2LXCA

Solution structure of the complex between the sgt2 homodimerization domain and the get5 ubl domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
b'MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein MDY2
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/protein binding
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lxcA00
2UWQA 3EC8A 2K25A 3RULA 2DZKA 2G45B 2ZVNA 3BY4B 2ZCCA 1E90A 1ZKHA 1PQSA 1GC6A 2ZJDA 2GBMA 3CSFA 3DDCB 1E8YA 3NZSA 2DHZA 3U30A 1GJZA 4TKNA 3B08A 2N9XA 4PYZA 5CHVC 3W1SA 2KD0A 1EO6A 1P98A 1F9JA 2EMSA 2K8HA 3AULA 3KUCB 4GDKB 4NPNA 3RUIB 2C9WB 3QC8B 3SHQA 4BVUC 1WYWB 4K1RB 2N7DA 2KJRA 2MCNB 3VHTC 4MJSA 3OJ4B 4EKUA 4ZYNA 2KJHB 4F7ZA 2C7NB 4KDIC 1XT9B 2C7MB 3VAWA 2Z59B 5J17A 2XK5B 4BOSC 1YD8U 2MX2A 3L54A 2IYDB 3PTFC 4I6LB 5E6NA 4EUTA 4JLCA 4HVBA 2FNJB 1L2NA 2MBHA 1V49A 2IZVB 4CYEA 1WY8A 2JZ3B 2LD9A 2LJ5A 2KMAA 2JPHA 2YVCA 2KFKA 1G6JA 2DYBA 4HK2A 3LJ3A 4FN2A 2CHXA 2IO1B 5AEKB 2GMIC 4NAWB 3DVNV 3R7RA 3VH4B 1R4MI 2JY6A 2MQJA 4W9LA 4OVVA 1WM3A 2CR5A 3A9JB 1RFAA 2DZIA 5D6JB 1V80A 4YL8A 2KDBA 4KIKB 2BWFA 4BKTA 1SGHA 3APFA 4W9DA 2FIFA 3B1LX 3W1SC 1UH6A 2GOWA 3Q3FA 4JIOU 1CMXB 5J18A 4NNJB 2K39A 3QX1A 4BKSD 2ZCBA 1J19A 3H1UA 2BYVE 5D94A 4AP4C 4EOYA 2D10A 2V4LA 3JVZX 2DZJA 4W9EA 4M8MA 1WFYA 3DPDA 1GUAB 1TTNA 1RRBA 3OLMD 1S1QB 3IVFA 2WWZA 4MELA 1NI2A 3JSVB 1WGDA 3AXCA 1JRUA 3H6NA 1UZXB 3H7PB 2NBUA 3SU8X 2O6VA 4ICUA 3L08A 4WJNA 2DZMA 5G2NA 2RD0A 1OQYA 1NBFC 2REXA 3U8ZA 2Z0DB 4J6IA 4URKA 4ICVA 2KLCA 1E8ZA 1MG8A 2LGYA 2LZ6A 3WAMA 3HM3A 2LRWA 4W9JA 2MP2B 3EHVA 5HKHA 1WGGA 4HWIB 2BGFA 4IWOA 1V5TA 4K7UA 2KX3A 1WR6E 3UINB 3ZW3A 2IO3B 3EECA 3P2BA 4ZRJA 1LXDA 4AJWA 3PRPB 4FULA 3ZO5B 3SD5A 4WWNA 3RZWC 5DPSA 4HJKA 2FCQA 2KQSA 3S2AA 3PLVA 2I1JA 4HCPB 5LXIB 2WDTB 4EZKA 2M8SA 3NOBA 2JVCA 3L0WB 2IY1B 1D3ZA 1KOTA 2KTFA 1WZ3A 3QAQA 4CO7A 3ZTDA 2BWES 2VRRB 2KC2A 2DENB 2NCNA 5AZHA 1WX9A 1WJNA 1XQQA 2LXCA 1EF5A 2XBBC 4FJZA 3VQIA 1S3SG 3KW5B 4JL9A 2KK8A 1QZEA 3R66C 2BF8B 1A5RA 1L7YA 4JGHB 4LDTB 1WXMA 2GBKA 4PS3A 3W1YA 2IY0B 1V9JA 3VTUA 3KYDD 3NY5A 4PS8A 2HE7A 3MHSD 3O65B 3PRZA 5IA7A 4FJVB 3VH3B 2M1MA 3ZLZA 1E7UA 4EZJA 5FR6A 4MGKE 1EF1A 4G11A 2KX0A 5C23A 2KXJA 2KN5A 3QA8A 2O6VD 2PJHA 2FIDA 4MEMA 5D7GA 3UQBA 1WXAA 3PVLA 3TBLD 5CX3A 4NAWA 3MTNB 2MBEA 4ZRKA 3LDZE 3ZNGC 4OVUA 3ZNHB 3K9PB 2L7RA 5CHWA 4E71A 1WXVA 2ZEQA 3M95A 4LDTD 3A9JA 2JT4B 4NY0A 3M63B 1OTRB 4IC7B 4KIKA 4W9FA 2R2OA 3UF8A 1SE9A 3VTVA 2YLMA 1WR1A 4GU2A 4DHJB 2MBQA 3BINA 3CF6E 3VXWA 1H8CA 2KWVB 3D32A 4G3XB 4BKGA 3ZUNA 4MDKE 4B9KA 4BBNC 2L00B 5TR5A 1E8WA 1KJTA 3KVFB 3TL5A 3NHEB 1WH3A 4X57B 3NS8A 4PYUA 3QHTA 2L3ZA 3V62A 2O2VB 3JSVA 1X1MA 3PLUA 1SIFA 3C0RB 3H7PA 5L95C 3V61A 5GMVA 4ANWA 2ZPYA 3DVGX 3R3MA 4II3B 1C1YB 2EMTA 1IP9A 2KKCA 3MJWA 3TIXA 2UYZB 2IO2B 1E7VA 1UGMA 2CHZA 2V3SA 3APDA 4GMVA 3QJZA 2AL3A 5JZEB 3PREA 2Y5BB 4EFOA 2XEWA 3QQ8B 4TQ1A 3HK0A 2AL6A 3VTWA 1V81A 2J0MA 2HJ8A 2G4DB 2MBOA 3DQVA 3QIJA 3M62B 4DHZB 3PPAA 2L0FA 2DAFA 2KANA 4ANUA 3N32A 4MSMB 3T8MA 2AWTA 3SDLC 4CHKA 1U4AA 4AUQC 1YJ1A 3WIMA 2MLBA 2BYFA 3JW0X 2LGDA 1GG3A 5AZFA 4HXDA 2KDFB 4MJSB 5D2MB 3ZRCA 2KZRA 2CS4A 4HCNB 1FXTB 3A4RA 2C7HA 2M0XA 1WX8A 2MWSB 3CMMB 4TQ0A 1AARA 4KDLB 3NZUA 3TMPB 2AYOB 1KM7A 3AI5A 1IYFA 3VVWB 3APCA 3WALA 1WM2A 3EFUA 2KWCA 3TCAA 3A1QB 5LLIA 1WX7A 3RYTA 4LJOB 2A4ZA 2CHWA 4DDGD 2N9PC 2NBWB 4WAAA 3ZNZB 4TUUA 2LI5A 1YQBA 4TV3A 4BBNF 1WJ4A 2M17A 3PZDA 4DK5A 4DWFA 1HE8A 3L17A 2GBRA 2K8CA 2L05A 2N1VA 2Z0EB 3Q3JA 3UIOB 3CSTA 2JUOA 2LASA 4IG7B 2RSUA 4NJ6A 3T9LA 3PV1A 3I3TB 3QK0A 1UBIA 4W9HA 5CTRC 3OJ3A 1YIWA 4FHJA 3ZNID 3UGBB 3A4SC 2A5UA 2DYOA 1Q1OA 3ZDTA 2LVPA 4GDKA 3QWZB 4LJPB 3ZRFA 3VUYA 4P7IA 3ZVVA 2M4NA 4FBJB 5JHBA 1R4NI 2ZNVC 4FA6A 4HDQA 1WRDB 2LRUA 1WJUA 3KYCD 3ML8A 3PRMB 3VDZA 1WGHA 2N4FA 2KHWB 2KC1A 4ZDVA 5KHOA 3IHPC 3ONSA 1WMHB 2BYEA 2KQ7A 3KUDB 2XK5A 2KJ6A 4WQOB 3TJPA 4KSKC 4MM3A 3PS6A 3V60A 2D11A 2KDEB 2KOXA 2WX0A 4IM3A 3H9DA 2N1WA 4MGIE 1V6EA 2K1FA 5JH5C 4GDLB 4GSWA 4IUMB 4N9F4 5AZGA 1H4RA 3DBSA 2PPHA 3HIZA 3ZTCA 1GNUA 2CU1A 2NPTB 2ZZPB 2KTRB 3WA0A 2K6DB 1I42A 4K81A 4KV2A 1WE6A 3IG3A 4MGYE 3UIPB 2PE6B 2K8BA 2DYMA 3A33B 1BT0A 3PT2B 4W9GA 4XX5A 3DOWA 1NDDA 4K7WA 1WJ6A 1XD3B 3DBLI 4RM8A 4EZLA 2KLGA 3B0AA 2KO3A 1YX5B 3A9KB 2KDIA 2MW5A 3VUWA 1UBQA 1WZ0A 2JF5A 2C60A 2D3GA 4ANVA 2J0KA 3GZNI 2V1YA 2JZZA 3ECIA 1J8CA 3VFKA 3VUXA 3K9OB 2LXAA 2N9EB 4NJ7A 2C5LC 1TBEA 5DPTA 1WXSA 2B3AA 4HDOA 4IM2A 2FCNA 1ZGUB 4WWPA 3IBEA 1M94A 2I1KA 1P9DU 1P3QU 4E3CA 3DVNU 2K6QA 4MH0E 2BKRB 4W9CA 2JXXA 4NQKE 5DPWA 1P1AA 2RPQA 4IM0A 3N3KB 4AOFA 3X23A 2PE9A 2JRIB 4RMAA 2BKFA 1WIAA 3PHXB 3KH0A 4KZCA 3ML9A 5JHAA 2ZPNA 3QCAA 1LM8B 4KVGB 1J0GA 3A1QA 4AJYB 2MP2A 2WYQA 4DHJD 2CKHB 4IW0A 4WWOA 1LQBA 5C1ZA 2KVRA 2D2QA 1VCBA 3RT3B 2GBNA 4F1SA 2G3QB 3V6EB 3ZKJC 2KFJA 4DHZE 4MSQB 5LXHA 4K7SA 5EDSA 2NS5A 3RD2A 4GXBA 4WJQA 2J0JA 1Q0WB 3L13A 4G50A 3R7QA 4I6PA 1TGZB 4W9IA 1Y8RC 4GOCA 1KLVA 3QARA 3GOEA 4GGQA 1TZ1A 3DBHI 3ENEA 2JRHA 1K8RB 5J2RA 4RM9A 4A20A 3RCZA 2FCSA 3IFWB 4PS7A 4NQLB 2J7QB 2DX5B 2L76A 1Q5WB 1T0YA 2KMCA 4E74A 5CHFA 2WX1A 4W9KA 1GC7A 5IAAC 3ZIMA 2MA9B 4GB9A 5E6PA 1WF9A 1Z2MA 2FUHB 2RR9A 3ALBA 1YX6B 2ASQA 2KFKB 2NVUI 3V6CB 3DBRI 2EKEC 1V5OA 3DCGA 3HHMA 1WGYA 4LCDE 3WAOA 3U7DA 4G0NB 1Z5SB 1WGRA 3HM6X 1ZW7A 3AU5A 1UELA 1WMHA 2HD5B 3H7SA 5DPRA 4ASWC 4B95A 1OEYA 4XC2A 4FLHA 1OGWA 3DVGY 4A3OA 2KNBA 1RLFA 4AWJA 2BPSA 5G55A 3X0WA 5KHQA 4M8NA 3ZDMC 1V86A 4FJYA 4GDLA 1EUVB 2MRPA 1E5WA 2QHOA 4HPMB 1OEYJ 4ZRIA 2L0TA 2L8JA 4IWQA 2OOBB 2OJRA 3PGEA 5E6OA 2NPTA 4F8CB 2ZVOA 4JQWC 2KTRA 4ANXA 1RAXA 4MGZE 4FADA 4IWPA 2MSED 4HLEA 4B6WA 4KSLC 3M3JA 2N7EA 3AU4A 3OAWA 2LGXA 4GN1A 2IBIB 4GIVA 4FHKA 1WE7A 2HTHA 2NR2A 4DBGA 1ISNA 1WI0A 3JYUA 2DAJA 2FCMA 4HPLB 2PEAA 1VD2A 4BFRA 2O6VB 3A9KA 1P0RA 2LWPA 3PHWB 2NBVB 2MBBB 4DDID 4BOZB 2ZNVB 2GBJA 2FAZA 3L16A 1LFDA 4I6NB 4II2B 3RZFA 4XZ4A 3WAPA 2KWUB 4A3PA 1IPGA 2LVQA 5L83A 2AEHA 1V2YA 4WJOA 1UD7A 3UQAA 2IO0B 3PSEB 1I35A 1E8XA 4DXAB 2JWZA 2O2VA 4WJPA 2RGFA 2W9NA 3WANA 2LVOA 2D07B 1C3TA 2R2QA 4EEWA 4KZ0A 5BO4B 3L10B 2LUEA 2G4SA 4M0WB 4BKSA 3N30A 3KUZA 5DCNA
chains in the Genus database with same CATH superfamily
2UWQA 2KVZA 3EC8A 1ZDVA 3AE8B 2ZVNA 2G45B 3BY4B 1E90A 1PQSA 1GC6A 2GBMA 1I4QA 3NZSA 3LYYA 2EELA 4M02A 4NPNA 1P98A 4GDKB 1DGJA 1GAQB 4KKIA 1MG4A 3B9JA 2N7DA 4KKJA 4JE3B 1JWAD 3Q8BA 3AM9A 1N5XA 4HVBA 4I6LB 2FNJB 2MBHA 1V49A 2LGSA 2LJ5A 2IJ0A 5BMIA 2CHXA 5AEKB 1QILA 3DVNV 3R7RA 4A90A 4OVVA 4XWWA 2DZIA 1P7EA 4BKTA 4W9DA 2FIFA 1UH6A 1BMLC 3Q3FA 4JIOU 4YSYB 2K39A 3CIRB 3P4PB 2D10A 1HZ5A 3Q69A 4DQOC 3E56A 2MJDA 3DPDA 3GS2A 3IVFA 5IKCM 2WXOA 3AXCA 2O6VA 1KLUD 3L08A 1JRPA 5G2NA 1NBFC 1SXTA 4XWTA 4J6IA 1DYQA 1QOFA 4K7UA 2KX3A 3NVWA 1LXDA 2YEPF 4FULA 1ZOYB 5E6JA 1B1ZA 3SD5A 4WWNA 2W82A 2OHFA 3PLVA 2WXIA 1JWUD 3QAQA 1FD6A 1TYGB 2NCNA 2BTEA 5AZHA 3VQIA 2W3RA 1C4PA 1QZEA 3AEBB 2BF8B 4PS3A 3W1YA 4YXDB 1V9JA 3KYDD 4PS8A 2HE7A 4KGSA 1AN8A 2M1MA 4EZJA 2FUG1 1FRRA 4M00A 3I5JC 4XDDA 2KXJA 2PJHA 1XEEA 1C79A 1FEHA 4MEMA 1FFUA 2DLBA 4NAWA 2V4IB 4ZRKA 3BZDB 1K50A 3LDZE 2AQ3B 2DNFA 3ZNGC 1ENFA 4E71A 4LNNA 2ZEQA 4LDTD 3VRAB 2L83A 2WLBA 4NY0A 1FPYA 4IC7B 4HKQA 3U52E 2Y5PA 4W9FA 2K5PA 2R2OA 2RMMA 3VTVA 2ZW0A 3BINA 3VXWA 1H8CA 1V1PB 2LJIA 4USAA 1E8WA 3NHEB 4X57B 3QHTA 1BUIC 3V62A 2O2VB 3JSVA 3C0RB 4EE2A 2YEPB 1C1YB 3ZQ4A 3SFEB 2GI9A 1E7VA 1UGMA 2CHZA 2V3SA 3QJZA 2AL3A 1IUEA 4EFOA 4OVZA 4QAYA 1IBXB 1ET6A 3PPAA 2DAFA 2W3SA 1U4AA 3W5UB 2WXMA 1OQRA 2BYFA 3JW0X 2LGDA 4HXDA 3URYA 3ZRCA 2CS4A 4HCNB 3HVZA 3CMMB 1AARA 2AYOB 3AI5A 3VVWB 3WALA 5BMGA 3NVZA 4LJOB 3EA6A 2J52A 1UGJA 1YOVB 3Q6BA 1YQBA 4TV3A 2M17A 1HA5A 5G5HA 1L0VB 2BS4B 1I4GA 1HE8A 4K3BA 3L17A 2K8CA 3PO0A 2Z0EB 3P1MA 3I3TB 1GPXA 1L5PA 5CTRC 2DWQA 3AEDB 1YN5A 1T3QA 2DYOA 1Q1OA 2JU6X 1EWCA 4RH6A 3VUYA 5JHBA 2K9XA 1EM7A 1UNSA 2LRUA 1WJUA 3ML8A 1WRIA 2E3TA 3AEFB 3TJPA 4WURA 1N61A 1KRHA 3IT4B 4IM3A 2QC8A 5JH5C 4GDLB 4JWUC 3EGRA 5AZGA 3U2SC 3AE7B 1RWSA 3WA0A 2K6DB 4KV2A 3IG3A 1RYJA 1PDXA 2PE6B 2K8BA 4XX5A 4W9GA 3DOWA 1WJ6A 3DBLI 3A9KB 3AECB 3VUWA 4PT5A 4ANVA 3GZNI 2V1YA 3N1YC 2LXAA 1J7CA 4HDOA 4L2YA 4ARCA 5IN7A 1ZGUB 1M94A 2Y5CA 1P9DU 2K6QA 1SJHD 3AEAB 4IM0A 3N3KB 4AOFA 3X23A 3CWIA 1ZXIA 1LM8B 3A1QA 4AJYB 2MP2A 1QOBA 1LQBA 3R8BA 5C1ZA 2D2QA 1IGCA 1QOGA 4N58A 4DHZE 5LXHA 2KFJA 2LMCA 1J7AA 4ZOHC 4K7SA 4GXBA 3HUIA 2LUMA 1C4AA 4G50A 3L13A 1TGZB 5HFYA 5IP4D 4W9IA 1D6EC 2CJNA 1DOXA 5J2RA 5CHFA 2WX1A 4A8XC 5E6PA 1STEA 1Z2MA 2RR9A 1YX6B 2KFKB 5H92C 3V6CB 2ICIA 1NVID 4GLSC 2EKEC 1V5OA 3WAOA 1HTQA 1WGRA 2IDYA 1WMHA 2WXPA 5DPRA 4RGTA 1F2RC 4B95A 4C4VB 2Y3AA 1CZPA 2KNBA 4A3OA 3X0WA 1TS4A 2VZKD 1E10A 2TSSA 2QHOA 4ZRIA 5E6OA 4ANXA 4B6WA 4LK0M 4KSLC 2N7EA 2H88B 2SEBD 4GIVA 4A9AA 2HTHA 1WI0A 2AQ1B 2NTTA 3DHIC 2ZNVB 4C80A 4II2B 2KYWA 2KWUB 4A3PA 1IPGA 2LVQA 2AEHA 1V2YA 3RNFC 1UD7A 2IO0B 3PSEB 2RGFA 2W9NA 4RGNA 1DOYA 2PKOA 1C3TA 5BO4B 2RDHA 4IOIE 2JZPA 4BKSA 3Q14C 2L52A 3N30A 3RULA 1SB3C 2INDC 3TEYA 2JQRB 4XE0A 3KQ4A 3U30A 1GJZA 2QDFA 2N7JA 3W1SA 1EO6A 3AULA 3AH7A 2C9WB 3QC8B 4WQMA 3SHQA 4BVUC 1WYWB 2MCNB 4MJSA 4EKUA 4IKGA 4F7ZA 1HZ6A 2XK5B 1YD8U 3L54A 5E6NA 2IYDB 5D3IB 1FNUA 1TS2A 3AE9B 4CQNA 2LD9A 2YVCA 4HK2A 4RGMA 2GMIC 1WM3A 3C19A 3A9JB 1JQ4A 4KIKB 2BWFA 4NAMA 4NNJB 4DXGA 1JWMD 4AP4C 2K3UA 2LHDA 2Q5WD 1AWDA 3AE2B 2WWZA 2V9HA 2M56B 1I4RA 3H7PB 2NBUA 3SFDB 4ICUA 4A6QA 4YSXB 2RD0A 1OQYA 4JWSC 3RNCC 1AYFA 3DBLB 4ICVA 2KLCA 2LGYA 2LZ6A 4JX1C 4TMAB 3HM3A 2E6XA 3EHVA 4FXCA 5HKHA 2BGFA 1WR6E 3EECA 3P2BA 4ITKA 1XLQA 4HJKA 2KQSA 2I1JA 4HCPB 3BIID 4EZKA 3NOBA 2JVCA 1ESFA 3MJ5A 3L0WB 1D3ZA 1WZ3A 2BWES 2VRRB 2KC2A 2DENB 1WX9A 1WJNA 1EF5A 5D3DA 1S3SG 2KN4A 4JL9A 2KK8A 3GB1A 3V05A 4S0RA 3R66C 1NYQA 2JSVX 3TEWA 1WXMA 1M4VA 2IY0B 2BVCA 3NY5A 3N1XC 3O65B 3VH3B 1JMLA 1PGAA 1QQRA 1E7UA 5FR6A 4MGKE 1EF1A 2LHEA 2KX0A 4O1NA 2FIDA 2PVOD 3PVLA 1YN3A 2BYTA 3HVDA 3ZNHB 2L7RA 5CHWA 2WXQA 1XO3A 1I7HA 3UF8A 3Q3OC 1WR1A 3EUB2 1N62A 1JROA 4G3XB 5LNK1 1QKZA 2QSDA 1XCTL 1ZPSA 4LNFA 4IDIA 3T3OA 1WH3A 3I57A 2BT6A 3Q8CA 5L95C 3V61A 5GMVA 1R4NB 5JXVA 2ZPYA 3DVGX 4HKZE 2WS3B 1JWSD 2EMTA 1PYWD 1SSNA 4KX6B 5H8YE 3N20C 3MJWA 2G9HD 3APDA 4GMVA 1K52A 2Y5BB 3AV8A 3QQ8B 4TQ1A 3HK0A 3VTWA 2J0MA 3RPFC 3DQVA 1VLBA 2D5GA 4MSMB 2AWTA 3SDLC 4Q2JA 1YJ1A 1GG3A 2VZKB 5T8IA 1IGDA 4MT5A 3SR6A 1VZ7A 2M0XA 1WX8A 4KDLB 1YNTE 3H8HA 3O13A 4JPSA 5IOIA 1WM2A 1WX7A 3RYTA 2CHWA 4DDGD 2NBWB 4WAAA 3ZNZB 3KLSX 1XLOA 4B0EA 4BBNF 1WJ4A 3PZDA 4DK5A 2W55A 3ZXRA 4DWFA 2INNE 4HROA 1YJJA 2JUOA 2GB1A 4NJ6A 3T9LA 1XLPA 1UBIA 3OJ3A 1YIWA 3ZNID 3WCQA 1XLNA 3QWZB 3ZRFA 3RMKC 1FNVA 3ZVVA 3L4PA 4H2AA 3T3NA 2ZNVC 1N6ZA 2KMMA 1EU3A 4BZAA 3KYCD 2N4FA 2KAJA 3R2TA 2B76B 5KHOA 3IHPC 3ONSA 4ZRPA 1XCQL 2BYEA 3KUDB 1V1PA 2D3BA 3PS6A 3V60A 3H9DA 4MGIE 1V6EA 1YQ4B 2L32A 2WDRB 4IUMB 1FMAD 2WNMA 3TUOA 1GNUA 2CU1A 2NPTB 2ZZPB 2KTRB 4MGYE 1WE6A 2JXTA 2JYEA 4REZA 3A33B 1ET9A 1YQ3B 3B2FA 1NDDA 2PTLA 3IAM1 2KDIA 2MW5A 2C60A 4RF1A 2JZZA 2N9EB 2PVGC 2C5LC 2B3AA 2RDBC 2QIEB 3DHHC 2I1KA 3OG5A 5C3JB 4RGOS 3GE8C 3DVNU 1P1AA 3P42A 1L0YB 5AUKA 3PHXB 3UI3A 4KVGB 2WYQA 2WDVB 2KVRA 1VZ6A 4HRSA 2GBNA 2MH7A 1L0XB 1ZP0B 2K22A 4WJQA 2J0JA 3R7QA 4I6PA 4HEA1 1D4BA 1TZ1A 3ENEA 2JRHA 3ZJUA 4RM9A 3RCZA 4PS7A 1FRDA 4OHJA 2DX5B 2PMVA 4E74A 1P7FA 4W9KA 3V3XA 3ZIMA 2MA9B 4TSSA 2FUHB 5HI1A 2NVUI 3HHMA 1Z5SB 3HM6X 3AU5A 1MPEA 3EFCA 4D2KA 4AQ7A 1OEYA 4FLHA 3DVGY 1RLFA 5IO9A 4AWJA 5KHQA 2KT7A 1VJKA 4FJYA 4GDLA 4UDUC 4B0MA 2OJWA 2HDEA 2ZVOA 1FIQA 4FADA 2MSED 2D3CA 1XF5L 3AU4A 1SF0A 2BS2B 1WE7A 3FC4A 1T0QC 1TY2A 3A9KA 1P0RA 4LNKA 1PFDA 2GBJA 1WSPA 2FAZA 3L16A 4I6NB 2GRIA 4AS1A 3UQAA 1I35A 1E8XA 5EE9A 3WANA 1UWXA 2R2QA 1KFYB 3L10B 2PLPA 2I2YA 4M0WB 3KUZA 3P63A 2ZW1A 2ZCCA 3IT6B 3DDCB 2DHZA 4TKNA 3B08A 1F77A 4PYZA 4C7YA 2KD0A 2W54A 2K8HA 4K1RB 1GB1A 3AEEB 2KJRA 2KJHB 2Z8LA 2C7NB 4KDIC 1XT9B 1NI3A 3DHGC 5J17A 4YSZB 3PTFC 3Q3MC 1L2NA 4ZHPA 3I9V1 2IZVB 3KWLA 2WGSA 2JPHA 1Q10A 1E0ZA 2KFKA 2DYBA 3AMZA 4FN2A 2IO1B 5HG2A 1N60A 1R4MI 2JY6A 2MQJA 3BVZA 4W9LA 3R2IA 1TIFA 3W9CB 1RFAA 1V80A 4P1BC 1WYGA 4YL8A 2KDBA 2J42A 1MFWA 1SGHA 1BXTA 3AE4B 1ACCA 2FBWB 4A55A 3FILA 2GOWA 2FE8A 2ZCBA 1J19A 4EOYA 2V4LA 2DZJA 4W9EA 4XDCA 4M8MA 1WFYA 4WAFA 1VRAB 1TTNA 1RRBA 2SAKA 1S1QB 1UZXB 3SU8X 2KQ4X 2DZMA 3TEXA 2REXA 4OW0A 2V0GA 1E9MA 2Z0DB 1E8ZA 1K51A 2LRWA 4W9JA 2MP2B 2WXNA 2H89B 1WGGA 4N59A 4OZCA 4YTNB 3MC0B 2WXJA 3ZW3A 4AJWA 3PRPB 3NG0A 1C9FA 1A70A 5LXIB 4YT0B 5MPOA 3RNEC 4XYCA 2IY1B 1NEKB 1KOTA 2KTFA 1ZDXA 2MHJA 1DOIA 2XBBC 4FJZA 2WXFA 2L1AA 1A5RA 4LDTB 4JGHB 1SE4A 4RFBA 1EWYC 2OEDA 1JW9D 3MHSD 3PRZA 1E7PB 4YWGG 1C76A 3ZLZA 3KWVA 3PZ7A 2LEKA 4G11A 5C23A 2KN5A 3QA8A 2O6VD 5EE3A 3UQBA 1WXAA 2BQQA 1SEBD 1B9RA 3TBLD 3C8YA 2VH2A 3MTNB 2MBEA 4OVUA 4P6VF 3NVYA 3M95A 3A9JA 2JT4B 3M63B 1OTRB 4KIKA 2AX5A 3MC9A 1SE9A 4GU2A 4RF0A 1UWMA 3CF6E 2GLSA 2KWVB 4BKGA 3BK1A 4MM3B 2WHIA 4MDKE 2J4XA 4KGRA 3VR8B 4BBNC 2L00B 5TR5A 1KJTA 1SE2A 1FXIA 3NS8A 2L3ZA 1X1MA 1F1HA 1SIFA 2WP9B 3H7PA 3P4QB 4K3CA 4ANWA 3R3MA 4II3B 1IP9A 2KKCA 3TIXA 2IO2B 3PREA 2WDQB 5AUIA 3AB5A 1RM6C 3NRZA 1KTKA 2HJ8A 2G4DB 3QIJA 4DHZB 1GB4A 2CU3A 2WXLA 4ANUA 3DWMA 1SJED 1OFFA 4MJSB 2KDFB 5AZFA 3BYTB 5D2MB 2RDGA 3FAHA 1FXTB 4OZBA 1MHHE 4TQ0A 1TY0A 1KM7A 1IYFA 1QF6A 3APCA 2KWCA 3TCAA 2A4ZA 3GZNB 2N9PC 3VRBB 4TUUA 1YN4A 2MEKA 3I63C 3AEGB 4L1BA 2CJOA 2L05A 1L4DB 3Q3JA 2BW2A 3CSTA 2RSUA 3PV1A 2AQ2B 3MC8A 4C00A 3AE6B 2IGHA 2INPE 2LFIA 4GDKA 4LJPB 4P7IA 2M4NA 4HDQA 3N9YC 3PRMB 2INCC 3LB8C 1WGHA 1R4MB 2KHWB 2KC1A 4ZDVA 4M01A 2KQ7A 4WQOB 2KJ6A 4R3DA 2VH1A 4KSKC 1HXYD 2WX0A 2N1WA 2K1FA 1ZE3D 2G1EA 4GSWA 2K0PA 2ONQA 2X38A 3E9SA 1I4PA 3DBSA 3TSSA 2PPHA 2XNAC 4S17A 3ZYYX 1BT0A 3PT2B 2N9LA 2XN9C 4RM8A 4EZLA 2KLGA 4KGTA 3B0AA 3RNGC 1UBQA 1WZ0A 2JF5A 3ECIA 3VFKA 3Q3NC 4NJ7A 3BK2A 1KLGD 5DPTA 1WXSA 2NTSA 4IM2A 4WWPA 2IGGA 1P3QU 4HPPA 4E3CA 3LXFA 3MFGA 1F0ZA 2JXXA 4NQKE 1RFKA 1Y56A 2RPQA 5DPWA 2PE9A 4RMAA 2BKFA 3BWUD 5JHAA 3QCAA 4DHJD 4J3OD 2CKHB 3Q8FA 1QLBB 4P1CC 2RPVA 3V6EB 5EDSA 2NS5A 1V1OA 3W2DA 3RD2A 2JX5A 4LTUA 1KF6B 1WGKA 1Y8RC 4GOCA 1KLVA 3BYYB 1TS3A 3QARA 4GGQA 3DBHI 3NUHB 4A20A 2JYTA 4NQLB 2J7QB 2L76A 1Q5WB 4LNIA 2DBYA 1GC7A 1SE3A 4YTPB 3ALBA 2ASQA 3PZ8A 3DBRI 3U7ZA 3DCGA 4LCDE 1TKGA 4G0NB 2BBCA 1ZW7A 1JALA 3NJTA 1UELA 3Q8AA 2HD5B 3U4EG 4ASWC 1OGWA 5G55A 4M8NA 3ZDMC 4WWMA 2UU7A 1E5WA 2L0TA 2L8JA 5EE0A 2BS3B 2OJRA 3PGEA 2NPTA 4F8CB 2KTRA 1RAXA 4MGZE 4IWPA 4HLEA 2WXRA 3M3JA 3OAWA 4GN1A 2LGXA 2IBIB 1UF0A 2NR2A 3FKYA 4DBGA 1ISNA 5GXGB 4HPLB 3W5VB 4BFRA 2FCMA 1VD2A 3GP7A 2O6VB 2LWPA 1I4XA 4N6EB 2MBBB 4BOZB 3WAPA 1UUPA 4XZ4A 1XXGA 5L83A 1FM0D 1V8CA 2JWZA 2O2VA 4WIPA 4EEWA 4KZ0A 2LUEA 2QILA 3BVGA 5DCNA 1JCKB 4MH8A 1KH0A 2K25A 2DZKA 1ZKHA 2ZJDA 3CSFA 1FNWA 2M0AA 1E8YA 1IBXA 2N0SB 3RN9C 2N9XA 5CHVC 1F9JA 2EMSA 3RUIB 3KUCB 2EKIA 5BYRA 1D5XC 1VZ8A 1NENB 1FCLA 3ZXVA 3VHTC 3HRDD 3OJ4B 4ZYNA 3ZGZA 4C7ZA 2C7MB 3VAWA 2Z59B 5HHDG 4BOSC 3RFZB 2MX2A 4EUTA 4JLCA 4CYEA 1WY8A 1YJIA 2JZ3B 2KMAA 4NJCA 1G6JA 3LJ3A 4NAWB 3VH4B 2KDMA 3AE5B 2CR5A 5BYQA 1J7BA 3VR9B 5D6JB 1HEZE 1WWTA 3APFA 3B1LX 3W1SC 5G5GA 5J18A 1CMXB 3QX1A 4BKSD 3H1UA 1CK1A 2BYVE 5D94A 3RI7C 3JVZX 4ZRQA 1GUAB 1TKEA 3IXSA 3OLMD 4MELA 1NI2A 3JSVB 1WGDA 3H6NA 1JRUA 3BVMA 1TS5A 2NMQA 3AN1A 4WJNA 1PGBA 1SBBB 3U8ZA 2IPKD 3N1ZC 4URKA 1MG8A 1VDVA 3WAMA 1HQRD 4YTMB 3RNAC 5EE1A 3IAS1 4HWIB 1T0RC 4IWOA 1V5TA 3ETRA 3UINB 2IO3B 4ZRJA 4XGAB 3ZO5B 4ZYSA 1L6UA 2WU2B 5DPSA 4M0WA 3RZWC 2FCQA 5FK9C 3S2AA 2WDTB 2M8SA 2HJ1A 1WXQA 4CO7A 2ACZB 1MVKA 3ZTDA 1D5ZC 1XQQA 2LXCA 3KW5B 1L7YA 2GBKA 5FKAC 4NZLB 3VTUA 4PK1A 3P4SB 5IA7A 4FJVB 3TEZA 1N5WA 3ZJVA 1T0SC 3DBHB 2KACA 2QMTA 5D7GA 5CX3A 3K9PB 1WXVA 3DBRB 1YMHE 2WU5B 2MJ3A 2YLMA 4DHJB 2MBQA 1MHXA 3D32A 3ZUNA 4B9KA 3NS1A 2QEJC 1FXAA 2D3AA 3KVFB 1SIJA 3TL5A 2WXHA 3NZ3A 4PYUA 4BAXA 1TKYA 4MACA 3PLUA 4WH4A 4C4VA 2MJEA 2UYZB 1MJDA 1D5MC 5JZEB 4LLGM 2XEWA 2LGIA 2AL6A 1V81A 2MBOA 3M62B 3ABVB 2L0FA 2KANA 3RNBC 3N32A 3T8MA 4CHKA 4AUQC 1QOAA 1ZXHA 1V97A 3WIMA 2MLBA 1R7SA 1TJEA 3MP9A 2KZRA 1ROEA 3A4RA 2C7HA 2MWSB 1I4HA 3NZUA 3TMPB 3P4RB 1PUTA 3EFUA 3A1QB 5LLIA 2R61A 1C77A 2LI5A 3J9CA 2X8XX 5BYSA 1T5XD 2GBRA 1N63A 2N1VA 2PW9A 3UIOB 1T6BX 2LASA 4IG7B 2QCZA 1ZUD2 3FILB 3QK0A 4ACFA 4HJGE 4W9HA 3AE3B 4FHJA 3UGBB 3A4SC 2A5UA 3ZDTA 3MHZA 2LVPA 3Q2AC 3Q8EA 4FBJB 1R4NI 4FA6A 1WRDB 3VDZA 3SEBA 5C2TB 1LGRA 2V3PA 1WMHB 4OZAA 1C4CA 1HTOA 2XK5A 4MM3A 2M19A 2HTME 1NYRA 2D11A 2KDEB 2KOXA 1CQVA 1AW7A 1QT9A 4N9F4 1H4RA 3HIZA 3ZTCA 1I42A 4K81A 3UIPB 3ZJTA 1OQQA 4ARIA 5FR3A 2DYMA 1LO5D 4K7WA 1XD3B 2KO3A 1YX5B 4DXFA 2D3GA 4RCOA 2J0KA 1F2RI 1J8CA 1TT5B 4ZHOA 3VUXA 3K9OB 2V3NA 1GOZA 4US9A 1TBEA 4US8A 2FCNA 3IBEA 1FFVA 4MH0E 2BKRB 4W9CA 3B2GA 2JRIB 1L6VA 1WIAA 3KH0A 4KZCA 3ML9A 2J53A 2ZPNA 4RNAA 1J0GA 5I4DA 5TSSA 4IW0A 4WWOA 2IGDA 1VCBA 3RT3B 1K53A 1L4ZB 4F1SA 2G3QB 3ZKJC 1TZOA 4MSQB 3AE1B 3DWGC 1Q0WB 2JWUA 4LNOA 3GOEA 1K8RB 2FCSA 3IFWB 2KWDA 1T0YA 2KMCA 5IAAC 4GB9A 1WF9A 1WGYA 3U7DA 1JWBD 3H7SA 2ON8A 4XC2A 1CJEA 4P16A 5BMHA 2BPSA 1V86A 2WXGA 1EUVB 3NVVA 2MRPA 2BB5A 1VR9A 4HPMB 1OEYJ 4IWQA 2OOBB 2N9KA 4JQWC 1FO4A 1F52A 2PIAA 1C78A 4FHKA 3JYUA 2DAJA 2PEAA 3PHWB 2NBVB 4DDID 2WQYB 1LFDA 1PGXA 3RZFA 3OWEB 2WXKA 2QJLA 3GE3C 1EU4A 1E6EB 4WJOA 4DXAB 4WJPA 4L23A 2BB6A 2LVOA 2D07B 4C56C 2I38A 2G4SA 1MI0A 1FCCC
chains in the Genus database with same CATH topology
2UWQA 3EC8A 2K25A 3RULA 2DZKA 2G45B 2ZVNA 3BY4B 2ZCCA 1E90A 1ZKHA 1PQSA 1GC6A 2ZJDA 2GBMA 3CSFA 3DDCB 1E8YA 3NZSA 2DHZA 3U30A 1GJZA 4TKNA 3B08A 2N9XA 4PYZA 5CHVC 3W1SA 2KD0A 1EO6A 1P98A 1F9JA 2EMSA 2K8HA 3AULA 3KUCB 4GDKB 4NPNA 3RUIB 2C9WB 3QC8B 3SHQA 4BVUC 1WYWB 4K1RB 2N7DA 2KJRA 2MCNB 3VHTC 4MJSA 3OJ4B 4EKUA 4ZYNA 2KJHB 4F7ZA 2C7NB 4KDIC 1XT9B 2C7MB 3VAWA 2Z59B 5J17A 2XK5B 4BOSC 1YD8U 2MX2A 3L54A 2IYDB 3PTFC 4I6LB 5E6NA 4EUTA 4JLCA 4HVBA 2FNJB 1L2NA 2MBHA 1V49A 2IZVB 4CYEA 1WY8A 2JZ3B 2LD9A 2LJ5A 2KMAA 2JPHA 2YVCA 2KFKA 1G6JA 2DYBA 4HK2A 3LJ3A 4FN2A 2CHXA 2IO1B 5AEKB 2GMIC 4NAWB 3DVNV 3R7RA 3VH4B 1R4MI 2JY6A 2MQJA 4W9LA 4OVVA 1WM3A 2CR5A 3A9JB 1RFAA 2DZIA 5D6JB 1V80A 4YL8A 2KDBA 4KIKB 2BWFA 4BKTA 1SGHA 3APFA 4W9DA 2FIFA 3B1LX 3W1SC 1UH6A 2GOWA 3Q3FA 4JIOU 1CMXB 5J18A 4NNJB 2K39A 3QX1A 4BKSD 2ZCBA 1J19A 3H1UA 2BYVE 5D94A 4AP4C 4EOYA 2D10A 2V4LA 3JVZX 2DZJA 4W9EA 4M8MA 1WFYA 3DPDA 1GUAB 1TTNA 1RRBA 3OLMD 1S1QB 3IVFA 2WWZA 4MELA 1NI2A 3JSVB 1WGDA 3AXCA 1JRUA 3H6NA 1UZXB 3H7PB 2NBUA 3SU8X 2O6VA 4ICUA 3L08A 4WJNA 2DZMA 5G2NA 2RD0A 1OQYA 1NBFC 2REXA 3U8ZA 2Z0DB 4J6IA 4URKA 4ICVA 2KLCA 1E8ZA 1MG8A 2LGYA 2LZ6A 3WAMA 3HM3A 2LRWA 4W9JA 2MP2B 3EHVA 5HKHA 1WGGA 4HWIB 2BGFA 4IWOA 1V5TA 4K7UA 2KX3A 1WR6E 3UINB 3ZW3A 2IO3B 3EECA 3P2BA 4ZRJA 1LXDA 4AJWA 3PRPB 4FULA 3ZO5B 3SD5A 4WWNA 3RZWC 5DPSA 4HJKA 2FCQA 2KQSA 3S2AA 3PLVA 2I1JA 4HCPB 5LXIB 2WDTB 4EZKA 2M8SA 3NOBA 2JVCA 3L0WB 2IY1B 1D3ZA 1KOTA 2KTFA 1WZ3A 3QAQA 4CO7A 3ZTDA 2BWES 2VRRB 2KC2A 2DENB 2NCNA 5AZHA 1WX9A 1WJNA 1XQQA 2LXCA 1EF5A 2XBBC 4FJZA 3VQIA 1S3SG 3KW5B 4JL9A 2KK8A 1QZEA 3R66C 2BF8B 1A5RA 1L7YA 4JGHB 4LDTB 1WXMA 2GBKA 4PS3A 3W1YA 2IY0B 1V9JA 3VTUA 3KYDD 3NY5A 4PS8A 2HE7A 3MHSD 3O65B 3PRZA 5IA7A 4FJVB 3VH3B 2M1MA 3ZLZA 1E7UA 4EZJA 5FR6A 4MGKE 1EF1A 4G11A 2KX0A 5C23A 2KXJA 2KN5A 3QA8A 2O6VD 2PJHA 2FIDA 4MEMA 5D7GA 3UQBA 1WXAA 3PVLA 3TBLD 5CX3A 4NAWA 3MTNB 2MBEA 4ZRKA 3LDZE 3ZNGC 4OVUA 3ZNHB 3K9PB 2L7RA 5CHWA 4E71A 1WXVA 2ZEQA 3M95A 4LDTD 3A9JA 2JT4B 4NY0A 3M63B 1OTRB 4IC7B 4KIKA 4W9FA 2R2OA 3UF8A 1SE9A 3VTVA 2YLMA 1WR1A 4GU2A 4DHJB 2MBQA 3BINA 3CF6E 3VXWA 1H8CA 2KWVB 3D32A 4G3XB 4BKGA 3ZUNA 4MDKE 4B9KA 4BBNC 2L00B 5TR5A 1E8WA 1KJTA 3KVFB 3TL5A 3NHEB 1WH3A 4X57B 3NS8A 4PYUA 3QHTA 2L3ZA 3V62A 2O2VB 3JSVA 1X1MA 3PLUA 1SIFA 3C0RB 3H7PA 5L95C 3V61A 5GMVA 4ANWA 2ZPYA 3DVGX 3R3MA 4II3B 1C1YB 2EMTA 1IP9A 2KKCA 3MJWA 3TIXA 2UYZB 2IO2B 1E7VA 1UGMA 2CHZA 2V3SA 3APDA 4GMVA 3QJZA 2AL3A 5JZEB 3PREA 2Y5BB 4EFOA 2XEWA 3QQ8B 4TQ1A 3HK0A 2AL6A 3VTWA 1V81A 2J0MA 2HJ8A 2G4DB 2MBOA 3DQVA 3QIJA 3M62B 4DHZB 3PPAA 2L0FA 2DAFA 2KANA 4ANUA 3N32A 4MSMB 3T8MA 2AWTA 3SDLC 4CHKA 1U4AA 4AUQC 1YJ1A 3WIMA 2MLBA 2BYFA 3JW0X 2LGDA 1GG3A 5AZFA 4HXDA 2KDFB 4MJSB 5D2MB 3ZRCA 2KZRA 2CS4A 4HCNB 1FXTB 3A4RA 2C7HA 2M0XA 1WX8A 2MWSB 3CMMB 4TQ0A 1AARA 4KDLB 3NZUA 3TMPB 2AYOB 1KM7A 3AI5A 1IYFA 3VVWB 3APCA 3WALA 1WM2A 3EFUA 2KWCA 3TCAA 3A1QB 5LLIA 1WX7A 3RYTA 4LJOB 2A4ZA 2CHWA 4DDGD 2N9PC 2NBWB 4WAAA 3ZNZB 4TUUA 2LI5A 1YQBA 4TV3A 4BBNF 1WJ4A 2M17A 3PZDA 4DK5A 4DWFA 1HE8A 3L17A 2GBRA 2K8CA 2L05A 2N1VA 2Z0EB 3Q3JA 3UIOB 3CSTA 2JUOA 2LASA 4IG7B 2RSUA 4NJ6A 3T9LA 3PV1A 3I3TB 3QK0A 1UBIA 4W9HA 5CTRC 3OJ3A 1YIWA 4FHJA 3ZNID 3UGBB 3A4SC 2A5UA 2DYOA 1Q1OA 3ZDTA 2LVPA 4GDKA 3QWZB 4LJPB 3ZRFA 3VUYA 4P7IA 3ZVVA 2M4NA 4FBJB 5JHBA 1R4NI 2ZNVC 4FA6A 4HDQA 1WRDB 2LRUA 1WJUA 3KYCD 3ML8A 3PRMB 3VDZA 1WGHA 2N4FA 2KHWB 2KC1A 4ZDVA 5KHOA 3IHPC 3ONSA 1WMHB 2BYEA 2KQ7A 3KUDB 2XK5A 2KJ6A 4WQOB 3TJPA 4KSKC 4MM3A 3PS6A 3V60A 2D11A 2KDEB 2KOXA 2WX0A 4IM3A 3H9DA 2N1WA 4MGIE 1V6EA 2K1FA 5JH5C 4GDLB 4GSWA 4IUMB 4N9F4 5AZGA 1H4RA 3DBSA 2PPHA 3HIZA 3ZTCA 1GNUA 2CU1A 2NPTB 2ZZPB 2KTRB 3WA0A 2K6DB 1I42A 4K81A 4KV2A 1WE6A 3IG3A 4MGYE 3UIPB 2PE6B 2K8BA 2DYMA 3A33B 1BT0A 3PT2B 4W9GA 4XX5A 3DOWA 1NDDA 4K7WA 1WJ6A 1XD3B 3DBLI 4RM8A 4EZLA 2KLGA 3B0AA 2KO3A 1YX5B 3A9KB 2KDIA 2MW5A 3VUWA 1UBQA 1WZ0A 2JF5A 2C60A 2D3GA 4ANVA 2J0KA 3GZNI 2V1YA 2JZZA 3ECIA 1J8CA 3VFKA 3VUXA 3K9OB 2LXAA 2N9EB 4NJ7A 2C5LC 1TBEA 5DPTA 1WXSA 2B3AA 4HDOA 4IM2A 2FCNA 1ZGUB 4WWPA 3IBEA 1M94A 2I1KA 1P9DU 1P3QU 4E3CA 3DVNU 2K6QA 4MH0E 2BKRB 4W9CA 2JXXA 4NQKE 5DPWA 1P1AA 2RPQA 4IM0A 3N3KB 4AOFA 3X23A 2PE9A 2JRIB 4RMAA 2BKFA 1WIAA 3PHXB 3KH0A 4KZCA 3ML9A 5JHAA 2ZPNA 3QCAA 1LM8B 4KVGB 1J0GA 3A1QA 4AJYB 2MP2A 2WYQA 4DHJD 2CKHB 4IW0A 4WWOA 1LQBA 5C1ZA 2KVRA 2D2QA 1VCBA 3RT3B 2GBNA 4F1SA 2G3QB 3V6EB 3ZKJC 2KFJA 4DHZE 4MSQB 5LXHA 4K7SA 5EDSA 2NS5A 3RD2A 4GXBA 4WJQA 2J0JA 1Q0WB 3L13A 4G50A 3R7QA 4I6PA 1TGZB 4W9IA 1Y8RC 4GOCA 1KLVA 3QARA 3GOEA 4GGQA 1TZ1A 3DBHI 3ENEA 2JRHA 1K8RB 5J2RA 4RM9A 4A20A 3RCZA 2FCSA 3IFWB 4PS7A 4NQLB 2J7QB 2DX5B 2L76A 1Q5WB 1T0YA 2KMCA 4E74A 5CHFA 2WX1A 4W9KA 1GC7A 5IAAC 3ZIMA 2MA9B 4GB9A 5E6PA 1WF9A 1Z2MA 2FUHB 2RR9A 3ALBA 1YX6B 2ASQA 2KFKB 2NVUI 3V6CB 3DBRI 2EKEC 1V5OA 3DCGA 3HHMA 1WGYA 4LCDE 3WAOA 3U7DA 4G0NB 1Z5SB 1WGRA 3HM6X 1ZW7A 3AU5A 1UELA 1WMHA 2HD5B 3H7SA 5DPRA 4ASWC 4B95A 1OEYA 4XC2A 4FLHA 1OGWA 3DVGY 4A3OA 2KNBA 1RLFA 4AWJA 2BPSA 5G55A 3X0WA 5KHQA 4M8NA 3ZDMC 1V86A 4FJYA 4GDLA 1EUVB 2MRPA 1E5WA 2QHOA 4HPMB 1OEYJ 4ZRIA 2L0TA 2L8JA 4IWQA 2OOBB 2OJRA 3PGEA 5E6OA 2NPTA 4F8CB 2ZVOA 4JQWC 2KTRA 4ANXA 1RAXA 4MGZE 4FADA 4IWPA 2MSED 4HLEA 4B6WA 4KSLC 3M3JA 2N7EA 3AU4A 3OAWA 2LGXA 4GN1A 2IBIB 4GIVA 4FHKA 1WE7A 2HTHA 2NR2A 4DBGA 1ISNA 1WI0A 3JYUA 2DAJA 2FCMA 4HPLB 2PEAA 1VD2A 4BFRA 2O6VB 3A9KA 1P0RA 2LWPA 3PHWB 2NBVB 2MBBB 4DDID 4BOZB 2ZNVB 2GBJA 2FAZA 3L16A 1LFDA 4I6NB 4II2B 3RZFA 4XZ4A 3WAPA 2KWUB 4A3PA 1IPGA 2LVQA 5L83A 2AEHA 1V2YA 4WJOA 1UD7A 3UQAA 2IO0B 3PSEB 1I35A 1E8XA 4DXAB 2JWZA 2O2VA 4WJPA 2RGFA 2W9NA 3WANA 2LVOA 2D07B 1C3TA 2R2QA 4EEWA 4KZ0A 5BO4B 3L10B 2LUEA 2G4SA 4M0WB 4BKSA 3N30A 3KUZA 5DCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWQ A;  3EC8 A;  2K25 A;  3RUL A;  2DZK A;  2G45 B;  2ZVN A;  3BY4 B;  2ZCC A;  1E90 A;  1ZKH A;  1PQS A;  1GC6 A;  2ZJD A;  2GBM A;  3CSF A;  3DDC B;  1E8Y A;  3NZS A;  2DHZ A;  3U30 A;  1GJZ A;  4TKN A;  3B08 A;  2N9X A;  4PYZ A;  5CHV C;  3W1S A;  2KD0 A;  1EO6 A;  1P98 A;  1F9J A;  2EMS A;  2K8H A;  3AUL A;  3KUC B;  4GDK B;  4NPN A;  3RUI B;  2C9W B;  3QC8 B;  3SHQ A;  4BVU C;  1WYW B;  4K1R B;  2N7D A;  2KJR A;  2MCN B;  3VHT C;  4MJS A;  3OJ4 B;  4EKU A;  4ZYN A;  2KJH B;  4F7Z A;  2C7N B;  4KDI C;  1XT9 B;  2C7M B;  3VAW A;  2Z59 B;  5J17 A;  2XK5 B;  4BOS C;  1YD8 U;  2MX2 A;  3L54 A;  2IYD B;  3PTF C;  4I6L B;  5E6N A;  4EUT A;  4JLC A;  4HVB A;  2FNJ B;  1L2N A;  2MBH A;  1V49 A;  2IZV B;  4CYE A;  1WY8 A;  2JZ3 B;  2LD9 A;  2LJ5 A;  2KMA A;  2JPH A;  2YVC A;  2KFK A;  1G6J A;  2DYB A;  4HK2 A;  3LJ3 A;  4FN2 A;  2CHX A;  2IO1 B;  5AEK B;  2GMI C;  4NAW B;  3DVN V;  3R7R A;  3VH4 B;  1R4M I;  2JY6 A;  2MQJ A;  4W9L A;  4OVV A;  1WM3 A;  2CR5 A;  3A9J B;  1RFA A;  2DZI A;  5D6J B;  1V80 A;  4YL8 A;  2KDB A;  4KIK B;  2BWF A;  4BKT A;  1SGH A;  3APF A;  4W9D A;  2FIF A;  3B1L X;  3W1S C;  1UH6 A;  2GOW A;  3Q3F A;  4JIO U;  1CMX B;  5J18 A;  4NNJ B;  2K39 A;  3QX1 A;  4BKS D;  2ZCB A;  1J19 A;  3H1U A;  2BYV E;  5D94 A;  4AP4 C;  4EOY A;  2D10 A;  2V4L A;  3JVZ X;  2DZJ A;  4W9E A;  4M8M A;  1WFY A;  3DPD A;  1GUA B;  1TTN A;  1RRB A;  3OLM D;  1S1Q B;  3IVF A;  2WWZ A;  4MEL A;  1NI2 A;  3JSV B;  1WGD A;  3AXC A;  1JRU A;  3H6N A;  1UZX B;  3H7P B;  2NBU A;  3SU8 X;  2O6V A;  4ICU A;  3L08 A;  4WJN A;  2DZM A;  5G2N A;  2RD0 A;  1OQY A;  1NBF C;  2REX A;  3U8Z A;  2Z0D B;  4J6I A;  4URK A;  4ICV A;  2KLC A;  1E8Z A;  1MG8 A;  2LGY A;  2LZ6 A;  3WAM A;  3HM3 A;  2LRW A;  4W9J A;  2MP2 B;  3EHV A;  5HKH A;  1WGG A;  4HWI B;  2BGF A;  4IWO A;  1V5T A;  4K7U A;  2KX3 A;  1WR6 E;  3UIN B;  3ZW3 A;  2IO3 B;  3EEC A;  3P2B A;  4ZRJ A;  1LXD A;  4AJW A;  3PRP B;  4FUL A;  3ZO5 B;  3SD5 A;  4WWN A;  3RZW C;  5DPS A;  4HJK A;  2FCQ A;  2KQS A;  3S2A A;  3PLV A;  2I1J A;  4HCP B;  5LXI B;  2WDT B;  4EZK A;  2M8S A;  3NOB A;  2JVC A;  3L0W B;  2IY1 B;  1D3Z A;  1KOT A;  2KTF A;  1WZ3 A;  3QAQ A;  4CO7 A;  3ZTD A;  2BWE S;  2VRR B;  2KC2 A;  2DEN B;  2NCN A;  5AZH A;  1WX9 A;  1WJN A;  1XQQ A;  2LXC A;  1EF5 A;  2XBB C;  4FJZ A;  3VQI A;  1S3S G;  3KW5 B;  4JL9 A;  2KK8 A;  1QZE A;  3R66 C;  2BF8 B;  1A5R A;  1L7Y A;  4JGH B;  4LDT B;  1WXM A;  2GBK A;  4PS3 A;  3W1Y A;  2IY0 B;  1V9J A;  3VTU A;  3KYD D;  3NY5 A;  4PS8 A;  2HE7 A;  3MHS D;  3O65 B;  3PRZ A;  5IA7 A;  4FJV B;  3VH3 B;  2M1M A;  3ZLZ A;  1E7U A;  4EZJ A;  5FR6 A;  4MGK E;  1EF1 A;  4G11 A;  2KX0 A;  5C23 A;  2KXJ A;  2KN5 A;  3QA8 A;  2O6V D;  2PJH A;  2FID A;  4MEM A;  5D7G A;  3UQB A;  1WXA A;  3PVL A;  3TBL D;  5CX3 A;  4NAW A;  3MTN B;  2MBE A;  4ZRK A;  3LDZ E;  3ZNG C;  4OVU A;  3ZNH B;  3K9P B;  2L7R A;  5CHW A;  4E71 A;  1WXV A;  2ZEQ A;  3M95 A;  4LDT D;  3A9J A;  2JT4 B;  4NY0 A;  3M63 B;  1OTR B;  4IC7 B;  4KIK A;  4W9F A;  2R2O A;  3UF8 A;  1SE9 A;  3VTV A;  2YLM A;  1WR1 A;  4GU2 A;  4DHJ B;  2MBQ A;  3BIN A;  3CF6 E;  3VXW A;  1H8C A;  2KWV B;  3D32 A;  4G3X B;  4BKG A;  3ZUN A;  4MDK E;  4B9K A;  4BBN C;  2L00 B;  5TR5 A;  1E8W A;  1KJT A;  3KVF B;  3TL5 A;  3NHE B;  1WH3 A;  4X57 B;  3NS8 A;  4PYU A;  3QHT A;  2L3Z A;  3V62 A;  2O2V B;  3JSV A;  1X1M A;  3PLU A;  1SIF A;  3C0R B;  3H7P A;  5L95 C;  3V61 A;  5GMV A;  4ANW A;  2ZPY A;  3DVG X;  3R3M A;  4II3 B;  1C1Y B;  2EMT A;  1IP9 A;  2KKC A;  3MJW A;  3TIX A;  2UYZ B;  2IO2 B;  1E7V A;  1UGM A;  2CHZ A;  2V3S A;  3APD A;  4GMV A;  3QJZ A;  2AL3 A;  5JZE B;  3PRE A;  2Y5B B;  4EFO A;  2XEW A;  3QQ8 B;  4TQ1 A;  3HK0 A;  2AL6 A;  3VTW A;  1V81 A;  2J0M A;  2HJ8 A;  2G4D B;  2MBO A;  3DQV A;  3QIJ A;  3M62 B;  4DHZ B;  3PPA A;  2L0F A;  2DAF A;  2KAN A;  4ANU A;  3N32 A;  4MSM B;  3T8M A;  2AWT A;  3SDL C;  4CHK A;  1U4A A;  4AUQ C;  1YJ1 A;  3WIM A;  2MLB A;  2BYF A;  3JW0 X;  2LGD A;  1GG3 A;  5AZF A;  4HXD A;  2KDF B;  4MJS B;  5D2M B;  3ZRC A;  2KZR A;  2CS4 A;  4HCN B;  1FXT B;  3A4R A;  2C7H A;  2M0X A;  1WX8 A;  2MWS B;  3CMM B;  4TQ0 A;  1AAR A;  4KDL B;  3NZU A;  3TMP B;  2AYO B;  1KM7 A;  3AI5 A;  1IYF A;  3VVW B;  3APC A;  3WAL A;  1WM2 A;  3EFU A;  2KWC A;  3TCA A;  3A1Q B;  5LLI A;  1WX7 A;  3RYT A;  4LJO B;  2A4Z A;  2CHW A;  4DDG D;  2N9P C;  2NBW B;  4WAA A;  3ZNZ B;  4TUU A;  2LI5 A;  1YQB A;  4TV3 A;  4BBN F;  1WJ4 A;  2M17 A;  3PZD A;  4DK5 A;  4DWF A;  1HE8 A;  3L17 A;  2GBR A;  2K8C A;  2L05 A;  2N1V A;  2Z0E B;  3Q3J A;  3UIO B;  3CST A;  2JUO A;  2LAS A;  4IG7 B;  2RSU A;  4NJ6 A;  3T9L A;  3PV1 A;  3I3T B;  3QK0 A;  1UBI A;  4W9H A;  5CTR C;  3OJ3 A;  1YIW A;  4FHJ A;  3ZNI D;  3UGB B;  3A4S C;  2A5U A;  2DYO A;  1Q1O A;  3ZDT A;  2LVP A;  4GDK A;  3QWZ B;  4LJP B;  3ZRF A;  3VUY A;  4P7I A;  3ZVV A;  2M4N A;  4FBJ B;  5JHB A;  1R4N I;  2ZNV C;  4FA6 A;  4HDQ A;  1WRD B;  2LRU A;  1WJU A;  3KYC D;  3ML8 A;  3PRM B;  3VDZ A;  1WGH A;  2N4F A;  2KHW B;  2KC1 A;  4ZDV A;  5KHO A;  3IHP C;  3ONS A;  1WMH B;  2BYE A;  2KQ7 A;  3KUD B;  2XK5 A;  2KJ6 A;  4WQO B;  3TJP A;  4KSK C;  4MM3 A;  3PS6 A;  3V60 A;  2D11 A;  2KDE B;  2KOX A;  2WX0 A;  4IM3 A;  3H9D A;  2N1W A;  4MGI E;  1V6E A;  2K1F A;  5JH5 C;  4GDL B;  4GSW A;  4IUM B;  4N9F 4;  5AZG A;  1H4R A;  3DBS A;  2PPH A;  3HIZ A;  3ZTC A;  1GNU A;  2CU1 A;  2NPT B;  2ZZP B;  2KTR B;  3WA0 A;  2K6D B;  1I42 A;  4K81 A;  4KV2 A;  1WE6 A;  3IG3 A;  4MGY E;  3UIP B;  2PE6 B;  2K8B A;  2DYM A;  3A33 B;  1BT0 A;  3PT2 B;  4W9G A;  4XX5 A;  3DOW A;  1NDD A;  4K7W A;  1WJ6 A;  1XD3 B;  3DBL I;  4RM8 A;  4EZL A;  2KLG A;  3B0A A;  2KO3 A;  1YX5 B;  3A9K B;  2KDI A;  2MW5 A;  3VUW A;  1UBQ A;  1WZ0 A;  2JF5 A;  2C60 A;  2D3G A;  4ANV A;  2J0K A;  3GZN I;  2V1Y A;  2JZZ A;  3ECI A;  1J8C A;  3VFK A;  3VUX A;  3K9O B;  2LXA A;  2N9E B;  4NJ7 A;  2C5L C;  1TBE A;  5DPT A;  1WXS A;  2B3A A;  4HDO A;  4IM2 A;  2FCN A;  1ZGU B;  4WWP A;  3IBE A;  1M94 A;  2I1K A;  1P9D U;  1P3Q U;  4E3C A;  3DVN U;  2K6Q A;  4MH0 E;  2BKR B;  4W9C A;  2JXX A;  4NQK E;  5DPW A;  1P1A A;  2RPQ A;  4IM0 A;  3N3K B;  4AOF A;  3X23 A;  2PE9 A;  2JRI B;  4RMA A;  2BKF A;  1WIA A;  3PHX B;  3KH0 A;  4KZC A;  3ML9 A;  5JHA A;  2ZPN A;  3QCA A;  1LM8 B;  4KVG B;  1J0G A;  3A1Q A;  4AJY B;  2MP2 A;  2WYQ A;  4DHJ D;  2CKH B;  4IW0 A;  4WWO A;  1LQB A;  5C1Z A;  2KVR A;  2D2Q A;  1VCB A;  3RT3 B;  2GBN A;  4F1S A;  2G3Q B;  3V6E B;  3ZKJ C;  2KFJ A;  4DHZ E;  4MSQ B;  5LXH A;  4K7S A;  5EDS A;  2NS5 A;  3RD2 A;  4GXB A;  4WJQ A;  2J0J A;  1Q0W B;  3L13 A;  4G50 A;  3R7Q A;  4I6P A;  1TGZ B;  4W9I A;  1Y8R C;  4GOC A;  1KLV A;  3QAR A;  3GOE A;  4GGQ A;  1TZ1 A;  3DBH I;  3ENE A;  2JRH A;  1K8R B;  5J2R A;  4RM9 A;  4A20 A;  3RCZ A;  2FCS A;  3IFW B;  4PS7 A;  4NQL B;  2J7Q B;  2DX5 B;  2L76 A;  1Q5W B;  1T0Y A;  2KMC A;  4E74 A;  5CHF A;  2WX1 A;  4W9K A;  1GC7 A;  5IAA C;  3ZIM A;  2MA9 B;  4GB9 A;  5E6P A;  1WF9 A;  1Z2M A;  2FUH B;  2RR9 A;  3ALB A;  1YX6 B;  2ASQ A;  2KFK B;  2NVU I;  3V6C B;  3DBR I;  2EKE C;  1V5O A;  3DCG A;  3HHM A;  1WGY A;  4LCD E;  3WAO A;  3U7D A;  4G0N B;  1Z5S B;  1WGR A;  3HM6 X;  1ZW7 A;  3AU5 A;  1UEL A;  1WMH A;  2HD5 B;  3H7S A;  5DPR A;  4ASW C;  4B95 A;  1OEY A;  4XC2 A;  4FLH A;  1OGW A;  3DVG Y;  4A3O A;  2KNB A;  1RLF A;  4AWJ A;  2BPS A;  5G55 A;  3X0W A;  5KHQ A;  4M8N A;  3ZDM C;  1V86 A;  4FJY A;  4GDL A;  1EUV B;  2MRP A;  1E5W A;  2QHO A;  4HPM B;  1OEY J;  4ZRI A;  2L0T A;  2L8J A;  4IWQ A;  2OOB B;  2OJR A;  3PGE A;  5E6O A;  2NPT A;  4F8C B;  2ZVO A;  4JQW C;  2KTR A;  4ANX A;  1RAX A;  4MGZ E;  4FAD A;  4IWP A;  2MSE D;  4HLE A;  4B6W A;  4KSL C;  3M3J A;  2N7E A;  3AU4 A;  3OAW A;  2LGX A;  4GN1 A;  2IBI B;  4GIV A;  4FHK A;  1WE7 A;  2HTH A;  2NR2 A;  4DBG A;  1ISN A;  1WI0 A;  3JYU A;  2DAJ A;  2FCM A;  4HPL B;  2PEA A;  1VD2 A;  4BFR A;  2O6V B;  3A9K A;  1P0R A;  2LWP A;  3PHW B;  2NBV B;  2MBB B;  4DDI D;  4BOZ B;  2ZNV B;  2GBJ A;  2FAZ A;  3L16 A;  1LFD A;  4I6N B;  4II2 B;  3RZF A;  4XZ4 A;  3WAP A;  2KWU B;  4A3P A;  1IPG A;  2LVQ A;  5L83 A;  2AEH A;  1V2Y A;  4WJO A;  1UD7 A;  3UQA A;  2IO0 B;  3PSE B;  1I35 A;  1E8X A;  4DXA B;  2JWZ A;  2O2V A;  4WJP A;  2RGF A;  2W9N A;  3WAN A;  2LVO A;  2D07 B;  1C3T A;  2R2Q A;  4EEW A;  4KZ0 A;  5BO4 B;  3L10 B;  2LUE A;  2G4S A;  4M0W B;  4BKS A;  3N30 A;  3KUZ A;  5DCN A; 
#chains in the Genus database with same CATH topology
 2UWQ A;  2KVZ A;  3EC8 A;  1ZDV A;  3AE8 B;  2ZVN A;  2G45 B;  3BY4 B;  1E90 A;  1PQS A;  1GC6 A;  2GBM A;  1I4Q A;  3NZS A;  3LYY A;  2EEL A;  4M02 A;  4NPN A;  1P98 A;  4GDK B;  1DGJ A;  1GAQ B;  4KKI A;  1MG4 A;  3B9J A;  2N7D A;  4KKJ A;  4JE3 B;  1JWA D;  3Q8B A;  3AM9 A;  1N5X A;  4HVB A;  4I6L B;  2FNJ B;  2MBH A;  1V49 A;  2LGS A;  2LJ5 A;  2IJ0 A;  5BMI A;  2CHX A;  5AEK B;  1QIL A;  3DVN V;  3R7R A;  4A90 A;  4OVV A;  4XWW A;  2DZI A;  1P7E A;  4BKT A;  4W9D A;  2FIF A;  1UH6 A;  1BML C;  3Q3F A;  4JIO U;  4YSY B;  2K39 A;  3CIR B;  3P4P B;  2D10 A;  1HZ5 A;  3Q69 A;  4DQO C;  3E56 A;  2MJD A;  3DPD A;  3GS2 A;  3IVF A;  5IKC M;  2WXO A;  3AXC A;  2O6V A;  1KLU D;  3L08 A;  1JRP A;  5G2N A;  1NBF C;  1SXT A;  4XWT A;  4J6I A;  1DYQ A;  1QOF A;  4K7U A;  2KX3 A;  3NVW A;  1LXD A;  2YEP F;  4FUL A;  1ZOY B;  5E6J A;  1B1Z A;  3SD5 A;  4WWN A;  2W82 A;  2OHF A;  3PLV A;  2WXI A;  1JWU D;  3QAQ A;  1FD6 A;  1TYG B;  2NCN A;  2BTE A;  5AZH A;  3VQI A;  2W3R A;  1C4P A;  1QZE A;  3AEB B;  2BF8 B;  4PS3 A;  3W1Y A;  4YXD B;  1V9J A;  3KYD D;  4PS8 A;  2HE7 A;  4KGS A;  1AN8 A;  2M1M A;  4EZJ A;  2FUG 1;  1FRR A;  4M00 A;  3I5J C;  4XDD A;  2KXJ A;  2PJH A;  1XEE A;  1C79 A;  1FEH A;  4MEM A;  1FFU A;  2DLB A;  4NAW A;  2V4I B;  4ZRK A;  3BZD B;  1K50 A;  3LDZ E;  2AQ3 B;  2DNF A;  3ZNG C;  1ENF A;  4E71 A;  4LNN A;  2ZEQ A;  4LDT D;  3VRA B;  2L83 A;  2WLB A;  4NY0 A;  1FPY A;  4IC7 B;  4HKQ A;  3U52 E;  2Y5P A;  4W9F A;  2K5P A;  2R2O A;  2RMM A;  3VTV A;  2ZW0 A;  3BIN A;  3VXW A;  1H8C A;  1V1P B;  2LJI A;  4USA A;  1E8W A;  3NHE B;  4X57 B;  3QHT A;  1BUI C;  3V62 A;  2O2V B;  3JSV A;  3C0R B;  4EE2 A;  2YEP B;  1C1Y B;  3ZQ4 A;  3SFE B;  2GI9 A;  1E7V A;  1UGM A;  2CHZ A;  2V3S A;  3QJZ A;  2AL3 A;  1IUE A;  4EFO A;  4OVZ A;  4QAY A;  1IBX B;  1ET6 A;  3PPA A;  2DAF A;  2W3S A;  1U4A A;  3W5U B;  2WXM A;  1OQR A;  2BYF A;  3JW0 X;  2LGD A;  4HXD A;  3URY A;  3ZRC A;  2CS4 A;  4HCN B;  3HVZ A;  3CMM B;  1AAR A;  2AYO B;  3AI5 A;  3VVW B;  3WAL A;  5BMG A;  3NVZ A;  4LJO B;  3EA6 A;  2J52 A;  1UGJ A;  1YOV B;  3Q6B A;  1YQB A;  4TV3 A;  2M17 A;  1HA5 A;  5G5H A;  1L0V B;  2BS4 B;  1I4G A;  1HE8 A;  4K3B A;  3L17 A;  2K8C A;  3PO0 A;  2Z0E B;  3P1M A;  3I3T B;  1GPX A;  1L5P A;  5CTR C;  2DWQ A;  3AED B;  1YN5 A;  1T3Q A;  2DYO A;  1Q1O A;  2JU6 X;  1EWC A;  4RH6 A;  3VUY A;  5JHB A;  2K9X A;  1EM7 A;  1UNS A;  2LRU A;  1WJU A;  3ML8 A;  1WRI A;  2E3T A;  3AEF B;  3TJP A;  4WUR A;  1N61 A;  1KRH A;  3IT4 B;  4IM3 A;  2QC8 A;  5JH5 C;  4GDL B;  4JWU C;  3EGR A;  5AZG A;  3U2S C;  3AE7 B;  1RWS A;  3WA0 A;  2K6D B;  4KV2 A;  3IG3 A;  1RYJ A;  1PDX A;  2PE6 B;  2K8B A;  4XX5 A;  4W9G A;  3DOW A;  1WJ6 A;  3DBL I;  3A9K B;  3AEC B;  3VUW A;  4PT5 A;  4ANV A;  3GZN I;  2V1Y A;  3N1Y C;  2LXA A;  1J7C A;  4HDO A;  4L2Y A;  4ARC A;  5IN7 A;  1ZGU B;  1M94 A;  2Y5C A;  1P9D U;  2K6Q A;  1SJH D;  3AEA B;  4IM0 A;  3N3K B;  4AOF A;  3X23 A;  3CWI A;  1ZXI A;  1LM8 B;  3A1Q A;  4AJY B;  2MP2 A;  1QOB A;  1LQB A;  3R8B A;  5C1Z A;  2D2Q A;  1IGC A;  1QOG A;  4N58 A;  4DHZ E;  5LXH A;  2KFJ A;  2LMC A;  1J7A A;  4ZOH C;  4K7S A;  4GXB A;  3HUI A;  2LUM A;  1C4A A;  4G50 A;  3L13 A;  1TGZ B;  5HFY A;  5IP4 D;  4W9I A;  1D6E C;  2CJN A;  1DOX A;  5J2R A;  5CHF A;  2WX1 A;  4A8X C;  5E6P A;  1STE A;  1Z2M A;  2RR9 A;  1YX6 B;  2KFK B;  5H92 C;  3V6C B;  2ICI A;  1NVI D;  4GLS C;  2EKE C;  1V5O A;  3WAO A;  1HTQ A;  1WGR A;  2IDY A;  1WMH A;  2WXP A;  5DPR A;  4RGT A;  1F2R C;  4B95 A;  4C4V B;  2Y3A A;  1CZP A;  2KNB A;  4A3O A;  3X0W A;  1TS4 A;  2VZK D;  1E10 A;  2TSS A;  2QHO A;  4ZRI A;  5E6O A;  4ANX A;  4B6W A;  4LK0 M;  4KSL C;  2N7E A;  2H88 B;  2SEB D;  4GIV A;  4A9A A;  2HTH A;  1WI0 A;  2AQ1 B;  2NTT A;  3DHI C;  2ZNV B;  4C80 A;  4II2 B;  2KYW A;  2KWU B;  4A3P A;  1IPG A;  2LVQ A;  2AEH A;  1V2Y A;  3RNF C;  1UD7 A;  2IO0 B;  3PSE B;  2RGF A;  2W9N A;  4RGN A;  1DOY A;  2PKO A;  1C3T A;  5BO4 B;  2RDH A;  4IOI E;  2JZP A;  4BKS A;  3Q14 C;  2L52 A;  3N30 A;  3RUL A;  1SB3 C;  2IND C;  3TEY A;  2JQR B;  4XE0 A;  3KQ4 A;  3U30 A;  1GJZ A;  2QDF A;  2N7J A;  3W1S A;  1EO6 A;  3AUL A;  3AH7 A;  2C9W B;  3QC8 B;  4WQM A;  3SHQ A;  4BVU C;  1WYW B;  2MCN B;  4MJS A;  4EKU A;  4IKG A;  4F7Z A;  1HZ6 A;  2XK5 B;  1YD8 U;  3L54 A;  5E6N A;  2IYD B;  5D3I B;  1FNU A;  1TS2 A;  3AE9 B;  4CQN A;  2LD9 A;  2YVC A;  4HK2 A;  4RGM A;  2GMI C;  1WM3 A;  3C19 A;  3A9J B;  1JQ4 A;  4KIK B;  2BWF A;  4NAM A;  4NNJ B;  4DXG A;  1JWM D;  4AP4 C;  2K3U A;  2LHD A;  2Q5W D;  1AWD A;  3AE2 B;  2WWZ A;  2V9H A;  2M56 B;  1I4R A;  3H7P B;  2NBU A;  3SFD B;  4ICU A;  4A6Q A;  4YSX B;  2RD0 A;  1OQY A;  4JWS C;  3RNC C;  1AYF A;  3DBL B;  4ICV A;  2KLC A;  2LGY A;  2LZ6 A;  4JX1 C;  4TMA B;  3HM3 A;  2E6X A;  3EHV A;  4FXC A;  5HKH A;  2BGF A;  1WR6 E;  3EEC A;  3P2B A;  4ITK A;  1XLQ A;  4HJK A;  2KQS A;  2I1J A;  4HCP B;  3BII D;  4EZK A;  3NOB A;  2JVC A;  1ESF A;  3MJ5 A;  3L0W B;  1D3Z A;  1WZ3 A;  2BWE S;  2VRR B;  2KC2 A;  2DEN B;  1WX9 A;  1WJN A;  1EF5 A;  5D3D A;  1S3S G;  2KN4 A;  4JL9 A;  2KK8 A;  3GB1 A;  3V05 A;  4S0R A;  3R66 C;  1NYQ A;  2JSV X;  3TEW A;  1WXM A;  1M4V A;  2IY0 B;  2BVC A;  3NY5 A;  3N1X C;  3O65 B;  3VH3 B;  1JML A;  1PGA A;  1QQR A;  1E7U A;  5FR6 A;  4MGK E;  1EF1 A;  2LHE A;  2KX0 A;  4O1N A;  2FID A;  2PVO D;  3PVL A;  1YN3 A;  2BYT A;  3HVD A;  3ZNH B;  2L7R A;  5CHW A;  2WXQ A;  1XO3 A;  1I7H A;  3UF8 A;  3Q3O C;  1WR1 A;  3EUB 2;  1N62 A;  1JRO A;  4G3X B;  5LNK 1;  1QKZ A;  2QSD A;  1XCT L;  1ZPS A;  4LNF A;  4IDI A;  3T3O A;  1WH3 A;  3I57 A;  2BT6 A;  3Q8C A;  5L95 C;  3V61 A;  5GMV A;  1R4N B;  5JXV A;  2ZPY A;  3DVG X;  4HKZ E;  2WS3 B;  1JWS D;  2EMT A;  1PYW D;  1SSN A;  4KX6 B;  5H8Y E;  3N20 C;  3MJW A;  2G9H D;  3APD A;  4GMV A;  1K52 A;  2Y5B B;  3AV8 A;  3QQ8 B;  4TQ1 A;  3HK0 A;  3VTW A;  2J0M A;  3RPF C;  3DQV A;  1VLB A;  2D5G A;  4MSM B;  2AWT A;  3SDL C;  4Q2J A;  1YJ1 A;  1GG3 A;  2VZK B;  5T8I A;  1IGD A;  4MT5 A;  3SR6 A;  1VZ7 A;  2M0X A;  1WX8 A;  4KDL B;  1YNT E;  3H8H A;  3O13 A;  4JPS A;  5IOI A;  1WM2 A;  1WX7 A;  3RYT A;  2CHW A;  4DDG D;  2NBW B;  4WAA A;  3ZNZ B;  3KLS X;  1XLO A;  4B0E A;  4BBN F;  1WJ4 A;  3PZD A;  4DK5 A;  2W55 A;  3ZXR A;  4DWF A;  2INN E;  4HRO A;  1YJJ A;  2JUO A;  2GB1 A;  4NJ6 A;  3T9L A;  1XLP A;  1UBI A;  3OJ3 A;  1YIW A;  3ZNI D;  3WCQ A;  1XLN A;  3QWZ B;  3ZRF A;  3RMK C;  1FNV A;  3ZVV A;  3L4P A;  4H2A A;  3T3N A;  2ZNV C;  1N6Z A;  2KMM A;  1EU3 A;  4BZA A;  3KYC D;  2N4F A;  2KAJ A;  3R2T A;  2B76 B;  5KHO A;  3IHP C;  3ONS A;  4ZRP A;  1XCQ L;  2BYE A;  3KUD B;  1V1P A;  2D3B A;  3PS6 A;  3V60 A;  3H9D A;  4MGI E;  1V6E A;  1YQ4 B;  2L32 A;  2WDR B;  4IUM B;  1FMA D;  2WNM A;  3TUO A;  1GNU A;  2CU1 A;  2NPT B;  2ZZP B;  2KTR B;  4MGY E;  1WE6 A;  2JXT A;  2JYE A;  4REZ A;  3A33 B;  1ET9 A;  1YQ3 B;  3B2F A;  1NDD A;  2PTL A;  3IAM 1;  2KDI A;  2MW5 A;  2C60 A;  4RF1 A;  2JZZ A;  2N9E B;  2PVG C;  2C5L C;  2B3A A;  2RDB C;  2QIE B;  3DHH C;  2I1K A;  3OG5 A;  5C3J B;  4RGO S;  3GE8 C;  3DVN U;  1P1A A;  3P42 A;  1L0Y B;  5AUK A;  3PHX B;  3UI3 A;  4KVG B;  2WYQ A;  2WDV B;  2KVR A;  1VZ6 A;  4HRS A;  2GBN A;  2MH7 A;  1L0X B;  1ZP0 B;  2K22 A;  4WJQ A;  2J0J A;  3R7Q A;  4I6P A;  4HEA 1;  1D4B A;  1TZ1 A;  3ENE A;  2JRH A;  3ZJU A;  4RM9 A;  3RCZ A;  4PS7 A;  1FRD A;  4OHJ A;  2DX5 B;  2PMV A;  4E74 A;  1P7F A;  4W9K A;  3V3X A;  3ZIM A;  2MA9 B;  4TSS A;  2FUH B;  5HI1 A;  2NVU I;  3HHM A;  1Z5S B;  3HM6 X;  3AU5 A;  1MPE A;  3EFC A;  4D2K A;  4AQ7 A;  1OEY A;  4FLH A;  3DVG Y;  1RLF A;  5IO9 A;  4AWJ A;  5KHQ A;  2KT7 A;  1VJK A;  4FJY A;  4GDL A;  4UDU C;  4B0M A;  2OJW A;  2HDE A;  2ZVO A;  1FIQ A;  4FAD A;  2MSE D;  2D3C A;  1XF5 L;  3AU4 A;  1SF0 A;  2BS2 B;  1WE7 A;  3FC4 A;  1T0Q C;  1TY2 A;  3A9K A;  1P0R A;  4LNK A;  1PFD A;  2GBJ A;  1WSP A;  2FAZ A;  3L16 A;  4I6N B;  2GRI A;  4AS1 A;  3UQA A;  1I35 A;  1E8X A;  5EE9 A;  3WAN A;  1UWX A;  2R2Q A;  1KFY B;  3L10 B;  2PLP A;  2I2Y A;  4M0W B;  3KUZ A;  3P63 A;  2ZW1 A;  2ZCC A;  3IT6 B;  3DDC B;  2DHZ A;  4TKN A;  3B08 A;  1F77 A;  4PYZ A;  4C7Y A;  2KD0 A;  2W54 A;  2K8H A;  4K1R B;  1GB1 A;  3AEE B;  2KJR A;  2KJH B;  2Z8L A;  2C7N B;  4KDI C;  1XT9 B;  1NI3 A;  3DHG C;  5J17 A;  4YSZ B;  3PTF C;  3Q3M C;  1L2N A;  4ZHP A;  3I9V 1;  2IZV B;  3KWL A;  2WGS A;  2JPH A;  1Q10 A;  1E0Z A;  2KFK A;  2DYB A;  3AMZ A;  4FN2 A;  2IO1 B;  5HG2 A;  1N60 A;  1R4M I;  2JY6 A;  2MQJ A;  3BVZ A;  4W9L A;  3R2I A;  1TIF A;  3W9C B;  1RFA A;  1V80 A;  4P1B C;  1WYG A;  4YL8 A;  2KDB A;  2J42 A;  1MFW A;  1SGH A;  1BXT A;  3AE4 B;  1ACC A;  2FBW B;  4A55 A;  3FIL A;  2GOW A;  2FE8 A;  2ZCB A;  1J19 A;  4EOY A;  2V4L A;  2DZJ A;  4W9E A;  4XDC A;  4M8M A;  1WFY A;  4WAF A;  1VRA B;  1TTN A;  1RRB A;  2SAK A;  1S1Q B;  1UZX B;  3SU8 X;  2KQ4 X;  2DZM A;  3TEX A;  2REX A;  4OW0 A;  2V0G A;  1E9M A;  2Z0D B;  1E8Z A;  1K51 A;  2LRW A;  4W9J A;  2MP2 B;  2WXN A;  2H89 B;  1WGG A;  4N59 A;  4OZC A;  4YTN B;  3MC0 B;  2WXJ A;  3ZW3 A;  4AJW A;  3PRP B;  3NG0 A;  1C9F A;  1A70 A;  5LXI B;  4YT0 B;  5MPO A;  3RNE C;  4XYC A;  2IY1 B;  1NEK B;  1KOT A;  2KTF A;  1ZDX A;  2MHJ A;  1DOI A;  2XBB C;  4FJZ A;  2WXF A;  2L1A A;  1A5R A;  4LDT B;  4JGH B;  1SE4 A;  4RFB A;  1EWY C;  2OED A;  1JW9 D;  3MHS D;  3PRZ A;  1E7P B;  4YWG G;  1C76 A;  3ZLZ A;  3KWV A;  3PZ7 A;  2LEK A;  4G11 A;  5C23 A;  2KN5 A;  3QA8 A;  2O6V D;  5EE3 A;  3UQB A;  1WXA A;  2BQQ A;  1SEB D;  1B9R A;  3TBL D;  3C8Y A;  2VH2 A;  3MTN B;  2MBE A;  4OVU A;  4P6V F;  3NVY A;  3M95 A;  3A9J A;  2JT4 B;  3M63 B;  1OTR B;  4KIK A;  2AX5 A;  3MC9 A;  1SE9 A;  4GU2 A;  4RF0 A;  1UWM A;  3CF6 E;  2GLS A;  2KWV B;  4BKG A;  3BK1 A;  4MM3 B;  2WHI A;  4MDK E;  2J4X A;  4KGR A;  3VR8 B;  4BBN C;  2L00 B;  5TR5 A;  1KJT A;  1SE2 A;  1FXI A;  3NS8 A;  2L3Z A;  1X1M A;  1F1H A;  1SIF A;  2WP9 B;  3H7P A;  3P4Q B;  4K3C A;  4ANW A;  3R3M A;  4II3 B;  1IP9 A;  2KKC A;  3TIX A;  2IO2 B;  3PRE A;  2WDQ B;  5AUI A;  3AB5 A;  1RM6 C;  3NRZ A;  1KTK A;  2HJ8 A;  2G4D B;  3QIJ A;  4DHZ B;  1GB4 A;  2CU3 A;  2WXL A;  4ANU A;  3DWM A;  1SJE D;  1OFF A;  4MJS B;  2KDF B;  5AZF A;  3BYT B;  5D2M B;  2RDG A;  3FAH A;  1FXT B;  4OZB A;  1MHH E;  4TQ0 A;  1TY0 A;  1KM7 A;  1IYF A;  1QF6 A;  3APC A;  2KWC A;  3TCA A;  2A4Z A;  3GZN B;  2N9P C;  3VRB B;  4TUU A;  1YN4 A;  2MEK A;  3I63 C;  3AEG B;  4L1B A;  2CJO A;  2L05 A;  1L4D B;  3Q3J A;  2BW2 A;  3CST A;  2RSU A;  3PV1 A;  2AQ2 B;  3MC8 A;  4C00 A;  3AE6 B;  2IGH A;  2INP E;  2LFI A;  4GDK A;  4LJP B;  4P7I A;  2M4N A;  4HDQ A;  3N9Y C;  3PRM B;  2INC C;  3LB8 C;  1WGH A;  1R4M B;  2KHW B;  2KC1 A;  4ZDV A;  4M01 A;  2KQ7 A;  4WQO B;  2KJ6 A;  4R3D A;  2VH1 A;  4KSK C;  1HXY D;  2WX0 A;  2N1W A;  2K1F A;  1ZE3 D;  2G1E A;  4GSW A;  2K0P A;  2ONQ A;  2X38 A;  3E9S A;  1I4P A;  3DBS A;  3TSS A;  2PPH A;  2XNA C;  4S17 A;  3ZYY X;  1BT0 A;  3PT2 B;  2N9L A;  2XN9 C;  4RM8 A;  4EZL A;  2KLG A;  4KGT A;  3B0A A;  3RNG C;  1UBQ A;  1WZ0 A;  2JF5 A;  3ECI A;  3VFK A;  3Q3N C;  4NJ7 A;  3BK2 A;  1KLG D;  5DPT A;  1WXS A;  2NTS A;  4IM2 A;  4WWP A;  2IGG A;  1P3Q U;  4HPP A;  4E3C A;  3LXF A;  3MFG A;  1F0Z A;  2JXX A;  4NQK E;  1RFK A;  1Y56 A;  2RPQ A;  5DPW A;  2PE9 A;  4RMA A;  2BKF A;  3BWU D;  5JHA A;  3QCA A;  4DHJ D;  4J3O D;  2CKH B;  3Q8F A;  1QLB B;  4P1C C;  2RPV A;  3V6E B;  5EDS A;  2NS5 A;  1V1O A;  3W2D A;  3RD2 A;  2JX5 A;  4LTU A;  1KF6 B;  1WGK A;  1Y8R C;  4GOC A;  1KLV A;  3BYY B;  1TS3 A;  3QAR A;  4GGQ A;  3DBH I;  3NUH B;  4A20 A;  2JYT A;  4NQL B;  2J7Q B;  2L76 A;  1Q5W B;  4LNI A;  2DBY A;  1GC7 A;  1SE3 A;  4YTP B;  3ALB A;  2ASQ A;  3PZ8 A;  3DBR I;  3U7Z A;  3DCG A;  4LCD E;  1TKG A;  4G0N B;  2BBC A;  1ZW7 A;  1JAL A;  3NJT A;  1UEL A;  3Q8A A;  2HD5 B;  3U4E G;  4ASW C;  1OGW A;  5G55 A;  4M8N A;  3ZDM C;  4WWM A;  2UU7 A;  1E5W A;  2L0T A;  2L8J A;  5EE0 A;  2BS3 B;  2OJR A;  3PGE A;  2NPT A;  4F8C B;  2KTR A;  1RAX A;  4MGZ E;  4IWP A;  4HLE A;  2WXR A;  3M3J A;  3OAW A;  4GN1 A;  2LGX A;  2IBI B;  1UF0 A;  2NR2 A;  3FKY A;  4DBG A;  1ISN A;  5GXG B;  4HPL B;  3W5V B;  4BFR A;  2FCM A;  1VD2 A;  3GP7 A;  2O6V B;  2LWP A;  1I4X A;  4N6E B;  2MBB B;  4BOZ B;  3WAP A;  1UUP A;  4XZ4 A;  1XXG A;  5L83 A;  1FM0 D;  1V8C A;  2JWZ A;  2O2V A;  4WIP A;  4EEW A;  4KZ0 A;  2LUE A;  2QIL A;  3BVG A;  5DCN A;  1JCK B;  4MH8 A;  1KH0 A;  2K25 A;  2DZK A;  1ZKH A;  2ZJD A;  3CSF A;  1FNW A;  2M0A A;  1E8Y A;  1IBX A;  2N0S B;  3RN9 C;  2N9X A;  5CHV C;  1F9J A;  2EMS A;  3RUI B;  3KUC B;  2EKI A;  5BYR A;  1D5X C;  1VZ8 A;  1NEN B;  1FCL A;  3ZXV A;  3VHT C;  3HRD D;  3OJ4 B;  4ZYN A;  3ZGZ A;  4C7Z A;  2C7M B;  3VAW A;  2Z59 B;  5HHD G;  4BOS C;  3RFZ B;  2MX2 A;  4EUT A;  4JLC A;  4CYE A;  1WY8 A;  1YJI A;  2JZ3 B;  2KMA A;  4NJC A;  1G6J A;  3LJ3 A;  4NAW B;  3VH4 B;  2KDM A;  3AE5 B;  2CR5 A;  5BYQ A;  1J7B A;  3VR9 B;  5D6J B;  1HEZ E;  1WWT A;  3APF A;  3B1L X;  3W1S C;  5G5G A;  5J18 A;  1CMX B;  3QX1 A;  4BKS D;  3H1U A;  1CK1 A;  2BYV E;  5D94 A;  3RI7 C;  3JVZ X;  4ZRQ A;  1GUA B;  1TKE A;  3IXS A;  3OLM D;  4MEL A;  1NI2 A;  3JSV B;  1WGD A;  3H6N A;  1JRU A;  3BVM A;  1TS5 A;  2NMQ A;  3AN1 A;  4WJN A;  1PGB A;  1SBB B;  3U8Z A;  2IPK D;  3N1Z C;  4URK A;  1MG8 A;  1VDV A;  3WAM A;  1HQR D;  4YTM B;  3RNA C;  5EE1 A;  3IAS 1;  4HWI B;  1T0R C;  4IWO A;  1V5T A;  3ETR A;  3UIN B;  2IO3 B;  4ZRJ A;  4XGA B;  3ZO5 B;  4ZYS A;  1L6U A;  2WU2 B;  5DPS A;  4M0W A;  3RZW C;  2FCQ A;  5FK9 C;  3S2A A;  2WDT B;  2M8S A;  2HJ1 A;  1WXQ A;  4CO7 A;  2ACZ B;  1MVK A;  3ZTD A;  1D5Z C;  1XQQ A;  2LXC A;  3KW5 B;  1L7Y A;  2GBK A;  5FKA C;  4NZL B;  3VTU A;  4PK1 A;  3P4S B;  5IA7 A;  4FJV B;  3TEZ A;  1N5W A;  3ZJV A;  1T0S C;  3DBH B;  2KAC A;  2QMT A;  5D7G A;  5CX3 A;  3K9P B;  1WXV A;  3DBR B;  1YMH E;  2WU5 B;  2MJ3 A;  2YLM A;  4DHJ B;  2MBQ A;  1MHX A;  3D32 A;  3ZUN A;  4B9K A;  3NS1 A;  2QEJ C;  1FXA A;  2D3A A;  3KVF B;  1SIJ A;  3TL5 A;  2WXH A;  3NZ3 A;  4PYU A;  4BAX A;  1TKY A;  4MAC A;  3PLU A;  4WH4 A;  4C4V A;  2MJE A;  2UYZ B;  1MJD A;  1D5M C;  5JZE B;  4LLG M;  2XEW A;  2LGI A;  2AL6 A;  1V81 A;  2MBO A;  3M62 B;  3ABV B;  2L0F A;  2KAN A;  3RNB C;  3N32 A;  3T8M A;  4CHK A;  4AUQ C;  1QOA A;  1ZXH A;  1V97 A;  3WIM A;  2MLB A;  1R7S A;  1TJE A;  3MP9 A;  2KZR A;  1ROE A;  3A4R A;  2C7H A;  2MWS B;  1I4H A;  3NZU A;  3TMP B;  3P4R B;  1PUT A;  3EFU A;  3A1Q B;  5LLI A;  2R61 A;  1C77 A;  2LI5 A;  3J9C A;  2X8X X;  5BYS A;  1T5X D;  2GBR A;  1N63 A;  2N1V A;  2PW9 A;  3UIO B;  1T6B X;  2LAS A;  4IG7 B;  2QCZ A;  1ZUD 2;  3FIL B;  3QK0 A;  4ACF A;  4HJG E;  4W9H A;  3AE3 B;  4FHJ A;  3UGB B;  3A4S C;  2A5U A;  3ZDT A;  3MHZ A;  2LVP A;  3Q2A C;  3Q8E A;  4FBJ B;  1R4N I;  4FA6 A;  1WRD B;  3VDZ A;  3SEB A;  5C2T B;  1LGR A;  2V3P A;  1WMH B;  4OZA A;  1C4C A;  1HTO A;  2XK5 A;  4MM3 A;  2M19 A;  2HTM E;  1NYR A;  2D11 A;  2KDE B;  2KOX A;  1CQV A;  1AW7 A;  1QT9 A;  4N9F 4;  1H4R A;  3HIZ A;  3ZTC A;  1I42 A;  4K81 A;  3UIP B;  3ZJT A;  1OQQ A;  4ARI A;  5FR3 A;  2DYM A;  1LO5 D;  4K7W A;  1XD3 B;  2KO3 A;  1YX5 B;  4DXF A;  2D3G A;  4RCO A;  2J0K A;  1F2R I;  1J8C A;  1TT5 B;  4ZHO A;  3VUX A;  3K9O B;  2V3N A;  1GOZ A;  4US9 A;  1TBE A;  4US8 A;  2FCN A;  3IBE A;  1FFV A;  4MH0 E;  2BKR B;  4W9C A;  3B2G A;  2JRI B;  1L6V A;  1WIA A;  3KH0 A;  4KZC A;  3ML9 A;  2J53 A;  2ZPN A;  4RNA A;  1J0G A;  5I4D A;  5TSS A;  4IW0 A;  4WWO A;  2IGD A;  1VCB A;  3RT3 B;  1K53 A;  1L4Z B;  4F1S A;  2G3Q B;  3ZKJ C;  1TZO A;  4MSQ B;  3AE1 B;  3DWG C;  1Q0W B;  2JWU A;  4LNO A;  3GOE A;  1K8R B;  2FCS A;  3IFW B;  2KWD A;  1T0Y A;  2KMC A;  5IAA C;  4GB9 A;  1WF9 A;  1WGY A;  3U7D A;  1JWB D;  3H7S A;  2ON8 A;  4XC2 A;  1CJE A;  4P16 A;  5BMH A;  2BPS A;  1V86 A;  2WXG A;  1EUV B;  3NVV A;  2MRP A;  2BB5 A;  1VR9 A;  4HPM B;  1OEY J;  4IWQ A;  2OOB B;  2N9K A;  4JQW C;  1FO4 A;  1F52 A;  2PIA A;  1C78 A;  4FHK A;  3JYU A;  2DAJ A;  2PEA A;  3PHW B;  2NBV B;  4DDI D;  2WQY B;  1LFD A;  1PGX A;  3RZF A;  3OWE B;  2WXK A;  2QJL A;  3GE3 C;  1EU4 A;  1E6E B;  4WJO A;  4DXA B;  4WJP A;  4L23 A;  2BB6 A;  2LVO A;  2D07 B;  4C56 C;  2I38 A;  2G4S A;  1MI0 A;  1FCC C; 
#chains in the Genus database with same CATH homology
 2UWQ A;  3EC8 A;  2K25 A;  3RUL A;  2DZK A;  2G45 B;  2ZVN A;  3BY4 B;  2ZCC A;  1E90 A;  1ZKH A;  1PQS A;  1GC6 A;  2ZJD A;  2GBM A;  3CSF A;  3DDC B;  1E8Y A;  3NZS A;  2DHZ A;  3U30 A;  1GJZ A;  4TKN A;  3B08 A;  2N9X A;  4PYZ A;  5CHV C;  3W1S A;  2KD0 A;  1EO6 A;  1P98 A;  1F9J A;  2EMS A;  2K8H A;  3AUL A;  3KUC B;  4GDK B;  4NPN A;  3RUI B;  2C9W B;  3QC8 B;  3SHQ A;  4BVU C;  1WYW B;  4K1R B;  2N7D A;  2KJR A;  2MCN B;  3VHT C;  4MJS A;  3OJ4 B;  4EKU A;  4ZYN A;  2KJH B;  4F7Z A;  2C7N B;  4KDI C;  1XT9 B;  2C7M B;  3VAW A;  2Z59 B;  5J17 A;  2XK5 B;  4BOS C;  1YD8 U;  2MX2 A;  3L54 A;  2IYD B;  3PTF C;  4I6L B;  5E6N A;  4EUT A;  4JLC A;  4HVB A;  2FNJ B;  1L2N A;  2MBH A;  1V49 A;  2IZV B;  4CYE A;  1WY8 A;  2JZ3 B;  2LD9 A;  2LJ5 A;  2KMA A;  2JPH A;  2YVC A;  2KFK A;  1G6J A;  2DYB A;  4HK2 A;  3LJ3 A;  4FN2 A;  2CHX A;  2IO1 B;  5AEK B;  2GMI C;  4NAW B;  3DVN V;  3R7R A;  3VH4 B;  1R4M I;  2JY6 A;  2MQJ A;  4W9L A;  4OVV A;  1WM3 A;  2CR5 A;  3A9J B;  1RFA A;  2DZI A;  5D6J B;  1V80 A;  4YL8 A;  2KDB A;  4KIK B;  2BWF A;  4BKT A;  1SGH A;  3APF A;  4W9D A;  2FIF A;  3B1L X;  3W1S C;  1UH6 A;  2GOW A;  3Q3F A;  4JIO U;  1CMX B;  5J18 A;  4NNJ B;  2K39 A;  3QX1 A;  4BKS D;  2ZCB A;  1J19 A;  3H1U A;  2BYV E;  5D94 A;  4AP4 C;  4EOY A;  2D10 A;  2V4L A;  3JVZ X;  2DZJ A;  4W9E A;  4M8M A;  1WFY A;  3DPD A;  1GUA B;  1TTN A;  1RRB A;  3OLM D;  1S1Q B;  3IVF A;  2WWZ A;  4MEL A;  1NI2 A;  3JSV B;  1WGD A;  3AXC A;  1JRU A;  3H6N A;  1UZX B;  3H7P B;  2NBU A;  3SU8 X;  2O6V A;  4ICU A;  3L08 A;  4WJN A;  2DZM A;  5G2N A;  2RD0 A;  1OQY A;  1NBF C;  2REX A;  3U8Z A;  2Z0D B;  4J6I A;  4URK A;  4ICV A;  2KLC A;  1E8Z A;  1MG8 A;  2LGY A;  2LZ6 A;  3WAM A;  3HM3 A;  2LRW A;  4W9J A;  2MP2 B;  3EHV A;  5HKH A;  1WGG A;  4HWI B;  2BGF A;  4IWO A;  1V5T A;  4K7U A;  2KX3 A;  1WR6 E;  3UIN B;  3ZW3 A;  2IO3 B;  3EEC A;  3P2B A;  4ZRJ A;  1LXD A;  4AJW A;  3PRP B;  4FUL A;  3ZO5 B;  3SD5 A;  4WWN A;  3RZW C;  5DPS A;  4HJK A;  2FCQ A;  2KQS A;  3S2A A;  3PLV A;  2I1J A;  4HCP B;  5LXI B;  2WDT B;  4EZK A;  2M8S A;  3NOB A;  2JVC A;  3L0W B;  2IY1 B;  1D3Z A;  1KOT A;  2KTF A;  1WZ3 A;  3QAQ A;  4CO7 A;  3ZTD A;  2BWE S;  2VRR B;  2KC2 A;  2DEN B;  2NCN A;  5AZH A;  1WX9 A;  1WJN A;  1XQQ A;  2LXC A;  1EF5 A;  2XBB C;  4FJZ A;  3VQI A;  1S3S G;  3KW5 B;  4JL9 A;  2KK8 A;  1QZE A;  3R66 C;  2BF8 B;  1A5R A;  1L7Y A;  4JGH B;  4LDT B;  1WXM A;  2GBK A;  4PS3 A;  3W1Y A;  2IY0 B;  1V9J A;  3VTU A;  3KYD D;  3NY5 A;  4PS8 A;  2HE7 A;  3MHS D;  3O65 B;  3PRZ A;  5IA7 A;  4FJV B;  3VH3 B;  2M1M A;  3ZLZ A;  1E7U A;  4EZJ A;  5FR6 A;  4MGK E;  1EF1 A;  4G11 A;  2KX0 A;  5C23 A;  2KXJ A;  2KN5 A;  3QA8 A;  2O6V D;  2PJH A;  2FID A;  4MEM A;  5D7G A;  3UQB A;  1WXA A;  3PVL A;  3TBL D;  5CX3 A;  4NAW A;  3MTN B;  2MBE A;  4ZRK A;  3LDZ E;  3ZNG C;  4OVU A;  3ZNH B;  3K9P B;  2L7R A;  5CHW A;  4E71 A;  1WXV A;  2ZEQ A;  3M95 A;  4LDT D;  3A9J A;  2JT4 B;  4NY0 A;  3M63 B;  1OTR B;  4IC7 B;  4KIK A;  4W9F A;  2R2O A;  3UF8 A;  1SE9 A;  3VTV A;  2YLM A;  1WR1 A;  4GU2 A;  4DHJ B;  2MBQ A;  3BIN A;  3CF6 E;  3VXW A;  1H8C A;  2KWV B;  3D32 A;  4G3X B;  4BKG A;  3ZUN A;  4MDK E;  4B9K A;  4BBN C;  2L00 B;  5TR5 A;  1E8W A;  1KJT A;  3KVF B;  3TL5 A;  3NHE B;  1WH3 A;  4X57 B;  3NS8 A;  4PYU A;  3QHT A;  2L3Z A;  3V62 A;  2O2V B;  3JSV A;  1X1M A;  3PLU A;  1SIF A;  3C0R B;  3H7P A;  5L95 C;  3V61 A;  5GMV A;  4ANW A;  2ZPY A;  3DVG X;  3R3M A;  4II3 B;  1C1Y B;  2EMT A;  1IP9 A;  2KKC A;  3MJW A;  3TIX A;  2UYZ B;  2IO2 B;  1E7V A;  1UGM A;  2CHZ A;  2V3S A;  3APD A;  4GMV A;  3QJZ A;  2AL3 A;  5JZE B;  3PRE A;  2Y5B B;  4EFO A;  2XEW A;  3QQ8 B;  4TQ1 A;  3HK0 A;  2AL6 A;  3VTW A;  1V81 A;  2J0M A;  2HJ8 A;  2G4D B;  2MBO A;  3DQV A;  3QIJ A;  3M62 B;  4DHZ B;  3PPA A;  2L0F A;  2DAF A;  2KAN A;  4ANU A;  3N32 A;  4MSM B;  3T8M A;  2AWT A;  3SDL C;  4CHK A;  1U4A A;  4AUQ C;  1YJ1 A;  3WIM A;  2MLB A;  2BYF A;  3JW0 X;  2LGD A;  1GG3 A;  5AZF A;  4HXD A;  2KDF B;  4MJS B;  5D2M B;  3ZRC A;  2KZR A;  2CS4 A;  4HCN B;  1FXT B;  3A4R A;  2C7H A;  2M0X A;  1WX8 A;  2MWS B;  3CMM B;  4TQ0 A;  1AAR A;  4KDL B;  3NZU A;  3TMP B;  2AYO B;  1KM7 A;  3AI5 A;  1IYF A;  3VVW B;  3APC A;  3WAL A;  1WM2 A;  3EFU A;  2KWC A;  3TCA A;  3A1Q B;  5LLI A;  1WX7 A;  3RYT A;  4LJO B;  2A4Z A;  2CHW A;  4DDG D;  2N9P C;  2NBW B;  4WAA A;  3ZNZ B;  4TUU A;  2LI5 A;  1YQB A;  4TV3 A;  4BBN F;  1WJ4 A;  2M17 A;  3PZD A;  4DK5 A;  4DWF A;  1HE8 A;  3L17 A;  2GBR A;  2K8C A;  2L05 A;  2N1V A;  2Z0E B;  3Q3J A;  3UIO B;  3CST A;  2JUO A;  2LAS A;  4IG7 B;  2RSU A;  4NJ6 A;  3T9L A;  3PV1 A;  3I3T B;  3QK0 A;  1UBI A;  4W9H A;  5CTR C;  3OJ3 A;  1YIW A;  4FHJ A;  3ZNI D;  3UGB B;  3A4S C;  2A5U A;  2DYO A;  1Q1O A;  3ZDT A;  2LVP A;  4GDK A;  3QWZ B;  4LJP B;  3ZRF A;  3VUY A;  4P7I A;  3ZVV A;  2M4N A;  4FBJ B;  5JHB A;  1R4N I;  2ZNV C;  4FA6 A;  4HDQ A;  1WRD B;  2LRU A;  1WJU A;  3KYC D;  3ML8 A;  3PRM B;  3VDZ A;  1WGH A;  2N4F A;  2KHW B;  2KC1 A;  4ZDV A;  5KHO A;  3IHP C;  3ONS A;  1WMH B;  2BYE A;  2KQ7 A;  3KUD B;  2XK5 A;  2KJ6 A;  4WQO B;  3TJP A;  4KSK C;  4MM3 A;  3PS6 A;  3V60 A;  2D11 A;  2KDE B;  2KOX A;  2WX0 A;  4IM3 A;  3H9D A;  2N1W A;  4MGI E;  1V6E A;  2K1F A;  5JH5 C;  4GDL B;  4GSW A;  4IUM B;  4N9F 4;  5AZG A;  1H4R A;  3DBS A;  2PPH A;  3HIZ A;  3ZTC A;  1GNU A;  2CU1 A;  2NPT B;  2ZZP B;  2KTR B;  3WA0 A;  2K6D B;  1I42 A;  4K81 A;  4KV2 A;  1WE6 A;  3IG3 A;  4MGY E;  3UIP B;  2PE6 B;  2K8B A;  2DYM A;  3A33 B;  1BT0 A;  3PT2 B;  4W9G A;  4XX5 A;  3DOW A;  1NDD A;  4K7W A;  1WJ6 A;  1XD3 B;  3DBL I;  4RM8 A;  4EZL A;  2KLG A;  3B0A A;  2KO3 A;  1YX5 B;  3A9K B;  2KDI A;  2MW5 A;  3VUW A;  1UBQ A;  1WZ0 A;  2JF5 A;  2C60 A;  2D3G A;  4ANV A;  2J0K A;  3GZN I;  2V1Y A;  2JZZ A;  3ECI A;  1J8C A;  3VFK A;  3VUX A;  3K9O B;  2LXA A;  2N9E B;  4NJ7 A;  2C5L C;  1TBE A;  5DPT A;  1WXS A;  2B3A A;  4HDO A;  4IM2 A;  2FCN A;  1ZGU B;  4WWP A;  3IBE A;  1M94 A;  2I1K A;  1P9D U;  1P3Q U;  4E3C A;  3DVN U;  2K6Q A;  4MH0 E;  2BKR B;  4W9C A;  2JXX A;  4NQK E;  5DPW A;  1P1A A;  2RPQ A;  4IM0 A;  3N3K B;  4AOF A;  3X23 A;  2PE9 A;  2JRI B;  4RMA A;  2BKF A;  1WIA A;  3PHX B;  3KH0 A;  4KZC A;  3ML9 A;  5JHA A;  2ZPN A;  3QCA A;  1LM8 B;  4KVG B;  1J0G A;  3A1Q A;  4AJY B;  2MP2 A;  2WYQ A;  4DHJ D;  2CKH B;  4IW0 A;  4WWO A;  1LQB A;  5C1Z A;  2KVR A;  2D2Q A;  1VCB A;  3RT3 B;  2GBN A;  4F1S A;  2G3Q B;  3V6E B;  3ZKJ C;  2KFJ A;  4DHZ E;  4MSQ B;  5LXH A;  4K7S A;  5EDS A;  2NS5 A;  3RD2 A;  4GXB A;  4WJQ A;  2J0J A;  1Q0W B;  3L13 A;  4G50 A;  3R7Q A;  4I6P A;  1TGZ B;  4W9I A;  1Y8R C;  4GOC A;  1KLV A;  3QAR A;  3GOE A;  4GGQ A;  1TZ1 A;  3DBH I;  3ENE A;  2JRH A;  1K8R B;  5J2R A;  4RM9 A;  4A20 A;  3RCZ A;  2FCS A;  3IFW B;  4PS7 A;  4NQL B;  2J7Q B;  2DX5 B;  2L76 A;  1Q5W B;  1T0Y A;  2KMC A;  4E74 A;  5CHF A;  2WX1 A;  4W9K A;  1GC7 A;  5IAA C;  3ZIM A;  2MA9 B;  4GB9 A;  5E6P A;  1WF9 A;  1Z2M A;  2FUH B;  2RR9 A;  3ALB A;  1YX6 B;  2ASQ A;  2KFK B;  2NVU I;  3V6C B;  3DBR I;  2EKE C;  1V5O A;  3DCG A;  3HHM A;  1WGY A;  4LCD E;  3WAO A;  3U7D A;  4G0N B;  1Z5S B;  1WGR A;  3HM6 X;  1ZW7 A;  3AU5 A;  1UEL A;  1WMH A;  2HD5 B;  3H7S A;  5DPR A;  4ASW C;  4B95 A;  1OEY A;  4XC2 A;  4FLH A;  1OGW A;  3DVG Y;  4A3O A;  2KNB A;  1RLF A;  4AWJ A;  2BPS A;  5G55 A;  3X0W A;  5KHQ A;  4M8N A;  3ZDM C;  1V86 A;  4FJY A;  4GDL A;  1EUV B;  2MRP A;  1E5W A;  2QHO A;  4HPM B;  1OEY J;  4ZRI A;  2L0T A;  2L8J A;  4IWQ A;  2OOB B;  2OJR A;  3PGE A;  5E6O A;  2NPT A;  4F8C B;  2ZVO A;  4JQW C;  2KTR A;  4ANX A;  1RAX A;  4MGZ E;  4FAD A;  4IWP A;  2MSE D;  4HLE A;  4B6W A;  4KSL C;  3M3J A;  2N7E A;  3AU4 A;  3OAW A;  2LGX A;  4GN1 A;  2IBI B;  4GIV A;  4FHK A;  1WE7 A;  2HTH A;  2NR2 A;  4DBG A;  1ISN A;  1WI0 A;  3JYU A;  2DAJ A;  2FCM A;  4HPL B;  2PEA A;  1VD2 A;  4BFR A;  2O6V B;  3A9K A;  1P0R A;  2LWP A;  3PHW B;  2NBV B;  2MBB B;  4DDI D;  4BOZ B;  2ZNV B;  2GBJ A;  2FAZ A;  3L16 A;  1LFD A;  4I6N B;  4II2 B;  3RZF A;  4XZ4 A;  3WAP A;  2KWU B;  4A3P A;  1IPG A;  2LVQ A;  5L83 A;  2AEH A;  1V2Y A;  4WJO A;  1UD7 A;  3UQA A;  2IO0 B;  3PSE B;  1I35 A;  1E8X A;  4DXA B;  2JWZ A;  2O2V A;  4WJP A;  2RGF A;  2W9N A;  3WAN A;  2LVO A;  2D07 B;  1C3T A;  2R2Q A;  4EEW A;  4KZ0 A;  5BO4 B;  3L10 B;  2LUE A;  2G4S A;  4M0W B;  4BKS A;  3N30 A;  3KUZ A;  5DCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...