2LXCA

Solution structure of the complex between the sgt2 homodimerization domain and the get5 ubl domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein MDY2
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/protein binding
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lxcA00
1WXAA 3ONSA 2ZCBA 4G3XB 4J6IA 4AWJA 3AULA 3RCZA 4A3PA 1D3ZA 2LASA 1SGHA 2N1VA 1WX9A 2FCQA 2JZ3B 2NPTB 2O6VA 3Q3FA 4JLCA 4LDTB 4XC2A 3R7QA 4BBNC 2LGYA 3UIPB 3M95A 1EF5A 2C5LC 4NAWA 2KMAA 1OGWA 3WIMA 5HKHA 2KK8A 4PS3A 3DPDA 3VH3B 4DHZE 3EECA 4TQ1A 1P98A 2KD0A 2O6VD 3AXCA 1UZXB 3A9JA 3HK0A 4WQOB 1Z5SB 4OVUA 3ZNZB 2LD9A 1SE9A 4HJKA 4MELA 1NI2A 4EOYA 2I1JA 3PGEA 3RT3B 1WXVA 4ICVA 3QK0A 4WWOA 1V49A 1KJTA 3RZFA 2KC2A 3N3KB 3PV1A 1WJNA 4ICUA 4KZCA 4II3B 3JSVA 4W9KA 3L0WB 3TL5A 4EZLA 3T9LA 4JQWC 1G6JA 3ZLZA 3ZTDA 1OEYJ 4F8CB 4IM3A 3QC8B 1E5WA 1YD8U 5JZEB 3DDCB 3M3JA 5E6PA 3TIXA 3IHPC 3JYUA 2ZPNA 2KTRA 4NQLB 4M8NA 1P0RA 3QA8A 1V6EA 4WWPA 5DPTA 4LJOB 4MJSB 1WJ4A 1WE6A 5JHBA 3CSTA 2AWTA 1WF9A 3PRZA 1P3QU 4NJ7A 1OTRB 2L8JA 3PSEB 2ASQA 4F7ZA 4ZRJA 1E90A 4NQKE 2D10A 4WJQA 2ZNVB 2A5UA 3HHMA 3V6EB 3H6NA 1TTNA 4HK2A 5DPSA 2G4SA 3QHTA 2DZIA 2BYFA 3VAWA 4CHKA 2K8HA 2C60A 2C7NB 2CU1A 2J0MA 4TKNA 3H1UA 2CS4A 4HDQA 3W1SC 2IO0B 4HXDA 2BF8B 3D32A 1WGYA 1WRDB 3DVGY 4I6NB 1AARA 3NZUA 4IC7B 4WJOA 1EO6A 2NPTA 4IM0A 2KFJA 3ENEA 4FJVB 3LDZE 1HE8A 1KOTA 3QCAA 4WAAA 2LGDA 3WA0A 4XZ4A 2V1YA 4W9HA 2IBIB 2UYZB 1ZGUB 4WJPA 3TBLD 1E8XA 4EZKA 5JHAA 2D11A 1J19A 3WANA 2MBHA 3PT2B 1WYWB 4ANXA 2BYEA 2M1MA 2N7EA 4IWPA 4W9DA 1WXSA 3APCA 3IFWB 4W9EA 2PEAA 3B08A 3ALBA 1IPGA 2JRHA 2AYOB 2RD0A 3TCAA 2DENB 2KXJA 5IA7A 1SIFA 4EZJA 2CHXA 4W9GA 4DHJD 1WM2A 3IBEA 2EKEC 1GC7A 3PPAA 5CHWA 2KX3A 1Q1OA 2ZNVC 1X1MA 3AU4A 4MGYE 4MM3A 1GC6A 3C0RB 4MGKE 4RMAA 1NDDA 4MJSA 3LJ3A 4BKTA 3CMMB 4BBNF 2HE7A 4TV3A 2LVQA 5FR6A 3DBHI 1RAXA 4FJYA 2G3QB 4FHKA 2KDFB 2BGFA 2AEHA 2BWFA 2M8SA 4ASWC 1UBQA 1YJ1A 3DBLI 2J0KA 1L7YA 3QIJA 2RPQA 2OJRA 2KWVB 1R4MI 2NS5A 2J0JA 5AZFA 3UF8A 2FNJB 2M4NA 2LXCA 2JZZA 3QX1A 3QAQA 3S2AA 3VXWA 2IO3B 3VUXA 4HDOA 3SDLC 3L13A 1LXDA 1NBFC 2LWPA 4W9IA 1J8CA 3R66C 3KYCD 4HLEA 1TBEA 2XK5B 2CKHB 3DQVA 1Q0WB 3A1QB 3M62B 4GGQA 4ZRIA 4II2B 4URKA 2KLCA 3OLMD 2DX5B 1WFYA 4NPNA 4MH0E 2K8CA 2KDEB 2LGXA 1RRBA 4JL9A 3N32A 2MA9B 3BY4B 3VH4B 1V9JA 4AJYB 3OAWA 3DCGA 4E3CA 2KNBA 2MBEA 2K39A 2HD5B 1V81A 1WZ0A 2N9XA 4FLHA 1ZW7A 1V5OA 2GOWA 5G55A 4BKSA 2GBNA 1H4RA 5CHFA 2DAJA 1P9DU 3U7DA 2IY0B 2ZZPB 2KWUB 4MEMA 3X23A 5CHVC 2KN5A 3I3TB 4MSQB 2NR2A 4BKSD 4IG7B 4W9CA 4KIKB 4KSLC 2LRUA 4B9KA 5KHQA 4ANWA 3UIOB 2MCNB 2O2VB 3T8MA 2ZEQA 2FCNA 1EUVB 2K6DB 2JT4B 3R7RA 4A20A 2K8BA 4G50A 2RGFA 3PRPB 2REXA 3V61A 2UWQA 2MP2B 1IYFA 2MBOA 4EFOA 3V6CB 2MQJA 4AP4C 1C1YB 1WX8A 2PE9A 4GXBA 2KHWB 2KLGA 3ZRFA 1V86A 1CMXB 1MG8A 4LCDE 1UBIA 3NZSA 4YL8A 5KHOA 3VHTC 2N9EB 3UINB 1WR1A 2C7HA 3OJ4B 5CTRC 1FXTB 4I6LB 2KVRA 3VQIA 2FIFA 3B0AA 2AL3A 4BVUC 5D6JB 2D3GA 3A9KB 2KKCA 4DHZB 2MSED 4K1RB 5D2MB 3MTNB 2XK5A 1WIAA 2M0XA 1YIWA 1YX5B 4W9FA 1KM7A 3A1QA 3APDA 3H7PB 4ZYNA 1WXMA 3VDZA 3PRMB 3PLVA 2GMIC 1WGDA 2KX0A 3B1LX 1WJUA 2KC1A 3ZNID 2K25A 4K7SA 3GOEA 3W1YA 2I1KA 1C3TA 2JVCA 3W1SA 2GBJA 2KOXA 2Z59B 3EHVA 3JVZX 4LDTD 5GMVA 3CF6E 4NNJB 1XQQA 3ECIA 3A33B 2MWSB 1ISNA 1WZ3A 2AL6A 1LQBA 2C9WB 3VTVA 1S3SG 3ZUNA 1H8CA 3WALA 4B95A 4PS7A 3H7SA 4GSWA 3BINA 2YLMA 3ZKJC 5E6NA 4KIKA 3UQBA 4EEWA 4HCNB 2L05A 3QQ8B 3ZTCA 1M94A 2O2VA 4MGZE 3ZNHB 5EDSA 2CHZA 3AI5A 3ML8A 2RR9A 3IG3A 4ANVA 2FCSA 4G0NB 4KDIC 2LZ6A 2MP2A 1E7UA 2JWZA 2MW5A 4M0WB 1WGHA 2L0FA 4E74A 3Q3JA 2G45B 5J17A 3AU5A 1E8YA 2K1FA 4IM2A 4IWOA 3U8ZA 3M63B 1WX7A 4GIVA 2KO3A 1E8WA 3V62A 4CO7A 1PQSA 4FADA 4NJ6A 1E7VA 3NY5A 3R3MA 3L08A 4IWQA 5L95C 1QZEA 4G11A 3HIZA 4B6WA 2NBWB 3PZDA 5E6OA 1WE7A 1ZKHA 2DYOA 2NBVB 2LUEA 1RLFA 2DAFA 3A9KA 3O65B 4GDLB 4N9F4 3QARA 1I35A 3VVWB 2Y5BB 3H7PA 5J18A 4AOFA 5DPWA 2HJ8A 3KYDD 3WAMA 2KWCA 3KUCB 2L7RA 1OEYA 5C23A 4MDKE 5LLIA 2L76A 3H9DA 3HM3A 4M8MA 5G2NA 3L54A 2KANA 2JXXA 2KMCA 4TUUA 3PTFC 3DBSA 1VCBA 4W9LA 5LXHA 2OOBB 1WY8A 4FBJB 4HPLB 5BO4B 4IW0A 4KV2A 3ZDTA 2ZPYA 4A3OA 2ZVOA 1OQYA 4DBGA 2IYDB 2FIDA 4BKGA 3MJWA 1WMHB 2Z0DB 4RM8A 1R4NI 2KJRA 4WWNA 5IAAC 4FHJA 2FAZA 3RZWC 3PHXB 3IVFA 2WDTB 4FN2A 5DPRA 1GG3A 3EFUA 3RYTA 3ZW3A 5AZHA 2XEWA 2FCMA 4GDKB 4JGHB 1WH3A 2NCNA 3A4RA 2IO1B 3GZNI 1S1QB 3VTWA 4GB9A 2B3AA 3PS6A 1V80A 3EC8A 3NOBA 1UD7A 2G4DB 4GOCA 3UGBB 3VFKA 4EUTA 1GJZA 4NY0A 2N4FA 3ML9A 4KVGB 3ZO5B 1UELA 3K9OB 3KW5B 1RFAA 2BYVE 5AEKB 2KFKB 4ZDVA 4AUQC 4XX5A 3VUWA 5DCNA 2PE6B 5TR5A 2R2OA 2JRIB 1BT0A 1WGGA 4HWIB 2ZCCA 2D07B 4DHJB 2ZVNA 2HTHA 2K6QA 2GBKA 2LVPA 3KUZA 4WJNA 3ZDMC 4GDLA 4AJWA 4HCPB 3RULA 1WM3A 2IZVB 2WX0A 3ZVVA 3SD5A 4FJZA 4CYEA 1TZ1A 4PYZA 5L83A 5J2RA 1WJ6A 2JPHA 1VD2A 3ZRCA 3OJ3A 3NS8A 1UH6A 4KDLB 4TQ0A 3RD2A 3WAPA 4JIOU 4RM9A 2N1WA 3DOWA 1IP9A 2LJ5A 4HVBA 5JH5C 2MX2A 3PVLA 3VTUA 3SHQA 4DDGD 3QJZA 3SU8X 3CSFA 2FUHB 2L00B 1E8ZA 2MLBA 4BOSC 2JY6A 2N9PC 4GU2A 4KZ0A 3V60A 4FULA 2N7DA 3VUYA 1WMHA 2BKRB 2VRRB 4DWFA 1TGZB 2DYMA 2KQSA 3DVGX 1WI0A 2DHZA 3A4SC 4HPMB 4DXAB 2A4ZA 4P7IA 2PPHA 3MHSD 2XBBC 2BKFA 2BPSA 2GBRA 2KZRA 2M17A 1XD3B 2YVCA 3K9PB 4F1SA 2CR5A 2R2QA 5LXIB 4GDKA 1V2YA 2KTFA 5C1ZA 3P2BA 3L16A 5D7GA 2O6VB 3UQAA 2IY1B 2KDIA 2LRWA 3U30A 4E71A 1Y8RC 4NAWB 3APFA 1LM8B 4MSMB 3DVNV 5AZGA 2WX1A 2ZJDA 3KUDB 1A5RA 3L17A 3PHWB 3A9JB 3KVFB 2KDBA 2J7QB 4GMVA 2KFKA 2IO2B 2W9NA 2D2QA 1LFDA 2KJ6A 3NHEB 1F9JA 3ZNGC 4PS8A 3PREA 1U4AA 3TMPB 3QWZB 5CX3A 1GUAB 4OVVA 4X57B 1J0GA 1L2NA 2MBBB 1Q5WB 4I6PA 3L10B 4BOZB 2V4LA 3JSVB 2WYQA 3RUIB 2WWZA 3ZIMA 2C7MB 2DZMA 2L3ZA 1T0YA 1UGMA 2JF5A 4K81A 4PYUA 1K8RB 3X0WA 2GBMA 1YQBA 2LVOA 2DZJA 5D94A 3HM6X 4FA6A 1WGRA 2JUOA 3DBRI 1GNUA 4IUMB 4LJPB 4W9JA 1EF1A 2MRPA 2RSUA 2KTRB 3JW0X 4GN1A 2LI5A 1Z2MA 2NBUA 2QHOA 4ZRKA 2KQ7A 2CHWA 3TJPA 2DYBA 4MGIE 2MBQA 3N30A 2LXAA 1I42A 2DZKA 2NVUI 3PLUA 2L0TA 2PJHA 2EMSA 1JRUA 1YX6B 4DK5A 1WR6E 4ANUA 4BFRA 1P1AA 4K7WA 4KSKC 2BWES 2V3SA 2Z0EB 3KH0A 2KJHB 4K7UA 3WAOA 4DDID 4EKUA 3DVNU 2EMTA 1XT9B 1KLVA 1V5TA
chains in the Genus database with same CATH superfamily
1TS3A 3ONSA 4G3XB 2W54A 4JWUC 1TY0A 4LDTB 3R7QA 2MH7A 1SSNA 3AM9A 1ZUD2 3VH3B 4OZBA 2KD0A 3AXCA 1UZXB 2L32A 1TS4A 1Z5SB 2INDC 5HHDG 3PGEA 1T0SC 4B0MA 3PZ7A 4WWOA 4N59A 3PV1A 1WJNA 4ICUA 4KZCA 4EZLA 4A8XC 3C8YA 3ZTDA 5GXGB 4F8CB 5AUIA 3NZ3A 2BYTA 5JZEB 5E6PA 1VZ8A 4WWPA 1ZP0B 4LJOB 4MJSB 2AWTA 4NJ7A 2L8JA 2NMQA 2W3RA 2WP9B 1R4NB 3PO0A 5HI1A 1WSPA 3B2FA 2BS3B 2G4SA 2K8HA 4HXDA 2BF8B 3B9JA 4IC7B 1TKGA 1E7PB 1ENFA 2NPTA 2KFJA 4WAAA 2UYZB 1E8XA 3VR9B 2PKOA 1WYWB 1NEKB 2M1MA 2QSDA 4IWPA 3TEZA 4W9DA 3APCA 2KMMA 4US8A 3BK2A 1XLOA 2JRHA 3TCAA 5IKCM 1JWSD 2LGIA 4IKGA 1D5XC 1MPEA 4EZJA 4NJCA 1Q1OA 3AU4A 4MGYE 1GC6A 1KTKA 3LJ3A 3AN1A 2WXMA 3CMMB 4R3DA 2HE7A 1RAXA 2G3QB 3SR6A 2OJRA 5H8YE 1R4MI 2NS5A 1FFVA 2FNJB 3UF8A 2LXCA 3QAQA 4RH6A 3S2AA 3VUXA 1LXDA 4K3BA 1J8CA 1FNUA 1TBEA 1WGKA 3M62B 1MG4A 1YQ4B 1D5ZC 1WFYA 1YMHE 3Q69A 4ARCA 1RRBA 4JL9A 3OAWA 4HJGE 5T8IA 2K39A 1NYQA 1V81A 1WZ0A 2WXFA 4YSYB 2GOWA 1V5OA 4L2YA 5G55A 5CHFA 1PGBA 2ZZPB 2OJWA 2KWUB 4MEMA 3X23A 4H2AA 5I4DA 4BKSD 1LO5D 2M0AA 3MP9A 4B9KA 5KHQA 2MCNB 3T8MA 2FCNA 2JT4B 1ET6A 4A20A 2RGFA 2JWUA 2MP2B 2MBOA 3V6CB 4AP4C 3IT6B 1VZ6A 4HRSA 1WX8A 4USAA 2JYTA 2KLGA 2ZW0A 3NZSA 4XYCA 3VHTC 2N9EB 4KKJA 3BVZA 2AL3A 3RNEC 3RFZB 5D6JB 3DHIC 4K1RB 2SEBD 2V9HA 3A1QA 4ZYNA 1WXMA 3VDZA 2BQQA 1BMLC 3B1LX 1WJUA 3ZNID 4K7SA 3GOEA 4WAFA 3GP7A 3JVZX 5GMVA 3VR8B 3CF6E 1WZ3A 2J53A 4B95A 1BUIC 4PS7A 4PT5A 3BINA 1VDVA 3UQBA 5D3IB 3QQ8B 2L05A 2ONQA 2CHZA 4G0NB 2DBYA 1TKEA 4A90A 1E8YA 1WX7A 2WXLA 4NJ6A 3L08A 1FEHA 1K52A 4G11A 4B6WA 2H88B 1I4QA 1PUTA 2VZKB 3TEWA 1T3QA 3IAM1 1V1OA 1WE7A 5E6OA 2LUEA 2DAFA 2IDYA 3O65B 1K50A 4TSSA 4P1BC 3VVWB 3H7PA 1XCTL 3WAMA 2LUMA 2WQYB 1PFDA 1OEYA 4MDKE 5G2NA 2OOBB 3Q3NC 1A70A 4O1NA 4RF1A 3R8BA 4IW0A 1MJDA 3DHGC 1EWCA 1HQRD 4RGMA 1F2RI 3MJWA 1WMHB 3Q8EA 4FHJA 1EM7A 1HXYD 5DPRA 3ZYYX 1F52A 1D6EC 2FCMA 4GDKB 3ZXVA 3VTWA 1NYRA 1SF0A 1MHXA 1V80A 5C2TB 3DBHB 2N4FA 3ML9A 3ZO5B 1E0ZA 1JCKB 3DBLB 2KFKB 4AUQC 4XX5A 3IXSA 1L4DB 2R2OA 4RFBA 1C77A 1WGGA 1IBXB 4DHJB 2LVPA 2DWQA 4WJNA 3R2TA 1WM3A 3SD5A 2I38A 1TZ1A 5J2RA 3ZRCA 4TQ0A 2WXOA 3WAPA 4RM9A 3DOWA 5BMHA 2LJ5A 5JH5C 3PVLA 3VTUA 3CSFA 4DXFA 1E8ZA 3Q3OC 4NAMA 4GU2A 1LGRA 3V60A 2BKRB 2DYMA 4RNAA 4DXAB 2WXIA 4P7IA 3MHSD 2BPSA 3AE3B 2BS2B 3ZGZA 2KTFA 2O6VB 2KDIA 3GE8C 2LRWA 2WU2B 1OFFA 3DWGC 4MSMB 5AZGA 3KUDB 3L17A 2KDBA 2W9NA 1D4BA 3ZJTA 1U4AA 3QWZB 1J0GA 1FRDA 3NG0A 1SE2A 2DZMA 2L3ZA 1RM6C 4PYUA 3BK1A 1YQBA 2N9KA 5H92C 2D3BA 3DBRI 4LJPB 1GNUA 4HPPA 1B1ZA 2NBUA 2QHOA 4RF0A 4JPSA 2CHWA 2DYBA 4LNOA 2NVUI 4DK5A 1YX6B 1KLVA 1WR6E 2KQ4X 4K7WA 2BWES 2V3SA 2Z0EB 1I4RA 3AEFB 1WXAA 4AWJA 4P1CC 2JZ3B 4BBNC 1OQQA 1FXIA 3RI7C 2LGYA 4NAWA 3R2IA 3RMKC 5HKHA 2LHDA 3DPDA 4ZHPA 3ZJUA 2LHEA 1ACCA 2AQ2B 4OVUA 1SE9A 1NI2A 3RT3B 1RWSA 3QK0A 1KJTA 3RZFA 2DLBA 4II3B 3L0WB 3T9LA 3AV8A 3E9SA 3ZLZA 3AECB 1OEYJ 5BYRA 1V97A 1VJKA 3Q8BA 4ZOHC 3RNAC 2ZPNA 2JX5A 2KTRA 2K0PA 5HG2A 2CU3A 4P16A 1FNWA 2PLPA 2WXNA 3ZJVA 5EE0A 5JHBA 2LFIA 1I4XA 3P1MA 1AWDA 1WF9A 3AE8B 1QKZA 4NQKE 2D10A 4WJQA 2A5UA 3QHTA 4K3CA 2K5PA 2C7NB 2CU1A 4TKNA 2BBCA 2CS4A 4MACA 2BVCA 1WRDB 4WJOA 1SIJA 3GZNB 2SAKA 3ENEA 2PIAA 3LDZE 1KH0A 4KGSA 2QC8A 4W9HA 3P63A 3E56A 3IT4B 1ZGUB 1KFYB 4EZKA 3N1ZC 1ZE3D 1E10A 3WANA 4ANXA 2QEJC 2N7EA 2GLSA 1I7HA 1RFKA 3IFWB 4YWGG 1Y56A 2PMVA 3RPFC 3ALBA 1V1PA 1DOIA 3BIID 3U7ZA 1ZDVA 4WH4A 4W9GA 1QILA 3HVDA 1V8CA 1GC7A 3RNBC 4MM3A 4MGKE 1KRHA 4TV3A 2LVQA 5JXVA 3AE4B 4FHKA 2BWFA 2AEHA 2IJ0A 2ON8A 3AEAB 3NVZA 2K22A 5AZFA 2JZZA 3QX1A 3ZQ4A 4WIPA 1PGAA 2V3PA 4W9IA 3R66C 4HLEA 2XK5B 3BYTB 3DQVA 1Q0WB 4ZRIA 1OQRA 4URKA 2WXJA 2DX5B 2M19A 3URYA 3VH4B 4AJYB 3DCGA 1ET9A 2X8XX 2HD5B 2N9XA 4BKSA 1L0YB 2GBNA 1H4RA 2DAJA 1P9DU 3B2GA 4JWSC 3Q14C 3N1XC 2KN5A 1JMLA 2NR2A 4KIKB 2QJLA 4KSLC 2LRUA 4ANWA 2O2VB 3R7RA 1EUVB 4G50A 3PRPB 1TT5B 2WHIA 1ROEA 3BVMA 1C9FA 2Y5PA 1CMXB 1MG8A 4LCDE 4YL8A 4JX1C 3BZDB 4A9AA 1C4CA 3MC9A 4I6LB 3VQIA 1WRIA 3B0AA 2E3TA 3W5UB 4C80A 1YX5B 3MC8A 3RNGC 1IGCA 3AE6B 2I1KA 2W82A 1DOXA 1K53A 2JVCA 3W1SA 3FILA 4NNJB 1XQQA 3ECIA 2MWSB 1VLBA 2AL6A 2EELA 3VTVA 1S3SG 2VH2A 3WALA 5E6NA 2AX5A 4EEWA 3AEGB 1M94A 2CJOA 2NTSA 3ML8A 2RR9A 4IOIE 1E7UA 4E74A 2QILA 3HVZA 3TEXA 5J17A 4IM2A 3V62A 4GIVA 2KO3A 3FKYA 1E7VA 3NY5A 1UGJA 3R3MA 2NBWB 2RMMA 4YXDB 3LYYA 1L6VA 2CJNA 1ZKHA 2NBVB 3A9KA 4GDLB 3I5JC 2AQ3B 3QARA 1CZPA 5DPWA 2HJ8A 3KYDD 2YEPF 5LLIA 2L76A 3H9DA 3HM3A 3I9V1 4M8MA 1WYGA 3SFDB 1WY8A 4FBJB 4HPLB 1I4HA 1D5MC 2ZPYA 4A3OA 5FKAC 1OQYA 2IPKD 4BKGA 5IP4D 4RM8A 5E6JA 1QQRA 5IAAC 2GI9A 3RZWC 1SBBB 3IVFA 4D2KA 3RYTA 1HTQA 5AZHA 4JGHB 1AYFA 2FBWB 4M0WA 4A55A 5LNK1 3NOBA 3UGBB 1UD7A 2G4DB 1GJZA 1RFAA 1R4MB 2JRIB 2W55A 1BT0A 2ZVNA 2HTHA 2K6QA 3KUZA 3RULA 2BB6A 4RGTA 3ZVVA 2WX0A 4C4VB 4FJZA 4CYEA 5L83A 3AE2B 2V4IB 5BYSA 2MHJA 3NUHB 4N58A 4JIOU 2N1WA 1YQ3B 4US9A 1C78A 4DDGD 2L52A 2FUHB 2L00B 4LK0M 2JY6A 4KZ0A 4FULA 3VUYA 1TGZB 3AMZA 4UDUC 1JWAD 3EGRA 1MI0A 1WI0A 2E6XA 3U2SC 5BMIA 2PPHA 2M17A 2KZRA 2RDHA 1XD3B 2YVCA 5LXIB 4E71A 3Q8CA 1NENB 2INPE 2WX1A 1L5PA 2ZJDA 3P4QB 3P4RB 1A5RA 3TEYA 2WXRA 2WDRB 2LGSA 1XLQA 1YOVB 3ZNGC 3PREA 2ICIA 5CX3A 1BXTA 1GUAB 1C79A 4X57B 2MBBB 1Q5WB 4I6PA 4BOZB 2JF5A 4K81A 1F0ZA 2GBMA 4KKIA 1TJEA 2JUOA 4FA6A 1ZOYB 3SEBA 2QCZA 2VH1A 2FE8A 1ZXIA 3PLUA 2KDMA 3W9CB 2PJHA 1JRUA 1FFUA 4WWMA 4ANUA 1P1AA 4KSKC 3KH0A 1TY2A 1UWMA 3WAOA 3DVNU 3AI5A 1V5TA 2LMCA 4A3PA 2LASA 3FC4A 4XC2A 2NPTB 3Q3FA 4JLCA 3MC0B 3M95A 2KK8A 4DHZE 3EECA 3EFCA 1P98A 2O6VD 4LTUA 3A9JA 4WQOB 3BYYB 1C4AA 3ZNZB 4YTMB 4HJKA 4P6VF 4MELA 4EOYA 4WQMA 5G5GA 2I1JA 4L23A 4ICVA 1HZ6A 3JSVA 3KWLA 1YN4A 3LXFA 3P42A 3QC8B 1YD8U 2INCC 3DDCB 3M3JA 1DYQA 2BB5A 3IHPC 3JYUA 4OZAA 1P0RA 3NVWA 2N7JA 1QOFA 1V6EA 5DPTA 4GLSC 1WJ4A 2JYEA 3PRZA 1P3QU 1OTRB 4F7ZA 1JWBD 4ZRJA 1FCCC 5C3JB 2ZNVB 1QOAA 3V6EB 5DPSA 2DZIA 2BYFA 1FMAD 2KN4A 4QAYA 1L0XB 4I6NB 3DVGY 1F1HA 1GOZA 1EO6A 2PVOD 3AE5B 1HE8A 3T3NA 1FXAA 1P7FA 1E6EB 1P7EA 2IBIB 2V3NA 3TBLD 4WJPA 5JHAA 2D11A 1DGJA 1J19A 3MJ5A 1HZ5A 2WS3B 4DQOC 1SE4A 3B08A 1JWMD 1IPGA 1UWXA 1MHHE 2DENB 2KXJA 4HROA 2MEKA 2D5GA 2JSVX 5IA7A 1WM2A 3IBEA 5AUKA 5CHWA 4KGTA 2KX3A 1X1MA 1N5XA 4RMAA 3C0RB 4MJSA 2YEPB 4BKTA 2QDFA 2WDVB 3CIRB 4FJYA 2KDFB 2BGFA 2M8SA 1KF6B 4M02A 1L7YA 1SB3C 2RPQA 2M4NA 2LEKA 4XDDA 1JRPA 3VXWA 2IO3B 4KX6B 3SDLC 1JW9D 1KLUD 3KYCD 1JQ4A 4GGQA 3A1QB 2RDBC 4II2B 2KACA 3ABVB 3OLMD 2HTME 1XF5L 3Q8AA 4MH0E 2K8CA 2KDEB 4M00A 1N60A 3N32A 3BY4B 3NS1A 4HKZE 4OHJA 4ZRPA 1MFWA 4FLHA 2D3CA 3O13A 1QT9A 1R7SA 2IY0B 5EE1A 5CHVC 4BAXA 3DBRB 1WXQA 2K6DB 3GB1A 2K9XA 4YSZB 2K8BA 2Q5WD 5EE3A 2UWQA 1IYFA 3AE1B 4EFOA 1JWUD 2MQJA 1KLGD 2KHWB 2GB1A 1EU3A 1QOBA 1UBIA 5KHOA 1WR1A 3OJ4B 4C56C 2WXQA 1FXTB 2KVRA 2FIFA 2D3GA 3OG5A 5D2MB 4S17A 1WIAA 1YIWA 3GS2A 4Q2JA 4W9FA 1KM7A 3H7PB 4XWWA 1DOYA 1TS2A 1T5XD 4BZAA 2PTLA 1WGDA 2KX0A 2K25A 3W1YA 1C3TA 1FD6A 4YSXB 4LDTD 3EHVA 5FK9C 1FO4A 1B9RA 1J7CA 3A33B 1ISNA 1LQBA 3RNFC 2XN9C 3ZUNA 1H8CA 3H7SA 2YLMA 3DHHC 3KLSX 3U4EG 4HCNB 1L4ZB 1KOTA 1AW7A 3ZTCA 3ZNHB 1J7BA 3IG3A 3AH7A 2FCSA 4KDIC 1GPXA 2LZ6A 2MP2A 2MW5A 3NVVA 1WGHA 4JE3B 3U52E 2KVZA 2G45B 3Q3JA 4HKQA 3M63B 3BWUD 4CO7A 4FADA 1SE3A 2RPVA 2OHFA 5L95C 1QZEA 4XWTA 3WCQA 3HIZA 2INNE 2DYOA 4N9F4 1I35A 1C4PA 2Y5BB 4C00A 2KAJA 1VZ7A 3L54A 2KANA 2JQRB 3V05A 4LNIA 5LXHA 1VCBA 2BT6A 4W9LA 4LNKA 3TSSA 1AN8A 2WXGA 1FIQA 1RYJA 4DBGA 2IYDB 5FR3A 1GB4A 3NJTA 1R4NI 4C7YA 3BVGA 2FAZA 3PHXB 1XXGA 4FN2A 1GG3A 2L83A 2JZPA 1WH3A 2NCNA 3A4RA 2IO1B 1S1QB 3W2DA 3EC8A 1HA5A 3VFKA 4EUTA 4J3OD 4NY0A 4ZRQA 1UELA 2ZW1A 3K9OB 3KW5B 2BYVE 1K51A 2G9HD 5DCNA 5TR5A 2ZCCA 2D07B 3ZDMC 2IZVB 4PYZA 1WJ6A 1PDXA 1N6ZA 1VD2A 3OJ3A 1UH6A 4KDLB 2G1EA 3RD2A 1TS5A 1E9MA 1IP9A 4CQNA 4HVBA 2MX2A 4YTPB 3SHQA 2KWDA 3HUIA 1JALA 2MLBA 2N9PC 2MJEA 2N7DA 1WMHA 2VRRB 4PK1A 3P4SB 3A4SC 2IGGA 4HPMB 2A4ZA 2B76B 2XBBC 2GBRA 4IDIA 4F1SA 2CR5A 2R2QA 2D3AA 3L4PA 4GDKA 1V2YA 4NAWB 1LM8B 3ETRA 2MJ3A 4TMAB 1YJJA 3PHWB 3KVFB 2J7QB 2KFKA 2IO2B 3NHEB 1F9JA 2UU7A 2WLBA 2NTTA 1QOGA 1IBXA 4OVVA 1L2NA 2V4LA 3ZIMA 3RUIB 2WWZA 4A6QA 4WURA 1T0YA 1UGMA 4EE2A 3X0WA 1K8RB 1FM0D 5D94A 3HM6X 2Z8LA 1WGRA 4W9JA 1EF1A 3TUOA 2KTRB 3JW0X 4GN1A 2LI5A 4KGRA 2KQ7A 1WWTA 3TJPA 4MGIE 2MBQA 4REZA 1I42A 1QF6A 2AQ1B 2L0TA 3UI3A 2HJ1A 3CWIA 4K7UA 2EMTA 2ZCBA 4J6IA 3AULA 3RCZA 1D3ZA 1SGHA 2N1VA 3I57A 1WX9A 2FCQA 2O6VA 3W5VB 3UIPB 1EF5A 2C5LC 2KMAA 1OGWA 3WIMA 4YTNB 4PS3A 1HEZE 4TQ1A 2J4XA 4AQ7A 3HK0A 4YT0B 2LD9A 1VRAB 1UUPA 1WXVA 1V49A 2KC2A 3N3KB 4W9KA 3TL5A 4JQWC 1G6JA 2R61A 4IM3A 3OWEB 1TYGB 1E5WA 1V1PB 3TIXA 2VZKD 4HEA1 3KQ4A 4M8NA 4NQLB 3AEDB 3QA8A 4MM3B 2WXHA 1Q10A 1WE6A 1CK1A 3CSTA 4C7ZA 3PSEB 2ASQA 5TSSA 1E90A 1STEA 2KT7A 3AB5A 4XE0A 3HHMA 3H6NA 1TTNA 2MJDA 4HK2A 4CHKA 3VAWA 2C60A 2J0MA 3HRDD 2TSSA 3H1UA 4HDQA 4RGNA 3W1SC 2IO0B 3D32A 1WGYA 1AARA 3NZUA 2M56B 3Q8FA 4IM0A 4FJVB 4LNNA 3QCAA 2LGDA 3AE7B 3WA0A 4ITKA 2V1YA 4XZ4A 2IGDA 2MBHA 3PT2B 2N0SB 2BYEA 4ACFA 1WXSA 4RCOA 1NI3A 4W9EA 2PEAA 2BS4B 2AYOB 2RD0A 2EKIA 1IUEA 3Q2AC 1EWYC 1SIFA 2CHXA 4DHJD 1F2RC 1T0QC 2EKEC 3PPAA 2ZNVC 1L0VB 1T0RC 1I4GA 1NDDA 1XO3A 3AE9B 1YNTE 4BBNF 4FXCA 1EU4A 5FR6A 3DBHI 4ASWC 1UBQA 1YJ1A 3DBLI 2J0KA 4L1BA 3QIJA 1N62A 5BYQA 2KWVB 2J0JA 4B0EA 1YN5A 1MVKA 4HDOA 3L13A 2OEDA 1NBFC 2LWPA 1CQVA 2Y5CA 2CKHB 4XGAB 2KLCA 4AS1A 4NPNA 2LGXA 2MA9B 1N61A 1V9JA 1HTOA 2N9LA 4E3CA 2KNBA 3FILB 2MBEA 1FNVA 1PGXA 1ZW7A 5BMGA 3FAHA 1FCLA 3U7DA 4DXGA 5G5HA 1TKYA 1XEEA 2KYWA 3I3TB 4MSQB 4IG7B 4W9CA 3C19A 3UIOB 3VRBB 2ZEQA 3SFEB 2JU6X 1T6BX 2DNFA 2REXA 3V61A 2WNMA 5IO9A 1C1YB 1YJIA 2PE9A 4GXBA 3VRAB 3ZRFA 1V86A 1CJEA 3UINB 2C7HA 5CTRC 2LJIA 4BVUC 2QMTA 3A9KB 1N5WA 2KKCA 4DHZB 4S0RA 2MSED 5EE9A 1GAQB 3MTNB 2XK5A 1IGDA 2M0XA 3APDA 3PRMB 3PLVA 2GMIC 3N20C 2IGHA 1JROA 2KC1A 2GBJA 2KOXA 2Z59B 1NVID 1QLBB 1YN3A 2C9WB 3ZXRA 3Q6BA 3N9YC 1VR9A 2X38A 4GSWA 3ZKJC 1C76A 4KIKA 2O2VA 4MGZE 5EDSA 2QIEB 4ANVA 4M0WB 2JWZA 1N63A 2L0FA 3AU5A 1SJHD 2K1FA 4IWOA 2BTEA 3U8ZA 4OW0A 1E8WA 1XLNA 1PQSA 4IWQA 1M4VA 2L1AA 1UF0A 3PZDA 4OVZA 1RLFA 1TIFA 2FUG1 3GE3C 1GB1A 5J18A 4AOFA 4ZYSA 5HFYA 2WDQB 1SEBD 2KWCA 3KUCB 2L7RA 5C23A 2GRIA 1L6UA 2JXXA 2KMCA 4TUUA 3PTFC 3DBSA 3RN9C 3IAS1 3PZ8A 5BO4B 3EUB2 3MHZA 4KV2A 3ZDTA 2ZVOA 3DWMA 2FIDA 1FRRA 1ZXHA 2Z0DB 2KJRA 2BW2A 4WWNA 4XDCA 3H8HA 3P4PB 2WDTB 3I63C 3EFUA 3ZW3A 1F77A 2XEWA 3T3OA 3GZNI 2I2YA 4GB9A 2B3AA 3PS6A 4GOCA 4ZHOA 4KVGB 3KWVA 3NRZA 1XLPA 4MT5A 2RDGA 5AEKB 4OZCA 3EA6A 4ZDVA 3VUWA 4LNFA 2PE6B 2J42A 4HWIB 2Y3AA 2GBKA 4GDLA 4AJWA 4HCPB 1ESFA 4NZLB 2JPHA 2JXTA 3NS8A 2WGSA 1TZOA 2XNAC 1I4PA 3QJZA 3SU8X 4BOSC 3J9CA 3RNCC 4DWFA 3NVYA 2V0GA 2PW9A 4N6EB 2KQSA 3DVGX 1ZDXA 2H89B 2DHZA 4RGOS 2WXPA 2BKFA 2K3UA 3K9PB 5MPOA 2HDEA 2WXKA 5C1ZA 5D7GA 3L16A 3UQAA 2IY1B 3MFGA 3U30A 1Y8RC 3APFA 3DVNV 1J7AA 4M01A 3A9JB 4GMVA 2PVGC 3V3XA 1FPYA 2D2QA 1LFDA 2KJ6A 1SJED 4PS8A 3TMPB 2W3SA 3L10B 3JSVB 2WYQA 3AEBB 2C7MB 2ACZB 4C4VA 4ARIA 3N1YC 2LVOA 2DZJA 4IUMB 1UNSA 2MRPA 2RSUA 4MH8A 5IN7A 1Z2MA 4ZRKA 5D3DA 1SXTA 3N30A 1XCQL 2LXAA 2J52A 3LB8C 3Q3MC 3AEEB 2DZKA 2EMSA 1ZPSA 4BFRA 5IOIA 2KJHB 2WU5B 4DDID 4EKUA 1XT9B 1PYWD 3P2BA 4LLGM
chains in the Genus database with same CATH topology
1WXAA 3ONSA 2ZCBA 4G3XB 4J6IA 4AWJA 3AULA 3RCZA 4A3PA 1D3ZA 2LASA 1SGHA 2N1VA 1WX9A 2FCQA 2JZ3B 2NPTB 2O6VA 3Q3FA 4JLCA 4LDTB 4XC2A 3R7QA 4BBNC 2LGYA 3UIPB 3M95A 1EF5A 2C5LC 4NAWA 2KMAA 1OGWA 3WIMA 5HKHA 2KK8A 4PS3A 3DPDA 3VH3B 4DHZE 3EECA 4TQ1A 1P98A 2KD0A 2O6VD 3AXCA 1UZXB 3A9JA 3HK0A 4WQOB 1Z5SB 4OVUA 3ZNZB 2LD9A 1SE9A 4HJKA 4MELA 1NI2A 4EOYA 2I1JA 3PGEA 3RT3B 1WXVA 4ICVA 3QK0A 4WWOA 1V49A 1KJTA 3RZFA 2KC2A 3N3KB 3PV1A 1WJNA 4ICUA 4KZCA 4II3B 3JSVA 4W9KA 3L0WB 3TL5A 4EZLA 3T9LA 4JQWC 1G6JA 3ZLZA 3ZTDA 1OEYJ 4F8CB 4IM3A 3QC8B 1E5WA 1YD8U 5JZEB 3DDCB 3M3JA 5E6PA 3TIXA 3IHPC 3JYUA 2ZPNA 2KTRA 4NQLB 4M8NA 1P0RA 3QA8A 1V6EA 4WWPA 5DPTA 4LJOB 4MJSB 1WJ4A 1WE6A 5JHBA 3CSTA 2AWTA 1WF9A 3PRZA 1P3QU 4NJ7A 1OTRB 2L8JA 3PSEB 2ASQA 4F7ZA 4ZRJA 1E90A 4NQKE 2D10A 4WJQA 2ZNVB 2A5UA 3HHMA 3V6EB 3H6NA 1TTNA 4HK2A 5DPSA 2G4SA 3QHTA 2DZIA 2BYFA 3VAWA 4CHKA 2K8HA 2C60A 2C7NB 2CU1A 2J0MA 4TKNA 3H1UA 2CS4A 4HDQA 3W1SC 2IO0B 4HXDA 2BF8B 3D32A 1WGYA 1WRDB 3DVGY 4I6NB 1AARA 3NZUA 4IC7B 4WJOA 1EO6A 2NPTA 4IM0A 2KFJA 3ENEA 4FJVB 3LDZE 1HE8A 1KOTA 3QCAA 4WAAA 2LGDA 3WA0A 4XZ4A 2V1YA 4W9HA 2IBIB 2UYZB 1ZGUB 4WJPA 3TBLD 1E8XA 4EZKA 5JHAA 2D11A 1J19A 3WANA 2MBHA 3PT2B 1WYWB 4ANXA 2BYEA 2M1MA 2N7EA 4IWPA 4W9DA 1WXSA 3APCA 3IFWB 4W9EA 2PEAA 3B08A 3ALBA 1IPGA 2JRHA 2AYOB 2RD0A 3TCAA 2DENB 2KXJA 5IA7A 1SIFA 4EZJA 2CHXA 4W9GA 4DHJD 1WM2A 3IBEA 2EKEC 1GC7A 3PPAA 5CHWA 2KX3A 1Q1OA 2ZNVC 1X1MA 3AU4A 4MGYE 4MM3A 1GC6A 3C0RB 4MGKE 4RMAA 1NDDA 4MJSA 3LJ3A 4BKTA 3CMMB 4BBNF 2HE7A 4TV3A 2LVQA 5FR6A 3DBHI 1RAXA 4FJYA 2G3QB 4FHKA 2KDFB 2BGFA 2AEHA 2BWFA 2M8SA 4ASWC 1UBQA 1YJ1A 3DBLI 2J0KA 1L7YA 3QIJA 2RPQA 2OJRA 2KWVB 1R4MI 2NS5A 2J0JA 5AZFA 3UF8A 2FNJB 2M4NA 2LXCA 2JZZA 3QX1A 3QAQA 3S2AA 3VXWA 2IO3B 3VUXA 4HDOA 3SDLC 3L13A 1LXDA 1NBFC 2LWPA 4W9IA 1J8CA 3R66C 3KYCD 4HLEA 1TBEA 2XK5B 2CKHB 3DQVA 1Q0WB 3A1QB 3M62B 4GGQA 4ZRIA 4II2B 4URKA 2KLCA 3OLMD 2DX5B 1WFYA 4NPNA 4MH0E 2K8CA 2KDEB 2LGXA 1RRBA 4JL9A 3N32A 2MA9B 3BY4B 3VH4B 1V9JA 4AJYB 3OAWA 3DCGA 4E3CA 2KNBA 2MBEA 2K39A 2HD5B 1V81A 1WZ0A 2N9XA 4FLHA 1ZW7A 1V5OA 2GOWA 5G55A 4BKSA 2GBNA 1H4RA 5CHFA 2DAJA 1P9DU 3U7DA 2IY0B 2ZZPB 2KWUB 4MEMA 3X23A 5CHVC 2KN5A 3I3TB 4MSQB 2NR2A 4BKSD 4IG7B 4W9CA 4KIKB 4KSLC 2LRUA 4B9KA 5KHQA 4ANWA 3UIOB 2MCNB 2O2VB 3T8MA 2ZEQA 2FCNA 1EUVB 2K6DB 2JT4B 3R7RA 4A20A 2K8BA 4G50A 2RGFA 3PRPB 2REXA 3V61A 2UWQA 2MP2B 1IYFA 2MBOA 4EFOA 3V6CB 2MQJA 4AP4C 1C1YB 1WX8A 2PE9A 4GXBA 2KHWB 2KLGA 3ZRFA 1V86A 1CMXB 1MG8A 4LCDE 1UBIA 3NZSA 4YL8A 5KHOA 3VHTC 2N9EB 3UINB 1WR1A 2C7HA 3OJ4B 5CTRC 1FXTB 4I6LB 2KVRA 3VQIA 2FIFA 3B0AA 2AL3A 4BVUC 5D6JB 2D3GA 3A9KB 2KKCA 4DHZB 2MSED 4K1RB 5D2MB 3MTNB 2XK5A 1WIAA 2M0XA 1YIWA 1YX5B 4W9FA 1KM7A 3A1QA 3APDA 3H7PB 4ZYNA 1WXMA 3VDZA 3PRMB 3PLVA 2GMIC 1WGDA 2KX0A 3B1LX 1WJUA 2KC1A 3ZNID 2K25A 4K7SA 3GOEA 3W1YA 2I1KA 1C3TA 2JVCA 3W1SA 2GBJA 2KOXA 2Z59B 3EHVA 3JVZX 4LDTD 5GMVA 3CF6E 4NNJB 1XQQA 3ECIA 3A33B 2MWSB 1ISNA 1WZ3A 2AL6A 1LQBA 2C9WB 3VTVA 1S3SG 3ZUNA 1H8CA 3WALA 4B95A 4PS7A 3H7SA 4GSWA 3BINA 2YLMA 3ZKJC 5E6NA 4KIKA 3UQBA 4EEWA 4HCNB 2L05A 3QQ8B 3ZTCA 1M94A 2O2VA 4MGZE 3ZNHB 5EDSA 2CHZA 3AI5A 3ML8A 2RR9A 3IG3A 4ANVA 2FCSA 4G0NB 4KDIC 2LZ6A 2MP2A 1E7UA 2JWZA 2MW5A 4M0WB 1WGHA 2L0FA 4E74A 3Q3JA 2G45B 5J17A 3AU5A 1E8YA 2K1FA 4IM2A 4IWOA 3U8ZA 3M63B 1WX7A 4GIVA 2KO3A 1E8WA 3V62A 4CO7A 1PQSA 4FADA 4NJ6A 1E7VA 3NY5A 3R3MA 3L08A 4IWQA 5L95C 1QZEA 4G11A 3HIZA 4B6WA 2NBWB 3PZDA 5E6OA 1WE7A 1ZKHA 2DYOA 2NBVB 2LUEA 1RLFA 2DAFA 3A9KA 3O65B 4GDLB 4N9F4 3QARA 1I35A 3VVWB 2Y5BB 3H7PA 5J18A 4AOFA 5DPWA 2HJ8A 3KYDD 3WAMA 2KWCA 3KUCB 2L7RA 1OEYA 5C23A 4MDKE 5LLIA 2L76A 3H9DA 3HM3A 4M8MA 5G2NA 3L54A 2KANA 2JXXA 2KMCA 4TUUA 3PTFC 3DBSA 1VCBA 4W9LA 5LXHA 2OOBB 1WY8A 4FBJB 4HPLB 5BO4B 4IW0A 4KV2A 3ZDTA 2ZPYA 4A3OA 2ZVOA 1OQYA 4DBGA 2IYDB 2FIDA 4BKGA 3MJWA 1WMHB 2Z0DB 4RM8A 1R4NI 2KJRA 4WWNA 5IAAC 4FHJA 2FAZA 3RZWC 3PHXB 3IVFA 2WDTB 4FN2A 5DPRA 1GG3A 3EFUA 3RYTA 3ZW3A 5AZHA 2XEWA 2FCMA 4GDKB 4JGHB 1WH3A 2NCNA 3A4RA 2IO1B 3GZNI 1S1QB 3VTWA 4GB9A 2B3AA 3PS6A 1V80A 3EC8A 3NOBA 1UD7A 2G4DB 4GOCA 3UGBB 3VFKA 4EUTA 1GJZA 4NY0A 2N4FA 3ML9A 4KVGB 3ZO5B 1UELA 3K9OB 3KW5B 1RFAA 2BYVE 5AEKB 2KFKB 4ZDVA 4AUQC 4XX5A 3VUWA 5DCNA 2PE6B 5TR5A 2R2OA 2JRIB 1BT0A 1WGGA 4HWIB 2ZCCA 2D07B 4DHJB 2ZVNA 2HTHA 2K6QA 2GBKA 2LVPA 3KUZA 4WJNA 3ZDMC 4GDLA 4AJWA 4HCPB 3RULA 1WM3A 2IZVB 2WX0A 3ZVVA 3SD5A 4FJZA 4CYEA 1TZ1A 4PYZA 5L83A 5J2RA 1WJ6A 2JPHA 1VD2A 3ZRCA 3OJ3A 3NS8A 1UH6A 4KDLB 4TQ0A 3RD2A 3WAPA 4JIOU 4RM9A 2N1WA 3DOWA 1IP9A 2LJ5A 4HVBA 5JH5C 2MX2A 3PVLA 3VTUA 3SHQA 4DDGD 3QJZA 3SU8X 3CSFA 2FUHB 2L00B 1E8ZA 2MLBA 4BOSC 2JY6A 2N9PC 4GU2A 4KZ0A 3V60A 4FULA 2N7DA 3VUYA 1WMHA 2BKRB 2VRRB 4DWFA 1TGZB 2DYMA 2KQSA 3DVGX 1WI0A 2DHZA 3A4SC 4HPMB 4DXAB 2A4ZA 4P7IA 2PPHA 3MHSD 2XBBC 2BKFA 2BPSA 2GBRA 2KZRA 2M17A 1XD3B 2YVCA 3K9PB 4F1SA 2CR5A 2R2QA 5LXIB 4GDKA 1V2YA 2KTFA 5C1ZA 3P2BA 3L16A 5D7GA 2O6VB 3UQAA 2IY1B 2KDIA 2LRWA 3U30A 4E71A 1Y8RC 4NAWB 3APFA 1LM8B 4MSMB 3DVNV 5AZGA 2WX1A 2ZJDA 3KUDB 1A5RA 3L17A 3PHWB 3A9JB 3KVFB 2KDBA 2J7QB 4GMVA 2KFKA 2IO2B 2W9NA 2D2QA 1LFDA 2KJ6A 3NHEB 1F9JA 3ZNGC 4PS8A 3PREA 1U4AA 3TMPB 3QWZB 5CX3A 1GUAB 4OVVA 4X57B 1J0GA 1L2NA 2MBBB 1Q5WB 4I6PA 3L10B 4BOZB 2V4LA 3JSVB 2WYQA 3RUIB 2WWZA 3ZIMA 2C7MB 2DZMA 2L3ZA 1T0YA 1UGMA 2JF5A 4K81A 4PYUA 1K8RB 3X0WA 2GBMA 1YQBA 2LVOA 2DZJA 5D94A 3HM6X 4FA6A 1WGRA 2JUOA 3DBRI 1GNUA 4IUMB 4LJPB 4W9JA 1EF1A 2MRPA 2RSUA 2KTRB 3JW0X 4GN1A 2LI5A 1Z2MA 2NBUA 2QHOA 4ZRKA 2KQ7A 2CHWA 3TJPA 2DYBA 4MGIE 2MBQA 3N30A 2LXAA 1I42A 2DZKA 2NVUI 3PLUA 2L0TA 2PJHA 2EMSA 1JRUA 1YX6B 4DK5A 1WR6E 4ANUA 4BFRA 1P1AA 4K7WA 4KSKC 2BWES 2V3SA 2Z0EB 3KH0A 2KJHB 4K7UA 3WAOA 4DDID 4EKUA 3DVNU 2EMTA 1XT9B 1KLVA 1V5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXA A;  3ONS A;  2ZCB A;  4G3X B;  4J6I A;  4AWJ A;  3AUL A;  3RCZ A;  4A3P A;  1D3Z A;  2LAS A;  1SGH A;  2N1V A;  1WX9 A;  2FCQ A;  2JZ3 B;  2NPT B;  2O6V A;  3Q3F A;  4JLC A;  4LDT B;  4XC2 A;  3R7Q A;  4BBN C;  2LGY A;  3UIP B;  3M95 A;  1EF5 A;  2C5L C;  4NAW A;  2KMA A;  1OGW A;  3WIM A;  5HKH A;  2KK8 A;  4PS3 A;  3DPD A;  3VH3 B;  4DHZ E;  3EEC A;  4TQ1 A;  1P98 A;  2KD0 A;  2O6V D;  3AXC A;  1UZX B;  3A9J A;  3HK0 A;  4WQO B;  1Z5S B;  4OVU A;  3ZNZ B;  2LD9 A;  1SE9 A;  4HJK A;  4MEL A;  1NI2 A;  4EOY A;  2I1J A;  3PGE A;  3RT3 B;  1WXV A;  4ICV A;  3QK0 A;  4WWO A;  1V49 A;  1KJT A;  3RZF A;  2KC2 A;  3N3K B;  3PV1 A;  1WJN A;  4ICU A;  4KZC A;  4II3 B;  3JSV A;  4W9K A;  3L0W B;  3TL5 A;  4EZL A;  3T9L A;  4JQW C;  1G6J A;  3ZLZ A;  3ZTD A;  1OEY J;  4F8C B;  4IM3 A;  3QC8 B;  1E5W A;  1YD8 U;  5JZE B;  3DDC B;  3M3J A;  5E6P A;  3TIX A;  3IHP C;  3JYU A;  2ZPN A;  2KTR A;  4NQL B;  4M8N A;  1P0R A;  3QA8 A;  1V6E A;  4WWP A;  5DPT A;  4LJO B;  4MJS B;  1WJ4 A;  1WE6 A;  5JHB A;  3CST A;  2AWT A;  1WF9 A;  3PRZ A;  1P3Q U;  4NJ7 A;  1OTR B;  2L8J A;  3PSE B;  2ASQ A;  4F7Z A;  4ZRJ A;  1E90 A;  4NQK E;  2D10 A;  4WJQ A;  2ZNV B;  2A5U A;  3HHM A;  3V6E B;  3H6N A;  1TTN A;  4HK2 A;  5DPS A;  2G4S A;  3QHT A;  2DZI A;  2BYF A;  3VAW A;  4CHK A;  2K8H A;  2C60 A;  2C7N B;  2CU1 A;  2J0M A;  4TKN A;  3H1U A;  2CS4 A;  4HDQ A;  3W1S C;  2IO0 B;  4HXD A;  2BF8 B;  3D32 A;  1WGY A;  1WRD B;  3DVG Y;  4I6N B;  1AAR A;  3NZU A;  4IC7 B;  4WJO A;  1EO6 A;  2NPT A;  4IM0 A;  2KFJ A;  3ENE A;  4FJV B;  3LDZ E;  1HE8 A;  1KOT A;  3QCA A;  4WAA A;  2LGD A;  3WA0 A;  4XZ4 A;  2V1Y A;  4W9H A;  2IBI B;  2UYZ B;  1ZGU B;  4WJP A;  3TBL D;  1E8X A;  4EZK A;  5JHA A;  2D11 A;  1J19 A;  3WAN A;  2MBH A;  3PT2 B;  1WYW B;  4ANX A;  2BYE A;  2M1M A;  2N7E A;  4IWP A;  4W9D A;  1WXS A;  3APC A;  3IFW B;  4W9E A;  2PEA A;  3B08 A;  3ALB A;  1IPG A;  2JRH A;  2AYO B;  2RD0 A;  3TCA A;  2DEN B;  2KXJ A;  5IA7 A;  1SIF A;  4EZJ A;  2CHX A;  4W9G A;  4DHJ D;  1WM2 A;  3IBE A;  2EKE C;  1GC7 A;  3PPA A;  5CHW A;  2KX3 A;  1Q1O A;  2ZNV C;  1X1M A;  3AU4 A;  4MGY E;  4MM3 A;  1GC6 A;  3C0R B;  4MGK E;  4RMA A;  1NDD A;  4MJS A;  3LJ3 A;  4BKT A;  3CMM B;  4BBN F;  2HE7 A;  4TV3 A;  2LVQ A;  5FR6 A;  3DBH I;  1RAX A;  4FJY A;  2G3Q B;  4FHK A;  2KDF B;  2BGF A;  2AEH A;  2BWF A;  2M8S A;  4ASW C;  1UBQ A;  1YJ1 A;  3DBL I;  2J0K A;  1L7Y A;  3QIJ A;  2RPQ A;  2OJR A;  2KWV B;  1R4M I;  2NS5 A;  2J0J A;  5AZF A;  3UF8 A;  2FNJ B;  2M4N A;  2LXC A;  2JZZ A;  3QX1 A;  3QAQ A;  3S2A A;  3VXW A;  2IO3 B;  3VUX A;  4HDO A;  3SDL C;  3L13 A;  1LXD A;  1NBF C;  2LWP A;  4W9I A;  1J8C A;  3R66 C;  3KYC D;  4HLE A;  1TBE A;  2XK5 B;  2CKH B;  3DQV A;  1Q0W B;  3A1Q B;  3M62 B;  4GGQ A;  4ZRI A;  4II2 B;  4URK A;  2KLC A;  3OLM D;  2DX5 B;  1WFY A;  4NPN A;  4MH0 E;  2K8C A;  2KDE B;  2LGX A;  1RRB A;  4JL9 A;  3N32 A;  2MA9 B;  3BY4 B;  3VH4 B;  1V9J A;  4AJY B;  3OAW A;  3DCG A;  4E3C A;  2KNB A;  2MBE A;  2K39 A;  2HD5 B;  1V81 A;  1WZ0 A;  2N9X A;  4FLH A;  1ZW7 A;  1V5O A;  2GOW A;  5G55 A;  4BKS A;  2GBN A;  1H4R A;  5CHF A;  2DAJ A;  1P9D U;  3U7D A;  2IY0 B;  2ZZP B;  2KWU B;  4MEM A;  3X23 A;  5CHV C;  2KN5 A;  3I3T B;  4MSQ B;  2NR2 A;  4BKS D;  4IG7 B;  4W9C A;  4KIK B;  4KSL C;  2LRU A;  4B9K A;  5KHQ A;  4ANW A;  3UIO B;  2MCN B;  2O2V B;  3T8M A;  2ZEQ A;  2FCN A;  1EUV B;  2K6D B;  2JT4 B;  3R7R A;  4A20 A;  2K8B A;  4G50 A;  2RGF A;  3PRP B;  2REX A;  3V61 A;  2UWQ A;  2MP2 B;  1IYF A;  2MBO A;  4EFO A;  3V6C B;  2MQJ A;  4AP4 C;  1C1Y B;  1WX8 A;  2PE9 A;  4GXB A;  2KHW B;  2KLG A;  3ZRF A;  1V86 A;  1CMX B;  1MG8 A;  4LCD E;  1UBI A;  3NZS A;  4YL8 A;  5KHO A;  3VHT C;  2N9E B;  3UIN B;  1WR1 A;  2C7H A;  3OJ4 B;  5CTR C;  1FXT B;  4I6L B;  2KVR A;  3VQI A;  2FIF A;  3B0A A;  2AL3 A;  4BVU C;  5D6J B;  2D3G A;  3A9K B;  2KKC A;  4DHZ B;  2MSE D;  4K1R B;  5D2M B;  3MTN B;  2XK5 A;  1WIA A;  2M0X A;  1YIW A;  1YX5 B;  4W9F A;  1KM7 A;  3A1Q A;  3APD A;  3H7P B;  4ZYN A;  1WXM A;  3VDZ A;  3PRM B;  3PLV A;  2GMI C;  1WGD A;  2KX0 A;  3B1L X;  1WJU A;  2KC1 A;  3ZNI D;  2K25 A;  4K7S A;  3GOE A;  3W1Y A;  2I1K A;  1C3T A;  2JVC A;  3W1S A;  2GBJ A;  2KOX A;  2Z59 B;  3EHV A;  3JVZ X;  4LDT D;  5GMV A;  3CF6 E;  4NNJ B;  1XQQ A;  3ECI A;  3A33 B;  2MWS B;  1ISN A;  1WZ3 A;  2AL6 A;  1LQB A;  2C9W B;  3VTV A;  1S3S G;  3ZUN A;  1H8C A;  3WAL A;  4B95 A;  4PS7 A;  3H7S A;  4GSW A;  3BIN A;  2YLM A;  3ZKJ C;  5E6N A;  4KIK A;  3UQB A;  4EEW A;  4HCN B;  2L05 A;  3QQ8 B;  3ZTC A;  1M94 A;  2O2V A;  4MGZ E;  3ZNH B;  5EDS A;  2CHZ A;  3AI5 A;  3ML8 A;  2RR9 A;  3IG3 A;  4ANV A;  2FCS A;  4G0N B;  4KDI C;  2LZ6 A;  2MP2 A;  1E7U A;  2JWZ A;  2MW5 A;  4M0W B;  1WGH A;  2L0F A;  4E74 A;  3Q3J A;  2G45 B;  5J17 A;  3AU5 A;  1E8Y A;  2K1F A;  4IM2 A;  4IWO A;  3U8Z A;  3M63 B;  1WX7 A;  4GIV A;  2KO3 A;  1E8W A;  3V62 A;  4CO7 A;  1PQS A;  4FAD A;  4NJ6 A;  1E7V A;  3NY5 A;  3R3M A;  3L08 A;  4IWQ A;  5L95 C;  1QZE A;  4G11 A;  3HIZ A;  4B6W A;  2NBW B;  3PZD A;  5E6O A;  1WE7 A;  1ZKH A;  2DYO A;  2NBV B;  2LUE A;  1RLF A;  2DAF A;  3A9K A;  3O65 B;  4GDL B;  4N9F 4;  3QAR A;  1I35 A;  3VVW B;  2Y5B B;  3H7P A;  5J18 A;  4AOF A;  5DPW A;  2HJ8 A;  3KYD D;  3WAM A;  2KWC A;  3KUC B;  2L7R A;  1OEY A;  5C23 A;  4MDK E;  5LLI A;  2L76 A;  3H9D A;  3HM3 A;  4M8M A;  5G2N A;  3L54 A;  2KAN A;  2JXX A;  2KMC A;  4TUU A;  3PTF C;  3DBS A;  1VCB A;  4W9L A;  5LXH A;  2OOB B;  1WY8 A;  4FBJ B;  4HPL B;  5BO4 B;  4IW0 A;  4KV2 A;  3ZDT A;  2ZPY A;  4A3O A;  2ZVO A;  1OQY A;  4DBG A;  2IYD B;  2FID A;  4BKG A;  3MJW A;  1WMH B;  2Z0D B;  4RM8 A;  1R4N I;  2KJR A;  4WWN A;  5IAA C;  4FHJ A;  2FAZ A;  3RZW C;  3PHX B;  3IVF A;  2WDT B;  4FN2 A;  5DPR A;  1GG3 A;  3EFU A;  3RYT A;  3ZW3 A;  5AZH A;  2XEW A;  2FCM A;  4GDK B;  4JGH B;  1WH3 A;  2NCN A;  3A4R A;  2IO1 B;  3GZN I;  1S1Q B;  3VTW A;  4GB9 A;  2B3A A;  3PS6 A;  1V80 A;  3EC8 A;  3NOB A;  1UD7 A;  2G4D B;  4GOC A;  3UGB B;  3VFK A;  4EUT A;  1GJZ A;  4NY0 A;  2N4F A;  3ML9 A;  4KVG B;  3ZO5 B;  1UEL A;  3K9O B;  3KW5 B;  1RFA A;  2BYV E;  5AEK B;  2KFK B;  4ZDV A;  4AUQ C;  4XX5 A;  3VUW A;  5DCN A;  2PE6 B;  5TR5 A;  2R2O A;  2JRI B;  1BT0 A;  1WGG A;  4HWI B;  2ZCC A;  2D07 B;  4DHJ B;  2ZVN A;  2HTH A;  2K6Q A;  2GBK A;  2LVP A;  3KUZ A;  4WJN A;  3ZDM C;  4GDL A;  4AJW A;  4HCP B;  3RUL A;  1WM3 A;  2IZV B;  2WX0 A;  3ZVV A;  3SD5 A;  4FJZ A;  4CYE A;  1TZ1 A;  4PYZ A;  5L83 A;  5J2R A;  1WJ6 A;  2JPH A;  1VD2 A;  3ZRC A;  3OJ3 A;  3NS8 A;  1UH6 A;  4KDL B;  4TQ0 A;  3RD2 A;  3WAP A;  4JIO U;  4RM9 A;  2N1W A;  3DOW A;  1IP9 A;  2LJ5 A;  4HVB A;  5JH5 C;  2MX2 A;  3PVL A;  3VTU A;  3SHQ A;  4DDG D;  3QJZ A;  3SU8 X;  3CSF A;  2FUH B;  2L00 B;  1E8Z A;  2MLB A;  4BOS C;  2JY6 A;  2N9P C;  4GU2 A;  4KZ0 A;  3V60 A;  4FUL A;  2N7D A;  3VUY A;  1WMH A;  2BKR B;  2VRR B;  4DWF A;  1TGZ B;  2DYM A;  2KQS A;  3DVG X;  1WI0 A;  2DHZ A;  3A4S C;  4HPM B;  4DXA B;  2A4Z A;  4P7I A;  2PPH A;  3MHS D;  2XBB C;  2BKF A;  2BPS A;  2GBR A;  2KZR A;  2M17 A;  1XD3 B;  2YVC A;  3K9P B;  4F1S A;  2CR5 A;  2R2Q A;  5LXI B;  4GDK A;  1V2Y A;  2KTF A;  5C1Z A;  3P2B A;  3L16 A;  5D7G A;  2O6V B;  3UQA A;  2IY1 B;  2KDI A;  2LRW A;  3U30 A;  4E71 A;  1Y8R C;  4NAW B;  3APF A;  1LM8 B;  4MSM B;  3DVN V;  5AZG A;  2WX1 A;  2ZJD A;  3KUD B;  1A5R A;  3L17 A;  3PHW B;  3A9J B;  3KVF B;  2KDB A;  2J7Q B;  4GMV A;  2KFK A;  2IO2 B;  2W9N A;  2D2Q A;  1LFD A;  2KJ6 A;  3NHE B;  1F9J A;  3ZNG C;  4PS8 A;  3PRE A;  1U4A A;  3TMP B;  3QWZ B;  5CX3 A;  1GUA B;  4OVV A;  4X57 B;  1J0G A;  1L2N A;  2MBB B;  1Q5W B;  4I6P A;  3L10 B;  4BOZ B;  2V4L A;  3JSV B;  2WYQ A;  3RUI B;  2WWZ A;  3ZIM A;  2C7M B;  2DZM A;  2L3Z A;  1T0Y A;  1UGM A;  2JF5 A;  4K81 A;  4PYU A;  1K8R B;  3X0W A;  2GBM A;  1YQB A;  2LVO A;  2DZJ A;  5D94 A;  3HM6 X;  4FA6 A;  1WGR A;  2JUO A;  3DBR I;  1GNU A;  4IUM B;  4LJP B;  4W9J A;  1EF1 A;  2MRP A;  2RSU A;  2KTR B;  3JW0 X;  4GN1 A;  2LI5 A;  1Z2M A;  2NBU A;  2QHO A;  4ZRK A;  2KQ7 A;  2CHW A;  3TJP A;  2DYB A;  4MGI E;  2MBQ A;  3N30 A;  2LXA A;  1I42 A;  2DZK A;  2NVU I;  3PLU A;  2L0T A;  2PJH A;  2EMS A;  1JRU A;  1YX6 B;  4DK5 A;  1WR6 E;  4ANU A;  4BFR A;  1P1A A;  4K7W A;  4KSK C;  2BWE S;  2V3S A;  2Z0E B;  3KH0 A;  2KJH B;  4K7U A;  3WAO A;  4DDI D;  4EKU A;  3DVN U;  2EMT A;  1XT9 B;  1KLV A;  1V5T A; 
#chains in the Genus database with same CATH topology
 1TS3 A;  3ONS A;  4G3X B;  2W54 A;  4JWU C;  1TY0 A;  4LDT B;  3R7Q A;  2MH7 A;  1SSN A;  3AM9 A;  1ZUD 2;  3VH3 B;  4OZB A;  2KD0 A;  3AXC A;  1UZX B;  2L32 A;  1TS4 A;  1Z5S B;  2IND C;  5HHD G;  3PGE A;  1T0S C;  4B0M A;  3PZ7 A;  4WWO A;  4N59 A;  3PV1 A;  1WJN A;  4ICU A;  4KZC A;  4EZL A;  4A8X C;  3C8Y A;  3ZTD A;  5GXG B;  4F8C B;  5AUI A;  3NZ3 A;  2BYT A;  5JZE B;  5E6P A;  1VZ8 A;  4WWP A;  1ZP0 B;  4LJO B;  4MJS B;  2AWT A;  4NJ7 A;  2L8J A;  2NMQ A;  2W3R A;  2WP9 B;  1R4N B;  3PO0 A;  5HI1 A;  1WSP A;  3B2F A;  2BS3 B;  2G4S A;  2K8H A;  4HXD A;  2BF8 B;  3B9J A;  4IC7 B;  1TKG A;  1E7P B;  1ENF A;  2NPT A;  2KFJ A;  4WAA A;  2UYZ B;  1E8X A;  3VR9 B;  2PKO A;  1WYW B;  1NEK B;  2M1M A;  2QSD A;  4IWP A;  3TEZ A;  4W9D A;  3APC A;  2KMM A;  4US8 A;  3BK2 A;  1XLO A;  2JRH A;  3TCA A;  5IKC M;  1JWS D;  2LGI A;  4IKG A;  1D5X C;  1MPE A;  4EZJ A;  4NJC A;  1Q1O A;  3AU4 A;  4MGY E;  1GC6 A;  1KTK A;  3LJ3 A;  3AN1 A;  2WXM A;  3CMM B;  4R3D A;  2HE7 A;  1RAX A;  2G3Q B;  3SR6 A;  2OJR A;  5H8Y E;  1R4M I;  2NS5 A;  1FFV A;  2FNJ B;  3UF8 A;  2LXC A;  3QAQ A;  4RH6 A;  3S2A A;  3VUX A;  1LXD A;  4K3B A;  1J8C A;  1FNU A;  1TBE A;  1WGK A;  3M62 B;  1MG4 A;  1YQ4 B;  1D5Z C;  1WFY A;  1YMH E;  3Q69 A;  4ARC A;  1RRB A;  4JL9 A;  3OAW A;  4HJG E;  5T8I A;  2K39 A;  1NYQ A;  1V81 A;  1WZ0 A;  2WXF A;  4YSY B;  2GOW A;  1V5O A;  4L2Y A;  5G55 A;  5CHF A;  1PGB A;  2ZZP B;  2OJW A;  2KWU B;  4MEM A;  3X23 A;  4H2A A;  5I4D A;  4BKS D;  1LO5 D;  2M0A A;  3MP9 A;  4B9K A;  5KHQ A;  2MCN B;  3T8M A;  2FCN A;  2JT4 B;  1ET6 A;  4A20 A;  2RGF A;  2JWU A;  2MP2 B;  2MBO A;  3V6C B;  4AP4 C;  3IT6 B;  1VZ6 A;  4HRS A;  1WX8 A;  4USA A;  2JYT A;  2KLG A;  2ZW0 A;  3NZS A;  4XYC A;  3VHT C;  2N9E B;  4KKJ A;  3BVZ A;  2AL3 A;  3RNE C;  3RFZ B;  5D6J B;  3DHI C;  4K1R B;  2SEB D;  2V9H A;  3A1Q A;  4ZYN A;  1WXM A;  3VDZ A;  2BQQ A;  1BML C;  3B1L X;  1WJU A;  3ZNI D;  4K7S A;  3GOE A;  4WAF A;  3GP7 A;  3JVZ X;  5GMV A;  3VR8 B;  3CF6 E;  1WZ3 A;  2J53 A;  4B95 A;  1BUI C;  4PS7 A;  4PT5 A;  3BIN A;  1VDV A;  3UQB A;  5D3I B;  3QQ8 B;  2L05 A;  2ONQ A;  2CHZ A;  4G0N B;  2DBY A;  1TKE A;  4A90 A;  1E8Y A;  1WX7 A;  2WXL A;  4NJ6 A;  3L08 A;  1FEH A;  1K52 A;  4G11 A;  4B6W A;  2H88 B;  1I4Q A;  1PUT A;  2VZK B;  3TEW A;  1T3Q A;  3IAM 1;  1V1O A;  1WE7 A;  5E6O A;  2LUE A;  2DAF A;  2IDY A;  3O65 B;  1K50 A;  4TSS A;  4P1B C;  3VVW B;  3H7P A;  1XCT L;  3WAM A;  2LUM A;  2WQY B;  1PFD A;  1OEY A;  4MDK E;  5G2N A;  2OOB B;  3Q3N C;  1A70 A;  4O1N A;  4RF1 A;  3R8B A;  4IW0 A;  1MJD A;  3DHG C;  1EWC A;  1HQR D;  4RGM A;  1F2R I;  3MJW A;  1WMH B;  3Q8E A;  4FHJ A;  1EM7 A;  1HXY D;  5DPR A;  3ZYY X;  1F52 A;  1D6E C;  2FCM A;  4GDK B;  3ZXV A;  3VTW A;  1NYR A;  1SF0 A;  1MHX A;  1V80 A;  5C2T B;  3DBH B;  2N4F A;  3ML9 A;  3ZO5 B;  1E0Z A;  1JCK B;  3DBL B;  2KFK B;  4AUQ C;  4XX5 A;  3IXS A;  1L4D B;  2R2O A;  4RFB A;  1C77 A;  1WGG A;  1IBX B;  4DHJ B;  2LVP A;  2DWQ A;  4WJN A;  3R2T A;  1WM3 A;  3SD5 A;  2I38 A;  1TZ1 A;  5J2R A;  3ZRC A;  4TQ0 A;  2WXO A;  3WAP A;  4RM9 A;  3DOW A;  5BMH A;  2LJ5 A;  5JH5 C;  3PVL A;  3VTU A;  3CSF A;  4DXF A;  1E8Z A;  3Q3O C;  4NAM A;  4GU2 A;  1LGR A;  3V60 A;  2BKR B;  2DYM A;  4RNA A;  4DXA B;  2WXI A;  4P7I A;  3MHS D;  2BPS A;  3AE3 B;  2BS2 B;  3ZGZ A;  2KTF A;  2O6V B;  2KDI A;  3GE8 C;  2LRW A;  2WU2 B;  1OFF A;  3DWG C;  4MSM B;  5AZG A;  3KUD B;  3L17 A;  2KDB A;  2W9N A;  1D4B A;  3ZJT A;  1U4A A;  3QWZ B;  1J0G A;  1FRD A;  3NG0 A;  1SE2 A;  2DZM A;  2L3Z A;  1RM6 C;  4PYU A;  3BK1 A;  1YQB A;  2N9K A;  5H92 C;  2D3B A;  3DBR I;  4LJP B;  1GNU A;  4HPP A;  1B1Z A;  2NBU A;  2QHO A;  4RF0 A;  4JPS A;  2CHW A;  2DYB A;  4LNO A;  2NVU I;  4DK5 A;  1YX6 B;  1KLV A;  1WR6 E;  2KQ4 X;  4K7W A;  2BWE S;  2V3S A;  2Z0E B;  1I4R A;  3AEF B;  1WXA A;  4AWJ A;  4P1C C;  2JZ3 B;  4BBN C;  1OQQ A;  1FXI A;  3RI7 C;  2LGY A;  4NAW A;  3R2I A;  3RMK C;  5HKH A;  2LHD A;  3DPD A;  4ZHP A;  3ZJU A;  2LHE A;  1ACC A;  2AQ2 B;  4OVU A;  1SE9 A;  1NI2 A;  3RT3 B;  1RWS A;  3QK0 A;  1KJT A;  3RZF A;  2DLB A;  4II3 B;  3L0W B;  3T9L A;  3AV8 A;  3E9S A;  3ZLZ A;  3AEC B;  1OEY J;  5BYR A;  1V97 A;  1VJK A;  3Q8B A;  4ZOH C;  3RNA C;  2ZPN A;  2JX5 A;  2KTR A;  2K0P A;  5HG2 A;  2CU3 A;  4P16 A;  1FNW A;  2PLP A;  2WXN A;  3ZJV A;  5EE0 A;  5JHB A;  2LFI A;  1I4X A;  3P1M A;  1AWD A;  1WF9 A;  3AE8 B;  1QKZ A;  4NQK E;  2D10 A;  4WJQ A;  2A5U A;  3QHT A;  4K3C A;  2K5P A;  2C7N B;  2CU1 A;  4TKN A;  2BBC A;  2CS4 A;  4MAC A;  2BVC A;  1WRD B;  4WJO A;  1SIJ A;  3GZN B;  2SAK A;  3ENE A;  2PIA A;  3LDZ E;  1KH0 A;  4KGS A;  2QC8 A;  4W9H A;  3P63 A;  3E56 A;  3IT4 B;  1ZGU B;  1KFY B;  4EZK A;  3N1Z C;  1ZE3 D;  1E10 A;  3WAN A;  4ANX A;  2QEJ C;  2N7E A;  2GLS A;  1I7H A;  1RFK A;  3IFW B;  4YWG G;  1Y56 A;  2PMV A;  3RPF C;  3ALB A;  1V1P A;  1DOI A;  3BII D;  3U7Z A;  1ZDV A;  4WH4 A;  4W9G A;  1QIL A;  3HVD A;  1V8C A;  1GC7 A;  3RNB C;  4MM3 A;  4MGK E;  1KRH A;  4TV3 A;  2LVQ A;  5JXV A;  3AE4 B;  4FHK A;  2BWF A;  2AEH A;  2IJ0 A;  2ON8 A;  3AEA B;  3NVZ A;  2K22 A;  5AZF A;  2JZZ A;  3QX1 A;  3ZQ4 A;  4WIP A;  1PGA A;  2V3P A;  4W9I A;  3R66 C;  4HLE A;  2XK5 B;  3BYT B;  3DQV A;  1Q0W B;  4ZRI A;  1OQR A;  4URK A;  2WXJ A;  2DX5 B;  2M19 A;  3URY A;  3VH4 B;  4AJY B;  3DCG A;  1ET9 A;  2X8X X;  2HD5 B;  2N9X A;  4BKS A;  1L0Y B;  2GBN A;  1H4R A;  2DAJ A;  1P9D U;  3B2G A;  4JWS C;  3Q14 C;  3N1X C;  2KN5 A;  1JML A;  2NR2 A;  4KIK B;  2QJL A;  4KSL C;  2LRU A;  4ANW A;  2O2V B;  3R7R A;  1EUV B;  4G50 A;  3PRP B;  1TT5 B;  2WHI A;  1ROE A;  3BVM A;  1C9F A;  2Y5P A;  1CMX B;  1MG8 A;  4LCD E;  4YL8 A;  4JX1 C;  3BZD B;  4A9A A;  1C4C A;  3MC9 A;  4I6L B;  3VQI A;  1WRI A;  3B0A A;  2E3T A;  3W5U B;  4C80 A;  1YX5 B;  3MC8 A;  3RNG C;  1IGC A;  3AE6 B;  2I1K A;  2W82 A;  1DOX A;  1K53 A;  2JVC A;  3W1S A;  3FIL A;  4NNJ B;  1XQQ A;  3ECI A;  2MWS B;  1VLB A;  2AL6 A;  2EEL A;  3VTV A;  1S3S G;  2VH2 A;  3WAL A;  5E6N A;  2AX5 A;  4EEW A;  3AEG B;  1M94 A;  2CJO A;  2NTS A;  3ML8 A;  2RR9 A;  4IOI E;  1E7U A;  4E74 A;  2QIL A;  3HVZ A;  3TEX A;  5J17 A;  4IM2 A;  3V62 A;  4GIV A;  2KO3 A;  3FKY A;  1E7V A;  3NY5 A;  1UGJ A;  3R3M A;  2NBW B;  2RMM A;  4YXD B;  3LYY A;  1L6V A;  2CJN A;  1ZKH A;  2NBV B;  3A9K A;  4GDL B;  3I5J C;  2AQ3 B;  3QAR A;  1CZP A;  5DPW A;  2HJ8 A;  3KYD D;  2YEP F;  5LLI A;  2L76 A;  3H9D A;  3HM3 A;  3I9V 1;  4M8M A;  1WYG A;  3SFD B;  1WY8 A;  4FBJ B;  4HPL B;  1I4H A;  1D5M C;  2ZPY A;  4A3O A;  5FKA C;  1OQY A;  2IPK D;  4BKG A;  5IP4 D;  4RM8 A;  5E6J A;  1QQR A;  5IAA C;  2GI9 A;  3RZW C;  1SBB B;  3IVF A;  4D2K A;  3RYT A;  1HTQ A;  5AZH A;  4JGH B;  1AYF A;  2FBW B;  4M0W A;  4A55 A;  5LNK 1;  3NOB A;  3UGB B;  1UD7 A;  2G4D B;  1GJZ A;  1RFA A;  1R4M B;  2JRI B;  2W55 A;  1BT0 A;  2ZVN A;  2HTH A;  2K6Q A;  3KUZ A;  3RUL A;  2BB6 A;  4RGT A;  3ZVV A;  2WX0 A;  4C4V B;  4FJZ A;  4CYE A;  5L83 A;  3AE2 B;  2V4I B;  5BYS A;  2MHJ A;  3NUH B;  4N58 A;  4JIO U;  2N1W A;  1YQ3 B;  4US9 A;  1C78 A;  4DDG D;  2L52 A;  2FUH B;  2L00 B;  4LK0 M;  2JY6 A;  4KZ0 A;  4FUL A;  3VUY A;  1TGZ B;  3AMZ A;  4UDU C;  1JWA D;  3EGR A;  1MI0 A;  1WI0 A;  2E6X A;  3U2S C;  5BMI A;  2PPH A;  2M17 A;  2KZR A;  2RDH A;  1XD3 B;  2YVC A;  5LXI B;  4E71 A;  3Q8C A;  1NEN B;  2INP E;  2WX1 A;  1L5P A;  2ZJD A;  3P4Q B;  3P4R B;  1A5R A;  3TEY A;  2WXR A;  2WDR B;  2LGS A;  1XLQ A;  1YOV B;  3ZNG C;  3PRE A;  2ICI A;  5CX3 A;  1BXT A;  1GUA B;  1C79 A;  4X57 B;  2MBB B;  1Q5W B;  4I6P A;  4BOZ B;  2JF5 A;  4K81 A;  1F0Z A;  2GBM A;  4KKI A;  1TJE A;  2JUO A;  4FA6 A;  1ZOY B;  3SEB A;  2QCZ A;  2VH1 A;  2FE8 A;  1ZXI A;  3PLU A;  2KDM A;  3W9C B;  2PJH A;  1JRU A;  1FFU A;  4WWM A;  4ANU A;  1P1A A;  4KSK C;  3KH0 A;  1TY2 A;  1UWM A;  3WAO A;  3DVN U;  3AI5 A;  1V5T A;  2LMC A;  4A3P A;  2LAS A;  3FC4 A;  4XC2 A;  2NPT B;  3Q3F A;  4JLC A;  3MC0 B;  3M95 A;  2KK8 A;  4DHZ E;  3EEC A;  3EFC A;  1P98 A;  2O6V D;  4LTU A;  3A9J A;  4WQO B;  3BYY B;  1C4A A;  3ZNZ B;  4YTM B;  4HJK A;  4P6V F;  4MEL A;  4EOY A;  4WQM A;  5G5G A;  2I1J A;  4L23 A;  4ICV A;  1HZ6 A;  3JSV A;  3KWL A;  1YN4 A;  3LXF A;  3P42 A;  3QC8 B;  1YD8 U;  2INC C;  3DDC B;  3M3J A;  1DYQ A;  2BB5 A;  3IHP C;  3JYU A;  4OZA A;  1P0R A;  3NVW A;  2N7J A;  1QOF A;  1V6E A;  5DPT A;  4GLS C;  1WJ4 A;  2JYE A;  3PRZ A;  1P3Q U;  1OTR B;  4F7Z A;  1JWB D;  4ZRJ A;  1FCC C;  5C3J B;  2ZNV B;  1QOA A;  3V6E B;  5DPS A;  2DZI A;  2BYF A;  1FMA D;  2KN4 A;  4QAY A;  1L0X B;  4I6N B;  3DVG Y;  1F1H A;  1GOZ A;  1EO6 A;  2PVO D;  3AE5 B;  1HE8 A;  3T3N A;  1FXA A;  1P7F A;  1E6E B;  1P7E A;  2IBI B;  2V3N A;  3TBL D;  4WJP A;  5JHA A;  2D11 A;  1DGJ A;  1J19 A;  3MJ5 A;  1HZ5 A;  2WS3 B;  4DQO C;  1SE4 A;  3B08 A;  1JWM D;  1IPG A;  1UWX A;  1MHH E;  2DEN B;  2KXJ A;  4HRO A;  2MEK A;  2D5G A;  2JSV X;  5IA7 A;  1WM2 A;  3IBE A;  5AUK A;  5CHW A;  4KGT A;  2KX3 A;  1X1M A;  1N5X A;  4RMA A;  3C0R B;  4MJS A;  2YEP B;  4BKT A;  2QDF A;  2WDV B;  3CIR B;  4FJY A;  2KDF B;  2BGF A;  2M8S A;  1KF6 B;  4M02 A;  1L7Y A;  1SB3 C;  2RPQ A;  2M4N A;  2LEK A;  4XDD A;  1JRP A;  3VXW A;  2IO3 B;  4KX6 B;  3SDL C;  1JW9 D;  1KLU D;  3KYC D;  1JQ4 A;  4GGQ A;  3A1Q B;  2RDB C;  4II2 B;  2KAC A;  3ABV B;  3OLM D;  2HTM E;  1XF5 L;  3Q8A A;  4MH0 E;  2K8C A;  2KDE B;  4M00 A;  1N60 A;  3N32 A;  3BY4 B;  3NS1 A;  4HKZ E;  4OHJ A;  4ZRP A;  1MFW A;  4FLH A;  2D3C A;  3O13 A;  1QT9 A;  1R7S A;  2IY0 B;  5EE1 A;  5CHV C;  4BAX A;  3DBR B;  1WXQ A;  2K6D B;  3GB1 A;  2K9X A;  4YSZ B;  2K8B A;  2Q5W D;  5EE3 A;  2UWQ A;  1IYF A;  3AE1 B;  4EFO A;  1JWU D;  2MQJ A;  1KLG D;  2KHW B;  2GB1 A;  1EU3 A;  1QOB A;  1UBI A;  5KHO A;  1WR1 A;  3OJ4 B;  4C56 C;  2WXQ A;  1FXT B;  2KVR A;  2FIF A;  2D3G A;  3OG5 A;  5D2M B;  4S17 A;  1WIA A;  1YIW A;  3GS2 A;  4Q2J A;  4W9F A;  1KM7 A;  3H7P B;  4XWW A;  1DOY A;  1TS2 A;  1T5X D;  4BZA A;  2PTL A;  1WGD A;  2KX0 A;  2K25 A;  3W1Y A;  1C3T A;  1FD6 A;  4YSX B;  4LDT D;  3EHV A;  5FK9 C;  1FO4 A;  1B9R A;  1J7C A;  3A33 B;  1ISN A;  1LQB A;  3RNF C;  2XN9 C;  3ZUN A;  1H8C A;  3H7S A;  2YLM A;  3DHH C;  3KLS X;  3U4E G;  4HCN B;  1L4Z B;  1KOT A;  1AW7 A;  3ZTC A;  3ZNH B;  1J7B A;  3IG3 A;  3AH7 A;  2FCS A;  4KDI C;  1GPX A;  2LZ6 A;  2MP2 A;  2MW5 A;  3NVV A;  1WGH A;  4JE3 B;  3U52 E;  2KVZ A;  2G45 B;  3Q3J A;  4HKQ A;  3M63 B;  3BWU D;  4CO7 A;  4FAD A;  1SE3 A;  2RPV A;  2OHF A;  5L95 C;  1QZE A;  4XWT A;  3WCQ A;  3HIZ A;  2INN E;  2DYO A;  4N9F 4;  1I35 A;  1C4P A;  2Y5B B;  4C00 A;  2KAJ A;  1VZ7 A;  3L54 A;  2KAN A;  2JQR B;  3V05 A;  4LNI A;  5LXH A;  1VCB A;  2BT6 A;  4W9L A;  4LNK A;  3TSS A;  1AN8 A;  2WXG A;  1FIQ A;  1RYJ A;  4DBG A;  2IYD B;  5FR3 A;  1GB4 A;  3NJT A;  1R4N I;  4C7Y A;  3BVG A;  2FAZ A;  3PHX B;  1XXG A;  4FN2 A;  1GG3 A;  2L83 A;  2JZP A;  1WH3 A;  2NCN A;  3A4R A;  2IO1 B;  1S1Q B;  3W2D A;  3EC8 A;  1HA5 A;  3VFK A;  4EUT A;  4J3O D;  4NY0 A;  4ZRQ A;  1UEL A;  2ZW1 A;  3K9O B;  3KW5 B;  2BYV E;  1K51 A;  2G9H D;  5DCN A;  5TR5 A;  2ZCC A;  2D07 B;  3ZDM C;  2IZV B;  4PYZ A;  1WJ6 A;  1PDX A;  1N6Z A;  1VD2 A;  3OJ3 A;  1UH6 A;  4KDL B;  2G1E A;  3RD2 A;  1TS5 A;  1E9M A;  1IP9 A;  4CQN A;  4HVB A;  2MX2 A;  4YTP B;  3SHQ A;  2KWD A;  3HUI A;  1JAL A;  2MLB A;  2N9P C;  2MJE A;  2N7D A;  1WMH A;  2VRR B;  4PK1 A;  3P4S B;  3A4S C;  2IGG A;  4HPM B;  2A4Z A;  2B76 B;  2XBB C;  2GBR A;  4IDI A;  4F1S A;  2CR5 A;  2R2Q A;  2D3A A;  3L4P A;  4GDK A;  1V2Y A;  4NAW B;  1LM8 B;  3ETR A;  2MJ3 A;  4TMA B;  1YJJ A;  3PHW B;  3KVF B;  2J7Q B;  2KFK A;  2IO2 B;  3NHE B;  1F9J A;  2UU7 A;  2WLB A;  2NTT A;  1QOG A;  1IBX A;  4OVV A;  1L2N A;  2V4L A;  3ZIM A;  3RUI B;  2WWZ A;  4A6Q A;  4WUR A;  1T0Y A;  1UGM A;  4EE2 A;  3X0W A;  1K8R B;  1FM0 D;  5D94 A;  3HM6 X;  2Z8L A;  1WGR A;  4W9J A;  1EF1 A;  3TUO A;  2KTR B;  3JW0 X;  4GN1 A;  2LI5 A;  4KGR A;  2KQ7 A;  1WWT A;  3TJP A;  4MGI E;  2MBQ A;  4REZ A;  1I42 A;  1QF6 A;  2AQ1 B;  2L0T A;  3UI3 A;  2HJ1 A;  3CWI A;  4K7U A;  2EMT A;  2ZCB A;  4J6I A;  3AUL A;  3RCZ A;  1D3Z A;  1SGH A;  2N1V A;  3I57 A;  1WX9 A;  2FCQ A;  2O6V A;  3W5V B;  3UIP B;  1EF5 A;  2C5L C;  2KMA A;  1OGW A;  3WIM A;  4YTN B;  4PS3 A;  1HEZ E;  4TQ1 A;  2J4X A;  4AQ7 A;  3HK0 A;  4YT0 B;  2LD9 A;  1VRA B;  1UUP A;  1WXV A;  1V49 A;  2KC2 A;  3N3K B;  4W9K A;  3TL5 A;  4JQW C;  1G6J A;  2R61 A;  4IM3 A;  3OWE B;  1TYG B;  1E5W A;  1V1P B;  3TIX A;  2VZK D;  4HEA 1;  3KQ4 A;  4M8N A;  4NQL B;  3AED B;  3QA8 A;  4MM3 B;  2WXH A;  1Q10 A;  1WE6 A;  1CK1 A;  3CST A;  4C7Z A;  3PSE B;  2ASQ A;  5TSS A;  1E90 A;  1STE A;  2KT7 A;  3AB5 A;  4XE0 A;  3HHM A;  3H6N A;  1TTN A;  2MJD A;  4HK2 A;  4CHK A;  3VAW A;  2C60 A;  2J0M A;  3HRD D;  2TSS A;  3H1U A;  4HDQ A;  4RGN A;  3W1S C;  2IO0 B;  3D32 A;  1WGY A;  1AAR A;  3NZU A;  2M56 B;  3Q8F A;  4IM0 A;  4FJV B;  4LNN A;  3QCA A;  2LGD A;  3AE7 B;  3WA0 A;  4ITK A;  2V1Y A;  4XZ4 A;  2IGD A;  2MBH A;  3PT2 B;  2N0S B;  2BYE A;  4ACF A;  1WXS A;  4RCO A;  1NI3 A;  4W9E A;  2PEA A;  2BS4 B;  2AYO B;  2RD0 A;  2EKI A;  1IUE A;  3Q2A C;  1EWY C;  1SIF A;  2CHX A;  4DHJ D;  1F2R C;  1T0Q C;  2EKE C;  3PPA A;  2ZNV C;  1L0V B;  1T0R C;  1I4G A;  1NDD A;  1XO3 A;  3AE9 B;  1YNT E;  4BBN F;  4FXC A;  1EU4 A;  5FR6 A;  3DBH I;  4ASW C;  1UBQ A;  1YJ1 A;  3DBL I;  2J0K A;  4L1B A;  3QIJ A;  1N62 A;  5BYQ A;  2KWV B;  2J0J A;  4B0E A;  1YN5 A;  1MVK A;  4HDO A;  3L13 A;  2OED A;  1NBF C;  2LWP A;  1CQV A;  2Y5C A;  2CKH B;  4XGA B;  2KLC A;  4AS1 A;  4NPN A;  2LGX A;  2MA9 B;  1N61 A;  1V9J A;  1HTO A;  2N9L A;  4E3C A;  2KNB A;  3FIL B;  2MBE A;  1FNV A;  1PGX A;  1ZW7 A;  5BMG A;  3FAH A;  1FCL A;  3U7D A;  4DXG A;  5G5H A;  1TKY A;  1XEE A;  2KYW A;  3I3T B;  4MSQ B;  4IG7 B;  4W9C A;  3C19 A;  3UIO B;  3VRB B;  2ZEQ A;  3SFE B;  2JU6 X;  1T6B X;  2DNF A;  2REX A;  3V61 A;  2WNM A;  5IO9 A;  1C1Y B;  1YJI A;  2PE9 A;  4GXB A;  3VRA B;  3ZRF A;  1V86 A;  1CJE A;  3UIN B;  2C7H A;  5CTR C;  2LJI A;  4BVU C;  2QMT A;  3A9K B;  1N5W A;  2KKC A;  4DHZ B;  4S0R A;  2MSE D;  5EE9 A;  1GAQ B;  3MTN B;  2XK5 A;  1IGD A;  2M0X A;  3APD A;  3PRM B;  3PLV A;  2GMI C;  3N20 C;  2IGH A;  1JRO A;  2KC1 A;  2GBJ A;  2KOX A;  2Z59 B;  1NVI D;  1QLB B;  1YN3 A;  2C9W B;  3ZXR A;  3Q6B A;  3N9Y C;  1VR9 A;  2X38 A;  4GSW A;  3ZKJ C;  1C76 A;  4KIK A;  2O2V A;  4MGZ E;  5EDS A;  2QIE B;  4ANV A;  4M0W B;  2JWZ A;  1N63 A;  2L0F A;  3AU5 A;  1SJH D;  2K1F A;  4IWO A;  2BTE A;  3U8Z A;  4OW0 A;  1E8W A;  1XLN A;  1PQS A;  4IWQ A;  1M4V A;  2L1A A;  1UF0 A;  3PZD A;  4OVZ A;  1RLF A;  1TIF A;  2FUG 1;  3GE3 C;  1GB1 A;  5J18 A;  4AOF A;  4ZYS A;  5HFY A;  2WDQ B;  1SEB D;  2KWC A;  3KUC B;  2L7R A;  5C23 A;  2GRI A;  1L6U A;  2JXX A;  2KMC A;  4TUU A;  3PTF C;  3DBS A;  3RN9 C;  3IAS 1;  3PZ8 A;  5BO4 B;  3EUB 2;  3MHZ A;  4KV2 A;  3ZDT A;  2ZVO A;  3DWM A;  2FID A;  1FRR A;  1ZXH A;  2Z0D B;  2KJR A;  2BW2 A;  4WWN A;  4XDC A;  3H8H A;  3P4P B;  2WDT B;  3I63 C;  3EFU A;  3ZW3 A;  1F77 A;  2XEW A;  3T3O A;  3GZN I;  2I2Y A;  4GB9 A;  2B3A A;  3PS6 A;  4GOC A;  4ZHO A;  4KVG B;  3KWV A;  3NRZ A;  1XLP A;  4MT5 A;  2RDG A;  5AEK B;  4OZC A;  3EA6 A;  4ZDV A;  3VUW A;  4LNF A;  2PE6 B;  2J42 A;  4HWI B;  2Y3A A;  2GBK A;  4GDL A;  4AJW A;  4HCP B;  1ESF A;  4NZL B;  2JPH A;  2JXT A;  3NS8 A;  2WGS A;  1TZO A;  2XNA C;  1I4P A;  3QJZ A;  3SU8 X;  4BOS C;  3J9C A;  3RNC C;  4DWF A;  3NVY A;  2V0G A;  2PW9 A;  4N6E B;  2KQS A;  3DVG X;  1ZDX A;  2H89 B;  2DHZ A;  4RGO S;  2WXP A;  2BKF A;  2K3U A;  3K9P B;  5MPO A;  2HDE A;  2WXK A;  5C1Z A;  5D7G A;  3L16 A;  3UQA A;  2IY1 B;  3MFG A;  3U30 A;  1Y8R C;  3APF A;  3DVN V;  1J7A A;  4M01 A;  3A9J B;  4GMV A;  2PVG C;  3V3X A;  1FPY A;  2D2Q A;  1LFD A;  2KJ6 A;  1SJE D;  4PS8 A;  3TMP B;  2W3S A;  3L10 B;  3JSV B;  2WYQ A;  3AEB B;  2C7M B;  2ACZ B;  4C4V A;  4ARI A;  3N1Y C;  2LVO A;  2DZJ A;  4IUM B;  1UNS A;  2MRP A;  2RSU A;  4MH8 A;  5IN7 A;  1Z2M A;  4ZRK A;  5D3D A;  1SXT A;  3N30 A;  1XCQ L;  2LXA A;  2J52 A;  3LB8 C;  3Q3M C;  3AEE B;  2DZK A;  2EMS A;  1ZPS A;  4BFR A;  5IOI A;  2KJH B;  2WU5 B;  4DDI D;  4EKU A;  1XT9 B;  1PYW D;  3P2B A;  4LLG M; 
#chains in the Genus database with same CATH homology
 1WXA A;  3ONS A;  2ZCB A;  4G3X B;  4J6I A;  4AWJ A;  3AUL A;  3RCZ A;  4A3P A;  1D3Z A;  2LAS A;  1SGH A;  2N1V A;  1WX9 A;  2FCQ A;  2JZ3 B;  2NPT B;  2O6V A;  3Q3F A;  4JLC A;  4LDT B;  4XC2 A;  3R7Q A;  4BBN C;  2LGY A;  3UIP B;  3M95 A;  1EF5 A;  2C5L C;  4NAW A;  2KMA A;  1OGW A;  3WIM A;  5HKH A;  2KK8 A;  4PS3 A;  3DPD A;  3VH3 B;  4DHZ E;  3EEC A;  4TQ1 A;  1P98 A;  2KD0 A;  2O6V D;  3AXC A;  1UZX B;  3A9J A;  3HK0 A;  4WQO B;  1Z5S B;  4OVU A;  3ZNZ B;  2LD9 A;  1SE9 A;  4HJK A;  4MEL A;  1NI2 A;  4EOY A;  2I1J A;  3PGE A;  3RT3 B;  1WXV A;  4ICV A;  3QK0 A;  4WWO A;  1V49 A;  1KJT A;  3RZF A;  2KC2 A;  3N3K B;  3PV1 A;  1WJN A;  4ICU A;  4KZC A;  4II3 B;  3JSV A;  4W9K A;  3L0W B;  3TL5 A;  4EZL A;  3T9L A;  4JQW C;  1G6J A;  3ZLZ A;  3ZTD A;  1OEY J;  4F8C B;  4IM3 A;  3QC8 B;  1E5W A;  1YD8 U;  5JZE B;  3DDC B;  3M3J A;  5E6P A;  3TIX A;  3IHP C;  3JYU A;  2ZPN A;  2KTR A;  4NQL B;  4M8N A;  1P0R A;  3QA8 A;  1V6E A;  4WWP A;  5DPT A;  4LJO B;  4MJS B;  1WJ4 A;  1WE6 A;  5JHB A;  3CST A;  2AWT A;  1WF9 A;  3PRZ A;  1P3Q U;  4NJ7 A;  1OTR B;  2L8J A;  3PSE B;  2ASQ A;  4F7Z A;  4ZRJ A;  1E90 A;  4NQK E;  2D10 A;  4WJQ A;  2ZNV B;  2A5U A;  3HHM A;  3V6E B;  3H6N A;  1TTN A;  4HK2 A;  5DPS A;  2G4S A;  3QHT A;  2DZI A;  2BYF A;  3VAW A;  4CHK A;  2K8H A;  2C60 A;  2C7N B;  2CU1 A;  2J0M A;  4TKN A;  3H1U A;  2CS4 A;  4HDQ A;  3W1S C;  2IO0 B;  4HXD A;  2BF8 B;  3D32 A;  1WGY A;  1WRD B;  3DVG Y;  4I6N B;  1AAR A;  3NZU A;  4IC7 B;  4WJO A;  1EO6 A;  2NPT A;  4IM0 A;  2KFJ A;  3ENE A;  4FJV B;  3LDZ E;  1HE8 A;  1KOT A;  3QCA A;  4WAA A;  2LGD A;  3WA0 A;  4XZ4 A;  2V1Y A;  4W9H A;  2IBI B;  2UYZ B;  1ZGU B;  4WJP A;  3TBL D;  1E8X A;  4EZK A;  5JHA A;  2D11 A;  1J19 A;  3WAN A;  2MBH A;  3PT2 B;  1WYW B;  4ANX A;  2BYE A;  2M1M A;  2N7E A;  4IWP A;  4W9D A;  1WXS A;  3APC A;  3IFW B;  4W9E A;  2PEA A;  3B08 A;  3ALB A;  1IPG A;  2JRH A;  2AYO B;  2RD0 A;  3TCA A;  2DEN B;  2KXJ A;  5IA7 A;  1SIF A;  4EZJ A;  2CHX A;  4W9G A;  4DHJ D;  1WM2 A;  3IBE A;  2EKE C;  1GC7 A;  3PPA A;  5CHW A;  2KX3 A;  1Q1O A;  2ZNV C;  1X1M A;  3AU4 A;  4MGY E;  4MM3 A;  1GC6 A;  3C0R B;  4MGK E;  4RMA A;  1NDD A;  4MJS A;  3LJ3 A;  4BKT A;  3CMM B;  4BBN F;  2HE7 A;  4TV3 A;  2LVQ A;  5FR6 A;  3DBH I;  1RAX A;  4FJY A;  2G3Q B;  4FHK A;  2KDF B;  2BGF A;  2AEH A;  2BWF A;  2M8S A;  4ASW C;  1UBQ A;  1YJ1 A;  3DBL I;  2J0K A;  1L7Y A;  3QIJ A;  2RPQ A;  2OJR A;  2KWV B;  1R4M I;  2NS5 A;  2J0J A;  5AZF A;  3UF8 A;  2FNJ B;  2M4N A;  2LXC A;  2JZZ A;  3QX1 A;  3QAQ A;  3S2A A;  3VXW A;  2IO3 B;  3VUX A;  4HDO A;  3SDL C;  3L13 A;  1LXD A;  1NBF C;  2LWP A;  4W9I A;  1J8C A;  3R66 C;  3KYC D;  4HLE A;  1TBE A;  2XK5 B;  2CKH B;  3DQV A;  1Q0W B;  3A1Q B;  3M62 B;  4GGQ A;  4ZRI A;  4II2 B;  4URK A;  2KLC A;  3OLM D;  2DX5 B;  1WFY A;  4NPN A;  4MH0 E;  2K8C A;  2KDE B;  2LGX A;  1RRB A;  4JL9 A;  3N32 A;  2MA9 B;  3BY4 B;  3VH4 B;  1V9J A;  4AJY B;  3OAW A;  3DCG A;  4E3C A;  2KNB A;  2MBE A;  2K39 A;  2HD5 B;  1V81 A;  1WZ0 A;  2N9X A;  4FLH A;  1ZW7 A;  1V5O A;  2GOW A;  5G55 A;  4BKS A;  2GBN A;  1H4R A;  5CHF A;  2DAJ A;  1P9D U;  3U7D A;  2IY0 B;  2ZZP B;  2KWU B;  4MEM A;  3X23 A;  5CHV C;  2KN5 A;  3I3T B;  4MSQ B;  2NR2 A;  4BKS D;  4IG7 B;  4W9C A;  4KIK B;  4KSL C;  2LRU A;  4B9K A;  5KHQ A;  4ANW A;  3UIO B;  2MCN B;  2O2V B;  3T8M A;  2ZEQ A;  2FCN A;  1EUV B;  2K6D B;  2JT4 B;  3R7R A;  4A20 A;  2K8B A;  4G50 A;  2RGF A;  3PRP B;  2REX A;  3V61 A;  2UWQ A;  2MP2 B;  1IYF A;  2MBO A;  4EFO A;  3V6C B;  2MQJ A;  4AP4 C;  1C1Y B;  1WX8 A;  2PE9 A;  4GXB A;  2KHW B;  2KLG A;  3ZRF A;  1V86 A;  1CMX B;  1MG8 A;  4LCD E;  1UBI A;  3NZS A;  4YL8 A;  5KHO A;  3VHT C;  2N9E B;  3UIN B;  1WR1 A;  2C7H A;  3OJ4 B;  5CTR C;  1FXT B;  4I6L B;  2KVR A;  3VQI A;  2FIF A;  3B0A A;  2AL3 A;  4BVU C;  5D6J B;  2D3G A;  3A9K B;  2KKC A;  4DHZ B;  2MSE D;  4K1R B;  5D2M B;  3MTN B;  2XK5 A;  1WIA A;  2M0X A;  1YIW A;  1YX5 B;  4W9F A;  1KM7 A;  3A1Q A;  3APD A;  3H7P B;  4ZYN A;  1WXM A;  3VDZ A;  3PRM B;  3PLV A;  2GMI C;  1WGD A;  2KX0 A;  3B1L X;  1WJU A;  2KC1 A;  3ZNI D;  2K25 A;  4K7S A;  3GOE A;  3W1Y A;  2I1K A;  1C3T A;  2JVC A;  3W1S A;  2GBJ A;  2KOX A;  2Z59 B;  3EHV A;  3JVZ X;  4LDT D;  5GMV A;  3CF6 E;  4NNJ B;  1XQQ A;  3ECI A;  3A33 B;  2MWS B;  1ISN A;  1WZ3 A;  2AL6 A;  1LQB A;  2C9W B;  3VTV A;  1S3S G;  3ZUN A;  1H8C A;  3WAL A;  4B95 A;  4PS7 A;  3H7S A;  4GSW A;  3BIN A;  2YLM A;  3ZKJ C;  5E6N A;  4KIK A;  3UQB A;  4EEW A;  4HCN B;  2L05 A;  3QQ8 B;  3ZTC A;  1M94 A;  2O2V A;  4MGZ E;  3ZNH B;  5EDS A;  2CHZ A;  3AI5 A;  3ML8 A;  2RR9 A;  3IG3 A;  4ANV A;  2FCS A;  4G0N B;  4KDI C;  2LZ6 A;  2MP2 A;  1E7U A;  2JWZ A;  2MW5 A;  4M0W B;  1WGH A;  2L0F A;  4E74 A;  3Q3J A;  2G45 B;  5J17 A;  3AU5 A;  1E8Y A;  2K1F A;  4IM2 A;  4IWO A;  3U8Z A;  3M63 B;  1WX7 A;  4GIV A;  2KO3 A;  1E8W A;  3V62 A;  4CO7 A;  1PQS A;  4FAD A;  4NJ6 A;  1E7V A;  3NY5 A;  3R3M A;  3L08 A;  4IWQ A;  5L95 C;  1QZE A;  4G11 A;  3HIZ A;  4B6W A;  2NBW B;  3PZD A;  5E6O A;  1WE7 A;  1ZKH A;  2DYO A;  2NBV B;  2LUE A;  1RLF A;  2DAF A;  3A9K A;  3O65 B;  4GDL B;  4N9F 4;  3QAR A;  1I35 A;  3VVW B;  2Y5B B;  3H7P A;  5J18 A;  4AOF A;  5DPW A;  2HJ8 A;  3KYD D;  3WAM A;  2KWC A;  3KUC B;  2L7R A;  1OEY A;  5C23 A;  4MDK E;  5LLI A;  2L76 A;  3H9D A;  3HM3 A;  4M8M A;  5G2N A;  3L54 A;  2KAN A;  2JXX A;  2KMC A;  4TUU A;  3PTF C;  3DBS A;  1VCB A;  4W9L A;  5LXH A;  2OOB B;  1WY8 A;  4FBJ B;  4HPL B;  5BO4 B;  4IW0 A;  4KV2 A;  3ZDT A;  2ZPY A;  4A3O A;  2ZVO A;  1OQY A;  4DBG A;  2IYD B;  2FID A;  4BKG A;  3MJW A;  1WMH B;  2Z0D B;  4RM8 A;  1R4N I;  2KJR A;  4WWN A;  5IAA C;  4FHJ A;  2FAZ A;  3RZW C;  3PHX B;  3IVF A;  2WDT B;  4FN2 A;  5DPR A;  1GG3 A;  3EFU A;  3RYT A;  3ZW3 A;  5AZH A;  2XEW A;  2FCM A;  4GDK B;  4JGH B;  1WH3 A;  2NCN A;  3A4R A;  2IO1 B;  3GZN I;  1S1Q B;  3VTW A;  4GB9 A;  2B3A A;  3PS6 A;  1V80 A;  3EC8 A;  3NOB A;  1UD7 A;  2G4D B;  4GOC A;  3UGB B;  3VFK A;  4EUT A;  1GJZ A;  4NY0 A;  2N4F A;  3ML9 A;  4KVG B;  3ZO5 B;  1UEL A;  3K9O B;  3KW5 B;  1RFA A;  2BYV E;  5AEK B;  2KFK B;  4ZDV A;  4AUQ C;  4XX5 A;  3VUW A;  5DCN A;  2PE6 B;  5TR5 A;  2R2O A;  2JRI B;  1BT0 A;  1WGG A;  4HWI B;  2ZCC A;  2D07 B;  4DHJ B;  2ZVN A;  2HTH A;  2K6Q A;  2GBK A;  2LVP A;  3KUZ A;  4WJN A;  3ZDM C;  4GDL A;  4AJW A;  4HCP B;  3RUL A;  1WM3 A;  2IZV B;  2WX0 A;  3ZVV A;  3SD5 A;  4FJZ A;  4CYE A;  1TZ1 A;  4PYZ A;  5L83 A;  5J2R A;  1WJ6 A;  2JPH A;  1VD2 A;  3ZRC A;  3OJ3 A;  3NS8 A;  1UH6 A;  4KDL B;  4TQ0 A;  3RD2 A;  3WAP A;  4JIO U;  4RM9 A;  2N1W A;  3DOW A;  1IP9 A;  2LJ5 A;  4HVB A;  5JH5 C;  2MX2 A;  3PVL A;  3VTU A;  3SHQ A;  4DDG D;  3QJZ A;  3SU8 X;  3CSF A;  2FUH B;  2L00 B;  1E8Z A;  2MLB A;  4BOS C;  2JY6 A;  2N9P C;  4GU2 A;  4KZ0 A;  3V60 A;  4FUL A;  2N7D A;  3VUY A;  1WMH A;  2BKR B;  2VRR B;  4DWF A;  1TGZ B;  2DYM A;  2KQS A;  3DVG X;  1WI0 A;  2DHZ A;  3A4S C;  4HPM B;  4DXA B;  2A4Z A;  4P7I A;  2PPH A;  3MHS D;  2XBB C;  2BKF A;  2BPS A;  2GBR A;  2KZR A;  2M17 A;  1XD3 B;  2YVC A;  3K9P B;  4F1S A;  2CR5 A;  2R2Q A;  5LXI B;  4GDK A;  1V2Y A;  2KTF A;  5C1Z A;  3P2B A;  3L16 A;  5D7G A;  2O6V B;  3UQA A;  2IY1 B;  2KDI A;  2LRW A;  3U30 A;  4E71 A;  1Y8R C;  4NAW B;  3APF A;  1LM8 B;  4MSM B;  3DVN V;  5AZG A;  2WX1 A;  2ZJD A;  3KUD B;  1A5R A;  3L17 A;  3PHW B;  3A9J B;  3KVF B;  2KDB A;  2J7Q B;  4GMV A;  2KFK A;  2IO2 B;  2W9N A;  2D2Q A;  1LFD A;  2KJ6 A;  3NHE B;  1F9J A;  3ZNG C;  4PS8 A;  3PRE A;  1U4A A;  3TMP B;  3QWZ B;  5CX3 A;  1GUA B;  4OVV A;  4X57 B;  1J0G A;  1L2N A;  2MBB B;  1Q5W B;  4I6P A;  3L10 B;  4BOZ B;  2V4L A;  3JSV B;  2WYQ A;  3RUI B;  2WWZ A;  3ZIM A;  2C7M B;  2DZM A;  2L3Z A;  1T0Y A;  1UGM A;  2JF5 A;  4K81 A;  4PYU A;  1K8R B;  3X0W A;  2GBM A;  1YQB A;  2LVO A;  2DZJ A;  5D94 A;  3HM6 X;  4FA6 A;  1WGR A;  2JUO A;  3DBR I;  1GNU A;  4IUM B;  4LJP B;  4W9J A;  1EF1 A;  2MRP A;  2RSU A;  2KTR B;  3JW0 X;  4GN1 A;  2LI5 A;  1Z2M A;  2NBU A;  2QHO A;  4ZRK A;  2KQ7 A;  2CHW A;  3TJP A;  2DYB A;  4MGI E;  2MBQ A;  3N30 A;  2LXA A;  1I42 A;  2DZK A;  2NVU I;  3PLU A;  2L0T A;  2PJH A;  2EMS A;  1JRU A;  1YX6 B;  4DK5 A;  1WR6 E;  4ANU A;  4BFR A;  1P1A A;  4K7W A;  4KSK C;  2BWE S;  2V3S A;  2Z0E B;  3KH0 A;  2KJH B;  4K7U A;  3WAO A;  4DDI D;  4EKU A;  3DVN U;  2EMT A;  1XT9 B;  1KLV A;  1V5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...