2LXCA

Solution structure of the complex between the sgt2 homodimerization domain and the get5 ubl domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/protein binding
molecule keywords Ubiquitin-like protein MDY2
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lxcA00
3NS8A 4W9KA 1ZW7A 1E7VA 3APCA 2UWQA 3M3JA 4ASWC 3IFWB 3SD5A 4YL8A 2KN5A 2O6VB 3VH3B 3ZIMA 1KM7A 2L05A 4B95A 1L7YA 3KW5B 5DPWA 3L54A 2C7HA 2V3SA 1V86A 2MA9B 2CU1A 4TQ1A 3U30A 3SHQA 1OQYA 2D2QA 2FCMA 3VDZA 2KLCA 2KMAA 1UBQA 2LD9A 3IHPC 4LCDE 3TCAA 2KD0A 1J8CA 1WZ3A 4FJVB 5LXHA 2GBJA 2FCNA 2C60A 3MHSD 4HXDA 4N9F4 2KJHB 3TJPA 4TKNA 4HCNB 5GMVA 4ZRIA 3O65B 2BGFA 2ZCCA 4HLEA 4IW0A 3TMPB 4AP4C 2N4FA 2ZZPB 4W9JA 2KFJA 3U7DA 2C9WB 4FN2A 4MDKE 2G4SA 2G3QB 4HDOA 4K7SA 2KWCA 1WJ4A 4OVVA 2CS4A 1GG3A 2LWPA 1V6EA 2N1VA 5IA7A 2HTHA 2LVOA 2VRRB 4J6IA 4HK2A 2KQ7A 2N9PC 3ENEA 1UBIA 3OLMD 4PYUA 2XEWA 2J0KA 2ZJDA 4NQLB 3X23A 1WGYA 2Z0EB 3QQ8B 2NBVB 3A4RA 3DBHI 3RULA 2LGDA 1V5TA 2KNBA 2L7RA 1V80A 2ZVNA 1WY8A 4TUUA 2IO0B 4LJPB 1UGMA 4P7IA 4BBNC 2BF8B 4FADA 5C1ZA 2IO2B 2C7NB 4GXBA 3AXCA 4NPNA 1OGWA 5E6NA 4KIKB 3L13A 2KZRA 2L76A 3ZNID 1TBEA 2LVQA 1ZKHA 4A20A 1RAXA 5CHFA 2KLGA 4TV3A 2KDEB 2Y5BB 1V81A 4FULA 5DPRA 4CHKA 1J19A 2KJ6A 4HDQA 4ZRKA 3V61A 2KWUB 2MQJA 4JIOU 4AUQC 3A4SC 4DDGD 4WWPA 3ZNHB 4BBNF 3KYDD 4EFOA 3ZDTA 2NPTB 1P1AA 2PEAA 1GC6A 2LRUA 2BYVE 3ZKJC 2MBEA 3DVGY 3W1SA 5D7GA 3NZSA 1WXSA 4W9FA 4IWOA 5LXIB 4W9LA 3ZTCA 4IUMB 1OEYA 4RMAA 3I3TB 3L17A 1SGHA 3JSVA 2GBRA 3PLUA 3DVNV 3IVFA 4WAAA 1GJZA 4MGIE 3CMMB 4KV2A 2GBKA 4BFRA 2G45B 2AYOB 3K9OB 2KHWB 2RSUA 2A5UA 3HK0A 3H1UA 4XX5A 2DENB 2KX3A 2LRWA 3TIXA 3V62A 1VCBA 1XT9B 3H9DA 5EDSA 2J0JA 3MJWA 2FCSA 2KDIA 4FHJA 2CHXA 2JY6A 4WWNA 2LXAA 2O6VA 4MGKE 4MM3A 1E5WA 3RD2A 3PPAA 3ZDMC 4WWOA 1J0GA 5IAAC 2K6QA 2OJRA 2FUHB 3LJ3A 3QWZB 2IYDB 2I1KA 3N30A 4E71A 2YVCA 3VTVA 1WMHB 3OJ3A 2Z0DB 3AU5A 2ZVOA 1I42A 3CSFA 3DBRI 2DZIA 2MCNB 2MP2A 4W9DA 2KC1A 3ML9A 1WR6E 1WFYA 3V60A 3VFKA 4E74A 4IC7B 3PRMB 2YLMA 5KHQA 4KIKA 2XK5A 2MW5A 1WGDA 3PRZA 1SE9A 1R4MI 1WI0A 3JYUA 1WJ6A 2UYZB 3M62B 4II2B 5E6PA 2KTFA 4NY0A 4W9IA 4F8CB 1EF5A 2B3AA 2LGXA 1OEYJ 2ZPNA 2C7MB 5L95C 2KKCA 1IP9A 4MSMB 4II3B 5CHVC 3AU4A 2AWTA 2JWZA 2KJRA 2PE9A 4DHZB 2IO1B 2BWES 4IM3A 3B0AA 2MRPA 2RD0A 3KUCB 3D32A 4BKSD 4URKA 1EF1A 4W9CA 2QHOA 5CX3A 2NBWB 3ZNZB 3DPDA 1KJTA 3M63B 2KMCA 3BY4B 4EZJA 2KFKB 1ZGUB 3PHXB 4FHKA 3QARA 4RM8A 2GOWA 4ANXA 2LI5A 3Q3FA 4EZKA 2CHWA 3N3KB 2D3GA 1RFAA 3KH0A 2V1YA 2CR5A 4GU2A 1WXVA 1WE7A 2FIFA 3ZVVA 3C0RB 3WAMA 2MP2B 3EC8A 4AJYB 4HCPB 1E8WA 1ISNA 2JRIB 2FAZA 4FA6A 3AI5A 2IBIB 1MG8A 1WX9A 2JVCA 3JSVB 4MH0E 2K8HA 3WALA 2KANA 3PREA 4G50A 3SU8X 3PGEA 4DDID 1M94A 2O2VB 2AL6A 1E8XA 1WXAA 3IG3A 3WIMA 2AEHA 4HJKA 3OAWA 4M0WB 1R4NI 3PZDA 4HPMB 4LDTB 2K8BA 2M1MA 2KFKA 1S3SG 3K9PB 4IM2A 1UELA 3QJZA 4WQOB 3UIPB 3UF8A 1X1MA 3PVLA 4HPLB 1IPGA 4IWQA 1WIAA 1NI2A 1YJ1A 1WGHA 1BT0A 3H7PA 3UQAA 2N7EA 3ZLZA 4GDKB 2EMTA 3HIZA 4M8NA 3PT2B 1WE6A 3UQBA 1IYFA 2NPTA 2L8JA 4BOSC 4KDIC 2O6VD 2IY1B 3ZNGC 5LLIA 3T8MA 5HKHA 2LGYA 3VUYA 2KWVB 4PS7A 4GOCA 2ZEQA 1WM2A 3DBLI 3QA8A 2LZ6A 2NS5A 2R2QA 4IWPA 4EOYA 2EMSA 2M4NA 2L0FA 1WGRA 1WXMA 5CTRC 4AOFA 1WX8A 4KDLB 1XD3B 3APFA 1Z5SB 3RT3B 5AZGA 1E8ZA 2M17A 2ZNVB 3A9KA 1Q5WB 4GDKA 3A33B 2HD5B 1E90A 4ZRJA 2N9EB 4IG7B 4W9EA 3WA0A 4EUTA 4B6WA 5AEKB 4WJOA 5BO4B 5CHWA 5L83A 3H6NA 3VUWA 2PJHA 1XQQA 2J7QB 1V2YA 2D07B 2LUEA 2KTRA 2MBBB 1UZXB 2XK5B 4B9KA 3ZRCA 2DZKA 4DHJD 3R7QA 2KTRB 5TR5A 1RLFA 3T9LA 3PS6A 4G3XB 3VVWB 2RPQA 1YIWA 5C23A 3CF6E 3WANA 1YQBA 4F7ZA 1WGGA 3KYCD 2LVPA 1P3QU 1GUAB 4JQWC 4K1RB 1EO6A 3R7RA 3TL5A 2BYEA 3EECA 3H7PB 4KSKC 1RRBA 1E7UA 3GOEA 3DVNU 3VHTC 5G55A 4M8MA 2K1FA 3DCGA 3L10B 3ML8A 3OJ4B 4AWJA 3ZW3A 2DYBA 2IO3B 4A3PA 1CMXB 3MTNB 2DHZA 3HHMA 4NJ7A 3HM3A 3PV1A 4KZCA 1EUVB 4TQ0A 3PLVA 2MBHA 4KSLC 2KQSA 1S1QB 2WX0A 4JLCA 2RGFA 3A1QB 2RR9A 3L0WB 2JZZA 4WJNA 1NDDA 4G11A 2MBQA 1WYWB 2WX1A 2O2VA 4PYZA 1WZ0A 2ZCBA 4GB9A 4FBJB 3VQIA 3L16A 1UH6A 2KC2A 3RCZA 3UIOB 2BYFA 4XZ4A 1VD2A 4MJSB 4CYEA 1V9JA 2GMIC 3NZUA 4OVUA 2KDFB 1WR1A 2JT4B 4BKSA 5D6JB 4CO7A 5KHOA 3R66C 4GN1A 3S2AA 2A4ZA 2L3ZA 3QCAA 2CKHB 1YX5B 4MELA 4X57B 2D10A 2MBOA 4EEWA 3RUIB 2DYOA 3QHTA 4F1SA 1WH3A 4EKUA 3GZNI 3EHVA 4NAWB 2FIDA 4ICVA 5D94A 3ZO5B 4WJPA 1UD7A 3VTUA 2JZ3B 5J2RA 2OOBB 1LQBA 2M0XA 1H8CA 2MX2A 2BKRB 2N7DA 3LDZE 3UGBB 4NQKE 4BKGA 2DAJA 2DYMA 2GBNA 3R3MA 4ANUA 2G4DB 4K81A 2MWSB 4FJYA 4HWIB 3ECIA 3L08A 4GIVA 5DCNA 3CSTA 2HE7A 4WJQA 3M95A 3NOBA 3P2BA 3RZFA 5JH5C 2KO3A 5E6OA 2NCNA 1E8YA 3DVGX 4GMVA 2K8CA 4BKTA 2N9XA 4NNJB 2JF5A 1AARA 2DAFA 4NAWA 1C1YB 1JRUA 1Y8RC 1WRDB 4W9HA 2W9NA 2BWFA 2IZVB 2FCQA 4K7UA 2BKFA 3KUDB 3QIJA 2ZNVC 4DXAB 1K8RB 1Z2MA 1WX7A 2MLBA 3WAPA 4BOZB 5JHBA 2AL3A 3W1SC 4HVBA 2GBMA 2NR2A 1TTNA 3A9KB 4MGZE 3RZWC 1P9DU 2M8SA 3N32A 3QK0A 4XC2A 3ZRFA 4GSWA 3ZUNA 2DX5B 4ICUA 2KOXA 5DPTA 4E3CA 1LXDA 3SDLC 1YX6B 2HJ8A 3QC8B 3W1YA 4ANVA 2NBUA 2ASQA 4MJSA 4PS8A 4A3OA 1I35A 3PHWB 3UINB 4I6NB 5DPSA 2C5LC 2KK8A 4K7WA 3X0WA 2LASA 3KUZA 3QAQA 1G6JA 4PS3A 3ALBA 3H7SA 3RYTA 5D2MB 4AJWA 4DHJB 4ZDVA 2WYQA 4LJOB 2IY0B 3WAOA 2KDBA 3VXWA 2DZJA 2REXA 5AZHA 2WWZA 2CHZA 1WJUA 2V4LA 1WMHA 2KVRA 1WM3A 2K39A 3ZTDA 4IM0A 3NY5A 4ZYNA 3DQVA 1YD8U 1P98A 2PPHA 5J18A 1TZ1A 2JPHA 1F9JA 4DBGA 3AULA 1T0YA 3APDA 2Z59B 5JZEB 3A1QA 3VAWA 4DWFA 1V5OA 1HE8A 2K6DB 4GDLB 1V49A 4W9GA 5G2NA 1NBFC 4JL9A 3JVZX 3VUXA 1H4RA 1SIFA 4G0NB 3ONSA 2MSED 4I6LB 1QZEA 3HM6X 3PRPB 4DK5A 2L0TA 5JHAA 2KXJA 4ANWA 4NJ6A 2JUOA 1FXTB 1OTRB 4KZ0A 3V6EB 4RM9A 3A9JB 3B1LX 5FR6A 2D11A 2BPSA 1TGZB 2JXXA 3DBSA 4BVUC 2ZPYA 4FJZA 3VH4B 2KX0A 3IBEA 4DHZE 2L00B 3A9JA 5J17A 1Q1OA 2PE6B 1P0RA 5AZFA 1GC7A 2FNJB 2XBBC 3B08A 2J0MA 3QX1A 4JGHB 1PQSA 3U8ZA 3Q3JA 1KOTA 2NVUI 1U4AA 3PTFC 2DZMA 3EFUA 4FLHA 1L2NA 1WF9A 3TBLD 2EKEC 1D3ZA 2I1JA 4MSQB 1C3TA 2JRHA 2K25A 4EZLA 3V6CB 3DOWA 3KVFB 1Q0WB 1LFDA 2N1WA 1WJNA 3DDCB 2LXCA 1GNUA 2LJ5A 2WDTB 4LDTD 3VTWA 4MEMA 4I6PA 3NHEB 2R2OA 1LM8B 1A5RA 3PSEB 4GDLA 4GGQA 1KLVA 4KVGB 3BINA 4MGYE 3JW0X
chains in the Genus database with same CATH superfamily
2BYTA 1E7VA 3APCA 3IFWB 4UDUC 3VH3B 3ZIMA 2JYTA 1I4PA 3KW5B 3L54A 2C7HA 4YSXB 2IGHA 3URYA 3U30A 2LHEA 3L4PA 3ZJVA 3VDZA 2KLCA 2KMAA 3AV8A 3CIRB 3MFGA 2WNMA 4N9F4 2AQ1B 2WLBA 3O65B 3P4SB 2OHFA 4HDOA 2CU3A 3MHZA 1WJ4A 4OVVA 2CS4A 2LWPA 3UI3A 1L0VB 3DWGC 2YEPB 2QCZA 2N9PC 4PYUA 3ETRA 2ZJDA 2Z0EB 3A4RA 3SR6A 3AB5A 4ARIA 2KNBA 1KLUD 3C8YA 2K3UA 4YTMB 2IO2B 4GXBA 4WWMA 5E6NA 2J52A 4Q2JA 3L13A 2KZRA 1FO4A 1TBEA 1T3QA 1N63A 4O1NA 2NTTA 1RAXA 3SEBA 2KDEB 3N20C 1J19A 4ZRKA 4AUQC 4DDGD 1SE4A 3ZQ4A 3MJ5A 4ACFA 2LRUA 2BYVE 3ZKJC 4W9FA 5LXIB 1C4AA 1OEYA 3I3TB 4RGTA 3L17A 3PLUA 1GB4A 1L4DB 1HTQA 1GOZA 5H92C 2JYEA 3HK0A 3ZXRA 2N9LA 3AE9B 1YJJA 4XX5A 2KX3A 3V62A 1VCBA 2FCSA 2JY6A 2O6VA 4MGKE 1E5WA 3B2FA 3GZNB 4LLGM 2V4IB 3OJ3A 2Z0DB 3AU5A 4C56C 3P4QB 3ML9A 3V60A 3Q69A 2XK5A 3JYUA 1NYQA 2UYZB 3M62B 4II2B 4NY0A 3AEBB 2FBWB 2ZPNA 3TSSA 3BK2A 4MSMB 2AWTA 2RD0A 3D32A 4URKA 3DPDA 4IKGA 1E9MA 3BY4B 4EZJA 1ZGUB 2GOWA 1NI3A 1PDXA 3Q3FA 4EZKA 4NAMA 1JWMD 3RNGC 1CZPA 3KH0A 4GU2A 1WXVA 2FIFA 5IKCM 1JCKB 5BMIA 1DGJA 2PLPA 1E8WA 2JRIB 5D3DA 2JVCA 3HUIA 4MH0E 4OHJA 1J7CA 1C76A 2KANA 4RFBA 2Z8LA 1C4PA 2AL6A 1E8XA 1N5WA 4L1BA 1TYGB 4M0WB 4HPMB 2K8BA 2M1MA 3K9PB 3V3XA 2MEKA 4IWQA 1WIAA 1FNWA 1NI2A 1FCCC 4GDKB 1OFFA 1TZOA 3HIZA 1IYFA 1EWCA 2NPTA 2L8JA 4BOSC 1MFWA 3ZNGC 3GE3C 2LGYA 1PYWD 2KWVB 3KQ4A 4PS7A 4KKJA 4IWPA 2LZ6A 2L0FA 3VR9B 3APFA 3RT3B 5AZGA 4A8XC 2JZPA 1XCQL 4P1CC 3A33B 4ZRJA 4B6WA 5AEKB 3FILA 4WJOA 5L83A 3VUWA 1ZOYB 1XQQA 1L0YB 1UNSA 4B9KA 1UZXB 3C19A 1RLFA 4C4VA 4G3XB 2PW9A 3CF6E 1YQBA 3U52E 3TL5A 2WXHA 4K1RB 3H7PB 3IT6B 1EU4A 3GOEA 2MJDA 3VRAB 4M8MA 3L10B 2JSVX 2BW2A 2IO3B 1K50A 1R4NB 1RM6C 2DHZA 2AQ2B 4ZYSA 1EUVB 4HJGE 2X38A 2WQYB 1K51A 3L0WB 2JZZA 1TKEA 1NDDA 2O2VA 4GB9A 3UIOB 4WAFA 1XLPA 1VD2A 3BK1A 4CYEA 2ACZB 2V3PA 4OVUA 5TSSA 1WR1A 3RNBC 2JT4B 5D6JB 1UGJA 1WYGA 2D10A 3QHTA 4RH6A 2B76B 3RNFC 4F1SA 3EHVA 4ICVA 5D94A 1F2RC 2N7DA 4K3CA 4NQKE 1JALA 2DYMA 4FJYA 4YWGG 1N6ZA 3ECIA 3L08A 4GIVA 2LGIA 5DCNA 3NVZA 3RZFA 1FIQA 2NCNA 4PK1A 1QOAA 3DVGX 4BKTA 4NNJB 4AQ7A 1AARA 4NAWA 1QOGA 1C1YB 2W9NA 5G5HA 5GXGB 1LO5D 1Z2MA 3WAPA 4KX6B 2H88B 2GBMA 3N1YC 3RZWC 3ZRFA 4XC2A 2DX5B 2KOXA 5C2TB 4ARCA 3PZ7A 1YMHE 4MJSA 4A3OA 2JXTA 1SIJA 3QAQA 2WDVB 3RYTA 4ZDVA 2INNE 4GLSC 4YXDB 2KDBA 2REXA 3W9CB 2CHZA 1WJUA 2W55A 3ZJUA 3VRBB 1WM3A 3ZTDA 3LXFA 4FXCA 2Z59B 3A1QA 4A90A 1V5OA 3GS2A 4N59A 5T8IA 4NJCA 2W3RA 4I6LB 3HM6X 3PRPB 4DK5A 1EU3A 4NJ6A 2JX5A 1FXTB 4RM9A 1TGZB 2FUG1 4BVUC 3B9JA 5J17A 5IN7A 1WGKA 1GC7A 5AZFA 2FNJB 3B08A 4C80A 3SFDB 3Q3JA 5HI1A 2INPE 2EKEC 4MSQB 1C3TA 2ZW0A 3V6CB 3DOWA 2BS2B 3I9V1 1DOXA 1DOIA 3DDCB 2LXCA 2WDTB 3NHEB 4GGQA 4HRSA 1KLVA 2NMQA 4JWSC 4K3BA 4W9KA 4ASWC 1QOFA 2KN4A 2KN5A 2L05A 1SE2A 4B95A 1L7YA 5DPWA 2DBYA 1SE3A 3SHQA 1FMAD 2D2QA 3AEEB 4LCDE 1DYQA 2BB5A 2GBJA 4HKQA 2FCNA 4HXDA 2KJHB 5GMVA 3N1ZC 4ZRIA 2ZCCA 3TMPB 2NTSA 5EE0A 1KF6B 2ZZPB 1I4HA 4K7SA 1V6EA 2WXRA 4J6IA 1TIFA 1P7EA 2XEWA 1ESFA 2J0KA 4NQLB 3DWMA 3X23A 1RWSA 3QQ8B 3DBHI 2PKOA 3R2IA 3RULA 3H8HA 2LGDA 3MC9A 3VR8B 1MG4A 1V80A 4LJPB 1SEBD 2BF8B 4C7ZA 3AXCA 1UWMA 2L76A 3ZNID 3RFZB 3NRZA 1KH0A 2D5GA 2KJ6A 4HDQA 2BVCA 4JIOU 1N61A 3W5VB 3DHIC 3FC4A 3KYDD 1L6UA 5FK9C 1GC6A 2RDGA 2MBEA 3DVGY 2LMCA 4IWOA 4W9LA 3AEFB 3ABVB 1TS2A 2IPKD 1ZXHA 4RMAA 1SGHA 3JSVA 3DVNV 1GJZA 4MGIE 2PIAA 4BFRA 1TJEA 2KHWB 2RSUA 2DENB 2LRWA 1ZPSA 4LNKA 5C3JB 2GLSA 2LXAA 3AE6B 3RD2A 1L4ZB 3ZDMC 1J0GA 5IAAC 2K6QA 1J7BA 3LJ3A 4ZRPA 3N30A 1WRIA 2YVCA 3VTVA 2KT7A 2ZVOA 3CSFA 4W9DA 2KC1A 1WFYA 1XXGA 2YLMA 3B2GA 2INCC 5E6PA 4F8CB 2B3AA 4BAXA 2C7MB 5L95C 2KKCA 2WXOA 1SF0A 3AU4A 4DHZB 2IO1B 2BWES 4BKSD 2R61A 4P16A 4L23A 5EE1A 2NBWB 1XLNA 1QT9A 3PHXB 3QARA 2LI5A 2KMMA 1QF6A 3AM9A 3E56A 1V1PB 3C0RB 3WAMA 3EC8A 4AJYB 3WCQA 1XLQA 4M02A 3BYYB 3RMKC 1L6VA 2QILA 1ZDVA 3CWIA 2FAZA 4FA6A 3AI5A 1JWSD 1WX9A 4WQMA 4CQNA 2E6XA 1VLBA 3LB8C 1ET6A 5HG2A 3FKYA 1WXAA 1VRAB 3PZDA 1UELA 3QJZA 4WQOB 2V3NA 1YJ1A 1WGHA 3H7PA 3UQAA 2N7EA 1AW7A 2EMTA 1WE6A 4XWTA 2O6VD 1F0ZA 1ET9A 2IY1B 5LLIA 1D5MC 3NVYA 3QA8A 1STEA 2Y5CA 4EOYA 1WX8A 2DWQA 2QC8A 2M17A 2ZNVB 1Q5WB 4KKIA 2N9EB 4IG7B 4NZLB 5BO4B 5CHWA 1I4RA 2GRIA 3H6NA 4KGSA 1JW9D 4IOIE 2KVZA 2LUMA 2LUEA 2MBBB 5G5GA 5HFYA 1D5XC 3ZRCA 2DZKA 3P42A 2CJOA 4S0RA 5LNK1 4H2AA 3VVWB 2RPQA 1YIWA 3Q3MC 5C23A 3WANA 2VZKD 2LVPA 1P3QU 4C00A 3R7RA 4KGTA 3EECA 4KSKC 3DVNU 3HVDA 2DYBA 2KWDA 2L32A 1CMXB 5JXVA 4LK0M 3BWUD 1VDVA 3Q8CA 3PLVA 2MBHA 2KQSA 1S1QB 2WX0A 1K52A 2RGFA 2DNFA 2WX1A 1QLBB 1WZ0A 4FBJB 1YJIA 3VQIA 3RCZA 1FNVA 1V9JA 3MP9A 1FRDA 1D6EC 2JWUA 4GN1A 1EWYC 4A6QA 3QCAA 2CKHB 4MELA 4X57B 4EEWA 3RUIB 1WSPA 1SBBB 1HA5A 4NAWB 1MHXA 2V9HA 3ZO5B 3VTUA 2JZ3B 2OOBB 2BKRB 1V8CA 3RN9C 2GBNA 3R3MA 4ANUA 4HWIB 3CSTA 2HE7A 3RPFC 4YTPB 2KO3A 1E8YA 3OG5A 2N9XA 2JF5A 2DAFA 2ON8A 1JROA 1QKZA 4W9HA 3P1MA 1NVID 4REZA 1JWBD 2RDBC 2KYWA 4K7UA 3KUDB 3QIJA 2ZNVC 4DXAB 1K8RB 1WX7A 2V0GA 4BOZB 2JQRB 2ONQA 2AL3A 2WXKA 1NEKB 4HVBA 4AS1A 1GPXA 1TTNA 4MGZE 4P1BC 3N32A 3ZUNA 2G9HD 1YQ3B 3W1YA 2NBUA 5E6JA 3PHWB 3UINB 1TS5A 1G6JA 4PS3A 3ALBA 4DHJB 2LEKA 3WAOA 3VXWA 2DZJA 1C79A 3EUB2 2KVRA 4IM0A 5D3IB 3NY5A 1QOBA 4HEA1 3Q8FA 2MJEA 4ZYNA 3E9SA 3AE3B 3T3OA 3AE7B 1TZ1A 3APDA 1V1OA 3VAWA 2K6DB 4W9GA 4GDLB 1V49A 2XNAC 4JL9A 3JVZX 1ROEA 1FEHA 4G0NB 3KWVA 1CJEA 2KXJA 2JUOA 3A9JB 4MT5A 2D11A 1KTKA 2JXXA 3DBSA 2ZPYA 4FJZA 3PZ8A 2L00B 1Q1OA 2PE6B 1EM7A 1T0SC 4JGHB 2QSDA 1MI0A 2NVUI 1U4AA 3PTFC 2PVGC 3EFUA 3TBLD 1ZP0B 1D3ZA 1T6BX 1AN8A 1Q0WB 1WWTA 1LFDA 3Q14C 1WJNA 4ZHOA 3VTWA 4MEMA 4DXGA 2WXJA 3RI7C 3PSEB 4GDLA 3U2SC 3BINA 1MJDA 4MGYE 4B0EA 1F1HA 1ZW7A 3SD5A 1R7SA 4A55A 2O6VB 4WURA 2V3SA 1V86A 5H8YE 2TSSA 4TQ1A 4KGRA 1OQYA 2FCMA 2QJLA 1L0XB 3IHPC 1XF5L 1J8CA 4FJVB 1I4GA 5LXHA 5BMGA 1HEZE 4HCNB 4JX1C 3AE8B 4HLEA 4IW0A 3BVZA 2N4FA 2KFJA 3BVGA 3U7DA 4FN2A 4MDKE 1HZ6A 2G4SA 2G3QB 1TT5B 2KWCA 1HTOA 1GG3A 2KACA 1N60A 4HK2A 2QEJC 1I7HA 3OLMD 4ZHPA 3RNCC 2NBVB 1D4BA 1V5TA 2L7RA 3R2TA 3NVWA 4BBNC 1OGWA 2HDEA 4KIKB 1J7AA 4YT0B 4JPSA 2GI9A 1C9FA 4TV3A 1FXAA 1LGRA 4CHKA 3IAS1 1PUTA 3I57A 2KWUB 2MQJA 3BYTB 2NPTB 1P1AA 2K22A 3Q8AA 4M01A 2X8XX 3W1SA 5D7GA 1NENB 3NZSA 4BZAA 4J3OD 4IUMB 4KV2A 3P4PB 1TS4A 4ZOHC 5EE3A 2G45B 3K9OB 4S17A 2A5UA 2K0PA 1R4MB 4USAA 3H9DA 4M00A 5EDSA 2J0JA 3MJWA 1YNTE 2KDIA 4FHJA 4XGAB 1IBXB 4WWNA 3PPAA 3Q3NC 5I4DA 3QWZB 1NYRA 2I1KA 2BTEA 2MJ3A 2MCNB 2MP2A 1IGDA 1JQ4A 3VFKA 4IC7B 3AEGB 3PRMB 5KHQA 2MW5A 3T3NA 1WGDA 1WI0A 4JWUC 2LGXA 2QMTA 1OEYJ 1SSNA 1PGBA 4IM3A 1PGAA 1XO3A 1EF1A 4W9CA 2QHOA 5CX3A 4OZBA 2KMCA 2KFKB 4RM8A 4ANXA 2J4XA 3N9YC 2D3GA 2KQ4X 2V1YA 2CR5A 2WP9B 1E6EB 1WE7A 3ZVVA 1SJHD 1I4QA 5BYQA 1ISNA 5MPOA 1UUPA 2IBIB 1C4CA 3JSVB 2I2YA 3WALA 4G50A 3PREA 3SU8X 3U7ZA 4B0MA 3PGEA 4DDID 2LHDA 2G1EA 3IG3A 3WIMA 2WXPA 1R4NI 1SJED 3Q6BA 3UIPB 3UF8A 3EFCA 4M8NA 3PT2B 3UQBA 2D3AA 4KDIC 1IUEA 3T8MA 5HKHA 3NS1A 2ZEQA 1WM2A 3DBLI 2R2QA 2NS5A 4MACA 1FNUA 2EMSA 2M4NA 1WXMA 2J42A 1XD3B 1Z5SB 2WHIA 2FE8A 2N9KA 4GDKA 4EUTA 1E90A 2YEPF 4W9EA 2RPVA 5EE9A 3DBRB 3TUOA 1RFKA 2J7QB 1V2YA 2D07B 4EE2A 2CJNA 3NVVA 4XWWA 3T9LA 4F7ZA 1GUAB 4JQWC 1EO6A 2BYEA 4RNAA 1RRBA 1E7UA 3VHTC 5G55A 3OJ4B 3ML8A 2WS3B 4AWJA 2HTME 4C7YA 4HROA 4RGNA 3PV1A 4KZCA 3EA6A 4JLCA 3A1QB 3PO0A 3R8BA 2L52A 4G11A 2MBQA 1WYWB 2ZCBA 1YOVB 3L16A 1UH6A 2D3CA 2BYFA 1ENFA 4YSYB 2GMIC 3NZUA 2KDFB 4PT5A 4CO7A 4YTNB 5KHOA 3R66C 3S2AA 2A4ZA 2L3ZA 2WGSA 2VZKB 2DYOA 1E0ZA 1XCTL 2FIDA 4ZRQA 5J2RA 1H8CA 1LQBA 1Y56A 2IGDA 2WXIA 4BKGA 2DAJA 2MWSB 1AYFA 1C77A 2M0AA 4WJQA 3M95A 3P2BA 1XLOA 5E6OA 4GMVA 3KLSX 1DOYA 1JRUA 4RF0A 3DBHB 2SAKA 2BWFA 4A9AA 2OEDA 2LFIA 2MLBA 1CQVA 3DHHC 3W1SC 3FAHA 3A9KB 2J53A 3AE5B 1P9DU 4TMAB 1ZDXA 4ICUA 5DPTA 4E3CA 4R3DA 1YX6B 3SDLC 2HJ8A 3P4RB 4ANVA 2VH2A 2ASQA 4PS8A 4I6NB 2KK8A 4K7WA 2LASA 3H7SA 5D2MB 4LNOA 2WYQA 4IDIA 2IY0B 5AZHA 2V4LA 3TEYA 1AWDA 3I63C 1VZ8A 3GB1A 3DBLB 2PPHA 5J18A 4DBGA 3AULA 1T0YA 2KAJA 5JZEB 5BYSA 1HE8A 1H4RA 1SIFA 2BT6A 4LNIA 3ONSA 1D5ZC 1QZEA 3OWEB 3GE8C 2L0TA 3V05A 1OTRB 4TSSA 5FR6A 1FXIA 4RCOA 4N6EB 2BPSA 3IT4B 3VH4B 4DHZE 3IBEA 3A9JA 4N58A 4C4VB 3QX1A 1PQSA 3U8ZA 3AMZA 1KOTA 2Y3AA 2DZMA 4DXFA 4FLHA 1L5PA 1L2NA 1WF9A 2L1AA 3Q2AC 4EZLA 1JWUD 2LJ5A 3IXSA 2PVOD 4KVGB 2AQ3B 3JW0X 3NS8A 1RYJA 2RDHA 2UWQA 3M3JA 4OVZA 4YL8A 1KM7A 3W2DA 4LNFA 2M19A 2MA9B 2CU1A 3EGRA 3MC0B 3RNEC 1SXTA 2E3TA 5HHDG 1UBQA 2LD9A 3TCAA 2KD0A 5AUKA 1WZ3A 3MHSD 2C60A 1MHHE 4LTUA 3P63A 4DQOC 1ZUD2 2MH7A 3TJPA 4TKNA 2GB1A 1FFVA 2BGFA 1F77A 1E7PB 4AP4C 2LJIA 1N62A 4W9JA 2C9WB 1C78A 2BBCA 2N1VA 5IA7A 2HTHA 2LVOA 1TY0A 2LGSA 2VRRB 2KQ7A 3AECB 3NJTA 3ENEA 1UBIA 1TS3A 1WGYA 1BUIC 1YQ4B 2H89B 4WIPA 2ZVNA 3HVZA 1WY8A 4TUUA 2M56B 2IO0B 1UGMA 4P7IA 4FADA 5C1ZA 2C7NB 4RGMA 1HQRD 4NPNA 2W82A 1IGCA 4US8A 1FFUA 2LVQA 1ZKHA 4A20A 1XEEA 3IAM1 5CHFA 2KLGA 3KWLA 4MM3B 4FULA 2Y5BB 1V81A 5DPRA 3V61A 3A4SC 3NZ3A 4WWPA 3ZNHB 1K53A 4BBNF 4EFOA 3ZDTA 2PEAA 3AEDB 3Q3OC 2WXLA 1IBXA 1WXSA 3ZTCA 3GP7A 1OQRA 3NUHB 4OZCA 2GBRA 3IVFA 4WAAA 3CMMB 2GBKA 2AYOB 1T5XD 1B1ZA 3H1UA 4P6VF 3TIXA 1XT9B 3AH7A 3RNAC 3ZXVA 3ZJTA 1HZ5A 2CHXA 4LNNA 4MM3A 4QAYA 1HXYD 4WWOA 2OJRA 3O13A 2FUHB 2IYDB 1FPYA 4E71A 2PTLA 2BQQA 1WMHB 1I42A 3DBRI 2DZIA 1WR6E 1I4XA 4RF1A 4E74A 1F2RI 4KIKA 2WXQA 3AN1A 3PRZA 1SE9A 1R4MI 1WJ6A 2KTFA 4W9IA 1FCLA 2WXNA 1EF5A 2W54A 1E10A 1IP9A 4II3B 5CHVC 2JWZA 2KJRA 2PE9A 2WDQB 1Q10A 3B0AA 2MRPA 3KUCB 3BIID 1KLGD 4US9A 3ZNZB 1KJTA 3M63B 4FHKA 4D2KA 2WDRB 2CHWA 3N3KB 2WXMA 3AEAB 1RFAA 2SEBD 1B9RA 2MP2B 3J9CA 1CK1A 4JE3B 3U4EG 2QDFA 1TKYA 4HCPB 1M4VA 2IDYA 4M0WA 1FRRA 1MG8A 2UU7A 2K8HA 1GB1A 4WH4A 3AE4B 1M94A 1MVKA 2O2VB 2WXFA 2AEHA 4HJKA 3OAWA 1SB3C 4LDTB 2KFKA 1S3SG 4IM2A 1X1MA 3PVLA 4HPLB 1IPGA 1BT0A 3ZLZA 2ICIA 1ZXIA 3VUYA 1P7FA 4GOCA 1GAQB 1VJKA 2D3BA 3N1XC 1WGRA 4AOFA 5CTRC 4KDLB 5IOIA 1E8ZA 3A9KA 4ITKA 1QILA 2HD5B 3WA0A 2Q5WD 2KDMA 2PJHA 2JU6X 2BS4B 2I38A 2KTRA 2IGGA 2XK5B 4DHJD 3R7QA 2KTRB 5TR5A 1MPEA 4XYCA 3PS6A 1WGGA 3KYCD 1TKGA 1TY2A 2WU5B 3LYYA 2K1FA 3DCGA 3ZW3A 4OZAA 1V97A 4A3PA 3BVMA 3MTNB 1ZE3D 3HHMA 4NJ7A 4MH8A 3HM3A 1ACCA 4TQ0A 4KSLC 2RR9A 1UWXA 3SFEB 4WJNA 4PYZA 2DLBA 3W5UB 2KC2A 4XZ4A 4MJSB 1KFYB 4OW0A 2HJ1A 1T0RC 1JMLA 4BKSA 2EELA 4XDCA 4YSZB 1YX5B 2Y5PA 2MBOA 1BXTA 1BMLC 1WH3A 4EKUA 1V1PA 3GZNI 4WJPA 1UD7A 3NG0A 2M0XA 5FR3A 2MX2A 3AE2B 3LDZE 3UGBB 1JRPA 2G4DB 4K81A 1OQQA 4XE0A 2QIEB 3TEZA 2INDC 2OJWA 3NOBA 5JH5C 3I5JC 2K8CA 3ZGZA 1Y8RC 1WRDB 3TEWA 2IZVB 1PFDA 2W3SA 2FCQA 2BKFA 1FD6A 2WXGA 1YN3A 5JHBA 5AUIA 2NR2A 2M8SA 3QK0A 4GSWA 2XN9C 2K9XA 1LXDA 1VR9A 3QC8B 3Q8BA 1I35A 5DPSA 2C5LC 3X0WA 3KUZA 1JWAD 4AJWA 4LJOB 2IJ0A 2AX5A 2K5PA 2ZW1A 2WWZA 1WMHA 3DHGC 2K39A 2WU2B 3DQVA 1YD8U 1A70A 1P98A 2JPHA 1F9JA 1YN4A 2BB6A 4DWFA 3VUXA 5G2NA 1NBFC 4XDDA 1FM0D 2PMVA 5BMHA 1VZ6A 2MSED 3HRDD 1VZ7A 1QQRA 5JHAA 1T0QC 4ANWA 2MHJA 4KZ0A 3V6EB 3B1LX 3ZYYX 5IP4D 2BS3B 2KX0A 3BZDB 2RMMA 1P0RA 4RGOS 2XBBC 1KRHA 2J0MA 3MC8A 4HPPA 1YN5A 3TEXA 1UF0A 1WXQA 3AE1B 3FILB 2I1JA 4HKZE 2JRHA 2K25A 1N5XA 2VH1A 1F52A 2N7JA 3KVFB 1PGXA 5BYRA 2EKIA 2N1WA 3Q8EA 2N0SB 4LDTD 1GNUA 4I6PA 2L83A 5FKAC 2R2OA 1LM8B 5IO9A 4L2YA 1A5RA
chains in the Genus database with same CATH topology
3NS8A 4W9KA 1ZW7A 1E7VA 3APCA 2UWQA 3M3JA 4ASWC 3IFWB 3SD5A 4YL8A 2KN5A 2O6VB 3VH3B 3ZIMA 1KM7A 2L05A 4B95A 1L7YA 3KW5B 5DPWA 3L54A 2C7HA 2V3SA 1V86A 2MA9B 2CU1A 4TQ1A 3U30A 3SHQA 1OQYA 2D2QA 2FCMA 3VDZA 2KLCA 2KMAA 1UBQA 2LD9A 3IHPC 4LCDE 3TCAA 2KD0A 1J8CA 1WZ3A 4FJVB 5LXHA 2GBJA 2FCNA 2C60A 3MHSD 4HXDA 4N9F4 2KJHB 3TJPA 4TKNA 4HCNB 5GMVA 4ZRIA 3O65B 2BGFA 2ZCCA 4HLEA 4IW0A 3TMPB 4AP4C 2N4FA 2ZZPB 4W9JA 2KFJA 3U7DA 2C9WB 4FN2A 4MDKE 2G4SA 2G3QB 4HDOA 4K7SA 2KWCA 1WJ4A 4OVVA 2CS4A 1GG3A 2LWPA 1V6EA 2N1VA 5IA7A 2HTHA 2LVOA 2VRRB 4J6IA 4HK2A 2KQ7A 2N9PC 3ENEA 1UBIA 3OLMD 4PYUA 2XEWA 2J0KA 2ZJDA 4NQLB 3X23A 1WGYA 2Z0EB 3QQ8B 2NBVB 3A4RA 3DBHI 3RULA 2LGDA 1V5TA 2KNBA 2L7RA 1V80A 2ZVNA 1WY8A 4TUUA 2IO0B 4LJPB 1UGMA 4P7IA 4BBNC 2BF8B 4FADA 5C1ZA 2IO2B 2C7NB 4GXBA 3AXCA 4NPNA 1OGWA 5E6NA 4KIKB 3L13A 2KZRA 2L76A 3ZNID 1TBEA 2LVQA 1ZKHA 4A20A 1RAXA 5CHFA 2KLGA 4TV3A 2KDEB 2Y5BB 1V81A 4FULA 5DPRA 4CHKA 1J19A 2KJ6A 4HDQA 4ZRKA 3V61A 2KWUB 2MQJA 4JIOU 4AUQC 3A4SC 4DDGD 4WWPA 3ZNHB 4BBNF 3KYDD 4EFOA 3ZDTA 2NPTB 1P1AA 2PEAA 1GC6A 2LRUA 2BYVE 3ZKJC 2MBEA 3DVGY 3W1SA 5D7GA 3NZSA 1WXSA 4W9FA 4IWOA 5LXIB 4W9LA 3ZTCA 4IUMB 1OEYA 4RMAA 3I3TB 3L17A 1SGHA 3JSVA 2GBRA 3PLUA 3DVNV 3IVFA 4WAAA 1GJZA 4MGIE 3CMMB 4KV2A 2GBKA 4BFRA 2G45B 2AYOB 3K9OB 2KHWB 2RSUA 2A5UA 3HK0A 3H1UA 4XX5A 2DENB 2KX3A 2LRWA 3TIXA 3V62A 1VCBA 1XT9B 3H9DA 5EDSA 2J0JA 3MJWA 2FCSA 2KDIA 4FHJA 2CHXA 2JY6A 4WWNA 2LXAA 2O6VA 4MGKE 4MM3A 1E5WA 3RD2A 3PPAA 3ZDMC 4WWOA 1J0GA 5IAAC 2K6QA 2OJRA 2FUHB 3LJ3A 3QWZB 2IYDB 2I1KA 3N30A 4E71A 2YVCA 3VTVA 1WMHB 3OJ3A 2Z0DB 3AU5A 2ZVOA 1I42A 3CSFA 3DBRI 2DZIA 2MCNB 2MP2A 4W9DA 2KC1A 3ML9A 1WR6E 1WFYA 3V60A 3VFKA 4E74A 4IC7B 3PRMB 2YLMA 5KHQA 4KIKA 2XK5A 2MW5A 1WGDA 3PRZA 1SE9A 1R4MI 1WI0A 3JYUA 1WJ6A 2UYZB 3M62B 4II2B 5E6PA 2KTFA 4NY0A 4W9IA 4F8CB 1EF5A 2B3AA 2LGXA 1OEYJ 2ZPNA 2C7MB 5L95C 2KKCA 1IP9A 4MSMB 4II3B 5CHVC 3AU4A 2AWTA 2JWZA 2KJRA 2PE9A 4DHZB 2IO1B 2BWES 4IM3A 3B0AA 2MRPA 2RD0A 3KUCB 3D32A 4BKSD 4URKA 1EF1A 4W9CA 2QHOA 5CX3A 2NBWB 3ZNZB 3DPDA 1KJTA 3M63B 2KMCA 3BY4B 4EZJA 2KFKB 1ZGUB 3PHXB 4FHKA 3QARA 4RM8A 2GOWA 4ANXA 2LI5A 3Q3FA 4EZKA 2CHWA 3N3KB 2D3GA 1RFAA 3KH0A 2V1YA 2CR5A 4GU2A 1WXVA 1WE7A 2FIFA 3ZVVA 3C0RB 3WAMA 2MP2B 3EC8A 4AJYB 4HCPB 1E8WA 1ISNA 2JRIB 2FAZA 4FA6A 3AI5A 2IBIB 1MG8A 1WX9A 2JVCA 3JSVB 4MH0E 2K8HA 3WALA 2KANA 3PREA 4G50A 3SU8X 3PGEA 4DDID 1M94A 2O2VB 2AL6A 1E8XA 1WXAA 3IG3A 3WIMA 2AEHA 4HJKA 3OAWA 4M0WB 1R4NI 3PZDA 4HPMB 4LDTB 2K8BA 2M1MA 2KFKA 1S3SG 3K9PB 4IM2A 1UELA 3QJZA 4WQOB 3UIPB 3UF8A 1X1MA 3PVLA 4HPLB 1IPGA 4IWQA 1WIAA 1NI2A 1YJ1A 1WGHA 1BT0A 3H7PA 3UQAA 2N7EA 3ZLZA 4GDKB 2EMTA 3HIZA 4M8NA 3PT2B 1WE6A 3UQBA 1IYFA 2NPTA 2L8JA 4BOSC 4KDIC 2O6VD 2IY1B 3ZNGC 5LLIA 3T8MA 5HKHA 2LGYA 3VUYA 2KWVB 4PS7A 4GOCA 2ZEQA 1WM2A 3DBLI 3QA8A 2LZ6A 2NS5A 2R2QA 4IWPA 4EOYA 2EMSA 2M4NA 2L0FA 1WGRA 1WXMA 5CTRC 4AOFA 1WX8A 4KDLB 1XD3B 3APFA 1Z5SB 3RT3B 5AZGA 1E8ZA 2M17A 2ZNVB 3A9KA 1Q5WB 4GDKA 3A33B 2HD5B 1E90A 4ZRJA 2N9EB 4IG7B 4W9EA 3WA0A 4EUTA 4B6WA 5AEKB 4WJOA 5BO4B 5CHWA 5L83A 3H6NA 3VUWA 2PJHA 1XQQA 2J7QB 1V2YA 2D07B 2LUEA 2KTRA 2MBBB 1UZXB 2XK5B 4B9KA 3ZRCA 2DZKA 4DHJD 3R7QA 2KTRB 5TR5A 1RLFA 3T9LA 3PS6A 4G3XB 3VVWB 2RPQA 1YIWA 5C23A 3CF6E 3WANA 1YQBA 4F7ZA 1WGGA 3KYCD 2LVPA 1P3QU 1GUAB 4JQWC 4K1RB 1EO6A 3R7RA 3TL5A 2BYEA 3EECA 3H7PB 4KSKC 1RRBA 1E7UA 3GOEA 3DVNU 3VHTC 5G55A 4M8MA 2K1FA 3DCGA 3L10B 3ML8A 3OJ4B 4AWJA 3ZW3A 2DYBA 2IO3B 4A3PA 1CMXB 3MTNB 2DHZA 3HHMA 4NJ7A 3HM3A 3PV1A 4KZCA 1EUVB 4TQ0A 3PLVA 2MBHA 4KSLC 2KQSA 1S1QB 2WX0A 4JLCA 2RGFA 3A1QB 2RR9A 3L0WB 2JZZA 4WJNA 1NDDA 4G11A 2MBQA 1WYWB 2WX1A 2O2VA 4PYZA 1WZ0A 2ZCBA 4GB9A 4FBJB 3VQIA 3L16A 1UH6A 2KC2A 3RCZA 3UIOB 2BYFA 4XZ4A 1VD2A 4MJSB 4CYEA 1V9JA 2GMIC 3NZUA 4OVUA 2KDFB 1WR1A 2JT4B 4BKSA 5D6JB 4CO7A 5KHOA 3R66C 4GN1A 3S2AA 2A4ZA 2L3ZA 3QCAA 2CKHB 1YX5B 4MELA 4X57B 2D10A 2MBOA 4EEWA 3RUIB 2DYOA 3QHTA 4F1SA 1WH3A 4EKUA 3GZNI 3EHVA 4NAWB 2FIDA 4ICVA 5D94A 3ZO5B 4WJPA 1UD7A 3VTUA 2JZ3B 5J2RA 2OOBB 1LQBA 2M0XA 1H8CA 2MX2A 2BKRB 2N7DA 3LDZE 3UGBB 4NQKE 4BKGA 2DAJA 2DYMA 2GBNA 3R3MA 4ANUA 2G4DB 4K81A 2MWSB 4FJYA 4HWIB 3ECIA 3L08A 4GIVA 5DCNA 3CSTA 2HE7A 4WJQA 3M95A 3NOBA 3P2BA 3RZFA 5JH5C 2KO3A 5E6OA 2NCNA 1E8YA 3DVGX 4GMVA 2K8CA 4BKTA 2N9XA 4NNJB 2JF5A 1AARA 2DAFA 4NAWA 1C1YB 1JRUA 1Y8RC 1WRDB 4W9HA 2W9NA 2BWFA 2IZVB 2FCQA 4K7UA 2BKFA 3KUDB 3QIJA 2ZNVC 4DXAB 1K8RB 1Z2MA 1WX7A 2MLBA 3WAPA 4BOZB 5JHBA 2AL3A 3W1SC 4HVBA 2GBMA 2NR2A 1TTNA 3A9KB 4MGZE 3RZWC 1P9DU 2M8SA 3N32A 3QK0A 4XC2A 3ZRFA 4GSWA 3ZUNA 2DX5B 4ICUA 2KOXA 5DPTA 4E3CA 1LXDA 3SDLC 1YX6B 2HJ8A 3QC8B 3W1YA 4ANVA 2NBUA 2ASQA 4MJSA 4PS8A 4A3OA 1I35A 3PHWB 3UINB 4I6NB 5DPSA 2C5LC 2KK8A 4K7WA 3X0WA 2LASA 3KUZA 3QAQA 1G6JA 4PS3A 3ALBA 3H7SA 3RYTA 5D2MB 4AJWA 4DHJB 4ZDVA 2WYQA 4LJOB 2IY0B 3WAOA 2KDBA 3VXWA 2DZJA 2REXA 5AZHA 2WWZA 2CHZA 1WJUA 2V4LA 1WMHA 2KVRA 1WM3A 2K39A 3ZTDA 4IM0A 3NY5A 4ZYNA 3DQVA 1YD8U 1P98A 2PPHA 5J18A 1TZ1A 2JPHA 1F9JA 4DBGA 3AULA 1T0YA 3APDA 2Z59B 5JZEB 3A1QA 3VAWA 4DWFA 1V5OA 1HE8A 2K6DB 4GDLB 1V49A 4W9GA 5G2NA 1NBFC 4JL9A 3JVZX 3VUXA 1H4RA 1SIFA 4G0NB 3ONSA 2MSED 4I6LB 1QZEA 3HM6X 3PRPB 4DK5A 2L0TA 5JHAA 2KXJA 4ANWA 4NJ6A 2JUOA 1FXTB 1OTRB 4KZ0A 3V6EB 4RM9A 3A9JB 3B1LX 5FR6A 2D11A 2BPSA 1TGZB 2JXXA 3DBSA 4BVUC 2ZPYA 4FJZA 3VH4B 2KX0A 3IBEA 4DHZE 2L00B 3A9JA 5J17A 1Q1OA 2PE6B 1P0RA 5AZFA 1GC7A 2FNJB 2XBBC 3B08A 2J0MA 3QX1A 4JGHB 1PQSA 3U8ZA 3Q3JA 1KOTA 2NVUI 1U4AA 3PTFC 2DZMA 3EFUA 4FLHA 1L2NA 1WF9A 3TBLD 2EKEC 1D3ZA 2I1JA 4MSQB 1C3TA 2JRHA 2K25A 4EZLA 3V6CB 3DOWA 3KVFB 1Q0WB 1LFDA 2N1WA 1WJNA 3DDCB 2LXCA 1GNUA 2LJ5A 2WDTB 4LDTD 3VTWA 4MEMA 4I6PA 3NHEB 2R2OA 1LM8B 1A5RA 3PSEB 4GDLA 4GGQA 1KLVA 4KVGB 3BINA 4MGYE 3JW0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NS8 A;  4W9K A;  1ZW7 A;  1E7V A;  3APC A;  2UWQ A;  3M3J A;  4ASW C;  3IFW B;  3SD5 A;  4YL8 A;  2KN5 A;  2O6V B;  3VH3 B;  3ZIM A;  1KM7 A;  2L05 A;  4B95 A;  1L7Y A;  3KW5 B;  5DPW A;  3L54 A;  2C7H A;  2V3S A;  1V86 A;  2MA9 B;  2CU1 A;  4TQ1 A;  3U30 A;  3SHQ A;  1OQY A;  2D2Q A;  2FCM A;  3VDZ A;  2KLC A;  2KMA A;  1UBQ A;  2LD9 A;  3IHP C;  4LCD E;  3TCA A;  2KD0 A;  1J8C A;  1WZ3 A;  4FJV B;  5LXH A;  2GBJ A;  2FCN A;  2C60 A;  3MHS D;  4HXD A;  4N9F 4;  2KJH B;  3TJP A;  4TKN A;  4HCN B;  5GMV A;  4ZRI A;  3O65 B;  2BGF A;  2ZCC A;  4HLE A;  4IW0 A;  3TMP B;  4AP4 C;  2N4F A;  2ZZP B;  4W9J A;  2KFJ A;  3U7D A;  2C9W B;  4FN2 A;  4MDK E;  2G4S A;  2G3Q B;  4HDO A;  4K7S A;  2KWC A;  1WJ4 A;  4OVV A;  2CS4 A;  1GG3 A;  2LWP A;  1V6E A;  2N1V A;  5IA7 A;  2HTH A;  2LVO A;  2VRR B;  4J6I A;  4HK2 A;  2KQ7 A;  2N9P C;  3ENE A;  1UBI A;  3OLM D;  4PYU A;  2XEW A;  2J0K A;  2ZJD A;  4NQL B;  3X23 A;  1WGY A;  2Z0E B;  3QQ8 B;  2NBV B;  3A4R A;  3DBH I;  3RUL A;  2LGD A;  1V5T A;  2KNB A;  2L7R A;  1V80 A;  2ZVN A;  1WY8 A;  4TUU A;  2IO0 B;  4LJP B;  1UGM A;  4P7I A;  4BBN C;  2BF8 B;  4FAD A;  5C1Z A;  2IO2 B;  2C7N B;  4GXB A;  3AXC A;  4NPN A;  1OGW A;  5E6N A;  4KIK B;  3L13 A;  2KZR A;  2L76 A;  3ZNI D;  1TBE A;  2LVQ A;  1ZKH A;  4A20 A;  1RAX A;  5CHF A;  2KLG A;  4TV3 A;  2KDE B;  2Y5B B;  1V81 A;  4FUL A;  5DPR A;  4CHK A;  1J19 A;  2KJ6 A;  4HDQ A;  4ZRK A;  3V61 A;  2KWU B;  2MQJ A;  4JIO U;  4AUQ C;  3A4S C;  4DDG D;  4WWP A;  3ZNH B;  4BBN F;  3KYD D;  4EFO A;  3ZDT A;  2NPT B;  1P1A A;  2PEA A;  1GC6 A;  2LRU A;  2BYV E;  3ZKJ C;  2MBE A;  3DVG Y;  3W1S A;  5D7G A;  3NZS A;  1WXS A;  4W9F A;  4IWO A;  5LXI B;  4W9L A;  3ZTC A;  4IUM B;  1OEY A;  4RMA A;  3I3T B;  3L17 A;  1SGH A;  3JSV A;  2GBR A;  3PLU A;  3DVN V;  3IVF A;  4WAA A;  1GJZ A;  4MGI E;  3CMM B;  4KV2 A;  2GBK A;  4BFR A;  2G45 B;  2AYO B;  3K9O B;  2KHW B;  2RSU A;  2A5U A;  3HK0 A;  3H1U A;  4XX5 A;  2DEN B;  2KX3 A;  2LRW A;  3TIX A;  3V62 A;  1VCB A;  1XT9 B;  3H9D A;  5EDS A;  2J0J A;  3MJW A;  2FCS A;  2KDI A;  4FHJ A;  2CHX A;  2JY6 A;  4WWN A;  2LXA A;  2O6V A;  4MGK E;  4MM3 A;  1E5W A;  3RD2 A;  3PPA A;  3ZDM C;  4WWO A;  1J0G A;  5IAA C;  2K6Q A;  2OJR A;  2FUH B;  3LJ3 A;  3QWZ B;  2IYD B;  2I1K A;  3N30 A;  4E71 A;  2YVC A;  3VTV A;  1WMH B;  3OJ3 A;  2Z0D B;  3AU5 A;  2ZVO A;  1I42 A;  3CSF A;  3DBR I;  2DZI A;  2MCN B;  2MP2 A;  4W9D A;  2KC1 A;  3ML9 A;  1WR6 E;  1WFY A;  3V60 A;  3VFK A;  4E74 A;  4IC7 B;  3PRM B;  2YLM A;  5KHQ A;  4KIK A;  2XK5 A;  2MW5 A;  1WGD A;  3PRZ A;  1SE9 A;  1R4M I;  1WI0 A;  3JYU A;  1WJ6 A;  2UYZ B;  3M62 B;  4II2 B;  5E6P A;  2KTF A;  4NY0 A;  4W9I A;  4F8C B;  1EF5 A;  2B3A A;  2LGX A;  1OEY J;  2ZPN A;  2C7M B;  5L95 C;  2KKC A;  1IP9 A;  4MSM B;  4II3 B;  5CHV C;  3AU4 A;  2AWT A;  2JWZ A;  2KJR A;  2PE9 A;  4DHZ B;  2IO1 B;  2BWE S;  4IM3 A;  3B0A A;  2MRP A;  2RD0 A;  3KUC B;  3D32 A;  4BKS D;  4URK A;  1EF1 A;  4W9C A;  2QHO A;  5CX3 A;  2NBW B;  3ZNZ B;  3DPD A;  1KJT A;  3M63 B;  2KMC A;  3BY4 B;  4EZJ A;  2KFK B;  1ZGU B;  3PHX B;  4FHK A;  3QAR A;  4RM8 A;  2GOW A;  4ANX A;  2LI5 A;  3Q3F A;  4EZK A;  2CHW A;  3N3K B;  2D3G A;  1RFA A;  3KH0 A;  2V1Y A;  2CR5 A;  4GU2 A;  1WXV A;  1WE7 A;  2FIF A;  3ZVV A;  3C0R B;  3WAM A;  2MP2 B;  3EC8 A;  4AJY B;  4HCP B;  1E8W A;  1ISN A;  2JRI B;  2FAZ A;  4FA6 A;  3AI5 A;  2IBI B;  1MG8 A;  1WX9 A;  2JVC A;  3JSV B;  4MH0 E;  2K8H A;  3WAL A;  2KAN A;  3PRE A;  4G50 A;  3SU8 X;  3PGE A;  4DDI D;  1M94 A;  2O2V B;  2AL6 A;  1E8X A;  1WXA A;  3IG3 A;  3WIM A;  2AEH A;  4HJK A;  3OAW A;  4M0W B;  1R4N I;  3PZD A;  4HPM B;  4LDT B;  2K8B A;  2M1M A;  2KFK A;  1S3S G;  3K9P B;  4IM2 A;  1UEL A;  3QJZ A;  4WQO B;  3UIP B;  3UF8 A;  1X1M A;  3PVL A;  4HPL B;  1IPG A;  4IWQ A;  1WIA A;  1NI2 A;  1YJ1 A;  1WGH A;  1BT0 A;  3H7P A;  3UQA A;  2N7E A;  3ZLZ A;  4GDK B;  2EMT A;  3HIZ A;  4M8N A;  3PT2 B;  1WE6 A;  3UQB A;  1IYF A;  2NPT A;  2L8J A;  4BOS C;  4KDI C;  2O6V D;  2IY1 B;  3ZNG C;  5LLI A;  3T8M A;  5HKH A;  2LGY A;  3VUY A;  2KWV B;  4PS7 A;  4GOC A;  2ZEQ A;  1WM2 A;  3DBL I;  3QA8 A;  2LZ6 A;  2NS5 A;  2R2Q A;  4IWP A;  4EOY A;  2EMS A;  2M4N A;  2L0F A;  1WGR A;  1WXM A;  5CTR C;  4AOF A;  1WX8 A;  4KDL B;  1XD3 B;  3APF A;  1Z5S B;  3RT3 B;  5AZG A;  1E8Z A;  2M17 A;  2ZNV B;  3A9K A;  1Q5W B;  4GDK A;  3A33 B;  2HD5 B;  1E90 A;  4ZRJ A;  2N9E B;  4IG7 B;  4W9E A;  3WA0 A;  4EUT A;  4B6W A;  5AEK B;  4WJO A;  5BO4 B;  5CHW A;  5L83 A;  3H6N A;  3VUW A;  2PJH A;  1XQQ A;  2J7Q B;  1V2Y A;  2D07 B;  2LUE A;  2KTR A;  2MBB B;  1UZX B;  2XK5 B;  4B9K A;  3ZRC A;  2DZK A;  4DHJ D;  3R7Q A;  2KTR B;  5TR5 A;  1RLF A;  3T9L A;  3PS6 A;  4G3X B;  3VVW B;  2RPQ A;  1YIW A;  5C23 A;  3CF6 E;  3WAN A;  1YQB A;  4F7Z A;  1WGG A;  3KYC D;  2LVP A;  1P3Q U;  1GUA B;  4JQW C;  4K1R B;  1EO6 A;  3R7R A;  3TL5 A;  2BYE A;  3EEC A;  3H7P B;  4KSK C;  1RRB A;  1E7U A;  3GOE A;  3DVN U;  3VHT C;  5G55 A;  4M8M A;  2K1F A;  3DCG A;  3L10 B;  3ML8 A;  3OJ4 B;  4AWJ A;  3ZW3 A;  2DYB A;  2IO3 B;  4A3P A;  1CMX B;  3MTN B;  2DHZ A;  3HHM A;  4NJ7 A;  3HM3 A;  3PV1 A;  4KZC A;  1EUV B;  4TQ0 A;  3PLV A;  2MBH A;  4KSL C;  2KQS A;  1S1Q B;  2WX0 A;  4JLC A;  2RGF A;  3A1Q B;  2RR9 A;  3L0W B;  2JZZ A;  4WJN A;  1NDD A;  4G11 A;  2MBQ A;  1WYW B;  2WX1 A;  2O2V A;  4PYZ A;  1WZ0 A;  2ZCB A;  4GB9 A;  4FBJ B;  3VQI A;  3L16 A;  1UH6 A;  2KC2 A;  3RCZ A;  3UIO B;  2BYF A;  4XZ4 A;  1VD2 A;  4MJS B;  4CYE A;  1V9J A;  2GMI C;  3NZU A;  4OVU A;  2KDF B;  1WR1 A;  2JT4 B;  4BKS A;  5D6J B;  4CO7 A;  5KHO A;  3R66 C;  4GN1 A;  3S2A A;  2A4Z A;  2L3Z A;  3QCA A;  2CKH B;  1YX5 B;  4MEL A;  4X57 B;  2D10 A;  2MBO A;  4EEW A;  3RUI B;  2DYO A;  3QHT A;  4F1S A;  1WH3 A;  4EKU A;  3GZN I;  3EHV A;  4NAW B;  2FID A;  4ICV A;  5D94 A;  3ZO5 B;  4WJP A;  1UD7 A;  3VTU A;  2JZ3 B;  5J2R A;  2OOB B;  1LQB A;  2M0X A;  1H8C A;  2MX2 A;  2BKR B;  2N7D A;  3LDZ E;  3UGB B;  4NQK E;  4BKG A;  2DAJ A;  2DYM A;  2GBN A;  3R3M A;  4ANU A;  2G4D B;  4K81 A;  2MWS B;  4FJY A;  4HWI B;  3ECI A;  3L08 A;  4GIV A;  5DCN A;  3CST A;  2HE7 A;  4WJQ A;  3M95 A;  3NOB A;  3P2B A;  3RZF A;  5JH5 C;  2KO3 A;  5E6O A;  2NCN A;  1E8Y A;  3DVG X;  4GMV A;  2K8C A;  4BKT A;  2N9X A;  4NNJ B;  2JF5 A;  1AAR A;  2DAF A;  4NAW A;  1C1Y B;  1JRU A;  1Y8R C;  1WRD B;  4W9H A;  2W9N A;  2BWF A;  2IZV B;  2FCQ A;  4K7U A;  2BKF A;  3KUD B;  3QIJ A;  2ZNV C;  4DXA B;  1K8R B;  1Z2M A;  1WX7 A;  2MLB A;  3WAP A;  4BOZ B;  5JHB A;  2AL3 A;  3W1S C;  4HVB A;  2GBM A;  2NR2 A;  1TTN A;  3A9K B;  4MGZ E;  3RZW C;  1P9D U;  2M8S A;  3N32 A;  3QK0 A;  4XC2 A;  3ZRF A;  4GSW A;  3ZUN A;  2DX5 B;  4ICU A;  2KOX A;  5DPT A;  4E3C A;  1LXD A;  3SDL C;  1YX6 B;  2HJ8 A;  3QC8 B;  3W1Y A;  4ANV A;  2NBU A;  2ASQ A;  4MJS A;  4PS8 A;  4A3O A;  1I35 A;  3PHW B;  3UIN B;  4I6N B;  5DPS A;  2C5L C;  2KK8 A;  4K7W A;  3X0W A;  2LAS A;  3KUZ A;  3QAQ A;  1G6J A;  4PS3 A;  3ALB A;  3H7S A;  3RYT A;  5D2M B;  4AJW A;  4DHJ B;  4ZDV A;  2WYQ A;  4LJO B;  2IY0 B;  3WAO A;  2KDB A;  3VXW A;  2DZJ A;  2REX A;  5AZH A;  2WWZ A;  2CHZ A;  1WJU A;  2V4L A;  1WMH A;  2KVR A;  1WM3 A;  2K39 A;  3ZTD A;  4IM0 A;  3NY5 A;  4ZYN A;  3DQV A;  1YD8 U;  1P98 A;  2PPH A;  5J18 A;  1TZ1 A;  2JPH A;  1F9J A;  4DBG A;  3AUL A;  1T0Y A;  3APD A;  2Z59 B;  5JZE B;  3A1Q A;  3VAW A;  4DWF A;  1V5O A;  1HE8 A;  2K6D B;  4GDL B;  1V49 A;  4W9G A;  5G2N A;  1NBF C;  4JL9 A;  3JVZ X;  3VUX A;  1H4R A;  1SIF A;  4G0N B;  3ONS A;  2MSE D;  4I6L B;  1QZE A;  3HM6 X;  3PRP B;  4DK5 A;  2L0T A;  5JHA A;  2KXJ A;  4ANW A;  4NJ6 A;  2JUO A;  1FXT B;  1OTR B;  4KZ0 A;  3V6E B;  4RM9 A;  3A9J B;  3B1L X;  5FR6 A;  2D11 A;  2BPS A;  1TGZ B;  2JXX A;  3DBS A;  4BVU C;  2ZPY A;  4FJZ A;  3VH4 B;  2KX0 A;  3IBE A;  4DHZ E;  2L00 B;  3A9J A;  5J17 A;  1Q1O A;  2PE6 B;  1P0R A;  5AZF A;  1GC7 A;  2FNJ B;  2XBB C;  3B08 A;  2J0M A;  3QX1 A;  4JGH B;  1PQS A;  3U8Z A;  3Q3J A;  1KOT A;  2NVU I;  1U4A A;  3PTF C;  2DZM A;  3EFU A;  4FLH A;  1L2N A;  1WF9 A;  3TBL D;  2EKE C;  1D3Z A;  2I1J A;  4MSQ B;  1C3T A;  2JRH A;  2K25 A;  4EZL A;  3V6C B;  3DOW A;  3KVF B;  1Q0W B;  1LFD A;  2N1W A;  1WJN A;  3DDC B;  2LXC A;  1GNU A;  2LJ5 A;  2WDT B;  4LDT D;  3VTW A;  4MEM A;  4I6P A;  3NHE B;  2R2O A;  1LM8 B;  1A5R A;  3PSE B;  4GDL A;  4GGQ A;  1KLV A;  4KVG B;  3BIN A;  4MGY E;  3JW0 X; 
#chains in the Genus database with same CATH topology
 2BYT A;  1E7V A;  3APC A;  3IFW B;  4UDU C;  3VH3 B;  3ZIM A;  2JYT A;  1I4P A;  3KW5 B;  3L54 A;  2C7H A;  4YSX B;  2IGH A;  3URY A;  3U30 A;  2LHE A;  3L4P A;  3ZJV A;  3VDZ A;  2KLC A;  2KMA A;  3AV8 A;  3CIR B;  3MFG A;  2WNM A;  4N9F 4;  2AQ1 B;  2WLB A;  3O65 B;  3P4S B;  2OHF A;  4HDO A;  2CU3 A;  3MHZ A;  1WJ4 A;  4OVV A;  2CS4 A;  2LWP A;  3UI3 A;  1L0V B;  3DWG C;  2YEP B;  2QCZ A;  2N9P C;  4PYU A;  3ETR A;  2ZJD A;  2Z0E B;  3A4R A;  3SR6 A;  3AB5 A;  4ARI A;  2KNB A;  1KLU D;  3C8Y A;  2K3U A;  4YTM B;  2IO2 B;  4GXB A;  4WWM A;  5E6N A;  2J52 A;  4Q2J A;  3L13 A;  2KZR A;  1FO4 A;  1TBE A;  1T3Q A;  1N63 A;  4O1N A;  2NTT A;  1RAX A;  3SEB A;  2KDE B;  3N20 C;  1J19 A;  4ZRK A;  4AUQ C;  4DDG D;  1SE4 A;  3ZQ4 A;  3MJ5 A;  4ACF A;  2LRU A;  2BYV E;  3ZKJ C;  4W9F A;  5LXI B;  1C4A A;  1OEY A;  3I3T B;  4RGT A;  3L17 A;  3PLU A;  1GB4 A;  1L4D B;  1HTQ A;  1GOZ A;  5H92 C;  2JYE A;  3HK0 A;  3ZXR A;  2N9L A;  3AE9 B;  1YJJ A;  4XX5 A;  2KX3 A;  3V62 A;  1VCB A;  2FCS A;  2JY6 A;  2O6V A;  4MGK E;  1E5W A;  3B2F A;  3GZN B;  4LLG M;  2V4I B;  3OJ3 A;  2Z0D B;  3AU5 A;  4C56 C;  3P4Q B;  3ML9 A;  3V60 A;  3Q69 A;  2XK5 A;  3JYU A;  1NYQ A;  2UYZ B;  3M62 B;  4II2 B;  4NY0 A;  3AEB B;  2FBW B;  2ZPN A;  3TSS A;  3BK2 A;  4MSM B;  2AWT A;  2RD0 A;  3D32 A;  4URK A;  3DPD A;  4IKG A;  1E9M A;  3BY4 B;  4EZJ A;  1ZGU B;  2GOW A;  1NI3 A;  1PDX A;  3Q3F A;  4EZK A;  4NAM A;  1JWM D;  3RNG C;  1CZP A;  3KH0 A;  4GU2 A;  1WXV A;  2FIF A;  5IKC M;  1JCK B;  5BMI A;  1DGJ A;  2PLP A;  1E8W A;  2JRI B;  5D3D A;  2JVC A;  3HUI A;  4MH0 E;  4OHJ A;  1J7C A;  1C76 A;  2KAN A;  4RFB A;  2Z8L A;  1C4P A;  2AL6 A;  1E8X A;  1N5W A;  4L1B A;  1TYG B;  4M0W B;  4HPM B;  2K8B A;  2M1M A;  3K9P B;  3V3X A;  2MEK A;  4IWQ A;  1WIA A;  1FNW A;  1NI2 A;  1FCC C;  4GDK B;  1OFF A;  1TZO A;  3HIZ A;  1IYF A;  1EWC A;  2NPT A;  2L8J A;  4BOS C;  1MFW A;  3ZNG C;  3GE3 C;  2LGY A;  1PYW D;  2KWV B;  3KQ4 A;  4PS7 A;  4KKJ A;  4IWP A;  2LZ6 A;  2L0F A;  3VR9 B;  3APF A;  3RT3 B;  5AZG A;  4A8X C;  2JZP A;  1XCQ L;  4P1C C;  3A33 B;  4ZRJ A;  4B6W A;  5AEK B;  3FIL A;  4WJO A;  5L83 A;  3VUW A;  1ZOY B;  1XQQ A;  1L0Y B;  1UNS A;  4B9K A;  1UZX B;  3C19 A;  1RLF A;  4C4V A;  4G3X B;  2PW9 A;  3CF6 E;  1YQB A;  3U52 E;  3TL5 A;  2WXH A;  4K1R B;  3H7P B;  3IT6 B;  1EU4 A;  3GOE A;  2MJD A;  3VRA B;  4M8M A;  3L10 B;  2JSV X;  2BW2 A;  2IO3 B;  1K50 A;  1R4N B;  1RM6 C;  2DHZ A;  2AQ2 B;  4ZYS A;  1EUV B;  4HJG E;  2X38 A;  2WQY B;  1K51 A;  3L0W B;  2JZZ A;  1TKE A;  1NDD A;  2O2V A;  4GB9 A;  3UIO B;  4WAF A;  1XLP A;  1VD2 A;  3BK1 A;  4CYE A;  2ACZ B;  2V3P A;  4OVU A;  5TSS A;  1WR1 A;  3RNB C;  2JT4 B;  5D6J B;  1UGJ A;  1WYG A;  2D10 A;  3QHT A;  4RH6 A;  2B76 B;  3RNF C;  4F1S A;  3EHV A;  4ICV A;  5D94 A;  1F2R C;  2N7D A;  4K3C A;  4NQK E;  1JAL A;  2DYM A;  4FJY A;  4YWG G;  1N6Z A;  3ECI A;  3L08 A;  4GIV A;  2LGI A;  5DCN A;  3NVZ A;  3RZF A;  1FIQ A;  2NCN A;  4PK1 A;  1QOA A;  3DVG X;  4BKT A;  4NNJ B;  4AQ7 A;  1AAR A;  4NAW A;  1QOG A;  1C1Y B;  2W9N A;  5G5H A;  5GXG B;  1LO5 D;  1Z2M A;  3WAP A;  4KX6 B;  2H88 B;  2GBM A;  3N1Y C;  3RZW C;  3ZRF A;  4XC2 A;  2DX5 B;  2KOX A;  5C2T B;  4ARC A;  3PZ7 A;  1YMH E;  4MJS A;  4A3O A;  2JXT A;  1SIJ A;  3QAQ A;  2WDV B;  3RYT A;  4ZDV A;  2INN E;  4GLS C;  4YXD B;  2KDB A;  2REX A;  3W9C B;  2CHZ A;  1WJU A;  2W55 A;  3ZJU A;  3VRB B;  1WM3 A;  3ZTD A;  3LXF A;  4FXC A;  2Z59 B;  3A1Q A;  4A90 A;  1V5O A;  3GS2 A;  4N59 A;  5T8I A;  4NJC A;  2W3R A;  4I6L B;  3HM6 X;  3PRP B;  4DK5 A;  1EU3 A;  4NJ6 A;  2JX5 A;  1FXT B;  4RM9 A;  1TGZ B;  2FUG 1;  4BVU C;  3B9J A;  5J17 A;  5IN7 A;  1WGK A;  1GC7 A;  5AZF A;  2FNJ B;  3B08 A;  4C80 A;  3SFD B;  3Q3J A;  5HI1 A;  2INP E;  2EKE C;  4MSQ B;  1C3T A;  2ZW0 A;  3V6C B;  3DOW A;  2BS2 B;  3I9V 1;  1DOX A;  1DOI A;  3DDC B;  2LXC A;  2WDT B;  3NHE B;  4GGQ A;  4HRS A;  1KLV A;  2NMQ A;  4JWS C;  4K3B A;  4W9K A;  4ASW C;  1QOF A;  2KN4 A;  2KN5 A;  2L05 A;  1SE2 A;  4B95 A;  1L7Y A;  5DPW A;  2DBY A;  1SE3 A;  3SHQ A;  1FMA D;  2D2Q A;  3AEE B;  4LCD E;  1DYQ A;  2BB5 A;  2GBJ A;  4HKQ A;  2FCN A;  4HXD A;  2KJH B;  5GMV A;  3N1Z C;  4ZRI A;  2ZCC A;  3TMP B;  2NTS A;  5EE0 A;  1KF6 B;  2ZZP B;  1I4H A;  4K7S A;  1V6E A;  2WXR A;  4J6I A;  1TIF A;  1P7E A;  2XEW A;  1ESF A;  2J0K A;  4NQL B;  3DWM A;  3X23 A;  1RWS A;  3QQ8 B;  3DBH I;  2PKO A;  3R2I A;  3RUL A;  3H8H A;  2LGD A;  3MC9 A;  3VR8 B;  1MG4 A;  1V80 A;  4LJP B;  1SEB D;  2BF8 B;  4C7Z A;  3AXC A;  1UWM A;  2L76 A;  3ZNI D;  3RFZ B;  3NRZ A;  1KH0 A;  2D5G A;  2KJ6 A;  4HDQ A;  2BVC A;  4JIO U;  1N61 A;  3W5V B;  3DHI C;  3FC4 A;  3KYD D;  1L6U A;  5FK9 C;  1GC6 A;  2RDG A;  2MBE A;  3DVG Y;  2LMC A;  4IWO A;  4W9L A;  3AEF B;  3ABV B;  1TS2 A;  2IPK D;  1ZXH A;  4RMA A;  1SGH A;  3JSV A;  3DVN V;  1GJZ A;  4MGI E;  2PIA A;  4BFR A;  1TJE A;  2KHW B;  2RSU A;  2DEN B;  2LRW A;  1ZPS A;  4LNK A;  5C3J B;  2GLS A;  2LXA A;  3AE6 B;  3RD2 A;  1L4Z B;  3ZDM C;  1J0G A;  5IAA C;  2K6Q A;  1J7B A;  3LJ3 A;  4ZRP A;  3N30 A;  1WRI A;  2YVC A;  3VTV A;  2KT7 A;  2ZVO A;  3CSF A;  4W9D A;  2KC1 A;  1WFY A;  1XXG A;  2YLM A;  3B2G A;  2INC C;  5E6P A;  4F8C B;  2B3A A;  4BAX A;  2C7M B;  5L95 C;  2KKC A;  2WXO A;  1SF0 A;  3AU4 A;  4DHZ B;  2IO1 B;  2BWE S;  4BKS D;  2R61 A;  4P16 A;  4L23 A;  5EE1 A;  2NBW B;  1XLN A;  1QT9 A;  3PHX B;  3QAR A;  2LI5 A;  2KMM A;  1QF6 A;  3AM9 A;  3E56 A;  1V1P B;  3C0R B;  3WAM A;  3EC8 A;  4AJY B;  3WCQ A;  1XLQ A;  4M02 A;  3BYY B;  3RMK C;  1L6V A;  2QIL A;  1ZDV A;  3CWI A;  2FAZ A;  4FA6 A;  3AI5 A;  1JWS D;  1WX9 A;  4WQM A;  4CQN A;  2E6X A;  1VLB A;  3LB8 C;  1ET6 A;  5HG2 A;  3FKY A;  1WXA A;  1VRA B;  3PZD A;  1UEL A;  3QJZ A;  4WQO B;  2V3N A;  1YJ1 A;  1WGH A;  3H7P A;  3UQA A;  2N7E A;  1AW7 A;  2EMT A;  1WE6 A;  4XWT A;  2O6V D;  1F0Z A;  1ET9 A;  2IY1 B;  5LLI A;  1D5M C;  3NVY A;  3QA8 A;  1STE A;  2Y5C A;  4EOY A;  1WX8 A;  2DWQ A;  2QC8 A;  2M17 A;  2ZNV B;  1Q5W B;  4KKI A;  2N9E B;  4IG7 B;  4NZL B;  5BO4 B;  5CHW A;  1I4R A;  2GRI A;  3H6N A;  4KGS A;  1JW9 D;  4IOI E;  2KVZ A;  2LUM A;  2LUE A;  2MBB B;  5G5G A;  5HFY A;  1D5X C;  3ZRC A;  2DZK A;  3P42 A;  2CJO A;  4S0R A;  5LNK 1;  4H2A A;  3VVW B;  2RPQ A;  1YIW A;  3Q3M C;  5C23 A;  3WAN A;  2VZK D;  2LVP A;  1P3Q U;  4C00 A;  3R7R A;  4KGT A;  3EEC A;  4KSK C;  3DVN U;  3HVD A;  2DYB A;  2KWD A;  2L32 A;  1CMX B;  5JXV A;  4LK0 M;  3BWU D;  1VDV A;  3Q8C A;  3PLV A;  2MBH A;  2KQS A;  1S1Q B;  2WX0 A;  1K52 A;  2RGF A;  2DNF A;  2WX1 A;  1QLB B;  1WZ0 A;  4FBJ B;  1YJI A;  3VQI A;  3RCZ A;  1FNV A;  1V9J A;  3MP9 A;  1FRD A;  1D6E C;  2JWU A;  4GN1 A;  1EWY C;  4A6Q A;  3QCA A;  2CKH B;  4MEL A;  4X57 B;  4EEW A;  3RUI B;  1WSP A;  1SBB B;  1HA5 A;  4NAW B;  1MHX A;  2V9H A;  3ZO5 B;  3VTU A;  2JZ3 B;  2OOB B;  2BKR B;  1V8C A;  3RN9 C;  2GBN A;  3R3M A;  4ANU A;  4HWI B;  3CST A;  2HE7 A;  3RPF C;  4YTP B;  2KO3 A;  1E8Y A;  3OG5 A;  2N9X A;  2JF5 A;  2DAF A;  2ON8 A;  1JRO A;  1QKZ A;  4W9H A;  3P1M A;  1NVI D;  4REZ A;  1JWB D;  2RDB C;  2KYW A;  4K7U A;  3KUD B;  3QIJ A;  2ZNV C;  4DXA B;  1K8R B;  1WX7 A;  2V0G A;  4BOZ B;  2JQR B;  2ONQ A;  2AL3 A;  2WXK A;  1NEK B;  4HVB A;  4AS1 A;  1GPX A;  1TTN A;  4MGZ E;  4P1B C;  3N32 A;  3ZUN A;  2G9H D;  1YQ3 B;  3W1Y A;  2NBU A;  5E6J A;  3PHW B;  3UIN B;  1TS5 A;  1G6J A;  4PS3 A;  3ALB A;  4DHJ B;  2LEK A;  3WAO A;  3VXW A;  2DZJ A;  1C79 A;  3EUB 2;  2KVR A;  4IM0 A;  5D3I B;  3NY5 A;  1QOB A;  4HEA 1;  3Q8F A;  2MJE A;  4ZYN A;  3E9S A;  3AE3 B;  3T3O A;  3AE7 B;  1TZ1 A;  3APD A;  1V1O A;  3VAW A;  2K6D B;  4W9G A;  4GDL B;  1V49 A;  2XNA C;  4JL9 A;  3JVZ X;  1ROE A;  1FEH A;  4G0N B;  3KWV A;  1CJE A;  2KXJ A;  2JUO A;  3A9J B;  4MT5 A;  2D11 A;  1KTK A;  2JXX A;  3DBS A;  2ZPY A;  4FJZ A;  3PZ8 A;  2L00 B;  1Q1O A;  2PE6 B;  1EM7 A;  1T0S C;  4JGH B;  2QSD A;  1MI0 A;  2NVU I;  1U4A A;  3PTF C;  2PVG C;  3EFU A;  3TBL D;  1ZP0 B;  1D3Z A;  1T6B X;  1AN8 A;  1Q0W B;  1WWT A;  1LFD A;  3Q14 C;  1WJN A;  4ZHO A;  3VTW A;  4MEM A;  4DXG A;  2WXJ A;  3RI7 C;  3PSE B;  4GDL A;  3U2S C;  3BIN A;  1MJD A;  4MGY E;  4B0E A;  1F1H A;  1ZW7 A;  3SD5 A;  1R7S A;  4A55 A;  2O6V B;  4WUR A;  2V3S A;  1V86 A;  5H8Y E;  2TSS A;  4TQ1 A;  4KGR A;  1OQY A;  2FCM A;  2QJL A;  1L0X B;  3IHP C;  1XF5 L;  1J8C A;  4FJV B;  1I4G A;  5LXH A;  5BMG A;  1HEZ E;  4HCN B;  4JX1 C;  3AE8 B;  4HLE A;  4IW0 A;  3BVZ A;  2N4F A;  2KFJ A;  3BVG A;  3U7D A;  4FN2 A;  4MDK E;  1HZ6 A;  2G4S A;  2G3Q B;  1TT5 B;  2KWC A;  1HTO A;  1GG3 A;  2KAC A;  1N60 A;  4HK2 A;  2QEJ C;  1I7H A;  3OLM D;  4ZHP A;  3RNC C;  2NBV B;  1D4B A;  1V5T A;  2L7R A;  3R2T A;  3NVW A;  4BBN C;  1OGW A;  2HDE A;  4KIK B;  1J7A A;  4YT0 B;  4JPS A;  2GI9 A;  1C9F A;  4TV3 A;  1FXA A;  1LGR A;  4CHK A;  3IAS 1;  1PUT A;  3I57 A;  2KWU B;  2MQJ A;  3BYT B;  2NPT B;  1P1A A;  2K22 A;  3Q8A A;  4M01 A;  2X8X X;  3W1S A;  5D7G A;  1NEN B;  3NZS A;  4BZA A;  4J3O D;  4IUM B;  4KV2 A;  3P4P B;  1TS4 A;  4ZOH C;  5EE3 A;  2G45 B;  3K9O B;  4S17 A;  2A5U A;  2K0P A;  1R4M B;  4USA A;  3H9D A;  4M00 A;  5EDS A;  2J0J A;  3MJW A;  1YNT E;  2KDI A;  4FHJ A;  4XGA B;  1IBX B;  4WWN A;  3PPA A;  3Q3N C;  5I4D A;  3QWZ B;  1NYR A;  2I1K A;  2BTE A;  2MJ3 A;  2MCN B;  2MP2 A;  1IGD A;  1JQ4 A;  3VFK A;  4IC7 B;  3AEG B;  3PRM B;  5KHQ A;  2MW5 A;  3T3N A;  1WGD A;  1WI0 A;  4JWU C;  2LGX A;  2QMT A;  1OEY J;  1SSN A;  1PGB A;  4IM3 A;  1PGA A;  1XO3 A;  1EF1 A;  4W9C A;  2QHO A;  5CX3 A;  4OZB A;  2KMC A;  2KFK B;  4RM8 A;  4ANX A;  2J4X A;  3N9Y C;  2D3G A;  2KQ4 X;  2V1Y A;  2CR5 A;  2WP9 B;  1E6E B;  1WE7 A;  3ZVV A;  1SJH D;  1I4Q A;  5BYQ A;  1ISN A;  5MPO A;  1UUP A;  2IBI B;  1C4C A;  3JSV B;  2I2Y A;  3WAL A;  4G50 A;  3PRE A;  3SU8 X;  3U7Z A;  4B0M A;  3PGE A;  4DDI D;  2LHD A;  2G1E A;  3IG3 A;  3WIM A;  2WXP A;  1R4N I;  1SJE D;  3Q6B A;  3UIP B;  3UF8 A;  3EFC A;  4M8N A;  3PT2 B;  3UQB A;  2D3A A;  4KDI C;  1IUE A;  3T8M A;  5HKH A;  3NS1 A;  2ZEQ A;  1WM2 A;  3DBL I;  2R2Q A;  2NS5 A;  4MAC A;  1FNU A;  2EMS A;  2M4N A;  1WXM A;  2J42 A;  1XD3 B;  1Z5S B;  2WHI A;  2FE8 A;  2N9K A;  4GDK A;  4EUT A;  1E90 A;  2YEP F;  4W9E A;  2RPV A;  5EE9 A;  3DBR B;  3TUO A;  1RFK A;  2J7Q B;  1V2Y A;  2D07 B;  4EE2 A;  2CJN A;  3NVV A;  4XWW A;  3T9L A;  4F7Z A;  1GUA B;  4JQW C;  1EO6 A;  2BYE A;  4RNA A;  1RRB A;  1E7U A;  3VHT C;  5G55 A;  3OJ4 B;  3ML8 A;  2WS3 B;  4AWJ A;  2HTM E;  4C7Y A;  4HRO A;  4RGN A;  3PV1 A;  4KZC A;  3EA6 A;  4JLC A;  3A1Q B;  3PO0 A;  3R8B A;  2L52 A;  4G11 A;  2MBQ A;  1WYW B;  2ZCB A;  1YOV B;  3L16 A;  1UH6 A;  2D3C A;  2BYF A;  1ENF A;  4YSY B;  2GMI C;  3NZU A;  2KDF B;  4PT5 A;  4CO7 A;  4YTN B;  5KHO A;  3R66 C;  3S2A A;  2A4Z A;  2L3Z A;  2WGS A;  2VZK B;  2DYO A;  1E0Z A;  1XCT L;  2FID A;  4ZRQ A;  5J2R A;  1H8C A;  1LQB A;  1Y56 A;  2IGD A;  2WXI A;  4BKG A;  2DAJ A;  2MWS B;  1AYF A;  1C77 A;  2M0A A;  4WJQ A;  3M95 A;  3P2B A;  1XLO A;  5E6O A;  4GMV A;  3KLS X;  1DOY A;  1JRU A;  4RF0 A;  3DBH B;  2SAK A;  2BWF A;  4A9A A;  2OED A;  2LFI A;  2MLB A;  1CQV A;  3DHH C;  3W1S C;  3FAH A;  3A9K B;  2J53 A;  3AE5 B;  1P9D U;  4TMA B;  1ZDX A;  4ICU A;  5DPT A;  4E3C A;  4R3D A;  1YX6 B;  3SDL C;  2HJ8 A;  3P4R B;  4ANV A;  2VH2 A;  2ASQ A;  4PS8 A;  4I6N B;  2KK8 A;  4K7W A;  2LAS A;  3H7S A;  5D2M B;  4LNO A;  2WYQ A;  4IDI A;  2IY0 B;  5AZH A;  2V4L A;  3TEY A;  1AWD A;  3I63 C;  1VZ8 A;  3GB1 A;  3DBL B;  2PPH A;  5J18 A;  4DBG A;  3AUL A;  1T0Y A;  2KAJ A;  5JZE B;  5BYS A;  1HE8 A;  1H4R A;  1SIF A;  2BT6 A;  4LNI A;  3ONS A;  1D5Z C;  1QZE A;  3OWE B;  3GE8 C;  2L0T A;  3V05 A;  1OTR B;  4TSS A;  5FR6 A;  1FXI A;  4RCO A;  4N6E B;  2BPS A;  3IT4 B;  3VH4 B;  4DHZ E;  3IBE A;  3A9J A;  4N58 A;  4C4V B;  3QX1 A;  1PQS A;  3U8Z A;  3AMZ A;  1KOT A;  2Y3A A;  2DZM A;  4DXF A;  4FLH A;  1L5P A;  1L2N A;  1WF9 A;  2L1A A;  3Q2A C;  4EZL A;  1JWU D;  2LJ5 A;  3IXS A;  2PVO D;  4KVG B;  2AQ3 B;  3JW0 X;  3NS8 A;  1RYJ A;  2RDH A;  2UWQ A;  3M3J A;  4OVZ A;  4YL8 A;  1KM7 A;  3W2D A;  4LNF A;  2M19 A;  2MA9 B;  2CU1 A;  3EGR A;  3MC0 B;  3RNE C;  1SXT A;  2E3T A;  5HHD G;  1UBQ A;  2LD9 A;  3TCA A;  2KD0 A;  5AUK A;  1WZ3 A;  3MHS D;  2C60 A;  1MHH E;  4LTU A;  3P63 A;  4DQO C;  1ZUD 2;  2MH7 A;  3TJP A;  4TKN A;  2GB1 A;  1FFV A;  2BGF A;  1F77 A;  1E7P B;  4AP4 C;  2LJI A;  1N62 A;  4W9J A;  2C9W B;  1C78 A;  2BBC A;  2N1V A;  5IA7 A;  2HTH A;  2LVO A;  1TY0 A;  2LGS A;  2VRR B;  2KQ7 A;  3AEC B;  3NJT A;  3ENE A;  1UBI A;  1TS3 A;  1WGY A;  1BUI C;  1YQ4 B;  2H89 B;  4WIP A;  2ZVN A;  3HVZ A;  1WY8 A;  4TUU A;  2M56 B;  2IO0 B;  1UGM A;  4P7I A;  4FAD A;  5C1Z A;  2C7N B;  4RGM A;  1HQR D;  4NPN A;  2W82 A;  1IGC A;  4US8 A;  1FFU A;  2LVQ A;  1ZKH A;  4A20 A;  1XEE A;  3IAM 1;  5CHF A;  2KLG A;  3KWL A;  4MM3 B;  4FUL A;  2Y5B B;  1V81 A;  5DPR A;  3V61 A;  3A4S C;  3NZ3 A;  4WWP A;  3ZNH B;  1K53 A;  4BBN F;  4EFO A;  3ZDT A;  2PEA A;  3AED B;  3Q3O C;  2WXL A;  1IBX A;  1WXS A;  3ZTC A;  3GP7 A;  1OQR A;  3NUH B;  4OZC A;  2GBR A;  3IVF A;  4WAA A;  3CMM B;  2GBK A;  2AYO B;  1T5X D;  1B1Z A;  3H1U A;  4P6V F;  3TIX A;  1XT9 B;  3AH7 A;  3RNA C;  3ZXV A;  3ZJT A;  1HZ5 A;  2CHX A;  4LNN A;  4MM3 A;  4QAY A;  1HXY D;  4WWO A;  2OJR A;  3O13 A;  2FUH B;  2IYD B;  1FPY A;  4E71 A;  2PTL A;  2BQQ A;  1WMH B;  1I42 A;  3DBR I;  2DZI A;  1WR6 E;  1I4X A;  4RF1 A;  4E74 A;  1F2R I;  4KIK A;  2WXQ A;  3AN1 A;  3PRZ A;  1SE9 A;  1R4M I;  1WJ6 A;  2KTF A;  4W9I A;  1FCL A;  2WXN A;  1EF5 A;  2W54 A;  1E10 A;  1IP9 A;  4II3 B;  5CHV C;  2JWZ A;  2KJR A;  2PE9 A;  2WDQ B;  1Q10 A;  3B0A A;  2MRP A;  3KUC B;  3BII D;  1KLG D;  4US9 A;  3ZNZ B;  1KJT A;  3M63 B;  4FHK A;  4D2K A;  2WDR B;  2CHW A;  3N3K B;  2WXM A;  3AEA B;  1RFA A;  2SEB D;  1B9R A;  2MP2 B;  3J9C A;  1CK1 A;  4JE3 B;  3U4E G;  2QDF A;  1TKY A;  4HCP B;  1M4V A;  2IDY A;  4M0W A;  1FRR A;  1MG8 A;  2UU7 A;  2K8H A;  1GB1 A;  4WH4 A;  3AE4 B;  1M94 A;  1MVK A;  2O2V B;  2WXF A;  2AEH A;  4HJK A;  3OAW A;  1SB3 C;  4LDT B;  2KFK A;  1S3S G;  4IM2 A;  1X1M A;  3PVL A;  4HPL B;  1IPG A;  1BT0 A;  3ZLZ A;  2ICI A;  1ZXI A;  3VUY A;  1P7F A;  4GOC A;  1GAQ B;  1VJK A;  2D3B A;  3N1X C;  1WGR A;  4AOF A;  5CTR C;  4KDL B;  5IOI A;  1E8Z A;  3A9K A;  4ITK A;  1QIL A;  2HD5 B;  3WA0 A;  2Q5W D;  2KDM A;  2PJH A;  2JU6 X;  2BS4 B;  2I38 A;  2KTR A;  2IGG A;  2XK5 B;  4DHJ D;  3R7Q A;  2KTR B;  5TR5 A;  1MPE A;  4XYC A;  3PS6 A;  1WGG A;  3KYC D;  1TKG A;  1TY2 A;  2WU5 B;  3LYY A;  2K1F A;  3DCG A;  3ZW3 A;  4OZA A;  1V97 A;  4A3P A;  3BVM A;  3MTN B;  1ZE3 D;  3HHM A;  4NJ7 A;  4MH8 A;  3HM3 A;  1ACC A;  4TQ0 A;  4KSL C;  2RR9 A;  1UWX A;  3SFE B;  4WJN A;  4PYZ A;  2DLB A;  3W5U B;  2KC2 A;  4XZ4 A;  4MJS B;  1KFY B;  4OW0 A;  2HJ1 A;  1T0R C;  1JML A;  4BKS A;  2EEL A;  4XDC A;  4YSZ B;  1YX5 B;  2Y5P A;  2MBO A;  1BXT A;  1BML C;  1WH3 A;  4EKU A;  1V1P A;  3GZN I;  4WJP A;  1UD7 A;  3NG0 A;  2M0X A;  5FR3 A;  2MX2 A;  3AE2 B;  3LDZ E;  3UGB B;  1JRP A;  2G4D B;  4K81 A;  1OQQ A;  4XE0 A;  2QIE B;  3TEZ A;  2IND C;  2OJW A;  3NOB A;  5JH5 C;  3I5J C;  2K8C A;  3ZGZ A;  1Y8R C;  1WRD B;  3TEW A;  2IZV B;  1PFD A;  2W3S A;  2FCQ A;  2BKF A;  1FD6 A;  2WXG A;  1YN3 A;  5JHB A;  5AUI A;  2NR2 A;  2M8S A;  3QK0 A;  4GSW A;  2XN9 C;  2K9X A;  1LXD A;  1VR9 A;  3QC8 B;  3Q8B A;  1I35 A;  5DPS A;  2C5L C;  3X0W A;  3KUZ A;  1JWA D;  4AJW A;  4LJO B;  2IJ0 A;  2AX5 A;  2K5P A;  2ZW1 A;  2WWZ A;  1WMH A;  3DHG C;  2K39 A;  2WU2 B;  3DQV A;  1YD8 U;  1A70 A;  1P98 A;  2JPH A;  1F9J A;  1YN4 A;  2BB6 A;  4DWF A;  3VUX A;  5G2N A;  1NBF C;  4XDD A;  1FM0 D;  2PMV A;  5BMH A;  1VZ6 A;  2MSE D;  3HRD D;  1VZ7 A;  1QQR A;  5JHA A;  1T0Q C;  4ANW A;  2MHJ A;  4KZ0 A;  3V6E B;  3B1L X;  3ZYY X;  5IP4 D;  2BS3 B;  2KX0 A;  3BZD B;  2RMM A;  1P0R A;  4RGO S;  2XBB C;  1KRH A;  2J0M A;  3MC8 A;  4HPP A;  1YN5 A;  3TEX A;  1UF0 A;  1WXQ A;  3AE1 B;  3FIL B;  2I1J A;  4HKZ E;  2JRH A;  2K25 A;  1N5X A;  2VH1 A;  1F52 A;  2N7J A;  3KVF B;  1PGX A;  5BYR A;  2EKI A;  2N1W A;  3Q8E A;  2N0S B;  4LDT D;  1GNU A;  4I6P A;  2L83 A;  5FKA C;  2R2O A;  1LM8 B;  5IO9 A;  4L2Y A;  1A5R A; 
#chains in the Genus database with same CATH homology
 3NS8 A;  4W9K A;  1ZW7 A;  1E7V A;  3APC A;  2UWQ A;  3M3J A;  4ASW C;  3IFW B;  3SD5 A;  4YL8 A;  2KN5 A;  2O6V B;  3VH3 B;  3ZIM A;  1KM7 A;  2L05 A;  4B95 A;  1L7Y A;  3KW5 B;  5DPW A;  3L54 A;  2C7H A;  2V3S A;  1V86 A;  2MA9 B;  2CU1 A;  4TQ1 A;  3U30 A;  3SHQ A;  1OQY A;  2D2Q A;  2FCM A;  3VDZ A;  2KLC A;  2KMA A;  1UBQ A;  2LD9 A;  3IHP C;  4LCD E;  3TCA A;  2KD0 A;  1J8C A;  1WZ3 A;  4FJV B;  5LXH A;  2GBJ A;  2FCN A;  2C60 A;  3MHS D;  4HXD A;  4N9F 4;  2KJH B;  3TJP A;  4TKN A;  4HCN B;  5GMV A;  4ZRI A;  3O65 B;  2BGF A;  2ZCC A;  4HLE A;  4IW0 A;  3TMP B;  4AP4 C;  2N4F A;  2ZZP B;  4W9J A;  2KFJ A;  3U7D A;  2C9W B;  4FN2 A;  4MDK E;  2G4S A;  2G3Q B;  4HDO A;  4K7S A;  2KWC A;  1WJ4 A;  4OVV A;  2CS4 A;  1GG3 A;  2LWP A;  1V6E A;  2N1V A;  5IA7 A;  2HTH A;  2LVO A;  2VRR B;  4J6I A;  4HK2 A;  2KQ7 A;  2N9P C;  3ENE A;  1UBI A;  3OLM D;  4PYU A;  2XEW A;  2J0K A;  2ZJD A;  4NQL B;  3X23 A;  1WGY A;  2Z0E B;  3QQ8 B;  2NBV B;  3A4R A;  3DBH I;  3RUL A;  2LGD A;  1V5T A;  2KNB A;  2L7R A;  1V80 A;  2ZVN A;  1WY8 A;  4TUU A;  2IO0 B;  4LJP B;  1UGM A;  4P7I A;  4BBN C;  2BF8 B;  4FAD A;  5C1Z A;  2IO2 B;  2C7N B;  4GXB A;  3AXC A;  4NPN A;  1OGW A;  5E6N A;  4KIK B;  3L13 A;  2KZR A;  2L76 A;  3ZNI D;  1TBE A;  2LVQ A;  1ZKH A;  4A20 A;  1RAX A;  5CHF A;  2KLG A;  4TV3 A;  2KDE B;  2Y5B B;  1V81 A;  4FUL A;  5DPR A;  4CHK A;  1J19 A;  2KJ6 A;  4HDQ A;  4ZRK A;  3V61 A;  2KWU B;  2MQJ A;  4JIO U;  4AUQ C;  3A4S C;  4DDG D;  4WWP A;  3ZNH B;  4BBN F;  3KYD D;  4EFO A;  3ZDT A;  2NPT B;  1P1A A;  2PEA A;  1GC6 A;  2LRU A;  2BYV E;  3ZKJ C;  2MBE A;  3DVG Y;  3W1S A;  5D7G A;  3NZS A;  1WXS A;  4W9F A;  4IWO A;  5LXI B;  4W9L A;  3ZTC A;  4IUM B;  1OEY A;  4RMA A;  3I3T B;  3L17 A;  1SGH A;  3JSV A;  2GBR A;  3PLU A;  3DVN V;  3IVF A;  4WAA A;  1GJZ A;  4MGI E;  3CMM B;  4KV2 A;  2GBK A;  4BFR A;  2G45 B;  2AYO B;  3K9O B;  2KHW B;  2RSU A;  2A5U A;  3HK0 A;  3H1U A;  4XX5 A;  2DEN B;  2KX3 A;  2LRW A;  3TIX A;  3V62 A;  1VCB A;  1XT9 B;  3H9D A;  5EDS A;  2J0J A;  3MJW A;  2FCS A;  2KDI A;  4FHJ A;  2CHX A;  2JY6 A;  4WWN A;  2LXA A;  2O6V A;  4MGK E;  4MM3 A;  1E5W A;  3RD2 A;  3PPA A;  3ZDM C;  4WWO A;  1J0G A;  5IAA C;  2K6Q A;  2OJR A;  2FUH B;  3LJ3 A;  3QWZ B;  2IYD B;  2I1K A;  3N30 A;  4E71 A;  2YVC A;  3VTV A;  1WMH B;  3OJ3 A;  2Z0D B;  3AU5 A;  2ZVO A;  1I42 A;  3CSF A;  3DBR I;  2DZI A;  2MCN B;  2MP2 A;  4W9D A;  2KC1 A;  3ML9 A;  1WR6 E;  1WFY A;  3V60 A;  3VFK A;  4E74 A;  4IC7 B;  3PRM B;  2YLM A;  5KHQ A;  4KIK A;  2XK5 A;  2MW5 A;  1WGD A;  3PRZ A;  1SE9 A;  1R4M I;  1WI0 A;  3JYU A;  1WJ6 A;  2UYZ B;  3M62 B;  4II2 B;  5E6P A;  2KTF A;  4NY0 A;  4W9I A;  4F8C B;  1EF5 A;  2B3A A;  2LGX A;  1OEY J;  2ZPN A;  2C7M B;  5L95 C;  2KKC A;  1IP9 A;  4MSM B;  4II3 B;  5CHV C;  3AU4 A;  2AWT A;  2JWZ A;  2KJR A;  2PE9 A;  4DHZ B;  2IO1 B;  2BWE S;  4IM3 A;  3B0A A;  2MRP A;  2RD0 A;  3KUC B;  3D32 A;  4BKS D;  4URK A;  1EF1 A;  4W9C A;  2QHO A;  5CX3 A;  2NBW B;  3ZNZ B;  3DPD A;  1KJT A;  3M63 B;  2KMC A;  3BY4 B;  4EZJ A;  2KFK B;  1ZGU B;  3PHX B;  4FHK A;  3QAR A;  4RM8 A;  2GOW A;  4ANX A;  2LI5 A;  3Q3F A;  4EZK A;  2CHW A;  3N3K B;  2D3G A;  1RFA A;  3KH0 A;  2V1Y A;  2CR5 A;  4GU2 A;  1WXV A;  1WE7 A;  2FIF A;  3ZVV A;  3C0R B;  3WAM A;  2MP2 B;  3EC8 A;  4AJY B;  4HCP B;  1E8W A;  1ISN A;  2JRI B;  2FAZ A;  4FA6 A;  3AI5 A;  2IBI B;  1MG8 A;  1WX9 A;  2JVC A;  3JSV B;  4MH0 E;  2K8H A;  3WAL A;  2KAN A;  3PRE A;  4G50 A;  3SU8 X;  3PGE A;  4DDI D;  1M94 A;  2O2V B;  2AL6 A;  1E8X A;  1WXA A;  3IG3 A;  3WIM A;  2AEH A;  4HJK A;  3OAW A;  4M0W B;  1R4N I;  3PZD A;  4HPM B;  4LDT B;  2K8B A;  2M1M A;  2KFK A;  1S3S G;  3K9P B;  4IM2 A;  1UEL A;  3QJZ A;  4WQO B;  3UIP B;  3UF8 A;  1X1M A;  3PVL A;  4HPL B;  1IPG A;  4IWQ A;  1WIA A;  1NI2 A;  1YJ1 A;  1WGH A;  1BT0 A;  3H7P A;  3UQA A;  2N7E A;  3ZLZ A;  4GDK B;  2EMT A;  3HIZ A;  4M8N A;  3PT2 B;  1WE6 A;  3UQB A;  1IYF A;  2NPT A;  2L8J A;  4BOS C;  4KDI C;  2O6V D;  2IY1 B;  3ZNG C;  5LLI A;  3T8M A;  5HKH A;  2LGY A;  3VUY A;  2KWV B;  4PS7 A;  4GOC A;  2ZEQ A;  1WM2 A;  3DBL I;  3QA8 A;  2LZ6 A;  2NS5 A;  2R2Q A;  4IWP A;  4EOY A;  2EMS A;  2M4N A;  2L0F A;  1WGR A;  1WXM A;  5CTR C;  4AOF A;  1WX8 A;  4KDL B;  1XD3 B;  3APF A;  1Z5S B;  3RT3 B;  5AZG A;  1E8Z A;  2M17 A;  2ZNV B;  3A9K A;  1Q5W B;  4GDK A;  3A33 B;  2HD5 B;  1E90 A;  4ZRJ A;  2N9E B;  4IG7 B;  4W9E A;  3WA0 A;  4EUT A;  4B6W A;  5AEK B;  4WJO A;  5BO4 B;  5CHW A;  5L83 A;  3H6N A;  3VUW A;  2PJH A;  1XQQ A;  2J7Q B;  1V2Y A;  2D07 B;  2LUE A;  2KTR A;  2MBB B;  1UZX B;  2XK5 B;  4B9K A;  3ZRC A;  2DZK A;  4DHJ D;  3R7Q A;  2KTR B;  5TR5 A;  1RLF A;  3T9L A;  3PS6 A;  4G3X B;  3VVW B;  2RPQ A;  1YIW A;  5C23 A;  3CF6 E;  3WAN A;  1YQB A;  4F7Z A;  1WGG A;  3KYC D;  2LVP A;  1P3Q U;  1GUA B;  4JQW C;  4K1R B;  1EO6 A;  3R7R A;  3TL5 A;  2BYE A;  3EEC A;  3H7P B;  4KSK C;  1RRB A;  1E7U A;  3GOE A;  3DVN U;  3VHT C;  5G55 A;  4M8M A;  2K1F A;  3DCG A;  3L10 B;  3ML8 A;  3OJ4 B;  4AWJ A;  3ZW3 A;  2DYB A;  2IO3 B;  4A3P A;  1CMX B;  3MTN B;  2DHZ A;  3HHM A;  4NJ7 A;  3HM3 A;  3PV1 A;  4KZC A;  1EUV B;  4TQ0 A;  3PLV A;  2MBH A;  4KSL C;  2KQS A;  1S1Q B;  2WX0 A;  4JLC A;  2RGF A;  3A1Q B;  2RR9 A;  3L0W B;  2JZZ A;  4WJN A;  1NDD A;  4G11 A;  2MBQ A;  1WYW B;  2WX1 A;  2O2V A;  4PYZ A;  1WZ0 A;  2ZCB A;  4GB9 A;  4FBJ B;  3VQI A;  3L16 A;  1UH6 A;  2KC2 A;  3RCZ A;  3UIO B;  2BYF A;  4XZ4 A;  1VD2 A;  4MJS B;  4CYE A;  1V9J A;  2GMI C;  3NZU A;  4OVU A;  2KDF B;  1WR1 A;  2JT4 B;  4BKS A;  5D6J B;  4CO7 A;  5KHO A;  3R66 C;  4GN1 A;  3S2A A;  2A4Z A;  2L3Z A;  3QCA A;  2CKH B;  1YX5 B;  4MEL A;  4X57 B;  2D10 A;  2MBO A;  4EEW A;  3RUI B;  2DYO A;  3QHT A;  4F1S A;  1WH3 A;  4EKU A;  3GZN I;  3EHV A;  4NAW B;  2FID A;  4ICV A;  5D94 A;  3ZO5 B;  4WJP A;  1UD7 A;  3VTU A;  2JZ3 B;  5J2R A;  2OOB B;  1LQB A;  2M0X A;  1H8C A;  2MX2 A;  2BKR B;  2N7D A;  3LDZ E;  3UGB B;  4NQK E;  4BKG A;  2DAJ A;  2DYM A;  2GBN A;  3R3M A;  4ANU A;  2G4D B;  4K81 A;  2MWS B;  4FJY A;  4HWI B;  3ECI A;  3L08 A;  4GIV A;  5DCN A;  3CST A;  2HE7 A;  4WJQ A;  3M95 A;  3NOB A;  3P2B A;  3RZF A;  5JH5 C;  2KO3 A;  5E6O A;  2NCN A;  1E8Y A;  3DVG X;  4GMV A;  2K8C A;  4BKT A;  2N9X A;  4NNJ B;  2JF5 A;  1AAR A;  2DAF A;  4NAW A;  1C1Y B;  1JRU A;  1Y8R C;  1WRD B;  4W9H A;  2W9N A;  2BWF A;  2IZV B;  2FCQ A;  4K7U A;  2BKF A;  3KUD B;  3QIJ A;  2ZNV C;  4DXA B;  1K8R B;  1Z2M A;  1WX7 A;  2MLB A;  3WAP A;  4BOZ B;  5JHB A;  2AL3 A;  3W1S C;  4HVB A;  2GBM A;  2NR2 A;  1TTN A;  3A9K B;  4MGZ E;  3RZW C;  1P9D U;  2M8S A;  3N32 A;  3QK0 A;  4XC2 A;  3ZRF A;  4GSW A;  3ZUN A;  2DX5 B;  4ICU A;  2KOX A;  5DPT A;  4E3C A;  1LXD A;  3SDL C;  1YX6 B;  2HJ8 A;  3QC8 B;  3W1Y A;  4ANV A;  2NBU A;  2ASQ A;  4MJS A;  4PS8 A;  4A3O A;  1I35 A;  3PHW B;  3UIN B;  4I6N B;  5DPS A;  2C5L C;  2KK8 A;  4K7W A;  3X0W A;  2LAS A;  3KUZ A;  3QAQ A;  1G6J A;  4PS3 A;  3ALB A;  3H7S A;  3RYT A;  5D2M B;  4AJW A;  4DHJ B;  4ZDV A;  2WYQ A;  4LJO B;  2IY0 B;  3WAO A;  2KDB A;  3VXW A;  2DZJ A;  2REX A;  5AZH A;  2WWZ A;  2CHZ A;  1WJU A;  2V4L A;  1WMH A;  2KVR A;  1WM3 A;  2K39 A;  3ZTD A;  4IM0 A;  3NY5 A;  4ZYN A;  3DQV A;  1YD8 U;  1P98 A;  2PPH A;  5J18 A;  1TZ1 A;  2JPH A;  1F9J A;  4DBG A;  3AUL A;  1T0Y A;  3APD A;  2Z59 B;  5JZE B;  3A1Q A;  3VAW A;  4DWF A;  1V5O A;  1HE8 A;  2K6D B;  4GDL B;  1V49 A;  4W9G A;  5G2N A;  1NBF C;  4JL9 A;  3JVZ X;  3VUX A;  1H4R A;  1SIF A;  4G0N B;  3ONS A;  2MSE D;  4I6L B;  1QZE A;  3HM6 X;  3PRP B;  4DK5 A;  2L0T A;  5JHA A;  2KXJ A;  4ANW A;  4NJ6 A;  2JUO A;  1FXT B;  1OTR B;  4KZ0 A;  3V6E B;  4RM9 A;  3A9J B;  3B1L X;  5FR6 A;  2D11 A;  2BPS A;  1TGZ B;  2JXX A;  3DBS A;  4BVU C;  2ZPY A;  4FJZ A;  3VH4 B;  2KX0 A;  3IBE A;  4DHZ E;  2L00 B;  3A9J A;  5J17 A;  1Q1O A;  2PE6 B;  1P0R A;  5AZF A;  1GC7 A;  2FNJ B;  2XBB C;  3B08 A;  2J0M A;  3QX1 A;  4JGH B;  1PQS A;  3U8Z A;  3Q3J A;  1KOT A;  2NVU I;  1U4A A;  3PTF C;  2DZM A;  3EFU A;  4FLH A;  1L2N A;  1WF9 A;  3TBL D;  2EKE C;  1D3Z A;  2I1J A;  4MSQ B;  1C3T A;  2JRH A;  2K25 A;  4EZL A;  3V6C B;  3DOW A;  3KVF B;  1Q0W B;  1LFD A;  2N1W A;  1WJN A;  3DDC B;  2LXC A;  1GNU A;  2LJ5 A;  2WDT B;  4LDT D;  3VTW A;  4MEM A;  4I6P A;  3NHE B;  2R2O A;  1LM8 B;  1A5R A;  3PSE B;  4GDL A;  4GGQ A;  1KLV A;  4KVG B;  3BIN A;  4MGY E;  3JW0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...