2LXCA

Solution structure of the complex between the sgt2 homodimerization domain and the get5 ubl domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/protein binding
molecule keywords Ubiquitin-like protein MDY2
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lxcA00
1FXTB 2NR2A 1P1AA 1WX8A 3B08A 4WJPA 4DHZE 1WRDB 2R2QA 2KN5A 2ZEQA 2PEAA 1XT9B 4EUTA 1KLVA 3DCGA 3KVFB 2ZPNA 3QA8A 4W9EA 5G2NA 2MLBA 4KDLB 3EECA 3ZNID 1WXAA 2GBNA 4X57B 2NS5A 1TBEA 4II2B 1WM3A 3APDA 3BINA 3D32A 2N9EB 3VVWB 2GMIC 3N32A 2CHZA 1WJ4A 2IO1B 4J6IA 1Y8RC 4WAAA 4FBJB 5CHFA 4F7ZA 5JHAA 2J0JA 1IP9A 4FHKA 4IWOA 3MJWA 1GG3A 1WXSA 3DBLI 1WJUA 4GSWA 3VHTC 1U4AA 1WFYA 1Q0WB 3KH0A 1NBFC 2KD0A 2N1VA 4NQKE 4BVUC 2C7MB 3UIPB 4EZLA 3QX1A 5TR5A 3SHQA 2OJRA 1V81A 5AZHA 4RM8A 4HDQA 4MGZE 3IBEA 4W9LA 1E8YA 3SU8X 3OJ3A 2C60A 1WZ0A 5EDSA 1D3ZA 5E6OA 5KHOA 2BYVE 3L10B 3WANA 2K1FA 2MBOA 3Q3JA 2R2OA 3PT2B 5DPSA 3ZDTA 3V6CB 2IY1B 3OAWA 4MELA 1T0YA 2NCNA 2KDIA 1Z2MA 4KV2A 2LZ6A 4MDKE 4B6WA 5L83A 1V49A 2CKHB 3N3KB 1IPGA 1WR6E 3CSFA 3PPAA 1P98A 2IZVB 2DAJA 1P3QU 4W9HA 4DHJB 2DZMA 4IUMB 1XQQA 4DWFA 4E74A 3ZTCA 1I42A 3TL5A 3MHSD 3RCZA 1CMXB 2MA9B 2LGXA 4WWNA 3T8MA 3A4SC 2MBEA 1WE7A 2JY6A 2W9NA 1J19A 2ASQA 2KX0A 3PRZA 5DPRA 2V3SA 3DBRI 2K25A 3A9JB 4BBNF 1AARA 2BKFA 2KJRA 2KLGA 3ZW3A 1V5OA 3R66C 3ZKJC 2PJHA 4F1SA 4YL8A 2IBIB 3A9JA 2JUOA 3ONSA 4MSQB 1P9DU 4W9FA 2UYZB 4K81A 3RD2A 3VH3B 4EFOA 2EKEC 4BKSD 2D3GA 2ZCCA 4GB9A 4LJPB 4GIVA 4A3PA 5J18A 1BT0A 1TGZB 3ZRCA 3EC8A 3JVZX 1EF1A 4NPNA 1VD2A 5E6PA 2KTRA 2KC2A 4E71A 2FAZA 2IO3B 5J2RA 3R3MA 2FCNA 2D10A 4IG7B 3VFKA 3EFUA 3NOBA 4KZ0A 1X1MA 3AI5A 1GC7A 3IHPC 4NJ6A 2KWVB 2J7QB 3L0WB 3RUIB 3RYTA 2V4LA 4FULA 4ANUA 2OOBB 2Z0DB 5C1ZA 1WX7A 4XZ4A 2LD9A 2G4DB 3P2BA 3PZDA 4I6LB 3M95A 4DXAB 1WM2A 1YD8U 3DQVA 2B3AA 2O2VB 2RSUA 4ZDVA 4A3OA 1TZ1A 2WWZA 4WJNA 1NI2A 4RM9A 1WGGA 2CR5A 2DZKA 5DPTA 3UQBA 3ENEA 2O2VA 2KMAA 3AULA 4ANXA 4FJZA 3A9KA 3VUWA 4JIOU 2DX5B 2G45B 1UH6A 2ZNVB 2LVPA 3PTFC 2N7EA 4NY0A 3H7PB 1OEYA 3WAPA 4FHJA 2RD0A 2C7HA 2RR9A 2EMSA 3ML9A 4JGHB 2REXA 4TQ0A 4JLCA 1E7VA 1XD3B 5J17A 2EMTA 1V80A 3H7PA 2JVCA 2KHWB 3HK0A 2BGFA 2KLCA 4AJYB 2I1KA 2LGYA 3PRMB 1OTRB 3ALBA 4IM3A 5D6JB 1Z5SB 2AEHA 2KDEB 2L7RA 4K7SA 4FJVB 2KFJA 3GZNI 1WYWB 2KWCA 2JZZA 2MW5A 2KOXA 2KWUB 2WX0A 4W9GA 5D7GA 4K7UA 3RT3B 2VRRB 4A20A 3B0AA 2HD5B 3HM6X 5FR6A 2XEWA 4ZRJA 1LQBA 2DZJA 3K9PB 2DHZA 2KMCA 2L3ZA 3AU5A 3APCA 4DDGD 1WGRA 2AYOB 3KUZA 3NS8A 2KFKB 4BKSA 4I6PA 2KQSA 2LXAA 3ZVVA 5CX3A 5D2MB 3M62B 1WX9A 2M1MA 2KFKA 5DCNA 1YIWA 5LXHA 3VAWA 3VTVA 3U8ZA 1V9JA 3ZNZB 4HXDA 2LJ5A 1RFAA 3PHXB 2HTHA 4ICUA 4ICVA 2RPQA 2FCMA 4RMAA 2JRIB 2ZJDA 2D11A 1YJ1A 1RAXA 1RRBA 3L08A 4IWPA 2L05A 3NZSA 3VQIA 1ZW7A 3QC8B 1WJNA 4GGQA 2LGDA 2YLMA 4EZJA 4KZCA 5CHVC 3PGEA 4ZRIA 2AL3A 4HLEA 5KHQA 2KO3A 3V61A 1C3TA 3ZRFA 4KDIC 2DENB 2L0FA 4CO7A 3UQAA 3ZNHB 1L7YA 2BWES 4LDTD 4P7IA 5AZGA 4ASWC 4W9KA 3TJPA 5LLIA 3PVLA 2FCQA 4WJOA 2MX2A 3A1QB 2BYFA 3RULA 4GDKA 2KDFB 3PLVA 1V86A 3NHEB 1UBIA 2WX1A 2KXJA 1WMHB 3PS6A 3VDZA 2L8JA 2N4FA 4HCNB 4NAWA 3A1QA 3KUCB 3RZWC 1GNUA 2ZPYA 3ZDMC 2K6DB 1WMHA 2KJ6A 4MGYE 1F9JA 4B9KA 1P0RA 4PS8A 1S3SG 2JXXA 3B1LX 3PSEB 2KTRB 4WWPA 5IAAC 4MEMA 4NJ7A 3WA0A 4JQWC 2C5LC 2L0TA 2C7NB 4BKTA 4LCDE 1NDDA 2AL6A 3IFWB 4IM0A 2WYQA 4AOFA 4G0NB 4G50A 2BF8B 3AXCA 2K8CA 5C23A 2BYEA 1ZKHA 2KZRA 2M17A 3ML8A 1YX6B 3DPDA 3LDZE 3VTUA 4FADA 2JWZA 2A5UA 2FUHB 3WAMA 2I1JA 4HCPB 5BO4B 2K8HA 1RLFA 5DPWA 1WGDA 2NVUI 4IC7B 3W1SC 2G3QB 2KX3A 3A33B 4EKUA 1EO6A 4DDID 3QK0A 2GBJA 3DVNV 3ECIA 3ZTDA 3L13A 1UGMA 2KANA 2J0KA 3ZIMA 1QZEA 3A9KB 3A4RA 1E5WA 1YQBA 1VCBA 2LI5A 2A4ZA 3CMMB 5CHWA 2D2QA 3HM3A 2IO2B 1SE9A 1KM7A 4EEWA 2FIDA 4FJYA 4K1RB 3CF6E 2BWFA 4ANVA 5L95C 2XBBC 1G6JA 2NBUA 4WJQA 4G11A 3S2AA 3I3TB 4HVBA 2HE7A 1OEYJ 4OVUA 4BKGA 3HHMA 3TBLD 2GBKA 3SD5A 2LVOA 1GC6A 4WQOB 1E8XA 3DDCB 2N1WA 1V2YA 2M8SA 1J8CA 4PYUA 2LWPA 2CS4A 1EUVB 3VTWA 2KK8A 4I6NB 4IW0A 4DHZB 3L54A 4W9IA 3KYCD 4HPLB 3L16A 1WE6A 4AWJA 3JYUA 4M8NA 2BKRB 4G3XB 4IWQA 4MJSA 4PS3A 5E6NA 2ZNVC 2PPHA 2LUEA 4NQLB 3DVGY 4EOYA 2MSED 2JT4B 3H1UA 3L17A 4GU2A 3U7DA 5IA7A 1KJTA 2NBWB 4BOSC 4AP4C 3UINB 1J0GA 2KNBA 1C1YB 3JSVA 3T9LA 1WR1A 4B95A 2MBHA 2KJHB 3QQ8B 2JPHA 2KQ7A 4HDOA 1JRUA 4GDLB 2L00B 3OJ4B 5JHBA 2ZVNA 2JZ3B 3VH4B 3LJ3A 3KW5B 1SIFA 2WDTB 1KOTA 5JH5C 1L2NA 2KKCA 4JL9A 2HJ8A 2FCSA 1WIAA 2FNJB 2IO0B 2LASA 2ZCBA 3CSTA 3IVFA 3PV1A 4GDLA 4PS7A 4ANWA 4DK5A 2V1YA 4M0WB 3UGBB 2DYBA 4KIKB 2O6VD 3PHWB 2PE6B 1OGWA 4BFRA 1WXMA 2KTFA 3C0RB 4KIKA 3ZNGC 1UBQA 3WIMA 3M3JA 3VUXA 3GOEA 3H9DA 1UZXB 4GMVA 4TV3A 4XX5A 2LRUA 1H4RA 4MGKE 1S1QB 1LFDA 2K8BA 1Q5WB 3V60A 2YVCA 3OLMD 3TMPB 2L76A 5D94A 4NNJB 1A5RA 4HPMB 3VXWA 3W1YA 1Q1OA 3V6EB 3X23A 1WH3A 3EHVA 4FLHA 3X0WA 4OVVA 3O65B 1YX5B 2MBBB 1PQSA 4GDKB 5GMVA 2ZVOA 1GUAB 2CU1A 4K7WA 4MSMB 4W9DA 1WGYA 4GXBA 2KDBA 2Z59B 3PREA 4NAWB 4WWOA 4ZYNA 1WY8A 3QARA 4LJOB 1MG8A 4E3CA 3N30A 4HWIB 2NPTB 2DAFA 3DVGX 4FN2A 3ZUNA 5LXIB 4CYEA 4IM2A 1WF9A 4W9CA 2N9PC 3QHTA 4XC2A 3UIOB 1TTNA 4URKA 2NPTA 4TUUA 1E8ZA 4HJKA 3V62A 3ZO5B 3AU4A 2UWQA 1WJ6A 1LXDA 2J0MA 2DYMA 2JF5A 4II3B 4TKNA 3SDLC 2MQJA 3UF8A 4FA6A 1WZ3A 3HIZA 2M4NA 4PYZA 3TIXA 2XK5B 3WALA 4MM3A 2QHOA 3PLUA 2IYDB 4KSLC 5JZEB 3QWZB 2D07B 1M94A 2XK5A 4ZRKA 2GOWA 2MP2B 2MRPA 3QCAA 3QAQA 4AJWA 2Z0EB 4AUQC 1HE8A 5HKHA 3QIJA 4KVGB 4EZKA 5AZFA 3DBSA 3TCAA 2O6VB 2MP2A 3R7RA 1E7UA 2Y5BB 2LVQA 3H6NA 5AEKB 2ZZPB 4GN1A 4TQ1A 2O6VA 2KVRA 3K9OB 4MH0E 3U30A 1E8WA 3W1SA 4N9F4 2GBRA 4BOZB 3WAOA 3NZUA 2FIFA 3PRPB 3KYDD 2K39A 1WXVA 2JRHA 2PE9A 3DOWA 3R7QA 2MCNB 4GOCA 3VUYA 2N9XA 1IYFA 4W9JA 2IY0B 3RZFA 1WI0A 1I35A 3BY4B 3NY5A 3DVNU 4MGIE 4BBNC 2MWSB 1V6EA 2GBMA 5CTRC 4CHKA 2DZIA 4LDTB 2DYOA 2N7DA 1V5TA 1ZGUB 2MBQA 3Q3FA 3APFA 1OQYA 2C9WB 2LXCA 3KUDB 4MJSB 1H8CA 3DBHI 1R4NI 2G4SA 2M0XA 1GJZA 2RGFA 3MTNB 2BPSA 5G55A 1WGHA 1R4MI 2LRWA 3IG3A 2KC1A 2K6QA 4F8CB 3H7SA 2CHWA 3JSVB 4M8MA 4DHJD 1EF5A 1K8RB 3JW0X 2NBVB 3M63B 4HK2A 4KSKC 4DBGA 1LM8B 1E90A 1UELA 1SGHA 2AWTA 2CHXA 1ISNA 3QJZA 1UD7A 3ZLZA
chains in the Genus database with same CATH superfamily
2NR2A 4OZAA 2R2QA 1HXYD 2KN5A 1XT9B 1TY2A 3Q8EA 2PMVA 2MLBA 1ZXHA 4KDLB 3ZNID 1WXAA 2GRIA 4II2B 2J52A 2N9EB 2PIAA 1SSNA 1WJ4A 4FBJB 5JHAA 1IP9A 4IWOA 1GG3A 1WXSA 2BB6A 3VHTC 2KWDA 3E56A 1Q0WB 4L1BA 4BVUC 2C7MB 3UIPB 4EZLA 4KGTA 1V81A 1FRRA 1R7SA 1YQ3B 2QSDA 4RM8A 4MGZE 3GZNB 2C60A 1WZ0A 4IDIA 5EDSA 4WIPA 2BYVE 2MBOA 2Z8LA 5DPSA 1T0YA 2NCNA 1Z2MA 1YMHE 2JX5A 4MDKE 4ZRPA 5L83A 1V49A 4ARIA 4NZLB 1WR6E 3TEYA 3TEWA 3N9YC 2DZMA 4WQMA 3TL5A 3MHSD 1GAQB 4WWNA 2MBEA 2HDEA 2W9NA 2KX0A 3PRZA 2QIEB 1VRAB 2KN4A 2KLGA 1FNWA 3U52E 2IBIB 4MSQB 3ONSA 4W9FA 4K81A 3RD2A 2HTME 4GB9A 4LJPB 1XLNA 5EE3A 1TGZB 1CQVA 3P1MA 3JVZX 1EF1A 2PLPA 4HEA1 1VD2A 2IO3B 3R3MA 5AUKA 2FCNA 2D10A 4OW0A 1HEZE 3NOBA 4KZ0A 4NJ6A 4FULA 4K3BA 1WX7A 4XZ4A 1TY0A 3RPFC 2G4DB 3GB1A 1YJJA 2RSUA 3MHZA 4XYCA 1C4PA 1EM7A 2DZKA 3AE2B 2KMAA 4XWWA 2DX5B 4HPPA 2N7JA 2M56B 3WAPA 3PTFC 3RNFC 2RR9A 4JGHB 3RFZB 1E7VA 1C77A 1QT9A 1V80A 3RNAC 2KHWB 1YN4A 4AJYB 4LTUA 3B2FA 1OTRB 4IM3A 4PK1A 1Z5SB 2L7RA 2KFJA 3GZNI 3GE8C 4QAYA 2KWCA 2JZZA 2WXMA 1P7FA 1V1PA 2IJ0A 5D7GA 4K7UA 3VR8B 3B0AA 3AU5A 1KTKA 1KLGD 2RDGA 4XGAB 4XWTA 2KQSA 5CX3A 5D2MB 2DLBA 1WX9A 4OHJA 2M1MA 3N1ZC 5DCNA 3VTVA 3U8ZA 3N1YC 1FFUA 3ZNZB 4B0EA 2FCMA 2GB1A 2JRIB 2ZJDA 4DXFA 1V1OA 4ZOHC 3OWEB 1T0QC 3NZSA 1ZW7A 3NVVA 4GGQA 2YLMA 4EZJA 4RCOA 2INCC 1C3TA 1PDXA 4MACA 2L0FA 4CO7A 3UQAA 3B2GA 1I4HA 4P7IA 2IGDA 3TJPA 2FCQA 4WJOA 2HJ1A 3PLVA 2LGSA 2WX1A 3VDZA 3E9SA 2ZW0A 2WXIA 4ZRQA 1WMHA 4MH8A 1S3SG 2KTRB 4MEMA 4NJ7A 1FRDA 1IGDA 3B9JA 4BKTA 2SEBD 1UWXA 4YTNB 3AM9A 2M17A 3DPDA 1C79A 1D5XC 2A5UA 3WAMA 2K8HA 3IAM1 3NJTA 5DPWA 2LJIA 4IC7B 2WDRB 1TKGA 3QK0A 4DDID 2LHEA 3DVNV 4YXDB 3ZTDA 2AX5A 1AW7A 1UGMA 2KANA 4UDUC 3A4RA 1VCBA 2A4ZA 3DHHC 3TUOA 1SE9A 3BK2A 3Q8BA 2FIDA 2WXKA 4K1RB 4ANVA 3V05A 2HE7A 2H88B 4RGMA 2LVOA 4WQOB 2N1WA 1QKZA 1QF6A 3VTWA 4I6NB 4DHZB 3L54A 2OEDA 3P4PB 3NRZA 1CK1A 4PS3A 4MT5A 1M4VA 2LUEA 3RNBC 3FKYA 4GU2A 5IA7A 2N0SB 1TJEA 1C1YB 3T9LA 1K53A 3ZQ4A 3Q2AC 2JPHA 2QDFA 3DHIC 2L00B 2CU3A 3LJ3A 1PGXA 1CZPA 1SIFA 1KOTA 4JL9A 2HJ8A 1E10A 1WIAA 2FNJB 2IO0B 2LASA 4DK5A 4M0WA 3WIMA 3H9DA 5HFYA 4GMVA 2G1EA 4MGKE 1S1QB 4OVZA 1L0YB 5D94A 2QEJC 4HPMB 3V6EB 3EHVA 4FLHA 4OVVA 4K7WA 4W9DA 3KWVA 4TSSA 4LJOB 2MEKA 3AE5B 2JWUA 4FN2A 3ZUNA 1SJED 1SJHD 4BZAA 2V9HA 1WF9A 4IM2A 4W9CA 4KGSA 2N9PC 3QHTA 1FD6A 3ZO5B 1LXDA 2JF5A 1J7AA 3UF8A 3DBLB 4M01A 5BYSA 1SXTA 2EELA 3AH7A 2JQRB 3QWZB 4LLGM 1M94A 3LB8C 1EWYC 1F2RC 4AJWA 2FBWB 2O6VB 3R7RA 1T6BX 2D3AA 3AN1A 3HVZA 2LVQA 1KH0A 2KVRA 3K9OB 4MH0E 3P42A 4N9F4 3C19A 2IDYA 3R7QA 4GOCA 4S17A 3MP9A 3NY5A 1VZ6A 5BMGA 5CTRC 1ZPSA 2GBMA 4OZCA 2N7DA 1WYGA 3KUDB 4MJSB 1XCQL 1H8CA 4CQNA 1WGHA 4HJGE 1EF5A 1K8RB 4HK2A 2D3BA 1E90A 1SGHA 2AWTA 3ZXVA 3QJZA 2WXNA 1FXTB 3B08A 1P1AA 4DHZE 4IKGA 1WRDB 2ZEQA 5EE9A 1JWAD 2ZPNA 1SEBD 2WS3B 1ET9A 2J53A 1HZ5A 1C9FA 1UUPA 1ZDXA 3I5JC 2GBNA 1TBEA 4XDCA 2Y3AA 2QMTA 2SAKA 3D32A 3VVWB 2WU5B 3ZJTA 5BMHA 2IO1B 3AE9B 3FILB 5CHFA 2MH7A 3DBLI 2DNFA 1WFYA 1NYRA 1SIJA 3QX1A 5TR5A 4JPSA 3SHQA 2NMQA 5AZHA 1MPEA 5TSSA 3URYA 1MHHE 2E6XA 3OJ3A 2M19A 1D3ZA 3CIRB 2K1FA 2ONQA 3Q3JA 4ACFA 4LNNA 2R2OA 3ZDTA 3V6CB 4MELA 2WXFA 2KDIA 4KV2A 1XXGA 2K9XA 1ZXIA 3N3KB 1NYQA 5C2TB 4W9HA 4IUMB 1D6EC 1XQQA 4E74A 3ZTCA 4RGNA 2LGXA 1WE7A 4M00A 4IOIE 2WLBA 2K25A 4EE2A 1AARA 2BKFA 2KJRA 4YL8A 3A9JA 3ZJVA 3AECB 3VH3B 2D3GA 1DOIA 4A3PA 4P1CC 4OZBA 3EC8A 2INPE 1HQRD 4RF0A 2KTRA 2FAZA 5J2RA 4H2AA 1MI0A 3AI5A 1GC7A 3IHPC 4B0MA 2KWVB 2J7QB 3RYTA 3IT6B 1PUTA 5C1ZA 3Q3OC 1N6ZA 1AWDA 2LD9A 3ETRA 2KVZA 3T3OA 4I6LB 1YD8U 2B3AA 2O2VB 2DBYA 1L0XB 2WWZA 2JSVX 1NI2A 1WGGA 2CR5A 3N20C 3ENEA 2L52A 2G45B 2ZNVB 4NY0A 2LVPA 1E6EB 2C7HA 2PVGC 1XD3B 2H89B 3H7PA 2X38A 2JVCA 1SF0A 3HK0A 2BGFA 2KLCA 2LGYA 4YWGG 2KT7A 2RPVA 4K7SA 4FJVB 2G9HD 2VZKD 3SEBA 1L0VB 2K22A 3IXSA 1WYWB 1JWUD 5JXVA 2WX0A 2RDBC 3LYYA 2KMMA 4A20A 2HD5B 2J42A 1JWMD 4ZRJA 2ON8A 4JWUC 3APCA 4DDGD 1WGRA 2AYOB 3KUZA 3UI3A 3AE4B 2NTTA 1TS4A 1RWSA 1XLQA 3M62B 1L4ZB 2KFKA 1RM6C 5LXHA 5MPOA 1N60A 1VZ7A 3VAWA 2OHFA 4ZYSA 3VRAB 2LJ5A 3PHXB 3EUB2 2HTHA 5HI1A 2RPQA 2M0AA 3Q6BA 3KLSX 3L08A 3VQIA 3R8BA 1UWMA 5E6JA 1WJNA 1E9MA 3PGEA 2QC8A 3ZRFA 2VH1A 3ZNHB 4LDTD 4ASWC 4W9KA 2BT6A 1C78A 1RYJA 3PVLA 2MX2A 2WXGA 3A1QB 2BYFA 2KDFB 3NHEB 4LNFA 1JWSD 2BB5A 2KXJA 4HRSA 1F77A 1QLBB 4HCNB 2L8JA 3KQ4A 2JZPA 3KUCB 1A70A 2K6DB 5G5GA 4B9KA 1P0RA 2JXXA 3B1LX 4S0RA 3WA0A 4JQWC 2C5LC 2C7NB 1NDDA 2ZW1A 4G0NB 2BF8B 4KX6B 3AXCA 5C3JB 5C23A 2ICIA 3LDZE 4K3CA 2JYEA 1RLFA 2FUG1 2NVUI 3W1SC 2G3QB 2CJOA 3A33B 3C8YA 1JCKB 4EKUA 2V0GA 2GBJA 3ECIA 3L13A 2J0KA 2RMMA 3ZIMA 3A9KB 1F52A 5H92C 1YQBA 3CMMB 1JALA 5CHWA 3W9CB 3HM3A 2IO2B 1LO5D 4EEWA 1QQRA 2NBUA 2JXTA 1IGCA 3S2AA 3I3TB 4JE3B 1OEYJ 2L1AA 4OVUA 1TS2A 3HHMA 2GBKA 1GC6A 4P16A 1HZ6A 3DDCB 1J8CA 1L4DB 2LWPA 1EUVB 3AV8A 4W9IA 2I38A 3KYCD 5BYRA 4AWJA 3W5VB 3JYUA 4G3XB 1NEKB 4MJSA 5E6NA 3I63C 3NUHB 3P4QB 4NQLB 4EOYA 2MSED 3H1UA 3L17A 1KJTA 3I57A 3UINB 3MC8A 4C7ZA 1J0GA 3MC9A 1WR1A 1UF0A 2JZ3B 3VH4B 1GPXA 3GP7A 1GB1A 2INNE 1FCLA 3IVFA 4GDLA 3CSTA 2BS2B 3PV1A 5IP4D 2V1YA 3UGBB 3PHWB 3DBHB 1R4NB 3P4SB 1OGWA 4BFRA 1SE3A 2KTFA 4KIKA 3M3JA 3VUXA 4RGOS 4D2KA 1JQ4A 1LFDA 3V60A 3OLMD 1QOGA 1A5RA 2B76B 1T0RC 3X0WA 1PQSA 4ARCA 1D5MC 2CU1A 1JROA 5IO9A 2KDBA 1E7PB 4KKIA 3PREA 4NAWB 2R61A 4WWOA 3Q69A 4E3CA 3N30A 2X8XX 2NPTB 5EE1A 2DAFA 1STEA 4CYEA 2LEKA 4XC2A 4XDDA 1SE2A 1YNTE 1E8ZA 4HJKA 1KRHA 4YSXB 3HVDA 3HIZA 1VZ8A 2M4NA 4PYZA 2IYDB 4KSLC 2GI9A 4WAFA 2XK5A 4ZRKA 3QAQA 1T5XD 2MP2B 2Z0EB 1YJIA 2W3RA 3QIJA 1PGAA 5LNK1 4EZKA 3DBSA 2BYTA 1B1ZA 1RFKA 3NVWA 3MFGA 3OG5A 4TQ1A 5BMIA 3U30A 1JMLA 2GBRA 4BOZB 3NZUA 1XLOA 3AE8B 3PRPB 2JRHA 1IYFA 1SE4A 2N9XA 1I35A 3DVNU 4MGIE 1TYGB 3DBRB 1DOXA 1V5TA 1ZGUB 2MBQA 3AEBB 3APFA 2V4IB 1OQYA 2C9WB 2LXCA 2LMCA 3DBHI 1R4NI 1XO3A 2RGFA 4LK0M 1OQRA 3MTNB 2LRWA 4F8CB 3H7SA 1GB4A 4Q2JA 4DHJD 4RFBA 3HRDD 3M63B 2CHXA 3CWIA 3RI7C 4WJPA 3AEAB 1V8CA 4EUTA 1FXIA 4W9EA 3EECA 3AEGB 3AMZA 3MC0B 3DWMA 2NS5A 1WM3A 4WWMA 1J7BA 1F1HA 2GMIC 3N32A 2CHZA 4J6IA 4WAAA 4F7ZA 5G5HA 2J0JA 2WP9B 3MJWA 1WJUA 4GSWA 1NBFC 1QOBA 2N1VA 2QCZA 2OJRA 4HDQA 4A9AA 1NENB 3IBEA 4W9LA 4TMAB 2MJEA 1E8YA 3SU8X 5E6OA 3WANA 3PT2B 2IY1B 1I7HA 1ZE3D 4B6WA 2CKHB 1IPGA 3CSFA 3PPAA 2IZVB 2DAJA 4MM3B 4DWFA 2AQ1B 1EWCA 2L32A 4A8XC 1I42A 1BMLC 1CMXB 3T8MA 3A4SC 2Q5WD 4AS1A 4P6VF 2JY6A 1J19A 2V3SA 3DBRI 4FXCA 2UU7A 1K52A 2JU6X 4F1SA 2PJHA 3TEXA 2JUOA 4EFOA 2ZCCA 5J18A 4GIVA 3AEDB 3VRBB 1BT0A 3ZRCA 1XEEA 1WSPA 3O13A 4BAXA 3RN9C 2WXHA 3VFKA 3EFUA 3Q8FA 3EFCA 3I9V1 3L0WB 4JX1C 1CJEA 2PW9A 3PO0A 1UGJA 1LGRA 1I4XA 1WM2A 3DQVA 4PT5A 4A3OA 1TZ1A 4RM9A 3UQBA 1C4AA 2W54A 5DPTA 4XE0A 4ANXA 4FJZA 3A9KA 3VUWA 4JIOU 1UH6A 1ESFA 1OEYA 4FHJA 2RD0A 3ML9A 2WU2B 2REXA 4TQ0A 2EMTA 2I1KA 3AE3B 3PRMB 4C80A 3ALBA 5D6JB 2KDEB 1EU4A 1K50A 3DWGC 3BYYB 2MW5A 3KWLA 2KOXA 1I4QA 2KWUB 4W9GA 2WHIA 3RT3B 2VRRB 1V97A 5FR6A 2XEWA 4WURA 3R2TA 2KMCA 3GS2A 3NS8A 4BKSA 4C00A 1GOZA 4I6PA 4REZA 2WDVB 2LXAA 1YN5A 2D3CA 1YIWA 1RFAA 4ICVA 2K3UA 4GLSC 1QOAA 1YJ1A 3EGRA 1RRBA 1WGKA 3QC8B 2LGDA 4KZCA 1TT5B 4KDIC 3IAS1 1FCCC 3RNCC 1L7YA 2V3NA 5AZGA 5IN7A 1FNUA 2TSSA 2WGSA 1JW9D 2YEPF 3RULA 1UBIA 2DWQA 4RNAA 3MJ5A 1WMHB 3PS6A 2VZKB 4NAWA 2BS3B 1E0ZA 3RZWC 2ZPYA 3ZDMC 1F9JA 1ET6A 1T3QA 2IGHA 1P7EA 1L6VA 2AL6A 3IFWB 4IM0A 2WYQA 1ROEA 4G50A 2K8CA 1PGBA 4O1NA 1DGJA 1ZKHA 2KZRA 3VTUA 4FADA 1MFWA 1Y56A 2WDQB 1MVKA 4HCPB 5BO4B 2QJLA 4HKQA 1OQQA 2JYTA 1WGDA 2MJDA 1D5ZC 1MHXA 1AYFA 5FK9C 3PZ8A 1E5WA 1TIFA 2D2QA 1UNSA 1KM7A 5L95C 2XBBC 1G6JA 1NI3A 2NTSA 5AUIA 3TSSA 4HVBA 3TBLD 1V2YA 2M8SA 3U2SC 1B9RA 2CS4A 2KK8A 4HPLB 4M8NA 2BKRB 4IWQA 4US8A 1HTOA 3DVGY 2JT4B 2NBWB 2K0PA 2KQ4X 2WXLA 2N9KA 2MBHA 5H8YE 3QQ8B 4HDOA 3OJ4B 5JHBA 2ZVNA 3ABVB 1L2NA 2KKCA 1N63A 2FCSA 3AE6B 5EE0A 2ZCBA 4PS7A 3BYTB 4KGRA 4M0WB 2DYBA 1KLUD 1WXMA 1F2RI 3C0RB 3GOEA 1UZXB 4TV3A 4XX5A 2LRUA 1H4RA 2K8BA 1Q5WB 1QOFA 1EU3A 3NG0A 4DQOC 1VJKA 1XCTL 3VXWA 3W1YA 3O65B 1YX5B 2MBBB 4GDKB 4US9A 2ZVOA 4MSMB 1WGYA 3IT4B 4GXBA 4ZYNA 1SB3C 1WY8A 2Y5PA 2IGGA 5LXIB 3DVGX 4URKA 2UWQA 4TKNA 3RNEC 2WXJA 3TIXA 3WALA 4LNKA 2QHOA 4MM3A 1DYQA 3ZYYX 4L23A 1T0SC 2LFIA 3SR6A 4AUQC 1HE8A 5HKHA 1KF6B 1WXQA 2E3TA 1N5XA 1HTQA 1F0ZA 5AZFA 3TCAA 1FFVA 3H8HA 1FIQA 1E7UA 2J4XA 3U7ZA 2Y5BB 2XN9C 1VLBA 2LGIA 5AEKB 3W2DA 2O6VA 1E8WA 4HKZE 4WH4A 4N6EB 2FIFA 4YSYB 4DXGA 1WXVA 2PE9A 3DOWA 3VUYA 3EA6A 1WRIA 4W9JA 2IY0B 3RZFA 1WI0A 3BY4B 2AQ3B 5D3DA 2MWSB 1FM0D 1V6EA 4CHKA 2DZIA 1K51A 3Q3FA 3ZGZA 2WQYB 1NVID 5I4DA 4N58A 2G4SA 2M0XA 1J7CA 5G55A 1SBBB 2K6QA 3BVZA 2CJNA 2CHWA 3JSVB 4M8MA 2BS4B 3JW0X 4KSKC 4DBGA 3BWUD 1LM8B 2MJ3A 4RF1A 1MG4A 1WX8A 1TKYA 3AB5A 4YSZB 2PEAA 1KLVA 3DCGA 3KVFB 3QA8A 5G2NA 3ZJUA 4X57B 3R2IA 4N59A 4AQ7A 3APDA 3BINA 3RMKC 1Q10A 1Y8RC 2MHJA 4FHKA 4ZHOA 1U4AA 3RNGC 3AE1B 3KH0A 4KKJA 2KD0A 4NQKE 3FILA 2KAJA 1VDVA 3N1XC 1ACCA 1AN8A 5KHOA 3L10B 4C4VB 3OAWA 2EKIA 2LZ6A 2BVCA 1P98A 2KACA 1P3QU 4DHJB 3RCZA 1FXAA 3P63A 2MA9B 2ASQA 5DPRA 1IBXB 3A9JB 4BBNF 3ZW3A 1V5OA 3R66C 3ZKJC 2OJWA 2I2YA 1P9DU 2V3PA 2UYZB 2W55A 2W3SA 3J9CA 2EKEC 4BKSD 2PKOA 3AE7B 4JWSC 4NPNA 5E6PA 4E71A 2KC2A 3PZ7A 1WWTA 4IG7B 2BW2A 1X1MA 3RUIB 2V4LA 4ANUA 2OOBB 2Z0DB 3GE3C 3P2BA 3PZDA 2BQQA 1XLPA 3NVYA 4DXAB 3M95A 4RGTA 3SFDB 4ZDVA 3V3XA 4WJNA 1FNVA 2PVOD 1FMAD 2O2VA 3AULA 2ACZB 1BXTA 2N7EA 3H7PB 2EMSA 4ITKA 4JLCA 1KFYB 2WXOA 5J17A 3BK1A 3W5UB 1FO4A 3U4EG 2AEHA 5IKCM 5HG2A 1L5PA 1YOVB 1I4RA 4M02A 4LNIA 3HM6X 1L6UA 1LQBA 2DZJA 3K9PB 2DHZA 2L3ZA 3AEFB 1N62A 4J3OD 2KFKB 4ZHPA 2BTEA 3ZVVA 3VR9B 3Q14C 1FPYA 3Q3NC 1V9JA 4HXDA 4ICUA 4RMAA 2D11A 1RAXA 1I4PA 4IWPA 2L05A 1ZDVA 1ENFA 3BZDB 5CHVC 3BVMA 2AL3A 4ZRIA 4HLEA 5KHQA 2KO3A 3V61A 1JWBD 2DENB 4USAA 2BWES 5LLIA 1YQ4B 1ZP0B 4GDKA 2VH2A 1V86A 4HROA 1ZUD2 2N4FA 3A1QA 1GNUA 2KJ6A 4MGYE 2INDC 4PS8A 4WWPA 3PSEB 5IAAC 1C4CA 2L0TA 4LCDE 3T3NA 2W82A 4AOFA 2BYEA 3ML8A 4YT0B 1YX6B 2AQ2B 4NAMA 2JWZA 3HUIA 2FUHB 2BBCA 2I1JA 2YEPB 4R3DA 4A90A 3Q8AA 2KYWA 2KX3A 1EO6A 4C56C 1I4GA 3Q8CA 3ZXRA 1QZEA 1N5WA 2LI5A 4RH6A 2FE8A 4FJYA 3CF6E 2BWFA 4WJQA 4G11A 2KDMA 4BKGA 2XNAC 3SD5A 1E8XA 2WNMA 4PYUA 1BUIC 1TZOA 1ZOYB 4IW0A 1V1PB 3L16A 1WE6A 5FR3A 2ZNVC 2PPHA 2LHDA 3SFEB 1QILA 1D4BA 1IUEA 2N9LA 3U7DA 4BOSC 4AP4C 1TS5A 2KNBA 3JSVA 1C76A 2K5PA 4B95A 2KJHB 2KQ7A 1JRUA 4GDLB 3KW5B 2WDTB 5JH5C 3AEEB 4ANWA 4KIKB 2O6VD 2PE6B 3NZ3A 3DHGC 1N61A 1VR9A 1OFFA 5HHDG 1R4MB 3ZNGC 2LUMA 1UBQA 3NVZA 2L83A 1YN3A 1DOYA 2YVCA 3Q3MC 3TMPB 2L76A 4NNJB 2RDHA 3X23A 1Q1OA 1WH3A 3FC4A 5GMVA 1GUAB 5BYQA 2Z59B 4NJCA 3QARA 1MG8A 1TKEA 4HWIB 2WXRA 3NS1A 2IPKD 4C4VA 1JRPA 3UIOB 5T8IA 1HA5A 1TS3A 1TTNA 2NPTA 4TUUA 1FEHA 2GLSA 3V62A 3AU4A 1WJ6A 2J0MA 4A6QA 2DYMA 4II3B 3SDLC 2MQJA 4FA6A 1WZ3A 2WXPA 2XK5B 3PLUA 4C7YA 5JZEB 2D07B 2GOWA 2MRPA 3QCAA 1IBXA 1PYWD 1XF5L 4KVGB 3FAHA 5IOIA 3BVGA 2MP2A 3H6NA 2QILA 2ZZPB 2WXQA 4GN1A 3W1SA 3WAOA 3TEZA 2PTLA 4L2YA 5GXGB 3P4RB 3WCQA 3KYDD 2K39A 4P1BC 4LNOA 2MCNB 4YTMB 4BBNC 5D3IB 4LDTB 2DYOA 3LXFA 5FKAC 1GJZA 1PFDA 2BPSA 3IG3A 1R4MI 2KC1A 3L4PA 1MJDA 2Y5CA 4YTPB 2NBVB 1UELA 3BIID 2D5GA 4A55A 1ISNA 1UD7A 3ZLZA
chains in the Genus database with same CATH topology
1FXTB 2NR2A 1P1AA 1WX8A 3B08A 4WJPA 4DHZE 1WRDB 2R2QA 2KN5A 2ZEQA 2PEAA 1XT9B 4EUTA 1KLVA 3DCGA 3KVFB 2ZPNA 3QA8A 4W9EA 5G2NA 2MLBA 4KDLB 3EECA 3ZNID 1WXAA 2GBNA 4X57B 2NS5A 1TBEA 4II2B 1WM3A 3APDA 3BINA 3D32A 2N9EB 3VVWB 2GMIC 3N32A 2CHZA 1WJ4A 2IO1B 4J6IA 1Y8RC 4WAAA 4FBJB 5CHFA 4F7ZA 5JHAA 2J0JA 1IP9A 4FHKA 4IWOA 3MJWA 1GG3A 1WXSA 3DBLI 1WJUA 4GSWA 3VHTC 1U4AA 1WFYA 1Q0WB 3KH0A 1NBFC 2KD0A 2N1VA 4NQKE 4BVUC 2C7MB 3UIPB 4EZLA 3QX1A 5TR5A 3SHQA 2OJRA 1V81A 5AZHA 4RM8A 4HDQA 4MGZE 3IBEA 4W9LA 1E8YA 3SU8X 3OJ3A 2C60A 1WZ0A 5EDSA 1D3ZA 5E6OA 5KHOA 2BYVE 3L10B 3WANA 2K1FA 2MBOA 3Q3JA 2R2OA 3PT2B 5DPSA 3ZDTA 3V6CB 2IY1B 3OAWA 4MELA 1T0YA 2NCNA 2KDIA 1Z2MA 4KV2A 2LZ6A 4MDKE 4B6WA 5L83A 1V49A 2CKHB 3N3KB 1IPGA 1WR6E 3CSFA 3PPAA 1P98A 2IZVB 2DAJA 1P3QU 4W9HA 4DHJB 2DZMA 4IUMB 1XQQA 4DWFA 4E74A 3ZTCA 1I42A 3TL5A 3MHSD 3RCZA 1CMXB 2MA9B 2LGXA 4WWNA 3T8MA 3A4SC 2MBEA 1WE7A 2JY6A 2W9NA 1J19A 2ASQA 2KX0A 3PRZA 5DPRA 2V3SA 3DBRI 2K25A 3A9JB 4BBNF 1AARA 2BKFA 2KJRA 2KLGA 3ZW3A 1V5OA 3R66C 3ZKJC 2PJHA 4F1SA 4YL8A 2IBIB 3A9JA 2JUOA 3ONSA 4MSQB 1P9DU 4W9FA 2UYZB 4K81A 3RD2A 3VH3B 4EFOA 2EKEC 4BKSD 2D3GA 2ZCCA 4GB9A 4LJPB 4GIVA 4A3PA 5J18A 1BT0A 1TGZB 3ZRCA 3EC8A 3JVZX 1EF1A 4NPNA 1VD2A 5E6PA 2KTRA 2KC2A 4E71A 2FAZA 2IO3B 5J2RA 3R3MA 2FCNA 2D10A 4IG7B 3VFKA 3EFUA 3NOBA 4KZ0A 1X1MA 3AI5A 1GC7A 3IHPC 4NJ6A 2KWVB 2J7QB 3L0WB 3RUIB 3RYTA 2V4LA 4FULA 4ANUA 2OOBB 2Z0DB 5C1ZA 1WX7A 4XZ4A 2LD9A 2G4DB 3P2BA 3PZDA 4I6LB 3M95A 4DXAB 1WM2A 1YD8U 3DQVA 2B3AA 2O2VB 2RSUA 4ZDVA 4A3OA 1TZ1A 2WWZA 4WJNA 1NI2A 4RM9A 1WGGA 2CR5A 2DZKA 5DPTA 3UQBA 3ENEA 2O2VA 2KMAA 3AULA 4ANXA 4FJZA 3A9KA 3VUWA 4JIOU 2DX5B 2G45B 1UH6A 2ZNVB 2LVPA 3PTFC 2N7EA 4NY0A 3H7PB 1OEYA 3WAPA 4FHJA 2RD0A 2C7HA 2RR9A 2EMSA 3ML9A 4JGHB 2REXA 4TQ0A 4JLCA 1E7VA 1XD3B 5J17A 2EMTA 1V80A 3H7PA 2JVCA 2KHWB 3HK0A 2BGFA 2KLCA 4AJYB 2I1KA 2LGYA 3PRMB 1OTRB 3ALBA 4IM3A 5D6JB 1Z5SB 2AEHA 2KDEB 2L7RA 4K7SA 4FJVB 2KFJA 3GZNI 1WYWB 2KWCA 2JZZA 2MW5A 2KOXA 2KWUB 2WX0A 4W9GA 5D7GA 4K7UA 3RT3B 2VRRB 4A20A 3B0AA 2HD5B 3HM6X 5FR6A 2XEWA 4ZRJA 1LQBA 2DZJA 3K9PB 2DHZA 2KMCA 2L3ZA 3AU5A 3APCA 4DDGD 1WGRA 2AYOB 3KUZA 3NS8A 2KFKB 4BKSA 4I6PA 2KQSA 2LXAA 3ZVVA 5CX3A 5D2MB 3M62B 1WX9A 2M1MA 2KFKA 5DCNA 1YIWA 5LXHA 3VAWA 3VTVA 3U8ZA 1V9JA 3ZNZB 4HXDA 2LJ5A 1RFAA 3PHXB 2HTHA 4ICUA 4ICVA 2RPQA 2FCMA 4RMAA 2JRIB 2ZJDA 2D11A 1YJ1A 1RAXA 1RRBA 3L08A 4IWPA 2L05A 3NZSA 3VQIA 1ZW7A 3QC8B 1WJNA 4GGQA 2LGDA 2YLMA 4EZJA 4KZCA 5CHVC 3PGEA 4ZRIA 2AL3A 4HLEA 5KHQA 2KO3A 3V61A 1C3TA 3ZRFA 4KDIC 2DENB 2L0FA 4CO7A 3UQAA 3ZNHB 1L7YA 2BWES 4LDTD 4P7IA 5AZGA 4ASWC 4W9KA 3TJPA 5LLIA 3PVLA 2FCQA 4WJOA 2MX2A 3A1QB 2BYFA 3RULA 4GDKA 2KDFB 3PLVA 1V86A 3NHEB 1UBIA 2WX1A 2KXJA 1WMHB 3PS6A 3VDZA 2L8JA 2N4FA 4HCNB 4NAWA 3A1QA 3KUCB 3RZWC 1GNUA 2ZPYA 3ZDMC 2K6DB 1WMHA 2KJ6A 4MGYE 1F9JA 4B9KA 1P0RA 4PS8A 1S3SG 2JXXA 3B1LX 3PSEB 2KTRB 4WWPA 5IAAC 4MEMA 4NJ7A 3WA0A 4JQWC 2C5LC 2L0TA 2C7NB 4BKTA 4LCDE 1NDDA 2AL6A 3IFWB 4IM0A 2WYQA 4AOFA 4G0NB 4G50A 2BF8B 3AXCA 2K8CA 5C23A 2BYEA 1ZKHA 2KZRA 2M17A 3ML8A 1YX6B 3DPDA 3LDZE 3VTUA 4FADA 2JWZA 2A5UA 2FUHB 3WAMA 2I1JA 4HCPB 5BO4B 2K8HA 1RLFA 5DPWA 1WGDA 2NVUI 4IC7B 3W1SC 2G3QB 2KX3A 3A33B 4EKUA 1EO6A 4DDID 3QK0A 2GBJA 3DVNV 3ECIA 3ZTDA 3L13A 1UGMA 2KANA 2J0KA 3ZIMA 1QZEA 3A9KB 3A4RA 1E5WA 1YQBA 1VCBA 2LI5A 2A4ZA 3CMMB 5CHWA 2D2QA 3HM3A 2IO2B 1SE9A 1KM7A 4EEWA 2FIDA 4FJYA 4K1RB 3CF6E 2BWFA 4ANVA 5L95C 2XBBC 1G6JA 2NBUA 4WJQA 4G11A 3S2AA 3I3TB 4HVBA 2HE7A 1OEYJ 4OVUA 4BKGA 3HHMA 3TBLD 2GBKA 3SD5A 2LVOA 1GC6A 4WQOB 1E8XA 3DDCB 2N1WA 1V2YA 2M8SA 1J8CA 4PYUA 2LWPA 2CS4A 1EUVB 3VTWA 2KK8A 4I6NB 4IW0A 4DHZB 3L54A 4W9IA 3KYCD 4HPLB 3L16A 1WE6A 4AWJA 3JYUA 4M8NA 2BKRB 4G3XB 4IWQA 4MJSA 4PS3A 5E6NA 2ZNVC 2PPHA 2LUEA 4NQLB 3DVGY 4EOYA 2MSED 2JT4B 3H1UA 3L17A 4GU2A 3U7DA 5IA7A 1KJTA 2NBWB 4BOSC 4AP4C 3UINB 1J0GA 2KNBA 1C1YB 3JSVA 3T9LA 1WR1A 4B95A 2MBHA 2KJHB 3QQ8B 2JPHA 2KQ7A 4HDOA 1JRUA 4GDLB 2L00B 3OJ4B 5JHBA 2ZVNA 2JZ3B 3VH4B 3LJ3A 3KW5B 1SIFA 2WDTB 1KOTA 5JH5C 1L2NA 2KKCA 4JL9A 2HJ8A 2FCSA 1WIAA 2FNJB 2IO0B 2LASA 2ZCBA 3CSTA 3IVFA 3PV1A 4GDLA 4PS7A 4ANWA 4DK5A 2V1YA 4M0WB 3UGBB 2DYBA 4KIKB 2O6VD 3PHWB 2PE6B 1OGWA 4BFRA 1WXMA 2KTFA 3C0RB 4KIKA 3ZNGC 1UBQA 3WIMA 3M3JA 3VUXA 3GOEA 3H9DA 1UZXB 4GMVA 4TV3A 4XX5A 2LRUA 1H4RA 4MGKE 1S1QB 1LFDA 2K8BA 1Q5WB 3V60A 2YVCA 3OLMD 3TMPB 2L76A 5D94A 4NNJB 1A5RA 4HPMB 3VXWA 3W1YA 1Q1OA 3V6EB 3X23A 1WH3A 3EHVA 4FLHA 3X0WA 4OVVA 3O65B 1YX5B 2MBBB 1PQSA 4GDKB 5GMVA 2ZVOA 1GUAB 2CU1A 4K7WA 4MSMB 4W9DA 1WGYA 4GXBA 2KDBA 2Z59B 3PREA 4NAWB 4WWOA 4ZYNA 1WY8A 3QARA 4LJOB 1MG8A 4E3CA 3N30A 4HWIB 2NPTB 2DAFA 3DVGX 4FN2A 3ZUNA 5LXIB 4CYEA 4IM2A 1WF9A 4W9CA 2N9PC 3QHTA 4XC2A 3UIOB 1TTNA 4URKA 2NPTA 4TUUA 1E8ZA 4HJKA 3V62A 3ZO5B 3AU4A 2UWQA 1WJ6A 1LXDA 2J0MA 2DYMA 2JF5A 4II3B 4TKNA 3SDLC 2MQJA 3UF8A 4FA6A 1WZ3A 3HIZA 2M4NA 4PYZA 3TIXA 2XK5B 3WALA 4MM3A 2QHOA 3PLUA 2IYDB 4KSLC 5JZEB 3QWZB 2D07B 1M94A 2XK5A 4ZRKA 2GOWA 2MP2B 2MRPA 3QCAA 3QAQA 4AJWA 2Z0EB 4AUQC 1HE8A 5HKHA 3QIJA 4KVGB 4EZKA 5AZFA 3DBSA 3TCAA 2O6VB 2MP2A 3R7RA 1E7UA 2Y5BB 2LVQA 3H6NA 5AEKB 2ZZPB 4GN1A 4TQ1A 2O6VA 2KVRA 3K9OB 4MH0E 3U30A 1E8WA 3W1SA 4N9F4 2GBRA 4BOZB 3WAOA 3NZUA 2FIFA 3PRPB 3KYDD 2K39A 1WXVA 2JRHA 2PE9A 3DOWA 3R7QA 2MCNB 4GOCA 3VUYA 2N9XA 1IYFA 4W9JA 2IY0B 3RZFA 1WI0A 1I35A 3BY4B 3NY5A 3DVNU 4MGIE 4BBNC 2MWSB 1V6EA 2GBMA 5CTRC 4CHKA 2DZIA 4LDTB 2DYOA 2N7DA 1V5TA 1ZGUB 2MBQA 3Q3FA 3APFA 1OQYA 2C9WB 2LXCA 3KUDB 4MJSB 1H8CA 3DBHI 1R4NI 2G4SA 2M0XA 1GJZA 2RGFA 3MTNB 2BPSA 5G55A 1WGHA 1R4MI 2LRWA 3IG3A 2KC1A 2K6QA 4F8CB 3H7SA 2CHWA 3JSVB 4M8MA 4DHJD 1EF5A 1K8RB 3JW0X 2NBVB 3M63B 4HK2A 4KSKC 4DBGA 1LM8B 1E90A 1UELA 1SGHA 2AWTA 2CHXA 1ISNA 3QJZA 1UD7A 3ZLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXT B;  2NR2 A;  1P1A A;  1WX8 A;  3B08 A;  4WJP A;  4DHZ E;  1WRD B;  2R2Q A;  2KN5 A;  2ZEQ A;  2PEA A;  1XT9 B;  4EUT A;  1KLV A;  3DCG A;  3KVF B;  2ZPN A;  3QA8 A;  4W9E A;  5G2N A;  2MLB A;  4KDL B;  3EEC A;  3ZNI D;  1WXA A;  2GBN A;  4X57 B;  2NS5 A;  1TBE A;  4II2 B;  1WM3 A;  3APD A;  3BIN A;  3D32 A;  2N9E B;  3VVW B;  2GMI C;  3N32 A;  2CHZ A;  1WJ4 A;  2IO1 B;  4J6I A;  1Y8R C;  4WAA A;  4FBJ B;  5CHF A;  4F7Z A;  5JHA A;  2J0J A;  1IP9 A;  4FHK A;  4IWO A;  3MJW A;  1GG3 A;  1WXS A;  3DBL I;  1WJU A;  4GSW A;  3VHT C;  1U4A A;  1WFY A;  1Q0W B;  3KH0 A;  1NBF C;  2KD0 A;  2N1V A;  4NQK E;  4BVU C;  2C7M B;  3UIP B;  4EZL A;  3QX1 A;  5TR5 A;  3SHQ A;  2OJR A;  1V81 A;  5AZH A;  4RM8 A;  4HDQ A;  4MGZ E;  3IBE A;  4W9L A;  1E8Y A;  3SU8 X;  3OJ3 A;  2C60 A;  1WZ0 A;  5EDS A;  1D3Z A;  5E6O A;  5KHO A;  2BYV E;  3L10 B;  3WAN A;  2K1F A;  2MBO A;  3Q3J A;  2R2O A;  3PT2 B;  5DPS A;  3ZDT A;  3V6C B;  2IY1 B;  3OAW A;  4MEL A;  1T0Y A;  2NCN A;  2KDI A;  1Z2M A;  4KV2 A;  2LZ6 A;  4MDK E;  4B6W A;  5L83 A;  1V49 A;  2CKH B;  3N3K B;  1IPG A;  1WR6 E;  3CSF A;  3PPA A;  1P98 A;  2IZV B;  2DAJ A;  1P3Q U;  4W9H A;  4DHJ B;  2DZM A;  4IUM B;  1XQQ A;  4DWF A;  4E74 A;  3ZTC A;  1I42 A;  3TL5 A;  3MHS D;  3RCZ A;  1CMX B;  2MA9 B;  2LGX A;  4WWN A;  3T8M A;  3A4S C;  2MBE A;  1WE7 A;  2JY6 A;  2W9N A;  1J19 A;  2ASQ A;  2KX0 A;  3PRZ A;  5DPR A;  2V3S A;  3DBR I;  2K25 A;  3A9J B;  4BBN F;  1AAR A;  2BKF A;  2KJR A;  2KLG A;  3ZW3 A;  1V5O A;  3R66 C;  3ZKJ C;  2PJH A;  4F1S A;  4YL8 A;  2IBI B;  3A9J A;  2JUO A;  3ONS A;  4MSQ B;  1P9D U;  4W9F A;  2UYZ B;  4K81 A;  3RD2 A;  3VH3 B;  4EFO A;  2EKE C;  4BKS D;  2D3G A;  2ZCC A;  4GB9 A;  4LJP B;  4GIV A;  4A3P A;  5J18 A;  1BT0 A;  1TGZ B;  3ZRC A;  3EC8 A;  3JVZ X;  1EF1 A;  4NPN A;  1VD2 A;  5E6P A;  2KTR A;  2KC2 A;  4E71 A;  2FAZ A;  2IO3 B;  5J2R A;  3R3M A;  2FCN A;  2D10 A;  4IG7 B;  3VFK A;  3EFU A;  3NOB A;  4KZ0 A;  1X1M A;  3AI5 A;  1GC7 A;  3IHP C;  4NJ6 A;  2KWV B;  2J7Q B;  3L0W B;  3RUI B;  3RYT A;  2V4L A;  4FUL A;  4ANU A;  2OOB B;  2Z0D B;  5C1Z A;  1WX7 A;  4XZ4 A;  2LD9 A;  2G4D B;  3P2B A;  3PZD A;  4I6L B;  3M95 A;  4DXA B;  1WM2 A;  1YD8 U;  3DQV A;  2B3A A;  2O2V B;  2RSU A;  4ZDV A;  4A3O A;  1TZ1 A;  2WWZ A;  4WJN A;  1NI2 A;  4RM9 A;  1WGG A;  2CR5 A;  2DZK A;  5DPT A;  3UQB A;  3ENE A;  2O2V A;  2KMA A;  3AUL A;  4ANX A;  4FJZ A;  3A9K A;  3VUW A;  4JIO U;  2DX5 B;  2G45 B;  1UH6 A;  2ZNV B;  2LVP A;  3PTF C;  2N7E A;  4NY0 A;  3H7P B;  1OEY A;  3WAP A;  4FHJ A;  2RD0 A;  2C7H A;  2RR9 A;  2EMS A;  3ML9 A;  4JGH B;  2REX A;  4TQ0 A;  4JLC A;  1E7V A;  1XD3 B;  5J17 A;  2EMT A;  1V80 A;  3H7P A;  2JVC A;  2KHW B;  3HK0 A;  2BGF A;  2KLC A;  4AJY B;  2I1K A;  2LGY A;  3PRM B;  1OTR B;  3ALB A;  4IM3 A;  5D6J B;  1Z5S B;  2AEH A;  2KDE B;  2L7R A;  4K7S A;  4FJV B;  2KFJ A;  3GZN I;  1WYW B;  2KWC A;  2JZZ A;  2MW5 A;  2KOX A;  2KWU B;  2WX0 A;  4W9G A;  5D7G A;  4K7U A;  3RT3 B;  2VRR B;  4A20 A;  3B0A A;  2HD5 B;  3HM6 X;  5FR6 A;  2XEW A;  4ZRJ A;  1LQB A;  2DZJ A;  3K9P B;  2DHZ A;  2KMC A;  2L3Z A;  3AU5 A;  3APC A;  4DDG D;  1WGR A;  2AYO B;  3KUZ A;  3NS8 A;  2KFK B;  4BKS A;  4I6P A;  2KQS A;  2LXA A;  3ZVV A;  5CX3 A;  5D2M B;  3M62 B;  1WX9 A;  2M1M A;  2KFK A;  5DCN A;  1YIW A;  5LXH A;  3VAW A;  3VTV A;  3U8Z A;  1V9J A;  3ZNZ B;  4HXD A;  2LJ5 A;  1RFA A;  3PHX B;  2HTH A;  4ICU A;  4ICV A;  2RPQ A;  2FCM A;  4RMA A;  2JRI B;  2ZJD A;  2D11 A;  1YJ1 A;  1RAX A;  1RRB A;  3L08 A;  4IWP A;  2L05 A;  3NZS A;  3VQI A;  1ZW7 A;  3QC8 B;  1WJN A;  4GGQ A;  2LGD A;  2YLM A;  4EZJ A;  4KZC A;  5CHV C;  3PGE A;  4ZRI A;  2AL3 A;  4HLE A;  5KHQ A;  2KO3 A;  3V61 A;  1C3T A;  3ZRF A;  4KDI C;  2DEN B;  2L0F A;  4CO7 A;  3UQA A;  3ZNH B;  1L7Y A;  2BWE S;  4LDT D;  4P7I A;  5AZG A;  4ASW C;  4W9K A;  3TJP A;  5LLI A;  3PVL A;  2FCQ A;  4WJO A;  2MX2 A;  3A1Q B;  2BYF A;  3RUL A;  4GDK A;  2KDF B;  3PLV A;  1V86 A;  3NHE B;  1UBI A;  2WX1 A;  2KXJ A;  1WMH B;  3PS6 A;  3VDZ A;  2L8J A;  2N4F A;  4HCN B;  4NAW A;  3A1Q A;  3KUC B;  3RZW C;  1GNU A;  2ZPY A;  3ZDM C;  2K6D B;  1WMH A;  2KJ6 A;  4MGY E;  1F9J A;  4B9K A;  1P0R A;  4PS8 A;  1S3S G;  2JXX A;  3B1L X;  3PSE B;  2KTR B;  4WWP A;  5IAA C;  4MEM A;  4NJ7 A;  3WA0 A;  4JQW C;  2C5L C;  2L0T A;  2C7N B;  4BKT A;  4LCD E;  1NDD A;  2AL6 A;  3IFW B;  4IM0 A;  2WYQ A;  4AOF A;  4G0N B;  4G50 A;  2BF8 B;  3AXC A;  2K8C A;  5C23 A;  2BYE A;  1ZKH A;  2KZR A;  2M17 A;  3ML8 A;  1YX6 B;  3DPD A;  3LDZ E;  3VTU A;  4FAD A;  2JWZ A;  2A5U A;  2FUH B;  3WAM A;  2I1J A;  4HCP B;  5BO4 B;  2K8H A;  1RLF A;  5DPW A;  1WGD A;  2NVU I;  4IC7 B;  3W1S C;  2G3Q B;  2KX3 A;  3A33 B;  4EKU A;  1EO6 A;  4DDI D;  3QK0 A;  2GBJ A;  3DVN V;  3ECI A;  3ZTD A;  3L13 A;  1UGM A;  2KAN A;  2J0K A;  3ZIM A;  1QZE A;  3A9K B;  3A4R A;  1E5W A;  1YQB A;  1VCB A;  2LI5 A;  2A4Z A;  3CMM B;  5CHW A;  2D2Q A;  3HM3 A;  2IO2 B;  1SE9 A;  1KM7 A;  4EEW A;  2FID A;  4FJY A;  4K1R B;  3CF6 E;  2BWF A;  4ANV A;  5L95 C;  2XBB C;  1G6J A;  2NBU A;  4WJQ A;  4G11 A;  3S2A A;  3I3T B;  4HVB A;  2HE7 A;  1OEY J;  4OVU A;  4BKG A;  3HHM A;  3TBL D;  2GBK A;  3SD5 A;  2LVO A;  1GC6 A;  4WQO B;  1E8X A;  3DDC B;  2N1W A;  1V2Y A;  2M8S A;  1J8C A;  4PYU A;  2LWP A;  2CS4 A;  1EUV B;  3VTW A;  2KK8 A;  4I6N B;  4IW0 A;  4DHZ B;  3L54 A;  4W9I A;  3KYC D;  4HPL B;  3L16 A;  1WE6 A;  4AWJ A;  3JYU A;  4M8N A;  2BKR B;  4G3X B;  4IWQ A;  4MJS A;  4PS3 A;  5E6N A;  2ZNV C;  2PPH A;  2LUE A;  4NQL B;  3DVG Y;  4EOY A;  2MSE D;  2JT4 B;  3H1U A;  3L17 A;  4GU2 A;  3U7D A;  5IA7 A;  1KJT A;  2NBW B;  4BOS C;  4AP4 C;  3UIN B;  1J0G A;  2KNB A;  1C1Y B;  3JSV A;  3T9L A;  1WR1 A;  4B95 A;  2MBH A;  2KJH B;  3QQ8 B;  2JPH A;  2KQ7 A;  4HDO A;  1JRU A;  4GDL B;  2L00 B;  3OJ4 B;  5JHB A;  2ZVN A;  2JZ3 B;  3VH4 B;  3LJ3 A;  3KW5 B;  1SIF A;  2WDT B;  1KOT A;  5JH5 C;  1L2N A;  2KKC A;  4JL9 A;  2HJ8 A;  2FCS A;  1WIA A;  2FNJ B;  2IO0 B;  2LAS A;  2ZCB A;  3CST A;  3IVF A;  3PV1 A;  4GDL A;  4PS7 A;  4ANW A;  4DK5 A;  2V1Y A;  4M0W B;  3UGB B;  2DYB A;  4KIK B;  2O6V D;  3PHW B;  2PE6 B;  1OGW A;  4BFR A;  1WXM A;  2KTF A;  3C0R B;  4KIK A;  3ZNG C;  1UBQ A;  3WIM A;  3M3J A;  3VUX A;  3GOE A;  3H9D A;  1UZX B;  4GMV A;  4TV3 A;  4XX5 A;  2LRU A;  1H4R A;  4MGK E;  1S1Q B;  1LFD A;  2K8B A;  1Q5W B;  3V60 A;  2YVC A;  3OLM D;  3TMP B;  2L76 A;  5D94 A;  4NNJ B;  1A5R A;  4HPM B;  3VXW A;  3W1Y A;  1Q1O A;  3V6E B;  3X23 A;  1WH3 A;  3EHV A;  4FLH A;  3X0W A;  4OVV A;  3O65 B;  1YX5 B;  2MBB B;  1PQS A;  4GDK B;  5GMV A;  2ZVO A;  1GUA B;  2CU1 A;  4K7W A;  4MSM B;  4W9D A;  1WGY A;  4GXB A;  2KDB A;  2Z59 B;  3PRE A;  4NAW B;  4WWO A;  4ZYN A;  1WY8 A;  3QAR A;  4LJO B;  1MG8 A;  4E3C A;  3N30 A;  4HWI B;  2NPT B;  2DAF A;  3DVG X;  4FN2 A;  3ZUN A;  5LXI B;  4CYE A;  4IM2 A;  1WF9 A;  4W9C A;  2N9P C;  3QHT A;  4XC2 A;  3UIO B;  1TTN A;  4URK A;  2NPT A;  4TUU A;  1E8Z A;  4HJK A;  3V62 A;  3ZO5 B;  3AU4 A;  2UWQ A;  1WJ6 A;  1LXD A;  2J0M A;  2DYM A;  2JF5 A;  4II3 B;  4TKN A;  3SDL C;  2MQJ A;  3UF8 A;  4FA6 A;  1WZ3 A;  3HIZ A;  2M4N A;  4PYZ A;  3TIX A;  2XK5 B;  3WAL A;  4MM3 A;  2QHO A;  3PLU A;  2IYD B;  4KSL C;  5JZE B;  3QWZ B;  2D07 B;  1M94 A;  2XK5 A;  4ZRK A;  2GOW A;  2MP2 B;  2MRP A;  3QCA A;  3QAQ A;  4AJW A;  2Z0E B;  4AUQ C;  1HE8 A;  5HKH A;  3QIJ A;  4KVG B;  4EZK A;  5AZF A;  3DBS A;  3TCA A;  2O6V B;  2MP2 A;  3R7R A;  1E7U A;  2Y5B B;  2LVQ A;  3H6N A;  5AEK B;  2ZZP B;  4GN1 A;  4TQ1 A;  2O6V A;  2KVR A;  3K9O B;  4MH0 E;  3U30 A;  1E8W A;  3W1S A;  4N9F 4;  2GBR A;  4BOZ B;  3WAO A;  3NZU A;  2FIF A;  3PRP B;  3KYD D;  2K39 A;  1WXV A;  2JRH A;  2PE9 A;  3DOW A;  3R7Q A;  2MCN B;  4GOC A;  3VUY A;  2N9X A;  1IYF A;  4W9J A;  2IY0 B;  3RZF A;  1WI0 A;  1I35 A;  3BY4 B;  3NY5 A;  3DVN U;  4MGI E;  4BBN C;  2MWS B;  1V6E A;  2GBM A;  5CTR C;  4CHK A;  2DZI A;  4LDT B;  2DYO A;  2N7D A;  1V5T A;  1ZGU B;  2MBQ A;  3Q3F A;  3APF A;  1OQY A;  2C9W B;  2LXC A;  3KUD B;  4MJS B;  1H8C A;  3DBH I;  1R4N I;  2G4S A;  2M0X A;  1GJZ A;  2RGF A;  3MTN B;  2BPS A;  5G55 A;  1WGH A;  1R4M I;  2LRW A;  3IG3 A;  2KC1 A;  2K6Q A;  4F8C B;  3H7S A;  2CHW A;  3JSV B;  4M8M A;  4DHJ D;  1EF5 A;  1K8R B;  3JW0 X;  2NBV B;  3M63 B;  4HK2 A;  4KSK C;  4DBG A;  1LM8 B;  1E90 A;  1UEL A;  1SGH A;  2AWT A;  2CHX A;  1ISN A;  3QJZ A;  1UD7 A;  3ZLZ A; 
#chains in the Genus database with same CATH topology
 2NR2 A;  4OZA A;  2R2Q A;  1HXY D;  2KN5 A;  1XT9 B;  1TY2 A;  3Q8E A;  2PMV A;  2MLB A;  1ZXH A;  4KDL B;  3ZNI D;  1WXA A;  2GRI A;  4II2 B;  2J52 A;  2N9E B;  2PIA A;  1SSN A;  1WJ4 A;  4FBJ B;  5JHA A;  1IP9 A;  4IWO A;  1GG3 A;  1WXS A;  2BB6 A;  3VHT C;  2KWD A;  3E56 A;  1Q0W B;  4L1B A;  4BVU C;  2C7M B;  3UIP B;  4EZL A;  4KGT A;  1V81 A;  1FRR A;  1R7S A;  1YQ3 B;  2QSD A;  4RM8 A;  4MGZ E;  3GZN B;  2C60 A;  1WZ0 A;  4IDI A;  5EDS A;  4WIP A;  2BYV E;  2MBO A;  2Z8L A;  5DPS A;  1T0Y A;  2NCN A;  1Z2M A;  1YMH E;  2JX5 A;  4MDK E;  4ZRP A;  5L83 A;  1V49 A;  4ARI A;  4NZL B;  1WR6 E;  3TEY A;  3TEW A;  3N9Y C;  2DZM A;  4WQM A;  3TL5 A;  3MHS D;  1GAQ B;  4WWN A;  2MBE A;  2HDE A;  2W9N A;  2KX0 A;  3PRZ A;  2QIE B;  1VRA B;  2KN4 A;  2KLG A;  1FNW A;  3U52 E;  2IBI B;  4MSQ B;  3ONS A;  4W9F A;  4K81 A;  3RD2 A;  2HTM E;  4GB9 A;  4LJP B;  1XLN A;  5EE3 A;  1TGZ B;  1CQV A;  3P1M A;  3JVZ X;  1EF1 A;  2PLP A;  4HEA 1;  1VD2 A;  2IO3 B;  3R3M A;  5AUK A;  2FCN A;  2D10 A;  4OW0 A;  1HEZ E;  3NOB A;  4KZ0 A;  4NJ6 A;  4FUL A;  4K3B A;  1WX7 A;  4XZ4 A;  1TY0 A;  3RPF C;  2G4D B;  3GB1 A;  1YJJ A;  2RSU A;  3MHZ A;  4XYC A;  1C4P A;  1EM7 A;  2DZK A;  3AE2 B;  2KMA A;  4XWW A;  2DX5 B;  4HPP A;  2N7J A;  2M56 B;  3WAP A;  3PTF C;  3RNF C;  2RR9 A;  4JGH B;  3RFZ B;  1E7V A;  1C77 A;  1QT9 A;  1V80 A;  3RNA C;  2KHW B;  1YN4 A;  4AJY B;  4LTU A;  3B2F A;  1OTR B;  4IM3 A;  4PK1 A;  1Z5S B;  2L7R A;  2KFJ A;  3GZN I;  3GE8 C;  4QAY A;  2KWC A;  2JZZ A;  2WXM A;  1P7F A;  1V1P A;  2IJ0 A;  5D7G A;  4K7U A;  3VR8 B;  3B0A A;  3AU5 A;  1KTK A;  1KLG D;  2RDG A;  4XGA B;  4XWT A;  2KQS A;  5CX3 A;  5D2M B;  2DLB A;  1WX9 A;  4OHJ A;  2M1M A;  3N1Z C;  5DCN A;  3VTV A;  3U8Z A;  3N1Y C;  1FFU A;  3ZNZ B;  4B0E A;  2FCM A;  2GB1 A;  2JRI B;  2ZJD A;  4DXF A;  1V1O A;  4ZOH C;  3OWE B;  1T0Q C;  3NZS A;  1ZW7 A;  3NVV A;  4GGQ A;  2YLM A;  4EZJ A;  4RCO A;  2INC C;  1C3T A;  1PDX A;  4MAC A;  2L0F A;  4CO7 A;  3UQA A;  3B2G A;  1I4H A;  4P7I A;  2IGD A;  3TJP A;  2FCQ A;  4WJO A;  2HJ1 A;  3PLV A;  2LGS A;  2WX1 A;  3VDZ A;  3E9S A;  2ZW0 A;  2WXI A;  4ZRQ A;  1WMH A;  4MH8 A;  1S3S G;  2KTR B;  4MEM A;  4NJ7 A;  1FRD A;  1IGD A;  3B9J A;  4BKT A;  2SEB D;  1UWX A;  4YTN B;  3AM9 A;  2M17 A;  3DPD A;  1C79 A;  1D5X C;  2A5U A;  3WAM A;  2K8H A;  3IAM 1;  3NJT A;  5DPW A;  2LJI A;  4IC7 B;  2WDR B;  1TKG A;  3QK0 A;  4DDI D;  2LHE A;  3DVN V;  4YXD B;  3ZTD A;  2AX5 A;  1AW7 A;  1UGM A;  2KAN A;  4UDU C;  3A4R A;  1VCB A;  2A4Z A;  3DHH C;  3TUO A;  1SE9 A;  3BK2 A;  3Q8B A;  2FID A;  2WXK A;  4K1R B;  4ANV A;  3V05 A;  2HE7 A;  2H88 B;  4RGM A;  2LVO A;  4WQO B;  2N1W A;  1QKZ A;  1QF6 A;  3VTW A;  4I6N B;  4DHZ B;  3L54 A;  2OED A;  3P4P B;  3NRZ A;  1CK1 A;  4PS3 A;  4MT5 A;  1M4V A;  2LUE A;  3RNB C;  3FKY A;  4GU2 A;  5IA7 A;  2N0S B;  1TJE A;  1C1Y B;  3T9L A;  1K53 A;  3ZQ4 A;  3Q2A C;  2JPH A;  2QDF A;  3DHI C;  2L00 B;  2CU3 A;  3LJ3 A;  1PGX A;  1CZP A;  1SIF A;  1KOT A;  4JL9 A;  2HJ8 A;  1E10 A;  1WIA A;  2FNJ B;  2IO0 B;  2LAS A;  4DK5 A;  4M0W A;  3WIM A;  3H9D A;  5HFY A;  4GMV A;  2G1E A;  4MGK E;  1S1Q B;  4OVZ A;  1L0Y B;  5D94 A;  2QEJ C;  4HPM B;  3V6E B;  3EHV A;  4FLH A;  4OVV A;  4K7W A;  4W9D A;  3KWV A;  4TSS A;  4LJO B;  2MEK A;  3AE5 B;  2JWU A;  4FN2 A;  3ZUN A;  1SJE D;  1SJH D;  4BZA A;  2V9H A;  1WF9 A;  4IM2 A;  4W9C A;  4KGS A;  2N9P C;  3QHT A;  1FD6 A;  3ZO5 B;  1LXD A;  2JF5 A;  1J7A A;  3UF8 A;  3DBL B;  4M01 A;  5BYS A;  1SXT A;  2EEL A;  3AH7 A;  2JQR B;  3QWZ B;  4LLG M;  1M94 A;  3LB8 C;  1EWY C;  1F2R C;  4AJW A;  2FBW B;  2O6V B;  3R7R A;  1T6B X;  2D3A A;  3AN1 A;  3HVZ A;  2LVQ A;  1KH0 A;  2KVR A;  3K9O B;  4MH0 E;  3P42 A;  4N9F 4;  3C19 A;  2IDY A;  3R7Q A;  4GOC A;  4S17 A;  3MP9 A;  3NY5 A;  1VZ6 A;  5BMG A;  5CTR C;  1ZPS A;  2GBM A;  4OZC A;  2N7D A;  1WYG A;  3KUD B;  4MJS B;  1XCQ L;  1H8C A;  4CQN A;  1WGH A;  4HJG E;  1EF5 A;  1K8R B;  4HK2 A;  2D3B A;  1E90 A;  1SGH A;  2AWT A;  3ZXV A;  3QJZ A;  2WXN A;  1FXT B;  3B08 A;  1P1A A;  4DHZ E;  4IKG A;  1WRD B;  2ZEQ A;  5EE9 A;  1JWA D;  2ZPN A;  1SEB D;  2WS3 B;  1ET9 A;  2J53 A;  1HZ5 A;  1C9F A;  1UUP A;  1ZDX A;  3I5J C;  2GBN A;  1TBE A;  4XDC A;  2Y3A A;  2QMT A;  2SAK A;  3D32 A;  3VVW B;  2WU5 B;  3ZJT A;  5BMH A;  2IO1 B;  3AE9 B;  3FIL B;  5CHF A;  2MH7 A;  3DBL I;  2DNF A;  1WFY A;  1NYR A;  1SIJ A;  3QX1 A;  5TR5 A;  4JPS A;  3SHQ A;  2NMQ A;  5AZH A;  1MPE A;  5TSS A;  3URY A;  1MHH E;  2E6X A;  3OJ3 A;  2M19 A;  1D3Z A;  3CIR B;  2K1F A;  2ONQ A;  3Q3J A;  4ACF A;  4LNN A;  2R2O A;  3ZDT A;  3V6C B;  4MEL A;  2WXF A;  2KDI A;  4KV2 A;  1XXG A;  2K9X A;  1ZXI A;  3N3K B;  1NYQ A;  5C2T B;  4W9H A;  4IUM B;  1D6E C;  1XQQ A;  4E74 A;  3ZTC A;  4RGN A;  2LGX A;  1WE7 A;  4M00 A;  4IOI E;  2WLB A;  2K25 A;  4EE2 A;  1AAR A;  2BKF A;  2KJR A;  4YL8 A;  3A9J A;  3ZJV A;  3AEC B;  3VH3 B;  2D3G A;  1DOI A;  4A3P A;  4P1C C;  4OZB A;  3EC8 A;  2INP E;  1HQR D;  4RF0 A;  2KTR A;  2FAZ A;  5J2R A;  4H2A A;  1MI0 A;  3AI5 A;  1GC7 A;  3IHP C;  4B0M A;  2KWV B;  2J7Q B;  3RYT A;  3IT6 B;  1PUT A;  5C1Z A;  3Q3O C;  1N6Z A;  1AWD A;  2LD9 A;  3ETR A;  2KVZ A;  3T3O A;  4I6L B;  1YD8 U;  2B3A A;  2O2V B;  2DBY A;  1L0X B;  2WWZ A;  2JSV X;  1NI2 A;  1WGG A;  2CR5 A;  3N20 C;  3ENE A;  2L52 A;  2G45 B;  2ZNV B;  4NY0 A;  2LVP A;  1E6E B;  2C7H A;  2PVG C;  1XD3 B;  2H89 B;  3H7P A;  2X38 A;  2JVC A;  1SF0 A;  3HK0 A;  2BGF A;  2KLC A;  2LGY A;  4YWG G;  2KT7 A;  2RPV A;  4K7S A;  4FJV B;  2G9H D;  2VZK D;  3SEB A;  1L0V B;  2K22 A;  3IXS A;  1WYW B;  1JWU D;  5JXV A;  2WX0 A;  2RDB C;  3LYY A;  2KMM A;  4A20 A;  2HD5 B;  2J42 A;  1JWM D;  4ZRJ A;  2ON8 A;  4JWU C;  3APC A;  4DDG D;  1WGR A;  2AYO B;  3KUZ A;  3UI3 A;  3AE4 B;  2NTT A;  1TS4 A;  1RWS A;  1XLQ A;  3M62 B;  1L4Z B;  2KFK A;  1RM6 C;  5LXH A;  5MPO A;  1N60 A;  1VZ7 A;  3VAW A;  2OHF A;  4ZYS A;  3VRA B;  2LJ5 A;  3PHX B;  3EUB 2;  2HTH A;  5HI1 A;  2RPQ A;  2M0A A;  3Q6B A;  3KLS X;  3L08 A;  3VQI A;  3R8B A;  1UWM A;  5E6J A;  1WJN A;  1E9M A;  3PGE A;  2QC8 A;  3ZRF A;  2VH1 A;  3ZNH B;  4LDT D;  4ASW C;  4W9K A;  2BT6 A;  1C78 A;  1RYJ A;  3PVL A;  2MX2 A;  2WXG A;  3A1Q B;  2BYF A;  2KDF B;  3NHE B;  4LNF A;  1JWS D;  2BB5 A;  2KXJ A;  4HRS A;  1F77 A;  1QLB B;  4HCN B;  2L8J A;  3KQ4 A;  2JZP A;  3KUC B;  1A70 A;  2K6D B;  5G5G A;  4B9K A;  1P0R A;  2JXX A;  3B1L X;  4S0R A;  3WA0 A;  4JQW C;  2C5L C;  2C7N B;  1NDD A;  2ZW1 A;  4G0N B;  2BF8 B;  4KX6 B;  3AXC A;  5C3J B;  5C23 A;  2ICI A;  3LDZ E;  4K3C A;  2JYE A;  1RLF A;  2FUG 1;  2NVU I;  3W1S C;  2G3Q B;  2CJO A;  3A33 B;  3C8Y A;  1JCK B;  4EKU A;  2V0G A;  2GBJ A;  3ECI A;  3L13 A;  2J0K A;  2RMM A;  3ZIM A;  3A9K B;  1F52 A;  5H92 C;  1YQB A;  3CMM B;  1JAL A;  5CHW A;  3W9C B;  3HM3 A;  2IO2 B;  1LO5 D;  4EEW A;  1QQR A;  2NBU A;  2JXT A;  1IGC A;  3S2A A;  3I3T B;  4JE3 B;  1OEY J;  2L1A A;  4OVU A;  1TS2 A;  3HHM A;  2GBK A;  1GC6 A;  4P16 A;  1HZ6 A;  3DDC B;  1J8C A;  1L4D B;  2LWP A;  1EUV B;  3AV8 A;  4W9I A;  2I38 A;  3KYC D;  5BYR A;  4AWJ A;  3W5V B;  3JYU A;  4G3X B;  1NEK B;  4MJS A;  5E6N A;  3I63 C;  3NUH B;  3P4Q B;  4NQL B;  4EOY A;  2MSE D;  3H1U A;  3L17 A;  1KJT A;  3I57 A;  3UIN B;  3MC8 A;  4C7Z A;  1J0G A;  3MC9 A;  1WR1 A;  1UF0 A;  2JZ3 B;  3VH4 B;  1GPX A;  3GP7 A;  1GB1 A;  2INN E;  1FCL A;  3IVF A;  4GDL A;  3CST A;  2BS2 B;  3PV1 A;  5IP4 D;  2V1Y A;  3UGB B;  3PHW B;  3DBH B;  1R4N B;  3P4S B;  1OGW A;  4BFR A;  1SE3 A;  2KTF A;  4KIK A;  3M3J A;  3VUX A;  4RGO S;  4D2K A;  1JQ4 A;  1LFD A;  3V60 A;  3OLM D;  1QOG A;  1A5R A;  2B76 B;  1T0R C;  3X0W A;  1PQS A;  4ARC A;  1D5M C;  2CU1 A;  1JRO A;  5IO9 A;  2KDB A;  1E7P B;  4KKI A;  3PRE A;  4NAW B;  2R61 A;  4WWO A;  3Q69 A;  4E3C A;  3N30 A;  2X8X X;  2NPT B;  5EE1 A;  2DAF A;  1STE A;  4CYE A;  2LEK A;  4XC2 A;  4XDD A;  1SE2 A;  1YNT E;  1E8Z A;  4HJK A;  1KRH A;  4YSX B;  3HVD A;  3HIZ A;  1VZ8 A;  2M4N A;  4PYZ A;  2IYD B;  4KSL C;  2GI9 A;  4WAF A;  2XK5 A;  4ZRK A;  3QAQ A;  1T5X D;  2MP2 B;  2Z0E B;  1YJI A;  2W3R A;  3QIJ A;  1PGA A;  5LNK 1;  4EZK A;  3DBS A;  2BYT A;  1B1Z A;  1RFK A;  3NVW A;  3MFG A;  3OG5 A;  4TQ1 A;  5BMI A;  3U30 A;  1JML A;  2GBR A;  4BOZ B;  3NZU A;  1XLO A;  3AE8 B;  3PRP B;  2JRH A;  1IYF A;  1SE4 A;  2N9X A;  1I35 A;  3DVN U;  4MGI E;  1TYG B;  3DBR B;  1DOX A;  1V5T A;  1ZGU B;  2MBQ A;  3AEB B;  3APF A;  2V4I B;  1OQY A;  2C9W B;  2LXC A;  2LMC A;  3DBH I;  1R4N I;  1XO3 A;  2RGF A;  4LK0 M;  1OQR A;  3MTN B;  2LRW A;  4F8C B;  3H7S A;  1GB4 A;  4Q2J A;  4DHJ D;  4RFB A;  3HRD D;  3M63 B;  2CHX A;  3CWI A;  3RI7 C;  4WJP A;  3AEA B;  1V8C A;  4EUT A;  1FXI A;  4W9E A;  3EEC A;  3AEG B;  3AMZ A;  3MC0 B;  3DWM A;  2NS5 A;  1WM3 A;  4WWM A;  1J7B A;  1F1H A;  2GMI C;  3N32 A;  2CHZ A;  4J6I A;  4WAA A;  4F7Z A;  5G5H A;  2J0J A;  2WP9 B;  3MJW A;  1WJU A;  4GSW A;  1NBF C;  1QOB A;  2N1V A;  2QCZ A;  2OJR A;  4HDQ A;  4A9A A;  1NEN B;  3IBE A;  4W9L A;  4TMA B;  2MJE A;  1E8Y A;  3SU8 X;  5E6O A;  3WAN A;  3PT2 B;  2IY1 B;  1I7H A;  1ZE3 D;  4B6W A;  2CKH B;  1IPG A;  3CSF A;  3PPA A;  2IZV B;  2DAJ A;  4MM3 B;  4DWF A;  2AQ1 B;  1EWC A;  2L32 A;  4A8X C;  1I42 A;  1BML C;  1CMX B;  3T8M A;  3A4S C;  2Q5W D;  4AS1 A;  4P6V F;  2JY6 A;  1J19 A;  2V3S A;  3DBR I;  4FXC A;  2UU7 A;  1K52 A;  2JU6 X;  4F1S A;  2PJH A;  3TEX A;  2JUO A;  4EFO A;  2ZCC A;  5J18 A;  4GIV A;  3AED B;  3VRB B;  1BT0 A;  3ZRC A;  1XEE A;  1WSP A;  3O13 A;  4BAX A;  3RN9 C;  2WXH A;  3VFK A;  3EFU A;  3Q8F A;  3EFC A;  3I9V 1;  3L0W B;  4JX1 C;  1CJE A;  2PW9 A;  3PO0 A;  1UGJ A;  1LGR A;  1I4X A;  1WM2 A;  3DQV A;  4PT5 A;  4A3O A;  1TZ1 A;  4RM9 A;  3UQB A;  1C4A A;  2W54 A;  5DPT A;  4XE0 A;  4ANX A;  4FJZ A;  3A9K A;  3VUW A;  4JIO U;  1UH6 A;  1ESF A;  1OEY A;  4FHJ A;  2RD0 A;  3ML9 A;  2WU2 B;  2REX A;  4TQ0 A;  2EMT A;  2I1K A;  3AE3 B;  3PRM B;  4C80 A;  3ALB A;  5D6J B;  2KDE B;  1EU4 A;  1K50 A;  3DWG C;  3BYY B;  2MW5 A;  3KWL A;  2KOX A;  1I4Q A;  2KWU B;  4W9G A;  2WHI A;  3RT3 B;  2VRR B;  1V97 A;  5FR6 A;  2XEW A;  4WUR A;  3R2T A;  2KMC A;  3GS2 A;  3NS8 A;  4BKS A;  4C00 A;  1GOZ A;  4I6P A;  4REZ A;  2WDV B;  2LXA A;  1YN5 A;  2D3C A;  1YIW A;  1RFA A;  4ICV A;  2K3U A;  4GLS C;  1QOA A;  1YJ1 A;  3EGR A;  1RRB A;  1WGK A;  3QC8 B;  2LGD A;  4KZC A;  1TT5 B;  4KDI C;  3IAS 1;  1FCC C;  3RNC C;  1L7Y A;  2V3N A;  5AZG A;  5IN7 A;  1FNU A;  2TSS A;  2WGS A;  1JW9 D;  2YEP F;  3RUL A;  1UBI A;  2DWQ A;  4RNA A;  3MJ5 A;  1WMH B;  3PS6 A;  2VZK B;  4NAW A;  2BS3 B;  1E0Z A;  3RZW C;  2ZPY A;  3ZDM C;  1F9J A;  1ET6 A;  1T3Q A;  2IGH A;  1P7E A;  1L6V A;  2AL6 A;  3IFW B;  4IM0 A;  2WYQ A;  1ROE A;  4G50 A;  2K8C A;  1PGB A;  4O1N A;  1DGJ A;  1ZKH A;  2KZR A;  3VTU A;  4FAD A;  1MFW A;  1Y56 A;  2WDQ B;  1MVK A;  4HCP B;  5BO4 B;  2QJL A;  4HKQ A;  1OQQ A;  2JYT A;  1WGD A;  2MJD A;  1D5Z C;  1MHX A;  1AYF A;  5FK9 C;  3PZ8 A;  1E5W A;  1TIF A;  2D2Q A;  1UNS A;  1KM7 A;  5L95 C;  2XBB C;  1G6J A;  1NI3 A;  2NTS A;  5AUI A;  3TSS A;  4HVB A;  3TBL D;  1V2Y A;  2M8S A;  3U2S C;  1B9R A;  2CS4 A;  2KK8 A;  4HPL B;  4M8N A;  2BKR B;  4IWQ A;  4US8 A;  1HTO A;  3DVG Y;  2JT4 B;  2NBW B;  2K0P A;  2KQ4 X;  2WXL A;  2N9K A;  2MBH A;  5H8Y E;  3QQ8 B;  4HDO A;  3OJ4 B;  5JHB A;  2ZVN A;  3ABV B;  1L2N A;  2KKC A;  1N63 A;  2FCS A;  3AE6 B;  5EE0 A;  2ZCB A;  4PS7 A;  3BYT B;  4KGR A;  4M0W B;  2DYB A;  1KLU D;  1WXM A;  1F2R I;  3C0R B;  3GOE A;  1UZX B;  4TV3 A;  4XX5 A;  2LRU A;  1H4R A;  2K8B A;  1Q5W B;  1QOF A;  1EU3 A;  3NG0 A;  4DQO C;  1VJK A;  1XCT L;  3VXW A;  3W1Y A;  3O65 B;  1YX5 B;  2MBB B;  4GDK B;  4US9 A;  2ZVO A;  4MSM B;  1WGY A;  3IT4 B;  4GXB A;  4ZYN A;  1SB3 C;  1WY8 A;  2Y5P A;  2IGG A;  5LXI B;  3DVG X;  4URK A;  2UWQ A;  4TKN A;  3RNE C;  2WXJ A;  3TIX A;  3WAL A;  4LNK A;  2QHO A;  4MM3 A;  1DYQ A;  3ZYY X;  4L23 A;  1T0S C;  2LFI A;  3SR6 A;  4AUQ C;  1HE8 A;  5HKH A;  1KF6 B;  1WXQ A;  2E3T A;  1N5X A;  1HTQ A;  1F0Z A;  5AZF A;  3TCA A;  1FFV A;  3H8H A;  1FIQ A;  1E7U A;  2J4X A;  3U7Z A;  2Y5B B;  2XN9 C;  1VLB A;  2LGI A;  5AEK B;  3W2D A;  2O6V A;  1E8W A;  4HKZ E;  4WH4 A;  4N6E B;  2FIF A;  4YSY B;  4DXG A;  1WXV A;  2PE9 A;  3DOW A;  3VUY A;  3EA6 A;  1WRI A;  4W9J A;  2IY0 B;  3RZF A;  1WI0 A;  3BY4 B;  2AQ3 B;  5D3D A;  2MWS B;  1FM0 D;  1V6E A;  4CHK A;  2DZI A;  1K51 A;  3Q3F A;  3ZGZ A;  2WQY B;  1NVI D;  5I4D A;  4N58 A;  2G4S A;  2M0X A;  1J7C A;  5G55 A;  1SBB B;  2K6Q A;  3BVZ A;  2CJN A;  2CHW A;  3JSV B;  4M8M A;  2BS4 B;  3JW0 X;  4KSK C;  4DBG A;  3BWU D;  1LM8 B;  2MJ3 A;  4RF1 A;  1MG4 A;  1WX8 A;  1TKY A;  3AB5 A;  4YSZ B;  2PEA A;  1KLV A;  3DCG A;  3KVF B;  3QA8 A;  5G2N A;  3ZJU A;  4X57 B;  3R2I A;  4N59 A;  4AQ7 A;  3APD A;  3BIN A;  3RMK C;  1Q10 A;  1Y8R C;  2MHJ A;  4FHK A;  4ZHO A;  1U4A A;  3RNG C;  3AE1 B;  3KH0 A;  4KKJ A;  2KD0 A;  4NQK E;  3FIL A;  2KAJ A;  1VDV A;  3N1X C;  1ACC A;  1AN8 A;  5KHO A;  3L10 B;  4C4V B;  3OAW A;  2EKI A;  2LZ6 A;  2BVC A;  1P98 A;  2KAC A;  1P3Q U;  4DHJ B;  3RCZ A;  1FXA A;  3P63 A;  2MA9 B;  2ASQ A;  5DPR A;  1IBX B;  3A9J B;  4BBN F;  3ZW3 A;  1V5O A;  3R66 C;  3ZKJ C;  2OJW A;  2I2Y A;  1P9D U;  2V3P A;  2UYZ B;  2W55 A;  2W3S A;  3J9C A;  2EKE C;  4BKS D;  2PKO A;  3AE7 B;  4JWS C;  4NPN A;  5E6P A;  4E71 A;  2KC2 A;  3PZ7 A;  1WWT A;  4IG7 B;  2BW2 A;  1X1M A;  3RUI B;  2V4L A;  4ANU A;  2OOB B;  2Z0D B;  3GE3 C;  3P2B A;  3PZD A;  2BQQ A;  1XLP A;  3NVY A;  4DXA B;  3M95 A;  4RGT A;  3SFD B;  4ZDV A;  3V3X A;  4WJN A;  1FNV A;  2PVO D;  1FMA D;  2O2V A;  3AUL A;  2ACZ B;  1BXT A;  2N7E A;  3H7P B;  2EMS A;  4ITK A;  4JLC A;  1KFY B;  2WXO A;  5J17 A;  3BK1 A;  3W5U B;  1FO4 A;  3U4E G;  2AEH A;  5IKC M;  5HG2 A;  1L5P A;  1YOV B;  1I4R A;  4M02 A;  4LNI A;  3HM6 X;  1L6U A;  1LQB A;  2DZJ A;  3K9P B;  2DHZ A;  2L3Z A;  3AEF B;  1N62 A;  4J3O D;  2KFK B;  4ZHP A;  2BTE A;  3ZVV A;  3VR9 B;  3Q14 C;  1FPY A;  3Q3N C;  1V9J A;  4HXD A;  4ICU A;  4RMA A;  2D11 A;  1RAX A;  1I4P A;  4IWP A;  2L05 A;  1ZDV A;  1ENF A;  3BZD B;  5CHV C;  3BVM A;  2AL3 A;  4ZRI A;  4HLE A;  5KHQ A;  2KO3 A;  3V61 A;  1JWB D;  2DEN B;  4USA A;  2BWE S;  5LLI A;  1YQ4 B;  1ZP0 B;  4GDK A;  2VH2 A;  1V86 A;  4HRO A;  1ZUD 2;  2N4F A;  3A1Q A;  1GNU A;  2KJ6 A;  4MGY E;  2IND C;  4PS8 A;  4WWP A;  3PSE B;  5IAA C;  1C4C A;  2L0T A;  4LCD E;  3T3N A;  2W82 A;  4AOF A;  2BYE A;  3ML8 A;  4YT0 B;  1YX6 B;  2AQ2 B;  4NAM A;  2JWZ A;  3HUI A;  2FUH B;  2BBC A;  2I1J A;  2YEP B;  4R3D A;  4A90 A;  3Q8A A;  2KYW A;  2KX3 A;  1EO6 A;  4C56 C;  1I4G A;  3Q8C A;  3ZXR A;  1QZE A;  1N5W A;  2LI5 A;  4RH6 A;  2FE8 A;  4FJY A;  3CF6 E;  2BWF A;  4WJQ A;  4G11 A;  2KDM A;  4BKG A;  2XNA C;  3SD5 A;  1E8X A;  2WNM A;  4PYU A;  1BUI C;  1TZO A;  1ZOY B;  4IW0 A;  1V1P B;  3L16 A;  1WE6 A;  5FR3 A;  2ZNV C;  2PPH A;  2LHD A;  3SFE B;  1QIL A;  1D4B A;  1IUE A;  2N9L A;  3U7D A;  4BOS C;  4AP4 C;  1TS5 A;  2KNB A;  3JSV A;  1C76 A;  2K5P A;  4B95 A;  2KJH B;  2KQ7 A;  1JRU A;  4GDL B;  3KW5 B;  2WDT B;  5JH5 C;  3AEE B;  4ANW A;  4KIK B;  2O6V D;  2PE6 B;  3NZ3 A;  3DHG C;  1N61 A;  1VR9 A;  1OFF A;  5HHD G;  1R4M B;  3ZNG C;  2LUM A;  1UBQ A;  3NVZ A;  2L83 A;  1YN3 A;  1DOY A;  2YVC A;  3Q3M C;  3TMP B;  2L76 A;  4NNJ B;  2RDH A;  3X23 A;  1Q1O A;  1WH3 A;  3FC4 A;  5GMV A;  1GUA B;  5BYQ A;  2Z59 B;  4NJC A;  3QAR A;  1MG8 A;  1TKE A;  4HWI B;  2WXR A;  3NS1 A;  2IPK D;  4C4V A;  1JRP A;  3UIO B;  5T8I A;  1HA5 A;  1TS3 A;  1TTN A;  2NPT A;  4TUU A;  1FEH A;  2GLS A;  3V62 A;  3AU4 A;  1WJ6 A;  2J0M A;  4A6Q A;  2DYM A;  4II3 B;  3SDL C;  2MQJ A;  4FA6 A;  1WZ3 A;  2WXP A;  2XK5 B;  3PLU A;  4C7Y A;  5JZE B;  2D07 B;  2GOW A;  2MRP A;  3QCA A;  1IBX A;  1PYW D;  1XF5 L;  4KVG B;  3FAH A;  5IOI A;  3BVG A;  2MP2 A;  3H6N A;  2QIL A;  2ZZP B;  2WXQ A;  4GN1 A;  3W1S A;  3WAO A;  3TEZ A;  2PTL A;  4L2Y A;  5GXG B;  3P4R B;  3WCQ A;  3KYD D;  2K39 A;  4P1B C;  4LNO A;  2MCN B;  4YTM B;  4BBN C;  5D3I B;  4LDT B;  2DYO A;  3LXF A;  5FKA C;  1GJZ A;  1PFD A;  2BPS A;  3IG3 A;  1R4M I;  2KC1 A;  3L4P A;  1MJD A;  2Y5C A;  4YTP B;  2NBV B;  1UEL A;  3BII D;  2D5G A;  4A55 A;  1ISN A;  1UD7 A;  3ZLZ A; 
#chains in the Genus database with same CATH homology
 1FXT B;  2NR2 A;  1P1A A;  1WX8 A;  3B08 A;  4WJP A;  4DHZ E;  1WRD B;  2R2Q A;  2KN5 A;  2ZEQ A;  2PEA A;  1XT9 B;  4EUT A;  1KLV A;  3DCG A;  3KVF B;  2ZPN A;  3QA8 A;  4W9E A;  5G2N A;  2MLB A;  4KDL B;  3EEC A;  3ZNI D;  1WXA A;  2GBN A;  4X57 B;  2NS5 A;  1TBE A;  4II2 B;  1WM3 A;  3APD A;  3BIN A;  3D32 A;  2N9E B;  3VVW B;  2GMI C;  3N32 A;  2CHZ A;  1WJ4 A;  2IO1 B;  4J6I A;  1Y8R C;  4WAA A;  4FBJ B;  5CHF A;  4F7Z A;  5JHA A;  2J0J A;  1IP9 A;  4FHK A;  4IWO A;  3MJW A;  1GG3 A;  1WXS A;  3DBL I;  1WJU A;  4GSW A;  3VHT C;  1U4A A;  1WFY A;  1Q0W B;  3KH0 A;  1NBF C;  2KD0 A;  2N1V A;  4NQK E;  4BVU C;  2C7M B;  3UIP B;  4EZL A;  3QX1 A;  5TR5 A;  3SHQ A;  2OJR A;  1V81 A;  5AZH A;  4RM8 A;  4HDQ A;  4MGZ E;  3IBE A;  4W9L A;  1E8Y A;  3SU8 X;  3OJ3 A;  2C60 A;  1WZ0 A;  5EDS A;  1D3Z A;  5E6O A;  5KHO A;  2BYV E;  3L10 B;  3WAN A;  2K1F A;  2MBO A;  3Q3J A;  2R2O A;  3PT2 B;  5DPS A;  3ZDT A;  3V6C B;  2IY1 B;  3OAW A;  4MEL A;  1T0Y A;  2NCN A;  2KDI A;  1Z2M A;  4KV2 A;  2LZ6 A;  4MDK E;  4B6W A;  5L83 A;  1V49 A;  2CKH B;  3N3K B;  1IPG A;  1WR6 E;  3CSF A;  3PPA A;  1P98 A;  2IZV B;  2DAJ A;  1P3Q U;  4W9H A;  4DHJ B;  2DZM A;  4IUM B;  1XQQ A;  4DWF A;  4E74 A;  3ZTC A;  1I42 A;  3TL5 A;  3MHS D;  3RCZ A;  1CMX B;  2MA9 B;  2LGX A;  4WWN A;  3T8M A;  3A4S C;  2MBE A;  1WE7 A;  2JY6 A;  2W9N A;  1J19 A;  2ASQ A;  2KX0 A;  3PRZ A;  5DPR A;  2V3S A;  3DBR I;  2K25 A;  3A9J B;  4BBN F;  1AAR A;  2BKF A;  2KJR A;  2KLG A;  3ZW3 A;  1V5O A;  3R66 C;  3ZKJ C;  2PJH A;  4F1S A;  4YL8 A;  2IBI B;  3A9J A;  2JUO A;  3ONS A;  4MSQ B;  1P9D U;  4W9F A;  2UYZ B;  4K81 A;  3RD2 A;  3VH3 B;  4EFO A;  2EKE C;  4BKS D;  2D3G A;  2ZCC A;  4GB9 A;  4LJP B;  4GIV A;  4A3P A;  5J18 A;  1BT0 A;  1TGZ B;  3ZRC A;  3EC8 A;  3JVZ X;  1EF1 A;  4NPN A;  1VD2 A;  5E6P A;  2KTR A;  2KC2 A;  4E71 A;  2FAZ A;  2IO3 B;  5J2R A;  3R3M A;  2FCN A;  2D10 A;  4IG7 B;  3VFK A;  3EFU A;  3NOB A;  4KZ0 A;  1X1M A;  3AI5 A;  1GC7 A;  3IHP C;  4NJ6 A;  2KWV B;  2J7Q B;  3L0W B;  3RUI B;  3RYT A;  2V4L A;  4FUL A;  4ANU A;  2OOB B;  2Z0D B;  5C1Z A;  1WX7 A;  4XZ4 A;  2LD9 A;  2G4D B;  3P2B A;  3PZD A;  4I6L B;  3M95 A;  4DXA B;  1WM2 A;  1YD8 U;  3DQV A;  2B3A A;  2O2V B;  2RSU A;  4ZDV A;  4A3O A;  1TZ1 A;  2WWZ A;  4WJN A;  1NI2 A;  4RM9 A;  1WGG A;  2CR5 A;  2DZK A;  5DPT A;  3UQB A;  3ENE A;  2O2V A;  2KMA A;  3AUL A;  4ANX A;  4FJZ A;  3A9K A;  3VUW A;  4JIO U;  2DX5 B;  2G45 B;  1UH6 A;  2ZNV B;  2LVP A;  3PTF C;  2N7E A;  4NY0 A;  3H7P B;  1OEY A;  3WAP A;  4FHJ A;  2RD0 A;  2C7H A;  2RR9 A;  2EMS A;  3ML9 A;  4JGH B;  2REX A;  4TQ0 A;  4JLC A;  1E7V A;  1XD3 B;  5J17 A;  2EMT A;  1V80 A;  3H7P A;  2JVC A;  2KHW B;  3HK0 A;  2BGF A;  2KLC A;  4AJY B;  2I1K A;  2LGY A;  3PRM B;  1OTR B;  3ALB A;  4IM3 A;  5D6J B;  1Z5S B;  2AEH A;  2KDE B;  2L7R A;  4K7S A;  4FJV B;  2KFJ A;  3GZN I;  1WYW B;  2KWC A;  2JZZ A;  2MW5 A;  2KOX A;  2KWU B;  2WX0 A;  4W9G A;  5D7G A;  4K7U A;  3RT3 B;  2VRR B;  4A20 A;  3B0A A;  2HD5 B;  3HM6 X;  5FR6 A;  2XEW A;  4ZRJ A;  1LQB A;  2DZJ A;  3K9P B;  2DHZ A;  2KMC A;  2L3Z A;  3AU5 A;  3APC A;  4DDG D;  1WGR A;  2AYO B;  3KUZ A;  3NS8 A;  2KFK B;  4BKS A;  4I6P A;  2KQS A;  2LXA A;  3ZVV A;  5CX3 A;  5D2M B;  3M62 B;  1WX9 A;  2M1M A;  2KFK A;  5DCN A;  1YIW A;  5LXH A;  3VAW A;  3VTV A;  3U8Z A;  1V9J A;  3ZNZ B;  4HXD A;  2LJ5 A;  1RFA A;  3PHX B;  2HTH A;  4ICU A;  4ICV A;  2RPQ A;  2FCM A;  4RMA A;  2JRI B;  2ZJD A;  2D11 A;  1YJ1 A;  1RAX A;  1RRB A;  3L08 A;  4IWP A;  2L05 A;  3NZS A;  3VQI A;  1ZW7 A;  3QC8 B;  1WJN A;  4GGQ A;  2LGD A;  2YLM A;  4EZJ A;  4KZC A;  5CHV C;  3PGE A;  4ZRI A;  2AL3 A;  4HLE A;  5KHQ A;  2KO3 A;  3V61 A;  1C3T A;  3ZRF A;  4KDI C;  2DEN B;  2L0F A;  4CO7 A;  3UQA A;  3ZNH B;  1L7Y A;  2BWE S;  4LDT D;  4P7I A;  5AZG A;  4ASW C;  4W9K A;  3TJP A;  5LLI A;  3PVL A;  2FCQ A;  4WJO A;  2MX2 A;  3A1Q B;  2BYF A;  3RUL A;  4GDK A;  2KDF B;  3PLV A;  1V86 A;  3NHE B;  1UBI A;  2WX1 A;  2KXJ A;  1WMH B;  3PS6 A;  3VDZ A;  2L8J A;  2N4F A;  4HCN B;  4NAW A;  3A1Q A;  3KUC B;  3RZW C;  1GNU A;  2ZPY A;  3ZDM C;  2K6D B;  1WMH A;  2KJ6 A;  4MGY E;  1F9J A;  4B9K A;  1P0R A;  4PS8 A;  1S3S G;  2JXX A;  3B1L X;  3PSE B;  2KTR B;  4WWP A;  5IAA C;  4MEM A;  4NJ7 A;  3WA0 A;  4JQW C;  2C5L C;  2L0T A;  2C7N B;  4BKT A;  4LCD E;  1NDD A;  2AL6 A;  3IFW B;  4IM0 A;  2WYQ A;  4AOF A;  4G0N B;  4G50 A;  2BF8 B;  3AXC A;  2K8C A;  5C23 A;  2BYE A;  1ZKH A;  2KZR A;  2M17 A;  3ML8 A;  1YX6 B;  3DPD A;  3LDZ E;  3VTU A;  4FAD A;  2JWZ A;  2A5U A;  2FUH B;  3WAM A;  2I1J A;  4HCP B;  5BO4 B;  2K8H A;  1RLF A;  5DPW A;  1WGD A;  2NVU I;  4IC7 B;  3W1S C;  2G3Q B;  2KX3 A;  3A33 B;  4EKU A;  1EO6 A;  4DDI D;  3QK0 A;  2GBJ A;  3DVN V;  3ECI A;  3ZTD A;  3L13 A;  1UGM A;  2KAN A;  2J0K A;  3ZIM A;  1QZE A;  3A9K B;  3A4R A;  1E5W A;  1YQB A;  1VCB A;  2LI5 A;  2A4Z A;  3CMM B;  5CHW A;  2D2Q A;  3HM3 A;  2IO2 B;  1SE9 A;  1KM7 A;  4EEW A;  2FID A;  4FJY A;  4K1R B;  3CF6 E;  2BWF A;  4ANV A;  5L95 C;  2XBB C;  1G6J A;  2NBU A;  4WJQ A;  4G11 A;  3S2A A;  3I3T B;  4HVB A;  2HE7 A;  1OEY J;  4OVU A;  4BKG A;  3HHM A;  3TBL D;  2GBK A;  3SD5 A;  2LVO A;  1GC6 A;  4WQO B;  1E8X A;  3DDC B;  2N1W A;  1V2Y A;  2M8S A;  1J8C A;  4PYU A;  2LWP A;  2CS4 A;  1EUV B;  3VTW A;  2KK8 A;  4I6N B;  4IW0 A;  4DHZ B;  3L54 A;  4W9I A;  3KYC D;  4HPL B;  3L16 A;  1WE6 A;  4AWJ A;  3JYU A;  4M8N A;  2BKR B;  4G3X B;  4IWQ A;  4MJS A;  4PS3 A;  5E6N A;  2ZNV C;  2PPH A;  2LUE A;  4NQL B;  3DVG Y;  4EOY A;  2MSE D;  2JT4 B;  3H1U A;  3L17 A;  4GU2 A;  3U7D A;  5IA7 A;  1KJT A;  2NBW B;  4BOS C;  4AP4 C;  3UIN B;  1J0G A;  2KNB A;  1C1Y B;  3JSV A;  3T9L A;  1WR1 A;  4B95 A;  2MBH A;  2KJH B;  3QQ8 B;  2JPH A;  2KQ7 A;  4HDO A;  1JRU A;  4GDL B;  2L00 B;  3OJ4 B;  5JHB A;  2ZVN A;  2JZ3 B;  3VH4 B;  3LJ3 A;  3KW5 B;  1SIF A;  2WDT B;  1KOT A;  5JH5 C;  1L2N A;  2KKC A;  4JL9 A;  2HJ8 A;  2FCS A;  1WIA A;  2FNJ B;  2IO0 B;  2LAS A;  2ZCB A;  3CST A;  3IVF A;  3PV1 A;  4GDL A;  4PS7 A;  4ANW A;  4DK5 A;  2V1Y A;  4M0W B;  3UGB B;  2DYB A;  4KIK B;  2O6V D;  3PHW B;  2PE6 B;  1OGW A;  4BFR A;  1WXM A;  2KTF A;  3C0R B;  4KIK A;  3ZNG C;  1UBQ A;  3WIM A;  3M3J A;  3VUX A;  3GOE A;  3H9D A;  1UZX B;  4GMV A;  4TV3 A;  4XX5 A;  2LRU A;  1H4R A;  4MGK E;  1S1Q B;  1LFD A;  2K8B A;  1Q5W B;  3V60 A;  2YVC A;  3OLM D;  3TMP B;  2L76 A;  5D94 A;  4NNJ B;  1A5R A;  4HPM B;  3VXW A;  3W1Y A;  1Q1O A;  3V6E B;  3X23 A;  1WH3 A;  3EHV A;  4FLH A;  3X0W A;  4OVV A;  3O65 B;  1YX5 B;  2MBB B;  1PQS A;  4GDK B;  5GMV A;  2ZVO A;  1GUA B;  2CU1 A;  4K7W A;  4MSM B;  4W9D A;  1WGY A;  4GXB A;  2KDB A;  2Z59 B;  3PRE A;  4NAW B;  4WWO A;  4ZYN A;  1WY8 A;  3QAR A;  4LJO B;  1MG8 A;  4E3C A;  3N30 A;  4HWI B;  2NPT B;  2DAF A;  3DVG X;  4FN2 A;  3ZUN A;  5LXI B;  4CYE A;  4IM2 A;  1WF9 A;  4W9C A;  2N9P C;  3QHT A;  4XC2 A;  3UIO B;  1TTN A;  4URK A;  2NPT A;  4TUU A;  1E8Z A;  4HJK A;  3V62 A;  3ZO5 B;  3AU4 A;  2UWQ A;  1WJ6 A;  1LXD A;  2J0M A;  2DYM A;  2JF5 A;  4II3 B;  4TKN A;  3SDL C;  2MQJ A;  3UF8 A;  4FA6 A;  1WZ3 A;  3HIZ A;  2M4N A;  4PYZ A;  3TIX A;  2XK5 B;  3WAL A;  4MM3 A;  2QHO A;  3PLU A;  2IYD B;  4KSL C;  5JZE B;  3QWZ B;  2D07 B;  1M94 A;  2XK5 A;  4ZRK A;  2GOW A;  2MP2 B;  2MRP A;  3QCA A;  3QAQ A;  4AJW A;  2Z0E B;  4AUQ C;  1HE8 A;  5HKH A;  3QIJ A;  4KVG B;  4EZK A;  5AZF A;  3DBS A;  3TCA A;  2O6V B;  2MP2 A;  3R7R A;  1E7U A;  2Y5B B;  2LVQ A;  3H6N A;  5AEK B;  2ZZP B;  4GN1 A;  4TQ1 A;  2O6V A;  2KVR A;  3K9O B;  4MH0 E;  3U30 A;  1E8W A;  3W1S A;  4N9F 4;  2GBR A;  4BOZ B;  3WAO A;  3NZU A;  2FIF A;  3PRP B;  3KYD D;  2K39 A;  1WXV A;  2JRH A;  2PE9 A;  3DOW A;  3R7Q A;  2MCN B;  4GOC A;  3VUY A;  2N9X A;  1IYF A;  4W9J A;  2IY0 B;  3RZF A;  1WI0 A;  1I35 A;  3BY4 B;  3NY5 A;  3DVN U;  4MGI E;  4BBN C;  2MWS B;  1V6E A;  2GBM A;  5CTR C;  4CHK A;  2DZI A;  4LDT B;  2DYO A;  2N7D A;  1V5T A;  1ZGU B;  2MBQ A;  3Q3F A;  3APF A;  1OQY A;  2C9W B;  2LXC A;  3KUD B;  4MJS B;  1H8C A;  3DBH I;  1R4N I;  2G4S A;  2M0X A;  1GJZ A;  2RGF A;  3MTN B;  2BPS A;  5G55 A;  1WGH A;  1R4M I;  2LRW A;  3IG3 A;  2KC1 A;  2K6Q A;  4F8C B;  3H7S A;  2CHW A;  3JSV B;  4M8M A;  4DHJ D;  1EF5 A;  1K8R B;  3JW0 X;  2NBV B;  3M63 B;  4HK2 A;  4KSK C;  4DBG A;  1LM8 B;  1E90 A;  1UEL A;  1SGH A;  2AWT A;  2CHX A;  1ISN A;  3QJZ A;  1UD7 A;  3ZLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...