA D;  2ACZ B;  1TGZ B;  2IY1 B;  3VVW B;  3QHT A;  4HJK A;  4GN1 A;  1SIJ A;  3BVM A;  2MSE D;  4F1S A;  1XCT L;  4J6I A;  1XEE A;  4II2 B;  2WU5 B;  2KN5 A;  1SF0 A;  4BVU C;  5JHB A;  2IBI B;  1WWT A;  1M94 A;  3OJ4 B;  1RLF A;  4HCN B;  2GBK A;  2E3T A;  2LGS A;  3AEF B;  4MGK E;  4OW0 A;  3R2T A;  4BBN C;  2KKC A;  2RSU A;  2AX5 A;  1VZ7 A;  1XCQ L;  1BXT A;  4A3O A;  4YTM B;  5JH5 C;  2MX2 A;  4JPS A;  4CHK A;  1CMX B;  1QOF A;  4P7I A;  3H6N A;  3ZRF A;  2KX0 A;  1FO4 A;  4IM3 A;  1E8Y A;  2LRW A;  1P3Q U;  3Q8A A;  1I4P A;  3NUH B;  1WH3 A;  2KTF A;  1XF5 L;  2JY6 A;  1FXA A;  2V4L A;  3Q8C A;  3WAL A;  2INN E;  4C00 A;  4FN2 A;  2MRP A;  3A9J A;  4REZ A;  3SFD B;  5I4D A;  1KFY B;  4HCP B;  1X1M A;  2NVU I;  3ABV B;  2NR2 A;  1ZUD 2;  3WCQ A;  2GOW A;  3AE6 B;  4PYU A;  4YL8 A;  2JRH A;  4BOS C;  1WGK A;  1K51 A;  1HEZ E;  1I4H A;  5CHV C;  1TY2 A;  4K7U A;  4USA A;  1WYG A;  1OQQ A;  3AUL A;  2GBN A;  1QT9 A;  1SE4 A;  1WX7 A;  1EWY C;  3H7P B;  5E6N A;  1V1O A;  3GZN I;  5AZH A;  4US8 A;  3RNB C;  4HKZ E;  2KTR A;  3AED B;  1WM2 A;  4MEL A;  2MBE A;  2Y5B B;  3PZ8 A;  4GB9 A;  1NBF C;  5IA7 A;  1L0V B;  1FEH A;  5BMH A;  2JZ3 B;  1XQQ A;  4W9D A;  5KHO A;  2J52 A;  3PLV A;  3AEE B;  3OAW A;  5EE9 A;  2IGH A;  2NCN A;  2KK8 A;  3EUB 2;  2JSV X;  4J3O D;  2BTE A;  1D5X C;  4JWS C;  1AYF A;  3T3O A;  2WQY B;  3DWG C;  5C1Z A;  4AP4 C;  3VH3 B;  4S0R A;  2K25 A;  3QAR A;  3OLM D;  3FAH A;  3IVF A;  5T8I A;  4PS3 A;  2PEA A;  3PGE A;  4KIK A;  1FIQ A;  1WJ6 A;  3EA6 A;  3RNE C;  1IGD A;  1WY8 A;  3A33 B;  2KFJ A;  2TSS A;  3FIL B;  1JW9 D;  4LNK A;  3DHH C;  2R61 A;  2KDM A;  3C0R B;  2MP2 B;  4YXD B;  1Q1O A;  2FCN A;  3B2G A;  3BZD B;  2IGG A;  4M8N A;  1L2N A;  2BQQ A;  2KAC A;  1F2R I;  1TKY A;  3QK0 A;  4GDK B;  2KWU B;  2QSD A;  2KJ6 A;  4C4V A;  3DBH B;  1OTR B;  4NQL B;  2UYZ B;  3VRA B;  2INP E;  2RDH A;  1DYQ A;  3O13 A;  3MTN B;  1OEY J;  1E5W A;  1QOG A;  1UBQ A;  2CHZ A;  1B9R A;  1YJI A;  4HPM B;  4C4V B;  4MT5 A;  3KYD D;  3I63 C;  3MC8 A;  2C7M B;  3PRZ A;  3CSF A;  2IO1 B;  2RDG A;  5IN7 A;  1J7A A;  3UQB A;  3KVF B;  3P42 A;  3RZF A;  3R66 C;  3AE5 B;  3HM6 X;  1XO3 A;  3PRM B;  1J8C A;  3RNA C;  2V0G A;  2DYB A;  1FFV A;  4YTP B;  1YQB A;  3N1Y C;  2Y5C A;  1ESF A;  1RFA A;  4RCO A;  1TT5 B;  2HTH A;  2JT4 B;  1WZ3 A;  1GB1 A;  1ACC A;  1F0Z A;  2B3A A;  1IP9 A;  1R4N B;  3UIN B;  2OOB B;  1PGA A;  3GS2 A;  2UWQ A;  1XD3 B;  1JAL A;  2UU7 A;  3GZN B;  2A5U A;  4YSY B;  1YJJ A;  3DVN U;  4MAC A;  2IPK D;  3TL5 A;  2WU2 B;  3APC A;  2DZI A;  4CQN A;  4NJC A;  2N9K A;  4TQ1 A;  1R4M B;  4PK1 A;  2MJD A;  4RMA A;  4ZRP A;  3Q8E A;  1SSN A;  4NJ6 A;  2XBB C;  1D6E C;  2PTL A;  4MEM A;  2I1J A;  3ZJU A;  4MSQ B;  4ZOH C;  2AL3 A;  3K9P B;  3CMM B;  2ZPY A;  4R3D A;  2IND C;  1YOV B;  2MBO A;  5GXG B;  1JML A;  3B1L X;  2G4S A;  4HVB A;  2WYQ A;  2O6V D;  5CHW A;  4WWO A;  4ZRQ A;  3N1X C;  1OFF A;  1QOA A;  2BVC A;  2JZP A;  4FHK A;  1QOB A;  1GJZ A;  4OZC A;  4PT5 A;  2NS5 A;  1V1P A;  1C9F A;  1NVI D;  1E9M A;  5FKA C;  2BS4 B;  4GOC A;  4LDT B;  1HE8 A;  2G9H D;  5D3D A;  3VXW A;  3ZXV A;  4XWW A;  5CX3 A;  2MCN B;  4RNA A;  1N60 A;  2RR9 A;  3WAN A;  2KMA A;  4G50 A;  4LCD E;  2YEP B;  3DBH I;  1ZXI A;  3B0A A;  2FBW B;  2M56 B;  1KM7 A;  3FC4 A;  1E10 A;  2SEB D;  4N9F 4;  4LTU A;  1NYR A;  2NPT B;  2IO2 B;  4IWQ A;  5IKC M;  1N61 A;  3VRB B;  2LZ6 A;  2K6Q A;  4K3B A;  2N7D A;  4LNI A;  2KHW B;  1MHH E;  3UQA A;  3MJ5 A;  4JLC A;  4JIO U;  1ZKH A;  1E8X A;  4ZDV A;  4IW0 A;  2FCM A;  1Y56 A;  3NVZ A;  5HHD G;  2LWP A;  5AZG A;  3A9J B;  4DHZ B;  2R2O A;  5KHQ A;  1JRO A;  4MDK E;  1GOZ A;  2ZPN A;  1I4X A;  3H1U A;  3ALB A;  1D3Z A;  2AQ3 B;  1NEN B;  1WYW B;  4KKJ A;  1XT9 B;  3MC9 A;  4YTN B;  1PGB A;  2N1W A;  1VJK A;  1ET6 A;  2HDE A;  2W55 A;  4F7Z A;  2V1Y A;  4ANU A;  2XN9 C;  4TKN A;  1E8Z A;  2J0M A;  1JWM D;  4E74 A;  4HDO A;  1CZP A;  2DNF A;  2KO3 A;  4ARC A;  2L0F A;  2CJN A;  4LNN A;  1YN5 A;  4FBJ B;  2N4F A;  4NJ7 A;  3B9J A;  1FNW A;  3JW0 X;  2JF5 A;  1ZGU B;  4OZA A;  5LNK 1;  3URY A;  2YVC A;  2M0X A;  2XNA C;  2KX3 A;  3KW5 B;  3KUC B;  3X0W A;  5LLI A;  2CU1 A;  4GDL B;  1XLO A;  4A55 A;  2AEH A;  1MI0 A;  3I9V 1;  2PKO A;  4NAM A;  3VUW A;  4WH4 A;  3SD5 A;  4L23 A;  2VH1 A;  2CJO A;  2BB6 A;  4S17 A;  3ZDM C;  2M19 A;  1Y8R C;  5CTR C;  4KGR A;  2Z0D B;  4PS8 A;  5LXI B;  2KJR A;  3U52 E;  5CHF A;  4GGQ A;  3RUI B;  3DVN V;  1OEY A;  2ON8 A;  4HXD A;  2LI5 A;  3KWV A;  1C79 A;  1AWD A;  3R2I A;  3APD A;  3KWL A;  1E7P B;  3NJT A;  3J9C A;  4HJG E;  3IT4 B;  3P1M A;  2HD5 B;  5DPW A;  1K52 A;  2WNM A;  1IGC A;  3NVW A;  3KH0 A;  4DXG A;  2C7N B;  3EGR A;  3M95 A;  4P6V F;  3UIO B;  2KLC A;  4G11 A;  1HQR D;  4TQ0 A;  1A5R A;  2DAJ A;  4C56 C;  2VZK B;  3VDZ A;  3VTV A;  2AYO B;  5AUI A;  4WJQ A;  3DBR I;  1SE9 A;  4EUT A;  3V05 A;  2ZCC A;  1C4P A;  5IOI A;  2JPH A;  1WGY A;  1UUP A;  5L83 A;  2D11 A;  3PO0 A;  3BY4 B;  2M17 A;  3Q69 A;  1V81 A;  4A6Q A;  1M4V A;  4HK2 A;  1K50 A;  2E6X A;  3EFU A;  2PJH A;  3ZQ4 A;  3AE7 B;  1UEL A;  1N6Z A;  2FAZ A;  3MC0 B;  3BWU D;  1QLB B;  1GUA B;  4FJV B;  5D3I B;  3L54 A;  2DX5 B;  4PS7 A;  2DZM A;  2C7H A;  2XK5 B;  4A9A A;  2ONQ A;  2X38 A;  2QHO A;  2WXJ A;  2CKH B;  1EF5 A;  3GB1 A;  3CF6 E;  4RF1 A;  1SXT A;  5FR3 A;  3M62 B;  3QQ8 B;  3NZS A;  4CYE A;  4KGT A;  1FXI A;  3TEY A;  3OJ3 A;  2NBU A;  4LNF A;  1AAR A;  3N32 A;  1HZ6 A;  4LK0 M;  1E7U A;  2AL6 A;  1PQS A;  3DBR B;  5C23 A;  1VZ6 A;  3N30 A;  1J0G A;  3ZYY X;  2BYT A;  1UF0 A;  5D2M B;  3NG0 A;  2G1E A;  1YQ4 B;  1XXG A;  3TCA A;  2C5L C;  4AJY B;  5E6O A;  3ZXR A;  1GPX A;  4IKG A;  2G3Q B;  1Z2M A;  3KLS X;  4C7Z A;  5J18 A;  1JWU D;  1V9J A;  3R3M A;  2PIA A;  2ZNV B;  2QIE B;  2WXP A;  2MJE A;  2JWU A;  2QJL A;  4KZ0 A;  3IAS 1;  1Z5S B;  3P4P B;  4DXF A;  4MM3 A;  1KTK A;  4DDG D;  4HRS A;  4DHJ D;  2NPT A;  3PZD A;  3ZNI D;  2KDF B;  2WXM A;  3DBL B;  1YIW A;  1IUE A;  3AEC B;  2WXG A;  1ZXH A;  4I6L B;  1FCL A;  2O6V B;  4A20 A;  2WX1 A;  1WM3 A;  3W1S A;  2DYM A;  5G55 A;  5D94 A;  4AWJ A;  3GE8 C;  3JSV A;  1WXM A;  1HTO A;  2KTR B;  2CR5 A;  3PS6 A;  4G3X B;  4O1N A;  1TS5 A;  2JXX A;  4LJP B;  2J0K A;  3A9K A;  1L0Y B;  1P7E A;  4EOY A;  1EF1 A;  1UZX B;  1J7B A;  5C3J B;  1GNU A;  1V5O A;  2PE6 B;  2M0A A;  3RNF C;  4N6E B;  2K8C A;  4TMA B;  1KLG D;  3RNG C;  4DXA B;  4RM9 A;  2K22 A;  4WJP A;  4P16 A;  4FLH A;  3NS1 A;  1E8W A;  3EEC A;  4DQO C;  2O6V A;  1WMH A;  1PUT A;  3RPF C;  1LQB A;  4IUM B;  1FPY A;  1CK1 A;  1DOY A;  2PVO D;  4ZHP A;  4OVZ A;  4ITK A;  4M02 A;  1DOX A;  1PDX A;  4NY0 A;  3QX1 A;  1WMH B;  2KVZ A;  1P98 A;  1BML C;  2N1V A;  4ICV A;  4XGA B;  3A4R A;  2MLB A;  4RGN A;  3ZJV A;  1V8C A;  2JWZ A;  2OHF A;  2AQ2 B;  2H89 B;  2WDT B;  2MJ3 A;  2D10 A;  1C4A A;  4WAF A;  5D6J B;  3CWI A;  3JVZ X;  5E6J A;  3RZW C;  2LGX A;  3IHP C;  2LVO A;  5HKH A;  1T6B X;  1ET9 A;  2JUO A;  1OQR A;  3ZNH B;  1D5M C;  4GDK A;  2WS3 B;  1ZP0 B;  4BOZ B;  2L05 A;  1YJ1 A;  1EU3 A;  3SR6 A;  2J0J A;  3PT2 B;  5BO4 B;  2WGS A;  4W9J A;  1EUV B;  4RGT A;  2LD9 A;  5BMI A;  2BKR B;  1JWB D;  4IWP A;  5H8Y E;  3I3T B;  4W9C A;  4K7S A;  5EE0 A;  1RRB A;  4IC7 B;  3Q3N C;  1LM8 B;  1ZPS A;  1UGJ A;  2KVR A;  4IM2 A;  1FM0 D;  4W9H A;  2JVC A;  5DPT A;  1WJN A;  4I6P A;  4ICU A;  5BMG A;  3U30 A;  1CQV A;  3GOE A;  4ANW A;  4CO7 A;  3W1Y A;  2DWQ A;  3VUX A;  1TTN A;  5H92 C;  2L00 B;  1NI3 A;  2EKE C;  3P4Q B;  2BYF A;  2KMM A;  2D07 B;  3Q8F A;  2FID A;  2DZK A;  2IO0 B;  3DOW A;  3QAQ A;  3HVZ A;  3L0W B;  2V9H A;  4EZK A;  4AOF A;  3U2S C;  2M8S A;  2J53 A;  3QIJ A;  1J19 A;  4ASW C;  2FNJ B;  2LMC A;  4W9E A;  2DAF A;  3RNC C;  5EDS A;  2LXA A;  3P2B A;  5JHA A;  5AZF A;  1Q10 A;  3VTU A;  3DPD A;  3ZTD A;  1FXT B;  2IJ0 A;  2O2V A;  3HVD A;  2KN4 A;  3IFW B;  5DPR A;  1L4Z B;  1H4R A;  1I4R A;  3ZDT A;  5EE3 A;  2EEL A;  2BYV E;  1ROE A;  1K53 A;  1WR6 E;  1WJ4 A;  3ZUN A;  1FMA D;  3WAP A;  2KC1 A;  5IO9 A;  4JGH B;  1C1Y B;  1E6E B;  1VDV A;  4P1B C;  4WIP A;  3KQ4 A;  2LJ5 A;  3S2A A;  2IYD B;  4N59 A;  1ZDX A;  2FIF A;  2L52 A;  3P4S B;  3AU5 A;  4HKQ A;  3GE3 C;  3UF8 A;  2Z59 B;  4FA6 A;  1ISN A;  4L1B A;  1S3S G;  1V1P B;  2H88 B;  1MG8 A;  1T0S C;  2G4D B;  2GBR A;  2ZW0 A;  2NMQ A;  4HEA 1;  3VH4 B;  1SE2 A;  2SAK A;  3EFC A;  4NPN A;  1IPG A;  2K5P A;  2RPV A;  5BYQ A;  2W9N A;  3VQI A;  2V3N A;  3V62 A;  2KWV B;  3UIP B;  1V5T A;  4MSM B;  1SJE D;  1NYQ A;  4EE2 A;  2JYT A;  4P1C C;  1A70 A;  1I7H A;  3N1Z C;  3QC8 B;  5TR5 A;  3L10 B;  2KC2 A;  3H8H A;  5DCN A;  1UWX A;  2GRI A;  4BBN F;  3SDL C;  2EMS A;  3W2D A;  2D3A A;  4WWN A;  3ZGZ A;  3V6C B;  3C8Y A;  4OHJ A;  4MJS B;  3PHW B;  5JZE B;  4LLG M;  4KVG B;  4OVU A;  2WXH A;  4LJO B;  2VH2 A;  3VR8 B;  3AE9 B;  3JSV B;  4KX6 B;  3RMK C;  3W9C B;  4A90 A;  3PVL A;  4XE0 A;  4XDD A;  4JWU C;  1WZ0 A;  1VRA B;  3AV8 A;  3ZTC A;  2N7E A;  3KYC D;  3T9L A;  1KOT A;  1FCC C;  2L1A A;  2FUH B;  2KNB A;  5HG2 A;  2KD0 A;  4IM0 A;  1AW7 A;  2BS3 B;  4DHZ E;  2LEK A;  3AE8 B;  3WAO A;  4MH0 E;  3BVZ A;  4ZYS A;  2DLB A;  3LXF A;  1JRP A;  4E71 A;  2N9L A;  1J7C A;  1TZ1 A;  4IOI E;  2I2Y A;  1STE A;  2BWF A;  2LJI A;  4FJY A;  3T8M A;  1V86 A;  3ZW3 A;  3VTW A;  2DZJ A;  3VAW A;  1R4M I;  4BAX A;  1TZO A;  5G5H A;  1LGR A;  2CU3 A;  4HPL B;  1NI2 A;  3DCG A;  2OJW A;  4GSW A;  3D32 A;  2Y3A A;  1VCB A;  3NZU A;  2M1M A;  4B0E A;  1P0R A;  5JXV A;  2PMV A;  2BW2 A;  4NNJ B;  1C3T A;  2QC8 A;  4MGY E;  2IGD A;  2MQJ A;  4YWG G;  4WWP A;  2K0P A;  2JRI B;  1YN4 A;  1FNV A;  4RH6 A;  2NTT A;  1UNS A;  1I42 A;  2NTS A;  1QKZ A;  4JL9 A;  2BS2 B;  3SFE B;  2GI9 A;  2D2Q A;  3Q3J A;  3RUL A;  1E7V A;  3CIR B;  1MVK A;  1KLU D;  5L95 C;  3IXS A;  3AN1 A;  4B95 A;  3P63 A;  4IWO A;  1PGX A;  3P4R B;  1U4A A;  2WLB A;  3O65 B;  2HJ8 A;  2REX A;  2V4I B;  1MJD A;  3K9O B;  2K8H A;  5IAA C;  2DBY A;  2FCQ A;  2QMT A;  2V3P A;  4N58 A;  3A4S C;  1SB3 C;  1V2Y A;  3AE2 B;  1MHX A;  3ML8 A;  4ZRK A;  3LYY A;  1YX5 B;  3DHG C;  2EMT A;  3QA8 A;  3HHM A;  2W82 A;  4KSK C;  3LJ3 A;  3C19 A;  1WE7 A;  3PTF C;  4TV3 A;  2WXQ A;  1V80 A;  2MA9 B;  4AQ7 A;  4X57 B;  3Q14 C;  3QJZ A;  2LUE A;  2K3U A;  2JYE A;  4LDT D;  5C2T B;  5BYR A;  5E6P A;  3U8Z A;  3FIL A;  3Q6B A;  1ZE3 D;  1EWC A;  2MHJ A;  4LNO A;  4M0W A;  5LXH A;  4H2A A;  3L4P A;  4EFO A;  2Z8L A;  4KKI A;  2IO3 B;  5FR6 A;  3UI3 A;  2OED A;  4DDI D;  2DYO A;  1SEB D;  2BBC A;  3KUD B;  4ACF A;  1L6V A;  2YLM A;  3VR9 B;  1V6E A;  2QCZ A;  3OG5 A;  1G6J A;  3MHS D;  1HXY D;  1R7S A;  4KSL C;  2LRU A;  2JZZ A;  1KH0 A;  4B6W A;  2K39 A;  4A8X C;  3BII D;  2KQS A;  4MGZ E;  4HPP A;  2PVG C;  1GG3 A;  4XYC A;  2KFK B;  3ENE A;  4QAY A;  3IAM 1;  4ANX A;  1UBI A;  2L7R A;  4XWT A;  1GC6 A;  3R7R A;  1IBX B;  2KOX A;  1BT0 A;  2CHW A;  3AMZ A;  4DHJ B;  1P7F A;  1JCK B;  4RGO S;  2KZR A;  2KYW A;  1N5X A;  4M8M A;  2RMM A;  2LFI A;  2WXK A;  3ML9 A;  5HI1 A;  4IG7 B;  1GB4 A;  5DPS A;  2V3S A;  2W54 A;  2LUM A;  4K7W A;  3T3N A;  3ZNG C;  3ZO5 B;  2PE9 A;  1N62 A;  1QQR A;  3TIX A;  4BKG A;  1TIF A;  2ZW1 A;  1WX8 A;  3AE3 B;  2L76 A;  4K81 A;  2KLG A;  4GIV A;  3V6E B;  1XLQ A;  1YMH E;  4TSS A;  2ZEQ A;  2JU6 X;  3EHV A;  3VHT C;  2KMC A;  1UGM A;  4MJS A;  1VLB A;  2KWD A;  1YN3 A;  1JRU A;  1TS2 A;  2CHX A;  3OWE B;  4XDC A;  4E3C A;  1L4D B;  2WXI A;  2LVP A;  2R2Q A;  2KAN A;  3ONS A;  4ANV A;  2PPH A;  4WJN A;  2N9X A;  4W9K A;  3AE4 B;  3DVG Y;  4ARI A;  2BB5 A;  3IT6 B;  4AJW A;  1RYJ A;  2ICI A;  2EKI A;  3KUZ A;  1N5W A;  3BK2 A;  4UDU C;  1YNT E;  2KAJ A;  3HRD D;  3HM3 A;  2WHI A;  1T0Q C;  5FK9 C;  3AEA B;  1P1A A;  3B2F A;  2WDV B;  3Q3M C;  4G0N B;  1VR9 A;  2I38 A;  2KDI A;  4KDI C;  5D7G A;  1SJH D;  2IY0 B;  3BVG A;  3APF A;  1RAX A;  3LDZ E;  4BKS D;  3TEW A;  4DWF A;  1WF9 A;  3AEB B;  3MFG A;  4ZRJ A;  2HTM E;  1XLN A;  4MGI E;  1I4G A;  3HIZ A;  2BGF A;  3AI5 A;  4NAW A;  4II3 B;  2N7J A;  1E90 A;  2ZCB A;  3PRE A;  3H7P A;  1KF6 B;  1C77 A;  2LGD A;  1EO6 A;  3CST A;  2BF8 B;  4KZC A;  2QEJ C;  3PZ7 A;  1UD7 A;  2PLP A;  2C9W B;  4US9 A;  3HUI A;  1H8C A;  2MBQ A;  3SEB A;  2BYE A;  4GMV A;  5HFY A;  1S1Q B;  2K8B A;  3MJW A;  3N20 C;  2AQ1 B;  2WX0 A;  1WX9 A;  4WJO A;  2KDE B;  2NBW B;  3PPA A;  2Y5P A;  4IDI A;  1T0R C;  1C76 A;  1KLV A;  1UH6 A;  2KXJ A;  4XZ4 A;  2W3S A;  4XX5 A;  2HJ1 A;  3W1S C;  1NDD A;  2BWE S;  2WP9 B;  3N3K B;  3U7Z A;  2L8J A;  1P9D U;  3NVY A;  4YSZ B;  4W9G A;  1WRD B;  1ZDV A;  2GLS A;  3MP9 A;  4M00 A;  1NEK B;  3U7D A;  4Q2J A;  2RD0 A;  1GAQ B;  3V3X A;  3VUY A;  3AU4 A;  3ZKJ C;  1TY0 A;  1KJT A;  3RN9 C;  1Q5W B;  4I6N B;  3SHQ A;  4K1R B;  2D3C A;  1WXQ A;  2MP2 A;  1HTQ A;  2WXF A;  4BZA A;  2LGI A;  3EC8 A;  2K6D B;  3IG3 A;  3RFZ B;  3A1Q B;  1SBB B;  1TKE A;  3Q3F A;  1L6U A;  2LXC A;  2VZK D;  3W5V B;  1FFU A;  1PYW D;  4NQK E;  1F1H A;  2X8X X;  4ZRI A;  1SGH A;  2ZVN A;  4W9I A;  4FXC A;  1ZW7 A;  4EKU A;  1SIF A;  2D3B A;  4MH8 A;  1WI0 A;  3VFK A;  1JQ4 A;  1WGD A;  5J2R A;  3BYT B;  2WXR A;  3L17 A;  1FRD A;  4KGS A;  2QIL A;  3RCZ A;  1TBE A;  2KFK A;  3NS8 A;  4FHJ A;  3TEX A;  3RD2 A;  1UWM A;  3WIM A;  1RFK A;  3A1Q A;  3AH7 A;  3NY5 A;  3RI7 C;  1FRR A;  3X23 A;  1F52 A;  2NBV B;  2GBJ A;  3R7Q A;  1WGR A;  2L0T A;  2ZJD A;  3NOB A;  4DK5 A;  1GC7 A;  1YQ3 B;  2N9E B;  1IBX A;  3H9D A;  4MM3 B;  2MBB B;  2K9X A;  2MW5 A;  1VD2 A;  1LXD A;  1L7Y A;  2J42 A;  2WWZ A;  2W3R A;  4WWM A;  1WJU A;  4C80 A;  3TUO A;  1OGW A;  5GMV A;  2L83 A;  2LVQ A;  2M4N A;  3E9S A;  5TSS A;  4WQM A;  3DHI C;  3WAM A;  4A3P A;  4BFR A;  3RT3 B;  2L3Z A;  3ZVV A;  4K3C A;  1D4B A;  4B0M A;  1D5Z C;  2ZNV C;  2GB1 A;  4HWI B;  1K8R B;  3TJP A;  2INC C;  1EU4 A;  5BYS A;  4JQW C;  2XK5 A;  2WDR B;  2JXT A;  2OJR A;  3ZLZ A;  4WQO B;  4PYZ A;  3DWM A;  3AXC A;  1BUI C;  1DOI A;  4RM8 A;  4HRO A;  3PV1 A;  2MEK A;  4HDQ A;  2I1K A;  2WXL A;  1WE6 A;  3SU8 X;  1WRI A;  4W9F A;  2N9P C;  1HZ5 A;  2FE8 A;  2HE7 A;  1T5X D;  2D3G A;  3V60 A;  1SE3 A;  3M63 B;  3TMP B;  3DBS A;  4KV2 A;  4BKT A;  5IP4 D;  3N9Y C;  3UGB B;  4JE3 B;  5G5G A;  3H7S A;  2KQ4 X;  2DHZ A;  1LFD A;  2WDQ B;  2LHE A;  4GLS C;  1WXS A;  3TEZ A;  3JYU A;  2FCS A;  1AN8 A;  1WXA A;  3DQV A;  2ZVO A; 
#chains in the Genus database with same CATH homology
 2IO3 B;  1EF1 A;  3ECI A;  5FR6 A;  1UZX B;  2B3A A;  4DDI D;  4B9K A;  2DYO A;  1IP9 A;  1GNU A;  3KUD B;  1V5O A;  2PE6 B;  2XEW A;  4XC2 A;  3UIN B;  2OOB B;  2YLM A;  2K8C A;  4FUL A;  1V6E A;  1WGH A;  2KDB A;  4DXA B;  1G6J A;  4RM9 A;  2UWQ A;  4WJP A;  3MHS D;  1XD3 B;  4FLH A;  3TBL D;  4KSL C;  1E8W A;  2A5U A;  3EEC A;  2LRU A;  2JZZ A;  3DVN U;  4B6W A;  2AWT A;  2O6V A;  2RGF A;  1WMH A;  1LQB A;  2G45 B;  3TL5 A;  2K39 A;  4IUM B;  4KDL B;  1Q0W B;  3APC A;  1T0Y A;  3HK0 A;  2KQS A;  4MGZ E;  2DZI A;  4NAW B;  2C60 A;  4NY0 A;  3QX1 A;  1GG3 A;  4TQ1 A;  4W9L A;  2MBH A;  1WMH B;  2KFK B;  3ENE A;  4RMA A;  1P98 A;  2N1V A;  4ICV A;  4ZYN A;  3A4R A;  4NJ6 A;  2MLB A;  4ANX A;  2LGY A;  1UBI A;  2XBB C;  2JWZ A;  4M0W B;  5G2N A;  2WDT B;  1F9J A;  2L7R A;  2D10 A;  2MWS B;  4MEM A;  1GC6 A;  5AEK B;  2I1J A;  4MSQ B;  5D6J B;  3JVZ X;  2AL3 A;  3K9P B;  3V61 A;  3RZW C;  3R7R A;  3CMM B;  2LGX A;  3A9K B;  2KOX A;  3IHP C;  1BT0 A;  2LVO A;  2ZPY A;  2CHW A;  5HKH A;  2MBO A;  2JUO A;  4DHJ B;  3L08 A;  3ZNH B;  3B1L X;  2G4S A;  4GDK A;  2IZV B;  4WAA A;  2WYQ A;  4HVB A;  2O6V D;  2KJH B;  4BOZ B;  2L05 A;  1YJ1 A;  4WWO A;  5CHW A;  2KZR A;  1V49 A;  2A4Z A;  4M8M A;  2J0J A;  4FHK A;  3PT2 B;  5BO4 B;  3RYT A;  2RPQ A;  3ML9 A;  1GJZ A;  4W9J A;  2ASQ A;  2NS5 A;  4EEW A;  4IG7 B;  5DPS A;  2V3S A;  1EUV B;  2LD9 A;  4GU2 A;  4HLE A;  2VRR B;  4K7W A;  2BKR B;  3NHE B;  3ZNG C;  3ZO5 B;  4GOC A;  2PE9 A;  4OVV A;  4LDT B;  1HE8 A;  4IWP A;  4BKS A;  3TIX A;  4DBG A;  4BKG A;  1QZE A;  3I3T B;  1WX8 A;  4W9C A;  2CS4 A;  2L76 A;  4GDL A;  4K7S A;  2Z0E B;  4K81 A;  3VXW A;  1RRB A;  2KLG A;  4GIV A;  4IC7 B;  3V6E B;  2LAS A;  1LM8 B;  2O2V B;  5CX3 A;  3QWZ B;  2ZEQ A;  3ZNZ B;  3EHV A;  2MCN B;  3VHT C;  1WGG A;  2KVR A;  4FJZ A;  2KWC A;  2KMC A;  4IM2 A;  2RR9 A;  3WAN A;  1UGM A;  4MJS A;  4W9H A;  2JVC A;  2KMA A;  1WJN A;  4G50 A;  4I6P A;  4LCD E;  4ICU A;  5DPT A;  3DBH I;  3B0A A;  3U30 A;  1JRU A;  3GOE A;  4ANW A;  4CO7 A;  3W1Y A;  1KM7 A;  3DDC B;  3VUX A;  2CHX A;  4F8C B;  4N9F 4;  2BKF A;  1TTN A;  3WA0 A;  2L00 B;  2KQ7 A;  2EKE C;  2NPT B;  2IO2 B;  3L13 A;  4IWQ A;  4E3C A;  2BYF A;  2D07 B;  3DBL I;  3L16 A;  2FID A;  2LVP A;  2DZK A;  2IO0 B;  2KAN A;  2R2Q A;  3ONS A;  3DOW A;  3M3J A;  4ANV A;  1WFY A;  2LZ6 A;  3QAQ A;  2K6Q A;  2PPH A;  3L0W B;  4WJN A;  2N7D A;  4EZK A;  2KHW B;  4AOF A;  2N9X A;  3IBE A;  3PHX B;  3UQA A;  2M8S A;  4JLC A;  4W9K A;  4URK A;  1IYF A;  1WIA A;  3QIJ A;  4JIO U;  1J19 A;  3DVG Y;  1ZKH A;  1E8X A;  3ZRC A;  3PSE B;  4IW0 A;  4EZL A;  2FCM A;  4ASW C;  4ZDV A;  3DVG X;  2FNJ B;  4W9E A;  2LWP A;  4AJW A;  2ZZP B;  4EZJ A;  2DAF A;  4KIK B;  3KUZ A;  4TUU A;  5AZG A;  5EDS A;  2LXA A;  3P2B A;  3A9J B;  3B08 A;  2GMI C;  4DHZ B;  2R2O A;  5KHQ A;  1WXV A;  4MDK E;  5JHA A;  5AZF A;  3VTU A;  3DPD A;  3ZTD A;  1FXT B;  2O2V A;  2ZPN A;  3HM3 A;  2GBM A;  3H1U A;  5J17 A;  3ALB A;  3IFW B;  5DPR A;  1D3Z A;  1H4R A;  1WYW B;  3ZDT A;  2BYV E;  1R4N I;  1OQY A;  1XT9 B;  1WR6 E;  1WJ4 A;  3ZUN A;  1P1A A;  3WAP A;  2N1W A;  4G0N B;  2KC1 A;  2KDI A;  2J7Q B;  3ZIM A;  4KDI C;  5D7G A;  4JGH B;  4F7Z A;  1C1Y B;  2IY0 B;  2V1Y A;  2BPS A;  3APF A;  1RAX A;  1I35 A;  1YX6 B;  3LDZ E;  4BKS D;  4ANU A;  4FAD A;  4DWF A;  1YD8 U;  1WF9 A;  3PLU A;  3QCA A;  4ZRJ A;  4TKN A;  4AUQ C;  1E8Z A;  2LJ5 A;  3S2A A;  1WR1 A;  2IYD B;  2J0M A;  3BIN A;  4GXB A;  4MGI E;  3HIZ A;  2BGF A;  3AI5 A;  4E74 A;  3PRP B;  4HDO A;  2FIF A;  2KO3 A;  4NAW A;  2L0F A;  3AU5 A;  4II3 B;  1E90 A;  2DEN B;  2ZCB A;  4FBJ B;  3UF8 A;  2Z59 B;  4FA6 A;  1ISN A;  2N4F A;  4NJ7 A;  3PRE A;  3H7P A;  2K1F A;  1S3S G;  3JW0 X;  2JF5 A;  1ZGU B;  2LGD A;  1EO6 A;  3CST A;  2BF8 B;  1TGZ B;  2YVC A;  2IY1 B;  2M0X A;  4KZC A;  1MG8 A;  3VVW B;  3QHT A;  2G4D B;  2GBR A;  2KX3 A;  4HJK A;  1UD7 A;  4GN1 A;  3KW5 B;  3KUC B;  3X0W A;  5LLI A;  2C9W B;  2CU1 A;  4GDL B;  3VH4 B;  1H8C A;  2AEH A;  2MSE D;  4F1S A;  1IPG A;  4NPN A;  2W9N A;  4J6I A;  3VQI A;  2MBQ A;  4II2 B;  2BYE A;  4GMV A;  3V62 A;  3VUW A;  1S1Q B;  3SD5 A;  2KN5 A;  2KWV B;  3UIP B;  4BVU C;  1V5T A;  2K8B A;  4MSM B;  3MJW A;  5JHB A;  3ZDM C;  2WX0 A;  2IBI B;  1Y8R C;  1M94 A;  3OJ4 B;  1RLF A;  1WX9 A;  4WJO A;  2KDE B;  2GBK A;  2NBW B;  3PPA A;  4HCN B;  5CTR C;  3QC8 B;  2Z0D B;  4PS8 A;  5LXI B;  2KJR A;  5TR5 A;  4MGK E;  3L10 B;  1KLV A;  2KC2 A;  1UH6 A;  5CHF A;  2KXJ A;  4GGQ A;  4XZ4 A;  5DCN A;  3RUI B;  4BBN C;  2KKC A;  2RSU A;  3DVN V;  4XX5 A;  3W1S C;  4BBN F;  1NDD A;  2BWE S;  3N3K B;  1OEY A;  4A3O A;  2L8J A;  1P9D U;  5JH5 C;  4HXD A;  2MX2 A;  2LI5 A;  4W9G A;  3SDL C;  4CHK A;  2EMS A;  1CMX B;  3APD A;  1WRD B;  4P7I A;  3H6N A;  3ZRF A;  2KX0 A;  4WWN A;  3U7D A;  4IM3 A;  2RD0 A;  1E8Y A;  3VUY A;  2LRW A;  3V6C B;  5DPW A;  3AU4 A;  2HD5 B;  3ZKJ C;  1P3Q U;  4MJS B;  3PHW B;  5JZE B;  1WH3 A;  2KTF A;  1KJT A;  2C7N B;  3KH0 A;  4KVG B;  4OVU A;  1Q5W B;  4I6N B;  3SHQ A;  4LJO B;  2JY6 A;  3M95 A;  2V4L A;  4K1R B;  3WAL A;  3JSV B;  2MP2 A;  3UIO B;  4FN2 A;  2KLC A;  3PVL A;  2MRP A;  3A9J A;  4G11 A;  1WZ0 A;  4HCP B;  4TQ0 A;  1X1M A;  3EC8 A;  2K6D B;  1A5R A;  2NVU I;  3IG3 A;  2DAJ A;  2NR2 A;  3ZTC A;  3A1Q B;  2N7E A;  2GOW A;  3KYC D;  4PYU A;  3T9L A;  1KOT A;  3VDZ A;  2FUH B;  2KNB A;  3Q3F A;  3VTV A;  2AYO B;  4YL8 A;  2KD0 A;  2LXC A;  4IM0 A;  3DBR I;  4WJQ A;  1SE9 A;  2JRH A;  4NQK E;  4BOS C;  4EUT A;  2ZCC A;  5L83 A;  2JPH A;  1WGY A;  5CHV C;  4ZRI A;  1SGH A;  2ZVN A;  4W9I A;  4DHZ E;  2D11 A;  3WAO A;  1ZW7 A;  3BY4 B;  2M17 A;  4K7U A;  4EKU A;  1SIF A;  1V81 A;  4MH0 E;  4LJP B;  3AUL A;  4HK2 A;  2GBN A;  4EOY A;  4E71 A;  1WX7 A;  1WI0 A;  3EFU A;  3VFK A;  1TZ1 A;  2PJH A;  3H7P B;  5E6N A;  3GZN I;  5AZH A;  1WGD A;  5J2R A;  1UEL A;  2BWF A;  3L17 A;  2FAZ A;  2KTR A;  4FJY A;  3T8M A;  1WM2 A;  1V86 A;  4MEL A;  3ZW3 A;  3RCZ A;  3VTW A;  1GUA B;  2DZJ A;  1TBE A;  2MBE A;  2Y5B B;  2KFK A;  4FJV B;  3NS8 A;  3VAW A;  4FHJ A;  3RD2 A;  1R4M I;  3L54 A;  2DX5 B;  3WIM A;  4PS7 A;  3A1Q A;  2DZM A;  2C7H A;  4GB9 A;  1NBF C;  5IA7 A;  2XK5 B;  3NY5 A;  2JZ3 B;  3X23 A;  4HPL B;  1XQQ A;  2NBV B;  2GBJ A;  2QHO A;  4W9D A;  3R7Q A;  5KHO A;  1NI2 A;  3PLV A;  3OAW A;  1WGR A;  2CKH B;  1EF5 A;  2L0T A;  2ZJD A;  3DCG A;  3NOB A;  4DK5 A;  4GSW A;  3D32 A;  2NCN A;  2KK8 A;  1GC7 A;  1VCB A;  3CF6 E;  2M1M A;  3NZU A;  2N9E B;  3M62 B;  1P0R A;  3QQ8 B;  3NZS A;  3H9D A;  2MBB B;  4CYE A;  4NNJ B;  2MW5 A;  3OJ3 A;  2NBU A;  1C3T A;  1AAR A;  4MGY E;  3N32 A;  2MQJ A;  1E7U A;  2AL6 A;  4WWP A;  1VD2 A;  1LXD A;  1L7Y A;  2WWZ A;  1PQS A;  1WJU A;  2JRI B;  1OGW A;  5C23 A;  5C1Z A;  5GMV A;  2LVQ A;  4AP4 C;  3VH3 B;  1I42 A;  3N30 A;  2M4N A;  1J0G A;  2K25 A;  3QAR A;  3OLM D;  3IVF A;  4JL9 A;  3WAM A;  4PS3 A;  4A3P A;  4BFR A;  2D2Q A;  2PEA A;  3Q3J A;  3PGE A;  5D2M B;  4KIK A;  1WJ6 A;  3RT3 B;  3RUL A;  2L3Z A;  3ZVV A;  1E7V A;  1WY8 A;  3A33 B;  2KFJ A;  5L95 C;  2ZNV C;  3TCA A;  2C5L C;  4B95 A;  4IWO A;  4AJY B;  5E6O A;  1U4A A;  3O65 B;  4HWI B;  1K8R B;  3TJP A;  2G3Q B;  1Z2M A;  3C0R B;  2MP2 B;  2HJ8 A;  2REX A;  4JQW C;  1Q1O A;  5J18 A;  2XK5 A;  2FCN A;  1V9J A;  3K9O B;  3R3M A;  2K8H A;  2ZNV B;  2OJR A;  3ZLZ A;  5IAA C;  4WQO B;  4M8N A;  1L2N A;  2FCQ A;  4PYZ A;  3AXC A;  3A4S C;  3QK0 A;  4RM8 A;  4KZ0 A;  4GDK B;  1Z5S B;  2KWU B;  3PV1 A;  4HDQ A;  1V2Y A;  2I1K A;  2KJ6 A;  1WE6 A;  4ZRK A;  3ML8 A;  1OTR B;  4NQL B;  3SU8 X;  2UYZ B;  4MM3 A;  1YX5 B;  2EMT A;  3QA8 A;  4DDG D;  4DHJ D;  3HHM A;  3MTN B;  2NPT A;  3PZD A;  1OEY J;  4W9F A;  1E5W A;  4KSK C;  2N9P C;  1UBQ A;  2CHZ A;  3ZNI D;  2KDF B;  3LJ3 A;  2HE7 A;  1WE7 A;  4HPM B;  3PTF C;  4TV3 A;  2D3G A;  1YIW A;  1V80 A;  3KYD D;  2MA9 B;  3M63 B;  3V60 A;  4I6L B;  2C7M B;  3PRZ A;  3CSF A;  2O6V B;  3TMP B;  2IO1 B;  3DBS A;  4KV2 A;  4BKT A;  4A20 A;  2WX1 A;  3UGB B;  1WM3 A;  3KVF B;  3UQB A;  3RZF A;  2DYM A;  4X57 B;  3R66 C;  5G55 A;  3W1S A;  3H7S A;  3HM6 X;  5D94 A;  4AWJ A;  3PRM B;  3JSV A;  1WXM A;  2DHZ A;  3QJZ A;  1J8C A;  2LUE A;  2DYB A;  1LFD A;  4LDT D;  2KTR B;  2CR5 A;  5E6P A;  3U8Z A;  1YQB A;  1WXS A;  3PS6 A;  5LXH A;  1RFA A;  4G3X B;  2FCS A;  3JYU A;  1WXA A;  2HTH A;  2JT4 B;  2JXX A;  4EFO A;  1WZ3 A;  3DQV A;  2ZVO A;  2J0K A;  3A9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...